3DBNA

Crystal structure of the streptoccocus suis serotype2 d-mannonate dehydratase in complex with its substrate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
363
structure length
349
Chain Sequence
SHMKMSFRWYGKKDPVTLEEIKAIPGMQGIVTAVYDVPVGQAWPLENILELKKMVEEAGLEITVIESIPVHEDIKQGKPNRDALIENYKTSIRNVGAAGIPVVCYNFMPVFDWTRSDLHHPLPDGSTSLAFLKSDLAGVDPSKEEMKAIIENYRQNISEEDLWANLEYFIKAILPTAEEAGVKMAIHPDDPPYGIFGLPRIITGQEAVERFLNLYDSEHNGITMCVGSYASDPKNDVLAMTEYALKRNRINFMHTRNVTAGAWGFQETAHLSQAGDIDMNAVVKLLVDYDWQGSLRPDHGRRIWGDQTKTPGYGLYDRALGATYFNGLYEANMRAAGKTPDFGIKAKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannonate dehydratase
publication title Crystal structures of Streptococcus suis mannonate dehydratase (ManD) and its complex with substrate: genetic and biochemical evidence for a catalytic mechanism
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Lyase
total genus 108
structure length 349
sequence length 363
chains with identical sequence B
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03786 UxuA D-mannonate dehydratase (UxuA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3dbnA00
5J8LA 4XIMA 1DXIA 2NQJA 1XIGA 9XIAA 1XIFA 2XINA 4QDPA 4YTSA 3AALA 3KBWA 3IUDA 3KBVA 3VNKA 3M0YA 4GQBA 4A8RA 4K1GA 3U0HA 1XLLA 3ITOA 3ITTA 5AVNA 1XISA 4XSLA 3ITLA 3ITXA 5EMLA 4DVOA 3P6LA 1XLAA 2GYIA 1XINA 4XIAA 1QUMA 5C9ZA 3AAMA 3XIMA 3TC3A 3C0SA 3ITVA 5EMMA 1XIIA 2GVEA 3VNIA 4QE4A 3DBNA 1XLFA 1D8WA 2I56A 1XYMA 4QE5A 3VYLA 4G56A 4GJJA 1DIEA 4YTQA 1XIDA 1XLMA 4K3ZA 4DUOA 4YTRA 3AYTA 2ZDSA 2NQ9A 1XYBA 8XIAA 3XISA 3KBSA 3GNXA 6XIMA 2ZVRA 3VNMA 5B7YA 2I57A 3C0QA 3TVAA 2XIMA 3CQIA 1K77A 3KCJA 3M0VA 3VNJA 3M0MA 4Q7IA 5B7ZA 3WQOA 2Q02A 4EACA 1XLDA 1XLCA 3CQJA 1QT1A 4XSMA 3BANA 2X7VA 1XLBA 3FVMA 1DE6A 3JU2A 4HGXA 3UA3A 3KBJA 3CNYA 4ZBCA 3CWHA 3P14A 1I60A 4J4KA 3CQKA 4PGLA 3UA4A 4A8LA 1XP3A 1XYLA 5FA5A 1MUWA 4ZB2A 4X60A 3KBNA 3BWWA 2GUBA 1XLEA 5XINA 1OADA 1XIMA 3QZAA 3UVAA 4YTUA 3XINA 1XLJA 9XIMA 4ZB0A 3M0HA 4GLEA 4US6A 1XYAA 3M0LA 3ITYA 1XICA 3N4AA 4QDWA 1DE5A 4LNCA 4YTTA 5XIAA 1DIDA 2XISA 1XIBA 5I7GA 2QULA 1XIJA 3BDKA 1S5MA 3KTCA 4PFHA 2J6VA 4X63A 4OVXA 4XISA 1XLKA 3M0XA 8XIMA 3KCLA 3AYVA 5EMKA 4KW2A 1MNZA 5AVHA 3C0LA 4HHMA 4X61A 4GJIA 5H1WA 4A8IA 1XLIA 1A0EA 3KCOA 2QUMA 4EAYA 5B80A 2NQHA 3QC0A 2QUNA 2OU4A 1CLKA 3U3HA 1A0CA 1XYCA 1BXBA 3VNLA 2X7WA 1TZ9A 2HK0A 4HNOA 1XLGA 3LMZA 1QTWA 3OBEA 4ZB5A 1XIHA 3BZJA 4W4QA 4HHLA 1BXCA 4QEHA 4QE1A 1S5NA 3BZGA 4E3VA 3KWSA 3IUHA 3KBMA 1A0DA 3DX5A 5EMJA 2G4JA 1YX1A 3IUIA 1XIEA 3QYSA 4QEEA 2G0WA 2HCVA 2HK1A 3QXBA 4A8NA 3CQHA 3L23A 1O1HA 7XIMA 5TNVA 3UU0A 1XLHA 5XIMA 2GLKA 6XIAA 2QW5A 4XKMA 5H6HA 1I6NA 3UXIA 3NGFA 1GW9A
chains in the Genus database with same CATH superfamily
3FFSA 3H4XA 5BWAA 3TLQA 1THFD 2HEJA 1R3TA 2PP0A 2V6AA 1WUFA 1BVWA 2XIQA 3M0IA 2IPWA 2PDXA 4UWMA 4N6EA 4C6LA 3C2FA 3ES8A 2VCAA 4HVXA 5KEZA 1ZL1A 3R1ZA 3O15A 1FXQA 3CPGA 5LYRA 4HOZA 3ARUA 2GJRA 3G1VA 2D2OA 4OOZA 4WKFA 1PZ0A 1KRMA 1SVDA 3EXTA 1R9XA 3TP4A 3E74A 1YE6A 1V08A 3EOEA 3ARXA 4QTGA 2IS7A 1UR4A 3FVMA 2B0MA 2VEKA 2XYLA 3CUZA 2PDIA 4IL0A 1VLWA 4OU1A 2Q01A 3REQA 1NWTA 3G6LA 4GY1A 3W7HA 3WDPP 2NUXA 1WAUA 1P6WA 2GL5A 5CG0A 4R88A 3A3HA 1Q4WA 2X2YA 3SIZA 4DIAA 3OZOA 3N3TA 2DUZA 2DY3A 5A6SA 4PMUA 4Q7BA 1CX9A 1JR1A 2V5JA 4J28A 4KETA 2UBPC 5DMYA 4Q4KA 3VABA 4LNYA 3WBWA 3TJXA 3DEQA 5JBFA 2ZUVA 5EB8A 1R2RA 1UWUA 4JKLA 1G69A 1SR9A 3UWWA 1U1UA 3LCXA 2VGFA 2PGWA 1RVGA 5E9XA 3WH9A 3R8GA 4HA3A 1PIFA 4QISA 4O4WA 2RFGA 1KXVA 3QHOA 4N42A 2D0HA 4V28A 4ADUA 3DBNA 2YSWA 1P6BA 3EX2A 1TJ2A 1P6CA 1EZWA 4BI7A 1WPCA 4JEJA 3SAZA 5C2CA 1UR3M 1O6IA 4AHPA 1EA0A 1VEMA 4QSHA 1MW3A 2V5BA 3HM7A 4KCUA 4JIRA 3MZNA 3FNDA 1UR9A 3NO3A 4S2CA 2Y7EA 1TWIA 3UA4A 2ZA3A 3S47A 3EKGA 2EQDA 3H54A 3SQSA 1NFPA 3Q67A 2WMIA 3NUKA 4F40A 1J8VA 1YQ2A 3WQGA 7PTDA 1HGYA 1PIIA 4ZL1A 2TODA 3GW3A 3MI6A 4AYGA 3E49A 3IIPA 4HJWA 1ZQ5A 2POTA 3QW3A 4H1ZA 2Z0IA 1WBHA 1KQZA 5EMJA 3DZ1A 2A3CA 1XW8A 1F73A 2GWNA 3S2LA 4O15A 4BEQA 1SYTA 2YL5A 1XM3A 3AO0A 3WQ4A 4XO6A 1ZLPA 4QG9A 1JUBA 1UWIA 2O9TA 1CGXA 1LCOA 3VKKA 3QVQA 1WZKA 5AYYA 5CCZA 2R24A 3C2YA 1XI3A 3PUOA 1MRAA 3EBVA 2ABBA 4M19A 5AHIA 5I24A 1EZ2A 1F8MA 4UCFA 3VD7A 2QV4A 4S3CA 3FYOA 1DHKA 4P7NA 3NPVA 1EO7A 3QZ6A 4CCDA 4CN4A 2BXYA 4PN2A 5BZAA 4IL2A 4DHGA 2PE4A 1GG1A 3B8UA 4WZHA 2NXHA 2YDAA 3LG3A 2Z25A 2D0GA 4HT3A 2I5IA 3QKEA 3CAWA 3SUUA 4QLJA 2XZ7A 5CJ5A 3S2NA 4H6QA 4MB3A 3DKJA 3OA3A 1E6NA 3NZQA 5HWMA 1A47A 2I14A 1EDQA 2IKJA 4Q8MA 4BI5A 1S3HA 1DEDA 2V82A 4DO5A 1QO5A 2ZICA 5E09A 3VDBA 1LROA 5CPTA 4AC7C 3HQOA 4A8NA 3WH8A 3EDEA 3USBA 4WOZA 3CMFA 1EGVA 1FH9A 4EIVA 3TZNA 3VCRA 3PHAA 1XCXA 2WMKA 3WYZA 4LAMA 4BQ2A 3QGKC 1W91A 4A8RA 1YPXA 1XF0A 3C0JA 4JTHA 1V6WA 3ITOA 2OPJA 4D6HA 3LQGA 4IQDA 4WK9A 3MSRA 3OB8A 3R4IA 3KLLA 4KEVA 3O63A 2I56A 1J6OA 3OHMB 1AUSL 3KTXA 4J3VA 1Q7QA 4A3YA 1AZ1A 4L9ZA 7REQB 1XLMA 2R9RA 4LY4A 2WK2A 3O2LA 4ADTA 1ONWA 1G0CA 2YA2A 4YYCA 5E9AA 3SURA 4PUMA 2A21A 4GO9A 5CQ1A 3PSVA 4OGZA 1QT1A 3GUGA 1XH0A 3AIVA 4IMCA 4XZHA 4I7UA 2WMHA 1NTHA 3WG6A 1KW1A 3O1NA 1EJSC 4PULA 1DJQA 4LJ3A 4B16A 1AMYA 1GT8A 2OKTA 4IUGA 4ORMA 1IXQA 1EP1A 3CHDA 3W53A 3TIMA 1XLKA 3WEOA 4LAZA 3GU2A 4NJIA 2I16A 3C0LA 3GC2A 3CPUA 1XLIA 2Z27A 1EPVA 5T26A 1UHVA 1EA9C 1UIPA 4AU0A 3GX9A 4KWSA 3BTNA 3LMZA 1TPEA 4B91A 2CWXA 1VLIA 3SRDA 1TMQA 1OCJA 1TREA 4D71A 1ZNNA 2YPIA 3LU2A 4NILA 2ZX6A 3PJXA 2YLLA 3L5AA 1HKMA 1T99A 4KRUA 2QXWA 3CK5A 1TVNA 3VE7A 1LBMA 5EMMA 3CU2A 5AHNA 3M9YA 4S3GA 2C3ZA 5FEXA 4ZOBA 1DWAM 2PGRA 3OLIA 4PBFA 4IGNA 3EWXA 3F4CA 4WSJA 3Q94A 4HZ7A 3NQDA 3NFUA 1QAPA 2RH9A 2Z7GA 2BNJA 4ZBCA 3PG8A 3WL0A 3UP8A 3MJYA 3TMLA 1PPIA 1JAKA 1GOXA 2C16A 4DO7A 2WMJA 1X96A 4HTBA 1ECEA 3H2FA 3VDHA 1K70A 3BMWA 2GSEA 1K4HA 5E0KA 3GM8A 3ZR6A 1UWSA 3VCNA 4IPNB 3NEVA 1A0EA 2GJPA 4JTCA 5A8GA 1A5SA 1J10A 2GGGA 1KC7A 2O7QA 2XFYA 2VJXA 2Y2WA 3QY8A 3M64A 4I9JA 5I3JA 3ZSTA 1HJXA 4JIIX 1KM2A 5A8MA 4F66A 1PKLA 5K9CA 1JD7A 3UZ5A 2J6XA 2VEMA 3WMBA 4LX4A 4BQ5A 5JBDA 1CPUA 1GQJA 3OJGA 2NVAA 3VGGA 1EQPA 1V0NA 2A3EA 4UFLA 1Z69A 1V0MA 4Q3MA 1KFWA 2DIJA 2P3ZA 6XIMA 2O9RA 2XH4A 3DUGA 1UC4A 2V2DA 4OQVA 1QPQA 2GFTA 2QJMA 1VFSA 1X1NA 1RBLA 4J7RA 4P8WA 3FXGA 4GX9A 1MI3A 3BW3A 3V7PA 2DT3A 1WDQA 2JK2A 4E8CA 2PRHA 3V5OA 4RE4A 1XLEA 3FDGA 3QZAA 1V02E 1WZLA 2A6LA 3ITYA 3LLDA 1U5JA 3QSTA 4O12A 4DPQA 7REQA 3PJUA 2XFFA 3AXXA 3EZ4A 4PMXA 1QHOA 4N4QA 2NQHA 4LXFA 2V5DA 1KCZA 3ICJA 5CGTA 4AMCA 4GKTA 5CH9A 2ISWA 4Z1AA 1TPVA 3R0UA 1H1ZA 3DECA 4I7VA 2HPIA 3QYSA 5DRCA 4F0MA 3STGA 3QR3A 2FTPA 3IGUA 1XUUA 3CUHA 4XO7A 2ALDA 3AHYA 3K8LA 3DGRA 1GW9A 5A94A 5D9NA 3BLDA 4HNUA 3RPDA 8TIMA 2J7FA 3FS2A 1MSSA 1F9CA 3RLGA 3W7CA 1YEYA 4NZ4A 3TTOA 5CLWA 3J7HA 1IIGA 3S1UA 3R7MA 4BWLC 5AZ0A 4JTLA 2A3BA 2ZA1A 4M0XA 4EXAA 3NAVA 3I6EA 2VFDA 3LV6A 2QCHA 2PWFA 1E0TA 1N8FA 1KKRA 1LDCA 1ZFJA 3WMCA 3PNUA 3LXBA 3SM0A 3WQOA 3AIQA 3PC0A 3KS6A 2ZWZA 1T41A 2CU0A 4HBKA 5JMUA 1OG0A 1XP3A 1RXOB 4H9MA 2KAUC 1X6UA 3L4ZA 5EYWA 1V3LA 3HFYA 3I65A 1NDYA 4XWUA 1E0VA 3MBDA 1W2PA 4K39A 3E38A 2OG9A 3PAJA 1MXGA 1ZP4A 4EF9A 4H9VA 1GKPA 2OT1A 1JULA 1QCWA 4GYPC 3WJSA 2AQOA 2J8TA 1H49A 3S2MA 1BGAA 1B3ZA 2AQVA 3C3UA 5HNTA 5DQPA 8RUCA 4KRTA 3UF9A 4MUPA 2PDLA 1LP6A 4L6DA 2H6RA 3UZZA 4ZTYA 4ZXOA 1JJKA 4JQ1A 4RZ6A 5CPNA 2GQAA 1YHTA 3LSBA 3IRDA 4CVWA 4HOWA 3L65A 4R85A 1I2RA 3T8QA 1FWSA 4KIRA 2E4TA 1Q7MA 5F4WA 2PP1A 4O17A 3F2DA 4HB7A 4GVHA 1IIHA 3LBMA 3UXKA 4J27A 1QNPA 4HMDA 3AS2A 1SMAA 2F7FA 8A3HA 1CXFA 4J2MA 4E4FA 1K9FA 1WB0A 3F5KA 4P8VA 2Y61A 5HMDA 2WV8A 1D8CA 4WY0F 1AG1O 1E0WA 3UNDA 1HX0A 1U30A 1KCXA 1F2JA 3EB2A 4UQ9A 3DU0A 4JX6A 3S42A 1VJIA 4M6PA 3BMXA 3VOFA 2GGEA 5AHMA 3IARA 3RXZA 1JFHA 4B3LA 3OLEA 3L4XA 3OVRA 1A0CA 2ODOA 4LYKA 5J5DA 5FJJA 3WBEA 4A6GA 5HUOA 2OQHA 3KBMA 4X3ZA 3UW6A 1JDAA 4GYFA 2HCVA 3MMDA 2YXXA 1ME8A 3CZGA 1W1YA 3W1QA 4G9PA 4GD0A 4OT7A 3RCYA 2BB0A 3KWXA 3W2JA 2O9PA 4IIBA 1K02A 1PTDA 4NI8A 1F3TA 3UR7A 1IT8A 1X39A 4YXGA 4OBSA 3H26A 3BXWA 4M82A 1PHQA 5GVJA 3M6YA 3KDNA 2W63A 2VR2A 4Y6GA 4I5RA 1I75A 3MVTA 1LF1A 1TELA 3PJTA 3GU1A 1TX2A 3BK0A 3AXMA 3LXCA 4PTWA 1K7FA 3PBMA 4R3UA 5DXYA 1GOMA 1LG1A 4LQ1A 4L65A 3RGTA 4EAMA 4Q4OA 3TJLA 4QHRA 1A80A 4AWTA 4ZSTA 2VHLA 1UOKA 3CWNA 4XK2A 5HQMA 3UGRA 4FLRA 4P2VA 3QV6A 4LCQA 3E2QA 4KQNA 3BGGA 2GPTA 1CEOA 2JBMA 1MNZA 3N19B 2B7PA 1JPKA 3ZT6A 4DO4A 3SI9A 1OSEA 4PMNA 2DZXA 4IMFA 3UCQA 1XBZA 1HP4A 5FD0A 3AIUA 5JUVA 4MMWA 5LHFA 1PVNA 3KL0A 1I2PA 5DCEA 1FFQA 4Q8OA 2AGTA 5GNYA 2IKGA 4LF1A 4GVIA 1ZZMA 4B90A 4OUEA 3SUTA 3M46A 1E5JA 4LC8A 1XISA 3HQ1A 2IMRA 1OFQA 2R1PA 3U2CA 3U57A 1B5TA 2QCLA 4RR4A 3H2OA 4U5KA 4PTNA 1LORA 1KBJA 1UQYA 1AA1B 4DWSC 1LLWA 1QFEA 2J47A 3RU8X 1M68A 2EF9A 3MUXA 4GJJA 3MWAA 3DFTA 1IYXA 1VPQA 3PSWA 4MKVA 4OWGA 2Q3OA 2VDIA 3P81A 3EPMA 4RPPA 1VYRA 4DB7A 2CEQA 3QV9A 4UMCA 3MVIA 2VOMA 2QJNA 2QIIA 4DI8A 1MUWA 3BWWA 4WY0B 2VWSA 3DIPA 2WZIA 3H23A 4NYYA 1HKVA 1DIDA 5H2ZA 3CT2A 1S5MA 5A95A 2POZA 4NAFB 4UTKA 3W23A 4HU4A 3U7BA 4FF7A 3NQFA 2VYOA 1P0DA 3PZOA 4GQRA 4AUBA 4MAZA 1NP0A 4GRSA 4ERIA 4HHLA 4RCXA 2WBKA 3SGZA 2Y5EA 4GXWA 4ENLA 2TSYA 4D8AA 4DQWA 5GJMA 4TMBA 4U3CA 4L80A 4DAFA 5FKYA 2IQ0A 4C6BA 4CNNA 4D6FA 3DI1A 4C6CA 1JG9A 3M41A 3GTHA 2P76A 5AYXA 4XSLA 5DXXA 5TD4A 1FXPA 3KX6A 3SCQA 4LH8A 2HISA 3TC3A 1AJ0A 4LV9A 1X6LA 2ZZ4A 2QCMA 2VENA 4PC8A 4XV0A 5CPOA 1OYAA 3VIMA 1ISYA 4BKNA 1JI2A 2OX1A 2EKCA 4YTRA 3NYDA 1W5QA 4Z2LA 4MB1A 4GI8A 3WNNA 1JPDX 2QGYA 2VWTA 2GDUA 3DOPA 4IGHA 3CV7A 2OO6A 1YLVA 1PCKA 2E3ZA 4LF2A 4M7SA 2EBNA 2I1OA 4PTDA 1GQKA 3DHFA 1XIMA 3VIFA 1AW5A 3W29A 3W25A 2FGBA 3GXFA 3W74A 4JY9A 3PANA 2PAJA 3T40A 2QYGA 4DXKA 3TCEA 4GHRA 4LVAA 3B9EA 4JTGA 2P10A 1JZ6A 2ZUSA 1ZAHA 3N9SA 4H2HA 3CB8A 3GR8A 5FAJA 1CXEA 1E5NA 2Z6JA 4C6PA 1ONRA 3BW2A 1UJQA 2FQIA 2R8WA 4JFVA 4GIEA 1FHVA 2I5GA 1KLZA 3GDLA 2HMCA 5BCAA 3QFWA 4FX8A 4JN6A 3UY7A 4PMVA 2FPTA 4D1IA 2RJHA 2P0OA 1VEPA 4MVAA 4NRSA 3S2CA 3GLCA 4PCPA 5HOSA 2JIEA 5HMFA 4PRTA 3ZJ7A 4H9TA 2Z2BA 5DF0A 1GCYA 4GG9A 2PRMA 1UH4A 1A5LC 2X16A 1NELA 4LB3A 2DJLA 2D22A 3EMZA 3AJ7A 4RDYA 2DIEA 3DFOA 4HOXA 4MB5A 1NOWA 1SSDA 5C2XA 4NJKA 2ZVIA 4IWWA 1OD0A 4TV6A 3BSHA 4OOUA 4BHYA 1XLCA 3M0KA 1FDZA 3ZJ6A 3FHQA 3FSUA 3PBYA 1V77A 2XTKA 4GGBA 1QU4A 2G8ZA 3VTRA 2XDFA 1Q6RA 4LNCA 3HGSA 3OQ8A 3WD4A 4PUDA 3BLIA 3JVAA 1BWKA 1R0MA 5FEPA 3TE9A 3B8SA 1VEOA 1B2YA 1D7KA 2QUVA 1M53A 3CL7A 3R6IA 4PMDA 4CN1A 1UD3A 3ENLA 5B80A 5CZKA 3WFAA 3AZTA 1DWJM 3UG8A 4DJDD 4B92A 4W4QA 2OVLA 4Q8PA 3O6DA 4CD6A 4W86A 4WY0A 3S5NA 1B3YA 3RJXA 1D9EA 4EPDC 1P7TB 2YL8A 2FHFA 4C6DA 1HN1A 3W00A 1JIBA 2FFCA 3UD6A 4Y9MA 4DM2A 9XIAA 4CGTA 3GD6A 4F79A 4JN8A 4NAFA 3M0YA 3K8KA 4O16A 3ITLA 3HGJA 2VZOA 4J5NA 1WBJA 4GIYA 2UY5A 2B31A 1PJ9A 5TAOA 4DYJA 3P8JA 2PDPA 4G56A 5I5RA 1QVBA 4K7VA 4HTYA 4R34A 4WDUA 4I8DA 5G1MA 3WELA 2D0FA 3CO8A 3VK5A 3HPXA 2QPXA 3S1GA 1MW2A 1EO5A 3DFHA 3UG5A 5PTDA 1QNSA 3WZ0E 1VC4A 3AHZA 3C8FA 3AMDA 3WLSA 1S2VA 5C55A 3ZT7A 1RJPA 2CERA 6ENLA 4P61A 2EPKX 2Z1KA 2G4FA 4GZ7A 1S46A 1JDDA 3MP5A 3S8HA 3MJMA 1OCBA 1EC9A 1IXNA 3GVQA 4JTTA 4W8AA 2WNZA 4LEFA 4QE1A 4QEEA 1MNSA 3CMJA 3BLPX 4IICA 1B4KA 2GLKA 1H60A 4JDBA 3F5LA 1OT2A 3W26A 4O10A 4K2SA 3KVJA 4GBDA 4Q8UA 1XLLA 2LLEA 2OCZA 4FX7A 1W9XA 1FWFC 3O6AA 1FDYA 1XYMA 3PWIA 4W88A 5HMSA 5A8PA 5D2YA 4B5NA 2B81A 3PPCA 1H7PA 3SQMA 2HZGA 1LL6A 1HVXA 3GZ3A 1ICSA 3TUUA 3UZWA 1E9ZB 1BVNP 1VP5A 1H51A 3WLNA 3QR1A 5FACA 4DJFD 1UR1A 2OYMA 2PODA 3WKZA 5FA5A 2VL4A 2GOKA 3KUMA 1OB0A 1FCBA 4JNZA 1G9HA 4NT0A 1SFSA 1KM6A 2ZIDA 3B8VA 4NZ3A 3UETA 3EMCA 2FVMA 1M03A 2GVGA 1PS9A 1JFXA 2A5HA 3GDRA 1YNYA 2VD8A 3O8AA 2INEA 4HKPA 4AD0A 3ALFA 1YKWA 5K3VA 1FCVA 5CJNA 1WOAA 2R82A 2R91A 1IHIA 1BYDA 3P61A 1BYCA 4UQEA 3B0PA 3PZUA 4L1GA 3MB9A 5G2IA 3VI2A 4BK9A 2EJ1A 1IEIA 5JVLA 3G1DA 3JW7A 3G77A 1OYBA 2WM1A 3DERA 1UR2A 1OFPA 4DYKA 5D03A 4LCRA 2IUZA 1VGAA 1DPMA 2WC3A 1LWIA 2DZSA 1PZ1A 1KFEA 5KTLA 1JXKA 3M0JA 3FDKA 3SECA 5D2TA 2BZNA 1QPNA 3LPFA 5BMXA 1BHGA 1G7UA 1XR2A 4NUWA 1FRBA 1OX5A 1TV7A 3N2BA 3TW9A 3T7VA 1K8YA 1E6QM 4CKQA 3OOQA 3M6DA 1MQPA 2FMOA 2NLYA 5K2ZA 1P7TA 4V33A 2FZ9A 2C19A 3B8TA 4U28A 1MXDA 1EJVC 1WV2A 4HZ6A 3CUGA 3W7PA 4GFIA 2D1ZA 1VJSA 4NJGA 4W93A 4AWEA 3MW7A 1R2TA 5FF3A 2XSAA 3MMWA 3AHVA 2W66A 1L2UA 1QPOA 3TX9A 3L5MA 2V5LA 3NWRA 1RD6A 3QC3A 4NXSA 4NZCA 3FKRA 4M3PA 1FWAC 4C6EA 2HDJA 2PDUA 3E12A 1Q6DA 3S83A 2CITA 1FTXA 2MNRA 3AYVA 4HK6A 3ZQ9A 4LYRA 2A7RA 3SN0A 3UPMA 1CXKA 1R3WA 2J7CA 3ELFA 5CPMA 5HNUA 1N55A 3H53A 2R6OA 3ZSSA 2CXGA 4OTKA 3WL1A 2BSLA 4KT2A 4GA8A 2A7NA 2OGJA 2ZXBA 4UMBA 3T0TA 3HFTA 3LRMA 1E71M 1UKPA 4LS2A 1TPB1 3UPWA 3PZVA 1KM4A 4C6MA 3ABZA 4H8UA 3B4YA 2V8ZA 4IISA 2NLIA 4UIOA 3PM6A 3WN6A 4FIRA 5CC3A 4AZHA 1BGGA 2UY4A 4DPPA 3G1AA 2GVEA 1O68A 3N6HA 3VX1A 4GNVA 4ACYA 1XYZA 1EH9A 2WZTA 3TFCA 3T4CA 4XZNX 3G24A 1RBOB 1GYMA 2DV0A 1IWAA 1DTNA 1R85A 2IQDA 3HGOA 3KDOA 1OFAA 1W5OA 3IANA 3T78A 3DYOA 3WBXA 3CIXA 3N1AA 3A4AA 1BD0A 1TE1A 3C8NA 3HZ3A 4AX7A 2NT0A 1WDWA 2DW6A 1LM1A 2J77A 4QQ3A 5F2IA 4G2DA 5I3DA 2VFEA 1RPXA 1U33A 5F1UA 4TUFA 3T08A 1NEYA 4H00A 4IGSA 3T1GA 3FEMA 2XWEA 1HZYA 1XLGA 3EAUA 2VQTA 1JRCA 1R86A 1AW1A 5IHRA 1U5VA 3VKCA 2PFHA 5M17A 2A3HA 2I9EA 1SO5A 1H41A 3OG2A 3WUEA 4JHOA 2ZRZA 4A2RA 3NCOA 5CKSA 4OECA 4TTGA 2O55A 3V0TA 4DJEA 1J96A 4KEUA 4JDYA 4KWWA 1FWCC 4Q7NA 1DQXA 3C56A 1QNQA 3HMCA 3K5XA 3ME3A 3RK8A 3ARYA 4GQ0A 3NSMA 4H8VA 4AMAA 2Y24A 3W3OA 4Z2HA 1EUAA 2EJAA 1JYVA 3KHJA 1Q65A 4GUIA 1CNVA 2XUCA 5KZEA 4XZBA 5EBAA 4J3TA 4JHZA 1AMKA 2IPJA 4WXZA 2FJUB 3N14A 5AN7A 1K8CA 3EWBX 5AB3A 3LX9A 5E0CA 3PBWA 5F2MA 3XINA 1QOQA 2VX6A 3AIEA 3DH7A 3GRIA 3L67A 2YL6A 3MP3A 4HNVA 3R25A 3WDRA 1UKTA 3C4UA 1S2UA 3VKBA 3NIYA 1ZTVA 6CGTA 2ISVA 4GNJA 1EBGA 1A5OC 1ELSA 1V8EA 3IJQA 1B90A 3ZO9A 2GDQA 3LI0A 1F3XA 2WSPA 3N12A 1CT5A 2DSKA 4MZ1A 3HO8A 5FAGA 1SZEA 1TQXA 1JQVA 1CGUA 3LSCA 4IIDA 1VJZA 3RMEA 4AEOA 4PUWA 4E3TA 4JICA 1GK8A 2I9UA 3KVLA 3CH0A 3IJ7A 2VZTA 4LRSA 4CCZA 1M7XA 3H2MA 3O6YX 3M1ZA 1JDFA 1F3WA 4R7WA 2D20A 3ZIZA 5C9WA 3F4DA 3MZ2A 4H9XA 4ILSA 2YKKA 3M07A 3LA4A 3RPTA 1QI3A 4ADSA 3U5UA 3QY6A 3V35A 5A2AA 4PRRA 1RLDA 3P0XA 3TQVA 3PZIA 1SU5A 3WLHA 1ZP3A 1GKRA 3CV2A 4YPJA 3I6RA 3N2CA 3WCZA 3EGJA 1JZ5A 3MCMA 1CWYA 3W24A 3WDQA 2XSXA 3T8LA 4O53A 3VMNA 2NVDA 3L21A 4MWAC 2QJGA 2GUYA 3TV8A 3O06A 1VPXA 3LRLA 1JEZA 3BAWA 3BJTA 4YTUA 3P74A 3TTEA 1QWKA 3L4VA 1VHNA 3U4AA 3NZPA 4D6IA 4AD4A 1WXZA 4JTKA 1RY0A 2DFAA 1CLKA 3CLWA 5H8MA 2F61A 4FO4A 3L2LA 2Y1HA 4K8HA 4AZCA 1OF6A 2RDUA 4HU0A 4M6VA 1GZJA 1B31A 4OJYA 3EDFA 1VBUA 2OTDA 3IUIA 4YN5A 3BARA 3H7UA 4UFHA 2Q09A 4GWEA 1TJ0A 5ENLA 2UY3A 3P8IA 4R27A 3RYSA 2H3DA 4B5XA 1S5VA 4OV9A 2PLKA 4MTVA 4RZ5A 2VUYA 3AOFA 3NO1A 3G6MA 3H24A 3PUDA 3LTSA 3L7RA 1GQNA 4IF2A 1XGDA 1L6SA 3TJ4A 1KD0A 4DJDA 4FHAA 1QNRA 1ITUA 3ANUA 2AL2B 2BMBA 1H5VA 4XD4A 3WD2A 1LL7A 3BANA 3E0LA 3JU2A 3N4FA 3VIPA 1OIMA 2B7QA 3P84A 3DHDA 2DZTA 3VOJA 4DRSA 4PEKA 2WVTA 1OGSA 5CJMA 1WZAA 3FSTA 3B9OA 3CAKA 3NOYA 3DDMA 4NG3A 3KTCA 3V75A 4B9YA 1OD8A 2FIQA 5AVHA 4JTUA 1A3HA 3TYAA 5LIYX 2OWCA 4HP5A 4UNIA 4UZUA 2PCQA 2OZ0A 2ZZ7A 4HNOA 2ZUTA 4ZB5A 2ISSA 2X8RA 1W54A 3HOJA 2IPGA 1QRQA 2WPGA 2PDYA 5U7SA 3WF0A 1V3MA 3DBPA 4HCLA 2VFIA 3NQCA 3BCJA 3BAJA 4W8BA 1XH1A 1QHPA 1GVOA 1ZGDA 3OZMA 3UGVA 4UOQA 1ZAIA 3RILA 5I06A 1W9VA 3ITXA 3LM7A 4GK8A 1E3ZA 1Y5XA 3H55A 3LGDA 1Y5VA 4CCEA 4KMQA 5A1AA 1WAWA 3CYVA 3E0VA 4YWSA 1BWLA 4J35A 5K9DA 3MSGA 1Q66A 2VGGA 4IMAA 2PEVA 3S9IA 1RHCA 3CIWA 3LI1A 5JIPA 1Q8AA 4QJ4B 2E68A 3W0KA 4F8XA 4Q4PA 5BYWA 4FLOA 4YCPA 2IKHA 1JUKA 1AD4A 1UC5A 3W27A 2WLYA 3MV11 2CPUA 5REQB 1H0IA 1W3HA 5I0DA 2XJ7A 1DJXA 3NQ8A 3AS1A 5AC5A 1TE6A 2QULA 4A2SA 1VFFA 2VX7A 1JCYA 3GWQA 4TX6A 4N4PA 4AZ6A 4ZSUA 4Z17A 1OF8A 5IDZA 3NPXA 3CL8A 5BXTA 1XS2A 3CV1A 3TA6A 3B0XA 3FJNA 3SCSA 3BJSA 3S6OA 1Q63A 5KMYA 3N9KA 1ICQA 5CGQA 1LLZA 2ZKMX 3KWSA 2VX4A 1HTIA 3VMOA 2JIWA 3VNYA 5BNKA 4Y2WA 4JQ3A 4DXVA 5IBXA 2FZ8A 1V03A 1GOKA 3AFBA 4DJFA 2SFPA 3V36A 4F4RA 3T42A 4TO8A 2BXZA 3IUDA 1T40A 1GHSA 2HE8A 1KBIA 1DJYA 3BGAA 1KM3A 3VOHA 3BV7A 4IUOA 2ZUNA 3CYJA 1IXPA 5LIWX 2AKZA 4ZR8A 1TJRA 4UFKA 5CBJA 4ZO9A 5HJYA 1VRXA 1T8QA 3BPWA 3PR2A 3KP1A 4GZJA 4GIRA 4IPPA 4C5YA 1KB3A 1GOIA 1V3JA 1JGIA 3PBVA 1H1NA 2ATMA 3THUA 2DP3A 4GGHA 4ZGYA 3THDA 2WXDM 4XG1A 4DNMA 1LBLA 5B7ZA 3AMGA 3PZGA 1TWWA 1CZ1A 4QJ1A 4G7EB 1ISVA 1KWGA 2XGZA 3NZGA 2FHCA 4JZ5A 2J13A 2P8BA 4BCEA 3UCDA 1YNQA 2OSXA 2ZADA 1TO3A 4W7VA 1BKHA 2ALRA 4C6OA 1GZ1A 3HG5A 1VBHA 2FVKA 4QBXA 3DKLA 1SZFA 2WPBA 1PE1A 3P60A 1J18A 3SIMA 1PKMA 2AL2A 1XGEA 1NAL1 4FOKA 3QQWA 1VFHA 2HXUA 3CZKA 4FX6M 2GQ9A 3DC0A 4EOUA 5EKYA 3H2CA 1K8ZA 3GH4A 4D9PA 1FFRA 2BVDA 2YDSA 3L2MA 3H6OA 4QGCA 2X2GA 1TV4A 3TH6A 5C7VA 2QUUA 4CU7A 5C9UA 2CHOA 3NTYA 1P0NA 3EDDA 4OBRA 3OGVA 4PSPA 5FCZA 1JI1A 3GY1A 1E0UA 3BQ6A 4MNMA 3W7OA 5F2GA 1B3WA 3TN4A 5AECA 4V1YA 1AD1A 3MUZ1 4UTIA 2D24A 5C9ZA 3NQMA 4H3DA 3P0WA 4UBPC 1DORA 2V69A 1Q6GA 3W7DA 5TF0A 1EF3A 4GH1A 3PVFA 3VOGA 2Y0FA 4J9JA 2DSVA 3CQIA 5KSWA 3UVIA 2PP3A 3TQ0A 3W7LA 2VFFA 3SY8A 4IXXA 1BQGA 5LA2A 3KBNA 4HPHA 2Y6ZA 1TX0A 2DDXA 1TZZA 4NJHA 4UOJA 3ANYA 5ABGA 1ZBWA 3LPGA 1TTQA 3ZZ1A 1UOZA 1KQYA 1QBBA 3KHDA 5EU9A 5LGXA 1JQXA 3ITGA 1VYSX 2NV1A 1A53A 3IJIA 4CQAA 1HT6A 4LPCA 1TTJA 2PF0A 1QK2A 1N7KA 5REQA 3URAA 4LTSA 4AD1A 4AY8A 1W3NA 5D2WA 5EBUA 4HA4A 3EKZA 5TNVA 3UWQA 3V1HA 4HYRA 4BEUA 2WANA 1E4MM 2J7GA 3MQTA 4I9AA 4QDPA 4FEZA 5I3FA 3VGHA 1OBAA 3BLFA 5AVNA 1YRRA 3UNTA 3ABXA 3H4WA 3XIMA 5A6BD 4H9YA 3K13A 1R46A 1XIDA 1XPYA 3MU7A 2Y62A 3QM3A 2QCDB 4OE7A 2OX4A 4KH2A 4BR1A 4LVGA 3KM8A 1XG4A 4WJXA 2E6YA 3ORWA 4ONVA 3UZJA 3BG5A 4POCA 1DJNA 3VNJA 3TU9A 3NQ2A 2A7PA 2EXOA 1POJA 4XZ9A 2HVMA 4ZCWA 1PHWA 2MANA 2Y7DA 4JFSA 1Y5WA 4DXXA 1XH2A 4PBGA 4HSOA 3WO8A 4GLEA 1MXSA 1QOPA 4WDTA 4ZEPA 3S0CA 1OFDA 5I77A 2VDGA 2WVVB 3R2GA 3WUGA 2BBFA 1SSGA 3WDJA 3A3XA 3MUY1 1WDDA 1AQFA 1I8JA 1XYCA 4KEZA 1RALA 4G7EA 4NZ5A 2VRJA 4YJ5A 3NGJA 3PP7A 3W01A 1Y7VA 2ZUMA 3ALGA 4KBXA 4D8ZA 2OSWA 4D72A 5CPQA 1FWHC 5KZ6A 3RM4A 4E8DA 2WO5A 3C2RA 4IX2A 3BMVA 2A85A 4JTQA 2HPMA 4KW2A 5EFFA 1JL8A 2AGKA 2WHKA 3E2RA 3FA5A 4B5WA 5H8PA 2HBVA 5BU6A 2FLIA 4PUUA 5TQLA 4UTUA 4HMNA 1CCWB 3SDOA 1KXHA 4QNWA 2H90A 3SRHA 4EXQA 1YADA 3VVGA 4CQ8A 3GVGA 1H7XA 3T4WA 1LOSA 2ISDA 4CEXC 5CC6A 5HQLA 1UD4A 3E0WA 5I03A 2F6UA 1P1XA 5HBFA 4LAKA 4Z2KA 1DIKA 3TCSA 3DFNA 1E70M 1G7VA 5G2WA 1KBLA 3EWZA 3ARSA 4PMZA 5CZ0A 5TIMA 3UR5A 3IIZA 3JR2A 1GOQA 4K36A 1VCVA 5EGRA 3R0DA 4JY8A 1JPIA 1SFJA 3OZPA 4MUZA 1WE5A 4Q4RA 3N2XA 3WH7A 1XDJA 3QQ0A 1KM0A 1A5BA 4P7QA 3FYPA 4W87A 4ACZB 1UWRA 4ZXLA 1MEHA 3I7QA 2VEFA 2ZUUA 4GI4A 4H2CA 4E2OA 5D30A 2ZE3A 3WY1A 2R94A 4P7LA 1FWDC 1W5NA 4S3JA 3IV8A 4ZQCA 2XFWA 4OFCA 4UTWC 3AIWA 3TZFA 2VX5A 2VGBA 4L4OA 1VKFA 4AW7A 1SUXA 2RDTA 3QXBA 4TQTA 3VM5A 4LUIA 5FJPA 3RO6A 4LU0A 1JVNA 5IOBA 4EF8A 3K1DA 1L6FA 4R7OA 3I3DA 4EWND 5AOUA 3UJFA 1UUQA 3CXOA 1F8IA 4FAMA 4PMYA 4B5TA 1M41A 4S3EA 4DVOA 3ZS4A 1J93A 2BOFX 2E40A 3NQAA 3OPSA 1A5AA 3ZOAA 5CLTA 1ZBKA 2QPUA 1JYNA 3CUXA 5J04A 3VM7A 3KRUA 5A8OA 5C9RA 1V3KA 2G3FA 2JKPA 1Y8BA 1T0OA 2NQ9A 1H0GA 1EWDA 1UROA 3QSRA 2WQPA 1JPHA 3MYPA 3PNZA 4WD0A 1XHGA 1P43A 4ZZ9A 4Q7IA 2VURA 3LHYA 3WNPA 5CEWA 3WEMA 3WBAA 2YIHA 4TMCA 4B5UA 2A79A 4E5TA 1UP3A 4S1FA 1UBSA 3P80A 4JTJA 3ARRA 3VXGA 3W82A 1K03A 1DXFA 2E5DA 4XAFA 1K9DA 4O54A 1F6YA 1CXHA 4QLKA 3B8IA 1UPPA 2C13A 4XBKA 2V0TA 3QTPA 2QCDA 2GGJA 3BH4A 4FPSA 4GISA 3UWUA 2DEPA 3OLGA 3EWCA 4UC5A 3OLDA 3WLPA 4PSRA 3MUCA 4I6VA 1XIHA 1YXCA 3IVUA 3LY0A 5ABFB 4H7ZA 5K4XA 4M56A 1D3HA 2TRSA 3P5ZA 4LW7A 2YBTA 5EA9A 4JFTA 3A24A 1E4NA 2X30A 4UQCA 1JYWA 2J79A 1EEXA 2OWXA 1OZQA 4JYFA 4CD4A 2YCJA 2WVVA 3MCNA 3UY8A 1VIWA 4JR5A 3RR1A 1RK6A 2OZTA 3T9PA 1XINA 2G3JA 1UD5A 4A22A 4PCNA 4H19A 4UFIA 4F9DA 4HYWA 1I2QA 3E0IA 5AYZA 2I57A 1IEQA 4MLRA 1R30A 3IK4A 2ANUA 2NZLA 4AEFA 1JZ7A 3UR8A 4EACA 5I02A 4ZQMA 2Q8XA 3LTYA 4LYQA 2O92A 1REQB 2E1DA 4PMRA 3VIGA 3B40A 1UR8A 3UXAA 1MO0A 2WSKA 2BWGA 3OIXA 5JIWA 4IJBA 4UTJA 1FY6A 1L8NA 2RUSA 2V3GA 1VIZA 1Q5MA 4TVCA 1OY0A 2QVNA 4W7UA 5F2LA 2CZVA 2GUUA 3LGEA 1NM9A 4WDXA 5DLCA 2BGQA 3PTDA 4WF7A 5H1WA 5I3GA 1P1MA 3U3HA 3FJLA 5JBEA 3CMGA 1JCJA 4IM4A 2XVNA 3NXLA 4I9MA 3CHVA 4RX0A 4JS3A 4PA8A 1XIEA 3AISA 4ZMGA 1O95A 5A6LA 2P88A 3ES7A 5CPSA 1XBXA 2JQXA 3BC9A 1YTEA 1TB3A 1HFBA 4O52A 3V16A 4HPXA 3W1MA 3PB2A 3WLLA 1EUNA 5A8QA 1ZCOA 1TRIA 3N18A 4RXFA 3IK2A 4M6QA 1H1YA 3AUOA 2CLEA 2NSXA 1KWKA 3DG7A 3EA2A 2XIIA 3WQ6A 3GC5A 2E9MA 3D46A 2YJQA 4OBTA 3UJSA 1J2BA 1BAGA 2PDJA 1OT1A 3HV8A 2VMFA 2PTYA 3QY7A 3KCJA 3GG7A 3AC0A 4PCFA 2CLOA 3U8GA 4HSNA 4YHEA 1O12A 5K9XA 2J9ZA 4CD5A 1KTBA 5DFAA 3W9ZA 1MW0A 2Y8VA 4HU8A 2YB1A 2ZZ5A 1A3WA 3LLFA 3IEBA 1GNXA 4XD6A 4X63A 3VD4A 4HZMA 3HPFA 4FNSA 1C91A 2PDMA 1TIWA 4UTLA 4IPIA 1NP2A 4J3UA 4O0KA 1KM5A 1V5XA 1NY1A 1UZ4A 5CBIA 3FV9A 1Q6OA 3B9AA 1PYFA 4B5SA 4R53A 2W0UA 4C1KA 2BODX 1XFBA 2G95A 3B9NA 5CC5A 1V93A 3BCDA 3KL3A 1OG6A 5DMNA 1GJUA 3NVTA 4C7DA 4JTDA 1EEPA 3C52A 1OZMA 1TQJA 1X97A 1Q7ZA 4GUGA 4M7TA 2PWEA 4XVEA 2D3NA 4D2JA 3WLTA 5A8NA 2E28A 3QGVA 4MWAE 5ABFA 1BYAA 5TBOA 1TR1A 4YNGA 1BG9A 3RX3A 4MB4A 3F2BA 4REQB 1W3IA 5JH1A 4MFDA 3C0QA 4FA3A 1Z9AA 7TIMA 3LCGA 1O60A 1W32A 1SM9A 3T0DA 2VI0A 3JZEA 1KFBA 4G6CA 1J0YA 1R7AA 3W07A 1DBTA 3W83A 1EX1A 9XIMA 4GZEA 2QCCA 3WD1A 5LA1A 2WKLA 1OK4A 1PL9A 4Z2GA 4LAOA 3BV4A 3LPOA 4PFHA 3FLUA 1MMFA 4FLQA 4XISA 1XKJA 2PLJA 3LPPA 4ATLA 1W1IE 2XH0A 2GOUA 5C8BB 1UB3A 2QCFA 2WAGA 2A0NA 2VC6A 3IIOA 4MY9A 3HG3A 2BXVA 3GTFA 4BF5A 3DX5A 3EDJA 1IZKA 1S2WA 4HCHA 5HANA 1NOFA 1EP3A 2WSRA 3WIJA 3VZYA 1RJQA 5J8LA 2ZFAA 3NZ1A 3LBOA 5ABTA 3V5CA 2OT0A 3GG0A 3P3BA 2X09A 3STPA 4O57A 2GJLA 4A21A 1IR2A 3PZTA 1TJPA 4QITA 5D02A 3ITVA 1JUEA 3KLKA 1QXLA 4TVUA 1S2TA 5AC6A 1W5PA 4XZLX 4DUOA 1SJDA 4WLCA 1O1ZA 3C86A 1KGUA 5HULA 4PR4A 5JQ9A 1OCQA 1QW9A 4TU1A 2XSBA 4F0SA 4W5UA 4F9JA 4K8EA 4NAEA 4UR8A 1QNOA 1W3LA 4PMQA 1Q13A 1K4GA 2E5BA 1C9DA 2QAPA 1KLYA 3NL6A 3TYBA 4GC3A 3N13A 3Q65A 4I3GA 2C18A 4FIQA 1TR9A 4LVFA 4O0ZA 4HIBA 3VOIA 3KZSA 5A6BA 3KRBA 1H7NA 3RRAA 3B05A 3PN8A 2O4MA 2H8ZA 4ORIA 4WDWA 5JU6A 4NX0A 1FKWA 1DVJA 2BTMA 4LSBA 4US5D 5BXPA 3DENA 4P8XA 2F38A 4DX3A 5M1TA 3GFYA 2XHYA 2P8CA 1XLHA 2QW5A 2PWVA 4TIMA 1VS1A 1UWTA 2VZUA 2OEMA 3RR4A 2HXTA 4G7FA 1TJ1A 1LBFA 4H8NA 3H7RA 3ITTA 4AAJA 5DMLA 1YW1A 1R3VA 2Y70A 3PULA 4UZSA 2ZXDA 1EDGA 1PEZA 3CLMA 3EOSA 1SW3A 1ECQA 4M80A 1R3RA 4HNNA 4DJEC 4YTQA 2X0YA 3M0ZA 1TWZA 1LRTA 2GWGA 4RL3A 2ISFA 2GSJA 4Q6JA 3E2VA 5HAOA 4QR6A 4W84A 2ZCGA 1FH8A 3GXTA 4EP8C 3GDTA 3EEZA 3KBJA 3CNYA 3LV5A 3VGDA 3CQKA 4KRZA 3S3GA 3T09A 1HJUA 3ITCA 5LGZA 1B4EA 4IP4A 4IQJA 3SGGA 3LOTA 1LZOA 2XISA 4LUYA 1ISZA 3NA8A 3GC4A 3PZQA 1OJXA 3EX6A 2F8QA 1WXJA 1NWRA 1PSCA 4C6IA 3K4DA 5M3WA 3A4JA 4D6JA 3E6EA 3R8HA 4N02A 3M4HA 3W7GA 3SN1A 4IP7A 3QLLA 2AAMA 5KZDA 4RE0A 4WEVX 4FXJA 1TZ7A 2WNQA 5A6KA 4I6KA 4KCVA 2RHGA 1E9YB 3GVRA 4PBEA 3G8RA 4QNEA 1VRDA 1WKDA 3H4GA 1D2KA 3C2VA 5EMLA 1GTEA 3NVDA 1XKYA 3AHXA 4NKCA 4MOZA 4BWLA 2D3LA 1J12A 2CZEA 3V4BA 2J25A 2FHBA 4KCWA 3AJXA 1AL8A 4HPNA 2PZNA 3B06A 2V68A 1XYFA 1XC6A 1VENA 3W2NA 1R2SA 4KKXA 3RU6A 4H8HA 2NSOA 2B7NA 4JCLA 2YCLB 2J7BA 5LIUX 4GYJA 4WUIA 4CU6A 1RPKA 1D7FA 3EX3A 1GPFA 2QJJA 3UVAA 4MPKA 4A35A 1HG3A 3SJNA 2DSZA 1DJGA 2NVCA 1EXPA 1ESWA 1F05A 4L6OA 3UBPC 3NQVA 1KFKA 3VUPA 4CD8A 1B1YA 1WZMA 2YYTA 4L4PA 4GYPA 3EWWA 2Q71A 3W4RA 2G3NA 3JZUA 4DUXA 4LC6A 4DWSB 3W70A 3Q45A 3TDFA 2JEPA 2JALA 2XPKA 1TV5A 1UD6A 4TOQA 2PDQA 2FGZA 2D2GA 1H63A 1XV8A 1CW2A 2DJXA 4LS0A 1FWWA 4GC4A 5DT7A 1PUDA 5D2VA 3MKKA 1JNEA 3OODA 4N2YA 5HPCA 1AH3A 4WJEA 4M6UA 2YA1A 4NF7A 1P0KA 4P8UA 1NFBA 1ZJAA 3W88A 4F3HA 3NZRA 2DSUA 4MNJA 3VZZA 3ZXWA 3TXZA 2ZVRA 5DO8A 2C0HA 2EO7A 3W71A 4D1JA 2XFRA 1YMYA 3PPGA 1HW6A 4LANA 4JD4A 5E6YA 3C3NA 1XCFA 4XD5A 4NI3A 2YCEA 1A3XA 1JCMP 3EWDA 2C8NA 4I8YA 2WC4A 1V6UA 3TW7A 4DJDC 3SY1A 5C54A 2YXOA 3WD3A 5G4HC 4PB5A 1ZBVA 2EEXA 5DMMA 1AW2A 1DYSA 1WDSA 3B0UX 4KWUA 4YU1A 3UEQA 2IQTA 2ZXAA 2I5QA 4H04A 3O05A 3NQGA 3H21A 3C2EA 8CGTA 3GNNA 3PJWA 3L4TA 2ZX7A 3D47A 2OELA 1Z42A 1V7AA 4LVDA 2ACSA 3S1WA 1KBKA 4OV4A 3B9DA 3GE7A 4NXKA 3LN3A 1H7WA 4WKHA 1F07A 2A2IA 2PSNA 3WF4A 3MSDA 1RQEA 3W84A 3PPHA 4IQEA 3AALA 3I4EA 1SFTA 1ZJHA 1WQ5A 4IFRA 1LG2A 3KFTA 3OU8A 2YLAA 1HL2A 1VBJA 3R11A 4KGLA 3EWUA 3ZVIA 3W1UA 5I00A 1RCQA 3MKVA 2O56A 4K3ZA 1FCQA 1IR1A 3EXSA 2FTYA 2ZX8A 3Q4DA 2BASA 4PZVA 4M1BA 4PFMA 4BQ4A 2G3MA 3NR0A 4O13A 1U1HA 3II1A 2F6KA 2WVSA 2IXUA 2GUBA 2YYUA 2G97A 2UWFA 4GYKA 3M0HA 2WBGA 4LB4A 2W27A 1T5AA 4H9UA 5AYBA 2XG9A 2CFFA 4N9BA 1AZ2A 3TA9A 2ZE0A 4W89A 1PWMA 3H7VA 2FDSA 1EC8A 4NQ1A 4B3ZA 3LM3A 1R3SA 2YCLA 4FOJA 1CDGA 2ZOXA 1BWVA 2P0IA 4R9XA 3RG6A 2DT2A 2HBXA 2WCSA 1ZAJA 3QFEA 5LIKX 4XBSA 1A50A 4BF9A 2HV5A 5L9FA 2HQAA 4PUEA 5XIMA 4B2DD 4MADA 1AH0A 2YFNA 5HINA 3NGFA 2Y85A 2W5FA 4UR9A 4WJ8A 5I2UA 3GH5A 1UA7A 3IPWA 2E25A 3VFLA 4HA1A 1KR0A 4MYXA 3LTPA 1PYMA 2HVNA 3STEA 5IBXC 4AC1X 1HUVA 1S1RA 1W1ZA 3SO7A 3ARVA 3NO5A 3TC6A 1YPFA 4EVZA 3APTA 2A3AA 1VZWA 3HPZA 4ZVJA 8XIAA 4IMDA 1E4IA 4WIWA 4ZQPA 3GVWA 1SR0A 2J24A 4DUVA 2X1UA 3P67A 1A5MC 1TMHA 3W6MA 2EKGA 3B97A 2E8ZA 3WJWA 1KFJA 1S39A 2Z2AA 1XYAA 1W2VA 3GHRA 3IRSA 3CHCA 3RNDA 2PB1A 3TLLA 5DELA 4PMOA 3M0XA 1LUCB 2WHMA 3VAVA 4S3DA 2PDNA 2EGZA 3A4WA 4GO8A 2RAGA 2VEIA 3IIXA 3L66A 4FOUA 4Z0JA 1J0JA 3PWGA 3P62A 4O11A 4WCJA 5FJUA 1G5AA 1L8PA 3V1PA 2I7GA 2ZC8A 1W17A 3GZAA 5I3HA 1XQLA 1NQ6A 1CXLA 1MQQA 4ML4A 1WO2A 3WF3A 4UFJA 4XAZA 3QPYA 4Q6XA 4IXHA 2JF7A 2ATSA 1RQHA 2ZDRA 4YTSA 1VFOA 4B15A 1VFMA 2J4GA 3JS3A 1FQ0A 2W61A 1HQTA 2V67A 3GNDA 3URQA 1VCGA 3G5EA 4LUTB 3G3DA 4HQVA 4QE4A 1FA2A 1SPQA 3GKAA 1NWSA 3CAQA 3VYLA 1PTAA 1CLXA 4Z0SA 1Z44A 2VTFA 3IAQA 1C3FA 4C7FA 3W2LA 1F76A 1W8SA 4DF2A 1L9WA 5IM51 4H7CA 1QATA 2QEZA 2REQB 1G94A 2XM1A 4H9ZA 1E40A 4GACA 1KA9F 1Q6CA 4ZB2A 4I7WA 1GONA 1RV8A 1UKQA 2GGIA 3GHTA 2W3ZA 1YIXA 1TPUA 3M0LA 3WX7A 3ID7A 2OOGA 1QOXA 4CU8A 3HN3A 2Z00A 5FESA 1I2OA 8XIMA 1XSIA 3EB4A 3NG3A 1MWOA 2Y88A 2YW4A 5EMKA 4AZ7A 5FL1A 1XFCA 3SSZA 2OQLA 2CCRA 4YL2A 3KOZA 1EBHA 3WH6A 3OBEA 2VVNA 1EDTA 3IJLA 1ZU8A 3AXIA 1YDNA 4UNKA 2P53A 5IXEA 2KZHA 4NHVA 1OX4B 4Y96A 3GUWA 4MWAD 1Q4NX 4MGGA 1ME7A 3CWOX 4GQBA 3MWCA 4NX5A 3TTSA 1ENUA 3WSUA 4U33A 1ITCA 4KIEA 1FX6A 3TYEA 1B30A 4E38A 4OUIA 5HWJA 1E15A 4QROA 3WENA 1WUEA 3EX1A 4YCOA 4LFYA 1SW7A 4U3AA 3S6DA 4ZFCA 3B04A 3QHNA 3URBA 5A6TC 4N9CA 2VD9A 3RO8A 2QCGA 4QM1A 3U4FA 4IP5A 4US5A 3M0VA 1U1JA 4W8LA 2C14A 5D8ZA 4O1DA 1B0IA 3W1TA 2Y7FA 3H8AA 1AH4A 1J79A 2DZWA 4A8LA 1WDPA 3N2OA 2QMKA 3GU9A 3HIJA 3BL3A 4DBSA 2DORA 2O0TA 1RVKA 4NZFA 5C0QA 4AHOA 5DANA 1ZY9A 1K1DA 1GJWA 5D09A 4JTEA 1CGWA 4LVBA 3CIVA 2FVLA 4TR9A 2NT1A 2OEJA 1U2YA 4P7OA 1MEWA 5CZTA 3UPBA 4O1FA 1W3TA 3WK2A 1UW9A 1FVPA 4LEQA 3DFQA 3WQ5A 4GXPA 3FJ4A 3TFXA 1BRLB 4O1CA 3O3RA 3OVQA 1Z41A 4GI9A 4MY8A 2ASHA 1XSJA 3CL6A 5DT5A 4E8GA 3AWOA 3OIHA 3UZXA 1DWGM 4RNHA 4U10A 3OG3A 1LUCA 2V81A 3OGSA 4ASTA 3V0SA 3AWNA 3WLOA 3A9IA 2RDXA 1J0KA 2WCAA 4C1LA 3SCPA 2CKSA 3P2VA 5DBTA 1XLFA 3NURA 4PCSA 4RW3A 5E0FA 1MZHA 1HO1A 3AHTA 1FWGC 4F0RA 1QK0A 3A23A 3HURA 3W02A 2XH2A 1H7OA 4FNUA 2HNHA 1EOKA 3EMQA 4PMJA 2CLLA 4NRRA 3G3MA 3EPOA 3F1QA 4EX4A 3AS3A 4N9DA 1GVQA 3EYPA 4L9XA 4S38A 4HK7A 5AY7A 4JEQA 4LUTA 4L1XA 2CKRA 2INZA 4KERA 3M5YA 4J3SA 1PX4A 2J75A 4MKSA 3C6CA 4X2PA 3TWBA 4GQQA 3K4WA 5CG7A 2REQA 4EAYA 2YCKX 4Y90A 4S3AA 3RM8A 4PB3A 2CXEA 3BZJA 2VNCA 3WBYA 1S5NA 4RLIA 2NQ5A 3U2OA 3OEXA 2ZUWA 3CEUA 5BXSA 3KRZA 3L23A 1DIOA 1QW7A 3NNTA 2VR5A 2PCEA 3KOXA 9CGTA 1DXIA 2IPFA 3ARZA 1U5HA 3PZMA 2CESA 3RMJA 3CASA 2A3LA 2C1IA 3FGCB 4LRTA 3G1YA 4U31A 3MKCA 4MYAA 1VPYA 1TPC1 1TKKA 2EG7A 2J66A 3GHUA 2VDHA 2YGYA 1KBBA 5BRPA 4XB3A 4LOCA 3F5JA 3WLJA 1XYBA 3SBFA 4KS0A 3PUGA 4FNPA 1OX4A 2VRQA 3CTLA 3VGEA 3TEVA 3W6YA 4JNMA 3TYZA 4IFOA 3WJXA 3W7JA 3GBDA 4Q8VA 3ARPA 4HNTA 1GORA 4EANA 4UTFA 1EYEA 5D2XA 4L64A 4ZE4A 3T05A 3GHSA 1XICA 5D4YA 1UH2A 3QH2A 5AC7A 3E9AA 1XIJA 1DQWA 1J5TA 3Q2DA 3QMSA 3D3AA 5AC8A 1Q6LA 4JQ4A 4NNBA 1OC6A 3SUSA 1TG7A 1BG4A 1QI4A 3MUAA 2R1NA 3M5VA 3MO4A 4YVPA 3A4XA 1OGGA 2WWDA 4WGXA 1WA3A 4V2XA 3PFMA 2QDEA 2DT1A 4QSFA 2QS8A 3LCIA 4O19A 1E1CB 3G8EA 1ZCCA 4YVXA 4MZYA 2ZRYA 3S6TA 4JFWA 3K2GA 2A4AA 5HATA 4IMEA 1EQCA 3L0KA 2F2KA 2XVGA 3SUVA 1EWEA 2QLYA 3I3BA 2CHRA 3TAOA 1J4EA 4NL1A 3BGJA 2CLFA 3BLLA 3AIBA 3NL3A 4NZJA 1EJTC 2Z29A 3ABRA 4A3QA 5M5DA 5IRPA 1BRLA 3HGRA 4IJCA 4EK7A 4QG8A 3THCA 1O4UA 1GYNA 3NQBA 3SUWA 2VVSA 4YS1A 3WQVA 3C5QA 3W22A 4JTSA 3W1PA 4GVGA 4A29A 3WQPA 3RF9A 4ES4A 4Z42C 1GWJA 4HGXA 1A4MA 2J74A 2PC8A 4TXEA 5C5YA 4UXDA 1K3UA 1R9ZA 3SEPA 4KWOA 2GVYA 4MJ2A 5I09A 1ZBCA 1M1BA 1SZNA 4PODA 2WW5A 3S5OA 5I3KA 4RJEA 2WNNA 1QDSA 2OR2A 3CM4A 2QMJA 3MP4A 2BV9A 3TQKA 4A8IA 3SFKA 4TTUA 2UZ9A 2C71A 4PYSA 3OBAA 2HE5A 5DCDA 1KKOA 3QV8A 2D69A 4FALA 4Y9AA 2G3IA 3D3FA 4JAWA 3SCNA 1DQUA 1U83A 4WX2A 4YLWA 4X9SA 4R33A 3LXAA 4FB7A 4WVXA 3HTWA 1RP9A 3UJRA 3VD5A 4AB4A 3W7KA 3GBEA 1X7FA 1GQLA 3TKFA 2QZRA 4Z1YA 1TVLA 2OJPA 4FK9A 1EJWC 4INFA 4MWAB 1DJHA 3G18A 2H8XA 3GFZA 1ADDA 3W2MA 1BLIA 1KV5A 5CSRA 3TW6A 3SW6A 3SCRA 5D38A 3NL2A 4FNQA 2PDBA 4PTVA 2CLKA 3MUIA 4KFPA 4MJZA 1LOQA 3POHA 4NASA 2XIMA 3TVAA 3K4AA 3SCVA 1X98A 4XKYB 5IFPA 2R14A 4L56A 4BZYA 2W9MA 1UD2A 3FGCA 2RKXA 3A64A 4AZGA 2OLHA 5HPOA 2E7FA 3IV3A 4B2DA 1XC4A 1GOWA 5GNZA 2GSHA 1RAKA 4I9TA 3MPGA 4JIPA 1RK5A 2DQXA 3V18A 1M7PA 1OINA 3DGBA 3BDKA 1LL4A 3MANA 5BRQA 1XD1A 1I45A 4HU3A 1H62A 2V5CA 4R5EA 1JAEA 1QHZA 1FP9A 1EHAA 3W2KA 3UERA 1V4YA 3RCMA 3BAYA 2TPSA 4XX6A 3W28A 3PS7A 4JXCA 1RZMA 3N11A 1KGWA 4R9OA 3NJ3A 4IJRA 4QRNA 2CETA 1QMLA 2P50A 2Z7KA 5E93A 1J9YA 2DVUA 3VDAA 3I6TA 4K1WA 6XIAA 4Q4QA 1P48A 3QOMA 1YXYA 3QW4B 5A6JA 1EYWA 4ICCX 3VNKA 5C70A 4C5ZA 1VHCA 1XLAA 2EAWA 4N9EA 1F4HA 4MNLA 2J7HA 4JTRA 1BTMA 3WF1A 4IIFA 3P93A 3DXIA 4FI4A 1VFLA 2DVXA 4OKDA 1E1CA 2WSQA 4AWSA 3VOCA 2CNCA 2OYKA 3GXIA 1A5CA 4QQUA 1ISWA 1EL3A 2PGFA 3GIYA 1HGWA 4AF0B 3W87A 3GVVA 2X42A 1ITQA 1NDZA 3HV9A 2QNEA 1Q6FA 2X0SA 5IHSA 3WMLA 1F6KA 2YX0A 4KFNA 4E4PA 2E77A 4Q8WA 1UP0A 4ZB0A 3QV7A 3AMKA 4BI6A 2Q6ZA 1IEXA 1PV8A 3GO2A 2WJFA 4HPGA 3CTTA 1GTHA 4FS9A 3GG1A 2CZFA 2Z28A 3U5YA 1XX1A 4PUKA 4DZIA 2J9YA 1EJUC 2OB3A 1H7RA 2DZAA 3KAOA 3QC0A 3FVDA 4F2BA 2FFIA 2WM0A 3GR4A 3STCA 2NV9A 2TMDA 1NVMA 1BPLB 2AMXA 2XGBA 3NEHA 1V6VA 5D9PA 3OYXA 4FR1A 2BY3A 3MMTA 3AMCA 4BS0A 1ITXA 3VA8A 5D04C 3BVJA 4ATDA 3ATYA 1G1YA 2ZC1A 3BJFA 2BFGA 3ERPA 5F4XA 1EIXA 4GINA 5CSYA 4ECLA 3QPZA 4XZWA 3VIJA 1SJAA 2QDHA 2FZDA 1OK6A 2BGNE 1J0ZA 3XISA 1JCTA 3UJ2A 4GNKB 2VEPA 2B7OA 1QPRA 2ICSA 5H8UA 3VGFA 2E67A 3AZRA 1N2VA 4HZ8A 2E9BA 3NDZA 1V0KA 3MSYA 2E6AA 5G5IA 3W75A 1E43A 1L0PA 2X1IA 4CNPA 2X7VA 3GDMA 3GDBA 3A12A 5I79A 1TYGA 2PD5A 3O0KA 4MWAA 3ZLHA 1WKEA 1EKOA 4DO6A 3A13A 3T2OA 1HJSA 4RE3A 4LUSB 1X7IA 1LTDA 1KRAC 3ZWSA 2PA6A 1GHRA 3SY5A 3SCTA 2PS2A 2WZEA 5M03A 2QT3A 2RGLA 3LUTA 1JGMA 4YYFA 4XKYA 3OP2A 4PUNA 1LYXA 3ZR5A 5LNVA 4AVNA 4DI9A 1PBGA 1RSCA 4KGJA 3DHPA 1WOBA 1Z3NA 2WZMA 1VR6A 2OLSA 2Z26A 2ZRVA 3HJZA 2DVTA 2DW7A 4UFMA 4CQBA 4I90A 1NJJA 1WP6A 4D6DA 1KTCA 2ACRA 5LSMA 4ROQA 2JKEA 4O28A 2GJXB 1BF2A 2CLIA 1SGJA 1GUVA 2PMQA 3S9ZA 3OYZA 1RCXB 1HL8A 3AU6A 1DL3A 2NQZA 3GIQA 2BY1A 3PTKA 3A47A 2H9AB 4JNYA 2R1MA 3VX0A 1MYRA 3R10A 1TCDA 2XVKA 3RX4A 2AL1A 3AMLA 5B7YA 3B8WA 3LNMA 3NDOA 5CC7A 3BLOA 4J40A 3M0MA 5GJNA 4HHHA 3PF3A 3GXMA 1HIZA 5ABEA 1O5RA 1NIUA 4F0HA 1KGXA 2WCGA 5EL1A 1L2QA 1OC5A 3VIIA 3NQ7A 3U7VA 3P14A 4UQDA 3L0NA 2X41A 1GW1A 2E8YA 1M3UA 2CYGA 1ZHAA 4KWVA 3SADA 4EXBA 4ZOEA 4DUWA 3S5ZA 3KL5A 2VR4A 3COTA 3AICA 4GUFA 4RV8A 3MBFA 3IIVA 2CBUA 2E6DA 1B3OA 3WJZA 3EOLA 3GXDA 2BX7A 4R7JA 3UWVA 3GQYA 3VIOA 2FZBA 4XZIA 4XTIA 2NUWA 4AF0A 3N9RA 3A6OA 4G5DA 1W0MA 3EPNA 2YL9A 2NX9A 3AI0A 4JX4A 4DZ5A 5G1YA 3THQA 2WQDA 1ZS2A 2G4JA 3L4YA 3V0UA 4AY1A 1F6PA 3W85A 3VCCA 2HRWA 2XM2A 4GFSA 1V6XA 2YBVA 3NM3A 1UPMB 3HG2A 5CSUA 2E6FA 1TV2A 2VFGA 1UWQA 3N25A 4JHMA 5BROA 2Y63A 3IAPA 3UXLA 2GDVA 1US0A 4ML9A 3QBUA 1Z32X 2Y8UA 3UG3A 3NM1A 1K9TA 1EJXC 5HR6A 1FWJC 4C6FA 4HMCA 3GKFA 4DZAA 1OIFA 1ODZA 1XLBA 1G4PA 3MS8A 3L4UA 4DF1A 2PDCA 1GZGA 1OADA 5C9XA 4Z08A 4FZIA 1XJBA 1EHNA 4WKAA 2PI6A 3FHAA 3TSMA 2VXNA 3OBKA 1F3EA 2QGHA 4O8RA 3MT1A 2BS9A 3BICA 2QIWA 3F4WA 2PRLA 1UZHA 4B9ZA 3QR0A 1H5YA 1PZ2A 1RP8A 4XZMX 3I3EA 1TZ9A 2HK0A 4KCTA 4UR7A 3TONA 3DFYA 3VIKA 1YX1A 3RAOA 3EOOA 3VC6A 4PEEA 1E3XA 4LUSA 4E2VA 4P7RA 3CHFA 3WQWA 1MW1A 3QOKA 2VC5A 4G8TA 2VEGA 1F7BA 2OLAA 4LCSA 1UG6A 3DG3A 4AVOA 2PDHA 3G22A 4WQ6A 5FEZA 3FOKA 1PKYA 2Q8LA 4ZO7A 1FUYA 3VE9A 4DM1A 1UMLA 2ZX9A 3GW0A 2I17A 3FIGA 3BAXA 1P0EA 2GQ8A 1W9UA 2VCCA 3AIRA 4JOMA 3BO9A 2YXGA 4H6EA 3KOFA 5D9OA 4CEUC 2GJXA 3QMRA 4FNTA 5DRIA 1XLDA 5GQBA 1YTDA 2WKGA 1JDEA 2WMFA 2PDKA 4NIRA 3GTIA 3E1F1 4IGMA 3U48A 1JZ3A 5T91A 2WOQA 1UJPA 1TV8A 1VBRA 2H9AA 3IVSA 4RPQA 4J2PA 4X9YA 5DBUA 1V6TA 2WVUA 3P82A 3RLUA 3HPSA 1FHLA 3Q58A 4GY0A 1UR0A 2PBOA 1UBPC 3ZYZA 5BU9A 2P1FA 4QDMA 2R1KA 1E0XA 3FX4A 3SCOA 3WFZA 4HMEA 2HJPA 4LALA 2VFHA 2J8GA 3IGXA 5AC4A 3T07A 3QZEA 1PDZA 4OIFA 5ECVA 3UCCA 1QO2A 3CZLA 4KF1A 3KOWA 3W7RA 4C90A 1ZB5A 5D9MA 3GNPA 4MY1A 7ENLA 4XUGA 4LAUA 3OA5A 2PURA 3IWPA 3P6LA 1PIGA 5LHEA 3PUEA 2NUYA 1CGYA 1UD8A 3W7IA 1QNVA 4JKKA 1P5BA 5BOEA 4GCXA 3C61A 3ARQA 5C2GA 1UIOA 1JZ8A 2PU0A 1N8WA 4H83A 3E2SA 2ZXQA 2E09A 4OHQA 3UYIA 5BOOA 1NQKA 2FH8A 2FB2A 4NP7A 1S5TA 3ARTA 5JXQA 2ZQ0A 5DX7A 3BQ5A 1XRFA 1K9EA 2PWGA 2DH2A 3DCPA 2YZRA 3PG9A 1J0IA 2PTXA 4XSMA 3HQNA 5MF5A 1C8XA 5F4SA 1F61A 2DZVA 1GGOA 5E6ZA 4B4HA 1ALDA 3UQNA 1XYLA 2F84A 1K6WA 2G37A 3W7MA 4KEMA 4DAIA 3W7QA 4Z2JA 1Z89A 4I5UA 2X1RA 2QAFA 1TMLA 3N29A 5LNWA 3MO7A 3GTNA 3OGRA 4YMZA 4D6GA 2HS6A 2R1LA 3GDKA 4PRWA 3RJYA 1PX8A 1XBYA 2PPGA 3CT7A 1I0BA 1V6YA 5CGMA 2GQ3A 1L6WA 2WJZA 3PB0A 3ARWA 1VFUA 2J8FA 2XIBA 2CBVA 3TOYA 5JH2A 1CENA 1FWEC 1IE7C 3U9IA 1O5XA 3JUGA 3H2NA 1JZ4A 4MM1A 3Q37A 3W6LA 2XN2A 1XIGA 5BXRA 2AQWA 4UTTA 4IOTA 2ON3A 1UUMA 4BA0A 3U0HA 2XZ9A 3VD9A 1OYCA 4Q22A 2HSAA 3CBWA 2VP8A 4QIUA 2VC9A 1Q45A 5AYIA 4RZ4A 1UP2A 3T0CA 4HK5A 1EFZA 7CGTA 4S23A 1ODUA 1FDJA 2Y5JA 3S5YA 4AZ5A 1JNDA 5A6MA 3PBGA 4IMGA 3T44A 1EXBA 3HPAA 5A6AA 5LXXA 1W6TA 4GOAA 3CQJA 1TSIA 3V3WA 1IQ8A 3MV01 1DE6A 2PTDA 3CWHA 3HB9A 4PGLA 5D8WA 2QCNA 1G4SA 1I9CB 2V9DA 4CN6A 3A22A 3QN3A 1DV7A 4M29A 1CB2A 1BSLA 3RUBL 3MI3A 4N0RA 1KNWA 1KCKA 1GVSA 2JKAA 4ZODA 1JDCA 3TK7A 3PWAA 2YW3A 4ZFMA 5HQEA 2ZWYA 1UCWA 3ZLFA 1R7OA 4C6KA 5CZSA 1QI5A 3TR9A 4G1KA 3WNOA 4DJED 3R58A 3EB3A 3W76A 1T96A 2GVJA 2OEKA 2ONEA 1UYQA 2GZXA 2V63A 2QUTA 5I23A 1TWDA 3VIHA 3PTMA 3R0KA 3L2IA 1FP8A 1WDRA 1XQKA 2G0WA 2HK1A 4CLMA 4AD5A 1CTNA 4AFYA 4DWDA 2FGLA 5T9CE 4JIHA 1WKYA 3G0SA 1WKFA 1TPDA 1DJWA 2XINA 3WD0A 1R38A 3FN9A 4XD3A 2QCEA 1XPGA 2EPNA 4A3UA 3FCPA 2WJDA 3AAMA 3I7SA 2NXGA 4BF7A 2PD9A 1XIIA 5BOFA 4FXSA 1F4AA 1SQ7A 2WZHA 3VKAA 3SSJA 3GR7A 4NU7A 2C1HA 3CUIA 1QBAA 4RDZA 2GK1B 3GNXA 1VH7A 1R87A 3R94A 2KX9A 2FPYA 5A5WA 3SRFA 1Y0EA 2WKJA 3SRKA 4NZ1A 3W1RA 1OFEA 1HJQA 3TXVA 4J4KA 1ZSXA 1I1WA 4UQBA 1XBVA 1FWIC 1G6CA 1I2NA 1Z7AA 4C6JA 3CJPA 2PDWA 3FYYA 2QDGA 2VT0A 4QDWA 3N4AA 3KS5A 1DE5A 4L61A 1DP0A 3QRHA 3EA1A 3ISIX 3TAKA 9RUBA 4RK8A 4Q8QA 3KTSA 4FR6A 3POCA 1OHLA 4PTXA 1R8LA 2Z1WA 3FA3A 1TVPA 3KCOA 3LQLA 2EPHA 3NSNA 1BF6A 2FZMA 3O6CA 6ALDA 2W79A 4UTWA 3N73A 3UFYA 3N34A 1RQBA 2H3BA 4IZGA 4L7ZA 2JGQA 1ADOA 3O7UA 1KXTA 4EKJA 5HUPA 2QHAA 1FHDA 3I10A 1JPMA 1H2JA 3LCHA 1GKQA 3M7SA 1W8GA 3GFXA 1OEPA 1NDWA 1K6AA 2XIOA 3BOLA 4WSHA 3G0UA 5HR7A 1GVFA 4WSKA 1VQTA 5KITA 4JTAA 4IIEA 1OFBA 1MUCA 1W1TA 4F0KA 2RDWA 3PAOA 1KR1A 2Z1BA 4IPLA 2DH3A 4JCMA 1KM1A 2ZX5A 3W38A 4QJ3B 4E2DA 4N7QA 1QW8A 2ZTKA 5G4WA 1GPWA 1J6PA 3W72A 1J01A 1LOLA 2CZ5A 3I7RA 1EJRC 7A3HA 3NXFA 4UUIA 1BTCA 4YTTA 1XDLA 5A2CA 4ALDA 1RCOB 2BHYA 4CNTA 3S9YA 4PTMA 5FJIA 3AUJA 3KCLA 3W1NA 3KVMA 4HHMA 2WYSA 1MVYA 2BVTA 3WLMA 4F0LA 3W7NA 2F2HA 2EHHA 1C7TA 2ZRWA 4KPLA 4GJ1A 4ZQNA 2OZ3A 1DWHM 3LGGA 3LBCA 4EWJA 3DC8A 2JE8A 2OOFA 4XIMA 1CI1A 3BSGA 3KBVA 1E6ZA 1TIMA 6REQB 4ZQOA 3LRKA 2CBJA 1B3XA 2ZZ2A 1OABA 1UKSA 4GH3A 2EG8A 1SW0A 2Z6IA 1I0DA 3PK7A 5I3IA 4EE9A 1YE4A 1C7SA 1W1A1 1VYPX 2YR1A 1POKA 1SO6A 4QXIA 1LWJA 2UY2A 3EWYA 3DFPA 1Q3NA 1E51A 1WX0A 5A2BA 1S38A 2C6QA 4IPJA 4TV5A 2G96A 4HYVA 3TROA 3WUBA 2CBIA 1E6RA 4DF0A 3EA3A 3WJYA 4RV3A 1DOSA 1NFGA 4DBDA 1PAMA 1G67A 3B3DA 3T2QA 5L6UA 5LNSA 2YDRA 1QASA 3AYSA 1W56A 2W62A 2DGAA 1PX3A 4C1NB 1M04A 1E9IA 2Z1SA 4A3RA 3VU2A 6PTDA 1XRSA 1TV3A 3GYEA 4FMVA 2W4XA 3ZT5A 1UZ1A 4QCFA 4Q8NA 4H01A 7TAAA 3OZYA 1M65A 4XAPA 2GK1A 3HQPA 4AH7A 3DN5A 1C9WA 4QG6A 3G1HA 5G4EA 2UV8G 4RNIA 3LNPA 3TYUA 3QGAC 1V7YA 1X8CA 3LHZA 1RD5A 4ZO8A 3GTXA 4QLLA 5FJRA 3TWAA 4DELA 1MQRA 1GVRA 1FCUA 3CPRA 4GY7A 3UU0A 2DU2A 3GSMA 1DJIA 5FF0A 4ZQRA 4LBRA 1BYBA 1X38A 2BVYA 3BAIA 1HNYA 1WCGA 3R12A 2PLMA 1HXJA 3APGA 3MDUA 3N3MA 3M7WA 2QJHA 1OGBA 2J78A 2Q8ZA 3ONCA 2NX1A 3R13A 4Y8FA 3MCOA 1LQAA 3WQEA 4L6HA 1ONEA 3I68A 3NSXA 2ZDSA 4HCDA 2WNWA 4W85A 1QJWA 3QTGA 4UTHA 2PDFA 4FXRA 1KV8A 2WLZA 2Q02A 5CAKA 3RIKA 1BFNA 4RNFA 4M24A 1Z6KA 3OVPA 1US2A 1IWPA 1XL9A 3DG6A 2QVHA 1FHUA 2O7SA 1EC7A 2Y89A 4US6A 5I7GA 1C90A 1C92A 4X22A 4AIOA 4IT1A 1VD6A 4XAYA 4IIHA 1HKKA 5KETA 6A3HA 3FAWA 5DEZA 5EMUA 3QJAA 1C8QA 1FH7A 1AK5A 3LZ5A 3N2MA 1S5WA 1QTWA 3T55A 3TR2A 4GKLA 1H50A 4IG2B 4IHCA 1YDOA 1KRCC 3NPWA 1OX6A 3HF3A 2CHNA 4JL1A 2OODA 2DSWA 1W1VA 2V3EA 4GE8A 2BHZA 1A5KC 1IT0A 4O18A 2NW0A 1CGVA 1FWRA 5GNXA 3STFA 4UMAA 1SJBA 2WSYA 3GYCA 1HVQA 1OFRA 4XIAA 5ECUA 3ABSA 1I1XA 3MHUA 1A4LA 2PWUA 1MEIA 4RXGA 1AQHA 2VKZG 1GEQA 4CNUA 4H7VA 5E70A 3NQ6A 4WGHA 1DKWA 1KRBC 3VUSA 3TN3A 1K7XA 3CS2A 5F7UA 4AG0A 3L0GA 4LYPA 6REQA 2AOSA 3BCFA 3TN5A 4H41A 1ML1A 2ZTJA 1DWFM 4TX9A 1LRNA 4G1NA 3RLVA 1Q6EA 3C2OA 2YB4A 5XINA 1UMYA 5XIAA 3CH9A 3V5FA 4GCAA 2C0AA 3NDYA 3LB0A 1JXJA 5AHEA 3VD3A 1O94A 4Q4MA 1M5WA 1C29A 2GGHA 2L5HA 3S5SA 1GVYA 1K8XA 7ODCA 1JD9A 3H2EA 2V3FA 3TSBA 1ME9A 4JTIA 4EPEC 3VKJA 5FJOA 3OQEA 2C91A 3UXDA 4RZBA 4C1NA 2FTWA 2WHLA 3W86A 5FEWA 4AIBA 1IEVA 1BEUA 5BWFA 7XIMA 2NV2A 3S1XA 1EB3A 1SZGA 4AD3A 3UZYA 4UB9A 1M01A 2NQJA 3QEZA 5C6MA 1P4CA 3CB3A 4U5IA 1P0BA 3SQLA 1A49A 1AJ2A 4Z2IA 3L5LA 2PF8A 3S1VA 3W2UA 3TOPA 3O07A 4M5PA 3PBUA 1XDMA 2VZSA 4KFOA 1H11A 4JIQA 3KXQA 5K4ZA 3E02A 3DYPA 5FSDC 3FXYA 3QKZA 1K77A 4O14A 3L68A 1PKNA 1SO4A 1GYLA 5FF2A 3FKKA 2ESCA 3UA3A 1KTNA 1C8YA 2PGEA 1QI2A 1ZPTA 1JF5A 1W3KA 4X60A 4MJMA 1ZRQA 4CD7A 1E55A 1TPH1 3K8MA 3IGHX 2V3DA 4HHPA 4ZA0A 2NX3A 3A9BA 1NU5A 3M16A 3UWEA 3WDHA 1HKJA 1HL9A 4LV4A 5M2FX 2VGIA 4MJ4A 3SR7A 2EG6A 4D8LA 5LZLA 3MA8A 4MSSA 1MFVA 3H70A 3ZM8A 5D33A 4AZCB 4HA0A 3N2TA 4ACZA 3L9CA 4ZO6A 3K1GA 4AY7A 5BW6A 3PY2A 1BXCA 4CQ9A 2BOGX 2O9OA 4XQ6A 4JFUA 2P5NA 2XVPA 3ZMRA 1QI0A 1QWGA 2AMGA 1U22A 1UZDA 1AJZA 4GABA 3LK6A 4ZENA 3KOYA 4WOQA 1K7EA 2YA0A 1JRBA 4JYEA 3TYDA 2VOTA 2PWDA 1XG3A 1RR2A 1KXQA 4IG2A 2V5KA 5HWNA 4Z1BA 1PDYA 2OGYA 3WH5A 3PPFA 1NDVA 3P5YA 4LGXA 2VELA 3M44A 5G1TA 3N04A 1AODA 4ZOAA 4L4LA 3S2JA 1DHPA 4NVTA 3HA1A 3L12A 1D3GA 1N82A 3JRKA 4DWSD 1LT7A 2V2HA 3R43A 1VBGA 1W1PA 3EOUA 3LZ3A 4CUCA 2PDGA 2FJKA 3BAKA 4AXNA 1Q2SA 1LT8A 4TVDA 1JYXA 3T0AA 1S2AA 4ICNA 3KP0A 3BOFA 4OVXA 3F2CA 5HDRA 3K30A 3WLIA 1F74A 3LCLA 4L5ZA 3VDGA 2JEQA 1Z48A 3ABOA 4FF5A 2WMGA 1GVEA 1KO0A 3CHEA 1J11A 1OFOA 1AQMA 5IDIA 3QHMA 2Y8KA 3KE0A 2C15A 4X0NA 1R47A 3ATZA 2Y7GA 3LERA 1L6GA 2IKIA 2BP1A 2FB3A 2HVOA 1EGMA 3CQ0A 4W7WA 3E5PA 5H6HA 1DWIM 2QR6A 1N8IA 1DXEA 1O5QA 2V2CA 2QQ6A 1W5MA 3E96A 3IJ9A 3PTQA 2GYIA 3BE7A 4W9TA 4GQGA 3C0SA 1R3YA 3SJ3A 4ERAA 4C7GA 3HJEA 3TC7A 4LY8A 5EPDA 1J2WA 3SZ8A 4IFKB 3LENA 5LIXX 2D23A 3N6QA 1CYGA 4LWWA 3SCWA 1X1ZA 3CZ8A 2HNEA 3GAKA 3GAYA 2NQLA 1W9BM 3MHFA 5AZ1A 1E9LA 4BQ3A 1MDRA 4LS1A 4M51A 1CGTA 1I60A 1RA0A 4FSAA 4DEFA 3QYQA 4RE2A 2V30A 3NOEA 3TMQA 1REQA 4H4IA 3THAA 2OO0A 3M5ZA 5KINA 2PLCA 1IEWA 4JPGA 1FOBA 4E0CA 4Q4SA 3GXPA 1LQ2A 3CAVA 3T2PA 5C7HA 2PUZA 3ZLGA 3L4WA 1JCXA 3VNLA 3F03K 4M81A 1TRDA 3CV6A 1YDYA 3UG4A 2BY2A 4DN1A 1O1HA 4AXKA 2FMNA 3RHGA 2BVWA 3E5BA 3KEHA 3W1XA 2EPMX 1O5KA 2D2JA 4ZOCA 4QFUA 4AX6A 2W91A 6TIMA 1YNPA 5FI8A 3LHUA 3F4NA 3IGSA 5LNRA 4FP1A 3W1LA 3W81A 3FK4A 2IW0A 2V38A 3G1RA 3F4VA 4C60A 4HD5A 2QKFA 1RBAA 2ZRUA 1SFLA 4XUYA 3T0BA 3MDWA 1PCWA 4KESA 2J27A 2QF7A 1Q85A 2A1YA 2BGSA 3G1SA 4DLFA 2X1SA 3APYA 2G5WA 5DY3A 4Y9OA 5CPLA 3A5VA 4GPNA 3ZVHB 1UKOA 4UOZA 1IGWA 3LS9A 4AYSA 1JCNA 1QPKA 2XWDA 3A3WA 3HU7A 4GI6A 4Y9NA 2W6RA 2OKOA 2J7DA 4MG4A 5ABHA 1TCMA 1ZJBA 4B4FA 4K68A 1XIBA 1EPXA 4Q8TA 2CW6A 2E0PA 2YBUA 4S39A 5AHFA 5EY5A 4LBSA 3B0YA 1QR7A 1E4LA 4GJIA 4PL2A 5HJXA 1V3IA 3CZEA 4J3ZA 4PUJA 1T6MA 2F6XA 3WNLA 1B3VA 4MHBA 1O7AA 4DZHA 3ZWTA 4QEHA 3S4TA 3BZGA 3IUHA 3S46A 1V79A 4UNLA 3DFSA 3RCNA 3TYCA 3UYCA 1RH9A 5C71A 3ECQA 4FXFA 4K7YA 5AHLA 2ZZ6A 1J5SA 1TA3B 4K38A 2X1TA 1SZRA 4IQLA 1W31A 4DYEA 1XUZA 3SCUA 3BW4A 1YTKA 4UQAA 1E1EA 3DAQA 5RUBA 1TUXA 2CWNA 4QE5A 2NXIA 4Y9PA 3AYTA 1G4EA 3KBSA 3EXRA 2WJEA 1UASA 3CEPA 2C79A 1FWTA 5AFDA 4REQA 5G2HA 4EPKA 4RDVA 2ADAA 2VCBA 4S3BA 3OTRA 3A5FA 4HJFA 1UH3A 3WFLA 2VQUA 1XSKA 1R9YA 5DCBA 1EIBA 4J3WA 3P7YA 1VF8A 1A5NC 3CUJA 1E6XM 4AD2A 3MHGA 4L9YA 4RKAA 4IFKA 1XCWA 3T81A 5FSEC 1NF0A 3UWYA 1CIUA 4S3KA 4GVFA 2AKMA 1YDVA 4QS6A 2XH7A 4NYUA 1PB0A 2EPLX 3ONBA 2WC7A 2X7WA 3ABQA 1Q2RA 1HP5A 4AIEA 5HNNA 4MPQA 1V0LA 4F48A 4M1RA 2WHJA 2OSYA 3QF0A 4CQDA 1UA3A 3HBLA 4K8GA 1I6NA 1UWAA 1W37A 3AZSA 3WQ8A 3TSDA 2NWRA 1BSIA 3VGBA 4UCGA 2XU2A 1V02A 5HA7A 1KFLA 3UWZA 3PZ9A 2PU1A 2XIJA 3MC5A 4TX8A 1EGZA 3WF2A 2GVLA 3INPA 3IS4A 1V3HA 4AZIA 2XN0A 2WWCA 1DTUA 5DY2A 1D8WA 1MUMA 3BG9A 5D32A 4RW5A 4A3HA 1NARA