3DBNA

Crystal structure of the streptoccocus suis serotype2 d-mannonate dehydratase in complex with its substrate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
363
structure length
349
Chain Sequence
SHMKMSFRWYGKKDPVTLEEIKAIPGMQGIVTAVYDVPVGQAWPLENILELKKMVEEAGLEITVIESIPVHEDIKQGKPNRDALIENYKTSIRNVGAAGIPVVCYNFMPVFDWTRSDLHHPLPDGSTSLAFLKSDLAGVDPSKEEMKAIIENYRQNISEEDLWANLEYFIKAILPTAEEAGVKMAIHPDDPPYGIFGLPRIITGQEAVERFLNLYDSEHNGITMCVGSYASDPKNDVLAMTEYALKRNRINFMHTRNVTAGAWGFQETAHLSQAGDIDMNAVVKLLVDYDWQGSLRPDHGRRIWGDQTKTPGYGLYDRALGATYFNGLYEANMRAAGKTPDFGIKAKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Mannonate dehydratase
publication title Crystal structures of Streptococcus suis mannonate dehydratase (ManD) and its complex with substrate: genetic and biochemical evidence for a catalytic mechanism
pubmed doi rcsb
source organism Streptococcus suis
total genus 108
structure length 349
sequence length 363
chains with identical sequence B
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03786 UxuA D-mannonate dehydratase (UxuA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3dbnA00
3ITLA 3C0QA 2J6VA 2G0WA 1XYMA 3M0XA 4KW2A 3BWWA 1DIEA 4GJJA 2GYIA 3DX5A 2NQ9A 4K1GA 1XIHA 4A8NA 3BANA 1XINA 1XLBA 4QEEA 1BXCA 1XYBA 4YTUA 4Q7IA 3AALA 4J4KA 2Q02A 3UVAA 3CQKA 3JU2A 5EMKA 4YTQA 3AAMA 2GUBA 1XIDA 1XLMA 1XYCA 3C0LA 1MNZA 1XLJA 4HGXA 4XIAA 3CNYA 9XIMA 1TZ9A 4DVOA 3KCJA 4XIMA 2X7VA 5AVHA 1XIGA 1DXIA 3N4AA 1XIIA 4X63A 1XLIA 3TC3A 3FVMA 1XLDA 4QEHA 3KBVA 5EMLA 4DUOA 2I57A 3AYVA 1A0CA 3CQIA 3P6LA 3ITTA 3CWHA 1QTWA 3KTCA 3M0VA 5EMJA 3UXIA 8XIAA 4QE1A 1XIJA 4QE4A 1XIBA 1DE5A 3ITOA 5B7YA 4K3ZA 4A8LA 1A0DA 2GVEA 4A8RA 1XLAA 3U0HA 3KBNA 1I6NA 1XLEA 1S5MA 1YX1A 3VNLA 4PFHA 3C0SA 3VYLA 2G4JA 5H6HA 5C9ZA 3CQHA 2HK1A 3KCLA 1O1HA 1I60A 3KWSA 3QXBA 4XKMA 4ZB5A 1XICA 4PGLA 3XINA 4QE5A 4E3VA 4ZBCA 5XIAA 3GNXA 3M0LA 1QT1A 4GLEA 3BZJA 1A0EA 3UU0A 3OBEA 1QUMA 1BXBA 4EACA 3XIMA 4HNOA 1XISA 2XINA 1XIFA 2GLKA 4XSLA 3IUHA 3L23A 2HK0A 3UA3A 1XLKA 4YTTA 4HHMA 6XIMA 2NQJA 2NQHA 3ITVA 3QZAA 4QDWA 5XINA 3ITYA 2QULA 1XYAA 2ZVRA 4US6A 2OU4A 3TVAA 7XIMA 1XLFA 3BDKA 1CLKA 4YTRA 2QUMA 4XISA 5AVNA 1OADA 1XLLA 2QW5A 2XISA 3KBJA 5I7GA 1D8WA 4X60A 1GW9A 3CQJA 2I56A 3M0MA 4XSMA 3U3HA 3M0YA 3IUDA 2ZDSA 3ITXA 3P14A 2HCVA 3IUIA 3LMZA 3AYTA 4ZB2A 1XLCA 4YTSA 5EMMA 9XIAA 5H1WA 1DE6A 5B7ZA 4X61A 5B80A 3VNMA 3VNIA 4GJIA 3NGFA 6XIAA 8XIMA 1XLGA 4GQBA 1XP3A 3QC0A 3M0HA 2XIMA 5XIMA 4HHLA 3XISA 1MUWA 4G56A 5J8LA 2X7WA 3QYSA 4LNCA 1XLHA 1S5NA 3KBWA 3DBNA 3WQOA 3KBMA 3UA4A 1K77A 4A8IA 5FA5A 2QUNA 4ZB0A 1XYLA 4OVXA 3VNJA 1XIEA 3VNKA 1DIDA 4QDPA 3KCOA 4EAYA 5TNVA 3BZGA 4W4QA 3KBSA 1XIMA
chains in the Genus database with same CATH superfamily
3F4CA 1LOQA 4GMEA 1KGUA 3UYCA 3RAOA 1VEPA 4QXIA 3N2BA 4ENLA 1MFUA 5EFDA 1KCLA 4S1FA 3HBLA 3QSTA 3M07A 3MJYA 1Q2RA 5JBFA 1LUCA 2GUBA 3VVGA 3G77A 1W5QA 2VJXA 1OFAA 1SZFA 4LC8A 1H0IA 1LBMA 3AU2A 3GNOA 2D2HA 4C1KA 2QR6A 2CLOA 5LIXX 1WZAA 4HCHA 4MZYA 2FVMA 2GVJA 4KT2A 4CNUA 4PTMA 4UFHA 2DZUA 3F1QA 3WNPA 3I7QA 2QF7A 3GU2A 2FDMA 3U2EA 4AUBA 4EACA 3P74A 4IFRA 3PR2A 4M29A 1TB3A 2E9MA 3UFYA 1E0VA 3LCWA 4QQUA 5HWJA 1F9CA 1KFEA 4XTDA 4JNYA 1O94A 1VRDA 1GOQA 4CCZA 2CLKA 1D8WA 3ARVA 4LBUA 3ARPA 1LDCA 1XSIA 3KDNA 3WUBA 4WDXA 4MY8A 1JDCA 4GQ0A 1P4CA 4BI6A 8XIMA 1BVWA 2E6DA 4RLIA 3LCXA 2PD5A 4L6OA 1O5KA 1NP2A 2YA2A 4WDTA 5REQA 5E9AA 4ZODA 3V5FA 3ZIZA 1BG4A 1NVMA 4GVHA 1XKYA 3S2MA 4IMAA 1V0KA 1X6UA 2V82A 4GHRA 5D9MA 1HT6A 2AQWA 4AY7A 1X1OA 3CQKA 1P1XA 4HJWA 3K4DA 4K1WA 5JH1A 1KM3A 3GR8A 3TJXA 4K2SA 5AVHA 4K6AA 2YKKA 1XCXA 1XD1A 3KVLA 3M0JA 3STEA 1YDYA 4J2MA 1D7KA 1UROA 4LSBA 4LUIA 1WV2A 4HKPA 4LOCA 3BLLA 1G1YA 4UTIA 1B1YA 5KZDA 1O7AA 1ITUA 1YPXA 3PFRA 1C8YA 1LORA 3GY1A 4HNOA 4RL3A 2F7FA 4JCMA 1C8VA 3OW1A 1FWNA 3UPMA 4BQ5A 3FXYA 3ITVA 3ZLGA 1VS1A 2INZA 4U4MA 5HXMA 3OYZA 4IP4A 4WDWA 1A5SA 1CGUA 2ZWZA 1FWIC 4O10A 3IV3A 4X60A 3UZWA 2PDIA 1WX0A 3P14A 4HCDA 3RR1A 1Z69A 4CU6A 3OG3A 1XQKA 2YCJA 4JX5A 3EPOA 3MVIA 2P3EA 2DVUA 3N18A 3VOGA 3TKFA 3G1VA 4UFJA 3VZYA 4AHOA 3TR9A 3UCDA 1MUWA 3KX6A 3AIRA 1GGOA 3QKEA 5LA1A 2HQAA 4H2CA 3RR4A 4I5RA 3AROA 1OX4B 1U5VA 1VFHA 1UWRA 1K4GA 5HMSA 4DY1A 3OVGA 1KR0A 3A64A 1GYNA 1TPVA 5BOFA 1ZAHA 1SYTA 3AUOA 1HJQA 1PS9A 4KESA 1QU4A 2GK1B 4BEUA 1EIBA 1JI1A 3N12A 4RW5A 4JTSA 4Q6JA 3NQAA 3VCNA 3VKKA 3W53A 1B90A 2XN2A 2PTWA 3IIZA 2XH7A 3Q2DA 4GYJA 3WIJA 1AL8A 1A3WA 1DYSA 1E51A 3PJUA 3GLCA 1LCOA 2IKJA 4MTVA 2VUNA 2Z25A 1OYBA 5HBFA 2WMKA 4AQLA 3GVWA 2G4JA 1BPLB 1E6RA 4LV4A 4B90A 5XIAA 2VGIA 4UMBA 2CETA 4H9TA 3EKGA 3EPMA 4LVDA 4AWUA 2TODA 3F5KA 3GU9A 4S3FA 2YGYA 4OUEA 1US3A 4PSPA 1UH2A 8RUCA 1JFHA 1T7LA 4R34A 2ACQA 2YXGA 4OIFA 2J9YA 4PTNA 3LUTA 3DXIA 2QDHA 3GTIA 3S0CA 1EFZA 1BYBA 2ZRYA 2VO5A 4P7NA 5HATA 1KM5A 3UVIA 4JEQA 3ABOA 5CQ1A 4MY1A 4PL2A 1Z32X 2PWFA 2ZDRA 2V8ZA 3O06A 3PG9A 3MA8A 3N9SA 1XDLA 1U22A 2NLYA 2XFYA 2ODOA 2OSXA 1MFVA 3OZPA 5A69A 1FDJA 1ZCOA 4RE3A 3TR2A 2J88A 3P0XA 4Q6XA 4DJDD 4NILA 2Q8ZA 2O9RA 1ECQA 4IWWA 1ZB5A 2E28A 3UJEA 2AOSA 1MXSA 1UP0A 3WMSA 1A5MC 4L6HA 3C6CA 3GIPA 3MP4A 3FYOA 3RJXA 4BS0A 3GTXA 2PZNA 1K1DA 5DMLA 2P0IA 2PDNA 3F5JA 3TLLA 1DWGM 2OZ8A 5FAJA 4XAFA 3POHA 3SIMA 3H21A 5FEWA 3A24A 3D46A 1QOXA 1GWJA 4XZNX 2Y5SA 1G6CA 1JUBA 3M1ZA 5D05A 3GC4A 3CEUA 5G5IA 3L4YA 4GO9A 5LIUX 2Z6IA 4YNGA 3V36A 2PCQA 4IFKB 2QCLA 4AZIA 3S8HA 1JPIA 3FN9A 1A5UA 2DW6A 1BWLA 4AMAA 3NL3A 1EL3A 4BF9A 2X1RA 3VILA 4E2VA 1BQCA 3LQLA 1QJWA 1TUFA 3M5YA 3NIYA 4JFWA 4MPKA 4AZCB 2W63A 1GT8A 1JXKA 3KRSA 2YIHA 4ZO7A 4HU4A 5KINA 3UEQA 1HKKA 3KW3A 4BQ2A 2NUYA 2YXOA 1QBAA 5FJTA 2EPKX 3ITGA 4UNLA 5F4SA 1ZS2A 1CIUA 3UWQA 4ZOBA 2X2GA 1BWVA 2X7VA 7REQA 4HSNA 3R2GA 4C6NA 3GTFA 2WC4A 2VXNA 3D3AA 3GQYA 1RY0A 4TVCA 3N4FA 4XZHA 2OGJA 4LAMA 2PURA 5FOOA 1IR1A 3RIKA 5ENLA 3C56A 3CIWA 3NPWA 1DHPA 3W7IA 4D6EA 1GVRA 1L9WA 3ORWA 5LIWX 3G1HA 2V69A 1OK4A 5MKGB 4EK7A 4YTTA 3DYPA 1E15A 3HFYA 1EHNA 3C2VA 4CNNA 4R7JA 1MW2A 1OYCA 1TE1A 1KXQA 1CXFA 3KL5A 3M0YA 2WMJA 3ZSSA 2W91A 4BCEA 1AUSL 4PMVA 4L61A 3B97A 1I45A 1UP3A 5AZ0A 5M5DA 4AWSA 2ZCGA 3TSMA 3TROA 4JKKA 1W1PA 4WOQA 1UD5A 2ZUUA 4EAMA 4HIBA 4W5ZA 4V1YA 4CNSA 2V9DA 3GUGA 1HJWA 7TAAA 4LH8A 3BOXA 1RR2A 4CGTA 2YL9A 3I7SA 4CN4A 1XRSA 2DV0A 3H4XA 2OWCA 1SU5A 1A3XA 3DH7A 4MOZA 2NQLA 4WDUA 2Q3RA 2OZ3A 4RW3A 5LA2A 1F8MA 4HHHA 3VIHA 3BARA 4DXXA 4LUYA 4U3CA 4XWUA 3IGXA 1SFLA 3W7CA 1EDGA 4R7OA 3WH6A 4ACZA 5JVLA 1RZMA 1IT0A 1A4MA 1QI3A 4QE4A 5HNNA 1SFSA 3G24A 2OYLA 3P82A 3F4DA 1YX1A 2J24A 1S2VA 3WLOA 3UWEA 2QJHA 3VGBA 1BYCA 1JAEA 4NNAA 4G1KA 4NAFB 1XLKA 5CAHA 4GQRA 2IPGA 5KZ6A 2NW0A 3LHVA 3FLUA 2CBUA 2GVGA 5HINA 1UA7A 3WFLA 3BLKA 4JTDA 2R1NA 1XPYA 3K8KA 3QGKC 3N2MA 4K7VA 4DZAA 3KZPA 4R9OA 4EF8A 1M01A 1WUFA 3QLLA 1MDLA 3BLOA 2ASHA 1J0YA 1U5JA 5D03A 3MSRA 5BXSA 2Z29A 5DLCA 1G67A 4BJHA 1WNOA 3CK5A 2WC7A 2JF6A 1Z7AA 3HPFA 4GE8A 4Z2LA 1P6BA 3LQGA 1MRQA 4ADSA 4TV6A 5F2IA 2FZBA 1IXOA 2XVPA 4Q4OA 3U7BA 4N4PA 4O13A 3S47A 3N3TA 2XIQA 2F8QA 2PDCA 2ON3A 3GK0A 2C0AA 4RCXA 3PAJA 4A3YA 4Y96A 4XKYB 1W9BM 1CDGA 3URAA 3EBVA 2YW3A 2QCHA 3WJSA 1TR9A 2A85A 1MZHA 1Z89A 2B7OA 3ELFA 3CH0A 4FHAA 1R3SA 5IFTA 1DKWA 1JCTA 3MMWA 5A2BA 3STPA 3PJXA 3DIPA 3UR7A 4M80A 1ME7A 1YNPA 3COTA 2A1YA 3WY1A 1MDRA 3G1DA 3ITCA 4DO5A 1DORA 5HUOA 1PX8A 2GLKA 4XSLA 3DN5A 2XH0A 3LU2A 4RPQA 1QBBA 4MG4A 4FXSA 3K13A 1GW9A 1RK6A 3GHUA 1UHVA 3LGEA 1D9EA 3G1YA 4UQAA 1CBGA 1RQHA 4GJIA 4S3AA 3FS2A 3GS6A 2YR1A 1BGAA 3PBWA 5DN1A 4GZJA 4DWSB 3MUAA 3WLRA 5DMMA 2Y8KA 3V0SA 1Z6KA 3WK2A 3VOHA 3CUFA 2Q09A 2VEFA 1XYBA 2CHNA 3AALA 4ATWA 1ONWA 1Z44A 8A3HA 5KZEA 3EOEA 2PMQA 3ALFA 4FX7A 3EDDA 5EY5A 4OGZA 4I9MA 4QEHA 1TVNA 4RE0A 4LTSA 3SZ8A 4H9VA 1FWRA 4TX6A 6A3HA 1ZTVA 3HURA 5FSDC 4L80A 3LLDA 2CXGA 4GG9A 4M7TA 5ABFB 3IJ9A 1ECEA 4FZIA 2BGSA 2MNRA 4AHQA 1KD0A 3CPGA 4L6DA 4ZBCA 3P60A 1PX3A 1DXEA 5CC7A 2CLHA 3NO5A 1EPVA 1W3IA 4NQ1A 5EBUA 4FXFA 3WH8A 1B3XA 4GC4A 1KCKA 2A3BA 1OFRA 2X1SA 3T81A 4AFYA 2AL1A 3CL8A 1V0LA 1KBJA 3A3WA 3NQGA 3W88A 4B5VA 2KZHA 2NUWA 2FGBA 1MUMA 2J78A 2HROA 3WUFA 4B3ZA 1OYAA 1E0UA 2CCRA 2INFA 1K03A 1E0TA 3SGGA 3QFWA 2EPHA 7PTDA 1XIMA 6TIMA 2G0WA 3DC8A 4DLMA 3NDZA 1XR2A 4KW2A 3BWWA 4DF2A 3U9IA 3GHTA 1FHUA 4C6BA 4ZMGA 1LUCB 3WDHA 2ABBA 2OFJA 2PODA 4UZSA 1KXHA 2EEXA 5ECUA 2JBMA 1W5NA 1Y65A 4O11A 4FA3A 4B2DD 1XH0A 1J10A 3M0ZA 3DGBA 3ENLA 4DJEC 2PA6A 2NSOA 1YHTA 1B2YA 2R1LA 4P8UA 4Z2JA 4GISA 1UD6A 2PDWA 4FK9A 4CEXC 4NJKA 1TE6A 3UCCA 4B15A 1PPIA 1JCYA 1RBAA 3F7JA 3OBEA 4IZGA 1NF7A 3H53A 4HYWA 3AMGA 4OT7A 2EQDA 2ZRWA 3QFEA 4ZQPA 3S9ZA 3IRSA 3RM8A 1DTUA 1ZBWA 3VDBA 3OZYA 1VEOA 3PHAA 4QNEA 1ZRQA 3T40A 2V3DA 4N9BA 1YXDA 4LY8A 1TVPA 3PF3A 3WENA 4AWTA 5FJRA 3WZ0E 4IXXA 4X61A 4UXDA 5B80A 4H7ZA 3MI6A 1OK6A 2CW6A 1RK5A 4MLJA 4X2PA 3VFLA 1H50A 4OKDA 4XO6A 5REQB 2QXWA 1SW3A 3OGRA 2Y1HA 1XDMA 3CZ8A 1ZALA 3UP8A 3ITLA 2VVNA 5A8NA 2HDJA 3D5HA 4A2SA 4L56A 3F4WA 3R89A 4NAEA 1C3FA 4MJ4A 3B8SA 4F40A 1PDYA 4J4KA 4DJFA 3UERA 1XRVA 3R11A 4KIEA 5M17A 2D1ZA 4M8UA 3UCQA 1ME8A 2WQDA 2PC8A 1R3RA 3VU2A 3VK5A 1EEXA 1W9XA 2WMGA 1XJBA 5I24A 5EBAA 1T41A 3TK7A 4PR4A 3TH6A 3QQWA 1IYXA 3THAA 3H55A 3DG3A 2DZXA 2ZKMX 4D6DA 5IBXC 1JNEA 2ZQ0A 1T40A 4TVUA 3W73A 3VDCA 1SZRA 1LP6A 1OFEA 3WEOA 1TCDA 2VNCA 3O9NA 5CGMA 5EFFA 2Z28A 3TVAA 5DY2A 1BRLA 2Z26A 3L4WA 3W38A 4Q7NA 5BXTA 3N9RA 5HAOA 1RPXA 3G2GA 1KQZA 1KWKA 5BWFA 3VZXA 5FIPA 3PZOA 3CUXA 2J7GA 3HV9A 3IVSA 3HTWA 4W7WA 4F8XA 2XIMA 4U5IA 3VUPA 1JD7A 3N34A 3BLIA 5FA5A 3VNZA 4E8CA 1XGDA 2WYSA 1IEIA 2YFNA 4PB4A 1PO9A 4AAJA 3VNDA 2ZWYA 3W1MA 1IEQA 3LEPA 3M6YA 4CU7A 4AISA 1P5BA 3PTDA 1KGWA 4AEOA 4EF9A 4HOWA 1Q6GA 3CNYA 2YBUA 3L4XA 3EDFA 3N6JA 2WPGA 5DCBA 3NZRA 3U2ZA 1XIIA 2QPUA 3N3MA 3S5SA 2DFAA 2NV2A 4EWJA 3H2CA 4AZGA 6TAAA 3OA3A 1HP4A 3UJ2A 4JQAA 2Z7KA 4LC6A 1UKOA 5LNRA 1S5MA 1WZMA 3DFSA 4WSKA 6PTDA 1JZ8A 3R7MA 3OBKA 3KTSA 3I68A 1GJPA 1S2CA 3C86A 1K8XA 3MKVA 2ZE0A 4S39A 5I23A 4MNMA 1Q5MA 2VZOA 4NZFA 4Q8PA 3E3HA 1TV5A 1J2WA 3CV1A 3FDGA 2ZZ1A 4TMCA 4JR5A 5BRQA 2J27A 4KH2A 1MEIA 4YN5A 1SW7A 1HL9A 4YTSA 3QSRA 3W82A 1Q6FA 1OC6A 5D2YA 3WNLA 4JTEA 2XVLA 2OLSA 3LRLA 4KRTA 1PKNA 4JFSA 5FJPA 4UTWC 4PMYA 2E77A 3VKDA 3A21A 3QY6A 2XJ7A 1J0HA 4AW7A 4U5KA 3DG7A 1M5WA 3SUSA 3AYRA 3SRFA 1V77A 3P93A 3NUKA 1M7JA 1EF3A 4M5PA 3VZZA 3CEPA 1JCNA 3SN1A 3AIUA 5ABTA 3LNMA 3B8UA 1E6QM 2PDMA 4KERA 3GKFA 1A0CA 3W6LA 3S3GA 1V6YA 4D6GA 3B0VC 1GQJA 5LYRA 4R53A 4A8LA 3WL1A 4FX8A 1V4YA 4WXZA 3TYCA 3W7KA 2YDRA 3L66A 5H6HA 4M0XA 1TWSA 4FOKA 5HQEA 3F4NA 2NLIA 2QZRA 4O0KA 3S2LA 4AD4A 4Q8QA 1LJYA 3R79A 1VZWA 2XG9A 1HJXA 4V2XA 6ENLA 4DBUA 2RH9A 1JPMA 3GU1A 4KRZA 1WP6A 3WQVA 3VUSA 4PEKA 2QUMA 2D0GA 4DBDA 2GUYA 2EG8A 4FLQA 2JALA 3WH5A 2JQXA 1SZGA 1FFQA 4BA0A 3SUWA 5RUBA 3GNRA 4NXSA 3WD1A 2QDGA 1L6GA 1CECA 2CLIA 1UR0A 3MDWA 3MSGA 4HHLA 3DERA 2E40A 3A6OA 1A49A 2R1MA 3MC5A 4HNLA 2FJKA 4Y6GA 2HNHA 4PZVA 1RXOB 3G18A 1PAMA 3LA4A 2FTYA 2WOQA 1LYXA 2Z1SA 1EC7A 1ZZMA 1FDYA 1BLIA 5E1QA 7REQB 3W7DA 4GCXA 1XGEA 5LKYA 1EDTA 3BW4A 2PZ0A 4X63A 1YTKA 2FQIA 1JYVA 4MHBA 1P6WA 4LANA 1YXYA 4LAUA 4KEMA 3TN6A 1H7OA 4H6QA 3OYXA 4C6MA 3S46A 1EJWC 4D6IA 3OLIA 1Q8AA 4A8RA 1XV8A 3BW2A 2VR2A 2X42A 3U2OA 4Z2HA 2BHYA 1MEHA 3L21A 4G5DA 7A3HA 2VEKA 2R14A 3N25A 2GSHA 1GQKA 3OP2A 2XVNA 3WG6A 4H8NA 1DWHM 3W72A 5EU9A 4O8AA 2EG6A 2OO0A 2Z6JA 3AHZA 3L0KA 4Z1BA 2VWSA 3NM1A 4KWVA 3PPHA 1W2VA 2CWNA 2HCVA 3LRMA 1ZENA 3BE7A 3O7UA 2WNZA 3TE9A 3S5YA 1FP8A 2WPBA 3NGFA 3L9CA 3TW6A 2WHLA 2XIJA 1VBJA 2G3NA 4N0RA 1VGAA 4IPLA 1C8XA 4PMJA 4KBXA 1B9BA 3AHVA 4I7UA 1W3TA 2PRMA 4NF7A 4JYFA 5CSSA 1ZAJA 2GSEA 4HK7A 5I09A 3R5EA 4YTUA 1QNSA 1W9PA 2Y88A 3KUMA 1PTAA 4Q8OA 1K02A 2CC0A 4AVOA 4QGCA 4PUUA 3W37A 4RXFA 4MY9A 2WHMA 1SFTA 4ACZB 1KFWA 4V15A 3WMCA 5EMLA 4R88A 1YDOA 5EGRA 1G01A 3GR7A 2DUXA 5D8ZA 1R3TA 4PUMA 1K6AA 3TYUA 3UG3A 3M0KA 4QAIA 1Z8AA 3QV8A 4DUXA 4E3VA 3IJLA 4BR1A 3VIKA 2X1IA 3VKAA 5I3GA 3GVVA 1LOLA 3MP3A 4UR7A 5A6KA 1V3LA 5I78A 3GC2A 1SW0A 4DJEA 2KX9A 4S3KA 3RK8A 4PULA 1XYAA 4EXQA 1XLFA 1LWHA 5GNZA 1JAKA 1V6WA 1Z48A 3CQJA 1JULA 3S5OA 4ZE5A 1OEPA 3NO3A 4ZB2A 4M81A 3VOCA 1WAUA 1DV7A 3WLMA 1ME9A 3GFZA 5AHLA 3TW7A 1ISZA 5LZLA 4Z1YA 2OX4A 4O1BA 1UMLA 1SR0A 4K8HA 3N4EA 3THCA 2PWDA 1OGSA 1UUOA 3IGUA 3LXBA 2YDAA 3VM7A 3UETA 4IP5A 5BOOA 1HKJA 2G3FA 3TSDA 3OZMA 1XCWA 3LRKA 3VGDA 1OX6A 5D2TA 4REQA 3P0WA 4LGXA 1XH2A 2R8WA 4YYFA 3II1A 5I0DA 5D9PA 4M19A 3AZTA 4O14A 1WA3A 4WXYA 5I02A 1J4EA 1IQ8A 1IE7C 3GR4A 3AXHA 1A5OC 1AW2A 4RDZA 4S23A 3KAOA 4B91A 2G3IA 4O1CA 4FLRA 3QN3A 2HISA 2Z1XA 2PDXA 2QUTA 2VHLA 1OD0A 1GQLA 2G96A 4S3DA 3TC6A 4ROPA 1S5WA 4AYSA 1ONEA 4CLMA 3FIGA 2O4QA 4ALDA 2GVYA 2PDQA 1J0IA 3EDKA 3K1DA 3QH2A 1Q6CA 1ELSA 4IIBA 1T0OA 4RDYA 1KB3A 5IBXA 1FWWA 1CXLA 2CLPA 4B5TA 4XSMA 3AU6A 4H9MA 4QJ4B 3G1RA 4XBSA 2C1IA 1ZJAA 1V02E 2Y7FA 5J04A 2NQZA 2WSRA 1JCLA 3GHSA 3CHDA 4F2UA 1BWKA 3AISA 4G2DA 5FL0A 3PFMA 1KO0A 3WLHA 4DB7A 2HWGA 3F2CA 1Y0EA 3TCEA 5FJJA 4UNKA 2ZXBA 3UY8A 3CLWA 1W91A 3RNDA 3V0TA 5JH2A 3VMPA 1JYNA 3AXMA 3L7RA 5A8QA 3QKZA 4ZQOA 2C1GA 1B3WA 2E5BA 4JL1A 4H7VA 1JZ6A 1EIXA 4AZHA 4EP8C 3CT2A 3C3NA 5DBUA 3EA2A 3CV7A 5T8GA 4YJ5A 2J7CA 4N4QA 4IICA 3EOLA 4KETA 3U4FA 3LLXA 4WY0A 1VHNA 3ABRA 4W5UA 1NDZA 1TIWA 2QCGA 4O0ZA 3W7QA 4IGHA 4S2CA 2YDQA 3GH4A 1KGXA 3WJXA 1EHAA 3FYYA 2IPWA 4LAZA 3SEPA 1N55A 3K30A 2CHOA 4A3UA 5AC7A 4FIQA 1TJPA 1FX6A 3N2OA 2CU0A 1WXJA 4EWND 2ZRUA 3CXOA 3FY1A 4HU3A 2PTZA 3QOKA 3ZS4A 3WF0A 4GIRA 4XV0A 2R9RA 1DE6A 2WSKA 3KVJA 5E6ZA 2E0PA 2ISSA 2BV9A 1NFBA 4Y8FA 5AC5A 4C90A 4GUIA 3QQ0A 1SZEA 3DFPA 4IXHA 2GJLA 3NQEA 1BKSA 2QJJA 5I3FA 2WV8A 4GKTA 2CIPA 2C8NA 1ZQ5A 3GH5A 4O8RA 2Q6ZA 3AO0A 1DIEA 2VP8A 4F66A 1TFVA 4LWWA 1DVJA 3WDQA 4UCGA 2V0TA 4ERGA 2XFWA 4N6EA 3U6WA 4HSHA 4R7WA 3W7MA 4GPNA 4WCJA 4UTWA 1JZ2A 3VIOA 5IDZA 3LK6A 1XYZA 2CLFA 3KBVA 1OFOA 4Y2WA 1H41A 4ERAA 1KBKA 1WPCA 5EMJA 4ZFMA 4U10A 3LHUA 5BMWA 4YCPA 3O8AA 1LQ0A 5FAGA 1KRBC 3EA3A 2Y89A 2JGQA 3GW0A 3QJAA 2VELA 1C7TA 1RBLA 3URBA 2VDGA 1QWGA 3JS3A 1TREA 2H6RA 1PUDA 1F3WA 3L23A 5CG0A 3S9YA 2O7QA 4NXKA 3OPSA 3NZQA 4UR8A 3MO7A 3SSZA 4A3RA 4WF7A 1QVBA 4R9XA 4S3GA 2YYTA 3W4RA 2GGIA 3IWPA 3TTOA 4LVGA 3NZPA 3H7UA 1HGWA 3M0IA 3LV5A 3VNIA 3N15A 2FYMA 4CN6A 6XIAA 4QG8A 2OT0A 4HSOA 1FWJC 1I0DA 4TIMA 3KRUA 1XYLA 1SZNA 1EWEA 3UESA 5HNUA 2IXVA 4ASTA 3TYBA 4QCFA 3NQ2A 2W61A 4NAEB 5DO8A 3NQ6A 2AQOA 2WQPA 1BG9A 3EB2A 2A3HA 5HQLA 5TAOA 5C0QA 4LQ1A 1QRQA 1X1ZA 3R4IA 1KRMA 3W6YA 3EX6A 3VKBA 1H1NA 4GRSA 4EPKA 1DPMA 3M0VA 4I8DA 3RGTA 4OU1A 1VF8A 5D9NA 2GVEA 2A7RA 4JQ1A 5LNVA 2HSAA 3GAKA 3JUGA 3CUIA 1ISVA 3XINA 3HPSA 1KRCC 3WDRA 3P5ZA 1QAPA 3QGAC 1PYMA 4JQ4A 3SCTA 4ADTA 3MYOA 5GVJA 1BRLB 2D20A 1V0MA 1M7PA 2DU2A 2PS2A 2XM2A 5EB8A 1V08A 1RUSA 5M03A 3WJYA 2ZADA 2FTPA 1MMFA 3HMCA 3QVQA 4WY0F 3TZFA 3GXMA 2DUZA 2FJUB 1MNSA 1TPB1 3FSUA 3O6CA 3TC7A 2WAGA 3KBWA 3P67A 3CS2A 3NURA 3FJ4A 1FWCC 5FD0A 2ZRVA 3CYJA 3PSVA 4IGMA 3GXTA 3QHOA 1XFBA 3W84A 4QJ1A 4UOQA 1Z42A 1XLBA 5TQLA 3MBDA 2NXGA 1EQCA 4N42A 1UZ4A 4XIAA 1AQMA 1HXJA 3TMQA 3GHRA 5AHIA 4XTIA 1EBHA 1U33A 3W85A 1W2PA 2PWVA 3A9IA 1XLDA 4ZXLA 2VZTA 3WD4A 3VIJA 3QBUA 3CWHA 4C7FA 4DIAA 1PCWA 2Z1BA 3WQGA 3T2QA 2UY4A 1SUXA 3RMEA 3IPWA 3QPYA 1VP5A 2J7FA 3E2SA 1Y5VA 4I7VA 3BCFA 5CZTA 3RM9A 4MFEA 1M65A 1C90A 3U5UA 2EKGA 3HPAA 5HUPA 2ZXQA 1X7FA 1IWPA 4NZJA 2J8TA 3MY9A 1VBGA 2NQHA 3V7PA 4QROA 4QDWA 2OKOA 4Q22A 4GI4A 1QPNA 2WHKA 3TYAA 1DJNA 3GUWA 1OG0A 4IJBA 5G1TA 1IXNA 1KFLA 3EOSA 5BW6A 4AC7C 2A6LA 5BNKA 3CHCA 1XP3A 4I5UA 3Q4DA 1YLVA 2VR4A 2QJNA 4MDPA 4IJRA 1ZPTA 1FWAC 1UZHA 2PPGA 1YNYA 4HYRA 3N6HA 1LLOA 4HK5A 1W8GA 3W87A 4HU0A 1OY0A 5CXPA 3H2EA 2B7QA 3G8EA 4FNTA 2NQ9A 3EEGA 2X30A 2X8RA 3GM8A 1V3KA 3RDKA 3BPWA 1E55A 3ARQA 1HF6A 3TNBA 4DNHA 1NM9A 1SJBA 1AZ2A 1RALA 3EWCA 3QF0A 1ALDA 2VR5A 5GJMA 3KOWA 2HXTA 3B8DA 2IKHA 3UR2A 1Z9AA 3NTYA 4MVAA 3W02A 2RDWA 4RUBA 1S2TA 3VIFA 2CZDA 2WLYA 4WX2A 4IIDA 4M6VA 3VD4A 1CGWA 1H1ZA 3NO1A 5IM51 3IJQA 3PWAA 2VRKA 3MV11 4XZ9A 4GO8A 4O52A 4AIUA 2OTDA 2AQVA 4ZVJA 3DFTA 1R47A 3STGA 4QBXA 3T44A 1D7FA 2I5QA 3LENA 4W93A 1IIGA 2OEKA 5CBBA 1SR9A 4C5ZA 1J8VA 3VE7A 2J8GA 3VM5A 1BVNP 1QOQA 4QTGA 1MVYA 4CQCA 2VCCA 1BKHA 2PU1A 1VKFA 3MSDA 4HN8A 4BHYA 1LRQA 4PYSA 4MADA 1DWJM 2VVSA 1EGMA 3PY2A 3L0GA 3UZXA 2TSYA 3K1GA 1CGVA 2YBTA 4JYEA 5KSWA 1UR9A 3QTGA 3WLJA 3LCLA 2DSZA 2FZNA 3OLGA 4FOUA 1UJQA 3WQ8A 3A3XA 1W3HA 4A05A 4QNWA 1H62A 3SCSA 4AWEA 3LD5A 3N2TA 3SCNA 2I9UA 3S1WA 4NX5A 1EJXC 3HU7A 3OBAA 2QHAA 4QFUA 1R46A 4UTFA 5FESA 3UJFA 5AZ1A 5LA0A 3C0JA 2C19A 1MXDA 3L5AA 2FPTA 3KTCA 1CXIA 8XIAA 2WSYA 1MZRA 4UTTC 3IANA 4ICCX 1JZ5A 1LWJA 4X22A 3WN6A 3SJ3A 1LL4A 2W4XA 1TRIA 2B7PA 1TX0A 1KFBA 1R5YA 4HOZA 1EP2A 4MM1A 4JL2A 3DFNA 2EPNA 1TCMA 3B9DA 1TELA 2ACSA 1GTHA 3MUIA 1E9YB 3IUHA 1CB7B 1W1YA 4O15A 1OZQA 4UBPC 2D2OA 2PCEA 4FNSA 4NJHA 1RCQA 4H2HA 4R5EA 3V16A 1TA3A 3VI2A 3EWDA 1FWTA 3KOZA 5AYIA 5MF5A 2VURA 3SADA 1UD2A 5HOSA 2CEQA 4ILSA 1YDVA 2X16A 3QZEA 4WLCA 3VPLA 5A6AA 3FA4A 1PTDA 1G94A 4ICMA 3M0XA 4EVZA 1UKPA 4ICNA 2X41A 3C61A 2UWFA 4GYPC 4JTJA 3AXIA 2VRQA 4WJXA 1OGBA 4LU0A 2DJXA 2V5BA 4M7SA 4PA8A 3HJEA 1FWGC 4Z08A 4X9YA 4PN2A 3FGCA 1NU5A 2DSUA 1XBXA 1N2VA 3F5LA 1W54A 1GKPA 2XVKA 2BTMA 3QPZA 3I7RA 3RILA 2J75A 2OYKA 1E9IA 1Q2SA 2F38A 3DG6A 4AXKA 2FVKA 4D71A 2DZVA 3WBXA 2FZ8A 3PS7A 1CTNA 3GW3A 5FL1A 5D02A 4ZB5A 2A3LA 4L9YA 3SN0A 4B4FA 5GPRA 4AB4A 3EDJA 3RU6A 4XAGA 1GOOA 3LHYA 2OGYA 1H49A 1QNPA 2A5HA 3BJFA 3MJMA 2RFGA 2YL6A 4BI7A 3GX9A 1UD3A 3WD0A 3LHWA 1QK2A 5J5RA 2DEPA 1AQHA 1TPH1 1QPOA 4O18A 5FF3A 4AU0A 5DY3A 1VH7A 4MF4A 3EPNA 1PHWA 5FJOA 4JTTA 4GH3A 1XLGA 3SO7A 2ABAA 4P7LA 1J5SA 4AVFA 3W7HA 3WF3A 4IG2A 4I9TA 3TTYA 1CXEA 4QIUA 2J6XA 3D0CA 1GKQA 4XZMX 4BF5A 4PUNA 3RO8A 5CKSA 2OELA 5I77A 5I3HA 2MANA 2TAAA 2BODX 3MDUA 1EJRC 3DDMA 4REQB 2QMJA 2W66A 3N29A 2HRWA 1BF2A 4JEJA 4E4PA 1U1JA 3EZ4A 4PUKA 4PB3A 1RJRA 3FA5A 3L2IA 3Q65A 1M68A 3AICA 1XH1A 3MCNA 2J7DA 2FMOA 3W07A 3LOTA 3MPGA 3VX0A 1L6SA 4LRTA 1F4HA 1EC9A 2VOMA 3M41A 1KXVA 3ABZA 3EYPA 4ZEPA 1BD0A 1MXGA 1V7YA 3W1QA 3O3RA 4K7YA 4IQJA 1W1B1 4UB9A 5EKYA 3FHQA 3OJGA 4HOXA 2QCCA 1NAL1 1V6XA 5DXYA 4HPJA 3R58A 1OABA 3OVPA 1UZ1A 1C9DA 2BLEA 1DL3A 3AOFA 1XLLA 1Y5XA 1IXQA 1JRCA 3E0LA 5DRCA 4B3KA 4NJIA 3DGRA 5LIYX 1OIMA 2Y62A 5E0CA 1JDAA 1XBVA 3GYCA 3STCA 1IGSA 5DF0A 4C6FA 1MWOA 4OFCA 1I2OA 5TBOA 7ENLA 1GTEA 1XI3A 1H5VA 1NEYA 3WNNA 3AHYA 3VIGA 2Y8VA 2D3NA 1OT2A 2QUUA 2Y4SA 3BC9A 4FX6M 4RV3A 4UC5A 3C0QA 1NJJA 4NZ4A 3WDIA 3ALGA 3G1SA 1UA3A 3LI1A 2HVOA 3TZNA 1KFCA 4O17A 3HZ3A 1XUUA 1OGGA 3NVDA 4WRHA 1RV8A 2ZUMA 4C1NA 3C2YA 4ATLA 1CEOA 4K39A 4U33A 3TSBA 3PZNA 1Q63A 3LXAA 2OB3A 3W1RA 3VABA 1W8SA 5HR6A 4KWUA 3MQTA 4RJEA 3FA3A 3B0UX 4WY0B 1ZBVA 1MYRA 1CT5A 2Q01A 1YBQB 1VJSA 3TYDA 3GWQA 1L6FA 2NXHA 2FPYA 1YE6A 1N8FA 2DIKA 4I7WA 5K4ZA 2NUXA 4D8AA 3GXFA 3XIMA 3ERPA 3ZLFA 5IOBA 2DT1A 4Z2GA 1F3XA 1PYFA 5XINA 4GUHA 4IIFA 2CZVA 2X1TA 3ABQA 1FXQA 2PLJA 3GXPA 5AHFA 2OWXA 4LYKA 1SO4A 3UT0A 3ZXWA 2VZVA 4HZ8A 1YDNA 4P61A 1VBUA 1JCXA 4DUWA 3LG3A 4GNVA 9XIAA 5I00A 4UTLA 3CU2A 2VOTA 2RUSA 2D69A 1G4PA 3WLKX 1RVKA 1EF2A 4Q8TA 1BYDA 1TZZA 4B5UA 4DN1A 1IEWA 3K8LA 1V5XA 1W1VA 3HJZA 3W24A 4AD0A 4MJZA 4FAMA 3NL6A 3LPPA 1G69A 2UY3A 2RGMA 3QV7A 1Q6LA 1YRRA 3WKZA 5KETA 2ZXDA 2REQB 1XFCA 4S3JA 4X0VA 1QCWA 1C92A 2ZRXA 2YLAA 4RDWA 2QYGA 1M6JA 3U48A 1QTWA 4R33A 4CQAA 3TV8A 1BQGA 1F74A 1B31A 4GYKA 1SMAA 3VD9A 1VLIA 3AYSA 4D1IA 1EC8A 5I3JA 3JVAA 4LY4A 3VYLA 2ZZ6A 3KM8A 1EGVA 4YHEA 4MYAA 5CG7A 2W67A 1S5TA 1P48A 1LWIA 2WMFA 4B9YA 1EX5A 2EKCA 4J35A 3G1AA 4JOMA 1ZL1A 2QVNA 4L65A 3ZT7A 3VGGA 3NXLA 1UPMB 4K37A 1CLKA 2VKZG 3B05A 3USZA 5CJNA 3IIOA 4LUTA 1TQJA 2X0SA 4PMNA 5LNSA 3EX1A 3TONA 3P5YA 3PPGA 2HV5A 3IGSA 1WQ5A 2OOFA 4LCRA 3SUVA 4XD4A 1S3TC 2FKPA 3UW6A 2CLLA 1GYLA 1S5NA 2QLYA 1V3HA 4JBRA 4X2RA 2Z00A 2D3LA 1XHGA 5CPMA 2BOGX 1GEHA 3M47A 4B5WA 1NWUA 1Q65A 3BCDA 4H4IA 2F6KA 2HE5A 4AEFA 4YLWA 2OR2A 4UZUA 1WKYA 3QY7A 3VCRA 3KS6A 2BSLA 3I10A 5JBDA 3IJIA 3VD5A 1K9TA 3T0DA 3PNZA 1EJUC 1WBHA 4W9TA 1GOWA 3AJXA 4M51A 1M53A 4HP5A 2EJAA 4E8GA 1PVNA 4Y9AA 1PL9A 4E6MA 3GDBA 1P1MA 1SJAA 4KEUA 2PBGA 4NSBA 2J4GA 1ZUAX 1F3EA 3MZ2A 4J3TA 1S1PA 4GIEA 3ATZA 4FR6A 1W1A1 4Y9NA 1UUMA 1UD8A 4AH7A 4UTTA 3T55A 2BB0A 4WR3A 4IMGA 1FHVA 1PZ2A 1V51A 1HQTA 5D2VA 2H8ZA 4C6IA 3UF9A 3TU9A 5HWMA 2OG9A 4BF7A 4HA3A 1EJTC 5A8MA 1T6MA 4UFIA 5HA7A 3XISA 5DCEA 4GVGA 3WQ6A 4QX4A 3VD7A 1H1YA 2PTYA 4IISA 5C7HA 4O4VA 4CCDA 3NQMA 5M2FX 3BJSA 4ORMA 4Y7EA 4KWWA 1QNRA 3UJSA 1XINA 1VPXA 4DYKA 4XD5A 1AK5A 1OCBA 4EANA 1KNWA 3AS1A 4GY1A 1TWDA 3CTTA 5D04C 5IFPA 4OV4A 5TF0A 3ZQ9A 2BMBA 4KWSA 3CQIA 2ZA2A 4F2BA 4N9CA 1RY8A 4N9EA 3ITOA 4NU7A 4J9JA 1A0DA 3NYZA 1EB3A 3W1LA 3F4VA 1RSCA 3BAYA 3B0XA 3B9EA 1XC4A 5H8MA 4PCNA 2PGWA 4NNCA 1EQPA 5G4WA 4DXKA 4W86A 3SCPA 4JDYA 5D9OA 1EPXA 4IGSA 2Z27A 1D8CA 1NF0A 2GPTA 2J47A 4W89A 3EWWA 3THQA 3QTPA 3AWOA 3ITXA 1EOMA 2WKLA 3IAPA 2V30A 1DIOA 3E0WA 5CBJA 3OVQA 2QF8A 3DHPA 3P84A 1JG9A 1OINA 5C71A 4DI9A 3AZRA 3MYPA 1TZ7A 1YMYA 2F2KA 1EA9C 1Q8JA 4JFUA 3IVTA 3RRXA 4PTWA 4IUGA 2WBKA 5BZAA 2XGZA 2D73A 4RE2A 5HPCA 3PUEA 3IARA 2AMGA 4J7RA 1X8CA 3LGGA 3V0UA 4MB5A 3G6MA 1UKQA 5A1AA 2XSAA 1CCWB 2HBVA 3EB4A 2V63A 4GACA 1BAGA 3WH9A 2ADAA 4QJ3B 1WKDA 4JFTA 2VX6A 4E4FA 3SQMA 2GGGA 4CUCA 2PDHA 4CD5A 1FH7A 3DECA 3VOFA 3OHIA 3FXGA 4IPIA 4PRTA 1KR1A 1N7KA 5T9BG 2G4FA 2ACUA 2ZBTA 4P5UA 5AHMA 2PAJA 3KZSA 3ARXA 4O0QA 1N8WA 4YWIA 4JD4A 4IQDA 4G6CA 4ZO8A 1AQ0A 1OFDA 4RXGA 3AS3A 2WC3A 1DP0A 4FXJA 1AJ2A 2F84A 3GBEA 2PTDA 5K9CA 4ZR8A 3ICJA 3W2KA 2IKIA 4PTVA 3TYZA 3WQ5A 5C2GA 1EXBA 1UWAA 1KW1A 2Y7EA 4LNCA 4NI3A 1PIFA 4DBWA 5HMFA 2QIIA 4MB1A 1D3GA 3PBVA 4H9YA 3BTNA 3WYZA 3DX5A 4XO7A 3RMJA 1JUEA 5DT7A 1A5AA 4F9DA 4QQ3A 1N8IA 4WOZA 4HMCA 4NHVA 4K8GA 1C29A 3BG9A 1WZLA 3WQ4A 1F6PA 1HO4A 2X0HA 4E2OA 2NT0A 1DWFM 1S46A 3MI3A 2QV4A 4LCQA 4BI5A 2OSYA 3MI2A 4YIWA 1R0MA 3EXTA 1SVDA 1AMKA 3T05A 2OOGA 3VMOA 4ZQCA 5AYZA 4DQWA 3LBCA 1TR1A 4JCLA 3UU0A 2NZLA 3PZGA 1XISA 1R7OA 4AG0A 3WMBA 3MW7A 3UZJA 2Q71A 3BGGA 2D22A 2DPEA 2GQAA 2EAWA 4FALA 3W2UA 4XBKA 1TA3B 1YPIA 5I7GA 1E6SM 4P7QA 1L6WA 1KBLA 3IUIA 1YTEA 4K36A 4J3UA 2HTMA 3G1FA 1PDZA 3VNMA 4FIRA 5GQBA 1KA9F 3WCZA 2VFIA 2POTA 3BICA 3G5EA 1R9YA 2FVLA 1VD6A 3SGZA 3RITA 2VFEA 4AD5A 2Y7GA 1DWAM 1FH9A 3OA5A 1E1FA 2WMIA 1KRAC 2VQUA 1E0XA 3CLMA 4WHBA 3FAXA 3T07A 1IHIA 3W27A 5C55A 2EPLX 3FGCB 3FKRA 3WQPA 2XH4A 3PP7A 2NWSA 2QCNA 3T42A 4J27A 1DJZA 2HVNA 3W71A 1TMQA 1WO2A 4U2YA 3BG3A 3ANYA 4FEZA 1EH9A 3BAKA 3KEHA 3UWYA 2GQ3A 4XZLX 3PZVA 3WK1A 3W25A 4WKHA 3W74A 4MNLA 1TYGA 3PNUA 2NXIA 1UIOA 3A23A 2YDSA 2HS8A 4LNYA 1E6XM 4POCA 3C2FA 4IIHA 4D6CA 3KBJA 4EE9A 3TUUA 1KM4A 3EOOA 4US5D 2KAUC 4DAFA 4DEFA 5DELA 1XLCA 2HZGA 4JFVA 2VT0A 4E3TA 3PVFA 1IXPA 2FB2A 2BVDA 5HNRA 4IG2B 3E74A 5A6BA 2GUUA 1R30A 3HPZA 3TX9A 1PZ3A 2OLAA 1UOKA 3MB9A 4HYVA 2G3JA 4EIVA 3NQFA 2RKXA 3IAQA 3IJ7A 1I8JA 1XYMA 4OZOA 4GJJA 2XN1A 2ZOXA 4L4MA 3HN3A 2A0NA 2GJNA 4JHMA 2B7NA 2J13A 1F7BA 4MKVA 2PRHA 2VMFA 3TA6A 1CGXA 3I3EA 2OT1A 6ALDA 4MB4A 1HL8A 5FKYA 3UG8A 3WD2A 1JDEA 3H54A 3SUTA 1UIPA 2Y70A 4I90A 2O55A 1RJQA 3LB0A 1S5VA 2YXXA 3UD6A 3H2OA 5E93A 2QCDA 1G4SA 5DANA 4JIRA 1VFMA 1UJPA 1VPQA 1GOKA 3RUBL 4WK9A 2J66A 3N19B 3AHTA 4CNTA 4HTYA 1OX5A 2C16A 1QPQA 2QPXA 4DJFC 3W6MA 3MHFA 2WKJA 3NPUA 2WANA 1JYWA 4J3VA 1VHCA 5E70A 2Y85A 3CZGA 4KEVA 4IQLA 4A35A 1LM1A 3TQVA 5AOUA 1V6VA 2GL5A 3GNDA 2V5LA 4UQCA 3LMZA 1GJUA 2BX7A 4C60A 3S1XA 4AD3A 1PIIA 3UNDA 4O16A 1V0NA 1XM3A 3W1UA 2P0OA 4V1XA 3GNNA 3UJRA 1FHLA 3M0HA 4EPDC 2OO6A 3BV4A 4XVDA 4I6VA 2FFIA 1QO2A 3TOPA 3CQ0A 2AAMA 5C6MA 1TQXA 3A13A 1TWIA 1K8ZA 4ACYA 3N9KA 1OT1A 4HD5A 4N9DA 2NWRA 1DQUA 3N11A 5HMEA 3DYOA 3AIQA 3ATYA 3M43A 4C1NB 5G2IA 1XYCA 4W8AA 4CD8A 3I6EA 1P6CA 5D30A 5H8UA 1OB0A 1UQZA 5CCZA 4LAOA 3S1VA 2P3ZA 3HM7A 4PMOA 2W92A 2DGAA 4C6QA 1X38A 3WF2A 4DPQA 1VIZA 3A4AA 4AEEA 3WELA 1QPRA 1JPDX 1A3HA 3ZZ1A 3KP1A 4J40A 1QUMA 5C9XA 1GVQA 1W3JA 1GW1A 2C3ZA 4RK8A 3T1GA 2BNJA 3SBFA 3GVGA 1PIGA 3PM6A 3ZSTA 5JIWA 3P8JA 4DBSA 3H23A 4RNJA 3MUXA 3O2LA 1AH0A 1DBTA 3G0XA 3BAIA 1TPFA 4HZ7A 3QC0A 5HMDA 1VFSA 3S1UA 3KOFA 4GNKB 3OB8A 2BBFA 3RLGA 1AG1O 2EHHA 4RNIA 1ZJIA 3KTXA 2P50A 3NQ8A 1QI4A 2Z1VA 3DC0A 3APYA 4XBJA 1FKWA 2ZZ2A 3DAQA 4V33A 4HNTA 1H7RA 4UFLA 4PCPA 1IZJA 4P7RA 4KPLA 4M1BA 4IGNA 4NIRA 4YTQA 3G3DA 4AF0A 4S3BA 3NYDA 2VC6A 2WVTA 3ZO9A 5D2XA 1BEUA 4GUGA 3DFYA 4F79A 1ITCA 4O12A 2XH2A 3NFUA 5F2MA 3EA1A 4PE8A 1NP0A 4DZ5A 3VC5A 3FW6A 2VFFA 2YYUA 4TX8A 1V93A 3TTSA 2W6RA 2X09A 1KFJA 4QS5A 2WZIA 3UZYA 4PFHA 4IX2A 2HNEA 2DSKA 4W7UA 3N13A 2J77A 5FF4A 2NV9A 1P7TB 3HO8A 1UR2A 1TRDA 4JY9A 1RD5A 1CB2A 2P76A 2J7HA 4Q8WA 1UPPA 2FIQA 1FXPA 4XUGA 4CD6A 3NCOA 5H8PA 1I4NA 2HEJA 3SCWA 3TN4A 4LUTB 4P8WA 1VFUA 5D32A 4UFMA 5IRPA 2OYMA 1X7IA 1WDSA 2IPFA 3E6EA 3C3UA 2A7PA 2C6QA 5U4NA 1QNVA 3RYSA 2IQTA 3HF3A 1EX1A 4J28A 1F2JA 1K7XA 2G41A 2A3CA 3P3BA 1X39A 3E0VA 4RV8A 3KOYA 4HBKA 3BSMA 4M6PA 1TMLA 4Q4QA 4INFA 1PB0A 4CEUC 2O92A 4H7CA 1CGTA 2Q02A 2E5DA 3VE9A 3ARWA 3NPVA 4WKFA 4YS1A 3TC3A 3ZT6A 3KVMA 3CZLA 3AIWA 2PI6A 2WSPA 4TOQA 5LHEA 3GKAA 3UBPC 1YQ2A 1K6WA 4GIAA 1W5MA 5AYYA 4Q8UA 5CJ5A 2F2HA 4GINA 1J93A 1W3LA 1F4AA 4K8EA 2FHFA 5LSMA 4JIIX 3BG5A 5CZJA 1FA2A 1UASA 4H6EA 4IH3A 4U2ZA 3VDHA 5ABEA 1RHCA 5KEZA 1ICQA 4OHQA 3ZLHA 2ISWA 2HS6A 3VDAA 1UC5A 4DF0A 2BY2A 3L2MA 5JMUA 3T6CA 2IW0A 2Z1WA 3R12A 2WK2A 2XUCA 8TIMA 1U1UA 3AJ7A 4MUZA 1C9WA 4NZ1A 4IIEA 3VIIA 3M0MA 4FXRA 5EYWA 3HIJA 5K9XA 2WB5A 3GXIA 1QATA 2XZ9A 1A50A 1QMLA 2ISVA 3M9YA 5I3KA 2YSWA 1LL6A 4BK9A 3PZ9A 2DZTA 1M7XA 4OQVA 3RPMA 1F3TA 2QUNA 4EXAA 3RM4A 1GZ1A 1E40A 3SUUA 1J2BA 4GKLA 3HQPA 5I06A 1WDQA 2V68A 4MJMA 3O15A 3H8AA 1GK8A 1GKRA 2E3ZA 2POZA 1R9ZA 1RCXB 2I5IA 4LB3A 5IXEA 4HGXA 1FQ0A 3N1AA 1WYIA 1R38A 1E4LA 2JFEX 3M16A 4DUOA 4L1GA 1FWFC 2TPSA 3SI9A 1MW3A 3NG3A 4MNJA 5CPOA 1OBAA 3LTPA 1IR2A 3QW3A 4Z0JA 1SO3A 2QUVA 2CBJA 1O66A 1VCGA 3SR7A 4GZ7A 2Z7GA 3FFSA 4UMCA 3C0SA 3MMUA 3S1GA 4PBFA 4FSAA 1S1RA 2PGRA 1E1EA 4FNPA 4DAIA 3B8TA 1WCGA 3EGJA 1V7AA 3CB3A 4DNMA 4F4RA 1R85A 5K7JA 3ITYA 3NM3A 3CBWA 4KRUA 1M9HA 3CUGA 4KCTA 2BFGA 2ZZ3A 2RDTA 1OFQA 1FWBC 5E6YA 3B06A 5AFDA 1R6WA 5AY7A 1ZP4A 4BWLC 1JF6A 4NAFA 1K8YA 3LSCA 3KP0A 5FEZA 4LX4A 3V75A 4TUFA 3MMDA 3QC3A 3TMLA 3BZGA 5IDIA 4G1NA 4CNOA 5F7UA 1F73A 1NFGA 4IOTA 2ZUTA 1ZCCA 3BLPX 4GQGA 3O63A 1LRNA 5FEXA 1G4EA 5E5CA 2VX7A 1YNQA 4GK8A 4XZIA 4HA0A 5L6UA 3KOXA 3WK3A 3WBAA 2ZX9A 3LCGA 1UQYA 3GIQA 3FYPA 2WJFA 4FB7A 3A5VA 4PMQA 4Z2IA 3C52A 3QR0A 2PDUA 1V02A 1XLAA 4WD0A 4F0HA 4XD6A 1QOPA 2JEPA 3CIXA 3BOLA 3KCLA 4GUFA 1MI3A 1SSGA 2XIBA 3L68A 1U1HA 1L8NA 1TWZA 4L9XA 1UR3M 3YPIA 1J01A 1E4NA 5HJYA 5FEPA 2CKRA 3E1F1 1PCKA 4K38A 2DVXA 3GC5A 2G8ZA 2E6AA 5JUVA 2AAAA 4H9XA 4KCUA 4GZEA 1UWSA 3WSUA 3OQ8A 4LRSA 1F61A 4IMEA 4Q3MA 2HVMA 4H9UA 1BXNA 3VFCA 2OZTA 1V79A 3R8GA 3VAVA 2ZFAA 2HMCA 3RLVA 1UR8A 3C2EA 3CMGA 1VENA 3DCPA 3F03K 4DYEA 2C13A 4ZOAA 1QFEA 3VOIA 1EJVC 3OZOA 4QR6A 1UWTA 4ZTXA 4FP1A 3K46A 4A6GA 1J11A 1OF6A 3PTMA 1OZMA 3O6AA 3KHJA 4H01A 5HK4A 4NP7A 3U2CA 4DI8A 3CAKA 3ITTA 2YL8A 2WJDA 3E96A 4ZQRA 3EOUA 3W26A 4WZHA 4MAZA 3S83A 3W83A 2XWDA 1JGIA 1WBJA 3R6IA 3GD6A 6REQA 5I6SA 4WIWA 5FF7A 4OOZA 5A2CA 3MUY1 2FH8A 1F76A 2DIEA 3V35A 3QV9A 3IJDA 3PUDA 4CNPA 4J1OA 2VRJA 3VIPA 1KCZA 1GZJA 4LVBA 2G95A 4QRNA 4Y90A 1UWQA 4TMBA 2QCFA 1G7VA 3B40A 5CPTA 4PUJA 1JDDA 3LBMA 1B4EA 3LV6A 1QDSA 1KV5A 5I2UA 2C7FA 1IEXA 3UXKA 1S2UA 4WVXA 3BURA 4Y9OA 2G37A 2XSBA 3C8FA 1W9VA 3S9IA 3H2FA 4EAYA 3NSNA 1A5LC 5BYWA 3LY0A 1KTBA 3TNOA 2WMIB 1P0EA 4AIEA 5DXXA 1FWHC 4ZFCA 2PGEA 1NWRA 4PMRA 1TV7A 3JZEA 4TTUA 2VZSA 3IK4A 1SSDA 4W7VA 5D33A 2IQ0A 3FVMA 3W2NA 3PZIA 3B8VA 1S39A 1PEZA 2GZXA 3C2OA 2PDPA 3T08A 3BK0A 1ICSA 4PEEA 2WWDA 1ZGDA 2WCGA 3PC0A 3GRIA 4LEQA 5AHNA 1TV4A 4ZZ9A 4NUWA 1E43A 3UQNA 3W0KA 4PC8A 2XDFA 4OUIA 2ISDA 3VMNA 4MFDA 4QDMA 1K8CA 3CAQA 3BQ6A 3VOJA 5EMYA 3P62A 4W85A 3QGVA 4J3SA 4FI4A 1O5RA 3KWXA 5EMUA 4G8TA 5LGXA 5H91A 4JYDA 2QJMA 4LVFA 3IJ6A 1JCMP 1KBIA 2NVAA 2PU0A 1O60A 3FK4A 1W32A 3CHVA 4D2JA 1HN1A 1ADOA 2WHJA 3AIVA 4A8IA 1IEVA 1K9EA 1X6LA 3MHGA 3W7EA 4LB4A 2FZDA 3QQ1A 5K2ZA 4JTRA 4A4AA 5E0KA 3A9BA 3E2VA 4L4LA 3NQBA 1YW1A 4EKJA 1UWUA 4DPPA 4E0CA 2ZZ5A 1B3VA 3KCJA 1HJVA 4O1FA 3LN3A 2EPMX 2PUZA 1XXXA 3MP5A 4L4PA 5DQPA 3MCMA 3KS5A 1ENUA 3W7LA 4AY8A 1TPUA 2EJ1A 3AIEA 2QCDB 1QW9A 2WKGA 8CGTA 1JF5A 4AZ7A 4JTFA 2D23A 4JX4A 4LT9A 1IIHA 3SFWA 3T9PA 2VC7A 3QEZA 3NAVA 2ATSA 4PL1A 2P1FA 1UKSA 2O4MA 1Q45A 2OODA 1YIXA 2PWUA 2VEMA 3WLLA 2VI0A 2W3ZA 3B04A 7ODCA 4C6DA 1H2JA 4TV5A 4GD0A 1SFJA 4MSSA 3EAUA 1ZU8A 1K3UA 2YCEA 1UKTA 2QW5A 2OX1A 2ALRA 3PUGA 2E6YA 4ZSUA 1XYFA 1XSKA 1H63A 2WSQA 4Z1CA 1P0BA 3A5FA 3PB2A 3W75A 1GPFA 1R3VA 2XHYA 2B0MA 1AVAA 3GG0A 4GQQA 4UTMA 4V28A 1K77A 4F3HA 1JUKA 3E02A 1VFTA 3VNKA 3CASA 1ESWA 4B5SA 4HHPA 3BO9A 1WXZA 3W76A 4FPSA 4JY8A 4CQDA 3O07A 5FF2A 4X0NA 3WLIA 3BANA 4H00A 4CVUA 1NWTA 1KTNA 1KBBA 4M3PA 1HKWA 3UZ5A 4O53A 1BTMA 2GFTA 1XLJA 2MUCA 4GXMA 4H41A 5CJMA 1FFRA 4ECLA 3W7JA 1GVSA 3SRHA 4JIPA 2OWWA 1HO1A 4XD3A 1TMHA 2BWGA 2VC9A 5KITA 3F2BA 2P53A 3PJTA 1DEDA 1GVEA 3GTNA 3S4TA 1SPQA 2XVGA 5AN7A 3RN6A 4J3XA 3W1NA 2GGHA 1EO7A 1GHRA 2FGLA 1UR4A 4LBRA 3AZSA 4MMWA 2IS7A 2QDDA 4E2BA 1GNXA 3I4KA 1FBAA 1OVDA 5AC6A 3RO6A 2E7FA 1D3HA 2P8CA 5GJNA 2J25A 3IUDA 3CMJA 4DWSD 1RD6A 1WZKA 3E5PA 3CO8A 3WQDA 3DKJA 3GIYA 1B0IA 2CNCA 1UWIA 4PFMA 3PPFA 3ZVHA 3APGA 1NH6A 2CWXA 2WNWA 3A12A 5BU6A 3TFCA 1WAWA 3T0CA 2Y2WA 3NZ1A 4QDPA 3VIMA 4R85A 3DUGA 4AXNA 2VL4A 5AECA 3K2GA 3LSBA 3TJ4A 2H9AA 4XB3A 2DQXA 4NT0A 4BWLA 3BMWA 1OC7A 3ANVA 4AF0B 5AB3A 1W56A 2FMNA 4QLLA 5BXRA 3EMQA 1NDYA 5BRPA 3IIXA 1E56A 2VM8A 2P8BA 2JIEA 1TTQA 3HG4A 1LROA 1XIJA 1V3MA 3NL2A 1EBGA 3EWBX 4QSFA 1UZDA 5F1VA 1A5NC 2G50A 3T0BA 1JI2A 1Q4WA 4E38A 1KM1A 4RZ4A 4C6KA 1PZ0A 3RPTA 2DT3A 3QMTA 3SFKA 3R25A 6XIMA 1K7FA 1R8LA 4QE5A 3QR3A 4MDOA 4AD1A 1JR1A 2WCSA 3OGVA 4LVAA 3UZZA 5BCAA 2XINA 4RNFA 3JRKA 4B4HA 1R2RA 1AD4A 4GIYA 3K4AA 4P7OA 3R0KA 1JIBA 1FVPA 3IEBA 1E4MM 3I3BA 5KZMA 1DQXA 5HULA 5C2XA 3PN8A 2YCKX 3S6TA 5A6SA 1EJ7L 3FJLA 4JN6A 4RDVA 3TXZA 3SCVA 2EF9A 1H0GA 2V5KA 3CHFA 5XIMA 3NVTA 2X7WA 1TJRA 3QYQA 1KM0A 1A80A 3EXSA 4IHCA 2XU2A 2ESCA 1Q85A 4O1AA 4PCSA 1IZKA 4NY2A 1G5AA 1F8IA 4K68A 3SN4A 1BF6A 5A6JA 1QO5A 2FDSA 5FF0A 4FLSA 4QEEA 1VBHA 3L65A 4NG3A 2V2HA 1XLMA 1ML1A 4EOUA 3LPOA 1RH9A 3UYIA 3NQVA 1TV8A 3HA1A 2JK2A 2I17A 2RJHA 3B8WA 4UFKA 3MMTA 4DWDA 3NL5A 2GDQA 1EWDA 3THUA 2J62A 2I14A 3S2CA 1PKMA 1IV8A 2DP3A 3CB8A 1C7SA 1XS2A 4IX0A 1GONA 2CYGA 4OWGA 1Y8BA 3SQLA 3Q67A 1VR6A 1C93A 1U83A 2ISFA 2TMDA 1FCBA 4H6RA 4H8HA 1C91A 1POJA 4ERIA 4YTRA 4Z42C 4Q8NA 3IGHX 3B9OA 4MGGA 1JGMA 4WQ6A 3RG6A 1B9ZA 2CBIA 1PKYA 2WZHA 2C15A 2PSNA 3FVDA 3DI1A 3R8HA 3IRDA 3WL0A 2OQLA 2BHZA 1GEQA 5LGZA 3WLTA 1MO0A 2TRSA 1YTDA 3ZWSA 3ES8A 1XRFA 1B4KA 3PBMA 3OTRA 3ABXA 1J12A 1X8FA 3CZEA 3G6LA 4GVIA 4MWAC 3I3DA 3EXRA 3E49A 2PFHA 2C71A 2QQ6A 2GQ9A 3CJPA 4PBGA 4KCVA 1PJ9A 4HCLA 4S38A 1H4PA 2Z2UA 2PTXA 2YX0A 2QCMA 3OG2A 3MZNA 3WUGA 2BP1A 2Z4GA 4KS0A 4R27A 4AMCA 2WM0A 4LXFA 4OECA 3SRDA 1ODZA 3JR2A 2YOCA 4QSHA 2V3FA 2PRLA 3CV6A 2I16A 4DYJA 3AI0A 1OCNA 2XWEA 3TQPA 3MWCA 7XIMA 1XICA 2R91A 3WLQA 4IP7A 3QMSA 4OOUA 5G4HC 3ARYA 2WNQA 3OLDA 1TJ0A 2DH3A 5CGQA 4JIQA 2H8XA 4PCTA 3WNOA 2ZUVA 3ARSA 3M7SA 3JW7A 2A79A 2V6AA 3W28A 3ONCA 4H04A 4Q4KA 3REQA 3OIHA 2IKGA 1UBSA 1ISWA 4M6UA 4U3AA 2HXUA 3DEQA 1YXCA 4N02A 3M64A 4XX6A 4IFOA 3BGJA 3RCMA 4GBDA 1XRTA 1LLZA 1XF0A 3WJWA 3TOYA 3RF9A 3NEVA 5G1MA 4PBEA 2FPVA 3EMZA 5CZKA 1U30A 3TQKA 3H7VA 4OE7A 2Z2AA 3IACA 4J2PA 3DFQA 5EMKA 5DMNA 3SW6A 2AKMA 4EPEC 4GI6A 1G0CA 4XIMA 2QCEA 2O56A 4F2TA 3DFHA 3PSWA 1V6TA 3LXCA 4QCEA 4UQBA 4CKQA 2O9OA 2YFOA 3S6OA 2E1DA 2ATMA 3O6DA 3MUCA 4ZGYA 5C9UA 2YCLA 2Y5JA 1KM2A 2ZRZA 4KMQA 4Q33A 4LW7A 5EPDA 3NGJA 3U0HA 3RLUA 1NWSA 2F61A 4LUSA 5CGTA 1JYXA 4Z0SA 4HN4A 4JIHA 4QLJA 1XIFA 3E5BA 1E5JA 2R24A 1WE5A 3NSMA 1ONXA 2J7BA 1QHOA 1J5TA 1TX2A 4F0MA 2DUAA 1YE4A 3ISIX 5GNYA 1R3YA 4JTGA 3S2NA 2BDQA 1FTXA 1J0JA 1TPWA 3BH4A 3WDPP 3LHTA 2YB1A 2YJQA 3R0UA 2NVDA 4CQ9A 7TIMA 2F6XA 1Q66A 1RQEA 1E3XA 2DY3A 5CPLA 4ORIA 2D2JA 4RZBA 5A6BD 2GJXA 5AHEA 1PZ1A 1GYMA 2YW4A 3KCOA 3TLQA 2RAGA 3W7PA 1XCFA 3SURA 5CC6A 4F48A 2V67A 2A3EA 1LBFA 3LYEA 5BRBA 3MCOA 1JEZA 3ZFHA 3ZJ8A 1GJWA 1K4HA 3FJNA 2VGBA 3D6NA 1W1ZA 4ZSTA 4D8LA 5A8GA 1GVOA 4GX8A 3T2PA 2YBVA 3T8LA 4DVOA 1WDRA 2ZVIA 5F1UA 4QLKA 2NX1A 4HMDA 1ZSXA 1Q7MA 3AYVA 3D47A 4GNJA 4TXEA 1BYAA 4JTQA 5JXQA 6REQB 3FSTA 4IQEA 4K3ZA 3S5ZA 3WF1A 3UPBA 3DHFA 4QG9A 3EWUA 2PF8A 1QHPA 3WX7A 4JTLA 1M41A 4DZHA 4LBSA 4Y9PA 2WXDM 3B03A 2DW7A 1I60A 4BEQA 4HQVA 4JGDA 3UPWA 1H60A 4ADUA 4AYGA 1BHGA 1LLWA 1ZY9A 3OHMB 2CFFA 4PODA 4PUDA 4DX3A 3GZ3A 1SJDA 4I9AA 1RBOB 4ZA0A 2V5CA 3ZYZA 4E8DA 3UGRA 5BOEA 1W0MA 2DSVA 2XIIA 1UW9A 1CX9A 1VFFA 3FV9A 1A47A 4WGHA 3PULA 4Y9MA 2OKTA 1X98A 1REQA 4O1EA 4P8VA 3LLFA 1E9LA 5CZSA 1KXTA 4JQ2A 1GORA 5K3VA 1FRBA 1TTIA 2ZZ4A 3L4UA 2XSXA 3H2MA 4JPGA 1JRBA 3KBMA 2WO5A 1XC6A 4FR1A 4JTIA 4C6OA 3LGDA 3QW4B 3W9ZA 4W87A 3N14A 4L64A 3ZOAA 3VGHA 2QKFA 3MANA 1TSIA 4IIGA 9CGTA 1XIHA 1GVIA 1AZ1A 1I2PA 2NX3A 2Q3OA 4C65A 1EOKA 2WZEA 2HPMA 1PX4A 3B9AA 3AMCA 3RFAA 3H2NA 3ABSA 3LDVA 3S2JA 3ZMRA 5A94A 1QHZA 4O57A 1HJSA 2A3AA 1HFBA 5FJIA 2A4AA 4B5NA 3L2LA 2VUYA 1TJ2A 3CMFA 1CPUA 4FF5A 2DVTA 3I65A 2D24A 2V81A 3DESA 1Q6OA 2GJRA 4NJJA 3RX2A 3C5QA 1EJSC 4QS6A 3CUZA 3UY7A 2OQYA 3DI0A 1ZP3A 1ZJBA 3DOPA 1TUXA 1QT1A 4WKAA 5F2LA 1E9ZB 3TAKA 1DJGA 4E5TA 2V5DA 4LCSA 1I1XA 4YPJA 2ZICA 3M5ZA 1BVZA 4HPNA 4N6FA 5IHSA 3PZUA 1Q6EA 3EWXA 1EXPA 5DT5A 3AXXA 4MUPA 4WSHA 1TJ1A 4PUWA 1K9DA 1I2RA 1EZWA 1GOMA 5CPSA 4WUIA 3THDA 4UR9A 2BOEX 2ICSA 2BVTA 2JE8A 3F2DA 1W1TA 3BW3A 5LIKX 3VNJA 1P0KA 4GUJA 3U8GA 3EX2A 3L5LA 4AZ5A 1VCFA 4A21A 4W4QA 3KFTA 2CLMA 1K70A 3OO2A 1GOXA 3AS2A 1VPYA 1XW8A 1W6TA 2YCIX 4LS1A 1RVGA 2GSJA 9RUBA 4N7QA 1WOAA 2ONEA 4HMEA 1KQYA 5CAKA 3K5XA 2XM1A 5DBTA 3BLFA 3T8QA 3E0IA 1EEPA 2C1HA 4HJFA 1HZYA 3ZJ6A 4ZOEA 5A8OA 1GUVA 3NDOA 1PWMA 2XYLA 3DYMA 3I4EA 4GI8A 5M1TA 3ZM8A 3U7VA 3B4YA 2VX4A 1LRTA 5D4YA 3RCNA 2RGLA 4Q7BA 4DM1A 5JBEA 2HK1A 3QXBA 4FLOA 3GXNA 2WJEA 3M0LA 1NOUA 1LTDA 2J8FA 1TPC1 2W79A 3T2OA 1PV8A 4OBRA 1S2AA 2WWCA 2D0HA 2Z24A 1NOFA 4HVXA 2F6UA 5HNTA 1SQ7A 1VFOA 3BMXA 3BCJA 1ONRA 2UY5A 1OWQA 2CITA 4D6HA 4HPXA 3RLHA 4HMNA 1I2QA 2HE8A 1TKKA 1B3ZA 3WBWA 3LPFA 3BLDA 1JD9A 3P81A 3ARZA 4GQBA 1PSCA 2PP3A 3HB9A 1TG7A 2CERA 1VBRA 4DLFA 2YA1A 1KM6A 1M04A 3AQUA 1B30A 4GGHA 3IJ8A 2E8ZA 4GFSA 1B3YA 3W1XA 1R2SA 3AHXA 1WOBA 2P10A 4LS2A 4I3GA 4DO4A 2PLMA 1P0DA 1HNYA 3I6TA 3N4AA 1LF1A 1VQTA 1DJWA 2YL5A 5HDRA 3AUJA 1KLZA 1WDWA 3EDEA 2PC4A 3HQ1A 2WJZA 4MWAA 2FZ9A 4H1ZA 3SIZA 1J9YA 1F5ZA 4ZO6A 1R2TA 3VC6A 2I7GA 3BSGA 5A8PA 3WLPA 1L8PA 1UYQA 3KWSA 4XZWA 3K8MA 1QW7A 4FNRA 1XBYA 5FJUA 5FACA 2DJLA 4HZ6A 2CPUA 4DO7A 4NZCA 3MS8A 4JNMA 3UXDA 4GJ1A 4UMAA 3URNA 4L7ZA 4MKSA 4B92A 3HV8A 1OIFA 4V27A 3ZR4A 3T78A 2PGFA 5CC3A 4F0SA 1SM9A 1CI1A 3ZVHB 1QI2A 3UG4A 1LQAA 3TJLA 3SY5A 1R3QA 4ZB0A 4DJDC 1RJPA 1LL7A 3PBGA 1EUNA 1S3HA 4Q4MA 2H9AB 1DJYA 1PTGA 1X1NA 2FGZA 3DKLA 1FP9A 1H3GA 3KRBA 3ANUA 2ZYFA 1IWBA 1ZFJA 4RNHA 3UWUA 2QEZA 1C8QA 1NELA 1QNQA 4DXVA 2GGJA 3V5OA 1OSEA 5T9CE 3E2RA 1EA0A 1HKVA 4MLRA 1NSJA 2PWEA 4LAKA 4L4OA 4AD2A 4GFIA 2VCAA 3UG5A 3VNYA 5D09A 1K9FA 2V2DA 1I1WA 1PKLA 3AMKA 1I9CB 4CVWA 3WD3A 3ZT5A 1FKXA 2J9XA 4LYRA 5DFAA 3JZUA 4PGLA 4GLEA 1GHSA 2FTWA 3WNKA 1H7WA 1WUEA 3MT1A 4Z17A 3SY8A 1ITXA 3J7HA 2A2IA 3NOEA 3H6OA 1VYSX 4LV9A 3E2QA 2QAPA 1XQLA 4F0KA 2PWHA 1V03A 2CLEA 3V5CA 3N73A 3DBPA 4F9JA 3O05A 4NX0A 3LPGA 2QT3A 3NR0A 4OBSA 3ZR5A 4Q4PA 1FCQA 3TN5A 3IVUA 1GVYA 3VINA 4UOJA 3IS4A 1IT7A 2QGHA 2EPOA 4XAYA 4L1WA 3SSJA 3HG3A 1XIEA 4FMVA 2VC5A 1UG6A 3BVJA 3QOMA 5CLWA 3W2LA 3W2JA 3ARUA 1KKOA 3SCUA 1TPEA 1IGWA 4G7FA 3CGTA 3L4VA 1TPDA 3L0NA 4I9JA 1DXFA 4LYQA 3NDYA 3AIBA 3MU7A 3GG1A 4YMZA 3ZR6A 1MQPA 3I6RA 1CXKA 1FH8A 4GGBA 1KV8A 2FB3A 5FCZA 1KWGA 3FDKA 2XFRA 2GQ8A 3TN3A 2GWNA 1EKOA 3GDTA 3LX9A 4GY7A 1XIBA 1AW1A 1J0KA 1T99A 3TIMA 1XLEA 1WKEA 1VRXA 2PLKA 1SO6A 3Q94A 4XKMA 1XX1A 2NV1A 1BXBA 3T0TA 1O1ZA 2WZMA 1HL2A 4S2BA 3CWOX 2AGKA 3CH9A 3BDKA 4XAPA 1HVQA 2BXYA 1VYRA 1OFBA 1H09A 4C5YA 1GZGA 3MBFA 3OGSA 3MWAA 1VC4A 1EDQA 1JFXA 5B7ZA 2JEQA 2E68A 4KWOA 4KF1A 1LT7A 4G7EA 1W3KA 1JJKA 2WVUA 1AL7A 3CV2A 1NQ6A 4DJFD 1MW1A 4NZ5A 5T26A 1W31A 3ID7A 4ZOCA 2XGBA 4IM4A 1E73M 2EBNA 1W17A 4D8ZA 1ZBCA 1MNZA 4HZMA 4DRSA 3G1XA 1N82A 4JTUA 4MAVA 1AJZA 4ZQMA 3UR8A 1PXGA 1XLIA 1J6OA 4JICA 3WEZA 2O9TA 4O19A 4ZTYA 4C1LA 1JPKA 5CSUA 4ZO9A 1AQFA 2IXUA 1VJZA 2V2CA 2CZEA 5A2AA 3H24A 4XZBA 1J6PA 5D2WA 4KGJA 1QR7A 1VJIA 3VTRA 2CBVA 1PBGA 1QWKA 1CLVA 2DZWA 3HG2A 4XG1A 3GTHA 3CYVA 1JCJA 4PCFA 1FOBA 1O6IA 2CZ5A 2NQJA 2WVVA 3G0UA 2C18A 2WM1A 3WNMA 3MO4A 4Z1DA 2PDLA 3L5MA 2L5HA 2Y61A 4XISA 1CENA 3C2RA 4JNZA 1Q6DA 3HOJA 3LHZA 5CZ0A 3REQB 1Q7ZA 2ZDSA 4U31A 3VA8A 4YVXA 3S42A 2Q8XA 4P2VA 2VFGA 5HJLA 3FKKA 4IL2A 3NSXA 4B3LA 1L2UA 2VQTA 4B9ZA 3O0FA 3S6DA 2QJGA 3WQOA 3KXQA 1S38A 4HPGA 2SFPA 1AD1A 3GXDA 2EXOA 1A53A 2QS8A 5AKQA 4O28A 3W7OA 3V1PA 1RAKA 3QHNA 5IHRA 3LCIA 4FNQA 3G0SA 5KTLA 3UWZA 3R8RA 2VGFA 1UMYA 4PRWA 5JQ9A 2DIJA 1FWDC 2GJPA 5LNUA 1H7NA 4UQEA 4C6JA 3PTKA 1NOWA 3AWNA 2YCLB 3EKZA 4YL2A 3LI0A 3NQCA 4YVPA 1H61A 3M5XA 2E9LA 4YXGA 1T96A 4C7DA 3L12A 3B4UA 5K9DA 3UXAA 5C7VA 3PUOA 4AHPA 4O1DA 3TDFA 1VAHA 2AMXA 2PDFA 2PB1A 4LUSB 4ONVA 2C79A 3TQ0A 2G3MA 1W3NA 1E72M 1VLWA 3M44A 3FX4A 2PEVA 3SECA 2VD9A 3NXFA 1B54A 1DJXA 1ISYA 3W7NA 4JX6A 4M1RA 2DSWA 3OIXA 1OADA 4IMFA 3W2MA 1KKRA 3W7RA 4PB5A 2ZUNA 1TTPA 3T4WA 2E1WA 2WLZA 1X97A 4IPPA 3MKKA 4KFOA 2VDHA 4NYUA 2E4TA 1UR1A 4IJCA 4M6QA 3LM3A 2Y24A 2UZ9A 2GJXB 1UCWA 3P2VA 4IL0A 1JL8A 4EX4A 3WH7A 2FFCA 2ZXAA 2ZX7A 3WQWA 4XAZA 2J6VA 4QP0A 1Q6RA 2OCZA 2VFDA 1I0BA 4NKCA 4OJYA 1GPWA 1UP2A 1Q4NX 2E09A 1E1CA 1JZ4A 1NDVA 4NJGA 1DJQA 4ZE4A 2QIWA 2A6NA 2BOFX 4JS3A 3CM4A 3PANA 2H3BA 3W1AA 1RCOB 1DQWA 3GE7A 3P80A 3HFTA 3OVRA 1TTJA 1LQ2A 4M24A 1K7EA 3EB3A 5GJPA 1AMYA 1GG1A 1Q6QA 2CESA 1CNVA 2PDYA 1DE5A 3GB6A 4W8BA 4MZ8A 5F4WA 2E25A 3KRZA 3URQA 3QMRA 1XG4A 2Z1KA 3LZ3A 4RZ6A 2X0YA 4FF7A 4OV9A 1B5TA 2ZUWA 3VKCA 3W00A 1SO5A 2WVSA 2DT0A 4R3UA 2CKSA 1FWSA 1U5HA 1G7UA 3H4GA 4GBUA 1YBQA 4Z2KA 3AMLA 3WFZA 4CU8A 1JZ3A 3U3HA 1REQB 4B5XA 3AMDA 4I8YA 2BHUA 3T0AA 5H1WA 2W5FA 3D3FA 2V3EA 4WJ8A 3W1TA 3L4TA 3ZVIA 2OEMA 4AIOA 3W3OA 4US5A 4EXBA 4KFNA 2LLEA 2I5GA 2RDXA 1HGYA 1GQNA 2J7EA 3SDOA 2X2YA 2J9ZA 3VX1A 3KL0A 3MUZ1 5I79A 5AYBA 2FZMA 4GOAA 2DZBA 3C0LA 2W0UA 1FCVA 1TWWA 3KDOA 1J18A 1L6YA 4DJDA 2JKEA 4XUYA 2JKAA 3BAJA 4DF1A 3PB0A 2PLCA 1R86A 1RLDA 3LTYA 1CZ1A 5A95A 1H7XA 4HU8A 3E0FA 5ECVA 1HJUA 4Q4SA 4RE4A 1HX0A 3OEXA 2TYSA 1DTNA 1W37A 4HA4A 3SGUA 4YCOA 2BGNE 2IQDA 4PMZA 4GVFA 4P8XA 2QMKA 3UWWA 2WNNA 1POKA 3FEMA 2REQA 3VGFA 1F6YA 3T7VA 3RX3A 3CAWA 3GO2A 3NJ3A 4KFPA 3TJIA 3E38A 5AC4A 3N2CA 7CGTA 1X96A 1GCYA 4KQNA 5FI8A 5L9FA 4DELA 1JNDA 2R94A 4US6A 4HPHA 1NY1A 5BWAA 5AVNA 1JXJA 2BY1A 4ML4A 4TX9A 1RLCL 4QJ5B 2BG5A 3TW9A 1R87A 5A6LA 5BROA 3RJYA 2YLLA 3WFAA 1UB3A 3PZMA 4TTGA 4MPQA 1MSSA 3GZAA 3KLLA 1KC7A 1JZ7A 4G56A 2ZC1A 5ABHA 4B16A 2AL2A 2F9RA 4H8UA 5AYXA 1ZBKA 1S2WA 3KBSA 3KVKA 2ACRA 1BGGA 2BS9A 4JTAA 3UNTA 5JIPA 5C54A 1VCVA 3WLNA 1UH3A 4UCFA 4QHRA 1YEYA 4Q7IA 4L1XA 4AC1X 4RR4A 1XIDA 2A21A 3VXGA 2QNEA 1Q13A 4JZ5A 1RQBA 2DDXA 4KIRA 1W9DM 3CL7A 3BOFA 1XPGA 2ZX8A 3A4XA 2I57A 4PRRA 5D38A 3BQ5A 3PTQA 1JVNA 1DJIA 4LJ3A 3CAVA 3CHEA 1E71M 3K4WA 3KBNA 4DJED 4HT3A 3VNLA 1HUVA 4QAWA 3LERA 3VGEA 5MHBA 4UTUA 1Y7VA 4DZIA 3G3MA 4A22A 3V3WA 3NPXA 3FEQA 3TWAA 4URIA 2VWTA 4RKAA 2J79A 2VYOA 5CPNA 2QULA 2VEGA 2DH2A 2ZVRA 1OCQA 1E6PA 4ATDA 4ML9A 1LZOA 5JU6A 2I56A 1A4LA 1AH4A 1FUYA 3GVRA 4Y8EA 1XKJA 1EO5A 1XUZA 3OOQA 1L0PA 3BGAA 1Q7QA 1DJHA 5LXEA 4H3DA 2YZ5A 3HGOA 3WQFA 1DHKA 3IIVA 1OG6A 2VTFA 2ZX6A 2UV8G 5I3IA 5H2ZA 4GABA 1BSIA 4O50A 2PE4A 1EUAA 4IF2A 4LF2A 5DRIA 3LCFA 2GYIA 1GVFA 4H19A 3P8IA 4JIEA 4FS9A 5I07A 3EEZA 1DWIM 3BAXA 1D3CA 3NEHA 1AH3A 2X40A 3BL3A 3ECQA 3B8IA 3QHMA 3QZ6A 1WDPA 2ZE3A 1NARA 3OLEA 1AODA 4KCWA 3MSYA 4ZL1A 5CEWA 2XPKA 2Y6ZA 3Q45A 4TU1A 4MWAB 4AIBA 2P5NA 2Y63A 4IMDA 4ZXOA 5B7YA 4IT1A 3BV7A 2OVLA 1ITQA 1T8XA 3LBOA 3KE0A 2OSWA 1F05A 4K1GA 5LHFA 2NVCA 3ZJKA 4TO8A 3M46A 3BXWA 2XN0A 4C91A 1ADSA 2HK0A 5CLTA 1AW5A 2Q8LA 5EL1A 3DHUA 4LUJA 4PUEA 4NASA 4UIOA 1W5PA 4I6KA 1QK0A 3DHDA 2ZX5A 4FOJA 3H22A 1J96A 3KL3A 2UBPC 4JTHA 4PMXA 2XTKA 4H6KA 4UQ9A 5G4EA 2Z0IA 5I5RA 1XGZA 2VCBA 2GOUA 4H83A 3A4WA 3TEVA 1Y5WA 3GVQA 2BXZA 1HW6A 4Z1AA 4HNCA 3DENA 2DQWA 2NT1A 3UA4A 4D72A 2OJPA 2PP0A 4TQTA 1DIDA 3EWZA 1JQVA 3IV8A 2FHBA 5HQMA 5M3WA 3EX4A 2X05A 1ZNNA 3H4WA 4IMCA 4GX9A 1FY6A 4MYXA 4GY0A 4DO6A 3BAWA 1QXLA 1TV2A 3JU2A 3AAMA 4GWEA 1YADA 5CC5A 3PK7A 3KLKA 1M03A 5CSRA 3H70A 2EG7A 4AX6A 1SGJA 2OQHA 4YVVA 1PE1A 2ZTKA 2JF7A 3O16A 2O0TA 2JIWA 2PDGA 5G1YA 4A29A 3BUVA 5HPOA 1FCUA 3HGJA 1HKMA 4UWMA 3ES7A 3MVTA 4IUOA 4JN7A 1XWYA 2EO7A 2OZ0A 2ANUA 2VGGA 3HQOA 2VD8A 2E6FA 3LM7A 4A2RA 3PWGA 4PH6A 1WB0A 3IK2A 2J74A 1OCJA 2PDJA 5HJXA 4H9ZA 3W70A 4HNNA 1XDJA 1MRAA 4DUVA 3QRHA 4NVTA 4AZBA 1HVXA 3Q58A 4M56A 4BQ3A 1US0A 2QPSA 1JPHA 2GGEA 3G22A 3GH7A 4MNKA 3CZKA 3B0PA 1R7AA 3FJ6A 4WGXA 1NQKA 5I3DA 4C6LA 2QVHA 4MJ2A 5E9XA 3CIVA 4H8VA 4CD4A 3N04A 4UQDA 1I2NA 3M4HA 1I75A 1MW0A 4ZQNA 3WLSA 1B57A 3N17A 4BKNA 2JKPA 1BXCA 2AGTA 4PSRA 3UVAA 2IPJA 1AFSA 1HTIA 2PD9A 4Q8VA 1XIGA 2CHRA 3TTQA 3B0YA 1H5YA 3DU0A 4CCCA 1VEMA 4WEVX 1OF8A 3LTSA 4HK6A