4AD4A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-isofagomine and alpha-1,2- mannobiose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
349
Chain Sequence
b'NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
total genus 130
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad4A00
1B0IA 2VR5A 3WMBA 1FFQA 8CGTA 1D2KA 1C7SA 1GPFA 1K9DA 2O92A 3LPGA 3IK2A 2WMIA 2YLLA 4D6DA 2ZUTA 5I24A 3II1A 2UWFA 5HDRA 2ZUUA 4UFLA 4ACYA 3CZEA 1XC6A 3RPMA 4HA4A 1JZ8A 1F4AA 3WDHA 3GNRA 5CZKA 5CSUA 1XRVA 5A95A 2XVLA 1D3CA 1OM0A 2G3JA 1W1VA 5DEZA 1GCYA 5ABGA 3M07A 4D6CA 4KH2A 4IM4A 1E4NA 3IANA 5JBDA 1MYRA 4QLJA 3WNOA 2CBIA 2V5CA 5CJ5A 1WAWA 1AQ0A 1EGZA 3CPUA 3TOPA 2X2YA 1V6VA 4J3XA 1J0JA 2W62A 3BC9A 3WF2A 4NRRA 4QAWA 1XD0A 1KWKA 2B31A 3WMCA 3DC0A 3WBAA 3OLEA 2XPKA 3UG4A 2J79A 3BMVA 3CZGA 5CQ1A 4UFJA 1L0PA 1WKYA 3PZVA 1CXHA 1H0GA 4M81A 1CXIA 1FA2A 3AJ7A 1OIFA 1E9LA 1XCWA 5I79A 3VIHA 5BXPA 1UR2A 4OBSA 3N17A 3PZTA 2VNCA 2J7GA 3VPLA 1UH4A 3ALGA 3ARXA 3PZIA 2GJXB 4HMCA 4PCSA 4N42A 5IXEA 3WNMA 2Q8XA 3WD1A 3VD3A 3AFBA 3ZM8A 2CETA 3SCOA 4JL1A 4TX6A 2PWFA 4XX6A 4GXPA 1GQJA 4JFVA 3WDIA 4KRTA 1QPKA 4UQDA 4J27A 2FHCA 4AYSA 1ISXA 3UESA 2J62A 3A4WA 3ZT7A 3VKKA 2VQUA 1MWOA 3DYPA 5GNXA 5D8WA 3ALFA 2E40A 4NI3A 3IJ9A 1ZJBA 3WDQA 1EOKA 4AZ7A 3CHFA 2Y2WA 2WSKA 5FCZA 2WLZA 3WQ6A 2WMKA 3SURA 1L8NA 2ZXQA 4QLKA 2ZUSA 3SCSA 1CLVA 4KRUA 2DSWA 2GDVA 4W88A 4OIFA 5EMYA 4B9YA 5D9PA 5E70A 2V3EA 4HU8A 3CMGA 5AYBA 2WWDA 2WVTA 3VOCA 2YL9A 1HKKA 1G94A 2G4FA 2EEXA 2VO5A 3WUFA 2D0FA 2G8ZA 3PHAA 3PN8A 5ABFA 4GO8A 2WMJA 2OWCA 4BA0A 2JIWA 3OB8A 4S3JA 2ZX7A 1UR0A 3AMLA 1GOKA 2PI6A 4WKFA 4AEFA 3PTQA 1E4LA 3IJ7A 3PZMA 1KB3A 2W63A 1B30A 5CSYA 3GM8A 3MKKA 3POHA 2DPEA 3PZQA 2FHBA 3HU7A 2V3DA 4UFIA 4QDMA 5I0DA 1ZU8A 3WY1A 1KGUA 2EPLX 4UQAA 5BRQA 3FAXA 1UUQA 3ZJ7A 1TZ7A 2GDUA 3WD2A 1WNOA 1RP8A 2XGBA 3L4UA 1DWIM 1W9BM 3U7VA 2X1IA 1UWUA 1NM9A 1QBAA 1VENA 3IJ8A 3W6LA 1NP0A 4GIAA 1GW1A 1SR0A 4D71A 5BXTA 1SFSA 5D9NA 4H8VA 2PB1A 1CGUA 1RPKA 3UR8A 4MNMA 2C8NA 2YBUA 1NH6A 4ACZA 1BLIA 2VUYA 6A3HA 2W66A 4J3UA 5DF0A 3EMZA 4LGXA 2WMIB 4TOQA 3KEHA 1FP8A 3MMWA 3TONA 3OGSA 1VBRA 1WPCA 2PWEA 4P8WA 1TFVA 5FIPA 2CITA 2VRJA 2VOTA 4DM1A 4W84A 2VC9A 4CN1A 4Z2HA 3GBDA 1OWQA 1B2YA 1DEDA 4BQ3A 4A3YA 1JDCA 5AC5A 1ISZA 1KR1A 1GHSA 4MJ4A 1V6UA 3ARUA 1FP9A 3VM7A 5BXRA 1LG2A 2WBKA 3EDDA 3EDEA 4MTVA 4CD4A 1XH2A 2CESA 4ZENA 1E3XA 3E1F1 3GXFA 3GXMA 2J74A 2JEPA 5F7UA 5C8BB 1GQKA 3THDA 3FW6A 2CHNA 3K4DA 2WAGA 1H41A 1W1TA 3GXIA 4CU8A 4NRSA 4WF7A 2ZX5A 2IXUA 3ZJ8A 4ATWA 4HZ8A 1HJXA 2ZX6A 1GOMA 4FLRA 2XFRA 3RILA 1HX0A 3ZT6A 2WSPA 3DYOA 1V3LA 3VD5A 1PJ9A 3N15A 4AD3A 1JYXA 3BAIA 2XM1A 3OG2A 1B3VA 1WP6A 3L4ZA 4GI8A 1FH8A 4HMEA 3GZAA 2ZE0A 1BHGA 2V38A 4W5UA 5A3HA 1ZS2A 4BCEA 1RH9A 1UD8A 1H2JA 2QMJA 3AIVA 3ARSA 4H41A 4WK9A 4PN2A 5A1AA 2BVDA 1CZ1A 2D3LA 1QI5A 1XYFA 2GVYA 2OLHA 4TTUA 3ARTA 2E8YA 1N82A 3LPPA 1W9PA 4B16A 1XGZA 1X1NA 1VFMA 1OD0A 4J28A 4PTMA 4D6EA 2C0HA 4HOWA 3RMEA 1FH7A 3T0DA 1ITXA 3VIJA 3RCNA 1BYCA 2CPUA 1HXJA 2XUCA 4DUXA 3CZJA 2FGZA 3NUKA 2J47A 3W82A 3FAWA 1WB0A 1J10A 5CPSA 1GUVA 3UCQA 2DT2A 1I1WA 2DT0A 2FDMA 1WZLA 1J12A 3WDRA 1CGVA 4HOZA 4UOQA 5A69A 4JHZA 2EQDA 2OWXA 3UEQA 3UG5A 5ABFB 1QNSA 1EQCA 1VJZA 3MMDA 4P7QA 5D4YA 4UFMA 3EMCA 4A4AA 4UQEA 4D6FA 3ZSTA 1WO2A 3AS3A 2YKKA 1LWHA 1UWTA 3AIRA 1B1YA 4UZSA 5A8NA 4IPLA 2E9MA 1TE1A 6TAAA 3THCA 3RM9A 2WK2A 1X6NA 4WLCA 1QNOA 4PSRA 4YHGA 4EK7A 4AC1X 1PX4A 1W9UA 3OA5A 2BHUA 3CH9A 4C7DA 4X9YA 1HT6A 4DWSD 2WMHA 5A6MA 5AC4A 2BS9A 3DECA 1QI4A 1M03A 3WFLA 2W61A 3MV01 2GJXA 1E43A 1W3HA 3KWXA 4AD1A 3BAYA 4ACZB 3KE0A 1UH2A 1E6XM 1C8YA 1OGGA 1UG6A 3AHVA 1KWGA 4UQCA 1ISVA 1J0KA 1JAKA 4FMVA 4LXFA 1CXEA 3WSUA 3SCUA 3WEOA 5A6JA 2YIHA 3VIPA 3VIFA 1ZL1A 4PMVA 4XUYA 1GORA 4FLOA 2A3HA 1M04A 2ZIDA 3EDJA 2VRKA 1E4MM 1E0VA 5LYRA 4D6JA 3NSNA 3HMCA 2Y8KA 3IAQA 3WF4A 2Y8VA 2FH8A 3A3HA 4AZBA 1QNQA 1E55A 3CLWA 4ZEPA 2OSYA 2X05A 3CHDA 4D1IA 4M24A 3ZSSA 2WCAA 5FL0A 3AHZA 3WH5A 4X0VA 4NF7A 3TTSA 3JUGA 3ZO9A 1W2PA 1V02A 2WANA 3AS0A 3MV11 4ATLA 4N0RA 4MB4A 4ZE4A 4FF5A 4MB1A 2JF7A 4AEEA 3GNOA 3WQ8A 2Y4SA 3VDHA 2WHKA 3VDCA 1W3KA 3QOKA 1UWSA 2RGMA 4C7GA 4Q7NA 3PZUA 4GZEA 4HA3A 2VL4A 3N12A 1PIGA 7CGTA 1GQIA 3B8SA 3GNPA 5A2BA 3NDYA 1FOBA 2V3GA 2J8GA 1DTUA 2VCAA 2XIIA 3FN9A 5A2AA 1NP2A 3VIOA 3WEZA 1OD8A 1SMAA 1VB9A 5AYIA 3SCQA 1WZKA 4H8HA 2O9OA 1R87A 2O9PA 3WMSA 2DH3A 4B15A 2WZIA 1ODZA 2QLYA 4MB5A 2Z1SA 2ZOXA 4GI9A 5CPQA 5CPTA 2ZXDA 2A3CA 3AYRA 1H09A 1HJWA 4U31A 3UG3A 5EB8A 3EMQA 2VTFA 3UR7A 1EDGA 1HKJA 3I3DA 4OOZA 4ATDA 1ZBVA 1H11A 4PMNA 3QHOA 1LF1A 1QW8A 1UQZA 4AD4A 1BFNA 3AHYA 1GVIA 3W25A 4J3TA 1B3WA 1X6LA 1JZ6A 4WSJA 3RM8A 1EA9C 2D2OA 1EH9A 1E1EA 1UWRA 4DM2A 5IHSA 2AMGA 7TAAA 1XV8A 5BROA 1NARA 3L4WA 3QOMA 4P8UA 3AMCA 1KXQA 1QVBA 1Q6FA 3PTKA 4H2CA 4GINA 2CCRA 5CLTA 3TTYA 1C7TA 1H1NA 4M56A 2E0PA 2OSWA 4RE3A 4AIEA 3DHUA 1BAGA 4LYQA 1XSJA 3ZT5A 1E1FA 4V27A 1QBBA 5JBEA 1H5VA 2RGLA 3CHCA 1V02E 3NIYA 1EDTA 1FFRA 4P7LA 1HP5A 3K8KA 5M17A 4HA1A 5CGTA 2GJRA 1HJSA 4OBRA 2ZWYA 3BSHA 4PMYA 2VURA 5GNYA 5E9AA 5BRPA 1D7FA 3VNZA 4ZFMA 3T08A 4ZE5A 3VX1A 4HPHA 3A47A 3K8LA 3AICA 2BVTA 1V3KA 3NSXA 4UOJA 4UQ9A 1C8XA 1HIZA 2Z1KA 2X0YA 4OUEA 3F4VA 4CVWA 3AROA 4PMDA 2D20A 3AHXA 3L4XA 4D6HA 5BWFA 4PTWA 1E0WA 2WCSA 2UY3A 3VTRA 2XVPA 1E6PA 4P7RA 3N13A 1JYNA 2XWDA 5DMYA 1LQ0A 3VGFA 2A3AA 4MNKA 5FD0A 2OYLA 1OGSA 3VD9A 2ZUVA 2CNCA 5A2CA 1XD1A 1DWAM 1ITCA 2YBTA 1F4HA 1LL4A 4H8UA 5GNZA 5I23A 2JALA 2NW0A 1B9ZA 4PYSA 1JNEA 1W91A 3PZNA 5E0FA 3A6OA 4D72A 4E8DA 1BQCA 3MANA 4PUEA 3BSGA 1QHPA 1JDDA 5LA1A 4D1JA 1V08A 1IT0A 3WF1A 3ZR5A 2VCCA 3K4AA 2J7BA 4XB3A 4Z2LA 4AIOA 1H0IA 4E4PA 1QI2A 1JG9A 3SUWA 1JZ7A 1IZKA 3WQWA 4BQ5A 2BHYA 1R85A 2AAAA 3T0BA 3WUGA 4LX4A 1QW9A 3QR3A 5HPOA 4W87A 1E5NA 4LQ1A 2BVYA 2JE8A 1PIFA 2CHOA 1J0YA 1CECA 1KXVA 1GOIA 2WNWA 4AD0A 1BGAA 4B3KA 3N04A 5C70A 3VGGA 3MUY1 2CKRA 1UKTA 1V0KA 2DSZA 1UZ1A 1KXTA 5JIPA 2VX6A 2QPUA 2OYMA 3OGRA 1CWYA 1TCMA 3B9DA 5I77A 4HPGA 1E0XA 2NSXA 4MNLA 5HPCA 2WKGA 1VFOA 1ZJAA 3AS1A 3W0KA 1HN1A 1UZ4A 4JKMA 3T2OA 4LYRA 1OIMA 1C93A 4Y7EA 3SCRA 1FH9A 1GONA 3S2CA 1V03A 3VIIA 3CUFA 5E0CA 2PBOA 3CGTA 4JAWA 3T2PA 5TD4A 5AY7A 1CNVA 1LJYA 1E73M 1BF2A 3GH7A 2XJ7A 1OT2A 1CGWA 4JKLA 1B3XA 3PZ9A 2TAAA 2EPMX 2X8RA 3NDZA 3BAKA 4L4PA 3L2LA 4F79A 4HMDA 2QMKA 9CGTA 1UKQA 4ZXOA 1K9TA 4CN6A 2Y24A 2YL6A 1HL8A 2XVGA 4YPJA 2VR4A 4F66A 1R7OA 4TUFA 4Z2KA 2J78A 1UYQA 2DT1A 2WXDM 4P7NA 2UY4A 3BLPX 4AMCA 1CGXA 3WBEA 4CU7A 3AZTA 1B90A 1NWRA 3WD4A 1J18A 1G1YA 4URIA 3BGAA 1EHNA 4CD8A 1HNYA 3BLKA 4W8LA 1I1XA 4MDOA 1G5AA 1JYWA 3GBEA 3EDKA 2VX7A 4PMRA 1QNPA 4HOXA 5ABEA 3POCA 2ZXBA 3CTTA 2ZWZA 5IFPA 4TX8A 2F2HA 1R7AA 1Q6GA 4PMUA 1G9HA 2ZUNA 3HN3A 4BZYA 3M7SA 1R8LA 4AISA 1ZB5A 1B31A 4UZUA 1MXGA 4NSBA 4YN5A 3ARVA 2VMFA 4V28A 3L4VA 3SUVA 3SCPA 5EBAA 2WMFA 3APGA 1VEPA 3M46A 2VVSA 2NT1A 1K9FA 4PCTA 3TA9A 1M01A 3NYDA 3N1AA 4CD5A 5C71A 1XSIA 4JKKA 3VDAA 3G6MA 3WD0A 5IHRA 1JF5A 1GZJA 1XSKA 4MAZA 3T09A 3ZOAA 3CZLA 1Q6CA 3VGHA 1AMYA 1TVPA 2E9LA 3PBGA 4MAVA 1VEMA 2VZOA 4Z2GA 4XZWA 1AQMA 5BXSA 1G01A 3L4TA 2OWWA 2JFEX 1O7AA 4M1RA 1MQPA 2WCGA 2BHZA 4B9ZA 1KCKA 4GZIA 1UR8A 1MW2A 1G0CA 3KL0A 4MJ2A 2BY1A 4UNIA 3ARPA 3VNYA 3SCTA 3ARZA 3GYCA 2YA0A 3K1DA 4W86A 1BVNP 3SCNA 3FXYA 2WC3A 3CUIA 4TVUA 1BYBA 4TTGA 5D8ZA 1E71M 5GQBA 2X0HA 3ECQA 2GFTA 1CBGA 4B3LA 2DQXA 3PTMA 8A3HA 5I2UA 1ZBCA 3EBVA 1K6AA 4AZGA 3OZOA 1V0LA 3MUIA 4U3CA 1UWIA 2EPOA 3AXHA 4TVCA 3O2LA 1AVAA 1ZBKA 3AIQA 3FY1A 4P8XA 1C8QA 5JIWA 3WH8A 3SUSA 1CGYA 4D6GA 1ISYA 1LL6A 5A94A 1OBAA 2AOSA 4DUVA 3L2MA 3MUZ1 3N9KA 3UETA 4L4OA 1GOWA 1W2VA 1RD6A 1W9DM 2X09A 2XYLA 5CG0A 4BQ4A 1E6ZA 3AMGA 4J3VA 2DSKA 4U3AA 1MVYA 1CEOA 5LA2A 3RM4A 4OKDA 4JFTA 1EO5A 1FHDA 4HTYA 3RJXA 3VD4A 1KGWA 1V3MA 2WMGA 2D3NA 3W28A 3VD7A 2QV4A 1EOMA 3W29A 3CO4A 2F61A 2YJQA 3TP4A 1WZMA 4KGLA 1JZ3A 3UERA 2BXYA 5A6BA 1V3IA 1E72M 1GVYA 2BV9A 3GXDA 4MDPA 3OBAA 4WKHA 4DUWA 2WHLA 1W3LA 3F5JA 1KQZA 4D6IA 1V3JA 5A6LA 2ZX9A 4F9DA 4EKJA 1DHKA 4HP5A 4JFSA 1KQYA 5A6KA 2WVUA 2VCBA 2ZUMA 1OINA 3WNKA 1OT1A 2EPKX 1BVZA 3O9NA 1XH1A 1YQ2A 4IUGA 4GQQA 1CENA 2BFGA 1AQHA 1VFFA 5M03A 1DWJM 2UY2A 4HZ6A 1BYAA 2E3ZA 3SCWA 3WNNA 1WCGA 3WF3A 3QGVA 2XIBA 1BTCA 2XFYA 4WKAA 2FH6A 3CUJA 6CGTA 1V6WA 1KXHA 2G3IA 1MFUA 1US2A 3NJ3A 2WKLA 1HVQA 1EXPA 3MO4A 2WB5A 1J0ZA 5M3WA 3AS2A 2PWDA 4DWSC 3NCOA 4QP0A 3KL3A 1JI1A 3VIKA 5I6SA 1JD7A 2VVNA 4MADA 4OZOA 3VMOA 2CEQA 3W38A 1S46A 1V3HA 4GO9A 1GHRA 4OJYA 2WW5A 4W89A 3ZIZA 1E3ZA 1E6QM 4PSPA 1NWSA 3QHMA 2O9RA 3FNDA 1UKSA 3WNLA 5M5DA 3A4XA 2E9BA 4UCFA 2VRQA 2WVSA 1VF8A 3AZSA 2W67A 1IV8A 1EQPA 1KBKA 4LYPA 3VIGA 1A47A 1OSEA 1E5JA 3OGVA 4IPNB 2D0GA 2VZSA 4M8UA 2EBNA 4QCFA 5A8OA 4BS0A 1V6YA 3WNPA 4CN4A 3U5YA 2VQTA 3KZSA 2PC8A 3BXWA 2JEQA 4CU6A 1JL8A 2YDQA 1TVNA 1UD6A 4W7UA 1QOXA 2D0HA 2QPSA 3ZR6A 4GZJA 1QHZA 4AZCA 4JIEA 4S3KA 2XWEA 3J7HA 1E6RA 2GK1B 3VUPA 4EANA 1E4IA 1KBBA 3MUAA 5IDIA 1CIUA 2J7HA 1UKOA 3WF0A 1GJUA 1BPLB 2YA1A 3VGEA 1Z32X 1LLOA 1KR0A 4AW7A 4J3WA 4JCMA 1PPIA 1BGGA 1MW3A 2XSBA 3ARWA 1E6NA 2EXOA 1VAHA 3ZJ6A 3SEPA 4U5IA 2YOCA 4AY1A 3BAXA 4MB3A 1J0IA 4HZ7A 2Y5EA 3LMYA 3AMDA 1PZ3A 2CKSA 5ABHA 3SIMA 1PZ2A 1UR1A 1UHVA 3WDPP 1WDRA 4E2OA 4CGTA 5IFTA 4W8AA 3BAWA 1W1PA 4F9JA 4GPNA 2XHYA 1LWJA 2WZHA 2DDXA 1C90A 1ZBWA 2GUYA 1V0NA 3OLDA 2VX5A 1UA7A 2VT0A 3N18A 4OOUA 1NOFA 4YHEA 4GI6A 5GPRA 2G3MA 1XHGA 2JIEA 4UTFA 1UR4A 2XGIA 5EFFA 5E6ZA 1GQLA 1C91A 3LPFA 4UOZA 1U30A 4JHOA 1QHOA 1W32A 3OIHA 1WDPA 3D3AA 5BCAA 1MQQA 3VU2A 3ARQA 3RIKA 2D22A 4ML4A 1UA3A 5DT7A 3TTOA 3CUHA 2PWGA 1XH0A 2CYGA 2WPGA 4JFWA 1UQYA 1TA3B 3VMPA 4CCEA 3I3BA 4X0NA 1MFVA 4JCLA 2QHAA 3VVGA 4PMQA 2CIPA 3ARRA 1MW1A 4TVDA 1MQRA 3CBWA 2YDSA 1HJVA 3AHTA 3AI0A 3OLIA 1PAMA 4RL3A 2VZVA 1JGIA 2DH2A 1NWTA 2J7DA 1C92A 5E6YA 1JAEA 1I75A 2PWHA 1PX8A 3B9AA 4W7WA 3CHEA 3AMKA 4H04A 2BNJA 4PTXA 2A3BA 4QCEA 1JXJA 1CXLA 1BSIA 1TMQA 2GSJA 4TXEA 5DT5A 1ESWA 1TR1A 2FHFA 2W5FA 3NSMA 4W93A 2A3EA 3FHQA 3BMWA 2J7CA 4QFUA 1PEZA 3BCDA 5HBFA 3ZJKA 1GNXA 3OZPA 2DGAA 1EIBA 3AXXA 4J7RA 2VJXA 4P8VA 1B3ZA 2WWCA 1J9YA 1M53A 4KMQA 3BH4A 4V2XA 4E8CA 5EFDA 3VMNA 1JD9A 1NQ6A 2W4XA 1P6WA 2G3NA 4W7VA 3AIEA 1KCLA 1GJWA 4UFKA 4UQBA 5A8QA 1FHLA 3VILA 2WBGA 4FK9A 2GJPA 1U33A 3AISA 1CLXA 4U2ZA 4PTVA 3K8MA 5JUVA 4ZXLA 3F5LA 1PBGA 3SUTA 1QI0A 4AZCB 4K68A 3WL0A 4HU0A 3VINA 3HJEA 4DWSB 4PMXA 1HKIA 5CGMA 3WD3A 4UFHA 2DIEA 2WVVA 4CCCA 3WIJA 1R86A 1Q6EA 2ESCA 1V6XA 1NOWA 4W85A 4MNJA 4NZCA 2EO7A 5DO8A 1UKPA 4AZ5A 4PEEA 4W8BA 4JFUA 4KGJA 1US3A 3CIVA 1CXKA 3AIWA 1H49A 1CDGA 1KFWA 1YHTA 2DSVA 2YLAA 4PRWA 2CBJA 2QF8A 4CCDA 5A6SA 4FLSA 2DT3A 1NWUA 4AZIA 1VFUA 2DIJA 2WHMA 3AYSA 3AXIA 1E70M 1DP0A 3VDBA 3MSDA 3CMJA 3F5KA 1DWGM 1QI3A 4AWEA 1HL9A 4F8XA 2BY2A 1JZ4A 3WEMA 5KZ6A 2ZICA 2CBVA 2E4TA 1OGBA 1XYZA 4WJXA 2CERA 4Z2JA 4XV0A 3U5UA 5DFAA 5I5RA 2EJ1A 1DWHM 2W92A 3WH7A 3I3EA 3AQUA 1CGTA 1J01A 4M29A 2ZXAA 3W27A 3QHNA 2OYKA 3RO8A 4RE4A 2YL8A 1RP9A 4KWUA 1GOOA 1ODUA 2E8ZA 4H7VA 1PX3A 3ZMRA 2DSUA 3WH6A 5A6BD 1U2YA 1WDSA 1GOQA 3AOFA 1WDQA 2J8FA 1EDQA 4BQ2A 3CUGA 2PF0A 3KL5A 3DHPA 2VI0A 2VZUA 2EPNA 3MU7A 3WQVA 1KGXA 5E09A 1EHAA 4P7OA 1J11A 1JFXA 5FKYA 1JFHA 1WZAA 2WYSA 3L4YA 3WFZA 3LPOA 3WQ5A 3FHAA 3O6AA 3ZQ9A 3RJYA 4CKQA 5D9MA 2V3FA 4M82A 4U2YA 2GK1A 3U57A 3WUEA 5FL1A 1OB0A 2G41A 1J0HA 3W4RA 4Q22A 4C7FA 3VO0A 3W37A 3W24A 1A3HA 4MPKA 3GH5A 1EO7A 4XZBA 1JIBA 3AIBA 3WL1A 2BY3A 2DEPA 2D24A 3OLGA 4AZHA 4WSKA 2C7FA 2PBGA 1LL7A 1CTNA 1BG4A 2WHJA 3VX0A 1HF6A 3EDFA 2XVKA 1VJSA 3W26A 1E40A 2OSXA 3BAJA 4WIWA 3WUBA 3D5HA 4JZ5A 1VBUA 5HNNA 3N11A 3U7BA 1CPUA 1QNRA 5A8MA 3AIUA 1Y7VA 4GKLA 3EYPA 1JZ2A 2MANA 3W81A 1W1YA 1MXDA 3B9EA 1W9VA 4R27A 3K46A 4IISA 5CXPA 4CD6A 1MW0A 1VIWA 4BF7A 2HISA 3VGDA 5I78A 4PUDA 2D23A 3WDJA 3VIMA 2J7FA 4J3SA 1HJQA 3WN6A 2JF6A 4GQRA 1WE5A 4EAMA 4UR9A 1ECEA 4A3HA 1K9EA 1UH3A 5HXMA 4U33A 3WKZA 2IXVA 2ZUWA 1UD5A 5A8PA 4EE9A 1B3YA 1ISWA 1UD2A 2WM0A 4RE2A 1UR9A 4AIUA 2YL5A 1JXKA 3WH9A 3VM5A 4AXNA 2CBUA 1CXFA 1JZ5A 3AZRA 2J4GA 2F8QA 2WVVB 4AZ6A 5JBFA 4LPCA 1E15A 3W53A 1JNDA 1Q4NX 1TA3A 5KEZA 4R5EA 4FLQA 3PZGA 1W3JA 3WELA 2IUZA 1SYTA 1UD4A 1VRXA 2XFFA 5CLWA 1M7XA 4PBGA 1UD3A 4QLLA 1H3GA 5I3DA 5D9OA 2VZTA 1JI2A 3M6DA 2WC7A 3GDBA 5BYWA 3MS8A 2XM2A 3ARYA 3CZKA 2HVMA 2J77A 7A3HA 2XTKA 1BG9A 2O9TA 3MMUA 2XVNA 3GH4A 3BCFA 1HP4A 5ECUA 2V5DA 3VGBA 4CUCA 3GTNA 2BY0A 2YDRA 3PZOA 4AD5A 2W91A 2VX4A 1BYDA 1E56A 1C3FA 1JF6A 1E6SM 1JYVA 1TUXA 2J75A 1SMDA 1H4PA 3DYMA 3CZ8A 4W5ZA 3IAPA 1IZJA 5LA0A 3T2QA 4M80A 2J7EA 2J25A 4U5KA 1W9XA 5FOOA 4PMOA 3MSGA 3S6TA 1OCQA 3SCVA 1O6IA 1XCXA 1HKMA 1VEOA 2XG9A 1Q6DA 3W6MA 1HJUA 2WC4A 4CVUA 2CXGA 4Z2IA 1NOUA 1DWFM 4DWSA 3G6LA 5HOSA 2FGLA 2YA2A 3WQ4A 4JL2A 5A6AA 1JDAA 1CYGA 3T0AA 3WENA 1HVXA 3TTQA 2D1ZA 1V0MA 3RDKA 1UOKA 2ZX8A 3SUUA 4CD7A 2UY5A 2NT0A 1LG1A 2WLYA 2XSAA 1TG7A 2WZEA 2BXZA 3A4AA 1UWQA 4PMZA 4AD2A
chains in the Genus database with same CATH superfamily
2OZ3A 3CAQA 4XZLX 3IARA 1FFQA 1D2KA 1GPFA 3BLEA 3LPGA 1OFBA 5MKGA 2YLLA 1LOSA 1WXZA 2ZUTA 5LNWA 1W3IA 1BWVA 4IQDA 3GU9A 4XSLA 1JCXA 1XC6A 4Q3MA 3RPMA 4O12A 3HQOA 3QJAA 1H60A 3ITYA 4HA4A 3EA1A 3GNRA 5CSUA 3FYOA 2A1YA 4HMNA 2B7PA 2XVLA 1D3CA 1OM0A 4Y8EA 1A5OC 4GI4A 1GCYA 3E2SA 3M07A 2RDWA 4KH2A 1UCWA 1NIUA 1E4NA 3IANA 2EJAA 5LGZA 4WUIA 3UXDA 4K36A 4WZHA 3THUA 1EGZA 3P6LA 5HINA 1V6VA 3EWWA 2W62A 2CLOA 3UNDA 3NM3A 3WF2A 1B5TA 1ALDA 1K8YA 2OOGA 4QAWA 1XD0A 1OCBA 1PS9A 2KX9A 3A13A 1EP2A 1N8FA 4LY8A 2XPKA 4Q7IA 3BMVA 1F07A 3CZGA 4GACA 1H0GA 4NKCA 4A8RA 1Y5WA 1PV8A 1E9LA 5BXPA 2UZ9A 3SO7A 3N17A 2VNCA 5HQEA 2CLFA 4HMCA 2ALRA 1GKRA 4N42A 3Q58A 3WD1A 3ABXA 5D2WA 3AFBA 3VD3A 3VYLA 3ZM8A 1LOLA 2QF7A 2PS2A 4GXPA 5C2CA 1EJXC 2ISVA 4F40A 2QJGA 4AX7A 1WOBA 1ISXA 2X30A 4XZHA 4M6UA 2J62A 2PCEA 4REQA 2VQUA 1R46A 1XPYA 2XH0A 1OFQA 4UMBA 4V1YA 1ZJBA 1XLEA 3DU0A 1TV7A 4DYJA 4PB5A 3CHFA 3PB0A 3H2OA 2Y2WA 1KO0A 2YW4A 2QEZA 1XIIA 3W1PA 4GYKA 3DDMA 5D30A 4C6FA 3W1TA 3QV8A 2INFA 2PE4A 4GA8A 2DSWA 1OABA 3WJYA 3FK4A 4RR4A 1V7AA 3U8GA 3MMTA 3PAOA 1G94A 2EEXA 2V69A 4ZQRA 3TK7A 4QITA 4GO8A 1F5ZA 3EXSA 2OWCA 2ACQA 4LEFA 3EOSA 3R7MA 1ICSA 3AMLA 1NDVA 1EC7A 2YCJA 3L66A 4XTDA 3IJ7A 2WZTA 3P0XA 4ADUA 5CSYA 1XLKA 3O0KA 5K7JA 3HU7A 1WOAA 3OZYA 1FWJC 1SFTA 2EPLX 3KOXA 4UQAA 5BRQA 1UUQA 3UXIA 1XLMA 5AC6A 1Q6OA 1RP8A 1YBQA 3L4UA 5K2ZA 4DJDD 3H26A 1DQUA 1NM9A 1VENA 3H2MA 5FESA 4LBUA 3W75A 3UWZA 3F1QA 2AQVA 4GIAA 1GW1A 4XG1A 4D71A 2GYIA 3IIPA 2VFEA 1CGUA 2FZNA 2DZVA 3UR8A 2C8NA 5CJMA 2IPJA 4R9XA 2GVGA 2VFHA 1BLIA 1NDYA 2W66A 3MVIA 5DF0A 2NQ5A 4NNCA 5FAGA 3N3TA 3HMJG 3KEHA 3MMWA 2CZVA 3TONA 5D03A 4NJIA 2GSEA 5T9CE 1XLHA 1A0DA 1WPCA 1TZ9A 2VWSA 5FIPA 1XIGA 2Q02A 4DM1A 2PDFA 1OF6A 3ZWTA 1OWQA 1B2YA 1DEDA 2QW5A 1JDCA 3F4WA 3FA5A 4JN6A 3V0TA 4A3YA 2OZTA 4KFPA 3VM7A 4MTVA 1XH2A 3CQ0A 4HHLA 1J4EA 3GXFA 2GVLA 2J74A 4K1GA 4NL1A 2FFIA 4BEQA 5C8BB 1GQKA 3FW6A 1M1BA 1WDDA 4DJDC 1R3SA 2ZX5A 7TIMA 1GOMA 2XFRA 2QAPA 3GD6A 1LQ2A 3RFAA 4GVFA 4KESA 1PJ9A 1IGWA 4AD3A 2XM1A 1EP1A 1FH8A 2ZE0A 1BHGA 2V38A 3VFLA 4RW5A 2YCLB 1UD8A 4IP7A 4NNAA 2QMJA 4HNUA 3AIVA 3H70A 3QZAA 4H41A 3EA3A 3THAA 5A1AA 2E09A 1CZ1A 2DJLA 3CB8A 2OLHA 1F2JA 3MKVA 3BANA 1ICQA 2E8YA 3EX3A 1W9PA 1PCKA 1AG1O 2DVTA 1W31A 1VFMA 3LQGA 4J28A 3UR5A 4NJGA 5G2HA 3PJXA 4HU3A 4HOWA 2PA6A 1QR7A 4GGBA 2TPSA 1I6NA 1HXJA 2FGZA 3NUKA 3MQTA 3S9ZA 3FYPA 3FAWA 1GQNA 2IKIA 3UCQA 4PFHA 1KKOA 4AQLA 2JKAA 3NO5A 4JYFA 1XC4A 4KS0A 5A69A 1WBJA 2CLLA 3UG5A 1EQCA 2A85A 3R0KA 3TV8A 1P0DA 4FXSA 1QPRA 1ZJIA 1FDJA 1FKWA 1CCWB 2OO0A 1W3NA 4UFMA 2PDXA 4UQEA 4JTCA 3SSZA 3V5CA 3ZSTA 1WO2A 1EJVC 4M19A 3IIZA 1OY0A 1H61A 4JTJA 4EIVA 2WZMA 3N4EA 1X6NA 5F2GA 3HFTA 2IKJA 4EK7A 2DP3A 1JRBA 3CH9A 4X9YA 4DWSD 2WMHA 4AYGA 1FX6A 5H91A 4ILSA 1AUSL 1CX9A 3DECA 4JTLA 3KZPA 4DLFA 1QI4A 4A05A 1R47A 2W61A 4IIGA 3VCCA 1E43A 2XN0A 3BAYA 3APTA 1TPC1 4FR1A 1TV4A 1KWGA 4UQCA 1J0KA 2E6FA 2FTWA 2OJPA 4LXFA 1CXEA 5A6JA 3RLVA 3JVAA 4BK9A 4KEUA 4XKMA 1TQXA 1P0BA 1ZLPA 4FLOA 5AYYA 2ASHA 2ZIDA 1BRLA 3EDJA 4WRHA 4RUBA 5CC6A 4NAFA 1A3XA 3NSNA 3HMCA 3LS9A 2Y8KA 5EMKA 3WF4A 1A5AA 1HGYA 3LBCA 4QM1A 1BXBA 4IP4A 2Y8VA 3H6OA 3A3HA 1TQJA 5G2IA 4ZEPA 2E5BA 3PPCA 4LVDA 4I3GA 3O8AA 2YZ5A 3I7QA 5EPDA 3W1RA 1RHCA 3ITXA 3GIPA 3CV6A 2TMDA 2WCAA 4Y9PA 3AHZA 3WH5A 3S3GA 4MIMA 1X39A 2FDSA 1IIGA 5AVHA 1OFRA 4ZE4A 4HNCA 5TIMA 2OXNA 4C6NA 3QW3A 2JF7A 3E0VA 4MGGA 3VDHA 2WHKA 5DBUA 4A2RA 1UWSA 3ITVA 4G7EA 4Q8UA 3MCOA 4I5UA 4GZEA 2Y5JA 4HA3A 2CW6A 2QT3A 3N12A 3VZZA 1W54A 4LANA 7CGTA 3B8SA 3NDYA 2HV5A 1AQFA 1DTUA 3HBLA 4S23A 5CBIA 1KCXA 3LDVA 2Z6IA 4BWLA 1WZKA 2PRMA 2Z2AA 2B4GA 4QISA 4JR5A 2DH3A 3K5XA 2G95A 3V5OA 3CUZA 1ODZA 3T1GA 1VPXA 2P3ZA 4MB5A 2ON3A 2ZOXA 2YYTA 2C15A 2F38A 3UG3A 2DZWA 2QCDA 3K13A 3VC5A 5B7YA 4ATDA 4YTTA 1GOXA 1VZWA 4Q6XA 5CGQA 1LF1A 2HK1A 1FCVA 4J3TA 1B3WA 1RUSA 4WSJA 1EH9A 1E1EA 3KLKA 4O4VA 3Q67A 3QOMA 1GW9A 2CZFA 3TW9A 4K8GA 4P8UA 1L8PA 2XU2A 1XLCA 3WQGA 1OK6A 3NO3A 5DXXA 3L65A 4X9SA 1H1NA 4M56A 1DYSA 3N73A 3C0JA 2PGWA 2NXGA 1XBYA 1MDLA 2ZA3A 1XSJA 5REQA 4V27A 1QBBA 5JBEA 1TJRA 3HG5A 1QO5A 4AFYA 3DG7A 4NIRA 4FNSA 4ZO8A 4OWGA 1GVRA 2ZWYA 4UTWA 5AZ0A 4N2YA 5AC8A 2VURA 3TROA 2JQXA 4V15A 2Q3OA 1D7FA 4JTEA 2DVUA 4LRTA 3K4WA 3R4IA 4ZFMA 1W1IE 3VX1A 3T0TA 3A47A 4H6EA 3TC7A 5B80A 2A7NA 3NSXA 4MMWA 5CJNA 5LNSA 1HIZA 2Z1KA 3LGDA 2X0YA 4CVWA 3BV4A 3L4XA 3TH6A 3LOTA 1E0WA 3GNDA 2XVPA 3RN6A 3N13A 1VC4A 4N4QA 1LQ0A 3L21A 2A3AA 5FD0A 1NJJA 3VD9A 2VFIA 4FB7A 2ZUVA 2FKPA 2PFHA 4JTIA 1HZYA 4L4LA 5CPMA 4ZSUA 3U48A 3T6CA 4LS2A 1K1DA 3R6IA 4NAFB 4ZQNA 4ZGYA 1BQCA 4PUEA 3D3FA 4C90A 3H24A 3IJ6A 1VYPX 3HPAA 2VCCA 4XB3A 1H0IA 1JZ7A 3L0NA 3T0CA 3WQWA 3HTWA 1E9YB 2V82A 4LW7A 3B4YA 2BVYA 3MSRA 1PIFA 2CHOA 1J0YA 2V68A 4AD0A 1BGAA 1AH0A 2PDQA 2V5KA 2CKRA 1UZ1A 1KXTA 4FALA 4JTQA 1CLKA 1XX1A 1TCMA 1JPDX 4G7EB 5FF2A 4S3BA 3SAZA 1I2PA 2QXWA 1VBJA 4XZIA 1VFOA 3W0KA 1H1ZA 1KFBA 4NHVA 1UZ4A 1C93A 3EEZA 3SCRA 1KTCA 1GJPA 3EB4A 3VIIA 4R53A 2ATSA 3EWZA 2P0OA 2POTA 2PBOA 4G1NA 4JQ1A 3OBEA 3T2PA 5TD4A 3AAMA 3IV8A 2PDWA 2XJ7A 3GFYA 4L6OA 3HM7A 1CGWA 4JKLA 4IMFA 2TAAA 2F9RA 4MUZA 2XH7A 3TZFA 1RV8A 3NDZA 2QCDB 1WKEA 2VR2A 3GZ3A 2YL6A 4F66A 4LUIA 2RKXA 4DBDA 1R7OA 3LBMA 4TUFA 2ZQ0A 3C56A 1O95A 2ZA2A 2G97A 2J78A 1YMYA 3FEQA 4QNEA 5KITA 3NYZA 4DBEA 1VJIA 3VC6A 1CGXA 3U4FA 3AZTA 3GLCA 1NWRA 3WD4A 1J18A 4F48A 1EHNA 3W01A 3EX1A 4PMJA 4MDOA 4UTIA 3EGJA 3C2RA 3EDKA 3KBVA 8TIMA 2VX7A 3TJLA 5ABEA 3POCA 4QAIA 2ZXBA 3CTTA 5REQB 2ZWZA 3IS4A 4EPEC 1R7AA 4JX5A 1KBLA 3UCCA 3STPA 1UBPC 1Z89A 1EB3A 3M5VA 3M7SA 4Z0SA 3MPGA 1R8LA 3QBUA 4X2RA 1OG0A 1EF3A 4D8ZA 3BLFA 1ZB5A 3TJXA 4YN5A 3ARVA 3GG0A 3SUVA 3SCPA 2PP0A 3G8EA 1X8FA 4L4MA 2WMFA 1XRFA 3M46A 4FNRA 4HNVA 3MDUA 3TA9A 5C71A 3QM3A 4Q8QA 2C14A 3UT0A 3G6MA 3WD0A 5IHRA 3E2RA 3PBUA 2NWSA 4K7YA 3LLFA 4MAVA 2VZOA 4Z2GA 1G01A 1OQFA 1O7AA 1XIHA 1YPIA 2BHZA 4US5D 4B9ZA 4WJEA 4NZ4A 1G0CA 3KL0A 4UNIA 4Q7BA 1RZMA 3G1SA 2X0SA 2YA0A 3K1DA 4W86A 4B5XA 3QPZA 4QJ3B 4DJDA 5D8ZA 2Y8UA 3ECQA 3PTMA 5I2UA 1ZBCA 1XYCA 4F0RA 1K6AA 1NY1A 3CPGA 3GE7A 2OEKA 3C2EA 5MHBA 3U6WA 4TVCA 3O2LA 4RZ6A 4JTRA 1AVAA 1AK5A 2Y88A 1KV5A 3FY1A 1ONEA 1C8QA 3LHZA 2NX3A 1ADDA 1CGYA 2TSYA 1S2AA 2PDHA 1NDWA 1OCJA 5A94A 1TX2A 4RNJA 4DUVA 3L2MA 5A5WA 3MUZ1 3O05A 4IIFA 5K3VA 3H53A 3UG8A 2P50A 3IGUA 1W9DM 2P76A 3NPVA 4EAYA 1E6ZA 1XPGA 1LM1A 4LU0A 1MVYA 4JFTA 1FXPA 1PVNA 2GGJA 3RAOA 3R2GA 4XZ9A 3DOPA 3TDFA 1SZGA 1B3OA 2D3NA 2V30A 1IE7C 1EOMA 2VD9A 3W29A 3L0GA 3I7SA 3VNDA 5C9UA 5F2MA 4KGLA 1XDLA 3BLDA 4G6CA 3R5EA 3PFMA 4MDPA 4LNCA 1IHIA 4DAIA 1F76A 1DHKA 4HP5A 4JFSA 3TN4A 2CZEA 3WNKA 1UPMB 1XL9A 2EPKX 1BVZA 3CPRA 3O9NA 4GQQA 2BFGA 3HG2A 1XGDA 4RV8A 4HZ6A 2G3FA 2E3ZA 4OECA 2F7FA 3ZFHA 3WF3A 3QGVA 2FH6A 3CUJA 4NX5A 3FFSA 1A5UA 1G67A 1KXHA 2ZVIA 2PRLA 3USBA 5AHMA 2WKLA 2FFCA 2GQ9A 3AS2A 3LGGA 1UZDA 1EYEA 3L68A 4NYYA 2HSAA 1FTXA 5C2GA 1IF2A 3E2QA 4MADA 4DIAA 2CEQA 2PURA 2PU1A 1NAL1 1S46A 1V3HA 3P0WA 3JW7A 4W89A 1Q65A 1EZWA 1F61A 1E3ZA 2X7WA 1E6QM 2Z1WA 3PTDA 4B5TA 3FNDA 1UKSA 3REQA 1AW1A 4UCFA 3DGBA 3QVQA 1JDFA 3AZSA 3TTEA 4LF1A 4GMEA 2QVHA 1VBGA 5HWMA 3VIGA 1A47A 3OGVA 2PC4A 3BOFA 4BS0A 3TQKA 1UJQA 1H50A 2VQTA 4MYAA 3BXWA 2YDQA 2Y85A 2D0HA 2QPSA 3V35A 4FZIA 3UJ2A 3E6EA 3J7HA 3WQCA 3TR2A 3W23A 1UIOA 4N6FA 2CLHA 1DE6A 1TWZA 2ZZ6A 1VPQA 2PLCA 2YBVA 2VEIA 4MSSA 3MHGA 4OTKA 1PWMA 4LYKA 1KFJA 1LLOA 3GVWA 3R79A 1BKHA 1BQGA 3NOEA 4O28A 2XSBA 4HKPA 3ARWA 1JPKA 4U5IA 3WX7A 3R43A 4HZ7A 1SR9A 1PZ3A 1XDJA 3MI3A 3GYEA 1XQLA 5D09A 1HKWA 2W0UA 4FNUA 3O16A 2IMRA 5RUBA 2FIQA 3WDPP 1WDRA 5IFTA 4MZ1A 2J6VA 3DFNA 1SZRA 2DZPA 3H2NA 1TTPA 5C55A 2Z24A 4IPJA 4TV6A 2GUYA 1V0NA 4O0KA 2VT0A 3PC0A 1ZHAA 3A24A 2JIEA 3NL5A 1XINA 1KM4A 1GQLA 1C91A 1EX5A 7REQA 1OZMA 1U30A 1LT7A 2R9RA 3OIHA 1WDPA 2PDJA 3D3AA 5BCAA 5K9DA 3ARQA 3RIKA 3CWOX 1GTEA 1EEXA 3CYVA 3B03A 3H2CA 4HN8A 2PWGA 5K9XA 1FUYA 3I6EA 4CCEA 4JCLA 3VVGA 3VCNA 3CL8A 3CQKA 1Q6QA 4MLRA 5AHLA 2D2JA 4K38A 1MW1A 2GGIA 3CBWA 2YDSA 3HFYA 6XIMA 3IK4A 3WQDA 5H1WA 2A3LA 1OC6A 1JGIA 3SY8A 1NWTA 3S4TA 4R33A 2J7DA 4C1NA 1C92A 5E6YA 1JAEA 1IQ8A 3LXBA 3B9AA 3AUJA 1SFLA 3IVUA 4LUSA 3W1NA 4KRZA 4L7ZA 5DANA 4EWND 4PTXA 2NUWA 4QCEA 2Q01A 2GSJA 1ESWA 1TR1A 3DAQA 3CASA 4W93A 2A3EA 3UD6A 2J7CA 1EFZA 1W1A1 1PEZA 3BCDA 4LC8A 2BZNA 8XIMA 3AXXA 3TYZA 3RX2A 4J7RA 1UASA 3REQB 1LLWA 1L9WA 1GYMA 2HVNA 3EWCA 1M53A 4KMQA 5EFDA 3OVRA 2X2GA 3NQ8A 4CQ8A 1XI3A 3AIEA 4JTUA 4WX2A 4GK8A 4ERAA 2WBGA 4O11A 3HURA 1YXDA 1CLXA 3VA8A 4U2ZA 3BV7A 4GVGA 4PTVA 3NGJA 2HXTA 3W7KA 1PBGA 3OHMB 4FIRA 3SUTA 4K68A 3TAOA 3LCXA 4NX0A 1MNSA 1KFLA 3VINA 2GL5A 3S2LA 1MO0A 4HCHA 4GUJA 1VH7A 4DWSB 1L6SA 2GWNA 5GJNA 1PKYA 4UFHA 5FAJA 2C1IA 3G77A 5KINA 4AVFA 4MNJA 1TCDA 5DO8A 1T5AA 4W8BA 4NJJA 4JFUA 4KGJA 2PEVA 3CIVA 2VDHA 2GJNA 1CDGA 4PRWA 1A5LC 1W56A 5A6SA 3B40A 4IGMA 1NWUA 3RK8A 4M5PA 3LBOA 4AZIA 5AHNA 3F4DA 1Y8BA 1E70M 3VDBA 4QQUA 3B8TA 3PULA 3SN4A 3KCLA 3RU6A 1EC9A 5EA9A 4F8XA 4ZB5A 3BZGA 4YTSA 4IHCA 1EL3A 2OLAA 1D3HA 1ICPA 2FPYA 2ZICA 3B04A 4WJXA 1XF0A 4WY0F 2AL2B 4XV0A 1ZAHA 1Z44A 2GDQA 5I5RA 1DWHM 2W92A 3WH7A 3AQUA 3UWVA 4J40A 2A6LA 4A22A 4S2BA 5DELA 1A3WA 4KFOA 1PX3A 7REQB 1D8WA 1VS1A 3ZMRA 3I65A 1U2YA 1GOQA 3N2BA 3WMLA 3LRLA 3CUGA 3KL5A 5TF0A 4DY1A 4S3CA 2YZRA 3ZYZA 2EPNA 4K7VA 3FA4A 3W83A 1S1RA 5E09A 1EHAA 1EGMA 3BJTA 4P7OA 3S42A 4BI6A 4PL2A 5FKYA 5CAKA 3L4YA 1TVLA 3LPOA 3WQ5A 4HBKA 3O6AA 3TE9A 5D9MA 4NXSA 3S2JA 1RA0A 3WUEA 2UV8G 1MRQA 4AWTA 1WA3A 4ZQPA 4OU1A 3W4RA 3VO0A 2E5CA 5I02A 1QASA 3QPYA 3EA2A 4MPKA 4XZBA 4C1NB 4EF8A 3WL1A 3KOYA 4HB7A 2QDEA 1PDZA 3ISIX 4Q8OA 3GW0A 1M7OA 4XAPA 3G1RA 4WSKA 1AD4A 4PCFA 4ENLA 4MZYA 1J93A 1JEZA 5FEWA 2XVKA 2OSXA 4WIWA 2BDQA 1VBUA 3N11A 1N55A 4DXXA 3B3DA 1P5BA 1V79A 3P5ZA 1W5QA 2ZTJA 1R3QA 3P81A 2NX1A 6REQA 4S1FA 3EYPA 1Q4WA 1W1YA 2BODX 4MFDA 4R27A 3W07A 4DZHA 5XINA 1QO2A 4O15A 3MZNA 4OGZA 1ZTVA 3W1XA 4F0HA 4K39A 1JQVA 3SY5A 3VGDA 5C7HA 2I17A 3WDJA 2FVMA 2J7FA 3WN6A 1R3YA 4EAMA 4UR9A 1K03A 4NXKA 4A3HA 1UH3A 3N2CA 5HXMA 4U33A 4Z1AA 1KW1A 1SJCA 1M68A 4ZQCA 5A8PA 3MYOA 1KM6A 1ISWA 3EOEA 4IMCA 2Y7EA 4JTFA 4Y9OA 3DFYA 2CWNA 1DHPA 4YIWA 4IGHA 1JCTA 4QG8A 4GUFA 4FXFA 4UMAA 3ABZA 3PNZA 4H7CA 3NG3A 5JBFA 5CCZA 1G7UA 1E15A 4WDTA 2XZ9A 3W53A 2G50A 1O68A 1Q4NX 4GVIA 2VYOA 3BGGA 4O8RA 1TPB1 3WELA 4GBUA 1N7KA 3MVTA 1UD4A 1VRXA 1ZAJA 3T07A 1M7XA 3IPWA 4LVGA 4A8LA 2OODA 2Z27A 4KWWA 1K6WA 3M1ZA 2VZTA 1MRAA 1PE1A 9XIMA 3PR2A 1JI2A 3PBYA 2WC7A 1MUWA 3GDBA 2MUCA 4G2DA 4ROPA 3IGXA 3W2MA 4MUPA 4YL2A 3JS3A 3MS8A 1ZCCA 3SY1A 1V8EA 3E3HA 4KIRA 1LROA 1SZNA 3BARA 2XIJA 4PZVA 2XTKA 3QV9A 1BG9A 4RZBA 3W02A 1XLBA 1S2VA 1T7LA 3Q4DA 3N9SA 3CAWA 4QG6A 1S2UA 4YLWA 3KRZA 5DLCA 3N6JA 3GXTA 1JCYA 1TTQA 2PDMA 2Y70A 1GYNA 4FXJA 4KKXA 4RDVA 1ONWA 4B5NA 2V6AA 3S1VA 2YDAA 3DYMA 3M43A 3T2QA 4M80A 3S47A 3OEXA 1W3TA 2J25A 1W9XA 1E9IA 1RY8A 4PMOA 3NQEA 1RK6A 3SCVA 2BMBA 4YYCA 3P8JA 1EXBA 5E9XA 1EGVA 4RZ4A 4POCA 4CVUA 3GVQA 4L1WA 3TCEA 1DWFM 4PR4A 4WVXA 5HOSA 2FGLA 4JL2A 4NJHA 5F2IA 1HVXA 1FWFC 5JXQA 1M41A 3SUUA 1WXYA 5D02A 1FWBC 4PMZA 5JMUA 1B0IA 4N9EA 5BOFA 3WMBA 2R1NA 3WK1A 4AC7C 1DQXA 3TN6A 1F6PA 1C7SA 4H9VA 4JQAA 1FWHC 1NFGA 4GUIA 6REQB 3II1A 5HDRA 3CZEA 4OUIA 1TKKA 3RMJA 5JH2A 5LHEA 4IQJA 1D3GA 3O07A 1RVGA 3GWQA 4XVDA 2PDKA 2G3JA 1Q6LA 5AVNA 4GLEA 3VNKA 3CTLA 1T6MA 1GVQA 3ZXWA 1LBLA 1PKMA 1WAWA 3CPUA 3TOPA 1SGJA 2X2YA 5I3FA 4J3XA 3QH2A 6ENLA 2OTDA 3RUBL 3WMCA 3CUXA 2Z28A 3GG8A 2D73A 1XBVA 3W73A 3WBAA 3GC5A 3UG4A 2J79A 5E93A 4HT3A 1L0PA 1A5NC 1TRIA 2Z00A 1WKYA 3PZVA 3QR1A 5C0QA 1CXHA 4M81A 1CXIA 1FA2A 3AJ7A 1OIFA 1XCWA 2F2KA 2RFGA 1U1HA 3Q2DA 1UR2A 1BXCA 3UZWA 3ALGA 3EPMA 2CETA 4IH3A 4NVTA 3WLQA 4FHAA 1H7NA 1GQJA 3WDIA 1HFBA 4UQDA 4J27A 2FHCA 3A9IA 3G1YA 3UY7A 1F73A 1LLZA 3UESA 2H9AB 3ZT7A 3G0UA 3VKKA 3WLLA 3UA4A 4GY1A 4Z0JA 3G1DA 5D8WA 5HATA 1RXOB 3ALFA 4NI3A 1OEPA 4N9BA 2CWXA 3FDKA 3PFRA 3URNA 1JR1A 3UYIA 1EOKA 1ZFJA 4GHRA 2J8TA 2WSKA 4Q4RA 5FCZA 5A6TC 3A4JA 3WQ6A 1L8NA 1MUMA 4FO4A 3W85A 4F3HA 5FEZA 3H22A 4RDZA 4Q33A 3NL6A 5XIMA 3DIPA 3SCSA 3MP3A 1YNPA 4DX3A 4OIFA 4A3QA 5E70A 3GKFA 4HU8A 3DESA 3CMGA 2PD9A 4E3VA 4BI7A 1PSCA 2WWDA 2YL9A 2G4FA 1O5RA 1Q5MA 1ONXA 1OZQA 3EOUA 3PN8A 4E2DA 2WMJA 3PB2A 3BG5A 3KTXA 2DZSA 1XIBA 4BA0A 2JIWA 4O1CA 2WNNA 1AD1A 3OB8A 4DNMA 5SWUA 1UR0A 5BOOA 1GOKA 1VFLA 4WKFA 2BP1A 2R94A 1QCWA 3AXMA 1KB3A 5T26A 1WDWA 1LP6A 3TN3A 1B30A 2V81A 2DPEA 3POHA 4JD4A 5D2VA 1KM5A 4GD0A 3HGRA 4GABA 4QDMA 5I0DA 4ZMGA 3TYAA 2PU0A 3ZJ7A 1TZ7A 3WD2A 1WNOA 3U7VA 2Y1HA 1UWUA 3SRHA 1QBAA 3QQ0A 4IIEA 2OKOA 1OYAA 3FX4A 3LYEA 1X38A 4PB3A 3QW4B 3DEQA 1SR0A 5D9NA 3P3BA 4H8VA 2PB1A 1RPKA 4ZQMA 4MNMA 1KLYA 1TV5A 1UZHA 3TU9A 1SO6A 2O7QA 3OGSA 1VBRA 2PWEA 3B9NA 2CITA 3H23A 4D9PA 2VOTA 4XO7A 4W84A 2VC9A 4CN1A 5G5IA 4Z2HA 1Z6KA 3F03K 1GHSA 1OHLA 3VFCA 1THFD 4MJ4A 1V6UA 3ARUA 1FP9A 3EDDA 4CD4A 2CESA 3FKRA 3GXMA 1I0BA 4R7JA 4B92A 2ZTKA 1GPWA 3THDA 1PIIA 2CHNA 1VR6A 1J6PA 1Q13A 4GG9A 4NRSA 4CU8A 4WF7A 1Y65A 2ZZ7A 2IXUA 3ZJ8A 5J04A 4I8YA 4ATWA 3VABA 2O4MA 4RK8A 4OQVA 1XISA 5K9CA 4AH7A 4YTRA 3A3WA 1H51A 3E9AA 4FS9A 5HUOA 1SPQA 3DYOA 4M6VA 3BOLA 3VD5A 3LMZA 5AYXA 4ASTA 1GTHA 4O0QA 4PRRA 1EJWC 4LNYA 1B3VA 2FZBA 4O1AA 3GTFA 3V1HA 4GNVA 3NL2A 3HF3A 5A3HA 1VBHA 4BCEA 3ARSA 4MYXA 1TMLA 3BG3A 2V2DA 4I9AA 3MHUA 4RDWA 3UZZA 2GVYA 4ML9A 1OYCA 4Q8TA 4UR8A 1N82A 3LPPA 3F4CA 4J3ZA 4NNBA 1OD0A 3WJZA 4PTMA 4Q8VA 4GIEA 4D6EA 1OF8A 5CG7A 4J5NA 4ZVJA 1ITXA 3VIJA 3RCNA 3GTIA 1BYCA 2WV8A 5I06A 3KVLA 3P61A 2PDBA 2XUCA 1PO9A 3CZJA 2XISA 6PTDA 3QFEA 3WLTA 1FWAC 2R14A 4L61A 4JPGA 5CBJA 2DT0A 3DKLA 3S5NA 2AKZA 1XP3A 1LWIA 4HOZA 4JHZA 3H54A 5DN1A 2ZZ5A 2EQDA 4GYPC 3UEQA 3G24A 4WGHA 4O0ZA 4MWAD 1SW0A 2CHRA 2OX4A 3MMDA 1RBAA 4FA3A 4FNTA 3GVVA 1O5KA 3EMCA 3LV6A 2BVWA 4HSNA 4JIQA 5A8NA 1B1YA 4IPLA 2E9MA 3GTXA 4E2BA 4ORMA 6TAAA 3THCA 4DF2A 3RM9A 1XIJA 3C0QA 4HYRA 4WLCA 4YHGA 3TJ4A 1Q7ZA 3EX4A 1ITQA 3OA5A 4LAZA 2BHUA 4KCWA 4C6QA 3URAA 3DFHA 3FGCB 4JS3A 4M51A 1KRCC 6XIAA 4AVNA 3MV01 2GJXA 3AU2A 3KWXA 3KE0A 1UH2A 1OGGA 3G1XA 1UG6A 3QKEA 1NF0A 4LAKA 3QYQA 3S83A 1JAKA 3NVTA 2VFFA 3EKGA 4NAEA 2Q3RA 3SCUA 3WEOA 1XW8A 5FJRA 5LIYX 2VOMA 1ZL1A 2A3HA 1E0UA 4UTKA 3RG6A 1Y5XA 4PUKA 5LYRA 4D6JA 2J9YA 2WNZA 5AN7A 3P80A 4C6KA 1GG1A 4XWUA 4AZBA 1QNQA 1MZRA 4QEEA 2QYGA 2X05A 3WCZA 3VNJA 4F2TA 5KMYA 4XAZA 4M24A 2D2HA 3V5FA 3ZSSA 3KCJA 4NF7A 2FTPA 3JUGA 2Y62A 4N0RA 3RLHA 1DXIA 3EZ4A 3CLMA 4MB1A 4AEEA 3WQ8A 2Y4SA 3VDCA 2AAMA 3M64A 2E6AA 1W3KA 4XIAA 4CQ9A 4A21A 2PTXA 4C7GA 5DX7A 5J8LA 3C2VA 5HWJA 3BW3A 1UR3M 2V67A 1UWAA 1U5JA 1GEHA 3GNPA 5A2BA 1FOBA 2V3GA 1QK2A 3FN9A 5A2AA 4PEKA 1OD8A 1VB9A 4YWSA 3T7VA 4HN4A 3URQA 3UWQA 1PHWA 1YKWA 4NU7A 1VGAA 2QLYA 3WYZA 2A3CA 3ZVHA 3E0IA 3UR7A 1EDGA 1F3WA 4HD5A 3VUSA 2NQ9A 3QHOA 4E5TA 3W25A 1P6BA 3LUTA 3B8UA 2OMAA 1JZ6A 3RM8A 1EA9C 2D2OA 4DM2A 5IHSA 2AMGA 7TAAA 2EKGA 5BROA 3L4WA 3QXBA 4L80A 3JR2A 4IL0A 3GR8A 4DRSA 4INFA 2CCRA 5CLTA 5DCDA 4IPIA 2OSWA 1TPH1 2R1PA 1VYSX 4AIEA 3RPTA 3DHUA 3GUWA 5EMJA 1NDZA 1EP3A 3WLSA 1V02E 3NIYA 1FFRA 3MJYA 3S1UA 3LRMA 1B4KA 1M7PA 1XLJA 3K8KA 3DFOA 1HJSA 5BOEA 1EJUC 4LUYA 3BSHA 4WJ8A 3TSDA 1VKFA 2CFFA 5BRPA 2ZA1A 1R9YA 4ZE5A 4KCUA 4O13A 3M0JA 1V3KA 1DOSA 4UC5A 3NVDA 1D9EA 3UGVA 2PTYA 3AROA 2DVXA 4PMDA 4WD0A 5BWFA 1J5SA 1J5TA 5C54A 4RXFA 4IX2A 4YYFA 3BG9A 1JYNA 3W71A 1RJQA 4N02A 2XWDA 3G5EA 4C6OA 2OYLA 1OGSA 1YTEA 4NAEB 1S1PA 2HDJA 3MSYA 1DWAM 3LSBA 1KNWA 4RLIA 1EEPA 2YBTA 1LL4A 2ZBTA 2JALA 2NW0A 3WLIA 1B9ZA 1JNEA 1XLLA 3MANA 1KD0A 4YTUA 1QHPA 1JDDA 5LIWX 4ZOCA 1IT0A 3LZ3A 2GSHA 3ZR5A 4GIYA 3LGEA 1X96A 2QCGA 4E4PA 1QI2A 3SUWA 3NNTA 3QV7A 2Q71A 4CNOA 3STGA 2ZYFA 2AAAA 2DORA 2NV2A 3T0BA 4IOTA 3WUGA 3QR3A 4LQ1A 2ISFA 3BSMA 1QMLA 2JE8A 2Y7DA 4AXKA 2OU4A 3MUXA 4B3KA 3N04A 3VGGA 2QIIA 3G8RA 1ZALA 5JIPA 2VFGA 4IIBA 1P0EA 1CWYA 3B9DA 5I77A 5D04C 1DVJA 4HK5A 3W7HA 3AS1A 4ECLA 1ZGDA 4JKMA 3T2OA 1OIMA 3V18A 4GY0A 1BF6A 4C6DA 1GONA 3S2CA 1V03A 3ITOA 5I07A 2IQ0A 3T81A 4EPDC 3CUFA 5E0CA 3G1HA 4HNTA 5LNUA 1YRRA 3O6YX 4WOQA 2VEKA 1CNVA 2EG6A 5IOBA 1E73M 1U1JA 1B3XA 3PZ9A 3LI1A 2ZKMX 2X8RA 3ZVHB 2R1LA 3FEMA 3W7CA 3PY2A 4DO5A 4HMDA 2QMKA 4LALA 9CGTA 4R34A 1P48A 1NTHA 5CPOA 3EWBX 3GAKA 4CN6A 1YDYA 3DBNA 2XVGA 4IP5A 4YPJA 3VKAA 1WX0A 1RY0A 3WG6A 4A29A 2OO6A 4LC6A 3KRSA 1Z7AA 2PWUA 2UY4A 1MSSA 3WBEA 3LERA 4PCPA 3KP1A 4PTDA 3ANYA 4CD8A 1OFAA 4C6MA 4W8LA 2ISSA 3QFWA 4GY7A 4DF0A 3WJXA 1DJGA 3RGTA 4PMRA 1QNPA 4NJKA 4HOXA 3H2AA 3DCPA 3W2NA 4E3TA 1V93A 3OOQA 5IFPA 4TX8A 2F2HA 4ZB0A 1Q6GA 1UMLA 4PMUA 1G9HA 1BKSA 5FJTA 1EC8A 4ERGA 3EOOA 4AISA 1AA1B 1B31A 2P0IA 3PWIA 4GYFA 5ABTA 1MXGA 4NSBA 1FY6A 3ABQA 5EBAA 5FSDC 2PDIA 3RRXA 3FSUA 1RK5A 4YS1A 3BQ6A 4FP1A 4JQ2A 5AZ1A 3NYDA 3N1AA 4CD5A 4JKKA 3TYCA 1GZJA 1XSKA 4IXXA 4MAZA 1Q6CA 3VGHA 3LEPA 4CQBA 1AMYA 4N9DA 1AQMA 2E6DA 5BXSA 3L4TA 4FX6M 2OWWA 2JFEX 4I9MA 5EL1A 3KRBA 3RITA 1XUZA 1P43A 1KCKA 3TSBA 4EF9A 3PPHA 3B0VC 1F05A 5C6MA 2VGGA 2FPTA 4KIEA 3ARPA 1G4TA 2NQJA 2O56A 5I3JA 2INZA 3C5QA 5LHFA 3UXAA 4QGCA 4B5VA 3FXYA 4DNHA 4TVUA 4TTGA 4WOZA 1P1XA 4C60A 4B90A 2PWVA 3A12A 5G2WA 3DFQA 3OZOA 1V0LA 3MUIA 3M0MA 4WDUA 1YXYA 3C8FA 1H7OA 1BXNA 3AIQA 4KEZA 3BVJA 2HROA 1DE5A 1DKWA 3W84A 3SUSA 3VDGA 4D6GA 1LL6A 2Z1VA 2P10A 4DUOA 1OBAA 4KT2A 1TTJA 2BASA 2O55A 4QROA 5LXEA 1C29A 1LRTA 1PHQA 3VNIA 4JQ4A 1RAKA 2X09A 2XYLA 5CG0A 4S3DA 3CL7A 3EB3A 1QPQA 3NQBA 4AHPA 3TQVA 4JIIX 1FHDA 2POZA 3RJXA 3TNOA 1V3MA 3W7QA 1DJQA 3EXRA 3VD7A 3HPFA 2F61A 2WSQA 2V5JA 3TP4A 1JZ3A 1I2QA 1O60A 3BE7A 2BXYA 1O5XA 3MT1A 2P1FA 1Q45A 2BV9A 1JPIA 3PBMA 3ONCA 1ZAIA 3QKZA 4DUWA 4HIBA 1W3LA 3F5JA 4GCAA 1XICA 2R91A 5A6KA 2WVUA 2VCBA 4R7OA 3L9CA 2XIOA 1OT1A 1NEYA 4GXWA 4YXGA 1XH1A 4IUGA 1T41A 4GYPA 1CENA 4S2CA 3ZLFA 1VFFA 1DWJM 3WNNA 3HOJA 1PKLA 3C52A 1BTCA 2XFYA 1S3HA 5K4ZA 2YCKX 2YGYA 4XK2A 2G3IA 3NJ3A 1LDCA 1HVQA 1XKYA 4KCVA 3SB0A 1EXPA 4HTBA 4AU0A 3S9YA 2OQLA 4ONVA 4WDXA 5M3WA 4XAGA 3ZR4A 4QP0A 3QTPA 1TV8A 4L9XA 1JI1A 1K02A 4NZJA 3VIKA 1HTIA 4OZOA 1EYWA 3VMOA 3KOZA 1W5MA 4MY9A 4ZSTA 5C5YA 2C19A 2ONEA 2DIKA 1IXOA 4OJYA 2VP8A 3FKKA 3GQYA 3QZEA 4XAFA 3ZIZA 1Z69A 5H2ZA 3DI0A 1Q8JA 2HEJA 1PZ1A 2E9BA 3MTWA 1TPWA 1DPMA 2VRQA 4AY7A 3GSMA 3SDOA 4O52A 3W7IA 1IV8A 1EQPA 2VWTA 3INPA 4XBKA 4DJFC 5I3KA 2RH9A 1E5JA 3AC0A 2FJUB 4OFCA 3SN1A 1V77A 5A8OA 1BWLA 1ZZMA 4RZ5A 3P2VA 4IUOA 3TQ0A 3KBMA 3Q37A 1XR2A 3TR9A 5D37A 2PC8A 4CU6A 4W7UA 1QOXA 1ADOA 2VEGA 1H5YA 1ME7A 3PBWA 4GZJA 4R88A 3ZR6A 2REQA 1QHZA 3UY8A 4AZCA 2XWEA 3P74A 1T99A 2B7NA 5XIAA 3VUPA 4EANA 1KBBA 2VGFA 3H12A 4LY4A 3L12A 3KRUA 4WXYA 3WF0A 1GJUA 1BPLB 2ACUA 1K70A 4O1FA 1V4YA 1Z32X 5D38A 4EPKA 1E1CB 4J3WA 4JCMA 1SO4A 3W00A 3WJSA 3KXQA 4U10A 1PPIA 1BGGA 2VELA 4GCXA 1MW3A 3GNXA 2EXOA 1K7XA 1VAHA 3ZJ6A 4PH6A 2YOCA 4AY1A 1Z42A 1FWNA 2ZZ4A 2OVLA 4B4FA 1MEHA 3AMDA 4ADTA 4TMCA 3WFAA 3CQJA 5I3IA 3SIMA 2QULA 2ZRZA 2Y0FA 2AL1A 3C86A 1UHVA 4K6AA 2XN1A 4LUTB 3EKLA 3VOHA 4F9JA 1LWJA 2XFWA 2WZHA 1EJ7L 3GY1A 4HJWA 1MDRA 1C90A 2DZUA 1O66A 3LHUA 1OX6A 2ISWA 4GI6A 1EKOA 1SW3A 1PCWA 1YPFA 3LZ5A 4BEUA 3T8QA 3SSJA 4GZ7A 1OCNA 2WQPA 4BR1A 2JKPA 2V63A 3USZA 3TC6A 1W32A 4KBXA 1GZGA 1MQQA 4HA0A 3VU2A 3HV9A 5EBUA 3RXZA 4ML4A 3CUHA 1XH0A 3E96A 2WPGA 4JFWA 4LOCA 5EU9A 1S5VA 2X7VA 3V36A 4X0NA 2QHAA 4GH3A 3H4WA 3WO8A 4LB3A 1MQRA 3IGHX 1KM3A 3AHTA 1RR2A 4TV5A 1YTKA 3AI0A 1PAMA 4RL3A 4IWWA 5ECVA 3ERPA 3SJNA 1F9CA 5E0KA 1I75A 3MJMA 1PX8A 4CQDA 3GIQA 4QSFA 4W7WA 3AMKA 4H04A 1XGEA 3GU1A 2BNJA 1XIFA 1I45A 3I68A 1JXJA 1BSIA 2J9ZA 1TMQA 3M5YA 2Z7GA 1TB3A 3OZPA 3SI9A 1ZJHA 2IS7A 3QRHA 1J9YA 3WLMA 1G4SA 2E77A 4X22A 4XSMA 2ZZ2A 4V2XA 4E8CA 2Q8ZA 3VMNA 4MWAB 1P6WA 4EXAA 3LSCA 3EX2A 1GJWA 4M6PA 3W1QA 5A8QA 3P7YA 2MNRA 3VILA 3HIJA 2ALDA 3W1LA 3QQWA 2V5BA 3K8MA 4ZXLA 2QCEA 4AZCB 3UP8A 3TW7A 5G1YA 1OC5A 1MZHA 2PGRA 3WL0A 2DW7A 3QMRA 2CLKA 2AKMA 3OO2A 1O94A 4PMXA 5CGMA 1ECQA 3WD3A 3OODA 2DIEA 4QE4A 4CCCA 2GUUA 4WY0A 3WIJA 3HGOA 2YSWA 1R86A 1Q6EA 2PDGA 1V6XA 1NOWA 3I6RA 4W85A 5LNVA 5KZDA 4AZ5A 1UKPA 4PEEA 4GX8A 1US3A 4HSOA 1H49A 1KFWA 3KWSA 2YLAA 1QXLA 2CBJA 2BWGA 4CCDA 1XRTA 1Q85A 3KFTA 1ELSA 1K3UA 1RBOB 1VFUA 2WHMA 5MKGB 1DP0A 1YIXA 3NFUA 3LHTA 3W7PA 4LH8A 5F2LA 4QJ1A 1HL9A 3CB3A 3FIGA 2BY2A 1JZ4A 5D32A 4H4IA 1OGBA 3RX4A 4Q32A 4Z2JA 1PWLA 3K1GA 2EJ1A 2P8CA 2ZRYA 1J01A 4M29A 1XLFA 3GHSA 3QHNA 4RE4A 3IEBA 3B0UX 4E2VA 1OJXA 1YE4A 4JTGA 2GLKA 1GOOA 1ODUA 3HPXA 2DSUA 2WJZA 3AOFA 1R6WA 1YX1A 3W3OA 1WYIA 4BJHA 5DXYA 2BOEX 5HNTA 1EJRC 4RNHA 4MKSA 2ANUA 2V9DA 4GGHA 1J11A 3FOKA 1JFXA 3FDGA 4B91A 3W7JA 1JFHA 3LHWA 2ODOA 2DUZA 3WLOA 4ERIA 3WQOA 3B8DA 2XINA 3UNTA 2GK1A 3RR1A 4Q22A 1VPYA 4REQB 5LIKX 1RBLA 1A3HA 3NL3A 1EO7A 3SM0A 1JIBA 2BY3A 2DEPA 3QYSA 4XD6A 3CJPA 4IFRA 2RDTA 2GOUA 4QEHA 1CTNA 3S8HA 3VX0A 3EDFA 4LEQA 3ONBA 3LM7A 3DXIA 3W26A 3BAJA 3WUBA 5EKYA 4MM1A 4JZ5A 5HNNA 1POKA 4M1BA 5A8MA 3DKJA 5LIUX 3BGJA 1A0CA 4HSHA 1Q7QA 3V16A 2ACRA 2MANA 2NQHA 1TWSA 5JVLA 4N9CA 3RX3A 1MXDA 3B9EA 3E02A 1RJRA 2NV1A 3K46A 4IISA 2J88A 2QJNA 4CD6A 2HQAA 4UTJA 1VIWA 4BF7A 4EVZA 1AW5A 1CB7B 3BJFA 3OVGA 3VIMA 3P5YA 1HJQA 3N3MA 4GQRA 4NZFA 1WE5A 1GVSA 4I9TA 3W7NA 1ECEA 1RJPA 2ZUWA 4O16A 3S2NA 2WM0A 3S5SA 4RE2A 1K8CA 1JXKA 3WH9A 3VM5A 4AXNA 1R2RA 4QDWA 1JZ5A 3GDMA 4GH1A 2J4GA 2YCIX 1YBQB 1NVMA 3MI6A 4XO6A 2P53A 4LPCA 4B5UA 3UF9A 4AEOA 3VXGA 3QY7A 1C9WA 1TA3A 5KEZA 2DY3A 1A4MA 2A0NA 1AJ0A 1W3JA 4TMBA 3P8IA 3B8IA 3WLPA 1KA9F 3IJQA 3ZLGA 4IIDA 4QLLA 1LBMA 1JGMA 2GVJA 3IWPA 5I3DA 2B0MA 2O0TA 5E1QA 4BHYA 2XDFA 1TV2A 3LG3A 4HPXA 3FJLA 5AFDA 3V4BA 3PUDA 3LTYA 1F6YA 4NI8A 2GQ3A 3W7EA 4NYUA 2XM2A 3GHRA 3ARYA 3CZKA 3NPXA 3JZEA 3BLLA 7A3HA 1S5MA 1NELA 3P14A 2WSYA 1HQTA 2O4QA 3IIOA 3MMUA 3PJUA 1X1OA 3R89A 2V5DA 1RLDA 5G4WA 2FTYA 4CUCA 2NLIA 5DRCA 3LLXA 3NPUA 4DZ5A 1BYDA 3MP4A 4O50A 4H01A 2VDIA 1TUXA 4Q8MA 1SMDA 4UBPC 3UJRA 1H4PA 4PUUA 3IAPA 7PTDA 2PDPA 1TX0A 3WBYA 2QDDA 4U5KA 3B0YA 4XUGA 1OCQA 1W6TA 1VEOA 2XG9A 1Q6DA 1GWJA 4IF2A 1HJUA 2PP1A 1JPMA 3O0FA 3V7PA 2CXGA 2X1RA 1NOUA 3NZGA 1ME8A 2BGQA 3GS6A 3W72A 2YA2A 1DQWA 3IUDA 1F3EA 1PXGA 1EJSC 5FF0A 4GXMA 3PM6A 4PGLA 3TTQA 2D1ZA 1UOKA 4NQ1A 4CD7A 1FWDC 3U9IA 2NT0A 3VE9A 1LG1A 1TG7A 1UWQA 1O12A 4FI4A 3ICJA 5EGRA 1XKJA 4F4RA 1K9DA 2O92A 2WOQA 3IK2A 2BTMA 2BX7A 2UWFA 1ZP4A 1JUBA 2PLMA 4DJFA 3E12A 1F4AA 2OFJA 5BNKA 3BOXA 3W7LA 5D2XA 2IQTA 2PRHA 3ES7A 4XD5A 1L2UA 1AH4A 4IM4A 1MYRA 3DENA 1DJYA 5CH9A 2CBIA 2V5CA 3CQIA 5CJ5A 4KWSA 1WV2A 4O14A 1DJHA 1Q2RA 3NEHA 3PUOA 4NRRA 3AJXA 4MWAE 4C6JA 3T4CA 1KWKA 4MY8A 2HJPA 3W86A 3OLEA 5CQ1A 1L6FA 4XZNX 1RQHA 2F6XA 1VYRA 5I79A 4U4MA 4H9XA 4OBSA 1XFCA 3PZTA 2J7GA 3SGGA 3ARXA 4C6EA 4PCSA 1H1YA 9XIAA 1JRCA 3WNMA 5IXEA 2Q8XA 2INEA 3C2FA 2PWFA 4XX6A 2AGTA 3TMQA 4KRTA 3KW3A 3HG4A 5FSEC 4KFNA 3UZYA 4Z42C 3TX9A 2EHHA 1MWOA 2J27A 5FACA 5GNXA 1BRLB 3PAJA 2E40A 2PLKA 3NWRA 3O7UA 1T40A 5LIXX 2Z29A 1DV7A 4K1WA 1SU5A 3WZ0E 4PUNA 2H3DA 3UWUA 2WLZA 2WMKA 1U5HA 2ZXQA 2JKEA 2FB2A 1CLVA 3QV6A 4KRUA 5FF4A 3R10A 4R3UA 5ENLA 5EMYA 3AWNA 2V3EA 4N4PA 3QSTA 3E38A 3L5LA 5AYBA 3GU2A 2CLEA 4GBDA 3WUFA 3W22A 2EKCA 2G8ZA 3G0XA 1JQXA 3PHAA 3PJTA 5ABFA 3W2UA 1O5QA 1W0MA 1SJBA 1QRQA 2X1UA 2W6RA 3MI2A 4S3JA 2ZX7A 4KF1A 1RLCL 2ZADA 4AEFA 2PI6A 5KZEA 1E4LA 3DERA 3PZMA 1LUCA 2W63A 3LTPA 1CT5A 3VOGA 4OV4A 2WM1A 3EB2A 4GYJA 4O19A 1UROA 2FHBA 4UFIA 4JGDA 1OFPA 1XRSA 4J4KA 2CZ5A 1KGUA 4LWWA 1HO1A 1UIPA 2GOKA 3B05A 4NZ5A 2PF8A 4ZOAA 1W9BM 3IJ8A 3TNBA 3W6LA 3OJGA 5HMSA 5TQLA 4L1GA 1LORA 3OYXA 4UR7A 1KCZA 3EWUA 1F8IA 1PYMA 3FYYA 1NH6A 2Z0IA 2HE8A 2RAGA 2VUYA 2EG8A 2CZDA 2QV5A 3FLUA 2ZDSA 2VC7A 4JBRA 2G4JA 7ODCA 5DMNA 4J2MA 4DYKA 4CEXC 4P8WA 3LENA 1PKNA 2WPBA 3NA8A 4F0MA 3C6CA 5CAHA 1GKQA 4JTDA 4DI8A 3RYSA 2GZXA 1A80A 2QCHA 1UC4A 3BMXA 4GUHA 5BXRA 1LG2A 3NTYA 1KFKA 1E3XA 3E1F1 4ORIA 1EBGA 4JTTA 1XLAA 1W1ZA 3H4XA 2P8BA 3GXIA 3WBWA 1Q7MA 3W2LA 4QHRA 3UVIA 4HZ8A 1OFDA 1HJXA 2ZX6A 3C3UA 4FLRA 1OFOA 1Q8AA 4GQGA 4KETA 4HNNA 3ZZ1A 3RILA 1HX0A 5LXXA 3KS5A 3ZT6A 2WSPA 2X1SA 1V3LA 3G1AA 4H9YA 3B8VA 3OG2A 4TQTA 1WP6A 2QCMA 5BZAA 3GZAA 2VHLA 2BOFX 4C6PA 4QR6A 1QFEA 3SQSA 4IJRA 2OEJA 1H2JA 1I0DA 1QNVA 4WK9A 4LSBA 4PN2A 2BVDA 3JRKA 3OQEA 2QAFA 2VGIA 2OLSA 2D3LA 1QI5A 1XYFA 3UPMA 4DELA 4TTUA 1IR2A 2QR6A 1DJNA 3U0HA 4B16A 1UJPA 2Y61A 1X1NA 2J24A 4Y9MA 1A5CA 1SO5A 1LZOA 5U4NA 1DIKA 2VEMA 4S39A 5LSMA 5I3HA 4DF1A 3T0DA 2C79A 2CPUA 3RR4A 3QC3A 4QDPA 3OG3A 1XUUA 3W82A 2JK2A 3KP0A 1J10A 2PDUA 2DT2A 4GC4A 2FDMA 5AOUA 4FNPA 1WZLA 1I4NA 1J12A 3WDRA 4DZAA 1CGVA 4PL1A 3MZ2A 4ZFCA 4JY8A 3ID7A 2Z6JA 3NXLA 3BWWA 4CCZA 5ABFB 1QNSA 1VJZA 2W9MA 2CLPA 2C91A 4ZO6A 4FF7A 4P7QA 3LV5A 5D4YA 4IL2A 4MPQA 3VCRA 4FNQA 1DJIA 4A4AA 3AXKA 1MNZA 5HMDA 4WGXA 3AS3A 1LWHA 3AIRA 4UZSA 4MJZA 1TE1A 3FVMA 1KRBC 2WK2A 3Q65A 1QNOA 3ABOA 1W9UA 2ZCGA 4DAFA 1I60A 1EJTC 1HT6A 1V5XA 5A6MA 4U28A 5HNUA 1VCGA 2YCEA 3PBVA 8RUCA 5KTLA 4AB4A 3TCSA 4PE8A 2A2IA 3P60A 4L5ZA 1QATA 4FPSA 3DGRA 3UVAA 4RJEA 1W3HA 4AD1A 3GFZA 1H7RA 4Z1DA 1C8YA 2BXVA 3KUMA 1TR9A 1BSLA 3NQAA 4QX4A 2QGHA 3C8NA 4FMVA 4C6LA 2DZXA 3VIPA 3L0KA 5I09A 4HYVA 1LRNA 1B9BA 4XUYA 1M04A 2VRKA 4HPJA 1E4MM 2NLYA 1W8GA 4JYDA 2HRWA 3CV7A 3GHTA 3H7RA 1TELA 3IAQA 3E2VA 3CAVA 1QTWA 4Z1CA 1FCUA 1XWYA 2NVCA 2PP3A 3TXZA 2OSYA 3CHDA 1MMFA 2X40A 3NQ6A 4MZ8A 1M6JA 4Y9NA 4D1IA 4Y9AA 1P6CA 4X0VA 2BGSA 3TTSA 3NQVA 1KLZA 1A49A 2H90A 3AS0A 3MV11 4JXCA 3DZ1A 4FF5A 1GVFA 4RX0A 3D0CA 2ZRWA 3B0PA 3M0XA 3THQA 3WK3A 1F8MA 1OYBA 1FBAA 3E5PA 3GNOA 5HQMA 1DXEA 5AHIA 4Q6JA 3D6NA 3VNMA 3PUGA 1XBZA 1K4HA 2RGMA 3A5VA 3PZUA 1QK0A 1SZFA 3CV2A 1K77A 3R11A 2P88A 3NZ1A 1IZCA 1DJZA 2VCAA 4F0LA 1KFCA 3VIOA 3WEZA 1SMAA 5CPNA 3GXNA 2J9XA 1KFEA 2IQDA 3ANVA 4AHQA 4H8HA 4H19A 1PUDA 3N4AA 3OP2A 2O9OA 5CZSA 4DVOA 4DWDA 3M0IA 4FOJA 2WZIA 4MFEA 5HQLA 1YYAA 3M9YA 2Z1SA 2CU0A 3L23A 3HQNA 4GI9A 5CPQA 5CPTA 2ZXDA 1R5YA 1H09A 2OKTA 4U31A 3MBDA 3PVFA 4AHOA 1HKJA 2QCFA 1KBIA 4OOZA 1ZBVA 3BCJA 4PMNA 1UQZA 1BFNA 3PPGA 1GVIA 1NFBA 3PNUA 3LNPA 4IT1A 4GOAA 4D8AA 4ZO7A 3CEPA 1ZY9A 1XV8A 4AX6A 1NARA 3RRAA 1KXQA 3YPIA 4NZ1A 1ADSA 2BLEA 3TSMA 2E0PA 4IFKA 2BOGX 1BAGA 2ZVRA 1RD5A 1LOQA 3GB6A 1H5VA 3CHCA 3O1NA 4GVHA 1TE6A 1EDTA 4P7LA 1TJ1A 1UW9A 2PZNA 5M17A 4G1KA 5CGTA 1Q63A 4OBRA 3G0SA 4WHBA 1S2TA 3LU2A 4PMYA 4ZTXA 3SRKA 4HPHA 3K8LA 2I14A 3QC0A 3UWEA 1XLGA 2BGNE 4GIRA 4OUEA 5FEPA 2YCLA 2YXOA 3UU0A 1TPUA 2WCSA 4QSHA 3VTRA 4HCLA 4P7RA 3AALA 5CEWA 4ADSA 3VGFA 6ALDA 1TV3A 3STCA 3SRFA 2CNCA 5A2CA 4H1ZA 4C6IA 4NILA 4YNGA 4H8UA 5GNZA 2RUSA 1IWAA 4A2SA 5HWNA 3BQ5A 1UP2A 2W79A 3PZNA 1X98A 3A6OA 4E8DA 3CH0A 3BSGA 5LA1A 2Y5SA 1AJZA 1V08A 3CYJA 3WF1A 2J7BA 4Z2LA 5DMMA 4GQBA 5D33A 2OQYA 3V0UA 1JG9A 1IZKA 1EWEA 2VXNA 3FV9A 4BQ5A 4R7WA 2BHYA 1R85A 3A3XA 3T42A 4LX4A 1DIEA 5HPOA 4JTSA 1E5NA 1CB2A 1S5NA 1KXVA 4GWEA 1GOIA 2NSOA 3R1ZA 1V0KA 2DSZA 3O6DA 2VX6A 3OGRA 4FX8A 2C1GA 4JIHA 3ABRA 1QAPA 3FJ4A 2NSXA 4IMGA 3N4FA 4MNLA 4DPQA 3NEVA 3ZS4A 2H6RA 1FH9A 3H2FA 4GQ0A 2W27A 1YLVA 2FYMA 1NFPA 1JPHA 1FDZA 2QDHA 4UTMA 1LBFA 2FZ8A 4LAOA 4D2JA 4IX0A 3NAVA 3VK5A 3R12A 2PTDA 1BF2A 1MEWA 1OT2A 1VRDA 3VZYA 3PUEA 1V7YA 3PK7A 1FRBA 1W5PA 2NUXA 4DBWA 2EPMX 3BAKA 3L2LA 4F79A 4DXVA 4C6BA 2R1MA 4L65A 1HL8A 2VUNA 3NQMA 5FA5A 1IEVA 3L67A 3C2OA 4IMDA 5LZLA 1UYQA 1ONRA 3R13A 2C0AA 2WXDM 2PDYA 3BLPX 2Z2UA 2ABAA 4AMCA 4O10A 4CU7A 1B90A 3QN3A 2ICSA 3EX6A 2E68A 2DJXA 3BGAA 3NQ2A 1TPFA 3WBXA 1ZQ5A 4IFKB 1HNYA 4GKTA 1I1XA 1JYWA 3GBEA 2PODA 1G69A 4IXHA 4A8IA 5CZTA 5T8GA 3DC8A 4DO7A 1VCFA 2QGYA 5K4XA 3U4AA 2ZUNA 1UBSA 4YU1A 5BMWA 3IUIA 4F0SA 4IMEA 4QE1A 4V28A 3L4VA 5I7GA 1TWIA 4Q8NA 2HVOA 3APGA 1VEPA 2VVSA 4PCTA 2GUBA 3UZ5A 3QGKC 2B7OA 5HA7A 1XSIA 4MY1A 3IACA 1TWWA 3OTRA 2HPMA 4H83A 4G5DA</