3EXTA

Crystal structure of kgpdc from streptococcus mutans
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
211
Chain Sequence
QLPNLQVALDHSNLKGAITAAVSVGNEVDVIEAGTVCLLQVGSELVEVLRSLFPDKIIVADTKCADAGGTVAKNNAVRGADWMTCICSATIPTMKAARKAIEDINPDKGEIQVELYGDWTYDQAQQWLDAGISQAIYHQSRTWGEKDLNKVKKLIEMGFRVSVTGGLSVDTLKLFEGVDVFTFIAGRGITEAKNPAGAARAFKDEIKRIWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Open-closed conformational change revealed by the crystal structures of 3-keto-L-gulonate 6-phosphate decarboxylase from Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Lyase
molecule keywords RmpD (Hexulose-6-phosphate synthase)
total genus 80
structure length 211
sequence length 218
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3extA00
2HS8A 4EF9A 3IIZA 2G97A 3P80A 2NUYA 3GKFA 4RCXA 3M5VA 3MHGA 4GUHA 1VZWA 2DZUA 3TV8A 1OG0A 4IX2A 1CW2A 1OYBA 3I6RA 3V75A 4O4VA 5AFDA 1GYNA 4ADSA 3PULA 4IXXA 2H3BA 3IVTA 3TC7A 5EMUA 3ZWTA 4XBSA 2ZZ6A 2JKAA 1TRIA 3GXNA 2V2HA 4Q4KA 4ZQOA 5BOOA 1KBIA 1YXYA 1MEHA 1XBZA 2YGYA 1EUAA 4N9BA 3SY5A 1TSIA 3QPYA 2ZQ0A 3GDLA 3I68A 1QPRA 3G1DA 3FJLA 3PSVA 1G69A 4UTTA 1W54A 3NL2A 2Y85A 1H1ZA 4UFHA 1XBXA 5BW6A 3KVLA 5I3JA 5GVJA 1LYXA 1P1XA 3W7DA 4CCCA 3NM3A 3ABOA 2E6AA 5T26A 1FWSA 3M5ZA 1HFBA 3G0UA 1W5PA 4LUIA 5CPMA 2X2GA 3LCHA 3NQEA 4LS0A 2V9DA 3LHVA 1H7XA 2FB2A 1UUMA 4BFAA 1ZHAA 1H63A 3NPUA 3RMJA 3FA5A 5ABTA 1O95A 2EHHA 1JUBA 5BRBA 2QJHA 1W8SA 3W76A 1K7XA 4DXVA 4LUJA 5AOUA 4CCEA 3BV4A 3MJYA 5G1TA 3EEGA 4JIPA 1SW3A 4BI5A 1LDCA 3FFSA 4FO4A 1OJXA 2OJPA 1KA9F 1SZEA 3W2UA 1WYIA 3E12A 3GAKA 4HSOA 4TR9A 3BLIA 4WOZA 2WNNA 5KINA 3GVGA 4JTLA 4H4IA 3L66A 4I7VA 3LTYA 3BG9A 4O54A 4NNAA 4B5NA 1Q6LA 3IVSA 1RPXA 1VYSX 1KLZA 5EBUA 1XFBA 1VS1A 4MZYA 1RQBA 3IV3A 3TW6A 3KAOA 4QM1A 2E6DA 4BI6A 5I3KA 4JYFA 4WD0A 4DO4A 2A7PA 1W5NA 4OV4A 5DCEA 5AHNA 3RFAA 5J5DA 1W1ZA 4O19A 2Q3OA 4FXSA 2GQAA 3TA6A 3LM7A 3OIXA 3UZ5A 1N8FA 1H7RA 1IIGA 3MWAA 3PR2A 1RQHA 5AYXA 5E1QA 1VYPX 1D9EA 4OHQA 1JCJA 3TQVA 4QSHA 2QCEA 1DORA 3G24A 4KFPA 3H53A 3GDTA 5K3VA 3QQ1A 3GXTA 4JDYA 1AL7A 4Y8FA 5L9FA 1XI3A 1XDLA 3A21A 3HGOA 1LLZA 4QNEA 3W1TA 3DGRA 3ZR4A 5C5YA 1MZHA 3IIXA 1UBSA 5H91A 4N6EA 1KTBA 4WJEA 2C18A 3STFA 2CZ5A 3NEVA 4IMFA 3EX1A 3LV5A 1Q6QA 3LXCA 2FB3A 2NUWA 4KWWA 2FPYA 3NPWA 3QFEA 4ORIA 2Z1BA 3GLCA 4JTHA 1KFLA 1C9DA 2NX1A 3IGXA 5D2XA 5DLCA 4K8HA 4O14A 2W0UA 2ZTJA 2E5CA 4RJEA 3PUDA 5DCDA 1PCWA 1FWTA 4GXMA 3QM3A 3N9RA 3ANYA 1H62A 3SGZA 4LY8A 4JTSA 1QNVA 2GJNA 2OMAA 3IGSA 3EX6A 3G3MA 5AC8A 1H51A 1TJRA 2FIQA 2OZ0A 2DORA 1OFQA 2J88A 2VEMA 3UPWA 3HOJA 3L2IA 1M5WA 2Y7FA 1DKWA 2VENA 3TJXA 2VFIA 4RX0A 1GVQA 2OT0A 3O6CA 1S5VA 3LLDA 3M43A 1BWLA 5D09A 2ZA2A 2V2DA 1ME9A 1VRDA 1JUKA 1F74A 3DU0A 3I7QA 1OFOA 4MLJA 1PV8A 3OVPA 4RK8A 1LCOA 1UJPA 2GQ9A 4POCA 4RLIA 1YDVA 1EPXA 2JGQA 1DBTA 4NZFA 3QF0A 5F4SA 1JRBA 3HGJA 4CNNA 1V7YA 1GVFA 3CEPA 1U83A 3LHWA 1VGAA 3YPIA 3W9ZA 3P74A 1A53A 4UNKA 3W1RA 2PC4A 3MP3A 3W7PA 4NX0A 3NVTA 3W87A 5D2TA 3G18A 2C15A 4DF1A 3T78A 4JX5A 2Z6IA 3W2MA 7TIMA 5E0KA 1R2RA 2F84A 2ZCGA 4XWUA 3NQCA 4M6VA 4RKAA 2EKCA 1KM3A 1SFLA 1RQEA 4FHAA 5DCBA 3LHZA 4GC4A 3W7IA 4CQ8A 2B0MA 3OHIA 3L0NA 4HNTA 4RXFA 1GVRA 2J24A 4FNSA 4MYXA 4OT7A 3M0ZA 4LVGA 1D3GA 4PL2A 4AWTA 5K4ZA 4UTWC 3F1QA 2XFWA 3DZ1A 2V2CA 2QKFA 1OX4B 2YPIA 3TKFA 3GNDA 3W07A 3L5LA 2CFFA 3EWZA 3S5YA 5CKSA 2UV8G 4ADTA 4RZ5A 1J4EA 3BPWA 3FYPA 3D0CA 1AW2A 4WOQA 3WK0A 4AF0B 5I3HA 1X8FA 4QNWA 2VFEA 2ZA1A 3JRKA 2VEKA 1J2WA 1T99A 1TRDA 1R46A 4FNRA 3W1PA 1TO3A 4XKYB 3MHUA 3FOKA 5E93A 3WJXA 1GG1A 4ZMGA 4Y6GA 4UCGA 3VE7A 4W9TA 1LBFA 1G6CA 3G1AA 4HSNA 2EAWA 1EA0A 4HNNA 5TQLA 1QO2A 1W5OA 1L6SA 5C6MA 2TSYA 3DI1A 1VCFA 1SO3A 3S8HA 4A2RA 3C2OA 1Z42A 5K2ZA 2YSWA 3NQGA 3GX9A 3HPZA 4N9CA 5C54A 4K39A 3QH2A 3QPZA 5D05A 4A21A 4I7WA 1KFEA 3N19B 1KM0A 5LGXA 4LU0A 5HWMA 3B0PA 5HNRA 2YXGA 1L9WA 3RNDA 5EPDA 1QOQA 2O7SA 4LW7A 4HN4A 3TH6A 2NXGA 4X2RA 3TAOA 5D03A 2PRLA 2NZLA 3P82A 2GJLA 3THAA 4M6PA 4TU1A 4DBDA 1G7UA 2CLIA 2NLIA 3TC6A 3T55A 4I7UA 5DY2A 4O50A 1IF2A 5FI8A 4DEFA 3OG3A 2QCHA 5HR6A 5D37A 4A29A 3BGJA 1X1ZA 1BKSA 2J9YA 3F03K 1UCWA 4O1CA 2C13A 2X1UA 5EL1A 3UWZA 3FYOA 3O6YX 1Q45A 2Y7EA 3C2EA 3C6CA 2QUVA 1SW7A 4YWIA 2VFDA 3EXTA 3UXDA 1F76A 3DH7A 1K8YA 1OVDA 4UFLA 1KW1A 5D2YA 3TJLA 2WJZA 4IX0A 1T0OA 3LHTA 4NX5A 3CHVA 3TK7A 3DHDA 5AHEA 1TCDA 4UMCA 3WJWA 4IMEA 1GZGA 4WY0F 1XXXA 1YADA 1C29A 4UIOA 1YLVA 4UTTC 4Z1DA 1PHWA 1SSDA 5IBXA 4AHOA 4DO5A 3EX3A 3PWAA 1LROA 2X16A 5K9DA 2P0OA 3FIGA 1HO1A 2TMDA 1JCMP 4PL1A 2QDGA 2KZHA 2QCMA 1QMLA 2JK2A 3OVRA 1K7FA 2VFHA 3W7RA 1RZMA 1EP1A 3O63A 2GVGA 5EA9A 4TO8A 3NDOA 2WSYA 1GT8A 1BWKA 4HT3A 3PBVA 2P1FA 4RR4A 3DFOA 3UZJA 1YTKA 3N9SA 4NJKA 3FKKA 3LTPA 3UWVA 2G95A 5U7SA 3UWYA 3LB0A 4O17A 3M6YA 3E02A 2GVLA 4BWLA 3HO8A 3LBMA 3W7KA 4O52A 5LHFA 4UNLA 5HINA 3GB6A 5L6UA 3S5OA 4WY0A 4QISA 3VNDA 2QCDA 4L4LA 4DPPA 5FF3A 1ZAIA 3O6DA 2JGYA 3FLUA 1GQNA 4UUIA 2DZPA 3QQ0A 4IQLA 3BGGA 2CLFA 2IQTA 4K6AA 1TPDA 2VKZG 4R53A 2G5WA 2C3ZA 2AQWA 1Q6RA 4JTJA 3G1XA 1LRQA 3W83A 2EPHA 1XL9A 5G2HA 2FFCA 4NJGA 2HS6A 3MO7A 2WNQA 5F4WA 3B0UX 2PRHA 1LBLA 1P5BA 2DZTA 1SU5A 3NQMA 2A0NA 2JKEA 4JTEA 3TSBA 5K9XA 3ABSA 2QEZA 4UR7A 2NWSA 3M5XA 2RDTA 1YYAA 1LLWA 5K4XA 1OYAA 1VLIA 3P62A 3W1NA 3PBUA 3NQAA 1HO4A 5C2XA 4AB4A 2ZZ3A 1DQWA 4Z1BA 1Z48A 3PUOA 3BVJA 1TPVA 1YTDA 3DAQA 3NM1A 2Y88A 1S5TA 2HMCA 3I7SA 1WBJA 3C56A 4LTSA 2NWRA 3CIWA 1LM1A 5F2LA 3NA8A 4NU7A 3S6DA 2A5HA 3STEA 1ZFJA 4CCDA 2NV2A 3LCIA 4L4MA 2R94A 5CG7A 4ONVA 4PTNA 1LOQA 3G1FA 4WXYA 3PSWA 3W7MA 2WSRA 3LCFA 3W7CA 4H6KA 4U28A 3OBKA 3PF3A 2QJIA 3P5ZA 1IXOA 5F2MA 1I2QA 3PB2A 5G4EA 2Y63A 1ICSA 4M5PA 1SO6A 3EWXA 2XN0A 5DXXA 1SZNA 1KFBA 1JCYA 3M9YA 2YFOA 3PC0A 4OGZA 2H8ZA 1F6PA 3L21A 2VC6A 5D02A 3LOTA 2RKXA 3VE9A 2Y62A 4CQ9A 2W79A 3ATYA 3NOEA 3UXAA 1X1OA 5KITA 3RU6A 3O05A 2NUXA 4IMCA 1QDSA 3CQ0A 2B7NA 2E6FA 3KRZA 2BXVA 4LWWA 2C6QA 2J9ZA 2D73A 1SZFA 4UTHA 3BARA 1H7NA 1TMHA 4GFSA 1R30A 1SPQA 2OCZA 4UFMA 1TPB1 3SI9A 3M41A 3R8RA 3NNTA 4JTGA 3IIPA 1O5XA 2A4AA 3GNNA 5HUOA 1JQVA 3TW7A 4KFOA 4HKPA 3KVKA 1WOBA 5DY3A 3W1LA 4MOZA 4OU1A 4PODA 2CU0A 2I14A 3CT7A 8TIMA 3P60A 3C3NA 4XZ9A 1RV8A 3HMJG 4JYEA 2ZRWA 4LV9A 3HJZA 3LDVA 4X22A 1NF7A 4XQ6A 3V1PA 3WK3A 4YLWA 3STGA 4N6FA 2CLMA 2FTPA 1H7OA 5DBTA 4YXGA 4DBEA 2Y89A 4ZQRA 5LGZA 3FEMA 3LXAA 4AH7A 3EKZA 4RXGA 3MBDA 1T8XA 3NYZA 4LVDA 2OT1A 1OFBA 3O1NA 3QMTA 3W2LA 3MI3A 1K02A 3TQKA 3LCLA 3C2RA 1TTIA 3HG5A 4MUZA 1TIMA 2E5DA 4NNBA 4OWGA 3W7JA 4HPXA 4N2YA 4LRTA 4NT0A 4JYDA 4MJZA 4TX9A 2ABBA 5A8GA 1X6UA 1F7BA 1WA3A 3QSRA 3TXZA 4KWVA 3L68A 3EB2A 5LNVA 1KLYA 4QJ1A 1PVNA 3EX4A 1DQXA 4RZ4A 1ZAHA 1LORA 4M19A 3TAKA 3VKJA 3ABRA 2C16A 1EP3A 4FIQA 3NQ6A 3RK8A 4LS2A 5LSMA 1SO5A 3HF3A 3P8IA 4Z1AA 5HWJA 1UASA 1WQ5A 3PY2A 4DO6A 1A5CA 1E51A 4O4WA 3I7RA 1MO0A 3P61A 5I3FA 3HIJA 4M7TA 1WOAA 5LHEA 3SFKA 3KFTA 4E38A 2V30A 4AHPA 2VOMA 2B7OA 1TV5A 4XTDA 5AHMA 3W88A 4JTKA 2FLIA 5I3GA 2QCFA 1NEYA 3RF9A 5AN7A 4UTUA 1A5AA 1N7KA 5AHLA 3MI6A 4OV9A 3LXBA 3S1VA 1A5BA 1BTMA 3M7WA 2B7PA 2BSLA 4MIMA 4O8RA 2A21A 4HNVA 2DJLA 3LERA 4E2DA 2R91A 5CZ0A 3NQDA 4S2CA 4RZ6A 1ICPA 4E2BA 3FKRA 3MI2A 1I4NA 3Q58A 1FXQA 5D38A 1O60A 5CZTA 3W7LA 3GIYA 4ZQCA 2ZZ5A 3HBLA 2NV1A 3GYEA 3EWYA 1ZNNA 3CU2A 3TNOA 1GEQA 3LI0A 4Z1CA 1PCKA 3GDRA 2YX0A 4UTJA 5EY5A 4OE7A 4WY0B 2WKJA 4QQ3A 3GDKA 4JTTA 4IPJA 3SR7A 2QCNA 4LVFA 4MPQA 4A22A 5FF0A 1THFD 4K38A 3TFCA 1IXPA 5HMSA 2RDUA 3HG2A 5IBXC 1UB3A 1P0NA 3EXSA 3MYOA 4AMAA 3CLMA 3MHFA 4WX2A 5KZDA 5J5RA 2ABAA 4Y90A 4O10A 2Q8LA 3GAYA 3R12A 2QUTA 2ZZ7A 1L6YA 1VHCA 4AWSA 3TX9A 4AF0A 3A5VA 5HULA 2ZYFA 3T44A 1TREA 4UFKA 5CSRA 1NFBA 3PG9A 4NXSA 4JTIA 3TMLA 3UWUA 4XKYA 1KM2A 4ML9A 2YYUA 4O12A 3WJYA 4EOUA 3M5YA 1OF8A 3C52A 1UUOA 3W75A 4FB7A 2GOUA 5MHBA 4UC5A 2DZSA 1XKYA 3W6YA 3W84A 5D2VA 3E49A 1TB3A 2V5BA 1H5YA 3THQA 2FPTA 3F4WA 5F2IA 1GG0A 3WFAA 5EYWA 4PEKA 6TIMA 1YXDA 3Q2DA 3G0SA 3E0IA 5FEXA 4EVZA 3W1UA 3G0XA 2QCDB 5CZSA 6ALDA 1WAUA 3KXQA 5CSSA 1OFPA 3G1SA 3S5ZA 1WDWA 3B04A 1JVNA 2TRSA 1A5SA 4AAJA 1KFJA 1AMKA 2QAPA 4LRSA 2J6XA 1SZGA 3NQFA 2QF7A 3C2VA 3G1VA 3A9IA 5G2WA 3N3MA 3QEZA 4LV4A 2YW4A 1VH7A 5LZLA 4ZQMA 4K36A 3P67A 2AGKA 4RV8A 3NZ1A 4FXRA 3F4NA 2Q8ZA 3P7YA 1S3HA 3L65A 4FX6M 4IUOA 3O06A 4R33A 3W3OA 3TQ0A 1OF6A 1GTHA 3QMRA 3PBWA 3LRLA 3HG4A 4WUIA 4O0KA 1JR1A 3BW2A 5DBUA 1FCQA 1PHQA 4IWWA 5U4NA 1GTEA 3W7NA 3G8EA 4MJMA 2QDHA 3VCRA 3PS7A 1K3UA 4JY8A 2I1OA 3LX9A 3NZRA 2ZZ2A 4O11A 3L0GA 4ZQNA 1I2PA 1QPNA 2GQ8A 4UTWA 2C19A 4YCPA 1YPIA 3NG3A 5AYZA 3JR2A 2X30A 1LRNA 3W7HA 1O5KA 5LNSA 4DF2A 1B3OA 1GPWA 2FDSA 1GYLA 3P81A 5CPLA 1D3HA 4JX6A 1GOXA 1JCLA 2X1RA 4ALDA 2JKPA 2V82A 2NX9A 1DL3A 3HGRA 3LRKA 1VCVA 1W3NA 3CC1A 2CLEA 4AXKA 3T7VA 1G67A 3A22A 3LCWA 3T40A 2ALDA 4DF0A 5G2IA 3WK1A 2BTMA 2QUUA 1EUNA 3TE9A 3M44A 2H90A 1L2UA 1O4UA 3HG3A 3W7OA 1FY6A 4DPQA 1JQXA 5AC7A 1WX0A 3G22A 4I9AA 1XBYA 3O8AA 3SSJA 4Z0SA 3S42A 1JUEA 3G8RA 3T4CA 4LNYA 2F7FA 3G1YA 1F2JA 2GUUA 3N73A 4N4QA 4O53A 1TJPA 2DZXA 3UY8A 2CLOA 4J9JA 1DV7A 2A7RA 2QR6A 3Q37A 1B9BA 2ZFAA 3L5MA 1FCVA 2Y7DA 2VEPA 4YCOA 4P2VA 1EEPA 3NR0A 3W22A 1AW5A 5G4WA 1LTDA 1YPFA 2YZRA 3C8FA 1EIXA 1O94A 4UMAA 5AHIA 3W2NA 3Q94A 2YFNA 5H2ZA 4MFEA 1Z41A 1SUXA 4ZL1A 4H3DA 2WOQA 1VLWA 4ICNA 3HGSA 4UTKA 2ATMA 4DQWA 4Y96A 5DN1A 3EWBX 3N14A 4Y9AA 3BW3A 3GR7A 3VFLA 4JD4A 5EKYA 1QPQA 4HPJA 4UFIA 1FQ0A 4MZ8A 3ZWSA 1G4TA 2AAMA 4KFNA 5LKYA 4WQ6A 3DFQA 4MZ1A 3PBYA 4HHPA 1NSJA 3NL6A 3CTLA 3SJ3A 4BR1A 2H8XA 3SIZA 5D04C 3ZS4A 3DENA 3KHJA 4QITA 3NAVA 1PS9A 1OYCA 1IXNA 2A6NA 2CZDA 3QSTA 3ELFA 3U8GA 3OVQA 2VFFA 3CB8A 5KZEA 1IXQA 1TQJA 3W85A 4FNUA 3PM6A 1TTQA 4PC8A 4ZQPA 3KRSA 1KTCA 5HQEA 3LCXA 5G5IA 1QPOA 1Q3NA 4XTIA 4MY8A 2RDWA 2ISSA 3MW7A 4E0CA 3W70A 4K8EA 4TMBA 4GUJA 4O0ZA 5FF4A 1K7EA 1AL8A 4YMZA 4G1KA 4IPIA 1W31A 3N2MA 1NAL1 2Y6ZA 3DFNA 1HTIA 1GVOA 1DJNA 2NXIA 4TMCA 1T96A 1I2OA 1W3TA 1SR9A 3IRDA 3USBA 1GVSA 4UTIA 1JCNA 3QRHA 5BMXA 4P61A 3EX2A 4M7SA 3UQNA 3UPBA 2B4GA 1OABA 3P8JA 2VFGA 3R13A 2CWNA 3N34A 3QZEA 3W71A 3W1AA 1FDZA 1VJIA 4MVAA 1DVJA 1H50A 3TXVA 2E1DA 3CIXA 5FF7A 2R8WA 3UY7A 4DELA 3HPSA 5K9CA 1CI1A 2VXNA 1C8VA 1WXJA 3NO5A 3NQVA 4JTFA 2DZVA 3S1UA 1YXCA 1TPUA 1KM4A 3B05A 3BO9A 2P10A 2CW6A 2ZRZA 3FS2A 1SQ7A 3GKAA 2NXHA 2V5LA 1MXSA 1VYRA 1OFRA 3W1QA 3DFPA 3TCEA 2HTMA 3R89A 2EGZA 3INPA 3N2XA 4JXCA 4C1KA 3AJXA 2YCEA 3DBPA 3OA3A 1DJQA 3L0KA 4Z0JA 3I65A 3EWWA 2QCLA 1QCWA 1JJKA 3PUEA 4AEOA 3KVJA 1KBJA 1S5WA 1OFAA 1TTPA 1MEIA 4JS3A 4XUGA 2V8ZA 3G3DA 3W74A 1AW1A 3NQ7A 1P4CA 4N9EA 3FJ6A 3S1XA 3NGJA 3MYPA 2BZNA 2E09A 1FBAA 1GWJA 2ISWA 3GK0A 3LTSA 2XN1A 3LHYA 2ZA3A 3KVMA 3UWWA 1M6JA 4IJBA 4LVBA 1ML1A 4JY9A 1ALDA 3MP4A 4IGHA 4D2JA 3KOFA 2R14A 4IMDA 2WPBA 4ZVJA 4UTLA 2QCGA 1QOPA 5A5WA 1EWDA 3NPXA 1HG3A 1TTJA 3UNDA 2X1SA 3B8DA 3S5NA 1FWWA 2V0TA 3L9CA 1DHPA 4EF8A 2ZZ4A 4FF7A 3RLVA 2XN2A 1R2TA 4S2BA 2WO5A 3W2KA 3B03A 3U6WA 1ADOA 4TIMA 3QYQA 2ZRXA 5TIMA 4JX4A 3KX6A 2GPTA 1OHLA 4NVTA 4X9SA 5KTLA 1MEWA 1A50A 3S0CA 2PURA 5FEZA 1AK5A 3VI2A 4GNJA 3R5EA 1KFKA 2ZRYA 1K03A 1ZY9A 4K37A 5DELA 2OX1A 1KTNA 4N4PA 1FX6A 2YYTA 1SSGA 3E9AA 4UFJA 4MLRA 4O15A 4JR5A 3TROA 4ZZ9A 4K7VA 3NPVA 1P0KA 1VC4A 3LLFA 4BWLC 1W56A 4FNQA 3C0JA 2E77A 3ATZA 3H55A 4CLMA 2BWGA 5G1YA 1H60A 2HSAA 3DFTA 1KFCA 1FWRA 5SWUA 2YDAA 4FNTA 4WXZA 1XUZA 4UXDA 5D33A 1XBVA 1ZCOA 4EIVA 2E68A 5D2WA 1Z44A 1FDYA 2C1HA 4FEZA 5FF2A 4QAIA 4FIRA 4LT9A 3W7QA 4PA8A 5I3IA 4O1AA 1ICQA 3U2OA 3LRMA 2CZEA 4O13A 3C2FA 5F2GA 1VCGA 2WSQA 1Y0EA 3P5YA 4XBKA 3TR2A 2A7NA 2Y61A 2ZRVA 4NQ1A 1VPXA 3SECA 1RVGA 2PE4A 3TU9A 2QCCA 3A5FA 4A2SA 3O07A 2B7QA 4A3UA 3TIMA 1AG1O 4LC8A 4X3ZA 3W2JA 3E96A 4CNPA 3NXFA 5CZJA 4KKXA 1IIHA 4NXKA 2FJKA 1NVMA 3O16A 3W1XA 1JRCA 1EWEA 1DOSA 3HPXA 3WK2A 4JTUA 3NL3A 2DP3A 3IIOA 4YL2A 3BLEA 1X7FA 2GVJA 2V81A 3PAJA 1ME7A 1WBHA 4MY1A 3QJAA 1W37A 4AWUA 4JN6A 2ZBTA 4PFMA 2J27A 4JEQA 1ME8A 3WJZA 3DFSA 4UTMA 2PRMA 1YDOA 2QJGA 4OQVA 4LOCA 4OBTA 3LBCA 4U4MA 1H7PA 5AHFA 4JIQA 3BG3A 1B4EA 3CEUA 4O1BA 1G4SA 1KM1A 4EWND 1XC4A 1OFDA 3UYCA 3L67A 3DKJA 1LBMA 1ZALA 1ZJIA 2E6YA 2Y7GA 1QAPA 3PG8A 3MBFA 2VEIA 1VR6A 1XM3A 2ZZ1A 1K8XA 2A2IA 1TPC1 2RHGA 3CM4A 3EKLA 3W23A 2RFGA 2J9XA 4UR8A 5BNKA 2C14A 5HJLA 1F6KA 2JBMA 3IEBA 4HNUA 2ZDRA 3W1MA 1OX5A 1I45A 1CX9A 1XDMA 3SGUA 4O18A 1H7WA 4O57A 3TMQA 4N9DA 4NJHA 3MMTA 4JDBA 1B57A 3GZ3A 3B0VC 3DHFA 1M7PA 5TBOA 1TPWA 3AO0A 3RLUA 3QC3A 4BI7A 3LHUA 2A1YA 4ADUA 2ATSA 3TUUA 1BEUA 2Q3RA 4AVFA 1FWNA 2E5BA 4Z08A 4FX7A 2CZFA 3IVUA 1LP6A 1OX4A 3NQ2A 4O1DA 5K7JA 4NUWA 1TV8A 2YW3A 1XUUA 1J5TA 1H61A 3W7EA 1R47A 1HUVA 5AYYA 1QFEA 1LOLA 3KRUA 3LV6A 4NNCA 1G4EA 3PB0A 4FX8A 1H1YA 1I2RA 5KZMA 4BF9A 4GJ1A 1ONRA 2VELA 2TYSA 4FNPA 3NQ8A 1VHNA 3CPRA 1PIIA 3PVFA 3LI1A 2WNZA 1W0MA 2ISVA 2FPVA 1XCFA 4JICA 1B4KA 1K8ZA 1ZAJA 1QR7A 1WV2A 5FEPA 4O16A 3NL5A 3GR8A 2NX3A 5AC6A 4IXHA 1PE1A 1TV7A 5BMWA 1YTEA 1I2NA 4GRSA 4GUGA 1KM6A 3W72A 4CQAA 3MP5A 2LLEA 4N02A 2QAFA 1L6WA 3LCGA 2H3DA 1LZOA 5HUPA 3A23A 4CNOA 1VQTA 3QMSA 3HQ1A 1SFJA 1V5XA 4MKNA 1F5ZA 3TSDA 3C61A 1FUYA 5HWNA 3W86A 1W5MA 2CLLA 4Q32A 3QW3A 4PH6A 4MY9A 3TFXA 1OFEA 5HR7A 1PL9A 3OEXA 3IIVA 2X1TA 4NJJA 4BK9A 5LNRA 2RH9A 3UWQA 1FDJA 2Y70A 2O7QA 1W3IA 4GUFA 1G4PA 3IGUA 1RD5A 2A85A 1JCXA 5CPNA 2FQIA 4UMBA 3DKLA 1MSSA 4O28A 3CWNA 4MYAA 4Q33A 1KM5A 1GJPA 3GXPA 1JULA 5DXYA 1OX6A 1OK4A 3P84A 1RR2A 4AHQA 1FCUA 2DU2A 3HB9A 4ORMA 5D30A 5LNUA 1HL2A 4K7YA 4GBUA 3S9YA 3BLFA 2W6RA 2Z0IA 2PCQA 3B4UA 1ZENA 1U5JA 3M47A 3STCA 4JNMA 3M16A 1I8JA 5F1VA 4IMGA 2DZWA 3ABQA 3R2GA 3EXRA 1M7OA 4R7JA 1QO5A 5F1UA 1SO4A 1FXPA 2WQPA 4PCFA 5F4XA 1TYGA 2H6RA 2A6LA 5KMYA 1LRTA 4NJIA 4MFDA 1F73A 3MUXA 2ZTKA 1LOSA 4NZJA 4JGDA 2Z6JA 4WZHA 1EX5A 2I9EA 4QIUA 1TPEA 3H54A 1W5QA 3TDFA 5AB3A 2Z2UA 2ZRUA 5CGQA 1KV8A 3ZFHA 4C1LA 1IGSA 3DI0A 5IM51 1R2SA 4GWEA 3JS3A 1OK6A 2BLEA 1TPH1 3G1HA 1QWGA 4M6QA 3W73A 2TPSA 3BW4A 3L5AA 3EWUA 5D32A 3SW6A 5C55A 3BG5A 5KSWA 1F05A 4LVAA 4GE8A 4S1FA 3K30A 2CLKA 1EB3A 2G96A 4IOTA 2DJXA 3LGEA 1TQXA 3WJSA 3W7GA 1EP2A 1FCBA 1Q6OA 3S1WA 5FESA 2EF9A 3O15A 5FEWA 4R34A 3C4UA 2YR1A 2WV8A 3DXIA 4LS1A 3SZ8A 3GDMA 1G7VA 1TPFA 3BK0A 3B06A 3A24A 4HIBA 1N55A 3TSMA 2C0AA 1SW0A 3M1ZA 3CWOX 4GUIA 3QW4B 3UD6A 1NF0A 1KV5A 5LNWA 2CLHA 4LC6A 5CPOA 2BX7A 1YDNA
chains in the Genus database with same CATH superfamily
1NFGA 4V33A 3S9IA 3RLGA 4C5YA 1YRRA 2OXNA 2VEGA 1CGWA 3M5VA 1HT6A 3TV8A 1OG0A 4B9ZA 1BTCA 1KBLA 5AFDA 1ZCCA 5E6YA 4IIEA 3UEQA 3IVTA 3TC7A 5EMUA 1TWZA 3OBEA 3I3BA 3WBEA 1AA1B 1CXHA 4E4PA 1KBIA 2YDQA 4R7WA 1MEHA 3AISA 4GYPC 1EUAA 1Q7QA 3VUPA 1TSIA 1KBKA 3MO4A 5IDZA 2GDVA 4ZFCA 2XH7A 1G69A 2BDQA 3VD7A 3DESA 3VFCA 3KVLA 1P1XA 1E0XA 4NYUA 4H01A 1FWSA 1HFBA 3QZAA 4LUIA 5CPMA 4LS0A 3NQEA 3KCOA 4P7OA 2HXUA 1H7XA 4BFAA 3ZVIA 1ZHAA 4JAWA 3BE7A 3NPUA 3RMJA 1A3WA 4P8XA 1VFMA 1E6XM 5BRBA 2QJHA 3UG5A 1CGUA 2UY3A 2WJFA 3BV4A 3IACA 1EC9A 3EEGA 3KL5A 2XZ9A 4BI5A 2DDXA 2DUXA 3EOOA 4QE5A 1J6OA 2OJPA 4KEUA 4EKJA 4HA3A 3KRBA 3GAKA 3E12A 3S3GA 3GNXA 3GVGA 1JAEA 3RPTA 4J7RA 4I7VA 4O54A 1Q6LA 3IVSA 1RPXA 4OOZA 2CIPA 2PDYA 1KLZA 5EBUA 1XFBA 3ZXWA 3POHA 1SR0A 2QIIA 4GD0A 4MZYA 3EB3A 3KAOA 4QM1A 1RJPA 2E6DA 2NW0A 5I3KA 4BI6A 2V63A 1UR0A 4DO4A 2A7PA 3TTSA 1RBOB 1W5NA 4IG2A 4KETA 4O19A 1QW9A 4B92A 1GGOA 2YB1A 3N04A 4GY7A 3DYOA 4OHQA 2GGHA 1JCJA 1PKYA 3B9DA 2ADAA 3TQVA 5C9XA 3M4HA 2GSHA 1CXIA 5K3VA 2G3JA 3H7UA 4KBXA 3U2ZA 1K8CA 3GXTA 4AC1X 4Y8FA 5A6TC 4QNEA 3DGRA 4IIDA 5C5YA 4HNOA 1NQKA 1UP3A 4XZHA 1ONEA 1LLOA 5H91A 4TTUA 4WJEA 3BC9A 2C18A 4Z2HA 1XIHA 2VL4A 2PTZA 3LV5A 2NUWA 4R88A 2Z1BA 4PEEA 4GZJA 1E0VA 3IGXA 3BZJA 4O14A 3WD3A 3GU1A 3F4DA 1PTAA 3UFYA 1PCWA 1FWTA 1LG2A 3OODA 3SGZA 3TEVA 3GNRA 4LNCA 2IQDA 1V4YA 4M29A 3EX6A 2ZX8A 3G3MA 4P7RA 5C2CA 2PD9A 1ISVA 2BGQA 2DORA 3B9NA 2QZRA 1OFQA 4B2DD 4O1FA 2VEMA 2BY2A 5CZKA 3AYSA 3HOJA 4RX0A 2UZ9A 2X40A 1QW8A 2PWGA 1BWLA 5D09A 2V2DA 1VRDA 1ZP3A 1F74A 3DU0A 5JXQA 1LCOA 2RAGA 1AZ1A 1UJPA 3OP2A 4POCA 3R43A 2C91A 3VD4A 3QF0A 1JRBA 3R25A 1V7YA 1GVFA 3VGFA 4XD5A 2L5HA 3W9ZA 3P74A 2PC4A 3W7PA 3NVTA 1W6TA 1VKFA 1IWPA 2PF0A 3I3EA 4F40A 4F2UA 4TX6A 3AS1A 4XB3A 3OU8A 5E0KA 1R2RA 3R8GA 2V5CA 3NQCA 4RKAA 3UPMA 1XIFA 3GHSA 4XK2A 4H8UA 2QV4A 1A80A 2HVOA 4I3GA 3TTYA 3S4TA 5JUVA 3CS2A 3N12A 4AY1A 2J24A 1J01A 4FNSA 3VM5A 4OT7A 2OR2A 1TUXA 4PL2A 1UD2A 3DZ1A 2V2CA 2WZHA 1IZCA 3WDIA 5CQ1A 3BLLA 4AD5A 2YPIA 3L5LA 1XLGA 3CNYA 3EWZA 3QHNA 4I6VA 2UV8G 5XINA 3R10A 3R6IA 1ITXA 4W7VA 4NILA 3JU2A 4Y9OA 3BPWA 3MCOA 4ZBCA 3WK0A 4AF0B 5I3HA 5IHSA 4QNWA 2VFEA 3MQTA 2ZA1A 1YQ2A 3V36A 1DTUA 1T99A 1TV4A 4FNRA 4C1NA 2HE8A 1X8CA 4DI8A 2FZBA 4YVVA 5C2GA 3VE7A 4H8HA 3EB4A 2PZNA 1LBFA 1UH2A 1JZ8A 1NTHA 2EAWA 1X98A 1EA0A 1L6SA 5BOFA 3T09A 2F9RA 1X6NA 4KGJA 4GK8A 1VCFA 1US2A 3S8HA 4IZGA 3RXZA 3C2OA 2YSWA 5CG0A 3WD4A 1K9EA 3GX9A 4N9CA 3WX7A 1DJIA 4K39A 3B97A 4Q4SA 3RX2A 5DANA 4U5IA 4A21A 4UOJA 4LU0A 5HWMA 1FWEC 1KWKA 1DJHA 3OLGA 1TG7A 4PBGA 2G3NA 2V3EA 2NZLA 2VCAA 3CMGA 2GJLA 3EYPA 4PUUA 3KLKA 1G7UA 3PPHA 4US6A 3AAMA 3VOFA 3I4EA 3TC6A 1P43A 5CBBA 4OECA 1FKWA 1PKMA 5XIMA 4OKDA 4DEFA 1MMFA 2QCHA 5HR6A 3ARTA 1D2KA 5DT5A 4Q4RA 1UCWA 3TWBA 5I23A 4O1CA 2I5IA 2PLMA 1IEWA 3FYOA 3O6YX 1Q45A 3P3BA 3C2EA 5MKGB 1NIUA 3QTPA 4FS9A 2QGYA 4BQ3A 2DH2A 1OVDA 4UFLA 1EHAA 3TJLA 2WCSA 2P8BA 3LGDA 4DUVA 4KT2A 2DT0A 2WHKA 3JZEA 2EKGA 3VDCA 5IBXA 4HYRA 2X16A 1R9XA 2XU2A 4Y8EA 2JK2A 1B5TA 1XSIA 4RNHA 5BU6A 4W7WA 1L6GA 2D0HA 4IIHA 1JZ2A 1E4LA 3NDYA 3SRKA 2GVYA 3NDOA 5CCZA 5A95A 4HT3A 4A3QA 2WZIA 2P1FA 4RR4A 2AQOA 3N9SA 4NJKA 1LWIA 3GW0A 3FKKA 1ITUA 4O17A 4BQ5A 3B8TA 4GI8A 2GVLA 3IAQA 2TAAA 2EG8A 4JZ5A 4CD7A 3GB6A 4WY0A 4QISA 3XINA 2QCDA 4DPPA 1R3RA 3VMPA 1UC4A 2OGJA 3LENA 3MSDA 4UUIA 2NQ5A 2DZPA 5CPTA 4C6IA 2IQTA 5A6JA 4QJ3B 4C91A 2G5WA 2C3ZA 4B4HA 3G1XA 1LRQA 3W83A 4NJGA 3USZA 3VNLA 4QXIA 2ZUTA 1E9ZB 3AOFA 1P5BA 2DZTA 5E0FA 1J18A 3R1ZA 3EGJA 2FZ8A 2WWDA 4ZOEA 4LCSA 1LLWA 5K4XA 1VLIA 3W1NA 3BAIA 3PBUA 3NQAA 3PN8A 4LALA 4PTWA 2YDSA 3V7PA 1GJWA 4QEHA 4HJWA 2VX7A 3IGHX 4AZ5A 3MANA 1JPMA 3PUOA 3BVJA 3AXMA 2HV5A 3DAQA 1PYMA 3C0SA 2Y88A 5FAGA 3XISA 1OEPA 4HYVA 3RPMA 3I7SA 4DUXA 4TOQA 3GD6A 3NA8A 1EC7A 3S6DA 2DIKA 3WNOA 2A5HA 2PI6A 5JU6A 4L4MA 2R94A 4AZ7A 1WUEA 3WQOA 1SJAA 4WXYA 5CLWA 3HV8A 3OBKA 2QJIA 5G4EA 4EXQA 1DJGA 2DFAA 4M5PA 1ZGDA 1SO6A 3EWXA 1REQB 5A6SA 3UXLA 2YFOA 2H8ZA 4B5TA 1AH0A 1RY0A 2VC6A 2RKXA 4LFYA 3N15A 3ATYA 3NOEA 3VABA 2DIEA 3AC0A 3QC0A 1YEYA 2B7NA 3AHVA 2E6FA 2E9LA 3KRZA 3BSMA 2BHZA 4LWWA 2C6QA 2J9ZA 3QFWA 1RPKA 3LMZA 1F61A 2RGMA 4QCFA 4DAIA 1ITCA 4GFSA 1GVIA 1R30A 2OCZA 4WIWA 3W01A 3E2RA 1US3A 1TPB1 5I77A 3K2GA 3SI9A 3M41A 3MKVA 3NNTA 4R85A 1O5XA 3VM7A 2NQLA 7XIMA 1JQVA 1WOBA 4W8BA 3OW1A 3IUDA 1CGXA 1M3UA 1WCGA 3C3NA 1DIOA 4UCFA 5GNXA 5AC4A 4REQA 4LV9A 1K4GA 1XQLA 4J27A 5TNVA 3V1PA 4AEFA 5AVNA 1H7OA 4B3ZA 4YXGA 4DBEA 3BMVA 5FKYA 4ZQRA 5FL1A 4GIAA 1XGZA 3LXAA 4AH7A 4Z2IA 2VWSA 1XLCA 3SDOA 1POKA 3CQHA 4HYWA 4LVDA 2OT1A 2PBGA 3QMTA 5HMDA 1K02A 3RU8X 3TQKA 3LCLA 1LL7A 1TTIA 3MSRA 4MUZA 5FJPA 2E5DA 4NNBA 5DFAA 4OWGA 4JYDA 3VKDA 2VC7A 2BY0A 2PDQA 3VX0A 1GPFA 1A0CA 3B40A 1F7BA 2CEQA 1XIJA 4GZEA 1KLYA 5CBIA 1PVNA 2NV9A 1ZAHA 3WD0A 2OO6A 4M19A 4W87A 3TAKA 3VKJA 4JQ3A 1VEMA 1EP3A 4C6NA 5LSMA 3RMEA 3KOXA 3S47A 2R1KA 3GS6A 3B0YA 1KFWA 4DO6A 2Z24A 2MUCA 2DT2A 2XSXA 1OCBA 3P61A 2JEPA 4NZ5A 1WOAA 1ZPTA 2V3FA 3SFKA 4PUKA 5C9RA 3RF9A 3WF1A 1JI1A 4F4RA 5AHLA 1XV8A 4MAZA 1BTMA 1RHCA 5A6AA 4M51A 3M7WA 2B7PA 4M1RA 2BSLA 1AUSL 4HNVA 3GG7A 4KESA 5C7HA 2R91A 4S2CA 3GM8A 4RZ6A 1OBAA 3GTFA 3DEQA 4W8AA 2PPGA 4DJDC 4F48A 3Q58A 4Q8TA 1NJJA 3GIYA 1M9HA 2NV1A 3GYEA 1P0EA 1E6ZA 3EWYA 1GEQA 4Z1CA 3U5UA 1PCKA 3GDRA 2YX0A 1IR2A 4I8DA 3LS9A 1RCXB 1YPXA 2WKJA 2F2HA 4QQ3A 4EACA 2PTXA 4JTTA 4KRTA 1BYAA 4NI3A 3SR7A 4A22A 3UZXA 3AMKA 1D7FA 4HU3A 3HG2A 3ZVHB 4M6UA 3ALFA 5FOOA 3NOYA 4XAFA 2WKGA 4WX2A 3GTIA 5KZDA 2W67A 1BXCA 3WF0A 4WEVX 5HPCA 2BHYA 4OJYA 3A4WA 4O10A 5AYIA 4HP5A 3A5VA 1F3XA 4IGMA 2I57A 3CYJA 4AMCA 3B9AA 1NFBA 4IH3A 3PG9A 1EBGA 4JQ1A 5J04A 1IWAA 1KM2A 2YYUA 4AFYA 1UUOA 3W75A 4FB7A 3EA3A 5MHBA 1WNOA 5JBEA 1XKYA 1E73M 3W84A 2CHNA 2FH8A 4XBJA 5KETA 1H49A 6PTDA 3F4WA 2POZA 3Q65A 3TYCA 1B31A 3U9IA 6TIMA 1YXDA 1IE7C 1IT7A 1IT8A 1CIUA 2OWCA 1UD3A 4EVZA 3W1UA 2OO0A 1UA7A 3TVAA 5CZSA 4Q7NA 3TYAA 1TA3A 1V3HA 2CXEA 1LQ2A 2AOSA 1YMYA 1A5SA 3LSBA 4AAJA 1KFJA 4GNKB 1AMKA 3EEZA 4W8LA 3ABZA 2QF7A 3DHUA 4UBPC 1NU5A 3N3MA 1F8MA 1AQMA 3QEZA 3PZGA 1VH7A 3V1HA 4JKMA 1VEOA 2WMHA 5H8UA 4FPSA 4RV8A 2NSOA 2WMGA 3EDDA 1YE6A 4FXRA 2Q8ZA 1S3HA 3L65A 4YTSA 4IUOA 4WJ8A 3AIVA 3DDMA 3KTCA 2O56A 3E0WA 2J75A 1E6PA 4G1NA 4W5ZA 4GJJA 2E9BA 1V0KA 4X63A 2FHBA 3K4DA 5HXMA 4WR3A 4OZOA 2IW0A 4MJMA 1EDGA 3NZRA 1IEXA 1RSCA 1VP5A 3L0GA 1I2PA 5CXPA 3NG3A 3JR2A 1LRNA 4E5TA 1O5KA 4PTMA 3TOPA 1EZ2A 4DF2A 2OTDA 4Z42C 4JCLA 3WFZA 1Q2RA 3QKZA 3KS6A 4JX6A 1GOXA 3VIJA 4ALDA 2V82A 2QVNA 4AXKA 3UJEA 3SAZA 2EG6A 2D0GA 5EB8A 4ZFMA 1EJTC 3QV8A 3OGVA 2BP1A 2ALDA 2ZC8A 3ANVA 2OLSA 2BTMA 4ZA0A 1FY6A 1WX0A 1BYCA 2R1PA 3UETA 1ZBVA 1FFQA 1UC5A 3LEPA 1FTXA 3FXGA 5A8OA 4DWSA 4PTXA 3UY8A 2CLOA 2A7RA 3FA3A 4GFIA 4LH8A 1TE6A 3BZGA 5CJNA 3CUXA 3LBOA 4BEQA 1W9VA 5AYBA 2UY4A 4LF2A 4P2VA 5KEZA 2C1IA 8XIAA 2HBVA 1QW7A 4BF5A 2XSBA 4AZBA 3QOMA 3VKKA 3N29A 4KCTA 4TTGA 3DIPA 4UMAA 3CH0A 5AHIA 3W2NA 3S2NA 3S83A 5H2ZA 4J3UA 3CTTA 4G7FA 1JXKA 3KL3A 3AMCA 1Q63A 2ZUWA 1PX8A 4DQWA 2VZOA 3EWBX 3N14A 4Y9AA 4GQGA 3GR7A 2QT3A 1QPQA 1Q85A 3VMOA 2ZC1A 1FQ0A 1RK5A 3ZWSA 1JL8A 1NOFA 4WQ6A 2DT1A 1SYTA 3PBYA 3ZS4A 2ON3A 4QITA 4YTRA 1W1YA 4DZAA 5C8BB 2VFFA 5KZEA 1IXQA 1TQJA 3GW3A 4E3TA 4ES4A 3KRSA 2YL5A 5HQEA 1M03A 1Q3NA 4XTIA 4H9UA 4MY8A 1ZUAX 2RDWA 4FI4A 3WFLA 4AIEA 4TMBA 4ZO8A 1AVAA 3FX4A 1UQZA 4YMZA 1DJYA 3V0TA 1W31A 1NAL1 2P3ZA 4CVUA 1DJNA 2WCAA 2Y5EA 1T96A 1KRCC 2VX5A 1R9YA 3N4AA 3IRDA 1GVSA 3CQIA 3EX2A 3UPBA 4P8UA 4TVUA 4B5UA 2J7BA 3WLTA 3GTXA 1L6FA 1FDZA 4V27A 1Z3NA 3UY7A 4L65A 3U48A 2WZTA 5JVLA 3SY8A 3AQUA 4GZIA 1CPUA 4HPGA 3NQVA 2DZVA 4UZUA 2CW6A 2ZRZA 4NZ4A 1SQ7A 2EQDA 3PHAA 1MXSA 1VYRA 3W1QA 1EOMA 3KTSA 4PRRA 2GJPA 4RDWA 1QRQA 3DBPA 4Q8OA 1FH7A 3L0KA 4Z0JA 3EWWA 3HFYA 1OIMA 1CCWB 3REQB 2WVTA 1K77A 1KBJA 2G3IA 1A47A 1OFAA 3W74A 1AW1A 4Q4PA 4Q8PA 2JEQA 3NQ7A 1P4CA 4DRSA 3NGJA 2E09A 1XF0A 3VD3A 3BUVA 3LHYA 2ZA3A 4PMVA 4IJBA 4LVBA 1DWHM 1ML1A 1RVKA 2WXDM 1ALDA 4WK9A 3TLQA 1TV2A 2PF8A 3ZT6A 2ACQA 4CU8A 3UZYA 3MC5A 2QCGA 3M0VA 1QOPA 3VOCA 4HK5A 1H41A 1TTJA 1QHPA 4GI4A 1OADA 4X61A 1DHPA 2XN2A 1R2TA 4UR9A 3MU7A 4L1XA 1G1YA 3JUGA 1XG4A 2AMGA 4JX4A 4JL2A 4L1GA 2GPTA 4GG9A 2EEXA 3BQ5A 3AWOA 4FMVA 4TUFA 2W92A 4K3ZA 2OSXA 4DJEC 5DELA 2D22A 3T07A 3RG6A 4P5UA 2R9RA 3E9AA 4ZE4A 4O15A 4GGBA 5A6KA 1VC4A 1W56A 1UD4A 2GUBA 3CUJA 1KFCA 1R85A 4FNTA 1QBAA 4Y9NA 3VGGA 3FV9A 5HANA 4DAFA 3FVMA 1ZCOA 3F5LA 4XAZA 4EIVA 2AKZA 2E68A 2C1HA 4FEZA 3CZGA 4GY0A 5I3IA 3LRMA 3UXIA 4O13A 4XBKA 3RN6A 2A7NA 3KWXA 4PYSA 2ZRVA 4U2YA 5H6HA 1J9YA 1J11A 2B7QA 4A3UA 1PKLA 4X3ZA 3V5FA 4CNPA 3PFRA 2WYSA 2P8CA 1QNOA 1IIHA 1YNQA 1TVPA 4DJFA 2FJKA 4MWAC 4IISA 1VB9A 3O16A 1EWEA 1AQFA 2XH4A 3WK2A 5A6BD 2DP3A 3IIOA 4YL2A 3BLEA 1X7FA 2FKPA 1QTWA 4LCQA 4H7ZA 4CD5A 1T6MA 3QJAA 1A5OC 4JN6A 4OBRA 3PTMA 2I5QA 2V5DA 1OGGA 4KRUA 4HOXA 4WKFA 4DZIA 1R3YA 3PZQA 1FWBC 3OQ8A 1V3JA 3WJZA 3DFSA 3N2OA 3V35A 9XIMA 2PRMA 3ZSTA 2O4MA 5LXXA 1Y5VA 4AZCB 1VAHA 5AHFA 3OLDA 5I79A 3E0VA 3QY6A 4O1BA 1KXHA 1G4SA 1KM1A 1JDCA 3L67A 1ZALA 1UKPA 1HKIA 1QAPA 2DW7A 3SRDA 2A79A 4Q8UA 1VBGA 1TPC1 2PDFA 3CUHA 3W23A 3WLSA 3OPSA 2C14A 2XH2A 3KS5A 4KEZA 2JBMA 3IEBA 4MWAD 1JF5A 4DB7A 4HNUA 2ZDRA 1OX5A 1JNDA 1XDMA 1K9TA 1E9YB 1H7WA 4MGGA 4CNTA 3TMQA 4NJHA 2J66A 4JDBA 1I75A 2ZE3A 1E43A 4WDWA 1MVYA 2WQDA 5D8WA 4OVXA 1FWFC 4DWDA 1FFRA 3FSTA 5TBOA 1Z9AA 3UVIA 2FTWA 1F3TA 2RDXA 3IWPA 4ADUA 1BEUA 4AVFA 4DUOA 4HB7A 1DEDA 3SCPA 2Y24A 4Z08A 1U1JA 1LWJA 3ITGA 4O1DA 5K7JA 1E3XA 1KWGA 2YCIX 2YW3A 1XUUA 1IGWA 1E6QM 3G77A 4QR6A 3N11A 4FAMA 4PMUA 4HN8A 2V3DA 1G4EA 4XZBA 4GCAA 2DT3A 1H1YA 2X42A 3SJNA 4D6JA 1EH9A 1Q6GA 4LJ3A 1SMAA 1QI0A 4FNPA 1PIIA 2WNZA 3V18A 3ITLA 2CERA 4ZEPA 4AD0A 4LB4A 1ZAJA 1QR7A 2YL6A 4O16A 3WQDA 2P88A 2PU0A 2NX3A 1EGMA 5GJPA 4W7UA 3EMQA 1Z7AA 1I2NA 4GRSA 4ZR8A 1KM6A 3W72A 3WDQA 4JQ4A 4A4AA 4B5XA 3LCGA 3B9EA 1LZOA 5HUPA 3A9BA 5I2UA 1V5XA 2NT1A 3TN6A 1F5ZA 3L2LA 1S3TC 1C93A 3W0KA 1W5MA 2UY5A 2CLLA 3S9ZA 3TFXA 2VZUA 3OEXA 2J6VA 2ODOA 2VUNA 4NJJA 4BK9A 2EPKX 1TWIA 4KCWA 5LNRA 4GYPA 3UWQA 2J74A 4NZ1A 1G4PA 1RD5A 3VIIA 3BAJA 2A85A 2QYGA 2F6XA 5CPNA 2FQIA 3DKLA 4O28A 3CWNA 4MYAA 3GG0A 4Q6JA 1EPVA 1AJZA 4ILSA 4K7YA 3S9YA 3KW3A 5MKGA 1VFHA 3M47A 4JNMA 4CD6A 3PK7A 2DZWA 3R2GA 3EXRA 3QV9A 2KX9A 3A13A 3DYPA 4R7JA 1W1IE 2GL5A 1PZ2A 2BV9A 2VQUA 2H6RA 1XCXA 3M0KA 4AX6A 3AXHA 4NJIA 1F73A 4K1WA 3H4XA 4NZJA 1AQ0A 4WZHA 1S1RA 4YHEA 3EDEA 1VIZA 4LYKA 1EQPA 4PMZA 4QIUA 3CWHA 5A8MA 1XYBA 1E5NA 1DJZA 2BODX 5C9UA 1KV8A 2CBVA 1OK6A 2BLEA 2NSXA 5CBJA 3WUEA 5EMJA 3SCTA 2TPSA 1V51A 3BW4A 4DBSA 5C55A 3BG5A 3WLMA 1XLKA 2JIEA 1F05A 4GQBA 4QJ4B 4LVAA 2X1IA 3U5YA 1DIEA 3REQA 1PXGA 3CMFA 3MVIA 1V6VA 1FCBA 4GO9A 1O1HA 1P7TB 4MB3A 3R7MA 4LS1A 4GIRA 4DNHA 4AY7A 2CYGA 3FGCB 4HNLA 5CAHA 1SW0A 3BAXA 1HKJA 3N9KA 1UR3M 4MJ4A 3KE0A 3VYLA 1JEZA 2ZXDA 1YDNA 1UA3A 2HS8A 4EF9A 2G97A 1H4PA 3GKFA 3AIEA 4CU7A 4IP5A 2DZUA 4IX2A 3ONBA 1CW2A 1OYBA 3WUBA 1XD1A 4AY8A 4IXXA 2H3BA 3ZWTA 2O55A 3WMCA 2DSUA 2ZZ6A 4D6HA 2JKAA 1VRXA 4J3TA 4Q4KA 4ZQOA 5BOOA 3WNLA 1XBZA 4PFHA 4N9BA 4H2CA 3QPYA 4JFUA 3GDLA 3I68A 2INEA 4JQ2A 1PIGA 5LA0A 3NL2A 3LK6A 1RA5A 4H04A 3F4VA 2CLPA 1BYBA 3N13A 4QCEA 1XH1A 1ECEA 5BW6A 1TV3A 2JF6A 2WC4A 1LYXA 2QS8A 3NM3A 3IRSA 5T26A 4W84A 1WP6A 4GQQA 2PS2A 1XLAA 3UP8A 3P0XA 1W5PA 3UW6A 4XD4A 2V9DA 3LHVA 3TW9A 5A1AA 4L6OA 2ZVIA 3K46A 1E1CA 1W8SA 4DXVA 1K7XA 5XIAA 3AHZA 1G94A 3MJYA 4GKTA 1GOKA 5G1TA 4M0XA 2DSKA 4FOJA 4S3BA 4ML4A 2FFIA 4FO4A 1OJXA 4WGXA 1NELA 1SZEA 4HSOA 3BLIA 2WNNA 3N4FA 4JTDA 3QV7A 3BG9A 4B5NA 2WZMA 3S46A 4RL3A 2FTYA 1RQBA 2BOGX 4I5UA 1CXFA 2D69A 3CUFA 4OV4A 5AHNA 3KWSA 1MUCA 5IXEA 1W1ZA 1AJ2A 4FXSA 1V6UA 2Y4SA 3VIHA 3OIXA 3UZ5A 3GC5A 1IIGA 4KWSA 1GYMA 5AYXA 4RDZA 1VYPX 1HJQA 2QCEA 1DORA 4KFPA 3PTKA 1C7SA 3H53A 3GDTA 1XYAA 2V5KA 1C7TA 3QQ1A 4GPNA 2PCEA 4JDYA 3L4UA 2UBPC 1XDLA 3A21A 3FK4A 5CC3A 1UBSA 4YIWA 1FRBA 3RILA 3P6LA 1ISWA 3NEVA 4IMFA 2B81A 1X6LA 3EX1A 4TQTA 3PUGA 3URAA 5E9AA 2NX1A 4YNGA 3AI0A 4E2VA 2ZTJA 1XLDA 4B15A 4BQ4A 1V02E 7REQA 3U0HA 3QM3A 2DY3A 4JHOA 2ZICA 4LY8A 1DHKA 1QNVA 2DUAA 2GJNA 2OMAA 4MKVA 1DIDA 4AX7A 3EOUA 2DGAA 5EMKA 2R1MA 1LJYA 5I09A 3W38A 2ZUNA 3BOFA 3L2IA 3T1GA 3WH9A 1MW2A 1UWTA 1DKWA 3TJXA 2QJMA 3MWCA 1KCLA 1JI2A 1S5VA 3LLDA 3VNMA 2CXGA 4H9MA 5FJJA 1ME9A 3UJ2A 4RK8A 2Z2AA 3CT2A 5A3HA 4RLIA 1YDVA 2JGQA 3K1DA 3CL8A 1DBTA 3OZOA 1ADSA 1UBPC 4AEEA 4PN2A 3HGJA 3F2BA 3VC6A 2ASHA 2D20A 5I07A 1U83A 2DIJA 3LHWA 3WQ4A 3YPIA 1A53A 4B2DA 2AL2B 1JPDX 5D2TA 2C15A 3WENA 3GC2A 3CUIA 4JX5A 4H7VA 3W2MA 4F2TA 5HK4A 3OZPA 3AS2A 2VT0A 1GW9A 1RJQA 1PZ0A 3W7IA 2B0MA 4URIA 3WEMA 2WAGA 1MW0A 4DXXA 4C6EA 4GO8A 1GVRA 2PTDA 2P53A 4FXJA 1HF6A 4WSJA 3CASA 3FY1A 1J96A 4PMRA 4GZ7A 1B3YA 3MPGA 2QKFA 1XWYA 4PCNA 2I9UA 2VZVA 1K6AA 3KUMA 5FJRA 1W9XA 3S5YA 4WHBA 4ADTA 1J4EA 3D0CA 3CZKA 1AW2A 4CQCA 3VZZA 4H9YA 3R0DA 2P50A 3U3HA 4Q22A 3ZQ9A 1TRDA 2VGIA 1R46A 3EMCA 4XKYB 3VIKA 3FOKA 4L6DA 4ZMGA 1WXZA 3VGDA 2JFEX 2PAJA 4XKMA 4RUBA 5GJNA 1TJ1A 4CCZA 1W5OA 3H6OA 2TSYA 3DI1A 2BG5A 1C8YA 4QGCA 1LT7A 1SO3A 3RX3A 1CGVA 4A2RA 3RUBL 5K2ZA 3QR1A 3NQGA 4PR4A 3HPZA 1W3LA 2VCCA 1D8CA 2BBFA 4MMWA 1ZBKA 2VR5A 4G2DA 4NKCA 3B0PA 3QOKA 2YXGA 3IJ9A 4S39A 1JCTA 3RNDA 5EPDA 1QOQA 1HIZA 4JN8A 4LW7A 1HX0A 3DCPA 4D6CA 1EJRC 4X2RA 3TAOA 2PRLA 3W29A 5GPRA 1UKOA 3P82A 1I6NA 1FP8A 5M5DA 4M6PA 4DBDA 5BXPA 5CH9A 4A3YA 1WZAA 3JW7A 5G1MA 3H2NA 1V6YA 3T81A 2BVWA 4I7UA 4XZNX 5FI8A 3W6MA 4C7GA 3OG3A 2XHYA 2HK0A 6REQA 4WDXA 2P0IA 1WO2A 1XISA 2J9YA 2FJUB 3F03K 3BCJA 1BWVA 1ZTVA 2C13A 5EL1A 3AU6A 3ZJ6A 2Y8VA 2QF8A 2Y7EA 3C6CA 1C3FA 4YWIA 4ZB0A 1IHIA 4Z2JA 4I5XA 4HA4A 3ARUA 4ICMA 4M3PA 2WSKA 3DH7A 3VIMA 4H6QA 2ZKMX 1IZKA 1T0OA 3CHVA 3TK7A 4AYGA 4UMCA 3GR4A 1UW9A 4IMEA 1GZGA 4WY0F 4IIGA 1YADA 2ZE0A 4UIOA 1PHWA 3NSMA 4DO5A 1C91A 2YLAA 1LROA 1HO1A 2TMDA 2IPJA 1ZJAA 4QLJA 1QMLA 3OVRA 1K7FA 1BQGA 5FJTA 1A4LA 3CV7A 1E70M 1EP1A 4H9TA 2OKTA 1CB7B 4X0VA 1VFFA 3PPFA 3DFOA 3UZJA 1IEIA 2PLKA 1TZZA 5U7SA 3UWYA 1QUMA 3LB0A 4ZGYA 3CAVA 2X8RA 4S3EA 3VIPA 1E15A 1NQ6A 4BWLA 1MQPA 4O52A 5LHFA 3S5OA 1S5MA 2ZIDA 3VCNA 1W17A 3O6DA 7TAAA 1GQNA 3STPA 4LUYA 3SN1A 2XTKA 1KC7A 3QQ0A 4IQLA 1U30A 4K6AA 1KNWA 1Q6RA 4AD1A 1XL9A 5G2HA 2J13A 3MO7A 1GHSA 2GQ3A 2WNQA 5F4WA 4LYQA 2ZOXA 1EJ7L 2PRHA 1ISZA 2GOKA 3NZQA 3OYXA 4MNKA 4Q4OA 1Q6DA 4NP7A 3TSBA 1Z69A 1E6SM 4UR7A 2NWSA 2WHLA 5FAJA 1VENA 1YYAA 1BG4A 3P62A 1NY1A 4MB4A 3TNBA 3WH7A 4ZOBA 1HO4A 3GHTA 5FACA 4JNZA 2ZZ3A 3ABXA 1DQWA 4Z1BA 2PUZA 3EWCA 4HHMA 4L9YA 3TN5A 1TPVA 2A3LA 1LWHA 3AMLA 3TN3A 3CL7A 3NM1A 3ARRA 1RLCL 3TTEA 3C56A 4LTSA 4KH2A 1XD0A 2VO5A 4L9ZA 4NU7A 3SFWA 2VDIA 4PUMA 5BRPA 4OTKA 4ONVA 1LOQA 4DN1A 1A0EA 3BAWA 2WSRA 3LCFA 4BHYA 4YVPA 1KGXA 3V0UA 1IXOA 3PB2A 4F0MA 1V3MA 2XN0A 1SZNA 1KFBA 3SUWA 1PDYA 2AQVA 4OGZA 3PC0A 3L21A 3VMNA 3SQSA 2F8QA 3GXDA 3UXAA 1JYNA 3LPOA 3VDBA 2NUXA 1QDSA 2OSWA 1GKRA 3SCNA 3WN6A 2AGTA 3SN0A 1HGYA 3LQGA 1NH6A 1SZFA 1EYEA 3PZIA 3KOZA 4ROQA 1YE4A 1JDAA 3QLDA 3R8RA 3GNPA 1CNVA 3IIPA 4ZB5A 4MHBA 1TR9A 3GNNA 4A3HA 3MUZ1 3KVKA 2BY3A 3FCPA 3W1LA 4DBUA 4YTUA 4GQ0A 8TIMA 1R6WA 4ZXOA 2Z28A 3F2CA 3P60A 1PBGA 4KS0A 4JYEA 1V3KA 2ZRWA 2DSVA 3T0BA 1CGYA 3A3HA 2CZVA 1NF7A 4XQ6A 2HXTA 3TJ4A 1FHDA 3MS8A 3H2EA 2Y89A 4KGLA 3AFBA 3MVTA 4RXGA 8CGTA 3Q4DA 3NYZA 2F2KA 5HATA 1DXIA 3U2EA 1QWKA 3W2LA 3SM0A 3C2RA 5EMMA 1TIMA 2I17A 4F79A 4DJFC 3VDAA 4F9JA 2EPNA 3PBMA 1E1FA 3FDGA 3QSRA 1Y65A 3SSZA 5FSDC 4S3FA 3EB2A 4IL2A 1RH9A 3OA5A 2GWGA 3EX4A 1GZ1A 1DTNA 2E25A 2QLYA 3H21A 1JGMA 1XYCA 1AH3A 4FIQA 4GVGA 4P8WA 1LG1A 4PCPA 2HVNA 1XLEA 5HWJA 3WQVA 3AIQA 4PRWA 3L4TA 3UZWA 2ZUSA 1E51A 4O4WA 5DRIA 2WLYA 1MO0A 1ODUA 3HIJA 4TX8A 4ERIA 2J7FA 4L5ZA 4XTDA 5AHMA 1KCKA 4JTKA 2D2GA 2FLIA 1NEYA 4ZO9A 1A5AA 1N7KA 1W32A 6XIAA 3LXBA 5CJ5A 1A5BA 3PPCA 1HJXA 2PDXA 2VX4A 3KZSA 2A21A 5CZ0A 3NGFA 4XIMA 1PIFA 4HMNA 4UOQA 2AL2A 1DWJM 2ALRA 3T0CA 4KPLA 1BYDA 3TYDA 5D38A 1O60A 3IARA 3W7LA 3MTWA 3RIKA 1ZNNA 3LSCA 3PP7A 1GNXA 5EY5A 4OE7A 4WY0B 3WKZA 3EWDA 2A3EA 4E8DA 4IPJA 5C9ZA 5FF0A 1THFD 3M64A 1A5MC 1KB3A 1GOQA 4PZVA 2GSEA 1PTGA 3APYA 1UB3A 4QDMA 1P0NA 2DZBA 4P8VA 3MHFA 2W66A 4PMYA 5J5RA 3BANA 4U2ZA 2ABAA 1HVXA 4Y90A 2Q8LA 1L6YA 1YBQB 2VZTA 3AS0A 4AWSA 2XIIA 1E56A 2PGWA 4UFKA 2GDUA 1RAKA 4C5ZA 1B54A 4NXSA 2HEJA 4JTIA 4XKYA 4BJHA 3SCWA 1MNSA 1PZ1A 4ML9A 2ICSA 1CXEA 2IXUA 5C9WA 3M5YA 3V16A 1JXJA 3QHOA 4DJED 4HU0A 4J5NA 3W6YA 1BG9A 1VF8A 5HDRA 1H5YA 3THQA 4TVCA 2ESCA 2XFFA 4RE3A 2NQJA 1P48A 4GKLA 1NFPA 1CBGA 3E0IA 3G0XA 4Q3MA 2VC9A 1TX2A 1JDEA 1JVNA 1FVPA 4OUEA 3RYSA 2R24A 2TRSA 1QHZA 3CUZA 4NI8A 1BGAA 4J35A 3PZNA 4LRSA 3THDA 2GGJA 4HOZA 3G1VA 2VOTA 5FD0A 4LV4A 2YW4A 3DOPA 1XC6A 5HOSA 3APGA 2A3HA 1M7JA 2O4QA 4ZO6A 1AFSA 1GK8A 1SZRA 4R33A 3QN3A 3B8SA 4M1BA 3O7UA 1OZMA 6REQB 1OF6A 1GTHA 3QMRA 1MYRA 3KP0A 3BW2A 3WBYA 3KOYA 3W7NA 3B4YA 3E0LA 1M01A 2QDHA 4JY8A 1F3WA 2Y5JA 2ZZ2A 3BOLA 2FYMA 2C19A 1YPIA 4GJIA 1XLHA 3M6DA 3B8IA 1XIIA 3GIPA 1VFTA 1JPHA 1B3OA 1GPWA 3ZT5A 1W9BM 2XDFA 1D3HA 3GBEA 2Z7KA 1JCLA 5HQMA 4A8LA 3LRKA 1VCVA 2CLEA 4O0QA 1C9WA 2YIHA 3CAWA 3FJNA 1U5VA 2NVDA 1S38A 4D71A 3RGTA 3T40A 1JZ3A 2BNJA 3VAVA 4DF0A 2OKOA 1W1TA 3WK1A 2H90A 1XINA 1JQXA 5AC7A 1HKMA 1VPQA 4MKSA 1JAKA 1DXEA 3O8AA 4BQ2A 3SSJA 5B7YA 3IUHA 2V68A 4GABA 4GXPA 2F7FA 3DG7A 2HBXA 4F0RA 3N73A 4N4QA 2GLKA 3LPGA 1JYWA 3VKBA 1R7AA 4PB5A 2BFGA 2DZXA 2QPXA 2E8ZA 3IS4A 1DV7A 2QR6A 3GU9A 2QIWA 3RO8A 4HGXA 3ZT7A 4NYYA 1W9DM 3RCMA 1REQA 3W4RA 3VD9A 1AW5A 4HU8A 2FHCA 4CKQA 3N1AA 1YPFA 1GQJA 3IJ6A 3C8FA 2XVNA 4G5DA 3VCCA 3TP4A 4DXKA 2J8TA 2EJAA 1Z89A 4HZ8A 1E0WA 4IFOA 2FZDA 1DYSA 2RUSA 4RE0A 3SUVA 4ZL1A 3TYBA 2WOQA 2J8GA 1IEQA 3HA1A 2ATMA 2H9AA 3PFMA 8A3HA 4Y96A 5DN1A 3MMUA 4MJ2A 4HPJA 4H7CA 2JF7A 4MZ8A 1G4TA 3AJ7A 4J28A 1E4NA 3M0JA 5ABFA 4GVFA 3NO1A 4HHPA 5REQA 4LEQA 1V3LA 1L8NA 1NSJA 4C6QA 3CTLA 1CLXA 3SJ3A 2H8XA 3SIZA 4XVDA 2Z26A 5D04C 4L4PA 1L8PA 1PS9A 1OYCA 2CZDA 2WMJA 3QSTA 3U8GA 2QUMA 4R9OA 1Q13A 1X96A 3FA4A 1Q5MA 4IICA 4FNUA 3PM6A 4PC8A 4ZQPA 4C6MA 4MWAA 3ZR6A 2OOGA 3GY1A 1XH2A 2QUNA 1QXLA 3WLQA 4UOZA 3B8WA 4HMCA 3N25A 1TX0A 1K7EA 1AL8A 1KRBC 2XWDA 3L2MA 3N2MA 2Y6ZA 3H2FA 1W3TA 1SR9A 2VURA 1S46A 4UTIA 3BLPX 2O92A 1VFOA 3AUOA 3B8UA 4M7SA 2VUYA 3VNZA 1LL6A 1W3JA 2CWNA 3WDJA 3W71A 4M8UA 1KO0A 1VJIA 3D3FA 1DVJA 3TXVA 4CGTA 3S2LA 2E67A 2R8WA 3MUCA 1P0DA 3D47A 1CI1A 1U2YA 4F2BA 1TPUA 4XD6A 1KM4A 3B05A 3BO9A 1I0DA 3FS2A 2NXHA 4KCVA 2V5LA 4UTFA 1K4HA 2OZ3A 1OFRA 3UBPC 2HTMA 4U33A 1GZJA 1S2TA 3INPA 3N2XA 4C1KA 1Y5WA 3AYTA 3AJXA 2PWUA 3V4BA 1DJQA 4GX8A 4IJRA 1V0LA 2C79A 3GIQA 1MUWA 3FAXA 1XYMA 1JJKA 5I78A 4AEOA 3KVJA 5FA5A 5E9XA 4HD5A 1EA9C 1S5WA 1OM0A 1B3WA 4S38A 3UF9A 1XPYA 3EA1A 5HMEA 4EANA 4ERGA 2VYOA 4XD3A 4N9EA 1WZMA 2EJ1A 4M80A 2BZNA 3EOEA 1J12A 1TZ9A 3LTSA 2XN1A 3KVMA 4IGHA 1WZLA 3TJIA 1U33A 3BLDA 4W88A 3GUWA 3SADA 4ZVJA 3NO3A 4UTLA 4ZODA 3C86A 1B1YA 5A5WA 1YIXA 1XRFA 1HG3A 3PNUA 3UNDA 3ZO9A 2OG9A 3F5KA 3P2VA 3RLHA 2V0TA 4EF8A 2ZZ4A 1F9CA 2XFYA 4Q7IA 2GGGA 4NSBA 3U6WA 5H1WA 3QYQA 3GRIA 5TIMA 3TN4A 3AXIA 3T0AA 2FVKA 1OHLA 2OWXA 4NVTA 3VC5A 4X9SA 1MEWA 3S0CA 4EAYA 4QSFA 1KFKA 3M0IA 4TXEA 1ZY9A 5LIWX 4B5VA 1O5RA 1LL4A 2CESA 1O1ZA 3S5SA 2A3CA 1FX6A 2YYTA 1XSJA 5CPQA 3MUIA 4E2OA 1TFVA 3L4YA 3TROA 4ZZ9A 3TONA 3NPVA 4XIAA 4QTGA 2R1NA 4BWLC 1UPMB 1AODA 2Y1HA 2BWGA 4UNIA 2D2OA 3LNPA 2HSAA 1GOOA 2YDAA 1A49A 3SCSA 2OVLA 3WLLA 1V77A 1XBVA 1H2JA 1FDYA 5FF2A 4EPDC 4QFUA 1W1VA 1O5QA 1XS2A 3VPLA 5F2GA 4NASA 1Y0EA 1H11A 3P5YA 1QI3A 1LUCB 3L12A 4D6FA 4NQ1A 1T41A 2FGZA 4S3GA 3SECA 1RVGA 2PE4A 2QCCA 1B30A 4YN5A 2HROA 1EZWA 4LUTA 3RCYA 3BOXA 1R9ZA 4NXKA 1MDLA 3UNTA 3R79A 4B5WA 3GQYA 4EWJA 4Z1YA 1U5HA 5I5RA 4JBRA 3SCRA 4FSAA 4GH3A 1JRCA 4OUIA 1DOSA 4J3VA 4FZIA 6CGTA 2QPUA 3GFXA 1QK2A 1UWQA 2ZBTA 1KR1A 2J27A 2PDCA 1WKFA 3UT0A 1ME8A 5C0QA 5JIWA 4JOMA 4MDPA 1NARA 4X60A 3W02A 4JIQA 1DWGM 3MDWA 2Q02A 2VCBA 3CEUA 1E4IA 1OFDA 4KQNA 3WQFA 3UG3A 5BYWA 1NOWA 4MF4A 1ZJIA 4LAMA 3AXKA 1OZQA 3PG8A 4DWSB 4C6LA 2ACSA 5A2BA 3OJGA 1GJUA 4JFWA 1K8XA 2A2IA 5IDIA 2RHGA 3EKLA 1MI3A 2RFGA 2IKHA 2J9XA 3WO8A 5HJLA 2VQTA 3VTRA 2I56A 4L6HA 3OHMB 3SEPA 1F6KA 2QV5A 1HXJA 3LM3A 2D2JA 1I45A 5A6BA 1CX9A 2HDJA 4LX4A 2WM0A 2OZ8A 2QMKA 3MMTA 1AH4A 1B57A 2Z25A 3DHFA 2OEKA 1VBJA 3KLLA 3RLUA 1QU4A 3V0SA 3CJPA 3QC3A 3TUUA 2A1YA 1L2QA 2ATSA 2Z1WA 2Z1KA 3K8KA 4LBSA 1XW8A 4FX7A 3IVUA 3OIHA 1E5JA 3MJMA 3NQ2A 3CH9A 1EEXA 3A6OA 1Z32X 4Q8WA 1YW1A 1J5TA 2OLAA 1HUVA 5AYYA 1QFEA 5LA2A 4NNCA 4PMDA 3PB0A 1I2RA 5KZMA 3ZJ8A 5LXEA 4BF9A 2PP3A 1CB2A 4R5EA 1Y8BA 2NQZA 4GJ1A 1PB0A 4INFA 4IUGA 3WEZA 3RX4A 1EBHA 2YKKA 2FPVA 1GKPA 2PZ0A 1B4KA 1K8ZA 4EX4A 5FEPA 1KD0A 4CN4A 2J4GA 2AMXA 2IS7A 1I0BA 4UB9A 5AC6A 1OINA 1PE1A 1DXFA 1JPIA 1YTEA 4CQAA 2LLEA 1MDRA 4GIEA 2BS9A 3A23A 1W3HA 4CNOA 4DJEA 1TWWA 3DX5A 5ABFB 5HJXA 1R38A 2PTWA 4Q4MA 1B0IA 3QVQA 1PEZA 3NVDA 4PB4A 3L23A 3RDKA 4Q32A 4AQLA 5HR7A 1OFEA 3P0WA 1MFVA 2F61A 5A8QA 4IF2A 1WKYA 4MB1A 1FDJA 1GONA 3BMWA 3TZFA 1ZZMA 4A8IA 1CLKA 3T6CA 4AD3A 2G4JA 3ARZA 1M68A 1GJPA 1OX6A 3P84A 1RR2A 4AHQA 1FCUA 4ORMA 4GBDA 1HL2A 5F7UA 3MV11 3TQPA 1ZENA 1U5JA 1C8XA 5F1VA 1I8JA 4Q7BA 1OSEA 3BURA 1M7OA 1G9HA 3ZSSA 2G3MA 1QO5A 4IIBA 5F4XA 5HPOA 5KMYA 8RUCA 1LRTA 4MFDA 4MNLA 1BD0A 3MUXA 3GU2A 2ZTKA 2XH0A 4JGDA 1M1BA 1EX5A 1OG6A 3SY1A 1KGUA 3LNMA 4J1OA 3AUJA 1CGTA 1TPEA 4EPBC 3ZM8A 4JQAA 1PKNA 4WF7A 5CSUA 2Z2UA 4EP8C 3KBWA 3TOYA 4C1LA 1R3WA 2PDHA 3DI0A 1QWGA 4E6MA 3AIRA 3W73A 3O6AA 3EWUA 2G37A 2C7FA 4LXFA 2DSZA 2YJQA 4GE8A 4S1FA 3NQBA 3K30A 2CLKA 2XZ7A 4S3DA 4KEMA 3K4WA 2ZUUA 2DJXA 4KWOA 5H8PA 4GISA 3H2OA 1NWSA 3VOHA 3VDHA 4CNSA 2EF9A 3O15A 4PSRA 3C4UA 2WV8A 2OQLA 3SZ8A 2VI0A 3GDMA 1G7VA 1BPLB 1CENA 3BJTA 4FK9A 7A3HA 5ABGA 3BGAA 3M1ZA 2WNWA 3GVVA 3UD6A 1NF0A 1KV5A 1WB0A 2OEJA 3AZSA 5CPOA 2QGHA 1P1MA 2YA0A 1HKWA 3GBDA 3MMDA 1ZSXA 3A4JA 3P80A 4XO7A 4MAVA 4GUHA 1VZWA 2WWCA 2ISDA 5JBDA 1W2VA 4O4VA 1JNEA 4MWAE 4ADSA 3ARYA 3PULA 5DEZA 3V3WA 4BCEA 1ODZA 3RAOA 4XBSA 5E5CA 2V2HA 3ISIX 1D7KA 4CU6A 2F38A 2X09A 4IQDA 1YXYA 1AD1A 4Q6XA 2YGYA 3KL0A 4DM2A 5CAKA 3AROA 3LZ5A 1EJSC 3EAUA 3UCQA 3SQMA 4UTTA 2Y85A 1N2VA 1H1ZA 1XBXA 1U1UA 2OLHA 3W00A 3AIWA 4FOKA 3W7DA 3ME3A 4CCCA 1GOMA 2FDMA 2VDHA 3WLRA 2OX4A 3M5ZA 3SCOA 3V5CA 1UZDA 3G0UA 3LCHA 2FB2A 4LAKA 1QVBA 5A6MA 1H63A 1M65A 3GTHA 4IHCA 3FA5A 1TJ0A 2YBUA 3W76A 3URQA 4LUJA 5AOUA 3WQPA 3CQJA 3G2GA 1V0MA 3E5PA 4JIPA 2DVUA 6TAAA 4R9XA 3LY0A 1XICA 1E6RA 1KA9F 1C90A 3LPFA 4AIOA 5BXRA 1V6XA 4FXFA 3SGGA 4DWSD 4PE8A 4F9DA 1EYWA 3SN4A 4JTLA 4PRTA 5KINA 1E6NA 3L66A 2Y2WA 3LTYA 4NNAA 2VP8A 4H6EA 1R86A 4GLEA 1VYSX 5E6ZA 4YPJA 1VS1A 3ZYZA 3TW6A 4IMAA 1NWUA 1A5NC 3RJXA 1W8GA 3AYRA 4JYFA 1XP3A 3URNA 3BLKA 4DJDA 4XO6A 1RXOB 2ZX6A 2HZGA 5J5DA 2PWFA 1SJCA 1PX3A 2Q3OA 4UZSA 1WKDA 3LM7A 2DVTA 1N8FA 3DECA 3MWAA 5DMMA 3I6EA 4FLRA 1RQHA 5TF0A 2WB5A 4ERAA 3OB8A 1D9EA 4L80A 2G41A 3G24A 2O9PA 3KZPA 3WUGA 2XPKA 1AZ2A 4HHHA 3KEHA 4US5A 3CHFA 4AZCA 3HGOA 1LLZA 3W1TA 2J79A 3C0LA 2WW5A 2GK1B 3WQCA 2QPSA 4J3XA 4N6EA 1KTBA 5I24A 1QI5A 2CZ5A 2R1LA 1Q6QA 3LXCA 2J47A 1H1NA 2FPYA 4KWWA 3QFEA 5FCZA 4ORIA 1MWOA 3GLCA 2XVLA 3A4AA 1F8IA 1KFLA 3QTGA 1Q4NX 1C9DA 3QZ6A 4G8TA 5DLCA 4K8HA 3AICA 1CYGA 1Q2SA 3WNMA 5DCDA 4D1IA 7ENLA 1G5AA 3ITXA 3N9RA 1ISYA 1H62A 4JTSA 3IGSA 3OZMA 1MFUA 5AC8A 1H51A 2FIQA 3GG8A 5LIXX 3AMDA 3UPWA 3VO0A 2PGFA 1M5WA 2VFIA 2OT0A 3CPGA 4Y9MA 4ZOCA 1EDTA 3H70A 5A6LA 1JUKA 3R4IA 3I7QA 4MLJA 1PV8A 2BVDA 4FR1A 3OVPA 1V79A 5M1TA 1EF2A 4CNNA 4V1XA 3CEPA 4IPLA 1F4HA 1VGAA 4UNKA 4GYJA 2PP0A 5DMYA 2XUCA 3MP3A 4NX0A 3W87A 4X2PA 3G18A 3K5XA 2Z6IA 1EJWC 3CMJA 2BHUA 4B9YA 2NQHA 4S3JA 2C1GA 2F84A 1WUFA 2ZCGA 4XWUA 3O0FA 1RQEA 3H2MA 4JPGA 4CQ8A 2ZUVA 1JYXA 3R11A 3ITOA 4MYXA 1BGGA 2IXVA 3M0ZA 4LVGA 4AWTA 3GTNA 3OZYA 4PCSA 2XFWA 1JZ6A 1OX4B 4JTQA 3TKFA 1PPIA 3W07A 1TWSA 4AXNA 5IFPA 1UIPA 1N8IA 2ZUMA 3EOLA 1E0UA 6XIMA 4WOQA 4DLFA 2XSAA 4PSPA 5CEWA 2DQXA 1QNSA 2VEKA 4LGXA 4LB3A 4PB3A 3SUTA 1TO3A 2IPGA 1HL9A 3EPNA 3WJXA 1GG1A 1SJBA 3S6OA 5AKQA 4GY1A 2KAUC 1F6YA 1QO2A 1BRLA 3S2JA 2X7WA 1ESWA 2D23A 4G56A 2HCVA 5C54A 3QPZA 5D05A 3DYMA 4TV6A 2DEPA 1KFEA 2E7FA 2OGYA 4XZLX 3VXGA 3UERA 3N2CA 5BROA 4C6DA 4E4FA 3TA9A 1HNYA 2PWHA 4QQUA 3N6HA 1XLBA 4QP0A 3R58A 3THAA 2CLIA 1F07A 1RJRA 4G6CA 4GH1A 1J79A 3VZXA 2FMNA 1IF2A 4YYCA 3Q67A 1UZHA 4A29A 3BGJA 4WDUA 1BKSA 3VOGA 3I6TA 3OQEA 3L4WA 1EIBA 2D2HA 1KRAC 3UWZA 1XSKA 1POJA 1P7TA 3HURA 3UR7A 2QUVA 1ZU8A 1SW7A 2VFDA 3UXDA 3WF4A 1PYFA 1PZ3A 4NZCA 1K8YA 1KW1A 2WJZA 3ID7A 4IX0A 3RR1A 1TCDA 1CTNA 4ACZB 1XXXA 3ERPA 4UTTC 4Z1DA 4AHOA 4HHLA 3NJ3A 4HQVA 3ARSA 5K9DA 1IT0A 2Y8UA 1JCMP 4PL1A 3UXKA 2QDGA 5B80A 1CWYA 4PCTA 2VFHA 1RZMA 2X0SA 3UR2A 2GVGA 1H09A 5EA9A 4N0RA 4GVIA 2WSYA 1GT8A 5A2CA 3ZJ7A 1E9IA 1YTKA 3QGKC 3UWVA 2YL9A 3SCUA 2PDLA 3MZ2A 4I8YA 2WC3A 3M6YA 3E02A 1W9UA 2HPMA 3LBMA 4R7OA 5HINA 5L6UA 3VNDA 3LPPA 1ZAIA 2EPLX 3FLUA 5DO8A 5E70A 4JFTA 3BGGA 2CLFA 3TCSA 4LPCA 4H2HA 2VKZG 5I7GA 4QG9A 1HJVA 3TC3A 3NZGA 4JTJA 2AQWA 2CNCA 1SM9A 3WQEA 1T5AA 1B3ZA 3IJIA 4LUSB 2VDGA 1UQYA 4MUPA 4KCUA 4D9PA 3N4EA 3NQMA 2JKEA 5K9XA 3S1GA 4DNMA 2QEZA 4R3UA 1NDVA 5AC5A 1OYAA 4Q8MA 3C8NA 1HP4A 3E1F1 3ES7A 1TMQA 2PWVA 3FHAA 3PNZA 3F2DA 1YTDA 2X2YA 5REQB 2QVHA 2HMCA 4K8GA 1WBJA 1RA0A 2PDWA 2NWRA 1LM1A 5F2LA 1RLDA 1S5NA 3WH8A 3BWWA 5CGTA 3COTA 3STEA 4ASTA 2NV2A 2REQA 3LCIA 5CG7A 3G1FA 3WQGA 3OLIA 1S2WA 3PSWA 3W7MA 3W7CA 3IUIA 4H6KA 3P5ZA 3HU7A 1I2QA 1ISXA 4IGSA 2Y63A 3MUY1 3JZUA 2W9MA 1JCYA 3M9YA 4H1ZA 5HBFA 1XIDA 3LG3A 5D02A 4YJ5A 4RPPA 3VE9A 2Y62A 1X1OA 5GNZA 5KITA 3N3TA 2XGBA 3O05A 3RU6A 4IMCA 4IFKB 1MW1A 3CQ0A 3MZNA 3A47A 3QHMA 2BXVA 3VNYA 3ITTA 1TUFA 3HQNA 1NDYA 2X7VA 1E71M 3VUSA 1H7NA 1XX1A 1CDGA 2WMFA 1BKHA 5A8PA 2A4AA 4KFOA 4HKPA 4ZTYA 3ITCA 3IJLA 4Z2KA 4OU1A 4PODA 3CT7A 3CL6A 3E74A 2VD8A 1QBBA 2CBJA 4I90A 3KOWA 4GC3A 3HMJG 2WCGA 4H83A 2OPJA 2PP1A 3WK3A 3STGA 3IK4A 4N6FA 2CLMA 2FTPA 4QDWA 5DBTA 3DFHA 5EFFA 2PGRA 3VX1A 3MBDA 1ZJBA 4LBUA 1FHVA 4Z2LA 5CLTA 1OFBA 2NT0A 2X0HA 4B4FA 4AYSA 4HPXA 4N2YA 4LRTA 4NT0A 3APTA 4MJZA 1HVQA 4PBFA 2VX6A 1X6UA 2ONEA 4BA0A 3TXZA 2D1ZA 4KWVA 3L68A 4PUWA 4ECLA 4QJ1A 1EO5A 4X9YA 2QJJA 2FZNA 2Z4GA 3A3WA 2POTA 5DMNA 1NM9A 3NQ6A 1QNQA 4WLCA 3K4AA 2YZ5A 3HF3A 3P8IA 4YYFA 4Z1AA 4B91A 3PY2A 3I7RA 3GYCA 6ENLA 4ZTXA 4M7TA 7ODCA 4D6GA 5LHEA 2IKIA 3KFTA 4E38A 2V30A 2VOMA 4XUYA 3W88A 3XIMA 4MADA 4B5SA 2HRWA 3GVWA 5AN7A 4UTUA 4YWSA 6A3HA 4GHRA 3OGSA 1KKOA 4G7EA 4QG8A 3S1VA 4LANA 5EU9A 1PSCA 2RGLA 3NSNA 5T9BG 2INZA 2XVPA 4KEVA 1NP2A 4L1WA 1ZL1A 3WLHA 2DJLA 4E2DA 4Q8VA 1K6WA 1ICPA 3BSHA 3MI2A 1PAMA 3WNPA 1I4NA 3HM7A 2BOEX 2ZXBA 1ITQA 1BRLB 5T8GA 4ZQCA 3HPAA 3UVAA 3HBLA 3CBWA 1NDZA 3TNOA 4UTJA 2VGFA 3GDKA 3ALGA 2ZVRA 2P5NA 3RM4A 4J40A 2QCNA 1FHLA 2GWNA 5H8MA 4HMEA