3DBNA

Crystal structure of the streptoccocus suis serotype2 d-mannonate dehydratase in complex with its substrate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
363
structure length
349
Chain Sequence
b'SHMKMSFRWYGKKDPVTLEEIKAIPGMQGIVTAVYDVPVGQAWPLENILELKKMVEEAGLEITVIESIPVHEDIKQGKPNRDALIENYKTSIRNVGAAGIPVVCYNFMPVFDWTRSDLHHPLPDGSTSLAFLKSDLAGVDPSKEEMKAIIENYRQNISEEDLWANLEYFIKAILPTAEEAGVKMAIHPDDPPYGIFGLPRIITGQEAVERFLNLYDSEHNGITMCVGSYASDPKNDVLAMTEYALKRNRINFMHTRNVTAGAWGFQETAHLSQAGDIDMNAVVKLLVDYDWQGSLRPDHGRRIWGDQTKTPGYGLYDRALGATYFNGLYEANMRAAGKTPDFGIKAKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannonate dehydratase
publication title Crystal structures of Streptococcus suis mannonate dehydratase (ManD) and its complex with substrate: genetic and biochemical evidence for a catalytic mechanism
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Lyase
total genus 108
structure length 349
sequence length 363
chains with identical sequence B
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03786 UxuA D-mannonate dehydratase (UxuA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3dbnA00
4DUOA 5TNVA 1A0DA 1S5MA 3KCOA 4YTUA 1S5NA 3VYLA 4GJJA 5B7ZA 2J6VA 4GQBA 3TC3A 4ZB5A 3QZAA 2QUMA 5XIAA 2X7WA 3KBJA 3KCJA 2QUNA 3OBEA 5EMLA 1XINA 3BANA 3ITTA 2G0WA 3L23A 5EMJA 1DE6A 3FVMA 3VNMA 3XINA 4Q7IA 1QTWA 1YX1A 3C0SA 4X60A 1XLAA 1XLGA 3M0YA 3BZGA 1XYMA 2G4JA 3UA3A 4A8LA 2NQ9A 1DE5A 1MNZA 4YTQA 3BDKA 1O1HA 3M0LA 3DBNA 4G56A 5H6HA 3AAMA 1QUMA 1XYCA 3KBVA 3CQKA 4EACA 5AVNA 5H1WA 4PGLA 4W4QA 2I56A 1I6NA 3QYSA 4GLEA 1XYBA 4DVOA 2ZVRA 4QE5A 3CQHA 1XIEA 3UVAA 5XINA 1CLKA 2Q02A 3JU2A 2OU4A 3P14A 3WQOA 3UA4A 3DX5A 3AYVA 3AYTA 4A8RA 1XLHA 4E3VA 4HNOA 4HGXA 1DIDA 3ITOA 3U3HA 1XYLA 1XP3A 4KW2A 2GUBA 2NQHA 4QEHA 2HK0A 2HK1A 2XIMA 3M0HA 3VNJA 2GYIA 1XLCA 4YTSA 4XIAA 1XICA 3NGFA 1XLJA 1XYAA 1DXIA 1K77A 3KBMA 3QC0A 4LNCA 4ZB0A 3XIMA 5XIMA 2XINA 3KBSA 5EMMA 1XLMA 1XLEA 3VNKA 3ITLA 3VNLA 1XIMA 1XLKA 1XLDA 2XISA 3KTCA 3LMZA 3P6LA 5B7YA 4K3ZA 1TZ9A 3ITXA 8XIAA 4X63A 3CWHA 5EMKA 3U0HA 1XIGA 3ITVA 3BZJA 3KBNA 4QE4A 5I7GA 2NQJA 3BWWA 4HHMA 1XISA 4YTRA 5C9ZA 4X61A 1XLIA 3CQJA 1XLBA 3QXBA 4XSMA 1D8WA 4PFHA 1BXBA 4QDPA 1DIEA 1XIBA 3CQIA 2ZDSA 3KWSA 4ZB2A 2QW5A 5J8LA 4QE1A 5FA5A 3ITYA 3VNIA 3M0XA 1XIFA 3AALA 6XIAA 3KBWA 4QDWA 4QEEA 4XIMA 4J4KA 3TVAA 3M0MA 5B80A 1XLLA 3GNXA 2I57A 4XSLA 3KCLA 1BXCA 4EAYA 4K1GA 3N4AA 5AVHA 1XLFA 3IUIA 1XIHA 2GLKA 3UXIA 3C0QA 2X7VA 3XISA 1XIIA 2HCVA 2QULA 4ZBCA 1A0EA 4XISA 6XIMA 1GW9A 1XIDA 4XKMA 4YTTA 8XIMA 7XIMA 1QT1A 2GVEA 1XIJA 4HHLA 4OVXA 9XIMA 1MUWA 4A8IA 3IUHA 4US6A 4GJIA 3UU0A 3M0VA 1OADA 9XIAA 3CNYA 3IUDA 1A0CA 1I60A 3C0LA 4A8NA
chains in the Genus database with same CATH superfamily
5EFDA 3NDZA 4JHZA 1S5NA 3M5YA 4PSRA 4UFIA 2CCRA 4GKLA 5HANA 1EGMA 4KF1A 2G0WA 2P8CA 4H9ZA 1VYRA 5F2GA 3B0YA 1TQXA 1RR2A 4DF1A 2DORA 3DGBA 3B9DA 3NQVA 3KE0A 3DFSA 2WK2A 4D72A 1JCXA 2VZVA 1XLHA 3WQ5A 1LWJA 1EJ7L 1ECEA 3G22A 3WJWA 2WO5A 1SFTA 4IX0A 4H9XA 3WD2A 4Q33A 3VIIA 4F0MA 1VP5A 4Z2GA 4PMOA 1FH7A 1AA1B 4JX6A 3PUGA 4HZ8A 1OFQA 1B57A 4TO8A 3DENA 4YTRA 3VIMA 3DGRA 4UQAA 3TJXA 3N73A 4QE1A 3COTA 4GK8A 3WQEA 4U3CA 4P7LA 3LOTA 5ABFA 2G96A 4XO7A 4ATLA 2TAAA 1QOQA 3C0QA 4L4MA 5F4XA 4A3HA 3RDKA 4AW7A 4D6IA 3B0PA 1G4PA 1RZMA 1X98A 4L65A 1B54A 1U30A 4PMNA 2OGJA 2XU2A 2CW6A 3TN5A 3V5CA 2JGQA 1BKHA 4MF4A 1TMQA 5C9WA 3RM4A 3W70A 2ZX9A 5HMEA 4AMCA 3ALGA 3W7KA 4Q4PA 3OBAA 1X6UA 4LVBA 2J7CA 5EKYA 1Q2RA 3LLDA 4IIDA 1R7AA 5IHRA 3N13A 3TX9A 2AKMA 3GBEA 4JIRA 1H5VA 1JDDA 2XM1A 4JTAA 4E8CA 3JU2A 1EZ2A 1FWSA 4TVCA 3FSTA 2W61A 3HPSA 2YXXA 1LQ2A 4Z1DA 2OZTA 4UTKA 1AZ1A 2QPSA 4V1XA 4CQ9A 2PCEA 4C1KA 4R9XA 1KR0A 4ZMGA 2XISA 3BO9A 3UZXA 2CHNA 3ITVA 2Z1KA 1YTKA 4HZMA 3AMLA 3S6OA 6ALDA 1R2TA 3PP7A 2GGHA 3TN3A 4B2DA 1LF1A 3M0XA 1T8XA 1FHUA 3BW4A 4DO6A 1HG3A 1V5XA 2A6NA 2J7DA 4B5NA 4C6QA 4DJDC 3EA1A 1UWIA 3U2CA 3ORWA 1HJSA 1VH7A 2JF6A 5JH2A 4O15A 3O15A 3IGSA 3NQ2A 4ZGYA 5D37A 1UD6A 2DZPA 1I60A 3UWWA 1GORA 1E9ZB 2YCLB 1JZ6A 1ZAHA 4GZJA 1NY1A 3A47A 3R0DA 5D9NA 3EB4A 2XFFA 3OVPA 5U7SA 2BY0A 2PA6A 1Y5XA 4K8GA 6ENLA 1XLAA 3F4VA 3VI2A 3FYYA 1VCGA 1GKQA 1LL7A 3WLKX 4NY2A 3B8TA 5AVNA 5BROA 3KLKA 2DZAA 3POHA 3F7JA 3I65A 4GA8A 4MGGA 1FRBA 2DZTA 2E9LA 3A22A 4DBDA 5HQEA 4OV9A 3GIQA 4KRUA 1J5TA 5BW6A 4KEMA 1H49A 3U7VA 3S0CA 3E96A 3S9IA 1GT8A 3WFZA 2PF0A 2VWSA 4GZIA 5F7UA 1R3QA 2INEA 5AZ1A 5E5CA 5H8PA 4NNCA 4XBKA 3E0VA 2FFCA 5GJPA 1KM5A 3DFTA 2FZDA 3W0KA 5C2GA 1GJPA 2ASHA 2AAAA 3RLVA 2O4MA 5CXPA 4NZCA 1BFNA 1U5JA 3N04A 4JBRA 1MW2A 5AOUA 3PSWA 3WNPA 3E2RA 3SRDA 2KAUC 2RDXA 1IT8A 3N9RA 2PTXA 3N2BA 3QQ1A 1XSIA 3O1NA 4MUPA 4PBGA 5LXEA 1KGXA 2OB3A 1S5MA 3ZS4A 1EXPA 3VDCA 3WD4A 3SY8A 3E1F1 3ABSA 1SJBA 5J04A 1E4LA 1L2UA 1P7TB 3SCSA 1SW0A 2EJ1A 4IUOA 3M0KA 1F5ZA 3AHXA 2D24A 3S47A 3D0CA 2VCAA 2XVGA 4MY8A 2OEKA 3CQHA 3BG5A 3G8RA 1VBUA 4TXEA 2D73A 3UA4A 1PSCA 4HIBA 5T9CE 1B9BA 4KCUA 2WNNA 3GDTA 4R5EA 1KKRA 4RW3A 4PMJA 1GG0A 3ITGA 1R3TA 3IVUA 1DXIA 5HR7A 2X1IA 3F2DA 2DPEA 1ITXA 4AAJA 1KBIA 1M3UA 1BF2A 3WD3A 5AHIA 4W7VA 1ISZA 4FOUA 1UW9A 2V5CA 1UR3M 1K9TA 1RLDA 1HT6A 3E9AA 3EA2A 4ACZA 3D46A 2VX4A 2GJLA 4JIHA 3LM7A 1TMLA 3G3DA 1ZJAA 3VOIA 2ESCA 4U2ZA 4JFTA 2C79A 3EXRA 4AD3A 2O9OA 2VYOA 4AX7A 1RQHA 4MUZA 3AI0A 2XUCA 1WUFA 3IJIA 8CGTA 5LSMA 1UASA 4DJEC 3EKZA 1TWZA 4HPJA 2Q8ZA 4ML9A 4E4UA 1RP8A 3LZ5A 1EJTC 1S1RA 4GI6A 3ISIX 3V0SA 2J75A 4XAPA 4JQ4A 1FTXA 4MWAB 2DJXA 1IIHA 1F4AA 5U4NA 3OZOA 5EU9A 1S2UA 1J11A 4AD2A 4CCDA 3MBFA 1P6WA 2ZVRA 1EC7A 3BE7A 2G3FA 1E1CA 4OECA 2C6QA 3LENA 4NQ1A 3ABOA 3OPSA 5REQB 1KGWA 3WQOA 4EANA 2V5JA 3M0ZA 1GYLA 2E0PA 3M0JA 4JQ3A 4WSHA 3LV6A 1KRMA 3I4KA 3O0KA 3DECA 1ODUA 4HTBA 1XICA 4CUCA 4O16A 3VGFA 4IGSA 1JZ4A 3AMDA 3KBSA 1I2QA 3EGJA 1K8YA 1OQFA 3TXZA 3NXLA 4LALA 4AIOA 2YFNA 3A21A 1UUMA 5CZTA 1K9EA 1J10A 4L4OA 1UZDA 1PHQA 2NWRA 2ONEA 1OFBA 2PD5A 5PTDA 4IQJA 4WY0F 3CIXA 1PO9A 1UWTA 2G5WA 3T81A 1SFSA 2J62A 5G2WA 3T40A 3ZR5A 1IQ8A 2E6DA 1Q6DA 3AC0A 8XIMA 4O1BA 2PAJA 3ARZA 4B9YA 4PUEA 3TJLA 1AJ0A 1TYGA 4DUOA 3OQEA 1LG2A 2EAWA 1W3HA 3DERA 4RDZA 4YWIA 4MAVA 4IJBA 3C86A 3GTFA 1NVMA 1QVBA 1JCMP 2GVLA 2HISA 3CHDA 4E2VA 1EA0A 3VZXA 4NJHA 4X22A 4JNMA 5DFAA 1UA7A 1OYAA 2V3GA 3RNDA 2C71A 5G1MA 1UH2A 2R1NA 1SFJA 3WSUA 1TMHA 1CXIA 1DJNA 4H19A 3QW3A 2HMCA 4YMZA 4DBEA 2RGMA 1TV5A 5G1YA 4LS1A 1VFLA 1YIXA 5BU9A 3EA3A 4LPCA 4C7GA 2VFDA 3FGCA 1UG6A 1LRTA 1WKFA 1VPQA 4PA8A 1JZ5A 1Z7AA 4XKYA 3E0LA 3C8NA 3CUXA 5FL1A 4IGMA 3KBNA 2GGGA 3NGJA 3RXZA 4LBRA 4FXRA 4I5UA 4ZZ9A 2F7FA 4NRSA 1GVFA 2E25A 3QC3A 2DT1A 1HFBA 3B4YA 1JYVA 2XSXA 2Y62A 3LGGA 4I5XA 3W37A 5C54A 4JL2A 4URIA 4KETA 3L4ZA 4FO4A 4HNNA 3RAOA 2BFGA 4M29A 3MI6A 1V6VA 3NPVA 5HULA 1V0KA 1DJYA 4Z1AA 3AIRA 4H01A 3IUHA 1OADA 3JW7A 1F3XA 2DT2A 3VIGA 3GDRA 1VRXA 4HHHA 4K7VA 2PDQA 1A5LC 4HB7A 2E28A 4AF0A 2WM1A 1IF2A 3GR8A 1UKPA 4GI8A 2VEKA 5IM51 2C13A 3CO8A 1H50A 3AIEA 4NJGA 3LPOA 5LKYA 4GYJA 3B8SA 1PYMA 2EJAA 3RMEA 4GOAA 4PUUA 2JQXA 3MSGA 1ICPA 5EBUA 4HNOA 4O4VA 3M1ZA 4ATDA 4CQ8A 3WL1A 3M41A 3CZGA 3P7YA 4IMGA 5CG0A 1XIMA 2WPBA 3W7NA 4NZ4A 3FK4A 1KGUA 4RKAA 1K3UA 4CD4A 5M17A 2WNWA 1Q4WA 1AL7A 3QV8A 1HL2A 5BXTA 3MMWA 4BCEA 1JDAA 3PZVA 3SAZA 4JTCA 2WMKA 1A5NC 1GPFA 2ZE0A 3GVQA 2Z1SA 2XN2A 3MCMA 5M03A 3W7DA 1AJZA 3RO6A 3TIMA 3H7VA 1XFBA 4XUGA 2ZRVA 4HPXA 1N2VA 1ADDA 3CL6A 3JS3A 1XIJA 2F6UA 4D1IA 3FKKA 3DBPA 5ABTA 4HCDA 5E6ZA 3BLFA 3SCQA 5KSWA 3Q45A 3B9EA 4N9EA 4ERIA 1E43A 1E6NA 1LM1A 1HO4A 3IJ9A 4KWSA 2PTDA 3KWXA 4MJMA 3QQWA 1OX5A 4IL2A 1XRVA 1MXGA 3W1PA 4J3XA 3GVVA 3LHYA 4QG6A 1BSLA 7CGTA 4PGLA 3SO7A 4XAGA 2R94A 1DXFA 1QW8A 2PDLA 4MFEA 4PB3A 4KS0A 3EWXA 4AHQA 4HSHA 4ZL1A 2BV9A 4AEEA 4YVPA 5H8MA 4HK7A 1E71M 3G6MA 1NEYA 2RJHA 2GVGA 3BLDA 1VEOA 4CNTA 2PWGA 8XIAA 3LPFA 1ADOA 4F0KA 4QROA 4XZNX 5IFTA 3PTMA 4IFKA 4JFSA 1LL4A 4FZIA 3L4WA 3IPWA 5I23A 3M6DA 3W1AA 4R7OA 1R9ZA 2RJGA 2DIJA 3ONBA 2WZEA 4YN5A 2X7VA 1P6CA 3NWRA 1ZPTA 1CECA 1T7LA 4IFOA 2CKSA 1C90A 3KP0A 3M47A 4KGJA 3NEVA 4QLJA 3MPGA 3NQBA 4W9TA 4IIBA 3GIYA 1QBBA 4PCFA 1MEIA 4TOQA 4B92A 2J7BA 2ALDA 1CIUA 4GX9A 2ZADA 2EPHA 1M7JA 2G4JA 4XZHA 4QS5A 5DMLA 2Y4SA 4Q7NA 1E9LA 3PPGA 3T1GA 4HHPA 9CGTA 1XBXA 2R1LA 3M7SA 1K6WA 2V38A 2PWFA 1TWWA 4I8YA 2Z1VA 1CLKA 2BLEA 2O92A 4CQCA 3KL3A 1L8NA 2PRLA 3RM8A 4FEZA 1CGYA 3I6EA 2VX7A 3PK7A 4UUIA 1K8ZA 5A1AA 1SM9A 1E6XM 4WDUA 5XIMA 3EWWA 3LMZA 1LBFA 3ITXA 4EXQA 1TPFA 4PODA 2PP0A 2VGGA 4FLRA 3C6CA 3IVSA 3DHFA 4GZ7A 1UD2A 3HTWA 4QG9A 5HPOA 1V77A 4XAZA 4KPLA 1BRLA 1JNEA 3PBYA 4F2BA 4B90A 2FGBA 4IGNA 4L4LA 3NPUA 5HNUA 2AAMA 3K46A 3VOCA 1EL3A 1UR0A 4DM1A 3BAWA 1ZALA 2VGFA 2WC4A 3N11A 1SSGA 1VFHA 2DGAA 2QUNA 3KHJA 4DAIA 4U4MA 3N14A 4JHMA 4W88A 1I2NA 3TYAA 4GCXA 1W1A1 1V02E 1NDYA 4IUGA 3G1HA 4DY1A 4AIUA 4ATWA 3IIOA 1BAGA 3TA9A 4M6UA 1UCWA 4PTXA 1QNVA 4BQ2A 1FWFC 3PS7A 4PEKA 3OIXA 4J3WA 4LRSA 4O0KA 1TIMA 1P1MA 2ABBA 5D9PA 1XLJA 3ZVIA 3B05A 1RXOB 1ZCOA 3TE9A 3KTCA 1KD0A 3VABA 5E93A 2WOQA 1HKKA 3NSMA 4JKKA 2WSYA 4IH3A 4V27A 1O5XA 2QJMA 3GUGA 5CZSA 1MNSA 1PKMA 1LLZA 2W66A 5DANA 3W7GA 1QNSA 3KHDA 1LCOA 2PDBA 2UY5A 8RUCA 4Y9AA 2ACRA 1WDSA 4DELA 2YZRA 1B30A 3AS3A 4JTGA 5FESA 2WAGA 3CAVA 3NZQA 3GWQA 3REQB 1WZMA 3LSBA 2D2JA 4Q4SA 2VVNA 4A8NA 3MYOA 1W1B1 1GVEA 4UOQA 2FHCA 2EQDA 2QV4A 3NYZA 2VHLA 3OBEA 3BANA 4N6EA 4UTLA 1YXYA 1JCLA 3RF9A 4C1NB 2W3ZA 5A8NA 2RKXA 4BR1A 5AC4A 3TDFA 1X1OA 4JIQA 1FXQA 4CQBA 3KBVA 3FEMA 1VPYA 3QRHA 4HOZA 3IARA 2NUXA 2AQVA 1JPMA 2Z0IA 4RXFA 3RRXA 3T8LA 3L0NA 1TPWA 2FH8A 2FPYA 4Z2LA 2NXIA 2ZOXA 4A8RA 1TO3A 1W17A 3LSCA 1GQNA 1U83A 1CGVA 4XAFA 3T8QA 3GR7A 3IRSA 2PB1A 3FJLA 4QHRA 3W4RA 2Z2BA 3GYEA 1QHZA 2VZTA 3ITLA 2TPSA 1B31A 5CJ5A 4X0VA 3N6QA 3V75A 4QJ5B 1EUAA 1QNRA 1CGXA 1AQMA 1B1YA 4A35A 4GGBA 1JR1A 3GXDA 3SGUA 2GGJA 3STGA 3N2XA 5D04C 4LYRA 3B4UA 5CPQA 5HBFA 3D47A 4Z2IA 2QIIA 1F8MA 3ARQA 7REQA 3L21A 3VD3A 1VB9A 1QNOA 4Z1CA 5EGRA 4MB4A 1WOAA 3C2EA 3VPLA 4DQWA 1GVIA 3EX6A 2GQ3A 4A8IA 3MV11 1UA3A 3QJAA 2GJNA 3VIJA 1A0CA 4X9YA 1R3VA 3VFCA 1E6RA 2VD9A 2ZC1A 3PTDA 4M56A 4GY0A 3XINA 3ZZ1A 1YQ2A 4XD3A 3K4AA 3CTTA 2O7SA 4IFRA 1DTNA 4PEEA 3K8MA 4K36A 2GVYA 4CQDA 2YBTA 4N2YA 3ALFA 1K7XA 1UKOA 3GQYA 1RCQA 2JF7A 1CCWB 1RPKA 1XIEA 3WLMA 1Q3NA 3BH4A 2XJ7A 3WH5A 4JTFA 3BLIA 1M41A 2PSNA 4D2JA 5LGZA 3TH6A 3LRLA 2ANUA 2PBGA 2DSVA 1HW6A 4J2PA 4JCMA 4ENLA 3V0TA 5K4XA 2JIWA 3NL6A 1Q4NX 1US2A 2YCLA 4UTJA 1Q5MA 3CYVA 3WLLA 2B7NA 4CLMA 2RDUA 3PZTA 2NSOA 3GG7A 1RAKA 3IGUA 5T8GA 4S3KA 4RZ5A 5I7GA 1TPC1 1OCNA 1U5HA 4NNAA 3DN5A 2TMDA 3RJXA 5CBJA 1SMDA 1CLXA 5EL1A 4HJFA 2D3LA 4G7EA 2AQOA 3HQ1A 1XCXA 1OG6A 4F2UA 4HNUA 1B4KA 1V0NA 1ZCCA 4YCPA 3NDOA 2AL2B 4Y90A 4FR6A 4J3SA 4PUWA 1QT1A 1VFUA 2VFEA 3TK7A 4D6JA 3HO8A 1ZZMA 4CNOA 5K3VA 4JR5A 2XWDA 3EWDA 1W9DM 3AZTA 4BF7A 4XUYA 4MM1A 3QZAA 3KX6A 1LQ0A 2DIKA 1PX4A 2GZXA 3NPWA 4EPKA 3URAA 1BXNA 1V79A 4XBSA 3UFYA 3LY0A 1DWAM 4FSAA 4ERGA 3LG3A 3SCTA 1HKJA 4JIEA 1ZUAX 1MUMA 4LXFA 4EKJA 2B31A 4HCLA 1WDWA 4MKNA 3AQUA 4W8LA 3YPIA 1B9ZA 3W26A 3VD4A 2HQAA 1J01A 5AB3A 1JDFA 1UHVA 3AHTA 1RLCL 3AFBA 3ANVA 4EF8A 2Y7FA 3WMBA 3A4JA 2I5GA 4UCFA 4K8HA 4WVXA 1ICSA 3S1WA 4REQB 3W7JA 1E5JA 3KOXA 1KBKA 4JTKA 1K9DA 2PGFA 3L9CA 3DG3A 3MHGA 1FWNA 2WXDM 3LU2A 3OGVA 3CQ0A 1Q66A 2IKHA 3IK2A 3PHAA 2OLHA 4DF2A 3UQNA 1A5OC 4IISA 1FWWA 3OZMA 1KTNA 5FSDC 4TQTA 1XH0A 3HMCA 4J4KA 2CBVA 1M53A 4Q8TA 1M6JA 1IXQA 3QMSA 5FI8A 2OOGA 3QH2A 4M7TA 3W7OA 1VJZA 1SFLA 1CPUA 1EJWC 2BDQA 3L7RA 4I6VA 4EP8C 2CWXA 2GDUA 1DJZA 3M0VA 1WXZA 2E5BA 1R30A 1XYZA 3O07A 2E40A 3W27A 2C0AA 3PF3A 3SCWA 3ZWTA 2VX5A 3H2CA 2Z26A 1OF8A 2DJLA 1OF6A 2RUSA 3WD1A 5SWUA 1FCVA 3GO2A 2ZIDA 3QPZA 1DOSA 4NAEB 1SZFA 2CBUA 1GKPA 1ITQA 3TZNA 2OWCA 3VX1A 4Y9PA 1ZBKA 2D23A 2QCLA 4JQAA 2QUTA 2ISFA 1EFZA 2FGZA 3LB0A 2ZZ3A 3ECQA 4PR4A 1DJXA 2VM8A 3I7RA 5AFDA 4UC5A 4AZCB 3PG8A 3M9YA 1L8PA 2D2HA 3H2EA 3GSMA 2OZ3A 2OYLA 1LT8A 1XLBA 3KRSA 3LI1A 4UFKA 3OIHA 1VENA 2QMKA 3OOQA 3VVGA 3SUUA 5DMNA 3L2MA 1G0CA 2CBIA 2OJPA 4LS0A 2PTWA 3W84A 3G1YA 2PGRA 1XW8A 1CYGA 4LB3A 2YGYA 3CB3A 5REQA 1C92A 3FW6A 1V3MA 4UTTC 3SCPA 1U1HA 3STEA 2ZA3A 3PC0A 1S1PA 3ENLA 5BOFA 5TIMA 3UETA 2V6AA 3ELFA 5HMFA 5F4SA 3Q67A 1Q7ZA 1TJ1A 3DFHA 1GZ1A 4GH3A 1QI2A 2BS9A 2V5DA 2CZVA 2GUUA 4KRZA 3LCLA 4NI3A 1BG4A 1YBQA 3L4XA 2OFJA 4PUJA 3B9AA 1I1XA 4DZHA 3HFTA 3GZAA 4DXXA 2E8YA 4EPEC 3C3NA 1TVPA 1OM0A 3B06A 4O8AA 1UWQA 1DXEA 2INZA 2WANA 4H7CA 2WPGA 3TQ0A 3T4CA 2EXOA 5BRBA 3GH7A 1X6NA 1GWJA 1W1YA 1W5PA 2BGQA 1SR0A 4FLOA 2CXGA 4QQUA 3WF1A 5E6YA 4IZGA 3SUVA 3GC4A 5CZJA 3TN6A 1OYBA 3EYPA 3PJXA 4O18A 4Z17A 4OE7A 5H8UA 4HZ6A 3AS2A 3UYCA 2QHAA 2BY2A 3OO2A 6TAAA 2TSYA 4ZTXA 3GNXA 4GFSA 1BXCA 5CBBA 3N4AA 1FHVA 1HVQA 1EC8A 1WDPA 1NDWA 1OT2A 4DNHA 2P50A 4CQAA 4AD0A 4WY0A 4H6RA 3WBXA 3CUIA 1EJRC 2CWNA 1XDLA 3KM8A 3UR8A 1FWDC 3BUVA 3IUDA 1Q6FA 3WUGA 4F40A 1EB3A 3QYQA 3OG2A 4ZB5A 1TSIA 2XYLA 1CXFA 2VGIA 4Q7IA 3KVLA 1BGGA 3UT0A 4MDOA 1O94A 3MANA 4C6NA 3BZGA 3PG9A 3N19B 1IXNA 2QCDB 1QFEA 2V8ZA 3ABQA 5GNZA 3VGBA 2P88A 5AYZA 3IV8A 4GQ0A 4LU0A 5CPSA 1E6PA 1F76A 2PDIA 1UBSA 4BHYA 3E0IA 2UY2A 1B5TA 5CJNA 4EPDC 1J18A 2Z7GA 3OZYA 2OSWA 1TV8A 3WLJA 1LLWA 2O9RA 3VE9A 3TQVA 2VQTA 4QITA 4OJYA 3BLOA 1UD8A 4GCAA 1WO2A 1IEWA 3P0WA 2X09A 1VKFA 2H90A 3CZEA 4UQBA 1CXHA 3M6YA 4MJ4A 4PFHA 1Q2SA 4FR1A 2NV9A 3APYA 1IXPA 3PAOA 4H7VA 1H11A 2HJPA 4XSLA 1XIHA 3FA3A 3R4IA 3R1ZA 2D22A 4WQ6A 3UZ5A 4YYCA 1G9HA 4QGCA 4AXNA 2XVNA 5C0QA 4HMDA 4RE0A 3HJZA 3CUGA 1C8QA 1G4EA 1YNYA 3S6TA 4P61A 2Z2AA 4UMAA 3ATZA 1EF3A 1ZFJA 5CPOA 4GPNA 3SUSA 3UA3A 1PEZA 1X39A 2IQTA 1NTHA 5ENLA 2P10A 4Z2KA 1Y65A 4PSPA 2R24A 2OVLA 3DCPA 5ABGA 2Q02A 1TCDA 4S3DA 1QXLA 3AHYA 1OGSA 3TTOA 5FOOA 2VL4A 3I10A 5HAOA 3IK4A 4HN4A 3WCZA 1J2WA 3ZLFA 1EJXC 3CH0A 1FKXA 3C2VA 1GZJA 3W76A 3CQJA 1EPVA 4I7WA 1TPVA 4MVAA 2W9MA 4HYVA 3NFUA 2XTKA 4GQQA 2NQ5A 1X8FA 4LYKA 3B3DA 1KXVA 2DQXA 5F2LA 1GUVA 1DV7A 1OBAA 2VRQA 3PTKA 1R86A 1W1TA 1E55A 1PIFA 4HHLA 3GIPA 4XK2A 2J66A 3K8KA 1NQKA 5A6AA 1Q8AA 4LNYA 3FS2A 4P8UA 2VOTA 4L64A 3TAOA 4F0SA 5FACA 2AGTA 5BRPA 4HTYA 1QCWA 2QJNA 1PZ0A 1T0OA 4ZQNA 4XD6A 4NX5A 5TAOA 2ZC8A 1QHOA 4JDYA 1B3ZA 1KNWA 4A21A 2VFFA 3CWOX 4J9JA 3QEZA 4C5YA 3D3FA 1XC4A 2EHHA 3EWYA 1KFCA 2BY3A 2FDMA 4FNPA 4EAMA 1BWLA 1ISYA 2YPIA 2HEJA 2PC8A 2QPXA 4AVFA 1LDCA 2G3NA 4L61A 3WK1A 3W85A 1EBHA 5I06A 3SFWA 5HNNA 1R87A 1UMLA 2Y8KA 3M64A 3RITA 3B8UA 3WNNA 3W9ZA 4ROPA 4L1GA 3FY1A 2D69A 2A7RA 1VIWA 4RZBA 3K1GA 2ALRA 4H4IA 4EXAA 4W8BA 1ISWA 1EHNA 1EC9A 3THCA 3S9ZA 4DWDA 4V33A 4L6HA 5BWAA 3LCHA 3M43A 3E38A 3PPCA 1X7FA 1JZ3A 3RR1A 1V8EA 3NOYA 5AY7A 5KTLA 3S5ZA 2Y8UA 5A6TC 4C60A 2EGZA 2GVEA 3ME3A 3SCRA 2J8TA 2X0HA 4FHAA 3H6OA 1YXDA 3B0XA 3UF9A 3AIVA 4N42A 3F4NA 3WH9A 1E72M 3F03K 2VEIA 4I7UA 2V69A 1RD6A 3B9OA 3QOMA 2Y88A 3W1QA 1WKDA 3C0SA 5A2AA 3WDPP 1GHSA 4MFDA 3MUIA 1E0XA 3EDKA 4P7NA 4Q32A 1YPXA 3PWAA 1J12A 2W4XA 1HKMA 5G1TA 1OGGA 1J79A 1ZP4A 2G37A 4PMRA 1BYCA 3U8GA 1KXTA 3AYTA 2C7FA 2XVLA 1ZBVA 1MQRA 2NWSA 3UGRA 2PODA 4GXPA 1TJPA 3DC0A 1PXGA 4N9CA 1K8CA 2PF8A 3SSZA 3T0CA 4CU8A 5JU6A 3WMSA 3E12A 2GJXA 1GOQA 3W2JA 3TP4A 3A23A 1ZQ5A 4PBEA 1PUDA 1SO5A 2Y63A 3R8HA 1TZ7A 2VD8A 5FL0A 4QE4A 2WZIA 1QO5A 3BV4A 1DIKA 4D8ZA 3UG8A 1G7VA 2IXUA 4WJ8A 4YHEA 1IT0A 3VOFA 3MTWA 2E5DA 2VR4A 3IANA 4XWUA 5F2MA 4JTEA 2J25A 3VXGA 4ZOAA 4Z2JA 3D3AA 5JUVA 3QHOA 1OFDA 4HU4A 4EWND 3A9IA 2PDKA 2YCJA 1AVAA 1AFSA 5CAKA 4FIQA 1RHCA 4JIPA 3QY7A 3WUFA 1UZ4A 1KFLA 1LL6A 4IHCA 3ATYA 1ZU8A 3W87A 3EDEA 3B8DA 2A21A 3GHRA 3MDWA 2W27A 1TA3B 4GX8A 4L7ZA 2C18A 3N3MA 2E8ZA 3MT1A 3KRBA 5I77A 2J74A 4RK8A 1BWKA 1WX0A 1UWUA 1W2VA 4XZMX 1J0JA 3BLLA 3V5OA 3REQA 3R8RA 4DX3A 4KWVA 3CHFA 1JVNA 1OFOA 1PHWA 2I9EA 1GEHA 3DYOA 3CYJA 1H0IA 3H8AA 2H3DA 3I6TA 3GNNA 1PCWA 4C1NA 4C90A 1EGVA 1LROA 1R5YA 1MMFA 4GNKB 1HP5A 3TSBA 4K8EA 4MJ2A 1HJQA 3UJFA 1GVRA 1JYWA 4DF0A 1V3IA 4Q4RA 4KCWA 2FKPA 2ZUUA 1LOSA 1KBBA 4A05A 4EAYA 4CVUA 4WJEA 3DOPA 4BY3A 4BWLA 2G3IA 5LA0A 1E0WA 4US6A 5I00A 3AIBA 3UZWA 1SW7A 1ZBCA 4HKPA 2PZ0A 2YYUA 3WQPA 3NVDA 4JFVA 3IACA 5D2VA 4R7JA 4PRTA 4A3RA 4Z42C 1TJ0A 2GK1A 2J13A 3VKDA 4PCTA 1QUMA 1Y5VA 3CZ8A 3WBYA 3UZYA 3W38A 2BMBA 1RSCA 3SECA 3VDHA 4ES4A 3CAKA 1H7OA 2Y24A 2IUZA 3LHWA 1OZMA 3H2OA 3QR1A 5CSSA 3PUDA 2XG9A 3ZYZA 3L66A 3OODA 3VX0A 1QHPA 1Q7MA 3U5UA 5LHFA 4MTVA 1VGAA 5I3HA 3LQLA 1TZ9A 4IIHA 5BOEA 3MUAA 1H5YA 1ZNNA 4MWAD 4Q4KA 3TC7A 3W7CA 3GFZA 2CLLA 5HMSA 1AUSL 4IWWA 2YDSA 1GGOA 3VGEA 3UWYA 3AXXA 5DX7A 4QRNA 3C61A 1MRAA 2OCZA 3H4XA 1EZWA 3KTXA 4M1RA 4A3YA 1L6SA 4R85A 4U33A 4NYUA 1JYNA 5CSYA 1DTUA 3I6RA 4GQBA 1X6LA 2F6XA 3U57A 3NYDA 3VNMA 4L6OA 4MNJA 5HXMA 4JL1A 5IOBA 3GXTA 4B3KA 3W1MA 3OJGA 3W7MA 2J27A 2FDSA 1DVJA 2FJKA 4WZHA 1QATA 5E09A 3W23A 3EBVA 5I79A 3Q2DA 1T41A 4Y9MA 1H1NA 3QBUA 5IRPA 4AU0A 3P14A 3AHZA 3CAWA 1JCJA 3FKRA 3V36A 1CLVA 1VIZA 1V0MA 3WNKA 3NA8A 3HGSA 3NL3A 1KR1A 2E1DA 2WNZA 4W7UA 3S2NA 4H00A 1MQPA 4NVTA 2YDRA 2BOGX 4OFCA 5EPDA 2ODOA 4GNVA 3PUEA 1Q6LA 2DV0A 3UXDA 1HL9A 4JGDA 2A6LA 3HN3A 1PL9A 4GHRA 4ZVJA 1RUSA 1UKTA 1D3HA 4S1FA 3HG2A 4PCSA 3RU6A 4DI8A 2F8QA 4GYPA 1CDGA 3VINA 4RV8A 1W5OA 3GY1A 1OY0A 2A4AA 4MLRA 3UEQA 1W91A 3PZQA 1KM1A 4OVXA 5A8QA 1MUWA 4OWGA 3VO0A 1LTDA 3TYZA 1J0KA 3MP5A 3OB8A 1L0PA 2YLAA 3GNOA 4US5D 5JIWA 2IPFA 1QAPA 4REQA 4AUBA 3B40A 2UWFA 3KBJA 4PB5A 4QAIA 3RMJA 3I3BA 4P7QA 1TJ2A 3A3XA 3PBUA 3C56A 3OP2A 5J5RA 4TV5A 2VWTA 3W2MA 3A12A 1GOOA 4Y9OA 3S2CA 3FXYA 4XTDA 2WKJA 2BWGA 4ZOCA 2J7FA 2OT0A 1JPHA 4GVHA 3BW2A 5CZ0A 2QAPA 4S3AA 4B5XA 2XH2A 2ZX5A 4CNUA 4NG3A 4S2CA 3NXFA 3TYBA 1S5TA 4I9JA 5DRIA 1XLEA 2QGYA 4K38A 1PPIA 1KXQA 4BZYA 5FJUA 4GACA 1W9BM 2Y7DA 4IIFA 1LBLA 3SIMA 3CASA 1KKOA 1DORA 2J79A 3UCDA 3A9BA 3VNIA 1TR1A 4H9UA 4L9XA 1OZQA 2CYGA 1ZRQA 2PLMA 1S46A 3USBA 4XKYB 3RCMA 4MB5A 1J0IA 3IIPA 2GLKA 1CT5A 5IBXA 5K9CA 5RUBA 3PBGA 3RG6A 5CC5A 4B4HA 2NV1A 1KRBC 3T6CA 1TTPA 4ZSTA 2JIEA 3W88A 4F48A 1VBGA 1F3TA 3MJYA 2PDJA 1EEPA 1OWQA 3ZR6A 3LXAA 4AZCA 4S23A 3L2LA 4CCZA 2X16A 3IS4A 2QJJA 2VZUA 1E4IA 3WDJA 4FLQA 4CN6A 5HJXA 4RE3A 1R46A 3CQKA 3CV6A 3M46A 3P84A 2PUZA 5DELA 4BFAA 2GPTA 2DT3A 2X1SA 1TIWA 2Q8XA 1J8VA 4M24A 4FA3A 3M16A 4ML4A 3TTQA 2ZRXA 1PIIA 5FCZA 3LI0A 3AXIA 1ITUA 3QGVA 1YDNA 3QR3A 1F9CA 1UD5A 1G4TA 3BAKA 2ZX6A 4V15A 4XZWA 5DN1A 3V4BA 3LBOA 1M03A 1B90A 1IEXA 4IP5A 2E6AA 3G18A 3W24A 4HYRA 1SU5A 1TTJA 4DJFD 3QXBA 4OHQA 4ORMA 4ZOEA 3NAVA 2Y8VA 4XTIA 4KFNA 1VFMA 1GTEA 3TNBA 3VNYA 1TPB1 4EE9A 1R7OA 2FFIA 3TTEA 2PDPA 3KLLA 5C55A 4KERA 5HR6A 2J78A 2DUXA 4C91A 2H3BA 4CEXC 1T6MA 2C19A 3OLGA 1Z69A 4LCRA 1EO7A 1KLYA 2EBNA 1H4PA 3SJNA 1PE1A 4GJ1A 1V3LA 4C6LA 5D2WA 5J5DA 3GC2A 1KCLA 1ME7A 3U4AA 4ZQMA 3L0KA 3ZVHB 3M5XA 2W62A 4I5RA 5TF0A 1H62A 2GWGA 5A6MA 1WDRA 4NILA 4ERAA 4YTQA 3KOZA 1PYFA 5D8ZA 1E1EA 1I45A 1E0TA 2PDUA 1EGZA 1ZBWA 5FEWA 2BXVA 4FX8A 4UR9A 1J0HA 2YFOA 3L5MA 1F3EA 3RPDA 2EO7A 2PDYA 4B4FA 2VTFA 2J8GA 3W7RA 3USZA 5C8BB 1SR9A 5L6UA 1AH0A 4UTMA 1Z44A 3RX2A 2J9YA 1U2YA 4XIAA 4A22A 2GDVA 1C8VA 2FIQA 3O8AA 1VAHA 1H1ZA 2JALA 4PTVA 3WF3A 1GQLA 4E4FA 5AYYA 1I75A 4BQ3A 3R5EA 3EDFA 4WKHA 3UG5A 5T26A 3W73A 3GU9A 2X30A 4JN6A 3QSTA 1O5RA 3BK0A 1YTEA 5CGQA 5C7VA 1DIOA 1W9PA 4K1GA 1KC7A 4MWAC 2C0HA 2VDHA 3UGVA 4IFKB 1G94A 3R94A 5EB8A 2NX1A 5A6SA 3E2VA 4W86A 3U7BA 4LV9A 3GG0A 4KESA 3NG3A 5B7ZA 4H1ZA 3MWCA 1OX4B 4EOUA 4DWSD 1WBJA 2V30A 2DU2A 1O95A 3GTXA 2A3AA 3SM0A 3LLFA 2C14A 2V2HA 2G4FA 1YHTA 2Z29A 3H2NA 1SQ7A 1XSJA 2CLEA 2WVVA 3TUUA 2OSYA 5HWNA 1WXJA 5D32A 4PMVA 1PDZA 3RFAA 5HATA 3I68A 3PZ9A 3DFOA 1QR7A 5DCBA 3CT2A 1CX9A 5LNVA 3PJTA 2NQHA 4DIAA 2DP3A 3D5HA 4O10A 1KV5A 1PIGA 2HXUA 2REQA 5I3GA 3EWUA 4YWSA 3QGKC 3AJXA 4CD8A 3EAUA 1TV2A 2QVHA 4E3TA 3PZOA 3W1XA 3L4UA 1XLIA 1DQUA 4M6QA 3N2CA 3L65A 1PV8A 1L6GA 1C91A 4KCTA 3WEMA 4HVXA 3NQDA 3NQFA 2ZWYA 3GM8A 1XGEA 1RA0A 2J9XA 3BW3A 2A1YA 1FHDA 3GAKA 3QZ6A 2FMNA 4JS3A 1H7RA 2ZUSA 3DZ1A 4UXDA 3QQ0A 5D02A 2OYMA 1BYAA 1BRLB 1JFHA 2OLAA 4MG4A 4O8RA 5K7JA 4YJ5A 2DZXA 3NURA 5E0KA 3BAXA 1CBGA 1POJA 4S38A 3ZSTA 4NUWA 2AMGA 2O55A 4IQEA 4MY9A 4QP0A 3BV7A 2NLYA 2TODA 1D8CA 2HRWA 3KRUA 3GXPA 1AH3A 3BMWA 1VFOA 3RX3A 2QCCA 1UOZA 1XD0A 3SB0A 1IWPA 4G5DA 4AMAA 4FX6M 4E3VA 1DIDA 1NAL1 3GC5A 1UBPC 3M4HA 4QXIA 4TX8A 4W7WA 6REQA 1OYCA 3BJSA 2O4QA 2WHJA 4HA0A 1ADSA 3VD5A 4M80A 3A5VA 2OEJA 3RPMA 1LWIA 1RK6A 1XISA 5CGMA 1JDCA 3H4WA 4OBRA 3VUPA 4OUIA 2HE8A 3KL0A 2PWVA 3ITYA 4AY7A 2IKJA 4PL2A 3AALA 4JY8A 5G2HA 4JZ5A 4GVFA 1EJVC 2ZZ1A 3AOFA 2GOKA 1ECQA 1R2RA 3N2MA 4B3LA 5I3JA 4HU0A 4JNYA 3W7LA 3IGHX 3PVFA 2HCVA 4NJIA 2E9MA 4KWUA 4QG8A 4DPQA 3H7UA 1BTMA 2Y1HA 3O6YX 1KM4A 4LUJA 3CNYA 1JJKA 2WBGA 1J6OA 3C0LA 2X0SA 3TONA 2WHMA 4MJZA 3T55A 5KITA 2YA1A 3NM3A 1DE6A 2C91A 4WHBA 4NP7A 3GVRA 1W3JA 4ZSUA 3TU9A 3ZSSA 1TE1A 4UQCA 4DJFA 5H6HA 3GAYA 5BXPA 2F2HA 4GINA 3WDQA 1FCUA 3QFEA 2QCNA 4RPPA 4XVDA 1A5MC 1IEVA 4IJCA 2BGSA 4LB4A 1NOWA 3TQPA 1T40A 2G3JA 2BODX 1I1WA 2R1MA 4IICA 4A3QA 1UZHA 1XV8A 2PDHA 4NT0A 3HF3A 3T0BA 1SO3A 3BLEA 3CT7A 2XINA 3UJ2A 3GW0A 2G50A 2AOSA 3O6CA 3EB3A 5LIWX 3AIQA 2Z1WA 1H09A 4UR8A 3IJLA 1UZ1A 5K2ZA 1QRQA 3O9NA 1GPWA 3NL2A 3VDAA 3L0GA 4PE8A 3R2GA 2CKRA 1OFEA 1FCQA 1NP2A 4DJFC 5I5RA 4YU1A 3D6NA 4DJDA 3CS2A 3BCJA 1IR1A 2HS8A 1X1ZA 1AD1A 2DFAA 2A7NA 3UPBA 3MP4A 5ECUA 3BAIA 4HMEA 1T99A 2WSQA 4ZFCA 3AISA 3WNOA 3K8LA 4IMEA 7REQB 5A94A 1N8IA 4NZ5A 1U22A 2P53A 4BEUA 3PWIA 3L23A 2V81A 1XRTA 4Q8PA 3RLUA 3AIUA 1I2RA 3WLHA 1VF8A 1XYCA 2BVDA 1G7UA 1J96A 3BGJA 1ZTVA 5HPCA 4KWWA 3A4XA 3WFLA 1BLIA 4UZUA 3BLPX 1D7KA 4NYYA 5M1TA 3CZKA 3CV7A 3MJMA 4P8VA 4ZEPA 3AYVA 1JUBA 1XSKA 1PTGA 2J7HA 4O11A 3PNZA 3WBWA 4BF5A 4NZ1A 3DAQA 3H2AA 1SW3A 4DAFA 4XB3A 1XYAA 3XIMA 1I8JA 1HTIA 3KOFA 1RQBA 3THQA 4NZFA 2J7GA 3GFYA 4PN2A 1RPXA 1RBOB 2FVKA 3S3GA 1TA3A 3CZLA 3T07A 2IPJA 3RO8A 4DLFA 4PL1A 2G95A 4LBUA 4LCQA 1GVQA 1W1PA 1SJCA 4Y8FA 3TW6A 4R33A 3WQDA 3OGRA 2OKTA 1W3KA 2PDWA 3TR9A 3A4WA 2B7OA 4EIVA 1DP0A 3N1AA 4C6DA 1TZZA 3PBMA 2C1IA 1KBLA 1WAWA 4G7EB 4HPGA 1YMYA 4JYEA 1WE5A 2B4GA 2J77A 4MY1A 2NT0A 1CGUA 3KCOA 3N6JA 4QTGA 4TVDA 4X3ZA 2J6VA 1NFBA 2Y7GA 5LIKX 2VJXA 4I90A 3GHTA 1DWIM 1I2OA 3MCNA 4G56A 2IMRA 1N8WA 2FGLA 4LOCA 3K5XA 2BB0A 2HBVA 2QJGA 4L80A 2QQ6A 4M81A 4UOJA 2YBUA 4DWSC 4WSKA 4JQ1A 2D0GA 2X0YA 2HPIA 2OU4A 1TWDA 2YW3A 3TROA 4QBXA 2Q01A 3T2OA 1I0BA 1V6WA 3R43A 2H6RA 2FTWA 2XIMA 3B9NA 4NZ3A 1JNDA 2RDWA 1CXEA 4AY1A 3BAYA 1XLMA 3WLIA 1MW0A 2QT3A 4JEQA 2ZUTA 3VIFA 3B03A 3DHUA 2ZUNA 3BPWA 3ZJ7A 3IRDA 4D8LA 1I4NA 1L9WA 3KWSA 4H3DA 4W8AA 5FA5A 3R89A 1EA9C 3OU8A 2GQ8A 2ISWA 1Q13A 4FNQA 2DSZA 3EOSA 2YOCA 4I9AA 4HU8A 4BS0A 2H9AA 2FPVA 3NQ7A 4V28A 3TV8A 4C6BA 4CN4A 4GYKA 5A3HA 4W84A 3G24A 3ZT6A 2V5LA 1Q6CA 5BNKA 4XVEA 3SQMA 3TLQA 4EF9A 4U2YA 3AS0A 1I0DA 3NVTA 1YDYA 1SSDA 4GIAA 2FB2A 3EZ4A 2NVCA 3S2MA 4LYQA 1HP4A 2EPKX 4DJEA 2PGWA 5H2ZA 1B3YA 3UR2A 4IMCA 5IDZA 1XQKA 2WVSA 4R9OA 5A6BA 2R1PA 1MEWA 4WXYA 2PU1A 4B15A 1R3WA 1GOWA 2VURA 2DSKA 5AKQA 5F2IA 3BQ6A 2ACSA 5FEPA 1SYTA 1QU4A 1EHAA 3RYSA 2QF8A 2C3ZA 5D33A 1KLZA 2XWEA 4AD5A 3UG3A 4UCGA 1DJIA 1Y5WA 3WQCA 2WZMA 3PB2A 4KW2A 2HK0A 6CGTA 1E1FA 2GYIA 3VMPA 2DIEA 4K6AA 1VC4A 3QC0A 1XUZA 5I09A 4PULA 4LVGA 1XLKA 2YLLA 1UB3A 3LRMA 3ZLGA 4GUFA 2XIBA 3LN3A 2QVNA 1HJUA 1EBGA 4DN1A 4E4PA 3WLSA 3H2MA 4Z1BA 4ZO7A 2XVKA 4LANA 4UQ9A 5K9DA 1QK2A 2A5HA 2D20A 1EF2A 3WN6A 3WFAA 3WIJA 3R12A 3LCFA 1DQXA 3ARRA 2UZ9A 4FOJA 2NUYA 1S2CA 5JIPA 3DG6A 4H7ZA 3RM9A 3ICJA 5EMYA 1UR9A 4QQ3A 3G1DA 2R1KA 1DKWA 4JTTA 4W5UA 3DESA 4KGLA 5I3FA 1QASA 4O54A 3ES8A 5XIAA 5G4EA 5A6LA 1F6PA 4WEVX 2V67A 4Y9NA 1KBJA 1HGYA 4PYSA 1W2PA 3M0LA 2Y6ZA 1TUFA 3S42A 1ICQA 3AMKA 3G0SA 3NTYA 4AZ6A 1XL9A 1DWJM 1D3CA 5C9RA 1A5UA 3FNDA 4JIIX 3VKCA 3WK2A 2VEGA 4A6GA 1EWDA 3PNUA 2ZCGA 2ZRZA 3NCOA 5D03A 3HU7A 5EFFA 3GXFA 1V6UA 3LCGA 3P0XA 5JH1A 1C3FA 1YBQB 3GB6A 1AD4A 4YYFA 3EOEA 2NQZA 5IDIA 4JNZA 3EMZA 5KMYA 1PX8A 5B7YA 3P61A 1RY0A 1WV2A 4IMAA 3V0UA 2WHKA 1G4SA 3GG8A 2A3CA 4JEJA 4NASA 3NUKA 1XM3A 3WH6A 4QDWA 4TX6A 2WJDA 1AQ0A 3M07A 2MUCA 4S3JA 4ZQCA 2I16A 1XFCA 2QUUA 5FF7A 4DBUA 1A0EA 3GH5A 1NWSA 5JQ9A 3JVAA 2E7FA 4H9YA 3C5QA 4PFMA 3T05A 4TMBA 3CUHA 2X2GA 2WMHA 3SFKA 4PTWA 4XG1A 1A0DA 1XG3A 2OGYA 4RJEA 3W74A 2VC6A 4AZBA 3O16A 1W1ZA 2X7WA 1OEPA 3P81A 3QLLA 5AN7A 1A5AA 3PUOA 4WR3A 1REQB 4X2PA 4WY0B 2PMQA 1O1HA 2GGIA 5LIUX 4RLIA 3T0AA 4JKLA 5H1WA 3S4TA 4IP4A 2Z2UA 2FZNA 3EB2A 3CH9A 4BA0A 4GIYA 1G69A 2HWGA 1I9CB 1XX1A 3ZFHA 2FTPA 2IS7A 3MU7A 5D9OA 1IYXA 3W01A 1DWFM 2V9DA 1FWTA 3PSVA 4U3AA 2ZTKA 1DWHM 1OCBA 3W25A 4FX7A 3VU2A 4PH6A 3H53A 5C70A 3C0JA 2XIOA 1G6CA 3KDNA 4RDVA 3VNDA 3WMLA 2PTZA 3FIGA 4A4AA 1TREA 1FKWA 3UPWA 3VKJA 3W82A 4DYEA 3SSJA 2J88A 2Z4GA 1Q6RA 2WMIA 2ZRYA 1XLFA 3S6DA 3ZJ6A 1ZGDA 1MXSA 4KCVA 4AZ5A 2GSEA 4FXFA 3AROA 3QM3A 1UWAA 3B8WA 2OMAA 1BYDA 2J7EA 4ZQPA 4F8XA 1PKYA 3QMRA 2VRKA 1IIGA 1PDYA 1GOKA 3HBLA 4L9YA 4O0ZA 3TJIA 1Q8JA 2EG7A 1EYEA 3SY5A 5AC6A 1BWVA 5DCDA 3QKZA 3LNMA 2DZWA 5CLTA 1H61A 4AZGA 1JUKA 1XLGA 2GSHA 2EPMX 3E3HA 1KQZA 4P8WA 3BDKA 4JQ2A 1G01A 3DBNA 2JKEA 3WLTA 1XPYA 5DEZA 4ZE4A 1ML1A 3TW9A 4P2VA 3CLMA 4KQNA 4ZE5A 2XVPA 4LY4A 1VCVA 2QS8A 3NQMA 3DX5A 3N4FA 1F61A 5A69A 1HKWA 2YDQA 3CPUA 4O12A 3DHDA 3OA5A 1UP3A 1YNQA 2G3MA 3LGDA 2PWEA 3BMVA 2PURA 3WLPA 2X8RA 3UESA 3SURA 3H4GA 3ZVHA 4NJKA 1JYXA 4GG9A 2OQHA 3SN1A 2R91A 1H41A 1R6WA 4C6FA 5TQLA 2MANA 2YR1A 3V16A 4PMXA 1FQ0A 1XIFA 4C6MA 3W6YA 4C6CA 4ORIA 3A4AA 3W6MA 4GD0A 1PWLA 1W1IE 1U1JA 3NNTA 2V3FA 4GBDA 1GZGA 3F4CA 3S5YA 1HKIA 4PMZA 4KEUA 2GSJA 3CWNA 4ZCWA 5C9XA 3O05A 3UR5A 3PR2A 3RCYA 5D38A 1YPIA 1TTQA 1OC6A 2IPGA 3IIVA 2CZ5A 2ZBTA 2GUYA 2ZTJA 3U2EA 2DQWA 3FVMA 3UXKA 4B16A 3WX7A 1AODA 2BX7A 2YCKX 2F84A 3UNTA 2HE5A 3TJ4A 3QV6A 1FBAA 4KBXA 1UC4A 5EBAA 2BSLA 2DZSA 5AHEA 2OG9A 1F74A 3MUXA 3QPYA 1MYRA 4GNJA 3MVIA 1LJYA 5MKGA 1DEDA 4D8AA 4K1WA 1NARA 4AZIA 4FK9A 3KUMA 2BNJA 3B8IA 1OX4A 1IR2A 2WLZA 4D6EA 5HQLA 3ZWSA 4MSSA 4JTJA 4EVZA 3CUFA 2VOMA 4XSMA 5FF2A 4QDPA 3AO0A 2VCCA 2H8ZA 2W0UA 4PUMA 2OWWA 4XBJA 3THDA 4X0NA 5AC8A 4XIMA 3LK6A 1D7FA 4M0XA 3EKGA 3UXIA 3UZZA 4RNJA 3NZ1A 3GZ3A 3LNPA 1QPRA 4YIWA 3MY9A 1NOUA 4N7QA 2DVUA 2Y61A 4ICCX 3CL7A 3G1RA 4NL1A 1WA3A 4S3EA 2CLHA 5CGTA 1J2BA 4GJJA 3LBCA 6PTDA 4Q4OA 4NSBA 2A3EA 4BK9A 4HA1A 3H55A 4H8UA 2P0OA 1J0ZA 3VIPA 4M19A 1XYMA 1S3HA 1LYXA 4TTUA 1H2JA 4RDWA 1QOPA 1EIXA 4KT2A 1W5MA 3SCUA 2CETA 1IEIA 1FDYA 3IGXA 4GLEA 3UP8A 1DL3A 4IL0A 3C4UA 1JCTA 2O9TA 4PUKA 1X97A 1ONWA 1UD4A 1H7NA 4IQDA 4W93A 2WW5A 4LW7A 1HVXA 4ZXOA 4B2DD 1F2JA 2Z7KA 1TWIA 2VRJA 3BICA 3QF0A 1TVLA 5HA7A 4HMNA 5TBOA 1JZ2A 1PS9A 4ASTA 2QPUA 4MNKA 1X8CA 1L6YA 5IHSA 1S5WA 2WHLA 3CB8A 1WPCA 4B91A 2XSAA 3W83A 3F5KA 2GQAA 3ZQ9A 4ACYA 5BXRA 4KEVA 4AIBA 3HOJA 1PAMA 4YL2A 3HG4A 5C9ZA 3A5FA 2V82A 3W6LA 3P67A 1H1YA 1UP2A 2GGEA 3TEVA 1V3HA 3EKLA 3VOJA 3TAKA 3N25A 1LZOA 1B3XA 2HVMA 4CNSA 2GJXB 5CG7A 4J2MA 2XSBA 3S1UA 2VENA 4PC8A 1QWGA 5CC3A 4PTMA 2QAFA 2BVYA 3IUIA 1PZ1A 2XGIA 1Z6KA 3MZ2A 1E9YB 1KV8A 3II1A 3FJ6A 1DJQA 2BXYA 4UTWC 1UPPA 4HP5A 1KWKA 1U1UA 1QMLA 3N34A 4DB7A 2E77A 2AKZA 4O1CA 3O3RA 4TVUA 1G67A 4PMDA 1JI2A 4KWOA 2EF9A 4A3UA 4HA4A 1VFFA 4YCOA 3A13A 3BSMA 3MYPA 1V03A 2QZRA 3BURA 1BPLB 3KS6A 3QV9A 4H8HA 5FF4A 2OELA 2W79A 1H0GA 5DXXA 4UTIA 1SZNA 2P3ZA 1C9DA 4O57A 4ADUA 3SADA 2QYGA 1JZ8A 5FAJA 1HO1A 4B5UA 2ZICA 1DBTA 4AISA 4JTHA 5D05A 2W5FA 4H8VA 1FP8A 3THUA 4TIMA 2OX1A 3BTNA 4ONVA 2RHGA 4PTNA 3RILA 5BCAA 2PS2A 3EX2A 1ZY9A 5HDRA 1V3JA 2YL5A 3PZIA 4JFUA 3SDOA 2GL5A 5EMUA 3LGEA 4Q4QA 1K4GA 1QI0A 1W8GA 1ZL1A 4L5ZA 1TE6A 4J3VA 1VBRA 1SO4A 3CV1A 2Y5SA 2QJHA 1YXCA 2BG5A 4D6DA 4WLCA 4UNLA 3MI2A 3GG1A 1K8XA 3SQLA 1O5KA 3JZEA 3CLWA 4HQVA 2E9BA 1YW1A 1KFBA 3BGGA 3AU2A 2KX9A 3GS6A 4GWEA 4XQ6A 1OSEA 1XBZA 3QZEA 2VGBA 3IWPA 2VMFA 4RV3A 1JIBA 3UCQA 5AYIA 4H6EA 4X60A 1UH3A 1W3NA 1B3WA 5E0CA 3VD9A 3CTLA 6TIMA 1BF6A 5AYXA 3CEUA 3MSDA 3FDKA 2PBOA 5CCZA 5FD0A 2R9RA 4CN1A 4C6EA 2GWNA 2ZX7A 4N0RA 4LAZA 3TCEA 3N9KA 3DFNA 2ZVIA 1K7FA 1A3WA 1P48A 3FA5A 3EX3A 2GK1B 2PTYA 1SO6A 2HV5A 4PTDA 1ESWA 2A2IA 2VR5A 1OGBA 4GI4A 1HUVA 3TWBA 5EMKA 5D2XA 5CLWA 2VI0A 4JHOA 1RP9A 4L6DA 3WUBA 1GOXA 1QNQA 1K9FA 1CW2A 2DY3A 1A3HA 4XZ9A 4ZENA 4YVVA 4JICA 1OFRA 1SZRA 5LXXA 1CI1A 2JKAA 2BXZA 3H21A 1TVNA 1HX0A 4QFUA 2DZBA 2CLPA 2Y2WA 4DHGA 4E2BA 1KRCC 2BASA 2A7PA 4XKMA 1EH9A 2OZ8A 4YVXA 1IWBA 1SGJA 2ZZ6A 1Y8BA 1HN1A 4LV4A 1YLVA 3PAJA 1H7WA 5DQPA 1F3WA 1VJIA 4IG2A 4MPKA 2VZOA 3VC5A 3NZPA 3F4WA 3O06A 2KZHA 1ODZA 2IPWA 3EDJA 2E67A 1ELSA 2AGKA 3VK5A 4LVDA 3PZUA 1XD1A 1R47A 3CHVA 2AQWA 1OVDA 3TYCA 3VGDA 4NI8A 5LGXA 3ZLHA 4GUIA 2ZXAA 5ABHA 2QCHA 3L5AA 5HQMA 1ZLPA 4O53A 4AXKA 2P76A 5D2TA 4H9VA 3IAQA 1WZKA 1GEQA 4UFLA 1R3YA 3PPFA 1NH6A 3BOLA 1MDLA 4POCA 1N82A 1O5QA 4LSBA 2B81A 2V3EA 3CUJA 1YADA 4ZB2A 1M1BA 1THFD 3EEGA 5G2IA 3KBWA 1X38A 1CXLA 1HXJA 1JD9A 2HNEA 1TUXA 2WCGA 2X05A 4N9BA 4RUBA 4D6CA 2GOUA 4OU1A 6XIMA 3NSNA 4JDBA 4YTTA 5DXYA 3VIHA 5KEZA 3LBMA 1FH8A 3P60A 4KIEA 3O6DA 4FXSA 4H83A 2X40A 3IAPA 5JBEA 3WBEA 2E6YA 4UNKA 4P7OA 3PZMA 3M0YA 2FLIA 3AZRA 4JD4A 1A5CA 4AHPA 3ZIZA 2FH6A 4EXBA 4E2OA 3ZM8A 1VHCA 2OLSA 1GYMA 1PTDA 4PMUA 4C1LA 1ZS2A 1MRQA 4FS9A 2HPMA 4LUYA 3HV8A 2VVSA 1Q63A 2CU0A 1LP6A 4HGXA 2ZUVA 1EX5A 3NPXA 3SZ8A 3C2YA 1F07A 1R3RA 1F4HA 1TR9A 2HNHA 1LG1A 1TJRA 5FIPA 8TIMA 5FF3A 4OT7A 4R34A 4AEFA 4X63A 1SJAA 4C6IA 1R8LA 4GISA 1EJUC 3G1AA 1AK5A 1TPDA 5JVLA 1IT7A 1XBYA 7ODCA 3HZ3A 1RK5A 4R3UA 3W02A 3NQGA 1U5VA 1W37A 1XRFA 3KVKA 4QIUA 2YCEA 4Q8MA 4YXGA 1HL8A 4L4PA 4IQLA 2OODA 4DLMA 4UTTA 4J27A 2XGZA 3GFXA 2WM0A 2OO6A 3CL8A 4FNRA 4MMWA 2X41A 1RJQA 3K4WA 1Q7QA 3K4DA 4LC6A 1YKWA 3LHVA 1AMYA 4H2HA 2R14A 4A8LA 1M5WA 4MHBA 1C29A 5A5WA 5CZKA 3DFPA 2IQ0A 3H2FA 4JN7A 3L12A 3THAA 3L67A 3W2NA 4PRRA 3IJ7A 4J7RA 1EXBA 3CHEA 3UY7A 1FCBA 4S3BA 1Y0EA 5BWFA 3HQOA 3W53A 2L5HA 4XD5A 1LOQA 3HURA 3AYRA 3MQTA 4R7WA 3F4DA 4Z0SA 1B0IA 3DKLA 5FJIA 1QO2A 2D2GA 3H24A 2PLKA 2A85A 4EK7A 2BOEX 4UTHA 4FALA 3MSRA 1LORA 1J6PA 2BTMA 1ZAIA 4BI5A 1BVNP 1K02A 1XCFA 4C6KA 1BTCA 1TWSA 4RW5A 4GVGA 4XAYA 3TVAA 1XLLA 3DU0A 3WDHA 1GYNA 3CMGA 3AUOA 2WKLA 1TB3A 4UOZA 5CC7A 7XIMA 3N6HA 1GVOA 1NELA 2DUZA 3U2OA 3NIYA 4BEQA 4A2SA 4CNPA 1GG1A 3URQA 3WQVA 1V51A 3N15A 3UYIA 3TC3A 2X42A 3ZJKA 3VGHA 3AXKA 4TTGA 2ZA2A 2JEQA 4F9DA 3PULA 3B0UX 1MEHA 5CBIA 1AQHA 4M5PA 1I2PA 3FHQA 3NL5A 1O7AA 2CXEA 1A50A 4JX4A 4P7RA 4UQEA 3WNMA 3P82A 3TMLA 3MMTA 3GTHA 1HJWA 3VILA 1UC5A 2J24A 3K30A 1LLOA 4GXMA 4OOZA 3ITCA 3R0UA 4AX6A 2CLFA 3DXIA 4QR6A 1WCGA 3KVJA 3UY8A 4A2RA 1US3A 1PJ9A 3URBA 4FF5A 4MYAA 1K6AA 3UWZA 1RVKA 4F0LA 5KZEA 2XH0A 2CLOA 4DZIA 3VUSA 2I5IA 2NQJA 4X61A 3FN9A 1REQA 2QDEA 2FB3A 3MW7A 2NZLA 2VFHA 2B7QA 4JPGA 1RALA 2WNQA 4E38A 1QPQA 1TQJA 2B0MA 3H22A 1CWYA 2HBXA 4NZJA 1JQXA 3VMOA 3FOKA 4LT9A 1JF5A 2XDFA 1YTDA 4RDYA 2Z25A 1PTAA 4I9MA 3EX4A 1MFUA 1AMKA 1MI3A 4UWMA 2CC0A 1XDMA 3LV5A 5E0FA 1EEXA 1TG7A 4J1OA 3VTRA 3MMUA 1UIPA 1YRRA 2WVUA 4AC1X 4NRRA 2R82A 5D09A 1WZAA 2CITA 2AMXA 3BQ5A 3INPA 1JGIA 7PTDA 6A3HA 1MW3A 1TFVA 4Q8OA 3OLEA 3SY1A 1PCKA 3DG7A 3FJNA 2YA2A 2QDDA 3UW6A 3IJDA 2X1UA 3RCNA 3EEZA 1RD5A 4YS1A 2VDIA 1SUXA 4DZAA 1H7XA 1S39A 5KZMA 4PCNA 5DRCA 1C7SA 2CHOA 4DO7A 2WVVB 5FJOA 4LF2A 1O1ZA 1GQJA 3R13A 4HU3A 1ISXA 1XGDA 1Q6EA 1JRCA 1RJRA 4AB4A 1OHLA 1A3XA 1F05A 3T0DA 1RBAA 4WX2A 3AIWA 4ZA0A 1M7XA 3SW6A 5EY5A 1KTCA 3F2BA 4M6PA 3G5EA 1QI4A 3FAWA 3UZJA 4B5WA 2REQB 4PMQA 3DHPA 4AG0A 4AD1A 5B80A 1EO5A 2I57A 1NM9A 1VJSA 4WJXA 3MMDA 3FAXA 4AYGA 3HV9A 4N4PA 3WLRA 3M5ZA 5AHMA 3GVGA 1Q45A 1O6IA 2NLIA 1UIOA 4ICNA 3PZGA 3SGZA 2VC9A 4GJIA 4AC7C 3R10A 1XWYA 3Q37A 5HUOA 2EKCA 3W1UA 2W67A 3L2IA 1SMAA 5DLCA 1H51A 4JYFA 2YXGA 4E6MA 4GH1A 1KB3A 3FHAA 3BXWA 3CM4A 3P5YA 5C2CA 2YYTA 1JZ7A 3A3WA 3VCNA 4PZVA 2PRHA 1CB7B 2D3NA 1Q65A 3TR2A 4GE8A 5BYWA 4IM4A 3DYPA 1UOKA 3F5JA 3NM1A 4WK9A 1IXOA 5JBFA 1V3KA 1LUCA 2VUNA 3N4EA 3MUZ1 3FYPA 2P5NA 1DYSA 5DMMA 1JCYA 5A8MA 1ENUA 2PD9A 1PWMA 3CIWA 3AUJA 4LVFA 3WDIA 3MDUA 5M2FX 3IVTA 7A3HA 3K1DA 1B4EA 1DHKA 1E9IA 1EDGA 4LQ1A 3NGFA 4CU7A 4HK5A 4D6GA 5CPLA 1K77A 4OV4A 1MVYA 4FLSA 3LA4A 5LNRA 3EMQA 2WWDA 2E68A 3OHIA 5DF0A 4C5ZA 5A95A 2WCAA 1QW7A 4H9MA 3T2QA 3FCPA 5C6MA 3TLLA 2NT1A 3CGTA 4BJHA 2CIPA 3W29A 4DUVA 4WSJA 4BQ5A 1D2KA 4NAFB 3GD6A 6REQB 3TYDA 3P93A 2E5CA 4ECLA 1LRQA 3WQ4A 3WZ0E 5D30A 1W9XA 3AS1A 3PB0A 2VNCA 3GXIA 2YB4A 1OIMA 4WKAA 2QEZA 2XN0A 4Q8VA 1W56A 1UUOA 1OD8A 4IXXA 1EOMA 2BVTA 3UWUA 3R0KA 3BLKA 3CO4A 1J9YA 1V6XA 3U4FA 2FVMA 3VMNA 2CHRA 3DH7A 1XRSA 3P8IA 1S2AA 4D1JA 4MYXA 1O4UA 1V93A 4GVIA 1OG0A 3LPPA 2ZYFA 1LBMA 4O1EA 4GMEA 1VYSX 2XM2A 4HPHA 3BAJA 4GXWA 5C2XA 3TFCA 3CIVA 1JAEA 4JFWA 1HNYA 5E1QA 2ICSA 3OG3A 2HVNA 3G3MA 3JZUA 2QV5A 2CERA 3LTYA 4LUSA 3WQGA 1WNOA 5FJJA 1NWTA 4FXJA 3EPOA 4M82A 2W6RA 4J5NA 3L4VA 1E0VA 4WD0A 3QVQA 2RFGA 1P6BA 3JRKA 4MLJA 1X7IA 4NXKA 2PC4A 4PCPA 3TQKA 1VR6A 1MZHA 4LJ3A 3BVJA 5HK4A 3F5LA 4GUJA 1HF6A 1HIZA 1BHGA 3CAQA 5CH9A 5AVHA 3S1XA 2ZRWA 2ISVA 1NDZA 3W7PA 5JMUA 3H7RA 2E4TA 3T0TA 2PGEA 4V2XA 5HWMA 1UMYA 2R6OA 3VYLA 1VHNA 5FJTA 1FWBC 4HPNA 2XFWA 1GOMA 3NQ6A 3UPMA 2ZKMX 1R3SA 4MAZA 3VM7A 1NF7A 3MKKA 3SUTA 1PKLA 1TKKA 1OK6A 2DSUA 1WDDA 3KZPA 3RN6A 1KFKA 3FV9A 1XGZA 3VNZA 4UBPC 3GDMA 3DYMA 3H54A 2OWXA 3LPGA 3FLUA 2Y0FA 3AU6A 1TX0A 2RDTA 2X1TA 3S9YA 3PBWA 1JXKA 1KM2A 3TYEA 3GKFA 4WGXA 4FIRA 1RH9A 1XLCA 1M01A 2W91A 2ADAA 5LA2A 4F4RA 1GVYA 2BY1A 3C2RA 3EWBX 2UBPC 3DI1A 2Q3OA 4QCEA 3EWCA 4ICMA 4IF2A 1V6TA 1YDOA 5FAGA 1XIGA 3GK0A 3SQSA 1C8YA 5G4WA 4MB3A 3WL0A 2CFFA 4J3TA 2BHUA 1P0BA 1SVDA 2WV8A 2PWDA 4HYWA 5F1VA 3GE7A 4MNMA 1UR2A 4RZ6A 2Q6ZA 4M6VA 1TPEA 3MO7A 5LNUA 3FA4A 1VPXA 2ZUMA 3MS8A 1ME9A 4DWSB 2QGHA 1A80A 1VLWA 4O50A 3UR7A 5LIXX 3TCSA 3AJ7A 3ZT7A 2XZ9A 1XF0A 4AH7A 4AEOA 1QI5A 1V6YA 2VC7A 1NOFA 3I4EA 1TCMA 1XS2A 1ISVA 1JUEA 3FFSA 3STCA 1R9XA 1KM0A 2NQ9A 3T08A 2EPNA 3MUY1 1E6ZA 4NHVA 3TZFA 1Z9AA 1OINA 3O63A 3ARTA 2JK2A 3SCVA 3SCNA 3HA1A 3AWNA 2XH7A 4F0RA 3PBVA 5CPNA 3KRZA 5GJMA 4Q8QA 4Q4MA 2HZGA 1AW5A 4WDXA 3VDGA 4YHGA 1RQEA 2ATMA 1BVZA 4ZB0A 3T4WA 2WKGA 2V63A 2Q3RA 1XR2A 3P6LA 1EUNA 1NWUA 1O60A 1AW1A 4X9SA 1FHLA 3A64A 4LCSA 1B2YA 3WENA 2H8XA 1FFQA 3CUZA 3R25A 4EPBC 4Y96A 4Q8NA 5FF0A 1EPXA 1E4NA 4F66A 3OZPA 3APTA 1QW9A 3WJXA 3TXVA 5MF5A 1BG9A 1W8SA 4V1YA 4WF7A 3STFA 2X2YA 2ZXQA 3PM6A 4GYFA 4JTDA 1UJQA 4KH2A 1XIIA 3STPA 1FWJC 2FZBA 3A6OA 4ZQOA 4KFPA 1FWHC 3TW7A 5F1UA 3CBWA 1XG4A 5EYWA 4AFYA 3MKVA 3W7QA 4B5SA 4RPQA 1FWAC 2X1RA 3SRHA 2H9AB 2Z27A 2DW6A 4S3FA 2J9ZA 3TYUA 3RGTA 3WKZA 4BI6A 1MNZA 4WCJA 3LCIA 4MDPA 1H3GA 1RY8A 4QLKA 4EACA 3VZZA 2PDGA 5LIYX 3LXCA 1E5NA 2HROA 3G2GA 2ZE3A 1D3GA 1ONXA 4QE5A 4OQVA 4LBSA 1GOIA 3ANUA 2V3DA 3RU8X 1UQYA 4CGTA 1FUYA 3MVTA 3QOKA 1VS1A 1XPGA 5CAHA 1EYWA 5C71A 3UJEA 3SRFA 3NQAA 3GYCA 2QKFA 3O7UA 4H41A 1LOLA 4QSHA 1FFRA 2WZTA 4LH8A 2QNEA 2NXHA 4GQGA 2DZUA 4DM2A 2GJRA 3L4YA 4GC3A 5FKYA 1M7PA 3M44A 5C9UA 6XIAA 2I14A 3BGAA 7TAAA 4JOMA 2A3HA 1C93A 3OLDA 4W89A 2VQUA 3IV3A 5F4WA 1PZ2A 4JTQA 2DZVA 3E5BA 3UU0A 4LEQA 1GJUA 5LZLA 5LHEA 2C16A 4RE2A 1MSSA 2JE8A 1OK4A 3NDYA 4R53A 5EMJA 1V7YA 2HVOA 2XZ7A 3WQ8A 3RR4A 3G1FA 4M1BA 4JTUA 4OOUA 3K13A 3H70A 3J7HA 4K7YA 3WY1A 4WRHA 4RR4A 4LWWA 3MO4A 2E6FA 1WZLA 1AJ2A 4QISA 1NU5A 3EOLA 3NJ3A 3DDMA 4GO8A 2INFA 4CCCA 2PWUA 1CTNA 1ZB5A 3W71A 5FEZA 4E2DA 3OGSA 1US0A 1JG9A 4O14A 1OIFA 3GNDA 4KEZA 2NXGA 2VXNA 3N29A 4HD5A 3W7HA 4UIOA 1V4YA 1U33A 1VZWA 3KVMA 1EQPA 2Z24A 4O1DA 1ZJIA 3G6LA 3A24A 3WMCA 1ZP3A 3CK5A 2FPTA 2BBFA 5ABEA 4GIEA 3ARYA 4IOTA 3IIXA 4YLWA 3VOHA 5CSRA 2HTMA 1ZJHA 1Z48A 5A8OA 4L1WA 2WMGA 3KTSA 2OQLA 3E2QA 3PPHA 2EPOA 4W5ZA 1XCWA 2I5QA 4FNUA 4LAKA 1F7BA 2WCSA 2PDMA 4LFYA 5BRQA 1DWGM 3SEPA 3N18A 4H2CA 4H6KA 3KS5A 2G41A 4O13A 4F3HA 5C5YA 4QCFA 3CEPA 4FNTA 2NX9A 3AWOA 3KEHA 3RK8A 3GTIA 4ZR8A 4LY8A 4WOQA 3KOYA 3ZO9A 2FMOA 2RH9A 5E9XA 1QPKA 3H12A 2TYSA 1QBAA 2XFRA 4N02A 1WBHA 3M5VA 3UJRA 3OW1A 2OKOA 5I2UA 4IX2A 4DNMA 2O9PA 1W3LA 3QHNA 3NQ8A 4NIRA 2PWHA 3C8FA 4PMYA 3WK3A 1XP3A 1KFEA 1A4MA 1MWOA 2PP3A 3GLCA 3LCWA 3ARUA 4LUTB 1E3XA 2PU0A 1TV7A 3S46A 2V5BA 2CESA 4GBUA 3L5LA 2O56A 3BMXA 2ZX8A 3FYOA 3QY6A 1FA2A 4OTKA 2GJPA 3FJ4A 1W9UA 5I78A 1E0UA 5HWJA 1ZJBA 2HXTA 3VCRA 3C2OA 1RVGA 4E8DA 4J40A 3N9SA 5KINA 1IGSA 1H60A 1GW9A 1MQQA 3E02A 1P7TA 2QDHA 1HQTA 2NW0A 3MP3A 5AYBA 2Y85A 1E40A 3GDKA 4JKMA 1KRAC 2DUAA 4AYSA 4O1FA 4MIMA 2WMIB 3UXAA 1BYBA 4H04A 5HOSA 3OBKA 4Q7BA 5M5DA 5AC5A 2JBMA 2WQDA 3MWAA 3TMQA 3MB9A 4WKFA 2F61A 3GH4A 3W81A 2J8FA 2WJEA 1KM6A 2UY4A 4JTLA 4ZQRA 4GABA 3LD5A 2CLMA 3AXMA 1XKYA 2BGNE 4S3CA 4IMFA 2NQLA 4JY9A 1GVSA 3SN0A 4NKCA 4AHOA 5LYRA 4IT1A 3OA3A 3WEZA 3LEPA 2Z00A 3GHSA 4G6CA 2I7GA 2OR2A 4C7DA 2XN1A 5DBUA 3N3TA 1BVWA 1EP1A 2FZMA 3GR4A 1JGMA 4XO6A 1QI3A 1Z8AA 1DQWA 3UG4A 4HK6A 4W87A 2IQDA 3WK0A 2V2DA 3WJZA 2Z1BA 4D6HA 3HPFA 1MZRA 3VCCA 3QV7A 3MCOA 3GXMA 1E51A 2JKPA 4MWAA 5T91A 1P0DA 1EWEA 1M04A 5TNVA 4YTUA 3W3OA 2I1OA 5DO8A 3S1GA 1C9WA 4IIGA 1FH9A 2VFIA 3ERPA 1QDSA 3AZSA 3SJ3A 3EXSA 3N2TA 1SPQA 4O4WA 1WYIA 3ZOAA 5CSUA 3GW3A 1TRDA 3H26A 2A0NA 2DW7A 3LHUA 3G1SA 2HS6A 1UP0A 2ZXDA 4A29A 4QDMA 1V0LA 1GJWA 1S5VA 1HKVA 1EOKA 4N6FA 3GVWA 3EMCA 1GTHA 4E0CA 4ALDA 4LS2A 2POTA 5DBTA 1FWGC 3TKFA 1TTIA 3SRKA 2DSWA 4MKSA 4TR9A 2I9UA 1VD6A 4AWSA 3QW4B 4ZOBA 3U5YA 2F6KA 4JN8A 3R11A 3WH7A 2HDJA 1W0MA 3RUBL 5BXSA 2P0IA 4Z2HA 1O66A 4Y6GA 1AH4A 2A79A 3OHMB 3KP1A 3S83A 3HPXA 4HHMA 3S1VA 1VYPX 4DXVA 2JGYA 3Q4DA 3GRIA 5MKGB 4GY7A 1BGAA 1XH2A 3TWAA 1E56A 1ZENA 4C6JA 4KRTA 4GIRA 4DUWA 5A2BA 3F2CA 4QAWA 1E6QM 1YE6A 2ISSA 1SZEA 3BJFA 3WH8A 1Z3NA 3P8JA 3EPNA 1EIBA 4G1KA 2IKIA 3EXTA 9XIMA 1NDVA 4HT3A 4AWUA 1XI3A 1L6FA 4IPLA 4UQDA 4HZ7A 4NU7A 5HJYA 1W1VA 1NFGA 5A2CA 1JI1A 3KCJA 3UD6A 3DFQA 2OQYA 4QS6A 3M0IA 3KL5A 1QTWA 5A8PA 1BD0A 5GNYA 1DE5A 1IZKA 1KO0A 2CEQA 4AD4A 3T2PA 3URNA 1KQYA 2XIQA 3POCA 4XZIA 4S3GA 1IGWA 3QLDA 1DHPA 4Z1YA 3PN8A 4R27A 4PUDA 3BG9A 4US5A 1FVPA 4XV0A 4FF7A 5HNTA 2PFHA 3FSUA 1IV8A 2VO5A 3NR0A 3HGOA 1FWEC 5DCEA 2VELA 1SJDA 3PZNA 5T9BG 2YSWA 1JPIA 1UUQA 4MPQA 3V1PA 4UR7A 4FOKA 3VZYA 4NNBA 4WXZA 1S2TA 3S5NA 3EOOA 3GNRA 1IWAA 1YDVA 2QF7A 2FHFA 1FX6A 2TRSA 3ARSA 1K1DA 1CENA 3JUGA 1F6KA 4DUXA 3U6WA 3I3EA 4DPPA 2P1FA 4RE4A 2DH2A 3ZMRA 1JXJA 1A49A 4G7FA 1E6SM 3KCLA 1VFSA 2QIWA 3FVDA 2Y70A 1PX3A 4HNTA 4JX5A 2YL8A 2VEPA 5HUPA 2BHZA 4IMDA 1NQ6A 3UERA 4QLLA 4GKTA 1EKOA 1QOXA 2XPKA 4AZHA 3BCFA 2OZ0A 3S2JA 3VDBA 1OB0A 3P2VA 4DYJA 3R8GA 4DRSA 2AL1A 2PDCA 3W7IA 4ZODA 4EX4A 3O2LA 4RNHA 1EDTA 1EDQA 3IJQA 1N8FA 2E3ZA 3UVIA 1FXPA 4NAFA 3NO3A 3VE7A 1NF0A 2BVWA 5CKSA 5GVJA 3PANA 3O0FA 4K68A 2YXOA 3OVRA 1WQ5A 1GONA 5I3DA 4CKQA 1KCXA 4D9PA 3E0WA 2ZZ7A 2D1ZA 4PB4A 3RJYA 3HFYA 5BMWA 3UWVA 1FWIC 1R9YA 3HG5A 4UZSA 3HGJA 4IPIA 3APGA 4WUIA 1OT1A 2ATSA 3P80A 1EX1A 3DFYA 3KFTA 1IEQA 4TX9A 1GW1A 2QLYA 4WDTA 3DKJA 4ADSA 3PTQA 4J35A 4Z0JA 3ZR4A 4LEFA 1AL8A 2VZSA 1OFAA 4TUFA 2ON3A 2W63A 1R85A 4HJWA 4J3ZA 5I02A 2CZEA 4O28A 5E70A 1NP0A 4HA3A 3ZJ8A 3VA8A 4UNIA 4FI4A 3LX9A 5G5IA 4LAMA 1IE7C 4RL3A 9XIAA 1Q6GA 1DJWA 1S2WA 2CLIA 4U10A 2QXWA 3T78A 4JTRA 4LYPA 2EG8A 2VEFA 5D8WA 2Y89A 1Q6QA 5I03A 3G1VA 1V08A 2C1GA 2VDGA 1O12A 1GHRA 4M51A 5LA1A 4AWEA 2FJUB 3B04A 1WKYA 1RCOB 4WOZA 2ACUA 4ILSA 2PZNA 3ZT5A 4LGXA 3QTPA 1A53A 2VC5A 3TOPA 2WMJA 2O0TA 3EOUA 4H6QA 1FDZA 3UVAA 3WG6A 3Q58A 3W22A 3ONCA 1VEPA 3CMJA 2Q71A 2ZZ2A 1QPOA 3C2FA 4LAUA 5AECA 4QEHA 2F2KA 2HK1A 4E8GA 1NIUA 3ID7A 4MNLA 1VBHA 4F0HA 2YBVA 2WSRA 3ABXA 1XLDA 1S38A 3P3BA 1RV8A 4INFA 1CNVA 3RHGA 1Z41A 2DT0A 3S8HA 2PCQA 2POZA 2YKKA 1XQLA 2CPUA 1LWHA 4HOWA 1XIBA 5M3WA 4AVNA 2OX4A 2ZDSA 2QW5A 2FZ9A 3PJWA 3DC8A 1P5BA 4F2TA 3WJYA 4AWTA 2WQPA 1UWRA 4TU1A 4R88A 3HQPA 3O6AA 4ZO6A 1GQIA 1KXHA 4GQRA 1LQAA 2YL9A 1UD3A 2R8WA 4U28A 3HJEA 3TNOA 3MUCA 4ROQA 4B9ZA 1ONRA 3GDLA 3NZGA 1A5KC 1DPMA 1K03A 4LVAA 4Y2WA 2VCBA 1G5AA 1POKA 3GDBA 1CXKA 1OC7A 2F9RA 4PRWA 2PLJA 3T42A 2QUMA 3Q94A 3RPTA 3T9PA 4C7FA 4HCHA 1XINA 2G97A 3W1NA 1UWSA 3ZXWA 4OGZA 3W2UA 1E70M 2C15A 1QPNA 5TD4A 5ABFB 3OEXA 1O68A 2BOFX 4Y7EA 1L2QA 2WZHA 4IG2B 4DO4A 1P0NA 2NUWA 2QMJA 4DWSA 1KW1A 4BQ4A 4GO9A 3U3HA 5AC7A 1ZSXA 2GUBA 3KZSA 1WUEA 3M0HA 3W1RA 2CZFA 4HSNA 5AHLA 2D2OA 4DXKA 5GNXA 9RUBA 3HG3A 3A3HA 4GRSA 1PBGA 1Z89A 3ARXA 4ZO9A 2QJIA 1W3IA 4XZBA 1HJVA 2Z6IA 3VD7A 4YPJA 1QNPA 2LLEA 4J3UA 2PDXA 4E5TA 5A6JA 3W1LA 1XJBA 1J0YA 3W28A 1KCKA 1XUUA 4P5UA 4GFIA 1Q85A 3TA6A 1EP2A 3EDDA 3VKAA 2YX0A 1T8QA 4IPPA 1UKSA 4F79A 4O52A 4RZ4A 4Q8WA 3NSXA 3IIZA 4OKDA 1YE4A 3L4TA 4LUIA 1VBJA 3LZ3A 3OTRA 1H7PA 1RA5A 2ISDA 1GK8A 3WD0A 3QY8A 2VUYA 4B5VA 2ZXBA 1BEUA 5JBDA 3KDOA 5CC6A 3ITTA 1VRDA 5I07A 3QPEA 4GUHA 4FPSA 1B3VA 2J47A 3AAMA 3V1HA 2YJQA 4O17A 3QR0A 1W3TA 5D9MA 1JCNA 1VQTA 3S2LA 2DDXA 3CJPA 4UB9A 1IHIA 1I6NA 2Y7EA 3N12A 1OC5A 4QM1A 3V35A 4U5KA 3S5OA 1A5SA 3WELA 2EKGA 1N55A 1XYLA 2YIHA 2IKGA 3W7EA 5BOOA 1ITCA 5DT5A 4XD4A 3DIPA 3VNJA 1R2SA 4WIWA 1VLIA 1JAKA 2OYKA 4WDWA 4NXSA 3NO5A 2V68A 3BZJA 5H91A 4TV6A 3W07A 1J93A 5I6SA 1D8WA 4I8DA 3NZRA 1JULA 3FXGA 5KZDA 1XHGA 4RNFA 3WQFA 1VEMA 1KFWA 1UYQA 4FB7A 2GVJA 5CPTA 1F6YA 2UV8G 4JCLA 2WBKA 3R6IA 3M0MA 3GKAA 2XGBA 2E1WA 3G1XA 3PFMA 3WYZA 3CZJA 3UBPC 2VT0A 2W92A 3WF2A 1OX6A 3AXHA 4N9DA 1XIDA 3V5FA 4IPJA 1D9EA 5FEXA 3CHCA 3TSMA 1E3ZA 1UPMB 1EP3A 3QMTA 3GBDA 3SCOA 3WDRA 2VP8A 2FZ8A 2OT1A 2CNCA 3QGAC 2XIJA 2NVAA 4BF9A 2ZZ5A 3SBFA 3E74A 1A47A 3CMFA 4CCEA 5HMDA 1WKEA 3VM5A 4WGHA 1AQFA 5A8GA 3P5ZA 4LAOA 4EWJA 1BQCA 3BSGA 4CVWA 2J6XA 4F9JA 3AICA 5I24A 4H9TA 1KA9F 2YDAA 4AQLA 4G1NA 5BMXA 2P3EA 5AHFA 4AIEA 4AZ7A 2YCIX 2NX3A 5HNRA 2FHBA 1PB0A 3ABRA 3KBMA 4GZEA 4UFJA 4Q6X