4IUOA

1.8 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) k170m mutant in complex with quinate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
259
Chain Sequence
NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Crystal structures of type I dehydroquinate dehydratase in complex with quinate and shikimate suggest a novel mechanism of schiff base formation.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 97
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4iuoA00
5D02A 1S3HA 2CLFA 2NV2A 1Q45A 4PFMA 3ZWSA 3E02A 5ABTA 1TYGA 4LVFA 3UZJA 3LM7A 4O17A 3H53A 3RF9A 1OX6A 3U2OA 4UTJA 1BTMA 2NX3A 5G2HA 4A29A 4RZ5A 1QO5A 1OX4A 3P62A 3QC3A 3W7IA 3W7EA 5MHBA 1H7XA 1KFKA 3W7QA 4NJHA 2Y89A 1GJPA 1E51A 4DF0A 2F7FA 3W7MA 2E09A 3PB0A 3QYQA 1SZNA 4OBTA 5D03A 2ZRXA 1I4NA 1MXSA 2NWSA 1KBIA 3L65A 3S5YA 2Y61A 2ZYFA 1F5ZA 1KLYA 1YTKA 1VLIA 3B04A 5HWNA 3W2LA 4MZYA 5F2LA 2Q3RA 3S5OA 4UFKA 4UTTA 4Y9AA 2UV8G 5U4NA 2C14A 3SW6A 5AHNA 1G69A 3QM3A 5D32A 4JTJA 4HSNA 3UYCA 2CZEA 1VJIA 3MHUA 1M7PA 3RU6A 3K30A 3E12A 3E9AA 3NAVA 1ZAJA 1O94A 4OT7A 3BG5A 3N2XA 1YXYA 3NQFA 3NQCA 1CI1A 4PL1A 1TRIA 4A21A 3W75A 2RKXA 4CQ9A 4MZ1A 1JCMP 2C1HA 2YPIA 4AAJA 1GVSA 4RZ4A 2ZFAA 1PVNA 3MP5A 5CGQA 2QAFA 3B06A 4LVAA 3M47A 2Y85A 2Q8LA 2I1OA 4Z1AA 2FDSA 3W1UA 3W7PA 4LW7A 4BWLC 1KV5A 3W2NA 1FDJA 3P80A 3W87A 3IIXA 2YFOA 4JIPA 3QRHA 5SWUA 1FWSA 4PC8A 3HG5A 1D3GA 3VKJA 1VYSX 3W2KA 1L9WA 2HSAA 2A0NA 2DJLA 4AWSA 4XUGA 3BGGA 1THFD 3TH6A 1QPQA 6TIMA 3FEMA 5LGZA 1OK6A 1EIXA 3B0VC 3C2OA 4N2YA 3WJXA 3S1VA 1H7OA 2AGKA 4K6AA 2ATSA 1AW5A 4R34A 3SZ8A 1UUOA 4XKYA 5A8GA 1JRBA 2B7OA 5EY5A 1VZWA 3BGJA 2WKJA 4NX5A 2JBMA 2GVLA 2ATMA 2V30A 3LCXA 2A6LA 1QOPA 3L0KA 3TUUA 1K8YA 1VH7A 2YYTA 1AMKA 2V5BA 3B0PA 3DFTA 3OG3A 1BKSA 4IQLA 1LDCA 2WNZA 2JK2A 2PCQA 1O60A 4R7JA 4ZMGA 1FCBA 4UTMA 1TQJA 3A5VA 3TX9A 2BXVA 1W5PA 3TFXA 3QMRA 1G4SA 3A24A 3C0JA 4D2JA 4R33A 1TRDA 4GWEA 1W3TA 4LUJA 2HS8A 4JX6A 1AK5A 3C2RA 5KTLA 3O07A 3W83A 3INPA 3LI0A 1G67A 2H3BA 2OT1A 1VYRA 2HS6A 2E1DA 3LI1A 2G95A 4EOUA 1WQ5A 4OV9A 2LLEA 3GXPA 1SZEA 4NUWA 3MBFA 2E6YA 5LKYA 3DFNA 4FNPA 4UXDA 4BI5A 5F2MA 5KZMA 1KM0A 2EPHA 2X16A 3F4WA 2PE4A 3P8JA 5K9DA 4JICA 3W1AA 1LRNA 4UTTC 2FTPA 3CIWA 4IGHA 2W0UA 1FXPA 1UB3A 2E5DA 1GYNA 3HGRA 3STEA 3PBUA 1G7UA 1C8VA 1ZHAA 2C15A 4UFMA 2RH9A 4AMAA 4FIRA 4Q4KA 3LHUA 4LVGA 2J9ZA 4OGZA 1SSGA 4UR8A 4M19A 3GZ3A 4LY8A 3MP4A 1K3UA 1F2JA 1L6WA 3NQ8A 3GXNA 5KINA 3LOTA 4JYDA 1FY6A 3EWYA 2QKFA 2Y62A 1TSIA 4N9CA 4XBKA 2J9YA 3GR7A 4OQVA 1LCOA 1LP6A 1EX5A 3NOEA 1TREA 5AHMA 3MYPA 2V2CA 1OFBA 3KVMA 3S8HA 1S5TA 3TW6A 1KTCA 3CT7A 3IIOA 4AEOA 2V81A 1WBJA 3IVTA 1EB3A 2Z2UA 5AB3A 1TV7A 3NQ6A 4GUIA 4JS3A 4DBEA 2E5BA 1JULA 1SZGA 4ADUA 3FYPA 3PC0A 3HPXA 3NQMA 1G7VA 5FEWA 4DELA 3G3MA 1GYLA 2OMAA 1HL2A 2V0TA 4M6PA 5D2YA 3EX3A 1VS1A 2GQ8A 1MEWA 4ZZ9A 5LSMA 1K8ZA 3TXZA 3M16A 3G0UA 4AWTA 2G5WA 1ZAIA 4NVTA 5D04C 3HIJA 3W1MA 5CSSA 3B0UX 2CLKA 1H61A 3EEGA 1MSSA 3UWQA 4M6QA 4AF0B 4O53A 3JR2A 1JCXA 2GQAA 3CWNA 1QR7A 3NGJA 4WJEA 5LHFA 1D3HA 1CX9A 1PIIA 3LTPA 3OVQA 5DCEA 1EEPA 4O1BA 2QCGA 2WNQA 1TO3A 3OA3A 3WK1A 3W76A 1PHQA 4Y6GA 2BSLA 3ZWTA 3PULA 1B4EA 4A22A 4AH7A 2E6DA 3VE7A 8TIMA 5L6UA 2FPVA 1XDLA 1TPFA 5HUPA 4YCPA 4PTNA 1J4EA 1G6CA 1XFBA 3PWAA 3LCIA 4WZHA 3LBCA 1FWWA 4B5NA 4JTTA 4QAIA 3S1WA 3QFEA 2A7NA 1SR9A 3TFCA 1RPXA 3EWBX 1KFBA 3KAOA 4AVFA 4K37A 4EWND 3BO9A 3NM1A 5TQLA 2X1TA 2VENA 3MBDA 3QSTA 1UASA 4Q33A 4Z1CA 1W1ZA 2Y7GA 2TYSA 4DO6A 1QWGA 4FX7A 1OFEA 1TCDA 5TBOA 2GQ9A 4GNJA 5DLCA 3I7QA 2VEMA 3LXAA 5EMUA 1YXDA 4GJ1A 2NUXA 3S42A 1FCVA 1F6KA 1C29A 3E96A 1DQWA 1OYBA 3C2FA 2JKEA 1GQNA 3QH2A 1R47A 1SU5A 5BMWA 2Z0IA 4MLRA 2I14A 2O7QA 3TMLA 3LCLA 1DOSA 3W7GA 1DBTA 3NQ7A 1SW7A 2PRMA 3RK8A 4O1DA 3T55A 3UZ5A 4LRTA 1D9EA 5I3GA 4KFNA 3TAKA 4LNYA 4DXVA 4UFHA 4KKXA 1LBMA 1Z48A 1B3OA 2VFDA 3JS3A 1ZCOA 4QQ3A 1ME8A 3VCRA 4GUGA 1GOXA 5AHLA 2Y70A 4ALDA 2E5CA 2GUUA 3NL5A 1OFAA 1U83A 2C3ZA 3IIVA 4I7VA 4QNEA 1H7RA 4UFIA 4RZ6A 2OCZA 3PG8A 3E0IA 3LCWA 3RLVA 4N6FA 4UMCA 4FX8A 2P10A 3VFLA 3M41A 4IX2A 1QCWA 5AN7A 4FXRA 3MHGA 4UFJA 3C3NA 3O6CA 3O6YX 4S2BA 4JTKA 5FEXA 1FCQA 3U6WA 4H6KA 3A21A 2ZCGA 3IGSA 3W73A 1K7XA 1LOLA 1YPFA 2TSYA 4NT0A 4AHQA 4MJZA 3L5LA 3QEZA 4ICNA 4FXSA 3PBYA 1TPDA 4PH6A 1LLWA 4TU1A 4NXKA 1KLZA 4DQWA 3GDRA 1VLWA 4O4VA 1T0OA 4M5PA 2R91A 4O57A 2ISWA 4YCOA 3DENA 3KHJA 3FOKA 1KTBA 2WPBA 5FF0A 3LHYA 4EVZA 1TMHA 5AYZA 1SO5A 3HG3A 2PRLA 2NWRA 3O15A 1FUYA 5BOOA 4LWWA 5FF3A 3PUDA 1OYAA 5G1YA 5GVJA 3DI0A 3IIPA 2Y7FA 1N55A 2ZZ1A 3A23A 4RXFA 2RHGA 3CEUA 3R2GA 4H3DA 1ME9A 4DEFA 4O52A 3W07A 4JTLA 5FEZA 4WXZA 1W37A 2C19A 3NL3A 2RDWA 4ZQRA 3W86A 1JCLA 1XUUA 4X9SA 3C6CA 3STGA 1O95A 2DZTA 1KW1A 3T7VA 2VKZG 4UTIA 3S6DA 5LGXA 4DBDA 2QCFA 3PVFA 1JQXA 4FEZA 1SO3A 3HGJA 3A22A 3I7RA 3QQ1A 3NDOA 4FNSA 3NL2A 4IMDA 4IMGA 1MO0A 3TCEA 5K7JA 1DQXA 4CQ8A 2QCNA 4MJMA 4E2DA 1OK4A 4IJBA 3MP3A 1H1ZA 4O14A 4TMBA 1ZFJA 3UXDA 3GNDA 4CNOA 3L68A 3BV4A 1B9BA 4FNQA 4HNNA 1F6PA 2QCDB 3P8IA 4JYEA 4MY8A 4WY0A 1X6UA 4NX0A 4AHOA 1WDWA 1K7EA 1NSJA 3SGUA 3WK2A 4OE7A 2A6NA 5EL1A 3OHIA 4IXHA 5H91A 1FWTA 1DKWA 4NZJA 1ICSA 3NPUA 1A50A 1TV8A 5K9CA 4NQ1A 2WOQA 4TX9A 2WNNA 2Y63A 4M7TA 1EA0A 3R12A 3HGOA 4JX4A 1RVGA 1UBSA 2ISVA 4FHAA 4Y96A 4WXYA 4O12A 1HG3A 1YXCA 3MWAA 1OFPA 1TPB1 3MI3A 3DKJA 3M5ZA 1RV8A 2I9EA 3MUXA 3PF3A 3F1QA 3QZEA 1BWKA 2ISSA 1WBHA 3LX9A 1ADOA 1FQ0A 3RLUA 3UD6A 1OABA 3SGZA 2B4GA 1JJKA 4NZFA 3C4UA 4WY0F 4Z1DA 2JKPA 1NAL1 4HIBA 4O15A 3ZFHA 3GLCA 3TQ0A 2ZDRA 1OX5A 3L2IA 3LXBA 3QQ0A 4AHPA 1LZOA 4C1LA 1ML1A 1RQEA 1P5BA 4JTUA 4K7YA 1UUMA 2XN1A 3V75A 1FDZA 3TKFA 4JD4A 4IXXA 2XN2A 2DP3A 1PS9A 2QR6A 2CW6A 4E38A 4GUFA 1XBVA 1PL9A 2EF9A 5CZ0A 2QF7A 3LDVA 4RX0A 3NPVA 1SW0A 2AQWA 3N3MA 3W71A 1KM2A 3TMQA 3HO8A 4CLMA 3LRKA 3G8EA 3RMJA 1KM5A 4O1AA 3O1NA 3LGEA 2KZHA 3TNOA 3FA5A 4WD0A 4HT3A 1RQHA 4ZQOA 4JR5A 2ZZ3A 4RLIA 2DZSA 3W1PA 1C9DA 3DFQA 4MLJA 4WOQA 3W1XA 3UWVA 3N9SA 3C56A 3W1NA 1QPRA 2E6FA 5D30A 3ABOA 2ZZ2A 1P0KA 1IXQA 1VCFA 3G1DA 2A4AA 3KRSA 1GT8A 3LXCA 3T40A 1OVDA 3I6RA 5D05A 4RR4A 3USBA 3G1VA 2YZRA 3EKZA 2BLEA 4XTIA 3G8RA 4BFAA 1PV8A 3Q37A 4IMFA 3RNDA 4W9TA 2ZBTA 4JTEA 4PEKA 1HTIA 5BRBA 3KVJA 5K3VA 3AJXA 3EXRA 1TB3A 1V5XA 3AO0A 1OHLA 1SO6A 3PS7A 3GDTA 2FFCA 4HSOA 3TK7A 4Y8FA 1V7YA 2HTMA 3YPIA 5I3JA 3RFAA 3CB8A 3LBMA 2A7RA 2ZTKA 1T8XA 4MFDA 2DJXA 4HPJA 1G4TA 3ANYA 2CZ5A 2TPSA 2NXHA 3W7LA 2Z6JA 3EWZA 4O18A 3W22A 3PY2A 3C2VA 4K8EA 4WQ6A 2QDHA 3TC6A 3UXAA 4N02A 5C54A 2JGYA 4FNTA 5AC8A 3ABRA 3W1LA 3W85A 4WOZA 2QCMA 3G1XA 1QMLA 3VNDA 1GVQA 1AL8A 3IRDA 1JUBA 3WFAA 1SFJA 2VFGA 3L66A 4IPIA 3C8FA 3W9ZA 1OX4B 3LLFA 1W5QA 3NVTA 1F73A 2FIQA 1XBZA 3CTLA 3NL6A 1GVFA 2OJPA 1VRDA 2ZA3A 3CM4A 4PODA 5KITA 4JEQA 3SJ3A 3GKAA 1GTHA 5AYYA 1TPC1 3LTYA 5U7SA 1IIHA 2DORA 3B03A 1R46A 2FJKA 4X2RA 1W5OA 2X1UA 5D2VA 3WJSA 3KX6A 5FEPA 2YW3A 1Z42A 3LRMA 3DKLA 4XZ9A 3ABSA 3BW3A 3STCA 1H1YA 2FB2A 3HOJA 2J9XA 4FF7A 1I2PA 4L4LA 2B7QA 3W7DA 4CQAA 3L0NA 4M7SA 4A2SA 1R2SA 1A5CA 2A7PA 1P0NA 3L21A 4JIQA 5G5IA 2D73A 3MHFA 4XBSA 4FB7A 4UMBA 2GVGA 3LERA 4AXKA 1GVRA 4LOCA 3MI6A 3SFKA 3VE9A 3DZ1A 3S1XA 1R30A 4LTSA 5CPNA 2G96A 3EWXA 3PR2A 5AOUA 3HMJG 3HJZA 1OFDA 5HWMA 1YDNA 3M0ZA 1VYPX 5DN1A 1WOAA 4O1CA 1QO2A 3M5XA 4BR1A 5LZLA 5DXXA 1DJNA 1AW1A 3L5AA 3LHWA 5G1TA 2ZRUA 1BWLA 2VEIA 5FF7A 4GC4A 1Q3NA 1Q6QA 4PA8A 3GAYA 4JYFA 3UWYA 2X2GA 3M7WA 1KFLA 1YDOA 6ALDA 2B7PA 3N34A 5G2WA 2NV1A 3SIZA 3G22A 3S0CA 3FKKA 4JNMA 5CPOA 5F1VA 4EF9A 1GEQA 2EAWA 3W7NA 2CLHA 3EX4A 4XKYB 4ADTA 3UY8A 1IGSA 4ONVA 1XBXA 3NQAA 4ZQPA 1OG0A 1TTQA 3W1QA 2CWNA 3LRLA 3EX6A 1ICQA 1KFEA 5J5DA 2RDTA 4UTWA 2P1FA 3LB0A 4CCEA 2WV8A 3WK3A 5CSRA 1WXJA 3QW3A 3TU9A 5F2GA 4NJJA 3SSJA 3TE9A 3EWWA 3DU0A 1M7OA 3DHDA 3GKFA 1L2UA 5CPLA 1JR1A 3TDFA 1O5XA 4O0ZA 3P5ZA 4RJEA 2QDGA 1OFQA 4A3UA 2V9DA 4P61A 1LBLA 2DZPA 3W2JA 2CLIA 2WO5A 5AFDA 1H60A 5K4ZA 3UWZA 3I68A 2ZRVA 1FDYA 2VELA 4OWGA 4Y90A 4PL2A 2HMCA 1HFBA 1JCNA 3SECA 3OBKA 4ZQNA 3DFOA 1RZMA 2VFIA 2VXNA 3OVPA 1H7NA 1H7PA 4EIVA 3N73A 1F7BA 3M1ZA 4LS2A 3Q2DA 1ZAHA 1LLZA 3M43A 1K7FA 1QAPA 3EWUA 4HNTA 1W56A 4P2VA 3EX2A 3P82A 2EGZA 3I65A 1KM3A 2P0OA 2XFWA 3PBWA 1H63A 2OZ0A 1VGAA 4O11A 4U28A 2CFFA 4LU0A 2QJGA 3W72A 1LBFA 4FNRA 1I8JA 3NO5A 4MKNA 4WX2A 4O0KA 2X1RA 3E49A 5E0KA 3W1RA 1TTPA 5I3IA 2QCDA 2QUUA 4LS1A 4CNPA 1IIGA 1MZHA 5HJLA 3QPZA 3MJYA 3L67A 4NNBA 4AWUA 2ZZ5A 4YXGA 4OHQA 3ELFA 4FIQA 1VCVA 3JRKA 3QSRA 3TQVA 4L4MA 3P61A 4O16A 4UC5A 3W7HA 5DCDA 3TC7A 3LTSA 3IIZA 2WSYA 3P7YA 3PSWA 3PSVA 3WJWA 3W88A 1XL9A 1P4CA 1EPXA 1H62A 2CLEA 3PUEA 3MW7A 2CLMA 1YPIA 3O8AA 3I7SA 4HPXA 2YR1A 3IGXA 4LRSA 3N14A 1WX0A 4JGDA 3WJZA 5BW6A 3WK0A 2FQIA 1TPWA 4KWWA 2VFFA 2FPTA 4NU7A 3G3DA 3W7KA 1A5BA 1ONRA 4X22A 3GDKA 4O10A 3F4NA 3M5YA 3W7JA 5EPDA 1K02A 3LHVA 5DY2A 5C6MA 4PCFA 3DAQA 4IMCA 1JRCA 2C16A 2X1SA 5F4SA 2NUYA 2V5LA 1ZNNA 1W5MA 3M9YA 4UTWC 1KV8A 1G4EA 4K8HA 1EWDA 4TO8A 1VCGA 2O7SA 2Y88A 1LRTA 4Q32A 1LTDA 4GE8A 2H3DA 4KFOA 3MI2A 4O54A 2QCCA 1UJPA 3G1FA 3G1AA 4I7UA 4A2RA 4K39A 3QJAA 4KWVA 5IBXA 3BLEA 4DPPA 5D2XA 3TW7A 1FWRA 1A5SA 4O4WA 5F4XA 1SUXA 2CZFA 2YYUA 3BLFA 5FI8A 1EUAA 5HULA 4ORIA 4DPQA 4GRSA 2YX0A 1I2OA 4RV8A 4O28A 2PC4A 2YCEA 1QNVA 3EB2A 3B05A 2J88A 5I3KA 3U8GA 1X1ZA 3CIXA 3GB6A 4GUJA 4LVDA 3THQA 3STFA 3BARA 1Z44A 7TIMA 2Y7EA 1XKYA 3KFTA 3GYEA 4K7VA 3A9IA 4MVAA 2R94A 3GX9A 2ZZ6A 5F1UA 3SY5A 3HB9A 1T96A 1W0MA 3DI1A 1NF7A 1VQTA 1ME7A 2WSQA 3NXFA 3OEXA 3D0CA 4NJKA 1H50A 3M5VA 3ZR4A 3UWUA 5F2IA 2DZWA 1DJQA 3FYOA 4DF2A 2BX7A 5EBUA 1ICPA 4NJIA 2ZRYA 2QJIA 1SZFA 3L0GA 3TV8A 5EYWA 2X30A 4UMAA 3CC1A 2Q8ZA 1UCWA 5HWJA 1HO1A 1OYCA 1XUZA 3N19B 2ZA2A 1WOBA 3NQGA 2BZNA 4LUIA 4OU1A 4J9JA 4JTGA 5L9FA 3UPWA 4GBUA 4JY8A 3V1PA 3LV6A 1H5YA 3QMSA 5HR6A 3LLDA 4HKPA 1R2RA 3L5MA 2NLIA 5G4WA 4RCXA 2VOMA 4DF1A 3KOFA 3FFSA 5FESA 1TIMA 2ABAA 1VR6A 3W1TA 1IXNA 1GZGA 1B57A 4UTLA 1KTNA 3M44A 1W8SA 4QNWA 3DXIA 2RDUA 2GJNA 4GXMA 3UY7A 1I2NA 5LHEA 3G18A 3Q58A 2R14A 2XN0A 3HG4A 4JTIA 5FF2A 4DO5A 3ATZA 1QDSA 1SW3A 3HGSA 4YWIA 4UTUA 1IXOA 4Z1BA 3W2MA 2V8ZA 2A1YA 3VI2A 3QPYA 4BK9A 3IVUA 4S2CA 3P67A 3NM3A 1GPWA 4CCCA 4OV4A 3HPZA 3EXTA 1KFCA 2DZVA 5AHEA 1EP3A 2QEZA 4QITA 3T44A 2VFEA 1XCFA 3BPWA 4M6VA 1I2RA 2B0MA 5CZSA 4BI6A 1AG1O 1TPEA 4TMCA 5T26A 1VC4A 3O63A 3P84A 1KBJA 4QSHA 4LVBA 3MMTA 4XQ6A 3G1YA 1ZJIA 4CNNA 2TMDA 1GG1A 1PHWA 2CLLA 3UPBA 3DHFA 2JKAA 3LCFA 4X3ZA 5LNWA 1KM4A 3P81A 3GR8A 5IBXC 1KM1A 2YW4A 4UTHA 5FF4A 2VEKA 5CPMA 2TRSA 3QW4B 4RK8A 1S5WA 1MEIA 4MIMA 5C5YA 3FKRA 5C2XA 4MOZA 4UFLA 3B4UA 5DXYA 2GPTA 3W7RA 1EP1A 5H2ZA 1FX6A 1I2QA 1IXPA 3TJLA 4TR9A 5DCBA 3CQ0A 3Q94A 1SFLA 4JDYA 4E2BA 2AAMA 1H7WA 4IX0A 4ZQMA 3C52A 3W23A 5D2TA 1ZY9A 1JQVA 2EKCA 3HBLA 5IM51 5HR7A 5D09A 2WQPA 1CW2A 1L6SA 2B7NA 1RD5A 2QCEA 4AF0A 2GJLA 2EHHA 2NXGA 1OF8A 4S1FA 5D38A 4MY1A 3NNTA 1WAUA 3CWOX 4UNKA 4I9AA 4N4PA 2IQTA 3HPSA 1X7FA 1W54A 3NR0A 3HQ1A 3GXTA 2DZUA 3CHVA 4ORMA 3R89A 3SI9A 4EF8A 1G4PA 2RFGA 2A85A 3KVKA 4QJ1A 1BEUA 2ZA1A 3G1HA 5G4EA 4WY0B 1NEYA 4POCA 5BNKA 5AHFA 3H54A 2C18A 1RR2A 3BW2A 3WJYA 2C13A 3PBVA 4JTFA 2ZZ4A 2FB3A 4BI7A 4IMEA 1JCYA 1W31A 2ALDA 4Z0JA 2C6QA 2A21A 1QPNA 3GIYA 1OJXA 3LHZA 5HNRA 1T99A 1SO4A 4YLWA 2Y6ZA 5F4WA 4R53A 2DU2A 5I3HA 3G24A 1YTEA 3MYOA 5AYXA 4MYAA 4U4MA 4XTDA 3NQ2A 3GVGA 1SQ7A 5AHIA 4O8RA 4N9BA 2J27A 2W79A 5KZDA 5D33A 1PCKA 2ABBA 3S9YA 3TA6A 3CPRA 5AC7A 4UR7A 1LROA 4JTHA 3NPWA 5DY3A 2DZXA 3T78A 5DELA 1F76A 2FPYA 1Q6RA 4NXSA 3GAKA 3NYZA 3P60A 1VPXA 3W84A 2W6RA 2ZRWA 1TJRA 3W3OA 1TPH1 3ATYA 2JGQA 4HNUA 4N4QA 5CZJA 1DV7A 3CEPA 3OVRA 2VC6A 3NA8A 3F03K 3TAOA 3L9CA 2PURA 1K8XA 1XBYA 3TSDA 2VFHA 1TTIA 1N7KA 2A5HA 1J2WA 3P5YA 4HN4A 2NXIA 1GVOA 4JX5A 1GG0A 4IWWA 1MEHA 3BG9A 1K03A 5LNSA 4MUZA 4ML9A 5EKYA 3S1UA 4C1KA 3O06A 1B4KA 2QCLA 4JN6A 4LS0A 4QM1A 2OX1A 1FCUA 3TIMA 3TQKA 1NVMA 4RKAA 3R5EA 3C61A 4JDBA 2H8ZA 5HINA 1P1XA 4AB4A 2ZZ7A 5E1QA 3FLUA 3FIGA 1GTEA 1FXQA 1LM1A 3EKLA 3PUOA 1OFOA 4O13A 5DBUA 5BMXA 5CG7A 1Q6OA 1FBAA 3W2UA 4E0CA 1ZENA 4ZL1A 4XWUA 1F74A 2R8WA 3KRUA 3O6DA 5A5WA 1TTJA 2YSWA 3DFSA 3W7CA 3B8DA 5HUOA 1TJPA 3IVSA 4DO4A 1AW2A 5K9XA 4BF9A 3FJLA 3UWWA 3TSMA 1L6YA 2H90A 2BWGA 1YADA 1QPOA 4RXGA 1Y0EA 4MFEA 3GNNA 3NQVA 5D37A 3W70A 4LC6A 5LNRA 4HNVA 3KXQA 4JTSA 3TJXA 3NEVA 1WA3A 3CU2A 1KM6A 1XC4A 3HG2A 1H51A 3FS2A 2J6XA 3W6YA 4LC8A 1JUEA 3DBPA 4MYXA 5KSWA 5LNUA 4UIOA 4LV9A 4O50A 4MPQA 2VEPA 3H55A 3LCHA 4TIMA 1A53A 2V2HA 4K38A 1IF2A 1Q6LA 3DGRA 4JXCA 1VHCA 3M6YA 1W3NA 4QIUA 3T4CA 2ZTJA 4GFSA 3ZS4A 3BLIA 3PB2A 1EP2A 2CLOA 2QAPA 3MO7A 4UUIA 4IOTA 2NZLA 5E93A 4UNLA 1WV2A 2YXGA 3O05A 3TXVA 1XM3A 2Q3OA 4FO4A 4GUHA 1W3IA 4IPJA 5K4XA 4LV4A 3O16A 2H6RA 3GDLA 4Z08A 1WYIA 2C0AA 1JUKA 5D2WA 3QMTA 2Z1BA 5G2IA 1LRQA 3NZRA 3TSBA 5J5RA 2ZRZA 1PE1A 2CZDA 1YTDA 1DVJA 4N9DA 1PCWA 5HQEA 5KZEA 2YFNA 3BVJA 4N6EA 4NNAA 3OIXA 3NG3A 4K36A 1YLVA 5CZTA 3R8RA 2NX9A 3GDMA 4NJGA 1VHNA 2F84A 1X8FA 1JVNA 1KFJA 1ALDA 1Z41A 3LV5A 4YL2A 4N9EA 2QCHA 1QOQA 3NQEA 3LCGA 1EWEA 1TQXA 1SPQA 2BTMA 1QFEA 3CLMA 2QJHA 3HF3A 1F05A 2NUWA 3IV3A 2PRHA 3C2EA 3A5FA 3BW4A 1TPUA 3TROA 2Z6IA 2A2IA 1DHPA 2E77A 1KA9F 3NZ1A 5K2ZA 1XDMA 3BG3A 1JCJA 3BK0A 3GK0A 1OFRA 4I7WA 2YDAA 5EA9A 4KFPA 1U5JA 1LYXA 2G97A 1DL3A 4QISA 1S5VA 2GOUA 1X1OA 2FLIA 2E6AA 5CKSA 1YYAA 5I3FA 1N8FA 2GVJA 1ZALA 3LHTA 3THAA 2QUVA 3DH7A 4MZ8A 1W5NA 4WUIA 1RQBA 1AL7A 1HO4A 1TV5A 4O19A 1J5TA 1LORA 3N2MA 4JY9A 3EXSA 1M5WA 3QF0A 4HHPA 3UNDA 4YMZA 1DORA 4H4IA 3DFPA 3ABQA 1FWNA 4MY9A 4FNUA 1TPVA 3P74A 1EUNA 1O5KA 1XI3A 2ZQ0A 3EX1A 4BWLA 4UCGA 3PM6A 1OF6A 4Z0SA 4ADSA 4NNCA 3KRZA 2J24A 3R13A 1A5AA 2QUTA 3UQNA 2OT0A 3G1SA 4G1KA 4LT9A 3IEBA 2WJZA 2YGYA 3FJ6A 2WSRA 1XXXA 3KVLA 1HUVA 3TR2A 2H8XA 3PG9A 1NF0A 4FX6M 5LNVA 2Y7DA 5DBTA 4ZVJA 1GWJA 1LOQA 4CCDA 2E68A 2V2DA 2NX1A 3IGUA 3W74A 1NFBA 3W7OA 1SSDA 3NQDA 5C55A 5TIMA 1R2TA 1LOSA 3G0XA 3PAJA 3S5NA 5KMYA 1YDVA 4UTKA 3SR7A 1I45A 2CU0A 3G0SA 3S5ZA 3NPXA 3N9RA 4IUOA 5AC6A 1M6JA 5HMSA 4ZQCA 1O4UA 2V82A
chains in the Genus database with same CATH superfamily
4ATWA 1XLCA 1WZKA 2V3GA 4GYJA 2NV2A 2BODX 4IT1A 2CXEA 3UZJA 3T2QA 1K6AA 5CCZA 4PMXA 1UWUA 3H53A 2V6AA 4FI4A 3PJWA 3S6OA 3GW0A 4UTJA 1BTMA 4E5TA 5CZKA 3HQNA 1DE6A 4DWSB 3QC3A 3W7IA 3CTTA 3DN5A 1UBPC 2F61A 1GJPA 2R24A 3UGRA 2VL4A 3D6NA 2F7FA 2DV0A 2E09A 3G1RA 3GHSA 3QYQA 5D03A 5A6KA 4OOUA 1BVNP 3FK4A 1MXSA 2NWSA 4Q8MA 4KRZA 3L65A 1U33A 1JDFA 2Y61A 1L6FA 1F5ZA 1MQQA 3W2LA 4UTTA 4Q4MA 5U4NA 2QZRA 2UV8G 4QQUA 5JIWA 5DEZA 5D32A 4JTJA 6REQA 4HSNA 4GISA 1S2TA 1LT7A 2X0SA 1EOMA 1PSCA 3RU6A 2CC0A 4PUEA 1ZAJA 1KKRA 3MKVA 3NQCA 2NQHA 1W2VA 2RKXA 1JCMP 2C1HA 3UXIA 4A3YA 1PVNA 2QAFA 3R4IA 1OT2A 3M47A 2Y85A 4Z1AA 4MPKA 3W7PA 4LW7A 3NSMA 1FDJA 4E2OA 2CNCA 4DJFC 3IIXA 3MVTA 3QRHA 2OZ8A 1AZ1A 3UU0A 3VKJA 3W2KA 3EMZA 4IP5A 2A0NA 2VQTA 3OB8A 1Q85A 2WSKA 2ZX8A 3PZIA 1IV8A 1ZP4A 3B0VC 3WJXA 3S1VA 4YTTA 3CQKA 4K6AA 2ATSA 4E6MA 4F2TA 4IUGA 4AZCB 2B7OA 3VAVA 3KRBA 4IGSA 4PYSA 3B8UA 4E8CA 1P0BA 2V30A 3TUUA 3TN3A 4GZEA 1K8YA 1VH7A 4WSKA 1L8NA 4RDWA 4H01A 3OG3A 1REQB 3VNMA 2PDCA 5A8PA 4XO6A 4KQNA 4GH1A 2HE5A 4P8WA 1O60A 2G37A 2VNCA 1JZ5A 2E4TA 2PDYA 2VD9A 2PDHA 3FJ4A 5BWFA 4GWEA 1W3TA 4IIEA 5A6MA 1NOFA 2HS8A 1AK5A 2OLHA 3C2RA 1EDGA 3IUIA 3INPA 3LI0A 3RCNA 3G77A 2OT1A 4GY0A 2E1DA 4OJYA 3AMLA 2LLEA 2WMHA 3GXPA 4QDMA 2G3NA 4AD5A 2INZA 3MS8A 1OIMA 4FNPA 4UXDA 3N2TA 1IE7C 3RN6A 5F2MA 2X7VA 4GXPA 2X16A 3F4WA 3BAXA 4EPKA 4JICA 4ZO7A 2FTPA 3E0VA 3DESA 4IGHA 3OW1A 4L5ZA 4JFTA 1F3XA 4G9PA 4YNGA 5FKYA 2WB5A 2EPOA 1ZLPA 3MU7A 2VR5A 1SYTA 1C8VA 3CMGA 3L12A 3UGVA 4EP8C 5E0FA 4FPSA 3CHFA 1R3VA 1V0LA 4Q4KA 3BLLA 4GO8A 4PMZA 2J9ZA 1E6ZA 4M19A 1F2JA 2WVTA 1E3ZA 4XZMX 2E9LA 3BDKA 3FVDA 3LOTA 3NQBA 5HANA 3UG4A 1VEOA 3W37A 1EO5A 2J9YA 4OQVA 1A5MC 3E5BA 4KH2A 5TD4A 1F8IA 3T0CA 3Q65A 3PTDA 4B9YA 3NIYA 1QUMA 4YTUA 1S5TA 1KTCA 2FMNA 4NF7A 3OGSA 1KXTA 3D46A 4LYKA 4EAMA 1TELA 2C0HA 4Z2IA 4GUIA 2BVYA 4L7ZA 4EK7A 3W6LA 3UWEA 2Y2WA 1CPUA 5GJNA 4DUWA 5I06A 1SZGA 2O92A 4I9TA 4ADUA 3PC0A 5A8NA 4YVXA 4WKHA 5FEWA 3G3MA 3KBSA 1GYLA 3AHZA 3V0TA 4F0RA 2OYMA 4B5UA 3E2RA 1NY1A 2XM1A 4F9JA 4AXNA 2XISA 3WBXA 2O9RA 4AWTA 4LFYA 3IS4A 3QGVA 4TVUA 2G5WA 3GXDA 5D04C 4HMEA 1QNRA 3ES7A 5CSSA 1H61A 3PBGA 1G0CA 3EEGA 1PTAA 1MDRA 4AF0B 1GJWA 4JNZA 1QR7A 4AZHA 4JEJA 1CX9A 4O1BA 1UH3A 2EPMX 2QCGA 2WNQA 4R3UA 1TMQA 3MTWA 4GKTA 1PHQA 1UWAA 2BSLA 2E9BA 3EOEA 2FPVA 1R3WA 5EMKA 2EPNA 3EEZA 3TLLA 3FGCA 4C7DA 3LCIA 2PMQA 3PPGA 1L0PA 3SQLA 4JTTA 4QAIA 3S1WA 3H7UA 5IHSA 1SR9A 1KFBA 3KAOA 4AVFA 4XZLX 2NV9A 2X1TA 3MWCA 4Q33A 2ANUA 4Z1CA 2CPUA 2TYSA 1QVBA 2PC8A 3GXIA 2J62A 2GQ9A 3I7QA 2XM2A 1YXDA 1C29A 4GQRA 2X41A 4BF7A 1OYBA 3C2FA 3S47A 1J0HA 3CGTA 2XVNA 1K8CA 1SU5A 5BMWA 5C7HA 3LCLA 1DOSA 2DFAA 3SADA 2J7EA 3GXMA 3UZ5A 1P43A 1NM9A 4QTGA 2VO5A 3TAKA 1ECEA 4XD4A 2WNWA 2WWDA 2VFDA 1ME8A 3VCRA 1CGVA 4GI6A 4HTBA 1UMYA 3IIVA 3UR8A 4I7VA 4XG1A 2W67A 4AX7A 2O4QA 1H7RA 3AMKA 4HD5A 4J40A 1OZQA 3EDFA 2IUZA 4QRNA 1XLEA 3VFLA 3COTA 3K13A 4IX2A 2WKGA 4FXRA 3MHGA 4JQ3A 4GYPA 3O6YX 4AWEA 5FEXA 1DWAM 3A4XA 3W73A 1YPFA 2O55A 4AHQA 4MJZA 4C5YA 3L5LA 7ENLA 4IG2B 4FF5A 1LLWA 2PDKA 2W9MA 3ZJKA 4NXKA 1XC6A 2DZBA 1OGSA 2ADAA 1H2JA 2DT0A 4O4VA 4PMVA 1I0DA 4M5PA 4O57A 3T0AA 4Z1YA 3FOKA 1KTBA 1ITUA 1VFSA 4EVZA 1KFWA 1TMHA 1FWJC 1PJ9A 1PZ3A 3C86A 5BOOA 3VD5A 1GW1A 2Y7FA 1N55A 2HNHA 4W8LA 4AQLA 2ZZ1A 1NELA 2IPFA 4RXFA 4H3DA 1ME9A 4DEFA 2FZNA 1RH9A 3ENLA 1VF8A 4NI8A 1GHRA 2C19A 4IGMA 3C6CA 3STGA 1O95A 2Z2AA 2EPKX 3T7VA 3AU2A 2AKZA 3PVFA 3PJUA 4FEZA 4V28A 5LA0A 1A5UA 4FNSA 4IMGA 4R7WA 1M41A 2QCNA 4MJMA 4WSJA 4E2DA 4IJBA 4TMBA 2WANA 3L4TA 3F4VA 4JIIX 4CNOA 1AQHA 3BV4A 1TUXA 4DJED 4H9MA 4ZO6A 2BGQA 4HNNA 3DG6A 3CIVA 3VNZA 2QCDB 4MY8A 2YDQA 4PBFA 2XVLA 3CO8A 4AHOA 4ACZB 1TMLA 3PTQA 3N2CA 4WDXA 3IRSA 4NZJA 2VI0A 4WIWA 1ICSA 3QZ6A 3T08A 4D8ZA 1TV8A 5K9CA 3QOKA 1E40A 2Y63A 4M7TA 1KR1A 5AZ0A 5I0DA 4CVWA 2IMRA 1FWIC 2IXVA 3IV8A 4CU8A 2L5HA 4Y96A 4NKCA 1HG3A 4O12A 1CXHA 2XZ7A 7REQA 1TPB1 4ZE4A 1DP0A 1RV8A 3PF3A 3QZEA 2GJRA 3KP0A 3OVGA 3LX9A 4KPLA 1JJKA 5D9MA 1NAL1 3ZFHA 3GLCA 2ZDRA 3RIKA 3L2IA 4C1LA 2QW5A 4QS5A 3APYA 1FFQA 1FDZA 3TKFA 3QKZA 3G6LA 2XN2A 4GBDA 4HTYA 2V69A 4HCHA 2DDXA 2QR6A 1KBKA 4IFRA 4FAMA 1XBVA 2VZUA 5A8OA 2XH2A 4OOZA 1SW0A 2AQWA 3N3MA 2WC3A 4CLMA 1K77A 1PDYA 1MI3A 5HXMA 3TYEA 3V1HA 1U1JA 2W63A 1N8IA 3TNOA 3FA5A 4WD0A 2NQZA 4K8GA 3G2GA 4IISA 2Z25A 2DZSA 3W1PA 3LQLA 1RD6A 3LPOA 3DC8A 3M0XA 3W1XA 1KGWA 1V6XA 5HAOA 3CWHA 5D30A 3VIJA 1X7IA 2DEPA 4D71A 1E55A 2J75A 1VCFA 4C1NB 3U0HA 5D05A 3AS3A 3EKZA 4ILSA 4XTIA 2ZWZA 3PNZA 3LS9A 4GZ7A 4GI8A 4W4QA 1OC7A 2JIEA 4W9TA 4JTEA 4PEKA 3AI0A 3WD0A 3QHOA 5K3VA 2XVKA 1TB3A 1SO6A 4F9DA 2FFCA 4JIHA 3PP7A 1V7YA 3O2LA 5I3JA 4GPNA 3FHAA 4HPJA 3ANYA 1XYCA 3EWZA 2R1LA 3PY2A 4FLQA 3MMDA 2Y5EA 4WQ6A 2Y8UA 3TC6A 3MUAA 1GW9A 4N02A 4PSRA 4JKMA 3ABRA 3REQA 4ERGA 3SRFA 4PBGA 1GYMA 2WK2A 1JUBA 3MPGA 2XH7A 1OX4B 2TODA 1W5QA 1F73A 4E4PA 5CSUA 1NOUA 3NL6A 1GVFA 4LGXA 4JEQA 1ZS2A 1IIHA 2VX5A 1J10A 2FJKA 3B03A 3NWRA 2YOCA 1KBLA 5D2VA 2Z1XA 4CN4A 2YW3A 1Z42A 3LRMA 3DKLA 2VRQA 3AYVA 4XZ9A 1H1YA 4IH3A 2PZNA 1UHVA 3M07A 3HOJA 2J9XA 4L4LA 4YYFA 2B7QA 4M7SA 2YBVA 2WZHA 3BSGA 3FYYA 4MTVA 1B1YA 2D73A 4UMBA 1DEDA 2WM1A 3BH4A 4AXKA 3SDOA 2Y24A 3UBPC 3SCSA 3GVQA 3SFKA 5LIUX 3RLGA 1CNVA 5FJRA 1J6PA 3POCA 2G96A 4B92A 3HMJG 1OFDA 5HWMA 4KS0A 4CQCA 1W1YA 4ICMA 3KL0A 3NDZA 2P50A 3M5XA 2PEVA 4BR1A 1KQZA 2Z1WA 1K4GA 3CH0A 4C6EA 1B0IA 4K68A 4PMDA 1AW1A 3LHWA 5G1TA 4GC4A 2G50A 1Q3NA 2F6UA 3M7WA 1E1CA 1W9UA 1Q2SA 1YDOA 2F8QA 1R3YA 1E4LA 3N34A 4HZ6A 5G2WA 2NV1A 2GGGA 3VC5A 4EE9A 2PTXA 1JF5A 3FKKA 4RPPA 1E0UA 4QP0A 1XBXA 1JPIA 1W1IE 3LRLA 1E6SM 3EX6A 3GU1A 1ICQA 3VDGA 5T91A 3QLLA 3NTYA 3GIQA 1FHUA 2J4GA 1WXJA 1KRBC 3QW3A 5F2GA 3TE9A 4QDPA 1XGEA 5T9BG 3EYPA 3DU0A 3BMVA 4XVEA 3LM3A 2J78A 1DPMA 5CJMA 4B91A 3TDFA 1XR2A 2J47A 2QDGA 4HK7A 3U2ZA 4OKDA 2V9DA 1PB0A 5I5RA 1E6RA 3SY8A 1OZMA 2VVNA 2CLIA 2WO5A 3W01A 4F0LA 3FW6A 2OELA 1J9YA 4PL2A 1HFBA 3OBKA 4ZQNA 3DFOA 1RZMA 1MW0A 1H7NA 2J7CA 4EIVA 3N73A 1F7BA 3AXXA 3ITLA 1ZZMA 3BAWA 4J3UA 3PFMA 4HQVA 3RJXA 1VBHA 3WSUA 1QAPA 1PPIA 4L9YA 3U9IA 1GQKA 4HNTA 1W9VA 1SJCA 3T42A 3PK7A 4M3PA 3TTOA 1PYMA 3NVDA 2O9OA 3PBWA 5HMDA 3PZQA 1H63A 2YCJA 3AOFA 4REQB 2VDIA 4LU0A 3W72A 2QUNA 1LBFA 1MXGA 1I8JA 4MKNA 3WMLA 5D8WA 3E49A 2QIIA 2QCDA 1AH0A 1H4PA 3KTSA 5LA1A 2XIJA 2VC5A 1M1BA 9XIMA 3N9KA 3R8HA 3CJPA 3D5HA 4EXAA 4WCJA 3QSRA 4H7ZA 4UC5A 3W7HA 1FA2A 3TC7A 5BRQA 3U3HA 3CV6A 4DNHA 3GG0A 3QPEA 2AQVA 1RJQA 2X05A 4MDPA 4QEHA 4H1ZA 1H62A 2YJQA 3TP4A 3PUEA 3SGGA 5A6BA 2PLJA 4IL0A 4UQAA 4N0RA 4H41A 4HPXA 4AZ6A 3N4FA 3AWNA 3N14A 3WQFA 3LENA 3LN3A 1TWWA 2G0WA 2FQIA 1UPMB 3SJNA 4H9TA 1O12A 2FPTA 3G3DA 1ELSA 3M46A 4O10A 3M5YA 1EOKA 4KETA 4HVXA 1UKTA 5I6SA 4PCFA 2FGBA 2O9TA 1NFGA 2X1SA 4LUTA 2V5LA 1ZNNA 3BV7A 3M9YA 1VJZA 2FMOA 1KV8A 4MNJA 4TO8A 4MWAA 1XLJA 3WENA 9XIAA 2H3DA 4L6HA 1QXLA 4JQ1A 3VGDA 3CL6A 3VUSA 3MI2A 4O54A 3G1FA 3THCA 4K39A 3FA3A 4GABA 1ZB5A 4CUCA 3F5JA 3WF3A 2V38A 5CC5A 4BEUA 4LJ3A 3RPMA 3F5LA 3EKGA 4ORIA 1ISVA 4RV8A 3N6QA 3SEPA 1XICA 1UOKA 3GB6A 3THQA 1XKYA 4HCLA 1SJAA 3N2BA 3OYZA 3R11A 4JZ5A 1LF1A 3WQGA 1CBGA 2XSAA 2BG5A 2R94A 4I8DA 2ZZ6A 5F1UA 2JEQA 3SY5A 3T2PA 5E6YA 3K8KA 5HQLA 5HATA 4M6UA 2WSQA 2Q8XA 1YIXA 4C65A 3L4ZA 4ZOAA 1GONA 1V3JA 3ABXA 4QGCA 1IEWA 2DZWA 4FOUA 2PDUA 4CEUC 3TV8A 4NZCA 2J66A 2Q8ZA 4RE3A 1RA5A 1HO1A 1OYCA 3NURA 3N19B 4KRTA 1WOBA 3NQGA 2BZNA 1O6IA 3WNOA 3CUHA 1VAHA 5L9FA 3UPWA 4NRSA 4GBUA 4JY8A 5CQ1A 2D23A 4DUVA 1JZ4A 3L5MA 2NLIA 4L61A 2GJXA 3IACA 1Y5XA 5G4WA 2VOMA 1W3LA 2WYSA 3FFSA 5I77A 5FESA 1TIMA 3OZMA 2ABAA 4ZOEA 4QJ5B 1IXNA 3IGHX 4J3ZA 3VGHA 4BA0A 3M44A 1PIFA 1W8SA 2RDUA 5HJXA 1I2NA 2XIBA 2YCLA 1LQ0A 5FF2A 4KWSA 4QE1A 3ATZA 3P93A 1QDSA 1SW3A 4YWIA 4UTUA 1IXOA 4TUFA 2V8ZA 2A1YA 3BGAA 1C93A 4S2CA 3NM3A 1FTXA 2QJMA 1EYEA 2CHNA 1CB2A 4J4KA 3WF0A 1OCNA 1BXBA 4ZTYA 1UD4A 2VFEA 3MCMA 1NP2A 5FAJA 4Q8NA 2B0MA 5CZSA 4M29A 2VTFA 4BI6A 4PMOA 1AG1O 4F0KA 4D6CA 1ODZA 4QSHA 3ANVA 3CV7A 4GX8A 1JDEA 1ZJIA 1GG1A 2PZ0A 3ZLFA 4MB1A 5C0QA 1M65A 3P81A 3P6LA 2Z7KA 1KM1A 2YW4A 2R82A 4V27A 5CEWA 3QW4B 1C90A 3FKRA 1UJQA 1XIDA 3ARZA 2NVDA 4B5XA 3W7RA 4MNLA 1EGVA 2Y4SA 5H2ZA 1FX6A 3TJLA 4TR9A 3B3DA 5DCBA 4DYJA 3Q94A 5CBIA 2KX9A 4E2BA 1RLDA 2IKGA 4BF5A 1V6TA 2OB3A 4ZQMA 1Z8AA 3AIEA 1RJRA 5D2TA 1ZY9A 3MB9A 1JDAA 1VBGA 1W9BM 3HBLA 5HR7A 1CW2A 1PWLA 3WL1A 2GJLA 4A8LA 2EHHA 1R38A 1OF8A 4S1FA 4R27A 4I90A 3A64A 1WAUA 7ODCA 2VWSA 4UNKA 4NZ3A 4HMNA 3GXTA 3CHVA 5I09A 4XAZA 5BXSA 1AQFA 1F6YA 3GNXA 4S3GA 5G4EA 3OZYA 4WY0B 1PWMA 3VMPA 3JW7A 5AHFA 4C91A 3H4GA 1BQGA 2C13A 4BI7A 4LQ1A 2D2HA 2BFGA 3A4WA 4RZBA 4QROA 3CZ8A 4V1XA 3KOXA 1T99A 1E5JA 3URQA 5F4WA 5I3HA 1YTEA 1Q65A 3MYOA 3L4XA 5AYXA 3SCTA 1ZBVA 2GDVA 1KGUA 1R6WA 4O8RA 3MSGA 4N9BA 4KEZA 1WDRA 3GUGA 2BY2A 3S9YA 4UR7A 4DYEA 2FVMA 2YCKX 3NPWA 1WDDA 1P1MA 2DZXA 3R10A 1F76A 3M0MA 3BICA 3TTSA 3WDRA 1TVPA 3BAKA 3NYZA 3W84A 1MNZA 1RSCA 5CZJA 2FHCA 4AZ5A 2VR4A 1V3KA 4DJDD 1J0YA 3TSDA 1NP0A 3IPWA 1XHGA 3FHQA 4K2SA 1BTCA 4LUYA 4CD4A 3BG9A 1J2BA 3ARTA 4L1WA 4MUZA 4ML9A 5EKYA 4C1KA 3DERA 1E9IA 3CZJA 2PWHA 3FY1A 1BKHA 4JN6A 4LS0A 3S2NA 3TIMA 1MDLA 3R5EA 1TFVA 1CB7B 5FJIA 1RY8A 3BLDA 4AB4A 2ZZ7A 3RX4A 3C5QA 3GTXA 3WKZA 2ZX6A 3RYSA 1GTEA 2GGJA 5DBUA 3WL0A 1QT1A 3W2UA 3KRUA 3QHMA 1WXZA 2YSWA 3DFSA 1BYDA 1GQLA 7XIMA 1RXOB 3K5XA 3NXLA 4BF9A 2PCEA 3IUDA 1W6TA 1QK2A 2BDQA 1ZUAX 2BWGA 1W1A1 1Y5WA 1YADA 4RXGA 5DRIA 1WZMA 1WDPA 5CPQA 4LC6A 4HNVA 4JTSA 1J93A 3NEVA 2BXYA 2IXUA 4DZAA 3FS2A 3W6YA 4G2DA 5FJTA 3DBPA 2FTWA 4H9VA 1NDWA 2VCBA 1UR1A 4I6VA 4JQ2A 3CHDA 4S23A 1RBLA 4ZO9A 2B31A 4P8XA 1E15A 3PB2A 3T05A 2CLOA 5T9CE 2PP1A 3KL5A 3MO7A 1GGOA 5I02A 4IOTA 4GH3A 4HNLA 3MUZ1 3EWCA 2VZVA 3HTWA 4GUHA 3ITOA 3OGVA 1E3XA 3IJQA 2H6RA 3EOOA 2CITA 4Z08A 3UJSA 1WYIA 4RNFA 1SVDA 3OLGA 2O56A 5D2WA 5G2IA 1LRQA 3TSBA 5J5RA 3H2EA 3VX0A 1PE1A 1CGXA 3VIIA 4A05A 4L6OA 1DVJA 3QBUA 4AY7A 5A8QA 2YFNA 3B9AA 1C7TA 1J79A 3R8RA 4H9XA 3GDMA 3VKKA 2E67A 5A6SA 1ALDA 4N9EA 2ZX5A 3NQEA 3VIPA 2PODA 2POTA 2YA1A 3VUPA 5A3HA 3VFCA 2WJDA 1DJXA 1F05A 2NUWA 3TYBA 3IV3A 2WXDM 3T9PA 2NQJA 1NQ6A 2A3CA 3OODA 1JF6A 3TROA 4DJDC 4DY1A 1K1DA 2XU2A 1LUCA 3BG3A 4Q7NA 2P3EA 1E0XA 1LYXA 1MFUA 4H9YA 1DL3A 2GDQA 2VC9A 4UBPC 5ECUA 2GOUA 3MUCA 1Y7VA 4IMAA 3RCYA 2E6AA 2WMIA 4AU0A 5CKSA 1YYAA 4IIDA 1V0MA 5I3FA 1T40A 2DW7A 3W0KA 2CETA 1N8FA 3AICA 2GVJA 4J35A 3LHTA 3IJIA 4B16A 4S3CA 3DH7A 4MZ8A 1W5NA 1NWTA 1RQBA 1NARA 3W02A 3CQIA 2VEFA 3EXSA 4JTCA 1XYBA 3DFPA 4FNUA 1XWYA 3H21A 4MB5A 1DQUA 1EDTA 4F2UA 3S2CA 1BG4A 1A5AA 2QUTA 2R1KA 4L4PA 3AYRA 4AW7A 2Z1SA 1OD0A 3FSUA 1WXYA 1EBGA 1LG1A 2WSRA 3KVLA 2X7WA 1HUVA 3VMOA 1JZ6A 3PG9A 4BS0A 1V3HA 4JTDA 1GWJA 1LOQA 4Q8UA 1XCXA 5A6JA 2E25A 4XBJA 3W74A 4DI8A 3W4RA 1UWTA 3NQDA 3EOSA 4C5ZA 1GOQA 1YDVA 4UCFA 1HJVA 4BY3A 1T7LA 2XIMA 2PWVA 1A5OC 3IAPA 2ESCA 4IUOA 5AC6A 2D69A 2HE8A 2FHBA 1GKQA 2O4MA 4JTRA 2G4FA 3E02A 3LSBA 4DM1A 1YBQA 5C9ZA 3PZVA 3FCPA 4LVFA 3LM7A 1X39A 3DYMA 3U2OA 4V1YA 1HJUA 1ZSXA 2PDMA 3HV9A 4DJEA 3SBFA 3LZ3A 1SGJA 1CGTA 2HVOA 1H7XA 3W7QA 2Y89A 1BAGA 2W27A 1UP2A 4W87A 4FR1A 8RUCA 3B9DA 2ZRXA 5H8UA 2V5CA 3HPAA 3DEQA 1UR8A 3S5YA 1Q4NX 3R0KA 1KLYA 2XSBA 5HWNA 4MZYA 3S5OA 3EDKA 4Q8VA 4NL1A 1BWVA 2WLYA 3QM3A 2PD9A 1E70M 3M0JA 4J2MA 2CZEA 3GR4A 4YU1A 2R6OA 3K30A 1O94A 3NQFA 1RAKA 1CI1A 1TRIA 4JQAA 4A21A 3W75A 2HXUA 2YPIA 1TA3B 2PTZA 4AAJA 2ZFAA 4MKVA 1VP5A 1XQLA 3B06A 4LVAA 3VOIA 5M3WA 2Q8LA 2I1OA 3W1UA 3VCNA 4UR9A 1KV5A 2F38A 4DBSA 1ZU8A 2Q02A 1AUSL 1FHDA 2XZ9A 5SWUA 2HPIA 3L2LA 2XDFA 1D3GA 4G7EA 4HCDA 1S2UA 1L9WA 2HSAA 1XLFA 2DJLA 4IIFA 1FP8A 3BGGA 3FEMA 4QLLA 2J7HA 4N2YA 4RE2A 2PDJA 4L65A 4KCVA 5IFPA 3UZWA 1AW5A 4R34A 4G1NA 3SZ8A 4XKYA 5EY5A 4U3CA 2WKJA 2E0PA 2FGZA 2PDIA 4AIEA 2ATMA 3O0FA 2GQ3A 1IQ8A 3LCXA 1QOPA 1FWEC 3R94A 1QHPA 2XIOA 4FOJA 1WDQA 2W4XA 2ACQA 3VOFA 4LYPA 4IQLA 2W61A 3OQEA 3WZ0E 4AYGA 3WNPA 3AHXA 1NWSA 2DVXA 5TAOA 1TQJA 3TX9A 4ZFMA 2BXVA 1W5PA 4JIEA 1G4SA 3UR5A 3A24A 4R33A 4PN2A 1Q4WA 2HK1A 4JX6A 3C0QA 3O07A 4Z17A 3V4BA 2QJJA 1BG9A 1VYRA 3RHGA 4EOUA 3GWQA 4OV9A 4CCZA 3MBFA 5BYWA 5LKYA 1PKYA 4ZOBA 1QNPA 4Y9MA 4EXBA 3QV8A 3VM5A 3DCPA 2CKSA 2PE4A 4HA0A 4HZMA 1TIWA 3GH7A 1LRNA 4UTTC 3CIWA 3H2FA 3EPOA 1GQIA 3TWAA 5C9UA 3MZ2A 1JPHA 2F6KA 3HGRA 3E2QA 3PBUA 1G7UA 4P7NA 1UD8A 5M5DA 4UFMA 3AIUA 4LVGA 4UR8A 1EC8A 4AY8A 3VDHA 2V68A 3CZKA 4G5DA 3GXNA 3B9OA 2ISDA 4YS1A 3SCWA 4XD6A 3EWYA 3OPSA 4IQJA 2P53A 3WLIA 1HKVA 3QZAA 3UA4A 4F0HA 5JH1A 1OFBA 3KVMA 3S8HA 1QASA 1HW6A 3IIOA 4OVXA 4QCFA 5AB3A 2WHLA 3KDOA 3NQ6A 3SUWA 1VB9A 4JN7A 3SCUA 4DBEA 1BPLB 1JULA 1O68A 1W9PA 3NQMA 4DBUA 3URAA 3H22A 4NHVA 1V6UA 1XP3A 5EGRA 4S3KA 5D2YA 4KEVA 3MV01 4PUJA 4AVNA 1MEWA 1CCWB 3VKBA 3WUEA 3PZUA 2SFPA 2OO6A 1ZAIA 1U1UA 2CLKA 3PTKA 4YIWA 1MSSA 3WLSA 2V5JA 3ZYZA 1JCXA 1YHTA 2GQAA 3T4WA 3NGJA 3LTPA 3OVQA 5DCEA 1RK6A 3H7RA 1EJRC 4FLSA 2VQUA 4FS9A 1TO3A 3OA3A 2ASHA 1PUDA 4Y8EA 4PCNA 5C2GA 1EPVA 3ZWTA 4A22A 1EL3A 1B4EA 3PULA 4F8XA 3CBWA 3PPCA 4EXQA 4IM4A 2P0IA 4EWJA 1TPFA 2IPJA 4B4HA 1R87A 1J4EA 5CC3A 5I24A 1G6CA 3PWAA 1DWFM 4WZHA 3TLQA 5KEZA 3LBCA 4B5NA 1VFUA 4HOXA 3OLDA 3QFEA 2Y0FA 5DRCA 4J3WA 4CD7A 3EA3A 3ZJ7A 1J12A 1RPXA 3EWBX 3C0LA 3I6EA 3RX3A 3CV2A 3FSTA 3BO9A 4NG3A 1G94A 1UASA 4NAFA 1W1ZA 4CGTA 4DO6A 5EB8A 1QWGA 4XIAA 1OFEA 5TBOA 3MV11 1UWIA 1BVZA 5M03A 2BOFX 5DLCA 3WDJA 2VEMA 3LXAA 5EMUA 3TYCA 4GJ1A 4PMRA 1FCVA 1F6KA 1DQWA 5A6TC 4X60A 5C71A 1R47A 2ZDSA 2I14A 2VJXA 1DBTA 3NQ7A 1SW7A 3RK8A 1QPKA 5E9AA 1ADSA 3QY7A 4LNYA 4IF2A 4UFHA 4GLEA 1LBMA 1Z48A 1B3OA 1E1EA 4GUGA 1B3ZA 1GOXA 1FHVA 2J8TA 3VABA 5GJMA 4AZ7A 2E5CA 2GUUA 1YX1A 3NL5A 3R6IA 1OFAA 4HP5A 2BS9A 2C3ZA 3SRKA 4LAMA 4OUEA 5JXQA 4RZ6A 1NH6A 2NVAA 4D9PA 4HU3A 3E0IA 3LCWA 1ESWA 3J7HA 2RUSA 4UMCA 1SM9A 4ROQA 3HFTA 3L2MA 4UFJA 3C3NA 4S2BA 2E3ZA 5G1MA 3A21A 3IGSA 4NT0A 3QLDA 1V77A 1WUFA 4ICNA 3PBYA 3WNKA 1OWQA 4PH6A 3QYSA 1V03A 1TA3A 4XSLA 1PZ1A 3VD7A 3BWWA 2OO0A 2AL1A 4DQWA 3GS6A 3GQYA 2PB1A 2UBPC 5DT7A 1B9ZA 2ISWA 2WPBA 1BLIA 1W2PA 5IHRA 5FF0A 3CAWA 3ARWA 2FHFA 4MDOA 1SO5A 3HG3A 5TNVA 4OIFA 5XINA 4LWWA 5G1YA 3DI0A 3VVGA 2P3ZA 3OHMB 3RUBL 1R7OA 2WQDA 2QVHA 4LPCA 4JHMA 2Z26A 3QVQA 4GOAA 3W07A 4GIEA 1KD0A 3NL3A 4ZQRA 3W86A 3ZZ1A 1JCLA 3VZYA 4D72A 3OJGA 1XUUA 4X9SA 1ODUA 5E5CA 2ZXAA 3U2EA 2W91A 5LGXA 3B40A 1RBOB 1QOXA 3HGJA 1V8EA 4M0XA 4AEEA 3N6JA 4JHZA 1RY0A 3NL2A 4MKSA 3NUKA 5K7JA 1K9EA 4CQ8A 3EDDA 5HBFA 3RRXA 3UT0A 2ZVIA 4BQ5A 3UYIA 1ZFJA 3UXDA 3VNKA 3L68A 4BCEA 3E1F1 4FNQA 2R1NA 1F6PA 2QYGA 3P8IA 4PCTA 2FZ9A 1GVIA 4HMCA 2BNJA 2NQLA 2WVSA 3WF1A 4NX0A 3AIBA 1WDWA 2ALRA 4DLMA 4I5RA 4GI4A 4R7OA 5EL1A 4A8NA 4IXHA 3C0SA 1A0CA 1DKWA 1JGMA 1X1NA 1A50A 1RUSA 4BHYA 2WOQA 4XB3A 2WNNA 1QNOA 3PJXA 5BXTA 2XYLA 5DT5A 1EA0A 1JNEA 4PZVA 3HGOA 3HV8A 1RVGA 1UBSA 1HKIA 4OUIA 4FHAA 4WXYA 2JF6A 1XLLA 1HL8A 4LBRA 3MWAA 1OFPA 3MI3A 3DKJA 3F1QA 4Z2GA 2ZX7A 2DQXA 1AH3A 4GYPC 5CPSA 3C4UA 4HYVA 2JKPA 1TWIA 2FH8A 4O15A 3WX7A 4DBWA 4Q3MA 3PZGA 3BZGA 4B3KA 4M8UA 4AHPA 1LZOA 4B15A 4JTUA 1QTWA 1UUMA 4DLFA 1H5VA 2QDEA 4DNMA 2OEKA 1E9ZB 5A69A 1BQCA 4S3BA 3WQ8A 3WY1A 1MXDA 3DYOA 3NPVA 3W71A 1EGMA 3TMQA 4U2ZA 2OOFA 4HHLA 1KM5A 2I5GA 3V5FA 4DX3A 3WD3A 4PB5A 2BV9A 2BGNE 2VRJA 1RQHA 4HT3A 4C6DA 1LJYA 2DSVA 4ZQOA 3SM0A 2NVCA 4XZBA 2ZZ3A 1G9HA 2AAAA 1E6NA 1C9DA 4WOQA 1Z32X 2YBTA 4ZSTA 3UWVA 2OLSA 1QPRA 4HHHA 4C6BA 3ABOA 4H9ZA 2VHLA 1JD9A 3E3HA 3T40A 3I6RA 4JKLA 3USBA 3G1VA 2BLEA 1L6GA 2DIEA 1PV8A 3N17A 1WAWA 3TTQA 1IHIA 2ZBTA 4S3JA 1DWGM 1HTIA 2PWDA 3KVJA 3WO8A 3EXRA 1V5XA 4JL1A 3AIQA 4DUOA 3U5UA 3TK7A 3YPIA 2HTMA 2OODA 3RFAA 3K1GA 3CB8A 5C8BB 3LBMA 2A7RA 4OECA 3S9IA 2ZTKA 1T8XA 3AXMA 4MFDA 3ZJ6A 4LAOA 4PSPA 1E56A 2NXHA 3IUHA 1QATA 1ADDA 4GXWA 2A3HA 4YTRA 2JGYA 4R9OA 6XIMA 3W1LA 3GC5A 2OVLA 4WOZA 1QBAA 2QCMA 2PBGA 1GVQA 4TVDA 1NU5A 4LY4A 1SFJA 1WB0A 3WLRA 1JFXA 1MUWA 2IPWA 3NVTA 4W86A 2FIQA 1XBZA 3AQUA 3ZLHA 2CBUA 3GSMA 1UMLA 2OJPA 2WMKA 4PODA 2QGYA 3RRAA 3TJIA 3LTYA 4PRWA 5U7SA 1OT1A 2DORA 4S3EA 2ZUWA 4X2RA 4I9MA 2X1UA 3ITGA 4X2PA 1SMAA 1PDZA 1B3XA 2FB2A 2OYLA 4QS6A 1O66A 3VNLA 1RCXB 2XVGA 3ITTA 4BEQA 4ZA0A 1J11A 4A2SA 3WH7A 3RXZA 1FFRA 1R2SA 4HJFA 2A7PA 1P0NA 1D3CA 4W85A 4INFA 5IDZA 3KWSA 2XFYA 4S38A 1DIEA 3CASA 4ATDA 2PWEA 1VEPA 1GVRA 4HK6A 1DIKA 1OB0A 3MI6A 3VE9A 3EZ4A 5I79A 1VD6A 1R30A 3PR2A 2GFTA 5AOUA 3NO3A 1FWAC 3SCRA 1YQ2A 3OBEA 4HZ7A 4MWAE 4I6KA 4S3FA 3OZPA 5DN1A 4OTKA 1QI4A 1VFMA 2ICSA 2BMBA 5LZLA 3N4AA 3SUVA 3AZRA 3FA4A 4NAEB 4Q6XA 1DJNA 2J6VA 2ZRUA 1E9YB 2Z27A 4J3SA 1BYBA 1TX0A 4QBXA 1P0DA 3AS1A 3E74A 3UERA 3GFXA 1FKXA 3ZSSA 1R9YA 2C8NA 4LSBA 3CUGA 3SIZA 4UQBA 5H6HA 3S0CA 1HVXA 3WFLA 5CPOA 5F1VA 4EF9A 1DJYA 1GEQA 4B5SA 1KO0A 3EX4A 2Q09A 4ADTA 1XRFA 1IGSA 4ONVA 3UY8A 3NQAA 4ZQPA 3ZVIA 1TTQA 3A12A 3DFYA 3KE0A 2PD5A 1QW7A 2P1FA 2WV8A 1UWQA 1MW3A 3WK3A 5CSRA 3E2VA 4B2DD 3EWWA 1V79A 4CQDA 2WHMA 1OADA 3EB4A 5CPLA 1Y5VA 1DIOA 4O0ZA 1CTNA 4H2CA 1LBLA 3W2JA 3PJTA 5C9XA 5FACA 2WCAA 3O6AA 1KCZA 1H60A 5K4ZA 1XV8A 4F0SA 1FDYA 2VELA 1X97A 2VZTA 2PU1A 1LWHA 4RV3A 1KCXA 2BY3A 3HFYA 1XJBA 2PLCA 2CESA 5DFAA 2VFIA 2VXNA 1H7PA 4GK8A 2EG7A 4LS2A 3GTNA 1XIGA 3II1A 3BQ6A 1XS2A 2HRWA 1J5SA 3WF4A 4P2VA 3NOYA 3I65A 3W26A 3DOPA 2P0OA 4O11A 4U28A 1E0TA 4I8YA 3ARRA 2CFFA 3VZXA 3KZSA 1J96A 5B80A 4LCQA 3VX1A 3EPMA 3W1RA 1TTPA 3PAOA 3KS6A 5HJLA 1UR0A 1WKDA 2BP1A 3L67A 4X61A 1GOIA 4OHQA 2WWCA 4QFUA 1CDGA 3JRKA 3P61A 5AECA 1W17A 3KOYA 3DHUA 3IIZA 2WSYA 3RJYA 3N04A 1A4LA 3PSWA 5XIAA 2INEA 5A6BD 3QKEA 5HPCA 2QNEA 2VUYA 3WLJA 1XL9A 2WZTA 3OA5A 4AD3A 3F4CA 3WMBA 1UR4A 2OQYA 2VWTA 3I7SA 1IT0A 1QNQA 3I6TA 2YR1A 4NZ4A 4O1EA 1TWDA 1WX0A 1XRTA 3WJZA 4LAKA 4B9ZA 3UNTA 4KCUA 2VFFA 4NU7A 5AY7A 1A5BA 4PTWA 1VEMA 2QQ6A 1BVWA 5EPDA 5CGTA 4RDZA 3R0DA 1OC6A 5IFTA 3DAQA 3ES8A 4Y9PA 2XGBA 1JRCA 4MWAD 2C16A 3DG7A 4UOQA 3BE7A 1LL7A 1WPCA 1G4EA 1VCGA 1LRTA 4RW3A 2AKMA 4KFOA 4O0QA 4B4FA 1XF0A 1QI2A 9RUBA 1GKPA 2YB4A 1UJPA 2HNEA 4I7UA 4KWVA 4ZXLA 3BLEA 3NZGA 3SQMA 4DPPA 5D2XA 2YLAA 3TW7A 1B3YA 1A5SA 4O4WA 2BY1A 1SUXA 1E6QM 2YYUA 3BLFA 4KGLA 5HULA 1SFTA 3OQ8A 2ON3A 4DPQA 2YX0A 4KIEA 4O28A 2YCEA 1E4MM 1QNVA 1UR3M 3TN4A 1R3SA 2J88A 5I3KA 4KW2A 1IEIA 1X1ZA 5CJ5A 1JPDX 2VURA 1OC5A 3STFA 1Z44A 2I7GA 3E0LA 3GO2A 3NGFA 1BSLA 3GYEA 2VRKA 4Q4OA 3WH6A 1B54A 2B81A 1WE5A 4YTQA 1NF7A 1Q7ZA 4JFSA 3NXFA 3D0CA 4NJKA 1MQRA 3M5VA 1GOKA 4QLJA 1EXBA 3AJ7A 3UWUA 5F2IA 5H1WA 4GIAA 2E9MA 4DF2A 2DIJA 1ICPA 4DHGA 3GUWA 1SZFA 2GSEA 3CC1A 4IIGA 1UCWA 4GA8A 5HWJA 4GVIA 1ITCA 4JFUA 1BXCA 2R9RA 1W3KA 3R7MA 2RJGA 4H8NA 2BVDA 2DY3A 4AIUA 4FA3A 3LV6A 2FDMA 4HKPA 2WCGA 1D8CA 1E4NA 3W6MA 4A8RA 4XZHA 1LWIA 3AMDA 2ONEA 1JAEA 3P0WA 4QNWA 5BRPA 4ATLA 4GXMA 1PKMA 3CZLA 3ITVA 5HJYA 4AUBA 2ZUSA 3NCOA 5LHEA 4ZOCA 1GZJA 3HGSA 3I4KA 3STPA 2EEXA 3W2MA 3QPYA 2FTYA 3QV7A 1X96A 3HPZA 2DPEA 3WLHA 2QEZA 4QITA 3T44A 4M6VA 1YNYA 4TMCA 1KR0A 4AVOA 1R3TA 1OD8A 4LVBA 3MMTA 4MWAC 3W38A 3G1YA 5E9XA 4CNNA 3TZFA 4EANA 4L1XA 1PHWA 5HNTA 5EFFA 3UPBA 3DHFA 1KCKA 6A3HA 3LCFA 3BXWA 4AD2A 1JL8A 1KM4A 2D1ZA 4Y2WA 5BU6A 4DI9A 1XFCA 4IFKA 2VEKA 5CPMA 2TRSA 4J28A 3R0UA 4NAEA 3HQOA 1EIBA 1WZLA 4Q6JA 4MAZA 3MVIA 3SUSA 2OR2A 9CGTA 4MOZA 4LALA 3ZVHA 4M51A 3B4UA 2VZSA 4C90A 3WIJA 5C70A 4YWSA 3OBAA 1I2QA 1IXPA 3QTPA 4I3GA 2PDQA 4W5UA 1TV3A 3VDCA 4PMNA 1RP8A 4FK9A 5IM51 1RD5A 3LA4A 3R1ZA 3B8SA 4C6CA 2J13A 1YE4A 3MJMA 3N4EA 4P5UA 5I07A 5GNZA 3FXGA 4I9AA 2IQTA 3MUIA 4ORMA 2EG8A 3R89A 4EF8A 2ISFA 1G4PA 1HN1A 2A85A 3VIGA 2GL5A 3GD6A 4QJ1A 1BEUA 1TCMA 1NEYA 4POCA 4MNMA 1HJXA 1VBRA 3WLTA 3H54A 2C18A 3MKKA 1RR2A 3BW2A 3VTRA 2OWCA 3PBVA 3GG8A 4JTFA 1JI1A 2FB3A 2W5FA 5A94A 1BGGA 2FYMA 3UR7A 3PZNA 2ALDA 1WNOA 2C6QA 4Q4QA 1QPNA 3GIYA 3ORWA 4MM1A 4C6MA 1OGBA 3LHZA 3E5PA 4W88A 1RA0A 4YLWA 2Y6ZA 3URNA 3EB3A 7REQB 5ABFA 2DU2A 1US3A 4RNJA 4CD6A 3SCPA 4EPDC 2CLPA 3UETA 2DW6A 3TW9A 3OG2A 4JBRA 1MUCA 4B5WA 3WG6A 1FWGC 1XLIA 5KETA 3TA6A 1LROA 3CL8A 4JTHA 5ABGA 2WC4A 5JU6A 3B8IA 3WEMA 2I16A 4KESA 4Q8PA 1HNYA 2XUCA 5I78A 2FPYA 4US5D 1Q6RA 4NXSA 3GAKA 4PRRA 1VPXA 1CXIA 3W3OA 2J79A 1BF6A 5B7ZA 1BFNA 4H6EA 3OVRA 2VC6A 1R85A 5BOEA 1XBYA 2AOSA 2NXIA 3H23A 4JX5A 5JBDA 4G8TA 3KW3A 1BRLA 5FL1A 4E2VA 1TV4A 2WZEA 3CUJA 3O06A 1B4KA 1Q7QA 1H11A 3H2MA 4QM1A 2OX1A 3TQKA 1ENUA 3I3DA 3C61A 2AGTA 2V3FA 1DXIA 2H8ZA 2XIIA 2F9RA 4ZFCA 1CXFA 4KMQA 3GTFA 3FIGA 3PUOA 1LM1A 4O13A 4XAPA 2ZKMX 4JN8A 5CG7A 4JFVA 4PMUA 4E0CA 4ASTA 4XWUA 2R8WA 3LNPA 3O6DA 5RUBA 3B8DA 1TJPA 3IVSA 1AW2A 3FDGA 3UWWA 3KBMA 1JGIA 4GYKA 2GUYA 4HPGA 5CPTA 3IWPA 1A80A 4MFEA 3GNNA 1CIUA 3NQVA 3ZSTA 3W70A 1SFSA 4HU8A 1C8XA 3IJ8A 3TJXA 1MRAA 3CU2A 4HYWA 4UOZA 2YLLA 2QVNA 1H51A 5LNUA 3GG1A 5KSWA 3REQB 3R25A 1S39A 4MJ2A 2IKHA 3LCHA 2VZOA 4ENLA 4RE4A 2V2HA 1TV2A 3KTXA 1CWYA 4JXCA 1VHCA 3M6YA 4LUSA 3T4CA 2ZTJA 1ZPTA 3ZS4A 4EPEC 2QAPA 3CPGA 4B90A 4UNLA 4FR6A 2PDPA 4LEQA 1CXKA 2DGAA 1F8MA 4D8AA 2Q3OA 5M17A 4GINA 5K4XA 5A95A 3PHAA 1POJA 3GNRA 7PTDA 2RAGA 1EXPA 2C0AA 1JUKA 1UD3A 1KCLA 3QMTA 1RHCA 2PDFA 5REQA 1KB3A 1X38A 1JPMA 1NWUA 1VRXA 3QY6A 2CZDA 2YXXA 3B0XA 4IFOA 1BYAA 1V6VA 1DJGA 1Z9AA 4LEFA 5KZEA 5BWAA 3PZMA 3OIXA 3NG3A 3R58A 4K36A 1YLVA 3PZTA 1LQAA 5E6ZA 1X8FA 5ABEA 1N82A 4I5XA 2DVUA 2PUZA 3LV5A 1BSIA 2QCHA 4MUPA 1C8QA 3LCGA 1EWEA 1TQXA 1SPQA 1TKKA 2BTMA 1QFEA 4C6OA 1PX3A 2PRHA 5CG0A 4XZNX 2UZ9A 1F07A 4Z2JA 3JZUA 2A2IA 1DHPA 4ES4A 5K2ZA 4F4RA 1XYMA 1KQYA 2QHAA 5LYRA 3B8TA 3BK0A 3U5YA 1YRRA 4I7WA 3ZT6A 2YDAA 2Q6ZA 4O1FA 5EA9A 2VD8A 5CH9A 2OTDA 1E1CB 1EZWA 4GX9A 4JOMA 3ZR6A 5HMEA 3UJ2A 2WZMA 3THAA 3CUFA 2P8BA 3CZEA 3WQWA 4WUIA 3T09A 1HO4A 3Q67A 1TV5A 2PF8A 1J5TA 1LORA 3AHYA 1E6PA 3WBEA 5DANA 3QF0A 4X9YA 2HCVA 3T8LA 3UNDA 2YL6A 1FWNA 4MY9A 5MKGB 3MCOA 3KBJA 3P74A 3ONCA 1EUNA 4QJ4B 3M0HA 4BWLA 4UCGA 3PM6A 3S46A 4IPPA 1WUEA 3DIPA 4Z0SA 4QSFA 5HMFA 1Q63A 4J3VA 3KL3A 4XD5A 3FN9A 3S9ZA 3VNIA 3UQNA 4XVDA 3G1SA 4LT9A 3H4XA 1W1B1 3IEBA 1GEHA 2YGYA 3TR2A 3HZ3A 5LNVA 2Y7DA 1XQKA 5DBTA 3CMJA 3KOWA 4CCDA 4PMQA 2IS7A 2V2DA 3B8WA 4ERAA 1UIOA 1JEZA 1V6YA 1QI3A 1C8YA 1H41A 5C55A 2CKRA 4C7GA 3G0XA 3PAJA 1HX0A 5GJPA 2DH2A 4E8DA 3VYLA 4Z2LA 3C3UA 1S1RA 4UTKA 4AYSA 1QJWA 1I45A 2CU0A 4UZUA 3NPXA 2BASA 3N9RA 2UY3A 4DXKA 4GJJA 3SCQA 1O4UA 2QJNA 4H00A 2V82A 4HK5A 8XIMA 5F7UA 3GG7A 4W84A 4PMYA 2DSUA 2CLFA 3H70A 4PFMA 2ZE3A 5ABTA 4JFWA 4PB3A 3OU8A 5ECVA 2AQOA 3BMXA 3IAQA 2DUAA 4IL2A 3OGRA 1OX6A 1J0ZA 4LYQA 5G2HA 1XKJA 2D24A 5LIYX 2Y5SA 4PFHA 4PR4A 3W7EA 1DWHM 5MHBA 4NJHA 3AMGA 4Z42C 5HPOA 4OBSA 4IIBA 3UZYA 4AEFA 4ERIA 4OBTA 1I4NA 4DXXA 1PIGA 3AMCA 1HQTA 2PPGA 1H1NA 4GVHA 4A3QA 2CBVA 4UFKA 4Y9AA 2C14A 5AHNA 3A6OA 2XG9A 3BL3A 3E6EA 1VJIA 2AMXA 4TTGA 3W82A 2I5IA 2OX4A 2GOKA 3E9AA 3GHRA 3NAVA 1KRMA 3KBNA 3BG5A 4GO9A 1YXYA 1XSKA 3TWBA 3A4AA 4XAFA 2X42A 1TR1A 4MZ1A 1EQCA 4RZ4A 3FDKA 4F40A 3MP5A 5FL0A 5CGQA 1GKRA 1UKPA 1FH8A 2BHZA 4XZIA 1TZZA 4LUTB 4L64A 1B3VA 3N2OA 1Z3NA 4AG0A 5HQMA 3W2NA 4MWAB 1J18A 1EC9A 3SCNA 4QCEA 4MF4A 4JIPA 3BOLA 3K4DA 3WBYA 4PC8A 3P0XA 5BXPA 3VIFA 1LLOA 3S3GA 3AYTA 1VYSX 4HB7A 2QMKA 3GC2A 4XUGA 4ZO8A 3TH6A 1NFPA 6TIMA 4NZ5A 5LGZA 1JZ8A 1TUFA 2DSZA 2VDGA 3C2OA 1A0DA 3L4YA 1H7OA 2AGKA 1E4IA 4HGXA 3GZAA 3L4UA 1H0GA 2HEJA 3BGJA 4NX5A 1UA7A 2WLZA 1WCGA 3CLWA 1JZ7A 4Q7BA 2GVLA 3TEVA 1P6WA 3GFYA 2YYTA 1AMKA 2V5BA 2V67A 3SRHA 1YNQA 1BKSA 1QHOA 2ZIDA 2J7BA 5DO8A 2WNZA 2JK2A 3UPMA 1XIHA 4R7JA 2NT0A 3A5VA 1GJUA 3WNNA 3TFXA 1HZYA 3QMRA 4GHRA 1CGYA 1MRQA 3V7PA 3AZSA 3C0JA 1TRDA 4DJEC 4LUJA 2G41A 5KTLA 3W83A 3KLLA 1AMYA 2H3BA 2XSXA 1XINA 2GJXB 3LI1A 2G95A 1WQ5A 2YL5A 3BCJA 4NUWA 4BI5A 3WH5A 2REQA 3GU9A 3MT1A 5KZMA 1XSIA 3TOPA 4GI9A 1HJQA 3W1AA 2YCLB 4RUBA 2J7GA 1UB3A 4F0MA 1GYNA 1O1HA 2JF7A 4HJWA 3STEA 4KERA 4L1GA 4IJCA 2PLKA 2X0HA 4KRUA 5D9PA 4AMAA 1F9CA 4YJ5A 4FIRA 3LHUA 1U1HA 3AHTA 5BU9A 1SSGA 4QXIA 3WDQA 3MP4A 1K3UA 2Z24A 3NQ8A 3LU2A 4L9ZA 5GNYA 4IQDA 1AJ2A 4XK2A 3VOHA 5KINA 1JFHA 2W66A 1U2YA 5E70A 3S5SA 1FY6A 1TSIA 4XBKA 3PPHA 3GR7A 1LCOA 4NSBA 2PDWA 1LP6A 1EX5A 1EKOA 3IJ7A 1TREA 5AHMA 3TN6A 3MYPA 3LUTA 3AHVA 2ZUTA 2PDBA 2V5DA 3TW6A 3RAOA 6PTDA 3CT7A 4S39A 2YL8A 2V81A 1WBJA 3IVTA 1EB3A 1I60A 4IJRA 4WK9A 3CV1A 3RPDA 3WQ5A 1Q6FA 1XGDA 5I7GA 1DWIM 3KZPA 3FYPA 3W81A 3HPXA 1UP0A 1G7VA 4DELA 1A5NC 4W93A 2OMAA 1HL2A 3VC6A 4PULA 3EX3A 3QV9A 5CC7A 2P88A 1VS1A 2GQ8A 2IKIA 1OIFA 1WP6A 2CBIA 5LSMA 1K8ZA 3LSCA 3VILA 1LL4A 3TXZA 2OWXA 4NVTA 1QNSA 3VGGA 4WSHA 1FOBA 3UWQA 1A4MA 4M6QA 5MKGA 2XGIA 1P0EA 4O53A 2X09A 4BQ4A 4IIHA 3UZZA 3WUGA 1PIIA 4URIA 2E8YA 2G4JA 3TVAA 1CT5A 2WKLA 4B2DA 4JL2A 4HMDA 3FAXA 1XLGA 1TJ0A 1F4HA 4N42A 4AH7A 2JE8A 5D9OA 5L6UA 3CMFA 4KIRA 8CGTA 1XDLA 5HUPA 5CBBA 4C6PA 4YCPA 3RLHA 4PTNA 4AZGA 2MNRA 1XFBA 2A3AA 1XIJA 4IHCA 3L4WA 4C7FA 2F2HA 1KBBA 2GVYA 3PANA 4F66A 2OGYA 3L4VA 4PTVA 4ZBCA 3AWOA 3WELA 4EWND 2VENA 4ICCX 2Q01A 6ENLA 3QSTA 3UCQA 2HWGA 2HVMA 2PF0A 4P8VA 1TCDA 4FOKA 2VEGA 4GNJA 4R85A 3RM8A 3AIVA 3BTNA 3CO4A 1RCOB 2VGGA 3DYPA 3E96A 1GQNA 3CB3A 4YTSA 3HM7A 2R1PA 2Z0IA 3AU6A 3W7GA 3A13A 4O1DA 2H9AA 3T55A 4LRTA 2PTDA 4M24A 5I3GA 2GZXA 4KFNA 3S2JA 3WLNA 4KKXA 4J1OA 3GHTA 4Y7EA 1W9XA 1MUMA 5AHLA 2JQXA 2W92A 2Y70A 4ALDA 4D6IA 1IWAA 1SZRA 4QNEA 4J2PA 4UFIA 2OCZA 2CHRA 1V6WA 3PG8A 3QR1A 3W27A 4M82A 3RLVA 2P10A 3M41A 2JFEX 1QCWA 3SUUA 4GGBA 2EKGA 4UQEA 2PS2A 3O6CA 2OEJA 2GGEA 2X2YA 3QFWA 1FCQA 3U6WA 2ZCGA 1K7XA 2TSYA 3AZTA 4P7OA 1UWRA 3QEZA 4KGJA 1UR9A 4AIOA 4EX4A 2YBUA 4NP7A 5TF0A 4X63A 4DJFD 3GDRA 5JMUA 3T07A 4JHOA 3WQ4A 2WMJA 3VDAA 1L2QA 5AYZA 3GBEA 1XLMA 2NWRA 3MY9A 3O15A 1U5VA 5FF3A 2D2GA 3ZLGA 1OYAA 4BQ3A 5GVJA 4Q4RA 3A23A 3CEUA 2Z28A 4RW5A 4JTLA 5FEZA 4WXZA 1W37A 3UF9A 2RDWA 3BLKA 2DZTA 1KW1A 4GMEA 1XH0A 3S6DA 3ANUA 3CAVA 1EJTC 1HP5A 4H8HA 1QW8A 2QCFA 5HA7A 3A22A 4D6GA 1ZTVA 5EMLA 2HK0A 4CD8A 3ARSA 3HJEA 3DECA 3TCEA 2G3FA 3VGEA 3K46A 1OK4A 3MP3A 1GZ1A 3CUXA 1EX1A 4O14A 1XW8A 3EA2A 1K6WA 2VX7A 2PGRA 1NDYA 5HK4A 1W8GA 1V3MA 1QRQA 4JYEA 5I3DA 3URBA 3AS2A 4E3TA 1K7EA 1NSJA 3SGUA 3WK2A 1DWJM 2A6NA 3C8NA 1FWTA 1JIBA 4CQBA 3ARPA 1EZ2A 4KBXA 3NPUA 4RE0A 4NQ1A 5CLWA 4LX4A 3RM4A 2QMJA 2DT1A 5HOSA 4MAVA 2POZA 3R12A 2ISVA 4AX6A 1YXCA 3M5ZA 2MUCA 5FJPA 3MUXA 1LUCB 1FQ0A 2WC7A 3UD6A 1OABA 1E5NA 1ZCCA 1P48A 3EDEA 4C6KA 4NZFA 4Z1DA 2DT3A 4HIBA 1JZ3A 2GK1A 3UJRA 4GACA 2WMIB 3QQ0A 1ML1A 3M0KA 2XN1A 2YXOA 1DHKA 4AD1A 2VX4A 4G6CA 2DP3A 1PS9A 3UCCA 4P7QA 5E09A 4XUYA 2NT1A 2CW6A 1PL9A 2DZAA 2EF9A 3OO2A 2QF7A 4KWUA 4XKMA 2NSXA 1V51A 3GC4A 4RDVA 2DVTA 4F48A 4UTFA 1KM2A 3HO8A 3SURA 1XYZA 3LRKA 1DXFA 1P7TA 3RMJA 1CYGA 4O1AA 3QHNA 3HU7A 2D0FA 4IICA 4S3AA 5XIMA 3WLQA 4WLCA 3CL7A 1HT6A 3DFQA 1ZJAA 4H9UA 2J8GA 3N9SA 3C56A 1VIZA 4O8AA 2DH3A 2ZZ2A 3F7JA 4NY2A 1IXQA 5M2FX 2RDXA 2DQWA 3G1DA 3K2GA 3KRSA 1GT8A 1OVDA 4MG4A 4RR4A 3H24A 1TG7A 3G8RA 3D3AA 2GYIA 3SQSA 5J04A 2QF8A 3RNDA 3S83A