3EXTA

Crystal structure of kgpdc from streptococcus mutans
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
218
structure length
211
Chain Sequence
b'QLPNLQVALDHSNLKGAITAAVSVGNEVDVIEAGTVCLLQVGSELVEVLRSLFPDKIIVADTKCADAGGTVAKNNAVRGADWMTCICSATIPTMKAARKAIEDINPDKGEIQVELYGDWTYDQAQQWLDAGISQAIYHQSRTWGEKDLNKVKKLIEMGFRVSVTGGLSVDTLKLFEGVDVFTFIAGRGITEAKNPAGAARAFKDEIKRIWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RmpD (Hexulose-6-phosphate synthase)
publication title Open-closed conformational change revealed by the crystal structures of 3-keto-L-gulonate 6-phosphate decarboxylase from Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Lyase
total genus 80
structure length 211
sequence length 218
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3extA00
1GVFA 1SZFA 5D2WA 2DJXA 3L9CA 1QO5A 3HPXA 3LXAA 1ONRA 1QWGA 2CLFA 4O0KA 3BG5A 3EWUA 2DZPA 1WDWA 4YLWA 1V5XA 2WOQA 4UR7A 3G0UA 3LGEA 1F74A 1JR1A 4XQ6A 2ZRWA 3I7SA 2B4GA 3W7RA 3NQDA 2J27A 2Z6IA 3QH2A 4ADSA 1TPDA 2HS8A 2CZDA 1M5WA 2QCGA 5DELA 3FJLA 4JYDA 5FEXA 4FO4A 4HNNA 3E96A 4FHAA 4MJZA 1LCOA 4JIQA 1HL2A 3LX9A 4MUZA 2RFGA 3R2GA 3NM1A 4N4PA 1WYIA 4N6FA 5AC6A 5G2IA 4R34A 2GOUA 3L5AA 3ATYA 1OK4A 3HG4A 4DF2A 2YZRA 3QMTA 3RMJA 4AEOA 1XUZA 2QJIA 3KRUA 3CIWA 3S1WA 1GTEA 1TPB1 3I7RA 5D04C 1Q45A 2HTMA 1IXNA 3DFTA 1LOSA 1KFJA 1ICQA 2VFHA 3W23A 3IIZA 4RZ4A 4RR4A 1AMKA 2FLIA 3FS2A 1A53A 2Q3RA 3M16A 3B04A 3W22A 1TB3A 1OK6A 2V5BA 3CLMA 4IMEA 4OHQA 2YYUA 5K3VA 1QPQA 3SGUA 2WNQA 5K4XA 4NVTA 1TPEA 1ZJIA 5LNVA 4FNUA 3W71A 3W1LA 3P8JA 4O10A 2RDTA 5I3JA 1HTIA 3W9ZA 1UJPA 3R89A 2VEKA 5C54A 5F2LA 3C6CA 2A7PA 3EWZA 3RFAA 4UTUA 2X1SA 3C2VA 3TQVA 5HWJA 3T40A 3ZS4A 2YSWA 3OIXA 4N2YA 3P84A 4M5PA 4NQ1A 4LVGA 4O15A 4AF0B 4O4WA 3LB0A 1S5WA 2ZRYA 4X2RA 2P10A 2DP3A 4MVAA 1BWKA 4Q33A 3LM7A 3FA5A 1VHNA 5AN7A 4EF8A 1KM2A 4FXSA 3EEGA 5G2WA 2TMDA 4K38A 4ZQNA 4ZVJA 1BTMA 2E5CA 3IIXA 3OA3A 3F4NA 5AHNA 2CZFA 5ABTA 5F4WA 1ZFJA 4MYAA 4ZQMA 3TCEA 2GVGA 4UTTC 3CIXA 1Z42A 3HB9A 5I3IA 3G24A 1I2NA 2H3DA 1N7KA 3AJXA 5HULA 1SFJA 3LCGA 1DQXA 1EUAA 2H8XA 3NNTA 3NR0A 1YXCA 1B3OA 1TTQA 1LOLA 3V1PA 3L65A 3LI0A 3EWBX 2DORA 4IJBA 4K36A 5AHIA 5HR7A 5AYYA 3ABSA 3WJSA 2QJGA 4MLRA 1ICSA 3CB8A 4TO8A 3O06A 3T78A 4N6EA 5D2XA 4HNTA 1VGAA 4JTUA 1WOAA 4N02A 2FB2A 4A21A 3A9IA 2Y7EA 3GDMA 2IQTA 2QCMA 5MHBA 3MJYA 5BRBA 3I6RA 4UC5A 5E0KA 3HG2A 1I2OA 3SECA 1K3UA 1KA9F 2G97A 2A0NA 5KZMA 4JTFA 4WOZA 2YCEA 3M5XA 1KV5A 4WD0A 2VC6A 3W2JA 1EIXA 4ZQRA 1HO4A 2J9YA 4P61A 2FQIA 2WKJA 4UTIA 1KLYA 3DFQA 3PUEA 2QEZA 4PFMA 3LTYA 5HWNA 1A5SA 4AHPA 1OFAA 2NWRA 3OHIA 4MZ1A 1TQJA 2B7NA 3WJYA 4LW7A 1C9DA 4R53A 4X22A 4UUIA 3DBPA 4JTHA 5IBXA 3CEUA 3QM3A 5EKYA 1D9EA 1H1YA 1WAUA 3M6YA 2A6LA 2H8ZA 3L0GA 3E12A 4WX2A 3VKJA 3HQ1A 1EPXA 3TV8A 1R2SA 3M47A 5A8GA 5CZ0A 2GPTA 2D73A 3TAOA 5IM51 4XUGA 4MIMA 1TV5A 1VZWA 1H5YA 1OHLA 1U83A 1Q6QA 1ML1A 1W5QA 1VPXA 1YDNA 2NUXA 3ABRA 3VNDA 1KBJA 3GDLA 4IXHA 3GDRA 3LCHA 3C3NA 4DPQA 1YDVA 1AL7A 4JY9A 3GDTA 3ZR4A 1L9WA 2CU0A 5AOUA 3S42A 2BWGA 3E9AA 1F6PA 2VFEA 3S1XA 4DO5A 1E51A 5F2IA 3KRSA 5FF7A 4K7VA 1ME7A 5CPNA 4GUJA 2V81A 2RH9A 3MHFA 3PAJA 2G96A 1W37A 3NQCA 4NX5A 3M44A 2J6XA 3PBUA 4E2DA 4QNWA 3GVGA 1UBSA 5D2TA 3PUOA 4NXKA 1RZMA 3EWXA 1JCNA 3N19B 4AVFA 2ZA3A 1DJNA 1JUBA 5DY3A 2PC4A 2NV2A 3TKFA 2OCZA 4UIOA 3IVUA 2VKZG 2CZEA 1K7FA 2A21A 3A5FA 1GPWA 3HPZA 3W88A 3NM3A 2R14A 3DH7A 1JVNA 2YDAA 5AC7A 1QOQA 1K8YA 1ZCOA 4H6KA 4UFIA 1PCWA 3KFTA 3IEBA 1Z41A 3PUDA 4LUIA 3BLIA 3CEPA 3HGOA 1JRCA 2OMAA 4A29A 2VEMA 2QJHA 1TJRA 4BI7A 2A6NA 4O1BA 4XKYA 1DKWA 4GE8A 4Z0JA 2PRHA 4DPPA 1UB3A 1XCFA 1A5CA 1TREA 1QPRA 1AL8A 1HFBA 4KFNA 5C2XA 1YDOA 2Q3OA 4YXGA 5HWMA 1DHPA 3CQ0A 4UFHA 4MY8A 1K03A 3KVJA 4YWIA 3W85A 1J2WA 4ONVA 5AHLA 1EWDA 3TXZA 4TU1A 1OFPA 2PURA 3UXDA 3EX6A 3GK0A 2GQ8A 3W7IA 1FWSA 5F4SA 1SU5A 3C2EA 3G1YA 4IMFA 3F4WA 2E6DA 1NAL1 2B7OA 3UY7A 1TO3A 2ABAA 1XM3A 2VFGA 2V0TA 4FIRA 3DI0A 5DCBA 3TX9A 3TAKA 1PIIA 2X1UA 3S9YA 5C6MA 4M6QA 5D37A 1YADA 5KSWA 3HMJG 3CC1A 1LBMA 2Z6JA 4MFEA 5DCDA 3GX9A 5KZDA 4U28A 4LUJA 3ANYA 2ZTJA 3LCLA 5CZSA 3B8DA 4E38A 3TQKA 4JIPA 4XBSA 3LHVA 1SFLA 2JGYA 1OABA 4DF1A 3W2NA 3L5MA 3NAVA 2RHGA 1T0OA 3U6WA 1JUEA 3TUUA 1VCVA 4OBTA 4O28A 1K7XA 3G0SA 1XBZA 3BVJA 5GVJA 4XTDA 2V9DA 2Q8ZA 2XN0A 3LXCA 3UY8A 1EA0A 4NJHA 4JDYA 3RF9A 1K02A 1O94A 3EWWA 4O4VA 1Z44A 2GJNA 1L2UA 4DQWA 3EX3A 3STGA 2XN1A 1WQ5A 3HGRA 5LZLA 2Y7FA 3JR2A 3NDOA 4I7VA 3OG3A 4O17A 1OX5A 1JUKA 2ISWA 3EKZA 1VH7A 3P80A 1M7PA 1K8ZA 1SW0A 4CQ9A 4LV4A 4NZJA 3WFAA 1I45A 3M5YA 1KFCA 3UWYA 6ALDA 4UXDA 4UFJA 4ADTA 2ATSA 5DN1A 4QM1A 2P0OA 3NEVA 3HG5A 2WSRA 4O57A 3M5VA 5DBUA 3LBMA 3HGSA 4LVFA 1GZGA 1G6CA 2TPSA 1KTBA 3SJ3A 3QW3A 1ZY9A 4E0CA 3NPVA 2TSYA 1Q6OA 2QUVA 3MP4A 5AC8A 3FIGA 3RLUA 2C3ZA 3L21A 1LORA 3DKJA 3LOTA 3WJWA 7TIMA 2BX7A 2QCDB 1PE1A 2E6YA 3HG3A 2H6RA 3P67A 1TRIA 2E68A 2ZZ1A 3BO9A 1OX4A 2FPYA 3NL5A 1LBLA 4GC4A 1O5XA 2Y7DA 1TV8A 3TMQA 3TFXA 1LLZA 1S5TA 4QNEA 1SO6A 3I65A 1TPWA 1MSSA 1PHQA 1LBFA 3K30A 3UPWA 4POCA 4UR8A 5L6UA 4GWEA 1H50A 1SQ7A 2OX1A 5LKYA 4PEKA 4LV9A 4JN6A 3DFOA 4RJEA 3W7EA 1GWJA 2W0UA 2ZBTA 4JTTA 4W9TA 2WNNA 4M6VA 4O8RA 2O7SA 2FTPA 5DXYA 1X6UA 1ZNNA 3W70A 2ZZ5A 2BLEA 4UNLA 3DHDA 3W1RA 1V7YA 2VELA 2C13A 4GNJA 3A5VA 4UNKA 3NPWA 3W6YA 4MY9A 3CHVA 1H7PA 3MP3A 1R2TA 4IMCA 1VCGA 3FFSA 2EGZA 3G3DA 3CWOX 4MOZA 3WK3A 5U7SA 1ADOA 1RR2A 4ZQOA 4ALDA 4FEZA 1WV2A 4C1KA 3W2KA 1P1XA 1X1OA 3T55A 4JTIA 4K8EA 3TSDA 1TRDA 1W31A 3STEA 1OJXA 1D3HA 4HN4A 3LXBA 4FX6M 4CCEA 5AYXA 3B06A 4DO4A 4PC8A 3W1PA 3S5NA 1H7XA 5LSMA 4AHQA 4HNVA 1MO0A 3SY5A 1T96A 3CPRA 3N9RA 4UTWA 4TMBA 1CW2A 3ELFA 1YTEA 1OX6A 1H60A 2E6FA 5CG7A 2P1FA 1M7OA 3TIMA 1QPOA 3PBWA 1IXPA 1W1ZA 4JTSA 2NXIA 3MMTA 1PCKA 4O18A 4RKAA 3CM4A 5T26A 2YX0A 4CQ8A 1VRDA 1JCYA 3MI3A 4WY0B 1LDCA 4QSHA 4KWVA 2TYSA 4CNPA 4FXRA 4X9SA 2Y62A 1H62A 1YXDA 4TR9A 1YXYA 5J5RA 3C2FA 3C4UA 4H3DA 5C55A 1F6KA 2YPIA 5CPLA 1YYAA 2VFFA 5E93A 1LOQA 4M6PA 4O1CA 3O8AA 4Q32A 1TV7A 4BFAA 1QDSA 2QAFA 5CKSA 4UTHA 1EEPA 4PH6A 3EB2A 1KV8A 1O95A 4Z0SA 2FPVA 3L2IA 3D0CA 1TPC1 3N73A 2WQPA 2ZTKA 2V30A 2ZZ6A 3NQVA 1TQXA 1KTCA 1PVNA 2BTMA 4JX5A 4L4LA 3NYZA 3GR7A 1W0MA 3Q94A 4P2VA 2J88A 2EPHA 5K9XA 1FCQA 3OVPA 1TCDA 2NWSA 2X2GA 2CZ5A 2FJKA 3R13A 4IX2A 4NJGA 1MXSA 4O16A 3W72A 1AW1A 3O05A 3UNDA 3UPBA 3WK1A 2A7NA 2JKEA 4S2BA 4ZL1A 4A3UA 3DHFA 1OYBA 1XKYA 5EBUA 1DQWA 3M9YA 1EB3A 3R12A 4GUFA 4LTSA 5EA9A 2CLEA 5D09A 1OFQA 3I7QA 3W7GA 3C8FA 3P60A 1ICPA 1VHCA 3THQA 3A21A 4ORIA 2Z1BA 2QCFA 2OT0A 1FWRA 1NSJA 3BGJA 5D32A 5HNRA 3LTPA 2JBMA 1TTJA 3PC0A 1TIMA 4XWUA 2WJZA 5HR6A 4JYFA 5DCEA 4GJ1A 1DV7A 2F84A 5DLCA 3IVTA 4AB4A 2WO5A 1LRNA 4RLIA 4RX0A 3I68A 3SI9A 3NA8A 5AHFA 3E02A 3EXRA 2VFIA 3FKRA 1I2QA 4NXSA 2X1TA 4LVDA 1BKSA 1VYSX 5D30A 4UTJA 4K37A 5KMYA 3W1AA 1F05A 4H4IA 3LRMA 4PTNA 1GYLA 3TA6A 1TYGA 3LBCA 2YYTA 1NF7A 2XFWA 3O16A 3LHUA 3LTSA 2V2CA 4IXXA 2NUYA 4O52A 1B57A 4X3ZA 1OG0A 3QSRA 1L6SA 3YPIA 4NNAA 3PB0A 1QPNA 5DY2A 3S5YA 1FCBA 2QDGA 4Y8FA 2VFDA 3LHYA 4JR5A 1U5JA 1LTDA 3MUXA 5AYZA 4BWLC 3S0CA 3ABOA 1GVRA 3PSVA 3QQ1A 1P0KA 2QDHA 3NL2A 3S5ZA 3TQ0A 3L0NA 3QSTA 3W76A 3NGJA 2QCHA 2C1HA 1GJPA 3PBYA 4WY0A 5DXXA 3P7YA 4BI6A 3C0JA 4JTJA 4OE7A 1GQNA 2V5LA 1XDLA 1OF8A 3V75A 4MZ8A 3T4CA 1LROA 3USBA 3UXAA 4AXKA 3SR7A 3E49A 2A1YA 4FNSA 4K39A 3LHTA 1H61A 3LCWA 4NT0A 1SZEA 4FX8A 1B9BA 1G4PA 4O19A 3NQ2A 3SGZA 5KTLA 2B7PA 1O5KA 3VCRA 1B4EA 3GZ3A 1TMHA 1K7EA 2YFNA 1VYRA 3NZRA 5AFDA 4OQVA 3PG9A 1LM1A 3PVFA 4FNRA 4HHPA 3QMSA 5D03A 5E1QA 1VYPX 2NLIA 3O6YX 3U8GA 3PR2A 3HOJA 3TE9A 2YFOA 3KX6A 3IIPA 1WBJA 2ZQ0A 3B0VC 3GKAA 5HJLA 5TQLA 4Q4KA 2NX1A 4AF0A 3DAQA 4N4QA 1ZAJA 1NEYA 1AW2A 1Q6LA 3BPWA 3NQ7A 3PY2A 3DXIA 2AQWA 2FPTA 3MHGA 3M43A 4MJMA 4D2JA 1EP2A 4GUIA 3H53A 1TPFA 3LDVA 3W7JA 5I3KA 4AAJA 4HSNA 2ISVA 4E2BA 2CW6A 2FFCA 1T99A 2C16A 2NV1A 3TFCA 5J5DA 5KZEA 2ZA1A 1M6JA 5G5IA 1KM3A 1NFBA 4RXGA 3FYPA 2R94A 3G8RA 5K9DA 4JX4A 4MLJA 5F4XA 3N2MA 4ZQCA 5TBOA 3UQNA 3EKLA 1F2JA 2W79A 1QAPA 4HKPA 3FJ6A 4L4MA 1KTNA 5K9CA 1UUOA 1RQBA 5FESA 3TC7A 3TK7A 3W7DA 3W7HA 2R8WA 3NQGA 4O53A 1DL3A 1IIHA 2GVJA 4AHOA 1OYAA 3G8EA 4UTTA 4IPJA 1W3TA 3HF3A 4O50A 2Y88A 4JEQA 3B4UA 3UWZA 2RDWA 3P8IA 4EWND 5BMWA 2FB3A 2ZA2A 3STFA 2I14A 2HMCA 3O07A 2DJLA 1FXQA 4YCPA 1FWTA 3TNOA 5KINA 4RV8A 4UTMA 1EWEA 5EYWA 4FNQA 1RQEA 4N9EA 3P81A 3TXVA 2JKAA 5CZJA 2GQAA 4O14A 4PODA 3GKFA 2UV8G 5LNUA 4LT9A 3TJXA 4FX7A 5I3FA 3C2RA 3W7CA 1VCFA 1FWWA 1GVSA 3O6CA 1J5TA 4B5NA 3EX2A 3TSBA 3TW6A 1YPFA 3GR8A 4ZQPA 1G4SA 1R46A 3PWAA 2DZVA 4FNPA 4K8HA 5EL1A 3STCA 1G7UA 1QMLA 5HUOA 5CZTA 1F7BA 3PM6A 1R30A 1N8FA 3EX4A 2Y63A 2V2HA 3G1FA 3S6DA 3P5YA 4UFKA 1XC4A 2Z0IA 4Z1DA 4JGDA 1MEHA 3L67A 1SW3A 1OFDA 2KZHA 4TMCA 1AW5A 2Q8LA 3NO5A 3GYEA 3PB2A 4IGHA 4YL2A 3BK0A 4RXFA 4JTEA 2E5BA 4KKXA 3CTLA 2H3BA 2HS6A 2QAPA 3UWUA 3OVRA 5HUPA 4FNTA 2C19A 2EF9A 1TPUA 4TIMA 4NNBA 3HJZA 4UFLA 5D05A 1KM6A 1OVDA 3W75A 2J9ZA 3RU6A 3A23A 4O0ZA 2C0AA 3BW4A 1P5BA 1LRQA 2WSQA 3N9SA 4UTKA 1VQTA 2EHHA 5F2MA 1O4UA 4GUGA 2WNZA 2EAWA 2BSLA 2TRSA 1TPVA 1SO4A 3DGRA 5BMXA 1D3GA 4JTGA 2CLLA 5CPOA 3W2LA 2F7FA 3BLEA 4J9JA 4IOTA 4JD4A 3KXQA 3QMRA 3P5ZA 2YW4A 5K4ZA 4LU0A 1JULA 5EPDA 3HIJA 5FEWA 2E6AA 4JNMA 4GUHA 2E1DA 4K7YA 5C5YA 4CLMA 2AAMA 1G67A 1K8XA 1SPQA 3RK8A 4Y9AA 1XDMA 2BXVA 3E0IA 3W7QA 3KHJA 2I1OA 3G1DA 4Y90A 3T7VA 2CLIA 3LCFA 1MZHA 4PA8A 3IVSA 2BZNA 3NQMA 3IV3A 2X30A 2V2DA 4WXYA 3C52A 4C1LA 3IIVA 2QCLA 3W73A 5FF0A 4IMGA 5K7JA 5G1YA 1FDYA 3JRKA 4WOQA 2I9EA 1PS9A 1RQHA 4N9CA 1PV8A 3CWNA 4EIVA 1FUYA 2FIQA 4LS1A 4JDBA 2QR6A 3TR2A 2ABBA 1WOBA 3CT7A 4A22A 3NQFA 3KVLA 3HPSA 3ZFHA 3KOFA 2Y6ZA 3NG3A 1G4TA 3W86A 4HT3A 3UYCA 3SIZA 4LC8A 2W6RA 3QEZA 1W8SA 1I8JA 5LNWA 1L6WA 1JRBA 2JGQA 1FBAA 2CLKA 4Z08A 3WK0A 5BOOA 3MP5A 4AH7A 3OEXA 2Y7GA 1Q6RA 1UASA 1AG1O 5IBXC 3L68A 3EWYA 4LRTA 4Z1CA 1W5NA 1R2RA 3MI2A 4DO6A 1KW1A 3MW7A 2A2IA 4M7SA 4NX0A 4YCOA 1WBHA 2C14A 3H54A 3ABQA 1WA3A 4AMAA 1A50A 3W1QA 3O1NA 3FEMA 4IX0A 1AK5A 4GFSA 3W74A 3F03K 4ICNA 3LCIA 1PHWA 2ZFAA 2ZZ2A 1W5OA 3G1AA 2QCCA 4CCCA 3NQ6A 3GIYA 1FCUA 4EOUA 1S3HA 1FDJA 4CCDA 1W3IA 1BWLA 3LI1A 4LY8A 2HSAA 3MHUA 3UD6A 1KBIA 4NJJA 4DXVA 5L9FA 2J9XA 3FLUA 2QUUA 1PL9A 4HNUA 1VS1A 5AB3A 3IGXA 5F2GA 5K2ZA 1HO1A 2WPBA 3UZJA 1VJIA 4ADUA 4MFDA 3UWVA 3L5LA 2NX3A 2Y89A 4WZHA 3CU2A 5H2ZA 4LOCA 1EUNA 2QCDA 3GNNA 4WUIA 3W84A 4NJIA 1W5PA 3QZEA 2QF7A 4PCFA 1H7NA 3QFEA 4QIUA 3NVTA 3BARA 2C18A 2VEPA 2QCEA 5FF3A 3O6DA 1NF0A 2ZZ7A 3BW3A 1XBYA 2VOMA 4UMAA 4NNCA 5D38A 1ZAHA 2X1RA 3B0PA 1T8XA 3EXSA 3B05A 4A2SA 4XZ9A 3TMLA 3G0XA 3WK2A 3TC6A 5CGQA 1GTHA 3MYOA 2ISSA 4JX6A 1ME9A 1NVMA 5D2VA 3M41A 1TTIA 3R5EA 3G1XA 3P62A 3SFKA 5LHFA 4MZYA 3AO0A 3VI2A 4LS2A 5KITA 8TIMA 2NZLA 2ZZ4A 5BNKA 2A7RA 2C6QA 3QRHA 3Q2DA 4LS0A 2ZRXA 1THFD 4N9BA 2NX9A 3VE7A 4CNOA 5LNRA 4MY1A 2GJLA 3W7NA 5HQEA 3SW6A 4WJEA 2PE4A 4JS3A 5U4NA 2CLOA 4EVZA 1FY6A 5G1TA 5LGXA 3B03A 1XFBA 4U4MA 3ZWSA 4OGZA 3TW7A 1ZAIA 3BG3A 1RD5A 1SSDA 4S2CA 1EP3A 3PF3A 4FF7A 3W7LA 1QR7A 1QCWA 2OT1A 2A85A 2NXHA 4LVAA 3W7KA 5HINA 2EKCA 2RKXA 4LC6A 3G18A 2CLHA 3TSMA 4IUOA 1KFLA 1OYCA 4FB7A 3G1VA 3GNDA 4XKYB 3GAYA 1WX0A 1KM5A 3NQ8A 4CNNA 4KFPA 3W2UA 2Z2UA 3NZ1A 3MO7A 4DBDA 2Y85A 2WV8A 3W07A 2A4AA 1F5ZA 1DOSA 1W54A 3NQEA 1OFRA 3M7WA 3EXTA 4AWTA 1O60A 4DBEA 2VXNA 3N34A 4MPQA 2ZRUA 5G4WA 3BV4A 4QQ3A 2ZCGA 3W7PA 3O63A 2VEIA 4ZZ9A 5FEZA 3QW4B 3KVMA 3RNDA 1R47A 4DF0A 4O11A 1RV8A 2DU2A 4QISA 2ZZ3A 2J24A 1VLWA 3SSJA 2ZRZA 1FDZA 3W87A 2DZXA 1MEIA 3UWWA 3GXPA 3OBKA 4RZ6A 3P61A 1ZALA 2ZYFA 3OVQA 1F73A 4I7WA 1GOXA 1EX5A 4I7UA 3GLCA 4UMBA 1S5VA 2GQ9A 3GDKA 3HO8A 4R7JA 3MBDA 1OFOA 1Q3NA 2ATMA 4HPJA 3MYPA 3LHWA 1X8FA 3F1QA 3M1ZA 2V82A 1OFBA 3C2OA 4MYXA 3QC3A 3MBFA 1VR6A 3Q37A 3W1XA 3QPYA 1LP6A 2E09A 2DZSA 3INPA 4RK8A 1SSGA 2YXGA 1G4EA 1RVGA 1ZHAA 4ML9A 3Q58A 5FEPA 3DI1A 4JY8A 3M5ZA 1C8VA 2R91A 2PRMA 1ZENA 4QJ1A 1KFKA 2O7QA 1H7WA 3MI6A 3H55A 1XBXA 4KFOA 2PRLA 4R33A 1ALDA 1I2RA 5FF2A 4ORMA 3DKLA 2NXGA 1EP1A 3GXNA 4RCXA 1SZGA 2ZRVA 3LCXA 3A24A 2JKPA 1XBVA 1OFEA 3S1VA 3LV6A 5H91A 4K6AA 5F1UA 3KRZA 4JTLA 4PL2A 3B0UX 3PULA 2ALDA 2E5DA 2C15A 2PCQA 4JXCA 1HUVA 4MKNA 4UTLA 2WSYA 4GBUA 3L66A 2CWNA 3DENA 2NUWA 1XL9A 1I2PA 3C61A 5I3GA 4JYEA 1YLVA 3DFPA 1TJPA 1XUUA 3LLFA 3R8RA 4BK9A 4DELA 2LLEA 4O1AA 4BF9A 1CX9A 1IXQA 3A22A 3VFLA 1QNVA 2QUTA 3NPXA 1JCLA 3NXFA 4OV9A 4NU7A 5I3HA 5LNSA 3LERA 1OX4B 1UUMA 3N2XA 1FWNA 1DORA 1MEWA 5D33A 2OJPA 5LGZA 1G7VA 3VE9A 1FCVA 1L6YA 2VENA 4PL1A 4O13A 1KM0A 4OWGA 4LNYA 3FOKA 5AHEA 3MWAA 1GVOA 3UZ5A 1GT8A 2XN2A 3LRLA 3UWQA 4WQ6A 3S8HA 2Y70A 1W56A 2QCNA 4UFMA 4QAIA 5CSSA 3QPZA 3NL3A 1DBTA 3QF0A 1VLIA 3W1TA 1SW7A 2FDSA 3W1UA 1GVQA 3HBLA 5DBTA 1JCJA 1KLZA 2G95A 3W3OA 1H51A 2RDUA 4O54A 2CFFA 3FKKA 3GAKA 3DU0A 5G2HA 4OT7A 5LHEA 4UTWC 1IXOA 3G1HA 3QYQA 5D02A 4N9DA 5CSRA 2OZ0A 1N55A 2YGYA 4UCGA 3P74A 3TDFA 2AGKA 5BW6A 2GVLA 1KFBA 3WJZA 1JQXA 3ZWTA 4O1DA 2G5WA 1P0NA 1F76A 5F1VA 1SR9A 3P82A 3G1SA 2QKFA 3LLDA 4RZ5A 2DZWA 3O15A 4XTIA 1CI1A 1I4NA 3IGSA 1GEQA 4EF9A 1B4KA 4DEFA 3M0ZA 1WXJA 5EMUA 4BWLA 3KVKA 1OF6A 4HSOA 1KM1A 3SZ8A 1TPH1 1Y0EA 4LRSA 3GXTA 2H90A 1Z48A 3NL6A 4HPXA 1W3NA 4FIQA 1LLWA 1SO3A 1IIGA 3WJXA 1QOPA 3PG8A 4IWWA 5HMSA 4BI5A 3C56A 4YMZA 3TU9A 1XXXA 3TH6A 4O12A 2B7QA 4BR1A 4JICA 1A5BA 1LRTA 2Y61A 3THAA 4Z1AA 6TIMA 4XBKA 4NZFA 2X16A 1YTKA 1UCWA 4TX9A 3NPUA 5EY5A 3S1UA 4A2RA 3W1NA 3QJAA 4ZMGA 3TROA 4WXZA 4QITA 2JK2A 1C29A 3FYOA 1SO5A 4Y96A 2E77A 1LYXA 1TTPA 4NUWA 3IGUA 3G22A 1RPXA 1QO2A 3TJLA 1DJQA 1FX6A 3LRKA 5A5WA 1H63A 1JCMP 2DZUA 1H7RA 2YR1A 4G1KA 3W2MA 3N14A 3DZ1A 4LVBA 1GYNA 3ATZA 4IPIA 4Z1BA 2CLMA 1YPIA 4IMDA 4KWWA 1BEUA 3U2OA 2YW3A 4M19A 1JJKA 2V8ZA 1X7FA 1X1ZA 4OU1A 1IF2A 5D2YA 3BLFA 2DZTA 1VC4A 1P4CA 4S1FA 4UMCA 1ME8A 4GRSA 1G69A 4LWWA 5FI8A 3W7MA 1GG0A 1XI3A 3NOEA 1H1ZA 1SUXA 1JCXA 1TSIA 2GUUA 3S5OA 1LZOA 1J4EA 3DFNA 3NQAA 3DFSA 3KAOA 1FXPA 4NJKA 3PBVA 3IRDA 1KFEA 3G3MA 3N3MA 1JQVA 3W1MA 1YTDA 4AWUA 1HG3A 3L0KA 3BGGA 4WY0F 1H7OA 2A5HA 3BW2A 4CQAA 4Y6GA 4I9AA 3LV5A 4OV4A 4HIBA 3RLVA 3HGJA 3W7OA 3W83A 5SWUA 3PSWA 3PS7A 5TIMA 1FQ0A 3EX1A 5AHMA 1W5MA 5CPMA 1IGSA 1QFEA 3GB6A 1KM4A 3BG9A 3T44A 2ZDRA 3QQ0A 3LHZA 4AWSA 3JS3A 4JTKA 3IIOA 2B0MA 5G4EA 1GG1A 4M7TA 1DVJA 5FF4A 4GXMA 1SZNA 4IQLA 1A5AA
chains in the Genus database with same CATH superfamily
2DJXA 1QO5A 4JFSA 1EGVA 1AD4A 3B97A 1WDWA 1NU5A 3VD5A 4XQ6A 1DXEA 4YS1A 1F3XA 3CV2A 4EPDC 3W7RA 3NQDA 2HV5A 4ADSA 1UR1A 1HP4A 1UR8A 2QCGA 2I7GA 4PMYA 4G7EA 4QTGA 1V6UA 4GGBA 1JPMA 4EPEC 5AC6A 4HB7A 3S2CA 2GOUA 2PDCA 2QULA 1OK4A 4DF2A 2I57A 3QMTA 4DAFA 2YL8A 3RMJA 4QLKA 3KRUA 3I7RA 1E3XA 4LPCA 1B3VA 1Q45A 5DEZA 5A2BA 3S9ZA 2HTMA 4S23A 4M1BA 3NZPA 3AYRA 3N2TA 4MG4A 2QF8A 4RR4A 3TW9A 2J62A 2PWEA 4TX6A 2CESA 1IEWA 1N8WA 1R3TA 1A53A 4HMEA 3M16A 3EGJA 1KCLA 1S5NA 3W22A 4IMEA 4OHQA 1KGXA 2WNQA 5K4XA 4FNUA 4E6MA 4GNKB 2NQLA 3ARYA 3P8JA 1E0VA 3CUIA 1ZJBA 2CC0A 1BXBA 5I3JA 4LALA 4FOUA 1HTIA 3MMWA 3S46A 3D3AA 3C6CA 3H2NA 3EWZA 4K8GA 2R1KA 2YSWA 2Z28A 3N4FA 3TZFA 2PLMA 2DSUA 3B40A 5FSDC 1S5WA 2P10A 2DSKA 3VM7A 2JEQA 3LM7A 4LGXA 1X98A 3FA5A 3W28A 4UQ9A 3BOLA 4K38A 1GOKA 2E5CA 5C8BB 5AHNA 4ZQMA 3TCEA 3VIFA 3CIXA 3HB9A 3T0DA 2Z7KA 4XUYA 3OBAA 1US3A 4IL0A 3E0FA 3V1PA 3L65A 2FHBA 3ZVHA 3BC9A 3T08A 3O6AA 5HR7A 1EC8A 1RPKA 5AYYA 2CBUA 1VFOA 2QJGA 4MLRA 2Q02A 3CB8A 5LIUX 4JCMA 3PBMA 3T78A 7XIMA 5D2XA 2HZGA 9RUBA 3NUKA 4N02A 4PCSA 5MHBA 2VYOA 3MJYA 2J75A 3I6RA 4D6HA 4AD4A 2YDQA 4BF7A 4J40A 4LB4A 1KA9F 1A5KC 5FACA 5HATA 4PUEA 3B0XA 4JTFA 1U30A 3ZM8A 1KV5A 3SRKA 2FGBA 4NSBA 3W2JA 1EIXA 4ZQRA 4JN7A 1OCNA 5GJPA 2NT0A 2WKJA 4KEMA 4IGSA 1PEZA 2BVWA 1YBQA 1A5SA 3FV9A 4AHPA 4F40A 1OFAA 2B7NA 3WJYA 4LW7A 3ARWA 1ITCA 3HQ1A 3TV8A 3NXLA 2FZMA 4IIBA 3VIPA 3ARXA 4WGXA 4E4FA 2D73A 1HQTA 3VGGA 3UPMA 2R9RA 2BNJA 4MIMA 3E1F1 6PTDA 1V3JA 1VZWA 1Q6QA 1ML1A 5G4HC 1YDNA 2NUXA 1WKDA 3BLKA 4HU8A 2VZVA 3LCHA 1F61A 1YDVA 4JY9A 2VZUA 3HV9A 1Q8AA 2Q01A 2VC9A 2PAJA 3TTYA 4QAWA 5IFTA 1EHAA 1ME7A 5CPNA 1MVYA 1EKOA 2QNEA 4RDZA 3B8WA 4L80A 4P7LA 3GYCA 2GK1B 4NAEA 4NX5A 3M44A 3PBUA 1UBSA 5D2TA 3PUOA 1JCNA 1XH1A 2AQVA 4UQDA 2PC4A 1S39A 3TKFA 4UIOA 1K7FA 1V8EA 2A21A 1GPWA 3HPZA 3RCNA 3W88A 6REQB 1D7KA 2WW5A 2YDAA 3UR5A 2Q71A 4I6VA 5LYRA 4FA3A 1E1FA 1Z41A 1MFUA 3HGOA 3SY1A 1Q6CA 1S46A 1TJRA 2OTDA 4A3HA 2F6KA 2OX4A 4ZFMA 1GJUA 4DM1A 3IWPA 4YYCA 5I07A 1UB3A 1XCFA 1XGZA 5A6TC 1TREA 3MZNA 5JMUA 1Z8AA 1QPRA 1AL8A 3APGA 5C2XA 1M7XA 4B15A 3WH8A 1TZ9A 5A6JA 4AZBA 2VOTA 4MY8A 3AMCA 4YWIA 3WQCA 3VU2A 3CZGA 1W1B1 2IKJA 3UEQA 2FJUB 4OOUA 2VD9A 1ZRQA 4M80A 1P48A 3F4WA 2H9AA 1NAL1 2B7OA 3GW0A 4CD5A 3S9YA 4E3TA 1YADA 4RNFA 3V16A 2Z6JA 1XWYA 3GX9A 1HJVA 1CPUA 2YZ5A 3FW6A 4PMZA 5FAJA 2VDGA 4JIPA 3L5MA 1V79A 1CXIA 2P53A 1T41A 5E5CA 3GTXA 4XTDA 2V9DA 1WZAA 3GTIA 2BGQA 4WIWA 1ISYA 4B5TA 1WCGA 1EA0A 3RRAA 3FCPA 1V6VA 2GJNA 1L2UA 4DQWA 2GJXB 1ODZA 4LNCA 4F48A 3RM9A 1WQ5A 3HGRA 3H2EA 3WNPA 1RD6A 3JR2A 2Z25A 1PZ1A 3G2GA 4BS0A 3S2LA 4H19A 3P80A 2VVNA 1M7PA 1K8ZA 4CQ9A 4LV4A 3WFAA 1E70M 3ARVA 2ATSA 4QM1A 2P0OA 3NEVA 1PDYA 1NQ6A 7REQB 1BAGA 4O57A 5DBUA 4GNVA 3HGSA 1G6CA 4R7OA 1KTBA 1FWIC 1ZY9A 4E0CA 2TSYA 3WF2A 3GD6A 2QUVA 3MP4A 4UBPC 3APTA 3DKJA 3WJWA 4C7DA 5FJTA 2E6YA 2PDBA 3CH0A 2EG7A 4WDTA 1LBLA 4A35A 3W26A 1TV8A 3TFXA 1S5TA 1SO6A 1BF6A 1TPWA 1QJWA 1TWIA 1BYDA 2PDHA 4IFRA 1L0PA 2V5DA 4PTVA 4ZO7A 2GUBA 3K30A 4POCA 4U5KA 1SQ7A 3QXBA 3PZIA 2OB3A 4HU4A 2PBOA 3C3UA 4YPJA 4FAMA 1V0KA 3WEZA 5CAKA 3DFOA 4RJEA 2W0UA 2BFGA 4HOXA 4JTTA 3EAUA 4NI3A 1JYNA 1C9WA 3KL3A 5MF5A 4CEXC 5EBAA 1X6UA 3GNOA 3SSZA 3W70A 5HJXA 3KCJA 4YVPA 1V7YA 5M2FX 2C13A 4GYKA 4DM2A 2R82A 4UNKA 4KRZA 3CHVA 1R2TA 1VCGA 3FFSA 1IT0A 2GUYA 1ADOA 1RR2A 3TC3A 1C3FA 3AU6A 4ALDA 1FHUA 1TE1A 2O9TA 2X0SA 2GFTA 1DE5A 4UOZA 1XIDA 1S2VA 3T55A 3RUBL 3WQOA 4JTIA 4K8EA 4M1RA 4CNUA 4HN4A 4FX6M 4F0SA 1WKEA 1QI5A 3W1PA 1PB0A 4FLSA 1V93A 4TUFA 1FP9A 4NKCA 4HNVA 1MO0A 3IACA 3SUUA 1J18A 4D8LA 1OADA 4GI8A 3M64A 1LQ0A 1YDYA 3OYZA 3ELFA 1H60A 2E6FA 3LU2A 1MQPA 4LYPA 3EDDA 2EEXA 1QPOA 2W62A 3PBWA 3AHVA 4JTSA 3BLOA 1PCKA 1FRBA 5FA5A 2QGYA 4QJ5B 5HMFA 4QE4A 2HCVA 4EPBC 1TX0A 1TVLA 3KLLA 1HP5A 2C91A 1YXDA 3UBPC 2PSNA 1EJ7L 3C2FA 1XYCA 2YPIA 5E93A 1LOQA 2AOSA 1VPQA 3UR8A 1RLDA 3MJMA 4C6JA 3BZJA 3UG4A 1KV8A 3U2CA 3L2IA 1TPC1 4KESA 2X7VA 1XJBA 4GLEA 1WDPA 3NCOA 3I3DA 4PULA 1NM9A 2BY3A 4AX6A 1LT8A 3WUGA 1UYQA 3NYZA 4CD6A 5CQ1A 5BOFA 3OVPA 3DIPA 4WDXA 4O8AA 2BGNE 3PZOA 7PTDA 3R13A 4IX2A 3WQ4A 1AW1A 4TXEA 1J11A 3NZGA 3O9NA 4AY7A 4ZSTA 2ZX6A 3VC6A 4A3UA 2JIEA 3QHMA 4XSLA 4BQ2A 4ZOBA 1Q6EA 3M9YA 1S2WA 4R5EA 3ITYA 3WNKA 2PWUA 1OFQA 1AQHA 3C8FA 2G3NA 3P60A 2ACQA 3A21A 3W38A 4ORIA 4ATDA 2OT0A 1FWRA 4XZNX 2X42A 1V51A 3HN3A 1REQA 2VEGA 2F84A 3IVTA 2J47A 2WO5A 3M0YA 2DW7A 1OINA 1VBUA 3E02A 2VFIA 1CENA 2VC7A 3FKRA 8XIMA 3K4DA 2X1TA 1BKSA 3DG3A 4ZXOA 2HXTA 1B2YA 3BH4A 1DJYA 4K37A 4H4IA 3LRMA 5DO8A 1TYGA 4RE4A 2YYTA 1W2PA 3LTSA 2CYGA 3NJ3A 2HE8A 1DJZA 5E6ZA 4C6DA 5BWAA 5IDZA 1T5AA 3QHOA 4NNAA 1I1WA 3VDAA 3S5YA 3LHYA 1U5JA 1LG1A 3ABOA 4ZOCA 1GVRA 2HWGA 1P0KA 1VAHA 2QDHA 2FGLA 3TQ0A 3L0NA 2HROA 1GKQA 3CZKA 2VCAA 4Q7NA 1GJPA 2AL2B 4U31A 2V5LA 4H00A 1VJSA 3AYTA 3U2ZA 3WZ0E 3GTNA 2OQHA 4A8RA 3V75A 3USBA 3UXAA 4AXKA 4EXBA 3LHTA 2GSEA 1E6QM 4NT0A 5RUBA 1G4PA 4OUIA 3NQ2A 4DB7A 5KTLA 2B7PA 1O5KA 2PBGA 2YCLB 1TUXA 5HPOA 1B4EA 1M41A 3AXHA 4DLFA 2J7DA 1DEDA 5AFDA 3PG9A 2D0FA 3PTQA 3CB3A 1VB9A 3QMSA 5D9NA 2NLIA 1R3RA 1TJ1A 3TE9A 3KX6A 1WBJA 3KTSA 4B4FA 4AZ7A 3BAJA 5TQLA 1VRXA 1AZ1A 2NX1A 3SUSA 3IJ9A 1V02A 3SN1A 2RJHA 3WL1A 3DXIA 3CO4A 4YTUA 1KR1A 2YOCA 4C5YA 3OA5A 1TPFA 4M0XA 3W7JA 3CO8A 4HSNA 5TAOA 4YTSA 4F2TA 3CASA 4B5XA 1GGOA 4MGGA 3WBAA 4KCTA 2BY2A 1XLGA 4H6RA 3TFCA 1UR4A 1LUCA 5KZEA 3CZLA 2J7HA 6XIAA 4HYVA 1KM3A 2GL5A 3FYPA 1YNYA 1XS2A 3ZSTA 1MI3A 1WXYA 5K9DA 3N2MA 4N42A 2B31A 4ZOAA 4QE1A 3S6OA 1J5SA 1GK8A 1PZ2A 1KTNA 5K9CA 1G0CA 4J27A 1D8WA 4D8ZA 3HFTA 4EACA 5GJMA 3W7HA 1AZ2A 4W5UA 2ICSA 4WEVX 4AHOA 4M3PA 3PNZA 3G8EA 4AIBA 3WD0A 1DJWA 1VENA 3WCZA 4O50A 4IF2A 1LLOA 1JDAA 3TJ4A 4EWND 5BMWA 2FB3A 4L56A 2VO5A 5HANA 2J6VA 4JHMA 4YCPA 1FWTA 4GA8A 3KWXA 3VUPA 1TMLA 4GQQA 4FNQA 1RQEA 2FH8A 3AAMA 4N9EA 1FTXA 1EJUC 2JKAA 5CZJA 2GQAA 4O14A 1JPKA 1VEMA 3MKCA 3P2VA 3TVAA 4O0QA 1ITUA 4FX7A 4DJDC 3W7CA 1GVSA 3OLGA 4MB3A 1CCWB 3GR8A 1AD1A 1AH4A 4Y7EA 2OSWA 3OLEA 4H9XA 1G4SA 1R46A 3CXOA 2DZVA 5EL1A 3V5OA 1G7UA 3IUDA 3LBOA 4CUCA 1R30A 5KEZA 2ZX9A 1SGJA 1RAKA 2Y63A 3QFWA 4GK8A 4M8UA 5A6AA 3ZZ1A 4XZMX 2ZOXA 1E72M 3P5YA 1EJRC 1XC4A 4ROQA 4GGHA 2J74A 2KZHA 4KMQA 4TMCA 4S3AA 3WNNA 3GYEA 3PB2A 1QT1A 2OQLA 3EWDA 4KKXA 3CTLA 3L2LA 3KOYA 1WZKA 1UD3A 3ISIX 3R1ZA 3OVRA 5HUPA 3K13A 3PFRA 3K4WA 3ENLA 5ABGA 4LCQA 4UFLA 3WLIA 3UNTA 2J9ZA 4R27A 1DE6A 2X41A 2C0AA 4XO6A 2WSQA 4UTKA 4PMXA 5A95A 2Z29A 4GQRA 4CQBA 3ABXA 2BSLA 5BMXA 3UZWA 4W8BA 4C6LA 1PTGA 2F7FA 3FA3A 4GI4A 4GZEA 4B4HA 2WMHA 1EXPA 4ERIA 4S3CA 2VQTA 5K4ZA 3S9IA 4LU0A 1QPKA 4JNMA 2GWGA 3RITA 1P6WA 2ZE3A 2VX4A 1YW1A 2XIMA 4CLMA 2VEFA 3AHTA 4JHOA 3FY1A 3BAKA 1C7SA 1ZJHA 4X2PA 2VT0A 2WC4A 4MDPA 1CLKA 3SY8A 1NWSA 3GIPA 3IVSA 2BZNA 3NQMA 3IV3A 3N3TA 3AIQA 3C52A 2WLYA 4JQ4A 2PTZA 2QCLA 3GS6A 4WRHA 3VIOA 5FF0A 4FPSA 3JRKA 4QS6A 2I9EA 2XGIA 4KCWA 4M81A 1SJBA 1PV8A 1FUYA 3CT7A 3ZFHA 3KOFA 3ZO9A 1GZ1A 1XIBA 2YLLA 3JU2A 3KZSA 5BRQA 3CPGA 3THDA 4H04A 2PTWA 3SIZA 2AQOA 2WCGA 3DESA 2JGQA 3WN6A 1KQZA 3EDJA 2NVAA 4MWAA 4AEEA 5A1AA 4Z1CA 1W5NA 1R2RA 3REQB 1TWWA 2V67A 3T81A 4JCLA 4AMAA 3WNLA 5CH9A 3RXZA 3O1NA 3FEMA 4IX0A 4QJ4B 2O4MA 1AK5A 1IWAA 1FWFC 3LCIA 2V3GA 2ZZ2A 4AIOA 3G1AA 4QG8A 4DJFC 2F6XA 3NWRA 3NQ6A 2ZUMA 4J3TA 4DI9A 3VNMA 1E0TA 1S3HA 3GBEA 3LI1A 1A3WA 4NJJA 5L9FA 3H4WA 2J9XA 4MKVA 4DYEA 3NTYA 3FLUA 7REQA 4PYSA 1F9CA 4GX8A 3WBEA 3IGXA 1TKKA 3I6TA 5J8LA 3R6IA 1VJIA 3QPEA 2R6OA 3WQEA 2YLAA 4WZHA 4LOCA 2Y8KA 3MVIA 2OYKA 4I6KA 3PPHA 4HD5A 4QIUA 1VFTA 2PS2A 2Q8XA 4GHRA 3H2OA 5FF3A 1A5OC 3GRIA 1F07A 4J5NA 1ZAHA 2X1RA 3BAWA 4GYFA 4LAKA 3TMLA 3WK2A 4TTUA 3TC6A 1SVDA 3PJTA 4RL3A 5D2VA 4C91A 1WUFA 3SFKA 5LHFA 3CMFA 5JBFA 4MZYA 5JIWA 3VI2A 3NQBA 3TWBA 3BSMA 2UY5A 3WBYA 4N7QA 3W6LA 2C6QA 4LS0A 2DQXA 5JH2A 4KRTA 3ZT7A 4MY1A 2GJLA 3W7NA 1GPFA 2WHMA 3WQWA 1OIFA 2CLOA 1R3WA 3CYVA 4HA3A 9XIMA 4MHBA 5LGXA 4U4MA 2HK1A 1DTUA 3ZWSA 4OGZA 4NRSA 3BG3A 4JAWA 3NVDA 3W7LA 3U7VA 1XYBA 4I5RA 1XGEA 2OT1A 2NXHA 1H2JA 2VGIA 1KWKA 5CC5A 4GI9A 4DVOA 3T05A 3HPFA 1KFLA 4WHBA 3S3GA 4JTAA 4PR4A 1W3KA 5E0FA 1UOKA 3FVMA 4CNNA 4KFPA 4Q4RA 2OZ8A 3MO7A 3W07A 4HHHA 1DOSA 4WJXA 1KXVA 1OFRA 3XINA 4DBEA 2VXNA 1XCWA 3E3HA 5G4WA 4QQ3A 1US2A 2R24A 2VEIA 1CB7B 5I09A 3CMGA 1R47A 4DF0A 1BQGA 2ZZ3A 1JNDA 1QUMA 3KDOA 3E74A 3DUGA 4F0RA 5I77A 3UWWA 4LUSB 4J2MA 3OBKA 4FLRA 2ACUA 1ECEA 2WZEA 3OVQA 1F8IA 1FWBC 1PDZA 1F73A 4I7WA 3GLCA 3NEHA 1J10A 1S5VA 1F4HA 2QS8A 4CU7A 1JGIA 1Q3NA 4HPJA 2XINA 3M1ZA 3C2OA 4MYXA 3QC3A 1G01A 3MBFA 1VR6A 3ARUA 4YTTA 3QPYA 4H9YA 1J9YA 3WX7A 1ZHAA 3Q58A 3L4YA 4ZSUA 3DI1A 4JY8A 2R91A 2O7QA 3H55A 4YN5A 4C6CA 1QHOA 4R33A 3V5CA 1I2RA 3UJ2A 4A4AA 4OIFA 3CZEA 3KCLA 3TOPA 4L5ZA 1U1JA 3GXNA 2ZRVA 3LCXA 4HPHA 3OYXA 4GOAA 1MUWA 4Q4QA 1RCQA 1XBVA 3LV6A 5H91A 1KBLA 2Z1XA 3IV8A 2YL6A 4D6EA 3B0UX 4LYRA 3PULA 2ALDA 1M04A 1BTCA 2E5DA 2C15A 2PCQA 4JXCA 1HUVA 1LG2A 3QTPA 2GDUA 4F8XA 2WSYA 3L66A 3GNPA 1UP2A 3DENA 4L7ZA 1WDRA 3C61A 1A4LA 2ZXQA 4JYEA 1YLVA 3DFPA 1XUUA 3MV11 3LMZA 1CX9A 2E4TA 4JZ5A 2NV9A 3ZT6A 4S3FA 3NPXA 1QNVA 4GKTA 2CBJA 2OQYA 2VGFA 3RPTA 2PWVA 4DZIA 5I3HA 4IGMA 3LERA 1UUMA 4L64A 3N2XA 4WLCA 5LGZA 1G7VA 1IE7C 3F2DA 2V3DA 4LNYA 2QIIA 2W92A 1GT8A 1BHGA 3UWQA 4WQ6A 4C6FA 2D1ZA 1W9VA 1UD5A 2QCNA 4UFMA 5CSSA 3WD3A 3NL3A 1DBTA 1UMLA 1SW7A 2GGEA 3AMLA 1KXTA 4PTWA 3EOSA 3FKKA 3GAKA 3DU0A 2ADAA 2EPLX 4UTWC 2X0HA 1IXOA 3II1A 1QNRA 3G1HA 5D02A 2FMNA 1N55A 1ELSA 2AL2A 1W9XA 3TDFA 2AGKA 2ONEA 3A47A 1GOIA 4FI4A 1KFBA 1H41A 1FKXA 3ZWTA 4O1DA 4JFUA 4GJIA 1QVBA 3WQ8A 5BWFA 3WDRA 1E0UA 5DMLA 1FWAC 2NQ9A 2YCLA 1R7AA 1B4KA 1LWHA 1O1ZA 3SADA 3DOPA 4ZO6A 3W82A 3M0ZA 3WDIA 2XIOA 1HKIA 3TTEA 1IT8A 3C5QA 1UWIA 5EMLA 3NL6A 4HPXA 1W3NA 1U5HA 3KHDA 1JZ3A 5HMSA 3CHEA 3TU9A 1J0IA 5HXMA 1S3TC 1EO5A 1A5BA 4ZA0A 2PDGA 5ENLA 2WHKA 2OXNA 1YTKA 1M7JA 3DFHA 4AZCB 3DC0A 3NPUA 3VOCA 1R6WA 3W1NA 3QJAA 4FOKA 3UJSA 3PJXA 1C29A 1EYEA 4Y96A 1CECA 3C0QA 4ACYA 2FFIA 4JKKA 1RPXA 1DWGM 1QO2A 1DJQA 3LRKA 1K9EA 3VIJA 4G1KA 1VFFA 4C1NA 5BU9A 3WLTA 1QI2A 4KIEA 3VVGA 4PRTA 1JJKA 2V8ZA 3L4UA 4MAZA 1IF2A 1T6MA 2DZTA 4HNOA 1VC4A 4GRSA 1XSIA 4URIA 4LWWA 2FH6A 3F2BA 1S2AA 3OODA 5FI8A 3GE7A 1SUXA 4I9TA 1TSIA 3DFNA 2BGSA 1XLCA 4BF5A 4TOQA 2E3ZA 2BXZA 1XYMA 3LQLA 4WSJA 1JQVA 3B8TA 3T2QA 1DHKA 2BG5A 3BW2A 2OOFA 4OV4A 3Q65A 2I9UA 3B4YA 4OJYA 4P7RA 5CZKA 2QW5A 2X40A 3VFCA 4D6DA 3EMZA 3JS3A 2J7FA 3U0HA 1EDTA 5G4EA 4BZYA 1GG1A 4M7TA 1XFCA 4ZR8A 1DVJA 4GXMA 1L8NA 3E2SA 1E4IA 1XKJA 4RNHA 4OBSA 1WZMA 1SZFA 5D2WA 4YTQA 4QCFA 1PUDA 4W7UA 1VKFA 3CV1A 3MPGA 1QWGA 3MSYA 2CWXA 4O0KA 3BG5A 1HGYA 4LB3A 2DZPA 1ENUA 4YLWA 1V3HA 1F74A 4PE8A 4FK9A 4C6KA 2ZRWA 4DXXA 3MS8A 3I7SA 2B4GA 1ONWA 1S1RA 3A4AA 1E5NA 1TPDA 4FMVA 5A94A 1M5WA 5CC3A 4FO4A 4FHAA 4U3CA 5HQLA 1HL2A 3LX9A 3AUJA 5HPCA 3PJWA 1N82A 1WYIA 3BTNA 3CV6A 4R34A 3L5AA 1UR2A 1GEHA 1TZZA 2OOGA 2QJIA 1OY0A 4LF1A 4MPKA 1EO7A 1V02E 3DGBA 5I6SA 3WD1A 1KFJA 4GIRA 2VFHA 1GYMA 3KL5A 1AMKA 4H9MA 3CV7A 2G4JA 1DWHM 3B04A 1JZ4A 2V5BA 3CLMA 1UH4A 3ZJKA 3KEHA 3OG2A 5K3VA 2C1GA 3W71A 4X0NA 4O10A 4KGJA 4XAZA 2VEKA 2A7PA 3RFAA 3VYLA 2X1SA 3C2VA 2F6UA 4PUUA 4LEQA 5HWJA 3VAVA 3F7JA 3UCQA 3RM4A 3UU0A 4N2YA 3DX5A 4M5PA 3MWCA 4LVGA 3BJTA 4AF0B 3A6OA 4Q7BA 3N13A 4X2RA 1QATA 4AC1X 2P50A 1BWKA 4Q33A 3S1GA 1KM2A 4FXSA 3CQJA 3V35A 2TMDA 3ZJ8A 1OT1A 1W9UA 3F4NA 3S83A 2CZFA 5ABTA 5F4WA 5BZAA 5E9XA 1XIEA 4DBWA 1Z42A 5I3IA 3WNOA 5ABFA 1SFJA 5DQPA 3NR0A 2PUZA 3RPDA 1LOLA 3GO2A 3V4BA 1K4GA 3AQUA 5D8WA 1BRLB 2VNCA 3FYYA 3A13A 1VGAA 4JTUA 1V3KA 3REQA 4A21A 4HA1A 1DJIA 3GDMA 3GFXA 4HA0A 2EPOA 3AC0A 5BRBA 2W61A 5E0KA 2OEJA 3HG2A 3AHYA 2PLCA 4NASA 3KM8A 1OSEA 5A6BA 2G97A 2L5HA 3SGGA 2A0NA 2PA6A 4Y9OA 3M5XA 1BKHA 3RU8X 3UJEA 4AVNA 3DFQA 3ARQA 4PFMA 4KWOA 1OWQA 1XQKA 3VX0A 1K1DA 2XVGA 4MZ1A 1QK0A 3KBJA 4X22A 5IRPA 4MB4A 3DBPA 2ZUVA 4BA0A 1H1YA 1WAUA 2A6LA 2BMBA 3MCNA 4NZ3A 2H8ZA 3L0GA 3E12A 2V68A 3AMGA 2G3FA 1EPXA 4PMOA 1A49A 1HL9A 5IHRA 5CZ0A 2GPTA 3TAOA 2W27A 5AZ1A 3VDGA 5IM51 3MSRA 1ISZA 1DTNA 4PUNA 3K46A 4CVUA 1W5QA 4DJFA 1XG3A 1XH2A 3ABRA 1BYCA 4F9JA 2WZHA 2WKLA 3QQWA 3GDLA 3GDRA 1RA0A 1V6TA 5CC7A 1UJQA 1L9WA 2X1IA 4UZSA 1FHDA 2P8BA 4IGNA 4S39A 2Y5EA 4C6IA 4C7GA 3MB9A 3H8AA 3T0BA 2GDQA 2YL9A 2RH9A 3MHFA 2G96A 1W37A 3QKEA 4JKLA 3SCQA 2J6XA 4E2DA 3A3WA 3GVGA 2J79A 4J4KA 3M0LA 1K8CA 1RK6A 2ZA3A 1JUBA 5DY3A 1L6FA 1R87A 3IVUA 2VKZG 5HA7A 4A6GA 1MW3A 1ZZMA 2PLKA 3NM3A 1UWQA 1KCXA 4QDPA 4XAYA 3QOMA 4H6KA 4J3WA 3VOFA 1MDLA 1A0DA 2XIJA 5HBFA 3BLIA 1JRCA 1XLJA 3KS5A 2PP3A 2VEMA 4BI7A 3N2OA 2A6NA 3B8SA 2D20A 5DRCA 4DUOA 1BVWA 4DNHA 3NO1A 3VD9A 1CBGA 2DY3A 2Q3OA 4V1XA 2AMGA 1PYFA 3KVJA 3W85A 1J2WA 4ONVA 2Z2BA 2J78A 1EWDA 1BSIA 1CGXA 3KDNA 3EX6A 2VHLA 3BDKA 3E2VA 1R5YA 4B2DA 1RH9A 3W7IA 1J0YA 3VINA 3C2EA 1GHRA 1L8PA 5HNTA 3E38A 4GO9A 4BEUA 2ABAA 4GQGA 1CGYA 4XD5A 4LUSA 2DVUA 1WKFA 3HQOA 1PIIA 3TAKA 3UERA 3H7UA 4M6QA 2QV4A 1ECQA 2ZUTA 3HMJG 2UY2A 5KZDA 4DYKA 4E38A 3H23A 2YB1A 1HL8A 4XBSA 3LHVA 2JGYA 2HPIA 3W2NA 3OZMA 1T0OA 4QS5A 4J3VA 2PZ0A 4OBTA 3G0SA 1NP0A 1HX0A 5GVJA 3BVJA 2WWCA 4BJHA 3LXCA 4G56A 1XLKA 2YDSA 5ECUA 3UY8A 5A8PA 3EBVA 2HK0A 1K02A 1O94A 2GSHA 4H9UA 5T91A 3EX3A 1X6LA 3CQHA 1W3HA 3ZR6A 3OPSA 5LZLA 2XM1A 3GTHA 3IJLA 3B9AA 4O17A 3WNMA 1V6YA 4HGXA 3TTSA 1VH7A 3D46A 2RUSA 2QPSA 1I45A 1NIUA 4XD4A 4UXDA 2PWDA 4AQLA 2WB5A 7ODCA 5DN1A 2WSRA 1E6PA 4E5TA 2DZBA 1D2KA 1QNQA 4GZIA 1XYFA 3NPVA 5JXQA 5AC8A 3HURA 4Q4OA 3L21A 7TIMA 4US6A 1TV2A 4ZE5A 3N25A 3HG3A 2ZWZA 5JQ9A 1CXHA 1TRIA 1BQCA 2E68A 3F5JA 3NL5A 2NVDA 4U3AA 2Y7DA 6XIMA 1LLZA 2A3CA 4QNEA 3GH4A 1XQLA 4NL1A 3ZT5A 2ZC8A 3L4TA 2OODA 3GVRA 3AU2A 2J8FA 4D8AA 3WH9A 4GI6A 4NRRA 4JIHA 4LV9A 4JN6A 3VDCA 3W7EA 1EJVC 3QV9A 4GO8A 4M6VA 2VX6A 4O8RA 2O7SA 3VA8A 4EAYA 2XFYA 4XB3A 1Q4WA 5H8UA 2O4QA 5EMKA 3DHDA 1NDVA 4PUKA 1H7PA 3V3WA 3PANA 4IMCA 2DEPA 2EGZA 2ISDA 3A9BA 2C71A 3WK3A 2EPKX 3RX4A 4X9YA 4WKHA 2QPXA 1WV2A 2PLJA 1X1OA 2ACSA 3P3BA 1W31A 3STEA 3VGBA 3RGTA 3LXBA 1UROA 2ZVIA 3VO0A 4CCEA 4AY8A 4PC8A 4W84A 1YHTA 4JNYA 2G50A 1KRBC 1JDDA 2VDHA 5LSMA 4AHQA 1PPIA 3SY5A 3K8LA 2P0IA 3CPRA 4UTWA 4TMBA 2QXWA 4ACZB 4HHMA 1YTEA 1OX6A 5CG7A 3AZTA 2PD5A 3EPMA 3TIMA 1W1ZA 2RGMA 2G3JA 2CETA 1K70A 4HN8A 4W93A 1E9IA 2YX0A 4FLOA 4NYYA 1XF0A 2Z26A 1JCYA 1BGGA 2WM0A 1IZJA 1JF6A 4DJEC 3MI3A 1LDCA 4KWVA 3LZ5A 2TYSA 1XSKA 3AROA 4CNPA 4FXRA 2C7FA 1TUFA 2Y62A 1ZBWA 4UQCA 4TR9A 3BCFA 1YXYA 3QY6A 2D2OA 2PP1A 4JIEA 5GNZA 1QHPA 5C55A 1YYAA 4Q32A 4O1CA 4BFAA 2VCCA 1QDSA 2QAFA 1BYAA 2VR5A 5CKSA 4UTHA 4F0KA 2FPVA 5ECVA 5A2AA 3AOFA 3N73A 4YIWA 2V30A 2V5CA 2IPFA 2ZZ6A 4J28A 3PHAA 1EDQA 1KTCA 5LIWX 2G4FA 4U10A 1DWIM 1W0MA 4AZIA 3CAQA 3PJUA 1ZPTA 5K9XA 3NIYA 5I78A 1FCQA 1UMYA 4GD0A 2CZ5A 2FJKA 2Y4SA 2I16A 4Q8UA 3PN8A 3O05A 3UPBA 2A7NA 9XIAA 3LM3A 1XKYA 2EKGA 3K8MA 2WSKA 8A3HA 4LTSA 4P7QA 3OGSA 2EPNA 4HNLA 2TAAA 2YBUA 3SRHA 3URNA 3I7QA 4AZHA 3T0TA 3THQA 1XLAA 2PU0A 3NDYA 1GONA 3AWOA 4AZ6A 1NSJA 1WPCA 2JBMA 1TTJA 3PC0A 1TIMA 3PWGA 5DCEA 4NG3A 4GJ1A 4FF5A 4W5ZA 5A69A 3G6LA 3EWCA 1W3JA 4AB4A 4L61A 2FZBA 4A3RA 3SDOA 3SI9A 1RY8A 1Q13A 2OGJA 4B90A 4BQ3A 3MSGA 5AHFA 4BKNA 1OCQA 4LVDA 1X39A 1VYSX 3WLLA 1EX1A 3CLWA 5KMYA 5EGRA 2QIWA 4WVXA 1I0BA 2QUMA 4IJRA 3O16A 3PK7A 5F7UA 2NQZA 3ZIZA 4Z2IA 2NUYA 2DH2A 4X3ZA 1JDCA 4MNMA 3C2YA 3W53A 1C90A 1XYLA 2UY4A 4IP4A 4JR5A 4BWLC 1LTDA 3MUXA 8CGTA 4W8LA 4GX9A 3NL2A 3S5ZA 2PTXA 3W76A 3VUSA 4RNIA 1K6WA 4WY0A 4O1FA 3WH7A 4MZ8A 4LAZA 3VCCA 1LQAA 3SR7A 2DIKA 2DUXA 2FTWA 3C86A 5DFAA 1SMAA 5I23A 1SZEA 1B9BA 4O19A 1BD0A 4A8IA 3FDKA 1NQKA 2Y8UA 2G3MA 3OGVA 3MT1A 4OQVA 4DY1A 3PVFA 1GQKA 1EOMA 1VYPX 5FL1A 3O6YX 4DN1A 2WJFA 3IIPA 3SRFA 3B0VC 1PKYA 3N4AA 4M82A 1P6BA 5HJLA 4Q4KA 5I3DA 4AF0A 3DAQA 3COTA 3W24A 1EA9C 1MNSA 1ZAJA 4GVFA 5CPQA 3NQ7A 3PY2A 2WMIB 1GJWA 2FPTA 3MHGA 4MJMA 1NOFA 1IQ8A 1EZWA 4D2JA 4FSAA 3CQKA 5GJNA 2D24A 1LL6A 2ZADA 1UPMB 3E0VA 5C70A 1EYWA 4MAVA 4PMNA 2Z24A 1W1A1 2IS7A 1OB0A 2VP8A 7ENLA 3SCNA 4S3KA 1R3QA 4D72A 3EDKA 1T99A 3IANA 2C16A 2NV1A 2I5IA 3RX2A 3WMCA 1IR1A 3WQDA 2QVHA 2POZA 3B8IA 2ANUA 1UG6A 4AW7A 2R94A 2PC8A 1HGWA 5TBOA 2PWHA 3UQNA 2Y1HA 1BRLA 1F2JA 2W79A 1S38A 3FJ6A 4L4MA 2DT3A 1RQBA 3LA4A 4KEZA 3TC7A 2DT2A 3W7DA 2KAUC 1H3GA 2YBTA 1HF6A 4W86A 1IIHA 2XH7A 4MNJA 2GVJA 1J2BA 4IPJA 4IJCA 3HF3A 2Y88A 4JEQA 3UWZA 2DIEA 1XSJA 2RDWA 3M07A 3P8IA 4RE2A 3PZQA 3NFUA 2OEKA 3VTRA 2HMCA 3SFWA 1M3UA 1F8MA 3MMDA 1E56A 2VGBA 1VP5A 3ALGA 1VPYA 1CGTA 4RV8A 3UVIA 4GZ7A 1EWEA 1NH6A 3TXVA 3HTWA 4NZCA 5LNUA 1TCMA 4LT9A 5I3FA 3C2RA 1FVPA 2YIHA 3MUZ1 4TVCA 4XZLX 4ZQPA 1E1EA 1JD9A 1Q65A 2J7EA 4K8HA 5HUOA 3APYA 1F7BA 1ZSXA 2X2YA 1GW1A 2E67A 3VPLA 4E4UA 2O56A 1X7IA 3G1FA 3S6DA 4O1EA 2VWSA 3GR4A 3TONA 1MEHA 1SW3A 1TJ0A 1OFDA 3UVAA 1AW5A 2CKSA 3SQMA 5H8PA 1CEOA 3DG7A 4IGHA 3BK0A 2ALRA 4JTEA 1WKYA 3N15A 2JFEX 1ODUA 2AL1A 4GCAA 2INFA 2QAPA 3WL0A 3UWUA 1D3CA 4FNTA 2EF9A 1TPUA 2W63A 2A3AA 1WDDA 1R38A 3WQ5A 1KM6A 4CGTA 3VIIA 1AMYA 3RU6A 4O0ZA 3BW4A 1LRQA 1A5UA 4JQ2A 2EHHA 2JF7A 3F4VA 5A2CA 2TRSA 1SO4A 4J3ZA 2DUAA 4LYQA 3DGRA 2V38A 2F2HA 3WD2A 1Z3NA 3IK2A 1XRTA 3BLEA 3UWEA 4J9JA 1M65A 2VX5A 4IOTA 4JD4A 2XWEA 2BVYA 2YW4A 1HNYA 2FZNA 4XX6A 2WLZA 3HIJA 2YCJA 2E1DA 5E9AA 5ABHA 2HVOA 2WPGA 2FZ8A 1O12A 3BCJA 5FJUA 3DHPA 1A0EA 1G67A 2BXVA 4LBRA 3W7QA 4QXIA 1XLEA 3G1DA 4HBKA 3LCFA 1UD8A 1MZHA 3UZXA 4PA8A 4DAIA 2X30A 3ZYZA 4C1LA 1QU4A 3IIVA 4DJDD 1Z6KA 3W73A 1JDFA 5K7JA 1FDYA 3NGFA 2WHJA 1ZQ5A 3UP8A 4JDBA 2QR6A 2EG8A 3TR2A 1E1CB 3RCYA 5TF0A 1Q85A 4U33A 3NQFA 4EXAA 2GYIA 3DFYA 3QY8A 4MUPA 2YCKX 4HMNA 4Z2GA 3W86A 1JD7A 4IQEA 3AISA 4LC8A 3ICJA 2PGWA 5LNWA 1L6WA 8XIAA 2R1NA 4DWSC 1UP0A 3L4XA 4Z08A 3WK0A 3MP5A 1ADSA 5EB8A 2Y7GA 3OEXA 1UASA 5IBXC 4PGLA 3GU1A 1RUSA 4OTKA 2NVCA 2PCEA 1G94A 1ZU8A 1WBHA 1WA3A 2QYGA 3W1QA 3GVVA 1UZ1A 4PBGA 1B54A 3HM7A 2A3EA 1W6TA 2BY1A 2V3EA 1PHWA 4AUBA 3L23A 1W5OA 1KGWA 4AVOA 1EF3A 3M0MA 1FCUA 4EOUA 1ADDA 4I3GA 1W3IA 1BWLA 3S5SA 4LY8A 2HSAA 5LXEA 2AKZA 3OZOA 4DWSB 2BXYA 2DT0A 1GHSA 5FKYA 1PL9A 4GYPA 1QK2A 1UC5A 4IHCA 4INFA 1RA5A 3BURA 2WPBA 2YA2A 4ADUA 2NX3A 3EKGA 5D8ZA 2Y89A 3CU2A 2PDJA 3W84A 4NJIA 3QZEA 4L1XA 1QRQA 4PCFA 1H7NA 3D3FA 4Q8QA 3QFEA 1V0MA 3NVTA 2V5JA 3B9EA 3V0SA 3AI0A 2VEPA 3LK6A 4ZO8A 3O6DA 3T42A 3BW3A 4NIRA 3VNLA 3BXWA 3T9PA 4A2SA 2DIJA 3MVTA 3MMUA 3WQGA 1GTHA 4EPKA 3CMJA 1NVMA 3M41A 3G1XA 1TE6A 2VWTA 5A8NA 4LS2A 4GBDA 1EGZA 5A6BD 2HBXA 3Q2DA 4NP7A 2WCSA 2ZRXA 1JXJA 1THFD 2NX9A 3IARA 2XPKA 1EL3A 4KS0A 3W6MA 4W85A 2PE4A 5U4NA 4EVZA 1FY6A 3CAWA 2ZDSA 2Z00A 3GM8A 1KRMA 4CNTA 2VMFA 3TW7A 1RD5A 1SSDA 4WDUA 1US0A 4WKAA 2DVTA 3DYOA 2HNHA 1QR7A 4R3UA 1GOQA 5MKGA 2A85A 3W7KA 1PXGA 2CHRA 4OVXA 2EKCA 4LC6A 3W27A 3G18A 2CLHA 3TSMA 1LL7A 4FB7A 4GH1A 3RX3A 2W66A 3G1VA 3GNDA 4UOJA 1JZ5A 2ZVRA 4ML4A 3UA3A 4EAMA 4XKYB 5AECA 1WX0A 1KM5A 4X61A 3NZ1A 4DBDA 1UOZA 4DJFD 4NZ1A 3UESA 3NQEA 2A3HA 4OBRA 4MPQA 4ACZA 3WDJA 3BV4A 2VZTA 3W7PA 3QW4B 2PGFA 3RNDA 5BXRA 1J96A 3VCNA 4K2SA 1ONXA 4KCVA 1VLWA 3SSJA 1UWRA 3W87A 4LANA 4RZBA 1MEIA 1J01A 1SFTA 3O3RA 3GNRA 3GXPA 2ZE0A 3ITXA 3VDBA 3P61A 1G1YA 5HJYA 4IUGA 5A6MA 1TWZA 3QR0A 1EX5A 1ISWA 4B5UA 4UMBA 4H6EA 3OVGA 2ZX8A 4R7JA 1GNXA 3MYPA 1XINA 1EJTC 1R3SA 3F1QA 3BJSA 2E9MA 3L7RA 3A3XA 3W1XA 2WVVB 2DZSA 2OWXA 1K6AA 3NDZA 4DZHA 5A8OA 1JPDX 1SSGA 1G4EA 1XG4A 4ML9A 5FEPA 4XVDA 3B9NA 4UWMA 1IWBA 2PRMA 1ZENA 1KFKA 4GVHA 1ZCCA 3MI6A 4ZOEA 1XBXA 4DJEA 4KFOA 3GXIA 1OCJA 3B0YA 5FF2A 3U5UA 4ORMA 4QGCA 3DKLA 1EP1A 3LNPA 4HVXA 1SZGA 1JF5A 1MW1A 3EB3A 5LIXX 3A24A 2JKPA 5AKQA 3S1VA 4KW2A 2A3BA 3AHXA 2J8GA 3B3DA 4S3JA 4B2DD 5F1UA 4LBSA 4JTLA 4PL2A 1RHCA 1MXGA 3VOIA 2PDQA 3ITVA 4MKNA 1JI2A 3GHRA 1MUCA 4PBFA 3MQTA 1K77A 1W1YA 3M6DA 3MUY1 5CJ5A 1WNOA 4B16A 3R8RA 4BK9A 4XD6A 4DELA 1L2QA 2D3LA 4O1AA 3VIHA 1RJPA 2WMGA 4XO7A 3A22A 3NXFA 2XIQA 1Q7ZA 2J13A 4HP5A 1GVYA 4EX4A 1OX4B 2YA1A 1DORA 1CLVA 2XIBA 1FCVA 1L6YA 1J79A 2GJPA 3WMBA 2Q6ZA 2GGHA 1KM0A 3RCMA 4WSKA 3MWAA 1MMFA 3QR1A 1VFUA 2XVNA 4J1OA 3I4KA 5DT7A 4RPQA 2J4GA 3S8HA 2Y70A 1W56A 4QAIA 4CN1A 4NZ5A 3EPOA 3QF0A 3W1TA 2FDSA 2YXOA 3HBLA 3LSBA 3S2MA 3GXMA 3SN0A 2RDUA 2CFFA 4OT7A 3VNIA 3QKZA 3ALFA 3PPGA 4N9DA 1CDGA 4IPLA 3P74A 5E6YA 5DRIA 3TYZA 1ZJAA 1PKMA 4QFUA 1TR1A 2G5WA 3VGDA 3AXMA 3KP1A 1P0NA 3UYIA 4QLJA 3P82A 2QKFA 4Y2WA 1R9XA 1C8XA 1CI1A 1HJQA 1I4NA 4JFVA 1GCYA 3IGSA 3AIVA 1R9ZA 3AIEA 2O9RA 3HQPA 1VF8A 4DEFA 3CJPA 1BGAA 2G37A 3NO3A 1WXJA 5EMUA 4BWLA 3WLMA 4HSOA 3BANA 4RPPA 3E5PA 1KM1A 3SZ8A 1TPH1 1JEZA 3EB4A 1EBGA 1QNSA 3NOYA 1GQLA 4FIQA 1LLWA 5M03A 3WJXA 1CZ1A 1QOPA 1NWRA 1V08A 2F61A 4Q6XA 4BI5A 4YMZA 1AJ2A 1UR3M 2ZUUA 3TCSA 2WMIA 2VZSA 1ZS2A 1I0DA 4XBKA 3BMVA 3E2QA 1YEYA 4TX9A 3RO8A 1RBAA 4A2RA 3URQA 4G6CA 3TLQA 3VABA 4JFTA 3TROA 4WXZA 2JK2A 2PDLA 2E77A 3G22A 3TLLA 4YHEA 3O7UA 3TJLA 6ENLA 1FX6A 1H63A 1JCMP 1IYXA 3DZ1A 2CLPA 2PGRA 4IPIA 4QJ3B 4Z1BA 4Q8NA 4IMDA 4KWWA 2XZ9A 1X7FA 2DZAA 3USZA 3ONBA 4AZGA 4C6EA 1QW7A 1ME8A 3ARRA 1VFHA 4Q7IA 2XDFA 1E15A 1RBLA 5B7YA 2VCBA 1GG0A 4PN2A 3NOEA 1H1ZA 4F2UA 1GQJA 2KX9A 1BF2A 2GUUA 1LZOA 3VKAA 2UZ9A 3DFSA 1TWDA 3PBVA 3IRDA 4OZOA 2INZA 3N3MA 3W1MA 1YTDA 4AWUA 4KERA 4WY0F 1H7OA 4KT2A 3POCA 4HIBA 4IQDA 1WO2A 3RLVA 3W7OA 5SWUA 3PS7A 1EC7A 1FQ0A 1F3EA 3FA4A 5AHMA 5CPMA 1QFEA 3T44A 2ZDRA 3ABZA 2R1PA 2E8YA 5CEWA 1JIBA 3CL6A 3ZVHB 2D0HA 4GINA 2ZXAA 4JTKA 1LL4A 3I3EA 3CBWA 5FF4A 1FA2A 3S2NA 5XIAA 4HPGA 1IT7A 4M56A 5J04A 1GVFA 1B5TA 2X0YA 2WM1A 3WF4A 1KGUA 3L9CA 1E6NA 3HPXA 3LXAA 3H2FA 1ONRA 3ZQ9A 4B91A 3EWUA 4PCTA 1OGBA 2WOQA 3G0UA 3LGEA 5AYIA 1DIDA 3BSGA 4WSHA 2J27A 1KR0A 3QH2A 2HS8A 2CZDA 5DELA 3FJLA 4HNNA 2QV5A 4P5UA 1LCOA 2QUNA 2EXOA 4D6IA 3RHGA 1RCOB 1BSLA 4MUZA 2XSXA 3R2GA 3NM1A 4N4PA 3QV8A 4E4PA 3EEZA 3K2GA 3M0KA 5G2IA 4DBSA 4CN6A 1U33A 1N8IA 3THCA 1AFSA 4PMVA 4JNZA 4Q8WA 3HG4A 4I90A 2C1IA 3G6MA 3SCRA 4QROA 2XH0A 1GTEA 1B1YA 3DDMA 5D04C 5D9OA 3W00A 4FR1A 2SFPA 4JIRA 1IXNA 2EQDA 3DFTA 1LOSA 1ICQA 3W23A 2BBFA 4RZ4A 2FLIA 3FS2A 1HVQA 3V0TA 2DGAA 5FJOA 1TB3A 1UIOA 1OK6A 2VR4A 3WLRA 1O66A 3WH5A 1FWCC 2YYUA 3LGDA 3SGUA 1W9DM 1UUQA 1TPEA 5LNVA 4KCUA 3W1LA 5XIMA 1WB0A 3GHUA 5BXTA 3OB8A 1UJPA 2QMJA 3R89A 1ISVA 1FHVA 2GVEA 2REQB 3TQVA 2GLKA 3UCCA 3T40A 1POKA 1RXOB 3VD3A 3OIXA 3BLPX 3V0UA 1B3XA 4NQ1A 4O15A 2XYLA 1A4MA 4O4WA 3V5FA 2ZRYA 1V0LA 3K1GA 4MVAA 1ZB5A 4L1WA 5AN7A 3OLIA 4EF8A 3WLKX 3EEGA 1H11A 3H2MA 4ZVJA 1BTMA 1E1CA 2J66A 4J3UA 3OA3A 4UNIA 1VBJA 3GU9A 5G1MA 3F5LA 1I2NA 1N7KA 2XGZA 4IIDA 1DQXA 1EUAA 2H8XA 3NNTA 4PCPA 1EJXC 2GQ3A 1YXCA 5AVHA 3V7PA 1S2UA 4LXFA 5BYWA 3OP2A 3EWBX 2DORA 4IJBA 5AHIA 3ABSA 3WJSA 4S3BA 2P3ZA 2OG9A 4TO8A 1CTNA 2PDIA 4N6EA 4U2YA 4AIUA 4HNTA 2YJQA 1XLHA 2DT1A 2FB2A 3A9IA 4FALA 3GSMA 2IQTA 2QCMA 2WQDA 4KEUA 7TAAA 1J6PA 4QP0A 1UQYA 3MTWA 3S2JA 5C9XA 4W4QA 1P0DA 2XSBA 3R11A 2JALA 1K3UA 2VJXA 4TVUA 4WOZA 1J0KA 2H9AB 2VC6A 5KZ6A 2VR2A 3EOOA 4AD1A 3PUEA 2QEZA 1T40A 2XISA 3MKKA 5HWNA 1I60A 1NY1A 4DWSA 1TQJA 1C9DA 2DH3A 2P88A 3VNYA 4UUIA 5IBXA 2ISFA 3CEUA 3QM3A 5EKYA 4F0LA 1D9EA 2PDMA 4HK7A 3EPNA 3ANVA 1BLIA 2Y2WA 1HIZA 1XYAA 1AQMA 3M47A 4PUMA 2PDFA 2PU1A 1VFSA 4K68A 4G7FA 4XUGA 3O0FA 1H5YA 1FWDC 1OHLA 1U83A 5CBIA 3WEMA 2O9PA 3UF9A 3VNDA 1YIXA 1CGWA 1KBJA 4IXHA 5JIPA 1AL7A 5LA2A 2MUCA 2CU0A 3VX1A 3S1XA 4DO5A 1E51A 3MUAA 4NI8A 5F2IA 4K7VA 4GUJA 3PAJA 1O68A 3M0JA 1J93A 3NQCA 4MB1A 5CAHA 2XU2A 3E5BA 3LYEA 4QNWA 5JVLA 4NXKA 1RZMA 1RJRA 3N19B 2OLSA 5C9UA 1DJNA 3HQNA 4GH3A 3WKZA 1CXEA 2CZEA 1Y65A 3CUXA 7A3HA 3A4WA 2R14A 1XIGA 4MKSA 3HPAA 4B3LA 1B31A 3VOGA 2WJEA 3UG8A 4UFIA 3KFTA 3PUDA 4LUIA 3LGGA 2OMAA 3HFYA 4A29A 4S3GA 4PB5A 2QJHA 1S2CA 3ARSA 2F38A 4O1BA 4XKYA 4GE8A 4Z0JA 2PRHA 2PODA 4LUTB 1S5MA 2V69A 3JUGA 4H9VA 1NOUA 2CITA 1YDOA 4YXGA 3FGCB 2OGYA 2Y5JA 3CQ0A 4UFHA 1K03A 5I03A 2VL4A 3TTOA 3TXZA 2CKRA 2WBKA 5E0CA 1V4YA 2Q09A 4J3SA 3U3HA 4YJ5A 2GQ8A 1HT6A 4J2PA 1H0GA 1SU5A 1BVNP 3G1YA 3UY7A 1UH2A 1XM3A 2VFGA 4NAFB 4FIRA 3DI0A 5DCBA 4AFYA 1BG9A 2X1UA 1KCZA 1UKOA 5C6MA 1JZ7A 1FH8A 4Z2KA 3CC1A 1T7LA 2BHUA 4OFCA 4X63A 5DCDA 4TV6A 4U28A 5CZSA 2ZTJA 3LCLA 3B8DA 4KPLA 3TQKA 3W02A 5FCZA 1KXQA 1NOWA 1SFLA 1OABA 4DF1A 2PWFA 2RHGA 3TQPA 3U6WA 3VOHA 1JUEA 3N17A 1PX4A 2WVVA 4H01A 4B5SA 3TUUA 1VCVA 1MQRA 3SQLA 1VJZA 4OOZA 4O28A 3K4AA 1KKOA 1MRAA 3P0XA 3ITTA 2XN0A 3UFYA 4H7VA 1R3YA 4NJHA 4JDYA 3RF9A 2D2HA 4O4VA 4E8GA 4I9JA 1HW6A 3QV6A 4L1GA 3HU7A 3STGA 1WXZA 2OYMA 2XN1A 2RDXA 2Y7FA 1KC7A 3OG3A 4UTFA 1ZP3A 1OX5A 2UY3A 1TX2A 1I6NA 3OHMB 4IPPA 5TNVA 2GK1A 1YKWA 1SW0A 4CU6A 4NZJA 3EA3A 3UWYA 3KTXA 2W4XA 4HZMA 3VIGA 4QEEA 4UFJA 4ADTA 3CUFA 1XIMA 4GIEA 4XZWA 3M5VA 1Z69A 2QQ6A 2BB0A 3FK4A 4LYKA 1R7OA 3PZVA 4LVFA 2TPSA 6REQA 3SJ3A 3QW3A 4V27A 2F2KA 1Q6OA 5FJJA 3LOTA 2CHOA 2YKKA 2WKGA 5CC6A 3ME3A 1PE1A 2H6RA 1XHGA 3BO9A 1OX4A 3E6EA 2FPYA 3SUVA 3I65A 1BG4A 4ZB5A 1PHQA 2VVSA 1LBFA 4R88A 1EGMA 4A05A 4ZB0A 4UR8A 5C7HA 4GWEA 2OX1A 1Q4NX 3T2PA 3VNKA 1C91A 2ZBTA 2BHYA 4Z1YA 2WZMA 2WNNA 2FTPA 2GWNA 1JCTA 1XIIA 1ZNNA 1DJXA 1NARA 2IKHA 1HKWA 3W1RA 3DECA 2VELA 2XTKA 2I5QA 3W6YA 4YTRA 4W8AA 4Z2LA 1SJCA 1XIFA 3GU2A 4YVXA 1KKRA 1KB3A 3G3DA 4HCHA 2VGGA 1FHLA 1EHNA 2IXVA 2XVPA 1TG7A 4Q8PA 3GXDA 4YYFA 5U7SA 4D6JA 1O6IA 1ITXA 5JH1A 3EA1A 4ZQOA 4AXNA 4FEZA 4FR6A 3RG6A 1JG9A 2I5GA 5I00A 3W2KA 1V3IA 5M17A 4ZENA 3TSDA 4GISA 1ZLPA 4NHVA 1D3HA 3AXXA 4ENLA 1QTWA 1OGGA 5AYXA 4L6OA 1XISA 3SO7A 3WUFA 1YMYA 3S5NA 3OJGA 1H7XA 1F4AA 4K3ZA 4UB9A 3BZGA 3ZVIA 2BOEX 3DYMA 3GHSA 3CHDA 1PBGA 3N9RA 1K9DA 4AD2A 1CW2A 2XH2A 4UCFA 2P1FA 2GJXA 2IQ0A 3HZ3A 4I5XA 1XW8A 4RKAA 5T26A 1XC6A 1CXFA 2OSXA 4CQ8A 1VRDA 2BODX 1WDQA 4RDYA 1E3ZA 2OFJA 1MQQA 1EBHA 1EC9A 3IUIA 5HQMA 5C9WA 3SAZA 5HNUA 3LPOA 3GBDA 4CVWA 1H62A 2YXXA 1EIBA 3TNBA 5J5RA 1HKKA 4H3DA 1Q7MA 4YVVA 3ZLHA 1ZL1A 3GHTA 5CPLA 3EYPA 4CD8A 2VFFA 4M6PA 4H41A 2ZUSA 4HTYA 1O95A 4Z0SA 3D0CA 3DHUA 1OGSA 1RCXB 2R1LA 3H26A 3H2CA 3G77A 1TZ7A 2VZOA 2WQPA 1V0NA 2FGZA 5BOEA 3KRBA 3RLHA 3V1HA 1TQXA 2BTMA 3AS3A 4HOWA 4L4LA 4AWEA 1WAWA 1NJJA 3WG6A 3GR7A 3Q94A 2J88A 2EPHA 2DPEA 3UJRA 2X2GA 3AWNA 4NJGA 1MXSA 4O16A 3TZNA 3TR9A 5JUVA 3EMQA 4S2BA 1GZJA 1JAKA 1OYBA 2Z1WA 2E9BA 1EB3A 1KBKA 2W67A 4GUFA 3GWQA 1YE4A 2CLEA 3W7GA 4AC7C 1VHCA 3FN9A 1LUCB 2E9LA 5C7VA 1IEIA 2IPWA 2QCFA 2FHCA 5D32A 5HNRA 3CUGA 4JYFA 4GABA 3D6NA 2QHAA 2P5NA 4RLIA 3C0SA 4RX0A 1PTDA 2WAGA 3I68A 5E70A 5A8QA 3EXRA 5M1TA 1I2QA 3FEQA 4AYGA 4I8DA 1GOMA 4PMDA 3MZ2A 4PTNA 4W7WA 4CNSA 1AJZA 1GYLA 3T0CA 2QLYA 4HPNA 2P3EA 1NF7A 2XFWA 1DP0A 1OC5A 2VRQA 3DC8A 3RPMA 4DXKA 3UCDA 2V2CA 4DJED 2GOKA 1QNPA 2DQWA 4XZHA 1B57A 4HZ7A 4CD7A 4IT1A 1PX3A 1L6SA 4JHZA 1VEPA 3XIMA 1UWSA 1GVIA 1FCBA 2VM8A 2VFDA 1E9YB 5AYZA 3PSVA 4NILA 4ICCX 2GGIA 3OLDA 3QSTA 3GG1A 3PBYA 4IICA 1YRRA 5DXXA 3P7YA 1W1PA 4BI6A 1MFVA 1OD8A 4OE7A 1GQNA 3ANUA 3VKCA 1XDLA 4C7FA 1OF8A 1JL8A 1MYRA