4IUOA

1.8 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) k170m mutant in complex with quinate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
259
Chain Sequence
b'NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Crystal structures of type I dehydroquinate dehydratase in complex with quinate and shikimate suggest a novel mechanism of schiff base formation.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 97
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4iuoA00
3LCHA 3CWNA 4LC6A 1WA3A 3S9YA 3CWOX 3N2MA 4JX6A 3UWYA 2ISSA 5G1YA 2ATMA 2FB2A 4UMCA 2NWSA 4K38A 4I7UA 4Y96A 4GXMA 5G2HA 3UXDA 5CZSA 3PWAA 2QCFA 5DELA 3TC7A 4UC5A 1IXNA 1LRNA 4JEQA 4PA8A 1VJIA 4DO6A 3NL5A 5KSWA 1DOSA 2D73A 1B9BA 2JGYA 1EA0A 2VEPA 5KINA 2V2DA 4ALDA 1IXPA 3O8AA 3CPRA 5U4NA 4MY1A 2TSYA 4S2CA 2Q8ZA 4O54A 1AL7A 4Y9AA 1F05A 3A5FA 2GVLA 1L6SA 3PBVA 4IMFA 3DFTA 3L0KA 3LRMA 4O0KA 3KAOA 5FF0A 2BWGA 1PCKA 1MEHA 1DJNA 4WOZA 1ADOA 1QPNA 2QJIA 5HJLA 4JICA 1XBYA 3S1VA 4Z0JA 3GDLA 3OVPA 1FWWA 4CNNA 1TPDA 3SY5A 4K7YA 3NQ6A 2CZEA 1W1ZA 2FJKA 3HQ1A 3CQ0A 5AHEA 2QCEA 1WXJA 1EP3A 4TX9A 4BR1A 3HGOA 3TW6A 5CZJA 3Q94A 3P84A 3CIWA 1SFJA 3TMLA 3TIMA 4QITA 3VE9A 4R34A 4DPQA 4WD0A 4UTMA 3B05A 1XC4A 4UFLA 1FY6A 2QUTA 3NDOA 3MI3A 2EF9A 3L0GA 1J5TA 5D2WA 5G4WA 2V5BA 4PEKA 1IF2A 4IX0A 2HTMA 2BXVA 3C56A 3QF0A 1YXYA 1CW2A 5AHMA 4A22A 4DQWA 1H50A 2CLIA 4HNNA 2PC4A 4R53A 2E6YA 3M41A 3BW2A 1OFQA 2GQ9A 2A85A 4JY9A 1OFAA 1BWKA 1Z44A 3RK8A 2B0MA 3LBMA 2Y88A 3LHZA 1EP1A 3LTYA 1FDYA 2FFCA 4BWLA 2HMCA 4UUIA 2Z6IA 3TXZA 2QCNA 1MZHA 4WY0A 4CQ8A 4ORIA 3EKZA 3GKFA 3W22A 2J6XA 4DF0A 1O94A 3I6RA 4IMGA 3S5NA 3B0PA 3IVTA 2X16A 1X7FA 2NUYA 3W7PA 2X2GA 5AHFA 1OX6A 1PHQA 1LTDA 4QNEA 1G4EA 3C2EA 5FF4A 1G4TA 1PL9A 3W71A 1I2PA 3V1PA 4GJ1A 3EX4A 4UTTC 5BW6A 3Q58A 1K7EA 1LYXA 4AMAA 4MPQA 4XQ6A 4N6FA 3W7HA 2BLEA 3W7MA 5FESA 3LLFA 3P8IA 1GWJA 1KM3A 3LXCA 3SGUA 1WBHA 5K4ZA 1EP2A 4IPJA 3DHDA 4I9AA 4O4WA 3QC3A 3Q37A 3M5YA 4O53A 5DBUA 1ZAJA 1F5ZA 2WJZA 3MMTA 1OABA 1VCFA 1K8ZA 5DCDA 4K6AA 4A2RA 3DAQA 4KWWA 4UTJA 1VYRA 1L6YA 4MY9A 2ZCGA 3NL6A 3P61A 3NQAA 2PURA 3C4UA 3L68A 1TTIA 2CLHA 5A5WA 3USBA 3HG4A 2Y63A 5K9CA 2YYUA 3G24A 3K30A 5DLCA 4LOCA 1XXXA 1LP6A 1YDVA 4FNTA 2R14A 4MJMA 2XN0A 1IXQA 3I7SA 1PV8A 1H62A 3IV3A 5EA9A 1EUNA 4UFKA 1OYAA 2WOQA 3GZ3A 4HNUA 1H7PA 1LDCA 2H6RA 3LTSA 4YWIA 1P1XA 3KOFA 3OHIA 1HTIA 1W3NA 3DH7A 3THAA 4BWLC 2EHHA 5K9DA 4PC8A 5FF3A 3P8JA 5K7JA 1M5WA 1ICPA 3U2OA 5FEZA 1Q6QA 2OZ0A 4RX0A 1Q6RA 3HGSA 1QR7A 1ZFJA 4O18A 1A53A 1VHCA 3W2LA 3M9YA 5E0KA 4ADTA 4PFMA 1H7NA 1VS1A 4LS1A 4MJZA 3LHTA 1W3IA 4HPXA 2X1UA 1T96A 3T4CA 1ZNNA 4D2JA 4NU7A 3P60A 4Y6GA 3FKRA 5HNRA 5AC8A 3P62A 2QJGA 1F74A 4YL2A 5AYYA 4AHQA 3L67A 1BTMA 4W9TA 1C8VA 3EX3A 1FWTA 3LHUA 5F4SA 1K3UA 2E1DA 4O1AA 1R2TA 2GVGA 4FO4A 3EWYA 3LV5A 3W2NA 1GYNA 1AW2A 4FX7A 2J27A 2YYTA 1VLWA 1IIHA 3LTPA 4YCOA 1GT8A 1JRCA 1GTHA 3FLUA 2DZPA 1HO1A 2VEMA 3W72A 5D09A 4I7WA 1GVRA 1TPEA 5I3IA 3PUOA 3UPBA 3O06A 3LCWA 4Q32A 3KVMA 3O16A 4MZ8A 2E5CA 1IXOA 5D32A 1SO3A 3BW4A 1TV8A 3TCEA 3LERA 2A7NA 2F84A 1QOPA 3HJZA 4ORMA 1QAPA 2OX1A 4K37A 3IIZA 5TBOA 2ALDA 3LV6A 2A2IA 3L9CA 4HPJA 1KM1A 2ZZ7A 3TA6A 1SQ7A 4FHAA 5FF2A 5MHBA 2FQIA 3T7VA 5D30A 4NT0A 1OFOA 2Y6ZA 1FWSA 2DJXA 3E9AA 3NM3A 1TCDA 4O1DA 2ZRVA 4Z1CA 4O16A 3RU6A 3TXVA 1THFD 3F4NA 3QSTA 4N9EA 1I4NA 1G67A 1XBXA 3G1VA 3AJXA 2A21A 5G4EA 1KFJA 3IVUA 2Q3RA 4XUGA 4OWGA 3RLVA 5D2VA 1WYIA 5L6UA 2PE4A 4MFEA 5HR7A 2JGQA 4FIQA 2NX9A 2CLKA 3LRLA 2BX7A 2QCHA 4FNRA 5D03A 3TR2A 3C6CA 2AGKA 1IGSA 1RQBA 3F4WA 3TAKA 3DGRA 3GXNA 1DHPA 1F76A 2P0OA 4M6PA 1HO4A 3G1DA 4OBTA 1SUXA 1I45A 3LCXA 4GUGA 3W75A 2I1OA 2WNNA 4IOTA 4XTDA 1KFKA 5D2TA 3AO0A 2AAMA 1TPFA 2ZA2A 3S1UA 1GTEA 4EF8A 4UNLA 3VKJA 3W88A 3BPWA 3SJ3A 3W7RA 5K2ZA 2J9ZA 1TPVA 1ZCOA 5CSRA 2RDWA 3CB8A 4U28A 1JQXA 4JTJA 3G1FA 5SWUA 3IVSA 2BTMA 1I8JA 1ME8A 5AYXA 1V7YA 1FCVA 3LM7A 3S1XA 1OFEA 2ZA3A 3RMJA 5FEWA 1EX5A 1TV5A 3UWZA 3R2GA 3E02A 4ADUA 4J9JA 2VFHA 3MBDA 4ADSA 5DY2A 5K4XA 2GVJA 3B04A 1VPXA 4RXFA 3FKKA 3NZ1A 2ZZ5A 5HWMA 4JTIA 4Z08A 3DFSA 3TFCA 1SZNA 4DXVA 4M5PA 3EXTA 1SZEA 3A24A 4YCPA 3BW3A 1SW3A 3NQVA 4UTWA 2HSAA 2WSQA 4JD4A 1YTDA 1H5YA 4UFIA 4O0ZA 3WK1A 5FF7A 2VFIA 4NJGA 3W7KA 3G1SA 5I3HA 3CC1A 4OV9A 1JUEA 3UD6A 4E38A 4PL2A 3QRHA 1X1ZA 2ISVA 4N4QA 1JCNA 1R30A 4ICNA 4LC8A 4LRSA 3W86A 2CWNA 3WJYA 1LRQA 2H3DA 4WXZA 3C0JA 5F1VA 2NZLA 4LVAA 1R2RA 5AC6A 4QM1A 1S5TA 3NQ8A 4WY0B 2ISWA 4WXYA 3SGZA 3RFAA 4NX5A 4O17A 4Z1DA 3H53A 3L5LA 1XFBA 3KVJA 2Y89A 4UFJA 1W37A 2PRHA 1JCMP 1SO4A 1NVMA 1A5SA 2E6AA 2QUVA 1I2RA 3UNDA 3W1AA 4FNUA 1BEUA 1H1YA 1OFDA 4POCA 1G7UA 1QCWA 1OFBA 2JBMA 1ICQA 3ELFA 1KM0A 4UXDA 4CLMA 1WBJA 1L2UA 1RZMA 4GUIA 4TU1A 5HUPA 1R2SA 3W7CA 1XDLA 1XI3A 3UY7A 1JCJA 4K36A 3LI1A 4LUIA 3TAOA 5EBUA 4N2YA 3BG9A 1O5KA 4EF9A 3LCFA 1GPWA 2H3BA 2XFWA 3DI1A 2GJNA 1GEQA 1ZAIA 3MI2A 2EGZA 1TQJA 4XKYA 2YX0A 3PBWA 1TJRA 4X9SA 1GG0A 4RLIA 5KZDA 3NO5A 5BMXA 2YSWA 3IRDA 1QO2A 3H54A 4IMEA 3DU0A 2FB3A 4PODA 1VYPX 3E96A 1T99A 4S1FA 3NG3A 1UUMA 4UTWC 1VGAA 1GZGA 1FWRA 2Z0IA 5HULA 4JTHA 2H8XA 1G4SA 1KLYA 1AW5A 1YDNA 5F2GA 1QPRA 3TU9A 1VRDA 5AHIA 1XDMA 2CLOA 4X2RA 4EWND 3PBYA 2VOMA 4O50A 3MHGA 1EB3A 3TROA 3I7RA 5GVJA 3W2UA 2E6DA 2NWRA 3W70A 4FEZA 5CZTA 3LB0A 3THQA 2V5LA 2LLEA 1ONRA 3HG3A 5J5DA 3PULA 4GUHA 3KXQA 1KBJA 1LOLA 3T40A 3SI9A 3EXRA 3L66A 3G8RA 2RFGA 3NQDA 3W7IA 5KZEA 2GPTA 2FPVA 3DFQA 3NQ7A 3TDFA 4UTTA 2XN1A 3STGA 1MSSA 1TRDA 1EEPA 4NJJA 3T78A 1TPC1 3W76A 1VHNA 3NEVA 3M5XA 1SR9A 1KLZA 4O12A 3BK0A 2A4AA 3OG3A 1OF6A 3FEMA 5F2MA 1C9DA 4AF0B 1YYAA 2G95A 4JR5A 4O19A 1SZFA 3W1TA 1Y0EA 1WAUA 2YW3A 2FIQA 4XTIA 3LOTA 1FCBA 5KMYA 2NLIA 3GLCA 3QPZA 1TTQA 1XL9A 1VCVA 3NVTA 3CU2A 1MEIA 4ZQOA 4XBKA 4UFMA 3S0CA 2ZDRA 1P5BA 2F7FA 3F1QA 1V5XA 2OJPA 4NZFA 3JS3A 4QAIA 4JIPA 4ONVA 1VCGA 4UNKA 3MO7A 4LNYA 4DBEA 1FCUA 1SPQA 3IEBA 3UWVA 3G3MA 4QJ1A 2J9YA 3GKAA 4JXCA 2NV1A 1S5VA 1KTCA 2WV8A 3NL3A 3YPIA 1TO3A 4AWUA 1UBSA 1A5BA 3WJSA 1KM4A 1XBVA 2GOUA 2ZZ4A 1DQWA 2O7QA 3GXPA 2YZRA 2V81A 4BF9A 2KZHA 4RV8A 3NYZA 3S8HA 1SO5A 2GQAA 2Z6JA 3MW7A 3NA8A 3U6WA 5LNUA 4JTKA 1L9WA 1W5NA 1MXSA 5IBXA 4JN6A 1UASA 3MYOA 1W5MA 1Q6OA 5D37A 1M6JA 3UYCA 1RQHA 1AL8A 4ML9A 3TW7A 4WOQA 4JYFA 4C1LA 1TPB1 3FA5A 3TC6A 5ABTA 4ZMGA 2OMAA 3C2VA 4BI6A 2TPSA 1LLWA 4JDBA 2ZRZA 1Z41A 2I14A 1PCWA 1Q45A 3FS2A 3HMJG 3QZEA 2Z1BA 4O1BA 1NSJA 2ZZ2A 2A1YA 1SSGA 3TSBA 3P7YA 5AHNA 4A3UA 4JTFA 4TIMA 4NXKA 2RDUA 2HS6A 1HG3A 5HR6A 3W87A 3L2IA 5FI8A 5BRBA 3EX1A 1YPFA 1TPH1 4QNWA 3GAYA 5G5IA 5LGZA 1QMLA 4JY8A 3PR2A 4RJEA 4XWUA 3GNNA 3WJWA 1H7WA 3CTLA 4Z1BA 5CSSA 1TTJA 4UTKA 3MYPA 3LGEA 3MHUA 5DXYA 4JTLA 3TV8A 3O6CA 1XCFA 1OK6A 2YR1A 5TQLA 5D2XA 2CZFA 2Y62A 4PTNA 5D2YA 3W7OA 2VEKA 2WSYA 1TQXA 4H6KA 4QISA 3IGSA 1W8SA 4IGHA 2W6RA 4O4VA 5L9FA 2DZXA 5C5YA 3QQ1A 3QH2A 4OGZA 1RD5A 1U83A 3P81A 2QCGA 5FEPA 5KITA 1N8FA 1TSIA 2NX3A 4QIUA 3DXIA 1UJPA 1OVDA 4Z0SA 3W7QA 3UZ5A 1GVFA 2QAFA 3TJXA 3OEXA 4HNVA 3KRUA 4NVTA 5E93A 1YXDA 5K9XA 6ALDA 4FX8A 3ZWSA 5EY5A 4BFAA 3NQCA 4LVFA 3W1UA 4H3DA 2FPTA 2TYSA 2OT0A 4NJHA 3N9RA 5IBXC 3LHYA 2B7NA 2DP3A 5DXXA 1QO5A 1F7BA 1D3HA 3MBFA 3CEUA 1VZWA 2C0AA 5LHEA 4KFPA 3P67A 3FJLA 4GWEA 3ZR4A 3W73A 3WK3A 4CNOA 4NX0A 4A29A 3VCRA 4HIBA 3NAVA 1DVJA 4IX2A 1YPIA 4RXGA 1M7OA 4GRSA 2VFEA 2BZNA 1KFCA 4GBUA 3TQKA 1WX0A 2UV8G 1FXPA 3CIXA 3M7WA 1OJXA 1NF0A 3PAJA 4M19A 4RZ5A 3E0IA 4GUFA 5AOUA 3PUEA 3P82A 5LZLA 1YTKA 4UMAA 3NPXA 4O57A 4AH7A 3EXSA 2X1RA 5AC7A 4A21A 5I3GA 2EPHA 4JX5A 2DJLA 5CGQA 3N34A 2G97A 1XKYA 4AVFA 5CKSA 1GOXA 1SFLA 2E77A 2W79A 4GUJA 3C2OA 4ZQCA 5IM51 1FX6A 3CHVA 3NQ2A 3GR8A 4NUWA 4JX4A 3PC0A 4UTUA 3HOJA 3S1WA 4AHOA 3P80A 1QFEA 1P0KA 1A5AA 5F4WA 5G2WA 2QCCA 2V0TA 3P74A 3RLUA 3NQEA 5H2ZA 1R46A 3W1XA 2Y7EA 3N14A 4NNCA 4K8EA 4DO5A 1X1OA 3BVJA 5C54A 1SW7A 1KM2A 3PG9A 3SW6A 5I3KA 1H63A 1QPOA 2PRMA 2P10A 2RHGA 1EUAA 2GQ8A 4OHQA 1WOAA 3HB9A 5K3VA 1OYBA 1TB3A 2QKFA 2Y7FA 3C3NA 4XKYB 2QUUA 1M7PA 1I2NA 3PM6A 4N6EA 4KWVA 1VQTA 2X1TA 4FNQA 3O15A 4N4PA 3N3MA 3G0XA 4JNMA 3W74A 1N7KA 1SZGA 4LS2A 4XBSA 4NJIA 2E5DA 1JCLA 5I3JA 1QWGA 4JTEA 3EX2A 3T55A 4DELA 3HPXA 3W2KA 2OCZA 3LRKA 3PBUA 3PG8A 4Q33A 5EYWA 5F2LA 3V75A 3DBPA 3KRZA 4K39A 3W2MA 3DHFA 1B4EA 2VFFA 5H91A 2YGYA 4AB4A 4MYXA 1E51A 1T0OA 4OT7A 3WJXA 1X6UA 4FB7A 1LBFA 4KKXA 4UR7A 2B7PA 4S2BA 4Y8FA 2GJLA 5HWJA 1W0MA 1XUUA 4FF7A 4FIRA 1S5WA 4IPIA 4OQVA 2J24A 1TTPA 1XM3A 3R5EA 5G2IA 2B7OA 1LZOA 1KW1A 2C19A 4H4IA 3W1RA 3QFEA 2NXHA 3RNDA 2NXGA 1ML1A 3LXBA 1W31A 3E49A 2DORA 1K7FA 2YDAA 3O6YX 2E68A 3LXAA 1SW0A 2X30A 3OVRA 3DFNA 3QMSA 3G0SA 2YW4A 3BLEA 2Y85A 3A22A 1Q6LA 1VLIA 5LNRA 4M6QA 3LX9A 5HMSA 2QJHA 5T26A 2P1FA 4UIOA 4O15A 1N55A 1B3OA 4O1CA 1O5XA 1GG1A 2WPBA 2B7QA 3N73A 3GXTA 1KFEA 2ZA1A 3UWWA 3L5AA 4PL1A 4EOUA 2PRLA 3BLIA 3PY2A 4UR8A 1O95A 2XN2A 4HKPA 4EIVA 4WUIA 4Z1AA 4UFHA 1TIMA 3HGJA 5D38A 2H8ZA 4O14A 4YLWA 3ZFHA 3M16A 1O60A 4L4MA 3F03K 3A21A 1PE1A 3LI0A 1XUZA 4JYDA 4IQLA 2YCEA 2VXNA 3W83A 4CQ9A 3TFXA 4L4LA 5F1UA 5BOOA 5LNSA 2C18A 1GQNA 1FDJA 3OA3A 4TO8A 3VNDA 3LBCA 1FWNA 5AHLA 4U4MA 4LV4A 2Y61A 3VE7A 4LVGA 4BK9A 1OK4A 3G0UA 2C15A 3ATYA 3EX6A 1H61A 3G1XA 3NZRA 2QCDA 2DU2A 2ZTJA 3QMTA 2GUUA 3LCGA 1KFLA 4LVBA 3WJZA 1CI1A 1W5PA 3TE9A 4Y90A 2C1HA 4JGDA 2RKXA 2A7RA 2Z2UA 3ABOA 5DBTA 4QSHA 4YMZA 3MP5A 1TPWA 3HPSA 1QNVA 1DBTA 3EWBX 2J88A 1LRTA 2V2CA 1OHLA 3QYQA 2VC6A 3CM4A 1JULA 3MWAA 5CPMA 4FXSA 2WO5A 2V82A 3NPVA 4LW7A 1MEWA 3L5MA 1TV7A 1G6CA 1H7XA 4NZJA 2A5HA 3SZ8A 3I65A 1K8YA 2VFDA 4K8HA 1LOSA 1TYGA 3MP3A 4IXHA 4TR9A 6TIMA 1QPQA 4TMBA 1W5QA 4N9CA 4AXKA 4LWWA 4O10A 3IGUA 2NV2A 3M43A 3ABRA 3OBKA 4Q4KA 5DCEA 1EWEA 3UPWA 1KFBA 3EEGA 1HFBA 1F73A 3NPUA 3W9ZA 4DF2A 1XBZA 2YPIA 2PCQA 2NUXA 3CT7A 5CPLA 3TUUA 1RR2A 3BGJA 3GR7A 3NGJA 3ANYA 3GX9A 1LBMA 3NQMA 3I7QA 4IXXA 4O13A 4LV9A 3BG5A 2QF7A 1VC4A 3QSRA 2YFOA 1QDSA 1UCWA 3CLMA 3TSDA 2ZZ6A 4MIMA 3HG5A 2TMDA 3LCIA 3SFKA 4RK8A 2A7PA 1B57A 1KTBA 4BI7A 3KVKA 1ICSA 3GVGA 3UZJA 5C6MA 5EKYA 3M47A 3QPYA 4HT3A 4AAJA 5A8GA 5EMUA 5EL1A 1OFRA 3HF3A 1EPXA 2DZUA 3OVQA 1SU5A 1JR1A 2C14A 3BO9A 1YTEA 5HUOA 3GDKA 3LCLA 3GDRA 4YXGA 3H55A 4WY0F 4LUJA 1S3HA 4QQ3A 2WSRA 2X1SA 4IJBA 5D05A 3T44A 2NUWA 3UY8A 4LTSA 2QDHA 3EKLA 4OE7A 3HBLA 3LHWA 1FCQA 3NXFA 1PHWA 3C8FA 3HPZA 4IUOA 3PSWA 1W5OA 5D04C 3PVFA 1EIXA 3ABSA 4CNPA 1BWLA 2C16A 1OFPA 4I7VA 1JUBA 3FOKA 3SSJA 3NM1A 3ABQA 1A5CA 4RZ4A 3M5VA 1W56A 2DZSA 4JS3A 4GE8A 1P0NA 3FIGA 2RH9A 1R47A 4G1KA 4P2VA 1JUKA 3N2XA 1FBAA 1NEYA 3GDMA 3GK0A 3UQNA 1ALDA 3W7DA 5CPOA 5FEXA 2J9XA 1VYSX 3E12A 4RKAA 4ZZ9A 2FTPA 1FUYA 1TMHA 2IQTA 3STFA 3VI2A 3QW4B 2R8WA 5G1TA 1WV2A 1Q3NA 2VEIA 1TPUA 1UUOA 4DO4A 1SSDA 1ZENA 3G1AA 3O07A 1LORA 3EWWA 3QW3A 1H51A 4LVDA 1OX4A 1NAL1 2R91A 3FYPA 2ZTKA 3IIPA 4UCGA 3WFAA 3W7NA 1AMKA 1VR6A 3L0NA 1TREA 2G5WA 3STEA 1HUVA 3IGXA 4X3ZA 4AEOA 3FFSA 2ABAA 2ABBA 1YDOA 1DJQA 5HQEA 3FJ6A 1A50A 1ZALA 2AQWA 1AW1A 4DF1A 5LGXA 1JCYA 3KVLA 1ZHAA 3KHJA 2DZVA 1KV5A 2I9EA 1IIGA 4O8RA 1OYCA 1B4KA 4MFDA 1H60A 3GDTA 1O4UA 3JR2A 1H1ZA 4WZHA 3W1NA 3NR0A 1G4PA 2A0NA 3TQVA 4KFOA 3W23A 2V30A 3SR7A 2B4GA 2JKAA 4ZQPA 3TQ0A 4GNJA 4JTUA 1KM5A 1K8XA 3G8EA 4AWSA 1KM6A 4ZL1A 4FNSA 2Y7DA 5CG7A 3TKFA 4HHPA 2Q3OA 4M7SA 4E0CA 2OT1A 4ZQRA 2FLIA 3BV4A 1LCOA 4NXSA 1K02A 1ME7A 2DZTA 3W7LA 1W3TA 3MP4A 5KZMA 3W07A 2CLLA 2ZZ3A 3HGRA 2QCMA 2ZQ0A 3M44A 4XZ9A 3PF3A 4AWTA 2A6LA 1L6WA 1WOBA 1OG0A 3LLDA 2E09A 1I2OA 4OV4A 3MHFA 3OIXA 2ZRYA 3L65A 2HS8A 2A6NA 4IWWA 3NQGA 3EWXA 2YXGA 4NNBA 4EVZA 5LKYA 5LNVA 3W1PA 1PIIA 1YLVA 4GC4A 4N02A 2VELA 3G1YA 4HSNA 3JRKA 1T8XA 1GVQA 4MLJA 1U5JA 1NF7A 2RDTA 3DKLA 5BNKA 2CU0A 4N9BA 3GIYA 2V8ZA 4CCDA 2WQPA 3TSMA 4LS0A 3SECA 4MYAA 3FYOA 4UTHA 3C52A 1KA9F 2CZ5A 2G96A 5CPNA 1KTNA 5E1QA 5D02A 5LSMA 2CLMA 1BKSA 3HIJA 4JTGA 3M0ZA 1RVGA 1FQ0A 3DKJA 2Y70A 2JKEA 2QEZA 1NFBA 1TRIA 4IMDA 3G22A 3RF9A 3O05A 4TMCA 4R33A 1F2JA 1K7XA 3R89A 4CCCA 3GB6A 4AF0A 2QCLA 4PCFA 7TIMA 1YXCA 4P61A 2QAPA 1K03A 3SIZA 3M1ZA 4M7TA 3WK2A 3NOEA 2R94A 3P5ZA 2JK2A 1LROA 3VFLA 1KBIA 2O7SA 5DN1A 2QCDB 4DEFA 3W3OA 4MVAA 3B4UA 3LDVA 2YFNA 4BI5A 2E5BA 5I3FA 5C55A 4O28A 4CQAA 2ATSA 1YADA 2QDGA 3KX6A 5F2IA 3W6YA 4NQ1A 2ZBTA 1GJPA 3NNTA 1WQ5A 2VKZG 1WDWA 1RPXA 1X8FA 3GNDA 1ZJIA 3G1HA 3QEZA 3STCA 3W85A 3D0CA 4M6VA 3C2FA 4K7VA 5LNWA 1J2WA 3ZWTA 3BARA 2FDSA 3DFPA 3INPA 5AN7A 3ATZA 1UB3A 3R13A 2BSLA 5AFDA 3NQFA 3R12A 3N19B 3TNOA 3G3DA 1D9EA 3NL2A 4R7JA 4WX2A 1JQVA 3KFTA 5AYZA 4DPPA 4CCEA 4C1KA 5DY3A 2ZZ1A 2QR6A 1RQEA 4WJEA 4FX6M 3UWUA 4X22A 3U8GA 4ZQNA 4MZ1A 4JYEA 3Q2DA 1VH7A 3PSVA 4LU0A 5TIMA 3W7GA 4JIQA 1AG1O 2EAWA 4HSOA 3IIVA 4RCXA 3QMRA 3MJYA 3UWQA 3QJAA 3MUXA 3B03A 3S5YA 1DQXA 3PUDA 2ZRWA 4AHPA 4LT9A 3S5OA 2WNZA 2WNQA 1ZAHA 3PB2A 5HINA 2V9DA 2EKCA 1DL3A 1JRBA 2ZYFA 3I68A 3M6YA 3R8RA 4JTTA 2CZDA 3TH6A 4UTIA 1Z48A 1PS9A 4HNTA 3EB2A 3GAKA 1EWDA 4E2DA 2ZRUA 5F4XA 1JJKA 4GFSA 3W84A 1MO0A 2ZFAA 4LRTA 3B0VC 5D33A 2V2HA 1LM1A 3PS7A 5C2XA 2CLFA 1F6PA 5HWNA 1Z42A 3P5YA 1W54A 3S6DA 3W1QA 3O1NA 3O63A 3IIXA 3N9SA 4WQ6A 1SO6A 3C2RA 3MI6A 2Y7GA 1H7OA 4N9DA 3W2JA 1TJPA 3W1LA 2C13A 3HG2A 3DENA 3O6DA 1FXQA 4NNAA 4RR4A 5U7SA 3UXAA 3HO8A 5J5RA 1KV8A 4MZYA 2ZRXA 4MUZA 4MLRA 5KTLA 1ZY9A 1C29A 1H7RA 3QQ0A 4O52A 1OF8A 3CEPA 4RZ6A 3TK7A 2FPYA 1DKWA 3L21A 4IMCA 4LY8A 5DCBA 3TJLA 3C61A 3S42A 2WKJA 3ZS4A 4A2SA 1DORA 3B06A 1FDZA 4B5NA 1AK5A 4NJKA 2VENA 3TMQA 3IIOA 3W7EA 2CFFA 1OX5A 4KFNA 4FNPA 1G7VA 1F6KA 2C3ZA 3M5ZA 1LBLA 3A9IA 2CLEA 4UTLA 4OU1A 1DV7A 3KRSA 1D3GA 1HL2A 2VFGA 4JTSA 2W0UA 3EWUA 4DBDA 4MKNA 4MY8A 2CW6A 1P4CA 3TX9A 3EWZA 3WK0A 3BLFA 3A5VA 5BMWA 4O11A 5EPDA 4ZVJA 1I2QA 1GVOA 2TRSA 1J4EA 3DI0A 5CZ0A 2NX1A 2NXIA 3G18A 3BG3A 1OX4B 3NPWA 8TIMA 3DFOA 1LLZA 3QM3A 1ME9A 3LHVA 3W1MA 4E2BA 2E6FA 3B0UX 3PB0A 1CX9A 1G69A 2JKPA 3W7JA 4FXRA 1LOQA 5LHFA 3A23A 3DZ1A 3S5ZA 4JDYA 1GVSA 1PVNA 4MOZA 3B8DA 2DZWA 1GYLA 3BGGA 2C6QA 4UMBA 1RV8A 4PH6A 4ZQMA 2Q8LA 5AB3A 1JVNA 1QOQA 2H90A 4HN4A 1JCXA 3GYEA
chains in the Genus database with same CATH superfamily
5FACA 2JE8A 3CWNA 1UP0A 4LY4A 4HZ8A 3ECQA 1C8YA 4HYWA 1GHSA 4PULA 5DMYA 2BHZA 4K38A 3QZAA 4I7UA 3UXDA 1Q6EA 2YCLB 4F3HA 2QCFA 3UG3A 3W26A 1J6PA 1J12A 1OM0A 2G0WA 2XJ7A 3NWRA 4DO6A 2IKIA 1DOSA 2D73A 4FSAA 4DUOA 1QW9A 2DUAA 1IXPA 4AEEA 3M0IA 3TJ4A 1AL7A 5BXSA 1W91A 3POHA 1F05A 3QY6A 1L6SA 4B15A 3DFTA 4O0KA 4YYCA 2J7HA 3TTSA 1PCKA 3VKDA 3KRBA 4AVNA 1MEHA 4UTFA 4L7ZA 3SUVA 4DWSA 4Y9MA 3H2CA 4Z0JA 3JZUA 3GDLA 3BLOA 3OVPA 1TPDA 1R9YA 2PUZA 2FJKA 3VXGA 3EA2A 3CQ0A 5AHEA 2QCEA 4TX9A 3U5YA 4BR1A 1KO0A 5CZJA 3Q94A 3WNOA 3CIWA 1ZBVA 1F61A 4LCQA 1E6RA 4DPQA 4WD0A 3B05A 2EG7A 1XC4A 4Q8QA 1XLDA 2DQWA 3DFHA 3NDOA 2WHJA 3CUFA 1FWBC 4IG2A 5GNXA 1J5TA 1P43A 3DYPA 2HTMA 3H8AA 4Y8EA 4GX9A 2BXVA 4GGHA 4RW5A 1CGUA 3QF0A 3PZTA 1YXYA 2OTDA 5AHMA 4A22A 1V0MA 3S6TA 3LYEA 3TTEA 3CAQA 1YQ2A 2PGEA 4GC3A 3BW2A 3EDJA 1OFQA 2GQ9A 2A85A 3BICA 3RK8A 3BOXA 1JDEA 1FDYA 4BWLA 3KM8A 2Z6IA 3TXZA 2QCNA 4WY0A 4Q8WA 4FALA 4ORIA 4J7RA 3WDIA 3EDKA 1QT1A 2OODA 4E4PA 1PHQA 1LTDA 1TVLA 1IT8A 3ZT5A 1UWUA 3F4DA 1ZS2A 1WXYA 2G3IA 5IXEA 4ATLA 3EX4A 1DWFM 4RNHA 3DESA 3S5SA 4GPNA 2HRWA 1K7EA 3W7HA 3NQBA 4DAFA 3P8IA 2OEMA 3WNMA 1KM3A 3SGUA 1WBHA 4ENLA 5K4ZA 3TWBA 4IPJA 1CXLA 4O4WA 3QC3A 4XZLX 3M5YA 4O53A 5DBUA 4B91A 4XSMA 1K8ZA 3G2GA 3DAQA 3BQ5A 4X9YA 1UC4A 4UTJA 1BXBA 1L6YA 3WDPP 3JZEA 4BA0A 4H8HA 3C4UA 1XLIA 1TTIA 5FJTA 5A5WA 2Y63A 3M0KA 3G24A 3U4FA 1Z7AA 4FNTA 4GKLA 5I7GA 1PV8A 1H62A 1V6WA 1EUNA 4CD5A 3OYXA 4KBXA 1FHDA 4HNUA 1A5MC 1H7PA 2X42A 1LDCA 4H8NA 1TV3A 4GOAA 5DEZA 2OWCA 3DH7A 1PBGA 5K9DA 1W3KA 4CNUA 5CJ5A 1X98A 5A6TC 1DP0A 1M5WA 4PMOA 3QGAC 1UR4A 3WDHA 3HGSA 3IACA 3PBMA 3UEQA 4C6QA 1ZFJA 4J3SA 2I5GA 4O18A 4AZHA 1RCQA 4LS1A 1W3JA 1W3IA 4KRZA 3AWOA 1O5QA 4H6QA 2X1UA 3T4CA 5KZ6A 4OZOA 1GHRA 4NU7A 3FKRA 1Y5VA 2QJGA 5JXQA 4DBSA 3U7BA 3NZQA 1SJDA 2GVGA 3WN6A 1GYNA 1AW2A 1NQKA 2HPIA 1BTCA 4KCVA 3WX7A 1GT8A 3CUIA 2ODOA 3N1AA 4Q8OA 4NSBA 3WDRA 4Q8PA 3RCYA 3W72A 2WBGA 4I7WA 1TPEA 3DUGA 3R79A 5A2CA 3O06A 3OTRA 3KVMA 3LUTA 4MZ8A 3REQB 1IXOA 1SO3A 2PDFA 2EO7A 3FHAA 2ZX7A 4MB1A 3UCCA 2BGSA 2ISFA 2A7NA 3A4AA 2F84A 4LEQA 3EDEA 2GGJA 3ARXA 2JF7A 5TBOA 3LV6A 5CJMA 4HPJA 3WLHA 3TA6A 1SQ7A 1EC9A 5MHBA 3AROA 4J3XA 5D30A 4HOXA 1FWSA 3E9AA 3NM3A 3I3BA 4HVXA 2UWFA 1PPIA 1XDJA 2YDQA 3RU6A 4CD6A 3OYZA 3IV8A 1GZ1A 3QSTA 5E9AA 2Y8KA 2Y1HA 2A21A 3WDJA 3RPTA 3D6NA 4JTRA 5D2VA 4CU7A 1PJ9A 2VNCA 3AI0A 4IHCA 1D8CA 5HR7A 2QCHA 5DT7A 3TR2A 2UY4A 4XD6A 4HN8A 2D2HA 2AAAA 1XQKA 3M0VA 3F4WA 4DUXA 3DGRA 3GXNA 1US2A 1F76A 5HBFA 1HO4A 4GO9A 1SUXA 5A8NA 2P0IA 2YJQA 2NW0A 3VC6A 2ZXBA 3ZO9A 1KFKA 3AO0A 1UA3A 4UQBA 1TPFA 2ZA2A 4NILA 2JF6A 4ZE5A 3BPWA 2OGJA 1BHGA 3II1A 1V0NA 2RDWA 3VILA 2OPJA 2Q01A 2P3ZA 5A69A 3HN3A 5SWUA 3IVSA 2BTMA 4DWSB 4ES4A 5D9MA 4MWAD 1FCVA 3LM7A 4XB3A 1OFEA 1EL3A 2RGMA 4WCJA 1ISYA 3UWZA 3MUY1 4A05A 4HYVA 4ADUA 5MF5A 1E6QM 4ZEPA 2PDLA 4G9PA 4QE4A 1R3VA 5HWMA 1JDDA 4JTIA 3QOMA 3EMZA 2FH6A 3TFCA 2YXXA 3EXTA 1F3WA 3D47A 4YCPA 3A24A 4UBPC 3CZEA 4IIFA 4IG2B 2HSAA 3AXHA 3W7KA 2HDJA 4OV9A 4E38A 1JUEA 2WMJA 3BCFA 2V67A 1JCNA 4GQGA 4QDPA 4TVDA 4DB7A 4LC8A 4LRSA 3FW6A 3W86A 4LYRA 1CEOA 1XRVA 4WXZA 3C0JA 3UXIA 4JFSA 2EG6A 3LY0A 1S5TA 4ROQA 4IGNA 4WY0B 3TOYA 3U3HA 3GY1A 2ZUTA 2J7BA 5A6BD 3TEVA 2FVKA 1VJZA 1X8CA 3BJTA 4ZB0A 2WLZA 4Z1DA 1FH8A 1V0KA 3DYMA 1A5SA 3UR5A 2QUVA 2GGIA 3W1AA 4IQJA 4OBSA 2JBMA 4RUBA 1ICQA 3ELFA 4CLMA 5AZ1A 2FVMA 2XSAA 2YBTA 4L6DA 1RZMA 5E09A 4GUIA 1R2SA 1M68A 3T1GA 3LI1A 1GUVA 4FA3A 1XRSA 4N2YA 1J79A 3OW1A 3U9IA 3B8UA 1O5KA 1ZZMA 2Z27A 4EF9A 1GPWA 4LF2A 3W6MA 3DI1A 2GJNA 5LA1A 4IFKA 1TQJA 3A12A 2GGEA 4IM4A 3PBWA 4X9SA 1GG0A 3VNYA 2YSWA 4ICMA 4PUMA 4U2YA 1KXVA 3GUGA 4GY1A 1RBOB 1T99A 1TKKA 1HJXA 2XSXA 4E2OA 1FWRA 2Z0IA 2GK1A 4JTHA 2H8XA 1KWKA 1S2AA 3N6HA 4NKCA 3SCWA 1YDNA 5F2GA 4GVIA 1QPRA 4KWUA 1AJ0A 1J0KA 1MW1A 1VRDA 2WBKA 5AHIA 1LF1A 4X2RA 4MMWA 4O50A 5CH9A 3I7RA 4F4RA 4GINA 4YHGA 1BQCA 1JL8A 3I6EA 5A6LA 1QK0A 1ONRA 1ONEA 5J5DA 4GUHA 3C0QA 3KXQA 4DXXA 3T2PA 3L66A 3G8RA 3NQDA 5HNUA 4BY3A 2YBUA 3N4EA 3HU7A 2XN1A 3STGA 2XIMA 1VHNA 3M5XA 2BVTA 4BQ4A 2A4AA 3OG3A 4X0VA 1DJXA 5F2MA 1XHGA 1YYAA 2G95A 4O19A 1HN1A 1JAKA 2RAGA 3KOYA 3AZRA 4IF2A 1TIWA 1CYGA 5KMYA 4Z2GA 2DV0A 3NSXA 2QJNA 1XL9A 1LT7A 1BGAA 3GU1A 2ZDRA 1P5BA 1KGWA 1AD4A 3IS4A 4PB3A 3K8KA 3F1QA 3SUUA 2X41A 3VOJA 4LJ3A 3JS3A 3UP8A 3WF3A 4XAZA 3OZOA 3GO2A 4QSFA 2DFAA 3MUAA 3DCPA 4DJDD 1R3YA 3DYOA 1TO3A 3ZOAA 3OGRA 1UBSA 4AZ5A 5C9UA 1A5BA 3L4YA 1Y8BA 1DQWA 2O7QA 4R85A 3VNMA 4FR6A 3S8HA 4QBXA 4F2TA 1SO5A 2A3BA 3IUDA 1CT5A 1GNXA 3MW7A 3NA8A 3U6WA 3MANA 4KGJA 3LPGA 2QW5A 2RUSA 4JN6A 1UASA 4RZBA 3UYCA 3LPFA 3TW7A 3WQ5A 4C1LA 1K9EA 3TC6A 2YB4A 1CCWB 5M03A 3ITVA 1XR2A 4ZMGA 1UP2A 4BI6A 2PMQA 1LLWA 1Y7VA 5DO8A 3L4VA 1PCWA 3FS2A 1GK8A 4RE2A 1HZYA 3D3FA 4HNCA 2YLLA 4TIMA 5BU9A 2RDUA 2HS6A 3W87A 3N25A 1R87A 5FI8A 5BRBA 3EX1A 2QT3A 4QNWA 2X0YA 1XRFA 4RJEA 3PR2A 4W7VA 3FA3A 1R6WA 4GCXA 5FL1A 5DXYA 3O6CA 1OK6A 1KRMA 5D2XA 4S3AA 2HE8A 2ZXDA 4JIEA 2PU0A 2AL2A 1UQYA 4WSKA 3WEOA 2PU1A 2W6RA 4IGHA 3T09A 2PWGA 4LALA 3HM7A 3KWSA 1CXKA 3BE7A 2ZX9A 3W7QA 3GUWA 2QAFA 4XUYA 5BU6A 2HXUA 3VGGA 6XIMA 4YIWA 3ZWSA 5EY5A 3LS9A 1UKPA 4BFAA 1FWEC 1BSLA 4NJHA 1FFRA 5IBXC 2B7NA 2DGAA 5DQPA 4CN6A 1D3HA 1GOWA 3IJQA 4PMUA 3CEUA 1VZWA 2C0AA 5LHEA 1O12A 4KFPA 4C6LA 4P8UA 2YL6A 3FJLA 3ZR4A 1DIKA 1T40A 3WK3A 4O1FA 5H6HA 3SDOA 4A29A 2G3JA 4GXPA 2BOEX 3A3HA 5T9CE 1V08A 4IX2A 4HZMA 4RXGA 2NQJA 2BZNA 1KFCA 3TQKA 2VURA 1WX0A 2Y8VA 1QHPA 2BHUA 4Y2WA 5I00A 1NF0A 4M19A 3KBMA 1IEQA 1OCQA 5LZLA 4UMAA 3NPXA 4O57A 2E4TA 2F2KA 2G4JA 2X1RA 1X6LA 1RBAA 3D46A 1UIOA 2EPHA 3PAOA 1PTDA 2DJLA 2G97A 2Q8XA 4I8DA 1SFLA 3M0JA 4EPBC 4M81A 1IZKA 2E77A 4GUJA 1AQ0A 4KEZA 4F9DA 4EKJA 5CC5A 4ZQCA 4NUWA 1H0IA 4JX4A 1YMYA 3HOJA 1E73M 1JPDX 2V0TA 3W1XA 3CMFA 4K8EA 4PMXA 3AJ7A 3RRAA 2C1GA 2WMFA 4ML4A 1X1OA 3PPFA 4I5RA 2W5FA 3SW6A 4EK7A 1QPOA 2PRMA 8RUCA 4E8DA 4OHQA 1JDCA 3HB9A 1XYAA 2Y7FA 4IFKB 1BPLB 1QJWA 1FKWA 2QUUA 1M7PA 3B8WA 1I2NA 1DWJM 1CWYA 1VQTA 4NG3A 4N4PA 4JFVA 3N3MA 3W74A 1Q6CA 4XBSA 1CDGA 3S2JA 1JCLA 3QZ6A 1UUQA 5C9XA 1XGZA 3T55A 2XUCA 3PG8A 3V75A 3KRZA 4LCRA 4K39A 3W2MA 2GK1B 3DHFA 2A3LA 1ITUA 1NP2A 2XH2A 2DZAA 4OT7A 4MNKA 3WFZA 2VR2A 4RE0A 1BG4A 1EZ2A 2C8NA 4IL0A 4IPIA 2J24A 1A3HA 3CL8A 1TTPA 1XM3A 5G2IA 1GOIA 1LZOA 1NOFA 3BCJA 3O0KA 1R7OA 1UG6A 3QFEA 3RNDA 3T08A 5I24A 1Q8AA 2WHKA 5MKGA 4QHRA 3UW6A 2OZ3A 5CSUA 1R86A 2X30A 3OVRA 4UZUA 3BLEA 6ENLA 5I3DA 1BGGA 3A22A 5LNRA 2OOGA 2YKKA 3GTXA 3LX9A 2AMXA 3LNPA 5T26A 3FHQA 3ES7A 4BQ3A 2GLKA 1LL7A 1GQKA 1HJSA 4LCSA 2YDRA 4H7ZA 3UWWA 3PJUA 4L5ZA 2PRLA 1M65A 4FAMA 3ITTA 1O95A 2GVYA 1NOUA 2DPEA 4UFHA 1TIMA 1XISA 4YLWA 4H2HA 3WL0A 3M16A 1O60A 3PP7A 3URQA 1PE1A 4GA8A 2YCEA 2Y5SA 3ZYZA 4CQ9A 2PFHA 5F1UA 4NZ3A 5CBBA 1D7KA 1CGVA 4KIEA 3S47A 2DT3A 4ECLA 3S2MA 1ZBWA 2YB1A 4L9XA 1HL8A 4LV4A 3O9NA 2F6XA 4RNJA 3CUGA 4LVGA 3PN8A 1WP6A 3AICA 4D72A 1RLDA 3ZSSA 3MVIA 3G1XA 3NZRA 3Q67A 2WMGA 3HV8A 3NDYA 4J5NA 3QMTA 4S3JA 3W28A 1KFLA 3GVVA 4J3VA 1PZ0A 2Y5JA 1CI1A 1V4YA 2C79A 2POTA 3RX4A 3RX3A 1DJIA 4YVPA 3GC4A 3T81A 1GOKA 4Q6XA 4IPLA 2PZNA 3MP5A 1QNVA 4FOJA 1LRTA 2V2CA 1MW3A 3AU6A 3ITXA 3QYQA 3WMBA 4FXSA 4H9TA 2PDPA 1TZ7A 1S2TA 3TTYA 4ZENA 4CEXC 2VFDA 4JIHA 1W5QA 3VDHA 4PB4A 2WAGA 2R82A 3VIFA 3GW3A 3SRHA 2NVCA 3KBJA 3P3BA 4Q4PA 2NV2A 1VPQA 1K70A 4B5VA 7CGTA 2V3EA 2PZ0A 1F73A 4L6HA 5FAGA 1XBZA 3LSCA 2PCQA 2YPIA 3TUUA 4F0RA 1RR2A 3DG6A 4BF7A 1SMDA 1W3HA 2V5CA 2VRQA 1VFHA 3BG5A 1HKJA 2HVOA 2AL2B 2ZZ6A 4JHZA 3GYCA 3HG5A 4ZE4A 4PBEA 3ME3A 5TD4A 3DERA 1B3WA 3USZA 3BL3A 1MQQA 4GVGA 1KTBA 3KVKA 3GVGA 3UPMA 1UWQA 4GD0A 1XSJA 2WW5A 2XTKA 3QOKA 2QZRA 1P6WA 3AS3A 2E9BA 4LYQA 4QEHA 4PMYA 3GNRA 2VT0A 3OVQA 2NT0A 2F61A 1Q6GA 1A3XA 5HUOA 1OSEA 2QMKA 1ZJAA 3GDKA 1JF5A 3UCQA 2A3AA 4YXGA 3V18A 4US5A 1ZP4A 2X1SA 5D05A 1A80A 1E9IA 3CTTA 3GU9A 3NXFA 1IT0A 1Z6KA 5LA2A 3PSWA 3M4HA 1TX2A 1W5OA 5D04C 3PVFA 4C6DA 1EIXA 3KDNA 4H19A 1JUBA 1JZ2A 3NM1A 2FZ8A 4PGLA 1WKDA 1ISXA 3M5VA 4Z2JA 5M17A 1P0NA 3QC0A 1NJJA 2RH9A 3QXBA 1JUKA 1E0WA 1FBAA 1SM9A 3N2XA 4H9UA 4HA4A 1PXGA 3GDMA 3MCMA 2XWEA 4V28A 3E12A 3WMCA 1XG3A 1TMHA 3STFA 4B5TA 4AX7A 1VFTA 1WV2A 1Q3NA 2VEIA 3TZNA 1UUOA 1V77A 3EWWA 2QGYA 1H51A 4LVDA 4A8LA 2X09A 3FSTA 2NQ9A 3IIPA 4KMQA 1AMKA 1NDVA 1TREA 2V3FA 3IGXA 1Q63A 3R8HA 2WVUA 4X3ZA 4AEOA 2G37A 2BGNE 1BFNA 1Q4NX 1A50A 4DF1A 5LGXA 1JCYA 1KBBA 5ABHA 4D8ZA 1ZHAA 2QJMA 3KHJA 4DWSC 2XVNA 4W8LA 2UZ9A 1YKWA 4O8RA 1OYCA 4YJ5A 4WZHA 3RILA 1G4PA 1CB2A 3TQVA 4R9XA 5CAHA 2GL5A 4PMNA 4E6MA 3NSMA 3TQ0A 3WNPA 1BYCA 4HMEA 4WVXA 3WD2A 2HWGA 4TXEA 2WSKA 2Q3OA 2OT1A 2FKPA 3HPAA 2FLIA 3BLDA 4AIBA 1K02A 1ME7A 4QRNA 1W3TA 3BWWA 2D0GA 2CLLA 3DFYA 1OIFA 3HGRA 2QCMA 4A35A 4AWTA 3NO1A 2WCSA 1WOBA 1OG0A 1A4MA 5AVHA 3MHFA 5A95A 3ITLA 3L65A 2PPGA 2HS8A 2A6NA 3EDFA 3VGBA 2YXGA 2IQ0A 4DZAA 4K68A 2VELA 4HSNA 1XIDA 2W92A 4DVOA 3VGFA 2RDTA 5CPSA 2C91A 4LS0A 4MB5A 5CLTA 4MYAA 4CKQA 1OQFA 3C52A 3IJ9A 3UETA 2RJGA 4DYEA 5D02A 1Q2RA 3PZGA 3K8LA 4D6DA 3M0ZA 1FQ0A 1M7JA 2JKEA 3IANA 1TRIA 1S46A 1VEOA 3UXKA 1K7XA 4R3UA 4AF0A 4PCFA 4XD5A 3AUJA 3B8TA 1W17A 3M1ZA 3FN9A 3VA8A 1KKRA 4IIGA 2YDSA 2R94A 3P5ZA 2JK2A 3VFLA 2XIQA 3AXXA 5DN1A 1GPFA 3VAVA 3MDWA 3B4UA 3M6DA 3LDVA 3H26A 5I06A 1JXKA 3V0UA 1UR0A 5I3FA 4OOUA 2O9PA 1YADA 1VIZA 4HNLA 2QDGA 3KX6A 4J27A 3W6YA 1C7TA 3GR4A 3GNDA 1ZJIA 4WDWA 1DEDA 1J2WA 1DJZA 1TZZA 2OWWA 5AN7A 3ATZA 2BSLA 1EHNA 2CHNA 3UJ2A 3BMVA 3R12A 3N19B 1PUDA 4XZBA 2FGZA 2H9AA 3MO4A 2WMHA 4WX2A 1JQVA 3CAKA 4N7QA 1D7FA 4C1KA 1JPHA 5LYRA 3SQLA 1RQEA 1C3FA 2W91A 4JL1A 4MZ1A 4GK8A 4WGXA 4JYEA 2XZ9A 3KZPA 4LU0A 3CQKA 5TIMA 4JIQA 3IAPA 4HU0A 1F8MA 3IIVA 3R10A 4RCXA 5BROA 3F5KA 3MUXA 1W32A 3S5OA 2XH7A 2WNZA 3PB2A 3CB3A 1KNWA 3RYSA 1M9HA 2UY2A 1N8IA 3R8RA 1Z48A 1P7TA 3CPGA 3RAOA 3MJMA 4FXFA 3LENA 4I9MA 4G1NA 4JCLA 2QPXA 1B3ZA 5D33A 5EGRA 1LM1A 3PS7A 5C2XA 2GOKA 1F6PA 3EPNA 4D1IA 2IKGA 4GJJA 2CEQA 1VAHA 2Z25A 4M1RA 1W54A 3S6DA 1RVKA 2VDIA 3O1NA 3O63A 2Z24A 3TN4A 3BH4A 3MI6A 2GDQA 1CXEA 3B0YA 1XLCA 4DM1A 4AY7A 3IJ8A 1ZQ5A 1DWHM 3W1LA 3ZT6A 2C13A 3WQEA 3O6DA 1S5MA 4TQTA 3OBEA 4RR4A 5J5RA 3HO8A 1KV8A 4MZYA 2ZRXA 4MUZA 3AS0A 4AC7C 2IKHA 1C29A 1H7RA 4RZ6A 4MHBA 1HJVA 4XKMA 4IPPA 5E0FA 3S42A 2WKJA 3ZS4A 2FGLA 3DGBA 3ALFA 2OLHA 3V5OA 3B06A 3ZR5A 4B4HA 4B5NA 4AIEA 1VFSA 3BGAA 2ANUA 3IIOA 4RPQA 3VNIA 1DYSA 3A9IA 3P0XA 2E28A 4OU1A 5DRCA 3G1RA 2VFGA 3EWUA 4JN8A 2CW6A 4KIRA 1E4NA 2G8ZA 4K1GA 4Q4MA 4KRTA 4O11A 5EPDA 1UD4A 1IYXA 3C8NA 2TRSA 4QG8A 3RIKA 2ZE0A 4D6CA 1EJTC 3DI0A 4H7VA 5CZ0A 2NX1A 4XO6A 4B3KA 3H4XA 4A3RA 5I77A 1KR0A 1XD1A 2XVPA 1LLZA 3QM3A 1X39A 1ME9A 3W1MA 3RHGA 1LWJA 2DSZA 5C71A 2PDBA 3W7JA 4NAFA 4Q8TA 3K1DA 5LHFA 4B3LA 2ZX6A 3BGGA 1PKYA 3S1GA 4ZQMA 5AB3A 1IT7A 1JAEA 4PMZA 3LCHA 4S39A 2BB0A 1E3ZA 4LC6A 1WA3A 4HK5A 3S9YA 3N2MA 2PSNA 2VC7A 2OKOA 3PFMA 5G1YA 5D4YA 2FB2A 1X6NA 1PB0A 1O6IA 1DTNA 2J7GA 4GXMA 1KRCC 1BRLB 1RHCA 4DWSD 2PODA 3PWAA 2NVAA 3U4AA 3VC5A 3W6LA 5DELA 4B92A 3AIWA 1IXNA 1LLOA 2VEFA 4I3GA 2VCBA 1CB7B 1CLKA 3C3UA 1WKFA 1JPIA 1B9BA 4XAGA 4KCUA 1EA0A 1OGSA 2WZTA 2G3NA 4ALDA 4QLJA 5U4NA 4MY1A 5BXPA 1EOKA 2AGTA 4R9OA 4Y9AA 4BHYA 1AH0A 1E6XM 4IMFA 3LRMA 1QBBA 3H4WA 3BZGA 3SURA 4KS0A 3U48A 1ZBCA 1ADOA 3WIJA 3PZMA 2QJIA 4W7WA 4JICA 2E9LA 4PCSA 4AYSA 1J96A 3VPLA 3CL7A 3PTQA 1J18A 3NQ6A 4MWAE 2DZBA 2EPMX 1ITXA 1WXJA 1EP3A 3POCA 2FHFA 1SFJA 4XZWA 3GSMA 1I60A 3VE9A 4EXAA 4UTMA 2CLPA 3E6EA 1YDYA 3QR1A 4B2DA 1TA3A 4UFLA 4AYGA 2P8CA 4F66A 2V5BA 1BLIA 2PDMA 2HISA 4IX0A 1PDYA 1MNSA 1TFVA 5JBDA 1R3RA 2WMIA 4NIRA 2EJAA 1CW2A 2Z1VA 4DQWA 2CLIA 3OLIA 1WZAA 3LBOA 4HNNA 1WUFA 2E6YA 1NWUA 5FKYA 3GBEA 1E0UA 4JY9A 2YIHA 4CQDA 3LBMA 4OECA 3EA3A 2FFCA 1U5VA 4CQ8A 3K13A 3O0FA 3EKZA 2F9RA 3GKFA 3W22A 2J6XA 4DF0A 1O94A 2PP1A 2DVXA 2H9AB 4W87A 4IMGA 3S5NA 3B0PA 4S3EA 2NUYA 3N2TA 3WQ4A 2OSYA 3W7PA 1ZTVA 3CGTA 1J10A 1FRBA 1R38A 4F0SA 1PL9A 3LM3A 1L8PA 3E2RA 1UMYA 5CC3A 3GBDA 1U1UA 5BW6A 1JFHA 2O9RA 4F0HA 3B9OA 1LYXA 2I9UA 3W7MA 3LLFA 1BYDA 1WKYA 1UPPA 2GVEA 1HNYA 3Q37A 3TYAA 1F5ZA 2WJZA 3NURA 3QHNA 4K6AA 2YL8A 1RP8A 4MY9A 4C7GA 3OIHA 3P61A 2VZOA 5HATA 2OLSA 2CLHA 3USBA 4GHRA 3SRDA 3HG4A 2YYUA 1XFCA 5DLCA 4LX4A 4LOCA 1XXXA 1EJWC 1VRXA 1KXTA 1IXQA 3WMLA 2Z2AA 3G77A 3IV3A 5EA9A 3RN6A 3EZ4A 2WOQA 4H6EA 4LANA 1SZRA 4GIYA 2H6RA 4YWIA 1P1XA 1W3NA 1QATA 3P8JA 1HP4A 4CQCA 4P7OA 1Q6QA 3URNA 1RP9A 5I78A 4RX0A 1Q6RA 1QR7A 5XIAA 1SR0A 2CBVA 1TWDA 1VHCA 2Y5EA 3BAJA 4GI6A 5E0KA 4ADTA 5AC4A 4AUBA 3D3AA 3ENLA 1UWAA 3CJPA 1VS1A 4MJZA 3LHTA 1GKRA 3OQ8A 4HPXA 1T96A 2WANA 2ZWYA 1QVBA 1IR2A 4Y6GA 2UY5A 3XINA 3P62A 2FFIA 4ICCX 4AIOA 1YNYA 5CEWA 1C8VA 1PZ1A 4B9YA 2MUCA 5BOFA 3AOFA 3UWEA 4H83A 4O1AA 1R2TA 4FO4A 3PZQA 4PFHA 1OD8A 3WH9A 1E5JA 4F0LA 1OGBA 2QUNA 3B9EA 2IKJA 2Y24A 2PDYA 1IIHA 1E4MM 3BAKA 3LTPA 4HPHA 1HO1A 2WHMA 4IH3A 4CQBA 2PDJA 4GISA 4PMJA 4D8LA 3PUOA 3UPBA 1OT1A 4PMQA 5I3IA 1XYBA 4P8XA 1EF3A 3CYJA 1PTAA 3BW4A 4AG0A 4CD8A 1R9XA 2XIBA 2B81A 3TCEA 3HA1A 2QPUA 2Q09A 3KCJA 4NAFB 4QCFA 2DT0A 3VIPA 1QAPA 1E0TA 2OX1A 5HJYA 4ZBCA 4A3QA 3NO3A 1FFQA 5EFDA 1KM1A 4UCFA 1NQ6A 1DQUA 3BAXA 4F40A 1E1CA 4NT0A 1OFOA 2B31A 4HHMA 2QGHA 5B7ZA 4WHBA 4O1DA 2HJPA 3FK4A 3L7RA 2FZDA 6CGTA 4KETA 3DEQA 3S2CA 3LSBA 3UJEA 3F4NA 1XD0A 1JNDA 2A3EA 4DJFC 1XH0A 5G4EA 1XICA 2WVSA 2P50A 1XIBA 4XUGA 4OWGA 2V5JA 2P3EA 1WYIA 1UD2A 3QGKC 5LIXX 2JGQA 4FIQA 2NX9A 3RCMA 2CLKA 1UH4A 5GNZA 2AGKA 1I1XA 4AC1X 1RQBA 4W86A 1DHPA 4A3HA 3SB0A 3ARZA 4M6PA 4AD3A 2W66A 2XFFA 4MGGA 4R5EA 2UBPC 4IT1A 4DJEC 1F4HA 2R24A 3LCXA 4JFWA 1W1B1 3H2AA 4W89A 4IOTA 4XTDA 3RR1A 1EJUC 4HU3A 3LG3A 5FJUA 1V3JA 3MQTA 3SJ3A 3OB8A 1CXFA 3VGDA 5K2ZA 4PR4A 3FYYA 3QV6A 4U28A 3OBAA 3OLEA 1I8JA 1ME8A 4N0RA 5AYXA 4UR9A 4LSBA 5HMFA 5FEWA 2CIPA 3BOFA 3EOLA 3R2GA 3TYZA 1WCGA 4J9JA 1Q5MA 3MBDA 3H7RA 1ESWA 2OVLA 5K4XA 1VEPA 3B04A 3AQUA 3UERA 1VPXA 4UZSA 4RXFA 4IQDA 5HAOA 2ZZ5A 3T4WA 5E6ZA 1I1WA 4Z08A 2IQDA 2ZUNA 1TA3B 4GZIA 4DUWA 3E2QA 4AD1A 2WSQA 1XJBA 2RGLA 1CXHA 4JD4A 4L9YA 4GKTA 3RJXA 4O0ZA 3GH5A 4HTBA 2WMIB 4ZR8A 3ZSTA 1R3WA 4QGCA 2I5QA 2D1ZA 4PL2A 4QJ3B 3TLQA 4ICNA 1BD0A 4BS0A 4M6UA 3I3DA 1WDQA 4LVAA 1R2RA 3AIBA 5AC6A 4QM1A 2POZA 4ASTA 2WJEA 3NQ8A 4W4QA 2ISWA 3SGZA 2E9MA 3H53A 3PJWA 1XFBA 2Y89A 1W37A 3CO8A 3E5BA 1NVMA 2XGZA 1WDSA 4FNUA 1GONA 1BEUA 1OFDA 4POCA 3RM4A 1QCWA 1OFBA 1XH1A 4UXDA 3URBA 1V79A 1L2UA 3CV6A 4K3ZA 1GQLA 4QDWA 1XDLA 1XI3A 5A6AA 5JUVA 3AXKA 5EBUA 3VX1A 3MKKA 1E9LA 4UOZA 4AFYA 1EZWA 4JEJA 1FA2A 1VENA 1KRAC 3TR9A 3UT0A 1ZAIA 3MI2A 4PTWA 5KZDA 4PRWA 1GVYA 1E1EA 4ERGA 4JTCA 3KUMA 1RY0A 4RPPA 2FB3A 4U10A 3E96A 1WB0A 3T0BA 3MKCA 1AZ2A 3MV01 3NEHA 4W8BA 1KLYA 3MVTA 1ZBKA 3N29A 6PTDA 1HJQA 2D24A 3M46A 2CLOA 1PIGA 4RNFA 3PBYA 2VOMA 5ECUA 2X0SA 3W2UA 5CZTA 4JKKA 3LB0A 2V5LA 4H9ZA 2XM2A 3E2SA 4B4FA 1KBJA 1UWSA 3DDMA 3T40A 2RFGA 3APGA 2PWUA 2VHLA 4GIEA 3W7IA 4CN4A 3UBPC 3KTXA 1UWTA 2FPVA 3SRFA 3OOQA 3NQ7A 1M04A 1TRDA 1PDZA 3IJ6A 1ITCA 2V5DA 3T78A 2WKGA 1SR9A 3BK0A 1XLAA 3N18A 4C6NA 1OF6A 3KBNA 2XWDA 1GVEA 3VIOA 1OCBA 4PSPA 1TWIA 1Y0EA 1WAUA 2VGGA 2FIQA 1ZCCA 3LOTA 4NASA 2CXEA 3CUJA 4US6A 1FCBA 3AHVA 3GG1A 3QPZA 2X1IA 3WCZA 1J0HA 3ARWA 2Z29A 1VCVA 2L5HA 4ZQOA 4S3DA 4XBKA 1JZ3A 3CASA 4HJFA 3IARA 3EOUA 5BOEA 4G8TA 2OYMA 1B54A 3P6LA 1DPMA 3RPDA 1RA0A 4C6OA 4DBEA 1FCUA 1SPQA 4GYKA 4QJ1A 2PDUA 2PCEA 4GYFA 1S5VA 1AQHA 3YPIA 4KCWA 2GOUA 2XHYA 5C7HA 2V81A 4OVXA 4RV8A 3NYZA 3NCOA 1XRTA 3K2GA 2PLKA 4GI9A 2XGIA 5LNUA 4I8YA 4JTKA 1VFOA 3SCQA 5IBXA 3A4JA 1W5MA 1Q6OA 1EA9C 1M6JA 2FZ9A 3KHDA 1S2UA 4ML9A 3V0SA 3BOLA 4JYFA 3FA5A 2BASA 2VDGA 3VCCA 4I9JA 1C9WA 2I14A 2HROA 3TC3A 3HMJG 3IK2A 4Q4RA 2A1YA 3P7YA 5AHNA 4A3UA 1EBHA 1R5YA 3KZSA 3DHUA 1S2WA 1HG3A 5HR6A 5GJMA 1YPFA 3WQ8A 5G5IA 3B8VA 2WLYA 4MPKA 1UYQA 1QMLA 5CSSA 4UTKA 3MYPA 3LGEA 2WNWA 5CXPA 3TV8A 1FHVA 3KP1A 2Y62A 3AMDA 2GGGA 3W7OA 3GVWA 2VEKA 2WSYA 2PC8A 2VVSA 1CXIA 5C5YA 2G50A 3QQ1A 1WZLA 7ODCA 1RD5A 3P81A 5KITA 1KBKA 2NX3A 4QX4A 3T0CA 2PTWA 1M1BA 1JZ5A 4L64A 1GVFA 2R1MA 1Z89A 3TJXA 1YIXA 3OEXA 1J8VA 3ZT7A 1NELA 1R3QA 3GXDA 3KRUA 4NVTA 5E93A 3QY8A 1VPYA 5K9XA 2PLJA 4FX8A 1NP0A 3NQCA 4LVFA 3W1UA 3B8SA 1NDZA 4DX3A 4LBSA 3WBAA 3W24A 3VNZA 4D6GA 5XIMA 1QI3A 2FDMA 4HIBA 4KPLA 3TVAA 3NAVA 3QV8A 3K5XA 2J47A 3W38A 2HVNA 3QGVA 3TA9A 4ZSTA 1W2VA 3RGTA 4GBUA 4TUFA 2J78A 1DWGM 3UR2A 2AQVA 1JYNA 5C8BB 3CIXA 1HX0A 4X60A 1O5RA 2PWEA 3SCTA 4WEVX 4L80A 3E0IA 1W9BM 3P82A 1JXJA 1LWHA 4ZTYA 4QEEA 3EXSA 5IRPA 4A21A 3OU8A 5I3GA 4JX5A 3VKKA 1XKYA 3O7UA 4AVFA 1X38A 5CKSA 1GOXA 1W1TA 2WM1A 3SADA 4UQEA 3C2OA 4MKVA 3NQ2A 1XLEA 1UW9A 3FJNA 4C7DA 4QS6A 1X7IA 2ZDSA 3NIYA 4AHOA 4JTDA 1P0KA 1A5AA 5F4WA 5G2WA 2QCCA 2ZUVA 3NQEA 5H2ZA 3PNUA 4A8IA 3N14A 1V3HA 1EDTA 3S46A 1SW7A 4DNHA 3FVDA 4GVHA 5I3KA 1H63A 2RHGA 1EUAA 1OYBA 1TB3A 2QKFA 2GJRA 4HCHA 4J3TA 1K9TA 4IGSA 5ABEA 4N6EA 2X1TA 3DX5A 3OGSA 3O2LA 1TR1A 1X1NA 2Q6ZA 4LS2A 4NJIA 2E5DA 5CCZA 1KGUA 5I3JA 2YA0A 2OG9A 2BHYA 3UVIA 1QWGA 4JTEA 3EX2A 3W2KA 2WVTA 3IUHA 2DUZA 5EBAA 4TOQA 1E5NA 4Q33A 4QJ4B 3VMOA 1B4EA 2VFFA 5H91A 2YGYA 4AB4A 4PMDA 2Y0FA 1X6UA 3IRSA 4NAEA 4S2BA 1YBQA 1W0MA 1XUUA 4FIRA 1XIFA 3ZLFA 4ZSUA 2B7OA 1VFFA 4H4IA 4HTYA 3OPSA 2NXHA 1ML1A 1MUCA 4W84A 4HSHA 1K7FA 2O0TA 2E68A 2VOTA 4HOZA 3B9AA 3FDKA 3T9PA 2F8QA 3G0SA 2Y85A 1Q6LA 1VLIA 1OADA 5HMSA 3KBWA 3NSNA 2P1FA 1DIEA 2A3CA 3AALA 3GS6A 5BWFA 1OIMA 1V3LA 1GG1A 1OT2A 3N73A 3KBVA 4L56A 3L5AA 2WK2A 4JHMA 4F8XA 4WUIA 3HGJA 5JH1A 3M0HA 1EEXA 1ECEA 3MSYA 3AMGA 4JYDA 4K2SA 2VXNA 2P88A 5BOOA 1GCYA 4IMAA 1DIDA 2C18A 1P0EA 4B5WA 3ARYA 3LBCA 1FWNA 4H6RA 2AL1A 1IEXA 2OZTA 2DW7A 4UQ9A 4L65A 4F9JA 4X63A 5CBIA 4O8AA 3A47A 3G0UA 4JIIX 3L4TA 1XYMA 3EX6A 1H61A 2D0HA 2QCDA 1RALA 1RK6A 3B40A 2GUUA 4LVBA 2D0FA 1W5PA 1Z32X 3GXMA 3TE9A 3HQOA 1TV4A 1EKOA 2PDHA 5FL0A 2O92A 4ACYA 5DBTA 1F3EA 3CS2A 2ADAA 4YMZA 1TPWA 3RRXA 3KE0A 1J0ZA 1CIUA 2FZMA 4WRHA 3AIEA 1OHLA 1IZJA 4IZGA 2VC6A 1JD7A 4R7WA 2EJ1A 1F9CA 5CPMA 4YTUA 3NPVA 2R1KA 3WUEA 1MEWA 5D8WA 1XIJA 3L5MA 3CHFA 3WBYA 3FXYA 1FOBA 1NH6A 4C6FA 2J7FA 1LOSA 3MTWA 3MP3A 4NYYA 6TIMA 1QI2A 3KTSA 1UR8A 2GGHA 2ZOXA 4HA0A 2PGWA 3SN4A 4LWWA 4O10A 3IGUA 1ZL1A 2XU2A 3SQSA 4UNIA 3VOFA 1EWEA 2DIEA 1XIHA 1EYEA 3EEGA 2GDVA 4IL2A 2YLAA 4DF2A 3VKBA 3GH7A 2XYLA 1PZ2A 1V7AA 1A5LC 4C6MA 3WQOA 2W27A 1N2VA 4QLLA 8XIMA 1WZMA 2AMGA 5IFPA 5EMMA 2YFOA 1QDSA 4US5D 4D6FA 1UCWA 4GG9A 1A5UA 2QV4A 4MIMA 2EPOA 2TMDA 5EMKA 3LCIA 1NWRA 3R43A 3SFKA 4Q8VA 4R27A 2WWCA 4W93A 3UZWA 3GHTA 1QTWA 4BI7A 1E6NA 3C2YA 4H9VA 1BSIA 3UZJA 3EPMA 1E6ZA 4NZ1A 1O7AA 1UQZA 2NLYA 1OFRA 3HF3A 4HMDA 4NF7A 2QJJA 2DZUA 1BXCA 2IUZA 3ONBA 3H55A 4HCDA 5AVNA 1S3HA 4QQ3A 5BRPA 2WSRA 4IJBA 3ZVIA 3T44A 2INFA 3UY8A 3WG6A 2FMOA 2QDHA 3T8LA 3EKLA 2GSJA 3VU2A 3LHWA 3PZ9A 3WL1A 3C8FA 1EDQA 3HPZA 4NHVA 4XAYA 4CNPA 4E2VA 1JIBA 4AWEA 1DJHA 3AYRA 1Z69A 3ABQA 1V6UA 1JPKA 1A5CA 2DZSA 3FIGA 1R47A 3LMYA 4M8UA 4LQ1A 3UQNA 1LL4A 4REQA 3GIPA 5FEXA 1TWWA 1CPUA 5XINA 4RKAA 4ZZ9A 4G7FA 2OGYA 1FH9A 4QROA 5M2FX 1FUYA 1FH7A 2IQTA 4U5KA 4QTGA 2R8WA 2DUXA 4D8AA 1TPUA 4DO4A 3UJSA 4KEVA 1LORA 1AH3A 3GD6A 5JVLA 1QNPA 2ZTKA 1P1MA 3W7NA 3L0NA 4AX6A 3PPCA 2G5WA 1JYXA 4Q4OA 1HUVA 3V35A 3KOXA 1F3TA 2ABBA 1YDOA 3ZM8A 1DJQA 4I5XA 3I3EA 4XBJA 4J40A 2DZVA 1XYFA 2I9EA 1YW1A 3E74A 3JR2A 2NSOA 1HKIA 4BJHA 2A0NA 3V3WA 4V33A 3SR7A 1REQA 2PS2A 4AU0A 1KM5A 3G8EA 5HQLA 3L4WA 4NAEB 3LN3A 3U2EA 2Y7DA 5CG7A 1YBQB 1K6WA 4D71A 1E1FA 4C5YA 1G1YA 3TKFA 4M7SA 4E0CA 5JMUA 4W7UA 3BV4A 2DZTA 1RCXB 1UJQA 1EIBA 2ZZ3A 4QXIA 2ZQ0A 4YU1A 3PF3A 1B90A 2A6LA 4JTAA 5M5DA 4PBFA 2ZC8A 1I2OA 4J3WA 4AD2A 2ZRYA 3CQJA 1T41A 3W1PA 1I75A 3APYA 3MZNA 1BF2A 3WUBA 3BQ6A 1MZRA 3JRKA 4MLJA 1U5JA 1NF7A 2CU0A 4A3YA 3GIYA 2V8ZA 1IGWA 4CCDA 3C0SA 1V02A 9RUBA 2DIJA 3FYOA 5IOBA 1KA9F 2EKGA 1EGMA 2W9MA 1W1IE 2WCAA 5LSMA 4KCTA 2G3MA 2HZGA 4JTGA 4M24A 2D20A 4YS1A 4WJ8A 4XAFA 3RF9A 3S4TA 3O05A 4TMCA 1F2JA 4YVVA 4LGXA 2X8RA 3GB6A 3R7MA 5E6YA 1YXCA 3GNXA 3TQPA 4HNOA 3V5CA 4P61A 1MI3A 1K03A 2OYKA 4M7TA 1NDWA 1YHTA 1EH9A 5JQ9A 3VNJA 2BBFA 1NARA 2QCDB 4DEFA 3MUIA 5D9PA 4WF7A 2E5BA 3WLIA 2ATSA 3E1F1 1VJSA 4OJYA 2ZBTA 1GJPA 1X96A 2VKZG 1WDWA 1RPXA 2BS9A 3CBWA 3G1HA 2J7EA 1KFWA 1BKHA 2PTDA 3STCA 4M6VA 3C2FA 3EWCA 3GG8A 3ZWTA 2OZ8A 4MADA 3B3DA 3R13A 1UB3A 5TNVA 3GNPA 2I56A 4HP5A 1YRRA 3NOYA 3TNOA 1D9EA 4DPPA 3KFTA 5AYZA 4TX6A 1XLKA 2GJXA 4HB7A 4WDXA 3WNNA 2QR6A 4GI8A 2VQTA 4WJEA 3UWUA 4ZQNA 3W37A 4E8GA 1J0YA 1VH7A 3TZFA 3FGCB 1Q13A 2EAWA 4HSOA 1G5AA 5HDRA 3S3GA 3QMRA 3MJYA 3S5YA 5T91A 4HHLA 2BMBA 3C5QA 1ZAHA 1E6PA 5FJJA 2EKCA 1XC6A 2VZUA 3N2CA 1DL3A 1QBAA 4NRRA 3BANA 1G94A 2J66A 3ABXA 3QV9A 3M6YA 3T2QA 2BGQA 3XIMA 1C90A 1SYTA 3EB2A 1V02E 1EWDA 1B2YA 5F4XA 1FWAC 3VNKA 1GQIA 3VYLA 5FSDC 2ZFAA 4LRTA 3GVRA 3TN6A 4G7EA 2XVLA 4HMCA 5HXMA 3T0TA 3SM0A 1P6CA 3ZVHA 3NFUA 3PJTA 3IIXA 4INFA 2FGBA 2FMNA 3VGHA 3KEHA 3OP2A 2TODA 5M3WA 1H7OA 3H2OA 1L6GA 3W27A 1X97A 2DIKA 4PCPA 3V16A 3HG2A 3DENA 4NNAA 3EAUA 3UVAA 2PI6A 4XK2A 2J62A 1ZY9A 1V03A 3Q45A 4WDUA 2ZX5A 2FPYA 4ZOAA 1DKWA 3W4RA 2J8TA 5AECA 1XLLA 4OTKA 4JNZA 1GZJA 4EE9A 9CGTA 4A2SA 1JD9A 1PKNA 4F79A 3IJLA 5FD0A 3TN3A 4NJKA 2PGFA 4MG4A 4LPCA 1A49A 3BJFA 4FNPA 4REQB 4MSSA 3M5ZA 1F6KA 5D9NA 1OCNA 5DRIA 4MB3A 2VQUA 2GDUA 4XZHA 3H4GA 3TX9A 3MC5A 3WK0A 1C92A 4FLQA 4ZVJA 1UIPA 3KW3A 2GUBA 2WMKA 1I2QA 3UESA 1GVOA 1J4EA 3ZMRA 4PUUA 3G18A 2XFRA 4J4KA 2VI0A 1W1A1 2CKSA 3PZVA 2XIJA 4UWMA 1BQGA 4AY8A 2WCGA 3B0UX 1CX9A 1D3CA 4FXRA 3DZ1A 4DUVA 4MOZA 3B8DA 1GYLA 5H8MA 2CCRA 1RV8A 4LAUA 1WXZA 1NWSA 1XIMA 2IPJA 1JCXA 3N15A 2Z1XA 5LXXA 4IJCA 2WWDA 3BLLA 3CWOX 1REQB 2ISSA 3ERPA 3ZLHA 2GWGA 3UGRA 1XLFA 4JCMA 4ZTXA 3OVGA 4UMCA 2NWSA 1V3KA 1GJWA 1AFSA 4Y96A 3G5EA 3SCVA 5IHSA 2E1WA 3TC7A 2O4QA 2JEPA 4UC5A 3SCRA 4JEQA 1VJIA 1NU5A 1QNQA 3LU2A 3GHRA 1IEIA 2CWXA 2JGYA 2VEPA 4BQ2A 5KINA 2INZA 5EU9A 4DY1A 2E3ZA 3O8AA 3ZJ8A 2Q8ZA 4O54A 3A3XA 2R9RA 3V5FA 3LD5A 4B2DD 3A5FA 2GVLA 3MB9A 3PBVA 3NXLA 2VD8A 3L0KA 5KETA 3SJNA 5FF0A 1TCMA 1HW6A 1BVZA 2NVDA 4EWJA 4IP4A 1GKPA 2W4XA 3S1VA 1PX4A 4FMVA 4WGHA 4A8NA 3VIKA 2CZEA 1EFZA 4FLSA 1W1ZA 1KWGA 4P8WA 4J1OA 3SSZA 3TIMA 2V5KA 1EO5A 2ZADA 1P6BA 4GI4A 1ONXA 4QITA 5AKQA 3GRIA 5A94A 1KC7A 2FHBA 3QQWA 4PYSA 3MI3A 1J2BA 1CGXA 1EX1A 2EF9A 3L0GA 5G4WA 5IDIA 1IF2A 3BURA 3L4XA 1JDFA 2CKRA 1UPMB 3K4AA 5HANA 4F0KA 4V15A 1CGTA 2XIOA 4FR1A 3WLOA 3R6IA 4LH8A 2DT2A 2PC4A 3KWXA 4R53A 3P14A 1WE5A 1QPKA 2ZXQA 1OFAA 4F48A 1L6FA 3GW0A 2PTXA 3AIVA 2Y88A 3LTYA 1EP1A 1SJAA 5A2BA 2HMCA 4UUIA 1MZHA 2OELA 3GIQA 4YN5A 4A8RA 2XH4A 3I6RA 4AZ7A 4KWSA 5I07A 2CXGA 2X16A 1K9FA 2GJXB 5AHFA 1AJZA 2JIWA 1NFPA 2GWNA 4CNTA 1G4EA 3B9DA 1A3WA 3P0WA 1Q85A 1I2PA 4JL2A 3AHZA 3EMCA 4GJ1A 4W5ZA 1SFSA 4UQCA 4MPQA 4XQ6A 4N6FA 2BLEA 3LXCA 1EP2A 4WDTA 1F4AA 3UG4A 1QI0A 4C6BA 4C65A 3MMTA 1OABA 1VCFA 4A2RA 3E0LA 4XO7A 2Q71A 2ZCGA 3NL6A 4EX4A 1JZ8A 2PURA 4LB3A 1K4HA 3DG3A 4J35A 4G7EB 4C6JA 3GTHA 5K9CA 2IPGA 3ARUA 3K30A 3ZVHB 1XSIA 2XGBA 1LP6A 1YDVA 1EJSC 1ZP3A 2R14A 5FJIA 1Z8AA 2XN0A 3I7SA 1JFXA 1GORA 2BXYA 4UFKA 1K9DA 3WLRA 4S38A 4WK9A 2XM1A 1L2QA 5RUBA 3JVAA 3DECA 3LTSA 4HMNA 3KOFA 3WMSA 3ICJA 5FF3A 1WNOA 1BVWA 4ZO7A 3LZ3A 3HPFA 1UR9A 2FJUB 5GNYA 1QU4A 3LGDA 3LZ5A 3TWAA 1A53A 4RDYA 4PFMA 3P2VA 4DJFA 4XVDA 4C1NA 4D6JA 1XIEA 4AQLA 1U33A 1V3MA 3P60A 4HJWA 1E3XA 4B16A 3SCSA 4YL2A 5C70A 1D2KA 3L67A 3CV7A 1BTMA 2DVUA 4KWOA 1CGWA 5BWAA 1FWTA 1OWQA 1UH3A 3LHUA 1UHVA 1K3UA 4L4PA 4WLCA 4AZBA 3EWYA 1MUMA 3LV5A 3W2NA 4Y9PA 3AXIA 4FX7A 2YYTA 3WELA 3CV1A 1MDLA 4DJEA 3RJYA 1GTHA 3FLUA 1U22A 2DZPA 2VEMA 5D09A 3KDOA 3H2EA 4Q32A 3O16A 3N13A 2E8YA 3NGFA 5D32A 3NYDA 5H8UA 1WAWA 4GIRA 3QPEA 3PZUA 1TV8A 2RJHA 5FSEC 2EPNA 1EDGA 5HPOA 4U3AA 4A6GA 3HJZA 4ORMA 1MYRA 4GBDA 3STPA 3OO2A 4Y7EA 2PDGA 1NTHA 1U5HA 3L9CA 2ZZ7A 4JHOA 1Q4WA 4ZO6A 3AMLA 4PZVA 4H8UA 4NRSA 2Y6ZA 1TCDA 2J77A 1T7LA 1GOMA 3P93A 3PK7A 4RDVA 1JYVA 1I4NA 3G1VA 1CECA 2FVLA 1AUSL 3AJXA 4Z17A 1D8WA 2CHOA 3TCSA 1KFJA 2VO5A 3IVUA 3PNZA 3WBXA 3RPMA 3R0UA 3ITOA 3AIUA 2Q02A 4GH1A 5D03A 1HVQA 4D6IA 3C6CA 4RNIA 2WSPA 3AIQA 4YTQA 1IGSA 3L12A 4KF1A 3IPWA 3G1DA 4V2XA 4OBTA 1DXFA 2YL9A 3R1ZA 4GUGA 3LQLA 2I1OA 2WNNA 3I6TA 2GUYA 5D2TA 2J8FA 1JZ6A 3VO0A 2O9TA 4G5DA 1KQYA 4H9XA 2J9ZA 1TPVA 1V6YA 1ZCOA 2VGBA 3A13A 3BAYA 1TJ2A 1B0IA 3IGHX 5CSRA 2EPLX 2Z2BA 3CB8A 1JQXA 1IWAA 3BXWA 1UROA 1BYAA 1A0CA 4ZOEA 4L4OA 3MSRA 5A8OA 1V7YA 3WDQA 3S1XA 2ZA3A 3NZGA 1R7AA 1BAGA 4GYPC 2FTWA 1JGIA 4H2CA 2VCAA 3E02A 4HOWA 2VFHA 4YNGA 1MQPA 1MRAA 2D3LA 2XG9A 2I17A 1XX1A 3DFSA 1SZNA 4DRSA 4DXVA 4M5PA 1UOZA 1SW3A 3SIMA 4H1ZA 4XSLA 3L4UA 3SCNA 4JKLA 1H5YA 2QYGA 3WK1A 5FF7A 2VFIA 1ONWA 3G1SA 1AH4A 2NSXA 5I3HA 3CC1A 3ITYA 3UD6A 4FS9A 3QRHA 2WZEA 1KD0A 4XIMA 2PDIA 2FYMA 4N4QA 1R30A 1WPCA 2OQYA 4HHHA 2CWNA 3GG0A 3WJYA 1LRQA 3Q65A 2H3DA 4J3ZA 2NZLA 3F2DA 4M51A 4KH2A 3HZ3A 4WXYA 4QCEA 4LUYA 5CGMA 3RFAA 5HMEA 1Q8JA 5AY7A 3L5LA 4UFJA 3CUXA 2PRHA 3ZJ7A 4DYJA 2E6AA 1I2RA 3BTNA 1V3IA 1G7UA 2DH3A 3GDBA 8CGTA 1C8QA 2FTYA 2Z4GA 2MANA 2PD9A 3KL3A 4XZIA 1KCZA 1TZ9A 4TU1A 3AS2A 5HUPA 1RH9A 3RCNA 3W7CA 1EGZA 1JCJA 3AYTA 3OODA 4HK7A 4LUIA 1G01A 3T07A 3BAIA 5A8PA 1PYMA 3FVMA 2CBUA 3GTNA 3AIRA 1PWLA 1QUMA 1POKA 2H3BA 3W53A 4MAVA 2XFWA 3BAWA 4Y9NA 3G6LA 1GEQA 2DVTA 2YX0A 4UOQA 5PTDA 4HCLA 5BMXA 3IRDA 1ZSXA 3SO7A 2GFTA 4PODA 2ZKMX 3SUTA 3NG3A 1UUMA 4UTWC 1UC5A 1DWIM 4GO8A 1VBGA 3UG5A 1XSKA 5HULA 3VMPA 3VOHA 2PB1A 3EOSA 1HJWA 3EOEA 3TU9A 4MWAC 1SJBA 1QOXA 1UWIA 3F4VA 1QRQA 4L6OA 4EWND 3GM8A 5GVJA 2E6DA 2EXOA 1K1DA 1DE6A 1VKFA 4FEZA 1UZ4A 1GVIA 2LLEA 3WD4A 1S38A 4DM2A 3SCPA 3SI9A 1UKOA 4Z2HA 2GPTA 3DFQA 2FZBA 4UTTA 4S3BA 1UBPC 2YXOA 1TR9A 3E0VA 4NJJA 1CTNA 1KLZA 4D6EA 4WKHA 4C1NB 2PTZA 1C9DA 3GWQA 4JR5A 4YHEA 4QDMA 3W1TA 2OYLA 2YW3A 2J8GA 2HVMA 4XTIA 1MQRA 4CU6A 5HA7A 3HFTA 1GEHA 5CC7A 3ISIX 1TTQA 4DIAA 3S0CA 3VDCA 3RM9A 4OIFA 2BNJA 1QI5A 3WLJA 1W9VA 2F7FA 2PDNA 2VL4A 5DANA 2NV9A 4QAIA 4JIPA 4ONVA 1VCGA 3EB4A 3MO7A 4LNYA 3IEBA 3UWVA 2J9YA 3H12A 3GKAA 4JXCA 1KTCA 2VM8A 4AD4A 3URAA 3B4YA 3ARRA 3WENA 3LEPA 1GYMA 4AWUA 4LYKA 4OUEA 4U2ZA 1KM4A 1XBVA 4P7LA 3GFXA 3MA8A 1AD1A 4V1YA 2Z28A 1CZ1A 2Z6JA 1Q6DA 1U1HA 4PMVA 3VGEA 3VIJA 3SQMA 1W5NA 1F3XA 3DIPA 3OZPA 3C0LA 1AL8A 2JEQA 3RR4A 5ABTA 1TPB1 4TTGA 3GTFA 2OMAA 2R6OA 2TPSA 4O1EA 4JDBA 2ZRZA 1Z41A 5DT5A 5JU6A 1FWHC 2Z1BA 1SSGA 4GGBA 1E4IA 4JTFA 4PCNA 4NXKA 3CHDA 3BMWA 1TJ0A 3UZXA 1OGGA 3W00A 1RK5A 2VWTA 3VINA 3GAYA 4E8CA 5LGZA 1OEPA 3WJWA 1H7WA 4LBUA 4I9TA 4I5UA 3CTLA 5GJPA 3GC2A 1E72M 4PCTA 3MUZ1 3IUIA 3K4DA 3MHUA 1T6MA 1XCFA 2YR1A 2CZFA 5ECVA 3WH8A 2A3HA 5D2YA 4EPKA 3QLDA 3CL6A 1BRLA 2VRKA 5D9OA 2VP8A 3KOZA 4QISA 3IGSA 1W8SA 1B9ZA 4O4VA 5L9FA 2DZXA 1S1PA 4OGZA 1U83A 2QCGA 5FEPA 1N8FA 2ZIDA 1XLJA 3AYSA 1UJPA 3V4BA 1UKQA 3UZ5A 2FHCA 4HNVA 3TYBA 1RJQA 4P7RA 5LA0A