3TQ0A

Crystal structure of leishmania major dihydroorotate dehydrogenase in complex with fumarate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
SMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Crystal structure of dihydroorotate dehydrogenase from Leishmania major.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3tq0A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tq0A01
3CTLA 3W87A 2RH9A 4MY1A 3W7HA 1FQ0A 1LDCA 4HNTA 2WNNA 1L6WA 3CT7A 5G1TA 3F03K 2ZA2A 3R13A 4NJIA 5LGZA 5AFDA 4FNUA 1VQTA 1R47A 2Z2UA 1SR9A 1JRBA 2NWSA 2Y61A 5LZLA 1EEPA 3E96A 3SECA 1JCJA 4EF9A 3LHWA 3TSBA 1W56A 1KM1A 1K7FA 2VC6A 5AC6A 4U4MA 2IQTA 1WQ5A 2CW6A 3C2OA 3SGUA 3S5NA 4UFHA 1SSDA 4XKYB 4FO4A 4JTHA 3LXBA 2B4GA 5AN7A 3WJSA 3W7MA 4A22A 1G67A 5E0KA 2D73A 3VNDA 3DKJA 2Q3OA 3A5FA 2ABAA 1SO6A 4GC4A 4WOZA 5CSRA 5D02A 3TH6A 2FIQA 4GXMA 4NX5A 2VFEA 4UFLA 2FLIA 2Z1BA 1ZJIA 1TMHA 2C15A 4UNLA 4D2JA 3ATZA 3NZ1A 4HNUA 4RZ6A 5K9CA 4HN4A 1MSSA 1Q3NA 3LHZA 3EX6A 1B9BA 3NQGA 1D3HA 2QCFA 3W1NA 5D30A 1WV2A 1KTBA 5BOOA 5DBUA 3LHUA 3W7OA 3M0ZA 3QMRA 5KZEA 5G2WA 1KFBA 1MEWA 2QCDA 1U83A 5LSMA 5CPLA 3T4CA 4IX2A 4O11A 1HTIA 3GR7A 5EMUA 1LOQA 3SIZA 2JK2A 5LNWA 3TJLA 4K7VA 2GJNA 3HGJA 3JS3A 2QAFA 3P8JA 3LHYA 1GZGA 4O4VA 3G3DA 1GPWA 2V8ZA 3ELFA 3CLMA 3NQ2A 5IBXA 1YTDA 4AF0B 4GJ1A 3PC0A 4BF9A 3GX9A 4Y9AA 4GUJA 3P67A 4DXVA 4JGDA 1YDOA 1Z41A 3C6CA 5LKYA 4BR1A 3GXNA 3W9ZA 4E38A 3WK1A 4O15A 5E1QA 4O1DA 2G96A 1W3IA 4JEQA 3SI9A 1TTIA 2O7QA 3O6YX 5AHIA 4AHQA 5A5WA 4TR9A 2YX0A 3I68A 3W85A 4YWIA 4BFAA 2Q8LA 2QKFA 1ME7A 2R91A 3LI0A 1WA3A 1XBVA 1YXDA 3S1VA 1VRDA 4BI7A 2A7NA 2BX7A 1LTDA 2W6RA 5F4WA 1ZFJA 5LNSA 2X2GA 1AK5A 4HSOA 1YDVA 2NX1A 2QF7A 2A7RA 1HO1A 2Y85A 3IVUA 1U5JA 3LLFA 1WYIA 3W7PA 3DXIA 4JIPA 1EIXA 4PA8A 2BSLA 5BNKA 3THAA 3NAVA 2F84A 3L5LA 5AHNA 3TQ0A 3G18A 3THQA 3C61A 1D3GA 1F74A 4GUGA 3W1AA 3W73A 3G3MA 1HO4A 4AWUA 1N8FA 1RR2A 4NZFA 2Y88A 3MI6A 4O4WA 3CM4A 3UZ5A 4UMAA 1FWSA 3L0NA 2DORA 1SZFA 3NGJA 2ZZ2A 2GPTA 4K8EA 1EP3A 2CWNA 2YYTA 1R2TA 3LCLA 3LV5A 3OA3A 4UTTA 4YCPA 1F73A 3L9CA 4YL2A 5FI8A 3GXTA 4IGHA 3HB9A 4GUIA 4UTJA 3QRHA 4PODA 2NXHA 1G4PA 3KVLA 2VEMA 1WOBA 1GT8A 4UNKA 3TSDA 5I3IA 3DAQA 4UFMA 5FF2A 5U4NA 1O5KA 1YXCA 3S42A 3ZS4A 3D0CA 2FDSA 2ZA3A 1UBSA 2C1HA 2A4AA 1R2SA 1R30A 2V5BA 1THFD 4EIVA 3BG9A 3B0UX 3M5ZA 4ORIA 2QCCA 1OF6A 4AVFA 2TMDA 2FB3A 5F2GA 4OT7A 5FF0A 4LVAA 3M5YA 2GVGA 1I2QA 1G4SA 3HQ1A 4UUIA 2JBMA 3HPSA 4FXSA 4JTFA 5D09A 3PB2A 4JYDA 2OT0A 1WOAA 3BLFA 1XUZA 1SW3A 1OX4A 3NQ6A 5D38A 3I7SA 3CB8A 3A5VA 1DL3A 2V2CA 1EP2A 4UTIA 4LU0A 4OQVA 3VE7A 5KZDA 3NG3A 1JULA 2VFHA 2VFDA 3NA8A 2DZPA 1ZAIA 4OE7A 1IXQA 1VHNA 3W07A 3W1XA 4JD4A 1OVDA 5GVJA 2J9ZA 5D37A 2PURA 3EX2A 3W75A 4IXXA 1XBZA 3PM6A 1YTKA 1OFBA 1AL7A 1MXSA 3DU0A 2ZZ5A 1OFAA 2NX9A 4MKNA 2QCNA 3QQ1A 1W5PA 3PBUA 1EUNA 3BVJA 2EF9A 4DELA 4RJEA 2WNQA 1EB3A 5CZTA 2RDTA 2V5LA 3NM3A 1T8XA 3R2GA 5LHEA 4XBSA 5CPMA 2I1OA 4AAJA 3MHGA 2YCEA 1LROA 2DJXA 5C54A 3STEA 4X2RA 1H51A 2QJGA 1TO3A 3L5AA 3MBDA 3E02A 2HSAA 1TRIA 5KZMA 1JVNA 4AHOA 1SFLA 1C29A 4QQ3A 4PC8A 4IOTA 4JX6A 4X22A 1TPVA 1MEHA 4UCGA 1Q6QA 3NDOA 3PR2A 2GVJA 5F2IA 3PSWA 1GTEA 4LS0A 4QJ1A 4DEFA 1R46A 2RKXA 4Z0SA 3CU2A 5AYXA 1DJNA 1XFBA 5AYZA 1K8YA 2C0AA 1NEYA 2YXGA 3G0SA 1J2WA 3TQKA 3QMTA 1KM2A 1I2PA 1KM5A 5FEPA 3C56A 2ZZ3A 2WNZA 1TPFA 2VFIA 3ABQA 3A23A 4FNPA 3FS2A 1L9WA 3N9SA 3BO9A 2FQIA 4GWEA 5K4ZA 2F7FA 2DZWA 2G95A 1AG1O 2ZRYA 2QDGA 3HG5A 3B03A 3NPXA 5IBXC 3LV6A 3LBCA 1QFEA 1Y0EA 4TO8A 4XZ9A 4NVTA 4AHPA 1VLIA 4UFIA 3PUDA 1RZMA 1TB3A 3BG5A 4KFOA 2TSYA 4O18A 1MO0A 3TW7A 1I4NA 4DO5A 5H2ZA 1PHQA 4TMCA 2AQWA 2NXGA 2Z0IA 3SJ3A 2A21A 4Z08A 3O06A 4OWGA 3EWBX 1SZGA 1X6UA 1VLWA 3GAYA 4FF7A 5D05A 1JUBA 2A0NA 2CZ5A 5K9DA 4KWVA 1VPXA 1G7VA 2TPSA 5K2ZA 2GJLA 5K3VA 1H50A 3M44A 5CZJA 3NQCA 2ATSA 1S3HA 2BXVA 2VKZG 2NUYA 3I65A 1H1ZA 2V2HA 1X8FA 1IIGA 1VZWA 3MYOA 2H3BA 4TX9A 1VR6A 4FIQA 2NZLA 1BTMA 1YADA 3UWUA 4CQ9A 5K4XA 1UJPA 3DFNA 3G22A 1OFPA 5BMWA 4C1KA 1VGAA 4FB7A 1KLZA 1SQ7A 4LW7A 4NNBA 2ZZ6A 3S1XA 2A7PA 1G4TA 3GDKA 1DKWA 2E09A 1M6JA 1OYBA 4N2YA 4EOUA 3RMJA 3SGZA 3W84A 4M5PA 4AB4A 1I45A 4JTLA 1CX9A 1N55A 1QOPA 4PCFA 4ZQOA 2CFFA 4N02A 4GRSA 4JTEA 3W2UA 1WXJA 3DZ1A 5CZ0A 5G2HA 3GZ3A 1XCFA 3UY8A 3LM7A 1JCXA 3M6YA 3SY5A 5DXYA 4OBTA 4HNNA 5HINA 3GDMA 4UTTC 1K03A 1AW1A 3A21A 4JY8A 2ZDRA 3TDFA 1JUEA 2Z6IA 1JRCA 4IPIA 5G2IA 2P0OA 3O07A 5HNRA 4HHPA 2E5CA 3VCRA 5EYWA 3C2RA 1TPH1 1UUOA 3U6WA 3NEVA 3HF3A 4DPPA 3W2NA 4O14A 4LRSA 1F5ZA 3W70A 2HMCA 4LY8A 3SSJA 3G0XA 4M6VA 3N14A 3ATYA 3N3MA 4NT0A 2LLEA 4YCOA 2C14A 3KAOA 4WY0F 4JTUA 1ADOA 3CWNA 3EKLA 3VFLA 1TTQA 2YW4A 1HL2A 1S5VA 1V7YA 4NQ1A 3TA6A 4R53A 1UCWA 2KZHA 3G8RA 3V75A 1FY6A 2YR1A 5I3GA 5G5IA 3LCGA 4MJMA 2A5HA 4UTHA 1XKYA 5HUPA 3W72A 3P5YA 1IXNA 3QJAA 2HS6A 2CLEA 4ZQMA 4Y6GA 2C3ZA 1WBHA 1WX0A 3B8DA 5AC7A 5SWUA 2JKAA 4O13A 4IMCA 3O6CA 4JTGA 3W2KA 2B7QA 2H8ZA 4PTNA 4ZQRA 4CCCA 3G8EA 2V81A 1SSGA 4AWTA 4HIBA 4OV4A 3NL3A 4S2CA 2PE4A 3GDRA 4JTTA 1W5MA 3DGRA 4MZYA 5DY3A 2DP3A 3GDTA 4GUHA 1XDMA 3QSRA 1W0MA 1OK4A 2XFWA 4FNRA 1I2NA 3LLDA 1ZAJA 3MP4A 3BLIA 3GXPA 2ZCGA 3TXZA 1OJXA 5C6MA 4I7UA 4JS3A 2DJLA 4MYAA 1FWTA 3YPIA 3KXQA 2E5DA 2PCQA 4NJJA 1Q6OA 4UFJA 4LRTA 3W2MA 1XBYA 3A9IA 3GNDA 2BZNA 4N6EA 4QNEA 3R8RA 3HPXA 4MLRA 3LCHA 2NLIA 4NJHA 4WXYA 2H3DA 1RV8A 2YFNA 5BRBA 5CSSA 3I7QA 3LCXA 5BW6A 3KRZA 3UXDA 4FNTA 4HKPA 2A85A 5LNUA 4JXCA 4QAIA 1XXXA 1PCWA 3AJXA 2FTPA 2GVLA 3DFOA 3MI2A 1KV8A 2CZDA 3TJXA 3B05A 2G97A 5F2LA 1KBJA 2AAMA 2E77A 2JKEA 3W22A 4S2BA 1DQWA 4RZ4A 3PBWA 1KM0A 4UXDA 2QCEA 2FFCA 1RVGA 3M43A 3DH7A 1HG3A 4LV9A 3CHVA 3STCA 1P5BA 1W1ZA 3TUUA 4WXZA 3W7EA 2YSWA 4K37A 1LRQA 2VXNA 4UTKA 6ALDA 1EP1A 4MZ8A 1Q6LA 4Q32A 3TMLA 3PUEA 3FKRA 1RQEA 1GEQA 4UMBA 5L9FA 3Q94A 2E5BA 3MYPA 3Q37A 3LDVA 1VCFA 3L66A 1FWNA 3TU9A 1F76A 4CNNA 1EX5A 1XL9A 3N34A 1R2RA 2V0TA 3FKKA 5KITA 3G1HA 4BI5A 2FJKA 4EF8A 2QJHA 3NL6A 4JY9A 4U28A 3EX1A 4KFNA 1C9DA 2ZQ0A 1H7OA 1PHWA 1B57A 1V5XA 1FDZA 3PB0A 4O53A 3T55A 4AH7A 4CNPA 1KM3A 3BG3A 2E6YA 2W0UA 3H55A 4JTKA 4ZQPA 4TMBA 5I3HA 1Z42A 5F2MA 4UTUA 3P5ZA 1TV7A 3NPVA 3OIXA 3Q2DA 4RCXA 3MI3A 5CGQA 1EA0A 2ZYFA 3IIPA 3DHDA 3EKZA 3M16A 4LC6A 3N73A 1GYNA 4WY0B 1XBXA 1PIIA 3BV4A 4UFKA 3IV3A 4OV9A 2UV8G 3NQEA 3KVKA 2ZZ4A 4EWND 3RF9A 2YW3A 4TU1A 2FPYA 4MY9A 1W8SA 1H61A 3RFAA 5C2XA 3TNOA 3TQVA 1QR7A 2A6NA 2V30A 1TPB1 2J9XA 3S5OA 2Q3RA 3CIXA 4ADTA 3HGSA 2PRLA 1F6PA 3BGJA 4BK9A 3W1PA 5C55A 4MUZA 1VYSX 1FUYA 3MWAA 2WJZA 1S5WA 4A21A 2YDAA 2BTMA 1QDSA 2WSQA 3PVFA 4XWUA 2VENA 4JTJA 4AMAA 3QFEA 4IMEA 4IUOA 3R89A 1TYGA 2CU0A 3BW2A 3UD6A 1TPWA 3UPBA 4B5NA 4O28A 3DFQA 1PVNA 5HWJA 1QO2A 1GWJA 3ANYA 3W7QA 2E6FA 5FEXA 1OFEA 3NQMA 1RPXA 5G4EA 3Q58A 4K38A 4M7SA 3LTYA 4OHQA 5EL1A 3OHIA 1FWWA 4LT9A 3CQ0A 2V2DA 2YYUA 4MJZA 3TCEA 1H7WA 4JYFA 3DFSA 4O16A 4LTSA 4K6AA 1KM4A 3MUXA 4MVAA 1LBMA 1QWGA 4JTIA 3W23A 2QCDB 3TAKA 2R8WA 3M5XA 2Y7EA 1BWKA 3EXTA 1HFBA 2R94A 2CLKA 1VCGA 4LVFA 1QO5A 3NQDA 5H91A 4GBUA 5J5RA 3T40A 3P84A 3TW6A 1CW2A 3QPYA 1O4UA 1JQVA 4ONVA 3EXRA 3IIZA 4Z1BA 3SZ8A 3GB6A 1O95A 2EPHA 3W88A 3O8AA 3O05A 4DF1A 4O1CA 4UR7A 2NV2A 2RHGA 3W7CA 3M1ZA 3P62A 4A2RA 2E1DA 1JCMP 4AEOA 1P4CA 4OGZA 4XBKA 5D2XA 1O60A 4O0ZA 5AOUA 4NX0A 1K7EA 2VFFA 3FJLA 2NV1A 2JGQA 1ZAHA 1LRTA 3P82A 3HJZA 5C5YA 3HOJA 3W7IA 5EA9A 3W83A 1OYAA 3N2MA 4ZMGA 4KKXA 1LORA 2X16A 1FWRA 3OG3A 3QQ0A 3QSTA 5LHFA 1SW7A 3VKJA 2WSRA 1L6YA 1FX6A 3EX4A 1GTHA 1OX6A 4JDBA 4WJEA 5DELA 5HMSA 3LCWA 3L68A 5FEWA 3LBMA 2YGYA 1LBLA 2CLHA 2EAWA 1GG1A 3GK0A 3P61A 3R5EA 3K30A 1EUAA 3W7GA 3ABRA 2R14A 5DCEA 3O15A 2A1YA 2X30A 4JDYA 2NUWA 1A5BA 2X1RA 1A5CA 4WZHA 1OFQA 3QH2A 4MOZA 3TFXA 3FA5A 3WK3A 3QF0A 2ZRVA 1FXQA 4N4PA 1G6CA 4LVGA 1F6KA 3W7KA 5DBTA 3SFKA 4IWWA 3QW4B 4PFMA 1DORA 1Q6RA 3N2XA 4BWLA 3HO8A 4JICA 3G1AA 4J9JA 1SUXA 3W74A 3HGOA 3U2OA 4RV8A 3TMQA 2ATMA 2PRHA 1K3UA 1QPQA 1W54A 4L4LA 3LXAA 4Y90A 1O94A 4E2BA 3HMJG 4IJBA 5HWMA 3T78A 3O1NA 4ZL1A 1H1YA 2QCGA 4L4MA 2Y7FA 1XDLA 2X1SA 4DBDA 5ABTA 4OU1A 4JYEA 4Q33A 4NJGA 4IQLA 2VEPA 3W7RA 2ZRXA 3ZFHA 3BW4A 3UWQA 1JR1A 2G5WA 3DKLA 3PAJA 4K36A 2OMAA 4QNWA 5I3KA 1A53A 5EPDA 1K02A 4UC5A 1XM3A 1DHPA 1OHLA 1W3TA 3LCIA 1TRDA 3G1SA 4LNYA 2NUXA 5DXXA 1ME9A 3NL5A 1SPQA 2RDUA 2J6XA 2H90A 3W6YA 1I2RA 2EHHA 4NNAA 2GQ9A 2ZRUA 4PEKA 3F4WA 4E2DA 3FFSA 4DPQA 4LUJA 1YPIA 1W37A 3ZWSA 2Y70A 3PUOA 5DN1A 1OX4B 2B7PA 4Z1AA 1P1XA 3QMSA 3TKFA 1KM6A 1KW1A 4DQWA 1AL8A 3NVTA 1TQJA 5AHEA 3NQFA 3TSMA 2FPVA 3C3NA 3PG8A 4O10A 1TSIA 3EWUA 4ZQCA 1DV7A 4MY8A 3SW6A 4XKYA 4QISA 3W2JA 1TIMA 1GOXA 3VE9A 4Q4KA 5KTLA 1A5AA 3QEZA 2JKPA 3DFPA 4QITA 4O17A 1WAUA 4O52A 1GQNA 3P60A 1W5NA 2AGKA 1H5YA 2ZFAA 1F7BA 4K7YA 2C19A 1TQXA 4I9AA 5LNRA 2CLMA 5F4XA 4FX6M 1GJPA 3B0PA 4JN6A 1H60A 3KVJA 4LS1A 2CLIA 3L21A 1X1OA 2VELA 2O7SA 2W79A 4UTWA 4UTLA 4M7TA 3E9AA 3EWZA 3HPZA 5LGXA 3EB2A 4ZZ9A 1J4EA 1VH7A 3C2VA 1XI3A 3OVQA 1BKSA 2ISSA 1TTJA 3NR0A 1W31A 1H7RA 2CLOA 3P80A 1FDJA 5G1YA 3HIJA 1GVSA 1TREA 1VYRA 3BPWA 4CNOA 1QPNA 4FXRA 1W3NA 3O6DA 1PV8A 3G1FA 2GQ8A 4FX8A 2QUUA 5LNVA 3E0IA 5EBUA 2Q8ZA 2E6DA 3A22A 1PE1A 3KRUA 5U7SA 3EWXA 3IVTA 4LVBA 1ALDA 4AF0A 4RR4A 1X7FA 4LVDA 3JRKA 3MBFA 2WOQA 3NQ7A 3IIXA 1WBJA 1NSJA 1LLZA 3FEMA 4UIOA 4WQ6A 2QUVA 5I3JA 5T26A 3LGEA 1SZNA 1TPDA 3KVMA 4H3DA 1BWLA 3C8FA 1UB3A 4N9BA 3LTPA 1YYAA 2Y63A 3G24A 1DOSA 4N6FA 3W3OA 2ZA1A 5K7JA 3TFCA 2OZ0A 1KLYA 1LZOA 5DCDA 3B0VC 3CPRA 2B7OA 2CLLA 1AMKA 4N4QA 2ZRWA 3BK0A 3GAKA 3W7LA 3T44A 3DI0A 5TIMA 2QUTA 5FF7A 3IGXA 5D2WA 3MP5A 3TK7A 4MPQA 1I2OA 2DZUA 5MHBA 3FLUA 4HPXA 1Z44A 1Z48A 3IIOA 4PL2A 3BW3A 4MYXA 1ZALA 3OVRA 2YPIA 4N9DA 3LTSA 1IXOA 2WV8A 3UQNA 4P61A 1OABA 3ZWTA 5D04C 5F1UA 5FESA 4O19A 2E68A 3MO7A 2QCMA 2XN0A 4QSHA 5EKYA 3P81A 1LRNA 2VEIA 1H7XA 2CZFA 4Z1DA 3WK2A 3W1MA 3G0UA 3M47A 4O8RA 3W1LA 3IGSA 4AXKA 4O1BA 3V1PA 3W2LA 2C6QA 4CQAA 3GR8A 1A50A 2XN1A 3P8IA 3G1DA 3GNNA 4ICNA 3O63A 4A3UA 2OX1A 1PL9A 4BWLC 2NXIA 3ZR4A 1TPUA 3TROA 4JIQA 2ZZ1A 4RXGA 3L2IA 3H54A 3W7DA 3HG4A 1IGSA 3C2FA 1JUKA 5F4SA 3RLVA 2A2IA 3W7JA 2ZTKA 3B06A 1DVJA 1UASA 3M5VA 1QAPA 2OCZA 1KBIA 1B4EA 1NF0A 3LRLA 2QJIA 2A6LA 3GIYA 2ZTJA 1TV5A 1ONRA 5TQLA 4CCEA 1W5OA 5DY2A 1A5SA 5CG7A 3S5ZA 3EX3A 3W1RA 2X1UA 4RKAA 5HR7A 1QPOA 3INPA 4LV4A 3OEXA 1X1ZA 2B7NA 3GDLA 1LOLA 3USBA 1KFJA 2ABBA 4ADUA 3DFTA 5KMYA 3CC1A 5G4WA 3ABOA 3W1UA 2QDHA 4HNVA 5DCBA 5CPNA 2JGYA 1JCNA 1M7PA 3DHFA 2P10A 1Q45A 4RK8A 1F05A 1IXPA 1VC4A 1NFBA 2Y7GA 1ZCOA 4G1KA 1VCVA 1H62A 3NQAA 4LC8A 1KTNA 1L2UA 4O0KA 4MIMA 2DZXA 5AHFA 5I3FA 4A29A 5A8GA 2C13A 2C18A 1D9EA 4ZVJA 2ALDA 2VFGA 3OBKA 1ZNNA 1SW0A 4XTDA 3HBLA 3WFAA 1LP6A 5IM51 1KTCA 2PC4A 4FEZA 3STFA 1AW2A 3VI2A 5EY5A 3S1UA 3P7YA 2V9DA 3IGUA 4KWWA 5F1VA 2CLFA 1JQXA 3PBVA 3FYOA 3FIGA 3UWVA 2HS8A 1N7KA 4NUWA 3HG3A 3NM1A 1YLVA 1G7UA 4PL1A 3KOFA 4IX0A 4ZQNA 4CCDA 1TPC1 2DU2A 3B4UA 4K8HA 3MHUA 1JJKA 4UR8A 4UTWC 3NPUA 4TIMA 1VJIA 3PWAA 4XTIA 3TR2A 5D03A 3M41A 1T96A 1K7XA 5D32A 1T0OA 5BMXA 3I7RA 1GVQA 3RU6A 4CLMA 1TV8A 1DBTA 3W86A 4HPJA 3EEGA 2VEKA 1H63A 4M6QA 3MJYA 4LOCA 3S9YA 4FHAA 5D2VA 2B0MA 3CIWA 3PS7A 4LUIA 2PRMA 4O50A 1K8ZA 2C16A 3SR7A 4IMFA 4UMCA 1SU5A 5FEZA 4MFEA 5HWNA 3U8GA 1QNVA 3GLCA 1AW5A 4GUFA 3EWWA 4R7JA 3LHVA 3UXAA 1LYXA 2QCHA 3WJWA 4M6PA 5FF4A 1B3OA 2J24A 4JX4A 4WX2A 1L6SA 4LS2A 1B4KA 1RQHA 3LOTA 1GVRA 3NQVA 3GKFA 4WUIA 4I7VA 3LB0A 1EWEA 4JNMA 5AHMA 3B04A 1OX5A 3LERA 1GG0A 2BLEA 5L6UA 4QM1A 1ICQA 1OF8A 5KINA 4DF0A 4O57A 4FNSA 1OG0A 2ISVA 2J9YA 2YFOA 4ORMA 2E6AA 2GUUA 3EWYA 4MZ1A 1YTEA 2RDWA 4YXGA 3E12A 1TTPA 4YLWA 3TV8A 3FYPA 4O54A 4Y96A 3S0CA 5HJLA 1P0KA 1ZY9A 3NO5A 7TIMA 2Y89A 3C4UA 1LOSA 4AWSA 1ICSA 3UY7A 3PG9A 3JR2A 3WJYA 4EVZA 4IPJA 1FDYA 3WK0A 4GNJA 1LCOA 1CI1A 3TAOA 2CZEA 1QOQA 3OVPA 3IEBA 2DZVA 1EPXA 3HGRA 4WOQA 4I7WA 4DO6A 1C8VA 1ICPA 1J5TA 1TCDA 4BI6A 2H6RA 4XUGA 2Y62A 3BARA 1SO5A 4GFSA 4QIUA 4KFPA 3TC6A 3L0KA 4WD0A 3W76A 1YDNA 5TBOA 1LM1A 3KFTA 1M7OA 1JCLA 1H7PA 3L5MA 4NXKA 5D33A 1LLWA 4RX0A 3LX9A 5D2TA 3C52A 2I9EA 1ZHAA 1E51A 1WDWA 3M9YA 4A2SA 1FXPA 4IXHA 3MW7A 1VYPX 2QR6A 3MHFA 2WQPA 4R33A 1KA9F 2J27A 4MFDA 2FPTA 3LXCA 1M5WA 1SFJA 1FCVA 5FF3A 3RNDA 4DO4A 4PH6A 3UYCA 2V82A 3IRDA 4FIRA 2NX3A 2TRSA 4NZJA 1OFDA 2QEZA 1KV5A 2ZRZA 4O1AA 3DENA 1NF7A 1H7NA 2GOUA 3WJZA 3STGA 4IMDA 4S1FA 1DQXA 4LWWA 5E93A 1DJQA 1OYCA 3S6DA 1KFKA 2EKCA 4JTSA 4GE8A 4MLJA 3EXSA 5CKSA 3MP3A 3G1VA 1XC4A 3NOEA 4NXSA 3KX6A 3TXVA 3NNTA 3N9RA 3QW3A 3NXFA 5HULA 4Y8FA 3CWOX 3PSVA 3C2EA 1VHCA 3AO0A 3LI1A 2ZZ7A 3NL2A 1S5TA 3H53A 3UPWA 3QC3A 1PS9A 2BWGA 3L0GA 4ML9A 2HTMA 1RD5A 2QAPA 3R12A 4JR5A 5KSWA 1YPFA 1QMLA 2ZBTA 3QYQA 5DLCA 4Z0JA 4POCA 3CEUA 1YXYA 2X1TA 3QM3A 1GYLA 1KFEA 2GQAA 5AYYA 1VS1A 3UWWA 3KHJA 3A24A 4UTMA 3W7NA 1MEIA 3NZRA 3GYEA 1T99A 1G69A 1NAL1 4ALDA 3F4NA 1FCUA 5AB3A 3BLEA 1ME8A 3UNDA 3BGGA 1RQBA 3LHTA 1FCBA 6TIMA 4HSNA 3ABSA 1KFCA 4YMZA 2WSYA 3S1WA 4NJKA 5CZSA 1FBAA 3DI1A 3W71A 1F2JA 2QCLA 5HQEA 3PBYA 3S5YA 1G4EA 1O5XA 1EWDA 1OFRA 2P1FA 3FOKA 1GVOA 3F1QA 3W1TA 4FX7A 4W9TA 3M7WA 1KFLA 3RK8A 3UZJA 5J5DA 2ISWA 2FB2A 4DF2A 3PF3A 5AHLA 4X9SA 1GVFA 5AC8A 2YZRA 1P0NA 1XUUA 4DBEA 2I14A 3L65A 3G1YA 3MMTA 3GKAA 2OJPA 3L67A 4Z1CA 1IF2A 1QCWA 3QZEA 3S8HA 1OK6A 4O12A 2TYSA 2EGZA 2OT1A 3PULA 3LRKA 2XN2A 3LRMA 1BEUA 2DZSA 2WKJA 3IVSA 4XQ6A 5K9XA 4N9CA 3TE9A 5D2YA 4K39A 4M19A 2RFGA 4CQ8A 3E49A 3I6RA 5CPOA 1K8XA 3G1XA 2VOMA 3NPWA 3NQ8A 4RZ5A 1ZENA 1ML1A 3HG2A 3WJXA 1TJPA 3C0JA 5HR6A 3DBPA 1PCKA 2H8XA 1QPRA 3GVGA 1IIHA 2WO5A 3NYZA 3O16A 2DZTA 3TC7A 3QPZA 8TIMA 1OFOA 4H4IA 3UWZA 1TJRA 4RXFA 3UWYA 1NVMA 4IMGA 4HT3A 3W1QA 1HUVA 2NWRA 3TIMA 4C1LA 3CEPA 1JCYA 1LBFA 3PY2A 2WPBA 1SZEA 3T7VA 1MZHA 3TX9A 3P74A 1W5QA 2Z6JA 4FNQA 4N9EA 4X3ZA 4RLIA 3KRSA 5HUOA 1TPEA 4JX5A 4NNCA 4P2VA 2J88A 3FJ6A 4H6KA 4WY0A 1UUMA 3N19B 3RLUA 3IIVA 1SO4A 2Y7DA 4E0CA 1I8JA 1SO3A 4NU7A 2Y6ZA 4ADSA 1FCQA 4R34A 3LCFA
chains in the Genus database with same CATH superfamily
4MY1A 3W7HA 1HNYA 1UP2A 2ASHA 5G1TA 2XVLA 3ME3A 4HZMA 2ZA2A 5AFDA 3GH4A 4ML4A 2OB3A 1R47A 3T2QA 3E96A 3RYSA 4XV0A 5T9CE 1US3A 1W56A 1CGUA 2BOEX 4YTTA 2VGIA 2HVMA 1WQ5A 3PZVA 4ZSUA 4PGLA 3KBVA 1Q65A 4XKYB 4FO4A 3LXBA 2B4GA 4GVHA 3BCFA 2VD9A 1AMYA 5FSEC 3VNDA 3WH5A 5I5RA 3ERPA 5CSRA 3H4XA 1E15A 3ONBA 1ZL1A 6CGTA 1W32A 1ZJIA 4UNLA 4D2JA 3TYBA 4HNUA 4RZ6A 5E0CA 4HN4A 2BBFA 3LHZA 3EX6A 6XIAA 1TG7A 1B9BA 5D30A 1X96A 3RRAA 2PDWA 3NWRA 3LHUA 3W7OA 1KWGA 5XINA 2QCDA 5LSMA 2WJFA 5CPLA 4S3KA 2WC7A 2OLSA 5EMUA 4AX6A 4GCXA 2JK2A 2W4XA 1C93A 4IIBA 3AIEA 2YBTA 1K77A 3HGJA 3PZMA 1FWCC 3DG6A 3JS3A 1DJHA 1MW2A 1FRBA 1JYVA 3H7UA 3G3DA 1GPWA 3ELFA 3NQ2A 4ZXOA 2BS9A 3M0XA 4ZOAA 9XIAA 1ZP3A 4UQ9A 4AF0B 1UKQA 4HTYA 1HVQA 4IISA 4BF9A 3WH7A 1SJDA 3GW0A 2VX5A 1U2YA 1Z41A 1BKHA 4C5YA 2GWNA 4DAFA 5C70A 5CLWA 2PWVA 3W9ZA 4E38A 3XISA 4WJXA 5E1QA 1W3IA 2WYSA 1TTIA 5A5WA 2IW0A 2YX0A 2EG8A 2Q8LA 2QKFA 1CGTA 3S1VA 3CT2A 4MDPA 4URIA 1F07A 1LTDA 2W6RA 5LNSA 3AWOA 1AK5A 1FWHC 3VOGA 2NX1A 4RDYA 1JZ2A 1DE5A 1RP9A 2Y85A 2PAJA 3DERA 1EOMA 1V0LA 1WYIA 2YZ5A 1P0DA 4W85A 4Z2IA 1OEPA 3CV1A 3VIIA 2OWXA 2BSLA 4FALA 3THAA 2PC8A 4S3CA 1BGAA 5AHNA 3C61A 2J13A 4GUGA 4JEJA 1GPFA 3HURA 3G3MA 2O9TA 4RE0A 4D6IA 1TA3B 4UOJA 4UMAA 1U5VA 2DORA 2NV9A 3N1AA 3NGJA 1S2VA 1EP3A 2CWNA 4UTTA 4B5WA 3BMVA 4U2ZA 1KGWA 3GXTA 4IGHA 4UTJA 1WZAA 3KVLA 3E2RA 3R0UA 2VEMA 1J11A 4WIWA 1PAMA 3SCRA 3DAQA 3L2LA 4UFMA 5FF2A 1K4GA 4Q4PA 3F2DA 1PKMA 1UIPA 2G3JA 1VFMA 3AJ7A 3MMUA 4I90A 4R7WA 1R30A 4QDWA 3TN3A 3VGBA 5CC6A 4ORIA 1TCMA 5A6SA 5D9PA 3O9NA 1UW9A 3V3WA 1LL7A 2FB3A 5F2GA 4BQ2A 5FF0A 1Q2SA 1TX2A 3GIPA 3HQ1A 4PZVA 3MV01 1J12A 1UPMB 5D09A 2GVYA 4RPPA 3CO8A 3NQ6A 3A5VA 1CGYA 5KZDA 1V02A 3W4RA 2DZPA 3RHGA 3BLDA 4JD4A 1VIZA 5GVJA 1XLDA 2PURA 3EX2A 2V67A 1B54A 1YTKA 1OFAA 4MKNA 2QCNA 3CUGA 2XM2A 1DJWA 2J6VA 3NUKA 4UWMA 3WUBA 2EF9A 4DELA 1RY0A 1VAHA 2HCVA 2GSEA 1NARA 5CPMA 3EGJA 3F7JA 1GJUA 1KR0A 2PDPA 5C54A 4XSLA 1H51A 1TUFA 1FWBC 2V38A 1ISVA 2ZUVA 4IOTA 1DQUA 2PGFA 4X22A 4QCEA 2GL5A 2R82A 5F2IA 5I2UA 4LS0A 4QJ1A 2DEPA 1RBOB 4Z0SA 1GJWA 3VOJA 2C0AA 1E1CA 3LY0A 2Z7GA 1KM2A 1DWFM 1YW1A 2P53A 4GVIA 2VRJA 3C56A 2PZNA 2WNZA 1XPGA 4IJCA 4FNPA 3HU7A 3ZO9A 3QFWA 4GWEA 3VDAA 3BE7A 5M17A 5BU9A 4XIAA 2JEQA 2QDGA 2WJDA 3MZ2A 3LBCA 1QFEA 4XZ9A 3AYVA 3U2CA 4AHPA 4EPKA 1M04A 1WXYA 1B9ZA 1TB3A 4BY3A 2A3BA 2TSYA 5IFTA 3TW7A 1Y5XA 3KM8A 1PHQA 4Z08A 3LK6A 3O06A 1CIUA 5A8OA 4NF7A 4UQAA 4A35A 3GAYA 5BRPA 3L7RA 3V0TA 5D05A 1JUBA 2A0NA 5K2ZA 5K3VA 3M44A 5CQ1A 4S39A 1MW0A 1XJBA 5CZJA 3VZYA 4X61A 3M0KA 2PTZA 3WLQA 2AAAA 3GXMA 1IIGA 2WK2A 3OGSA 4OUIA 1VBRA 3DECA 4WKHA 1UROA 4RNFA 3QHMA 2W62A 1UJPA 4AU0A 3CXOA 5B7YA 2V69A 5BMWA 3MUAA 4FB7A 2BMBA 3WEMA 4S38A 2A7PA 1DKWA 2PDUA 2VR2A 2GUYA 3SGZA 3W84A 4DYKA 3FAWA 5A2AA 3VGFA 1SMAA 4E8CA 3IANA 1EPVA 1KCLA 3P3BA 1M41A 3W2UA 4F0HA 1WXJA 3VMPA 5CZ0A 5G2HA 3GZ3A 2PWUA 3LD5A 3M6DA 4B3ZA 3S9IA 1G9HA 2REQA 3BAXA 3IACA 4DNMA 3GDMA 4D6DA 3ES7A 1K03A 1AW1A 3CBWA 4U33A 4ACZA 3A21A 3RJXA 2ZDRA 3TDFA 1JRCA 3TW9A 2P0OA 3O07A 2GGHA 1FWGC 4BCEA 4LX4A 4O14A 3N13A 1WDRA 1MFVA 1ZBCA 4LY8A 3G0XA 4RE2A 1E6XM 2PGEA 4M6VA 2C0HA 2E28A 1JG9A 2Q8XA 3FSTA 3N3MA 2FFIA 2DQWA 4NT0A 4HZ7A 5LXXA 1PWLA 3FGCB 1I0DA 1ADOA 3KCOA 4HA1A 2YW4A 3FX4A 4XBJA 4R53A 1XH2A 1H2JA 1PKYA 1CPUA 3V75A 1OCJA 2ZWZA 5G5IA 3LCGA 2A5HA 2D23A 4UTHA 1XKYA 2IKJA 2NT1A 1JYWA 2HS6A 2CLEA 3G2GA 2J7DA 3RLGA 5AC7A 3TN6A 2JKAA 4O13A 4IMCA 4PUUA 3D47A 1WZLA 2XFRA 4DUVA 1P6BA 1EZWA 5ENLA 5XIAA 1V6XA 4GVGA 1KBKA 3DC0A 2V81A 1JDAA 4AWTA 4HIBA 3U7VA 4OV4A 3NL3A 3R10A 2PE4A 4CKQA 2NVAA 3E74A 2ZVRA 1K6AA 1UWRA 1DJZA 3N11A 2HBXA 3GDTA 1UZ4A 4GUHA 4G56A 3CL7A 1I2NA 3WMSA 2ADAA 4CCZA 2PTWA 4GX8A 4L56A 4PCSA 1SM9A 4QNEA 5E9AA 3HPXA 4NJHA 4WXYA 2PLMA 3V36A 3W26A 1RV8A 5CC7A 3I7QA 3LCXA 5BW6A 4MJ4A 3KRZA 1Q7MA 2A85A 4ZOCA 3UJSA 4LAKA 3OO2A 2FTPA 3OJGA 1RALA 2CZDA 1TJ2A 4HNCA 3B05A 5F2LA 2NQHA 1CXHA 4FP1A 3W22A 2HJPA 4HN8A 4S2BA 3UESA 3MKCA 3WNKA 2QCEA 3B0YA 4WKAA 1XLAA 2NSOA 4H9YA 1HG3A 3CHVA 3SBFA 2YSWA 3QR1A 4GGHA 6ALDA 3TYAA 4C6JA 1EP1A 5AC5A 3E0LA 4FR6A 1GEQA 4G8TA 4JFUA 3Q94A 2E5BA 2BHYA 2J8FA 3Q37A 3T1GA 4IGSA 1F76A 3T4WA 4CNNA 1XL9A 1KRCC 3EWCA 3G1HA 2FJKA 2OEKA 4KFNA 1C9DA 1AUSL 1PHWA 1FDZA 3T55A 4CNPA 3U0HA 1UKTA 4KIEA 3H55A 1DJYA 3UETA 3WEZA 1CT5A 2HZGA 4O1EA 3GVWA 3ZJ8A 4DYEA 4KRZA 1V6WA 3L4WA 3BDKA 3URAA 4RCXA 3MI3A 1K9DA 2ISFA 2NQ9A 3CIVA 3IIPA 3F4CA 2PI6A 1MWOA 3IV3A 1GUVA 3U7BA 5CAHA 3KTXA 1UD2A 2A3LA 4DY1A 7CGTA 4Z2LA 1I9CB 4NRSA 1CYGA 3RFAA 2VI0A 3OZYA 3TQVA 3WD2A 3TZNA 2V30A 1TPB1 2R24A 2Q3RA 3PANA 4ZTXA 3HGSA 4LUSB 1HGWA 2OSXA 1NWTA 4YHEA 1VYSX 3MWAA 2WJZA 2RGLA 4CVWA 2ZX6A 1S5WA 4A21A 3OVGA 2WSQA 3PVFA 3ZQ9A 3H26A 4IMEA 3AXHA 3R89A 2WMJA 3LPFA 1DJXA 4QLKA 1TPWA 4B5NA 3VXGA 2YCJA 3CQJA 3FVDA 3LEPA 4GYPC 3AOFA 1FA2A 1XF0A 2C91A 1NOWA 4REQA 1GWJA 3ANYA 3E6EA 3EKGA 2E6FA 3IS4A 3GHUA 3LS9A 4Z2JA 4LUTA 4OHQA 3EOUA 4A8RA 1LG1A 4LT9A 4JAWA 5IHSA 2CBIA 2V2DA 4UB9A 4O16A 2XIBA 2AL2A 3G77A 1LBMA 2WWCA 2XH4A 3TC3A 4JTIA 3W23A 2CKRA 2GWGA 2Y7EA 2Z2BA 4NYYA 2INZA 3VD7A 3CO4A 4Q8UA 3RDKA 2IPFA 5HJXA 3T40A 3P84A 1CW2A 1JQVA 4ONVA 3ARWA 3ARZA 5E5CA 3W88A 3M1ZA 1OZMA 4O1FA 4AZBA 1EJVC 4WDTA 4B4HA 3KE0A 5E0FA 1F61A 3EDDA 5AOUA 4EWJA 2VFFA 2OYMA 1OD8A 3HJZA 4DLFA 3KL5A 3UG4A 3HOJA 4C6IA 5TF0A 5EA9A 3W83A 3DHUA 5A8MA 3B8UA 3QQ0A 1S2TA 3VIFA 1SW7A 4HHMA 2WSRA 1L6YA 1FX6A 2VC7A 3HMCA 4W89A 5LIKX 4WJEA 1IQ8A 3TOPA 5HMSA 5FKYA 5FEWA 5E09A 1A3HA 3SSZA 1LBLA 1X39A 3P61A 3GK0A 4PMYA 2PTDA 3K30A 3ABRA 4HCLA 1XLHA 4Q4OA 3TONA 1EIBA 5CSUA 2VCAA 2X30A 4JDYA 4KBXA 2NUWA 2X1RA 5D8ZA 3OLGA 4HNOA 4WZHA 1OFQA 3QH2A 4MJ2A 1KCZA 3WK3A 3K4AA 5LA2A 3QF0A 2ZRVA 4QLJA 4N4PA 3EPOA 4CD7A 1ADSA 4IWWA 4NY2A 4RW3A 1ZBKA 2WZHA 1FH9A 3HO8A 2FHCA 5JMUA 1HW6A 1GOWA 3PZIA 4RV8A 4GHRA 2ATMA 4LFYA 1W54A 3QY7A 1OD0A 3N4EA 4DO7A 2ZX8A 1P7TA 4IJBA 3URNA 1IEIA 4ZL1A 2I5GA 4LGXA 1H1YA 1MXDA 4L4MA 2JIEA 4DBDA 4L7ZA 3FCPA 5ABTA 3VM5A 2WSPA 4IQLA 4E2VA 1GW1A 4AISA 4ILSA 3JW7A 2DFAA 3DKLA 3AAMA 4QNWA 2F6UA 1E72M 2WCSA 1I0BA 4ZENA 1XM3A 3HQOA 1DHPA 2I16A 1JDCA 2HWGA 4LNYA 3GNOA 2NUXA 5DXXA 1OIFA 1SPQA 3STPA 3S2JA 2H90A 3W6YA 1I2RA 4PEKA 3WLLA 5DRCA 3C2YA 4E2DA 3FFSA 3UZWA 4DPQA 1E40A 5I77A 1SGJA 3DFHA 2Y70A 2PGRA 1N8WA 1QHZA 3ZVHB 1P1XA 1OGBA 4YN5A 1KW1A 4DQWA 2PWEA 1E6QM 3NQFA 4EK7A 1WZKA 3C3NA 4O10A 1TSIA 3BC9A 1PZ0A 4AIEA 1DV7A 4LPCA 4MY8A 4XKYA 1TIMA 3VE9A 4Q4KA 1A5AA 4F40A 4QITA 4O17A 3OG2A 1CBGA 3P60A 1UP0A 2Y24A 1S2WA 3PTKA 3VOCA 3BLKA 5A6LA 1H5YA 2XFFA 4L6HA 5F4XA 2XVGA 3KVJA 4LS1A 1YX1A 3A47A 4XK2A 1XICA 4UTWA 2DGAA 3QZAA 1P6CA 1J4EA 1YNYA 3B8IA 3EDFA 4XX6A 2EPOA 2WMIB 3R8GA 3NZGA 3P80A 3HIJA 1VYRA 4CNOA 2XIIA 3O6DA 1PV8A 3TTQA 4TV5A 4QEEA 3WDPP 3WUEA 1QNQA 5LNVA 4TTGA 1ADDA 3ARVA 1A4LA 5JH2A 1WKFA 3UA3A 4GKLA 1PE1A 4EPEC 2UY2A 2Y8UA 3EWXA 1ALDA 1I75A 4AF0A 4CEUC 3EA3A 4HCHA 1XPYA 2WOQA 1NSJA 3FEMA 4WQ6A 4IQJA 3LBOA 5I3JA 2OOGA 4DLMA 5JBDA 1SZNA 3IAPA 3AU6A 1BWLA 1UB3A 1PDZA 2J78A 3LTPA 2HRWA 3IV8A 4N6FA 3MT1A 1OADA 2W66A 2ZA1A 1DP0A 3TFCA 4C6FA 1ITXA 2CZVA 3ICJA 1LZOA 5DCDA 1KXHA 1M1BA 1V3LA 2D69A 4NAEB 4IH3A 3T44A 2XVKA 3DI0A 5TIMA 3I4EA 4HMNA 4ERGA 3IGXA 1RAKA 4RV3A 2V5CA 2KX9A 3TK7A 4GIYA 1I2OA 4H8NA 2NQJA 4NZ1A 1B90A 3IIOA 3BW3A 1ZALA 2YPIA 2RDXA 3CQKA 4N9DA 1BD0A 4ERAA 1J93A 1W2VA 2J74A 2VZOA 3DG7A 2YOCA 1TA3A 1ESWA 1B3WA 3CAKA 1UKOA 1U5HA 3W6MA 4QSHA 3ARTA 1LRNA 4MB1A 2EO7A 4Z1DA 2OKTA 5I23A 3W1MA 1EC8A 3M47A 4O8RA 2C6QA 5FAJA 3VPLA 3ABZA 3P8IA 3G1DA 4ICNA 5LA1A 3BXWA 3OODA 2IKHA 4GQBA 1PL9A 4HA4A 2VEFA 1HVXA 3IARA 3TROA 1XRSA 2QUMA 4HK6A 2Z4GA 2ODOA 2WLYA 1RCOB 5F4SA 3BV7A 3EDKA 2ZTKA 3B06A 4XAPA 1QU4A 2NW0A 2J66A 1KBIA 3A4WA 4J4KA 1OIMA 4YVPA 4D6HA 3RM9A 2XJ7A 2GDVA 5CG7A 1G01A 3WLPA 1VFUA 4L6DA 3INPA 3IGHX 4AWEA 1J79A 1PKLA 3PPHA 3EPMA 3TJ4A 4WLCA 3KEHA 3WH8A 1H1NA 2DV0A 3BAYA 2VVSA 1U22A 1J2BA 3TNBA 3FNDA 1Q45A 1JFXA 1IXPA 3OYZA 4DBUA 4US5A 1NFBA 1XSJA 2Y7GA 3RM4A 7REQA 4G1KA 1XISA 3OQ8A 3ITXA 1RSCA 4LC8A 4UR9A 4K2SA 3VOHA 2FMNA 3VGEA 5M5DA 2EPLX 2GLKA 3GDBA 4A29A 1D9EA 3SUWA 3H4WA 1ZNNA 1SW0A 3RPDA 4IL2A 1LP6A 1EJTC 1NOFA 1KTCA 3KTCA 4CN6A 1UR9A 3NVDA 2Y5JA 1XLFA 4KWWA 3NO1A 4Q7BA 5HOSA 1LQAA 4MNJA 3FIGA 3UWVA 2HS8A 1N7KA 3FXYA 4NUWA 1C7SA 4J3ZA 3U3HA 1G7UA 4IX0A 3LQGA 5CSYA 3WBWA 1W9VA 1IGWA 3B4UA 2HXUA 1YIXA 5MF5A 1VJIA 4XTIA 3TR2A 2OOFA 1BWVA 1XLKA 1HIZA 1E71M 2HDJA 1T0OA 2INEA 5B80A 5I00A 2JQXA 4MB3A 1CLXA 4Y9NA 4CLMA 1TV8A 4HPJA 3W86A 1IWBA 2VEKA 9CGTA 3BMWA 3WBYA 4M6QA 4FHAA 5DMMA 3PS7A 2PRMA 1PSCA 1QBAA 3R0DA 1PZ1A 4MKVA 5FEZA 5DX7A 3LUTA 3SB0A 1LT8A 1PEZA 3E38A 3HJEA 2XINA 4W86A 4D1IA 2PODA 3EWWA 4Q3MA 3WUGA 3VX1A 1E1FA 3WJWA 2Z27A 4I9MA 3VM7A 5G1MA 4WX2A 1B4KA 3UJ2A 2X42A 3GKFA 4Q8PA 1ISWA 2YA1A 4WUIA 4Q4MA 2WNWA 2I57A 1ISXA 1OX5A 1MW3A 2PP0A 2Q71A 2F8QA 1U30A 1OF8A 5KINA 4O57A 1JFHA 4ORMA 3GXFA 1YTEA 1TIWA 2RDWA 3DYOA 4YLWA 1E4MM 3KLLA 4Y96A 3CPGA 3SY8A 1Q7QA 3QGKC 1ZY9A 3NO5A 7TIMA 3C4UA 4KH2A 4AWSA 2R9RA 4RNHA 4Q8MA 4QQUA 3BURA 4GBDA 3JR2A 3RLHA 4L9ZA 4GNJA 4ROPA 2CZEA 3OVPA 1EPXA 3HGRA 4WOQA 3WBXA 4I7WA 1ONEA 2OLAA 1C8VA 1BF6A 1J5TA 2VZVA 4BI6A 1KRMA 3AS2A 3TC6A 2E8ZA 5JH1A 3L0KA 5A6BA 3MSYA 1VFFA 3LGGA 1E4IA 2ZADA 1S39A 3GXIA 4BF5A 5LIXX 1M7OA 1JCLA 3ZJ7A 4NXKA 5D33A 4RX0A 4RNJA 3C52A 2A3CA 4PRWA 3OOQA 5I09A 4CNSA 1E51A 4A2SA 4LALA 1FXPA 4IXHA 1ZJBA 4JIHA 1X8CA 4R33A 4MFDA 2C1GA 4NKCA 4AG0A 4DO4A 2D0HA 4WF7A 3GO2A 1DJIA 3UYCA 3FGCA 5BU6A 4ROQA 1KRBC 1NF7A 4NZ3A 4L9YA 4S1FA 1CGWA 1VBGA 1J6PA 3FDGA 1ITUA 1GNXA 3OBEA 4IT1A 4JTSA 2VCBA 4MLJA 1UJQA 3NOEA 2PS2A 3AHVA 1Q4NX 2CERA 2EEXA 3CWOX 5H1WA 2X40A 3PSVA 3AMLA 3AO0A 4AVNA 3NL2A 3L4YA 3GD6A 3H53A 4V33A 1R3VA 4ML9A 2VQUA 1OC6A 4AD2A 6XIMA 4JR5A 4BS0A 5KSWA 1YPFA 4YNGA 2VP8A 4POCA 4UTFA 2WBGA 3CEUA 4H8HA 3NZQA 4X0VA 3AALA 3WEOA 1E0UA 4UCFA 4B5VA 3N25A 2GQAA 3KHJA 3GYEA 4KCTA 2IQDA 4ALDA 4OBSA 4LAMA 3GC2A 4LF1A 4C1NB 4HSNA 2GYIA 3VKBA 3BSHA 3VIMA 1E6ZA 4GISA 4WSHA 4YMZA 3S1WA 1GONA 3C0QA 1FBAA 3DI1A 4GINA 2QCLA 5HQEA 4M3PA 3CZKA 3CK5A 1VFTA 3AZRA 5BOFA 2UY5A 1G4EA 4XZLX 1OFRA 2P1FA 4FSAA 3WQPA 4FX7A 3UZJA 1W3LA 2PDBA 1XD1A 2FB2A 2V3GA 1DWGM 4DF2A 5AHLA 4HP5A 2D0GA 1IR1A 4J27A 3H22A 2XDFA 3MMTA 4I6KA 3L67A 3GHSA 1IF2A 1QCWA 3S8HA 3OZPA 3LRKA 3OTRA 2V3EA 4PUDA 3IVSA 2VR4A 2XSXA 5K9XA 2Q09A 5D2YA 2ACUA 1AQ0A 3E49A 3I6RA 1QW8A 4HTBA 4RZ5A 1ZENA 4M6UA 1ML1A 3HG2A 4G9PA 1TJPA 5HR6A 4HHHA 2A3AA 1PPIA 2BNJA 1XIJA 1QTWA 3DHPA 4G7EA 5AZ1A 1Q6CA 5KETA 2WO5A 3S2CA 4GI9A 4CEXC 5I7GA 2G50A 3CNYA 1M65A 4AY7A 5C8BB 3RPMA 4C1LA 3CEPA 4LQ1A 1JCYA 1LBFA 3PY2A 1R7AA 5FCZA 2OGYA 1BYCA 4IQEA 3GFXA 5CXPA 4JX5A 3WKZA 4GO9A 3FJ6A 4H6KA 3N19B 2ESCA 2GZXA 3DIPA 4YJ5A 3CH0A 1WPCA 4WJ8A 1CCWB 1SO4A 4E0CA 3AQUA 1B30A 1QXLA 1SO3A 4NU7A 1EQPA 3BLOA 3W87A 1FQ0A 3VNYA 2XPKA 1R87A 1LDCA 2WNNA 1L6WA 3CT7A 3HFTA 1RK6A 3WLRA 3R13A 4NJIA 5LGZA 3NSNA 5A1AA 4LUSA 3QLLA 1LT7A 4P8UA 1EEPA 2ZE3A 3LHWA 3VIHA 2VC6A 2IQTA 1PB0A 2BY2A 3UR7A 3N2TA 5HXMA 1S1PA 2ZC1A 3GS6A 5AN7A 4H9TA 3W7MA 1G67A 7ENLA 3RX4A 1HKVA 1V03A 4A6GA 1XRVA 1SO6A 4WOZA 3CHDA 5D02A 2FIQA 4KRUA 3BMXA 3LNPA 3ATZA 3NZ1A 5EMMA 3N2OA 3TA9A 1KKRA 1Q3NA 2VX7A 3NQGA 3W1NA 5CC3A 1WV2A 2WVSA 3KOXA 4JN7A 5DBUA 4KW2A 2VNCA 3M0ZA 2OGJA 1WKDA 3QMRA 1UR2A 1MEWA 2DT3A 1U83A 2I7GA 3VIKA 4IX2A 4O11A 4B9ZA 1R86A 1LOQA 2ACRA 1E0VA 5EU9A 4TX6A 1UD3A 3TJLA 4K7VA 2GJNA 1WKYA 3UZZA 5ABFB 2QAFA 1ECQA 1GZGA 2FMOA 2PSNA 4GI8A 1XIMA 3K4WA 3CLMA 4FXFA 4KCWA 1AH0A 5IBXA 3VVGA 4OBRA 1YTDA 4OKDA 3TTSA 3PC0A 4QJ4B 2AOSA 1QHOA 3VGHA 1YDOA 3T6CA 1OT2A 4PMJA 2Y0FA 4K3ZA 4BR1A 1K9TA 1LWJA 1NQ6A 1C92A 3Q67A 4O15A 1XLJA 2G96A 3O6YX 2FDMA 1ZP4A 3N4FA 4ZB0A 3I68A 2W63A 4BFAA 2Z1XA 1ME7A 1WA3A 1EF3A 2OU4A 1HKJA 4BI7A 2GJRA 3SUSA 2X2GA 4HSOA 3UCQA 2PMQA 1KNWA 2YDSA 1TZ9A 3N12A 3H2FA 4YTSA 1EIXA 2O56A 2O4QA 3EWDA 4BQ3A 2Z29A 3PWGA 3THQA 1UYQA 3V18A 1VP5A 3W73A 2G3NA 1U1UA 4NZFA 1BYBA 1GQKA 1CGXA 3CM4A 3UZ5A 3ORWA 4FXJA 2G4FA 2CC0A 4R85A 1K9EA 2ZZ2A 2QDEA 4HA0A 3F5KA 3LCLA 1C91A 4YL2A 3WDRA 3HB9A 4GUIA 3QRHA 1NWSA 4PODA 3A9BA 4LB4A 4XVDA 1KQZA 5HNTA 4W8AA 3BH4A 1GT8A 1Q6EA 1RK5A 5IFPA 1O5KA 3MZNA 2EJ1A 2DZAA 2C1HA 3U57A 2JF7A 3N17A 2WPGA 1L6FA 1M53A 4PCTA 2V5BA 1GOOA 3MUIA 2WZMA 2QCCA 2TMDA 3VNKA 1B3VA 4OT7A 5BOEA 4M81A 2DW7A 3M5YA 2OR2A 1IV8A 3MMWA 3HZ3A 1V0MA 1JDDA 4M1BA 1K9FA 3Q65A 1FH7A 3PB2A 4JYDA 1GOKA 2OT0A 4LUYA 1XUZA 1SW3A 3L4UA 1GZ1A 3ZVHA 1EP2A 3MDUA 2HE8A 4XO7A 1JPHA 4WKFA 4M8UA 3NG3A 2PBOA 2VFHA 2OWWA 2BB0A 3BJTA 4OE7A 4E3TA 1VHNA 3BANA 2AQVA 3RO8A 3CYJA 2J9ZA 3IJQA 5D37A 2BGNE 4TVUA 4V2XA 1MXSA 2BY3A 3VUSA 2ZZ5A 2R1PA 4L1WA 3F4DA 3PBUA 3CZ8A 1EUNA 3KP1A 1PX3A 2WNQA 1EB3A 2V68A 1T8XA 1WXZA 4XBSA 5DRIA 4AAJA 3CUHA 3MHGA 4J28A 3IJ8A 3DGBA 2D2GA 1LROA 4HPHA 4MGGA 2VWSA 3KBWA 3MBDA 1FFQA 2HSAA 5KZMA 4H2HA 3E5BA 4V1XA 1SFLA 4QQ3A 4PC8A 4PUWA 3L4XA 4JX6A 1SJAA 2YXOA 1S2CA 1MEHA 1Z8AA 3NDOA 3PR2A 3SRFA 1TR9A 1TWIA 2FYMA 3BSGA 1R46A 3T8LA 3CU2A 5AYXA 1K8YA 2OZTA 3G0SA 1J2WA 3PPFA 1UPPA 3PJUA 1TV2A 1WDQA 1KM5A 2ALRA 4GH1A 2ZOXA 3LZ3A 3ABQA 4D9PA 2NT0A 2FZNA 2X7WA 3ENLA 1L9WA 3N9SA 2FQIA 4HBKA 5K4ZA 2F7FA 2VZUA 4OFCA 2D1ZA 4D8LA 2FHBA 3IWPA 1AG1O 3HA1A 1UR0A 3HG5A 1FWEC 3B03A 4TO8A 3GBDA 2XYLA 4NVTA 3KL0A 4YWSA 3PUDA 4TUFA 3BG5A 4WDWA 1MO0A 3DOPA 4DO5A 4TMCA 1YBQB 2AQWA 2NXGA 2Z0IA 3Q4DA 2NSXA 5ECVA 2YB4A 4LF2A 4NIRA 4FF7A 3H12A 5K9DA 4IGMA 4KWVA 4XB3A 2DT0A 2TPSA 2GJLA 4ZCWA 1U1HA 5A95A 4O0QA 1UZ1A 4L4OA 2ATSA 4PUNA 4DB7A 3WFLA 1EZ2A 4D6FA 1H1ZA 1BAGA 4H04A 4AZ7A 1YADA 4HOXA 3AC0A 2VGFA 1I1XA 4CQ9A 2IQ0A 1XYAA 1ODUA 3G22A 4Q8VA 1O5RA 1QT1A 2VO5A 4LW7A 4NNBA 3QV8A 3S1XA 1S2UA 3BJSA 4H9ZA 2VC5A 2E09A 1M6JA 1OYBA 4N2YA 1X6NA 3TYCA 3MA8A 1IWPA 1I45A 1ZBVA 2G3IA 5A2BA 3W6LA 4N02A 4WRHA 4GRSA 1NJJA 4DJFA 1O66A 1XCFA 4LBSA 1E3XA 1PKNA 3LM7A 5TNVA 3FV9A 4ZA0A 3M6YA 5DXYA 1W9XA 5HINA 4UTTC 2INFA 2VMFA 1W1YA 1CEOA 2EKGA 2IXUA 1W1TA 4LY4A 4GZ7A 1NH6A 2YXXA 1ECEA 4MADA 5HNRA 4HHPA 2NLYA 1PIFA 1TPH1 2WXDM 3NEVA 3UNTA 3HF3A 5HPCA 1JI2A 2IPWA 2J62A 3WD0A 1K6WA 3KAOA 1QATA 2QGYA 3OHMB 1Z7AA 3EKLA 4JTUA 5IXEA 2IMRA 2P3ZA 3I3BA 2ZX9A 2P50A 2KZHA 1E1CB 3U5YA 2YR1A 5I3GA 4DYJA 4MJMA 4OJYA 1BVNP 1RD6A 4KEMA 3P5YA 1IXNA 1QNRA 4FLSA 3QJAA 4ZQMA 4ECLA 3B8DA 3HTWA 1DYSA 3EOOA 4JTGA 3QTPA 4IFKA 3OLDA 4W8LA 3WY1A 2H8ZA 4YYFA 4M0XA 4HQVA 3WL1A 3WUFA 2FTYA 1H3GA 4S2CA 1RA0A 3CLWA 4GZEA 4JTTA 3DGRA 1GVEA 3KDOA 1UQYA 5DY3A 4XIMA 1UKSA 1KXVA 1XDMA 3T0CA 3LLDA 5M1TA 4OOZA 3MP4A 3QZ6A 1R9XA 2C8NA 3BLIA 2GQ3A 3LSBA 2ZCGA 1OJXA 5C6MA 3KXQA 2E5DA 3CV7A 4ENLA 2PCQA 2QLYA 3IJIA 5BYWA 4LRTA 3A9IA 1XBYA 3GNDA 2BZNA 3R8RA 4E3VA 2JE8A 2NLIA 1UD5A 3ECQA 2H3DA 2YFNA 1PWMA 5BRBA 5C2GA 1LF1A 4AMCA 5EBAA 3THUA 3P14A 4X0NA 4YTRA 1G0CA 4QE4A 1XHGA 1XXXA 3P93A 3MI2A 3DFOA 4RL3A 4Y9PA 5A6MA 3TJXA 1R3YA 2GGIA 1B3ZA 3B8VA 5AVNA 5M03A 2E77A 2JKEA 2RUSA 3HPFA 3PZNA 4JQ3A 2Y2WA 4XZBA 4UZUA 1RVGA 3DH7A 1P5BA 2REQB 2E0PA 3TJIA 5C7HA 1LRQA 4ACZB 3AXMA 7TAAA 1JNEA 1XKJA 1O1HA 1FVPA 1JCTA 1Q6LA 3TMLA 3GTIA 2CWXA 2WHJA 3NFUA 3H7VA 2J7HA 4FLOA 3VZZA 5CPSA 1FWNA 3TU9A 2I5QA 2PDGA 1EX5A 2V0TA 1M03A 5C0QA 4JL2A 4KWSA 4BI5A 5CGMA 4EF8A 2I56A 4U28A 1XIGA 2BOFX 5M3WA 2ZQ0A 4A8IA 1V5XA 1B57A 4Q7IA 4DJEA 3PB0A 4O53A 4GQ0A 3NDZA 3BG3A 2E6YA 2W0UA 5IOBA 4JTKA 2OQHA 4S3EA 5FL0A 2J25A 4UTUA 5C9RA 4I3GA 2DUXA 2QJJA 2XH0A 2OEJA 3M0MA 3FN9A 1ELSA 1HKWA 3Q2DA 5CGQA 4LYKA 3LG3A 2G3MA 3WX7A 1E56A 3DHDA 1EBGA 5FACA 1GYNA 2PB1A 1XYFA 3BV4A 4L6OA 1TMLA 4IUGA 1BVWA 2D2JA 4OV9A 3RCYA 1U33A 1LJYA 1JD7A 2FPYA 3RJYA 3WLOA 2OSYA 2WMFA 1AJ0A 5FJPA 5JUVA 5C2XA 4EXAA 3TNOA 1MDLA 2ZUWA 4ATWA 1SVDA 3KW3A 2FZ9A 3M46A 3CIXA 1A3WA 4ADTA 4BK9A 3W1PA 4J3UA 4PTXA 3GTXA 1KCXA 2VZSA 4MUZA 3BWWA 1PIGA 1DXIA 1FUYA 2CBVA 2NQLA 3VCNA 3S2MA 2YDAA 2BTMA 1IZCA 3H2CA 4PRRA 1RHCA 2VENA 3UW6A 4AMAA 4IUOA 4LEFA 2CU0A 2E8YA 1V8EA 3BW2A 3DFQA 4GLEA 3ARXA 1JI1A 5FEXA 4PB3A 3GR4A 3ZR5A 2QUNA 3KZSA 3Q58A 3UR2A 3LTYA 4I5UA 5C9UA 4IFRA 3B8WA 1E55A 1NP2A 3OLEA 2DDXA 4JYFA 3A64A 2QVHA 3GH5A 3KWXA 3F2CA 4GYJA 4MVAA 4W7WA 1O1ZA 3U2EA 1QWGA 3TAKA 2R8WA 5DMNA 3M5XA 4G6CA 3RUBL 1HFBA 2QNEA 1LQ2A 1MRAA 5CBIA 1X1NA 1US0A 4LVFA 3NQDA 3ANVA 3TW6A 1GW9A 3ZR6A 2YCKX 4J1OA 1NY1A 1O4UA 5HMEA 3SQMA 4WSJA 4C7DA 4C1NA 5MKGB 1E5JA 4KMQA 3REQA 4UR7A 5HMDA 4UQEA 2GGJA 4OGZA 4XBKA 1O60A 4NX0A 3USZA 4DZHA 2JGQA 1ZAHA 3WF4A 1FWAC 3RRXA 5C5YA 4W8BA 1E9ZB 1H11A 3W7IA 1EYEA 3N2MA 4KKXA 1LORA 2DT2A 3ITYA 4Q4QA 5JXQA 3EX4A 1OX6A 3NURA 3QLDA 3WH6A 4AZGA 3LM3A 1KGUA 4XD6A 3BICA 3SCOA 4IF2A 1ISYA 3KP0A 1Q8AA 1TVLA 3UBPC 3W7GA 4JIRA 4KGLA 3DESA 1HL8A 1XLLA 4IPLA 5DEZA 3LGDA 2XVNA 3WQCA 4QGCA 4J7RA 3AIVA 4MOZA 5T9BG 1XIDA 1HX0A 4JHOA 3W7KA 5DBTA 1DORA 4BWLA 2YL8A 3ISIX 1EC7A 3U2OA 3ONCA 2WKLA 2ZXQA 3EMQA 4KT2A 1BQGA 4FI4A 4I5RA 3V0SA 1EO5A 5HWMA 4PMOA 3VDGA 7ODCA 2OKOA 1UWAA 3WD3A 4KERA 3V5FA 4NJGA 3B8SA 4ZO8A 4HMCA 5FD0A 4PB5A 4REQB 4H7ZA 1E3ZA 3BW4A 3UWQA 4CN1A 4K36A 4DN1A 2Z1KA 1K02A 2W67A 4LUTB 3WLHA 1OHLA 2D3LA 3G1SA 4TTUA 1ME9A 2RDUA 2W61A 2HK1A 2EHHA 4F8XA 3F4WA 1W1A1 2FH8A 5I06A 3A3HA 3QV6A 1FWFC 4PCNA 2CHRA 1AJZA 3MPGA 4F2TA 1OX4B 2B7PA 2EPMX 2CETA 3KOYA 4L64A 3NVTA 3C86A 1DXEA 3SEPA 1J0JA 3I3DA 2FZMA 3VKCA 3SW6A 3W2JA 2R1MA 1GOXA 1NDWA 4IL0A 2JKPA 2PDXA 3ZSTA 4GI6A 1WAUA 2DIJA 4KWOA 1GQNA 4FLQA 1WB0A 4PYSA 1ZJHA 2VVNA 5D4YA 1F7BA 2BFGA 2C19A 1TQXA 4I9AA 2V5DA 1GJPA 3B0PA 1H60A 2CLIA 5IDZA 3L21A 2VELA 4UTLA 3E9AA 1ISZA 1JDFA 2PDQA 4IM4A 5EMLA 1Q66A 5LGXA 3PFRA 1B0IA 1VH7A 4H83A 1BKSA 1CXKA 3NR0A 3VMNA 1H7RA 2CLOA 5G1YA 3FA4A 3BPWA 1LUCA 7A3HA 1F8IA 3O0FA 1W3NA 2P8BA 2GJXB 1PBGA 4ZODA 2GDQA 2D2OA 5M2FX 4QS5A 2Q8ZA 1J0YA 1J96A 3A22A 3WDJA 5LA0A 4OUEA 1VEOA 1K70A 4LVBA 3FA3A 3JRKA 2WMHA 1WBJA 3VILA 2PWGA 2EQDA 3KVMA 3SQSA 2HBVA 4JBRA 1VBHA 3G24A 1FHVA 3BTNA 3B9OA 3C8NA 2RJGA 2BODX 4EAMA 2OZ0A 1KLYA 2XTKA 2FH6A 1O7AA 3B0VC 2FVLA 2VGBA 1AMKA 1EC9A 3BK0A 3AS3A 1Z6KA 3UVIA 3D3FA 4WGXA 3MO4A 1IYXA 4XZWA 1VIWA 3SJNA 3FDKA 1JYXA 4PCPA 4W84A 3WELA 1R6WA 2DZUA 1EHAA 1FP8A 4HPXA 2GK1B 4LYRA 1Z48A 8XIMA 5BROA 1V3IA 3L2MA 4P61A 3S4TA 2J4GA 2V63A 5F1UA 5FESA 3MO7A 1ZJAA 5EKYA 1WAWA 3T07A 1H7XA 3UGVA 3KWSA 2DUAA 3V1PA 2BVDA 1OCNA 3O63A 4PBFA 3EZ4A 1UWUA 1WDDA 1RUSA 1TPUA 2E40A 3TEVA 4DUXA 3KOWA 3L2IA 3GZAA 1AJ2A 3H54A 1XLMA 3W7DA 3HG4A 4C6LA 5DANA 2A2IA 1VBJA 1DVJA 2DSZA 3ES8A 3H4GA 4GNVA 3JZEA 3GIYA 2FZDA 2ZTJA 3SGGA 1ONRA 5TQLA 2BVWA 2P76A 3WF1A 1A5SA 1XLCA 1X97A 2X1UA 1QPOA 3AYTA 2PF8A 3OEXA 4LV4A 2XZ7A 2WW5A 3E2QA 3USBA 1KFJA 4ADUA 2J8TA 3AXKA 3WMBA 5KMYA 3VA8A 2PZ0A 1YE4A 3CC1A 3T09A 8RUCA 2QDHA 5DCBA 3FSUA 5C71A 4YTQA 4GOAA 1JCNA 2D22A 3ZIZA 2P10A 5D9MA 1F05A 3P0WA 3WLTA 5LIYX 3NQAA 1KTNA 3A12A 1L2UA 3A6OA 4MG4A 3O2LA 4MIMA 3WDQA 1E9LA 2OQYA 3PHAA 3R6IA 2XM1A 5AHFA 2PA6A 2C13A 2C18A 2ALDA 2VFGA 3OBKA 4ZTYA 3HN3A 2E9LA 3HBLA 3WFAA 2PC4A 5EY5A 1E6SM 2HNEA 3IJDA 1WDSA 3RXZA 1JQXA 3CUZA 3PBVA 4AQLA 1BHGA 1KQYA 1OZQA 1YLVA 1A49A 1LWIA 1TJ1A 3KOFA 1D7KA 3PPGA 3B8TA 1PO9A 1KB3A 3MHUA 1JJKA 4UTWC 3NPUA 3TWAA 3V7PA 2CLPA 3P0XA 3M41A 2VDGA 3RU6A 4DWSB 1ITCA 3W02A 5CEWA 3WNNA 1H63A 4GG9A 2B0MA 3CIWA 4O50A 2C16A 2H9AB 4M80A 3PZTA 3VIGA 3GYCA 1TVNA 3GLCA 4QEHA 3GNXA 1TKKA 4R7JA 2Z00A 2XVPA 1J0KA 4AZ5A 1BTCA 2XSAA 3G6LA 5FF4A 1B3OA 4EPDC 3NZPA 1J0HA 1GKRA 1XQKA 3K8MA 4LS2A 1IEQA 5HQMA 1E6PA 1NTHA 5FJIA 1YBQA 3VK5A 1MNZA 1EWEA 3LB0A 2R6OA 3AZSA 3WLJA 4QG6A 1V77A 1XRTA 2PDLA 3J7HA 5A6AA 2BLEA 3CAVA 1ICQA 4DF0A 4FNSA 2ISVA 2YFOA 3EWYA 3FYYA 2CYGA 3FXGA 1TTPA 1J9YA 4MUPA 2PFHA 1PZ2A 3WN6A 3MJMA 5HJLA 1P0KA 4BHYA 4J3SA 5FJOA 2NVCA 4KETA 1GK8A 4UZSA 2ZE0A 3UY7A 1YDYA 3PG9A 1RCQA 2DIKA 3KHDA 1L8PA 3K46A 4IPJA 5PTDA 3GNPA 2CCRA 2PDHA 3TAOA 1F4AA 4YPJA 1RLDA 1POKA 4Q22A 1AODA 1P43A 3MY9A 4HK5A 4GY7A 1UD4A 3PJTA 1RJPA 3V5CA 3IEBA 2DZVA 4B5UA 4JKLA 4YHGA 7REQB 4V1YA 1TCDA 1SO5A 4QIUA 3CZJA 3SRKA 4KFPA 4US5D 3W76A 5I78A 2IKIA 1HXJA 1VFHA 1LM1A 3KFTA 3EMZA 2AKZA 3L5MA 1LLWA 2ANUA 1GOMA 3EOEA 1V93A 1ZHAA 2GGEA 4S3FA 2QGHA 1A3XA 1ZPTA 1IWAA 1VYPX 3KZPA 2QR6A 3UERA 1RPKA 1XLBA 1KA9F 1IZKA 1M5WA 3RNDA 3L4ZA 1OC7A 2WMGA 4AD5A 3RN6A 3SCUA 2V82A 3IRDA 4FIRA 3NEHA 4S3JA 2QEZA 3ZMRA 1KXTA 4O1AA 1RBLA 3DENA 1H7NA 2GOUA 1MQPA 1FTXA 4J5NA 5AYBA 1DJQA 2BP1A 5CKSA 3MP3A 3G1VA 1XINA 3R58A 3OLIA 7PTDA 3NXFA 4F3HA 3RM8A 3KS6A 1G5AA 4RUBA 1XGDA 3C2EA 3GC4A 3UJRA 4NP7A 1S5TA 4GMEA 3OZMA 1PS9A 2BWGA 3ARYA 1RD5A 2QAPA 3QTGA 3R12A 3AU2A 1UBPC 3QR0A 1YXYA 2HISA 3BCJA 4Q6XA 3DDMA 3QM3A 1GYLA 2ISDA 1KFEA 4LAZA 1EEXA 1VS1A 3A24A 3K1GA 3UR5A 3MUCA 3QKZA 1M68A 5AC4A 4IJRA 1FCUA 3RO6A 4H8VA 3VD9A 3A3XA 3LHTA 2J7EA 4AX7A 4NJKA 1V08A 3S6OA 5C2CA 3WF0A 1U1JA 1XG3A 3PBYA 3R79A 3S5YA 3SY1A 1NDYA 3U9IA 5EMJA 1S1RA 2OZ3A 3FOKA 1GVOA 3W1TA 3DX5A 4W9TA 1OCQA 2VRQA 3M7WA 1KFLA 5I79A 1CWYA 4HPNA 1QI2A 2OYLA 1EA9C 4EP8C 4PSRA 4X9SA 4TVCA 2YL9A 6PTDA 4DBWA 4H8UA 5AC8A 2YZRA 1XUUA 1EBHA 3MCNA 3Q45A 3L65A 2A79A 2DT1A 3N2CA 3GKAA 1QWKA 3QVQA 3KCLA 4Z1CA 2X09A 1EJUC 4O12A 3PULA 2OT1A 2XN2A 3VNZA 5A6BD 1BEUA 2YKKA 4R9OA 2DZSA 4QX4A 4K39A 1JPIA 3VOIA 4MNKA 1M3UA 2VX4A 3C0JA 8CGTA 3DBPA 5FOOA 2X8RA 1YPXA 2EG6A 2J75A 2H8XA 3GVGA 4PMXA 2EG7A 2DZTA 1TWZA 2F6KA 3CAWA 4HT3A 3W1QA 2NWRA 2ZXAA 3VU2A 3WLSA 1W5QA 4N9EA 4RLIA 1TPEA 4QAWA 2J88A 3FJ4A 3RLUA 1W8GA 2Y7DA 2QQ6A 3SCQA 2Y6ZA 1P0EA 4H1ZA 3KBJA 4ADSA 4C65A 3CTLA 2RH9A 2VR5A 2PP3A 2O9RA 4HNTA 2WVVB 1E6RA 3F03K 1XSIA 1J01A 1Q85A 3CZLA 2NWSA 2VC9A 5LZLA 3C0SA 3TSBA 1FOBA 1VEMA 4AC1X 1M7XA 3JU2A 3M4HA 1ZTVA 3VIJA 1XH0A 3SGUA 3EA2A 3S5NA 4NSBA 4UFHA 1SSDA 2OELA 3TLQA 3HQNA 2HXTA 2UWFA 3PZQA 5E0KA 5ABHA 3ZVIA 1Q6FA 2D73A 3KLKA 5H8MA 4XD5A 2Q3OA 4J3XA 2ABAA 2XHYA 3TH6A 4PSPA 4GXMA 1L0PA 4NX5A 4UFLA 1BSLA 2FLIA 2Z1BA 4C6EA 3ZZ1A 2YCIX 5K9CA 3TCSA 4XAZA 3UG8A 3QOMA 4HD5A 1EDTA 2QCFA 1KTBA 1W9BM 3CPUA 4XD4A 1JL8A 3WF2A 2QV4A 4U3CA 3LYEA 2PLCA 3MKKA 5A6JA 3IUDA 3NOYA 3T4CA 3GR7A 4AFYA 3SIZA 4LCQA 3MSDA 5LNWA 3RR4A 3HPAA 3P8JA 3M0LA 5B7ZA 2V8ZA 3SCSA 1HGYA 5MKGA 4YIWA 4JL1A 4INFA 4GJ1A 5EMKA 4Y9AA 4BJHA 4JGDA 3C6CA 5LKYA 3BLPX 4G7EB 4AW7A 2ZXDA 4O1DA 4I8DA 1HKKA 4JEQA 3SI9A 2O7QA 5AHIA 3PFMA 3R1ZA 4TR9A 3AMDA 3W85A 3PZUA 4YWIA 1MQRA 1N2VA 3ITGA 1VRDA 1DWHM 5FJRA 3ZJKA 1BYAA 1ZFJA 4GCAA 1JXJA 2YLLA 1YDVA 2A7RA 3IVUA 1BXNA 3LLFA 3T2OA 5HDRA 4GYKA 3DXIA 4JIPA 4PA8A 1QK2A 3CB3A 5BNKA 1AFSA 1QI4A 4DNHA 3WD1A 2F84A 1MZRA 4ACYA 1BQCA 1OG6A 3G18A 1IZJA 3IJ6A 2EPNA 3W1AA 1J5SA 1N8FA 4DXXA 2POTA 3GNRA 4O4WA 1M01A 2ZUUA 1V6TA 5A94A 1NDZA 5DMLA 3EA1A 2GSHA 1SZFA 2CIPA 1TV3A 2AQOA 1Z89A 4K8EA 4W93A 4PBEA 1R2TA 3LV5A 2GVEA 3L9CA 3RMEA 1YRRA 1VENA 5FI8A 4JQ1A 4S3AA 2NXHA 1G4PA 4BKNA 1AVAA 4Q8QA 2D20A 1S2AA 3TSDA 4B5SA 5I3IA 3PZ9A 5U4NA 3BGAA 4TV6A 3GG0A 1YXCA 1GVIA 2X7VA 3ZS4A 3D0CA 2CBJA 1E6NA 1NWUA 1UBSA 5I24A 4NASA 4MNMA 1THFD 4EIVA 2OTDA 4QCFA 2A3EA 3IK2A 4IHCA 5CAKA 4JTDA 4LVAA 2GVGA 3PZOA 1I2QA 2R1KA 4UUIA 2JBMA 1JPDX 4IQDA 3W81A 3HPSA 4FXSA 4JTFA 1WOAA 1UZDA 3S5SA 2QIWA 1GORA 1OX4A 3I7SA 1JF5A 1DL3A 4UTIA 1HJSA 8A3HA 4J2PA 2O4MA 4PEEA 4XSMA 1BG4A 4GK8A 1JULA 3S9ZA 1J18A 3AIQA 4L9XA 3NA8A 3UXLA 1ZAIA 1IXQA 1DE6A 1VRXA 3W1XA 3V4BA 3WLNA 8XIAA 1ZS2A 4C6KA 1OVDA 1GHSA 1XBZA 4F9JA 2ICSA 1AL7A 3VKAA 4FOJA 4H6EA 5I07A 3QQ1A 3SAZA 3S83A 4RJEA 2ZDSA 4PE8A 1S38A 2L5HA 4LJ3A 4D8AA 2V5LA 2BY1A 2QDDA 4NI8A 3R2GA 5LHEA 1IEVA 1QNSA 2OZ8A 2I1OA 4UQDA 3ARQA 2YCEA 3CWHA 3EAUA 3CYVA 4X2RA 1O68A 2QJGA 3L5AA 3IPWA 2JALA 4C6NA 1N8IA 1W9UA 4QP0A 1AQHA 2GJXA 2GVJA 4MTVA 3PSWA 1GTEA 3KBSA 3M7SA 5HA7A 5HAOA 2RKXA 1UOZA 3N04A 3GSMA 1XFBA 1KCKA 2QVNA 4HK7A 1W17A 1H4PA 2UZ9A 2YXGA 3AXXA 3TQKA 3QMTA 2WQDA 1J8VA 3COTA 3AIRA 5FEPA 5A6KA 2XSBA 2ZZ3A 2VUYA 5A8PA 4K1WA 1TPFA 2VFIA 3A23A 1EF2A 1EJWC 2PWHA 2HE5A 2P0IA 1XWYA 4H7CA 2DZWA 3VABA 5FL1A 2ZRYA 5IBXC 3LV6A 3SURA 4E8GA 1VLIA 3LQLA 3AHTA 2QJMA 3H7RA 2ZKMX 2YL6A 4KFOA 3EOLA 3K1DA 1L6GA 3MC5A 4GD0A 1I4NA 3SJ3A 3TTYA 1VB9A 2A21A 3GQYA 1B3YA 3EWBX 1SZGA 3H8AA 1VLWA 1DXFA 4CNTA 1G7VA 1BGGA 2Y5SA 1XGZA 3NQCA 1S3HA 2GK1A 1EL3A 3N29A 4JQAA 2BXVA 2VKZG 2NUYA 4FAMA 2QYGA 1X8FA 1VZWA 1MI3A 2YL5A 4TX9A 4FIQA 2NZLA 2AKMA 2WC4A 4AD4A 4WSKA 5K4XA 3PZGA 1ONWA 5FAGA 1SMDA 4AZ6A 1ITQA 3BZJA 1OFPA 3NSMA 1VGAA 2QMKA 4L1GA 1KLZA 4PTMA 1QK0A 5TD4A 3TZFA 2VHLA 1G94A 1RP8A 4HA3A 4FOKA 3B4YA 4B92A 3RMJA 4EAYA 3WENA 4M5PA 2GOKA 3PJXA 4AB4A 2FGBA 4JTLA 1CX9A 5JBFA 4JCLA 4PCFA 4QSFA 4ZQOA 1V0KA 1AD4A 1VPQA 3UY8A 2E3ZA 4OBTA 4U2YA 1WCGA 3L4VA 3K8LA 4JY8A 3LSCA 3SIMA 3MTWA 2ZUSA 3O3RA 4HZ8A 4Y2WA 1AQFA 1SZRA 5AZ0A 1JUEA 5EYWA 1HF6A 3C2RA 2GGGA 4Q7NA 3VOFA 1UUOA 4RNIA 6A3HA 1XFCA 4Q4SA 4EXQA 4H19A 4LRSA 1F5ZA 3C0LA 4MSSA 3FHQA 3SSJA 3N14A 4M24A 3QY8A 4MWAA 4WY0F 3VFLA 1TTQA 1VF8A 5AYIA 1S5VA 3WNOA 1UCWA 3G8RA 3AMKA 1FY6A 1KGXA 3LPOA 2DPEA 4PMQA 5GNYA 1BRLB 4MF4A 3ZM8A 1B2YA 4DJDA 3W72A 3VINA 4S3GA 4P7RA 4Y6GA 5BZAA 2C3ZA 1WBHA 3N6QA 4M51A 1WUEA 3O6CA 2IS7A 2BGSA 4AZCB 3W2KA 2B7QA 1XIBA 3PWIA 2XISA 5CBJA 4PTNA 2VCCA 3MDWA 1UR3M 4ZQRA 2PUZA 3WFZA 4X60A 1SSGA 4ASTA 3IUHA 2OPJA 3DN5A 1QUMA 2FKPA 4MZYA 3ARSA 4IGNA 1EJXC 4Q8OA 3QSRA 1OK4A 2XFWA 4FNRA 4FPSA 1ZAJA 3KBNA 3ARRA 1P48A 1EGMA 3ZT7A 4ZB5A 4JTRA 3EBVA 4C6QA 3GXPA 3TXZA 4HYRA 1OB0A 4JS3A 4DI8A 1QI0A 3YPIA 4MMWA 4DWSA 3B9DA 1Q6OA 3L4TA 4UFJA 3GUGA 3GU2A 3FY1A 4MLRA 3LCHA 5BXPA 1UQZA 2H9AA 2OEMA 1F3WA 3GVQA 4OECA 3LMZA 3UXDA 4FNTA 2ZUMA 4HKPA 5LNUA 4QAIA 1V6UA 1PCWA 3AJXA 2GVLA 3GFYA 4B2DA 1MNSA 1ONXA 2G97A 1UD6A 1KBJA 2AAMA 4H9UA 1DQWA 4UXDA 4ZE5A 4MHBA 4D8ZA 5H8PA 1JZ5A 3TUUA 4S23A 3UEQA 4WXZA 1EGVA 5HPOA 4MDOA 4DJFD 1JD9A 4ZB2A 4UMBA 3OP2A 3GBEA 1VCFA 3L66A 1RH9A 4OIFA 4QHRA 4XO6A 2Z25A 2FVMA 3ZYZA 1R2RA 4ZO9A 4KEUA 1E9YB 3FKKA 5KITA 3SM0A 4LB3A 2QJHA 3NL6A 4JY9A 3CMJA 2F6XA 3EX1A 4XAGA 2J7FA 4JOMA 1H7OA 4M82A 1CTNA 4CD6A 3CGTA 4AH7A 5HNNA 4J3WA 2PD5A 2YCLB 4B90A 1ZGDA 3AISA 1ZUAX 1Z42A 3S3GA 2W91A 1IEXA 3T42A 4XKMA 1TV7A 3NPVA 3OIXA 4GIEA 1Y7VA 2EBNA 3M16A 3E0WA 2WZEA 3FK4A 3N73A 3PN8A 1PIIA 2GJPA 3QBUA 3U4FA 4D71A 3S2LA 4IFKB 2XWDA 1S5MA 2ZZ4A 3H2NA 2YW3A 4TU1A 1CLVA 1H61A 2XZ9A 1XYBA 3NGFA 3R7MA 5DMYA 4GPNA 2J9XA 3EPNA 4RZBA 4DJFC 2PRLA 3BGJA 1GCYA 1UWIA 2YBUA 5C55A 2EXOA 2BY0A 2O55A 2CPUA 3BOXA 2F2HA 2C1IA 1S3TC 1W3JA 4XWUA 1W1PA 4ES4A 4XD3A 1O6IA 4O28A 5GPRA 1PVNA 1FP9A 5HWJA 3MB9A 1QO2A 5CPQA 3VNJA 3OZOA 5JBEA 4CD5A 2C79A 1V3JA 3W7QA 1E0XA 1DIEA 1RPXA 5G4EA 3RIKA 4K38A 4KEZA 2PU1A 3M0YA 4JFTA 1FWWA 1VEPA 4UNIA 3AXIA 4Z2GA 1TUXA 1NOUA 1W3HA 3II1A 3QR3A 1H7WA 4H41A 3TCEA 2PBGA 3WQ6A 4K6AA 1KM4A 3N6JA 1T7LA 3D3AA 1UUQA 4KCUA 4P8XA 1R3RA 3W0KA 1BWKA 3EXTA 2R94A 1BXBA 1XG4A 5J5RA 5RUBA 3QPYA 2CITA 4R7OA 3EXRA 3IIZA 4EE9A 1EO7A 3GB6A 1O95A 5HK4A 2DW6A 3O05A 2XH2A 2NV2A 1MQQA 3P62A 4KWUA 4A2RA 2E1DA 3AUOA