4AD4A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-isofagomine and alpha-1,2- mannobiose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
total genus 130
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad4A00
4D6DA 2WMJA 2DIEA 3WBAA 1J0JA 1XV8A 3ARSA 1QI5A 1VF8A 1NOWA 4XB3A 4AZ7A 1QPKA 1M7XA 4P7LA 3L4YA 2BY0A 3ZR6A 3M07A 2DT3A 2WWDA 3UG5A 3ALGA 3VKKA 4LQ1A 5BRQA 4CD7A 1QI0A 5GPRA 1VIWA 1YHTA 1VBUA 4PMDA 2DSKA 1W9VA 3L2MA 2VT0A 3ARYA 1GNXA 3NDZA 1W2PA 4D6HA 1LWJA 2J7FA 3AZSA 1JXJA 2W61A 1VEPA 2UWFA 4EKJA 3AMDA 3PZ9A 1UHVA 2J25A 3KE0A 3MUY1 3WEMA 3WH9A 1PX3A 1OINA 3VDCA 4MADA 3VVGA 3CZLA 2WHMA 4A3HA 3GBDA 2OYKA 2VZVA 1XSJA 2F2HA 1W9UA 1WZMA 1GOWA 1QI2A 4B3LA 4W5ZA 1I1WA 2A3CA 3GXFA 4QLJA 1JYWA 2J4GA 4MJ4A 5LA1A 1FFRA 2W4XA 3MANA 1X1NA 4J7RA 3IANA 5DT5A 3TTSA 2E9LA 2WANA 3TTOA 1HX0A 2WLYA 2ZUVA 5DO8A 4P8UA 1OGGA 3RILA 1E43A 1JGIA 4W5UA 1UKQA 2QLYA 1Q6CA 2J62A 1QNQA 3VD7A 1ZBWA 3AHVA 3K4DA 2IXUA 4LX4A 4F9DA 4UQAA 3FAWA 2WBKA 2EO7A 3UERA 1SMAA 1C8QA 5ABHA 1JIBA 3AS2A 1RP8A 2ZXQA 3HMCA 1PX8A 3AIVA 2XPKA 5HNNA 5I6SA 4D71A 1KXQA 2G8ZA 2DPEA 1H0GA 3CZEA 3WD4A 3BLKA 2VVNA 1JI1A 5I24A 3WFLA 4CU7A 4GQQA 2GK1A 1E0WA 1UR1A 2E9MA 1CZ1A 4E8CA 2XVNA 2WC3A 4MNJA 3FNDA 3WENA 2DH3A 1J0KA 3EMZA 1JI2A 4HOWA 5AC4A 1WB0A 1DEDA 2XGIA 4AZBA 3VMOA 1GQIA 2EPMX 1IZKA 1DTUA 4F9JA 1AMYA 1KBKA 1HJQA 2O9PA 3PZGA 1KCLA 3POHA 1BAGA 3ECQA 3HJEA 5E6ZA 3PTKA 3WH7A 2VRJA 2VMFA 5KEZA 4MB4A 2O9TA 4JHOA 3CUFA 4AXNA 1QW8A 1JZ7A 4PTMA 4EANA 4EAMA 1HF6A 4PMQA 3VIJA 1E1EA 3CHEA 4D6EA 2WVUA 1JDAA 1C7SA 3A6OA 1GW1A 3WQ8A 1WZLA 1V3HA 3I3EA 1WP6A 4CD6A 3ZT6A 2OWXA 3OLGA 3VGEA 4AIUA 2FH6A 4OZOA 2JF6A 2XG9A 2CBUA 1VEOA 2WPGA 3ARXA 3IJ8A 1W9BM 4H8UA 3UEQA 3PTQA 1CTNA 1KCKA 2WLZA 1EDTA 1ITCA 4Z2JA 5CGTA 3WKZA 4YHGA 5JBFA 1WAWA 4J3UA 4JFVA 3W29A 2CBVA 1HNYA 1DWAM 2JF7A 2ZWZA 3N13A 4ZXOA 4PBGA 1KXTA 2V5CA 2GJXB 3SEPA 3VDHA 4CVUA 4ZXLA 1ZB5A 3LPOA 2YLLA 2WW5A 1V3LA 2FHCA 3TONA 4AZGA 1UQYA 3AMCA 2XWDA 1P6WA 2HISA 2J7DA 5E6YA 2J7GA 5ABGA 3NYDA 2WAGA 5BROA 3K8LA 3FW6A 1HT6A 1PX4A 3ZJ7A 2VJXA 5ABEA 3N11A 1B3VA 1QI4A 3SCQA 3L4VA 5A6BD 4BZYA 1XH0A 3BC9A 3RM4A 1HL8A 4J3VA 5LYRA 3VGHA 4GPNA 1F4AA 3AMGA 4XV0A 4F66A 3WQ4A 6CGTA 1W9PA 1XHGA 3TA9A 4H41A 3O9NA 1EOMA 2J8GA 2CPUA 1HL9A 4IM4A 3PZVA 3TTYA 1UKSA 1B30A 1J9YA 4N0RA 1M03A 3F4VA 1G1YA 3UETA 2G3MA 4P7RA 1GHRA 1QNSA 2X05A 3A4XA 2ZUWA 3WMSA 4GZIA 2JFEX 2W5FA 3OA5A 1PZ3A 3NUKA 1RPKA 1W3LA 1LQ0A 4J3TA 1CGWA 3BGAA 1EGZA 2BS9A 1KR0A 1R87A 3L4UA 1UWSA 4DWSC 3AOFA 1WDPA 1VAHA 1KWKA 1ZU8A 3PZIA 1CBGA 5DEZA 2W63A 3WD1A 1UH4A 4HZ7A 3RIKA 3RMEA 3U57A 1MYRA 3VOCA 4J3SA 3K1DA 3EDEA 1UKPA 1QBBA 2WYSA 2DIJA 1W2VA 2VRQA 3CZKA 4CN4A 3VDBA 4IUGA 1B3WA 3THCA 1C3FA 3AZTA 2UY3A 4C7GA 2XUCA 4PCTA 3QHOA 4WK9A 4HPHA 4PMZA 1GOKA 2G4FA 2WSKA 1HN1A 1UG6A 2CERA 4W7WA 4ZEPA 4JFTA 5DMYA 4M29A 1PIGA 3GXDA 4RE4A 1CXKA 3APGA 4WLCA 5FL1A 2J74A 1JDCA 6A3HA 1JYXA 1OIFA 2XTKA 4OOZA 2Z1KA 3CIVA 5A6MA 4UOZA 5JIWA 1XCXA 2J78A 1H41A 1BG9A 3VD4A 3IAQA 1MQQA 3VD9A 4OKDA 3VGGA 4D1IA 1TUXA 2ZXAA 4GZEA 1DP0A 5BXSA 4H04A 2BHZA 2BY3A 4M56A 1L8NA 4MNLA 4AZCA 1A3HA 3AROA 1JZ5A 2WCAA 5KZ6A 2VR4A 7TAAA 3WIJA 3NIYA 3CMJA 4AD4A 4JKMA 1NQ6A 1CGTA 1D3CA 1E5JA 4ML4A 4JCLA 5BXRA 1BSIA 4DWSD 1EDGA 2J7EA 2YBUA 1W1PA 1WO2A 4Z2LA 1R7AA 5E09A 1UWIA 3GTNA 4Z2GA 1Q6DA 2QMJA 3ZT7A 4DUVA 2GJPA 2X1IA 2V5DA 2VX6A 3WEZA 2V38A 3O2LA 2Y4SA 3AIQA 4D6CA 3BAIA 1SYTA 4AD0A 5FKYA 1QVBA 1ZJBA 3A4AA 3S6TA 3OGRA 1CGVA 1RD6A 1UQZA 5ABFB 2YL6A 3VPLA 3A47A 1V0MA 5BWFA 2VZUA 4AZ6A 3UESA 3VINA 2WSPA 2J75A 3EDJA 5A6SA 1XC6A 3ARZA 1LG2A 5HXMA 7CGTA 4Y7EA 2ZUNA 1S46A 1E6PA 3WUFA 1C8YA 1VFMA 4DWSB 4BS0A 2CBJA 2ZUUA 3SCSA 1UA3A 4W87A 1E9LA 3T09A 3PZMA 1IV8A 4XX6A 4CU8A 4GO8A 3GBEA 1E56A 1E15A 3WNKA 3WNOA 4TVUA 5IFTA 1QI3A 5A1AA 3VUPA 3FHAA 2XM1A 2W66A 4U31A 4FLOA 2ZX5A 3FY1A 3ZOAA 4PUDA 1UWRA 4C7FA 1M01A 3PZQA 2JALA 2X2YA 2AMGA 2J77A 1MW0A 4WKFA 3FN9A 1WZAA 1EIBA 1HVQA 3SUVA 3ZJ8A 2WCSA 3MMDA 8A3HA 3OLIA 4W89A 4YPJA 3T08A 3UG3A 3WD0A 2XFYA 1JNEA 3VMPA 1H1NA 4QDMA 4S3JA 4FLSA 3IK2A 1V6VA 3W26A 1QNOA 3GZAA 3NSXA 3EDKA 4LPCA 1W3JA 4TVCA 4RE2A 3M6DA 5DF0A 3VILA 5M3WA 1XGZA 3GYCA 1DWGM 2VO5A 2GSJA 2J47A 5EFDA 1K9EA 1TZ7A 1SMDA 1CWYA 3G6LA 4H8VA 1PIFA 4CCCA 3U5UA 4B15A 1NARA 3QHNA 1BF2A 1PAMA 3QOMA 3WF0A 5LA0A 1E4MM 3UCQA 4M1RA 1UWTA 3WDRA 2PI6A 2ZICA 3FAXA 2W67A 3CMGA 1UR9A 1V02A 2CEQA 4X0NA 2CITA 1H5VA 2GVYA 1OSEA 2E4TA 2F8QA 4MNMA 1J11A 2OWCA 3EYPA 5EMYA 1XH1A 4QLKA 4V2XA 3AIRA 1JAKA 2XVLA 1WKYA 2BNJA 4D6FA 2NSXA 4CU6A 2C8NA 2CXGA 3W6LA 3BSHA 3W0KA 2VX5A 2WHJA 1QOXA 1UKTA 1AQMA 1JZ2A 1H4PA 2YDRA 2XVGA 2DEPA 3BXWA 1R8LA 1CEOA 1JF5A 1GCYA 1UOKA 1CXFA 5AC5A 2VTFA 5A8QA 3OZPA 4QLLA 3VIOA 1C7TA 1KGWA 2DT2A 5CGMA 1MW3A 1E70M 2CYGA 2A3HA 1UR8A 2PB1A 5I78A 4PSRA 4H7VA 3WD3A 1GZJA 3OLDA 1UZ4A 3DHPA 1AVAA 3WDHA 1DWIM 5E0FA 4JIEA 4UQEA 1LL4A 2VVSA 3SUUA 1C8XA 4ZE4A 3RJYA 4MJ2A 1Q4NX 1HKJA 1ITXA 6TAAA 2V3EA 1VJZA 5A6JA 3M46A 4QAWA 3AICA 1BHGA 2HVMA 2PF0A 1UD2A 2D0GA 3JUGA 4JL2A 1GQKA 4AD5A 5I2UA 2WXDM 3CUJA 5I77A 1TVPA 2XFFA 4AISA 1B1YA 1ODUA 1XCWA 1CENA 1LL7A 4HP5A 5A69A 1BVNP 2D0HA 4MDPA 1NM9A 1FHLA 1GQLA 4W8AA 4CN6A 4ATLA 1HIZA 3T2QA 3W38A 1W3HA 3OB8A 2XIIA 1GJUA 3BAXA 3POCA 3SCPA 1PEZA 3FHQA 1VJSA 5D9OA 1V0KA 1HKIA 4X9YA 3WD2A 2DQXA 3G6MA 2D3NA 3WDJA 3PZTA 4HZ6A 1LF1A 2BVTA 2JIWA 2YBTA 4W8LA 4GKLA 1G01A 4TXEA 1E5NA 2XVPA 1TE1A 2CCRA 1BYDA 1EHAA 1ZBKA 5A94A 4KGLA 5HPCA 1C90A 1HKMA 3UG4A 1JD9A 4AZCB 3GXIA 4U5IA 4XZWA 2D0FA 2D1ZA 1I75A 2G41A 3II1A 4CN1A 1UYQA 1E4NA 1H3GA 1UA7A 2YKKA 4JCMA 3VDAA 4UZUA 1WCGA 4AYSA 1Q6GA 3RDKA 4OOUA 1BFNA 5CSUA 5JIPA 4JAWA 1J0ZA 2VX7A 3CZGA 1NWRA 1G9HA 1XRVA 2EXOA 2WVVA 3CUHA 3ZJ6A 2XWEA 1R7OA 4PRWA 4P7OA 1QNPA 4KH2A 2DT1A 4FLRA 3VMNA 1ESWA 4UOJA 1VBRA 2DSWA 3B9EA 3WH6A 3W82A 2Q8XA 4WSKA 2FHFA 1NP0A 4R5EA 3SUTA 3HN3A 4YHEA 1V3IA 4HU0A 2V3GA 3GH4A 1V6UA 1B3YA 1MQRA 2XYLA 3OLEA 4UTFA 3MSGA 1KXVA 5A2BA 3ZIZA 2F61A 5FOOA 1W3KA 5CG0A 2W91A 1XH2A 3PBGA 5F7UA 3WQVA 1CGUA 3GM8A 1WDSA 1D7FA 2WMFA 3TP4A 1FH7A 2YL8A 3VIGA 3BSGA 2NT0A 4GI6A 1ISYA 1PZ2A 3AS3A 4H8HA 4PYSA 1B31A 5E70A 5A8PA 1C91A 1ODZA 3WUGA 3DYMA 3NJ3A 4HA1A 2ZIDA 1K9TA 4URIA 4DUWA 3B8SA 4WF7A 1FH8A 4CD4A 1E0VA 1VRXA 3OBAA 1JYNA 3CTTA 3VX0A 4BQ3A 3ARQA 4AWEA 2C0HA 5BXPA 1EDQA 3CZ8A 3ZO9A 3T0DA 3WNLA 1US2A 5D9PA 3MMWA 5A8OA 4JHZA 1UD3A 2BHYA 1KGUA 2VUYA 4NI3A 1VB9A 1FP9A 4XZBA 4PMUA 4ACZB 1UD8A 4HPGA 2FHBA 1H0IA 1MQPA 2YL9A 3MMUA 2VURA 3VGFA 2JEPA 3VD3A 4ZFMA 1EQPA 1JYVA 3D5HA 1R86A 4HMEA 3W81A 3BCFA 1G0CA 1TA3A 2XGBA 2O9RA 4OBSA 2WMGA 4CCDA 5FD0A 4U3AA 1OT1A 2IUZA 1NH6A 3BMWA 3W27A 3F5KA 3K8MA 2D2OA 3WH8A 3CHFA 2O92A 2Y8VA 1YQ2A 3DYPA 4DM2A 1GHSA 1MXDA 1BVZA 4NZCA 3THDA 1B9ZA 1E6RA 3BAWA 2FH8A 2WWCA 2ESCA 5A8MA 1E71M 2YLAA 4KMQA 5DT7A 1RH9A 2QPUA 4D6GA 3N12A 4UQDA 3QOKA 2DH2A 4KRTA 1OIMA 3KL3A 2WVSA 1Q6EA 3PZUA 4JKKA 1OD8A 3DC0A 5ECUA 2W62A 1EO5A 2VX4A 1TG7A 1FA2A 2ZX9A 3OGSA 1MXGA 2YIHA 2ZUMA 1OM0A 2VR5A 5EBAA 4PEEA 3ZSSA 1U33A 3NDYA 3ZM8A 8CGTA 3B9AA 2G3NA 2CIPA 3MV11 5CPTA 3WMCA 5I23A 5M5DA 1IT0A 4GXPA 2WC4A 1H2JA 2BXYA 2JE8A 2VOTA 2PWEA 4TX8A 2FGLA 4R27A 4E8DA 2VQTA 9CGTA 1Q6FA 3AISA 4AD3A 1WPCA 4QFUA 1QW9A 1O7AA 2PBGA 3W53A 1H49A 1MWOA 1DHKA 3AJ7A 4BQ5A 5D9NA 2VCAA 2QV4A 2ZXBA 3OGVA 3N17A 4TOQA 1B3XA 2XHYA 1EA9C 5A95A 2V3DA 4AIOA 3RPMA 3BMVA 4YN5A 2NT1A 3EMQA 1BGGA 2EPKX 4WJXA 1BQCA 2Y2WA 2W92A 3VM5A 3VGDA 2D3LA 2ZOXA 1QHZA 2GK1B 2JEQA 4QP0A 1KB3A 4LYRA 4U2ZA 1V6WA 2J7BA 5I5RA 1BG4A 4J3WA 4M24A 1US3A 5D4YA 2PBOA 4PSPA 1GUVA 3QHMA 1UZ1A 1UWQA 5EB8A 2WMHA 4UNIA 4LGXA 1H09A 3WSUA 1XYFA 4TX6A 2Y8KA 4P7NA 3ZSTA 4Z2KA 2XSBA 4B3KA 1XD0A 2WB5A 3M7SA 1E6SM 4Q7NA 4V28A 3J7HA 4AEEA 4AD2A 1CXIA 3IJ7A 1QBAA 2IXVA 3IJ9A 4XUYA 5E9AA 3AYSA 1HKKA 5CJ5A 5M03A 1ZJAA 4D6IA 4HMDA 4HOZA 1E73M 1LJYA 2PWFA 3CGTA 2BFGA 1OT2A 4OUEA 1KBBA 4X0VA 1E55A 2YDQA 4IPLA 2WZIA 3AIWA 2WM0A 1BLIA 1EXPA 1KGXA 5C71A 2EEXA 4UQCA 4PCSA 1KFWA 1XYZA 3BAKA 3WDIA 1CGXA 4RL3A 1E40A 2GJXA 3CHDA 3AXHA 1V03A 5CQ1A 3GXMA 5IHRA 4BF7A 3ARRA 2E3ZA 2WC7A 2WK2A 3WFZA 4M82A 3MS8A 3MO4A 4RE3A 3N15A 4PMVA 3VX1A 5CPQA 1JZ6A 2VRKA 1TCMA 4OJYA 5FL0A 2EJ1A 4Z2HA 3AS1A 1X6NA 4UQBA 3QR3A 1LWHA 1SR0A 1MW2A 4MB3A 4TTUA 1V3KA 4MTVA 2O9OA 2GDUA 4HZ8A 2WNWA 3SCTA 2AOSA 4F79A 1HP4A 4FK9A 3HU7A 1CXHA 1E6QM 3ZR5A 1JZ3A 5JUVA 2ZUSA 4MNKA 4Q22A 1TFVA 3AMKA 5CSYA 2WHLA 3SUWA 4PMYA 2WKLA 2WMIA 3I3BA 4PTXA 3RO8A 5I79A 1QHOA 4E4PA 1FP8A 1W32A 1WDQA 5A3HA 5HDRA 1BPLB 5IDIA 1C93A 2J79A 4UFIA 1GORA 1UD5A 1K6AA 3MV01 1EO7A 4P8WA 4TUFA 3F5LA 1EQCA 5A8NA 3BAJA 1E6ZA 1ISXA 4FMVA 3SURA 4H2CA 3FXYA 3AZRA 3VO0A 2OYMA 3WN6A 2JIEA 3L4WA 5GNZA 1OGSA 2XM2A 2YOCA 1ZBVA 1E4IA 1WZKA 5BCAA 5A6BA 3RJXA 1UKOA 2J8FA 3WF2A 2MANA 3UR7A 3VM7A 2X0HA 3ARPA 1GVYA 1OB0A 4W84A 1JXKA 4AZHA 1M04A 1W9XA 3T0AA 3AIUA 4WIWA 1IZJA 1ECEA 1B2YA 2WMKA 1TA3B 1HJXA 4K68A 3EMCA 3WMBA 3PZOA 4MAZA 2CBIA 4B16A 1ISWA 2XVKA 1OCQA 7A3HA 3OIHA 2A3AA 1CECA 3W6MA 1CNVA 1GVIA 3E1F1 3WNPA 2X8RA 3T2OA 3LPGA 3RCNA 5IFPA 1QNRA 3VD5A 3KWXA 3LMYA 1LLOA 2PWHA 4BA0A 1PBGA 3WF1A 3ZMRA 1W9DM 2DSUA 2Y5EA 5JBEA 1C92A 1WE5A 2D22A 3VGBA 4WKAA 3W28A 1J01A 2D20A 4J3XA 2QMKA 1BYAA 1BYCA 1LL6A 1UR2A 4TVDA 4TTGA 4A4AA 3N9KA 3AHXA 4ATWA 3WQ5A 3CBWA 3SCWA 3PHAA 4D6JA 2YA1A 3WL1A 1SFSA 2E8ZA 2CETA 1PJ9A 3VIKA 3AYRA 4HMCA 4F8XA 4ZE5A 3KL0A 5D8ZA 3KZSA 1MFVA 3NCOA 1XSIA 3NSMA 3OG2A 3CUGA 3W24A 1KQYA 4PMRA 3CUIA 1TMQA 1GPFA 3SCNA 3L2LA 1G94A 2BY2A 1OD0A 4HTYA 5TD4A 2CNCA 4KRUA 1HP5A 2CKRA 4CKQA 2Y24A 2ZXDA 3SCVA 3PN8A 3B9DA 4L4PA 3ZT5A 4S3KA 3L4XA 1JD7A 2YA0A 3T2PA 3L4ZA 1TR1A 3LPFA 5D8WA 2VNCA 4KGJA 4NRRA 1NP2A 2EPNA 1MVYA 2BHUA 3WNMA 2WKGA 2QF8A 5AY7A 1E4LA 2CHNA 1ZBCA 2XFRA 5ABFA 1MW1A 1V6XA 1NWUA 4JFUA 3KEHA 1B0IA 3ARVA 2OYLA 5HPOA 1O6IA 5C8BB 1JZ4A 4PMNA 2D23A 5GNXA 2WZHA 4DWSA 2VZOA 5D9MA 2X0YA 5HOSA 1EOKA 5DFAA 5A2AA 3VU2A 3WELA 1BTCA 3L4TA 1PPIA 3F5JA 3ZQ9A 4EK7A 4V27A 2EPOA 1Y7VA 3MUIA 1NWTA 3AXXA 4MB1A 4PUEA 4AD1A 2YDSA 1DWJM 3MKKA 1VEMA 4JZ5A 4BCEA 3OZOA 4P8XA 3AFBA 2VCCA 1GOOA 1J0HA 4CCEA 4P8VA 1V3MA 3WF4A 4U5KA 5M17A 1UR0A 4JFSA 4A3YA 3AMLA 2ZWYA 3MU7A 4CD5A 4GZJA 4W85A 2D24A 4GO9A 2X09A 4UFJA 2E8YA 3VNZA 1CIUA 3ARUA 2ZUTA 2YA2A 5GNYA 4ZENA 4E2OA 4U33A 4HOXA 1K9FA 1UH3A 3CPUA 3AHTA 4AC1X 1UH2A 1NWSA 4CGTA 1GOIA 4L4OA 4KWUA 1CYGA 1DWHM 3GNPA 1JG9A 4GI9A 2BY1A 2XSAA 3T0BA 4UCFA 4HA3A 2G3IA 1N82A 5AYIA 4W7UA 2EQDA 3U7VA 1V3JA 2VL4A 2ZX7A 1A47A 1BYBA 1CLXA 3WF3A 2FGZA 4MAVA 2EBNA 2J7CA 2BVYA 4BQ4A 2J7HA 2RGLA 3UR8A 2UY5A 1ZL1A 4NRSA 5HBFA 3RM8A 1E72M 3K46A 5BYWA 2CESA 3TOPA 1JL8A 2ZX6A 4JL1A 4D1JA 5A6LA 3BLPX 3WUEA 1CPUA 3AHZA 4HU8A 2XJ7A 1B90A 3CH9A 3ARWA 3N18A 4PMXA 4JKLA 5CZKA 1I1XA 2RGMA 1KR1A 2WZEA 3U5YA 1F4HA 4FLQA 3DHUA 2WMIB 4UR9A 4MPKA 1VFUA 4N42A 1VENA 1E6NA 1J0IA 1J0YA 3A3HA 3D3AA 4NSBA 1ZS2A 3NSNA 1JNDA 3GNRA 3VIFA 4AIEA 3VIHA 2QHAA 3GH5A 4PTWA 4GQRA 1FFQA 5IHSA 1ISZA 4J28A 4J27A 5E0CA 5LA2A 4MDOA 3SUSA 1V0LA 1X6LA 4HA4A 2OSXA 3BAYA 1J12A 4C7DA 3EDDA 1UD6A 4ACYA 3VIPA 1BGAA 3BH4A 3N04A 3PZNA 1TVNA 3WY1A 1UUQA 3WDQA 1CXLA 4QCFA 5A6KA 2NW0A 2DSVA 4AEFA 2A3BA 3WNNA 2ZE0A 5BXTA 3SCUA 2QPSA 2TAAA 2DT0A 2YJQA 4CD8A 3SIMA 4D72A 3W37A 1DWFM 1H11A 2PC8A 3AS0A 1UWUA 2OWWA 2GDVA 4MB5A 1E6XM 4LXFA 2V3FA 5AYBA 1GQJA 2GFTA 3O6AA 2VZTA 1E3XA 4AY1A 1NOUA 3CZJA 4DM1A 2A3EA 4W88A 4UOQA 3K8KA 3K4AA 1VFFA 2YL5A 2VC9A 1V08A 2BXZA 2UY2A 4GIAA 2BV9A 1CDGA 5JBDA 2CKSA 2WBGA 3QGVA 2E9BA 4U3CA 1K9DA 1XD1A 2WCGA 3BCDA 4UFLA 1HJVA 3N1AA 2G3JA 4LYQA 3WQ6A 1G5AA 3AIBA 3CHCA 3LPPA 4UFHA 1GOMA 4UZSA 1E3ZA 4W93A 4OIFA 4PTVA 1FHDA 3WDPP 3MUZ1 1CXEA 1VFOA 1ISVA 2OSYA 1AQ0A 4DUXA 1FH9A 3I3DA 3ALFA 3A4WA 3RM9A 1E1FA 4IPNB 2C7FA 5IXEA 4M80A 3S2CA 1W91A 3AXIA 1RP9A 3DYOA 4WSJA 3U7BA 3CO4A 2DDXA 4UFMA 1MFUA 1L0PA 1R85A 3IAPA 2WHKA 1U2YA 2E0PA 4ATDA 5C70A 2DGAA 3EDFA 2BVDA 1WDRA 3WQWA 3MUAA 1V0NA 3CLWA 1JAEA 1QHPA 5GQBA 3WEOA 4BQ2A 1CLVA 1U30A 3ZJKA 1JF6A 1GOQA 3VNYA 4CUCA 4WKHA 2EPLX 3TTQA 3GNOA 1FOBA 2VI0A 5FIPA 5CLTA 3GH7A 1M53A 1UR4A 4B9YA 1JFXA 1HJWA 1KXHA 4FF5A 5A2CA 3GDBA 4IISA 2PWDA 1HJSA 1AQHA 3MSDA 2B31A 3EBVA 1GONA 1XSKA 2OLHA 4P7QA 1HXJA 5CPSA 1JDDA 1NOFA 1CGYA 3VIIA 1B3ZA 1UD4A 4AZIA 2GUYA 4LYPA 4JFWA 4UQ9A 4NF7A 3PTMA 2WVVB 5A6AA 4PMOA 3DECA 3AQUA 3AI0A 1HVXA 2XIBA 3AIEA 2VCBA 1D2KA 4CVWA 5FCZA 4OBRA 5EFFA 3KL5A 2AAAA 3WH5A 2VQUA 5CXPA 3W4RA 1OGBA 4UFKA 1W1VA 3SCRA 2ZX8A 1OBAA 1EHNA 1V6YA 2OSWA 3SCOA 1Z32X 3WUBA 4EE9A 4QCEA 4GINA 2Z1SA 4AW7A 2DSZA 2GJRA 4W8BA 4GI8A 5I3DA 3ARTA 1E0XA 4W7VA 2PWGA 4B9ZA 1EH9A 4M81A 1J10A 1KWGA 3WL0A 2WVTA 4AMCA 2FDMA 1KQZA 1GJWA 3W25A 3VTRA 2UY4A 1HJUA 1JFHA 4AZ5A 1J18A 1OWQA 1V02E 3AHYA 5I0DA 1W1YA 4M8UA 1W1TA 2CHOA 1WNOA 4W86A 4ACZA 2E40A 4PN2A 3WBEA 1JZ8A 4U2YA 5BRPA 5CLWA 3VIMA 4Z2IA 1LG1A 2VZSA
chains in the Genus database with same CATH superfamily
2WMJA 3WBAA 1XBYA 1JPMA 3R0UA 3FJNA 4TO8A 2VD9A 1Z41A 4P7LA 6XIAA 3TSDA 5BOFA 3ZR6A 2WWDA 3EZ4A 3ALGA 3UG5A 1XFCA 3RX2A 3P60A 3ZWTA 4X61A 1YHTA 3HG5A 3HQPA 2WJEA 4RNHA 4KETA 1RCXB 2DSKA 1W9VA 3R11A 4IFKA 2QJIA 1AJZA 2YGYA 4YIWA 1UR3M 1W2PA 1XIMA 2CLLA 3AZSA 1XX1A 2C14A 3PZ9A 3SECA 5HQLA 3MUY1 3IACA 3WEMA 3BV7A 1OINA 4DI9A 4D2JA 3CZLA 3IIVA 1TV8A 3GBDA 5HAOA 2VZVA 2DU2A 2F2HA 1WZMA 3NWRA 1JCTA 3IWPA 4GQGA 5DMMA 1JYWA 3IIPA 4MJ4A 2C1HA 4MLJA 4MGGA 3WMLA 3TR2A 3TTOA 1SZFA 4TX9A 4P8UA 1N8WA 3NVDA 1UKQA 4WDWA 2QLYA 4HNTA 3U4AA 4DZHA 4N2YA 5EA9A 5MKGB 2IXUA 2XH7A 3ICJA 3CL8A 3BGGA 2WBKA 4AMAA 4C6NA 4ROQA 4R34A 5ABHA 1W3TA 2HMCA 2ZXQA 2ABAA 1I2OA 5I7GA 3QY8A 3UXLA 1G67A 2GQ8A 4J9JA 1R9ZA 4IJBA 3W83A 3CZEA 3BLKA 2VVNA 3LZ3A 3FX4A 3WFLA 3QY7A 3QMRA 2XVNA 1I4NA 2WC3A 3NQAA 5TAOA 1YEYA 1J0KA 3P74A 2E1DA 6TIMA 5AC4A 1KTCA 4S39A 2TRSA 1DEDA 1S5NA 2XGIA 3A22A 3ID7A 3C52A 2VM8A 4ZO9A 3ITCA 3VMOA 1FRBA 2DQWA 1DTUA 3OYXA 1A0EA 3PWIA 4RKAA 2ZDSA 4AY7A 8RUCA 3ECQA 3IJIA 3KS5A 3UR5A 1ZAIA 3ZLFA 2YZRA 4K6AA 1GVEA 4G7EA 2VFFA 3URQA 1RA5A 5J04A 4GVIA 1JZ7A 4BF5A 1E1EA 2I56A 4D6EA 2WVUA 4B5NA 5G2WA 2ZCGA 4YYFA 1V3HA 2HV5A 1MNZA 3GNDA 1Z42A 1WP6A 1Q45A 3LTYA 1ECQA 3ZT6A 2OWXA 3OLGA 3VGEA 2XU2A 1IWAA 3QW4B 1SFTA 3W1NA 2CBUA 2WPGA 3ARXA 4YNGA 4B2DA 2QQ6A 3WO8A 1A0CA 2VGGA 1R2TA 1M9HA 4H8UA 1BKSA 1K8XA 1TR9A 4J3UA 4N9DA 1HNYA 2ZWZA 3N13A 1GOXA 3NL2A 4ENLA 3OG3A 4QS6A 2V5CA 4UNKA 4GJIA 2X1RA 4XBSA 1J8VA 2RAGA 2B7NA 2PGWA 5LNWA 3AMCA 4XVEA 1MI3A 5E6YA 4AXKA 5ABGA 3K8LA 3FW6A 1EGVA 1A5CA 1HT6A 4UTTA 2CC0A 1PX4A 4IFRA 3ZJ7A 3N11A 4KW2A 3WLRA 2G96A 1QI4A 3L4VA 3BLDA 3WQPA 5A6BD 3RM4A 1HL8A 4R33A 5LYRA 3R25A 2NQ5A 3CH0A 1VFHA 1XHGA 4JTUA 1TJ1A 2NQHA 4IM4A 4DZIA 4PZVA 1WKEA 3TC3A 1GVFA 3RGTA 4N0RA 4RZBA 4XZLX 1OFRA 3QBUA 3U2ZA 2C16A 1S3HA 1QNSA 2PDXA 3WMSA 4FO4A 2W5FA 3OA5A 3L7RA 3W7MA 3LA4A 4ADSA 3S9ZA 1XWYA 1V79A 3VZZA 4YCPA 2BS9A 2QJJA 3BQ6A 2I14A 1R87A 2JKPA 1KWKA 5CC3A 1X8CA 4O28A 1CBGA 2W63A 3HJZA 3UT0A 1UH4A 5G4EA 3U57A 2ISDA 1Y0EA 3R0DA 1UKPA 3M43A 3ZLHA 4NL1A 2NXGA 3THCA 3BDKA 3GXTA 3AZTA 4C7GA 5I3GA 3UA3A 3QHOA 2OPJA 4WK9A 2VC6A 4HPHA 4PMZA 1NIUA 4Q8UA 3H2FA 1HN1A 2ACUA 1UG6A 1REQB 2CERA 3IRDA 3W1QA 4ZEPA 3WYZA 3CB3A 5E1QA 3F4WA 5DMYA 1P7TA 3CXOA 3GXDA 1KFLA 1SQ7A 5JH1A 2OZ3A 2J74A 4ZGYA 1JDCA 5H8UA 4POCA 3G1RA 3V5CA 3VC5A 2VELA 3JVAA 1Q5MA 3AWNA 5A6MA 4WXYA 2DZPA 5JIWA 1VQTA 4C6BA 1H41A 4C5YA 1GTHA 3F4DA 3MI3A 3IAQA 1F2JA 3VD9A 3WLJA 4PB3A 1YXCA 3FLUA 4D1IA 1DP0A 4M56A 4O50A 4FX6M 3R94A 2VR4A 2HPIA 4ZOAA 3CMJA 4AD4A 1IE7C 4LVDA 1NQ6A 1LM1A 3GFZA 5FJJA 1TTIA 3LK6A 2HBVA 4RZ4A 2YBUA 1H1ZA 1RXOB 3R13A 1FWFC 3OODA 5I3KA 5HNRA 4GLEA 1MRAA 2GJPA 4Q32A 2VX6A 3NQBA 3WLNA 4MZYA 3NQVA 3AIQA 4D6CA 4AD0A 1QPNA 2XFWA 3N2MA 5AHIA 3S2JA 1ZJBA 2D69A 2C3ZA 2F9RA 2VZUA 3UESA 3PB0A 2J75A 5A6SA 1Q7ZA 3TC7A 1QCWA 1LG2A 4M51A 4W9TA 3LLXA 1KBIA 1EGMA 3LS9A 3CO8A 1S46A 3EX4A 1E6PA 3W01A 3ATYA 4BS0A 3SCSA 4Q8WA 4W87A 3T09A 3PZMA 2PP1A 3PJWA 4XX6A 4GO8A 3LSCA 1RCOB 5IFTA 5A1AA 1IXNA 3FHAA 3S1GA 2YBVA 4GH1A 2W66A 4LW7A 2Y5SA 2Z1BA 2YW3A 2FVLA 3B03A 3W23A 2YX0A 5AYYA 2Y62A 1UWRA 2AMGA 2J77A 1LLZA 3FN9A 4GK8A 3KVLA 2FZ8A 3ZJ8A 4JTFA 2F84A 3CYVA 3O1NA 5HINA 8A3HA 1P4CA 4NZ1A 5K9XA 3S46A 4Q4KA 2QZRA 1JNEA 3A9BA 4WDTA 1SUXA 2ZZ3A 4S3JA 2BVWA 3E5PA 4FLSA 4AWSA 3IK2A 3INPA 3W26A 3PM6A 1QNOA 3VABA 4GOAA 3SRDA 3H26A 1XIJA 4F0RA 5DF0A 1X7FA 3KM8A 3T07A 4QROA 1K9EA 3TSMA 2CFFA 1SMDA 1WYIA 3HG2A 3DGBA 5HUOA 2DZUA 2QT3A 3UCDA 4J35A 2YYUA 4B15A 3BW4A 1BF2A 1R3TA 2P1FA 4WR3A 3UCQA 4M1RA 1UWTA 3DI0A 3DFNA 3OQ8A 4HNUA 1A53A 1H5YA 1UR9A 2CITA 1O5XA 1OSEA 2E4TA 2BB0A 2F8QA 4MNMA 3NZ1A 5J5DA 3EYPA 4HK5A 1UUOA 4G2DA 4TV5A 4QLKA 4XIMA 3W7PA 2XVLA 3H2OA 1WXZA 2BNJA 4D6FA 2NSXA 3RU6A 1PKLA 4MPQA 2VX5A 1ZUAX 1TIWA 3S5SA 1QOXA 3OP2A 4EP8C 1JZ2A 2A6LA 3MJMA 1D8CA 1RZMA 1R8LA 2XIMA 1GCYA 1F07A 1UOKA 1CXFA 3NQ7A 4ZCWA 1C7TA 5CGMA 1E70M 1ZLPA 3JR2A 3MI2A 2A3HA 1UR8A 2PB1A 4QR6A 4QRNA 4JQ4A 4PR4A 3OLDA 2QCCA 1TELA 1UIPA 3Q65A 1AVAA 2CXEA 4N4QA 1LL4A 1OY0A 9XIAA 1W5OA 3RJYA 4TU1A 5AFDA 2F2KA 5GJMA 2PDMA 4HCDA 4U4MA 4O11A 3TN5A 2ZVRA 5EU9A 2HVMA 1GPWA 1XYLA 3JUGA 1GQKA 4GCAA 5I2UA 2WXDM 1R3QA 1B1YA 1ODUA 1XCWA 1SW3A 1TZZA 4MDPA 3A4JA 5JH2A 4LC6A 1GQLA 3AWOA 4W8AA 3TZNA 1TPUA 5EMJA 3EWZA 1RBOB 3GC2A 3PWAA 3E2RA 3BAXA 1VJSA 4OVXA 4GKTA 2GGGA 3W73A 2OEMA 3G6MA 3RO6A 3WDJA 3NQEA 2NWSA 5I03A 1TSIA 4YTRA 4AUBA 4NZ5A 4Q6XA 4GKLA 1G01A 2CHRA 4TXEA 4C6CA 1BYDA 1L6SA 1EHAA 1ZBKA 4KGLA 2PF8A 4U5IA 2D0FA 1T8QA 5AKQA 1IR1A 2WQDA 5CAHA 3II1A 1UYQA 3ZZ1A 2ABBA 4I9TA 1HO4A 1XFBA 2OCZA 3VI2A 3PANA 3C3NA 5LNVA 4ZB0A 4F3HA 4AYSA 1Q6GA 1OFQA 1LTDA 3GRIA 5JIPA 4HPNA 4AB4A 3ZVHA 1LOSA 3DIPA 2DP3A 4H9UA 4HMNA 4XAFA 4JTSA 4F40A 3FFSA 1EF2A 1Q63A 3OJGA 4DJEC 2BASA 1JRBA 1OHLA 4P7OA 1VBJA 3EA3A 3P80A 1QNPA 6REQB 2DT1A 5EBUA 1ESWA 4UOJA 1VBRA 4LB3A 2XINA 5LXEA 2Q8XA 1WQ5A 1NP0A 4HU0A 4IQEA 2V3GA 2JQXA 1G7VA 1B3YA 3XISA 3TEVA 4D9PA 3G1YA 3DG6A 5FOOA 4M0XA 3SRKA 3W7EA 3DHDA 1TB3A 3BLIA 4XISA 1CGUA 3GM8A 1WDSA 4H1ZA 2NT0A 4WGHA 3WK3A 3AS3A 1C8VA 4PYSA 4PUJA 4GABA 4KCVA 5A8PA 1R3YA 2E5DA 5CG7A 1K9TA 1S39A 3RCYA 3PTDA 3QKEA 1AUSL 1FH8A 4CD4A 3FK4A 4LF2A 2VGIA 3EGJA 5AC7A 4LT9A 4N02A 1P0NA 3VZYA 3VX0A 1NDVA 2C0HA 2PFHA 3PNZA 4XVDA 3TYBA 4C1LA 4UTMA 1EDQA 1UP2A 3WNLA 1EJVC 1US2A 2XH2A 3MMWA 1FXQA 4RK8A 3RYSA 1RA0A 5A8OA 3UZYA 3U3HA 3GYEA 4NJHA 3KLKA 1VR6A 3PNUA 2NUWA 4WQ6A 4PMUA 4ACZB 4O15A 1GVSA 4DJED 1MZHA 2XN0A 4NJIA 4G1KA 3MMUA 4ECLA 3VGFA 4GY0A 3N4EA 4HYVA 2ZC1A 3MBFA 3GWQA 1JYVA 1ZAHA 3A24A 1R86A 2ZRVA 4GIEA 4DNHA 2QUVA 3W1PA 2QF7A 4OBSA 3C56A 3BMWA 3H70A 4A2RA 4MWAE 1UCWA 5FF3A 3IRSA 2HNEA 3CHFA 4AF0A 2QULA 1ZPTA 4DM2A 1GHSA 4K8HA 5FF2A 7ODCA 4NZCA 3M0XA 4MZ8A 5EYWA 2ESCA 3DFHA 5A8MA 5AOUA 1R6WA 1RH9A 2J8TA 3BLOA 4D6GA 3N12A 5LNSA 2DH2A 5CCZA 1U5HA 5B7ZA 1RBAA 3PZUA 4ES4A 5DY3A 1FA2A 4XG1A 1MXGA 2YIHA 4UR8A 2ZUMA 4OBTA 1ZHAA 5EBAA 4DBWA 1UWAA 2ZVIA 1U33A 4R53A 2FDSA 5I23A 4DBSA 5M5DA 5H1WA 3NQ8A 3HOJA 1OFBA 1KRMA 5RUBA 3BG3A 8XIAA 3NFUA 2PWEA 4TX8A 4E8DA 3FKKA 4GXMA 4Y6GA 4L9XA 2FTYA 1Q7QA 5LIUX 3AISA 4AD3A 2W9MA 4QFUA 1QJWA 3BW2A 2PBGA 4LF1A 1AD4A 3F4NA 1OCBA 1M3UA 3P82A 3WQCA 4JNZA 2V3DA 3RPMA 1H60A 1R2RA 3FYYA 2NT1A 3RPTA 5JVLA 2EPKX 5ECVA 4WJXA 6ENLA 4N6FA 4M5PA 1V93A 3CWNA 1VPQA 1BG4A 5D4YA 1GUVA 3GR4A 5EB8A 2WMHA 4WOZA 4AVOA 4XAPA 4Q8OA 1CB2A 1H09A 5L6UA 3IV3A 3R6IA 3T0CA 1PO9A 3LX9A 3F2DA 3AJXA 4Z0JA 4L5ZA 4YTUA 4O13A 3IJ7A 1PUDA 1F7BA 3N9RA 1EYWA 4FX7A 3AYSA 1HKKA 4ROPA 3TJ4A 2UV8G 4HOZA 1XIGA 1TKKA 3PF3A 2YDQA 3R89A 2Z2AA 3NZGA 2WM0A 1K8YA 2CZEA 3GG1A 3BAKA 2QGHA 2GJXA 4OT7A 3AXHA 1QW7A 5CQ1A 1Q8JA 2FMOA 3GXMA 5IHRA 2E3ZA 2VC5A 2WK2A 4M82A 1PVNA 4PMVA 1DYSA 1H51A 1VHCA 1JZ6A 4EWJA 1SO6A 4OJYA 1TCMA 5FL0A 2EJ1A 4DYJA 4ZMGA 1R38A 3IIXA 3AS1A 2VEIA 4WSHA 3KWSA 2PTDA 5FEXA 5I09A 3B4UA 3SN1A 1Q7MA 2C71A 4LCRA 1V3KA 5AB3A 2O9OA 2GDUA 2YFOA 2AL1A 4OHQA 3SSZA 2V67A 1HP4A 4FK9A 3KOYA 1TMLA 1Q8AA 5FEZA 1XIHA 1IF2A 1TFVA 4Q22A 1UZDA 4YJ5A 3HM7A 3LSBA 2OOFA 3TXZA 1QHOA 3W85A 5A3HA 5HDRA 3MTWA 1OYAA 1BPLB 4HSNA 1VPYA 3R4IA 1K6AA 1EO7A 2E6DA 3MV01 4REQA 1Y5VA 4J5NA 1VYRA 3DX5A 5HANA 3S5YA 1RSCA 5C2XA 3BV4A 3QLDA 3FKRA 3LM7A 4FALA 3TWBA 4GXWA 4XZIA 3MBDA 2MANA 5CBBA 3ITOA 5FJIA 3JU2A 3TK7A 4WY0B 4YVXA 3LI1A 1A5UA 1OB0A 3E2VA 5D05A 4QITA 1M04A 3AIUA 4B5TA 1RY8A 4WIWA 1ECEA 1FCBA 2WMKA 1TA3B 4MAZA 3A21A 2CWXA 3LG3A 1DVJA 5FSDC 4FNSA 1OCQA 3GW0A 4PMJA 1S2VA 3PB2A 4GBUA 1IEXA 1RLDA 4DB7A 3UWVA 3WNPA 2OJPA 5EMMA 1H1YA 3LPGA 3N14A 4O18A 2QCDA 3ZLGA 1F6KA 5B80A 3GU1A 3AYTA 3WF1A 2PLKA 3FSTA 5G2IA 5JBEA 2OVLA 1C92A 1WE5A 3VGBA 4H9VA 4LS2A 2D20A 1MRQA 4J3XA 1UROA 4LSBA 3H7VA 3B8VA 1LORA 1UR2A 1E51A 4A4AA 2X40A 4ZQOA 4N4PA 3WQ5A 4KCUA 1N8FA 3SCWA 6ALDA 1S38A 4D6JA 2YA1A 3WL1A 1SFSA 3MVTA 1S5MA 2CETA 1PJ9A 3KL0A 4PUUA 3KZSA 2XGZA 1IEVA 1ZJIA 1TRDA 3QTGA 3W24A 1KQYA 1TMQA 1GPFA 3SCNA 1MUWA 2O7QA 1ONEA 3L2LA 1TIMA 4ICCX 3W2KA 2CNCA 2VEPA 3KVKA 4BK9A 1HP5A 1FWEC 1XDJA 3QPYA 3G2GA 3ZT5A 4S3KA 2ALRA 1K8ZA 4A29A 2YA0A 3QZEA 1S2UA 3UXIA 4DBEA 3L4ZA 3AUOA 4IOTA 4EPBC 4JTGA 4LV4A 3C86A 1KC7A 4C1NA 2ICSA 1XS2A 4AHPA 2BHUA 1IIHA 2XFRA 3TCSA 2PDIA 4O1DA 3MYOA 2BOEX 2EG7A 4LUTB 1NJJA 4YMZA 2DZVA 4FXJA 3QFWA 2XIQA 4DWSA 2X0YA 3CEPA 3B06A 4XSLA 1BTCA 4HPXA 3KP0A 2DVXA 4HCHA 2H6RA 4E3TA 3IS4A 3WJXA 2XSXA 2ADAA 4ICNA 5FJOA 2VCCA 1GOOA 1J0HA 4CCEA 5KETA 1PYMA 5AC8A 1UP0A 3KTCA 2JKEA 4PTDA 1QMLA 4A3YA 3AMLA 1JCXA 4W85A 1YBQB 2PRMA 1TTJA 4UFJA 4FS9A 6PTDA 1ZNNA 2RJHA 1FBAA 1U83A 2ZUTA 5LZLA 4E2OA 3TQPA 4AWUA 4HOXA 4KQNA 1UH3A 3CPUA 4ML9A 1GOIA 3T9PA 3HPFA 2RH9A 2PZ0A 3LCIA 1DWHM 4C60A 4GI9A 1XI3A 4O0ZA 1XDLA 3UJFA 3Q45A 2BWGA 3UJ2A 5XIAA 4HU3A 4IFOA 4D8ZA 2BOFX 1LP6A 1N82A 3AUJA 3H54A 4JTIA 1QNVA 4C1KA 3U7VA 5K4ZA 3UCCA 4DXKA 2AQVA 2V63A 3WF3A 4XZHA 2J7HA 3UR8A 2BOGX 1ZL1A 4NRSA 5DLCA 1SSDA 4HIBA 1EJUC 3SJ3A 2ZX6A 4Q7IA 3UYCA 1UUMA 1IR2A 3N18A 4JKLA 4A8LA 4C6IA 4UTUA 4O1AA 4IMEA 1KFBA 4XZNX 4WOQA 1XLMA 4XK2A 3TCEA 2WMIB 4UR9A 1POJA 4MPKA 1J0YA 1F3EA 4C6JA 1POKA 3GNRA 3PP7A 3RAOA 1YDYA 1YXYA 2E77A 1EP1A 4O1BA 4J3ZA 5IHSA 3IJQA 3ANYA 4MM1A 4HA4A 2OSXA 1J12A 4ZBCA 3U2OA 4ZO6A 1UD6A 2ZRWA 3JRKA 3BH4A 3MKCA 3TV8A 3NGFA 2E09A 2A7PA 1OYCA 4I7VA 1DOSA 2C1IA 1QPQA 2A3BA 2ZE0A 1IEWA 5BXTA 2DT0A 3QYSA 4D72A 2Y1HA 3OHIA 2OWWA 2AKMA 4UBPC 2Z2UA 1VCVA 1SJAA 4GX9A 3S1UA 5AYBA 5MKGA 3W2LA 3VOGA 5CH9A 4YYCA 1NOUA 3M16A 3CZJA 4DM1A 4AYGA 1SW0A 3K8KA 2BXZA 5JBDA 3UYIA 4Z1AA 3QGVA 1K03A 1YE4A 4PCNA 1HJVA 1TWSA 1G5AA 2X1SA 4PA8A 2YCLB 3AIBA 4NY2A 1G4SA 3E9AA 5I3IA 3BLLA 4UFHA 1A5MC 1GOMA 3PPGA 3OZYA 4J1OA 4QDPA 4OGZA 1T99A 4PTVA 1R3SA 3WDPP 2I9EA 4XKYA 1VFOA 3LENA 2VEKA 4DUXA 3ALFA 4IPNB 4EPKA 2F7FA 4E5TA 4JIHA 3AXIA 1TRIA 1PKMA 3DYOA 3I6RA 4EAYA 5CC5A 2DDXA 4RNFA 3GE7A 1OADA 3RK8A 1U2YA 4K7VA 4ATDA 3EDFA 2OGYA 3WQWA 3CLWA 5C9XA 3ABOA 3IUDA 4DO5A 1OZQA 3ZJKA 1X6UA 4O14A 1BD0A 1FOBA 5FIPA 3GH7A 1UR4A 3B40A 1H7WA 1ZCCA 1FWHC 1ZP3A 4B9YA 3RU8X 1FX6A 4FF5A 1TV3A 3GDBA 3QZAA 3U9IA 1XSKA 1ITUA 2E28A 1JDDA 2QW5A 1HFBA 3W2UA 3I7SA 4AZIA 2PURA 3THAA 1FWIC 2TPSA 3DECA 3HGSA 4X60A 2QAFA 4JHMA 3GHRA 4J40A 3AIEA 5KINA 1TV5A 3QSTA 1QU4A 3ZYZA 3UP8A 4DX3A 5AC6A 2PDGA 5HNTA 1FWNA 2ZQ0A 4XO6A 3VNLA 1N55A 4YS1A 2C18A 2A6NA 3P5YA 4H9TA 5E93A 3TFXA 5AZ1A 3O63A 3W2NA 4EE9A 4EF8A 4CLMA 4WHBA 2ISSA 2DSZA 4I9MA 1FDJA 1FWBC 1LWIA 5I3DA 1Q6LA 1E0XA 3S2LA 1EH9A 4LAOA 4AHQA 3CV2A 1KWGA 4AMCA 1KQZA 3I4EA 3TQVA 4DBDA 4L80A 3CS2A 3TU9A 3WBEA 1JZ8A 2RUSA 1XBZA 4BI6A 2PU0A 3VAVA 3VIMA 2P10A 2HPMA 4JGDA 1JCJA 2BMBA 1M41A 3FA3A 3ARSA 1QI5A 4O54A 3S0CA 4XB3A 4AZ7A 3SAZA 3B8IA 3L4YA 4LUSB 1J93A 3C4UA 4IMFA 2G37A 3M07A 2DT3A 4LCQA 5BRQA 1ICPA 4CD7A 5GPRA 2ZFAA 3RXZA 3LTPA 5LHFA 4UB9A 4NNBA 4O1CA 4ADTA 1QXLA 1YX1A 1G4PA 2YCIX 3V1HA 1GNXA 3V0SA 2O4QA 3MYPA 2V5KA 3OOQA 1FWRA 3WK1A 4PEKA 1GVOA 2UWFA 1DJWA 4L6DA 4MWAD 2J25A 4S3BA 3R5EA 4QGCA 2J9XA 4YU1A 2QUMA 2J9YA 5G4WA 3VVGA 5D04C 3L66A 2IS7A 3RCMA 4IJRA 2QCLA 1RPXA 2XZ9A 3N73A 1WV2A 3M5VA 5C2GA 1XSJA 4GGBA 3WJSA 1QI2A 1I1WA 4MSSA 3P67A 1SVDA 4GYPC 2A3CA 3GXFA 1GYNA 1KRBC 1SZGA 1EP2A 1CB7B 3UNDA 2E9LA 1GKPA 1ML1A 1NEYA 2WANA 2I16A 1DTNA 4B4FA 4QIUA 5C54A 4LS0A 4MWAB 3AXKA 1OGGA 4Y8EA 3RILA 1QNQA 1ZBWA 2ZZ4A 2Q71A 3URBA 3FAWA 3T40A 3N4FA 3UERA 2H8XA 1QTWA 2PCQA 1U22A 3QJAA 4H19A 1C8QA 1JIBA 3CUXA 2PP3A 1PTGA 1WX0A 5DN1A 1EEXA 1KLYA 2XPKA 1RQEA 3QH2A 4JNMA 3TJIA 1T40A 4D71A 3E12A 2A79A 4IP5A 4P61A 4LTSA 3FEQA 3F4CA 5I24A 3GR7A 3K1GA 2HBXA 3U4FA 1UJQA 1JI2A 4HOWA 1EJTC 3UXKA 4V1XA 4B5UA 1IZKA 2QEZA 4F9JA 2QUTA 3PFRA 1AMYA 3GK0A 4Z1BA 4ORMA 2J24A 1KCLA 3UZ5A 1BAGA 5KZEA 4BY3A 2YPIA 2VRJA 1KKOA 1RV8A 2VMFA 2O9TA 2DY3A 3CV7A 2VDHA 4Q8TA 4IL2A 1GQNA 1HF6A 4K8EA 3DG7A 4TMCA 5CSSA 1C7SA 2Z2BA 5D2XA 1BSLA 5D2YA 3NZRA 3IARA 3T1GA 2NLIA 4FIQA 2R82A 5KZDA 2FFCA 4NX5A 2FH6A 1LBMA 1WA3A 4OZOA 1TMHA 4LWWA 4G7FA 1VEOA 1RJQA 3H53A 1VLWA 1RD5A 1K8CA 1EDTA 1Z89A 1ITCA 5CGTA 1PTAA 3WKZA 2H9AA 4EXAA 3TR9A 2OZ8A 4JFVA 5JQ9A 1VPXA 3DGRA 2IW0A 1DWAM 4FNPA 2JF7A 4PBGA 3T8LA 3CIXA 3FOKA 2ONEA 1XC4A 1ZB5A 2YLLA 2WW5A 2FHCA 3TONA 4WZHA 1QPRA 1MUMA 2WNZA 1SPQA 3PS7A 1S2CA 3KBWA 1P6WA 3D46A 2HISA 3NYDA 2ZA2A 3TC6A 2ALDA 2DZAA 4NKCA 2PD5A 3EB3A 2VJXA 4RX0A 4GD0A 1DKWA 3UG8A 2Y7GA 2E1WA 4NUWA 6CGTA 4RW3A 3WQ4A 1W9PA 4H41A 3LCGA 1H7PA 3QYQA 1HL9A 1MO0A 3E49A 3CQHA 1UKSA 1B30A 1J9YA 3G1DA 3RHGA 1G1YA 2G3MA 1GHRA 3FA5A 2C1GA 2PU1A 4XSMA 2HK1A 4HSHA 1JPDX 3S9IA 3M0JA 2ZUWA 4GZIA 1Q2RA 5AN7A 1PTDA 1FCUA 3NUKA 1DIOA 1W3LA 1LQ0A 2ZZ6A 3RLGA 1DE5A 1WDWA 3BGAA 2VFHA 3PG9A 3C0SA 5AHMA 2ZRXA 3MZ2A 3L4UA 2AL2B 1WDPA 1VAHA 1ZU8A 5DEZA 4HZ7A 1O95A 3RMEA 3EWBX 3VOCA 4J3SA 3W7GA 3K1DA 3EDEA 1QBBA 3QQWA 2WYSA 3M41A 2DIJA 3USBA 4C5ZA 2EAWA 4QJ5B 4V33A 4JN6A 4IUGA 1B3WA 1PE1A 1RBLA 4FZIA 3A9IA 1C3FA 4G56A 5F4SA 3GZ3A 4PCTA 1FQ0A 3RN6A 2ZE3A 1LUCA 2WSKA 1F3XA 4W7WA 2R1LA 4JFTA 4M29A 3FJ6A 2FB3A 4WLCA 5FL1A 4GJJA 1JYXA 3ITTA 3MDUA 3LEPA 3LHTA 4UOZA 4QNWA 4KWVA 3G1SA 1K3UA 1BG9A 1NF0A 3VD4A 1IWPA 1W31A 4P2VA 1IIGA 2DZWA 4GZEA 4UTLA 3W7LA 2QAPA 2PD9A 2KZHA 3P7YA 7TAAA 2PWVA 4NI8A 4LVFA 2HXUA 4HGXA 3S5NA 3FV9A 1E5JA 1BSIA 1WO2A 3MJYA 4NVTA 1UWIA 3GTNA 1Q6DA 4LOCA 5HMEA 2V5DA 4UNLA 3WEZA 2Y4SA 2QDDA 3W7QA 2ZZ2A 4FOUA 1YDVA 3BAIA 4JBRA 6REQA 1OZMA 1SYTA 3A4AA 3NXFA 4FR6A 2ZKMX 3OGRA 1RD6A 4IH3A 3PSVA 2V6AA 4L4LA 3DH7A 1T5AA 1XUZA 3HQNA 4AZ6A 4AX6A 2QJGA 3EDJA 2Q02A 3WLSA 3ARZA 3NDOA 4K38A 4Y7EA 2R24A 3LNPA 3DOPA 2I9UA 4QE5A 2CBJA 2ZUUA 4XAYA 1E9LA 3GBEA 3PSWA 1E56A 2QIWA 3VUPA 3NQGA 3MY9A 2XM1A 1GG0A 3A3XA 1Q65A 2CLMA 1EEPA 3R7MA 4DAFA 4QTGA 3PZQA 4LAKA 1EIBA 1KM6A 3CT2A 3B0PA 3SUVA 4JTDA 4X9SA 3S1VA 3EPNA 1XM3A 5D32A 2YB4A 3STPA 4FOJA 4RNIA 2JKAA 4RCXA 3T08A 1H1NA 4QDMA 1ZP4A 1CW2A 4DUOA 3SQSA 1V6VA 4X2PA 4O10A 3QTPA 3FDGA 5DMNA 3O0KA 3MZNA 3NSXA 4QQ3A 3GLCA 1W3JA 3FYPA 4LNYA 3M6DA 4O52A 3VILA 2BODX 1XGZA 3GYCA 1GZGA 2YFNA 5CGQA 4NZFA 1CWYA 3G6LA 4PRRA 3K13A 4H8VA 4CCCA 1MDLA 3QHNA 2PPGA 3O05A 1HQTA 3HPSA 5G1YA 5C7VA 3KDNA 2IKJA 4L1WA 4A2SA 1XLCA 1IYXA 3WDRA 4D8LA 1VFTA 3FAXA 2W67A 3CMGA 1TV2A 4V1YA 2CEQA 3V16A 1H5VA 2POTA 4AY8A 3LHZA 5EMYA 4IQLA 2BTMA 3DU0A 4I9JA 1AA1B 2O56A 3LTSA 4TIMA 2GGJA 3QPEA 4EXQA 1L2UA 1S1RA 2NZLA 3BSHA 2QDGA 3HG3A 1UKTA 3EWDA 3OVGA 4H9XA 5MF5A 2DEPA 1XL9A 1T96A 5KTLA 4GJ1A 3L12A 2OG9A 3EAUA 4N9EA 1V4YA 5A8QA 5M1TA 5H8MA 2CZVA 3N3MA 3S5ZA 1MW3A 2A7NA 4JOMA 2IKGA 3EOLA 1F3WA 3F2CA 1UZ4A 5CC7A 1DWIM 3NR0A 4JIEA 1C8XA 2QJHA 4ZE4A 1L6WA 4EOUA 2VWSA 1ZCOA 4Y9NA 3QY6A 3M5YA 2V3EA 2V5LA 5A6JA 3M46A 1B54A 4M6VA 1K7XA 3AICA 2PA6A 3JW7A 4JL2A 1X1OA 4AD5A 3CUJA 5I77A 2DORA 2XFFA 4XUGA 4AISA 1HGWA 5LNRA 5E0KA 1LL7A 3LRLA 5A69A 1BVNP 3EOSA 3IJ6A 2H3DA 1P0KA 1FHLA 1UMYA 3O6DA 1TUFA 1X1ZA 1RLCL 4DO6A 2FTPA 4IGNA 5BNKA 1A4LA 2D3NA 3C0JA 2X1TA 3PZTA 4HZ6A 4MFEA 3BCJA 3QF0A 2JIWA 3GTXA 4KESA 4HNVA 2XVPA 2CCRA 1PHWA 1JQVA 1XBXA 1SZEA 5HPCA 1C90A 3KRBA 3SR7A 3CWHA 1A5BA 4XZWA 2D1ZA 3SY5A 4L6OA 2BBFA 3UWZA 1H7OA 2ACQA 1E1CB 1H3GA 1NQKA 3UZJA 2NQJA 3MUXA 4GQ0A 4JCMA 1QWGA 3VDAA 1XIFA 2Q8ZA 4PBFA 4UZUA 5DMLA 3C0QA 3RDKA 1M7OA 4IXXA 2CZ5A 4OOUA 4NJKA 2YCKX 1J0ZA 2VX7A 3CZGA 3THQA 4NASA 3MCNA 5XIMA 3TYDA 1NWRA 3RNDA 1MSSA 2VD8A 1G9HA 1XRVA 3HB9A 2EXOA 3QC0A 1EZ2A 4R9XA 4AVFA 1EC7A 1LZOA 4FA3A 4KH2A 2V2DA 2DSWA 4OU1A 3SB0A 4NU7A 4WSKA 2FHFA 1ZRQA 3VFCA 3HN3A 4YHEA 3GTIA 1V3IA 1O60A 3FVMA 5BMWA 2XYLA 3NQCA 4KS0A 3WK0A 4RZ5A 3MSGA 3BK0A 3O15A 5A2BA 4QG6A 3S42A 1W3KA 1TPEA 5CG0A 4CNOA 2GSEA 4US5D 1NF7A 4DXVA 3LM3A 4Q4RA 2W91A 1XH2A 5F7UA 3PBMA 1TYGA 1OK4A 2O0TA 3GIYA 3U2CA 3VIGA 3BSGA 4GI6A 4JQ2A 1B31A 5E70A 3TA6A 1ODZA 1AW5A 4JTCA 3QZ6A 3NJ3A 4HVXA 4I6KA 4BI5A 4A21A 1R3VA 3B8SA 4WF7A 1E0VA 1SZRA 3PJUA 4UC5A 1XLAA 3CTTA 4BQ3A 1Z9AA 2REQB 5BXPA 3T0DA 1WOAA 3ZO9A 3C0LA 2DW7A 5D9PA 3GXNA 2HROA 4IL0A 4IP7A 3QQ0A 3QMTA 3LOTA 4NI3A 4OFCA 1FP9A 4HKPA 3GIPA 4FX8A 1BXNA 4S3CA 2FHBA 3RG6A 1H0IA 4WY0A 1ZENA 2YL9A 2IQTA 2HWGA 3FS2A 4YVPA 4O4WA 3VD3A 4ZFMA 5F2GA 3HFTA 4IQDA 2I17A 2L5HA 4KWWA 1TWIA 1G0CA 1TA3A 2XGBA 3H21A 2WMGA 3NVTA 1DL3A 1OT1A 2IUZA 4AFYA 2FYMA 3F5KA 1B5TA 2WKJA 1I60A 2D2OA 4H6KA 3WH8A 5CZTA 2HSAA 1K70A 2Z24A 3ONCA 2V81A 1YQ2A 3QPZA 1UMLA 5FEWA 1L9WA 1MXDA 1BVZA 4IFKB 1QPOA 3BAWA 2WWCA 2EKCA 1FWDC 5T91A 3CK5A 2QPXA 2MUCA 4DXXA 2X30A 4DYEA 1XICA 4JYEA 1OIMA 4R88A 3DESA 4MKNA 3DC0A 3LLDA 2XIOA 3OGSA 4TQTA 2VR5A 4U28A 2DUZA 3WQFA 4JIQA 2VFIA 3ZSSA 5TBOA 5HWMA 3LMZA 3F03K 2G3NA 2CIPA 4HU4A 4UMBA 1ME7A 2J13A 2QJNA 2IQ0A 3E3HA 2VOTA 3W1UA 3GX9A 2FGLA 4R27A 9CGTA 4WD0A 1Q6FA 4IJCA 1V8EA 3WBYA 3P62A 1QW9A 1O7AA 3UZWA 1H49A 5SWUA 3EX3A 1YYAA 5I3HA 1DHKA 4F4RA 3AJ7A 4AAJA 4LFYA 2VCAA 2QV4A 2ZXBA 3KBSA 4TOQA 1B3XA 3V35A 2XHYA 1UPMB 4H9MA 5LIXX 4UTTC 1XYCA 5EMLA 4LUTA 5ENLA 3OBEA 1BGGA 2G0WA 4EPDC 2CLOA 1D8WA 3VM5A 4E4FA 3Q2DA 3WCZA 3DFPA 1SJDA 2JEQA 3T78A 4QP0A 1YTEA 2Z1VA 4LYRA 1V6WA 2FKPA 2PBOA 1PDYA 1UZ1A 3T0TA 4XIAA 3FJ4A 3N2XA 2OR2A 3RF9A 7PTDA 3B0UX 3WSUA 3E6EA 5HWJA 4WRHA 2XDFA 1VCGA 1YPFA 3O3RA 2W79A 1PKNA 4B3KA 1XD0A 3CB8A 1KCXA 4Q7NA 3LHUA 5BU6A 2KX9A 3J7HA 1KM1A 4E6MA 1YBQA 3SN4A 4AD2A 2GDQA 1QBAA 2Y63A 3IJ9A 1DPMA 2XISA 3IJDA 3SN0A 3CIWA 1XP3A 2FB2A 4D6IA 2PP0A 1VBGA 3GQYA 5EMKA 5TQLA 1E73M 1LJYA 3CGTA 1Y5XA 2BFGA 1OT2A 1KBBA 1E55A 4IPLA 3APYA 3F1QA 1TJPA 3AIWA 1EF3A 3NZPA 1BLIA 1QT1A 4DLFA 2QCEA 4GNJA 4LAMA 4UQCA 1KFWA 1SU5A 1XYZA 4PL1A 1E40A 5HUPA 1V03A 4JIRA 4BF7A 3ARRA 4NG3A 2WC7A 3WFZA 5BWAA 3MO4A 4RE3A 3N15A 5CPQA 1EUAA 5DELA 3CQKA 3PFMA 3OPSA 3SADA 4AWTA 1X6NA 2Y7FA 5F1VA 1LWHA 3NG3A 4TTUA 3S83A 4MTVA 4K8GA 4JR5A 2AOSA 1XW8A 1KFCA 1OC7A 5H6HA 3LLFA 1KM4A 2ZUSA 4MNKA 5CSYA 4BWLA 3N19B 2WMIA 4QJ4B 1V7AA 3KBNA 3NO3A 3CL6A 1FP8A 1W32A 4DYKA 1XGEA 3WLHA 1C93A 1UD5A 3FEMA 4P8WA 2NVDA 3F5LA 3GAYA 5A8NA 1ISXA 3Q67A 4H2CA 3C2VA 3OIXA 1YW1A 2OYMA 3V1PA 1OGSA 3TYAA 1AW1A 2YOCA 3SSJA 5HJYA 5BCAA 2Z1WA 3RJXA 4QE4A 3E0LA 2TYSA 3VM7A 3H24A 1O5QA 3ARPA 1GVRA 2INFA 4K2SA 3SI9A 4W84A 3W76A 2IQDA 1W9XA 4HK6A 4GY1A 4FF7A 1DJXA 1IZJA 2CLEA 3D47A 3NEVA 1B2YA 2X7VA 1EJ7L 2X42A 1OX4A 3EMCA 3WMBA 2CBIA 3CT7A 4S23A 3G3DA 4AX7A 4NILA 3BL3A 3TW7A 1TPH1 3LBOA 2RDTA 2A3AA 5JU6A 1CNVA 3E1F1 2X8RA 2W27A 1VBHA 3MP4A 5HR7A 3P5ZA 4WY0F 1LLOA 2YCLA 4BA0A 4DY1A 1NU5A 2DSUA 3ZMRA 1AK5A 2D22A 1J01A 2QMKA 1YE6A 1C9WA 5G4HC 4TVDA 3AHXA 1FWCC 4RXGA 4M6QA 3LHYA 3QW3A 1JCNA 3L5LA 2E8ZA 3LNMA 5I3JA 4UMCA 4A22A 3O16A 3NCOA 2E6FA 3TN4A 3IIOA 3CUGA 1KCZA 3QR0A 2BGQA 3VOFA 2DVUA 4O53A 3UWEA 4MLRA 1G94A 1OD0A 1IWBA 2P3EA 4KRUA 4H00A 3NA8A 4HZMA 4CKQA 1TX2A 2C0AA 3PUDA 4CCZA 2YDAA 5A5WA 3COTA 1JD7A 4GX8A 1TR1A 3IGSA 2R9RA 5D8WA 4IIDA 3VOJA 4NRRA 4YTQA 3AXMA 4O8AA 3WNMA 3PPCA 3DAQA 1E4LA 2CHNA 5ABFA 4FAMA 4O1FA 1V6XA 3M4HA 2OOGA 4I8YA 1XYAA 2GUUA 2XN1A 2QR6A 3HV9A 2AQOA 4JFUA 1SZNA 4LBRA 3ARVA 3MC5A 5HPOA 3EPMA 1F61A 1RJRA 1FY6A 5GNXA 3ZVIA 4I5XA 4DF0A 5HOSA 1EOKA 3WELA 1OG0A 2V0TA 3WZ0E 2R1PA 3MI6A 1Y7VA 4K1GA 4C6MA 1NWTA 3AXXA 3CC1A 4MB1A 2YDSA 4JZ5A 3MKKA 1VEMA 4PFMA 3OZOA 1GVQA 3TX9A 2VFDA 1V3MA 1OFEA 3FDKA 4GHRA 4U5KA 3MU7A 2XZ7A 2CLHA 4CD5A 2D24A 1LRNA 2QDHA 1O5RA 3VNZA 4JTAA 2ZYFA 3T05A 3ARUA 2YA2A 4QEEA 3KBMA 4NNAA 3Q58A 4AC1X 4DAIA 4L4OA 4BHYA 1BWVA 4MY1A 3CM4A 3GNPA 3NPXA 1LT8A 2BY1A 3CEUA 2VGBA 3T0BA 4Z0SA 1XYMA 4HA3A 2G3IA 1XR2A 4JTKA 4PC8A 3B8UA 4O57A 4Q7BA 5AYIA 4W7UA 1DBTA 2DUAA 4UTJA 3CL7A 1A47A 1BYBA 1CLXA 3W00A 4QDWA 1MEHA 3VC6A 4GH3A 4Q33A 4WJEA 4LUSA 3LCXA 3RM8A 7REQB 4RR4A 3MCMA 3TOPA 3SGUA 4D1JA 5A6LA 5IBXA 3BLPX 4L7ZA 4HU8A 1XIBA 2A7RA 3SY1A 2YSWA 4IWWA 3TH6A 3L65A 2NV1A 1I1XA 5LHEA 3MP3A 1VYSX 4IGHA 2WZEA 3U5YA 4TV6A 4N42A 5CBIA 3PBVA 5LIKX 1J0IA 2B81A 4E8GA 4NSBA 3IJLA 1ZS2A 3NSNA 1JNDA 1R2SA 4AIEA 4F48A 4H9ZA 3VIHA 1GEHA 4GQRA 1FFQA 1ISZA 5KSWA 4HCLA 3KHJA 1DIDA 1YNQA 4C7DA 4ACYA 3VIPA 4ZSUA 3N04A 2A0NA 4RDWA 3WDQA 1AJ2A 4IIGA 4LCSA 2OT0A 2NW0A 2DSVA 4YTTA 4AEFA 2E6AA 3DFYA 4GVHA 3P0XA 4CQ9A 4LVGA 1FWAC 1JJKA 2TAAA 2YJQA 3B0VC 3KHDA 1OFPA 4JPGA 3QV7A 4FP1A 3AS0A 4MWAA 1XISA 3RRAA 2FGBA 4LXFA 3EWCA 2V3FA 1GQJA 3O6AA 1DV7A 4JD4A 1R3RA 1Y8BA 2A3EA 4W88A 4UOQA 4RV8A 2VC9A 4FEZA 2UY2A 4C6LA 1K4HA 1X8FA 2NQZA 1KNWA 1KTNA 2WBGA 4U3CA 1XD1A 4Y9AA 1AFSA 3NM3A 3PPFA 4UFLA 4Y9PA 1MEIA 1B9BA 3GDMA 3N1AA 2R1NA 2QKFA 4B5WA 1IEIA 4NXSA 3CHCA 1HZYA 3LPPA 3U48A 3JS3A 3EWXA 4GNVA 1FHDA 3MUZ1 3BOLA 1CXEA 4Y2WA 2OSYA 1FH9A 3I3DA 1BF6A 3GVRA 1YKWA 5TNVA 4YLWA 2Z00A 3S2CA 3QSRA 4RV3A 4GVFA 3U7BA 3CO4A 4UFMA 4LV9A 2FZBA 4MKVA 3CNYA 3PBYA 5C70A 4GFIA 5GQBA 3GC4A 5C9RA 4R7OA 4UCGA 4BQ2A 3VDGA 4HNOA 3UWQA 2B0MA 3L0GA 1PS9A 2PDUA 3S4TA 1U30A 5EPDA 1DE6A 1GZ1A 1IXPA 1ONXA 4LALA 1QO5A 4CUCA 2EPLX 4LY4A 3TTQA 2VI0A 2Z26A 5CLTA 1GKRA 4S3AA 4HYWA 1CI1A 1JFXA 1HJWA 1A4MA 4I6VA 1JVNA 5LXXA 1TX0A 3THUA 3TN6A 3EBVA 2I5QA 1GONA 2OLHA 4ZQPA 4P7QA 2V82A 1ZJHA 4JTJA 1CGYA 3VIIA 3UWWA 2GUYA 1VKFA 2PLCA 2IKHA 4LYPA 4JFWA 1Q2SA 4F0SA 2C13A 3PTMA 4GACA 2DJXA 1H7XA 4PMOA 4HSOA 3AQUA 2GL5A 3AI0A 1HVXA 2VXNA 3ANUA 4XBKA 4B91A 5FCZA 2W0UA 4JTTA 3W4RA 3WQEA 4UFKA 4FOKA 2OQLA 3SCRA 1G6CA 1OBAA 3W2MA 1RK5A 4UIOA 3TN3A 4D8AA 1ME9A 3WUBA 4QCEA 2GJRA 4W8BA 4GI8A 3ARTA 3DKJA 3GO2A 1B57A 4W7VA 2PWGA 5FJPA 5C7HA 4M81A 2QNEA 1KM3A 5I02A 5ABTA 3G24A 2WVTA 1XPYA 1EFZA 1V02E 3AHYA 5I0DA 3B4YA 1IXQA 2RJGA 5JXQA 1W1TA 4W86A 2E40A 1LRTA 4EPEC 3NL6A 3CQJA 1TPWA 3CAWA 4YWIA 4Z2IA 2DIEA 1PDZA 4DRSA 1J0JA 1YIXA 3V5OA 3Q94A 4YVVA 1XV8A 1QPKA 3P61A 1M7XA 2WJDA 2ZC8A 3GXPA 5CKSA 4QX4A 2R1KA 3TNOA 3VKKA 1QI0A 1BTMA 4IMGA 1VBUA 4DQWA 5IDZA 3L2MA 5AHLA 3MHFA 2VT0A 3ARYA 2PDNA 4KEUA 3P8IA 3W72A 1QR7A 5GJPA 4CEUC 3ATZA 2W61A 2QCNA 4JN8A 3CPRA 4NX0A 1UHVA 3OVPA 4F0LA 4YTSA 3RRXA 1P6CA 3STGA 4LS1A 3WH9A 3AU2A 3VDCA 4MADA 3WLQA 4A3HA 1J5TA 2XH0A 3L5MA 2QGYA 3BPWA 2OYKA 4PB4A 1XG4A 4P5UA 1Q13A 2BZNA 3EXRA 1F6PA 3GSMA 4QLJA 3I68A 3W7JA 3V0TA 3R43A 5LA1A 2W4XA 2JBMA 2B7QA 3DCPA 1X1NA 4J7RA 3IANA 3TTSA 4FNQA 1PSCA 3DFQA 2Y61A 3F2BA 1HX0A 1XLDA 4ZB2A 2RDXA 4ERAA 2WLYA 4O4VA 5BZAA 4B5XA 3VD7A 3H12A 3K4DA 3AHVA 4LX4A 3M9YA 2C15A 2QDEA 5REQA 3MW7A 2BG5A 2R6OA 1JULA 3AS2A 1RP8A 2WJZA 4H4IA 1D3GA 1O4UA 2GZXA 3PVFA 1PX8A 2TMDA 3AIVA 4A3QA 1EX5A 4WVXA 5I6SA 3ZWSA 1KXQA 1F6YA 2G8ZA 1KO0A 3VYLA 2G5WA 3T42A 3G1XA 1JI1A 2YZ5A 2GK1A 3C2EA 1UR1A 2E9MA 4IQJA 5HATA 3W7HA 2Z6IA 1A5KC 3WENA 2DH3A 3BG5A 3EMZA 4S2CA 1WB0A 3BANA 4DZ5A 3BW3A 4AZBA 4ZTYA 2EPMX 2VC7A 5GVJA 2ZBTA 4X63A 5F2IA 1X98A 3LZ5A 2O9PA 3PZGA 1T41A 4BR1A 3GDTA 4S3FA 4NQ1A 5GJNA 2PODA 3R10A 1UC4A 2P76A 3HJEA 3PTKA 4C91A 5KEZA 4MB4A 4JYFA 1O68A 1XLKA 4PTNA 3M0IA 3G0UA 4A3UA 5C0QA 4EANA 2ZRZA 4EAMA 4PMQA 1LQAA 4FNRA 3TTEA 3QGKC 3CU2A 1CLKA 1JDAA 4NJJA 1GW1A 3WQ8A 1WZLA 3ONBA 2HCVA 3H22A 1Q6QA 4AIUA 4CQDA 2FQIA 5BW6A 3S5OA 4K36A 5AHEA 1W9BM 3LI0A 4X3ZA 3PTQA 1KCKA 5HJXA 4Z2JA 1XG3A 5JBFA 2OMAA 4YHGA 4XTDA 1WAWA 2OGJA 4KEZA 3LD5A 3M0VA 1UIOA 1MXSA 1KXTA 2QIIA 3BLEA 3LCHA 2GJXB 3SEPA 2Y88A 3SFWA 1VFLA 4CVUA 4ZXLA 1D9EA 2GOKA 1S3TC 3TFCA 1FWTA 1V3LA 3MP5A 4OUIA 3P84A 2WJFA 2J7DA 2J7GA 3S47A 3HQ1A 4AHOA 3T4CA 5BROA 1VS1A 3S3GA 5D33A 3N6JA 3ZR4A 1B3VA 1JCYA 1DJZA 5HQEA 3SCQA 4BZYA 1XH0A 4J3VA 3TLQA 4KERA 3LXAA 3VGHA 1JPIA 1F4AA 3EEGA 3LV6A 4XV0A 2YXGA 5MHBA 4GUGA 2I57A 3O9NA 1EOMA 3I4KA 2D2HA 3TTYA 5D2VA 1OYBA 4JTQA 2ZA1A 3EXSA 1M03A 3F4VA 4P7RA 3NURA 4REQB 5AVNA 3A4XA 3MUCA 2GGHA 3SBFA 1QRQA 2JFEX 3JZEA 5D02A 1PZ3A 4J3TA 1CGWA 1EGZA 4AU0A 8TIMA 1I45A 1KR0A 4Z1YA 3HA1A 1UWSA 4F0KA 4DWSC 4K37A 3WD1A 2FPVA 1GT8A 1G7UA 2WOQA 5DCBA 2H3BA 5BOOA 1HKVA 1W2VA 2VRQA 3CZKA 4N7QA 2WQPA 4QAIA 3VDBA 4XTIA 3UF9A 3WLPA 2OLSA 3SGGA 3ABZA 2XUCA 4Q6JA 1EC9A 1GOKA 3HZ3A 4S1FA 4ASTA 2OODA 1BXCA 2OLAA 2QCDB 4O1EA 4M7TA 4N9BA 4RE4A 2Z29A 1E9YB 1R30A 3PJTA 3RMJA 4HJWA 3WJZA 6A3HA 4GMEA 3PAOA 3CIVA 3N2TA 3G3MA 4F2TA 4K3ZA 4B90A 3TKFA 1TUXA 1OG6A 5BXSA 4H04A 1NSJA 2Z4GA 4GIRA 5LSMA 1A3HA 2WCAA 3WIJA 1JUBA 3S9YA 4EX4A 1B4EA 4H8NA 2P8CA 1D3CA 1E1CA 3RLVA 3D3FA 3DFSA 4OWGA 1UP3A 4ML4A 3KOZA 3PC0A 4H6RA 5I07A 3FYOA 2X0SA 4NP7A 2NXIA 3BZJA 4JCLA 2FJKA 4DWSD 2ON3A 1W1PA 1R7AA 5E09A 4Z2GA 3HURA 3PBWA 2QMJA 4RUBA 4L1XA 2CLFA 4DUVA 4OECA 2V38A 1F73A 4E38A 1TVLA 4JICA 4ZA0A 4TR9A 5FKYA 1VD6A 4JQ1A 4ZQRA 4QISA 3GD6A 3NOEA 1CGVA 3E0VA 3VPLA 3A47A 1V0MA 5BWFA 2DFAA 1TV7A 2YW4A 3VINA 3CAQA 1XC6A 1FWGC 4DJDA 3FVDA 2PLMA 5HXMA 1I2PA 3DHFA 7CGTA 4JQ3A 3G1FA 1ELSA 3S6OA 3WJWA 3WUFA 1PCWA 1VFMA 4DWSB 1M1BA 1UA3A 3UY8A 1IV8A 4CU8A 3WNKA 5FACA 4TVUA 3GG0A 3N34A 4U31A 4CNSA 4H6EA 3NL5A 2ZX5A 4KFNA 4L1GA 4XD4A 3G0SA 2VOMA 2JALA 2X2YA 1YADA 2PTXA 4JX4A 1WZAA 3T81A 3Q37A 2GPTA 3MMDA 2HS8A 4LJ3A 3OLIA 2J88A 2REQA 1AQFA 2PDJA 1TPB1 5J8LA 3UG3A 3WD0A 1XINA 1LQ2A 1MZRA 3GB6A 4LANA 3EWWA 3GZAA 3KCJA 4LUIA 3O06A 3EDKA 2VYOA 1GG1A 4RE2A 3K5XA 3M44A 1G4EA 5M3WA 1DWGM 2VO5A 2GSJA 5EFDA 2IPWA 1TZ7A 3P2VA 6XIMA 1RALA 1PIFA 3XINA 1Q85A 3M1ZA 1RY0A 1NARA 1PAMA 3QOMA 5LA0A 1E4MM 2OT1A 4NZ3A 1DQWA 2PI6A 3SDOA 1HKWA 4WGXA 1OJXA 3EPOA 3EX2A 4CQAA 3E74A 4RPQA 1HL2A 3M7WA 1J11A 2TODA 1XH1A 4LRSA 1JAKA 2V8ZA 5D2WA 1A50A 3FGCB 3LB0A 3PAJA 2PRHA 3KP1A 2J27A 5AYZA 2Y89A 1OFDA 3W0KA 2WHJA 4N9CA 3MA8A 2DV0A 3BXWA 4GYJA 3W6YA 4JEJA 1CEOA 1JF5A 3CV6A 1OCNA 5C55A 2PC4A 5AC5A 2VTFA 3DXIA 1FDZA 2H90A 3OZPA 3QV8A 4MKSA 4PUKA 1KGWA 2DT2A 2P50A 3KFTA 3L5AA 3WD3A 1GZJA 1DJYA 3WDHA 4S3GA 3KCOA 2EJAA 5E0FA 3VKBA 4UQEA 3SUUA 5EL1A 3V36A 2CU0A 2OQHA 5EKYA 1XRFA 4HHMA 3N25A 1HKJA 1ITXA 6TAAA 1YNYA 3LCFA 4QAWA 3VCCA 4QHRA 1DQUA 4PL2A 3O8AA 3VNMA 2A2IA 1UD2A 2ZZ5A 2D0GA 4J4KA 3C61A 1TVPA 4KF1A 3GU9A 1R9YA 1UZHA 2NXHA 4NZJA 4H3DA 4R3UA 1GYLA 2D0HA 4F2BA 1K6WA 2Q8LA 4ATLA 1PV8A 3NM1A 3OB8A 2XIIA 3WJYA 3POCA 1PEZA 2WSYA 3MWCA 1V0KA 1HKIA 3UQNA 4LYKA 3CPGA 2GSHA 4PUWA 1P6BA 4XKYB 3LQLA 1D3HA 1JCMP 2BVTA 1DJIA 5FF0A 1YXDA 1XIEA 1DIKA 2YBTA 2NVAA 5BU9A 5A94A 1AZ1A 3R12A 3UG4A 1K7FA 4AZCB 2HZGA 3CHVA 4ZSTA 3VOIA 3W02A 4CN1A 1XRSA 9RUBA 3EOOA 4XZMX 1OX5A 3GFXA 3HQOA 1FXPA 1BFNA 4X2RA 4JY9A 2YXOA 4DJFA 2D2GA 5L9FA 2WVVA 3CUHA 3ZJ6A 2XWEA 5KMYA 4DVOA 4PRWA 2PGRA 3V18A 3VMNA 3QC3A 1WUFA 3QLLA 1KM0A 4UMAA 3W82A 4R5EA 3H23A 1V6UA 3C2RA 1MQRA 2Y8UA 3TJLA 3OLEA 4UTFA 2CLPA 2F61A 1DXEA 3MHGA 4HN8A 1WDDA 2EG8A 3QV6A 1IT8A 3WQVA 2YL8A 3G8RA 1ISYA 1W1A1 3D0CA 1PZ2A 1F76A 1RCQA 3GNNA 4H8HA 5LGXA 4YL2A 4R7WA 1H62A 4ZQMA 3DYMA 3A13A 2ZIDA 2PDKA 4Q4PA 2HE8A 4EVZA 1NY1A 3OA3A 3W87A 4PH6A 1NELA 1EZWA 1VRXA 3OBAA 1JYNA 2RKXA 3BSMA 1KBLA 3VE7A 3CAVA 4HPJA 1LOLA 3UFYA 3M47A 4JHZA 3TSBA 3NYZA 1UD3A 1WKDA 1KGUA 3UGRA 1O66A 1W5QA 2EPHA 4HPGA 3IIZA 4RDVA 3EKZA 1BVWA 2PAJA 4QNEA 3GVVA 4HMEA 4O16A 3BCFA 1CX9A 1JGMA 3P8JA 4FPSA 3NXLA 1W56A 4E2VA 4EACA 1YPXA 5FD0A 1EBGA 3W27A 2JGYA 1MDRA 3K8MA 2ZRUA 2EKGA 5PTDA 2Y8VA 1F05A 3DYPA 4TMBA 4DWDA 4IZGA 1JPKA 3THDA 1E6RA 1LBLA 2ACRA 3MO7A 1E71M 2POZA 1TE6A 1ZZMA 4Q4SA 2AGKA 1VCFA 5DT7A 2QPUA 5LIWX 4KCTA 3QOKA 4KRTA 2WVSA 3GIQA 1I8JA 2QS8A 1Y5WA 1PIIA 2NVCA 1OD8A 5ECUA 2W62A 4MUPA 3IUHA 2VX4A 4G8TA 1RVKA 1ICSA 1E9IA 1OM0A 4DO4A 3P6LA 3IVUA 3NDYA 3ZM8A 2WNNA 5H8PA 8CGTA 1YTKA 3QKZA 4FSAA 3MV11 2OFJA 3WMCA 1OFOA 1IT0A 3VA8A 4GXPA 1H2JA 2GGEA 3O7UA 3SJNA 4UTWC 2BXYA 4H2HA 1P1MA 3NPUA 2VQTA 4B5VA 3W7KA 1WPCA 1J5SA 3FIGA 4L6HA 3R2GA 3UD6A 1J2WA 3W2JA 1MWOA 3H4GA 1UBSA 3DC8A 3EXTA 4BQ5A 5C5YA 3N17A 4GY7A 1EA9C 4KPLA 5A95A 1XUUA 3WLMA 1IXOA 4AIOA 3BMVA 4YN5A 2XIJA 3OVRA 3SY8A 3EMQA 1W5PA 3GVQA 1BQCA 2HQAA 2W92A 3T55A 3VGDA 3ITVA 2ZOXA 1QHZA 1XIIA 4NAFB 1KB3A 5M2FX 1PHQA 4J3WA 4M24A 1US3A 1LLWA 4LRTA 2V5BA 1I2RA 4PSPA 3QHMA 1ZY9A 3R79A 4RXFA 4UNIA 2DUXA 3ENLA 2PSNA 2TSYA 3R1ZA 2ZRYA 1ZAJA 2BP1A 3S8HA 3EX6A 4P7NA 1EB3A 4L65A 2I5GA