4GZ7A

The crystal structure of apo-dihydropyrimidinase from tetraodon nigroviridis
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
492
structure length
492
Chain Sequence
AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFKMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREPYAGEVVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lysine Carboxylation: Metal and Structure Requirements for Post-translational Modification
rcsb
source organism Tetraodon nigroviridis
molecule tags Hydrolase
molecule keywords dihydropyrimidinase
total genus 186
structure length 492
sequence length 492
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gz7A01
3UF9A 4I6KA 2HNHA 1I0DA 3UPMA 1P6CA 2XIOA 4GY1A 3F4CA 3CS2A 4LALA 3LGGA 2IMRA 3S2MA 4C6PA 2WJDA 3BE7A 5HMFA 5AKQA 1YMYA 2Z2AA 3F2CA 4NP7A 3LA4A 1E9ZB 1FWGC 3S2NA 2EG8A 2BGNE 2Z25A 4RDZA 4DYKA 3ORWA 4HK6A 2ADAA 4IGMA 2Z4GA 4ICMA 3MVIA 4QROA 4DZIA 5FSDC 1FKXA 3RYSA 4XD5A 1RJQA 4IFKB 3OOQA 2FVMA 4PE8A 1O5RA 1ZZMA 1J6OA 1ADDA 3F2DA 1RK6A 3DCPA 4C65A 4GX9A 3AU6A 2FVKA 3PNZA 2Z24A 2R1MA 2YB1A 4C6BA 1FKWA 4GY7A 3SO7A 1IE7C 4G7EB 1YBQA 4C6LA 2GOKA 4L6DA 1UIPA 3LS9A 4IFOA 4KF1A 1FWIC 2GZXA 4H9YA 3LSBA 4TQTA 2F6KA 2VC5A 1M65A 2D2JA 3GIPA 4CNSA 2UBPC 2Y1HA 4C6CA 2PGRA 3URQA 3GTFA 1GKQA 3IV8A 4D8LA 4XD3A 3WZ0E 4CQBA 3IARA 1A5OC 3GTHA 4XAYA 2Z00A 1RK5A 2QT3A 2WJFA 4MUPA 2PUZA 4C6KA 1V77A 2AQOA 1V4YA 1EJWC 2R1LA 2FFIA 2YZ5A 3PNUA 1UBPC 3K5XA 4PBEA 1KCXA 3B0YA 4PBFA 2GWNA 2HPIA 4V1XA 4BY3A 1YRRA 3N2CA 4LCQA 5A6TC 4B90A 4AQLA 4J5NA 5LXXA 4WVXA 4XAGA 3LU2A 1EJTC 1W1IE 2ANUA 2VM8A 1R9YA 1WXYA 4GX8A 2R1KA 3B0XA 1S3TC 3ID7A 4GK8A 2I5GA 1XWYA 1HZYA 1J79A 3PANA 4GC3A 1RJPA 3MSRA 3TN5A 2WJEA 3K4WA 2GSEA 4F0SA 4C6JA 3MPGA 2AMXA 3ISIX 4RZBA 1J5SA 3OQEA 1FWBC 3QGAC 2ICSA 1A4LA 1DPMA 4NG3A 1YNYA 4H00A 4H9MA 2OODA 3R0DA 3OJGA 1XGEA 4B3ZA 3F2BA 2G3FA 4HK7A 2W9MA 3MJMA 5FSEC 1EJRC 4JOMA 3A3WA 3FEQA 1GKPA 3PBMA 3NURA 2E25A 2QVNA 3LSCA 3FDGA 4R7WA 4G7EA 3TN4A 4NI8A 4CEUC 4B91A 3KM8A 3CAKA 2I9UA 4H9VA 3GTXA 4KERA 1FWHC 4LANA 4KQNA 1RJRA 3GU9A 3QY7A 2OGJA 3MTWA 4C6MA 3V7PA 2Z28A 4H9XA 1YIXA 3TNBA 2A3LA 2HPMA 3UR5A 3AUOA 4UB9A 4ZSUA 2HBVA 4C6NA 1R9XA 2GWGA 4CNUA 4PCPA 2CZVA 1BF6A 2Z7GA 4XD6A 4DI9A 3O7UA 3UBPC 4DNMA 2P50A 3NEHA 1A5LC 3B40A 4KETA 4INFA 3G77A 2PLMA 4HK5A 3CJPA 1K70A 3RN6A 4CQCA 3MDUA 2EG7A 1P1MA 2ZC1A 3URAA 4QSFA 1FWDC 5CH9A 3GTIA 2QS8A 4C6EA 3GG7A 4KEVA 1A5NC 4LAOA 2O4MA 2Z26A 1KRAC 1A4MA 3E0LA 3ITCA 4J2MA 3IPWA 1NDWA 3IJ6A 4H9TA 1EJSC 3QY6A 4DZHA 4E3TA 3E74A 4YIWA 1KRCC 2PGFA 1FWEC 3S4TA 3HTWA 3A4JA 2FTYA 4ERAA 4IGNA 4C6OA 2P53A 1M7JA 1ITUA 1FWAC 1QXLA 4XAFA 4H01A 4CEXC 4DIAA 2HQAA 4C5YA 1PTAA 4BKNA 4AC7C 2Z2BA 2QPXA 1ONXA 4ERIA 1EJVC 1POJA 3QY8A 3T81A 3SFWA 4I6VA 3AU2A 4LCRA 1FWJC 4GY0A 1A5MC 4EPKA 1XRTA 4QS6A 2VHLA 1R9ZA 3NQBA 1EF2A 4LH8A 4Z42C 1UIOA 2Q09A 4GXWA 4P5UA 2PAJA 2YXOA 4EPEC 1RAKA 3IGHX 4G2DA 3GIQA 2HBXA 4IG2B 1NDYA 5HMDA 3IACA 4LAKA 3QGKC 4HA0A 1NDVA 4C6DA 1QW7A 2YB4A 3GRIA 4C6QA 1ITQA 4BJHA 3WMLA 3FDKA 1NFGA 4F0LA 4C60A 4GZ7A 2E1WA 2DVUA 2R1NA 3PAOA 1WXZA 1V7AA 4OFCA 3JZEA 3T8LA 4ZSTA 3URBA 3RHGA 1XRFA 4KEZA 4GOAA 4RE0A 1VFLA 4IH3A 4KEUA 4KESA 2BB0A 3LGDA 3MKVA 5G4HC 2OQLA 4F0RA 2DVTA 4QS5A 4QTGA 4DLFA 1JGMA 4C6IA 3D6NA 3EWDA 4RDWA 1EJUC 4WGXA 1YBQB 4CNTA 4HJWA 1O12A 2VR2A 3K2GA 4KIRA 1EYWA 3C86A 4H9ZA 3DUGA 3F4DA 3URNA 3RCMA 4C6FA 1I0BA 1EJXC 4UBPC 2Z29A 1GKRA 4XD4A 4GYFA 4DO7A 3MDWA 4IFKA 3O0FA 2EG6A 3GU2A 3OODA 2VUNA 1KRMA 3HPAA 3A3XA 4PCNA 3E38A 2WM1A 4IG2A 3E3HA 3EGJA 3MVTA 5E5CA 4R88A 4V1YA 4LAMA 1UMLA 4LFYA 4LEFA 1POKA 3LNPA 3OVGA 3S2JA 1RA0A 3S2LA 3ICJA 1FWCC 1K1DA 4CQDA 4DLMA 3EWCA 3T1GA 2RAGA 2VC7A 4IF2A 1V51A 4EPBC 4R85A 2D2HA 2AQVA 2O4QA 4WHBA 4GBDA 4M51A 1A5KC 1V79A 3TN3A 3OU8A 1J6PA 1PO9A 2Z27A 1E9YB 4EPDC 2FTWA 4B92A 2DVXA 1EZ2A 4XAZA 3E0FA 4L9XA 1RA5A 4RDVA 2KAUC 1KRBC 2OB3A 2Q01A 4RDYA 2OOFA 2R1PA 4H9UA 3LY0A 4QRNA 5HMEA 1ONWA 1FWFC 3HM7A 3IRSA 2UZ9A 1PB0A 4DI8A 3WYZA 1PSCA 4C5ZA 4J35A 4IFRA 2D2GA 4EP8C 1P6BA 4IQJA 1M68A 3GU1A 3E2VA 4LCSA 4ERGA 1NDZA 3GUWA 3UR2A 3DC8A 1K6WA 3TN6A
chains in the Genus database with same CATH superfamily
1YDNA 2VR4A 2TRSA 3GG0A 1V02A 1K7FA 3LENA 2XH0A 4P7LA 4DYEA 5A6AA 4RV8A 4NIRA 1SFLA 1WDDA 1BXNA 4B15A 1NTHA 4TX6A 4U31A 5MKGB 4Z2KA 1XFCA 2Z25A 3BOFA 2XVPA 2G37A 1O60A 3AZTA 1AD4A 5A95A 2ZXDA 3U2CA 2GUYA 2P5NA 2WLYA 4ZO8A 1NSJA 2GDVA 1IWPA 2YW3A 4ZVJA 1ICQA 3RR4A 2YB1A 4DM2A 3BURA 5CG0A 3PG9A 1I1XA 1Z42A 3VOGA 4C1NB 1R0MA 3NPVA 3OVRA 1QAPA 3U8GA 4AW7A 1M7XA 3UW6A 4C6CA 1U5JA 1GUVA 3W1MA 4IJCA 2HROA 2AMGA 4HPGA 1ALDA 4DM1A 1WBHA 3RPDA 1OQFA 2BY0A 3JRKA 2PZNA 4PUWA 4EAMA 1UBPC 3K5XA 3U6WA 5HPCA 4US6A 2PF8A 1JVNA 2FZMA 3EA3A 3PC0A 3A4AA 4XO6A 3FA3A 4S3GA 5B80A 5LXXA 5IM51 4W7WA 3GDRA 1ISVA 4L6HA 4DJEA 1W1IE 3CQJA 3NQFA 3VD4A 2XJ7A 1WXYA 4GX8A 2HV5A 2PBGA 3CASA 3QQ1A 5HWMA 3LCIA 5ABEA 2DZWA 5EYWA 3L0GA 2EBNA 1ISWA 4FOKA 1FWRA 4V33A 2XIBA 2IXUA 3OQEA 2FMOA 4LTSA 3CL7A 2VEPA 3CAVA 3VGFA 4F8XA 3SQLA 2HVNA 1QHOA 3PR2A 4H04A 3PPGA 1S5MA 3DENA 3NPXA 3O6CA 3L65A 2G3FA 2WPGA 4BHYA 5CCZA 1EJRC 5LA2A 5CPNA 3ZT5A 3FEQA 1ZU8A 5LXEA 3ZO9A 4A35A 2WM0A 1FH9A 5BXSA 3TN4A 2WVSA 2XINA 2VCCA 1OSEA 2FB2A 3MUXA 1FWHC 4IXHA 4X3ZA 1A3WA 5A6JA 1VFTA 3APYA 3N4EA 4C6MA 3GXDA 1YIXA 3QYSA 4Z1BA 2XM1A 3H7UA 3KOXA 1PIGA 3FLUA 1FWSA 3BLPX 2Z7GA 4XD6A 4CGTA 3CHFA 1RBOB 1RUSA 3ABQA 2J7CA 3W6MA 4IXXA 1H0IA 1G4TA 1PS9A 4FO4A 3KFTA 2CZEA 1OC6A 3AXMA 4DBDA 4MDPA 1ADSA 1QUMA 1E6PA 3BH4A 2OEJA 2PDXA 2GGJA 4JD4A 1JPIA 3E0LA 3W25A 1IT7A 3DGRA 3V5CA 1JR1A 3SCWA 4JCLA 1U30A 4QITA 1RR2A 5I6SA 3C8FA 4WSKA 1LRNA 1ZJIA 1OC5A 4JTJA 2BSLA 4GC4A 1CGTA 3LCWA 3DI1A 1CW2A 4UTTA 3CQIA 3GZ3A 3NQ2A 4XSLA 2J47A 1TG7A 5BZAA 5HNNA 5A8MA 5BXRA 1OZMA 3KWXA 3NL6A 5CC3A 2G4FA 4O14A 3DFHA 4H8NA 1R9ZA 4C91A 5M3WA 3LTYA 3WQGA 3S46A 1SFJA 5A6BD 3I3BA 2YXOA 4PTDA 3WFLA 4JN8A 2F6UA 4L80A 5GNYA 3TROA 3SDOA 1FUYA 3MUIA 3CUFA 3AQUA 1TV4A 3L5AA 3L21A 4TX9A 1DHPA 2QCLA 5IXEA 3GRIA 2WHMA 5CPOA 2E8ZA 3FDKA 2YJQA 3BSHA 5HPOA 4G6CA 4O13A 3F1QA 3P62A 1WXZA 3BLEA 1M9HA 3CQ0A 2DV0A 2ACQA 4ZQRA 4P8WA 4KESA 1X1OA 2RJHA 3MMWA 4BZYA 1OADA 3VDCA 4HVXA 1KD0A 4H19A 2XISA 3A9IA 1UH2A 2OT0A 3S47A 2ISDA 4R33A 3ITYA 2FIQA 4LYPA 5AC5A 1DP0A 1LBLA 3URNA 1F7BA 3EMQA 2BOEX 2BHYA 2Z29A 3DHFA 5LNVA 2OR2A 3BZGA 4LVFA 1U83A 2FVLA 2AGTA 3TE9A 4IICA 5HQLA 3IK4A 3NOEA 4ZODA 1K77A 4CKQA 1KLZA 3B0PA 1Y65A 1UCWA 1L2QA 1BD0A 1A47A 4TV5A 3P8JA 2JK2A 1NOUA 2R6OA 3KL0A 3ICJA 1JNEA 3AJ7A 3LLXA 1XJBA 3EWCA 1RVKA 4QQ3A 2RAGA 2VC7A 4EPBC 4L9YA 3R11A 3LOTA 3TN3A 3QPZA 3V3WA 2IPJA 2FTWA 1TTQA 3BG9A 3RILA 1PX8A 5HJXA 1H0GA 1PX3A 3O63A 3UESA 4DPPA 3VILA 4YWIA 2R1PA 3GK0A 4H9UA 3R8HA 1OGSA 2HK0A 2V5KA 4AXNA 4W7VA 4OU1A 2PDNA 4ML4A 4HJFA 3MI3A 3DXIA 5LNSA 3DKLA 4AYGA 1EUNA 1E1EA 2OXNA 2WNNA 3PG8A 5SWUA 3CNYA 3MJYA 1TR9A 3W73A 4YCPA 4B5UA 4JQ3A 3TW9A 3F4CA 2H3DA 2R82A 4REQA 3NQAA 5CC6A 3VNLA 2GPTA 3Q67A 2BMBA 3KCOA 1KWGA 3ZLFA 5C71A 4IUGA 4PUJA 2RH9A 3MC5A 4B5NA 1E6RA 2XSXA 1GVSA 4TTUA 4JNMA 2WMGA 2BP1A 2YA2A 1BGAA 4IFKB 1S1RA 4AIOA 2VL4A 3NWRA 4CD7A 3OEXA 4L6DA 2FZDA 1GZ1A 3DFSA 1ME9A 1WYIA 3M43A 1O6IA 4LV4A 5HWNA 4F4RA 3W1AA 1EL3A 1QO2A 4I7VA 1DJHA 1H41A 3MZNA 3URQA 1DJWA 3SCRA 4EKJA 5EB8A 2BBFA 3WNKA 1W32A 2J9XA 1P6WA 1KA9F 1JQXA 3S5NA 4MY8A 4LV9A 3MI2A 3NQDA 1QRQA 3C6CA 3JVAA 4LVAA 5CPQA 2F2KA 2V0TA 1V77A 5TF0A 1EJWC 1OK4A 4HU4A 1LZOA 5JBFA 4YHEA 2QCGA 4JHOA 3HJZA 3VIMA 5DANA 5BYWA 4S3FA 1EC7A 3LU2A 5F1UA 3WH6A 3HF3A 1JNDA 3E0VA 3IV3A 3U7BA 1LT8A 3ID7A 3L4UA 3CWNA 2X8RA 3BSGA 1HN1A 3ABXA 5AOUA 1XSJA 3WQ4A 2GSEA 4X60A 1EP3A 1DXIA 2FHFA 3GFYA 1PJ9A 3MHGA 3VNYA 3Q2DA 2O0TA 1Q8AA 5K4ZA 1T99A 4QXIA 5AZ0A 1UJQA 1D3GA 3TC3A 1JJKA 1LLWA 3QQWA 2PS2A 5HQMA 1Q4NX 2ON3A 3NL3A 4XWUA 3GKAA 2PU0A 1HGWA 1XXXA 4JOMA 4MWAE 1QI2A 3INPA 2J66A 1RCQA 1RBLA 3GXTA 3ENLA 1C7TA 4B4FA 1P0NA 1FOBA 1AZ2A 2OQYA 1S2UA 3ATYA 3MANA 5DCEA 5AC7A 5BOFA 3AJXA 2JGQA 4MY1A 2BVYA 3CIXA 4XQ6A 5KTLA 1IV8A 3PPHA 3UG3A 2OGJA 2GSJA 4XKYB 3I6TA 4HP5A 4WSJA 4D6JA 2HPMA 3W7QA 3GC2A 3EDDA 4PCPA 4PMDA 4WIWA 1ESWA 3UWWA 1V0NA 2PLMA 3CM4A 1K70A 3A5VA 4X61A 1OFBA 4CQCA 3G0SA 2WQDA 3VIIA 1FXQA 7PTDA 3LHVA 2WBGA 2BOGX 4DJED 1E3XA 3CQKA 3GBDA 3ZXWA 3KDOA 1C8QA 3LHTA 5KZ6A 4ACZA 4OWGA 3UPWA 1KRAC 3ITCA 3PUOA 4NZJA 2CWNA 2W63A 4MTVA 4LB4A 1A5UA 1SZFA 3F7JA 3VE9A 4C1NA 4DIAA 1GQIA 3HA1A 3FGCA 3S1UA 3W7GA 3WMSA 1LG1A 1POJA 1BKHA 2ZDSA 4YTRA 3AU2A 2WVVA 1KBJA 5LYRA 4AG0A 4MHBA 1M7PA 4UFHA 4AWUA 4L4OA 4YXGA 3UZ5A 3N12A 3AXXA 2VEKA 3LI0A 5D05A 4NAEB 1DE6A 2BVWA 3IJ9A 4NYYA 3KEHA 4AMAA 1E1CB 1KXQA 1YHTA 1KM4A 3KBWA 2ZZ3A 3TAKA 2JKPA 5FD0A 2CNCA 4BQ3A 1TVNA 1LORA 3RDKA 3W3OA 3KP0A 5LKYA 2PC8A 2AOSA 3F4NA 3NNTA 4DO5A 1TUXA 4CN6A 4GOAA 3C61A 4KEUA 4M1BA 1GPWA 5I06A 3MKVA 3CEUA 4QS5A 4NZFA 3KLLA 1F05A 3PTQA 5DMNA 4PUEA 1EJUC 3T0TA 1GOMA 3TLQA 2VR5A 2E68A 2QKFA 2VR2A 2XFRA 3HGRA 3R5EA 2VZUA 1TSIA 3VOFA 4DHGA 1BGGA 3RO8A 3W0KA 5D37A 3PJUA 3DN5A 3RCMA 1OF6A 4MB1A 3L4WA 2BTMA 3CGTA 5I3DA 3HB9A 4E8DA 1UR2A 2QUMA 4DWSC 2VFIA 1XH0A 2FTPA 2ZE0A 3S3GA 4AEOA 4UTKA 3N6HA 3QBUA 3TW6A 4K3ZA 4R27A 3VGHA 3TOYA 4RE3A 1K7XA 2F38A 3CPGA 4OJYA 2HNEA 4H8HA 2ZA1A 3QKEA 4U3CA 1JF5A 3W53A 4CQ9A 2YCIX 2DDXA 1EOKA 2NVCA 5I2UA 2CLPA 3N14A 3KBJA 1NIUA 2D69A 1VRXA 2O55A 3LG3A 4RDVA 2YL8A 3VOIA 5FESA 4UCGA 2BZNA 2GVJA 4IGSA 3P0WA 4NT0A 5T91A 1MO0A 3GDTA 4MGGA 3WNMA 3U2ZA 5FF3A 2VFGA 3FA4A 3R89A 1DOSA 2BXVA 5JUVA 3REQA 4IQJA 2C7FA 2BG5A 1KFKA 2PGWA 3GWQA 3THAA 4RCXA 1UH3A 4GCXA 4WKFA 1W1VA 1ZLPA 1MEWA 2WV8A 4AY7A 2CYGA 2W67A 5U4NA 4GY1A 1RXOB 3L2MA 4EF8A 5HJYA 3E49A 1UKSA 1W9XA 3SW6A 4POCA 2GSHA 3M7SA 4JIEA 3EPMA 3TDFA 3ALFA 4WOZA 1HJXA 1NU5A 1C8VA 2PURA 1GG1A 1H7WA 4R9XA 1OFOA 1KO0A 1G6CA 2FQIA 1FHLA 2GGEA 4ZB5A 1MQQA 2WB5A 3M0HA 3G1XA 2EPMX 3UT0A 4IMCA 3A64A 1TPUA 1LBMA 4IPJA 5IDZA 4NZ4A 4P7OA 1OCQA 3CMFA 4GJJA 2NLYA 3AS2A 3L67A 1YPIA 3WF1A 1NF0A 2Y1HA 2QJMA 2P0OA 3IV8A 1NWTA 4IIDA 1JI2A 3TFCA 3UPBA 3ECQA 4WDTA 5BWFA 2DIJA 1GQKA 3PY2A 5AY7A 4UMAA 4PUMA 3TAOA 1U1JA 3VUPA 5HJLA 3T08A 4AAJA 3T4WA 4U3AA 3A3HA 3WD3A 1OK6A 2ODOA 3GBEA 5A6TC 1WZKA 3GC5A 3M0KA 1PXGA 3P74A 2VCBA 4U28A 2O92A 2RDXA 4HHHA 1C90A 5AHEA 1Z9AA 2VM8A 5D02A 4JTDA 3C4UA 2VX7A 1XYZA 3SJ3A 3K4WA 1F9CA 4JS3A 1S5WA 3TEVA 4RZBA 4IWWA 3B8IA 1MRAA 4GUHA 3G1AA 4GUGA 1GORA 1UOKA 4O0KA 3OYZA 3WD2A 1GG0A 4PTWA 5HUOA 2GDUA 1IEWA 2QW5A 5BRPA 3O0KA 2W5FA 3WF4A 2JFEX 1WKEA 4JNYA 2P8BA 5F2GA 5KSWA 1RZMA 4MKSA 3OGVA 3U0HA 3W7JA 3Q4DA 1K03A 1VEPA 2FPYA 1W1TA 5BWAA 1LJYA 5GVJA 2DQWA 1FY6A 5LIWX 2DJLA 4YCOA 3CAKA 2XUCA 4JY9A 1XDJA 4A3RA 3ZZ1A 3T6CA 3DG3A 1OZQA 1QDSA 3GTNA 1HJVA 4H9XA 1CTNA 4XBJA 2R9RA 3VIKA 1TZ9A 4GIEA 1XX1A 4S3AA 3OVPA 4TO8A 1MRQA 3STCA 4NKCA 3O7UA 4GINA 3UBPC 4ZMGA 4NNCA 4F9JA 2CHOA 4KETA 3DG6A 1E4IA 4EOUA 1HP4A 4HN8A 1TWSA 5CXPA 3GVRA 1T96A 1OX5A 2B0MA 4B4HA 1ZP4A 2PE4A 5DQPA 1J9YA 3D0CA 3FAXA 1CB7B 1W1YA 4GCAA 1ZAJA 4WKHA 1HVXA 3VX1A 1UOZA 3LZ5A 2PDJA 3MHFA 2V3GA 1JAKA 4H4IA 2Y61A 4MSSA 3QZAA 4ENLA 1V3JA 2XZ7A 4UOJA 1KM1A 4D6FA 5FJJA 2I5IA 1SJBA 2D2OA 4LCRA 3B05A 1QOXA 1PWMA 2DZTA 3BOXA 4EPKA 5K2ZA 1AG1O 4OUIA 1EX1A 3W76A 4WK9A 2J79A 3SADA 1I2RA 4P5UA 3LCFA 3FXYA 4EANA 4I8YA 1RAKA 4FZIA 2Y24A 2BODX 1US3A 3S2CA 5AHNA 3RUBL 3G1SA 2X40A 3GKFA 2X42A 1QW7A 3P82A 3CB8A 3N2BA 1W91A 4LBRA 2NV1A 1JZ6A 2D0GA 3VKKA 3KZPA 2NLIA 2ZX6A 4GVHA 2A3AA 3VGEA 2X16A 2XH4A 2ZWYA 5LA0A 2RDWA 2EJ1A 3OP2A 1OGGA 5I23A 4QSHA 1XF0A 4LT9A 2W3ZA 1LWIA 7REQB 3CUZA 3RHGA 4AY8A 3B8SA 3I4EA 4LUYA 1YPXA 1JF6A 3HG4A 3MZ2A 5DMMA 3RGTA 2V81A 1GVIA 1HKWA 3T0AA 3UWEA 3NUKA 4O4VA 2A7NA 4FIRA 4P2VA 4C6IA 3QGVA 5C9XA 4CNTA 3LTSA 1TCMA 4KIRA 4P7QA 2A5HA 1XP3A 1I8JA 3RCYA 3PP7A 7XIMA 4FK9A 4A4AA 1IXNA 5BOEA 2INFA 2VWSA 2EG6A 3V18A 2E5CA 3OODA 3WEMA 3UZJA 5XIAA 3B0UX 4XISA 1BSIA 1ZTVA 1KFLA 4AVNA 1H7XA 1L6YA 1GOIA 3LHZA 4R88A 1KXTA 1SVDA 3CTLA 2WK2A 3LXCA 2OYLA 1OT1A 5GPRA 1JAEA 3BO9A 3A4WA 1RA0A 3SQMA 1XYMA 4E4FA 1SO3A 3H4XA 2GGGA 1CXHA 3G22A 3IUIA 4IF2A 4GJIA 5IHSA 4IQDA 1TA3A 2QLYA 3GW0A 2Z27A 3MQTA 4HT3A 3PVFA 4D71A 2UY2A 1E6NA 4ZQNA 1L9WA 4L9XA 5BW6A 5CAKA 2DW7A 1JPMA 4K2SA 1EWEA 5CPLA 1OX4A 3EB3A 1ONWA 4EXAA 1E15A 5DXYA 2UZ9A 3OGSA 1CLKA 3ITOA 1XYFA 2OWCA 3GG1A 4UCFA 1M68A 4NJIA 3BGJA 1NWSA 3BCDA 1GVEA 4AZIA 3RLUA 1UZDA 3BLLA 1QPNA 1IGSA 1XIEA 2FH8A 5ECUA 4PCSA 4C6PA 2NWSA 2I5QA 5HMFA 2Z2AA 2Z7KA 5D2WA 2EG8A 1BXCA 4PUKA 4B5SA 4JX6A 3FHAA 2VC6A 4IGMA 4Z2IA 3KOZA 3RYSA 3O2LA 3VCRA 3F2DA 1S2CA 4KT2A 1C92A 3BW3A 3TQVA 3WUBA 2PDUA 4DXKA 1GJWA 4WZHA 3PSVA 2NVAA 3TR9A 4HYWA 1ZPTA 3PTDA 1QPQA 2PZ0A 2FZ9A 1R2RA 2UBPC 5IOBA 1JPHA 1S2AA 1I9CB 2Y70A 5G1TA 3UFYA 4G1NA 3WZ0E 4UFMA 1W8SA 3E02A 1L6FA 3GTHA 3BAYA 2XWEA 3SN4A 4NX5A 4FXRA 2YZ5A 4E5TA 4DNHA 2R24A 2RUSA 3LLDA 5EMJA 2DZUA 3B0YA 4HIBA 1X96A 4PBFA 1C93A 4BY3A 4LCQA 1X38A 2VEIA 3L4YA 3M47A 1V3LA 3W7OA 1R87A 1Q63A 5A2BA 1I2NA 2J4GA 3KBNA 2QNEA 3PZGA 1V6UA 2FZ8A 5D9OA 1QOPA 3NOYA 3FYPA 2NQHA 4FPSA 2ZX9A 3BCJA 1WOBA 3JS3A 3N2XA 4FS9A 3FX4A 1FWBC 2VZVA 2YDSA 3QGAC 4KIEA 5EBUA 2JBMA 2XGZA 2Y5SA 4I3GA 2ACUA 2ZXBA 4F66A 1UKTA 3P6LA 3BW2A 3C0SA 3W1PA 1UWTA 2W4XA 3NURA 1EEXA 2QVNA 2J27A 4GQQA 5K9CA 2YXGA 3S8HA 1TE6A 3SUVA 4UMBA 3RIKA 4MPKA 4H9VA 4KERA 4PUDA 3C2EA 3CK5A 1DKWA 1G01A 3CPRA 3WFAA 2PBOA 3TNBA 8A3HA 3FCPA 3AYTA 2W91A 5DMLA 3AUOA 1Z7AA 3BW4A 3QV9A 3PFMA 4DWSD 1QI4A 4MWAB 1J4EA 1W0MA 4ZEPA 3NQGA 4CNUA 4L5ZA 1D2KA 2CZDA 1BF6A 4L9ZA 3G6LA 1O5QA 2P50A 3C0JA 3BLKA 3G1YA 4DO4A 4A3YA 1TTPA 1PZ0A 4KFNA 1J0ZA 3PUEA 1G69A 3BV4A 3VMNA 2IS7A 1L2UA 4R5EA 1SFSA 4RX0A 3SRKA 1OABA 2WMFA 3PBUA 1TV3A 3IPWA 3QC0A 2DGAA 1L6SA 3QY6A 3GW3A 3T07A 3E74A 3MMDA 3WUGA 4E3TA 3FY1A 4DJDA 2FTYA 4ERAA 1PKLA 1R86A 4GQRA 3KWSA 5CZSA 4FNPA 3WQEA 3L0NA 1HTIA 3V1PA 3O07A 3U2OA 4Z2LA 3LZ3A 2WLZA 2CLOA 3N04A 1IXPA 5GNXA 1B0IA 6ALDA 3W7KA 5EMLA 2ZXQA 3H8AA 2WJZA 4GZEA 4U2ZA 1Q6OA 3C3UA 1A5MC 4NSBA 4W5ZA 3MY9A 5CZJA 4GH3A 2FDSA 4J27A 4D8AA 4D6GA 3U3HA 4Y96A 5FJUA 3VXGA 4I9JA 4LBUA 8RUCA 5A1AA 4AHOA 2PLJA 4MZ1A 3MKKA 3V75A 2PU1A 3GIQA 1S5NA 1H1ZA 7A3HA 3MKCA 3KXQA 4UQAA 4HA0A 5I03A 1EXPA 1YXYA 3WK3A 2XGIA 2XFFA 1DQUA 2B31A 4W84A 3B04A 1B54A 3DFQA 4AIUA 4DJFC 1J0YA 3AS0A 2RJGA 3PAOA 3T7VA 4ZSTA 4JFSA 5CZKA 4B5XA 5PTDA 5LZLA 1J0IA 1F07A 1FQ0A 4REQB 1AJ0A 2OOGA 1BXBA 4L64A 5FIPA 3GE7A 1R85A 1TV5A 1H7RA 3G8RA 4RXFA 3CPUA 2L5HA 2G3NA 2VQUA 2FYMA 3KCLA 4GD0A 1R7OA 2YYUA 3F4DA 1I0BA 2CZFA 4FALA 4TVDA 2XN1A 4JTIA 1BYDA 4IFKA 5A8GA 1QPRA 3MW7A 3A24A 3APGA 4XTIA 1TQJA 1KFBA 4NYUA 4WOQA 4GIAA 3W83A 1TV2A 2XFWA 2X7VA 4GYKA 1AMKA 1B4KA 1TZ7A 3GNRA 5HANA 7TAAA 3NQ7A 4LFYA 1FCBA 3L2IA 3W7IA 1KGUA 1CXKA 1FWCC 2WZHA 2DUZA 4GQ0A 2PRHA 5HK4A 4K8GA 1A5KC 3IANA 4EXQA 1DWAM 1UP3A 1X8FA 2ZZ4A 3IJQA 2DVXA 4UFLA 4LS1A 3WY1A 2QCFA 2OX1A 4HHMA 3LYEA 3P5YA 4Q8WA 4HYVA 1XLAA 1FBAA 3DYMA 5AC6A 2Q01A 1TO3A 1FCUA 3RPTA 5M5DA 4J3ZA 3MI6A 4J35A 3EKGA 1MW0A 2GQ8A 3UCQA 4NZ1A 4RR4A 2I17A 3TONA 2MNRA 4LCSA 3MMUA 1KKRA 3W1RA 3HG3A 1OG0A 1TMHA 2R94A 4O54A 3U9IA 1TX0A 3N3MA 3M0JA 3HU7A 3QHMA 2JF7A 3D47A 4CNPA 1MVYA 4X9SA 1H51A 2BHZA 2R8WA 2ZZ5A 3WBXA 1XQKA 4L1XA 3UD6A 4K7YA 1HKVA 4ZGYA 4MFEA 1TPB1 3VO0A 1J2BA 1P4CA 4JZ5A 2Z4GA 3LMYA 4ICMA 3ARWA 4S2BA 4UOQA 1O5RA 1ADDA 4Q4KA 4H8UA 3FA5A 4XTDA 4GY7A 1PHWA 4K1GA 1YDYA 3W2UA 1NFBA 3VM5A 2QV5A 4CCZA 4E4PA 1KM2A 1YXDA 2C1HA 2VEGA 3ZR6A 3GIPA 1OF8A 1XLCA 3TH6A 2PGRA 4YYFA 2P76A 1W3KA 2GYIA 2ZC8A 1DJNA 4CQBA 2YBUA 4OZOA 3EDJA 4K68A 4LY8A 4C1KA 3M1ZA 1RK5A 3GDKA 1FXPA 3AROA 5J5RA 4WY0B 1MZHA 2F8QA 1V93A 4Q8QA 3VC6A 1GT8A 4PBEA 3PULA 3W72A 3DDMA 1WKFA 2AL2B 4IPPA 3CZEA 4L56A 2PTDA 4UC5A 4XZHA 4ZFMA 1SYTA 3O6AA 4O53A 4A05A 2AKMA 4GBUA 4NZ5A 2ANUA 1TZZA 1E5JA 1Q6EA 4JL1A 1A0CA 1FWTA 3VNMA 3LRLA 3A6OA 1H5YA 3GSMA 2EQDA 4B2DD 1QW9A 3POHA 2G41A 3BZJA 2W92A 4AXKA 3SSJA 5CG7A 2Z2UA 4GI9A 1DPMA 2E28A 3TKFA 3WQ5A 1YDVA 3DFTA 1BSLA 3TK7A 3U5YA 1A3XA 4QM1A 1KQZA 4DF1A 3OJGA 1XI3A 4GH1A 4OQVA 4ATDA 2P10A 1A5SA 4MB3A 5LGZA 4M80A 4JX5A 4K37A 3I7QA 1EDQA 3V16A 1H1YA 5CJNA 2E25A 4IM4A 2CETA 5M03A 3QLLA 4QAWA 1B3VA 5FJTA 4JYEA 1TCDA 2WSRA 5F1VA 1XLEA 4US5D 3BL3A 4PRRA 2X05A 3WD1A 4Z1YA 3PJXA 4DF2A 2I1OA 1Q45A 4GYPA 3M16A 4GUFA 3KS6A 3UR5A 4UB9A 4UR9A 1OHLA 3HMJG 3M5VA 1NP2A 2FDMA 5MF5A 5F4WA 4F0HA 1WP6A 1O7AA 1UR9A 3S6DA 1UR4A 2VUYA 2YL6A 3LEPA 5A2AA 1LOLA 4WX2A 2VRKA 5AYZA 3EAUA 1P0BA 1ZP3A 3S1WA 1EH9A 2QS8A 4C6EA 4PL1A 3AYRA 2VD9A 1IT0A 2PGEA 3UXIA 4HPHA 1VEMA 4A3HA 1KRCC 2V67A 2VTFA 3LCLA 3S4TA 1CXLA 4LB3A 2DSUA 4Y8FA 4UTWA 3AIVA 4YS1A 1QXLA 1UP2A 4MM1A 4PL2A 1E71M 4XAFA 3VU2A 3PBYA 3UWZA 4LNYA 4QQUA 1GQNA 3TA6A 4GQBA 2WCAA 3L23A 4CN1A 4ADUA 3D3AA 1YTEA 1PZ2A 1HJUA 4O10A 3I65A 4LUSB 1V6VA 1QU4A 2VMFA 4CD8A 3BJSA 4QFUA 2HK1A 1WDWA 3OGRA 3QR1A 2WMHA 3B03A 1EF2A 4DWSB 1BVZA 4MNKA 4NXSA 4IJBA 2VZSA 1X1ZA 5E09A 3TJ4A 3C3NA 3KOFA 1F76A 2VEFA 3FXGA 3SGUA 1I6NA 4KFOA 2PDIA 3ZLGA 4MB4A 1NDVA 4C6DA 4AVOA 1H62A 4U10A 1IZJA 3AIWA 2WHJA 1QTWA 3WO8A 1G4SA 4MLJA 2PMQA 4BFAA 2WSQA 1AJ2A 4YWSA 1F3TA 4Y9MA 3HURA 1V0LA 4BF7A 4QJ1A 2X0HA 2F9RA 5JH1A 4OECA 1PHQA 2DSKA 2GGIA 4JYDA 4LW7A 4MIMA 1XW8A 2AGKA 2F6XA 4KPLA 2QIIA 3GO2A 3TYZA 3QFEA 1W5MA 4PFHA 1E6SM 3MUAA 3CLWA 1BG9A 5CJ5A 2ZVIA 6A3HA 2DP3A 4QNEA 5DN1A 1XL9A 3KVKA 1T41A 1YLVA 5GJMA 1TVPA 5HDRA 3C86A 1VJIA 3B8WA 3VOCA 3VOJA 4A3UA 2HS8A 3WLSA 1FX6A 4QAIA 4AH7A 4IX0A 3GAKA 1Q6QA 3WLQA 1VR6A 2X09A 4A8IA 1QK2A 4E0CA 4HNOA 3UXAA 4LXFA 1H63A 3QRHA 1M7OA 2ALRA 1V6YA 4LEFA 2XVKA 1TPFA 4JIQA 4Q4QA 1XSKA 4PN2A 1X6LA 3LNMA 1SU5A 1DWIM 3W02A 4Q4PA 5DT5A 4PZVA 3WQPA 1KFJA 5JBDA 1R3YA 5DT7A 3BG3A 5TD4A 4AD1A 1SR0A 4X9YA 2G8ZA 3OLEA 3T2PA 4Q8NA 3HM7A 1Q6CA 2OO0A 3UXDA 5GJNA 3PAJA 1UD5A 3VC5A 3M5ZA 1AD1A 3AYSA 3T8QA 1GW9A 4GZIA 3OA3A 1EA0A 3W7HA 3VD9A 1FHUA 2X30A 4ZQPA 4JDYA 2DZSA 2H8XA 4QCFA 2BS9A 3VZZA 2QHAA 3G8EA 2QDEA 5FEZA 2IKJA 5CGTA 2W66A 5KEZA 2ZVRA 2X1RA 1B31A 3QKZA 3BE7A 2O56A 4O1BA 1JYWA 4HU0A 1OINA 3MSYA 2V3EA 2GUBA 3P93A 1V3IA 3BDKA 1FKXA 3E12A 3ARRA 4RKAA 4MAVA 4KBXA 4QP0A 4QX4A 2G96A 3VCCA 2E7FA 1J8VA 3CQHA 3LBCA 4C6LA 4I7WA 2YR1A 1S2TA 1XV8A 2TODA 2OSXA 4E2VA 3KRZA 5C0QA 2QZRA 4D72A 4LS2A 2XIIA 4RPPA 1QWKA 4ZL1A 4Y9OA 1LRQA 3VIFA 1Q6FA 3WJWA 2J7DA 1OBAA 3ERPA 2VGIA 1HFBA 3SIMA 4QGCA 4QG6A 5I79A 3GVVA 5C7HA 1JD9A 1XLLA 3BC9A 4DJFA 1BTCA 3ZIZA 2Z6IA 4YPJA 1EDGA 1SO4A 2Y62A 1U2YA 1VBUA 5LNUA 3CHVA 1JXKA 1S5VA 3EWWA 4JEQA 4ZE4A 1UC4A 3W86A 3NCOA 3G3MA 3SSZA 1CZ1A 1S3TC 3NGJA 4GK8A 2HVMA 4MDOA 4WUIA 1PEZA 3PSWA 1JZ7A 3C8NA 3MO4A 5CBBA 1FWWA 2PP0A 4Q8UA 3R2GA 3FGCB 4ICCX 3W88A 3QSRA 1OX6A 1A4LA 2DEPA 3NXLA 5BU9A 3VDBA 4GI4A 4G7FA 1F3XA 2V2DA 1E4LA 2OKTA 1E73M 1XGEA 2JIWA 1OT2A 3S9ZA 2ZDRA 1X1NA 2EPNA 1GKPA 1Y0EA 3MS8A 2TMDA 3FDGA 4AX6A 1Q7ZA 3WCZA 1DBTA 2VOMA 4NI8A 1OIMA 1PKMA 2QJJA 1G4PA 4CLMA 4LC6A 1RVGA 1CWYA 1J12A 5AYBA 4LANA 1W5PA 1S2WA 3MTWA 3NTYA 1T8XA 3IGXA 3ARTA 2A3LA 5AVNA 4FNQA 2VP8A 4YTTA 3NGFA 3T09A 2BASA 1CEOA 1E70M 1XICA 1XGDA 3HIJA 2BGSA 1ODUA 1CPUA 4AZ7A 4KMQA 1QT1A 1O5KA 2WVVB 2YYTA 4MYXA 3CWHA 4O19A 1TWWA 2CXGA 1WO2A 5DELA 2VELA 2ISSA 1F74A 2XH7A 2PWFA 4QG8A 1GWJA 3AO0A 1UHVA 2OO6A 3BMXA 3QSTA 4LC8A 4MNMA 4D2JA 4KEVA 2OZ8A 4R7JA 5ABFB 2NQZA 3VOHA 2EKGA 2Y88A 1C29A 3CZKA 4FNUA 3UWYA 3V1HA 1QR7A 4RZ4A 4TVUA 3UGRA 2V69A 4O16A 3TWBA 4NJJA 3I7SA 4UNLA 1XIMA 1OB0A 2D23A 1H61A 4D1IA 4P61A 1SJAA 3UEQA 4ERIA 1YQ2A 2JE8A 1CENA 4KCTA 5ABGA 1UD3A 3RPMA 2WMIB 3S6OA 3N4FA 1JXJA 2DZAA 4TXEA 1M3UA 4QR6A 1P7TA 3O05A 3E2SA 4IZGA 4ZOEA 5DEZA 3JZUA 1ISZA 1QHZA 2E5BA 3HGSA 5LSMA 4KWUA 2VFDA 4DJDC 1RD5A 3I10A 3IACA 2XN0A 3VKBA 3W29A 2OWXA 3BLDA 4PMVA 4J28A 1CXIA 1XR2A 4I8DA 1OYCA 4MJMA 4EWJA 1EIXA 4NASA 2DVUA 3BV7A 3BANA 1TE1A 3A12A 3UJSA 4FEZA 3W71A 5AC4A 3I6EA 1Q8JA 1MW3A 4JFTA 1Z8AA 3LHWA 2BB0A 3QOMA 3UGVA 4PCTA 5G4HC 3VTRA 2Q02A 3WENA 2G3IA 2YDAA 3GR4A 3HGJA 4DEFA 2XIQA 3A5FA 2IPGA 1FTXA 3WNLA 4XZNX 4YYCA 1GHSA 3JW7A 3DUGA 1GONA 2RFGA 1TPEA 3AS3A 5CLWA 3SQSA 2OLHA 1C8XA 1R30A 2BGQA 3GYEA 1B3YA 4LJ3A 5FL1A 2W61A 4AU0A 3TJXA 2YBVA 3EEZA 3DIPA 1HL8A 4AIBA 3GXIA 4EVZA 3GVWA 3HQOA 1W3LA 1POKA 3G1FA 3AICA 3VD5A 4HSNA 3S2JA 2A3BA 3RM8A 2ABBA 1K1DA 3MUCA 3M41A 1C9DA 4O18A 1KGXA 4DWDA 3A22A 2DT1A 3OU8A 4CUCA 5IFTA 1SO6A 4DRSA 4FOUA 3STEA 4B92A 1NOWA 4O11A 5EPDA 3H2EA 3WH9A 2INZA 1RA5A 3KRSA 3I6RA 3DX5A 2OB3A 3JR2A 7ODCA 4DZAA 2CHRA 1SW3A 4N9CA 4J9JA 3DZ1A 1UR0A 1TB3A 4J3XA 1TWIA 5BU6A 4CU8A 1EGMA 1LWHA 4GFSA 1EKOA 3T0DA 4A2RA 2G50A 1AJZA 1OY0A 2PFHA 3VNZA 2GK1A 3L4XA 4MKVA 2PDHA 2HNHA 1W1B1 1K02A 2C79A 4GUIA 1FFQA 1D7KA 3LGGA 5MHBA 4YTQA 2CERA 2ZRVA 3VABA 3LX9A 5EFDA 2DZBA 4M19A 1DQWA 4E2BA 5ABHA 1TJPA 4UTFA 3M0XA 4LRSA 2OSWA 4UTTC 4CD5A 1H49A 5DRIA 2CZ5A 3LTPA 3LPPA 4XD5A 3GVGA 1ZSXA 3OOQA 2FVMA 4PE8A 1ZZMA 3NDOA 1I45A 3SFKA 1MMFA 1RK6A 4C65A 4GX9A 2A6NA 3M7WA 3VVGA 4N6EA 3LS9A 4FB7A 4UQEA 4Z1CA 4Y9AA 2I16A 3ZJ7A 1AH4A 3DEQA 4OKDA 4HPJA 5K9DA 1CGXA 2GJRA 1LL6A 3W07A 5E1QA 2POZA 1RPXA 4I9TA 3TTYA 1KKOA 1F5ZA 3WLKX 5BMWA 2PDFA 4PUNA 3M0VA 1EC8A 1WAWA 4QJ4B 1CBGA 4LUTB 2OMAA 5D03A 3KE0A 1ZFJA 2V5CA 2V5BA 3LHYA 4W7UA 3P7YA 1V6TA 5FF4A 5HOSA 2FPTA 3RCNA 4ZXLA 1BYBA 2C8NA 1HXJA 2BVDA 2QGYA 1NOFA 2VQTA 3AI0A 3UZXA 4DJEC 4Z08A 4I7UA 4QHRA 4S2CA 1PL9A 3S9IA 3EX2A 2OLSA 5DX7A 3L5LA 4YJ5A 3B4YA 1G9HA 4DVOA 2JALA 2XSBA 1OG6A 1JDEA 3UWVA 4U4MA 1QWGA 4HOZA 4O50A 3U5UA 3L7RA 1EX5A 3SUTA 1HZYA 3R6IA 3G1VA 5FF2A 1KM3A 4MVAA 3FEMA 2QF7A 4QG9A 1B3WA 5I3KA 3GHRA 1S39A 2HVOA 5D32A 3O15A 1TVLA 1YEYA 4WF7A 2YA1A 4GKTA 1IZKA 1X7FA 4FOJA 4W5UA 3BAJA 1CECA 2QGHA 3WQFA 1EUAA 1SM9A 4URIA 3MHUA 4AEFA 4NJGA 3R0KA 3UWUA 2ZOXA 1TQXA 1W31A 3TTOA 1VCVA 1JG9A 3AWNA 4JIPA 1XIFA 3GU9A 1RQBA 3BGAA 3NIYA 2QCDB 3GB6A 4AZGA 4GUJA 4FX8A 3IIZA 3TX9A 3M6YA 1ZENA 4DNMA 5H1WA 2Y8KA 3CAWA 3BUVA 1SSGA 3O1NA 2HXTA 4A8RA 3N25A 2DT2A 1ZGDA 3R1ZA 4MG4A 4XZ9A 1UKPA 4QSFA 4NF7A 1K4GA 1XIGA 2TAAA 1FP9A 1E9IA 2HJPA 3B9DA 2IQDA 4O1FA 3GR8A 2E3ZA 3QMRA 3N2MA 1EJSC 4Y6GA 4DZHA 2JIEA 2ZCGA 6REQA 4JTHA 3VYLA 3N3TA 4C6OA 3VUSA 2ZUSA 1ITUA 1IGWA 3E6EA 4IQEA 1PDYA 4AC7C 4AEEA 4X0VA 1ONXA 5F2MA 3T81A 5B7YA 2PTYA 3BTNA 1KTCA 1O4UA 4KH2A 4UFJA 4QS6A 1Z6KA 1GYMA 2GUUA 4GJ1A 4JQ1A 3IVSA 4TMBA 4CCDA 1T0OA 4ONVA 4Q7NA 1F6KA 3WLTA 3M0ZA 1QI5A 4BS0A 1NDYA 1AK5A 1E5NA 5B7ZA 3RAOA 1LLZA 4DXXA 4NILA 4H2HA 4UR8A 5LHEA 3ZR5A 3P5ZA 1ISYA 3WMLA 3EX4A 3FJ6A 3WD4A 1QOQA 4PSRA 4ADTA 1VBRA 1MXDA 3T8LA 3S5OA 4OOUA 3W7CA 3WDQA 1TWDA 4LNCA 4S23A 2VCAA 4F0RA 2GVYA 3B9AA 2JEQA 5F2IA 3D6NA 2Y7FA 5I24A 4YNGA 3HPSA 5KITA 1UD4A 3H2FA 2Q3OA 1EYWA 4RW5A 3AHXA 4GA8A 3O06A 4H6QA 3K8MA 4DUOA 3WF2A 4HNTA 1E3ZA 2QCNA 4F3HA 4DBSA 1WUFA 4C7FA 2YL9A 1XHGA 3TV8A 3VDAA 2VUNA 2WCGA 2VRJA 1F3EA 5FA5A 3A3XA 4JPGA 2WM1A 4F0KA 3FAWA 3CV1A 2FMNA 3GXFA 1H09A 5BMXA 1NEYA 3AZRA 3L0KA 1Y8BA 1BWLA 3VMPA 3THQA 4GXPA 3W1XA 4KRTA 4WKAA 1X97A 5C9ZA 2CLFA 4BA0A 1DJQA 3CWOX 3TU9A 4XAZA 3E0FA 3LRMA 3B8VA 3QTGA 4KWOA 1KRBC 4O0QA 3T42A 2CWXA 1R3QA 1A5BA 4IL0A 2YGYA 4PB5A 1YE6A 4MKNA 5BROA 2WW5A 1X98A 3UY7A 1WDSA 4BEUA 1AODA 1PSCA 3T2OA 1XC6A 1PBGA 2NW0A 5A8NA 4Z0JA 1XBVA 3LM7A 2ZUUA 3FSUA 1PCWA 3QH2A 4FA3A 3FJNA 2J75A 3WUFA 3UQNA 3L5MA 3CYJA 1I0DA 1EWDA 3AOFA 3QOKA 7TIMA 2OG9A 1ZL1A 1GK8A 2XWDA 5CC7A 4HTBA 2BHUA 1XUZA 4ZA0A 1LBFA 3EOEA 4ZZ9A 2HDJA 1FWGC 2BGNE 4HB7A 1W2PA 4GYPC 1KTBA 3QZ6A 3TSDA 1PE1A 1UUQA 5A6SA 4ASTA 1J5TA 1BWVA 3STGA 1XDLA 3AIEA 4JFVA 4AMCA 3AU6A 2Z24A 1SR9A 5I7GA 5HNRA 4C6BA 5I3GA 2GOKA 1G94A 1HJWA 3KBMA 3N15A 3UZZA 2GDQA 2D0HA 2POTA 4LWWA 3TWAA 4B5TA 3ZMRA 1C7SA 4UZUA 3W84A 1O95A 1QJWA 2X1TA 4D8LA 5CKSA 2PB1A 2NT0A 4UQDA 1RP9A 1VFHA 5HINA 1VH7A 1F6PA 1XKYA 2Z1VA 5REQA 2WJFA 4NX0A 1BG4A 4CVUA 5KZEA 4YN5A 2NQ9A 2PPGA 4V1XA 5CC5A 2NT1A 3BAKA 4N02A 5T9BG 4H8VA 3TQ0A 4AB4A 3WG6A 3CAQA 4GFIA 4PODA 1E43A 1QPKA 2Y89A 5E0KA 3TW7A 3S0CA 5DRCA 4AD0A 1LQ2A 3PANA 1UKQA 1TRIA 4P8UA 3TTSA 5FJPA 1J93A 1EYEA 3M64A 4DELA 4LX4A 4DUXA 1NFPA 4GPNA 3W1QA 4H9MA 1CXFA 4Q32A 5I3HA 3SY1A 1XYLA 4MOZA 4DWSA 4XSMA 3MJMA 1UQZA 3TCEA 3QW4B 5CSRA 3P14A 3CHCA 2ALDA 3S83A 2CLMA 3GG8A 3W2KA 4QISA 1KFWA 2PEVA 3DOPA 4X2RA 3H22A 5BXTA 3SGZA 4AISA 4PH6A 1SJCA 3ITXA 1S5TA 1MEHA 3SCOA 3GFZA 4FNSA 4HQVA 4IJRA 3PTMA 3R8RA 3FNDA 3K8KA 1KLYA 5AHIA 3W4RA 2G97A 4LAZA 3ZR4A 2Z28A 1Q66A 1LWJA 1ML1A 1VQTA 5LNWA 3N29A 3GS6A 4BCEA 1X7IA 1BVNP 3WMCA 3CB3A 5FJRA 2ZRXA 3KBVA 4DJDD 3GHUA 2YCLB 3T4CA 1UPPA 1CI1A 3B40A 3GY1A 3G77A 3EWYA 2Y8VA 2QUNA 3TIMA 2RDUA 1FCQA 2YCJA 2HE5A 2UY4A 3UCCA 3MDUA 3URAA 4RXGA 5CH9A 2Y8UA 3L68A 4DF0A 4RLIA 4W89A 4DO6A 4CQ8A 4WDUA 1A4MA 4RZ6A 5CLTA 1N82A 3TZNA 3W7LA 1ZB5A 3NEVA 2PGFA 4XK2A 2CBJA 3AMCA 3TQKA 3R94A 1M7JA 2ZICA 4P8XA 3FJLA 1UWQA 2ZZ2A 1OFPA 4HMNA 3V35A 4V28A 4F48A 3H12A 1KBBA 4IIFA 4GI8A 2DJXA 1DORA 1I60A 1XFBA 3SCSA 3TSBA 1K8CA 3SFWA 3KRBA 4Z2HA 4J7RA 2J8FA 1JCNA 1W9PA 1WPCA 2ZUWA 3OHMB 2WSPA 3NQBA 3H24A 3HPXA 3FJ4A 1UIOA 1TPH1 5D9MA 4AZCA 4EPEC 1LQAA 1NP0A 1V7YA 2E4TA 3NO5A 2HBXA 4IG2B 5JMUA 3B4UA 1VC4A 1WOAA 3WNPA 4KCWA 1DV7A 2P0IA 3P0XA 4FF5A 1W3IA 2A4AA 4BJHA 4PCFA 5LHFA 4ZR8A 4M3PA 4MLRA 1PZ1A 2WZEA 4B3KA 4HA3A 4IH3A 3H55A 3MCNA 2XH2A 3UYCA 5I3FA 4NAFA 2YOCA 1UROA 2DVTA 2QMKA 1A3HA 1YW1A 3B8UA 3TC6A 3KTSA 2XM2A 5C2XA 5DXXA 3W2MA 1YYAA 3HQ1A 3K2GA 2WVTA 1N7KA 1KBLA 4MNJA 1KTNA 1R3TA 3OZOA 4HZMA 4C6FA 1AW5A 4IQLA 1I2OA 4UBPC 4XD4A 3GU2A 1VF8A 1V02E 1V0KA 3TMLA 3S5ZA 1LF1A 4LUJA 5HA7A 4B9ZA 3MVTA 3M0MA 2OKOA 4IP4A 1GVOA 4C1LA 2EGZA 3II1A 1RY0A 1VPXA 1EO7A 2QCDA 2FZBA 4R9OA 3CUHA 4O57A 2IKGA 4GBDA 1PIIA 3VD7A 1OCJA 4KRZA 1E9YB 4GQGA 4O17A 1CCWB 3DFPA 1REQA 2HMCA 3W26A 2YFNA 1JZ2A 2ZRZA 3ITTA 9CGTA 3HMCA 2GQAA 3LV5A 1ZJBA 1JCXA 1N55A 2ZX7A 4W93A 1FWFC 2WNQA 2J62A 3C2VA 3R7MA 6REQB 1TX2A 1W8GA 1PB0A 4OE7A 3C2YA 1OX4B 1FDZA 1LRTA 2E6YA 1DVJA 1JDCA 1R3SA 1IYXA 2H90A 4N4QA 1NQKA 1HP5A 2X2GA 2OZTA 1HQTA 3NDYA 2C15A 3W9ZA 4Z2GA 3WQ6A 1XQLA 2OCZA 3TN6A 2E8YA 3K8LA 4ZB2A 1P6CA 2HRWA 2Z1SA 5CPTA 3WLOA 4J2PA 4MY9A 8XIAA 5AKQA 4OBSA 4KFPA 3DBPA 3DHDA 3S2NA 4S3DA 5M17A 1Z3NA 4ZO9A 1KM0A 1H60A 2PWGA 2V82A 5LIYX 4GIRA 1RLCL 3AMDA 5M2FX 1VHCA 3WNNA 3EX1A 1PVNA 4I5RA 1UJPA 1W1PA 1H1NA 1FKWA 3ES8A 2X1SA 5XINA 5JIWA 4I5XA 2CLKA 2FFCA 1FWIC 2BY1A 1HW6A 3WBEA 3AXKA 4JL2A 1O68A 3K13A 3VIJA 4S38A 5HBFA 2VENA 4IMGA 4IIHA 2NUYA 4YMZA 4X22A 2P1FA 4HA1A 2AAMA 3E2QA 1F3WA 3UG5A 3QMTA 2ZX5A 3F4WA 3WMBA 4EIVA 4C6KA 4ECLA 1UUOA 1M6JA 3MMTA 4UTIA 3C5QA 1C91A 3MSDA 3G5EA 2CITA 3N2TA 3N2CA 3BARA 1KC7A 2FPVA 4K36A 3CT7A 4B90A 3WBWA 3KLKA 2GOUA 1TJRA 1ZALA 1EJTC 3O16A 3ONBA 4GACA 2QUTA 2DU2A 3L4ZA 1XBYA 2FJUB 4G8TA 2GFTA 3LGEA 1GVFA 2NX9A 1J79A 1EO5A 1RJPA 1XD0A 2QUVA 4HCDA 4DXVA 2GLKA 1PYFA 4FLRA 5C8BB 3E2RA 3WQWA 4TU1A 4FLOA 4S3JA 2Z1BA 4LVDA 4LUSA 2PDCA 3G1DA 1TA3B 3G18A 4O1EA 5FJOA 4X0NA 1PWLA 1YNYA 2PC4A 3EMCA 4M1RA 4RUBA 5CAHA 4B3ZA 3F2BA 2J88A 2DT3A 3PZ9A 3FVMA 3IAPA 2OPJA 3JU2A 3SUWA 5G2WA 4G7EA 1M41A 2NXGA 1H7PA 3CXOA 1H4PA 4XUGA 2V68A 5DO8A 3WF0A 4QLLA 3BCFA 3LHUA 4NQ1A 1LT7A 4PBGA 4UMCA 1MDLA 3NZPA 1JI1A 3DC0A 2DPEA 1VFUA 4J3UA 3LB0A 4I5UA 5G1MA 1H7NA 5G4WA 3PPCA 2CBVA 1R9XA 1XRVA 2CIPA 1TKKA 3SUUA 2OSYA 1Z48A 2A0NA 1KM6A 2NWRA 3WKZA 1HIZA 4BI6A 2CU0A 2RKXA 1E72M 1E1CA 3THUA 2PP3A 1TREA 2ISWA 1MQPA 4Q6XA 3T2QA 3VIGA 1JYVA 3VNKA 2OLAA 4HSHA 3PJWA 2G5WA 2DORA 1JCYA 4LAOA 1JULA 2FGZA 1KFCA 4FF7A 2VOTA 1E0XA 4HHLA 2A3CA 4QDPA 3I3DA 1TYGA 2ZRUA 2PDMA 1THFD 3DYOA 1LG2A 3LQLA 2DH3A 3QJAA 1T8QA 4M6VA 4H01A 1C8YA 2BXYA 2QMJA 3L2LA 1J10A 3QY8A 1O5XA 5C9UA 1WNOA 4JN7A 5T9CE 1GOOA 2IPFA 4JFUA 5AECA 4FMVA 4G9PA 4F2UA 2ZRYA 1V03A 4GXWA 3EXSA 5D2TA 3Q37A 2VXNA 4G2DA 3N13A 3AFBA 4QDWA 3ZM8A 3NM1A 2OZ3A 2E40A 4WXZA 2QJHA 1LROA 2FJKA 4JFWA 3SRFA 5HMDA 3KTXA 4PMZA 1G7UA 2Q6ZA 4IP5A 1P0DA 1B3XA 5C6MA 3H7VA 3JZEA 3N2OA 3WLIA 2VX6A 3B9NA 4S3CA 1VFLA 1W9DM 1OYBA 1VCFA 4QLJA 1C3FA 5EMMA 1WA3A 2OQLA 1Q3NA 3EWDA 1NWUA 1B1YA 2PTXA 3PZNA 1AW1A 1JDAA 5F4XA 2VVSA 1BEUA 4AF0B 1T5AA 1QNSA 2X1IA 1XH1A 4JGDA 1PPIA 1SSDA 2H3BA 5BOOA 2WQPA 2PDYA 1DQXA 3ZVHA 3N18A 3CUIA 1CDGA 3UR8A 3BG5A 4LAUA 1P1XA 4JHZA 3W74A 2J77A 2H9AB 4MUZA 4GVGA 4PRWA 4LAMA 4F9DA 3KBSA 2GVGA 3N17A 1OFAA 5F4SA 1WV2A 4KS0A 2Y4SA 5D9PA 4LQ1A 4IPIA 1VBJA 3WLJA 1IEIA 4FSAA 2IQTA 1U1HA 3LQGA 5BRQA 1XS2A 4PMJA 1PTDA 3NQMA 3EDEA 1W9BM 3RX4A 1WB0A 1GOXA 1OJXA 3USBA 3UP8A 3NQVA 4M8UA 4S3KA 1R47A 1B9BA 1FRBA 4MZYA 5AHMA 3DKJA 1VENA 4FIQA 4QRNA 3PK7A 2I56A 3BGGA 3IJ7A 4FX6M 4BR1A 3L12A 5H8MA 5CPMA 3H26A 4GGBA 4FR1A 3DGBA 2WKJA 1P5BA 4QE4A 1PDZA 1UQYA 3TTEA 2JF6A 1P6BA 4PULA 3CHDA 4RL3A 3MSGA 3STPA 3AALA 2QPSA 4HN4A 4MF4A 1MXGA 5D04C 2DSWA 4KGJA 1BHGA 1LYXA 4E38A 4D6CA 1NM9A 4MNLA 3S2MA 2WJDA 3SUSA 4BQ2A 2X1UA 4OUEA 4NP7A 3UNDA 1GZJA 1HO4A 4ATLA 3GM8A 2VGGA 1BVWA 1QO5A 3BLFA 3EKZA 3OVQA 1MI3A 2W6RA 3UZYA 1WBJA 4BWLC 5L9FA 1HGYA 4Q4RA 3NPUA 1KM5A 4QROA 1AQHA 2REQB 5CZ0A 2B81A 3ANVA 3NDZA 3TVAA 4LOCA 4Z2JA 2R1MA 2PCQA 1LTDA 1YBQA 4R53A 2CBUA 4TQTA 3BAIA 4L1WA 5BRBA 1JCJA 3KP1A 3L66A 4EACA 1BF2A 1QPOA 1W5QA 4WXYA 5ABTA 6TAAA 3GNDA 4XD3A 4DZ5A 3HV8A 1UR3M 1XG3A 1UC5A 4A6GA 5E6YA 4XX6A 2XFYA 2PUZA 3NVTA 2XU2A 2AQOA 1V4YA 4M5PA 5HMSA 3FW6A 1S3HA 4UQ9A 3PNUA 5I07A 1K6AA 2A1YA 2IKHA 1QI3A 1GVRA 2ZWZA 4ZOBA 2QJNA 1CT5A 4AZ6A 1ODZA 4AZBA 2V3DA 4AQLA 3BMWA 4UTUA 4ORMA 5AZ1A 1ZBKA 3S5SA 1MUWA 1UBSA 2V6AA 1HKJA 3DERA 3WL0A 4YVVA 1B30A 1JIBA 5FL0A 5FOOA 1RD6A 3CHEA 1JFHA 3MA8A 2E6DA 3TN5A 1K7EA 1GCYA 4HZ8A 5T8GA 4OBTA 4MYAA 1DTUA 2ICSA 1GOWA 1G5AA 1RH9A 1I2QA 2WNWA 1QW8A 4X2PA 1YTDA 2OODA 3FOKA 5MKGA 5DF0A 1KV8A 3SCUA 3S1VA 4ZOCA 2FB3A 2ZRWA 1PUDA 3M6DA 5IBXC 3W2JA 3PBMA 4MMWA 2BY3A 4QCEA 4HZ7A 3U48A 2WANA 1FP8A 4EK7A 3WEOA 4YHGA 4PMQA 5I00A 4HA4A 4QJ5B 4NI3A 6XIMA 9RUBA 4DUVA 3W81A 5KETA 1RJRA 3QY7A 9XIAA 3S6TA 1TPWA 1XYAA 1AL7A 3GH4A 1WDRA 2D20A 1H5VA 1QK0A 2HBVA 3PZVA 3NL2A 4F79A 4NRSA 2OYMA 3W7DA 4JNZA 1K8XA 3T78A 4JX4A 3HGOA 3RN6A 1D7FA 2VGFA 2VJXA 1XG4A 5H8UA 1F6YA 1IR2A 3LCHA 4W87A 3CMGA 4HZ6A 1YTKA 3OLDA 3WH5A 3K46A 3UXLA 3ARQA 3RO6A 1TR1A 2FZNA 5KMYA 2J6VA 3RNDA 3LCXA 3HTWA 3W28A 1BQGA 1UR8A 5A8PA 1J2WA 5JQ9A 4XZMX 1PTAA 4BKNA 2YBTA 1XRSA 1ZAIA 3EOUA 4LPCA 2G4JA 3VINA 3Q65A 4J1OA 5D2YA 3RX3A 3HN3A 4UOZA 4N9EA 1ZJAA 2XSAA 1B57A 4MWAA 1TWZA 2Q09A 1LL4A 3UNTA 3KHDA 3FSTA 1VFMA 3H2OA 4FP1A 3W00A 4WDWA 1TTJA 3IIPA 3SN1A 3WJYA 3WQOA 5FACA 3DG7A 1V6WA 3RU8X 3MWAA 4C6QA 2C6QA 3VGBA 4QE1A 3V0TA 2BV9A 5G2HA 4Y7EA 2TPSA 4GZ7A 1EPVA 2E1WA 3EEGA 4EE9A 1SW7A 3URBA 3NVDA 1XRFA 2X2YA 4GNJA 3IGUA 2IXVA 3HPFA 1R3RA 3NJ3A 3MB9A 2VWTA 1GPFA 4O1DA 4PTXA 3ES7A 3KCJA 3HJEA 1PTGA 1Q6DA 3B8DA 2CEQA 1RCXB 3TLLA 3WQDA 4CCEA 2V8ZA 2EAWA 3NL5A 1SZGA 3H2CA 5TBOA 2XGBA 1UPMB 3Q45A 3O6YX 3I7RA 3IJIA 3IIOA 5E9XA 1D3HA 2PDWA 1YNPA 1ISXA 1D3CA 3CO4A 5K3VA 1X8CA 3VMOA 1W5NA 2Y63A 1RSCA 1PKYA 3TYBA 3UU0A 1B3ZA 2WAGA 1BAGA 3WLMA 4BK9A 4ZXOA 1VFOA 2YX0A 3TYDA 3EX3A 1JUKA 1VLWA 3KUMA 4IOTA 4ZO6A 4DYJA 4AFYA 1KBKA 3DYPA 2DSVA 1W6TA 4PTNA 3ZJKA 4RE2A 3VK5A 4DAFA 2GQ9A 3TXZA 5JIPA 1EA9C 1JPKA 1V79A 4EPDC 1IR1A 4WJEA 3QZEA 3CL6A 1VIZA 4LU0A 5JVLA 3NSXA 1JRBA 4DBUA 1K8YA 4P8VA 3Q58A 4OT7A 3GDMA 3SAZA 1PYMA 3WELA 3IRSA 1ZNNA 3WYZA 4JEJA 3THCA 3FN9A 2VZTA 1QNRA 2YCEA 5K9XA 1I1WA 2HISA 2VKZG 3PB2A 3E2VA 3QHOA 6PTDA 3MV11 1KCKA 4FXSA 2KZHA 4DPQA 4S3EA 1N8IA 2A3HA 3P67A 1A50A 2XVGA 1ADOA 3CS2A 3BICA 4RJEA 3QHNA 3HBLA 1XBZA 1GW1A 3NSNA 1JUEA 4MJZA 4DYKA 4HMEA 3ORWA 3V5OA 3IVUA 3NQCA 3WQ8A 1WDQA 4N6FA 1RLDA 2NQ5A 3H7RA 3VDGA 2OEMA 3GD6A 4EXBA 4K7VA 2NSXA 5HAOA 4O1AA 1WQ5A 4BF9A 9XIMA 2UWFA 2NX1A 3SO7A 3UVIA 3HQPA 3M5YA 4M7SA 3DBNA 4QE5A 1CGYA 4TIMA 2J8GA 4HPNA 1M03A 2DSZA 4JQ2A 1QHPA 3EOSA 1PKNA 2ESCA 1OEPA 4I9AA 3RMEA 3TA9A 2ZX8A 1OYAA 1SW0A 3TQPA 3GTFA 1SO5A 1F73A 4ACZB 1R38A 4KRUA 1V3MA 3IARA 2WO5A 1XCFA 1ME8A 4AD3A 3RMJA 4LS0A 2XTKA 2QT3A 3NZGA 4ZQCA 3MBFA 1ZBWA 4NJHA 1TUFA 3GXPA 5DFAA 5KZDA 3VKCA 1AH3A 2DZXA 4LVGA 2XHYA 4N9BA 2GWNA 4XG1A 5IDIA 4AZHA 1SUXA 5J5DA 5EMUA 1XLIA 4J5NA 1WX0A 4WVXA 2BX7A 4D6EA 1J96A 3KVJA 1MZRA 4NL1A 1EHNA 1R9YA 1K4HA 1CNVA 4DN1A 2YDQA 2I5GA 3BVJA 2B4GA 3MSRA 4HNVA 4A8LA 1FH8A 2H8ZA 4H7CA 1CB2A 4C6JA 3AHZA 2AMXA 1US0A 1YXCA 3ITLA 1PV8A 3G3DA 1U22A 3CH9A 1AH0A 1RY8A 3AMGA 3ANUA 3H21A 2J74A 2PD5A 1DWGM 1JL8A 3ABOA 4UXDA 2C1GA 3GXNA 3N9KA 2OQHA 2IUZA 4RNJA 3SECA 4B91A 2FKPA 3KM8A 4JTGA 4LY4A 1O1HA 3CZ8A 2BNJA 2EPKX 1Y5WA 3VFLA 5A3HA 2CLEA 3V7PA 4O8RA 1TMLA 2D24A 1XSIA 2VDGA 1WE5A 4C6NA 3WEZA 3WLRA 2EF9A 2WSKA 3KL5A 1YNQA 2E9LA 4Y9NA 3VX0A 2A3EA 3G2GA 4R3UA 3NG3A 1OD8A 2BDQA 3G1RA 1XPYA 2QAPA 2TSYA 3BK0A 3NQEA 1GTHA 1KQYA 3GTIA 5E0FA 4WY0F 2V5JA 1EHAA 4ZTXA 3SY8A 1YDOA 1J11A 3STFA 3EX6A 3W7PA 3PZIA 5I09A 4Z1DA 1Q6GA 1CLXA 2ATSA 5E9AA 4YIWA 3W82A 2NV2A 3RFAA 4JKLA 2CBIA 2JKAA 5KZMA 4CQAA 3IWPA 2Y7GA 4HBKA 2UV8G 4UTLA 3VD3A 2PI6A 2HQAA 3W87A 4OGZA 2C1IA 1EGZA 4EWND 4MADA 2QPXA 1EJVC 1SQ7A 2C14A 3TUUA 1QASA 4I6VA 3W38A 1HKMA 1WZLA 2FLIA 4XZLX 4LYKA 5E0CA 6ENLA 2VHLA 4XIMA 4AUBA 4FI4A 1VGAA 1CLVA 4MJ2A 1VZWA 5DBTA 2B7OA 4Q8VA 1TV7A 1US2A 5EL1A 3IGHX 3SCNA 4ZENA 4H2CA 3LV6A 1HL2A 1DWHM 3RK8A 1BQCA 4TOQA 3NYZA 3GAYA 4LAKA 1AMYA 1ZJHA 3VZYA 1QCWA 2YB4A 2YLLA 1UZ1A 1XH2A 2W79A 1FDYA 1EOMA 3H6OA 2OEKA 3ZJ8A 4GNKB 1RP8A 1E56A 1OC7A 4PMYA 3HG5A 1K9TA 4RE0A 1ZAHA 3LGDA 5HULA 4NU7A 4MAZA 1MEIA 2VI0A 1GZGA 4JTRA 4DLFA 1WUEA 4AD5A 4MZ8A 4D8ZA 4RDWA 2VVNA 1G7VA 1HNYA 4HJWA 3EA1A 5HWJA 1O12A 5BNKA 1KNWA 1Z44A 4H9ZA 3VCNA 2VYOA 3RLGA 3WN6A 4DO7A 3MDWA 5D30A 3SB0A 1VYPX 2OELA 3OHIA 4UIOA 1LOSA 3T05A 1NELA 4M29A 4GISA 1KXHA 3TFXA 3E3HA 5EMYA 5CSYA 1DYSA 3DI0A 3T0BA 3M0IA 3B97A 4WQ6A 2I14A 1R2TA 2E09A 3NO3A 3VZXA 4MWAD 4WJ8A 3VNIA 3AMLA 1JGIA 1GJUA 4GGHA 1GYLA 3W22A 4JTTA 3WDHA 4E3VA 3H4WA 1UD8A 3ARYA 1VP5A 1YPFA 5J8LA 1UWIA 2OYKA 4RDYA 3GNNA 3RJYA 4AC1X 3BLIA 3QXBA 2NXIA 1IQ8A 3S1GA 1LUCB 3GC4A 3W1TA 3POCA 1NAL1 4IIGA 5AB3A 2WC7A 1B4EA 3VKJA 3VI2A 3RRAA 5HUPA 3TP4A 4UTMA 2B7QA 4J3VA 1KGWA 1JCMP 3RJXA 3DC8A 3BWWA 3UF9A 3N19B 5DY3A 4YLWA 3RM4A 3UJRA 2Y7EA 2IPWA 1KB3A 3PBGA 2NV9A 2J13A 5C70A 2WBKA 1B5TA 3LCGA 1VLIA 5CGMA 2C18A 4JY8A 3IVTA 3D5HA 1E9ZB 3NO1A 5LIKX 4HK6A 5GJPA 1EDTA 2NUXA 5FSDC 4M24A 3UWQA 3LDVA 4HCHA 1J6OA 3J7HA 1JYNA 3PZOA 1MNSA 3PNZA 3LM3A 3OZYA 1Q5MA 5HR7A 1JZ8A 1MUMA 4G7EB 3GDBA 1IWBA 1CGVA 3ME3A 4H9YA 2OFJA 2X0YA 3KRUA 1YADA 3QF0A 4JKKA 1TFVA 2MANA 2Y5JA 3AIRA 3GIYA 4RNIA 2QVHA 1F8MA 2ZIDA 1AQFA 3B06A 1A0DA 4JKMA 2VURA 3NPWA 2O7SA 1OFQA 2SFPA 4WDXA 1A5OC 4L61A 1Y5XA 3CZJA 2WNZA 4XAYA 1KR0A 3PHAA 2F61A 1TTIA 2R1LA 1GOKA 3WJSA 4H3DA 6XIAA 1XIHA 3RM9A 4V15A 4ORIA 4JBRA 5D2XA 3QM3A 2J9ZA 1NF7A 4E4UA 3RR1A 1Y7VA 4AY1A 3H23A 3P84A 1IIGA 3HFTA 3GQYA 1JCLA 4ZCWA 3M0LA 3OIXA 1XLKA 3IEBA 4AHQA 3NSMA 3RLVA 3MP3A 3E0WA 1REQB 2C0AA 1SFTA 3WH7A 3GYCA 1HT6A 3MYPA 4Q7IA 3ISIX 4A3QA 1HX0A 2O9PA 4KWSA 4WRHA 4YTSA 5CJMA 3W75A 4Q4OA 3G24A 3FYYA 3R0DA 3M0YA 1DJIA 1HJSA 1R7AA 3FS2A 3SURA 4GI6A 4ZBCA 2OZ0A 2W9MA 4UTJA 4Q33A 5GNZA 2Y6ZA 1XINA 3NXFA 3VNDA 3VAVA 3ZFHA 3GUGA 4RE4A 1BYAA 1Q65A 2ZYFA 1DWJM 1E1FA 2ZZ6A 3UR7A 1RPKA 2AL1A 1RV8A 3BJFA 4JTUA 1WKDA 4LYRA 1WAUA 2PDBA 4KQNA 2HS6A 1G1YA 2VEMA 3ZT7A 2D3LA 2GJLA 3WBAA 3PPFA 4DUWA 4LEQA 3AZSA 2VZOA 2DH2A 3RG6A 2CZVA 4DI9A 3NZ1A 3NEHA 1QBAA 1VD6A 1H3GA 3CJPA 3MP5A 4AHPA 1VPQA 4L7ZA 4WSHA 4K38A 1BYCA 1LLOA 5TQLA 4JTKA 3LXBA 3HFYA 4D1JA 4GLEA 1V08A 4WEVX 4H1ZA 3IJDA 3WDIA 1VRDA 5C7VA 1A5NC 2PWUA 2F84A 5E6ZA 4E2OA 3UG4A 4O1CA 3IJ6A 2WYSA 3AXIA 2ASHA 1OM0A 2I57A 2ISFA 3A4JA 3EWUA 4IGNA 1NH6A 1FWAC 2J24A 2E5DA 3CV7A 1UZ4A 2PWEA 2XVNA 1UASA 4CEXC 5ENLA 4C5YA 4TVCA 1KWKA 3WX7A 3RRXA 3T44A 4Q8OA 1P43A 4KWWA 4MWAC 3CC1A 1MXSA 1FWJC 4KCVA 1ZBCA 1A53A 1XRTA 4LF2A 3U4AA 1ECQA 1GYNA 1VEOA 4JICA 4Z17A 5A69A 2YXXA 4LH8A 1W1A1 3ZQ9A 1XIDA 2RDTA 4FX7A 3E0IA 4M82A 3LRKA 4XUYA 1H11A 1MQRA 3BMVA 1OVDA 3VM7A 5EFFA 2VX4A 1KR1A 3WBYA 1JCTA 1M5WA 3KVLA 2BY2A 4Q4SA 2UY3A 4WY0A 1R3WA 2DIEA 2E77A 1L8NA 4OTKA 1ENUA 4C60A 3GVQA 2JEPA 1DXFA 4HMCA 4XKMA 3WDJA 1U5VA 3PN8A 3VKAA 3BLOA 4Q4MA 1XIIA 4HNCA 4AVFA 5FEXA 1GQLA 4KEZA 3W7MA 4H6KA 5K7JA 1U33A 3YPIA 2D22A 4R7OA 4C7DA 1EXBA 1E51A 3AYVA 3EBVA 3IIVA 4QTGA 3AHTA 2ZFAA 1NWRA 5IBXA 3DH7A 2OTDA 4M6QA 2ZXAA 4PR4A 5G4EA 3PUDA 3WIJA 3SJNA 5A8QA 1TPC1 3WLHA 2W62A 3P60A 4BEQA 1XYCA 1XC4A 4GYJA 2REQA 1JEZA 4L6OA 1KRMA 5I3IA 4PCNA 1KFEA 2DIKA 2EJAA 2PDGA 2DFAA 3PZUA 4JHMA 1N8FA 4NAEA 4GXMA 3QPYA 2PDQA 5G1YA 4BI5A 5BXPA 3M5XA 4GHRA 3L4TA 4A8NA 5FEPA 3S2LA 1J18A 3C2OA 4DBEA 3T1GA 2YPIA 3TYAA 3SCPA 1W9VA 2ZQ0A 4DQWA 3W7NA 2O4QA 1XCXA 3K4AA 1HUVA 1BWKA 1PO9A 1EQCA 4WLCA 4C90A 2WOQA 5T26A 4IUOA 4XV0A 1LOQA 1J0JA 2JQXA 3A13A 2KAUC 1XCWA 1V3KA 1ZQ5A 5D33A 5HMEA 1R6WA 3CL8A 2CHNA 2XG9A 3ITGA 4YTUA 3R25A 3GH5A 2PWDA 3P8IA 2G3JA 4C5ZA 3TCSA 4IFRA 5FKYA 5D2VA 1DHKA 4L65A 3GDLA 3W7EA 1R46A 4EP8C 2CFFA 4D9PA 4EF9A 2D1ZA 2HXUA 4LGXA 3IJ8A 1I4NA 1WZMA 5DY2A 2C19A 1E9LA 3ABRA 4JN6A 1TV8A 1FCVA 1HKKA 1PX4A 1NARA 3N1AA 3F2CA 1MWOA 1L0PA 3OZMA 2CXEA 2HWGA 4QJ3B 1AQMA 3PJTA 1XISA 3G0UA 1GEHA 4Y8EA 4ZE5A 1LP6A 1QNOA 3R8GA 1V3HA 2BLEA 1AVAA 2AL2A 1HJQA 3UJEA 2FGLA 3CO8A 3EKLA 1WZAA 5DMYA 3P80A 5IRPA 3C0QA 1CGUA 4JIIX 1GVQA 3APTA 1A5AA 2OWWA 1UIPA 2AQWA 3GFXA 4AF0A 2EPLX 2XPKA 3SR7A 2ACRA 2VC5A 1GVYA 1UH4A 2D2JA 3V5FA 3CTTA 1IHIA 3BQ6A 4EAYA 1ME7A 3HOJA 2RHGA 1B9ZA 7REQA 3DFNA 2E9MA 1JQVA 4UFIA 3OIHA 5C9RA 4E8CA 1DTNA 3FIGA 4Q8PA 4U5KA 3ZJ6A 1ONEA 2BXZA 4IMDA 1QNQA 3UY8A 5DCDA 3OW1A 1OFEA 5A6LA 4X63A 4JTFA 1D8CA 1SGJA 1Z69A 3ARZA 4CCCA 1Q2RA 3E1F1 1UWRA 4XAGA 2ZTKA 4NUWA 3OTRA 3ARPA 3RXZA 2E6FA 3CLMA 3F4VA 2QDGA 3SCTA 3QFWA 2R1KA 1EP2A 2QDHA 4S1FA 4PSPA 1L6WA 3QV8A 3TYCA 1CYGA 2WJEA 4NNBA 5FI8A 3NAVA 3CUGA 4W85A 4PEKA 3NQ6A 1TPVA 1RHCA 2NSOA 2QCMA 3V0SA 2BVTA 3CUXA 4A21A 5GQBA 2X0SA 4LYQA 3CV2A 3EOLA 4XBKA 5FCZA 4RK8A 5L6UA 1DL3A 3NM3A 4A29A 1UA3A 4H41A 3LPOA 5C55A 3I4KA 2PTZA 5RUBA 3LK6A 4W86A 1F2JA 2A85A 1M1BA 4PMRA 4GO8A 3WH8A 2C16A 2D73A 3AMKA 2PLKA 3GTXA 2QYGA 1LUCA 2P3ZA 4L1GA 3RU6A 3MUY1 3S9YA 1YX1A 2ZZ1A 3WNOA 3WK2A 3DHPA 3UYIA 1P0EA 1GEQA 1L8PA 1EC9A 4M6PA 3PS7A 4WCJA 3TTQA 1H2JA 2YKKA 3ABZA 2ZUTA 2QDDA 1IXOA 3EOOA 2C71A 3A21A 4INFA 1C9WA 1AL8A 3WQVA 2NX3A 4BF5A 1NJJA 2WMKA 1W9UA 4Q3MA 3PWAA 1P1MA 2ZC1A 1E0WA 2A2IA 3M9YA 4ZOAA 1FWDC 1GNXA 2VT0A 3GG7A 2O4MA 2PDPA 1NQ6A 4M6UA 5FEWA 1K9DA 1TRDA 4W4QA 1FWEC 8CGTA 4HD5A 4U5IA 3WLNA 2P53A 3ZVHB 2WHKA 3TOPA 3O8AA 3LN3A 4AWSA 1MDRA 5HXMA 3L4VA 3W23A 3F5KA 2A7PA 4TV6A 4AZ5A 4ML9A 3ZYZA 1JZ4A 5J04A 2QQ6A 1QBBA 3A23A 4GY0A 3FVDA 1LQ0A 1E40A 1RBAA 3TJIA 2DZPA 1ICPA 1EFZA 3SY5A 3IUHA 3EA2A 4QEHA 4S3BA 2QPUA 2ISVA 5CSSA 4PMNA 1YKWA 1TIMA 1QVBA 5CGQA 2WZIA 4ATWA 1SMDA 4H6EA 1XLBA 5LNRA 3ZS4A 3M07A 1E0UA 4F0LA 3G6MA 4I9MA 4XIAA 1TELA 4ZTYA 2YLAA 2H9AA 3U4FA 2A21A 1XLJA 3SRDA 3TC7A 4XZIA 4LUTA 2RGMA 4YVPA 3E5BA 2CCRA 1WXJA 1UB3A 4WD0A 4AX7A 3MCOA 3EWZA 1JGMA 5H91A 4WGXA 1O66A 1I75A 4LBSA 4PMXA 2J6XA 4PC8A 2J7FA 1UWUA 5EA9A 2EO7A 4KWVA 2AAAA 1XLFA 3PF3A 3LI1A 5EMKA 1EJXC 3CMJA 3PB0A 2XDFA 3MU7A 4GYFA 3IS4A 1F4HA 5A94A 4Y9PA 1S46A 2ZA2A 5AFDA 3HPAA 3OZPA 4HKPA 1VYRA 3CEPA 4GMEA 4IG2A 1A0EA 3A9BA 4CNOA 4AWTA 2QCCA 4FAMA 5AYYA 3EDFA 1IEXA 3OVGA 3FYOA 1QMLA 5U7SA 4JAWA 2PTWA 4DLMA 3R0UA 4P7RA 4IIBA 4GVIA 4JTQA 4FLSA 1NY1A 4K39A 4WHBA 5HNTA 2JKEA 1J6PA 4A22A 2V5DA 3IUDA 5LA1A 1PAMA 1CXEA 3PTKA 1VJSA 5TIMA 1QFEA 2OOFA 1X39A 1Q13A 1EBGA 1MFUA 4O52A 3WLLA 2H6RA 3LPGA 3KS5A 5G2IA 2D2GA 2BOFX 4AYSA 1EF3A 3E5PA 3W6LA 3EPNA 3MWCA 2I7GA 2INEA 3ANYA 4GWEA 2CESA 1RALA 1VKFA 1UG6A 1DIKA 2DW6A 1T40A 5JH2A 1KCLA 1E0VA 2X7WA 3N11A 2XIOA 3W6YA 2YW4A 2YCKX 4ACYA 3C2FA 2R14A 3U57A 2I9EA 3ZWSA 3EDKA 2DQXA 2FHBA 3MO7A 4TUFA 3VE7A 1MYRA 1EZWA 3EWBX 1XD1A 3WJZA 4J40A 5AYXA 5IHRA 8XIMA 3O3RA 3DCPA 1T7LA 3AWOA 1W3TA 2C91A 3R58A 4QLKA 3WD0A 8TIMA 1M65A 1PIFA 5C2GA 2CKSA 1IF2A 1IT8A 1VFSA 4PA8A 3PBWA 3PZQA 3V0UA 4LRTA 2Z1KA 4OV9A 4NJKA 4FHAA 4O4WA 1IZCA 4CN4A 4W8LA 2CKRA 3KL3A 1VIWA 4LUIA 4KCUA 2PWHA 3DFOA 1TJ2A 2CLHA 2ZUVA 1G4EA 1UYQA 2XN2A 3W7RA 2ZUMA 2FFIA 4YU1A 4GKLA 4ILSA 4J3SA 1RCOB 3FV9A 3A4XA 2YIHA 1F61A 3WK0A 3ZVIA 3I68A 1UMYA 1ONRA 3WJXA 5H6HA 4DY1A 3W1LA 4W88A 1TIWA 2WKGA 5I0DA 3B0XA 2ABAA 1SZEA 1W5OA 4F0SA 1FHDA 3MPGA 3CZGA 2QJIA 1E6XM 1LL7A 4H6RA 4NG3A 5XIMA 4H00A 4JQ4A 4G56A 2QUUA 1HL9A 3D46A 2PLCA 2YL5A 2E67A 4O28A 3C2RA 2PRLA 5I5RA 3IAQA 1DJYA 2P3EA 2QXWA 3W01A 3LERA 2UY5A 5EKYA 3SZ8A 1OFRA 4MJ4A 3DHUA 2ZBTA 1KBIA 3VGDA 1W3JA 3SIZA 4XVDA 2HCVA 2VNCA 4GG9A 1JDDA 3ALGA 4HHPA 4HMDA 2B7NA 3TNOA 2NQLA 4ZSUA 2P8CA 4JTAA 3SEPA 4GABA 2J7GA 2VDHA 4AZCB 2GWGA 2QJGA 3D3FA 3FHQA 2EHHA 1TMQA 4ROPA 4PYSA 3ARSA 4PB4A 2DT0A 5A5WA 3SCQA 1ITXA 3GH7A 1SPQA 2PDLA 2GK1B 1KW1A 3WLPA 2QCEA 3QPEA 3HO8A 3GNXA 4ROQA 3OQ8A 3ARXA 3WFZA 3N4AA 4N4PA 4PMUA 4K6AA 3EB4A 3IK2A 1JD7A 2CPUA 5G5IA 1VHNA 2G3MA 1DIEA 3KZSA 4D6DA 3WSUA 1N8WA 3C56A 2FH6A 4QBXA 4Z0SA 3CUJA 2WMJA 5D09A 4BQ5A 3MBDA 3CT2A 2QIWA 1XDMA 1K9FA 1XUUA 5D8WA 1S2VA 3QLDA 4E2DA 1K8ZA 3PZMA 4M56A 3PUGA 4IMFA 3CZLA 5AC8A 1XLDA 2JGYA 2EEXA 1BFNA 2P88A 3PBVA 4JTCA 3WDRA 4KEMA 3GLCA 3ONCA 2QV4A 4K8EA 2V63A 4PTVA 1LCOA 2E6AA 5D8ZA 2FGBA 3EZ4A 2Q3RA 2GGHA 4RPQA 3VNJA 2C3ZA 3LMZ