3W73A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-129
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-129
rcsb
source organism Trypanosoma cruzi
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w73A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w73A01
3G1VA 4JTTA 4XKYA 4JYEA 3GLCA 2JKPA 3GR7A 4PFMA 2GVGA 1EP2A 5HUPA 4N6FA 4JS3A 2H3BA 3PG9A 3N34A 1F74A 2DP3A 4JTEA 4N02A 1R2TA 1O94A 3C2EA 5H2ZA 2QCEA 5LZLA 3TSBA 4FNRA 4UR8A 5EKYA 3P67A 4R7JA 3TXVA 1SZGA 3CIXA 1C8VA 1ME8A 3KRSA 2R91A 3W2LA 1QPRA 3W73A 1SFJA 2OJPA 4XWUA 3QW4B 3W9ZA 3WJYA 1T8XA 4O17A 2G95A 2V5BA 3VCRA 3Q94A 4GXMA 4CNPA 1H63A 1OFBA 1QR7A 4DO5A 3LCGA 5FI8A 2E6FA 1RV8A 1C9DA 5K4ZA 4Z1AA 2FFCA 4LY8A 2GUUA 3NQVA 3RLUA 3TQVA 3EB2A 4FIQA 3M1ZA 2E5CA 4K36A 3U2OA 4TIMA 1B3OA 2D73A 3R5EA 3IIZA 3HGJA 3L0KA 3S5YA 4XBSA 4GRSA 1VR6A 4ORMA 5I3JA 3W1AA 5K3VA 1FQ0A 1R30A 3MHGA 3FLUA 4IWWA 1QO5A 5ABTA 4MY8A 3T7VA 3TE9A 2ISVA 1FDZA 1FUYA 1VYSX 1DBTA 1TCDA 4JN6A 4PL2A 1IXPA 1QPQA 2A1YA 2GVJA 3ATYA 1I2OA 3O6YX 2A6LA 1RZMA 2PURA 5FESA 3DFTA 3NPWA 3W7NA 1OK4A 4P2VA 3NNTA 3P62A 1OFRA 3SY5A 1Q6OA 4O15A 4NZFA 2EF9A 2NXGA 3STGA 3KX6A 1X8FA 1KFJA 3JS3A 4AHPA 1TRIA 4NXSA 1OFDA 1SUXA 2QCDB 4MFDA 5LHFA 1B57A 3OVPA 1GVFA 3IV3A 4JD4A 2JGYA 1GVQA 1ZFJA 3UY7A 1OABA 3VE9A 3PB0A 2TMDA 1GVRA 1LRQA 3ANYA 4G1KA 2ZRXA 3LERA 4JYFA 3R8RA 1V5XA 2WV8A 4NVTA 3TR2A 2YW4A 4H6KA 5HWJA 2CLKA 4A29A 1M5WA 3GDMA 3TV8A 2PCQA 3CT7A 3G22A 3OBKA 2CU0A 1VQTA 1OX5A 5CZ0A 1CX9A 5KINA 3HGSA 1H51A 1PE1A 3E49A 4M19A 1LOQA 3UWWA 4YLWA 4Q4KA 2JKAA 3BGJA 1VRDA 2I9EA 1WAUA 1OVDA 4FX8A 3C6CA 3WK0A 1VZWA 3LM7A 1SQ7A 3UWUA 4O50A 5C5YA 1WX0A 2E6AA 3LI0A 5G5IA 4LT9A 5CG7A 1NAL1 3SJ3A 1VYRA 3A24A 3C0JA 3T40A 4DPQA 2CLEA 3CB8A 3W7JA 3PAJA 3P61A 2VFEA 1D3GA 2XFWA 4GNJA 1CI1A 2EAWA 3A5VA 3G3MA 4DF0A 4LUIA 1B4KA 4BF9A 1FWNA 1ALDA 4N4PA 3G1DA 4AAJA 8TIMA 3W2JA 4RXGA 5D38A 4E2DA 4X22A 4XUGA 2PRLA 2O7QA 1KFBA 3RLVA 4M6PA 4WY0A 3NPVA 4PC8A 4WUIA 1W37A 5CPNA 4XKYB 5K9XA 3QJAA 4QAIA 4DQWA 3USBA 3WFAA 3UY8A 3LHTA 2JGQA 2AGKA 4OU1A 2QAFA 1SU5A 4S2CA 5H91A 4O1AA 1UJPA 3MJYA 4FNTA 5D30A 4OE7A 3TUUA 2XN1A 3TNOA 4E0CA 1C29A 3GX9A 4TR9A 4A22A 1ZHAA 6TIMA 4NU7A 3W1LA 3PSVA 1LTDA 2H90A 4I7WA 4OHQA 1F76A 3EWXA 3W2KA 3L5LA 3UD6A 1GTHA 5D05A 2ZTJA 2NV1A 2HTMA 3P81A 2QDGA 5A8GA 2Y89A 1FDYA 4JY9A 4O28A 4JTJA 2A21A 1Z42A 3O05A 2NWRA 3GAYA 2V2HA 4QITA 1GJPA 5A5WA 1W54A 3MHUA 2YR1A 3FYPA 4IMGA 4UXDA 4D2JA 4YMZA 3UXAA 2DZUA 1KM2A 2RDUA 4UTUA 3CIWA 3UQNA 2CZEA 1T99A 2FB2A 3W1QA 5U7SA 2V8ZA 3M44A 4HPXA 3P74A 1JVNA 3MO7A 4PL1A 1YDNA 3MBDA 5KTLA 4DO6A 5D2VA 1HO1A 2GVLA 2QUVA 3S6DA 1GVOA 2ATMA 1MO0A 4FHAA 3HMJG 4IXXA 1PV8A 5DELA 3NZRA 2Z6IA 3NQAA 2Y85A 4M7SA 1ZAHA 3CEUA 1IXOA 1R46A 2JK2A 1WBJA 3DI1A 1THFD 4IPJA 4WOZA 1XL9A 3PY2A 4A3UA 1L9WA 2E09A 2ATSA 4NNCA 2GJLA 3DU0A 4C1KA 1XBVA 3S0CA 3SI9A 5E0KA 2ZRVA 4DXVA 1QO2A 2FB3A 2DJXA 1GEQA 3M6YA 1DL3A 1KM4A 4I7UA 3FS2A 2Y7FA 3G1XA 3UZJA 2ABBA 3B03A 3L5MA 4LNYA 2VFIA 2VELA 1H5YA 3P5ZA 3LGEA 4S1FA 5EY5A 4CLMA 3DFQA 4O16A 4HKPA 3ABRA 1NFBA 1ICSA 2C14A 3HGRA 3W7RA 2QJHA 2ZDRA 5DBUA 3VFLA 1UASA 1YPFA 2V81A 1AK5A 2VC6A 5AYXA 2J9XA 3MBFA 3MP4A 4R33A 1F5ZA 5HR7A 2ZYFA 2BLEA 3W83A 2DZSA 1PCKA 4DBEA 4IMEA 3NL5A 1IXNA 2C18A 2Y70A 5LGZA 3G1HA 2ISSA 2QDHA 3UWQA 4UMAA 3S5OA 2NXIA 5AYYA 3B0UX 3NDOA 3DBPA 3LCIA 3W1XA 3HJZA 3IIOA 2DJLA 4TX9A 1OYCA 1WDWA 3C2VA 2FDSA 3C56A 2R14A 3IVTA 1RPXA 2I14A 5AHNA 2Y7DA 1IIGA 1T0OA 1ICPA 4MPQA 4I7VA 3TFCA 4K38A 2HS8A 5LHEA 1QOQA 3F03K 3BLIA 4LV4A 3MP3A 3C2FA 5BNKA 3N19B 1VHCA 3KVKA 3FFSA 2TSYA 5BOOA 4EF9A 1O4UA 3VE7A 4YCOA 3NO5A 3P8JA 4IMDA 4N9CA 4FX7A 4HN4A 1YTEA 1Z44A 3LLFA 5D2WA 4Y6GA 2QCGA 5CPLA 1NVMA 1LM1A 4DPPA 5D2YA 1RQHA 4OGZA 4LVFA 2VEIA 1ME7A 3KVMA 3STFA 3R2GA 1UBSA 3N9RA 4O4WA 5AHMA 1OFEA 4WY0B 3OHIA 1OF6A 1AL8A 1I2NA 3NAVA 1JCMP 2QF7A 5DLCA 4HHPA 4WXYA 1F05A 5FEXA 1VS1A 2Q8LA 3BLEA 1HUVA 3LCWA 2RDWA 1VJIA 4GWEA 3NVTA 5G1TA 2OCZA 4UNLA 4UUIA 2EHHA 3EX1A 2V82A 2VEKA 3GYEA 1PS9A 2EPHA 2B7PA 3S8HA 1XBYA 1KBJA 4J9JA 1L6SA 3S42A 1MSSA 1N8FA 3EX3A 3LX9A 1IIHA 2JBMA 2EGZA 4O11A 3EWBX 1W3TA 3SR7A 1SW7A 1VYPX 2YGYA 1QMLA 5TIMA 4LVDA 3TJLA 4Z1BA 3L68A 2C1HA 5EPDA 5F4SA 1K8ZA 4WX2A 2Y6ZA 3IEBA 2B7NA 1MEIA 1K7XA 2WNNA 3LCXA 1A5AA 4O53A 1TPEA 1Q3NA 2NXHA 4JNMA 1EP1A 1KTNA 3OG3A 4BR1A 3PC0A 3R12A 1PVNA 4UTMA 1ZJIA 3O07A 2QCCA 1F6PA 1WV2A 1OFOA 1XCFA 5D03A 1A53A 1YPIA 5DCDA 1H7PA 1SZNA 3PBYA 2BX7A 4NT0A 1QFEA 3O6CA 2HS6A 1E51A 5C55A 1KM0A 1DJNA 3WJZA 1JRCA 5FEZA 1H7WA 4PCFA 1K8YA 2Z2UA 1GG1A 4N4QA 4B5NA 2OX1A 3ZS4A 1TV7A 3EXRA 5TBOA 3NL3A 3SECA 2X1UA 3L5AA 5D32A 3TMLA 2P10A 3FJ6A 4JTLA 4K8EA 2B7QA 4DELA 4LV9A 3CU2A 4JTUA 3DENA 3M5YA 2FPTA 4N2YA 4ZQNA 3PG8A 1KBIA 3ABSA 3E02A 4O52A 3W2UA 4KFPA 2QR6A 4WJEA 4BI5A 3Q37A 3C3NA 1X1OA 4A21A 4AMAA 4L4LA 5TQLA 1KLYA 5K2ZA 4MZ1A 3HG2A 4MOZA 1Q6QA 2TRSA 3A5FA 1EB3A 1VCFA 1VHNA 2E1DA 1H7XA 4UMCA 1FWSA 1LZOA 1QDSA 3NQ8A 4O8RA 3KOFA 2VOMA 3MWAA 3NL2A 3W70A 3N2MA 3NQCA 3BW2A 2R8WA 4JTKA 2ZA3A 2H8ZA 3NZ1A 4UFLA 1FCQA 1W5NA 1SR9A 3I7SA 4O1CA 1SFLA 3M43A 4YCPA 3HO8A 2YFNA 5FF3A 1X6UA 4ADTA 2WOQA 1WOAA 4A2SA 3W2NA 4K6AA 1TV8A 1G7VA 1KV8A 1JQVA 3DFSA 1DQWA 5D37A 1W8SA 2R94A 5FEPA 3U8GA 4JDBA 3ABQA 3IIXA 4IUOA 3QSRA 1EX5A 1ZY9A 3C2OA 5DN1A 3SIZA 4JTGA 1ZAIA 3DKLA 3GDLA 3SGUA 1SZFA 3S5ZA 3O6DA 4RK8A 2G97A 2EKCA 1W5OA 2ZFAA 4MUZA 3P82A 4RJEA 2HSAA 3H54A 3W88A 4FEZA 2OT1A 5E1QA 1WBHA 4EIVA 3ZR4A 1D9EA 3E9AA 1ZALA 2FTPA 4LS0A 2J6XA 3TSMA 2Z6JA 4O57A 4UTJA 3EX6A 4QSHA 3KHJA 5HMSA 1LCOA 2A7RA 4H4IA 3G3DA 3AJXA 2VEMA 2QCHA 4ADSA 3NQFA 4ALDA 1N7KA 4EVZA 1H61A 2VFGA 3LCFA 3M5VA 1W5QA 2ZZ4A 3RFAA 2VKZG 4UC5A 3H55A 5T26A 3DHDA 1DQXA 3UWZA 5AC6A 3CTLA 4R53A 1RD5A 5CZJA 2NX3A 2Y7EA 5CSRA 2GPTA 2V9DA 2NX9A 4QISA 3LHZA 2E6YA 3MHFA 1I8JA 3CHVA 3QYQA 4RZ6A 2YYUA 2G5WA 5DXXA 3RK8A 4JYDA 1LROA 1EEPA 5F2LA 2DZWA 3OA3A 2QCLA 4LWWA 4GUJA 3FIGA 2NUWA 3G1YA 1TV5A 3CC1A 1OYAA 1QCWA 4Q33A 3QMSA 5I3KA 1Q45A 5I3IA 4UFHA 1HFBA 3LDVA 1YDOA 4LVGA 4AEOA 3E0IA 3W86A 3KXQA 4MZYA 3M7WA 4HIBA 4Y8FA 1CW2A 5F2IA 4ZZ9A 4EWND 2J9ZA 4R34A 4ADUA 4AHOA 3TH6A 4GC4A 4O12A 1FWWA 2ZRYA 3IIPA 4GBUA 1TIMA 1JUKA 1TTPA 3GXPA 5AN7A 4CNOA 4XTIA 4KWVA 1AL7A 3NGJA 1FBAA 1IF2A 1EPXA 2FLIA 3M5ZA 1ZENA 5F4XA 2HMCA 3QEZA 4O19A 1MEWA 1YYAA 2QUTA 5DBTA 5KZMA 3LRMA 4FF7A 1K02A 2W0UA 3GXTA 1TTJA 3FA5A 3CEPA 1PIIA 2VFDA 3EWWA 3Q2DA 4ONVA 1LDCA 2QKFA 4O18A 3LHYA 4O1BA 5LNSA 5IBXA 1LORA 1OX6A 3W7PA 2P0OA 1FXQA 1JR1A 4PODA 3A22A 4GFSA 4DF1A 1KFLA 1GQNA 3BLFA 3W2MA 1ZNNA 2FJKA 1DV7A 4ORIA 2E77A 1Y0EA 3G0XA 3W7MA 5KZEA 1WXJA 2DZPA 3INPA 5FF0A 3G8RA 3HIJA 1NF0A 2YSWA 1ZCOA 1TPDA 2P1FA 1LBMA 1XKYA 2Y88A 4NNBA 4S2BA 4FXRA 5I3HA 5CPOA 2FPYA 1BWKA 4IX0A 4PA8A 1RQEA 3S1VA 1KM6A 5IBXC 3BARA 1YDVA 4LS1A 4UFMA 3TX9A 4RR4A 2QJIA 4OV9A 3PF3A 5DY2A 3TU9A 3WJWA 3WK1A 1YLVA 3TW6A 5LNUA 1P0NA 2UV8G 3PULA 1UCWA 2JKEA 4HNUA 4Y9AA 2GQ8A 2J88A 1O5KA 3JRKA 3IRDA 1G69A 4MLJA 3SW6A 4HNNA 1ZAJA 1O60A 4TO8A 4MZ8A 4KKXA 2CZ5A 4IGHA 4RZ5A 1JRBA 1SO5A 1TJPA 3PR2A 4Z08A 3LCLA 4MJMA 1FX6A 2CLFA 4NXKA 1KFEA 2FPVA 1FY6A 1BKSA 1OFPA 3MI6A 3LHWA 4GJ1A 2PRMA 3NG3A 4Q32A 3QPYA 5HJLA 1OHLA 3BV4A 5CZTA 1FCVA 3NM3A 4LC8A 4Z0SA 4AXKA 1PL9A 4WXZA 5EYWA 4JIQA 2VFFA 2BWGA 3W1MA 2X1RA 3FEMA 4FNUA 5KZDA 3QC3A 4DBDA 2YPIA 4UTHA 3T55A 1HG3A 2YDAA 3UPWA 3PVFA 1I2RA 3IGXA 3GKFA 3ZWSA 3P7YA 4K7YA 4C1LA 1F6KA 4U4MA 3BG9A 3PS7A 3RF9A 1X7FA 4FO4A 3GK0A 3TXZA 3EWZA 1AW5A 3UWYA 2NUXA 3U6WA 3PUEA 1SSDA 1BWLA 4RCXA 2WO5A 4Z1CA 3M41A 1QNVA 1YXYA 4LOCA 3GDKA 2LLEA 4OQVA 5D2XA 1A5SA 1ML1A 5HWMA 4O54A 4NZJA 2J9YA 2ZZ7A 3SSJA 2ZZ2A 2XN2A 4M5PA 1SSGA 3I7QA 4CCEA 3P80A 4JY8A 3SGZA 4IMCA 4X2RA 3VI2A 1VCGA 1GOXA 2PC4A 2V2DA 3P60A 4FX6M 2WKJA 1M6JA 1A5CA 3QFEA 2CLHA 3STCA 1ADOA 5J5DA 3TQ0A 3A9IA 1JCXA 3TCEA 3M5XA 4CQ9A 4K8HA 1S5VA 3NPUA 1KTCA 3EKZA 3PBWA 2X30A 3GKAA 2BTMA 4YL2A 5L6UA 1LRNA 1J2WA 3PBVA 4NJGA 3GNNA 2A6NA 4MVAA 1ONRA 2E68A 1SPQA 1S5TA 3GZ3A 5G2HA 2YFOA 2CLIA 3ZWTA 1B4EA 1RVGA 3THQA 1MZHA 3GNDA 1KTBA 3F4WA 4GUHA 2BZNA 3JR2A 4O0KA 4PH6A 3G18A 3FJLA 2V0TA 5KSWA 2GOUA 4N9DA 1AG1O 1FDJA 1UUMA 4O0ZA 2C6QA 3RMJA 5G2IA 3T78A 5FEWA 1YTKA 1OX4A 1TSIA 2NZLA 1KW1A 4K7VA 3S1WA 4HSNA 1GPWA 1M7OA 4RV8A 1JCNA 5CSSA 1G6CA 1XFBA 2VENA 2QEZA 3GVGA 3UNDA 1W1ZA 3NOEA 4H3DA 5HWNA 4AWTA 4IJBA 1F73A 4LUJA 2CZFA 2WNZA 2NX1A 5AHFA 1K7FA 1ME9A 4TU1A 4FB7A 2F84A 1KM5A 5G4EA 3NL6A 3TKFA 5EA9A 1OYBA 3B05A 3P8IA 5CZSA 1F7BA 1MXSA 1RR2A 2ZRUA 4AVFA 3W7QA 3STEA 5AYZA 2FIQA 3G0UA 1H7OA 1RQBA 3B04A 3L65A 5HUOA 3VNDA 3L67A 3ATZA 1H1YA 3A23A 4ZVJA 3S9YA 4K37A 1IGSA 4BK9A 3AO0A 2Y7GA 4UFIA 4JIPA 3G1SA 1TPVA 1K8XA 5BW6A 3CM4A 5D09A 2CZDA 3LXBA 1MEHA 1H60A 5L9FA 1H1ZA 3DKJA 3BG3A 1FWRA 1XBZA 1TRDA 1GTEA 4AWSA 2OMAA 1HTIA 1I2PA 1W3IA 2A7NA 2C16A 3W7CA 1YADA 4U28A 5BMXA 5HNRA 4UTWC 1U83A 1TTIA 3TAKA 2Y61A 3EX4A 3S1UA 1VC4A 3LHUA 4UMBA 3PBUA 4OT7A 1K03A 3V1PA 3WK2A 3W7KA 1VLIA 1VGAA 2OZ0A 2ZRWA 3R13A 1EIXA 2ZA2A 3M16A 2ZZ3A 3TK7A 4DF2A 1X1ZA 1EUNA 4Z1DA 3TFXA 1Q6LA 4LVAA 1DHPA 3MMTA 4M6QA 1WOBA 3EKLA 3HGOA 2A0NA 5D33A 2NUYA 2VXNA 4RX0A 4ZL1A 1XUUA 4OWGA 5U4NA 1WQ5A 5G4WA 1FCUA 2A7PA 3TAOA 4JTIA 1XDLA 3NQ7A 1AW2A 3DXIA 2C13A 1G4EA 3I7RA 3TQKA 3TA6A 2WSYA 3BO9A 3BG5A 5AHEA 1EA0A 2GJNA 1JCYA 2GQAA 4BWLC 5LNRA 1OFQA 3SFKA 1QOPA 4GUIA 1JQXA 3QH2A 3NPXA 5I3FA 5DCEA 2C19A 1KA9F 2DZXA 5F4WA 4JDYA 4ICNA 3NQGA 3DI0A 3GIYA 4JX4A 1L6WA 4N6EA 4PTNA 1G67A 5D2TA 1W5PA 3DFNA 3OVQA 3C4UA 2H8XA 3W7HA 3GXNA 3OEXA 1PHQA 3O15A 4DEFA 3NQ2A 4FNQA 1OFAA 1AMKA 1TQXA 3W75A 5AB3A 1U5JA 1J5TA 1GG0A 3ELFA 4NX0A 5EBUA 3LCHA 5K4XA 1LLZA 3L2IA 4LRSA 1Z48A 3LTSA 4IOTA 4WQ6A 1SW0A 2WJZA 4UFKA 2WPBA 2QUUA 4NUWA 3HOJA 2V30A 3QF0A 1TPUA 5E93A 3N9SA 5LGXA 5LKYA 4NJHA 1SW3A 4NJKA 3LTPA 3G1AA 2CLOA 7TIMA 4MYXA 3W7DA 3TSDA 3W84A 4JX5A 1G4SA 1SZEA 1FCBA 1TQJA 4OV4A 4BI7A 4KWWA 5G1YA 1V7YA 1VLWA 3LI1A 2Q3RA 4N9EA 1JCLA 3H53A 1OX4B 1H50A 3R89A 1LOLA 1TYGA 3C8FA 3GAKA 1XI3A 2RHGA 3I6RA 3NQMA 3UWVA 3UXDA 1JJKA 3KFTA 4QIUA 2QAPA 3ABOA 3F4NA 4K39A 2DZVA 2NLIA 1LYXA 4PEKA 5FF4A 1AW1A 1YXCA 3KVJA 4CCCA 4ZQMA 4LS2A 2VFHA 1JUEA 1TPWA 1TPC1 2GQ9A 4O14A 3LBMA 2CW6A 2E5BA 4Y96A 3W22A 3HPZA 3A21A 4AF0A 4RZ4A 1OF8A 1A50A 3LXCA 5C6MA 5AC8A 4CCDA 4UCGA 4JGDA 3L66A 4E2BA 3UYCA 2RH9A 1I4NA 1EWEA 3T44A 1LLWA 1KV5A 4QNEA 4NX5A 3MUXA 4ZMGA 5C2XA 1YTDA 4FXSA 1SO4A 2ZBTA 4UIOA 1DJQA 4WY0F 3G1FA 3EX2A 2X2GA 4JEQA 4ZQCA 3CWOX 3I68A 4GUFA 3B4UA 5HR6A 1GVSA 2X1TA 3B06A 2A2IA 5GVJA 3QRHA 1PHWA 4EF8A 2YX0A 1L2UA 2DORA 2A5HA 1P0KA 3DGRA 4MJZA 3MI3A 4UR7A 5AHIA 4UNKA 3L0NA 2WNQA 1H7NA 2YYTA 3BVJA 5BRBA 1DOSA 1YXDA 3V75A 2X1SA 1I2QA 3TMQA 3EXTA 4IX2A 3TC6A 3FYOA 3NR0A 4IMFA 4BI6A 3O16A 5BMWA 4W9TA 4GE8A 1HO4A 3L9CA 3QW3A 1VPXA 2W79A 4BFAA 2CFFA 2G96A 4I9AA 2BSLA 2C0AA 3TIMA 3KVLA 4IPIA 1KFCA 2WSQA 1XDMA 4MIMA 5FF7A 2C15A 4M7TA 2IQTA 3PM6A 5EMUA 1TPH1 1UUOA 1XBXA 3FKKA 1I45A 4GUGA 3M0ZA 4WOQA 4Z0JA 3QSTA 1T96A 1QWGA 1TPB1 5CGQA 1FWTA 2YXGA 4JICA 2Q8ZA 5IM51 1FXPA 1NF7A 3CLMA 3DHFA 4FIRA 4ZQOA 3W1NA 3EEGA 2PE4A 4RLIA 4M6VA 3LRLA 3NQEA 1PCWA 1QPOA 2ZZ1A 2YZRA 1WA3A 4KFOA 3L0GA 4NQ1A 2ABAA 3NM1A 1OG0A 2NV2A 3VKJA 3W87A 3N2XA 3Q58A 2Y63A 3BW4A 4FNSA 5C54A 4RKAA 4N9BA 4HNTA 2WSRA 3LHVA 3WJSA 5D04C 3IVSA 4EOUA 4LTSA 2RKXA 1TREA 3O1NA 4E38A 3HG5A 1Q6RA 3PWAA 2TPSA 3C2RA 1DORA 4QQ3A 3PB2A 3BPWA 1P5BA 3N3MA 4A2RA 4JTSA 3F1QA 4HSOA 5EL1A 1GT8A 1SO6A 6ALDA 5KITA 2ISWA 5J5RA 3HQ1A 1W56A 4QM1A 2CWNA 4XQ6A 3LV6A 5K9CA 1TTQA 1DVJA 4HPJA 2ZA1A 4IQLA 4AHQA 5AC7A 5F1UA 1W31A 1XUZA 5F2MA 2B7OA 1B9BA 3TW7A 1TO3A 2ALDA 1GYLA 4XBKA 1EWDA 4RXFA 2I1OA 2VEPA 3CQ0A 4ZQRA 1KM1A 1O5XA 3TJXA 3MYOA 2Q3OA 3CPRA 2H6RA 1TB3A 2DU2A 3W7LA 4P61A 1K7EA 5HQEA 3SZ8A 3HBLA 1W0MA 1Z41A 2A4AA 3O06A 3G0SA 5SWUA 3MP5A 4LC6A 5LNWA 2ZCGA 4UTTA 5DCBA 3IGUA 3D0CA 4AF0B 4O13A 1KLZA 1QPNA 3ZFHA 1K3UA 3K30A 4O4VA 2KZHA 5K7JA 4QJ1A 3P84A 1OJXA 3LLDA 1A5BA 1IXQA 5I3GA 1S3HA 1GYNA 3W6YA 1EP3A 2WQPA 3DZ1A 3W7EA 3NEVA 1JCJA 2B0MA 3NXFA 4CQ8A 2V5LA 5LNVA 3LXAA 3KRZA 4YXGA 2H3DA 3G8EA 1G7UA 1GZGA 2ZZ6A 1LOSA 3HB9A 1KFKA 2ZRZA 1H7RA 4MY1A 2A85A 4UTTC 3LV5A 2E6DA 1P4CA 4AB4A 3EWYA 3PUOA 4LRTA 4UFJA 3GR8A 3W07A 1JULA 1W5MA 3G24A 3O63A 2CLLA 4AWUA 3IIVA 3W71A 2RDTA 3GB6A 1TMHA 3BGGA 4AH7A 4LW7A 2J24A 4POCA 2W6RA 4L4MA 1GWJA 4YWIA 3E96A 5D02A 5K9DA 4XTDA 3HPXA 2QCNA 4NJIA 1F2JA 3OVRA 3PUDA 1G4PA 3I65A 3W7OA 4O1DA 2FQIA 4JTFA 4TMBA 1XM3A 1N55A 4CNNA 4UTKA 3W1TA 2YW3A 4HT3A 4QNWA 3BW3A 1L6YA 2ZZ5A 1M7PA 3UPBA 5AOUA 5HULA 4HNVA 1R2RA 1VCVA 3QQ0A 4JR5A 4LU0A 1WYIA 2ZTKA 1LRTA 2J27A 4WZHA 3MYPA 1DKWA 2O7SA 2Z1BA 4ML9A 3T4CA 3OIXA 5G2WA 1BTMA 3W3OA 1TPFA 5MHBA 3W23A 1SO3A 2E5DA 3HG4A 3M47A 3W1RA 2Z0IA 1OK6A 3FKRA 3NQDA 4OBTA 5AHLA 4MYAA 4KFNA 3M9YA 1G4TA 3W74A 3NA8A 3HF3A 3W1UA 4UTWA 3TDFA 2QJGA 4UTLA 4FNPA 3UZ5A 3TC7A 5LSMA 3HG3A 4NNAA 1P1XA 4X9SA 2NWSA 3KAOA 3LRKA 1ICQA 5DY3A 3KRUA 1KM3A 3EXSA 3E12A 4CQAA 3W1PA 1D3HA 2TYSA 1XXXA 3O8AA 3MW7A 4UTIA 3QM3A 3LBCA 2PRHA 1R2SA 3RNDA 2AAMA 4LVBA 2XN0A 5AFDA 2QCDA 3GDTA 4ZQPA 3MI2A 2BXVA 3L21A 3C52A 2AQWA 5FF2A 3TROA 3LB0A 1S5WA 4NJJA 2Y62A 1BEUA 4MLRA 3EWUA 3C61A 3DH7A 3NQ6A 5F2GA 2QCFA 5F1VA 5CKSA 1VH7A 4WD0A 3DAQA 3IVUA 3N14A 1NEYA 3B0PA 1LBFA 3NYZA 3DFPA 3GDRA 5CPMA 3QQ1A 5HINA 4O10A 4BWLA 2B4GA 2CLMA 1W3NA 1EUAA 4Y90A 4TMCA 2X16A 3IGSA 4DO4A 3S5NA 1UB3A 1HL2A 3LOTA 3W76A 2RFGA 1LBLA 3PSWA 3W85A 1QAPA 5DXYA 4X3ZA 2C3ZA 1TJRA 3QZEA 4IXHA 5KMYA 3HPSA 3CWNA 3W7GA 4XZ9A 1NSJA 3QMRA 3B8DA 3THAA 4JX6A 4MFEA 3WJXA 1J4EA 4MY9A 3YPIA 3WK3A 1XC4A 3N73A 3FOKA 1H62A 1JUBA 3P5YA 3RU6A 4JXCA 4JTHA 1O95A 4MKNA 3S1XA 2ZQ0A 3W72A 2DZTA 3W7IA 3B0VC 1R47A 1LP6A 3QPZA 3BK0A 2QCMA 3LTYA 2OT0A 3DFOA 2F7FA 2YCEA 2V2CA 3QMTA
chains in the Genus database with same CATH superfamily
4JTTA 3BCFA 4DJDA 2ZVIA 3CPGA 2D69A 4C6JA 2TAAA 3QV6A 5HUPA 4DRSA 3XIMA 1YMYA 1F74A 3OQEA 3TTQA 1O94A 3C2EA 1EZ2A 1H1NA 3U4FA 3KDOA 4XSLA 1WO2A 3QXBA 4RV3A 5EKYA 3L4WA 3XISA 3A13A 5DMMA 1OWQA 3T08A 2BGQA 1SZGA 3CV1A 3BURA 1C8VA 4XZIA 2JIWA 3L2LA 1FP9A 4TTGA 3WQWA 3W2LA 1QPRA 2WMKA 1SFJA 3W9ZA 3QW4B 4HU3A 4O17A 5HNTA 4KS0A 4PUNA 1J0ZA 3SURA 2VGFA 1U33A 1OFBA 2NVAA 4KERA 5GJMA 2F2HA 3COTA 1R3VA 4H04A 4LY8A 2BY2A 2Q71A 3VDBA 4BKNA 1WKFA 3EB2A 1MZRA 3PZOA 3L2MA 6A3HA 4QXIA 5HK4A 4MNKA 2E5CA 1JZ3A 4HU4A 4M82A 3VZZA 1YQ2A 3P14A 3HGJA 3QPEA 2O9TA 1XINA 4ORMA 3BAXA 4ZOAA 4HTBA 3MZNA 2HDJA 2E4TA 5BXTA 4M29A 5T91A 4OZOA 3OJGA 4FR6A 1FDZA 4BQ5A 1FUYA 3URQA 1DYSA 4PL2A 4ATWA 3GH7A 2OOGA 3HN3A 2GVJA 2REQA 3NPWA 3W7NA 1I6NA 4P2VA 1OFRA 2CLPA 3SY5A 1OY0A 1Q6OA 5C9WA 2ZX8A 4PCTA 2EF9A 1KFJA 4QSFA 3RPMA 3QR1A 5LHFA 1GVFA 3V36A 1ZFJA 2XISA 4GYPA 5CZKA 3VE9A 2TMDA 1LRQA 3LERA 4JYFA 3R8RA 4NVTA 5DF0A 3R0DA 4H6KA 1W3HA 1O5QA 4NI3A 3ZJ8A 3AMCA 1C93A 1M41A 1CX9A 4DI9A 3ARXA 1CWYA 4WF7A 1LOQA 3IJ9A 3GY1A 1OADA 1A80A 4Q4KA 4Q8NA 4IIGA 2Y24A 5DO8A 1VRDA 1OVDA 3WK0A 2OGYA 3LM7A 1SQ7A 1W1VA 4LT9A 3VM7A 4FLSA 4PBFA 1OQFA 4M1RA 4GI9A 4LF1A 3HFYA 2YA2A 3CUXA 5CPSA 3C0JA 1EDTA 3T40A 2Z1KA 3S46A 3W7JA 4IQEA 1D3GA 4A3QA 1VFHA 3B8TA 4R5EA 4CU8A 4GNJA 3UNTA 2EAWA 3A5VA 3G3MA 3VIGA 4OTKA 1BYCA 4LUIA 3G5EA 3QR0A 4N4PA 3G1DA 3ZT6A 2DPEA 8TIMA 2VL4A 4RXGA 4B2DA 4HHLA 4DM2A 4XUGA 3APGA 4HMEA 3RLVA 5E70A 2J8GA 4TQTA 3NPVA 4WUIA 3ZLGA 3ES7A 5KEZA 4RE3A 3N25A 3USBA 1EOKA 4DLMA 2JGQA 1KRCC 3OU8A 3K4AA 2PF0A 4FNTA 1OIMA 1QUMA 3EOUA 5M2FX 2XDFA 4REQA 4YU1A 1RLCL 1O66A 1C29A 4E0CA 3H2OA 4DYEA 1XLMA 3CQIA 3QOMA 3CJPA 1BG4A 7REQB 2INEA 1ITXA 1CGVA 1EA9C 3RGTA 3AIUA 4PB5A 3P81A 3B3DA 3GTNA 1KCLA 1EZWA 4LAKA 1FDYA 4JY9A 1VFMA 4JTJA 2A21A 1Z42A 3GAYA 2V2HA 4DZHA 4LAZA 5A5WA 4A4AA 2CKRA 2YR1A 3FYPA 1S3TC 1HF6A 4EPBC 1WZLA 3UXAA 3HJEA 1ECQA 1LT7A 3MCNA 2D2GA 4LAMA 3UQNA 2FB2A 1FWEC 2V8ZA 3KBJA 3M44A 3PNZA 4XB3A 2UZ9A 3AMKA 1JVNA 5ABFA 4DO6A 3H26A 5M3WA 1HO1A 2QUVA 4HNCA 4IF2A 3EDJA 3V18A 4D8ZA 4FHAA 1DJHA 5C2GA 1WXZA 3P0XA 1SZRA 2Y5SA 3GBEA 1FHLA 3CEUA 1WBJA 4IPJA 3K8MA 2J7FA 2JEQA 1XL9A 3PY2A 2E09A 4NNCA 2GJLA 1QO2A 2FB3A 2JIEA 4IL0A 1KM4A 4PTDA 4W85A 3RCMA 3UZJA 1F3XA 1OCNA 2OLHA 2VFIA 1H5YA 3P5ZA 4QGCA 5EY5A 4HYVA 2NVDA 4F0KA 4HKPA 3K1GA 1NFBA 2VDHA 4ZBCA 3I3EA 2ZDRA 1AMYA 1IWBA 3DFHA 1YPFA 1MNSA 1AK5A 4MB3A 2GJRA 4BS0A 4R33A 1F5ZA 4HMDA 2BLEA 1R8LA 4IMEA 3NL5A 4E4PA 1CXFA 2C18A 2Y70A 5LGZA 2QDHA 2WZIA 3S5OA 4PMOA 4DUVA 5CBBA 3QTGA 2I56A 1GEHA 4GJIA 1DHKA 3DBPA 3VILA 3UJ2A 2VR4A 3WLKX 2ZWYA 3E2RA 3N4AA 3UERA 3WCZA 5JH2A 1WDWA 3C2VA 2BXYA 2I14A 2Y7DA 2FDMA 3R0UA 1IIGA 1ICPA 1BD0A 3VOHA 3VGBA 1EPVA 1A0DA 5BOEA 1EYWA 5I3DA 4LV4A 4FAMA 3N19B 1VHCA 2PDKA 3W6LA 3KVKA 4IGNA 5BXPA 4EF9A 3VE7A 4YCOA 3NO5A 1Q8JA 1MQQA 2HBVA 3AYRA 4S3DA 1QNSA 4D6EA 4L1WA 1M3UA 4F4RA 3GU2A 4KRZA 2QUMA 3KVMA 2O0TA 1UBSA 4E2OA 3OHIA 4HNOA 1I2NA 3NAVA 1T8QA 4NP7A 3VDHA 1CDGA 1OC6A 2R82A 2QPUA 4HHPA 5FEXA 1BF2A 2VX5A 3VD9A 5I77A 2YCLA 1VJIA 4QCEA 4GVFA 4GI6A 5G1TA 2OWCA 1FWAC 1V4YA 4AFYA 2EHHA 1XRFA 3EX1A 3GYEA 1PS9A 3L12A 4CN1A 3EX3A 4FLOA 1IIHA 1QU4A 2O92A 1EBGA 1VYPX 4HPHA 3W38A 4LVDA 1YBQB 1E70M 1YEYA 3TN6A 1OT2A 5F4SA 2CYGA 1DWFM 4WX2A 4AIBA 2GK1B 1S46A 2Y6ZA 3IEBA 1D7FA 1MEIA 1K7XA 3LCXA 1TPEA 4MWAE 1Q3NA 5E6YA 5C9ZA 4QS6A 4IUGA 1PVNA 1UBPC 3O07A 1F6PA 1WV2A 1OFOA 1XCFA 2J7BA 4GC3A 4C6EA 3S9ZA 1A53A 5DCDA 4B4HA 2WMFA 1QFEA 1BWVA 1E55A 4OOZA 3SRFA 1E51A 5FL1A 1KM0A 3WJZA 2PP0A 5CJ5A 1H7WA 1HKIA 1K8YA 3NIYA 4XAGA 4AX6A 4IISA 1E9ZB 3ZS4A 1TV7A 3CNYA 4Y8EA 3BE7A 2X1UA 3L5AA 2DZBA 1ZU8A 1LL7A 1E73M 3TMLA 4K8EA 4LV9A 1EC8A 3DENA 2AKZA 2FPTA 4KGJA 1LG1A 4A05A 3MUY1 3PG8A 4O52A 4RDVA 3W2UA 3PFMA 3Q37A 4JCMA 1M53A 4A21A 1JYWA 3D3FA 2VD9A 4AMAA 2PDPA 5TQLA 5K2ZA 3P6LA 1KWGA 2A3CA 4MZ1A 4BF7A 2DT2A 2TRSA 4MGGA 1VHNA 3ITVA 1H7XA 3ARWA 2DW6A 3NQ8A 4O8RA 3RCNA 3N2MA 3NFUA 1DJWA 1OBAA 1GVEA 3RRXA 2R8WA 3P3BA 2J62A 4GI4A 2ZA3A 4B3ZA 1W5NA 4MAZA 1SR9A 4O1CA 3MU7A 1UA3A 3PTMA 1OM0A 2YFNA 1X6UA 3C3UA 3GQYA 4ADTA 2WOQA 2FGBA 4A2SA 1KGWA 4CVWA 4B15A 3BZJA 5BROA 1U1HA 5ABGA 3M0YA 1XLIA 5D37A 1UC5A 2AMGA 5FEPA 3PZVA 3WQ5A 4OECA 3QSRA 1CXIA 1XG3A 3LSCA 1TX0A 2GUBA 1ZAIA 5FAGA 1FWBC 3DKLA 1UH2A 3S5ZA 4GNKB 3HPAA 1W5OA 3NTYA 4RJEA 3H54A 2OT1A 2PDNA 1VIWA 3T6CA 2X41A 2HE5A 2V3DA 2FTPA 2J6XA 1LT8A 4DUOA 2Z6JA 2OX4A 4H83A 1PWMA 3S9IA 4JIRA 2HNHA 4C5YA 4H4IA 4AEEA 1TE6A 3AZTA 2DDXA 3QZ6A 3B9DA 2VEMA 1A5KC 1WDPA 3RM9A 1H61A 2ZXAA 1EBHA 1EXBA 3M5VA 1W5QA 2GJPA 2GSHA 3HU7A 3WL1A 2WLZA 4R53A 1RVKA 1E0TA 2ZE0A 3BANA 2Q8XA 4RZ6A 3P93A 2YYUA 2OSWA 3T81A 1W2PA 2UY5A 2QCLA 2PDMA 3RXZA 3UR8A 1TV5A 4DLFA 1UMYA 2GGEA 1SFSA 1XX1A 3UCDA 2DSVA 3EMCA 2VC7A 3ARUA 5I3IA 1UZDA 4UFHA 4XZHA 4AEOA 2Z2BA 3W86A 4ZTYA 1M01A 4Y8FA 3KL0A 5F2IA 2ZICA 2J9ZA 2BVYA 4O12A 2ZRYA 4GBUA 1TTPA 3IJLA 4GIYA 4CNOA 1GORA 1TELA 2BBFA 1B3WA 2O9PA 4O19A 4H9YA 1JL8A 4B90A 1YYAA 2MUCA 3LRMA 1K02A 3GXTA 1TTJA 4GVIA 3CEPA 1PIIA 3IS4A 2G37A 4O1BA 1GKQA 1ITCA 1FXQA 3UR7A 1UKSA 4F0MA 4PODA 6XIAA 4DF1A 3BLDA 2E1WA 3EDFA 3W2MA 3G0XA 2VMFA 3AMLA 2DUZA 1NF0A 3N15A 2BGNE 2VDIA 4FALA 4JOMA 2FPYA 1Q7ZA 2A3EA 2J4GA 3WNLA 1EGZA 3UG5A 1KM6A 4F9DA 4FOUA 2AMXA 3S2NA 4F2TA 4JL2A 3BJFA 2QJIA 3PF3A 5DY2A 1QBBA 3WK1A 1P0NA 5J8LA 2EPLX 4HNUA 4ZENA 2OODA 2DUXA 3A6OA 3IARA 3M0XA 2NVCA 3QYSA 5DANA 1G69A 2OR2A 1ZJAA 3HMCA 4HNNA 2ZXQA 1MUWA 4MZ8A 1DJZA 4KKXA 4YTRA 2CZ5A 4Q8VA 2MNRA 3PPGA 5I02A 3NO3A 4C6CA 5IXEA 4JL1A 2OLAA 1BKSA 1EHAA 1OFPA 4GJ1A 2OZ8A 2PRMA 3QPYA 5HJLA 1OHLA 1RALA 3IUIA 3VNJA 3BV4A 4ILSA 5A94A 1PL9A 4WDTA 5EYWA 3KOWA 3FEMA 4FNUA 2QYGA 2YPIA 3AHXA 3ID7A 4D72A 2ON3A 4MNLA 1P7TB 2G4FA 4CNUA 2YDAA 3IGXA 3T0AA 2RJHA 3WMLA 3ZWSA 2DT3A 4WSKA 3RF9A 1MUCA 1X7FA 1N8IA 3KP0A 4XX6A 4DIAA 1AW5A 3UWYA 1YW1A 2NUXA 4IMAA 1JPDX 3M41A 3UJFA 1NDZA 5I06A 5CGMA 1CT5A 4XK2A 1JI2A 4KIRA 3PZIA 2ZZ7A 3F4CA 4RW3A 1R3YA 1YHTA 1UP0A 3AOFA 4M5PA 4H6EA 4GINA 4WGXA 4JY8A 3E5PA 3H4XA 2R1LA 1M6JA 3H2MA 1J11A 3GIPA 3QFEA 3MV01 4EKJA 2WKLA 1XF0A 5I2UA 3TQ0A 1S39A 1JCXA 3SO7A 4CQ9A 2J77A 2XHYA 2BHYA 1XGDA 3PBWA 4ZO6A 3JVAA 3GNNA 2ZUSA 4GIAA 1E72M 2PWVA 2CLIA 3MUCA 3TYZA 1B4EA 1RVGA 1MZHA 1X6NA 5AZ0A 4O0KA 1GOKA 4PH6A 2XUCA 4P5UA 3SUUA 2XJ7A 1FWFC 4N9DA 1FDJA 1W9PA 2QIIA 3ZT5A 3SUTA 3KOZA 3WH8A 2VR5A 5ABHA 3U5UA 5T8GA 2VEGA 4KEMA 1CXHA 1M7OA 1UPMB 1QNQA 2VENA 4Q6JA 4WDXA 1W1ZA 2NV9A 1CGTA 4HZMA 2ZXDA 3CO8A 5HDRA 2NX1A 4GYKA 5AHFA 1K7FA 4F0SA 4D6CA 1ME9A 4TU1A 1F3WA 4Q22A 3E2VA 4KCTA 5EA9A 1OYBA 4I5XA 3URBA 1V3IA 2BP1A 5CZSA 1F7BA 4AD2A 1MXSA 2V3EA 5AYZA 2FIQA 4GACA 1RQBA 3ZVHB 5HUOA 1WKDA 1W3LA 3L67A 3ATZA 4K37A 1IGSA 4UFIA 3CXOA 2PDBA 2Z1XA 3G1SA 3L23A 3EOEA 1K8XA 4HPNA 1S2VA 4YS1A 4MJ4A 3CS2A 1H60A 5L9FA 3ABZA 3BG3A 3DN5A 2BY1A 1GTEA 5E5CA 2OMAA 4IHCA 1W3IA 3TCSA 4E8GA 2GSEA 1BFNA 1GW9A 4U28A 1E6SM 2AL2A 2HISA 1P6WA 1TTIA 4QR6A 1VC4A 1EDGA 1VJSA 3V1PA 1K03A 4AZIA 3WK2A 5CAHA 3R13A 3CUGA 4GX8A 4HCLA 3M16A 2BMBA 3S2CA 3TK7A 1EUNA 1DHPA 3MMTA 1TFVA 2WHJA 2ISDA 4NG3A 1JGIA 1KR1A 2VXNA 1R3QA 5U4NA 1O7AA 4GQBA 4ML4A 1XDLA 2NSOA 1J93A 1G4EA 1Y7VA 3MPGA 4GGHA 4R7OA 3TQKA 3TA6A 2WSYA 4Q8QA 2GJNA 5LNRA 1OFQA 1QOPA 4GUIA 4KWSA 3QH2A 1GJUA 2C19A 2XFRA 4JDYA 1DE6A 2WMJA 4LSBA 3GIYA 3GU9A 3AMGA 4N6EA 1RP8A 3RILA 1EJXC 2CC0A 2Z24A 1WXYA 3C4UA 2H8XA 2OYKA 2EEXA 1PHQA 3G6MA 1OFAA 1H0IA 1TQXA 2WYSA 1J5TA 2CETA 3ELFA 3OYXA 5K4XA 1LLZA 1X39A 4LRSA 4L80A 4G6CA 3B4YA 1X1NA 2ODOA 3QQWA 4UFKA 2WPBA 3QF0A 1TPUA 1V08A 3N9SA 4X0NA 1V3KA 3LTPA 2WVSA 4B5UA 4JX5A 2W3ZA 1G4SA 4GX9A 4KWWA 3LMYA 5G1YA 3KEHA 1HL8A 1V7YA 3LI1A 4N9EA 1JCLA 3EAUA 1TYGA 3GAKA 1TMQA 2XIOA 3OLGA 4J35A 1K70A 3FW6A 3ABOA 3H8AA 5IOBA 1B30A 4K39A 2DZVA 2NLIA 2I5QA 4PEKA 5FF4A 1AW1A 1UPPA 1YXCA 4CCCA 4ZQMA 2DIEA 3QKZA 2CW6A 3T0DA 4GQQA 4RZ4A 4XV0A 1QOXA 1CIUA 3ZQ9A 1V6XA 3LZ3A 4CCDA 3T1GA 4E2BA 2RH9A 1UUQA 3ME3A 2VGBA 1E3ZA 4B16A 3T44A 2PGWA 3AISA 1PZ2A 2CEQA 2RAGA 4NX5A 4OFCA 5C2XA 4WCJA 2X2GA 3MMWA 1FH8A 2Z4GA 1B3YA 3RYSA 5HR6A 5GVJA 2QVHA 1PHWA 4J28A 4US5A 2PP1A 2YX0A 1JIBA 1UR9A 2DORA 3HFTA 1P0KA 3DGRA 3MI3A 5AHIA 3L0NA 3AHYA 5BRBA 2OEJA 2Z7GA 1YXDA 3V75A 3NSNA 4Q8UA 3EXTA 1AZ2A 4BI6A 1XIHA 4L9XA 4JCLA 4DBWA 1Q2SA 4W9TA 1RJQA 1HO4A 2W79A 2EPKX 5A95A 2CFFA 4NAFB 2G96A 2BSLA 1I75A 3HURA 1TZ7A 1Z6KA 2C0AA 2INFA 3VFCA 5FJIA 1KFCA 2WSQA 1XDMA 1UIOA 1S1RA 5FF7A 4M7TA 3HQNA 2J7EA 3PM6A 4GI8A 4JIEA 1M7XA 5C9RA 1M9HA 3UJEA 1SJDA 1UUOA 2FZBA 1XBXA 3FKKA 1I45A 1I1WA 2W5FA 2CHNA 1K4HA 3QSTA 3I6EA 3PN8A 1CEOA 1T96A 1QWGA 2PODA 3LZ5A 3R94A 5GQBA 4KRTA 2BV9A 4L6OA 1XSIA 8XIAA 3QHMA 3VKAA 4AD3A 3QY6A 3VIMA 1CGYA 3N2OA 1HQTA 1MFVA 1VPYA 2PE4A 4GCXA 3TYCA 4EAYA 3GM8A 1IEXA 1KD0A 1WA3A 4KFOA 4QJ5B 4X61A 3MUZ1 1DP0A 1DTUA 4CD5A 4JTRA 3W87A 1QWKA 3BW4A 4LTSA 1S2CA 7CGTA 4E38A 4DUWA 1SJBA 3I4KA 1JYNA 1Q6RA 1LL4A 4MMWA 1Q13A 3PZMA 1DORA 1DJYA 2WMGA 5TD4A 3BPWA 5CJNA 1AD1A 4HSOA 5EL1A 6ALDA 1EYEA 2ISWA 5J5RA 3S4TA 2DQWA 4QM1A 4XQ6A 4V15A 3NZPA 1QVBA 4D6IA 1J6PA 4O8AA 3CAWA 1CXLA 2ZOXA 4HPJA 2ZA1A 4IQLA 4AHQA 5AC7A 2JFEX 1XUZA 5F2MA 2B7OA 3ITCA 4GABA 1R9YA 4FOKA 4P8UA 3VGGA 1WZMA 3SJNA 1OGBA 2Q3OA 2YDRA 3VIOA 1NOUA 1ISZA 1QW9A 3W7LA 1AH4A 3KL3A 4P61A 3KM8A 4RNFA 1ISXA 3W37A 2E40A 4DHGA 1W0MA 4TX6A 4ZO7A 5SWUA 5I00A 4JHMA 2WBKA 3U9IA 1E1FA 4Z2IA 4S3BA 3H2EA 1NFGA 1UKTA 1JXJA 2KZHA 1P0BA 4QJ1A 3BICA 1CGXA 1A5BA 1IXQA 4WLCA 2HXTA 2EJ1A 4I9TA 4OBSA 2X1IA 1JCJA 2B0MA 1J96A 3NXFA 1Q8AA 4GQRA 4CQ8A 2D3LA 4XD4A 2DGAA 3WMBA 5D8ZA 4RL3A 1H5VA 3HB9A 1A5OC 2ZRZA 4GIEA 1GZJA 3LV5A 3S47A 4LRTA 3VKDA 4UFJA 1BG9A 5CGTA 5BU6A 4C65A 1UKQA 1W5MA 2YDQA 1FHVA 4PRTA 4EPDC 2QPSA 1V3JA 1E3XA 3QN3A 5LA0A 2RDTA 4H9TA 3KBWA 2J24A 2W67A 4NAEB 2VT0A 3LUTA 3OODA 4YWIA 3E96A 3EDDA 4D71A 4CNTA 4IP5A 3AIRA 3Q65A 2A3LA 3KBVA 2QCNA 2G3IA 4NJIA 2XG9A 5H6HA 3DGBA 4XZNX 1B90A 2FQIA 4JTFA 1XLJA 4CNNA 4PMNA 3W4RA 1W1B1 3BW3A 3UPBA 5AOUA 5HULA 4HNVA 1SMDA 1XRTA 3QQ0A 4JR5A 4PUDA 3LBOA 1Q7MA 4WZHA 3MYPA 5I79A 4NIRA 3AHVA 2VCBA 1IYXA 3UVAA 3W23A 2UY4A 4M81A 4HK6A 1MYRA 1QASA 2Z0IA 4R7WA 3FKRA 4U3CA 2F61A 3BWWA 5EB8A 4OBTA 3ZSSA 2FJUB 1EJRC 4MYAA 2JQXA 3KTCA 2YBVA 5E0CA 3W74A 3NA8A 3HF3A 3W1UA 4UWMA 6ENLA 1DXIA 2D2OA 3GVRA 3M46A 4ZCWA 3SM0A 3UZ5A 5LSMA 3MCOA 4NNAA 1XGEA 2NWSA 3KAOA 3LRKA 1ICQA 3KRUA 2PBOA 2XM1A 1W9DM 3RM4A 4Q8PA 3WLSA 1D3HA 5H8UA 4C6OA 1XXXA 4G2DA 3E74A 1KBLA 3QM3A 1R2SA 3SRKA 1UROA 3RNDA 4C7DA 2BOFX 2XN0A 5AFDA 1E1EA 1VBHA 3KOYA 4S38A 2P3ZA 3UEQA 1AQ0A 1C92A 2PU0A 3C52A 2AQWA 4FPSA 1OG6A 2W61A 2Y62A 2WC3A 1TE1A 3EWUA 3DH7A 5F2GA 2QCFA 5F1VA 4DJEC 1V02E 4WKAA 1IR1A 1XGZA 3R8GA 4EXAA 3B0PA 2VR2A 4NYUA 4H8UA 3UR2A 3WNNA 3DFPA 1WDSA 4Q7IA 1DIOA 3AC0A 4BWLA 1HX0A 3T9PA 2VZOA 1NQ6A 5FAJA 3TQPA 3GNOA 1KXVA 2P53A 3LOTA 3W76A 1LBLA 4I5RA 1MWOA 3W85A 2CHOA 4PUEA 5KMYA 3R58A 1B9ZA 2XFYA 4H9ZA 3PJUA 5D9PA 1HKMA 4C6FA 3OOQA 1BQCA 1RBLA 2VNCA 4QDWA 3FOKA 2PU1A 3F5LA 1JUBA 3XINA 3RU6A 3UG4A 4M24A 4MKNA 5JBDA 3CMJA 1MW3A 2DZTA 2QF8A 3B0VC 3FJNA 9XIMA 1XG4A 4M8UA 4DWSB 3BK0A 2QCMA 1OINA 4IG2A 2OT0A 1KKRA 3DFOA 3F5KA 1F8IA 1EGMA 3G1VA 1SYTA 4XKYA 2JKPA 2VJXA 3CUFA 4J7RA 2GVGA 1GZ1A 4D6GA 4C1NB 2NSXA 1V3LA 4MJ2A 3VX0A 1NWTA 4N6FA 2H3BA 3ICJA 2DP3A 4N02A 1R2TA 5H2ZA 3BMVA 4FNRA 1SVDA 3MJMA 4UR8A 1Z9AA 2XYLA 3GRIA 2DSKA 3TXVA 3WLRA 1L8PA 3R1ZA 1B54A 3SCRA 1ME8A 4KCUA 4C7GA 4P7NA 3W73A 4G5DA 5EU9A 2OJPA 4XWUA 2ACSA 1UMLA 3WJYA 1T8XA 1CGUA 4HMCA 1E0XA 1UQZA 4GXMA 1DIKA 4W8AA 1B0IA 1ISVA 1O1ZA 4AUBA 4F3HA 1E43A 3SDOA 3OB8A 1XQLA 1ZUAX 4U5IA 5EFDA 5K4ZA 2GQ3A 2UY2A 2P88A 3NQVA 1XYCA 4FIQA 4IFKA 3M1ZA 3IPWA 4K36A 4TIMA 1HP5A 1UA7A 4Z2JA 1JYVA 4DWDA 4J27A 4U2ZA 1VR6A 3BOLA 5I3JA 2PDGA 3CT2A 1PDZA 4PTWA 3LEPA 1YNQA 3RO8A 2Z2AA 1BXBA 3MHGA 4AZCB 1E15A 1X96A 3POHA 5ABTA 3WH6A 3EOLA 4ZXLA 4HA1A 1G5AA 2P76A 1DBTA 1Q6CA 1TCDA 4DAFA 2E9MA 3ZSTA 2A1YA 3ATYA 2XVNA 3O6YX 4NL1A 1TZZA 1RZMA 2ISFA 4QG9A 4R88A 3GFYA 2ZUMA 3P62A 4O15A 3VKCA 3WF1A 4NZFA 5KETA 4L9ZA 3STGA 3BLLA 1TRIA 4TX8A 1B57A 3TZFA 3IV3A 2OO0A 5M17A 3OGSA 3T0TA 1UKOA 2D22A 1GVRA 2ESCA 4GZEA 6PTDA 4KEVA 4IFRA 4J4KA 2WV8A 2ZXBA 3TR2A 2FVMA 2QGYA 4U5KA 1EJTC 4A29A 3CT7A 4HNLA 3WF3A 2CU0A 1JXKA 4H6RA 1QK2A 2NT1A 5HJYA 1VQTA 2EKGA 3A4XA 3LSBA 1HJVA 4DZAA 1H51A 3E49A 1HJXA 3QGVA 3UWWA 4CD4A 2HRWA 4YLWA 4AWEA 2JKAA 4UQAA 3C6CA 3ONCA 3F4VA 4O50A 5C5YA 5G5IA 1EO5A 1TKKA 1ONEA 3WN6A 1HJWA 1QNOA 4MB4A 3A24A 4RDWA 3NXLA 4IPPA 4YTQA 4EPEC 3CB8A 1CLVA 1K8CA 3GXFA 1OGGA 3WD2A 4BQ4A 1CPUA 3PBMA 1ZSXA 4AZBA 4DF0A 1MRAA 3QOKA 4TXEA 3WQ4A 1F4HA 4QQUA 1PJ9A 2ZVRA 2GGJA 4E2DA 2O7QA 5XIMA 4C6QA 3WLOA 4PC8A 3NEHA 1NY1A 4CQDA 4QAIA 1B3XA 3WFAA 4ZTXA 3UY8A 1RCOB 3UXKA 1TG7A 4OU1A 1SU5A 4S2CA 5H91A 1UJPA 2WZHA 3MJYA 3PPCA 2OEMA 3SQLA 3T09A 4RUBA 2CNCA 3TUUA 3GX9A 4YTSA 4TR9A 1ZHAA 3OLIA 2XVGA 1PTDA 3WSUA 1LTDA 4I7WA 3SGGA 4GH3A 1F76A 1GTHA 3H7UA 4LYPA 1ZP3A 1JPHA 5A8GA 2FH6A 1E6RA 2RGLA 3O05A 3OLEA 3FJ4A 1GJPA 1GYMA 3MHUA 3DUGA 4YMZA 3WDJA 2DZUA 5A6SA 4UTUA 3TONA 2CWXA 3CIWA 3W1QA 4EAMA 4HPXA 3OZPA 3P74A 4MWAC 2J25A 1WDQA 1EC9A 1WZAA 5KTLA 1NJJA 3TC3A 5AECA 2BNJA 4IXXA 5DELA 4C6LA 2J75A 5HA7A 3LNMA 3HZ3A 3NQAA 5EGRA 1ZAHA 2Y2WA 3BV7A 1R46A 3Q67A 4R9XA 4JHOA 4B91A 1L9WA 4B5WA 4PSRA 2REQB 4HYRA 2DJXA 1GEQA 2FZ9A 2WNWA 1ADSA 4I7UA 2BOGX 3AIEA 2Y7FA 4AMCA 3B03A 5CJMA 2BXZA 4LNYA 2VELA 3LGEA 3DFQA 4Y9MA 2J47A 2VDGA 2C14A 3HGRA 3W7RA 2QJHA 3N9KA 3VFLA 1XLHA 2GUYA 4YN5A 3BUVA 3VUSA 3PHAA 3MBFA 4AZGA 4ACZB 3AIQA 5HR7A 2ZYFA 2WCGA 4IIHA 2VCCA 2EG6A 2AQOA 2KX9A 7ENLA 2ZUNA 3CK5A 2V3FA 2G3MA 3CASA 4KETA 3UWQA 2DZAA 3MSDA 5AYYA 4C5ZA 4WVXA 3NDOA 3LCIA 3HJZA 1SR0A 1LWHA 2FDSA 3C56A 3STPA 1RPXA 1YX1A 1T0OA 4MPQA 3PPFA 4H8HA 4MF4A 1B3VA 3TFCA 2HS8A 1G1YA 5BNKA 2WPGA 3KS6A 3FFSA 1TR1A 5CCZA 4HZ7A 3VIKA 3P8JA 5CC3A 3K4DA 4HN4A 3NGFA 2PS2A 2E9BA 1Z44A 3LLFA 4Y6GA 4I9JA 3VD4A 1NVMA 2DVXA 2HEJA 1RQHA 1AODA 4LVFA 2HK1A 2VEIA 1UOZA 2Y8KA 4MSSA 2HE8A 1DEDA 3H7VA 3UGVA 1OF6A 1AL8A 4Y7EA 2QF7A 2PAJA 5DLCA 4WXYA 1F05A 1SFTA 1VS1A 3GVQA 1KKOA 4KQNA 2Q8LA 2QMKA 4Z1YA 1HUVA 1FWJC 4P8VA 3A3HA 4GWEA 1LF1A 4OUIA 1JZ6A 4C6PA 4UUIA 4REQB 3RM8A 3UPMA 1PYMA 1RUSA 2XIMA 1JF5A 3S42A 4AD0A 4GOAA 1N8FA 5B7ZA 3GXMA 3BAIA 4HK5A 3H6OA 4MWAB 1W3TA 4PEEA 3SR7A 3VMPA 4H6QA 5TIMA 1FFQA 4ZR8A 3L68A 1K8ZA 3H12A 4RNJA 4HU8A 2QJMA 4O53A 3VVGA 4H9UA 3K1DA 1UR2A 1EP1A 1KTNA 4PMZA 4UTMA 1R7AA 5D03A 4ES4A 2PDXA 3ITOA 4IJCA 3PBYA 1SZNA 2BX7A 5ABFB 2RUSA 1DJNA 1JRCA 4PCFA 2CXGA 2E25A 4GKLA 2Z2UA 1RA0A 1CLXA 4AU0A 1TMLA 2J8TA 2I7GA 3VD7A 4N4QA 5EMKA 2OX1A 4UQDA 3NL3A 2RGMA 4Q8OA 5D32A 3L4UA 5E6ZA 3M5YA 4N2YA 3TN4A 4V1XA 2V5JA 4KFPA 2QR6A 4LYKA 4WJEA 3KP1A 4EP8C 2EG8A 3BAKA 4PB4A 3O7UA 3QTPA 3N6QA 2PZNA 1V3MA 2OLSA 3HG2A 3VO0A 1EB3A 5HXMA 4PUUA 1VCFA 2E1DA 1QDSA 1XWYA 2VOMA 1Y5XA 3MWAA 4GBDA 3BW2A 3W25A 3MB9A 4IFOA 2H8ZA 3NZ1A 1KQYA 1S2AA 4DNHA 4YCPA 1MW0A 3NO1A 1CNVA 4C6DA 3N3TA 3WQCA 4BY3A 4IZGA 3VPLA 1PUDA 1DWHM 2OFJA 1TV8A 1G7VA 1DIEA 4KGLA 2FVLA 1JYXA 3ABQA 3IIXA 2NQJA 1EX5A 3SIZA 1CECA 3WLMA 3B0YA 2PD5A 5BOFA 3SGUA 2PDQA 4BQ3A 3O6DA 1ODUA 4RK8A 2G97A 4QTGA 2EKCA 3MQTA 2ZFAA 2FYMA 3P82A 2P5NA 4PMJA 1WAWA 2HSAA 4JNYA 3W88A 1BPLB 1XYMA 1ZTVA 1D9EA 3E9AA 2R1KA 3EDKA 4Q4RA 4LS0A 4QLLA 3EA1A 5A6KA 3AS0A 1DTNA 3KHJA 4QP0A 5HMSA 3BTNA 7ODCA 4Q8MA 1LCOA 1XKJA 3AI0A 3SFWA 3AJXA 4RPPA 2QCHA 2YCLB 1J0HA 4EVZA 4H7ZA 4X9YA 3RFAA 4F48A 5T26A 4UOZA 3LK6A 1DQXA 3CAQA 3E0VA 3IACA 1UC4A 3JW7A 4XG1A 3DERA 1UD4A 3LHZA 3ZIZA 2C7FA 4CD7A 1IE7C 1BVWA 1LROA 1GNXA 5M03A 3VX1A 3FIGA 4E8CA 2J7HA 2CESA 1KRAC 3LENA 1QCWA 4Q33A 3QMSA 3CV7A 3HV9A 1ZBCA 4Y9PA 3H21A 1J10A 1XR2A 1YDOA 3E0IA 4MZYA 5E9XA 3M7WA 2DUAA 1CW2A 5A6AA 3KTXA 2VRKA 4L6DA 3RX2A 4ADUA 3TH6A 1FWWA 1TIMA 1JUKA 3H2CA 2E0PA 3GXPA 5AN7A 1UIPA 2GL5A 2ZUVA 5FKYA 2FLIA 4W89A 2HMCA 4HA3A 3LA4A 3WYZA 5I07A 3WQ6A 1CYGA 5LIXX 4FF7A 3N4EA 3DECA 4IL2A 4YHEA 2VFDA 4ONVA 1DWGM 2C1GA 5IBXA 1OX6A 1GQLA 2VWTA 1TWSA 1JR1A 2CPUA 3SN4A 4JIHA 3A22A 4GFSA 4GVGA 1GQNA 3TWBA 1HKKA 4CN6A 5FSDC 1IEQA 3SIMA 1Y0EA 1Z7AA 2XSAA 3HIJA 2ZX6A 4XO6A 1TPDA 4PMVA 3KCLA 2OKTA 3PZGA 4FXRA 3N6JA 4LY4A 3TR9A 2Z25A 1BWKA 4IX0A 1RQEA 1XS2A 4ZE5A 4D6HA 4CU7A 2PGFA 4XIAA 3BARA 4LAUA 4MAVA 1KB3A 1NDVA 2JE8A 3VAVA 2I5IA 3GW0A 4OV9A 3WJWA 3RDKA 1KC7A 3AU2A 1UCWA 3WBEA 4Y9AA 2GQ8A 4XUYA 3OVGA 1A5LC 5C0QA 3SW6A 1EJWC 3LMZA 1O60A 2J78A 1SO5A 4OJYA 3B8VA 4MJMA 1FX6A 3ZOAA 4TOQA 4NXKA 2ACQA 3S2JA 1V0KA 3IJ8A 4JPGA 1QHPA 1CB2A 4MDOA 3BMWA 1FCVA 4QE5A 1XRVA 4H9VA 2PDIA 2XVPA 4WXZA 2WW5A 1W1A1 4JIQA 3W1MA 1PX3A 3DC0A 4JQAA 2FTYA 2SFPA 3T55A 2PB1A 1ZP4A 1OCBA 1HG3A 2O9OA 4LAOA 3BGAA 3LM3A 3B9NA 2OELA 4L64A 4V2XA 4K7YA 4QFUA 3H70A 3GWQA 1XDJA 3TXZA 1J0IA 4O1FA 3U6WA 1SSDA 1BWLA 1HXJA 1J18A 4JKLA 4OQVA 5HWMA 2PBGA 2J9YA 4R9OA 4MDPA 2XN2A 1BSIA 4XZWA 3I7QA 4CCEA 3P80A 1A0CA 3SGZA 1LQAA 1M65A 1VCGA 2PD9A 2PC4A 2V2DA 2XM2A 4NY2A 3P60A 4FX6M 2WKJA 1JAKA 4GKTA 3RLHA 1D2KA 2NQ9A 4CN4A 1PTAA 5J5DA 2HJPA 3BAYA 1REQA 3UYIA 4G7EA 4W86A 2A3AA 3S6TA 4K8HA 4J1OA 1S5VA 4AY8A 3MS8A 4YL2A 5JMUA 5L6UA 1LRNA 3PBVA 3DG7A 4MVAA 4N42A 4LBRA 4F8XA 1S5TA 4D1JA 5MF5A 4HJFA 3RAOA 3B8SA 5G2HA 1I0DA 1GJWA 3MSRA 4MTVA 3GNDA 5HMDA 4QHRA 3EMQA 1QBAA 1E6QM 2EPOA 2BZNA 3BOXA 4GUHA 2VX7A 2QDEA 3FJLA 3T8QA 4H8NA 2GOUA 1AG1O 4O0ZA 1TV4A 3RMJA 3T78A 3KBNA 2CBUA 3CLWA 3G6LA 1XD0A 1YTKA 1KW1A 4G7FA 4K7VA 1LL6A 3S1WA 1GPWA 4RV8A 4S3FA 3GG0A 5CSSA 4DYJA 4LJ3A 4NHVA 2W66A 3NOEA 4H3DA 5FA5A 1F73A 4LUJA 2WNZA 4J40A 2VD8A 1Z32X 2B31A 3WUEA 4FB7A 4EPKA 3G2GA 3L4XA 3HPFA 4AZHA 3LS9A 3A4WA 5I24A 4AQLA 3B04A 2O4QA 3N6HA 1PDYA 3O6AA 2DVUA 3MZ2A 1H1YA 3C0QA 3UG3A 4BK9A 5D4YA 2Y7GA 2ZKMX 4DJED 2PLKA 1AVAA 1TPVA 3CM4A 5D09A 2CZDA 3VIFA 2XU2A 2G3JA 1GHSA 2VRQA 5HANA 1BGGA 1HTIA 1I2PA 2Y0FA 2A7NA 4OKDA 3EMZA 9RUBA 4X2PA 2PI6A 3W7CA 1U83A 3EX4A 1UYQA 3C86A 5HJXA 5JIWA 4XZMX 4W7WA 2IKHA 5M1TA 2ZA2A 3IRSA 3VNIA 1QW8A 1VFSA 5A8MA 4FF5A 4ERIA 4LANA 4DF2A 4JTQA 1X1ZA 1W9XA 3GH5A 4I6VA 4M6QA 2QPXA 2A0NA 2QMJA 1LUCA 1XLFA 2NUYA 4A8LA 4PTMA 4IT1A 4ZL1A 2CXEA 3GU1A 4CCZA 1WQ5A 2WJDA 3TAOA 3AMDA 4JTIA 3A47A 3PANA 5DT5A 2J79A 3U3HA 3I7RA 2PDFA 3DEQA 3LG3A 5FSEC 3BG5A 3BJSA 1JCYA 2GQAA 4B4FA 1JQXA 2D24A 3OPSA 3NPXA 2DZXA 5F4WA 2Q01A 4Q8WA 3NQGA 3DI0A 4BHYA 3S2MA 2PMQA 4Z2LA 4EX4A 1FA2A 5D2TA 1W5PA 4I5UA 3FAWA 3W7HA 3SRHA 1PXGA 4K1GA 2EJAA 2XINA 2HK0A 2R24A 4M6UA 2DY3A 2F38A 3N2TA 1U5JA 1GG0A 4RW5A 4V27A 3LCHA 1H0GA 3V7PA 4PRRA 2EQDA 3L2IA 1Z48A 3LTSA 4HA0A 1O12A 3VGHA 5E93A 5LGXA 1RH9A 4Y2WA 1OC5A 5LKYA 2YXOA 3MO4A 4NJKA 1V6VA 5FD0A 7TIMA 4MYXA 4XSMA 2FGLA 3S1GA 2XVKA 3UP8A 1FCBA 1TQJA 2EPNA 1LLOA 1BRLA 4R27A 3NJ3A 4JQ2A 1RHCA 2D23A 3H22A 3CHDA 2HVNA 2CZVA 2Z1VA 1US3A 4RZBA 1W1YA 2W91A 3AWNA 1LYXA 1TV3A 2WBGA 2G0WA 4W8BA 1JUEA 2OQLA 4UR9A 3ZYZA 1AJ2A 5E09A 5D9MA 4ZFMA 2D0GA 4CEUC 1A50A 1LJYA 3LXCA 4AX7A 3UYCA 3VNYA 1Y5WA 3WZ0E 1I4NA 1FKXA 5B7YA 5PTDA 1LLWA 1VFOA 3MUXA 3N11A 6TAAA 1CTNA 1DJIA 1SO4A 2ZBTA 3CUHA 1DJQA 4WY0F 4DBSA 3G1FA 3EX2A 4JEQA 4ZQCA 4GUFA 2X1TA 3TTSA 1RLDA 1TJ0A 3G1RA 3UR5A 2AQVA 4EF8A 1L2UA 4MJZA 4UQCA 2PP3A 1R6WA 2GDQA 3UZYA 4NZ4A 3BVJA 1BXNA 1DWAM 4W88A 1I2QA 2AL2B 3TMQA 1GOWA 1UD2A 2IPGA 3REQA 2E8ZA 3O16A 2VO5A 3O9NA 4E4UA 2GFTA 1VPXA 3UCCA 3FNDA 4XO7A 3KVLA 2C15A 4C7FA 1D8WA 3VYLA 5B80A 3TNBA 2ZIDA 2YCJA 2OVLA 3AU6A 1EJVC 4WOQA 2PFHA 2PDHA 3EBVA 1VEPA 3OW1A 4JICA 5IM51 3RU8X 1XIEA 2X7WA 1TV2A 1GKRA 3CWHA 3W1NA 3EEGA 1V79A 4M6VA 4PE8A 4BEUA 1PCWA 2XH7A 2ZZ1A 4KMQA 1UP2A 3IAPA 2ABAA 1OG0A 2NV2A 1FH9A 3U0HA 4R3UA 4FNSA 4RKAA 1RK6A 4CEXC 3LHVA 4FK9A 2OWXA 2RKXA 3HG5A 4HBKA 3WLHA 2YIHA 4JNZA 2TPSA 4QE1A 3PB2A 3C0LA 1V0MA 1P5BA 1WUEA 4JTSA 4UCFA 4ZODA 3SUVA 1SO6A 5KITA 1A3XA 4AISA 1E9YB 1AUSL 2VC5A 1NDWA 2YL5A 2E8YA 1TTQA 2XIBA 1WCGA 1VFTA 2D2HA 1DVJA 3ANVA 4MWAD 1LQ2A 1W31A 3TW7A 1GYLA 4QJ4B 3ARRA 4RXFA 2I1OA 2IQDA 3GTFA 4FI4A 2UWFA 1TCMA 1KM1A 1O5XA 3QGKC 3R79A 1S2WA 3UF9A 2H6RA 2PLCA 2XSBA 2BVDA 2WZMA 4ICMA 4GK8A 3IK2A 4DO7A 3HBLA 2J8FA 3IUDA 3G0SA 4CQCA 2CKSA 1XCWA 1F4AA 5GNZA 1ZS2A 1EKOA 3MCMA 4O13A 1KLZA 4P8XA 2X0HA 4F79A 3FHAA 3ZJKA 5K7JA 1E4NA 3WD3A 8XIMA 5I3GA 3V0SA 4MNJA 3DZ1A 3SQMA 3W29A 4PR4A 3J7HA 3LXAA 4YXGA 4KBXA 2I5GA 1G7UA 1GZGA 1L8NA 1WE5A 1LOSA 3SCVA 3U57A 4MY1A 5T9CE 3CQKA 2QLYA 3WD0A 5HQMA 1P4CA 4AB4A 3EWYA 3PUOA 3WLNA 2BGSA 1BYDA 4J2PA 4HQVA 2CLLA 3N2BA 4AWUA 3W71A 3PFRA 1TMHA 3BGGA 3EB4A 1B5TA 4NZ3A 4POCA 1P48A 2W6RA 3BLOA 4HP5A 4ATLA 4V28A 1GWJA 1MXGA 3VINA 5D02A 4LBUA 2QXWA 4ZEPA 3W0KA 4UQBA 3PUDA 4QDPA 3WO8A 4TMBA 1N55A 1PIFA 4UTKA 3W1TA 2YW3A 4QNWA 1RAKA 3VIIA 3ZLHA 1L6YA 2G4JA 5HOSA 1XHGA 1U22A 1R2RA 1NTHA 4LU0A 1LRTA 2KAUC 1JPIA 5DMLA 4M51A 4NRSA 2O7SA 3D5HA 4F9JA 3OIXA 2HXUA 1S5MA 3W3OA 3WQGA 3TOYA 3VXGA 2E5DA 1QTWA 3WUGA 1YDYA 4JTDA 4Z2KA 3OYZA 1V0NA 4GG9A 3UJSA 3MVTA 4KFNA 4ZSUA 3M9YA 2PC8A 4HA4A 3E0LA 2QJGA 4UTLA 1Y5VA 3AWOA 4D9PA 1UWSA 1P1XA 4JQ1A 2GGHA 5DFAA 1UR8A 5EMLA 1OCQA 3W1PA 2F9RA 1IHIA 1MVYA 3H24A 1HP4A 3MW7A 3LBCA 4JTCA 3ZR6A 4MKSA 2QCDA 2IKIA 2YZ5A 2BXVA 3RPDA 4C6KA 4NF7A 3TROA 4DX3A 3I4EA 3NQ6A 3LN3A 1KBKA 5CKSA 4YTTA 1TWDA 1VH7A 3DAQA 3I6TA 3N14A 5A8OA 2W9MA 3BL3A 3GDRA 2R9RA 1TWWA 2CLMA 1R9ZA 2DV0A 4E6MA 4I9MA 1JAEA 2X16A 2P3EA 3S5NA 2VX4A 5JBFA 4AY1A 1VBJA 1NARA 2PUZA 4X3ZA 2C3ZA 1TJRA 2DSWA 4XZ9A 3P0WA 3THAA 4JX6A 4MFEA 3YPIA 3WK3A 4QG6A 3DDMA 1TVPA 3KOXA 4JFUA 5TF0A 1H62A 3ZR5A 1J0JA 3S1XA 3W7IA 3H4GA 2QIWA 3WMCA 3CZ8A 4BF5A 4XAFA 1XRSA 4LALA 1W32A 1KXHA 3WQEA 1O6IA 3WNMA 3A3WA 3TW9A 4JYEA 3OBEA 3GR7A 4PFMA 4XBJA 1XW8A 2OTDA 4L5ZA 3W26A 2OB3A 2IXVA 4JTEA 1AJ0A 3TJIA 1XLBA 3FDGA 2QCEA 2IKJA 4PN2A 3VCNA 3P67A 1DWJM 4HCHA 3CIXA 1JG9A 3KRSA 2R91A 4PMDA 1JPMA 2G95A 2V5BA 4I90A 4Q4QA 4CNPA 5CBJA 3VC5A 4C6IA 4DO5A 2H9AA 2DT0A 5FI8A 1C9DA 4OBRA 3TTEA 4ZO8A 1VF8A 4Z1AA 2BOEX 2GUUA 3T05A 4ZOEA 3TQVA 5IRPA 5TNVA 2AL1A 4B5XA 3N12A 4KPLA 5CQ1A 1J9YA 1B3OA 3CIVA 1VFUA 1E4IA 3R5EA 3IIZA 4BCEA 5LXEA 3S5YA 4XBSA 3GHTA 1ZBVA 3VK5A 4TVUA 3W1AA 4ROQA 1XV8A 1VFLA 3E5BA 1FQ0A 1E4MM 1XC6A 2DW7A 3GNPA 1QO5A 4MY8A 3PJTA 3TE9A 2ISVA 2Y8UA 1Q66A 1NWRA 4S23A 1DJXA 2XZ7A 2A6LA 1WZKA 5FESA 1PEZA 1W17A 3NNTA 3H23A 2NXGA 3KX6A 1X8FA 1PO9A 3JS3A 4AHPA 5GJNA 2OYLA 1G01A 2IPFA 4NXSA 1OFDA 2PDCA 4W4QA 2O56A 4JFTA 4JD4A 2JGYA 1GVQA 3UZZA 4EK7A 1OABA 4MUPA 2VQTA 3ANYA 4XZLX 3LLXA 4G1KA 4DNMA 1JI1A 2EG7A 3HQOA 4AC1X 5CC5A 1LQ0A 2YW4A 1QK0A 5FOOA 3GDMA 2HPMA 4WR3A 1ITQA 3G22A 1BGAA 1OX5A 5CZ0A 5KINA 3HGSA 1PE1A 4F2UA 3GNXA 4S3CA 3VOFA 2VX6A 3ITTA 3TYDA 2PWHA 2X7VA 1KCXA 3PJWA 3BGJA 2FHCA 5C2CA 5CBIA 1WAUA 4BEQA 2WJEA 4FX8A 1Q4WA 1WX0A 2E6AA 2X40A 5CG7A 1NAL1 3SJ3A 3AXMA 3UXIA 3WF4A 5BYWA 1VYRA 4DPQA 4A8IA 4QS5A 3P61A 1UD6A 2VGGA 1UZHA 1HIZA 3E3HA 2XFWA 2PLJA 1CI1A 3CL6A 4DN1A 2WANA 4BF9A 1FWNA 5F7UA 4AAJA 3VNLA 3NURA 4IG2B 3W2JA 2QV4A 4X22A 2YA0A 3M0LA 1KFBA 4DJFC 4WY0A 5CPNA 4XKYB 2Z27A 3QJAA 2PWGA 1OIFA 3KZPA 3LHTA 2AGKA 4BA0A 2IS7A 2QAFA 2JF7A 3AS2A 4JEJA 4WRHA 1DE5A 4DZ5A 1BYAA 3GFXA 5D30A 3T0BA 4OE7A 2XN1A 3BCDA 4JFWA 4AIUA 2O4MA 1FWIC 4NYYA 3WNPA 4UNIA 6TIMA 4NU7A 1BAGA 4J3SA 4TV6A 2H90A 4UOJA 4OHQA 1PZ3A 3KHDA 3UD6A 3W2KA 3L5LA 4TUFA 3S3GA 5D05A 2ZTJA 2HTMA 3VC6A 3M64A 4O28A 2NWRA 3DHUA 7XIMA 1W54A 4IFKB 4IMGA 5EFFA 2C0HA 5A6MA 1M7JA 2WM0A 3RG6A 1KM2A 3I10A 2RDUA 2NQ5A 1T99A 1UR4A 1YPXA 3MO7A 1YDNA 4HTYA 3NCOA 2ATMA 3S5SA 1MO0A 1A5MC 3HMJG 1PV8A 4DYKA 3NZRA 2Y85A 3FA3A 1IXOA 5E0FA 3DI1A 4WOZA 2ATSA 3DU0A 1XBVA 1A0EA 3B8UA 4WEVX 4DXVA 4X0VA 5JQ9A 4NZ5A 1DL3A 3FGCA 3FS2A 3G1XA 3VDCA 3EPNA 3TYEA 1M03A 1LG2A 3E38A 1K9DA 4S1FA 2Z28A 5KZ6A 4ZXOA 4CLMA 2WZTA 3ABRA 1NDYA 2PTDA 1ICSA 3SEPA 4CKQA 5CG0A 3TEVA 3WLIA 3BCJA 3MTWA 4HHHA 5DBUA 3TVAA 4LB3A 1UASA 2VWSA 4S39A 5FJRA 5AYXA 2J9XA 3F2CA 3WQVA 2EBNA 1QT1A 3W83A 3SCTA 1PCKA 4DBEA 1JZ2A 1IXNA 1ZCCA 3WENA 3G1HA 1EO7A 2IPJA 1C8XA 1XIFA 3EYPA 3PP7A 4UMAA 2NXIA 4I3GA 3ES8A 1UWIA 3W1XA 2HCVA 3GH4A 3IIOA 3WQFA 2DJLA 3SRDA 2WVVA 4W93A 1OYCA 3FK4A 4AEFA 1FVPA 4JFVA 2GDVA 3CUIA 3EPOA 4H19A 4I8YA 1C8YA 1BXCA 3VD3A 3QLDA 1VAHA 3USZA 2V5KA 4XVEA 4F0HA 5BOOA 1O4UA 1AA1B 2C1IA 2WCAA 4IMDA 4FX7A 1PZ1A 1YTEA 4J3XA 4HK7A 5D2WA 2QCGA 5CPLA 1GOOA 1LM1A 2NT0A 4DPPA 4OGZA 5C70A 1UD8A 1ME7A 3N9RA 4O4WA 1IV8A 1OFEA 4J3VA 4V1YA 4DJEA 1EXPA 1FWHC 2OWWA 2XGIA 1EEXA 4H2HA 2A3BA 3BLEA 1UP3A 3WBXA 3LCWA 2RDWA 2Z1SA 3UETA 5DT7A 1ISWA 1UG6A 4O0QA 4HOZA 4UNLA 1NH6A 2PLMA 2PDJA 4DUXA 2V82A 1A5NC 2J6VA 3ECQA 1KBJA 1L6SA 4P7RA 3K4WA 3LX9A 4JN7A 1EH9A 2QZRA 3SY8A 5HQLA 2DSUA 1K77A 3F4DA 1SGJA 3TJLA 2XFFA 2QHAA 3GVWA 2V38A 5HPCA 2WNNA 1XIIA 4S3EA 3GYCA 5FIPA 3TN3A 3SUSA 3MKKA 1MDRA 4JNMA 4RE0A 3PC0A 3R12A 1ZJIA 5H1WA 3FA4A 2OQHA 2R6OA 2HS6A 5C55A 5FEZA 4L4OA 1R3WA 3AHTA 4ERAA 4HCDA 1AQFA 3FVMA 1H41A 3EOOA 3WUFA 5G1MA 5D8WA 3SECA 3EA3A 4A3RA 2A79A 2P10A 1J0YA 4F0LA 4NRRA 4J3TA 4ZQNA 2ASHA 1KBIA 3E02A 1US0A 2YL8A 4BI5A 3C3NA 3CB3A 1X1OA 4GXPA 3BLPX 1E6PA 2QQ6A 4L4LA 3BSMA 3WQOA 1KLYA 4X63A 2GVEA 4AZ6A 2WSKA 3A5FA 1XLAA 3EEZA 1YNPA 2FHBA 1LZOA 3KOFA 1POKA 4N0RA 5IDZA 3AALA 3NL2A 5GPRA 1Q6FA 3NQCA 4IIDA 4JTKA 4WGHA 3M07A 2YOCA 4UFLA 1U5VA 3ZJ7A 3I7SA 3M43A 3L4TA 3WF2A 3HO8A 1V0LA 3S6OA 3VABA 3BSGA 3THDA 3SAZA 1UW9A 2XWDA 3L7RA 4K6AA 4KWUA 1KV8A 1XH2A 1PKNA 1JQVA 1UHVA 1DQWA 4RDZA 2MANA 1P0DA 3U8GA 3L4ZA 4JDBA 4IUOA 1X98A 1ZY9A 3C2OA 4JTGA 1GW1A 4E3TA 1SZFA 3LPPA 3RIKA 4AIEA 3II1A 4MUZA 1DXFA 3AUJA 1XLLA 3PTQA 4FEZA 1H3GA 5E1QA 1WBHA 4EIVA 3FAXA 2OYMA 1EF2A 4HOXA 4EWJA 4NILA 3UG8A 4O57A 4UTJA 3FVDA 3WNKA 4QSHA 1SMAA 1J01A 2XVLA 4GQGA 4KEUA 3NQFA 3LCFA 1O5RA 2F6UA 2VKZG 3PZUA 2J74A 4UC5A 1V6TA 4U2YA 4YVPA 5AC6A 1A47A 3R8HA 3CTLA 4X60A 2Y7EA 5CSRA 2V9DA 2NX9A 2QDDA 2E6YA 9CGTA 1I8JA 2BFGA 5IFTA 2G5WA 5DXXA 1HT6A 1EEPA 3CMGA 3CZEA 1IQ8A 3OA3A 4QLKA 1PWLA 4ACZA 4LWWA 3VDAA 4GUJA 2NUWA 2P0IA 1P6CA 1OYAA 1GONA 5AZ1A 1X7IA 4US5D 5GJPA 4URIA 3RHGA 3MDWA 3ZJ6A 3VIJA 3KXQA 1H4PA 2HBXA 3OHMB 2I57A 5C9XA 4K2SA 3IIPA 3K13A 5IDIA 2WQDA 1XP3A 4XTIA 1AL7A 3NGJA 1FBAA 1IF2A 4UB9A 1ZENA 2AAAA 5F4XA 1D7KA 5AC5A 5DBTA 5KZMA 2W0UA 1UJQA 5LA2A 1W1TA 3FA5A 3EWWA 1JFXA 1W8GA 1HJSA 2QKFA 1HNYA 4ZA0A 3CH0A 1LORA 3W7PA 3JUGA 3THCA 1LWIA 4GY1A 1KFLA 5A2CA 4JAWA 3BLFA 3FSTA 3FN9A 1DV7A 3M6DA 1S1PA 3N17A 2E77A 4ORIA 5KZEA 2HPIA 2DZPA 2V5DA 3G8RA 1CBGA 1E5JA 4IGMA 1ZCOA 1XKYA 4NNBA 4S2BA 4PBGA 5CPOA 3TLQA 4E2VA 3VNMA 4UTFA 1T7LA 4KCVA 3CHCA 5FJPA 5IBXC 4MG4A 5REQA 5JVLA 1HGWA 3CBWA 1E1CA 1NP2A 3CQJA 4LFYA 3LQGA 1JZ7A 5A6JA 1QATA 1ZJBA 3S83A 1RJRA 1UZ4A 3TW6A 5LNUA 4PMQA 2UV8G 2YCIX 3PULA 2JKEA 4HZ6A 5I23A 4MWAA 4GLEA 2XIIA 1O5KA 3WY1A 1BVNP 1OD0A 2CITA 3TOPA 3BQ5A 3JRKA 3IRDA 4MLJA 3AXIA 1M04A 4PGLA 4IGHA 3DYMA 3PR2A 3K46A 3K8LA 3GIQA 2CLFA 1P6BA 2VZVA 2G8ZA 5C7VA 1KFEA 2FPVA