4GZ7A

The crystal structure of apo-dihydropyrimidinase from tetraodon nigroviridis
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
492
structure length
492
Chain Sequence
b'AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFKMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREPYAGEVVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords dihydropyrimidinase
publication title Lysine Carboxylation: Metal and Structure Requirements for Post-translational Modification
rcsb
source organism Tetraodon nigroviridis
molecule tags Hydrolase
total genus 186
structure length 492
sequence length 492
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4gz7A01
3ID7A 3IV8A 4H9XA 1R9YA 5HMDA 5LXXA 1GKRA 4L9XA 2VR2A 4ERAA 1KRMA 3QY7A 4IFKA 3RYSA 1YBQB 3S2LA 1RK5A 3LGDA 3IRSA 4LAKA 3O7UA 3RHGA 3MSRA 3GU9A 3LU2A 1DPMA 3E2VA 3LGGA 2D2GA 3QGKC 4IH3A 2DVUA 1A5NC 4LANA 4KEVA 2EG8A 4KEUA 3TNBA 1QW7A 3E0LA 4QROA 4P5UA 2ICSA 4C6FA 2KAUC 1HZYA 3LY0A 3TN6A 1P6CA 4H9UA 4LALA 4EP8C 4C60A 3IJ6A 1UBPC 4IFRA 3OU8A 4XD6A 2BB0A 3AU6A 1FWFC 3MPGA 4INFA 3C86A 3TN4A 4JOMA 4Z42C 5HMFA 3A4JA 1A5OC 3UR2A 3LS9A 1FWBC 2HPMA 2GOKA 2Z25A 3B0XA 4KESA 2QPXA 4UB9A 1EZ2A 4H9YA 4KEZA 2DVXA 1NDYA 3E3HA 3T81A 1WXZA 3ICJA 1M65A 4R7WA 4ERGA 2I9UA 4IQJA 2Z4GA 3GRIA 2GZXA 2EG6A 1EJWC 3F4CA 4RDVA 4G2DA 4QRNA 1E9YB 3UF9A 1IE7C 4H9MA 4IF2A 1O12A 1XRTA 3B40A 3DCPA 1EJXC 3F2CA 4CNSA 2Z24A 1ONWA 4LEFA 2HQAA 4KETA 2Z2BA 2HNHA 3TN3A 1YRRA 1KRCC 1FWDC 1XRFA 1UMLA 2R1KA 4GY0A 4XAYA 4C6KA 3AU2A 4CNUA 4DI9A 2F6KA 1I0BA 3S2JA 4C6OA 2FFIA 3URBA 4IG2B 3MTWA 3GTHA 4LCRA 2AQOA 1V51A 2W9MA 4EPDC 4C6MA 4NP7A 2UZ9A 1NDZA 3IACA 3S2NA 2BGNE 3K5XA 3SFWA 2ADAA 2AQVA 3EGJA 4H9TA 2WJFA 1P1MA 2YB1A 4B3ZA 2CZVA 2WJEA 4HA0A 1GKPA 1M7JA 2WJDA 1FKXA 3WYZA 4C6EA 3F2DA 1XWYA 4H01A 4DI8A 4J5NA 4WGXA 4CEXC 2GSEA 3CAKA 4PCNA 4F0LA 4LAMA 3MJMA 2R1NA 1V77A 4XD5A 1A5KC 4HK6A 1ITUA 1UIOA 3LSCA 2R1MA 1A4MA 1FWGC 4C65A 4TQTA 3ORWA 4DZHA 1FWHC 3MVTA 3AUOA 3WMLA 1GKQA 4RE0A 4V1XA 3MVIA 4GBDA 2HBVA 2PGFA 2EG7A 3OOQA 4QTGA 3MDUA 3LNPA 1YNYA 1BF6A 2AMXA 3FDKA 4CNTA 3OODA 1FWCC 3URNA 4LAOA 1FWIC 4ZSUA 4QSFA 4L6DA 1K1DA 3QY6A 2VUNA 2GWGA 2YZ5A 3GG7A 5AKQA 3TN5A 2VHLA 2HBXA 2Z27A 1RK6A 4F0RA 3S4TA 3S2MA 4WHBA 3CJPA 4HJWA 5CH9A 4C6IA 2YXOA 2RAGA 4RDWA 5HMEA 2UBPC 2E1WA 2PLMA 3FDGA 2QS8A 1RA5A 4HK5A 2G3FA 4C6LA 4KQNA 4F0SA 4B92A 2OGJA 3E38A 3GUWA 4GXWA 4EPBC 3PAOA 3GIQA 3V7PA 4EPKA 1A5MC 4AQLA 4XD3A 3A3XA 4BJHA 4R85A 4BKNA 3E74A 4IGNA 2QVNA 4J2MA 3R0DA 2PUZA 3PNZA 1RAKA 1NFGA 2VC5A 1K6WA 4DLMA 4PBEA 4IFKB 2PGRA 3GU1A 4C6DA 3NQBA 3RN6A 3URAA 3A3WA 2VM8A 1J6OA 4PBFA 4QS5A 2Y1HA 1EJTC 4I6VA 3GTFA 4ZSTA 1RJPA 5G4HC 1EJUC 2FTWA 4ICMA 3NEHA 4HK7A 4H9VA 1POKA 2PAJA 1ONXA 3GTIA 4R88A 4XD4A 4EPEC 4PE8A 1O5RA 4H9ZA 2O4MA 2Z26A 1FWAC 2D2JA 1POJA 4H00A 1PB0A 2R1PA 3DC8A 4KF1A 3UR5A 5FSEC 4WVXA 3N2CA 3O0FA 5E5CA 3E0FA 3F4DA 3OJGA 1EJVC 1E9ZB 2VC7A 4V1YA 1NDVA 3OQEA 3LA4A 1S3TC 4C6CA 3GTXA 3UBPC 1FWJC 1RJRA 4CEUC 3EWCA 4GX8A 3FEQA 4C6JA 4DIAA 4XAFA 2IMRA 4XAGA 1V7AA 4GY7A 1PO9A 4C6QA 4DLFA 1R9ZA 2Z29A 4XAZA 2OODA 1K70A 3EWDA 2FVMA 3MDWA 3GIPA 4GYFA 4E3TA 1P6BA 3RCMA 4BY3A 4CQBA 1WXYA 1J79A 4GY1A 2D2HA 3DUGA 3OVGA 3CS2A 4IG2A 1FWEC 2P50A 1J5SA 2OB3A 4DYKA 3HPAA 4IGMA 5A6TC 4CQDA 3IGHX 3PBMA 1A4LA 1PTAA 1KCXA 3QGAC 4G7EA 4AC7C 4GZ7A 4RDZA 4KIRA 4DO7A 1QXLA 2FVKA 3K4WA 1PSCA 2R1LA 1KRBC 3GU2A 1V4YA 4DZIA 2DVTA 4UBPC 2WM1A 2I5GA 3IARA 2Q09A 3MKVA 4J35A 4RDYA 4LFYA 2QT3A 3QY8A 3JZEA 3D6NA 2Z28A 3F2BA 2FTYA 1ADDA 3PANA 4GC3A 4C6BA 3G77A 1YBQA 2E25A 3K2GA 4B91A 3WZ0E 1I0DA 2OOFA 1JGMA 3IPWA 3BE7A 1EJRC 4C5YA 3B0YA 2OQLA 1EJSC 3PNUA 4RZBA 4LCSA 2O4QA 1RA0A 1ZZMA 2HPIA 4C6PA 3NURA 1RJQA 4D8LA 3KM8A 4YIWA 4DNMA 1YMYA 2Z00A 2XIOA 2A3LA 4MUPA 2P53A 2ANUA 2GWNA 4GK8A 4IFOA 1EF2A 1FKWA 4I6KA 4PCPA 4M51A 2Q01A 3HM7A 4GX9A 4LH8A 4KERA 3URQA 1EYWA 1J6PA 4B90A 3SO7A 4GOAA 3T8LA 4QS6A 1UIPA 4NI8A 3ITCA 2ZC1A 2YB4A 4OFCA 4LCQA 1KRAC 4C5ZA 3UPMA 1W1IE 3HTWA 5FSDC 1YIXA 1V79A 1ITQA 4ERIA 4G7EB 3ISIX 4CQCA 1NDWA 1A5LC 3LSBA 1M68A 4NG3A 3T1GA 2Z2AA 4C6NA 1R9XA 1XGEA 1VFLA 2Z7GA
chains in the Genus database with same CATH superfamily
4US5A 1TJ1A 1HVQA 2G4FA 2VR2A 1QI0A 5K9CA 3QY7A 5TBOA 4DO6A 4Q8QA 5AC8A 5CZTA 4DJFA 3UR8A 4H1ZA 4GNKB 3TIMA 3I6EA 1CIUA 3QV9A 4B5TA 1W37A 4LY8A 3OIXA 2YCIX 5HK4A 4U33A 1BG4A 4LANA 1OD8A 2EG8A 3I4EA 3PF3A 1QATA 3AIUA 4C6FA 2TODA 5DT7A 1YYAA 2YDRA 4HJFA 4UTUA 2ISSA 3GVWA 4R3UA 2QCDA 3SCVA 1QOQA 4O1CA 5FF4A 6ENLA 1A0EA 1KM2A 3PK7A 2V5LA 3S1UA 4UB9A 4KEZA 4MPKA 5B80A 1PHQA 3C2OA 1LBFA 1HKIA 1P48A 3HU7A 4R7WA 3HB9A 4R9XA 3PVFA 2VDIA 4K3ZA 2HWGA 1NP2A 1P6WA 5G2WA 4ZVJA 4IMEA 2BP1A 1M7OA 3ANVA 4CNPA 1QWGA 2ZADA 4XV0A 2GSHA 2PURA 4L1GA 3IVSA 5HPCA 2DZPA 3EX6A 4LEFA 1RPXA 4TXEA 2FJUB 3SURA 4B9ZA 2D20A 1AK5A 2DY3A 5CPLA 1I6NA 5BWFA 5HQEA 2WMIB 2YDSA 4A3HA 4GUIA 2F6KA 1O94A 2FFIA 4GO9A 5E6YA 5C9ZA 5CC7A 2IPGA 1XC4A 3AHTA 4EPDC 1WXJA 3GHUA 5I3KA 4XO7A 2WC7A 4ZQMA 3TX9A 3W7RA 4POCA 4JQ3A 1TPFA 3UR7A 3GBEA 1P1MA 4NJJA 1SZRA 4X0VA 1RV8A 1FKXA 1QW9A 5U7SA 1VENA 4H01A 1HKWA 4C1NB 1AG1O 3TLQA 3AS3A 5FF3A 4CEXC 3NJ3A 3WMBA 5A3HA 5A2CA 5AC4A 4U5KA 1ITUA 1X6LA 4PUUA 4A35A 4G6CA 4W8LA 1DWJM 2VRQA 3QF0A 1QNSA 1XINA 1NOUA 1AL7A 3DHFA 4DJFC 1UC5A 4M6QA 1YLVA 4RE3A 5I2UA 1FWCC 4D6EA 4F79A 1TREA 1IGWA 3UWQA 3EB4A 1FCUA 3VUPA 4RW3A 1K6AA 3A6OA 2VHLA 4OOZA 2CHRA 2V3GA 1DJNA 3CUHA 3W7EA 3E49A 3AI0A 2PLMA 1LLOA 5AN7A 4B9YA 1MRQA 2Z1BA 1I9CB 1R86A 1RCQA 1KXHA 3C4UA 1TWZA 2UY3A 2HCVA 1XBYA 2BVDA 3M47A 1TG7A 4M1RA 2PTZA 4N0RA 2CU0A 1HQTA 3VX1A 1EJ7L 3QKEA 4W7WA 3V7PA 1X97A 3W7PA 3SIMA 4NIRA 2J78A 3KFTA 1E5NA 2CLLA 4X60A 3IUDA 4S39A 4XUGA 4NT0A 4DM1A 2BFGA 3MU7A 1F4HA 3PNZA 2Y0FA 1K6WA 4IQDA 4LC6A 3MS8A 1JRBA 2OZTA 2BY1A 2W27A 2XISA 4LYKA 2GJLA 2EPHA 4Q4OA 3RN6A 1SMAA 4M0XA 4DVOA 3AUJA 5DCDA 4HCLA 1GONA 3AMKA 1XLMA 3AIQA 3DHPA 2W6RA 3BJTA 1BQGA 4MJMA 4W4QA 2WMFA 1E3XA 1U5HA 4LVGA 3AHXA 2Y7FA 1UUMA 3R4IA 4K7VA 1GG0A 1AL8A 1OHLA 4E0CA 2L5HA 4CKQA 4UOJA 5I78A 2PF0A 5AC6A 3TYEA 3W24A 1NDVA 4GGBA 4ZO9A 5BNKA 3P74A 2B7QA 1Q6EA 4GX8A 4DIAA 3ZIZA 4ASTA 3NSXA 4GY7A 5LGXA 4GVIA 4QLJA 1ENUA 1GEHA 2D22A 1K70A 3RO8A 3IJIA 4GUGA 5CZSA 4JCLA 1ZBWA 1IT8A 3RCMA 3ZJ8A 3VIPA 4S3GA 4B2DD 1AQ0A 2GQ3A 2CFFA 2TYSA 2J7EA 4IPJA 5K2ZA 4JPGA 2PDJA 1XYAA 2PWFA 3TR9A 2FB2A 1VFOA 4GI4A 3TWAA 1SU5A 2ZX8A 3WF0A 3I7QA 2FVKA 3WLRA 2R1LA 1LBMA 1B4EA 4UBPC 1PAMA 4XTIA 4QHRA 1FXPA 3NQMA 2A3BA 1UWAA 3APYA 3LB0A 3TYZA 2WKGA 3UESA 3IAPA 5LIUX 3EOOA 3PS7A 4F2BA 1WPCA 3BE7A 3MA8A 3MANA 2DV0A 5BXPA 3PWGA 4AH7A 2WOQA 1J0IA 3TOPA 4DNMA 1A50A 7PTDA 4LS2A 3RFAA 1WBJA 2GUUA 5JBEA 3WLMA 1XKYA 4JKLA 4RUBA 4FIRA 5FJIA 2CBJA 1I2NA 3AIVA 2A6LA 1EOMA 5TNVA 2ZX9A 4EF8A 2ZFAA 1DWHM 4QE5A 2GJNA 4BF9A 1X8CA 5KSWA 1LOQA 4LCQA 3H2NA 2QAPA 2FH6A 1UQZA 4ICNA 2XH2A 4QNEA 2A7PA 3E2RA 3GXFA 4DN1A 5FF2A 3WENA 1J93A 5IFTA 1BPLB 1Y8BA 5FF0A 2QJNA 3GC2A 1XLKA 4NQ1A 4EF9A 1ZJBA 1E4LA 1Q8JA 4P7LA 3KRBA 3CL7A 4J3TA 4HU8A 5A6AA 3LLFA 4ADSA 4LGXA 5C9XA 1XYBA 4GQGA 1J5TA 4NZ3A 4I7WA 2SFPA 2GVEA 3NQAA 2DQWA 1AQMA 4AUBA 4S2CA 3EPOA 3LU2A 4MB3A 3P60A 3VDAA 4E8CA 3LGGA 4YVVA 2QXWA 1HUVA 2PRLA 1YTEA 2IXVA 3ATZA 3FSTA 2V3DA 4KCVA 1DORA 3F7JA 3O6CA 1JDEA 4JQ4A 2E7FA 1FP9A 4LAUA 1FWFC 4W7VA 3TDFA 4JOMA 1RQEA 3VNLA 3UR2A 1PKNA 2OT0A 4CUCA 1H2JA 4U3CA 1CTNA 3B8IA 2CLOA 3T81A 4P61A 2Z4GA 4XZ9A 3UYIA 4IPLA 3SRKA 2P88A 2J8FA 3W27A 4DM2A 1KFLA 2POTA 1I1WA 1DE6A 1CXLA 3E12A 2G0WA 3GG8A 2D69A 3LBCA 1W8SA 3NR0A 1TKKA 1VCGA 2HQAA 4YMZA 4WXYA 1TQJA 3TNOA 2Z2BA 3GXNA 3W6MA 3PUEA 2WVTA 1VJSA 3G2GA 1FWDC 1O4UA 1UMLA 2B0MA 3AU2A 1K9EA 4IIHA 2AMGA 4IX2A 1XBVA 4O8AA 3L0GA 1JCLA 4HD5A 4C6MA 3TP4A 2VQUA 1TIWA 4UTWA 2VGIA 4E8DA 1UWTA 4A8LA 3CYVA 2E40A 4H9TA 1GVFA 1IHIA 4OBSA 5BU6A 1Q6LA 3L4VA 2Y8KA 2CPUA 5AY7A 1XWYA 3H7VA 5JU6A 7A3HA 2VMFA 1ZLPA 4PCNA 3S0CA 5MKGB 2ATSA 4BEUA 5DO8A 3EA3A 3N2OA 2WHMA 4AEEA 2EEXA 2GLKA 1A4MA 3R13A 1RCOB 1O1ZA 3HFYA 1JDFA 4IPNB 2NLYA 3N04A 1TR9A 4EWND 5CLWA 4LF1A 3DKJA 2PGFA 4HNOA 4TIMA 5HJXA 3VK5A 4AWTA 2FIQA 4LUSB 5GJNA 4GHRA 1K1DA 2PDMA 3KUMA 1W17A 3UD6A 4OUEA 2DUZA 1M3UA 1V0KA 1MZRA 3EOEA 3NFUA 4L64A 7REQB 2ZVRA 4Y7EA 4ZB5A 1TTIA 3ANYA 1N7KA 4BK9A 4O19A 3FDGA 1QO2A 4AFYA 1ODZA 2OOGA 1I1XA 1RA5A 3GDLA 4F40A 1XIHA 3K1GA 4C6LA 2YKKA 3W82A 2VVNA 1S5NA 4GJIA 2JKAA 5I5RA 2DZBA 1N55A 1VCVA 1TPUA 2YLAA 1VKFA 1W91A 3OVRA 4AQLA 3RLGA 2NQ9A 3GSMA 2X0HA 4AHQA 2IQTA 4PBEA 3H21A 4HCHA 1TV3A 3NVTA 3NXLA 2QGHA 2XVNA 3LHTA 3KRSA 3LTSA 3CNYA 3W74A 1XIBA 1C93A 4LB3A 2QJGA 2WPGA 4FX7A 3HA1A 2ACQA 3BANA 3CXOA 3CZEA 2NWRA 1CGVA 3SQSA 2O4MA 4A8IA 5AYIA 3B06A 3BAKA 4GO8A 2QCNA 1KR1A 1KCLA 4N9BA 3VZZA 4A2SA 1HTIA 4UTWC 1H49A 1V93A 3QW3A 4BCEA 2BOGX 2PPGA 2QULA 1CENA 3AXHA 3PB0A 3OQEA 2E8ZA 2HE8A 3M64A 4H6EA 2YXGA 1Q45A 1UZDA 5E93A 5AYYA 2V68A 2HZGA 5A95A 2HTMA 1B3VA 4C6QA 1GJWA 3W53A 2C0AA 2Z1SA 1EGVA 4ZEPA 1BTCA 1WKFA 1EL3A 2EHHA 1IEXA 1XCFA 1SW7A 3TTQA 3W7HA 3UCCA 2NQZA 3VZYA 5KZMA 2D2HA 4JIQA 3GG0A 3NCOA 1Q6DA 3WH5A 3IIXA 2YCJA 4IGMA 3KZPA 2E28A 3AXIA 3NDOA 4CCCA 1V3HA 3WK3A 5J04A 4H04A 1XM3A 1OEPA 5XIAA 3W1XA 2VL4A 1KBJA 4B3KA 4IT1A 4GRSA 2VCCA 3AIWA 2NVDA 1HJVA 5D33A 3NAVA 2Z28A 1W9UA 4PL2A 1ADDA 4IMFA 2QCEA 4X63A 3V5FA 1B9BA 4MLRA 3QTGA 4RZBA 1IWPA 3SQMA 3LHWA 3CHCA 4LU0A 2I56A 2XH4A 3L0KA 4D8LA 4FNRA 2ZCGA 2XVGA 4PCTA 1J01A 3RR4A 3MZNA 2ANUA 1RBLA 1TMLA 2VYOA 3KZSA 3KWXA 3THUA 1EF2A 1VJIA 4UCGA 4JIPA 2VC9A 3G0UA 4FXFA 5A6BD 4QLKA 4CD8A 3RGTA 1H63A 1IV8A 2XUCA 1YXDA 1J11A 1TR1A 3DAQA 1C8XA 1G94A 1TWDA 2BOEX 3RCYA 5DY3A 1GYMA 3VIJA 3L21A 1P43A 2CLKA 2HK0A 1HJXA 4EANA 3QW4B 4CGTA 1I2RA 3Q37A 3CUIA 4Q4QA 4C7GA 2BODX 5ABFB 2V67A 1JI1A 1TQXA 3GH5A 4JEQA 3PZUA 3JUGA 3V1PA 4GACA 2HK1A 4OQVA 1J0HA 5DEZA 3RYSA 1V7YA 4LVAA 4UNKA 1XBZA 3LHZA 4JTAA 3EX3A 3OZOA 3MSRA 3POHA 4X0NA 2YYUA 4PMOA 4AMAA 2GJPA 5HULA 1TV2A 3MQTA 1UWUA 3GO2A 3MI3A 4RW5A 3TNBA 3BOFA 2GQ8A 3OP2A 2Z7KA 4R53A 2UY4A 3W26A 2J79A 4QCEA 3C2YA 1RQBA 1PX8A 3VILA 1PWMA 3PTDA 5C54A 1H1NA 4Q7BA 5C7VA 2Z25A 3N11A 3NWRA 2OZ0A 3AYTA 3OQ8A 1XP3A 5D30A 3E3HA 1EYEA 1J2BA 4OOUA 1DXEA 2WMGA 2O9RA 4AYGA 2EG6A 1DJHA 3WQFA 5FEXA 1W3TA 2JALA 2V63A 2HNEA 3M0HA 3C2FA 4H9MA 4IIFA 2JQXA 4KGJA 3WNPA 1FDYA 4OKDA 4WKAA 1JPKA 2AKZA 1ONWA 3SZ8A 4MYAA 3W1NA 1LRNA 3UWVA 1QASA 1RP8A 2J8GA 3ES7A 2V2HA 1PIFA 3OLDA 1W1A1 4MJ4A 4PA8A 4LB4A 4PULA 3URBA 3AHVA 3R0KA 8RUCA 2BTMA 3S8HA 3ITYA 4HZ6A 3GM8A 4QEHA 3QMTA 3TCEA 1KFCA 4NHVA 7XIMA 1MW0A 3E96A 2VCBA 3VKCA 2QCCA 1JQVA 3SGZA 4HNLA 2QCDB 2WNWA 2X2YA 3MSDA 3BC9A 2DH2A 3CAKA 4PB3A 1GQIA 1JCTA 5FKYA 3MUXA 3IIZA 4TVDA 2R1NA 1V77A 4BEQA 2GVLA 2VUYA 4TQTA 3KDNA 1S2CA 2VI0A 2EAWA 3TSDA 1A3XA 1KC7A 1KGWA 2VVSA 3SADA 1XI3A 2EG7A 2VX7A 3B9OA 1V0MA 3R8GA 4NSBA 2H9AB 3NG3A 4C7FA 2YZ5A 2YLLA 4FXSA 1HO4A 5I7GA 3W2KA 3P0WA 1VQTA 1KTNA 4GBUA 1EO5A 3S2CA 5HWNA 3AS2A 1OFEA 1TJPA 5CQ1A 2CHNA 3N15A 5CSUA 4CCEA 4Q33A 2A3AA 1OGGA 5M1TA 4DJDA 5KITA 4G7FA 2WSRA 4FIQA 2ON3A 5GJPA 3M0VA 1Q3NA 3CASA 3WLNA 3H54A 2PDUA 6TIMA 2IQ0A 2ISVA 3CLMA 2BVTA 2MUCA 4RNJA 4D6IA 2VM8A 5AVNA 1KGUA 2GUYA 4Z2JA 2Y1HA 4X2PA 4I6VA 5CG7A 4M3PA 4U4MA 5IBXC 4NZCA 2W61A 4EVZA 5F7UA 2DORA 1WP6A 2PCEA 3W70A 1UW9A 3QMSA 4PMQA 4ZQNA 4W8AA 4PUWA 5LA0A 2BOFX 1EEXA 4H8VA 3W7KA 4AMCA 4G5DA 4GZEA 1RLDA 3A5FA 3BAWA 3F4DA 4M6VA 1DJZA 4WDXA 4CVWA 1W9VA 1MSSA 4JTDA 1VBJA 3B04A 5CJNA 3PHAA 3CLWA 2GFTA 2ZXBA 1T99A 3E9AA 3FEQA 3M4HA 5FI8A 5KZEA 3MO4A 4ZCWA 5AOUA 3A4XA 3VCRA 3CQIA 5GJMA 2QR6A 3QR0A 5HNNA 4AWEA 4JHZA 1JZ6A 1ZNNA 4NYUA 1D3HA 2AOSA 4HU3A 3QR1A 2OT1A 4CQDA 3U2CA 2ZE3A 3MP5A 2FYMA 3ZQ9A 4AC7C 1TUXA 3LENA 3KP0A 1GK8A 1PSCA 1QBBA 3T2QA 2NQHA 3UNDA 3TSBA 2IPWA 3MKVA 4MWAD 3CU2A 3BARA 3DFHA 3H4XA 3FIGA 1U22A 3GW3A 3QFEA 4J2PA 2DIJA 3AS0A 3FAXA 5ENLA 1VBHA 3JS3A 1WE5A 1YBQA 2E25A 2XGIA 3KL0A 3BLEA 3LDVA 5DBTA 2QHAA 3PNUA 1OX4A 3HMCA 2EPLX 4WF7A 1K03A 3N6JA 5I79A 4DJDC 1FWTA 3IJ9A 1TV5A 3B8DA 1V5XA 5BZAA 3W9ZA 3APTA 3FHAA 2I57A 2EXOA 3EKLA 2ZYFA 3V0TA 4PB4A 1UG6A 1R38A 5EU9A 1EIBA 3WDIA 3MUAA 3S6DA 1E40A 2OYLA 1SMDA 5CPSA 4UOZA 3ME3A 2QIWA 1FCQA 4KGLA 2CNCA 3SY8A 2DU2A 5BCAA 1CXFA 2VWSA 5LHEA 2ZRZA 4DEFA 2J13A 3MCOA 3LQGA 1MEHA 4FS9A 4LBUA 3HG5A 4MDOA 1E4IA 3GDTA 3UU0A 4JYEA 4C6NA 4JFWA 1VFLA 1Z41A 2Z7GA 4AZBA 1FWWA 5EBAA 3AXMA 4Q6XA 4QNWA 5HAOA 3DFYA 4ZO8A 4MNJA 2NXIA 2V30A 4UTFA 3S2LA 1T0OA 2XPKA 3RM8A 1L2UA 4H2HA 1GEQA 5HBFA 1EWEA 3VMPA 5C6MA 3TTYA 5JMUA 2G3NA 2V3EA 3QZEA 4GVHA 2WPBA 4MHBA 1VPYA 1EB3A 1MYRA 5HR6A 4UQDA 3FGCB 3PFRA 1PCWA 2ICSA 3LY0A 3KRUA 2NVCA 1H7PA 3FXGA 2ZZ5A 2Z6IA 1UH4A 4TV5A 2ZVIA 3TXZA 5CZKA 1JAKA 3GAYA 3OVPA 3WX7A 1KM1A 2ZRWA 1VRDA 2DZTA 2RDUA 3B0PA 7ODCA 3ARZA 3ICJA 2I9UA 2A21A 3UJFA 4DX3A 1DL3A 1XLDA 1D9EA 3U4FA 2WLYA 2V38A 4IICA 3HJEA 1Z44A 1RH9A 1Z9AA 2XH0A 4GC4A 3L23A 3CHDA 3VNKA 1EJXC 2J7GA 3MHFA 3WCZA 1OFOA 3FLUA 3H23A 2BG5A 4XIMA 5F4SA 3RG6A 1FOBA 2FB3A 3VDHA 4X61A 1SR9A 3CV6A 2WBGA 3V4BA 1CLXA 2F2KA 1TB3A 4FNUA 2Y5EA 4BI5A 3GTHA 1SQ7A 4FOJA 3ZZ1A 3AIBA 1EOKA 5LSMA 1ZJIA 2PDQA 4RV3A 2Y62A 1E73M 3KW3A 2YB1A 3ABRA 3GAKA 4G56A 4UMAA 5CAKA 3WYZA 2YBTA 5D9MA 3TLLA 5H91A 3N9KA 3EKGA 3I3BA 1F3EA 4F0LA 3MJMA 1S5MA 2W0UA 4UMBA 2RDXA 4C65A 3ZWSA 4M56A 1RR2A 4Z0JA 1RUSA 4O15A 1W5PA 4XSMA 1X1OA 2Y61A 1XICA 4QITA 4HBKA 4HNTA 3GR4A 4H6KA 3S6OA 3T42A 2PLJA 1BF6A 4KW2A 3VOJA 4ZR8A 2PF8A 4FNTA 4D6FA 1RALA 4WJXA 3EWYA 1CCWB 1K4GA 2VX6A 3AAMA 4IMAA 2YXOA 1V3JA 2XVLA 3L65A 1CX9A 4M1BA 4LF2A 2GYIA 1KXVA 4LOCA 3W1TA 3L4YA 4S3AA 1VC4A 3KOXA 4LV9A 2DW6A 1QDSA 3O16A 4WCJA 5F2IA 3FXYA 2W67A 3E74A 5IHSA 4HHLA 5JH1A 4BS0A 1B3XA 3HGRA 3SI9A 5C2GA 3ZLHA 4Q7NA 3UERA 4E38A 3F5KA 4D2JA 3HQOA 3USBA 1JZ8A 5DCEA 4K2SA 3CHVA 3O3RA 5A8NA 1S3HA 1JCNA 4I9MA 3LPFA 5ECUA 4S3FA 1X98A 4KH2A 1F9CA 2Z26A 3UQNA 3N1AA 1U5JA 4H4IA 4V15A 4YYFA 1YTDA 4D6JA 1QNQA 9RUBA 4UFLA 4IIBA 3CHFA 1D8WA 4D6GA 3NIYA 4K36A 4XAGA 3Q58A 1LG1A 3VM5A 3DFQA 3PUGA 3VABA 1UCWA 5G1TA 5HNRA 2J7DA 2DZVA 4P7OA 1SM9A 5LKYA 4GZJA 3LBMA 4MWAC 4HYWA 4JN8A 3SUVA 3W71A 3M6DA 3Q67A 3PBMA 3LHVA 3WEZA 3TCSA 2XDFA 3GQYA 5E0FA 4R7JA 3REQA 4NZJA 1V4YA 4W86A 3FS2A 3CT7A 1PV8A 3DENA 1GORA 3UG4A 4RDYA 1KKOA 1DWIM 1O5QA 2F84A 2JF7A 3QY8A 1P0NA 4NVTA 4EACA 4WLCA 2C15A 4DAIA 3K2GA 2X2GA 3SIZA 3P67A 1I0DA 4CU7A 3HGJA 4S23A 5F1UA 2PTWA 2FMOA 3HZ3A 3BW3A 3QPZA 3IK4A 1VR6A 2VD8A 4GH1A 3S46A 4MB1A 4UFKA 1RJQA 4OWGA 3SUTA 2D24A 5ABEA 4K8GA 4Q8UA 3A3HA 1B2YA 3GFZA 1GUVA 4A6GA 3GNPA 4M7TA 1ZENA 2P8CA 3JZUA 1YXCA 1EYWA 1F7BA 1GOIA 1H09A 1VEPA 2BGSA 1W0MA 1V8EA 3ITCA 1J0ZA 4OFCA 4NXSA 1SJAA 1HO1A 1H5YA 2JKEA 4Y6GA 3UWYA 3GDKA 5AYBA 1TIMA 1NM9A 3WQCA 4PRRA 1MVYA 4H7VA 4PR4A 5HATA 1E6RA 3NVDA 1JZ4A 3B9NA 3UETA 1J96A 4K68A 1KNWA 4ZTYA 4GGHA 3GG1A 3IV8A 2VFEA 4LRTA 2ZUNA 4DPPA 3NOYA 3PPCA 2OO6A 3MCMA 1UUOA 2YYTA 2YGYA 4S38A 1DIKA 2QPSA 2QYGA 1H7NA 3WLIA 3AROA 1NIUA 1QW7A 3AISA 1JRCA 5FL0A 4ZMGA 2P3ZA 1XGZA 5IXEA 4FF7A 3AU6A 1B31A 1UBSA 4CN4A 3VFCA 4KWWA 4AVNA 2D1ZA 3UXAA 1K02A 3VE9A 2GUBA 1JZ5A 2ZXQA 1FVPA 1S2VA 4JHMA 2VFIA 2DVXA 4MY1A 1Z69A 1M65A 1VFMA 1K4HA 3PBUA 3TSMA 1CT5A 3MSYA 3B05A 2ZTKA 4GNVA 3NOEA 4IXXA 1W1TA 3DBPA 2Q8XA 3MI6A 4M81A 4XKYA 1BFNA 2VWTA 3G0XA 2DIKA 4FNSA 4DZ5A 1W1B1 4PYSA 2ZXDA 3F2CA 3GNOA 2VZTA 3BOLA 5I3GA 4WDUA 2OJPA 1KRCC 4M5PA 3NQFA 3VDBA 4HB7A 4IG2B 4GI9A 3MTWA 2QAFA 2AQOA 1B90A 2X0SA 1AW5A 3M0XA 4MYXA 4Z2KA 1DV7A 4CD6A 3K5XA 3RLHA 2AQVA 3UVIA 3W4RA 5CSSA 4IQLA 1XPYA 1M7JA 1E71M 3P93A 4PZVA 1M6JA 4JIRA 4D72A 4LVBA 1A0CA 2XN0A 1AMYA 5EA9A 2GSEA 3NGJA 5K4XA 2BY0A 3SRFA 3W76A 1PKLA 1TE6A 1UHVA 3M07A 1JUBA 3RNDA 2ZZ4A 3WF2A 2DZWA 2IW0A 1H0IA 1DBTA 1QHPA 4WJ8A 2G5WA 3MVTA 5D9PA 3ZR4A 4MAVA 2YBVA 2HVMA 4N6EA 3PBYA 2GGIA 1Y5VA 3TQVA 1AD1A 4MZ1A 3B8VA 3ARSA 4GIEA 4GCAA 4N6FA 2VUNA 4YJ5A 5EYWA 3KBSA 3W88A 5CZ0A 1EP1A 3SY1A 2QV4A 4REQA 3VNJA 1WV2A 2WMHA 3W7JA 3ZT6A 4ATDA 9XIMA 3QXBA 4GUHA 1SR0A 4PEKA 2XIJA 1VBUA 1R2RA 1OZQA 2WQPA 4CCZA 3QGVA 4MKNA 2Z2UA 3UZWA 2C71A 3WDHA 5D37A 4L61A 3MMTA 4IIGA 4GD0A 4DWSD 3BK0A 3GUWA 3SN1A 1PWLA 3QM3A 1EHAA 4RPPA 2RUSA 3T05A 2C6QA 1DJGA 3W22A 2OEJA 3B03A 1NAL1 2NQJA 2ZDSA 2E8YA 3F4WA 3W1MA 2X40A 1WDPA 3T8QA 4UZUA 2X8RA 3L66A 2ACSA 3T07A 1V3LA 1MNZA 5BMXA 4O14A 1H3GA 4HA1A 1LTDA 1K7FA 4NX5A 3K4DA 3PZ9A 1EJUC 4LS1A 4CN1A 3TJ4A 5EFFA 4XKMA 4H9ZA 1V6TA 1O6IA 2ISDA 3RJXA 4KCTA 4ZQCA 2ODOA 2R1PA 3F4NA 1A5BA 3BLOA 1GQKA 1NFPA 1WZKA 5HDRA 1UWRA 4FA3A 1RCXB 4AZIA 4O0QA 2E5BA 3WFAA 3UXDA 4L7ZA 4L56A 3VXGA 1FWJC 3U3HA 4I7VA 3VIHA 2BX7A 4KCWA 2IMRA 1V7AA 2PD9A 3RR1A 4ZA0A 4OGZA 3FY1A 1QO5A 1OFBA 4NAEB 3PZOA 2VTFA 3ATYA 4MB5A 1XYLA 1BVZA 2ZRXA 1QOPA 4Q4SA 3WF3A 2PDKA 1PYFA 3VD5A 2ZRVA 4AD4A 3M9YA 1OCBA 4WRHA 4NZ1A 4AY8A 1UMYA 3JW7A 1AW1A 3UWEA 3ITOA 1XW8A 2OMAA 3MI2A 1C90A 1OG0A 2IPJA 3UG3A 2J66A 3C2VA 1JPHA 1PZ2A 1VYRA 1EWDA 1US2A 4L6OA 4GFSA 3WMCA 3EWZA 4C1NA 4BI7A 1IIHA 3G77A 5IFPA 5GVJA 1EIXA 4Q4RA 2E68A 1BSLA 4LCSA 3WBWA 1SZNA 1M41A 1RA0A 4ADTA 4TTGA 3CM4A 3MP3A 1BLIA 2VR5A 3L68A 2OQHA 1TX2A 2C1GA 1RVGA 2CLPA 3LLDA 2R82A 1SUXA 4GX9A 4ROQA 3K8KA 5HUOA 3K4AA 3TONA 1E0UA 2RJHA 4IMGA 2POZA 3PULA 1OFPA 1MNSA 3FVDA 2F38A 4RPQA 4ACZB 1EC9A 4CVUA 3BAXA 4Y96A 3M0IA 1K7XA 3S5OA 1NDWA 2EPKX 2WANA 4AF0A 2WC4A 2X1RA 1TA3A 3NPXA 1DKWA 2EF9A 4ZBCA 3O07A 1R9XA 3UJEA 4H9XA 3AMDA 3RMJA 3TH6A 3RUBL 1FWRA 3N73A 1YBQB 2WSPA 2B4GA 2G96A 3LGDA 3SJ3A 3U6WA 4MDPA 1LRQA 3VGBA 3ZO9A 3O7UA 3C3NA 2QCFA 3D3FA 5IDZA 4G9PA 4LBSA 1PKYA 2WHLA 4GIYA 4JTTA 2O56A 2DVUA 3OZPA 4JICA 1RVKA 4UOQA 2PBOA 3O63A 1GVEA 1TV7A 3WH6A 4LALA 4YNGA 4JBRA 3C8NA 1G4PA 1M03A 5CPMA 4IFRA 1E4MM 1B3ZA 3W7GA 2X1SA 2H90A 4H3DA 1QWKA 2FZ9A 1MO0A 3QN3A 3LG3A 3UXIA 2XWEA 5BW6A 1PL9A 1F3TA 5JH2A 1G9HA 3G1FA 1TPH1 3FX4A 1UD5A 1NDYA 2NVAA 1Q6CA 1XIJA 1ODUA 1CGUA 1CLVA 1RHCA 2QUUA 1EC8A 1IYXA 2PLKA 2P5NA 4ZQOA 3WDPP 2CCRA 1LDCA 3HFTA 3F5JA 3NO3A 3VIKA 1GQJA 1XH0A 2QKFA 4RE4A 5LYRA 2C0HA 4FLSA 2CBUA 2QMKA 5HJYA 4IJBA 4PRWA 5DMLA 4PMXA 4DHGA 5BRBA 4GA8A 3H7UA 1XRFA 2AAAA 4FLOA 2X30A 3TMLA 4AZGA 2YL5A 5ABGA 4AIEA 3HMJG 2W9MA 1KQYA 5FAGA 4F2UA 3OLGA 1PVNA 1ITXA 3IIOA 4P7QA 1BWKA 1V6XA 4DB7A 3NQCA 1OSEA 3H26A 1IZCA 4ADUA 3LNMA 5G4WA 4C7DA 3T78A 1E9IA 5K4ZA 1W2PA 3G8EA 1FQ0A 4XZHA 3TXVA 3LMZA 4UXDA 4GQBA 4Q4KA 4B5XA 1TPC1 1BF2A 4HZMA 4XD5A 2BHUA 4HK6A 3WN6A 3DN5A 3L2MA 2XFFA 3OTRA 1V03A 9CGTA 3QSRA 2YDAA 1B1YA 1TPVA 4V1XA 4E4PA 2PDPA 3UFYA 4CNTA 2PI6A 3WNLA 1K77A 2YCLA 3SQLA 3VGHA 2AGTA 3UY7A 4AB4A 2PBGA 4O1BA 3CB8A 1I8JA 1XD1A 3A12A 3CV2A 4GUJA 4F0RA 3M16A 3OG3A 2HXTA 5FESA 4JX6A 5CAHA 4Z1DA 3WQEA 1YDNA 1R3TA 3CJPA 1ZPTA 1S39A 1UD8A 2XU2A 3R58A 3PP7A 4RV8A 3SUSA 2QW5A 4GYPA 2WVVA 5LGZA 4F0SA 4L1XA 4O1EA 1BSIA 1CBGA 2PDIA 4QQUA 3GIQA 1F5ZA 4XZBA 4AD3A 5AHEA 2ABAA 4YYCA 1WBHA 2VJXA 4JIHA 4WGHA 5A2BA 4RNFA 3KOYA 4XISA 3I3DA 1DXFA 4TUFA 4HYVA 1YE6A 3K30A 3APGA 1G7UA 1LORA 3SEPA 4MMWA 2VD9A 2XSXA 4JZ5A 4HHMA 3U2EA 2OX4A 3QPEA 3CIXA 2NV9A 1J6OA 2QJIA 2V81A 4PMJA 1EJTC 1K8ZA 1Z48A 2Y89A 3VKAA 4MLJA 4WD0A 3IJDA 5JIWA 3WLHA 4D1JA 3S42A 1ZAJA 2VCAA 4JTSA 2ZA1A 4ZE5A 4ES4A 1B0IA 1JGIA 3ECQA 1GZJA 2PFHA 3A22A 3HQNA 4JL1A 2GGHA 4Y9NA 1XLCA 3ZMRA 3P7YA 1C92A 2B7PA 1F8IA 3T55A 1LG2A 1EP2A 1E9LA 1Q6GA 1UZ1A 1DP0A 2WZEA 1HKKA 3QQ1A 1W5OA 4C6JA 3MY9A 4NNAA 2EGZA 4DJED 4AIOA 1WO2A 1CZ1A 5A8QA 2GPTA 3MDWA 4GYFA 3MBFA 4HOZA 2HS8A 1SJDA 4JFSA 2XVKA 1UYQA 5G2HA 4DELA 3HG3A 1HIZA 4AD0A 3TC6A 3JU2A 2ASHA 4AD1A 3I7RA 1JG9A 5C7HA 1PTAA 4XAPA 1U33A 1IR1A 2XGZA 4YCPA 1D7FA 2JGQA 3BMVA 5D4YA 2W3ZA 2VGGA 5H6HA 4A3RA 3QV6A 4ZOEA 4TTUA 5TQLA 4UZSA 3ONCA 2XN1A 1K8CA 3ARTA 4WKFA 4GC3A 4ZB0A 2NQLA 3WZ0E 2YR1A 1OD0A 4GYPC 2V5DA 2YSWA 3GY1A 4FI4A 3FKRA 2E4TA 5DELA 1XIMA 1HF6A 2HPIA 3AOFA 2GGGA 3A47A 5RUBA 2VX4A 4JTCA 4MUPA 2P53A 4HNVA 3MW7A 2FKPA 4GH3A 4PMYA 4PCPA 3PZQA 3GZAA 4IUGA 3V3WA 3HOJA 1H11A 3T0TA 4LH8A 2P3EA 3ZFHA 4KERA 3URQA 1VLWA 5I3IA 1HJSA 2RGLA 1T6MA 2CLEA 3S9ZA 3BQ5A 4MG4A 2W63A 5AHMA 1D3CA 3BCJA 2W92A 3PY2A 2C79A 1XUZA 4LUIA 3LV5A 5I23A 3LERA 3W38A 3TE9A 1V3KA 2H8ZA 1A5AA 2WMJA 1R0MA 5A2AA 3REQB 3WKZA 4J40A 3DERA 2GDUA 1PPIA 1QJWA 3V0UA 1MMFA 1BVNP 1YDYA 2XM1A 1FDJA 3WUBA 4ALDA 3LGEA 1WCGA 4Q8MA 1JFHA 1D8CA 4L80A 3N2TA 1GOOA 3FJ6A 3K13A 1Q4NX 5LNWA 3UGVA 3O05A 2D2GA 1ME9A 1NARA 3CQKA 4HN4A 3CO8A 3E0LA 1JZ2A 2IKHA 2WYSA 1UP0A 3WJWA 2W5FA 2YFNA 4NNBA 4US5D 3CPUA 5TIMA 3KWSA 1C8VA 1CB2A 4QDWA 4IIEA 4ZENA 4INFA 4JXCA 1IEQA 4DJFD 4E6MA 4M6PA 1ZL1A 1JZ7A 1VYPX 4H7CA 1OB0A 3TA9A 1Q2RA 4H9YA 2D0FA 1WAWA 3VCNA 4L4MA 3JR2A 4L9YA 1REQA 4N2YA 5F4XA 1K7EA 1WAUA 4DUXA 3BMWA 5BRQA 1HL8A 4GMEA 4GCXA 4IF2A 3GNRA 4QDPA 4Q3MA 2O7SA 2HEJA 1WDSA 4OV4A 2PP3A 4JY8A 3L2LA 2D3LA 3RF9A 3E5PA 3IIPA 2FVLA 1T40A 4XAYA 4C6KA 4V27A 4OECA 3VUSA 1V08A 3NL3A 1GVRA 4CQ8A 4JTJA 3CV7A 3S2NA 4QEEA 1A0DA 3SFWA 3BLDA 1E6PA 1XIFA 3EGJA 3PPFA 2J47A 2WC3A 1G6CA 3DYPA 3T0DA 4C6EA 2J9XA 5D05A 2R14A 4DI8A 4F9JA 3O06A 4PTMA 4LAMA 1ZS2A 2YA0A 4FX8A 1A5KC 4PEEA 3BOXA 3LPOA 3NTYA 3MC5A 3MYPA 4KEMA 3LRKA 3MUCA 1AJ2A 4LYRA 4E3VA 4RE0A 3N2MA 4NNCA 1KLZA 3Q2DA 1AH3A 4A4AA 1W9DM 3URNA 4PMDA 1FWIC 2C16A 3H2EA 3WQ8A 2Y4SA 1A53A 4PC8A 1XFCA 2Z27A 4Z2LA 4HA3A 1R85A 2YXXA 2VFHA 3FAWA 1Q13A 1AJZA 3S2MA 1ONEA 2OWCA 5HQLA 3ZR5A 1Q7QA 1XLAA 2CLFA 4RDWA 1MXGA 3R10A 3UWWA 4MIMA 1EQCA 3GR7A 3FHQA 1GQNA 3B0UX 3EDFA 1DVJA 1SO6A 1UASA 5AHLA 5ABFA 4OUIA 1OCQA 4QR6A 4KQNA 3ABXA 3LM7A 3AC0A 2HVOA 3SCUA 2DSWA 3A3XA 2XM2A 4XG1A 5T26A 3FK4A 2OELA 4YTSA 2OTDA 3GC5A 4WEVX 4M29A 1EC7A 4IGNA 4H6RA 2GOUA 3GHRA 1XBXA 3ZT7A 4A8NA 1ISVA 3A3WA 5D2WA 2FZMA 3TTSA 2W79A 1SZGA 4IGSA 2G3MA 2IPFA 3AHZA 3VOFA 1YXYA 2YIHA 4XD4A 3KOZA 3KLLA 4JIEA 4JFVA 1FWAC 3VCCA 4DRSA 4KWUA 4IIDA 4YWIA 3UPBA 2OZ8A 1PKMA 3TJLA 1I2OA 4Z1YA 4CEUC 3W28A 3ARRA 3W02A 8XIAA 1H60A 1A5SA 2VGBA 1Z89A 3A24A 3RU8X 3TYCA 5JBFA 2BDQA 1P6BA 2PS2A 2DUXA 2IKIA 4H83A 1YX1A 2WKJA 1H5VA 1XH2A 3TU9A 3V0SA 3LTYA 1WDDA 1VAHA 2RDTA 2DJLA 3NPVA 2INEA 3OVQA 4S1FA 3SSZA 1A47A 2BY3A 4ZO6A 4M19A 2OEKA 3CK5A 3IANA 3PAJA 2DPEA 3DG7A 3W01A 1KBKA 2VZSA 2R8WA 4X22A 4S3BA 3UP8A 1GTHA 3A64A 2UWFA 2ZIDA 2VT0A 2BHZA 1UD2A 2C19A 3R1ZA 1P0KA 4Q4PA 3ARWA 4O16A 1TPEA 3OLEA 2ISWA 3TKFA 3NO5A 1HP5A 2PDHA 3U2ZA 4UR9A 4J9JA 1V3IA 1W1PA 4W5ZA 5A6SA 4W85A 4O4VA 4GUFA 3WEOA 3RJYA 3SW6A 3MMWA 3G1YA 3SCNA 3B3DA 4O54A 3LPGA 3QTPA 2CLMA 1DJWA 4ORMA 5BXSA 2H9AA 4IFOA 1H7XA 1JL8A 4JTLA 3MP4A 1GOKA 4IGHA 4BA0A 2WMKA 4AZ7A 5HQMA 3MYOA 3EDJA 3W1AA 2YL8A 2YB4A 3RLVA 2C8NA 3ZWTA 1AODA 2J7FA 1YIXA 3LCWA 4S3DA 3W1QA 3WSUA 4IP4A 4XTDA 1NY1A 4O4WA 3I10A 1QRQA 4CNNA 2D0GA 2ZZ1A 4DUWA 1RD6A 4FALA 3WH8A 3ZT5A 1UA7A 3T7VA 1F07A 5LXXA 3OBAA 2XTKA 3IJLA 3WNOA 5FJRA 2NX3A 1OG6A 1X38A 3ARPA 4LT9A 2VDGA 1NJJA 4MKSA 4JCMA 3GW0A 3PTQA 3UJ2A 3VGFA 4B5NA 3MV11 1QVBA 4QJ4B 3IV3A 3E2VA 2BZNA 4PCFA 1AUSL 3SSJA 3QGKC 4DBWA 4U2YA 1A5NC 4KEVA 4TMCA 3P5YA 4P8VA 1E6QM 5CEWA 1FUYA 3DFSA 3E5BA 4GQRA 1P6CA 2VOTA 2Y88A 3T0CA 4MY9A 1Y65A 3OU8A 4DF1A 3TN4A 4ATWA 1UD6A 1W56A 3QPYA 1S46A 3BG3A 2DQXA 2ZA2A 3E1F1 2V5BA 5AYZA 5EBUA 4I8YA 4W9TA 3THQA 1R6WA 1JFXA 3VKJA 5G1MA 3A13A 4QE4A 2EPMX 4H8NA 2J62A 2NUWA 1B5TA 3OBKA 5CJ5A 1IE7C 1DOSA 3CBWA 4R7OA 4XX6A 3KBMA 3W7LA 3SECA 4AF0B 1TA3B 3I3EA 1SGJA 1EUNA 3AXXA 3VYLA 1QTWA 5HOSA 4ZQRA 1BGGA 3ZVIA 4J1OA 4CNOA 1VFHA 5EL1A 5FEWA 2R6OA 2WW5A 3UZ5A 1N2VA 2NSXA 4NJGA 3QQ0A 2QCHA 1EP3A 1W31A 4AXKA 4Z17A 3QJAA 1G01A 4FR1A 5JBDA 1HNYA 2OLHA 1S2WA 1UWIA 3CMGA 2V9DA 3AJ7A 2LLEA 3CZJA 3VIMA 4WY0F 3DFPA 3JVAA 3ARUA 4GZIA 5D2XA 3O0KA 1XDJA 4YXGA 5J8LA 2A6NA 2O9PA 4TX6A 3ZYZA 1DIDA 3BXWA 4AZ6A 4K37A 4Y8EA 1ZP3A 3PZIA 4HMCA 3SCRA 3OW1A 4AZCA 3T2PA 1QR7A 1OIFA 4MTVA 3VD7A 1PZ3A 2PGWA 3S3GA 5CJMA 1P7TB 1W3HA 2WCAA 1ZCCA 3CMJA 3K8LA 4HTBA 3AMCA 2QVHA 1NWSA 1G7VA 1P4CA 1OK6A 7ENLA 1FWHC 4ZE4A 4PMRA 3L7RA 1GKQA 3M7WA 3HQPA 3PJTA 1V6UA 1ZY9A 4M6UA 2OPJA 3AJXA 4EKJA 3CT2A 2QDHA 3Q4DA 2ZWYA 2GWGA 3GG7A 4E2DA 2Y7EA 3WDJA 1C9DA 2WZTA 2YL9A 2F61A 4ML4A 1YEYA 2OCZA 2PCQA 3KOWA 1H61A 4QIUA 2QDEA 4FHAA 1R3VA 3M0LA 2HV5A 4AG0A 4XBJA 3VIFA 1PS9A 2QS8A 3WIJA 1CW2A 1XRVA 3DOPA 2ZRYA 2PTYA 4NRSA 3W7DA 1M1BA 1K8YA 5A6LA 4GYKA 2J7BA 1GT8A 4AXNA 4UTLA 4BKNA 2PDBA 4J3XA 3THDA 2R24A 4QG6A 1WUEA 2QUNA 1WQ5A 5E70A 4XZLX 1YTKA 2PGRA 4O0KA 2F6UA 1ONRA 1XDLA 3BW4A 3FGCA 1VS1A 3S1XA 3VOHA 4KMQA 3BDKA 3ZLGA 3M6YA 1ZHAA 2FTWA 3TFCA 4H9VA 1XS2A 3OG2A 4ML9A 2YCLB 3GTIA 4PE8A 1QUMA 3W37A 1S1RA 5HNTA 3F1QA 3EKZA 4QAWA 1VBGA 2YW4A 2JEQA 1FWSA 3W23A 1BWVA 4FLRA 3CAWA 1GVOA 2CXGA 3D5HA 4C6CA 2DUAA 3ALGA 3TQKA 5CZJA 3W72A 3MJYA 1F2JA 5BWAA 2WZHA 4L4OA 1YKWA 4UFJA 3WEMA 1P1XA 2E9BA 4YWSA 2QJJA 4HU4A 4XWUA 1R9ZA 2WVVB 2XGBA 1OYBA 3GIPA 4E3TA 4IOTA 4ZFCA 2QLYA 1L6FA 4ONVA 4ZOAA 4H8HA 3WQWA 2YZRA 4D6HA 3C0QA 4O52A 3SR7A 3CWOX 5A6TC 2VENA 3NXFA 2EJAA 3QGAC 2WSYA 1ISZA 4GZ7A 4GIAA 1QXLA 1UPPA 4DZIA 2FPVA 2I9EA 1CGYA 3P8IA 4MNMA 4IP5A 2CITA 2VFGA 4LFYA 1GG1A 4A29A 5BOFA 3KP1A 1E55A 2IUZA 1XL9A 2BSLA 4C91A 2J77A 3CMFA 3WNMA 4O1DA 1O5KA 3DIPA 5HUPA 3WDRA 1BRLB 4Y9PA 3NPUA 1JUEA 3G5EA 3R79A 1W9PA 3N14A 2Y8UA 4DUOA 1LYXA 1NELA 1JXKA 4RCXA 2CZFA 1R5YA 1ZJHA 3STPA 4IJCA 2ESCA 2X41A 1XFBA 5FL1A 3P14A 2ZE0A 1TZ9A 4EWJA 2J9ZA 3I6RA 1SJBA 3SO7A 3VDGA 2YL6A 4NAFA 1W1ZA 2BXYA 2ZA3A 6A3HA 3GE7A 5I3DA 1IT0A 3EB2A 1E51A 5H8UA 4AZ5A 1KRAC 4GVGA 3H7RA 3MV01 1V6WA 1V79A 2Z1VA 1ZB5A 1W54A 5FJJA 1ZP4A 3NL5A 3QYSA 3NYDA 2FZBA 5IOBA 4LNYA 5FJTA 3MO7A 3KX6A 3RXZA 4NG3A 4FEZA 1ML1A 3A4WA 4ZOBA 4K1GA 4K1WA 4FOUA 4PTNA 3KTSA 3RM9A 4US6A 1DQUA 1OABA 1XSIA 3IGUA 3NPWA 1TTJA 3L5AA 4LAKA 3WK1A 4NZ5A 3CQJA 1Y5WA 1L6GA 5D02A 1JD7A 4JQ1A 3BQ6A 2OSXA 1W8GA 1HG3A 3VINA 2X1TA 3TN6A 1R7AA 2YCKX 3FJNA 4C60A 3R2GA 1BKHA 1XSJA 3HBLA 2RHGA 4ZTXA 2ZX6A 1JIBA 3Q65A 4J3SA 1A5UA 3TW6A 1V02A 3E0WA 3GX9A 2HPMA 1PUDA 1DTNA 3VKDA 3HPSA 1U2YA 1ECEA 1HGYA 2PTDA 2XFWA 3PZMA 1ZTVA 4PH6A 3P8JA 3RRXA 2XZ7A 3BSGA 4HNUA 4IQJA 4B4FA 2J6VA 4I3GA 3W7MA 3TYDA 3DFOA 5E0CA 1OZMA 1IEVA 2BV9A 5XIMA 5FCZA 3ERPA 2OGYA 3C2RA 2ZBTA 3I7SA 3EZ4A 1MI3A 2DGAA 3WLJA 1LOLA 1KFJA 3TROA 2GQAA 3WK0A 1QAPA 1GVIA 5H8MA 2JGYA 3TQ0A 1M9HA 3MKCA 1AFSA 1A5CA 4W89A 4XZMX 1A3HA 1OCJA 2AL1A 4CQAA 3Q45A 1IWBA 4EAYA 4DI9A 1OCNA 1EH9A 1LRTA 3I4KA 4TOQA 6PTDA 3WD0A 4WQ6A 3IGXA 1NDZA 3U7VA 1NWUA 3QEZA 3C6CA 5K3VA 1GJPA 2ADAA 3FA5A 5CLTA 1ZFJA 2GQ9A 2IKJA 2CZEA 1ZBCA 5M17A 3RILA 5CGTA 4YCOA 3BPWA 1UH3A 1YDOA 3ABZA 2Y85A 5I06A 2CLHA 6XIMA 2I7GA 4PTXA 3BCDA 2E6YA 4R33A 3VFLA 4UTTA 1FWGC 3R8HA 5BXRA 3NM3A 5G1YA 1XLEA 2PDWA 1REQB 1L2QA 4Q7IA 4HIBA 3MCNA 5C9RA 1CLKA 1YNYA 5EB8A 2TPSA 2VEPA 3OHIA 3UZJA 1R30A 3OYXA 1DJQA 2XG9A 5HMSA 2CWNA 1MRAA 4PFMA 1K9DA 4JKKA 3NQ7A 3SGUA 5EFDA 4QFUA 3OGRA 3BG5A 1HL9A 1UQYA 4C6IA 2Q8LA 5BOEA 3R8RA 4OVXA 1WDWA 2HSAA 2UBPC 2CYGA 3HN3A 4A2RA 4HT3A 3MHUA 2UV8G 1QK2A 3LK6A 4WJEA 2OYMA 1FP8A 2V8ZA 1KWGA 5D8WA 1BEUA 1QPQA 3QR3A 2C1HA 4IMCA 1JYXA 1CXKA 4GXWA 1Q7MA 1W3KA 2J7HA 1DYSA 3XINA 1QW8A 4A3UA 1VCFA 2VURA 1X8FA 3S47A 2WCSA 3HF3A 2VEFA 5M03A 4HPGA 3QBUA 3WLSA 3WLOA 1F73A 3URAA 1U5VA 2ZUMA 5BXTA 1UB3A 1NF7A 3VGGA 2DZAA 3PB2A 3VKBA 4HSNA 1SSGA 3BW2A 4HK7A 4KRUA 4QQ3A 4DJDD 1OGBA 3H2CA 4PCSA 4IXHA 3N4AA 4QLLA 3M5YA 2E6DA 2P10A 3W73A 3W1RA 4PL1A 3DC8A 3PWAA 1UKQA 5FSEC 3VZXA 3L4UA 5D04C 2V0TA 3N18A 2DT2A 3ZJ6A 3OJGA 1VHNA 3V16A 4DF2A 3LQLA 3TV8A 1E0WA 1NFBA 2E6AA 3L12A 3VMNA 3VX0A 4NYYA 5BROA 1IXQA 3S5SA 1IXNA 2PA6A 4GABA 2PGEA 1US3A 5CPQA 2O9TA 4DLFA 1B4KA 1C9WA 1H62A 1N8FA 4UTTC 4QSHA 3EXTA 2PWUA 4QG9A 3M41A 1S2UA 4DAFA 3U57A 1JPIA 3FEMA 4IG2A 4P8UA 2OB3A 4JHOA 1JVNA 2QJMA 4TV6A 4DYKA 3WUFA 4UTKA 1ELSA 3TJXA 3M43A 1NP0A 1MQPA 5IHRA 3PBWA 1EBHA 4LBRA 3C56A 3QZAA 8A3HA 2DVTA 4JTRA 4NUWA 1UR1A 2QT3A 4MFDA 4BF7A 1FDZA 1Z7AA 2HE5A 1J0JA 1P0BA 2ZZ7A 1EX1A 3IPWA 3AYSA 3H53A 3TWBA 3HV8A 1VFFA 4YIWA 4ILSA 4KS0A 3R43A 5D8ZA 7TAAA 4IL0A 5FJUA 1LLWA 2QDDA 4YTTA 1FKWA 4HPXA 3EOUA 1SFJA 3HPXA 4MVAA 3VIOA 5T8GA 1DQXA 2BWGA 1F3XA 2BNJA 2NXHA 3PSVA 1E0XA 1LUCA 4QE1A 4A3YA 3G1RA 3AMLA 1UIPA 1TZ7A 4U31A 1OYCA 2KX9A 4UFIA 1Z3NA 4J3ZA 1Q63A 3NZGA 2E5CA 4GQ0A 4F48A 3ZVHA 2PU1A 1XIEA 1BXCA 3ZSTA 1QT1A 4HTYA 3SRDA 3CEUA 4IZGA 1UA3A 5I02A 3SJNA 3B9EA 3T1GA 2Z2AA 3B8WA 5AC7A 2V69A 2FGBA 4PN2A 3WJXA 5HMDA 3VNZA 3N12A 3VKKA 3VIGA 1CB7B 1TPWA 3NO1A 1S5TA 1OQFA 1PCKA 4XSLA 2XZ9A 2WVSA 3NZ1A 3IRSA 1O1HA 1BYCA 4XZNX 1RY8A 1A49A 4EK7A 1DPMA 1JDCA 4M8UA 3O2LA 3RX2A 1KD0A 3GDMA 1NWRA 1VEMA 1XPGA 1MXDA 3FW6A 1XDMA 1L8PA 3PR2A 4KEUA 1BKSA 4NY2A 3WLTA 5I0DA 4BQ3A 1R47A 4H19A 3IJ6A 2EKCA 2ZUSA 2QJHA 5DMYA 4LQ1A 3A4JA 1ZALA 4O17A 2J7CA 1RLCL 3DYMA 1EA0A 4KESA 3SCSA 1CPUA 4ZFMA 3LZ5A 1TZZA 4HMDA 1JULA 3BG9A 1QFEA 1EPXA 5E9AA 4RR4A 1V0NA 2G4JA 1MXSA 1EO7A 4NAEA 3RX3A 1TX0A 3LXCA 1U1JA 4YN5A 1BYAA 1QPNA 3CL6A 2Z24A 4GKTA 1PXGA 2WNNA 2BY2A 3EMCA 2J8TA 3AZRA 2NX9A 2X7WA 4S3CA 1LM1A 1K9FA 3GH4A 3VTRA 2JF6A 3EBVA 4B5SA 2CZDA 2XIQA 3GKFA 4WZHA 4AW7A 2WQDA 3LCLA 4U5IA 4DXKA 9XIAA 3MUIA 3IACA 1E5JA 1DJXA 3VDCA 3GB6A 3R7MA 2NSOA 3CHEA 4D71A 2WJEA 1BXNA 3K8MA 1C3FA 5TF0A 2DJXA 4HPHA 4M24A 3G6MA 5LIYX 1F05A 2ZX5A 3GNXA 3LSCA 1QPRA 5KMYA 2A2IA 4FPSA 2VFFA 3AUOA 4NKCA 3MDUA 3EDEA 3WQ6A 3L9CA 3U5YA 1KM0A 1YPIA 3KOFA 2DW7A 4ZL1A 5C2XA 2E09A 2VXNA 2I17A 3LCGA 1AH4A 3D0CA 4OJYA 3WQGA 3WJYA 3TN5A 3VOCA 2INZA 4ACZA 4ROPA 4JTGA 3P6LA 1K9TA 1CDGA 4LUYA 2PC4A 3KCOA 4WHBA 4LAZA 4OU1A 3VD9A 2BMBA 3KBVA 3IS4A 2Y7GA 2E1WA 4GIRA 4O18A 1OX5A 3THAA 4AEFA 3G0SA 2V6AA 1Q6FA 3KTCA 2ZKMX 2NT1A 2XHYA 3XIMA 1C7TA 4IMDA 4GI6A 2PP0A 5LIKX 1F4AA 1AZ1A 2A79A 1RPKA 3A4AA 1A5MC 1H41A 2FHFA 1OBAA 2D73A 4BJHA 4R85A 2B81A 4AZCB 4Q32A 3ITGA 2PUZA 1THFD 2ALRA 4EIVA 4NRRA 4M82A 1LBLA 1Y7VA 2TAAA 3WJZA 4IFKB 4YTRA 5CPNA 3GZ3A 3D3AA 1CGWA 1QNPA 3NQBA 1L6SA 5CSRA 1FHDA 1UOZA 1UR8A 3TA6A 5GNXA 4CLMA 4HKPA 3N9SA 5FD0A 2ZWZA 1EXBA 4HPJA 1P5BA 1POKA 4CD5A 1ISWA 2CC0A 1TYGA 1POJA 4RNHA 2VR4A 2GJXB 2VEGA 3C0JA 2VC6A 4WVXA 3TW7A 5E5CA 3S9YA 5CBJA 1SO4A 4UC5A 3LA4A 1S3TC 2E9LA 4MNKA 3UBPC 1RJRA 2O0TA 2GGJA 1IXPA 1I2QA 5CCZA 1H1ZA 4AX6A 3PC0A 5ABHA 2OODA 5DLCA 2NW0A 4MAZA 2G3JA 2F7FA 1PBGA 3GXIA 3S1VA 1YQ2A 3ZXWA 1GHRA 1Q6OA 3AWNA 1O5XA 3OA3A 1W1YA 4ZQPA 4QXIA 1W5QA 3KE0A 4RDZA 5LXEA 5AZ1A 4WKHA 3K4WA 3MWAA 2XFRA 1X96A 3GU2A 2QUMA 1OM0A 8XIMA 2GDVA 4IQEA 5GPRA 3AXKA 1DTUA 1DHPA 1V6YA 4A05A 3F2BA 3P0XA 3PANA 3SN0A 5F4WA 2JE8A 1JGMA 1CGTA 1F6PA 1FHUA 3VD4A 1KA9F 1KTCA 3ELFA 3H4GA 3WH7A 3N19B 3BUVA 1JQXA 4C6PA 3KM8A 1WOBA 1U1UA 2QDGA 4QISA 2XIOA 1YNPA 3M5ZA 4KWVA 2OFJA 3KBWA 3ABSA 3UGRA 2NV1A 1T7LA 3WD1A 1ESWA 1UR3M 1EPVA 5HPOA 2HMCA 1XG4A 3BVJA 3MSGA 5B7YA 1UPMB 4YTUA 2VZVA 3T2OA 5IDIA 4DWSB 2WZIA 3U9IA 1HJUA 3EYPA 3R89A 4YL2A 1XYFA 4W93A 1W1IE 3ENLA 1AVAA 4JTIA 3AQUA 4P7NA 1ITQA 4AHOA 3A9IA 3TAOA 2X42A 2J4GA 1MW2A 3TMQA 2OSYA 5C0QA 1QI4A 3WNKA 3H22A 3LEPA 2Q71A 1XIGA 4HN8A 4YPJA 4JTKA 4JKMA 2WK2A 3KL3A 4DQWA 1AJ0A 1PDYA 4YVPA 3E6EA 1XRSA 3L4WA 3RRAA 3TQPA 3V75A 3EX4A 3G18A 4GINA 3Q94A 4LTSA 4CCDA 5JVLA 4NI3A 4FK9A 1KM6A 1JNDA 4UIOA 4TO8A 3KRZA 1L8NA 4IUOA 2DP3A 3OYZA 4FAMA 3IUIA 2A1YA 4MB4A 3COTA 2NUYA 2OR2A 2DH3A 4XD6A 3ES8A 4W7UA 2O9OA 1BTMA 3CPRA 2RGMA 4NAFB 4G1KA 5A5WA 2PWEA 4D6CA 2XN2A 4UUIA 4PMUA 2W66A 4O11A 4ATLA 3WQDA 3G3DA 1BYDA 4HMNA 3GRIA 1EJWC 5FF7A 4PMVA 4KPLA 5I3HA 2VP8A 4UQ9A 3L5LA 4JX4A 3NQ6A 3HQ1A 4Z1BA 4CNSA 4X3ZA 3C5QA 4FOKA 3D47A 1XLIA 2B7NA 4YS1A 4IL2A 4PSRA 3TJIA 1OC6A 3VA8A 1Q5MA 1YRRA 3NA8A 4RKAA 2WXDM 4Y9OA 3G1AA 4CNUA 2YCEA 2JFEX 3W6LA 5BOOA 3L5MA 3STCA 4O10A 4H41A 2OU4A 1R2SA 3GVRA 3T0AA 4F4RA 3L4XA 2J74A 3LN3A 3R6IA 3L0NA 4BQ4A 1UR4A 3T44A 1OYAA 4Y9AA 2PLCA 3CH9A 5FEPA 1I2PA 4XBKA 2HRWA 2R9RA 3F2DA 2OWXA 4J5NA 1HL2A 4E4UA 3QSTA 2TMDA 4H7ZA 2NUXA 3SCOA 2D2OA 2QMJA 2PWHA 1WYIA 3N4EA 4NJKA 1X7FA 2ZUWA 1O7AA 3QH2A 1XHGA 3GDRA 5AZ0A 3ARXA 3QHNA 3WK2A 4FXRA 4UR7A 4LAOA 1JPDX 3ITTA 1JCXA 3N6HA 1BD0A 1MQQA 2XINA 3E0VA 2W62A 1RK6A 3EMQA 3CUZA 5M2FX 1W3IA 1Y5XA 5DFAA 1J2WA 4GYJA 4HJWA 1OF6A 4JN6A 2RAGA 1XLGA 3OB8A 4KCUA 3V1HA 4AIBA 4N4PA 4BWLA 4QGCA 1FFRA 1XISA 1UR2A 3IJQA 3BTNA 3S5YA 3T0BA 1E15A 3CTTA 3TZNA 4N9EA 1SFLA 5K7JA 3VMOA 4LXFA 1UR0A 2GVYA 2QVNA 3R0DA 3QV7A 3SM0A 1NFGA 2VC5A 4GISA 5LNVA 2Y8VA 4NJIA 3LMYA 3GU1A 4OBRA 4IJRA 3N13A 2NXGA 4J4KA 4WIWA 4QS5A 1I60A 1O66A 3HV9A 1HT6A 3GTFA 1YW1A 4PTDA 3NDYA 3TYBA 1M04A 2WSQA 4ICMA 5T91A 5DBUA 1FFQA 4H6QA 3K1DA 2PAJA 5C55A 4AWSA 5I00A 1OFQA 1H7WA 1US0A 3T40A 4KF1A 3FJLA 1F76A 4QX4A 4AVFA 4UTJA 2CKSA 4TX9A 4EXBA 4XVDA 2R91A 3O0FA 4B2DA 1ZAHA 5DRIA 2V82A 3TVAA 2CERA 4JFUA 1HVXA 3WFLA 4KIEA 3G3MA 2XSBA 2Q02A 2QCLA 4HCDA 1LLZA 1EUAA 1W3LA 4XAZA 3BLLA 4U3AA 2JKPA 4LVFA 2VZOA 5GQBA 1IEWA 5D9OA 1DXIA 1OGSA 3B97A 4HHPA 2PZNA 3OVGA 1F61A 5M3WA 1H4PA 3TTOA 4TVUA 1N82A 1RBOB 2VKZG 3IGHX 1UJQA 1G0CA 4UNIA 1A80A 3GXPA 2BHYA 1ZJAA 1LL7A 2VRJA 4MPQA 1IZJA 4BF5A 1KR0A 3IARA 3AYVA 1TJ2A 3AWOA 4HZ7A 4ZO7A 1UWQA 1V02E 3F03K 2H3DA 4QG8A 3GFYA 2WO5A 4H2CA 2ACRA 3CQ0A 4GJJA 3LM3A 4BWLC 3B9DA 1JCJA 1KM3A 3CPGA 3FJ4A 1EJRC 3QYQA 4C5YA 3B0YA 1DJIA 4RNIA 2ATMA 5C71A 1JPMA 5AVHA 1ZZMA 1RBAA 3UA3A 3GVQA 3IRDA 4HVXA 2IKGA 3RM4A 3ANUA 3R5EA 4MKVA 2CHOA 3HJZA 2G97A 3LX9A 3EA2A 6ALDA 3IGSA 5DCBA 3P62A 1CXEA 4UTHA 3CO4A 4K38A 3LUTA 3BV4A 2ZC8A 1WNOA 5FAJA 4BI6A 5G5IA 1LZOA 3FCPA 4UQCA 1LOSA 4C5ZA 3IJ8A 4BZYA 1W3NA 1H0GA 3G22A 1QI3A 2INFA 2HVNA 1YE4A 1KV5A 4PMNA 2IS7A 3M0JA 3OA5A 4LNCA 4YHGA 1WKEA 4XZIA 4LUTB 3LSBA 1IZKA 4Q6JA 1C29A 1OX6A 2GVGA 3DXIA 5IRPA 1R9YA 3O9NA 4HOWA 1FWNA 3G1VA 4KRZA 4L4PA 1VPXA 1EDGA 2MANA 1JUKA 1FH8A 1MW3A 3I68A 1JZ3A 1GPFA 3WJSA 3UWZA 2VELA 1ME8A 4GE8A 3TC7A 1XGDA 3M0MA 1Q7ZA 3UYCA 1BYBA 1J18A 2VRKA 1S1PA 3PPHA 4QROA 1FTXA 1FHVA 1HZYA 1EZWA 2QF7A 3LI1A 3N3TA 1FX6A 3MMDA 2BB0A 1XLFA 1NQ6A 4Z42C 2AL2A 3EEGA 3EX2A 1LUCB 3B9AA 2GOKA 2W91A 1GOMA 2FJKA 1WXZA 2YX0A 4ERGA 4PRTA 4FXJA 5DXYA 2PODA 3ZVHB 1SW3A 3NQ2A 3VI2A 1TVNA 3SUUA 1GNXA 3F4CA 4PBGA 1BGAA 3WL0A 3QLDA 1X6UA 2FH8A 1XKJA 3KBJA 2WHJA 5KTLA 4PUMA 4AZHA 4I9JA 3AZSA 1EX5A 3PPGA 1K3UA 1GGOA 2X7VA 3BAIA 4K8HA 2OVLA 4J3VA 5EMJA 3KCLA 4GXPA 5A6KA 3PJWA 4JQAA 3O1NA 3IAQA 3NQGA 4TX8A 4C6OA 2HS6A 1PTDA 3N34A 2PZ0A 5LA2A 3O6YX 2E3ZA 5A6JA 1V51A 4KWSA 3PWIA 1IXOA 1OT1A 3ZOAA 2CWXA 2BGNE 1HGWA 1WKYA 4NXKA 4ENLA 4HA0A 1VZWA 3T09A 2CZ5A 4P7RA 4AEOA 4ZGYA 1AW2A 4WGXA 2Q3RA 3A9BA 5F2MA 4J28A 5FACA 4XB3A 5EMUA 3P61A 3GYEA 1VGAA 1DWAM 4QBXA 1UIOA 1UKOA 1VHCA 4HA4A 3BLKA 2BVYA 3GS6A 2GK1A 2PU0A 1CECA 4RX0A 1L0PA 3OIHA 1W5NA 2QEZA 3FDKA 3QOKA 3UVAA 2O55A 4L65A 5DX7A 5D03A 4ZSUA 4RZ5A 4L6DA 1ISYA 3QY6A 4D8ZA 1PX4A 4Q8PA 4Z2IA 3M5XA 4ICCX 4IM4A 3AFBA 1HFBA 1XYZA 1YPXA 3V5CA 3BV7A 1Q66A 1W2VA 1XQKA 3QLLA 4HPNA 5REQA 4D8AA 1TELA 3H6OA 3SCWA 1T5AA 1TCMA 3UT0A 2GSJA 3TOYA 2F9RA 2G3FA 3BL3A 1Z32X 3FKKA 2GVJA 4I5UA 5U4NA 1UKPA 1X6NA 1SFTA 3E38A 4ZODA 5FOOA 4NASA 1I45A 1E1EA 3PZGA 4S2BA 4RL3A 1C91A 4MY8A 1HKVA 4DLMA 5FJOA 4N9CA 3EMZA 1PZ1A 2WLZA 1Q6QA 5IBXA 1MZHA 1XV8A 3G1SA 3E0IA 4QP0A 2C14A 4Q8TA 1JJKA 4Z2GA 2VOMA 3MUY1 4PBFA 4O53A 4TR9A 5CPTA 5ECVA 2ZTJA 2DSKA 3PFMA 3E2QA 1TMQA 4OZOA 4WOQA 1ONXA 2Z6JA 4G8TA 4EPEC 1R46A 3GUGA 2QGYA 1VF8A 1UD3A 3CQHA 4AVOA 5I77A 4MZYA 4Q4MA 4QJ3B 4K6AA 4G1NA 3WL1A 1GOXA 2OO0A 3N2CA 4RXFA 1E9ZB 3CZGA 1NQKA 2Y5JA 1LP6A 3ZLFA 1R7OA 2AAMA 2FMNA 1OVDA 1QPKA 1J8VA 4B5WA 3GXMA 3N3MA 2Z29A 1IIGA 3DBNA 1EGZA 1JYWA 3WLKX 1LQAA 2FVMA 3AALA 4URIA 1ZSXA 3WUGA 3DFNA 3TC3A 4C90A 2WM0A 2P1FA 4R9OA 3C0SA 2YDQA 2QQ6A 2VEMA 1OWQA 2H8XA 3VNIA 3HPAA 4QDMA 4WSHA 3MB9A 1OK4A 4WXZA 1OFRA 1Q65A 5CC3A 1D2KA 4PUNA 1TWSA 4Q8NA 5EY5A 4KIRA 3N9RA 4DO7A 2FZNA 3UZYA 4JQ2A 5DN1A 3BZGA 3EWXA 4GVFA 1KRBC 3WQOA 1ISXA 3IEBA 5SWUA 3V36A 1XD0A 3W7IA 2CBIA 3L4ZA 2JIEA 1TVPA 1VB9A 4KFOA 4JFTA 5AHFA 1W3JA 4I5RA 3HO8A 1EA9C 1KFBA 5JIPA 4FP1A 4DYJA 3U0HA 5A6BA 1WDQA 1P7TA 2CBVA 1CWYA 2WBKA 3H2FA 3WBXA 4GFIA 4P2VA 2UY5A 3ZSSA 4DBUA 3BO9A 2BLEA 4AC1X 3LXBA 1F74A 3W2LA 3VOGA 5DANA 3A5VA 3P82A 1FCBA 3B8SA 4O1AA 2E0PA 4Y90A 4K39A 3RIKA 2E77A 1Z42A 1GYLA 4B16A 3UWUA 4LYQA 4BFAA 1L9WA 2WJZA 2E67A 2TRSA 1XCXA 1JI2A 3BZJA 4QS6A 3BGGA 2PDCA 2QIIA 2ZC1A 2WCGA 1R3RA 1CGXA 5BMWA 4XQ6A 1DJYA 6REQA 4V28A 3UPMA 3W1PA 3HTWA 5FSDC 5AHNA 1OIMA 3W7QA 1KM4A 4XUYA 1H7RA 4KRTA 3ISIX 2ZUTA 4CQCA 4R5EA 3O15A 3QRHA 2OLAA 2QPUA 3WD4A 4I8DA 1YADA 7CGTA 4CQ9A 3ARVA 3S83A 2XIMA 1E3ZA 1SFSA 3CH0A 4ERAA 4W8BA 4AAJA 1KRMA 2WSKA 1TMHA 2OSWA 1JAEA 3FVMA 3M5VA 2DT1A 4LRSA 3RPDA 1H50A 2Q8ZA 3LYEA 3AYRA 3GHSA 1WZMA 3AIEA 1OJXA 5A8PA 5EMMA 4Q8WA 4P5UA 3W83A 2KAUC 3NQVA 2CEQA 1JYNA 1K8XA 4EP8C 1BG9A 4B3LA 1UBPC 3VNYA 2VNCA 1S2TA 3C86A 1BQCA 1SPQA 3B8UA 4O8RA 5TAOA 1FHLA 3PJUA 3FYOA 4MJ2A 1FY6A 2JK2A 3BSMA 3W7NA 5EMKA 3KBNA 1FH7A 3M1ZA 3PZVA 3OPSA 2C3ZA 4BQ2A 3GDBA 1ZBKA 5D2VA 4DXXA 3GXTA 3BWWA 2JBMA 3KDOA 4JTUA 4RDVA 1LWJA 3G1DA 1R2TA 2WAGA 3LPPA 4DNHA 3V5OA 2WNQA 4RE2A 1OFDA 2X16A 1O12A 1XRTA 3UW6A 1KBBA 2D23A 3DFTA 2E9MA 1KTBA 4JN7A 3CGTA 1R3QA 4KETA 1XXXA 3O8AA 2HNHA 3UXKA 1HKMA 4JTQA 1R3YA 4N02A 3QHMA 2XSAA 4YVXA 5H2ZA 2PP1A 2HROA 5JUVA 4LCRA 4RJEA 2C91A 4NP7A 1TVLA 4OTKA 1VIWA 2C7FA 1NWTA 2ZDRA 3AIRA 3CWHA 4QJ1A 5TD4A 3NGFA 3P5ZA 4B3ZA 3KCJA 1BRLA 2QNEA 4MZ8A 1X1NA 5DMMA 5EPDA 2J25A 2NT0A 2NX1A 3DI0A 3RU6A 2QCGA 1HX0A 4JIIX 1UP3A 5I3JA 3DG3A 4WSJA 2RFGA 3ORWA 1ZU8A 4AX7A 1ITCA 1GPWA 1KXTA 3BAYA 1LJYA 3P3BA 4DZHA 5LNUA 3WMLA 2J88A 1O60A 3N6QA 2HBVA 3W2NA 4M80A 3W00A 4U2ZA 1QK0A 2YA2A 2CETA 1HXJA 5FJPA 1VFTA 3U2OA 1LROA 1E0TA 1JNEA 2FPYA 3P84A 1U1HA 1ME7A 3PZNA 4HU0A 4E5TA 5KETA 3SDOA 3N25A 1TTPA 1E0VA 2ACUA 4GI8A 4HSOA 3G1HA 5DRCA 3SB0A 1LF1A 1S5VA 3VU2A 1A3WA 1KLYA 2J6XA 5C9UA 1B57A 3WQVA 3SCQA 3B8TA 5F1VA 3H55A 5H1WA 1B30A 4LPCA 4WK9A 3T9PA 3OZYA 4JDBA 3KVKA 3STFA 3LOTA 4J3WA 1NEYA 3FA3A 3U5UA 3OHMB 4JTEA 2ZUVA 3VC5A 1WA3A 1E4NA 3LTPA 1SSDA 1AH0A 5HJLA 5MHBA 3FYPA 2H6RA 4NZ4A 5HINA 2W4XA 1C8QA 3CWNA 4IP7A 3VPLA 5LIWX 4MGGA 1PZ0A 1MUMA 4H00A 1XIDA 3TZFA 2BASA 1HP4A 3SUWA 3GD6A 5CGQA 2REQA 1EJVC 2WZMA 3LBOA 4J7RA 1BAGA 2FPTA 4L1WA 1V0LA 4JX5A 5A69A 3DGBA 1W5MA 2CLIA 4XAFA 5C70A 3CEPA 1GTEA 1PO9A 1RP9A 3WD2A 4AY7A 1CI1A 3NQEA 1R8LA 4MWAA 3EWDA 2BBFA 3G8RA 3NYZA 3GC4A 3GH7A 1CYGA 3RCNA 1OC7A 1VLIA 3NUKA 2YPIA 4LY4A 1KW1A 3DUGA 1FWEC 1NSJA 5CBBA 1QHOA 5CC6A 4EE9A 2ZZ2A 1A4LA 1KCXA 4UQBA 1ICQA 2GJRA 4ECLA 2WWCA 4LX4A 3C3UA 3CZLA 4FB7A 5CPOA 1B3WA 1GHSA 3GLCA 2V5CA 5KINA 1DE5A 1MQRA 1MDRA 1T8XA 2J24A 3VVGA 4KWOA 3T6CA 5I24A 3M0ZA 3UZXA 2FTYA 1KXQA 2E5DA 2FFCA 2OOFA 3R94A 3UCQA 3BH4A 3GR8A 2O4QA 2Z1KA 4GXMA 4L6HA 4CU8A 1D3GA 3BAJA 3BLPX 3WBAA 5LZLA 3LD5A 1JCYA 3RDKA 3DG6A 1UJPA 5T9CE 1CXHA 3FFSA 3OGSA 2Q01A 1S2AA 2V2CA 1QI2A 1JF5A 1XUUA 1I4NA 4J3UA 4RZ4A 5B7ZA 3C0LA 3W0KA 3LZ3A 1UZHA 5CC5A 1JD9A 3W3OA 2R94A 4GOAA 2FLIA 3T8LA 1E1FA 5A8OA 1ECQA 1TV4A 3P2VA 3KAOA 4B5UA 1KCZA 2RJGA 3EOLA 3TYAA 1Q8AA 2FQIA 3VE7A 3U48A 4K7YA 1UH2A 3NSNA 3STEA 1KQZA 1C7SA 3CYJA 4W87A 1M68A 2PE4A 4CD4A 2X05A 1IWAA 1XGEA 4BHYA 1M7XA 1TUFA 3CTLA 2FHCA 3ID7A 3H24A 2QUVA 2FGLA 1GKRA 2A0NA 2PRMA 4L9XA 4HYRA 5AECA 2G3IA 5C2CA 1GVYA 2VQTA 1JCMP 2A5HA 4ZXOA 4Z1CA 3WLPA 3OLIA 3BJSA 3W1LA 2XWDA 3QFWA 3W2JA 2C18A 2P76A 3KEHA 3WLQA 1DWGM 3KHJA 4IH3A 2OLSA 4A3QA 1JXJA 4CD7A 1KM5A 3SBFA 5DMNA 1E70M 5HANA 5AC5A 4H9UA 1QBAA 3KTXA 4DO4A 3O6DA 2X09A 4F9DA 4HNNA 5HMFA 1UROA 4QJ5B 3A23A 3LS9A 4NU7A 1LL4A 3W85A 3T08A 3HGSA 4OBTA 1KB3A 1LQ0A 1UOKA 4CU6A 3WH9A 3S9IA 5HR7A 3R25A 2XJ7A 4C1LA 1B9ZA 3U7BA 4FMVA 4JS3A 3OEXA 4JNMA 4UQAA 2ZRUA 5DT5A 1SZEA 5A6MA 4G2DA 4QRNA 3UF9A 5HXMA 4Q8OA 2WB5A 1E6NA 4YHEA 5I09A 2PSNA 2Y70A 3PTKA 1E6SM 2HXUA 3B40A 4X9YA 1M53A 3U4AA 2OG9A 5D38A 1GQLA 1QMLA 4NZFA 3QHOA 2Y7DA 1IGSA 1EGMA 2ZX7A 3CIVA 3EXRA 1XYMA 3VM7A 3HPZA 3OGVA 5CXPA 3QZ6A 4I9AA 3PUOA 1CXIA 1XH1A 2OKOA 4GY0A 1FBAA 4B5VA 4PUDA 3S2JA 2WHKA 1RY0A 1FXQA 1VEOA 1G5AA 3S6TA 3GVVA 3WFZA 5AHIA 1J0YA 4F3HA 4HMEA 4QCFA 1XLLA 2A85A 1OF8A 3FNDA 2NQ5A 4N7QA 3STGA 5FIPA 3VO0A 2CZVA 3SCTA 4O0ZA 1XX1A 1GKPA 1HJQA 3GNDA 1D7KA 2AKMA 3KVLA 2G50A 1DHKA 1EFZA 2Y5SA 3L2IA 2AL2B 1ZCOA 3G1XA 2V5KA 3EWBX 4OHQA 3LCFA 3CUXA 3THCA 3P81A 4YLWA 4DWDA 4KBXA 4LYPA 4M7SA 2E6FA 1B3YA 3ITXA 1F3WA 1HJWA 4YTQA 3N2XA 4QTGA 3BLIA 2C1IA 4AD5A 2AMXA 3TR2A 4IISA 3UCDA 1SYTA 2Y63A 5GNYA 4UR8A 4Z08A 2Q6ZA 3M0YA 1ICSA 2HBXA 3RX4A 2ISFA 3S4TA 2OEMA 1JF6A 1RD5A 4UCFA 3DHDA 5CH9A 3HURA 2Z0IA 2BS9A 4O1FA 2HISA 4DBSA 2DIEA 4Z0SA 2PD5A 2P8BA 4C1KA 1PIIA 1TWIA 4UQEA 4B92A 3M46A 2OGJA 3M44A 5ABTA 1RZMA 2NWSA 3NZRA 3RO6A 4I5XA 1E1CA 2F6XA 1VBRA 2JEPA 4XVEA 3KS6A 4WSKA 3R0UA 2PTXA 4J2MA 2XIIA 2C13A 2OZ3A 5C5YA 5HWMA 4F66A 3F4VA 4MFEA 1G4SA 2PB1A 2OX1A 3MWCA 5D2YA 1PYMA 4ORIA 1TFVA 4C6DA 2G41A 3USZA 3GXDA 4RK8A 2GK1B 4DY1A 1J12A 4E2OA 3SRHA 2Z1XA 3MUZ1 1GOQA 5K9XA 4KT2A 4ZSTA 5KZ6A 3W2MA 5G4HC 5C9WA 1QU4A 2O92A 1PJ9A 1XC6A 3WQ4A 1GVQA 4GG9A 4ZXLA 5C8BB 4L9ZA 3NZQA 3NL2A 2OWWA 3EXSA 4RXGA 4HHHA 3ITLA 3E0FA 1J0KA 2A3CA 4EOUA 1UKSA 5CGMA 5LNSA 1LWIA 4LUJA 1BWLA 5REQB 2F2HA 1NU5A 3WUEA 1DQWA 5JQ9A 3SGGA 1O68A 5E9XA 3SCPA 1TV8A 1IT7A 4XIAA 3DC0A 1KO0A 1Q4WA 2AGKA 3RLUA 3BLFA 2XYLA 1G67A 2G95A 3KVJA 3DH7A 2EPOA 2X1UA 1EQPA 2DSZA 2P50A 1J5SA 1GWJA 4UFMA 1QNOA 5G2IA 5D32A 1YPFA 5FA5A 1F6KA 1KBIA 4G7EA 3EOSA 3BSHA