3TQ0A

Crystal structure of leishmania major dihydroorotate dehydrogenase in complex with fumarate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
SMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Crystal structure of dihydroorotate dehydrogenase from Leishmania major.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3tq0A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tq0A01
3M41A 2AQWA 2GQ8A 5FF3A 2Q3OA 2PRLA 4P2VA 3GDTA 1IXPA 3TJLA 2YZRA 4MIMA 3S5ZA 3C56A 4UTKA 3G1SA 2BLEA 3G8EA 1FWTA 3MJYA 1SO4A 3HOJA 1JRCA 1OJXA 3P81A 3LI1A 3BK0A 3PY2A 1G4PA 1W1ZA 3N73A 5KINA 3HF3A 5AHLA 4GFSA 4HIBA 3GXNA 3W7OA 1OVDA 1O94A 3MW7A 5C2XA 1WBHA 1NAL1 2QJGA 4LS0A 3IVUA 1OK4A 4WOZA 5FEPA 1W5NA 4AAJA 3S5YA 1I2PA 3DHFA 1Q6RA 2GQ9A 3EWBX 3SECA 3UY7A 5CSRA 2NXGA 4JTKA 3UWZA 1BWLA 4I7UA 1RZMA 4UTWA 5HNRA 4K37A 1DKWA 2VFGA 2X1RA 2ZZ5A 4PC8A 4Z0SA 1TTJA 1I2RA 3W7PA 3MHFA 4Y90A 4JYFA 4BR1A 2V9DA 1W5MA 3ELFA 4FHAA 3G1DA 3O8AA 4ZQPA 3BLEA 3VNDA 3R8RA 5BRBA 3NL2A 4AF0A 4FNSA 6TIMA 3TU9A 3HO8A 3MBDA 4GXMA 5A5WA 3TSMA 3GZ3A 2YSWA 1VRDA 5C5YA 4JEQA 5CSSA 5EMUA 4EVZA 1E51A 1R2SA 1PVNA 4K8EA 3R13A 3FS2A 2J88A 3W75A 3W7NA 4MZYA 1FY6A 1AMKA 4UTHA 2C3ZA 3HGRA 4A22A 1WDWA 4LS2A 4BWLC 1ADOA 4OV9A 1B57A 1TMHA 3BO9A 1TPB1 4NNCA 3DFOA 2OZ0A 1A50A 4LUJA 4LC6A 4XWUA 5ABTA 2G96A 5CZTA 3PB2A 4OBTA 3LOTA 2UV8G 3TV8A 2ZTJA 3HPSA 1F5ZA 1JCNA 2QUUA 3QQ1A 2VEMA 4FXRA 3CU2A 2ATSA 3NZ1A 1DBTA 3HIJA 4DQWA 3LI0A 1YYAA 4X22A 3R12A 4O17A 3E96A 2DJXA 1OFBA 3L21A 4LVGA 1KM1A 1EWEA 3ANYA 1DVJA 2DZXA 3STEA 3S5NA 3IRDA 1F6KA 4AXKA 5I3IA 1WXJA 1G7UA 4LRSA 1I2NA 1LCOA 4IPIA 4PL1A 5G2WA 2H3DA 2ZRVA 1X6UA 3QMSA 4UTJA 3CWNA 1QFEA 5F1VA 4CQAA 4MY8A 4ZQMA 4TX9A 5LKYA 4S2BA 4BI7A 3ATYA 2FQIA 4LWWA 5FEWA 4YCPA 3NM1A 2CLOA 3TW6A 3NQVA 3K30A 3DZ1A 3HGJA 2RFGA 4JTSA 3NEVA 3QZEA 3TH6A 3S42A 1PCKA 2E6FA 3NPVA 5LNWA 3Q2DA 3PWAA 3W22A 3GNDA 2VXNA 2ZZ1A 2OMAA 2CZ5A 3KRZA 2QUTA 4O12A 3A24A 5EL1A 4Z1AA 1J4EA 2J24A 1NF7A 5AYYA 4JTLA 3HG2A 3KX6A 4PEKA 2FB2A 4YMZA 4NZFA 3W7CA 5D2WA 3DI1A 3OHIA 1OX6A 5HWNA 3P5ZA 1TSIA 3P84A 2EGZA 4NJKA 5A8GA 3W7DA 1YADA 3NGJA 5KZMA 1GG0A 4PODA 2CLHA 3LTSA 4IQLA 1TREA 4RJEA 4MPQA 2CZDA 2FLIA 5DY3A 3C2VA 3PM6A 3P8JA 1VS1A 5CZ0A 3QRHA 1K7XA 1FWRA 3Q37A 2QKFA 1C8VA 3STCA 2QCNA 1R30A 4HNTA 3NL3A 3PBUA 4LU0A 1QCWA 2NV2A 3W88A 2E5DA 4GWEA 2FTPA 3LCIA 3TJXA 2WNQA 3F03K 1LDCA 3W1LA 1VQTA 3UWYA 5AYZA 5D2YA 3UWUA 3L5LA 4FNQA 1P0NA 2ZZ4A 3G1VA 1WQ5A 3TQ0A 3W7RA 5G4EA 2O7SA 1MSSA 2CW6A 4JNMA 4H6KA 2DZVA 3LTYA 4Q4KA 3T40A 5FI8A 3MHUA 4RK8A 5IBXC 2Y62A 3AJXA 3W76A 3GKAA 2CU0A 5HWJA 1DJNA 3LRMA 2WNNA 5CPNA 2QDHA 3M6YA 3L68A 1YDOA 3B0PA 4GE8A 1SZNA 1VPXA 3P5YA 3W1TA 3MHGA 4FB7A 3BGJA 4NJJA 1XBZA 5T26A 1GTHA 5TQLA 3KVKA 1EUNA 3L5MA 1L6SA 4NJGA 2DP3A 1EP2A 1L6YA 2ZFAA 4AEOA 1A5AA 1NVMA 1TTPA 4FXSA 3N2MA 4N9DA 3C2FA 1FDZA 3A22A 3TXZA 5CPMA 4EOUA 3QEZA 4ZQCA 1M7PA 3CEPA 3TXVA 1QDSA 2Y70A 3BV4A 3LXBA 4NXSA 3YPIA 1H7NA 1OX5A 2ZCGA 2CLEA 1I2QA 3R89A 1LTDA 1W3NA 3HPXA 3PR2A 3LLDA 1G69A 1K02A 3NQCA 3VE9A 1KV8A 1IF2A 3W84A 2WPBA 1TB3A 2Z6JA 4KKXA 1SW3A 4BI5A 1WYIA 3IV3A 4LNYA 1XM3A 2E1DA 1MEIA 1KFEA 3LV6A 4JTGA 4WXYA 1F6PA 4D2JA 2EKCA 3SGZA 1F76A 1ZAJA 5E1QA 2YXGA 2JK2A 3M5ZA 3UD6A 4N9EA 1SO5A 4NJIA 1L9WA 2LLEA 2ZZ6A 3I6RA 3L9CA 3NR0A 3OEXA 4O4VA 4QM1A 4PCFA 2WSQA 2E6DA 3Q58A 3W1QA 1DORA 4K8HA 4I7WA 2ZBTA 4JYEA 1Z41A 3W1AA 1TV7A 1GWJA 1TCDA 5AHNA 4HNNA 4WD0A 3MWAA 1KM6A 3G22A 2GUUA 1OYAA 3N2XA 5L9FA 1UJPA 4LT9A 3FEMA 1TPUA 4O1CA 1G7VA 1SO6A 3C4UA 1VLWA 1A5BA 2F7FA 3EWZA 4A2SA 4J9JA 3CIXA 5AHEA 2Y89A 4UMAA 4WY0A 1XCFA 1H61A 1B9BA 1RD5A 1EIXA 1TO3A 3DKLA 2E6AA 5D2XA 1W3IA 5D2VA 4AWSA 3SIZA 4NT0A 8TIMA 4JX4A 2C19A 5D05A 2ZZ2A 1XXXA 4HHPA 2B7PA 4UFJA 4QAIA 1T8XA 2QCCA 5I3KA 1I45A 1QOQA 2Q8LA 1EWDA 2FPTA 1OF8A 2BZNA 3QMRA 3PUDA 3LBMA 5HQEA 4AB4A 4K7YA 1WA3A 3NQGA 2G5WA 3GB6A 1UBSA 2WSYA 2JKAA 3FKRA 4XZ9A 1FWNA 3EKZA 3EWWA 4FIRA 1OX4B 3NQ7A 4IXXA 2GPTA 1FUYA 1JCXA 5DCBA 3EXRA 4O10A 1JULA 1HL2A 2C6QA 1QOPA 2V81A 2Q8ZA 2QF7A 3ZWTA 3WK1A 1GG1A 2Z0IA 4YLWA 1HFBA 1H1ZA 2R8WA 3N3MA 2DORA 3M9YA 4JY9A 3USBA 5EYWA 4O18A 2TYSA 4JR5A 5LHFA 3HMJG 3T4CA 5HR7A 5CKSA 3G0UA 3PS7A 3STFA 3W7HA 5AHFA 3FJ6A 3CEUA 5LGZA 2A1YA 3TFCA 4ZVJA 4UNLA 3M5VA 2C16A 2W79A 1TPWA 3P8IA 3KRSA 4XKYB 5D02A 1GYNA 3GAKA 4OQVA 1ZJIA 2B7NA 4M7SA 3LTPA 4ADUA 3MMTA 3TR2A 1JQVA 1P5BA 2Y88A 2A7RA 3EKLA 4RXFA 1NF0A 3UXDA 1YXDA 3BW3A 4KWWA 4POCA 1JRBA 2A7NA 3BG9A 4UFKA 2NX3A 1G4SA 3M47A 3VCRA 5IM51 1LBMA 1V5XA 3W86A 3B03A 4OWGA 4DF1A 4EIVA 2RDUA 4MLJA 1KTCA 2V2DA 3GR7A 4E2BA 2VENA 2A0NA 1GVSA 3OBKA 1RQBA 5AN7A 4GUHA 1ML1A 3S8HA 3LERA 2YW4A 1TRIA 1F7BA 1HG3A 3GYEA 1DOSA 1KTNA 3DXIA 3C6CA 3QYQA 3S1UA 1VJIA 2NUYA 1SZGA 5F1UA 1IXNA 3RFAA 5HULA 3NQAA 4MOZA 1S5VA 3TMQA 5C6MA 3DFNA 3VKJA 2XFWA 4O11A 3PB0A 1UASA 3L5AA 3W1NA 1JCLA 3GNNA 1G4TA 1SU5A 1PS9A 1GPWA 5C54A 1ZENA 5DCDA 5H2ZA 3I7QA 1ZHAA 2V2CA 3MBFA 2ISVA 3CTLA 2H90A 3UWVA 1LLWA 5FF2A 3G18A 1A5CA 3W2UA 1XFBA 1KBIA 2QJHA 2X1UA 1BWKA 3RMJA 1OYBA 4LTSA 4X2RA 2H8ZA 3M43A 4YXGA 3EB2A 2QDGA 5G1TA 5K7JA 2WKJA 1SFJA 1JVNA 1H63A 3N19B 4JDYA 2H8XA 3PG8A 3UWQA 1AW2A 3G3DA 1K8ZA 3LLFA 3TROA 3TA6A 3I65A 1K7EA 4JTHA 5K4XA 1GJPA 4MYXA 1I4NA 3SJ3A 3QW4B 4Z1BA 2E77A 4GUGA 2HTMA 2Y61A 3EWUA 4WXZA 1EEPA 5CZJA 2NXHA 3LCGA 2NZLA 3V75A 5DBUA 1ME8A 1LM1A 1ZAIA 3GDLA 3I7RA 1OHLA 4RKAA 5D09A 1SW7A 3NXFA 3TUUA 3WJZA 1XKYA 2DZSA 1FCUA 1PL9A 2TMDA 4LVFA 1ZALA 4H4IA 4GNJA 3U2OA 2FFCA 4OU1A 4RZ6A 4O0KA 3AO0A 2PC4A 2WQPA 1LBFA 2DZWA 1LOSA 3N9RA 3W7KA 3W2NA 4L4LA 3S9YA 1Z42A 3PBVA 3I7SA 2QCDB 3QPYA 2FJKA 2A6NA 5FEZA 1TTQA 1G6CA 1GVOA 1FQ0A 4PFMA 5D03A 4DF0A 2QCEA 3M0ZA 1O5KA 4IMFA 2NLIA 5D32A 3SFKA 1Z48A 3LHWA 1QAPA 3DFSA 3TAOA 2ZQ0A 3ZWSA 2JGYA 2PCQA 3QSTA 1IGSA 3W1MA 2FPVA 3L0KA 4WUIA 5G2IA 5LZLA 4N2YA 1XUZA 1K03A 4AVFA 4IX0A 5D2TA 3IIZA 2EHHA 5I3JA 4X3ZA 2OT1A 1LRQA 4JN6A 5I3FA 3W87A 4I7VA 1SZEA 1UUMA 3HJZA 5CPLA 2A2IA 5F2MA 3C2OA 5AC6A 1W5OA 4WY0F 4JICA 3BLFA 5F4XA 4NUWA 5G2HA 4AH7A 2PURA 4DEFA 5F2IA 2VELA 3INPA 2VEPA 1JCMP 5F2GA 3FA5A 1QPRA 2ZTKA 3QQ0A 3DFPA 2H6RA 1EB3A 1AL8A 1H51A 2RDWA 2CWNA 3QH2A 4JXCA 4DXVA 1PE1A 4IMDA 3S0CA 2W0UA 4Z08A 3EXTA 3W7IA 5D30A 3CT7A 3NL5A 4H3DA 2QR6A 1LROA 1H7WA 3G0SA 1K7FA 3E12A 3GDKA 1I8JA 3FOKA 1W8SA 1AL7A 2J9YA 5DY2A 2DZUA 4EWND 1TQXA 2NX9A 2V0TA 2RKXA 4BK9A 1CW2A 1H7PA 3TNOA 1QR7A 3BVJA 3E02A 1DQXA 3LHTA 3U6WA 1JUKA 1DHPA 4QNWA 4K39A 4ZQRA 5EA9A 3NQMA 2Q3RA 1R47A 4JIPA 4CNPA 4UTWC 2ZRXA 3B4UA 1OYCA 4NVTA 5CGQA 1VZWA 2ZA2A 4O14A 2CLFA 4O4WA 1KFLA 4UTTA 1M6JA 1R46A 4TU1A 2Y63A 2X1SA 1W54A 5HWMA 1KFJA 1SSDA 3DGRA 3LDVA 3JR2A 3B0VC 4JGDA 2BXVA 3GAYA 4XBSA 2NUWA 2JGQA 2TPSA 2ZZ7A 4AHQA 2R94A 3DBPA 3NQDA 3ABSA 2OCZA 5CG7A 5LGXA 2V2HA 1GVRA 2C15A 3HGSA 3O07A 1QPNA 4UR8A 5AYXA 4UTMA 3QJAA 2BX7A 4TR9A 2CZEA 4JDBA 1YDNA 3O06A 4WOQA 4KFPA 3TAKA 1BTMA 3TW7A 1YTDA 4JTFA 3PUEA 2E5BA 2HMCA 3C2EA 5K9XA 2NX1A 4OT7A 4Q33A 3TC6A 3OIXA 4LOCA 3S5OA 3PC0A 3GVGA 5CPOA 5LNUA 2V5BA 4LY8A 1OF6A 5EKYA 5HUPA 3LCFA 4YWIA 1YXCA 2RH9A 1G4EA 3IGXA 1SW0A 1GZGA 4HKPA 1VR6A 2ABAA 1PCWA 2QAPA 4OV4A 2B0MA 3C52A 2J9ZA 2NV1A 2WV8A 4DO6A 1ME9A 3NM3A 1Z44A 3S1VA 3NQ6A 1BKSA 3BGGA 3CHVA 1X8FA 1MEWA 2QEZA 3R2GA 2X16A 3TX9A 4M6QA 5DXXA 1OX4A 2JKPA 2O7QA 4AWTA 4JX5A 3TQKA 3A23A 4AHPA 2A21A 4WJEA 3D0CA 2DZTA 4NJHA 3KVMA 3PBWA 1MZHA 4NQ1A 4NZJA 1KM5A 3OVQA 3OG3A 4HT3A 5HJLA 3W7QA 4Y6GA 1TJRA 3B05A 1Q45A 4JIQA 1VCGA 2ZRWA 2RDTA 4W9TA 4O53A 1U83A 3UZJA 1TV8A 4PH6A 4HNUA 1RQEA 1B4KA 2Y7EA 4UFIA 4PL2A 2NUXA 1TV5A 3TK7A 4PA8A 3CQ0A 2VKZG 3NQFA 2GQAA 2YPIA 4XKYA 2B4GA 4HNVA 3SZ8A 1RR2A 2J6XA 3O15A 1TPDA 1VYSX 2ALDA 2X30A 5F2LA 4EF9A 4FF7A 1EP3A 4M6VA 3GLCA 5KMYA 3A21A 3CIWA 4HPJA 4O1BA 3O6DA 1YXYA 4UR7A 1N7KA 1YPFA 4C1KA 4O57A 3E9AA 3TDFA 1F2JA 1SO3A 2AGKA 1KTBA 1H50A 2G97A 3QSRA 2QCFA 3W7GA 2ABBA 1DL3A 3L0GA 1W0MA 4A21A 1FWSA 3M16A 2GJLA 3DAQA 3TQVA 3W6YA 1CI1A 3VE7A 3NOEA 2QUVA 3WFAA 1VCFA 3DFQA 1ZCOA 1IXQA 2VC6A 4UIOA 3VI2A 3P74A 4DO5A 3PULA 1D9EA 3VFLA 2WOQA 5D38A 1N8FA 1VGAA 2YX0A 5H91A 3UNDA 3UPBA 1LRNA 4MVAA 3CLMA 4NX0A 2GVLA 4LRTA 2VFFA 5F4SA 3LXAA 3N14A 3L66A 2NWRA 2VFDA 1VLIA 1F73A 4FNUA 1D3HA 1VHNA 1MXSA 5K2ZA 3G1HA 3MO7A 2GOUA 3A5VA 4N4PA 3NVTA 5G1YA 4TMCA 2WJZA 3MUXA 1T99A 4UTUA 1QNVA 4HN4A 3OVPA 5DBTA 1A53A 1HTIA 2Y85A 3F4NA 4GJ1A 2W6RA 4MFDA 4XUGA 3ABOA 1OABA 1PHWA 3F4WA 1TPH1 2PRMA 2BTMA 2CFFA 5LHEA 3E49A 3G1FA 3T55A 3LB0A 1Q6OA 4QSHA 1JQXA 1YDVA 1ZAHA 4LS1A 5AB3A 5E0KA 2I9EA 4UMCA 3BARA 3G24A 3QFEA 1SQ7A 3W7JA 1NFBA 5AC7A 2C14A 2FPYA 3V1PA 3LHZA 3KRUA 1EUAA 1KM0A 3W71A 4JTEA 1K8XA 2V5LA 3NO5A 3PUOA 3KVJA 1X7FA 3CWOX 5EBUA 3TKFA 4O54A 1KM2A 1V7YA 1XL9A 2CLLA 5BOOA 3GIYA 4HPXA 3EX2A 4ZMGA 3UPWA 3H54A 4UFHA 1EP1A 4N6EA 1EX5A 3KVLA 3C3NA 1TPEA 3RF9A 6ALDA 1THFD 4AMAA 4AHOA 2P1FA 4UTIA 3WJSA 4K7VA 3IIVA 4DBEA 1ICSA 3NQEA 4LUIA 4BWLA 3P60A 1GOXA 1WOBA 1GVQA 2QCDA 4K6AA 4UFLA 1QWGA 4CCCA 3FIGA 3LCLA 4CNNA 1B4EA 1GT8A 3NG3A 5J5DA 3C0JA 3PSWA 3WJXA 4LV9A 5BMWA 5J5RA 1OG0A 2PE4A 3STGA 4QQ3A 3UYCA 4FNRA 3W70A 2FIQA 2QCLA 4MLRA 3M5XA 3M7WA 1ICQA 4CLMA 1UUOA 2DJLA 5D37A 3FJLA 3W1PA 2ZZ3A 3QM3A 5I3HA 3NAVA 3QPZA 1YPIA 1KFBA 1RQHA 4RV8A 2A6LA 1FX6A 4DO4A 4LV4A 1Y0EA 4GC4A 1FCQA 2V82A 1T96A 1FXQA 4JTIA 4ORIA 1FCBA 5DLCA 5DXYA 5HUOA 3LBCA 4MUZA 1O60A 2FDSA 2ZRZA 3EX1A 3FYOA 3LCHA 4L4MA 5HR6A 3M5YA 1EPXA 1FDYA 2V8ZA 2BWGA 4FIQA 3UZ5A 1ALDA 4WQ6A 1ZNNA 2EPHA 4ZZ9A 5K4ZA 1KA9F 4NX5A 4Y96A 4ML9A 3WJYA 1CX9A 5AFDA 2HS8A 3BW2A 2V30A 3IVTA 5KSWA 4MJZA 2D73A 2CLKA 1OFRA 3HPZA 1TIMA 4MY9A 3ABQA 2VFEA 1KFCA 2R14A 4IJBA 3TSDA 4RCXA 1DJQA 3LM7A 3T78A 1H1YA 3E0IA 3B0UX 4ADTA 1MEHA 3BG5A 1ZY9A 4C1LA 4Y8FA 1K8YA 4JTJA 5K9DA 4ZL1A 4CQ8A 2QAFA 1UB3A 3CC1A 1GTEA 1X1OA 2VEKA 3EX6A 3L2IA 3W74A 4MKNA 5BMXA 3IEBA 1EA0A 1QO5A 1TYGA 3WK2A 4YCOA 3WK0A 2WNZA 2YW3A 5AHIA 3S6DA 4IX2A 2C1HA 5G4WA 2OT0A 2VFHA 3LV5A 3O1NA 4O28A 2H3BA 2EF9A 2PRHA 2XN0A 4U4MA 3P80A 2I14A 1XDLA 3THAA 3W1UA 3RLVA 3L65A 5L6UA 2A5HA 1DV7A 3KFTA 1KV5A 2HSAA 4TIMA 1JCJA 4OHQA 3RLUA 5K9CA 4BFAA 1LP6A 5DN1A 1LYXA 1OFQA 3B06A 3PVFA 2ISWA 3TMLA 3LRKA 5LNSA 4ZQOA 4GUFA 4M19A 3W7EA 5FF4A 3RU6A 2E68A 2IQTA 2YFOA 3RNDA 1VC4A 4PTNA 2I1OA 3DU0A 1OFAA 2E6YA 2YCEA 5IBXA 3O6YX 3GXTA 2VFIA 4JTUA 3EWXA 3SW6A 3WJWA 1WBJA 4E2DA 4M6PA 1FBAA 1QPQA 4IUOA 4DPPA 4WZHA 2ZA3A 3ZFHA 4IMCA 1G67A 2CLIA 3F1QA 3CPRA 2KZHA 3FYPA 2ZRUA 5K3VA 1L6WA 7TIMA 1LLZA 3HG5A 3M1ZA 3NQ2A 2X2GA 4O15A 4UUIA 1K3UA 2EAWA 1Q6LA 4TMBA 4QITA 1TPVA 5C55A 3OVRA 1C29A 5FESA 4IPJA 3L67A 3ZS4A 4JY8A 1AW5A 3G1AA 5D04C 4UFMA 1TRDA 4CQ9A 3G1XA 1SFLA 3LXCA 2Y7FA 4Y9AA 3MYPA 4Q32A 3ATZA 5U4NA 1H62A 1VYPX 2Y6ZA 2Z2UA 3EX3A 1SUXA 3T7VA 1W5PA 4LVAA 1H5YA 1B3OA 4N02A 4Z0JA 4N9BA 1KFKA 1LRTA 3LX9A 1I2OA 3LHYA 4BI6A 2YDAA 1O4UA 4K36A 1FXPA 1JR1A 2B7QA 3PF3A 2AAMA 3WK3A 5BW6A 4JTTA 2FB3A 3P61A 3KOFA 1JUEA 4IGHA 3C8FA 3MI2A 3FLUA 4JYDA 3W07A 3B04A 3H53A 3FFSA 3BLIA 4XQ6A 3RK8A 2VEIA 4FNPA 3W1XA 1R2RA 3JS3A 4E38A 1U5JA 5MHBA 4MFEA 5LNRA 5EY5A 3C2RA 3MYOA 1H7RA 1JCYA 2C0AA 3NQ8A 4A2RA 2GVGA 5U7SA 1HO1A 3LCWA 3PG9A 3LHVA 4JS3A 3TIMA 5TBOA 2J9XA 4HSOA 4N4QA 2GJNA 3BW4A 4NU7A 2YFNA 2P0OA 3EX4A 4OGZA 4HSNA 4AF0B 1J5TA 2VOMA 1OK6A 3NPUA 2ZRYA 4MZ8A 3BG3A 1VCVA 2G95A 4GUIA 1T0OA 3GKFA 2NXIA 3IGUA 1WAUA 1D3GA 4IXHA 1SSGA 4NXKA 4RR4A 3CB8A 1H60A 3TC7A 4MJMA 3G1YA 2RHGA 1M5WA 1F74A 1NEYA 4XTDA 1SZFA 3TE9A 4QISA 5AOUA 2JBMA 1KBJA 5AC8A 1QO2A 3NYZA 4ICNA 4MZ1A 3HB9A 4QIUA 3A5FA 4LC8A 3SY5A 2TRSA 1KW1A 1QMLA 3SR7A 3TCEA 5SWUA 1YTKA 1KM3A 3Q94A 2Z1BA 3G3MA 1ZFJA 4A3UA 1FCVA 4M5PA 3S1XA 3NNTA 1OFPA 1WV2A 3UWWA 2Y7DA 4UNKA 1OFOA 3S1WA 3DKJA 3IGSA 2B7OA 4DF2A 5G5IA 4WX2A 1JUBA 5BNKA 1GEQA 3LHUA 4E0CA 3UY8A 1W5QA 2R91A 2E5CA 5KZDA 4OE7A 3EXSA 3P82A 1P0KA 1TPC1 3W1RA 3OA3A 1KLYA 3GR8A 3DH7A 4RX0A 3FKKA 4X9SA 3NA8A 1FWWA 1RVGA 4LVDA 1KLZA 1J2WA 1VHCA 2P10A 3R5EA 4CNOA 4K38A 1TTIA 3HBLA 4O50A 3CM4A 1KM4A 5DCEA 3TSBA 1XDMA 3HG3A 2DU2A 3SSJA 1IIHA 4NNAA 1FDJA 1XC4A 3EWYA 2DZPA 2X1TA 5GVJA 3GDMA 2XN1A 5KZEA 1AW1A 4S1FA 1LBLA 3NZRA 1LOQA 3G0XA 3W9ZA 2A7PA 1VH7A 2ZYFA 1XUUA 1OFDA 1S5WA 5E93A 1M7OA 3JRKA 4B5NA 3KXQA 3GK0A 2A85A 4O8RA 1PV8A 1P4CA 4FX8A 3MP4A 1TPFA 5LSMA 3IVSA 3H55A 3LGEA 3O6CA 3PAJA 3ZR4A 1AG1O 2HS6A 1S3HA 1OFEA 1O95A 3O16A 5FF7A 3TFXA 4G1KA 2JKEA 2Z6IA 4JD4A 1VYRA 1R2TA 3ABRA 3NDOA 3NPWA 1BEUA 2QCHA 5EPDA 4I9AA 1IIGA 4ADSA 1NSJA 1YTEA 3B8DA 3W2JA 1UCWA 3W2LA 3W72A 1GQNA 3UXAA 4O52A 4O16A 2ZDRA 4LW7A 4UTTC 4GUJA 4MY1A 4FEZA 4FX6M 5LNVA 5CZSA 4R33A 1XBVA 4P61A 2ATMA 3SGUA 5FEXA 1PIIA 4ONVA 3THQA 1X1ZA 3NL6A 1WOAA 5I3GA 1LZOA 3I68A 5DELA 4JX6A 3HG4A 4S2CA 2ZA1A 1S5TA 1SR9A 4FNTA 3SI9A 3QMTA 3O63A 3N9SA 4DBDA 1DQWA 3O05A 2YYUA 3W7MA 2WSRA 3LCXA 4XTIA 4UTLA 4KWVA 4O1DA 1PHQA 2OJPA 4UMBA 2Y7GA 1H7XA 1Q6QA 2OX1A 4GBUA 4ORMA 4CCEA 5KITA 3P67A 1W3TA 4Z1DA 4XBKA 2NWSA 4DELA 3W23A 1TQJA 1W31A 4O19A 1WX0A 5FF0A 4U28A 4N6FA 2A4AA 3W2KA 1XBXA 2YGYA 4R34A 3G8RA 4DPQA 4GRSA 4YL2A 4IMEA 4QNEA 1Q3NA 4NNBA 3GX9A 4AWUA 1LOLA 2QJIA 3GXPA 4R53A 2C13A 4RXGA 5AHMA 3HGOA 4Z1CA 3DENA 4EF8A 1L2UA 3LRLA 3UQNA 1GVFA 3L0NA 4UC5A 3DI0A 1A5SA 5HMSA 4FX7A 3QW3A 3IIXA 5HINA 4IOTA 1JJKA 4MYAA 5F4WA 3N34A 1GYLA 1YLVA 3MI3A 1QPOA 3PSVA 3C61A 1C9DA 1F05A 3W83A 1MO0A 3W85A 1ICPA 3BPWA 3W3OA 3M44A 2ISSA 2J27A 5TIMA 1TJPA 4M7TA 2BSLA 2XN2A 3MP3A 3A9IA 1P1XA 4IWWA 2F84A 1N55A 1AK5A 3GDRA 3QF0A 2YR1A 2E09A 1O5XA 2QCMA 2CLMA 4UXDA 2WO5A 4KFOA 4O1AA 3P62A 2TSYA 3QC3A 1LORA 4O13A 1ONRA 4LVBA 4KFNA 2C18A 4A29A 4ALDA 1SPQA 4IMGA 4N9CA 4CCDA 5KTLA 3KHJA 1HO4A 4QJ1A 4R7JA 1XBYA 3EEGA 2CZFA 3W7LA 4WY0B 3IIOA 4RZ4A 1RV8A 3KAOA 4ZQNA 5D33A 1XI3A 4FO4A 1HUVA 3DFTA 3W73A 4O0ZA 3P7YA 3IIPA 3DHDA 3T44A 3PBYA 4RLIA 1H7OA 4UCGA 2YYTA 3W2MA 1RPXA 4RZ5A 1W56A 3MP5A 1ME7A 4TO8A 1W37A 2GVJA 3HQ1A 3NPXA 2QCGA 3MI6A 3U8GA 1IXOA 4BF9A
chains in the Genus database with same CATH superfamily
4X60A 4PUKA 2QPSA 1XH1A 2YZRA 2PWFA 1JF6A 4UTKA 1JRCA 1OJXA 1GOKA 3P81A 4KERA 2ISDA 2RAGA 3ARVA 4GFSA 4AUBA 1WDPA 2QPXA 3W02A 3AIWA 2IQ0A 1ONXA 3PZNA 5C2XA 1NAL1 2AGTA 4LS0A 1HL9A 1OK4A 4AAJA 4AZ6A 1EHAA 4DIAA 1I6NA 3IJDA 3SECA 2XTKA 4BQ4A 3UWZA 4CD6A 1RZMA 4K37A 4Q7NA 3C0LA 4ATLA 3W7PA 3WH8A 3ELFA 4FHAA 3ONBA 1OT1A 5BRBA 1QT1A 4AF0A 3OYXA 5IOBA 3HO8A 2Z2AA 1Y65A 3HQPA 4NZCA 1VRDA 3OB8A 5C5YA 5CSSA 1E51A 2WMIB 3R13A 1KBKA 2KX9A 4TVCA 4A22A 2XVGA 4BWLC 4U5KA 3DFOA 4LUJA 4YNGA 1UP2A 3R10A 4HNCA 1KKOA 4RV3A 1LQ0A 3LG3A 4MMWA 2PLCA 1A5OC 2QUUA 1E1CA 2GJPA 3HFTA 3CU2A 3TLQA 1JZ2A 4GZ7A 1FWGC 1QNSA 2OR2A 4X22A 3MC5A 4J3VA 4KT2A 3L21A 1OFBA 2O9OA 1KM1A 3MVTA 4QE5A 5IDIA 3TN6A 3S5NA 1F6KA 1XV8A 3UR2A 1WXJA 1G7UA 4D9PA 2GDUA 1MNZA 3K5XA 4IPIA 4PL1A 2XZ7A 2ZRVA 3L4UA 3VU2A 3QMSA 1FH8A 1UKSA 3LBOA 4ERGA 3XISA 4TX9A 5LKYA 2Y5SA 1NELA 1PZ2A 4MG4A 4ZO9A 4HYWA 3NQVA 1ITUA 4HU3A 2RFGA 1X96A 1PCKA 1Q13A 2BB0A 3A3HA 5XIAA 4A35A 5A6BA 3Q2DA 3PWAA 4PCTA 6REQA 3CUHA 2ZZ1A 4JBRA 2CZ5A 4IPLA 4NF7A 2QUTA 1UA3A 2DW6A 2G3NA 3QV6A 4KRZA 3KX6A 4PEKA 3N11A 5D2WA 3DI1A 3OHIA 3SY8A 4XBJA 2XVPA 3QLLA 4NJKA 5I2UA 3I3EA 2GYIA 4W8LA 4PMYA 4DNMA 5I5RA 4PODA 2CLHA 3LTSA 4IQLA 4RJEA 4MPQA 4B9YA 3NO3A 3P8JA 1VS1A 2E9MA 3QY8A 3LZ3A 1K7XA 3Q37A 1R30A 2A3LA 4XD5A 3KW3A 1AMYA 1OGSA 1TE1A 5IHSA 2WHJA 5BWAA 2ACRA 3CMJA 4QLKA 1V0MA 3F03K 3RYSA 1RA0A 5CC5A 3W1LA 1QK0A 1PAMA 4JAWA 1MRQA 2HPIA 3I4KA 5G4EA 2L5HA 2VUNA 1FKWA 3WL1A 1EC8A 1J9YA 3B3DA 2VYOA 1MSSA 2PDWA 4B5WA 3OYZA 3SUSA 1FFRA 2XIQA 1FVPA 4MNJA 4XZNX 2PTDA 5IBXC 4FF5A 1GHRA 3TTOA 3AJXA 2O4QA 4MPKA 2MUCA 1WPCA 3M6YA 3RM9A 4GE8A 1QPKA 3HMCA 3CQHA 3P5YA 2BY1A 3BGJA 3FJ4A 5TQLA 3WFZA 1L6YA 4AEOA 1NVMA 4D1IA 3C2FA 1DTUA 3A22A 4IIFA 3L4VA 3W00A 3DYMA 3EDDA 2WVVA 3OGVA 3VOFA 1DJYA 3TXVA 1H7NA 1OX5A 3NUKA 1E6SM 4WHBA 2DUZA 1M53A 1W3NA 5CSYA 3LLDA 3LGGA 1KB3A 3VE9A 1J0YA 3W84A 3RIKA 2D20A 3MUY1 4S3FA 1QW9A 1SW3A 1TWDA 1F6PA 1RBOB 3R94A 2CPUA 1TX0A 5FJTA 2EKCA 2WWDA 1ZAJA 4XG1A 2JK2A 3WD2A 3ANVA 1P6BA 4N9EA 1SO5A 4JTCA 3WG6A 3WNOA 1L9WA 3BZJA 2LLEA 4FSAA 4E8CA 2WSQA 1QOXA 3EPOA 2E6DA 3W1QA 4MB5A 4PMZA 4I7WA 1V8EA 4ZO6A 2V5CA 1R3YA 1GWJA 3W28A 2XVKA 5AKQA 4CU6A 5AHNA 1E70M 3ONCA 4P7LA 3G22A 1BRLA 1OZQA 1XIEA 4XAYA 3QN3A 4AXNA 1SO6A 3VMOA 2F7FA 5A3HA 4A2SA 4BQ2A 3VKDA 3CIXA 4IIDA 5AHEA 4EXBA 4PBFA 2Y89A 3ITXA 1MI3A 2DDXA 1H61A 2I56A 1B9BA 2GWNA 1TO3A 3EPMA 4QQUA 5D2VA 3BSHA 3U2ZA 1ZQ5A 3PTDA 2J75A 4LB3A 4KEUA 1E0VA 1O5QA 4NRRA 1OINA 2QLYA 1XXXA 4D1JA 3CL7A 2FVLA 4GYJA 4LB4A 4D6HA 2DZBA 1EBHA 2Q8LA 3BAXA 2YIHA 2FVKA 1OM0A 3IS4A 4MWAA 1H49A 4LQ1A 3FKRA 1FWNA 4PMNA 3GE7A 3VK5A 3ZJ7A 1D8WA 2WPGA 5DANA 4ZENA 1FUYA 1JCXA 4O10A 1HL2A 2Q8ZA 1YMYA 3PPFA 2YDRA 2Z0IA 3QKZA 1HFBA 1H1ZA 2R8WA 4PMUA 4LF2A 5AY7A 1MDLA 3M9YA 1DWGM 2WHKA 5D9NA 5LHFA 3HMJG 1EX1A 4JHOA 3EDKA 3U48A 5EMMA 3BH4A 2A1YA 1DIKA 1WUEA 3K4AA 2D0GA 3M5VA 3C0SA 4QEEA 4XIMA 1TPWA 3N4AA 4US5A 1WZAA 2QW5A 2VCAA 4AD1A 4OQVA 4RNJA 3GHSA 2QNEA 5ABEA 1JQVA 2G4JA 1HGWA 4V15A 1NF0A 4DUWA 2Q02A 4G7FA 3UXDA 3WD1A 1QUMA 1ENUA 3VIGA 4YPJA 2AKMA 3WQ4A 2NX3A 4UQDA 3AS0A 5KETA 4OWGA 1U5VA 3KBNA 1W3HA 4MLJA 1JZ5A 4GGHA 4IGNA 3EOEA 4MF4A 1OIFA 4LCRA 4P8VA 5EGRA 2CKSA 2GL5A 2O9PA 2WHMA 1BYCA 3SIMA 3M0VA 4EKJA 1DOSA 4OOZA 1KTNA 2R1KA 3C6CA 3QYQA 3QHOA 1VJIA 3KE0A 5F1UA 4TVUA 5LA1A 3DDMA 5C6MA 5EFFA 2INFA 3K8KA 1A0CA 1ZENA 5DCDA 2OWWA 4E6MA 4RPQA 1ZHAA 2V2CA 3BLDA 4C5ZA 3CTLA 1Q6DA 3VCCA 4Z2KA 3G18A 4MJ2A 3W2UA 3EKGA 4ZXLA 5IDZA 1J6OA 1OYBA 1O7AA 1M9HA 4RNHA 3CHCA 1JVNA 5C8BB 4PZVA 1HW6A 2ASHA 3TROA 2F61A 4MYXA 1Z6KA 3SJ3A 3QW4B 3V0UA 4L6HA 3BCJA 3D3FA 1Y5WA 5CZJA 5T9BG 3V75A 2IKGA 5DBUA 8XIAA 1ZAIA 3GDLA 4LXFA 1OHLA 1WKYA 2NQJA 1QHOA 3TUUA 2ZXAA 1XKYA 1CXEA 3U2OA 2FFCA 4OZOA 4RZ6A 1QJWA 3AO0A 3ITVA 3EDJA 4UWMA 1LOSA 1XIJA 4UQ9A 1L2QA 4PR4A 1AH3A 4QDPA 4ASTA 4U33A 1TTQA 3FXYA 2YB4A 1JI2A 3M0ZA 3TN5A 3FSUA 4IMFA 2NLIA 3WQ8A 3SFKA 1NARA 2NQLA 3LHWA 1EJUC 3DFSA 4PMQA 2PDNA 2JGYA 2V3FA 3H4WA 2AL2A 1B3VA 1IGSA 1XG3A 1XIFA 4WUIA 1E3ZA 4F3HA 3PZVA 4P5UA 2EHHA 3WLIA 4Z42C 3FA3A 4X3ZA 4JN6A 1ZPTA 1QNRA 1B90A 4NILA 3N6HA 4C6QA 1ONWA 4IQJA 1XCWA 4LBSA 2GDQA 3C2OA 4QS5A 3BJFA 1W5OA 5DRCA 4ROQA 3U4FA 3HM7A 4AH7A 4Q3MA 3EBVA 4LUSA 5F2GA 1KO0A 1TMLA 3T2QA 1QPRA 4KWOA 2ZTKA 3ARYA 4C6EA 1H2JA 3DFPA 3VNMA 1NM9A 3QH2A 4GY1A 1LT8A 3MUZ1 6ENLA 4DXVA 3BAKA 3QR3A 3FNDA 2YA0A 4GNVA 5FOOA 3GVWA 4GFIA 3W7IA 3NL5A 3AC0A 4H3DA 2QR6A 1LROA 3C5QA 2VT0A 3GDKA 4PSPA 1CB7B 1PEZA 4M82A 3ITGA 1XH2A 1I8JA 2J9YA 4EWND 4Q6JA 1TQXA 2DQWA 3W25A 4PB5A 4BK9A 1CW2A 3TNOA 1QR7A 3Q45A 2FZBA 1J0HA 3WUBA 3LHTA 3PHAA 3U6WA 1CXHA 5BXSA 1K4HA 1UWUA 3PZUA 5EA9A 3CUZA 3NQMA 2Q3RA 1B1YA 5DRIA 2XU2A 3F5LA 3UG5A 4CNPA 4UTWC 1CBGA 1JNEA 3B4UA 3OIHA 1OYCA 3REQB 2ZA2A 4O14A 4UTTA 3APTA 3SCTA 1Q2RA 4GYPC 1JDDA 4PCNA 2WZMA 3WQCA 3BDKA 1DXIA 3E0WA 4JGDA 3GAYA 3NFUA 2JGQA 1AH0A 4RE4A 1OEPA 4BS0A 3GUWA 3NQDA 3ZLFA 2OCZA 5LGXA 3N9KA 4MJ4A 4UR8A 3QJAA 2BX7A 5BXRA 2CZEA 2NT1A 3WH7A 7ODCA 3O06A 4WOQA 4KFPA 4X63A 2OKTA 4JTFA 2E5BA 5FJOA 5K9XA 2J13A 4P7NA 3AXMA 3T0AA 3OIXA 2OO0A 3DUGA 3SUTA 1BTCA 3UJSA 3AXIA 1JZ3A 3LCFA 3WQWA 2RH9A 3IGXA 2OSXA 4ZB5A 1VR6A 2ABAA 2E9BA 3C52A 4DO6A 3GD6A 1Z44A 1CLXA 3N6JA 2D69A 1OX4A 2O7QA 4ZODA 4AWTA 1FFQA 4Q8VA 2BY0A 3OVQA 4HT3A 4JFVA 3B8TA 2WKGA 4QLJA 4M24A 4Y6GA 1Q45A 4JIQA 2Z2BA 1HZYA 4O53A 3GTNA 3ORWA 1EJTC 4UCFA 2AOSA 2WM0A 3VNJA 1B4KA 2IXVA 2NUXA 1TV5A 3TK7A 3WLNA 1VFTA 4XKYA 8RUCA 2EPMX 2QIWA 3F5JA 4L56A 2Q6ZA 3SZ8A 2Z1VA 2QF8A 1RY8A 2X05A 1Z89A 1AD1A 4FF7A 1JYXA 3I6TA 3WDPP 2DSZA 3K2GA 4M6VA 5KMYA 2HNEA 2PMQA 4HPJA 3VUSA 4B5SA 1YPFA 3DHUA 2QZRA 2Y8VA 3AUJA 3CGTA 1H50A 1RP8A 3N2BA 1DL3A 1W0MA 1KBLA 3TQVA 4C6NA 1WKEA 2IPJA 2QUVA 1JIBA 3WFAA 5CC3A 3H22A 1XQKA 4V28A 5ABGA 3L2MA 2PGFA 3XINA 1UR4A 3BOXA 3WMCA 1KR1A 7A3HA 4ES4A 4DI9A 1JG9A 3K46A 4DJDD 2GVLA 2YDSA 2BXYA 1IWPA 2HK1A 1GVYA 3GVQA 3LXAA 3M4HA 3L66A 4GABA 2X8RA 2YXOA 1VLIA 5C9WA 1F73A 4DWSA 1D3HA 1MXSA 5K2ZA 3G1HA 2XM1A 3H7VA 5JU6A 2WVSA 1BF2A 3MUXA 4UTUA 2GOKA 4H00A 1ZBKA 1HTIA 3CNYA 1NP2A 1V02A 5CXPA 4KEMA 3WDJA 1K6WA 3MT1A 4W5ZA 3ABOA 3CLWA 1TPH1 3APGA 1K1DA 5LIYX 2XM2A 2BTMA 3S4TA 1BSIA 3QGKC 1JQXA 4QG6A 1ZAHA 2V6AA 3NGFA 2VTFA 3S2LA 4UMCA 1UJQA 3BXWA 1SQ7A 1E0WA 3PN8A 5BRQA 3W7JA 1DWHM 2C14A 2W61A 3QPEA 4DJFD 1EUAA 2XH2A 2J8FA 5CH9A 2V5LA 4JFWA 4R5EA 4JTRA 1X7FA 5EBUA 1UWTA 4YJ5A 4DLMA 2EPOA 2HXUA 4AZCB 1QI4A 4HPXA 3UPWA 5JH1A 1J0IA 1RXOB 4LAOA 3DHPA 4HK6A 4E2OA 4KEVA 5ABHA 4AMAA 4KESA 1U2YA 4NSBA 4HMCA 5FA5A 3IIVA 3CV2A 4DBEA 3P60A 1GOXA 4GACA 1GOOA 1GVQA 4H6RA 4K6AA 2IQDA 2PTXA 4KS0A 2VCCA 2PSNA 3OLDA 3PZQA 1MUMA 4DWDA 5I7GA 4H8HA 5BMWA 4HGXA 1UP0A 5J5RA 1OG0A 3AS2A 1E0UA 3MCOA 4QQ3A 1PZ1A 3B4YA 4GGBA 1LWJA 1QNOA 4DBSA 2VX7A 3M5XA 3P3BA 1P7TB 4CD4A 4GZIA 3FXGA 1WAWA 2DJLA 3IUHA 4NI8A 4BF7A 4QR6A 2ZZ3A 4H41A 1HL8A 3W37A 3NAVA 3VUPA 3WQFA 3DCPA 3NYDA 1MZRA 2EPNA 4PTVA 3JZEA 3KCOA 3KUMA 1JPDX 1FXQA 4NL1A 2VM8A 3FGCA 3HPAA 4ORIA 1JGMA 3EX1A 3TONA 3N1AA 5HR6A 5HJYA 5G1MA 1A0EA 5T8GA 2Y5JA 4E4FA 4NX5A 1EGMA 3WENA 4E4PA 4Y96A 3TR9A 1C3FA 3UU0A 3BW2A 2V30A 3CMGA 2D73A 2F2KA 1EF3A 2CLKA 4FALA 1VFLA 2I5GA 1IHIA 2VFEA 2R14A 1A4LA 4S3EA 1ITCA 1S2TA 2YB1A 4C1LA 2J7HA 1UB3A 3E5BA 2XH0A 1GTEA 1QASA 2VEKA 3A4XA 1HKKA 3L2IA 4XV0A 4U2YA 1XG4A 1TYGA 3PBMA 4W88A 5JQ9A 3S6DA 2BOGX 2C1HA 5G4WA 2G4FA 3DERA 1S5NA 4ZE4A 4Y9NA 1E40A 2OT0A 2VFHA 1IEQA 3NO1A 1Z9AA 3MB9A 3VZZA 3GNRA 4HOZA 3FX4A 3P0XA 1AUSL 2OYKA 2QV5A 1XDLA 2XZ9A 3W1UA 1GQKA 3OQEA 5BOFA 2A5HA 3FDKA 4WGHA 3KFTA 3N15A 4TIMA 3QV9A 3GIPA 1ZB5A 3UJFA 1LP6A 5DN1A 4Q4QA 3B06A 3PVFA 4ZQOA 1GCYA 2BGNE 2HK0A 3PJWA 3K1GA 2E68A 5AVHA 3RNDA 1EZWA 4L80A 2MANA 1VC4A 4LAKA 4PTNA 3AMLA 5BWFA 5C7HA 3PUGA 2EJAA 2SFPA 4G1NA 4M6PA 1OGBA 1T8QA 1FBAA 4D6GA 2ZA3A 4IMCA 3VABA 3F1QA 5RUBA 3FYPA 5K3VA 1L6WA 7TIMA 3HG5A 3KBVA 3NQ2A 2X2GA 5C2GA 2EAWA 4K68A 4IPJA 4CKQA 4JTDA 2ACQA 3CUFA 3JVAA 1VEPA 1R6WA 1ZU8A 4Y9AA 1CXIA 4Y9OA 1VYPX 2Y6ZA 7CGTA 1SUXA 2V63A 1H5YA 3GBEA 4N02A 4IIEA 2GUBA 4G2DA 3O0FA 1M68A 1PXGA 4JTTA 4H7VA 1CPUA 1JUEA 3UNTA 2WXDM 1S46A 4L6OA 3IJIA 4ZFCA 1W6TA 3CL8A 4XQ6A 3LS9A 1GJUA 3CH0A 3F4CA 1R2RA 3JS3A 4E38A 5MHBA 3WH9A 5LNRA 4GQBA 2V69A 2Z00A 2C0AA 1BKHA 4A2RA 3GW0A 3RRAA 3LCWA 4JS3A 5TBOA 4R7WA 2OOGA 4HSOA 3TWAA 3L4XA 3BW4A 4NU7A 2YFNA 1XIDA 4AF0B 1OK6A 1XLDA 3NDYA 4PB3A 3VMNA 2OFJA 2HPMA 4HD5A 1T0OA 4P7RA 3VGDA 3DYPA 2ZWZA 4WSKA 4QDWA 3URAA 1V6UA 4IXHA 4NXKA 4XD6A 3CB8A 1BVZA 2GQ3A 1JCTA 1UZ1A 2UY4A 4LX4A 2RHGA 1M5WA 1F74A 1NEYA 4XTDA 3E1F1 3KTXA 3NEHA 1EJWC 1KBJA 1QO2A 1BD0A 1QMLA 1YTKA 4GJIA 3RJYA 3Q94A 1ZFJA 2DIJA 1E1CB 3S1XA 3V3WA 4NKCA 4M6UA 3WF1A 1FWEC 1G94A 3DKJA 3IGSA 1PB0A 2B7OA 3VD5A 1DJWA 4DF2A 3CHDA 3ITLA 1D2KA 4ZSTA 3SUVA 2TODA 1GEQA 4DJEA 2VEFA 4URIA 3UY8A 4IH3A 4O1FA 4IMAA 5D9MA 3RAOA 4AC1X 1V3LA 5KZDA 2QQ6A 2E1WA 1UR1A 3H4XA 4GVHA 2ZX7A 1WKFA 3EZ4A 1P0KA 1E0TA 1TPC1 2PLJA 3OA3A 1BSLA 4RX0A 1FWWA 2WHLA 1RVGA 1UC4A 1XISA 1ZLPA 3OZYA 2ZXDA 2PDGA 4C6PA 3WF2A 3AUOA 3THCA 4FLSA 4CNUA 3HBLA 1BGGA 3W38A 5C9ZA 2DU2A 3SSJA 1ISXA 2DZPA 2X1TA 2XN1A 2WMJA 1XYFA 2X40A 3H2EA 1DIOA 5GPRA 1POJA 2GSJA 1LBLA 1A5UA 2E40A 3W9ZA 4D6EA 3BLLA 3RN6A 1E43A 3GK0A 3VIKA 3QHMA 1CT5A 3MP4A 4QX4A 5BROA 5LSMA 1N8IA 2X0YA 3LGEA 3O6CA 4WJXA 2YBUA 1AG1O 2HS6A 3AIUA 3VO0A 3NJ3A 1S3HA 3O16A 4JQ4A 3KL5A 4JD4A 3CZ8A 4HMDA 1R2TA 3ABRA 4L5ZA 3NPWA 2QCHA 3BMWA 5EPDA 1SJBA 2VD9A 2EEXA 3VGBA 3P93A 3B8DA 3W2JA 3AXHA 2J7BA 4CVWA 1GQNA 2XIMA 4O16A 1BQGA 2BHUA 2IPWA 4YVPA 3ZJ6A 5EMLA 3F2CA 1OCNA 5B80A 1XBVA 2J8TA 2J4GA 3B9AA 3VOIA 3THQA 3NL6A 4DRSA 3FVDA 5PTDA 3PZGA 5ABFA 2C8NA 4CEXC 3O63A 3N9SA 3N2TA 3GFXA 3O05A 5HJXA 4UTLA 2WW5A 3VDCA 3T0DA 3GM8A 4O1DA 1PHQA 3RPDA 4UMBA 4V33A 2CC0A 1Q6QA 4CCEA 4B3LA 5KITA 3FEQA 3OA5A 3P67A 1FRBA 3LNMA 1KXHA 3W23A 2RJHA 1OQFA 1W31A 1SFSA 1HVXA 1WX0A 1E5NA 1SM9A 4N6FA 4HN8A 3ZYZA 2A4AA 1XBXA 2YGYA 4U3AA 1UWRA 3G8RA 4NYUA 1VFMA 3CV6A 3QR0A 4QNEA 2PP1A 1Q3NA 4NNBA 1EOKA 2VUYA 2QVNA 1LOLA 3OLIA 4RXGA 4V27A 5CJMA 3VFCA 1W1IE 3UQNA 3LLXA 3UYIA 3L0NA 3EWCA 5HMSA 1A5SA 4LUYA 3LPGA 3W4RA 1JZ4A 3B9DA 5HINA 2J6VA 4XVEA 3H4GA 4B5VA 4QS6A 3BAIA 4WR3A 1XS2A 3W3OA 2EQDA 4IZGA 3H70A 2FGBA 3DG7A 3A9IA 3T2PA 2DFAA 1OIMA 4GISA 3GDRA 1EO5A 4S3AA 1E4MM 2E09A 2HE5A 3VA8A 3IK4A 2VD8A 3NTYA 4PN2A 1BRLB 1ONRA 3NOYA 4I8YA 4ALDA 3GC2A 1XHGA 4IMGA 5KTLA 3KHJA 2DZAA 4IIHA 1W1VA 3MQTA 2E8ZA 1VBUA 1XBYA 4H6QA 2F2HA 2JIWA 4JCMA 4RZ4A 1RV8A 3GXIA 3DBNA 1UKTA 1O5RA 4NZ4A 3T44A 1H7OA 4JTQA 4HK5A 4NAFA 4AD0A 3RLGA 3MP5A 5CC7A 5DMYA 1IGWA 2GVJA 5AZ1A 4A8NA 3U8GA 1IXOA 2GQ8A 4P2VA 4IT1A 1IXPA 3B8UA 2VX5A 2BLEA 3G8EA 1HX0A 4MWAB 2XIOA 1SO4A 4F2TA 4MGGA 1TJ1A 3EOUA 1AVAA 2CNCA 3PY2A 4PMJA 3UETA 1G4PA 3N73A 2WLYA 3HF3A 3KDOA 5AHLA 1HKVA 3GXNA 3VIHA 3MW7A 2QJGA 3IVUA 4WOZA 1W5NA 3RX2A 1IT7A 4UQCA 1DJXA 2J7EA 3IJLA 1CENA 4AY8A 1PZ3A 1AD4A 4ZBCA 3BQ6A 3CUJA 1BWLA 4I7UA 5HNRA 2X1RA 1TTJA 1XLFA 4JYFA 2P5NA 3G1DA 4PRWA 3O8AA 1BLIA 3R8RA 1V51A 3NL2A 4FNSA 1PBGA 5JVLA 2R6OA 3RJXA 3S3GA 3AYRA 4GXMA 5A5WA 4W4QA 3GZ3A 3TSMA 2VX4A 4EVZA 3S6OA 1PVNA 1UZHA 4X9YA 4PUEA 1REQA 3FS2A 2J88A 4DZIA 4MZYA 3TWBA 4GLEA 2C3ZA 1WDWA 4HYVA 4S3DA 1RK6A 1ADOA 1OBAA 4OV9A 2OZ0A 5CQ1A 4LC6A 4LNCA 4XWUA 5CZTA 5ABTA 2ZTJA 3M46A 4INFA 3UR8A 2VEMA 2JIEA 3GWQA 1DBTA 3KDNA 3HIJA 4WSJA 5TD4A 2VDGA 1GONA 4HB7A 3NSXA 3E96A 1K70A 4LVGA 3RCNA 1SYTA 3VD9A 1OCBA 4DXXA 3SRFA 3H6OA 3UWEA 4UQEA 2GVEA 3D47A 1WCGA 4CQDA 4L1XA 4JOMA 3B0YA 3I3BA 4LRSA 1I2NA 1X6UA 3CZJA 1L8PA 1Q7QA 1IQ8A 4DUVA 3LQLA 4LWWA 5FEWA 4YCPA 1GVIA 4HTYA 4S23A 4UB9A 1K8CA 3VINA 3N4EA 4GZEA 5A2AA 1W32A 3K30A 3HGJA 4JTSA 3IRSA 3TH6A 4AIEA 4AG0A 1PTDA 4A3QA 5LNWA 3VKAA 3E2QA 3BAYA 2ZXQA 4FXJA 3CHFA 1QHPA 3FVMA 4D6JA 1TV2A 3UVIA 1M04A 1OC5A 5I07A 5AYYA 4JTLA 3MMWA 4NZFA 4R7OA 5DO8A 3MY9A 5JBFA 3P5ZA 3B8SA 3P84A 5C2CA 5A8GA 1WDQA 1YNPA 3CAVA 1DWFM 4UOQA 4KEZA 3USZA 5KZMA 1GG0A 1TREA 2CZDA 2FLIA 5DY3A 3C2VA 3PM6A 4BKNA 1FWRA 4PUNA 2QKFA 3W0KA 3AIBA 3STCA 4HCLA 3GQYA 4LU0A 1W2VA 1F3TA 3PTKA 2XHYA 3GNXA 2E5DA 4GWEA 1V77A 2FTPA 2FZMA 1JAEA 3LCIA 1LDCA 2OXNA 5D2YA 3UWUA 4C6JA 2ZZ4A 2AL2B 3G1VA 4HHHA 1F8IA 1XRVA 1AZ2A 3VGEA 3W7RA 3VNLA 3SEPA 4UZUA 2O7SA 1RBLA 4JNMA 3VC5A 1LLOA 2R1MA 1TCMA 3L4WA 3VMPA 1W9BM 4DB7A 2A3EA 4RK8A 2Y62A 4PUMA 3V5OA 3W76A 1XINA 3MVIA 5HWJA 3GSMA 2WNNA 3LRMA 5CPNA 2OX4A 4XZIA 1FWIC 1UR9A 2DVTA 3W24A 2A3CA 5A6JA 5C9RA 3KVKA 4LUSB 3V5CA 3DC8A 4D8ZA 3URNA 1BVNP 3N2MA 4N9DA 1H41A 1FDZA 2ZWYA 1KKRA 3TXZA 2PLMA 1JAKA 1M7PA 4JPGA 4PMDA 3BV4A 4FLRA 3LXBA 4GYFA 4Q4MA 1H5VA 3R89A 4G7EA 3VKKA 3A6OA 4RE0A 3NQCA 5MKGA 1IF2A 2WPBA 1TB3A 1TVLA 2BG5A 2WK2A 3ZT6A 4BI5A 1WYIA 2XSAA 2E1DA 4H8UA 2WZHA 4D2JA 3N18A 4EX4A 3LZ5A 1WE5A 1JD9A 1R9ZA 1VIWA 1YE6A 3UD6A 3OBAA 4FMVA 2ZZ6A 3I6RA 3L9CA 1W9UA 3WNLA 1PDYA 4DI8A 3Q58A 1NY1A 3SQSA 1DORA 2XG9A 4ZOAA 2ZBTA 4XB3A 4JYEA 1CXKA 4Q8NA 1OSEA 1TZ7A 3IK2A 3F2DA 4HNNA 2GUUA 2OELA 1OYAA 2YA1A 3PJTA 2CXEA 3WEOA 5L9FA 1JEZA 3FEMA 4WDTA 4IGSA 1G7VA 3C4UA 4XUYA 4K1GA 1EC9A 1PSCA 4XX6A 4J9JA 3ES7A 1RD5A 3DOPA 3OQ8A 5D2XA 5IFTA 1W3IA 1RCQA 3A4AA 3QBUA 4AWSA 1CGWA 4RW3A 3SIZA 4JX4A 2C19A 3SDOA 4DZ5A 1A5NC 2C0HA 1L6GA 3GXFA 3UXKA 4LAZA 1JDAA 3MDWA 1QOQA 4GIYA 2FPTA 2VR5A 2VZVA 5EU9A 1MRAA 4B5TA 3VD3A 2YL6A 4AIBA 1WA3A 2WSYA 1EDTA 2JKAA 4AX6A 1XWYA 5DFAA 1LT7A 1OX4B 2G3JA 1XSIA 2GGEA 2PDFA 4FLOA 4PUWA 3I6EA 2QHAA 1NWUA 3A9BA 2JEQA 1E15A 3V0TA 4YLWA 3TCSA 9XIMA 3M0KA 1FP8A 3ZR6A 3CZKA 2DORA 1TVNA 3R8GA 3RXZA 3SB0A 4C6BA 4O18A 4JR5A 4L65A 3LNPA 5CKSA 3G0UA 3STFA 3I4EA 3JZUA 3BCFA 2OWXA 3CEUA 5LGZA 4ZVJA 4UNLA 4Y7EA 2BV9A 3BJTA 1E3XA 2C16A 2WNWA 5FD0A 3KRSA 1VFHA 4XKYB 5D02A 1GYNA 1WDSA 2V3GA 1ZJIA 5H8PA 3AHVA 2FGZA 1P5BA 3SBFA 3MDUA 1B3YA 3EKLA 3TYCA 4M1BA 1YXDA 3OP2A 4KWWA 4KW2A 1JRBA 5XINA 2PBOA 4UFKA 3M47A 3VCRA 3KLLA 4EIVA 4PBEA 4AZIA 3BLKA 1B3ZA 2A0NA 2RUSA 2OKOA 1C8XA 3S8HA 1ZJBA 3LERA 2A79A 4CN4A 1TRIA 1IEXA 2G0WA 5TNVA 4WF7A 5CCZA 3M7SA 1R8LA 2NUYA 1SZGA 3ALGA 4QE1A 1IXNA 1R38A 1QI5A 3NQAA 3PPHA 1S5VA 3TMQA 3AYSA 3MZ2A 3BUVA 3TJ4A 4B3KA 3DFNA 2XSXA 4O11A 4CD5A 4EPEC 2WCGA 3R11A 4HA4A 4DWSB 3L5AA 1UH2A 1G4TA 1SU5A 4XAPA 4KRTA 3V7PA 3WUFA 7XIMA 4DLFA 3AU6A 1A3WA 5H2ZA 1MQRA 3IANA 3OZPA 3STPA 4GD0A 2VZTA 4LSBA 1Q8JA 1LLWA 2DIEA 2FGLA 1NFGA 2X1UA 5I03A 3AYTA 1M03A 2E8YA 4X2RA 3M43A 4YXGA 3MS8A 4PGLA 5G1TA 3UZYA 1H63A 3OLGA 1K8ZA 5K4XA 1E6QM 4EE9A 3SADA 4Z1BA 4H2CA 3VGFA 3WD4A 3EWUA 4IJCA 4WXZA 1KRBC 5FSDC 3GU2A 1ME8A 3I7RA 4RKAA 1SW7A 2FFIA 3CYJA 2DZSA 4QROA 4M80A 3UPMA 5DX7A 1X6LA 3BL3A 2CBIA 5CSUA 2WWCA 1QI2A 3IJQA 2PC4A 1LBFA 2NW0A 2DZWA 4L4LA 2Z25A 1RJRA 3I7SA 4RUBA 1GW9A 1R3SA 5FEZA 2D2HA 4F9JA 1G6CA 4PFMA 5D03A 3PAOA 4U5IA 3SAZA 1C91A 3ITCA 3U4AA 5D32A 5M03A 2Z4GA 1Z48A 1IEWA 1QAPA 1C90A 2Z1KA 1VFUA 2ZQ0A 2PCQA 4TVDA 3OODA 3W1MA 4B3ZA 3EA3A 2CITA 2OVLA 3G77A 1HT6A 1M7XA 3S2JA 2UY5A 4IX0A 4HOWA 4M51A 4F9DA 5I3FA 3W87A 3KOZA 4I7VA 3LMZA 4Q7BA 1PWMA 3ZVHA 2A2IA 3CAQA 3IV8A 1TJ2A 3QY7A 1TX2A 1C92A 1OY0A 4B2DD 2XINA 3TYDA 5G2HA 4PB4A 3OZMA 2VELA 2FMOA 3INPA 3QR1A 3FA5A 4QAWA 3R4IA 4P8XA 2H6RA 1EA9C 1EFZA 2GVYA 2CWNA 1YIXA 2YL5A 4AZBA 1QBBA 1GPFA 2OPJA 2EPLX 2PC8A 2CBVA 4PTWA 1YEYA 3PZTA 1I60A 1WKDA 2PGEA 1HP5A 2EPKX 4NRSA 3G0SA 1H7WA 1K7FA 2GGHA 4I5UA 3E12A 2NQ5A 3WDRA 4WJ8A 3BLOA 1W8SA 1US3A 2IW0A 1N8WA 4AIUA 2D3NA 2RKXA 1H7PA 3N4FA 4IFOA 3VDHA 3ZLHA 4QNWA 2WC7A 1XLMA 4OTKA 4AVOA 2FDMA 3M0XA 3IARA 2ZIDA 1RA5A 1QTWA 2XWEA 2BFGA 4C6KA 2IKJA 1KFLA 5FL1A 1M6JA 1R46A 6PTDA 4MAZA 1T41A 1XP3A 2QDDA 1BPLB 4ECLA 2X1SA 5HWMA 1KFJA 1SSDA 3M64A 3TYBA 2BXVA 4XBSA 1HJQA 2J7DA 2VQUA 2ZZ7A 4AHQA 2R94A 3RX4A 4YYFA 4J3SA 4EWJA 5CG7A 4ZOCA 3C2YA 3EWDA 3O07A 5AYXA 3NCOA 1NTHA 5J8LA 2REQB 1MXDA 1CGXA 1TELA 5HMFA 1LL4A 2HMCA 3C2EA 4J3XA 4Q33A 3TC6A 3G2GA 3UR7A 4MWAD 2DUAA 4LY8A 3WBAA 2V38A 3WLHA 1A5LC 2HNHA 3R79A 5I79A 1SW0A 4CQBA 4FP1A 4HKPA 3IPWA 3PZ9A 1PCWA 2B0MA 1TWSA 2WV8A 1WZMA 1FWAC 4QJ5B 1ZGDA 5HNNA 4JQ3A 1G5AA 1BKSA 3QFWA 1MEWA 1X6NA 3TX9A 4M6QA 3BOFA 2JKPA 3A23A 3T09A 1Q85A 2DZTA 5BXTA 2JEPA 3PBWA 4J4KA 4FS9A 4D8LA 5HQMA 2J79A 2PU0A 3B05A 1AJ0A 4US5D 1DIEA 4W9TA 4YIWA 2PWUA 2O4MA 3RLHA 3TN4A 6XIAA 1FKXA 4ZXOA 1VKFA 4HNUA 3U2EA 1RQEA 3EEZA 4ERAA 1F3WA 3HURA 4C6CA 3CQ0A 2VKZG 1V08A 2GQAA 2YPIA 2B4GA 2NVAA 1CNVA 1W9PA 4CNSA 2J6XA 1PIFA 4CD8A 1EIBA 2X30A 3KCJA 4EF9A 1EP3A 3Q65A 3GLCA 3QY6A 3A21A 4O1BA 1EGVA 1MW2A 1XDJA 2PWEA 2ZUMA 3AOFA 2VR4A 2OWCA 4ZB2A 3L2LA 2G41A 2G97A 3CPUA 4Q8TA 1TWIA 2WC4A 4A21A 1EF2A 3NOEA 2VC6A 3VI2A 3PULA 1D9EA 2BVDA 1LRNA 3S2CA 4Z1YA 2JQXA 4G5DA 2PD9A 4MVAA 1EQCA 2WMKA 3S6TA 4QCFA 2W91A 4FA3A 5F4SA 1WNOA 3N14A 2WANA 4LYPA 1WUFA 2NLYA 4HK7A 1VHNA 2AAAA 1V79A 4R9OA 3VM7A 2WJZA 3PTMA 2E4TA 1QWKA 1QNVA 4HN4A 4MB3A 5DBTA 2DSWA 4NAEA 2C91A 2Y85A 3F4NA 4GJ1A 3GH5A 2W6RA 4QBXA 1NOUA 3QGAC 3UCCA 3UZWA 2X1IA 1OABA 3F4WA 4M81A 2PRMA 1PTAA 2CFFA 4GBDA 3E49A 2D24A 2I5QA 3LB0A 1YDVA 4LBUA 2I9EA 4BEQA 4J3UA 3QFEA 3R25A 4GOAA 3V1PA 5E0CA 1UPPA 1IYXA 3PUOA 4B9ZA 4WKFA 4KIRA 3UCQA 3KVJA 3CWOX 2NQ9A 7REQA 1XL9A 1A47A 2D3LA 3OOQA 4I90A 3H54A 3KVLA 3C3NA 3VD4A 1DHKA 2BBFA 3KZSA 6ALDA 3CPGA 4AHOA 3S1GA 2QMJA 4O0QA 3II1A 1QNQA 4OUEA 4ENLA 1CLKA 1RPKA 4BWLA 1A3XA 4UFLA 1QWGA 1EOMA 5HATA 2PDBA 3FIGA 2XGBA 4NYYA 4CNNA 1GT8A 5J5DA 4ZA0A 5A1AA 2BHZA 3VIPA 3PSWA 3VKCA 2Z7KA 5I6SA 1ZBVA 2PE4A 1MW1A 3BSGA 3STGA 3EA1A 5GNYA 1O1ZA 5CGMA 3RPTA 2G37A 5GJNA 4HZ6A 4BY3A 4BJHA 2VZOA 1KCXA 2RGLA 1M1BA 2J25A 5D37A 3H21A 3QM3A 4A8IA 1QATA 5I3HA 1GGOA 3SN0A 3QPZA 5E70A 2O9RA 1KFBA 5I09A 3WLQA 5ABFB 3GIQA 4LV4A 5E09A 1FCQA 2BGSA 3WLRA 3KEHA 4Z17A 3O0KA 1Y8BA 4PUDA 2ZOXA 4JTIA 3MKKA 2NT0A 1FCBA 5HUOA 5A2BA 2ZRZA 3FYOA 4L4MA 1S3TC 2QVHA 2CBJA 1FDYA 4QDMA 1GOWA 4FIQA 1QBAA 1ALDA 1GEHA 1Z69A 3BMVA 1TVPA 4LEFA 5AFDA 1U33A 1AQMA 1ESWA 2J78A 2VZUA 4GC3A 4PBGA 3HPZA 1TIMA 2VWTA 3AJ7A 4H19A 3ABQA 1U30A 3TSDA 1LG1A 1OC6A 3LM7A 3T78A 3E0IA 4ADTA 4KH2A 3N04A 1DIDA 2Y2WA 4HNLA 2QAFA 3EOOA 1UP3A 2OGYA 1X1OA 2OSYA 1EPVA 1EJ7L 3W74A 3MJMA 4GVGA 3IEBA 1EA0A 1QO5A 3HN3A 3WK2A 4K2SA 3WK0A 2YL9A 2YW3A 4IX2A 3AMCA 1W9DM 1W1PA 3R0UA 3THUA 4OUIA 2A3HA 3OG2A 3LV5A 2ANUA 3UW6A 3N2CA 2YL8A 2EF9A 2XN0A 3WLKX 2I14A 2Z1SA 4DHGA 1NQ6A 3RLVA 1EQPA 3IJ8A 1KWKA 2QDEA 1R0MA 2HSAA 9RUBA 2YZ5A 4OHQA 1CLVA 1VPQA 1GZJA 5LNSA 3LRKA 2WQDA 1JPKA 1E9LA 4M19A 5FF4A 2CHOA 3RU6A 5LIUX 2DT0A 4UOZA 3SCNA 5EMJA 3QYSA 1TA3A 2I1OA 1H11A 5IBXA 3IGHX 9XIAA 2GUYA 1RJQA 1V6YA 1PKLA 3WJWA 3ARRA 1WBJA 4IUOA 4DPPA 4DVOA 2GGJA 3VDGA 1V0KA 1G67A 5AZ0A 2CLIA 4L64A 2PU1A 3WQ5A 3ARQA 3TYAA 5FJIA 1K3UA 4TMBA 5C55A 3OVRA 5CC6A 5FESA 1MDRA 3MMDA 3ZS4A 1AW5A 3G1AA 1KGUA 3HQOA 4UFMA 2DUXA 1TRDA 4CQ9A 1DJZA 1SFLA 3MA8A 3LXCA 2Y7FA 3NZGA 3ATZA 5U4NA 3EX3A 3GTFA 3TA9A 1W8GA 3T7VA 1W5PA 3U9IA 4DJDC 2E3ZA 3WF4A 4LANA 1YKWA 1BVWA 1CEOA 1KFKA 1LRTA 4BI6A 2B7QA 5BW6A 2GGGA 3KBMA 3KOFA 2FHCA 1Q6GA 2VC5A 3RO8A 1KBBA 4ZOBA 1GUVA 4OKDA 3W07A 3B04A 3H53A 2VVNA 3FFSA 3BLIA 1VFSA 2PAJA 4GI9A 4KCWA 5EY5A 2D0HA 3KOWA 3MYOA 4IICA 4F0SA 3UZXA 1XLCA 5GNXA 2GWGA 2GSEA 5I02A 2KAUC 2QS8A 3E2RA 5HNUA 3RRXA 4Y9MA 5DF0A 2P0OA 4HSNA 2VOMA 1R7OA 2ZRYA 4MZ8A 4DJFC 2POTA 3GFZA 1S38A 3N29A 4LPCA 1B2YA 2BS9A 1WDDA 3LK6A 3VAVA 5EFDA 3UVAA 1G0CA 4C6FA 2NXIA 3IGUA 3H7RA 2PF8A 1REQB 2D22A 3EOSA 3ZVIA 4RR4A 3M07A 1H60A 4F0RA 3G1YA 3KRBA 1UD8A 3UGVA 1SZFA 3TE9A 1JZ7A 1EC7A 5AOUA 2BOEX 5AC8A 5CJ5A 3NYZA 3HB9A 4LC8A 3SY5A 4FLQA 2TRSA 2V5KA 3ARSA 3SR7A 1JYVA 3TCEA 3O6AA 2Z1BA 4YU1A 1ZL1A 2DT1A 4F2UA 4TUFA 3T2OA 2VHLA 3NNTA 4WCJA 3UWWA 3CIVA 2Y7DA 1OFOA 1RUSA 2WB5A 1EYEA 1IR1A 4FXFA 5BNKA 4E0CA 3KP0A 4C6OA 2E5CA 3QV8A 1V93A 4A3RA 4HHMA 1QXLA 4XAZA 4F4RA 4F79A 1ZRQA 4PUUA 3NXLA 4JKMA 1KLYA 1ZSXA 4X9SA 3NA8A 3N3TA 3WLJA 3HJEA 2AQVA 4J2MA 1J2WA 1ZBCA 2BVYA 2P10A 3R5EA 1JDFA 4CNOA 3MPGA 4K38A 1S2VA 2XVNA 4IISA 1J2BA 2J47A 2BY2A 1XDMA 4NNAA 1XC4A 3UCDA 3GDMA 3UEQA 3OGSA 1GW1A 5KZEA 4S1FA 4KWSA 4DBWA 3B9NA 3M0JA 1VH7A 2ZYFA 5AYIA 1M7OA 3KXQA 4O8RA 1PV8A 1P4CA 2QGHA 4FX8A 2DT2A 4E4UA 1TPFA 4PSRA 1IV8A 1BQCA 1O95A 5FF7A 3BLPX 2OEKA 1UR8A 3HTWA 4G1KA 4ATDA 1XLBA 3NDOA 3P0WA 1E4NA 4WEVX 2C71A 2YLLA 4DZHA 5A69A 1IIGA 4H1ZA 4FR6A 1UCWA 4O8AA 3KOYA 3GXMA 2XPKA 1VEMA 4LW7A 5BU6A 4RE2A 4ZB0A 4MY1A 2ZXBA 4FX6M 3W6LA 4R33A 3ENLA 4IUGA 4L7ZA 5HA7A 1BGAA 2Y4SA 3CV7A 3VNIA 1PIIA 2VCBA 4AEFA 3CV1A 3WL0A 2WZTA 3TZFA 2ISFA 4S2CA 2ZA1A 2PTWA 3QMTA 1ISYA 2RDXA 2HBXA 3WF0A 3LCXA 3W01A 1H7XA 1IZJA 3WMBA 3GG8A 3W6MA 2OX1A 4GBUA 4ORMA 4AFYA 1H1NA 1W3TA 2FMNA 4XBKA 1XLJA 4HTBA 1E4IA 2J7GA 4I9JA 4L4PA 3WD3A 1T6MA 1TQJA 2VMFA 5I3DA 2VQTA 3W2KA 2Q71A 4R34A 1XLLA 3BSMA 1UPMB 2B81A 1DYSA 1KFWA 7PTDA 4L61A 4JIRA 2C13A 5AC5A 1HGYA 5AHMA 5MKGB 2BVWA 3TZNA 4EF8A 4PCSA 3LRLA 3ERPA 4L1GA 3DI0A 1X8CA 4L9XA 3QW3A 4RZBA 3JUGA 1P43A 4KGJA 1PJ9A 1VFFA 1YLVA 4MDPA 4MB4A 3MI3A 4Q8QA 4UQAA 3PSVA 3W83A 1W3JA 1ICPA 2ZX6A 3IJ7A 4ZE5A 2BSLA 3PBGA 1XYLA 3IUIA 4IQEA 3NQBA 1YQ2A 1EEXA 3QF0A 1NDZA 4AYSA 5C0QA 1EJSC 1Q65A 2C18A 6CGTA 4A29A 2C1IA 5D9OA 1POKA 4N9CA 1E6PA 3T05A 5LIWX 2ZUVA 3EEGA 3WBWA 1DJHA 4BEUA 3KAOA 1XI3A 2X0SA 4FO4A 3PTQA 3IIPA 4PMRA 1E9IA 2EJ1A 1RPXA 4KPLA 4F40A 2JALA 4Y9PA 1W37A 3NPXA 3MI6A 3C3UA 3M41A 2AQWA 2Q3OA 4OFCA 1N2VA 1WO2A 3GDTA 5M1TA 1K9EA 4MIMA 4KMQA 2ZVRA 1CWYA 3S5ZA 2AMXA 3G1SA 1FWTA 3RITA 3HOJA 2X7WA 1XLGA 2JF7A 2AMGA 3OPSA 2ZX5A 2IMRA 1W1ZA 2GSHA 5KINA 3W26A 3U7VA 4HIBA 4N7QA 3W7OA 1OVDA 2O55A 4KQNA 1O94A 5CGTA 4AISA 3B40A 1WBHA 2YOCA 3MKVA 4EACA 5FEPA 1GOIA 3WLMA 3S5YA 1CIUA 1I2PA 2ZX8A 4U2ZA 5CSRA 4JTKA 4UTWA 4PMOA 1DKWA 1IEVA 1UROA 3PP7A 4XSMA 2WLZA 4PC8A 4Z0SA 2W67A 1I2RA 3MHFA 4QLLA 4Y90A 1PX3A 4BR1A 2V9DA 1W5MA 4GYPA 3REQA 4ZQPA 3BLEA 1TMQA 2WMHA 1IT8A 1O1HA 2PBGA 3T0BA 5BOEA 1JPHA 3MBDA 3MWCA 4K1WA 1JZ8A 1MVYA 5EMUA 3AWOA 3E0LA 4I6KA 1MW3A 1F07A 2PWVA 2Y8UA 3ZT5A 1OG6A 5HANA 1V4YA 4H9ZA 1PYFA 2PDIA 1FY6A 1AMKA 1W3LA 2F8QA 3S5SA 4UTHA 2Z29A 1LQ2A 3V18A 3WN6A 5A94A 5HQLA 5AVNA 3BO9A 3NSMA 4GK8A 2O92A 1P0DA 2Q01A 2VDHA 1A50A 1RH9A 3DG3A 2CXGA 1NQKA 3D46A 3CBWA 3PB2A 3LOTA 2UV8G 3TV8A 2ZC8A 3QQ1A 1I1XA 3LENA 4FXRA 2DPEA 1XX1A 2XSBA 2ATSA 1R86A 3GTHA 3LI0A 3TQPA 4DQWA 5BU9A 2DJXA 1S2UA 1EWEA 1LWHA 1DVJA 1V6WA 3ANYA 3A12A 2DZXA 3IRDA 3KBSA 2P53A 4AXKA 4IPPA 5I3IA 4QSFA 3KP1A 8XIMA 4MTVA 1H3GA 1LF1A 4KF1A 1LCOA 4CD7A 1WXYA 3CWNA 1QFEA 5F1VA 4CQAA 1XYZA 1C8QA 1E6ZA 2PP0A 1TKKA 3ATYA 2CLOA 3TW6A 3AHZA 1R5YA 2XIJA 3BURA 3NEVA 1GNXA 2Y8KA 4R27A 3S42A 3S47A 3L12A 3UFYA 3NPVA 3QC0A 3AQUA 4OIFA 3W22A 2CESA 3GNDA 3AAMA 4C6LA 2JE8A 4NHVA 5E6YA 2VXNA 2OMAA 5A2CA 1BYAA 4IFKA 3MTWA 3VILA 3CQJA 2WJFA 5A95A 1NF7A 4TX8A 3HG2A 4H2HA 3GG7A 4YMZA 3W7CA 1R9YA 1OX6A 1TSIA 4GQQA 2EGZA 1B3WA 5A6LA 3W7DA 1YADA 4L6DA 4R85A 1R87A 5CEWA 2F6XA 2WSPA 1J0ZA 3VX1A 4FK9A 5A6KA 4HMEA 1C8VA 2PD5A 1A0DA 4I8DA 3IJ6A 1OT2A 4HNTA 3NL3A 4LY4A 4ZCWA 1YPXA 2NV2A 1R7AA 1QRQA 1UWIA 3W88A 4LUTB 3TJXA 2WNQA 1ZBWA 1A5MC 2OZ3A 3UWYA 5H1WA 3RCYA 3D3AA 3GVVA 1TE6A 1P0NA 4W7WA 1WQ5A 1LL7A 5JH2A 1KRCC 4TV5A 3VIMA 1GHSA 2CW6A 4H6KA 3ZSTA 2DZVA 1PPIA 4Q4KA 4AIOA 2ZVIA 3OO2A 3EMCA 2J7CA 1FWDC 3ZVHB 3AU2A 4YTSA 1N82A 4QG9A 3ARTA 3LQGA 2CETA 3GKAA 1TFVA 2W27A 3XIMA 3BAWA 3WQVA 3IWPA 3AMKA 1VPXA 2BHYA 4IM4A 5T26A 1EUNA 1L6SA 3BCDA 4NJGA 2UY3A 2ZFAA 1W3KA 1TTPA 3MU7A 2RJGA 4AW7A 5H6HA 5CPMA 4WDWA 4R3UA 3KTCA 2DW7A 2OOFA 4EOUA 3QEZA 2I5IA 3CEPA 3T08A 1Q66A 1QDSA 3ISIX 3YPIA 4JNZA 1SMDA 1XICA 1WXZA 2ZCGA 4E5TA 2CLEA 1I2QA 3U7BA 4HYRA 1LTDA 1US0A 3PR2A 5CPSA 4PRRA 1G69A 4XAFA 1MQQA 3UJRA 4M56A 1JPIA 1KV8A 2G3MA 3MSRA 2C79A 4JHZA 5D4YA 4KKXA 2Y5EA 3WY1A 1MEIA 1KFEA 3LV6A 1AJ2A 2W92A 4JTGA 4WXYA 2ONEA 4XZMX 4AC7C 5E1QA 4RE3A 2WYSA 4NJIA 4WK9A 1MW0A 3PJUA 4L1WA 4EAMA 2WZIA 3NR0A 4QM1A 4PCFA 3WEZA 4QP0A 2MNRA 1BFNA 3WUEA 2OLSA 4M3PA 2PF0A 4WD0A 3MWAA 2XUCA 4W7UA 1UJPA 1EJXC 1TPUA 4O1CA 1P7TA 1VLWA 1A5BA 3EWZA 5EBAA 1XPGA 3VOHA 3GFYA 1XKJA 1Q8AA 4WY0A 4MUPA 4B92A 4IP4A 1EIXA 3C8NA 1GYMA 3DKLA 2WAGA 1DXFA 1UWQA 2PZNA 4LJ3A 8TIMA 2X7VA 4HA3A 4XISA 2J8GA 3BZGA 3FV9A 5D8ZA 2ZZ2A 4UFJA 2E0PA 4E2VA 3QVQA 1KXVA 1RLCL 1EWDA 1CB2A 1D8CA 1QW8A 1OF8A 5HQEA 4AB4A 4JCLA 3NQGA 3GB6A 3TN3A 4Q4OA 4XZ9A 3EKZA 3EWWA 1IEIA 4I9TA 4IXXA 2YDQA 2GPTA 3QZAA 5DCBA 3EXRA 1V03A 1JULA 4H04A 1QOPA 3IUDA 1GG1A 2WVUA 4D6CA 3CWHA 4Q8UA 3N3MA 2VC9A 3GH4A 3OW1A 4JY9A 3CAKA 3KWSA 4RDYA 1U1UA 1UQYA 4A05A 5AHFA 2OYMA 3FJ6A 2FZ8A 1ADSA 3TFCA 1BXBA 3PWIA 1VBJA 3UA4A 3NZPA 2VJXA 2WC3A 1XLIA 5FSEC 3PZMA 5CPTA 3EDFA 1DE5A 2B7NA 3WBEA 2ODOA 3LTPA 3TVAA 2PA6A 1F4HA 3DN5A 4ADUA 1UIOA 3CJPA 3TR2A 5KEZA 2QIIA 3VVGA 4RXFA 4A3YA 1G4SA 4B90A 1LBMA 1RD6A 3W86A 1V5XA 3B03A 5FAGA 4DF1A 2RDUA 2OQHA 1ONEA 3COTA 2VVSA 1KTCA 2WCAA 2V2DA 3GR7A 1KXTA 4PE8A 2VENA 5C70A 4HA0A 3OBKA 1RQBA 2PEVA 1EXPA 4GUHA 1ML1A 1OD8A 2YW4A 4GQ0A 3WDHA 1F7BA 1PWLA 4C6IA 3DXIA 3EDEA 1E9ZB 5CZKA 3GS6A 3RFAA 5HULA 4MOZA 4GH1A 1L6FA 3VKJA 2XFWA 1KCLA 1ECQA 4AU0A 3PB0A 1FH7A 3NVDA 5C54A 3FHAA 2ICSA 3E38A 1F3XA 5HMDA 4WVXA 1RJPA 2P76A 3DFYA 2GJXA 3LPFA 4NAEB 1C9WA 3CMFA 3RDKA 1VENA 2H90A 2R24A 5GJPA 3UWVA 4D71A 5FF2A 1A5CA 3BMXA 2Z26A 1KBIA 3MMUA 4V2XA 4IIBA 3KLKA 2I16A 1I1WA 3N6QA 3RMJA 1E5JA 2H8ZA 4JZ5A 1WP6A 3MV01 3EB2A 1F9CA 2TAAA 5K7JA 2WKJA 1UMYA 3TTQA 3UWQA 3CUIA 5FL0A 1JI1A 3LLFA 3I65A 1K7EA 1XGZA 1GJPA 1OB0A 3GTIA 1UA7A 3EOLA 4GUGA 4GCXA 5JXQA 2HTMA 3Q67A 5MF5A 4JIEA 2NXHA 1LM1A 1BYBA 5D09A 7REQB 4MHBA 3WJZA 4RDWA 3A47A 1FCUA 4LVFA 3BQ5A 2CZVA 4K8GA 4C91A 3SRKA 6A3HA 4OU1A 1FWFC 4O0KA 2WQPA 1PO9A 4AQLA 1NWTA 1UOKA 3N9RA 2XFFA 2Q09A 3LYEA 3NWRA 4HSHA 2PDYA 4P7OA 3S9YA 4PMXA 5T9CE 4TTGA 2VDIA 3DC0A 1Z42A 3PBVA 1FHVA 1HP4A 2A6NA 1GVOA 4G8TA 1FQ0A 4YTUA 1VF8A 4DF0A 2QCEA 1IWBA 1O5KA 3AALA 1XGEA 3W27A 2V5DA 1UC5A 2QJNA 4BZYA 1GKPA 2QJJA 3F4DA 4RL3A 3RX3A 1K9TA 3SCWA 3ZWSA 3FY1A 2J66A 1EH9A 3FHQA 3ZQ9A 1MQPA 3QSTA 1Q63A 5B7YA 1ZJAA 1W17A 3L0KA 4A4AA 1VFOA 3SCRA 1R9XA 2DVUA 2W63A 1XUZA 1K03A 2WMFA 3IIZA 4H7ZA 1AH4A 1LRQA 2GGIA 1JXKA 1SZEA 3GR4A 3HJZA 2GZXA 5CPLA 1NOFA 4ZFMA 4EXQA 4NZ1A 3WLPA 5F2MA 2OZTA 1ITXA 5HBFA 1TV3A 3BAJA 3BLFA 1V3HA 3WH5A 6TAAA 5F2IA 3CUGA 3V4BA 2VEPA 3EPNA 1P0BA 4BF5A 1VJSA 1UKPA 3KHDA 1EB3A 1MFUA 2RDWA 3MSDA 1DE6A 1UR2A 2VOTA 3F2BA 4IMDA 2W0UA 1EGZA 4Z08A 3HA1A 4H9TA 2IKIA 3EXTA 4CN1A 1PKMA 4HU8A 5D30A 3CT7A 2ZUTA 4ZSUA 1JXJA 2VRJA 2ACSA 2INEA 5CJNA 3GG1A 3N2OA 4PYSA 5DY2A 1VB9A 2DZUA 4JHMA 4FI4A 4Q7IA 4JQ1A 2V0TA 1TWZA 4NG3A 3VPLA 1OC7A 3T4WA 1NP0A 5AC4A 1EYWA 4EXAA 1DQXA 4IG2A 4IFRA 5HPCA 5F7UA 4K39A 1V3KA 1TZZA 3ABXA 1R47A 2PPGA 4DX3A 3VGHA 2G8ZA 3HU7A 3ZMRA 2BP1A 1R3VA 4U10A 4O4WA 4HPHA 1J93A 1X97A 3ALFA 2Y63A 3FA4A 1W54A 4HZ8A 3VZXA 4LAUA 4W5UA 3DGRA 3LDVA 1PYMA 3JR2A 4ZGYA 4REQA 1K4GA 3UA3A