3W73A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-129
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-129
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w73A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w73A01
2UV8G 4TMCA 6TIMA 4HPJA 3CM4A 1LOQA 3W2NA 3P5YA 5EA9A 5CSRA 1FWWA 3BG3A 1QR7A 1SO3A 3LHWA 1YADA 3G0XA 1YPFA 1AG1O 1PL9A 1DVJA 4LTSA 2H8XA 4LOCA 1G6CA 2Z6IA 3KVKA 1EEPA 4K37A 3GX9A 1TPWA 2YYUA 3W7LA 3MMTA 1QAPA 2C3ZA 5ABTA 1DQXA 3GK0A 5AHFA 1A50A 2OCZA 5K4XA 3GXNA 3A9IA 3CU2A 4HSNA 1PHWA 3LHVA 4ADTA 1H7WA 3QMSA 4PC8A 3TFXA 1TTJA 3W1RA 4O14A 4NXKA 3NQVA 4ONVA 1MEIA 3TIMA 4UFLA 4JNMA 1G7UA 2WNNA 3YPIA 1DKWA 2CLHA 4I7UA 4KWWA 4NU7A 2E6FA 1JCNA 2X30A 2E1DA 3G3MA 4WZHA 4NJJA 3QM3A 1IGSA 3S5OA 4KFOA 4UTHA 1XI3A 1EX5A 3WK1A 1GYLA 2H3BA 2JBMA 4D2JA 4WY0F 3EX3A 5CKSA 1GJPA 3WJSA 4LC6A 1SO6A 2JGQA 4N6FA 3N19B 4CCEA 4MOZA 3WJWA 3W73A 4O8RA 2ZZ4A 4ML9A 1F5ZA 4OHQA 3NQMA 5AHNA 1DHPA 1SZGA 2VC6A 1KTCA 1S5TA 3W7KA 1TV7A 3P5ZA 5E1QA 3G1FA 3A5VA 3GIYA 1VZWA 3IGUA 2YPIA 1GG0A 1P0KA 3HO8A 4HN4A 4JX5A 2NV2A 2V5BA 3W1NA 1C9DA 3P61A 5IBXC 3G18A 4UTJA 4N02A 3N14A 5BRBA 1KFBA 4JXCA 3W7MA 1AK5A 2V0TA 2WJZA 2WV8A 1U83A 5C2XA 2DORA 4HNTA 4RLIA 4RXFA 3DENA 4FXSA 1DL3A 3M41A 4MFEA 5D04C 3NQ7A 4MUZA 4PTNA 4ADUA 1W54A 3N9SA 4I7WA 5LKYA 3MI3A 1V5XA 3G1VA 4IPIA 2VEMA 1FDZA 3LLDA 1HFBA 2RHGA 3CQ0A 1ME7A 1K02A 4Q33A 2LLEA 1N7KA 3UZJA 2E6AA 4Q32A 1F73A 5IM51 1XKYA 3KRSA 5CPOA 3W7EA 5CPLA 4LVDA 5KZMA 1GVRA 3LBCA 3VKJA 1SU5A 2V2DA 1BKSA 3CIWA 3HBLA 5TBOA 3NAVA 3HOJA 3HIJA 3T4CA 1P1XA 4MFDA 3HG5A 3QW4B 4OGZA 1TRIA 2QJGA 1DOSA 3DU0A 3L67A 1OFAA 1NEYA 4MY1A 1RPXA 1T8XA 2NWRA 4NX5A 1LBLA 1W3IA 4O0KA 1UASA 4JD4A 4JYEA 4GE8A 3C52A 1TPDA 4JDYA 2A6LA 1R2TA 3QJAA 3HGSA 2YDAA 2WQPA 3S1XA 2Y6ZA 5LGXA 2QCGA 2R8WA 3NGJA 5U7SA 4X9SA 2XN1A 3NQFA 1ZAHA 5I3HA 5D30A 1XDLA 3LDVA 4UNKA 1MEHA 4IXHA 3TA6A 1S5WA 3LTPA 4LUIA 3C6CA 2V82A 3PR2A 2GJNA 1OK6A 2EAWA 4XBSA 4CNOA 5I3IA 2YSWA 4BI7A 5HUPA 2ISSA 3P67A 3MP4A 3UWYA 1FCUA 3W85A 4ALDA 2E68A 2BZNA 3QMTA 2X2GA 2ZYFA 2GUUA 2ISWA 4E2DA 4GUHA 3I6RA 3NQEA 3M1ZA 2BTMA 3W1MA 3NG3A 2Q3RA 1ZHAA 4LS1A 1SO5A 3TJLA 5I3FA 1IIHA 3SGZA 2ZBTA 4IQLA 4Z1CA 4HPXA 3V1PA 1EWEA 2VFEA 1KFEA 4UTMA 3SFKA 4NT0A 4Y8FA 1H1ZA 3W2UA 3G1AA 1JQXA 4NVTA 1TTPA 2PE4A 3NQ2A 4Y96A 1YTKA 4I9AA 3UWQA 1XCFA 2YX0A 1LTDA 1H50A 5FESA 1UCWA 4O13A 3W1AA 1TREA 2CFFA 3QPZA 4B5NA 3TJXA 3PY2A 3W22A 5J5DA 3GKAA 5KZEA 3MW7A 3FS2A 2X16A 5AC7A 1WX0A 3PBUA 5D32A 4O4VA 2Q8ZA 2G97A 5AN7A 3EX6A 3B0UX 3HG3A 3H55A 2CLOA 3PULA 4M7SA 3HGRA 3GVGA 1LCOA 4A21A 2Y7DA 4IMEA 2CZFA 1QOQA 1SQ7A 4DPPA 4ZQMA 1FY6A 2C18A 3W2LA 1FCQA 1ZY9A 3G1DA 2NUWA 4UR8A 4AMAA 5CZJA 2B7PA 4IX2A 4Z0SA 2C13A 2BXVA 3F1QA 4M6VA 3HGJA 5HNRA 2RDWA 2NWSA 1L6WA 1A53A 1X1OA 2G5WA 1K8ZA 2CLFA 3LTYA 4PODA 3BVJA 3MP3A 3ELFA 3EWXA 1KFKA 4P2VA 4X22A 4HNVA 4Z1BA 3Q37A 1SW3A 4KKXA 1X6UA 2H8ZA 4UFJA 4LU0A 5L6UA 5K4ZA 1EPXA 5F2LA 2NX1A 1OHLA 1H7OA 1SFJA 1UBSA 2C14A 2FB3A 2NX9A 4M19A 5EMUA 2EHHA 4JYDA 3H53A 4FXRA 1D3HA 2TMDA 4O54A 4AHOA 3NDOA 2FQIA 4AWSA 4LRSA 3PUDA 1SPQA 5C55A 3MHUA 3LRLA 4FNRA 4OE7A 1D9EA 3KRUA 2VELA 2VFHA 1Z42A 3CC1A 3G0UA 3UYCA 1OFRA 1GPWA 4AWUA 4ZL1A 1ADOA 2VENA 2RH9A 3G24A 2RDTA 3QQ0A 1TRDA 2IQTA 4LRTA 1GVFA 3NL6A 4RJEA 2DZSA 1F7BA 4QAIA 4PFMA 4BR1A 3M9YA 4N2YA 2VEPA 3DFSA 3RFAA 1TPH1 1O94A 5BNKA 1H63A 1WYIA 3DAQA 1OX6A 2YR1A 3BW3A 1H7NA 3LRKA 3NM1A 2QR6A 2CZ5A 1VYRA 4LT9A 1TMHA 4N4QA 2OX1A 2A7NA 2VKZG 2PRLA 4GUGA 3W86A 3LHZA 3G8EA 3C0JA 4CQ8A 1KV5A 4O0ZA 1GT8A 4DEFA 5CZSA 1G67A 1YDNA 4NUWA 1LROA 3L21A 1VR6A 4YCPA 2WSYA 3THAA 3W7DA 4RX0A 1OFEA 4LV4A 4FIQA 3O06A 3M5XA 4RXGA 4K8HA 1SR9A 3AO0A 1DV7A 3LX9A 3ZFHA 1M7OA 2G95A 3UY7A 4GWEA 4H4IA 3KOFA 3BG5A 2YZRA 4UUIA 1UB3A 4W9TA 3FKKA 5HR7A 3B4UA 3W72A 4WJEA 4S2BA 1NVMA 1B4KA 3SZ8A 3W84A 3PAJA 2Z2UA 1TJRA 3GLCA 4UMAA 1LBFA 4N9DA 1FX6A 5FF0A 3WJZA 1CI1A 2GQ8A 2ZTKA 1K7EA 4HT3A 5DXXA 3W7PA 1GG1A 1W31A 2V5LA 4LV9A 3MHGA 4FNQA 4JTLA 1KBIA 4N9CA 4BI5A 2QF7A 1CW2A 1W0MA 5TQLA 1C29A 1JCJA 3NR0A 5CPMA 4JTEA 4JICA 4JTKA 4XWUA 3P62A 3MBDA 1WBJA 3TQ0A 3OG3A 3TQKA 5K9CA 2DP3A 1UJPA 4PEKA 3GDRA 2A5HA 4LUJA 2E77A 3W1QA 3W23A 1AMKA 1OFQA 1XBXA 3N34A 1SSGA 3T40A 5EY5A 2ZRZA 1XBZA 3NL5A 1O5KA 5DXYA 3TMQA 3M5YA 4K39A 3NQ8A 5D03A 2CLEA 1L2UA 1BTMA 3UWUA 1ZAIA 4BWLA 4XKYA 1OFOA 3KVMA 3WK0A 2QAFA 3S8HA 3PBWA 2GOUA 2ZRWA 4Y90A 3QSTA 3PM6A 3FFSA 3LCWA 1LZOA 2V2HA 4JGDA 2JKEA 1EP3A 3CLMA 1TJPA 5LZLA 3IIOA 3KRZA 2JK2A 1PS9A 1W3TA 3M5VA 1Q45A 1ME9A 3HG2A 1W3NA 4UMBA 5KMYA 3EX2A 3LLFA 2X1SA 3EWBX 4MZYA 1SW7A 3LXCA 5E0KA 3GDTA 4FB7A 1SZEA 1HL2A 3LERA 3PG9A 1K3UA 3RNDA 1RVGA 3W7NA 1K8YA 1WBHA 3S42A 3W71A 3I65A 1W37A 2F7FA 5CZTA 2RFGA 2H6RA 3CIXA 4DO6A 5L9FA 6ALDA 1OJXA 4DXVA 1RD5A 2ATSA 1AW2A 2A0NA 2ZZ1A 2WKJA 4K8EA 2QCDB 1OYCA 2ZFAA 2W6RA 1QMLA 3NPUA 5J5RA 4XTIA 2ZA3A 5LNWA 3N2MA 1XFBA 4LVAA 3EWYA 3G22A 1GQNA 2VFIA 4XTDA 1KM0A 3NL3A 2Z0IA 3THQA 2E6DA 4X2RA 2HSAA 5D2VA 5DBTA 4DF2A 3S9YA 3W7GA 4IPJA 1JCLA 1ICSA 2QCNA 3I7SA 2YFNA 5C54A 2VEIA 4FNSA 4OV4A 3QPYA 3ATZA 4RKAA 5K3VA 1IXQA 3TSMA 3EXSA 2NZLA 2PCQA 4Z0JA 5LHEA 5FEZA 3MO7A 4E38A 1TTQA 2V81A 5LGZA 4NZFA 4C1KA 2OJPA 5HWJA 1VCGA 4RK8A 3MJYA 1QWGA 4CLMA 1QPRA 2R91A 4K7YA 4CNNA 5H2ZA 3FA5A 3CEUA 2BX7A 3LXBA 5KITA 2D73A 3UQNA 1ICPA 5HULA 1H61A 4AAJA 1E51A 4NZJA 2TPSA 3EEGA 5LSMA 3DFNA 5F1UA 1K03A 4AXKA 2NX3A 1RV8A 3MHFA 1TCDA 4XKYB 3VE7A 2F84A 4LW7A 4OBTA 1MZHA 1NSJA 3DI0A 2Y63A 5FF3A 3W76A 4O1CA 3M0ZA 3VI2A 3E9AA 2OT1A 4MLJA 3SJ3A 1VS1A 3NZ1A 4IMDA 5K9XA 5D2XA 1KV8A 1GEQA 4DQWA 5D09A 1M6JA 4CQAA 1J5TA 2GVGA 4PL1A 3DXIA 1WV2A 3O6DA 3A21A 4KFNA 1I45A 1BWLA 4CCCA 3C3NA 1OG0A 3TU9A 3S6DA 5A5WA 3P74A 3I68A 3WJXA 1H5YA 3B8DA 3GNNA 3QMRA 4NJKA 5D37A 3M43A 1WOAA 1LDCA 3INPA 3C2RA 2Q3OA 2HMCA 1ZENA 1RZMA 1FUYA 5CPNA 3RU6A 1FXQA 3TV8A 1UUMA 4EF8A 1IF2A 2VFGA 1KFLA 3E49A 3G1YA 1K7FA 3C56A 4BFAA 2FB2A 3M6YA 3E12A 5AHEA 4UTKA 3EKLA 1Q6OA 4CNPA 4UTTC 4A22A 3NQ6A 5G2HA 5G2IA 2G96A 1XL9A 3TNOA 4DBEA 3CEPA 1ZCOA 4NNBA 5HUOA 4DO4A 1OYAA 3KAOA 4IX0A 3G1SA 4MIMA 1THFD 1HO4A 2GVLA 2I1OA 3T55A 4ICNA 1LRTA 1YLVA 3I7QA 3VFLA 3N73A 3EWUA 3FLUA 4AWTA 3ABOA 1AL7A 3W7QA 2B7NA 2TSYA 2C15A 5LNSA 4OQVA 1ZJIA 8TIMA 4HNUA 2A6NA 2YFOA 3UZ5A 4NJHA 2QCEA 2XN2A 4ZQRA 3W2MA 3N2XA 3QH2A 5F2IA 5AC6A 3FKRA 3BV4A 4IUOA 3HPZA 2C0AA 3TQVA 2ALDA 2DZPA 3NA8A 4A2SA 2GJLA 3W1LA 1G69A 3TX9A 1EIXA 4IMCA 4O18A 3TAOA 1FWRA 4FEZA 1G7VA 2A7RA 3UXAA 4MVAA 3QC3A 1IXNA 2R94A 4GC4A 4UXDA 4GUFA 4Z08A 5HMSA 1ZALA 2CLMA 2J6XA 3MI2A 1KM5A 4E0CA 1WAUA 2EGZA 3TE9A 4JX6A 4R7JA 5FI8A 2J24A 1QPQA 1O95A 1OX4A 2V2CA 5EL1A 1FXPA 3TUUA 5T26A 1KLZA 2C6QA 3NO5A 4KWVA 4O1AA 4GUJA 5C5YA 2A21A 4Z1AA 3NXFA 5AHLA 2Z6JA 4QNWA 1OX5A 5DCEA 4FX6M 4J9JA 3KVLA 1S5VA 3W1XA 4R34A 3SW6A 4YXGA 4TO8A 1LOLA 1AW1A 2WPBA 4O52A 1DQWA 2A7PA 4JY8A 4UMCA 4RZ6A 3C2VA 2CLIA 3DFPA 4ZQNA 3SECA 2ZZ3A 5AYZA 4S2CA 5DBUA 5KTLA 1FCVA 3T44A 3IV3A 3TKFA 4ZMGA 3IIZA 1JCYA 1JJKA 4QJ1A 3DBPA 3GB6A 3NQDA 3IGXA 5DELA 1MEWA 1G4TA 1GOXA 2OMAA 1VLWA 1VLIA 4QQ3A 4I7VA 2QCFA 4UTUA 1H7XA 3B0PA 1FCBA 4C1LA 4RR4A 1LYXA 2O7SA 4U4MA 1K8XA 3B03A 2E6YA 1NFBA 3QZEA 3A5FA 3M44A 3R2GA 1GWJA 4O10A 2AAMA 5HINA 4OWGA 3E02A 3EXTA 1ZNNA 1X1ZA 3C61A 3HPXA 3GYEA 4JTSA 3F4NA 5F1VA 3TR2A 1KFCA 1KW1A 1W5MA 4HHPA 4DF0A 1JCXA 1X8FA 4GJ1A 1DBTA 1GYNA 2VFFA 1JUEA 4O1DA 3QF0A 4YWIA 3TAKA 1Q6LA 1YDVA 2CLKA 2VOMA 4AB4A 1KM1A 1N8FA 1P0NA 3LTSA 4WOZA 2J9ZA 3TW6A 2ABBA 1KTBA 1G4SA 1HTIA 4YMZA 2JGYA 2QUVA 4JTTA 5BW6A 3PVFA 5HQEA 3S1UA 3O05A 3MUXA 2X1UA 4BWLC 3L66A 3PWAA 2DU2A 4UTLA 4NXSA 1VCVA 3KHJA 3EB2A 1OX4B 3L5MA 2Q8LA 4YLWA 2YCEA 4QITA 3HPSA 5I3KA 3L65A 3W9ZA 3TSDA 4NJIA 3R89A 4QM1A 2EPHA 4FX7A 3PC0A 5AOUA 5SWUA 4JTUA 5GVJA 4MYXA 2GQAA 4AF0B 1DJQA 1J4EA 1VHNA 2QJHA 4AVFA 2E5CA 2O7QA 3TXZA 2NXGA 3O15A 1WA3A 3BW4A 2PRMA 3FEMA 1I2QA 1VCFA 3BLEA 3DI1A 7TIMA 1IIGA 1R2RA 3DH7A 3NEVA 3CT7A 3KX6A 2WOQA 4FIRA 1B4EA 2Y85A 1H7RA 1EB3A 2J9XA 3NL2A 3FIGA 5AYXA 3FOKA 2YYTA 3NPVA 4HSOA 4IGHA 5EPDA 1TTIA 3DFOA 1Q6RA 2H90A 5LNUA 3S5ZA 4FNPA 5I3GA 3FJLA 2FJKA 4CCDA 3RMJA 2QUTA 2X1RA 2QCDA 5AYYA 4Y9AA 5K7JA 2B0MA 2RDUA 3Q94A 4UC5A 2PRHA 3FYOA 3W07A 3SI9A 1EP1A 4ZQOA 3IRDA 3C2OA 1GVSA 5HWMA 3UXDA 3Q2DA 2Y89A 3LV6A 4LNYA 4RV8A 4UFKA 2Y7EA 1PV8A 5G1TA 5KINA 1P5BA 1SUXA 3L5LA 3GAKA 2FPYA 3HGOA 3ZS4A 1JUBA 5G4WA 4PL2A 3IIVA 4S1FA 3PBYA 3U2OA 3LRMA 1QO5A 1AW5A 3EWZA 1T99A 2YW3A 1Z44A 3A24A 3GAYA 1KBJA 3B06A 1VJIA 3ATYA 4IMFA 3B0VC 4K7VA 1KLYA 3FJ6A 3GR7A 2PC4A 4JEQA 2NXIA 3CTLA 4HNNA 1QFEA 2ATMA 1TPVA 4QNEA 4MJMA 1LORA 1F2JA 3LBMA 3P8IA 2CZEA 3PB2A 1TV8A 1OF8A 2FPVA 2ZZ6A 3QQ1A 3T7VA 4NQ1A 1Q3NA 1O4UA 1C8VA 1KA9F 1MO0A 3TK7A 2ZZ7A 4O12A 2Z1BA 3K30A 2P0OA 4IMGA 3RLUA 5BOOA 3WK3A 3G8RA 2DZVA 1PE1A 3NOEA 4IJBA 2J88A 3S1WA 3ABSA 2H3DA 1IXPA 1R47A 3U6WA 4X3ZA 4GRSA 4K6AA 5E93A 2WNZA 1OVDA 2QCLA 4MPQA 1XUUA 4PH6A 2VFDA 1F05A 1KM4A 1R2SA 1OK4A 3IEBA 4UTWA 3VCRA 2NLIA 4AEOA 2Y70A 4TR9A 3LV5A 4JY9A 1F74A 3W87A 5F2MA 3SIZA 1JR1A 3W7HA 2DZUA 3RLVA 3PBVA 1OFPA 4MZ8A 1D3GA 2Y62A 1S3HA 5KZDA 1SFLA 3W70A 2DJLA 3M16A 4DELA 1U5JA 2EF9A 3N3MA 1QNVA 2QDGA 2TYSA 1H7PA 4O19A 2BSLA 3L0KA 3L5AA 2A1YA 5EBUA 3RF9A 3TH6A 1FDYA 1F6KA 3LHTA 4A2RA 2GVJA 1PIIA 2ABAA 4UCGA 1HUVA 4JTJA 1R30A 2TRSA 1YDOA 2P10A 3TMLA 3TC6A 1LBMA 5CZ0A 4WUIA 4JDBA 1TSIA 4OT7A 3MYPA 4LVFA 4WX2A 4EF9A 2ZQ0A 5DCDA 4DF1A 3W7JA 4NNCA 3NYZA 1RQBA 1KTNA 1VRDA 1WXJA 1H51A 1VH7A 1TYGA 3B04A 4JIQA 2Y61A 1XM3A 3DHFA 3DHDA 1YYAA 1J2WA 1FQ0A 2VEKA 4RCXA 1QPOA 4XBKA 5C6MA 2QCMA 1O5XA 5CGQA 2WNQA 2QKFA 3W3OA 1GVOA 3QFEA 3W1TA 4LWWA 5MHBA 4FNTA 3W83A 4N9BA 4GUIA 1B9BA 4LY8A 2DJXA 5FEWA 5LHFA 3W7IA 1R46A 4ORIA 3IVTA 1BWKA 2BWGA 3MI6A 1H1YA 1W56A 4DBDA 3L0NA 3LCLA 4LVGA 1SZFA 1A5AA 3PSWA 4MLRA 4ORMA 3LM7A 2A2IA 4GFSA 4UNLA 3G3DA 1QCWA 1TPEA 1UUOA 1Y0EA 3GNDA 3LCGA 3BK0A 1W5OA 4LS0A 4BF9A 4BK9A 3W7RA 4TIMA 2QCHA 4NX0A 4JTIA 2ZZ5A 3LB0A 4DO5A 3OBKA 3UPBA 1PCWA 1W5NA 4JTFA 2C1HA 1XBVA 3HJZA 3STEA 3LHYA 5FF4A 3TFCA 3W75A 1GTEA 4NNAA 3KVJA 1JRCA 3B05A 1XUZA 2OZ0A 1VQTA 3W74A 1TB3A 1DJNA 3W7OA 4L4MA 1GVQA 4MJZA 5LNRA 1A5BA 3S5NA 2FLIA 1KFJA 3H54A 2HTMA 3C8FA 4TX9A 5G1YA 4MZ1A 3CHVA 4M7TA 3UPWA 3GDMA 3O63A 1NAL1 3G0SA 3LCHA 4Q4KA 4EVZA 5A8GA 3UD6A 1W5QA 3M5ZA 4IOTA 1M7PA 3P80A 3S5YA 2AGKA 3QW3A 5F4WA 1M5WA 3ABRA 1VHCA 2ZA1A 5DCBA 1PCKA 1JCMP 3I7RA 3NQGA 1VGAA 1T96A 3EX1A 3QRHA 2V9DA 2QCCA 4N6EA 3U8GA 1LLWA 3O1NA 3W2JA 1SZNA 2ZA2A 3WFAA 1QPNA 3SGUA 4BI6A 1NF7A 5H91A 4AHPA 5EYWA 4LVBA 5D33A 2QDHA 3O6YX 2ZRYA 1FDJA 3W1UA 5FF2A 4MYAA 1YXDA 3C2FA 4XZ9A 5KSWA 1L6YA 4Y6GA 3TDFA 2CW6A 2WSRA 5DN1A 2BLEA 1OYBA 3A23A 1N55A 4PA8A 3O16A 4LC8A 1F6PA 3NVTA 4ZVJA 3R12A 3PS7A 5AB3A 3W7CA 3IIPA 4WXZA 5HR6A 1YTEA 1ZAJA 4L4LA 3GZ3A 1O60A 2FFCA 3UNDA 1LLZA 1BEUA 5D38A 2WO5A 3LCFA 3MP5A 1I4NA 2ZRVA 4FO4A 4G1KA 2R14A 1TO3A 1TPC1 3HG4A 3W88A 1RQHA 5G2WA 3O8AA 1G4EA 2E09A 1SO4A 3TXVA 4MKNA 3CWNA 2FPTA 4AF0A 4AH7A 2E5DA 3G1XA 4UFIA 1EA0A 3HQ1A 3DZ1A 1W1ZA 1ONRA 5FF7A 3GKFA 5K2ZA 4TMBA 3NQCA 5CSSA 3TC7A 3P8JA 1SW0A 2P1FA 3D0CA 5D2TA 3MBFA 3CPRA 1RR2A 4K36A 2B7QA 1VPXA 3HB9A 3EKZA 4JTGA 1YTDA 3P82A 3ABQA 4UIOA 1XDMA 3RK8A 3P7YA 4N4PA 5IBXA 1VC4A 3VE9A 1GTHA 1HO1A 5AHMA 3L9CA 4ZQPA 3QSRA 1KM2A 3JS3A 1K7XA 1WDWA 4FF7A 3O6CA 2J27A 1JULA 1W8SA 1I2PA 3DKJA 3LHUA 3NPXA 4EIVA 4WD0A 1LRQA 5TIMA 4EOUA 2B4GA 3MYOA 1TPFA 5DLCA 2FTPA 3C4UA 3GDKA 1A5SA 2NUXA 3IVSA 1I2OA 3LXAA 3UWWA 1L6SA 3O07A 3C2EA 1EUNA 3DFTA 1FBAA 3V75A 1OABA 3L0GA 1NF0A 2QJIA 3LCXA 4E2BA 4UTTA 3JRKA 5LNVA 5DY3A 3FYPA 2DZTA 1QO2A 3LCIA 5I3JA 3CWOX 2E5BA 5F4XA 1DORA 3UWVA 1B57A 2JKPA 4Z1DA 2XN0A 4QIUA 4AHQA 2Y88A 1HG3A 2CU0A 4O28A 4JIPA 4UR7A 4JN6A 2ZDRA 1I8JA 3MWAA 2ZTJA 4WOQA 1SSDA 2YW4A 1FWTA 3PF3A 4QISA 5AHIA 3IGSA 4IXXA 4ZQCA 4RZ5A 4DPQA 5D02A 5BMWA 1EP2A 2ZRXA 1XXXA 2QEZA 5BMXA 2JKAA 2HS6A 1I2NA 2I14A 4FX8A 3IVUA 4PCFA 3N9RA 4TU1A 1OFDA 4EWND 1WOBA 4O4WA 1OFBA 2ISVA 4JYFA 1XC4A 4HIBA 4R33A 3OIXA 4HKPA 4UTWC 4OU1A 1ME8A 4WXYA 5D2WA 3HF3A 2C19A 3BLFA 3DGRA 3M47A 4M6QA 1TQXA 2GPTA 3L68A 4LS2A 2HS8A 3OEXA 3GR8A 4XQ6A 2Y7FA 1TIMA 3TSBA 2QAPA 3OA3A 5G4EA 5AFDA 1ICQA 3LI1A 4WY0A 3EX4A 5D05A 2PURA 4ADSA 2V30A 3BGGA 3KXQA 3WK2A 2WSQA 3S0CA 3NZRA 3TW7A 4POCA 1YPIA 1YXYA 4R53A 3DFQA 1VYPX 3W6YA 1AL8A 5U4NA 1ML1A 4GBUA 3W1PA 4RZ4A 3TCEA 3JR2A 4NJGA 3VNDA 1H62A 2YXGA 3M7WA 1LM1A 1V7YA 1XBYA 3NPWA 5F4SA 2DZWA 3AJXA 3EWWA 1TV5A 3NQAA 3HMJG 5AC8A 1TQJA 3CB8A 3UY8A 4H6KA 2J9YA 3BARA 3E0IA 4P61A 4UFMA 4O50A 2FIQA 5HJLA 3SSJA 4UFHA 3SR7A 1H60A 2NUYA 1X7FA 3ZWTA 1TPUA 1MXSA 2QUUA 3BLIA 4JX4A 1VYSX 1F76A 2ZZ2A 3STCA 1FWSA 2KZHA 3ANYA 3QEZA 4GNJA 4ZZ9A 2NV1A 3GXPA 4YL2A 1WQ5A 3GDLA 1GZGA 1Z41A 4O11A 3OVQA 2CLLA 3BW2A 3PSVA 3OVRA 1T0OA 4IWWA 3L2IA 4K38A 4M6PA 5F2GA 2V8ZA 3P60A 2C16A 2W79A 5K9DA 4O57A 4OV9A 1EUAA 3OHIA 3BGJA 4FNUA 3P81A 3Q58A 1RQEA 2X1TA 4CQ9A 3BO9A 4KFPA 3QYQA 1QDSA 3STFA 3BPWA 1JQVA 2FDSA 4JTHA 3PB0A 1A5CA 2XFWA 4H3DA 1JVNA 5G5IA 2Y7GA 3S1VA 3PG8A 1LOSA 1KM3A 1EWDA 1TPB1 3LOTA 3NM3A 5D2YA 4A29A 1CX9A 2CZDA 4U28A 4XUGA 4O1BA 2GQ9A 3R8RA 3WJYA 1JRBA 4QSHA 3LI0A 1G4PA 1ZFJA 2NXHA 5FEXA 1LP6A 3R5EA 4MY9A 2I9EA 3A22A 1ALDA 3SY5A 5CG7A 3ZWSA 4M5PA 2OT0A 5DY2A 1B3OA 3W2KA 1PHQA 4JR5A 3KFTA 1L9WA 4YCOA 1W5PA 3DKLA 3BG9A 3F03K 3UWZA 3EXRA 4O17A 2A85A 1OF6A 1P4CA 2AQWA 2YGYA 2RKXA 1YXCA 3E96A 2A4AA 4WY0B 2DZXA 2CWNA 1IXOA 3T78A 1KM6A 3NNTA 4GXMA 3P84A 3USBA 3R13A 4JS3A 3LGEA 4WQ6A 1Q6QA 4O53A 5FEPA 3OVPA 4O16A 2VXNA 3F4WA 1PVNA 3TROA 2EKCA 3G1HA 3PUOA 4FHAA 1Z48A 5HWNA 2ZCGA 1QOPA 3GXTA 2ZRUA 4MY8A 1FWNA 2B7OA 1I2RA 1LRNA 3IIXA 4UTIA 4A3UA 2W0UA 5EKYA 1MSSA 3PUEA 3ZR4A 3STGA 4N9EA 1JUKA 4O15A
chains in the Genus database with same CATH superfamily
7REQA 3ZR6A 1CIUA 4MM1A 3W2NA 1XR2A 2XDFA 2R9RA 4DI8A 3K8MA 1SO3A 1UR8A 3LHWA 4TV5A 1OT2A 4B5UA 5IDIA 4FP1A 3KEHA 1EEPA 5C2CA 2ICSA 4K37A 4P7NA 1TPWA 2YYUA 2P3EA 3W7LA 3VIKA 5ABTA 3KBMA 4NSBA 3GXNA 4HSNA 1Q6DA 1PHWA 1H7WA 2PU0A 3JU2A 1TTJA 3W1RA 5A8QA 4DZAA 4F0LA 3MV11 5AVHA 3TIMA 3ZR5A 1G7UA 5IHSA 2JQXA 4GQQA 1VFLA 1YNYA 4HHHA 3VDCA 2X30A 4WZHA 4DUWA 4H7ZA 4NY2A 2HV5A 3W26A 3WK1A 1LQ0A 2OG9A 2H3BA 1ZP3A 3K4DA 4HK5A 4PTWA 3ARYA 4CCEA 3WJWA 3NVDA 3BMWA 3VOGA 2F9RA 4CVUA 3TOPA 4IUGA 4WK9A 1OZMA 3ITGA 4ACZA 4PGLA 1VZWA 4H83A 2ZC1A 2JF6A 5XIAA 3GFZA 3MS8A 2YL5A 1H2JA 2NV2A 2DEPA 5IBXC 4IISA 1V6TA 1K9DA 5BRBA 3AHZA 3ZJKA 4WJXA 2WZIA 3UW6A 2G8ZA 4MADA 4HNTA 4RLIA 4U5KA 4FXSA 3A6OA 3COTA 2XVPA 2VHLA 4MFEA 5D04C 5JQ9A 4FI4A 4ADUA 1NELA 1W54A 2BGQA 3JUGA 4C5YA 2VEMA 3SCNA 4Q4RA 1HFBA 1ME7A 1D8CA 2E3ZA 5D8WA 2E6AA 1XKYA 4KW2A 4E8GA 4LVDA 1GVRA 2V2DA 3HU7A 3BCDA 1FKXA 4LY4A 1W1IE 1V3JA 4WDUA 4YHEA 1P1MA 3QW4B 1GK8A 2R1NA 4PB4A 3OPSA 2VDGA 2Y8KA 4L6OA 1JI2A 1UASA 3Q65A 2YLLA 5EMKA 3AIQA 1MFVA 1YPXA 4IGNA 2EO7A 4JDYA 4O8AA 4PMXA 4S3BA 1VBHA 2Y6ZA 1S1RA 4W88A 2NW0A 4CQBA 1H11A 3NGJA 4X9SA 1TMQA 1J0HA 1N8WA 1OD0A 3ZJ7A 3PPFA 4V27A 4X61A 2DQXA 3LDVA 4S3CA 1MEHA 4IXHA 4LUIA 3C6CA 4DWSA 2E67A 5HUPA 3WMLA 1PWLA 3MP4A 3UWYA 1FCUA 5AC4A 1OT1A 2BZNA 1PKYA 3EA2A 2ZYFA 5E0CA 4GO9A 2EJAA 3G1RA 4H9TA 2HPIA 3NQEA 1CXIA 1WDQA 4LS1A 1B90A 1VFTA 1LL4A 2GYIA 1IIHA 2YCLB 4IQLA 2DPEA 3SEPA 2QMKA 1EWEA 2VFEA 4X9YA 1KFEA 4NT0A 3FSUA 1TTPA 4Y96A 5FIPA 2QF8A 2ZX8A 4N0RA 3UERA 1LTDA 4O13A 2AKMA 3U5YA 3W1AA 1CB2A 3W22A 3GKAA 4FXFA 2EQDA 2VI0A 3PBUA 4G1NA 1KWGA 1WO2A 2IPFA 1DWHM 3HG3A 4GG9A 3HGRA 4QLLA 1UKQA 4IMEA 1JL8A 4IGSA 1QOQA 2PD9A 4ZQMA 3LPFA 1E9LA 2EPKX 3GC4A 2J74A 2NUWA 3LEPA 5CZJA 2B7PA 2VTFA 3HGJA 3UXLA 1PX4A 3E3HA 4L1WA 3CAQA 1A53A 3CMGA 2V67A 4KEZA 1K8ZA 2R1LA 4JHOA 4QLJA 1UD5A 4EXQA 1HNYA 4P2VA 1KFKA 4E8CA 5BCAA 4X22A 4Q4OA 2Z24A 5DX7A 3L4XA 4QSFA 3OBEA 5A2CA 4JN8A 4Y9NA 4UFJA 2XGIA 5K4ZA 4C7DA 2C79A 3IJIA 1SFJA 1OEPA 1UBSA 3ISIX 3WQCA 4O54A 2E1WA 2FQIA 1S2WA 1JYNA 3MHUA 4OE7A 4PCSA 3DERA 1UD3A 2PDNA 1Z42A 4AWUA 2G41A 2V69A 2VZVA 3G24A 4LRTA 4QCEA 1E6QM 1GVFA 3NL6A 4EPDC 3M9YA 4N2YA 4AIUA 1FWFC 2CBIA 2TODA 1NOUA 2Z1XA 3N6HA 1O94A 3WLHA 3U7VA 3WH5A 1OX6A 1BG9A 1H7NA 3BW3A 1U1HA 2CZ5A 4HA3A 3H7RA 1UKSA 3FX4A 4DUXA 3V0SA 2PS2A 4LT9A 1VPQA 1US2A 3VKDA 2A7NA 1SFTA 2VKZG 1NQKA 1A47A 3N9KA 2QIIA 1R3SA 3NZPA 4XBJA 4O0ZA 4CQ8A 2OLSA 2XIIA 1GT8A 4DEFA 1XISA 2OO6A 4KWOA 4XKMA 1ZLPA 3T07A 3UG8A 2HISA 1VR6A 2A3HA 1OBAA 5DQPA 2G3JA 1Q4WA 1C92A 4C7GA 5FJUA 3LX9A 2PODA 4F48A 5IXEA 4D6DA 2WM1A 3UZYA 4JFTA 1JDDA 2B31A 1CGWA 4S23A 2YZRA 4UUIA 1LT7A 4JNZA 1BXNA 1I0BA 3B8TA 3B4UA 4WJEA 2WKLA 1KKOA 3F5JA 2YCIX 1NVMA 4ZOAA 3E5PA 4IMAA 2Z2UA 4HZMA 1FX6A 3WJZA 5DXXA 1YIXA 1GG1A 4OVXA 2I5GA 4F0SA 5ABEA 4HU3A 4BI5A 2QF7A 5LYRA 3LY0A 4C6LA 1EGVA 5J8LA 5CPMA 4JTEA 4S3EA 3MT1A 1BXCA 3QBUA 4RNIA 4B90A 1VRXA 2DP3A 1FFRA 5A6LA 1YE4A 3UCCA 2A5HA 3A12A 3QZAA 1OFQA 3VXGA 4Q22A 2E8ZA 3VUPA 4QE5A 2ZVIA 2EG6A 2ZRZA 2D3LA 4UZSA 3TC3A 1HGWA 1XYCA 1L2UA 1BTMA 2VD9A 3SURA 3WK0A 4JPGA 2GOUA 5I09A 1LZOA 3EZ4A 4JGDA 2OQYA 2JKEA 3IIOA 3M5VA 3L4UA 3HG2A 1W3NA 1NIUA 2VD8A 3N1AA 2ZXBA 3H7UA 1KR1A 1CGTA 5E0KA 3GDTA 5BOEA 3OO2A 5ABFA 1HL2A 4DBSA 3RNDA 1RVGA 3WH6A 4C6EA 3BZGA 4H9UA 3S42A 2FVMA 4KRUA 1XP3A 1FHDA 4DHGA 1CECA 5L9FA 4DO6A 1JF6A 1W1A1 6ALDA 3M0JA 4DAIA 1Q4NX 1AW2A 4DAFA 2ZFAA 1UH2A 1QMLA 3NPUA 3OZYA 4YJ5A 5MF5A 4UB9A 5T91A 1J0ZA 4D6HA 3BJTA 1QI5A 4XTDA 1KM0A 1BF2A 4GVHA 4X2RA 2HSAA 3PZVA 4DF2A 3UZXA 1NU5A 4IPJA 3APYA 3WF2A 1ICSA 1RAKA 4WVXA 2C8NA 3I7SA 2E4TA 3V3WA 4L9XA 1IXQA 3UVAA 2PTWA 4DX3A 2EJ1A 3BC9A 4PMZA 4W5ZA 4HPNA 4QBXA 1QHPA 4GY7A 2UZ9A 5A8MA 1QTWA 2ZADA 4PUNA 2WMIB 2CBJA 5HJXA 4NZFA 3S9IA 2ZXDA 2PZ0A 1HKIA 4HGXA 4CLMA 1D8WA 3IV8A 4M24A 4Q7BA 1FP8A 3EDEA 1CB7B 3CEUA 2BX7A 4HYWA 5J04A 1V08A 2DUZA 2DDXA 1E51A 4TV6A 4XZMX 4S3AA 3TN3A 3W28A 4XIAA 1UG6A 3CAWA 3GUWA 3LGDA 5F1UA 1QK0A 1K03A 4AXKA 3FK4A 2OFJA 3RRXA 4DJDC 3VE7A 2ACRA 4DXKA 3DYPA 5FF3A 2ZWZA 4O1CA 3T81A 3M0ZA 4KRZA 3VI2A 3TNBA 4G7EA 2QULA 5JH1A 4DJFA 3NZ1A 5K9XA 3VZZA 4GIYA 1KV8A 2PGFA 2XIMA 3EGJA 4HD5A 4JTDA 1J5TA 1UROA 1WV2A 1I45A 2OTDA 4PMVA 1BWLA 3ARTA 4CCCA 5I23A 3MVTA 3S6DA 5A5WA 3I68A 2YDQA 1S5NA 2DY3A 3QMRA 1XLEA 4FPSA 3ALFA 4I8YA 2HVOA 4ZB0A 4OBRA 4I8DA 1WOAA 3QVQA 5BU6A 3KDNA 1RZMA 2GFTA 9XIAA 4QLKA 1VP5A 4GD0A 5DRIA 4I5XA 1L6GA 3KM8A 2D20A 4EF8A 2XFYA 1G01A 3E49A 1XIJA 3EA1A 3KLLA 3SAZA 1UWSA 1JIBA 2V3DA 2FB2A 1NH6A 3LYEA 1HKJA 3U2EA 4IZGA 4TXEA 4CD8A 1HL8A 3QR1A 1N82A 4E4PA 3CEPA 1NFPA 2P8BA 4GZ7A 3BURA 3CHDA 3DHUA 1BXBA 1HO4A 3NFUA 4G8TA 3T55A 4ICNA 1LRTA 2C0HA 3I7QA 1E55A 1GW9A 2YL8A 3OTRA 3MANA 4Y9PA 3ABOA 2HZGA 4AZBA 1OCJA 3ZLGA 3KTCA 3W7QA 5I00A 1S38A 2B7NA 4HNUA 2A6NA 2YFOA 4NJHA 4IUOA 2I56A 3E0WA 4V2XA 5CPTA 1CLKA 1Q6FA 2R1PA 3CV1A 4HA1A 4A8IA 3QOKA 4IMCA 4FEZA 1NP2A 2BY1A 2R94A 3DG3A 4GC4A 4Z08A 1ZALA 3MI2A 4E0CA 1KXHA 3TE9A 3E2QA 4JX6A 3TJIA 1XCXA 4R7JA 1QPQA 1GZ1A 3MVIA 3TN6A 3TYCA 2CBVA 1EBGA 2C6QA 4KWVA 3WQ4A 1J6OA 1E4NA 1S39A 2W67A 5AHLA 3FY1A 4QNWA 5E70A 5DCEA 3KVLA 4R34A 4KCVA 1QRQA 2WKGA 4B9ZA 3AICA 2WPBA 3TYEA 1DQWA 4JY8A 1BWVA 4RPQA 3C2VA 4RE4A 3SECA 2ZZ3A 3LQGA 5AYZA 4W8BA 2XZ7A 5KTLA 4IQDA 2J79A 1UWRA 1UZHA 3SN0A 3IV3A 1JCYA 2DW7A 4GGHA 3WLOA 1OSEA 1JD7A 5E5CA 3DBPA 4V33A 5TNVA 1NWTA 4GY0A 4MKSA 1US3A 4QHRA 3VINA 1UMYA 2SFPA 4QQ3A 2P53A 2Q01A 3HQPA 2O55A 1LYXA 1K4HA 3VD3A 3PP7A 2E6YA 1PX3A 3R2GA 1EX1A 1R6WA 2JALA 4NG3A 2AAMA 4D1IA 5HINA 2YA2A 2ZX7A 3EXTA 3ME3A 4H6RA 4L1XA 4IP7A 3HPXA 4H9ZA 1JZ4A 1JGIA 1UZ4A 5CCZA 1KW1A 4C91A 3IJQA 2F2KA 4GJ1A 1DTNA 2BVDA 2BVTA 2WNWA 1R87A 1JUEA 1MFUA 4X60A 3TAKA 1Q6LA 2CWXA 1RXOB 1MZRA 2VGIA 3VOJA 4QCFA 1PYMA 2JGYA 2QUVA 4QG9A 3KBWA 3VABA 5HQEA 1V3HA 3S1UA 1ZGDA 2X1UA 3PWAA 3CTTA 2DU2A 1VCVA 4AY7A 2QDDA 4JBRA 2Z1WA 2WJDA 4QITA 3FHAA 3L65A 3KL0A 1NWSA 2NSOA 4QDMA 5AOUA 3WQGA 1XLBA 2BASA 3B40A 1MDRA 1DJQA 3EPOA 1N8IA 4OECA 2NXGA 3MB9A 3O15A 3R43A 1WA3A 3OYXA 1I2QA 1MQRA 4FS9A 4EK7A 1R2RA 7TIMA 1Q5MA 3JVAA 2WOQA 3WLTA 1B4EA 1KRAC 4GXWA 1H7RA 5MKGB 3NL2A 3AMGA 2PDMA 3NXLA 4IGHA 5EPDA 2OOGA 1TTIA 2INFA 5H8MA 3S5ZA 2IPWA 4FNPA 5I3GA 1D7FA 3VAVA 1E9IA 3HZ3A 4CCDA 2O4QA 4JTAA 1AD4A 4GY1A 5AYYA 3TYAA 3BSMA 2B0MA 2RDUA 3Q94A 4UC5A 3FYOA 3M6DA 4QG8A 3AXMA 1OIFA 3ZVIA 3C2OA 1GVSA 2OSYA 4KPLA 4PB5A 5I02A 4LNYA 2ACUA 3GXDA 3IJ9A 1P5BA 3MMDA 5T9CE 4S3FA 3HGOA 3ZS4A 4MDPA 4HA0A 2FZDA 2Z28A 4PUDA 3U2OA 1VIZA 1WDRA 2PDWA 3A24A 3IJLA 1KBJA 1K4GA 1R9XA 4IIDA 4H8HA 1UZ1A 2NXIA 3PK7A 1A5KC 4HNNA 2FJUB 3OJGA 4GZIA 5BROA 2CZEA 3PB2A 2QZRA 4IFKA 2ZZ6A 2F38A 4DWSD 3WLKX 1BVZA 3BQ5A 2DV0A 3TK7A 2ZZ7A 4DJFC 3H24A 2Z1BA 3CO8A 1X7IA 3T9PA 1FH7A 3GHUA 5I07A 1ODZA 3K8KA 2WVVB 1XJBA 3M0KA 2DZVA 1AQ0A 3NOEA 4OBSA 2J88A 1VFMA 3ABSA 4W5UA 1PUDA 1XQLA 1IXPA 1R47A 4MDOA 4GRSA 4K6AA 3AIUA 1W1B1 1NP0A 1PX8A 1KM4A 1DEDA 1DJIA 3PZUA 4AZCA 1KBLA 3DDMA 3LN3A 4UTWA 3PNUA 1YBQB 3RMEA 2NLIA 4AEOA 4TR9A 3ID7A 4JY9A 1F74A 4Q8MA 1BSIA 1S2AA 2FTWA 2PDQA 1OFPA 2PPGA 2CYGA 3MDWA 1PZ3A 2Y62A 3REQB 5KZDA 3W70A 2DJLA 1RVKA 3RYSA 3O6AA 1QNVA 4B3LA 4O19A 2A3CA 2BSLA 3L5AA 4GVIA 5EBUA 3VIFA 4JFSA 1CYGA 1FDYA 1XSKA 1KCKA 2QW5A 4A2RA 2GVJA 4UCGA 2E9MA 2QDEA 4AG0A 4HU0A 3OLIA 3F4VA 4G56A 3ENLA 5CZ0A 4J1OA 2PLJA 1V03A 4WX2A 1HW6A 4E5TA 3NYZA 1RQBA 1YMYA 1KTNA 5BXRA 1WXJA 1H51A 1WDPA 4DM2A 1MYRA 4GKTA 1FQ0A 3URBA 1Q6CA 3GBDA 3O7UA 5A3HA 1DTUA 1LL7A 5C6MA 4KQNA 3STPA 5LIXX 3APTA 4HCHA 5A6MA 3A3XA 2X7VA 1G94A 4Z2LA 1J0JA 1XRSA 5C9XA 4LY8A 4M29A 1VBGA 3ZT5A 3A13A 3MU7A 2NV9A 3IVTA 1K6AA 1W91A 1S2UA 1KQZA 3VYLA 1H1YA 4ZB2A 3PWGA 1W56A 1VPYA 4C7FA 2VC5A 1I75A 2Q8XA 1A5AA 3PSWA 4PB3A 2QPSA 1EIBA 3LM7A 4ZEPA 3QV9A 5C70A 4GFSA 3B8VA 1BD0A 2OEJA 1O6IA 2XZ9A 3MWCA 4BF9A 4PE8A 1Y5VA 3VNZA 1UR2A 3NO3A 3LB0A 1IEXA 4HN8A 4UQDA 4PEEA 6XIAA 4KGJA 1XLDA 5FF4A 4NNAA 3UZZA 1PIFA 2V5CA 1J0YA 1XUZA 5A6KA 1E4LA 4MTVA 2OZ3A 1V0NA 4Z1YA 3T08A 4ZR8A 5LNRA 1E4IA 1XW8A 2WAGA 2J7GA 3BH4A 3ZJ6A 3GTNA 1KFWA 3AOFA 3CT2A 1Y65A 5G1YA 3UPWA 1U2YA 4N7QA 5B80A 4EVZA 3BAYA 4O0QA 4IOTA 3ANUA 4C6DA 2QPXA 3QW3A 5F4WA 2BGSA 1QNPA 1J0KA 4TUFA 2FZMA 1A3HA 2YA1A 2I7GA 1F9CA 1ONXA 3I7RA 5JUVA 5DO8A 2CLPA 3WFZA 4BKNA 4WR3A 2V9DA 4EX4A 2ZX9A 2OLAA 4AIOA 1LLWA 1UR1A 3TYZA 2QGYA 3CV2A 3A3HA 2FYMA 2J78A 4BI6A 1YDYA 1NF7A 3SCRA 3MUCA 1YXDA 2PWGA 4IFRA 2PDJA 4JQ1A 4UQAA 2PA6A 2WSRA 1WDSA 1E6SM 4LF1A 1EJRC 2OR2A 3H4WA 4DRSA 3CV6A 3IUIA 1FWDC 4PA8A 4D72A 2V3GA 1BAGA 4LC8A 1F6PA 4ZVJA 3R12A 1W3HA 3IIPA 5HR6A 3H4XA 1UR3M 4J3TA 3GZ3A 2FFCA 3PTKA 3DG6A 4OUIA 5TF0A 4FOJA 1I4NA 2ZRVA 4NZCA 3SSZA 2R14A 3R58A 4LUYA 1TPC1 4MGGA 3W88A 1A3XA 1ISVA 1G4EA 2E09A 1SO4A 2OYLA 3AQUA 4UFIA 1EA0A 3DZ1A 3SIMA 2Q71A 2ZWYA 1ONRA 3HMCA 1XS2A 5K2ZA 4L56A 3WLPA 4PMQA 2MUCA 4CNTA 5HQLA 4K8GA 1RA5A 4A3HA 5CSSA 1EQPA 1P6CA 2P1FA 3ARXA 4PUUA 5CAHA 1F6YA 3O0KA 1SZRA 3H12A 1WKEA 4EXBA 2BVYA 1P0EA 3OHMB 3ABQA 4UIOA 2VZUA 3C2YA 3QY8A 4N4PA 3N2OA 3VE9A 2ODOA 4EKJA 3OLDA 3QSRA 4M1RA 3JS3A 1POJA 4GZJA 4GISA 4IPLA 2FZ9A 1SMDA 1JULA 3LHUA 3OW1A 3P0WA 5HNUA 5TIMA 1XFCA 1H5VA 3MYOA 1TG7A 4RW5A 4IJRA 1V4YA 2FTPA 3XISA 1EH9A 3T0CA 1FWHC 1QI4A 2J47A 1E73M 3LXAA 3OGRA 2PDUA 3G2GA 1L6SA 1Y5XA 1MRQA 1NY1A 5A8OA 3L0GA 3GXMA 3KBJA 1B54A 3N12A 3JRKA 5EMYA 3ZMRA 4CU8A 2WSKA 4FLOA 2JKPA 2RUSA 1GOOA 4WKAA 2A3BA 3P93A 4AHQA 1IWBA 1HG3A 4JN6A 3B3DA 2ZTJA 3RN6A 3EPMA 2YW4A 1PKLA 1XH1A 4MF4A 1GQIA 3LLXA 4IXXA 1QPKA 2BOGX 2Z7GA 2RGLA 5BMWA 4QR6A 1CXLA 2ZRXA 4ZSUA 5FOOA 5PTDA 1UWIA 3ARWA 3V0UA 3ZIZA 1I2NA 5HQMA 3WF4A 4AYGA 4DJFD 4KMQA 4EWND 3L23A 3EB3A 1OFBA 2X7WA 1XC4A 4R33A 2PDCA 4UTWC 1E56A 1CGYA 2F8QA 3DGRA 4QP0A 1HXJA 2WHKA 2GPTA 1O68A 3L68A 4XD6A 4AZIA 4QG6A 2Y7FA 3APGA 2X0SA 3LI1A 2V5JA 1XGZA 3PJWA 7PTDA 4ADSA 3F2DA 3S0CA 2ZICA 1E6RA 1VBRA 1YPIA 2BHZA 1ML1A 3TCEA 4RZ4A 4L6HA 3RITA 4H8VA 3CHFA 3SO7A 2I5IA 3VNDA 1FOBA 2O9OA 5G4HC 2VCAA 4ML4A 3ONBA 5FSDC 4KWSA 2NQHA 1EJVC 3UY8A 3BARA 1MNZA 3CO4A 4GNVA 1H60A 1X7FA 3ZWTA 3UR2A 3RLHA 3PJTA 3RG6A 4JX4A 4W85A 5IDZA 4DYKA 3BLLA 3BOLA 1F3TA 4O11A 4KWUA 2P0IA 3UEQA 3WO8A 9RUBA 3L2IA 2BXZA 3T2OA 1C91A 3CZ8A 3P60A 2C16A 5EB8A 2W79A 3H4GA 3FGCA 4PMRA 4PMNA 4EACA 4KESA 1QHOA 3PTDA 4H9VA 3TLQA 4AVNA 2BFGA 3M64A 3KL3A 3QYQA 3BPWA 3L4YA 4FOUA 5CZKA 3PB0A 4QXIA 4ENLA 4H3DA 1BYCA 5G5IA 2Y7GA 3S1VA 1EWDA 2PB1A 3KCLA 3K46A 3EDDA 3AUOA 4JIIX 1CX9A 4XUGA 3G5EA 3CZEA 3LI0A 2BNJA 1G4PA 1LP6A 5DFAA 2BODX 4MY9A 2I9EA 1ALDA 3MCNA 3V36A 1GHRA 1FKWA 4LX4A 2QJNA 1L9WA 1W5PA 1OGGA 3DKLA 3UWZA 1JPKA 1AMYA 4O17A 2A85A 1P4CA 3KOZA 3KBVA 5A6JA 3E96A 1G5AA 4AEFA 4WKFA 1RLDA 4UBPC 3T78A 1Q8AA 2BOFX 2HBVA 3THCA 4AXNA 2XVNA 3AS3A 1W6TA 4UQ9A 1DIKA 1P6BA 4XUYA 4O53A 4Q8NA 8CGTA 1DIDA 3H2NA 3TROA 4BZYA 3PUOA 4F4RA 1U5VA 3W24A 1CNVA 1Z48A 5HWNA 1XG3A 2ZCGA 3ZQ9A 1K8CA 4JIHA 3H26A 2PUZA 4MY8A 1FWNA 2QJJA 2VCCA 5JH2A 3MO4A 4N9EA 1EL3A 2UV8G 4TMCA 6TIMA 1LOQA 2OSWA 3R0KA 3P5YA 3MUY1 3BG3A 3IARA 1TELA 1V02E 4GH3A 4IIEA 4IP4A 1YPFA 3SRKA 2Z1SA 3P2VA 1DVJA 1QBBA 3QHOA 2H8XA 4LOCA 2PLKA 3NZGA 1A5UA 5GNZA 4BCEA 5I2UA 3TWAA 1D2KA 1QAPA 2PC8A 2C3ZA 4C6FA 1XG4A 2OCZA 5JVLA 4RE3A 1YX1A 3G77A 3CU2A 1E70M 3GG0A 3ITYA 3LHVA 4P5UA 4Q7NA 3QMSA 4WKHA 3TFXA 4O14A 3NQVA 4JNMA 1H49A 4KWWA 2FGLA 3H23A 2E6FA 1BLIA 2E9BA 1EA9C 2PGEA 4K1GA 1UP0A 3CUJA 1ZUAX 4D2JA 4WY0F 3CB3A 3EX3A 3U48A 1SO6A 3VIJA 3C5QA 1QNRA 4HU4A 1CXFA 4PUMA 1JYWA 1R3RA 1F5ZA 2W63A 4HZ7A 3A64A 2HJPA 3NQMA 4KEUA 2VC6A 1FRBA 1S5TA 1W8GA 5FACA 3QY7A 4C6KA 3T8QA 3A5VA 4L61A 2YPIA 1LWHA 3HO8A 1DJGA 4HN4A 5FJIA 3WNMA 2PWEA 8XIAA 2V5BA 5IOBA 3P61A 3G18A 4E4FA 4EANA 3N14A 2IXVA 4JXCA 3W7MA 4C6IA 2YCLA 4GA8A 2BB0A 1GKQA 2WV8A 2DORA 3AROA 3CLWA 4KIEA 3DENA 1DL3A 1O1ZA 3NQ7A 4MUZA 4PTNA 4I7WA 2CHOA 1A3WA 3G1VA 5HPCA 3PN8A 1XIFA 2XFFA 5IM51 3KRSA 4YU1A 3SRDA 3LPGA 5CPLA 5KZMA 3PFMA 1SU5A 2XIQA 1BKSA 7A3HA 1S5MA 2ZUNA 4JKKA 5TBOA 5LA1A 3T4CA 4MFDA 2XM1A 1TRIA 3VMNA 3L67A 1N2VA 1WE5A 2DZAA 5M17A 4O1EA 1T8XA 1LBLA 1W3IA 5M1TA 4JYEA 4GE8A 3BOXA 1TPDA 3VX0A 2A6LA 2QLYA 4ZFCA 1KXVA 1EHAA 2YDAA 2WQPA 5LGXA 2DSUA 3KOWA 3V1HA 5CBJA 1XIHA 2IPJA 2XN1A 1YEYA 5I3HA 1GCYA 3ZT6A 3LUTA 4UNKA 3TA6A 4O1FA 2P5NA 3E1F1 4MJ4A 5C8BB 3R11A 2YL6A 1C7SA 5I3IA 5I79A 2XGBA 3FEQA 4JQ4A 1EBHA 3W85A 2E68A 1B3VA 2Y5EA 3FAXA 4G7EB 1WZLA 3GH5A 2GUUA 2ISWA 3CV7A 1QUMA 1KCXA 4GUHA 3I6RA 1UP2A 3ES8A 2BTMA 3W1MA 2XTKA 4J3SA 5I06A 3NG3A 1ZHAA 1P0BA 3PNZA 5GQBA 1UH3A 3SGZA 3V5OA 5CEWA 3G1AA 1Z32X 4FF5A 2PE4A 3NQ2A 4Q6JA 3VU2A 2YX0A 4GINA 1XPGA 1Q2SA 5FESA 2IKJA 5GNYA 1UC4A 4XX6A 1O5RA 2XIJA 3MY9A 4B5NA 1IHIA 3PY2A 1EZ2A 3FS2A 5G1MA 5C71A 2Y24A 3BSGA 2G97A 2FH6A 5AN7A 2X8RA 3EX6A 4A35A 4AISA 4M7SA 2OZ8A 4I90A 4J35A 1LCOA 5H1WA 1QK2A 4Q8VA 4J3UA 3SM0A 4C5ZA 1MMFA 1SQ7A 2P8CA 2V5KA 2GZXA 1ZY9A 4C6PA 4AMAA 3F1QA 1U30A 1RJQA 4FR6A 1QT1A 2NWSA 1X1OA 1WUEA 5FJJA 3ELFA 1JDFA 3EWXA 3MC5A 1MW3A 1TWZA 1EJXC 1SW3A 4KKXA 4LB4A 3ZZ1A 4WSKA 3WLQA 1E71M 1DWFM 4LU0A 2VR2A 5L6UA 5F2LA 2NX9A 2C14A 4JL1A 5EMUA 1GZJA 2ZXQA 3H53A 4AHOA 3GHSA 5H6HA 1W2VA 1PTGA 4LRSA 4AWSA 1J01A 4CNUA 3PUDA 3LRLA 4PRRA 3BLPX 2VFHA 1E5JA 3CC1A 3EOUA 3G0UA 3UYCA 1GPWA 4ZL1A 1ADOA 2VENA 4FMVA 4KGLA 2RH9A 1TRDA 2DZSA 2PP1A 1S2CA 4PFMA 3FXYA 4DZIA 2VEPA 1FH9A 3DFSA 3ZYZA 1RJPA 4V1YA 1TVNA 3QV8A 1YKWA 4JCMA 1H63A 3DAQA 3H21A 3LRKA 3NM1A 3WDHA 2PCEA 1JNEA 2Z1VA 1VYRA 4N4QA 1UC5A 2OX1A 4MKVA 3W86A 4PUEA 1G67A 1MXGA 2QIWA 2GGIA 3W25A 5CAKA 1LROA 3QFWA 4HK7A 3POCA 3THAA 3PPHA 4FIQA 4RXGA 2BV9A 1DV7A 1Q7ZA 1M7OA 2Z25A 2BHUA 2G95A 3UY7A 4ZA0A 3KOFA 2HK1A 3R4IA 3VO0A 1E1CA 1GPFA 3UJFA 2VVNA 4S2BA 2VMFA 1B4KA 3SZ8A 4OUEA 3N29A 1TJRA 3M0VA 1SVDA 3MCMA 3NSMA 3K4WA 2ZTKA 4HT3A 9CGTA 3GTFA 1DJWA 5CC6A 4JTLA 4N9CA 1CENA 1CW2A 1SJBA 1VFUA 3NR0A 1MNSA 4R9OA 3WEMA 3LENA 3GNRA 4JICA 4XWUA 3MBDA 2WMIA 1WBJA 1QU4A 3B8SA 3TQ0A 4C6OA 3U2ZA 3TQKA 3BAXA 4IIBA 1UH4A 3GDRA 1ADSA 2ZX5A 4LUJA 1TKKA 2R82A 3AYTA 4L4PA 1AMKA 2WMGA 2PFHA 1XBXA 1V8EA 1PKMA 1XBZA 1ZJHA 3PBMA 1OGSA 3V35A 3GWQA 5GNXA 4JFVA 3O3RA 5DXYA 3M0LA 3M5YA 3EBVA 4Q4SA 3UWUA 1HF6A 1CGUA 4XAZA 4K68A 1TMLA 1LQ2A 3AWNA 3LCWA 3A4AA 1EP3A 3P3BA 3CLMA 3KP1A 4PMOA 4F79A 2INEA 4GI6A 4UMBA 1JFHA 4WHBA 4MZYA 1EC7A 1VEMA 4YTTA 2X2YA 3GUGA 1QI2A 3ZO9A 2DT3A 1VIWA 1K8YA 1DWGM 1UWAA 3I65A 2J7DA 3B8UA 2FHFA 3IWPA 1BRLB 5B7ZA 3DBNA 4BEUA 1QOXA 1VFHA 3OB8A 2ATSA 2VT0A 2WKJA 1EOKA 4QX4A 4XTIA 2ZA3A 5LNWA 1NFGA 1R85A 3G22A 4MJ2A 1BF6A 3W7GA 4EPEC 2QCNA 4GX8A 1RCOB 2FH8A 1E0WA 5C54A 1B1YA 3V7PA 2VEIA 1XRTA 3QPYA 4AW7A 1VBUA 5BWFA 3CXOA 2PCQA 5LHEA 1V3IA 4PN2A 3A3WA 1ZRQA 3I6TA 4E38A 2DH2A 5CSYA 1DPMA 3TP4A 1VCGA 3MJYA 1QWGA 4YYFA 1QPRA 2R91A 2D24A 4CNNA 5H2ZA 4IT1A 3IPWA 3LXBA 1TV4A 3FV9A 2YZ5A 4CD4A 1V7AA 5KITA 3POHA 2D73A 4IFKB 1GNXA 4HVXA 3ITOA 5LSMA 4AD3A 2QVNA 2NX3A 4UZUA 1TCDA 4ZO8A 2F84A 5JIPA 2H9AB 4W7VA 1NSJA 3DI0A 5LIYX 5FJRA 1DJHA 1XX1A 1TV3A 2GUBA 3MSRA 3SJ3A 4FALA 1WKYA 4PMJA 2NQJA 1GEQA 3R25A 4XV0A 2GVGA 4H8UA 4PL1A 3DXIA 1AJZA 3A21A 4KFNA 4URIA 1HP4A 1M53A 3GQYA 4AZCB 3WJXA 1IGWA 3ABZA 4H9XA 3S5SA 1XIDA 4L7ZA 4X0VA 1V3MA 3INPA 2OX4A 4J3XA 1R9ZA 2Q3OA 2D22A 1HKVA 3W38A 5HXMA 4ZO9A 3RU6A 3TV8A 1T41A 4JTCA 2VFGA 3AXKA 4KCTA 3QZ6A 3G1YA 1E0TA 3C56A 3M6YA 1EOMA 1Q6OA 4CNPA 3VFCA 5HMEA 4HNOA 1Y5WA 3SJNA 2G96A 4DBEA 1BQCA 5C9WA 3IK2A 1ZCOA 4DO4A 1OYAA 4IX0A 2KAUC 3OOQA 4MIMA 3SUUA 1Q63A 4AWEA 4BQ2A 4ROQA 5TD4A 3KOYA 1CCWB 1AL7A 5AECA 2FTYA 2X09A 2GDVA 4PTXA 2YBTA 3CAVA 2QCEA 5XINA 2XN2A 2ON3A 3AHTA 5F2IA 1XYZA 5AC6A 3HPZA 2C0AA 4PTMA 2DZPA 3TQVA 3OP2A 1M68A 3ANVA 1DXFA 5FD0A 1FWRA 3UXAA 4HB7A 4U3CA 2J6XA 4H04A 5FI8A 2XWEA 2V2CA 2E7FA 5EL1A 4Z2IA 3FDGA 5T26A 4HOZA 2Z27A 1PEZA 3UA4A 1EGMA 1HX0A 4Z1AA 4AZGA 4U3AA 3SDOA 1J12A 4CEUC 4YXGA 4TO8A 4DB7A 1AW1A 1GYMA 4K2SA 2A7PA 3URNA 4LQ1A 4RZ6A 2X42A 4GACA 4ZQNA 4CVWA 4GCAA 1W1PA 1M01A 5T9BG 3TKFA 3WQDA 3WD1A 3O2LA 3OG2A 1JJKA 4QJ1A 3GHRA 1GKPA 3JZUA 3GB6A 1H4PA 1CXKA 5MKGA 1S1PA 2OU4A 4S38A 4HZ6A 3OYZA 1GOXA 2NQZA 1VLWA 2EPNA 1S3TC 3NIYA 4DO7A 1FCBA 4WEVX 2VGGA 1P6WA 2YXXA 3T8LA 4R7OA 1R3TA 4NZ3A 1QNQA 4M8UA 4O10A 3VOHA 3F4NA 5F1VA 6REQB 1Z6KA 4IIFA 1JCXA 1X8FA 1EYEA 4UOJA 2A3EA 1GYNA 3NTYA 1HKWA 1J5SA 2J13A 4YWIA 4Q4PA 3VTRA 1UR4A 1KM1A 4US6A 1N8FA 3TW6A 2ABBA 1G4SA 3N18A 4YMZA 3CASA 1VFSA 4A8LA 1GORA 3U4FA 1CDGA 2GJXB 2R1MA 1XIMA 3RHGA 3QXBA 2ZUVA 4UTLA 1TWSA 1HJQA 4I6VA 2O9TA 4B5VA 1OX4B 2Q8LA 3WQFA 1S2VA 4YVPA 4XK2A 1H1NA 4YLWA 4YTSA 2YCEA 1M65A 3H7VA 3UG5A 2VR5A 3TR9A 3TSDA 1QWKA 3R89A 4LBRA 4K3ZA 4QM1A 3ITXA 3VA8A 4MSSA 3PC0A 3T4WA 5AZ1A 1UWQA 1J0IA 4JTUA 4MYXA 3H8AA 2GQAA 4Q8UA 3H2AA 1K9EA 4MAVA 5C7HA 3HQOA 1P48A 1EGZA 2PRMA 3FEMA 3WYZA 1IIGA 3NEVA 1TR9A 2Y2WA 5REQA 4FIRA 2Y85A 2QXWA 1BYDA 1FWGC 5AYXA 3FIGA 3PZNA 4JZ5A 4F2BA 1GJWA 2YYTA 2W66A 1Q6RA 3SQMA 3REQA 4EE9A 4QJ5B 5K7JA 4NZ1A 1EP1A 4BY3A 2VL4A 2WMHA 3VPLA 5A8NA 2DT0A 1ECQA 2CBUA 3UXDA 3Q2DA 2QJMA 4Z42C 3N2TA 1PDZA 5HOSA 4Q8WA 4RV8A 4UFKA 1PV8A 5G1TA 1SUXA 4PTDA 1LL6A 2W27A 3WNNA 3GAKA 4F2UA 2FPYA 2OVLA 2V38A 5G4WA 3U7BA 1A5MC 1G1YA 1CXHA 5C0QA 3LG3A 2YJQA 1JZ3A 1OZQA 1T99A 1BHGA 4DBUA 3GAYA 3SY8A 1SMAA 1VENA 3ATYA 3B0VC 1IQ8A 3TZFA 2INZA 2PC4A 4YWSA 5HNTA 1GQLA 1V6UA 3CTLA 3VC6A 3SCTA 4HSHA 2PWHA 4QNEA 5AC5A 1R38A 2ISFA 4MJMA 1LORA 4GCXA 1F2JA 3LBMA 3P8IA 3ITTA 2FPVA 2ESCA 2OWXA 2WMKA 1KCLA 1X6NA 2ZDSA 1O4UA 1C8VA 3RGTA 1KA9F 1DJZA 1Z69A 4GQRA 1PDYA 1BPLB 3HN3A 5E6ZA 1RH9A 3IJDA 2PLMA 4IMGA 5AVNA 1UWTA 3VMOA 2ZVRA 5E6YA 5HPOA 1PE1A 2WWDA 1V6VA 4IJBA 4DY1A 1E43A 1LWIA 2H3DA 3U6WA 1NWRA 3CPUA 4UOZA 2WNZA 4F9JA 2CHRA 4LNCA 3VIMA 2AMXA 3HQNA 1F05A 5FL1A 1R2SA 1JCTA 1M41A 4KBXA 2VP8A 4WSHA 2GUYA 3VCRA 4AFYA 1ZS2A 3RXZA 3SCVA 3T2PA 4LXFA 3VGEA 2HQAA 3GE7A 3UBPC 5CH9A 2NVDA 5F2MA 3SIZA 3W7HA 5HATA 3SN4A 3RLVA 3RCMA 1D3GA 1SFLA 3M16A 1U5JA 3N3MA 3P14A 3AIEA 4CN1A 1MXDA 3IUDA 1PIIA 1DHKA 1CTNA 2A3AA 1YDOA 4QEHA 3FAWA 3TC6A 3K8LA 4F0KA 3VX1A 3TYDA 3PAOA 4BJHA 4JDBA 4YNGA 2O9PA 1ZP4A 1UW9A 2ZQ0A 1B31A 3W7JA 1Z8AA 3H6OA 4JIQA 2Y61A 4FAMA 4UOQA 1J96A 3DC0A 1EEXA 4F0HA 2P50A 3GTXA 3M07A 1IEQA 3CYJA 4XBKA 2CNCA 1O5XA 3CBWA 3S6TA 3SUWA 3W3OA 3W1TA 3ZSTA 1ZJAA 5LIWX 3FGCB 5ECUA 3LGGA 1BSLA 4D6CA 4S3GA 4GUIA 5DMNA 5FEWA 5LHFA 5CC7A 1ESWA 1LJYA 1R46A 1BWKA 2BWGA 3MI6A 1SFSA 2PDIA 4DBDA 3N3TA 4GYJA 1SZFA 4MLRA 1E72M 2A2IA 4NI8A 1QCWA 1ONEA 1E15A 4LS0A 5FAGA 4BK9A 3W7RA 4JIRA 2GK1B 4NX0A 2JEPA 4HU8A 4DO5A 3BAJA 2G37A 3FA4A 3M0IA 1JEZA 4JFWA 4DYJA 1W5NA 4XG1A 1XBVA 3HJZA 3EMZA 1RP8A 1IZCA 3LHYA 3GG7A 1UMLA 2J7BA 3MMWA 4PUWA 2J4GA 3B05A 2AMGA 3KZSA 3NDYA 1DXIA 3QV6A 1TB3A 5I3DA 3U9IA 3W7OA 2WHMA 3TYBA 2AGTA 2FLIA 1KFJA 3H54A 3C8FA 3CHVA 3QTPA 3GDMA 3VGGA 2OWWA 2Z26A 4GK8A 3N11A 4H9MA 3UD6A 4C1NA 1DJXA 4LUTB 5CBBA 2DVTA 3E74A 1M5WA 3ABRA 1VHCA 2ZA1A 3MSYA 3IJ6A 5DCBA 1J11A 1JCMP 2Y5JA 4PFHA 5FAJA 5A6SA 3CS2A 3QRHA 3UJEA 4JAWA 2QCCA 4PCNA 4DM1A 5GPRA 4C6CA 3O1NA 3GTIA 1EF2A 4AY8A 5H91A 1R5YA 4LVBA 3BAWA 2ZRYA 3WKZA 1TE6A 3C2FA 3SN1A 2DQWA 2OQLA 4Y6GA 3UJRA 3WNKA 2BLEA 1OYBA 3A23A 1N55A 4EXAA 5I77A 2DUXA 3O16A 3ALGA 3LNPA 4AZ5A 3W37A 3PS7A 2GVYA 3R0UA 5BRQA 4WXZA 1YTEA 1ZAJA 4EWJA 1O60A 3UNDA 1LLZA 3HFYA 1BEUA 3GFYA 2WO5A 1H09A 1FHLA 1W1YA 1UYQA 4AEEA 4FO4A 4ERAA 3VGHA 4P8WA 1F07A 1RQHA 1XF0A 3O8AA 3TXVA 3CWNA 5DRCA 4AF0A 3E0FA 4J3VA 2E5DA 2MNRA 2XINA 3IACA 2OPJA 1RUSA 2FZBA 5FF7A 3ZM8A 3GKFA 3QGAC 4H00A 1QI3A 4DJDA 3MQTA 3TC7A 2VRJA 4ATWA 1SW0A 4Y2WA 5CXPA 4HP5A 4JQ3A 4PR4A 1QVBA 3MBFA 3S9ZA 1RR2A 1RK6A 3WL0A 4A3RA 1AJ2A 2ZE0A 3FDKA 1WNOA 1XDMA 3P7YA 3OBAA 1VC4A 2AL1A 4B9YA 4ZQPA 1R3QA 4HMDA 4H2CA 2Z2BA 3L4TA 1WDWA 1ZBCA 5DANA 4WD0A 3KCJA 1LRQA 4EOUA 4FLSA 4IP5A 2B4GA 2XYLA 4PTVA 3GDKA 1HKKA 1FH8A 2PMQA 1CBGA 4UQEA 3UGVA 3VVGA 3WQWA 4CD6A 3GHTA 1PPIA 1E5NA 3DFTA 1ECEA 1FBAA 1OABA 1P7TB 3GG8A 3WDJA 3AXIA 1MW2A 4F8XA 3DYMA 3WIJA 3M0HA 4UNIA 3FYPA 2DZTA 3EWCA 1QO2A 2WPGA 3WUBA 4D71A 3LCIA 3BSHA 3CWOX 3BWWA 3KWXA 1DORA 3OIHA 2CCRA 1B57A 1OGBA 2GOKA 2Y88A 3SCWA 1US0A 1HJSA 4O28A 4JIPA 3GBEA 2ZDRA 3F2BA 1ITCA 4WOQA 4QS5A 2XJ7A 3CNYA 1XICA 3IGSA 3PZQA 4DPQA 1J9YA 2YB1A 6A3HA 1XXXA 5BMXA 8A3HA 1B9ZA 1TJ0A 3MZ2A 4FX8A 4EAYA 2OXNA 3N9RA 1OFDA 1WOBA 4UWMA 4TVUA 3AAMA 2ZUUA 4HKPA 2WC4A 3QPEA 1ME8A 1EXPA 2WVTA 4WXYA 1E0VA 5D2WA 2D23A 4HHMA 4US5A 4JHMA 3E0LA 1G0CA 4LS2A 3OEXA 3GR8A 3GVVA 4H41A 1JZ7A 3ARQA 5G4EA 3GH4A 3PFRA 3RRAA 2YB4A 5D05A 1MQPA 3RX2A 1GOQA 3GU2A 3SUVA 4MNLA 3WLLA 1QBAA 3I3BA 4POCA 1TWWA 3LSCA 4HCDA 4R53A 3WMSA 1AL8A 3ZOAA 3W1PA 4RNJA 1H62A 1LM1A 1XBYA 1CGXA 3LM3A 3B0YA 1LG1A 2DVXA 3NQAA 4NZ4A 1EO7A 1E9YB 2J9YA 1C8XA 3E0IA 4P61A 4UFMA 4RV3A 2FIQA 5HJLA 3SSJA 1U5HA 4TX6A 4YYCA 1TA3A 2PGWA 1TPUA 2PTZA 1RJRA 3SRHA 3WLIA 2QUUA 3TVAA 3UG3A 4D8ZA 4GBDA 1FWSA 2KZHA 3ANYA 3FNDA 3A4XA 1XWYA 2UWFA 3GXPA 4YL2A 3WBAA 1GZGA 4AD4A 4MNJA 3MJMA 1T0OA 4K38A 5F2GA 4FOKA 2VR4A 1XHGA 3TTSA 4O57A 4KH2A 1V79A 2WC7A 2WMJA 3OHIA 4ZO6A 1IWPA 3ARRA 1V51A 3WCZA 1JZ8A 4MWAC 2BHYA 2FHCA 1QDSA 3STFA 2J7FA 4JTHA 2GWNA 2XFWA 3GIPA 1JVNA 1V02A 1LOSA 4RE0A 4MHBA 1KM3A 2IW0A 3WQ8A 3LOTA 4ZXLA 1QW7A 4A29A 4U28A 2GQ9A 5HMFA 4MB4A 3R5EA 1JDAA 3SY5A 3ZWSA 5DY2A 3OA5A 3BICA 3W2KA 3PBGA 3RPMA 3UCDA 3E2VA 3B97A 4GX9A 4YCOA 3ZXWA 4L6DA 4LJ3A 3BG9A 3IJ8A 3EXRA 2AQWA 4LAKA 2DZXA 2IKGA 3A9BA 1VEOA 1KM6A 3CK5A 3USBA 3EPNA 3R13A 4IHCA 1BVNP 4JS3A 4QGCA 3VNLA 4WQ6A 2Z00A 1F8IA 2VQUA 5FEPA 2VXNA 3F4WA 4G5DA 4D6IA 2OOFA 4FHAA 4AVOA 2ZRUA 1U1UA 1LRNA 1R3VA 2OLHA 4QFUA 3IIXA 4UTIA 2W0UA 1ONWA 1JUKA 1Q13A 1R3YA 3VNMA 1VFOA 2OELA 3CM4A 5D8ZA 4YN5A 4GIEA 3T0DA 1MRAA 2ZE3A 5EA9A 5CSRA 1FWWA 3LNMA 1E1CB 4M6UA 1SJCA 4MPKA 1YADA 1R86A 3G0XA 1AG1O 1PL9A 4LTSA 4B92A 3R79A 2R6OA 2Z6IA 8XIMA 5JMUA 1UQYA 1DQXA 4GJJA 1HT6A 5CLTA 3SBFA 5AHFA 1XLHA 5IFTA 5K4XA 3A9IA 3JZEA 2BBFA 4RDZA 4ADTA 5FSEC 3MSDA 1B2YA 4NXKA 1G9HA 3WN6A 2VDIA 2WNNA 3R0DA 1R7AA 3YPIA 1DKWA 2CLHA 2HEJA 1M04A 1JCNA 1MWOA 2B81A 2E1DA 4A3QA 3G3MA 3WD2A 2PWDA 1IGSA 1XI3A 1SJDA 1IR1A 1GYLA 4QDWA 2YOCA 2JBMA 4NAEB 3QKZA 1L8PA 1DWIM 4M3PA 4MNMA 5CKSA 1V0KA 3WJSA 2ZIDA 1NOWA 1LG2A 2OYKA 2JGQA 5E0FA 3N19B 1UD6A 4O8RA 2ZZ4A 1UA7A 2XU2A 2GL5A 5AHNA 1DHPA 2POTA 1SZGA 1KTCA 3W7KA 1TV7A 3P5ZA 2D3NA 2R24A 1XLLA 3G1FA 3GIYA 3IGUA 3PPGA 2J7CA 1GG0A 1CT5A 2VYOA 1P0KA 3H2MA 1M03A 1PWMA 4JX5A 4LALA 1MW0A 4PMUA 4N02A 2PDBA 4H6EA 2OEMA 2BVWA 3ICJA 2AKZA 2V0TA 3NZQA 4LBSA 1XYAA 4RXFA 4A8NA 3WH8A 3TTYA 1UWUA 4P8UA 3M41A 2CKSA 3N9SA 2YXOA 4LAUA 3MI3A 1FDZA 1JXJA 3IS4A 2LLEA 1K9TA 4Q32A 4GLEA 1F73A 2VUYA 4GFIA 1Q6EA 4NAFB 5CPOA 3GU1A 3VDHA 1AA1B 3VKJA 3CIWA 3NAVA 3HIJA 1P1XA 4OGZA 2DSKA 3VM7A 2QJGA 2WMFA 1DOSA 5BWAA 3DU0A 1OFAA 1W9XA 4MY1A 2NWRA 4NX5A 2WXDM 1S46A 4O0KA 3EOLA 1XD0A 2FVKA 3HGSA 3PZ9A 3TA9A 4H2HA 3S1XA 2OKTA 2QCGA 2R8WA 5U7SA 4L4OA 1Q66A 1HZYA 3NQFA 5I5RA 5D30A 2A79A 1XDLA 3EDJA 2DIKA 3CMJA 1S5WA 3LTPA 1Q7QA 3QN3A 3HM7A 2D1ZA 2V82A 1PTAA 1XIEA 2GJNA 1OK6A 4XBSA 3W4RA 1Z89A 2WLZA 1UD2A 4DJEA 3CUXA 4BI7A 4LYQA 2ISSA 1O7AA 3GZAA 3BDKA 4UQBA 4A4AA 4ALDA 1BGGA 1UKPA 2X2GA 4IM4A 1W2PA 4ASTA 4E2DA 2E28A 3CQHA 1OADA 2Q3RA 1SO5A 2EPMX 2GDUA 1KKRA 4W86A 7CGTA 2NQLA 5DMLA 2ZBTA 4Z1CA 2DH3A 4HPXA 3GSMA 3B9OA 4X63A 4PYSA 2GVEA 1ZBVA 4UTMA 3SFKA 4LYPA 4Y8FA 3ZT7A 4NVTA 1JQXA 2WW5A 1YTKA 4I9AA 3CUZA 1XCFA 3N6JA 1H50A 1L0PA 1OC5A 1M3UA 4LFYA 2ADAA 3KBSA 1AQHA 3KRBA 1TREA 3SQLA 3FSTA 2AAAA 5J5DA 5KZEA 3MW7A 2X16A 3BV7A 3AYVA 1WX0A 1TR1A 5D32A 1GJUA 3B0UX 3H55A 3PULA 1JZ6A 3AYSA 4F0MA 2WHLA 1EKOA 4DPPA 3FCPA 2C18A 2VEGA 4IX2A 1H0GA 2BXVA 2WANA 3AZSA 4QJ3B 5BXTA 5HNRA 1L2QA 4LANA 4TTGA 2BY3A 1VFFA 2G5WA 2GSEA 3SY1A 3V5FA 1EDGA 1NDVA 4J28A 4AUBA 3BVJA 2J8GA 4BQ4A 4J2PA 4Z1BA 4PMDA 1JPIA 3R10A 1EPXA 2NX1A 1OHLA 1H7OA 1IE7C 4M19A 2PTDA 2P3ZA 5C9UA 1D3HA 2TMDA 1XKJA 5C9ZA 4OJYA 3SCPA 3VIGA 1DQUA 3WD4A 4LGXA 3KRUA 2VELA 3B9AA 2J7EA 4XZIA 3VCNA 4YTRA 3VOCA 4GI8A 3S83A 4RJEA 1F7BA 4XO7A 3NEHA 4JKLA 4QAIA 4BR1A 4KETA 3WZ0E 2J8TA 2X1IA 3W27A 1E40A 4LAOA 4HMNA 3URAA 1I6NA 2G3MA 2IQ0A 1WYIA 1DE6A 2YR1A 3UESA 2VOTA 3M4HA 2QR6A 2WB5A 4ZOEA 4IL0A 1TMHA 2PRLA 4E2OA 2HROA 2CKRA 1KV5A 5CZSA 3AIBA 3ARUA 4ZODA 3N4FA 5CJMA 1YDNA 1HVQA 3L21A 4YCPA 1BRLA 4XO6A 4RX0A 1VKFA 1OFEA 4LV4A 3IAQA 3KS5A 3M5XA 4K8HA 3WELA 1AODA 3ZFHA 1AZ1A 3GU9A 2DUAA 3CGTA 3VIHA 4GMEA 3KL5A 4GWEA 2X40A 3DFYA 4W9TA 3FKKA 5HR7A 3W72A 3W84A 1U1JA 2ALRA 3GLCA 3EOEA 4UMAA 3UVIA 1LBFA 4N9DA 5FF0A 2UY3A 1W31A 5H8UA 2V5LA 4LV9A 3MHGA 4FNQA 1KBIA 3NURA 3UZWA 1E6XM 1JCJA 2P88A 1DWJM 1JFXA 1MI3A 5EMMA 4JTKA 3P62A 4DNHA 2KX9A 3ZVHB 4E3VA 3OG3A 1V3LA 3WUEA 3GIQA 1UJPA 4PEKA 3VIPA 1ZTVA 2D2HA 3AIWA 2E77A 2PAJA 3W23A 1A0CA 3RJYA 3M46A 3TLLA 2VCBA 5DT7A 4KT2A 3I3DA 5EY5A 4Q8QA 2GGHA 3NL5A 2WBGA 4XZNX 2V63A 4CUCA 4Z2JA 4K39A 5D03A 3W53A 4BWLA 1ZAIA 3H2FA 3KVMA 2H9AA 3E6EA 1RHCA 4F0RA 2YKKA 5LXXA 3DOPA 3PM6A 4DJDD 5GJPA 2V2HA 4V28A 2W92A 1UIPA 1UA3A 5LZLA 1TJPA 2AOSA 4NILA 3KRZA 3BQ6A 2JK2A 4MG4A 4L64A 3WL1A 1Q45A 4RDWA 1ADDA 1JPMA 2X1SA 3PZMA 2C91A 1HQTA 3EWBX 3U4AA 3BMVA 2OWCA 5REQB 3ITVA 1K3UA 2WZMA 3WDPP 4DN1A 3VGBA 2WWCA 3KBNA 3CUHA 5CZTA 2RFGA 2H6RA 3M7SA 2Y5SA 2ZZ1A 2XM2A 4W93A 3ITCA 5EBAA 1XFBA 4AD1A 4LVAA 3EWYA 1Q65A 1GQNA 3T1GA 2CIPA 2Z0IA 3THQA 1JNDA 2IKIA 5FJPA 1JCLA 4DVOA 4NASA 2YFNA 1CGVA 3UR5A 4FNSA 5HANA 3ATZA 3IGHX 4RKAA 5K3VA 3E5BA 1H41A 2HWGA 2IMRA 1XCWA 3EXSA 4Z0JA 1HN1A 2REQB 2PZNA 5FEZA 1XIBA 5FKYA 3K13A 4M0XA 5LGZA 4C1KA 4FZIA 2O9RA 3K1GA 4K7YA 4PCTA 4B5WA 1GONA 4W87A 2EEXA 4HOWA 2XIBA 3W02A 3N17A 4HTBA 4DJEC 3UQNA 3HJEA 1ICPA 5HULA 4GXPA 1VJZA 3GY1A 1T40A 4PRTA 3RX4A 4C90A 2PDGA 3MA8A 3RDKA 2P76A 3BZJA 5D9OA 1RV8A 3MHFA 4XKYB 3ONCA 4LW7A 1MZHA 3WNPA 1CPUA 1KQYA 2Y63A 2PDPA 3C0QA 4US5D 3W76A 3L2LA 4CU6A 3F2CA 3E9AA 2BS9A 4MLJA 4TOQA 4IMDA 1UZDA 5D2XA 5D9MA 4DQWA 5D09A 1M6JA 3PWIA 3O6DA 3QHNA 4F9DA 3C3NA 4DUOA 1FFQA 3KE0A 2HDJA 3RILA 1H5YA 4REQA 3GNNA 4GVGA 1Z3NA 1C93A 2XIOA 4ATDA 1TUXA 4J5NA 3B9EA 5CC5A 1A0DA 2WK2A 5BXSA 4HMEA 1J93A 5ABHA 1JPHA 3RPTA 2FGBA 4NIRA 3AU6A 1K9FA 4B4FA 2YCKX 1WDDA 4Y9MA 1IF2A 3PANA 3WDIA 3VMPA 4Q6XA 3DX5A 3W82A 1K7FA 4AD5A 1R9YA 5AHEA 4UTKA 3EKLA 4UTTC 1SYTA 1J18A 5G2HA 5G2IA 1XL9A 5CLWA 3VILA 1TZ7A 3KAOA 4JHZA 1THFD 2GVLA 2I1OA 1OG6A 2TAAA 3WMCA 5CJ5A 6REQA 3FLUA 1RCQA 4LB3A 4N42A 4AWTA 4B3ZA 3I4EA 2XFRA 4MWAE 2TSYA 2X0HA 4H8NA 5LNSA 4OQVA 8TIMA 2BG5A 4MAZA 3UZ5A 3AHYA 4ZQRA 3W2MA 3FKRA 3BV4A 1QW9A 2JIWA 2EKGA 2VGBA 2ALDA 3CHCA 3RCNA 4A2SA 2GJLA 3W1LA 3IUHA 2I57A 4HYRA 3TX9A 1EIXA 2ACQA 4HJFA 3BLDA 3TAOA 1ITUA 1XC6A 1G7VA 2A7RA 4MVAA 3WMBA 1IXNA 2GJXA 4UXDA 2VWTA 4GUFA 5HMSA 3AISA 3VCCA 5ENLA 2C7FA 5LXEA 1KM5A 1WAUA 4EPKA 2CPUA 1AJ0A 1OX4A 3TUUA 3UETA 1C9WA 2OSXA 3NO5A 4MWAB 3WQVA 4XZLX 2BOEX 4G6CA 4GUJA 5C5YA