4GZ7A

The crystal structure of apo-dihydropyrimidinase from tetraodon nigroviridis
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
492
structure length
492
Chain Sequence
AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFKMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREPYAGEVVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords dihydropyrimidinase
publication title Lysine Carboxylation: Metal and Structure Requirements for Post-translational Modification
rcsb
source organism Tetraodon nigroviridis
total genus 186
structure length 492
sequence length 492
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gz7A01
1YNYA 5FSEC 2Q01A 4QRNA 4HK5A 4G2DA 5HMEA 2BGNE 4WHBA 4KEUA 4IGNA 3UPMA 4GX9A 4C60A 5HMDA 4NP7A 3FDKA 4C6DA 4LFYA 4QTGA 1J79A 4RDYA 4PE8A 1FWFC 2W9MA 5AKQA 3K4WA 4G7EA 2E1WA 3AU6A 2EG7A 2FTWA 3N2CA 4B90A 3A3WA 2O4MA 4LAKA 1P6BA 4LALA 3GU2A 4XAZA 4CNTA 1FWAC 1E9ZB 2D2HA 2PGFA 4KEZA 2AQOA 4DO7A 4H9ZA 4R7WA 3CAKA 4EPKA 5LXXA 1V4YA 2RAGA 4GXWA 2OQLA 3CS2A 3RHGA 4GC3A 4C6OA 4MUPA 4XAGA 1FWEC 4HK7A 4WGXA 1NDYA 1NDZA 4H9XA 3QY6A 4LAOA 1A5OC 1RK5A 3UR5A 3S2MA 1KRBC 4EP8C 3RCMA 3LY0A 3PANA 2XIOA 3OVGA 3S2NA 3QGAC 1ITUA 2Z29A 3UR2A 4IFOA 1FWIC 4LCQA 4NG3A 4PBEA 4KQNA 2HBXA 4PCNA 1IE7C 1W1IE 1A5LC 1PSCA 3A4JA 2QPXA 1RJPA 1EYWA 3TN5A 4CNSA 2I9UA 3URQA 1EJVC 4C6MA 1A5MC 2FVKA 3IARA 3UF9A 4CEXC 3MKVA 1FWHC 4KIRA 3GTFA 1FKWA 2D2GA 4HJWA 4XAYA 4GY1A 1V79A 1RJQA 2Y1HA 4JOMA 2OOFA 4D8LA 4XD4A 3O0FA 4ZSTA 3MJMA 4C5ZA 3LGGA 4CQCA 2R1PA 4J5NA 2PUZA 4PBFA 4CEUC 3OODA 1EJRC 2R1LA 4BKNA 2YB4A 4DLFA 2PGRA 3MDWA 5E5CA 1NDVA 3UBPC 4GK8A 4H9VA 3LSBA 4ERAA 1JGMA 3E74A 4KEVA 4LEFA 4C6EA 1YMYA 1ONXA 4V1YA 1P6CA 2DVXA 3FDGA 4H9MA 2Z00A 4ERGA 1V51A 4H9TA 4XD6A 3MSRA 2P50A 1ITQA 4H01A 1I0BA 3JZEA 1RK6A 3C86A 4HA0A 1EJXC 4ERIA 3NQBA 1EJUC 3LU2A 3PBMA 3S4TA 4GOAA 2GWGA 1KRAC 4H9UA 3URNA 4IFKB 4J35A 4BJHA 3ITCA 2F6KA 4IH3A 2ANUA 4QS5A 3DUGA 4KESA 3E2VA 1K1DA 1J6OA 2VHLA 5A6TC 2D2JA 1DPMA 4F0RA 1EF2A 1O12A 4H00A 3MPGA 1K6WA 2QT3A 2HQAA 3LGDA 2ADAA 2HPMA 3LSCA 3TN6A 1YBQB 4C6PA 4RDVA 2Q09A 2YZ5A 3ORWA 2FTYA 1NFGA 3GTXA 4RZBA 2UZ9A 3EWDA 1UIOA 3KM8A 4B91A 2UBPC 3QY7A 3R0DA 1YIXA 3TN3A 4RDWA 3F4DA 4GY0A 4LAMA 1UIPA 1GKRA 4DZIA 3IV8A 4AC7C 3B0XA 2Z2BA 1PO9A 3GUWA 2R1NA 3PNUA 2VM8A 4KF1A 3PAOA 3A3XA 4C65A 3E38A 1VFLA 2EG6A 1A4LA 1J5SA 3GTHA 1EZ2A 4EPDC 3WMLA 2WM1A 4B92A 2HNHA 3URBA 3IGHX 1PB0A 4IF2A 4L9XA 1PTAA 4GYFA 3PNZA 4B3ZA 3QGKC 3DC8A 3O7UA 4GX8A 1HZYA 2VC5A 2Z2AA 1RA5A 2IMRA 1YRRA 2GZXA 2WJFA 1A5KC 1FWDC 3GU9A 3IRSA 3QY8A 4C6BA 3OQEA 2DVTA 3RYSA 3F2DA 4J2MA 5HMFA 4C6KA 1O5RA 4DI9A 3IJ6A 4C6QA 4M51A 2A3LA 3B0YA 2YB1A 2QS8A 1S3TC 1A5NC 3HPAA 2OODA 4E3TA 3MTWA 5CH9A 1KRMA 3MVIA 2OGJA 4QSFA 3ISIX 4C6FA 2Z4GA 2P53A 4C6LA 4WVXA 4C5YA 2YXOA 3MVTA 3AUOA 1QW7A 3LNPA 4IFKA 4LANA 1A4MA 1WXYA 3GIPA 2HBVA 4L6DA 4KERA 3G77A 4XD3A 4F0LA 4C6IA 2WJDA 4TQTA 1FWJC 2AQVA 1KRCC 4DZHA 4DYKA 2I5GA 3ICJA 1V77A 3S2JA 1UMLA 4XD5A 4DI8A 4RE0A 3URAA 2OB3A 3OU8A 3EWCA 2ICSA 1M65A 4UB9A 3OJGA 1YBQA 2Z28A 4PCPA 3F2BA 1V7AA 2BB0A 3GG7A 3GRIA 1GKPA 4LCSA 1BF6A 3TN4A 1FKXA 4DNMA 3EGJA 3E0FA 4RDZA 4I6VA 3LS9A 4ICMA 4CNUA 1RAKA 4INFA 4Z42C 2AMXA 2DVUA 3B40A 3IACA 4LCRA 4CQDA 3K5XA 3NEHA 2EG8A 4F0SA 2VUNA 4GZ7A 4XAFA 1ADDA 1J6PA 4QS6A 4IFRA 4BY3A 4R88A 1NDWA 3CJPA 1R9XA 4R85A 3TNBA 3WZ0E 2R1KA 1I0DA 1XGEA 3SO7A 1M68A 2CZVA 2PAJA 3F4CA 2QVNA 4I6KA 1QXLA 2GSEA 1XRFA 2FVMA 4P5UA 2VC7A 4V1XA 3WYZA 1POJA 1EJTC 3MDUA 2VR2A 4IG2A 2Z25A 3GTIA 2FFIA 3ID7A 3E0LA 2O4QA 1EJWC 2Z27A 4C6NA 3E3HA 1FWCC 1UBPC 1ONWA 4G7EB 3S2LA 4HK6A 2G3FA 4GY7A 2E25A 3IPWA 1FWGC 1P1MA 1K70A 3AU2A 1M7JA 4C6CA 1FWBC 2Z7GA 4UBPC 1ZZMA 1WXZA 4QROA 1RA0A 3F2CA 4DIAA 4IG2B 3D6NA 3BE7A 3GIQA 3T8LA 3T1GA 4NI8A 2Z24A 3LA4A 2Z26A 3NURA 3RN6A 4ZSUA 3GU1A 3HTWA 3FEQA 4EPBC 4C6JA 4OFCA 4KETA 2R1MA 3T81A 2WJEA 4EPEC 1KCXA 3V7PA 4AQLA 4GBDA 4H9YA 2KAUC 1RJRA 1XRTA 5G4HC 1POKA 1GKQA 1R9ZA 4IGMA 4YIWA 5FSDC 3SFWA 3K2GA 4CQBA 4IQJA 2HPIA 2GWNA 1R9YA 4DLMA 4LH8A 3OOQA 2PLMA 3DCPA 2GOKA 2ZC1A 3HM7A 1EJSC 1XWYA 1E9YB
chains in the Genus database with same CATH superfamily
2P5NA 2CW6A 4ZVJA 8A3HA 1NSJA 1OGSA 4D6EA 2Y24A 1LTDA 4OQVA 3ATZA 3NA8A 4DBEA 1E43A 4QBXA 1DE5A 3W01A 4CN1A 4C6DA 4LSBA 2BS9A 1PXGA 2NV1A 3ZT6A 1KFEA 2NWRA 1C93A 2GK1A 3UCDA 1AH3A 3AHZA 3W1UA 3N6QA 3TOPA 3GU2A 3GXIA 2YBVA 6REQA 3SCSA 3W71A 1JDAA 4FZIA 4N4QA 3ZJ6A 2AQOA 3CMJA 1D9EA 1GNXA 2XGBA 4R7WA 1UW9A 4C1LA 5BWAA 4IPLA 4JHMA 1X38A 2QCMA 1V6TA 4ZB5A 3SN0A 4PMZA 3N6HA 3WEMA 4NQ1A 4K2SA 2IXUA 2ZWYA 1IWAA 3NG3A 2B7QA 1TZ7A 2OTDA 3PANA 2CBJA 4WDWA 4LY4A 1RQEA 2C6QA 5M3WA 3GB6A 3UFYA 5GNYA 2VZSA 5FEXA 3P61A 1JD7A 3EYPA 4LVGA 4PCNA 4HOXA 1LQ2A 3L12A 5EMUA 2C1HA 3N4FA 3MZ2A 3MV01 5DO8A 3JUGA 3TN5A 3CMGA 1L2QA 1HL8A 3HGJA 2G37A 1MEWA 2F2KA 3PZGA 3SJNA 4C7FA 3SZ8A 2AAAA 2ZTJA 1OG0A 3UP8A 1OX4B 4D8LA 4AEOA 3BG9A 1R2TA 1AUSL 4UWMA 3L0GA 4KCTA 2PI6A 2J24A 1FFRA 1Z6KA 5LNVA 3VNIA 4UR8A 5AHIA 3ZM8A 3MW7A 1AZ2A 1XSJA 1LWJA 1AW2A 2QGHA 1CWYA 5M03A 3WF2A 2IKHA 1LWHA 4L5ZA 4F4RA 4GHRA 4ZMGA 4S2BA 3O6YX 4FOJA 4A4AA 3SSJA 1SJCA 1IWBA 3R0KA 3M9YA 3I7SA 5D38A 2BX7A 4X60A 2YL6A 4JNZA 4B5WA 8CGTA 4PGLA 5FAJA 1A3HA 5L9FA 3SRKA 3N2TA 2VD8A 4JN8A 1N2VA 3KW3A 3SUVA 3TTYA 3EWZA 3RIKA 2VHLA 4QLLA 4GJIA 4DHGA 1SFSA 1R3YA 1X39A 1YNQA 4N9DA 4XZLX 3WMCA 1GORA 3BAJA 3T0DA 1JVNA 1V6XA 2NSXA 3WJYA 3RF9A 4GH1A 3TCEA 5M2FX 1YBQB 4A8RA 1W3NA 4O19A 3CIVA 1CT5A 2QEZA 2GVJA 3GXPA 3BK0A 2JEPA 4NYYA 3UD6A 3FCPA 4ZO8A 4OE7A 5IDZA 3BGGA 4UXDA 1I45A 3QY7A 3R0DA 3P14A 2YPIA 5HWNA 2V9DA 1JDCA 1J8VA 3MUAA 1WYIA 1G6CA 2VM8A 4XX6A 4HSNA 1OABA 2R91A 3GYEA 3DN5A 5LKYA 4OV9A 2ACUA 3BH4A 2QCCA 2GJXA 2GDVA 5BNKA 4FB7A 1F74A 1PTAA 1OYCA 2XFWA 1G4EA 3NZPA 4NJKA 4X63A 3G0UA 4MWAA 3IRSA 2ZUMA 3A24A 3GYCA 1RR2A 3ZVIA 5CC7A 4DI9A 3W25A 2A3LA 2QCDB 1J0KA 2QPUA 4G9PA 2CU0A 4IIEA 1SO4A 5SWUA 2WB5A 1AH4A 2E6AA 1JDDA 2PTXA 3ONCA 4LANA 1UR9A 1XDMA 5D09A 4X2PA 2GGIA 1TG7A 3H26A 1ZGDA 1TWDA 5BYWA 1N8WA 1IWPA 4UC5A 3AS2A 5D32A 4JFWA 1XXXA 3E9AA 1EDGA 2MNRA 3LHTA 3BC9A 2ZXBA 5F2MA 1W2VA 1XGDA 1RCOB 2BXVA 3TN4A 3ZZ1A 3SY8A 1W3IA 3L4TA 4MZ1A 3NPUA 3KVJA 1XPGA 4QP0A 4F0SA 2PD5A 3UVAA 2J9XA 3Q67A 2VC9A 1H5YA 5H8PA 3A4AA 4E3VA 3A12A 2YL9A 1ZJIA 1ZCOA 2PB1A 4N6EA 1UH3A 1VBRA 1ZAJA 1G0CA 5LHFA 4UTKA 4E4UA 2ZRVA 2J6XA 3VNYA 1EJWC 3KZPA 3GC2A 3U48A 2NWSA 3AMLA 3KWSA 4Z2IA 4IP5A 5HMSA 4ONVA 1SJDA 4OHQA 5EB8A 3N9SA 2QW5A 3UYIA 4JTEA 2NQZA 3UJFA 1RBLA 1EKOA 1KFKA 1L6GA 5TAOA 3N2BA 5HUOA 2XFYA 5ABTA 3DERA 1A5UA 3TTOA 3AICA 5A3HA 3OLIA 4C6JA 3AWNA 3AXKA 1KTNA 3V0TA 1YHTA 4Q4SA 4IIGA 5LA0A 2QDHA 2NXIA 1K9DA 3LM3A 3R11A 4GBDA 4LBSA 3KLLA 1D8WA 4GA8A 3OO2A 1GKQA 1SSGA 2ZE3A 5LYRA 5J5RA 2KZHA 4FNTA 4YIWA 2NUWA 2V38A 4CQBA 3EA3A 4LH8A 1Q45A 1Y5VA 3FSTA 4NNCA 2GGHA 1KFJA 1CGVA 1CGXA 4NAFB 4GUHA 1N7KA 3VIJA 3OGSA 2X7VA 3LCHA 3THAA 4LY8A 3Q45A 1JF5A 2V68A 4Y7EA 1KM5A 1K9TA 1H7RA 1RD5A 2OFJA 4LPCA 3WH9A 4JTCA 4GX9A 2GGGA 3NL5A 4W4QA 4LFYA 1KBJA 3EB2A 1H51A 3H23A 4FPSA 2PTYA 3N2CA 4B90A 3H70A 3RX3A 2PGFA 1JZ2A 3R1ZA 1JXKA 4H9ZA 3LOTA 4QEHA 4EPKA 2J7FA 1YPFA 3AIEA 2OQLA 1HJSA 2ZADA 4RCXA 3S6DA 3VNMA 1U5VA 1BG4A 2R6OA 3U2EA 1FCUA 2VC6A 3ZO9A 4CD4A 3QQ1A 1B57A 1VCFA 1B30A 3AYSA 1E70M 3SQSA 2DSUA 1JL8A 3W1MA 4POCA 4FLRA 4TX6A 2OT1A 4ACYA 3B9NA 1Y7VA 3IIPA 1J11A 2E6YA 1WZLA 2HMCA 4FAMA 2XU2A 4MKVA 1TTPA 3BW4A 4HZ6A 3KRUA 3WH6A 3UWWA 3NDYA 5TNVA 2IKIA 3R13A 3AROA 1FWHC 4KIRA 4LS0A 3AIRA 1T5AA 3I7RA 5I00A 4TMBA 1QO5A 1TWWA 3TWAA 1E6XM 2PD9A 4J4KA 4GUJA 1J5TA 1WP6A 1PUDA 4RNJA 4UQBA 1XGZA 1F05A 4C5ZA 1K8YA 2R1PA 3L4UA 3THDA 4MM1A 4L56A 5CSRA 4C91A 3RLVA 4JKMA 3G8RA 2XGZA 3M41A 1CX9A 4GVIA 4AZBA 4Q6JA 3PG9A 3VCRA 2XYLA 3BLIA 5EMJA 2PF8A 4BK9A 1VS1A 5CZTA 1X6LA 2CXEA 3BSMA 1KR0A 1B1YA 3S5ZA 1NWSA 4ZXLA 2FZBA 3W4RA 4IICA 5LNUA 2B7OA 4L1XA 4LQ1A 3CXOA 4UMBA 2DSZA 3ARZA 3G1VA 3LU2A 3ZOAA 3WDPP 1KFBA 3KOZA 1EBGA 3CZKA 3RR4A 9RUBA 2HVNA 3N19B 3ZLGA 3LV6A 4BJHA 2YYUA 4IQLA 3KX6A 3G22A 1KM1A 1HUVA 1OHLA 3WKZA 1T8XA 2HSAA 1N8FA 4IIHA 5K4XA 1NOWA 1OFAA 4FI4A 4Q4PA 2HPMA 2NV9A 2PA6A 4MNMA 3DFNA 2FGLA 1GEQA 1K3UA 2UZ9A 1WBJA 3EWDA 4DPQA 2I17A 1FHUA 3MA8A 2J4GA 1UR4A 3MSYA 2PU0A 5DT5A 3LBOA 3T78A 2FMNA 3NVDA 3F4DA 3DESA 4GQBA 4WSJA 3AHXA 3FYOA 5I09A 4JDBA 2R94A 5M1TA 4E2VA 2J9ZA 4D6DA 4JTIA 3AC0A 2HE8A 3QMRA 1RZMA 2OJPA 1ICSA 4KFOA 1TPUA 1NU5A 2HNHA 4L4PA 1XC6A 3NPWA 1ME7A 4U3CA 3PNZA 3SB0A 1KW1A 4Z1YA 2ABBA 3OVPA 1TJRA 3W2LA 4F40A 3VGEA 4TTUA 4M3PA 1ONEA 5ECUA 3BO9A 4Z2LA 2YB1A 3W70A 3FS2A 4UQCA 3MVIA 3NJ3A 3UG4A 1VF8A 1GVEA 4A8NA 4QLKA 3MUY1 3SUTA 1ISVA 4QE4A 1GTEA 4L6DA 1LG2A 1F3WA 4KERA 4GZJA 2DU2A 1Q6CA 4QG8A 1GG1A 5U7SA 3BZJA 3HQPA 1DXIA 3AIWA 4YPJA 1E3ZA 1TJ0A 1D7KA 3KE0A 2HXTA 3KBSA 2V5BA 1RBOB 2GJRA 4NZFA 3V3WA 3A64A 3ZMRA 3NO5A 2X1SA 3QQWA 4OTKA 4BZYA 4C90A 3ES7A 2PDFA 3ZWTA 1PX4A 2NUYA 2DVUA 3K5XA 4RPPA 4BY3A 4F0KA 4ILSA 3CJPA 4KH2A 4WK9A 4JL2A 1IGSA 3QPZA 3W86A 4YNGA 4R34A 4FLSA 4ML4A 3W53A 3N4EA 2X0SA 2FVMA 1R0MA 1WKEA 1DXFA 4BFAA 1VFTA 5FJTA 3R5EA 4QSHA 3W1LA 4C6NA 2WZHA 4F8XA 1MXGA 3CHCA 5BU9A 2J66A 3N34A 4B5SA 3G6LA 4K38A 1UASA 1EA0A 1UA3A 1WXZA 3T2PA 3WNOA 3VE9A 3NURA 1LLOA 3ITYA 1BYCA 3BL3A 1JYVA 4W7UA 4IMEA 3L5MA 2WCGA 3ME3A 1SJAA 5DCDA 4YJ5A 3BOLA 3TTEA 1W9DM 1VBJA 3W1NA 1RJRA 4GNVA 4AWUA 2VZVA 3NL6A 2Y7EA 3T9PA 4DVOA 4LUTB 3S5OA 3FSUA 1OY0A 2I16A 4LBUA 2BOEX 4U2ZA 4Q4QA 2FLIA 1JZ4A 3HZ3A 3S9ZA 1DHPA 4HQVA 2VWTA 3EA1A 3W87A 1DJWA 5KITA 2BZNA 4FA3A 5JIWA 2VDHA 4PMRA 3LHUA 1MW2A 1OB0A 4AAJA 4XWUA 3CO4A 4PMNA 1OCQA 3S1WA 4CU8A 3WUFA 4LB4A 4G2DA 1F5ZA 3KBMA 3KFTA 3IJLA 1BRLA 5D9NA 1B2YA 2VR5A 2DSKA 4GVFA 1CLKA 3R7MA 4IJCA 2ZZ3A 3T0BA 5LNWA 4H8UA 2E1WA 1I1WA 1TV7A 3WJZA 2H6RA 3SUSA 3GVRA 4H6QA 2CWXA 3NYDA 3G1HA 2ZA3A 1A5CA 2VVNA 3LGEA 5MKGA 1GYNA 3SY1A 1KXQA 2NVAA 4US5D 3QH2A 1QU4A 3UWZA 4JTDA 2Y5JA 1D2KA 3S6TA 4WKFA 4TX9A 4XZBA 4J2PA 1UWAA 1W6TA 3VDBA 2V5CA 3UR2A 1DTNA 4PULA 3F5KA 4PSPA 3NQVA 4H19A 2Q3RA 4D8AA 4CCDA 2QYGA 4O14A 7CGTA 2O92A 1RJPA 5JUVA 2A3AA 1OD8A 1Q3NA 1R7AA 1PL9A 3QV7A 2V67A 3ZWSA 4OVXA 3RILA 1P7TA 3G1RA 2ISSA 3WLNA 1QI3A 5A6MA 2W79A 1AW5A 5I02A 2QCGA 2PGRA 2JGYA 4XK2A 2PURA 3C8NA 4O17A 2G3MA 2QCLA 1JGMA 1XF0A 1QWGA 3I7QA 5I79A 4QJ5B 4WEVX 1UD6A 2BHUA 2Z00A 1W1B1 3CYJA 3LPFA 1V51A 1OSEA 5HNUA 3QRHA 1SFLA 2VEFA 4H01A 2YFNA 3VUSA 4HGXA 1AL8A 4RNIA 4M6UA 1L8PA 4M81A 1FDJA 3P80A 1KFWA 2OSYA 3S4TA 1KWKA 4RZ5A 2VGGA 3EX3A 4L64A 1S46A 3IIXA 1UB3A 2F6KA 3NSNA 3R58A 3Q94A 2QV5A 2XSAA 3TTQA 1O7AA 1KM2A 4DBWA 1Q6GA 1SVDA 3WK1A 3TP4A 1HX0A 2VFDA 3SI9A 2PLJA 1NF7A 5CZKA 5JXQA 1YE6A 2OCZA 1SYTA 3WBXA 1KFCA 5DCEA 4AF0B 4ZQRA 5I07A 3CUJA 3WL1A 5AHFA 3VNZA 3TVAA 3T0TA 2PZ0A 3VINA 3GNXA 3WQOA 4JAWA 3TSMA 1CXLA 3MT1A 2DT3A 3SCPA 1JIBA 1DWAM 4IT1A 4OUIA 4CCZA 3TV8A 3FV9A 5KZDA 4P8XA 3LQGA 2VFIA 2VYOA 3PULA 5C8BB 1GHSA 1VFUA 3MWCA 3MQTA 3WMLA 1R3RA 4EIVA 2ISWA 2DSVA 5I06A 4DAFA 3AYTA 2PTDA 4GCAA 1ESWA 4MSSA 1IZJA 3UT0A 2ZZ6A 1KWGA 2HV5A 2PMQA 4E8CA 4GX8A 3AIUA 1DYSA 1FOBA 3L21A 1BWVA 4PCTA 3W7CA 3OQEA 4MY9A 2V6AA 3CV7A 3RYSA 3NGFA 1O5RA 3VK5A 2ACRA 3WX7A 4H2CA 1A0DA 4JTFA 1S5WA 4PFMA 1FVPA 4IP4A 4JTKA 1BSLA 3KVMA 1XYLA 4JX6A 3ZFHA 1Q4WA 3UETA 3LXCA 1JYNA 3FK4A 4W87A 4QCFA 1QHPA 1XQLA 3IANA 3V0UA 1S2VA 2HDJA 4GIRA 4XD5A 2X1IA 1EX1A 2GVLA 4ZOCA 2PDPA 3OU8A 2JK2A 1GT8A 3PPHA 1UR3M 3G24A 2Z28A 4HCLA 1ZPTA 3SRHA 4ATLA 3GO2A 1X98A 2WSPA 5AYYA 3V5FA 1MFUA 1I4NA 4I6VA 3HJEA 1HJWA 2VOTA 3LS9A 4ICMA 3UZYA 1RAKA 4TR9A 4X22A 4CQDA 3V36A 3F03K 5D02A 5HXMA 3UG5A 5I3IA 3OIHA 4FIQA 2Z6IA 3QKZA 2DP3A 4YL2A 1Q85A 3R12A 5FI8A 3A3HA 3VYLA 2E6DA 5FF4A 2VNCA 3PP7A 4V33A 1LT8A 1GOWA 1TPH1 5G1YA 4CCCA 4UR9A 2O4QA 3R89A 1A5SA 3F1QA 1BAGA 3M43A 3PWIA 2VR4A 4V27A 1XL9A 2TMDA 4CLMA 1B4EA 3P74A 3M46A 3MV11 1ME9A 2HCVA 1ZJHA 1EUNA 1W1ZA 3DENA 4UBPC 4Q8NA 3NTYA 1WA3A 1JUKA 3GHTA 4AXNA 3NZGA 3TE9A 3WFAA 4JICA 1MDRA 1UWTA 3CGTA 1B9ZA 4REQA 1OT2A 5EMYA 2W4XA 1HXJA 1GUVA 4WXZA 1G7VA 2ONEA 3NVTA 3RFAA 3OGRA 1Q66A 3ONBA 4BQ4A 3EWBX 3GG0A 1US0A 4GNKB 4ACZA 4C1KA 3BJSA 2EO7A 4FLOA 1XBVA 1AVAA 2RFGA 4MFEA 2O7SA 1POKA 5M17A 3TXZA 3JZUA 4EXQA 2W3ZA 2XIQA 2YW4A 5FSDC 1IXNA 3SY5A 1T96A 1XLDA 3OOQA 4F3HA 3GS6A 3GW0A 3S0CA 3BLOA 3VD5A 4WDTA 2E3ZA 3WEOA 2IPWA 1SR9A 1A3XA 1XG4A 2C1GA 1F4AA 2Y0FA 4A05A 1TPEA 1E40A 3BGJA 3SADA 4NZJA 5KINA 4DYJA 5HMDA 4NAEA 4FF7A 1REQB 3M6DA 4QTGA 2VX7A 2XHYA 4GLEA 2IW0A 3F5LA 1Z8AA 4K39A 4JTHA 2XH4A 3WJXA 4J3SA 1GOOA 5FJPA 4M29A 1OYAA 3H2OA 1BGAA 5A8NA 4N42A 5JIPA 5G2WA 1KFLA 1E6SM 1K8XA 2HTMA 4YXGA 5F4WA 4HA1A 2PCQA 1VJSA 2G41A 2QJGA 3AIQA 4M5PA 4W8AA 4XZHA 1D3HA 3LQLA 4JTUA 2B4GA 4IPNB 3I4EA 1LCOA 1BXNA 1L6YA 2BHYA 1Z48A 1H2JA 4XQ6A 4E2DA 4MIMA 4PBEA 1FCQA 3A23A 4MF4A 2HBXA 1W1VA 1A5LC 3HG5A 4NYUA 4UOZA 1QHZA 1S1PA 4IPJA 4RJEA 3URQA 4C6MA 3N18A 1Y0EA 3QC0A 3DFSA 4MPKA 1OIMA 1W8GA 2IQDA 1VJZA 4AZHA 1C7TA 4PL2A 1OCBA 3C2EA 1RJQA 1J2WA 5CLTA 5FF7A 4ZSTA 5JQ9A 2FHBA 5HOSA 3QEZA 2I5QA 3W1XA 5E0FA 1WDPA 2ON3A 3EX2A 1NJJA 4M6PA 3FJNA 5E5CA 2OZ8A 4HB7A 3TKFA 1H7XA 1XLEA 2OSXA 1EDTA 4J27A 5K2ZA 4L6HA 1UUOA 3FAXA 2BGSA 3PZTA 2DVXA 3BAYA 1KV8A 4O8AA 4QJ4B 1UZ4A 4DJFD 4DXXA 1FFQA 2OPJA 4AISA 2ZX9A 1DV7A 3CT2A 3GM8A 1I0BA 3W2KA 4E2OA 2J8GA 1XLGA 3NQMA 1OFPA 4JL1A 2AKZA 1T6MA 3ARTA 2GUUA 4DUWA 5CPNA 3VOCA 1M7PA 2BVYA 2VFHA 2DH2A 1DJXA 3MPGA 2WMIB 3BSGA 4KMQA 1PYFA 3HPXA 2DGAA 2WMJA 5LXEA 3P60A 5IOBA 4O15A 2Q09A 1G94A 4PEKA 5C54A 5LHEA 3E5BA 1CB7B 2FZNA 1NARA 4PTMA 4BWLA 4LTSA 1NP2A 2TSYA 3NO3A 1XCFA 2BLEA 1XX1A 5K3VA 1GVYA 3MI3A 5GJNA 5FJIA 3DHDA 2A3BA 4JQAA 1XG3A 3I68A 1OX4A 2Z2BA 1KGUA 5DMMA 1XBYA 1BKHA 3CHDA 1DE6A 3WO8A 4ZE5A 4D6FA 4DELA 1O6IA 4JTTA 2NZLA 2WMGA 3UA3A 1X6NA 1E0TA 1Y5WA 2OQYA 4ZZ9A 3URBA 4AB4A 1OWQA 1B31A 3DFQA 4NZ3A 3PPCA 4H7CA 4P2VA 1QCWA 3O7UA 1M41A 1XIHA 1ADOA 4C6BA 3VNJA 5HMFA 1AK5A 3LCWA 3QW3A 3RMJA 6TAAA 1G4PA 1OADA 3LD5A 1XIMA 5A8MA 2WZEA 4ZEPA 1I6NA 3RXZA 1VZWA 4U10A 4C5YA 3V16A 1VEPA 4U3AA 2D69A 4LUIA 3NQ7A 4C6IA 4ZTXA 4HCHA 4DYKA 4RNFA 4B16A 4CQAA 3E0VA 2CHRA 3S2JA 1JPMA 2YFOA 4HSOA 2OB3A 2W63A 2V5JA 3H22A 4S1FA 3TQKA 2QZRA 2AKMA 3RO8A 1M65A 4HNCA 1LUCB 1YBQA 3WDIA 3UZJA 2OWXA 3MBDA 2POTA 3WQGA 4K1WA 4LCSA 1QUMA 2WAGA 2ZYFA 1TPWA 1JI2A 3VKCA 1B54A 1XI3A 1B5TA 2XVNA 5H8MA 3TCSA 1YKWA 2BY2A 4PYSA 4NJHA 4AD0A 4WDXA 3W1RA 4XAFA 1UWQA 2NQ9A 2V5KA 1KLZA 4I5UA 2H3BA 2PWDA 1DVJA 1LWIA 3SO7A 4A8IA 2V2DA 2HS6A 2A4AA 1PJ9A 1ZBCA 4NASA 3OZMA 4LB3A 4Y90A 2RDTA 4FHAA 4GVGA 1P0KA 3WYZA 2YCLA 4JCLA 3PZUA 2YXXA 1GOIA 2ZZ1A 5PTDA 2JIWA 1ZENA 4TTGA 1R2RA 5TQLA 2NQ5A 2R8WA 4S2CA 1M03A 3FYYA 1MZHA 5CEWA 3NQ6A 3RLUA 4FSAA 4O52A 3HPFA 5CZJA 3C2YA 4ZTYA 4BR1A 1UP3A 2OZ3A 3WCZA 4QROA 2QPSA 1RA0A 1US3A 2OG9A 4PB4A 5C9UA 1UC4A 2ZRWA 2FJUB 4AYGA 4DPPA 2D73A 4ZSUA 4L1WA 4B9ZA 4J3ZA 1A53A 2R1MA 4TOQA 3C3NA 3PTKA 1ZJAA 3EWWA 4LEQA 1F3TA 1V3KA 1VIZA 1ZS2A 4AQLA 3I65A 1JCYA 2QUMA 3S8HA 4E38A 1W3LA 1OYBA 3FY1A 1TMHA 3CO8A 5T26A 4HU0A 4LJ3A 4E4PA 1G4SA 4ROPA 3K30A 1NIUA 2DZPA 2HPIA 1YXYA 4G1KA 1UKPA 3CLMA 3OLEA 1V0KA 3EWUA 4K68A 1JRCA 2Q8LA 5A2AA 4GVHA 1S2WA 4X3ZA 1C3FA 4PODA 3HG2A 2QIWA 4N4PA 4RW3A 5D8WA 4IGNA 3MP4A 3GC4A 4C60A 3WJSA 4I90A 1W5MA 3Q37A 1EOKA 1MVYA 3FDKA 3TJXA 3WF0A 2ALDA 3CNYA 2V5LA 1T41A 5IBXC 3QMTA 1G4TA 4GYPA 1KNWA 4CCEA 3QLLA 2VEKA 1E73M 5I03A 2ZUTA 1E0WA 1TQXA 1GOXA 1QFEA 3KOFA 2OEJA 5F2GA 4HMCA 2NXGA 5A8PA 5FJRA 3RHGA 3CS2A 1I2NA 4MUPA 4XAGA 3TMQA 4JEJA 4XVEA 1OX6A 1N82A 1D8CA 3WQ6A 2DZWA 3QZEA 2YDAA 4GWEA 4XTDA 2PFHA 4EANA 4KWSA 5FL1A 1JPKA 3W3OA 3N9RA 4OIFA 1EEXA 3QM3A 4E4FA 2J8TA 5CKSA 3UJRA 3GWQA 3BLKA 5BZAA 5G4WA 2VX5A 1PSCA 5AC7A 2WYSA 4GCXA 4YVPA 1ZNNA 2BGQA 1V08A 2BVTA 1KD0A 1LG1A 3VGBA 2UY5A 3C2VA 2WNQA 3EXSA 1OCNA 4K8HA 2W61A 3GTFA 2C3ZA 3WUEA 4U5KA 4NAFA 4DJDC 3O05A 2OOFA 3VFCA 3DG3A 3TA9A 5FJJA 1F4HA 3WLHA 1A5BA 1QNVA 5MHBA 3ARSA 1O1ZA 4YHGA 4LOCA 3GDTA 1EJRC 3WNPA 2JQXA 4BKNA 3TX9A 1E6RA 3NCOA 4JTLA 2NT1A 2CLHA 4PB5A 3VMOA 3EOOA 1SZEA 3LPPA 3EOUA 3QHMA 3RLHA 2DZSA 3GXNA 3IJ7A 3WQWA 5J8LA 3GVWA 2QDEA 5IRPA 3TW6A 3WQEA 1AH0A 1J0YA 3U3HA 3WQFA 5D03A 2A3CA 4HA0A 4M24A 3PF3A 3TDFA 2PDWA 1EJUC 1XYAA 3MCMA 3W72A 4J3WA 4N0RA 3SIZA 4IFKB 4ADUA 3WIJA 3VX0A 1IXPA 7ENLA 4NX0A 3P3BA 4X0NA 1AQFA 1EGVA 1YPXA 2OO6A 2PWUA 3D5HA 2ZBTA 4AEEA 1TJPA 2X7WA 4M1RA 1XIFA 3PHAA 3TR9A 4PEEA 1JCLA 4S3DA 4KCWA 4PTWA 1MQRA 3ITVA 4DUVA 5A69A 4CD6A 1TPC1 2FGBA 4BF5A 4UCFA 1RV8A 1OF6A 3UCCA 3FOKA 2NQJA 2PDUA 3NQDA 3VZZA 1T99A 2WBGA 4AIOA 1MWOA 1YADA 1EWDA 4C1NB 3VU2A 1DJNA 7REQB 2XZ9A 5A2BA 3ANYA 3VO0A 2EEXA 4PFHA 4IXXA 2YCEA 4FIRA 2QDDA 1H0IA 3DXIA 2HROA 3M1ZA 1YRRA 5FD0A 3ZT7A 3QSRA 5EMKA 1RQHA 2GSHA 4HNLA 5A8GA 4Z0JA 3HPAA 5CH9A 4CQ9A 2OGJA 3CUFA 4J28A 2VCAA 2HISA 1XBXA 2BMBA 4JNMA 3P7YA 3GAKA 1CGWA 3AUOA 1EFZA 6PTDA 3CIXA 5IBXA 4NIRA 1PTDA 2FQIA 2WJDA 4O1FA 1MYRA 1KRCC 2I5GA 5D2TA 3H8AA 3OJGA 4L9YA 2DPEA 3HO8A 2D3LA 4UTFA 3HGSA 5C2CA 2PWFA 1DHKA 1CNVA 3EGJA 5C55A 1H1NA 3WDJA 2OR2A 1ISWA 2AMXA 5JBEA 4ATWA 4UUIA 1UWIA 2Y5EA 2I7GA 1HO1A 3OP2A 2HWGA 1LRNA 2F38A 3B3DA 3D47A 3A47A 1PZ3A 1U5HA 1F07A 1XGEA 1H09A 2XVLA 2AGKA 2YX0A 2PAJA 3WEZA 4Y8EA 3GHSA 3VNKA 5A94A 4QDPA 4S3JA 3O8AA 4WRHA 1POJA 2QF8A 3PUGA 4MJZA 4MKSA 3SN4A 3E0LA 4GRSA 2DUAA 1PPIA 5DFAA 4LYKA 1EZWA 1W1TA 3LCLA 3LYEA 4HK6A 4DJDA 1TX0A 2E25A 2TODA 4H7ZA 5EFDA 3FW6A 3BCDA 5C9ZA 1RPXA 3DI0A 2PP1A 1K02A 3GKFA 1DORA 4QITA 4YVXA 3WD0A 2QJJA 2OLSA 3JU2A 4TVUA 2B81A 5DCBA 3HTWA 3FEQA 3QV9A 1GONA 4JYDA 4F0MA 3GH4A 3O16A 1X1OA 4GIAA 2VX4A 3N9KA 4LYRA 1TA3B 3TW7A 3B8IA 3VVGA 1RPKA 4H9YA 1F76A 5D05A 3UWEA 2XSBA 1KBBA 3GVGA 4GUIA 4ZQOA 4AXKA 1E9LA 1QPKA 4PRRA 3M5YA 1QK0A 1XYFA 4EXAA 5AY7A 2VX6A 1DQUA 1W2PA 4JFVA 2ZRXA 3HM7A 3N12A 3W02A 3SCRA 1FX6A 4A3HA 3O2LA 1H50A 4XSMA 3BMVA 1A0CA 1V3HA 3SQLA 2BGNE 4DBDA 4AIBA 3LCIA 3M7WA 3RAOA 3F7JA 3HGRA 4HOWA 1P6WA 1EO5A 2DZXA 3W7HA 3T40A 1EQCA 1MDLA 4CNTA 1FWAC 4W86A 3PZOA 3W38A 3AHTA 3CAKA 1XCXA 4DEFA 5ABEA 3GNNA 3ABSA 2X40A 4A3YA 4MGGA 1EPXA 4LX4A 1Q8AA 1NDYA 4MKNA 3IK2A 1YPIA 3LY0A 2E9BA 3QTGA 4Q6XA 1ODUA 3H53A 3O06A 2RGLA 1K7XA 3IEBA 5BRQA 1FWIC 4S23A 3S83A 1VCVA 4QX4A 5KMYA 4DWSD 2YDRA 2ZRZA 1UR0A 2QDGA 4LUTA 4A3UA 3HURA 3GBDA 4P8WA 1XIIA 2Y6ZA 3T4CA 2I9UA 4PMOA 4MTVA 3TXVA 3IUDA 5EBUA 4CEXC 1E4MM 2ZXAA 3P6LA 2POZA 3ABXA 2GVEA 3SCUA 3TC7A 4PSRA 2P3EA 1QPRA 4HSHA 5JMUA 4O54A 5G2HA 4AMAA 4UTIA 4UMCA 4QE1A 1TVNA 1QATA 3CAQA 3MBFA 3HN3A 1XLHA 4HPHA 2R24A 1RCQA 3H7UA 1QJWA 1CXFA 1PKMA 3FJLA 3WQ4A 3M0VA 1ONXA 1J0HA 4D6GA 2AL1A 3E1F1 5CBIA 3IIZA 2E28A 1BF2A 4MB4A 1R3WA 1UKOA 1XRSA 3TSDA 1QBBA 3WJWA 5ABFB 1Q8JA 1HKMA 3QBUA 3IGXA 4L6OA 1W91A 4DJEC 3CAVA 4P7LA 1EP1A 4GOAA 3BLEA 5EA9A 1ITCA 2PDCA 4HOZA 2YLLA 4NX5A 1QASA 2BY3A 4JY9A 1J6OA 1DKWA 4PRTA 2PWVA 2YOCA 3GH5A 3ES8A 1WOBA 1D7FA 2XH0A 4XO7A 4C6PA 4MOZA 2A7RA 3PB0A 3ORWA 5C9RA 1IT0A 1C7SA 1UROA 1YLVA 3KM8A 3ZSTA 4DUXA 5LIXX 1WDRA 2HK1A 3B04A 4E2BA 4RK8A 4LAMA 5I77A 4BA0A 1RLDA 3PB2A 5FACA 3DIPA 2PP0A 3QGVA 5A2CA 4C65A 1VRXA 1A4LA 3JVAA 1UC5A 4KRUA 4O13A 5E6YA 2X41A 3BCFA 2Y61A 1P0NA 3BOXA 3FA4A 1NWRA 3STPA 2NV2A 3RO6A 2O9OA 4EACA 1B3WA 5D2WA 1SO5A 2NX9A 3I3DA 4W5ZA 1Q6EA 2RJGA 3Q58A 1AZ1A 3N17A 3IJ6A 3MUIA 3QJAA 5D9OA 2Y8VA 8XIMA 4WY0A 3L0KA 3QPEA 2OYMA 3AMCA 4GFIA 4FLQA 3VC6A 3SN1A 4AX6A 4IMFA 4XD3A 1BFNA 3VNLA 3WQCA 1IEVA 1TRIA 2YSWA 4CGTA 3TFXA 2BXYA 3TUUA 1UJQA 2WKGA 4RE0A 3LMYA 3MMWA 3CH0A 4K7VA 3PFRA 1UA7A 4PCPA 1M04A 1BYBA 1E4LA 4AF0A 3K8KA 2C14A 1O94A 3RDKA 4QIUA 4R7JA 4XZMX 4LCRA 1V02E 4LVDA 2TYSA 3W27A 3APTA 2J6VA 1JXJA 4IFRA 4QR6A 4EX4A 1QR7A 3G1YA 2WZTA 7TAAA 3T07A 3M0MA 3U5YA 4KT2A 4IIFA 3GC5A 4I6KA 5AZ1A 1IR1A 2W92A 4ZQPA 3KOYA 3QHOA 1FRBA 1TIMA 2G3JA 4MB1A 3XINA 3G1AA 1DTUA 3E3HA 2EPKX 4G7EB 3VDHA 4GFSA 3UEQA 3VGDA 1L9WA 3N13A 1TZ9A 1ZBVA 2ZVIA 1IR2A 2QUNA 2DFAA 2IKJA 2NVCA 1ZZMA 3IUIA 5C6MA 2E9MA 1UD5A 5HNTA 5REQB 1LZOA 4WD0A 1YEYA 5LA2A 3T1GA 1SMDA 1V0MA 1Z9AA 5C5YA 5B80A 2BWGA 4EF9A 3SRFA 3ITGA 5IHSA 1GVFA 5CAHA 1Q6DA 1GEHA 1TR9A 2VI0A 4L61A 4KIEA 1E9IA 4FXJA 4M6QA 3SGZA 5I3HA 3VM5A 3LZ3A 3BWWA 3IS4A 2VEMA 3W9ZA 4DJEA 1D3GA 2I14A 2PS2A 3WLKX 9XIMA 1SJBA 4JQ4A 1WZMA 2PLKA 1GTHA 3NQCA 1K8CA 1BQCA 2XDFA 4EAMA 2GWNA 2FGZA 3OA3A 4Q8UA 2WJZA 3LHZA 4MJ2A 2ODOA 3DGRA 3WDQA 1F6PA 5AOUA 1O95A 3KDNA 1F9CA 3V1HA 1XISA 4EE9A 1DWFM 4ZB2A 3CC1A 4PBGA 1JAEA 2P76A 1JZ7A 4UFJA 3INPA 2G50A 1THFD 3TNOA 4G56A 2FB3A 3ZXWA 1Z44A 1CLVA 1E1EA 4F2UA 1OFEA 3TMLA 4NILA 3M5XA 1UH4A 2A1YA 4K1GA 4ZR8A 1ZQ5A 3UPMA 1H3GA 2VRJA 3GVQA 1J79A 4MHBA 3W22A 1YTEA 3NOEA 4HHMA 2FTWA 3WBEA 4K8GA 2O4MA 4LALA 2GQ8A 1PZ1A 5ABHA 3OTRA 2INEA 2ATMA 2A2IA 2ZIDA 2Z1SA 2OWCA 1Q6LA 1UWSA 2AAMA 3UXIA 5CLWA 2E5CA 4ZCWA 4GKTA 4DXVA 4YLWA 3P82A 1NDZA 3BLDA 2GK1B 3ZSSA 1YDYA 3RCMA 3U7VA 1RHCA 2FVLA 3RRAA 3R8GA 3PZQA 3OIXA 4KGLA 3QGAC 2I56A 3KRZA 4LC8A 2XVGA 3VTRA 5H1WA 3QC3A 2VZOA 3S5YA 1E1CA 4YYCA 4YCPA 1EYWA 1LLZA 3LTPA 3ITOA 2GJNA 4GGHA 1V3JA 1BVWA 3GDKA 4J3XA 1E5JA 4MLRA 1JD9A 3WSUA 1UWUA 3O0FA 3ATYA 4XTIA 3QQ0A 2O9RA 1EHNA 1XPYA 2CETA 3H24A 3U8GA 1J0JA 1TPB1 4PBFA 3OODA 2ZKMX 2E1DA 2YB4A 4DLFA 3NXFA 1H7WA 3RR1A 3CUZA 3REQB 1LOQA 3LSBA 2JF6A 3TK7A 1JCNA 3KDOA 3R6IA 3CZJA 2WSKA 1BD0A 1ZHAA 3B8VA 4H9MA 3UXAA 3ENLA 3MSRA 2P50A 4DO6A 1ITQA 1GQLA 2ZX5A 4F2BA 3W7RA 4LUYA 1W31A 3GE7A 3O07A 4K36A 3WK0A 2EBNA 4A21A 4DRSA 2PF0A 4UTLA 1JQXA 1GOMA 4IH3A 3GDRA 3QZ6A 3UXDA 3H2MA 3LTSA 4ZGYA 4AZ7A 1TWZA 4KFPA 1OGBA 4F0RA 1HKKA 1T8QA 5A6BA 2CCRA 4GJ1A 3V75A 1QVBA 4W93A 3S3GA 5CGTA 4IL2A 1CXKA 1R85A 4N9CA 1DL3A 4FOKA 2E09A 4H7VA 2PDNA 2D20A 3PBUA 3CPRA 4ORMA 4QG9A 3KOXA 1IQ8A 1XLIA 4RDWA 3I6RA 1XLKA 1L6WA 3BLFA 3CQKA 1KXHA 1MMFA 4FNPA 3T09A 1AFSA 1DOSA 3VA8A 1JFXA 1PO9A 3IJ8A 3AS3A 1X1NA 4QQUA 2VEIA 2OWWA 3SM0A 2G3IA 3E38A 1OX5A 1CB2A 2A3EA 2WCAA 1ELSA 2BY0A 2J7GA 2Y7GA 2Y7DA 3F4NA 4HVXA 3MANA 3MWAA 1BPLB 1RSCA 4B92A 1TYGA 3NPVA 1V0NA 4GGBA 3CHVA 3CLWA 5EFFA 5EGRA 4QE5A 2CZEA 2RHGA 2Z7KA 3WQ5A 4MUZA 4XKYB 4WXYA 3TAOA 1GVOA 3H2NA 3R79A 4IUGA 1N8IA 4NU7A 3HG3A 3UG3A 2J74A 1QPNA 1UPMB 2YGYA 4FEZA 3EDFA 3S5SA 2GJXB 3F4WA 2YDSA 5CBBA 3UQNA 3UERA 2E6FA 2XM1A 3GIPA 4MWAB 1G7UA 3UWVA 3W1TA 4RW5A 1B3VA 2AQVA 1MQQA 2OT0A 1JZ8A 3WH8A 1XYCA 2WMIA 2OXNA 3V4BA 5HR6A 1TRDA 3QFWA 3MC5A 3WQVA 3F2BA 1V7AA 3GG7A 1A5AA 1QDSA 4Q33A 3P93A 1QHOA 2FZMA 5AVHA 3PUEA 1SGJA 1EC9A 3EMQA 2AMGA 2VDGA 3W1PA 1OEPA 1XYBA 3KBJA 2PDYA 4HT3A 5BRPA 1Q63A 1GG0A 3J7HA 4QNWA 4KRTA 3TA6A 2OKOA 2WXDM 4JIHA 1KKRA 2CZVA 5EPDA 3F4CA 4XBJA 4B5XA 3M7SA 2WVSA 3TYCA 3KVKA 4UFHA 5EY5A 4WCJA 3I3BA 4IG2A 4X2RA 2PBOA 1FWCC 4UFLA 2PU1A 2NX3A 4P7OA 4NL1A 4LUJA 4DQWA 2WLZA 4AG0A 5A95A 1JI1A 3U5UA 1TX2A 3GIYA 3EBVA 4XUGA 3T4WA 3KL3A 3EMZA 3HGOA 5E0CA 4IXHA 1U30A 1HQTA 3E49A 4TVCA 2B7NA 4FX6M 4UIOA 4Q8TA 1CPUA 2WNZA 4BEUA 3E2SA 1TKKA 1M5WA 4AZ5A 1X6UA 3FA5A 2BV9A 2FPVA 4DO4A 1XR2A 2C0HA 1V6VA 3L65A 2XN1A 3PBWA 3EPOA 1WO2A 3BVJA 4Z1CA 5A6SA 1LROA 3L67A 1LUCA 1UD2A 2VENA 5H6HA 3AS1A 3SFWA 4PTNA 3C2OA 3AALA 4P8UA 3UESA 2DH3A 3N3MA 3RM8A 4K37A 5AFDA 1TJ2A 4LVBA 3NPXA 2YR1A 3QR1A 1PCKA 2Q01A 3VE7A 2V0TA 3W82A 4GQQA 2BTMA 5G4EA 3VKJA 3IGUA 3WNMA 5FEWA 2OLHA 4WIWA 3K46A 5KZMA 4ML9A 3EPNA 4PMYA 1J10A 3PZMA 3NFUA 1QTWA 1BLIA 5CQ1A 1TPFA 4ZOBA 1QO2A 4OGZA 1H7PA 2ZE0A 3WNLA 3OYXA 1G69A 4Y9NA 4HIBA 3T2QA 5CPSA 4QAIA 2DEPA 2QAPA 1Q13A 1CGYA 4S3GA 4YS1A 2H8ZA 1UKTA 3WH7A 3FKKA 2BY1A 3FEMA 5HR7A 5CJ5A 2RAGA 4HTBA 2CWNA 4NF7A 2E9LA 1FWEC 3EEZA 4Z2JA 2PWEA 2WO5A 4GUGA 1W3HA 3GSMA 2WNWA 3BGAA 3NQ2A 1A5OC 3ITXA 1EOMA 1LOLA 5GJPA 5BXRA 5EYWA 5I6SA 2NLYA 1R5YA 4ZENA 2E5BA 1MEHA 3P67A 4GI8A 1A49A 3ZJKA 3QR3A 4IHCA 4Q7BA 1FHDA 3GD6A 3VAVA 4LYQA 2NLIA 3W76A 5IFTA 4GO8A 1L0PA 2FVKA 3E96A 3CASA 4OV4A 2C13A 1R2SA 1K4HA 3E12A 3G0XA 3VD4A 4HJFA 4XAYA 1V7YA 2TPSA 2DDXA 4IIBA 3LG3A 4IMCA 4F0HA 2VQUA 4XD4A 5AC6A 1A50A 1VYPX 1VD6A 5BXTA 4PMDA 4AZCA 4JYFA 1E0VA 1KBLA 4PRWA 1IHIA 3AMGA 3ABRA 3B0VC 1V3MA 1W3TA 1MRAA 4HPNA 4GK8A 4UCGA 1F61A 1PKYA 2DZTA 3W7MA 3DYPA 2J79A 3PSVA 1SW0A 2EKCA 2PDGA 3W6LA 5CPOA 1BG9A 2XTKA 4HA3A 2FZDA 4WKHA 3JZEA 4S3AA 3EX1A 1GVSA 1J96A 3WLRA 4YWSA 3WD2A 5LZLA 4H9UA 5HQLA 4JEQA 4PMQA 3SW6A 2UV8G 1DJYA 3TLQA 1QRQA 5DMLA 4BHYA 4JX5A 2D2JA 4DM1A 1GOQA 1JRBA 1UZ1A 2W62A 3GFXA 3VIMA 3LSCA 3TN6A 5K9DA 3A4XA 3UR7A 5I3GA 1DXEA 4X0VA 4F2TA 2XIJA 2NW0A 1OK4A 2O0TA 4GMEA 4HNNA 3CZ8A 1EB3A 3BUVA 5DBUA 2P8BA 6CGTA 2IPJA 1BTCA 1HJVA 2UBPC 2CERA 3G5EA 4OOUA 4HZMA 2PEVA 3QZAA 4ZO6A 3T7VA 2XH7A 1NOFA 4AD4A 4YMZA 1XM3A 1WV2A 4HU8A 3LCXA 4XV0A 3W85A 1VPQA 1KA9F 3QLDA 3W2MA 4LT9A 2NT0A 4NXKA 3EB4A 3TROA 5JH1A 2V3GA 5I3JA 4B3ZA 1S3HA 1ZCCA 1IZCA 2Z2AA 3VGFA 3CV6A 3ZQ9A 1FWDC 1XFCA 3AJXA 2XIIA 4WQ6A 3NWRA 3TFCA 3QKEA 1DJZA 3OHMB 3WNKA 1HL2A 3F5JA 4HHHA 5M5DA 2FDSA 4UTHA 1HO4A 4IFKA 1A4MA 2HBVA 1M9HA 4OBRA 3PUOA 4XG1A 2AL2A 5J5DA 2F2HA 3E2RA 3MHGA 1KTCA 1V77A 5DRCA 3VKBA 4AZGA 3S6OA 3CMFA 4IJBA 3D0CA 1IYXA 4FOUA 2QULA 4NXSA 1GGOA 3GRIA 3EOLA 5F4XA 2HVOA 5FA5A 4CNUA 3W00A 4AZIA 3GH7A 1OZQA 4O8RA 1EL3A 1ADDA 1QBAA 4QS6A 4S3CA 2JIEA 3WY1A 1M7XA 1R9XA 2DW7A 4O1AA 4PUUA 3M5ZA 1SZRA 3HPZA 1TQJA 1NVMA 4YTQA 3BOFA 4RUBA 1ODZA 4V1XA 7REQA 1CENA 2FDMA 3THCA 3WBAA 4QDWA 1ONWA 1S38A 1LJYA 1ZP4A 3RLGA 3FJ4A 1K70A 2JBMA 4C6CA 4RL3A 3SEPA 1JZ3A 3L7RA 3VFLA 3NAVA 4HTYA 1M01A 3LXBA 3KHDA 2FB2A 1UCWA 4CUCA 2R82A 2W67A 1BXCA 1EXPA 1MUMA 2Z24A 3K1GA 4GYJA 1K8ZA 1UKSA 3EXTA 3DI1A 2C0AA 4H8VA 1GW1A 3GY1A 3IJQA 2HE5A 1P5BA 3PBYA 3MB9A 4PC8A 1OM0A 1Y65A 4WF7A 1NP0A 5CSUA 1JCXA 2WSRA 1TV3A 1SR0A 2GVGA 4HP5A 1KTBA 2FPYA 4N02A 4N7QA 3IAQA 4IGMA 4MAZA 5CC3A 1X8FA 1E0XA 1VFMA 4TV6A 3MMUA 2PLMA 2ZQ0A 1JAKA 1DJHA 1C8QA 1AW1A 3OBEA 2F61A 4UR7A 5BOFA 2IPFA 2C16A 1XD1A 2D3NA 2FPTA 3ZVHB 5FSEC 4RNHA 2A6LA 1ZL1A 4HK5A 3O3RA 1QT1A 3CV2A 1TV4A 2REQB 1Z3NA 1HKVA 4KEUA 2BVDA 3MCOA 1TTIA 4O0KA 3OBKA 2PLCA 2ZUSA 1ALDA 3W7KA 1VYSX 2V63A 4RKAA 1WDWA 1FCBA 1BYDA 3L5LA 1XKJA 3M0YA 3K13A 4GXWA 4GC3A 1IZKA 3HBLA 4YTUA 1CXHA 3AXXA 3N14A 4HK7A 3RITA 1UYQA 4GH3A 1Q7ZA 1TO3A 2V8ZA 3HJZA 2OZ0A 4XBSA 3M47A 3OVGA 2QQ6A 5I3DA 3T55A 1I2OA 3DHUA 1ISYA 4LU0A 3NM1A 3RM9A 1VBGA 3PVFA 4B2DD 4CKQA 3KBWA 4Y96A 3RJXA 2J78A 4DWDA 4WUIA 2W91A 4E8GA 3VOGA 4QLJA 1WUEA 1HJQA 3C2RA 1EJVC 3G2GA 3LHVA 1UD3A 2NXHA 3T0AA 3UF9A 1E72M 4CD5A 1JNEA 3L4WA 3ABOA 1FKWA 2J77A 4JN7A 1Q7QA 4TU1A 1P43A 1P1XA 4GY1A 1UUMA 1G67A 4O12A 2BFGA 5DX7A 2OKTA 2G8ZA 3K8MA 3N2MA 2ZX7A 3ZT5A 1PS9A 3EPMA 2EKGA 4LBRA 1H5VA 5HATA 4CEUC 2WC3A 4B4HA 3W07A 6ALDA 3L4YA 4HN4A 3MDWA 4AVNA 3O63A 1EDQA 3HF3A 4NY2A 5A6LA 2CPUA 5BXSA 3N73A 4PUMA 2I9EA 1W37A 3O15A 4ERAA 3B9OA 2PTWA 2ZFAA 3OG3A 1GJPA 3TJ4A 3EDJA 5A6BD 1UQZA 1EF3A 1VB9A 2IKGA 2A0NA 1WCGA 4YHEA 1UZDA 3ARRA 1GQKA 4RZ4A 1O60A 2WQDA 3WLIA 2EPNA 3UJSA 1QI2A 4MNLA 4WKAA 1TIWA 4U28A 3NYZA 1JQVA 5G2IA 2Y88A 1SFJA 4YTSA 4RXGA 2DUZA 1DWJM 4QS5A 3DUGA 7XIMA 4YTTA 4IX0A 1I8JA 2B31A 2Q6ZA 4D72A 3AO0A 4OBTA 4DX3A 1O12A 5HBFA 1XFBA 2YCJA 3LGDA 3SFKA 3PJTA 1HN1A 1QWKA 4TX8A 5LIUX 4ZQMA 2YZ5A 3HA1A 1NFGA 2OYKA 1I9CB 2YBUA 3L68A 4QNEA 5DMNA 4HPGA 4WR3A 4N9EA 2G95A 1BKSA 4PA8A 1DWGM 1Y8BA 2HS8A 4Q4KA 2X05A 2J9YA 1M53A 2R9RA 4AC7C 4A2RA 5CZSA 2X42A 1BTMA 3KCLA 4AMCA 3PNUA 3M64A 3MZNA 2OLAA 2IQTA 3EA2A 1P0EA 2EG6A 5I0DA 4HU3A 1O4UA 1ONRA 1XIJA 4JHOA 3UY8A 4CU7A 1D3CA 1EGMA 1UP2A 2FKPA 4JTQA 2WM1A 3VDAA 4N2YA 4OWGA 1OD0A 1TV5A 4AHQA 2G3NA 1XP3A 4OU1A 4LF2A 1T0OA 5KZEA 3DHFA 1CEOA 4DBUA 3QF0A 1QW8A 2RUSA 5ABFA 4M82A 3TLLA 1UH2A 2D2OA 3OBAA 4IUOA 4MNJA 4AEFA 3FGCB 4D6HA 1HP4A 1JCJA 4QSFA 4I9JA 3PBVA 1PDZA 2OX1A 4JQ3A 1Q6RA 5I23A 2A5HA 3LNPA 3BSHA 1GVRA 2ZXQA 3G77A 3AS0A 4B4FA 1JGIA 3L4ZA 4YTRA 2DT1A 1WUFA 3KHJA 5GNXA 1CGUA 3P0WA 3EWCA 4S39A 2V3EA 3LCGA 5DELA 1KCZA 2PCEA 1QK2A 3TEVA 1BF6A 2Z1WA 2G4JA 3E0FA 2BSLA 1LRQA 3IACA 3AIBA 3CIWA 1GPWA 2VUYA 1J0IA 4HZ7A 1M1BA 5FIPA 4R85A 1H62A 3SQMA 5DRIA 1PWLA 2OOGA 1O66A 3H6OA 2Z6JA 2FH8A 2W6RA 1I2RA 2E7FA 1XRFA 2X0HA 3DHPA 3IAPA 7ODCA 2HXUA 1KGXA 2XUCA 2Y62A 5A8QA 2QUUA 3LUTA 4KWVA 1LL6A 1WE5A 4PTVA 1ZLPA 4G6CA 1RXOB 4AD2A 4AHPA 5LIKX 4PH6A 7A3HA 2LLEA 2WC7A 1PIGA 1TMLA 2YA1A 2YXGA 3QW4B 2C8NA 2X16A 4ZL1A 3UJEA 4QJ3B 3UNTA 4NJJA 1TVPA 5DXXA 2WWCA 1KCXA 1P0BA 3FVMA 2C19A 1QNPA 4LAUA 5TIMA 1HGWA 1I75A 3N11A 2VVSA 3DG7A 4NT0A 1S5VA 2UY4A 2CXGA 6XIMA 1LDCA 4O50A 1VKFA 3DEQA 1U33A 3VIPA 1X7FA 1UBSA 2NX1A 2ZX6A 1AQHA 3MMDA 4PTXA 1N55A 1ZAHA 2WMHA 2GOKA 3M4HA 4Q4MA 4ADSA 1PEZA 1XWYA 2QCFA 3EDEA 1Z42A 2H9AB 1YNYA 3M5VA 2DIJA 5E09A 1WZKA 2CLKA 5JU6A 2WVUA 1HGYA 4JIPA 3I6TA 1OVDA 3VIOA 1YW1A 3FXYA 5U4NA 1S5MA 3H12A 3MO7A 1TCDA 3CAWA 1I1XA 3LBMA 1FDYA 1R3TA 2DZVA 3U7BA 3S46A 3CWOX 1VENA 4G7EA 4UNIA 3TYUA 1QNRA 4O18A 3B8WA 4XAZA 3GKAA 1CW2A 1BVZA 4BQ3A 3VX1A 1VFFA 1F6YA 3CUIA 1E6QM 3G3DA 2CYGA 2VGFA 5F7UA 2P10A 2EF9A 2GLKA 4AW7A 1TV2A 1CGTA 1DJIA 1IT8A 2G0WA 2OQHA 2GUBA 4Q7NA 5F2IA 5REQA 2ZUNA 4E5TA 3VD7A 3UVIA 4H1ZA 1GPFA 1AA1B 2A7NA 3KBNA 3QY6A 4LAOA 3LMZA 2EPMX 3LHYA 4WJ8A 1X96A 3GR4A 4ASTA 2YA2A 3B9AA 4MWAD 1JYXA 2A79A 3BAXA 2PE4A 4O0QA 4HNTA 3RPTA 3QFEA 2QPXA 3ZIZA 4JIEA 3TQ0A 2ISVA 1KCLA 1SW3A 1XHGA 2IS7A 4UTJA 5I7GA 2J47A 4IQEA 1ZRQA 1H0GA 3SECA 3W29A 3QHNA 3JW7A 4LS1A 3CQHA 1KBKA 3A6OA 4HNVA 4BS0A 3NZ1A 4A22A 4ZOAA 4MNKA 1BEUA 5C2GA 4S3FA 3O1NA 3VABA 3MY9A 4S38A 4FMVA 3OZOA 3P0XA 3MJYA 1PCWA 5JVLA 2EJ1A 2YCIX 1TWSA 1PDYA 2A85A 4UTTC 3AZRA 3OYZA 3K8LA 2QV4A 3W1AA 1YMYA 2GQ3A 4YYFA 4MWAC 2D24A 1Z7AA 1MXSA 4ICNA 4ERGA 3NL3A 5CXPA 1HKJA 5HDRA 3PAJA 1V6UA 3DBPA 2VCBA 5B7ZA 1E0UA 3IJDA 5AHLA 3LB0A 3PWAA 3C86A 4DWSB 3EX6A 1EJXC 1J4EA 2PDHA 3IRDA 4AHOA 3VDCA 1OC5A 4YCOA 5DT7A 5D30A 2JEQA 1KV5A 3M44A 3ZLFA 4W84A 1PHQA 1DPMA 3KOWA 3TONA 3BQ6A 4LV9A 4Q8QA 1Z89A 2QJNA 2VDIA 5CSYA 3OGVA 3FN9A 3BV7A 4P61A 1OGGA 1DBTA 4RZBA 1RP9A 1W17A 3ANVA 1F6KA 2Y2WA 4TIMA 1WKYA 1RVKA 2F84A 1JZ6A 4OZOA 3N15A 4GY0A 3UGRA 1MSSA 1UIPA 4W8LA 5AYBA 1VIWA 4ROQA 1JJKA 3AMDA 3KRSA 2O55A 3B06A 1WX0A 1GQIA 1ZY9A 4RX0A 4US5A 1UOZA 3BZGA 3PUDA 3XISA 4JKLA 3CB3A 3REQA 1WDSA 2WMKA 3GFYA 3IGHX 4XZ9A 3B8DA 4QQ3A 4R27A 3QPYA 1HF6A 2J27A 2IMRA 3NQ8A 4JTGA 4ZODA 3UWYA 4J1OA 4FS9A 1B3YA 3KL5A 4J2MA 1KGWA 4M51A 3B0YA 3MHUA 2JALA 3DYOA 1S3TC 1A5NC 2OODA 1KRMA 2A3HA 4AD1A 4C6FA 1DQXA 4WVXA 3OQ8A 3WNNA 1U2YA 3SUWA 1WXYA 4XSLA 1L6SA 3DOPA 2WQPA 5CAKA 5FKYA 3T2OA 2FJKA 3GNDA 1NM9A 2PDJA 2Y85A 4AD5A 1FWSA 1T7LA 4NRSA 5EKYA 5H91A 3U6WA 1A0EA 5FL0A 3VIIA 1NY1A 2DJLA 4W9TA 2WLYA 2VFGA 3NEHA 1ZAIA 2VUNA 4RZ6A 2Q3OA 5RUBA 3W37A 2PZNA 3TNBA 5EU9A 3U0HA 1PKLA 2R1KA 5FF0A 1EP2A 2JF7A 1M68A 5HPCA 2QVNA 3RPMA 3FKRA 4KGJA 1MQPA 3QN3A 4MMWA 1EX5A 2PDMA 3VC5A 4DYEA 3LRLA 3AZTA 2FFIA 3ID7A 4NZ5A 1CBGA 3WMSA 2E40A 3WF3A 2V5DA 4ZOEA 2YDQA 2G3FA 1C91A 2F9RA 3JS3A 3GX9A 4GY7A 3TQPA 2F6UA 4UFIA 5T91A 2X0YA 2J8FA 6ENLA 2IUZA 4XKYA 3I3EA 3MYPA 2CBIA 3NEVA 1UKQA 2YCLB 1AJ2A 3VKKA 2CLFA 4U4MA 4NZ1A 5T9BG 1ME8A 2WMFA 3RCYA 4UTTA 1RP8A 3QVQA 1SPQA 1J0ZA 5AVNA 2X09A 5C9XA 4OFCA 4KETA 3T05A 4QHRA 3PZIA 1QNQA 4FNUA 2CKSA 3WL0A 2UWFA 3V1PA 1Q4NX 4XIMA 4IPIA 5HWJA 1XRTA 1E51A 3DBNA 1XICA 1WXJA 1DWHM 1EIXA 1PIIA 5A5WA 4O1DA 3S5NA 3CL8A 4WX2A 4AC1X 1H41A 4XZWA 4Q3MA 3K2GA 4PMVA 5AECA 1R9YA 2IXVA 3C6CA 1OIFA 3LNMA 1H4PA 1GWJA 1CDGA 1EJSC 5FOOA 3H4XA 3L2LA 2QNEA 5FESA 2ZZ5A 3F4VA 3DKJA 3W7IA 5AC8A 1XH0A 2PGEA 4WHBA 1H61A 5E0KA 3PS7A 3U2ZA 3OB8A 3KLKA 4PE8A 3E6EA 2W9MA 2PP3A 1R8LA 2D0HA 3A3WA 4W7VA 1K03A 1MNZA 2WBKA 2X2GA 1DIEA 3W7NA 4LW7A 2GGEA 1EYEA 4L65A 3MKKA 4Q32A 1HJUA 1VRDA 2CBVA 1VCGA 3BJFA 2PSNA 3MI2A 7PTDA 2BDQA 1ZUAX 4H3DA 3W7PA 3UR5A 2JFEX 1NF0A 4KCUA 3L0NA 1V3IA 5J04A 2INFA 2ZA2A 4IFOA 4Y9OA 1V03A 5ENLA 4LRTA 2X8RA 4NG3A 3GTNA 4DJFC 5AB3A 3TYDA 1IE7C 9XIAA 1W54A 3HOJA 1I60A 3CZLA 3W7QA 1S2UA 2J7EA 2FIQA 1VGAA 1UP0A 4YWIA 5GPRA 1H1ZA 3RMEA 2AGTA 4BQ2A 3WBWA 4BCEA 1Z69A 3PM6A 1C8XA 1GOKA 2V2CA 3P5YA 1XYZA 4PUKA 3W7GA 3LGGA 3NSMA 2B7PA 2GJLA 1S2TA 1SQ7A 3IWPA 1TELA 2GDQA 3IV3A 3N3TA 2VMFA 2WPGA 4H9VA 5AC5A 5C7VA 5E9XA 3N2OA 1XLAA 2NQHA 5MF5A 1XDLA 4MZ8A 4P7QA 2VEGA 3GNPA 3L4VA 2GFTA 3DAQA 4QAWA 1FA2A 4D71A 3ZJ8A 1V02A 3BJTA 2PRMA 4KRZA 3GZAA 2WK2A 1UD4A 3NO1A 3NQBA 1H63A 4O4WA 2VGBA 4HD5A 2XGIA 4H4IA 3GZ3A 3A22A 5BU6A 1XDJA 1GK8A 4Z2KA 1E56A 3A5VA 4NNAA 5CPMA 3E2VA 3LZ5A 3WUBA 3K4DA 1O5XA 3BPWA 3VILA 1EF2A 3KP1A 4H00A 4V2XA 4GI4A 1RD6A 3D3FA 1TVLA 1EP3A 1IXQA 2ESCA 3NR0A 4FP1A 8RUCA 3THUA 4RDVA 2Y89A 2VZUA 3UNDA 2FTYA 3GXTA 1SO6A 1V5XA 2PGWA 3MUCA 4Q8VA 5FJOA 3TQVA 5LIWX 3A9BA 2C71A 4I9TA 2YCKX 2XIMA 2A6NA 2GYIA 4DB7A 2C18A 1GKRA 1UHVA 4GABA 3B0XA 1HT6A 4M6VA 1HG3A 3A13A 3CM4A 4KF1A 1ZJBA 1QI0A 4JKKA 4R7OA 3VPLA 1J5SA 1M3UA 5A1AA 1XINA 4IZGA 3OLGA 1OFQA 2QCDA 4ZA0A 3PG8A 1LOSA 2JKAA 3ARPA 4G7FA 3NNTA 3FXGA 1B4KA 3KEHA 2YIHA 4L9XA 3TOYA 4WLCA 3DC8A 5I2UA 2C79A 3W88A 3MSDA 1F3XA 2W66A 4PTDA 4FXFA 1VBHA 2VP8A 4JIQA 1PZ0A 2CZDA 1J9YA 5XINA 3L5AA 3C0LA 4C6QA 3ARXA 1VLWA 1UWRA 4AWTA 2ZDSA 1XYMA 1Z32X 1ISXA 2VURA 1V0LA 1PX3A 2D0FA 4NI3A 2XFRA 3VD3A 3GR7A 3W28A 4JTJA 5K9XA 3OPSA 3MUXA 1YTDA 1SO3A 3AISA 1GW9A 2CESA 2F8QA 2VGIA 2ZTKA 4B5TA 3P5ZA 2VXNA 3AHYA 3PPGA 1ZFJA 3AQUA 4LV4A 3DX5A 3FLUA 3II1A 2BB0A 2CZ5A 4UQ9A 1IEIA 4U5IA 1UOKA 2Y4SA 4GG9A 4AFYA 4INFA 3LN3A 3THQA 3Q65A 2DV0A 4FNSA 1R46A 3EX4A 3E02A 1IEQA 1ZALA 1Q6FA 5IDIA 3KUMA 4DJFA 2D1ZA 1YDOA 4JBRA 1MEIA 4D6JA 4R9XA 2GSEA 3VMNA 4FK9A 3KP0A 2ZCGA 1EJTC 3DFOA 4PMUA 4L1GA 2Q8XA 2GOUA 3A21A 4A3QA 2SFPA 1EXBA 1XLFA 2WC4A 4F66A 4ICCX 3B9EA 5EL1A 5TD4A 3N2XA 3HV8A 1RALA 3JR2A 2V2HA 1TUXA 4WY0F 4LAZA 2WVVB 3F2CA 4DIAA 3QYQA 2Z1XA 3CHFA 2QCEA 2Y70A 3SSZA 3U4AA 1B3OA 1UR8A 2PC4A 5AHNA 2WJEA 1JPDX 2CFFA 5ECVA 1U83A 5AYIA 3BMXA 4W7WA 3DKLA 3V7PA 1JNDA 2XISA 1XLJA 3O6DA 1Q2RA 1E1FA 3BXWA 2EQDA 5D2VA 4LUSB 3PTMA 1KKOA 1A80A 3P2VA 4MJMA 3EKGA 5HANA 2DQXA 3NSXA 3DCPA 4B3LA 4Z1DA 1OJXA 5E1QA 3TYBA 1YE4A 3H7VA 3GQYA 4UZSA 3USBA 4GIYA 3ABZA 1XCWA 3BCJA 1AG1O 3KS6A 2J62A 5H2ZA 4ZXOA 5AZ0A 2RDWA 1FHVA 4P7NA 3KZSA 3HQ1A 3DFHA 3EWXA 2QVHA 4ECLA 7TIMA 4B15A 4MZYA 3MU7A 3B4YA 1UR2A 4RDYA 1FWFC 1YQ2A 2ZC8A 3MKCA 3AU6A 2VT0A 2FMOA 1L6FA 2YYTA 3ALFA 1E9ZB 3CZGA 4B5VA 3KWXA 5CCZA 4H8HA 3ARVA 1L8NA 5LXXA 4JFTA 3T42A 1Q7MA 4OECA 2WCSA 2DIEA 4WGXA 3T08A 1IF2A 1R7OA 1I2PA 2RGMA 3N25A 1W3JA 3H2FA 1GHRA 1VC4A 4EP8C 4JX4A 2FTPA 4JTRA 2G97A 3ARYA 1C8VA 5D9MA 3WUGA 3TJLA 3WQDA 1TE6A 4HYRA 4HPXA 4IGHA 3TJIA 1LM1A 3N04A 2ZRYA 4TO8A 3B8SA 1WNOA 4KQNA 2WW5A 4Q7IA 1KXVA 1W1IE 3GHRA 3QXBA 4U33A 4GXPA 4AU0A 4UTWC 1CZ1A 5FJUA 2EXOA 4CNSA 1VAHA 1XH2A 1A5MC 4IWWA 1VPYA 4DO5A 3IARA 1XS2A 3CHEA 5HK4A 3S9YA 1T40A 5BW6A 3GVVA 1CXEA 2Y1HA 1AD1A 3M0HA 2HK0A 2QAFA 3ZVHA 4DF1A 2VCCA 4IMGA 5KEZA 2BG5A 5DXYA 2REQA 2R1LA 1FY6A 2BASA 3RM4A 2PDXA 3L4XA 1G01A 4HYWA 2OO0A 4CD8A 1YNPA 1MO0A 5E9AA 4LS2A 4LEFA 1HVQA 5TF0A 3W2UA 4V1YA 1P6CA 3G6MA 1XC4A 2PTZA 2J7DA 3KCOA 3H4WA 4H83A 1R6WA 3GXDA 4PUNA 4PMJA 2VEPA 1WQ5A 2RKXA 4FR1A 1RQBA 1C92A 2FZ9A 5AC4A 1EUAA 3CUXA 3W75A 5CJMA 1MUWA 4GJJA 3WLQA 4F9DA 1K6WA 4FX7A 2HQAA 5DEZA 1EWEA 3VDGA 3STGA 2ACQA 3GNOA 3KAOA 1WKFA 2EPHA 5HPOA 4JZ5A 3ERPA 1EEPA 4Q4RA 1E6NA 3DFTA 4FF5A 3CWNA 5JBDA 3HIJA 4I5RA 4L4MA 2WZIA 3AIVA 1IIHA 3EAUA 5FF3A 3TN3A 3T6CA 1GJWA 2GSJA 1UQYA 3IV8A 1BHGA 1NWTA 3W7EA 2R1NA 4GD0A 5BWFA 3CEPA 1RBAA 3PAOA 3A3XA 4FALA 2OX4A 4XISA 5E6ZA 3H2AA 4EPDC 2ZX8A 2INZA 1IGWA 3SAZA 1BQGA 1U1JA 4MPQA 5L6UA 4JCMA 3IUHA 4M7SA 4R3UA 2I1OA 3GU9A 5XIMA 1ADSA 3EKLA 4C6KA 3BURA 3ZS4A 1IXOA 3L2MA 1YXCA 1R47A 1LT7A 1IIGA 3V18A 1QW7A 1LQAA 3W84A 1JZ5A 4M19A 3R94A 3NGJA 3WLPA 3AXMA 1QOPA 1HIZA 3AYVA 3PJXA 4AWEA 1W32A 3GG8A 4WY0B 4NKCA 2CLOA 4DI8A 1DIDA 1WKDA 3AXIA 2R14A 3AXHA 4PCSA 3LPOA 3CTTA 1LBMA 2ISDA 4DNMA 1KC7A 4S3BA 4QCEA 2NQLA 4JXCA 5DBTA 4MY8A 1XLBA 1HJXA 1BXBA 2J13A 1EA9C 3W83A 4Z42C 3APYA 2ZWZA 4WOQA 4JDYA 2Y8KA 4GZ7A 5D4YA 5I3KA 4O53A 4PR4A 3EDKA 1Y5XA 2X2YA 3WZ0E 5HQMA 3AWOA 2VRQA 4O11A 2RDUA 5CBJA 1E5NA 3DZ1A 4EWND 3TTSA 4UTWA 4W89A 3NM3A 3FX4A 1ML1A 2B0MA 1W5QA 1R3QA 2XJ7A 1NAL1 4NZ4A 2E8ZA 2WHLA 4YU1A 3GTIA 3M0IA 4KKXA 3HMCA 3KTSA 1E4IA 4RE2A 3FYPA 1KLYA 2ZVRA 3IPWA 5T8GA 4LGXA 3IIVA 1FDZA 3PR2A 3ARWA 5HJXA 4GZIA 5TBOA 1M7JA 3G8EA 4MVAA 3VOJA 1FWBC 2Z7GA 4JHZA 4O57A 3T0CA 1W9BM 1GYMA 3FGCA 4LNCA 1XRVA 3GIQA 5HJYA 2Z26A 4BI5A 3RN6A 3LEPA 3B8UA 3DFPA 1QW9A 3GU1A 3CBWA 4Q4OA 3NDOA 4IISA 5HNRA 3GDBA 3PJUA 1ZBKA 3GXMA 1WB0A 1CIUA 1KM4A 3S47A 3TYAA 3ARUA 2E68A 4C7GA 1R9ZA 1O1HA 3AHVA 4I8YA 4S3KA 2XVKA 4XO6A 3PN8A 5I5RA 4HPJA 4DF2A 4MADA 4MWAE 5HJLA 1DIKA 1EO7A 1SMAA 3P8JA 3B9DA 4OUEA 1NFBA 2VKZG 5D2XA 1DQWA 1DEDA 1ZBWA 3M0KA 4EAYA 1EIBA 1W3KA 2H8XA 1BSIA 2QF7A 3P62A 1XJBA 3B03A 3D46A 3KTCA 2DW6A 3MMTA 1QNOA 4KBXA 1E6ZA 3OW1A 1UG6A 4DWSC 4CVUA 2WPBA 1KM6A 3G1XA 3K4AA 5C7HA 2I5IA 2Z0IA 1MXDA 4DZAA 1MW1A 3OHIA 1FH8A 4XB3A 3S1XA 4I7WA 1RLCL 4S3EA 1AQ0A 3SR7A 4KWUA 4H6RA 2DQWA 1C9WA 2EAWA 3NQGA 4AYSA 2QMJA 3AMKA 1TJ1A 3B97A 3ZR6A 1OFOA 4HKPA 4XBKA 3VKAA 2HEJA 2Q02A 3CZEA 1BVNP 1VP5A 1CCWB 5FEZA 2OELA 1JFHA 4Y2WA 1E6PA 4H9XA 4G5DA 3RU6A 5BMWA 1O68A 3KBVA 4UQEA 1JPIA 3H55A 1JUBA 1ENUA 3BV4A 3IVUA 2OZTA 1NH6A 3V0SA 4MAVA 4LCQA 4Z08A 3WLTA 3LXAA 2VFFA 1QAPA 4M1BA 3VGHA 5AHMA 4BWLC 2V82A 3W1QA 1LL4A 3S1GA 3LX9A 3WLMA 9CGTA 1ECQA 3UPBA 1H1YA 1JPHA 2FH6A 2D2GA 4JFUA 4HJWA 4GO9A 2BVWA 3SUUA 2H9AA 1XQKA 4V28A 1RY0A 1WOAA 2EPLX 2E0PA 1E1CB 3N6JA 3AJ7A 4M80A 2YW3A 4GC4A 3VI2A 2W5FA 2Y7FA 3UXLA 2PDLA 3H2CA 4C6EA 1KM0A 4M7TA 1U1HA 1S39A 4Q8PA 1XIEA 2BODX 4HU4A 2CBUA 4C7DA 2VD9A 3WK3A 1W9UA 3FFSA 3AZSA 3ABQA 2IPGA 1RK6A 3SCOA 2TAAA 3UR8A 2UY3A 3H4GA 1SM9A 3CB8A 2UY2A 2BOGX 3POCA 3URNA 2VOMA 1KO0A 4IPPA 2PDQA 2ANUA 1K1DA 3R8HA 4H41A 2ALRA 2O9TA 3HPSA 3LDVA 4UQDA 3TC3A 1BWLA 4I5XA 2ZZ2A 1EC8A 1US2A 4IOTA 1NOUA 1VBUA 1TTJA 5DANA 2E8YA 4Y6GA 1UIOA 3MO4A 3CQJA 4DY1A 2H90A 1OT1A 3S1UA 4RE3A 4B5UA 5E70A 5GNZA 1AL7A 1IEXA 2PDIA 1L2UA 2WWDA 3FIGA 2Z1BA 2ZOXA 4IMDA 1AMYA 3GTHA 3VGGA 4ZBCA 1P4CA 4X61A 2XINA 3H7RA 3NIYA 5CG0A 3WLSA 1VHCA 1LQ0A 5DMYA 1XV8A 1PBGA 2P0OA 2GPTA 4GYFA 2ZICA 1FWRA 1SZGA 3SGGA 3CV1A 4AH7A 1Q6QA 4GYKA 4M0XA 4CNPA 1TZZA 2VC5A 3AFBA 2D22A 2DVTA 2J7HA 1UZHA 4DWSA 3CK5A 2YKKA 1XW8A 5A8OA 4C6LA 2QKFA 1H60A 4H8NA 1ISZA 4AIUA 3H54A 3MSGA 1H11A 3DECA 1F3EA 2X1TA 1WPCA 2QUTA 3C0JA 3UA4A 3O6AA 3S2CA 1R30A 2G4FA 1J12A 5EMMA 4DNHA 3W73A 4UFKA 1LF1A 5EMLA 2ICSA 1XIBA 2AOSA 2MUCA 1OFDA 1GKPA 2GUYA 2XN2A 2HZGA 4NZCA 3B4UA 3OLDA 4PMXA 3B40A 3B0PA 2OGYA 2EG8A 4FNQA 4R5EA 2JE8A 2XSXA 3NZRA 4GINA 3UW6A 3EMCA 4HA4A 3AUJA 4PUDA 2CLEA 2O7QA 2L5HA 4UQAA 1U1UA 5A6JA 4JY8A 2QXWA 1LRTA 1FUYA 4Z0SA 4P5UA 5K7JA 4I7UA 4LC6A 5HWMA 2P88A 2VR2A 4GQ0A 1VHNA 1KM3A 4GYPC 1O5QA 3QTPA 4RLIA 3FA3A 4I3GA 3UJ2A 3RK8A 3FNDA 6REQB 1XLCA 4AVOA 2VELA 2V30A 3S9IA 4FXRA 5KTLA 3FHQA 1W9PA 3A4WA 4IG2B 2VFEA 3BTNA 3T8LA 5HULA 3LA4A 5HUPA 3WD3A 3R4IA 3RX4A 1XUZA 3WQPA 1GZGA 4RV3A 1UPPA 5IFPA 2WNNA 4XZIA 2EJAA 5IM51 1R3VA 3C61A 4ADTA 5IXEA 4CVWA 2OSWA 3U9IA 1AODA 1GVIA 4CNNA 1S1RA 3DYMA 3VKDA 3PBGA 1S5TA 3LI1A 3IGSA 2X30A 2C7FA 5D04C 4US6A 4LRSA 3R10A 5C71A 2E5DA 2ZA1A 3VZYA 3GHUA 2JGQA 3C0QA 4M8UA 1B3XA 3IJ9A 2WHMA 4H04A 3TYZA 1REQA 4D1JA 5K9CA 2ZC1A 2XPKA 1O5KA 2PWGA 3AAMA 4HHPA 2FYMA 5HMEA 4W85A 3OVQA 5EBAA 1OINA 1MI3A 3NL2A 1V6YA 4JFSA 5LGXA 4ATDA 3STFA 1WBHA 4NP7A 4UNKA 2X1UA 4PN2A 5FAGA 2V3FA 2GDUA 5KSWA 3K4WA 5G1TA 4HMNA 1K7FA 2EG7A 4RXFA 4JQ1A 3VXGA 3ZJ7A 4LAKA 1SZNA 1VH7A 3GUGA 4UFMA 2P1FA 2FZ8A 3UWUA 4G1NA 5D33A 3PK7A 2J25A 3C2FA 1MUCA 3VUPA 1V4YA 1XIDA 3ALGA 4MFDA 4OBSA 3W2NA 1PHWA 3HMJG 2O9PA 1DWIM 1K4GA 3LHWA 3NQEA 2FHCA 3L2IA 3GG1A 4QXIA 1YXDA 1H49A 1ZSXA 5CG7A 2ATSA 2Q71A 3YPIA 3LRMA 2DT2A 3QOMA 3S2MA 4GXMA 3B05A 4YVVA 3LENA 1ITUA 3BANA 4X9YA 2PWHA 2BOFX 4P8VA 4O1BA 4A8LA 5HINA 2WHJA 4QGCA 3M0XA 2XFFA 3POHA 6TIMA 4F79A 3Q4DA 3DGBA 5AYXA 1ZU8A 3IVSA 3SIMA 2DIKA 4MG4A 1EQPA 5DN1A 1V79A 1X97A 3VNDA 5K4ZA 1YTKA 2PC8A 2WOQA 5GJMA 1GQJA 3VCNA 3R2GA 3MJMA 4CQCA 5LNSA 1HW6A 2V69A 1ECEA 2QCHA 3CU2A 2I57A 4ZO7A 1K6AA 3L66A 4L4OA 3APGA 3EWYA 5DY2A 3ZR5A 3E74A 3SCVA 4DN1A 4UOQA 4E0CA 4H6EA 4ZB0A 4JS3A 4J9JA 2XG9A 4FO4A 3C5QA 5BOEA 3ELFA 4AZCB 5A6KA 3EEGA 4H9TA 4K3ZA 4XD6A 3EDDA 3G1SA 2DZUA 1TPVA 2ZUVA 1A3WA 4I9MA 5CPQA 1ZP3A 3PBMA 2VQTA 4EOUA 2GWGA 3UYCA 1KRAC 1QOXA 2BNJA 2DJXA 2YL8A 2CLLA 2JKEA 4DJDD 4KESA 1JDEA 4XIAA 3HV9A 3W26A 5T9CE 3KL0A 3PY2A 2BBFA 3PFMA 3S42A 1XIGA 2PPGA 1U5JA 4GIEA 3W7LA 3P8IA 2V81A 1ITXA 1FHLA 1J18A 1C8YA 3GTXA 1K9EA 2CLIA 1JEZA 4B91A 1VFHA 4JNYA 3GK0A 2P8CA 4XZNX 4R53A 4XAPA 4MYAA 3PZ9A 3CH9A 3C8FA 3QV8A 2ZXDA 3WBYA 3GUWA 3SURA 4ZO9A 3GW3A 3PWGA 3V35A 3HQOA 1VFLA 4W8BA 1SUXA 3W6MA 4MY1A 3HB9A 2DUXA 4PUEA 3LI0A 4O28A 4K8EA 4EKJA 1FCVA 1QNSA 1VPXA 6XIAA 4IF2A 2BXZA 3W0KA 3W7OA 3UWQA 4Z2HA 3BG3A 4FX8A 3CWHA 3QV6A 3QY8A 1FWTA 1MRQA 2ZRUA 1F8IA 5AHEA 1TFVA 2QS8A 3U2OA 3K1DA 5F2LA 3PTDA 3OA5A 1E4NA 1XLMA 2EHHA 5I3FA 3KCJA 3IVTA 4FXSA 2XM2A 1WDDA 3LTYA 3O0KA 1VJIA 3MP5A 1OZMA 5BCAA 1VFOA 4MJ4A 2IQ0A 2VZTA 4TQTA 5F1UA 3UZWA 4H2HA 4DAIA 3E5PA 2NUXA 4EXBA 1GYLA 1PZ2A 3M0LA 1PWMA 3DU0A 3JRKA 1FQ0A 2Z1VA 1MW3A 3BLPX 5ABGA 3WLLA 3EZ4A 1OCJA 3CL7A 2OEKA 4UOJA 2AL2B 4UMAA 3PJWA