4IUOA

1.8 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) k170m mutant in complex with quinate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
259
Chain Sequence
NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
publication title Crystal structures of type I dehydroquinate dehydratase in complex with quinate and shikimate suggest a novel mechanism of schiff base formation.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 97
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4iuoA00
3MP4A 5E1QA 3SECA 4NXSA 3CQ0A 1FDYA 1XBVA 3QMTA 4TO8A 3TE9A 5LGZA 5DCBA 1DQXA 5CSRA 3SFKA 1NF7A 4FX7A 4JGDA 2V81A 2G5WA 3NVTA 2FB3A 1LBFA 3H55A 4AHOA 3QPYA 3T78A 4M6PA 3W2NA 3O15A 3SY5A 4C1LA 1K03A 3O07A 1E51A 4BI5A 3W7HA 2FPTA 5IBXC 3VCRA 4Z0SA 4BK9A 3DFQA 3A24A 3M44A 3SR7A 3N14A 4CQAA 1ALDA 1P1XA 1JQVA 3B8DA 1W5QA 1SR9A 2WSQA 1GVFA 1W3NA 4IMFA 4IUOA 1OYBA 4XTIA 4EIVA 2V0TA 1LTDA 3JRKA 4N2YA 2C19A 3NQGA 3WJYA 2DZWA 3LM7A 2XFWA 4FNUA 2DZPA 5GVJA 5EA9A 1KLZA 2PURA 4IX0A 2OJPA 3TSDA 4QISA 3LI1A 3W71A 3LI0A 2XN1A 3B05A 1WBJA 3P8IA 4S1FA 3NM1A 5F4WA 5K9XA 1PCWA 1MO0A 1LLZA 4R33A 1FX6A 3HG3A 1WDWA 3TX9A 3FS2A 3B0VC 1QWGA 3MWAA 4TU1A 4ICNA 2C1HA 2E5DA 2ISSA 2UV8G 2NXIA 1G4PA 4FXRA 2GQ8A 4WXZA 4CLMA 5CG7A 1C29A 4NJKA 3GKFA 4IWWA 4MIMA 3M43A 2Y7EA 3UWQA 4WJEA 1JRCA 1UJPA 2Q8ZA 1YTDA 3TQVA 5AHIA 4JS3A 4JY9A 1H7WA 2RDTA 5K9CA 3TDFA 3KVLA 3FYOA 4WOQA 5CZTA 2JK2A 4PL2A 3SW6A 4UFMA 3LRLA 1T0OA 4JTFA 4UMAA 5D03A 3F4NA 1T96A 1KM5A 1ZCOA 4EF8A 4PFMA 4O54A 1FCVA 4O4WA 2CZDA 4ADSA 4A21A 3N9SA 4U28A 3U8GA 3W73A 4NJHA 1BEUA 1L6WA 1VS1A 3UXDA 1OHLA 3PWAA 4NT0A 4UR8A 4HSNA 1DOSA 1MZHA 4RX0A 2RDWA 3G3MA 1Z44A 3C6CA 4MZ1A 2H3BA 1JCLA 1KFBA 2E6FA 3NL5A 4MLRA 3EKLA 1M7PA 2CW6A 3MI3A 3SGUA 3G0SA 1TPC1 3DAQA 4UFHA 5HWJA 2GQ9A 3C61A 1FQ0A 4UNKA 3NL3A 3W1MA 4BR1A 4LC8A 2RKXA 3OHIA 5HR6A 5BMXA 3W2JA 2OT1A 3EX6A 4PC8A 3DFNA 3CTLA 5DY2A 1AK5A 3O6CA 2EPHA 2E09A 4WZHA 1CW2A 5F1UA 4QM1A 4GUGA 4O0KA 2VOMA 2PE4A 1THFD 1RPXA 1D3HA 2A6LA 3W1XA 3UWYA 1NF0A 3GYEA 4ONVA 2E6DA 3LCXA 5I3HA 1WOBA 4WUIA 1ZJIA 4CNNA 2V30A 3OVPA 3TW7A 2YGYA 3G1YA 1TV7A 3TMQA 2DZVA 7TIMA 1TRIA 1PCKA 1AW1A 4K38A 3T44A 4WQ6A 4PEKA 1I2RA 5DXYA 3DI1A 2ZZ4A 2ZFAA 2A7NA 2RH9A 4UTTA 3S5ZA 3LX9A 3L21A 1ME8A 2VKZG 3R89A 1JVNA 4Q33A 1QO2A 3TQKA 3DBPA 1TPFA 4HHPA 4N6EA 3G0UA 3P7YA 4K8EA 5I3JA 3DFTA 1VC4A 4GBUA 1XC4A 1KFCA 5D37A 1QPQA 3L9CA 4K7VA 3IIZA 3W1AA 2Y88A 4IOTA 3SI9A 3ATYA 3LBCA 4MFDA 3STCA 5AC7A 1R2SA 5FF7A 3W23A 2PCQA 5E93A 2ZRVA 2EAWA 3W74A 3C2OA 3HPZA 1A5AA 4MKNA 4H3DA 1N7KA 1OYCA 3QQ1A 3W70A 2YSWA 1LYXA 3F1QA 3UXAA 3PG9A 2QCGA 3NQ8A 4OU1A 1TPWA 5KTLA 5KSWA 1O60A 4FHAA 5ABTA 1NAL1 5DN1A 1R2RA 4HNUA 4JNMA 3ZFHA 4LT9A 2QUUA 3QFEA 1NFBA 2ZTJA 3EWYA 5FESA 3PUEA 4HNNA 1F7BA 1SZFA 5AHEA 1I45A 2CZEA 2QCFA 1W3IA 2A1YA 1KW1A 3C2VA 4XKYA 3BO9A 3QH2A 3N2MA 4RXFA 1S3HA 3LCFA 2ZRWA 1KBIA 3BW4A 3TAOA 4CNPA 1SO4A 2OT0A 3TJLA 1AL7A 1DORA 2TPSA 2JKAA 3PS7A 3KAOA 4QITA 5IM51 4JY8A 1VGAA 4LUIA 4O19A 3L5MA 1P0KA 4R34A 4MFEA 2DZUA 4JTKA 3RU6A 1QDSA 4Y8FA 3PR2A 4JTGA 3ELFA 1GWJA 3LHTA 3M16A 5D2WA 5AHFA 1ME7A 4O11A 3LV5A 2VEKA 1ZHAA 3HGOA 4PTNA 1YXDA 4QNWA 4Y9AA 2B7NA 3OVRA 3UZ5A 3NQ2A 4NZFA 5CPLA 1JCMP 3TAKA 1G4SA 3BW3A 4UTKA 1Z41A 4O8RA 1HG3A 5D30A 4WX2A 3MHFA 1W5OA 2Y7DA 3NGJA 3VKJA 2QCCA 5CKSA 3NG3A 3DZ1A 1B4EA 1NVMA 4IMDA 1FCUA 3L0KA 3BG5A 3Q37A 1FBAA 3B04A 2X1UA 1XBZA 1DKWA 4X3ZA 1UCWA 2NUYA 1K7EA 2W6RA 3HIJA 1OFEA 1R2TA 3FOKA 1F6PA 2CU0A 4OV9A 1JJKA 3U6WA 4ZVJA 3C8FA 1XDLA 3PB2A 1F73A 1KM1A 3UPBA 4A3UA 1OFQA 1S5VA 1RD5A 4CQ9A 1RZMA 3P61A 3NPWA 1TPB1 2Y63A 4NNAA 4O1AA 3C2EA 1GG0A 4UTWC 1TTPA 1FCBA 3A9IA 3L67A 4CQ8A 2H6RA 2H8ZA 2C3ZA 3I6RA 5K3VA 3OA3A 4O50A 5C55A 1YXYA 3OBKA 3IGUA 5G4WA 2Y62A 2BZNA 3EXRA 1H60A 1QOPA 4RKAA 2Y85A 4LV4A 1KFJA 3MYOA 1PIIA 3W85A 3B4UA 1YTEA 1JUKA 5BNKA 3O05A 4IXXA 4CCCA 3GNDA 4M7SA 3W7PA 1A50A 3EEGA 1TTIA 2QCDA 3T40A 3RNDA 3R13A 1Q3NA 1L6SA 3I68A 3NNTA 8TIMA 5EYWA 3VE9A 1J5TA 2TRSA 4RZ4A 2FLIA 4JN6A 4Z08A 2DJXA 5FI8A 3NQCA 3L5LA 4JIQA 3ZS4A 5F4XA 5U7SA 4ADUA 5IBXA 1TCDA 3P84A 4Y96A 1TJPA 5HR7A 3LRMA 2YW4A 1KFLA 1F5ZA 3IVSA 2A7PA 2ABAA 4LS0A 2WQPA 3E96A 1DJQA 5EPDA 1K3UA 2YZRA 2WNQA 3CC1A 5K4XA 3UY8A 1IXPA 3CPRA 3YPIA 1GVSA 4ORIA 4BWLC 3W07A 3LCHA 2ZRYA 1TB3A 3R8RA 5L9FA 1H61A 4JTUA 2CLLA 1DQWA 2QAFA 2QCEA 2V8ZA 2H3DA 2GVJA 3VE7A 2CFFA 5CPNA 3JR2A 4UMBA 5AC8A 5LNSA 2GVLA 3G8EA 2J27A 4A2RA 4IX2A 4E2DA 4DO5A 1JCJA 5FF4A 3HO8A 3S5YA 1XL9A 4JYDA 3NQEA 1GG1A 5FF3A 4O14A 4LWWA 1SQ7A 3BLFA 3NOEA 3E02A 5D05A 3CT7A 3W2LA 3BARA 1DBTA 4W9TA 3STEA 1FDJA 2NX1A 2JBMA 3KRSA 1GYNA 1W37A 3THQA 1H51A 1TQJA 3O63A 2CLIA 2P10A 1M6JA 5BMWA 5DCEA 3P5YA 4S2CA 3WK1A 3TFXA 3NPVA 1VCGA 5BOOA 3EWUA 3MMTA 3R2GA 4M7TA 1V5XA 5D09A 1JR1A 4LOCA 3KFTA 2OMAA 2X1TA 2ZA1A 1EP2A 3W7LA 1LCOA 5HWNA 3NQDA 5LHFA 5CZJA 4N9DA 1KM2A 2AQWA 1I2QA 1B3OA 3SJ3A 1QOQA 1I2PA 5DBUA 3NL6A 3W1TA 2C13A 2PRHA 2I9EA 3LGEA 1DHPA 4C1KA 3OG3A 2W0UA 1NEYA 3H53A 3F4WA 3UPWA 3B03A 5KZEA 1W1ZA 3M5XA 2F7FA 2VELA 3QYQA 3LV6A 5HJLA 1QPRA 3ANYA 5D02A 1RQEA 3USBA 1XUUA 1XFBA 1UUOA 3QMSA 4KFPA 4ZQMA 4LW7A 2V2DA 3IGSA 4R53A 1OF8A 3HQ1A 4YCPA 3EXSA 1SSGA 3UWZA 2FJKA 3W2KA 4RK8A 1GVOA 2QR6A 3CM4A 4MYAA 3S42A 2VC6A 3LOTA 1TPDA 2G95A 4K6AA 4UCGA 1LORA 1J4EA 2V5BA 3PBUA 3C0JA 3OIXA 2YYUA 1SO6A 4JTIA 2YR1A 2O7SA 3PULA 1FWSA 1OFDA 1XM3A 1LOQA 4FNPA 1B9BA 4IXHA 2PRLA 3TK7A 1WV2A 4M19A 2RFGA 2LLEA 3LHVA 2ZZ6A 4BI6A 2BSLA 2EHHA 4O16A 3L5AA 4PA8A 2C18A 3QEZA 3BPWA 2BX7A 4ZMGA 3PBWA 1AW2A 4LVAA 3S1WA 4LC6A 1K02A 1ML1A 1RQBA 4HPJA 4K39A 4QSHA 1J2WA 1B4KA 4RLIA 4UTUA 4KFNA 4O12A 5H2ZA 5A8GA 1KM4A 4LUJA 1WYIA 1TSIA 3LTSA 3AO0A 2DP3A 2NX3A 5CGQA 3ZWTA 1AMKA 4GWEA 4HPXA 1R30A 3O16A 1H7PA 2CLHA 1VRDA 3N2XA 3DU0A 2J88A 1CI1A 1D3GA 2DZTA 3G0XA 5I3KA 3EX1A 4PODA 3E49A 3MP3A 4JTEA 3RFAA 3LHUA 1WA3A 4N4QA 1KM3A 1KTCA 2NWSA 3GXTA 5D2YA 5U4NA 5HNRA 2Z0IA 3S5NA 1ICPA 3P67A 4RCXA 3WK3A 3NXFA 3NR0A 1VLWA 4KWWA 3STGA 1OFPA 1YPFA 4DF2A 2QCHA 3R12A 1A5SA 5G2HA 1OFBA 4ADTA 3H54A 4TMBA 2YW3A 4Q32A 3EWXA 4O1BA 4ORMA 1U83A 2X1RA 2A0NA 3KOFA 1NSJA 1QR7A 3W7IA 4YXGA 2DJLA 4NUWA 4OWGA 4RZ5A 3GDMA 4JTJA 3MJYA 2JGYA 2A7RA 2RHGA 4QQ3A 1PS9A 3DGRA 1X8FA 5HQEA 3A23A 3W83A 3GZ3A 2B0MA 2F84A 1QPNA 1DJNA 3G1FA 4UFIA 1ZFJA 2B7PA 3MW7A 4G1KA 1VCFA 2HSAA 4MZYA 3STFA 4O17A 3K30A 2TMDA 3M6YA 3O06A 1EUAA 1BTMA 2CZ5A 2E1DA 5TIMA 3W1NA 1KV5A 2CLKA 1TQXA 1W5NA 3GR8A 1H62A 3MHGA 4CCDA 3MBDA 2WNNA 4GE8A 4IMCA 1EWDA 2I1OA 2DU2A 5CPMA 3Q2DA 4JR5A 2BWGA 2Y7FA 3M47A 1ZAJA 5F2MA 2JKEA 3P62A 3OVQA 2ZA2A 2A6NA 4NJJA 3G1HA 4OBTA 4OE7A 3W22A 2V2HA 5FEPA 5C5YA 1JUBA 4JDBA 1PHQA 1H7NA 1HTIA 3SGZA 1HO4A 3UWUA 2X16A 3DKLA 4ZZ9A 1U5JA 1X1OA 5AHNA 4HKPA 3MYPA 4IMEA 1VR6A 3PM6A 3KX6A 3SSJA 4MJZA 3FLUA 3UD6A 4GJ1A 4Q4KA 1UBSA 4UIOA 2CLEA 3QW3A 1B57A 1XXXA 1Q6RA 4JEQA 3GB6A 2WKJA 4IJBA 3UZJA 1JRBA 3WK2A 3HGSA 4YL2A 4YWIA 3MI2A 1VYSX 4XKYB 3QW4B 3BGJA 1X1ZA 2NUXA 3WK0A 3DHDA 3O8AA 3GIYA 1RR2A 1KBJA 2QAPA 5TBOA 3W7QA 1UASA 2R91A 4MJMA 2Z6IA 1G6CA 1EEPA 3TV8A 5BRBA 2ZDRA 4AHPA 4PH6A 4OV4A 3P82A 4UTWA 2TSYA 5D2TA 3W7MA 1VZWA 3N3MA 2IQTA 3W7NA 2WSYA 4UXDA 5I3IA 3QM3A 5A5WA 3P60A 1SZEA 2ZZ5A 3G1AA 3NAVA 4N6FA 4GXMA 1OFOA 3W7EA 3EX4A 1IXQA 1PV8A 3GXPA 4MY9A 1EIXA 3UNDA 3A5FA 2GPTA 3KRZA 1W3TA 1LRQA 3W7CA 2Z1BA 5KMYA 3HGRA 4JICA 1K7FA 1GTHA 2E68A 4NJIA 3TIMA 1GVRA 3CWOX 2OCZA 3HOJA 2WOQA 4KKXA 1LOLA 5H91A 5LHEA 2QDHA 1YDVA 3L66A 4GUFA 3KXQA 4ALDA 1L9WA 4DPQA 3LXCA 3DFOA 3DH7A 5I3GA 2ZZ3A 3NA8A 1I4NA 2V2CA 3GK0A 5MHBA 3LDVA 4IGHA 3TNOA 3BK0A 5D32A 3HPXA 1SW7A 4MPQA 2FQIA 1A5BA 3HGJA 4P2VA 4WD0A 3TU9A 4HIBA 3ZWSA 1IIHA 4OQVA 5K2ZA 2NV1A 5HUPA 4FNTA 1ZY9A 3B06A 1MXSA 5I3FA 2ISVA 1XUZA 4AF0A 2YCEA 3G18A 1W31A 3ABOA 4BWLA 1GYLA 2NXGA 3NQVA 4DF0A 1TYGA 3FIGA 4O15A 3W76A 1SU5A 1K8ZA 1OX6A 1Z48A 2V9DA 3BGGA 1P5BA 3S8HA 3GDLA 3G1XA 2H90A 3DXIA 2NV2A 5D33A 2A2IA 2B4GA 6ALDA 1FUYA 3BVJA 3S5OA 3NPUA 3W2MA 1GTEA 1H1YA 3VI2A 4ZL1A 3HJZA 1TPVA 1LP6A 1TV8A 3RF9A 1HL2A 3L0GA 4NU7A 2B7QA 2ZRZA 4WXYA 3FJLA 4FXSA 1QMLA 3TROA 4XWUA 2QCDB 3PF3A 1IGSA 3UYCA 1EUNA 3TSBA 4TX9A 2WNZA 4JYFA 3TC6A 4JD4A 4P61A 3JS3A 2GJNA 1OX4A 5KZMA 1LOSA 3QMRA 2E6YA 1GZGA 1FWRA 3KHJA 4HN4A 3ABSA 4LTSA 2C0AA 3FA5A 2Q8LA 4OGZA 2ZA3A 4LV9A 3TFCA 2G97A 3PBYA 1L2UA 3NQMA 1EWEA 5E0KA 2FPVA 4UR7A 3SZ8A 5FF0A 4KFOA 3N73A 3NZ1A 4AAJA 3GXNA 1R47A 2QJIA 5C54A 1W0MA 2YYTA 2EGZA 4UFKA 5CZSA 1C9DA 5AN7A 4UMCA 1GT8A 4LS1A 1WAUA 1QAPA 1SZNA 5T26A 3PUDA 1Q6OA 4A2SA 4TIMA 4UTLA 1EA0A 2QCLA 2AAMA 5AOUA 3NEVA 3GDKA 3PSVA 2FFCA 2ZYFA 3IVTA 3ABQA 3TSMA 4NX0A 1LRNA 3E9AA 1QNVA 1H7RA 1I8JA 2GOUA 4PL1A 3W1PA 1V7YA 4Z1AA 3AJXA 4UFLA 6TIMA 3D0CA 3KVMA 4NX5A 5DY3A 5HUOA 3NL2A 1Q45A 1VCVA 3IVUA 1SO5A 2YFNA 3C2FA 4UTIA 1TTQA 3VNDA 3RLVA 4ML9A 1QPOA 1L6YA 5TQLA 2VFHA 1I2OA 4Z1BA 3NPXA 3MO7A 3DFSA 4QJ1A 3A21A 4GUIA 3TKFA 1BWKA 2AGKA 2E6AA 3TC7A 4FF7A 1XBXA 2P0OA 4A22A 5HINA 1ZALA 1VHCA 1M5WA 2QUTA 1KM0A 1SFLA 4X2RA 4LU0A 3BG3A 1Z42A 3PG8A 3V75A 1FWTA 3KVJA 3LTPA 5CSSA 2C6QA 1WQ5A 4XTDA 3M9YA 4Y6GA 4CCEA 5FEWA 5EL1A 2Y70A 2VFIA 2PRMA 4MY1A 3RLUA 3IRDA 2WSRA 3A5VA 3I65A 1WXJA 3VFLA 3CHVA 3DHFA 1QFEA 3FJ6A 4O57A 5AYZA 2Y7GA 4YMZA 4BFAA 3M5YA 5FEZA 3S1XA 5KZDA 3W72A 4L4LA 4XUGA 2R14A 4JXCA 3M1ZA 3UWVA 5J5DA 2HTMA 1OVDA 2PC4A 4Z1DA 3LERA 3TJXA 3EB2A 2JGQA 4QIUA 5G2IA 3E12A 1K8YA 4H6KA 1G7VA 2VXNA 3BV4A 4POCA 4ZQRA 2HS8A 3EXTA 1LBMA 3P81A 1VH7A 4NVTA 1JUEA 4U4MA 4ZQOA 3PSWA 3TCEA 1YADA 5D2XA 3A22A 3N9RA 4AHQA 4R7JA 3W86A 1LRTA 4RXGA 1OK6A 1RVGA 2Q3OA 3MI6A 1TREA 3OEXA 4ZQNA 4RR4A 4FIRA 4M6VA 2YFOA 4I7UA 4QAIA 4AWTA 4X22A 1MEHA 2XN2A 4JTTA 3V1PA 3UY7A 5D2VA 3GDRA 4IQLA 3PVFA 1F2JA 5K4ZA 3LTYA 3NM3A 1SO3A 2QCMA 3MHUA 2GQAA 1YYAA 2GVGA 2J9ZA 2J9YA 1HUVA 3CB8A 1WBHA 5LNWA 5FF2A 5F1VA 4UC5A 1WX0A 5C2XA 2P1FA 3LCGA 3B0PA 2NZLA 3KVKA 2WV8A 2CZFA 3GX9A 1VYRA 2X1SA 2Y61A 2C14A 2WO5A 3QZEA 1O5XA 3NYZA 4MZ8A 4S2BA 4E0CA 4NJGA 3SIZA 3CLMA 1PHWA 2CWNA 2YX0A 4RV8A 3WFAA 4N9EA 1W54A 4D2JA 1P0NA 5DXXA 3W1QA 2FTPA 2ZZ2A 4O4VA 3EWWA 4JTHA 3TXZA 1DV7A 1AG1O 1ZAHA 2J24A 2ZQ0A 1KV8A 2BXVA 1F74A 4WY0F 2ZCGA 3HG2A 2EKCA 4LNYA 3R5EA 4AEOA 1W5PA 1TMHA 1S5TA 4Y90A 4DO6A 3W7DA 4FNQA 3FEMA 2RDUA 4FEZA 4EF9A 1ZNNA 1MEWA 4I7VA 3GDTA 3N34A 4JTLA 3S9YA 1AL8A 1JQXA 4UTJA 4M5PA 5DCDA 3T7VA 4LVFA 3TW6A 4AMAA 1W8SA 1SUXA 4O0ZA 5G4EA 3M7WA 1OG0A 2Q3RA 5AHLA 1KLYA 3NDOA 1VHNA 4K37A 4FX6M 2VFDA 1G69A 4MUZA 1O94A 3L65A 3BG9A 5LKYA 1G67A 3QQ0A 4AXKA 3GNNA 5HWMA 2KZHA 1OJXA 2ALDA 1XKYA 1TV5A 2R94A 3DFPA 1WOAA 2WPBA 3TA6A 3S0CA 4LY8A 4PCFA 2X30A 1LROA 2Z6JA 4DELA 1RV8A 3I7SA 2OX1A 1OX5A 4FX8A 1LBLA 3KRUA 2HMCA 4X9SA 1YPIA 1IXNA 5D38A 1TIMA 3S1VA 1H50A 1UUMA 1O5KA 4O28A 5HMSA 3W7OA 3PAJA 3G3DA 3TH6A 3L2IA 4WOZA 4MVAA 4DBEA 4NXKA 5LNVA 4AWSA 4NNCA 1TO3A 1TPEA 4TMCA 4XZ9A 4FO4A 2G96A 3N19B 3LHZA 3M41A 1AW5A 1SW0A 2E5BA 4UTMA 3PB0A 4OHQA 1GEQA 3CEPA 2ZRXA 4LVGA 1JCXA 2NUWA 1H1ZA 5G1TA 2NX9A 1HO1A 3GLCA 2VFGA 2YXGA 3Q58A 5K9DA 3LHYA 2VEIA 3ABRA 5C6MA 1XBYA 1TPH1 3FKKA 3QC3A 1KTNA 3W87A 4MYXA 2CLFA 3TXVA 4HNTA 3LBMA 1OF6A 4DBDA 3S6DA 3W75A 1LM1A 2X2GA 4B5NA 1GJPA 3BLEA 2ZZ7A 2ABBA 3W7JA 3G1SA 1OYAA 4LRSA 3HMJG 3M5VA 1DL3A 2GUUA 4A29A 4AVFA 3W6YA 1SPQA 1W5MA 1ZENA 2QCNA 4H4IA 3DI0A 2Y6ZA 3HF3A 3W9ZA 1S5WA 4ZQPA 4HT3A 3GAKA 3GKAA 1FY6A 3QSRA 4JTSA 1XI3A 3LCIA 4N02A 5LNUA 4QNEA 3LCLA 3UQNA 4JX5A 1FDZA 1PE1A 4BI7A 4J9JA 4L4MA 3BLIA 1I2NA 3CWNA 3TUUA 3O1NA 2FB2A 2ZTKA 3EKZA 1EP3A 3W7RA 5FEXA 3QRHA 4N9BA 1XCFA 1X7FA 3I7QA 4M6QA 3NQ6A 2W79A 4DQWA 3NQ7A 3ATZA 1SFJA 1EX5A 1EPXA 3CIWA 1YDOA 3WJZA 2R8WA 3C52A 5G2WA 4O53A 2DZSA 2VEMA 5DELA 1GQNA 1FXQA 4AB4A 1QCWA 1A5CA 3IIOA 2ATMA 3T4CA 4FB7A 4GFSA 3CU2A 3INPA 3NO5A 5G1YA 1VLIA 1OABA 4CNOA 4RZ6A 3O6DA 3PUOA 2XN0A 3GVGA 3IIVA 4IPIA 5AB3A 3LXBA 2O7QA 3QSTA 4O10A 1JCNA 3TMLA 4XBSA 4GRSA 4K36A 4LVBA 1MSSA 4HSOA 3FFSA 1YXCA 4E38A 3W1RA 4AF0B 2BLEA 2QDGA 1TRDA 3G1DA 1OFAA 1ZAIA 1IXOA 2J9XA 3EWZA 2E5CA 5LGXA 1TPUA 4K7YA 4O18A 4E2BA 2V5LA 1KFEA 5DLCA 2A5HA 5KINA 5SWUA 2FDSA 2VEPA 1W56A 3FKRA 5EY5A 3WJSA 4BF9A 1GVQA 3O6YX 3W84A 4FIQA 3W7GA 1ME9A 3C2RA 1H7OA 3W7KA 3WJWA 2BTMA 5F4SA 4FNRA 1N55A 1A53A 4DEFA 1TJRA 1OFRA 3QPZA 2I14A 1GOXA 4UUIA 2ATSA 4UTTC 4O13A 3W1UA 3IEBA 3S1UA 2NLIA 5F2IA 4AH7A 4N9CA 3W1LA 3IGXA 5EMUA 4NQ1A 3NQAA 1IIGA 3NZRA 2ZBTA 5EBUA 1JULA 1T8XA 1LLWA 1OK4A 1OX4B 2E77A 4MOZA 3HG4A 2A4AA 3B0UX 4O52A 1YLVA 4EWND 1N8FA 1KTBA 3HB9A 3IIXA 2QJHA 1ICSA 4YCOA 1DVJA 5HULA 4MY8A 4I7WA 2C16A 4MLJA 3EWBX 1SZGA 1O95A 4AWUA 1F6KA 3E0IA 1M7OA 5BW6A 2ZRUA 1P4CA 1SW3A 4WY0B 1Q6QA 1K7XA 1PL9A 2OZ0A 4K8HA 1Q6LA 3FYPA 5CPOA 1ADOA 4TR9A 1G7UA 2DORA 3HPSA 4LRTA 5AFDA 2J6XA 3BW2A 2TYSA 3PBVA 4N4PA 5K7JA 4JIPA 3GAYA 3UWWA 2QF7A 4XQ6A 5J5RA 5AYXA 3T55A 4Z1CA 2CLOA 3CIXA 1KFKA 5AHMA 2CLMA 4WY0A 2QUVA 2YDAA 2FIQA 3W2UA 1UB3A 4UNLA 1YTKA 1JCYA 3LRKA 1Y0EA 3PC0A 4GC4A 4JX6A 4IPJA 3W3OA 2D73A 1ONRA 3IIPA 5DBTA 1FXPA 1LDCA 1HFBA 3C4UA 3G24A 3LB0A 4I9AA 3WJXA 4XBKA 4O1DA 3TQ0A 4LVDA 3MBFA 1ICQA 2Y89A 5KITA 1T99A 4GUHA 4LS2A 5F2GA 3LLFA 4JX4A 1IF2A 2QEZA 2A85A 3PY2A 4O1CA 4Z0JA 5LNRA 1G4TA 3CEUA 4EOUA 4ZQCA 2HS6A 2FPYA 3HG5A 5LSMA 3M5ZA 1PVNA 4IMGA 1BWLA 2JKPA 3P5ZA 2QKFA 3LCWA 3IV3A 4GUJA 5EKYA 1H5YA 3EX2A 4YLWA 3U2OA 3P80A 4UTHA 1H63A 1KA9F 2DZXA 1VJIA 2B7OA 2VFFA 3TR2A 1X6UA 4GNJA 1H7XA 3G1VA 3MP5A 1YDNA 2ISWA 3P74A 3C56A 1CX9A 1FWWA 3L68A 2VENA 3I7RA 4DF1A 1EB3A 4KWVA 3F03K 3MUXA 2WJZA 2C15A 3GR7A 3QF0A 1R46A 3Q94A 1KM6A 3G8RA 3ZR4A 1F76A 3DKJA 1TTJA 1XDMA 2GJLA 5L6UA 1GPWA 4DPPA 1O4UA 2V82A 5D04C 1MEIA 1C8VA 3L0NA 2Z2UA 1RQHA 4NZJA 1SSDA 1QO5A 1VPXA 2ZZ1A 2QJGA 4NNBA 1VQTA 4EVZA 3P8JA 1FWNA 2NXHA 3DENA 3W88A 2A21A 3HBLA 4DO4A 4HNVA 3QJAA 2H8XA 4FNSA 4UFJA 4OT7A 5F2LA 3NQFA 1F05A 1K8XA 1EP1A 4JYEA 5G5IA 3C3NA 5CZ0A 2VFEA 4DXVA 3LLDA 2YPIA 1BKSA 5LZLA 1VYPX 3G22A 5AYYA 5AC6A 2NWRA 3RMJA 4JDYA 2EF9A 3RK8A 3M0ZA 3THAA 1G4EA 4RJEA 1FCQA 1LZOA 3LXAA 1D9EA 3EX3A 3LHWA
chains in the Genus database with same CATH superfamily
3BJSA 3CQ0A 5AYBA 1FDYA 3CT2A 4M3PA 3EDDA 1TE1A 3ZVIA 4HPNA 4CN6A 3GC4A 3CUZA 2G5WA 1XHGA 1U5HA 1VIWA 5TAOA 5C7HA 2FB3A 3WF2A 3RG6A 3BQ5A 1LBFA 2E8ZA 4RNJA 4M6PA 1CENA 6XIMA 1K03A 2FPTA 2Z25A 3RPTA 1UKSA 5I07A 1E5NA 3M44A 1W2VA 1V3KA 2R1LA 1FKWA 1P1XA 4K8GA 1JQVA 3UZYA 2E7FA 4OBSA 1GVFA 2YBVA 5C70A 4D6EA 4QLLA 3ITCA 3SO7A 3UEQA 1XV8A 4Q8TA 3WJYA 2DZWA 1B30A 7ODCA 5EA9A 1KLZA 1WCGA 3KLLA 1XLEA 3TSDA 1UZ4A 4QISA 1AQHA 3ZR5A 2UWFA 1WBJA 3NM1A 1FWBC 1EQCA 2GK1B 2I5GA 1Y5VA 3PJXA 5GNYA 3WF0A 4CD5A 3PTQA 3KBJA 1TELA 2OO0A 1WE5A 3B8TA 3SCRA 1S2AA 1K1DA 1A5OC 4FXRA 2GQ8A 1AH3A 4NJKA 1C91A 2QJMA 3APYA 4A8IA 4Y9OA 4Q8UA 1DWGM 3XISA 5ABHA 4J3UA 1JD7A 4M81A 4JY9A 2F8QA 3FYOA 2JK2A 4PL2A 4C6OA 3SW6A 1V93A 4YPJA 3LRLA 1ZZMA 1C90A 2BB0A 7REQB 4Q7IA 4ZEPA 1ZCOA 4EF8A 3GYCA 4O54A 1WKDA 2CZDA 4X9YA 4UQCA 4A21A 4U28A 1UH2A 4V1YA 1BEUA 3AMDA 3PWAA 4UR8A 1QOXA 3FSUA 2W91A 1PWMA 2ON3A 5HNNA 2GGGA 1CYGA 5CXPA 1TPC1 3VKKA 2GQ9A 4UNKA 1HXJA 3E0LA 3APTA 2RKXA 2OQHA 4L6DA 5HR6A 5BMXA 4QDWA 2XDFA 4PC8A 4LANA 1HKWA 5HNTA 3A4WA 1W2PA 3K1GA 3CTLA 2EPHA 3QBUA 2XGBA 1RPKA 4WZHA 5IRPA 5F1UA 4GUGA 4O0KA 3CK5A 2H9AB 2VOMA 3HPAA 5HMEA 3OP2A 1E70M 2A6LA 4TTUA 3PJUA 3Q45A 1GZ1A 3EOOA 1AMYA 1WOBA 5FJPA 4WUIA 4CVUA 3L4TA 1QNSA 4G5DA 2DQWA 5FA5A 3PAOA 2X8RA 3TW7A 2YGYA 2POZA 4GVHA 3WMSA 3WLLA 7TIMA 1AJ0A 1DWAM 1PCKA 4DWSA 4WQ6A 4ATDA 2A7NA 4UTTA 1KXVA 2AOSA 3LX9A 4J3SA 3S83A 4AD1A 3K4AA 1ME8A 3RGTA 1DQUA 2J4GA 4Q33A 3WD1A 1DJWA 3TQKA 1TPFA 3DN5A 3BCDA 3G0UA 1UOZA 4IQDA 3P7YA 4K8EA 1VC4A 5D37A 3CGTA 4NAFA 4Z2HA 3L9CA 1CLXA 4KWOA 3GD6A 3IIZA 3RCNA 3ATYA 4JNZA 3WUEA 2YOCA 1FKXA 1R2SA 4W85A 4UB9A 4LX4A 3QY8A 3W23A 3KP1A 2HVOA 4D8LA 3E3HA 2VOTA 1KC7A 3VA8A 1YBQB 2ZRVA 4P8XA 4EANA 4QE1A 3LMZA 3DHUA 1V0MA 3AYSA 3MQTA 4KEUA 3M0KA 3NQ8A 4OU1A 3ZXWA 5KSWA 4IIEA 3ZSTA 4FHAA 5ABTA 4XG1A 1R7OA 5DN1A 1R0MA 3ZFHA 4MWAE 2ZTJA 3EWYA 2BASA 5FESA 1P48A 1SZFA 1I45A 4NZ1A 1CZ1A 2QCFA 1XSKA 2J7CA 1BSLA 2A1YA 3KS5A 4FP1A 1VBJA 1QU4A 2CWXA 3BO9A 4JZ5A 3QH2A 4ML4A 4UOJA 2FZ8A 1ISVA 1D2KA 2P8CA 1S3HA 2Y2WA 1SO4A 2WYSA 3GY1A 2JKAA 1KRBC 2IQDA 3KOXA 4MWAC 2XH0A 4S38A 1Z7AA 3QVQA 1UMYA 4O19A 1XLDA 1SJBA 4MFEA 4JTKA 2PU1A 1J96A 2ESCA 1QDSA 2J25A 2D3LA 5GNZA 3GIPA 3M16A 1ME7A 1UWRA 2XZ7A 1IWBA 3CV2A 2BV9A 2VEKA 3GS6A 1XYBA 3B9OA 2B7NA 1QI5A 3NQ2A 4WKAA 3CL7A 4GYPA 1EJRC 4QJ5B 1QHZA 1Z41A 1HG3A 3MSDA 4WX2A 1OZMA 2WHKA 3ZVHB 1NFGA 3GFYA 3WH7A 3L4VA 1XGZA 1US3A 3E2QA 1F4AA 4JTDA 1QBBA 3BLLA 4B4HA 1R38A 4H9UA 2V68A 2NUYA 3JZEA 2W6RA 1OFEA 3FHQA 2J8GA 4CU8A 4ZVJA 3PB2A 1GQLA 1XGDA 3GVRA 5A94A 3IANA 1RZMA 4IFOA 4LNCA 6CGTA 1U22A 4O1AA 3N2BA 3KP0A 3CBWA 4I6KA 3I4EA 3AYRA 4EPEC 3URQA 2C3ZA 4ACYA 3I6RA 5K3VA 4JFSA 1FP8A 1JIBA 1R7AA 3OA3A 1P0EA 2POTA 4O50A 4ZA0A 3E2RA 2O4QA 1R9YA 3OYXA 3IGUA 1NP2A 3T8LA 2Y62A 4Q4OA 1H60A 3MB9A 2Y85A 1PZ3A 2FTYA 3B4UA 3UA4A 1YTEA 5BNKA 3V4BA 4IXXA 4CCCA 3QV9A 4M7SA 4GIRA 2OFJA 1A50A 3HM7A 1M7JA 4MPKA 3R13A 1CB2A 5LIYX 3NNTA 8TIMA 4RZ4A 1CLVA 2XVLA 5CGTA 4JN6A 2CLPA 5FI8A 4BQ5A 3BXWA 1F3EA 2PDCA 3ZS4A 4DLFA 1TCDA 4Y96A 5HR7A 3NIYA 3VKCA 4GKTA 3TOPA 3WNMA 3IVSA 1QK2A 2ABAA 1KWGA 3BICA 2WQPA 3E96A 1DJQA 3CB3A 2OGYA 2DSVA 2CBUA 4ECLA 2YZRA 5K4XA 2V67A 3P0XA 3TYCA 1IXPA 1GVSA 1MFUA 4BWLC 2WPGA 2ZRYA 3WL0A 5E5CA 1SFTA 4AZBA 3GG7A 1QASA 3DC0A 1DQWA 2PSNA 3WNLA 2A3LA 1V3HA 2UBPC 2D0GA 3R1ZA 4OECA 5CPNA 1R3QA 3G8EA 3MSRA 4E2DA 1AH0A 5FF4A 3S5YA 2VP8A 1MWOA 5FF3A 4O14A 2DZAA 3L7RA 4GH3A 3E02A 4N7QA 3S2JA 1R3YA 3QC0A 3MO4A 2JALA 3I3BA 2HBVA 3DDMA 4I5RA 2BS9A 3BAJA 1FDJA 2QIIA 1HGWA 3LS9A 1GYNA 3VD4A 3W02A 4YYFA 3O63A 2CLIA 2P10A 3L23A 4CVWA 1XLBA 3TFXA 1TX0A 1V08A 2ZC1A 2VUYA 2XSAA 2WVVB 5LIWX 3EWUA 1TMQA 2IKGA 3MMTA 2DUZA 3R2GA 4M7TA 2PGEA 2VZUA 3KFTA 2OMAA 2ZA1A 4QHRA 3VZYA 5HWNA 1LCOA 3M7SA 5LHFA 5FCZA 1TIWA 2BGQA 3SIMA 1NJJA 2AQWA 4LUTB 1QOQA 1E1CA 1V77A 3LGEA 5AY7A 1DHPA 4QDMA 3ZOAA 1NEYA 3IARA 3WF4A 1LQ2A 4EE9A 3B03A 5KZEA 3DHPA 3VDCA 1RQEA 2V3GA 3VPLA 4KFPA 1K9FA 2P0IA 3IGSA 4GXWA 1L8NA 2FJKA 1E9LA 2ISFA 3IJ9A 4HA4A 4K6AA 2VC6A 3LOTA 1TPDA 3ITYA 4Q8OA 4EPBC 3CNYA 1VFMA 4J35A 4FNPA 3BAIA 2WMGA 1JDEA 1WV2A 2QDDA 1OGSA 3GBEA 1E9ZB 4O16A 4PA8A 3N9KA 2WLYA 4A8LA 4J2MA 3FXGA 4LVAA 5CCZA 1K02A 4K39A 1ZUAX 1XRTA 1B4KA 4RLIA 3SUUA 5T9CE 3ZIZA 5C2CA 4BF7A 2DP3A 3ZWTA 4GWEA 4HPXA 3VOJA 4TX8A 3EB3A 1VRDA 3N2XA 3DU0A 2YL6A 2DH2A 3M0MA 3LNMA 1CI1A 2QMKA 4FAMA 1XRFA 4H8HA 5I3KA 2PS2A 4JTEA 3RFAA 2VD9A 3BC9A 1JZ3A 1QI2A 1KM3A 3UYIA 4AD4A 5D2YA 1TX2A 5HNRA 3T2PA 1ICPA 1POJA 1F8IA 3TZNA 3VIIA 4IHCA 1VLWA 3H2MA 2EQDA 3QTGA 2J75A 4ACZA 4YHGA 5A2BA 3KCLA 5G2HA 4ADTA 1R86A 4O1BA 1U83A 1JL8A 1QR7A 5FSDC 4UNIA 1WZMA 3GDMA 1Q6EA 2RHGA 2XPKA 4QQ3A 1PS9A 1Z8AA 3MZ2A 1QPNA 4UFIA 1A5KC 5D8WA 5DQPA 2V69A 1N8IA 2PTDA 3MC5A 1K9DA 4DWSB 3M6YA 1EUAA 1CXIA 4JL1A 3NTYA 1WNOA 2CLKA 3OOQA 1H62A 4H7VA 1PUDA 4AD2A 1EWDA 2I1OA 2DU2A 5CPMA 3GIQA 2JKEA 3P62A 2A6NA 3G1HA 2WMKA 1PZ2A 2IXVA 1UA7A 1PHQA 4GINA 3RPMA 3UWUA 3AC0A 2ZVRA 3DKLA 4ZZ9A 4W84A 5AHNA 4IMEA 3MKKA 2O9OA 1GVEA 2INFA 3SSJA 4M1BA 4MJZA 2Z00A 3UD6A 4Q4KA 1J5SA 4QX4A 4H01A 2PDXA 2ZADA 3QW3A 2PDUA 3W25A 2XZ9A 2Z28A 1GOKA 3U7VA 3UXKA 5DMMA 3PZIA 1N2VA 3GTIA 3HV9A 3CV7A 3K8MA 4D1IA 4JEQA 1FWJC 4IGMA 4KCWA 4V15A 2XM2A 3HGSA 3HFYA 3RJXA 4G8TA 4L9XA 2PDWA 3WNKA 5A3HA 3BGJA 1X96A 2DFAA 2YDRA 3DHDA 3O8AA 2QAPA 3ZSSA 1Y5XA 2Z6IA 1GOIA 1G6CA 2AQOA 4IPLA 1EEPA 1EXBA 1OCJA 5BRBA 2ZDRA 1G1YA 3APGA 3MUIA 2IQTA 3W7NA 1M04A 4Q7BA 3QM3A 4D72A 3NQBA 2ZZ5A 2WM0A 4WJ8A 4N6FA 1OFOA 2X40A 3CL6A 1GVIA 4Q6JA 3GXPA 3A5FA 1LRQA 4AFYA 1ZS2A 2Z1XA 1HJXA 2FVMA 5KMYA 3HGRA 5HQLA 4MB4A 1WKYA 1P7TA 1ZJBA 3VM7A 4PCTA 2VEGA 3G6LA 4KKXA 1LOLA 5LHEA 4H9XA 2EPMX 1IT0A 4QRNA 4ALDA 1L9WA 4DPQA 2QZRA 2ZZ3A 3K2GA 5E9XA 4XD5A 3VKAA 2PWUA 4GYJA 1J79A 4W87A 3BK0A 1SMDA 1MXGA 1A5BA 3E38A 3TN4A 4ERIA 1A0CA 5DEZA 4LAOA 4HK6A 4AD3A 4OQVA 2NV1A 2VM8A 4FNTA 5EBAA 1YNPA 2D2GA 1MDLA 5I3FA 3WLJA 1XKJA 3G18A 2YIHA 3ABOA 1OCQA 2NXGA 3M46A 1FWDC 5LIUX 4DWDA 1TYGA 4L1XA 4O15A 3VGGA 1W17A 1SU5A 1K8ZA 1OX6A 1PTGA 2F6KA 4MAVA 4UQAA 4J40A 1IEWA 2ZE0A 3G1XA 2NV2A 4ERGA 3C8NA 1OCBA 3DYMA 3W2MA 2DIJA 2GUBA 2E8YA 5E70A 4H9MA 3HJZA 4GC3A 2NQ9A 3S9ZA 1ZJHA 2CHNA 1EGMA 1HKIA 3RF9A 3L0GA 3ITGA 3SN1A 4FXSA 3GH4A 3QKEA 3IGHX 1EO5A 3HQNA 3UYCA 1MUMA 3CAWA 3K5XA 4JD4A 4P61A 2G3MA 2GJNA 3WF3A 5HBFA 3QMRA 1GZGA 3AIQA 4PB3A 3U5UA 2Q8LA 1RLDA 4QCEA 4Z2JA 5FJIA 5FF0A 4L65A 3N73A 3WNPA 3GXNA 2VTFA 4YJ5A 3W26A 3FSTA 2D2HA 2YYTA 1UWTA 4WVXA 1TMLA 1QAPA 1WAUA 4GA8A 3GR4A 1BRLB 1Z3NA 2FVKA 5AOUA 3WELA 1OM0A 2L5HA 3PZVA 4DZIA 2OSYA 3NGFA 5LA2A 2FFCA 2ZYFA 2PWVA 4UR9A 2OYLA 1S2CA 4PL1A 3W1PA 2OLSA 1YDYA 3AJXA 4UFLA 4KEMA 2ZUWA 3KVMA 4H8NA 4JL2A 5DY3A 3NO1A 1Q45A 3L4XA 3C2FA 2E28A 3R58A 1Q7QA 3VNDA 2BVDA 4E8CA 3H7UA 3BAKA 3RLVA 4ML9A 1L6YA 2VFHA 4A3YA 1PO9A 1I2OA 2D23A 3MO7A 1UIPA 3D5HA 4QJ1A 4AISA 1BWKA 2AGKA 1S3TC 2E6AA 3AUOA 4FF7A 1XBXA 3WDQA 4GPNA 2HVNA 5HINA 4YHEA 1US2A 1M5WA 4X2RA 2PGRA 1C8QA 3BG3A 2WHLA 4R5EA 3LQGA 1WQ5A 3QV8A 3M9YA 4Y6GA 4CCEA 3S2LA 4ERAA 4X0VA 1E1CB 3ID7A 3IRDA 1WXYA 2WSRA 3VFLA 3WD3A 5JIWA 3FJ6A 1JYVA 3M5YA 5AZ1A 2FHCA 2PLJA 1SYTA 4H8VA 3UWVA 5ENLA 3RMEA 1V3LA 2PC4A 1X1NA 3TJXA 3EB2A 3T6CA 4ENLA 4QIUA 4H6KA 3BV4A 4POCA 5ABFB 2ZXAA 1XINA 2HS8A 4B3ZA 2P5NA 1E0XA 1LBMA 3BJTA 3P81A 4WRHA 1VJSA 4NVTA 1UOKA 3PSWA 3TCEA 4DXKA 5D9OA 5B80A 4R7JA 3W86A 1RH9A 3CMFA 4AIBA 4RR4A 3II1A 3DG6A 3KL0A 1B5TA 2YFOA 3ZT5A 4M51A 3ZMRA 3A4JA 4X22A 3V1PA 3MWCA 3UY7A 5D2VA 3GDRA 4RPQA 2OSXA 1F2JA 5K4ZA 3NM3A 4N42A 5BU9A 3AZRA 1YYAA 1XDJA 5D4YA 1JZ4A 1UG6A 1EJXC 1RLCL 1WX0A 3HTWA 2P1FA 3LCGA 3VIJA 3DBNA 3I3DA 2NZLA 1OC6A 4PUKA 2XSBA 2ASHA 1DIOA 1VYRA 3TTYA 4UWMA 3QZEA 4NF7A 1J6PA 2YX0A 4RV8A 4GIEA 5C2GA 2PUZA 2FYMA 7XIMA 3N6JA 3MKCA 4NASA 1AG1O 1NH6A 1TR9A 4ACZB 2OG9A 4F0HA 1KV8A 2BXVA 2I16A 1JZ8A 2EKCA 4LNYA 4XB3A 1V6XA 4JIEA 1VPYA 4AEOA 3WY1A 3WF1A 4IQJA 3UZZA 1ONEA 2FGLA 1EHNA 3G77A 1JXKA 3UR5A 4EF9A 5CC5A 1K6WA 1MW2A 1MEWA 4I7VA 2GWNA 3V16A 3GDTA 4TV6A 1DTNA 2Y1HA 3E0FA 2VZSA 4CN1A 3N34A 4BA0A 4B5UA 3BZJA 3A3HA 1AL8A 1W9UA 2WC7A 3CH0A 1EYWA 4LVFA 3T7VA 2BXYA 3TW6A 3WLMA 1PPIA 5G4EA 1Q2RA 3ZLHA 3M7WA 1OG0A 3SB0A 1VHNA 2VGFA 3KZPA 4K37A 4NAEB 3CUIA 5M1TA 3L4WA 2E25A 3SCPA 2OZ3A 5CPTA 3BG9A 1BVNP 3ABZA 3BGAA 3AIRA 4QXIA 1F3XA 4WF7A 2GGEA 3GXMA 2F6UA 3BAYA 1VPQA 2KZHA 2ALDA 1YMYA 3L4YA 2R94A 2HNEA 2X30A 1OX5A 3SY1A 4X9SA 1YPIA 1IXNA 4BQ2A 1XWYA 1H50A 5HMSA 4CQBA 3WIJA 4KCTA 3TH6A 2XU2A 4WOZA 1FWFC 4DBEA 4NXKA 3UG8A 4Y2WA 4XZ9A 1EXPA 3N19B 1IE7C 3M41A 2NQHA 4UTMA 1GEQA 3QOMA 5I3DA 2IKIA 1JNEA 1JCXA 3PHAA 4LBUA 3BLPX 2NUWA 1E6XM 3P93A 1EGVA 2QYGA 3A47A 4LY4A 5GPRA 2YXGA 3VM5A 1YX1A 4LUYA 3TYDA 2J79A 2DEPA 3WEMA 1ITUA 4HOWA 3P14A 2DT2A 1UD2A 1YKWA 4M56A 3RCYA 4HNTA 1K77A 1XYLA 3ARVA 3S6DA 1GJPA 4GQ0A 2ZZ7A 4IPPA 1TA3B 3RXZA 1W32A 1OYAA 1HP4A 1DL3A 2GUUA 3NSMA 4A29A 1E73M 5BRPA 2QCNA 4H4IA 3ARYA 2Y6ZA 3HF3A 1S5WA 2VGIA 4HT3A 3GAKA 4D6FA 4N02A 3ITOA 4WEVX 4RW3A 3SRDA 3CIVA 1R3RA 3T81A 1FDZA 2V63A 3H70A 1G9HA 4X2PA 4J9JA 1XG4A 1GONA 2YL5A 1O7AA 3R94A 4WHBA 3CWNA 1EFZA 4GKLA 4MWAD 3EWCA 3W7RA 4JKMA 4HU0A 4PB5A 4Z42C 4M6QA 3NQ6A 4DQWA 4EKJA 5AVNA 2GVEA 1VBHA 3R0DA 1YDOA 2R8WA 3N15A 5G2WA 3OU8A 4O53A 2DZSA 2R24A 4R9XA 1EJWC 5DELA 3GTNA 1A5CA 1ISZA 3T4CA 4FB7A 2VQTA 3CU2A 3NO5A 4MNKA 4D6CA 4JIRA 3PUOA 3GVGA 3IIVA 4IPIA 1OC5A 2HVMA 2W5FA 1S2WA 1ENUA 1F9CA 1D3CA 4RW5A 1MSSA 4HSOA 3FFSA 1YXCA 4GXPA 3J7HA 3EWZA 3UJSA 5LGXA 3NCOA 1L2QA 1TPUA 2IPFA 4Q4SA 3RU8X 1KFEA 3F7JA 5KINA 4E6MA 3JVAA 3VMNA 1R3VA 3VU2A 2NVAA 3UZXA 3GC2A 4PE8A 4D6DA 3AXKA 4ZB5A 4NYYA 4DEFA 4CN4A 3QPZA 2I14A 5A8OA 1FHLA 3IEBA 1HT6A 3S1UA 4NP7A 2NLIA 4MKVA 4N9CA 4ZB2A 4HA1A 2XSXA 3NQAA 1IIGA 3MCNA 4AIEA 5EBUA 1T8XA 2R1PA 3H2CA 1OK4A 2E77A 4MOZA 4HCDA 4TUFA 3B0UX 1N8FA 3HB9A 1TWSA 4I7WA 1O95A 1DJXA 1M7OA 5BW6A 2YA2A 2ACRA 4KT2A 2XISA 2OZ8A 1ECEA 2OZ0A 4J3XA 1FH7A 3PZ9A 1KXHA 4JAWA 4TR9A 5M3WA 3HPSA 2J6XA 4JIHA 1JI1A 1SFSA 4N4PA 4FF5A 4WK9A 4GX9A 1QTWA 3GAYA 4B3KA 3UG4A 1TUXA 2BVTA 4KRZA 1LG2A 1FHDA 1YTKA 1JCYA 1FH8A 4Z1YA 2YB4A 3H23A 2WZMA 3GZAA 2CKSA 3PC0A 3W3OA 4C1NB 3UCQA 1ONRA 1MXDA 3AWOA 3C4UA 3LB0A 4O1DA 1EDQA 1CGTA 3MBFA 5A6JA 2Y89A 1T99A 4HB7A 4XVDA 4LS2A 3GNOA 4K68A 5F2GA 3TJ4A 2A85A 1VFHA 3PY2A 2R82A 3CEUA 1V3JA 2FPYA 1V8EA 2OTDA 3UW6A 3P5ZA 4GUJA 5B7YA 3IV3A 4DJEA 1RCXB 3PJTA 3ARTA 5XIAA 4QR6A 1H5YA 3EX2A 4YLWA 3TP4A 1J2BA 4UTHA 1RALA 2VFFA 1DWIM 4GNJA 3MP5A 4L61A 2QDEA 1DIDA 1CX9A 3QGKC 1V0KA 3FEQA 5T8GA 3T42A 1XLIA 1EB3A 1DWJM 2DT1A 3F03K 2P50A 2C15A 2J74A 3QF0A 3WN6A 1HW6A 3DKJA 4GZJA 1TTJA 1XDMA 1BVZA 1GPWA 3V5FA 1NDZA 5D04C 1S5MA 5JBFA 4HYWA 2OX4A 1TWDA 1DJZA 1RQHA 3GHRA 3ZJ7A 3C3UA 1VPXA 3FJNA 4NNBA 5C9ZA 3GRIA 4QCFA 4XUYA 3P8JA 4HP5A 4S3CA 3ZR6A 5I77A 4DUVA 4MB3A 4AD5A 3O3RA 4AEEA 4HNVA 1GKPA 2X7WA 3QFWA 4L9ZA 4OT7A 5H6HA 3KOYA 1A3XA 5F2LA 4O0QA 4JYEA 5AVHA 1QNOA 4HNCA 1C7SA 2WKLA 1TWIA 1H5VA 4ZOAA 1I0DA 4DJED 3H8AA 1B0IA 3IAPA 1XQLA 4H41A 3SY8A 3RMJA 2E9BA 3VUPA 3LMYA 1LZOA 3KWXA 4TX6A 2NQJA 1D9EA 5E6ZA 1XLCA 3SECA 1FOBA 4NXSA 3TE9A 5LGZA 1QW7A 4C6MA 4X60A 2EPKX 3PFRA 2RGMA 1XRVA 3ZZ1A 1ONXA 3BURA 2DQXA 3LA4A 5DT5A 2Z1KA 4AHOA 3QPYA 3EMQA 3W2NA 1EF3A 2V5JA 1EGZA 3SY5A 3V36A 2PC8A 2DT3A 4F4RA 3H4XA 3O07A 1E51A 4BI5A 3W7HA 1KBKA 3DFQA 3A24A 1BAGA 3N14A 4ZO7A 4CQAA 1ALDA 4LYKA 1W5QA 1HQTA 2WSQA 6XIAA 4IMFA 4IUOA 3BMXA 1BXBA 3JRKA 1BF2A 4N2YA 3U57A 3LM7A 4FNUA 1F3WA 3M0LA 2W9MA 4HGXA 1CXLA 3R8GA 1W1IE 3FAXA 1RP9A 3LI1A 1RJPA 3W71A 4S1FA 3P8IA 4LB3A 4GG9A 1PCWA 4OOZA 3EA1A 3KW3A 1XIDA 2NSXA 1FX6A 3HG3A 4Z2KA 2B81A 3LNPA 1WDWA 2D22A 3FS2A 4W8LA 1QWGA 3VX0A 3KHDA 3MWAA 1CXFA 1NQKA 2ISSA 1P6WA 3A4AA 4CLMA 1LWJA 2WQDA 3BV7A 1CGVA 3UESA 3M43A 4YN5A 2Y7EA 2ISDA 3UWQA 4WJEA 2CEQA 1KD0A 3WL1A 4LUSA 1PX8A 2F2HA 2OWCA 4JS3A 1FWAC 2ICSA 2OXNA 2RDTA 1PAMA 5K9CA 3KVLA 3N18A 4WOQA 1CXHA 1XIBA 1TFVA 2J77A 3EYPA 5D03A 2PCEA 1T96A 4B2DA 4J27A 4GACA 4PFMA 3RJYA 1IEXA 1BD0A 2DW7A 4ZBCA 2YCIX 4NJHA 3AMCA 3UXDA 1OHLA 4NT0A 1DOSA 1MZHA 1OINA 1V6WA 4WR3A 4K3ZA 1JCLA 4MLRA 3SGUA 3G0SA 2C71A 1HN1A 3WLPA 5HWJA 4FSAA 3NL3A 4LC8A 3OHIA 3KUMA 5C9RA 1NWUA 1XLLA 1EDTA 2C7FA 2HXUA 3GXIA 3IACA 5DY2A 1RHCA 1ITXA 4R7OA 3N1AA 5GJMA 2E09A 2QXWA 4I6VA 3AROA 5LIXX 1JXJA 2PE4A 3S47A 2Q71A 3BMVA 6REQA 1QXLA 1Q4WA 1RPXA 2OOGA 3W1XA 1FWHC 5AYIA 3AHYA 4B2DD 2HZGA 4IGSA 2E6DA 3LCXA 5I3HA 2OELA 4EWJA 1IGWA 1VFFA 3W0KA 4S23A 1BKHA 1W8GA 4GI9A 1ZJIA 2KX9A 2Z2BA 5D8ZA 8CGTA 1UYQA 1I6NA 2GQ3A 4W5UA 5CBBA 2J66A 4CQDA 2DZVA 1O12A 4OTKA 1VD6A 3T44A 1XFCA 2ZFAA 2ZDSA 3S5ZA 4ZGYA 4MJ4A 5DFAA 4YNGA 4HHPA 1DE5A 3R6IA 2Y88A 4PR4A 4IOTA 3H6OA 3M07A 3LBCA 1HX0A 5CQ1A 5BU6A 2ZWYA 2OQYA 4LAKA 1IWPA 1YE4A 2PCQA 3KLKA 2EAWA 3C2OA 3CV1A 3UPMA 3V35A 1YE6A 1R9ZA 3VXGA 4C91A 1OYCA 3QQ1A 3VNZA 4GISA 2YSWA 4B90A 3RILA 1LYXA 3POCA 3PG9A 2QCGA 2X1IA 5KTLA 1UJQA 3VNLA 4DRSA 2XH4A 1VFLA 4ZFCA 3QR0A 4XAPA 1R2RA 1XLFA 4JNMA 4JN8A 4LT9A 2QUUA 2GDQA 3QFEA 1NFBA 4HNNA 1F7BA 1KRCC 3LGGA 1LF1A 3NWRA 1G0CA 3CZKA 2CZEA 5FJTA 1NQ6A 2AMGA 5ECVA 1UC4A 5E0FA 2ZRWA 1KBIA 1SVDA 1I0BA 4A3RA 2OT0A 4JFWA 4PMJA 1KKRA 1DTUA 1P0KA 4DZAA 2DZUA 1POKA 1Z9AA 3ELFA 5D2WA 3S3GA 5AHFA 2XIMA 3PWGA 2IKHA 4O11A 4QEHA 1PKNA 4YWSA 4PTNA 1YXDA 4QNWA 3AICA 3UZ5A 2JE8A 2QJNA 3UT0A 4BEQA 2I17A 1G4SA 3TAKA 3WD4A 4UTKA 4M29A 4O8RA 5D30A 5FKYA 1W5OA 2PDHA 3WD2A 3VKJA 1XSIA 3UJFA 3SCQA 2IS7A 1B4EA 1NVMA 2A3EA 4UZSA 2OEJA 3L0KA 3FVMA 3Q37A 1XBZA 2HV5A 3BLDA 4X3ZA 1K7EA 3TLLA 1R2TA 4OV9A 3U6WA 1ONWA 5EMLA 2JIWA 1A0DA 1S5VA 3NUKA 3NPWA 2E40A 3W4RA 4AY8A 3C2EA 2XG9A 3F5KA 2A3CA 4UTWC 4XK2A 3L67A 2BXZA 2H6RA 2Z4GA 2H8ZA 1WDPA 1Z69A 4QS6A 3CV6A 5CEWA 2O9RA 3TTEA 2YBTA 1QHOA 4L1WA 2BZNA 1BPLB 3HU7A 4DJFC 4RKAA 5DRCA 1KFJA 1E72M 4US5A 1P0DA 1PIIA 2V5CA 5BZAA 5JVLA 3O05A 1WPCA 3GNDA 4U2ZA 3EEGA 2QS8A 2ACQA 1Q3NA 4IM4A 2DJXA 3NQCA 3L5LA 2X42A 1YRRA 5F4XA 3AS1A 4ADUA 5IBXA 2CBIA 3P84A 1JPMA 3LRMA 5BWAA 2ODOA 3RR4A 2YW4A 4JCLA 4LFYA 4YVPA 3BSGA 1J0ZA 1JEZA 4E8DA 1RCOB 1G5AA 2BGSA 2WNQA 3CC1A 5M2FX 2VR5A 2INEA 2D69A 4ORIA 3U2ZA 3DECA 2PDMA 1KCZA 5CLWA 1TB3A 1U33A 2ZUNA 2BOGX 4JTUA 1UQYA 4JBRA 5FIPA 3JZUA 4US5D 1UWAA 2V8ZA 2GVJA 3JR2A 4UQEA 3H2OA 1LWIA 4L6OA 4A2RA 4I9TA 4IX2A 2WWCA 3LQLA 3HO8A 2G3NA 3NQEA 1H4PA 2PLKA 4GQBA 1HKVA 5CPQA 5A6AA 3RX3A 3BARA 3VDAA 1Q7MA 1F3TA 3KCOA 2JBMA 3KRSA 1GOWA 1TQJA 4AZ6A 3GC5A 5BMWA 1E6QM 4S2CA 4IP5A 3T8QA 2OOFA 1IEVA 2CCRA 1XW8A 2DIEA 4BHYA 4LOCA 2X1TA 1EP2A 4H00A 4DLMA 5CZJA 4C60A 4N9DA 1KM2A 1YPXA 1H41A 3SJ3A 1X7IA 2C13A 2BMBA 4F0MA 4C1KA 2W0UA 3WFLA 3H53A 1Z32X 3F4WA 2FDMA 1W1ZA 2DV0A 2F7FA 3LV6A 1EPVA 3OZYA 5HJLA 4C6DA 5D02A 4U3CA 1J12A 1HNYA 4MNLA 2V2DA 2VT0A 3UJEA 1P6BA 3GHUA 3EXSA 3A12A 2JQXA 4NRSA 4KETA 1XX1A 4B5XA 3N11A 4RK8A 4EAMA 4LUSB 3CMGA 3CM4A 4MYAA 4ZOBA 1Q66A 1A47A 4M24A 3PBUA 1J4EA 2V5BA 3C0JA 3LYEA 1A80A 1RBLA 1SO6A 2YBUA 1UUQA 1FWSA 4ASTA 1LOQA 3WUBA 2YDSA 5FD0A 5LXEA 1B9BA 3T07A 2PRLA 3TK7A 3GVQA 4DBWA 5BOEA 2CBJA 3OLDA 3GU2A 3N04A 2BSLA 2EHHA 1AODA 2QQ6A 2BX7A 3PBWA 1AW2A 1AZ2A 4QSHA 3U0HA 1GJUA 2DGAA 5H2ZA 1AZ1A 5A8GA 1WYIA 1ZBWA 1GORA 2R1NA 3AO0A 1AMKA 2Y5EA 3O16A 4AZHA 2ZOXA 3AS3A 3SCWA 3GQYA 2J88A 1FRBA 4HJFA 2DZTA 2ZX6A 3G0XA 3VKDA 1IZCA 3EX1A 1LQAA 4PODA 3MP3A 2CETA 4H2HA 1QUMA 1OY0A 5I6SA 1WA3A 2AQVA 2VWTA 3S5NA 3QYSA 3P67A 5CH9A 2PTWA 2G3FA 1XQKA 3CAVA 1XIGA 1XLAA 3LEPA 3NXFA 1X6NA 1RUSA 2DDXA 1TE6A 3STGA 3C0LA 1J0IA 4YYCA 3BOLA 4PGLA 6REQB 4JFVA 5EGRA 2X1RA 2A0NA 1EYEA 3KOFA 2GSJA 1R3TA 3W7IA 1KXQA 1ZTVA 4RZ5A 3DGBA 1JNDA 4IQEA 4JTJA 4L4PA 3PPHA 3DGRA 4QJ4B 1X8FA 3W83A 3CTTA 3GZ3A 2F84A 1UHVA 1DJNA 4C65A 1HKJA 4EPKA 3MW7A 3VOGA 2FHFA 3F2BA 5CG0A 3QLDA 4G1KA 1VCFA 2HSAA 3STFA 3MV11 2TMDA 3AS2A 3UU0A 1ESWA 4WKFA 1BTMA 2CZ5A 4GD0A 1VFTA 1W5NA 1DJHA 1JYXA 4YVXA 3MBDA 3A3XA 2WNNA 2ANUA 4L7ZA 1MNZA 3Q2DA 5TF0A 2BWGA 2XHYA 1L0PA 3M47A 5F2MA 1YHTA 3IAQA 2A79A 5FEPA 4Y9PA 1PKLA 1JUBA 4JDBA 1K4GA 4B3LA 1HTIA 2G4FA 1HO4A 5G4HC 1BGAA 4U3AA 4GJJA 4PUDA 1X1OA 1MQPA 3MYPA 2O92A 2OR2A 2QVHA 3E74A 3VNJA 1I9CB 3VGHA 4LJ3A 4D6HA 1O5RA 1TZZA 4GVIA 2E1WA 3GUWA 1UBSA 1RBAA 1CXEA 2CLEA 3LPOA 1XXXA 2EO7A 1C92A 2C91A 4Q8PA 3VCCA 4GGHA 1Q6RA 3LN3A 3UZJA 3WK2A 4YL2A 4YWIA 3MI2A 1VYSX 4NI8A 3QW4B 3KWSA 4F9DA 1XYCA 3GIYA 2CXGA 3W7QA 3WLRA 4MJMA 3GSMA 1XYAA 1FTXA 3AIVA 1CIUA 4OV4A 3P82A 4HA3A 4IIFA 3W7MA 5MKGA 2VMFA 4Y9MA 3ISIX 1TV2A 4UXDA 3G6MA 2QVNA 3SCVA 4PMDA 4LBRA 2BNJA 3P60A 3UR2A 3TW9A 1SZEA 3FVDA 6A3HA 3G1AA 3NAVA 5FSEC 3UNDA 2GPTA 1JF6A 3W7CA 3IK4A 4HK7A 2Z1BA 2Q02A 3CO8A 4JICA 2E3ZA 1ZCCA 1L6FA 4NJIA 3HOJA 4M8UA 3WBXA 5H91A 5GQBA 2DZBA 1YDVA 2CNCA 3IS4A 3LXCA 3DFOA 3VGFA 3DH7A 3NA8A 9RUBA 1I4NA 2E9MA 4HZ6A 2FH8A 2WANA 1JFXA 3LDVA 3HPXA 1IV8A 3WD0A 1SW7A 2BDQA 1PDYA 1J10A 4MPQA 1LQ0A 1X6LA 4OVXA 3N3TA 3W28A 2VX4A 3N4EA 3RLHA 2FQIA 4FOUA 4OFCA 4P8WA 4WD0A 1GCYA 4ATWA 3B0XA 2BODX 3OB8A 2GFTA 4Q7NA 4KWSA 5K2ZA 5HUPA 3ZJ8A 1ZY9A 3NXLA 1W31A 1KRMA 3PJWA 3CHFA 1XPYA 3TTSA 2OEMA 3W76A 2P88A 4ZB0A 3MUCA 1WZAA 3BGGA 1OCNA 4KEVA 3S8HA 3AIWA 2GUYA 2H90A 1V6UA 4L9YA 6ALDA 2F9RA 2FZBA 3MDWA 5C9WA 2GL5A 4N0RA 3IJIA 3VI2A 2I9UA 1TPVA 4KW2A 4QAWA 1BG9A 2WWDA 1LP6A 3S46A 3OZMA 3UF9A 2B7QA 3DFHA 4AC1X 4J3TA 3TROA 4XWUA 3ARSA 3TC3A 3ZO9A 2X09A 1EUNA 3TSBA 2WNZA 1OT2A 3WNOA 3AU6A 1SZRA 3RRXA 5KZMA 2Z1WA 1Y65A 4LQ1A 2E6YA 2ZUVA 2C0AA 2NQLA 3FA5A 1DWFM 3RN6A 2ZA3A 1H09A 2BHZA 4LV9A 3TFCA 2VC5A 3WEOA 3NQMA 4WGHA 2FPVA 3VOFA 4G7EA 4LAUA 4KFOA 1NOUA 4MAZA 8XIAA 5C54A 5BRQA 4F2BA 1C9DA 1E1FA 3TN3A 2PB1A 1SZNA 3QOKA 5T26A 4IIHA 2Z1VA 1EIBA 1Q6OA 4TIMA 4AZ7A 1EA0A 3KDOA 2AAMA 3WBWA 3N4FA 2J7HA 3GDKA 1JCTA 4MF4A 3K13A 4OKDA 4AIUA 3TSMA 4NX0A 1LRNA 2CITA 3AXIA 4IFKB 1UP0A 2GOUA 4PMZA 4YTSA 1S5NA 1VAHA 1V7YA 4Z1AA 3ZJ6A 1DP0A 3W81A 3N12A 5HUOA 3V0TA 3UG5A 4DAFA 4UTIA 1TTQA 1R87A 2WZEA 4DBSA 3OJGA 4UQBA 3U7BA 5TQLA 4L5ZA 3WQ5A 4AX7A 2Q6ZA 4PMQA 3A21A 4F79A 1GHSA 4A22A 3FGCB 4CD7A 1VHCA 3VNIA 2QUTA 7A3HA 3AFBA 4B5WA 3Q65A 2YB1A 3FV9A 1FWTA 2XGIA 4PMUA 4ILSA 3DYPA 3ZT6A 4EX4A 5EL1A 1BTCA 1UPMB 2PRMA 4JQ1A 4MY1A 2OKOA 3CHCA 4ZOCA 4XZHA 3OZPA 4UCFA 3DHFA 1OB0A 5AYZA 2Y7GA 3HV8A 1XYMA 2WBGA 3W72A 4Q8QA 4XUGA 2R14A 2BY3A 5J5DA 1OVDA 2XJ7A 1DIKA 3LERA 3GUGA 4C6BA 4E4PA 1MUWA 2JGQA 3BE7A 2Y24A 1RA0A 3W6LA 4FLQA 4NZ5A 4DYKA 5D2XA 5EU9A 3WDPP 3SQLA 5DX7A 1E9YB 4YS1A 4AHQA 1LRTA 4XVEA 3MI6A 3SAZA 1TREA 3OEXA 4W8AA 4M6VA 4QAIA 4AWTA 5CSUA 4GY1A 1J8VA 3H21A 2J7GA 2Z29A 3E6EA 4ZXLA 3ARRA 3PVFA 1XYFA 2CHOA 2WCGA 3BLKA 3LTYA 4Z2LA 3MKVA 1IWAA 4GQQA 3SUVA 2GQAA 4FLRA 4CQCA 2PZ0A 3VC5A 3PZNA 3CB8A 1CTNA 1NELA 3MDUA 1ZL1A 4JQAA 2BY0A 4E4FA 4ICCX 3VAVA 3GX9A 3C0QA 3LGDA 3LUTA 2X1SA 1RK5A 1O5XA 3NYZA 1DE6A 4MZ8A 3U2EA 4S2BA 4NJGA 3SIZA 3CLMA 3UXIA 1K8CA 1PHWA 5CZKA 1W54A 4D2JA 1GK8A 1P0NA 1KGWA 3EWWA 1CGXA 3TXZA 1DV7A 3F5JA 4NG3A 1ZAHA 1TWWA 2WHMA 3HG2A 4BKNA 1W5PA 1TMHA 3H2NA 3ARZA 3WDRA 1CCWB 1S5TA 4IJRA 4DO6A 4XZLX 3FEMA 1XPGA 3U4FA 4ZCWA 3VNYA 2GJXA 1ZNNA 3CQHA 4O1EA 3B8SA 7ENLA 1JQXA 3FK4A 1JDFA 2ONEA 2MANA 1J0YA 3B40A 4HNOA 3NDOA 4I9JA 2IPWA 1RA5A 1O94A 1MYRA 2F2KA 2NVCA 3RM8A 1QW8A 1G67A 3FCPA 5BOFA 4AXKA 4Z17A 1JDAA 1FH9A 3GNNA 1XH2A 4HMEA 4FA3A 3SQSA 4YVVA 2QIWA 2Z7KA 3CQKA 1TV5A 2WPBA 3TA6A 2PDYA 1R3SA 3AZTA 4B9ZA 4LB4A 1LROA 1VFSA 1XH0A 2OX1A 4J28A 4HZ7A 2HMCA 1TIMA 5ABGA 3S1VA 1O5KA 4NRRA 1F8MA 3W7OA 3F4DA 3G3DA 1PXGA 3L2IA 5C7VA 5LNVA 3ITLA 1FFRA 3L4ZA 4NNCA 4JOMA 2G96A 2QGYA 2CPUA 3WG6A 4U5KA 1AW5A 1GUVA 4J3VA 4AU0A 3WUFA 4GIAA 1ISXA 1HVXA 1GW9A 3MVIA 2NQ5A 1EA9C 5G1TA 1HO1A 2VFGA 3SSZA 3BTNA 3FYYA 1PYFA 4RPPA 3CH9A 3EA2A 5C6MA 2VI0A 2J8TA 4LEQA 9CGTA 1OF6A 4KGJA 2EPNA 5A6KA 1QBAA 1GOOA 2G3IA 2PF0A 3I4KA 1W6TA 1JGIA 3PZMA 5J8LA 2NSOA 3WDIA 3W6YA 1SPQA 2XH7A 1S2TA 4RDVA 2JEPA 2BG5A 3GU1A 3HN3A 1V3MA 3GKAA 1FY6A 1XI3A 5I5RA 3B8UA 3LCLA 4MG4A 3QR1A 3B97A 3DUGA 3O1NA 2BY1A 1BYDA 1A49A 4KRUA 1MRQA 1EP3A 5RUBA 3TZFA 2WVUA 4LBSA 3I7QA 1Y8BA 1Q65A 5I02A 4S3EA 4REQB 1JGMA 1SFJA 1EPXA 3MV01 1VEMA 4GOAA 4PRWA 3UZWA 4IISA 5EFFA 4AB4A 1QCWA 3IIOA 1R9XA 3INPA 1JFHA 1OABA 4CNOA 2YCKX 3VKBA 2XN0A 5AB3A 5IHSA 2QGHA 1S39A 4O10A 1JZ6A 1KGXA 4GRSA 1VFUA 4XZWA 4UOQA 1WZLA 4PCSA 4LVBA 1W91A 4LH8A 4E38A 3W1RA 2BLEA 2QDGA 3AYVA 3MY9A 3ANUA 4E2BA 2V5LA 2REQA 4US6A 3P6LA 3UG3A 1GPFA 5AC4A 3O0FA 3DEQA 2A5HA 3CWHA 2CIPA 2QV4A 2HISA 3VOHA 3WJSA 1HJUA 4BF9A 4IUGA 3VFCA 3O6YX 3W84A 4FIQA 1ME9A 3C2RA 1H7OA 4H6RA 3RCMA 4DWSC 3R11A 5F4SA 4FNRA 1NOFA 1A53A 1REQA 1OFRA 4UTTC 3A64A 4O13A 3PPGA 3W1UA 5I00A 3CYJA 3PZUA 4KH2A 4PTDA 3OTRA 1V6TA 2CBVA 3DESA 3W1LA 4DN1A 4ZSUA 1P6CA 4NQ1A 2VURA 4P7RA 2VC7A 4GO8A 2ZBTA 4DJFD 1S1RA 1JULA 4IP7A 3B4YA 2G4JA 4S3JA 4O52A 1Q6GA 1GNXA 1KTBA 5B7ZA 2GSHA 3T9PA 2QJHA 1DVJA 4MY8A 2VHLA 3LLXA 4MLJA 3GHSA 2Z1SA 3EWBX 5LA0A 3RIKA 1SZGA 2PDGA 4AWUA 2OZTA 1SW3A 4WY0B 4G7EB 2DW6A 3ANVA 1K7XA 1PL9A 4K8HA 3SEPA 2DORA 3CPUA 4EXQA 3BW2A 2TYSA 3PBVA 5K7JA 4JIPA 3EMZA 2QF7A 4XQ6A 5J5RA 5AYXA 3T55A 1IEIA 1VIZA 2OLAA 4HSHA 2CLMA 2QUVA 1IR2A 1Q7ZA 1UKQA 1Y0EA 1S2UA 3ARQA 3OIHA 3MU7A 4JX6A 1RSCA 1V3IA 3IIPA 5DBTA 3A9BA 4I9AA 2WAGA 3TQ0A 4PUMA 3H2FA 3PBGA 4PUEA 3MSGA 2KAUC 4PB4A 1G4TA 3TWAA 4P8VA 2HS6A 1LT8A 3HG5A 2I56A 5C9UA 4O8AA 1BWLA 3GNPA 4PBFA 3UGVA 3LBOA 9XIAA 3LZ3A 1X38A 3BSHA 4GQRA 1XLHA 1H63A 1VJIA 2ZE3A 4GYPC 3G1VA 2V38A 1NDYA 3P74A 3C56A 1FWWA 3KDNA 4UBPC 2P53A 3K4WA 1TWZA 1UR1A 2VUNA 3L68A 2VENA 3I7RA 3OBAA 4EK7A 4HZ8A 4MM1A 1DXFA 2WJZA 1R46A 4QTGA 5G1MA 3Q94A 2EPOA 2OYKA 3LD5A 3G8RA 1FA2A 3LM3A 2GJLA 5L6UA 2J78A 3OW1A 3WH5A 4PN2A 4DPPA 1H3GA 1JYNA 2HPMA 5CJ5A 5A95A 3W24A 2QULA 4NZJA 4TTGA 1PKMA 1SSDA 3RX4A 2ZZ1A 4F40A 3DC8A 1VQTA 1FWNA 1TG7A 1XSJA 3HBLA 4FXJA 3VGEA 2WBKA 2YCJA 4KRTA 3D3FA 3OODA 1K8XA 2R1MA 4NY2A 1PTDA 3GW0A 3WNNA 4DUWA 4XISA 2DSWA 1VYPX 3IPWA 2NWRA 3ONCA 4H8UA 4JDYA 2EF9A 4UQ9A 1EJVC 3THAA 1G4EA 4MNMA 1BYBA 1FCQA 4KIRA 4X0NA 3SBFA 3TLQA 2XWDA 1XP3A 3HQPA 3MP4A 5E1QA 4R27A 4ZTXA 2HK1A 1K70A 4W7UA 1XBVA 3QMTA 5EMKA 3PPFA 1QWKA 1DQXA 4ZO8A 4ZXOA 2PEVA 3SFKA 1NF7A 2ZUMA 3SN0A 1HF6A 4QE4A 5DT7A 2HBXA 3T78A 2OWXA 2JF7A 2PI6A 3O15A 1Q4NX 2PD9A 4AMCA 4GABA 4BK9A 4B5SA 3TNBA 2PP1A 3B8DA 1SR9A 4QROA 1W3NA 4XTIA 1AJZA 4EIVA 2V0TA 4JNYA 1B3ZA 3NSXA 3T4WA 1LTDA 4BF5A 3KS6A 3ALFA 4EAYA 2XFWA 2DZPA 1VKFA 2RGLA 1C8YA 3A6OA 5HPCA 4IX0A 2INZA 2VCCA 5CLTA 1G94A 3LI0A 2XN1A 3B05A 4GMEA 5K9XA 2VGGA 1MO0A 4AD0A 2GJXB 5HANA 4R33A 3RRAA 4D6JA 3B0VC 4ICNA 4ZOEA 2UV8G 2NXIA 5I24A 1V0LA 1G4PA 4WXZA 3UGRA 1OIFA 5CG7A 2XGZA 1NFPA 5FJJA 5A2CA 2EG7A 3ARXA 1JRCA 2Q8ZA 2VQUA 1YTDA 3TQVA 3FW6A 5AHIA 3W82A 1H7WA 4I90A 2WZHA 3N2TA 5IDZA 5CZTA 3COTA 5E9AA 1ITCA 3R10A 2PWFA 1T0OA 1IZKA 3KRBA 3URAA 1KM5A 1NWSA 1O6IA 1XLGA 1FCVA 4ADSA 5H8UA 3OGRA 3WKZA 1ISYA 4HSNA 2HXTA 1W9VA 2IUZA 1FWGC 2RDWA 3G3MA 1Z44A 3C6CA 3G5EA 5A8PA 2EXOA 1KCKA 2H3BA 3W00A 1KFBA 2E6FA 1HKKA 7REQA 1M7PA 2CW6A 1EX1A 3DAQA 2OLHA 3C61A 3W1MA 3DOPA 1W9PA 3THUA 4W8BA 2C79A 1OC7A 3W2JA 1H0IA 3ZLGA 3TYBA 3EX6A 3NZQA 2QT3A 3DFNA 1E55A 2V5DA 2ZUSA 3GG1A 1AK5A 3O6CA 1AQMA 1CW2A 3I10A 3URBA 2AL2A 3T05A 1PEZA 1W1TA 1J93A 1THFD 3O9NA 4M82A 4ZODA 3BSMA 2V6AA 1QT1A 3TYZA 3UWYA 4HOZA 1AUSL 3GYEA 2AMXA 2YLAA 1SJDA 4ONVA 3CASA 2OO6A 4G7FA 2J13A 1EC9A 2WMFA 2Y5JA 3VK5A 4I9MA 3KZSA 4NAFB 3CS2A 3PBMA 4GZEA 3G1YA 1VF8A 4RDZA 4B5TA 3TMQA 1XIIA 3WYZA 1GW1A 1TRIA 2WZIA 4K38A 1M53A 3IJLA 1I2RA 4PEKA 4PMOA 1NTHA 2D0FA 3DI1A 4CCZA 1MW0A 4DI9A 2J7DA 5I79A 4AXNA 3MMUA 4F0RA 3L21A 1E6NA 2VKZG 3NZPA 3R89A 1JVNA 2YZ5A 3KL3A 1QO2A 4N6EA 1TVNA 4FXFA 1V03A 4GBUA 1XC4A 1KFCA 1R8LA 3SN4A 1QPQA 2VRJA 4QLJA 1U30A 2Q09A 2ZX7A 1VRXA 3SI9A 5XIMA 2PP0A 5FJRA 5LXXA 2BY2A 1OD0A 4MFDA 2DPEA 2VR2A 4YTTA 5FF7A 3LK6A 3B9NA 1M03A 5E93A 3EPNA 3W74A 3LY0A 1A5AA 4QBXA 4MKNA 3RDKA 5EMMA 5AC5A 3QGVA 4H3DA 1N7KA 3K8KA 1BYAA 3F1QA 3UXAA 3FDGA 4IJCA 3ARUA 5HAOA 3WQGA 2W66A 2PDFA 1LG1A 3S2CA 4HNUA 1F61A 4JFTA 4XZMX 1HJSA 4LYQA 5AHEA 1EKOA 3FN9A 3DFYA 1F4HA 1W3IA 1YBQA 1G01A 1KW1A 4XKYA 1V6YA 1A5LC 1ZRQA 3WQ4A 1NWRA 2EJ1A 2XFFA 4RXFA 1W1VA 3LCFA 2EKGA 1PDZA 1REQB 2ZXQA 3BW4A 5FL1A 3TJLA 4EXAA 1DORA 3M64A 3VD5A 2EEXA 3PS7A 3KAOA 1MW1A 4QITA 1LL6A 2B31A 2CZVA 1K6AA 4GVGA 1VGAA 3E0WA 1EF2A 4MHBA 4P7NA 4LUIA 2PAJA 3CL8A 3AMKA 3L5MA 4R34A 1HJQA 4Y8FA 3PR2A 3VTRA 3LHTA 2WHJA 1OIMA 5XINA 3BWWA 1ZHAA 3GH5A 1ITQA 1CGYA 3HGOA 3UBPC 1X39A 4NZFA 5CPLA 3UXLA 1JCMP 3K4DA 1TZ7A 3BW3A 4J4KA 4QG8A 2D0HA 3R79A 3MHFA 2Y7DA 3AHXA 3CZGA 3NGJA 1UZ1A 3TTQA 4MDOA 4XZNX 2XTKA 4IMDA 5DO8A 1FCUA 2IKJA 3BG5A 1FBAA 3XINA 4MNJA 4DIAA 3B04A 3FNDA 1L8PA 4DYJA 1L6GA 5A1AA 3ZM8A 1EEXA 1UCWA 2BVYA 1T7LA 2CU0A 1JJKA 4PRRA 3C8FA 3K46A 3OBEA 4PBGA 1OFQA 1UD4A 4Y8EA 1C7TA 1S2VA 1TPB1 1UQZA 1GG0A 1TTPA 3VIKA 2J7BA 4D1JA 2QNEA 2YLLA 3DCPA 4H04A 2D24A 1W1B1 3VIPA 4DBUA 4L6HA 1LL7A 4RNHA 5HMFA 1BGGA 1YXYA 1Q2SA 5G4WA 4J1OA 4YIWA 3MYOA 3W85A 1WAWA 2DUAA 4M6UA 2XWEA 4H19A 3U3HA 1TTIA 3T40A 3RNDA 3I68A 5EYWA 3NEHA 2FLIA 1A5NC 1RK6A 4JIQA 4CNSA 5DMNA 1UMLA 3NYDA 5U7SA 2UY5A 4HD5A 3AXHA 4I8DA 4MDPA 3JU2A 1OD8A 1KFLA 1F5ZA 2A7PA 4L1GA 4WIWA 5EPDA 3NO3A 2WMHA 1Z89A 1K3UA 3P3BA 3RM4A 1UR4A 4HK5A 1V0NA 3YPIA 3T0BA 3LCHA 4S3KA 3UNTA 3R8RA 2UY4A 2HE8A 1YEYA 3WQFA 1MVYA 2CLLA 5C9XA 2OEKA 4HU8A 1NARA 3GFZA 1UH3A 2QAFA 2QCEA 3OPSA 2H3DA 4WJXA 2CFFA 4PMRA 3BCFA 4A6GA 1FWIC 4QJ3B 5AC8A 5LNSA 2WNWA 2JIEA 3CPGA 2J27A 1TVPA 3KL5A 4DO5A 1KCLA 1XL9A 2DVTA 2QF8A 1E0UA 1OZQA 5D9NA 1GG1A 1E71M 5D9PA 3B9AA 1V51A 1SQ7A 2YA0A 3AHVA 3BLFA 3NOEA 3CHEA 1WUFA 2GZXA 5D05A 3CT7A 3NOYA 2W61A 3W2LA 2OQLA 3ARPA 4W9TA 4KCUA 3STEA 4WKHA 2NX1A 1CBGA 2FZNA 1CGUA 3THQA 1ADDA 2OPJA 1E6RA 4RE2A 3ME3A 3NPVA 1VCGA 5BOOA 3OYZA 1V5XA 3W7LA 4IH3A 1I2QA 3M0XA 1YNYA 3NL6A 2PGWA 1JPIA 2O0TA 3FAWA 2DY3A 1WB0A 2WVVA 3CYVA 2GYIA 3M5XA 1AJ2A 2VELA 1QPRA 1Y5WA 3VGDA 3USBA 2V3EA 3QMSA 4ZQMA 1FHUA 3ECQA 2P76A 4LUTA 3ZLFA 4YCPA 1M68A 1W9DM 4E2VA 3W2KA 4JTAA 2X0YA 1GVOA 4FOKA 4C6LA 2QR6A 3S42A 2G3JA 8XIMA 3QHNA 1B1YA 1ZBVA 2W27A 3KTSA 3VNMA 2GVYA 3BOXA 4JTIA 2YR1A 4G6CA 3VD7A 3Q67A 3RITA 4IXHA 3LZ5A 2LLEA 2YXOA 3D46A 3O0KA 2ZZ6A 3VDGA 2GWGA 3L5AA 1AFSA 3EPOA 2QHAA 3QEZA 4ZMGA 4PMVA 3FY1A 3S1WA 4LC6A 5JUVA 3PTMA 4UTUA 1B90A 2HCVA 3HJEA 1IT7A 1TSIA 3KBNA 3UVIA 4J3WA 3RYSA 1R30A 2CLHA 4HCHA 2IQ0A 1TZ9A 2DVXA 3WLOA 1V02E 5CBIA 4G9PA 3E49A 2R1KA 5J04A 4N4QA 3AAMA 2NWSA 3CXOA 3GXTA 3LSCA 3TEVA 2Z0IA 3PTKA 5LIKX 1EJ7L 4RCXA 2PLMA 5JMUA 3WK3A 3V1HA 3NR0A 1OFPA 2Z2AA 2AL2B 3QZ6A 1A5SA 2CESA 1OFBA 3WQDA 4GNVA 2XINA 2YW3A 4ORMA 2BHYA 3GG0A 4K1WA 3F2CA 3ARWA 5IHRA 1XG3A 1AVAA 2DJLA 4NUWA 4OWGA 4G56A 2OGJA 1E4MM 3QR3A 2JGYA 5CJMA 4H6EA 5BROA 5E6YA 3P2VA 4E4UA 4RE3A 1BLIA 3JW7A 4Q8VA 1ZFJA 2G50A 4MZYA 4FI4A 4O17A 3W1NA 3MCMA 1KV5A 2HJPA 3SUSA 1TQXA