3W73A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-129
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-129
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w73A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w73A01
2OT0A 3DAQA 5FEWA 2Z1BA 1S5WA 3M0ZA 5D2YA 2H3BA 3QW3A 4QNWA 3V1PA 4IMEA 3I7QA 1FWRA 4JYFA 2GVJA 3UWQA 3BW4A 4NJIA 2Q8LA 1OYBA 2E77A 3NEVA 1LZOA 4XKYA 2ZRWA 4RXFA 3HQ1A 2Z6JA 1LBLA 4H6KA 1JRBA 3HOJA 4C1LA 3C2RA 2B7NA 2Y7GA 1ZNNA 5D09A 2Y63A 2E6YA 1YDVA 3P8JA 4MYAA 4Y90A 4UTUA 1D9EA 1H7PA 2I9EA 4D2JA 3N73A 3BG9A 2J24A 4DO5A 3SY5A 2JGYA 3C8FA 1K8ZA 4GWEA 3TFXA 1FX6A 1SW0A 4O1AA 2CW6A 3NPWA 3ANYA 2RDWA 3QRHA 5G4WA 5F2MA 1BKSA 3TJLA 3NPXA 2WNNA 3M47A 1OYCA 3OBKA 4UTMA 1TPUA 5IBXC 2ZZ2A 1XFBA 3W1TA 4JTSA 5LNSA 3DBPA 1C29A 3EWWA 5FESA 2ZZ3A 1VZWA 3O8AA 3F03K 4YCPA 1SZNA 4XBSA 4BI6A 1TO3A 1K3UA 4UMAA 1W5QA 1LRQA 4LV4A 4JIPA 4KFPA 4UC5A 3TC7A 1EP3A 3W7CA 1XCFA 2H8XA 3LLDA 3SIZA 1UASA 2HTMA 5LKYA 4AH7A 4EVZA 3B04A 2A6LA 3MWAA 4JR5A 3LXBA 3IRDA 4YL2A 4Y9AA 4K6AA 2TPSA 5G2HA 4IUOA 4KFOA 1EEPA 3GYEA 1SSDA 2CLKA 2ZRZA 3KXQA 1DVJA 4I7VA 2C15A 2RKXA 1VC4A 1F6KA 1SO3A 5D32A 1SFLA 2QCNA 2XN2A 5FF2A 3UWVA 3ZWTA 4LVAA 3LCFA 4FF7A 3W7QA 1O5KA 5DCDA 3T40A 2DZVA 3W7KA 4Z0JA 3GAYA 5EYWA 2ATSA 2VFIA 5FI8A 1H7NA 3KVJA 4GC4A 3HF3A 1W0MA 2B4GA 4ICNA 1FDZA 1XXXA 2ZA3A 2F7FA 3MI2A 6TIMA 3S5NA 4JY9A 4MFEA 5EL1A 4O57A 3A23A 3GNNA 3QMRA 1VYPX 1JUBA 4K38A 3QC3A 2QJHA 3EWYA 2DORA 1JCYA 4O16A 2Q3RA 1VRDA 4IJBA 2R94A 3TSMA 1B57A 4RZ6A 3W7LA 1JULA 1WBHA 1IXNA 3VKJA 1XBVA 4XWUA 3H53A 3TSDA 5AFDA 3DU0A 1R2SA 1QO5A 2F84A 4X2RA 1VCVA 4ZVJA 3DFQA 3P62A 2QCFA 4RKAA 3CEPA 3MMTA 4NNAA 1XI3A 3OG3A 4ZQPA 5G2IA 3GXTA 4GUHA 4O12A 3MYOA 5AC7A 4A2RA 4IWWA 3NG3A 1YDOA 3LTSA 3FLUA 4LOCA 1YADA 2VFEA 3P5YA 1ICSA 1FWNA 4FX7A 3FEMA 1YTEA 1DL3A 1K7XA 3EXRA 2Y85A 1LP6A 4I7UA 3HG2A 3W73A 2QCMA 4PEKA 3HG5A 4IXXA 5AHIA 3Q94A 5AYZA 4YWIA 4JDYA 3TJXA 3M44A 3OVQA 4HNVA 5G1YA 1LYXA 2VEMA 3W76A 1TREA 2QEZA 2X1TA 3CTLA 2FJKA 3M41A 1ZAIA 3CB8A 1YPIA 1S5TA 3FJ6A 3HPXA 2FB2A 1Q45A 4JTHA 4LC8A 4K8HA 1FCUA 4WOQA 3LI0A 3NVTA 2ZRXA 3I7RA 2QDGA 4R34A 4NU7A 1RD5A 1FWWA 1V5XA 1LBFA 3STCA 4FEZA 1F5ZA 2CLMA 1BWKA 1Q6OA 2X30A 1E51A 3EKLA 3BW2A 3RLUA 2Y7DA 4FHAA 1GEQA 3NZ1A 2ZYFA 4AVFA 1F73A 2QCDA 3YPIA 2ZA2A 1Q6RA 4LVFA 1ZJIA 5HR7A 3HGJA 5HQEA 4Z1BA 2DJXA 2EF9A 1UUOA 3TXZA 3W23A 3W88A 1W56A 4A29A 3KVKA 1GPWA 1SPQA 3NQAA 2WO5A 1FBAA 3DZ1A 4OE7A 1PCKA 4WZHA 1BTMA 1LLWA 3PBVA 2Z0IA 1H50A 4LTSA 2QR6A 1SQ7A 1KM1A 4OU1A 3GR8A 5AHMA 1P1XA 5FF4A 4MVAA 1VHCA 5EBUA 3W1LA 3MW7A 4KKXA 4UIOA 1GG1A 1ZFJA 3F4WA 4X22A 1B3OA 1EA0A 3I68A 2ABBA 1HFBA 1DOSA 3W2NA 3TAKA 4AF0B 3BGJA 4WXZA 3ABRA 3TXVA 5BMXA 2CLFA 5K4ZA 4EF8A 3AJXA 4PL1A 3L5AA 3O06A 4DBEA 2A85A 3GKFA 3EXTA 4S1FA 3QM3A 1MEIA 3GAKA 3DI0A 5LHFA 1TRDA 2WNQA 4Z08A 3QPYA 1LOSA 3LTPA 3LTYA 1L6WA 3VE7A 2JBMA 2V30A 3IVTA 1TPEA 4O14A 1ADOA 1YLVA 1TCDA 4AWUA 3C6CA 2V5LA 2YW4A 3NQGA 3IIVA 3W2MA 2QJIA 5IM51 3FJLA 3ABSA 5LGXA 1L9WA 2EAWA 4QSHA 3T44A 5K9DA 1FQ0A 3O63A 3IIZA 2C3ZA 4CLMA 3VI2A 1WBJA 4O0KA 4XBKA 3MHGA 4JN6A 2QCEA 4UFMA 3KHJA 3MBFA 4RJEA 5I3KA 2EPHA 1WOAA 2NWRA 3LHWA 1TJPA 2HS6A 2PURA 3IV3A 4NJGA 3M16A 2E5DA 3BK0A 3KFTA 3S1UA 3NPUA 3NAVA 3SSJA 4JYEA 3MI3A 3VFLA 2GOUA 1XUZA 1LLZA 4UR8A 5CPLA 1SR9A 1VPXA 1KM3A 4AF0A 3JR2A 3LHYA 3PBYA 4DF1A 3R2GA 1TTPA 5AHNA 2JKPA 3TW6A 3LBMA 1SSGA 3MHFA 3PSVA 5LNRA 3G1VA 3P8IA 2QUVA 1OX4A 3FS2A 1XC4A 3IIXA 1QMLA 5L9FA 2DJLA 1ZAJA 4M7TA 3FKKA 4O28A 1A5CA 3CWNA 1PHWA 4Z1AA 1FDYA 2Y61A 1VH7A 3PR2A 3UPBA 1W5PA 3EWUA 4OHQA 2CWNA 3QJAA 4HPJA 1KM5A 2E6FA 1KM0A 5CZJA 4TR9A 1O4UA 4RCXA 5SWUA 4IX0A 1TPWA 2HMCA 1QOPA 2R14A 2WSQA 3P74A 4IXHA 2QCLA 3DXIA 3LHUA 3PAJA 1G67A 3W07A 3CWOX 1B4KA 3M5YA 1W5OA 2C19A 2CFFA 3L68A 3THQA 1N8FA 3PF3A 3O16A 3L0GA 2PRLA 5KITA 3VCRA 3HG4A 3EX6A 2E1DA 3G1AA 4O18A 3O15A 5F2GA 5F1VA 2FIQA 3E49A 2R8WA 4LS1A 3BGGA 5D02A 5E93A 4MY8A 3CM4A 3RLVA 3NZRA 3LCLA 3QQ0A 4CNOA 4H3DA 5DLCA 2FPVA 1A5SA 3HO8A 3UZ5A 1GQNA 4WXYA 3DFSA 3LV6A 2GUUA 3IGXA 4LU0A 1PS9A 3OVRA 3W1RA 4UTHA 3OIXA 2DZXA 5CGQA 1PCWA 1QPQA 4UFLA 3W7PA 2V9DA 4O1BA 3W2JA 3ATZA 3HGRA 3THAA 3IEBA 1TTIA 1SW7A 2QAPA 3LCIA 1JCNA 3M43A 3NM3A 2A4AA 4NJHA 1V7YA 4O50A 5F4XA 1Y0EA 4EF9A 3WK3A 4P2VA 3NQCA 1NF0A 1PVNA 2YPIA 3RK8A 4LNYA 2J6XA 1H60A 4UNLA 4L4MA 1OX6A 2G97A 4BFAA 1OFDA 1JCJA 3C52A 3LCWA 4JY8A 4UFKA 4GJ1A 4KFNA 3TC6A 1OFBA 3W85A 3W7HA 1H7OA 4IGHA 4UXDA 4X9SA 1I2OA 5FF0A 3TSBA 3BLFA 4O17A 4S2CA 4W9TA 3W74A 5DCEA 3FIGA 3G1YA 1GTHA 1HG3A 3TUUA 5AC8A 4N02A 3HG3A 3VE9A 3HBLA 1G7UA 4MYXA 3S9YA 2G95A 1TIMA 4XZ9A 4O4WA 7TIMA 4WJEA 3GXPA 3LXCA 4OBTA 2W6RA 2P10A 4N6FA 1IIHA 1I2NA 2X2GA 4N9CA 2ZBTA 1NEYA 1ZENA 3HPZA 1FDJA 2WSRA 1X1ZA 1X7FA 2YW3A 4K7VA 4WOZA 1WXJA 4O8RA 3W87A 1KV5A 4DPQA 4J9JA 4WUIA 3G18A 4ZZ9A 3W7JA 3P61A 1GOXA 3MP4A 5AYYA 4IMFA 1I2RA 4JTIA 4P61A 2RFGA 2RDTA 4A22A 1EP2A 4N9DA 5I3HA 1XL9A 2V2CA 4WY0F 3SECA 2H6RA 4LW7A 5AB3A 2GQ9A 1TB3A 3NXFA 1J4EA 3QZEA 3LHTA 3QEZA 5KZDA 3LB0A 1VCFA 1G4EA 3NQ8A 1LM1A 3OEXA 2VENA 3EXSA 1HTIA 1IXPA 3L5MA 3BLEA 2BSLA 1I4NA 2A5HA 4G1KA 2NXHA 4XTDA 3E0IA 5G2WA 3PWAA 3NOEA 3RMJA 1UJPA 1PV8A 3UD6A 4ADUA 4NNCA 2B0MA 1WQ5A 3TA6A 2E6AA 1W5MA 3W22A 2WQPA 2B7QA 5AOUA 3BO9A 4GNJA 1VQTA 3MP3A 1WYIA 3NYZA 4FNUA 1QPRA 1M5WA 4LUJA 8TIMA 2G96A 1W3IA 3H55A 3L9CA 3ZR4A 4LS0A 4PTNA 1JJKA 3W84A 1LORA 3QFEA 3EKZA 3W1PA 1A50A 4ZQOA 3NL2A 1FUYA 3B0PA 5LNUA 2ISWA 2AGKA 4Z1CA 3C0JA 3GDTA 4JTLA 3T7VA 5F4SA 1ICQA 4U4MA 3AO0A 2PE4A 5K3VA 1HUVA 5BW6A 3B4UA 4UTLA 1CW2A 3PUDA 4CNPA 2E68A 1P0NA 3MBDA 2NZLA 1AW1A 2NUWA 1OABA 4O54A 1L2UA 4UTWA 4LVBA 3A9IA 2BZNA 4IMGA 3GK0A 5C5YA 1A5AA 2ISSA 3HJZA 3ABQA 3LCXA 3TMQA 5CG7A 3UY8A 1KFJA 1SW3A 1XDLA 3PUOA 3LDVA 3SJ3A 3T78A 3FYPA 2RH9A 3NL3A 4DEFA 3B05A 3N2MA 4NT0A 1NVMA 5C54A 4QIUA 1FCQA 5EPDA 2A6NA 3PG9A 1EIXA 3C4UA 3O1NA 3P80A 2EGZA 5E0KA 2OJPA 4LS2A 3TX9A 1F05A 4MJMA 3QSTA 4O13A 1RR2A 5D03A 3G24A 2V81A 1J2WA 1OFAA 2UV8G 4UCGA 5K2ZA 3BG3A 3G1SA 1EUAA 3LERA 3R13A 4UMCA 3GR7A 4JTEA 4MOZA 2XFWA 3LRKA 2DP3A 1YDNA 4XQ6A 5HULA 5EY5A 2CZFA 4HSNA 3W2KA 2VFFA 3EEGA 4IOTA 1O5XA 5AHLA 3MYPA 3G8RA 3U6WA 2DU2A 3LGEA 1IXOA 5ABTA 1XBYA 3WJZA 2CLOA 1VR6A 3BVJA 3H54A 4RZ5A 4JX4A 5G1TA 2BTMA 1H7XA 2ZZ6A 5TQLA 1X1OA 4ORMA 1OFOA 1QAPA 3W2LA 4ZQNA 3CIXA 1Z41A 1CX9A 2YZRA 4O19A 1KW1A 4WX2A 3GIYA 3G1HA 1RQBA 3WFAA 1R2RA 5LGZA 2CLEA 2A21A 1I8JA 3R12A 4QM1A 3TAOA 3OVPA 4E2DA 5KMYA 1Z42A 3RF9A 4JX6A 1AW5A 5FEPA 1DBTA 2E09A 3DH7A 5HWJA 3TE9A 4UFJA 1TTJA 2A2IA 2QAFA 3UYCA 2J88A 4BI7A 5KZEA 3S5YA 2ZZ1A 3C56A 4N4QA 1WV2A 5CKSA 4AMAA 3Q37A 3NQDA 3L5LA 5EMUA 2Y88A 3QPZA 4R53A 2A7RA 1WOBA 2WV8A 4MKNA 2W0UA 1AK5A 3DFPA 3UWYA 1SO6A 4FNTA 4Q32A 4AWTA 4LRSA 2VC6A 1K02A 4MY1A 4K36A 4NXSA 4ZL1A 2BWGA 5G4EA 2I14A 3LBCA 4Z0SA 3A21A 3W3OA 1KFCA 1M7OA 1VLWA 2H3DA 4NUWA 1N55A 4JS3A 4UFHA 3BG5A 5DBUA 1F76A 2YYUA 1TTQA 2JKEA 1H1ZA 5A8GA 4I9AA 2WSYA 2YFNA 4O1DA 4JNMA 1VLIA 1GTEA 1P0KA 4N4PA 3W2UA 2NV1A 2ZZ7A 3DENA 4IMCA 3STGA 1K7FA 4BF9A 2YFOA 5AN7A 2BLEA 5LNVA 1LDCA 3HPSA 2XN1A 2H90A 4AHOA 2NUXA 2QKFA 1R46A 1AG1O 2V82A 4TMCA 1VCGA 4GUJA 2X1SA 5TBOA 4YCOA 1VGAA 1WAUA 1I2PA 4JICA 3NPVA 1XBZA 4KWVA 1NF7A 3O05A 4Q33A 3MI6A 4AEOA 5DELA 1GG0A 3QMSA 3IGUA 2Y7EA 2CZ5A 3W1UA 1JR1A 1ALDA 4ONVA 3EX1A 4FNPA 5D2VA 4PA8A 4JGDA 2QCDB 5F1UA 3E96A 4UTTA 2YR1A 1KLZA 1QDSA 2VEKA 1QCWA 1KTCA 3INPA 1IGSA 3N34A 1KFEA 3NQMA 4E0CA 1H5YA 1DQWA 4JD4A 2OZ0A 1K8YA 5AC6A 2YX0A 1Q6LA 2A0NA 1W1ZA 1ME8A 3SGZA 3GDLA 4FXRA 3TH6A 2E5BA 2WPBA 3EX3A 5CZ0A 3O6YX 4HNUA 4HT3A 4I7WA 1SU5A 1TSIA 2OCZA 3RFAA 3HIJA 1OYAA 4RZ4A 4JEQA 2WJZA 1M6JA 4BWLA 5J5DA 3ABOA 2PC4A 2GJNA 3PG8A 2TYSA 3PUEA 3ZWSA 4TIMA 3NQVA 5HUPA 3NA8A 2G5WA 3P84A 3OHIA 3DFOA 3E9AA 4Y8FA 2C6QA 1PIIA 1DQXA 4UTKA 3CLMA 3W7RA 1QFEA 5KSWA 1LROA 4YMZA 4IPJA 3MJYA 4DXVA 1KA9F 3S1WA 4RR4A 3U8GA 3KAOA 1G69A 3L2IA 1TV8A 3NM1A 4IMDA 1LOLA 3WJWA 5I3GA 1A53A 3G1XA 2CLIA 3WK0A 3IIOA 1RV8A 3SW6A 3B0VC 4Q4KA 4EWND 3TDFA 4GFSA 2NXGA 1RPXA 4NNBA 1L6SA 3IVUA 5C2XA 5K4XA 2J27A 2QCCA 3S0CA 3NQ7A 1FY6A 2IQTA 1HO4A 2EKCA 3LCGA 2DZSA 3W7DA 3T4CA 4JDBA 1AMKA 4MLRA 3L0KA 3N3MA 4LWWA 4JTKA 1S3HA 1U5JA 1RQHA 3C2FA 4QAIA 4QITA 1M7PA 3HGOA 2QCGA 1YXCA 5BRBA 2ABAA 3A5VA 3QH2A 4PH6A 2VOMA 3LCHA 3PSWA 1VS1A 1O94A 4WY0B 3TNOA 1TQXA 2A7PA 5HWMA 3KRSA 3GDRA 5FEZA 3QQ1A 1X8FA 5LZLA 2O7QA 4K39A 3L66A 4MLJA 5D2TA 2CU0A 3TW7A 3W75A 1YYAA 2A1YA 3WK1A 1JQXA 1O95A 4M19A 1OHLA 4RX0A 3GKAA 4QQ3A 3M7WA 2VELA 3M5XA 5DBTA 5HMSA 3TV8A 3C2VA 4R7JA 5DN1A 3KX6A 4JTGA 5EKYA 4LV9A 3O6CA 5D2WA 2NUYA 3HGSA 3HB9A 1ZALA 3STEA 1LTDA 1YPFA 3TK7A 1BEUA 4ZQRA 4EIVA 1SZGA 2VFHA 4TU1A 3G0UA 1GVQA 2NX9A 1OK6A 2P1FA 1PL9A 3I65A 3SFKA 4LY8A 2ALDA 2J9XA 3NDOA 4HHPA 3MUXA 2YDAA 1KLYA 3W72A 1GT8A 1UB3A 3LHZA 4U28A 1J5TA 4A2SA 4ADTA 4TO8A 4KWWA 5MHBA 1SO4A 1JCMP 2ZRVA 4AHPA 4WD0A 4OV9A 1TYGA 1OFPA 4XUGA 3LOTA 4M6PA 1YTDA 1R30A 2ZTKA 4ALDA 4BR1A 1NSJA 1B4EA 2FDSA 1JUKA 4JIQA 1IXQA 4ML9A 3OA3A 1T99A 4HIBA 4NX5A 3I7SA 3TQVA 3W71A 1ZHAA 3USBA 1LOQA 3S42A 1XUUA 5CPOA 3LI1A 2E6DA 2C1HA 1G6CA 4UTWC 3G0XA 3FOKA 1Z44A 2WNZA 4ZMGA 4RLIA 1OF8A 4E38A 4FIQA 3IGSA 3PVFA 4NX0A 3UWUA 2QCHA 3RNDA 2ZCGA 3QF0A 1GVSA 1WA3A 3R5EA 3PB0A 3KRZA 1MZHA 4CQ8A 3T55A 2TRSA 5DY3A 4CCCA 2FQIA 4O0ZA 2PRMA 1KV8A 3N9SA 4C1KA 1DORA 4OQVA 5J5RA 3G8EA 5CZTA 4PCFA 5CPMA 2DZWA 2D73A 3R89A 4DO6A 2CLHA 1G7VA 2Y7FA 1EPXA 3MP5A 5D2XA 4MZ1A 2V5BA 3DKLA 3STFA 3QW4B 4Y6GA 1VYRA 3BLIA 1ONRA 2Q3OA 5D37A 1FXQA 2RHGA 1QPNA 3FFSA 1THFD 4HKPA 3TQKA 2P0OA 3LXAA 4MFDA 5KZMA 2CZDA 2QUTA 1VYSX 3PY2A 4O4VA 1KM2A 5I3FA 4OT7A 1XKYA 2AAMA 3C2EA 3MHUA 4BK9A 1TPB1 4MY9A 4FNRA 4K7YA 4LRTA 3ATYA 1EUNA 1TV5A 3UXAA 4QNEA 2CZEA 3BW3A 1MEHA 1QR7A 2NV2A 3W1MA 3QYQA 4DO4A 4CQAA 2ISVA 4HNNA 2VXNA 4YLWA 5F2LA 3V75A 5CSRA 1GZGA 3NL6A 3B06A 2VFDA 2PRHA 3RU6A 3NO5A 3LRMA 1O60A 4O11A 4RV8A 3M9YA 1FCBA 4MUZA 1SUXA 1JQVA 1PHQA 4A21A 3L67A 5G5IA 1I45A 4FB7A 2BXVA 1KM6A 3UXDA 5HUOA 5D04C 2C13A 3LM7A 3TMLA 3DFTA 3DKJA 4CCEA 4DQWA 1EB3A 1C9DA 2B7OA 1YTKA 3TCEA 3CU2A 3EX4A 1I2QA 5K7JA 1AL8A 2V8ZA 4XTIA 1JVNA 1T0OA 3UZJA 2JKAA 3DI1A 1OFQA 4JTUA 4TX9A 4Y96A 3S6DA 5E1QA 2ZTJA 4M7SA 4GBUA 2NWSA 1GYLA 5LNWA 5HR6A 5EA9A 1HL2A 1UBSA 3A5FA 3SGUA 3N14A 3M1ZA 1L6YA 1F2JA 3CT7A 5H91A 5GVJA 2JGQA 3NGJA 4ORIA 1QNVA 1KFLA 5C55A 3NQEA 4RK8A 3DHDA 2Y89A 4MZYA 3P60A 5FF3A 2YXGA 5D30A 4POCA 1Z48A 4M6QA 3NR0A 3WK2A 4ADSA 2WKJA 2NX3A 3NNTA 3C61A 3BV4A 4MIMA 3CC1A 2YCEA 4L4LA 3W86A 5CPNA 4UUIA 1SZEA 3BPWA 1GJPA 4N6EA 2NX1A 3LX9A 3N19B 5BNKA 4M6VA 5LHEA 3ZS4A 5LSMA 3S1XA 4TMBA 1D3GA 3G3DA 3M6YA 3W1NA 1DV7A 5HJLA 4AHQA 3HMJG 2YSWA 1W37A 4HNTA 3SR7A 2GJLA 5K9CA 3EWZA 2VEIA 2V2DA 3A24A 3E02A 3A22A 4JX5A 1ZCOA 2OMAA 3LHVA 5DXYA 4FNQA 3GDKA 1NAL1 5H2ZA 3P81A 1TV7A 3LLFA 4GXMA 5D38A 2TMDA 1JCLA 3G3MA 3U2OA 3DHFA 1IIGA 1YXDA 3TU9A 2J9YA 3UY7A 5HINA 3C2OA 2VKZG 1SZFA 4MZ8A 2NXIA 3CEUA 3MO7A 4LUIA 5D33A 1A5BA 1DJQA 1OX5A 4DF0A 2X1UA 3IIPA 1W54A 4BWLC 4UTJA 1SFJA 2Y6ZA 3K30A 4UR7A 1OFRA 1H51A 2GQ8A 1ME9A 5FEXA 1OF6A 1ZY9A 5DY2A 2QUUA 3JS3A 3W1AA 4E2BA 3WJXA 1U83A 2HS8A 1EWDA 4NJJA 1EX5A 1G4TA 1CI1A 2C18A 4PL2A 2DZPA 3W9ZA 1OX4B 1KTBA 1P4CA 6ALDA 3EWBX 2AQWA 2B7PA 4AWSA 2V0TA 3WJSA 3KOFA 4K37A 3SZ8A 3ZFHA 3TFCA 4QISA 1K03A 4QJ1A 1W3TA 1KFKA 1RZMA 1KBIA 4DF2A 3PULA 3UNDA 3TKFA 3ELFA 2FPYA 3CPRA 1XBXA 3W83A 2H8ZA 4FNSA 1K7EA 4FIRA 3M5VA 2GVLA 4MJZA 3GXNA 3W70A 1RQEA 1ME7A 4N2YA 1B9BA 2HSAA 1H63A 2CLLA 2C0AA 1W5NA 4GUIA 1QWGA 2GVGA 1MSSA 5BMWA 1W31A 5C6MA 4M5PA 3L21A 3EWXA 1GWJA 4YXGA 2FLIA 2ZA1A 4JYDA 5K9XA 2DZTA 2DZUA 3CHVA 4NJKA 4OWGA 1KBJA 1DJNA 3KRUA 1XM3A 1FWTA 2OX1A 1UCWA 5BOOA 2W79A 3S8HA 3SI9A 1RVGA 1VHNA 3P82A 3PC0A 4JXCA 4LT9A 3B0UX 3W7NA 5HWNA 4LVGA 1DKWA 4NQ1A 1N7KA 2YYTA 3PM6A 3M5ZA 2Y62A 3PS7A 3B03A 3FA5A 2ATMA 4PFMA 1D3HA 4R33A 4N9EA 1JUEA 2ZRUA 3PBUA 5HNRA 4ZQCA 3L65A 1G4SA 4Z1DA 2PCQA 4JTJA 4GRSA 1T8XA 2ZZ5A 4PC8A 3O07A 2ZZ4A 4IPIA 3I6RA 1W3NA 2X1RA 1FWSA 1JCXA 1AW2A 3S1VA 3GB6A 1EP1A 1PE1A 5KINA 3W7MA 3TROA 4RXGA 3GNDA 3B8DA 3E12A 3EB2A 1GVOA 1WX0A 3P7YA 3Q58A 1DHPA 2ZFAA 5L6UA 2ZRYA 3F4NA 1YXYA 4IX2A 3DFNA 1NFBA 2FFCA 2VFGA 4FX8A 3VNDA 5KTLA 3LV5A 2Z2UA 4CCDA 4K8EA 1G4PA 3G1FA 4O52A 4PODA 1TRIA 5A5WA 1FCVA 4NZJA 1C8VA 3CQ0A 1KM4A 3P5ZA 1KTNA 1H7WA 3GVGA 5T26A 2Y70A 4EOUA 1SO5A 3NQ2A 1TPC1 1OK4A 1VJIA 4OV4A 2KZHA 4NXKA 4JTFA 4WQ6A 4FXSA 3GDMA 3UWZA 1GVFA 2C14A 4FX6M 4UTIA 1X6UA 1Q6QA 4NZFA 1K8XA 4FO4A 1ICPA 3G1DA 1R2TA 2YGYA 1TQJA 1QO2A 1TPH1 5U7SA 4ZQMA 3BARA 1F74A 4LVDA 1LRNA 1TPDA 1MXSA 5F2IA 3DGRA 4LC6A 2JK2A 2BX7A 1LRTA 3FKRA 4B5NA 3UQNA 5DCBA 3W1XA 4MPQA 1H7RA 3F1QA 2R91A 4NVTA 2J9ZA 3G22A 2E5CA 1XDMA 1F6PA 2I1OA 3EX2A 2TSYA 4AB4A 1TMHA 5I3IA 2ZQ0A 1FXPA 2C16A 3TQ0A 4OGZA 2QF7A 1JRCA 4O10A 1P5BA 1IF2A 4AAJA 1MO0A 1TJRA 1TPVA 1R47A 5D05A 3IVSA 2Z6IA 4GUGA 4DBDA 3PBWA 5AHFA 1MEWA 3W7OA 3UWWA 1ML1A 3G0SA 3P67A 4BI5A 1T96A 3W6YA 3W7GA 3WJYA 2LLEA 2ZDRA 4HN4A 1F7BA 1UUMA 3KVMA 2FPTA 2GQAA 1W8SA 2XN0A 1HO1A 1LCOA 1OVDA 5AYXA 3NQ6A 1S5VA 1H61A 1OG0A 2WOQA 3QSRA 2FTPA 4GE8A 4S2BA 3Q2DA 1KFBA 3GLCA 4UMBA 4CQ9A 3KVLA 5F4WA 4O53A 1OFEA 3R8RA 5IBXA 2Q8ZA 5CSSA 1EWEA 2QDHA 4XKYB 1Q3NA 4H4IA 2X16A 3TR2A 2FB3A 1TPFA 4X3ZA 4N9BA 4HPXA 3QMTA 3N9RA 3W1QA 5DXXA 1LBMA 4WY0A 3W7IA 1AL7A 1OJXA 3W7EA 5TIMA 3JRKA 4CNNA 1H1YA 3UPWA 5U4NA 1H62A 1QOQA 1QPOA 2RDUA 1GYNA 3D0CA 1ZAHA 4HSOA 1WDWA 4UNKA 1GVRA 4JTTA 5CZSA 2V2HA 2NLIA 4DPPA 3GX9A 2QJGA 1BWLA 5I3JA 2OT1A 4O15A 3S5ZA 3PB2A 4GUFA 5FF7A 2GPTA 4O1CA 3LRLA 4DELA 4A3UA 3FYOA 3NL5A 3C3NA 2A7NA 4IQLA 3TIMA 3L0NA 3GZ3A 5AHEA 3NQFA 3CIWA 2O7SA 2VEPA 4AXKA 3S5OA 4UTTC 3N2XA 2EHHA 3O6DA 4UFIA
chains in the Genus database with same CATH superfamily
1XQKA 5D8ZA 1MUCA 4ZE5A 1C90A 4HJFA 3BW4A 4S3DA 5CC3A 1PXGA 2XH4A 1DJHA 1RJPA 4H6EA 3BLLA 2V69A 3HQ1A 4H6KA 1E0VA 2HWGA 2XGIA 4C1LA 4FPSA 2B7NA 4REQA 2ONEA 3A3XA 2NQ9A 3O3RA 4ERIA 2DSZA 1GZ1A 1E3ZA 2I9EA 3B40A 4D2JA 1JPHA 2J24A 1NOFA 2JGYA 3WLRA 1G9HA 4O1AA 4RDYA 2WHLA 2FHBA 4L5ZA 2WHJA 1BKSA 2W67A 3IPWA 3S9ZA 3NPXA 2DSUA 2JE8A 3MT1A 4UTMA 5IFPA 5IBXC 2ZZ2A 2CHRA 4W8LA 1BAGA 8CGTA 3R0UA 5LNSA 2WB5A 3EWWA 1M3UA 3SCNA 2AL1A 1MI3A 4LH8A 4HYVA 4YCPA 4AD1A 4FOUA 2WBKA 4ZXOA 4DI9A 1LRQA 4LV4A 4YN5A 1HGWA 1S2WA 3U57A 3TC7A 2RDXA 3ZJ6A 2ZWYA 1XCFA 3H7UA 5IXEA 4EVZA 3QOMA 4BQ4A 1AH3A 3MWAA 3IRDA 4YL2A 3GYEA 6PTDA 1SSDA 2ZRZA 1GQJA 2C15A 2HK0A 5HDRA 1NM9A 2GK1A 1UR0A 2QCNA 2E28A 3TTOA 3UWVA 2HZGA 4LANA 5DCDA 3A4XA 3WNPA 3GAYA 2DUXA 3KVJA 4ILSA 2V3EA 1A0EA 3VD9A 1W0MA 4C6NA 2B4GA 1QTWA 2BFGA 1FDZA 2XISA 4W7WA 4XO7A 3O7UA 3CMFA 1TV4A 1EEXA 2WZMA 4O57A 5I6SA 1A5LC 1JUBA 4GOAA 2QJHA 4O16A 2OX4A 1B57A 4RZ6A 3AXXA 1GVIA 5DX7A 4OJYA 1XBVA 3R8HA 1R2SA 3IAQA 4ZB0A 2VJXA 1U2YA 5I7GA 3UA3A 5T9CE 2QW5A 4BQ5A 3DFQA 1XH0A 2V63A 3VNIA 3P62A 5LA0A 2WMKA 3POHA 4AZ6A 1TWWA 1KXTA 3NO3A 3HJEA 4PMXA 1F9CA 1AD4A 2ZE3A 1J11A 1I75A 1YDOA 2HNHA 4LOCA 2VRQA 3A4WA 1UWRA 1XH2A 4FX7A 1E6PA 3NZPA 1DL3A 1K7XA 3EXRA 2P53A 4PEKA 3DECA 3RCYA 5AYZA 3TJXA 3ZJKA 3M44A 3WBEA 3AICA 3OVQA 1A5NC 3G5EA 3E1F1 5G1YA 1Y65A 1SMDA 1DEDA 2VEMA 1NFPA 4F0HA 4HZ7A 2QEZA 4J2PA 1HP4A 3CB8A 1S5TA 3FJ6A 3FGCA 1VENA 4JTHA 1CTNA 5H8UA 3LI0A 3NVTA 5FKYA 2ZRXA 2QDGA 4R34A 1FP8A 4MB5A 2PGRA 1I9CB 2PD9A 1BXBA 1RD5A 5I23A 4KEVA 4IJCA 2XHYA 3QFWA 3BW2A 1Z8AA 3GG1A 4AVFA 4LVFA 1ZJIA 3HGJA 1JFHA 3I3EA 4Z2LA 4ZENA 3EB4A 1GZJA 1UUOA 1W56A 4A29A 2BP1A 3GXMA 3SCTA 1UD8A 1ZJHA 1J0KA 3NQAA 3T07A 4ICMA 4AZ5A 1PCKA 3GNXA 2G0WA 3W00A 4WZHA 1LLWA 3BWWA 4C91A 3AI0A 1H50A 1OGSA 3LPGA 1JDAA 2QR6A 3HN3A 2XH2A 4AZHA 3GR8A 1CXEA 2OKTA 3B9EA 1HX0A 5CBJA 4X22A 3BC9A 1BGGA 1EA0A 3I68A 5EGRA 3W2NA 2J7GA 4AF0B 1S2VA 1OEPA 5BMXA 2VX7A 5K4ZA 4M1RA 3QTGA 3H8AA 4EF8A 4QGCA 2A85A 3VKKA 1GQLA 3GKFA 4UCFA 1EOKA 1DPMA 5HK4A 1MEIA 3GAKA 3DI0A 3ID7A 4IGSA 1DIDA 1TRDA 2WNQA 4Z08A 1EJRC 3LTYA 4OOUA 1S38A 3CPGA 4N42A 2VZSA 1NP0A 1L0PA 2YDSA 3IVTA 4O14A 4QLJA 1ADOA 1YLVA 1DQUA 3BAXA 4QDPA 2C7FA 1YMYA 3C6CA 2V5LA 2GL5A 3RO8A 7REQA 5I07A 3IIVA 1ITUA 2QJIA 3SCPA 1QW9A 1QWKA 1L9WA 4YVPA 2EAWA 4QEHA 3O63A 3IIZA 4CLMA 6REQA 7ODCA 1HQTA 4XBKA 1BFNA 4AQLA 3KHJA 3VTRA 1S1PA 4XZIA 3P0WA 3MBFA 1HJWA 2FYMA 1TJPA 2PURA 4D6JA 3M16A 1KD0A 2E5DA 3QZAA 3KFTA 3SSJA 1WP6A 1CCWB 1XUZA 1SR9A 1VPXA 5EB8A 3R2GA 5AHNA 3LBMA 4YHEA 1SSGA 3VM7A 5LNRA 2I9UA 2A79A 3G1VA 3BAYA 2QUVA 3P8IA 4D1IA 4UQCA 3IIXA 1QMLA 5L9FA 1ZAJA 4M7TA 4O28A 2QGHA 2DY3A 2QPUA 5I24A 1D8CA 3SUWA 4QS6A 2FZ8A 2Y61A 4MNKA 4HZ6A 1E6ZA 1VFSA 3EWUA 5HMEA 4HPJA 1M41A 1O4UA 4RCXA 1KQYA 4IX0A 4GCXA 4B16A 2R14A 2WSQA 3P74A 2PGFA 5E6YA 1NQKA 2QCLA 1A5OC 1PYMA 3DXIA 5CCZA 1EHNA 3W07A 1LJYA 1W5OA 3APGA 4JAWA 5KITA 3THCA 2E1DA 3O15A 5F1VA 2WC4A 3EDJA 2R8WA 3BLDA 4AD4A 2YL5A 2Y24A 3THUA 4MY8A 3IK4A 3RLVA 3QQ0A 1B3VA 3UZ5A 1GQNA 2DEPA 2XH0A 1AQHA 4FXFA 3W1RA 4UTHA 3OIXA 2DZXA 3CXOA 5CGQA 3R94A 1QPQA 3PZGA 4UFLA 3R0KA 3GM8A 4O1BA 3HV8A 2VGBA 4JN7A 3HGRA 1TR9A 4GYJA 4UR9A 3OJGA 4X2PA 2XVLA 3NM3A 4TX8A 4NJHA 4O50A 4EAMA 2WSPA 4EF9A 4P2VA 3CB3A 1UQYA 2OSYA 2YBVA 2J6XA 1DIEA 4UNLA 1PIFA 2G97A 3WQCA 3WH6A 3WDHA 5A6TC 4GABA 3CUFA 4AD2A 2GJXA 4IPNB 3AMCA 3OQEA 3AC0A 4KFNA 3TC6A 3IJQA 1OFBA 2XG9A 4H9UA 3W7HA 4PCSA 4W9TA 2QDDA 4GZ7A 2PWHA 3MZNA 3HG3A 1AH4A 1KRBC 1UPMB 1G7UA 4B9ZA 3T0BA 2DZAA 1TIMA 3SRKA 1B31A 3E0VA 4HTBA 4WJEA 4YHGA 1RA5A 1PO9A 3ITGA 3XISA 2X2GA 1VJSA 5LIUX 2ZBTA 1ZENA 3HPZA 3UBPC 1X1ZA 1XLAA 2VCBA 4WRHA 3FA4A 1KV5A 4WUIA 4ZZ9A 3MP4A 4IMFA 4JTIA 1ODUA 1A5UA 4N9DA 1XL9A 2FVLA 1ESWA 2H6RA 3GRIA 4LW7A 3U4AA 3URBA 3K5XA 1TE6A 3RCNA 4ZTYA 2PWVA 3FY1A 2BB0A 1UZHA 3ORWA 2G3MA 3LHTA 1G4EA 2FTYA 2XWDA 3PUGA 1W32A 2DQWA 4Y9NA 3EXSA 1JDCA 3KTSA 3R10A 4JCLA 4C60A 1UWIA 1I4NA 4G1KA 3RJYA 4GQQA 1Q5MA 3RMJA 3TZNA 4V27A 4ADUA 4EPEC 3WH7A 4GJJA 1Z7AA 5CPSA 1H09A 1W5MA 2B7QA 3BO9A 3D47A 1A4LA 1MUMA 4CQCA 3CJPA 2AKZA 2IMRA 3UNTA 1LL6A 2JF7A 2X7VA 5CBIA 3GTFA 8TIMA 2VDHA 3ECQA 1EZWA 2NVAA 2XIJA 3L9CA 3ZR4A 1EGMA 1E9ZB 1G94A 4QHRA 1JJKA 2PWFA 1KFWA 3WMBA 3EKZA 3IJLA 2PAJA 3GS6A 3NL2A 4AX7A 5LNUA 4MAZA 1VD6A 2AGKA 4G7EB 1ONEA 4Z1CA 3C0JA 1NARA 4JTLA 3AALA 5F4SA 1ICQA 1W17A 4KETA 3OGVA 3M0XA 2XSAA 2VR5A 2GFTA 3GH4A 3PZMA 2E68A 2NZLA 1O6IA 4Q4PA 1OABA 3TTEA 1BVZA 2WMIB 4O54A 4GISA 5MKGA 3A9IA 1BYDA 2Z1SA 3GK0A 2DT3A 5C5YA 2ISSA 2RGLA 4IPPA 3E6EA 4FR6A 4FLSA 4MB4A 3DYMA 3UXKA 1XDLA 1PDZA 1GKRA 3EGJA 3LDVA 3SJ3A 4WHBA 3T78A 2RH9A 3NL3A 3N2MA 5FD0A 4NT0A 4IISA 1XJBA 4FMVA 4I3GA 3C4UA 3P80A 3PZ9A 3V3WA 5CC5A 4MJMA 2JEPA 3WQ6A 1RR2A 4V33A 3V0TA 2C71A 1CLVA 2CZVA 4PUDA 1J2WA 1OFAA 2UV8G 5K2ZA 4PMJA 1TV2A 4E3VA 1KWGA 1XG4A 1WPCA 4JTEA 4MOZA 3AYTA 4MWAD 4XQ6A 1YDNA 5ENLA 2CZFA 4HSNA 4ZO6A 2E9MA 5AHLA 3G8RA 3U6WA 2DU2A 1IXOA 4DJEC 3GWQA 3LQLA 5AECA 4L6DA 5G1TA 1UKQA 3H6OA 3I6EA 1L8NA 1H7XA 2FVKA 3E0FA 1OFOA 1UH2A 2YZRA 1OD8A 3S3GA 4ICCX 2XIQA 3AWOA 2CLEA 1I8JA 4QM1A 4AYSA 3OVPA 4E2DA 5KMYA 1AW5A 1CENA 1DWHM 5FEPA 2NVDA 3DH7A 4L9ZA 1GKPA 2J78A 1JI2A 3S2JA 2A2IA 2QAFA 1VFFA 3GU1A 4M0XA 3S5YA 2VWTA 4GG9A 3AUOA 3AYVA 2QJMA 2BG5A 2Y88A 4OZOA 4Z17A 3UWYA 4FNTA 4Q32A 4K3ZA 4MUPA 4H00A 1E72M 3BTNA 3NTYA 2VC6A 3ITXA 4MY1A 4ZL1A 7TAAA 3A21A 3UJRA 5I5RA 5A6AA 2WVSA 1VLWA 4NUWA 4UFHA 1QW7A 1JD7A 3FEQA 1XV8A 4Z2HA 1XWYA 1MVYA 4C6IA 4I9AA 3TWBA 4O1DA 2GWNA 1E1FA 1UR8A 1GTEA 3N18A 3ABXA 4Q8QA 3QR0A 4FI4A 2PFHA 2YFOA 5LNVA 1LDCA 5I3DA 1MRAA 4AHOA 4XKMA 2ASHA 2WM0A 5GNYA 3WD4A 4TMCA 1IZJA 4DZ5A 2X1SA 1EC7A 5TBOA 1VGAA 4H8HA 4JICA 1UH3A 4A3QA 3UF9A 3UYIA 5BWFA 3DYOA 3O05A 3V0UA 2ZX9A 4JCMA 4AZCB 2CZ5A 2AAAA 4JGDA 4JIEA 3M7SA 4ZB2A 1R3WA 1TZZA 1QDSA 1IGSA 3ARPA 3E5PA 4C1NA 4JQ1A 2DH3A 2YX0A 3MANA 4US5D 5HPOA 3WG6A 5IRPA 2JFEX 3TH6A 2E5BA 3EX3A 4DJDA 3O6YX 5LXEA 3VIOA 3ARSA 2PF0A 1OYAA 1AH0A 5AC5A 3HQOA 4AY8A 1QI4A 4ZO8A 1BPLB 1AODA 4GA8A 3ABOA 3LSCA 2TYSA 5HUPA 3OHIA 1VFLA 4MWAC 4IH3A 3CLMA 4IPJA 1Q65A 5FL1A 3G6LA 2V3DA 3L2IA 1TV8A 4IMDA 4DJDC 4CN1A 3GFXA 4NKCA 2NXGA 5A6LA 4Z1YA 3UVIA 3S0CA 2O4MA 3LCGA 1MDRA 3T4CA 4JDBA 1TWIA 3N3MA 4LWWA 3M6DA 1U5JA 4NYUA 1M7PA 3HGOA 1W1YA 5M17A 3A5VA 2CESA 4PH6A 3EWDA 1XLEA 1ZJAA 1S5MA 3CIVA 2VX6A 3TNOA 1IYXA 1TQXA 3VNKA 5HWMA 3B8UA 3GDRA 3N17A 1XYFA 1H5VA 2CU0A 5D2TA 2WAGA 4WKFA 2CITA 1O95A 2WVUA 3M7WA 1TVLA 2VELA 1OT2A 3F4DA 3GUWA 2HBVA 3BJSA 1RUSA 5DN1A 1X38A 5E70A 5EKYA 1XHGA 2IQDA 3FJ4A 4KRUA 1V0LA 3HGSA 4JIRA 1BHGA 3STEA 3PFRA 1SZGA 2VFHA 2X40A 4ZO9A 1PKNA 1CWYA 5ECVA 3FCPA 2Y8KA 4AY1A 4J40A 3NDOA 4KCWA 2YJQA 3L4TA 1OC5A 1TE1A 3MUXA 4D9PA 1VBUA 3T4WA 4ADTA 3WYZA 5MHBA 2VX5A 5E9AA 3FN9A 5A2BA 5A8MA 1H41A 3ZR5A 3BCFA 2QJJA 3LOTA 3DGBA 3BH4A 1R30A 1BKHA 2ZTKA 4ALDA 1LWIA 1POJA 1NSJA 3WENA 2FDSA 5EMYA 1JUKA 4JTQA 4NAEB 4KWUA 3TQVA 3WUEA 3USBA 4C6PA 2SFPA 1XUUA 4IP7A 3B9DA 6A3HA 4GD0A 3USZA 1DJWA 3FOKA 2Z1KA 2QCHA 1X6NA 3QF0A 4F9DA 1KXVA 2WWCA 3AIEA 2O92A 1WA3A 2PB1A 3KRZA 1O68A 1UROA 2TRSA 5A8NA 1GJUA 2ZC8A 4RUBA 4XZBA 2O9OA 4O0ZA 5EMJA 1U22A 4KT2A 2PRMA 3KM8A 2HE8A 1V03A 5J5RA 1V08A 3G8EA 5CZTA 4UQBA 1E5NA 1VEMA 3Q67A 4DO6A 3GG8A 3DUGA 3STFA 2RJGA 1B3XA 2NLYA 1Q4NX 2G3FA 3HPFA 1ONRA 3FVDA 3HQNA 6CGTA 1R3QA 4HKPA 2CZDA 4XD3A 1GEHA 1R87A 1CLXA 3VAVA 2DT2A 1KM2A 2D3LA 4H7VA 4BK9A 1JZ8A 1JGIA 4K7YA 4JEJA 3B97A 1EUNA 2CZEA 4XG1A 1QR7A 4H7ZA 3KOWA 4CQAA 2VXNA 2VEGA 4L64A 4F0RA 5CEWA 8RUCA 4PMRA 2PRHA 3RU6A 5IFTA 4HOXA 3M9YA 1FCBA 4ECLA 2C8NA 1ADDA 1PHQA 2VQUA 3MCNA 1KM6A 1BXNA 4DYKA 1E70M 3PK7A 4GXPA 2QJNA 4QJ5B 3LK6A 1WDSA 4WK9A 4JQ4A 4CCEA 2QT3A 1C9DA 3MS8A 4IFRA 5BCAA 1XIIA 1XSKA 2V38A 3T0AA 1W1IE 5I79A 4P7LA 4DJFD 1AL8A 2V8ZA 4PSPA 1NP2A 4NF7A 3WD2A 3F4CA 2Z26A 3DI1A 1OFQA 4Y96A 2PGEA 1PZ1A 2GZXA 4R7WA 4H9ZA 4M7SA 2YCKX 3WD3A 5LNWA 2OZ3A 2XFRA 3GBDA 1HL2A 2OEMA 5CJMA 4RZBA 3A5FA 4FS9A 3G77A 3WLIA 3ALFA 5TNVA 2PDUA 1F2JA 4Q6XA 4L6HA 2I57A 2CBVA 4PUWA 5IHRA 2ALRA 4GYPC 1KRMA 1P43A 3P60A 4DWDA 4DIAA 5D30A 3V16A 3OTRA 2J79A 2F8QA 1K6WA 4M6QA 2E25A 3NR0A 1U33A 3GVVA 2NX3A 1DTNA 1EXBA 3PZVA 3BV4A 1E1CB 1EJWC 3W86A 1BYAA 2DUZA 4DXKA 4UUIA 1SZEA 1QJWA 3VPLA 4RDZA 2NX1A 4QE4A 1NDZA 1QI2A 2XPKA 5LHEA 3ZS4A 3S1XA 1XC6A 5HJLA 4PN2A 4JNZA 4HNTA 2GJLA 1DJZA 1RP8A 3SCSA 4BQ3A 2V2DA 4JX5A 1FWEC 3LHVA 3UCQA 3GDKA 3VX0A 3WQPA 3MUY1 5DMLA 2WC3A 4L1WA 3EPMA 5D38A 2BY3A 3UP8A 4E5TA 3G3MA 3DCPA 3PJTA 1IIGA 3TU9A 2J9YA 3QV9A 1ITCA 1EJXC 2QIWA 4L1GA 5CBBA 2DW7A 2NXIA 3MO7A 2QVHA 4NRRA 2X09A 2CYGA 2Y6ZA 3AHXA 3GU9A 7ENLA 1OFRA 4G56A 5FEXA 4IIFA 1PX4A 2BVDA 3W1AA 3WQ8A 2HS8A 1EWDA 4NJJA 3GZAA 5EU9A 4YIWA 3IWPA 5B7ZA 1OX4B 1B5TA 1KTBA 3VKCA 1REQA 5EFDA 6ALDA 3NZQA 4AWSA 2V0TA 1OCBA 3KOFA 3TFCA 2XINA 1ITQA 1K03A 3IK2A 4UTFA 2XVPA 8XIAA 4E8GA 1FHLA 1KBIA 5F7UA 1OIMA 3KCJA 3UNDA 2YCIX 3AIUA 4YPJA 1XBXA 2PDCA 3W83A 2H8ZA 1K7EA 3E38A 3W70A 1RQEA 1ME7A 2MUCA 1B9BA 1H63A 2JEQA 3C86A 3KTXA 4YTRA 4PTWA 3UW6A 3QGKC 1W31A 4GZEA 1JPIA 4M5PA 5FJJA 1Z89A 3L21A 4ZFMA 2DW6A 5A6BD 4U3CA 1KR1A 4NJKA 4YYCA 1LQ0A 2ISFA 3CO4A 4R5EA 1V6YA 3KRUA 3LS9A 4QROA 1PZ3A 1XM3A 4P8VA 1C93A 1UCWA 3SI9A 2EKGA 1VHNA 5FJTA 1MNSA 2WZHA 3TN4A 2PTDA 1KXHA 3PM6A 3PS7A 3TNBA 1LQAA 2QXWA 3FA5A 4GQBA 3OLEA 3WD0A 3OGRA 1A47A 4PFMA 3CQKA 5LA2A 4R33A 1Q2RA 1E4NA 1JUEA 1WZKA 2ZRUA 3BQ5A 3KLLA 3MKVA 2PCQA 4JTJA 3CYVA 4GRSA 1XLBA 1CNVA 4QCEA 4IPIA 3I6RA 1W3NA 2B81A 2X1RA 4YU1A 1P0BA 3GB6A 2X0YA 5KINA 1IWPA 3B8DA 1WX0A 3P7YA 5T9BG 4PMQA 1YXYA 4LY4A 3THDA 2VFGA 3H2EA 2Z2UA 5A6MA 1YW1A 4GH3A 3G1FA 4O52A 4PODA 4MG4A 5A5WA 1RY0A 3QR1A 3GVGA 1R85A 3TA9A 4CUCA 1VJIA 4OV4A 2KZHA 4I90A 3O9NA 4WQ6A 3B3DA 4AD0A 4UTIA 1HJXA 1NJJA 3TN6A 4HNLA 2R82A 1ICPA 3GH7A 2YGYA 1TQJA 1TPH1 3CAKA 3AWNA 3LPOA 3KL3A 2CHNA 5ABFB 2E4TA 1MXSA 5F2IA 4KEZA 2VZOA 2IXVA 5FSEC 2QIIA 4B5NA 4C7FA 2Y0FA 2CHOA 3UJFA 3W1XA 1Q63A 1H7RA 3D3AA 3RM8A 2J9ZA 4UQEA 4E3TA 1F6PA 3EX2A 5AZ1A 1FA2A 3ZXWA 2Z27A 4J2MA 3XINA 3D46A 3WUGA 4DWSB 2OQYA 2C16A 3TQ0A 2QF7A 3UG4A 3AHVA 1TJRA 4DAFA 1FH8A 4Q8VA 1D8WA 5D05A 3EAUA 3W28A 2XH7A 1MEWA 1C8XA 3BCJA 3GNRA 3WDJA 4C5ZA 4ERAA 3WLSA 1ML1A 3G0SA 2VR2A 1AFSA 2LLEA 4HN4A 4JFWA 3IJ8A 1F7BA 5BZAA 1UUMA 2FPTA 2VDGA 1HO1A 3BOFA 2VR4A 2WOQA 3W24A 2J66A 4Q7BA 3V5OA 4AYGA 1D7FA 4UMBA 1PTGA 4UQAA 3VGFA 2V5DA 5CSSA 1EWEA 2CC0A 4H1ZA 4TTGA 5FA5A 1C92A 1P6CA 2OQHA 4JTRA 4D6DA 4X3ZA 3WQ4A 4M81A 3W7IA 1OJXA 4W93A 4MF4A 3W7EA 3JRKA 3NEHA 4NZ5A 3EOOA 1H1YA 5T91A 3UPWA 1GQIA 2QMJA 5U4NA 2RDUA 3M07A 1GYNA 4Q4QA 1GHRA 5M5DA 1MW3A 4JTAA 4UNKA 1NQ6A 5CXPA 3UG5A 1EDTA 4UOJA 4E2VA 1IGWA 4GJIA 4O15A 3HQPA 3SB0A 3GYCA 1WO2A 2EG7A 2WCGA 1FTXA 4DELA 2E67A 4YVXA 3LNPA 4A3UA 3FYOA 3C3NA 3S83A 2ZUTA 3PWGA 4XO6A 2QGYA 1RK6A 3QV8A 3M0VA 4HOWA 2VEPA 1A5KC 1EJTC 1K8CA 2PP1A 1CGVA 4UTTC 2DSWA 4XSMA 5CH9A 2EHHA 4HBKA 4UFIA 1C3FA 2CCRA 4Q7NA 2OT0A 4JTDA 1E1CA 5FEWA 2Z1BA 1YBQA 2H3BA 2DUAA 2Y5EA 3QW3A 4QNWA 1QI5A 1NY1A 1M04A 3I7QA 4JYFA 1XCWA 4NJIA 1OYBA 1X98A 3HU7A 1QK0A 3WF3A 5I02A 2PF8A 4HHMA 4XKYA 2WCSA 4M56A 3WQVA 3WZ0E 2Z6JA 4NAFA 2H9AB 1JYNA 1OADA 4M82A 3QHMA 5EMMA 3HOJA 3LEPA 1E40A 1ZNNA 5D09A 4F3HA 1HJQA 4EXQA 2ACQA 1YDVA 3FK4A 3BLOA 3AQUA 1EZ2A 1JGMA 3TFXA 4GWEA 1FX6A 1HKIA 1SW0A 2QZRA 5FIPA 2CW6A 3NPWA 3VMPA 3QRHA 3SM0A 3VC5A 3QGAC 3TJLA 3CV2A 3S1GA 2ZWZA 2ZC1A 2W61A 1TPUA 1XFBA 3W1TA 4AC1X 2OZTA 3MJMA 1J0YA 4NZCA 1UWTA 3GUGA 5M3WA 4ZB5A 2HXUA 2P8CA 4ZEPA 4HK6A 4KFPA 2AQOA 3SBFA 1H49A 2H8XA 3SIZA 3LLDA 3KTCA 2HTMA 5LKYA 1K4HA 3H23A 1LLOA 3VO0A 1K70A 3M0YA 1BD0A 3ZO9A 2TPSA 2E3ZA 5G2HA 4MDPA 1EEPA 4IL0A 4C7GA 2YCLB 4F40A 4BKNA 2RKXA 1EHAA 1F6KA 1E9LA 4QJ3B 4H01A 1W9PA 3T40A 4A6GA 1KRAC 2ATSA 2VFIA 2WMHA 3BAJA 1IWBA 2W66A 1DXEA 4ICNA 1AMYA 2F7FA 5CPQA 1HKWA 6TIMA 3V36A 3VUSA 1EC8A 2HVNA 4MFEA 4U33A 1EBGA 1VYPX 4K38A 3CV1A 2DORA 1IEQA 2Q3RA 2R94A 1IEVA 5I06A 3AU6A 3UPMA 1HKKA 3VKJA 3H53A 3MUAA 2PDKA 5HQMA 3ARRA 1TZ7A 1JZ5A 4IP5A 4B3KA 1ZRQA 4H9VA 3CEPA 3MMTA 4H41A 3W81A 2Z24A 3OG3A 3QKZA 3GXTA 4GUHA 2GYIA 3MYOA 4A2RA 4AIUA 3CV7A 2BHUA 3ZLGA 3LTSA 1NFGA 4XD6A 1AJ2A 3VD4A 2Z00A 5G1MA 4MWAE 1IEWA 3FEMA 1YTEA 2DT1A 3T2QA 2Y85A 3RITA 3HG2A 3W73A 1AZ1A 1RJQA 1N8IA 3VOHA 4BF7A 3HG5A 4IXXA 4IQJA 3H2AA 3Q94A 2INEA 4AVNA 3GSMA 3WLHA 3T42A 4HNVA 3W27A 2L5HA 3OODA 3W25A 1I6NA 2JALA 1TREA 3CTLA 5ABGA 1CEOA 3WLNA 2QDEA 4HMDA 4BHYA 1GOKA 1FCUA 3SCOA 3GBEA 2Z2AA 3LMZA 2XFFA 4XSLA 4PMZA 1FWWA 1V5XA 1LBFA 2CLMA 3NXLA 1BWKA 1I0BA 2Z1XA 3PNZA 2Y7DA 1EQPA 1GEQA 3NZ1A 1X1NA 2ZA2A 4G7EA 3FYYA 4PRTA 4Z1BA 1KR0A 4LB3A 3W23A 2OELA 4HYRA 4QG6A 2EPOA 5JH1A 1J2BA 1LT7A 4KCVA 5A94A 1GW1A 3DZ1A 4OE7A 2WJEA 4HA4A 4URIA 1BTMA 2EEXA 2Z0IA 3CNYA 2BY2A 3RO6A 3OW1A 1SQ7A 4FXJA 4LNCA 5FF4A 4J35A 3W1LA 3MW7A 3KRBA 1ZFJA 1X96A 1SJAA 1B3OA 3OIHA 4RE0A 1HFBA 3T0DA 4BY3A 3BGJA 5HNTA 1RLDA 4TVDA 3ABRA 4W7UA 2BBFA 2CLFA 3SQLA 4NYYA 2OYKA 2PBOA 3AJXA 1V6XA 1BF6A 3UR8A 4S1FA 2B31A 3QPYA 3WMCA 1KGUA 1X7IA 4LUYA 3KS6A 4HMNA 2JBMA 4U2ZA 3RM4A 3VD3A 2GDUA 2ZUMA 3QV6A 3TN3A 4IMAA 2AKMA 3VCNA 5CSUA 3AROA 4X63A 4CNSA 3NQGA 3T0TA 1B0IA 1X6LA 2PTYA 4PUKA 1XIFA 4QSHA 5K9DA 3R58A 4I5XA 2Q01A 2C3ZA 2YA2A 4OTKA 4IQDA 3AMGA 5JIPA 4CU8A 4JKMA 4UQDA 2HS6A 4Q4OA 2HXTA 1Z3NA 3VIMA 1ZJBA 3NAVA 1FWHC 4YTTA 4W88A 2GOUA 1LLZA 2REQB 5CPLA 4AF0A 1YIXA 4G1NA 4I9MA 1DJGA 2QYGA 2JKPA 3TW6A 3PSVA 1XIDA 4GI8A 8XIMA 1F3EA 3FKKA 3N25A 2JIWA 4QSFA 3UJSA 3V18A 2I7GA 3QY6A 2D69A 7CGTA 3GTNA 4Z1AA 3SY8A 4Y9OA 1UR1A 2PP3A 3UPBA 1WKDA 5JIWA 4OHQA 2CWNA 4AX6A 5BU6A 3ME3A 1GK8A 1KM5A 1KM0A 4UZUA 2OTDA 2FZ9A 1ZUAX 1UOKA 4ZSTA 1QOPA 3VGDA 4H9YA 3ZJ8A 2FZNA 5XIMA 2O56A 3CWOX 4PUMA 5HATA 3M5YA 1XCXA 2C19A 2XZ9A 3L68A 1T41A 1M53A 4YVVA 3O16A 1H0GA 3VCRA 3EWCA 4O18A 2W63A 5F2GA 2EG8A 3WNMA 1VKFA 4LS1A 2NW0A 2PZ0A 1BLIA 1EGVA 3PP7A 2MANA 5A1AA 4Y9MA 4U5IA 4UB9A 4QE5A 3BGGA 1VEOA 5E93A 1GJWA 3CT2A 3KDNA 4DJFC 5A6KA 4X0NA 5A8PA 1CXFA 5DLCA 4IIHA 3HO8A 4WXYA 1ZP4A 1CECA 3PBGA 1RCQA 4JFTA 3SRHA 1TV3A 3OVRA 2QMKA 3TYAA 1EXPA 2P3EA 4YTSA 3W7PA 1XSJA 2PD5A 3W2JA 4I8YA 3THAA 3UXIA 5C9ZA 4JKLA 3U2EA 1J12A 1PWMA 2WQDA 2QNEA 1XLDA 4E2OA 4BQ2A 1SW7A 1GGOA 4AZCA 2A4AA 1CGUA 5F4XA 3UVAA 3WK3A 4UZSA 2YPIA 3RK8A 1FVPA 3MQTA 3CK5A 1H60A 3UCDA 4L4MA 2DFAA 1OX6A 2W4XA 2QS8A 3S5SA 1JCJA 3C52A 3W01A 4Q6JA 1OT1A 4UFKA 4GJ1A 2DGAA 4Q4SA 4IGHA 5FF0A 3BLFA 5DCEA 3FIGA 3TUUA 1HG3A 4RL3A 2J47A 2VCCA 3IJ9A 3S9YA 3PZIA 2G95A 3M64A 4XZ9A 3FDKA 4O4WA 7TIMA 3GXPA 4OBTA 3CLWA 4XZLX 1IIHA 5MF5A 4BS0A 5KZ6A 4N9CA 3DC0A 4XVEA 4XAFA 2OGYA 1UZDA 4K7VA 4XD4A 4O8RA 3TJ4A 3W87A 4DLFA 3G18A 3WH8A 3W7JA 3DOPA 2P76A 4ZGYA 3T09A 2O9PA 4P61A 4GX8A 2RFGA 1CGWA 2RDTA 4WY0F 4Y8EA 1DWIM 1R3YA 2X1IA 3BE7A 5H6HA 1R3VA 4HCDA 1JI1A 1PTDA 3JVAA 4DWSD 5KZDA 3RR4A 3RDKA 3L23A 2D0FA 4FF5A 2CLPA 4HJWA 2WMIA 1IXPA 5E09A 1Q8AA 4GO8A 2BSLA 4QJ4B 3E0IA 5DFAA 3K8LA 1MDLA 1IEXA 1VAHA 2XSXA 1F8MA 1PV8A 4NNCA 2ZOXA 3HTWA 1NDYA 1E1EA 3TA6A 4GY0A 2E6AA 2J62A 1AD1A 4GNJA 1VQTA 1WYIA 2OEKA 4FNUA 1E55A 4ERGA 4G6CA 2PDHA 4ATDA 4LUJA 2XUCA 2IKGA 4NG3A 2G96A 4ZE4A 3VIHA 3EPNA 4PTNA 1R9ZA 2BNJA 1W3JA 3QFEA 1V8EA 2WYSA 3W1PA 4ZQOA 1V7AA 1C9WA 3K8KA 4C6LA 3GDTA 4MNLA 4U4MA 5BW6A 4UTLA 4EKJA 4LCSA 4S39A 3UZWA 1AW1A 1LQ2A 1WCGA 4W4QA 3FXYA 1Q4WA 4UTWA 2CWXA 1MXGA 3WL1A 1WB0A 3WLJA 2VC5A 3LCXA 4XIAA 4UOZA 1DWGM 2UBPC 3TMQA 3CQHA 4XBJA 4DO7A 3N9KA 1KFJA 1OWQA 1SW3A 2NQLA 3JUGA 3XIMA 4QDWA 3REQB 3B05A 5C54A 3GC4A 4QIUA 2A6NA 4LUSA 2J8GA 3PG9A 1EIXA 2DVTA 2OJPA 3L4VA 3QSTA 4O13A 2V81A 4KEUA 3BG3A 3WLMA 2WKGA 3E2SA 3LERA 3R13A 3GR7A 3VNZA 1CXLA 3AFBA 4WGHA 2VFFA 1O5XA 4X0VA 3MSDA 1R7OA 4JFSA 2FKPA 2D2HA 3H54A 3T0CA 4RZ5A 4JX4A 5GNZA 1JEZA 2OFJA 2Y2WA 4H19A 1W91A 1CPUA 2ZZ6A 1TX2A 1SJCA 4RW5A 3CIXA 2HRWA 4O19A 1KW1A 1H3GA 1RLCL 4WX2A 3WFAA 1R2RA 2VRKA 2C0HA 5M03A 3VM5A 1Z42A 4IFOA 3FJNA 4H8VA 3OG2A 2AL2B 4RE2A 2WZEA 4BI7A 4FR1A 3P6LA 5LIXX 3GHTA 2V6AA 2OXNA 4N4QA 1WV2A 3A6OA 1HW6A 5J04A 5EMUA 1OZMA 2W0UA 4RE4A 4IPLA 2PZNA 4LRSA 1WDRA 4QX4A 3G2GA 1B1YA 4H04A 4K36A 4L80A 2ACSA 1X39A 1QVBA 5CGMA 3LBCA 2ZKMX 2FDMA 2INFA 4Z0SA 1HL8A 1KFCA 1K1DA 1KXQA 1TJ1A 1N55A 2I5QA 1XDJA 3BG5A 5DBUA 5EFFA 2H9AA 2X0SA 2PDFA 1KO0A 2G4JA 3AS0A 2JKEA 5A8GA 3LPPA 1R3RA 2CBJA 2YFNA 4EK7A 3LM3A 2EPKX 2W62A 3R43A 3W2UA 5C7VA 4MJ4A 4IMCA 3STGA 3LGDA 5AN7A 1WZMA 3HPSA 2XN1A 2H90A 4XVDA 2NUXA 2XWEA 1R46A 1OGBA 2V82A 2PLMA 1VCGA 4PRRA 1R3TA 3GW0A 3NPVA 5D9OA 1MQPA 4KWVA 3TVAA 1JF5A 2A3AA 3M46A 3MI6A 4AEOA 3ZOAA 1NU5A 3ARQA 1JDEA 3ZT5A 3QMSA 1GONA 1N8WA 3IGUA 3PZUA 4PCNA 2Y7EA 1G5AA 5BU9A 3SUVA 1VPQA 5D2VA 3WF1A 3A13A 5F1UA 3E96A 2YR1A 5EMLA 2QVNA 3INPA 4Z42C 4ZODA 4GACA 3IJ7A 1QHOA 3IACA 1OC6A 3PPFA 1Q6LA 3LU2A 2J8TA 1UP2A 3MSYA 1W1ZA 3SSZA 3GDLA 3N2TA 2WPBA 3BZGA 4HNUA 1EF2A 4HT3A 4I7WA 1I1XA 2HQAA 2W9MA 2ICSA 2D1ZA 4JEQA 3SUUA 2WJZA 4NIRA 1M6JA 4BWLA 3AYRA 2GJNA 3PG8A 3PUEA 3ZWSA 1EH9A 3NA8A 3DFOA 2VC9A 4HGXA 3EB3A 4YWSA 4Y8FA 2C6QA 3OZYA 1DQXA 2YKKA 2WSKA 4LBRA 4YMZA 3GU2A 2VYOA 2PP0A 3WDRA 1KKOA 1W2VA 3N04A 3QY7A 1KA9F 2GSEA 4QE1A 2CERA 3KUMA 3NM1A 1XFCA 3RAOA 3FX4A 1A3XA 4M24A 4PMOA 2EJAA 3ARWA 3WK0A 4EWND 2RUSA 3TDFA 1RPXA 3ZMRA 4A8IA 2GJRA 5C2XA 4D6CA 2YCLA 3WNOA 1K77A 4LAUA 3AZTA 3LUTA 1AJ0A 2GDQA 2G41A 1BYCA 3AIRA 2WW5A 1XIGA 3VIPA 1HN1A 1AMKA 2X05A 4JTKA 1S3HA 1RQHA 1KGWA 4LB4A 1TKKA 2ABAA 1YDYA 3LCHA 5CGTA 3AXHA 4WDXA 2OLAA 4WY0B 3S2LA 2VOTA 4OFCA 1GQKA 2XU2A 1X8FA 3U5YA 2O7QA 4MLJA 3IRSA 2V5KA 1FHUA 1JQXA 4RX0A 3GKAA 4QQ3A 4KESA 4WDTA 1AA1B 4MMWA 3C2VA 4LQ1A 4KERA 1HP5A 1WDQA 3O6CA 5D2WA 3HB9A 1YPFA 3RRAA 1T6MA 1HKJA 3ZLFA 1BEUA 4ZQRA 4EIVA 3RGTA 4E4PA 2IKHA 3R25A 3H2CA 4HOZA 3BV7A 3GVRA 2PWEA 4DZHA 1OK6A 2CBUA 3IV8A 1PL9A 2ZICA 2EJ1A 1SGJA 2Z7GA 2INZA 4IG2A 4DVOA 4KH2A 2IQ0A 3SRFA 4E8CA 1KLYA 3W72A 3S46A 2A3HA 1UB3A 4U28A 1J5TA 2VTFA 4TO8A 4L4OA 1SO4A 4CCZA 4OUEA 3UT0A 3BAKA 1POKA 1RXOB 1OFPA 4EACA 4M6PA 3M0JA 3H2MA 5FOOA 4LXFA 1DIOA 1B4EA 3CL8A 4BF5A 3IUDA 3AISA 1T99A 1NTHA 1EA9C 5A6BA 2J7DA 5CAKA 2WHMA 1JFXA 3W71A 3CUHA 1V6TA 3S42A 4GKLA 2XSBA 1NWTA 3NCOA 2VNCA 4XUYA 3G0XA 1Z44A 4ZMGA 3RHGA 1OF8A 4NX0A 3IARA 1GVSA 1JZ6A 1J6PA 1DJIA 3R5EA 3SEPA 3H4WA 1EO5A 5I77A 1J0ZA 4CCCA 4QFUA 2CEQA 4HHHA 4IZGA 1DORA 1V93A 1DE5A 4OQVA 1F61A 3CHCA 3WQFA 3N13A 3DHUA 4S3AA 1R8LA 1Y5VA 2CLHA 1BG9A 2Y7FA 4Q7IA 4AZBA 2P50A 5D2XA 4D72A 3VVGA 4B3LA 4NZ4A 1J0IA 3H4GA 4Y6GA 3ITLA 3H2OA 2BOEX 1L6GA 1V0NA 4HD5A 5FCZA 4DXXA 2RHGA 3UG3A 3W29A 1QPNA 3TQKA 1SZRA 1VYSX 4ZOBA 1U5HA 4HTYA 1J01A 3UGRA 5HNUA 2D3NA 1Y5XA 3N6HA 2AAMA 1TPB1 4MY9A 4AIOA 3FXGA 3E0LA 5GJPA 2OO6A 4LAZA 1EYEA 4DB7A 1TV5A 1FWBC 4QNEA 2V5JA 1MEHA 2NV2A 3W1MA 3LBOA 4HA1A 2BHYA 5RUBA 3O6AA 3V75A 5CSRA 1GZGA 3NL6A 1YX1A 1PB0A 1ZU8A 1QNPA 5AKQA 1B3ZA 1CIUA 9CGTA 1O60A 3OHMB 1IT7A 4RV8A 4QTGA 1Q6GA 4P7RA 4GIAA 3GE7A 4MKSA 2ZX8A 1EQCA 3WNLA 1I45A 2OLSA 3P0XA 3UXDA 4KS0A 5HUOA 2BGSA 2C13A 3TMLA 3DFTA 3DKJA 4LEFA 3W02A 4JNYA 3SQMA 3HFTA 2ON3A 3TCEA 3RX3A 3CU2A 2FZBA 4DAIA 4Q8TA 3G1RA 3UZYA 1C91A 1DTUA 3UZJA 4JTUA 4ZCWA 5FJUA 3OYZA 3ITOA 1GYLA 5HR6A 2D2JA 3SGUA 1GOOA 1OCQA 1VBRA 5GVJA 4ORIA 1KFLA 2IPFA 5C55A 1FRBA 1ZP3A 3OB8A 2NQHA 3DHDA 4MZYA 4YTUA 3UJEA 2GGEA 4EPDC 3QZ6A 3ZVIA 4W86A 1JXKA 1Z48A 4CD8A 3AOFA 4JHZA 2OYLA 1DXIA 3CC1A 3KE0A 2YCEA 4J3TA 4DHGA 2WWDA 4N6EA 1UG6A 3VKDA 3N19B 1S2AA 3LPFA 1PIGA 5LSMA 3QN3A 1CGXA 3G3DA 3DBNA 3M6YA 1OB0A 4AHQA 2YSWA 3CUGA 5JBDA 1H11A 3A22A 3PAOA 4AD5A 3GHSA 5DXYA 3RLHA 1OGGA 4FNQA 2D0GA 4OECA 3LLFA 1JPMA 4GIEA 4GXMA 3U3HA 6XIAA 2TMDA 3OZPA 3U2OA 2CETA 5C2GA 1JDFA 5HINA 3C2OA 1U1HA 4IIGA 1OX5A 3IIPA 4HMEA 2EXOA 4UR7A 1MW1A 4IIEA 1PX3A 3FV9A 1CXKA 4NI8A 1OF6A 1ZY9A 5DY2A 4J3SA 1XLIA 4E2BA 1U83A 2VHLA 3HMCA 3A9BA 1G4TA 2VC7A 1CI1A 2DZPA 1W1A1 3IANA 3ABZA 2AQWA 5CSYA 3WJSA 4K37A 3SZ8A 3ZFHA 4TUFA 4EPKA 5HPCA 5XINA 3CZJA 2WC7A 1M68A 3EYPA 3WLOA 3ZVHA 3GVQA 1AJZA 3AU2A 1MUWA 1XYMA 2OOFA 3UCCA 2GVLA 3GDBA 4ZOAA 3GXNA 3U48A 3W53A 3UETA 4A8LA 2D22A 3ARUA 4N2YA 2HSAA 4GQRA 2GVGA 3VDGA 5C6MA 1R5YA 1T8QA 3A3WA 2ZA1A 3OYXA 2OWXA 3PNUA 2CNCA 2DZTA 4OWGA 3UU0A 3KLKA 1FWTA 1MXDA 2ISDA 2VUYA 1YE6A 3B0UX 5HWNA 4LVGA 1DKWA 4NQ1A 3URNA 3M5ZA 2Y62A 4IGMA 1TVPA 1CB2A 1ZLPA 4N9EA 2EG6A 1VF8A 3PBUA 4ZQCA 2PBGA 4QP0A 1SFTA 1RSCA 4PC8A 4MGGA 2G37A 3R7MA 4F2BA 2FH6A 3MB9A 4C6CA 3GTIA 3GNDA 2EQDA 2IS7A 3EB2A 4RNJA 4Q8MA 1LG1A 1V02A 3DFNA 3DERA 3VNDA 3VU2A 2PU1A 3LV5A 4CCDA 4DWSC 1L6FA 6REQB 1LL7A 3FGCB 1TRIA 1FFRA 3CV6A 4NZJA 1Z9AA 2WBGA 1KM4A 1H7WA 2Y70A 1UA3A 4EOUA 3NQ2A 1TPC1 3CUJA 1UR4A 4GY7A 2NSOA 4JOMA 1GVFA 4FX6M 3AXIA 4NZFA 4KQNA 3GFZA 1K8XA 3SCRA 1E4MM 4NP7A 1QO2A 2TODA 5U7SA 4ZQMA 3BARA 4LVDA 4W8AA 1TPDA 2J7BA 2JK2A 4PUUA 1KNWA 4ROQA 4E8DA 4I5RA 1ISVA 5DCBA 4H9XA 4RE3A 1GVEA 1OY0A 4MPQA 3N15A 3F1QA 5IHSA 2R91A 4XIMA 3OU8A 2E5CA 1XDMA 1T7LA 4S3BA 3N29A 1R9YA 1TMHA 2ZQ0A 1FXPA 1F8IA 4S3JA 3KEHA 1TWSA 5DMMA 4K2SA 5I03A 4OGZA 1JRCA 3U0HA 1P5BA 2J7EA 1GHSA 1DJYA 1XLLA 2R9RA 1R47A 1ONXA 4GUGA 3PBWA 5AHFA 1DHKA 2VVSA 1SM9A 1C7TA 4BI5A 1T96A 1WKEA 3OGSA 2ZDRA 3M0HA 1W8SA 1ISZA 3GNOA 4W85A 2NT1A 2IW0A 1KBLA 1S5VA 4FOJA 4B5XA 3QSRA 2FTPA 3CZLA 3SN1A 5C8BB 3LNMA 2FJUB 1UZ1A 3T9PA 1KFBA 3GLCA 5E9XA 5F4WA 4O53A 3LYEA 4U5KA 5IBXA 2Q8ZA 5D9MA 2YL8A 4XKYB 1Q3NA 4H4IA 2OSXA 4OIFA 1TPFA 4HPXA 5JUVA 1FWIC 1XINA 3IJDA 4CNNA 1A49A 1H62A 1QOQA 2RAGA 3CHEA 3KWSA 1IR2A 2V68A 5C9WA 4K8GA 1P7TB 4XD5A 1E0TA 1J96A 1GVRA 2V2HA 3R4IA 2QJGA 3B8TA 1XIHA 2FTWA 3TOPA 5DANA 4CD7A 2VZUA 1TA3B 3N2OA 3PB2A 1XICA 4GUFA 5FF7A 1XG3A 2J7HA 3C3UA 3KOXA 4ZFCA 5BRPA 3ZIZA 1XLGA 4R9OA 1DXFA 1HJSA 2GJXB 4JHOA 3PTKA 3GZ3A 3MKKA 2WLZA 3NQFA 4GVFA 4L6OA 3A4AA 4AXKA 3S5OA 1J18A 3N2XA 2OZ8A 1S3TC 2HCVA 1S5WA 5REQB 5D2YA 1S2TA 3V1PA 3UR7A 4CVWA 2G50A 3UWQA 2NT0A 1SJDA 6ENLA 3IUHA 2A3CA 2E77A 2VURA 3MCMA 1E4LA 1NWRA 4JQAA 1TMQA 2PDBA 5FACA 5IDZA 1BYBA 2Q6ZA 3HURA 3T2PA 2Y7GA 5GNXA 3DFYA 5IDIA 2GGHA 2E6YA 4RNHA 4MYAA 3P8JA 4RV3A 4Y90A 5AYBA 3QPEA 3WEZA 3N73A 2D24A 2ZXDA 4DO5A 3SY5A 1K8ZA 2OODA 1EX1A 2RDWA 2ESCA 4JBRA 1BQCA 1BVWA 1UD5A 3F2CA 2WNNA 4GNKB 3OBKA 3T8QA 4AW7A 2ZE0A 5GJMA 5ECUA 4JTSA 4RW3A 3DBPA 4L65A 4QS5A 5FESA 2ZZ3A 2OYMA 1GKQA 1VZWA 3F03K 4QBXA 3AZSA 1PJ9A 1AQ0A 1K6AA 4J5NA 4BI6A 1TO3A 4UMAA 1W5QA 4MTVA 4JL1A 4UC5A 3HZ3A 3QXBA 4ZOEA 1EP3A 3W7CA 4NY2A 3S2CA 4P8XA 1UASA 3QBUA 2I17A 4V2XA 1HJUA 4AH7A 4HVXA 1OC7A 2A6LA 3LXBA 4Y9AA 4OBRA 4K6AA 4IUOA 4TTUA 1M65A 3WBXA 4GI9A 4JIIX 3KXQA 1DVJA 2VUNA 1W3LA 1VC4A 4TOQA 3FSUA 3MMWA 5D32A 1SFLA 5HMDA 2XN2A 3FSTA 4LVAA 2PTWA 4FF7A 4H6QA 5E0CA 1FP9A 2DZVA 3W7KA 4Z0JA 5EYWA 2F6KA 5FI8A 2G3IA 4GC4A 2ZX7A 3U7BA 3SADA 1S46A 3RMEA 2YXOA 3GNNA 3ICJA 4MHBA 3CZ8A 3QC3A 2FFIA 3EWYA 4TQTA 1JCYA 4IJBA 2GGGA 1JULA 1WBHA 1IXNA 4JPGA 5AFDA 3KOZA 1QO5A 2F84A 4X2RA 2AGTA 1VFUA 4RKAA 4L61A 4NNAA 1XI3A 5G2IA 3ARVA 4O12A 1XIEA 3DYPA 3GTHA 3GXFA 4O1EA 3BLPX 4IWWA 3SFWA 3NG3A 5XIAA 3FLUA 1TFVA 1KBKA 1YADA 4HK5A 3DDMA 4NSBA 4B5WA 2OU4A 1BSIA 1N2VA 1LP6A 2CIPA 3U5UA 2QCMA 2AMGA 2FHFA 5AY7A 2FMOA 2GUYA 5AHIA 3RPDA 2OEJA 4YWIA 4JDYA 3W4RA 1J0JA 1TVNA 3KDOA 2FHCA 3W76A 3QR3A 4ZO7A 2OR2A 2X1TA 3M41A 3B9AA 2EPNA 2BVYA 2FB2A 3W82A 1Q45A 4B5UA 3T6CA 1UOZA 3WMSA 4U3AA 3WNNA 3I7RA 2E7FA 3K4AA 4XZWA 3N1AA 2J8FA 5D9NA 1KWKA 3MMUA 3STCA 1F5ZA 4DBUA 4CNUA 1FH9A 2HDJA 3WBYA 3W6LA 3M4HA 1E51A 1H0IA 3P14A 1BSLA 2BVWA 1F73A 2QCDA 4AZIA 1Q6RA 5HR7A 3O0FA 5DRCA 3VCCA 2DJXA 4PMYA 3GG7A 1OCNA 2Q71A 3TXZA 3QYSA 2J7FA 1V0KA 1XD1A 1FBAA 2QPXA 1YNPA 1BGAA 4KGJA 2Q02A 5TD4A 1B90A 1UBPC 1KM1A 1QNQA 4MSSA 1P1XA 1VP5A 4KKXA 3KHDA 1GG1A 3F4WA 2ABBA 2PC8A 1DOSA 3TAKA 3AMDA 1J79A 4WXZA 3TTYA 2PUZA 3TXVA 3BURA 5DO8A 4Z2KA 4YJ5A 1W3KA 4PL1A 3VZXA 4R7OA 1XR2A 3O06A 2BV9A 5ABHA 4UWMA 3I10A 2FZDA 4AZGA 2AL2A 4GYKA 3GTXA 1LOSA 3LTPA 1L6WA 3FHQA 3NSXA 4PTMA 3VE7A 1ZB5A 4KRTA 2HROA 2V30A 3PFMA 4HCLA 2IKJA 4XAGA 1SJBA 1PKYA 1TCDA 4AWUA 4CGTA 1F07A 4LYQA 1XRSA 4L4PA 3W2MA 4IIBA 2J74A 2VI0A 3FJLA 3ABSA 4W5ZA 5LGXA 4WDUA 5I2UA 3N3TA 1FQ0A 3BSHA 2GDVA 3VI2A 1WBJA 1B54A 4O0KA 3MHGA 1I0DA 4GVGA 4JN6A 2VT0A 4B5VA 1JD9A 5I3KA 2NWRA 4K1GA 9RUBA 1Q85A 3EA3A 4EAYA 3IV3A 3BK0A 2D2GA 3VOJA 3S1UA 3MI3A 3B9NA 3WQOA 4CEXC 1KCXA 3JR2A 3PBYA 5H1WA 1TTPA 4NASA 3MHFA 3PZNA 5JU6A 3LZ5A 1OX4A 1V79A 1JZ3A 3FS2A 3I3DA 3BJFA 4I5UA 3ZQ9A 4HQVA 1PHWA 3R6IA 1RD6A 1GCYA 2WJDA 1FDYA 3PJUA 3RG6A 1OG6A 4WGXA 3PR2A 1UP3A 2PDLA 4F66A 3QJAA 2E6FA 6TAAA 1S39A 1UP0A 1A3WA 4A35A 2HMCA 3H7RA 3KL0A 5HA7A 2O9TA 5CLWA 4IXHA 3PAJA 1G67A 2ANUA 3ALGA 4XZHA 1B4KA 2F61A 4AVOA 1EYWA 3THQA 3PF3A 5JMUA 3L0GA 3WL0A 4CN4A 3CMJA 3HG4A 4V15A 3G1AA 2VGIA 4J4KA 3VGGA 3E49A 1A0DA 3TLQA 1IEIA 3CH9A 2PLKA 5DMNA 4NAEA 3CM4A 4CD6A 2HNEA 3UWEA 1L8PA 4GO9A 1PTAA 2F2KA 4CNOA 4H3DA 2X42A 2J25A 3WX7A 2PGWA 3LV6A 2GUUA 3IGXA 4LU0A 3VILA 3BICA 5CG0A 2OOGA 1PCWA 3OA5A 1XSIA 2QLYA 1OZQA 3L4WA 4EP8C 2V9DA 3ATZA 3IEBA 4RDWA 5B7YA 3V4BA 2PDWA 4KEMA 1JCNA 4C6QA 4LF1A 1V7YA 2QHAA 3NIYA 2ZUUA 1Y0EA 3NQCA 1NF0A 5AVNA 2QUMA 3JU2A 1W9BM 3B0YA 3WF2A 3W37A 4LF2A 1IT0A 3N6QA 4BFAA 3RX4A 1OFDA 5BOFA 5FJPA 2PCEA 3J7HA 3PPGA 2FGZA 4JQ3A 5JQ9A 2WANA 4TX6A 1H7OA 4UXDA 4X9SA 4AZ7A 5KEZA 4S2CA 2HJPA 1FOBA 1GTHA 9XIMA 5AC8A 4N02A 3OBAA 3HBLA 2UZ9A 1US0A 4PTVA 3RXZA 2WMFA 3BJTA 4N6FA 4KMQA 1E56A 1XLJA 1I2NA 3EDDA 2R1NA 1KQZA 1UUQA 3VDHA 1FDJA 1UKSA 1X7FA 2YW3A 3SN0A 2OLHA 1WXJA 4DPQA 1VIWA 1BQGA 1GOXA 4B5SA 1J5SA 2BVTA 1ZZMA 1VJZA 5AYYA 2NQZA 2G3JA 3EOEA 4DY1A 3SECA 1YRRA 3N4AA 4HK7A 2XZ7A 4F4RA 1TB3A 3NXFA 3GIPA 1J4EA 3QZEA 3LB0A 1VCFA 1Q7MA 1LM1A 4LUTB 3SCUA 1HTIA 1VPYA 2E1WA 2NXHA 3KP1A 5G2WA 3RRXA 3NOEA 1UJPA 3RYSA 2DDXA 1E0UA 2B0MA 4KCTA 4JHMA 3S9IA 3STPA 3I4EA 1OINA 3VDBA 3W22A 4LAOA 1YHTA 3MP3A 3NYZA 1KCKA 1M5WA 1QNRA 3F2BA 4L7ZA 1W3IA 3H55A 2X2YA 3U4FA 4LS0A 3NGFA 2EBNA 1AQMA 1LORA 1OM0A 4PYSA 4PTXA 3B0PA 4JN8A 3K4DA 1O5RA 1RA0A 3T7VA 4EXBA 1AVAA 3AO0A 2PE4A 4MAVA 3D3FA 3PHAA 1HUVA 1PZ0A 4DN1A 3B4UA 3MTWA 4IM4A 1P0NA 3MBDA 1HVXA 4N0RA 4RPQA 4DX3A 1L2UA 4P5UA 3LSBA 2FGBA 1F6YA 2IUZA 3QLLA 1IZKA 1RVKA 1EJ7L 4LBSA 1A5AA 4PR4A 1Y5WA 3HJZA 3ABQA 5CG7A 3UY8A 3VGEA 2BOGX 3PUOA 1K9EA 3FYPA 2PDNA 3H12A 5HAOA 3B4YA 4HA3A 4Z2IA 1C8YA 5FSDC 1KRCC 5E0KA 1TZ9A 4LS2A 1NWUA 2PA6A 1P0EA 4KW2A 5D03A 1F4HA 3GXIA 3G24A 1P7TA 3ZYZA 1JDDA 2DT0A 3N6JA 1ZBVA 1RP9A 7REQB 2Z7KA 3BDKA 2XFWA 3LRKA 3VIKA 5EY5A 3W2KA 2OQLA 3EEGA 4IOTA 4U2YA 4L9YA 3MYPA 3QQWA 5ABTA 2VDIA 1XBYA 3WJZA 2CLOA 1VR6A 2I56A 1UWAA 5CZKA 4HA0A 2Z2BA 1UKPA 3GVWA 3W2LA 4JTCA 4I9TA 1CX9A 4A8NA 1RBLA 3G1HA 1TX0A 2FVMA 5LGZA 3U9IA 1XYLA 1EF3A 1JYXA 3WQGA 1KB3A 3WFLA 4FALA 2PWDA 1CZ1A 3CGTA 3F5JA 2HEJA 3CUXA 1G01A 3OLGA 1PDYA 3H22A 4NI3A 3QY8A 3RM9A 2J88A 4MB3A 2ZZ1A 3C56A 4FLOA 4I8DA 4MJ2A