3W73A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-129
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-129
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w73A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w73A01
1NSJA 4O16A 5K4ZA 3VFLA 5D05A 3PBVA 3G1YA 3LCWA 3M5ZA 4FNSA 4E2BA 2NV1A 2WNNA 4JDBA 1EB3A 1VCFA 4N4QA 4R7JA 1W31A 2FQIA 2B0MA 2TSYA 4E0CA 1LOQA 4ZVJA 3GNNA 4GBUA 2QCGA 4CQ8A 3UZJA 2E6DA 2QEZA 2Y7EA 1Z44A 3IEBA 3DU0A 4GUIA 1AMKA 4MYAA 2J24A 1TPFA 1TCDA 2YXGA 1G4PA 5HUPA 1SSDA 2DU2A 5F1VA 4ZQPA 3W7RA 3HF3A 3DXIA 3QZEA 3U8GA 3N34A 1OHLA 5I3IA 1FWSA 3TAKA 2VFGA 4X3ZA 1A53A 3I7QA 5A8GA 2DZSA 4JTUA 3NAVA 3HJZA 3W2LA 3NL5A 4DPQA 3SJ3A 1OFDA 4IQLA 2HS8A 4K8EA 1R2RA 4GFSA 1W0MA 2FB2A 5BW6A 4JEQA 2CU0A 4JTSA 3GIYA 3LBMA 5C6MA 3GKAA 2NUYA 2YPIA 4AF0A 4JNMA 2OJPA 2TMDA 3NPUA 3PULA 2R91A 4FXRA 5DY2A 4AB4A 3S5NA 1V7YA 2QCEA 3TR2A 2V2DA 1W5QA 3B06A 1JCLA 3QM3A 1JUEA 3NPXA 4Y8FA 3M16A 3L9CA 1W1ZA 2XN1A 2E77A 5GVJA 2GQ9A 1I45A 1YYAA 4JX5A 5I3FA 5HMSA 2QF7A 1W3NA 4UXDA 3NM1A 1GWJA 3G1FA 1KV5A 1G7VA 4N4PA 4QITA 5FEXA 2B7QA 2F7FA 2I1OA 4XWUA 3LXCA 1R47A 4R53A 4XUGA 1VZWA 1KFBA 4Z0JA 5LKYA 2C1HA 4JTTA 3GR7A 4HPXA 4P2VA 4R34A 3ZWSA 1K03A 1NAL1 3UWZA 1WA3A 3G0UA 4LVGA 4A29A 3GZ3A 3PR2A 5D2WA 3I65A 4DXVA 1ZAIA 2DZPA 1O95A 5AYYA 4MFEA 3MHFA 3R12A 3M6YA 3W86A 3R2GA 4MIMA 1KW1A 3USBA 3UWYA 5LNUA 1E51A 5AC6A 4O4VA 1SZGA 1XL9A 4NZJA 1EP3A 4AEOA 2YX0A 2VC6A 5IBXC 3CEUA 3PC0A 3ATZA 5CPNA 2Y61A 2Y63A 3EWBX 3S5ZA 4GUGA 2ZZ3A 5CZ0A 4MJMA 2TYSA 2ZZ6A 3CQ0A 2C3ZA 2NWSA 1W56A 2H3BA 3C2FA 2ALDA 5E1QA 3Q94A 4Q32A 3MHUA 1VHNA 2FPYA 3TK7A 2YCEA 3BLFA 1NF7A 2EF9A 1PHWA 3TV8A 2Y70A 4UMBA 1WBJA 1WV2A 2CLFA 4FIQA 4EF8A 1XXXA 2FFCA 3L66A 4O15A 3W2NA 4Z08A 4K7VA 3L0NA 3MJYA 4MY1A 4O50A 3W1LA 4UFLA 1B4EA 2ZRVA 3CIWA 3CIXA 3CPRA 3PAJA 3B8DA 2KZHA 5U4NA 5EBUA 1KM2A 2VFFA 1P0NA 3MBFA 3LXAA 5K3VA 3HB9A 2A4AA 3WK0A 4BWLA 4LTSA 3KX6A 3N9SA 3BV4A 3NEVA 3ABRA 3S42A 4JXCA 4CCDA 2DJXA 4K7YA 4HIBA 5LZLA 4A3UA 2YFNA 1Q45A 3IIPA 1JCNA 4YCOA 2WPBA 3F4NA 3F03K 1GOXA 1PHQA 1OFAA 3BLIA 1RQBA 3M43A 2YYTA 4PA8A 2Y7FA 2GVLA 2ISVA 3T7VA 4DQWA 3NL2A 1L9WA 3W23A 4UIOA 1GG1A 1YPFA 4IUOA 3W75A 3LHZA 3SSJA 3FKRA 4UTWA 3A9IA 3HOJA 3UWQA 3W7QA 2Y62A 5G1TA 4UR8A 1EPXA 2QCLA 1T8XA 4LNYA 4DO5A 3G1HA 1OFBA 1HUVA 4Y6GA 3L68A 4LS2A 3C2EA 1HTIA 3QRHA 1TJPA 4O1CA 5IM51 2QCDB 4O17A 1BTMA 3SI9A 1G67A 1RZMA 5KZDA 2P1FA 3KRZA 5I3KA 2EAWA 3QJAA 1ZAHA 4HHPA 3NQ6A 4TMBA 4ORIA 1H50A 2ATMA 4NQ1A 1GVQA 4UTTA 1KM3A 4M7SA 5AHEA 4JY9A 2J9YA 2OT1A 2VFHA 1UUMA 1ME8A 3DI0A 1VYRA 1EA0A 2NUWA 3P84A 3TA6A 4UTJA 1IXOA 5LNWA 1ICQA 4O28A 3OA3A 1HFBA 2E09A 1LRQA 1ICSA 1M5WA 3LBCA 4LVAA 1B57A 1SSGA 4NJHA 1KM0A 3QMRA 2LLEA 5KMYA 4GUFA 4UR7A 3STGA 2FJKA 1KBIA 1LROA 1A5SA 2GJNA 1DVJA 3DFPA 1FXPA 3W2KA 1N55A 3O6YX 3QFEA 5BNKA 3GDLA 3O15A 3W1MA 1AK5A 4K38A 1THFD 3W84A 1TQJA 3UY7A 1H7OA 3M9YA 2QJIA 5T26A 4D2JA 4IMCA 4UMAA 3EXRA 3GAYA 1DL3A 1RR2A 2WKJA 2WQPA 1F2JA 2ZRWA 4WY0B 2IQTA 4FNRA 4AH7A 3LHWA 3ELFA 3DGRA 4LVBA 2A6NA 3A21A 2P10A 4OV9A 3W7EA 4DBDA 2JKEA 4XKYB 4JR5A 1R30A 4LRTA 2F84A 1TV8A 1H1ZA 3TC6A 3T44A 1ZALA 4Y90A 3G8RA 3G3DA 3ZWTA 3B4UA 5KZMA 1YTKA 1QWGA 1DKWA 4O1BA 3MO7A 3KVLA 3A22A 4RZ6A 2VENA 3E96A 3HGRA 4FNPA 1U5JA 5AC7A 1VYPX 1TO3A 3ZS4A 3BPWA 1C9DA 2YW3A 5E93A 4UTMA 3PBYA 5D33A 4EF9A 2VFEA 4LS1A 3IVTA 3B03A 4JIPA 1N7KA 1R46A 2RKXA 3G22A 1FWRA 2CZEA 3TUUA 5E0KA 4S1FA 1A50A 3TAOA 1XFBA 3QQ1A 1LBFA 2A7RA 3TSBA 3PB2A 4UFMA 4XZ9A 3LDVA 2ZCGA 3LERA 3S1XA 3W07A 4DPPA 1XBYA 2QCDA 3LTSA 5LGXA 2VOMA 1RVGA 2QAFA 3STFA 2E5BA 4M19A 1FBAA 4XBSA 1L6SA 1MSSA 2V5LA 2RDUA 1YTEA 5CGQA 3TMQA 3HO8A 5D2VA 3YPIA 1QAPA 2ZRYA 3TW6A 4OWGA 4XTIA 4H3DA 2HS6A 5IBXA 4ADTA 4FX7A 2VEIA 3EX1A 3P61A 3RF9A 3HBLA 2PRLA 2Z6IA 2QDHA 3HG5A 2NZLA 3W22A 5AC8A 2VKZG 2ZFAA 4FHAA 1D3HA 1VLWA 3EWYA 4LV4A 2V2CA 5AYXA 1AL8A 5FF2A 4JTFA 5F4SA 4Q4KA 3DI1A 3P62A 1V5XA 4X2RA 4ZL1A 3QEZA 1YXCA 3L0GA 3GXPA 1W8SA 4PCFA 4BWLC 1FWWA 5KTLA 1OYBA 2VELA 3G24A 1C29A 2I9EA 4GXMA 3NO5A 2Q8LA 1CX9A 1F6PA 3C3NA 1QMLA 1SFLA 3G0XA 3M47A 1H7WA 1K7EA 2X1RA 4WY0A 1WOBA 1F7BA 2DZWA 1H5YA 3FKKA 2Y6ZA 4NXSA 1FCQA 2G96A 4CNOA 4FIRA 4N9DA 3DHFA 1F05A 2I14A 4RX0A 4XKYA 2C13A 4ORMA 2OT0A 4AWTA 1P5BA 4B5NA 4QJ1A 1LORA 1LRTA 3GKFA 1SO3A 4Z1BA 4JX6A 4UTWC 4S2BA 3TXZA 3W76A 3O8AA 4RV8A 1WQ5A 4NU7A 5FF0A 5EL1A 3JR2A 1F73A 5CPMA 3IIVA 1ADOA 4N6FA 3ANYA 3FJ6A 3O63A 5D2XA 3GXTA 5L6UA 1ZJIA 4ZQNA 4WOQA 5G4WA 2BWGA 3O16A 4IX2A 4UTKA 3LHVA 3LTPA 3HMJG 4UTTC 2FTPA 2WSQA 4LUIA 2ISSA 5DXYA 3A24A 1GZGA 1IF2A 1JJKA 1W5OA 2Y89A 3LCIA 3BW2A 4K37A 3QYQA 5AHLA 4AMAA 5CZJA 5KSWA 3VKJA 3DAQA 2C19A 3R89A 1OFRA 2YGYA 4LW7A 2H8ZA 4FX6M 3VE9A 2ZZ5A 4NUWA 5DCEA 1AW2A 3HPSA 4O54A 4DF2A 4K6AA 2X30A 3S1VA 5AFDA 1LOSA 2Z1BA 2DZUA 1HO4A 3QSRA 4UTIA 1QPNA 3L2IA 5EY5A 4JICA 2X1SA 3JRKA 1LCOA 2DJLA 5LHFA 5L9FA 1UBSA 3L65A 3C2RA 1OJXA 5G2HA 3RLVA 1OFPA 1L6WA 3I7SA 2QUUA 2G95A 3W1TA 3UD6A 1D3GA 3KOFA 4N2YA 3NQCA 5G5IA 4Z0SA 2C0AA 3OIXA 1QOQA 3C6CA 4JYEA 3EXSA 5D04C 3FJLA 3EWWA 3B05A 4ALDA 4Z1CA 2WOQA 4GC4A 4O13A 4O12A 1AG1O 1TRDA 4M6VA 1TREA 1VCGA 3KHJA 1PCWA 2Q3RA 4ZZ9A 2QCNA 3EX6A 3GDMA 3QH2A 3V75A 1KM6A 4K8HA 3P60A 4KKXA 1FXQA 4O0ZA 1B9BA 3DKJA 2BLEA 3EKZA 3W1UA 1P4CA 3MW7A 1LBLA 1I2RA 2OZ0A 2BTMA 1KBJA 2GUUA 2QJGA 3STCA 4IMEA 1FY6A 1LP6A 2QDGA 5LNVA 3TC7A 5CZTA 2DZXA 4RJEA 2A21A 1R2SA 2QJHA 1O5XA 1VQTA 1PVNA 4TMCA 2PURA 1VJIA 4YMZA 3LX9A 5D03A 5C55A 5EYWA 3T55A 2Y7DA 3LI0A 1GG0A 3QF0A 2DP3A 5HINA 3RMJA 1MEHA 4ADSA 1ZY9A 3E49A 5D02A 1S5WA 1GYNA 1NEYA 2VEMA 4TIMA 5LHEA 4UC5A 2ZRXA 3UZ5A 3OEXA 1TV5A 3ZFHA 1L6YA 3W88A 5CKSA 2W79A 1RD5A 1TPDA 4M5PA 2CFFA 3IVUA 4DF1A 4I7VA 1M7OA 1K7FA 3N9RA 3G18A 1TPC1 1KFCA 2VFIA 3M44A 1Q6OA 3VNDA 4FNTA 4C1KA 3R13A 1QFEA 4HNUA 4JIQA 1KFEA 3W87A 2XFWA 3P82A 1X7FA 3T40A 3Q37A 2ZTKA 5CPOA 3U2OA 4DO4A 3GXNA 1PIIA 3GVGA 3FLUA 1KA9F 3W7PA 3BG5A 2QCCA 3TXVA 4M6PA 1RV8A 4O57A 1GVSA 1SO6A 1ZFJA 8TIMA 3NOEA 1QDSA 4HT3A 4MZ1A 4MYXA 3M0ZA 1GJPA 4TR9A 3C56A 4MFDA 4HSNA 1JRCA 2YDAA 3G1DA 1ZHAA 5CG7A 5TBOA 1P0KA 1CI1A 1TTIA 5D32A 1KM5A 3WJYA 3Q58A 3BGJA 3W7MA 1AL7A 4KWWA 4JTIA 3NPVA 3PS7A 5C5YA 4NT0A 4BR1A 3PSVA 4MPQA 2QKFA 4GWEA 5AHFA 4BI5A 1KTBA 3UWWA 2V30A 1OK4A 3CLMA 2FIQA 2ISWA 2RH9A 2E6AA 3GDTA 5DCBA 1VR6A 3W1QA 1N8FA 4O14A 1BWLA 2Z0IA 3WK2A 1K3UA 1Y0EA 1QCWA 3CEPA 3LRLA 1WAUA 1Z48A 4UCGA 1QOPA 3MBDA 5G2IA 2H8XA 1JR1A 4ML9A 4Q33A 2ABAA 4ONVA 3ABOA 5G4EA 3MP5A 1Q6RA 3RLUA 2H90A 1WX0A 3AJXA 3BO9A 4CCCA 3EWZA 1I4NA 3PWAA 4P61A 4LS0A 4Y96A 5DBUA 1EX5A 3GYEA 1DQWA 3G8EA 4RXFA 1XI3A 1MZHA 5KZEA 4UFJA 4L4MA 1KLYA 3W7CA 2G97A 3SZ8A 1EUAA 1G7UA 3TX9A 2XN2A 2WNQA 3MI6A 4IPJA 3PBWA 2A85A 1M7PA 4BK9A 1TRIA 2BXVA 6TIMA 1H63A 4DO6A 3NQVA 1MEIA 3U6WA 4MY9A 3ATYA 4UNKA 3OHIA 2E6FA 1JQVA 3IGXA 3W7OA 3TQ0A 3C4UA 3O06A 2NXGA 4XBKA 5D30A 3PB0A 3W9ZA 3W7KA 2C15A 4YXGA 5F2MA 4LVFA 1DV7A 3S5OA 2X2GA 3W74A 1A5BA 2CZ5A 5D09A 1VLIA 2Y85A 4K39A 4N9BA 5F2IA 5CPLA 4PEKA 3BG3A 4JTHA 3OVRA 1YXDA 2V8ZA 1A5CA 2WSYA 2GJLA 5F2GA 4E2DA 1YPIA 3TDFA 1O60A 3DKLA 1QNVA 3JS3A 4I7UA 3CC1A 1ME7A 3C2VA 3E9AA 3PM6A 4GNJA 3IIXA 1VCVA 1QO2A 1M6JA 1SZEA 3L21A 2V0TA 4HKPA 1FWTA 4PFMA 2E1DA 2B7OA 3HPZA 5ABTA 1YLVA 1JVNA 2H3DA 2EKCA 4MVAA 2ZZ1A 1JCJA 3GDRA 2YYUA 3NQFA 4HPJA 2A6LA 1OG0A 4RK8A 3UPBA 2OX1A 3SW6A 1WXJA 1OX6A 1KTNA 1F76A 3R8RA 2V5BA 4NNBA 4M7TA 2PRHA 1TPEA 3MP4A 4I9AA 3DFOA 2A0NA 1EP1A 1XBVA 3HPXA 3CHVA 1TQXA 3EX3A 3W1NA 3G3MA 4KFPA 3TSDA 3BARA 2A7PA 1K8ZA 2FPTA 4MLJA 1TPUA 5J5RA 2ZYFA 3G1AA 4U4MA 3T4CA 3L5LA 3Q2DA 1LTDA 7TIMA 1ZCOA 4OQVA 1FUYA 5HWMA 4YL2A 1GVOA 3UY8A 1L2UA 4KFNA 1QPOA 3NR0A 3P5YA 5HULA 1ZENA 5CSSA 3DBPA 3RNDA 2R14A 4WOZA 3EKLA 2NUXA 3TNOA 1H1YA 2ZA3A 1DOSA 3MUXA 4JN6A 2FB3A 3NQMA 3NQDA 4JTEA 1OF6A 4LV9A 3ABQA 3NQ7A 2O7QA 1LDCA 2ZZ4A 1J4EA 5A5WA 1HG3A 1SW3A 2C18A 4QNWA 3S9YA 4O8RA 4WZHA 1UASA 3NPWA 2XN0A 1DHPA 4NX0A 4WY0F 4KFOA 1SZNA 1KFJA 3IIZA 4QQ3A 2H6RA 2ZRUA 3NNTA 1XDMA 3NQ8A 1WYIA 1FDZA 3LM7A 4JTLA 4RXGA 4AHQA 1U83A 5C2XA 4OGZA 3O1NA 1D9EA 5I3JA 2B7PA 5BMWA 3LXBA 4FNUA 3P8JA 5CSRA 4NNAA 3B04A 3EXTA 4AHOA 4I7WA 3WJZA 3TJLA 4U28A 1S5VA 4POCA 3SGUA 4FEZA 3GDKA 3THQA 1Q6LA 2CW6A 2RDTA 3C0JA 4XQ6A 2EPHA 4LVDA 4NJGA 2Q8ZA 3WJSA 4L4LA 3LB0A 1SQ7A 3SR7A 5K2ZA 1QPRA 1I2PA 3G1VA 4BF9A 4NX5A 2JKPA 4PH6A 4QM1A 1PS9A 4S2CA 5F4WA 3NA8A 3OVQA 3I68A 2CLKA 3S6DA 3UWVA 4GE8A 1TPVA 1RQHA 4YWIA 4WQ6A 2QUTA 4PL2A 3IGUA 3IGSA 3F1QA 1TYGA 4A21A 3O6DA 2R8WA 3LHYA 1JULA 1O4UA 4UTHA 1LLWA 1R2TA 3GB6A 1AW1A 2ABBA 4JYFA 4Z1AA 5HR6A 1KM1A 5DN1A 1SZFA 3QW3A 3HQ1A 1JRBA 5K9CA 5BMXA 5DXXA 2Z2UA 4J9JA 3P80A 3F4WA 4MZ8A 3C52A 3NQGA 1IGSA 5SWUA 2PRMA 4O10A 5FESA 1B3OA 3P5ZA 5F2LA 5G1YA 1I2OA 4UFKA 1YDNA 3BG9A 3VI2A 3IIOA 1LOLA 3G1XA 5CZSA 3BVJA 4JTGA 3V1PA 3EX2A 1G4SA 3LRKA 5AHIA 4HSOA 4WUIA 3FIGA 3I6RA 2RHGA 2UV8G 4IOTA 4X9SA 5LNSA 1K8YA 1TTJA 5K7JA 3QPYA 1H7PA 5EMUA 3THAA 2DORA 3LI1A 3NQAA 5MHBA 1DJNA 3NXFA 1H62A 2HTMA 1OVDA 1K7XA 1VRDA 2NXIA 1C8VA 1G6CA 1H51A 5LGZA 1FX6A 3LCFA 1LRNA 3DFNA 4YLWA 5D2YA 4DELA 1I2QA 4PTNA 4EIVA 1BKSA 1IXQA 1T99A 2VXNA 5TQLA 1QPQA 3H55A 3HGOA 5LSMA 3S5YA 4OE7A 3NQ2A 3C8FA 1SFJA 2GQAA 2AAMA 4O52A 4N02A 3TU9A 3M41A 2CLIA 5FF3A 3CB8A 4CQAA 2A7NA 3IVSA 1JUKA 3S0CA 1YDVA 3N2MA 2FDSA 4YCPA 1OABA 4NVTA 1KFKA 4GRSA 5DY3A 3HG4A 4BFAA 4RKAA 5DBTA 2E68A 5EPDA 3W6YA 3WK3A 4EWND 3BK0A 4IMGA 2CWNA 2E5CA 2JGYA 2W6RA 4IXHA 1HO1A 3PVFA 4MY8A 1J5TA 4UFIA 4TX9A 3PY2A 4FNQA 2A5HA 1GVRA 1QR7A 1H60A 3CM4A 3QPZA 1GVFA 4LC8A 3N73A 4FF7A 2J9ZA 4NJIA 3O07A 1NF0A 5D37A 2Y7GA 3CTLA 1FCUA 3W1AA 4CNNA 2QUVA 4DEFA 1O5KA 3KAOA 3FFSA 4HNNA 1GPWA 1K8XA 2CLLA 2J6XA 4UUIA 2GVJA 3NQEA 2V82A 4MOZA 1XBXA 5K9DA 3KRSA 6ALDA 2OCZA 2ZTJA 3QMSA 3LHUA 1KM4A 3DH7A 4ZQCA 1YTDA 3TCEA 1SUXA 3OG3A 5AYZA 3MYOA 2FLIA 4N6EA 3WFAA 3TFCA 4ZQRA 1W3TA 1JCMP 4O18A 1OYCA 5H91A 2WNZA 1I8JA 4X22A 2WSRA 1FCBA 5G2WA 5FI8A 3W3OA 1VPXA 4O11A 2VEKA 4DBEA 1SW7A 3P74A 3IRDA 5AB3A 1IXPA 3H53A 2J9XA 3PUOA 4OBTA 2CZFA 1SPQA 1G69A 5KINA 1JCXA 4RR4A 1FDJA 3W2UA 5F1UA 3TH6A 1ME9A 1TSIA 1EUNA 3NGJA 1UJPA 3N14A 4UTLA 2V9DA 5HJLA 4IWWA 4HN4A 1OFEA 3W85A 1UB3A 2GQ8A 2Y88A 3DZ1A 2YZRA 1ZNNA 3ZR4A 1EIXA 1OX5A 4WJEA 2Q3OA 4LRSA 1LBMA 4A2SA 3LLFA 3NL3A 1F5ZA 4JGDA 3NVTA 2V81A 3PBUA 3LHTA 1KV8A 3INPA 3L5MA 4FXSA 3S1WA 4JTKA 2TRSA 5EA9A 5BRBA 3LCHA 4HNVA 1EWEA 3W7DA 3GK0A 3MI3A 2ZQ0A 4KWVA 4G1KA 3W1RA 3NYZA 3DFSA 1UCWA 3FOKA 4OV4A 1DBTA 1FCVA 5TIMA 3E0IA 2W0UA 4O19A 5D38A 1Z42A 1MO0A 3LLDA 3KVJA 5HWNA 4TU1A 3GNDA 1F6KA 1Q6QA 3EEGA 1I2NA 4GUHA 3CWOX 3GX9A 3UXDA 3UYCA 4EOUA 1OX4B 5FEWA 1OYAA 3B0UX 3QW4B 3O05A 3S8HA 1YXYA 5H2ZA 5FF7A 4JS3A 3TMLA 1WDWA 1W54A 2NXHA 1LLZA 3L67A 2ZA2A 1GEQA 1Z41A 3BW4A 2V2HA 2QCMA 5K4XA 5HQEA 4AHPA 4NXKA 3DFTA 4HNTA 1LM1A 2C16A 4IGHA 1QO5A 3NL6A 2A2IA 1G4TA 2QR6A 2DZVA 1PE1A 5HWJA 3QC3A 1EWDA 3FS2A 4JX4A 1X1ZA 2CLMA 4EVZA 3DFQA 1Q3NA 4ICNA 1PV8A 2X1UA 1ZAJA 2NX3A 3R5EA 2C14A 1X6UA 4RZ4A 3TROA 1ML1A 5FF4A 3PF3A 2ZZ7A 5DELA 3MMTA 2A1YA 4UMCA 4ADUA 1SO4A 2QCFA 1XCFA 3CU2A 4LU0A 4PL1A 2G5WA 1RQEA 3SECA 3I7RA 1TJRA 4OU1A 1VHCA 4GUJA 2VFDA 3IV3A 5F4XA 2E5DA 3PUDA 4IXXA 4MJZA 4JD4A 3W73A 3KFTA 1WOAA 4GJ1A 1JQXA 3S1UA 2NX9A 3W2MA 1RPXA 1TIMA 3ABSA 4NNCA 3A5VA 4MUZA 2WV8A 3LV5A 4MZYA 4AAJA 5C54A 2R94A 4LUJA 3N19B 2P0OA 4N9EA 2CLHA 4PC8A 2X1TA 3SIZA 2VEPA 3PG8A 1H7NA 1O94A 3N2XA 3EB2A 3GAKA 1KTCA 3P7YA 1GTEA 4OHQA 5AHNA 3D0CA 2WJZA 2WO5A 4R33A 1JUBA 2AQWA 4ZQMA 1H7XA 3NZ1A 3STEA 1FDYA 1IIHA 2D73A 3W7GA 3NZRA 3T78A 4Y9AA 3GLCA 1YADA 1CW2A 4UNLA 4H6KA 4WX2A 5DLCA 4H4IA 4A2RA 3LCGA 4LC6A 3HIJA 3UWUA 1UUOA 1X8FA 1JCYA 1HL2A 3LCXA 4NZFA 4LY8A 3QMTA 3UNDA 3W7HA 2B7NA 3PG9A 3A23A 1VGAA 3BW3A 2J88A 1T0OA 1W5NA 3MP3A 1OX4A 3EWXA 1T96A 3MHGA 2YFOA 4QIUA 3FYOA 2O7SA 4N9CA 3KVMA 5AN7A 2BSLA 3TKFA 4E38A 1W37A 3A5FA 1DJQA 2CLOA 4IMDA 4QAIA 1XDLA 3RFAA 4O0KA 4AVFA 3WJXA 2J27A 1H61A 4MLRA 1OFQA 3M5XA 2GPTA 1TV7A 3HG3A 4IPIA 3QSTA 4WD0A 5I3HA 3M5YA 3PSWA 4IMFA 3N3MA 2AGKA 2C6QA 1OFOA 1NFBA 4LOCA 3HGJA 4IJBA 3W2JA 4UFHA 4C1LA 1ONRA 1IIGA 4W9TA 2ZRZA 1FWNA 4NJKA 3K30A 4RZ5A 4WXZA 1PCKA 2FPVA 3EX4A 2PC4A 1W3IA 1LYXA 3VCRA 2ZA1A 2JKAA 3NM3A 2JGQA 5AOUA 2RDWA 5I3GA 4JDYA 4UTUA 3M1ZA 3W7JA 1MEWA 3OBKA 3HGSA 1OF8A 2Z6JA 3BLEA 2B4GA 4O1AA 1MXSA 2EGZA 3UPWA 4JY8A 2NWRA 3SGZA 1S3HA 2YSWA 2EHHA 4AXKA 3C61A 2OMAA 1BEUA 3FYPA 3G0SA 4O4WA 3TW7A 1GQNA 3TIMA 3M7WA 1TPH1 1TPB1 1VS1A 3GR8A 2X16A 2NLIA 1S5TA 3FEMA 2CLEA 3KVKA 1XKYA 3BGGA 3OVPA 1XUZA 4O53A 4Z1DA 1A5AA 4A22A 1YDOA 3AO0A 3QQ0A 1TTPA 2NX1A 3P67A 1NVMA 3LGEA 4QNEA 3DENA 1KFLA 1G4EA 3C2OA 1TTQA 3LOTA 2ZBTA 3SY5A 5FEPA 1LZOA 3KXQA 3W83A 2NV2A 3VE7A 3TFXA 1SO5A 4AWUA 2TPSA 1EP2A 5LNRA 3TSMA 5HNRA 3LCLA 4FO4A 4CCEA 3UXAA 3B0VC 2DZTA 2E6YA 5EKYA 1EEPA 4M6QA 3CT7A 2HMCA 4TO8A 4ZQOA 5HR7A 5AHMA 4CQ9A 3DHDA 1PL9A 2YW4A 3M5VA 2GOUA 3E02A 2QAPA 3E12A 4AF0B 2ZDRA 3PUEA 1F74A 1K02A 3UQNA 1B4KA 1J2WA 1XC4A 3B0PA 1AW5A 3RK8A 1W5PA 1XBZA 3WK1A 1X1OA 3LV6A 1BWKA 3SFKA 3O6CA 1FQ0A 1XM3A 3TQVA 1VC4A 3MI2A 4OT7A 1GTHA 1VYSX 2CZDA 3RU6A 1SU5A 1GYLA 3P81A 5U7SA 3EWUA 2JBMA 1TPWA 3CWNA 4RCXA 5J5DA 2ATSA 3W7IA 2PCQA 3KRUA 3P8IA 5BOOA 4CLMA 3NDOA 2ZZ2A 1P1XA 2HSAA 4RLIA 3MWAA 3G1SA 3LTYA 4ZMGA 3W7LA 2YR1A 5DCDA 3MYPA 1DORA 1KLZA 2BZNA 3TQKA 1W5MA 4JTJA 4JYDA 4CNPA 1H7RA 1TMHA 3TE9A 3W1PA 1ICPA 5HUOA 3W1XA 4FX8A 3L0KA 1WBHA 4NJJA 1IXNA 4PODA 4IX0A 3HG2A 5K9XA 2BX7A 3W7NA 4BI7A 4BI6A 5KITA 3TJXA 3H54A 1OK6A 1ALDA 5D2TA 4XTDA 1DQXA 3WJWA 4DF0A 1VH7A 2RFGA 4FB7A 1GT8A 4K36A 4MKNA 4LWWA 4WXYA 3W70A 2PE4A 4AWSA 3NG3A 3LRMA 2QCHA 1SR9A 2JK2A 4LT9A 3W71A 1SW0A 3L5AA 5FEZA 1TB3A 1XUUA 2GVGA 4O1DA 4QSHA 3W72A 4QISA 3FA5A
chains in the Genus database with same CATH superfamily
3KZPA 3TOYA 4O16A 4ZFCA 3BURA 3RITA 2FVLA 3GH4A 4E2BA 1ZP4A 3RM4A 2WNNA 4C6KA 4JDBA 1VCFA 4R7JA 3IAQA 4F2UA 1UZ4A 2B0MA 1AH4A 1LOQA 2QUMA 4NHVA 1JGMA 2QEZA 2Y7EA 3A3XA 3P0WA 4AUBA 1XD1A 4GIEA 3S83A 4KMQA 1JPDX 1XISA 2FGLA 2BS9A 5F1VA 4ZQPA 4ICCX 3W7RA 2ZVRA 4RDYA 2R1LA 3DXIA 1QW9A 3N34A 2DZBA 1GORA 3TAKA 3K5XA 3SGGA 1CGXA 2DZSA 3NAVA 3ITLA 4K8EA 3E0FA 3UFYA 1W0MA 3CIVA 3E0WA 1Y65A 3DECA 4E4FA 4ZB2A 5C6MA 1EC8A 2NUYA 3LM3A 1Q8JA 3VNMA 3NPUA 3WY1A 2R91A 2XWEA 5DY2A 1K4HA 2G41A 3BJFA 1MW1A 1PAMA 1JCLA 1JUEA 4Y8FA 3F5LA 3M16A 5FJPA 3L9CA 1W1ZA 4Y9NA 4DO7A 2NQJA 4C1NB 4Q8VA 3SBFA 2PA6A 3QV7A 1YYAA 2XGBA 4CVWA 4GH3A 1XLMA 2L5HA 4UXDA 3NM1A 2AQOA 3G1FA 1MNZA 1G7VA 4QITA 5FEXA 3H12A 1PPIA 2NT1A 4MWAA 3Q4DA 2C1HA 2OPJA 1EC7A 3PWGA 1AQ0A 2PODA 3VZXA 2Y24A 4LAKA 1K03A 3ZWSA 1NAL1 3UWZA 3OQ8A 1WA3A 4LVGA 1E0TA 4ATWA 1OB0A 4DXVA 1ZAIA 2DZPA 1O95A 3MHFA 2OZTA 3GY1A 3FDKA 3M6YA 3W86A 2OGJA 5FJRA 3UJEA 4QLJA 1XIEA 1SZGA 1XL9A 2GSHA 4QE4A 4PMNA 1FH8A 3CEUA 2BXYA 3VIPA 3WIJA 1RP8A 1E71M 3ATZA 2VEGA 5CPNA 3EWBX 1DXFA 2ZZ3A 4MJMA 2ZZ6A 2G4FA 1PX8A 5CC3A 2C3ZA 1W1A1 2NWSA 1W56A 5E1QA 4DRSA 3BQ6A 3U0HA 1V7AA 1XINA 1NF7A 4GFIA 3WDJA 4FIQA 4EF8A 2PSNA 4Z2KA 3ES7A 4JQ2A 2OEKA 4KRUA 2DIEA 1YPXA 4A6GA 2CYGA 4O50A 1W1PA 4UFLA 3UG8A 4GACA 3CIXA 2X42A 2WANA 3B8DA 4Q4MA 5DQPA 3ITYA 1B3XA 3OO2A 1O1HA 4RPQA 1IEVA 3HB9A 5HNUA 1HN1A 4BWLA 3OHMB 3GTHA 4S3AA 3GU1A 1P48A 3WQOA 4CCDA 4GVIA 2DJXA 1M7JA 5I09A 2PTDA 4FXFA 4NRRA 1Q45A 3IIPA 2POZA 4JTDA 4NG3A 3LG3A 1PHQA 4S39A 1GQKA 4HMNA 4PA8A 2YYTA 2BP1A 3BSMA 5D9NA 5BU9A 2VYOA 3NL2A 1UR8A 3C5QA 1E0VA 1YPFA 1XW8A 1E9ZB 3OPSA 3LHZA 1DP0A 1XH2A 3W7QA 2Y62A 2DY3A 4UR8A 5G1TA 2YA2A 4C1NA 3H26A 1T8XA 2XIJA 4I8DA 3KLLA 3ZLFA 1Q6CA 3SI9A 1G67A 3SRFA 2YIHA 3QJAA 3LMZA 4DUXA 3NQ6A 4QS6A 3URBA 1ODZA 1H50A 3LGGA 1EBHA 4JY9A 2J9YA 2OT1A 3AHXA 2RJHA 6REQB 1BYAA 5I0DA 4JCLA 1ME8A 5IHSA 2JQXA 4XBJA 2EG6A 1VYRA 3TWAA 4UTJA 1IXOA 1ICQA 2QXWA 2G50A 3OA3A 4OUEA 1HFBA 1EYWA 2BHZA 4PN2A 1W9VA 1XV8A 3AICA 4HK7A 3LBCA 1B57A 4OOZA 1KM0A 3N4AA 3HV8A 4GUFA 4Z2HA 4RDZA 1KBIA 1LROA 1A5SA 1Q2SA 3W2KA 5CH9A 3EPNA 3O6YX 3VNIA 4JIHA 2X09A 1KGWA 3W1MA 1XPYA 4IT1A 3W84A 1HGYA 3UY7A 2IPFA 2RDXA 5T26A 4D2JA 2A3EA 1Q66A 4HMDA 4LSBA 4D6EA 4XO7A 3VNKA 2WKJA 3ONBA 1JZ7A 4IQJA 4Z1YA 2WSKA 2A6NA 5C9WA 3W7EA 3M0XA 1R3VA 1L6GA 4DBDA 1JAEA 4XKYB 2R1KA 3H70A 2P8BA 4U3CA 3BDKA 3T44A 1UD3A 4NYYA 3S9IA 1GQIA 3KCJA 5AECA 1US3A 3PFRA 3SSZA 1G1YA 3VINA 2R1PA 2UY2A 2IW0A 1BYDA 2P5NA 4HQVA 3BPWA 1XPGA 1Z89A 3O7UA 4WSHA 4UTMA 3OGRA 1XSIA 3PTDA 5H1WA 4KIEA 4LS1A 3MWCA 4EANA 2RKXA 3W53A 4DB7A 3PZMA 3GRIA 2CZEA 1ZLPA 1WE5A 2Z25A 4S1FA 1YE6A 2PDLA 4KESA 3TAOA 4P7RA 3PB2A 4YYFA 1DE5A 1VBGA 3ZVIA 2ZCGA 1J10A 1ITUA 5LGXA 3B9EA 1RVGA 4PUJA 1EX1A 2J47A 2XFYA 4M19A 3QGVA 1MSSA 3KTCA 1HQTA 2PD5A 2RDUA 3AMKA 4PUWA 5D2VA 3WQWA 2IQDA 4MHBA 3TW6A 3UXKA 1S2UA 6REQA 1JYWA 4OWGA 4IQEA 2WMFA 4ADTA 4FX7A 2HBXA 3RF9A 1EZWA 3URQA 1V0MA 3QHNA 5A6AA 4GH1A 4PMOA 4FHAA 3D5HA 4QE1A 5AYXA 3QV9A 5ABFB 3E2VA 3QQWA 2BVYA 3TN3A 4Q4KA 3DI1A 3P62A 3H22A 3ARWA 4HVXA 3QEZA 3L0GA 2D2GA 2F38A 5RUBA 1FWWA 3GIPA 2VGIA 4I5RA 2PGEA 2HCVA 2I9EA 2OQHA 4GXMA 4LCSA 1SFLA 4W8BA 3SN1A 2IXVA 1SM9A 3BMXA 2UY5A 4NXSA 1E4MM 4CNOA 3T8QA 3M46A 4N9DA 3ZM8A 4XKYA 4KEZA 5IHRA 1Z69A 1X38A 1BQGA 2W67A 4JFWA 4QJ1A 8RUCA 1AA1B 1E3XA 2PGRA 3V4BA 3RR1A 1DIKA 1KRAC 3O8AA 2PBOA 1WQ5A 3I4KA 4PBGA 5A95A 3JR2A 3MKKA 1F73A 1KWKA 2VO5A 3IIVA 1QNPA 1ADOA 4IICA 2FZDA 1F4HA 1ZB5A 3WUFA 5L6UA 4WOQA 5G4WA 3TYUA 3N2CA 2BWGA 4CUCA 4Z2LA 4H7ZA 2FTPA 2WZTA 2PLKA 2YXOA 2J7GA 3BW2A 1LG1A 3QYQA 4OFCA 5KSWA 3SUTA 4FP1A 5HATA 4DWSB 2DSVA 3IJ8A 2ZZ5A 4W89A 1TWDA 5DCEA 1AW2A 3HPSA 4K6AA 4ENLA 4WGHA 2X30A 3MC5A 4KCTA 3S4TA 3VX0A 1HO4A 4JICA 4UZSA 4L1GA 1LCOA 1CLXA 1JI2A 1TKKA 3UG3A 3REQB 3VYLA 3WLSA 1UZ1A 1JYXA 2Z2BA 3VO0A 2QIIA 5G2HA 5M03A 3R94A 3UD6A 4JIEA 3LMYA 4E3TA 1S5NA 4Z0SA 3AJ7A 1V02A 3C6CA 1TJ1A 3EWWA 3M07A 1LG2A 4Z1CA 4ALDA 5EMLA 3UR5A 3CUZA 3WBEA 5ABFA 1AG1O 1TRDA 4M6VA 1ADDA 4ZZ9A 1F9CA 2QCNA 4OECA 3RLGA 3P60A 4O0ZA 1B9BA 3V5OA 2A3CA 1F07A 5DT7A 5CBIA 3W1UA 1JZ6A 2XVNA 1JXKA 4GABA 1EZ2A 1LBLA 4CNTA 1I2RA 4QSFA 5C71A 1ENUA 2GUUA 2OVLA 2QDGA 4MWAD 5CZTA 1V3JA 2A21A 1R2SA 3A4XA 1VQTA 3TYAA 3QHOA 3W38A 3ID7A 3LX9A 5D03A 2Y7DA 2EJAA 2G3NA 3QF0A 4NKCA 2I5GA 1AFSA 2YCLB 4ADSA 1OZQA 4W7WA 3OODA 1S5WA 4TIMA 3OEXA 3ZFHA 5CKSA 3WUBA 3JZEA 1RJQA 1XLDA 1K4GA 1SJAA 4S3JA 2WYSA 2Z2AA 1M7OA 3N9RA 3G18A 1U1HA 3N3TA 2VFIA 3M44A 1Q6OA 3VNDA 4S3GA 1E73M 4O1EA 2XFWA 4L64A 1LJYA 3KLKA 3P82A 3T40A 3CYJA 3U2OA 2ZTKA 1TVPA 2GQ3A 4MM1A 3FLUA 2DGAA 1PDYA 3W7PA 3GR4A 4IIHA 4HOZA 2PDGA 3N29A 1NDVA 2WPGA 3WD4A 3QKEA 1Y5WA 4FOJA 4DWSA 1Q65A 2OELA 2NV9A 2FHFA 4H7CA 1EQCA 3M0ZA 1GJPA 1E1FA 3T07A 3WSUA 1QWKA 3C56A 1T8QA 4JFSA 4HSNA 3U2EA 4ZA0A 1KKOA 3RX3A 5CG7A 3ZOAA 3ZT7A 4AEFA 1TTIA 1KM5A 3WJYA 3BGJA 4W88A 1XYLA 2PDWA 4F2TA 4Q4PA 4LAOA 3REQA 1E1CB 5AHFA 2PZ0A 3VM7A 2ISWA 1TWSA 2VOTA 3W1QA 1GYMA 4GZJA 3HQPA 5E6YA 2WWDA 1AMYA 3LRLA 3GHSA 4F48A 4GA8A 4J28A 1WZLA 5A8OA 4WLCA 3TYZA 3K8MA 2VRQA 1QI3A 2H8XA 3AIQA 4DWDA 1KB3A 4Q33A 2ABAA 3MUCA 1HJSA 4ONVA 2ZVIA 3ABOA 2XSAA 3CAWA 1S2VA 3I4EA 3C0SA 2H90A 3PBMA 3SCTA 1WXYA 3EWZA 2ICSA 4LS0A 4Y96A 1K9TA 5DBUA 3NVDA 3G8EA 3GYEA 1DQWA 4RXFA 4F66A 1KLYA 1CT5A 3TNBA 4DJDC 5LIXX 1TRIA 1KQZA 3KBJA 3KL3A 3WLOA 3PTKA 3U6WA 2WLYA 3OHIA 2H9AB 3S6OA 1XG4A 2X40A 2YCLA 1W9PA 1VJZA 4C5ZA 3WLPA 2G3FA 7A3HA 3AIVA 5C0QA 5F2MA 4X2PA 4E5TA 3IS4A 4U2YA 1A5BA 3V35A 3WBXA 2Y85A 1JL8A 3M0LA 3VKBA 4PEKA 4K1WA 3BG3A 1EKOA 3SB0A 1YNPA 3WQCA 4F9DA 4H6QA 2WSYA 2VZSA 2HVMA 2GJLA 1VP5A 2RGMA 1ME7A 2VZTA 2I17A 3GS6A 3IIXA 3UZXA 4HZ6A 3UWEA 2V0TA 3CQKA 2RAGA 4PFMA 3S6TA 1L0PA 3VGEA 2I9UA 4MVAA 1DJXA 1JCJA 4CKQA 4DJEC 3RU8X 4GZIA 2YOCA 5HJXA 3E0LA 2W91A 2OX1A 1E0WA 4HCDA 1KTNA 1F76A 2DPEA 3LBOA 3CZ8A 1EP1A 1XF0A 1E1CA 3W1NA 3G3MA 3AYTA 2A7PA 3B8WA 1BFNA 5REQB 3TZNA 5M2FX 3TTYA 2Z29A 4V1XA 3CV1A 4LAZA 1QOXA 1QPOA 4Z2JA 5HULA 3CUXA 4ECLA 3VD4A 2W5FA 4GI4A 4HHMA 1H1YA 2ZA3A 3S46A 1SJBA 2WNWA 2PS2A 3ZZ1A 4JTEA 2Q6ZA 1OF6A 2E8YA 3ABQA 3S2LA 2O7QA 1LDCA 3ITCA 1B2YA 2J74A 1XRVA 4QNWA 2XIMA 3OZOA 2IQ0A 4LALA 3H6OA 3VD5A 1H1NA 2NQZA 1T7LA 4WY0F 1V77A 1DYSA 3TN4A 4XZMX 4NP7A 4BEUA 3NQ8A 2QJJA 3T4WA 1TUFA 4JTLA 2Z7KA 2H9AA 3O1NA 5I3JA 5BMWA 3LXBA 1DWAM 4FNUA 5CSRA 3LPFA 7REQB 1R7AA 4WJXA 4AHOA 3WJZA 1E4LA 1KCZA 5BXSA 5C2GA 4WEVX 1DWJM 3GDKA 4GX8A 1GEHA 3THQA 1Q6LA 1J0KA 1QJWA 2RDTA 4XQ6A 2EPHA 4NJGA 3WQFA 3LB0A 1SQ7A 3SR7A 5K2ZA 4YVPA 1ZL1A 1QPRA 2XG9A 4W5ZA 4H8VA 1PS9A 2V69A 2FH6A 4S2CA 4DAIA 5F4WA 1FTXA 3OVQA 1CLKA 4QJ4B 8CGTA 1E70M 3UWVA 3CXOA 3B97A 3BJTA 3U4FA 1TPVA 2F2KA 5A1AA 1BF2A 4HJFA 2QUTA 3S47A 2QPSA 5CXPA 1FWBC 1K6AA 4FOUA 1XRSA 2R8WA 4FZIA 1V4YA 1VFUA 5I5RA 4KW2A 1BVWA 1XLEA 3RX2A 3VD9A 1KM1A 1KXVA 3QW3A 4LUSB 3RM8A 4PCPA 3HQ1A 3AYSA 2INFA 3CMFA 4V28A 1DXIA 4EP8C 2Z2UA 4KRZA 3F4WA 4XD6A 3C52A 5SWUA 1IGSA 2PRMA 4O10A 4AZ5A 5F2LA 5G1YA 5REQA 4CU8A 4DAFA 4GIAA 1W3HA 1I2OA 3BG9A 1JYVA 3BVJA 3N6JA 4NZ1A 2J77A 1YX1A 4ZOBA 4X0VA 3TONA 5LNSA 3QPYA 4R9OA 5A8NA 1EJVC 3THAA 3NQAA 3VKAA 2HTMA 1K7XA 1DWFM 4OKDA 4XAZA 4A3HA 1G6CA 2YDSA 4LBSA 1FKXA 1XSJA 4QCEA 3LUTA 4PZVA 5D2YA 1BWVA 3WN6A 4IF2A 1IXQA 1JPMA 1T99A 1Q8AA 5TQLA 4OE7A 3OYZA 3A13A 3NTYA 3BUVA 3PZOA 4WKHA 4JFVA 4O52A 2QGHA 2IKGA 3OP2A 3S0CA 7REQA 3KL5A 2GGEA 3WDQA 3F2CA 1YDVA 3N2MA 2FDSA 3VFCA 1AJ2A 2CEQA 1O7AA 4YCPA 5FL1A 3EOOA 4NVTA 1C90A 1KXQA 2Z27A 1WB0A 2E68A 5EPDA 3ZLGA 3WMLA 3CPUA 2Z1XA 1PZ3A 3QV8A 3B3DA 5IDIA 2JGYA 1WKEA 4IXHA 3T6CA 3SDOA 3PVFA 4RNIA 1A4LA 3GVRA 4TX9A 4FNQA 1GVRA 2ZICA 1H60A 4HJWA 2ZE3A 4LC8A 2Y1HA 3N73A 4WDWA 1RCOB 2J9ZA 1XYMA 2VJXA 1QHPA 3DHPA 4GD0A 2Y7GA 3CTLA 1FCUA 4CNNA 1B1YA 3KAOA 1FVPA 3NO3A 5G4HC 3CAKA 2Y8KA 1WCGA 5K9DA 3KRSA 4P8WA 1NFPA 6ALDA 2ZTJA 3TCEA 1YTDA 1Z8AA 4GKTA 4MDOA 5AYZA 4ZQRA 1W3TA 3CH9A 1JCMP 1Z6KA 2WNZA 2PUZA 3H2NA 3H21A 4WCJA 1FCBA 4LUSA 3M0KA 3W3OA 3H2EA 4K68A 4DBEA 1W1YA 4LF1A 3VMNA 3IJIA 4L1WA 2J9XA 2QT3A 2GDVA 1KRBC 4OBTA 3IJ6A 3CUGA 2F8QA 1JCXA 3V16A 3TH6A 1QI2A 1TSIA 4R3UA 2QPUA 1XSKA 3WEZA 2IPJA 4D1IA 2V9DA 3SCVA 4L80A 1UD6A 4JN8A 4J3SA 4IWWA 4TOQA 3IAPA 3W85A 2Y88A 3DZ1A 2YZRA 4DWSD 1SMDA 4L9YA 4WJEA 2Q3OA 1X6NA 1GOIA 2UBPC 4LRSA 1SGJA 2WK2A 2PP0A 2G0WA 2G37A 3H2AA 4A2SA 2IMRA 1F5ZA 4J40A 2V81A 4JBRA 3GHUA 3INPA 2CXGA 4FXSA 3H2CA 3E2SA 5BRBA 4CU7A 3FYYA 4PMVA 1EWEA 1HNYA 3NWRA 2VWSA 1H41A 4TX6A 3URAA 4KWVA 3FOKA 4OV4A 4H9VA 4JKLA 2W0UA 1IGWA 2ANUA 3WKZA 1J01A 1OCQA 1MO0A 1HKKA 1PDZA 4HOXA 1EA9C 3E74A 3N12A 3GX9A 2VVNA 4N0RA 4B90A 5A6JA 3B0UX 4U3AA 3FK4A 5BRPA 2SFPA 4J27A 1OC5A 3TMLA 4BF7A 4F0LA 3BW4A 3CH0A 4P7QA 5I24A 2QCMA 2GSJA 3OBAA 4R7WA 3K1GA 2WHJA 3GU2A 3MCNA 4P8XA 1NH6A 5C7VA 4LUTB 3OBEA 3KOYA 3GO2A 4DIAA 2A2IA 1G4TA 2QR6A 3ZYZA 1PE1A 3BCJA 5HWJA 1Q7QA 1JGIA 4ICNA 2NX3A 4WKAA 1QVBA 1VFFA 3GBEA 5JBDA 4I9TA 4FI4A 4JHMA 3CL7A 2P76A 1B3YA 2A1YA 4UMCA 1TR1A 4JTRA 4YPJA 4WSJA 3EAUA 3WD1A 4HU8A 3SECA 3I7RA 3SRHA 4OU1A 1JF5A 3KS5A 2BY2A 2VFDA 3KP0A 1Q4WA 1YNYA 4IXXA 2BOEX 4GJIA 2DUZA 4E4PA 1U33A 1RK5A 2GJRA 3A5VA 4MZYA 3R8HA 3WD3A 4LUJA 1UH4A 4RE3A 5I7GA 3W82A 3ARYA 5FSDC 3KWXA 3NSXA 2VEPA 1M1BA 4MAZA 4A8RA 3GAKA 3P7YA 5GNXA 2DZAA 1RCXB 1JDCA 4LBRA 1HJWA 1N82A 3KOZA 2C79A 1JUBA 3PZVA 1RD6A 3GVWA 1FDYA 1RY0A 2GL5A 1E5JA 2D73A 3L4ZA 1YADA 3AYVA 4A2RA 1TA3B 3LCGA 4E8GA 3ZJ7A 2E28A 4XZLX 2WMGA 1VAHA 4MKVA 3GHRA 4GI9A 2OZ8A 2Y8VA 3HPAA 3LD5A 2ZADA 6ENLA 4J3VA 3ZJ8A 3TVAA 2XHYA 3BW3A 3MPGA 1SFSA 1T0OA 1W5NA 4QJ3B 3WNNA 5A94A 1T96A 3MHGA 2YFOA 1PTGA 5BWAA 3FYOA 4N9CA 4D6JA 5AN7A 3A5FA 1QHOA 1XDLA 2O9OA 3RFAA 4JHOA 1OFQA 4B3KA 2GGJA 3AALA 4L7ZA 4KIRA 2PCEA 3N3MA 3GH5A 1UOZA 3JU2A 2DW6A 1Y5XA 1E6QM 4LOCA 4LUTA 3B0YA 4HTYA 4C1LA 1A5NC 2PWGA 4W9TA 3WF4A 2ZRZA 3THUA 4NJKA 2YB1A 4WXZA 4Q8TA 1PZ1A 3RCNA 3BOFA 4GGBA 4NIRA 4DYKA 2QVHA 4JDYA 3TN6A 4J3XA 3WUGA 3RX4A 3BZGA 3L2MA 1MRQA 4HZ8A 1LQAA 3EKGA 2XZ9A 3MQTA 2EGZA 2WMKA 2WBGA 4O1FA 4HA1A 1NWRA 4DZ5A 4QP0A 1KBBA 5BXPA 2YSWA 2BVTA 4AXKA 2OO0A 3II1A 4O4WA 1JG9A 1RVKA 3LN3A 4I6VA 3WH9A 4GLEA 3M7WA 4PMDA 4FF5A 2X16A 2NLIA 3FEMA 4GJJA 1RAKA 1UWRA 3BGGA 4QTGA 3AO0A 4I9MA 3E0VA 3QQ0A 3S1GA 1ISWA 1FFRA 1NVMA 3LGEA 1M04A 3DENA 1G4EA 1TTQA 3LOTA 3QR1A 2ZBTA 1GKRA 5FJUA 2NV2A 1SZRA 3TFXA 1KD0A 4QRNA 4CCEA 1DPMA 1VEOA 2DZTA 2E6YA 4EXQA 4V15A 1Y8BA 4ZQOA 4IIBA 1TA3A 3UBPC 3T09A 2VGGA 2YW4A 3OQEA 3E02A 3E12A 4AF0B 1EXPA 1S2WA 3N4EA 1M03A 5GJNA 3POCA 4MB1A 4KEMA 1J2WA 1XC4A 3RK8A 2J6VA 3ERPA 3LV6A 7XIMA 2W66A 3TQVA 4BQ3A 1ZSXA 1VC4A 5HNNA 2Q02A 1SU5A 4D6GA 1CXIA 1GYLA 3P81A 5U7SA 4CQCA 1TPWA 3CWNA 2ODOA 4TX8A 3KRUA 3P8IA 5BOOA 4CLMA 3FNDA 4LEQA 2WVUA 4RLIA 3I6EA 3MWAA 3LTYA 3MYPA 5HBFA 1W5MA 1TMHA 3TE9A 3KZSA 3R10A 3W1PA 2O9PA 1RH9A 2VRJA 4FX8A 3HPFA 4NJJA 3HG2A 2QV4A 3GNOA 1ALDA 1UUQA 2ZUWA 4XTDA 5CPTA 2VUYA 2ZX5A 1DQXA 4YU1A 5MKGB 4DF0A 2VCBA 1K70A 4LWWA 3V18A 2VL4A 2JK2A 3TW9A 4IIEA 1HGWA 1UBPC 1SW0A 3L5AA 4RW5A 5FEZA 1TB3A 3VIOA 1NSJA 3M0IA 1EH9A 5FAJA 1MVYA 3ARQA 5H8PA 4YJ5A 5K4ZA 1ECQA 5CSYA 1A5MC 1EB3A 1ITXA 1W31A 2NVAA 3WZ0E 1TUXA 4FS9A 2BB0A 4ZENA 1XLBA 3NOYA 3UZJA 2E6DA 4JIRA 1Z44A 4MB4A 1V6WA 1OEPA 4GQQA 3F7JA 3CASA 1SSDA 3FA3A 3RCMA 2Q8XA 3QZEA 4DHGA 1ZBVA 4PB3A 2J8GA 3HJZA 3SJ3A 1POJA 4GCAA 2PDMA 4I5UA 1OFDA 4IQLA 2F6XA 1R2RA 1UKSA 5BW6A 4JTSA 5CJ5A 2XDFA 3VNYA 2R6OA 4AF0A 1KWGA 2TMDA 4M8UA 4AB4A 3S5NA 3ALFA 1V7YA 2QCEA 2PI6A 2ISDA 2V2DA 3TR2A 1W5QA 1ZBCA 3OA5A 3W0KA 2J4GA 4GPNA 2XN1A 5GVJA 2OYKA 5T91A 2QF7A 3BCFA 3JVAA 1GWJA 3MCMA 1KV5A 2XIOA 5FJJA 2I1OA 3RG6A 5I23A 1K9FA 3FX4A 4AU0A 5LKYA 1MZRA 4E8CA 1IZKA 4JTTA 4DN1A 1UD2A 4P2VA 4R34A 4GQBA 4NYUA 3G0UA 1UZHA 2ZUVA 4Q7BA 4HK6A 3GZ3A 3TTOA 3I65A 1BPLB 1XIGA 4S3BA 2E8ZA 1TV3A 3R12A 1BF6A 3K13A 2BHYA 1PIGA 2PLJA 3USBA 4R9XA 1KW1A 5LNUA 1E51A 4O4VA 5MKGA 1EO7A 4NZJA 4W86A 3GG0A 3KDNA 4Y7EA 1GVIA 1Q7MA 2FFIA 3UT0A 2XJ7A 3S5ZA 2P0IA 1UPMB 2E0PA 4Q4QA 3EEZA 5DX7A 3CO4A 2ALDA 2HWGA 2PDCA 3MHUA 2FPYA 2EF9A 4B4HA 3H4XA 1VBJA 3D3FA 2FFCA 1XXXA 2PDKA 3MSDA 1QNSA 3MV01 4K7VA 3DERA 3E5BA 5C2CA 4CQBA 4A8LA 1UOKA 4FR1A 2ZRVA 2VVSA 3OG2A 4BKNA 1TX0A 1E4NA 1SJCA 1U1UA 4Q7NA 3O3RA 3JUGA 3QY7A 2J7DA 3WEMA 1J6OA 2VX7A 2GLKA 3BICA 5LA0A 4HIBA 4XG1A 5IRPA 4A3UA 5E6ZA 3CQIA 4X63A 3CUHA 1OFAA 3VABA 3ARVA 3V0SA 4Q3MA 2OB3A 2GVLA 4F8XA 1VFMA 3MCOA 4BJHA 3GTXA 4DQWA 3NQBA 3NZPA 4CD8A 3W25A 4UIOA 1DWHM 2VI0A 3BJSA 2XIBA 4UTWA 1V08A 4IMAA 1V3LA 3HOJA 4S38A 3UPMA 4DO5A 5A6KA 4JFTA 1RA0A 4Y6GA 3HURA 2GK1A 1TJPA 4CU6A 5I3KA 2EAWA 4ZOAA 4HB7A 1JPHA 4Q4OA 4TMBA 3N11A 2ATMA 1E15A 2ACSA 4YWSA 4UTTA 3MUAA 1I1WA 3WNKA 3V5FA 4NASA 4IIFA 5XIAA 1F8MA 1EA0A 2NUWA 4AD3A 2DQXA 2VQUA 4O0QA 2KX9A 1FWJC 1C3FA 2Q01A 4DUOA 4NJHA 3A3WA 3I6TA 3AIUA 3E6EA 2OEJA 4LAUA 1VBRA 1HVQA 2GJNA 3WNPA 4MSSA 3DFPA 1FXPA 2GWGA 4C6LA 2BGNE 3QFEA 5BNKA 4PMXA 2VR5A 1THFD 2DT1A 3MS8A 1D8WA 1B90A 3M9YA 2KAUC 2FZMA 2V63A 4HU4A 3LZ5A 3PJTA 1DWIM 1AUSL 4GI8A 1JZ4A 3ES8A 1F2JA 4WY0B 4D9PA 2JALA 3ELFA 4FXJA 2PC8A 4AZBA 3DGRA 4LVBA 4OV9A 3GQYA 1MQRA 2O55A 1V8EA 1B54A 2NSXA 2R9RA 3W26A 2DVUA 1UZDA 2OXNA 4Q22A 2HPMA 2FHCA 5CC6A 1ZALA 4Y90A 3WD2A 4PYSA 3G3DA 1NM9A 4C65A 2YKKA 4W84A 1UMYA 2ZDSA 1AVAA 5FA5A 3KVLA 4L4PA 2CBIA 1CENA 2V5CA 5EB8A 3ZS4A 3H7RA 1QW7A 1JI1A 4C6MA 3VKKA 4MWAC 2MUCA 3PBYA 4Y2WA 2VFEA 4XSMA 3B03A 4X60A 2EEXA 1JYNA 4YVXA 4H8UA 2VC7A 1W2PA 1FP8A 3N15A 5E0KA 1A50A 2FYMA 3EOEA 4PTWA 2VWTA 4XZ9A 2GGIA 3CZGA 3LDVA 3LERA 4RE0A 4DPPA 4GY7A 2YA1A 2VOMA 3UXLA 2YBUA 3VOIA 4KF1A 4AQLA 2QAFA 3FJ4A 3STFA 4QS5A 1CXLA 4LCRA 4PSRA 2YL5A 3AHYA 5CGQA 3TMQA 2C8NA 1QAPA 2HPIA 1OINA 3JZUA 3ARTA 1NP2A 2UWFA 2D22A 1S46A 3EX1A 2DW7A 1W32A 3OIHA 3LZ3A 2XVKA 2Z6IA 2QDHA 4GVGA 5AC8A 3WH7A 2VKZG 1D3HA 5CCZA 1O66A 2WJEA 2V2CA 1AL8A 1O6IA 3MTWA 2C71A 5FF2A 3U9IA 3U3HA 4XD4A 4P7OA 3WD0A 2BDQA 4J4KA 2DT3A 4RUBA 1MDLA 1YXCA 3GXPA 3CT2A 4BWLC 3CHCA 2VNCA 1OYBA 1UH3A 5HMEA 4F9JA 1U2YA 3G24A 4A3QA 2Q8LA 1CX9A 1F6PA 1QMLA 3KUMA 3G0XA 4YTRA 1W9DM 1PSCA 4A4AA 1K7EA 1E6NA 4WY0A 5A6BA 2DZWA 1XIJA 2C91A 3F4CA 2G96A 3ZO9A 3DHFA 1F05A 3RPDA 4AVNA 5M5DA 2J7HA 4UZUA 3RM9A 1MUMA 3L4WA 4RV3A 1XYAA 1PJ9A 1P5BA 4B5NA 3VOHA 1LORA 4C6JA 4ZOEA 4S2BA 2AMXA 5GJMA 3TXZA 4B5VA 3AXMA 1REQB 3S2CA 1OADA 5T9BG 5FF0A 1OCJA 1XH1A 3H8AA 2BVDA 3F5JA 1J0JA 3FJ6A 1NDYA 2P3ZA 3AZTA 1KCXA 4JPGA 3PPFA 4PB4A 2YL8A 3TTEA 3VAVA 4QEHA 1XGEA 5CBBA 1FHLA 1SFTA 1W5OA 4C6QA 2DV0A 3LPOA 2NW0A 3IJ9A 3I3EA 4YTUA 5E0FA 3QZ6A 4EK7A 4L6DA 3QZAA 2H8ZA 1C7TA 1W6TA 4NUWA 5FL0A 4O54A 1TE6A 4DF2A 3P93A 1LOSA 3A6OA 5G1MA 3MY9A 2DZUA 3SJNA 1QPNA 2FGBA 2I5IA 3L2IA 5JXQA 3JRKA 3GG1A 2DJLA 1S39A 5CLWA 5LHFA 1UBSA 3ZQ9A 2OYLA 5I77A 1QPKA 1P6CA 2W3ZA 1OJXA 3QR0A 5GNZA 3VUSA 3OOQA 1OFPA 1L6WA 1RXOB 1K9DA 2PDJA 2V5JA 3B9NA 2OOGA 1XLJA 2G95A 3W1TA 1VBUA 4LY4A 1EJWC 3OU8A 4FSAA 3AQUA 3B05A 2ISFA 4O13A 1HKIA 4O12A 4JTAA 1EF2A 1TREA 1VCGA 2Q3RA 2CPUA 2OTDA 3EX6A 1TVNA 1PX4A 3S5SA 4KKXA 2GDUA 4IJCA 2BLEA 1JFHA 3EKZA 1HP4A 2QPXA 1EJTC 2OZ0A 1EGZA 4KEVA 4B5SA 2HXTA 1EO5A 5LNVA 4GVFA 3ONCA 3GXDA 2DZXA 4Y8EA 5JVLA 2QJHA 1XLAA 3ITTA 3D3AA 4D8ZA 1Q5MA 4H19A 2PURA 2Z7GA 3TA9A 4C6FA 3FEQA 5C55A 5EYWA 3T55A 4GQ0A 3BCDA 3UESA 3B8SA 4B4FA 4ILSA 1ZY9A 3E49A 1REQA 2WQDA 2C7FA 1GYNA 1NEYA 5LHEA 4UC5A 1BQCA 1E6ZA 4D6DA 3CS2A 3W88A 4GNVA 1MW0A 1R86A 3VZYA 2W79A 1Z32X 4IPNB 1TPDA 4GYFA 4M82A 4DF1A 1TPC1 2WCGA 1GOWA 1IEQA 2BY3A 4FNTA 4C1KA 1WDSA 4IP5A 4JIQA 1KFEA 3W87A 3Q37A 5CPOA 4DO4A 2INEA 1PIIA 2V3FA 3GVGA 2DUXA 3TLLA 4AD2A 1RV8A 1SO6A 1Q6DA 4MZ1A 1VFTA 4MYXA 3RGTA 3WO8A 3T81A 5FJTA 4ZFMA 4M6UA 3PN8A 2BV9A 2EG8A 2V3EA 4PSPA 1BG4A 1JRCA 5JU6A 1CLVA 1NY1A 5TBOA 5BWFA 2Q71A 4QDWA 4UB9A 2W61A 3Q58A 1HJQA 3W7MA 4KWWA 4B9ZA 6XIAA 4UR9A 1E6XM 3SCUA 4NT0A 1SMAA 4Q8PA 3QV6A 1L8PA 4MPKA 1HF6A 2ZUUA 5BCAA 2D1ZA 5DCBA 1JPKA 4ASTA 4O14A 2PU1A 1BWLA 4I5XA 4NY2A 2Z0IA 1K3UA 1FOBA 3CEPA 3FVMA 4KGLA 1P1MA 3MBDA 4ML9A 1MI3A 4CEUC 2WVVA 4UOZA 1GVEA 5G4EA 3FHAA 5LIWX 1Q6RA 2OSXA 3W37A 1R8LA 2DEPA 2E4TA 2X2YA 2CERA 3SCNA 5KZEA 4L4MA 3W7CA 2G97A 1EUAA 3TX9A 3OGSA 1M7PA 4BK9A 5A3HA 1SJDA 4OJYA 6TIMA 4DO6A 1GW9A 4DY1A 4YHEA 1MEIA 4MY9A 4CN1A 4UNKA 2E6FA 1JQVA 3H4WA 1LL4A 5C8BB 1UP3A 4HGXA 3O06A 3IARA 4XBKA 5D30A 4FLQA 3GC4A 2QZRA 3W74A 2X2GA 3USZA 2CZ5A 1AZ1A 4G2DA 1R3QA 2PF0A 4M81A 2ZX9A 3OVRA 3M4HA 5F2GA 3QY8A 3F2BA 3DKLA 1QNVA 1CXHA 3JS3A 3E9AA 3OLEA 1UWQA 4W8AA 4GNJA 1EOKA 3RAOA 1HKMA 4HKPA 3HPZA 3N04A 2ZWZA 4EXBA 3GDRA 1DTUA 1TVLA 3SW6A 1WXJA 3ARSA 2Z00A 2D3LA 4NNBA 2QULA 3MP4A 3UA4A 4PUUA 2A0NA 1DIOA 1J2BA 3TSDA 4MLJA 5J5RA 2ZYFA 3T4CA 4AD1A 3Q2DA 1ZCOA 4OQVA 5HWMA 4YL2A 4ZXOA 4KFNA 5EMYA 3KE0A 1V6UA 4WGXA 5JMUA 4H2CA 3R7MA 3DFHA 3AWNA 4HYVA 2FB3A 3E2RA 3WBAA 3NQ7A 4LCQA 1VD6A 4F0RA 1HG3A 5T8GA 4DXKA 2ZX8A 1UASA 1YNQA 2XN0A 4C7GA 1B0IA 1KFJA 3IIZA 1XYCA 1BGAA 1ISYA 1J0YA 2H6RA 3FDGA 3KS6A 4RXGA 4AHQA 4AIEA 5CZKA 1EC9A 4NI3A 3KBMA 3IRSA 3RHGA 1ADSA 3L4TA 4ZE4A 3EPMA 3P8JA 4RW3A 2E67A 4AWEA 3B04A 4F0MA 1XG3A 3EXTA 2XZ7A 4I7WA 3TJLA 3DG3A 4DWSC 3MKVA 2NQ5A 5A2BA 3D6NA 1UPPA 4L6OA 3LQGA 3C0JA 4KEUA 4LVDA 2XPKA 3L4UA 3LYEA 1I2PA 3G1VA 1LWIA 4NX5A 3W6LA 1OM0A 2JKPA 3U4AA 4BF9A 4PH6A 4QM1A 4MNMA 3VX1A 2DIJA 3MZNA 2CLKA 2YA0A 5XINA 2YL6A 3S6DA 5DANA 4NRSA 5A6BD 1UWIA 2BMBA 2G3JA 5ENLA 4GZ7A 1RBLA 4PTMA 3F1QA 2XSBA 4A21A 2VDIA 2VX4A 4XIAA 5DO8A 2CC0A 1JULA 1O4UA 1PBGA 2G3MA 3VGGA 3U2CA 1EDTA 1DJYA 3GH7A 2GYIA 4W85A 1RCQA 3C3UA 1QI5A 1JRBA 5K9CA 3MVIA 6CGTA 2O4QA 1LL6A 3FCPA 4J9JA 4E2VA 3P80A 5H6HA 3H24A 2V3GA 4UFKA 1YDNA 3Q65A 3AHZA 3IIOA 3G1XA 5EMKA 3V1PA 3B8IA 3HMCA 2BXZA 2ZXQA 3PFMA 4XSLA 3VOJA 5JH2A 3FIGA 1AH0A 4X9SA 3SFWA 1PYMA 5K7JA 2XTKA 3RXZA 5MHBA 1DJNA 4A3YA 3IUDA 1LWHA 1H62A 2Z4GA 2XH7A 5A8MA 1OVDA 3WMBA 3PJXA 1VRDA 2YL9A 2NXIA 2Q09A 4WVXA 3CL6A 3VGDA 2EPMX 1FX6A 4YLWA 4J3ZA 4C6NA 4E6MA 4AW7A 3H55A 3S5YA 2FMOA 3NQ2A 3C8FA 2HXUA 3EA3A 1SFJA 2AAMA 1KBKA 2AKZA 2AAAA 4N02A 1XJBA 3TU9A 1M41A 1JZ2A 3SUUA 3HJEA 1W1B1 3IVSA 3VU2A 4LB4A 1LF1A 1KFKA 5DY3A 5DBTA 1KO0A 5E09A 1ZS2A 1EEXA 4EWJA 3FVDA 3KBWA 4UFIA 2A5HA 3QPZA 4OBRA 4DJEA 4NJIA 3SQLA 5D37A 3RPMA 4LF2A 1O5KA 3FFSA 4HNNA 3N2OA 1GPWA 1PO9A 2J6XA 4UUIA 3GNPA 1XBXA 3NDZA 5IXEA 4QDPA 1QNRA 1KM4A 4ZQCA 1SUXA 1AH3A 4M1RA 2OGYA 3MYOA 2FLIA 4N6EA 3WQVA 3WFAA 9RUBA 5JIWA 3PZTA 5CPQA 1OYCA 5I79A 1I8JA 4X22A 1CZ1A 1XDJA 2AMGA 2WSRA 2VEKA 1FP9A 1SW7A 4X61A 4Q6XA 3MSGA 1S1RA 2YJQA 1QT1A 1UG6A 5AB3A 1TV2A 3H53A 1GQLA 4XISA 1SPQA 1G69A 2PGWA 3MJMA 2WZEA 3AZSA 5F1UA 3SUWA 2GGGA 1X1NA 4GO9A 5CJMA 4M1BA 4U33A 3QTGA 5HJLA 9XIMA 3G5EA 4HN4A 3RN6A 5A2AA 4E4UA 5EGRA 3VDGA 2J7CA 1EIXA 2VC5A 4GYKA 4DZHA 4FA3A 1UA3A 1LBMA 4JQ3A 1JFXA 1J8VA 4QQUA 1VFLA 4EE9A 1GONA 1KV8A 4LYKA 2QV5A 3T1GA 4H9TA 3A4AA 4HNVA 1PTAA 3WLIA 1V6XA 3GK0A 3MI3A 4DBUA 2PLMA 1NOWA 3WG6A 3DFSA 1JEZA 4R27A 1UCWA 4GKLA 2X1IA 2WLZA 1BRLB 4IP4A 5D38A 2AL1A 1Z42A 1KGXA 3ITVA 1F6KA 3EEGA 4GUHA 3CWOX 4P8UA 1CIUA 3OZMA 4TVCA 3CV2A 1CCWB 5JUVA 3LLXA 3QW4B 1M01A 2B81A 3B8TA 1T40A 1YXYA 5H2ZA 1GGOA 2PPGA 1TJ2A 1YRRA 5H8MA 3S2NA 4IGSA 1WDWA 2NXHA 1UMLA 4US5A 3VK5A 3PZGA 3L67A 2ZA2A 1GEQA 1Z41A 3TJ4A 5DMLA 1RJRA 4JAWA 4KRTA 4YTQA 3E1F1 4W7UA 4F0KA 4AVOA 5K4XA 4HNTA 3L7RA 1UROA 2WHKA 4BQ4A 2OX4A 2C16A 2BBFA 2HROA 4C5YA 1QO5A 3QPEA 4JX4A 2J66A 1G9HA 1FHUA 3PNUA 3R79A 4B3ZA 4GINA 2FJUB 1X6UA 3EMQA 4RZ4A 5FF4A 2Z1KA 1CGUA 1ESWA 4MDPA 4ADUA 2PP3A 3ARPA 2QCFA 4XVEA 3PTMA 1TJRA 4GY1A 4MTVA 1TMLA 1XLCA 1EQPA 4GUJA 4OBSA 2IPGA 1J11A 4CNSA 2QGYA 3VXGA 4H9XA 1J0IA 1GOQA 4JD4A 3W73A 1PEZA 4MJZA 2I7GA 3PJUA 1XIIA 2D2JA 1Q63A 1XLFA 4ZB0A 1TIMA 4OUIA 3V3WA 1X39A 4MUZA 2WV8A 4ROPA 4CN6A 3IV8A 2R94A 3ITGA 2QNEA 3DEQA 2P0OA 4N9EA 1VENA 5ABEA 3UVIA 2X1TA 2J75A 5C70A 3W29A 1KTCA 2RGLA 2GWNA 4W4QA 2CBVA 5JBEA 4A8NA 1MXGA 4CN4A 4MNLA 2AQWA 4GIRA 3U57A 4ZQMA 1H7XA 2Z1VA 2ZWYA 1J79A 4RDWA 3NZRA 4Y9AA 1CXEA 5DLCA 4H4IA 1J6PA 1BRLA 2CHRA 2OQYA 4QG6A 1X8FA 1HL2A 2I5QA 4H7VA 3FV9A 3QMTA 4PTXA 3ISIX 4DZIA 3VNZA 3PG9A 3A23A 1NU5A 1VGAA 2HQAA 2J88A 3RDKA 3EWXA 3IWPA 3P0XA 1IWBA 1DIEA 2P8CA 3V1HA 4QIUA 3SY8A 7TAAA 3HV9A 2O7SA 4IIGA 3KVMA 3KL0A 1D7KA 3EB3A 4XAFA 4IMDA 1B9ZA 1GOKA 4YVVA 4AVFA 3WJXA 2VDGA 4MLRA 4MMWA 3WMSA 1P7TB 2ACQA 4IHCA 3QSTA 4U5KA 3PSWA 4L1XA 1A4MA 2C6QA 5E9AA 4IG2B 4V2XA 1NFBA 4EPEC 2J7BA 3WQ5A 1FWAC 3THCA 1WDQA 3AC0A 3ICJA 3GC5A 2P3EA 2X8RA 3K30A 4J3TA 1W1VA 4RZ5A 5KETA 1A5KC 3BLDA 3S2JA 2DH2A 2FTWA 1Q6FA 1GHSA 1LYXA 2JKAA 1N2VA 4C7FA 1J0HA 5AOUA 3V36A 2RDWA 1R5YA 4UTUA 3BLPX 3GFYA 3KRBA 4R5EA 4XAGA 1ZCCA 2B4GA 2ON3A 3KTXA 1P0BA 2OU4A 3UPWA 4UWMA 3IJ7A 3R8GA 3SGZA 5TD4A 3A9BA 1V0KA 3S3GA 2EHHA 3C61A 4I6KA 2TODA 3FYPA 3G0SA 3PP7A 1GQNA 1XYZA 1TPB1 4Y9MA 2PBGA 1J93A 4PE8A 4DZAA 2XU2A 4AZ6A 1W2VA 2CLPA 1E0UA 4G56A 2E9LA 4A22A 1IEXA 1EGMA 5TAOA 4QNEA 4JKMA 1I6NA 4R7OA 3U7VA 1J9YA 1BHGA 3SY5A 5FEPA 1LZOA 4K1GA 3W83A 3VE7A 3B4YA 1CWYA 1TFVA 2XYLA 5LNRA 1XLLA 3TSMA 5HNRA 3LCLA 5D8ZA 1EEPA 4M6QA 3CT7A 3WNLA 3C0QA 1W1IE 3N18A 5HR7A 2PTXA 3DHDA 3PZNA 2ZDRA 3PUEA 1M9HA 1K02A 2Y2WA 1B4KA 3K8KA 1W5PA 1O68A 4DJDD 4XKMA 2OSYA 3GXMA 3CMGA 3MI2A 4OT7A 1NIUA 2DSKA 1UHVA 1X6LA 3RU6A 5J5DA 1MUCA 3ZIZA 3W7IA 2PCQA 3MMWA 1P7TA 1A47A 3B0XA 3NFUA 4N42A 1P1XA 4QLLA 4IG2A 2WM0A 2YR1A 5DCDA 1DORA 3DIPA 3OYXA 2WZMA 3VPLA 2O0TA 3TQKA 4JTJA 1KBLA 1LLOA 4QCFA 5GPRA 4JYDA 4CNPA 4PTVA 1ICPA 3W1XA 3L0KA 1BTCA 1X98A 5KITA 3IJQA 3TJXA 1OK6A 1FWFC 3ORWA 3WLHA 4AIOA 3TEVA 2NVCA 4PRTA 1VH7A 1MUWA 3PZIA 4QJ5B 2RFGA 1Z3NA 4K36A 4MKNA 5HXMA 1WDDA 3NG3A 4PUDA 3LRMA 2QCHA 4LT9A 1KGUA 1XUUA 2VM8A 4O1DA 3SAZA 3W72A 4DJED 1E9YB 3DN5A 1KFBA 3RO8A 3TYDA 1UR3M 3VFLA 5D05A 3PBVA 3G1YA 5FCZA 4FNSA 3EDJA 3FXYA 3CZLA 5I03A 2NV1A 4DYJA 4LYPA 4N4QA 2DVTA 4HA3A 4GBUA 2QCGA 1C93A 4H2HA 2OLAA 4FALA 3IEBA 1A5LC 3DU0A 4GUIA 1AMKA 2J24A 1NQKA 1TPFA 1TCDA 2YXGA 3ZMRA 1W17A 1EBGA 2G3IA 5HUPA 4FLRA 3HF3A 3Q45A 2O9TA 3CJPA 4GMEA 3HQOA 1OHLA 2D2OA 5I3IA 1FWSA 1QXLA 2VFGA 4X3ZA 1ISZA 1S1PA 5A69A 4JTUA 4HTBA 3W2LA 2DT2A 2HS8A 4PUNA 5I3DA 2CU0A 1XR2A 3LBMA 4GVHA 2OFJA 3SY1A 3LEPA 3V0UA 5CC7A 1UWUA 4FXRA 2V5DA 3WL0A 3L2LA 3TP4A 1RALA 3L4XA 4WF7A 3B06A 3LSCA 3QM3A 2J62A 3NPXA 1MQPA 4ES4A 2FMNA 3T8LA 1A0CA 1I45A 4JX5A 2EPLX 2XWDA 5HMSA 3CQHA 4QFUA 1IT8A 4DI9A 2F7FA 3LXCA 1R47A 4P5UA 4R53A 2I56A 4XUGA 1W9XA 4QAWA 3RCYA 3VDAA 4HPXA 3MV11 1O12A 2YCIX 5D2WA 2O56A 1VEMA 4UQ9A 1PKMA 4S3CA 4DJFA 1OGSA 4MFEA 1CPUA 7ENLA 1D8CA 2FZ8A 2VTFA 3UWYA 5I06A 5AC6A 3CL8A 1EP3A 4AEOA 2YX0A 4L65A 1IQ8A 4MADA 5GNYA 5IBXC 1UWSA 3PC0A 2NVDA 2Y63A 4PR4A 4S3DA 4GUGA 5CZ0A 2TYSA 4US5D 4XZHA 4AIUA 4Q32A 1HKVA 3TK7A 2YCEA 3BLFA 1PHWA 3CQJA 2Y70A 4UMBA 3TV8A 1VFOA 3SQSA 5ABGA 2Z24A 1XICA 4MY1A 1U1JA 3CIWA 1QI4A 2PDNA 4YTTA 2KZHA 1TIWA 5CLTA 5U4NA 3MBFA 2OSWA 3LXAA 2A4AA 3WK0A 2YDRA 2EXOA 5EBAA 1DXEA 1UR0A 3N9SA 5KZ6A 4JXCA 2XIIA 4DBWA 3GW0A 5LZLA 4IL2A 3H2OA 2YFNA 4JTCA 3SUSA 1JCNA 2WPBA 3F03K 4FLSA 3M43A 2AKMA 4QR6A 2Y7FA 3T7VA 4RZBA 1L9WA 1GJWA 1EJRC 1D2KA 1ONEA 1GG1A 4HCHA 2CIPA 3DGBA 3W75A 3SSJA 3FKRA 4EPKA 3DYPA 4B92A 4CEXC 3AXIA 5AC5A 4I8YA 4UCFA 5CEWA 3UWQA 1XIFA 4WR3A 3FAWA 1EPXA 2QCLA 4LNYA 3O9NA 1QUMA 1OFBA 4D71A 3L68A 3QRHA 4O1CA 3IUHA 4GOAA 2PWUA 2QCDB 4O17A 3VIMA 1BG9A 2FZ9A 3HTWA 1ZAHA 3MMUA 3DUGA 4HHPA 2WBKA 4MB3A 1E6SM 4ORIA 4J2MA 4JL2A 4NQ1A 3AROA 1KM3A 4M7SA 1AZ2A 3UJSA 3V0TA 4PCNA 1J12A 3DI0A 3P84A 4UQEA 5LNWA 1OG6A 4O28A 2WCAA 3AIEA 1ICSA 1M5WA 4DNHA 1GCYA 4LVAA 4GXPA 4H1ZA 3DC8A 3L12A 4IFOA 1XKJA 3QMRA 4GZEA 4HU0A 4UR7A 4DUVA 4KCWA 5BYWA 4ZBCA 3VC5A 4JN7A 4B9YA 3UR8A 1V3KA 1ITQA 1AK5A 4K38A 1GW1A 1H7OA 4QHRA 4R88A 2OQLA 2IPWA 3IK2A 4IMCA 3EXRA 3GAYA 3WDPP 1RR2A 1S2CA 3TWBA 1ZJHA 3WF1A 2WQPA 1ZGDA 4FNRA 3LHWA 1A0DA 2XINA 4HNCA 3A21A 2P10A 3CWHA 3ME3A 4JCMA 1RP9A 1H3GA 1CNVA 1FA2A 3OLDA 4JR5A 1R30A 1EJUC 2JF7A 4LRTA 4AZCB 4WDTA 1YQ2A 1EJ7L 2WM1A 3G8RA 5ECVA 3WLLA 1YTKA 1XX1A 2BY1A 1T5AA 3AS2A 4UOJA 4O1BA 3ECQA 1V3IA 1W9UA 4IUGA 4RZ6A 1WPCA 4JTQA 2VENA 3E96A 5AZ1A 4Q8MA 2FHBA 1U5JA 5AC7A 1VYPX 4DX3A 1QHZA 2PP1A 1UYQA 2YW3A 4WKFA 2R1MA 1I60A 4G5DA 1N7KA 1RK6A 1V51A 5EFFA 1R46A 1FWRA 2HISA 1XP3A 5DRCA 3W01A 3H2MA 3QQ1A 1LBFA 2A7RA 3TSBA 1UWTA 5BU6A 3OGVA 3T0DA 3W07A 1XBYA 4D8LA 1MYRA 4W5UA 2QCDA 3EDEA 1OT2A 4GQGA 3BOLA 1MQQA 2X0YA 3ARZA 2E5BA 3K1DA 2BNJA 2QIWA 4XBSA 1I75A 2V5LA 1XIBA 1YTEA 3HO8A 5CC5A 1M3UA 4RNFA 4AC1X 1VFSA 1UQZA 1OD0A 2OEMA 3HU7A 4W7VA 4JFUA 4C6CA 4XTIA 1WKDA 2HS6A 1NWTA 2VEIA 3P61A 3W02A 3QN3A 3VIHA 4AD0A 2NZLA 3W22A 4N7QA 3DC0A 2ZFAA 4TQTA 3K8LA 1VLWA 4UNIA 3DESA 1ZU8A 2QLYA 4LV4A 3UG4A 2D2HA 4JTFA 3GG7A 1G5AA 4LFYA 3GYCA 4X2RA 5FJIA 4DXXA 1NOFA 4PCFA 5KTLA 1JNDA 2VELA 3WLMA 1C29A 4LYRA 1K6WA 1R85A 5TF0A 4WK9A 3M47A 3I3BA 2DDXA 3OVGA 1H7WA 1ZQ5A 3H7VA 1POKA 4KWOA 4MB5A 3LPGA 3F2DA 2X1RA 1BD0A 1WOBA 2EPKX 1NWSA 3N6QA 2X0HA 3FKKA 2PDIA 4FIRA 3SEPA 4RX0A 2C13A 4NI8A 4JHZA 4AWTA 1XQLA 1CGTA 4AZCA 3GKFA 1LRTA 1SO3A 3EOSA 4Z1BA 5A8PA 4UTWC 4LUYA 4RV8A 2WAGA 3CO8A 4L5ZA 1H0IA 4NU7A 4DM1A 2J7EA 4RPPA 2AL2B 2F2HA 5EL1A 1WUFA 1CGYA 4Z2IA 3N4FA 2VEFA 3COTA 3R1ZA 3GXTA 4ZQNA 1HIZA 4Q8OA 2HVOA 4UTKA 3LHVA 4UTTC 4I90A 2WSQA 4ZB5A 4LUIA 2ISSA 2JEPA 1GZGA 1IF2A 2Y89A 2QVNA 4QX4A 3T0AA 4GISA 3BLLA 3VKJA 3GNXA 4IJRA 1JDDA 1OFRA 2YGYA 4LW7A 3UF9A 4M51A 4IM4A 3PZUA 2Z1BA 3WF3A 4Q8NA 3GVQA 3UU0A 3R6IA 4IFKB 4PCSA 5L9FA 1KKRA 1U30A 3L65A 1XFCA 3C2RA 3I7SA 4EX4A 5HQLA 2QUUA 1EDGA 2A79A 4N2YA 3NQCA 5G5IA 3UETA 4J35A 2NQHA 3OIXA 4JYEA 5D04C 3CZJA 3FJLA 4BEQA 4AG0A 4AD4A 4GC4A 1AQFA 3KHJA 3R0DA 4QDMA 4YS1A 3GDMA 4GO8A 3V75A 4K8HA 2XGZA 1FXQA 3DKJA 4L6HA 1RA5A 1P4CA 1OSEA 3MW7A 2BTMA 1KBJA 3GUGA 3AU6A 4IMEA 3HM7A 5AYIA 3VILA 2OG9A 1LP6A 2WVTA 1KXHA 2F61A 4RJEA 2CBUA 2VGBA 2VMFA 1O5XA 2GJPA 1FHDA 2FDMA 1WO2A 1XCXA 2FZNA 3P6LA 1XGDA 1FWDC 2PB1A 4MAVA 3GBDA 3HFTA 4U2ZA 4DJFD 3RYSA 2WW5A 1MEHA 1RHCA 2RUSA 1EJXC 1JIBA 1NP0A 2EO7A 1QK0A 2F6UA 1IHIA 2VEMA 3R58A 2AL2A 2ZRXA 3UZ5A 1XIMA 3PAOA 3PZQA 3G6LA 3IJLA 3F5KA 1AQHA 4CD5A 4M5PA 3IVUA 1YE4A 3UCCA 3UZYA 1K7FA 5D9MA 3WBWA 1CGWA 1MXDA 4C6IA 1WXZA 5HPOA 3C2YA 1MFVA 4AZ7A 4HNUA 1WDRA 3A4JA 1X7FA 2PAJA 1V3HA 2UY3A 1K1DA 1ZJAA 1KA9F 3VIKA 1YW1A 1E3ZA 4PEEA 3UEQA 4OTKA 1JD9A 4CCZA 1GVSA 8TIMA 3NOEA 4HT3A 1J0ZA 1IV8A 2HV5A 4TR9A 1JD7A 4HD5A 1A80A 2YDAA 4LEFA 1LT7A 3VD3A 4PULA 1P0KA 2Z1SA 3T2OA 1CI1A 3QC0A 4JTIA 4IFKA 2V68A 3GG8A 3PS7A 5C5YA 1GPFA 4BR1A 1Q85A 2QKFA 3MSRA 3UGRA 4BI5A 1KTBA 5LA2A 3CLMA 4JQ4A 2FIQA 1E72M 1VBHA 2RH9A 2E6AA 3GDTA 1ZP3A 1N8FA 3L4YA 1DEDA 3WK2A 1XGZA 5F7UA 3VZZA 2DFAA 1Y0EA 5B80A 1WAUA 1Z48A 3ARRA 1MFUA 3VDBA 4JQ1A 3TC3A 2CCRA 4JKKA 3MP5A 1TMQA 3RLUA 3WQ6A 4Q8UA 1WX0A 3AJXA 3BO9A 3LENA 4CCCA 1AQMA 1I4NA 4FK9A 4P61A 3N9KA 1ZTVA 5J8LA 3AUOA