4IUOA

1.8 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) k170m mutant in complex with quinate
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
259
Chain Sequence
NLYFQSNAMKTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPMIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Crystal structures of type I dehydroquinate dehydratase in complex with quinate and shikimate suggest a novel mechanism of schiff base formation.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 97
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4iuoA00
4K39A 1ML1A 2VFHA 3FKKA 1I2NA 1NFBA 1Q45A 3NXFA 2J24A 5AHIA 2FPTA 5I3IA 3TC7A 3W1RA 3W2UA 4O14A 1H62A 5ABTA 3M5VA 2WQPA 5T26A 4LS2A 3JRKA 3T78A 3QZEA 4QIUA 1RD5A 1UBSA 1G4EA 5KINA 2V30A 3L68A 4DO4A 1FDZA 5K7JA 4QM1A 3MBFA 1G4PA 2I1OA 4DF2A 2FPVA 1VLIA 4QQ3A 1T96A 3LBMA 1EA0A 4JDBA 3HPZA 2NXIA 3OG3A 2JKPA 4WXZA 3P82A 4GWEA 2GJLA 1IF2A 1ICSA 4CNOA 3IIOA 3N2MA 4O11A 2ZZ4A 5AHMA 1JCLA 4JTUA 2KZHA 2J9ZA 4IOTA 2VEKA 1SW7A 4XTIA 2E6FA 1KBIA 4JTSA 3W7OA 3L21A 1W5MA 2BWGA 2YX0A 2AAMA 3HGRA 2A0NA 3WK2A 2FFCA 1SQ7A 1THFD 3UZJA 3UNDA 2B7NA 3GDMA 3JS3A 4JIQA 3CU2A 4LOCA 3ANYA 1UUMA 4LVAA 3L0KA 2Y7DA 2F84A 3R13A 1H63A 5L9FA 4AH7A 5C5YA 2CW6A 4EOUA 1SU5A 5BMXA 5IBXA 5TBOA 1K3UA 1WV2A 3MYPA 5I3KA 1OK4A 3GR7A 3RLUA 2A2IA 3CIXA 2H8XA 3B05A 1WAUA 1XXXA 2WOQA 5CG7A 4O4WA 1FXPA 1FXQA 3ABQA 1JQVA 4WY0B 4BI5A 2ZZ1A 2QCDA 1JVNA 2RKXA 5A5WA 5AHNA 3LDVA 4Y96A 2VFDA 4KWWA 5LNRA 4BR1A 5CKSA 3FKRA 2ZZ6A 1U5JA 3TR2A 4X22A 2CLKA 2Y7EA 1F2JA 1K8XA 3O05A 1BKSA 1JCMP 1TJRA 3HJZA 3B03A 1XUUA 5AB3A 3G3MA 4IJBA 2Y63A 5G4EA 1GVRA 2HSAA 1P4CA 5FEWA 2TPSA 2HS6A 3LCXA 2H3DA 3LV6A 5AFDA 4O54A 3N9RA 4RXGA 4LUIA 4KKXA 4BWLA 3PUDA 2ISSA 3C8FA 4AVFA 4CCDA 2FQIA 3L5AA 4YCOA 1VHCA 3QRHA 5TIMA 3W7QA 4OBTA 3BARA 4HPJA 1P0NA 5D32A 4ADSA 3EB2A 3W88A 4OV9A 1H7XA 1XBYA 4JTHA 3ABSA 1TPUA 2VXNA 2BSLA 1TV5A 4JTIA 2CU0A 3C2VA 3IEBA 3C2OA 4K36A 5KITA 1GQNA 4FIQA 1TRIA 1NF7A 4LVGA 3DZ1A 2ISWA 3M7WA 4ZZ9A 4FO4A 4NJIA 2QUUA 1JRBA 3W2LA 3NA8A 3GXPA 2A7NA 1YDVA 4O0KA 3S8HA 3LRMA 1IIGA 1K7XA 3UQNA 5K4ZA 3CT7A 3KHJA 1KM3A 2IQTA 3TAOA 2VOMA 4IXXA 1W8SA 2DORA 2Y7FA 4W9TA 5BOOA 2H90A 3RMJA 1NVMA 3W2MA 4JTTA 2TYSA 1G69A 2WSRA 1ZNNA 3SJ3A 2B0MA 3GDKA 2C19A 5K9CA 5CSSA 2GQ8A 4EVZA 1CW2A 2QUTA 2G5WA 1H7NA 4MY8A 4EIVA 1FQ0A 3WJWA 3P74A 2WPBA 1OFQA 3CC1A 2QJHA 4OWGA 2QR6A 4IMFA 3I68A 3U2OA 3CEPA 4N9CA 4UFJA 4WUIA 2A7RA 5CSRA 4O1BA 3W7GA 4A21A 3FIGA 3P60A 4LUJA 2X2GA 1FWWA 4RZ4A 1FDYA 3BV4A 2I14A 4HIBA 3P62A 3DFQA 3P8IA 4L4LA 1X7FA 3BLEA 1I8JA 1XM3A 1QWGA 1B57A 2R14A 2GOUA 4LW7A 3W7MA 4MZYA 4QNEA 1L2UA 1TPC1 5CPMA 2P0OA 3IVSA 5H91A 1XKYA 3UD6A 4CCCA 1SO3A 1GOXA 1LOQA 2FB2A 2ZZ5A 1SO4A 2CLFA 2QDGA 4JN6A 5D2WA 3R89A 1PHQA 3LGEA 3B0PA 2PRMA 2C1HA 5HWMA 4DBEA 4ZQOA 4DO6A 1A5CA 1S3HA 2CZEA 3LTPA 2E68A 5TQLA 2EPHA 2Z0IA 4AHOA 3C2EA 1X1ZA 1EEPA 5U4NA 1A50A 1Z48A 4FNTA 3KOFA 5LNWA 1A5BA 3FJ6A 5AC7A 3BLIA 3S1UA 4IPJA 4E2DA 3DKLA 3HGJA 1SFLA 5FF3A 3BO9A 3T55A 1B9BA 3M43A 3I6RA 2WV8A 3M44A 4MLJA 5GVJA 2YW4A 3EXSA 2GUUA 2R94A 1LBLA 5C2XA 3S9YA 1H7WA 3W7NA 4BI7A 3EX4A 4XZ9A 4IMDA 3CPRA 5KMYA 1EB3A 3NR0A 1AL8A 1F6PA 3W70A 2P1FA 1OHLA 2DP3A 4JYDA 1DL3A 2NLIA 1XBXA 2RDTA 3M5YA 2QUVA 1J5TA 3DBPA 1EP2A 3S5OA 3NPUA 3LERA 1W3TA 3UY8A 1Y0EA 1GG1A 4HHPA 4KFOA 4WJEA 1WXJA 2QEZA 3LI1A 4LS0A 4MJZA 3DFSA 5DY2A 3TMLA 5DCEA 4OT7A 5AOUA 3EKZA 1ZAJA 3MI6A 3W2JA 1VYSX 2RDUA 1ZY9A 3NPVA 4Z1AA 5F2GA 1M7OA 5DELA 3G0XA 3UWYA 1OX5A 4AWSA 1YDOA 4O53A 1KFKA 5H2ZA 1M7PA 3B0VC 3GYEA 4RXFA 3QJAA 2EAWA 4WX2A 4DBDA 1R46A 2JK2A 3QH2A 4JTLA 5E0KA 2WSYA 4UTWC 2YZRA 2NX1A 1LM1A 3TSDA 1A5SA 3TC6A 3IRDA 1RQHA 4Z1BA 5EA9A 2Z2UA 2NXHA 2LLEA 4A29A 3TFCA 3EXRA 1FWTA 2QCDB 2ZA2A 4O1DA 1QOQA 4A22A 1O5XA 5EMUA 3S0CA 4K38A 4FNPA 4CQ8A 3OVRA 4RK8A 4CLMA 1KFEA 3NQ6A 4TU1A 3P81A 3C2FA 1FCUA 3ATYA 1XDLA 1WYIA 2V81A 1KM5A 3O06A 2W6RA 1SW0A 5D03A 5G2HA 4X9SA 4O1AA 2CZDA 5D04C 5HR6A 1LZOA 1ME8A 3DXIA 1FX6A 3TAKA 3STGA 2QF7A 3M0ZA 3NPWA 1H1ZA 4Y90A 3DHDA 2ZYFA 3UWUA 1MEHA 3PWAA 1ZHAA 1O94A 1HO1A 1ZAHA 2VC6A 3L65A 3GZ3A 2ZTKA 3WJZA 3LXCA 1GVSA 2VENA 3BW4A 5G1TA 3NOEA 1G6CA 4PL1A 3WK0A 4O28A 1KM0A 3KVMA 2Y89A 1IXQA 3QW3A 1P1XA 3KAOA 5SWUA 3VKJA 3ZWSA 1RZMA 1Q6OA 3C3NA 3DKJA 4N02A 3I7QA 1QAPA 1O5KA 3U8GA 1SZEA 1YPFA 2ZZ2A 1R2RA 5D2YA 1W0MA 2E5DA 4QSHA 1TV8A 1U83A 1H7RA 3M5XA 1H7PA 2DZXA 1YDNA 4HNUA 2A21A 4Z0SA 5LHEA 3EWZA 5FESA 1H50A 2EKCA 1QOPA 3NNTA 4X3ZA 4AF0A 3G3DA 4NU7A 3PG8A 3GAYA 4JS3A 3SW6A 3ATZA 3WK1A 4UTJA 3FLUA 1FCVA 3H53A 4PH6A 1VS1A 3G0UA 3Q94A 1C29A 1YTEA 1MXSA 2AGKA 5U7SA 4LVFA 1NAL1 1WOAA 3PUOA 3W7KA 1KTBA 1K8ZA 3A9IA 3RNDA 2C3ZA 3CHVA 4WOQA 1OG0A 3VI2A 2CLLA 4JYEA 2UV8G 3SGUA 4MPQA 3KFTA 1Z41A 3T40A 4AWTA 5D30A 5I3HA 4C1LA 4ZQRA 1JQXA 2QAPA 1WBHA 5K4XA 4KFPA 1YTKA 3BG3A 3MWAA 4K7VA 4LVDA 1XUZA 3PG9A 1ME9A 4O57A 3CB8A 2ZFAA 1QFEA 2G95A 3LCWA 4E38A 2YDAA 2CLIA 2NZLA 3NZRA 3NL2A 1LROA 3DHFA 3E02A 3VCRA 1QNVA 5F1VA 4BF9A 1EPXA 1OF8A 4O50A 4Z0JA 3W73A 3NPXA 4PC8A 3MI3A 2E6DA 3NQEA 4PCFA 3UY7A 3LB0A 2DZSA 3UWWA 1KBJA 2Q8ZA 3CQ0A 1VCGA 4RJEA 5CZJA 2DZTA 4JTFA 5A8GA 4MYXA 3W7PA 1X6UA 3P5YA 2Q3RA 1Z44A 1OYAA 1ALDA 2ZQ0A 1H5YA 4HKPA 2B7OA 1VYRA 4FB7A 1ZJIA 4B5NA 3C61A 3KRZA 3F4NA 3NQ7A 2YSWA 2DZPA 4Z1DA 1H1YA 1C8VA 4Y6GA 3HG4A 4WQ6A 3NM1A 3ABOA 3W1UA 3V1PA 2V2DA 3W7EA 5CPLA 4AEOA 3Q2DA 3JR2A 1OFPA 2NXGA 4M7SA 2Y7GA 3LTSA 2ABAA 2C13A 4YL2A 1LP6A 3HG3A 1TTJA 4MOZA 3KRUA 4UFMA 3TA6A 4QNWA 4MFDA 2XN2A 3O6YX 3W1AA 1XFBA 4O17A 4P2VA 2XN1A 5HULA 4AHPA 4PODA 2EF9A 1OYCA 3TDFA 2ZRUA 2E1DA 1K02A 2D73A 3HPXA 5J5RA 2V82A 3WJXA 3BGGA 2QJIA 4NJGA 4JXCA 3LRKA 1O60A 4UUIA 2XFWA 1OF6A 2CLOA 3LX9A 3GAKA 4MVAA 3L5LA 3NQ2A 2ZA3A 4UFIA 3HPSA 2E77A 2VFEA 4NUWA 4JNMA 4J9JA 2QCGA 1YXDA 3GVGA 1FWSA 1IIHA 4UMBA 3W9ZA 1Z42A 2OT1A 4FNQA 1F6KA 4S2BA 5LHFA 3W1LA 4XUGA 1LOSA 2C14A 4O19A 4GUHA 5F4SA 1RQEA 1S5TA 5J5DA 3L5MA 1TPWA 5BW6A 3UWZA 1JUBA 1YYAA 3F4WA 3ZFHA 1OFBA 3P7YA 1QPRA 4O52A 3L0GA 3DGRA 2ZDRA 1KM2A 4MY1A 2PRLA 3W7CA 2BTMA 4HNNA 3TQ0A 3W7HA 2BLEA 5EY5A 2QCHA 1K7EA 3OHIA 3S5YA 1H61A 3O8AA 2YGYA 4XKYA 3TE9A 2BX7A 1F73A 4JDYA 3GDTA 4WZHA 3W7JA 4A3UA 3O07A 2NUYA 3IIPA 5DCBA 2X1UA 4A2SA 1SSDA 3GXNA 4WOZA 3OVQA 2V5LA 1JCXA 4LV4A 3MO7A 2OJPA 3UPBA 1EX5A 3EX3A 4ORMA 3U6WA 4XBSA 1H51A 4UCGA 3RLVA 2VFFA 5EPDA 3UXAA 3TW6A 3GB6A 3EXTA 1A53A 2NV2A 1QO2A 3B0UX 4ALDA 1TSIA 2BZNA 3MHGA 1PL9A 3PB2A 1I2PA 2NWSA 5HUOA 1WX0A 2GQAA 1R2TA 3SI9A 4AAJA 2VELA 5DBUA 2CZFA 1N7KA 3W84A 3W3OA 5K9XA 3SZ8A 2WO5A 3DENA 4RCXA 5AYYA 4K7YA 4IXHA 1KFJA 1W31A 4JTGA 2ZRXA 3PY2A 3LCHA 1ZENA 5G2WA 1F5ZA 3D0CA 3W75A 3C2RA 4JR5A 3Q37A 3MP4A 4ZQNA 3EWWA 1ICPA 2C16A 4JIPA 3TFXA 3SFKA 1TTQA 3STCA 3HGOA 1D3GA 3LBCA 2EHHA 4NJHA 3S5NA 4GJ1A 2GJNA 4GNJA 1ONRA 4O12A 4FEZA 3VE7A 3UWVA 3Q58A 3DI1A 4M6PA 1R2SA 3W7DA 4UNLA 3TJXA 3HIJA 4UNKA 2TRSA 1G4SA 3G1VA 4PTNA 3TKFA 4NZJA 1AL7A 4JTKA 3TQVA 1VZWA 1MO0A 4LC8A 2F7FA 1FCQA 5D33A 2GQ9A 3TROA 3BG5A 5IBXC 4GRSA 1DQXA 1TO3A 4R33A 3W1PA 1KLYA 2W79A 1VLWA 3BLFA 4JYFA 2JGQA 3E12A 4IMGA 2CFFA 3HF3A 4AXKA 1SUXA 3NVTA 1CI1A 1OVDA 1LRQA 3HQ1A 5LNUA 1UJPA 3RF9A 5LGXA 1AK5A 2A5HA 1NSJA 3PSVA 2ALDA 2DZWA 3GXTA 1FY6A 3UYCA 1G4TA 5D02A 3TSMA 3LV5A 1LOLA 2WNZA 1QMLA 3O16A 2FDSA 3FOKA 3PR2A 1KA9F 2HS8A 3MW7A 2W0UA 3A5FA 1JJKA 2RDWA 4Q33A 3NGJA 4GFSA 5F2LA 2Q8LA 2Z6JA 3TH6A 2PURA 3IIXA 1HG3A 1OX4A 2JGYA 3E96A 4BWLC 1PCKA 1SPQA 2CLHA 3G1AA 3TNOA 3UPWA 1VCVA 1RQBA 2J9YA 4R53A 3W7LA 1PIIA 1MSSA 3EX6A 5CZ0A 3W72A 4AHQA 3MYOA 4UR7A 3MMTA 1VPXA 1L6YA 4X2RA 4MY9A 3S1VA 2V2HA 3AO0A 2Y88A 4JX5A 3HOJA 3MBDA 3IIZA 2OX1A 5C54A 3LHZA 3BK0A 4EF8A 3LI0A 3M1ZA 3SECA 1DOSA 3B04A 5FF2A 3QMTA 2ZRWA 3E49A 1T99A 2PCQA 1AW5A 3NQVA 1SZNA 4JTJA 3G24A 3W6YA 1IXNA 3QFEA 4O0ZA 3LLDA 4K37A 1SO5A 1I4NA 5D37A 4MUZA 4XTDA 2C18A 4GUJA 3PBVA 1TREA 4JY9A 3B4UA 2XN0A 1DORA 4NZFA 5K2ZA 2Q3OA 2Y85A 4K6AA 4FNSA 4OHQA 1KFBA 3P8JA 5AC8A 5FI8A 3C52A 1G7VA 1YXCA 4OU1A 4OQVA 2E5CA 3NQMA 3KVJA 6ALDA 2A6LA 3A21A 4UIOA 3NM3A 4E0CA 2V5BA 1UASA 3USBA 4LRTA 4DPQA 4G1KA 2YYUA 3I7RA 4UTMA 1KFLA 4LS1A 1EP3A 1LLWA 3NQFA 3TUUA 1DBTA 5L6UA 1YADA 1ZALA 1S5VA 3EKLA 3G1HA 2X1TA 4E2BA 4LRSA 1K03A 5LZLA 2A1YA 2QDHA 1BWKA 5F1UA 2HTMA 3KVKA 3NL5A 4N6FA 1XI3A 3SIZA 2ATMA 3W22A 3QQ1A 1P5BA 4XKYB 3DU0A 3NZ1A 3CEUA 2DZUA 4PL2A 4DELA 1R30A 3E0IA 2ZA1A 5DLCA 1L9WA 1GZGA 2TSYA 1R47A 3BVJA 2E09A 3DFPA 3KX6A 3MP5A 4IX2A 1H7OA 1Q6RA 4U4MA 5D38A 1JCNA 2YPIA 4NT0A 3NQAA 1SSGA 3TJLA 2FTPA 4LVBA 4LC6A 3PBYA 1JR1A 3PM6A 2R91A 5FF4A 5AHEA 4WY0F 3EWYA 4DEFA 3S1WA 2ZRVA 3HG2A 3TK7A 1RR2A 1KTNA 3OIXA 3SY5A 3NAVA 1GVQA 2DJLA 1ME7A 3B06A 5DY3A 3FS2A 3W1QA 1FCBA 3RU6A 1XDMA 1HUVA 4O18A 3N34A 3UWQA 5HMSA 5LSMA 3HB9A 4ICNA 8TIMA 2DJXA 3R2GA 2NX3A 1DQWA 2A6NA 5HNRA 5KSWA 4O13A 1OX6A 1QDSA 3F03K 4YLWA 2B7QA 2QCEA 1JUEA 2Y6ZA 3ABRA 4HN4A 4M6QA 4NJJA 4UTTC 1ADOA 3INPA 3LRLA 1HL2A 1QO5A 4CCEA 3GNDA 2QCFA 4UMAA 3OEXA 5FEXA 3W23A 1LRNA 1NEYA 5I3FA 2J88A 3M41A 1OK6A 2ZTJA 4WD0A 3CWNA 3N19B 3MP3A 1E51A 2TMDA 3LHTA 3PS7A 1TQXA 4N9BA 3NYZA 3GK0A 3HGSA 3P61A 4A2RA 5D2VA 2WNNA 1TPEA 2C15A 4N9DA 4QITA 1PS9A 2NUWA 2QKFA 4UTKA 4RR4A 3W86A 4S2CA 2QAFA 1T0OA 2X16A 4ZQPA 3G1FA 4FHAA 5LNVA 3VE9A 4K8EA 4PEKA 1XBVA 4H3DA 4MIMA 1UCWA 3TXVA 3VNDA 5CPOA 2Z6IA 3LCFA 3OBKA 1W3NA 4UFKA 3ZWTA 3PB0A 3G1SA 3M47A 3C6CA 1W56A 1S5WA 3W1TA 1KV8A 5FEPA 1N55A 3WJYA 2VFGA 1LTDA 3IVTA 3MHFA 1X8FA 1ZCOA 4ADUA 2HMCA 1VRDA 3GNNA 3P80A 3IGSA 2A4AA 3NG3A 1GEQA 2E6YA 5LGZA 1TRDA 4ML9A 5EYWA 4D2JA 5CZSA 3GDRA 1LYXA 1GT8A 5F2IA 3QYQA 1FDJA 3M16A 4FNUA 4GE8A 4FNRA 2X1SA 2QCMA 4PA8A 4KFNA 4QAIA 4LY8A 4ZL1A 1X1OA 4LV9A 1F76A 3CIWA 4IPIA 1W5OA 2V9DA 4N4PA 2YR1A 2FIQA 4UTUA 5HWNA 5D2XA 2CZ5A 1OFRA 1XL9A 3G8RA 3QSTA 3LCIA 1VQTA 4YWIA 2B7PA 1OX4B 3CM4A 4DF1A 2Y62A 3O6DA 4UMCA 1IXPA 3TU9A 2ZRYA 4BK9A 5FF0A 3RFAA 4OE7A 1LBFA 1ZFJA 4UTHA 4OGZA 2GVLA 3NQGA 1QPOA 4H6KA 4GUGA 1PE1A 5D09A 3LHWA 1VH7A 3HG5A 4RZ6A 3TIMA 1G7UA 5E1QA 1HFBA 1KLZA 4I7VA 2OCZA 2E6AA 1YPIA 3LHUA 3R5EA 4N4QA 3TV8A 3O1NA 3W7IA 2ZZ3A 3C4UA 2VKZG 5MHBA 1H60A 3EEGA 5EKYA 1QCWA 4NNBA 3QC3A 3GKFA 1W5QA 4O1CA 4UTLA 4RKAA 1TIMA 1I2QA 3GR8A 3L2IA 1SW3A 1LCOA 1W37A 2WKJA 2V2CA 4NVTA 4O15A 4TMCA 3DFTA 1CX9A 2VFIA 4IUOA 4JX4A 4S1FA 2V0TA 5HWJA 2YW3A 2Z1BA 2B4GA 4YMZA 4C1KA 2FJKA 3TXZA 4R7JA 1QPNA 3PULA 3ELFA 1ICQA 3M6YA 1K7FA 5LKYA 3KXQA 3BGJA 3N73A 4CNNA 4RV8A 4HSNA 3YPIA 1KV5A 4PFMA 5CZTA 3PAJA 3GDLA 1Q6QA 4MLRA 3LXBA 3FFSA 1I45A 4ZQCA 3WK3A 1OYBA 1VGAA 1EIXA 4BFAA 3IIVA 1LDCA 4QJ1A 3W07A 1DJQA 4GUFA 3M5ZA 4NXSA 2YFOA 3NEVA 4TIMA 1DVJA 4LT9A 4MFEA 1LRTA 1W5NA 5D2TA 1RPXA 3BW3A 1PV8A 2H3BA 2FLIA 3EWUA 5HJLA 4FX7A 5C6MA 3G8EA 3THAA 3V75A 1GYLA 1TPFA 3LHVA 2YCEA 5KZEA 5KZMA 3M9YA 3N3MA 3L9CA 3OA3A 5I3GA 4LU0A 4MKNA 3T4CA 4ZMGA 4ONVA 4IQLA 1JULA 4O10A 1KM4A 1LORA 2A7PA 3WFAA 3TQKA 2PRHA 1G67A 4O8RA 4TR9A 5AC6A 3W2NA 1TPB1 4RLIA 3NQDA 5F4WA 1F05A 1M6JA 1OFDA 3W87A 2A85A 1OJXA 5FF7A 3K30A 3FYPA 3UXDA 1C9DA 1QPQA 1DV7A 1JUKA 4N9EA 4ORIA 2GVGA 4GC4A 3L67A 1JRCA 4XBKA 4Z08A 4NX5A 1XBZA 3IV3A 1IGSA 5DN1A 3MI2A 3QMSA 3W7RA 1M5WA 1UB3A 3TCEA 4CNPA 5G4WA 3DFNA 4N2YA 2C0AA 3G22A 3O15A 4TMBA 2JKAA 4NNAA 4XQ6A 3PBUA 4IMEA 1TTPA 1XCFA 3TMQA 1AW2A 4UXDA 3W83A 4YCPA 2YYTA 5E93A 2FB3A 3LXAA 3IGUA 3CTLA 1GVOA 4UTWA 3R8RA 1SZGA 5K3VA 3LCGA 4AF0B 3MJYA 1EWEA 2BXVA 3C56A 1FWRA 3F1QA 5AYXA 3W1MA 2GPTA 1KW1A 1WOBA 2VEMA 3B8DA 3W85A 5DCDA 4TO8A 2OT0A 5HR7A 3LOTA 4I9AA 3N14A 5AN7A 4OV4A 3H54A 3W76A 4NXKA 4Z1CA 4AWUA 4NQ1A 3QPZA 1GVFA 2J9XA 2Y61A 3T44A 4AB4A 1W5PA 1EWDA 4NNCA 3DH7A 3QMRA 1KTCA 1KM6A 2NWRA 1TV7A 3G18A 4M19A 3KRSA 3DFOA 3LCLA 3GLCA 4HPXA 3UZ5A 1AG1O 1BTMA 3R12A 2R8WA 1B3OA 5F2MA 3P67A 1TMHA 4U28A 4JEQA 3TSBA 2VEIA 1V7YA 3DI0A 3OVPA 3HBLA 4FIRA 2H6RA 3I7SA 1SZFA 4HNTA 4I7UA 4I7WA 1EUAA 3LM7A 4DO5A 4TX9A 1AW1A 4JD4A 1RVGA 2WJZA 5KTLA 3G1DA 1BEUA 4XWUA 3LTYA 2ZRZA 2RHGA 4IGHA 4N6EA 2FPYA 5DBTA 3RK8A 3A22A 2PC4A 3BPWA 2J6XA 2RFGA 3W74A 3C0JA 4IWWA 3S6DA 3QEZA 3FJLA 3PC0A 3NDOA 4M5PA 1DJNA 2ZBTA 4JX6A 4GUIA 3QW4B 2ATSA 3G1XA 3QSRA 3IGXA 1HO4A 3O63A 4BI6A 3SR7A 3BW2A 4LWWA 1TB3A 1BWLA 3A23A 4JGDA 3PVFA 3HMJG 1B4KA 3THQA 4Q4KA 4DXVA 4MYAA 4WXYA 2DZVA 2JKEA 2QJGA 4O4VA 1GWJA 3MHUA 2ABBA 3EWBX 4IMCA 1OABA 1KFCA 3QQ0A 7TIMA 1P0KA 2PE4A 3PUEA 3W2KA 4UTTA 4UFLA 5I3JA 1WDWA 1PCWA 2CLMA 3N9SA 1TPDA 3T7VA 1WA3A 1SR9A 1TQJA 4Q32A 2NX9A 4WY0A 1J2WA 5F4XA 2QCCA 1VR6A 3SSJA 4HNVA 5KZDA 2DU2A 3NL3A 1O95A 5AHFA 2OMAA 4AMAA 1TYGA 4H4IA 1TPH1 2V8ZA 1GTEA 1MZHA 5CGQA 3TX9A 1VJIA 3SGZA 2YXGA 4DF0A 1LLZA 1SFJA 3P84A 1W1ZA 3S5ZA 1FUYA 4ZQMA 1YXYA 1N8FA 3QM3A 1V5XA 5LNSA 4O16A 4UFHA 6TIMA 4FX6M 4RZ5A 4UC5A 5G1YA 3I65A 3G1YA 1XC4A 3KVLA 3VFLA 2AQWA 4FF7A 4P61A 1IXOA 1I2OA 2ZZ7A 1VCFA 4CQAA 3NL6A 4HT3A 1YLVA 4Y8FA 4JY8A 2CLEA 3H55A 1UUOA 3NO5A 3N2XA 1EUNA 2ZCGA 4QISA 4NX0A 1YTDA 3QF0A 5EL1A 3ZS4A 2O7QA 3W71A 1GTHA 3FA5A 1GPWA 4JICA 2G96A 2EGZA 3S42A 3A5VA 4EWND 3PBWA 2E5BA 1NF0A 5BNKA 2X1RA 1Q6LA 3G0SA 3PSWA 2ISVA 5FEZA 3PF3A 4IX0A 3A24A 5C55A 2QCLA 2NV1A 5CPNA 3L66A 4LNYA 3STEA 1D9EA 3GIYA 1PHWA 1WBJA 1JCYA 1QR7A 2Y70A 3EX2A 3S1XA 3IVUA 1D3HA 2J27A 5DXYA 1I2RA 5G5IA 1FBAA 4ZVJA 2G97A 3ZR4A 4LTSA 2RH9A 3CLMA 4K8HA 4Y9AA 4CQ9A 1K8YA 1W3IA 1B4EA 1AMKA 5AHLA 4GXMA 4DPPA 3FEMA 5HUPA 1ZAIA 1A5AA 4ADTA 4FX8A 5HQEA 1WQ5A 2C6QA 4L4MA 1GJPA 1TCDA 2X30A 2I9EA 5AYZA 1KM1A 3NQ8A 4KWVA 2WSQA 3CWOX 3P5ZA 1JCJA 4MZ1A 2JBMA 1L6WA 4RX0A 1DKWA 3TW7A 2NUXA 4M7TA 4FXRA 2VEPA 1OFAA 3GX9A 2GVJA 2H8ZA 3QPYA 1Q3NA 3WJSA 2OZ0A 1HTIA 1MEIA 3EX1A 4UR8A 1FWNA 2WNQA 3GKAA 5BRBA 5BMWA 4JTEA 1VHNA 3AJXA 5EBUA 5HINA 4POCA 4EF9A 4DQWA 1F74A 1J4EA 1TPVA 4MJMA 1TTIA 5G2IA 3EWXA 1DHPA 1O4UA 2YFNA 3W1XA 1T8XA 3NQCA 3O6CA 3DAQA 4HSOA 3HO8A 1RV8A 4NJKA 1MEWA 1OFEA 4GBUA 4YXGA 1LBMA 3STFA 2O7SA 1GYNA 4FXSA 5K9DA 3FYOA 1PVNA 1VYPX 4MZ8A 5DXXA 1EP1A 3BG9A 4R34A 4UTIA 3E9AA 3L0NA 1F7BA 3MUXA 1VC4A 2P10A 5D05A 1TJPA 2CWNA 3W1NA 5IM51 3LHYA 1L6SA 1SO6A 2QCNA 1W54A 1GG0A 4M6VA 1OFOA 3LLFA
chains in the Genus database with same CATH superfamily
4WSKA 4GYFA 4ZB5A 1NFBA 1EX1A 5LA1A 4Q8WA 1I0DA 2J24A 3TC7A 4MB4A 4F0MA 4GH1A 4LBUA 4O14A 1UQYA 4A3QA 4D6CA 4Y9PA 4QIUA 4FZIA 3FDKA 5JBDA 5GNXA 4LB4A 1FDZA 2G3FA 4Q4SA 4QQ3A 1EA0A 2VCAA 1E4NA 2JKPA 4GWEA 3RM8A 3U7VA 1VENA 1DXIA 3IIOA 4CN6A 3GNXA 3C86A 3OLEA 3ZJ7A 3S2CA 1PZ3A 1Y5XA 1JCLA 3WQOA 4JTUA 3UJSA 3DYMA 1TA3A 2E6FA 3W7OA 1W5MA 3NDYA 5DMYA 3E0LA 1FH9A 2FFCA 3VXGA 5A8MA 3BC9A 2VP8A 3GDMA 3OQEA 4U3CA 2DV0A 5G1MA 1OG6A 4JIQA 4LOCA 1E15A 3N6JA 4X2PA 3L0KA 5L9FA 1V3LA 4AH7A 5C5YA 4BQ3A 5IBXA 3WO8A 3GR7A 3B05A 2H8XA 1FWJC 1WAUA 3CIXA 5CG7A 5HPOA 4GXWA 5HAOA 1FXQA 3CQJA 4WY0B 1JQVA 3SCWA 3U3HA 1JVNA 4J27A 5A5WA 5AHNA 2GGIA 1TE1A 1U5JA 1JCTA 2VRQA 2Y7EA 3O05A 3HJZA 4TTGA 1XUUA 4KRTA 3XISA 5BWAA 2V3FA 1H1NA 1P4CA 2IPWA 3PZNA 2YXXA 5FEWA 3ZR5A 2HS6A 3LCXA 2H3DA 5AFDA 2NQJA 3HQPA 4RXGA 3R43A 1E1CB 1GUVA 4GIYA 1RBOB 2PI6A 3ENLA 1I6NA 2EPMX 1U5HA 1D2KA 2FQIA 2XTKA 4FXJA 3V0TA 1CZ1A 3CTTA 3AIEA 2PDWA 2ZUMA 3NWRA 3JW7A 3A9BA 4AD4A 3ABSA 2X0YA 2VXNA 2BSLA 3GHTA 7ENLA 2UY4A 4JTIA 1ZJBA 5FD0A 4FIQA 2NQLA 1NF7A 4LVGA 2ISWA 3M7WA 1EDTA 1JRBA 2VX4A 2A7NA 3GXPA 4GQRA 1YDVA 2XUCA 1BYDA 3QOKA 2J78A 1MRAA 5FKYA 3UQNA 4I9JA 3ARUA 2DORA 2Y7FA 4JNZA 4PMYA 2NVAA 1RXOB 3OTRA 2ICSA 3RMJA 1CDGA 5E5CA 1A0EA 1QBAA 1OC5A 1JDDA 3PPGA 3WBYA 2GQ8A 1OC6A 2G5WA 3WDIA 5JU6A 5M2FX 2PD9A 5CC3A 3SRKA 3TR9A 7XIMA 3WF0A 3I68A 4UFJA 3P6LA 3WZ0E 4HOWA 1DWAM 3P60A 4WR3A 4HIBA 2PP1A 3P8IA 3R79A 1B0IA 4N42A 4W84A 3CV6A 1L6FA 4D1JA 2Z26A 3LD5A 5A95A 2AL1A 1TPC1 3ARQA 1BFNA 3WQWA 4CCCA 1LUCB 4C6CA 4Y9NA 2ZZ5A 1SO4A 2CLFA 1Q6FA 3G77A 3GTXA 2XIBA 3EB4A 3LGEA 3B0PA 4ZB2A 4RPQA 2PRMA 2WKLA 4DO6A 1A5CA 1S3HA 5TQLA 3LQGA 4PUWA 1X1ZA 5U4NA 4YYCA 2PLCA 4RDWA 2YB1A 3HQOA 3KOFA 3K8KA 4A6GA 1AZ2A 3VCNA 4HJWA 4Q7BA 1WPCA 1PX3A 1RH9A 3REQB 2YW4A 3U5YA 2J25A 1UPMB 2A3BA 1CIUA 5CCZA 1Q66A 5I06A 4EPBC 1FWIC 1UD3A 4P7RA 1H7WA 4BI7A 2DIJA 4PZVA 1NFPA 1GZ1A 3FGCA 3CPRA 1O12A 1OHLA 2DP3A 1WE5A 1DL3A 1RVKA 3RO8A 4C7DA 1C90A 2RDTA 5MKGB 1RP8A 2QUVA 3S5OA 3NPUA 1RCOB 3WQEA 3GFXA 4BQ2A 1Y0EA 2I57A 3WMSA 2O9OA 5FJJA 1XYCA 4BCEA 3S47A 4S23A 3WH9A 3LI1A 2HRWA 3DFSA 3QHMA 5DY2A 3FHAA 1JG9A 4BF5A 1A4LA 3RHGA 4EK7A 3C0LA 1ZAJA 3BSGA 3MI6A 2RDUA 7A3HA 3NPVA 5EU9A 4AY7A 3CBWA 3ABXA 2ZIDA 1OX5A 3GVRA 2QULA 2VZSA 1M7PA 3R0KA 1F8IA 4RXFA 3QJAA 4WX2A 6REQA 4MG4A 1R46A 3QH2A 1D7KA 4JTLA 3AS1A 5E0KA 5GJNA 2YZRA 3W0KA 3VMOA 3T05A 1OZMA 4YTTA 3GY1A 2CKRA 4PMUA 2NXHA 2LLEA 4S3DA 4A29A 3TFCA 3GW3A 4LALA 4DVOA 4HU3A 1FWTA 3LNMA 4O1DA 5EMKA 5EMUA 4FNPA 4CQ8A 2XFRA 4RK8A 4MNLA 3NQ6A 1DIEA 4AZGA 4CLMA 1FCUA 4XZNX 1GKPA 3HFTA 1WYIA 4U10A 2W6RA 1SW0A 5G2HA 3EPMA 1ISWA 2PTZA 5HR6A 1LZOA 3S2MA 1M03A 1LT8A 3NPWA 3MY9A 1H1ZA 5CC7A 5AYIA 4V27A 1O94A 4IL0A 3TLLA 1ESWA 2ZTKA 1EC8A 1GVSA 3MUIA 1QNQA 1GNXA 1CTNA 1IXQA 1BHGA 3ITXA 5CPSA 4FLSA 2WCSA 5BZAA 3VKJA 3C3NA 1QAPA 3GDBA 1RY0A 5DQPA 3U0HA 1SZEA 3GXDA 1YPFA 4FALA 3VA8A 3CXOA 1R9XA 2A3LA 2E5DA 1RCQA 1H7RA 3VIGA 3M5XA 4LPCA 3DC0A 1VP5A 2OOFA 1R3SA 4NZ1A 2A21A 3ZLGA 4HNUA 3SUTA 1KRBC 1DJIA 4AMCA 4GQ0A 2DIEA 4AF0A 1SR0A 3AYRA 2E4TA 4B5VA 3N18A 3FLUA 1IWAA 3UG5A 2TODA 1NAL1 4DJDD 1HP4A 3T8LA 4IG2B 3A4JA 4ZXOA 3OLGA 1K8ZA 3PTKA 3A9IA 3RNDA 2BXYA 4H8HA 4WOQA 1OG0A 1LQ0A 1NWUA 2B31A 3WLIA 3WNNA 4KRUA 3NZQA 3AIRA 3KFTA 3N25A 4D6JA 4H19A 2QAPA 1WBHA 3W27A 1KRMA 4LVDA 4B15A 5E09A 4O57A 2ZFAA 4E38A 2YDAA 1BD0A 4ZTXA 3URQA 4NRSA 1LROA 5BU6A 3DHFA 4GD0A 3VPLA 5F1VA 4BF9A 2YKKA 1EF3A 5I23A 1EPXA 3QYSA 1DXEA 4B2DA 3A13A 1CENA 4Z0JA 3W73A 2WMJA 1WO2A 4PC8A 3L4WA 1QI3A 1Z7AA 3O0FA 3H8AA 4PCFA 1HZYA 1UR1A 1FRBA 1W9UA 1VCGA 5CZJA 2DZTA 5A8GA 3P5YA 2ASHA 2VC9A 2YCLA 1Z44A 2ZQ0A 3FXYA 4FB7A 1ZJIA 1TJ0A 3LYEA 4H2CA 3KRZA 3F4NA 4JTCA 2OLSA 2FVMA 4MWAD 4H8UA 3BLOA 2OSYA 4XZHA 3VU2A 1E40A 3M7SA 3EOUA 5CPLA 4F0HA 4HU4A 3Q2DA 4MAVA 5E6YA 2Y7GA 1V08A 4Z2IA 2R6OA 2OPJA 2RJHA 3BJSA 4MOZA 2AKZA 4QNWA 2XN2A 3O6YX 4P2VA 2P0IA 1IZJA 1UR3M 1OYCA 3GNRA 3TDFA 3VD5A 1K02A 3CNYA 4LUYA 2IMRA 2WMGA 3SIMA 4JQ2A 1M68A 3LRKA 3A3HA 4MVAA 3L5LA 4UFIA 1EBGA 3ERPA 4J35A 4NUWA 2OXNA 3SCPA 2C71A 4JNYA 2QCGA 4Q8UA 3KS5A 2HDJA 5A8NA 2YXOA 3SCRA 3WG6A 4F79A 5TD4A 4FP1A 4FNQA 5LHFA 4S2BA 3W1LA 2XIMA 4XUGA 3F2BA 3SN0A 1HNYA 4XZWA 1KCXA 3QTPA 4YTQA 3AS0A 3UWZA 1TIWA 4YPJA 4O52A 1QPRA 5D9MA 5M5DA 1JYWA 4MY1A 1J12A 3QGAC 4ZR8A 3CUJA 2O92A 3EA2A 3TQ0A 1S3TC 4XKYA 3TE9A 3W82A 3VMPA 4JDYA 3GDTA 4WZHA 3O07A 3IIPA 2QJNA 2VR5A 4A2SA 3ISIX 2V5LA 1PPIA 2WMHA 2YA0A 3MO7A 1W1VA 2PTXA 5RUBA 3EX3A 4IJRA 4PMNA 3RPMA 2DUAA 1MYRA 4J1OA 2HXUA 1CECA 4GG9A 3KCLA 3RLVA 1QBBA 2VFFA 2D20A 1J01A 1JF6A 3EXTA 1A53A 4M51A 1QVBA 1TSIA 2BZNA 2J7HA 1PX8A 1YBQB 1WX0A 1RA0A 4JKLA 4DXXA 4L5ZA 3W3OA 3R58A 4PMVA 1KGWA 4IXHA 2WWCA 3ONCA 1W31A 4JTGA 3LCHA 2ALRA 1F5ZA 5AYBA 1J0ZA 3W75A 2NT0A 4WJXA 3AI0A 3MP4A 1H4PA 5HANA 3CUGA 3TFXA 2V5CA 3TYUA 2FVLA 2W5FA 3IJQA 4ECLA 1D3GA 2YB4A 3LBCA 4GO9A 1NDYA 3BANA 1K9DA 2GGJA 3UWVA 3WDRA 3ZJKA 4ZB0A 3TKFA 4LJ3A 3NSNA 4NZJA 4X61A 2FHFA 5CBBA 1MO0A 3ANUA 4LC8A 4LH8A 5D33A 1WKYA 5A3HA 3FAXA 3D3AA 1UD4A 3BG5A 5IBXC 1DQXA 1KLYA 4JYFA 1V02E 3IJ7A 4IMGA 2CFFA 5J04A 3NVTA 1KBBA 1OVDA 5LNUA 1F07A 4EANA 1AK5A 3B97A 5CH9A 3MQTA 2DZWA 4CN4A 1G4TA 1LOLA 1LWJA 1QMLA 2DVUA 4PR4A 3FOKA 2GLKA 4DAIA 4HZ6A 2YBTA 2W0UA 1HKMA 1XHGA 2QS8A 2EO7A 4GCAA 1HJQA 4I6KA 4LUSA 1POJA 1WDDA 2CLPA 1OX4A 2CHRA 3CL6A 1PCKA 3G1AA 1KB3A 1XYAA 2Z1XA 2CC0A 3UPWA 1VCVA 4GVGA 4HNCA 3KRBA 2PGRA 1KCZA 5HPCA 1VFUA 2XH4A 2Z24A 2GZXA 5DANA 2V2HA 3S83A 3T0TA 4A4AA 4JX5A 2OX1A 4F40A 5ABFA 3UERA 1T99A 3AWOA 5PTDA 4PMJA 3EYPA 5CZKA 4Z2KA 4CU7A 3G24A 1VFTA 4BZYA 1UYQA 1RY8A 2HXTA 4L4PA 3LLDA 1E9IA 3EDJA 4BEUA 5I0DA 4K37A 5D37A 4XTDA 2G3IA 2I16A 3W24A 4ZTYA 1TREA 3ONBA 4NRRA 3TN3A 4F0LA 5C9XA 1KFBA 3NO1A 1G7VA 1YXCA 3M0HA 4ROPA 3N4FA 4OQVA 1MVYA 2A6LA 4UIOA 1UC4A 3NM3A 4LRTA 3KDNA 4QS5A 1TR9A 2XINA 3DX5A 3I7RA 4W89A 4OUIA 4LS1A 1ISXA 2J6VA 4AIOA 1YADA 2DZAA 4HYWA 2RAGA 3BMWA 1S5VA 3O0KA 4E2BA 2V5DA 3KUMA 1YQ2A 4LRSA 4RL3A 4ZSUA 1DPMA 5LZLA 4YTUA 1FTXA 2ZUSA 3SIZA 4GIRA 3W22A 1MWOA 2F8QA 4PL2A 1JDCA 3A4WA 1R30A 3T0BA 4ZFMA 3DCPA 2E09A 1H7OA 4AU0A 4U4MA 5D38A 1ZZMA 3GH7A 4NT0A 2CHOA 3CAQA 3B0YA 1V3HA 1S2CA 2R91A 1XLLA 4XISA 5AHEA 4WY0F 4P8XA 4XSMA 4W87A 3AAMA 1RR2A 1GGOA 1KTNA 3OIXA 1X7IA 4QXIA 1GVQA 1RCXB 1ME7A 1E3ZA 3K4DA 1UR4A 1DQUA 2HBVA 3U2CA 3W1QA 1KWGA 1XDMA 3ZZ1A 3QHNA 3AYVA 4XAFA 1DJHA 1VBUA 5HMSA 3HB9A 1M53A 5A8OA 2DJXA 3ZLHA 4XZIA 1KRCC 1V0MA 3ARWA 1UWRA 3WL0A 2EPLX 4YLWA 2B7QA 1XSKA 1YW1A 2Q8XA 1UIPA 3LRLA 4IHCA 1Q7MA 1HL2A 3Q67A 3GNDA 2QCFA 3W23A 1NEYA 4LXFA 3M41A 1YMYA 4WD0A 3CWNA 3N19B 5D8ZA 2V5JA 2ZVRA 3LHTA 1X8CA 4N9BA 4XK2A 3P61A 2WNNA 5IFTA 4N9DA 4QITA 1DIDA 1PS9A 1E0TA 4UTKA 1U33A 1RJRA 1LWIA 3THCA 3UETA 4S2CA 4PEKA 3TXVA 3VNDA 1OIMA 4NZ4A 1UH2A 2OWWA 2ZVIA 1JPKA 4H8NA 1S5WA 1Q4WA 5AY7A 1KV8A 4FR6A 1N55A 3WDPP 4DZAA 4ZE5A 3IVTA 4H04A 1QT1A 3GNNA 2NQHA 2VZVA 4JKKA 3GRIA 2E6YA 5LGZA 1TRDA 1LYXA 4QR6A 4F0KA 2Z2AA 5F2IA 1FDJA 4FNUA 3IAPA 4WLCA 2C1GA 2QW5A 4S3FA 4KFNA 4EPEC 4ZL1A 1XJBA 2Y5EA 3GNPA 1F76A 3CIWA 4IPIA 4J3UA 1RBAA 1XL9A 2B7PA 3CM4A 1IXPA 4O1FA 4J7RA 3BCJA 4YU1A 2RGMA 4WJ8A 4H6KA 2QVNA 3LHWA 2X41A 4RZ6A 1YRRA 3TIMA 2BY2A 5CEWA 1G7UA 5E1QA 1HFBA 4LYPA 2ZE3A 4NAEB 2P76A 1FKWA 3LHUA 2E6AA 3O1NA 1R3RA 3P14A 3W7IA 3VIHA 1H60A 3QC3A 3GKFA 5CJNA 4O1CA 4GQQA 4QJ5B 3L2IA 1ZUAX 2WKJA 2P50A 3ZLFA 4O1EA 1W9DM 4NVTA 2VRJA 4JX4A 4IUOA 5HWJA 2YW3A 2P88A 2B4GA 3IS4A 2D1ZA 3CQIA 1QPNA 5HATA 3M6YA 1K7FA 5LKYA 3AS2A 3N73A 4HSNA 3LXBA 3UGRA 1A0CA 3GBDA 3QN3A 4JFSA 3IIVA 1RD6A 4QJ1A 3W07A 1DJQA 4GUFA 4QE5A 2H9AB 4NXSA 2GSEA 4NZ5A 2WVVA 4TIMA 4KEMA 2XIIA 4MFEA 2WZHA 1LRTA 5A2AA 1RPXA 5AKQA 5A6TC 4URIA 2H3BA 4MJ2A 3AIUA 5C6MA 3M0LA 3THAA 3WNOA 3QZAA 4HP5A 1HX0A 1GOKA 2WAGA 3L9CA 1EEXA 4LU0A 4MKNA 3MSYA 4NSBA 1BXCA 3MCMA 4XZLX 3WFAA 1JI1A 3WEZA 3WLKX 4O8RA 4XKMA 3W2NA 5AC6A 9RUBA 1XRVA 1OFDA 3W87A 3QLLA 3UXDA 1C9DA 2XIQA 3HURA 4N9EA 4ORIA 3L67A 3OLDA 3WUGA 3JU2A 1KKRA 4HZ7A 3KP0A 3WYZA 2QMJA 4MF4A 3QMSA 3W7RA 3EWCA 5JH1A 3TCEA 4PB3A 3TYCA 1REQB 5G4WA 2JIEA 4DIAA 2IW0A 3O15A 3VOHA 4XQ6A 8A3HA 2G37A 4DUVA 4IT1A 1CWYA 4IMEA 2ZUNA 4PRWA 1V3MA 5IHRA 2X7VA 2JALA 2WJEA 1XH0A 2YYTA 4QDMA 4D8LA 2FB3A 3IGUA 3B8IA 3CTLA 1ZGDA 3KZPA 1SZGA 3L4ZA 1A5KC 3LCGA 2VMFA 2BXVA 1HKIA 1TX2A 1VJZA 3F1QA 3W1MA 4HPGA 2VEMA 2Z28A 4DAFA 3B8DA 3BJTA 3W85A 2ACSA 2O4QA 5AN7A 1MW2A 4BQ5A 4DX3A 2XSAA 4AWUA 2DUZA 1IWBA 1XLFA 3DERA 3TN4A 2J9XA 2Y61A 1W9XA 2J47A 4AB4A 1W5PA 1EWDA 4NNCA 1TKKA 3KRSA 1H49A 3VMNA 4AZ5A 4UB9A 3UZ5A 1BRLB 3R12A 2R8WA 2FKPA 3P67A 1TMHA 2UZ9A 1PTGA 4AC7C 4IP4A 1Z8AA 4AC1X 3I6TA 3FAWA 3HBLA 4EXAA 4FIRA 1SZFA 4I7UA 2PZNA 1G9HA 2XGZA 3PFRA 3WQFA 2QZRA 3ZT5A 1BEUA 1QATA 3Q65A 2PDUA 2RHGA 3IPWA 4WRHA 5DBTA 3RK8A 3KP1A 6CGTA 3IWPA 4U33A 4M81A 2PC4A 1OD0A 1HVQA 2A3EA 4IWWA 4W85A 4RV3A 2BGNE 4HPNA 4HZMA 1QRQA 2IXVA 4JX6A 4QLKA 4GUIA 3MDWA 1Q85A 3KTXA 3T08A 1AMYA 3NSMA 4K2SA 1XINA 2ZUTA 3FDGA 3IGXA 1HO4A 4B3LA 2GJRA 4JGDA 4HNLA 3MMWA 3GVQA 1WAWA 3VIIA 4IIGA 4H41A 4WXYA 3AROA 4K68A 2ABBA 2F6KA 3OZYA 2WC4A 3BGAA 4BF7A 3QQ0A 3FV9A 4F2UA 5I79A 3MJMA 5I3JA 1Q6CA 3BAXA 1JDEA 1EO7A 1R38A 3B4YA 2QJJA 3NURA 2X8RA 1TQJA 1QI5A 4GJJA 3L2MA 4WY0A 5FAGA 2D0GA 2YZ5A 3EOOA 1J2WA 3N6QA 2OEKA 1Q8AA 1ODUA 2NQZA 4ASTA 1CLVA 4D9PA 1LL4A 2OMAA 1TPH1 2V8ZA 1MZHA 3TX9A 3SGZA 3BOFA 5A69A 2GDUA 3QBUA 3BCDA 1SFJA 3CH0A 3S5ZA 3KEHA 2JFEX 1N8FA 1SJBA 2PDCA 3QM3A 1A0DA 2W66A 1E1CA 4O16A 6TIMA 4FX6M 4UC5A 3PJXA 2VZTA 3WLQA 1EGMA 1TWIA 3M4HA 4FF7A 4P61A 1FWAC 2Q6ZA 3WY1A 4CQAA 4MWAE 2PU0A 3QLDA 3UYIA 4M0XA 3NO5A 3F4VA 3KWXA 5CJ5A 8CGTA 4MHBA 4I9MA 2GGHA 5EL1A 3SQLA 3FA5A 4JICA 3S42A 4CU8A 1NF0A 5BNKA 2X1RA 3WQ4A 4IX0A 5CPNA 6TAAA 2X05A 3N3TA 1ONXA 1T8QA 1B2YA 1GVEA 2OEJA 1QR7A 3EX2A 3S1XA 4CVUA 2HK1A 4RNFA 1I2RA 1FBAA 2ZOXA 2HVNA 2XH2A 2REQB 5LXEA 4AZIA 2ZX7A 1W3IA 1R5YA 1B4EA 1Y5WA 4JBRA 3GTFA 3FEMA 5HUPA 3WFLA 1B3ZA 1WCGA 4ADTA 1OINA 4WF7A 1TVPA 1R85A 2ZX5A 1WQ5A 2C6QA 1TCDA 1BYBA 3F5KA 1DJGA 2D22A 3NQ8A 4UOQA 2BVWA 1AODA 1E0WA 4FI4A 2ZX6A 3M6DA 3EOSA 3FA3A 4U2ZA 4F3HA 3S4TA 1UHVA 3E74A 3PK7A 4M7TA 3ES8A 4M1RA 3NO3A 4FXRA 3G2GA 2VEPA 1OFAA 2GVJA 1FFRA 4C7GA 4OVXA 3VK5A 3GKAA 1XIDA 4JTEA 1W8GA 3AJXA 5EBUA 3T8QA 4POCA 5I3DA 4DQWA 1BPLB 1J4EA 4JTRA 1J10A 1DHPA 1TMLA 4U2YA 2YFNA 1UD5A 3ZR6A 1PSCA 3W1XA 1T8XA 1EZ2A 3UFYA 1NU5A 3NQCA 2FZ9A 4GBUA 4YXGA 1LBMA 2XFYA 4FXSA 3RR4A 3B9AA 3FYOA 1OCNA 1PVNA 4L56A 3AS3A 2NSXA 3EWDA 1EP1A 1RLCL 3AYTA 4B2DD 3E9AA 2W62A 2P10A 3TW9A 4WDXA 4F2BA 2J75A 1W54A 3U2EA 1NOWA 1K70A 3LLFA 1PWMA 3K8MA 1NDWA 3FKKA 1JAKA 4EACA 1L8NA 2PD5A 1CXIA 5AHIA 5FJTA 3REQA 5GQBA 2V3DA 1C92A 4H9MA 1LL7A 3RG6A 1H62A 2WVSA 5ABTA 2WQPA 4P7LA 5I77A 2W4XA 3T78A 1XLAA 5KINA 3APTA 4GKLA 3VGDA 2WLZA 2I1OA 4DF2A 2OR2A 3VZZA 1BYAA 3KCJA 2RGLA 5MKGA 1J0IA 4WXZA 3P82A 4ZOAA 4D6FA 4KERA 2Y24A 1PZ0A 4NHVA 3VIKA 4S3EA 2J9ZA 1P48A 4IOTA 3LSCA 3RRXA 4ZCWA 2BWGA 2YX0A 2AAMA 2XH7A 3L4YA 4ZO8A 3VD7A 1XW8A 3SCSA 2Z1KA 5HJXA 5GNZA 1SQ7A 1THFD 3N11A 3KLLA 1PIGA 2B7NA 5ABGA 3JS3A 3FW6A 3TWAA 3B3DA 4LVAA 4MM1A 4S3GA 3WEMA 3K8LA 1DWHM 3GXIA 2E8YA 1Q4NX 2CW6A 1SU5A 4EOUA 5BMXA 3VD4A 1UWTA 5TBOA 1NWRA 2WMKA 3IUDA 2OU4A 3RLUA 2A2IA 4C5ZA 4O4WA 2DIKA 4DYKA 2CERA 5A6BD 1F61A 4J3VA 5A6SA 2ZZ1A 4WKHA 3K1GA 4LCQA 4YTRA 3WCZA 2PLKA 3USZA 2VFDA 2OWCA 5LNRA 1FHLA 4V2XA 1PWLA 1P0DA 1SMAA 2ISFA 4X22A 2CLKA 5T91A 1JCMP 1TJRA 3WQ5A 1H2JA 3B03A 4HTYA 3PBMA 4R3UA 1F3TA 2J7BA 1LG2A 2HEJA 4AEFA 3VNLA 4PMRA 2QVHA 1XF0A 2XVLA 3N9RA 2WSPA 1J2BA 2GYIA 4G5DA 3C8FA 4CCDA 4G56A 4FSAA 3L5AA 4YCOA 2IS7A 4C6JA 1VHCA 3QRHA 5TIMA 2CBIA 1XYLA 1CPUA 2XVGA 4HPJA 1P0NA 5D32A 4ADSA 3W88A 1H7XA 2NLYA 4ML4A 4GHRA 1HGYA 3URAA 2DT1A 1E4MM 3C2VA 1OCJA 1GQNA 4QE1A 1TRIA 4B92A 1FH7A 4ZZ9A 2D3LA 4RE2A 4PBEA 3BOLA 5EMMA 4GYPA 3LRMA 2NV9A 4JFVA 5HOSA 1IIGA 3DDMA 3E0WA 1R86A 1KM3A 1UD6A 3KBVA 1E3XA 2WJDA 2EPOA 2YA2A 4W9TA 4UOJA 2H90A 2PFHA 3W2MA 3IK4A 1G69A 2WSKA 3PZMA 1ZNNA 3MC5A 3WSUA 3GDKA 2C19A 4IG2A 4IGSA 5CSSA 4EVZA 2QUTA 2VRKA 3UG4A 3W81A 3D46A 3A4AA 3RIKA 2HE5A 4GLEA 3WJWA 2WPBA 1S2UA 3CC1A 3WF1A 2QJHA 4IMFA 5FCZA 3QKEA 3ARVA 4WUIA 2A7RA 5CSRA 3W7GA 4H9UA 2AMXA 3CMFA 3P62A 1X7FA 1UBPC 4HJFA 2YDRA 2PBOA 3BLEA 1H11A 4XAPA 1C7TA 4RE3A 3UA3A 3GH4A 3WD3A 4QNEA 3WQCA 4IFKB 4FOUA 3PHAA 4LEQA 5H91A 5IRPA 2PODA 3UD6A 1SO3A 2PEVA 3BH4A 4JTQA 3UXLA 2FB2A 4JN6A 3FA4A 7ODCA 3PN8A 4OKDA 1K4HA 4MUPA 1P7TB 4DBEA 2WYSA 1JGMA 5C9UA 2Z0IA 4AY1A 3RX3A 1MRQA 1Z48A 4OJYA 2FYMA 5AC7A 1AQ0A 3N2BA 3R7MA 1QNRA 1DHKA 2QIWA 3CUXA 1IT8A 1SFLA 3BO9A 3KBSA 3M43A 4KESA 4MLJA 3M44A 3N6HA 4H83A 2VGGA 2R94A 1LBLA 3ES7A 1Q63A 1IEIA 2G3MA 4IMDA 1QHOA 1EB3A 2UBPC 4KCVA 3W70A 3VD3A 4JYDA 1ITCA 2V69A 3P0XA 2NLIA 3H7VA 1XBXA 2DVTA 4MWAB 4WCJA 4GY7A 1V7AA 2XSBA 3LERA 2GJXB 2YLAA 3UY8A 1TV4A 3VNYA 4WJEA 1L6GA 3EEZA 3UJEA 3SRHA 4IP5A 2OO6A 4MJZA 2P53A 3UWEA 4OT7A 3H2EA 3WH5A 1R9YA 3DOPA 3EKZA 3C8NA 2BB0A 1ZY9A 1W9PA 2ZE0A 3AOFA 1M7OA 3G0XA 1YDOA 3ICJA 4HSHA 3S3GA 1KFKA 5H2ZA 4V33A 3B0VC 3GYEA 1B90A 1CXHA 2EAWA 3VIOA 1EDQA 4LCSA 2CITA 3TSDA 3MT1A 1A5SA 3VOIA 3PWGA 3AUJA 4Z1BA 3ARTA 4GVHA 4X9YA 3DBNA 1R0MA 4CKQA 1A3XA 2VX5A 4KF1A 1P6BA 2O9TA 2ZA2A 2QDEA 4A22A 3ARXA 3OVRA 4TU1A 1UKQA 3P81A 3C2FA 3HQNA 3IV8A 4S3KA 4ATWA 5D03A 3PTDA 4LBSA 3K5XA 2I5GA 3OVGA 4O1AA 2XH0A 3S5SA 2I17A 5D04C 5H6HA 1FX6A 3PZTA 1FHDA 2YBVA 1HKJA 3GM8A 3WLMA 4MNKA 2ZYFA 1JEZA 1O1HA 1YBQA 2Y8UA 5TAOA 4C1NB 2AL2B 3L65A 2FH8A 3GZ3A 2MUCA 1WZKA 3WJZA 2JF6A 2VENA 1O66A 3BW4A 1HVXA 4P7QA 4REQB 3B8WA 1VF8A 4C6MA 4ZXLA 4JL2A 2OYKA 2D2OA 3QW3A 3KAOA 5SWUA 3MZNA 1Q5MA 3GD6A 3I7QA 4DY1A 3RCYA 4JIEA 5D9NA 1PB0A 4PUKA 5IHSA 3VD9A 5DMMA 1O5KA 4FF5A 5FL0A 4ATLA 4CCZA 4AD5A 1R2RA 4LAUA 2CXGA 3KWSA 1UMLA 2DZXA 3TONA 1YDNA 4MTVA 3AMKA 3WNMA 3DEQA 1BAGA 1UWQA 3EWZA 1NFGA 4V1YA 3T0AA 2R1KA 3AXMA 4X3ZA 3G3DA 3TTYA 4LFYA 3PG8A 4I5UA 3GAYA 2BHYA 1M3UA 4UTJA 2HNHA 1BG9A 3G0UA 3Q94A 1QI4A 3CWHA 4OTKA 3UJ2A 2BMBA 1MXSA 4MMWA 1OCBA 3LNPA 3PUOA 4D8AA 3W7KA 2AKMA 1PTDA 1MXDA 4CD8A 3VI2A 2EG7A 3NJ3A 1XYZA 1EBHA 2XVNA 4QQUA 1Z41A 3CB3A 2BP1A 1E71M 4C1LA 3PZ9A 1H0IA 2Z29A 3LCWA 1XLDA 1E0VA 1NM9A 3NVDA 1BQGA 4GY0A 1OM0A 1B3YA 1E6ZA 4AIUA 4GX9A 5FAJA 3MI3A 1S2VA 3F2CA 3VO0A 1JPDX 5FSEC 1EJXC 1IZCA 4O0QA 4RNJA 3UY7A 2BHZA 3LB0A 3M64A 1KBJA 5T9BG 3SBFA 4RJEA 3E2SA 3PZVA 3LMZA 3D3FA 2Q3RA 2OFJA 4LY4A 2F38A 4HCLA 3AIWA 1H5YA 1WDPA 4HKPA 3UA4A 4WKFA 2WVTA 2ZXQA 5XIMA 2YSWA 1UKSA 4Z1DA 1H1YA 4PB5A 1TE6A 4Y6GA 3SN4A 4W5UA 3W1UA 3ABOA 3V1PA 4Q8PA 5GPRA 1V77A 3LM3A 1UR0A 5C70A 1NDVA 2NXGA 2O55A 3H7RA 1A5UA 4HHLA 3H22A 3E2RA 2ZXDA 3BURA 2PSNA 4YL2A 1LP6A 5ECVA 3KRUA 1RJQA 5HBFA 4MFDA 1QHZA 2HISA 1P6CA 2CNCA 3W1AA 1XFBA 1J18A 4I3GA 3EAUA 4XO7A 4CEUC 3CS2A 3KL3A 2E1DA 4HK6A 3HPXA 9CGTA 4U31A 2V82A 1YHTA 4WHBA 3WQ6A 3NEHA 4UQAA 4PCSA 3LX9A 4KPLA 3FJ4A 3R8GA 4UBPC 3IARA 4CGTA 3NSXA 5CLWA 3V0UA 3CO4A 1EGZA 1FWSA 2Y8KA 3TTOA 1IIHA 3GU1A 1K4GA 1Z42A 2OT1A 3KL5A 1F6KA 1BXNA 4MB1A 3DHPA 3A64A 4GQBA 1JPMA 1H3GA 3DN5A 2C7FA 1C3FA 1RQEA 7CGTA 5J5DA 1SJAA 1TPWA 1VBRA 3SSZA 3KHDA 3AALA 2D0HA 2Z7GA 3ZFHA 1OFBA 3DGRA 1KNWA 2PRLA 5B7ZA 1R7OA 2WWDA 4HNNA 2BLEA 3KE0A 1BGAA 2QCHA 3OHIA 3TN5A 1H61A 2HVMA 3O8AA 2YGYA 1K6AA 2CHNA 4FOKA 3W7JA 2UY5A 4ZO6A 5DCBA 3LN3A 4WOZA 4JTAA 5D9PA 4C6PA 2QPXA 1Z69A 4LV4A 2VCBA 5JQ9A 1Q8JA 3ITYA 1BVWA 5FJUA 3V18A 1QXLA 1XP3A 5CLTA 3QTGA 3D5HA 4XBSA 1JXJA 1TJ2A 1MQQA 1CB7B 4UCGA 1ONWA 3GBEA 5EPDA 3UXAA 1LWHA 2NV2A 3PAOA 4JN7A 2BOEX 5I09A 4XIAA 1FWFC 3CQKA 3PB2A 1I2PA 3TYDA 1LT7A 2NWSA 5HUOA 4OOUA 3MS8A 1ZJHA 4AAJA 3A47A 4HZ8A 5DBUA 4ILSA 3MO4A 4O8AA 1KC7A 1XIEA 3APYA 2WBGA 2VEFA 1E5JA 4M82A 4P7NA 4XO6A 1ICPA 4IQJA 4JIPA 3RAOA 1DJWA 4UQEA 2VQTA 3T0CA 4KETA 3HGOA 1F6YA 3RRAA 4RPPA 2EHHA 4NJHA 3S5NA 2KAUC 4GJ1A 3WUEA 3H4GA 1ONRA 3RO6A 3VE7A 2HZGA 4M6PA 1R2SA 2CIPA 1HJXA 3W7DA 4UNLA 2XDFA 3EPOA 4X0NA 1BKHA 2PWDA 3HIJA 2VGFA 2VQUA 4DM1A 3AHTA 3G1VA 4PTNA 4FLOA 1XFCA 4JTKA 4A8IA 2VX7A 4IQEA 2DSUA 1O5QA 3J7HA 1TO3A 3CO8A 3W1PA 1CLXA 5DT7A 1IYXA 3SY1A 3HF3A 1CI1A 1LRQA 3I6EA 5LGXA 1DWJM 3CHCA 3CT2A 3UF9A 4J3SA 1FY6A 3UYCA 3KCOA 1JDAA 2WNZA 3QR0A 5A8QA 3PR2A 1KA9F 4HMEA 3N4EA 1WZMA 3WBWA 2HS8A 3MW7A 3OW1A 2VURA 2V3GA 4LGXA 1XPYA 4GFSA 2YDQA 1ZTVA 4S38A 2Z6JA 2OO0A 3SURA 1FKXA 2PURA 1HG3A 3E1F1 5BOEA 5AZ1A 3E96A 2OQHA 2PA6A 5KZ6A 3ZJ8A 2NQ5A 2J9YA 3WLPA 3CZJA 1PIIA 4AZCB 1AH4A 3MYOA 1UOZA 4QAWA 4UR7A 2FHCA 3QPEA 4MY9A 3S1VA 1C8XA 4NAEA 4XZBA 3WQDA 4IISA 1E9LA 4A8NA 3E5PA 1FH8A 3HOJA 3BAJA 3LHZA 2OELA 4FS9A 3V5OA 1DOSA 3B04A 5FF2A 3QMTA 3GZAA 3T1GA 2XFFA 4GYPC 4PFHA 2PCQA 3NQVA 1QK0A 3P2VA 1S5MA 5HNNA 3QFEA 1MQPA 5HK4A 1UQZA 1I4NA 2E8ZA 4PTMA 1C9WA 1XWYA 4XVDA 1DORA 3V4BA 4HN8A 3IJIA 2INFA 3TJIA 4HK7A 4QDPA 1R87A 4Y8EA 5AC8A 1GVYA 3B9EA 5FI8A 1ISVA 4GJIA 2CESA 3A21A 2H9AA 1UASA 4G1KA 3VGBA 3B8SA 5ABEA 3BAKA 2DSVA 3CAVA 5BU9A 1XIBA 3W02A 3SRDA 4W86A 1KFLA 1EP3A 2G8ZA 3NQFA 5L6UA 2QYGA 4JQAA 1SGJA 5JUVA 1BGGA 4HK5A 8XIMA 3G1HA 3RU8X 2X1TA 4J3XA 1K03A 4YHEA 2QDHA 3PPFA 4DWSD 4CUCA 4X60A 3NL5A 1XI3A 3QQ1A 2INZA 3CEUA 1VFMA 4V15A 3N13A 1V02A 4DELA 3GUGA 2YA1A 5DLCA 3DFPA 3BVJA 3KX6A 3MP5A 3AZRA 4IX2A 1TWZA 4Q8MA 1Q6RA 3LGDA 1C7SA 2YPIA 3TYBA 3ZVIA 4IFRA 1J96A 1S2AA 3SCNA 1M01A 4HHHA 1REQA 3CZKA 4R5EA 4LVBA 3WBEA 4LC6A 1JR1A 3EWYA 3S1WA 5B7YA 1QTWA 1TFVA 3R0DA 2OEMA 1DJZA 1ZBWA 4CVWA 2DJLA 3B06A 5DY3A 3BL3A 2QUMA 3FS2A 4H6QA 3ORWA 1JYNA 1HUVA 4L65A 3AU2A 3UWQA 5LSMA 3Q4DA 4J5NA 2UY3A 3M07A 2NX3A 4D1IA 2A6NA 1W6TA 1OX6A 2I7GA 1D8WA 3F03K 2Y6ZA 3WMCA 4HMNA 4HN4A 3NFUA 3NIYA 4CCEA 3L23A 1BF6A 5FEXA 2X7WA 3P3BA 3PJTA 4DJEA 1LRNA 2CWXA 1BQCA 2P5NA 1OK6A 2ZTJA 3N9KA 1E0UA 3V16A 3QZ6A 3GTHA 4L9XA 1EF2A 4FXFA 1E51A 2TMDA 4YVXA 3WLTA 4V28A 2QGHA 5E0CA 3GK0A 5C9RA 3M0IA 3HGSA 1BRLA 4A2RA 2C15A 4BS0A 1UJQA 2NUWA 4MDPA 3MV01 5DRCA 1JPHA 2QAFA 4AYGA 1T5AA 3ZVHB 1R3VA 1X1NA 5LNVA 3WD4A 3VE9A 4MIMA 1UZ1A 4NASA 4G9PA 2EBNA 1WUFA 3LCFA 4GX8A 3PB0A 2XHYA 2PDQA 3G1SA 4B5TA 1W56A 3DFHA 2FZDA 2ZWZA 3W1TA 1M04A 5FEPA 3VABA 4YVVA 4ADUA 2POTA 1E43A 2J62A 3P80A 4LYQA 2A4AA 5T8GA 4WSHA 1GEQA 4KWOA 3IACA 5EYWA 4NY2A 3GIPA 3TTQA 2YCJA 2RDXA 2OSWA 4W8LA 1GQJA 3QYQA 5KETA 3M16A 4GE8A 4FNRA 4ATDA 3EOLA 2PDGA 2X1SA 3ITLA 4QAIA 4LY8A 4Q22A 1X1OA 5DMNA 4N4PA 3T07A 5C9ZA 1ADSA 4C65A 2NW0A 4R85A 5HWNA 2CZ5A 1B9ZA 3QSTA 3APGA 4GYJA 4YWIA 3NOYA 3O6DA 2PDXA 3TU9A 2ZRYA 3RFAA 4OE7A 1LBFA 1ZFJA 4UTHA 2CXEA 3NQGA 1QPOA 1PE1A 5D09A 3VOCA 2J79A 1U30A 1E6PA 2V5KA 4XD5A 3SJNA 2XWDA 3GC2A 3TV8A 1W91A 2V68A 5A2BA 3C4UA 2VKZG 4NILA 5MHBA 3TEVA 4NNBA 4JL1A 4W8BA 1PXGA 1VFFA 3UVAA 1PO9A 4IFOA 1TIMA 2PTDA 1P1MA 4QCFA 3WX7A 2PWVA 4GIAA 1W37A 1A3HA 2V2CA 4YN5A 4TMCA 3DFTA 2VDIA 2OZ8A 1IGWA 2WQDA 1V6VA 4KRZA 1GHRA 1RK5A 1NARA 2Z1BA 4HU0A 4YMZA 1F8MA 1JZ7A 4R7JA 3PULA 3ELFA 1UUQA 1EIBA 1ONEA 2WHLA 3KXQA 3RGTA 1QNSA 4RV8A 4EKJA 1WXZA 2DQWA 5AC5A 2PS2A 2ZX8A 1Q6QA 4F66A 3PZGA 4ZO9A 2E9BA 3JUGA 1LDCA 1S39A 4Q4QA 4DXKA 4I9TA 2PWFA 3E2QA 3WBAA 2V38A 1W5NA 2GOKA 3BW3A 1PV8A 1OGSA 2FLIA 4L1XA 4PGLA 1SJCA 3VAVA 2PDBA 4QRNA 2PP3A 3NTYA 3MSGA 3OA3A 5TNVA 3IGHX 1GYMA 2D0FA 4IQLA 1JULA 2ISDA 2REQA 1XLIA 3RYSA 2FZ8A 5H8UA 3BWWA 2BVTA 4RLIA 4EP8C 5JBEA 3QC0A 1W3LA 3GS6A 5FF7A 1ZCCA 3FYPA 1JUKA 3GIQA 4UZUA 5JVLA 2GGEA 1EXBA 4NX5A 5DN1A 1TVNA 3OBAA 3VIJA 1UB3A 3GHSA 1J0YA 4N2YA 1XV8A 3RITA 1DTUA 3G6MA 1HT6A 4IH3A 3TMQA 1VBJA 2VC5A 2GVYA 1DIKA 1XG3A 1XQKA 3QV8A 4JEJA 1GVOA 4UTWA 3R8RA 2CKSA 4Q4RA 4AF0B 3MJYA 3XIMA 3HN3A 3T2PA 4IQDA 4J3ZA 3V35A 5FA5A 5REQB 5HR7A 3UW6A 3LOTA 4I9AA 4DHGA 3CHEA 5ENLA 4H7VA 4EX4A 4NXKA 3A4XA 3OJGA 3U4FA 3WMBA 3MSDA 1GVFA 1ZJAA 1NY1A 2BBFA 3DFYA 1KTCA 1KM6A 3C5QA 3G18A 2DY3A 1BG4A 4WIWA 3KBNA 2BGSA 3LCLA 4HPXA 5LIXX 2X40A 1BTMA 1QI2A 3VIMA 4DI8A 1NQKA 4U28A 2WMIB 3KTCA 1HKVA 4H00A 3WLLA 3TSBA 3U57A 1V7YA 2P3ZA 4UQ9A 3OVPA 1YDYA 1O68A 4HNTA 3E5BA 1AW1A 2WJZA 5KTLA 4J40A 3G1DA 4E8DA 5IDIA 4IGHA 4QG9A 1KBKA 3KBMA 1KR0A 1ZU8A 1C8YA 3PZUA 4ZFCA 4I8DA 1ITUA 3S6DA 3QEZA 1AD4A 4RNIA 2HNEA 2HJPA 3G1XA 5C71A 3AYSA 3O63A 5HA7A 1ADDA 2XGBA 3BW2A 4LWWA 5I2UA 3N1AA 4GVIA 3FCPA 2G0WA 2W67A 2DZVA 3G6LA 1GWJA 3BSMA 3W01A 4Q8QA 2X2YA 1KFCA 2ZUUA 1F9CA 1P0KA 1K9EA 3WF3A 4KW2A 1VAHA 1WDWA 5DMLA 4Y7EA 1PCWA 2IPJA 4XVEA 1TPDA 1X98A 2QV4A 1J8VA 3WNPA 4OIFA 4PN2A 1WA3A 1W9BM 4Q32A 2PU1A 3XINA 2NX9A 3LPPA 3A12A 3L4TA 3SSJA 2DU2A 4IJCA 5AHFA 4M56A 4AMAA 1TYGA 3MWCA 1GTEA 1GW1A 1FA2A 4DNHA 3N17A 1PKYA 1VJIA 4ROQA 3TTSA 2I56A 5JMUA 2BG5A 2J8FA 2DT0A 2ZC8A 2PDKA 1K9FA 3PJWA 2VT0A 1YXYA 4GVFA 4HMDA 1V5XA 1V6WA 3B40A 3I65A 2E3ZA 3W6MA 1XC4A 1MUMA 3HZ3A 2GDQA 4XAGA 2BGQA 4QG6A 1NWTA 2HCVA 1I2OA 2ZZ7A 2J8GA 1W17A 3TNBA 3H55A 1VD6A 3VM5A 4QISA 4NAFB 4IZGA 3V3WA 5C2CA 1DJYA 2EJAA 3W71A 3SUUA 1GPWA 1UR9A 2G96A 4G6CA 3WLNA 3PBWA 2OGYA 2E5BA 3H21A 4F2TA 1Q6LA 3PSWA 3VNZA 3A24A 3HMCA 5C55A 2DGAA 5BXPA 4MB5A 1D9EA 2X0HA 4AD0A 1XG4A 1D3HA 2J27A 2QQ6A 1JD9A 3QHOA 1O7AA 1E0XA 4ZVJA 2RH9A 5I6SA 3RPDA 4K8HA 4Y9AA 1E1EA 5BXSA 1K8YA 5AHLA 3LQLA 5I78A 2GGGA 4LX4A 1A5AA 4FX8A 3AQUA 2CEQA 5HQEA 4DJFA 2X30A 2I9EA 5AYZA 3PJUA 2QT3A 1EJRC 1ZLPA 2WSQA 1VKFA 3CWOX 2Q02A 4RX0A 1DKWA 3TW7A 1MW0A 3POHA 4DLFA 3C2YA 3T42A 2YL8A 3GX9A 2H8ZA 2JE8A 3QPYA 1V79A 3WJSA 2OZ0A 1MEIA 3EX1A 4JCLA 4UR8A 5BRBA 3VUSA 3E2VA 1VHNA 4IFKA 3FY1A 5I5RA 1TPVA 4MJMA 1O4UA 1AQFA 4IL2A 3VKBA 5D9OA 5BOFA 5H1WA 3O6CA 3DAQA 3HO8A 1MEWA 1OFEA 5I00A 1DEDA 2O7SA 1CXFA 1P7TA 3AXKA 2QV5A 5LXXA 4MZ8A 4A3RA 2DW7A 2ANUA 3MSRA 4JQ4A 4YIWA 3ZMRA 3LMYA 1VC4A 1Q13A 3WD2A 1TJPA 5IM51 2X09A 1SO6A 2E0PA 4QCEA 1GG0A 5CAHA 2XVKA 5I02A 1WKFA 1UH4A 1ML1A 1I2NA 1FP8A 3W1RA 3UR8A 1V6YA 1X39A 3EOEA 3JRKA 2XM1A 3QZEA 1US0A 5KEZA 1UP0A 1RD5A 1G4EA 2V30A 2QHAA 4QM1A 3MBFA 3OZMA 1GKQA 1XCWA 3HPZA 1LJYA 2NXIA 3OG3A 3WD1A 4PMDA 4MWAA 3P0WA 2GFTA 1IF2A 1ICSA 3N2MA 3BOXA 1O5RA 4O11A 3O7UA 5CQ1A 1V6UA 2PDIA 4Q4OA 5FOOA 1B1YA 1IWPA 2VEKA 4XTIA 4B4FA 3DC8A 1JZ2A 4JTSA 4YJ5A 2VZOA 3HGRA 2A0NA 1AFSA 4EXBA 3WK2A 2F6UA 3UNDA 4AX7A 3SCOA 9XIAA 4LAMA 3CU2A 1GOQA 5H8PA 3ZSSA 3ANYA 1UUMA 2FDMA 1PZ2A 1JI2A 3R13A 1H63A 2D24A 3CAWA 4QFUA 2D69A 1FWHC 1AH0A 4CEXC 3MYPA 1OK4A 3SGGA 4JPGA 4QJ3B 1XXXA 2WOQA 2WBKA 3LBOA 4DBUA 4BI5A 3ABQA 1CGWA 3ZJ6A 4W7VA 2RKXA 4LEFA 4DJEC 3LDVA 4Y96A 3FKRA 2ZZ6A 1A5OC 1ZP3A 4XIMA 3TR2A 1RALA 3THUA 1K8XA 2Y2WA 4PTWA 3VKDA 4J2PA 1F3XA 3G3MA 1PUDA 4QTGA 1GVRA 5GNYA 3UG8A 4MJ4A 5I24A 4LAOA 1US3A 1XIIA 1VB9A 4FLRA 4UQBA 5LIWX 4LUIA 4C1NA 2AL2A 1VFLA 3PUDA 5BXRA 2ISSA 1EOMA 4REQA 4MAZA 3FHQA 1SFTA 4BEQA 2FJUB 4Q6XA 1UZDA 3FEQA 4E8GA 3K46A 3A3XA 5CGMA 2QNEA 1BSLA 1EQCA 3VCCA 1HKKA 3RX4A 1VEPA 1H0GA 3C2OA 3IEBA 4R7OA 4NJIA 1QI0A 4YHGA 2WM0A 4O0KA 3MZ2A 3OU8A 1EYEA 1K7XA 1FP9A 3CT7A 2VOMA 1W8SA 5C9WA 2X42A 4EPDC 1E1FA 5BOOA 3EDDA 4XBJA 4JTTA 4JAWA 2B0MA 2NSOA 4UZSA 1KO0A 4GMEA 2YIHA 5K9CA 2YOCA 1T40A 5M17A 4OFCA 4EIVA 4UQDA 1OFQA 1BWVA 4OWGA 3TYEA 2QR6A 2FH6A 2IKJA 1RUSA 3U2OA 1UKPA 3CEPA 4N9CA 1PJ9A 2CETA 5HMEA 2C91A 2VVNA 4O1BA 4A21A 4RDVA 3SY8A 2X2GA 4NZCA 3BV4A 2I14A 2E7FA 1JZ5A 3DFQA 4L4LA 3EMQA 2OYMA 1X97A 1XM3A 1QWGA 2DUXA 3BDKA 5A6MA 3TYAA 1QHPA 1R3YA 3W7MA 4PCTA 2WCAA 1H5VA 2VX6A 1L2UA 4QE4A 4DUXA 3GG8A 3UR2A 5CPMA 1XKYA 1EA9C 1UMYA 3WD0A 1GOXA 3DG7A 1LOQA 2VGIA 1W1PA 2QDGA 5D2WA 4C6OA 1DTNA 3R89A 1PHQA 2QIIA 3L12A 3VGHA 4ZQOA 2CZEA 3LTPA 1EJUC 2EPHA 4AHOA 3C2EA 4RE0A 3LLXA 3NDZA 5LNWA 1VBGA 3FJ6A 3DHUA 3BLDA 4PMOA 2WANA 5IXEA 4AX6A 3W4RA 2QJMA 3AMLA 3DKLA 5FF3A 5HQLA 3T55A 1B9BA 1MUWA 3I6RA 2WV8A 4F9DA 3NQBA 4YNGA 3VDHA 4EAYA 1Q6DA 2GUUA 3TCSA 5C2XA 3AMDA 3W7NA 1JDFA 3PNUA 3EX4A 3NR0A 1KGUA 1AL8A 1F6PA 3GHUA 2P1FA 3IANA 4IGMA 4H9XA 2W61A 4IPLA 3MUCA 3W26A 1GOOA 3DBPA 3W00A 1EP2A 1GK8A 2RUSA 2R1PA 4HHPA 4KFOA 1WXJA 2YL5A 3UESA 3HJEA 2QEZA 4B16A 3ITOA 4Z17A 4LS0A 1TUFA 1IR2A 3TMLA 4JHZA 3ITTA 4ZE4A 5DCEA 2WJFA 1NIUA 2PAJA 5AOUA 1YNPA 2VC7A 1UR8A 4NI3A 1VYSX 2WXDM 1DYSA 1CYGA 5F2GA 4V1XA 3K1DA 4AISA 1JL8A 3UWYA 1Y5VA 4CN1A 4AWSA 3MCNA 4O53A 3GXFA 2XGIA 1GEHA 4I8YA 3VDGA 2JK2A 2WSYA 3FJNA 1XC6A 2GWGA 4J3TA 4UTWC 3PPCA 1XICA 1LM1A 4US5A 3IRDA 4W5ZA 1UKTA 3T6CA 2OOGA 2QCDB 1M7XA 4WEVX 1QOQA 1PKNA 4K38A 1KFEA 1EDGA 3UJRA 4PTXA 3ATYA 1OT1A 2X0SA 3UXIA 2ZXAA 2V81A 1KM5A 3O06A 3IJ8A 5EMYA 1B3WA 2QMKA 4H7CA 4DM2A 1MZRA 3U5UA 4X9SA 2CZDA 3GXMA 1KFWA 1ME8A 3DXIA 3RLHA 4GPNA 3TAKA 3OHMB 4Y90A 2DT3A 3PTMA 1IT0A 4YTSA 2ZDSA 2ONEA 3PWAA 4MDOA 1ZHAA 3R8HA 2VC6A 4GK8A 1ZAHA 2PDYA 1VIZA 1K77A 3LXCA 1UIOA 5G1TA 1XIFA 1FWEC 3NOEA 1H41A 1G6CA 4PL1A 2DSWA 2EQDA 3MDUA 4O28A 3H2AA 2V3EA 1TWWA 1KM0A 2Y89A 2PDPA 3M0MA 3H26A 4LQ1A 2Z25A 4LUTB 1RZMA 2D2GA 1E5NA 3DKJA 1YE6A 1Q65A 3U8GA 4FR1A 1S5NA 3N04A 5HMFA 1A49A 5H8MA 1H7PA 4GABA 1PX4A 4DUOA 4UOZA 1J6OA 4K8GA 5LHEA 1ZBKA 3CV1A 5FESA 3UT0A 1H50A 2EKCA 1OY0A 1QOPA 3AXXA 3NNTA 3UCCA 1RAKA 2Z1SA 3OG2A 3RCMA 1E6SM 4JS3A 4LB3A 3SW6A 3ATZA 3WK1A 3E38A 1FCVA 4X63A 3H53A 1CCWB 4LYRA 1YTEA 3NZGA 4LVFA 4AZBA 3I3DA 1E6QM 3U48A 1KTBA 2R24A 1B31A 2GSJA 1DJXA 5LIUX 2CLLA 3E3HA 4JYEA 4WKAA 2UV8G 3SGUA 4MPQA 1P0EA 4AWTA 5I3HA 1ZBVA 3UVIA 5CXPA 2BS9A 1JQXA 4WDWA 2J7GA 5K4XA 1YTKA 1XUZA 3AXHA 1FWDC 1QFEA 5FIPA 2CLIA 2PTYA 1W1A1 2E67A 4ERIA 3EA1A 2NZLA 1WDQA 3E02A 4KIEA 3VCRA 1QNVA 4HNOA 3VX1A 4EAMA 4AZ6A 6XIMA 1ZB5A 3AMCA 2MNRA 3NQEA 3UWWA 4AZCA 2ZICA 4M80A 5BXTA 3WH6A 4JTFA 2RJGA 4MYXA 1JYVA 3R10A 2J77A 1GQKA 4Y2WA 1OYAA 3R6IA 4IIBA 1MUCA 2B7OA 4B5NA 1MMFA 1LL6A 3C61A 2VEGA 5M3WA 1SZRA 1WXYA 2DZPA 4I90A 1C8VA 3HG4A 4WQ6A 3NM1A 4YS1A 4XG1A 3W7EA 4AEOA 4AXNA 3JR2A 4C6BA 3LTSA 2F61A 3STPA 4ZO7A 4GOAA 2ABAA 4AZ7A 3GHRA 1Z32X 4HA3A 5DEZA 1TTJA 1UP3A 3TA6A 3OBEA 1TELA 4O17A 1XH2A 2XN1A 3LGGA 3ECQA 4AHPA 4PODA 1TV3A 2ZRUA 2D73A 1KRAC 1EQPA 2VM8A 3B0XA 3WJXA 2QPUA 2QJIA 1XIGA 1O60A 4UUIA 1OF6A 4DJFC 2ZA3A 2VFEA 4JNMA 4J9JA 3VFCA 4H1ZA 2Y1HA 4JN8A 1YXDA 1K8CA 3PZOA 3W9ZA 1OB0A 2CCRA 4IMAA 1TV2A 1LOSA 3UZWA 4JZ5A 2PWEA 4O19A 4PSPA 2G41A 1S2TA 5F4SA 1S5TA 3LS9A 4DJDC 5LIYX 3L0GA 1KM2A 1L0PA 3W7CA 2BTMA 3ZT7A 4AY8A 3F2DA 4NYUA 3W7HA 1XYFA 1WB0A 2VTFA 3AHZA 2PC8A 3VTRA 1PYFA 1T7LA 3AZTA 2X1UA 1U1UA 1D8CA 3MB9A 1JCXA 1I9CB 4HOZA 3RM4A 2CBJA 3ARSA 1XLBA 3OO2A 3DG6A 3RJYA 3F5JA 3UPBA 1AH3A 1IV8A 2OGJA 1JYXA 3B9NA 4ORMA 1OIFA 1WKDA 1RSCA 2WHKA 4HB7A 1H51A 1XLEA 1PBGA 3GB6A 1XCXA 4DWSB 1GOWA 2KX9A 3B0UX 4CNSA 3VX0A 1GKRA 3L4UA 4ALDA 3MHGA 3AFBA 4YVPA 2PZ0A 4QSFA 4M3PA 1WKEA 3A3WA 2GQAA 1EPVA 1R2TA 3BICA 3SI9A 4C60A 2VELA 1DE5A 5K9XA 3SZ8A 3VDAA 3DENA 4ZSTA 3KZSA 1HL9A 3PANA 4DI9A 4MWAC 1HN1A 3WMLA 2IKIA 1PKLA 3D0CA 3D47A 4J4KA 1FWCC 3Q37A 2FMOA 3CJPA 3EWWA 3KOXA 4E8CA 3QY8A 1UD8A 1TTQA 1W2VA 4IIFA 2GJNA 4GNJA 2DZBA 4O12A 4FEZA 4TVUA 1YEYA 3WQPA 1QNOA 3H2OA 1NOUA 4UNKA 2TRSA 1ZQ5A