4AD4A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-isofagomine and alpha-1,2- mannobiose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
total genus 130
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad4A00
3AIVA 4J7RA 2QHAA 1HT6A 3AYSA 4BCEA 3CPUA 4W84A 1KR1A 2QMJA 4JHZA 5FL1A 3VGBA 1E1FA 1DWAM 3L4TA 2JALA 2C0HA 5E0FA 2WVTA 2V38A 3WD2A 1B1YA 3AI0A 1LG1A 4LX4A 3WF3A 4XV0A 2FDMA 3VIKA 3WKZA 3ARYA 2VCBA 3PTMA 4OBSA 3VMPA 2CERA 3VGDA 4JFVA 2E4TA 4MNMA 5M5DA 3AIUA 2VL4A 1VBUA 2VO5A 1VJSA 1MXDA 3KL3A 1TG7A 3UG3A 1XRVA 2PWEA 3VTRA 2CBUA 2O9PA 5D9NA 1HF6A 3AMGA 1EO7A 1BGGA 1JG9A 1GORA 1ZBCA 1W9VA 1EXPA 1R8LA 4AEFA 3BSHA 1ISZA 2EXOA 1W3KA 4RE2A 1JYXA 4AD1A 3CBWA 3VX0A 3T0DA 3B9AA 3SURA 3VIMA 3DYPA 1GPFA 4OOZA 1V6XA 2DSVA 3BXWA 1CGVA 1OINA 2BNJA 3W25A 3ZJ6A 4E8CA 1UWIA 1KXVA 3AS0A 1ITCA 1BFNA 1AQ0A 3VIFA 5ABEA 2ZXAA 1ISXA 1MFVA 1CLXA 2BY3A 3ARRA 3BMWA 5LYRA 3EMZA 4P8XA 1K9EA 1R86A 3PZQA 1JF6A 4D6IA 5CGTA 2IXUA 5I24A 1UH3A 4TVCA 3RDKA 4ACZA 3CZ8A 3WH8A 3WNOA 1MFUA 1XV8A 4GPNA 3VM7A 1ZJBA 1B3VA 3W37A 4PUDA 1YHTA 3SCQA 1MW2A 5LA2A 4AZHA 1MQQA 1KB3A 2E9MA 1VENA 3AHTA 4D71A 1J0IA 1VFUA 4H8UA 2VZSA 3WFLA 8CGTA 3ARQA 3PZIA 1I1XA 2W66A 3VMOA 4W7VA 1WB0A 4MAVA 1CGUA 3RIKA 5D9PA 2VC9A 3DECA 2GDVA 4IPNB 3GTNA 1KGWA 4B15A 4LQ1A 4PCSA 1V6YA 4MDPA 2ZUSA 2ZX6A 4H8HA 3NDYA 1V3KA 1EQPA 2G4FA 5DF0A 3WN6A 3AHZA 1E4NA 5IDIA 3ZO9A 1XCWA 5A6BA 1KCLA 2DIEA 1UD5A 1CNVA 3W4RA 2WMKA 5E0CA 1JNDA 1GQKA 2YL8A 2VCCA 1QNQA 1UUQA 2WNWA 1QBBA 3W53A 5BXRA 5HPCA 4XUYA 2XSBA 1QNRA 3W24A 4F9JA 4J3UA 1HVQA 3BLKA 2J4GA 3O6AA 3K46A 1C7TA 4UOQA 1EO5A 1R7OA 3WUEA 4E2OA 1B3YA 4QLJA 4UQ9A 3PZ9A 1GOOA 1CGTA 3M7SA 2WC4A 1HL8A 1BYDA 2CBVA 3AZRA 3HMCA 2D0HA 1NP2A 2GJXB 4TXEA 2GK1B 2HISA 3PTQA 1OIFA 1CECA 5AC5A 5IXEA 1W3LA 2CBIA 1UOKA 2MANA 4NRSA 1E6QM 5JBEA 5I77A 2V3GA 4XB3A 3LPPA 3TTYA 1J10A 4PMZA 3CUHA 4PMDA 5A8NA 3WH5A 4GKLA 3WMSA 4W86A 4PN2A 1DWIM 3EDDA 3VUPA 4AWEA 1FHDA 1H1NA 1LJYA 4HMDA 2WYSA 2O9TA 2HVMA 1CTNA 4RE4A 3MU7A 2XSAA 1RPKA 1UR2A 1PIGA 2WVVA 2A3EA 1ZBKA 1GQJA 2XTKA 3MUZ1 2O9OA 2O92A 5I6SA 1J11A 4GXPA 1FFQA 2A3HA 3S2CA 2J7HA 2WWCA 3SUWA 2VCAA 4FLQA 1JZ3A 4M80A 3ZOAA 3WELA 5DEZA 1PZ2A 1JXJA 3DHPA 1C8XA 1C8YA 1VB9A 1CXKA 4F8XA 1W2VA 4W89A 4CVWA 2V3FA 1OIMA 1GZJA 1OD0A 3M07A 1HKIA 2FH6A 4AZGA 3MMUA 1ZBWA 2EPOA 5DO8A 3WUFA 1BG4A 2ZX8A 1WKYA 4V28A 4PUEA 3MUAA 1JFXA 3NIYA 2GJPA 3BAIA 1HJUA 4J3XA 1BG9A 5HXMA 4Z2JA 3ZQ9A 2E0PA 1K6AA 4KGLA 4IPLA 3ARVA 2WB5A 2IUZA 3CZGA 4AY1A 2XGBA 3UG5A 2WBGA 2BHZA 2XJ7A 4CU8A 3VD9A 4IISA 5BRPA 4K68A 4UFMA 2YIHA 3RM4A 1K9FA 1QOXA 3W82A 1LWJA 4DUWA 1GHRA 2DGAA 4L4PA 3OBAA 2WMGA 1JI2A 3WEOA 3WSUA 1GHSA 3WF4A 3WL0A 2BVTA 3OLGA 4D1IA 1HJWA 5A2AA 1WP6A 1QHOA 4DWSC 3ZM8A 4QCEA 2C8NA 1E0WA 5E9AA 2W67A 3SUTA 4CD6A 1VEPA 1V6UA 3M6DA 2IXVA 2PC8A 3F5LA 4JCLA 3N11A 4X0NA 3AISA 2GSJA 4OUEA 4QP0A 1FH9A 4JFUA 1ODZA 4BQ5A 4AZ7A 3BSGA 3OLIA 1FHLA 4U3CA 5A69A 2NT1A 3WH6A 3THDA 4EKJA 1CLVA 2WCSA 4YN5A 4UZSA 3W28A 1H0GA 1MW1A 1BQCA 2Y5EA 4N0RA 4CCDA 2Z1KA 2OWWA 1HXJA 3WNNA 3CO4A 3VO0A 5I78A 1V02E 3HN3A 1XCXA 3K4DA 3OGSA 2X2YA 1W1PA 1QPKA 3A4AA 5DFAA 1LWHA 2D0GA 1XGZA 2PWHA 3WQVA 3CZJA 3QOKA 4ZE5A 3VDHA 1HVXA 1E6RA 5HDRA 3L4YA 2J75A 3QOMA 5HPOA 3NCOA 1PBGA 2AAAA 3N12A 1F4AA 2F8QA 1IZJA 2D3LA 3GH4A 4FF5A 4UTFA 1ISWA 2XIIA 3ZT5A 5ABFB 1C91A 3N18A 3ZSTA 1CBGA 2ZUUA 4HPGA 4DWSD 3GZAA 1XYZA 4OKDA 5EFFA 1VFFA 1LQ0A 1WPCA 1X6LA 1BVNP 3DC0A 1UZ1A 3IJ8A 5EFDA 2WHKA 1JD9A 1LLOA 1JIBA 2XGIA 1TZ7A 1UG6A 2G8ZA 2V5DA 1OD8A 1KBKA 3NDZA 4HMEA 4PMXA 1OGGA 3CGTA 4PMVA 4CVUA 2JIWA 4WKFA 4UOZA 3OGVA 2X0YA 2J47A 2FHCA 1DWJM 2D1ZA 3W27A 5EMYA 3CHFA 2XVKA 1FH7A 1G9HA 7CGTA 2Q8XA 4PTWA 1H3GA 4B3KA 1M01A 3AOFA 1R87A 2EPNA 2OYMA 2CETA 3CUFA 1WDPA 1CPUA 1E71M 5LA1A 4IM4A 1V3LA 1DP0A 1HIZA 2PBOA 4RE3A 4BS0A 5A1AA 4CGTA 1W1YA 4P7NA 2CKSA 2X0HA 1NH6A 5D9OA 4C7DA 4B16A 3K4AA 1V0NA 3ZJ8A 2XPKA 2XVGA 1OCQA 1GOIA 4UQDA 3BAKA 1FH8A 1Q6FA 4FK9A 2WMJA 3CMGA 1GUVA 1LF1A 1SMDA 2JF7A 2ZXDA 4NF7A 1K9TA 3ARXA 1VRXA 1SFSA 4PRWA 4HP5A 1GJWA 4CD7A 2UY3A 4GINA 3DHUA 4F66A 3WY1A 1BAGA 2VTFA 2YLAA 3VDCA 3SUSA 1CEOA 1LG2A 1VJZA 1GOWA 1UKOA 2YA2A 3K8LA 1M04A 3WL1A 3ZMRA 3BMVA 1D3CA 1PAMA 2WKGA 3O2LA 4HA1A 3TTSA 4AZ6A 3KWXA 4KRUA 1RD6A 5A95A 2CYGA 3ECQA 4CN6A 2WCGA 4AYSA 3VGFA 4AEEA 1OT1A 3WF0A 2VR5A 4GZJA 1WDSA 5A6LA 1JDCA 1IV8A 2CITA 2XM2A 4WJXA 2VQTA 4KH2A 3GNOA 2D3NA 3GXDA 3QGVA 3WDIA 1J0KA 1QW9A 3WDHA 1TVNA 3GNPA 3RMEA 2XVPA 4MTVA 2RGLA 2OLHA 4ACZB 1OM0A 2EBNA 4HOXA 1H4PA 5A2BA 5AC4A 2XWEA 1XSIA 2XFRA 3A47A 1JF5A 1X6NA 1CZ1A 5IFPA 4J3VA 2J62A 1KGUA 2O9RA 3PZOA 4JAWA 5BWFA 3VDAA 4J3SA 4X9YA 3J7HA 4YPJA 1QHZA 3WNLA 1KWKA 4P8UA 1MQRA 1TFVA 3MKKA 3KL5A 1JZ5A 1QNPA 1VIWA 3UG4A 3VINA 1QI3A 2XVLA 3FAXA 1NP0A 4GZEA 3RJXA 3ALGA 2D0FA 4V27A 5E6YA 1J12A 3II1A 1E6ZA 1W91A 1XH0A 1ZB5A 1E4LA 1U33A 3CUJA 2FHBA 4XX6A 3A4XA 2CKRA 3EBVA 3JUGA 3MUIA 4BQ3A 2F2HA 2QV4A 1GONA 2VRQA 4V2XA 2VRJA 2J7GA 2GFTA 3WIJA 5CLWA 4YHEA 3LPGA 1GOKA 2VZOA 2ZX5A 1CXFA 3PZUA 3ARUA 3W26A 1E55A 1V6VA 1NWUA 3WQ6A 3WEMA 3IANA 2OYKA 3SUUA 4D6FA 1MVYA 1BF2A 3VU2A 3WNMA 3U5YA 2XFFA 2VZTA 4PYSA 1UWUA 5JBFA 2PF0A 5A6KA 2ZXQA 5ABHA 2WW5A 2BXZA 3MMDA 4FLRA 3TONA 3BLPX 5FL0A 1PPIA 2WWDA 1WO2A 4QFUA 1GCYA 4UZUA 4HA3A 4Z2IA 1KFWA 4AZCA 4HPHA 4L4OA 3F5KA 3ZR5A 1EOMA 3GM8A 3WBEA 1MWOA 2VVNA 2J79A 4LPCA 1CWYA 1KCKA 3EYPA 1GOMA 4CD4A 4GO8A 2W92A 3FNDA 3VD5A 3VGEA 4QLKA 2ZWYA 1AMYA 1Y7VA 2W62A 4MB4A 3MANA 1YQ2A 3WF2A 3AQUA 2PB1A 2E8ZA 3CH9A 3VKKA 4A3YA 3SEPA 3WQ4A 3U5UA 1US2A 1LL7A 2BVDA 4UQCA 3ARSA 4AZBA 2J8GA 2ZUMA 4S3KA 1NOUA 1XSKA 3VIHA 1GVIA 2BS9A 2G3NA 3VNZA 1KWGA 1WZKA 2WVVB 3SCPA 3GXIA 1H41A 3MSDA 4H7VA 5CJ5A 3PHAA 5A3HA 4KMQA 4CU6A 2VT0A 3DYOA 1E4MM 3F4VA 3AXXA 1PJ9A 5M03A 4TOQA 1B3XA 4JKMA 2WHJA 2E9LA 2YL6A 3BAXA 5CLTA 1UD8A 5JUVA 5M3WA 3NSNA 1E15A 4W5ZA 4AC1X 1UH4A 2PBGA 3WEZA 1FOBA 1X1NA 2YBUA 1NOWA 3PZMA 2JE8A 4Q22A 2VX7A 4HZ7A 4R5EA 3NSMA 3VX1A 2WBKA 1HKJA 2Y8VA 2V5CA 4M56A 4PSPA 4GI9A 4AZ5A 2D24A 3FAWA 3LPFA 3SCSA 2A3BA 2G3JA 5C71A 3UR8A 4P7RA 1QHPA 1WDRA 3AS2A 2NSXA 1IT0A 5BCAA 1JZ7A 3ZIZA 5KZ6A 1UZ4A 1GVYA 3WD4A 2W91A 4MNJA 5HOSA 4B9ZA 4P7QA 5AY7A 3KZSA 3QHOA 4P7LA 1UYQA 3AMLA 2WMIA 3N17A 2WK2A 2ZE0A 5A94A 1U30A 3THCA 4S3JA 3WNKA 3QHNA 2BFGA 1DWFM 5D4YA 8A3HA 4Y7EA 1JXKA 1JZ4A 4GO9A 4LGXA 4MB1A 2ZUTA 4ZXLA 2BHUA 4M24A 4DUVA 3CLWA 3G6LA 4CD8A 2A3CA 3EMQA 4PEEA 3POCA 2OYLA 4D6CA 1JYWA 1HJXA 2CIPA 5AYIA 4Z2LA 3GXMA 4ACYA 4W7WA 4AD0A 3UCQA 2WLZA 4UFIA 4B3LA 1B90A 4PCTA 4J27A 5E09A 2J7DA 4AD2A 1C92A 1GJUA 3WDQA 1UQZA 1G1YA 2WHMA 4JZ5A 3WD0A 2JEQA 4ZE4A 3L2MA 4EE9A 1ISVA 3I3DA 4Z2HA 1GQIA 5A6AA 4CCEA 4TX6A 3WDPP 4WKAA 4PMQA 4U2ZA 5CG0A 7TAAA 3OB8A 1ZS2A 2EPLX 4A4AA 3GBDA 2WZIA 1D2KA 1JYVA 1OB0A 1KXTA 3GH7A 3OG2A 2OSYA 2DSWA 3VDBA 4TVUA 1M53A 4W5UA 4HTYA 1Q6DA 5AYBA 1BVZA 1UWRA 1BPLB 1XD1A 1J0YA 1KXQA 3F5JA 4AD3A 2PWDA 3OLDA 4U5IA 1VBRA 1GOQA 3WQ8A 1KQYA 1MYRA 4JFWA 4XZWA 4P7OA 5EBAA 3TTQA 1GQLA 1UR1A 2D20A 2ZICA 3PZNA 4E8DA 1VFOA 1TA3A 2XFYA 2YKKA 1Q6EA 4JIEA 5IHSA 4TVDA 1C7SA 4JHOA 4U2YA 4GQRA 1EOKA 1WDQA 3FN9A 1DWHM 3WH9A 5HBFA 1WZMA 3WMCA 4PMNA 3AZSA 3AMKA 3L4ZA 4IUGA 3WF1A 4MJ2A 4UFLA 1KQZA 1I1WA 5FD0A 5HNNA 1H49A 1TE1A 3NUKA 4GI8A 2W61A 2VNCA 1PX8A 2QPUA 2X09A 5CQ1A 4X0VA 4ZEPA 1P6WA 2DDXA 1LL6A 2BXYA 3K1DA 1PEZA 3OZPA 2XWDA 3CZKA 3E1F1 4Z2GA 2EO7A 4D6HA 2J77A 4PMUA 2ZUVA 4PTXA 1CIUA 1W3HA 1TMQA 1KBBA 1VAHA 3AIEA 4KGJA 1E6XM 2E8YA 3G6MA 1NWRA 5CPTA 1BYCA 1UA3A 3BAWA 4BQ2A 1XC6A 2J74A 3CUIA 2DPEA 2UWFA 2JEPA 4AXNA 3MO4A 1JAKA 1NWSA 5I79A 4AZIA 5JIPA 3L4XA 3IJ7A 1E6NA 4CD5A 3WMBA 4XZBA 1N82A 4W8AA 4MB5A 3T09A 1J18A 1E70M 2J7EA 4GZIA 6A3HA 1BLIA 2GUYA 2BY1A 1Q4NX 3BH4A 3TA9A 4YHGA 4AD4A 1H09A 1R7AA 1EQCA 1CDGA 1CXIA 1UR9A 3MS8A 4W8BA 1B9ZA 2ZX7A 3AIQA 1QBAA 1TR1A 1OBAA 4EANA 1HL9A 1G01A 2VZUA 2YLLA 2X05A 3VVGA 2YDSA 4UQAA 1E56A 3W6MA 2WSKA 1W9BM 2CHNA 1VEMA 1J0HA 1NM9A 4MB3A 3PTKA 3VD7A 1SR0A 5CPQA 1F4HA 1NWTA 2VI0A 5M17A 1O6IA 1Z32X 4DWSA 1TVPA 4EAMA 3CZLA 3OIHA 2DT2A 3T2OA 1E40A 3WD3A 5FKYA 3I3EA 2CBJA 2XIBA 2OSXA 5BRQA 2XHYA 2BVYA 3EMCA 3W38A 3N04A 5A6MA 2CPUA 4LYQA 3VNYA 4PTMA 1OT2A 1Q6CA 1UD2A 1UR8A 2VVSA 4ATWA 3ZSSA 4U3AA 2W4XA 2AMGA 3ARZA 2YL9A 2ZXBA 1B3WA 1JZ2A 1EGZA 3CZEA 2JFEX 2DT1A 1E4IA 2DIJA 1CGXA 4AIUA 1EDTA 2ZUNA 2BV9A 5GNZA 3AIWA 1UA7A 4KRTA 1EA9C 3POHA 5GPRA 1QI4A 1EH9A 2EQDA 4MNLA 1E5JA 2Y4SA 4NRRA 1EHNA 3MMWA 5D8WA 2J8FA 4JFTA 1V3IA 3GXFA 3AS3A 2WC7A 2NT0A 1V02A 3AHVA 4M8UA 1OWQA 1QNOA 2EPKX 4J3WA 1G0CA 1E1EA 1CXLA 2X1IA 3MSGA 1ISYA 1UKPA 2AOSA 4U31A 1JZ6A 3WH7A 1UHVA 3RCNA 3W0KA 4AD5A 1V08A 3GDBA 3PN8A 5GQBA 3S6TA 3AYRA 4M29A 3NJ3A 1QI2A 3BAYA 4AW7A 2EJ1A 4WSKA 4TTGA 5GNXA 4AZCB 3RPMA 4RL3A 3N1AA 4W93A 4FMVA 3IK2A 2VRKA 1I75A 4AMCA 4ATDA 1US3A 4NI3A 1TCMA 3ZJKA 5EB8A 3WQWA 4Z2KA 1O7AA 1R85A 3VGHA 3UESA 1A47A 1KR0A 3KL0A 3RO8A 3N9KA 2OWCA 4NZCA 1G5AA 3L4VA 3HU7A 3L4UA 1OGSA 2CEQA 3CIVA 1MW3A 3B9DA 2WHLA 4UOJA 3BGAA 3W6LA 4HOWA 1HP5A 2Z1SA 1PX3A 1C90A 1M7XA 5D9MA 2YA1A 2DEPA 5D8ZA 1E3ZA 2BY0A 1JAEA 3WNPA 1PZ3A 1W1VA 1E72M 4ML4A 4CU7A 4GIAA 2TAAA 2ZX9A 3AXHA 2WZEA 1JFHA 3A6OA 4W85A 3DYMA 4HOZA 2XUCA 1ZBVA 2DH2A 5BYWA 2WVUA 1HNYA 4CCCA 1WE5A 2RGMA 5I0DA 2J7FA 1E6PA 3U7VA 5CXPA 1E6SM 2WXDM 3WBAA 1ITXA 4KWUA 4UQEA 1UR0A 1WZLA 4JL1A 4MDOA 1H11A 1V0LA 3W81A 3AJ7A 2WANA 1PX4A 4PMYA 1A3HA 3SCVA 4EK7A 5C8BB 1D7FA 4Q7NA 1QNSA 1SMAA 5A6BD 1JI1A 3PZTA 1JDDA 1S46A 3ARTA 4D6DA 3OA5A 3VPLA 5A8PA 2VX4A 5A6JA 2XVNA 1ODUA 2JIEA 5CGMA 3SCUA 1E3XA 4W88A 4W87A 3WDJA 5DMYA 1UQYA 3ALFA 4BA0A 5CSYA 4W8LA 1CYGA 2DQXA 1ZL1A 1AVAA 4UNIA 3EDKA 3UETA 4ZFMA 1WZAA 5LA0A 3CUGA 1W9XA 2FGLA 4UFJA 1XH1A 3T2PA 3T2QA 3VIOA 1TUXA 1ZJAA 1B30A 4AIEA 1H2JA 2WMIB 1CENA 5F7UA 3O9NA 2WSPA 3KEHA 2FGZA 4GQQA 3U7BA 4PBGA 3IJ9A 2DSUA 1UKTA 2YBTA 2QMKA 3MV01 2EEXA 3AS1A 4MJ4A 2QLYA 2Y2WA 5A8MA 1E0VA 3AHXA 2ZWZA 1DWGM 2J7CA 2Y8KA 3MUY1 4E4PA 3PBGA 4H8VA 1V0KA 3FY1A 2DSZA 3OLEA 3VILA 3SIMA 3K8KA 1G94A 1UWQA 4P8WA 3VM5A 4WSJA 2CHOA 4HU0A 2PWFA 3SCWA 3VIIA 4GI6A 1B3ZA 1ESWA 1MW0A 2WZHA 3APGA 4D6GA 3VD3A 3W29A 1J0JA 1GNXA 4OBRA 4JL2A 1K9DA 1OSEA 3WUGA 4DM2A 2WM0A 1E0XA 3VOCA 1WCGA 5JBDA 5I5RA 1RH9A 3WD1A 2XYLA 1C93A 1BYBA 2DSKA 1BTCA 1J0ZA 1UD4A 5KEZA 2NW0A 1HJQA 1XYFA 2V3DA 2FHFA 4LXFA 2EPMX 9CGTA 1JGIA 2E9BA 2WMHA 1BYAA 1ZU8A 1JD7A 2UY4A 7A3HA 3TTOA 3ZT6A 4DM1A 3ZR6A 4MAZA 6TAAA 2V3EA 1JDAA 4WIWA 1CGWA 1B0IA 2VURA 3IAQA 5IFTA 1SYTA 5ECUA 4M82A 5FIPA 3L4WA 2J78A 4JKLA 3T0BA 3VIPA 2XM1A 1B2YA 3I3BA 1FP8A 3SCOA 2YJQA 3A3HA 2BY2A 2G41A 5CZKA 1TA3B 2CESA 2CNCA 4B9YA 5JIWA 1E43A 1Q6GA 3M46A 4JFSA 3ZT7A 1AQMA 1UD6A 3EDEA 1UKSA 1W9UA 3B9EA 1E73M 4CKQA 4OZOA 2G3MA 3GYCA 1BHGA 1JZ8A 2C7FA 3AIRA 1V6WA 3QR3A 1HX0A 2OWXA 4R27A 4ZXOA 2CXGA 3VMNA 1IZKA 5CSUA 3CHCA 2ZUWA 1HJSA 2PI6A 1U2YA 1QVBA 4QCFA 3ARWA 5A8QA 2FH8A 4JKKA 5A6SA 1NARA 4UCFA 3GH5A 3CHEA 5BXTA 1HJVA 3GBEA 3AIBA 3CMJA 2GJXA 3BCDA 2GK1A 5DT5A 1XH2A 4AIOA 5E6ZA 5E70A 6CGTA 3PZGA 5CPSA 1ECEA 3AICA 1HN1A 2VOTA 3AFBA 4J3TA 3AMCA 2JF6A 1CXEA 1E9LA 2WC3A 5A2CA 1JYNA 4DUXA 1EDQA 2YOCA 2F61A 2WKLA 3RM8A 1LL4A 3FW6A 4PTVA 4D1JA 1MXGA 4OJYA 3NYDA 2QPSA 1UWTA 1OGBA 2A3AA 2J25A 2VJXA 1XHGA 1W9PA 4TTUA 4H41A 4AISA 3RM9A 1W9DM 2ESCA 4JCMA 4N42A 2PWGA 1W2PA 3VIJA 4HU8A 1HP4A 3VD4A 5IHRA 3UERA 1VFMA 2UY2A 1FA2A 4BF7A 2WVSA 4C7FA 2E40A 3VIGA 1J9YA 4H04A 5BXSA 5ABGA 1MQPA 1H0IA 4UQBA 1M03A 4H2CA 1C3FA 4WLCA 2B31A 2DT3A 3KE0A 5C70A 4A3HA 1H5VA 2E3ZA 3TOPA 4U33A 3T08A 1L8NA 1UR4A 1W3JA 1QI0A 2G3IA 4HMCA 4F9DA 3ZJ7A 3WUBA 3U57A 3AXIA 1FP9A 1UKQA 5GNYA 5FOOA 1J01A 4HA4A 4DWSB 1UD3A 5TD4A 2CCRA 2VZVA 1XD0A 2Y24A 4D72A 3T0AA 3BCFA 4M81A 2WMFA 1B31A 1DTUA 2W63A 3L2LA 4OIFA 3WFZA 5I2UA 4UFHA 1VEOA 3NSXA 4HZ8A 2VQUA 3FXYA 3VGGA 1NQ6A 4LYPA 3QHMA 3GNRA 1L0PA 4J28A 1NOFA 1PIFA 2D22A 4PSRA 1CXHA 4CUCA 2QF8A 2YDQA 1HKMA 1WNOA 3IAPA 2W5FA 3D5HA 3EDFA 3SCNA 4FLOA 2D2OA 1RP9A 2UY5A 1QI5A 2VX5A 2VX6A 3TP4A 3SCTA 4BQ4A 3A4WA 1WAWA 3AZTA 1V3MA 2WPGA 2XG9A 1VF8A 3SUVA 2VUYA 2GDUA 4LYRA 5BROA 2YA0A 3CHDA 1W1TA 4UR9A 4MADA 4QAWA 3WDRA 1DEDA 3BC9A 4TX8A 5I3DA 3EDJA 4TUFA 4CN1A 1FFRA 5FCZA 4U5KA 3N15A 4PMRA 4WF7A 3D3AA 3FHAA 4QLLA 3CTTA 1GW1A 1KGXA 4HZ6A 2J7BA 1JNEA 1EHAA 1BGAA 1CGYA 1EDGA 2GVYA 3SCRA 3RILA 4WK9A 4CN4A 4ZENA 3RJYA 1KXHA 3K8MA 4OOUA 2YDRA 2OSWA 4WKHA 2DH3A 3UEQA 3AHYA 1V3JA 2WCAA 2GJRA 1E5NA 1V03A 2X8RA 2D23A 3HJEA 1XSJA 3OZOA 3BAJA 1AQHA 2WAGA 3WQ5A 4D6JA 3MV11 2ZIDA 1RP8A 2VMFA 1W32A 4FLSA 2WLYA 3UR7A 3WENA 3B8SA 4QDMA 4NSBA 1V3HA 4PMOA 2ZOXA 2DT0A 3ARPA 5ABFA 4D6EA 3LMYA 3AROA 1EIBA 4URIA 5DT7A 1HKKA 2VR4A 3AMDA 4MNKA 4F79A 4BZYA 3N13A 4ATLA 1V0MA 5I23A 1UH2A 1DHKA 1QW8A 5A8OA 3LPOA 4UFKA 5BXPA 1JL8A 3OGRA 3PZVA 1BSIA 3FHQA 1UWSA 4MPKA 4W7UA 4C7GA 2YL5A 4M1RA 1C8QA 4P8VA 2BHYA
chains in the Genus database with same CATH superfamily
4UBPC 3G1AA 4IFOA 1A0CA 2CW6A 1KR1A 5J04A 4MVAA 1I0BA 3FYYA 3VGBA 2EF9A 1E1FA 4GY0A 4U28A 3T1GA 1XRFA 1BEUA 1YNYA 4L65A 2V38A 3PK7A 1B1YA 3AI0A 3R13A 2FDMA 3WKZA 2G37A 2EG7A 1QMLA 2VCBA 2YDAA 3VMPA 3VGDA 4AX7A 4JFVA 3B4YA 3ZWTA 1XRVA 2PWEA 2E6FA 2QAFA 1U1UA 2CBUA 2O9PA 1HF6A 3NOEA 2V67A 3WFAA 1RK6A 1BGGA 3AWNA 1GORA 2V5BA 1W9VA 3KOFA 3JS3A 1IGSA 1EXPA 3WX7A 1ONXA 3F4CA 4NNBA 2EXOA 2ISVA 2IKGA 1XDLA 2QYGA 5AOUA 4O10A 3DYPA 4Q8TA 3CV7A 1KTNA 4LANA 5TF0A 1UWIA 1KXVA 3OYXA 2LLEA 1BFNA 1FY6A 3VIFA 1ISXA 3T0CA 4WZHA 3N2OA 3UBPC 1RK5A 1A5OC 2FZDA 2V63A 1XBVA 4HJFA 3UZZA 3W1MA 5F1VA 1S2CA 5CGTA 1RCQA 1A80A 1FVPA 2A5HA 3RDKA 4ACZA 1LQAA 3CZ8A 3WH8A 3KVKA 2RHGA 3HBLA 1H7XA 3HMJG 1TE6A 2FQIA 1SO5A 4LRTA 2QF7A 4HBKA 2ZRZA 1RXOB 1RHCA 2PEVA 1Q7QA 4AZHA 2E9MA 5DELA 5DRIA 2VZSA 2D2GA 3C0LA 4BWLA 2CZEA 2G4JA 2W66A 3VMOA 4W7VA 4D8AA 2HXUA 1CGUA 3HM7A 5JXQA 5HWJA 3SECA 3NZQA 2F7FA 3WJZA 1SQ7A 1F61A 3GTNA 1KGWA 1ZFJA 4PCSA 1SGJA 2ZUSA 4KFPA 2FPVA 2G4FA 3S1XA 1XGDA 3BL3A 3W2NA 2CLEA 4B5VA 1IYXA 5A6BA 3P2VA 4QRNA 4O0ZA 1REQB 1R5YA 3QYQA 3W4RA 4YL2A 3UWQA 2YL8A 3EB3A 1QNQA 3H2AA 3VNIA 3KS6A 1KFCA 2GJNA 1AL7A 2VYOA 2XSBA 4XUYA 2ICSA 3GRIA 2H3DA 3HPZA 3TQ0A 2QW5A 3VKDA 2J4GA 3QFWA 1H7NA 3K46A 1C7TA 3O6AA 4UOQA 5HJYA 1OQFA 4WHBA 4NASA 1UP2A 3A12A 5KTLA 4IICA 2WC4A 2G50A 3MWCA 2E67A 2NLIA 1UMLA 1PKLA 1DKWA 3E02A 4TXEA 5G4EA 5LHEA 1CECA 3Q37A 3EX2A 2PMQA 1GVRA 1O1HA 3MA8A 3Q58A 2GSHA 4H9MA 1J10A 1W56A 5KETA 3ORWA 4PN2A 3KX6A 2PP1A 4LVAA 3EDDA 1FHDA 1H1NA 3BOLA 4HMDA 4BKNA 1PCWA 2HVMA 4M6UA 1SU5A 4NP7A 1RPKA 1YX1A 2VC5A 1PIGA 3SGGA 2PDLA 3UGRA 2NX9A 1QK2A 3O8AA 3RMJA 1J11A 3E5BA 1FFQA 1E9YB 1JPIA 3UCCA 2VCAA 2OG9A 2TRSA 1GKQA 3V0TA 5FJPA 3R79A 1ELSA 5F2LA 4JNYA 1C8XA 4EF8A 4DQWA 1C8YA 1VB9A 4F8XA 5AKQA 1W2VA 4W89A 3M07A 4WGHA 3RX4A 1D8WA 2F6UA 4BF9A 1ZALA 3S46A 3UWZA 2EPOA 4Z08A 3ITXA 2ZX8A 3H4WA 3NQMA 2GJPA 1IT8A 1BG9A 1ALDA 1TPC1 4Z2JA 3TA6A 4KGLA 3B03A 1LUCA 4IPLA 4J4KA 7XIMA 5L9FA 1ICQA 3HG4A 4KCUA 5DY3A 3VC5A 2WBGA 3QMSA 2BHZA 4Q33A 1T8XA 1C29A 5BRPA 3DESA 4ZGYA 4KBXA 2YIHA 3RM4A 4FNRA 1F3XA 1K9FA 3W82A 3RPDA 2VWSA 3BZGA 3A24A 2WMGA 1JI2A 1Q6LA 3WEOA 3NL5A 5FSDC 3OVGA 2ACSA 3OLGA 4D1IA 2QT3A 2VFHA 3QLDA 1RBOB 2YFOA 1S2WA 1FCUA 3TYCA 3VAVA 2ZRYA 4GKTA 4N2YA 4L9XA 2AL2A 3M6DA 2FPTA 2PC8A 3ATYA 3GVGA 5E93A 1OADA 3DOPA 3N11A 1X38A 3H4GA 4GCXA 4QSHA 2VKZG 5HR7A 3PTDA 5I07A 3F2CA 1ODZA 1FWRA 4BQ5A 3UJFA 1LRNA 3S1UA 3OLIA 4U3CA 1RLCL 3AJXA 2QCCA 2BP1A 4UIOA 3THDA 5C5YA 3CYJA 4A3QA 4DX3A 4KWWA 2Z7KA 4C65A 2WCSA 4UZSA 4GIEA 4N0RA 2OWWA 3WQOA 3VDGA 1W8GA 3FIGA 1XCXA 1B5TA 3OGSA 3A4AA 1NQKA 5CZTA 4R53A 1LWHA 2NQJA 3KRSA 3NO3A 2PWHA 3WQVA 2J27A 4ZE5A 3VDHA 2J75A 2Q02A 5HANA 1VBJA 3N12A 4JIQA 2F8QA 2HJPA 1HO4A 4UTFA 4FNPA 2IPWA 4LCSA 1C91A 3CQJA 1MUWA 5LNRA 4HPGA 2DORA 1XYZA 4QROA 1X6LA 1UZ1A 1YE6A 2VHLA 5EFDA 2WHKA 1LLOA 3L7RA 2G8ZA 2AKMA 3LEPA 3V0UA 1KBKA 4QM1A 4PMXA 5U7SA 3K30A 1XQKA 3BLOA 5C55A 3WBWA 3TQKA 3QM3A 1G9HA 2O55A 3FSTA 1DXIA 3KBMA 5AC6A 4JYFA 3STGA 2GOUA 5LA1A 1V3LA 3P67A 1KRCC 4DYJA 1KRMA 3S83A 2CKSA 4DF2A 4YCOA 3IIXA 1ZRQA 1V0NA 3W7QA 5IM51 5DBUA 1XPGA 2ZYFA 3CB3A 2WQPA 1DJGA 1LF1A 2ZXDA 4NF7A 1VRXA 2JBMA 3LRKA 1GJPA 3CL6A 1SFSA 1EBHA 1OABA 1FWJC 1R2TA 3Q4DA 4MSSA 1M68A 1Q45A 1GEQA 2PDHA 3L65A 3OODA 3P3BA 4M1BA 3GD6A 4JQ4A 3T42A 3DFHA 1FWEC 3NPUA 4B5WA 3SUSA 2GL5A 4HB7A 3UJRA 3WL1A 1D3CA 4KERA 2WNNA 1WXYA 3T40A 3COTA 1ZSXA 5DCDA 5A95A 1NJJA 3N19B 2CYGA 3ECQA 2RJHA 3WZ0E 1KV5A 1OT1A 1SO3A 5A6LA 1JDCA 1IV8A 2FIQA 2XM2A 4WJXA 4E6MA 4YNGA 1O5XA 2NUXA 4MFEA 1W5NA 3EGJA 3K2GA 5K9CA 1H7OA 1TVNA 3RMEA 4UTTA 2OKOA 4ACZB 3H2MA 5A2BA 4GOAA 1K3UA 4KCVA 4JAWA 5BWFA 5I3JA 5REQA 5FF0A 1T6MA 3S9YA 3BLLA 4X9YA 1FKWA 2DW6A 1QHZA 3B8IA 1Z42A 5HK4A 1MI3A 5G1MA 1VIWA 4N9DA 4WY0A 4W9TA 2J9ZA 1Z3NA 3RJXA 1DORA 4EVZA 4V27A 5E6YA 2HQAA 3TNBA 1GWJA 1KM3A 1E4LA 2A85A 1JPHA 1U33A 3NQBA 2A7NA 3CK5A 3WBXA 1KM2A 4BQ3A 4GJIA 4NJIA 4Z1AA 1Y5VA 5JVLA 4MG4A 1HGWA 1XWYA 2IPJA 4V2XA 2VRJA 3ANYA 1IWBA 2VZOA 4Z17A 3ARUA 1V6VA 4PGLA 3SUUA 1EFZA 4Q6XA 3SBFA 1WUFA 2HMCA 1AFSA 1TWWA 4PYSA 2HROA 3OW1A 4XSMA 4LS1A 4LEFA 4DPPA 3KS5A 2ASHA 1N7KA 3BLPX 1PPIA 1GCYA 2FTPA 4G1KA 4PULA 4O4WA 2A21A 1KFWA 3L67A 1JR1A 2B81A 3W6YA 4L4OA 1Q7ZA 1TPVA 3W2JA 1EOMA 3GM8A 5D2YA 1BXBA 1T5AA 4PODA 4LPCA 3SQMA 3NVDA 1KCKA 1X96A 3EYPA 5CPLA 2PUZA 1HTIA 2PDGA 4GO8A 5XIAA 4HU3A 4ZOEA 1Y7VA 3MBDA 1YQ2A 4HYRA 5DY2A 5HQLA 3PR2A 3R10A 3BV7A 4MZ8A 1VKFA 4DLFA 1OFQA 3CH9A 2INEA 4A3YA 2GQAA 4JOMA 3U5UA 4UQCA 2VFFA 4O52A 4XTIA 4YMZA 2J8GA 2ZUMA 4EXQA 4E3VA 1XSKA 2PTDA 1K4HA 1WZKA 2XN0A 4HCLA 3PS7A 5CJ5A 4MWAD 2W3ZA 2X1RA 3QSRA 4CU6A 1KFLA 2VT0A 3DYOA 1E4MM 2FZ9A 4HK7A 1VPQA 3HG5A 5M03A 3DG7A 1ADSA 1TJ0A 3QPEA 3TEVA 4RNHA 2F6XA 3DKJA 5EYWA 2GQ3A 3BAXA 3PSVA 4I6VA 5JUVA 5M3WA 4XZIA 1E15A 4I9MA 4QISA 2HWGA 3BO9A 3TCSA 3KRBA 1UH4A 3WEZA 1T8QA 4O0QA 1SW0A 1XLKA 1X1NA 2YBUA 2WO5A 1I60A 1NOWA 2NZLA 3PZMA 4OWGA 2JE8A 4Q22A 1RQHA 3NSMA 1LUCB 1F5ZA 3GLCA 1FWFC 1T41A 4QQUA 3G0UA 4WRHA 2Z1VA 3CAQA 2TYSA 3AYTA 1IT0A 4UTIA 1R3RA 3LGDA 4G56A 5KZ6A 5BOEA 3WD4A 4MNJA 4B9ZA 1AG1O 4FALA 3DX5A 4LT9A 2OZ3A 3H4XA 2VFGA 5LIUX 3S3GA 1JUKA 3WQPA 3EX6A 5FEZA 3LHVA 5I3IA 3THCA 1QU4A 1VHNA 3QHNA 3DI1A 4IX0A 1JXKA 4I7UA 2VGIA 1LLWA 4MB1A 2X7VA 2AL2B 1P0KA 1S2VA 3WJYA 4DUVA 1EJUC 4Y9MA 1H5YA 1XR2A 1GZ1A 1JYWA 3DC8A 1HJXA 5AECA 1PZ0A 4Z2LA 4ACYA 3LM7A 4FNQA 2E1DA 3M44A 4AD0A 3QV8A 3UCQA 3V16A 1Q6QA 1XIDA 3UNDA 4J27A 2J7DA 4ZOAA 4WD0A 1NU5A 1T96A 4HZMA 3CWOX 5HMFA 1WDWA 3V75A 1GTEA 3W1UA 2DFAA 2JEQA 3WJWA 2VC7A 2EG8A 1GQIA 5C9RA 4DBUA 1A4MA 2HS6A 4KT2A 1ZS2A 3HIJA 4ZB0A 4A4AA 2WZIA 4MZYA 2E6DA 2OSYA 2C15A 2DSWA 2E68A 3C5QA 4W5UA 3QMTA 4GC4A 3BARA 1UWRA 2QDEA 4NZ5A 1J0YA 3QEZA 1EEPA 1LOLA 3CNYA 1OCNA 4YTQA 5AZ1A 4CCZA 3IUHA 3VZZA 3TTQA 1TZZA 4QG6A 2D20A 4E8DA 2YKKA 1Q6EA 3WLSA 1XFBA 1VBHA 3RNDA 2OZ0A 3WMCA 4IUGA 4XAZA 3WF1A 3UPMA 3FCPA 4UFLA 1H49A 1TE1A 4OBTA 4GJ1A 3CB8A 5CQ1A 3DFTA 2O4QA 1LL6A 1IR2A 5L6UA 4QJ4B 1YTEA 4LY8A 2QS8A 4GUGA 1WOAA 3MKCA 3S5SA 2PWUA 1T99A 1QPRA 1JUBA 1V7AA 4J1OA 1KBBA 4GYPC 1E6XM 1LBLA 1Z41A 2AQOA 5CPTA 2RDWA 1QATA 4JEQA 4JY9A 3TVAA 4DN1A 1S1PA 2JEPA 3IJ7A 4W8AA 6ENLA 1E70M 4QE1A 3IPWA 1J4EA 1BLIA 1TJ1A 2GUYA 1LM1A 3BUVA 2GGIA 1EQCA 4ERIA 1CXIA 1UR9A 3MS8A 3TH6A 1B9ZA 1KV8A 2ZX7A 5T9CE 1R3WA 3AIQA 1JPMA 1TR1A 4UTMA 2VZUA 1IWPA 2ZCGA 4DAIA 3O07A 4RZ4A 1EEXA 5EL1A 3W6MA 4M51A 3GNNA 2RDUA 1VEMA 1J0HA 2GPTA 2OR2A 3PTKA 3VD7A 1SR0A 4UMCA 4B2DD 3A9BA 1Z32X 3G8EA 2QUUA 4L5ZA 2DT2A 3T2OA 5REQB 2XIBA 2BODX 2QCLA 2OPJA 2NV1A 5CPOA 1R46A 5C2XA 3W38A 1ZLPA 3N04A 5GVJA 1E0TA 4HCHA 5FJOA 3VNYA 1OT2A 2QCNA 4AH7A 4MMWA 3S2NA 5BMWA 4WY0B 1UR8A 3NOYA 1TTJA 2VVSA 4ATWA 3PJXA 3ZSSA 3B9OA 1QK0A 1M9HA 3T6CA 2ZXBA 1B3WA 5C9ZA 3RCMA 2H8XA 4AY8A 1SZRA 4YVPA 3ITGA 4UB9A 1WUEA 2PLCA 3A4JA 1A5UA 1E4IA 3I6EA 3D6NA 4AIUA 4HK6A 1QOPA 5LKYA 5LIXX 5GNZA 3TZFA 2QAPA 4Q4PA 1XIHA 1KTBA 4ZB5A 2QNEA 1POKA 1E5JA 3T55A 1TYGA 1W1A1 3LY0A 4G5DA 4DZHA 1TPWA 1QNOA 4LVBA 2BASA 1G0CA 2X1IA 4V33A 2AOSA 3WK0A 3CMFA 1TJRA 2FZ8A 3RCNA 1YBQB 1MO0A 5GQBA 4B4FA 3AYRA 4M29A 3NJ3A 1QI2A 4TTGA 5HR6A 5MHBA 5DMMA 2A2IA 2G0WA 1R3SA 3N1AA 1Z69A 3IK2A 2C1IA 5CSSA 4AMCA 1IF2A 4XO7A 4KEUA 4NJJA 1I8JA 1KC7A 2VDIA 1O7AA 1R85A 4JD4A 5FF3A 3GC5A 1OX6A 3VGHA 4XD3A 4GVHA 3I7QA 1KR0A 3MCOA 4DBEA 3LNPA 3LQGA 2OWCA 2XIMA 1Q3NA 3L4UA 4REQA 3TW9A 3W6LA 3FS2A 4UTWC 2YCJA 4JS3A 4F0LA 3LMZA 2YA1A 4PUMA 2V2HA 1R9ZA 4XBSA 1NAL1 1IHIA 3IEBA 4GIAA 2WZEA 3A6OA 5EMUA 4B5NA 3DYMA 2PRMA 3SJ3A 1ZBVA 3PPHA 3W84A 4QX4A 4RNFA 8TIMA 4J40A 4YU1A 1AW2A 4CCCA 1WE5A 4GA8A 2AQWA 2RGMA 3BLEA 3AWOA 1FHVA 1E6SM 3ZWSA 5KMYA 1TV3A 4KWUA 1GK8A 2WANA 1PX4A 5AC8A 1TWIA 3SCVA 4DUOA 5CAKA 3O1NA 1SZEA 1JI1A 3EWCA 4GYJA 3GNDA 3MQTA 4IIBA 1EC8A 3AC0A 5C6MA 1EP3A 4BJHA 4XAFA 1H7RA 4BA0A 1CYGA 2DQXA 8XIMA 5HA7A 1KFBA 3QY8A 5LA0A 3CUGA 2PDBA 3SRKA 2FGLA 5HMDA 3T2PA 3GIYA 1ZJAA 2IW0A 4HNLA 2FGBA 4GQQA 3TK7A 3QN3A 3CQKA 3EKZA 1WOBA 1UBSA 3ITLA 3FVMA 3N9RA 5AZ0A 1SFTA 2YBTA 1KD0A 2FJKA 1X1ZA 1M3UA 3RR1A 1DWGM 3MDUA 3R8RA 4E4PA 1DJQA 3DFSA 4R85A 2VFDA 1D8CA 3EPNA 3QKZA 3OLEA 5J8LA 3R8HA 1G94A 1M7PA 1UWQA 2YPIA 4H3DA 4HPJA 4WOZA 1XIGA 4WSHA 2DQWA 3SCWA 1B3ZA 5LNSA 3APGA 1ZJIA 2C18A 4KPLA 1EB3A 1OC5A 3JRKA 3N14A 1J0JA 4A8LA 3PAOA 2XZ7A 3ITCA 3W1XA 4LAOA 4DM2A 3VOCA 3T81A 4LV9A 1C93A 2BG5A 3U4FA 4J2PA 2WSQA 3ME3A 2EPMX 9CGTA 3PFRA 3W87A 3P81A 1BYAA 2I7GA 1F9CA 4TR9A 1OVDA 7A3HA 1P0BA 3ZT6A 1LWIA 3ZR6A 4NVTA 2I14A 1TIWA 5DXXA 3L4WA 2J78A 3BQ5A 4JKLA 3GR8A 1PS9A 3LS9A 1KLYA 3OJGA 2BY2A 2G41A 3B05A 3S6OA 4FPSA 2CNCA 1E43A 1UD6A 3B9EA 3U2CA 2ZTKA 2G3MA 5HUOA 2PGRA 3AIRA 3NL6A 5G2WA 1V6WA 4S39A 3DFPA 3QR3A 4FOJA 1HX0A 2ATMA 4UWMA 3FOKA 1VCFA 2PI6A 2GOKA 3VE7A 5T9BG 3ARWA 1E9ZB 1ECQA 5DX7A 5C54A 4UTKA 3M0MA 1XBZA 3MZNA 3GBEA 3CMJA 3DG6A 1RZMA 4IZGA 3UXIA 4YWIA 2R1LA 1QWGA 3KOWA 1O60A 3SFKA 3H2CA 3IGHX 3TW7A 1EDQA 2WKLA 4WVXA 1QO2A 5KSWA 1UWTA 2Y70A 4KFNA 2D2HA 2J25A 4FXJA 1W9PA 5AVHA 3GS6A 2EKCA 1IIHA 3ATZA 2ESCA 2KAUC 3PBWA 3LGEA 1HP4A 2OLSA 6XIAA 3VD4A 4TO8A 1FA2A 1K70A 4HNTA 3SSJA 3GVRA 5H8UA 1AK5A 4TV5A 3HPFA 2QKFA 1TV5A 3U2EA 4UQBA 4GBUA 4HNNA 4AYGA 2VGBA 2CZFA 3GWQA 2NUWA 3TE9A 4WLCA 2B31A 5C70A 4U33A 3STEA 2P3ZA 2FFIA 1EX1A 1QI0A 4Y8EA 5FOOA 5C9WA 3DAQA 4FNTA 5G4WA 1F8MA 2ZC8A 2Y24A 3MY9A 4D72A 2E5CA 3UF9A 3T0AA 4AF0A 2INFA 3BCFA 4K7YA 3DGRA 2WMFA 5FJUA 1B31A 3UR2A 1WXJA 3QTPA 3WFZA 3BVJA 3CT2A 1XLMA 4X3ZA 5T91A 5DANA 4HZ8A 2VQUA 3VGGA 4LYPA 3QHMA 2UBPC 2NQZA 1R47A 4Q32A 2QIIA 3A64A 3YPIA 4QJ5B 1B54A 3L23A 2IKJA 4HK5A 4IGMA 4TU1A 3KBVA 4HHLA 1RP9A 2VX5A 2IKHA 1TQXA 4NUWA 2OZ8A 4BQ4A 3MJYA 2PDWA 1P1MA 3NM1A 5K4XA 3ZFHA 1WAWA 2XG9A 3QV6A 4N9EA 2VUYA 5BWAA 2GDUA 2C1HA 3NQ8A 4MYXA 4MADA 3WDRA 3NEVA 5I3DA 4TUFA 1FFRA 4CQ9A 1UZHA 3N15A 4PMRA 4QG8A 4AB4A 4FXSA 2XGZA 1GW1A 1KGXA 3KVJA 1ZNNA 4ZMGA 4QQ3A 3C0JA 1QUMA 2OEKA 1AUSL 2AQVA 4WEVX 2GVYA 1BGAA 2TMDA 4F0HA 2DZTA 3NQ7A 4WK9A 4CN4A 1P1XA 4ZR8A 3OHMB 3RJYA 5AYZA 3RK8A 1IE7C 3W7LA 4H01A 3UEQA 3AHYA 1AZ2A 4I90A 2OMAA 5A6TC 4YCPA 1XLFA 3BAJA 2ISDA 2OO0A 3MV11 2ZIDA 3WQGA 2VMFA 1W32A 4FLSA 5D2TA 1OFOA 1J5TA 1UPMB 3B8SA 4QDMA 5ECVA 1QXLA 4QGCA 1NTHA 1V3HA 1DPMA 3ARPA 5ABFA 3LMYA 3AROA 1EIBA 3LUTA 4J3ZA 3NAVA 4L1XA 2ZA2A 4L1WA 4MNKA 3MYOA 4BZYA 4UTLA 4F0RA 2VELA 4QBXA 1QW8A 2WV8A 1K8CA 3TC6A 3WQEA 1JL8A 5AB3A 1UWSA 4W7UA 3GNXA 2DVTA 1L2QA 3UU0A 2HNEA 1H50A 3KDOA 1FP9A 4J7RA 5K9DA 3OEXA 1XIMA 1HT6A 3KTXA 1A5BA 3AYSA 2XZ9A 4BCEA 5JMUA 3Q67A 4W84A 4X9SA 3R12A 1JCXA 5LNVA 5GJNA 2QMJA 2NVAA 5FL1A 2FJUB 1NDZA 4OT7A 3OVRA 1FDZA 1DWAM 3BURA 4JTIA 2JALA 1LRQA 2WVTA 3ANUA 5AYXA 4LX4A 3WF3A 2V5KA 3SN4A 4IOTA 3ARYA 3W88A 2B7PA 3RN6A 3SIZA 2XISA 4P2VA 1J6PA 1Q7MA 4IHCA 4NQ1A 4C6KA 3OOQA 1JUEA 3OPSA 1VBUA 3LHUA 3QJAA 3VTRA 4HNOA 5D9NA 3AMGA 1ADDA 1Q2RA 3IACA 1UC4A 1L6FA 4UTUA 1EJSC 3E0IA 4NL1A 2VGGA 1R8LA 1O12A 3DKLA 1O95A 2E09A 1ISZA 4ZODA 4QIUA 1WA3A 1IR1A 1KM1A 1JYXA 4AD1A 2XN2A 1MSSA 4R33A 3VX0A 3T0DA 1XUUA 3I4EA 1GPFA 3C2OA 4OOZA 4FOKA 2DSVA 3BXWA 3UA4A 1CGVA 4KEVA 4LFYA 3W25A 3N73A 2J8TA 1W6TA 1O4UA 3LV6A 3DEQA 3VFLA 4P8XA 4YVXA 1R86A 1RUSA 1TB3A 2CLMA 1RCOB 2IXUA 1UH3A 1X6UA 4TVCA 4G9PA 2Z29A 2W6RA 2E5DA 3ES7A 1DJIA 4L4LA 1IT7A 3SJNA 3M43A 2D73A 4PUDA 3SCQA 1XLCA 1XBXA 5LA2A 3W74A 1MQQA 3QR1A 5C2CA 2EGZA 3AHTA 4DJDA 2XSXA 1VFUA 3CC1A 3PZIA 4K8GA 2QXWA 4OUIA 4XZNX 3L68A 4U10A 1FWWA 1NVMA 3F2BA 1GKPA 3B8VA 3WYZA 3RGTA 3H21A 5D9PA 3P80A 1EJ7L 4O1AA 2HS8A 3DECA 2C19A 1V6YA 2BBFA 6REQA 5TNVA 3E0LA 4A8IA 2OOGA 3NDYA 1PTDA 5DF0A 4OV9A 1R9XA 1XIBA 2A1YA 3AHZA 3CV6A 2P53A 1CI1A 5IDIA 2DIEA 3N6HA 1UD5A 1B4EA 2VD9A 2WMKA 1JNDA 3A23A 2VCCA 3P0WA 4X63A 1X39A 1UUQA 3GDLA 3W53A 3LTPA 1EP2A 5HPCA 1X1OA 1QNRA 3W24A 4XK2A 1OZMA 3A13A 1BTMA 1B3YA 5H2ZA 3MP3A 1K7FA 3E2QA 1UJPA 3M7SA 4XKYA 1QOQA 4HU4A 3TYUA 2P76A 4B4HA 2D0HA 5HMEA 2VEPA 3W73A 3VA8A 3PTQA 6XIMA 1K6WA 1OIFA 5AC5A 5IXEA 2PCQA 2GGJA 4NRSA 4LU0A 1E6QM 1FX6A 5I77A 2V3GA 3O3RA 3LPPA 1J96A 3OZMA 1H51A 3BICA 1A5NC 4HIBA 4PMDA 3WH5A 3O7UA 3GVQA 1VLWA 2HPIA 2OOFA 2Y0FA 1DWIM 1HL2A 4AWEA 1PHWA 3UZWA 3TV8A 5F1UA 4EPKA 4M5PA 4RE4A 3MU7A 1UR2A 2WVVA 1ZBKA 3UPBA 1GQJA 2XTKA 3MUZ1 1TCDA 4O4VA 4MF4A 2W27A 2O9OA 2GUBA 3QRHA 1AH4A 3S2CA 2J7HA 3B40A 2Y62A 1IXOA 4FLQA 4AU0A 3GQYA 3ZOAA 3WELA 1SSGA 3H7UA 4I9JA 1EJXC 4YTTA 4BR1A 4JX6A 3UNTA 3RLGA 1D9EA 3TSBA 1GZJA 1FDJA 2A6NA 4IG2A 3QW4B 2Z2AA 4Q8NA 1FKXA 4F0MA 3ABQA 4IFRA 3QY6A 3MMUA 3WUFA 5K2ZA 4LAMA 3UVIA 5M2FX 3HQPA 1WKYA 4PUEA 5KITA 1ZZMA 1LOQA 1HJUA 3QF0A 3ZQ9A 4F48A 2YCKX 4AF0B 3UG5A 2BB0A 3BLDA 4A2RA 4CU8A 3HB9A 3IGSA 3EAUA 4NY2A 2PA6A 3MYPA 3GHRA 4KCWA 4UFMA 3REQB 1MNSA 3G0SA 1YRRA 4QR6A 3OBAA 3CASA 1LDCA 2J88A 1WV2A 6ALDA 3WL0A 3MUCA 1K02A 1DE5A 1QHOA 3DHFA 3B9NA 4DWSC 5G5IA 4QTGA 3SUTA 1LCOA 4BI6A 1YE4A 4CD6A 1B9BA 1V6UA 4LB3A 3FKRA 4Q8MA 1OCJA 1M7OA 4XIAA 4GMEA 4IXXA 4JCLA 4OUEA 4QP0A 1HO1A 2PSNA 1SM9A 1XISA 1L6WA 3PG8A 3PWIA 3M9YA 4AZ7A 4INFA 3PANA 3L2IA 2NT1A 2FZNA 5EMJA 3WH6A 4EKJA 3KCLA 4YN5A 5KZEA 1H0GA 1QW7A 3GFZA 4Y9NA 2PPGA 4ERAA 2Z27A 2WNZA 1KM6A 3GXPA 3URAA 3CO4A 4M7TA 1L9WA 4QSFA 3C8FA 4TX9A 1QCWA 3IUIA 4LS0A 2BOFX 3QOKA 4O53A 2GWGA 1E6RA 3QQWA 2J66A 3LLDA 4KEZA 3M47A 3NCOA 1F4AA 3W7IA 3GDKA 3GKFA 2XIIA 3VKBA 2OEJA 4ORIA 3ZT5A 5ABFB 2GVJA 3SY5A 3HPAA 9RUBA 4IJCA 5EGRA 5AHMA 4NNAA 1WQ5A 5I02A 3IJ8A 1KBIA 2DU2A 2XGIA 1JIBA 4MJZA 1EWEA 3UZJA 2GZXA 1PKMA 4PMVA 4WKFA 3QQ1A 3OGVA 3CPGA 2X0YA 5I06A 2BOEX 2D1ZA 2JKPA 3W27A 3EPOA 5EMLA 4P5UA 1FH7A 7CGTA 3ZVHA 3TJ4A 4ZL1A 4Y90A 4PTWA 3KOXA 2OYMA 3CUFA 3S2JA 3VNJA 4F0SA 3RUBL 3P84A 2X40A 1DQXA 1DP0A 2PBOA 4BS0A 5A1AA 1NH6A 1S38A 4IWWA 3ZJ8A 1IEXA 1OCQA 3KWSA 4DJEC 1VFLA 4LW7A 4FK9A 1DOSA 3RX3A 4I7WA 1K9TA 3ARXA 3N25A 4IIHA 5F2MA 4PRWA 3R58A 4US5D 5AYYA 4HP5A 4AHOA 1GJWA 4YYFA 4GXWA 3GX9A 3WY1A 2YLAA 3SAZA 1CEOA 3HV8A 2YA2A 4AIBA 4RLIA 2V2DA 3ZVIA 3BMVA 4IQLA 3O2LA 1H61A 4HA1A 2BXVA 2Z0IA 2HK0A 1W5MA 2V81A 3HQNA 3PUGA 5H8PA 3VGFA 1KBJA 1TJ2A 2VR5A 4ZOBA 1TWDA 4GZJA 1WDSA 3C4UA 4N02A 3R5EA 2VQTA 4KH2A 3HGRA 3I7RA 3GXDA 1JRCA 3TYZA 1Q4WA 1A5LC 4RNIA 1ZP3A 1QPOA 3KCOA 3PF3A 4MTVA 1XLDA 4IQJA 4HOXA 2EBNA 1J5SA 4PFMA 3LRMA 2XWEA 1XSIA 5EBUA 3A47A 4LUIA 4K1GA 2NQ5A 2O9RA 2R94A 3LCLA 3CTLA 4MYAA 4H19A 1N8WA 5B7YA 4DJFA 3FVDA 4XISA 4GZ7A 1RY8A 3WNLA 3CO8A 1KWKA 4L56A 4P8UA 1MQRA 3GO2A 3MVTA 1SUXA 3MKKA 1BSLA 3KL5A 1JZ5A 1VCVA 2QULA 1XLHA 3UG4A 1QI3A 1NP0A 1XLGA 3BGGA 5LSMA 2PTXA 3NDOA 3PB0A 3ALGA 2TPSA 1J12A 5CPNA 1XH0A 4O54A 2OXNA 3CUJA 5HJLA 2QUMA 3A4XA 3JVAA 2CKRA 5AN7A 2F2HA 2QUNA 4O1BA 4DJEA 3UQNA 3PM6A 2GFTA 4QS5A 3WIJA 4CNSA 1I0DA 3C0SA 4DWDA 3W07A 2ZX5A 3A5FA 3PZUA 3W26A 4BI7A 1E55A 1NWUA 3WQ6A 4LTSA 3NURA 2OYKA 3WEMA 1WKDA 3EX4A 4ZO8A 3CV1A 3U5YA 2XFFA 2VZTA 3A3XA 4JXCA 5JBFA 4GYKA 2PF0A 3N6QA 5ABHA 2PGWA 2BXZA 5HQMA 1XUZA 2ZRVA 3TONA 3NQGA 4GIYA 3T05A 4YYCA 3GU2A 4Y9PA 4UZUA 3CL7A 4FS9A 1Z9AA 4AZCA 3F5KA 3AO0A 3ZR5A 3M5ZA 2CLPA 2HTMA 1MWOA 2WQDA 1ZJHA 1CWYA 4EPBC 1S3TC 1R0MA 1GOMA 3EA1A 4GX9A 2W92A 3FNDA 3VD5A 2ZWYA 1AMYA 4AUBA 2W62A 3WF2A 2GGHA 1XRSA 4LAKA 2PC4A 3VKKA 1AZ1A 1R2SA 4NAFA 1LL7A 3LHZA 3ARSA 4AZBA 3F4NA 3WLKX 5G2HA 1NOUA 2KZHA 1TVLA 3M0JA 2O7QA 1KWGA 2WVVB 1H41A 3E0FA 3MSDA 3O6YX 1K8ZA 2TODA 3PHAA 5BMXA 3LDVA 3P60A 5CBIA 3NZGA 1M7JA 1UCWA 3LOTA 4TOQA 2FPYA 3S2MA 3N9SA 2ACQA 1UR3M 3GUWA 5K9XA 1TUFA 2YL6A 4IG2B 5CLTA 3NSNA 2MNRA 4W5ZA 5CJNA 3I7SA 3ZS4A 1AMKA 1FOBA 3TROA 4JR5A 2VGFA 3BSMA 1LTDA 4JQ3A 3SCSA 1VBGA 4ZTXA 5C71A 1EBGA 3UR8A 1QHPA 5FJIA 1WDRA 1DXEA 1F7BA 3AS2A 3A21A 3LCIA 1JZ7A 1S3HA 1UZ4A 2W91A 5HOSA 4P7QA 1DVJA 3C61A 3QHOA 2NV9A 4JTDA 3GYEA 1UYQA 3EOOA 1B4KA 3L0NA 2WMIA 3N17A 1VIZA 4BF5A 1U30A 3KXQA 3RLVA 3WNKA 3SB0A 1RPXA 2BFGA 1PB0A 3R6IA 1Q6OA 3M41A 4GH3A 1JZ4A 4ES4A 1Q65A 3T7VA 2ZUTA 1P0NA 3XINA 4DO6A 3W70A 1VFHA 3CLWA 3W7NA 3ZXWA 3G6LA 2A3CA 3K13A 3POCA 2CIPA 3TJIA 1REQA 4W7WA 3QTGA 2YFNA 2YW4A 4JQ2A 4ILSA 2WLZA 4ROQA 3KOZA 3OVPA 4AD2A 1C92A 2HV5A 2V68A 1KKRA 3EXRA 1UQZA 3E96A 3LXBA 4CCEA 4G7FA 3UJEA 5CG0A 4XBKA 4O16A 1D2KA 4F2TA 4MPQA 2V2CA 4EXBA 3A5VA 3PWAA 4C6DA 1DQUA 4R88A 1Q6DA 3ABXA 3CWNA 3WQDA 4ZQRA 4JTEA 1POJA 3IUDA 2CZVA 1YMYA 1GOQA 3WQ8A 4FXFA 1GEHA 3U8GA 4IL0A 3Q94A 2X42A 5EBAA 3SGZA 3IIPA 1GQLA 4E4FA 2ZICA 3W23A 4AC7C 2XFYA 3NO5A 4XVEA 5IHSA 1C7SA 1FWNA 1G69A 4JHOA 1H1YA 3USZA 2CLKA 1WZMA 4PMNA 3LM3A 4AWUA 3UA3A 2FTWA 4C1NA 5AHLA 1BWLA 1KQZA 3PFMA 4GI8A 4E5TA 1V51A 5CSRA 3ZVHB 3VNKA 1UOZA 1BF6A 3OZPA 2OGYA 2OB3A 4MKNA 1QTWA 4JTSA 3SFWA 4D6HA 4U4MA 4PMUA 2ZUVA 4PTXA 4O1DA 4Z1YA 1CIUA 2R91A 3P8IA 4KF1A 1TMQA 1Q2SA 4S2CA 1Z89A 4KGJA 2E8YA 3G6MA 3SSZA 1F76A 1BYCA 4DXKA 3BJSA 1UA3A 3BAWA 1XC6A 3G3MA 2X41A 4OV4A 3CUIA 4HGXA 2ABBA 1RD5A 4OE7A 3MO4A 3W1PA 3BTNA 5I79A 4H9YA 1E6NA 1S39A 2F9RA 5HQEA 3WMBA 4PB3A 1PXGA 1OFPA 1XW8A 5J5DA 1PVNA 1A50A 3BG5A 5JH1A 4Q8VA 2BGSA 3BPWA 2JGYA 5LGXA 2Y61A 3S6DA 3E6EA 2RUSA 4JTLA 4QG9A 1CDGA 4Y6GA 4WDWA 5DCEA 3W7MA 1W3TA 1ZPTA 1IWAA 1G01A 4NAEA 4GNJA 5G1YA 1LBMA 3LXCA 2YDSA 4UQAA 3GDTA 1W9BM 1KCZA 1W1B1 1NM9A 4MB3A 3W00A 1EWDA 3SRDA 4DYEA 1EJRC 4MLRA 4ZVJA 4PUKA 4C6EA 4O18A 2VI0A 3WLLA 1O6IA 4Y9OA 5F2IA 3VC6A 4EAMA 2HCVA 2OT1A 4KEMA 2VENA 3RFAA 4B5UA 5FF2A 2XHYA 4Q4RA 2BVYA 2Z1WA 3E12A 2PZ0A 3P61A 1Q6CA 5PTDA 1UD2A 3MB9A 1Q66A 3SRFA 3ABZA 1O94A 1JGMA 4U3AA 2W4XA 1EIXA 5FJRA 4AEOA 3SZ8A 2P0OA 2QJNA 2Y88A 3A9IA 2JFEX 1X8CA 2DIJA 2ZUNA 3TQPA 3LXAA 3EWYA 3G5EA 4WOQA 3TMLA 1UA7A 4KRTA 1EA9C 5XINA 5GPRA 1QI4A 1EH9A 3WK1A 2CHRA 4S38A 2Y4SA 1EHNA 5D8WA 2J8FA 3GXFA 3LB0A 4XIMA 1V02A 4M8UA 1W0MA 3VKCA 1AL8A 1PTGA 2NX1A 2BGNE 4BWLC 2Z25A 4FAMA 1E1EA 4V1XA 2A4AA 3IV3A 4HTBA 1FCBA 3SY1A 3WH7A 2V30A 3W0KA 3GDBA 5HMSA 2RFGA 3S6TA 1RA0A 2VFIA 4S3AA 3ITVA 4GNKB 2OX4A 4AZCB 4DRSA 4RL3A 2B4GA 4YTSA 4RKAA 1RA5A 2VRKA 4TV6A 1ITUA 2ZC1A 3MCMA 1TCMA 3BG9A 1UJQA 3KOYA 3WQWA 4Z2KA 4GXMA 2FYMA 4IMDA 4DF0A 3OG3A 5FJJA 3KL0A 2EPHA 3NGFA 1F05A 1YNPA 1E51A 3W7CA 1WBJA 3LCGA 3HU7A 4NAFB 2YB4A 7REQA 4OECA 1Z8AA 4ZB2A 4XQ6A 2WHLA 4UOJA 4AAJA 4NILA 4HOWA 3PJWA 3HZ3A 5HNRA 1OF6A 1JAEA 1W1VA 3P5ZA 3FA3A 2VXNA 3PPGA 1E72M 2XH0A 4ML4A 2ZX9A 4JN6A 2B7QA 2FZBA 1QAPA 4W85A 1O5RA 4B92A 4PTNA 3H55A 3T8QA 2DH2A 1NDWA 5LXXA 2NQHA 4DI8A 3FK4A 4L6OA 3WLOA 4JTCA 3W2UA 1O5KA 2J7FA 5I0DA 1NFPA 3A22A 1E6PA 4WJ8A 5CXPA 3WLMA 4FX7A 3WBAA 1I2PA 4UQEA 3NXFA 3UXDA 4JL1A 1NELA 4IUOA 3W81A 1W5PA 2BZNA 3CWHA 1A3HA 5I3HA 4EK7A 1GTHA 1AODA 1P6BA 3V1HA 1L6GA 3C2YA 3PZTA 2ZRWA 3OA5A 3GW0A 4IGSA 5A6JA 2C3ZA 1ODUA 2WSYA 4PFHA 1ONEA 2PU0A 3BW3A 4H9ZA 1IEIA 2ZDRA 3W9ZA 1UQYA 3NXLA 4RZ5A 1MEIA 1AVAA 4C1KA 1XIEA 3UETA 4ZFMA 4FX6M 4C6LA 1W9XA 3ABRA 4UFJA 3PJTA 4AIEA 4Y96A 2WMIB 5EMKA 2FMNA 3KEHA 3T07A 3H2NA 3G1SA 1UKTA 3MDWA 1P0DA 1TRIA 2QMKA 3MV01 4MJ4A 2Y2WA 2RAGA 3AHXA 1E1CB 1CB2A 3UZYA 5LNWA 4H8VA 1V0KA 5DN1A 2DUXA 1NF0A 1TTPA 1JVNA 4OVXA 3SIMA 1XDJA 3HJZA 3MTWA 4O17A 2CHOA 3AUOA 4POCA 1AJ2A 1BKHA 1ESWA 4NJHA 2Z6IA 1RJPA 4UR8A 3TWAA 1JRBA 1P7TA 5H91A 1GNXA 1J93A 4B5SA 2QJJA 4H9VA 3WUGA 1WX0A 4EXAA 2WM0A 1PSCA 4OTKA 2XYLA 5J5RA 1S2TA 1BTCA 3SN1A 1F73A 2I57A 2I1OA 4MWAA 1A5CA 3K5XA 3LCHA 3UJSA 2ATSA 4RR4A 1KFJA 1LT7A 4DM1A 5EMMA 3NQCA 5AHFA 3RU6A 1LYXA 5ECUA 3W7OA 4H9UA 1EA0A 2O4MA 3FKKA 3T0BA 4E0CA 3VIPA 1K7EA 1B2YA 3AU6A 3UWYA 1L6SA 5F2GA 3EWZA 2PS2A 1XBYA 3M0IA 3WLTA 3QZAA 4B9YA 3O15A 1Q6GA 3M46A 4JFSA 3VXGA 1AQMA 4ZFCA 4PL1A 4C1NB 4X2PA 2NXGA 4CKQA 2P8BA 4OZOA 3VOGA 3EWWA 2C7FA 3UPWA 2YCEA 2CZDA 4P61A 4YJ5A 3HQOA 3JZUA 4R27A 2V0TA 1W8SA 4ZXOA 3VMNA 3UT0A 2DZBA 3GB6A 3PUOA 1HJSA 4GRSA 2Y7GA 2PE4A 4MUPA 1VRDA 3VOJA 2HZGA 3HG2A 5A8QA 4JKKA 3USBA 3L9CA 1NARA 3TFXA 3GH5A 1HJVA 3AIBA 2GJXA 5DT5A 3BZJA 3M0YA 4FI4A 1PYMA 2C0AA 5ENLA 5E70A 1IEQA 3PZGA 2H90A 1EZWA 2WZTA 2VOTA 3E2SA 3P82A 3LBCA 3UW6A 3QPZA 2JF6A 1R9YA 3FA4A 8XIAA 3IJQA 4PH6A 1JYNA 2PTWA 2PDQA 4UC5A 4GVFA 4PTVA 3R7MA 1XKJA 3SRHA 3WCZA 2A3AA 5CGQA 1XHGA 4A29A 3NQEA 5CBBA 1XYBA 4HU8A 1W2PA 1FWAC 4FP1A 5HINA 3QC3A 3S5ZA 2UY2A 4BF7A 3FYOA 4Y2WA 4GISA 3LERA 1J9YA 4H04A 1W1IE 5ABGA 4NAEB 1XYAA 4DXVA 4GNVA 3KE0A 3W02A 3UJ2A 2E3ZA 4O28A 3NPXA 3QQ0A 3BE7A 4GJJA 3U48A 1DIDA 1XLEA 4GGBA 4DF1A 1IXPA 3WUBA 1UKQA 1J01A 4HA4A 1QASA 2ZA1A 3HOJA 4FIQA 3LENA 4NX0A 3THUA 2Y1HA 4UMBA 4F3HA 1A49A 4YIWA 4Q7IA 3WLJA 3Q45A 3U3HA 3URNA 4HA0A 4BEQA 2XH2A 5CZ0A 3VOHA 3PAJA 4CNNA 4UFHA 1VEOA 1OZQA 4MOZA 5TAOA 2CU0A 3FXYA 3HA1A 3QKEA 4V1YA 1L0PA 4J28A 1NOFA 3BANA 3WBYA 4DEFA 5A8GA 4MUZA 3IAPA 3D5HA 1ICPA 3PNUA 3W71A 4UTTC 4Q3MA 3M6YA 3TP4A 4C90A 4IGHA 3SCTA 1FQ0A 4FZIA 2ZA3A 4HPXA 4QE5A 3GHTA 3OTRA 1EUNA 5JH2A 2PU1A 4RV3A 4RCXA 4M0XA 1DEDA 4UR7A 4FHAA 4WQ6A 4GVGA 2VDHA 4EOUA 1PYFA 3B97A 3WLPA 4R9XA 3M4HA 4A35A 1PWMA 3G77A 1JNEA 1CGYA 3RILA 1KFKA 4LNYA 1KXHA 2GGEA 1S5MA 3NZ1A 3H54A 4LAUA 2DV0A 4KWSA 2Z1XA 3G2GA 4GQBA 1Y5WA 1V3JA 2WCAA 2GJRA 2X8RA 1ZQ5A 3SN0A 3OZOA 2WAGA 3WQCA 1RP8A 1XLLA 2CZ5A 3UR7A 3WENA 4D6EA 3BW4A 3VNMA 2VEIA 5DT7A 1HKKA 3BG3A 1KLZA 7REQB 3B0YA 1QPNA 3CV2A 2NX3A 4KKXA 1UH2A 4B2DA 1DHKA 2NQLA 3LPOA 4AWSA 5EA9A 4GACA 1BSIA 2INZA 3FHQA 5E1QA 3SR7A 1UROA 3H8AA 4P8VA 2BHYA 1NF7A 1TO3A 2IQTA 4NZ3A 2QHAA 3PY2A 3LSCA 4DNMA 1TPFA 4JHZA 3GR4A 1L8PA 3GTHA 1EX5A 4CNPA 1EF3A 4LV4A 1SVDA 1A3XA 3M5YA 1S2AA 1VFSA 3L4TA 2C0HA 1E9IA 5E0FA 1ZP4A 1OFDA 5LHFA 5FSEC 3CAKA 2QQ6A 4OBSA 2QCFA 2CERA 3RO6A 3DU0A 4MNMA 5M5DA 4NZFA 3AIUA 2FTYA 2Q3RA 1Y8BA 2VO5A 1VJSA 1MXDA 3KL3A 4ECLA 3UG3A 3UWEA 1U5JA 3W7GA 1KCXA 4R7OA 5FEPA 1SJDA 4LF1A 1ZBCA 4IPIA 1PDYA 4IGNA 3BSHA 4A3UA 3S1VA 1Q8AA 4JN8A 3S9ZA 4RE2A 2O0TA 4ASTA 3GVWA 4ADTA 3CBWA 4DJDD 3SURA 4IJBA 3VIMA 3I10A 1V6XA 4E8CA 3ZJ6A 2DY3A 4F4RA 1IXNA 2A7RA 1AQ0A 1ZHAA 3FA5A 3G22A 5ABEA 4NJGA 2GVLA 3DI0A 3U2OA 3BMWA 5LYRA 3EMZA 1ZY9A 1K9EA 3PZQA 5DRCA 4D6IA 5I24A 4XTDA 4ZQMA 2WNQA 1P7TB 1MFUA 1XV8A 1YBQA 4IL2A 4GPNA 3ZR4A 4LVDA 1B3VA 3W37A 1MW2A 2EHHA 4PUJA 3GZ3A 2C14A 1GGOA 1VENA 2E5BA 3LCWA 4D71A 1J0IA 4H8UA 3WFLA 8CGTA 4CNUA 4MWAB 2Z4GA 3TYAA 3ARQA 3MO7A 4DI9A 5G2IA 1VGAA 2X16A 2QUVA 1WB0A 5EY5A 3RIKA 1UIPA 2JKEA 1JJKA 2VC9A 3E2RA 2RKXA 4O15A 2GSEA 3LI0A 4LY4A 2GUUA 2FFCA 1XKYA 3C2EA 1WKEA 3URQA 3RYSA 3RG6A 4AXKA 3UCDA 3WK3A 3SADA 1MRAA 2ODOA 3TMQA 2PLJA 1CNVA 4ZA0A 1Z44A 1RALA 4JIRA 3EWBX 1UW9A 1QBBA 5BXRA 3PPFA 3GTXA 3UWUA 1OYCA 4E2DA 4J3UA 2DIKA 1HVQA 3BLKA 2PTZA 4HD5A 2HRWA 3WUEA 1EO5A 1XIJA 5HAOA 4UQ9A 2VEMA 1Q63A 3PZ9A 3NL2A 3VNLA 2ZVRA 3W01A 2Y7EA 1PL9A 3H2OA 4X22A 2GJXB 1VR6A 5CG7A 1M1BA 3KLKA 1W3LA 2CBIA 4I3GA 4MY1A 3W2LA 3FV9A 4LF2A 1WAUA 3F4DA 3TTYA 5A8NA 2H6RA 2VWTA 4AHQA 1UC5A 4Y8FA 3DBPA 3VUPA 1LJYA 4RZBA 2WYSA 2O9TA 1RQEA 1SFLA 3M7WA 5CCZA 1I2QA 4K3ZA 4G8TA 1RCXB 5FI8A 4WCJA 3TQVA 3V0SA 2ZKMX 4JTRA 1WXZA 1MMFA 4H9XA 2KX9A 3B8UA 1G6CA 4L4MA 1JZ3A 5DEZA 3LQLA 3IRDA 1JXJA 3DHPA 4K8EA 1P5BA 2CXEA 2V3FA 1OD0A 4IIDA 3GAKA 1BXCA 1HKIA 2FH6A 2YB1A 3OQEA 1ZBWA 4HMNA 4M3PA 4V28A 3MUAA 1JFXA 1VJIA 3UFYA 4A22A 1K6AA 3TJXA 1A0DA 4XZLX 3ARVA 2WB5A 1VD6A 2IUZA 4BI5A 1K8YA 1K7XA 3UGVA 1F74A 2QCHA 4R9OA 1GVSA 3VD9A 4IISA 2PP0A 4O14A 4K68A 1JULA 4GUJA 5D38A 3EA2A 3BOFA 2G96A 4GUIA 3R0KA 3RU8X 4JDYA 3WSUA 3E9AA 1GHSA 3WF4A 1YIXA 1HJWA 3NL3A 4QCEA 5E9AA 4PB4A 1TMHA 3W7HA 3WG6A 4IQDA 1UB3A 2IXVA 3F5LA 1HGYA 4X0NA 2GSJA 4FF7A 1FH9A 1Y65A 4JFUA 2W9MA 4RZ6A 3KDNA 3BSGA 3IGXA 3VOFA 4KW2A 2BVWA 1I6NA 1T40A 2PZNA 2ZRXA 5TQLA 6PTDA 3UG8A 1OYBA 3ZYZA 4XZHA 1CLVA 1QWKA 4K6AA 2V6AA 2RH9A 1EF2A 3LN3A 3W28A 3NQ6A 1PIIA 3LYEA 1FWCC 1MW1A 1BQCA 2Z1KA 4GFIA 3W2MA 5D05A 3WNNA 3VO0A 4NKCA 4ZTYA 4RDYA 5I78A 1V02E 3HN3A 1W1PA 5DFAA 1O1ZA 1XGZA 3CZJA 1AH3A 4G1NA 3KAOA 2QUTA 2IPGA 4YXGA 5HNTA 3E2VA 3CEUA 4WGXA 3PJUA 5IBXA 1IZJA 2D3LA 4LEQA 2PDFA 3GC2A 2ZVIA 3N18A 3ZSTA 1CBGA 2ZUUA 4DWSD 3L5MA 5EFFA 3ZZ1A 1VFFA 1WYIA 3DIPA 3DC0A 4K1WA 3MUXA 2AL1A 1TZ7A 4PA8A 1M65A 1UG6A 3P0XA 1ICSA 2V5DA 1VFTA 2ZQ0A 4HMEA 2CLOA 4F40A 3CGTA 3WLNA 4DZ5A 2JIWA 2ZTJA 3R43A 2Z00A 2AAMA 4IP7A 5AC7A 1AW1A 4C60A 2FHCA 4NI8A 1DWJM 1MEWA 4C6NA 2XVKA 1FXQA 3AOFA 1OC6A 2ZZ1A 5I3KA 1OG0A 3GY1A 2CETA 3B8DA 1YDNA 1WDPA 1E71M 4H9TA 3W1AA 4JQAA 4GFSA 1XRTA 4CGTA 4P7NA 3QZEA 4FOUA 4C7DA 3W2KA 3K4AA 2XVGA 1OFRA 1GOIA 5K3VA 3BAKA 4K8HA 1Q6FA 1LQ2A 3GHUA 2VEKA 3CMGA 2OODA 4L1GA 1SMDA 2PTYA 3XIMA 1TKKA 1TWZA 4XAPA 1XPYA 1W37A 3D0CA 4JNMA 4O57A 2NLYA 2NXIA 1V6TA 2YSWA 4CD7A 4GINA 3TDFA 2VTFA 4PUUA 1XC4A 3F7JA 1LG2A 3MI3A 1V5XA 3W76A 1XXXA 1M04A 4N7QA 4LCQA 3ZMRA 4UXDA 1HW6A 1PAMA 2WKGA 3UVAA 1W17A 3TTSA 1F6YA 3O0FA 4AZ6A 3KWXA 3B0XA 4H00A 5CJMA 3EWDA 4G7EA 1UUMA 3GG7A 4CN6A 2WCGA 2HNHA 4AEEA 3LBOA 1GQNA 3WF0A 1R30A 2IQ0A 3G8RA 1JCTA 1LLZA 3ID7A 3GNOA 2QDDA 3QGVA 1BWKA 3WDIA 1QW9A 3VNDA 4DJED 2Z7GA 1XLAA 2RGLA 1J2BA 4XAGA 1H4PA 1YYAA 5AC4A 2V9DA 2XFRA 1CZ1A 5IFPA 4J3VA 4QE4A 2J62A 1KGUA 3KRZA 2QCDA 4M6PA 3LBMA 2DUAA 3VDAA 2BMBA 4XD6A 4YPJA 2E6YA 1IEWA 1KTCA 4HSNA 3B04A 3EWXA 1YEYA 2FLIA 1TFVA 1TPH1 4YS1A 4FA3A 1QNPA 1RVGA 2XVLA 4Q4QA 1FHUA 2D0FA 5DMNA 1E6ZA 1ZB5A 3QMRA 1UIOA 4C6FA 3D46A 2C79A 2OQHA 2PRLA 2B7NA 3JUGA 3DH7A 4MWAE 3WMLA 1GONA 3V5CA 3PB2A 2VRQA 4CNOA 3UP8A 2J7GA 3W1QA 4S23A 5CLWA 3LPGA 1GG1A 1GOKA 1K8XA 4DXXA 4HJWA 4UMAA 1CXFA 4QNWA 1VYSX 1HUVA 3EXTA 3UWWA 3IANA 1MVYA 1BF2A 3LX9A 3BJTA 3WNMA 1PHQA 2ZXQA 1VP5A 2WW5A 3MMDA 4MJMA 1TQJA 3HFYA 3PBUA 4FLRA 1PZ1A 1ZTVA 4NNCA 4ZCWA 2DP3A 3O05A 1R3VA 4O1CA 1QPQA 2PLMA 3QFEA 5D37A 4HPHA 4BFAA 2VVNA 3UYIA 5BZAA 2C6QA 3CS2A 3L5LA 4CD4A 1B57A 4QLKA 1I2NA 2OJPA 1UUOA 1T7LA 1GT8A 2QJGA 3ES8A 4WDUA 2YW3A 3LTSA 3AQUA 3V3WA 2PB1A 3SEPA 3WQ4A 2ZZ7A 1V93A 3DENA 5HWMA 3MSYA 4J9JA 1TTQA 3QPYA 4V15A 3TZNA 3D47A 2G3NA 3LLXA 3W1RA 2R9RA 3G3DA 3GTIA 3OQ8A 4LUYA 2AGTA 5DCBA 5A3HA 4KMQA 2PAJA 3LCXA 1PJ9A 2OQYA 4ERGA 1XF0A 3B06A 4JKMA 1F3TA 2OLAA 2E9LA 3MP4A 1XG4A 2X1UA 3UZ5A 4UNKA 4A3RA 2VUNA 5FAJA 2HVNA 1EGVA 2VX7A 4R5EA 3VX1A 5B80A 2WBKA 1HKJA 2G95A 2Y8VA 4M56A 4PSPA 4RDVA 4AZ5A 3FAWA 3LPFA 4JDBA 5SWUA 2G3JA 3TWBA 4P7RA 4WXZA 2FDSA 2H3BA 2X0SA 3GK0A 1Q85A 1XFCA 4DHGA 3ZIZA 1J8VA 3N2CA 3BWWA 4Z1CA 2GGGA 5CKSA 3KUMA 5AHIA 1PCKA 1XJBA 3L5AA 3T0TA 3AMLA 2ADAA 2WK2A 2ZE0A 4LC6A 2PGFA 1SW3A 5D4YA 4Y7EA 4GO9A 2VM8A 1D3HA 5EU9A 4ZXLA 2BHUA 1A5AA 4AVNA 1RV8A 4GIRA 3APTA 2E6AA 4B5XA 3BLFA 3FJLA 4Q8OA 3MT1A 4D6CA 3JR2A 5AYIA 4GUFA 3GXMA 4DZAA 1Q5MA 5C9UA 1X97A 3W22A 3G1VA 3IARA 4UFIA 2BX7A 2DZSA 3EKLA 2ISWA 5E09A 5CC3A 1GJUA 3WDQA 3NPWA 2OT0A 1G1YA 1NEYA 2CLFA 1V8EA 1U1HA 4JZ5A 4ZE4A 4EE9A 3CAWA 3FX4A 3I3DA 2R6OA 5A6AA 4JTTA 1RR2A 4TX6A 3WDPP 1A5MC 4KWVA 1PE1A 4PMQA 1OEPA 1A53A 3OB8A 3GBDA 2P8CA 1JYVA 1OB0A 1OX4A 3M1ZA 2I56A 3OG2A 4TVUA 4HTYA 1Y0EA 2CWNA 4AVOA 1BPLB 3S5NA 4L61A 1XIIA 3F5JA 2FB3A 1VBRA 3EPMA 3W7JA 1R2RA 2AKZA 1U83A 4C6IA 2GLKA 1KQYA 2V82A 4E4UA 4RX0A 1GW9A 4AX6A 4E3TA 4XZWA 3APYA 1TA3A 2ZDSA 4IPPA 1TPEA 4K38A 3QXBA 3NZPA 1OK6A 1DWHM 3TC7A 4JIPA 4LUSA 3R94A 1EC9A 3AZSA 3AMKA 5G4HC 4MJ2A 3NQDA 4HN4A 2YR1A 1I1WA 1OYAA 4C5ZA 5HNNA 5C7HA 2Y5SA 3KBJA 7TIMA 5AVNA 3IK4A 2VNCA 1PX8A 1XINA 5IDZA 4D2JA 4X0VA 3LNMA 4ZEPA 1N8FA 3EA3A 2DDXA 3PUEA 2BXYA 2G97A 4HKPA 1PEZA 2DZAA 3LG3A 1G4TA 3CZKA 9XIMA 3E1F1 4Z2GA 2EO7A 1W3HA 4JEJA 3IIZA 1MUMA 1PTAA 3AIEA 1NWRA 2Q8LA 4B5TA 1OCBA 1SO4A 5FEXA 4KWOA 3N2BA 2B7OA 2NSOA 2I9UA 3C6CA 4AXNA 4KCTA 2QIWA 5C7VA 1JAKA 5JIPA 3GE7A 1VZWA 1J79A 1EJTC 1CX9A 4LSBA 1D3GA 1N82A 3CHVA 4MB5A 4N6EA 3REQA 2HXTA 2RJGA 1LT8A 4GCAA 3LZ5A 4NJKA 1KO0A 3TYEA 3F4WA 3PNZA 4GZIA 1NSJA 1UP3A 3H2FA 2W79A 2E7FA 2BY1A 4US6A 3D3FA 4LBRA 4JTJA 3TA9A 1XCFA 4YHGA 1H09A 1DBTA 4DELA 4G7EB 3TAKA 3KTSA 3OU8A 5DLCA 2NQ9A 2G3FA 3ICJA 1RJRA 1OBAA 1HL9A 2Z28A 2X05A 1UBPC 1QFEA 1ADOA 3WJSA