3EXTA

Crystal structure of kgpdc from streptococcus mutans
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
211
Chain Sequence
QLPNLQVALDHSNLKGAITAAVSVGNEVDVIEAGTVCLLQVGSELVEVLRSLFPDKIIVADTKCADAGGTVAKNNAVRGADWMTCICSATIPTMKAARKAIEDINPDKGEIQVELYGDWTYDQAQQWLDAGISQAIYHQSRTWGEKDLNKVKKLIEMGFRVSVTGGLSVDTLKLFEGVDVFTFIAGRGITEAKNPAGAARAFKDEIKRIWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RmpD (Hexulose-6-phosphate synthase)
publication title Open-closed conformational change revealed by the crystal structures of 3-keto-L-gulonate 6-phosphate decarboxylase from Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Lyase
total genus 80
structure length 211
sequence length 218
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3extA00
3MYOA 3WJXA 3TQ0A 4JTFA 2BZNA 1OX4A 5DLCA 3TW6A 4BK9A 3W7PA 4IMFA 2NX3A 1XUUA 1VS1A 1H62A 4MIMA 1GOXA 1QPNA 1I2NA 1X6UA 2NUXA 3DXIA 4MPQA 5DBTA 1M6JA 2QCHA 4L4LA 3HB9A 2RFGA 1GG0A 4GC4A 1A5CA 2XFWA 3M0ZA 4ZL1A 3E96A 1YTKA 2V9DA 2VC6A 4AWSA 1GVQA 1NSJA 4UFKA 3MW7A 3M44A 3TMLA 3NQEA 3UZJA 2WSQA 3QPZA 4JX6A 2VOMA 3PBUA 1LRTA 1VJIA 3PM6A 1KFLA 3QZEA 1K3UA 3KFTA 2WNQA 1OFDA 1FXQA 4PEKA 1JVNA 2DU2A 4UTLA 5CG7A 2VFHA 5FEZA 4AAJA 4FB7A 4Q4KA 1H5YA 3TSDA 2ABBA 2NUWA 2QCEA 4O28A 1TMHA 5HR6A 3NA8A 4R33A 1TPC1 3S1UA 2C18A 1GT8A 2ATMA 2CZDA 3KXQA 4CCCA 3PBYA 3RNDA 3H55A 5BW6A 5F2LA 3W7HA 1GTEA 2CZ5A 5K9CA 3MO7A 3P74A 3G1SA 4UIOA 4HNUA 2ZBTA 5IBXC 2QR6A 3P7YA 1JJKA 5T26A 3W6YA 5HWMA 5G1YA 1N7KA 4JYFA 3O1NA 1HTIA 3NPUA 3W7NA 1CI1A 3TSBA 4ZVJA 4XTDA 2NXHA 3H54A 2C1HA 1HO1A 4Z0SA 3L5AA 3LRKA 2P10A 3LHUA 5C5YA 1MXSA 3G1YA 1FBAA 4AHQA 4NXKA 4LTSA 4Z1DA 1KV8A 5LHEA 3FJLA 3LM7A 4E2DA 5KTLA 4JTIA 2YYUA 3W22A 3GKAA 5TBOA 1QO2A 1UUMA 3CT7A 2PCQA 3BLFA 1HL2A 2VFEA 3K30A 3NM1A 1P4CA 4P61A 3T40A 4O53A 3L2IA 1EUNA 3Q94A 4ZQOA 2BWGA 1QPQA 4CQAA 3NQMA 1OF8A 2X1SA 1S5VA 3S8HA 4NX5A 3G0UA 3QW4B 1A53A 3O16A 3KRUA 1D3GA 2V5LA 4AB4A 4JTLA 2H3DA 5KSWA 3QM3A 1GTHA 2ISVA 3HPXA 4QISA 1QMLA 5A5WA 3FA5A 2VEIA 1OYAA 3OA3A 3W2UA 3LCLA 3L0KA 4O15A 3MWAA 1PCKA 2VFIA 3O6DA 4AH7A 1TJPA 3TCEA 2A0NA 1K8ZA 2HS6A 4LS0A 3UY7A 3LTSA 4YCOA 1TV5A 4U28A 3LX9A 2EAWA 3I7SA 4GRSA 1I2PA 4PH6A 1R46A 3LLFA 3BV4A 1XI3A 3KX6A 4CQ9A 2V2DA 4NXSA 3TR2A 3MJYA 1QPRA 4A3UA 4WXYA 3PSVA 4FX7A 2JKPA 3A24A 3P5YA 3NPXA 3EXTA 1PHQA 2GQAA 2V82A 3MYPA 1TYGA 2X30A 3W71A 4NJKA 1LTDA 4GUHA 4MZ8A 3NR0A 2D73A 4EVZA 1Z48A 3W7RA 4AVFA 3P5ZA 4JDBA 3EX6A 3R8RA 4K38A 5G1TA 3NQVA 5BMWA 3E12A 1RZMA 2AAMA 3IGSA 3IIZA 2Z1BA 5AOUA 1EPXA 1PCWA 3TA6A 2E5CA 1RQBA 4GUFA 4O1BA 4KKXA 4FNPA 3IIVA 1QR7A 5E93A 3EX4A 3NQGA 4LVFA 3W86A 4BI7A 3LXAA 3HG5A 4TMCA 2NWRA 2VFGA 1FCQA 3KVJA 3EX2A 5BMXA 2PE4A 2ALDA 4FX6M 3TDFA 1R30A 5LSMA 3ABQA 1D9EA 3FKKA 3LLDA 4FNUA 2E5BA 3ZS4A 1OK6A 3W7QA 4QNEA 2FTPA 2YDAA 4RR4A 1VCVA 1SR9A 3NL6A 1TV8A 2P0OA 1YYAA 4A29A 2W79A 1DV7A 4TU1A 3PB0A 2E5DA 1K7FA 2CLMA 3W1MA 2AQWA 4AF0B 2C13A 3CM4A 3A5VA 1RD5A 1WXJA 3GVGA 2O7QA 3F03K 2C15A 1M7OA 4FO4A 3EB2A 5HINA 1AW2A 5F1VA 2GJLA 3G1XA 3EX1A 3N34A 4ZQRA 6ALDA 3W3OA 2A21A 3U2OA 4CNNA 2Y7DA 3BG3A 3W2LA 3ABRA 5AC8A 3W7KA 2FFCA 3W1RA 1F05A 3BW2A 3MBFA 3QQ0A 3C56A 3PUOA 4MJZA 2NV2A 1B4KA 3ABSA 3P60A 5L6UA 2RKXA 1R2RA 1O5KA 3ELFA 3EWXA 8TIMA 1W1ZA 4UTUA 1XXXA 2YX0A 1KFKA 3IIOA 4UMBA 2X2GA 2WJZA 3M16A 2Y89A 3PUEA 3TC6A 1LZOA 5D2XA 5C6MA 1HFBA 2YW4A 4ICNA 3B0UX 3G8EA 5SWUA 2B4GA 1FWRA 5FESA 4DF0A 3ZFHA 4LC8A 2QJIA 1W8SA 4LWWA 3DFQA 5GVJA 2X16A 1N55A 3G22A 4HNTA 3MUXA 4UTTC 3W1UA 4A2RA 5DELA 1X8FA 2DZPA 2F84A 3G0XA 2CZFA 3UXAA 3L66A 3WK1A 1JRBA 2J9ZA 1W3IA 1L6SA 2I9EA 1RV8A 3MHGA 3DFNA 1KM6A 1QNVA 1VYPX 4HNNA 1TB3A 3TFCA 3UYCA 1WV2A 2XN2A 2ZYFA 1RVGA 3LB0A 3UD6A 4FX8A 3F4NA 4JIQA 5EY5A 3BLIA 1SZNA 4FIRA 3W9ZA 3LERA 2H6RA 3NQ2A 1EWEA 1MSSA 2OZ0A 3W7DA 1TV7A 4Z0JA 1KFCA 1M5WA 3G8RA 1TSIA 1F6KA 2YR1A 3BGGA 3C8FA 4Q33A 3AO0A 1WYIA 2GUUA 4BWLA 4LT9A 3SFKA 1LOQA 5DN1A 1QO5A 3PWAA 2NV1A 1TCDA 3CIWA 2E1DA 3HF3A 2JBMA 1L6YA 2DZVA 3H53A 5EYWA 2Q3RA 1RPXA 2QJHA 3TXZA 4M5PA 3R12A 3FJ6A 5LNRA 5K9DA 3CU2A 3PUDA 4NJJA 3FS2A 1K7EA 3S1WA 3EKLA 3TJXA 1DVJA 2Y62A 1JCXA 1FQ0A 3R5EA 4E38A 1XM3A 5F4WA 1T8XA 3F4WA 3DKLA 1XC4A 4TMBA 4KWWA 2PURA 1LLZA 4UTHA 1LP6A 5AC6A 4OV9A 3PY2A 2OT1A 1HUVA 3M7WA 3BK0A 4KFPA 1H7WA 1XBXA 3NGJA 4MKNA 2HTMA 2BX7A 4O10A 1LRQA 2NXIA 3STEA 3RMJA 1X1OA 1WX0A 3FOKA 3AJXA 3O6YX 3Q37A 4OGZA 4CCEA 3NEVA 3TC7A 4UTTA 4LUJA 3WK0A 3P84A 3ZWSA 1AK5A 5HMSA 5LKYA 1D3HA 3HG4A 4OWGA 4N2YA 2VKZG 2R94A 2J6XA 3Q58A 4IMEA 3LCIA 2RDWA 1A5AA 1GJPA 2JGYA 4O11A 5LGZA 1OX5A 4PL2A 3QF0A 1O4UA 2WNZA 4M6QA 4WZHA 1P5BA 3WK3A 4JDYA 4JNMA 1DJQA 1ZAHA 2ZTKA 4CNPA 4HPXA 2X1RA 3STGA 4QSHA 4AHOA 3PG8A 1WOBA 1UB3A 4DQWA 1BTMA 1JCNA 4IUOA 2ZRUA 3W87A 2B0MA 4UMAA 1LBMA 4LUIA 3T44A 2HSAA 3UXDA 4K7VA 3TE9A 4CCDA 1LROA 1YDOA 1G4EA 1Q45A 4FNRA 3NPVA 4FXSA 2QUUA 4XTIA 5KZMA 4PTNA 3THAA 4LS1A 3C2FA 2ATSA 1F74A 2CLFA 1DQWA 3DU0A 2VXNA 3QW3A 3GIYA 3P82A 1LCOA 5CPNA 1AW5A 4AHPA 3W7CA 2QCDA 4DO5A 4MY8A 3S1XA 3TROA 1TTIA 1OG0A 4RZ5A 5HULA 1KLYA 3HPZA 5BNKA 3A21A 1XUZA 1TQJA 5FF0A 1DBTA 1KA9F 3CIXA 3TV8A 4NUWA 2ISSA 2CZEA 5E1QA 3TAKA 2I14A 1W5PA 1XFBA 2ZZ5A 5DXYA 1U83A 1TIMA 5LGXA 1I2OA 1YXYA 2OMAA 1UASA 3NXFA 1DL3A 1YADA 4NX0A 5FI8A 3O06A 3TKFA 3CWNA 3HGJA 4XBSA 3W85A 3BLEA 2V81A 3EWYA 5LNVA 1BKSA 5KITA 4DPPA 4GE8A 2PRLA 1P0KA 4JD4A 4N4PA 3ZR4A 5LNUA 3W7MA 3B4UA 5EBUA 3DBPA 3LOTA 4JX5A 3QMTA 3GAYA 4DEFA 2O7SA 4XUGA 3VE9A 3CWOX 1FDZA 2ZFAA 3EWWA 1UCWA 2ZZ1A 3TQVA 3EX3A 1OHLA 3GXNA 1EEPA 4MLJA 3PBWA 3UWUA 1VZWA 1P0NA 2VENA 3BPWA 2DZTA 4N9DA 4JXCA 1TTQA 4NNCA 3KVLA 1RQHA 3M41A 3SI9A 5KINA 1I8JA 1B3OA 4DBDA 4MLRA 1MZHA 4WUIA 2PRHA 4CQ8A 4K39A 2CLKA 1B57A 5CZSA 5FEPA 5HUPA 2ISWA 4EWND 3IEBA 3SGZA 2CLLA 2YFOA 3ATZA 3W74A 1AW1A 4X9SA 1FDJA 3KRSA 3LHWA 4P2VA 1LDCA 3W1TA 5CGQA 3M47A 4AWTA 3B05A 1ZCOA 4YWIA 4W9TA 1QPOA 1CW2A 5CZJA 4WX2A 3VNDA 1FCBA 2FLIA 5DXXA 1I2RA 3C2RA 5FF7A 4JGDA 3LGEA 3GX9A 1SW3A 2YSWA 1EP2A 1FWNA 4GUGA 1WBHA 4K6AA 4ZQMA 1WQ5A 2YCEA 3O05A 2FQIA 4IOTA 3TX9A 3ATYA 5K4ZA 1GEQA 4KFNA 1HO4A 2JK2A 4WY0F 3W83A 5BOOA 3DZ1A 3VE7A 3L68A 2JKAA 3V1PA 2QUTA 1PL9A 1QCWA 1LOSA 1SSGA 3E49A 1XBZA 1PIIA 4K36A 4R7JA 1JUBA 1VC4A 5AHFA 1ZAJA 4NZJA 1EIXA 4LVDA 5K9XA 3W70A 2V0TA 3PS7A 5DBUA 3MBDA 4POCA 4UTMA 5C54A 2VELA 5K3VA 3O07A 1A5BA 3OG3A 1R2SA 2QDGA 1K7XA 4I7VA 1YLVA 1YTDA 2WPBA 2E09A 1YXCA 5EMUA 1EWDA 4FF7A 1SUXA 3GR8A 4BI6A 1SSDA 3CC1A 5U4NA 5I3GA 1G67A 5K2ZA 3IGUA 4GWEA 1XL9A 5FF4A 1FUYA 1YDVA 3KHJA 1Q6RA 3I7QA 5D38A 3FLUA 1SFJA 3CTLA 1OYCA 4MUZA 3P81A 3PC0A 2C6QA 4BF9A 5I3HA 4YLWA 4O4VA 3A5FA 3DAQA 4UNLA 5D03A 4QITA 3IVTA 5ABTA 3FYOA 4Z08A 2RH9A 2Q3OA 2EKCA 3W73A 1GVOA 2ZZ6A 3F1QA 3W1PA 1TPFA 1VLWA 4A21A 4WOQA 1G7VA 1U5JA 3G18A 3C0JA 5G2HA 4UFMA 2H8XA 4IXXA 5TQLA 5AHIA 2A6LA 1FCUA 2Y88A 1JULA 4E2BA 3OVRA 1IXOA 4YXGA 5CSSA 5CPLA 1ICPA 2VFFA 4O18A 1Z44A 3PVFA 3L0NA 1HG3A 1SW7A 5D33A 4GFSA 4O8RA 2ZZ3A 1SFLA 4JTSA 4N9BA 1UUOA 2TPSA 2OT0A 3LI0A 2VEMA 1SO4A 2JKEA 3TFXA 5DCEA 4Q32A 4UR8A 3C2EA 3RK8A 4EF9A 4RLIA 3NQ8A 1ZHAA 3W1LA 5AC7A 4LVGA 5F4SA 1G4TA 3S6DA 3NQCA 3GNNA 3M5VA 4U4MA 1TPUA 3SECA 3SR7A 1KTNA 2DORA 4WJEA 2CU0A 4JTJA 2IQTA 4K7YA 1KTCA 4UUIA 3LXBA 5TIMA 3NVTA 4UTIA 1YPFA 2A1YA 1F7BA 4BWLC 4UNKA 3N2XA 1EB3A 4N4QA 4I7WA 1PVNA 3WK2A 4LY8A 4N6EA 3W1NA 3QRHA 1XKYA 3SJ3A 2Z0IA 1YXDA 3HGOA 5I3IA 4S1FA 3LDVA 2W6RA 5CZTA 1I45A 3UPBA 4Y6GA 3CLMA 5DY2A 5C55A 2A2IA 4ADTA 4DF2A 4JR5A 1VHNA 1V5XA 2YZRA 1O5XA 1VQTA 3THQA 1XCFA 3GAKA 5CKSA 3GKFA 4HPJA 3IRDA 1KTBA 1GVSA 3C6CA 5LZLA 3G0SA 1GVFA 4QQ3A 4BFAA 5EA9A 1JUEA 5I3JA 2E6FA 2ZRVA 5AHNA 3LXCA 3HQ1A 2BSLA 4OHQA 2EGZA 3GLCA 3A23A 3IGXA 3T55A 2A7RA 3G24A 4MY9A 2E6DA 4ZQNA 2ZA1A 3RU6A 1TTPA 1ME8A 3QMSA 2Y7GA 2WNNA 2WO5A 1W0MA 1XBVA 5K7JA 1IGSA 4FNSA 3PR2A 4MY1A 1LBFA 1Z42A 2PC4A 1I2QA 2YFNA 5G4EA 1W54A 2CLOA 5HUOA 1T96A 3M5XA 4JTHA 2V8ZA 1OX6A 3DHFA 4NJGA 1K8YA 1FWWA 3TK7A 1H1YA 4RKAA 1MEHA 4TX9A 3DH7A 1F2JA 3LCHA 3W1XA 3MHUA 1W56A 3W2MA 3P8JA 3C61A 4N9EA 2CW6A 2R14A 3NO5A 2VEKA 2KZHA 4R34A 3W7LA 4HSNA 4YCPA 1J4EA 2LLEA 3DENA 3KAOA 3LCXA 4NU7A 3HGSA 3M5ZA 3I6RA 4M6PA 4FEZA 2J9YA 5HWNA 3T78A 4Y96A 2CLIA 1XDMA 4LS2A 4O1CA 1IXNA 4UMCA 4M19A 3G1HA 5HJLA 1GZGA 4N6FA 3L9CA 3NQDA 1WAUA 5D04C 4DXVA 1VLIA 4Z1CA 4AF0A 3CHVA 3M43A 4E0CA 4LRTA 1NAL1 4O4WA 5IM51 1ZFJA 1GWJA 3EXRA 1C29A 3DFTA 5D37A 3GDRA 3HIJA 3GDTA 3GK0A 2VFDA 1SO3A 4O1DA 3EKZA 4HHPA 1JR1A 4O14A 4XBKA 1JCLA 1KFEA 2WOQA 3OIXA 3U6WA 2G95A 2ZRXA 3E0IA 3W23A 2J24A 4A22A 2QKFA 3B8DA 5EPDA 1Y0EA 2V30A 3V75A 2GQ8A 4MFDA 2H3BA 3G1VA 2EF9A 2NWSA 4AMAA 1S3HA 3HOJA 5F2GA 2ZRWA 5L9FA 4LU0A 4O16A 5KZDA 3LHVA 3I68A 1J2WA 1W5MA 2AGKA 4UXDA 3M5YA 4YL2A 4GXMA 4X3ZA 3JS3A 1ZALA 3LTPA 4LOCA 2J88A 2R8WA 3G3DA 1SPQA 3GB6A 4ONVA 5MHBA 4GJ1A 1YTEA 1TO3A 3NQFA 4RV8A 2ZTJA 5K4XA 1VYRA 4MZYA 1OFOA 2Z6IA 3C52A 5DCBA 1LORA 4NJIA 5E0KA 4XQ6A 1F73A 3TMQA 2RDUA 1JCYA 4XKYB 2FPTA 1VPXA 3NNTA 3LV6A 2CFFA 1IXPA 4GUJA 3P62A 1VH7A 2TRSA 3W7GA 5CZ0A 4M6VA 3DFOA 1B9BA 5AHMA 3S5OA 4Z1BA 3QYQA 1G69A 3UWQA 4HNVA 3QSRA 1C8VA 1PE1A 3S42A 1TPEA 3G3MA 3UWZA 3HG3A 3LCWA 4JTEA 2DP3A 3WJWA 2FB2A 5HWJA 4YMZA 4IPIA 4WY0B 1TPWA 1ZENA 3FEMA 4FNTA 1ZJIA 4UCGA 3UQNA 2NX9A 3BO9A 5LNWA 3GXPA 1GVRA 3HGRA 2GOUA 4G1KA 5CSRA 3TNOA 4O50A 1ZY9A 4OU1A 5H91A 5DY3A 2RHGA 1AL8A 1W31A 2DZUA 1ZNNA 3L67A 3VCRA 1YPIA 1E51A 1ALDA 2GPTA 4TO8A 3IVSA 4Y9AA 3QJAA 1Z41A 1FWTA 2Y7EA 5D2YA 2X1UA 4MFEA 1J5TA 2FB3A 2DJXA 4ADUA 5I3FA 3B0VC 3N3MA 1VHCA 1EP3A 3NQAA 1AL7A 3NYZA 3KOFA 3IIPA 3E9AA 3R89A 4WD0A 3WFAA 1W5NA 3U8GA 4EOUA 1H7PA 3KVMA 1QFEA 2C16A 3TSMA 2G96A 2J27A 2NX1A 1GPWA 3NL5A 3W2JA 1TRDA 3W07A 4MJMA 1DORA 1JQVA 3C2OA 1H60A 1QDSA 5FF3A 4ZMGA 1KM5A 2DJLA 3UY8A 4QNWA 1MO0A 2C0AA 1UJPA 4DBEA 3IIXA 3SSJA 1GYNA 1ADOA 4FHAA 3MI3A 3MP5A 4O12A 3DFPA 1THFD 1KW1A 3G1FA 1OFRA 3P61A 5FF2A 1KBIA 1DQXA 2WV8A 3IVUA 3W2KA 3O63A 4UTWC 5AB3A 3P67A 2A5HA 2E6AA 2QCFA 3SW6A 4NQ1A 4LNYA 4ZQPA 3STCA 4IX2A 3M1ZA 2FIQA 4UFHA 4JIPA 4Y8FA 1OFQA 1PS9A 3NDOA 3TXVA 3O6CA 4UC5A 5AYYA 1KLZA 1OVDA 4MYXA 3S5ZA 3MMTA 1QOPA 3T7VA 4OV4A 5AHEA 3MP3A 2GVJA 3HBLA 4UFLA 1SZFA 1GQNA 4CLMA 4I7UA 3O15A 3GDLA 4HT3A 2HMCA 4M7SA 5H2ZA 4XKYA 4ORMA 5D05A 3L5LA 4JY9A 1SZEA 3LTYA 5DCDA 1GG1A 3LHZA 3W76A 3W1QA 5CPOA 3L21A 3W7JA 4LV9A 1KBJA 4UR7A 2C19A 3LHTA 1FWSA 1JRCA 3B06A 3GNDA 4WY0A 1Q3NA 5D32A 3QEZA 1SW0A 2G97A 3BGJA 1ZAIA 5D2VA 4R53A 5KMYA 4OBTA 5C2XA 3ZWTA 3DFSA 2ABAA 3FFSA 3R13A 3VFLA 4Z1AA 1SO5A 5D30A 3WJZA 1SU5A 2V5BA 5D2TA 3LRMA 4KFOA 4DELA 3W75A 2FPVA 3UPWA 3W1AA 2B7QA 3W72A 4HIBA 1G4PA 3W84A 5AYXA 2VEPA 3S9YA 1F76A 5HR7A 3HG2A 3GXTA 4DF1A 2OJPA 3T4CA 5J5DA 4QIUA 3N9SA 1M7PA 1H63A 4H6KA 1TPB1 2OX1A 4PL1A 3BVJA 4ZQCA 1H51A 3N9RA 1KM1A 4UTWA 3W7EA 1K03A 3PF3A 1EUAA 2ZA3A 1OF6A 2C14A 4FIQA 3INPA 2R91A 3SZ8A 1S5WA 2A7PA 2E68A 4TR9A 3LI1A 3OHIA 1X7FA 3HO8A 3TIMA 2YGYA 3EWBX 1IXQA 5KZEA 1DOSA 3TU9A 1GYLA 4OT7A 3VI2A 3HMJG 4K8EA 1IF2A 2YW3A 2QCCA 1VGAA 1MEWA 3NQ7A 4PODA 5D02A 4X2RA 2RDTA 2YXGA 1G7UA 3NM3A 4BI5A 3I65A 4AEOA 4UTJA 4PC8A 1ME7A 4JYDA 1NFBA 4IMGA 4EF8A 1SQ7A 5J5RA 1H7RA 3C2VA 4K8HA 2ZDRA 3LCGA 3USBA 3KVKA 3OVQA 5U7SA 3DKJA 3MI2A 4O1AA 3G1AA 1X1ZA 3ABOA 3DHDA 3PBVA 4IPJA 2B7NA 3QFEA 4L4MA 4QJ1A 5IBXA 4LRSA 1FDYA 2BLEA 3QQ1A 2UV8G 3QC3A 2QCNA 2E77A 2XN1A 4D2JA 4BR1A 3P80A 1BEUA 4QAIA 4Y90A 3CQ0A 1XDLA 1RQEA 2YYTA 4NNBA 4AXKA 1W3TA 3NL2A 2Z2UA 3EWZA 1KFJA 1OK4A 3P8IA 3TUUA 4LC6A 4ORIA 1WBJA 2NUYA 2CWNA 3GDMA 2PRMA 1A5SA 5LHFA 1LM1A 1V7YA 2A4AA 2H8ZA 4O19A 3EEGA 5HQEA 1KM4A 3W88A 1PHWA 3BARA 2WSYA 1MEIA 4O57A 3E02A 3YPIA 4ZZ9A 4MOZA 3PB2A 4FXRA 1PV8A 4JTKA 3M6YA 4IMCA 3TW7A 4HSOA 3LBMA 4IQLA 2Y6ZA 3FIGA 4MVAA 1H7XA 1R2TA 5LNSA 4HKPA 2FPYA 1ML1A 4DO4A 3C3NA 1TREA 1S5TA 1I4NA 4S2BA 3LCFA 5AFDA 3A22A 1T0OA 4JX4A 3L0GA 1AG1O 2GVLA 2GVGA 4IX0A 2FJKA 3CPRA 4RXFA 1JUKA 1OJXA 3MHFA 1TJRA 1KM2A 1LOLA 2WKJA 2Z6JA 3TQKA 5F2IA 4A2SA 2DZXA 3LBCA 1P1XA 1QOQA 4NNAA 4O17A 1WOAA 3B0PA 3NZ1A 2ZQ0A 1FXPA 5BRBA 1WA3A 2HS8A 2W0UA 3JR2A 1CX9A 4JICA 1LYXA 1UBSA 1VCGA 2CLHA 4WQ6A 2QUVA 1JCJA 4ML9A 1SO6A 4M7TA 4LV4A 3W7IA 4KWVA 4H3DA 4O54A 1K8XA 5AN7A 4O13A 1TPDA 5FEWA 4RJEA 3NOEA 3UWYA 2P1FA 3OBKA 3G1DA 4X22A 3B04A 3FKRA 5HNRA 3GR7A 4PCFA 3LRLA 5G4WA 1W5OA 1Q6LA 3S1VA 3QMRA 3OEXA 2QEZA 7TIMA 3NL3A 1TPVA 4I9AA 2DZSA 4OQVA 2ZCGA 1T99A 4UFJA 1VRDA 1KFBA 1L6WA 1OABA 1B4EA 4JEQA 5G5IA 3SGUA 1FCVA 2TMDA 1L2UA 4RX0A 2Y7FA 2B7OA 4NJHA 1F5ZA 3UZ5A 4NVTA 3PAJA 4IXHA 5FEXA 5D2WA 4JY8A 2C3ZA 3S5YA 2QCLA 1R47A 4JTUA 4NZFA 2NZLA 2NLIA 4ADSA 2QAPA 2BTMA 3W2NA 1XBYA 3PG9A 3CEPA 4QM1A 4RCXA 4IGHA 1Q6QA 1WDWA 2DZWA 3C4UA 1G4SA 4H4IA 3OVPA 2A85A 4NT0A 4MZ1A 4WOZA 5I3KA 1N8FA 2J9XA 2B7PA 2CLEA 5AYZA 2WQPA 1VR6A 1OFEA 3A9IA 2QJGA 3QSTA 5D09A 4JYEA 4AWUA 2I1OA 4LVBA 1BWLA 2QCGA 6TIMA 1O94A 2WSRA 2QAFA 3MP4A 2XN0A 3L65A 5CPMA 3I7RA 4XZ9A 4IJBA 4N02A 3FYPA 1H50A 1JCMP 3UWVA 1NF0A 3DGRA 4FNQA 3M9YA 5G2WA 2ZZ7A 3CEUA 3UNDA 3SIZA 2ZRYA 1O95A 1DKWA 3NQ6A 3VKJA 3Q2DA 3GYEA 3N19B 4B5NA 1LLWA 3RFAA 2QCDB 1ICSA 3R2GA 3BG9A 1W3NA 2X1TA 3BW3A 2H90A 1H7OA 1SZGA 1FX6A 2EHHA 4DO6A 1VCFA 3RLVA 3GDKA 1OX4B 1A50A 2ZA2A 4LW7A 2TYSA 4HN4A 4C1LA 4CNOA 2A6NA 3HPSA 1ME9A 4ALDA 5EL1A 3WJYA 1F6PA 1KM3A 4DPQA 3S0CA 1EA0A 2QCMA 1ONRA 3NZRA 1C9DA 2OCZA 2YPIA 5G2IA 3TAOA 1NEYA 2F7FA 4S2CA 1TQXA 4IWWA 1OFAA 3EWUA 4RZ4A 3SY5A 3B03A 1K02A 4PFMA 3N14A 5F2MA 3CB8A 3O8AA 1KV5A 3RF9A 1H1ZA 3STFA 2Y85A 4LVAA 4RXGA 3LV5A 4GUIA 2ZRZA 4JN6A 3GZ3A 4K37A 2Q8ZA 1W37A 1G6CA 2QDHA 4RK8A 3WJSA 1W5QA 4JS3A 1NVMA 1TRIA 1Q6OA 1H7NA 1OFPA 4JTGA 2G5WA 1EX5A 5AHLA 3DI1A 2JGQA 3TJLA 3NPWA 2GJNA 1LBLA 1JQXA 4EIVA 2E6YA 2GQ9A 2FDSA 3W7OA 5F4XA 3RLUA 3S5NA 2Y63A 1IIHA 4O52A 3QH2A 4RZ6A 1H61A 4TIMA 4GNJA 2QF7A 1RR2A 3HJZA 1LRNA 3N2MA 1VYSX 4OE7A 2V2HA 3BW4A 4MYAA 2NXGA 3LHYA 1EP1A 2EPHA 1IIGA 3PULA 4IMDA 4O0KA 5EKYA 3KRZA 3NG3A 1ICQA 4XWUA 2Y70A 2Q8LA 1DJNA 3EXSA 2TSYA 3UWWA 1NF7A 2A7NA 2Y61A 2ZZ4A 3QPYA 4J9JA 3TH6A 4O0ZA 1FY6A 2BXVA 1YDNA 5F1UA 4N9CA 3NAVA 4WXZA 5A8GA 1OYBA 2V2CA 4JTTA 1L9WA 3MI6A 3PSWA 1KM0A 3N73A 1BWKA 3BG5A 1QWGA 4PA8A 1QAPA 3DI0A 1OFBA 3IV3A 3ANYA 4GBUA 4C1KA 2ZZ2A 1O60A 1DHPA 1TTJA 1AMKA 3D0CA 4UFIA 1TPH1 4UTKA 3JRKA 3L5MA
chains in the Genus database with same CATH superfamily
3TQ0A 2OWXA 5DLCA 3TW6A 3PUGA 4PTDA 3SY8A 4MHBA 3BOFA 3W7PA 2ADAA 3RO6A 2XGZA 2NX3A 3UXIA 1QWKA 1VS1A 1H62A 4MIMA 4F2TA 1QPNA 4J5NA 5ABEA 3VDGA 1XH0A 3HTWA 4XZIA 4XZBA 2QCHA 2C1GA 4GC4A 1A5CA 3E96A 1YTKA 3GVQA 2VD8A 2V9DA 4GZJA 2VC6A 2F2HA 1NSJA 4K8GA 3WLPA 3M44A 3C86A 5BCAA 3TMLA 3OGVA 3URQA 3UZJA 2VZSA 1GZ1A 1E3ZA 2PBGA 4LNCA 3PBUA 1FWGC 2HDJA 4GC3A 4QSFA 1GQLA 4Q7NA 1W9XA 2R24A 4BEQA 5I3DA 1OFDA 2Q6ZA 2PDMA 3AIUA 3MKKA 1TZ9A 2PDLA 2VFHA 1MDRA 5CG7A 5FEZA 3D5HA 5DX7A 2OO6A 5LXEA 1GZJA 5ECVA 2Z4GA 5C9ZA 5BWAA 3W27A 3VIKA 2ZVRA 3OJGA 3PTKA 1KXHA 1TMHA 5HR6A 3OZPA 1UZ1A 1BVNP 3CL8A 3T9PA 1GT8A 4L56A 3A9BA 3AAMA 3PBYA 1J6OA 2GVYA 3RHGA 4UQCA 1UR1A 3TYZA 3W7HA 1GTEA 4JQAA 3MO7A 2YIHA 4A3RA 1M7XA 1MQQA 3P74A 2ZBTA 1UR9A 5EGRA 3P7YA 1RA0A 5G1YA 1N7KA 3FX4A 5AVNA 3GNRA 4XO6A 1CI1A 3KTXA 1G0CA 2C1HA 2OFJA 1HO1A 1T8QA 3LRKA 3B8WA 3S2MA 1KV8A 1VBHA 3SQMA 4E2DA 3SEPA 3EPOA 3W22A 2YYUA 1UMYA 1TX2A 3GKAA 1PBGA 3H2MA 5TBOA 1YNPA 4QJ3B 3CT7A 2VFEA 1P4CA 1VAHA 4O53A 4MMWA 2OX4A 4ZQOA 4C6LA 2POTA 1UZDA 4XZNX 3S8HA 4IG2A 4H9ZA 5CLWA 4ZBCA 4KCWA 1A53A 2J7BA 2PWGA 4AB4A 2V5LA 3QZ6A 4JTLA 5CSUA 2H3DA 1GTHA 3HPXA 3O6AA 3QGAC 3CHFA 1OYAA 3OA3A 3W2UA 3EB3A 1ESWA 4Y9OA 2W66A 1EC9A 3AYRA 4Q4QA 1E4MM 2W5FA 1UP3A 3TCEA 3ZQ9A 3UG3A 4GO8A 1K8ZA 1XRVA 4LS0A 3SCPA 4GXWA 2INFA 4YCOA 1TV5A 4BS0A 4U28A 1OD0A 2EAWA 3CXOA 4GRSA 5MKGB 4R7WA 1H0IA 4CQ9A 3TR2A 3CAKA 1EO7A 2VC9A 3A24A 1PHQA 3MQTA 2GQAA 4M51A 2V82A 1JXJA 4BZYA 4AWEA 3NR0A 3VOFA 2VUNA 2D73A 1F3XA 4GISA 1QUMA 5FCZA 1Z48A 4L4OA 3W7RA 3LA4A 4AZBA 4F0SA 3EX6A 1NTHA 2J25A 3NQVA 5G1TA 5BMWA 1CXKA 4JTAA 3IIZA 4PMZA 5AOUA 1EPXA 2J74A 3TA6A 3N13A 2E5CA 2OSXA 4GUFA 3UESA 1IQ8A 3UF9A 3WEOA 3H70A 4EP8C 3NQGA 3FV9A 3W86A 4BI7A 2Z1VA 4UZUA 4HJWA 3HG5A 2NWRA 1FCQA 1HKKA 3BGAA 3EX2A 5BMXA 4FLQA 4JTDA 1D9EA 3LLDA 3XIMA 2D3NA 3ZS4A 1OK6A 3UG5A 4L7ZA 4H8NA 3UW6A 3NL6A 2V5KA 3WH8A 4TU1A 1TUXA 3SAZA 1HP4A 4MWAE 2BV9A 5A8MA 1VFMA 2C13A 2VCCA 2ZXQA 9RUBA 1WXJA 3GVGA 1XYBA 5G4HC 2O7QA 1M7OA 1AW2A 5F1VA 3EX1A 3N34A 4GCAA 3FCPA 1V51A 3HM7A 2OLAA 4CNNA 3W2LA 4PCTA 5D9NA 3ARXA 4HA0A 4XO7A 1RP9A 3MBFA 3VNYA 3F5JA 1VIWA 1V3IA 1DWAM 3VNIA 3VK5A 1UROA 3FJ4A 2YX0A 3GXMA 3WUEA 5IDZA 2HROA 2QYGA 3TN4A 2P0IA 1XINA 3PUEA 2X09A 4D9PA 2CC0A 3FK4A 2D3LA 2DW7A 3B0UX 2GJXB 5SWUA 2AL1A 4W7UA 3ZLHA 1FWCC 1QNSA 1QHOA 2ZDSA 4M0XA 1S2TA 1V77A 2X16A 2X0HA 3G22A 4HNTA 4RNFA 3QV9A 3L7RA 2E7FA 4A2RA 3VNJA 3KBMA 4JHZA 2DZPA 2CZFA 3B0YA 3WUGA 3RILA 1L6SA 1C8YA 4MB5A 3USZA 1KM6A 3U9IA 4Z2IA 5XIMA 4M1RA 4HNNA 2I17A 1TB3A 2Y24A 4B15A 2FDMA 2HXTA 1WV2A 1JDAA 4AYSA 2QMJA 3P6LA 4NRRA 1F61A 5CH9A 3APGA 4IL0A 4MM1A 1XYAA 3RU8X 2OYMA 3W53A 1Y8BA 4AZ7A 4S3FA 1KFCA 4Z0JA 1M5WA 4PTVA 5HOSA 4ZOAA 3VD9A 1VIZA 4BWLA 4NYUA 3NYDA 4LJ3A 1EFZA 4N42A 1C7TA 1XLBA 1TCDA 3CIWA 2XFRA 4HVXA 1P6WA 1FP8A 2DZVA 2BGQA 2BMBA 3VIMA 3ES7A 3TXZA 4M5PA 3R12A 4F48A 2V5CA 4Q8OA 2P5NA 3WDRA 4PB4A 1XIGA 4I8DA 3UERA 1F07A 4IH3A 3TJXA 3K8MA 4C90A 4KRTA 5HA7A 2GL5A 4TMBA 1WO2A 1LP6A 5AC6A 4FXFA 1PYFA 3G2GA 1J2BA 1HUVA 2VEFA 4R88A 4MKNA 4NI8A 2BX7A 1LRQA 2VURA 2NXIA 3RMJA 1I1WA 1MW0A 2W92A 2BS9A 3O6YX 3Q37A 4IHCA 3NEVA 4LUJA 4IGSA 1E6PA 2OZ8A 1A4LA 5HMSA 1D3HA 1W1VA 1BHGA 3VDAA 5H8UA 2J6XA 4KWOA 2RDWA 1A5AA 1GJPA 3KW3A 1A0CA 1MW1A 1OX5A 4PL2A 3VOIA 3QF0A 4EPKA 2WNZA 1VENA 1HX0A 4ZE5A 4WZHA 4BY3A 2J75A 3WK3A 2ISFA 4AX6A 2R1NA 1DJQA 2ZXAA 4NKCA 2CBIA 3EWCA 1ZAHA 5HPCA 3FSUA 4PTMA 3BAKA 4IFOA 3STGA 1Y7VA 6REQB 4I6KA 1JPKA 4YIWA 1E6SM 1JCNA 1LBMA 4LUIA 4YVXA 2HSAA 5JIPA 2P3ZA 4KWUA 3A3HA 5JU6A 4JIIX 1Q45A 3DYOA 5KZMA 2WCGA 2OPJA 3GXIA 3WEMA 4C6OA 1PKMA 3QW3A 3GIYA 1TWIA 4R3UA 5EU9A 4AZCA 5CPNA 1AW5A 1MVYA 3W7CA 2QCDA 4DBSA 4MY8A 2PDXA 1A0DA 1JNEA 1MRQA 1KLYA 3HPZA 4PMUA 4E3VA 2DUZA 3A21A 3N6QA 5HANA 2GVEA 4NUWA 2CZEA 5E1QA 4CD8A 2I14A 1W5PA 4NF7A 3JW7A 3PTQA 4P7NA 1U83A 2HBVA 1WB0A 1TIMA 4Q22A 1I2OA 2OMAA 3NXFA 1DL3A 4UQAA 4J2MA 3TKFA 2PU1A 1P7TB 1EH9A 3TYBA 1XQKA 5I23A 3QTGA 2OQLA 3AHTA 1V3HA 5EBUA 3LOTA 4L80A 2VVNA 5DANA 3A13A 3WKZA 2PGFA 4S23A 1TE6A 3VE9A 3CWOX 1TA3B 4CEUC 2CLPA 3EX3A 4B92A 1NU5A 3VKAA 1LL4A 4S3EA 1I9CB 3ALGA 5RUBA 2VENA 4WDTA 7TAAA 2DZTA 2A3HA 1I75A 2O92A 4HJFA 4MLRA 3VGFA 7PTDA 4ACZB 5CZSA 4H2HA 4CN1A 3VGGA 3IEBA 4OOZA 2CLLA 2YFOA 1CXIA 3LHWA 1RK5A 3M47A 2C71A 3QC0A 5JBEA 3WMSA 1R87A 1EXPA 3SUUA 3WH5A 3BC9A 5CBJA 5DXXA 2FLIA 3IJQA 1R8LA 2FHBA 4JGDA 1SW3A 2YSWA 1MQPA 1EP2A 4YS1A 4RNJA 4K6AA 3WELA 1RY8A 1XV8A 3O05A 2FQIA 4H2CA 4JNZA 4IOTA 4LANA 1HO4A 2FGBA 4WY0F 1JXKA 3W83A 5T91A 3V1PA 1DJXA 3QYSA 1PL9A 4AC1X 2WVVB 4J35A 3AXIA 1SSGA 2CCRA 4LVDA 5DBUA 1FTXA 1R3WA 1SJDA 1UBPC 4OFCA 1ZRQA 4IL2A 4E6MA 2QDGA 1XCXA 1DTUA 1K7XA 2NT0A 1YLVA 1YTDA 4NP7A 1NM9A 1Z32X 1E1CA 5FJRA 4UQEA 3TONA 1S1PA 5I3GA 1G67A 4L61A 2PEVA 2OGYA 3JZUA 1QW7A 1YDVA 3CUGA 1YNQA 1TV2A 3LSCA 4B3LA 5D03A 3SURA 1YQ2A 1ISYA 3IVTA 2PZ0A 2YCJA 4Z08A 4IP5A 2EKCA 2W63A 2YOCA 2J7FA 4DJFC 3K4AA 1V02E 4GIEA 1U5JA 3HJEA 1M9HA 1FKWA 3SRDA 3WSUA 5G2HA 5TF0A 1DWJM 4JQ1A 1IXOA 4IIGA 5BOEA 1HF6A 4YXGA 5CPLA 1ICPA 1EOMA 3KCOA 4O18A 3QLLA 1HG3A 1SW7A 4PUMA 3VM5A 3WLIA 4GFSA 1TMQA 4N9BA 3G6LA 3PJXA 2OT0A 4KEUA 1OSEA 1SO4A 2VEMA 2Z2AA 3EDJA 4HOWA 3TFXA 1MUMA 1A5OC 3R8HA 3MT1A 1CGTA 3CQHA 1FHUA 3MVTA 5E5CA 2OB3A 5B7ZA 1OC5A 5AC7A 4LVGA 4PMQA 1TPUA 1WDQA 2DORA 3CMFA 2CU0A 3SQSA 3VX1A 1KTCA 2IPWA 4BWLC 3N2XA 2QMKA 2QV5A 3DYPA 4TV5A 2WCAA 4AZ6A 3CQIA 1JI2A 4YTQA 4DJED 3AZSA 1YHTA 3SJ3A 3ZT6A 3E38A 3S46A 4JCMA 3GTNA 1E6QM 2VGIA 2W6RA 4CUCA 3D3FA 4Y6GA 2HNEA 3I3BA 5KETA 4DF2A 1HGWA 3GRIA 3RYSA 3THQA 2PWUA 3G0SA 4RPQA 3VM7A 4OIFA 2Z7KA 4HCDA 5AHNA 2J77A 3RX2A 2BSLA 3A4WA 4OHQA 2EGZA 3GLCA 3IGXA 4DUWA 2OKOA 2OO0A 1Z6KA 1QNQA 3G24A 1UD2A 3HU7A 4MY9A 3QMSA 3SN1A 2VRKA 1HQTA 1RD6A 1W0MA 4C5YA 2GWGA 3DYMA 3PR2A 1LBFA 1Z42A 1W9DM 3R1ZA 3CLWA 1W54A 3QHNA 3LYEA 2P76A 1E6XM 1UR2A 1Q8AA 4AIUA 3DHFA 4NJGA 2Y5EA 1A5LC 1K8YA 3EGJA 1F2JA 1KWKA 3LCHA 4YU1A 4HK7A 5E70A 3MHUA 3RUBL 3S47A 1GCYA 4Q8QA 2D0HA 4Q8VA 3AI0A 3NQBA 1FH7A 4ZTXA 2R14A 3R10A 1I60A 2AMXA 1M04A 3GBDA 1IWPA 5DEZA 2NQJA 3LCXA 1B54A 3HGSA 2J9YA 2HQAA 2V67A 4F79A 2CLIA 2P3EA 4RZBA 1C93A 1TWSA 3VC5A 3CB3A 3EOSA 1GZGA 4LEQA 5CPQA 1GJUA 4GQGA 3L4TA 3KS6A 1WAUA 4PUDA 4DUVA 1E5NA 1Q13A 4DXKA 4LRTA 1YE4A 1CLVA 1TWDA 4CU7A 3EXRA 2XH4A 3AXMA 3DBNA 1C8XA 2G50A 3HPAA 3BXWA 2XZ7A 2WOQA 3KHDA 3OIXA 4A22A 2QKFA 1BD0A 3AIVA 3GG8A 4D6IA 5EPDA 3LN3A 4MWAC 1UWQA 2GQ8A 2VQTA 3G1VA 1E1FA 2NWSA 4QTGA 3HOJA 2YL6A 5F2GA 2ZRWA 5C9WA 4XVEA 3F4DA 4UQ9A 4LU0A 1J11A 3T0DA 2IQDA 1W5MA 4US5D 3UVAA 2RAGA 1U1UA 4LOCA 5GQBA 3BAIA 3WQGA 3G3DA 3GB6A 1F3WA 1A0EA 3GHRA 2DUAA 4TTUA 1TO3A 3R43A 4RV8A 2XINA 3MZ2A 4GQRA 4MZYA 1OFOA 3TYCA 2ACUA 2VRQA 3H7RA 2RDUA 1OC6A 1MDLA 3GBEA 3PANA 3LV6A 3G1RA 4ZSUA 4GUJA 3W7GA 1E4NA 3S5OA 3A4JA 3VC6A 1E9YB 4HNVA 3QSRA 3UWZA 1E0TA 4TVDA 2MUCA 1O66A 2FB2A 3HV8A 5HWJA 3WQFA 1U30A 2EG6A 1ZENA 3R0UA 1CIUA 2BY2A 4M3PA 2GOUA 1DQUA 2V3DA 5LA0A 2X05A 2RHGA 1W31A 4YJ5A 2DZUA 1ZNNA 3L67A 1EGMA 4C65A 3VCRA 1K1DA 3IVSA 1W8GA 5D2YA 1E72M 2X1UA 5LA2A 1XYZA 4MFEA 3BSHA 2MNRA 5C2GA 1VHCA 1FP9A 3NYZA 4ATDA 4BHYA 2PLMA 5E0CA 1MUCA 1X38A 1AD1A 1YBQB 3U8GA 1QI3A 2A3LA 2G96A 4X60A 2NX1A 4KWSA 1XWYA 1E6ZA 1H60A 1KM5A 1VF8A 1IGWA 2DJLA 3TZFA 3UY8A 4QNWA 3VPLA 2JQXA 2WVUA 3L2LA 5LXXA 3LZ5A 3MP5A 3DFPA 2EXOA 3CO4A 1T7LA 1XFCA 3RXZA 3POHA 1N82A 3IVUA 4UTWC 2C91A 4FA3A 4B2DD 4LNYA 4ZQPA 3STCA 4Y8FA 3ZJ8A 3TYDA 2DPEA 4DBWA 1XD0A 4IP7A 3F2DA 4PMYA 4MYXA 5JH2A 3TZNA 4OV4A 2JALA 3M0IA 3AOFA 4H9UA 4ES4A 5FKYA 3N15A 3GNXA 4DIAA 2HMCA 4M7SA 4XKYA 4ORMA 4LGXA 3ENLA 1BF6A 1LWHA 3WQPA 1SZEA 2JEQA 3LTYA 1MI3A 2ZX5A 4O8AA 2BB0A 1SMDA 3W7JA 3LHTA 3AISA 3URBA 1H4PA 1MNSA 5M03A 1Q3NA 4ZFMA 2G97A 4M80A 4R53A 4M81A 3CUHA 1YNYA 3QN3A 4PMOA 3OLEA 4GYPA 5B80A 1V6YA 2XYLA 3LRMA 4PTWA 4K1GA 2B7QA 1OQFA 3WDPP 1G4PA 5A6BA 3WUBA 3LQGA 1R5YA 5C7VA 3T4CA 3GE7A 4HK6A 4QFUA 3BAWA 2V5DA 4C7FA 4XK2A 3BVJA 5I06A 1H51A 1HP5A 1KCZA 2E28A 3PF3A 3INPA 2VX6A 2R91A 5HNTA 1J0JA 5FSEC 3HO8A 3TIMA 4XZWA 3OB8A 3QV8A 2WHKA 4KCVA 4OT7A 3VI2A 1R38A 5BXPA 1JZ8A 2QULA 4DBUA 2QCCA 3NQ7A 2CESA 5BOFA 1G7UA 3NM3A 1QBBA 3AZTA 2G4FA 4QG9A 4PC8A 4JYDA 1HJWA 3GZAA 1F4AA 3TW9A 3KCLA 1H7RA 4K8HA 1B0IA 1W1A1 3LCGA 3GR4A 3OVQA 4XAFA 3IK2A 5U7SA 3ABOA 3PBVA 2B7NA 3QFEA 1OT1A 2Z26A 3E74A 4L4MA 4QJ1A 5T9BG 2UV8G 2BHYA 2E77A 3P80A 1V08A 5T9CE 2ZUNA 1E6NA 4AXKA 3EWZA 1CB2A 4IQDA 3TUUA 2Q8XA 5BROA 3NWRA 4WDWA 1R3VA 1OCNA 3E0FA 1W17A 2A4AA 2H8ZA 3EEGA 3GDBA 1UOKA 1J10A 3Q67A 3Q65A 2RDXA 3BARA 4HQVA 1F3EA 3YPIA 3LSBA 4A3YA 4ZZ9A 1UA3A 3PB2A 3ZVIA 3W6MA 1S2WA 1SGJA 1JYVA 4JTKA 3M6YA 4IMCA 5HAOA 4QJ5B 2ZC8A 1TZZA 4IQLA 3FIGA 4PSPA 5M2FX 3RCMA 1H7XA 4W86A 3OQ8A 1NDYA 2YCLA 1ML1A 4MNLA 5DO8A 1I4NA 4S2BA 3LCFA 5AFDA 1AJZA 3DN5A 1IWBA 2GVLA 3HQOA 4IX0A 4V27A 4LYPA 1KM2A 1LOLA 3TQKA 2TAAA 4GKTA 3LBCA 1NP0A 1QT1A 4NNAA 4O17A 3R8GA 1FXPA 3DG3A 2HS8A 1GKPA 4J28A 2W0UA 4JICA 1UBSA 3VILA 2QUVA 5JXQA 4W8LA 3ARWA 1T40A 1BXNA 1K8XA 4QS5A 4O13A 1UYQA 3E0LA 2P1FA 3OBKA 4DWSB 3AMLA 1RJQA 3FKRA 3GR7A 3LRLA 5FIPA 3CHCA 4KETA 1TPVA 2FH6A 1U1JA 2DZSA 4OQVA 2ZCGA 1WZMA 1CXEA 2FYMA 4UBPC 1VRDA 4RDVA 1L6WA 1B4EA 1BRLA 1IEVA 4B9ZA 3S9ZA 5REQA 1FFQA 1KCLA 2J8TA 3SGUA 3M6DA 2FKPA 4RX0A 3CYJA 3ZJKA 2B7OA 3QHMA 5FOOA 4Q7BA 3UR7A 1J8VA 2YL5A 4NZFA 2WMIA 2NZLA 3I6TA 2D2HA 2BTMA 4IGHA 4ML4A 3PNZA 4MZ1A 4WOZA 4XD5A 1N8FA 2B7PA 1L6FA 5LIYX 2OZTA 4GYFA 3COTA 2WQPA 5AYZA 2BVDA 2NW0A 3VD5A 1DWHM 1EJUC 4Q8UA 2PD5A 4LVBA 3WBXA 3KBSA 3WLKX 4BKNA 3WF3A 2V68A 4B5UA 3GIQA 3KRBA 3T2QA 2ZUWA 2YBUA 2I16A 3M9YA 4F9DA 4HSHA 3OOQA 4W84A 1PZ2A 2P88A 3VKJA 3GYEA 1HJSA 1LLWA 2QCDB 5CXPA 3R2GA 2WZIA 1M41A 4I9JA 4XBJA 2EHHA 4B5WA 1TKKA 2DUXA 1R0MA 2P8BA 3VIOA 4HN4A 4C1LA 4D6DA 2IW0A 4IPPA 2QQ6A 5A2CA 1C9DA 1NY1A 2OCZA 4GQQA 3TC3A 1Q7ZA 3Q45A 4IWWA 2ZUMA 3RM4A 4L1WA 2GK1A 2XWDA 3UCDA 2BBFA 2DSUA 2Y1HA 3N14A 1PX8A 4S3KA 3TN6A 1F9CA 4E4UA 3CB8A 2J7EA 2O9RA 5C9RA 4PCPA 4X2PA 3LV5A 4GUIA 1BSIA 2WNWA 3WLJA 3OA5A 3GZ3A 4AD2A 5EMLA 1W37A 1A47A 5IXEA 3FHAA 3WJSA 1CB7B 4IIDA 4HB7A 1Q6OA 1P0DA 4DJDA 2PLCA 3IANA 1UZHA 1JCTA 1EX5A 1ECQA 3DI1A 3SJNA 1LBLA 5F4XA 1KBLA 2Y63A 4GQBA 5CAHA 3VOHA 4TIMA 4HU4A 3HJZA 3WL1A 1US0A 2WJDA 4D6FA 2ACQA 3BW4A 3CL7A 3LHYA 1L8NA 3K8KA 3OODA 2WPGA 3ARSA 4GIAA 3VZYA 3GC5A 4J3XA 4ICCX 2Y61A 3CZEA 3PN8A 5A6MA 4QX4A 2XIQA 4N9CA 3VIJA 3H7UA 1OYBA 2V2CA 4GYPC 2YJQA 3MI6A 3U7VA 3PSWA 1KM0A 3N73A 3N4AA 3WO8A 3BG5A 3CUJA 3IV8A 5TAOA 2EBNA 3VGHA 3FJNA 1CZ1A 3DI0A 1OFBA 3ANYA 2ZZ2A 4L9ZA 4Q6JA 2VYOA 1UR8A 3NVDA 1QK0A 2XIIA 4UTKA 3JRKA 4P7OA 2INZA 1E6RA 5A8PA 1HVXA 5A1AA 4IMFA 4XD3A 3IUDA 4M6UA 1XUUA 4V28A 1GOXA 3CZGA 4HPHA 2QF8A 4XSMA 2CPUA 1OCQA 4HZ7A 3DXIA 1UKSA 4YTSA 1RXOB 2XFWA 4ZL1A 1EHNA 2PDCA 3UR5A 3WD1A 1QI2A 3LGDA 1G01A 3KBVA 3BOLA 3NQEA 2WSQA 3QPZA 4JX6A 2VOMA 4YHEA 5ECUA 3NDZA 3WMBA 1VJIA 1ZBCA 4Z42C 1K3UA 3KFTA 3OIHA 3C0QA 3S6OA 1FXQA 1E9IA 3KTCA 2DU2A 2VWTA 2V5JA 3O0KA 4M24A 1ZP3A 4AAJA 2GZXA 3E5BA 3SN0A 2WWCA 2NUWA 3RITA 3NA8A 1TPC1 4QDWA 4Y8EA 1ZJAA 3KXQA 4AEFA 2DSZA 1EPVA 1RCQA 1TMLA 2NLYA 4DYEA 4DB7A 1W6TA 4NY2A 3W7NA 4PB5A 4A35A 4XTDA 3H54A 4WSKA 4MAVA 1QK2A 3NSMA 4MG4A 3G1YA 3BICA 4NXKA 1QW9A 1HKVA 4CD5A 4LTSA 4Z1DA 1KQZA 2OQHA 1RALA 9XIAA 1W1B1 5KTLA 1V93A 2Z1XA 4GGHA 3SSZA 2D2GA 3QLDA 1GGOA 3ARRA 3AU2A 1XLFA 1L0PA 1GQKA 3BLFA 3MUAA 4GX9A 4AIEA 1GORA 3C2YA 3L2IA 1EUNA 3Q94A 2GDUA 2ZX7A 3NQMA 1S5VA 3SCNA 4NX5A 3EB4A 3G0UA 4AY7A 2XVLA 2XU2A 3THCA 1C90A 1A3WA 2BY1A 1D3GA 5KSWA 2OEKA 1GOKA 2X42A 2PDQA 1OM0A 2AGTA 1ADSA 4ZFCA 2E40A 2XTKA 2O0TA 4C1NA 3O6DA 3L4UA 4AH7A 1O5RA 1V3LA 1PTDA 2D2JA 3I7SA 4NG3A 4PH6A 1WDPA 3LLFA 2D20A 3BV4A 2V2DA 4HA3A 1U33A 1QPRA 5HBFA 4A3UA 4WXYA 1RAKA 1FWBC 3S83A 3T07A 4ZSTA 3WBYA 3SCWA 4LAZA 3GU2A 2R1MA 1YW1A 3PK7A 2X30A 4RW5A 3W71A 3ISIX 1UKPA 4MZ8A 1U5VA 1PTGA 4EVZA 4IPNB 2A3AA 1OINA 4JDBA 3R8RA 4K38A 3QKEA 1ZBKA 3VKCA 5GNXA 3IGSA 1HW6A 2Z1BA 4GVGA 1RQBA 5I03A 2ZVIA 5CAKA 5E93A 2OZ3A 3EX4A 2E8YA 3L4WA 4C6NA 3B9NA 3GVVA 1L6GA 1DE6A 1P43A 4TMCA 3WG6A 3CBWA 5A2AA 1RPKA 4M56A 5LSMA 3TDFA 3ABQA 4UB9A 1B1YA 4FNUA 3W7QA 3W26A 1REQB 3BWWA 2Y5SA 2WYSA 2KAUC 4KPLA 2P0OA 4EACA 1YYAA 4UWMA 1KRCC 4A29A 2ON3A 1DV7A 3PB0A 1DTNA 1K7FA 4IP4A 3R94A 3IARA 3W1MA 1JPMA 1KCKA 3WFZA 3RX3A 3S2LA 1AJ0A 3CM4A 3AIWA 3QQWA 1J0IA 3G1XA 3OU8A 3EMZA 2UY5A 2V3EA 2Y7DA 3BG3A 3TTQA 3SCQA 1Q2RA 5AC8A 3ABRA 3W7KA 2FFCA 1TWWA 3BW2A 1XH1A 4BCEA 1JF5A 4DY1A 3C56A 3LPFA 4ICMA 2NV2A 2VC7A 5L6UA 3P2VA 3UA3A 4P8VA 1E9LA 3EZ4A 3ECQA 3EWXA 3B0XA 8TIMA 2IQ0A 1W1ZA 4LYKA 3GVWA 5GNYA 5FL1A 3M16A 3TC6A 3MPGA 3U0HA 1HFBA 5A6SA 1UZ4A 4A8NA 4DI8A 5MKGA 3BLKA 1CPUA 3GY1A 1FWRA 5A8OA 4LC8A 2W91A 4B4HA 1U1HA 1W8SA 1HGYA 1HKJA 4QE1A 4J40A 3V0SA 3VO0A 3MUXA 1XLGA 1WXZA 3ME3A 1PB0A 1BYBA 1X8FA 2GLKA 3MKVA 3G0XA 1EJTC 2CNCA 3L66A 4LUTB 1BAGA 2J9ZA 3RLGA 4HNLA 2I9EA 1LT7A 1QNVA 5LYRA 1VYPX 1RUSA 3AS2A 3N2BA 4ERGA 3TFCA 1JGIA 3WLNA 1GKRA 4J3TA 3W82A 3M0XA 2OYLA 4QROA 3UD6A 3BLIA 1SZNA 1T6MA 3V5FA 2D2OA 4FIRA 1UWIA 3GSMA 5DRCA 1EWEA 1MSSA 1EIBA 2OZ0A 2XVPA 4S3CA 3W7DA 1TV7A 4JOMA 2FH8A 3MSDA 2VJXA 3AYVA 4WDXA 2BASA 4PMNA 4HU8A 1VFHA 3BGGA 3MS8A 4LT9A 1VP5A 3VZXA 4GI9A 3D47A 2NV1A 4E4PA 3VVGA 3MZNA 1KCXA 4RL3A 3H53A 1L6YA 5EYWA 1RPXA 4PULA 2WLYA 5DRIA 5LNRA 5K9DA 3CU2A 4GZ7A 5DMMA 2WQDA 3FS2A 3S1WA 1PZ0A 1DVJA 1WCGA 2Y62A 1CYGA 1OIFA 3MCMA 2OGJA 1UR4A 1XRSA 1RK6A 1XC4A 4KWWA 4UTHA 5GNZA 1POJA 3PY2A 3M7WA 3BK0A 4KFPA 1J0KA 1H7WA 4L9XA 2HTMA 4O10A 1JNDA 1XGEA 3STEA 2ZE0A 2VL4A 3VGEA 1WX0A 3AJXA 1D7FA 1WDSA 3LENA 4CCEA 4UOQA 4UTTA 2GJXA 1AK5A 2Z2BA 1EGVA 3IJ6A 4OWGA 1DWGM 4ROQA 4N2YA 1X6NA 2R94A 3CV2A 1Q6EA 4IMEA 4ROPA 2O9TA 4DYKA 2JGYA 2VO5A 1Z69A 3CUIA 1UH2A 1IEQA 1QASA 1DJHA 2J78A 1S2CA 1PIFA 1B3YA 4PUWA 4XAYA 3H12A 3QFWA 4EE9A 1XLJA 1UHVA 1CGYA 4ZODA 5CZKA 4BF7A 3PG8A 5ABGA 3NDYA 1UB3A 3AIQA 4R5EA 4H41A 3WLMA 1QI0A 3MANA 3WLOA 1UC5A 2WAGA 3UXDA 4CCDA 4M82A 1G4EA 1DE5A 4S3BA 5HQMA 2HPIA 4MADA 4FNRA 2QUUA 1EZWA 1CGXA 2PAJA 1HNYA 1D8CA 3PZOA 1F74A 1DQWA 3OLIA 1KD0A 4W93A 1M3UA 3W29A 1X6LA 1LCOA 1P6CA 4DO5A 3R7MA 3TROA 1OG0A 3IJ8A 4GQ0A 4RZ5A 3H2OA 2PZNA 3UGVA 4QQUA 3NZPA 2CEQA 1TQJA 3N2OA 1E0WA 4JZ5A 5EMMA 3BJFA 2ZZ5A 2ZICA 2R82A 5LGXA 3NO1A 1DJIA 1YXYA 2E9BA 3VA8A 1YADA 5FI8A 1V4YA 3IK4A 3UEQA 3W02A 4D6GA 1PAMA 3KP0A 3CWNA 3HGJA 4YTTA 5IHSA 3W85A 2PCEA 3AXHA 2V81A 3BMVA 1ISZA 5LNVA 5HNUA 1OWQA 1OZMA 1Y5VA 4BQ3A 3K1DA 4DPPA 5LNUA 3W7MA 5BU6A 4JKMA 2Z1SA 2D22A 5IRPA 2PGWA 3TNBA 4XUGA 1H49A 3BJTA 2F8QA 3AIEA 1OHLA 3DFHA 3GXNA 5I24A 3K1GA 1VZWA 2I56A 1KR0A 1K6AA 1BQGA 1JAKA 4GY1A 1A5KC 3KVLA 3V16A 1RVKA 1VBJA 4R27A 1B3OA 1GHSA 4DBDA 3GU9A 1MUWA 3LBOA 4K39A 1A5NC 5HUPA 3UZWA 1NOWA 4EWND 3ATZA 1WDDA 3KRSA 4AWTA 3B05A 4WDUA 4W9TA 1QPOA 3IAPA 1JZ6A 3CAQA 1XIJA 4WX2A 4TTGA 4DN1A 3VMOA 3PZVA 3WH7A 4PTXA 3C2RA 1QJWA 4D1IA 7ENLA 6REQA 3ITGA 3LGEA 2OWCA 1IWAA 1ZJBA 4GUGA 1XGDA 4FOJA 1WQ5A 1HN1A 3ATYA 1US3A 5HNNA 2FZ8A 4HN8A 3I3EA 4PEEA 3AYTA 3VE7A 3L68A 3UCCA 4DX3A 1WNOA 4UR9A 4OECA 2YL8A 3LGGA 4ZB5A 1VC4A 3TWAA 1ZAJA 2YCLB 4NZJA 1YRRA 3W70A 3PS7A 3BCFA 1BQCA 3MBDA 2G3JA 2VELA 4GVIA 3OG3A 1PO9A 3KTSA 5J04A 3A64A 4I7VA 4HD5A 4P8XA 5EMUA 3RPMA 3U5YA 1DJYA 4XG1A 2DH3A 3E2QA 1UD8A 4GVFA 5U4NA 5K2ZA 1JYNA 1P7TA 1PYMA 1SJAA 5FF4A 1FUYA 1J9YA 1EOKA 1GUVA 1RLCL 5D38A 1SFJA 1VJSA 3WZ0E 4GFIA 2VC5A 1NWSA 5I3HA 4L6HA 1V0NA 1LL6A 3STPA 2BNJA 4UNLA 5E9XA 1XLDA 3FYOA 1TA3A 3W73A 1QOXA 2HPMA 4NAEA 5JVLA 3CT2A 5XIAA 1VLWA 4S38A 3G18A 1KGUA 3GG1A 3C0JA 3UA4A 4TV6A 2QIWA 5TQLA 1BRLB 4B5XA 2OR2A 4C6EA 3TA9A 4Q7IA 1FCUA 3ZSSA 3OVRA 4ACZA 1JL8A 1J6PA 3PVFA 1A5UA 5HDRA 4HMCA 5D33A 4Z1YA 4QS6A 2ZZ3A 1UUOA 2TPSA 2DY3A 3T2PA 3LI0A 2JKEA 3DGBA 5DCEA 4JN7A 4Q32A 4UR8A 3C2EA 1J12A 3RK8A 2QJMA 3U7BA 4RLIA 3NQ8A 4I8YA 2IMRA 3W1LA 1G4TA 4D6HA 4AIBA 2FTWA 5BZAA 3CV7A 2IQTA 5HXMA 3OQEA 2OODA 4UUIA 4TQTA 3ZLFA 5I7GA 4WGXA 2VM8A 3TVAA 3KE0A 4WKAA 1L2QA 1EB3A 4N4QA 1PVNA 3F5KA 3W1NA 1ITXA 1XKYA 2DEPA 2Z0IA 2G0WA 3HGOA 4JEJA 4GOAA 3R11A 1I45A 4RE3A 1Q4WA 3VOJA 5DY2A 1J5SA 3EPMA 2ZE3A 4JTQA 2W61A 1O5XA 4P7RA 1F3TA 3QY8A 1TUFA 5A6BD 1KTBA 1GVSA 4EAMA 5LZLA 4J4KA 4BFAA 4CKQA 5I3JA 3B8IA 4AZIA 3GC4A 3EOLA 1P0BA 2GDVA 2F2KA 4S3JA 3T55A 4Z2LA 3IWPA 3OLGA 2E6DA 4ZQNA 2ZA1A 2XSXA 3BQ6A 3GUGA 2Y7GA 2WO5A 1XBVA 4XD4A 3VOCA 1B9ZA 3P0XA 5HMFA 4HPNA 2PC4A 1XLAA 1UW9A 3M0HA 1TJ1A 2W67A 3HQNA 2V8ZA 1JDFA 4RKAA 4U33A 4MDOA 3DH7A 3WQ8A 1Q6DA 2CHOA 2C7FA 4DVOA 5CJNA 3VNKA 4C6KA 4EX4A 1SJCA 3VIPA 5M5DA 2VEKA 3MSGA 2ZX8A 4JN8A 4R34A 3W7LA 4YCPA 1VFUA 3N4FA 1J4EA 4JFWA 2PBOA 1GK8A 2QDEA 4W7WA 3WBAA 3RM9A 4B91A 2PDUA 3MY9A 3I6RA 5HWNA 3CIVA 3N17A 4LS2A 4O1CA 4UMCA 1EO5A 3RO8A 4J7RA 4JQ3A 4W8BA 2CWXA 2X2YA 1GEHA 1WP6A 4AF0A 4E0CA 3CNYA 5A94A 4GZEA 5IM51 1WXYA 4HYRA 1GWJA 1C29A 2FVKA 3DFTA 3SCSA 5D37A 3WLRA 2Q09A 3GDTA 3WD3A 3WD4A 2NVAA 3GK0A 3KOWA 1SO3A 1R3RA 2DV0A 1CXFA 3LPGA 3ITLA 3C5QA 3UWEA 4XBKA 1JCLA 1K8CA 1KFEA 3CQJA 4D6EA 1ITUA 2G95A 1RCOB 2Y8UA 3GIPA 3WLSA 4WCJA 2Z1KA 2JEPA 1SJBA 4U3AA 1Y0EA 1CXLA 5EFDA 2V3GA 4FAMA 2H3BA 4BEUA 2EF9A 1FH9A 4AMAA 1S3HA 2KX9A 4JFUA 2V3FA 3LHVA 2AGKA 1ONWA 3APYA 4NZ5A 3DX5A 4X3ZA 4GNKB 1ZALA 1ODZA 3WUFA 4LAMA 2OLSA 1E0VA 2J88A 3LPPA 2F61A 4QE4A 1SPQA 2P53A 3ITOA 5MHBA 1C8QA 1LUCB 1C91A 4KEVA 3RPDA 1KRBC 2XFFA 2ZTJA 1E15A 4MKVA 1XYFA 1IR1A 2G41A 3WENA 4RE2A 4DWDA 3WD0A 4NJIA 4R7OA 4IIHA 1S46A 3TMQA 3CH0A 1VPXA 1CGVA 4ZB0A 1IXPA 2B81A 2TRSA 1EXBA 3ARPA 3DFOA 4LUYA 1O1ZA 4GZIA 3QYQA 1TE1A 5D9OA 3UJ2A 1C8VA 4FI4A 3S42A 1TPEA 3G3MA 1ZLPA 5FJTA 4G5DA 1QHPA 1TPWA 3BLLA 3V5OA 2NX9A 3PZIA 3B8VA 3BO9A 1GVRA 3HGRA 3S1GA 3SUTA 4G1KA 4GMEA 1XIEA 4LEFA 5DY3A 1AL8A 3R58A 1AFSA 1YPIA 3B4YA 3WEZA 1S2VA 3QJAA 1ENUA 3T09A 5KEZA 2Y7EA 4DJEC 5DT5A 1J5TA 2FB3A 4BA0A 3FEQA 1YDYA 1EP3A 3KOFA 4CVWA 4WD0A 3KZSA 5I02A 1H7PA 3KVMA 1QFEA 2C16A 3F5LA 4E8GA 4PRTA 4HHLA 3NL5A 4MNMA 3W07A 4HBKA 2D1ZA 2O55A 4C6QA 1OEPA 4IMAA 1ZUAX 5FF3A 4ZMGA 1YKWA 1L8PA 1UJPA 3MDWA 3OZYA 3ERPA 4FHAA 3MI3A 2F6UA 3VGBA 1OZQA 5HJYA 3G1FA 5FF2A 6ENLA 3KBWA 4JIEA 3W2KA 3QOMA 1R7AA 4Z17A 4C1NB 2A5HA 2QS8A 1A4MA 2QCFA 4JNYA 4J3ZA 4XIMA 3A4XA 4IX2A 1J0HA 3M1ZA 1DP0A 3SRHA 4UFHA 5ENLA 1OFQA 4XV0A 4UC5A 1KLZA 1OVDA 4V15A 3MMTA 1XIIA 3IUHA 4FF5A 2VZVA 2INEA 1SZFA 1GQNA 3OVGA 1SM9A 4CLMA 3ONBA 5BU9A 3O15A 1K9TA 4Q4RA 4ATLA 5H2ZA 5CGTA 5M1TA 1CGWA 4GBDA 4W85A 1M68A 4D6JA 3WCZA 3CZ8A 1GG1A 1SYTA 5LIWX 5CPOA 1C9WA 4LV9A 1KBJA 4U3CA 2WKLA 1K4GA 3B06A 4AXNA 3GNDA 4S3DA 2WHJA 3WQ4A 5CC6A 4DJDD 4OOUA 1ZAIA 4D1JA 3DFSA 1XIFA 3VFLA 2V63A 3H2EA 4AZHA 1T5AA 3VIIA 2OSWA 6XIAA 4XAZA 1SU5A 5D2TA 1AQMA 4A8IA 4DELA 2PU0A 3W75A 2ANUA 3UPWA 1OADA 1VPYA 1FRBA 5AYXA 4LFYA 3JVAA 1LQ2A 8RUCA 4B90A 4DF1A 4GK8A 1NP2A 3AS3A 3SCVA 4WKFA 3T1GA 3UXKA 1YBQA 4QIUA 4ZB2A 4H6KA 3F2CA 3KL3A 4PL1A 1R9XA 1KM1A 1NOFA 2HNHA 3W7EA 1S3TC 2ZA3A 3NXLA 4KGLA 2A7PA 3AHYA 3RPTA 4BQ2A 2E68A 4JFTA 2PB1A 4H7ZA 3SM0A 5DQPA 7ODCA 3GH5A 1EJXC 1R3SA 5KZEA 1DOSA 3M46A 3TU9A 1BGGA 1GYLA 2IKHA 3HMJG 4K8EA 1IF2A 1HZYA 1VGAA 4OJYA 2RDTA 1OC7A 4PUUA 2YXGA 2IXUA 3WLTA 4J3VA 4JFSA 2YBVA 3K4WA 3DDMA 4UTJA 1VFFA 3KOXA 1ME7A 2VDGA 4V1YA 1K6WA 4DUXA 2WW5A 4JPGA 2ZDRA 2IKIA 3MI2A 1X1ZA 1E9ZB 4DZHA 1OBAA 2Q71A 4L64A 1EJ7L 5IBXA 4LRSA 2BLEA 3NO3A 1BKHA 2QCNA 2XN1A 4NYYA 2WM0A 1ZBVA 4D2JA 3V4BA 1RQEA 5PTDA 3NL2A 4H9MA 3ZOAA 1OK4A 1TR1A 1AQ0A 1DEDA 4NZCA 4LC6A 1WBJA 3EAUA 2AL2B 3FXGA 1SZRA 2BHZA 2C1IA 2PRMA 1A5SA 2X0YA 5C70A 1QW8A 2EG7A 4O19A 2ZX9A 3JU2A 4GX8A 1K77A 5HQEA 2HJPA 1HL8A 2VHLA 1X8CA 2WSYA 2GYIA 3E02A 1B3VA 4MOZA 1PV8A 5JBDA 1PKYA 3LBMA 3WYZA 5A6AA 1R2TA 5LNSA 1KXVA 4E8CA 2FPYA 3N12A 1IV8A 4DO4A 1V6UA 1TREA 3N1AA 1W3JA 1T0OA 2EPLX 3L0GA 1FWIC 3PFRA 1XSIA 1U5HA 2ALRA 1UH4A 1JUKA 4A2SA 2Z6JA 2FZNA 5F2IA 1QOQA 3AU6A 3NZ1A 1P48A 3W4RA 3CUXA 3H2FA 5ABFB 2ZQ0A 3M4HA 3N29A 1DHKA 1AVAA 3JR2A 3OW1A 4MGGA 1LYXA 2CLHA 4WQ6A 3CZJA 2IPJA 4M7TA 1IZKA 3W7IA 4BQ4A 4MNKA 4KWVA 1XIBA 3LPOA 4X0NA 5AVHA 3O3RA 1US2A 1Q5MA 4UOZA 3AIRA 1Y5WA 3VD7A 1UG6A 3UWYA 5FJPA 3TP4A 3C0LA 3O0FA 3G1DA 4X22A 2FGLA 3B04A 4ENLA 4AZGA 1Q6LA 3S1VA 4K3ZA 1PZ3A 1JZ3A 3OEXA 2CYGA 7TIMA 1Q6FA 1T99A 3P14A 4EAYA 1KFBA 5G5IA 1MFVA 2TMDA 1UIOA 5CLTA 1W1IE 4NVTA 2BOEX 3PAJA 2J6VA 4YHGA 1XH2A 5D2WA 4JY8A 3SUWA 1R47A 4JTUA 1ZJHA 2QAPA 4QM1A 3CEPA 1GW9A 1WDWA 5FJIA 9XIMA 1G4SA 3OVPA 4DZIA 1LQ0A 2CLEA 1RY0A 2XH0A 1OFEA 3NFUA 3QSTA 4P5UA 4JYEA 5D09A 3WDIA 1ISXA 1RHCA 3DG7A 1UA7A 6TIMA 4LB4A 1O94A 1AH0A 1Q6CA 3MP4A 1GQJA 1XRTA 3L65A 4Q4OA 4XZ9A 3KS5A 3IJ7A 4N02A 3FYPA 1XISA 1Z3NA 2OEMA 1H50A 1M7JA 7CGTA 1JCMP 1R7OA 4D8ZA 1NF0A 3RJXA 5G2WA 2BDQA 2ZZ7A 4C6CA 4RDZA 2ZRYA 4IQJA 1S38A 2NQZA 4B5NA 1P1MA 3RFAA 1V79A 1RJPA 1XIHA 4C60A 1ZBWA 2X1TA 3BW3A 2H90A 3SRFA 2A3CA 3UETA 1E73M 1VEMA 1OX4B 2ZA2A 2TYSA 1A80A 4W7VA 3VNMA 3GC2A 1XLLA 4CNOA 2A6NA 4A3HA 2DT2A 1XC6A 1UD6A 4ALDA 1E4LA 4KESA 5MF5A 1E71M 3S0CA 1C92A 3WQCA 1ONRA 4IIFA 3C8NA 1NEYA 4G6CA 3SY5A 1K02A 3BSMA 4PFMA 2PWVA 3AUOA 4LBUA 1TVNA 3N9KA 4D6CA 3RF9A 2XUCA 4D71A 5CGMA 1H1ZA 4LVAA 4DWSA 3R79A 1WPCA 1PX4A 1QXLA 2VDHA 4QDPA 4RK8A 2E3ZA 1W5QA 1JYWA 4LB3A 1TRIA 3H21A 2CITA 3EOOA 2BY0A 1ZU8A 2HE8A 1DXEA 2X0SA 2JGQA 3NPWA 3LU2A 3PPHA 2GJNA 3A12A 4EIVA 2GQ9A 2FDSA 1R86A 2XIJA 1NFGA 3RLUA 3S5NA 3WMLA 3U5UA 2OYKA 1WUFA 3QH2A 5EMYA 3VOGA 1H61A 4RE4A 1HXJA 2QF7A 1EJRC 2V2HA 3N6JA 3WNLA 3TYAA 3SFWA 1IIGA 3PULA 3E2RA 4QDMA 3BAYA 2TSYA 2A7NA 4C6MA 1QATA 2ZZ4A 5A6TC 4AG0A 4J9JA 4DRSA 1IEXA 4KIRA 2BXVA 3GHUA 3ES8A 1YDNA 5F1UA 4WXZA 5A8GA 2WJFA 1ONEA 4TX6A 3U57A 4KERA 2E25A 1BWKA 2WC3A 1GOWA 1P0EA 4PA8A 3AJ7A 3VIGA 3WL0A 3NTYA 4C1KA 4GBUA 1O60A 5D8ZA 3D0CA 3WF4A 1TPH1 3S6TA 4B3ZA 3L5MA 3MYOA 2XG9A 4DI9A 4JTFA 3HQPA 2AKMA 1H3GA 1E70M 3ZT7A 3QOKA 1QNRA 4L4LA 1GG0A 1XLIA 3T0AA 5FAJA 4AWSA 1X98A 1GVQA 1H41A 2PWFA 3MW7A 4FZIA 3B8UA 3LD5A 1VBRA 3SO7A 1ZP4A 2V38A 1MW2A 3PM6A 4IJCA 4KRUA 3QZEA 3CTTA 1GOQA 3AMKA 5FAGA 1XX1A 4UTLA 2GSEA 4F3HA 1FH8A 4NAEB 1UWAA 2D24A 1E1EA 3H7VA 3PZTA 1H5YA 4Q4KA 3TSDA 3VMPA 2ATMA 2CZDA 4HYVA 3H55A 5FL0A 3OPSA 5K9CA 4QP0A 5I6SA 2HXUA 5A8NA 2DQWA 4UIOA 3G1SA 5IBXC 2QR6A 1JJKA 5T26A 3W6YA 5HWMA 4JYFA 2VCBA 2I5IA 1BWVA 4UOJA 1W3KA 4ZVJA 1KB3A 2NXHA 2GDQA 1UWRA 4HZ8A 4QHRA 4L1GA 1W3LA 4Z0SA 3QKZA 3LHUA 2Z27A 1H11A 1TJ0A 1ZCCA 1FBAA 3N3TA 1PDZA 3DHPA 4QBXA 3VIFA 1V0LA 2PD9A 4FALA 2F38A 1H1NA 5CSYA 3V5CA 3DESA 2DDXA 1QO2A 1V0KA 2PCQA 1HL2A 3K30A 3H4GA 2D0FA 3OZOA 3NM1A 1QPQA 1JDEA 1OF8A 2DGAA 2BGNE 3GWQA 4DUOA 2E0PA 3QW4B 3NEHA 3O16A 1M65A 2OELA 1GVYA 3QM3A 5A5WA 1QMLA 4IZGA 1U22A 3SY1A 2PDPA 3W81A 3L0KA 4O15A 2XH2A 3GVRA 2PDWA 2E67A 2VX7A 1TJPA 3QGKC 1NDZA 2HS6A 2DW6A 3UY7A 1Y5XA 3LX9A 2QDDA 4WKHA 5AZ0A 1I2PA 1R46A 3GU1A 3II1A 1RSCA 3KX6A 4NXSA 5DMLA 1V03A 1NOUA 1FHVA 4U2YA 3THDA 3PSVA 3AYSA 1UD3A 3NPXA 3EXTA 1X39A 1TYGA 3KEHA 1MYRA 2ICSA 2GGEA 4WVXA 1M03A 1N8IA 2PTXA 3ITVA 4GUHA 5HPOA 3QR0A 3PWGA 3S2CA 2IKJA 4AVNA 3FGCB 3P5ZA 4AVFA 2PP3A 4HPGA 3R6IA 2AAMA 2WSPA 4Q4SA 4PBFA 3AFBA 3DEQA 4I3GA 2VQUA 4KKXA 5I0DA 2PDNA 3LXAA 3G6MA 5E0FA 4F4RA 3CO8A 2PE4A 2ALDA 4FX6M 1R30A 2G37A 3FKKA 5G1MA 2BGSA 5GJMA 2FTPA 4W89A 1VCVA 3EEZA 1SR9A 1RLDA 1I6NA 4E8DA 3RCNA 1QPKA 4GKLA 4AF0B 1Q65A 1GNXA 4PMRA 3CGTA 3A5VA 1IYXA 1RD5A 2Z29A 4E4FA 3UFYA 3GO2A 2C15A 3F03K 5HINA 3EB2A 4MNJA 1CXHA 4ZQRA 6ALDA 3KOYA 3I10A 2A21A 1R85A 3SIMA 3PTMA 3BAJA 1KGXA 4Q8WA 3V0UA 4G7EB 3ITXA 1F05A 3GG0A 1JFHA 1EF3A 4OKDA 3QQ0A 3PUOA 4H6RA 4MJ2A 2G8ZA 1B4KA 1IEWA 5C7HA 4OTKA 4B9YA 4XIAA 1O5KA 1R9YA 1FWFC 1DJZA 1IEIA 1XXXA 2X8RA 1KFKA 3IIOA 2IXVA 4UMBA 2X2GA 4MTVA 2Y89A 4EPDC 1LZOA 1PSCA 5C6MA 3G77A 2YW4A 4WK9A 2B4GA 5FESA 2CBVA 4L4PA 3ABXA 2PFHA 5IFTA 2YXXA 2QJIA 4LWWA 3DFQA 5GVJA 1XF0A 1N55A 1TFVA 4CCZA 3TN3A 3W1UA 3VDBA 5DELA 3AALA 4B16A 2F84A 3WK1A 2BVTA 3H8AA 1JRBA 1W3IA 3P3BA 6PTDA 1RV8A 3MHGA 4I5XA 1LT8A 1PIGA 2QHAA 1EEXA 2XN2A 2PS2A 4UCFA 2CERA 5TD4A 1FWAC 1TVPA 2XSAA 1RVGA 3CUZA 3I3DA 4FX8A 4U31A 3F4NA 4C6JA 5EY5A 4H00A 3QR3A 3ZM8A 3EOEA 1WKFA 1TV3A 3G8RA 4MDPA 1GVEA 1F6KA 3C8FA 1AODA 1WYIA 2GUUA 3DECA 1REQA 1LF1A 1VEOA 5DN1A 3PWAA 1SR0A 3HF3A 1UPPA 2JBMA 4W88A 2Q3RA 3B97A 3CZKA 3TR9A 4AISA 1GYMA 2OLHA 3PUDA 4NJJA 1AH4A 2E9MA 3NSXA 2ZWYA 2HVNA 1JCXA 4XUYA 1F6YA 3NGFA 1XM3A 1PKNA 5F4WA 3WBWA 3F4WA 3DKLA 4J3UA 3W6LA 1LLZA 4OV9A 1W9PA 2OT1A 2UY2A 1ZQ5A 3NGJA 4J3WA 1JF6A 1UJQA 2XIMA 4U2ZA 3N6HA 2A79A 3ZZ1A 4FK9A 4OGZA 4MSSA 3TC7A 1EZ2A 3WK0A 3P84A 3LMYA 3GW0A 5LKYA 2G3MA 4CD7A 2VKZG 4G56A 5IOBA 3Q58A 2E8ZA 2P50A 3S2JA 5LGZA 3BANA 1Q7QA 4ZO6A 4QG8A 1KGWA 4Q8PA 4JIHA 1V8EA 2JIEA 4LUTA 4AY8A 5FJOA 1ECEA 2W27A 1EKOA 2ZTKA 1XLEA 2PGEA 4HPXA 2X1RA 1TVLA 3U3HA 2BY3A 1KRMA 2ZUVA 4N0RA 3WQOA 4UZSA 5F7UA 5I79A 3PZNA 2GWNA 1BTMA 4IUOA 2ZRUA 3W87A 4GD0A 3T44A 2PWDA 4K7VA 1HT6A 1LROA 1YDOA 3MCNA 1JGMA 4XTIA 1ITCA 4PTNA 3THAA 2CLFA 2VXNA 3ANVA 3P82A 1ODUA 2J66A 3CASA 1NWTA 1JPIA 3SCRA 4AHPA 1JFXA 4LY4A 3OZMA 1TTIA 1B31A 4AQLA 3N18A 5HULA 4QRNA 4GIRA 4DNMA 4YVVA 1XUZA 3CIXA 2ISSA 5A95A 3TAKA 1UD4A 4S3AA 1XFBA 3BH4A 4IFKB 1JIBA 5FJUA 3B3DA 1SFSA 1K9FA 4NX0A 3O06A 3AUJA 1ADDA 4K68A 5H8PA 3BLEA 3EWYA 1BKSA 3QXBA 1RP8A 2HEJA 4LBSA 4LSBA 2PP1A 5A6KA 2DVXA 4GE8A 1P0KA 4JX5A 3V18A 3QMTA 3GAYA 4DEFA 4PRWA 2QV4A 3OYZA 4DZ5A 1FDZA 3EWWA 2EO7A 1UCWA 1O12A 3TQVA 2IKGA 1EEPA 1TCMA 3E3HA 2HBXA 4OUIA 3JZEA 2VOTA 1P0NA 4LUSB 4N9DA 4U10A 3NUKA 1TTQA 1ZSXA 2I5GA 2NQLA 4NNCA 4C91A 5KINA 3SI9A 1I8JA 1MZHA 3ITCA 2WMFA 4A8RA 4CQ8A 2B31A 2CLKA 3SB0A 2R1LA 3A3WA 4EKJA 5FEPA 2ISWA 1W9BM 3EPNA 3IPWA 3SGZA 4Q3MA 2P8CA 3W74A 1AW1A 1CGUA 1FDJA 3FN9A 3PHAA 4YN5A 4P2VA 1LDCA 3DFYA 1ZCOA 3S4TA 2BXYA 2WANA 5EMJA 4P7QA 5I2UA 1IHIA 1E43A 3CPUA 1ONXA 5FF7A 4GH3A 3WIJA 1F4HA 4HHHA 3F7JA 3GX9A 4W4QA 1S5MA 1PZ1A 1AH3A 4HA1A 5EB8A 1WBHA 2WVSA 4ZQMA 3J7HA 1CNVA 2ZC1A 5CPSA 1UC4A 1GEQA 3AHZA 5AC5A 2JK2A 4XAGA 2VTFA 2JKAA 4MPKA 1QCWA 1LOSA 1VBUA 3E49A 1XBZA 1PIIA 1JUBA 4EPEC 5K9XA 2V0TA 2HVMA 1YX1A 1OD8A 1TG7A 4HCLA 1J0YA 4UTMA 4A05A 5C54A 5K3VA 3K2GA 1W2PA 3O07A 1A5BA 3CL6A 4YNGA 3CV6A 4EXBA 3Q4DA 3UJEA 2G4JA 5I78A 4WGHA 2DT1A 4C7DA 1O7AA 4CEXC 4F66A 2BFGA 2O4MA 2E09A 1YXCA 2F9RA 1JDCA 1EWDA 1SSDA 3PAOA 5JBFA 3OBAA 2Z28A 3QBUA 4GWEA 3SGGA 1XG3A 1Q66A 3ABZA 3KHJA 1Q6RA 2JF6A 3WY1A 4INFA 4JL2A 3N11A 2O4QA 4FMVA 3FLUA 7REQB 3UZXA 3CTLA 1OYCA 3PC0A 1N8WA 5CJMA 4EK7A 3CHDA 2CZVA 4O4VA 3A5FA 3DAQA 4PMXA 3VAVA 4JFVA 4AD1A 2PP0A 3AZRA 1PJ9A 4CN4A 3OLDA 2RH9A 1AD4A 1GVOA 2ZZ6A 2QGYA 3W1PA 1TPFA 2V69A 4A21A 4WOQA 2YDQA 1RJRA 4UFMA 2H8XA 3EMQA 4FOKA 2A6LA 3WLLA 2Y88A 5CSSA 4JHOA 3AMCA 1NFPA 2VFFA 1XYCA 1Z44A 5T8GA 3BLOA 3L0NA 5C0QA 4W8AA 4L6DA 1HJQA 4O8RA 2CHRA 4AZ5A 4JTSA 3UZYA 4Y9PA 3URNA 4WHBA 4G7FA 3FXYA 1UUQA 1ZHAA 3T0BA 4U4MA 3GNNA 3NURA 3SR7<