4AD4A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-isofagomine and alpha-1,2- mannobiose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
total genus 130
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad4A00
2ZX5A 1EA9C 3CPUA 4B9ZA 3DC0A 1Q6EA 2XYLA 3VGGA 3TTSA 5M3WA 3T0BA 4Z2GA 3SCQA 1JD7A 2WVTA 2VRKA 1J0JA 1RD6A 2DH3A 3PTQA 3PTKA 1R86A 4HTYA 2CCRA 2D2OA 4D6CA 1AQHA 1E40A 4PSRA 5A2BA 1BG9A 1W3KA 3AIEA 3EMQA 3WH8A 2VVSA 4J28A 2OSYA 2VZTA 2XPKA 2Z1SA 2VCAA 2WHKA 4JHOA 2FHFA 3CUIA 2WPGA 4M56A 2XWEA 2E8YA 1JD9A 3AISA 3UR7A 1C90A 4IISA 2CNCA 4JKKA 4U31A 3SCTA 1UR1A 3CZGA 1E6NA 4OZOA 1JZ2A 2RGMA 4NZCA 4W8LA 2EPNA 2Y5EA 3ZMRA 1E9LA 1UWRA 1G94A 4EE9A 3NDZA 2D3LA 3SCOA 1E73M 2DEPA 1ODZA 3L4VA 4W85A 3WL1A 1ISXA 4HZ6A 3APGA 2J7DA 4AY1A 4D6EA 4FF5A 2YL9A 3HU7A 5DT7A 4P8WA 1WB0A 2XGBA 4AYSA 3AROA 3VGHA 1J10A 4R5EA 5CSUA 3ARSA 4UQAA 1CYGA 3AIUA 3J7HA 4KGLA 1BQCA 2ZWYA 1HN1A 1JZ8A 1HKJA 3VNZA 5ABFA 3RM4A 2XVNA 1PPIA 4PRWA 3A4XA 3CHFA 4WK9A 3ZM8A 3GXIA 2OWWA 1FP8A 4ATWA 4GI8A 1E1EA 4W7UA 2V38A 2E3ZA 3VMPA 4P7QA 2YOCA 1J0ZA 3EDDA 2ZX7A 1A3HA 1ZS2A 2XWDA 3IAPA 1Q6DA 5JUVA 1O7AA 2OLHA 1U30A 2ZUTA 1KFWA 1V3LA 4AXNA 2ZXAA 3FHQA 4FLRA 4WKHA 2WZIA 3FAXA 3ZR5A 2BVYA 4YHEA 1GHSA 1QNPA 4RE2A 1E4NA 4WLCA 1PBGA 4X9YA 1H4PA 1HX0A 2CERA 4F8XA 4WIWA 3VINA 4PYSA 4U5KA 2BHZA 1MQRA 1FH7A 2ZUVA 1EOMA 3CUHA 1H1NA 2X0YA 2XVGA 4UQEA 2WBGA 1PIGA 2ESCA 3PZVA 2VX5A 4D71A 2VZVA 2Y2WA 2OWXA 1Y7VA 3GNOA 4LX4A 4CCCA 3E1F1 1VFOA 1E43A 1R7OA 2PB1A 3BAJA 4BQ4A 3NJ3A 3W26A 1JFXA 4AEEA 2PWGA 4D6DA 1PJ9A 5CSYA 2JEQA 5GQBA 2Y24A 1JYVA 4RE4A 2BNJA 4HZ7A 3VX1A 3WQWA 1GQIA 1B9ZA 4AZCA 1BYDA 1M53A 3WQVA 9CGTA 3SCPA 2WMIB 2J4GA 4MTVA 3RM9A 2CIPA 5A6BA 5FCZA 2CBVA 2EO7A 3PZ9A 3AIRA 3WH5A 4NSBA 1HKMA 2VJXA 3T2OA 3II1A 1GVIA 3CIVA 3PBGA 4Z2IA 3PZMA 2RGLA 1FH8A 3KL0A 2WWCA 1HL9A 1EDGA 2VVNA 2J75A 2O9PA 2VR5A 2B31A 1JXJA 1V6UA 1WDQA 3VD7A 1CECA 2WKLA 1HKKA 3CTTA 2W5FA 3ALGA 3A3HA 3W53A 5BRPA 1V3JA 2WVVB 4CN4A 1GJWA 4CD6A 1Q4NX 4UOQA 1MFUA 2JIEA 3QOKA 5GPRA 4CD8A 4ACZA 2VX4A 5E6ZA 1V0NA 3FNDA 1ITXA 4M81A 3SIMA 2BY3A 2GSJA 1V3KA 1QHPA 4H8UA 4LXFA 1V03A 4ATDA 1V3IA 3ARPA 3AS0A 1Q6FA 5CJ5A 2CKRA 4JZ5A 2ZUMA 3OZOA 2WNWA 1VFUA 3OLGA 3QGVA 3W6MA 1W9VA 1GNXA 2ZOXA 4UFLA 3WF0A 3THDA 3RJYA 5JBDA 5CLTA 1RP8A 3MMDA 1KR1A 1JYNA 4V27A 2E9LA 2GK1A 1UKTA 4P8XA 3BCDA 1GOWA 1XV8A 4UR9A 3L2MA 2X09A 5D8ZA 2XSAA 4JFSA 1CNVA 1TA3B 5IFTA 1XD1A 3D3AA 4HA1A 4PMNA 1CXFA 3IK2A 4JL2A 4JIEA 4J3XA 5BROA 1TG7A 3UETA 1R8LA 1E6XM 3HN3A 4UOZA 2J7BA 3MUAA 2E9BA 1UR2A 2NT0A 4NRSA 2DDXA 1GZJA 4CD7A 2J7HA 1V6WA 1MQPA 1K9EA 1VEOA 1MYRA 1VFFA 1JI2A 1E0XA 2VNCA 3EMZA 1VBUA 4F66A 1OIFA 1G1YA 2EPOA 4CCEA 2BHUA 1QNOA 2J7CA 2QMJA 1CGYA 2XVLA 1CGTA 1UWUA 1MXGA 3WDJA 1R85A 1VEPA 3EDKA 1PAMA 3CUGA 4P7RA 1EQCA 2WSPA 4OBSA 1OT1A 1UH2A 3PN8A 1LG1A 1OINA 4GKLA 2VR4A 1QI2A 3AXHA 1VFMA 4DM1A 4F9JA 1JYXA 1UD5A 1PX4A 1KBBA 2JFEX 3N17A 3TP4A 4JCMA 1SMDA 1JDCA 2PWDA 3VD3A 4CCDA 2DT0A 4Q22A 2W61A 3ARUA 3DHUA 3MUY1 3U5UA 2WK2A 3KEHA 1XSJA 3FW6A 4MNMA 1A47A 3CGTA 4QLLA 3N15A 3QR3A 2WZHA 3BXWA 1HJQA 2W67A 3F5KA 1XD0A 1G9HA 1TVPA 2YA1A 3VVGA 3ZJ7A 2XJ7A 1EH9A 3A47A 2ZE0A 2VRJA 2OSWA 3A6OA 2ZX6A 3VMOA 3IAQA 1E0WA 2XUCA 1FP9A 3RDKA 1JIBA 4MDOA 1UKPA 2YDQA 1JF5A 2GDUA 1ZBCA 2J25A 3OGRA 4PUDA 1PIFA 4ZXLA 2EXOA 2V3FA 3VUPA 1L0PA 3AIVA 4OKDA 4DM2A 1BYBA 1FA2A 1EOKA 1B31A 2WVUA 2YDSA 6A3HA 3IANA 1UQZA 3T09A 4HZ8A 5AYBA 3GXDA 3GH7A 2OSXA 2BVDA 4A4AA 4CKQA 3O6AA 2JF6A 3UCQA 5A8MA 1IZKA 3L4TA 1P6WA 4W7VA 1LL4A 2E8ZA 4AMCA 1PZ3A 2WMGA 3MV01 4M29A 1XRVA 5BXRA 3VPLA 4CU6A 5A94A 4HU0A 2ZICA 4NF7A 3CZJA 1JAEA 3M46A 3BAWA 1UA7A 1UZ1A 4HMEA 1CGWA 2EPKX 3VOCA 1V6XA 5HBFA 1BVNP 2NW0A 3WDQA 1NP2A 1N82A 4AZ6A 3VDHA 3CHDA 2JIWA 1G5AA 3WF4A 1JAKA 2YDRA 5A95A 4QLJA 4TTUA 1Q6CA 1EXPA 3FHAA 1BGAA 3U7BA 4AD3A 1DWHM 1JZ5A 3TOPA 3VDAA 4X0VA 1BPLB 1QHOA 4GZIA 5GNZA 3W29A 1HL8A 5BCAA 3RMEA 4HMCA 3CH9A 2WCGA 4BA0A 1H3GA 1MVYA 2D23A 3FY1A 3N9KA 2A3HA 2OYLA 1JDAA 3VDBA 1WZMA 2JALA 2CXGA 4YPJA 3ZJ8A 5A6LA 2BXZA 4U33A 3WF1A 3SCRA 1QNSA 3ARQA 1JZ7A 5D9MA 2XFRA 3UG5A 5I79A 3T08A 3NCOA 2GUYA 1OCQA 3K8MA 2QF8A 1OIMA 3L2LA 1E5JA 1CXEA 5M17A 4XB3A 2DH2A 3SUWA 1MW0A 5A8QA 4W8AA 3B8SA 1JI1A 1H11A 1ZU8A 1JZ3A 5CPTA 3WEOA 3ARWA 2BFGA 1KBKA 2CITA 2GJXA 5KZ6A 2WKGA 2WMKA 3ZT5A 3F5JA 1LLOA 3DYOA 2VURA 3DYPA 1SFSA 1AQMA 2AMGA 4D1JA 2DSWA 4QP0A 1J9YA 4PBGA 4PEEA 5CG0A 3RPMA 1QHZA 5FKYA 4JKLA 1K9FA 3UESA 2CBIA 3VIHA 5C70A 3UG4A 4QCEA 1TE1A 2D0FA 1LWHA 2IXVA 2W4XA 4KWUA 1W3LA 3KWXA 2D0HA 1GONA 2GFTA 2O9TA 4BCEA 2IUZA 3WUEA 4HOXA 2DT2A 3W4RA 3IJ8A 5HOSA 3ZIZA 2VCCA 1R7AA 6TAAA 2O92A 2VC9A 3WDHA 1PX8A 4Y7EA 2WCSA 2DT1A 2UY3A 3I3DA 3DHPA 1IT0A 4P7NA 2CEQA 2YKKA 3PZIA 1JZ4A 4PTVA 1KCLA 4GQRA 1AMYA 3TTYA 4KMQA 2EEXA 1J0YA 4M80A 2G3NA 1NWTA 1TMQA 1ZB5A 1H49A 4Z2LA 3PZUA 4FLOA 1US2A 3WIJA 4BS0A 4WKAA 2CYGA 1FHDA 1H5VA 1GOOA 3EDEA 3CLWA 4UQ9A 3WH9A 2AAAA 4H8HA 5EMYA 1OM0A 1ISVA 2VCBA 4OUEA 2GJPA 5A8PA 4NRRA 2YL8A 2G3IA 4E8DA 2XM2A 2XVPA 1NWSA 1UUQA 1E3ZA 2X0HA 2Y8VA 3ARXA 4JCLA 1ISZA 3AMKA 3WD0A 4IPNB 1E6PA 1B3YA 1BTCA 2NT1A 4J3TA 1MW1A 4Q7NA 1KCKA 5ABGA 5D8WA 1BYCA 3WH7A 2G3MA 1CWYA 1TCMA 2DQXA 3WQ8A 4JFUA 5A3HA 5LYRA 1W1PA 5DF0A 1VAHA 5I23A 1XGZA 1J0HA 4P8VA 7CGTA 3LPOA 1HNYA 1MW3A 4PUEA 1JG9A 4H04A 1UD8A 4BQ2A 4J7RA 3GBEA 4ZE4A 5IXEA 1KR0A 3BSHA 3SCSA 4H7VA 1JF6A 3AMGA 3L4ZA 4CGTA 1ITCA 4P7LA 4LYPA 2J62A 4HP5A 4AZ7A 3AZTA 3MUZ1 2XG9A 2WM0A 5IHSA 4PMRA 4W7WA 1NQ6A 1CXKA 4B3LA 2VUYA 1JNEA 5D4YA 4UFJA 2BS9A 3PTMA 1K9TA 5AC5A 4E2OA 3PZGA 1WNOA 4S3JA 3K8KA 5D9OA 3LPGA 3OB8A 1KWKA 2O9RA 2BXYA 5BYWA 3W24A 3NSMA 4TX6A 3T0DA 4BZYA 1W2PA 2W66A 4PMQA 1BHGA 1X6NA 2JF7A 2J7FA 3VO0A 3MU7A 1UQYA 2WSKA 3WNOA 4WJXA 3W27A 1NWRA 4JHZA 2GJXB 3M07A 1VENA 4HOWA 1CEOA 4Z2JA 3VTRA 1D3CA 3TTQA 1QOXA 1CGUA 2GK1B 2W63A 2WBKA 3ZJ6A 2ZUWA 1QI0A 1LL7A 3D5HA 4HPHA 3SCNA 1JDDA 1E6QM 3OIHA 1UD3A 3LPPA 3VIMA 4H2CA 1MQQA 2VT0A 3A4WA 1CTNA 5I24A 4PN2A 2FGLA 4GXPA 3WH6A 3N13A 2J8GA 4UQBA 1J0IA 4R27A 1GOIA 3DYMA 4A3HA 2WANA 4JL1A 4MB3A 2E9MA 4HA3A 3THCA 1NWUA 3WMSA 5AY7A 4TVUA 2QPSA 4ZEPA 1E1FA 2BHYA 3PZOA 2C8NA 2VRQA 4NI3A 2QLYA 4MJ2A 2A3EA 3CHCA 3T0AA 3VX0A 3BCFA 2OYMA 4H41A 4W93A 1CDGA 1MXDA 4YHGA 3BH4A 2WW5A 1TFVA 5EFDA 1C93A 1C7SA 1NOFA 1BGGA 4GZJA 4N42A 3WUGA 4D6FA 4UFKA 2PBGA 4AZCB 1GJUA 4FK9A 4DWSD 4BQ3A 3S6TA 4QFUA 4HMDA 3QOMA 2GDVA 3OGVA 1QVBA 3SUUA 4XUYA 1GVYA 4RL3A 2YL5A 4UQCA 5E9AA 3AHTA 3VGEA 4DWSA 2XGIA 1HXJA 4IM4A 3VM5A 3VMNA 2XHYA 2XSBA 3OLIA 4UTFA 1O6IA 3NUKA 3A4AA 2O9OA 1RPKA 2EJ1A 4ML4A 4UZSA 4W89A 2VZSA 3ZT7A 3K4AA 1DWJM 1GQLA 4AZBA 1CXLA 3G6MA 1FOBA 4CUCA 1TZ7A 1GCYA 2X8RA 5A8OA 5HXMA 1QNRA 2XVKA 1BG4A 5A6MA 2WLYA 4M82A 4UFIA 4AC1X 2DSUA 5E70A 4E8CA 2EBNA 1XH1A 1RH9A 7TAAA 1ISYA 4OIFA 4C7GA 3AIWA 3MSDA 2VZUA 4DWSC 4K68A 3W37A 3W6LA 1B3VA 1LWJA 3AI0A 1B3ZA 1B2YA 1VEMA 5CPSA 1NOWA 2XIBA 4D1IA 3EYPA 5A6SA 3AS3A 1QI5A 4D6IA 4GO9A 2ZWZA 5A1AA 3ARVA 1LQ0A 1G0CA 2J7GA 2G8ZA 1D7FA 3QHOA 1TVNA 3AMLA 1GQKA 5HDRA 4ATLA 2EPMX 1UYQA 1E6ZA 1V0KA 1W1VA 3RJXA 4XV0A 2DIJA 2C0HA 5EBAA 4PMUA 1GW1A 1XH2A 1OD0A 4D72A 4HA4A 1VF8A 1C3FA 4JFWA 1KGWA 3POCA 1UWIA 3VGFA 3VKKA 2ZXBA 4YN5A 1HVQA 5DO8A 2PBOA 4AIOA 1C8QA 4F9DA 1EO5A 3FN9A 3O9NA 3SEPA 3F5LA 4BF7A 4CU7A 2J47A 3KL3A 2FH8A 4E4PA 4KRTA 2J77A 3GXFA 5ABEA 2WXDM 3ARZA 2C7FA 3UEQA 4ZE5A 1HIZA 3SCUA 3I3EA 1UWQA 3AZSA 2QMKA 3AFBA 2D0GA 5BXTA 5DMYA 3BMVA 5I6SA 7A3HA 4HPGA 1M01A 4MDPA 5BXSA 1XCXA 5GNYA 4J3WA 4DUVA 4XZBA 2DIEA 3WQ4A 2A3CA 1SMAA 3UR8A 1B30A 1U2YA 2V3EA 3GTNA 4WSJA 3MMWA 3QHMA 1KQZA 2OYKA 4AISA 3B9AA 3U5YA 1C8XA 4W8BA 1EIBA 3WDRA 5LA1A 4V28A 3MS8A 4PMXA 1H0IA 1TA3A 3GH4A 1V3HA 5IFPA 3WEMA 3RM8A 2FH6A 4CN6A 1J18A 3WMBA 1H0GA 2F2HA 1VB9A 1HP4A 3WF2A 3LMYA 5CPQA 2Y4SA 2A3AA 3TONA 3AHVA 1QW8A 1J12A 1K6AA 2PWEA 4MPKA 3W25A 3ALFA 5BXPA 2HVMA 4GQQA 1J01A 1KB3A 1DWIM 8CGTA 1UR0A 1ODUA 3MV11 4DUXA 5CGMA 2UY5A 3WENA 1OGBA 1YHTA 4PTWA 1VBRA 1NM9A 4UFHA 2AOSA 2QV4A 4XX6A 4B15A 1E5NA 1W32A 2Q8XA 3ARYA 3N18A 3MO4A 2YA0A 1JYWA 1JZ6A 3KZSA 5DT5A 1WAWA 3MUIA 5CGTA 2BVTA 2XFYA 1C7TA 1V3MA 5C71A 3VNYA 4ZFMA 1HF6A 2IXUA 5E0FA 2CETA 6CGTA 4ACZB 3L4XA 3UERA 1US3A 3U7VA 5HPOA 1Q6GA 1WPCA 3BAYA 5IDIA 4HU8A 2WVVA 4LQ1A 3VDCA 1M7XA 3W38A 4N0RA 5CXPA 5FOOA 1WO2A 3W82A 1OGSA 4JFVA 1W91A 1B0IA 3B9DA 4UZUA 1NP0A 1EDQA 1GOMA 1VJZA 1E71M 2YA2A 4U2ZA 5M03A 1C8YA 4AD2A 5DEZA 1B3WA 1I1WA 2J78A 4UNIA 2WMIA 3RO8A 1KXVA 3U57A 1ECEA 1UD6A 1CLXA 2ZUSA 2F61A 1WDSA 4PMZA 1UR8A 1OGGA 2V3GA 3PZQA 5D9PA 4AIEA 4EAMA 1JXKA 1F4HA 1BFNA 2WMJA 3VU2A 4FLSA 5I78A 2PI6A 5E0CA 2VX6A 3GXMA 2WCAA 3NYDA 4WKFA 1CXIA 1TR1A 2W62A 5JIWA 5JBFA 1M04A 2G4FA 1DHKA 1XC6A 1R87A 4P7OA 3K46A 1X1NA 4W87A 3VIGA 3NDYA 1WE5A 1W9UA 4U3CA 3WSUA 3GH5A 3ECQA 4MB5A 2VTFA 4WSKA 1CLVA 2G3JA 1ZBWA 4U5IA 2WVSA 3WD1A 3NIYA 1ESWA 3GYCA 2FHCA 2UWFA 5E6YA 2WC3A 5F7UA 5CLWA 2ZX9A 3AZRA 1NH6A 4L4PA 4U3AA 1H2JA 1HVXA 2PF0A 1EO7A 4X0NA 3KL5A 4IUGA 3W81A 3N1AA 4B16A 4EK7A 1KGXA 2BV9A 5CZKA 2J7EA 4UFMA 3VIPA 2WMFA 4MNKA 5D9NA 3BAXA 2WC4A 3WL0A 4B9YA 3SCWA 2YJQA 2BY1A 3O2LA 4A3YA 1UHVA 1JNDA 2QHAA 1GOQA 4AD4A 1QW9A 2E0PA 2HISA 1Z32X 2JE8A 1XSIA 4RE3A 4GIAA 1PEZA 3AMDA 1DWGM 1V08A 4M8UA 3VD5A 1HJUA 3WKZA 3WD4A 1WCGA 4W88A 2BY0A 3GM8A 4PTXA 3RIKA 1U33A 3AIBA 2UY2A 3WUFA 1HJWA 3N12A 1EGZA 3W0KA 3G6LA 2CKSA 1IZJA 5LA0A 5CQ1A 3WNNA 5A6KA 5A8NA 4U2YA 3WQ5A 3FXYA 1GOKA 2FGZA 3VIJA 1W9DM 1LL6A 4MB1A 3W28A 3AICA 3MANA 4W86A 1ZJBA 3WFLA 1WP6A 2MANA 8A3HA 2XIIA 4PMDA 4CD4A 1L8NA 4EKJA 4KRUA 2CHOA 2J8FA 3OG2A 1CENA 1JGIA 4PMYA 3SURA 1E70M 3OBAA 3K1DA 3CMJA 2DSVA 3VD4A 4D6HA 1ZL1A 3DECA 4B3KA 1E4MM 4FMVA 4V2XA 1W9XA 3AYRA 3MKKA 1HJXA 4QLKA 4J3UA 5A6BD 1CIUA 2NSXA 1EQPA 3NSNA 3WUBA 2WLZA 3RILA 2JEPA 4AW7A 1QI4A 1BF2A 1DP0A 1XH0A 1GHRA 3GDBA 4AZIA 2D3NA 4QCFA 3WNPA 2D22A 1E15A 3WNMA 4LPCA 1VRXA 3TA9A 3K4DA 3WNLA 2YIHA 1C91A 4AD1A 5FD0A 3GZAA 3AJ7A 2WYSA 5BRQA 5A2AA 3VD9A 3VIOA 1J0KA 2YBTA 3T2PA 2D20A 2WB5A 3BLPX 1UWSA 1BLIA 2J79A 1HJSA 1UR4A 3TTOA 3ZQ9A 2DT3A 2XTKA 3CZ8A 2VO5A 3LPFA 3VIFA 5FL0A 2QPUA 1BVZA 1CPUA 4W5UA 3WD3A 4L4OA 5E09A 3GNRA 3VM7A 2ZUUA 2W91A 1YQ2A 1DWAM 4J3SA 3ZJKA 4AZ5A 4PSPA 1C92A 3AQUA 4PMVA 1BSIA 1WZLA 1QPKA 1GPFA 3WY1A 3ZT6A 3WEZA 3GNPA 4PTMA 3K8LA 4D6GA 4GO8A 3M7SA 1XYFA 3CBWA 3OZPA 5DFAA 1NOUA 2W92A 3WDIA 2D1ZA 5I0DA 1HT6A 2F8QA 4TOQA 2BY2A 1EHNA 2CHNA 1DTUA 2VOTA 4AEFA 1UA3A 1XHGA 4GZEA 3WNKA 1W3JA 3WN6A 1CZ1A 1DWFM 2J74A 5TD4A 5I5RA 3SUVA 1BAGA 1V6YA 4MAVA 4GINA 3SCVA 3WELA 1UD2A 2PWHA 1M03A 2V3DA 4UOJA 3WBEA 4ZENA 1UH3A 3VIKA 3AXIA 1OBAA 1HP5A 5A2CA 1SYTA 2PWFA 2V5DA 1ZBVA 1V02A 4OOUA 3VGDA 1WKYA 3BAIA 3IJ9A 4F79A 2CBUA 4TVDA 1AQ0A 3WBAA 3IJ7A 4Z2KA 3VGBA 3AS2A 1ZBKA 1PZ2A 2ZXDA 5LA2A 1QBAA 3I3BA 3WF3A 1XYZA 5I2UA 5AC4A 1B3XA 1UD4A 4C7FA 3PZNA 2E40A 5FIPA 1E6RA 3AHXA 3B9EA 5GNXA 2Y8KA 3CO4A 3AS1A 2XM1A 4URIA 3L4UA 4PCTA 4P8UA 3N04A 3BGAA 2VZOA 2DSKA 4PMOA 4GPNA 2V5CA 3VILA 1QBBA 4CU8A 1LG2A 1VJSA 4MNJA 5M5DA 5EFFA 1BYAA 3ARRA 4M24A 3AOFA 4JAWA 3BAKA 1LF1A 3ZSSA 4GI6A 1V0LA 1SR0A 5JBEA 1E0VA 1JFHA 3BLKA 3WQ6A 1JL8A 1IV8A 2Z1KA 1MFVA 1MWOA 4ACYA 1QI3A 4OOZA 1GUVA 2WMHA 4QDMA 4KH2A 1KXHA 2A3BA 4UQDA 1FFQA 3POHA 4Z2HA 1WZKA 2DPEA 1W3HA 3UG3A 1HKIA 4DWSB 4DUWA 1F4AA 1I75A 1J11A 1UKSA 2PC8A 4AD5A 3BC9A 1V02E 4MB4A 2VMFA 4WF7A 1E72M 5HPCA 1E55A 3MSGA 2VI0A 1PX3A 3PHAA 3AMCA 4EANA 2D24A 2ZX8A 3WMCA 2DSZA 3CMGA 1E56A 1WZAA 1K9DA 3AHYA 4MADA 2VQUA 3AYSA 5I77A 3RCNA 4W5ZA 1H09A 1KXQA 2OWCA 4M1RA 4ZXOA 4LYRA 3ZO9A 5IHRA 3WD2A 1OB0A 3AHZA 4CVWA 3EMCA 5ABHA 3AIQA 3M6DA 3CZKA 3OGSA 4IPLA 5A6JA 1UR9A 3FAWA 2CBJA 5JIPA 1WDPA 3EDJA 1CGXA 1B1YA 3HMCA 3KE0A 4AD0A 1UG6A 2WHJA 1TUXA 3ZOAA 5C8BB 2DGAA 1KWGA 5ECUA 4UCFA 2G41A 2YLLA 3ZR6A 1E4IA 2ZXQA 5AYIA 4PCSA 1OD8A 1DEDA 4QAWA 4CVUA 2E4TA 2VQTA 2CESA 4MNLA 3CHEA 3T2QA 2YBUA 4CN1A 4LGXA 3GBDA 2ZUNA 3SUSA 1X6LA 3CZLA 3PZTA 3CZEA 4TX8A 4JFTA 4XZWA 3OLEA 2ZIDA 5ABFB 5A6AA 5I3DA 4LYQA 1W9PA 4KGJA 1UOKA 3EDFA 3NSXA 1E3XA 4TXEA 2EPLX 1LJYA 1OWQA 4D6JA 4J27A 2VX7A 4OBRA 5HNNA 4AIUA 1VIWA 2EQDA 4BQ5A 4TTGA 2WHLA 4S3KA 2TAAA 1FH9A 4GI9A 1V6VA 1CXHA 1E4LA 1CGVA 1W2VA 4MJ4A 1UZ4A 4JKMA 4W84A 3WDPP 3L4YA 5A69A 4TVCA 5BWFA 3BSGA 2X2YA 2WWDA 3S2CA 1G01A 2FDMA 1EHAA 4J3VA 2XFFA 2CPUA 1UKQA 3HJEA 2GJRA 3F4VA 3OLDA 3CUJA 1OT2A 1I1XA 3N11A 2X05A 1WDRA 1UWTA 1S46A 1HJVA 1RP9A 1FHLA 1OSEA 2X1IA 1KGUA 1NARA 1W9BM 2FHBA 3QHNA 3WFZA 1KQYA 4AWEA 1V0MA 4OJYA 4FLQA 1CBGA 1D2KA 3JUGA 1W1TA 2WAGA 3ARTA 4H8VA 1XCWA 1XSKA 4MAZA 4C7DA 2WZEA 2WC7A 1AVAA 1ISWA 2VL4A 2YLAA 4HOZA 4TUFA 1UKOA 1GQJA 1EDTA 2YL6A 5EB8A 5KEZA 4AZGA 4AZHA 3VIIA 3SUTA 1UH4A 1H41A 2GVYA 1E6SM 1ZJAA 5FL1A 1QNQA 1FFRA 1MW2A 2UY4A 3EBVA 3AXXA 1B90A 3ZSTA 1GORA 3OA5A 2WHMA 3L4WA 1KXTA 1W1YA 4CD5A 3BMWA 3CUFA 3MMUA
chains in the Genus database with same CATH superfamily
4QEHA 2YFOA 2HMCA 4Z17A 3AYVA 4DBWA 1SZEA 2I9UA 4Y8EA 3T0BA 3LQGA 2WVTA 1JULA 3K1GA 2D2OA 4DBEA 4D6CA 1AQHA 1B57A 4PSRA 1BG9A 1WXYA 2ODOA 4QE4A 2PDNA 2XPKA 3WQCA 2VCAA 4C91A 4JHOA 3LCHA 4ZO9A 3N2TA 2FHFA 1EJTC 2WPGA 3S1WA 4NXSA 2BMBA 3V1PA 3AISA 2GJNA 4C6NA 5JH1A 2NV1A 3WQFA 4WJ8A 3EA1A 4XVDA 3RPDA 1UR1A 2VGFA 3CZGA 4OZOA 4QQUA 3S1GA 1Z48A 3ZMRA 3OO2A 3TA6A 3TFXA 1JCNA 3QKZA 1QK2A 2DEPA 4H9UA 3WL1A 1HZYA 3CWNA 4D6EA 3H2NA 3HU7A 5CPOA 2NX9A 1XQLA 3AROA 3VGHA 5CSUA 2AL1A 2Y63A 3TZFA 4KGLA 4A22A 2ZWYA 3VZXA 2XH7A 1DJHA 3N6QA 4PRWA 2HNEA 1FWRA 3IJQA 5AVHA 3A4XA 4WK9A 3ZM8A 1NFPA 2Z27A 2OWWA 1UWAA 3OG3A 3WJYA 1FP8A 5K9CA 1UC5A 1E1EA 4PRRA 2V38A 2E3ZA 4E2BA 4C6BA 3E2SA 2YOCA 2DW7A 4IICA 4F0HA 2ZX7A 3KX6A 4QE1A 1A3HA 5BNKA 2H90A 3C6CA 3P2VA 3NEHA 1J96A 4Q6JA 2ZUTA 1GVSA 2I9EA 5FA5A 1JUEA 1UASA 1GW9A 4G7EB 1POKA 2WZIA 1OF8A 1LLWA 3F7JA 1JUBA 3A21A 4LEQA 2BVYA 1SO5A 4O1DA 3RU6A 1GHSA 3UW6A 4YL2A 3W7KA 3BOLA 3QYQA 3KXQA 2QKFA 4IUOA 4F8XA 3VINA 4PYSA 3GDKA 2BHZA 3LCXA 3W1AA 3MCMA 3B8DA 1H1NA 2X0YA 4UQEA 3KBJA 2ANUA 2WBGA 4GGHA 4CNNA 3DOPA 3TYUA 2NVAA 4DF0A 5LSMA 5ENLA 1JCLA 4CCCA 3E1F1 1VFOA 1R7OA 2PB1A 1ZTVA 4BQ4A 3NJ3A 4WD0A 3Q45A 4B2DD 2NUWA 1JYVA 4RE4A 3KOYA 4I3GA 4HZ7A 4O4WA 1GQIA 3K4WA 4AZCA 3ME3A 1BYDA 3WQVA 9CGTA 3QLDA 1A5BA 1TV2A 2WMIB 3HG5A 5A6BA 2CBVA 4IOTA 2EO7A 3OBEA 3PZ9A 1B3OA 4NSBA 3ITOA 3II1A 4Z2IA 1JPMA 3PZMA 1FH8A 2FPTA 2WWCA 1I0BA 4GVIA 3R8RA 4L6HA 9XIMA 2J75A 1BXNA 3V0SA 1JXJA 1WDQA 1X6UA 3NO3A 3VD7A 5D32A 1XDMA 2WKLA 3CLMA 3A3HA 1DXEA 4BK9A 4QRNA 3E0FA 1MFUA 3QOKA 4CD8A 1F05A 2Z28A 4M81A 2RDWA 4LXFA 2F6KA 3B0YA 3TOYA 4ATDA 3R58A 4MZ8A 1OQFA 1D9EA 2CKRA 4JZ5A 5D2TA 2WNWA 3TZNA 1F73A 2NQHA 2PP1A 1I2PA 3JR2A 4MY9A 1JPDX 4UFLA 1W1ZA 5CLTA 4A2SA 1XW8A 2A6NA 3EB2A 3B0UX 4I5RA 4MG4A 1UKTA 4P8XA 3A13A 1SR9A 3VNJA 2QUMA 4S3EA 2X09A 3EPMA 3R25A 5CG7A 2HDJA 1VGAA 1VBHA 2XSAA 2OZTA 3F4DA 1CNVA 2A1YA 2PRLA 1GJPA 3LM3A 2QW5A 2ASHA 3IK2A 4KWWA 4E4UA 4UOZA 2PD5A 2E9BA 3EWWA 4CD7A 4YIWA 4EWJA 1VFFA 1JI2A 3NZPA 1S3HA 1VBUA 2FJKA 1OIFA 2G37A 4CCEA 3MP3A 2O56A 2XVLA 1TPWA 1FUYA 1CGTA 4X9SA 3A64A 4LEFA 4PUKA 3WDJA 1VEPA 3EDKA 3G5EA 2REQA 4P7RA 1RAKA 1ZRQA 1EJSC 3UGVA 3PUGA 3HFTA 5F1UA 2PE4A 2VR4A 5IM51 4XQ6A 4DM1A 1YNYA 1AL7A 3P82A 2INEA 3LHUA 5HMFA 2O7QA 1PX4A 1E0TA 6PTDA 1KBBA 7TIMA 3DX5A 4CCDA 4Q22A 3NQ7A 3ARUA 3FVMA 4RZ4A 2PPGA 4EVZA 3N9RA 3CQHA 4Q8PA 3U5UA 1F8IA 2ZRVA 3O07A 1NF7A 4ZSTA 3FW6A 3ABOA 4MNMA 1A47A 3CGTA 2VD8A 3QR3A 1AJZA 2F84A 3BXWA 4INFA 3LTYA 2W67A 1QU4A 4GYFA 3R94A 5AB3A 2A5HA 2ISSA 3WLJA 1O12A 2PSNA 1OJXA 4YTUA 1L8PA 1UKPA 4JTLA 3CEPA 4X2PA 4PUDA 1PIFA 1IGWA 4Q8WA 4ZXLA 3FS2A 3NEVA 3Q94A 1XPGA 2UZ9A 1BYBA 3BSMA 1W56A 3R8GA 4IZGA 2AKZA 1MEIA 1AODA 4A8LA 1N2VA 3GXDA 2WV8A 1C8VA 2OSXA 1JCJA 2VEKA 2OO6A 4RNIA 4CKQA 4DNMA 4CQ8A 3ZS4A 4UBPC 2YXXA 1IZKA 2JGYA 1OHLA 1P6WA 4GUHA 3GTXA 4J4KA 3KWSA 2E5CA 5KTLA 3OZMA 4C6JA 2WMGA 3MV01 3VPLA 4DYKA 1K6WA 5A94A 2OG9A 2ZICA 4ENLA 5LNVA 3E49A 4L9XA 3CZJA 4QS6A 3BAWA 3PWIA 1UA7A 1UZ1A 3LOTA 1B4KA 2C6QA 3WK3A 1F8MA 2R1MA 1BVNP 3R10A 5AFDA 2OGYA 1XLCA 1PCKA 2MNRA 2GGIA 1OX5A 1JAKA 2O0TA 2YDRA 2DZWA 4HHLA 4QLJA 4TTUA 3WQDA 1ZAIA 5EA9A 1A49A 3U7BA 1JZ5A 2DZUA 3UJ2A 4GZIA 3MJYA 3LNMA 5IOBA 3DIPA 1ML1A 4YCPA 3LRLA 1LZOA 3RMEA 4G56A 4G7EA 3P60A 1EPVA 1H3GA 2VFGA 2OYLA 4GABA 1WZMA 2JALA 1DJZA 5DELA 1WKFA 4RJEA 2GQ8A 4WUIA 4HTBA 5I79A 4EPBC 3DHFA 4HK7A 1CXEA 3OYXA 4XB3A 1I60A 3MWAA 3SUWA 1YDYA 1MW0A 1K4HA 4HK5A 3TJIA 4H6KA 3W22A 1H11A 2G96A 4LH8A 5CPTA 1JEZA 3KRUA 2GJXA 3ZT5A 1SPQA 1E0UA 4HYWA 4QXIA 5F2IA 5FEWA 2NWSA 5LZLA 4JTIA 4XBJA 1PV8A 3F4NA 4I7VA 1K3UA 2AMGA 4Z0SA 5BMWA 2DY3A 2DSWA 3UNDA 4C6CA 3RPMA 4WX2A 1XI3A 5FKYA 2VDHA 3M0JA 2CBIA 3GVVA 5FJRA 5C70A 3T0CA 1AJ2A 2D0FA 3GTFA 3RN6A 2IXVA 2W4XA 3W84A 2WJDA 4ZB5A 3WUEA 4IJBA 2Z1BA 4HOXA 4N6FA 3W4RA 3IJ8A 1K8CA 4GHRA 4HHMA 3SRKA 3TU9A 3ZIZA 1SU5A 1R7AA 2ISDA 6TAAA 2VC9A 3QZAA 3MP4A 3KTCA 2WCSA 3TMLA 3VKAA 2QQ6A 4GC4A 2XZ9A 5DANA 1DE6A 3CB3A 2EEXA 3KLKA 4M80A 4MSSA 2OEMA 4EIVA 1NWTA 4C1KA 4FLOA 1LWIA 5LHEA 3BZJA 3FFSA 4QITA 4BS0A 3OEXA 4WKAA 1FHDA 4XAYA 2EHHA 1H5VA 1GOOA 3EDEA 5JVLA 4GUFA 3UZZA 1W5MA 2X40A 4IX0A 4XTDA 3LLFA 5EMYA 2G4JA 3CL8A 3QM3A 4OUEA 4NRRA 2YL8A 4E8DA 2FZMA 4OECA 2XM2A 4ADTA 1UUQA 2OEKA 3NVDA 4YJ5A 5D2WA 2PDWA 3QBUA 7REQB 3WD0A 4HN4A 3PR2A 1E6PA 2NT1A 1O5RA 4Q7NA 4XAPA 1CB7B 2G3MA 2CZ5A 1CWYA 2E77A 1HKVA 3M6YA 4B92A 5A3HA 3CQIA 1A0CA 3LCIA 4P8VA 1VD6A 1JG9A 1UD8A 3W7HA 5LNSA 1I2NA 3EKLA 1DXIA 1PKLA 4NZFA 1D3HA 1RA5A 1R6WA 4H7VA 3S5NA 1TJ1A 2YXOA 4CGTA 4M5PA 4P7LA 1JQXA 2Z2BA 3O6CA 3AZTA 3UJRA 3GRIA 4PMRA 4HZMA 2PCEA 2XH4A 4QNWA 4UFJA 2BS9A 1XL9A 2I17A 2Z2AA 1PTDA 5AC5A 2Y70A 3BL3A 5D9OA 3LPGA 2Q09A 3OB8A 1CW2A 4Y9NA 2BXYA 2J6VA 1U1JA 3AUOA 1FWNA 1R0MA 2PDYA 2W66A 1BHGA 1X6NA 3MU7A 2WSKA 1A5MC 4GZ7A 4IMEA 4J40A 5M2FX 4JHZA 3M07A 1V4YA 4H6EA 4Z2JA 1KCXA 1THFD 1CGUA 3S3GA 3QTPA 3T8LA 1EC7A 2V5KA 3S1XA 2ZUWA 1IYXA 5EGRA 2WPBA 2XU2A 1AG1O 4H9TA 2GVLA 1JQVA 1T8XA 2XGZA 3SCNA 1JDDA 1I6NA 2YW3A 1X1ZA 3TSBA 4O1FA 3UA4A 5I24A 3IK4A 2FGLA 4N7QA 3CU2A 4UQBA 1BWKA 3DYMA 2QCDB 3T78A 3HPZA 3TXVA 3W72A 1H7NA 3EPNA 3W7CA 3THCA 4MFDA 3WMSA 3BDKA 2Z00A 3L0GA 2BHYA 1AZ2A 2C8NA 3W70A 4NI3A 3NM1A 3BCFA 3DFYA 2GVGA 5D05A 1KBJA 3GG0A 1V79A 3BH4A 1CT5A 3CM4A 3DCPA 2QUVA 1TFVA 1C93A 5D2XA 1C7SA 1UP2A 4N9EA 1BGGA 4D6FA 2AGKA 2Q02A 4LCQA 4FK9A 3S6TA 4XBSA 3BG9A 4QFUA 1QVBA 3EAUA 1EUAA 1GVYA 4RL3A 4UQCA 2FB2A 1X39A 5E9AA 4R88A 4DWSA 1VIZA 1HXJA 3N14A 5DXYA 3ELFA 3NQVA 3OLIA 3LMZA 1O6IA 3NUKA 4F0RA 2EJ1A 4ML4A 2VZSA 2F2KA 1GQLA 1CXLA 4JOMA 3G6MA 1NIUA 1SZFA 3R0UA 3CT7A 1WKDA 2HS8A 3PNUA 2R8WA 3NZGA 1VPYA 2CZFA 2WLYA 4M82A 4UFIA 1AQFA 2DSUA 5E70A 4E8CA 1FWFC 1XH1A 2XN2A 5HMDA 4K68A 4YXGA 3W37A 2ZZ7A 2BDQA 4K1WA 3LLXA 4X2RA 5CPSA 5CSSA 1NOWA 2XIBA 4D1IA 4XIAA 1W3TA 3NQ6A 3PK7A 3HO8A 4E3TA 5A1AA 3K5XA 4LFYA 4GUJA 3BWWA 1G4PA 4L9ZA 5C9XA 3W00A 1SVDA 2E6YA 1RCQA 4C5ZA 2Y7EA 1Q5MA 1TZZA 4LBSA 4NNCA 3IIOA 4LUTA 1E6ZA 4H01A 1Z9AA 2FDSA 4NG3A 2C0HA 4QM1A 2ZRXA 3TJ4A 1XH2A 3REQA 1OD0A 4HCHA 2YCLA 4D72A 1XWYA 1VF8A 4LWWA 3T7VA 2ZXBA 1V7AA 3GAKA 3FYOA 3RLHA 4F9DA 3E5BA 1QT1A 3O9NA 3QV9A 3LQLA 3OA3A 1GQNA 4B5SA 3UVIA 1GKRA 4AIBA 2C7FA 3UEQA 3VOHA 5FJTA 1HIZA 1B5TA 1MRAA 2EPHA 2D0GA 5BXTA 5EKYA 1F7BA 1GWJA 4RDYA 5I6SA 4PB4A 2A7PA 3S4TA 4KRZA 3BJSA 4JEQA 3DENA 1BF6A 3NTYA 4XZBA 3W1MA 2HBVA 2A3CA 3UR8A 1U2YA 3GTNA 4NI8A 1J79A 3MMWA 1LOSA 2OYKA 4AISA 4XO7A 1RSCA 4MYXA 3GO2A 3U5YA 1C8XA 2ZZ6A 1XIIA 5LA1A 4V28A 3MS8A 3W6YA 1FTXA 2PP3A 1L6FA 5KMYA 4DF1A 5IFPA 4OWGA 3WEMA 3RM8A 1FHVA 1XG3A 3FEMA 2NUYA 2F2HA 3E3HA 5CPQA 2Y4SA 1I0DA 3AHVA 2NQZA 4F0SA 7REQA 2PWEA 2HVMA 1P7TA 1J01A 4KF1A 2QXWA 3M47A 3WENA 1BWVA 2ZRWA 4O8RA 1VBRA 3E2QA 2I5IA 2QV4A 1E5NA 3ARYA 4DWDA 1MDLA 2CHRA 4JHMA 4ES4A 5DT5A 2QAFA 3MUIA 4QG6A 5I02A 2DZTA 1AW5A 2P50A 2Z29A 3HG3A 3LI0A 4IG2A 3LXCA 1YTKA 3G0SA 3OODA 3GG1A 2CETA 3LCFA 4NT0A 3SGZA 4ACZB 4HYVA 3L4XA 3NOYA 1DJXA 4NILA 1IEWA 3EX2A 4LQ1A 2HS6A 5CXPA 5FOOA 3UZJA 4C6OA 3T81A 4HN8A 4N4QA 3W2LA 1H5YA 1QWGA 1TV7A 4A35A 1ZFJA 1NP0A 1HGYA 4RCXA 2ACRA 4IFRA 3DI0A 1C8YA 4XZHA 4AD2A 5DEZA 4GK8A 5KZEA 4E38A 4TMCA 4LALA 1O95A 3G2GA 3M41A 3AUJA 3UU0A 2OJPA 4I9MA 1XC4A 4K7VA 4EXQA 1S2AA 1JXKA 1M41A 1F4HA 2HK0A 1BFNA 1UMLA 2B7QA 3GUGA 3TC7A 7PTDA 4Q4KA 3L67A 1XLAA 3GXMA 4EF8A 3NYDA 4P5UA 1NJJA 5JIWA 5JBFA 2PTXA 3KVKA 2G4FA 5G2WA 3R79A 1XC6A 4LAUA 4FF7A 1XLGA 3O16A 4XIMA 3LK6A 4XZMX 1G7VA 4MB5A 2HE8A 2VTFA 4N9BA 1CLVA 4HA0A 4CQCA 3KOZA 1XIGA 3ITCA 3WD1A 3NIYA 3NO5A 2Q71A 2UWFA 3NFUA 4KW2A 1NH6A 4IFOA 1AK5A 1PS9A 3KL5A 4IUGA 1J5TA 3N1AA 1T40A 4OQVA 2YYUA 2J7EA 4KCWA 3ZR4A 1GVEA 3G1YA 2WC4A 3URAA 2FZ9A 1SFJA 1FCUA 4UTUA 2YJQA 2HTMA 1QTWA 1OEPA 1LROA 3PBYA 1GOQA 4AD4A 1R30A 4ZGYA 1VBJA 5IRPA 1P1MA 1QK0A 3UZXA 2HPMA 2JE8A 2P10A 4NXKA 1PEZA 3AMDA 1V08A 4M8UA 3S2LA 2TMDA 2QZRA 2H9AB 2WSYA 4W88A 4AG0A 4LF1A 3N12A 3RUBL 2O55A 3WNNA 4JTQA 1Q6QA 5F2MA 3W2KA 1XBZA 5A8NA 3M0HA 3WLHA 5A8GA 1KBIA 1WKEA 4RUBA 3W7LA 1RCXB 3V5OA 4WRHA 4KERA 1X8CA 3I68A 1EJWC 1F3EA 1WP6A 2CZEA 1XLMA 1TREA 2ADAA 3OG2A 1JGIA 2WKJA 3URQA 3I4EA 2VGIA 4JTCA 1Q8AA 1E4MM 3GHSA 4V2XA 1W9XA 4US5D 3MKKA 4HNCA 4RPQA 1EQPA 3PB0A 3NSNA 1VS1A 3DFNA 1BD0A 2E1DA 4AW7A 1VHCA 4UTIA 4KFOA 1GHRA 2AQVA 3C2RA 4AZIA 3SM0A 1XYLA 1ENUA 3TA9A 1Z3NA 3WNLA 1C91A 3G1HA 3KDNA 1DJGA 1K4GA 1XFBA 3LERA 1YTEA 3DESA 4GNVA 5BRQA 5A2AA 3H2CA 1XLKA 1YPIA 4ZOAA 3VIOA 1AZ1A 2H6RA 3QMTA 5FACA 3T2PA 2NWRA 1F6PA 1WXZA 2D20A 1UWSA 2J79A 4LRSA 4CNSA 2DT3A 1J5SA 1ADDA 4FPSA 3V5CA 1ICSA 1SM9A 1H60A 1R9YA 3DKJA 3GNRA 4U4MA 1Q2SA 2ZUUA 1DWAM 1XCFA 4J3SA 1RHCA 5C9WA 2YFNA 4AZ5A 1TTJA 4GA8A 3AQUA 1YNPA 3RR4A 2OU4A 4Z08A 4NX5A 3WY1A 3LGDA 3ZT6A 2IKJA 3GSMA 5KETA 1MDRA 4GO8A 3PBMA 3JZUA 5DFAA 2W92A 5I0DA 4G5DA 2VKZG 4P61A 4QROA 1XBXA 3EXSA 1DTUA 3RF9A 4ZR8A 4AEFA 2ACSA 4R7OA 3QY7A 5FI8A 1W3JA 1DWFM 5I5RA 3DFOA 4XAFA 2PWHA 2QCHA 1W1IE 1DBTA 4HCLA 1TYGA 3VIKA 3ZLHA 3AXIA 1YLVA 2WSRA 1SYTA 2PWFA 4BI7A 2W9MA 4WDXA 1ZBVA 1V02A 3QLLA 4I6VA 4LTSA 5FSDC 3UQNA 3IJ7A 4GIEA 3VGBA 3FA4A 3BJFA 2KX9A 1Z7AA 5AC4A 2OQLA 1UD4A 4YVPA 3PZNA 2E40A 5FIPA 4BWLA 1ECQA 4ZQMA 5MKGB 4AMAA 3R0KA 2CLEA 4PCTA 4P8UA 3LHTA 4BFAA 2VZOA 1LG2A 4LC6A 3H55A 4PGLA 4M24A 3DBNA 3KVMA 3EKZA 3WO8A 4L65A 2VFHA 2Y5JA 4QDWA 5AC6A 3GDTA 3UWYA 2VENA 4HJFA 1EWEA 1JL8A 1IV8A 4C1LA 2P53A 4MKSA 3UPWA 1MRQA 1VR6A 2WMHA 4KH2A 4UQDA 3POHA 2DPEA 4M0XA 1W3HA 2XH2A 1HKIA 2YB1A 3ES7A 3FDGA 1J11A 4AD5A 4GRSA 3ITGA 3HTWA 8XIMA 4QQ3A 2ATSA 5LNRA 4JIIX 3VC6A 3URNA 3WQGA 2XN0A 1E55A 2VI0A 4JBRA 3BMXA 3PHAA 3LCWA 1EGMA 4EANA 1A80A 3WMCA 2HK1A 3V1HA 1E56A 2TSYA 4MADA 2QYGA 3RLUA 4W5ZA 4FNRA 2E1WA 3AWNA 4FS9A 2C15A 3WD2A 1OB0A 4TV5A 4UR8A 1P0NA 1Q66A 2ZZ5A 3AIQA 5FJIA 3CZKA 1UR9A 4FOKA 1LOLA 2CLIA 2Z2UA 4PZVA 3KE0A 1UG6A 5E9XA 1KFJA 3PY2A 4UTWC 4AHOA 5AECA 3P67A 4DXVA 2GQ3A 1IE7C 1GYLA 1SO6A 4PCSA 2I14A 2BB0A 1DVJA 5HJLA 2P8CA 2BP1A 3PAJA 2E4TA 5EL1A 1F9CA 4F3HA 4MNLA 2QCGA 1Z89A 3W7OA 3W23A 4GMEA 3GBDA 1X7FA 4XZWA 3QZEA 2ZIDA 2EG7A 1DV7A 1Y0EA 4KGJA 3QR0A 3GDRA 3EDFA 3NSXA 1NDZA 3OHIA 4FX7A 4D6JA 1D8WA 3B0PA 3P81A 4XZNX 5HNNA 4AIUA 3E6EA 1KTCA 4S3KA 1Q6LA 2TAAA 1UJQA 4GWEA 3PNZA 1V6VA 3AAMA 1E4LA 1SGJA 1CGVA 1W2VA 3MSRA 4JKMA 4W84A 4GD0A 3WZ0E 3STEA 3WDPP 4K37A 3W85A 5BWFA 4UC5A 3KP0A 3THQA 4QSFA 4ADSA 3CL6A 5HWJA 2FDMA 1QWKA 1IWAA 4S23A 3HJEA 1GK8A 3UXKA 2CW6A 5J5RA 3W7RA 3SECA 3W2NA 3NQBA 4ZZ9A 3VKJA 5LIWX 3KOXA 2V6AA 1RP9A 4XD6A 2OMAA 1OSEA 2X1IA 1KGUA 1W9BM 4AWEA 1WOAA 4L4LA 4OJYA 5M1TA 4XD5A 1V51A 1OABA 2BGNE 3D46A 5DY3A 5D09A 3O3RA 1XCWA 1XSKA 3M64A 3A12A 5DBUA 3W7EA 2PTYA 2V0TA 3W1RA 2V69A 3S83A 3S5OA 1KV8A 3VIIA 1H41A 1ZJAA 3O1NA 3G22A 4NZ4A 3TIMA 1LUCB 1FFRA 1MW2A 1GORA 3H4GA 5CGQA 4FR1A 2DUAA 3FV9A 1IIHA 3LD5A 3L4WA 1AH0A 1U22A 1KXTA 1W1YA 4CD5A 3EWBX 1KRMA 3CUFA 1OFDA 5HJYA 3TW9A 4S3BA 3AXMA 3VGGA 3TTSA 5M3WA 3UVAA 4Z2GA 2B81A 3KVLA 5FEXA 2GQ9A 3HPXA 3VAVA 3PTKA 1R86A 4HTYA 2CCRA 3P0WA 3KCOA 3FSUA 3QQWA 3LDVA 1TTQA 4KQNA 3WH8A 2IS7A 2VVSA 2Z6JA 3G8RA 4OV4A 4DPQA 4LUYA 1K02A 2QJGA 4TV6A 4IISA 2DZAA 5G1MA 3NQGA 1E6NA 1K7XA 4NZCA 4AVNA 2Y5EA 1E9LA 4LNYA 3U2OA 4UTKA 2D3LA 1A0EA 4I9AA 1SFLA 4J9JA 3PFMA 1SSDA 2J7DA 3LA4A 4Q7BA 4P8WA 4G1KA 1YXYA 1GEQA 4UQAA 1CYGA 3AIUA 3J7HA 3URBA 3BURA 1BQCA 3SJNA 3HB9A 5ABFA 2X0SA 3B03A 1PPIA 3CHFA 4KCUA 4ATWA 4GI8A 4W7UA 3N29A 5C2XA 3VMPA 5G5IA 4P7QA 3T40A 1J0ZA 2BODX 3TYZA 4JYEA 5D02A 2JKEA 4GFSA 3W2MA 5JUVA 3N34A 3W7MA 4O52A 4AB4A 2DJXA 2Y1HA 1OYBA 3NR0A 1YDNA 4ZSUA 4YVXA 1MUWA 3LSBA 1KFWA 2QNEA 3FX4A 3G1SA 3EWUA 4C1NA 4AXNA 2ZXAA 4UTTC 4NAFA 4WKHA 1XLFA 1IGSA 3GG7A 3MI3A 4GOAA 3IPWA 5D04C 5LIYX 2ZZ3A 1XIBA 3SRHA 2HXTA 1PBGA 4X9YA 1H4PA 1HX0A 4IXHA 4WIWA 1RVKA 5C9UA 2FMOA 2ZUVA 1EOMA 5FF3A 3S5ZA 2PLKA 1OG6A 5D33A 1IIGA 2ESCA 4RNHA 4GJIA 3PZVA 4XWUA 2VZVA 1O94A 2Y2WA 3TE9A 4HNTA 4HSOA 1IHIA 4IGHA 2PGEA 3SIZA 1F3TA 3W26A 2CZVA 1AMKA 3GX9A 1XFCA 2JEQA 3SFWA 1G4EA 3P0XA 3W2UA 5AYXA 1A3XA 1RLDA 3QY8A 4O0QA 1PB0A 5FCZA 3EKGA 1GVIA 2RGLA 3NM3A 1H7PA 1HL9A 4DO6A 1EDGA 2VVNA 3M43A 4DF2A 5C2CA 2BWGA 2QJNA 2VR5A 5CAKA 5EMLA 3WK2A 3UGRA 2Y88A 2XIJA 4KFNA 3R1ZA 3S2NA 1V3JA 4LS1A 2Z1XA 4LUSB 3FGCA 4UOQA 4GX9A 4XAGA 2VEMA 4CCZA 2VX4A 5E6ZA 4GIRA 1E51A 4G7FA 3SIMA 2NSOA 2QCDA 4H8UA 2F7FA 1V03A 1V3IA 3VKCA 3UPMA 1Q6FA 5AHEA 2ZC1A 3ENLA 2FIQA 3OLGA 3QW3A 3UCDA 3THDA 2HZGA 2W0UA 4PE8A 3BK0A 5EMUA 1JYNA 2E9LA 1UCWA 2PDKA 3BCDA 4X3ZA 1XV8A 4H2HA 5D8ZA 2ACQA 4HVXA 5K4ZA 1TA3B 2QDDA 2J9ZA 1YMYA 2X7VA 3D3AA 4HA1A 3MW7A 1CXFA 4RDWA 4JL2A 4JIEA 1J2BA 1ONRA 3UETA 3GZ3A 1R8LA 2J7BA 2OTDA 3MUAA 5XIAA 1V6WA 1MQPA 1K9EA 3RR1A 1VEOA 4DZ5A 1J6PA 2BHUA 4JTKA 5LGXA 4Y9MA 3TK7A 3MCOA 1ONEA 2ZVIA 4UXDA 1TPFA 3IJLA 5C9RA 5DRCA 1PAMA 1GVFA 4OBSA 5TIMA 4AC7C 3GR4A 3PN8A 1LG1A 3W7PA 3AXHA 1VFMA 1JYXA 1UD5A 5E1QA 3B97A 3HG4A 4MMWA 4IIBA 3N17A 3TP4A 4JCMA 4B91A 4G2DA 2G97A 4Q8NA 3IJDA 1O4UA 2DVUA 3DHUA 3REQB 3S9YA 5LNWA 2GYIA 5AHNA 1JPIA 3B8IA 4LVDA 4E6MA 3S42A 3QRHA 5HUPA 5ECVA 1E1CB 1R47A 2WZHA 1HJQA 3KCLA 3GC5A 1G9HA 4JQ3A 1TVPA 2YA1A 3ZJ7A 2XJ7A 2PDLA 2ZE0A 3GHTA 2B4GA 2OSWA 2E67A 3PUEA 2ZX6A 3VMOA 1IT8A 1FP9A 1FCQA 2KAUC 1JF5A 2G95A 1ZALA 4I9TA 3OGRA 3EB4A 1VCFA 3KS5A 2EXOA 1ELSA 4FP1A 1R3VA 1SZGA 4AFYA 1FA2A 2VFFA 1EOKA 4KCTA 1UQZA 3T09A 4LCRA 3GH7A 2GJLA 4OV9A 2GOUA 3MKVA 4RR4A 4X63A 2JF6A 5HANA 2CLPA 3UCQA 3NVTA 3L4TA 4Y8FA 3U4AA 4F4RA 4TO8A 1I4NA 1WV2A 1PZ3A 2PAJA 3UZYA 4HNLA 4I5UA 5BXRA 3OVQA 2EF9A 4DRSA 4NF7A 2PZ0A 4GBUA 1JAEA 5CJNA 4F40A 5TAOA 3H2MA 1MUCA 3AALA 4H9VA 2A79A 4DJFA 1CGWA 1H7OA 4H4IA 3VNDA 4XD3A 1V6XA 3W75A 4K2SA 5HBFA 1OFRA 1Y8BA 1XG4A 4LAZA 1PTGA 2YCEA 2BGQA 2V2CA 3VDHA 3CHDA 3EOUA 4W9TA 3WF4A 1EB3A 3CNYA 3BW2A 3ITVA 1PHQA 4KWVA 4NVTA 1KCZA 1Q6CA 2J9XA 1POJA 3FHAA 4AD3A 3VDAA 4JTRA 1BPLB 1LBLA 1DJNA 3BICA 1EL3A 4DIAA 5GNZA 4DYEA 1HL8A 5BCAA 4BEQA 4HMCA 4C1NB 3ZFHA 1MVYA 2D23A 2CWNA 3N9KA 4Q8UA 2A3HA 4JGDA 3VDBA 1LT7A 2RDTA 1Z42A 1DIKA 4YPJA 3TQ0A 4ZB2A 3S1UA 3WF1A 1JUKA 3SCRA 5TNVA 2YZ5A 3N9SA 4NJHA 3IV8A 2FZ8A 1OCQA 2QF8A 3PULA 3BUVA 2DH2A 3BLDA 1PUDA 4NJJA 3TH6A 3W7JA 1JI1A 3ARWA 3PSVA 2WMKA 1LLOA 1R2RA 5LHFA 5LXXA 2SFPA 3SR7A 3WCZA 2W79A 1SFSA 2X2GA 1NVMA 1XJBA 1XBYA 2ZYFA 2E28A 4CEXC 4PBGA 4C5YA 1FKXA 1UIPA 4JIRA 4JKLA 4HPNA 1SW0A 1UMYA 3S9ZA 1TJRA 3VIHA 3TC3A 4QCEA 2G5WA 3KWXA 4IGNA 2IUZA 3DDMA 1T96A 5KZMA 1CX9A 3MZNA 1ADSA 1EBGA 1PWMA 5HOSA 4V33A 2O92A 5HQEA 3WDHA 1PVNA 1ICPA 4H19A 3CV6A 3VK5A 3WFAA 3GVRA 4NX0A 2DT1A 4E0CA 2UY3A 3I3DA 4NZJA 1IT0A 1QOQA 3CV2A 3VDGA 4IT1A 2ZVRA 4LT9A 1AMYA 1U5VA 3TTYA 4KMQA 1EC8A 4JEJA 1WUFA 3CASA 3CTLA 4GXMA 5HATA 1K7EA 2V8ZA 4LSBA 1ZB5A 4IP7A 4Z2LA 5BOFA 1W54A 3PWGA 4AUBA 3WIJA 2CYGA 2QUTA 2CLFA 2AKMA 3KTSA 3WH9A 4AHQA 3EZ4A 3LHVA 3LHZA 3NZRA 3SZ8A 1OM0A 2PWVA 1LUCA 2VCBA 3TX9A 4YTSA 1MZRA 3LTPA 4IIGA 4ZTYA 4OT7A 1E3ZA 5G2IA 2QUUA 2AQWA 1LBFA 1OFQA 2VR2A 3IIPA 4IPNB 4Z1DA 1BTCA 4DAIA 1VFTA 3R5EA 4Q4PA 1V8EA 5DRIA 3TJXA 1ONWA 1TCMA 1DJWA 3DI1A 3WQ8A 4JQ1A 1L9WA 1XGZA 4PUMA 1EP2A 7CGTA 1HNYA 1MW3A 3P14A 4PUEA 4H04A 4DY1A 4Z1CA 4BQ2A 5F4SA 2YGYA 3WQEA 4B3ZA 4J7RA 5AVNA 4NJKA 5IXEA 1KR0A 3SCSA 3ABXA 3AMGA 3L4ZA 4HMNA 2Y8UA 2J62A 5C7VA 2AQOA 1ZENA 5EY5A 3M0YA 2WSQA 3MUZ1 3H70A 5AOUA 1OX6A 4LY8A 3CJPA 1NQ6A 3L23A 2OR2A 4B3LA 2VUYA 4E8GA 2WJEA 1TIMA 3MBDA 4JNYA 1XF0A 3C2EA 1WNOA 4S3JA 3K8KA 4O18A 1KWKA 1W8GA 2O9RA 4D9PA 3C5QA 4HNNA 3LTSA 5BYWA 3W24A 3GB6A 1ZNNA 3VOGA 4O1CA 1UQYA 5MF5A 3W27A 1I2RA 1S5WA 1NELA 1NWRA 3E5PA 2A85A 3UXDA 3EX6A 4MWAB 2W63A 3ZJ6A 4BY3A 5FEPA 2HSAA 3RGTA 1LL7A 3GY1A 3W7NA 3F2BA 1IWBA 2OCZA 1UD3A 4NYYA 4CNUA 3A23A 2VT0A 5G1YA 4R3UA 4MLJA 4PN2A 1FXQA 4GXPA 4IL2A 4MGGA 4R27A 5CAHA 2Y89A 2H3DA 4ADUA 4WGHA 2QCEA 2R24A 3M5YA 4M7SA 4TVUA 4PCNA 4US6A 2QPSA 4ZEPA 1P43A 4Q4MA 3MT1A 2GQAA 4I5XA 4KEVA 3OIXA 1DXFA 2VEFA 2YX0A 4PMJA 2ABBA 3FJLA 4L1XA 1R5YA 3AU6A 5CZJA 3PPGA 3VX0A 1F3WA 4EPEC 2OYMA 1M5WA 4W93A 1WDWA 1CDGA 2WW5A 3DFHA 3M0VA 4WEVX 3BPWA 1B9BA 4GZJA 4N42A 3WUGA 2PBGA 4AZCB 3GWQA 4L1WA 4UTJA 3EWDA 1FWAC 1VBGA 1ZY9A 3SUUA 4Q8TA 2YL5A 2Q6ZA 1RA0A 4L6DA 2VHLA 1KA9F 4DJDD 2YCKX 1MEWA 4D2JA 2C19A 2XSBA 3A4AA 2OX4A 2O9OA 3A24A 1MZHA 3ABSA 1OADA 2HJPA 1TZ7A 1GCYA 2X8RA 5A8OA 5HXMA 3NOEA 4R9OA 3BE7A 1Q85A 5AHLA 5F2GA 5HQLA 2FPYA 1VP5A 1DYSA 4OIFA 5D2VA 3MSDA 3C0QA 2VZUA 4DWSC 1BXCA 3FJ6A 3TQPA 3GFXA 4A8RA 2D73A 1TSIA 1B3VA 5HR6A 1B2YA 4IQLA 1XBVA 1T6MA 4TIMA 1REQA 3MVIA 3AS3A 4GGBA 4D6IA 5B7ZA 1M7JA 4FXJA 4GO9A 3KBSA 3C0JA 3LB0A 2J7GA 1D7FA 3T44A 5HDRA 3CYJA 2PMQA 2HEJA 3EB3A 5MHBA 3R8HA 1NDYA 1T41A 4XV0A 6REQB 3PWAA 4FXSA 4PMUA 1OVDA 1GW1A 3N2MA 5FAGA 1VYPX 1C3FA 4JFWA 1EUNA 1UWIA 3VKKA 4HPXA 2PDFA 5C7HA 2JQXA 5HMEA 4AIOA 5IBXC 3FN9A 2ZA3A 3F5LA 3KL3A 2FH8A 1FVPA 2J77A 1XIMA 1KBLA 3WMLA 4C90A 1XLHA 1EX1A 4ZE5A 3SCUA 4OUIA 3UG8A 4R7WA 1S2WA 3ZWSA 3JW7A 3AZSA 3GXNA 3GFYA 4LV9A 3BMVA 2EKGA 4NQ1A 5BXSA 1PKMA 1XUUA 1XCXA 4J3WA 4GH1A 3NO1A 3C56A 1BRLB 3WQ4A 1B30A 2FZBA 4WSJA 1OFPA 1UBSA 4NL1A 1KQZA 5G1TA 3OQEA 4ZVJA 4BI6A 3QTGA 3SRDA 4PMXA 1FX6A 1QFEA 4PCFA 5DMNA 1BKSA 4O10A 4CN6A 1BKHA 1H0GA 3IWPA 4UTTA 2A3AA 2A3LA 1QO2A 2HCVA 3TONA 1SZRA 2X1TA 4J2MA 4YWSA 2OLAA 5BXPA 8CGTA 3GVQA 1UR0A 4J2PA 2ZRYA 1ODUA 1VYRA 3MV11 5CGMA 2UY5A 1OGBA 4GACA 1R9ZA 1NM9A 3CQJA 3T05A 1GVRA 1W32A 2Z1VA 3N18A 3E0VA 3MO4A 3NQEA 4GCXA 2YA0A 4GVFA 3WLLA 4DJDA 1LRNA 2XFYA 1C7TA 3IUDA 4HYRA 1KM6A 1PKNA 4NIRA 2Y6ZA 1EZ2A 3VNYA 3ITXA 4ZFMA 1HF6A 2IXUA 4LVGA 1V77A 1JDFA 4JTDA 2EAWA 3CT2A 2WZMA 4M6QA 3B0XA 3B40A 3LBCA 4N0RA 1QMLA 1G7UA 2W6RA 4DO4A 3W82A 1EEXA 1W91A 1B0IA 1KC7A 4UZUA 3RK8A 4LJ3A 4TQTA 1LRTA 3H4XA 1JCXA 5JQ9A 2OXNA 4UNIA 3RO8A 3U57A 1ECEA 2ACUA 3OZYA 1UD6A 3RPTA 2ZUSA 4JDYA 4FB7A 3NGFA 4PMZA 3H7RA 5CCZA 3PZQA 3B3DA 3W71A 2IPWA 4CLMA 4EAMA 3PJWA 3WJXA 3CAQA 2Z25A 5I78A 1A53A 4E2DA 5CZ0A 3L2IA 4S39A 5E0CA 3UA3A 3IJ6A 3H7UA 4FIQA 4PFHA 1N7KA 1KNWA 3HF3A 4JX6A 1TELA 2PDXA 3Q37A 2BX7A 3Q67A 3HA1A 1KLZA 3QPEA 4L64A 1VCVA 1X1NA 4W87A 3VIGA 3W76A 3NDYA 4DVOA 5HNUA 1W9UA 1H7RA 3ISIX 3WSUA 2XSXA 1A5CA 3EWZA 6ALDA 3E0WA 3Q4DA 5I7GA 1FWGC 3QQ1A 4R33A 2VM8A 2BG5A 2WC3A 4RLIA 3JZEA 3CPGA 3AZRA 4L4PA 3DGRA 4U3AA 2PF0A 1EO7A 3GU2A 5JU6A 2OQHA 4EK7A 3O8AA 1ICQA 5FJPA 4HJWA 1ZJHA 4H8NA 5AZ1A 5D9NA 3BAXA 3O2LA 4A3YA 1JNDA 1QW9A 1RJRA 1X38A 1ALDA 1H50A 2NVDA 3AXKA 1P6CA 1XSIA 4GIAA 2IPJA 1ME8A 5FEZA 5IDZA 3M16A 3VD5A 1HJUA 1PO9A 1NAL1 4PTXA 2ATMA 3RIKA 3AIBA 2UY2A 3WUFA 1TMLA 3W0KA 1K7FA 2CKSA 3MZ2A 1TX2A 4RZ6A 5A6KA 4C6MA 4GXWA 3KOFA 3P84A 4PH6A 3VIJA 3A9BA 4QNEA 4ZMGA 1LL6A 3SBFA 4DLMA 4RX0A 3SGUA 3W28A 3AICA 3O06A 3MANA 4W86A 1ZJBA 2WJZA 3WFLA 4ZOCA 8A3HA 4JTJA 1N8FA 4IGSA 4WGXA 4CD4A 4KRUA 2J8FA 4L1GA 1RQBA 1XIHA 3WQOA 1CENA 4XBKA 3ES8A 3SURA 1E70M 3OBAA 3K1DA 3VD4A 3GYEA 3E74A 1D3GA 4FMVA 3IGUA 2GUBA 4WQ6A 3AYRA 2ZC8A 1HJXA 4QLKA 3G24A 4J3UA 4G8TA 5U4NA 1F6KA 2OPJA 3MPGA 3MI6A 2QS8A 3WUBA 5BRBA 3RILA 2JEPA 1TV4A 3GKAA 1QI4A 3N2CA 3LUTA 4KPLA 4OGZA 4DI9A 5LIKX 2YIHA 4DHGA 3PB2A 4DO5A 2R1PA 2R91A 5FD0A 3W2JA 3TCSA 3MSYA 3AJ7A 1EF3A 4REQB 3QFEA 5DCEA 3VD9A 2NLYA 2YBTA 4S3AA 2WB5A 1BLIA 2IQDA 1LLZA 3TVAA 1Q4WA 3CZ8A 2B7PA 3LPFA 3MYPA 3VIFA 1BVZA 4EXBA 3ICJA 3WD3A 3ZXWA 5I3GA 5E09A 3VM7A 4Z1YA 1YQ2A 1OZMA 1UPMB 4LB4A 4XK2A 1V7YA 1JCYA 1C92A 1WZLA 1XYAA 3HGRA 3KTXA 3GNPA 4ZOEA 1UZDA 1PYMA 1XYFA 5SWUA 3OZPA 4D8LA 3VXGA 3W7QA 2BY2A 4EP8C 3APTA 3TWAA 4IPPA 3HBLA 1A3WA 1GTHA 4GJ1A 2L5HA 4FHAA 5H8UA 1CZ1A 3EXRA 5TD4A 3NL6A 1X98A 3SUVA 4C6DA 3C4UA 1V6YA 2QDGA 4NY2A 1Q8JA 3WBEA 1M03A 4ZENA 2YCLB 4IP4A 4REQA 1OBAA 1WUEA 4ZOBA 1HP5A 4JTEA 5A2CA 1RQEA 2PURA 5I03A 3VGDA 4LOCA 1WKYA 4ASTA 1IQ8A 3CXOA 4QX4A 2DQWA 3EX4A 4Z2KA 1YBQB 2ZXDA 4MY8A 1QBAA 4KWOA 3VFLA 1XYZA 3WF3A 3D0CA 2OT1A 4ROQA 1E6RA 1RY8A 3V3WA 4LAKA 3AHXA 3B9EA 3H23A 1B54A 1T0OA 3E96A 4G6CA 1XM3A 3NZ1A 4FX6M 3ITYA 3RAOA 4XUGA 3N04A 3QFWA 3BGAA 4PMOA 2V5CA 3VILA 5GJNA 1W37A 3T0TA 1OC6A 3AOFA 4LUSA 1LF1A 4LYKA 1V0LA 1SR0A 2HQAA 3B4YA 1OFBA 1VJIA 1EF2A 1MWOA 4ICMA 4OE7A 3VFCA 4ACYA 1GUVA 2XISA 1X8FA 2PLCA 2C16A 1GYNA 4MUZA 4S1FA 4O11A 4DWSB 2VEPA 4AXKA 1I75A 1HO4A 4JXCA 3RX2A 3TAOA 3UXIA 4MB4A 1PDZA 5CH9A 2VMFA 4LBRA 2CLMA 3VCNA 4LB3A 1Z44A 1E72M 4XKYA 3S6DA 3KUMA 3T6CA 3E0IA 1PX3A 4JS3A 1AW2A 5G4HC 1L6WA 3AMCA 2D24A 3M0IA 1E9YB 2I16A 3EWYA 3WJZA 7ODCA 3N3MA 2BOGX 3AHYA 2VQUA 3CYVA 2PZNA 2FZDA 4JY9A 4QJ1A 4ZXOA 5IHRA 4IIFA 1FCVA 3PPHA 5RUBA 3AHZA 5ABHA 4K36A 3OGSA 2ZRZA 4O54A 3FAWA 3NPVA 3TSMA 4GH3A 3C8NA 3GVWA 3O6DA 4JYDA 3CAVA 4L61A 5CPNA 4UR7A 3MP5A 1MNZA 3VZZA 1WDDA 4NAFB 5AYYA 3GKFA 3UYIA 4TR9A 2DGAA 3L21A 4UCFA 1JPHA 2YLLA 3STPA 5DN1A 2ZXQA 1Q45A 3QMSA 4QAWA 2VQTA 1YBQA 3LXBA 4H6QA 3UP8A 1UP0A 4LGXA 1N8WA 5D2YA 4MWAE 3LHWA 5HMSA 3L66A 3OLEA 5ABFB 5A6AA 2QGYA 4LYQA 4V1YA 5I3DA 4MKNA 1E3XA 3JVAA 4TXEA 2EPLX 4TU1A 1LJYA 1OWQA 3GDMA 3UXLA 2QCCA 3WK1A 1XDJA 2EQDA 2VEGA 3GXTA 2WHLA 2F9RA 2PGFA 1FH9A 4M6PA 4C6IA 4GI9A 1CXHA 1S2CA 2VXNA 3L4YA 3W1XA 4TVCA 4YYFA 3RFAA 2E25A 2VYOA 5LIXX 2WNNA 1I2OA 2X2YA 3MY9A 3QW4B 2GDQA 4J3VA 4RZBA 2NX3A 1UKQA 4WY0F 2PP0A 4M7TA 2GJRA 1XLBA 1QR7A 4AWTA 2FTPA 2I1OA 3CUJA 3UT0A 4R9XA 3N11A 2R1NA 4DLFA 1WDRA 1U5JA 3SY8A 3HQ1A 3VNLA 3FOKA 4FSAA 3CEUA 3T07A 3AC0A 3UWVA 3TXZA 3HV8A 3QHNA 3QN3A 3WFZA 2PFHA 4DBDA 4IFKA 4FLQA 1QAPA 1W1TA 2BSLA 3R43A 1W31A 5LXEA 4E4FA 1LQAA 3NQDA 5AN7A 2WC7A 3GNNA 2HNHA 3U8GA 1ISWA 3GUWA 4HOZA 2DVXA 3GQYA 4Q8MA 4AZHA 4IQDA 3IEBA 3GNDA 3SUTA 4BF5A 4L5ZA 5GJPA 5GVJA 2GVYA 1IXQA 3DFSA 4EXAA 2EG6A 4B5UA 1QNQA 2UY4A 1B90A 3UCCA 2WHMA 1H7WA 2DIKA 2A6LA 2D2JA 3B05A 3OVRA 1GZGA 2CXEA 1YIXA 4DYJA 2XIMA 3CPUA 4C6FA 4B9ZA 3QMRA 1Q6EA 2XYLA 1YYAA 3V16A 3M5ZA 3INPA 2DW6A 1J0JA 2VRKA 1RD6A 4MVAA 4ZTXA 3ABQA 5HR7A 5LKYA 2PDHA 1E40A 3IIVA 1SW3A 1W3KA 3MDWA 3CPRA 3EMQA 3N4EA 4DBSA 4J28A 1UR3M 2OSYA 1VFSA 4PULA 2Z1SA 2WHKA 2XDFA 4N2YA 2RH9A 3MMTA 1TMHA 1JD9A 4PB3A 5EMMA 3HJZA 3LNPA 2CNCA 5I3IA 4RW5A 4XTIA 1ONXA 3F4CA 2RGMA 4W8LA 2QAPA 4YTTA 1O5XA 4YYCA 3P6LA 1UWRA 1K8YA 1VCGA 3NQAA 1TWZA 2C1HA 4EE9A 1L2UA 1R9XA 2ZCGA 3SCOA 1ODZA 4W85A 1X1OA 1A50A 2V68A 3CIXA 4AY1A 2NLIA 4FIRA 1S3TC 5DT7A 1WB0A 2XGBA 4XD4A 1FWIC 1J10A 2QCLA 4Q4SA 5DBTA 3RM4A 3EPOA 5BZAA 4RKAA 2UV8G 1UW9A 5FJJA 2V5JA 4DO7A 3U3HA 3CMFA 3F2DA 2GZXA 1XPYA 1KM4A 1P0DA 3EDDA 3QV6A 3KP1A 1ZS2A 2XWDA 1O7AA 1WOBA 4JIHA 4PA8A 1U30A 3BLFA 7ENLA 3QSTA 3QPZA 3GXPA 3LCGA 4M1BA 3FHQA 4FLRA 3FAXA 3ZR5A 1O68A 4AF0A 3WLPA 1EPXA 4YTQA 1H1YA 3F1QA 2A2IA 4N02A 1YDOA 2CERA 4RDZA 3DKLA 5EMKA 1MQRA 1FH7A 3CUHA 2XVGA 3DU0A 2OZ8A 3OQ8A 1PIGA 3TFCA 4UMCA 2VX5A 5K9XA 2P76A 1Y7VA 2ZDRA 3GNOA 4LX4A 4RW3A 3BAJA 1IEVA 1EJVC 1RPXA 4AEEA 3TW6A 1PJ9A 2V9DA 2QR6A 3VX1A 2FGBA 1B9ZA 1M53A 1U5HA 1S38A 5T8GA 2CIPA 4WR3A 2NV9A 3AIRA 1HKMA 2VJXA 4L80A 3T2OA 1SSGA 3L5LA 4Q33A 3CIVA 3PBGA 3NURA 3KL0A 4Q7IA 1W0MA 3DN5A 4MYAA 1DHPA 2F6XA 3BGGA 2B31A 5B80A 4TX9A 1CECA 1TCDA 3CTTA 3SY1A 3KHDA 4ZQCA 2WVVB 1F3XA 3TN3A 1GJWA 3UXAA 3L0KA 4CD6A 1Q4NX 4C6QA 1EA0A 2JIEA 1V0NA 3FNDA 2BY3A 2PGWA 2GSJA 3H54A 1V3KA 4JQAA 1OYAA 3R7MA 4IMGA 1QHPA 3OP2A 4I6KA 4NU7A 1BVWA 2QEZA 3NXLA 2ZUMA 3OZOA 4MJMA 3LV5A 3W6MA 1GNXA 4FOUA 4M51A 4ZODA 3U9IA 3WF0A 3CIWA 1HFBA 4JIPA 4IL0A 3MMDA 4O57A 1QASA 4V27A 1TV5A 2GK1A 4MM1A 3LN3A 4UR9A 1JDEA 3P62A 4KIRA 5I09A 5XIMA 3COTA 5IFTA 1XD1A 4W4QA 3H2AA 2VD9A 3N3TA 1SZNA 4A05A 1VC4A 2XIQA 3HN3A 1QDSA 2NT0A 3OU8A 1GZJA 2J7HA 4DI8A 4KT2A 5I3KA 3WBYA 4GQGA 1MYRA 4C65A 1BRLA 3IRSA 4F66A 3H2FA 1AJ0A 2REQB 1UPPA 1CGYA 1E9ZB 4PUUA 5LGZA 1MXGA 1W5OA 4PFMA 2WSPA 1UH2A 1KFCA 1P1XA 2DORA 4WOQA 1QI2A 1GPWA 3WLOA 4F9JA 4Z0JA 4L4MA 1UC4A 5C9ZA 3W7IA 3H24A 3G0UA 1JDCA 3VD3A 3EWCA 2W61A 3HQNA 4WXYA 1GT8A 3I6TA 3ZLGA 4I8YA 3TSDA 1XSJA 2ZZ2A 3NPXA 2QIIA 1NY1A 3BG5A 4GUIA 2INZA 2RJHA 1FXPA 4LV4A 4DQWA 3NL2A 4BI5A 3QSRA 2WQPA 4YVVA 3F5KA 1XD0A 3SN1A 4NYUA 2NQ5A 1EH9A 3A47A 2YYTA 3SAZA 3QV8A 3A6OA 2QV5A 4LVFA 1S5MA 4OU1A 3IAQA 1E0WA 3H6OA 2IKIA 2XUCA 2RHGA 1K03A 3RDKA 1NDWA 3GU9A 4MDOA 1PZ0A 4R85A 3FYYA 2J25A 4FXRA 4B4FA 3NG3A 3A22A 5REQB 3VUPA 1L0PA 2VC7A 3AIVA 4OKDA 4DM2A 3RG6A 1Z8AA 1K77A 2YDSA 2WVUA 1TRDA 6A3HA 3IANA 2P8BA 4HZ8A 4EACA 2BVDA 3U2CA 4A4AA 1OC7A 3O6AA 1XYCA 2QUNA 2RUSA 4UMAA 4W7VA 2AMXA 1LL4A 4O53A 5HWNA 3QXBA 3MC5A 1SW7A 2POTA 3PPFA 3RX4A 1XRVA 1ZPTA 4CU6A 5H8PA 3PTDA 3CS2A 4HU0A 1T8QA 4J5NA 1PYFA 3M46A 5DCDA 2RKXA 1SUXA 3CWHA 3I6RA 4IWWA 3NXFA 2A4AA 4XISA 1U1UA 2RJGA 2ISVA 3TMQA 2BBFA 5CBJA 2GWNA 4Q8QA 3UJFA 3CAKA 3SFKA 1NP2A 5DY2A 1N82A 2PU1A 2JIWA 4X22A 5L6UA 1XLLA 2QGHA 4K1GA 1AA1B 3IS4A 1TVLA 1DWHM 2DP3A 1UB3A 3TOPA 3B04A 1R38A 2HVNA 4OFCA 3V75A 5K4XA 4WDTA 4AF0B 1DKWA 1GYMA 1YE4A 3LU2A 3I6EA 1Q3NA 3GR7A 1RK6A 5H6HA 2WCGA 4BA0A 4LVBA 3QF0A 2FLIA 1M6JA 4HSNA 2ZADA 2OLSA 2CXGA 5A6LA 3PJUA 2BXZA 4Y2WA 1AW1A 5D9MA 1W8SA 3UG5A 3T08A 3TROA 2YPIA 1ME9A 1OIMA 4K8EA 1XLJA 4W8AA 2Q8LA 1KBKA 5KZ6A 4AWUA 5C54A 3F5JA 3DYOA 2OGJA 3BTNA 3DYPA 3UYCA 3S9IA 3P80A 3IGXA 3B8UA 1J9YA 3QEZA 5CBBA 5D37A 1K9FA 4ALDA 3Q58A 3UESA 3UG4A 2CLLA 1TE1A 1LWHA 1W3LA 1GONA 1XLIA 2ON3A 4DNHA 1CB2A 3N73A 4DJDC 1TTPA 2DT2A 1XYMA 4DUOA 4K38A 4EF9A 3G1XA 1PX8A 1H63A 2PGRA 4IIHA 3STFA 4AWSA 3WBWA 3DHPA 2CEQA 3HMJG 1O1HA 4ZFCA 1JZ4A 4BKNA 4PTVA 4IQJA 4F2TA 3A4JA 2C14A 1J0YA 1GG1A 1J8VA 1L6YA 2G3NA 1TMQA 2WNZA 1H49A 4R34A 2XIOA 2PF8A 5CSRA 2WOQA 2IPFA 4YNGA 4QGCA 2AAAA 4V1XA 3MO7A 2DUZA 3S5YA 1ISVA 1ADOA 3BV7A 4M6UA 1DPMA 3FJNA 5A8PA 2G3IA 2TRSA 4Q32A 1P7TB 1NWSA 2X0HA 1IXPA 4JCLA 6XIAA 1ISZA 3AMKA 1FKWA 1TX0A 7XIMA 4DB7A 1OY0A 5A5WA 3VI2A 1B3YA 3BARA 1UBPC 1KCKA 5D8WA 3UWWA 3W83A 4MF4A 2DQXA 3UWEA 1ZQ5A 2E6AA 4S3GA 1LOQA 4ZB0A 5LYRA 3V7PA 1W1PA 1J0HA 3AWOA 3LPOA 3H12A 5EYWA 4CNPA 5BU6A 1TWWA 4ZE4A 2H8XA 3ZYZA 3BSHA 1JF6A 1EP1A 4PR4A 4F0MA 3C8FA 1ITCA 2DZXA 4LYPA 4JQ2A 4HP5A 2PTDA 4FEZA 2RAGA 1XIDA 1LT8A 2XG9A 5IHSA 2Y5SA 1CXKA 1UIOA 5D4YA 3PTMA 3DBPA 1OCJA 1DIDA 4E2OA 3PZGA 1JRCA 3P7YA 1H1ZA 3N4FA 2ISWA 2X1RA 1NU5A 4C6KA 3H7VA 3NSMA 3T0DA 4BZYA 1W2PA 1DE5A 4PMQA 2JF7A 3M0XA 3VNMA 2J7FA 3VO0A 3WNOA 4WJXA 3RRXA 2YSWA 2W3ZA 1RBLA 3HOJA 1VENA 3TQVA 4HOWA 3N2BA 3G1VA 1D3CA 3TTQA 4IIDA 4GX8A 1O5QA 4NNBA 4Y90A 4LUTB 1TPH1 2C0AA 1IXNA 3KHJA 1F61A 1E6QM 2R6OA 3LPPA 3VIMA 4H2CA 4LRTA 3EA2A 1CTNA 3IIZA 2CWXA 4CNOA 3WH6A 2GUUA 4GBDA 1J0IA 3B9NA 1M7PA 4JL1A 4MB3A 1EEPA 2E9MA 3DEQA 3V0TA 4HA3A 3QR1A 4I8DA 1E1FA 3CUXA 4O1BA 3PZOA 3VA8A 4XSLA 2VRQA 2DJLA 4IF2A 2QLYA 3WK0A 4MJ2A 4K8GA 5K2ZA 1IF2A 1W3IA 4ERIA 2PDCA 4H41A 1FRBA 4MY1A 4BF9A 5EFDA 2VFEA 2PDPA 2QCNA 3N25A 3P8IA 2HBXA 1GJUA 2BOEX 1A4MA 4HMDA 3QOMA 2GDVA 3AHTA 3VGEA 1JCMP 3M0ZA 1KKOA 2XGIA 4IM4A 3VM5A 3VMNA 3KRSA 2XHYA 4MPQA 3P61A 1ZGDA 3KCJA 4IMAA 4UZSA 3EOEA 3GG8A 3K4AA 2R1KA 4AZBA 2E5DA 1FOBA 4CUCA 1R3QA 1RCOB 2J8TA 2XVKA 2V30A 5A6MA 4TMBA 4AC1X 3UZ5A 2EBNA 4HGXA 1RH9A 7TAAA 4GYKA 1W6TA 4C7GA 1XGDA 3MBFA 4RZ5A 3W6LA 5DX7A 1LWJA 3AI0A 1B3ZA 4JX5A 1LYXA 3HZ3A 2QULA 1PL9A 2ABAA 5A6SA 1QI5A 4S3FA 2OT0A 1IR2A 2QVHA 4LY4A 2ZWZA 1RXOB 5K3VA 3IV3A 1G0CA 2FVMA 2VFDA 1OX4B 4ORIA 3AMLA 3K13A 4ATLA 1UYQA 4LW7A 3RJXA 4GYPC 4XZ9A 1W3NA 4JQ4A 3NPWA 5EBAA 3K30A 3L5MA 3EX3A 5CPMA 5JXQA 3FKRA 3W3OA 4IMDA 4YLWA 3POCA 4YN5A 2ZQ0A 3W1TA 5H2ZA 4PUNA 2B0MA 1UUMA 3SEPA 1FDJA 1MUMA 2YB4A 4BF7A 3TR9A 3HGJA 4PB5A 4E4PA 1KRCC 1AUSL 3GXFA 3PPCA 1T7LA 5ABEA 3EXTA 2WXDM 3IVUA 4YS1A 3V4BA 1UWQA 3LENA 4UWMA 2QMKA 5DMYA 3T1GA 4GQ0A 1US0A 1M7OA 2BZNA 7A3HA 4HPGA 2XINA 4MDPA 4N6EA 1DIEA 2DV0A 5K9DA 3G77A 3H53A 2YCIX 2QCFA 2DIEA 3B8VA 4F0KA 9RUBA 4QTGA 3ANVA 1H7XA 1JPKA 3DZ1A 4A3RA 3M0MA 2HWGA 2VGBA 3NQ8A 4Y96A 4GLEA 1QXLA 4W8BA 3WDRA