3W73A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-129
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-129
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w73A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w73A01
3UZ5A 1KM0A 2GVLA 4LT9A 4IWWA 3W2MA 4RXFA 3B03A 3TJXA 2NXHA 3DKLA 5F2MA 2Q8LA 1FWNA 4JTKA 1GEQA 4UTLA 2FPVA 1TPB1 3S5OA 2JGQA 4R7JA 1YTKA 1OABA 3S0CA 2EPHA 3NQFA 4CQ9A 1AW1A 2V81A 1NEYA 3NEVA 3HPSA 1TTQA 4WJEA 5DY2A 3NGJA 4NX5A 3O06A 1YADA 2YDAA 4UFJA 1Z41A 3TC6A 1OF8A 4HT3A 3TE9A 2FLIA 1DVJA 3ZR4A 5F2LA 1H7WA 5H2ZA 3M16A 3W7DA 4LY8A 4M6VA 1ML1A 2E77A 1K7FA 3L0GA 4UTMA 4DBDA 3W3OA 3CHVA 4O57A 1WAUA 5CPMA 3N34A 3NQCA 3W07A 3KAOA 2O7QA 3ABRA 3I7RA 3HO8A 3NPWA 4L4LA 1VYRA 5AN7A 5FF3A 4JDYA 5G1YA 3HPXA 1SO3A 1LYXA 3PVFA 3P81A 4E2BA 4OE7A 1OYAA 2ZRZA 1YLVA 3R5EA 4MYAA 4JTSA 3FKRA 3C2VA 3M47A 1TO3A 4UR7A 1XBXA 2VFIA 3T7VA 4N6EA 1DQWA 1M5WA 1A53A 1W5OA 3LRLA 4LWWA 5IBXA 5LHFA 3OVQA 1O95A 3PSWA 3W83A 5I3GA 3NZ1A 4WQ6A 2YW4A 3C52A 4OU1A 2QCDA 4A2RA 4GUIA 4UTUA 4LW7A 1DKWA 4QIUA 3CLMA 4LVFA 2YPIA 4FO4A 3FS2A 3P80A 3HQ1A 3CU2A 3RMJA 4TIMA 2FQIA 2BSLA 5BW6A 5HNRA 3C2FA 3P62A 4DO5A 2W6RA 5AYYA 2FPYA 2J88A 2YFNA 1VC4A 3WK2A 4H3DA 4BI6A 1I2NA 3NPVA 1P0KA 1YXCA 1SU5A 1GG0A 2B4GA 3NG3A 3G24A 3B06A 1RZMA 2ZBTA 3MHGA 4OQVA 3O8AA 4UMAA 4GJ1A 3OA3A 5LNWA 1ZNNA 1O5XA 4N4PA 4CCDA 3C0JA 4HKPA 4WX2A 1ZFJA 1DV7A 3WJXA 2P1FA 4E0CA 3QYQA 3U8GA 1W5QA 1ICSA 3GDRA 3NA8A 6TIMA 5AB3A 4LV4A 5AFDA 4JYDA 3C3NA 2ZYFA 1ME9A 3G0UA 5LNVA 1C9DA 3G0XA 1H62A 3G18A 4IOTA 1EB3A 3VFLA 4TO8A 3CEPA 1EUAA 2R14A 4M5PA 3EEGA 4N9CA 3CWOX 3NVTA 5U4NA 1KM2A 3M5ZA 1TJPA 1I4NA 1J5TA 3CEUA 4OBTA 5K9CA 5D09A 4TR9A 1JVNA 3P82A 5D38A 2NZLA 5GVJA 1NFBA 3W9ZA 4XZ9A 2E5DA 5HMSA 3W7JA 3MW7A 4LS0A 2DZVA 2VEMA 3T78A 1HL2A 3P8IA 3BG9A 1TTJA 3PS7A 5FESA 3OVPA 3S5ZA 1QPOA 4QQ3A 2PC4A 3UXDA 5FEWA 3GK0A 4NJKA 3O15A 4JR5A 4IMEA 4DO4A 3W72A 1KV8A 5LHEA 3GVGA 5G5IA 2VELA 1OF6A 2CLLA 4O28A 2CLEA 1XI3A 2J9XA 4O52A 1WDWA 1KBIA 3FLUA 3LCLA 4RLIA 1EP3A 1SO4A 3DAQA 2QUVA 5KITA 3IRDA 1OVDA 2Q8ZA 1I2PA 1T99A 3PBUA 2Y63A 4O0KA 4A22A 1S3HA 4LTSA 4JTJA 4BF9A 3P5ZA 4UMBA 4MYXA 1FX6A 1WX0A 3HG2A 5DCEA 2Q3RA 4CCEA 4YXGA 4O53A 3NQGA 3RLVA 1F6PA 3GXNA 3HGOA 5LNSA 1MEWA 3EWWA 4IX2A 3L66A 3SIZA 2YX0A 1JUKA 3W73A 3I7QA 4HN4A 3W1AA 3BO9A 1NVMA 1ZY9A 4NNAA 2QCEA 1LTDA 2EAWA 3IVSA 1VCVA 2QAFA 3DGRA 2VEIA 1KFEA 3MMTA 3W7KA 3VE9A 1W1ZA 3EXTA 4HNVA 3SY5A 3TV8A 4Z0SA 3V75A 1ONRA 2ISSA 3IIPA 3W84A 5BMXA 1RQEA 3W7NA 4K8HA 4RZ4A 2CU0A 1HFBA 1SZFA 1SUXA 3LXAA 1IXQA 5DXYA 4M6QA 5K4ZA 3G3DA 3M5VA 4NJGA 1H63A 1SZGA 1VR6A 3LCGA 5D03A 5U7SA 3HPZA 2ZA3A 3HB9A 3MI3A 3EWXA 2DJLA 1R47A 2FB2A 3N2MA 2J24A 3E96A 2ZRVA 3GIYA 4HSNA 4O14A 1H1YA 3KVLA 3USBA 1P5BA 3VE7A 3HG4A 2E6DA 4LS1A 1HUVA 2IQTA 3ELFA 3DFQA 5BOOA 2CZDA 3LERA 5FF2A 3HMJG 3G0SA 3GZ3A 2C13A 3MYPA 4NJHA 5BMWA 1R2RA 3EKZA 3C56A 4O1CA 1Z44A 3T55A 2J6XA 3QMSA 1LOQA 4XBKA 3A21A 1A5AA 4XTIA 5FF4A 2DORA 1G4PA 1RPXA 4AAJA 5HWJA 5AHFA 2UV8G 1W0MA 2TRSA 3VI2A 2ZTJA 4KWVA 3BLIA 3W76A 1W56A 4O13A 4JTIA 4ZZ9A 3W1PA 3L65A 2Y7FA 4BWLC 3KVJA 4UCGA 1TPEA 4U4MA 3W7CA 3W1UA 3GYEA 1TPUA 2QJGA 1SFLA 3BGGA 3L9CA 5DELA 3TXVA 4PODA 1JRCA 5KINA 1FDZA 3C2EA 1EUNA 3U2OA 3N9RA 1TB3A 1FWSA 1I2QA 1TREA 5CPNA 5G2IA 1GVSA 3R12A 1FDYA 1V5XA 3EX3A 4PL1A 1QNVA 4ML9A 3MJYA 3UPWA 2YGYA 1EPXA 3W87A 4LVGA 4DXVA 5KZDA 4CNNA 3TU9A 1JCMP 3FYOA 1LRTA 1RQBA 2LLEA 5EKYA 3UXAA 3M5YA 4BI7A 4JTLA 2QCGA 1TRIA 1N55A 4DF2A 1BEUA 3DH7A 4AHPA 3B0UX 5CZJA 3WJSA 4JXCA 3FEMA 1ZHAA 3NM3A 3PB2A 5I3FA 5F2GA 3G1FA 5ABTA 5F4SA 4JIPA 1SSGA 3EX4A 1TQJA 5CGQA 2Z1BA 2QUUA 1VYSX 2ZZ5A 4MJZA 1VJIA 5CZSA 2NXIA 3LCFA 1IIHA 4R53A 4JTEA 3P74A 1XFBA 3QFEA 4FB7A 4JD4A 3GX9A 1TPFA 1VCFA 4AHOA 5AC7A 1MSSA 3N9SA 4AF0A 4AWUA 2X1SA 2ZCGA 4QAIA 3DHFA 1WYIA 5I3KA 1JJKA 1MXSA 3A9IA 3DBPA 1LRNA 4AF0B 5C6MA 4UXDA 1TJRA 3O6YX 2QDHA 3NL5A 4LUJA 4MIMA 3UZJA 5D05A 3AO0A 3ABQA 2V30A 2ISWA 4JX5A 1KV5A 3M6YA 1G67A 4AWSA 4N2YA 1C29A 4LC8A 5AHNA 2VEKA 4XQ6A 3ATZA 1KLZA 4FNQA 2ZZ4A 3TW6A 5F4XA 1TQXA 1JCNA 1OG0A 4JS3A 2NX3A 3CC1A 3DFTA 3QPYA 2Y89A 4Y96A 2JBMA 3PBVA 4TMCA 1F73A 4A21A 3N73A 2WNNA 2BX7A 3GDTA 3BK0A 3DFPA 2NX1A 1H7RA 1QO5A 3TX9A 4ORMA 4DF1A 2ZA1A 1O94A 4BFAA 4N02A 4HPXA 4M7TA 4ZQPA 2C18A 2X30A 4ORIA 2E5CA 3F1QA 3PWAA 3BG3A 3IEBA 4UTWC 4UFMA 4PTNA 2CFFA 2C16A 3GDKA 1BKSA 4NX0A 3STEA 4OV4A 4Z1CA 4S1FA 3LI0A 3DENA 1J2WA 1TPC1 1ZAHA 4PH6A 3S1WA 5D37A 3HOJA 3STFA 1FQ0A 3BVJA 4DEFA 2XFWA 2P10A 3NNTA 3GKFA 3L68A 2GJNA 5A5WA 3BW2A 3CTLA 3PB0A 3PULA 4H4IA 3KXQA 4MY1A 4OGZA 4Q4KA 3O63A 4O19A 4O4VA 2OCZA 4Z08A 1K02A 3W2JA 4ADSA 2VEPA 4FX7A 5D2YA 3KRUA 5DBTA 3I7SA 1OX4A 4R34A 2ZFAA 2B7NA 3NQDA 1WA3A 2X1TA 3M9YA 3TXZA 4ZQOA 4HNNA 3L5AA 1OX4B 3ATYA 4XTDA 3ZS4A 4JY8A 4O16A 2X16A 1SO5A 4QISA 1R30A 2E6AA 1TPWA 3W1TA 1G7UA 5A8GA 3TKFA 1JCYA 1EP2A 2G5WA 1KFKA 1SSDA 2YW3A 3B8DA 4LV9A 5FI8A 3W2NA 3IGXA 1PV8A 2O7SA 4WOZA 1UASA 1LBLA 1AK5A 3UD6A 4YLWA 4UC5A 4S2BA 1Q6OA 1F74A 1V7YA 1KM1A 4O18A 1JULA 5FF0A 1SZEA 1ZCOA 1PVNA 4TMBA 3S1UA 4HIBA 1TV5A 3S5YA 3TROA 4IGHA 4WXYA 2OT0A 3W1LA 5LNRA 1YTEA 1VHNA 2HS8A 4MPQA 3G1DA 2VFGA 1JQXA 2G96A 3W23A 5J5DA 3G1HA 4KFOA 3G1YA 2ABAA 1J4EA 5EMUA 3C2RA 4JTUA 3SGZA 4IMGA 3VNDA 3OIXA 1ME7A 4JTFA 2DZSA 3TMQA 4E38A 1QPQA 3FIGA 1H50A 1H61A 1JCXA 4AHQA 2ZTKA 3M0ZA 1Q6RA 1W5NA 3LV6A 4NXSA 1X8FA 1QWGA 5EY5A 1EWEA 1UJPA 3IVTA 5K9DA 4RXGA 1SFJA 2QCDB 2E5BA 5LZLA 1HG3A 1HO1A 3EX2A 2WPBA 2CW6A 3M7WA 2J27A 1KFLA 1P1XA 1W8SA 1UUOA 4WOQA 4ADUA 4BWLA 3B05A 5C55A 3W7HA 3UWZA 4N9EA 1KM6A 1KFJA 2QDGA 5HINA 4WD0A 1ME8A 4KFPA 3E49A 4TX9A 3YPIA 1ICPA 1M7OA 1W37A 4HPJA 4O1DA 2ZZ2A 1D9EA 4ZQMA 5E93A 1ICQA 1B9BA 2QJIA 1XCFA 1FDJA 1VH7A 1X1OA 3PBWA 1QO2A 5HWNA 3CIWA 1OFDA 1A5SA 3T44A 1TPH1 2PCQA 3ABSA 1P4CA 2CLOA 2WO5A 2FPTA 4OV9A 1ZJIA 4WZHA 4RCXA 4CQAA 5E0KA 2C19A 2V2CA 5LGZA 2V9DA 1KM3A 4NNBA 1QMLA 2RKXA 2TSYA 3BLEA 4GUHA 4NT0A 4NUWA 3QC3A 4M7SA 3NPXA 2VKZG 4O0ZA 3LHWA 1Q6QA 4NQ1A 4PEKA 3LHZA 1JQVA 1OFBA 1UBSA 2DZUA 5AHLA 4DQWA 1VCGA 3ABOA 4QSHA 1R2SA 1KA9F 4FNUA 1YDVA 4UNLA 4NZFA 2B7QA 4UTJA 3I6RA 3NOEA 2Y88A 2H8XA 1LLWA 3M41A 5L6UA 1FCUA 3SR7A 4CNOA 2WJZA 3M44A 4ZMGA 1X1ZA 4JDBA 4G1KA 2VC6A 5E1QA 3HIJA 5KZEA 2CLKA 5CSRA 1GQNA 2GQAA 3S5NA 3GDLA 3HG5A 3CPRA 3IIZA 3WJZA 3KFTA 1DBTA 4EIVA 5IM51 3NQ7A 5CSSA 3UWUA 4B5NA 2ZA2A 2WNQA 2X1RA 3UPBA 3W71A 1ZALA 1Q6LA 1WXJA 3ZWSA 3G1XA 3W22A 2RDTA 2QUTA 4JTGA 4CQ8A 3CIXA 1H60A 1SO6A 1WBHA 1F2JA 2YCEA 2A7RA 2Z0IA 1GYLA 4R33A 2NLIA 4YMZA 1YXYA 1PHQA 2QEZA 4O1BA 3MBDA 1RR2A 1OFQA 1D3HA 3TSBA 3C6CA 1C8VA 3W7RA 2VFDA 4LC6A 2QF7A 1VHCA 1O4UA 1TV8A 4DBEA 1XDMA 2ALDA 4UIOA 3D0CA 4KKXA 3WJWA 1RD5A 3W7LA 5AC8A 4I7UA 4NXKA 1RV8A 2NV1A 2ISVA 4POCA 1WBJA 4NVTA 3EWZA 8TIMA 3LV5A 3NPUA 4Y8FA 1W5MA 3MBFA 3CM4A 4KWWA 3W85A 3TH6A 1FWWA 1SW7A 1AW2A 2QAPA 5AYZA 2CLFA 1OFAA 3S1VA 1PCWA 4FNRA 3KVMA 3UWYA 3G1VA 4MOZA 1IXNA 3GKAA 1OFRA 2KZHA 1OK4A 1Q3NA 3O16A 4UTWA 1TSIA 4ICNA 4RR4A 3M1ZA 4UFKA 3NDOA 1XDLA 1X6UA 5DCBA 3W1NA 4HHPA 3W74A 1B4KA 1Z42A 1K8YA 2YYUA 3LM7A 3THAA 3N3MA 3OG3A 3O05A 3QQ0A 4FIQA 5TIMA 2QR6A 1VYPX 5CZ0A 3WK1A 3DZ1A 5FEZA 1YPIA 1OK6A 1WQ5A 4EF9A 4Z0JA 1AL8A 5EL1A 4YL2A 3GXPA 2ZRUA 5T26A 3QH2A 4IUOA 3PAJA 4WY0F 1G4SA 1S5TA 4OT7A 1EA0A 3E02A 1ZENA 1LROA 3FA5A 2I1OA 1OX5A 3FJ6A 3S6DA 1NAL1 5BRBA 2A21A 4PL2A 1FCQA 2HMCA 3O1NA 2ZRYA 4JEQA 3KRSA 4GRSA 4IMFA 3UNDA 3R2GA 4QNEA 3NQVA 1PE1A 3L5MA 3STCA 2WSQA 1SR9A 4L4MA 2AGKA 2JKEA 3P84A 2AQWA 1CW2A 3MUXA 5AHEA 3SW6A 3F4WA 3OEXA 3F4NA 4XWUA 3M5XA 4NU7A 3P7YA 4IXXA 1FXQA 4K7YA 3IVUA 4UFIA 3SGUA 4X2RA 2H90A 5FEPA 2VXNA 1JUBA 1A50A 3W1MA 2H3DA 4O15A 1GVQA 4MUZA 3PSVA 3DXIA 3QSRA 2ZRXA 3O6DA 3NAVA 5AHMA 5D04C 3S42A 1QOQA 2E09A 5KSWA 4I7WA 1P0NA 5KMYA 3E12A 2QCCA 4FX8A 2Y7EA 1YXDA 3HBLA 3UQNA 2DZPA 5AC6A 4JN6A 4S2CA 4N9DA 2QCMA 1EWDA 1TTIA 3VKJA 1KW1A 4LRSA 1PS9A 1GOXA 1TIMA 5D02A 1TRDA 2JKAA 1ZAJA 2CZFA 1XC4A 3RK8A 1JUEA 2NX9A 3RNDA 5KZMA 1ALDA 1QCWA 2HSAA 1RVGA 1H1ZA 3UWQA 5D30A 1LDCA 1BWKA 2A7NA 3NQEA 2P0OA 1N8FA 2NUXA 2Y7GA 4UUIA 5SWUA 3W70A 4NJJA 2FIQA 2EGZA 4WXZA 4XBSA 4IPJA 1Q45A 1SPQA 4IX0A 1L2UA 3W7GA 3RU6A 4UMCA 4LVBA 3EWYA 3IIOA 4GNJA 2W79A 3NQ8A 3MHFA 3QMRA 1H5YA 2VFHA 3CT7A 4K6AA 1VGAA 4ONVA 1XUZA 4P2VA 1IGSA 4GUJA 3SI9A 3TAKA 1W3NA 3ZFHA 2Z6IA 5AHIA 2V2DA 2HS6A 4LVAA 1XBZA 2ATMA 2QKFA 1D3GA 1GTEA 1NSJA 4RJEA 4FIRA 4K39A 2C1HA 4M6PA 3LHTA 5AOUA 4O10A 2EKCA 1EEPA 1QOPA 1WOAA 4X3ZA 3QW4B 3TFCA 3LBMA 5K4XA 3TMLA 3W6YA 3GNNA 3TSDA 5G1TA 2TPSA 1LLZA 3MYOA 4KFNA 2I9EA 3LTPA 5TBOA 3W7OA 1LOSA 5C2XA 1B4EA 4JNMA 2DZXA 3I68A 3QF0A 5CG7A 1JCJA 3RF9A 3PUEA 2WOQA 4QITA 3S8HA 2TYSA 5DLCA 2YR1A 1AG1O 3TFXA 3K30A 1GT8A 3NXFA 3U6WA 3GAYA 4MZYA 2A7PA 4EWND 4MFEA 4Y6GA 6ALDA 1TMHA 2OJPA 4JTHA 4MY9A 2GOUA 1W3IA 3MP4A 1OYCA 4PA8A 1H7XA 1LOLA 3MWAA 2PRHA 3L5LA 1W31A 2VFFA 1OYBA 4XUGA 5TQLA 4FNPA 5I3JA 2YXGA 2A6LA 5EA9A 3W1RA 5CPOA 3DFNA 4AXKA 3NO5A 1VS1A 3H55A 2FTPA 4X9SA 4Z1BA 1OFPA 3P5YA 3SZ8A 2H8ZA 2C0AA 2BZNA 4EVZA 3R13A 2YZRA 3MI2A 4RZ6A 1EP1A 4GE8A 4EOUA 2NUWA 5G4EA 4C1KA 2B7PA 5L9FA 3HF3A 2GQ8A 3LLDA 3C4UA 3OHIA 3CB8A 1S5VA 3G22A 4QM1A 3NQ2A 3QSTA 5H91A 3BARA 2FFCA 2DZWA 3QJAA 3LXBA 5D32A 3W7PA 3LCWA 3LLFA 5MHBA 3DI0A 3V1PA 3FKKA 4UR8A 4NNCA 4WUIA 2WKJA 4WY0A 4YCPA 2G97A 5LNUA 4TU1A 1VPXA 3G1AA 3UY8A 5D2WA 5HJLA 3FOKA 2WSRA 4RZ5A 5D2VA 3L2IA 3LCHA 4WY0B 2A2IA 4O17A 2BWGA 2D73A 1O60A 4IMCA 3LI1A 1LBMA 7TIMA 2XN1A 4Y90A 2CLHA 1OX6A 2A4AA 2QJHA 1L6SA 1HTIA 4RK8A 5HR7A 2XN0A 1OFOA 2I14A 2NWSA 3B4UA 1DHPA 1QDSA 4IQLA 3H53A 3P61A 4YCOA 1F6KA 4JGDA 2VENA 2ZZ7A 3G8EA 4AEOA 3MP5A 2Y70A 4Y9AA 4O50A 1JR1A 3NZRA 3LCXA 4CLMA 2BXVA 4O1AA 2CZ5A 4O54A 1KFCA 5EYWA 5FF7A 3IV3A 1KBJA 3PY2A 4FF7A 1NF0A 2NV2A 5F2IA 4JX6A 1IF2A 2Y7DA 3LTSA 1BWLA 5G2HA 3W88A 1XL9A 3LBCA 1RQHA 3LHUA 4K37A 3PG8A 1K3UA 4PCFA 1IIGA 1O5KA 2TMDA 3STGA 1THFD 3BW3A 1GTHA 5K2ZA 4LUIA 1MZHA 2RFGA 3GB6A 4JTTA 2BTMA 3F03K 3UWVA 1L6WA 3KOFA 2CLMA 5HWMA 3LCIA 2FB3A 5LKYA 4K38A 3TNOA 1DORA 2C6QA 1MEIA 1XBYA 4K8EA 4AVFA 2PRMA 4MLRA 4O8RA 2ABBA 4HSOA 1L6YA 3TA6A 2GQ9A 4LS2A 3TQKA 4AH7A 5DCDA 3L21A 2WQPA 5CZTA 3UY7A 2NXGA 3EXRA 1K8ZA 1N7KA 1A5BA 1YPFA 1SQ7A 2DP3A 3WJYA 2GVGA 5K9XA 3PF3A 3PUDA 3QEZA 3TK7A 3IGUA 3TQVA 2E1DA 1LP6A 3MO7A 2ZQ0A 1SW0A 1U5JA 1XM3A 1QPRA 4AWTA 2JKPA 3P60A 3TDFA 2DJXA 4I9AA 2Y61A 4XKYA 1PCKA 3QPZA 5C5YA 2DZTA 1KM5A 1UUMA 1F76A 2Y62A 4XKYB 3HJZA 3KVKA 3LGEA 3GLCA 3LX9A 3KX6A 5HUPA 3E9AA 5J5RA 4GC4A 4W9TA 3GXTA 1CI1A 1IXPA 3IIXA 2E68A 5EBUA 2C15A 4FXSA 3W7QA 3EKLA 4ZQNA 4I7VA 4Z1DA 2FDSA 3MP3A 4K36A 3H54A 3O07A 4H6KA 5DXXA 1WOBA 2G95A 1K8XA 5AYXA 4FNSA 1W3TA 3G1SA 5BNKA 3UWWA 2PE4A 2V5BA 1K03A 1EIXA 1VLWA 1AL7A 2X2GA 2Y85A 3C2OA 4JICA 3W86A 2QCNA 2A1YA 3LRKA 3L67A 2YFOA 1AW5A 2QCHA 3L0NA 1T8XA 3LB0A 3W1XA 4ALDA 1L9WA 3SJ3A 3Q94A 3GNDA 1ADOA 1FCVA 2GJLA 4HNUA 2R91A 5D2TA 4MVAA 5HUOA 3B0PA 3LDVA 3LTYA 4GUGA 2E6FA 3KHJA 3EWBX 2Y6ZA 1KM4A 4MFDA 3EB2A 3RFAA 4UTTC 3IIVA 1PHWA 3BPWA 2CZEA 5F4WA 1H7NA 5C54A 1FWRA 3LXCA 3NQMA 3VCRA 5HR6A 1GVRA 1F5ZA 1U83A 3SSJA 1LORA 4D2JA 4UFLA 2R94A 2Q3OA 2EHHA 1LCOA 4UNKA 1DJQA 4ZQRA 3DKJA 3QRHA 3G3MA 4ADTA 1GPWA 3L0KA 1KLYA 4YWIA 5LSMA 1KFBA 4UFHA 5F1UA 2NWRA 4K7VA 1W5PA 2V8ZA 2A6NA 1PL9A 3LRMA 3W7EA 2OX1A 2OT1A 2ZRWA 1DJNA 4C1LA 3GR8A 2OMAA 1FCBA 3EWUA 2JGYA 3MI6A 4DELA 2NUYA 4PC8A 3B0VC 5FEXA 1QR7A 1HO4A 1TPVA 1FBAA 5DN1A 3S9YA 4FHAA 3WK0A 4LRTA 4O11A 1BTMA 2EF9A 1I45A 2VOMA 1I2RA 1DL3A 3QMTA 1TCDA 2PURA 4UTHA 2V82A 3TUUA 5KTLA 3QZEA 1LZOA 4A29A 1MO0A 4FEZA 3PM6A 3P8JA 3N14A 3HGSA 1QFEA 3W75A 3JRKA 3TAOA 3DU0A 3W7IA 3T40A 1A5CA 4RKAA 2B7OA 3LHYA 2YYTA 2H3BA 3TCEA 4Z1AA 2J9ZA 1WV2A 4UTIA 3GR7A 4QJ1A 4N9BA 1OHLA 1QAPA 3TJLA 4BK9A 1VZWA 3CQ0A 1TYGA 3SECA 3NM1A 3INPA 1FWTA 5K3VA 5CKSA 2V2HA 2RDUA 3NYZA 2CWNA 3B04A 1KTCA 2YSWA 2DU2A 3LOTA 1T96A 2WNZA 3BG5A 4DO6A 1LBFA 4IMDA 1YYAA 2GPTA 4AB4A 3EX6A 4Q32A 4DF0A 3HGRA 4BI5A 5D33A 3AJXA 1FY6A 5I3IA 1E51A 2E6YA 5IBXC 1VLIA 2FJKA 2F7FA 3S1XA 1YDOA 4M19A 5CPLA 3WFAA 4A2SA 3DHDA 3NL3A 1T0OA 3PBYA 2ZZ3A 1JRBA 3PR2A 1EX5A 1K7EA 1B57A 3FYPA 2R8WA 2ZZ1A 5K7JA 3A23A 3NL2A 1M6JA 3CWNA 5HULA 3UYCA 1DOSA 1W54A 3G8RA 2A0NA 4U28A 1VRDA 3N2XA 3SFKA 4DPPA 3W1QA 5HQEA 4N4QA 4FX6M 4P61A 3NQ6A 3Q37A 1CX9A 3QM3A 3PUOA 1SZNA 3DFSA 3WK3A 2WSYA 3FJLA 4ZVJA 5DBUA 4FNTA 1ZAIA 4AMAA 4E2DA 1VQTA 4BR1A 4NJIA 2J9YA 3LHVA 1TV7A 3HGJA 3IGSA 3TC7A 3W2LA 3MHUA 2QCLA 3QW3A 4CNPA 4O12A 2RDWA 1DQXA 3BGJA 4MJMA 4HNTA 3W2UA 3EX1A 5LGXA 1F7BA 4LU0A 2XN2A 1OJXA 2A85A 3QQ1A 3JR2A 4JIQA 3ZWTA 4Q33A 4RX0A 4LNYA 2W0UA 3KRZA 3NL6A 3HG3A 3N19B 4GFSA 1GZGA 1I2OA 3R8RA 5EPDA 4PFMA 5F1VA 1OFEA 2PRLA 4JX4A 4OHQA 2C3ZA 1LRQA 4J9JA 3P67A 2GUUA 3C8FA 4N6FA 3A22A 3TIMA 2Z6JA 1B3OA 3I65A 4DPQA 4UTKA 2C14A 3PG9A 2JK2A 2CLIA 1SW3A 2GVJA 4O4WA 4MZ1A 1H7OA 4GWEA 3A5VA 3NR0A 1YDNA 1LM1A 1Z48A 4EF8A 2BLEA 3PC0A 5D2XA 4ZQCA 1TPDA 2WV8A 1GG1A 3GDMA 3R89A 5G2WA 3M43A 1KTBA 1FXPA 1MEHA 1GVOA 1F05A 4X22A 1KTNA 3DI1A 4ZL1A 3TQ0A 4GXMA 4CCCA 2A5HA 1GWJA 1G69A 3A5FA 3E0IA 2RHGA 1R46A 4JY9A 3RLUA 2F84A 3FFSA 4NZJA 1GJPA 5G4WA 3TR2A 1XXXA 1G7VA 3Q2DA 4MZ8A 1G4EA 3GAKA 1UB3A 1XKYA 2ZDRA 1YTDA 3BV4A 1IXOA 3EXSA 4RV8A 3TSMA 1I8JA 3O6CA 2HTMA 4MLJA 1G4TA 1TTPA 3W7MA 4IPIA 4UTTA 3BW4A 4GBUA 4JYEA 1M7PA 4IXHA 1NF7A 3TW7A 3OVRA 3W2KA 1H51A 1H7PA 1PIIA 2X1UA 1XUUA 1FUYA 2VFEA 2V5LA 1GYNA 1GVFA 1XBVA 4A3UA 4IJBA 2H6RA 4LVDA 2B0MA 3C61A 2ZZ6A 3Q58A 1R2TA 1UCWA 4QNWA 4MKNA 3T4CA 1JCLA 4JYFA 4MY8A 2RH9A 3OBKA 2ATSA 1X7FA 3BLFA 4FXRA 2AAMA 4GUFA 2OZ0A 3ANYA 4OWGA 1AMKA 3JS3A 1Y0EA 1QPNA 2V0TA 3NQAA 1G6CA 5I3HA 3DFOA 1S5WA 1K7XA 2Z2UA 2QCFA 4LOCA 3A24A 5DY3A 3THQA
chains in the Genus database with same CATH superfamily
3PFMA 2GVLA 5CZKA 1ZB5A 5RUBA 2WMFA 4IWWA 3W2MA 4RXFA 3B03A 2E9MA 2PBGA 4JTKA 4HZ7A 3FV9A 2FPVA 1TPB1 5HPCA 1BPLB 3S0CA 4ZB5A 2EPHA 3WQ8A 5LA1A 5FJPA 1W91A 1TTQA 4WJEA 4ZE4A 1E72M 2WMKA 3W53A 1Z41A 3TC6A 1RH9A 4H00A 1A0CA 3VK5A 3W7DA 1ML1A 1U22A 1QHZA 1K7FA 3L0GA 4FSAA 3W3OA 1E40A 2XM2A 1M1BA 3UG8A 1HKVA 1UD3A 1K9EA 3ABRA 3I7RA 3VD5A 2V3GA 1VYRA 3ABXA 1E1CA 5FF3A 4Q6JA 1HJWA 4U5IA 2BBFA 2PPGA 4J27A 5G1YA 2I16A 3HPXA 2WSKA 1CT5A 3WENA 4OE7A 2PDCA 2ZRZA 3FKRA 1JXKA 1R7OA 1XLBA 4D6EA 1LWJA 2GSHA 3OVQA 3PSWA 3W83A 3UBPC 1XLKA 3WCZA 5T9CE 2E25A 4ZSUA 3ARXA 3UZYA 2G8ZA 4GUIA 1NFGA 1DKWA 1GQJA 2WVSA 3WQ5A 2W4XA 2PDLA 4D8LA 3L2MA 1NTHA 5BW6A 5HNRA 3MUIA 2ZE0A 4XIMA 4UNIA 4YIWA 1R0MA 2YFNA 3WK2A 4BI6A 1TKKA 4B2DD 3SCUA 1UWAA 3KBNA 2B4GA 3NG3A 5JIPA 3G24A 1O5RA 4RW3A 4WVXA 3O8AA 3PJTA 3MANA 1XQLA 5JUVA 3W02A 5LNWA 1ZNNA 1O5XA 1ZJAA 3ES7A 2QHAA 1FHUA 3NSNA 4CCDA 3C0JA 1AZ1A 2ZXQA 4HKPA 1AA1B 3EEZA 1YNQA 1ZFJA 4WX2A 1DV7A 3U4AA 2ZUSA 3U7BA 2Y5JA 3SQSA 1XH2A 5AB3A 1GQLA 4QGCA 2DVTA 3G0XA 2BODX 3VNYA 1EB3A 2PDIA 1DJXA 3Q67A 4PUJA 2HE8A 1EUAA 4M5PA 2YA2A 4E2OA 3CWOX 5HXMA 3MSDA 4IP4A 4CD4A 4ZB2A 5D09A 2WM1A 4TR9A 3R8HA 1J0KA 3IV8A 4KEVA 4MTVA 5GVJA 3VNZA 2E5DA 3REQB 1Z89A 1HL2A 3P8IA 2VWTA 3OHMB 3OLEA 2YZ5A 4F4RA 2Z24A 4NASA 2XZ7A 1C9WA 3SUVA 4W5ZA 1P7TB 3PS7A 5LIWX 2UY3A 3A12A 3S5ZA 2EPOA 3PWIA 4PB3A 4BQ3A 3GK0A 4JR5A 4IMEA 1XW8A 5LHEA 3QFWA 5A1AA 5G5IA 1OF6A 3SUUA 2R24A 3UP8A 2BG5A 2AMGA 3WLPA 2CLEA 4FLOA 2PBOA 3D46A 1RY0A 3FLUA 4RLIA 1SO4A 2IPJA 3RHGA 2YBUA 2VZVA 3IRDA 1XYFA 3WF2A 3PBUA 4JTCA 4A22A 1S3HA 3CUXA 4AQLA 2WCAA 4BF9A 4ILSA 4UMBA 3H6OA 1QW7A 4L4OA 4D6IA 3H4XA 5DCEA 6CGTA 4CCEA 4O53A 2VR4A 5C7VA 3NQGA 2GWGA 2OZTA 2ODOA 2PWFA 3EWWA 1XLJA 4H9VA 3SIZA 5FJIA 2NVCA 1E1FA 1JUKA 4HN4A 3WSUA 1NVMA 4C7DA 4V1XA 4MB1A 1VCVA 3DGRA 4FAMA 2VEIA 3MMTA 4JTAA 5G4HC 3RCNA 3V75A 1XLEA 3GW3A 1ONRA 2RUSA 2CBVA 2ISSA 1ZSXA 3EOSA 3IIPA 5BMXA 1RQEA 1HJXA 4M3PA 1BRLA 1GK8A 4TOQA 1GZJA 3WLJA 1H63A 3BWWA 1SZGA 4DNHA 3LCGA 2IPFA 2PDXA 4IGNA 4OBRA 3HPZA 1EJUC 2ZA3A 1FWAC 3ENLA 2W67A 1R47A 2FB2A 4HCHA 3F7JA 4MNLA 4QEHA 1S2AA 1RCQA 3VX0A 2OPJA 3E0WA 1NIUA 4B91A 2DPEA 3KVLA 4G1NA 3USBA 4GNVA 1P5BA 1EGMA 5LXEA 1DJGA 4Z2JA 1C90A 2VCCA 3WYZA 3PZMA 3IJ8A 3HMJG 4TXEA 1LOQA 1X6NA 4XBKA 3A21A 1A5AA 3OZYA 5FF4A 1G4PA 1EJWC 2WCSA 1BD0A 3WDHA 1HZYA 3VI2A 3DESA 2VYOA 3W1PA 1GOWA 2EXOA 4U4MA 1TPUA 1SFLA 3L9CA 5DELA 5HATA 4PODA 2ZWZA 4IPNB 4TX8A 1EUNA 3H4GA 1QU4A 1QT1A 1TB3A 3CZLA 1GVSA 3R12A 3CH9A 2BS9A 1F3TA 1ZJBA 4AD2A 1UKOA 2JIEA 2D20A 4LVGA 3F4VA 2WC3A 4EX4A 2JQXA 5KZDA 2QPXA 4WDWA 4HNCA 1LRTA 3R11A 3LNPA 1CLXA 3VUSA 1TRIA 1DE5A 4DF2A 1BEUA 3K1DA 1PZ1A 4W4QA 5I07A 1ZHAA 5I3FA 2F6XA 1KXVA 2CIPA 3OOQA 3N6HA 5F4SA 4JIPA 3WX7A 3H2EA 2Z1BA 1VYSX 3LPGA 4MJZA 3OO2A 1TV3A 2NXIA 1QJWA 1M7XA 4RE0A 5IDZA 2YCKX 4JTEA 4JL2A 3PWGA 1EH9A 4JD4A 3FHAA 2J7EA 1V6TA 1SMDA 2X1SA 4QFUA 4QAIA 3IUIA 3DHFA 3A9IA 3LMYA 1MFVA 3S6OA 5D9OA 1TJ1A 3EKGA 1TJRA 2QDHA 4H9TA 3WQFA 3STPA 5ABFB 4JX5A 4FA3A 4C6MA 1LL7A 1ODUA 7REQB 2VEKA 4B2DA 3ATZA 4HMNA 2P76A 5B7ZA 2ZZ4A 2G41A 1HJVA 1TQXA 3CIVA 3C0LA 3QZAA 1OQFA 1OG0A 4XD6A 2PLKA 4YNGA 3GTXA 1H5VA 2JBMA 5AZ0A 4TMCA 3SCVA 5CJMA 3CAQA 1OSEA 3N73A 2WNNA 5AECA 3WEOA 3TX9A 4ORMA 2YXXA 2ZICA 3A6OA 1MQQA 4F0RA 3GR4A 1OINA 3U57A 4Q8PA 3PPFA 1KR1A 3BG3A 1OT1A 5D9NA 4PSRA 4UFMA 3BGAA 3IJLA 4RZBA 3L12A 3WY1A 1BKSA 4HB7A 3QLLA 3STEA 1NWUA 1RLCL 3E3HA 1GOMA 3AMKA 1ZAHA 1FFQA 4I3GA 4G6CA 3BOLA 1GONA 1REQB 5FL0A 3STFA 1FQ0A 1RY8A 3NNTA 3L68A 3CUGA 3CTLA 5E0CA 4QROA 2MNRA 2E7FA 4EPKA 4Q4KA 4A6GA 4JKMA 3TLQA 2VEPA 3H7RA 4LAUA 3AMDA 5DBTA 1TZZA 1OX4A 5ABGA 4J3ZA 1TIWA 1S5MA 8XIMA 4XTDA 4KCWA 3HFTA 4JY8A 2X16A 3K1GA 1TPWA 5A8GA 3VDAA 4ZE5A 2VUYA 4UOJA 1ZBKA 2PGWA 4LBUA 1AK5A 3W38A 1A3HA 1CGWA 1KM1A 1QW9A 1JULA 4HIBA 3S5YA 4AYSA 1VENA 6REQB 4WXYA 2OT0A 4OKDA 3W1LA 2BP1A 5LNRA 1YTEA 2HS8A 3TEVA 3B0XA 4MPQA 2VFGA 3R79A 2G96A 3H4WA 2P53A 3TYCA 2ABAA 1EO7A 2ZX8A 3QC0A 1S38A 2PF0A 1QPQA 1H61A 4L5ZA 2FGZA 2X7VA 3M0ZA 4PBFA 5CSUA 3LV6A 3CQHA 1QWGA 5EY5A 1EWEA 1BYCA 1UW9A 1CXEA 2E5BA 5DFAA 1CEOA 4A3QA 1HO1A 3ZIZA 4ZTXA 1H11A 3KTCA 1KFWA 5C55A 1ISXA 4LBSA 4N9EA 3A4AA 1KFJA 5HINA 5D9PA 1XIMA 4KFPA 4TX9A 3YPIA 1M7OA 3WLTA 4FI4A 1D9EA 4ZQMA 3SUTA 3QN3A 1X1OA 3VIPA 3PBWA 2IKJA 4BF5A 3CIWA 3T44A 2J7FA 3E5PA 1HNYA 1XLDA 2I5IA 3GU2A 1VEPA 2FPTA 4OV9A 6A3HA 2VX5A 4WZHA 4RCXA 5E0KA 2C19A 3T4WA 2V2CA 1KM3A 4LUSA 1W1PA 4IIFA 5CAKA 2RKXA 2TSYA 4LAZA 1DWIM 3QC3A 1Q6QA 1W1TA 3KW3A 4LH8A 2J8TA 1W9UA 4NQ1A 3LHZA 1UBSA 2PGRA 1P6WA 3ABOA 4XVEA 1XYAA 4US5D 4UNLA 2PF8A 3RCYA 4I5XA 3M41A 3SR7A 1S1RA 4ROQA 2V5CA 2W91A 4JDBA 4MWAE 4XIAA 3TW9A 3RITA 3G5EA 5A94A 5CSRA 1U1JA 3BZGA 2F9RA 3MDUA 4DUVA 5REQA 1DIEA 4UZSA 3H7VA 3GZAA 3KFTA 1DWAM 3VGGA 5IM51 5EGRA 2WNQA 1V3KA 4JQAA 3UPBA 1WXJA 3ZWSA 3S2MA 2RDTA 1CLVA 4JTGA 1H60A 1WBHA 1Y7VA 2WLZA 1GYLA 2HCVA 1OCNA 1XS2A 2QEZA 3NGFA 4X9YA 1OFQA 1D3HA 5GNZA 1UG6A 3C6CA 3OTRA 3W7RA 1HKIA 1F9CA 4LC6A 1T6MA 3T0DA 2NV9A 3D0CA 5AZ1A 3EOOA 1FHVA 5AC8A 1Q2SA 4JTQA 2V68A 2I17A 1VFOA 3LV5A 2NSXA 3CM4A 4KWWA 4KWSA 3CV7A 3GXFA 1AW2A 2QAPA 2Z2BA 1OFAA 4HNLA 1V51A 3S1VA 3WUBA 4IQDA 1PCWA 4GO8A 3QGAC 3UWYA 3GKAA 1WDQA 3CMFA 3WH7A 4OVXA 1TSIA 4RR4A 2BASA 2J75A 1CXHA 1QI5A 1K8YA 3OG3A 2RGLA 1BRLB 3QQ0A 2Q6ZA 1HJUA 1RA0A 1R85A 1E6SM 2IKHA 4ZFCA 1LLOA 4DBSA 1UJQA 4Z0JA 1ISZA 1ISVA 4QJ5B 3WQ6A 2ZIDA 4YL2A 4S3AA 1PKNA 2OB3A 2ZRUA 2G3FA 2ZUUA 4UTFA 3PAJA 3NZQA 4OT7A 3VDHA 1EA0A 3E02A 3IJ9A 3FA5A 3CXOA 4IJCA 2CZVA 3LSCA 3TOPA 3S6DA 1NQKA 3MV11 1NAL1 4PL2A 2E4TA 2PDWA 1AH3A 4AZGA 2EPLX 4M81A 3CL7A 3UNDA 3R2GA 1DTUA 4NL1A 3OG2A 4WRHA 3STCA 1EDTA 4WKFA 1SR9A 5BXPA 2AGKA 3O6AA 5I2UA 3UW6A 3VKCA 3I6TA 1DIKA 5AHEA 5A69A 2RAGA 3F4WA 3OEXA 3VDCA 4HU8A 5BWAA 1PWMA 4HQVA 2DEPA 5CBBA 3KP0A 4IXXA 2XFYA 1FXQA 5GJMA 1PZ2A 1RCOB 5FEPA 1SJAA 1OWQA 1GVQA 9CGTA 1Q63A 3DXIA 3NAVA 3S42A 2E09A 3KDNA 4I7WA 1P0NA 2WMHA 3R1ZA 2OYLA 3KBVA 3UQNA 5AC6A 1WKEA 1XSKA 3WQDA 1EWDA 1TTIA 4LRSA 1PS9A 1GOXA 5D02A 5ENLA 2HNEA 3TTSA 5HDRA 2CHRA 1XIBA 5A2AA 3NQBA 5FIPA 3VXGA 1XC4A 4G2DA 1ALDA 1QBAA 1QCWA 4G5DA 3RILA 1F3WA 2EG6A 5D30A 5BRQA 2QVHA 3GS6A 1BWKA 2BVDA 2WKLA 3SQMA 4KIRA 1HXJA 5SWUA 3W70A 2IKGA 2FIQA 1Q66A 4F3HA 4WXZA 4L56A 2YDQA 3AHXA 2PDNA 1TWIA 3NQ8A 1EC7A 1H5YA 2Y2WA 4TX6A 2W27A 4FZIA 2DSVA 1IGSA 4GUJA 3SI9A 4R27A 3WBXA 2ZADA 4BS0A 5AHIA 2V2DA 3P6LA 4IM4A 1XBZA 4DHGA 2QKFA 3GIQA 4FIRA 2WVVA 4K39A 5AOUA 5F7UA 3HU7A 4A35A 2BOGX 4KS0A 4WF7A 1WOAA 3AUJA 3CUHA 1AJ0A 3WNLA 3BANA 1LLZA 1ODZA 3LTPA 3QTGA 1R9YA 3QV7A 1VIWA 1B4EA 5H8MA 2DZXA 4X2PA 3B8UA 3QF0A 3BICA 5HA7A 2ZXBA 3BV7A 3PJUA 1IZKA 2YLAA 4P7QA 2WOQA 4QP0A 3S8HA 1V93A 3RIKA 2VD8A 2HZGA 3F4DA 1GT8A 2QQ6A 1W3HA 4OJYA 4F2BA 2A7PA 3M0YA 1LJYA 2MANA 4Y6GA 1TMHA 2OJPA 4JTHA 1S3TC 4H83A 3OYZA 4PA8A 3TYEA 4AZCA 2PRHA 5CAHA 5CBJA 4GIAA 7ENLA 2YXGA 3G6LA 5CPOA 3DFNA 3TZFA 4O1FA 4IFKA 4Z1BA 2H8ZA 4DY1A 2QS8A 2C0AA 5HJXA 1W9VA 2YZRA 2VZSA 5DEZA 3MI2A 1W8GA 4HPGA 4Q6XA 4GE8A 4EOUA 3RR4A 2PU0A 4C1KA 4JOMA 3UG3A 3OHIA 3CB8A 3G22A 1NDWA 4RPQA 3NQ2A 3VUPA 5I02A 3RYSA 2FFCA 3S9ZA 5D32A 3VMOA 2GDUA 4LGXA 4ZOAA 4NNCA 4WUIA 3IWPA 1ENUA 4F66A 5TNVA 3DX5A 5A8MA 3UY8A 1BQCA 4D6CA 3PBGA 1P6BA 3L2IA 1JYWA 3H23A 4WGHA 4M0XA 2BWGA 2D73A 3SIMA 3G77A 1LBMA 3A9BA 3TN3A 4BEQA 1BHGA 3WELA 1PPIA 1L6SA 3FNDA 2ZVRA 2NWSA 3B4UA 3T08A 1V0KA 3G8EA 4Y9AA 4O50A 4R88A 2XPKA 5GJNA 4O1AA 1KFCA 5FF7A 3LGDA 2Y5EA 3PY2A 4H6EA 3VD3A 2NV2A 3SJNA 1F4HA 3COTA 3LTSA 1JZ4A 4GVFA 3WLMA 5I03A 4Q8QA 4C91A 5I09A 4AG0A 3C3UA 2TMDA 3VOHA 4GH3A 3IS4A 4GACA 1C8QA 1CZ1A 4X63A 1DJYA 2RFGA 3GB6A 4JTTA 1MUCA 4KEUA 5DT7A 3BZJA 4CN6A 3KTSA 3TNOA 4K8EA 3QYSA 2PRMA 4HU4A 4DB7A 3TA6A 4A3RA 3F5KA 3P3BA 3GE7A 1NU5A 1XKJA 1UR2A 1OY0A 5A6TC 4PB4A 3UY7A 3D5HA 5I06A 1K8ZA 1N7KA 1A5BA 4CQDA 4DJED 2DT0A 3PF3A 3TK7A 5FAJA 5TF0A 2V63A 4NRSA 3UJRA 3ZSTA 2E1DA 1LP6A 2XH0A 3MO7A 1SW0A 1XM3A 3WDIA 3P60A 1KXTA 4I9AA 5HJYA 1IEVA 1PCKA 1TG7A 3A64A 3UFYA 1UUMA 3P0WA 3USZA 3ANUA 4F2TA 2JE8A 3LM3A 2O9RA 5C9UA 1J8VA 3HJZA 3KVKA 5J5RA 4GC4A 5EBUA 3GXTA 3IIXA 2E68A 4P8WA 1DYSA 4ZQNA 4I7VA 4Z1DA 2DV0A 2OKTA 2ALRA 3HURA 4B5XA 2G95A 5AYXA 4DJEC 1MUWA 5BNKA 2PE4A 2WJDA 1K03A 1AJZA 2X2GA 4AX7A 3C2OA 5A6MA 2QCNA 3HQNA 3L67A 2GDVA 4JCMA 4EAYA 4H7VA 1AW5A 2QCHA 3L0NA 3W1XA 1QI4A 4J5NA 3MUAA 2ACQA 3AS0A 1L9WA 3AYSA 3SJ3A 3OLDA 1EHNA 5C9WA 3ITYA 4HSHA 5EB8A 2YB1A 2R91A 4MVAA 4WKAA 5MKGA 4KESA 3RLHA 3LDVA 1XFCA 3QY8A 4JKLA 2E6FA 3KHJA 4MFDA 2QNEA 1FHDA 2YXOA 1M04A 2YBTA 2CZEA 4GH1A 1EJSC 3WH8A 1FWRA 1ITQA 4GINA 3SSJA 2ISDA 3O0KA 4D2JA 1V7AA 3SADA 2Q3OA 2FZDA 4R7OA 5DMNA 1BKHA 1UKQA 3VDBA 4WR3A 5XIAA 1WAWA 1V4YA 1M41A 4MNJA 3U7VA 1KFBA 4J3WA 1K8CA 1TV2A 1Q6CA 4CN1A 5CJ5A 2NWRA 1W5PA 4PUDA 3QY7A 3LRMA 3W7EA 3AIVA 4PMOA 2WXDM 2HRWA 2OMAA 2QULA 4C1NB 1FCBA 1NARA 4HU0A 1GEHA 1QR7A 2BB0A 5DN1A 4LRTA 5LIUX 1SVDA 3EZ4A 3WBWA 3EDDA 3I3EA 1W6TA 5HANA 3WBAA 1CYGA 5KTLA 1XISA 1YRRA 5DMLA 2CLPA 1X1NA 4RDYA 3AXKA 3KOXA 1PIFA 4W8AA 2R6OA 3EGJA 3JRKA 3DU0A 1A5CA 4RKAA 3TYZA 1U1UA 2H3BA 4FLQA 4QDWA 1K9DA 3M0XA 1OHLA 4B9ZA 2X09A 3CQ0A 3FVDA 3SECA 2O92A 4PN2A 1TX2A 5CKSA 1F3EA 4LPCA 4BEUA 2RDUA 3CJPA 1R7AA 3GNXA 1FOBA 1ZTVA 4DAIA 3MC5A 4JAWA 3GFXA 1EJVC 4AZIA 1LBFA 3B9OA 1YYAA 3WLLA 3EX6A 3L4WA 2HPMA 4H9ZA 4AC1X 4QLLA 1H49A 1X8CA 3FW6A 4DJDA 2PWVA 3AJXA 5GJPA 1RP8A 4GI9A 2XINA 4ICCX 4J4KA 2F7FA 1KRAC 3IUHA 3T1GA 2F6UA 2C8NA 4A2SA 3ARQA 3DHDA 4I8DA 1HIZA 5I6SA 4C6PA 1T0OA 2ZZ3A 5BCAA 1UWSA 3PR2A 4R7WA 1B57A 2VDGA 1XGDA 3MUZ1 3NL2A 4GI4A 1UD8A 1RVKA 4NILA 1M6JA 4L9ZA 3CV1A 3QR0A 1JF5A 1ZGDA 2REQA 3AAMA 4M1RA 2DUAA 4PUWA 4AXNA 4IHCA 3PZGA 2AAAA 4NZ1A 1VRDA 1O1HA 2Z00A 3V1HA 1K4GA 4GI8A 4GYFA 4FX6M 2XYLA 1WO2A 3P2VA 1DIDA 2XH4A 1CX9A 4HPHA 2PD5A 3TTOA 3QM3A 3LBOA 5DBUA 1MVYA 4E2DA 2Z25A 3GUWA 4KW2A 4W88A 4NJIA 2J9YA 3LHVA 3WD1A 2C91A 2E3ZA 3IGSA 2DSKA 3Q65A 4CNPA 3RX4A 4HNTA 2KX9A 3EX1A 5IDIA 2OXNA 2XN2A 2WHJA 4PULA 1XSIA 4A8NA 5AYBA 4L7ZA 3D6NA 3JR2A 3HV8A 1B3ZA 4NAEB 3N19B 4GFSA 1N8IA 2A3LA 3ITXA 3QV9A 5JBFA 1K1DA 3K8LA 2PRLA 4OHQA 2CETA 2C3ZA 2BHUA 3GHTA 3P67A 1E71M 5E6ZA 4DI9A 2Z29A 1JD7A 2WHKA 1DPMA 1B3OA 4DPQA 1UWUA 3ZLFA 3WN6A 4O4WA 2WVVB 1TVPA 3BMVA 3VIIA 2W5FA 3NR0A 4U33A 2GOKA 1CGUA 4DWDA 2BLEA 3PC0A 1R3SA 4B90A 4P7LA 4URIA 3A13A 4DJEA 1UZHA 3ERPA 2PDGA 1EDGA 5FSEC 1KTBA 4KRTA 1FXPA 4W7VA 1HP5A 3FN9A 1UWRA 3WBYA 2F8QA 2HK0A 4XAGA 3LLXA 3E0IA 2XWDA 5XINA 2F84A 2QF8A 4HMEA 4E3TA 2CYGA 1VP5A 4QE5A 3H2NA 3Q2DA 4MZ8A 4JHOA 1UB3A 4XKMA 1E43A 2XIOA 3HN3A 3ZVHA 3H2AA 3CUZA 1V79A 4DWSD 3W7MA 1E6PA 3T0AA 2FTYA 3UR8A 2VCAA 4XZIA 1H41A 1UBPC 3GNPA 2JF7A 1EBGA 4XB3A 2UBPC 1GVFA 4GCXA 4K1GA 2PDHA 1XIEA 3RJYA 3GC4A 4LVDA 3W81A 3Q58A 3CAKA 1JCLA 4NZ3A 4MY8A 3LG3A 2P8CA 2G3JA 2OZ0A 2V0TA 1WUEA 1DJZA 1Z9AA 5D9MA 1QWKA 2VX7A 3AWOA 2Z2UA 1EGZA 2QCFA 1W32A 4F8XA 3A24A 5DY3A 1XD1A 1TUFA 3ZXWA 4LT9A 1KQYA 5FSDC 1XQKA 5F2MA 4Q8UA 2Q8LA 1FWNA 4YYFA 4UTLA 1GUVA 1ZP3A 3MKCA 1PO9A 1VFTA 4JN8A 3LPFA 1VEOA 1HX0A 1NEYA 3ARSA 3HPSA 4HBKA 4IL2A 3EPMA 2XH7A 1E5JA 4MB3A 1KCLA 2UZ9A 3KCJA 2VVNA 1DVJA 2J13A 1OGSA 1H7WA 6ENLA 5H2ZA 3M16A 4LY8A 2UY2A 4M6VA 3ZSSA 2E77A 4DBDA 2A3HA 3V5FA 3N34A 3NQCA 2W3ZA 3KAOA 1B3WA 1R3YA 3CUFA 4YJ5A 1UPPA 1Q7QA 1Q2RA 1PIGA 2J7CA 3PZ9A 3AIBA 3R0KA 3VNMA 1SO3A 3P81A 4MHBA 1F07A 2DQXA 4F40A 4MYAA 4JTSA 3KS6A 4M1BA 1TO3A 1J18A 4UR7A 1XBXA 3WD3A 3T7VA 1EX1A 5JVLA 1JDEA 1W5OA 3TWAA 3A47A 4LWWA 5LHFA 3IJIA 1UZ4A 1M03A 1PUDA 4YVXA 2QCDA 5EU9A 3N2CA 4UTUA 3U0HA 2YDRA 4HK5A 1GOQA 3CLMA 4LVFA 1B9ZA 1WCGA 1G94A 3FS2A 2QJJA 3CU2A 2OQHA 3RMJA 2BSLA 3C2FA 3P62A 2W6RA 2OEKA 1UR8A 4TV5A 2J88A 4AFYA 2VL4A 1VC4A 4H3DA 1I2NA 1KO0A 4DZ5A 4A3HA 3FVMA 1GG0A 1R3WA 4U10A 4Q22A 3B06A 3GSMA 3UT0A 4HCDA 2R1MA 1Q5MA 1ADSA 2Z7GA 4OUEA 3V16A 1J96A 1BGGA 3ZT5A 1IWAA 4ZA0A 1Q7ZA 2DSWA 2FDMA 3U8GA 1YE6A 9RUBA 1BYAA 4AYGA 5DT5A 6TIMA 5JH1A 4LV4A 3Q4DA 3KBMA 1FWBC 3C3NA 2ZYFA 4DYEA 1ME9A 3G0UA 5LNVA 1PSCA 3BJTA 3N29A 3SSZA 4IOTA 1MRAA 3WLHA 5A6SA 1XP3A 2R14A 4N9CA 3V0UA 5U4NA 3M5ZA 2GUYA 1TJPA 2XG9A 2XUCA 1I4NA 1J5TA 3W6MA 3WQOA 5K9CA 1MXDA 2W92A 1JVNA 1Q6EA 3P82A 1UKSA 4XZ9A 5I23A 3W7JA 4LS0A 2VX6A 1XPGA 3JZEA 4IZGA 4LALA 4IFOA 5LA0A 4PTWA 3KHDA 3RX2A 3E5BA 3PPGA 1KCZA 2PDQA 3ZYZA 1AZ2A 3WF3A 1JL8A 3M4HA 1KV8A 4IF2A 3KS5A 4GZ7A 3BLLA 2UY4A 2VELA 2VVSA 5FAGA 3ARUA 3FK4A 3ARTA 3IRSA 3E0LA 3DYPA 2QT3A 1EBHA 4WLCA 3BLOA 1NDYA 3DAQA 2QUVA 5KITA 5C7HA 5ABEA 1B90A 3WFZA 1OVDA 3PNUA 1I2PA 4ZO9A 2Y63A 3ME3A 4H2HA 4JTJA 4DJFD 2VRJA 1WDDA 1FX6A 2PU1A 2V5KA 2XVGA 2Q3RA 3SRHA 4WSKA 4D8ZA 3TWBA 3UF9A 5LNSA 3B3DA 3BXWA 3I7QA 4LFYA 3DDMA 1J93A 4FK9A 1XLMA 2EAWA 3IVSA 4ZOBA 3EXTA 4PUMA 4Z0SA 2J7DA 4DJFC 1JG9A 3N2TA 4ZXOA 3ITCA 4LYQA 3W7NA 4RZ4A 1HFBA 1SZFA 3AU2A 1SUXA 2Z1SA 4X0NA 4HGXA 3APTA 1UD5A 3T09A 3R25A 2EO7A 3XINA 3VD7A 2WNWA 4GKTA 4K2SA 4LYKA 3N2MA 2J24A 1GVYA 3E96A 3LSBA 1UQYA 3WNPA 1V6YA 2C79A 4QQUA 2PODA 3AXHA 1H4PA 3N11A 1HUVA 3GC2A 4M51A 4R3UA 1LQ2A 2PTDA 3K2GA 4QDMA 3EKZA 3C56A 5A95A 4O1CA 3QMSA 3UG4A 3R0DA 4ERGA 2CEQA 4AAJA 5HWJA 1I6NA 3F2BA 5AHFA 1GOIA 1W0MA 2TRSA 4C6FA 1XDJA 1W56A 1IZJA 2Y7FA 4BWLC 2GK1A 1JAKA 4GNKB 1U1HA 3KVJA 4UCGA 1TPEA 3W7CA 3O3RA 2QJGA 3TLLA 3BGGA 3EWCA 1JRCA 1UIOA 5KINA 1QHOA 3U2OA 4HK6A 2WBGA 2X0YA 1XRVA 1SGJA 3UNTA 4J3TA 3A4XA 4AIEA 4L1GA 3T8QA 4U5KA 3FA3A 2HXTA 4S3DA 1U33A 4ML9A 4TQTA 1EPXA 5CJNA 5EFDA 3W87A 4CNNA 1JDDA 4AWEA 1RQBA 5EKYA 3M5YA 3BJSA 4F0KA 4JTLA 1VRXA 1XLAA 2HJPA 1FKXA 3B0UX 4JXCA 3FEMA 3PB2A 4UQAA 3HJEA 1B5TA 1A49A 3EX4A 3TYUA 3L2LA 2QUUA 3N2BA 2ZZ5A 4FOJA 4DXXA 1Q4WA 5CZSA 4U3CA 3VMNA 1GQIA 3P74A 3QHNA 1XFBA 1M9HA 3V0SA 3GX9A 4NF7A 1HJSA 3MCOA 4Z42C 3N9SA 3CZJA 1A5NC 3DFHA 3SCPA 1GZ1A 4AF0A 1ZBCA 4D8AA 1WYIA 1MXSA 3DBPA 4CCZA 1U2YA 4V1YA 1KQZA 2XGBA 4UXDA 4QX4A 1Z7AA 3O6YX 2YCIX 4JBRA 4MIMA 2PLMA 3AO0A 2V30A 2FYMA 1FFRA 2ISWA 3BE7A 1ITUA 1G67A 1LL4A 4AWSA 1JIBA 4XQ6A 3RXZA 3G1RA 2VR5A 4FNQA 4Q4QA 5AY7A 1OC7A 3BQ6A 1JCNA 1KKOA 3P0XA 2NX3A 1ONWA 2Y89A 3MUCA 4A21A 3DFPA 2ZX7A 4DF1A 1QRQA 3QVQA 4FR1A 4LYRA 2WYSA 3F4CA 4M7TA 1OD8A 2ZUWA 2JEQA 5A6LA 4Y9OA 5BOEA 2XWEA 3U2ZA 3GRIA 3GDKA 4HA4A 4OV4A 4S1FA 3DENA 4J2MA 3B9AA 1TPC1 1XIHA 2RJGA 3HOJA 4WKHA 3GG1A 1XIIA 1K77A 3BVJA 3W0KA 4DEFA 1A3WA 1BFNA 1EOKA 5A5WA 2FGBA 3VM5A 2XSBA 4XAFA 1EZWA 3PULA 3M46A 2V6AA 2Z2AA 2EPKX 1GW9A 3O63A 4Q7IA 4O19A 4Z08A 1K02A 1UROA 4FX7A 3BSMA 1MYRA 5D2YA 2J8GA 4TVDA 4IIEA 3WLKX 2J47A 1X39A 4R34A 4Q8NA 5C2GA 4W8LA 3NQDA 2X1TA 3M9YA 1DJIA 2GGHA 1LUCB 2E8ZA 3WQEA 2XTKA 4O16A 2E6AA 4DBWA 3TKFA 5JMUA 4EXAA 2ZX9A 2YW3A 4LV9A 3AYRA 3IGXA 4DJFA 1PV8A 2AKZA 4FS9A 4PCSA 1UASA 1LBLA 2OQLA 4YLWA 2OKOA 4S2BA 1NWSA 5IOBA 1F74A 1C7TA 2BNJA 1ZRQA 3FJ4A 4O18A 3IK2A 4L6DA 1PX8A 1SZEA 2BHZA 1E9LA 4TMBA 3TONA 3BJFA 1TV5A 3TROA 1SR0A 4LNCA 3NSMA 3C0SA 1YE4A 2ZUMA 2ZXAA 1QATA 4Y9MA 4H9YA 1JQXA 1X98A 2GWNA 5J5DA 4GQQA 3G1HA 4XISA 5H8PA 1J4EA 3C2RA 2L5HA 4BZYA 2CWXA 1ME7A 2E9LA 3TMQA 4JQ2A 3EB4A 1H50A 4E8GA 1JCXA 1ITCA 1O5QA 4XD3A 3BOXA 4Y9NA 4IPPA 3VOGA 3IVTA 2ASHA 3ALGA 3KCOA 2QCDB 1J5SA 4HHMA 1B31A 2W62A 3C0QA 4DYJA 4ADUA 4BWLA 2ZWYA 1EFZA 3PTKA 3L4TA 1XHGA 3ZT7A 2OLSA 3UWZA 4XZWA 4WD0A 2R82A 3E49A 4O1DA 4HPJA 2ZZ2A 5JH2A 5DRIA 5E93A 4HN8A 1FDJA 1ONEA 4HZMA 2V3FA 4QLKA 4ZO8A 4MWAB 1QO2A 5DRCA 1EJTC 4DBUA 1ZBWA 4JQ4A 4KIEA 1P4CA 2ZKMX 3OLGA 1UQZA 2VX4A 4IT1A 1NH6A 3ZT6A 3FDGA 4CQAA 4J3XA 1L6FA 4W87A 3FCPA 1E6XM 4QAWA 3VNIA 5FL1A 4NNBA 1QMLA 2DH2A 3BLEA 2WB5A 4GUHA 4M7SA 5LIYX 2VKZG 4ZO7A 1HL8A 1Y5WA 4PEKA 1OFBA 4PUNA 3O2LA 5AHLA 2E1WA 1M68A 4DQWA 1VCGA 4QSHA 3WUFA 3B8TA 1KA9F 4FNUA 4IMAA 2I7GA 4RPPA 3I6RA 3NOEA 2Y88A 2WJZA 3H7UA 1X1ZA 5E5CA 5KZEA 2CLKA 2HV5A 4NAFB 3CUIA 1EZ2A 5EMYA 2NSOA 1Z69A 2CNCA 3GDLA 3HG5A 1RPKA 3CPRA 1XLIA 2O56A 3WJZA 1DBTA 3DG3A 4B5NA 2ZA2A 4RL3A 4J2PA 4KRUA 2QUTA 5BU9A 3CIXA 3MS8A 2NQZA 2YCEA 2A7RA 2Z0IA 5EMKA 4R33A 1WDPA 1PHQA 4O1BA 5J8LA 1KBKA 2QIWA 4M8UA 1AQFA 4HPNA 3B9NA 3CYVA 2QF7A 3CWHA 1VHCA 1OCQA 4DBEA 2ALDA 5CBIA 3W7LA 4I7UA 4GVHA 3W24A 2NV1A 4POCA 3FDKA 4B92A 1XRSA 7TAAA 3NURA 3MBFA 3W85A 1FWWA 4E4FA 2VHLA 1Z8AA 5AYZA 2CLFA 4WHBA 2YL9A 3T6CA 2BFGA 3ARPA 3UZZA 1IXNA 4F2UA 1Q3NA 1DWFM 3O16A 2WHMA 4IPLA 5T9BG 3GBDA 4AMCA 3TN5A 1YNYA 1X6UA 2PDPA 3W1NA 5DCBA 4HHPA 1B4KA 4TTUA 2YYUA 3N3MA 2VI0A 4BHYA 3HQPA 3JU2A 3UERA 1K6AA 3FYYA 4FIQA 1EQCA 5CZ0A 3WK1A 2XH2A 1QNOA 1V0MA 1XGEA 4IP7A 2WMIA 4HOXA 1VD6A 5D8WA 2EEXA 1A3XA 4QXIA 3W4RA 3RMEA 2PLCA 4JHZA 1ZENA 1LROA 4IISA 3A3HA 3FJ6A 5BRBA 2HMCA 1UA3A 2ZRYA 4JEQA 4N7QA 3KRSA 3VNLA 1US2A 3LU2A 4UZUA 1PE1A 4LANA 3L5MA 4QEEA 1UH2A 2JKEA 3P84A 1CCWB 4Q7BA 4ZTYA 4WCJA 4S3FA 3SW6A 4JFVA 1BVNP 3KOWA 1WNOA 3IVUA 3SGUA 3R58A 4QG9A 3GTNA 2OLAA 1A50A 3CASA 3SGGA 5A2BA 3FA4A 3QSRA 2O9OA 1QOQA 1QUMA 1JF6A 5KMYA 3BMXA 5HQLA 3E12A 4FX8A 1YXDA 3HBLA 3TOYA 1WP6A 3VM7A 3VKJA 1F8IA 1T5AA 1TIMA 2JKAA 2PMQA 1KC7A 2VEFA 1ZAJA 1EEXA 2CZFA 2NVAA 2QJMA 3QHOA 5BU6A 4W7UA 5KZMA 3RNDA 2OG9A 5DMMA 2HSAA 3UZWA 3N25A 3RU8X 4I6VA 2A7NA 1E6NA 4B3KA 1PWLA 4GY1A 1EJXC 3CL6A 5DMYA 3ARVA 2YA1A 1J11A 1GOOA 1IR2A 2EGZA 2OOFA 4CUCA 1XLGA 4IX0A 1X38A 4KF1A 3W7GA 3IIOA 2W79A 2FVLA 3UA3A 3CZEA 4P2VA 3GUGA 4LJ3A 3UJSA 3KRBA 2WZTA 2Z6IA 2HS6A 4LVAA 1ECQA 2ATMA 4F0LA 1NSJA 2EG8A 4RJEA 1J6PA 4DVOA 1QNPA 1EEPA 1VJSA 3TFCA 1OT2A 3ZLGA 3W6YA 4PMQA 5G1TA 1W9XA 4PGLA 3MYOA 4GIYA 2I9EA 3RM8A 3W7OA 1LOSA 4V27A 3ANVA 5C2XA 3OODA 1KB3A 4XX6A 3PUEA 1W1YA 2TYSA 3SCQA 2YR1A 4CU6A 1FWHC 4NYYA 3AICA 4MKSA 6ALDA 4MY9A 5T91A 3MZ2A 1W3IA 3NVDA 3MWAA 3L5LA 3KCLA 4IG2A 1W31A 4GGBA 4XUGA 2VGIA 4FNPA 5I3JA 2A6LA 5EA9A 3W1RA 3NXLA 1FWDC 1VS1A 3T2QA 3P5YA 3SZ8A 2BZNA 3R13A 4KBXA 4RZ6A 3HF3A 4GO9A 3S4TA 3NSXA 1HL9A 1BXBA 3C4UA 1J0IA 4G7FA 3R94A 1EGVA 4QM1A 4O0QA 1KKRA 3QSTA 2FMNA 2DZWA 3QJAA 3LXBA 4EKJA 3BAXA 3UETA 1E55A 4UR8A 2F6KA 4UCFA 3NO1A 5LNUA 1DWGM 5D2WA 3PZIA 3SN1A 4WY0B 1TE1A 2X7WA 4IMCA 1O60A 2CLHA 1OX6A 2A4AA 2OELA 4PMYA 2QJHA 3W37A 3NWRA 3O0FA 2PFHA 4RK8A 3CZ8A 4DLFA 1OFOA 2BOEX 4NSBA 1FWIC 3H53A 3P61A 4XUYA 4YCOA 3JUGA 2ZZ7A 1H1NA 2PGFA 4P8UA 3NIYA 1E6RA 2Y70A 3D3AA 4RE2A 3RN6A 4UWMA 4GQRA 2ICSA 3POCA 2CZ5A 2PWDA 2CKRA 5EYWA 3RPMA 4FR6A 3LQGA 1O1ZA 3NDYA 1JFXA 4J7RA 3TC3A 5F2IA 4L65A 3WNKA 1AUSL 5DQPA 5CC6A 5G2HA 1XL9A 3W29A 4K37A 3PG8A 1ZQ5A 3UR7A 1Y5XA 3U9IA 4PCFA 4KCVA 3NDZA 4ZSTA 3B97A 5K2ZA 2FZMA 2X0HA 4LUIA 3ZJKA 3XIMA 2VGFA 3F03K 2XFRA 3WD4A 1L6WA 3KOFA 3HM7A 2CLMA 3GWQA 3QGVA 2FB3A 4ZOEA 1DORA 3QOMA 2XIIA 4DIAA 3CMJA 1JXJA 5A8QA 4MLRA 2ABBA 3RAOA 1L6YA 3KTXA 3S2JA 2GQ9A 3TQKA 5DCDA 3AXXA 3WH9A 4C5ZA 1RBLA 3VD9A 1CWYA 2BGQA 2O4MA 2WC7A 1ZZMA 3BUVA 3WJYA 5K9XA 2PDFA 3TQVA 5AVHA 2ZC1A 1BQGA 1FP8A 4UB9A 2Y61A 1NOWA 5C5YA 3VIOA 1UIPA 1F76A 4Y7EA 2CBIA 4XKYB 1WKDA 3E9AA 4GJJA 2X40A 3WQGA 2VC7A 3HPAA 3W7QA 3EKLA 4HMCA 3LYEA 2G4FA 4KWUA 3O07A 4KMQA 5DXXA 3QKZA 1P0EA 4RW5A 1AVAA 2EKGA 3WQ4A 1W3TA 3G1SA 3UWWA 1EIXA 4JICA 3GC5A 4GGHA 3WDRA 3N15A 3H12A 1E73M 3PANA 8A3HA 2FHFA 2A1YA 3S5SA 3N3TA 2YFOA 1DXFA 2WANA 3LB0A 1R3QA 2VP8A 1ADOA 2GJLA 3UR2A 1NWRA 4ZB0A 1I75A 3T0TA 4CD8A 3EWBX 2Y6ZA 3KL3A 3KE0A 5HOSA 4UTTC 2GDQA 5F4WA 5C54A 5HR6A 1GVRA 1U83A 3QOKA 1LORA 4D6FA 1BF6A 1TMLA 4RNFA 5HBFA 3ITGA 3ONCA 3N13A 3N18A 4ZQRA 2EG7A 4O1EA 4QE1A 3M6DA 4ADTA 1KLYA 1BWVA 1I0BA 4G7EA 3MCNA 5A2CA 2FHBA 1WDSA 1CGXA 2V8ZA 3AZTA 1PL9A 3ZR5A 2OX1A 1SM9A 1V6VA 1ISWA 2OT1A 2ZRWA 2POTA 5IXEA 5HPOA 1DJNA 4C1LA 3GR8A 3EWUA 2JGYA 3CH0A 4DELA 3B0VC 1HO4A 3BDKA 1TPVA 1FBAA 5A8OA 3S9YA 4FHAA 2P88A 3AMGA 2VOMA 5KZ6A 1DL3A 1JPHA 1QI0A 1TCDA 2PURA 5I00A 1W1B1 1EOMA 5LIKX 1UKTA 1E0VA 3TUUA 3CLWA 4DLMA 2XM1A 3QZEA 3N1AA 2ADAA 1AH0A 1X96A 3N14A 3BQ5A 2CXGA 3M0MA 1AQHA 3T40A 1YNPA 3LHYA 2VC5A 2YYTA 3TCEA 4EPEC 4UTIA 2PP0A 4QJ1A 4N9BA 3RPTA 3T8LA 1QI3A 4BK9A 1RBAA 4MB5A 5BXRA 2OX4A 1JYNA 1JNDA 4YN5A 4PMZA 1V3LA 4PUUA 5BZAA 9XIMA 3B04A 4GJIA 2DU2A 1RSCA 2QV4A 2OR2A 1UPMB 3NCOA 1EKOA 4DO6A 1IT0A 4IMDA 1AMYA 3CQJA 1FH7A 1F3XA 4DF0A 3HGRA 4BI5A 2IQ0A 2DSZA 3OGVA 3WH6A 1P43A 3QV8A 4KETA 4C6LA 5IBXC 2FJKA 1E0UA 2VR2A 4EE9A 1BF2A 3DHPA 4M19A 2VEGA 1JDAA 1VFFA 3CPGA 3B0YA 4MJ2A 1CB7B 1N82A 3PBYA 4ECLA 2P3ZA 2R8WA 5K7JA 1C92A 2X2YA 1NJJA 3UYCA 4PMNA 1DOSA 1NOUA 2B31A 1W54A 1OBAA 4MKVA 3ZOAA 2XU2A 2IXUA 2PDMA 3SFKA 3MCMA 3W1QA 5HK4A 2EJAA 1PTDA 4R9XA 4XAZA 4LEFA 1RHCA 3PUOA 3EYPA 4ZVJA 4AD1A 4YTQA 4AMAA 2H9AB 1YBQA 2I9UA 1H0GA 4BR1A 1TV7A 1P1MA 3U48A 3THDA 1LWIA 4WJXA 4ZFMA 2ZXDA 2RDWA 1KRCC 2EPMX 3BGJA 4MJMA 2PP3A 1XICA 4B5TA 1H3GA 4LU0A 2QPSA 4HNOA 4I9MA 1OJXA 2D0GA 2A85A 1YKWA 2Z1VA 4IH3A 4Q33A 4RX0A 4LNYA 4CU8A 5M2FX 2HWGA 2VC9A 3MMDA 3VIGA 4ZGYA 5HNUA 5F1VA 3GH7A 4JX4A 1LT8A 3VOCA 3A22A 4Z2HA 3HFYA 3I65A 1MW1A 4UTKA 2JK2A 1SW3A 3DG6A 4OTKA 4ERIA 1DQUA 1R3RA 1EPVA 4PYSA 4BA0A 4C7GA 2CHNA 2I5QA 5D2XA 4ZQCA 1GNXA 1TWWA 3GDMA 3R89A 1T41A 1F05A 1ONXA 1KTNA 1E4MM 1YW1A 3TTYA 4ZL1A 4GXMA 4CCCA 4D6HA 1H09A 2RHGA 1LG2A 4JY9A 3UR5A 3GVRA 3FFSA 4NZJA 2WJFA 1GJPA 1VAHA 4BQ2A 2FFIA 1GCYA 3TR2A 1XXXA 3AZRA 1G7VA 2YOCA 4HMDA 1PXGA 3T81A 2P5NA 3EXSA 4JIEA 2J78A 4H8HA 1I8JA 2HROA 3O6CA 4Q4PA 2HTMA 4MLJA 3V18A 3W27A 4AD4A 4UTTA 1FWEC 1GPFA 1FTXA 3FGCA 2BY2A 3L23A 5DO8A 4E4UA 4GBUA 1J2BA 3PFRA 4GXWA 1NF7A 2C7FA 3SRKA 1PIIA 3OZOA 2VFEA 2V5LA 4YPJA 4PRWA 2OLHA 1YEYA 1R38A 2BXZA 4CGTA 4A3UA 1S2TA 4IJBA 3A3WA 3RJXA 4AD3A 4JTRA 1UCWA 1VPQA 4JYFA 3OQEA 1E3ZA 1AMKA 3UWEA 1VPYA 1Y0EA 1QPNA 2PLJA 2UY5A 4AIBA 1X97A 2HQAA 2Z7KA 1S5WA 2X05A 1V3JA 4EXBA 4LOCA 3GTHA 4C6EA 3ZVIA 1Q13A 3UZ5A 2O0TA 5E70A 4DN1A 2CBJA 4FXJA 3DKLA 3TJXA 2NXHA 2B81A 1GEQA 4LF2A 3THUA 1B3XA 3S5OA 2EBNA 2JGQA 1PKLA 3KOYA 4PTVA 1FA2A 4CQ9A 3AZSA 1AW1A 2BDQA 4I8YA 3NFUA 3NGJA 4NX5A 1YADA 5ABHA 1E6ZA 1FH8A 4BY3A 1OF8A 3TE9A 6PTDA 1XJBA 3ZR4A 1VBGA 4AY1A 2ZDSA 1UR3M 1SMAA 3EMCA 1E6QM 1FVPA 4O57A 3WQWA 1L8NA 4HA1A 2WK2A 3HO8A 2GJXA 4M29A 3CAWA 3TTQA 4L4LA 3PTDA 4Y8EA 3SCRA 5AN7A 4GPNA 4JDYA 4S38A 4FOKA 3DHUA 4PMUA 4E2BA 4LBRA 1OYAA 2P0IA 1E1CB 3R5EA 3C2VA 2W63A 3M47A 2VOTA 2D22A 2YCJA 2CKSA 3R6IA 2VFIA 1DQWA 3GG7A 1M5WA 3IANA 1A53A 3OYXA 1OM0A 4LEQA 5IHSA 2P8BA 4EK7A 3LRLA 1B54A 5IBXA 4YTSA 2D2JA 1JI1A 4CNUA 2NQ5A 1TWDA 3LZ5A 4F0SA 1O95A 4TV6A 4RNIA 2OGYA 4WQ6A 3C52A 4A2RA 4NZ4A 4QTGA 2CBUA 4PSPA 4QIUA 3UJFA 4FO4A 1A5UA 2WZMA 5IRPA 3HQ1A 4TIMA 4DO5A 1TWZA 2FPYA 3B40A 1W3LA 3NPVA 1P0KA 5BYWA 4XD4A 1SU5A 1OD0A 2PC8A 3GQYA 2GYIA 1FRBA 4DZHA 3UG5A 4GD0A 3SCNA 2E67A 4OQVA 4PMJA 1TA3A 4HYVA 1A5LC 1UZ1A 4NY2A 3OA3A 2WPGA 4N4PA 4PR4A 1EC9A 4QCFA 3WJXA 1NY1A 4E0CA 3ES8A 1EDQA 1W5QA 1ICSA 2OTDA 3D3FA 3NA8A 2D1ZA 4AIUA 2QMJA 4BJHA 1V8EA 2HEJA 1H62A 3LQLA 3N4FA 4W86A 3VFLA 3CEPA 2QXWA 3LD5A 4OBTA 1RUSA 3VIHA 4IQJA 3THCA 2GSJA 2E9BA 2Q71A 5AVNA 1W9PA 4PMVA 1NFBA 1UMYA 1MDLA 3W9ZA 1P7TA 5HMSA 3NO3A 2VEMA 5T8GA 3EMQA 4JQ1A 2FZBA 3BG9A 4A4AA 1TTJA 2DVUA 5CH9A 3CO8A 1S46A 1UWQA 4F0MA 5HNTA 4RNHA 3OVPA 1S2VA 2VNCA 3PN8A 4QQ3A 5FEWA 2PC4A 3UXDA 2W9MA 3RGTA 3O15A 4DO4A 5LYRA 3W72A 3CAVA 3GVGA 2CLLA 1V0NA 2YDSA 4G7EB 3VGFA 3WD0A 4AD5A 2R1LA 4O28A 1MFUA 2J9XA 4O52A 3W26A 1YHTA 3LCLA 1EP3A 2WAGA 3OU8A 4KERA 4QJ4B 3UJEA 2C1IA 4O0KA 1POJA 1UR1A 2NQ9A 4LTSA 4OOZA 3P5ZA 3TR9A 1WX0A 1O7AA 2R1KA 3HG2A 3EA3A 2CESA 3CV6A 4YXGA 1XF0A 3FY1A 2D2GA 3AOFA 1F6PA 3UXIA 3DN5A 3GXNA 3MZNA 3BCDA 1MEWA 4FXFA 4IX2A 3L66A 4G9PA 3R10A 2YX0A 3CHFA 3LMZA 3QKEA 4DXKA 3W73A 1E70M 4GA8A 4XZLX 3AS3A 3WUEA 3GU9A 1W1A1 4BF7A 3GHRA 2QCEA 1LTDA 1O66A 2WC4A 3AMCA 2QAFA 3VGEA 1KFEA 3PAOA 3VE9A 1EL3A 4HNVA 1E4IA 1O6IA 3SY5A 2OQYA 4D1JA 4K8HA 5CLWA 3LXAA 5DXYA 3G3DA 1BSLA 2A3BA 1AQ0A 1VR6A 5D03A 4H7ZA 4YHEA 2DJLA 3R0UA 3VTRA 3DOPA 4MADA 3IPWA 5HMDA 4N42A 1Y5VA 4X61A 1OZMA 3GIYA 1D8WA 1V0LA 2V67A 3VIFA 1UUQA 4O14A 1H1YA 3AU6A 3HG4A 2E6DA 2CCRA 2IQTA 1E5NA 2QMKA 3DFQA 4JFUA 3GTFA 2CZDA 3NJ3A 3LERA 5FF2A 1DTNA 4GISA 4B5WA 1OCJA 2DZAA 1KXHA 3GZ3A 4NJHA 3MYPA 1BVZA 1Z44A 1EHAA 3T55A 5M03A 2J6XA 4XTIA 3VABA 2RDXA 5FKYA 3URQA 1BVWA 4Q8TA 1R8LA 2PWGA 3APYA 1CGTA 3HA1A 3BLIA 4ZZ9A 4PBGA 3WZ0E 5H6HA 4FPSA 1A47A 3U2CA 2D2OA 4Q4OA 3TXVA 4NHVA 3MMWA 3VIMA 2QIIA 1FDZA 2GGIA 3N9RA 2DH3A 1WPCA 4LAKA 1I2QA 3EDFA 1BTCA 4Q3MA 2CHOA 3BL3A 5CPNA 5G2IA 3UCCA 1YBQB 1V5XA 5HAOA 3EX3A 3G2GA 3MJYA 1W3JA 4AZ7A 1GW1A 4DXVA 2YL6A 4A05A 1Q7MA 1Q6FA 2E0PA 1JCMP 4E5TA 4MSSA 4OUIA 3UXAA 1XWYA 4BI7A 2QCGA 3DH7A 4AHPA 4H2CA 5CZJA 3C86A 4C7FA 3WNNA 4ACZA 3D47A 1XLLA 2RJHA 3CHCA 5ABTA 2YCLA 1JZ2A 4LXFA 4BCEA 3AS1A 1TQJA 3B8WA 1C3FA 2V5JA 4YVVA 1WE5A 4N0RA 4HOWA 4ATWA 1T7LA 4R53A 5CPQA 4YTRA 4FB7A 1VCFA 4BQ4A 3TVAA 1ZP4A 1YQ2A 4AWUA 2WSPA 2ZCGA 3GNRA 1TV4A 2XSXA 5C6MA 3WLIA 5ABFA 3NL5A 4NZCA 5A6JA 2XZ9A 1G1YA 1I1XA 2IKIA 7REQA 1K9FA 3UZJA 3ITVA 5D05A 2CC0A 3ABQA 3MSGA 1SFTA 7PTDA 2BVWA 1WZAA 2VZUA 4QRNA 3M6YA 4RDZA 1W2VA 1C29A 4LC8A 5AHNA 1QNSA 5CPSA 5M17A 2ZUVA 2Z4GA 3TW6A 4GMEA 1DXEA 4JS3A 2QUMA 3CC1A 3DFTA 2VTFA 3VILA 3QBUA 3VIKA 4KWOA 2INZA 3GDTA 3BK0A 1QO5A 3RRAA 4UOZA 2FZ8A 2ZA1A 1O94A 2D3LA 3A4WA 4P8VA 2C18A 4IIGA 2X30A 2A79A 4ORIA 4YTUA 3WMLA 1H0IA 3ZJ7A 3F1QA 3PWAA 1XRTA 3IEBA 3TJIA 4UTWC 1CXLA 2CFFA 1S5NA 4PTNA 4QR6A 4ZENA 1XYCA 1REQA 1J9YA 4JIRA 1XCXA 3WDQA 2C1GA 1TJ2A 5D37A 4NZ5A 1HVXA 2P10A 2XFWA 1LQAA 3SN0A 4AUBA 2YLLA 3N4EA 3GKFA 4I9TA 4US5A 3GU1A 2GJNA 4LAOA 4DAFA 3PB0A 4C6KA 3E0FA 1VJZA 5CCZA 2BMBA 3IK4A 4XG1A 5HNNA 4O4VA 2OCZA 3W2JA 1U5HA 4ADSA 3PNZA 1VFHA 4Q8VA 3I7SA 2Y0FA 2B7NA 3BTNA 2GJRA 4J40A 3TXZA 4HNNA 4I5UA 1OX4B 3ATYA 5JU6A 2J4GA 1SO5A 1V6UA 1XYBA 2BHYA 2X8RA 2PB1A 4PCNA 1R30A 1C8XA 3W1TA 3TP4A 1JCYA 3ISIX 1SSDA 5FI8A 4Z2GA 3AQUA 1JEZA 3W2NA 2OZ3A 1A5OC 3UD6A 4UC5A 1V7YA 6REQA 2Y1HA 4C6IA 3H8AA 5FF0A 1G5AA 1ZCOA 3S1UA 1CECA 2GJXB 1V3IA 3ZQ9A 4IGHA 2XSAA 2P50A 2J74A 3AIWA 3V0TA 1V3MA 3UU0A 1US0A 3G1DA 1EXBA 3RG6A 5M3WA 3W23A 4F79A 2OGJA 3G1YA 2WCGA 3SGZA 2QLYA 5D8ZA 3VNDA 3MY9A 4FMVA 3OIXA 4QHRA 4JTFA 2DFAA 2NLYA 3UCDA 1J0JA 4R85A 1IEIA 4GC3A 1BYBA 1V6XA 4DM2A 1UH4A 3OBEA 2ZTKA 1UD2A 4PTXA 4GZIA 5K9DA 2F38A 5LZLA 1HG3A 3EX2A 2CW6A 2J27A 3ARRA 1AH4A 3GW0A 1KFLA 1Z3NA 1UUOA 4WOQA 2OFJA 3B05A 4MUPA 3T0CA 1DWJM 2GVEA 1KM6A 2QDGA 5DF0A 2I57A 2ZVIA 3R8GA 4AD0A 1ICQA 4CNSA 1FHLA 1NOFA 1TA3B 4FF5A 5HWNA 3OVGA 1OFDA 1VB9A 1TPH1 2FGLA 3R4IA 3WF1A 2CLOA 1GQKA 5C0QA 1EYEA 1ZJIA 4HD5A 1UWIA 4C6QA 5LGZA 3KBJA 2PDKA 5I79A 1E9IA 1TMQA 3RCMA 4L80A 3WL1A 1QTWA 1E15A 4GIRA 1GHRA 4A8LA 2WLYA 4G56A 4LUSB 2E40A 4NUWA 3VX1A 3NPXA 2DY3A 4O0ZA 3LHWA 1CTNA 4MGGA 3I4EA 4O8AA 1JQVA 1XC6A 4NKCA 3VINA 3QR1A 1R2SA 4MDPA 1RAKA 2PTWA 1FWGC 4JKKA 4WDUA 1LLWA 4H01A 1V02E 1UKPA 4CNOA 4ZMGA 4G1KA 4WSJA 1GQNA 1ISYA 3S5NA 3DFYA 3I3BA 2ZX5A 3IIZA 1AJ2A 4EIVA 2A3AA 2Y8UA 4J3SA 5REQB 3W71A 1ZALA 3T42A 3G1XA 3W22A 4CQ8A 1ITXA 1SO6A 4AZ5A