3BK0A

Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with 5-cn-ump
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
publication title Crystal Structure of Human Orotidine 5'-monophosphate Decarboxylase Complexed with 5-CN-UMP
rcsb
source organism Homo sapiens
total genus 94
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3bk0A00
1ZAHA 2QCMA 2XN0A 4ONVA 2X1UA 4Y90A 3FKKA 4X3ZA 2CLIA 1FBAA 3S8HA 1GOXA 2E6FA 4QNWA 4DF0A 3NXFA 1G4EA 2NZLA 3GIYA 3MI3A 1XKYA 3C52A 1KM3A 4NX5A 4UMBA 3W7QA 4O4WA 2ZA3A 4PODA 3L65A 2G96A 3HG5A 3RK8A 2VFGA 2QCNA 1FQ0A 3E49A 3GXTA 4JIPA 4HHPA 3QRHA 2QCLA 2ISWA 4C1KA 1N7KA 2QAFA 4Q4KA 1OF6A 5F4WA 1WBJA 1THFD 3G1SA 4Q32A 4AMAA 1H7NA 2OX1A 4KFNA 4Z1BA 3QMRA 4UNLA 4IQLA 3M43A 4N4PA 3C4UA 1QCWA 1SW0A 2DZTA 1G7VA 3Q94A 2CLKA 3BVJA 2AGKA 4FXSA 4FIRA 1H62A 3KHJA 3SGUA 5D02A 4NJIA 1YTKA 1VPXA 1DORA 2CLMA 2KZHA 3HB9A 5CPNA 3VCRA 1W31A 2QEZA 3W7MA 8TIMA 5K4XA 3LM7A 2NUXA 2Y7FA 3L66A 1EP1A 4MJMA 1RV8A 4BWLC 3IIPA 5E1QA 1MEHA 3S42A 1JRBA 2EPHA 5I3JA 3W23A 4O13A 4IPJA 1WAUA 5LSMA 1QR7A 3NM1A 5DXXA 1ME8A 2HMCA 4UIOA 1XBVA 5EL1A 3G0UA 4TU1A 4XKYA 2ZRVA 3UWVA 4PC8A 3DAQA 3UD6A 3DHDA 2A0NA 1UBSA 3TNOA 2QUUA 1GPWA 2ABAA 3NAVA 5CZ0A 1I8JA 1KLYA 1UCWA 1TQJA 2Z2UA 3LERA 3SZ8A 1UJPA 2F7FA 2W0UA 4UTLA 4NVTA 2BTMA 4QJ1A 1FDYA 1QOQA 1R2RA 1A53A 5HULA 2JKEA 4OV4A 1OX4A 1G67A 1KM4A 5D2TA 3LDVA 4IUOA 1I2QA 1R2TA 2BXVA 1XBXA 4K37A 2DP3A 2V9DA 3FYOA 4PEKA 4UFKA 5MHBA 3G8EA 1Z44A 3G0XA 3KVJA 1O95A 3FIGA 3MP4A 4K7YA 2QCHA 1H63A 5BW6A 1F73A 1TREA 3LV6A 3WFAA 4NXSA 3T7VA 2B7OA 1ZY9A 4O1AA 3PM6A 3O15A 3CT7A 1J5TA 5F2GA 4R34A 5CPOA 1AK5A 3W86A 5HR6A 4DF2A 5C54A 2WJZA 4JTIA 3O63A 2BWGA 4QSHA 3GNNA 3SY5A 2GQ9A 3QYQA 3PUOA 1AW5A 2E1DA 5D04C 3LRLA 3TC7A 2FPTA 2YXGA 2ISVA 2QCGA 3LRKA 4DO5A 3O05A 3NDOA 4ALDA 2ZRXA 1DOSA 3DXIA 4UFLA 1JUKA 3DENA 5G4EA 2VFEA 4H4IA 4LU0A 3M7WA 5D33A 5LGZA 1W37A 3KVMA 4O0KA 5AHLA 3CQ0A 4RK8A 5FESA 1C29A 4JEQA 3LV5A 1T0OA 3TQKA 2DJXA 3T4CA 3UWUA 5TIMA 1D3HA 3DFQA 3HGJA 1K7XA 2DZXA 2Z6IA 1U5JA 2OJPA 3BG9A 3H53A 4IX0A 3N2MA 1WOAA 5FI8A 1GJPA 4BF9A 5FEWA 4DF1A 3GB6A 1SZFA 5AHFA 3C3NA 4A2RA 2A5HA 5AB3A 3DFSA 1H5YA 3L0NA 1TB3A 3C2RA 3MHUA 5F2IA 3F4WA 4WXZA 4EWND 5C5YA 1R30A 4CCCA 1DBTA 1RQHA 2PCQA 3DI0A 1HL2A 1KLZA 2X30A 5AOUA 1TTQA 4QIUA 5E0KA 3O16A 2YSWA 3QM3A 3IIXA 3TW7A 2EKCA 4XTDA 3TSMA 2NV2A 3LHZA 1RD5A 3LTSA 1VZWA 2C14A 3CEUA 5K2ZA 3HPZA 4R7JA 3TUUA 2F84A 3N9RA 3W84A 3W7NA 3LBCA 2GJNA 3NQ2A 1GZGA 1VRDA 3SIZA 3I6RA 4MYAA 3ABRA 4CNPA 4LV9A 4ML9A 1NF0A 2ZYFA 1ADOA 3CU2A 5AYXA 3DHFA 3P81A 4MY1A 2DJLA 2ZDRA 2E68A 1T96A 4ADSA 3M16A 5LHFA 2XFWA 3E9AA 3WJYA 3NOEA 4EVZA 4WUIA 2HSAA 5BRBA 2V8ZA 3H54A 2YR1A 3EWBX 1L6SA 2ZZ2A 5I3HA 2A7RA 3WK3A 2P0OA 1FY6A 2ZTKA 2GJLA 5ABTA 1VR6A 1QPQA 1JCLA 3NGJA 2JBMA 1XBZA 1J4EA 2Q8ZA 2J6XA 3R12A 4O14A 3IRDA 5BMXA 4IXXA 1W5MA 3W7EA 1H7RA 2FPYA 5DBUA 1W1ZA 2QDHA 4FF7A 1S3HA 1W3IA 2QCFA 1VCGA 4O19A 3W22A 1FDZA 3GDMA 1EPXA 4HPXA 4GE8A 4QAIA 4OU1A 1KFKA 4NNAA 2H90A 4LVGA 3B8DA 3M5ZA 4GRSA 4EOUA 3HGOA 1SFJA 3PSWA 2CZEA 4DXVA 3R13A 4WXYA 1LOLA 4O12A 2WSYA 1TPFA 1G4PA 2P1FA 4HN4A 3F4NA 3UWWA 1JUBA 1NVMA 3VI2A 1JQXA 3NNTA 4K39A 1QOPA 2WOQA 4QQ3A 1W3NA 3TH6A 5FF2A 4WY0B 5DN1A 2Y7GA 1MEIA 3GNDA 1BKSA 5AC7A 1EUNA 1VYSX 4LUJA 4JTEA 2C3ZA 3LCFA 3DFNA 2A7PA 4YL2A 3TC6A 3I7SA 3PBUA 1JVNA 3L5MA 2FQIA 4FB7A 2VKZG 3B03A 4LVBA 3TROA 5G2IA 1D3GA 3FJ6A 1Q6OA 5KSWA 5AHMA 2CZDA 5KZDA 3TQ0A 4PA8A 3GAYA 1P1XA 3N14A 1VLWA 3QFEA 1FXPA 1WX0A 1LYXA 5D05A 3TSBA 1O5XA 3K30A 4QNEA 3HBLA 1HO1A 2ZCGA 4GUFA 4OBTA 4ZQNA 3G24A 4MY8A 3NZRA 1P4CA 1ZNNA 2ZRZA 1X7FA 4B5NA 4KFOA 1OFBA 2VXNA 1QWGA 2CZ5A 3MYPA 4CQ9A 4ADTA 2YW4A 4GWEA 3W75A 1QPRA 1SW3A 1TO3A 1B57A 2A6LA 4GJ1A 3INPA 3LHUA 3MI6A 3W7RA 3PBYA 5KITA 1M5WA 4LNYA 3S1VA 5CPLA 3JRKA 1A50A 3YPIA 1B4KA 3BGJA 2QUTA 2HTMA 4NT0A 1QO5A 5AFDA 3W73A 2V0TA 3UZJA 3CPRA 1LCOA 4E2BA 2VEIA 4ZVJA 3R8RA 4TR9A 1SZNA 1W0MA 4ZQPA 1OG0A 3IV3A 3VKJA 4KFPA 1K8YA 4WJEA 1H7WA 4JDYA 2QCDB 2WNQA 4AF0B 1LRNA 2I14A 3G3MA 2GPTA 3ATZA 4HNUA 3L0GA 2Y85A 4NJJA 1JRCA 1UASA 4JX5A 3SR7A 3UWYA 1OK4A 5HJLA 4S2BA 1FCBA 3OG3A 3HPXA 1H7OA 4AHQA 3OIXA 3TJXA 1NSJA 4RXFA 4Z0JA 3S6DA 4NX0A 3G0SA 4LW7A 3IEBA 3U6WA 4JY8A 3W76A 5DY2A 1O60A 3LTPA 4PL2A 1F5ZA 2LLEA 3DBPA 4AXKA 1WBHA 3NQGA 1QO2A 2WNZA 5D2XA 1DHPA 2OCZA 1MO0A 3LCXA 1XC4A 3W1MA 4IMFA 1R2SA 3B4UA 4OQVA 5K9CA 1V7YA 4RKAA 2YYUA 1SW7A 3CWOX 5F1UA 4UC5A 3S1WA 1F6KA 3H55A 3NQ6A 1W5PA 1BEUA 1JUEA 2CLHA 3PBWA 1YTDA 1TRDA 1XDMA 1ICPA 4MJZA 4QITA 1KTBA 1DVJA 4FO4A 1FCUA 3GDLA 1AL8A 3W2KA 2QAPA 3B04A 3TSDA 5T26A 4M6PA 3BLEA 3P5YA 2GOUA 3OEXA 4CQAA 3W70A 4K8HA 5F1VA 1G6CA 1SO5A 3CEPA 3PY2A 4BR1A 3PVFA 3BV4A 2J88A 1YXCA 3UWQA 2E6AA 4JGDA 4NU7A 3UWZA 2DZWA 5I3IA 2V82A 1H50A 1FWWA 4UTUA 2V81A 3NYZA 1UUMA 2YZRA 1F6PA 2RKXA 4Y96A 3EWZA 3EXSA 3OHIA 1WA3A 1GYNA 1F74A 4UTTC 3GYEA 4OV9A 4E2DA 2H3BA 3MUXA 1ML1A 1TJPA 1JCMP 2H8XA 4O15A 2G97A 4XBKA 1WV2A 3RMJA 3UXDA 1Z48A 2QJGA 1ZFJA 3RNDA 3G1HA 4MZ8A 1YXDA 4NNBA 4FX8A 2A2IA 1VLIA 2E5CA 1KM1A 2I9EA 1KTNA 1OX5A 5G5IA 4XKYB 3A21A 3NQMA 3WK1A 3A5FA 2ALDA 2ISSA 3UPWA 4ZQCA 3EWYA 3PG8A 2GVGA 1TPH1 4BI5A 1G69A 1EEPA 3DU0A 2FIQA 1N8FA 3P7YA 2EHHA 1T8XA 2G95A 1OX4B 1GVOA 3ABOA 4JYFA 4ICNA 2E09A 4NZFA 3W07A 1GG0A 3HO8A 3N2XA 1FWTA 2Q8LA 4UTWC 4CNNA 2JGQA 1Q3NA 1A5SA 1TV7A 1LZOA 1VJIA 2X1TA 1Z42A 1QDSA 1J2WA 5D38A 4UFHA 1AW2A 2A1YA 1Q6QA 1K8ZA 4I7VA 2X1RA 4M6VA 1ME9A 1EX5A 5FF3A 3QZEA 1IXPA 1WOBA 3PB0A 5K9DA 2OT1A 1XL9A 4IWWA 3BLIA 3NL3A 3QSTA 3MJYA 2CZFA 3N34A 4Z1CA 5CZJA 5AN7A 2VFDA 5D30A 2Y7EA 4BFAA 2VFHA 3VE9A 3EWXA 2ZQ0A 3STFA 4K7VA 3W2LA 4N6FA 4IMEA 2YDAA 3M1ZA 1JJKA 1OF8A 3BGGA 2O7QA 3U2OA 4WOZA 5F4XA 1XI3A 3WK2A 3GXPA 5DCBA 2VEMA 2VFFA 3KXQA 5DY3A 3W7CA 2WSQA 3Q58A 2J24A 3HMJG 5KZMA 4NXKA 4XUGA 1TIMA 2E5BA 3O07A 3P84A 1XFBA 3LCWA 1I2RA 4EF9A 2BLEA 2NUYA 4XZ9A 2QF7A 4YCOA 1D9EA 3LRMA 4DBEA 3S1UA 3TAOA 2DORA 3PSVA 4IPIA 5I3FA 4O16A 4IX2A 2C15A 3BG5A 1SO3A 2C13A 3QMTA 5TBOA 4TO8A 1SZEA 3L21A 3NQDA 1IF2A 4N2YA 2IQTA 3GKAA 3TU9A 4NNCA 1XUUA 2GQ8A 1OYBA 5AHIA 4JYEA 3UQNA 1FWSA 4UR7A 3TE9A 4UTHA 4MOZA 2ZA1A 3O06A 1QPOA 4UMCA 3TIMA 1SR9A 3QEZA 3NO5A 3P8IA 3CWNA 3LTYA 5LNRA 1I2NA 4UNKA 4PH6A 2Q3OA 3TV8A 1NAL1 2RFGA 3KAOA 3QF0A 1GEQA 2CLFA 1NF7A 4BI6A 3E96A 3G8RA 3O8AA 3NQAA 4O8RA 1ONRA 3W7IA 3BG3A 3W7LA 1B4EA 1TV5A 3EX4A 1NEYA 3MP5A 3HOJA 3WJXA 2GVLA 4WX2A 3BW2A 3CIWA 3IVTA 3O6YX 4Y9AA 1Q45A 4GNJA 2GUUA 3NG3A 5LNVA 2A21A 3S0CA 1YDOA 5K4ZA 1K7FA 4FNSA 2VEPA 4Z08A 1ALDA 3B06A 1YLVA 2CLLA 4JTUA 1A5BA 2ZZ4A 4XWUA 4WOQA 5EY5A 3W1AA 3EX6A 3VFLA 1C9DA 3QSRA 3LCIA 4TX9A 1EWEA 4AWUA 3TX9A 1TSIA 1M6JA 3V75A 5F4SA 2GQAA 4IMCA 4ORMA 2TPSA 2A4AA 1HG3A 1LOSA 3PBVA 1O4UA 4RZ5A 1EP3A 3SGZA 3KFTA 4OGZA 4UUIA 2C19A 3W7DA 1GYLA 3PC0A 3FLUA 1Q6RA 4LOCA 1U83A 2DZSA 4D2JA 4E0CA 4FHAA 2ATSA 4LS0A 2CWNA 3N3MA 4A2SA 2TRSA 4HSOA 4Y8FA 3GKFA 2B7NA 1W5OA 1W56A 4OHQA 1IIHA 4A22A 1L9WA 3W7HA 1DJQA 1CW2A 1TPVA 1YDNA 3HJZA 4NQ1A 2W6RA 3CIXA 4JTHA 4FEZA 3TK7A 1BWLA 2J9XA 1ZJIA 1KA9F 4M5PA 1GWJA 3W1LA 3PUDA 1OFEA 4AB4A 1P0NA 2WV8A 4UTJA 4UCGA 1XXXA 3PUEA 2RDUA 5KMYA 1SQ7A 2QJIA 2VEKA 4AEOA 1F76A 4PFMA 1XDLA 3GAKA 2ZZ6A 2E6DA 4ZMGA 3GX9A 4C1LA 3R89A 4A3UA 4Z1AA 4YCPA 3IGSA 4OT7A 3PR2A 3VNDA 4LY8A 3W1TA 1SU5A 5AC8A 2AQWA 1G7UA 2ZZ7A 3G22A 4PTNA 2Z6JA 5FEZA 4GUJA 3FA5A 4O1BA 3TFXA 1WDWA 1JCYA 2BX7A 3G1DA 1L2UA 1IXNA 1JCNA 4O18A 2EGZA 1W54A 3QH2A 3EKLA 2VOMA 4HPJA 2DZUA 1LORA 2NXGA 3LHVA 1IXOA 4YWIA 1LOQA 3W2UA 5EMUA 1O94A 4KKXA 3W6YA 2HS8A 2CFFA 4K8EA 1YDVA 3G1AA 3JS3A 5D09A 4J9JA 4HNNA 3HQ1A 3JR2A 4Y6GA 3GVGA 2VELA 3LBMA 3T44A 2PURA 3PS7A 3C61A 4GFSA 5EBUA 4O1DA 1H61A 3TAKA 3MHFA 1H7XA 1VH7A 4O10A 2WPBA 5J5DA 2JKAA 3RF9A 2RH9A 3M5XA 1GQNA 1LLZA 4KWVA 2J9ZA 1T99A 2FB3A 1AG1O 2AAMA 2PC4A 3W88A 3KRSA 1I2PA 3W7OA 1VCVA 3IIOA 4CCEA 1ZCOA 1KFCA 2PE4A 4JIQA 3L0KA 3MP3A 2Y6ZA 3IGUA 1PL9A 2V2HA 3QPZA 3W7JA 2R14A 1W5NA 3S1XA 4RZ4A 3C0JA 1GVFA 1LTDA 4M6QA 5I3KA 4EIVA 3LXCA 4JTJA 1SFLA 5HQEA 3BW3A 2OZ0A 4JX6A 2NLIA 4RR4A 5D03A 1AW1A 1LROA 2QR6A 4ZZ9A 1GVQA 5HINA 5A8GA 1P5BA 4DPQA 5D2YA 1W5QA 4JTTA 3P8JA 2HS6A 1SUXA 3C8FA 1SPQA 3LI1A 4Z0SA 2VC6A 2JGYA 3LXBA 2ATMA 3EXRA 2Q3RA 6TIMA 3NPXA 5U4NA 4S1FA 3P60A 1IGSA 1R46A 2ZZ3A 3UZ5A 3KVLA 3L68A 1WQ5A 1OHLA 3EWUA 2NWSA 3I7QA 3M47A 4JX4A 4JDBA 3W1QA 1A5AA 3GK0A 3MWAA 4FNUA 3G3DA 3S5ZA 3QJAA 5L6UA 2X1SA 3S9YA 3QW3A 1K7EA 3M41A 3GDKA 5AYYA 3FOKA 4YLWA 3P5ZA 3PB2A 3QPYA 4MLRA 4UTIA 1EB3A 3HIJA 1YYAA 3IIVA 3ANYA 1OFAA 2Y62A 2TSYA 3E12A 3EB2A 3UPBA 3TCEA 3Q2DA 3EWWA 4ORIA 2QCEA 2NX9A 1DJNA 4FX7A 5SWUA 3M6YA 4RLIA 5K9XA 3P82A 1LRTA 4GUIA 5IBXA 4MKNA 4RCXA 3TR2A 5HUPA 4OWGA 1GG1A 3DKLA 3A9IA 3RLUA 1BWKA 3DH7A 3O6CA 1RZMA 1VHNA 1QFEA 3BLFA 3I68A 3TJLA 1TTIA 3ZFHA 4AH7A 1FCQA 3DKJA 3STGA 3EXTA 3NL6A 1AL7A 1S5WA 4LRSA 1KM5A 2NWRA 2ZZ1A 4UTMA 5EPDA 4AWTA 4UFMA 4XTIA 3QMSA 4FNPA 4LS2A 1IXQA 1YPFA 4KWWA 4EF8A 1OX6A 2H8ZA 2NV1A 3TA6A 3L67A 4UMAA 3M0ZA 1TPUA 2QJHA 2O7SA 1WYIA 4JTGA 1G4TA 3NZ1A 2ZRUA 4LC6A 1EP2A 1MXSA 3DGRA 2ZBTA 5LNUA 4AF0A 5D37A 4X9SA 3N9SA 1LBLA 3UY7A 2YW3A 4XQ6A 1K3UA 3T55A 3OBKA 1GTEA 4WY0F 3LCGA 4MYXA 1EWDA 4N02A 4O50A 3R2GA 4TMBA 4TIMA 3OVRA 1GT8A 3IVUA 4K6AA 1QPNA 1RQEA 2FJKA 5DCEA 4LVDA 4PL1A 4NJGA 3C2EA 4FIQA 4PCFA 5LNSA 2DZPA 1VC4A 3ABSA 3SFKA 1W3TA 3AJXA 1LRQA 4MIMA 4LUIA 3TFCA 5H2ZA 2CLEA 4MZYA 5G2WA 2V5BA 5L9FA 3BK0A 3LI0A 3EEGA 3FJLA 1WXJA 3UY8A 3ATYA 1TRIA 1F05A 3LXAA 1HO4A 4O54A 3ABQA 4UFIA 3HGRA 1GVRA 3FKRA 5LKYA 3A5VA 3CHVA 4FX6M 1VQTA 3MO7A 3B05A 1E51A 4JTFA 4ZQMA 4H3DA 2WKJA 4JYDA 3PG9A 1Y0EA 4AVFA 4RV8A 3NM3A 2C16A 4MUZA 5DXYA 5D2WA 1VYPX 4E38A 4IOTA 4FNQA 1B3OA 1KFJA 2R91A 1KM0A 1ZHAA 3DFOA 3MI2A 2YCEA 4LVAA 1UUOA 4POCA 3LHTA 4P61A 1OK6A 1YADA 3NQVA 3OVPA 1SSGA 5DELA 1TPC1 3I65A 2EAWA 1PIIA 5CSSA 3RFAA 2V2DA 4IMDA 4UFJA 5KTLA 1TPB1 5AC6A 5GVJA 3CB8A 4UTKA 2WSRA 2R94A 1K03A 3G18A 4L4LA 2E6YA 4DO6A 2GVJA 1K8XA 1OFQA 1M7OA 1A5CA 3LGEA 5CKSA 5HNRA 2VENA 1RR2A 3IVSA 5FF4A 5G1YA 4WZHA 3LCLA 3LLDA 2YGYA 3I7RA 4X22A 1PHQA 1TJRA 3THQA 1LDCA 4UTTA 3SSJA 4I9AA 1X1OA 3MW7A 3NEVA 3GZ3A 4JN6A 4TMCA 5LGXA 3L5AA 4WQ6A 1L6WA 1C8VA 1SSDA 4JXCA 2RHGA 4WD0A 4GXMA 3TQVA 5BMWA 4RZ6A 1OABA 2DU2A 4N9EA 4O1CA 4GUHA 1MEWA 1ZAIA 5C2XA 1DQXA 4K38A 2Z1BA 3ZS4A 2NXHA 5BOOA 3TMQA 2FDSA 5A5WA 3HG2A 4QISA 2V30A 3RLVA 1DV7A 1GVSA 3QQ1A 1HUVA 3GDRA 2A85A 2PRHA 4N9DA 5E93A 3T40A 3ZWSA 5CSRA 5D2VA 5LZLA 1X1ZA 5U7SA 1VCFA 1H1ZA 3N19B 1PCWA 5HWNA 3S5YA 3P80A 3W85A 3DFTA 2Y89A 4UTWA 1GTHA 3G1XA 4N9BA 4MVAA 3HGSA 4JTKA 3UYCA 4BWLA 3LX9A 5HMSA 4I7WA 3EKZA 1JR1A 5F2LA 4CNOA 3ELFA 1H51A 2Y7DA 4JNMA 2FPVA 2DZVA 2H3DA 4DELA 1VHCA 4AWSA 4MLJA 3M5YA 1TPDA 1LLWA 1VYRA 5AHEA 2XN2A 4JD4A 1LP6A 3G1YA 4IJBA 1VS1A 4JICA 3P62A 4O4VA 4DPPA 5C55A 3QQ0A 4N4QA 4O52A 3P67A 1I2OA 1FCVA 1QNVA 1X6UA 2CW6A 3W3OA 1FXQA 1TQXA 4NUWA 2WO5A 3W71A 5F2MA 3Q37A 1QAPA 3CLMA 3MBDA 4JR5A 1F2JA 2Y70A 3E0IA 1M7PA 1PVNA 4O17A 5FF7A 3VE7A 2BZNA 3LHYA 1KM2A 4BI7A 1VGAA 4X2RA 1KV5A 1QMLA 1W8SA 3O6DA 3WK0A 4W9TA 3NQ8A 1ICSA 3E02A 1MSSA 1TTPA 3M5VA 5D32A 3W7PA 3QC3A 4YMZA 7TIMA 1EIXA 1BTMA 3LHWA 4FXRA 5HWJA 3BO9A 1JULA 5DBTA 1TTJA 3HF3A 3FFSA 4HSNA 2ZTJA 3FEMA 2C0AA 5CGQA 3ZWTA 3STEA 3GDTA 3HPSA 4XBSA 2WQPA 3F03K 1TV8A 2G5WA 2D73A 4O57A 3TKFA 4MZ1A 1KW1A 3SI9A 1OVDA 1FDJA 1Q6LA 3NL5A 1XBYA 4HIBA 3M44A 1TPWA 3SJ3A 4IGHA 1NFBA 3QW4B 1S5TA 4N9CA 3BARA 3DI1A 4LV4A 4ZQRA 3W2JA 2A6NA 1CX9A 1LBMA 4JTLA 4RXGA 1RQBA 2B4GA 3KX6A 2YYTA 2FLIA 3W1XA 3NVTA 3KVKA 3LOTA 1ZALA 1KFEA 1YPIA 3NPVA 1XCFA 3THAA 4DBDA 2BSLA 2P10A 3CM4A 2ZFAA 3F1QA 4CQ8A 2A7NA 3PWAA 4QM1A 2QKFA 4GC4A 3NR0A 1OFPA 1MZHA 3LB0A 2OT0A 2NUWA 2E77A 5AYZA 2EF9A 1PS9A 1YTEA 3O1NA 4FNRA 2CLOA 1KBJA 3PAJA 3DZ1A 1TMHA 2NX1A 2QDGA 3GR7A 1TCDA 4ZQOA 1KBIA 4UXDA 3EX1A 4LT9A 2V2CA 1FWRA 3CTLA 1TYGA 2NXIA 5K7JA 4HT3A 3NQCA 1JCXA 2JK2A 6ALDA 3WJWA 4NJKA 3M9YA 2YPIA 4BK9A 1F7BA 4MY9A 2QCCA 4UR8A 1KFBA 3P74A 4RJEA 3MYOA 5EKYA 2Y63A 4Q33A 2FB2A 4A29A 5BNKA 3W87A 3TMLA 3USBA 5AHNA 1S5VA 1DQWA 4K36A 4M7SA 5CZTA 3B0PA 3L5LA 3FYPA 1L6YA 3ZR4A 1OFRA 1PHWA 4AHOA 2WNNA 1RVGA 1KTCA 2X16A 5CZSA 1YXYA 2E5DA 1ZENA 5IM51 5EYWA 4YXGA 1LM1A 3W7KA 1UB3A 2RDWA 1B9BA 3PULA 2RDTA 2X2GA 4NJHA 4OE7A 2C6QA 3TXZA 3KOFA 3A22A 5DCDA 1OYAA 1ME7A 5KZEA 2C1HA 5G2HA 4CLMA 3P61A 1ICQA 2ZRWA 4LVFA 4M7TA 3W83A 3W72A 3STCA 2H6RA 1OYCA 1IIGA 3W7GA 1OFOA 3B0UX 5KINA 4O28A 3MHGA 1N55A 5LHEA 5LNWA 5K3VA 4HKPA 4GUGA 1O5KA 3PF3A 2ZRYA 2J9YA 1PV8A 5IBXC 2YX0A 3C6CA 5FEPA 3NL2A 3WJSA 1EUAA 3IIZA 2W79A 1SZGA 4U28A 3LCHA 4LRTA 3NQEA 2TYSA 3WJZA 1I45A 2ABBA 2I1OA 1Z41A 4FNTA 3SECA 4R33A 4HNTA 4O0ZA 3D0CA 4MFEA 4JTSA 4LC8A 3HG3A 1H1YA 4WY0A 3BPWA 4P2VA 4GBUA 2YFOA 3NQ7A 4O11A 4HNVA 2PRMA 3W1RA 2JKPA 3T78A 2Y61A 3G1VA 1OJXA 1PE1A 1RPXA 3C2FA 4AAJA 4LWWA 1CI1A 4O53A 1AMKA 1EA0A 1JCJA 3HG4A 3W1PA 3CC1A 1KFLA 1FUYA 2ZA2A 3V1PA 1JQVA 3AO0A 2PRLA 5I3GA 3LLFA 3UNDA 3A24A 2CU0A 5EA9A 4R53A 3C2VA 1G4SA 3EX3A 3UXAA 4Z1DA 4LS1A 2C18A 1DL3A 5HR7A 2B7QA 3NPUA 3W2NA 5CPMA 2FTPA 4JY9A 3IGXA 5DLCA 2V5LA 1PCKA 2UV8G 1TPEA 3W9ZA 3GXNA 1K02A 3EX2A 1DKWA 2ZZ5A 4CCDA 1LBFA 4JS3A 3DFPA 2XN1A 3W1NA 1H7PA 2B0MA 4NZJA 1HFBA 3BW4A 3NA8A 4U4MA 5HWMA 1KV8A 2NX3A 2TMDA 1I4NA 3MBFA 3B0VC 2VFIA 4AHPA 3W74A 2Y88A 5J5RA 4H6KA 4LTSA 3R5EA 3A23A 2YFNA 3OVQA 3OA3A 3TDFA 3W2MA 3GR8A 2FFCA 3S5OA 4IMGA 4S2CA 3RU6A 4I7UA 2QUVA 3G1FA 1V5XA 4DO4A 2J27A 3C2OA 5C6MA 3TXVA 3FS2A 4G1KA 4ADUA 1FX6A 1SO4A 2QCDA 5CG7A 3N73A 4N6EA 1X8FA 1FWNA 4RX0A 3TW6A 4IXHA 4DEFA 1ZAJA 2Z0IA 5G4WA 1P0KA 1HTIA 3GLCA 5FF0A 5TQLA 3L9CA 3NPWA 1OFDA 4DQWA 3W1UA 3L2IA 3C56A 4MPQA 1KM6A 3MMTA 3KRUA 5HUOA 3S5NA 2R8WA 4M19A 4A21A 2OMAA 1XM3A 1R47A 5FEXA 4L4MA 2B7PA 1XUZA 5G1TA 3SW6A 3KRZA 4MFDA 1H60A 3U8GA 1SO6A 3NQFA 5H91A 4ZL1A
chains in the Genus database with same CATH superfamily
1XW8A 1ZAHA 3BJFA 2FJUB 3N25A 4X3ZA 2X7WA 1FBAA 1GOXA 4QNWA 4IIFA 3NXFA 4TX8A 3MI3A 1NWRA 1ELSA 2EJ1A 1XKYA 2XIIA 3CL8A 3UJEA 2ZA3A 1BG4A 4U3AA 4V27A 1HJUA 3MSRA 7CGTA 2QCNA 3E49A 4F9JA 3FX4A 2VEGA 1N7KA 2QAFA 1BGAA 4MKVA 4M3PA 1CYGA 4Q32A 1GUVA 4IISA 2HVMA 1H7NA 2OX1A 1SZRA 4KFNA 4L56A 4ERIA 3ARSA 4Z1BA 4UNLA 4IQLA 5A6TC 3C4UA 1GQLA 3LPFA 2DZTA 1X39A 3I3EA 1HKIA 4NILA 1WXZA 3VA8A 2Z1WA 4JL1A 2AGKA 3AXHA 4FIRA 1H62A 4C6MA 2YLAA 5T8GA 5D8ZA 1YTKA 1VPXA 1DORA 2CLMA 4U5KA 1UD3A 3HB9A 4V15A 1W31A 3W7MA 2R82A 3KDNA 1UROA 1BVNP 4MJMA 4BWLC 1H0IA 3EKGA 3IIPA 5E1QA 2PZNA 3GVQA 1JRBA 2EPHA 4PRWA 2GGIA 5FL0A 3NO1A 5LSMA 3LNMA 1QR7A 2WK2A 4WHBA 4ZGYA 2D20A 1UJQA 2C71A 3KUMA 3VNMA 4DJFA 2ZRVA 4GVHA 3DAQA 3DHDA 4EP8C 2A0NA 3A4JA 4HNCA 2ZE3A 1I8JA 1KLYA 1UCWA 3SZ8A 4LUTA 2BHYA 4MM1A 1M1BA 4NVTA 2BTMA 1QOQA 1R2RA 1A53A 2W63A 1OX4A 5BRPA 4XK2A 3PBGA 4IUOA 1J79A 1XJBA 4K37A 5FSEC 2DP3A 5A2AA 4P7LA 1Z44A 1O68A 3CYJA 1O95A 1XLDA 1CT5A 3LV6A 3WFAA 4PSPA 1R3QA 4GH1A 3PM6A 3O15A 5BU6A 3CT7A 1B2YA 4CD7A 2XM1A 5HR6A 3O63A 2BWGA 4HZMA 4C7GA 4CU7A 3SY5A 3QYQA 2J74A 1U5HA 2YXGA 3LRKA 4AWEA 4DO5A 3O05A 3NDOA 4ALDA 2WHJA 2OLSA 3QN3A 3CV6A 3GFXA 4HVXA 1J12A 3N4AA 4X9YA 2XUCA 2EPKX 5G4EA 3CUHA 1FH7A 5JXQA 4H4IA 4XG1A 2E1WA 2DSUA 4AZIA 5HMEA 3KVMA 4L5ZA 4O0KA 2INFA 3L4ZA 2R1LA 1QT1A 1T0OA 3P93A 3TQKA 1DE6A 3T4CA 3UWUA 3SCTA 3BE7A 2XVPA 3L23A 4I9JA 2FFIA 3BG9A 3N2MA 5A1AA 5FEWA 1GOKA 1JDAA 3AIBA 4EPKA 2E3ZA 5CSYA 1XIBA 1OD8A 3GRIA 2OX4A 1RQHA 2NQLA 2XINA 1RXOB 3HQOA 4QIUA 4UB9A 4AIUA 3H26A 3O16A 2YSWA 1XQLA 3U48A 3TW7A 2DPEA 3TSMA 1G0CA 1RD5A 3LTSA 4DZHA 3N9RA 3IUIA 3M7SA 3R0KA 3QGKC 3UNTA 1X7IA 3LK6A 1JZ2A 3NQ2A 5EGRA 3WLNA 1FWAC 4XD6A 2EPMX 4L9YA 1E0XA 3H2EA 3U57A 1KRMA 4HA4A 4PB4A 4ML9A 1NF0A 4W85A 3CU2A 4L6HA 5AYXA 3P81A 4W89A 2E68A 1T96A 4DYKA 3HM7A 5LHFA 4UQAA 5CJNA 3VMPA 3GTHA 1FWJC 3WJYA 1DPMA 4HU0A 1MXDA 1GVYA 1P6WA 2F61A 1L6SA 2ZZ2A 2EPOA 5A69A 1E0VA 2GJLA 1IQ8A 2JBMA 1XBZA 3QVQA 2Q8ZA 3UR8A 2XSXA 5H1WA 4PB5A 4YYCA 4N42A 3OOQA 3GU1A 4IXXA 1W5MA 3W7EA 4DLMA 4PEEA 3WQEA 3WLSA 5MF5A 1R8LA 3GDMA 4FLRA 3VAVA 2VTFA 4WKHA 1KBKA 3LU2A 4OU1A 5TNVA 4IQJA 3EB4A 2X09A 3TTOA 5H8UA 3M5ZA 4K1WA 4DXVA 4PSRA 1LOLA 4O12A 1TPFA 1RK6A 1NVMA 4ZB2A 3VI2A 3AMGA 3WQPA 5FF2A 1JYWA 4WY0B 2Z24A 1EO7A 5AC7A 1EUNA 3AU6A 1TJ0A 3FA4A 3OQEA 4YL2A 1KFWA 3PBUA 1JVNA 2ESCA 1PIFA 4AU0A 1CB7B 5G2IA 2GGGA 1D3GA 1Q6OA 5HA7A 1C8XA 2CZDA 2FHFA 3TQ0A 2Y8VA 1P1XA 3D3FA 2VD9A 3CH0A 3QFEA 3S47A 2ZUVA 5D05A 3UCQA 3AYRA 4OBTA 3G24A 1P4CA 1ZNNA 1X7FA 4B5NA 1DWIM 3P3BA 3MYPA 4ADTA 1KNWA 1SW3A 5AKQA 1P0BA 4NZ1A 3INPA 3LHUA 3MI6A 5FSDC 3K1GA 4LNYA 1QK2A 5CPLA 3YPIA 4LXFA 2E0PA 3HV8A 3EDFA 1OEPA 1BKHA 2FHCA 5AFDA 2FGBA 2B81A 3W73A 2V0TA 1UZHA 1UD8A 2Z28A 2GJXA 3UXLA 1EKOA 4TR9A 5JH1A 1UWRA 3IV3A 4KFPA 4DNMA 4QXIA 1J01A 1O5QA 3PFRA 1UIPA 4AF0B 1IHIA 3FV9A 2GFTA 4WJXA 3VNLA 1TUFA 1UZDA 1W9VA 1XP3A 2Y85A 1A5OC 4XV0A 5HJLA 4AYSA 3KRBA 1V08A 3MY9A 4UZUA 3S6DA 4NX0A 1TELA 1U33A 4LAKA 4U3CA 4LCSA 1G9HA 3UW6A 2YOCA 5DY2A 1QWKA 1IYXA 3LTPA 4PUEA 5A8MA 1K1DA 3MSYA 4AXKA 1W9PA 1DJHA 2DH2A 1QO2A 3CMFA 3OLEA 4S3KA 5HPCA 4XD3A 4AW7A 1V3JA 1XC4A 4OQVA 3WQWA 2TODA 1V7YA 3C8NA 1SW7A 5TD4A 1OGGA 4U2YA 5F1UA 1C91A 3S1WA 5B7ZA 1YX1A 4ECLA 4W8AA 3V3WA 3TR9A 4Q8TA 3TVAA 1DVJA 3W28A 3CUXA 1W3KA 4GINA 3W2KA 5I07A 1JEZA 4U31A 5T26A 3GIPA 4CQAA 3W70A 3MDWA 3AJ7A 3CEPA 3EA2A 1L2QA 3D3AA 3WLJA 4CN4A 3AWNA 3UWZA 1HL9A 5I3IA 3H24A 3D6NA 1R3TA 4UTUA 1UUMA 2YZRA 2V68A 2JEPA 2QYGA 3OHIA 1KQZA 4H9YA 3PTQA 2XIQA 4UTTC 3E5PA 3FN9A 2FVMA 3MU7A 2H8XA 2G97A 3ZO9A 5DMMA 2HQAA 2PDQA 3UXDA 2QJGA 3QR0A 4RDZA 1WP6A 4MZ8A 2A3BA 5G5IA 3WK1A 4XKYB 2ALDA 3UPWA 4ZQCA 3EWYA 5FCZA 2WKGA 4F0LA 1EEPA 3DU0A 4PBFA 4QJ4B 2Y24A 3K8KA 4C1NB 4G2DA 4KCWA 4ICNA 3VD7A 2UBPC 2E09A 1GOOA 3KBWA 1W2VA 5A6AA 4HU3A 1LL6A 3AROA 4XAFA 1Q3NA 3CMJA 1TV7A 1VJIA 5GJPA 1QDSA 1T6MA 1J2WA 2BNJA 4GJIA 1PDZA 3FY1A 4YTRA 1Q6QA 2W4XA 4BY3A 3GM8A 2F8QA 1EX5A 5FF3A 1IXPA 3PB0A 1H49A 3VOHA 1CGTA 3BLIA 4DJDA 3MJYA 2CZFA 4AIBA 3H2FA 4RNIA 4Q4RA 3L4WA 3VFCA 5FJRA 2D0GA 2IS7A 3EWXA 4QQUA 3W2LA 1XSKA 1M7XA 4K7VA 3U2EA 4N6FA 3M1ZA 3VZYA 4H2CA 3B8UA 3GG1A 3ANUA 3BGGA 4MNKA 4A8RA 2IPGA 2CKSA 3RCMA 3VOCA 5HQLA 3IJ9A 5F4XA 4HPHA 2WMJA 4MKSA 3WDQA 4LANA 3WL0A 5KZMA 4NXKA 3VIOA 1TIMA 3ZMRA 2E5BA 3E38A 2C1GA 5HNUA 1XFBA 5B80A 1I2RA 4EF9A 2QF7A 1D9EA 3S1UA 2DGAA 1WKEA 4O16A 1WO2A 3S3GA 4PMOA 4C6NA 2WPGA 2C15A 2OKTA 3REQB 3T07A 1J6OA 2XGZA 4N2YA 3GKAA 1DWJM 1A47A 1OYBA 2BGQA 1A0DA 3TE9A 5PTDA 4EPEC 4P7QA 3TIMA 3QEZA 3VCCA 4F0HA 3AHXA 2XH0A 3LTYA 5DO8A 1CGVA 3SY1A 3H21A 2O9TA 3LQLA 1KR0A 4PBEA 1I6NA 3MO4A 4JFTA 4RNHA 3T05A 3T0CA 2CLFA 1NF7A 4KS0A 1F9CA 1ODUA 1EZWA 1C92A 2WANA 1TV5A 1T41A 1D8WA 2P53A 3WJXA 1X97A 4FOKA 2PEVA 3RN6A 5CBBA 3HV9A 3RLHA 3CIWA 1WZLA 3OTRA 4Y9AA 3H70A 2IPWA 4Y8EA 4GNJA 2GUUA 2RGMA 2FH6A 1SVDA 2A21A 1IWPA 3M0LA 2VEPA 3B8TA 1TX2A 4Z08A 3B06A 5JBEA 2XVLA 5EY5A 4HB7A 4L1GA 4H19A 1ZU8A 3SUSA 5DMNA 2PBOA 1HKKA 3UT0A 2GQAA 2IQ0A 4PTXA 4FSAA 4KBXA 2G3MA 3PBVA 3F4VA 4Y9MA 3GYCA 1GYLA 3FLUA 1TUXA 2XG9A 2DZSA 1RALA 4EPDC 2CWNA 3WF0A 4ZTYA 4A2SA 3MKCA 4Y8FA 3GKFA 5LA2A 4A22A 2PF8A 2XPKA 4H8HA 4GYFA 4F40A 1L6GA 1RCQA 4NYUA 1TPVA 1YDNA 2W6RA 3JZEA 4FEZA 3SQMA 1BWLA 4IPLA 3C2YA 1KA9F 4M5PA 1ECQA 4AB4A 4DWSB 1UA3A 3N6HA 3WYZA 3C0LA 5CAHA 2PGWA 1IR1A 2OU4A 3KDOA 3STPA 3HPAA 3RJXA 1UHVA 4AEOA 3BV7A 1XSIA 3GAKA 1W9XA 2XTKA 3GX9A 3DC8A 5H6HA 2HISA 3R89A 1VP5A 3JVAA 1C7SA 4OT7A 4LY8A 5ENLA 2JEQA 4R9XA 1XLJA 1SU5A 3FA3A 3ICJA 3G22A 4PTNA 4OBSA 5FEZA 1HJXA 1BYBA 1WDWA 4IICA 3I3BA 3ARQA 1L2UA 1IXNA 1NU5A 1JCNA 1E6PA 1S5NA 1E9LA 4AZCB 3EKLA 3WLKX 6XIMA 5I6SA 3EOLA 2DZUA 4ZSTA 2NXGA 2ALRA 1IXOA 1EX1A 1LOQA 3V16A 8CGTA 5EMUA 1O94A 1F6YA 4MUPA 3W6YA 2CFFA 4H6QA 4JQ2A 5LA0A 4J9JA 2PDJA 4Y6GA 2VELA 3LBMA 2J6VA 3ITOA 4D6CA 3CV2A 2X0YA 5F7UA 1XLMA 1I9CB 2GSEA 5GNXA 4DBSA 5J5DA 3RF9A 1AH0A 2R1KA 3V18A 5T91A 1MW3A 1KR1A 1LLZA 4KWVA 1ENUA 2QV5A 1PTAA 3W88A 4LB4A 1EFZA 3IIOA 2P8CA 4B2DD 3OLGA 3WF3A 1XIEA 3A3WA 3QPZA 1J96A 3GE7A 1WDDA 1A0CA 2WSKA 1XHGA 1H0GA 4HBKA 1NDYA 4RZ4A 4TVDA 2PBGA 5E6ZA 2PDNA 2P0IA 7REQB 3C0JA 3FXGA 2R9RA 4M6QA 4JIIX 3LXCA 1Q8AA 5AYBA 1SFLA 2CHNA 5HQEA 4AEEA 5IDZA 1HZYA 3CUFA 4RR4A 4S3FA 1O1HA 3A9BA 2QR6A 1OC6A 5A8GA 1V0NA 1SUXA 4LBRA 4DYEA 3NIYA 1JI2A 2ZUTA 3OB8A 4MMWA 3W4RA 4Z0SA 3OGSA 3PUGA 3LLXA 5E70A 4FXFA 3EXRA 2Q3RA 4LSBA 1F3WA 3RM4A 3URAA 1ESWA 6TIMA 3NPXA 3P60A 4GJJA 4UQCA 1LT7A 4XKMA 3UZ5A 3BSGA 4H1ZA 4WCJA 4D6FA 4JX4A 2DUAA 3MWAA 4ZB5A 3G3DA 3S5ZA 1DIEA 3VO0A 3M41A 5AYYA 1XRSA 4UTIA 3QPYA 3SRFA 3WQ6A 3HIJA 3ZJ7A 1UKOA 3G2GA 2P3EA 4TX6A 3VU2A 4IIHA 3H2MA 4H6RA 3U9IA 1EOKA 2Y62A 2TSYA 2XSBA 3BTNA 3EB2A 2PWUA 3IJ6A 1JFHA 1Z32X 4IUGA 2QCEA 2EKGA 1DJNA 1BVZA 3M6YA 3P82A 2NT1A 1DTNA 3CHEA 4MG4A 1F3XA 1GG1A 1LG2A 1G1YA 2G4JA 1XDJA 3WQGA 1RZMA 3BLFA 5A6SA 4J40A 1Q2RA 3HU7A 3TJLA 3LSBA 4OOUA 3DKJA 1AL7A 1XYZA 4QE5A 5DF0A 5EPDA 1A5MC 3QMSA 5FIPA 2F2KA 4LS2A 3WDIA 2GDUA 4KWWA 3DEQA 4L6DA 3TA6A 2V3EA 3FYYA 4I3GA 4JTGA 3VKCA 1QI5A 3ARTA 2XISA 4ZOBA 1FWBC 1SM9A 2BVDA 3U7VA 4URIA 5LNUA 4X9SA 4OJYA 2G3FA 4J2MA 2YW3A 4JOMA 1GTEA 3TOPA 1EWDA 3SCSA 4O50A 3R2GA 1OT1A 4TMBA 5LIYX 4TIMA 3GR4A 4AD5A 3GH4A 2QUMA 2ZXBA 3W02A 4R3UA 2F9RA 4ILSA 4L9XA 1YQ2A 4YN5A 3V5FA 3F7JA 4NJGA 2YBVA 3V7PA 2CWXA 4DIAA 1Y8BA 4V2XA 3QBUA 4M51A 3SFKA 4MWAE 1F3TA 4RDWA 3AJXA 3GUWA 4X61A 3CYVA 2V5BA 5L9FA 3EEGA 1WXJA 1TIWA 3TYZA 4O54A 3ABQA 4UFIA 4ZTXA 5LKYA 4FX6M 1E51A 2VC7A 3EDKA 4JYDA 1TKKA 1PSCA 1UH2A 1UW9A 2HNEA 2YLLA 3GC5A 1B9ZA 3ZR6A 1ZHAA 3B8SA 3TW9A 4P61A 3WH8A 1YADA 3NQVA 3OVPA 5DELA 3EBVA 1PPIA 2ZVRA 4GZIA 1TPC1 2EAWA 3KTCA 4ZB0A 3UZXA 4UFJA 4GYPA 1OC7A 1TPB1 2ASHA 4UTKA 3EGJA 2CHRA 3G18A 3RGTA 1AJ0A 4FLQA 4UOZA 4L4LA 1C90A 3TZFA 1JL8A 2WZMA 3TTEA 2Y5SA 4UQDA 1B5TA 5FF4A 5HBFA 4O1FA 1BSIA 5H8MA 2YGYA 3HZ3A 2Q01A 3AXXA 3RUBL 3SADA 3THQA 3SSJA 3NEVA 3GZ3A 3MSDA 4Q22A 1SSDA 4PUJA 2BFGA 4WD0A 3WNNA 2DU2A 3GW3A 4O1CA 2WXDM 3A4XA 5C2XA 4K38A 3TMQA 4K1GA 3RLVA 1DV7A 4ZOAA 4KWSA 4LEFA 2PRHA 2EBNA 4N9DA 1BAGA 2PTYA 1EF2A 2PSNA 1DJIA 1X1ZA 1ZPTA 2ZX8A 2W27A 1W32A 4B16A 1VCFA 5HANA 4IIGA 5LXXA 2DH3A 5BU9A 9RUBA 3H2NA 3I6TA 3DFTA 5JU6A 1GTHA 1QW9A 2XDFA 5FD0A 3S6OA 4IP4A 3KL3A 3LX9A 2XH4A 4ERGA 1R6WA 1QHOA 4CNOA 1H51A 3N11A 2BY1A 3BCDA 2FPVA 3AU2A 4AWSA 2QPUA 1A49A 1LLWA 3MQTA 5AHEA 1LP6A 4IJBA 1RBOB 2OGYA 1GPFA 1O5RA 3VZZA 4ZFMA 4FXJA 1QNVA 1TQXA 4NUWA 3Q37A 1PX4A 1VFLA 3K4DA 1JGIA 3VC6A 2J77A 1N2VA 3AHVA 3QFWA 4PCPA 3EWCA 2ZX9A 5CC7A 3K4AA 3R8GA 1F3EA 4F3HA 5JMUA 1W8SA 3O6DA 1W3JA 1V7AA 3TTYA 3BUVA 1E6NA 1ICSA 3E02A 1TTPA 3M5VA 2G3IA 4I5RA 7TIMA 1BTMA 3ITLA 3TA9A 4GCXA 3CV1A 4XIMA 1ZUAX 5C2GA 3HF3A 3B8VA 3NGFA 3ZWTA 3OBEA 1E6ZA 4JTDA 3STEA 3WFLA 3ISIX 1LG1A 2PDLA 2G5WA 3RPTA 3EDJA 3W25A 3WBYA 3ORWA 4MZ1A 1KW1A 1BFNA 1XBYA 4HIBA 4KEVA 3M44A 1HVQA 3OLDA 1B54A 4N9CA 1XLFA 3WD3A 3IACA 4ZQRA 1CX9A 3U5UA 3V0SA 2FLIA 3AYVA 3WDHA 3KVKA 3VMOA 4KRTA 5IFPA 2ZWZA 1YPIA 3NPVA 3THAA 1AMYA 1WDQA 3CM4A 3F1QA 3QOMA 4CQ8A 4GBDA 4GC4A 4F48A 1OFPA 2HK0A 2OWXA 2NQHA 1YTEA 3JU2A 2CXGA 2PDHA 4FNRA 3RRAA 2CLOA 3AIWA 4HK7A 3H22A 3GR7A 1L8PA 1Q63A 1KBIA 4PUNA 4UXDA 3EDDA 2V2CA 1FWRA 3CTLA 2VDIA 3GBEA 3NFUA 3CL6A 3OP2A 4J7RA 1PYMA 4HT3A 4LGXA 6ALDA 2VRQA 3M9YA 3QV7A 3E2QA 4RW5A 4C7FA 4UR8A 1POKA 3WH5A 1OM0A 1V02A 4RJEA 2Y63A 2FB2A 1ZP4A 3AMLA 3KTXA 4F2UA 5BNKA 3A3HA 2MANA 3L5LA 3PFMA 4D9PA 3FYPA 3ZR4A 4E8DA 3SQSA 1RVGA 4IJCA 7TAAA 2E5DA 2Z27A 5CPTA 1QW7A 5IM51 4MNMA 5EYWA 4MB1A 3W7KA 1UB3A 3W38A 1B9BA 4QROA 4S3AA 4OE7A 1BF2A 2WZTA 3A22A 2CBVA 1KCKA 2XVKA 4GGHA 4YVVA 2OOGA 3IRSA 2VGIA 4U33A 1ICQA 4M7TA 3STCA 2X7VA 2H6RA 1IIGA 3W7GA 5KINA 4O28A 3P0WA 4K3ZA 1KRAC 5K3VA 8XIAA 1QHPA 1V3KA 2J9YA 2CZVA 2J8TA 3DBNA 5FEPA 3NL2A 4S38A 1XISA 1TJ2A 3VPLA 5I77A 1HP4A 2EPLX 3L2LA 3SECA 2VX4A 2OQHA 4MFEA 3ABZA 3HG3A 1H1YA 1WB0A 4WY0A 4MJ2A 2V6AA 2FDMA 3NQ7A 5BOEA 2PRMA 3W27A 3T78A 4AAJA 4F0MA 1RPXA 1ZBVA 4LWWA 2J47A 3UESA 2E40A 3HG4A 3POHA 5FJIA 5LA1A 2AAAA 3V0TA 4MHBA 1K4HA 3UNDA 1ZGDA 5FL1A 1OCNA 5IDIA 3U5YA 1RBLA 2C18A 5HR7A 1QNQA 2HZGA 4GNKB 3W2NA 4GISA 3QV6A 3VDBA 4XX6A 5CPMA 3PZMA 3IGXA 1W2PA 4JY9A 1FWIC 4G7EB 3WH7A 1GZJA 4B2DA 5LIKX 4LCQA 4CCDA 2XN1A 3A13A 4JTQA 3NZGA 4JNYA 4JPGA 4YS1A 1ISZA 2D2OA 1XCWA 5D4YA 1TMQA 2P3ZA 4WGHA 3PK7A 2TMDA 3MBFA 3B0VC 2VFIA 3W74A 2Y88A 3PJTA 4V1XA 3E5BA 5J5RA 4DYJA 4Q7NA 2YFNA 2FGZA 4ZXLA 3G6MA 6REQB 2QNEA 3IS4A 3G1FA 1NELA 1V5XA 2J27A 3E0LA 5C6MA 3VGFA 1QPKA 4ATDA 1LL4A 5H8PA 1CTNA 2W67A 3VDAA 3GQYA 4N6EA 4RX0A 3TW6A 2Z0IA 2ISFA 1YDYA 5TQLA 2GGHA 2P76A 3NPWA 1XLHA 3C56A 3KRUA 5HUOA 4M19A 2YL9A 1B3WA 2QZRA 4DM1A 4DJDC 3KRZA 4MFDA 1H60A 1XYLA 3A47A 1SO6A 1IE7C 4IFRA 4ZL1A 3OGVA 4GY1A 2XN0A 2F6KA 4Y90A 3ARWA 4DAIA 5LYRA 1TFVA 4J3ZA 2E6FA 1KBLA 3SRHA 3AC0A 4NX5A 5GNZA 3W7QA 4O4WA 4H9UA 3L65A 2G96A 1J5SA 2R1NA 4AIEA 3GXTA 4JIPA 2IKGA 4KRZA 4Q8PA 2PWVA 3OHMB 3O0KA 5A3HA 1T40A 2VC5A 1THFD 3G1SA 5D9MA 1EJTC 1TWDA 4DZ5A 4J3XA 2ZC8A 1VFOA 1DEDA 3FVMA 3Q94A 4DY1A 3SDOA 3BVJA 1AQMA 5BCAA 3ARXA 3BAIA 2IXUA 4NJIA 1GOIA 3UU0A 1OGSA 1J0HA 5K4XA 4OIFA 1UG6A 2X0SA 2NUXA 4QCEA 2XSAA 3KL5A 1EP1A 4AZBA 1RV8A 1PAMA 2NQ5A 3KWSA 3VNZA 5JIWA 2I17A 3U4AA 4DJEC 3MMDA 1E1CB 1G94A 2WC4A 3G0UA 4IIEA 1EQPA 1US2A 4XKYA 2DUXA 3POCA 2QUUA 2ZUUA 1AUSL 1GPWA 1UD2A 3T0TA 1NH6A 2ABAA 5CZ0A 1N8IA 2YCLB 2F7FA 4QJ1A 5HULA 3ZLGA 4C1NA 1R9XA 4CEXC 4S3BA 3LDVA 2XM2A 3GG7A 1CWYA 1I2QA 2CPUA 4UFKA 2OLAA 1MXGA 5DFAA 4MWAA 1UIOA 2VM8A 3MP4A 4K7YA 3RCNA 3VKKA 4PTVA 3FDKA 3BMWA 3WEZA 1L6FA 3T7VA 3TYAA 1UR9A 3VDHA 1J5TA 5F2GA 4DUVA 5CPOA 4DF2A 1T5AA 3LMYA 4IL0A 5C54A 5EMKA 1I1WA 3SBFA 4QSHA 1V0KA 2GQ9A 2W3ZA 3IANA 4HCDA 1AW5A 2E1DA 5I78A 2QCGA 2Y5JA 4MSSA 2Y2WA 2VR5A 3MTWA 1R3WA 1VJZA 1DOSA 3OQ8A 1XPYA 5I03A 3DENA 3PANA 2VFEA 3DHPA 3CQ0A 2ZADA 4E8GA 5FESA 1C29A 1X96A 2DJXA 4FK9A 4J3WA 3U7BA 4JQ1A 3AMKA 1ZJHA 3WF2A 3HGJA 4O8AA 2OJPA 3H2CA 4IX0A 4CEUC 1WOAA 5FI8A 1GJPA 4DF1A 1ISXA 1SZFA 1QK0A 3REQA 4A2RA 5AB3A 2OZ8A 1JD7A 1NM9A 5F2IA 3OZOA 3UVAA 5C5YA 1R30A 4CCCA 3F2BA 1P7TB 1DBTA 2PCQA 3DI0A 1XGEA 4TXEA 1Q85A 2X30A 5AOUA 1TTQA 4DM2A 1KKRA 2OELA 3RYSA 3MUIA 1ZQ5A 2EKCA 3VNKA 1FFRA 4AG0A 4HCLA 1VZWA 4GK8A 2VHLA 5K2ZA 4CD4A 4DUWA 3NJ3A 1LQ0A 3LBCA 4HJWA 1YBQA 1GZGA 3IUDA 4MYAA 3ZQ9A 2PU1A 3R94A 2UZ9A 3GNPA 3OW1A 4MDOA 1PBGA 3APYA 3GSMA 4HMNA 4MY1A 4IJRA 2ZDRA 4X60A 3GG8A 4FLOA 4ADSA 3M16A 4OZOA 3NOEA 4WUIA 1JNDA 2DVTA 3H54A 5DEZA 4LNCA 1V6WA 2V5CA 1JAEA 5I3HA 3BOLA 1DIDA 1PZ1A 3P0XA 2P0OA 1QPQA 1JPDX 3A3XA 3NGJA 4CKQA 2QGHA 3S46A 3LG3A 3UJSA 2CESA 4C6KA 3R12A 1JPHA 3W82A 1XF0A 1H7RA 2VP8A 2ICSA 1NQKA 1RLDA 2QDHA 1W3IA 2JIWA 4DVOA 3W22A 1Q6EA 4GE8A 3WN6A 4IIDA 2PDWA 3ZM8A 4CD6A 1P6CA 4LVGA 3CJPA 5IFTA 3QGVA 4I5UA 3RX2A 3ITCA 1SFJA 3R13A 2ZKMX 2HRWA 1V77A 2VUYA 4LAUA 1JQXA 3NNTA 2XZ9A 4M29A 4REQA 2GK1B 4CU6A 5M03A 1GJWA 1RA5A 4JTEA 5CJMA 1HXJA 2FZMA 3TC6A 1A3WA 2VKZG 2IW0A 3QQWA 1IZJA 3B03A 5HJYA 4LVBA 4QCFA 3TROA 2AL2B 3LY0A 3SURA 5AHMA 5A8OA 2YA2A 3N14A 1FXPA 3AMCA 1WX0A 5CPSA 5A95A 3I6EA 2BOEX 3TSBA 3LPOA 4D71A 3K30A 2PA6A 4QNEA 1HO1A 3FEQA 3B9AA 4GUFA 4ZQNA 1SJAA 3NZRA 2QV4A 4AZCA 4CNSA 2YBUA 1QWGA 3TNBA 2Z25A 2YB1A 3W75A 1TO3A 2YCIX 2VRJA 3CGTA 1DJWA 3WSUA 4ICMA 3FJ4A 3JRKA 1A50A 4LEQA 1ZRQA 4GIRA 3BGJA 1JPIA 2HTMA 1ZBWA 4NT0A 3IWPA 4XO6A 1NOFA 1UD6A 4D6GA 3GU2A 4AD3A 1XRTA 5HATA 4GACA 4GO9A 3ONBA 2VEIA 3R8RA 1IEQA 4IFKB 2HBVA 1W0MA 1OG0A 4PN2A 3RIKA 3VKJA 2R1MA 4WJEA 1RJQA 3T0AA 1H7WA 2QCDB 2WNQA 1VFSA 3WQCA 3KOZA 2VWSA 1NQ6A 3G3MA 2GUYA 4PRRA 4PE8A 1GKQA 3S2NA 4MPKA 2I16A 3LS9A 7REQA 1OK4A 2PDCA 3K1DA 3R0UA 3XISA 1FCBA 4Y9OA 2QIIA 3FCPA 3HPXA 1H7OA 3OIXA 1F07A 1RK5A 3UYIA 4EXAA 3KZSA 4O0QA 4RXFA 5DRIA 1XYFA 1E40A 3U6WA 3M0KA 1O60A 2F2HA 1UMLA 3QHMA 1LLOA 1EC9A 1V4YA 1K70A 4AD1A 5D2XA 3F4DA 2OCZA 1EL3A 4KT2A 1MO0A 2WBGA 5DMYA 4GQQA 2PGRA 1R86A 3V36A 1JZ8A 4UC5A 5ABFB 1BEUA 2PODA 2CLHA 3PBWA 4EPBC 4IQDA 1WZKA 4GCAA 1ICPA 4MJZA 2PMQA 2V3FA 2I5IA 4QITA 4QRNA 4R27A 4FALA 3GDLA 4QSFA 4D8ZA 2QAPA 3H23A 1W3HA 3BLEA 3P5YA 3OEXA 4G8TA 4D8AA 2XWDA 3GNOA 2VI0A 4BR1A 3BV4A 5A94A 4W7UA 4FS9A 2DZWA 2X8RA 3DC0A 1R7OA 1PO9A 4HYWA 1F6PA 4QDPA 3EWZA 1TE6A 3EXSA 1JZ3A 3R4IA 4L6OA 1WA3A 3WLQA 1F74A 1KCZA 4NI8A 3KS5A 2H3BA 3MUXA 1ML1A 5GPRA 1JCMP 5J04A 4O15A 1RA0A 4E4UA 1YMYA 5HNTA 3RNDA 1R9YA 4FX8A 4WF7A 2E5CA 2VRKA 3A21A 3NQMA 2A3HA 4R9OA 4S3JA 2VZOA 5ECVA 2O0TA 3AS3A 1TPH1 3GHSA 4HMDA 2GJPA 4PCSA 3F5LA 3HPFA 3P7YA 4HU8A 3KEHA 3CHCA 3QV8A 4M80A 2G95A 2O56A 2DT1A 3ABOA 3BOXA 3WH9A 1H1NA 4HOWA 3HO8A 1JZ4A 3N2XA 1GOQA 5C9XA 3IAPA 2CBJA 4ZEPA 1LZOA 1Z42A 2OG9A 4ZFCA 4BHYA 3R43A 1W1VA 4QE4A 5D38A 4UFHA 3LBOA 2VUNA 1K8ZA 2Z1VA 4K68A 2X1RA 2BP1A 4C6QA 1H09A 2HE5A 4R7OA 1ME9A 3DESA 2OT1A 2OO0A 4EX4A 3NL3A 4Z1CA 4KWUA 5E5CA 3BH4A 4L9ZA 2VFDA 4J3TA 1IZKA 3KE0A 4Z17A 2VFHA 4S39A 4R7WA 2WCAA 3VE9A 1UWAA 2PDFA 3EPNA 4IMEA 1JZ5A 1HKJA 1Z6KA 2O7QA 3U2OA 4WOZA 1XI3A 3WK2A 3GXPA 1FWGC 3KXQA 5DY3A 2WSQA 4UR9A 3A4WA 2J24A 2WVSA 3UGVA 1XYAA 4R85A 5CZKA 1EF3A 2Q8XA 2WMFA 1Q6GA 2BLEA 2QDDA 4XZ9A 4YCOA 1E1FA 4GHRA 1RAKA 1ADDA 2DORA 5I3FA 1TVPA 3ZJKA 3ZT7A 3WENA 4EE9A 3GBDA 4WGXA 1SO3A 2C13A 1DIKA 4TO8A 1SZEA 3L21A 1BHGA 2IQTA 3SUVA 1UC4A 3QLDA 1XUUA 1I0DA 2GQ8A 2QULA 4JN7A 5AHIA 1Q2SA 2BODX 3T1GA 3UQNA 3SCOA 4UR7A 3IK2A 5I79A 4UTHA 4MOZA 1E3ZA 2ZA1A 3KP0A 4GY0A 1AJZA 1DE5A 1JDEA 1WDRA 1I2NA 4UNKA 3SGGA 1UWTA 3T2QA 4PH6A 3VIGA 1BQGA 1NAL1 2RFGA 2PDXA 3WDRA 3LENA 1SMDA 2EXOA 3BG3A 1UD5A 3GU9A 2KX9A 1IWBA 1NEYA 3HOJA 3IVTA 3N6QA 2WM1A 3CNYA 4ZBCA 5HK4A 1VENA 4RDYA 1WPCA 1EYEA 1QU4A 2ZVIA 1YDOA 4A3RA 3FAWA 5C7HA 4JTUA 2PTXA 1XH0A 4WOQA 1BGGA 3W1AA 4ZE4A 3EX6A 3VFLA 4AISA 1PIGA 3H4WA 4TX9A 1M6JA 2DZAA 4IMCA 3GTFA 2TPSA 4IQEA 1OWQA 1Y5WA 1LOSA 2RJGA 4OGZA 3ZOAA 1S1RA 2ZICA 4MJ4A 7ODCA 4LOCA 4E0CA 3KBVA 2ATSA 3NYDA 4JQ3A 3A64A 3V0UA 3BWWA 1F61A 3IPWA 1KO0A 1TE1A 2QUNA 1BXNA 3S5SA 3AQUA 1DJQA 1VIWA 2EQDA 4BA0A 4DI8A 1M04A 3SUTA 3APTA 3HJZA 4NQ1A 3CIXA 4HZ6A 3TK7A 4W8LA 4WEVX 2J9XA 1ZJIA 2PWDA 3ECQA 4F4RA 4JAWA 4AD4A 1JAKA 2WV8A 4UTJA 2FMNA 4FPSA 3OG2A 2RDUA 4ZE5A 5KMYA 2VEKA 3LA4A 1V3HA 1JYXA 4PFMA 2XFRA 2E6DA 3CAQA 3LZ3A 4JFVA 2IPJA 3KCOA 1W1TA 4XO7A 4A3UA 4Z1AA 4YCPA 4LPCA 3U2CA 1BWVA 3IGSA 4B90A 3BLPX 1IWAA 1QNSA 4UWMA 3ZZ1A 2AQWA 5LIWX 1TCMA 3FGCA 1JG9A 1HKMA 1F4HA 4GUJA 4O1BA 2OYMA 3GTNA 4J3SA 1ISVA 3WMLA 1U1JA 1ZTVA 4QX4A 2EGZA 2VOMA 4QLLA 3LHVA 5T9BG 4KKXA 3VIPA 4Z2KA 4K8EA 2PDYA 2QW5A 3JS3A 5D09A 3AS2A 1I0BA 2E9BA 4DRSA 3EOEA 3MT1A 1XICA 4JTRA 3MHFA 4JHZA 3WDPP 3RU8X 2X05A 2P5NA 3V4BA 1XFCA 1GQNA 3CH9A 1AG1O 1RBAA 1CGYA 3F5KA 3A4AA 2PC4A 2NT0A 1I2PA 1EJXC 1VCVA 1W6TA 1NDWA 2PE4A 4KEMA 2PAJA 3IGUA 1PL9A 4Q4SA 3W7JA 3IJ7A 2Y8KA 1WDSA 3II1A 3RPMA 2O9OA 2IXVA 3ZVHA 4JHOA 4AZGA 1GVFA 5M5DA 3ES8A 4QAWA 2OZ0A 4JX6A 2NLIA 1LROA 3SUUA 1C8YA 1ZZMA 4PBGA 4ZENA 3U4FA 2HS6A 3ZIZA 1FWFC 5C7VA 3C8FA 3CL7A 2WW5A 1SPQA 3KWXA 4ZO9A 2VC6A 3UZZA 5FJUA 1HP5A 3MDUA 2FHBA 1QATA 1XCXA 5CC3A 5U4NA 4S1FA 1BRLA 5EMMA 4JIRA 3KVLA 4F66A 2HWGA 1WQ5A 1OHLA 1QNRA 2NWSA 3M47A 2HVNA 2AMGA 3GK0A 5L6UA 2X1SA 4UQBA 3S9YA 3FOKA 4YLWA 3PB2A 1OINA 4P8XA 3BMXA 4G9PA 2FTYA 3IIVA 1RCXB 2Y8UA 3ANYA 4TOQA 1TV4A 3SCWA 3Q2DA 3EWWA 1WAWA 2GGEA 5K9XA 1QNOA 3SAZA 1LRTA 4PGLA 2ZX5A 4GUIA 2GYIA 4GFIA 1OQFA 5HUPA 4TV6A 1E4LA 1TR9A 3A9IA 1DP0A 3TYUA 1XLBA 4H04A 4XAYA 3I68A 3WLRA 3ZFHA 1CGUA 5IOBA 4LUYA 3GFYA 1FCQA 2ZXAA 4HU4A 4AZ6A 1TVNA 5C70A 1S5WA 4LRSA 4XIAA 4H9XA 4IP7A 2JALA 3EZ4A 1W9UA 2VCCA 2Q02A 3LD5A 1OX6A 1TZ9A 1B3VA 1WYIA 4RUBA 1K8CA 4E2OA 1YE4A 5EMJA 1W1IE 3N9KA 1V93A 2ZRUA 1EP2A 2HDJA 3MUAA 3DGRA 3WLPA 2ZBTA 4HPGA 3PN8A 5D37A 1OCJA 3N9SA 4C91A 5I5RA 5BROA 4XQ6A 1K3UA 2J62A 4G7EA 2WYSA 4QS6A 2Z2BA 3OVRA 4LAMA 4HMCA 1DJGA 1GT8A 3QXBA 2VGGA 2DSVA 1QPNA 2V38A 2W9MA 1UWSA 3UXKA 1EJSC 2PDBA 4PCFA 3ABSA 3GZAA 1W3TA 4F0RA 5H2ZA 3LI0A 1TWIA 4FR1A 6REQA 3VOJA 3DN5A 5EMLA 1OD0A 1Q7MA 3WQVA 3ATYA 3VD3A 1F05A 3LXAA 3ZVIA 1IEXA 1V3MA 4HNOA 3HGRA 1BTCA 3FJNA 2WC3A 1GHRA 3FKRA 1OC5A 3CHVA 4XZMX 4PTDA 3XIMA 4JTFA 4GVIA 2J66A 2WKJA 3V35A 1Y0EA 4MWAC 4AVFA 4RV8A 3FHAA 4DXKA 2UY5A 1VYPX 1X1NA 2FZNA 4E38A 2Z1KA 1B3OA 3WEMA 4RE4A 1GQJA 1E4NA 4LYQA 1JFXA 3MI2A 4LVAA 1UUOA 3TYEA 4POCA 3LHTA 3CAVA 1Q6FA 4GI4A 1VFUA 3BQ6A 3HTWA 3TN5A 2WQDA 1RY0A 2V2DA 5KTLA 3CB3A 3L2MA 5AC6A 1ONEA 3BOFA 2E67A 4ROPA 1UWQA 7A3HA 4BKNA 2E6YA 4DZIA 3ALFA 4DO6A 3AAMA 1FWCC 3CO8A 1IT0A 1A5CA 3LGEA 2JQXA 4BJHA 4P8VA 3EDEA 5G1YA 4DB7A 3LCLA 4BCEA 1ZS2A 4I90A 3QTPA 3RXZA 1MMFA 4WQ6A 4KCVA 2XHYA 3BAYA 4JXCA 3TQVA 5BMWA 4RZ6A 4WKAA 4N9EA 1ZAIA 1X6NA 1DQXA 2Z1BA 2CERA 4HD5A 5C8BB 3B97A 1GVSA 2WKLA 1PX8A 3GDRA 2D22A 4KCUA 1CCWB 4FMVA 1J9YA 4CVWA 1RVKA 5U7SA 2XGBA 3WMBA 2PPGA 4NZ3A 3S5YA 1HJSA 4B9YA 5A8PA 2PLJA 4Q8WA 4YTUA 4W93A 3G1XA 4HNLA 3HGSA 1LWJA 1M65A 4JTKA 3UYCA 3EA3A 4BWLA 4ZXOA 5HMSA 3EKZA 4PMUA 2DT3A 4GO8A 3ELFA 3K4WA 2P88A 2QMJA 2ZUSA 3N18A 4MLJA 5MKGA 4CD5A 1VYRA 1EJRC 1DWHM 3VXGA 1VS1A 3WNMA 4H8UA 4M0XA 4DPPA 2CNCA 1KB3A 4LAZA 4N4QA 3I10A 3P67A 4NZ4A 5AC5A 3W71A 5F2MA 4Q4MA 4JR5A 3MA8A 4F79A 5EMYA 2BBFA 4DX3A 2QHAA 3QV9A 5FF7A 4YTSA 3LHYA 4QTGA 2YZ5A 1VGAA 1NWTA 4X2RA 4S3EA 3LEPA 2POTA 1QMLA 3N29A 1L0PA 1QNPA 2OWWA 1EGZA 3W7PA 1PX3A 4PUWA 4FP1A 1EBGA 2WZIA 3HURA 4HN8A 3MKVA 3LHWA 1JYVA 5HWJA 3BO9A 1TMLA 2WJFA 1CXLA 2HBXA 4HSNA 5CGMA 2ZTJA 8A3HA 3HPSA 3COTA 3OZPA 2WQPA 3F03K 1WKYA 4WK9A 1TV8A 1R3RA 4A3HA 1GVIA 4RL3A 3MANA 3NL5A 4Q8NA 3SJ3A 1S5TA 3NURA 4I9MA 4FLSA 3TJIA 3BARA 3DI1A 4LV4A 4U5IA 2A6NA 4ACYA 4RXGA 2B4GA 3KX6A 3W1XA 1T8QA 3OYXA 4PCNA 3G6LA 3E74A 1FH9A 4DBDA 3DYPA 2A7NA 2A3LA 4QM1A 1R7AA 4CUCA 3NR0A 1F4AA 1QXLA 2YL5A 2XIJA 5AYZA 4WLCA 2EF9A 1Q8JA 5IHRA 4B4HA 3O1NA 3NSMA 2CBUA 1KBJA 3SO7A 1DJZA 1P7TA 1HKVA 1TMHA 5DX7A 1V3IA 2C7FA 2A3AA 3VTRA 3GHTA 4LT9A 3HFYA 2NXIA 5K7JA 2PDIA 4N7QA 1HX0A 3EPMA 3WELA 3N2BA 3SCUA 3DGBA 4NJKA 3R11A 2YPIA 3UBPC 1F7BA 4MY9A 2QCCA 1QI0A 1KFBA 2FTWA 1CB2A 4Q33A 4RW3A 4A29A 3W87A 1NP2A 3USBA 4UTFA 1DQWA 1M9HA 2WMGA 4K36A 2J78A 1L6YA 1RPKA 4AHOA 2WNNA 2X16A 1KTCA 3H12A 4W87A 3B8WA 2DSKA 1OIFA 2PD5A 1ZENA 3N13A 1FHVA 4YXGA 3TC3A 4GI9A 4CQDA 4PMQA 2GJXB 3M0HA 4LYKA 1UUQA 2DW6A 3KOFA 3W26A 5BZAA 4HOZA 1HW6A 4C60A 3BSHA 2R6OA 1WKFA 3W29A 1R3SA 2GGJA 4LYRA 1RLCL 1OFOA 3B0UX 2VR4A 5JBFA 1REQB 3UA4A 3WFZA 3AXKA 3VMNA 4HKPA 4G1NA 2RDXA 4GUGA 3DYMA 3PF3A 3GH7A 1PV8A 2XFYA 1MI3A 4J4KA 5IBXC 4A05A 3NEHA 1AJ2A 3UR7A 3R0DA 1XPGA 3IUHA 3WJSA 6ENLA 3GTIA 2MUCA 3IIZA 4MB4A 1SZGA 3LCHA 3BICA 4LRTA 4RV3A 3NQEA 1H11A 2YXXA 3WJZA 2ABBA 4UCFA 1E9IA 4R33A 1FA2A 5DT5A 3D0CA 2GK1A 4IGNA 4Q8UA 4P2VA 1JCTA 1FP9A 4O11A 2EPNA 5D9NA 1MQRA 4GZJA 3G1VA 3C2FA 5ABEA 1CI1A 4O53A 1EA0A 1JCJA 1AH3A 1AA1B 1T7LA 2ZA2A 1XLEA 1V3LA 1EOMA 1VRXA 4L65A 1J0ZA 1FHLA 3A24A 2WVVA 1NOUA 5EA9A 4R53A 3C2VA 2NQ9A 3NUKA 1G4SA 1PKMA 3N2CA 3UXAA 1E5JA 2B7QA 3NPUA 4RPPA 2PC8A 2FTPA 2V5LA 3W9ZA 3GXIA 1DKWA 2ZZ5A 4JS3A 3DFPA 1H7PA 5A6JA 2W61A 3BW4A 2NX3A 4E6MA 3CUZA 4JTAA 1I4NA 2ZUWA 1KXVA 4H6KA 3VX0A 4R5EA 2FZDA 1ZCCA 5E09A 4OECA 3TDFA 2PWEA 3CIVA 2FFCA 3R10A 2AMXA 1QI3A 2QUVA 5HNNA 2VL4A 5IXEA 4GVFA 2FKPA 4KGJA 1CIUA 2PB1A 1GEHA 4D72A 2DZBA 3VGGA 2A3EA 2QCDA 1NIUA 5CG7A 3FAXA 1X8FA 2V63A 4GNVA 3VIHA 5HXMA 5G4WA 3GLCA 4GA8A 3PJUA 2B31A 2WSPA 2PWHA 3L2IA 1P48A 4DHGA 1JXKA 1OBAA 2C0HA 2VX7A 1MFUA 3WQDA 4L4MA 2B7PA 1XUZA 4QR6A 5G1TA 1W8GA 3U8GA 3NQFA 2PF0A 3B4YA 3PTDA 4ONVA 1VFTA 3G5EA 2CLIA 1J11A 1M53A 4DF0A 1G4EA 3GIYA 4F0SA 1ISYA 1XLLA 3C52A 1KM3A 3WUEA 4GYJA 2PLKA 2PS2A 4UMBA 5G1MA 2VVSA 4XSMA 5IRPA 2EJAA 1H3GA 6XIAA 2FZ8A 3TYDA 1E6QM 3HG5A 3RK8A 2VFGA 2D0HA 3T9PA 4B5VA 1A5UA 2NVAA 5ABFA 3OODA 1HJVA 4HHPA 1TX0A 2QCLA 3VYLA 4C1KA 4Q4KA 1OF6A 1WBJA 3S2LA 1GHSA 3O6AA 3CTTA 3VKAA 2PTZA 4QG6A 4W5UA 1O12A 3QMRA 4CQCA 5DT7A 3UXIA 4N4PA 4RZBA 1QCWA 1SW0A 1NDVA 3VX1A 2NQZA 2DSZA 7ENLA 4FXSA 1A80A 4LYPA 3SGUA 3WF4A 5C0QA 5D02A 4D6DA 2KZHA 4B3KA 4P7OA 2X2YA 3BJTA 4EKJA 8TIMA 1B0IA 3L66A 2J7HA 4J2PA 4V33A 4Y2WA 1MEHA 3S42A 1ZP3A 2WJDA 3W01A 3W23A 1Q4WA 4IPJA 1IT7A 1QW8A 4Z2GA 4UIOA 3L7RA 5EL1A 4TU1A 3OYZA 2RUSA 1UBSA 3TNOA 3O3RA 2J7EA 4P8UA 3FDGA 3ITGA 3NAVA 3THUA 1D2KA 1TQJA 2Z2UA 3LERA 1CNVA 4QDMA 4I8YA 2O92A 4PMXA 2WMIA 3C0QA 2OLHA 3WDJA 3MJMA 1FDYA 1PXGA 2JKEA 1Z89A 4XAGA 1KM4A 4ICCX 5D2TA 1R2TA 1UZ4A 2BXVA 1XBXA 3TTSA 4J1OA 3FYOA 4PEKA 1R87A 5MHBA 3KOYA 1ITQA 3G0XA 3KVJA 5XIAA 1PB0A 1FFQA 5BW6A 2V5JA 1TA3B 2Z4GA 5E6YA 2ZX6A 4FAMA 5EFFA 4GQRA 1ZY9A 2ZIDA 1E3XA 4O1AA 4ACZB 4R34A 1US3A 3W86A 2VVNA 4UZSA 2WJZA 2PU0A 4JTIA 2YKKA 4PFHA 2GDVA 3GNNA 1PEZA 5A2CA 2PD9A 2G37A 3PUOA 3GC2A 5D04C 4IM4A 3LRLA 2FPTA 3WUFA 3W6MA 5I09A 2ZRXA 3VC5A 3QC0A 2GLKA 3PNZA 4UFLA 3PPGA 5D33A 5LGZA 5C9UA 4CQBA 3PNUA 1W1B1 3LV5A 1RJPA 3Q65A 1AFSA 3SB0A 1VFMA 3DFQA 1K7XA 1EGVA 1GQIA 2Z6IA 1U5JA 4W8BA 3H53A 3LMZA 1V02E 4BF9A 4CN1A 3GB6A 1ISWA 3UVIA 5AHFA 2DY3A 4XBJA 4D1JA 3VKBA 2QJJA 3DFSA 3L0NA 1TB3A 3TONA 3MHUA 3F4WA 4WXZA 2QLYA 1XQKA 1B3XA 5BWFA 1KLZA 3PTMA 2PDUA 1H4PA 2PGFA 2WAGA 4ZO7A 4XTDA 1DXEA 2NV2A 2QS8A 3LHZA 2C14A 3SIMA 1U30A 3HPZA 4B4FA 3TUUA 3W84A 1VBGA 4TVCA 2WZEA 3SIZA 3I6RA 4W5ZA 1PWMA 4ZOEA 4FA3A 1XC6A 1ADOA 4JCMA 3DHFA 4IMAA 4WDXA 1JXJA 2DJLA 1K6WA 4YTQA 2XFWA 1G5AA 2ACRA 1D3CA 2ZWYA 4TQTA 4HPNA 2HSAA 2V8ZA 3EPOA 3O9NA 2YR1A 1OG6A 3EWBX 3K46A 1A4MA 1MRQA 4M1RA 4XZBA 2ONEA 2H9AB 3WK3A 5ABTA 1VR6A 2D3LA 3ID7A 4Z2LA 3FHQA 3U2ZA 1J4EA 2X1IA 2J6XA 4O14A 4GOAA 4OVXA 3VOFA 4CCZA 5DBUA 2GL5A 1FWEC 1LL7A 5BRQA 3UCCA 2ON3A 4FF7A 1S3HA 5CXPA 1VCGA 4C6IA 1EPXA 4HPXA 3A6OA 1KFKA 4C90A 1W91A 3P6LA 4QBXA 1JDFA 1JF5A 1ECEA 4NNAA 1UH4A 3B8DA 4Q8OA 4GRSA 1OGBA 1JPKA 3HGOA 3PSWA 3IK4A 1R9ZA 3NSNA 2CEQA 4WXYA 5JBDA 1BYDA 3EOUA 2GUBA 2WSYA 1G4PA 4RE3A 3F4NA 6PTDA 3UWWA 1VJSA 3ITXA 3CO4A 4K39A 1QOPA 3ARVA 5JQ9A 1W17A 1MEIA 2Y7GA 3LGGA 3VUSA 1BKSA 3VD5A 4PYSA 5BOFA 3SSZA 3IV8A 1VYSX 4LUJA 4Q8MA 1RP9A 1WXYA 4KRUA 2C3ZA 3LCFA 3AYSA 5DMLA 3EAUA 3I7SA 2FQIA 4FB7A 1UR1A 3S6TA 3S2MA 1LT8A 3FJ6A 5KZDA 4PA8A 5CLWA 4KQNA 1LYXA 1VBRA 4FOUA 3A12A 1M41A 2MNRA 4QLJA 2ZCGA 2E8YA 3F2DA 3PZOA 5FOOA 3UWEA 2CZ5A 4CQ9A 4GWEA 1QPRA 3I4EA 2A6LA 1V79A 1UA7A 4GJ1A 5KEZA 2IKJA 4IGSA 3W7RA 3SN4A 3S1VA 2GVYA 3WUBA 4GY7A 4ZR8A 2INEA 5DQPA 1QJWA 4AQLA 1J2BA 1C93A 1SFTA 2BHUA 3ZJ8A 3RDKA 2QJMA 3L4TA 4ZVJA 1Y5VA 1KCXA 4HHMA 1E5NA 1JNEA 4ZQPA 2X42A 1VAHA 4C5YA 1K8YA 3T6CA 4KEUA 3H2AA 3PJXA 1LRNA 4V1YA 1BLIA 2I14A 4XD5A 3ZLHA 4PMDA 4HNUA 2D2JA 3DG6A 3L0GA 3G1RA 1J8VA 4D6HA 4NJJA 1JRCA 1UASA 4JX5A 1MZRA 3SR7A 5AZ1A 2CITA 4XZWA 2YDRA 3EMCA 9XIAA 4HYRA 3TJXA 1NSJA 3Q45A 2PP1A 3IJIA 4LW7A 1KC7A 4JY8A 3W76A 2NW0A 1XIFA 4PL2A 1F5ZA 3WD0A 2LLEA 1E73M 3DBPA 1XSJA 3NQGA 1RY8A 1DHPA 4D6IA 1TV3A 3TEVA 1UP2A 1W9BM 3LCXA 3W1MA 4IMFA 3AIVA 3WLLA 3B4UA 5K9CA 3AUJA 2QPSA 4RKAA 2YYUA 2WVUA 2FZ9A 3CWOX 1BG9A 4ZOCA 3OU8A 2WBKA 1F6KA 3TOYA 1W5PA 4KF1A 1JUEA 1YTDA 3O2LA 1XRFA 2D1ZA 4XZNX 1XDMA 1GVEA 3I4KA 2C79A 4NP7A 3CLWA 5HOSA 4LF2A 1KTBA 1AL8A 3AIRA 3WLMA 3B04A 3TSDA 1TR1A 3M6DA 3NVDA 5CCZA 2HJPA 4K8HA 3USZA 5F1VA 5C2CA 3QY6A 2BS9A 2J88A 1YXCA 3UWQA 4JGDA 4NU7A 3UERA 2WLZA 4QHRA 8XIMA 5BXPA 5GQBA 2G50A 3E0WA 2D0FA 4JKLA 1V0LA 3E3HA 2OWCA 2V82A 4EACA 2V81A 3NYZA 4ZODA 3F4CA 2VWTA 3OO2A 3VGEA 4Y96A 3URBA 5CSUA 1B1YA 3BAWA 4NYYA 1AD4A 1E9ZB 4DJFC 1TJPA 4TTGA 4XBKA 1WV2A 3RMJA 3W24A 3PBMA 1UKPA 2HVOA 2D23A 4NNBA 2A2IA 3AZRA 4YHGA 3ZR5A 2I9EA 1OX5A 3A5FA 1S38A 1JPMA 5BWAA 3CZJA 3PG8A 3DG7A 4GYKA 3EYPA 5HMDA 1E71M 4BI5A 4MF4A 3F5JA 2FIQA 1N8FA 3K8MA 3RPDA 5JUVA 4AD0A 5TF0A 4GIYA 3TQPA 3GHUA 4AVNA 1DWGM 2BVYA 4H8NA 4K8GA 1K9FA 3SEPA 2Q8LA 2JGQA 2V67A 3W6LA 2X1TA 1HJWA 4ZSUA 1S2CA 4ZA0A 4DJED 4I7VA 1QBAA 2YL6A 2IKHA 4PMVA 3RG6A 3QZAA 3QZEA 1WOBA 1XL9A 3N34A 2WB5A 1QHZA 5AN7A 1CZ1A 2Y7EA 1E70M 1JIBA 2VZSA 3STFA 1KWKA 2JE8A 3LPGA 2WCGA 4QEEA 1JJKA 4QG8A 5DCBA 2VEMA 2VFFA 3W7CA 3T81A 2RJHA 2EG6A 3AYTA 3IJDA 4XUGA 3BAJA 4YIWA 4B5WA 4QLKA 4QP0A 2ACSA 1DXFA 3VGDA 4QG9A 2NUYA 5T9CE 4KMQA 3LRMA 4DBEA 2VQTA 3TAOA 3PSVA 3BZGA 4IPIA 3SN1A 3PZ9A 4JFWA 3KS6A 2VNCA 3CZLA 3VM7A 2V3GA 4IX2A 2J7DA 3BG5A 3QMTA 5TBOA 1EO5A 2CBIA 4TTUA 3U0HA 2AGTA 1Q7QA 1GKRA 4NNCA 1WZMA 1UZ1A 3VNIA 2PWGA 4JYEA 3BL3A 1QRQA 1FWSA 3KCLA 2OEJA 3FSTA 1XIHA 1E43A 3WCZA 4XVDA 1HGWA 1M03A 5LNRA 5IHSA 3CQKA 4CD8A 4WKFA 1EQCA 4C6BA 3KAOA 1GEQA 4WSJA 4BI6A 1FH8A 2VZTA 3O8AA 5REQB 3S9IA 1ONRA 3W7IA 1B4EA 3JUGA 3EX4A 3LGDA 3MP5A 3TWAA 1AQFA 3N4EA 3VZXA 2VQUA 3QTGA 4J28A 2VT0A 4WX2A 3BW2A 1Q7ZA 1R0MA 2YDSA 3O6YX 1Q45A 4F8XA 3ZLFA 3ABXA 4BEUA 3NG3A 1RJRA 2CKRA 3S2CA 1K7FA 1P6BA 4FNSA 4TV5A 1E6XM 1B3ZA 3VUPA 3BQ5A 3MVTA 2CLLA 4J27A 1A5BA 1NP0A 2ZZ4A 2HROA 2BHZA 3GIQA 4XWUA 4JFSA 2WM0A 1IR2A 1S46A 2XU2A