4AD4A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-isofagomine and alpha-1,2- mannobiose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
total genus 130
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad4A00
1CXHA 4LPCA 4GI9A 3UEQA 5FOOA 4OIFA 1JGIA 3WNOA 2WC7A 2WZEA 4TX8A 3JUGA 1UR2A 2C7FA 3LMYA 2YBTA 4D6EA 3RILA 3WMCA 4EANA 2V3DA 3GXMA 3GM8A 3ARSA 4XUYA 2GJXB 2OWWA 3T2QA 2WHLA 4W87A 1QI2A 2ZUSA 2GJXA 2WAGA 3AHVA 2XYLA 1X1NA 4P8UA 1KXQA 1ZL1A 4UFLA 1KGUA 1EH9A 4M1RA 1U33A 1XC6A 2RGMA 2MANA 1UD3A 3AS2A 2D22A 1H41A 3TA9A 3UESA 3CLWA 3AZSA 1US3A 2VX4A 3QGVA 3VU2A 5JUVA 5E09A 1BQCA 2FH6A 1ISZA 1ZBVA 3WH6A 5ABHA 3VGBA 3ZJ6A 3WSUA 4PMVA 3SCPA 4LYPA 1ZBKA 1FH7A 5E70A 1EIBA 2XFYA 3OBAA 2O9OA 4Q22A 1E4LA 3DYOA 3AFBA 4MNJA 1ISWA 4LYRA 3FW6A 1J01A 5KZ6A 1V6XA 2VI0A 3RM9A 3VM7A 4XB3A 3SURA 2RGLA 3M46A 4CVUA 1CNVA 4W7VA 4BCEA 1J11A 1JNDA 4ZE5A 1E3ZA 4PMYA 2OYKA 4AIUA 4AIOA 1W9XA 1D7FA 1JNEA 3L4WA 4JCLA 3W4RA 2Y5EA 2XPKA 1PAMA 1JF5A 1IV8A 1W1PA 2WNWA 3A47A 2D1ZA 2PWEA 3W6MA 1XYZA 2PWDA 3AZTA 3AMDA 2CKSA 4PCTA 2G3JA 2XSBA 4AZBA 3CZGA 5EMYA 3SCSA 3MUY1 2WSPA 1QBBA 3CIVA 1HJQA 3U5UA 4PSPA 4LYQA 4HU8A 2XFRA 4MNKA 2J74A 3VVGA 2D0GA 2VR5A 3W37A 1X6LA 1KQZA 3WMSA 1BVZA 3SCWA 4MB1A 3N12A 3WD2A 5IFPA 1G1YA 3KE0A 1G0CA 4IPNB 2A3EA 3WENA 2XTKA 1Q6CA 1RPKA 1HKIA 4B3LA 1FH8A 3CUFA 2WXDM 4AY1A 5DFAA 4AD2A 2O9PA 4W8LA 1ZU8A 3EDKA 4HZ6A 3MKKA 4MDPA 3RM8A 4E2OA 5CXPA 1E55A 5A6MA 2W91A 5HPOA 3ARQA 4D1IA 1KWGA 2Y8VA 1EQCA 1L8NA 2E0PA 3DYMA 1HL8A 3MUZ1 3WL1A 1CBGA 4J3TA 3D5HA 1HJWA 1CWYA 4UQBA 4XZBA 1K9FA 5EBAA 3IAQA 4BA0A 4OUEA 2JEPA 3U7VA 2J7EA 4NRRA 1CECA 3AMKA 1DEDA 1OT1A 3OGVA 4KGJA 4U5KA 3MANA 2BHYA 1DWAM 2BY3A 4J27A 3W24A 1UD2A 3UG4A 1JYNA 1NM9A 1JZ4A 3VNZA 3WF3A 1H2JA 3A3HA 3ZSSA 4PMRA 4P7RA 2IXVA 3WDHA 3ZT7A 3BAKA 1WDSA 1W9PA 3MMUA 3SCQA 4BQ3A 2OYMA 2Y4SA 2J7HA 2VTFA 3B9AA 1CGUA 4D6GA 2A3BA 1LLOA 2XFFA 2XWDA 1JZ8A 4GZIA 2CITA 3S2CA 4UOJA 3W29A 4AEFA 5GQBA 1KGXA 5BRPA 4JCMA 2YDSA 3W6LA 1UHVA 2JALA 4UOZA 2ZX9A 1QI0A 3AHTA 4MNLA 1E6RA 2GDUA 4UCFA 1OCQA 2FHFA 5CSUA 3VIPA 4EKJA 4DWSC 4CD6A 1VFFA 2CXGA 1BLIA 1PBGA 3S6TA 2GK1B 4CN6A 1LWHA 3ARZA 2GK1A 1V6YA 3PZTA 4HMEA 2UWFA 1WAWA 4D6DA 2ZOXA 5M17A 5LYRA 2EBNA 3PBGA 4M81A 2EJ1A 2Y2WA 1JIBA 1UKTA 3AYSA 3WF0A 4P8WA 1QW9A 1UA3A 4RE4A 3IJ9A 1C3FA 1B3ZA 5I2UA 1DWJM 5CSYA 1C93A 3WL0A 1BHGA 1GOOA 3ARYA 3F5LA 3WUEA 4ACZB 3GH7A 1E72M 3LPFA 1LWJA 1Z32X 4ACZA 4AD4A 1CXEA 4R5EA 1LL4A 4AZ7A 2PBGA 4J28A 1XD0A 3QOMA 4W88A 4F9DA 4MAVA 4M29A 2XGIA 3POHA 1KQYA 5I0DA 4UQ9A 3MS8A 5C71A 3OLDA 3WBEA 3CZ8A 2Y8KA 1YQ2A 3CUGA 3PZIA 4GXPA 1NARA 4N42A 4Z2JA 3ZO9A 1E0XA 2VZTA 4CU6A 1MW0A 4BQ2A 5M03A 2YA1A 5FD0A 1FP8A 1B2YA 1E4IA 9CGTA 3UG5A 3FNDA 1GJUA 1PX3A 1PX4A 2VVSA 1MVYA 3K8MA 1HJUA 1UWRA 2VCBA 2WCAA 1H1NA 1ZBWA 3K8KA 1PIGA 4HMCA 1B0IA 1E6XM 3B8SA 2BHUA 2WK2A 1UD5A 1JDAA 1VRXA 4JFTA 4ZE4A 4JL2A 3PN8A 3TP4A 1FHLA 3WDIA 3WNMA 5HXMA 3WDRA 5JIWA 1JZ7A 1AQHA 1OSEA 1CLXA 3MO4A 4AD1A 1QNQA 1MWOA 3FN9A 2VZUA 1LL6A 4LGXA 5CZKA 5ECUA 1J0HA 1BF2A 2QMKA 4UZSA 1QNRA 2VCAA 3E1F1 2NW0A 1UQZA 3VMOA 1WE5A 4WSKA 3WD1A 4PUEA 1MXDA 1BGGA 2YLAA 5A8MA 5D4YA 5JBEA 1V02A 1SFSA 1TR1A 2V3EA 3ZIZA 2D3NA 1EOKA 4AZCB 4HOXA 4UOQA 3SUTA 4AZIA 1V6WA 3WY1A 4F79A 4BZYA 1GUVA 3L4ZA 5ABEA 4IM4A 5IDIA 1GOIA 5A6KA 2VJXA 3SIMA 4PCSA 4CN4A 1Y7VA 5BROA 2YDQA 1UR8A 4AZGA 3AS1A 4Y7EA 2YL8A 3T09A 4GZEA 4HOZA 4V27A 4JFUA 4PMDA 1OB0A 2XM1A 4PN2A 5CPSA 4JZ5A 3AIBA 5EFFA 2WLZA 1E6NA 2ZWYA 8A3HA 3NDYA 2PBOA 2BXYA 1PJ9A 3K8LA 2PWFA 3N17A 3QR3A 2VQUA 1MQQA 1VEPA 2DT3A 4HA4A 3UR8A 1CIUA 1XV8A 1C8YA 4LQ1A 1IZKA 3U57A 4H7VA 5I3DA 3AHZA 4KWUA 4DUVA 7TAAA 5CG0A 5M3WA 3O6AA 2VZOA 3EBVA 4GQQA 5C8BB 1OIMA 3VIIA 3W0KA 3BMVA 3B9EA 1EDTA 4W7WA 4OKDA 1AQ0A 2FDMA 3O2LA 5C70A 1QVBA 5A6LA 1HVXA 3VGFA 3VMPA 1KXHA 4HA1A 5AC4A 2GSJA 3GBDA 1R7AA 2CBJA 3VINA 2ZUUA 3KWXA 1DTUA 2WWCA 4MB4A 3OZPA 2YOCA 3WUFA 3ZJ7A 1K6AA 1KFWA 5AYIA 3WQWA 1E5NA 4A3YA 3L2MA 1KB3A 2W63A 4FLRA 3VDBA 4PUDA 3WNKA 2CETA 3L2LA 1HP5A 1E1FA 1R85A 2EPMX 2BHZA 3POCA 3VKKA 2EPLX 1V03A 3T08A 1J0ZA 1H4PA 3TTOA 1OD0A 3ZJKA 4ZFMA 3GYCA 3KZSA 2FGZA 4HP5A 3WQ5A 1DHKA 3EMQA 3SCUA 5HBFA 1WDQA 3BSHA 2PI6A 3VMNA 1FP9A 1K9DA 1R7OA 4J3XA 1OWQA 3N13A 2YIHA 2XVPA 5IXEA 4Q7NA 1XH1A 4PMQA 1PZ3A 3BCFA 4U3AA 3VPLA 1UKQA 1FFRA 1NP0A 5CGMA 3WELA 1D2KA 1NWTA 3BAIA 2J47A 5I5RA 2F8QA 4PMOA 1EDGA 2DH2A 4LXFA 3MUAA 4H8UA 5BYWA 1M7XA 5A8QA 4H41A 5LA2A 2XJ7A 1ZS2A 1DP0A 3CTTA 5CQ1A 3W25A 1E40A 5M5DA 4AZ6A 3BLPX 3AIRA 4X0VA 1UR1A 2AMGA 4J3WA 4PMZA 2WC3A 4QDMA 3RCNA 1Q6DA 1MXGA 3RPMA 1GCYA 3WMBA 1JFXA 1GW1A 1V6VA 4NSBA 1WZMA 1HP4A 2UY5A 1V3KA 1QHPA 2QF8A 2EPOA 3GTNA 1GQJA 1EO5A 3AMGA 3QHOA 3SUWA 3VD4A 1E73M 3WF2A 3ZR6A 2OLHA 1E15A 2DH3A 1BG4A 1GQIA 1MFUA 5I77A 2E9MA 4GI6A 4TXEA 5D9PA 2WSKA 5D9NA 4FLQA 1VFUA 3BXWA 3UG3A 3I3EA 3SCOA 3BC9A 3OLEA 3VGDA 3NSMA 1J9YA 2ZUWA 3HJEA 5A8OA 1WNOA 1HX0A 2HVMA 3CUIA 3WQVA 1I1XA 4HZ8A 4J3VA 3WBAA 1WPCA 1AVAA 4P7NA 4ZXOA 3TONA 1VF8A 1W1YA 3OGSA 5I23A 2WKLA 5A95A 1CDGA 2DT0A 3ARXA 2V3GA 5A6SA 3CZLA 4XZWA 2ZX8A 1UUQA 6A3HA 5I79A 2ZXBA 2D23A 2FH8A 2XVNA 3AYRA 3NCOA 1JZ5A 2XM2A 2W61A 1JI2A 4NRSA 3K4DA 5BRQA 4JHZA 3WEZA 3SUUA 1E3XA 3EDFA 3CZEA 3THCA 2J7GA 1I1WA 2D2OA 1W9VA 1ITXA 1BYAA 2IXUA 4GIAA 2J7CA 2A3CA 2DPEA 1E4MM 5A2AA 3AHXA 1UR9A 3ZT6A 4PTMA 5E6ZA 4W7UA 1QW8A 4Z2GA 2EPKX 4NZCA 2O92A 3THDA 2C0HA 4AXNA 3AZRA 1HN1A 1W91A 2X05A 3L4TA 4D6FA 4ML4A 3VIMA 1MFVA 3CHDA 1QNPA 1UA7A 4JFWA 2WB5A 1JAEA 2VX7A 1QNOA 3UERA 4GO8A 1CXIA 2DSZA 2E3ZA 4RL3A 3OG2A 1AMYA 1L0PA 2DSVA 3GXDA 2ZUNA 2EQDA 4D6CA 3T0DA 1PIFA 1GOKA 3SUSA 1H11A 3VGHA 2BS9A 2BVYA 2VX6A 2XWEA 4W5UA 4DWSD 4J3SA 1V3LA 1ITCA 4KGLA 2J77A 1UKSA 1IT0A 3WDPP 1DWHM 4HPHA 3N15A 1OGSA 1DWIM 1V0MA 3WIJA 1HNYA 2WCGA 3AIWA 3GNOA 3CBWA 3MUIA 1WB0A 3A6OA 4HZ7A 3VD3A 1FA2A 1JI1A 2J7DA 3AIEA 4D6JA 2V3FA 3APGA 1NH6A 2DT1A 3IAPA 2EEXA 2X2YA 1MW1A 3UETA 1XD1A 4BQ5A 4ZENA 3WNLA 1QI3A 1RP9A 1TG7A 4JKMA 3WNNA 2PWGA 4E4PA 4JFSA 2XG9A 2XVGA 3PZQA 4AYSA 3VOCA 4HOWA 1WP6A 1OIFA 2G3IA 5AC5A 1C90A 1PPIA 2GJPA 2NT0A 4J7RA 1UOKA 4L4PA 2W4XA 4ZEPA 5A8PA 4OJYA 1VAHA 3AXXA 4MAZA 5BXPA 1HXJA 3BLKA 3OA5A 3KEHA 4HMDA 4MB5A 4V28A 2WZIA 3G6MA 4UZUA 1EHAA 1LF1A 2D0FA 1CENA 1PZ2A 2Z1KA 1V02E 1GQKA 3PZNA 3PZGA 3LPGA 3ARWA 4B15A 5D9MA 2VOTA 2VL4A 1O7AA 2J4GA 1KXTA 3ALFA 4WJXA 4HTYA 1E6SM 1IZJA 4GQRA 6TAAA 2WC4A 1B9ZA 1UD4A 5ABFB 3VIFA 1GHRA 3BGAA 2X0YA 3KL5A 5D8WA 5ABFA 5DMYA 3SUVA 1M04A 2VZSA 1JZ2A 4DM2A 2VVNA 4Z2LA 1V3HA 2DQXA 1BFNA 4TTGA 1C8XA 3N18A 1DWGM 2BXZA 3J7HA 3W53A 4QLJA 4TUFA 4WKHA 1B30A 1W1TA 3IK2A 1TA3B 2WVSA 1BAGA 2E8ZA 1TA3A 4AISA 4Z2HA 1BSIA 3WH9A 1OGBA 1US2A 3L4VA 1R8LA 1JAKA 5E6YA 4OOUA 4AW7A 3W38A 4Z2KA 1UWQA 1XCWA 3UCQA 3WFLA 4P7QA 3A4XA 3ARRA 2VURA 1BPLB 4WK9A 1E0VA 3LPOA 4H2CA 1UD6A 2CBVA 3OZOA 3B9DA 5DF0A 4QP0A 1E71M 1H5VA 2BVDA 3WNPA 1ODUA 1V08A 2ZUVA 3ZM8A 4YN5A 4UFHA 2WMJA 4EE9A 7A3HA 1NOWA 2D0HA 5BXSA 1UWIA 1F4AA 4PMNA 3VUPA 3PTMA 3NIYA 4JL1A 4CKQA 2J78A 4A4AA 2DDXA 5I6SA 1JXKA 4K68A 1UWSA 4PMXA 3L4YA 2OYLA 2DEPA 1TVNA 2PWHA 1WDRA 3VM5A 2CYGA 1QHOA 5DT7A 2X1IA 1UYQA 1TE1A 1E6QM 4OBRA 4RE3A 3WF1A 3MV01 5LA0A 4QFUA 5GNYA 2W92A 1QHZA 3VDCA 2WWDA 3AXHA 3CZJA 3AS0A 1EQPA 5A8NA 4W5ZA 2YDRA 3WEMA 2G3MA 4UNIA 4D6IA 2E9BA 3G6LA 2E40A 4PTXA 3W82A 5FL0A 3GBEA 1QBAA 1W32A 4MTVA 4L4OA 4KMQA 5GNXA 3ZMRA 1CEOA 4ATDA 2X8RA 1KCLA 5BCAA 3TTYA 1BYDA 3ZT5A 2QMJA 3GDBA 4AD3A 5ABGA 2GFTA 2JF7A 1J0YA 3ARTA 4AZHA 1D3CA 1V6UA 2DSWA 1P6WA 2D3LA 4PMUA 4UR9A 2WVVB 4DUWA 5AY7A 2OWXA 4DWSB 2WVVA 1OD8A 1UH2A 2BY0A 2WANA 4X0NA 4DWSA 2WVTA 3MV11 1DWFM 2J25A 1TVPA 3QHNA 4W84A 3VIHA 4D72A 4W89A 3CGTA 3VD7A 1B90A 3SCTA 1HIZA 2OSWA 4CN1A 3AIQA 3N1AA 4JHOA 5DEZA 5A2BA 1CTNA 3FHAA 2D20A 2PC8A 3RO8A 4M56A 2YA0A 5GNZA 3U5YA 5CPQA 2UY2A 3HU7A 3AXIA 2VMFA 5LA1A 2VT0A 2DSUA 5IHSA 1H0GA 3DC0A 2HISA 2W66A 1GOMA 4JIEA 2J7FA 2C8NA 4W86A 4D71A 4B16A 2YL9A 1B3XA 1JYWA 3IANA 1ZJBA 3BAJA 3ARPA 3RJYA 2ZE0A 2NT1A 1CXLA 3VIOA 1HJXA 2X09A 2WMIB 3EMCA 2WMIA 1CXFA 1B1YA 4YHGA 2EO7A 1BGAA 4S3KA 3GNRA 2ZXDA 3GXIA 3GZAA 1UR4A 2J79A 1VEMA 4WF7A 5A6JA 4MDOA 1HF6A 1G01A 3K4AA 3WEOA 4HPGA 2BNJA 2YL6A 1JG9A 3BH4A 3D3AA 2ESCA 3W27A 2UY4A 1SYTA 4NF7A 4P7OA 1E70M 4MNMA 3HN3A 1Q6FA 2QPUA 2UY3A 1FH9A 3AIVA 4DM1A 4FF5A 4J3UA 3PHAA 4PTVA 4F66A 1UR0A 3CH9A 2CPUA 4TX6A 3NUKA 4WSJA 5JIPA 2CIPA 2VC9A 1BVNP 3L4UA 3N04A 3AMCA 1N82A 1HKMA 4B9ZA 2J75A 2F61A 4C7DA 3QHMA 1M01A 5TD4A 4JKLA 1Q6EA 1XSIA 4UTFA 1KCKA 4WKFA 4GPNA 2W67A 2ZX5A 1CGYA 1J0KA 2G8ZA 4WLCA 1G9HA 1ISXA 1UQYA 1E0WA 1J0JA 2GVYA 2WM0A 4QCFA 2WVUA 1E5JA 1VBUA 4CD8A 4EK7A 7CGTA 5HPCA 4CU7A 1EO7A 2JIWA 4PSRA 2VX5A 3ARUA 2ZXQA 1BG9A 1W1VA 3WDJA 2QPSA 2Y24A 2CBUA 2XIIA 3WFZA 2IUZA 1NOUA 1HKKA 1QOXA 1CGVA 4P8VA 2J8FA 2XGBA 5DT5A 4UQAA 3VX1A 1VFOA 5AYBA 1GJWA 2QV4A 1OGGA 1F4HA 4RE2A 1WZKA 4CD5A 3WH8A 2E4TA 1MW3A 3VGGA 2BVTA 3CPUA 1ODZA 1SMDA 1VBRA 1ISVA 2D24A 1KXVA 1LL7A 4U2YA 2YKKA 4OZOA 4U33A 3WH7A 5A69A 1VJSA 2VRJA 4CCCA 4WIWA 3FXYA 2GJRA 4CD4A 3F5KA 4UQDA 1UD8A 2NSXA 2AAAA 4GO9A 1VIWA 4IISA 1TCMA 1V3JA 1OINA 1CZ1A 2E9LA 1CLVA 3VDHA 1HVQA 4AC1X 1X6NA 4FLSA 4OOZA 4PTWA 1BTCA 2ZICA 1XH0A 1EXPA 5CLTA 3SCRA 3BAYA 3PZVA 1WKYA 4F8XA 3CMJA 1E4NA 4D1JA 2AOSA 3I3DA 3T2OA 3SCVA 1GPFA 3CHFA 2VRKA 5D9OA 5E0FA 4HU0A 3VIGA 4TTUA 2CKRA 1GQLA 2J7BA 3M6DA 1JFHA 3CHCA 1C7SA 2V5DA 2A3AA 3A4AA 4AD5A 1VFMA 2YL5A 3W26A 2CEQA 2JEQA 3AJ7A 1WZLA 1HL9A 4HA3A 2WBKA 1ESWA 2X0HA 3BAWA 3IJ7A 1QPKA 4AD0A 3VTRA 4TOQA 2TAAA 1B3VA 1LG1A 3NSNA 3GH4A 1GNXA 2V5CA 2GDVA 3WUBA 1WDPA 1E1EA 1HJSA 1PEZA 1C92A 1EGZA 1UZ1A 1LJYA 3OGRA 3W81A 2JF6A 4AZ5A 2CHNA 3NJ3A 1M53A 5E0CA 3WF4A 1RP8A 3M07A 4M80A 2GUYA 1I75A 4E8CA 2FHCA 2G41A 3WQ8A 5HOSA 3SCNA 1MW2A 2JIEA 2WBGA 4OBSA 3MMDA 1UZ4A 3ZSTA 2EXOA 3WH5A 4U5IA 3AHYA 2YJQA 3AMLA 2B31A 1ISYA 3T0AA 1NWUA 2XVLA 3FAWA 4V2XA 1OM0A 3GH5A 1PX8A 1LG2A 1C8QA 3VNYA 1GVIA 1QNSA 2VQTA 2WLYA 4MB3A 4ZXLA 3OLIA 2ZX6A 2CESA 3EDDA 1GOQA 2VNCA 3FAXA 1J10A 1K9EA 4PYSA 1KR1A 4P7LA 3PTQA 4F9JA 2G3NA 3BAXA 4A3HA 4CVWA 3VILA 1V0NA 3KL0A 1GONA 3NDZA 1TMQA 3TTQA 1XGZA 2YA2A 4CUCA 1E6ZA 2FGLA 5A6BD 4KRTA 3ZOAA 4IPLA 2VZVA 4U3CA 4FMVA 4AEEA 1UH4A 1MQRA 1U2YA 2O9RA 4M82A 3IJ8A 3VGEA 5FCZA 3M7SA 1NP2A 3VD9A 2VO5A 2OWCA 2BY2A 4MPKA 3N11A 2DGAA 1XYFA 3CO4A 3T2PA 3TTSA 4JKKA 1BYBA 3VX0A 5E9AA 1MQPA 1C7TA 4M24A 5A2CA 1CPUA 3CMGA 5A94A 2CHOA 4M8UA 1GZJA 5FKYA 4BF7A 1MYRA 4MADA 1HKJA 4PBGA 4CGTA 2V38A 5BWFA 3MSDA 3K1DA 2QLYA 1VJZA 1XRVA 3F5JA 3TOPA 2WPGA 1TZ7A 1H09A 4JAWA 4P8XA 1KBKA 3CHEA 4CCEA 1W3LA 3AICA 1VENA 4FK9A 3RJXA 4DUXA 1XHGA 3AQUA 1V3MA 1KGWA 4WKAA 4UFKA 2BY1A 2FHBA 1H49A 3CUHA 4W93A 1JF6A 1W2PA 3FY1A 1V0KA 1EOMA 1XSJA 3AIUA 1ECEA 4S3JA 1O6IA 3AISA 5CPTA 3KL3A 1R87A 3A4WA 2ZIDA 3W28A 5A3HA 1KR0A 1HJVA 1JDDA 1W9BM 4QAWA 2ZX7A 1VB9A 1J0IA 1G5AA 1UG6A 3WKZA 4H04A 3K46A 1XSKA 1EHNA 1Q4NX 4BS0A 4C7GA 1SMAA 2VCCA 4XX6A 2WCSA 1B3YA 4UQCA 4W85A 3GNPA 1M03A 2A3HA 1FHDA 2WHKA 1A47A 2WHMA 4CCDA 1BYCA 1W2VA 4KRUA 5I78A 3OLGA 3WQ6A 2BFGA 1E6PA 1UWUA 2WMHA 4AIEA 1W9UA 4GZJA 2VRQA 1B3WA 2XHYA 2XVKA 1W9DM 2VR4A 3PZ9A 1JD9A 1RD6A 1OBAA 2XSAA 4XV0A 1U30A 3EDJA 3I3BA 1B31A 1WO2A 3DHUA 2XIBA 3MMWA 1JZ6A 3HMCA 5EB8A 3ZJ8A 1NWRA 2DIEA 1NWSA 3VIKA 3FHQA 2CBIA 1S46A 3AROA 4MJ4A 8CGTA 1WZAA 1XCXA 4TVUA 2QHAA 1QI4A 1V3IA 1GOWA 4NI3A 4QLKA 5EFDA 1CXKA 1ZJAA 3T0BA 1FFQA 2J8GA 5CGTA 1W3HA 2YLLA 3PTKA 2OSYA 1W3JA 2DT2A 1AQMA 1JD7A 2O9TA 1J12A 3GXFA 1H3GA 4YHEA 3DHPA 3RIKA 5JBDA 4H8VA 4QLLA 4AZCA 3ECQA 4B9YA 1KWKA 2WW5A 5HNNA 5IFTA 4FLOA 3L4XA 1CYGA 4UFIA 3VIJA 3WUGA 1Q6GA 1OT2A 1HT6A 3MSGA 3VD5A 3EMZA 4UFJA 3DECA 2OSXA 2ZUTA 5A1AA 1E56A 2CCRA 4GKLA 4D6HA 3II1A 1TFVA 4C7FA 1JDCA 5GPRA 1VEOA 1GVYA 4GI8A 1EDQA 3WN6A 3NSXA 3BMWA 1XH2A 5CJ5A 2G4FA 3AI0A 1UKOA 1V0LA 1G94A 2ZXAA 3RM4A 3DYPA 5F7UA 2JE8A 1UH3A 1ZBCA 2ZWZA 1UKPA 2ZUMA 5D8ZA 3AOFA 2WHJA 4U2ZA 4YPJA 3ZQ9A 4TVDA 3RDKA 2JFEX 4GINA 3WD3A 6CGTA 5I24A 2XUCA 3N9KA 4AMCA 5BXRA 4BQ4A 4PRWA 5HDRA 3MU7A 1C91A 3AS3A 4Z2IA 4ACYA 2E8YA 3OIHA 4PEEA 2CERA 5A6BA 3UR7A 2WMGA 2F2HA 1TUXA 1JYXA 4LX4A 3ZR5A 2Q8XA 2WKGA 3QOKA 3F4VA 4N0RA 1NQ6A 5DO8A 1EA9C 2EPNA 4U31A 2W5FA 1LQ0A 1UWTA 1RH9A 1R86A 2WMKA 3CZKA 1YHTA 3WD0A 3PZUA 5A6AA 4W8BA 4UFMA 4MJ2A 4E8DA 1E43A 1W3KA 4JFVA 4KH2A 3ALGA 1JXJA 1E9LA 4CU8A 4QCEA 1ZB5A 3NYDA 4AWEA 5CLWA 4H8HA 4B3KA 2CNCA 2DIJA 3SEPA 1JZ3A 4URIA 1QI5A 2BV9A 2PB1A 2VUYA 1WCGA 1K9TA 4R27A 4ATWA 3VO0A 3BSGA 1FOBA 3PZOA 1GHSA 2YBUA 3CUJA 2WMFA 2PF0A 1J18A 5IHRA 3EDEA 1JL8A 3PZMA 1CGXA 4EAMA 2J62A 2WZHA 3VDAA 3WD4A 2WYSA 2W62A 3O9NA 5KEZA 4UQEA 5FL1A 1H0IA 1A3HA 4TVCA 3WQ4A 1GORA 3EYPA 4W8AA 1CGWA 1NOFA 1KBBA 1JYVA 3ARVA 4IUGA 5JBFA 4X9YA 3BCDA 3LPPA 1SR0A 2Z1SA 3RMEA 4CD7A 3U7BA 2DSKA 5FIPA 5BXTA 3OB8A 3WDQA 4ATLA 1CGTA
chains in the Genus database with same CATH superfamily
1ADOA 4GI9A 1UMYA 1F6PA 3UBPC 2WZEA 4A3UA 1UR2A 2C7FA 1N8IA 3LMYA 1OJXA 4A8RA 5T91A 3RILA 2E67A 5G4HC 2VEGA 3QMSA 3ARSA 4XUYA 2L5HA 2GJXB 4O0QA 3T2QA 1LLZA 1QI2A 1Z7AA 2ZUSA 4ONVA 2OODA 1T6MA 1X1NA 1H7XA 1BWLA 3LD5A 4UMBA 3AS2A 3DFQA 3LXBA 3UESA 1US3A 1O1HA 3QGVA 4I5UA 5JUVA 3UY8A 4D8LA 3IUDA 1LBMA 2FH6A 2E6YA 2CLPA 3WYZA 1ISZA 1ZBVA 1B54A 4S3GA 2QUTA 4PMVA 3THAA 3SCPA 3M44A 5E70A 2XFYA 3HIJA 3KX6A 3S1WA 5HNTA 1C9DA 3JR2A 3LCLA 3AFBA 4RV8A 1ISWA 3SGZA 1AJ2A 3W7DA 1TUFA 1J01A 3GG1A 2ZBTA 1AW1A 3SURA 1FWHC 3R89A 4ZE5A 2VUNA 4IIDA 1E3ZA 2QCEA 4PMYA 4Q8UA 2OYKA 2V5BA 4AIOA 1W3TA 1W9XA 3L4WA 3W4RA 1QTWA 3SRHA 5LGZA 1A5OC 1Q85A 1W1PA 2EG7A 2D1ZA 4GUJA 3V5OA 2J66A 1XLMA 3AZTA 1WAUA 5KTLA 1EWEA 3RG6A 2XSBA 1YEYA 4UCGA 4AZBA 3CZGA 4LUIA 3I4KA 1E0TA 2XFWA 4O11A 4FO4A 2WSPA 1V79A 1FXPA 4UWMA 3U5UA 2QCDB 4MNKA 4LCQA 1VGAA 4DPPA 3VVGA 2ATSA 4R85A 1X6LA 3WMSA 2PGWA 1D8CA 3SCWA 3K30A 3VE9A 4L7ZA 5IFPA 1U5HA 1A0DA 1MRAA 3WENA 4HNVA 1X8CA 1XYLA 2AAMA 2G95A 3M0HA 4AY1A 5DFAA 3EDKA 4HZ6A 2XSXA 4MOZA 3P0WA 5U7SA 4E2OA 1XXXA 4HT3A 3R8HA 5HPOA 3LM7A 2Y8VA 1L8NA 3BLEA 2R82A 4MFDA 4GI4A 2GSEA 3DYMA 4E3VA 3MUZ1 3FLUA 3CH0A 3RF9A 3S3GA 1XP3A 3BG9A 3FGCB 4XZBA 3CXOA 3IAQA 3RITA 4FNUA 2WQPA 1CECA 2ZVRA 1DEDA 1EC8A 4LS1A 2G0WA 4GUHA 4BFAA 3CT2A 1EJUC 3S83A 3BURA 5D04C 3TWAA 5E1QA 2QCMA 3WF3A 1H2JA 4P7RA 1JRCA 4ZQNA 3T44A 4LY4A 3MMUA 2B4GA 2Y4SA 4LT9A 4D6GA 3KW3A 1RLCL 1JZ8A 4GZIA 3SBFA 4A3RA 3KOZA 3S2CA 3LTYA 4I5XA 3WLSA 3HPZA 4A22A 4LAOA 2PS2A 4F0RA 3WK1A 1QI0A 2CFFA 2PCQA 3TYUA 3PBMA 4WY0F 3B3DA 3EB3A 3O7UA 5C9WA 2DP3A 5CAKA 3GWQA 4KCTA 1IEIA 1PBGA 3S6TA 2GK1B 4LC8A 3C5QA 2Z1VA 1V6YA 3PZTA 4O1FA 4XZ9A 3C0LA 4DB7A 1Y8BA 3MHFA 3PBGA 1SZFA 2Y2WA 1H60A 1JIBA 4TX9A 3KTXA 3PP7A 3CWOX 3E02A 3PB2A 1C3FA 1GK8A 5K9DA 1D7KA 1TV2A 3GAYA 5CSYA 1BHGA 1GOOA 1FUYA 2PP0A 4MPQA 3FFSA 3LPFA 3INPA 1LWJA 4ACZA 4N02A 3OBEA 1XLHA 4Q8MA 4R5EA 3LDVA 3TSBA 4J28A 1OZMA 1XD0A 3QOMA 1TWIA 4W88A 3RU8X 5AVHA 3O0KA 3PFRA 1RJPA 3PSVA 3V35A 1K8ZA 2CLFA 3MS8A 3OLDA 4O0ZA 4TV6A 1I9CB 4GXPA 1AA1B 2GWGA 3V36A 3ZO9A 3TAOA 4CU6A 1MW0A 3W1QA 3W85A 5M03A 3R11A 1B2YA 4N9EA 1Q45A 1TPFA 4LALA 5DQPA 3E74A 1YPIA 1TWDA 3VOHA 3K8MA 3QJAA 4X2RA 3N2OA 5LIKX 1B0IA 4DXVA 4KBXA 2WK2A 1RSCA 4KCVA 1JDAA 2QCHA 1FHLA 3WLRA 3WDIA 4NL1A 3NQVA 3S0CA 1OSEA 4XG1A 3ORWA 1UZHA 1LUCB 3H7RA 1F8MA 5ECUA 1BSLA 1QNRA 2FJUB 4M6UA 1WE5A 4WSKA 4GYPC 4PUEA 3JZEA 1MXDA 2G3FA 5D4YA 1BXBA 1NEYA 3B03A 4DNHA 4KQNA 1EGVA 4H19A 4RXFA 4IGMA 3MI2A 3ABQA 3SUTA 4DJFD 5K7JA 3WY1A 1K4HA 1GUVA 4NY2A 1PZ0A 2PODA 5A6KA 4PCSA 4WHBA 2DJLA 3WBWA 3KVJA 1Y7VA 2C19A 2YDQA 1REQA 6ENLA 4IOTA 2CXEA 2LLEA 3PJUA 4FXFA 4LBUA 4V27A 4PN2A 5CPSA 5EFFA 2Z26A 1EB3A 1KLZA 2BXYA 1PJ9A 3K8LA 2PWFA 5B7YA 4Z42C 3STGA 2Q09A 1V77A 1TPWA 4XBKA 2ZADA 5I3KA 4Q8VA 4H7VA 3IACA 4KWUA 4AY8A 4GHRA 3KXQA 1Q2RA 5C8BB 3H2FA 1E1CB 3SZ8A 3W0KA 3ABXA 3BMVA 1EDTA 4OKDA 1AQ0A 5HMEA 3O2LA 4N4PA 4IH3A 3DFSA 1TPH1 2H6RA 2IPWA 1KXHA 2NQ5A 3T42A 3G1RA 3LZ5A 3DERA 4BEUA 2VWSA 4IHCA 5E5CA 2A85A 4RLIA 4RW5A 3CQHA 3TJIA 3NNTA 1FWGC 3HPXA 1IGWA 4PH6A 3C0JA 1KKOA 3ZJ7A 1R2SA 1E5NA 3CU2A 3AWOA 3B0YA 3HPSA 1JVNA 3R94A 4TU1A 2YX0A 1E1FA 2EPMX 4S2CA 3VKKA 1W8GA 2Z27A 4KWSA 3OA3A 3TMLA 3T08A 3W1LA 1EBGA 3DFYA 3ITXA 3G0SA 4E8GA 3ZJKA 1H7NA 1KBJA 1JCXA 4S2BA 4HP5A 3EMQA 1XIIA 5HBFA 1DYSA 2GQ3A 3VMNA 1W31A 3EEGA 4H4IA 2DIKA 2RKXA 4XKYB 3N73A 4XIMA 2XVPA 4R9XA 1VQTA 4KPLA 3BCFA 4JOMA 3SR7A 1H7RA 1UC4A 5CGMA 3B4UA 1NWTA 3BAIA 1Q13A 2DH2A 3K5XA 4HPJA 3OOQA 3PUEA 2XJ7A 3W7NA 1S38A 4O1EA 4GA8A 5M5DA 4LUJA 3BLPX 3AIRA 4LVGA 4RNJA 3DFNA 5CH9A 4J3WA 2E25A 2WC3A 1EEPA 3GR4A 4FAMA 4IGNA 2X1SA 4X63A 4ZL1A 3RAOA 1MXGA 1VRDA 2ZZ7A 5F2IA 3RPMA 1PKMA 1MDLA 3KOXA 3SADA 2HZGA 3NL2A 1EO5A 3LN3A 1E73M 3BLOA 4GY0A 4HIBA 4C6DA 1BG4A 4HJWA 3UG8A 4GI6A 2FZNA 5D9NA 3P0XA 2Z4GA 3MMTA 3GDTA 3LLXA 1YW1A 3SCOA 4DJDD 4BEQA 4NQ1A 1EJTC 1XPYA 1ADDA 1SW7A 2ZUWA 1WNOA 3H6OA 3VFLA 3C61A 4ZXOA 4PL2A 1DIEA 1CDGA 4P61A 3C0QA 3GIYA 2QCCA 2ZX8A 5DMMA 5I79A 3RGTA 2D23A 3G3MA 3RR4A 1GTEA 2XVNA 1EUAA 3AYRA 4HHMA 4NX5A 4C1NA 1IXNA 2PZNA 2NQLA 3UWVA 4O1BA 2G50A 3K4DA 2OX1A 3DX5A 3UXDA 3WEZA 3SUUA 1E3XA 1GGOA 3THCA 2J7GA 3MA8A 1I1WA 4JQ3A 1QWGA 1BYAA 3L5MA 2J7CA 3R0UA 2A3CA 2DPEA 3RCMA 4TR9A 4PTMA 3U3HA 1I4NA 4NZJA 3WLIA 3W02A 1JCLA 4GC3A 3LCXA 4JN8A 3EXSA 2HV5A 2C0HA 4R53A 2B7NA 3L4TA 2HMCA 2QJJA 4XD5A 3VIMA 4RXGA 1DIOA 4V33A 4XUGA 3OZYA 1QNPA 2A79A 3UERA 4GO8A 1XIFA 1CXIA 2DSZA 4RL3A 3NQCA 4LFYA 5FJPA 2QJNA 1S5NA 3U6WA 3QH2A 2ZUNA 2ABAA 2C1HA 2C0AA 3SRDA 3T0DA 2PDPA 1PIFA 1GOKA 4FX6M 3SUSA 1UBPC 4K37A 4J3SA 3BQ5A 3WDPP 1J96A 1YNQA 2QDGA 1V0MA 3WIJA 4LC6A 1JPKA 3A6OA 3APYA 5CPOA 3VD3A 1JCNA 3AIEA 1Q6QA 1MZHA 1NH6A 2X2YA 3C2FA 1PZ1A 3CASA 1MW1A 1QPRA 1XD1A 4FF7A 4BQ5A 1BTMA 1P0EA 3WNLA 1TG7A 2E5DA 4UB9A 1YPXA 2XG9A 2XVGA 3N9SA 3PZQA 4AH7A 3VOCA 1VC4A 2TRSA 4IFOA 3V3WA 4UTTA 4IIEA 4OJYA 5FJUA 2RDWA 4S1FA 3AXXA 4RUBA 2EF9A 3CQ0A 1XIDA 4NILA 5CG7A 3RCYA 5AC7A 1A0EA 1M7OA 4HMDA 4MB5A 4ZTXA 1GQNA 4V28A 3BJTA 1FCVA 1EHAA 1LF1A 4DO5A 1P48A 3NZGA 4RZ6A 4GUIA 3ABOA 1QPNA 3LPGA 4HYWA 3ARWA 4B15A 1X1OA 5D9MA 2PURA 2VOTA 3E96A 1KXTA 3AUJA 2NUWA 5EGRA 2O7QA 3V16A 3BOFA 3G1HA 3E49A 2WC4A 1JRBA 1B9ZA 3LGEA 5ABFB 1K7EA 3WJWA 1R9ZA 4ERGA 5EL1A 1ECQA 1Q5MA 5DMYA 3SUVA 4FP1A 3NVTA 4Y8FA 2VZSA 4PTNA 2VVNA 3IGXA 4Z2LA 1KFEA 5M2FX 4M6VA 1BFNA 4WDWA 4TTGA 2X7WA 2ZA3A 1WKEA 4DBWA 1W1TA 3IK2A 4M51A 1US2A 3BCJA 1XYCA 1DTNA 1GW9A 4AW7A 5I03A 3I7SA 4M6PA 1XCWA 3UY7A 2BSLA 3TW7A 2YR1A 4P7QA 3A4XA 4DJDA 3SIZA 2VURA 1BPLB 5FF2A 1ITUA 3OTRA 2CBVA 3IUHA 4K7YA 1IF2A 3B9DA 4PBFA 3USZA 2HNHA 1GEHA 2OVLA 3E0IA 3W1NA 1ODUA 1V08A 3R7MA 2ZUVA 5AB3A 4BI7A 4YN5A 3GHSA 2REQA 2Y85A 3VFCA 3LB0A 4KCWA 3NIYA 2NV1A 4A4AA 5I6SA 1JXKA 3P2VA 1TV5A 1TVNA 2DEPA 2CYGA 4Z08A 1N2VA 2GVJA 1XWYA 1XW8A 3IS4A 1Y5WA 4ORIA 4OBRA 3SO7A 3CQIA 4WY0A 1O68A 3F1QA 1T5AA 5GNYA 1H5YA 2A6LA 1EJVC 3BMXA 3LTPA 1RJQA 4YTTA 1QHZA 1MEWA 3VDCA 3NPVA 3DHDA 4LUYA 4JQAA 1S2AA 3GR8A 2QUUA 2YDRA 3NM3A 2P1FA 2GLKA 3G6LA 5FL0A 1OFQA 3GBEA 1W32A 1VLWA 1M5WA 4MTVA 4KMQA 1TSIA 4HA0A 1KTBA 3LHWA 1ZFJA 2X8RA 1KCLA 5BCAA 2Z2AA 4GX9A 5FACA 1SR9A 2ZRUA 5HATA 1TWZA 3GLCA 4Q8OA 4QSFA 2F7FA 1XQKA 4UR9A 2I9UA 3CHVA 4N6FA 4DWSB 3PF3A 1FDZA 2BY0A 2YW3A 2WVTA 3MV11 4W84A 3VIHA 2FGBA 1RAKA 3NXLA 1C29A 4D72A 3T4CA 2HSAA 1SU5A 1B90A 2CLMA 5A2BA 3N1AA 3JVAA 3RRAA 2D20A 2GUBA 2XZ7A 3RO8A 2YA0A 3U5YA 2UY2A 1JCTA 3LI0A 2GL5A 3C56A 3CC1A 2CLOA 5LA1A 4GGBA 5EMLA 5AC8A 1O5XA 1H0GA 4AY7A 1GOMA 2BP1A 2HVNA 3IIZA 3RXZA 4B16A 5HWNA 4GIEA 1TRIA 1DKWA 2PRLA 1U83A 4IPPA 1HJXA 4F2TA 3GFXA 2WMIB 3QZ6A 1U5VA 4S23A 8RUCA 3EEZA 1ZNNA 4QJ3B 4S3KA 4ZZ9A 1YNPA 3GXIA 1DQXA 5A6JA 2VD8A 2XH0A 1UC5A 1HF6A 3QGAC 2FZDA 3K4AA 3B0VC 2BGNE 3QSRA 1FWAC 1QO2A 4FIQA 4GJ1A 2YL6A 4MWAB 2YCJA 3QV7A 2V5LA 2Z29A 4H1ZA 4AAJA 1JPMA 2PMQA 1SYTA 4NF7A 2VENA 4Q8TA 4MNMA 3HN3A 1LYXA 4N9BA 3IVTA 5C9XA 2UY3A 2ZFAA 1KA9F 4DM1A 4PTVA 4F66A 1UR0A 4TX6A 1O12A 3W2NA 1R30A 3GG0A 1HKMA 1OFAA 2J75A 5I3FA 3VABA 3QHMA 5TD4A 5TAOA 3ZZ1A 4JKLA 1QR7A 1Q6EA 3O15A 2HNEA 2PDXA 4UTFA 4NZ5A 2W67A 2ZX5A 1EJXC 1S2CA 4IFRA 2DFAA 1VCGA 2G8ZA 4CNNA 2J8TA 2QGYA 3EAUA 3QQ1A 5K4XA 5HUPA 3VAVA 2CLLA 1J0JA 3G1AA 2WVUA 1E5JA 1VBUA 3NL6A 3L23A 2QXWA 1PWMA 4RZBA 2VX5A 3MJMA 4NZFA 4O18A 4NI8A 4NU7A 1W1VA 2Y24A 3EWCA 1MRQA 4EXBA 5LIXX 1CGVA 4PCFA 2J8FA 2P50A 4UBPC 2P10A 3SY5A 1VFOA 5AYBA 1CLKA 1Y5XA 5FF0A 1YDNA 1OGGA 4LVAA 3OO2A 1WZKA 3R0KA 1TTJA 4C6MA 3CPUA 4H6KA 1ODZA 1VBRA 1R47A 3UXLA 3V75A 4ZQCA 4EAYA 3B8UA 4OZOA 4U33A 4KEMA 3N19B 4WIWA 4EOUA 3UJSA 3RR1A 1RXOB 2ALRA 4B4HA 2GVGA 1RA5A 4NJJA 2VFDA 1TCMA 3HZ3A 1OINA 2HK0A 1CZ1A 1SSDA 4AC1X 1VFSA 3KRZA 2NVAA 4P5UA 1FWRA 2ONEA 9XIMA 1XH0A 4H6EA 1EXPA 3UT0A 3HA1A 5D9OA 4H6RA 4MLJA 3VIGA 3DFPA 2PF8A 3SW6A 1OCNA 2X42A 4GISA 3A4AA 3E5PA 2QNEA 2YL5A 3W26A 1FHUA 5G2HA 3P67A 4C6FA 5B7ZA 3OVPA 3A9BA 2XN1A 1WZLA 4YXGA 4A21A 3N6QA 1HL9A 4HA3A 4O54A 1WUFA 4DI9A 2JGYA 3BAWA 5DY3A 4HNCA 3ATYA 4MY9A 4AD0A 3VTRA 1B3VA 4XZMX 5FSDC 4IPIA 2PRMA 1GNXA 1OF6A 3CPRA 4F0LA 4LBSA 4NG3A 3W3OA 1WDPA 3WUBA 5LHEA 1HJSA 3QZEA 1PEZA 3PWGA 4GY7A 4Q6JA 1LT8A 2FLIA 1H7OA 3TW6A 3I6TA 1OK6A 3BGJA 4AZ5A 2CHNA 5K2ZA 1X7IA 4AWTA 3CWNA 2G41A 3SY1A 1XBZA 4IL0A 2BMBA 2WBGA 3QGKC 4CQCA 1WXZA 4DI8A 3MI3A 4ROPA 4UTHA 1S3TC 1VHNA 1LORA 1NWUA 4QS6A 4C6NA 4R33A 4OVXA 3E2QA 3L0NA 1C8QA 3UF9A 2MUCA 1GVIA 3GVWA 1PTDA 4ROQA 1ZLPA 2CESA 3EDDA 5G1MA 3FAXA 4JTQA 4WDUA 3PTQA 4GWEA 1F74A 2WNQA 4B90A 2Z00A 4WQ6A 3MC5A 5U4NA 1TZZA 1TMQA 1TV3A 2NV9A 1E6ZA 3GNNA 4LEQA 3EZ4A 2X41A 3ZOAA 2FPTA 4U3CA 2BXVA 3V1PA 2J6VA 4Q8WA 1RJRA 4UR8A 5AN7A 3G22A 3M7SA 2VO5A 1GVOA 3N4AA 2DVUA 3TZFA 4LVDA 5C9UA 2A4AA 5E9AA 1MQPA 1CPUA 1EA0A 3F4WA 2PTWA 4Q8NA 1UASA 4PBEA 5FKYA 2PCEA 1S2UA 5HINA 3UA3A 4CNOA 3T07A 2X0SA 4BF7A 3H2NA 5AC6A 1OVDA 4MADA 2ALDA 3M0XA 4ZOCA 1VFLA 2QIWA 3W7LA 3MSDA 4Y96A 1VJZA 3DBPA 4FNSA 1WXYA 4NNAA 3QLDA 1PDYA 2R24A 3ITGA 3C2VA 2J88A 1OG0A 1NFBA 1GVFA 5CZJA 5AHLA 2BG5A 4PC8A 3UW6A 1V3MA 2BY1A 5TF0A 2AGTA 1EJ7L 1FWSA 1V0KA 3R6IA 2G5WA 4EWJA 2J13A 1WA3A 3MJYA 2NX3A 4S3JA 5F1VA 2KX9A 1G7UA 3EX2A 3RX2A 3AISA 5EU9A 3TLLA 1BRLA 1R5YA 3GC2A 3UXAA 1W5PA 3PPCA 5HK4A 2PTXA 3FKKA 5A3HA 3NPUA 3MQTA 4ADTA 1VB9A 1J0IA 1G5AA 1B4KA 4H04A 1Q4NX 3DHFA 3N29A 4IQEA 4NAEB 2B0MA 2Q02A 5AKQA 1B3YA 4MZYA 2TSYA 5CPMA 2WHKA 2WHMA 1A5AA 1W2VA 1KD0A 3WQ6A 2H9AA 1UWUA 2WMHA 4AIEA 3LV6A 5AYYA 3HFTA 1Z44A 3NZ1A 4INFA 4DVOA 5DCDA 1DJHA 4YNGA 1KCXA 1OBAA 4YIWA 3EDJA 4FS9A 2PDUA 1R3VA 1WO2A 3DENA 3DHUA 1JZ6A 2NX9A 2ZC1A 3SQSA 5BWAA 4I9JA 2F6KA 3MYPA 3MY9A 3DGBA 3MUCA 5LHFA 1V3IA 4NASA 4IMAA 1XIHA 1ZJAA 1QNVA 3PANA 2J8GA 2TPSA 2YLLA 3PG8A 1W3JA 4YU1A 3OW1A 1SJAA 5D38A 5JBDA 2XISA 4F40A 4EPBC 3ECQA 1ZCOA 4B2DA 3TH6A 1KWKA 2WW5A 1JJKA 4FLOA 4C5YA 3QY8A 4FA3A 1VLIA 2VFGA 3ZS4A 2OO6A 3VIJA 3BANA 4YLWA 2ZYFA 3VD5A 1XI3A 3EMZA 3DECA 4HD5A 4US5A 5A1AA 2R1NA 3QSTA 4ZO8A 1WYIA 2OCZA 2E5CA 2QS8A 1JDCA 5GPRA 1I45A 1XDMA 3G1XA 4AUBA 1EDQA 2V0TA 3EA3A 3H55A 1D3GA 2YCLA 5D2XA 5CJ5A 1HFBA 5FJIA 1V0LA 2ZXAA 2Y63A 5F7UA 4HNUA 4YTRA 5M1TA 4G1KA 4U2ZA 3ZQ9A 1S3HA 3K4WA 5BXRA 1Z8AA 4PRWA 3UPMA 5T9CE 3DZ1A 4WVXA 3EKGA 2V68A 3UYCA 3I7QA 4I8YA 4QBXA 2O4MA 4J3ZA 3TA6A 3OQ8A 1JYXA 4LX4A 2ZQ0A 3F4VA 4WDTA 1M65A 1Q7ZA 1UWTA 1RH9A 4ZSTA 2WMKA 3CZKA 3IGHX 5H8PA 3KFTA 3NQFA 4UFMA 2VHLA 4BWLA 3VYLA 4A8IA 5XIMA 4BI6A 4GNVA 3IGUA 1JCMP 1MEIA 1ZB5A 3ID7A 4AWEA 1HGWA 3UWQA 1TIMA 2CNCA 1OX4A 3VUSA 1QI5A 3CWHA 3S2LA 2PTZA 3RX4A 1P43A 1DV7A 4JD4A 4OV9A 3N2XA 5G2IA 3CAWA 1FOBA 2YBUA 2WMFA 1J18A 2GDQA 2PP3A 3WD4A 4J5NA 2VKZG 2YB1A 2WYSA 4JIRA 2W62A 2R6OA 2WPBA 2OR2A 2CZVA 3E12A 4C6BA 4GVGA 4E38A 1SW3A 1IWAA 5CAHA 3SGUA 3NQBA 4K6AA 1TJRA 4C60A 3LM3A 4MIMA 4X9YA 4LV9A 2XGZA 5FIPA 3OP2A 1XYBA 7REQA 1RCOB 3WDQA 3MDWA 1CCWB 1S5MA 1CXHA 4LPCA 2E09A 3PNZA 4OIFA 3PB0A 3WNOA 4GC4A 1DXFA 2GQAA 4TX8A 4DLFA 1G6CA 4CNTA 4EANA 2V3DA 1YDYA 3AWNA 5F1UA 4W87A 2GJXA 2WAGA 3YPIA 1PCWA 4UFLA 3TZNA 3BG3A 1DJWA 2OKTA 3P61A 4JS3A 2UV8G 2BLEA 4GYKA 3ZWSA 1UD3A 2D22A 3CLWA 3Q58A 4Q4PA 2GGEA 2OFJA 3VU2A 2ISSA 1TV7A 3E2RA 5E09A 1BQCA 4ICNA 1HTIA 2P8BA 3RPTA 4EF8A 2A7PA 4GH1A 4AF0B 1EF2A 3OBAA 4YS1A 3R25A 5MHBA 3DYOA 4EXQA 1NVMA 1CX9A 3FW6A 5KZ6A 4I7VA 1V6XA 3RM9A 3VM7A 4XB3A 2RGLA 4B5UA 3M16A 1JNDA 2VR2A 3HFYA 1D7FA 3V5CA 1I2OA 3QMTA 1OCJA 1JF5A 4KRZA 3A47A 1XYZA 3GSMA 3GG7A 2FB2A 1R9YA 1DJIA 4JTLA 3V7PA 5EMYA 3MUY1 2BX7A 5J8LA 1ITQA 3CIVA 2OQLA 3U0HA 2J74A 3VC6A 2QCDA 3S2NA 2VR5A 3KAOA 1BVZA 4M1BA 3WD2A 1G1YA 2A3EA 2XTKA 1Q6CA 4MYAA 3SJ3A 3GHRA 2WXDM 5K3VA 3XISA 1QOPA 2O9PA 3U48A 4W8LA 3U2OA 5HAOA 3MKKA 4MDPA 3UXKA 5A6MA 1X97A 2W91A 4D1IA 3ES8A 5DANA 1CB7B 3D5HA 2HBXA 3Q37A 4XVDA 1CWYA 3UPWA 3FGCA 2OJPA 1Q6LA 2BGSA 2JEPA 4NRRA 1R2RA 5DRCA 4ZCWA 1OT1A 3OGVA 3R13A 3ENLA 3SB0A 4FZIA 1DWAM 2BY3A 1PTAA 1WBJA 2AQOA 5L6UA 3UG4A 4RDVA 1JYNA 1NM9A 1XLAA 4PMRA 2IXVA 3WDHA 3URNA 4OE7A 4EP8C 3B9AA 1GKQA 4JICA 4X9SA 4PB3A 2A3BA 1LLOA 4QE5A 4JTEA 4C6IA 5BRPA 1DOSA 4JCMA 4O16A 1UHVA 5HQMA 4IMCA 2EAWA 4OQVA 2GGJA 3LG3A 2VGFA 4Z1CA 1E6RA 4OHQA 2H8XA 3PBUA 2FHFA 3IIVA 4EKJA 2EG6A 4M6QA 1VFFA 1RCXB 2I14A 2ZZ5A 3ARZA 4MGGA 4C90A 5HMFA 4GD0A 4GGHA 4X61A 4S3AA 2GK1A 2INZA 1K8YA 2ZA2A 4D6DA 2ZOXA 2EBNA 2GGIA 3WLJA 1JDFA 1WOAA 2GQ9A 3M41A 1VHCA 3AYTA 3HG3A 2R1KA 2EJAA 4RE4A 5I2UA 1B3ZA 1DWJM 1V6TA 1ZTVA 3CL6A 3UXIA 1EP2A 3LLFA 3BE7A 1C93A 3C52A 3WL0A 1RK6A 3ARYA 2PDNA 1E72M 2PDFA 1EJWC 2ZE3A 1Z32X 4AD4A 1CXEA 2ISFA 3KM8A 3QBUA 3GVRA 2AL1A 2ZKMX 3B0PA 3NYZA 3SQMA 4Y9AA 4UQ9A 4DO4A 3WQDA 3GTFA 4IP5A 4QDWA 2F2KA 2GVLA 4N42A 1YQ2A 1NARA 4K8HA 1XS2A 3GVQA 3WBXA 5BOFA 2UBPC 4V1YA 4ZBCA 4J4KA 5AZ1A 3SGGA 5FD0A 5IM51 2J27A 1E4IA 9CGTA 1AL7A 3UG5A 1MXSA 3M9YA 2QT3A 3H70A 1GJUA 1PX3A 3H26A 1PX4A 2DW7A 2VVSA 5D2TA 3HGOA 2WCAA 1H1NA 3K8KA 3S1VA 4EIVA 4XAZA 1PIGA 1QASA 1S1PA 3B8SA 4JPGA 3CL7A 2BHUA 4O17A 1UD5A 4GCXA 4JL2A 1VYPX 4QDPA 4QHRA 4TO8A 3JS3A 3WNMA 1JZ7A 1O1ZA 3H23A 4DYEA 1AQHA 4F0HA 3V0TA 1CLXA 4IL2A 4AD1A 4K7VA 1JCYA 2VZUA 1Z9AA 4LGXA 4YWIA 3LCGA 1J0HA 4GBDA 1LUCA 4DX3A 4PULA 1UQZA 3VMOA 5CC5A 3TC6A 1P6CA 1A5LC 1W0MA 2FMOA 5JBEA 1V02A 1F07A 4H8NA 4L4LA 4JNYA 2V3EA 4C6PA 1YDVA 5C5YA 1DHPA 4K1WA 4AZCB 4HOXA 3ABZA 1OYCA 1UPPA 1Q4WA 3DG7A 1V6WA 1NU5A 2PDGA 4I5RA 4BZYA 6TIMA 1GOIA 7XIMA 3SIMA 4IT1A 1NAL1 3W7IA 1FWTA 3BZGA 5BROA 4I9AA 3TQVA 4J40A 1G4PA 1JPDX 2E6AA 2YL8A 4R7JA 2OQYA 3T09A 4GZEA 4DJEA 4XTIA 4JFUA 4PMDA 1OB0A 8XIMA 1W54A 1R3YA 3IRDA 1S5WA 3DBNA 1E6NA 2ZWYA 2GYIA 1MUMA 3NDYA 3BUVA 1K4GA 3KBMA 3S4TA 1GG0A 1VEPA 1XINA 3C3NA 1H63A 3IIXA 1IZKA 1YXDA 5KMYA 4E4FA 5M3WA 1T99A 2VZOA 3EBVA 3M43A 4GQQA 2NV2A 1DQUA 4UTLA 3VIIA 1Y0EA 1E1CA 1LRNA 2I5GA 5A6LA 1RA0A 4HN8A 3VGFA 3VMPA 4JR5A 4HA1A 1YE4A 1M3UA 5AC4A 4ZGYA 3LNMA 3WLPA 3VINA 2QCFA 2JQXA 3R4IA 4MB4A 5LNRA 2NXIA 1IGSA 2QJHA 5T9BG 2ZTJA 3QF0A 5C2GA 2YOCA 4I6KA 4QNWA 3WX7A 3E2VA 3W7CA 1K6AA 1SGJA 2HS6A 1AMKA 5IBXA 3L2MA 3A3XA 4HSHA 4PUDA 1SPQA 2J9YA 3P8JA 1R85A 4JY9A 4O1AA 3NEVA 3S5YA 3KDNA 1J0ZA 4M5PA 1QOQA 5EMJA 3LCHA 4Z0SA 3GYCA 1J6PA 4KEVA 2C14A 1L6FA 4EPDC 2PI6A 3KOWA 1FP9A 3FJ6A 1K9DA 1TPDA 2CLIA 1K6WA 1R7OA 2PUZA 2OZTA 3N13A 4XKYA 4NZ3A 3ABRA 3T05A 3QC3A 3VPLA 1UKQA 4EXAA 1NP0A 2IS7A 4GFIA 1D2KA 3LMZA 2R1MA 1NF0A 1PL9A 3ITCA 4OFCA 4LXFA 4JGDA 5BYWA 1M7XA 5A8QA 5LA2A 3HG4A 1ZS2A 5CQ1A 1OQFA 4QIUA 4XBSA 3ZLFA 2ODOA 4JTGA 1W8SA 4FI4A 4IMEA 3GY1A 4GLEA 3FDGA 3RCNA 4QDMA 1E9IA 3HPAA 2C71A 3VNDA 3REQB 4A8NA 1JFXA 1GW1A 2VC6A 4RX0A 4JQ4A 1TPEA 3HQ1A 4LAUA 5I3JA 1HP4A 1V3KA 1QHPA 2QF8A 2YZRA 3WCZA 1OX5A 1OK4A 3OHIA 5AYXA 4DXXA 3SUWA 3QHOA 3EB2A 2OLHA 5F2MA 4Q7BA 2DH3A 2I7GA 4AB4A 5I77A 4XO7A 3CQJA 3N3TA 1K3UA 3UG3A 4C6JA 2VDIA 3OLEA 3VGDA 3NSMA 3FYPA 2OEMA 3B06A 4JEQA 3HJEA 4DZIA 1GYNA 2HVMA 5GJMA 4K8EA 3CUIA 4KEZA 2E1DA 1I1XA 1F3XA 3W84A 3TK7A 4C5ZA 1YPFA 1VF8A 3L5AA 1KRBC 3OGSA 5A95A 4BY3A 3KVLA 2V3GA 3VKJA 5A6SA 4XZWA 4F2BA 3HJZA 1UUQA 2ZXBA 1R38A 2F6UA 3F4CA 2FH8A 5HMSA 2GJNA 2NWRA 2XM2A 1LRQA 1SJDA 4NRSA 4NXSA 5BRQA 2PDYA 1TRDA 3NURA 1SO5A 3HM7A 4FR6A 2D2OA 2IXUA 3TFXA 1LOQA 2OOGA 4YL2A 4MHBA 3TIMA 3CUZA 1POJA 4ICMA 1ALDA 3THDA 1RCQA 4AXNA 4DBSA 1ME7A 1HN1A 5FSEC 1W91A 1XM3A 5FJOA 4ML4A 5CPNA 1MFVA 2NLYA 2WB5A 3BWWA 2ZRYA 3A3WA 1QNOA 2HWGA 2E3ZA 4XAFA 1IXOA 1RY0A 1L0PA 4PUWA 3H2AA 1UP0A 5AFDA 2OZ8A 3TJLA 1LTDA 1H11A 1XYAA 2BS9A 1XKYA 2VX6A 4W5UA 4DWSD 1V3LA 1ITCA 4Q33A 5FAJA 3MVIA 1FWEC 1IT0A 3B8IA 2PLJA 1DWHM 3GKFA 1ZP3A 3BLIA 3ITLA 2RFGA 3GNOA 4WSHA 2AGKA 1F7BA 1VPQA 1WB0A 4JBRA 3RHGA 1FCQA 4HZ7A 1FA2A 4F4RA 3APGA 3NPWA 2DT1A 3IAPA 2EEXA 1GPWA 3UETA 2G97A 4FX8A 4L80A 2QDDA 1QI3A 1DORA 4JKMA 2PWGA 4E4PA 4A35A 3C4UA 1AQFA 4PUJA 4AYSA 2H3BA 1WP6A 1VD6A 1XLEA 5AC5A 1ME9A 3C3UA 3VOJA 2NT0A 4J7RA 4L4PA 3T0TA 5A8PA 1IWPA 3KVMA 1OCBA 1S5VA 5BXPA 3TXVA 1PDZA 3IGSA 3PUDA 1VJIA 3VKDA 4YYFA 2DQWA 3FVMA 5E9XA 1CENA 1PZ2A 2Z1KA 3N6HA 1A5SA 2PFHA 5CBJA 3PZNA 3PZGA 4UTUA 2Y1HA 2VL4A 2J4GA 1GTHA 3WQOA 2DVXA 3C8NA 1J2BA 1N7KA 3P81A 4WJXA 3KLLA 1IZJA 1I6NA 1MNZA 3NG3A 3E9AA 3MKVA 5ABFA 4MWAD 5IDZA 1OYAA 3GX9A 1UBSA 3LHYA 3ITVA 1TV4A 5BOEA 1PE1A 3TR9A 3A5VA 2DZXA 4QM1A 3J7HA 3C6CA 4QLJA 1MEHA 1B30A 2B7OA 3FJLA 4H9UA 2E8ZA 1LOLA 3BV7A 4Z2HA 4Q4QA 5T26A 5D32A 2GGHA 3L4VA 4JY8A 4AWSA 4PEKA 4F0SA 4Y8EA 4DRSA 1CW2A 1WXJA 4K36A 4RW3A 4IJRA 1R2TA 3ONBA 3PUOA 3WFLA 1NDWA 3OODA 4XWUA 4JQ1A 1W5MA 1TR9A 3ZR4A 1ZJHA 2VD9A 3MUXA 4GKTA 3OZOA 1EP3A 2DZPA 1PXGA 1E71M 4BHYA 2BVDA 5FA5A 3ZFHA 3VNMA 2ISDA 1ZY9A 2XN0A 3RRXA 4GABA 5BXSA 3QRHA 1IEVA 3QW3A 1RR2A 2FMNA 3SI9A 1IXQA 1ICPA 1DJGA 1YADA 3QY7A 4K68A 2NSOA 1LROA 3L4YA 2OYLA 3VM5A 2DU2A 2X1IA 1UYQA 1TE1A 4MG4A 1E6QM 3VKCA 2D2JA 3RLUA 1ONXA 4MKNA 2IKHA 3WMLA 3B8WA 4QFUA 4Y90A 2HJPA 1I2QA 2HS8A 3KDOA 5D33A 2WWDA 3AXHA 3CZJA 1AH0A 1EQPA 3LHVA 5A8NA 4W5ZA 4MWAE 4QITA 3WEMA 2G3MA 4YCOA 5BZAA 4D6IA 4LS2A 4C1KA 1UP2A 3NPXA 4RK8A 2E40A 3DC8A 1QBAA 3LCWA 1EKOA 4L4OA 3GVGA 4F2UA 3F7JA 3VE7A 2D2GA 2NXGA 1BYDA 3BLFA 3ZT5A 4IPJA 2VEPA 1YX1A 3P93A 4AD3A 1DXEA 5GJPA 4LYKA 2JF7A 2CHRA 3GTXA 4AZHA 1ZJIA 1V6UA 1EGMA 1F3EA 2DSWA 1V8EA 2WVVB 3M0VA 4DUWA 5AY7A 4B5WA 1A5MC 1ZP4A 2X16A 4KFNA 1GZGA 4DWSA 2R14A 1HO4A 2J25A 3T7VA 3PVFA 3KBWA 1MO0A 1W5NA 4ZB5A 4W89A 4DY1A 3SCTA 3TN6A 3WJXA 1P0BA 2OSWA 4JHOA 5DEZA 4ZR8A 2PC8A 3CAQA 5GNZA 2C18A 2X1TA 3AXIA 3PJXA 2TODA 3EA1A 3QR1A 3GQYA 3M4HA 5KSWA 1UWAA 4FNRA 1Q66A 5EBUA 3DCPA 4C6OA 3FEQA 2ZCGA 3U4AA 2HISA 2P76A 4D71A 3B0XA 3D3FA 4ZOEA 1YIXA 1O5KA 5H91A 5HR7A 2ZE0A 4E6MA 4XISA 3NDOA 2NT1A 5FJTA 3VIOA 1UJQA 1BKHA 2WMIA 3MCNA 2Y5JA 1CXFA 3CIWA 1B1YA 3TQ0A 3LGGA 2E6DA 3H4GA 1R3QA 4FOJA 3TROA 1EJRC 1VEMA 2YPIA 3TNBA 4IFKB 4MDOA 3G1FA 3WEOA 4HPGA 3TYAA 4KT2A 3JW7A 4GNKB 2PDLA 4GIRA 2FYMA 3MI6A 3LERA 3W27A 4FB7A 3NO1A 1TJ0A 4P7OA 1E70M 4IIBA 3CAKA 5JU6A 4HHHA 1DIDA 1NJJA 3QYSA 3G8EA 5JIPA 4WSJA 2CIPA 4ERAA 4JNMA 2I5QA 3AMCA 4B9ZA 2F61A 4C7DA 1M01A 1OABA 1VBHA 3CEUA 4GPNA 5GVJA 4WLCA 3G8RA 2AQWA 3LGDA 2JBMA 3TJXA 4A6GA 2KAUC 4JDYA 4PGLA 4QAIA 1UQYA 1E0WA 2GVYA 2VDGA 1XF0A 3U2CA 4CD8A 1SZGA 4QG9A 7CGTA 5HPCA 4PCPA 4CU7A 1Q3NA 2WSYA 3N6JA 3ARUA 4NHVA 2QPSA 2IUZA 3LLDA 5LXEA 1HKKA 4PL1A 4WDXA 2XGBA 1DBTA 3M5VA 3VX1A 5D37A 1H7PA 3T1GA 4GJJA 1QDSA 1OF8A 4Y9MA 2C16A 3MW7A 4I7WA 3CPGA 1ZCCA 3BOLA 3O07A 3VGGA 2HQAA 1L6YA 4IP4A 3ATZA 1C9WA 2D24A 4DO6A 2IKGA 4U2YA 3CK5A 2YKKA 1GZ1A 4NYYA 2MNRA 3IJIA 1J5SA 3FXYA 3W7OA 1UD8A 4QE1A 3CV2A 3BJSA 3M0JA 1W6TA 2JGQA 3UU0A 2AAAA 4JTAA 2Y61A 1VIWA 3VOIA 4IISA 1V3JA 4AIBA 3VOGA 2DW6A 3VDHA 1KNWA 1X1ZA 5SWUA 2XINA 1T40A 2ZVIA 4GYFA 3KS5A 3UZZA 3VKBA 3A4JA 4AYGA 4OOZA 3PJWA 4PUMA 3NQ7A 5EYWA 3MZ2A 3R2GA 3SCRA 2OKOA 1EFZA 4XZLX 1W1ZA 3CMJA 3IJDA 4WGXA 1E4NA 1M7JA 3SCVA 1KCZA 2VRKA 4WJ8A 3G1DA 4HU0A 3NAVA 3PM6A 1ZAJA 2CKRA 4JHMA 3OVGA 3M6DA 3CHCA 4B4FA 2XU2A 4AD5A 1VFMA 2PDHA 2CEQA 3AJ7A 2Y7FA 2WBKA 4LAKA 1XQLA 2EKGA 3AU2A 3TMQA 4J35A 4WXYA 3UWWA 3XINA 1GVRA 1OG6A 3LHTA 1CT5A 1HZYA 2QYGA 1DXIA 3N9RA 2GDVA 5FF4A 3FA5A 3FK4A 1XFCA 1G4SA 1C92A 1UZ1A 1H1YA 2J9XA 4OU1A 3I65A 3OGRA 2JF6A 1XRTA 2DZTA 1S2WA 3NJ3A 2YFNA 5E0CA 3TCSA 1RP8A 2BTMA 4M80A 4O1CA 2RUSA 3MP3A 4Q32A 4NNCA 1PKLA 1XICA 3UZYA 2JIEA 3GAKA 4V1XA 4G7FA 5C9RA 4MY1A 4QR6A 2YJQA 4IICA 1ISYA 3QC0A 1YTEA 2XVLA 4V2XA 1OM0A 3WO8A 3GH5A 1PX8A 3SECA 1SSGA 3RMJA 1QNSA 4S3BA 4XD6A 1JPHA 4ZXLA 5D09A 4JTRA 4QG6A 3SAZA 2OOFA 2VNCA 4DBDA 1J10A 4PYSA 2QAPA 3KHDA 1N8FA 4Q4KA 4QX4A 5L9FA 1K77A 3VILA 2OO0A 1V0NA 3KL0A 1XGZA 5LNUA 1K8CA 1KM5A 3E5BA 4CUCA 5A6BD 3S5OA 4RPQA 4XZHA 1Z3NA 1QJWA 1X7FA 3OEXA 1MQRA 1U2YA 3LXCA 1C8VA 1Z6KA 1NP2A 3VZYA 3VD9A 2OWCA 4LAZA 3IVUA 4MPKA 3N11A 1DPMA 1XYFA 4UTIA 3T2PA 4JKKA 1VBGA 5A2CA 1YYAA 4CQ8A 2CHOA 4JXCA 4M8UA 1LDCA 3AALA 2AQVA 3LZ3A 3M64A 2I9EA 4AVNA 4ICCX 3QV8A 1QWKA 4NKCA 4S39A 5ECVA 1MYRA 4RNIA 3NXFA 2CZDA 1HKJA 4PBGA 3EWBX 5BWFA 3GD6A 3P3BA 1S2TA 4ZODA 4JIPA 4KERA 1H09A 4JAWA 1MSSA 2IMRA 4P8XA 3NQMA 1OHLA 1KBKA 3AICA 3CIXA 1UUMA 3RJXA 5KITA 3HB9A 3S46A 3UWYA 3QN3A 4UFKA 2FHBA 1H49A 3Q4DA 3CUHA 5TIMA 1W2PA 4OBTA 3LK6A 1EOMA 1XSJA 1TQJA 3NM1A 1ECEA 1KO0A 4JN6A 3FJ4A 2WQDA 5BMWA 1P0NA 2REQB 3NO5A 1IXPA 2ZIDA 5KINA 2NWSA 3N2CA 1S2VA 3VCCA 3EOEA 1EHNA 1TIWA 3LQLA 4C7GA 4AX7A 4IG2B 1OC5A 2D2HA 4NAEA 4XX6A 2WCSA 3Q67A 4XK2A 4H9TA 4NJKA 4AG0A 3OVRA 1J93A 2A3HA 3PTDA 1IQ8A 3WQFA 4CCDA 3EX1A 1O60A 4KRUA 5I78A 3OLGA 1E6PA 4N2YA 2XHYA 2WM1A 3AJXA 2XVKA 3MWAA 2IPGA 1TYGA 3NOEA 2RAGA 3PZ9A 3PG9A 2XSAA 4FXSA 1QU4A 4GH3A 2W3ZA 2E28A 4F0KA 4KETA 1XBXA 5BNKA 1IEXA 3ZJ8A 2YYTA 3GKAA 3VIKA 3L5LA 2ZC8A 3EOLA 3WLLA 3JRKA 4DELA 1EZWA 4MJ4A 1KM1A 1WZAA 1XCXA 4WCJA 2QHAA 2P0OA 3T8QA 1UJPA 4LUTB 1W3IA 3I4EA 2V5KA 3OYZA 1UUOA 5EPDA 2DT2A 4K38A 2CZEA 5DCEA 1EIXA 2O9TA 4TMBA 1WDWA 3GXFA 3DHPA 4H8VA 5LIWX 2O0TA 3WBYA 1ZQ5A 5HNNA 1FBAA 5HULA 1HW6A 3V0SA 3RLGA 3W7PA 3WUGA 1HT6A 1IHIA 1U5JA 4KWVA 1RBLA 5LXXA 2CCRA 4GKLA 3WG6A 1TZ9A 1TFVA 3AO0A 3GVVA 5K9XA 1ZAIA 3W2MA 1GVEA 4GI8A 3WN6A 2J6XA 3AI0A 3MKCA 1A5BA 1G94A 3EPOA 3RM4A 3DYPA 4A2SA 1UKPA 2YB4A 2ZUMA 5D8ZA 3AOFA 2WV8A 4YPJA 1BWKA 3RDKA 4GINA 3WD3A 5GJNA 5HR6A 4AMCA 3B9OA 4A8LA 5HDRA 3MU7A 3AS3A 3FV9A 4HSNA 1DIKA 1P0DA 1E51A 5H6HA 5A6BA 3L2IA 1IEWA 4H01A 4ZOBA 1AG1O 2ZZ3A 2Q8XA 4GXMA 2WKGA 2XZ9A 3ZR5A 2FPYA 4N0RA 1NQ6A 5REQB 1VP5A 5DO8A 1EA9C 1KRCC 4H9YA 2O55A 2O4QA 1R86A 3CLMA 3I6RA 1KFCA 1I2RA 3DFOA 2Y7GA 1YHTA 1B4EA 1MDRA 5A6AA 4E8DA 1FKWA 4PUNA 3HMJG 1E43A 4O4WA 1W3KA 4JFVA 1BD0A 4CU8A 3QLLA 3NYDA 5KZMA 2CWNA 4B3KA 3SEPA 4B3ZA 1JZ3A 1K1DA 3D6NA 2PB1A 1O4UA 1DJZA 1K9TA 1K03A 4X3ZA 3E6EA 4ZQRA 4JIQA 2GQ8A 4C1LA 3UWUA 3GDLA 2PF0A 1V93A 1TREA 1CGXA 2NZLA 1MZRA 2J62A 5DX7A 2FFCA 3KWSA 3KBNA 1QXLA 1V51A 3VXGA 3IRSA 3LCIA 2Q71A 3DXIA 4FNPA 4UQEA 2KZHA 1H0IA 3W6YA 4TVCA 1CGWA 1EP1A 5LIYX 3STCA 1KBBA 1JYVA 3S5SA 1I2NA 3ARVA 4HTBA 5JBFA 5FF7A 3H22A 4NAFA 3W73A 2QPXA 2OGJA 2DSKA 5IOBA 1DQWA 3ANYA 3OB8A 1KC7A 3SJNA 3RUBL 4C6QA 3S2MA 4OT7A 3NZRA 3UEQA 5FOOA 4FOUA 1JGIA 2WC7A 4C91A 6REQB 3JUGA 6PTDA 2PDBA 3T4WA 1AUSL 3GM8A 3G24A 4UTTC 2OWWA 1NIUA 4NXKA 4DYKA 1F8IA 3W23A 3QY6A 3AHVA 4ERIA 3NA8A 3SFWA 4P8UA 1KXQA 1ZL1A 3TE9A 1KGUA 4DF2A 1VFTA 4M1RA 1U33A 1XC6A 2RGMA 1H41A 2ZZ1A 1QATA 4O57A 3TA9A 2VX4A 1YBQB 3P6LA 2OT1A 5DY2A 1LOSA 2VM8A 2QKFA 3WSUA 3FIGA 4LYPA 1FH7A 4GXWA 5HWJA 2Q3RA 4DJFA 4NJIA 4AF0A 3BLLA 5LKYA 1E4LA 2PAJA 4LYRA 4QSHA 5MF5A 2VI0A 5JVLA 2Y88A 3UWZA 1K8XA 3WQEA 4CVUA 1CNVA 4H3DA 4BCEA 1NSJA 4GFSA 5D30A 1JNEA 4JCLA 2Y5EA 2XPKA 3I68A 1IV8A 3W6MA 2PWDA 4C6LA 1QK0A 1ZAHA 3I7RA 3WQCA 3NWRA 3DN5A 2CKSA 3GXPA 1FWJC 5DELA 4DJDC 2BWGA 3W7HA 1QBBA 3KCJA 1HJQA 1FHVA 4PSPA 1WUEA 4HU8A 2XFRA 3XIMA 1VZWA 3N25A 1EX5A 2D0GA 3GW0A 3W37A 3N2BA 2VC5A 4HB7A 3N12A 1WKFA 2A2IA 4IPNB 2V67A 3CUFA 3TDFA 3C2YA 3BO9A 3USBA 4AD2A 2PDJA 3RM8A 1O5QA 1E55A 1EL3A 1TWWA 3RLHA 4H83A 2ANUA 1F3TA 1KWGA 1EQCA 4K39A 2E0PA 1RQHA 1HL8A 3WL1A 5G1YA 1AH4A 2VYOA 2V6AA 4PFHA 3CB8A 1T41A 4G8TA 5EBAA 4BA0A 1K70A 4OUEA 3AMKA 5FEZA 3O05A 4U5KA 3MANA 2BHYA 1EPVA 2CZ5A 4J27A 3M0ZA 1UD2A 5J04A 3UPBA 5I00A 3O8AA 3TN5A 1JZ4A 1F6YA 3NGFA 4J9JA 3ZSSA 5CKSA 1ML1A 2OT0A 1OFOA 3ZT7A 1HUVA 1WDSA 3SCQA 3TUUA 2P3ZA 2VTFA 1CGUA 3NFUA 2XWDA 1DJQA 1DE6A 4WOQA 4UOJA 3W29A 1Q7MA 1YKWA 3UZXA 3WLHA 2YDSA 3W6LA 4UOZA 2ZX9A 3FA4A 5KZEA 3MSYA 3CT7A 2PD9A 1OFDA 4YMZA 3OQEA 3VIPA 1PYFA 3HGJA 3LI1A 1SFLA 3QM3A 4IQLA 2CXGA 4CN6A 1LWHA 1NF7A 5I7GA 4HMEA 3APTA 2UWFA 1WAWA 5M17A 5LYRA 4MKVA 4M81A 2PDCA 1UKTA 3AYSA 3BSMA 3SSJA 3WF0A 3UFYA 2OTDA 1UA3A 1A50A 1GKRA 4LAMA 3G1SA 4ILSA 1Q2SA 4U28A 4OV4A 2PD5A 4DYJA 4S3DA 3GH7A 4JIHA 4LCRA 2WJZA 1VIZA 3T9PA 4AZ7A 5C2CA 4RE0A 3HGRA 3GFYA 4M29A 4G56A 2XGIA 4UXDA 5C9ZA 4JTFA 1KQYA 5HQEA 4L4MA 5AVNA 4YVVA 3P5ZA 1XIMA 3UR2A 3WBEA 4H9XA 2Q8LA 2IKJA 4Y2WA 4Z2JA 1XG3A 2RJGA 1V7YA 3ZVHA 2VZTA 4EWND 4QS5A 2DZBA 4FXRA 1FP8A 4UTWA 1L8PA 3M0YA 3H54A 4WZHA 3KTCA 1HJUA 2VCBA 3R5EA 1ZBWA 2FPVA 4AU0A 3IJQA 4HMCA 1E6XM 1AD1A 3TP4A 5HXMA 3F2CA 3UJ2A 4FHAA 4KS0A 1H1ZA 1PB0A 4GMEA 1MWOA 3FN9A 2FIQA 2GOKA 2IPFA 4UZSA 2NW0A 2Z6JA 2C1GA 3WD1A 5AHIA 1BGGA 2YLAA 3L21A 3HBLA 4Q8PA 3PBYA 1Z48A 4MY8A 4RZ4A 1NFPA 3RPDA 2D3NA 3FSUA 4HJFA 1TX2A 1XBYA 4UOQA 2VFHA 4AZIA 3S1XA 3H4WA 2PZ0A 3TW9A 3C0SA 4EF9A 4F79A 5C55A 3PULA 5ABEA 5IDIA 2OEKA 2VJXA 3F2DA 3TN3A 3B97A 2YFOA 1UR8A 4AZGA 4Y7EA 1A4MA 1UZDA 1ZALA 4IP7A 2ISVA 4HOZA 1X38A 2XM1A 1KTNA 2WLZA 1RLDA 1TCDA 5F4SA 2E68A 1T96A 4JTCA 2PBOA 4MSSA 1XLLA 4L1XA 3RFAA 3W7EA 3N17A 2Q01A 4REQB 2XH7A 2VQUA 4R7WA 1MQQA 1CB2A 4HA4A 3UR8A 2WSQA 4BF9A 1XV8A 3I6EA 3TAKA 4G1NA 4LQ1A 3EWUA 1SO6A 3W70A 3KP0A 7TAAA 5JH2A 4MLRA 3H8AA 3BDKA 3B9EA 3R79A 4W7WA 3AU6A 2FDMA 1QVBA 2G96A 4IIFA 1HVXA 1I8JA 2GSJA 2INFA 1UROA 2Z25A 3BJFA 2CBJA 4LUSB 2ZUUA 4ZO9A 2P5NA 1DTUA 2WWCA 4ZTYA 3OZPA 5IRPA 3L0KA 4X22A 2ZRWA 4HMNA 1J5TA 3WUFA 3LSBA 1FWBC 4JX6A 5AYIA 3WQWA 4KIEA 1N55A 2Z28A 1KB3A 1EPXA 3VDBA 3PWAA 1OEPA 2OXNA 1B57A 3GC5A 3L2LA 2R9RA 2NVDA 4N4QA 1OX4B 2BHZA 2EPLX 4IUOA 2NQ9A 1V03A 3TYZA 4F0MA 2V2HA 2JKEA 1H4PA 3TTOA 5FEWA 1OD0A 1VPYA 3CV1A 2PC4A 2QF7A 1XCFA 2FGZA 4LVBA 2VFIA 2CWXA 1J4EA 2H3DA 1IR2A 1OWQA 2YIHA 5PTDA 5IXEA 1IR1A 4Q7NA 1XH1A 4PMQA 4U3AA 4CQAA 4M19A 4IWWA 2F8QA 4PMOA 1XKJA 4H8UA 2VFFA 2YCIX 1DP0A 3CTTA 3WJSA 5AHMA 1M1BA 3W25A 3G18A 2PDQA 3W1AA 1JGMA 3V5FA 3OHMB 1EXBA 1UR1A 1TB3A 2AMGA 5DBTA 4O15A 4PMZA 1Q6DA 5DXXA 2V8ZA 4AEOA 1ICQA 4KCUA 3CAVA 1GCYA 3WMBA 3REQA 1V6VA 4NSBA 3F4DA 2Q6ZA 1WZMA 2UY5A 2GVEA 1TPC1 1H62A 2EPOA 3N3MA 2OX4A 1GQJA 3PAOA 3WLTA 5CBIA 1E15A 2E6FA 2E9MA 5D9PA 2WSKA 2BBFA 2ISWA 1KFLA 3L9CA 2CLEA 2P0IA 3BC9A 4ZQMA 5A5WA 3AUOA 3COTA 1I0DA 2HEJA 4ZFCA 3UCDA 3ITTA 5A8OA 1ADSA 4ADSA 1X39A 3WQVA 3STFA 4J3VA 3W7JA 1OFPA 1WPCA 4P2VA 1AVAA 4P7NA 4S38A 4L56A 1W1YA 1LWIA 4KEUA 1Q7QA 2DT0A 5D2WA 3PPGA 5HWMA 6A3HA 4G5DA 3EKZA 3SRFA 5HQLA 4HPXA 1JUEA 4XQ6A 1B9BA 1JI2A 3SQLA 2E5BA 3P74A 4D2JA 3LBCA 1S1RA 2I56A 3A23A 3EDFA 4ML9A 3CZEA 1ZRQA 5HANA 1W9VA 4GIAA 1US0A 2AL2B 3OBKA 5JXQA 4ADUA 2NUXA 3AHXA 3IWPA 2A3LA 1UR9A 3ZT6A 3UCCA 4DBEA 3VNJA 5DLCA 2FB3A 3W1PA 4PB5A 4MJZA 4W7UA 4B5XA 2EPKX 4NZCA 2ZRVA 1RPXA 3AZRA 3A21A 3LOTA 1FQ0A 2WO5A 2QJGA 3CHDA 4YCPA 4JFWA 1JAEA 4HU3A 2VX7A 3CV7A 2GZXA 1J8VA 1L6SA 4M7TA 2EGZA 2DSVA 3GXDA 1XR2A 3PK7A 4ZA0A 1PYMA 1YMYA 2YYUA 1E9YB 2XIOA 2BVYA 2OG9A 3TC7A 3W88A 4KGLA 4Z1DA 1UKSA 3BW2A 2HPMA 3N15A 1K7XA 3N2MA 4HU4A 1DWIM 2HDJA 2WCGA 3TV8A 3DG6A 3MUIA 2HCVA 2V3FA 5BU6A 3HF3A 5C0QA 1BKSA 5G4WA 1UB3A 4ZENA 1RP9A 2V82A 1CI1A 3IV3A 1TJ2A 3IJ6A 5H8MA 3WNNA 2DJXA 4JDBA 4GE8A 1ONEA 5D02A 1FTXA 4MM1A 1OIFA 3SRKA 4E4UA 3EX6A 1PV8A 3B05A 2GJPA 3LTSA 3MHGA 2QDHA 1UOKA 4QG8A 4ZEPA 4RDWA 1AZ2A 4JQ2A 5G1TA 1A3XA 2PTDA 3FA3A 4MAZA 1HXJA 3BLKA 3OA5A 4UUIA 2QEZA 2WZIA 3G6MA 5LNVA 5CPLA 2D0FA 4PB4A 3MP4A 4CNSA 4JYFA 2ZRXA 6XIAA 4EVZA 3UZ5A 1VYSX 4OUIA 1XC4A 3HQOA 3HV8A 4XD3A 3ALFA 3VA8A 3DUGA 2B7PA 6TAAA 4PRTA 3VIFA 1GHRA 3TSDA 2X0YA 3KL5A 5D8WA 3BPWA 2VFEA 3PPHA 4CQDA 3IUIA 4AFYA 1JZ2A 4DM2A 1V3HA 1HO1A 1HKVA 3TXZA 2WSRA 4TUFA 4WKHA 3U2ZA 4DEFA 1TA3B 5H8UA 2WVSA 4KW2A 3R0DA 1BSIA 2DZUA 4XZIA 2BOEX 3WH9A 1OGBA 3W7GA 1R8LA 1QW7A 1V4YA 1R3SA 3SN0A 3FS2A 1JAKA 1P7TB 5E6YA 4OOUA 3W7RA 4Z2KA 2Z7KA 1XIBA 2NUYA 1XLGA 2IKIA 3UCQA 3W86A 3W00A 4R9OA 3ARRA 1QAPA 3N2TA 5G5IA 4LSBA 4WK9A 1E0VA 1SUXA 3LPOA 3QYQA 2XH2A 4G7EB 4UR7A 5CSSA 5DF0A 4QP0A 1ME8A 3PBWA 3WNPA 3GNXA 1QT1A 3EPMA 3ZM8A 3DOPA 3RNDA 4UFHA 2RDXA 2WMJA 4EE9A 7A3HA 1M41A 2D0HA 9XIAA 3MZNA 3C2OA 3H2OA 4WXZA 4BJHA 3VUPA 2Z2BA 3W1RA 2P53A 2J78A 2PDMA 4A2RA 5CC7A 4ZQOA 1UWSA 2IQDA 5HA7A 1QHOA 4BWLC 2Z2UA 4B5VA 4O8AA 2FFIA 1MUWA 4O28A 1KM4