3TQ0A

Crystal structure of leishmania major dihydroorotate dehydrogenase in complex with fumarate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
SMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
publication title Crystal structure of dihydroorotate dehydrogenase from Leishmania major.
pubmed doi rcsb
source organism Leishmania major
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3tq0A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3tq0A01
4CCCA 4ZL1A 4ADUA 1L9WA 1EPXA 4GFSA 3O07A 3TXZA 3QM3A 3NQEA 2QCDA 2Y61A 2ZRYA 2GVJA 4FX8A 4JR5A 4BK9A 2Y7EA 3O63A 3O6YX 3FYPA 4JN6A 4WD0A 1MEHA 3PY2A 4NU7A 3M43A 5EMUA 4JNMA 5CPMA 3S5NA 3B8DA 1GEQA 1KW1A 1KTNA 2PURA 3QZEA 2HMCA 4OV4A 2PCQA 1DOSA 4HNVA 3P81A 3TUUA 5KTLA 3MP3A 1X8FA 1SO4A 1GVSA 3IV3A 3LERA 1TV7A 3C2EA 3WJWA 5I3GA 1PL9A 3G22A 3CIWA 2Z0IA 3LCFA 3SFKA 5F2IA 1K8YA 2Y62A 3EWWA 4FHAA 4WZHA 2ZRUA 3G0UA 2CW6A 4O15A 2ZDRA 3R2GA 4EVZA 1HO1A 1IXPA 1WAUA 4CQ8A 4E2DA 3GX9A 4K7VA 3QPZA 4UTTC 2FB2A 4LV9A 3LTSA 4IJBA 2ZZ5A 4Z1CA 4KFPA 1ZAJA 1N7KA 1GVQA 4JDYA 2NUWA 3DENA 5DBTA 3QH2A 4HNUA 4UTKA 4A3UA 3W7LA 2NXIA 4QJ1A 1MXSA 1XKYA 3O06A 3V75A 3QSTA 1O4UA 2XN0A 5LNRA 1RR2A 1OX6A 4WOQA 1BEUA 3UY7A 1WA3A 1TTIA 1DL3A 2Y89A 3LRLA 1LP6A 4RXGA 3B03A 3GIYA 1BKSA 3PUOA 4AEOA 3CIXA 3P60A 5T26A 3FJLA 4O1BA 1OYAA 3TSDA 4ZZ9A 3ZFHA 3W1AA 4M7SA 1X6UA 3HG4A 2O7QA 1QAPA 1V7YA 3E0IA 4LVFA 3W75A 1LRTA 5J5RA 1QOPA 5KZMA 4O13A 1J4EA 3TC7A 5I3IA 2J88A 3C52A 2WPBA 1XUUA 1G4EA 1H7NA 1JCYA 4XUGA 1H1YA 3NL2A 1ICSA 4O1CA 2NV2A 3SGZA 3G1FA 3UXAA 3FKRA 1VHCA 3G1DA 5FF0A 3E12A 1EIXA 2V2DA 2ZFAA 1EX5A 1PV8A 2ZTJA 4MZ8A 3YPIA 3NDOA 4O1DA 3UWWA 3SI9A 3W1QA 4NX0A 2V9DA 1TV5A 3PWAA 5LGXA 3A9IA 4IXHA 4GC4A 3MYOA 2E68A 3W7RA 3TA6A 3TQVA 4JTTA 2G97A 1GZGA 3UXDA 5MHBA 3S42A 1G6CA 3G3DA 3C2FA 1XXXA 2FQIA 4G1KA 1TTJA 3G1YA 2W0UA 5E1QA 1ALDA 4AXKA 1DQWA 4AH7A 2YCEA 1RQEA 3N19B 4QSHA 3WK0A 3TC6A 1H61A 2NX3A 3A23A 4NVTA 4ML9A 4GNJA 5IBXA 2ZTKA 4UFKA 3WK1A 2V2HA 4FX6M 3BG9A 1KM2A 4FEZA 1UCWA 1C9DA 4IWWA 1GQNA 4WQ6A 1YTKA 2Y85A 4UTLA 2Y6ZA 2E6AA 3LTYA 4YWIA 3R5EA 3QMSA 2FFCA 4O4WA 3QMTA 3W70A 3AO0A 3OEXA 4O0ZA 1CI1A 4I7UA 3T55A 3DI0A 2FPVA 3NQ2A 1O95A 3EX4A 5AHLA 1MEWA 2R94A 1MZHA 4UFJA 4O4VA 2JBMA 3TQ0A 1T8XA 3O15A 4P61A 4M6PA 3LCGA 1RZMA 4PTNA 1PCKA 4KFNA 5D2VA 1H7WA 2J6XA 3DKLA 4IMDA 4CQAA 5DLCA 2I9EA 1BWKA 4JX6A 1H7PA 3TSBA 3E96A 2PRLA 5CGQA 4NXKA 3E02A 3L65A 1YADA 1FCVA 1Q6RA 5KZDA 3ZWTA 2YFOA 3I68A 3C6CA 4ORMA 1SPQA 1X1ZA 3NL3A 4O1AA 3L68A 1XFBA 3S1XA 2HS8A 2A85A 4LNYA 3LM7A 5CG7A 1JUKA 1W56A 2VFDA 3OVRA 1F6PA 3A21A 1W5QA 5CZ0A 3T78A 4JTSA 5AHNA 2WSRA 3TV8A 1MSSA 3QMRA 2DZUA 3G24A 3ABSA 1GTHA 3DAQA 1TTQA 3IIZA 2NLIA 3IVTA 1DHPA 3W3OA 4IMGA 3UY8A 4POCA 3B04A 4GRSA 2E5DA 4FIQA 4ZQPA 3W7PA 3WK3A 2E09A 4Z1AA 1B57A 3LRKA 3GDMA 1TPC1 4RZ4A 4XKYB 3HG2A 5AYYA 1JCJA 3W85A 3QW4B 3F4NA 3TK7A 4K6AA 5HWMA 1KFJA 3PUEA 1AW1A 3PB2A 3PR2A 4EWND 2OCZA 3QRHA 1TV8A 3LHYA 3LDVA 3KVMA 1AW5A 1P4CA 1LDCA 1RV8A 2AGKA 3W2NA 3PBVA 3DFOA 3MBFA 1ME9A 1H51A 2YFNA 3C4UA 1GG0A 4JYFA 3U8GA 3G8EA 2VELA 3IIPA 3DFPA 3PF3A 3QEZA 5LHFA 1N55A 3UWYA 1SSDA 3NXFA 1VYPX 1FXPA 4N4PA 5K4ZA 2ZBTA 4RK8A 3KFTA 1LBLA 1WX0A 3OHIA 2NWSA 1OFOA 1XBZA 2GJLA 4NXSA 4BF9A 2ZA3A 3M1ZA 4PL1A 3T44A 2GVLA 5F1UA 4KFOA 3CM4A 1I2NA 1OK4A 1T99A 3W7QA 4RZ6A 1HO4A 1QMLA 1YXYA 4YXGA 1ZY9A 1FCQA 3M9YA 3DBPA 3L67A 3FKKA 2C1HA 1ZNNA 1LZOA 5D04C 1KBIA 1IGSA 4BR1A 2VEKA 3PBYA 2PRHA 3PG8A 2YYUA 5FF7A 2DZVA 4LWWA 2J9YA 3W71A 3G0XA 1FWRA 1H5YA 2B7QA 1VCFA 2RDTA 1SW3A 3BLEA 3MHFA 1OF6A 2X16A 3P5YA 5D09A 4JICA 1QO5A 2JK2A 3I7SA 1GVRA 4P2VA 3N2XA 3EX1A 4CQ9A 1BTMA 1RVGA 4MOZA 5EBUA 4MY9A 3HO8A 3W83A 2C15A 4X3ZA 4M19A 1VZWA 1O5XA 3IIOA 4ORIA 4RCXA 5I3JA 3M6YA 3EWZA 4LV4A 3NEVA 4Z08A 5U7SA 3MW7A 2TSYA 1S3HA 4LC8A 1PVNA 3NQAA 5DXYA 1LBFA 4Y96A 2X1SA 1SSGA 4DQWA 4IMFA 3BW4A 2HS6A 4UFHA 3NA8A 1HL2A 4GUGA 4GUJA 3M5XA 3LI1A 3THAA 3C8FA 4PFMA 4QM1A 4DBEA 3W74A 3MJYA 2QUVA 4Y90A 3P84A 5EA9A 3W1MA 5FF2A 5G2WA 3VE9A 3HG3A 1SZEA 2FB3A 3DZ1A 3SECA 1F05A 3P80A 3STCA 2X2GA 2TYSA 2E1DA 3DFQA 2TPSA 3IGUA 4O10A 1Z44A 4RXFA 5CZTA 1KTCA 3KRUA 3ZS4A 5KSWA 3C2OA 5K9CA 3NR0A 3DFTA 2CLKA 1M7PA 3W7EA 3W84A 4K39A 4I7VA 4JTFA 5BNKA 2QUUA 2ZZ2A 1TMHA 1TPEA 1EWDA 4MKNA 5DCBA 4MFDA 2VXNA 3LBMA 3CWNA 4FF7A 4M6QA 3RFAA 2YW3A 1CX9A 3TJXA 1TJRA 2NV1A 2J9XA 2QCFA 1W3IA 4XQ6A 3NL5A 4WUIA 2ZZ3A 3UWZA 3VE7A 4ZQRA 3FEMA 3T40A 2VENA 3FIGA 1SO3A 3NPUA 1K8ZA 3STGA 3SGUA 4CCDA 5AHEA 1TPUA 3C3NA 2QKFA 4ZMGA 3V1PA 4LW7A 4JY9A 1EA0A 4BI5A 1FX6A 4RZ5A 3H53A 2HTMA 1WOBA 3P74A 1O94A 4YLWA 2WSQA 5CSSA 4LVBA 3L66A 4UMCA 1I2QA 3CC1A 3BVJA 1YPFA 2CFFA 4FXRA 1K03A 5TBOA 3TMQA 2G96A 3F4WA 1P5BA 4LS1A 1NSJA 4WJEA 4JDBA 1QPOA 2FTPA 4MY8A 4A2RA 4AAJA 1AL7A 3BARA 2OMAA 3ZR4A 4MYXA 1TYGA 5HUOA 2J27A 2CLIA 3RLVA 4O17A 4UCGA 1G69A 3P67A 3ATZA 5HUPA 2NUXA 2G95A 3CTLA 1S5TA 3Q37A 4GJ1A 3RF9A 3HB9A 2CWNA 1PE1A 2QCMA 1H60A 2WV8A 2Y7DA 3FOKA 3PAJA 3W2LA 3GYEA 1R2SA 4OV9A 1H1ZA 3GK0A 2QJGA 3GXNA 1G7UA 1TCDA 5DY3A 3WJXA 2AQWA 4AWSA 5CZJA 1J2WA 4LRSA 1AG1O 1SZNA 1YYAA 4NNBA 1T0OA 5DCDA 5BW6A 2C18A 5C5YA 3ELFA 4OE7A 4GUHA 2Z1BA 4JIPA 3DHDA 2BXVA 3W7DA 1U83A 3W1TA 3LGEA 4FNQA 4E0CA 3BG5A 4NNCA 3HJZA 4AVFA 1Q6QA 5E93A 4LVAA 1FUYA 4ZQMA 5F4WA 5F2GA 1KLZA 5K4XA 4Y6GA 3LI0A 1LOSA 3PBUA 4NX5A 1H7XA 3QSRA 3LCIA 2E77A 3GR8A 2YSWA 3USBA 5I3FA 3LHUA 5DN1A 2QDHA 5D2WA 2PE4A 1LCOA 5BRBA 3LX9A 3VFLA 2WNQA 4NJIA 4X22A 1K7XA 5F4XA 1JR1A 1OG0A 3TMLA 1W1ZA 2PC4A 1GJPA 3NQ7A 1UUOA 1KFCA 4IQLA 1H7OA 3K30A 4UMAA 1KM6A 2NXGA 1EP2A 2YPIA 2JKEA 2R14A 5I3KA 2XN2A 3KX6A 1VRDA 4JTHA 3TFXA 2A4AA 2QCCA 2WSYA 1DVJA 2Z2UA 5D32A 3LCXA 1T96A 2RDUA 3BW2A 3NM1A 3O6CA 3G3MA 3QQ1A 4H3DA 2EGZA 3GLCA 5HULA 1VR6A 3GB6A 2R8WA 3TE9A 4ICNA 1W54A 1QPQA 4K7YA 1WXJA 4IGHA 2QCNA 1AW2A 1IF2A 2RKXA 4HNTA 3DFSA 4Z0SA 1FWWA 1OF8A 3W1UA 5H91A 1QWGA 2W6RA 1KFBA 1F5ZA 3W07A 1IXOA 2EHHA 3EEGA 1TREA 1CW2A 3I7RA 4HIBA 4R34A 1UBSA 2ZA1A 2NX9A 3EWBX 3TNOA 1VYSX 2YZRA 3M16A 5D2YA 4UUIA 4HNNA 2V82A 1XDLA 3WJZA 3A22A 2CLEA 2ATMA 4DPQA 2NWRA 3L0GA 4UIOA 1W5NA 4HN4A 3W7HA 3W1RA 1ZENA 4LS0A 2B7NA 3EWYA 1QPRA 3C2RA 3W22A 3STFA 1XCFA 3VKJA 1HUVA 2QR6A 3UQNA 5KINA 3W73A 4HHPA 4FNSA 3CHVA 1AMKA 1ZHAA 2WKJA 4EF8A 3N2MA 2NXHA 4LRTA 4N2YA 1WV2A 4N9BA 2QJIA 3W9ZA 1MEIA 3MMTA 2WQPA 4YCPA 4FNUA 3LCLA 3M0ZA 2NUYA 3GZ3A 1OX4B 1TRIA 3CEUA 3W76A 3CLMA 3D0CA 3IVSA 4TMBA 4GE8A 1SR9A 4NJHA 1G4TA 2B0MA 4A22A 5D03A 1RPXA 5G2IA 1J5TA 3UNDA 3S9YA 1JRCA 4R7JA 3G1SA 1YXDA 3S1VA 1W8SA 3DFNA 3I7QA 4ADTA 3SR7A 4ADSA 4MY1A 2ZZ6A 5CPLA 3UPWA 2VFEA 1OFDA 5FF3A 4Q33A 4MZ1A 1Q6OA 4JD4A 1QO2A 4AF0B 4KKXA 2C19A 3TQKA 1X1OA 3NQCA 2CZFA 2E5CA 1D3GA 4QITA 1SUXA 1KM5A 4UTUA 2GVGA 3C2VA 2FLIA 1F6KA 2QUTA 4N9DA 4UXDA 3P62A 4HSNA 4B5NA 3W2JA 4H6KA 3BW3A 1HTIA 5DBUA 4Q32A 1UB3A 4ZVJA 1B4EA 1LLWA 4O28A 2P0OA 1E51A 1H62A 3BO9A 5K2ZA 3OBKA 3W7OA 2WNZA 1LM1A 4AF0A 1M6JA 4CCEA 3HGSA 2V5BA 5GVJA 1ONRA 4OBTA 1K7EA 4I9AA 4FNRA 2YR1A 1OABA 2C6QA 3A24A 1LTDA 5FI8A 3NQMA 5SWUA 2P10A 4RV8A 1TPB1 2F7FA 1XUZA 1FWTA 2H8ZA 1ZJIA 1FCUA 4UTWA 4Z1DA 4EOUA 1EP3A 3KAOA 2H3BA 1M5WA 1UASA 2RHGA 2ZZ4A 5FEWA 3HMJG 3WK2A 1VGAA 3T4CA 1IIHA 2VOMA 1JULA 1OFRA 3N14A 4JTKA 4PEKA 2CU0A 1GPWA 2DORA 3W7CA 1PCWA 3VNDA 1OYCA 3MI6A 3NQ8A 1SZFA 4K38A 3O1NA 1KBJA 3BLIA 4X9SA 3TIMA 3GNNA 1XI3A 4WOZA 3PSWA 4XKYA 3NQDA 4JS3A 2JGQA 3I65A 1Q3NA 1JRBA 5AFDA 4IPIA 3QYQA 3GDKA 5EL1A 2DZWA 5HQEA 2QEZA 1TQJA 3QW3A 1AL8A 4M6VA 2C13A 1F73A 4MFEA 5CZSA 3PBWA 1XM3A 2A7PA 4PCFA 2ZRWA 4NJJA 2EPHA 1TB3A 2EAWA 3UWQA 4RLIA 5C6MA 3EWXA 1ZFJA 3LHZA 3EB2A 4XWUA 2Z6JA 2A6NA 3QF0A 3QFEA 4FX7A 2OT1A 4C1LA 5BMXA 4O54A 3FYOA 3HF3A 3QC3A 3TW7A 3L5MA 4LVGA 3W7GA 4W9TA 4U4MA 3BGGA 3P8JA 3NZRA 1ADOA 2BWGA 1OFPA 5LNSA 2C3ZA 3S5YA 3CB8A 3ABOA 3EKZA 1W3TA 3TDFA 4OQVA 4MLRA 2FIQA 5LGZA 3NG3A 4O14A 2B7OA 1AK5A 1R47A 4BFAA 3W1XA 4ZQOA 2Q8ZA 5F1VA 2DJXA 1Z41A 5AN7A 5D05A 3N3MA 4NZJA 1I45A 1VS1A 3NPVA 2ABBA 1W31A 4XTDA 3O6DA 1A5SA 2QF7A 4O11A 4QQ3A 1I2PA 1C8VA 1P1XA 1H50A 3MO7A 2ZQ0A 3LHTA 2BSLA 5AYXA 4GBUA 4R53A 3T7VA 1ME7A 3R89A 4ZQNA 3P61A 3W23A 4JX5A 2P1FA 3LXAA 4N6EA 5H2ZA 4UTWC 2V5LA 1K7FA 1WOAA 1NFBA 3HIJA 4UTIA 3O05A 3L5LA 4DO5A 1DKWA 2B4GA 1FCBA 1YDOA 2ISSA 3BK0A 2DZTA 3G1VA 1JVNA 3FJ6A 3FLUA 4KWWA 1F7BA 3G0SA 4JTGA 4GWEA 2VKZG 1RQHA 2X1UA 2Q8LA 3EKLA 1TRDA 2BZNA 1W5MA 2YDAA 5KITA 1R30A 3MP5A 4JXCA 4IMCA 2V81A 3DU0A 4DF0A 2YX0A 3TKFA 1XBVA 5EKYA 4TMCA 2Y63A 1F74A 1G4SA 4M5PA 3S1WA 4Z0JA 3RLUA 3C0JA 4WXYA 3DXIA 4Y9AA 2GOUA 5D33A 1OJXA 4WY0F 4BI7A 4UR7A 4RR4A 4X2RA 4LT9A 2ZA2A 3GAKA 1GTEA 3OVPA 1YXCA 2GJNA 3N73A 3GNDA 4L4LA 1WYIA 5DXXA 5L9FA 3R12A 1QR7A 3L9CA 1KFLA 3BGJA 3IIVA 2CLOA 4JYEA 1ICQA 4WXZA 5LSMA 3SY5A 2D73A 5ABTA 4ALDA 1ZAIA 4DBDA 5TQLA 4YL2A 2JKAA 1SU5A 4JYDA 2WO5A 3IIXA 4NJGA 1WBHA 3L21A 4O52A 4MYAA 1EWEA 1HFBA 4NJKA 1KM1A 2LLEA 4LU0A 3LOTA 1SQ7A 3IRDA 1W3NA 1L6WA 3KRZA 1FDYA 3W7IA 3LV5A 3VCRA 2A7RA 2H3DA 4YCOA 4JY8A 5AB3A 1P0NA 3ANYA 1L6SA 4K8HA 3IGXA 2QCHA 3SSJA 5HWJA 1VYRA 4TIMA 4UTHA 5K7JA 1W0MA 4DO4A 4N4QA 3S5OA 2X1RA 1L2UA 3TH6A 1JQVA 3PC0A 1YDVA 3N34A 3ABRA 1LRNA 1NF7A 1XC4A 5LNVA 2YW4A 3FFSA 1GG1A 5FF4A 1TQXA 3U6WA 1H7RA 3EWUA 4S2CA 3KHJA 1KM4A 1SW0A 1I2OA 1Q6LA 4O0KA 2QCDB 4QISA 4YMZA 5CKSA 1D3HA 1F2JA 4IPJA 4EIVA 4UTMA 5A8GA 4CNOA 4DF2A 3E9AA 3UYCA 1A50A 1LOLA 2H90A 2YYTA 2VEIA 4QAIA 1I8JA 5G1YA 5C55A 2WOQA 2E6YA 3M7WA 5HNRA 1GYNA 1RD5A 3LXCA 5HMSA 4KWVA 3A5FA 2DZSA 1WQ5A 2A0NA 1EP1A 3W7MA 3TFCA 5AHIA 3B05A 3KVLA 5G1TA 1KFKA 3W1LA 3HQ1A 1D9EA 4FNPA 4IXXA 2GUUA 4N9EA 2H8XA 1LORA 1VCVA 2JKPA 1FQ0A 4GUFA 3QQ0A 5EPDA 1S5VA 3TX9A 2QCEA 1OFAA 5LKYA 2G5WA 5AOUA 1VLIA 1THFD 1KLYA 4TO8A 8TIMA 3C61A 3BLFA 5F2MA 2FPYA 4NT0A 5J5DA 3CT7A 3PS7A 1JUEA 4BWLA 4FO4A 3S8HA 3F1QA 3W72A 3R8RA 1L6YA 1OVDA 3P5ZA 4S2BA 1OFBA 4LVDA 1TPVA 1G7VA 1R2TA 3MBDA 4AHQA 1C29A 3LXBA 4BI6A 4Q4KA 4U28A 1VJIA 1K8XA 3LB0A 4JGDA 3OA3A 4IOTA 5C54A 4NQ1A 5EY5A 2GQAA 5DELA 2ZRVA 1O60A 1VQTA 1W37A 1XDMA 1IXNA 3CEPA 1VH7A 3NGJA 5DCEA 4OWGA 1YTEA 3CQ0A 3TROA 4LTSA 2A1YA 1KA9F 1QOQA 4JTIA 4E2BA 3Q94A 4EF9A 4UC5A 5TIMA 3W88A 1FDZA 3NQ6A 4MJZA 3TCEA 4R33A 1H63A 4CNPA 3N9SA 3GR7A 2QDGA 1ME8A 2WJZA 1JQXA 2ZYFA 1ZAHA 1EUNA 3NOEA 2ZZ7A 3MHUA 3UWVA 4S1FA 3G1HA 2A21A 1ML1A 1B9BA 3W2MA 3KXQA 3S5ZA 5FEXA 4IUOA 2QAPA 2V8ZA 1FDJA 3PULA 3NVTA 2TMDA 3KOFA 1KFEA 3BPWA 3L0NA 4DF1A 6TIMA 1UJPA 2BTMA 3H55A 3MWAA 4Y8FA 5A5WA 1FXQA 4MPQA 4A29A 2VEMA 3A5VA 1FBAA 1NVMA 4K37A 3DGRA 3G1XA 1ICPA 2I14A 2E5BA 3B0UX 3NNTA 3HBLA 1OFQA 1DBTA 4TR9A 1B3OA 4AB4A 2A2IA 3QJAA 1G4PA 4Z1BA 5D2XA 4XBSA 4CLMA 2XN1A 3M5ZA 4JTLA 2ZZ1A 2OJPA 5AYZA 4RKAA 2XFWA 1PIIA 3W1NA 4NZFA 4UR8A 1QCWA 5F4SA 4AMAA 2ZRXA 3OIXA 3M5YA 4BWLC 5AHFA 1GVFA 1K02A 3GDRA 4E38A 4FB7A 3WJSA 1VLWA 2VC6A 3LBCA 4AWUA 3INPA 1ZCOA 5KMYA 1I4NA 1W5PA 4AHOA 6ALDA 2Q3RA 4K8EA 3DH7A 3P82A 4MUZA 3NAVA 3RNDA 4ZQCA 4FIRA 2HSAA 3LHVA 4DO6A 4PA8A 3UWUA 5G4WA 4HPJA 1MO0A 4LC6A 1OYBA 3EXSA 5G2HA 2OZ0A 5FESA 2NX1A 1LLZA 2X1TA 2JGYA 2VEPA 4LOCA 5D30A 2EF9A 1X7FA 2CZEA 3TXVA 1JCNA 4FXSA 2KZHA 2ZRZA 3IVUA 1OX4A 3UD6A 1IIGA 3H54A 4UNLA 3EXRA 3UPBA 5G4EA 3NL6A 3W7JA 4GUIA 4C1KA 4JIQA 3QPYA 3W7NA 5G5IA 4O18A 4O16A 3TU9A 1A5BA 3IEBA 2QCLA 3GXPA 4UTJA 2C16A 5EYWA 1TSIA 2ATSA 4JEQA 5LNWA 3TAOA 1LRQA 3OVQA 4DELA 3NQGA 3FS2A 3GDTA 5K3VA 5HR6A 4UFMA 3CU2A 1IXQA 3NQVA 1VHNA 2QCGA 3L2IA 2H6RA 3W7KA 3LV6A 4FNTA 3S0CA 1BWLA 4OT7A 2YXGA 5D37A 4MVAA 2BX7A 2F84A 3SW6A 1DJNA 1NEYA 3B4UA 3NPWA 1JCXA 3GKFA 3MUXA 3NZ1A 3ATYA 3HPZA 4RJEA 1JCLA 3WFAA 1GOXA 1LROA 4HSOA 2RDWA 2QAFA 2A5HA 3LLDA 1YPIA 3B0PA 3F03K 3SJ3A 1PHWA 3W87A 1Z48A 3HOJA 4PODA 1OHLA 1TPFA 2A7NA 4J9JA 5BMWA 3LTPA 2CZDA 2J24A 5D02A 2V30A 4N9CA 1Q45A 2CLLA 3TW6A 1KV5A 5LHEA 3GKAA 5IM51 3ABQA 3WJYA 1K3UA 3RMJA 4AHPA 5IBXC 4LS2A 3TR2A 1SO5A 4DPPA 3W86A 3GDLA 1SW7A 1UUMA 4D2JA 2DU2A 1I2RA 4HT3A 5HR7A 3DHFA 3GXTA 1W5OA 4RX0A 1DQXA 3GAYA 5LZLA 1FY6A 1KM3A 4DXVA 1Y0EA 3SZ8A 2Y88A 1JJKA 3UZJA 1SO6A 2OT0A 3VI2A 4O53A 4PL2A 3TJLA 1PHQA 3PVFA 2Q3OA 2DZPA 3HG5A 2GPTA 3SIZA 1TIMA 1VCGA 4QNWA 5U4NA 3LCHA 3KVKA 3LLFA 3RK8A 3L5AA 4JX4A 3HGRA 4O57A 2VFGA 1TPH1 2EKCA 3M5VA 2X30A 1SFLA 3P8IA 3UZ5A 3DKJA 2C0AA 3MI3A 1VPXA 4OU1A 5LNUA 4XTIA 2PRMA 1GYLA 4UMBA 4OGZA 5CPNA 1A53A 3NO5A 2Y7FA 2DJLA 1KM0A 1HG3A 4O8RA 3MP4A 5BOOA 1EUAA 1DV7A 4O19A 3CPRA 1P0KA 2E6FA 2CLHA 3PG9A 4UNKA 2BLEA 2R91A 2V2CA 1YDNA 4DEFA 1DJQA 1NF0A 2ZCGA 3M41A 1GWJA 3O8AA 1M7OA 3BV4A 1V5XA 1B4KA 3W2KA 5AC7A 3MI2A 4A21A 2ISVA 2J9ZA 3EX6A 3HGOA 3HPXA 3M47A 3JRKA 3TSMA 2NZLA 4UFLA 4QNEA 5K9DA 4NUWA 5F2LA 4N6FA 1F76A 5KZEA 3MYPA 2OX1A 5AHMA 5DY2A 3NQFA 4PC8A 4ONVA 2ABAA 1ZALA 3M44A 3MHGA 4I7WA 2W79A 1VC4A 3I6RA 2VFFA 3HPSA 2TRSA 4A2SA 1EB3A 4HKPA 7TIMA 4LUJA 4MJMA 3W6YA 1KTBA 1XBYA 2GQ8A 1RQBA 3NPXA 4IX0A 4CNNA 1R46A 4NNAA 3JR2A 3LHWA 4XZ9A 1LOQA 3EX2A 1QDSA 4HPXA 1EEPA 1TTPA 5D2TA 3L0KA 2V0TA 1OX5A 2E6DA 4TU1A 3C56A 4O50A 2ALDA 4MLJA 4GXMA 3NM3A 1OFEA 4M7TA 3S6DA 2Z6IA 3EX3A 3GVGA 1OK6A 3KRSA 5E0KA 1XBXA 1WDWA 1N8FA 1QFEA 4O12A 3LCWA 1LYXA 5FEZA 3W2UA 5HWNA 1A5CA 2C14A 3STEA 1TJPA 1FWSA 1GVOA 2QJHA 3PSVA 2YGYA 2Y7GA 2DZXA 3CWOX 3G18A 4JTEA 2WNNA 3BG3A 2Y70A 2FPTA 1WBJA 5K9XA 3TAKA 3ZWSA 4OHQA 4UTTA 4K36A 3AJXA 1GT8A 3JS3A 1LBMA 5HINA 3NYZA 5C2XA 1S5WA 2I1OA 2UV8G 1JCMP 4MIMA 5AC8A 2VFIA 3B0VC 5AC6A 3G8RA 2ISWA 3DI1A 4QIUA 4WY0B 1QNVA 1U5JA 4JTUA 4AWTA 1KV8A 5CSRA 4H4IA 3P7YA 4L4MA 1DORA 3O16A 3RU6A 1O5KA 3HGJA 4WX2A 4N02A 2GQ9A 3KVJA 3THQA 1TO3A 2RH9A 1QPNA 1TPDA 1Z42A 4LY8A 2CLMA 3LRMA 1TPWA 3EXTA 3B06A 4XBKA 2IQTA 3OG3A 1JUBA 2FDSA 3PB0A 1R2RA 3W1PA 5HJLA 2A6LA 2O7SA 2FJKA 1NAL1 5I3HA 4JTJA 4WY0A 2CZ5A 1YTDA 2RFGA 1G67A 3PUDA 2AAMA 3IGSA 3Q2DA 3PM6A 4TX9A 3Q58A 4UFIA 3E49A 1XL9A 1PS9A 5L6UA 5CPOA 4IMEA 3S1UA 2B7PA 1SFJA 2VFHA 3G1AA 3U2OA 3N9RA 2DP3A 4LUIA 3R13A 4PH6A 1SZGA 3FA5A 1A5AA 5FEPA 5D38A 1FWNA 4IX2A 1YLVA 2CLFA 4MZYA
chains in the Genus database with same CATH superfamily
4CCCA 4ADUA 3IACA 1BKHA 1RCXB 4IP5A 3TXZA 2QCDA 2GVJA 4FX8A 1YDYA 3O63A 3O6YX 1W8GA 5EMUA 3S5NA 1WZMA 1GEQA 4LFYA 3TYUA 1KTNA 2PEVA 5JQ9A 4Q4SA 3QZEA 3TP4A 4ASTA 3E2RA 3KLLA 4DAFA 4F0KA 1P7TA 3MP3A 1Q5MA 3IV3A 3ARWA 3W81A 1TJ0A 5I3GA 3G22A 4LBUA 3SFKA 1CB7B 1FFRA 1WDQA 1XFCA 3CL6A 2AL1A 1UA3A 1TMQA 2ZRUA 3G0UA 1YPXA 1JXKA 1EJWC 1E6XM 3R2GA 4EVZA 3RM8A 3GX9A 4HJWA 5CG0A 3QPZA 1RVKA 4UTTC 3DHPA 3LTSA 2PP0A 4Z1CA 4KFPA 4W88A 4QROA 2NUWA 3DENA 1V6UA 4A3UA 1EF3A 4MF4A 3MMUA 3P6LA 3MANA 1MXSA 1A0EA 3O06A 1UMLA 3WL0A 3UY7A 1VJSA 1IGWA 4I8DA 4M51A 2HK0A 1EDQA 2Y2WA 4RXGA 3GIYA 1XIDA 3PUOA 2PMQA 5T26A 2XH0A 2F2HA 3FJLA 3GG0A 3TSDA 2ALRA 5ECVA 1X6UA 3KM8A 5C9RA 1AJZA 1QAPA 4GABA 3K46A 3P93A 4TUFA 4EKJA 1EDGA 3V7PA 5J8LA 2REQA 3SUWA 4CCZA 1JCYA 3FJNA 3OGRA 1ICSA 4NAFA 3G1FA 4UOJA 3UXAA 3DYMA 5FF0A 1PYFA 3SRDA 1EX5A 3OLGA 1VBGA 2AMXA 1F9CA 2BGQA 3W1QA 2WC7A 3WMBA 3PWAA 3NGFA 4G2DA 4GC4A 2ZX9A 2E68A 4AD5A 4PMNA 1YIXA 5JUVA 1WKFA 2P8BA 3LK6A 3H2OA 4L56A 5HMFA 1G6CA 4GYPA 3QKEA 3EA3A 2VGBA 3G1YA 2W0UA 4W87A 2Y8KA 5XIMA 4D6HA 2GDVA 1EJXC 3TC6A 1GHRA 4NVTA 1NDYA 1Q7QA 5IBXA 4H1ZA 2J77A 2IKIA 1XSIA 4UFKA 3WK1A 2VR2A 2V2HA 1ZBVA 3BG9A 3OOQA 2QDDA 4D72A 3PZOA 4FEZA 1A4LA 4H04A 2H9AA 4WDUA 1GQNA 4WQ6A 3DG3A 2Y85A 2QPXA 3CV1A 2P5NA 3LTYA 1WKEA 1Z89A 2UY4A 3QMSA 1QI4A 3CUJA 4YVVA 3QMTA 2GGHA 2PDKA 3W70A 1ISXA 1ISZA 3BE7A 3AS2A 2VDHA 4FZIA 4XD4A 2NQJA 2RGLA 4JQ3A 5AHLA 3UVIA 3CQIA 1MZHA 3C2YA 2FVMA 2JBMA 4P61A 1HXJA 1VAHA 4LY4A 3RRXA 1RZMA 1E43A 5D2VA 4KFNA 4FLQA 1H7WA 3DKLA 4IMDA 1TE1A 2O9TA 1M04A 3ES7A 4EANA 3RDKA 1JYNA 3TSBA 2OZ8A 4DN1A 3U48A 2PUZA 3E02A 1YADA 1FCVA 1Q6RA 4XAGA 4AZCA 3T0DA 3QC0A 1GJUA 3TYZA 4JQAA 1W1PA 1U1HA 3GSMA 3C6CA 3MSYA 2JIWA 1X1ZA 1QXLA 2J4GA 2AQVA 1PTGA 2PTXA 4NI8A 2QPSA 4GY1A 4LNYA 3OVRA 2W67A 3A3XA 4GO8A 1Q6DA 5CZ0A 3TV8A 3QMRA 2DZUA 2WZMA 2YLLA 4HA0A 1TTQA 4R27A 3IIZA 2NLIA 1FWCC 3IVTA 1XIMA 3W3OA 1ZL1A 1WDSA 1ODUA 3WQDA 2WMKA 2E09A 1IEIA 3UJSA 1B57A 3U2EA 3LRKA 4ZEPA 4A4AA 3UJFA 4L4OA 4F2UA 1JCJA 3CPUA 2G37A 3F4NA 1MW1A 2F6KA 3PPHA 3TK7A 3WENA 1AW1A 1KCZA 3PB2A 4EWND 3QRHA 1FWIC 7A3HA 2VUNA 3Q45A 1AW5A 3TYAA 2AGKA 4JIHA 3PBVA 3GTIA 3E38A 4FR1A 3H2NA 4M0XA 4PYSA 1ME9A 1AQFA 1TA3A 2Z24A 2O92A 2WLZA 3G8EA 2XIBA 3IV8A 2ZXDA 3OBAA 3THUA 3QEZA 1Z6KA 3UWYA 1V79A 5DRIA 3NXFA 4X61A 1VYPX 5CGMA 1FXPA 4N4PA 5K4ZA 3NTYA 4AD0A 3QV6A 3OHIA 5KETA 1HL9A 3ORWA 1XBZA 3TCSA 3VINA 4LUYA 2Z1SA 3CM4A 1I2NA 2EJAA 5HBFA 1AQHA 1YXYA 3ZMRA 2QT3A 3E74A 3M9YA 4QRNA 1N2VA 5ABFB 1NFGA 4AX6A 3EKGA 3IJLA 1XCXA 1LZOA 5D04C 4RV3A 2OLHA 5DT7A 4GA8A 2VEKA 1PZ0A 3PBYA 3NUKA 5FF7A 1CXFA 4LWWA 2J9YA 2B7QA 2R9RA 2QPUA 3ONBA 5BRQA 3P5YA 3ARQA 1JYVA 1ITQA 1R3YA 3IUIA 2MUCA 3UT0A 3OG2A 3N2XA 3EX1A 4HOWA 1BTMA 3TONA 1XLMA 3ZT7A 4ROPA 2I5GA 1DWJM 3HO8A 3W83A 1UA7A 4H2HA 1FH7A 5I77A 1VZWA 3ARTA 1JF6A 3EWZA 4LV4A 3KE0A 1TVPA 1C7TA 3ARSA 2X1SA 4BHYA 1PDZA 3BANA 3BW4A 4NRRA 4Q8NA 3NA8A 4GUJA 3LI1A 2W91A 1XIEA 3ABZA 1MXGA 4QM1A 4GYKA 4BF7A 5G2WA 1RA5A 4MHBA 4Q8QA 3RUBL 2Z27A 1EHAA 3UGRA 2TPSA 1RXOB 2NQ9A 3OLDA 3IGUA 2BY2A 4F3HA 1KTCA 3KRUA 1MVYA 5K9CA 3W7EA 3S2CA 1VD6A 3U5UA 5BNKA 2QUUA 4HU4A 1EWDA 6REQB 4FOKA 4MKNA 1JZ6A 4FF7A 4M6QA 3RFAA 3SUTA 2YW3A 4IIFA 3TJXA 4MDOA 1XG3A 2VYOA 1UYQA 3H7UA 4PUKA 2YBTA 3NL5A 2CWXA 3M0LA 1D8CA 4U5KA 3FEMA 3T40A 3B0XA 3LS9A 3B9DA 3FIGA 1BGAA 5AHEA 1XYBA 5DMLA 4ZMGA 2EO7A 1EA0A 4RZ5A 1KB3A 3AMKA 3OIHA 4YLWA 3KCLA 3WD1A 1EGVA 4XZIA 4QEEA 3A64A 4JFSA 3IJ6A 1YPFA 4KWOA 4L6HA 3TOYA 3UG5A 3ZYZA 1GQJA 1POKA 1I0BA 3N4EA 2ZXAA 4H8NA 4M80A 3UZZA 4C90A 5IHRA 4WJEA 4JDBA 1QT1A 4DJEC 2BHUA 5HPCA 1QPOA 2FTPA 4OKDA 2O55A 3C0SA 3AMGA 4AAJA 3BARA 4Z17A 1TYGA 1RP9A 1TE6A 2OEMA 1TWWA 1GOKA 1G69A 4MNJA 1TV2A 4C6FA 5JXQA 5HUPA 3WLSA 3E0WA 2G95A 4KEUA 3CJPA 4D6FA 3RF9A 1H60A 4EXAA 3FY1A 3CUFA 5HNNA 3Q67A 1HNYA 3GXNA 3RAOA 1EXPA 5DANA 3WLMA 4AWSA 4LRSA 1AG1O 4NNBA 5DCDA 5BW6A 1SJDA 4GUHA 1OC7A 4ZTXA 3K4WA 3QV7A 2BXVA 1L8NA 3W7DA 4R85A 2HVNA 1FTXA 4E0CA 5AZ0A 1XS2A 3QGKC 3BMWA 4NNCA 5FAJA 1FUYA 4ZQMA 3A12A 5C9UA 4D8AA 3PBUA 4QLLA 2HNEA 3GR8A 3AIRA 3QTGA 2PWEA 2W27A 3EMZA 1EKOA 2PE4A 5BRBA 5A8QA 3B8TA 3VFLA 1JGMA 1K7XA 3T0CA 2OQLA 4QP0A 2CESA 1W1IE 1W1ZA 2PC4A 4JFUA 1UUOA 4ECLA 3STPA 4IQLA 1V6WA 1CEOA 2NXGA 1XIBA 3MDWA 5I3KA 4OZOA 3CXOA 3QYSA 2A4AA 2OSYA 3KZSA 4JCLA 2Z2UA 5D32A 4LSBA 5FJPA 1OCQA 5HK4A 5LIUX 3OLIA 3QQ1A 3MJMA 4H3DA 2EGZA 3GLCA 5HULA 1KBLA 3NFUA 1Z69A 3EDFA 3GB6A 3TE9A 1QPQA 2NLYA 3PFRA 1WXJA 4CKQA 2FZ9A 1IF2A 3OVGA 2W63A 3PTQA 2XH4A 4HNTA 4Z0SA 5T91A 4C6IA 1ZJAA 5H91A 1QWGA 4QE5A 4NY2A 2W6RA 5B7YA 2QNEA 2ZVRA 1NWUA 2OEJA 3DOPA 1CXHA 1ONWA 1CXLA 1VYSX 4ZO7A 4ZXOA 1O1ZA 3FVMA 4HA3A 1R38A 3A22A 1ITXA 3NURA 2HQAA 3MO4A 2WM0A 1B9ZA 4UWMA 4YVPA 2NWRA 1YNPA 3PPGA 1P48A 3W24A 2HDJA 2B7NA 1VFOA 3VNLA 1SJCA 3C2RA 1HUVA 2QR6A 5KINA 3W73A 3RCNA 4D71A 1MQQA 2WKJA 3N2MA 4NSBA 4B16A 3MKCA 3URQA 3HTWA 4I8YA 3QFWA 3VABA 3MMTA 3WIJA 1E6PA 4YCPA 4FNUA 3LCLA 3WUBA 2WYSA 4NZ5A 3BGAA 3SCVA 1TWZA 3CLMA 4TMBA 1SR9A 2HPMA 5D03A 5A6LA 5G2IA 3RGTA 2BVTA 3S9YA 1JRCA 4XSMA 1W8SA 5CEWA 1I6NA 3UPWA 4Q33A 3NO1A 1QO2A 4KKXA 1X1OA 1DJZA 3NQCA 3CPGA 1UWSA 1KM5A 4BKNA 3C2VA 4N9DA 4UQ9A 4HSNA 1QHOA 3UCDA 2XZ9A 3HU7A 1B4EA 2J62A 4LPCA 3CL8A 5XIAA 1FA2A 1LLWA 4IJRA 2WK2A 1H62A 3BO9A 4CCEA 1XPGA 5LIXX 7XIMA 2CKSA 2QVHA 4I9AA 4LYRA 3ITXA 3UJRA 3WLRA 1LTDA 3NWRA 4LEQA 3NQMA 2VT0A 5C9ZA 4RV8A 2F7FA 1FWTA 4JKLA 1XIFA 3LPFA 1WNOA 4Z1DA 4EOUA 9CGTA 2H3BA 3ZLFA 1WUFA 3HPFA 2FFIA 4KWUA 2ICSA 2CU0A 4UOZA 3KCOA 1QVBA 1HGWA 3DN5A 4O1FA 4K38A 3GNNA 1XI3A 4INFA 3PSWA 1ZJHA 2E28A 3NQDA 5MF5A 4KEVA 3KP1A 1JRBA 4HK5A 3QYQA 1NARA 3UW6A 3RN6A 1F73A 5CZSA 4KW2A 3CAVA 3PBWA 1W17A 4PCFA 3FW6A 2ANUA 5CH9A 4NJJA 3O0FA 4DBSA 3PZIA 4DIAA 1RH9A 4QAWA 1DJIA 3GHSA 2OT1A 4O54A 3QC3A 1E73M 1KXHA 2Y8VA 3TW7A 2PS2A 4CU6A 4U4MA 3IJ9A 1CYGA 1ADOA 3RX4A 1OFPA 5CBJA 3CB8A 2DQXA 3AIVA 4UNIA 2FIQA 2B7OA 3CZKA 4NHVA 1R47A 4ZO9A 4BFAA 2Y0FA 3H2AA 5AN7A 1EJTC 5ABFA 1C93A 4LAZA 4XTDA 1RD6A 2J7HA 3AAMA 1FHLA 4GQRA 4X0VA 1K6WA 1H50A 2X41A 3DC0A 2ZQ0A 3WQFA 2DT0A 4MTVA 2BXYA 3MV01 2J6VA 5H2ZA 4DJEA 1B30A 4UTIA 3O05A 2WBKA 1LWHA 4D1IA 1KBBA 1DKWA 1GQIA 1XLKA 3H22A 2DZTA 4I6VA 3MVIA 1WZKA 5CZKA 4KWWA 3WQ6A 4GWEA 1XYLA 1XYMA 2Q8LA 3EKLA 1ZSXA 2PSNA 3UBPC 2BZNA 5E9XA 1ZP4A 3AXHA 2XVLA 1GQKA 3VD4A 3CASA 5G4HC 4RNJA 4AEEA 2OVLA 4DF0A 3DFHA 3WQPA 3AU6A 3DFYA 1MDRA 1XBVA 1IQ8A 2D0FA 2BHYA 4H01A 3UR5A 1F74A 4XZMX 4M5PA 5I23A 3S1WA 1PTDA 4WXYA 3DXIA 2IKGA 2GOUA 4BI7A 5BXSA 4UR7A 4DAIA 4X2RA 1BSIA 2VNCA 2ZUUA 3GAKA 4L6OA 1GTEA 3S6OA 3OVPA 5L9FA 1EX1A 5JH2A 1ZTVA 3GW3A 5A8PA 1E5JA 2RJHA 3WG6A 4DWSD 3ITCA 1KFLA 4JYEA 1B31A 3EMQA 4WXZA 1XLDA 6REQA 4DBDA 3ZJKA 3WN6A 3IIXA 3L21A 4NJKA 3SCRA 3LPOA 2LLEA 3LOTA 1SQ7A 3WUEA 1L6WA 4KF1A 2CHOA 3DG7A 4JNZA 1FDYA 3CGTA 3S3GA 4MWAD 2WZEA 2WSPA 2V3DA 3BC9A 1EFZA 4K8HA 4RPQA 4DYKA 3DYOA 1PKNA 2QCHA 3NSMA 3O3RA 4BZYA 1E40A 1Q7ZA 4PTVA 3WO8A 4JOMA 1W0MA 4DO4A 2D2JA 3S5OA 2WCGA 2X1RA 1DYSA 1L2UA 1TFVA 3PC0A 1KC7A 3ABRA 3M64A 4LX4A 2YW4A 4NZ3A 4S2CA 3KHJA 2CXEA 2PGEA 4O0KA 5CKSA 1ITCA 4EIVA 1E9IA 1UR2A 3AHXA 3ZM8A 3BAKA 3GVRA 1A50A 3QTPA 3QLDA 2BNJA 1NP0A 4QAIA 2WOQA 2E6YA 3M7WA 1GYNA 3K8KA 3LXCA 2G3NA 3VGBA 3VNZA 1WKYA 4AX7A 1K9EA 3A5FA 2ACUA 2AKMA 5G1TA 5CXPA 1D9EA 1GGOA 3RMEA 4IXXA 4N9EA 4QJ5B 1LORA 1VJZA 1JCTA 1KNWA 3VCCA 1QTWA 2XM2A 4MNMA 4IP4A 5EPDA 2XIIA 3TX9A 3FHQA 2QCEA 2QJMA 1FVPA 3UR7A 1E5NA 4UTFA 3BLFA 2FPYA 4NT0A 3P0XA 4HCDA 3QXBA 2E3ZA 1UW9A 3W72A 3R8RA 1RAKA 3IJ8A 3RIKA 4EAMA 4J3SA 3RPDA 1TPVA 1G7VA 2GOKA 3SO7A 1C29A 3R7MA 1OGSA 2PZNA 3GS6A 3GTNA 2D1ZA 3LB0A 3OA3A 4GCAA 2Q09A 2EPLX 4ZTYA 5EY5A 2GQAA 1J8VA 2CXGA 3T0BA 4GNVA 4B15A 2FDMA 3S9IA 5C2GA 1O60A 4GYFA 1DWIM 4H7CA 1VH7A 2GDUA 4LTSA 1G01A 1XC6A 1E0XA 1Z7AA 4HOZA 4EF9A 5I5RA 1JZ5A 3W88A 1MUMA 1E3XA 1ADSA 4QLJA 3MMWA 3QBUA 3SAZA 4PCPA 1XDJA 1JQXA 3F7JA 1DWHM 1VPYA 3UWVA 1J79A 1B9BA 5JH1A 3IRSA 4NYUA 2QAPA 5AYIA 3KOFA 2YCKX 2QLYA 3N25A 2Z1VA 2CEQA 3QZAA 3A5VA 5GNYA 1NVMA 4K37A 1B3YA 3B0UX 1X6LA 2JEQA 4WJXA 2VVSA 4UQCA 5D2XA 4B9ZA 1WB0A 2OJPA 1GONA 5REQB 4RKAA 1Z8AA 3ITLA 3W1NA 5DQPA 1AQMA 4HNOA 4LB3A 4L65A 3MUZ1 4BWLC 5AHFA 4FB7A 3IUHA 2PGFA 1I4NA 1K9DA 4AHOA 4MUZA 4ZOAA 3NAVA 3RNDA 4DNHA 2OZTA 5F7UA 4EP8C 2NVAA 3PZQA 4HPJA 4PRTA 3VTRA 1DTUA 2WKLA 2NX1A 2FKPA 2PGRA 2VEPA 4LOCA 1P0BA 2YZ5A 4V33A 2EF9A 2CZEA 4QQUA 3WBWA 5MKGB 2J7EA 1W6TA 3UD6A 1IIGA 1BVNP 3L4TA 3EXRA 1QNRA 3UESA 4C1KA 4Z2GA 2L5HA 5D4YA 1RLCL 5G5IA 4FAMA 2CLPA 3ZXWA 4O16A 1JGIA 3TU9A 5FJIA 4E4UA 1BXCA 2DUZA 2G4JA 3URAA 3NQGA 4MB1A 3FS2A 3NQVA 4WDTA 1VHNA 3EDDA 4KT2A 3WFZA 1ISYA 3EGJA 2H6RA 3W7KA 3KTSA 2VRKA 4FNTA 3LG3A 4OT7A 1XLFA 1JDEA 3L23A 4I5XA 3TN5A 6XIAA 3SW6A 1NEYA 3B4UA 3GKFA 1VENA 2DFAA 1GOXA 3SM0A 1YPIA 3F03K 3N4AA 4O1EA 3SJ3A 2A7NA 3LTPA 4HYWA 1FWEC 4TXEA 4KWSA 3B8IA 4Q4MA 1KO0A 2PWGA 1Q45A 1DWFM 3RMJA 3W86A 1UUMA 4D2JA 1I2RA 5HR7A 5C7VA 4QTGA 2AGTA 3DHFA 1RA0A 4RX0A 3GAYA 3VOIA 5LZLA 5DRCA 1W9UA 4PBEA 2DSVA 1W1A1 3LQGA 2VL4A 2XIMA 3UZJA 4PL2A 2RAGA 3PVFA 1F4AA 1H4PA 1EJVC 2WMIB 3VPLA 4MGGA 1HJXA 4QS5A 3MDUA 1A3HA 3OP2A 3L5AA 5AY7A 2WMFA 4MNKA 4O57A 2VZTA 4LYKA 2X30A 3MUY1 1SFLA 1OBAA 2C0AA 1E1CB 2HXTA 2XH7A 1GYLA 3H24A 3D3FA 2V3EA 5BOOA 1EUAA 3CPRA 1P6WA 3QLLA 1XRTA 4N0RA 2R1LA 2R91A 1YDNA 4H9VA 1H1NA 4C6MA 1NF0A 4J3VA 3L4ZA 4C6DA 1GWJA 3BV4A 3AROA 2DQWA 4H2CA 9XIAA 3H2MA 2P50A 3S2NA 2J9ZA 5LYRA 3HPXA 2MANA 4UFLA 4QNEA 5I2UA 3W38A 1X96A 3BSGA 2OX1A 2VQUA 1E15A 1HP5A 4ONVA 2ABAA 1ZALA 5I03A 4PUMA 4I7WA 1OB0A 4EPBC 3HPSA 4H6QA 3WD3A 3W6YA 4DXKA 3VIOA 1XBYA 2GQ8A 3MZ2A 1RQBA 3NPXA 1Z3NA 4IX0A 4CNNA 5A8MA 3PPFA 3SUSA 2E4TA 4GK8A 4RL3A 4BQ3A 2E25A 5FJRA 3GDBA 4QGCA 1ZRQA 5D2TA 4F66A 2R1KA 1OX5A 4DI9A 4BF5A 3C56A 1PO9A 1XWYA 4MLJA 5D9PA 2G8ZA 2E0PA 1JPDX 3R43A 1CT5A 1LG1A 2PWHA 2Z6IA 3EX3A 4B5WA 3GVGA 4TTGA 2Y1HA 3KRSA 5FL1A 5E0KA 3AIQA 3LZ5A 2DT3A 2HEJA 2OWWA 2X40A 1J11A 1LYXA 5FEZA 2C14A 1FWSA 1GVOA 2DZXA 4JTEA 3WELA 5I02A 2Y70A 1E4NA 2FPTA 5JBDA 4AU0A 5K9XA 4NRSA 3TAKA 4RNFA 4OHQA 3WQOA 3FHAA 1U33A 4C91A 1DQUA 1GT8A 1LBMA 1UWQA 5HINA 3CHDA 4AG0A 3TTSA 3LZ3A 3ZO9A 1JCMP 2XIJA 2VFIA 1R3QA 4XG1A 2HV5A 3DI1A 3G8RA 1XLHA 3LPGA 4Y8EA 4JTUA 3H7RA 4H4IA 4I5RA 3AIUA 4GGBA 1XH1A 4N02A 4K2SA 2GQ9A 2RH9A 3ZIZA 4IQJA 1LWIA 1Z42A 1TPWA 4R9OA 3B06A 4XBKA 4DUVA 3PBGA 2E9MA 1ISWA 1VEPA 1JUBA 1A3WA 1V51A 3CMJA 3GNPA 3W1PA 5HJLA 2A6LA 3N3TA 1E70M 2CZ5A 1G67A 2AAMA 3S1GA 3H12A 4V28A 4Q4OA 3J7HA 1OINA 3Q58A 1PB0A 5JU6A 5L6UA 1LJYA 3TTEA 3W53A 5CPOA 1SFJA 4W5UA 4J27A 3Q65A 2BVWA 2OWCA 4LUIA 3CWHA 1SZGA 3ZT5A 5FEPA 1FWNA 2CLFA 4MZYA 1YNYA 4ZL1A 1L9WA 1EPXA 3O07A 1DJHA 3FYPA 4WD0A 1S2AA 7REQB 3PZ9A 5CPMA 1KW1A 2PURA 1WO2A 1X8FA 3PTKA 3LERA 1YNQA 1PL9A 5F2IA 1AD4A 1K8YA 1ZBWA 1V8EA 3EWWA 4Q4RA 2QXWA 1W1YA 6CGTA 3FDKA 1HO1A 1IXPA 1WAUA 4E2DA 1PYMA 3M0KA 3BSHA 4K7VA 1UBPC 2FB2A 1JD7A 4IJBA 2ZZ5A 4G56A 4XVEA 3IUDA 4PZVA 1ZAJA 1DIDA 1N7KA 5DBTA 3A13A 1UOZA 3ZVHB 2CCRA 4HNCA 3WDIA 2X7VA 1O4UA 4C6KA 3EDKA 5XINA 4GIEA 1WA3A 4S38A 4CQCA 1HQTA 1U1JA 2ZDSA 1LP6A 3I3DA 4WJ8A 3NYDA 1BKSA 4AEOA 3QGVA 4RW5A 3FVDA 1OYAA 3JU2A 3ZFHA 1UOKA 1Y5VA 1V7YA 1KKRA 4LVFA 1EO7A 5J5RA 2VD9A 3PBMA 1J4EA 4ERAA 1BPLB 4HJFA 4GI8A 2J88A 3C52A 1QHZA 1G4EA 3ITVA 3NL2A 4KMQA 4YN5A 1UD6A 2RJGA 1FH8A 1NDWA 5AZ1A 1EIXA 2HVOA 2V2DA 2ZFAA 3YPIA 1T41A 1UP3A 1ZJBA 3AALA 2WCSA 4ZSTA 4NX0A 4EX4A 4D1JA 4XD6A 3TYEA 3UZXA 1XRFA 3VYLA 1EGMA 2W92A 2DEPA 3A9IA 3APYA 3C0QA 3W7RA 3TA6A 4LXFA 3LPPA 3TQVA 4KQNA 3L4WA 4F9JA 1D2KA 2PP3A 1OT1A 4HHHA 4PMVA 3KBWA 5MHBA 3ZZ1A 4TX8A 3G3DA 1XXXA 4AY1A 2XFRA 3F5JA 3AZRA 2YCEA 4UQAA 4GZJA 1EOKA 3WK0A 5AVHA 2NX3A 3A23A 5H1WA 4PULA 4LUTB 4YU1A 1US0A 2ZUTA 5REQA 2VOTA 3RCMA 2B81A 4LCQA 4AZ7A 3IK4A 5I09A 1XKJA 3EPNA 1YE6A 4UTLA 3D6NA 1EBGA 3PPCA 1CBGA 3R10A 5IDIA 2FFCA 3GR4A 3QN3A 4Y9OA 3GWQA 4L7ZA 4Y9PA 1CI1A 3SN0A 4I7UA 3PJWA 1UD3A 3DI0A 1HF6A 3OZOA 1MEWA 1PX8A 2DW6A 4W84A 4O4VA 3TQ0A 4MB5A 3RX2A 4KGLA 4M6PA 3LCGA 3BAIA 2IPFA 3MUCA 2J6XA 4CQAA 5DLCA 1XIGA 4C6BA 2I9EA 2YA2A 1BWKA 3BUVA 4JX6A 2NQHA 4L9ZA 3E96A 2PRLA 1X97A 3MSDA 5KZDA 1Q63A 1JAEA 2Y5EA 1R87A 3LLXA 2YFOA 3ARUA 1SPQA 3NL3A 3VILA 1XFBA 4A3HA 3FGCB 4OOZA 4ZB2A 2A85A 1J18A 1T8QA 2VFDA 1W56A 4F79A 1BRLB 1PXGA 1W5QA 3T78A 3WBXA 4U2ZA 1QOXA 1SVDA 3GO2A 3AXMA 1DHPA 4GZIA 3UY8A 1PAMA 4CUCA 4C6PA 3B04A 1JNEA 4AVOA 4GRSA 4PRRA 4ZQPA 2PWFA 4PMZA 2QUMA 1J5SA 1TUXA 5AYYA 3QW4B 4Q6XA 5IHSA 2XM1A 1UC4A 3GRIA 2OCZA 3H4GA 1J0YA 3LDVA 4HZ8A 5DX7A 5FACA 1LDCA 2DUXA 1J9YA 1OGGA 3DFOA 3MBFA 1H51A 4AXNA 2YFNA 1GG0A 3T42A 3GC2A 3HZ3A 2PTWA 1NDZA 1KRCC 5LHFA 4ZBCA 1SSDA 3W25A 2OEKA 5T8GA 2GWGA 3AHZA 4IHCA 1LBLA 1WX0A 1DPMA 2NWSA 1W9DM 1ZQ5A 4BF9A 2WHKA 9XIMA 4PL1A 2XWDA 2GVLA 2QJNA 5F1UA 4KFOA 1KWKA 1T99A 3GHRA 2DZAA 1ZY9A 3CZ8A 3L67A 1NY1A 1XINA 1ZNNA 1VBRA 1LF1A 1E0TA 2WMIA 4W85A 4HQVA 4BR1A 1ENUA 1B3XA 1A5UA 4J28A 2V5JA 1X39A 1R7OA 3KDNA 2NW0A 3UF9A 1HX0A 1FWRA 4HCHA 2RDTA 3BLEA 3MHFA 1OF6A 2X16A 2XSAA 3CZEA 4C6QA 1GVRA 1ZB5A 4P2VA 4CU7A 4GIRA 3TNBA 4NAEB 2FMNA 4QR6A 1VFUA 1W9VA 2Y8UA 2C15A 2J8FA 2YB4A 4M19A 4IFOA 3IIOA 5I3JA 3M6YA 1X98A 2O9PA 1ZPTA 5BCAA 3MW7A 2TSYA 2VGIA 3NQAA 1LBFA 1GCYA 4ZE4A 1CZ1A 4IMFA 2GVEA 3GVVA 2J25A 3N2CA 1GZJA 3OHMB 4GUGA 1QW8A 2FJUB 4DBEA 1AH3A 3W1MA 4RNIA 1JNDA 2FGLA 3WMSA 4MAVA 1F05A 3STCA 1GOMA 4PBFA 2JEPA 1LG2A 1TUFA 4YTUA 4DLFA 1Z44A 4RXFA 2OG9A 5CZTA 4HHMA 5CSUA 5KSWA 3SQSA 1CGUA 3C2OA 3NR0A 3W84A 3T9PA 3BAJA 3LGGA 3M0JA 1TMHA 1K4HA 4DUWA 1C3FA 1XF0A 1GZ1A 2J9XA 2QCFA 1W3IA 1H2JA 1TVNA 4IT1A 3UWZA 4WUIA 1D7KA 1XLEA 3VE7A 4HZ6A 3LU2A 3U4AA 1OZQA 3CB3A 3NPUA 3IK2A 1K8ZA 3WBEA 1TPUA 2J8GA 2INZA 2WKGA 3H53A 3MSRA 1YQ2A 3ONCA 3IGHX 4Y9NA 3I10A 1TJ1A 1NTHA 2WSQA 3ICJA 4LVBA 4UMCA 3TVAA 3GHUA 1IT0A 1DIKA 1K03A 5HMDA 3OZMA 4E5TA 1NSJA 3UCQA 2DT2A 2R1NA 3W27A 3PNZA 4MY8A 1MRAA 4B3ZA 3BH4A 2VDIA 2D0GA 4MYXA 2J27A 3WDQA 5A6AA 3I4KA 3DDMA 3RLVA 1J96A 3WF1A 4M29A 3P67A 4E4FA 1JZ4A 4R7WA 1NU5A 2DY3A 2NUXA 4J3WA 3SRKA 3HURA 3EWCA 4Q7NA 4D6EA 1S5TA 1PIFA 1JZ8A 1R2SA 1ELSA 4A8RA 1VEOA 3TR9A 3VD9A 5FJTA 4IGMA 3VKAA 1AUSL 3WJXA 2PAJA 2AQWA 4CD5A 5CZJA 5I07A 1YYAA 3W6LA 3CIVA 3WUFA 2Z1BA 1TVLA 2HNHA 1S38A 3ARVA 1U30A 1U83A 4I6KA 4XV0A 3NQBA 3SCNA 1UR1A 4YIWA 5A8NA 2BOGX 2WNWA 3U5YA 1W9PA 2D3LA 4J3TA 4RZBA 5F4WA 1LOSA 1K1DA 1H7XA 3QSRA 3QY6A 1EIBA 1EDTA 2DV0A 3KTXA 3CV2A 1R8LA 3VD7A 1LCOA 3LX9A 4NJIA 4R5EA 5HNTA 3TMLA 4AFYA 1GJPA 1KFCA 3MC5A 4UMAA 2CPUA 2E40A 1GYMA 4PB3A 1EP2A 4BS0A 4DB7A 2R14A 3E6EA 4QCEA 3KX6A 1VRDA 4JTHA 2QIIA 2WSYA 1DVJA 4B9YA 5G1MA 3BW2A 3B8SA 3KDOA 3W6MA 3O6CA 3G3MA 2E8ZA 1KCLA 2HVMA 3UFYA 2Z2BA 2GYIA 4ZR8A 4ICNA 4K7YA 4QHRA 2QCNA 4AIBA 5E09A 3RYSA 2JALA 1AW2A 1ZLPA 5A6BD 5BXRA 2WZHA 3OLEA 4EE9A 3DFSA 1FWWA 1OF8A 3W1UA 1POJA 6PTDA 4J1OA 4HVXA 1KFBA 3TWAA 1IXOA 3BSMA 4KRTA 3VOFA 1CW2A 1EF2A 4HIBA 3WFLA 2NX9A 4L1XA 3WJZA 1AH0A 3F4CA 2V3GA 1ONXA 2IXVA 2YL6A 1EHNA 3M0YA 1VB9A 1FP9A 3PJXA 5JIPA 3WDHA 3W7HA 3W1RA 1ZENA 4GISA 4LEFA 3EWYA 3POCA 4H6EA 4DZIA 4K68A 3VDBA 3VKJA 3UQNA 3CHVA 4GMEA 1ZHAA 1JDAA 4GVHA 4DJFC 4AD3A 1EC7A 4N9BA 5EMKA 3L4UA 3ARPA 2WQPA 4XK2A 3BV7A 1R9YA 3FK4A 2WVUA 4C6LA 1ZBKA 1MMFA 1WKDA 4LUTA 4OBRA 4A22A 1DE6A 3UNDA 3G1SA 2OZ3A 1Y65A 1MQPA 3DFNA 3LNMA 4HMNA 1G9HA 4MY1A 2ZZ6A 1D3CA 1H0IA 2VFEA 4MZ1A 4AF0B 2C19A 3SY8A 3BLDA 4B5TA 2CZFA 3WLLA 4JFVA 1SUXA 4PN2A 3K1GA 4RE2A 2QUTA 3P62A 3R58A 3W2JA 3BW3A 3WH8A 4Q32A 1UB3A 4ZVJA 3TZNA 3QHOA 3W28A 2P0OA 1E51A 3N6JA 5EMJA 2VGFA 1LM1A 3JZEA 3W82A 3UP8A 2V5BA 2INEA 1HJVA 1ONRA 4KBXA 2WLYA 1XX1A 1XYFA 2C6QA 3A24A 4QDPA 5FI8A 2VWSA 3SUVA 1ESWA 4ZOEA 1OCJA 2BDQA 1N8IA 2H8ZA 2QGYA 3F2DA 1ZJIA 4UTWA 1QATA 3KAOA 1BRLA 1M5WA 3ZOAA 4CQDA 3KOYA 2OKOA 3AISA 2RHGA 3HMJG 1UQZA 4XAPA 4L61A 2WJEA 3AIBA 1IIHA 1XGEA 3GIPA 3CTTA 2VOMA 5A2BA 4PEKA 5ABEA 3VX0A 4GY0A 1E6NA 4DUXA 3NQ8A 1SZFA 4GHRA 2PPGA 4MNLA 2PDJA 2Z25A 4X9SA 3FNDA 1U22A 1EYEA 3RO6A 1J0IA 5AFDA 5A2AA 1TQJA 2D3NA 1AL8A 1Q8AA 1S1RA 2QHAA 3JVAA 2WCAA 4M24A 4DZHA 4B4HA 3DEQA 4JL1A 3BCDA 4Z2KA 4DWSB 2E8YA 1BG4A 3UA4A 3LN3A 4L5ZA 4RLIA 2ESCA 1WUEA 1ZFJA 4LAKA 3EB2A 5FJUA 4XWUA 4OIFA 3QF0A 2BV9A 5TD4A 4LYPA 5BMXA 3AZTA 3SCTA 1JZ3A 1V3LA 4IP7A 3W7GA 3AUOA 5CSYA 1IE7C 2C3ZA 3S5YA 3EKZA 3DECA 5FAGA 4MLRA 3VNIA 5LGZA 4O14A 2PI6A 2Q8ZA 5F1VA 2DJXA 2I56A 2ZX6A 3DG6A 1Z41A 5D05A 3N3MA 4NZJA 3QHMA 1I45A 1IV8A 1XIHA 3FSUA 2PDYA 2QF7A 4ICCX 4QQ3A 1I2PA 3SDOA 2D2GA 3CYJA 3LHTA 4GI4A 5AYXA 3T7VA 4ZQNA 1MUCA 1LT7A 4JX5A 3LXAA 4JHZA 2W3ZA 3TJ4A 3HIJA 4PTDA 1FWDC 4NAEA 3FJ4A 1YDOA 2ISSA 3G1VA 4H9MA 4C5YA 1UR0A 1BXBA 3FLUA 3G0SA 2GZXA 4JTGA 2VKZG 5ABHA 2F38A 2XUCA 3K4DA 1TRDA 4YTSA 3GU1A 4AIUA 2YDAA 3LYEA 5KITA 1R30A 3POHA 4US5D 3MP5A 3DU0A 1RK6A 4AC7C 1B5TA 2AKZA 5BU6A 4FA3A 4GXWA 3GIQA 3C0JA 3GXFA 3ARRA 5D33A 1OJXA 4WY0F 1AH4A 4RR4A 3IJ7A 2ZA2A 1PJ9A 1YXCA 4BY3A 3GNDA 2SFPA 4ZB0A 5BWAA 1HKJA 2OYLA 1QR7A 1SJAA 5FJOA 3VGEA 3IIVA 2CLOA 4I3GA 5LSMA 7ODCA 3RHGA 3ITOA 3KBVA 4HHLA 1JZ2A 4JYDA 1EWEA 4DWSC 1KM1A 1KGXA 4TTUA 4H9UA 2WVSA 1BYDA 1WE5A 1HW6A 1TX0A 3CV6A 2YDSA 1P1MA 3VM7A 4YCOA 1P0NA 1GVEA 2PWUA 4AZ5A 4I9JA 3TTOA 1UD4A 3BCFA 3QPEA 1DIEA 1XRVA 3SSJA 1TR1A 1VYRA 4TIMA 4RE3A 3THDA 2QV5A 2P8CA 4GZEA 2Z1WA 1F3XA 3U7BA 3G77A 1YDVA 3CHCA 1XC4A 3AJ7A 5E0FA 1GG1A 1TQXA 2VR4A 3ISIX 3HFYA 4QISA 1ECQA 2GUBA 1F2JA 5A8GA 4CNOA 4DF2A 3UYCA 4IGSA 1CIUA 1RJRA 5CBBA 5LA1A 4Y9MA 5AVNA 4KWVA 1W91A 2O4QA 1QNPA 3W7MA 3JUGA 2PWVA 3HQ1A 3G2GA 4E6MA 1A49A 4OJYA 2GUUA 3EOSA 2H8XA 2YDRA 1VCVA 2JKPA 3H4WA 1I9CB 3OTRA 3EZ4A 1B3WA 1V3HA 1FQ0A 1A3XA 4QDMA 1FWBC 3LNPA 4GH1A 5LKYA 2CC0A 5AOUA 2Z7GA 3P3BA 2OR2A 3CAKA 3MQTA 4RNHA 2OXNA 1KLYA 4TO8A 3RLGA 5F2MA 3CT7A 1XSKA 6ENLA 3SSZA 3VCNA 2OLSA 3S8HA 3F1QA 3H4XA 3AXXA 4ZFMA 2PD5A 2WC4A 4NKCA 1L6YA 4AIEA 2WB5A 4LVDA 3EDEA 4HA4A 4HU0A 1R2TA 4UQDA 2YL5A 4BI6A 1HIZA 4JGDA 5EU9A 3FA4A 5EMMA 4FXFA 4PMDA 1YBQA 2J79A 2GUYA 1S2WA 1H41A 4JKMA 3NXLA 1XQLA 2ZRVA 1VQTA 1WAWA 4OFCA 3CEPA 4GNKB 1RALA 3CQ0A 4NI3A 3R8GA 5IDZA 2C79A 1L0PA 4JTIA 1QOQA 3Q94A 4MUPA 1REQB 5TIMA 1FDZA 2F9RA 1LL4A 1UD8A 2NV9A 3BQ6A 4CQBA 3GR7A 1ME8A 2WJZA 1ZAHA 1C7SA 1EUNA 2XG9A 1UC5A 1KFWA 4S1FA 5AYBA 5IRPA 1M9HA 3S5ZA 5FEXA 4MAZA 2V8ZA 2TMDA 1W9XA 4V1XA 2PDQA 3BPWA 3L0NA 4C7GA 1KR0A 4LF1A 3VIPA 4DF1A 2BTMA 4Y8FA 3DESA 2DSZA 1HN1A 5C0QA 1ICPA 2E5BA 4W7WA 1F4HA 1OIFA 3HBLA 3WEZA 3BLLA 4TR9A 3N11A 1EBHA 4Z1BA 4Q4QA 4AWEA 1IZKA 1XW8A 2UY5A 4O8AA 2Q6ZA 4MM1A 2UY2A 2ZZ1A 3VZZA 5DMMA 1PIIA 1AJ0A 3UPMA 2GVYA 1E3ZA 5I00A 4FR6A 4D8ZA 1QCWA 5F4SA 4Q7IA 4H9YA 4AMAA 3M5YA 3WQ4A 4M82A 2VC6A 4CVWA 1ZCOA 3LUTA 4GVGA 1KD0A 2POTA 1NFPA 1UKTA 3LHVA 2DZBA 3OGVA 4JN8A 5FESA 1LLZA 1X7FA 3LY0A 4J3ZA 2GFTA 3KCJA 2D0HA 2O4MA 3CBWA 2JQXA 3UU0A 2GJXA 2FYMA 4EWJA 3UPBA 4YVXA 4GUIA 1R85A 4JIQA 3QPYA 3W7NA 4O18A 1V3IA 2WPGA 1QUMA 1A5BA 3GXPA 1BLIA 4UTJA 3TJIA 2C16A 1FKWA 4HTYA 4JEQA 4I90A 3CO4A 3VOCA 1NQKA 3OVQA 4DELA 4GI9A 5K3VA 3LMZA 2QCGA 4TOQA 1J0KA 2CIPA 3LV6A 1RP8A 5D37A 2BX7A 1YW1A 1DJNA 1DJYA 1AD1A 4KETA 3NZ1A 3MUIA 4WDWA 2ZX5A 3GU9A 3HPZA 1JCLA 4RJEA 3ITYA 2G4FA 4XO7A 1VFSA 3PJUA 4HSOA 1A5MC 2RDWA 2QAFA 3LLDA 3B0PA 5C71A 4J4KA 1Z48A 1OHLA 4CD7A 1TPFA 3EEZA 5BMWA 2QGHA 2GJPA 1M03A 3D5HA 5D02A 4NILA 3WLIA 2G3MA 5HJYA 3TW6A 1KV5A 2PD9A 3GKAA 5IM51 1CNVA 3WH9A 3WJYA 4E2OA 1K3UA 3UG4A 1Q13A 1GOIA 4XB3A 3AOFA 4AHPA 1QNOA 1UH3A 4LS2A 1QNQA 2YXOA 1O68A 2DU2A 4LANA 4WK9A 3GXTA 3SCOA 1ITUA 1DQXA 4UBPC 4PB4A 1KM3A 3LENA 1PX4A 4DXVA 2X09A 2Y88A 3VA8A 1JJKA 2V5KA 4JZ5A 1SO6A 3KP0A 3VI2A 3L12A 1TELA 4MB3A 3TJLA 4C5ZA 2Q3OA 4DJDC 1GKPA 5CPTA 1TIMA 3NZQA 5U4NA 2IPGA 3LLFA 3RK8A 2DW7A 3FN9A 1H49A 2B31A 4JX4A 4L6DA 5BZAA 3MCMA 1LWJA 4PMYA 3DKJA 5CCZA 1RUSA 1J93A 3NDYA 4DWSA 3MI3A 1VPXA 4L64A 2PRMA 1MI3A 4XTIA 1OC5A 4P7OA 1MFVA 3NO5A 2R24A 1HG3A 1TZ9A 3MP4A 4LBRA 4JQ4A 3DIPA 2FHFA 4GLEA 2CLHA 3PG9A 1Q6EA 4N7QA 2FGZA 3ZSTA 4M6UA 5CC5A 2ZCGA 3M41A 1V0NA 4MWAA 2D23A 2CBVA 1M7OA 3AHYA 1V5XA 4ZE5A 3WNOA 1UG6A 1HL8A 3AU2A 3EA2A 1IWBA 3QHNA 3W2KA 3ANUA 1OCBA 4H6RA 3M47A 4GX8A 3GH7A 1R3VA 3JRKA 4P7NA 3SB0A 2BY3A 1F8MA 5CQ1A 3KOWA 1CDGA 1F76A 3MYPA 2MNRA 4ACZB 2X2YA 3M44A 4G7FA 1VC4A 2VFFA 3BJTA 2TRSA 4A2SA 7TIMA 4LGXA 1EO5A 3V0SA 1KTBA 3VC5A 1V0KA 3L4YA 3E2SA 3WEMA 2FVLA 3UETA 1XGDA 1WXZA 3LHWA 3VUPA 3GXIA 1UP2A 1LOQA 2C8NA 2IQDA 4XO6A 1QDSA 2QF8A 1RCOB 1TTPA 4S3GA 3HQOA 5HOSA 3L0KA 1HJWA 2E6DA 3B40A 4TU1A 2I7GA 2PF8A 2GGJA 1JF5A 3AIWA 4PBGA 3SN4A 1OK6A 3SBFA 1XYZA 3XISA 1XLLA 4B91A 2F6UA 1WDWA 2Y5SA 3QKZA 4O12A 3RJYA 2BMBA 3LCWA 5HXMA 1K70A 2YA1A 3W2UA 2HROA 3GC4A 3VKKA 3O0KA 3RPMA 5HWNA 2DH2A 3STEA 1UUQA 3PSVA 4IFKB 5D9OA 2Q02A 1SGJA 4YTQA 1YEYA 2WNNA 2A3EA 1MW0A 4XD3A 3A3WA 3M7SA 3E5BA 2ZUVA 4UTTA 3CS2A 2XISA 3KWXA 2WHJA 4JPGA 2KAUC 1E6RA 2I1OA 2XJ7A 5C2XA 2UV8G 4KIRA 2DSWA 3B0VC 3ANVA 4AWTA 4WY0B 4DBWA 1KV8A 5GJPA 1G0CA 3O16A 3PP7A 3WQ5A 3E0VA 4L1GA 3HGJA 1JXJA 4KEZA 4GX9A 1V6VA 1SM9A 3KVJA 4ATWA 3WDJA 1TO3A 1TPDA 2CNCA 4LY8A 3IWPA 3LRMA 2J8TA 4TVUA 3OG3A 4HYVA 3F4VA 3PB0A 1XYAA 1Q7MA 1XG4A 2FJKA 4URIA 1NAL1 3KBJA 5I3HA 4OUEA 1YTDA 4NIRA 8XIMA 3PUDA 3IGSA 3Q2DA 3PM6A 2WZTA 1XD0A 2BOFX 1XL9A 3E49A 1PS9A 3PK7A 4QJ3B 3THCA 4IMEA 2XH2A 2B7PA 2VFHA 3O6AA 3G1AA 3N9RA 4C60A 2OWXA 1A5AA 4XKMA 1YLVA 3UXLA 4U31A 3DGBA 3KS5A 1R6WA 4CNTA 4GFSA 3V36A 5GJMA 3OB8A 3T6CA 3QM3A 4BK9A 1OZMA 2Y61A 2ZRYA 2Y7EA 3WEOA 3PY2A 4NU7A 1LUCA 3M43A 3RJXA 4Q8VA 3ITTA 1YMYA 1GHSA 1HJQA 4H8HA 4Z2HA 3BJSA 4MB4A 4OVXA 4ACYA 2HMCA 2PWDA 2PCQA 4HNVA 3P81A 3TUUA 3VMPA 5KTLA 1SO4A 2F61A 4LF2A 1F07A 4FOUA 4FOJA 3LCFA 3T2QA 2BY1A 2IMRA 1A5OC 4FHAA 4WZHA 2IKHA 2W66A 2CW6A 1IT7A 4O15A 2ZDRA 2POZA 1UIOA 4CQ8A 4XBJA 1Q6FA 1R7AA 4LV9A 3K8MA 3D46A 4F48A 1GVQA 4JDYA 4HP5A 4HNUA 3WF3A 1PKMA 2NXIA 4QJ1A 4FALA 1U5VA 1NJJA 3DC8A 3QSTA 4CD4A 2XN0A 4RDYA 5LNRA 3UZYA 4XZNX 1O6IA 1BEUA 4OTKA 1TTIA 1DL3A 3LRLA 4S3DA 4NAFB 3ZLHA 3P60A 4GQQA 4DY1A 4O1BA 3HG4A 4H8VA 4DUOA 4CD6A 5E70A 3E0IA 4Q8MA 4E3VA 4Q8OA 2W62A 3N6QA 1VPQA 4M8UA 4C7DA 2IQ0A 5I3IA 4X60A 1W2PA 2WPBA 4UZUA 4GKTA 1H7NA 1YRRA 1H1YA 4XUGA 5C2CA 2R1MA 3FXGA 1REQA 2Q71A 2QYGA 4B90A 4O1CA 2IKJA 4S23A 1XQKA 4AW7A 2XHYA 2OU4A 3FKRA 3G1DA 4ICMA 1JAKA 4GQBA 3E12A 3GG8A 2VCAA 4MZ8A 3NDOA 3UWWA 4PMXA 1EQCA 1NDVA 4AZIA 1TV5A 3CQHA 2D22A 3F2BA 1GW1A 3MYOA 2CHNA 5A6MA 4JTTA 2GGIA 1LL6A 4P7RA 2QZRA 5JIWA 3S42A 1P0DA 2INFA 3H2EA 2J47A 3C2FA 1TIWA 1FWAC 4DZAA 4UOQA 5E1QA 2PDBA 1ALDA 4AXKA 1DQWA 4AH7A 4DJFD 1BSLA 1J0HA 1RQEA 1HJSA 3N19B 3WNPA 4QG8A 3T2PA 3SQLA 1WDPA 4FPSA 3TA9A 1E56A 2ZTKA 5FA5A 4GIYA 4ZOCA 4H41A 1UCWA 1C9DA 1AVAA 4IWWA 1J2BA 1MNZA 2E6AA 1RBAA 4MMWA 1EC8A 3VGGA 4DNMA 2C0HA 4P7QA 4O4WA 3PZVA 1OD8A 3AO0A 4HMCA 2ZKMX 4JKKA 3V5CA 4O0ZA 2DSUA 5CGTA 3T55A 4AZCB 4F8XA 4LUSB 2A79A 2R94A 8XIAA 3WY1A 3N2OA 4WIWA 3R0DA 1B90A 3M46A 3O15A 1VFLA 1GEHA 3L2MA 1JPKA 3KTCA 4PTNA 1PCKA 3WNNA 1GKQA 3CUZA 2HZGA 1Q85A 2BXZA 4QEHA 1H7PA 4W5ZA 5CGQA 4NXKA 3V18A 3L65A 3B9OA 5A95A 4WR3A 3FAXA 1ODZA 3MKKA 1VIZA 4O1AA 3WD2A 3L68A 1VKFA 2HS8A 2YCIX 3FYYA 1JUKA 2Z00A 3PZTA 4G8TA 3N04A 1QK0A 4JTSA 2WSRA 3BOFA 4IF2A 3W00A 3WBYA 4X0NA 1GTHA 3DAQA 4IMGA 3MCNA 3MS8A 1XHGA 4POCA 3LA4A 4FLRA 4YNGA 4GYPC 3WK3A 4Z1AA 3ZR5A 1UQYA 1TPC1 3GDMA 4RZ4A 4XKYB 3HG2A 2XGBA 4JAWA 5GNXA 3CT2A 3W85A 1NWRA 2XWEA 1HVQA 2GSJA 4UB9A 1F3EA 2CBIA 3USZA 3PR2A 3AICA 2W5FA 3A4WA 3C5QA 3WDPP 4QCFA 2OQHA 2HISA 3ALFA 3W2NA 4DM2A 1KXVA 3C4UA 3FEQA 3QR1A 2VELA 3R94A 3VD3A 3IIPA 3TC3A 3PF3A 4P8WA 1XV8A 3KFTA 1O5RA 3FXYA 2DPEA 1E1EA 1OFOA 2WW5A 4NXSA 2VM8A 4S3FA 2ZA3A 3O7UA 2EPMX 1OK4A 1QMLA 1BVZA 1FCQA 3GFYA 1V77A 1KKOA 4AYSA 4HU8A 3E2VA 4ILSA 4HPHA 2PRHA 2YYUA 2BB0A 2DZVA 1Q65A 3G0XA 4WKHA 3WUGA 2D24A 3H23A 3CMGA 1VCFA 1SW3A 4HMEA 4MPKA 5D09A 1QO5A 1WXYA 3I7SA 1RSCA 3MVTA 4GIAA 4D6DA 4CQ9A 5JVLA 5CLTA 3ALGA 4MOZA 3P0WA 5EBUA 3MT1A 3RM9A 4MY9A 1RY0A 2PBGA 4U33A 1BYCA 4X3ZA 1DXEA 6A3HA 1N8WA 1O5XA 3MZNA 4RCXA 2DVXA 1QJWA 1XH0A 5U7SA 1PVNA 2PZ0A 1HT6A 4DQWA 3RU8X 2WVTA 4UFHA 5I0DA 1LQ2A 5FCZA 1HL2A 3THAA 3C8FA 2QUVA 4Y90A 2QDEA 4J35A 4XX6A 5FF2A 4H9ZA 3VE9A 2I5QA 3HG3A 4JIEA 2QIWA 4IPPA 3UEQA 3EOLA 2FB3A 3DZ1A 4FK9A 3OZYA 4ACZA 2TYSA 4YTRA 3CZLA 3VMNA 4GH3A 4F0SA 5BU9A 5JBFA 3KRBA 3ZS4A 4LCSA 4E4PA 3A4AA 2CLKA 3DFTA 1M7PA 2O9OA 1KWGA 4I7VA 2ZZ2A 2ZUSA 3RR1A 4JQ1A 4W89A 4MFDA 2VXNA 3LBMA 1CX9A 1QW7A 4WVXA 1TJRA 2NV1A 5AECA 4UZSA 2HJPA 4LB4A 4F0MA 4XQ6A 1ADDA 2ZZ3A 3GXDA 1JPIA 2YBVA 3AI0A 2E1WA 4ZQRA 4ZFCA 1CXIA 1QI2A 3TLLA 4RDVA 1UWTA 3CH9A 4BCEA 2R6OA 3F5KA 3UGVA 1SYTA 3I6EA 2QKFA 3BZGA 3V1PA 2CERA 4JY9A 2XYLA 1IWPA 4IGNA 1FX6A 4IFKA 2WMJA 2HTMA 1QBBA 1LQ0A 1O94A 4FF5A 4CGTA 3SADA 4U3AA 3CLWA 3K13A 5CSSA 2G3FA 3LQLA 2VX6A 2J7DA 1I2QA 3CC1A 5T9BG 1UKOA 4AD4A 1PEZA 2GSEA 4US6A 2CFFA 4L9XA 5CJNA 1ZGDA 3M0VA 4FXRA 3BDKA 3TMQA 2G96A 3OODA 4W93A 4W8BA 4PCSA 1E6SM 5TAOA 2OODA 1J0ZA 2GSHA 3MA8A 4A2RA 2AAAA 3ZR4A 2PB1A 4J2PA 4K1WA 4L4PA 4BA0A 3QY7A 1JIBA 3ATZA 4KERA 3PFMA 4TV6A 3CTLA 4PSPA 4A8IA 2V68A 4CD8A 4GJ1A 1PPIA 3PANA 4GOAA 2XIOA 1YKWA 1PE1A 2QCMA 3QZ6A 4A3QA 3PAJA 1PTAA 4HPGA 4OV9A 1MQRA 1H1ZA 3VKDA 2WHMA 1QNSA 3NVDA 1EC9A 4IPNB 2WM1A 2QJGA 3U57A 5A6TC 3CUIA 2RGMA 2XVGA 4D6JA 2VEGA 4PUNA 1J2WA 1UR4A 4Z2LA 4BJHA 2C18A 4AVNA 4B4FA 1MUWA 4OE7A 2BVDA 1HKIA 1MRQA 3W1TA 3URNA 4WSJA 1O12A 3BG5A 1IHIA 2ZIDA 4AIOA 1Q6QA 4LVAA 1KLZA 1KBKA 1IEWA 4Y6GA 5DMNA 4NX5A 3B8VA 2JE8A 3LCIA 3T81A 2YSWA 4ES4A 2TAAA 1DIOA 5I3FA 4M1RA 2QDHA 1US2A 3WLNA 2PDCA 2WNQA 1Z9AA 4X22A 5F4XA 2WXDM 1FWJC 2QS8A 1H7OA 3K30A 3BURA 1EL3A 1KM6A 4G9PA 2YPIA 1IEVA 7CGTA 2XN2A 2QCCA 2G50A 2WANA 4QJ4B 1PZ2A 3LCXA 1T96A 4AMCA 2PFHA 3NM1A 4UQEA 3WLQA 3OBEA 3R0UA 3UG3A 1VR6A 3WLPA 2R8WA 4DZ5A 4NYYA 3ZJ6A 1M41A 4JN7A 2VC7A 1K8CA 5IFPA 3CH0A 5CPSA 2RKXA 4HGXA 1FHVA 1G1YA 2ON3A 3W07A 3WQEA 1JYXA 2YA0A 1O1HA 1RBOB 4Q8UA 4R34A 2ZA1A 3TNOA 3EWBX 4JTCA 2YZRA 3M16A 1NQ6A 2PC8A 4M56A 4UUIA 4HNNA 1XDLA 3V5FA 4LAUA 3BLPX 3R8HA 2CLEA 4Q4PA 4RUBA 3COTA 3WH5A 3AS3A 2VTFA 2VEFA 4DPQA 1Q66A 1AA1B 4LS0A 1OY0A 4MG4A 1DJWA 1QPRA 4I9MA 1XCFA 5EMYA 4GXPA 4HHPA 5DFAA 1AMKA 3TWBA 4OBSA 1W3LA 1EJRC 3KW3A 3EMCA 4LRTA 2VGGA 4RDZA 3K8LA 1MEIA 3T0AA 3WNLA 1W3JA 3GZ3A 1TRIA 3DX5A 3VD5A 3CEUA 5EGRA 3D0CA 2BGSA 1GK8A 4RE0A 5I7GA 4GE8A 1U5HA 4IIDA 4NJHA 3SRHA 2B0MA 4A3RA 4PRWA 4ZCWA 1DHKA 4R7JA 2HE8A 1YXDA 4GKLA 4C6NA 3I7QA 5ENLA 3SR7A 4ADSA 3OJGA 4HMDA 4TX6A 1Q6OA 4JD4A 4G7EB 3VOJA 2E5CA 4QITA 3UG8A 2GVGA 2FLIA 1F6KA 3WSUA 3QOMA 1UZDA 1QASA 4MKSA 4WHBA 4UXDA 4IG2B 4B5NA 4H6KA 1UWAA 4LUSA 3UZWA 5DBUA 3MCOA 4O28A 2PU0A 7PTDA 3VM5A 5K2ZA 3OBKA 3W7OA 1GUVA 2WNZA 1M6JA 4Z1YA 4XZBA 2VJXA 3HGSA 4ZODA 2F8QA 3M0MA 3EOOA 3IARA 4FNRA 4PTXA 3TN6A 3C86A 1OABA 4G5DA