4GZ7A

The crystal structure of apo-dihydropyrimidinase from tetraodon nigroviridis
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
492
structure length
492
Chain Sequence
AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFKMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREPYAGEVVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords dihydropyrimidinase
publication title Lysine Carboxylation: Metal and Structure Requirements for Post-translational Modification
rcsb
source organism Tetraodon nigroviridis
molecule tags Hydrolase
total genus 186
structure length 492
sequence length 492
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gz7A01
4C6IA 2D2HA 2VC5A 5HMEA 2EG7A 2F6KA 1RJRA 4HK7A 3SO7A 3WYZA 2OOFA 3LGGA 2VUNA 4PBFA 3URAA 1QXLA 1A4LA 3LU2A 4I6KA 4EPBC 2WM1A 3RCMA 4GBDA 4C65A 4B91A 2KAUC 4WGXA 1V4YA 3EGJA 3G77A 4XAFA 2GSEA 1FWFC 2A3LA 4GOAA 2HNHA 3LA4A 3F2BA 2YB1A 4LFYA 2PGFA 2VM8A 1NFGA 1VFLA 1ZZMA 2QT3A 4UBPC 4DYKA 4DO7A 3OODA 3MJMA 2Z4GA 2GWGA 3E3HA 4C6BA 4IGNA 3GU1A 3MVTA 2R1LA 4MUPA 1JGMA 4CEXC 1V7AA 3GTHA 2WJFA 3QY7A 1K1DA 4OFCA 3A3XA 3GTXA 4PCPA 1E9ZB 4KESA 4LH8A 2QVNA 3IJ6A 4H01A 4H9VA 4EPDC 1M7JA 4GC3A 4XAZA 3DCPA 1P6CA 1GKQA 3F2CA 4H00A 2G3FA 1O5RA 3LNPA 5G4HC 1UIPA 3RN6A 3IPWA 3K4WA 2IMRA 3CAKA 4ZSTA 3EWDA 3HPAA 2I5GA 3GU2A 2O4MA 4L6DA 2WJEA 3PNZA 4F0LA 3GTFA 4RE0A 1KRCC 3WZ0E 3ISIX 4J35A 1RA0A 4BJHA 4WVXA 2OQLA 4RDWA 5FSEC 3MSRA 2I9UA 4IFKA 2Z25A 4C6CA 3BE7A 3GRIA 3O7UA 4RDVA 2CZVA 4R7WA 3PAOA 2AQVA 4H9YA 4V1XA 1RJQA 3AU6A 1V79A 4XAYA 4LCRA 4AC7C 2FTWA 4H9TA 2QPXA 3E0LA 4XD6A 3FDGA 3NURA 2YXOA 1M65A 2Z7GA 4B90A 4XAGA 4C6MA 3UF9A 2PAJA 4C6DA 1ADDA 2D2JA 1KCXA 1NDZA 1A5NC 4AQLA 2OODA 1DPMA 2FVKA 3GU9A 4KEVA 1YNYA 3AU2A 4B92A 3F4DA 2Z2BA 4INFA 3QY8A 2HQAA 4H9ZA 4IFRA 1EJRC 2Z29A 2O4QA 1YIXA 1ONWA 2Z26A 2Q09A 1GKRA 2Z00A 3E0FA 2YZ5A 1YBQB 1POJA 3IRSA 4NG3A 3K5XA 1J6PA 3S2MA 1FWDC 4QSFA 3URQA 4KEZA 1A5LC 2HPMA 3RHGA 3MKVA 3C86A 4LAKA 4HK5A 2EG6A 1XGEA 4DLMA 3IACA 2R1NA 1I0DA 1S3TC 2YB4A 1V77A 1YMYA 4HA0A 4DIAA 2Q01A 3A4JA 3S2LA 4GX8A 4LCQA 2OGJA 5CH9A 2WJDA 3OOQA 2E1WA 5HMDA 3TN5A 4ZSUA 2BB0A 3S4TA 4JOMA 1XRTA 2GZXA 4TQTA 1FWGC 3PBMA 1J5SA 3NQBA 3N2CA 4D8LA 2ADAA 3UPMA 4GY1A 3JZEA 4WHBA 4C5ZA 4G7EB 1NDVA 2AQOA 2UZ9A 3ICJA 2HPIA 1K70A 1FWIC 4J5NA 4C5YA 1UMLA 4F0SA 4DZHA 1EJTC 3EWCA 1ITUA 3CJPA 4V1YA 2Z24A 1K6WA 4J2MA 3S2NA 4B3ZA 1FWBC 2RAGA 3V7PA 2DVUA 3MTWA 1WXZA 4M51A 1EJSC 4H9MA 2AMXA 2VHLA 2GWNA 4DI9A 1J6OA 3LS9A 4HK6A 1FWAC 1FWJC 4LEFA 4KIRA 4LAOA 1KRMA 3QGAC 2FTYA 4ICMA 4QTGA 3ID7A 4PBEA 4KERA 1FWEC 3WMLA 1A5OC 3OJGA 3PNUA 1PB0A 1PO9A 4IF2A 4LALA 3OU8A 3T1GA 1A5MC 4IG2B 3GIPA 1RAKA 4LANA 3D6NA 4C6NA 2D2GA 4C6LA 4CEUC 4NP7A 3LSCA 1O12A 1KRBC 1R9YA 1J79A 4RDZA 2R1MA 3ITCA 4KQNA 4DI8A 4GXWA 4HJWA 1ITQA 4H9XA 3URNA 4XD3A 1V51A 2GOKA 3B40A 4CNSA 4GYFA 4DLFA 4LCSA 1FKWA 2VC7A 4EP8C 2PUZA 1EJXC 3MDWA 3FDKA 2E25A 3PANA 4QROA 4EPKA 4C6FA 5E5CA 5LXXA 3B0YA 1EZ2A 3QGKC 1NDWA 2FVMA 3MDUA 1YBQA 2DVTA 3GTIA 4G2DA 4C6EA 2Z2AA 4CQCA 3GG7A 2UBPC 1E9YB 4DZIA 2Z28A 1UBPC 4XD5A 1BF6A 2R1KA 4GY0A 4CNTA 3O0FA 1UIOA 2R1PA 4C6KA 2QS8A 2OB3A 4F0RA 3DUGA 4I6VA 2VR2A 4C6OA 3F4CA 2W9MA 3IGHX 1EF2A 3FEQA 4KETA 4BKNA 5AKQA 1RA5A 4UB9A 1A5KC 1RK5A 3HTWA 3CS2A 4LAMA 2ICSA 4R85A 3IV8A 1WXYA 1RJPA 3UR2A 4KF1A 3B0XA 3E2VA 4P5UA 4RDYA 1W1IE 2P53A 3LY0A 3TN3A 3URBA 2Z27A 4PE8A 4IQJA 4GZ7A 2ANUA 1HZYA 3SFWA 3GIQA 3ORWA 3AUOA 4PCNA 4C6QA 4BY3A 4Z42C 3T81A 1EJUC 2XIOA 3R0DA 3T8LA 4G7EA 4IH3A 4ERGA 3RYSA 4H9UA 4C60A 2ZC1A 4IFKB 4RZBA 2FFIA 3E74A 4C6JA 4KEUA 1IE7C 3MPGA 3NEHA 4QRNA 3LGDA 2Y1HA 1XRFA 1M68A 1FWHC 1EYWA 4GY7A 4XD4A 1XWYA 3HM7A 3E38A 2HBXA 1FWCC 1KRAC 3GUWA 3OVGA 2DVXA 1P6BA 4CQDA 2PLMA 1R9XA 3S2JA 3IARA 2BGNE 3QY6A 4QS5A 3A3WA 3UR5A 2HBVA 4IGMA 5FSDC 4C6PA 3MVIA 1A4MA 1YRRA 2P50A 3KM8A 1FKXA 1PSCA 1RK6A 2EG8A 4GX9A 3TN6A 3F2DA 3OQEA 3DC8A 2PGRA 4CNUA 4CQBA 4L9XA 1I0BA 1PTAA 1EJVC 1ONXA 4R88A 4E3TA 5A6TC 1QW7A 1POKA 1EJWC 3UBPC 5HMFA 4YIWA 4IG2A 4NI8A 1NDYA 1P1MA 4IFOA 3K2GA 3TNBA 4GK8A 3TN4A 4ERAA 4DNMA 1R9ZA 4ERIA 4QS6A 1GKPA 3LSBA 4EPEC
chains in the Genus database with same CATH superfamily
2NVAA 4FXRA 1VPYA 1XLBA 3QH2A 1MQPA 1TKKA 4L9ZA 1ECQA 5ENLA 5C2XA 3PPFA 5G1TA 3OGSA 3NM3A 3RCMA 4JIRA 1C91A 1NVMA 4UCFA 2ZRVA 2NUWA 2ZICA 3AICA 4NZFA 1OFAA 3MV11 4E2DA 2PCQA 2A3BA 4JPGA 4J3VA 5ABGA 5DN1A 3S42A 4UBPC 3R58A 4M56A 5D2YA 3AIQA 2NXGA 3H2OA 1JGIA 3BC9A 1VJSA 1BKHA 3CH9A 4XISA 3AYSA 1KFJA 3GTXA 2OQHA 2ZZ5A 3QRHA 2NX9A 2PP0A 2ZUTA 4H01A 3WKZA 3T4WA 1GKQA 1UROA 4HU4A 2DJLA 3JW7A 3LNPA 1RR2A 1UIPA 5FJPA 1GONA 3THQA 3MP3A 1LP6A 3GM8A 3QBUA 3KUMA 2XINA 3LV5A 1HL2A 1EC9A 4AEEA 3C2RA 4W89A 4L1GA 5C0QA 1EQCA 4OZOA 3WNOA 1YTEA 2VZVA 4PSRA 1QW9A 1RJQA 3ARXA 5JVLA 4XAYA 1GJUA 3CHFA 3WBAA 3SIMA 5D9MA 3W71A 3FDGA 1E6SM 2ZZ1A 1TJPA 1EO7A 2OWCA 3S3GA 3DFHA 3M6DA 1UOKA 1IR1A 4IX0A 4M7SA 3P74A 5JH1A 2WMIB 1YYAA 4WSHA 1EJRC 1C9WA 2VD9A 2PDIA 3ZVIA 3CV2A 1XLFA 4FXJA 1D3GA 4HTYA 3R0UA 3BLLA 1GKRA 1PUDA 5KSWA 4NJGA 4FX7A 4NAEA 1CXEA 2J78A 1DTNA 1PKMA 1J6PA 4GINA 4KEZA 2EPOA 1OCJA 3FNDA 3GYCA 4PUUA 2FPVA 1EHAA 3W23A 1HNYA 4Z2LA 3LV6A 5F2IA 2YW3A 1RCOB 2EPLX 1JD9A 3VMPA 3W7MA 4G9PA 3MMDA 3I6RA 2E1WA 4FNTA 2OSWA 5GQBA 1Q4WA 3ERPA 1A47A 2PWDA 1WYIA 1DWJM 3W74A 3ARVA 5EGRA 1LL6A 1H5YA 1UKSA 4QNEA 4MMWA 4JTJA 2WV8A 2Y85A 3OO2A 4PFHA 1WDQA 3WLKX 7CGTA 5AY7A 2ZRYA 5HOSA 1HJWA 2C71A 4IMAA 4ZL1A 1EP2A 1MDRA 1H50A 2VZUA 2YZRA 3MC5A 4REQA 1GW9A 3TLLA 3LMYA 3L5AA 3TNOA 1GQKA 3TFXA 1B3VA 4B15A 3BV4A 3UESA 1XDMA 4LY8A 3MSYA 3WELA 4PBEA 5FIPA 3PNUA 3SGZA 4IF2A 5G2HA 5D2TA 1PBGA 2I17A 1Q66A 2ZC8A 4K36A 3LHYA 4AC1X 4NZ4A 1J79A 1CLXA 2RDTA 2BBFA 4RW3A 4KQNA 4DI8A 4LT9A 4XZMX 1TJ1A 3BTNA 1QNOA 2R94A 3URNA 1SVDA 3GE7A 4WDXA 2WQDA 3WFLA 4LY4A 2WMIA 1PX8A 2QUTA 3PSVA 3PN8A 2BTMA 4XIMA 3M41A 1JAEA 1NDWA 1XKJA 4B5NA 2FVMA 1OFPA 3SGGA 3V0SA 1O68A 2E7FA 3T55A 2XFRA 1VIWA 1YDNA 1RY8A 4QR6A 1GVSA 4QDPA 4M6UA 2Z6JA 3W1UA 1NWUA 1LRTA 3VC5A 2R8WA 3BARA 2J7CA 4ZCWA 4W88A 1NELA 3IGHX 3VD5A 4PCSA 4C1LA 1R6WA 1XQLA 3HTWA 3B9AA 2C1GA 1SJDA 2UY3A 4HNTA 4R85A 1EL3A 1WZKA 2Y88A 2CEQA 3UR2A 4KF1A 1ZTVA 2ZRUA 1E71M 1B5TA 2CETA 1Q7ZA 3MS8A 3GNXA 3OHIA 1TYGA 3OBEA 3TZNA 3SCQA 1E5JA 5AC7A 3SR7A 4LF2A 2D0GA 2IXVA 4BEQA 3T0DA 1MQQA 1NOWA 4UTWC 3L9CA 3RLUA 3S47A 4JY9A 2PDGA 3B8TA 4IZGA 3LZ5A 3MP4A 4Y9OA 3WENA 1FA2A 1A53A 4XD4A 1XWYA 3HM7A 3E38A 4GISA 3PAJA 4Z2JA 4UNLA 1HIZA 1R9XA 1OC6A 2Y7EA 4ALDA 3QY6A 4DUOA 2GGEA 2VC9A 2E9MA 4RV3A 4PTXA 4GIRA 1J11A 3AHZA 3B9NA 2HRWA 3QJAA 4TO8A 2G96A 1KTCA 3W2LA 2A0NA 1EJVC 1FCUA 3IV3A 1QW7A 2XDFA 3FIGA 1EJWC 4TXEA 3WFZA 4Q8WA 2ON3A 3TN4A 4KRUA 1T5AA 5K9XA 4ERIA 1G7UA 2WJZA 3QZEA 4N7QA 1W3IA 3LSBA 1TUXA 1EF3A 2PGEA 3W2MA 1KGUA 4O17A 3SDOA 1TZZA 2NQHA 3ABOA 2A7RA 1GYNA 2ZTKA 3WYZA 1P7TB 1KBIA 3TH6A 1TJRA 4O50A 1SMAA 1XDJA 4F9JA 3VIHA 5AN7A 1UG6A 4K68A 2IPGA 2POTA 3HIJA 5FF2A 3SEPA 3HG5A 1GZJA 2GSEA 4XV0A 3TE9A 3SAZA 3PZMA 4PMXA 1GQNA 4HZ8A 4ZQMA 3PZTA 1EDGA 3T08A 1KW1A 2D73A 3MJMA 1A80A 4AIEA 5AYXA 2V30A 1QPRA 2Y2WA 2ZA1A 4XKMA 4ZVJA 3P7YA 1QHZA 4UNIA 3TYAA 3VIIA 3VUPA 3GW3A 1QI2A 1OYCA 4EPDC 3FSUA 5FKYA 4XAZA 4W9TA 5DBTA 5IDIA 1UC5A 2UY4A 2D1ZA 3GX9A 4ZSTA 3WUBA 1DJYA 2ACUA 3WZ0E 3ISIX 5A6LA 3BJSA 3MHFA 3SCVA 1RZMA 3W2NA 1QBBA 1VJIA 3GWQA 4A05A 1EGVA 4A6GA 4DXKA 3KAOA 3W3OA 1FWTA 1VEPA 2WSQA 3CGTA 3MCMA 3RLHA 3NURA 4MM1A 4XK2A 1HVXA 3QN3A 4U4MA 3OLGA 1NTHA 3PR2A 1NDZA 3EZ4A 3SIZA 3OG2A 4R34A 5CC7A 5LNRA 4UTIA 3TROA 4A29A 2YDQA 5CG0A 3F4DA 1F3EA 2ZOXA 3GIYA 3QY8A 4H9ZA 3BXWA 3ARTA 1WDWA 2OOGA 1AH0A 4Z0JA 2TRSA 4ML9A 1KR0A 1VJZA 3WQGA 2FLIA 5A69A 3H2FA 3GO2A 1VEMA 3W84A 1Z3NA 4NG3A 1I60A 3GDLA 1FWDC 2GSHA 5C5YA 1UWIA 1GZGA 2I56A 3AI0A 1GOOA 3GKAA 4MG4A 1PXGA 2YB4A 3M43A 2Q8LA 3TW7A 5JMUA 1OFEA 4PMOA 1YMYA 3E02A 1MRQA 1P7TA 1W6TA 3QW4B 2Q01A 4HA4A 3GS6A 4H4IA 4MPQA 4PTVA 1OT2A 2WMKA 1KFLA 1VD6A 3QC0A 2OZ3A 4YMZA 1HP5A 5HMDA 3TN5A 3UCDA 3WQ8A 2BNJA 4XB3A 6ENLA 3C0QA 1JXJA 1M41A 2DZXA 1H09A 4IX2A 3ZYZA 1E43A 3VD3A 3LHUA 5FD0A 3O06A 3KOYA 2FGLA 2Z2UA 1A0CA 4GY1A 5FEPA 4QDWA 3CMFA 3HPXA 4JTGA 4BQ3A 4QX4A 2JE8A 3I6EA 2H3DA 2AL1A 3SSJA 3O6AA 3UWUA 3USZA 1SR0A 1JCJA 4A35A 4DBUA 1X8FA 3CJPA 4V1YA 3F4WA 4UCGA 4NT0A 4Y9MA 5EMKA 1X7FA 4B3ZA 3TC3A 2DVUA 1TPEA 3CAVA 2DGAA 3B8WA 3QV6A 1E70M 2PD5A 4PRTA 1V0NA 3QQWA 5MF5A 2VQUA 2JGYA 1W31A 3LNMA 2ALDA 4KCUA 5I02A 3WMLA 3DFOA 5D2XA 2HSAA 4L65A 3ES7A 2QNEA 2YA2A 3MT1A 1VPXA 1RAKA 4C6NA 3KTCA 4CEUC 3FKKA 3WBYA 5EY5A 4EOUA 1HFBA 2J7DA 3ITCA 3UZ5A 1QPOA 6XIAA 1LWHA 3N15A 1ZAIA 4RE2A 2D20A 3TYUA 2I5IA 5K4ZA 3AROA 4NRSA 3FCPA 3FDKA 3POHA 3VNJA 3ZM8A 2NUYA 1LT8A 4ENLA 5M5DA 4GI6A 1EZ2A 4N4QA 4O15A 4RNHA 2CKRA 4X3ZA 1E9YB 1P0KA 1F8MA 3W7RA 3RG6A 1KKOA 4DVOA 1XCFA 1K9TA 3HQOA 5H1WA 2W4XA 4ICNA 5TD4A 1MNSA 1OZMA 2F2HA 4DWSB 4MNMA 2ZXQA 3UWEA 3CUIA 3G1FA 1E3ZA 2VKZG 4KIEA 3GXNA 5LXEA 3ABZA 1HJQA 3UYCA 3M0YA 3H4XA 3B06A 4PE8A 1RQBA 5EB8A 2J7FA 4GC4A 1XGDA 3A22A 2O7QA 1XPGA 3FAXA 3T0TA 1SO3A 2DQXA 3EMQA 3ONBA 3L0NA 2PC8A 3G1XA 1AFSA 3APGA 2G0WA 4DWDA 1PKNA 2FZBA 4O4VA 3N11A 1FH8A 4UFJA 1VFMA 4KGJA 4PUMA 3U9IA 3LG3A 1KB3A 2YXGA 4NZJA 4WR3A 1S5WA 2IKIA 5CZTA 1TVLA 2O9PA 4E5TA 3BSGA 4G8TA 4JFSA 4Q8OA 3FV9A 4G5DA 1PHQA 1DXFA 1OGSA 7TIMA 1AMYA 2PDNA 3VUSA 1NH6A 1PSCA 3V35A 4DO4A 2XH4A 3NR0A 2ZUSA 5I7GA 1H4PA 3B0PA 4PCTA 1OG6A 2VI0A 5KZDA 1LL4A 2C16A 2VFHA 2BHUA 4EKJA 5CBJA 1C3FA 4N9DA 3QQ1A 3TYEA 3PS7A 1IGSA 2VMFA 4IFOA 1XG3A 3TYCA 4TUFA 2BY2A 3PBVA 4Q32A 1J01A 1FDJA 3AMCA 3ZLFA 1ZHAA 1WDPA 3W00A 4KWWA 1QNQA 4LEQA 3OA3A 3VILA 1FRBA 3SRHA 2YBUA 2EG7A 3SW6A 3ENLA 4YTTA 1KD0A 1QXLA 3NFUA 2G50A 4IMFA 4JTQA 5HQMA 2VWSA 3STFA 3PZGA 7TAAA 2XU2A 2A3EA 3A5VA 4G6CA 2EGZA 4QE1A 3TFCA 4GOAA 3H21A 1M7PA 4QIUA 1E1FA 3EDDA 4LAUA 3F4NA 1VFLA 1NM9A 4QHRA 4J27A 4YJ5A 3LTSA 2OT0A 4MGGA 1EXPA 1PPIA 2VFEA 4HBKA 5HR6A 1K1DA 4DWSA 4OFCA 4U31A 8XIAA 2Y5EA 4PMYA 1WDRA 3WQ4A 3IJ6A 1Z48A 4H9VA 3CBWA 4F0MA 3F2CA 3ITTA 3W27A 3DHDA 2A2IA 3RN6A 4ACZB 2IMRA 5C9ZA 2E5BA 4L6DA 1JEZA 4F0LA 2BY1A 4BHYA 5JBFA 3L67A 2VOMA 3BURA 4IQLA 2QPUA 5HANA 4X60A 1A5UA 1BAGA 1V79A 3EWWA 4E38A 2VENA 2QDEA 4PUJA 3AIVA 4FF5A 2Q8ZA 1HKKA 1XLAA 4M3PA 1D3CA 1S38A 1XLEA 3GBDA 1XIEA 5L9FA 4JTRA 1X39A 3VFLA 1BRLB 2Y7FA 1K3UA 4JIHA 3UZJA 4DN1A 4TMCA 1R46A 3TTYA 5D38A 3P62A 3N14A 1OFBA 3WK2A 5CEWA 2CBJA 2XVKA 4N6EA 3VZZA 4MZ1A 1TX2A 3EDJA 3PZUA 1GVRA 3UG4A 1J5TA 5LA2A 3E0FA 5LIYX 2VT0A 5AHIA 1VFFA 4LB3A 5CGMA 3FA5A 1A5AA 3Q94A 4N9CA 4HU0A 3CV6A 1S2WA 2HPMA 3CL7A 1UWQA 2VRKA 4X2PA 4JN8A 1YNPA 1F6PA 5LIWX 3EOEA 1IXNA 2ZDRA 4K8GA 2ZXDA 1M01A 2NQLA 4GX8A 1U5JA 4O1DA 4LNCA 4DJEC 4S3JA 7PTDA 4MTVA 1R3QA 1R8LA 2Z1VA 3BANA 1YE6A 3P84A 4H2HA 2WNQA 3UFYA 4K37A 5D37A 3RXZA 2PTDA 4QG8A 5KZEA 1BGGA 1T0OA 2E6AA 2XVLA 3NQBA 4KGLA 3R94A 1EBGA 4JTLA 2PU1A 3PUDA 2Y8KA 1W1YA 1BG4A 4W8BA 4PRWA 4HZMA 1XIFA 2QLYA 3W1AA 1W5MA 3T40A 4M24A 2ZX5A 1JZ5A 3KCLA 4J3UA 2IXUA 3G1HA 5HR7A 5CPMA 4KEMA 1FY6A 1F05A 2DSWA 3LBOA 4HVXA 2GJRA 2QCLA 4XG1A 3IAQA 4E4FA 3NPWA 3B9DA 3WQVA 4ACZA 1H2JA 1XLHA 4GH3A 2UY2A 5AYBA 1QUMA 3WJYA 1RP9A 3HB9A 4P8XA 3STPA 1FHVA 3VMNA 2CBVA 4DJED 1W3LA 5G5IA 4PH6A 3WF3A 2E5CA 1LOQA 4E8DA 3M0MA 1K4GA 3CHVA 1M03A 2VDHA 1VBHA 2YKKA 3OVQA 1XIMA 1LZOA 3N17A 3W9ZA 2YL9A 4NL1A 4KWUA 2DSKA 3M16A 2VGBA 1AH4A 4NILA 2J6VA 5FJUA 2PDCA 1N82A 2VO5A 4AVOA 3QOKA 4AD1A 1BRLA 3S1WA 3GXIA 1UA7A 3N04A 2NQJA 2VEIA 2NQZA 2OLAA 4EP8C 6XIMA 3W1NA 2F9RA 3BG9A 1YE4A 2A21A 3SECA 1VR6A 2PU0A 1B31A 4PZVA 4JTAA 5IFTA 1AW5A 4D6EA 2PD9A 1W2VA 2XGBA 3SCNA 3P0WA 3LCLA 1H1YA 1NP0A 1I1XA 2QS8A 1V6YA 3UP8A 3OBKA 3N4EA 4NSBA 2GVEA 1VAHA 4IGHA 2GVYA 4FNRA 1OJXA 4JTIA 1EZWA 3S9YA 2INEA 3VDCA 5FI8A 2DT0A 3IV8A 4D6HA 4DF2A 1W1IE 3BWWA 2P53A 4Y6GA 1EA0A 4ICCX 2OKOA 5A6AA 3SJ3A 3C2FA 3QW3A 2EPNA 3W72A 2GGHA 1XDLA 1JDFA 1F6YA 1G69A 4FP1A 3KLKA 1F8IA 3AS0A 3ARZA 2JIEA 3MPGA 4NYYA 4PMZA 2Y1HA 4I9JA 4DBWA 5GJMA 4QSHA 1VP5A 3LHWA 3W22A 1SFJA 4HHHA 3IJ8A 3GUWA 1NWRA 2GQ3A 3DFSA 4JQ4A 2TAAA 4MLJA 1SW7A 2BHYA 4GGHA 1YRRA 4FO4A 4PBGA 2ZA2A 2GLKA 3ZLGA 4PB3A 1EPVA 3V1HA 3NYDA 4O8RA 4DM1A 3EWBX 1VBGA 3VXGA 5FF0A 2WYSA 3LERA 3B9EA 1CLKA 3N4FA 4H41A 3FGCB 4I7WA 1SO4A 1R9ZA 1GEQA 4PSPA 2DPEA 4O1EA 4HYWA 3WQ6A 1DJHA 1XLMA 3GKFA 1L6FA 5D05A 3AMGA 3W1LA 1UWSA 1KC7A 4HK7A 1I45A 2C0HA 5GJNA 2PDBA 1GQJA 4PBFA 2QUNA 2FJUB 1RV8A 3K46A 3ONCA 1AQFA 4MWAC 1TPWA 2Y8UA 4DY1A 4Y9NA 3VDBA 1RVKA 4MWAE 3DYMA 4TMBA 2X1TA 5I24A 3WD2A 1VCFA 3WEZA 3MWCA 4PULA 1ELSA 4OV9A 1AD4A 3GAKA 2P5NA 4DO7A 1KO0A 4MNLA 2GWGA 3MMUA 4BI7A 2Y7DA 1H1ZA 1RXOB 5CCZA 4EANA 5HQLA 2QF7A 3CAQA 4PCPA 3ZVHB 5K9DA 4W7VA 4GNKB 5KINA 3W2UA 3IANA 5RUBA 3CZJA 1UH2A 2Q3RA 1Y5WA 1DXIA 1XSIA 4O18A 5I06A 1K7XA 2XIJA 3EWDA 3D47A 3STCA 3WDPP 1UUMA 5EBAA 1TPDA 3M9YA 2IQTA 3U48A 1TWDA 1ZSXA 1CYGA 4MWAD 1MEHA 4XBJA 3GTNA 3PVFA 4V1XA 3IGSA 1XPYA 1Y65A 4RJEA 4WEVX 2EAWA 4A8LA 1BYDA 4WQ6A 3V0UA 4M6PA 4CD7A 4UTUA 3MHGA 3TMLA 3WEOA 3TJLA 4B90A 3GDMA 3UF9A 4FI4A 2YCJA 5C70A 3CUXA 3NM1A 3SRDA 4ZA0A 1OYAA 1ZJAA 2VXNA 5DMYA 1YNYA 4B92A 2XSBA 3TCSA 3NUKA 4CU7A 2W91A 3G1YA 4RCXA 1YIXA 4A21A 1Q5MA 3WNNA 3VX1A 3FGCA 1CGVA 2OELA 1EKOA 3VI2A 5I5RA 1QK0A 1W9BM 4IPNB 1TV8A 1H62A 4FLOA 4P8WA 4PN2A 4QEEA 2Y62A 1ADSA 1F3XA 2A3CA 4HK5A 1W8GA 3WQ5A 1XSJA 1KFKA 3FHQA 1DHKA 1FQ0A 3C4UA 3OVPA 4YCPA 3CUHA 2F7FA 4MSSA 3VZYA 4YLWA 3WL0A 1EA9C 3CB8A 5CPSA 3DXIA 1J0YA 5F2LA 2YLAA 4CLMA 2A6NA 2W62A 4US6A 3UNTA 1JF6A 3MO4A 1EQPA 3RFAA 3I6TA 4JN7A 4OIFA 4RPPA 3EX2A 4GIEA 1LQ0A 1K70A 2WAGA 8TIMA 5HMSA 2F2KA 1V8EA 1V93A 4NJJA 1KTBA 3ZVHA 3OTRA 4GVFA 1IZJA 3U6WA 1FHDA 1G1YA 3FX4A 1JCMP 3BZGA 1XFBA 1I9CB 4GQ0A 4QCFA 1RH9A 2ZFAA 3CV7A 4JDYA 4I7UA 1KKRA 2WC4A 1SQ7A 5AYZA 1QU4A 3UWZA 1ZB5A 2FTYA 4H7ZA 2J79A 1LWIA 1OF6A 4IHCA 4CUCA 3SCOA 1B2YA 2EPMX 1R5YA 2OXNA 3VNDA 1FWEC 5AZ1A 4UOJA 3XIMA 3OU8A 2HS6A 1J4EA 3L4XA 2NSOA 1EX1A 4WX2A 4HA3A 1TTQA 1ZP4A 4PTWA 3VZXA 2PLCA 2VJXA 5IHRA 2DW7A 1H5VA 4ATLA 3C3UA 4S3BA 2A3HA 4QDMA 4M80A 5C2CA 4FR1A 1F3WA 4O16A 4UMBA 2J77A 5BU9A 1SSDA 2DU2A 4IP5A 3JVAA 1XH2A 1UP3A 4ECLA 3UETA 4MJ4A 4NU7A 4QLKA 5DXXA 3B0YA 3T78A 3IVSA 2YCLB 3RJYA 4O0ZA 5C9WA 1HW6A 3WMCA 4UZSA 2INZA 3CWOX 2Y4SA 3HQNA 3O1NA 1WZAA 4WGHA 2V5CA 4CNTA 2EF9A 4NY2A 1CTNA 5M2FX 4UTTA 2CU0A 4K6AA 2RHGA 2PGWA 2WC7A 3VIMA 1DV7A 2CHNA 1HJSA 4UB9A 4UQEA 4GO8A 5BWFA 3ALGA 3KBNA 3LTPA 5A2BA 3UWVA 4V28A 3H2MA 1NEYA 1OIMA 1AVAA 8XIMA 3WK3A 5CPQA 3GIQA 4LS1A 3PC0A 4BK9A 2Y6ZA 3KZPA 4YVXA 3SCPA 3RYSA 1G4SA 3LCWA 2QUVA 4H9UA 1HKMA 3N3MA 3FXGA 2VDIA 1JYVA 4BFAA 3N1AA 4QE5A 3RRXA 2XGZA 1NOUA 3AMKA 2XHYA 3JUGA 4ZB0A 3UWQA 1UB3A 3BLDA 1UKPA 3D3FA 1TPFA 3DBNA 5H8MA 1WKDA 1FWCC 1KRAC 1VQTA 1P6BA 5CZKA 1ME8A 4ZFCA 1IIGA 2ZE3A 1MZHA 3O6YX 3CMGA 2ZX8A 1H7OA 2GSJA 2GFTA 4P61A 3QKEA 2Z0IA 2C18A 4L9XA 2X8RA 1E40A 4M82A 4I3GA 1ZBKA 2B7QA 1R3RA 1POKA 1SSGA 2VX6A 3F5LA 3TNBA 4GK8A 4FHAA 5U7SA 4NAFB 1U1UA 1CCWB 3RILA 4GFSA 3TC7A 4GYJA 4A8RA 2VC5A 2RKXA 4HA1A 2V81A 1GVOA 4Q4MA 3W7DA 5LIXX 1UD5A 3QV7A 3V16A 2ZUVA 1ME7A 2FPTA 1A4LA 2IS7A 2FFCA 4GO9A 4B3LA 4WDWA 2EJ1A 1E15A 2EJAA 1X97A 4C65A 4PMUA 3WLIA 2YCLA 1O66A 5E09A 4POCA 1P0EA 2HNHA 2YBTA 3NZQA 5I3HA 2OEMA 4DF1A 1U22A 3HGOA 2X7VA 3O9NA 3T2PA 3B8VA 4QNWA 4YL2A 1B54A 1XX1A 4B5TA 4ZQCA 4R9XA 1UD2A 1KCZA 2E3ZA 3LXCA 1S46A 3JZUA 1LM1A 2ABBA 3B4UA 1WKYA 2UY5A 1B4KA 1PYMA 2XIQA 5G4HC 3IJQA 4PEKA 1G5AA 2QW5A 3WH8A 3HPAA 3VDHA 1UWAA 3MCOA 4G56A 3LM7A 2FJKA 4RE0A 3U4AA 2X7WA 4YTQA 4H6EA 1HKWA 1CWYA 5D03A 3A4WA 1HT6A 1U5HA 1SO5A 3GH7A 3PUOA 2W5FA 2AQVA 1GZ1A 4E2BA 4WKHA 4B5XA 2QJJA 3NZ1A 3W53A 1G9HA 3NL6A 4YVPA 1VPQA 1OG0A 1YPXA 4DPQA 3D5HA 3PJXA 4HN4A 1VHCA 1GNXA 3LB0A 1PVNA 5E9XA 2D3LA 4IL0A 4C6MA 5KZ6A 4DB7A 1DIEA 1DJWA 1IF2A 4W84A 3VIGA 4I5XA 1AZ1A 4QFUA 4CNPA 1A5NC 2QDHA 1DP0A 5E9AA 5BXTA 1TTJA 1W5NA 3H4GA 3B97A 4GKLA 4BF7A 1C93A 2HQAA 1U1HA 2CZDA 3AHTA 4P8VA 5CGQA 2Z26A 1BD0A 3GSMA 1AG1O 1Q85A 1D2KA 1KM3A 1ODUA 4ZQNA 5E6YA 4TVUA 3DH7A 3WBXA 2CXGA 4NAFA 3MY9A 2DH3A 3ABXA 1XYZA 4ZQRA 1KXVA 2BLEA 4Z2GA 3TQ0A 1WZMA 2VYOA 1X38A 4S3KA 1XBYA 1KWGA 4A22A 1JDEA 4E8GA 5HNUA 2NV1A 4TR9A 5EL1A 5HATA 1O6IA 3NDOA 3QFWA 1XRTA 4KKXA 2VGFA 4GG9A 3W75A 1UQYA 1WUFA 3B05A 3MI2A 4D8LA 1D7FA 2J7EA 4V2XA 1QRQA 1Q2SA 1UR4A 4WHBA 3RPTA 4HMNA 4C5ZA 1M04A 3TQVA 5DX7A 2VQTA 4OGZA 3IGUA 2OPJA 3NL3A 4J5NA 3E96A 2E28A 4WY0B 3EWCA 3GG8A 4XZIA 5DT7A 3HGJA 2ZRZA 1Q3NA 2QQ6A 5EMYA 5HBFA 2DZSA 4NXSA 1UUQA 2RAGA 5A1AA 3OHMB 1VHNA 1QK2A 4IL2A 4XO7A 4JIPA 3O8AA 1L6WA 4BZYA 3W83A 4DI9A 3F5KA 5DT5A 2ZKMX 3VIPA 1FFQA 3VX0A 4UNKA 1IWBA 1B9BA 2QUMA 1GGOA 4NYUA 1Z44A 3AIWA 4HNUA 3DHFA 1IZKA 3NA8A 5FF4A 4KERA 1EEXA 3OJGA 5BRPA 4LVAA 2VWTA 4LALA 5F7UA 1G4EA 4IIBA 4IPPA 4DXVA 1MDLA 2PPGA 4CN1A 3FOKA 1XP3A 3AXXA 1EOMA 3ZJ6A 3GB6A 4J3TA 2V8ZA 4GYFA 1R85A 1QCWA 3FJ4A 4JCLA 1UWTA 3KHDA 5EU9A 4IP4A 1WKEA 3G1VA 4JN6A 5C7HA 3SJNA 1GUVA 5D09A 3I7RA 1UASA 4RZ5A 5T9CE 3VMOA 1JIBA 3PWGA 2QVHA 4WJXA 1LL7A 2R1PA 4C6KA 4S2CA 4DUWA 4UMCA 4QBXA 3B0VC 1TQJA 1G4PA 1JCNA 1QJWA 4Q8TA 1BWVA 3UXIA 4N0RA 4TU1A 1X6LA 4ROPA 3KVJA 1JYXA 4P8UA 2E0PA 3HZ3A 4MF4A 3B0XA 2BGSA 2BVWA 2W0UA 2CLPA 4WXYA 3URBA 2Z27A 1OVDA 4MY1A 4MOZA 1Q6RA 2R91A 4X61A 4MYXA 4EAYA 2XIOA 3UJFA 4IH3A 5IM51 3L2MA 3NDZA 3KOWA 4L4MA 2B81A 3UJ2A 3U3HA 4WY0A 1XLJA 3WO8A 1CDGA 1IT0A 3WH7A 1J0JA 5AB3A 3AIRA 3HJEA 5C6MA 4PYSA 3KP1A 1BG9A 2XVPA 1M68A 3NQ6A 8CGTA 3PWAA 3PWIA 1EYWA 1ZQ5A 5HUPA 1BKSA 1Q2RA 4CQDA 4Q6XA 3ECQA 3CXOA 3DEQA 1CGUA 4P7QA 4NZCA 4C6PA 4LC6A 4E4PA 1K6AA 4UTFA 3NTYA 1OYBA 6PTDA 3H2NA 4KWSA 3KM8A 1X96A 1UR1A 2EG8A 2VGIA 5CJMA 3PTKA 1ITXA 2V82A 3EX4A 3QR3A 3RM8A 3VCNA 2D2OA 2P88A 2HE5A 4H8NA 4F48A 5CJ5A 4CU8A 1JQVA 2P76A 5CPTA 3CQKA 2CFFA 4GYPA 2WSYA 3KRSA 2HK0A 2VEFA 4B9YA 3M4HA 1DJGA 5TIMA 3G24A 5E70A 1DE5A 1TVNA 2RGLA 3GHSA 1VF8A 4GZIA 1BPLB 1GPFA 1ONEA 1XM3A 4QQ3A 1NAL1 3GC4A 2CHRA 2VZOA 3BGJA 4QAIA 2OFJA 2ZXAA 4B5UA 1O5KA 4O52A 3RX3A 1GK8A 2WM1A 1S2CA 4B91A 1YPIA 1FH9A 1I2RA 3F1QA 1LJYA 1O4UA 4AF0B 2PGFA 5T9BG 2PDUA 1F76A 2QT3A 3MSGA 4C1NB 4KPLA 5BW6A 4MUPA 1IT8A 3WQWA 1V7AA 2HXTA 3WJWA 1JZ8A 5HQEA 2DIKA 3SN0A 3AISA 2QYGA 3ARWA 4MIMA 2GYIA 4GC3A 5C9UA 1SM9A 4BCEA 3SURA 5M03A 4CVUA 4JNMA 3GU2A 2WHMA 4GCAA 3PNZA 3SN4A 3WLMA 4BJHA 4ZQPA 5G2WA 2I9UA 4ADUA 4LRTA 2D23A 3A13A 2LLEA 2WVSA 4M29A 1M53A 1H49A 3PTQA 3AU6A 1KBJA 3Q45A 3HMCA 4K7YA 4KRZA 5I77A 3TYBA 3VM5A 3UZXA 4JQAA 1ISVA 1FVPA 4EVZA 3L66A 4IPIA 3TIMA 3S0CA 5T8GA 5AHEA 4UOZA 4LBUA 4I9MA 4KEVA 3CEPA 3TWBA 4S1FA 1P48A 2CERA 3WD0A 3ZT5A 4KCTA 2CESA 3MUY1 1W5OA 3R7MA 3AHXA 3NWRA 1TE6A 1UJPA 4GBUA 5HNNA 2FIQA 3WUEA 1KCLA 2BVTA 1A5LC 3NAVA 3MKVA 4YHEA 3W25A 3T07A 1EC7A 1J0HA 3AMDA 2J7BA 4WRHA 1RD5A 1Q63A 5FL1A 1JUBA 2NQ5A 2HVMA 2QMKA 1MUCA 2E8ZA 4IISA 4UQDA 1K03A 4PC8A 1EP1A 4IMDA 3GW0A 1W56A 3KBMA 3CQHA 5H8UA 2ADAA 4AF0A 1OABA 2GQ9A 4IQDA 4O10A 2VP8A 3GFYA 4KT2A 2J88A 2EXOA 3W26A 2O9OA 3W7HA 4L61A 3ICJA 4C1NA 1W5PA 4PUEA 4C5YA 1KFBA 2FTPA 4IJRA 2PLJA 1VIZA 2JALA 3FA4A 1DYSA 1CXHA 4WIWA 1CIUA 1WA3A 4D72A 1OX5A 1FWBC 3WJSA 1MXDA 3GXPA 5A94A 1ODZA 1BVWA 1TVPA 3LCXA 4PUKA 5BRBA 1FP8A 4JS3A 3I65A 1OINA 3GYEA 2YL5A 2FB2A 3WLJA 2C0AA 1FCQA 1B4EA 2OQYA 3KRUA 3LS9A 1FWAC 2PFHA 1KRMA 2YCKX 3W7KA 1E6RA 4ORMA 1SR9A 4UTLA 3V5FA 4BA0A 1DJXA 3S6OA 2YL6A 3HURA 2WNZA 1CLVA 1G4TA 1GCYA 3T1GA 3AC0A 4UTJA 3D6NA 4H3DA 4LUIA 2D2GA 1TV2A 1V6TA 1C8YA 3OBAA 3E0WA 3VOJA 4JTHA 3AXMA 2DZUA 3N2TA 2YDRA 3VOFA 3U2ZA 3OZMA 4FX8A 2CLKA 2Y7GA 3MYPA 1BSIA 1XIHA 2QEZA 9CGTA 4Q8PA 4NKCA 3R2GA 3APTA 3WY1A 1M1BA 2DSUA 3DKJA 1CXLA 3TSMA 4GGBA 1W9DM 4ZODA 3BW3A 4BS0A 5AFDA 1KLYA 3LHTA 1DJQA 5M3WA 4UTHA 3HV9A 5FF7A 3TQKA 3TSBA 4I6VA 1V02E 2VR2A 4WY0F 1YTDA 3F4CA 3NNTA 3WL1A 4RXFA 3FEQA 4KETA 4W5ZA 5C54A 1DTUA 4HKPA 3NPXA 4C90A 2P8CA 3M44A 1OD8A 1QPNA 2JF6A 1WXYA 2J9ZA 2PTYA 3GR8A 1ALDA 4AB4A 4PTNA 1JZ7A 5D9OA 3TCEA 1XLLA 4FAMA 2PWUA 4A3YA 1AK5A 1SUXA 3BAWA 4FLRA 3DFPA 1PKYA 1W5QA 4ZENA 4GIAA 5DRIA 3C2YA 4N42A 4MB4A 1OC7A 4KWVA 2G8ZA 1EUNA 1PTGA 2J47A 3IS4A 1SJBA 1W1TA 1HF6A 4B3KA 1I2QA 4S3AA 1O95A 2V5LA 4PMRA 3S2JA 1E4MM 3H53A 1QNVA 4RZ4A 4O0QA 4AH7A 1A4MA 2EPHA 1MW3A 2P50A 3KWSA 5LHEA 2E8YA 3TOPA 1ZCOA 3QR0A 1K9EA 5DXYA 3W7CA 1VCGA 2VZSA 1CB7B 2E5DA 5HUOA 1CGXA 5G4EA 3UZZA 2YR1A 5B7YA 3BW4A 3IJDA 1ISZA 2WNNA 3EX1A 3BQ5A 1GKPA 3TR2A 2X1SA 1G67A 3GG1A 1QO2A 1XIIA 4JTUA 3H2EA 4GIYA 1XLCA 4HOWA 2W92A 3DI1A 4J4KA 4C6IA 1E4IA 1UMYA 3IK2A 5KMYA 3VD7A 2E77A 3NQEA 2E68A 3U2EA 2YW4A 4PL1A 2KAUC 4JL1A 3VIJA 4AVFA 3THAA 3WMBA 3EGJA 3W01A 1QR7A 3PBYA 2GGJA 3AUJA 2WB5A 4MPKA 1ZAJA 1EB3A 3APYA 1LROA 3G8EA 1LBFA 1JGMA 1ZL1A 1HTIA 1JPMA 2WCGA 4B5WA 1LLWA 3O6CA 3BGAA 2A3AA 2QR6A 1M7JA 3T0BA 1P6CA 4S38A 4H00A 2C1IA 3W2KA 4Q4KA 5EBUA 3B9OA 5I3DA 2ZDSA 3S1XA 3DGBA 4HP5A 3CM4A 3BGGA 2ZRXA 2DT3A 1V0MA 4XUYA 3DN5A 1KRCC 5D2WA 2XUCA 3C5QA 3OLEA 3W29A 2NXHA 2E9LA 3DG7A 3MSRA 1H7NA 2QV4A 2H8XA 2WCSA 4Q8UA 3O7UA 1BWKA 3PTDA 5FAJA 2GDVA 3CQ0A 5HDRA 3E5BA 2FTWA 1JDCA 3VOGA 2HV5A 1V6XA 1MEWA 4JQ2A 3E0LA 1GOIA 3KCOA 1HJXA 4MY9A 3BH4A 2YXOA 4N02A 1CXFA 5I79A 4AHPA 2PAJA 3VDGA 3ZFHA 2DIEA 3JRKA 4K3ZA 2Y63A 1K8ZA 1KM2A 4OOUA 3I3DA 3E2RA 2XWEA 4GI8A 1EWEA 6REQB 5FESA 1TE1A 1HGYA 1XQKA 2Z1SA 1TR1A 3GFXA 3PP7A 4UQ9A 1HX0A 1W9PA 4EAMA 4JDBA 2R1NA 3C6CA 5LA0A 4A3UA 2CCRA 2L5HA 2PDXA 1DKWA 4TOQA 3UPWA 4LQ1A 1Z6KA 3EX3A 1M9HA 4MAZA 3F4VA 1OK6A 4PMVA 2QIIA 1UZ1A 4NJKA 2J6XA 4O53A 3UJEA 2AL2B 2FKPA 4GVGA 1VYRA 5D8WA 5H2ZA 1KA9F 1B3YA 2ZX9A 2O9RA 4EXAA 2WCAA 4AZ5A 3UPMA 3VK5A 2UZ9A 1V7YA 2QUUA 1S5VA 3KL5A 2XVGA 2GPTA 2ATMA 5E6ZA 1EJTC 3G18A 5D2VA 3S1GA 3WLLA 2ISFA 1A0DA 1L8PA 3HA1A 2F8QA 2BWGA 1G01A 2PSNA 3H7VA 3EX6A 1GTHA 1XFCA 4EF8A 2RDXA 1DQUA 4IXHA 3LK6A 4WZHA 3KEHA 3R5EA 3VA8A 5CPLA 2OJPA 4JIEA 1JZ2A 5I0DA 4QTGA 1TIWA 1JCLA 4DXXA 2CITA 4FNSA 3MUIA 4CCEA 1RQHA 5KEZA 4DNHA 3ARSA 2Z1BA 3AQUA 1CT5A 4EACA 4FPSA 5IFPA 3VO0A 3OGRA 1MWOA 1P1XA 5CBIA 3ABSA 1XJBA 3R12A 1X6UA 5U4NA 4RKAA 2A5HA 1OM0A 4J9JA 4AD5A 3WX7A 1BTCA 1YEYA 4M5PA 1X1ZA 4MNJA 1HJUA 2ABAA 3GDTA 1S1PA 3IJ7A 5FJJA 1VLIA 1XH0A 1S39A 2CLEA 4FSAA 2E9BA 3BOLA 3E2QA 1U33A 5L6UA 6REQA 4X22A 1BYCA 3GTIA 3NPUA 1UBSA 4CQCA 1SJCA 2BOFX 3VIKA 1RPXA 4TX8A 5LSMA 3C2EA 3GDRA 4U3AA 2Y24A 5BMWA 2NWRA 5FJRA 3G6MA 4J3XA 2J9YA 3SY1A 2DEPA 1IEXA 3DUGA 4UXDA 1L6GA 1G6CA 4LUSB 3FYPA 6CGTA 4P7NA 3XINA 4UTKA 1WDDA 4FNUA 4GI9A 2QULA 2PTWA 3S5YA 3BMWA 5I09A 3P61A 4YU1A 3E1F1 3OA5A 3IUIA 2PB1A 1G0CA 4O12A 1ADOA 1TV3A 3T8LA 3P14A 5GNXA 2YL8A 5BMXA 2TODA 1PWLA 2V2HA 4C6JA 1R3TA 4LS2A 2VVSA 3LGDA 3KOXA 4UR8A 2HNEA 4E2VA 2X0YA 4AG0A 4BWLA 3VGGA 3LRMA 3LCHA 2DJXA 2HBXA 5DCBA 1RBAA 5I00A 4AXKA 2P10A 1UD4A 2XFWA 1BVZA 3TU9A 5IDZA 3VIFA 3LX9A 1K7EA 1SYTA 2BDQA 4HIBA 4NZ3A 2E6DA 2WANA 3TN6A 3HJZA 2XFYA 2PGRA 3MZNA 2DZVA 2MANA 3L12A 3C0JA 3AAMA 1TCMA 1LTDA 2WHJA 1A0EA 3UBPC 3EPMA 1OX4B 3U8GA 3LOTA 1MMFA 4GNVA 3MUAA 3WQPA 5BXPA 5T26A 1TPVA 3NEVA 4PTMA 5A8OA 1GJWA 1R86A 3IIVA 3B4YA 2QIWA 5DEZA 1RJRA 1B0IA 4HSOA 1KM0A 3MB9A 3C8NA 3NVDA 5BXSA 5C2GA 3W7GA 4R27A 3GK0A 1E0UA 3M0ZA 3TXZA 4WGXA 3G0UA 4XAFA 3QSRA 3VKCA 1Q4NX 1VH7A 5FJIA 1JG9A 1EO5A 3S2CA 1EOKA 4LFYA 4DEFA 3TW6A 3QHOA 3ZT7A 3MP5A 1TWIA 4YWSA 4RLIA 4UFHA 2ZUMA 2OYKA 3GU1A 4GZEA 3UU0A 1D3HA 4LF1A 1LOSA 3NPVA 4LUSA 1SW0A 2CXEA 1FFRA 1LWJA 3WDJA 3PULA 1JDDA 3S5NA 4LSBA 2GQAA 3KVMA 1RALA 2G3FA 3ZR6A 4J3WA 4P7RA 2WKLA 1XHGA 2J27A 2PRHA 4IGSA 2DDXA 2MNRA 4RDWA 5FSEC 4AD0A 3PPHA 1KFEA 1ZS2A 3TJ4A 2GGGA 3U4FA 3P67A 3PAOA 4QITA 3STGA 2AKZA 2QJIA 1LRNA 3QMSA 3PJWA 4R3UA 4LAZA 3CQIA 2GUBA 3H7RA 4FIQA 2FB3A 3W6MA 3C56A 4PMQA 5I03A 4WLCA 5H91A 4CNOA 3GU9A 3KW3A 2E4TA 4GVHA 1VYSX 3WD4A 5A6SA 3BG3A 3HGSA 4PA8A 2O4QA 2Q09A 1Q6EA 3C52A 1YBQB 3A21A 3NZRA 4E2OA 1BYBA 3H4WA 2ISSA 1OX4A 3EKLA 2V3GA 3C86A 3FK4A 2VD8A 2FDMA 3EPOA 1YLVA 4HPGA 4QG6A 4AZHA 1G94A 1GVIA 1IGWA 1FHUA 3BCJA 3W76A 1YPFA 2UV8G 5I3KA 1I2PA 3PK7A 4UUIA 2X05A 3WK0A 1H7RA 4HA0A 2DZWA 4JX6A 1IEVA 9RUBA 4O28A 4PL2A 2VDGA 3QR1A 3H24A 4Y96A 1L2QA 4I7VA 3VD9A 4W5UA 4GFIA 1OT1A 4WKFA 1SJAA 3PBMA 1QOXA 3AS2A 4LNYA 1K9DA 3G1RA 4O4WA 4XUGA 3EMCA 5H6HA 2YSWA 1AH3A 1CW2A 3Q65A 4IIEA 1UKOA 4BI5A 4E6MA 4B5SA 1H41A 4QP0A 2VEMA 1QDSA 3W1MA 3DAQA 3KRZA 2YFOA 3TA9A 2YJQA 5BYWA 2D3NA 2P8BA 1XI3A 2AMXA 4X0NA 2BG5A 3A23A 4ZOEA 3QKZA 2RFGA 1J8VA 3TR9A 4GA8A 4KIRA 1S2UA 2IPJA 2EPKX 3W81A 4JY8A 1VS1A 3L2IA 2V67A 3AWOA 2XN2A 5AHMA 5E1QA 1A5OC 3N13A 3PZ9A 1OIFA 1RVGA 3DFQA 4RZ6A 4DBEA 5J8LA 4C6LA 2PTZA 3NL2A 4NJHA 1DQWA 2VEPA 1R9YA 2VR4A 3WFAA 4GLEA 1GQLA 2Q3OA 3QMRA 3MO7A 2EO7A 3ANYA 4DUXA 3B40A 4LW7A 3CIXA 3DYOA 5HXMA 4V15A 3I3EA 3WBEA 5XIMA 2A1YA 1GHRA 1GTEA 4F2UA 2MUCA 3CZGA 3NQ7A 1YBQA 4HNNA 4QE4A 2QCGA 2DZPA 1HQTA 3R10A 2DZBA 1ISXA 2W66A 3H8AA 3H70A 3O0FA 1UIOA 2C91A 2TYSA 4F0RA 2IUZA 1PAMA 3BLKA 5A8MA 4J2PA 3GVVA 3RRAA 1JUKA 3COTA 1R7AA 3TJIA 4XVDA 4XZWA 1HJVA 5TF0A 4D1IA 3QSTA 4P5UA 1S5MA 4Y9PA 3HF3A 1GOXA 2O56A 3LLDA 3AUOA 1TZ9A 4JIQA 2WMFA 4MB5A 3T81A 4AWTA 1EJUC 3WMSA 1HKJA 3U5UA 4MJZA 2VELA 1I1WA 3TV8A 5FJOA 1Z7AA 2FFIA 3FHAA 1IR2A 4RK8A 3B03A 1W1A1 2P3ZA 3QOMA 4DJDA 2WK2A 5TNVA 4TV5A 5IBXA 2HCVA 2IW0A 3VDAA 1TPUA 4CGTA 3W7IA 1E73M 1T7LA 3SN1A 2C14A 3GXTA 4O8AA 5LA1A 3CUJA 2V63A 2FH6A 1GOQA 4GE8A 3QFEA 1JPHA 4AEFA 1OZQA 4ZTXA 3F2DA 4AHOA 2X1IA 1VBRA 3HG4A 3P8JA 3ZT6A 1AQMA 3DC0A 3S1VA 3UPBA 1XBVA 5A5WA 3M0LA 1HO1A 1ZU8A 1LQ2A 5A6TC 5EMUA 3PFMA 1TPH1 4F4RA 1AJ2A 2G3NA 2XIMA 3M5ZA 2ZVIA 2BS9A 3CPGA 4LTSA 1Q6LA 4V27A 3INPA 2ONEA 4HHMA 4PR4A 2XH2A 1E0WA 3N2MA 3ITGA 2ZTJA 2WZMA 3TP4A 3WH5A 3VGFA 3U2CA 4AIUA 2XZ9A 3QVQA 4RE4A 5HNRA 1D8CA 3PBUA 4DQWA 1YKWA 4GBDA 4Z1AA 5FA5A 4HPJA 2GVLA 3L4ZA 7ODCA 1RLCL 1VBUA 3QF0A 3MI3A 4LXFA 4ZQOA 2AGTA 4M1BA 2VM8A 1XLGA 3UD6A 3CZKA 1ZJHA 2Z4GA 3GHUA 5A6BA 3N9KA 1HKVA 3MVTA 3OP2A 4QISA 1MSSA 1JXKA 1QAPA 4Z1BA 1CECA 4Z2KA 1TFVA 2XIBA 3N9SA 4H83A 4ZGYA 4DX3A 3CH0A 4D2JA 4LH8A 3QYSA 4KESA 3W7JA 5D9NA 3M5YA 1VFSA 4H6KA 3LN3A 1TV4A 3L65A 2Y0FA 4AIBA 2XGIA 3W73A 4S23A 3K13A 2OT1A 3B3DA 5E0FA 3HV8A 4D8AA 2AAAA 1CXKA 4MY8A 3CAKA 3PZNA 3ZMRA 4X63A 4W8AA 1PZ2A 4OBSA 3G6LA 2FHFA 4UTMA 1RA0A 1E51A 3WF1A 3A12A 4H8VA 3DFNA 4Z1YA 1DE6A 4JICA 1F2JA 3L21A 3R25A 2Z25A 4WD0A 1JFXA 4FALA 2C15A 1ZGDA 3G3MA 5AC4A 3WH9A 2CZVA 1W32A 1Q7QA 4AWEA 1BFNA 3HPZA 3VNZA 1PL9A 1J0ZA 4MFEA 2QPXA 4DWSC 3CLWA 4XD6A 4OJYA 1BXBA 3WQEA 3ARQA 2PE4A 2VEKA 1XYBA 3CQJA 5FOOA 1DORA 3MJYA 2ZZ7A 3SGUA 1DPMA 4JYDA 1DWFM 3UR8A 3PF3A 5K3VA 4IIFA 4AU0A 3QTGA 1Q13A 4OBRA 5AHNA 3VKAA 3M0KA 3QZ6A 2IKHA 3LRLA 4AYSA 1KXTA 3I7SA 3FY1A 3LI1A 1EXBA 1F73A 4GD0A 5KITA 2FMOA 2X2GA 2DIJA 3WN6A 1JZ6A 1A5SA 1GPWA 2WHLA 1JZ4A 3K5XA 1XCWA 4FNPA 4WK9A 3KZSA 4QAWA 5AOUA 1EGMA 2QCFA 4TTUA 1J2WA 3KDNA 4L6OA 1S5TA 4YNGA 3OZPA 4FLSA 3DGRA 4JHMA 3LBMA 1V77A 5G2IA 2SFPA 1I75A 1NIUA 1V3HA 3QQ0A 4DWSD 1PX4A 1OFDA 4YYCA 3HPFA 1XYFA 4HQVA 2CC0A 1TMHA 1J5SA 3KL3A 1IIHA 3DX5A 2P0OA 4UQBA 2OVLA 5D9PA 4GVIA 3S5OA 1DJIA 5AHFA 3E5PA 1WV2A 1DEDA 4L9YA 4DZHA 3W82A 3UG5A 4A2SA 2CLOA 1AJZA 2Z24A 3GZAA 3WK1A 1T40A 3TAKA 3ARPA 4J2MA 1Q65A 3L2LA 3LCFA 1M6JA 2V5BA 3NIYA 1E6XM 4M51A 3GVGA 1EJSC 1L9WA 3VPLA 4X9YA 1FXQA 1FDYA 5AVNA 4OWGA 1DQXA 2G3MA 1UH4A 3LQLA 3BPWA 4IIHA 5F2MA 3JU2A 4LYKA 1KBLA 1BYAA 1W3TA 3R43A 2FH8A 3WQCA 4XO6A 4L4LA 4L5ZA 3PY2A 4IJCA 2BMBA 2ZADA 4NP7A 1RY0A 3GXDA 2H9AB 4NVTA 3VKKA 3VNYA 1PCWA 4I9AA 4C7DA 2F61A 2R1MA 4W7WA 2QJNA 1PJ9A 2X42A 2GOKA 1QI5A 1XICA 1A49A 4LCSA 4RX0A 2O55A 1WPCA 2PDLA 4QROA 4EPKA 4R53A 2WSKA 3TW9A 3WLRA 3NG3A 1E3XA 1C7SA 1ZAHA 1EHNA 1OCNA 3GUGA 3H2AA 5JUVA 2UBPC 3V5OA 4TX9A 4LGXA 5AZ0A 2R1KA 2V5DA 4UQAA 2PTXA 3W1XA 1SZFA 4AZ6A 3UVAA 3GH4A 1HXJA 3V1PA 1XS2A 2PEVA 3ME3A 1ZNNA 4IJBA 2XJ7A 1KGWA 4DELA 5CPNA 1V3JA 2Y5JA 4HPHA 3WLHA 3L0KA 5E0KA 1RJPA 2Q6ZA 2HK1A 4Q8NA 3E2VA 4LYQA 2ZCGA 1GW1A 4H6QA 3MV01 4PEEA 2NLYA 3T2QA 1K02A 2ALRA 3R0DA 5K4XA 3WLNA 4Q8QA 2TSYA 2ZC1A 3BCFA 4KEUA 4UQCA 2VFGA 3DECA 3DERA 1V6UA 2AMGA 1OFOA 3C2VA 3ITYA 4BQ2A 5I3FA 1EJ7L 3I68A 2FZNA 2R6OA 2RDWA 1DIDA 1W1B1 5HAOA 4U33A 3UR5A 3RPMA 1PZ3A 4GX9A 1WBHA 1C9DA 2QDGA 3DC8A 4KS0A 2OZ0A 2DT2A 1TWSA 3L4WA 4MUZA 3RIKA 5HMFA 4O54A 1YXCA 3GG0A 3NQMA 1JZ3A 1C7TA 1VRXA 5HULA 1XBZA 5FACA 3SI9A 3MKCA 4NQ1A 2H9AA 3NZGA 1Q8AA 3QHMA 4ZB2A 3AIBA 2QCNA 2E6FA 4N9EA 1YTKA 1WX0A 1CGYA 5DMMA 3NQAA 2OO6A 5JH2A 2F6KA 3WEMA 1RCQA 2V69A 3IIZA 3MANA 4L4OA 1K7FA 4XZ9A 4DJFD 3BV7A 3OLDA 5CBBA 3URAA 3AS3A 2DT1A 2F38A 2BHZA 4GUIA 3R4IA 1SW3A 5HPCA 5DO8A 1CEOA 2CWXA 5IXEA 3TYDA 2NXIA 4HHLA 2OZ8A 1FP9A 2I5QA 4Q22A 1YXYA 4Z1CA 3ELFA 3K4DA 5DF0A 1QNPA 4HCDA 3AXHA 2OR2A 4DYKA 4FEZA 1JI2A 3OODA 2C8NA 1FWRA 1TREA 1ZFJA 3BJTA 3W85A 4FOJA 4UZUA 2G41A 1OF8A 1ECEA 3R79A 1W1VA 2J7GA 2QVNA 3SUWA 2VCAA 3A6OA 1A5CA 3BLFA 4B2DA 1Y5XA 2WVUA 3PJUA 1GORA 1O5RA 1JNDA 1PE1A 1HL9A 1TSIA 1V08A 1KBBA 2V68A 3EKZA 1US0A 3AS1A 4NF7A 1Q45A 2CZEA 3TXVA 2B0MA 1GOWA 2WSRA 3MI6A 4MFDA 1NP2A 2HTMA 5CAHA 4IP7A 3HBLA 1XD1A 3NL5A 3AYVA 2WQPA 2WZEA 3VC6A 4AC7C 3P5YA 3VM7A 1XIGA 5BCAA 4HSHA 1JCTA 3HN3A 2DY3A 4L56A 3WQOA 1F74A 2Y61A 3W7OA 4MJMA 3NO1A 1R47A 1TRIA 3L68A 1AA1B 1JUEA 4ONVA 3NSXA 5ABEA 4K39A 1YADA 1QHOA 3N73A 5GPRA 2VUYA 1XC6A 4XZLX 4NASA 1UQZA 3SFKA 2HS8A 4FLQA 3W24A 1ZPTA 3GNOA 4JHOA 3AXKA 4MZ8A 3AZRA 2C1HA 4AZGA 1XGEA 1MQRA 2PF8A 2PWHA 1B3OA 1R2TA 4DO6A 2P1FA 5LHFA 1S3TC 1XRSA 4H19A 3VINA 3A47A 3THCA 3UT0A 1XIJA 1A50A 1D9EA 3CV1A 1AW2A 3QPEA 2GZXA 2HMCA 1C8QA 4N9BA 4PB5A 1MI3A 4DJFA 1FWGC 3GC5A 2NLIA 2BASA 4MZYA 1TWZA 2A79A 3CIWA 1B90A 3BMXA 4REQB 4G7EB 2PRMA 2ZUUA 4YCOA 5AYIA 3DFYA 2ZUNA 3G2GA 3IGXA 3CC1A 4W86A 2G4FA 4GPNA 1DIOA 1JRCA 2VRJA 2E67A 1EDQA 4R7OA 3IIOA 1IEIA 6TIMA 2OEKA 3CO8A 1I2OA 4HHPA 5CZSA 1UZDA 4OECA 4GI4A 3S46A 4B4FA 1PIIA 2PP1A 3ATYA 2VHLA 4JEQA 1Y7VA 3N2XA 2J9XA 2A7NA 2ZZ2A 3M64A 3OZYA 1EUAA 1GJPA 4K7VA 4Y2WA 2CLHA 4DZ5A 1IWAA 5DMNA 3ZO9A 4GKTA 1UP0A 1JL8A 2V38A 1UPPA 1N7KA 1NQKA 1I6NA 4G1NA 3TSDA 4NX5A 1KRBC 1JR1A 1ZRQA 3KWXA 1R3VA 2CIPA 2BGQA 4KFNA 5GVJA 3TZFA 5TQLA 4IMCA 3CT7A 2ZUWA 3UG8A 2VEGA 5A3HA 3NVTA 3M0XA 1AW1A 1UKTA 3ZZ1A 4NXKA 5PTDA 3MDWA 4Y90A 2E25A 3FJNA 5FEWA 3BLIA 1UA3A 3UY7A 3UZYA 4U2ZA 1H63A 1E6PA 3LEPA 2OZTA 2J7HA 3QGKC 4PMDA 5EKYA 2GVJA 3GG7A 4JCMA 4AISA 2Z28A 1UBPC 4IM4A 2FGBA 4RNFA 3TA6A 2QCMA 1GYLA 2ZQ0A 3ES8A 3UY8A 1NY1A 1Q6OA 1QMLA 2XM2A 3CMJA 3N6JA 4BKNA 3LPPA 1QASA 3V4BA 3SRKA 3IVUA 4KCVA 3CS2A 2NWSA 2PZ0A 5CXPA 1E0VA 4U2YA 2QAPA 1H0GA 4WDUA 4RDYA 3WCZA 1GG0A 1V3IA 3FKRA 2PP3A 3LY0A 4ZOBA 3A9IA 3SZ8A 1XH1A 4ZXLA 1S1RA 3T0CA 3ORWA 2QV5A 3OW1A 1MW1A 4G7EA 1MZRA 4KFOA 2ATSA 1AUSL 4O57A 4S2BA 3IVTA 3SADA 1FHLA 1XV8A 3EB4A 3CHCA 4QG9A 1F61A 1LLZA 4UTTC 3VKJA 4FZIA 4U28A 3S8HA 2JF7A 2BODX 3S5ZA 3RMJA 4AAJA 4NNAA 4JQ1A 2WSPA 1TR9A 1NWTA 3MVIA 3W87A 4MADA 4DO5A 3E9AA 2P3EA 1JVNA 3BAXA 3KE0A 2E40A 4YTSA 4E3TA 4K8EA 4AMAA 2YDSA 4Q3MA 2VC6A 4NI8A 3RR4A 3GQYA 3UW6A 2FHBA 1KLZA 4IT1A 4D6FA 2X1RA 1R3WA 4F9DA 5K7JA 4JKLA 2OMAA 3K8MA 3KBSA 1EX5A 4A3QA 1JDAA 1IEWA 2QJMA 4GUGA 5FEXA 2YOCA 4ES4A 4I6KA 3MWAA 4HMCA 2XFFA 3CL8A 3KXQA 1EWDA 4DBSA 1B3XA 1JRBA 1GWJA 4W8LA 4Q4PA 3J7HA 2YB1A 2VRQA 2AAMA 2I14A 1ZALA 1UC4A 3OYXA 5TBOA 4OT7A 4AZ7A 1X1OA 3HG2A 3NO3A 2R1LA 1QNSA 3R1ZA 3PTMA 3W7LA 1SFLA 3FXYA 3T6CA 3I10A 3THDA 4XZNX 5AC8A 3AHVA 4MDOA 1FUYA 3UA3A 5KTLA 5C9RA 1BVNP 4O13A 3K4WA 3V5CA 2OSYA 3RO6A 4GUHA 4MKSA 1QPQA 2HISA 2WJEA 2X30A 4JXCA 4PGLA 3C0SA 1KQZA 4GRSA 4MKVA 2ZX6A 3NQDA 1VFOA 3CT2A 4EX4A 3D3AA 4ZO9A 2BOEX 1UP2A 1QNRA 4FNQA 3W1PA 3CWHA 1JYWA 3BSMA 3KRBA 2PI6A 2W27A 4GZJA 1UKQA 3VABA 4C6DA 3BCDA 3H7UA 4ATWA 2C79A 4O19A 1MW0A 4D9PA 3BZJA 1XUUA 2IKJA 1OFQA 1EBHA 1MRAA 2EKGA 3CUFA 1VFHA 3KLLA 2FQIA 4Y8EA 3CYJA 2YZ5A 5HA7A 3WBWA 1B30A 2CPUA 4D6GA 3FVDA 4HU8A 2G5WA 3SUTA 4JTDA 3ZJKA 4LAKA 2EG6A 4DLMA 1H7XA 1I0DA 1KCKA 3NYZA 3OPSA 4LC8A 5CSSA 3KS5A 4DF0A 3CZ8A 5IRPA 3EXRA 4AY8A 3AMLA 1TV5A 3S2LA 2JGQA 3DHUA 4A3RA 1PZ0A 4CCZA 1WP6A 2RJHA 5DCEA 4FOKA 1NOFA 3PG8A 4F2TA 3T8QA 4IQEA 3OIXA 4TQTA 2QJGA 3N2CA 2W79A 4GUFA 5E93A 1B1YA 3I3BA 2JKPA 4J3SA 2A4AA 4OV4A 3U57A 4UR9A 2HPIA 3S83A 4K2SA 3KTXA 1U2YA 3PHAA 3KVLA 1GYMA 1K6WA 1V0LA 3FN9A 1TX0A 4N2YA 4PMJA 1DBTA 4Q4QA 3HPSA 1JNEA 2O92A 3KX6A 1TTPA 1JI1A 3EEGA 3E2SA 3WIJA 1WCGA 1E6ZA 3A4XA 4AD2A 3VGHA 1UZ4A 1T6MA 2FGZA 1QWKA 3VNLA 3OVRA 2GWNA 3LMZA 3WDQA 1H7WA 4TIMA 4NIRA 3QGAC 4GXPA 2YXXA 2GVGA 3A24A 4LRSA 1OY0A 5CC3A 3O63A 3NSNA 1ME9A 1PO9A 3T2OA 2WZTA 3BK0A 1A5MC 1P0BA 4Q6JA 3YPIA 4YTRA 3S6DA 3GVWA 5XIAA 1THFD 3LSCA 3HFYA 5LNUA 3AHYA 3BMVA 3NO5A 4LBSA 4HD5A 1ITQA 4XAPA 1V51A 4CNSA 4LU0A 1SMDA 2CYGA 4PRRA 1FKWA 2OEJA 2PUZA 3K8LA 3WDHA 1J10A 2FZ9A 4QJ1A 1KM4A 5LXXA 1RPKA 3RU6A 1VENA 1XGZA 3MDUA 3W28A 1A3XA 1AD1A 1FDZA 3MBFA 1EIBA 1GVFA 4UTWA 4AY7A 3R8RA 4GY0A 2YYUA 3GR7A 4AZBA 4DM2A 2I9EA 1MEIA 2X1UA 4YN5A 3TUUA 1MO0A 3TLQA 4NX0A 3VNKA 4H04A 3AIUA 2D0FA 4W93A 4W4QA 2WKJA 3ARRA 1F7BA 1ZENA 3P81A 4LAMA 2YX0A 1Z89A 4YPJA 4D8ZA 5B7ZA 2Z1XA 4I5RA 2ISDA 3C0LA 4NJIA 4F2BA 1LT7A 4A4AA 5TAOA 3VNMA 5BWAA 4IQJA 2CZ5A 4PCNA 2FMNA 4ADSA 4GH1A 4C6QA 1P43A 4BY3A 1GT8A 5XINA 4ERGA 3H6OA 3QZAA 3WLSA 2ZWZA 3WF2A 4KWOA 4HU3A 2ACSA 3G0XA 4C60A 1TPB1 2AOSA 1KV5A 1US2A 2XSAA 4HMDA 2PLKA 4QJ5B 5K9CA 4P2VA 3GNPA 5FL0A 4HCHA 5FCZA 1FX6A 4OKDA 1XRFA 5DRCA 3W7PA 3B8UA 4XX6A 3BOFA 2A6LA 5GNYA 4QS5A 3LM3A 4IGMA 4J40A 5FSDC 1FBAA 2Z6IA 3C3NA 3MW7A 3QLLA 5HJLA 1J93A 3JS3A 3AXIA 1A5BA 4GJIA 5DELA 2TMDA 1VCVA 3NGJA 1K77A 3AJXA 3TJXA 2WBKA 5CKSA 4UR7A 1ITCA 4YYFA 4DNMA 2BSLA 1UCWA 1WZLA 3AFBA 1V6VA 2YCEA 1E72M 2F6XA 2B31A 5C7VA 3N19B 1QT1A 3W6YA 3CK5A 3FFSA 5DY2A 5HMEA 3M0JA 2PWFA 5BOOA 4HOZA 5D04C 2OOFA 2VCBA 3PPGA 3D46A 4NUWA 1T41A 3GNRA 3E49A 1H1NA 1P4CA 1Z32X 6ALDA 4FXFA 3FA3A 1ZUAX 1VB9A 3EWZA 4IMGA 5D02A 1QBAA 4I5UA 4GYPC 1FXPA 3VE9A 2CHOA 1MNZA 5A6KA 1J0IA 3E6EA 2XH7A 4GJ1A 4AD3A 5DY3A 1M3UA 1AL7A 1K4HA 1XIBA 4H8HA 3EYPA 4JAWA 3THUA 1DWGM 4EF9A 2DZAA 3LHZA 1VYPX 2KX9A 3A3XA 1OB0A 1VFTA 5DMLA 1EP3A 1X7IA 4Q7IA 2B7PA 3QC3A 3PBWA 4RV8A 3LI0A 1US3A 3W6LA 2WPGA 2FVLA 1J12A 4FF7A 4Q7NA 5EMLA 3T0AA 5JU6A 5EMMA 1DL3A 2OSXA 2RH9A 2I1OA 3K1DA 3NJ3A 2ACRA 4ZR8A 3MMTA 4Q33A 1PIFA 2PA6A 4PTDA 3I4KA 3P3BA 1AQHA 4A2RA 1LDCA 2D0HA 3NDYA 2DORA 3S1UA 3GHRA 1H0IA 4TVDA 3RX2A 4LCRA 5I2UA 1J18A 3IUDA 1WDSA 4IUOA 5C9XA 4GQRA 4IPJA 4EIVA 2CW6A 4O1AA 2EBNA 1WE5A 1W3HA 1ADDA 3W1QA 1KCXA 3KL0A 3VAVA 1JFHA 4M8UA 2FVKA 3LPFA 1IXOA 1W91A 2Z2BA 4AXNA 3M7SA 1OC5A 5C8BB 3DFTA 3MHUA 3FJ6A 1SGJA 2AKMA 4G7FA 3ANUA 4CD6A 2WMJA 1POJA 1VFUA 3QGVA 3MKKA 3LENA 5AECA 3EOUA 5CQ1A 3HO8A 3SCSA 4CQAA 3WLOA 4CN4A 1ZBWA 2YFNA 4K8HA 3UR7A 2OX1A 2EQDA 5CH9A 2WJDA 3W7EA 4B9ZA 4ZSUA 2BB0A 4O1BA 4KCWA 3WNMA 4XBSA 3MQTA 3KBWA 4I90A 4UOQA 3H54A 1QPKA 4MKNA 3TONA 1W9VA 3JZEA 2ZZ4A 3UYIA 5JBEA 3FS2A 3O2LA 4BEUA 4JYEA 1LG1A 1FWIC 1RD6A 1WOBA 2AGKA 2YDAA 4MLRA 2YYTA 3O15A 1P0NA 1BTMA 1YX1A 1K8YA 1P5BA 3EKGA 3LUTA 3PSWA 4D6DA 1Q6FA 2GQ8A 4Z1DA 2V9DA 4C91A 2PF0A 2XIIA 3NQVA 2IKGA 2NX3A 4GHRA 3VOIA 1J6OA 1GQIA 2X40A 3QPZA 3PB0A 5I3JA 3LPOA 1NQ6A 4LAOA 2XPKA 3VOHA 3ZOAA 5E0CA 1DHPA 2V3DA 3T09A 4OOZA 2FHCA 3RLVA 1H60A 2IPFA 1HVQA 3ZLHA 1TCDA 3CZLA 2ACQA 2Y5SA 1QWGA 2JKAA 3MBDA 3DU0A 3QTPA 1W3JA 3WG6A 2FYMA 4M1RA 3T05A 5BXRA 4H6RA 3QV9A 1LUCB 1N55A 4Q7BA 2EHHA 1UYQA 1WAWA 3AIEA 3WJZA 3PM6A 5A2AA 2PDKA 3BLOA 5CZJA 3IJIA 4RW5A 2C13A 1GHSA 3SBFA 1UD6A 4HCLA 3REQB 1LF1A 3FSTA 3UXDA 4JTSA 4NZ5A 2VC7A 2V5JA 2BY3A 1XCXA 4MAVA 3NQCA 3VYLA 3CWNA 2BXZA 1I8JA 3E0VA 3N2OA 3B8IA 2CNCA 1PKLA 1ISWA 2D69A 4L7ZA 2ESCA 2B7NA 3PUEA 4D1JA 3QPYA 4TV6A 4C6OA 1U83A 3CL6A 4CN6A 2NT0A 2QCEA 1O1ZA 1A5KC 1UD8A 5DQPA 2ICSA 1F6KA 3Q2DA 3SM0A 2JEQA 4OTKA 4Y7EA 2X41A 2OO0A 3TN3A 3DZ1A 3RPDA 4PMNA 3O0KA 4L6HA 2OWWA 4IIGA 1EPXA 4KMQA 3STEA 1YXDA 4LUJA 3EWYA 3PZIA 3WLTA 2UWFA 5JBDA 3LHVA 2V3FA 4BR1A 1JPDX 4IWWA 2Z7KA 4GQGA 3G1AA 1RBOB 3RGTA 1JAKA 3DENA 1HO4A 2PLMA 3GLCA 4JQ3A 1KM1A 3QHNA 3E0IA 5MKGB 3TTEA 2A85A 1C8XA 2HBVA 3UQNA 3AZSA 1F5ZA 4IICA 4ML4A 5D30A 1RK6A 1F4AA 4LV9A 4HYRA 2HVOA 2WXDM 4DHGA 2DQWA 5D8ZA 2XN1A 1LCOA 1PTAA 2BZNA 4AD4A 3EAUA 3AWNA 1P0DA 2G95A 4TTGA 1QATA 1NDYA 1ZLPA 1X1NA 3LTYA 3FAWA 1LUCA 3BO9A 1B3WA 1L8NA 1L2UA 2J75A 3SY5A 2PURA 2HROA 4EPEC 2CLFA 3RLGA 2D2HA 5D33A 3EDEA 4ACYA 1ESWA 3REQA 3SO7A 3M5XA 3W1RA 3EA3A 1TPC1 3ZR5A 5HWJA 3LD5A 2WVVB 1GOMA 4AYGA 1D7KA 3AZTA 4HN8A 1XRVA 3PZQA 2BVDA 3UEQA 3N6HA 1V4YA 2YA0A 3G77A 4CD5A 3ZSSA 2FZ8A 2R82A 1EYEA 4OHQA 4ORIA 4LUYA 4H8UA 4LX4A 3F2BA 3G5EA 3N12A 3ITLA 1VGAA 1WQ5A 1ZZMA 1BXCA 2GL5A 1XISA 4GACA 1R3YA 3HG3A 3WNKA 3GXFA 3UG3A 3L5MA 3BLPX 4CEXC 3P93A 4R33A 4OE7A 4HB7A 1Q8JA 3QY7A 5GNZA 2XWDA 5JIPA 1E5NA 2DW6A 4M81A 4MNKA 4PUWA 3VKBA 3II1A 1LRQA 4D6CA 2V3EA 1TJ0A 3G1SA 1LORA 1DOSA 2I5GA 2O4MA 3KVKA 1YW1A 1ONRA 3PB2A 2BY0A 2F6UA 3IIXA 3H26A 3RUBL 3SQMA 3GRIA 3S9IA 2J24A 3DG6A 3O6DA 2X09A 2PC4A 1OEPA 4NHVA 4QLJA 4ZXOA 1EIXA 5LNVA 1FH7A 5CC5A 5K2ZA 2XYLA 1NFPA 5MKGA 3PPCA 1PCKA 4HYVA 4AQLA 5CJNA 4DJEA 1BQCA 1BSLA 2NV9A 3BSHA 3R6IA 4WCJA 4UC5A 2WMHA 4AVNA 1X98A 4I9TA 1EEPA 4IMEA 3UJRA 3UGVA 2Z29A 1XG4A 4Z2HA 4RXGA 1XYAA 3CO4A 5IOBA 1RBLA 4ZEPA 4J28A 2I7GA 2OTDA 1VBJA 1BEUA 1E4LA 4QSFA 3OB8A 3URQA 1BQGA 4PUDA 3TWAA 5JXQA 5KZMA 3IEBA 5EPDA 2OLHA 1TRDA 1TA3B 5DFAA 4ROQA 1ICPA 3A4JA 2WVVA 2HZGA 4CQ9A 1JPKA 1TELA 3W7QA 4JOMA 3CU2A 4AHQA 4PB4A 4ZOCA 4JTFA 4PUNA 1OADA 2PDHA 3R13A 3KHJA 4S3FA 1J9YA 3CUZA 3O05A 4ZFMA 2WWDA 2JKEA 3KFTA 1TO3A 1CI1A 1MUMA 3EB3A 4BQ5A 1OWQA 1UMLA 4F0SA 3GD6A 3BLEA 4J1OA 3RM9A 3QV8A 5FF3A 4JX5A 3U0HA 5HPOA 3GR4A 3LGEA 4ZOAA 1XR2A 4I8DA 4R9OA 3R8HA 7ENLA 2WLZA 4JTKA 1NARA 4N4PA 1WXZA 4HNLA 1BWLA 1OHLA 4XTIA 1R0MA 3NQ2A 4FIRA 3EDFA 3O16A 3L7RA 1KXQA 4CNNA 3SSZA 4HMEA 3BICA 4D6JA 2OLSA 4H1ZA 4A8NA 4MWAB 4ADTA 4DAIA 2W67A 2Y8VA 4RPQA 2JEPA 3V36A 4JKMA 1TMLA 3UCCA 4JX4A 3R8GA 3CPUA 4XTDA 1PB0A 4A8IA 2CLIA 2ZWYA 2VR5A 1IHIA 1ENUA 4LANA 4O1FA 2XISA 3BAIA 4HSNA 5CC6A 1OFRA 5CSYA 3ZSTA 1PYFA 3KCJA 4Q4OA 2NUXA 2O7SA 3VTRA 1O5QA 7A3HA 3DIPA 4HJWA 1TB3A 2NSXA 1OK4A 5J5RA 3GY1A 4DLFA 2J8FA 4L64A 4XZHA 1X6NA 2BV9A 1ZJIA 4F0KA 4EK7A 4AEOA 3H12A 4KH2A 3GZ3A 5F1VA 1S2TA 2V2DA 3TOYA 3GH5A 4OBTA 3GNDA 4O14A 4WOZA 4C6EA 4FA3A 5EFFA 4AX6A 1XF0A 1BF6A 1Y8BA 4L1XA 1WKFA 5FJTA 1E6QM 1W17A 1NJJA 4JL2A 5EFDA 1T8QA 3BL3A 1PEZA 1TA3A 3H55A 3ZJ7A 2ZVRA 3HU7A 1OD0A 4ZO8A 3ATZA 1RK5A 1MUWA 1P6WA 1BF2A 3M6YA 3WQFA 4U5IA 1HKIA 4HPXA 3ZR4A 3TK7A 1EGZA 4AX7A 5REQB 3RK8A 3RNDA 3VCRA 4CQ8A 4HNOA 3AO0A 5J04A 2VX7A 3AYRA 2PODA 1DWHM 4G1KA 1E1CB 4JR5A 3NXFA 1CENA 2R24A 3LYEA 4URIA 4RZBA 4JFUA 1FOBA 1LG2A 3FJLA 3UZWA 4D71A 2J66A 1FWSA 3SCRA 1KQYA 3NEHA 4FR6A 4ATDA 5CAKA 2DSVA 4ASTA 3EDKA 9XIMA 1W1PA 1XYCA 1DWAM 2CBUA 4CD8A 1B9ZA 4KFPA 3WQDA 1IZCA 3EOSA 2WZHA 3A3WA 3U7VA 4DRSA 2PBOA 4JEJA 4GYKA 4MWAA 4GJJA 2RJGA 2JK2A 2J74A 4LBRA 2ODOA 3Q37A 1XYMA 1QOPA 1N8FA 2C7FA 5BROA 3CZEA 1UH3A 4IOTA 1KNWA 4CNUA 4E4UA 1GVYA 4CQBA 2VX5A 3R0KA 5LNWA 1REQB 1R3SA 1V3KA 3M0VA 4F3HA 3ZQ9A 3LPGA 2QMJA 2R14A 3V3WA 4ERAA 2PMQA 1TMQA 2NV2A 4IPLA 1ZBCA 4QS6A 5F1UA 4BWLC 2KZHA 1EC8A 5D32A 2PWEA 1QFEA 3GDKA 7REQB 3LGGA 2VUNA 4J3ZA 4NI3A 5HJXA 1Z8AA 4L4PA 1XLKA 3LU2A 3N6QA 3H22A 4EPBC 4TX6A 2WW5A 2XTKA 2PDFA 4GABA 1KM6A 3KBVA 4GQQA 3C8FA 3NZPA 4M0XA 3AYTA 2E1DA 3D0CA 2NW0A 2W3ZA 3GVQA 3O3RA 3F03K 1L6YA 3OGVA 4NZ1A 3EA1A 4LVGA 2C3ZA 4C6BA 4IGNA 4JFWA 2B4GA 3TYZA 3MUXA 8A3HA 5HWNA 5G1YA 2WJFA 1ZBVA 3P60A 1JCXA 3LCIA 3SY8A 3BQ6A 5M1TA 2YLLA 3TMQA 1FCVA 5LKYA 4XKYB 3DCPA 5REQA 3UERA 1H51A 1CNVA 2V2CA 3G0SA 8RUCA 5HNTA 4J35A 1E1CA 1M7XA 3POCA 2VNCA 2OQLA 3PJTA 5AYYA 3QEZA 4C6CA 3AALA 3BE7A 1A3HA 3RU8X 4R7WA 3MMWA 3UA4A 4Q4RA 2JFEX 1QI0A 3L5LA 4LYPA 4CCCA 4Q8MA 4EWND 5CPOA 2FDSA 1Q6QA 5SWUA 5FEZA 4M6QA 3B8DA 1JCYA 3I7QA 4CCDA 1XKYA 1HN1A 3LCGA 1JQXA 3HFTA 1JJKA 2CZFA 3VU2A 4K1WA 4AFYA 2QXWA 3A64A 4FK9A 2B7OA 5EYWA 2HJPA 1J0KA 3AU2A 2XH0A 1H7PA 2ZXBA 2W63A 1E9IA 3T9PA 3EA2A 4O0KA 3USBA 2PDWA 1ONWA 1REQA 3OLIA 4U10A 2HE8A 2WMGA 3L0GA 3GDBA 3UJSA 5BU6A 3RMEA 5CLWA 3M0HA 3WDRA 3SUVA 4JKKA 3GNNA 3U2OA 1TV7A 1ICSA 3F7JA 2Q8XA 5A8PA 2J62A 3AJ7A 4XSMA 6A3HA 5MHBA 3ZJ8A 5C71A 3S5SA 3IRDA 1EFZA 7REQA 4WOQA 4QJ3B 3P8IA 4DYJA 1GG1A 4LCQA 3SCWA 5F4XA 2NZLA 3ITOA 1I4NA 2WBGA 3SQSA 1IWPA 4JYFA 1PHWA 5DLCA 1F07A 5GJPA 4JTTA 3S4TA 2INFA 1RUSA 2XN0A 4Q4SA 4QGCA 4XWUA 2VURA 3GVRA 3M0IA 5A95A 1W9XA 1RHCA 2PDYA 1Q6CA 1PS9A 3CHDA 1Q7MA 4LVDA 1O94A 3VGDA 1CBGA 1OBAA 2GUUA 4XSLA 4RL3A 3PUGA 2AL2A 2QCCA 3RDKA 1W54A 3MA8A 4CKQA 3UXKA 2G97A 1ITUA 1UUOA 5AC5A 1CGWA 4OQVA 3ARYA 3SCUA 2Y70A 5ECUA 3UVIA 4FX6M 1KR1A 3W0KA 2DFAA 2ASHA 4UIOA 3V7PA 1ZCCA 1KM5A 4XKYA 1B57A 5I6SA 4AIOA 4XBKA 2XM1A 3TTSA 3TTQA 2HDJA 3GBEA 5EA9A 2PBGA 3IJ9A 3VCCA 4ZZ9A 1SU5A 4CVWA 1AQ0A 4HK6A 1OCQA 2GJPA 4AY1A 2PWGA 3LXAA 3TEVA 2BP1A 5CLTA 4LUTB 2OYLA 1QI4A 3ID7A 3RR1A 2VCCA 1AZ2A 4WXZA 3T42A 1IXQA 2DV0A 1SZNA 7XIMA 1F9CA 3FVMA 1U1JA 3LLFA 2VOTA 2WLYA 5A8QA 4GXWA 5CGTA 4TVCA 4Q8VA 2BVYA 4H9XA 4XD3A 1YNQA 3V0TA 1WB0A 2PDQA 2GDQA 4ILSA 3HQPA 2NT1A 4QM1A 1B3ZA 1IYXA 1LBMA 3RCYA 5E5CA 3IWPA 1IXPA 1OGGA 3A9BA 2QCDB 4PCFA 4MHBA 3MYOA 1EDTA 3TX9A 5A6JA