3W73A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-129
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-129
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w73A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w73A01
5K2ZA 2CW6A 3UYCA 4MIMA 4S2BA 3SW6A 3YPIA 4JDBA 4EF8A 2QDHA 4XBKA 3LHYA 2VKZG 4GUFA 1PVNA 1L9WA 4XWUA 1WYIA 5LNVA 4NNCA 3W75A 2NX3A 1LCOA 2QR6A 3W1UA 4WXYA 3W1AA 3LHTA 3TU9A 4Z1CA 3M7WA 3W7RA 4JYEA 3TK7A 2FDSA 2Y88A 1QAPA 3RMJA 1I2PA 3DHDA 1QPOA 2V8ZA 3GKFA 3INPA 3NR0A 3GX9A 5EA9A 3LHWA 3PWAA 1WV2A 1X6UA 2J24A 5K9DA 4D2JA 2PC4A 4OE7A 3A5FA 4PODA 1A5AA 4N6FA 5G4WA 4UR8A 1AW5A 1SU5A 3TJLA 3P74A 4TR9A 3NQMA 1ZCOA 1KTBA 3KVMA 3HB9A 1K8YA 1P0KA 1K03A 3LBMA 2VFFA 3NAVA 1GVSA 5CZTA 1UCWA 2C0AA 3M0ZA 3STFA 3JRKA 5BOOA 1GOXA 1YDVA 5IBXC 4GNJA 1VYRA 1H7XA 1Q3NA 3PG9A 4Z08A 4ZMGA 3MHFA 4RX0A 1SSDA 4EOUA 3B0PA 3GVGA 3M5VA 5AYXA 4DF2A 3PUDA 3DKLA 4NXKA 4HN4A 1W5MA 3L68A 5G1TA 5EY5A 2E68A 2ZBTA 1YDNA 3JS3A 1H5YA 2Y7DA 4RZ4A 3PBUA 4O12A 3QM3A 4C1KA 5D33A 4LS1A 3BG5A 1OJXA 3L5MA 5D04C 1KTCA 4K7VA 4EVZA 3G8RA 1YADA 4MZ1A 2CWNA 4JX5A 4Q32A 4O52A 2QCDA 2Z6IA 4L4LA 3HPSA 2JKPA 2AQWA 3RK8A 2AGKA 3VFLA 4JXCA 1IXNA 2Z6JA 3G3DA 1X7FA 4UNKA 4NX5A 4POCA 1BWKA 1FCUA 4LVAA 4I7VA 2WSQA 2J27A 4H6KA 5G2WA 3TE9A 3LCLA 1JVNA 4Y6GA 1VJIA 4GUGA 3THAA 4H3DA 1KBIA 2CLLA 4RK8A 2A21A 1TV5A 4MYAA 5CPOA 3TUUA 4PA8A 1EIXA 1LOQA 3S8HA 1JCXA 1TREA 3GNNA 4UFKA 4IX2A 2E77A 3GXNA 1Y0EA 3N34A 4FNSA 4JICA 4Y8FA 5DXXA 3CIWA 3P62A 1PHWA 3HMJG 4N4PA 2DJLA 3CU2A 1EWDA 2NZLA 2RDTA 3DENA 1THFD 5CPMA 3NQ6A 2YX0A 4RCXA 3W7LA 4RKAA 3QQ1A 4TX9A 1VC4A 1ZNNA 3LRMA 4N2YA 3W22A 4ZQRA 2QJHA 1JQXA 2ZA1A 2JKAA 2W0UA 1LRNA 3GDTA 2C6QA 4GFSA 4GUHA 1TJPA 4LS2A 4HHPA 3EKLA 3V75A 3VNDA 1ADOA 3PF3A 2QAPA 3E02A 3MUXA 5CG7A 3LRKA 5HJLA 3N3MA 4JTFA 2E6FA 2ZRYA 4JTLA 3L65A 3LCIA 3GDLA 4OQVA 2X1SA 1MZHA 2P1FA 1C9DA 1TPDA 2CLMA 1CI1A 2FLIA 2QAFA 1XXXA 2HMCA 5FEPA 1SO6A 1OFOA 2A1YA 2QUUA 3P81A 2DZXA 4ZVJA 1G6CA 1M7PA 1VR6A 5C6MA 3S6DA 2G5WA 4WUIA 3TX9A 3WK1A 3LXBA 1VH7A 1H51A 1TIMA 1YPFA 1WX0A 1OFAA 5MHBA 1DVJA 1WBJA 4UFJA 1J4EA 3BO9A 5FF7A 1F2JA 4MLJA 1W1ZA 1TPVA 1JJKA 1JQVA 5K9XA 4IMEA 1UUOA 2FB2A 3UY7A 1YXCA 3N2XA 1JRCA 5LHEA 5K3VA 4MZ8A 2A0NA 4UUIA 4WD0A 4RXFA 2NUXA 4LVBA 3KRUA 1GQNA 3BK0A 4N9EA 2OZ0A 1TB3A 5F2GA 3DH7A 3NA8A 3P84A 3W23A 5AHNA 4N02A 3L5LA 4DQWA 1FWNA 4NJHA 1DQWA 1L6SA 1RVGA 2HSAA 2ZTKA 3NDOA 4AEOA 4DBEA 2E09A 1QOQA 2V2CA 4CNNA 3EXTA 1OF6A 1QPRA 4FX6M 2QCHA 3W2LA 3PBWA 2ISWA 3DFTA 1X8FA 2V81A 1H1ZA 1J5TA 1W5PA 3STGA 2B7PA 1WOAA 3NXFA 1VHCA 3KX6A 5DCEA 4O54A 5GVJA 4I9AA 4O1CA 2Z2UA 3LXCA 3L66A 3UNDA 2X1UA 2ZYFA 2V5LA 3WFAA 1SFJA 4HNVA 1XM3A 3UWZA 2QUVA 2NUWA 1WAUA 3EKZA 4O50A 4ADUA 2V0TA 3DI1A 5AHFA 3TC6A 3MW7A 3BW2A 3DBPA 4LTSA 2YW3A 4MOZA 2NLIA 1B57A 4PCFA 1R2RA 3MO7A 2BXVA 3U6WA 2ZQ0A 4MY8A 5CGQA 4I7UA 1OABA 3RNDA 4LC8A 1KA9F 3IVUA 1OFDA 4ZQMA 4JTTA 3TSBA 3LDVA 1ZAJA 5EL1A 4DF0A 1JCJA 1H7PA 3QJAA 1OYBA 3ZFHA 4LWWA 2A2IA 2CZFA 5I3JA 4QIUA 3S1WA 3IGXA 3NQEA 3D0CA 1WXJA 5FF2A 1U5JA 3TW6A 4P2VA 3IIVA 3HPXA 3B4UA 3W7NA 4AHOA 1L6YA 3R5EA 1D3GA 3TFXA 4UTIA 3KRSA 4BF9A 5G2HA 4YMZA 2XFWA 4QNWA 3PG8A 3CTLA 4JTJA 5FF3A 1I45A 3DFNA 4JTKA 5D09A 1TPFA 4IUOA 3PBVA 2GQAA 5J5RA 3N19B 3W7OA 4EWND 1TRIA 2PE4A 4IX0A 1Z48A 1ZAHA 5FF4A 4EIVA 2VFIA 2TSYA 3EWBX 3W7PA 3GXTA 3TJXA 1SZNA 3QMSA 3BLFA 1XC4A 1KM1A 3DXIA 4B5NA 1LROA 1ME8A 4JY9A 4ZL1A 2B4GA 4NZJA 4MKNA 1T0OA 2NV2A 1JULA 3G22A 3PVFA 4KFNA 4UCGA 4QSHA 3P80A 3H54A 1KFCA 3EWWA 1QCWA 1VYSX 1N8FA 1IXOA 3BG9A 4O1AA 3M43A 1HO1A 4LS0A 5DY3A 3B06A 4LVFA 2V5BA 3HG2A 1LBMA 1T8XA 4Z1AA 1K8ZA 3BG3A 5K7JA 1Z42A 1L6WA 4Y90A 5G1YA 3T44A 2HS6A 1JUEA 5F2MA 4IMFA 1H7RA 5KZEA 4LRSA 3BW3A 3EWUA 3W7HA 3WJZA 4S1FA 1GZGA 1TQXA 1R2SA 4DEFA 1BKSA 4HT3A 3S42A 5AHEA 3FKKA 5HWMA 1YXYA 5F4WA 1KLZA 2E5DA 2VEIA 4CNPA 4OV4A 1X1OA 4RZ6A 4HKPA 1S3HA 2J6XA 4JTIA 3NO5A 5CPLA 2GVJA 3DZ1A 3LHZA 1HUVA 4RLIA 1ML1A 1JUBA 3FA5A 3UPBA 3PS7A 3RLVA 4UR7A 2WNNA 3HBLA 3LHUA 4O16A 3GLCA 2Y63A 4E2DA 2X1TA 4O18A 1DJNA 1B9BA 3S5ZA 1OFEA 3ATYA 5ABTA 1HFBA 1RV8A 3E0IA 3UWYA 3PC0A 3JR2A 1E51A 4IPJA 1B4EA 3A5VA 1G4SA 1ZALA 1JR1A 1GYNA 1H7WA 3O6YX 3PULA 3CIXA 1TPEA 3IIXA 3W3OA 3UWWA 3KHJA 2Y6ZA 3L2IA 2C18A 3MI2A 1KFKA 2Y7GA 4FNRA 3C6CA 1ZENA 4AXKA 4A2SA 1YTDA 1W54A 5I3FA 1QOPA 2FPTA 2EF9A 4O0KA 5DBUA 3TCEA 2DZTA 1TTIA 4K8HA 1AG1O 1JCLA 3A9IA 3QYQA 3RLUA 1O4UA 3T7VA 3NPVA 5G4EA 4OGZA 3V1PA 1ZFJA 4O19A 5DCDA 2CZEA 1VGAA 5CZJA 3GAKA 3S5OA 3HF3A 1VLWA 1ICSA 4CQ9A 3NPUA 3TQ0A 3GB6A 2CLEA 4AF0B 3TAKA 4O1DA 3G24A 5D37A 3CQ0A 4HNTA 4K7YA 2H8XA 3P8JA 4A2RA 3HQ1A 2H3DA 3QRHA 3T78A 4UTMA 2ISVA 4HPXA 5D03A 3G3MA 2B7QA 5I3KA 3NQ2A 2FJKA 4XZ9A 4W9TA 5CZSA 4RZ5A 4JY8A 4MPQA 3BLIA 1FWRA 4NQ1A 3W7DA 2O7SA 3PSWA 1P5BA 4NZFA 1AL7A 3NOEA 3EX4A 2X30A 2CFFA 1FXQA 1K02A 4CNOA 3VKJA 1K7EA 3FYOA 3IGSA 5SWUA 1DHPA 3G1HA 5D2YA 3WJWA 1QR7A 2QCNA 2HTMA 3B0VC 3W73A 4JYFA 4FIRA 3GAYA 2DZUA 3MI6A 1W3NA 5EMUA 3N9RA 1DL3A 3LB0A 3F1QA 2VEPA 2TYSA 3UXAA 3W1RA 1GEQA 2X2GA 3W7QA 1SPQA 3UQNA 3CWOX 3G0UA 3NQFA 3GYEA 3T40A 3W7JA 4AVFA 3L9CA 1RQHA 2ZZ2A 1KFEA 4K38A 2OX1A 4JR5A 4FX7A 4DO5A 1OYCA 1MO0A 3MP5A 2GVGA 3TH6A 2ZRWA 4HPJA 1VCVA 4X22A 2FPYA 4ZQNA 1F73A 3QSRA 2A5HA 3W86A 3G8EA 1TYGA 3L0GA 1FCQA 4WX2A 1KFJA 1XBVA 4LY8A 2TRSA 2J88A 3N9SA 2V9DA 4MLRA 4AAJA 3L0KA 2NV1A 4UNLA 1ZHAA 2QJGA 1B4KA 3GDMA 2C1HA 3TAOA 1WBHA 2NX1A 3EX1A 1G7UA 2ZZ4A 4QJ1A 1GVOA 2RH9A 1I2NA 3L5AA 5KZDA 4NJIA 3HGJA 4FF7A 2FIQA 3SGUA 2ZZ6A 1QPQA 3W1XA 3EX6A 3M5ZA 1IGSA 1K3UA 5D2WA 1PHQA 3ABSA 4NXSA 2NXGA 4O4VA 1LP6A 1YTKA 2BTMA 3IIPA 5L6UA 3B8DA 1YLVA 3NL6A 3FEMA 4IGHA 4TU1A 5K4XA 2AAMA 1EEPA 5CSRA 1DKWA 4N6EA 1C8VA 4ZQCA 4UTHA 3CM4A 1MEHA 1GWJA 3G1SA 4ADTA 4BK9A 3B03A 3EWXA 1Z44A 2QDGA 2YYTA 4LNYA 7TIMA 4PFMA 3T55A 5A5WA 4KFPA 3SECA 1CW2A 1TO3A 3TNOA 5F4XA 3IEBA 3H55A 3PUEA 4Y9AA 1HL2A 1WOBA 2R94A 3NM3A 3TV8A 2G95A 3G1YA 4DPQA 4JNMA 4IWWA 5CKSA 2QEZA 1C29A 4OV9A 3RFAA 3SZ8A 2R14A 4QISA 1TPWA 2QCCA 4A21A 2ZTJA 1DBTA 4HNUA 2PRLA 2Q3OA 5D2XA 5AHMA 2GQ9A 1W31A 4N4QA 3MI3A 1H63A 1FY6A 1D9EA 2RKXA 4O4WA 3R8RA 3ZWSA 1FBAA 3SSJA 3W88A 5HWNA 2UV8G 1XUUA 3C4UA 1EWEA 4JTHA 1TQJA 3LGEA 3GK0A 5LNWA 3W87A 3NGJA 1XBYA 2OCZA 1LBLA 1TSIA 5U7SA 4UMBA 2ZRXA 2BSLA 4HSOA 4MY1A 5DLCA 2F84A 1G7VA 5U4NA 3CPRA 1VPXA 5TBOA 3PUOA 1SW3A 2GJLA 4QAIA 4JTEA 3ZS4A 4ZQOA 2CLKA 5BRBA 1W5QA 5D02A 3HO8A 4MYXA 4C1LA 4LVDA 3NNTA 4XTIA 2R8WA 1SQ7A 3C8FA 3IIZA 2Y7FA 4DPPA 1UASA 1KM6A 1H1YA 1GVRA 2Z1BA 1XFBA 3ZR4A 3NQGA 5L9FA 2E5BA 2G96A 3Q2DA 2YZRA 1GVFA 4E0CA 3LCGA 1DORA 1M5WA 2BX7A 1TTJA 4JIPA 5LNUA 3OBKA 4UFHA 5AYZA 3TXZA 2I14A 1LYXA 3IV3A 4XTDA 3W7KA 1EX5A 3LTYA 3NG3A 4GC4A 4YWIA 3FYPA 5FF0A 2CLHA 3R89A 3I7QA 1G4TA 4KWVA 3KVLA 3I68A 2GQ8A 3KVJA 3N2MA 4MVAA 4YCOA 2VFGA 2C16A 1Q6OA 3MYOA 3DKJA 4M5PA 3G1AA 1R2TA 2NXIA 3LTSA 2QCMA 4O57A 1JCNA 3UWQA 1TV8A 1MEWA 4UFMA 4J9JA 4FNPA 4UFLA 3FFSA 4IOTA 3HOJA 4MFDA 3KOFA 5BNKA 3TMQA 3WJSA 3ELFA 1LM1A 5FEWA 2WNZA 5F2IA 3M6YA 5C55A 1W56A 4UXDA 5FESA 1MXSA 4XUGA 2D73A 1ICQA 1RR2A 1Q45A 4M6PA 4K39A 3MHUA 3LI1A 1GYLA 4RR4A 3W7MA 1NEYA 3NEVA 3C2EA 4FEZA 5F4SA 1VQTA 3L21A 1LRTA 1KV8A 3CLMA 2WO5A 1KTNA 3IIOA 5IM51 4O10A 8TIMA 3HJZA 1VZWA 3HG4A 4L4MA 1VYPX 4CQ8A 4MUZA 1LZOA 1PL9A 2I1OA 3IRDA 3R13A 3DHFA 5T26A 1VCFA 4Y96A 3P7YA 3IVTA 3CEPA 5C2XA 3OVRA 3U8GA 1MSSA 5EKYA 2RDUA 2VOMA 2QCFA 4IQLA 3TKFA 3LLDA 4K8EA 2WPBA 5KINA 2NWRA 1YYAA 1BEUA 4FB7A 3GR7A 1I2OA 3W1TA 5AHIA 3SY5A 1GTHA 1K7FA 1D3HA 4LT9A 3C3NA 3W1LA 1P1XA 3LCWA 1HO4A 5F1VA 3FS2A 3TSDA 4CCDA 3UWVA 2FTPA 3E49A 2CLFA 2VFEA 3NQAA 4E38A 1BWLA 1K8XA 2JGQA 4XKYA 2EKCA 1OX5A 4QQ3A 1GJPA 1FWSA 3THQA 2VENA 4H4IA 3W07A 3PM6A 4FXRA 3BPWA 4KWWA 4JGDA 4UTWA 2JGYA 3GNDA 4AF0A 4WZHA 4CLMA 3W1PA 1EPXA 3M16A 2RFGA 3W84A 1WQ5A 3W85A 3MP3A 4PC8A 3FLUA 4BI7A 3SFKA 3SI9A 3OEXA 3I6RA 4NVTA 1VLIA 2VFDA 1FQ0A 2QCLA 4FXSA 4NX0A 4Z1BA 4YCPA 3I7RA 4X3ZA 3MHGA 2YCEA 4IXHA 1H61A 3CEUA 1RQEA 3O16A 4A3UA 4BI6A 4FNTA 1TJRA 3B05A 1LLZA 1OHLA 1LOLA 5BMWA 1A5CA 3P5YA 2V2HA 4GUJA 1QDSA 4M6VA 3PAJA 3DU0A 1VRDA 2ABBA 3E12A 4YLWA 1H7OA 1UBSA 1I2QA 1OF8A 3C56A 5IBXA 4TMCA 3KAOA 5H91A 2H3BA 3NQCA 3NVTA 4UTWC 3NZRA 2E6YA 2ZA3A 3S1XA 1H62A 1FUYA 1RQBA 4BWLC 1SZFA 1PCKA 1LRQA 3LLFA 3A21A 3ZWTA 4ZZ9A 4LRTA 4UFIA 3QPYA 1B3OA 2YXGA 4M7TA 2ZZ1A 1AK5A 3SJ3A 3HIJA 4IMCA 4WJEA 1YPIA 4DO4A 3P82A 1W37A 2Y62A 1ONRA 2PRHA 1R47A 3OVQA 2EHHA 4XKYB 4BFAA 3OA3A 1YDOA 2CU0A 2A4AA 3WK0A 3UY8A 3NL3A 4M19A 3VE9A 1SR9A 1J2WA 4GWEA 4HSNA 4BR1A 2C13A 5AB3A 3S5NA 4JN6A 2VFHA 3W2UA 1SW7A 2A6LA 3KRZA 3LHVA 4FIQA 5BMXA 2DJXA 3CHVA 1IIHA 2A7NA 1W3TA 3LI0A 1G4PA 4LU0A 4WXZA 3DAQA 1MEIA 5FEXA 3WJYA 4R33A 1SZGA 3M41A 4FX8A 1TV7A 5AYYA 1XKYA 4TIMA 4Z1DA 2J9XA 3EB2A 3P8IA 3O1NA 2ATMA 4IMDA 4GBUA 3QMTA 1JCYA 3HPZA 2ABAA 4O13A 4ML9A 5FEZA 5I3GA 3P61A 4O17A 2W79A 3A23A 2GJNA 4JTGA 4E2BA 4O11A 2P0OA 1ALDA 5F2LA 3TXVA 3G1XA 2B0MA 4OT7A 5LHFA 5DBTA 2W6RA 4JX4A 3B0UX 1OFRA 5I3HA 4FO4A 1PIIA 1U83A 1XDMA 1Z41A 2YR1A 2V82A 1TRDA 1XI3A 1ZJIA 3UWUA 4RJEA 1OX4B 5CPNA 1PE1A 2V2DA 4AMAA 3M5YA 2NX9A 3GZ3A 3FOKA 3KVKA 2FFCA 5CZ0A 5C5YA 3ATZA 2RHGA 2WQPA 2NXHA 2JBMA 2O7QA 2GOUA 5DCBA 3UZJA 3GKAA 2CZ5A 3GDKA 1AL8A 3TFCA 2YSWA 4JYDA 3BVJA 3PR2A 2Y85A 5KMYA 2BWGA 2VC6A 3T4CA 3TSMA 5C54A 3L0NA 3LCFA 2ZZ5A 1F6KA 1GG1A 2GPTA 3F03K 5D2VA 5DY2A 4YL2A 3LV5A 2H6RA 4RXGA 1IF2A 3W7CA 4N9CA 4KFOA 1RPXA 4UTLA 2ALDA 2DP3A 4ICNA 3P5ZA 5BW6A 3DGRA 5E93A 1SW0A 4AHQA 3W2MA 3I65A 3UXDA 6ALDA 3AO0A 3GR8A 4AWSA 2QCEA 1EP3A 1YXDA 2Q8ZA 1FX6A 4QNEA 4LOCA 2J9ZA 4UTKA 2J9YA 3O15A 3LCHA 1SZEA 2FQIA 4LVGA 2A6NA 2A85A 2FPVA 3C2RA 3QH2A 1NF0A 5AC8A 1KFBA 2C15A 2DZPA 1Q6LA 1TPC1 1KM0A 3P67A 3W70A 4U4MA 5LZLA 3BGJA 3TR2A 2Y89A 1NVMA 3HGOA 3PY2A 1M6JA 3USBA 2V30A 1GG0A 1O5XA 1QWGA 3W2JA 4GUIA 1S5TA 2EAWA 1OK6A 2Q8LA 3NQVA 4WOQA 3OIXA 4ONVA 4ZQPA 4DF1A 1TMHA 3EX2A 2DZVA 3B04A 2BZNA 5DELA 2WSRA 1EB3A 1KLYA 4R34A 3PB0A 1R46A 2YW4A 1KM2A 1OX4A 2GVLA 1KM5A 4NU7A 2A7PA 3A22A 4DXVA 1RD5A 2YFOA 1O94A 3U2OA 5TQLA 2WSYA 2WJZA 4JD4A 3H53A 4LV9A 2C14A 1A50A 4JEQA 3UPWA 4K37A 3WK3A 3TC7A 1F7BA 5D32A 2XN0A 1RZMA 2G97A 5EYWA 4Q33A 1S5WA 3LOTA 3TMLA 1QMLA 3M44A 1AW1A 5G2IA 1VS1A 4PL2A 4JS3A 1OFBA 2QCDB 5G5IA 3W1QA 3PB2A 3TROA 4UTTC 3MMTA 4HNNA 1VHNA 1TPH1 3CWNA 1K7XA 5AOUA 3CB8A 3W7IA 1I4NA 4O1BA 5KTLA 3QEZA 3W1MA 1SUXA 1EUNA 4NT0A 1F5ZA 3S5YA 3DFOA 5HR6A 5K4ZA 4O14A 3LX9A 6TIMA 4TMBA 5D38A 4YXGA 2VELA 1KV5A 3KFTA 1H7NA 2ATSA 3NL5A 1O60A 1TTQA 2ISSA 1FDZA 1NFBA 4JIQA 4WY0F 4G1KA 3EWZA 3LERA 4FNUA 5D05A 4Q4KA 1SO4A 5H2ZA 1TTPA 3KXQA 3GXPA 4EF9A 3VI2A 4HIBA 2H90A 5LNSA 3NQDA 4FHAA 2OMAA 3RF9A 1N7KA 3G18A 4JDYA 4LW7A 1TCDA 2VXNA 4LC6A 2X16A 1CX9A 4OU1A 4QITA 4UTTA 2Y7EA 5LKYA 2WOQA 3MBFA 2TMDA 1VCGA 1W8SA 5AC6A 4PH6A 3OHIA 1G69A 3OVPA 4O8RA 2JKEA 3GIYA 4KKXA 3C2VA 1XBZA 4GRSA 3QC3A 5KZMA 2RDWA 1EA0A 3LBCA 1ZY9A 3DFQA 2QKFA 2BLEA 3QPZA 4JTUA 1Q6RA 1W5NA 4K36A 1S5VA 1Q6QA 3HGRA 2CLIA 3ABRA 4GJ1A 1P4CA 3O63A 2KZHA 3FKRA 1EP2A 2C19A 1QO5A 2Y70A 3WJXA 5HINA 1ZAIA 3HG5A 3W2NA 1OK4A 3FJLA 3BARA 3DI0A 3C52A 1XCFA 1JCMP 3W7EA 2A7RA 4LV4A 2XN2A 2ZDRA 2OT0A 1O5KA 1N55A 3W72A 4LUIA 1KM4A 2WV8A 1R30A 4ALDA 1FCBA 3QMRA 1G4EA 4AWUA 4GXMA 4ORIA 3MP4A 3C61A 1V7YA 3TW7A 2NUYA 1LTDA 1TPUA 1LBFA 1OX6A 2DZSA 3QF0A 2I9EA 1P0NA 3BGGA 5DXYA 3GDRA 5TIMA 3O06A 1PCWA 2CLOA 3W83A 1I2RA 1XBXA 5LGZA 4DO6A 1SSGA 1V5XA 2Q3RA 1GVQA 2ZZ7A 3EX3A 3QW3A 3Q37A 1KW1A 3NM1A 4S2CA 3G1VA 3UD6A 2P10A 3ANYA 4I7WA 1H50A 3TQVA 2X1RA 2DORA 1DOSA 2F7FA 3SIZA 4CCEA 1O95A 1QPNA 1XL9A 1SO5A 1QFEA 3MBDA 3SGZA 5I3IA 2EPHA 3Q58A 1GTEA 3EXRA 2FB3A 1F6PA 3S1UA 1T99A 1AW2A 2JK2A 4O15A 1A5BA 4QM1A 3VE7A 3S9YA 5F1UA 1G67A 4Z0JA 2OT1A 5KSWA 5HNRA 4JX6A 5HWJA 4BI5A 4MY9A 3BLEA 4PL1A 4R7JA 3ABOA 4WY0B 5HR7A 4CQAA 3G1DA 1ICPA 4MJMA 4UMAA 1XUZA 4XBSA 1FCVA 1KM3A 4WOZA 1GPWA 1TPB1 2PCQA 3E9AA 5CSSA 3W7GA 3M5XA 4IPIA 2C3ZA 1EP1A 3HG3A 1JUKA 1QNVA 2ZRVA 3MWAA 1F76A 1UB3A 3R2GA 1NSJA 3M1ZA 3NL2A 3NPXA 4AWTA 1LORA 2XN1A 2QJIA 2ZA2A 4X2RA 4MFEA 1WA3A 3NQ7A 4UIOA 2OJPA 4MJZA 1OYAA 5FI8A 2E6DA 3TIMA 5LNRA 2ZCGA 1A5SA 4BWLA 1AMKA 4RV8A 3EWYA 3LCXA 3PBYA 3FIGA 3N73A 4WQ6A 4JTSA 3LXAA 3M47A 3IGUA 3DFSA 3O07A 2PRMA 3LRLA 5D2TA 1OVDA 4P61A 4O28A 1I8JA 4N9DA 2CZDA 2Z0IA 3C0JA 4NJKA 3W76A 5D30A 4A22A 2QF7A 2E6AA 1F74A 3BV4A 3C2OA 1FXPA 3NPWA 5HUPA 3NQ8A 2YYUA 1HG3A 2LLEA 3LTPA 2EGZA 4IJBA 3TDFA 2E5CA 2H8ZA 3RU6A 3Q94A 3QFEA 3ABQA 1X1ZA 1T96A 4M7SA 1W3IA 3N14A 3W2KA 2DU2A 4A29A 1LOSA 4MZYA 4FNQA 1ME9A 3TQKA 4AH7A 1OG0A 5HULA 1ME7A 4NUWA 1XDLA 3PSVA 1UJPA 3QSTA 4NJJA 3K30A 4DBDA 3O05A 5AC7A 1EUAA 4N9BA 3G0SA 2ZFAA 3C2FA 5EBUA 1NAL1 4OBTA 3FJ6A 1SO3A 2NWSA 3BW4A 3F4NA 4WY0A 3W9ZA 4ORMA 1W0MA 3QQ0A 2VEKA 2B7OA 3M9YA 2YGYA 3AJXA 3A24A 4M6QA 1SFLA 5EPDA 2ZRUA 3S0CA 4DELA 3O6CA 3W71A 4UTJA 4UTUA 1FDYA 3L67A 4LUJA 5E0KA 3SR7A 4AHPA 5K9CA 1NF7A 3G0XA 3STCA 1KBJA 5AHLA 5HUOA 5DN1A 1OFPA 3LV6A 1FWWA 5A8GA 3R12A 2VEMA 1IIGA 3QZEA 2B7NA 4NJGA 1JRBA 1F05A 4X9SA 2ZZ3A 4UC5A 1GT8A 3DFPA 1IXQA 4TO8A 1UUMA 1DV7A 1WDWA 3STEA 4U28A 1M7OA 3CT7A 4PEKA 1YTEA 3MYPA 5LSMA 1QO2A 2Y61A 1IXPA 2WNQA 1L2UA 4NNAA 1KFLA 1DQXA 4R53A 3S1VA 2IQTA 4OHQA 1PV8A 3MJYA 3G1FA 2YPIA 1LLWA 4Z0SA 5J5DA 3E96A 1DJQA 3F4WA 3TA6A 4ADSA 2QCGA 2YDAA 3O8AA 2R91A 2YFNA 1FWTA 4XQ6A 1H60A 2PURA 4IMGA 3VCRA 3HGSA 2WKJA 4AB4A 3UZ5A 2DZWA 3P60A 3NZ1A 2TPSA 2QUTA 3O6DA 3NYZA 5AFDA 3QW4B 3WK2A 1A53A 5E1QA 4OWGA 3EEGA 5AN7A 1PS9A 1OFQA 3LM7A 2E1DA 3EXSA 4O53A 4GE8A 3W6YA 1FDJA 2GUUA 1LDCA 5KITA 1HTIA 5HMSA 4K6AA 3CC1A 2HS8A 2ZRZA 4CCCA 3W1NA 4PTNA 5LGXA 3I7SA 3IVSA 4NNBA 3OG3A 1BTMA 4IXXA 4UMCA 1W5OA 4O0ZA 3W74A 5HQEA
chains in the Genus database with same CATH superfamily
2CW6A 4AZHA 3E1F1 5FJTA 1J6OA 2QVHA 1QXLA 4M81A 3CUIA 2ACUA 4XD4A 1PVNA 2J6VA 4XD6A 4XWUA 4YU1A 4A4AA 1LCOA 4M3PA 4Z1CA 3M7WA 4Z2KA 4B3ZA 4XAZA 4IL0A 3LNPA 2VO5A 3DHDA 1XIHA 1TG7A 1OCQA 2D2JA 3GDBA 3INPA 4ML4A 3GX9A 1CLXA 1VD6A 2CC0A 3V0TA 3PWAA 4V1XA 1X6UA 2J24A 3A5FA 3UXLA 4N6FA 4UR8A 1SU5A 1VFOA 2PLCA 2UY3A 4RNFA 2DDXA 3NQMA 1E1CA 4F79A 4PSRA 3GHRA 3UG8A 3VM7A 5GJMA 1K03A 2C0AA 3M0ZA 1Z7AA 1CLKA 3UG4A 1YDVA 4XK2A 3MQTA 1H7XA 3MKCA 2PU1A 3PG9A 1UWRA 3FAWA 4DX3A 4ZMGA 5DRIA 1P0BA 4RX0A 7ENLA 1EEXA 1UPMB 3SRKA 4MJ4A 4EOUA 1OEPA 1JXJA 2PGWA 1BVNP 3IPWA 5AYXA 4DF2A 3L68A 3WDPP 5A69A 4OUEA 2ZXBA 4S3GA 5J04A 2J62A 1OBAA 1QI3A 4FAMA 3FA3A 4RZ4A 4O12A 4QRNA 4LS1A 3BG5A 1KTCA 2PLKA 4MZ1A 3WBAA 3AMGA 3RCMA 4ZE5A 5FAJA 1ONXA 4Q32A 3THDA 3DFHA 3LM3A 3RIKA 2Z6IA 1QUMA 3GC2A 3WLLA 4KEUA 3AYTA 3VFLA 1QWKA 1QASA 3QLDA 3BE7A 2GJXB 4NX5A 2FZBA 1DTUA 3U5UA 2JE8A 3OU8A 3LMZA 3PK7A 3Q65A 2R9RA 2OPJA 4LVAA 4I7VA 2DFAA 3IAPA 4H6KA 4AZCB 3WLMA 2XU2A 4GVHA 4GUGA 3VOJA 1A5MC 3N4FA 2HJPA 3MCOA 3TUUA 1LOQA 4IM4A 2AKZA 3L4ZA 2E77A 3OOQA 1YIXA 4Y8FA 3N34A 3SSZA 2YKKA 2VCCA 1Q65A 1PPIA 3BCFA 4MNLA 4AZ7A 2YX0A 4RCXA 5I02A 3PTQA 3W7LA 4RKAA 5HMFA 1TELA 3QQ1A 4PMQA 4GNKB 4C6OA 1W6TA 4N2YA 2VYOA 3W22A 1JQXA 3MUIA 3ONCA 1C8XA 4GUHA 1TJPA 1BRLA 5I5RA 4FLRA 1JDAA 4JIRA 4JTFA 2ZRYA 3VM5A 3LCIA 2ZX5A 3RJYA 3T81A 1CI1A 2FLIA 1OFOA 4QQUA 2QUUA 1K9EA 1M7PA 1VR6A 3CHFA 1US0A 2D22A 1XCWA 3PNUA 4NAFA 4WUIA 6A3HA 4PZVA 4ZSUA 2IKGA 3UVAA 1YPFA 4KRZA 5ABGA 4H7CA 1WZAA 3VD9A 3EPOA 2VM8A 3GIQA 1EO7A 2WZMA 4M24A 5K9XA 4IMEA 3B8UA 3N2XA 2ISFA 3RXZA 3HZ3A 1M1BA 1J9YA 4HA4A 2A0NA 1ZP4A 1L0PA 3BLDA 2OZ0A 1TB3A 4DYJA 3DH7A 3NA8A 1ISYA 3BSMA 4H41A 1SJBA 1L6SA 1UD5A 3NDOA 4DBEA 2E09A 1QOQA 4CNNA 2BASA 3D3AA 4H9XA 2QCHA 3W2LA 2G3NA 1VF8A 4C90A 4B91A 3STGA 3WEOA 3OZYA 4WGXA 2NSOA 3HN3A 3L66A 5CH9A 2ZYFA 4MB4A 4HNVA 1WAUA 3EKZA 2V0TA 4QCEA 3LG3A 3E2RA 4C6CA 1HJUA 2VGFA 4TVUA 3TC6A 2CHNA 1WDDA 1UOZA 4DWSC 4LTSA 5MKGA 2BP1A 4MOZA 1EC9A 5CPQA 4Q8WA 2BXVA 3ZR5A 3CUZA 4XBJA 5EB8A 3TA9A 3RNDA 8CGTA 4ZQMA 4TTUA 1AUSL 4JTTA 1JCJA 3MB9A 3GD6A 4ASTA 1OYBA 3ZFHA 2PDPA 2A2IA 4LYRA 3IGXA 1W2PA 4DBUA 2NVDA 1U5JA 4GACA 3V0UA 2MANA 4HOZA 1SJDA 3ITCA 3R5EA 5TD4A 1IEVA 5A6TC 4B4HA 4EPKA 4HU3A 4BF9A 1I0DA 5G2HA 3QV8A 2XFWA 3PG8A 3VU2A 1I45A 5D09A 1WCGA 3PBVA 5J5RA 3U9IA 2P3EA 4EWND 2DW6A 2BV9A 5GNXA 4M82A 5FF4A 2VFIA 1V93A 3OBAA 3W7PA 2J77A 1OWQA 1XC4A 2VGIA 3CMJA 1DJGA 3J7HA 2B4GA 1TJ0A 2EBNA 1T0OA 1JULA 3PVFA 4IGMA 4UCGA 5CSYA 3P80A 3T2PA 4EAMA 2VI0A 1KFCA 5FACA 1KKOA 3N25A 1T6MA 3SCPA 2WWCA 1IXOA 3KBSA 3BG9A 4O1AA 1WUEA 1EJTC 1KXVA 4ZO6A 2DGAA 1AH0A 2XH2A 3B9DA 1L6WA 3WLJA 1O12A 3T44A 4QTGA 4RW3A 1JUEA 3KLLA 5JVLA 3EMCA 1L6GA 3WX7A 2YBVA 3BW3A 3EWUA 1GZGA 4WKAA 4G1NA 4HOXA 4HT3A 2X0YA 3FKKA 5HWMA 4K8GA 4CNUA 1KLZA 1J5SA 1VBHA 2VEIA 2GGGA 1RK5A 4HKPA 1TWWA 2VEGA 1S3HA 2F8QA 3WQ5A 3NO5A 5CPLA 2GVJA 3DZ1A 2D2GA 1HUVA 4HPHA 2BS9A 1ML1A 4H19A 4GLEA 2CBJA 3RLVA 2OYKA 2DY3A 4UR7A 3LHUA 2Y63A 4E2DA 1UG6A 1H41A 1CIUA 1OFEA 1HFBA 1KWGA 1E40A 1OC6A 3WNKA 3IAQA 5MF5A 4IPJA 3HM7A 4PMVA 2YA1A 1K4GA 2J75A 1GOQA 3A5VA 1G4SA 2XTKA 1KO0A 1PDZA 1GYNA 3CIXA 2FH8A 3W3OA 3KHJA 3GY1A 2Y6ZA 1RK6A 1Q63A 4RPPA 2C18A 3LPOA 2Y7GA 1ZENA 2IPGA 3TYEA 2WW5A 5I3FA 3SUSA 4RZBA 2DZTA 3A9IA 1HQTA 1UZ4A 4ICCX 3BAJA 3T7VA 3V1PA 5CZJA 4DO7A 4XIMA 4QEEA 1GZ1A 1VLWA 2EJ1A 2Q8XA 4CQ9A 2F9RA 2CLEA 1E0WA 3EKGA 3TAKA 4AF0B 3G24A 3RU8X 1J11A 1EJUC 2WMGA 1RXOB 3K46A 3QRHA 2ISVA 3O0KA 2B7QA 1KRMA 1EOMA 2QZRA 4XZ9A 2CXGA 1Q6EA 1KCLA 4RZ5A 4RE4A 4NZFA 4BQ2A 1GOKA 1KXHA 1AL7A 2DH2A 2J66A 1JDFA 1WUFA 3EX4A 3UZXA 1EH9A 1K02A 4CNOA 3WD1A 2XIOA 3FYOA 1HP4A 1UWTA 3G1HA 5D2YA 3NGFA 3WJWA 1G01A 1AZ1A 2OGJA 3V35A 4FIRA 3GAYA 3LGGA 3EB4A 4NRRA 1W3KA 3LB0A 3QGAC 3F1QA 4X2PA 3T0CA 4U2YA 1DWFM 3SB0A 3AZTA 4PCPA 4NI8A 4V1YA 1V03A 1TV3A 3GYEA 3T40A 3VXGA 1W9UA 1VBUA 2OX1A 3I10A 5B80A 4DO5A 3HV8A 3MP5A 3GG0A 2HEJA 1GW9A 3AYSA 3TH6A 4GZ7A 3EAUA 1R6WA 1M65A 3UXIA 1WB0A 2A5HA 3W86A 1TYGA 4Q8UA 1WDRA 2TRSA 5HMEA 2V9DA 4MLRA 4GYJA 4AAJA 4WGHA 2NV1A 4UNLA 2QJGA 2C1HA 4MGGA 3AS1A 3TAOA 2GLKA 3EX1A 1GJUA 3AS3A 4LUTA 4RPQA 4PBFA 4QJ3B 3WY1A 4DN1A 4Q8NA 1JCTA 3ABSA 3IUDA 3CZKA 3FA4A 3WLIA 4O4VA 1YTKA 1XRSA 5HJXA 2ZIDA 1K9DA 4TU1A 3GXDA 5REQA 3UERA 1FWAC 5CSRA 4REQB 3OLEA 1C8VA 1GCYA 4JTAA 4BCEA 1Z44A 3GH4A 4LNYA 2VQUA 5ABFB 5D9MA 4A8RA 3N4EA 1F8IA 1TO3A 3WQWA 5IRPA 4J3XA 5F4XA 4JFWA 3WL0A 2VZSA 2EPNA 1XYLA 2QULA 4Y9AA 1E6RA 4A3QA 1E0VA 1Q2RA 3PWIA 3S2CA 5IDZA 1CGVA 5CKSA 4AQLA 1N8WA 3AAMA 1E6XM 3N17A 4CQCA 5DF0A 4A21A 2BXZA 1DBTA 4PMUA 1OGSA 2GQ9A 1EX1A 5A6SA 4DZIA 3W88A 4J3SA 3C4UA 4JN7A 3RO8A 4GH1A 1XBYA 3E5PA 1AA1B 2XVKA 2ZRXA 1UR0A 1M53A 4HSOA 1D8CA 1VEPA 3LQGA 1XWYA 2F84A 3CPRA 2P5NA 3CZGA 1SW3A 4KEVA 4QAIA 4LYQA 1OADA 3WQFA 3HTWA 3ZS4A 3BC9A 2CLKA 4IIHA 4L56A 4D8LA 5CG0A 1TCMA 4AIBA 4E3VA 1GVYA 3HO8A 4MYXA 3NNTA 1SQ7A 5C0QA 3MUCA 1TE1A 4DPPA 2FHCA 1KM6A 4PB4A 1H1YA 5B7YA 1GVRA 1XFBA 3QKEA 1EC8A 3POCA 4E0CA 1EJWC 3B97A 2BX7A 4CD6A 1EZWA 4ZA0A 5LNUA 4UFHA 3DYMA 1W1TA 2QNEA 1OCBA 4XTDA 3OO2A 3NG3A 4GC4A 4IMAA 1RSCA 1W91A 2VRJA 3I7QA 3KVLA 2XVPA 1XP3A 3B0XA 2VX7A 3IJ6A 3ZYZA 4BA0A 4YTQA 3MCMA 4FNPA 3FFSA 1DYSA 4HBKA 3KOFA 2ZWZA 3KP1A 4C1NB 4W5UA 3WJSA 2O56A 3ELFA 1LM1A 4A8LA 5FEWA 3M6YA 1W56A 3ZM8A 5FESA 3UESA 1E6ZA 3BDKA 1B30A 2CLPA 3LI1A 1VB9A 2P88A 4WIWA 3W82A 1NEYA 1W9BM 3NURA 5LA0A 4FEZA 3OODA 4HHMA 3CLMA 5E5CA 4RNHA 2FYMA 8TIMA 3HJZA 1E0TA 4AYGA 4CQ8A 4LH8A 2PWEA 2O9PA 1QNSA 3MTWA 3DHFA 4IPLA 2GUBA 2BGQA 1UKPA 1CGUA 3CEPA 3U8GA 4DAFA 3GTHA 4E8GA 3WMBA 1R7OA 2REQA 2J47A 4IQLA 3SQSA 2YXXA 3TKFA 1A4MA 1SFSA 4F0SA 2NWRA 1YYAA 2CNCA 3QOKA 5ABEA 3CS2A 1Y8BA 4B92A 4AC1X 1UZDA 3T1GA 6XIMA 3FS2A 3R6IA 3UWVA 1QI4A 2VFEA 3NQAA 4E38A 3CAKA 4XKYA 4QQ3A 4B5VA 5I03A 2HE8A 3VD3A 3VZXA 3WQDA 3PM6A 2O9OA 2WVVA 4OKDA 1MUCA 4JGDA 2D3NA 2JGYA 4AF0A 4WZHA 3BAKA 3CQKA 3M16A 4INFA 1PWLA 4Z2LA 4BI7A 2HPMA 3AIBA 1VLIA 2VFDA 2QCLA 1NP2A 4LBUA 2EPLX 3WQEA 4UOJA 4B5XA 3TJ4A 4GK8A 3UW6A 3OB8A 3O16A 2BHUA 1UOKA 4D9PA 3B3DA 1MWOA 1LOLA 1BVWA 1M7XA 2Y8VA 4O8AA 3UP8A 2DIEA 3SCRA 3PAJA 3E12A 4YLWA 1UR4A 1H7OA 2Q6ZA 3IJQA 3TYZA 2ONEA 3JZEA 1TMQA 3S46A 2VZVA 2H3BA 2V69A 2F6KA 2FMNA 3FGCA 2ZUSA 1CXLA 3LU2A 3S1XA 4C5ZA 1H62A 1B54A 3CUHA 4BWLC 1H09A 1V3IA 1IGWA 3COTA 1TUFA 3S6OA 4LRTA 4DYKA 4NHVA 1EYWA 1B3OA 2ZZ1A 3ITVA 3HIJA 2VWSA 4DO4A 3P82A 4HZ7A 2V67A 1H2JA 3S5SA 2PRHA 3L4VA 4BEQA 1R47A 3OVQA 1JZ3A 2IW0A 1HW6A 2CU0A 1R7AA 4OECA 1KRAC 3LD5A 4D1JA 1XHGA 1J2WA 4HSNA 3AUOA 2C13A 2GGIA 2GK1A 3EWDA 3AI0A 3OW1A 1XQLA 2PDGA 1KGWA 1UIOA 3CHVA 4PB3A 1RCOB 2VGBA 1NWUA 4LU0A 5DANA 3WJYA 1SZGA 3M41A 4UQAA 1XKYA 2E9LA 4TIMA 4Z1DA 4CN1A 2PDXA 3LZ5A 2ATMA 4IMDA 5BROA 1BQCA 3RPMA 1Q6CA 3QMTA 1GEHA 3HPZA 2DZAA 2WZHA 1LQ0A 4ML9A 1KQYA 4RE0A 5I3GA 3ZT5A 3BAWA 2FZNA 2VRQA 5A8OA 1ALDA 1PX4A 3TXVA 3G1XA 1AQFA 2GGEA 3V4BA 1BG9A 1OQFA 4HGXA 3K13A 2FZ9A 5CC7A 1YBQB 4GKTA 3U4FA 4EWJA 2Z24A 3AMLA 4H7VA 3B0UX 5I3HA 3E0FA 3RLHA 1U83A 5I24A 3HU7A 2I56A 1Z41A 4IHCA 1ZJIA 3UWUA 2ICSA 3BSHA 3DC8A 5AC4A 1FP9A 1JZ4A 4AMAA 4H6QA 2NX9A 3GZ3A 2FFCA 4MNMA 2WQPA 2NXHA 4XSLA 4ACZA 3CLWA 1QW9A 1QATA 2XDFA 3GDKA 3U2EA 2YSWA 4JYDA 3NOYA 1Q7MA 3ARRA 2UZ9A 5KMYA 2VC6A 5LXXA 3VNYA 3SCNA 4U10A 3QYSA 2BVDA 4AU0A 4PMNA 2ZZ5A 1PZ2A 5D2VA 5DY2A 3AJ7A 3ZVHB 2H6RA 3BMVA 1ENUA 1C90A 4YN5A 1IF2A 3W7CA 4Q7BA 4N9CA 3T0DA 1S2AA 1EDQA 1RPXA 2DP3A 3F4CA 3ZIZA 2QPUA 5M1TA 5E93A 1D7KA 1SW0A 2RGMA 3I65A 3R58A 1T41A 2ZUNA 3GR8A 2QCEA 1FHVA 5HDRA 4HCLA 4QNEA 3BGAA 4LOCA 3AIEA 4P7OA 1WAWA 3LENA 2J9YA 2L5HA 5M3WA 3O15A 3LCHA 1HJXA 5DT7A 1V77A 1WKEA 4LVGA 2A6NA 2A85A 4AY7A 2OELA 1E1FA 3QGKC 1O66A 1JYNA 1XIFA 4D6FA 5LZLA 4AWEA 1NFPA 2A79A 3BGJA 3TR2A 3UJ2A 4DM1A 1NVMA 3USBA 3RRXA 1KBLA 1QWGA 3GTFA 2XFRA 3KBJA 4ICMA 4WOQA 4DWSB 4PUUA 1PIGA 4J3VA 1TMHA 4MWAB 2DZVA 4P5UA 3GNXA 2NQHA 4AEFA 4R34A 3U48A 1J10A 1KM2A 1KM5A 3QR0A 2G4FA 4MDPA 1EIBA 3R25A 1UWAA 2YL5A 1OSEA 3BLOA 1RD5A 1O94A 4GCXA 1WKFA 2WSYA 4LV9A 3POHA 5HNNA 4PMDA 1F7BA 5FKYA 1VENA 2PU0A 2WC3A 4IIBA 3TQPA 2ZC1A 3DYOA 3LOTA 3IACA 4R85A 4FK9A 3SO7A 1VS1A 4JS3A 4PUJA 1OFBA 3FYYA 3W1QA 4Q7IA 5DRCA 4UTTC 4RL3A 3M6DA 4P7LA 1BXCA 1VHNA 3PFMA 4FR6A 4F66A 2Z2BA 1I4NA 4RW5A 3R10A 3PUGA 3QEZA 1XLMA 2WWDA 4GJJA 4GI9A 1XYAA 1AQMA 5CAHA 1E5JA 2QXWA 4TMBA 5TAOA 4J1OA 2VELA 1DTNA 3KFTA 2ATSA 2VEFA 3MSRA 4C7GA 1TTQA 1NFBA 2F6UA 1SFTA 3LERA 4W88A 1LQAA 5D05A 5E09A 5BOEA 4AZBA 2JF7A 4IG2B 5H2ZA 2PS2A 3DG6A 3MDUA 4MWAA 4FHAA 1CGTA 3RF9A 1N7KA 4JDYA 4M6UA 1TCDA 3FDGA 2X16A 1NP0A 4OU1A 2DT2A 5LKYA 2WOQA 2TMDA 4GIEA 1PAMA 3H7UA 3PZ9A 4NYYA 3OYZA 1G69A 2IXUA 5AC5A 2JKEA 1HZYA 3GIYA 3C2VA 1CDGA 3UPMA 2PDIA 5KZMA 3ZXWA 3CNYA 1EA0A 3W27A 3CAVA 3IJ9A 5BYWA 3LBCA 3DFQA 2QPSA 3PZGA 3M64A 3RUBL 1HP5A 5D9OA 4GIRA 4QROA 2Y5EA 4IQDA 1P4CA 2J74A 4GZIA 2VCAA 2VCBA 4JTRA 1V6UA 2XIQA 1QO5A 3U2CA 4ZO8A 4UNIA 2NQJA 4PTXA 3W2NA 1OK4A 5A2CA 3FJLA 3BQ5A 1XIDA 1J0IA 1JCMP 4NAFB 3W7EA 2A7RA 3KTXA 4A6GA 2OT0A 2P8BA 2WV8A 3V5CA 3MMWA 5BU6A 2VX6A 1G4EA 3T2QA 4AWUA 4GXMA 4ZXLA 1V7YA 2I9EA 1P0NA 2W91A 2BHYA 2A3LA 4Y9MA 4YVPA 1V5XA 5CJNA 1NFGA 4GO9A 4EANA 3EX3A 3QV6A 4BKNA 1PWMA 4FLSA 4ENLA 3UD6A 4I7WA 3FVDA 5I3IA 3Q58A 1GTEA 3S4TA 2X0SA 1GOMA 1F6PA 4GQQA 1UWUA 3CYJA 2JK2A 3W29A 4O15A 3F7JA 3VE7A 1TR9A 1XIJA 5F1UA 1V02A 1U1UA 2OT1A 1JNDA 1JDDA 2PD5A 4RDZA 2YA0A 3N3TA 4CVUA 4PEEA 1IZJA 3FN9A 3ABOA 3HQNA 1PKNA 3N11A 4CQAA 1ICPA 3BURA 3RPTA 1L2QA 4UMAA 1EBHA 3VC6A 4ROPA 3O2LA 3T6CA 4QHRA 3G1RA 3S9ZA 3G77A 4IPIA 4YVXA 2R1KA 3R2GA 1NSJA 5JXQA 4MG4A 3TJIA 5KEZA 4GXWA 3OGSA 7A3HA 1IT7A 1Q7QA 2WZEA 3PTDA 4DUWA 1UZHA 1LORA 2XN1A 4W8BA 4MFEA 3TCSA 3SAZA 4GI8A 4CGTA 1YMYA 3NQ7A 2PDJA 4MJZA 4HMNA 5LNRA 1A5SA 3W0KA 4BWLA 1L6FA 2IMRA 4RV8A 3EWYA 2PF8A 1CGYA 1XYCA 3N73A 3M47A 4J27A 5FCZA 2CITA 1XLKA 2G50A 4IIGA 4JIHA 1I8JA 3TP4A 4HA3A 3HFYA 5D30A 3BV4A 1JFHA 1MQQA 4B5TA 1TV2A 2V5KA 4UZSA 5C2GA 4IIFA 4IJBA 3TDFA 2E5CA 4IISA 5JQ9A 4ZE4A 3ABQA 1X1ZA 4LYKA 4M7SA 1W3IA 1TVNA 2DU2A 3KDOA 4MZYA 4B5UA 1Q4NX 1JYXA 3ITTA 1BPLB 2C8NA 2CCRA 3OJGA 4PMOA 4DBDA 4DWSD 3O05A 3AIWA 1EUAA 4N9BA 4PCTA 2ZFAA 4GJIA 4R7WA 5EBUA 4OBTA 1SO3A 1DXFA 3BW4A 4WY0A 3W9ZA 3A6OA 4DVOA 4ORMA 2GWNA 2PF0A 4M51A 3NZPA 2QGYA 3AJXA 5JUVA 1SFLA 5EPDA 4US5D 2ZRUA 4AUBA 4DELA 3O6CA 1U5VA 5A3HA 3U3HA 4UTUA 3OLGA 5FJJA 4U5IA 5FA5A 2EG6A 4AHPA 3DYPA 5AHLA 1OFPA 3LV6A 1FWWA 2B7NA 4A3RA 3AXMA 1DIOA 4X9SA 2ZZ3A 4HVXA 3UU0A 4UC5A 2WCGA 3ALFA 3CWHA 1IWBA 4GGHA 1RBLA 4PUEA 3KRBA 4Y9NA 4U28A 4PEKA 3MYPA 4AZIA 3W37A 1W1B1 5LSMA 1DXIA 4NNAA 2Y61A 3PNZA 1A80A 1DQXA 2HROA 3WEZA 4Q22A 2CIPA 4OHQA 2VD9A 3MJYA 1DP0A 4ACZB 4Z0SA 4J2MA 1ZU8A 4KCWA 1HXJA 3E96A 2G0WA 2OB3A 1RUSA 2V63A 3EDEA 3VIIA 2R91A 2YDRA 2PP1A 3RCNA 2YFNA 4MTVA 4PULA 4XQ6A 1OM0A 4FI4A 5D8WA 4V15A 5CSUA 2BY2A 2DZWA 1FH9A 2QUTA 1NQKA 1R3RA 2J8GA 3VDHA 1IWAA 4OWGA 1F3WA 1NDWA 3WFZA 1Q4WA 3QXBA 5CZKA 3VGGA 1FWFC 2FTYA 1X96A 1ODUA 3DHPA 5JMUA 2WSKA 2XJ7A 3W6YA 4K6AA 4HMDA 1Y65A 4UB9A 2HS8A 5EFFA 3PZTA 3FSTA 3CV7A 5HJYA 1BTMA 1B0IA 1W5OA 2XVNA 4B2DA 1CTNA 5HQEA 1BWVA 3YPIA 4GQRA 4XBKA 4I9JA 4S38A 4UOZA 1WZMA 4NNCA 2NX3A 2QR6A 1HGYA 3W1AA 3LHTA 1BYBA 3R0KA 4JYEA 3TK7A 3AZSA 3GWQA 2WBKA 4AZCA 2Y88A 1QAPA 2GJPA 2P0IA 3RMJA 3OLDA 1QPOA 4V27A 4X60A 3NR0A 1EPVA 3LHWA 3P0XA 1WV2A 3MVTA 4HMCA 3AHTA 4OE7A 4PODA 4J4KA 1AW5A 2YDQA 2YXOA 5LA2A 3CMGA 3P74A 5FJRA 1KTBA 1BYAA 5FL1A 4NG3A 1P0KA 4AY1A 1P0DA 1A3XA 2VFFA 3CPUA 3N12A 5CZTA 1UCWA 7REQA 4W85A 1RY0A 1XLFA 1WO2A 2DUAA 1ZGDA 4IPPA 1Q3NA 1E55A 5F7UA 3GNPA 4F2BA 4W93A 4Z08A 1UZ1A 4LAMA 3KCOA 3MHFA 2XISA 1SSDA 4DM2A 3T8LA 4GD0A 3WDQA 1DJXA 3GVGA 5CBIA 3M5VA 3DKLA 4NXKA 4FOKA 2AL2A 3P6LA 3K4AA 1T40A 2XSBA 3RPDA 2Y7DA 3GR4A 4HU0A 2E28A 3WDHA 3L5MA 1YNQA 3BICA 3TYUA 1MW0A 3G5EA 4CN6A 5FAGA 4TV6A 4LQ1A 3F4VA 2D23A 3ITXA 4KRTA 1R3YA 3G2GA 1ZBCA 1MZRA 1ITQA 4C7FA 2ZOXA 1U5HA 3RR4A 1E6SM 2AGKA 5FSDC 3SBFA 4XAGA 4UNKA 2X05A 1JZ8A 2PZNA 4M56A 3CGTA 2J27A 3GUGA 3TE9A 1VJIA 2HVNA 3PZUA 3BAYA 3C0LA 1C91A 5ABFA 3SDOA 3L12A 4RK8A 2A21A 4HNCA 1POKA 1C92A 3L4TA 4GABA 1GW1A 3GNNA 3QY7A 1EGVA 4JICA 4KETA 5H8MA 3OP2A 1PHWA 3KOXA 4N4PA 2DJLA 1EWDA 3CL6A 5CPMA 1EJ7L 1IYXA 4Z2GA 4EXAA 3LRMA 4HHHA 1FH7A 3KUMA 3LQLA 1HKWA 1JPMA 1XR2A 5CC6A 4I5RA 2JKAA 1LRNA 2C6QA 3WD4A 2OXNA 4LS2A 4HHPA 4PMRA 2GGJA 2QJMA 3EKLA 3N6QA 3AHXA 1ADOA 4PRWA 1CWYA 2OWWA 3NCOA 4TTGA 3N3MA 1BSLA 4HJFA 4U5KA 4OQVA 1CECA 3VUPA 2X1SA 1TPDA 2NQLA 4JFSA 5FEPA 1KCKA 2YOCA 1SO6A 2DZBA 3L4YA 4QGCA 1M7JA 4EAYA 4MM1A 3LXBA 2E8ZA 3R8HA 1ZQ5A 4HK6A 1H51A 1XPYA 1TIMA 3H21A 1XJBA 3IARA 1UR9A 1JYWA 1WZLA 1UR1A 1X1NA 1QK0A 4KQNA 1F2JA 4MLJA 1W1ZA 4FP1A 1RHCA 2NW0A 2FB2A 1YXCA 4NAEB 4XISA 5K3VA 4MZ8A 3UGVA 1DIEA 2NUXA 1HKVA 2PGEA 2ZX7A 2VL4A 3VNZA 3P84A 2GWGA 3AWOA 4DQWA 4AXNA 3UJSA 1RVGA 2XIMA 2HSAA 4QDMA 5BU9A 3EXTA 1QPRA 1IZKA 4FX6M 2VZTA 3VIMA 1KXTA 2V81A 1PTGA 1H1ZA 3TYCA 1RJPA 1P6CA 1KWKA 1WOAA 1VHCA 1PDYA 5DCEA 1S39A 3WKZA 4I9AA 5BXPA 2Z2UA 2WJDA 5JU6A 2X1UA 4JCLA 4QE5A 4IJCA 2IXVA 4KIRA 4KWSA 1H5VA 1SFJA 4TX8A 4FOUA 4O50A 3DI1A 1UP3A 2IPWA 1FTXA 5CLTA 2VDIA 3MW7A 4Q4QA 3WMLA 3BW2A 4PUKA 1QJWA 4C1NA 2G41A 4YYCA 1RVKA 6REQA 5JBEA 1LT7A 4GA8A 1R2RA 3F2CA 1EGZA 1EXPA 4M29A 4Z42C 4MY8A 5C9RA 5CGQA 3OGRA 1OABA 1OFDA 2IUZA 5CCZA 1ZAJA 5EL1A 5GNYA 2CEQA 3QJAA 2UY2A 5LIYX 3VKBA 4LWWA 5BOFA 2VR5A 2CZFA 4O1EA 1XGDA 1VFLA 2QMJA 3NQEA 3KTSA 5FF2A 4S3EA 4AD3A 3C0SA 1JI2A 4H1ZA 4AHOA 1L6YA 3ZVIA 4DUOA 4GBDA 1UR2A 4UTIA 3UZZA 5HNTA 1Q6DA 2R24A 4YMZA 3HQOA 4MKSA 3WQVA 3AQUA 4ZO7A 4IUOA 1AMYA 3W7OA 1B3ZA 3VOIA 2YJQA 3FCPA 1A5NC 4IX0A 3RR1A 2QW5A 4NRSA 4DHGA 3EWBX 1GNXA 4DUVA 4UQBA 1XRFA 3QMSA 1NDZA 3BLFA 5C9XA 4GO8A 1KM1A 4B5NA 2HXTA 2QF8A 1ME8A 4OOZA 4ES4A 1TX2A 2NV2A 3EPNA 3V5OA 4PGLA 4C91A 1PTAA 3M43A 4LS0A 5AECA 4KBXA 3C2YA 2OGYA 4KEMA 4LVFA 1M04A 4Z1AA 1K8ZA 3PPHA 5K7JA 1BXBA 3H4XA 2HS6A 3KWSA 5F2MA 4IMFA 5KZEA 2RJHA 3LEPA 3WJZA 4MSSA 1TQXA 1I60A 5JIPA 1R2SA 3S42A 1EDTA 5AHEA 4D6DA 5F4WA 2E5DA 3DECA 1DHKA 4CNPA 1EYEA 1X1OA 3M4HA 2BHZA 2WC4A 4EACA 1X38A 4JTIA 3E0WA 3VOGA 3TWAA 1Y5VA 2J8TA 4RLIA 3LMYA 2PWVA 3FA5A 3UPBA 3PS7A 1W1VA 3VIHA 3RO6A 2VOTA 4ZOEA 2X1TA 4KESA 2BG5A 3T42A 4BEUA 2E40A 1UH3A 3E0IA 3UWYA 1BSIA 5A8PA 4PMZA 3DESA 2VDHA 4JZ5A 2PDBA 3MU7A 1C7SA 3WQ6A 2ACSA 2ZUVA 2BVTA 1R9XA 3L2IA 3MI2A 1KFKA 2GDVA 2EQDA 1FHUA 1BYCA 3R8GA 4V33A 5FJPA 2DH3A 1XX1A 4O0KA 3TCEA 4K8HA 4PMXA 1IE7C 3QYQA 3RLUA 2YCLA 3SURA 3NPVA 1MW3A 4OGZA 1ZFJA 3WNNA 2CZEA 1Y5WA 3G6LA 3S5OA 3CH9A 1IQ8A 2HV5A 4J35A 1SJCA 3TQ0A 2X2YA 3H4WA 3KS5A 4AIOA 2WHKA 5D37A 5AVHA 4K7YA 2H8XA 4PTMA 3U7BA 3P8JA 3MPGA 4LUSB 4A2RA 3HQ1A 3T78A 4HPXA 4HYVA 2G3IA 3NQ2A 5CZSA 4L64A 4JY8A 3EOLA 3W4RA 3CL7A 4NQ1A 4KERA 5LIXX 3TWBA 2X30A 1FXQA 1XPGA 3WLSA 1K7EA 2Q71A 3N2OA 3TOPA 2DV0A 2HTMA 3ZR6A 3P3BA 4XAPA 2YB4A 3GFYA 5EMUA 2CBVA 2EG8A 4L4OA 1ZJAA 2PTDA 3WF2A 2TYSA 3MWCA 1GEQA 3W7QA 3UQNA 4CNTA 2FH6A 3G0UA 3NQFA 4F40A 3W7JA 1XS2A 2ZZ2A 1KFEA 4K38A 1XGZA 1E3XA 3WQOA 2PDYA 3GIPA 2WVUA 2GVGA 4KF1A 2XGBA 1VCVA 3PPGA 2FPYA 4ZQNA 4WKFA 4Q3MA 3QSRA 4R88A 2WMHA 4MWAC 4P8XA 3G8EA 3L0GA 4TVCA 4WX2A 1ZUAX 1KFJA 2CETA 4H2CA 1A0CA 2PDQA 4HK5A 2XH4A 3ZOAA 3GDMA 4XZNX 4YTUA 4LX4A 3TTOA 4QJ1A 3QR1A 2EPMX 2VQTA 2RH9A 1I2NA 5KZDA 3S2MA 4HTYA 3HGJA 4L61A 2Z28A 1B3VA 3IJDA 3EX6A 1IGSA 4GQGA 4PE8A 1FWIC 2XHYA 5CC3A 1YEYA 3EB3A 3FEMA 2ACRA 4IGHA 2J8FA 3PPFA 4YPJA 4I9MA 2AAMA 3SUUA 1GQJA 1KC7A 2DSZA 2JIEA 1DKWA 1BFNA 3C8NA 1U2YA 1OCJA 1OCNA 1XD0A 4ZQCA 4UTHA 3CM4A 4AVOA 1MEHA 3VOHA 1XLCA 3N04A 4N42A 3B03A 1REQB 1YW1A 2YYTA 3I3DA 2PTXA 4PFMA 1XH1A 1XIEA 1ZJBA 4A3HA 3OG2A 3ZSSA 3H55A 3PUEA 2WJFA 2R94A 3PBMA 1QI5A 2G95A 1V0NA 4DPQA 4JNMA 4WLCA 1QBAA 2QEZA 4OV9A 3CJPA 3RFAA 3SZ8A 1PEZA 2QCCA 4MWAE 2NVCA 2PRLA 1QW7A 1XLIA 1E6PA 4ZFCA 5I2UA 2O0TA 2X09A 3RMEA 4DI8A 3MI3A 3SRHA 2RKXA 2MUCA 4JL1A 3T0TA 3SSJA 3DUGA 1VJZA 1ECQA 1XUUA 4DWDA 3WUGA 3AHVA 3LGEA 5LNWA 3NGJA 3LPFA 1TSIA 5GQBA 4UMBA 5FJIA 4A05A 4MY1A 1RALA 1XSJA 5JBFA 5TBOA 2TODA 3GH5A 2GJLA 2DEPA 3R0UA 2QJNA 3IJ8A 4IIEA 2CPUA 3LGDA 3ID7A 5BRBA 4DJDC 3APTA 5D02A 1MYRA 1FP8A 4LVDA 4JIIX 2R8WA 5CGTA 5DO8A 1E70M 3C8FA 4D72A 4J28A 3K1DA 3BH4A 2Z1BA 1NQ6A 3TTSA 3NQGA 4OVXA 2G96A 3Q2DA 4P8VA 4CU8A 3UJFA 3IK4A 2YCIX 3LCGA 2JIWA 1BF6A 1TTJA 4JIPA 3OBKA 3UJEA 3IV3A 3SN0A 3SEPA 1CPUA 3OBEA 5A6JA 1W3JA 3R89A 1G4TA 2ZDSA 3I68A 2GQ8A 4EPBC 1Q2SA 3TZFA 4YCOA 1J0ZA 4IP7A 2XWDA 4OFCA 1R2TA 3SUTA 1XDJA 1TV8A 1MEWA 4UFMA 4J9JA 4UFLA 4IOTA 2X0HA 3ES8A 4JPGA 3HOJA 2QDEA 5BNKA 2OLAA 4DWSA 1OD8A 4HCHA 5F2IA 4WSJA 4UXDA 4XUGA 1ICQA 1EJVC 4M6PA 4K39A 3MHUA 4Q4MA 1WZKA 4KGLA 2PP0A 4KW2A 4MWAD 3W7MA 2QV5A 4HPGA 3WLNA 2PWFA 1LRTA 3CQIA 3MKVA 3OVGA 2WO5A 4QP0A 3H22A 5IM51 3ZLGA 2PLMA 3S9IA 1VZWA 3HG4A 3VKDA 2BGSA 1PL9A 2I1OA 4QDWA 3IRDA 3H70A 3P7YA 3VIPA 1XYFA 3IVTA 1UHVA 3WSUA 5C2XA 1CB2A 1MSSA 4YHEA 5EKYA 3V36A 2RDUA 2VOMA 4FZIA 2QS8A 9CGTA 3THUA 2QCFA 3VUSA 3MDWA 3H2EA 3LLDA 3C5QA 3WLQA 2AL2B 3ANVA 3RILA 3NUKA 4XZBA 3BLKA 5DX7A 4LF1A 3VGDA 3GR7A 1W32A 1I2OA 5I3DA 2Z29A 4QLLA 1R3WA 1D3HA 3URNA 2XH7A 3M07A 4IQJA 3OQEA 3W1LA 4DB7A 3E49A 2CLFA 3I4EA 4MHBA 4TVDA 2JGQA 1K8XA 1V6YA 4RDVA 3T2OA 5HBFA 3THQA 2VENA 3HURA 1GYMA 2PMQA 4FXRA 3QV9A 2CYGA 3FXGA 2XWEA 4NZ5A 1EPXA 3EOEA 3MP3A 3SI9A 3OEXA 1MQPA 3I6RA 1LUCB 4FXSA 4Z1BA 4XD5A 4OJYA 2CBUA 4GIYA 2WMKA 1FA2A 5AVNA 3SCSA 3VKCA 1H61A 1G94A 3GG1A 2BMBA 2CHOA 3WELA 3CEUA 1LL4A 1RQEA 1JI1A 4FNTA 4IP4A 3EOOA 1Q6GA 1TJRA 3A12A 1GVIA 2NQ9A 3B05A 1N82A 3L4WA 5BMWA 3P5YA 4RE2A 3IS4A 2OEMA 2V2HA 3REQA 1GOIA 2P76A 3CO8A 2V6AA 4GI6A 2ABBA 2PWHA 1I2QA 3C56A 1TJ1A 3II1A 2HWGA 2HNHA 4QG9A 3VIOA 5H91A 1DJYA 2X1IA 3NQCA 4UTWC 3NZRA 1HF6A 1RQBA 1SMDA 1PCKA 1UP0A 1VFMA 1K70A 4UFIA 4GIAA 2J25A 4I6VA 3DOPA 4KCUA 1CGWA 4WJEA 1UW9A 2Y62A 4FXFA 4P8WA 1ONRA 4BFAA 3OA3A 2O55A 1ZP3A 3WK0A 3A3XA 3UY8A 4UQEA 4GWEA 1MRQA 2PDNA 2VFHA 2ZXAA 1XSIA 3W2UA 1S2TA 1SW7A 2A6LA 3LHVA 4FIQA 2DJXA 2F2HA 1IIHA 1RCQA 3QTGA 4WXZA 3DAQA 1MEIA 4R33A 3C86A 1PTDA 2QPXA 1ZTVA 3P8IA 3L7RA 1HL9A 3O1NA 2PTZA 3MMUA 4URIA 2E9BA 1LUCA 4GBUA 4L6DA 1UKTA 3QGVA 4L6OA 3K2GA 4O13A 5FEZA 5HQLA 4O17A 4JTGA 4QSFA 2P0OA 2Z1WA 1YE4A 3UT0A 3TONA 4JTQA 4J40A 3VMPA 2B0MA 4B5SA 2INEA 5LHFA 3AXKA 1MDRA 4JX4A 4PUDA 3QY6A 2POZA 4Q8VA 3EMZA 1VAHA 2D69A 1JPDX 1TV4A 3VNJA 4BJHA 4PRRA 2V82A 1TRDA 4RJEA 1EGMA 1UMYA 3M5YA 3KVKA 4Q4SA 3UA4A 1H1NA 3ATZA 4X9YA 4QG8A 2JBMA 2GOUA 5DCBA 3GC4A 3QVQA 3CAQA 4FPSA 4CKQA 3O7UA 3TSMA 4XV0A 1PJ9A 1V79A 1MRAA 1PKYA 4DNMA 2EG7A 1JIBA 2GPTA 4IGNA 4AIUA 3LV5A 4RXGA 7ODCA 3SY8A 2OEKA 1IHIA 4A8IA 3WFLA 5BW6A 3WH9A 3DGRA 6ALDA 4AWSA 1EP3A 1UD6A 3FEQA 2D20A 4RNIA 1J96A 4YVVA 3CXOA 4LCQA 2DUZA 2WXDM 3C2RA 2C15A 1TPC1 1KM0A 3O6AA 4OBSA 3WQGA 1G9HA 3PZMA 3H2OA 1ZB5A 3PY2A 4GUIA 1S5TA 4QG6A 4L9XA 1W1PA 3NIYA 1OK6A 4H00A 4NASA 4IFKB 3NQVA 3EX2A 4G8TA 1VPQA 3BJSA 2BZNA 5DELA 3RRAA 1EB3A 4A8NA 3PB0A 1UYQA 2GVLA 4NU7A 1XLDA 4D8AA 3WQCA 1YNPA 1DJHA 4DXVA 1Q13A 4ATLA 3TN5A 3U2OA 5TQLA 3H53A 2C14A 3W38A 1A50A 3UPWA 5AZ0A 3TNBA 4K37A 2O9TA 5D32A 2XN0A 1KKRA 1OY0A 1RZMA 4O0QA 5EYWA 4Q33A 4QDPA 1S5WA 8XIAA 2ZUTA 1J8VA 3ENLA 4LNCA 2G3MA 3ZLFA 2QCDB 5G5IA 3PB2A 3TROA 1YRRA 5I07A 1CXEA 3N2TA 1F8MA 1XFCA 2Y4SA 1J0HA 1UMLA 3S2LA 5AOUA 3UF9A 2X8RA 3W7IA 2X41A 5E6ZA 4NY2A 2D1ZA 5KTLA 3ARQA 2GYIA 3ARVA 1MNZA 1SUXA 1UR8A 4NT0A 3S5YA 4C60A 1IV8A 1IEWA 5K4ZA 2FTWA 3LX9A 4GNVA 4GX8A 6TIMA 4P7QA 3B40A 2PWGA 3STPA 4YXGA 4UBPC 1KV5A 1N8IA 1H7NA 3NL5A 4HYWA 4AX6A 3N15A 2ZXQA 2ISSA 4WY0F 4G1KA 3EWZA 1IT8A 4ZOAA 4K68A 4F0KA 4Q4KA 2UY4A 3DFYA 3GU2A 1TTPA 5CPTA 4EF9A 3VI2A 1TZ7A 3G18A 1KGXA 4LW7A 4LC6A 1TWIA 1SGJA 4QITA 4QS5A 2WKGA 3GW3A 4IFRA 1KRBC 5AC6A 4ZXOA 3OHIA 4KKXA 2C71A 3I3EA 4JQ3A 1XBZA 2F6XA 2VC5A 4GRSA 3QC3A 3CBWA 3JZUA 4JHMA 4N7QA 4Z17A 4FOJA 2HBVA 3EOSA 2EO7A 1BG4A 2QKFA 2Z2AA 4C6JA 2XSXA 3THCA 3N4AA 1Q6QA 2CLIA 1IT0A 5E9AA 4J2PA 2VNCA 3AYRA 5FD0A 2KZHA 4PBGA 3VOFA 3WJXA 1OB0A 1ZAIA 3WZ0E 3C52A 2QHAA 3MA8A 1K8CA 4XO6A 2ZDRA 1O5KA 2YA2A 1N55A 3W72A 4LUIA 3VGEA 1O68A 1KM4A 3AXHA 3AXXA 4WDTA 1E56A 1FCBA 2CERA 3ZJ7A 4JCMA 3AHYA 2XYLA 3A4XA 3A3HA 1QI0A 3TW7A 3U5YA 4HYRA 1LTDA 4CU7A 1LBFA 4HU4A 2DZSA 3QF0A 3BGGA 3WMCA 5BWFA 3GDRA 1VPYA 3VFCA 1DWJM 1GVQA 2ZZ7A 2BFGA 5AYIA 1F3EA 1UD3A 3T05A 3H2AA 2W63A 1B31A 2DORA 1DOSA 1XIMA 1R3TA 2FGZA 3FNDA 4EXBA 2EPHA 5FL0A 2DT0A 1T99A 1YE6A 1K6WA 3RG6A 1OG6A 3N18A 1WDSA 3OLIA 4I5XA 3GSMA 4UR9A 5IXEA 3CO4A 4CQDA 4FA3A 2PDHA 5KSWA 2Y5SA 2PEVA 4MY9A 3AU6A 3BLEA 3TZNA 4R7JA 1MVYA 2PZ0A 2WVSA 4M1RA 3ALGA 1XUZA 3ARXA 3SQMA 1FCVA 4JTCA 1KM3A 1TPB1 3ARZA 1GONA 4CD5A 1UPPA 5CSSA 1RLDA 2ZRVA 1TWDA 1PUDA 3MVIA 3NL2A 3NPXA 2XFYA 5BXTA 5A6MA 1GHSA 2ZA2A 5D4YA 3K8MA 3H12A 3TIMA 3LCXA 5CLWA 2HE5A 3PBYA 3FIGA 4WQ6A 2RJGA 3LXAA 4S3JA 1Q5MA 4PN2A 2ZC8A 5D2TA 4O28A 2CZDA 4NJKA 2DPEA 3W76A 4F8XA 2HK0A 2E6AA 3FGCB 3B0YA 3NPWA 5BWAA 3REQB 1ELSA 3S6TA 2QIWA 1HG3A 5A8MA 2LLEA 3LTPA 4E5TA 2H8ZA 4FF5A 2OX4A 4GY7A 2PODA 4H04A 3PWGA 3AUJA 5HULA 4NUWA 1REQA 1XDLA 3PSVA 3QSTA 4L9YA 3GBDA 2OKTA 2VT0A 4LB4A 3GU1A 1RP9A 3PPCA 1Q66A 3FJ6A 4DJDD 2B7OA 3M9YA 4XZMX 2C1IA 2X7WA 3S0CA 4BHYA 2PGRA 4ZB0A 4YJ5A 2INFA 1TUXA 3L67A 1XLAA 1RH9A 4XAFA 1CENA 2VUNA 3G0XA 1KBJA 2OQHA 4MB5A 3K4DA 1E1CB 2RAGA 5DN1A 5A8GA 2GVYA 4TOQA 1C93A 1T5AA 4TO8A 1Z3NA 1XH2A 3FHAA 2YL8A 3WDIA 1HVXA 1Z9AA 4PUWA 4JQAA 2UWFA 3QV7A 1WE5A 1QO2A 3CZJA 5FSEC 4PYSA 1PO9A 2ISDA 1A5LC 2IQTA 1K77A 2JEQA 3G1FA 2YPIA 1LLWA 1OIFA 3VILA 4H8UA 4YYFA 1DJQA 3TA6A 4ADSA 1B1YA 1ONWA 2YDAA 2GVEA 3WDJA 3O8AA 3SY1A 1FWTA 4J5NA 3PJTA 3VDBA 2O4MA 2GGHA 2WZIA 3JU2A 3VCRA 2XH0A 3NZ1A 3P60A 3URQA 3O6DA 4GOAA 3QW4B 1A53A 5E1QA 1J0JA 3GVRA 4UZUA 3EEGA 4JQ4A 2DQXA 2WMIB 1PS9A 3TYAA 4G6CA 1WKYA 3EXSA 3QZ6A 4HA1A 4GE8A 2QQ6A 2GUUA 1HTIA 3GHUA 3ZSTA 1E0UA 3BLLA 4MDOA 3WBEA 5FOOA 4CCCA 3W1NA 3K8KA 1BXNA 1C7TA 3WD3A 3GS6A 4DZHA 2DW7A 1M03A 3W74A 5K2ZA 4MIMA 4S2BA 4ZEPA 3T0AA 4JDBA 3KDNA 1OT2A 3B8SA 4C6KA 2QDHA 3EPMA 3AZRA 3GHSA 2VKZG 4GUFA 4XIAA 2YBUA 1JAEA 4I6KA 2XZ7A 4QS6A 1EF2A 3FVMA 2OOFA 4ROQA 3W1UA 4WXYA 3W7RA 5I09A 1NDVA 2FDSA 4XZWA 1G1YA 1I2PA 3TLQA 1JNEA 1F3TA 2ZE0A 5H8UA 5EA9A 1ZBVA 1E43A 1S5NA 4UQ9A 3EEZA 5K9DA 2FKPA 1ZJHA 2Z00A 2PC4A 5BRQA 2BVWA 1A5AA 2CKSA 3TJLA 4IICA 3V1HA 4TR9A 2RGLA 4FMVA 1ZCOA 3KVMA 1AJ2A 3E0LA 3HB9A 3STFA 4PTWA 5BOOA 1GOXA 5E0CA 1Q6FA 2OWCA 1R5YA 2D3LA 1XG4A 3ZLHA 3DDMA 1LWIA 3GE7A 3B0PA 2PP3A 2BNJA 3EBVA 2ZWYA 1I6NA 1CYGA 3PUDA 4HN4A 4XZHA 3E2QA 3JS3A 1H5YA 1FWCC 2W27A 3PBUA 4C1KA 5I23A 2GJRA 1ZCCA 4K7VA 4XO7A 4EVZA 3G8RA 1YADA 1JXKA 2Z7KA 2CWNA 2CBIA 2QCDA 4O52A 1US3A 2V3EA 4L4LA 3HPSA 2JKPA 2AQWA 1M68A 3RK8A 5GPRA 1DQUA 4JXCA 2Z6JA 2QDDA 2YDSA 3WH5A 1E4LA 1X7FA 4U33A 1HJWA 1QHOA 4POCA 4GCAA 1BWKA 2WMIA 2WSQA 4B90A 5REQB 5G2WA 1XLEA 1H49A 3LCLA 1JVNA 2R1PA 1XCXA 4WHBA 5CAKA 4H3DA 2HCVA 3TN4A 4E4FA 2FVMA 9RUBA 1FH8A 4DUXA 1GOWA 4MYAA 1V0LA 4AISA 1FHLA 3WUEA 4PCNA 1EIXA 3EA2A 1A0DA 1W17A 3S8HA 1JCXA 3A3WA 4IX2A 3GXNA 5DXXA 4FNSA 3CASA 3LSBA 3UZYA 3CIWA 3P62A 3IV8A 3TN3A 3CU2A 2NZLA 3SIMA 2RDTA 3DENA 2XIJA 3NQ6A 3WD2A 5EBAA 4D6IA 1P6BA 3WLPA 4TX9A 1ZNNA 3O9NA 2BBFA 3BANA 1XRVA 4ZQRA 2ZA1A 3SM0A 5IOBA 9XIAA 2PTWA 3GDTA 1R87A 1W9PA 1QNOA 6PTDA 3CUFA 2I57A 1K4HA 3V75A 4ZB2A 1KCZA 2QAPA 3E02A 3S2JA 3CB3A 1MUMA 3T07A 1FKWA 5CG7A 3WNOA 2E6FA 4JTLA 1AH3A 3GDLA 2W66A 1MZHA 2P1FA 3RM9A 1R38A 4S23A 2QAFA 2V68A 3U0HA 3VO0A 1D7FA 2A1YA 4ZVJA 1ESWA 1G6CA 5EMYA 5C6MA 1KR1A 3WK1A 3NJ3A 2HQAA 3VX1A 3BJTA 1DJZA 2VHLA 2A3CA 4K1WA 1WX0A 2EJAA 1OFAA 5IDIA 5MHBA 2BXYA 1ECEA 1WBJA 3M0IA 3MANA 1PKLA 4ZSTA 3FXYA 3BO9A 3UWEA 1TPVA 1JJKA 3VGBA 1JQVA 2F38A 1O5RA 1UUOA 4S3CA 1JRCA 3ZQ9A 5LHEA 2IKHA 4RXFA 3KRUA 5EMMA 3BK0A 5CC5A 4I90A 1V8EA 3GW0A 5F2GA 4ZOCA 4BF7A 3W23A 4Q6JA 2PDUA 2E67A 1FWNA 1HKIA 1AVAA 4DBSA 1ZRQA 2V2CA 1NM9A 3KCJA 4QXIA 2DVTA 1OF6A 1R9YA 5AY7A 3QR3A 4O1FA 4H9MA 2ISWA 3KOZA 1J5TA 2B7PA 2HVOA 3NXFA 1KGUA 4LSBA 4O54A 4HD5A 1X39A 1XLJA 1LL7A 2I16A 4O1CA 3UNDA 2OYLA 6TAAA 3WFAA 3V5FA 2NSXA 1DE5A 2G8ZA 1XM3A 3B9NA 4H8VA 2QUVA 4ADUA 3WN6A 3KBVA 5AHFA 1MFUA 5HATA 4PR4A 1TZ9A 3AC0A 1NOUA 2YW3A 2NLIA 1B57A 3U6WA 4D1IA 1KBKA 1A47A 3VVGA 4H8NA 5DMYA 3VIJA 2F61A 3P2VA 4HNLA 4LC8A 2PWUA 3O0FA 1HNYA 5C7VA 1XSKA 4JEJA 3TSBA 3U57A 4DF0A 3VNMA 4C7DA 1H7PA 3RDKA 3ZJ6A 3UR7A 5I3JA 5EU9A 1V6XA 2HPIA 4Y9PA 1JAKA 4C6DA 4P2VA 2W67A 3IIVA 2KAUC 3HPXA 3GG7A 4JIEA 3ARWA 3TFXA 2NT1A 5JBDA 4TV5A 2GDQA 4F3HA 4RDYA 1KFWA 4QNWA 4JTJA 3KWXA 4JTDA 4J3UA 5FF3A 3DFNA 4AD0A 1TPFA 3GUWA 4NI3A 4GVIA 3F2DA 1TRIA 1CXFA 1Z48A 1ZAHA 4QEHA 1V51A 4EIVA 3NQBA 2TSYA 2PDKA 3TJXA 1SZNA 2IQ0A 1EQPA 2C1GA 3LNMA 2E9MA 3DXIA 5E0FA 4NIRA 1J6PA 3V0SA 1XLLA 1AQHA 4IH3A 4JY9A 4ZL1A 4NZJA 4C6PA 1BVZA 3H54A 3QHMA 3EWWA 3WIJA 1N8FA 2BGNE 4KCVA 3H7RA 3B06A 1XICA 4YHGA 2V5BA 3HG2A 1T8XA 3AWNA 9XIMA 3OZOA 1K9FA 3BG3A 1Z42A 2HZGA 4Y90A 4NZ4A 1BRLB 3HQPA 4NZ1A 3KLKA 4DJED 5FIPA 1LLOA 2OYMA 1P6WA 4CQBA 3H23A 1DWIM 1H7RA 4LRSA 4S1FA 3VC5A 4DEFA 1BKSA 2DVUA 3ITOA 1F07A 2Z26A 3OZPA 1PX8A 2BB0A 3SCUA 2I5QA 4OV4A 4LBRA 4OBRA 4RZ6A 3P14A 4YWSA 1WP6A 3LHZA 4B3LA 4DJFA 2YL6A 2W62A 1JUBA 1FFRA 4F0RA 4DXXA 3BZJA 3A4WA 2WNNA 3N6HA 3HBLA 1LG2A 3GLCA 2DIKA 5DEZA 1B9BA 2OO0A 3UR8A 3W26A 4TQTA 4B4FA 3PC0A 3JR2A 1V3HA 3PJWA 1JR1A 3PULA 3IIXA 3CZ8A 3VCNA 1D3CA 4CNSA 3E2VA 3QFWA 4FNRA 4AXKA 3VYLA 5LA1A 4A2SA 1YTDA 1W54A 3E74A 1R3VA 1RP8A 1TTIA 2GJXA 2RUSA 1JCLA 2PLJA 1O4UA 4O19A 5DCDA 4B9YA 3GAKA 1ICSA 3RHGA 3BOXA 3NPUA 1RPKA 5H6HA 3QPEA 3GB6A 2NV9A 3CQ0A 4HNTA 2YZ5A 2H3DA 5D03A 3GH7A 3BL3A 3TC3A 4WSHA 2FJKA 3UBPC 4R5EA 4W9TA 2D0GA 2V3FA 1FWRA 3W7DA 2O7SA 4L5ZA 1YBQA 3PSWA 1P5BA 3FAXA 4JOMA 3NOEA 1NJJA 3AIUA 1DHPA 4U31A 2AL1A 3B0VC 1YDYA 4W8AA 3MI6A 1W3NA 4CD4A 3K1GA 1XG3A 3N9RA 8A3HA 2BDQA 4MJ2A 2VEPA 3BXWA 4MB1A 2I7GA 3W53A 1MMFA 3UXAA 3W1RA 2QMKA 2X2GA 3CIVA 1NY1A 5E70A 3LLXA 3B9AA 1QVBA 5E9XA 4QJ4B 2WANA 3SCVA 4AVFA 3AHZA 4JR5A 2YIHA 4HZMA 2ZRWA 3VKAA 4X22A 1UA3A 5A6LA 4U3CA 1FCQA 2X7VA 1P7TA 1XBVA 2B31A 4LY8A 4B2DD 3BTNA 3JUGA 1ZHAA 1B4KA 3IJLA 3I6EA 1WBHA 2NX1A 4CD8A 1GJWA 8RUCA 1G7UA 1GVOA 4LFYA 2MNRA 1E9ZB 3L5AA 1VIZA 3CV2A 2GK1B 3TTYA 4FF7A 2FIQA 2WMFA 3CHCA 3SGUA 1QPQA 2OQYA 1K3UA 1A4LA 3AU2A 2HNEA 4NXSA 1BAGA 5HA7A 1LP6A 2BTMA 3IIPA 3B8DA 4ZB5A 1MI3A 3WEMA 1EEPA 3NYDA 2WLYA 1VFTA 4N6EA 5LIKX 2J79A 1GWJA 1TX0A 4ADTA 4DJEC 1E72M 4BK9A 3CMFA 3EWXA 2V38A 2H9AB 2C91A 3T55A 1GZJA 3PFRA 5RUBA 1JZ2A 1XRTA 3SECA 3TNOA 2GSEA 5I7GA 1HL2A 1WOBA 3TV8A 3SUWA 1CZ1A 1OGGA 2FZ8A 4ATWA 1C29A 4Y8EA 1UJQA 1C8YA 4QISA 1TPWA 3E38A 4H6EA 2ZTJA 4Z1YA 4HNUA 3SQLA 4LUYA 5D2XA 5AHMA 1W31A 1DJIA 2VD8A 1H63A 3E5BA 1FY6A 4O4WA 3ZWSA 5HWNA