3BK0A

Crystal structure of human orotidine 5'-monophosphate decarboxylase complexed with 5-cn-ump
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
KELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase
publication title Crystal Structure of Human Orotidine 5'-monophosphate Decarboxylase Complexed with 5-CN-UMP
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 94
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3bk0A00
4W9TA 1ME8A 1SW7A 3U6WA 3UY8A 2ISVA 3NPVA 3PM6A 3LCFA 2XFWA 3LTYA 2PE4A 3VKJA 3WJZA 3NM1A 4MY9A 4UC5A 3NL5A 4MJMA 5D02A 1LZOA 3W83A 2WV8A 3WJSA 2KZHA 1I2RA 2H3DA 3PY2A 3W2JA 3GNNA 4JTLA 1XC4A 2HTMA 2ZBTA 3SECA 2QCLA 1EWEA 4FNPA 4X9SA 3W9ZA 3IEBA 2X30A 2Q8ZA 4MUZA 5H91A 1LOSA 3A24A 4JXCA 1FWSA 2FTPA 3GNDA 2H6RA 3O15A 2RDTA 4DELA 3W73A 4HNTA 2A6NA 5D30A 3NEVA 3MP3A 1TREA 2QEZA 3SGZA 1W0MA 3UWWA 3M47A 5DN1A 1VC4A 1FDJA 3S1WA 4K36A 2J9YA 4JTKA 2H3BA 2X2GA 3Q37A 1TV5A 2Y7GA 5AHEA 3BG9A 3KX6A 1SO5A 5DBTA 2GJNA 3KFTA 1HL2A 3L0KA 1JQXA 3PUDA 1W5OA 1GVQA 3C6CA 5HWNA 2RKXA 3O6CA 3G3DA 1KFJA 1EP2A 4NX5A 1B9BA 3MYOA 3DFTA 4MY1A 3B0UX 2PRHA 1BKSA 2I14A 2EAWA 2ZA3A 1AW5A 3CIWA 2IQTA 1YDOA 5D38A 3HQ1A 4GBUA 3IVUA 2DZWA 4N2YA 3P67A 1Z48A 1BWLA 2E09A 2E6DA 3W85A 5AHIA 1J2WA 3P61A 2X16A 5C54A 3LDVA 5L9FA 4KWVA 4TMBA 4XTDA 4CNPA 3M5VA 1FX6A 4FNRA 1I2PA 3R2GA 4N02A 4HT3A 3TW6A 4UR7A 4O1CA 2V2HA 3CTLA 1OF6A 3KVKA 3PG9A 2ZRZA 4FB7A 1SUXA 4CCDA 1ZAJA 3G1XA 3TJLA 1GYLA 3HGOA 1R2SA 2OT0A 3EWZA 4JX5A 3JS3A 4Y8FA 3QJAA 3G1HA 1GWJA 5K9CA 3G0XA 2QCFA 4ADSA 1LBLA 2YPIA 2NLIA 3W72A 1YXCA 3GKAA 1IIGA 3P5ZA 3UWYA 4UTTC 1ZCOA 1OFBA 3QQ0A 1YDVA 3NQ7A 3A21A 2A5HA 2QJHA 2YFNA 1JQVA 1VJIA 3L65A 5CG7A 4NJJA 3LHTA 4O16A 1EX5A 1CX9A 5A5WA 1H7NA 2VELA 3WJYA 1ME9A 4UTMA 2NXHA 4NU7A 2ALDA 5HR7A 5G1YA 1SO6A 3TNOA 4DQWA 4N6FA 5D04C 1KFKA 2V30A 3B8DA 5AYYA 5U4NA 1Z44A 1DL3A 5F2IA 4FIQA 1TIMA 4K7YA 3LCWA 2Z6IA 1KM5A 1A5BA 1F2JA 1ALDA 2CU0A 2Y63A 4DO5A 2OMAA 4LRTA 1M6JA 4KFOA 2DZTA 4PTNA 1L6YA 5F2MA 3A22A 3TCEA 3A5FA 1VYSX 3USBA 4JTSA 5G2IA 1YTDA 3NPUA 2E77A 5AC8A 5DELA 3TMQA 5LNRA 4UTUA 4AB4A 1WQ5A 1LROA 4H4IA 5AYXA 2C18A 1YADA 3F4WA 6TIMA 4CNNA 3NVTA 3S1UA 1LORA 1ICSA 2DZVA 3SGUA 2PRMA 2J6XA 2A7PA 3LTSA 4FO4A 3PUOA 1WV2A 3NAVA 3PF3A 3QSTA 2LLEA 5KZEA 1VLWA 4L4LA 1TV7A 4GUFA 3CLMA 4UTTA 3P8JA 2WNNA 2G96A 5F2GA 4J9JA 1Y0EA 1S3HA 4UFIA 1TQJA 2WNZA 2Y88A 1GT8A 2GQ8A 4E2BA 5D33A 4FXRA 3OVPA 3WJWA 1MZHA 2XN0A 4HKPA 3TQ0A 3W1PA 1Q45A 3G18A 1OX6A 2TRSA 4OWGA 5DY2A 1GPWA 1K03A 5DXYA 1KTBA 1Z42A 1KM0A 3B04A 3FJLA 4M19A 5K9XA 4CLMA 2QCDB 2JGQA 2OZ0A 4K39A 3GK0A 2NV1A 1DJQA 1YTKA 4DF1A 4CQ9A 2A7RA 4DO6A 3LHWA 3HIJA 2RHGA 3ZR4A 4ALDA 1OF8A 2Y61A 5K7JA 3LLFA 2FQIA 3HGRA 1TMHA 4DBDA 3CM4A 1GYNA 5CSRA 1XBVA 1KM4A 1JRCA 3ABSA 1B3OA 4O28A 1EP1A 4X22A 1OJXA 4TU1A 1UASA 3N14A 3ZWTA 1FXPA 4PEKA 1A5AA 2CFFA 2Z0IA 1SFLA 2EPHA 4ORIA 2Q8LA 3PBVA 5FF2A 1KLYA 1W3NA 3P82A 3TC6A 2V8ZA 4HPXA 3LGEA 3KXQA 3W22A 4HSOA 3C0JA 4I7VA 5AC7A 3NPXA 3CWOX 3FJ6A 3WK3A 2O7SA 4B5NA 4IMGA 2EGZA 4O50A 4PH6A 1JVNA 3NYZA 1XFBA 3LV6A 1P4CA 3KVJA 4ADUA 3B06A 2WQPA 4LVDA 3S42A 5MHBA 3CB8A 5G4WA 3I7RA 4GWEA 4UFJA 3HBLA 2GQ9A 3KOFA 1G69A 3DH7A 1HO4A 3IIXA 1L6WA 4E0CA 3W2NA 3C56A 4Y90A 2FB3A 2C3ZA 4FHAA 4M6PA 2ZZ6A 4XQ6A 2DJXA 1G4SA 1SZNA 1YDNA 3S1XA 1H51A 5CZSA 3DKLA 4AWUA 1O95A 1G4TA 3NQGA 1G6CA 3NQEA 3MJYA 4UCGA 3SSJA 3V75A 1VPXA 4UFHA 1HG3A 3W7HA 3TJXA 4JTIA 3W7LA 4JIPA 1BWKA 4JGDA 4AAJA 3MI6A 1AL8A 4LNYA 4O17A 2J27A 3DGRA 3G1FA 2ZZ1A 1SW3A 3BGJA 4TMCA 1P0KA 5FEZA 1TTPA 1X1OA 4IPIA 1H61A 3NR0A 1OFPA 4IQLA 3FS2A 1YPFA 5FF3A 4I7WA 2NXGA 1FDYA 1LBFA 1KTCA 1TTJA 3W7QA 3MBFA 4RXFA 4JDBA 3BLEA 2C13A 1Q6LA 3UWUA 4TR9A 4UFLA 4IPJA 4OT7A 1ZFJA 1TV8A 3MYPA 3OIXA 5EPDA 5LNWA 5K3VA 4LS0A 3KVLA 3GB6A 4ZQPA 3R13A 3EX1A 1NFBA 2R91A 3L5LA 2TSYA 4DPQA 3NPWA 3KRUA 3LCLA 4NUWA 1KBJA 3EXSA 4JX6A 5G1TA 2Y7FA 3FIGA 3TUUA 4O54A 1G7UA 3NQAA 3H53A 3NQ8A 3PWAA 2DZUA 5F4SA 4WY0B 3W75A 3W2LA 4BI5A 1O5XA 3S0CA 1GG1A 4MLRA 3UWZA 3DFNA 2TMDA 5LHEA 3EWBX 1PCKA 3TXVA 1OFQA 3G24A 4XBSA 2VC6A 3MP4A 3UQNA 1V7YA 4GXMA 1D3HA 5KSWA 1LDCA 1M7OA 1UB3A 5CZTA 4MLJA 1OHLA 5K4XA 1QOQA 4PODA 4S2CA 1W37A 3FKRA 3QW4B 1HO1A 1RV8A 1W31A 3FA5A 1H62A 2C16A 2VFGA 1TQXA 3OVQA 3GXNA 3O06A 2ATSA 5AFDA 1K8XA 1OFEA 3P8IA 2QDHA 1QPNA 1QOPA 2J9ZA 3CPRA 3G0SA 1CI1A 4MYAA 5LGXA 2E6AA 2TPSA 5LSMA 2E6YA 3W76A 2ABBA 3NQDA 4JNMA 4LU0A 2W6RA 3L21A 4HNNA 1KA9F 3DAQA 3OVRA 3R8RA 1LBMA 3C2EA 5SWUA 3B0VC 1X1ZA 4MZ8A 4M7TA 3U8GA 3GR8A 2EHHA 4ZQNA 2TYSA 4O1BA 3BLIA 3T78A 5D32A 2ZZ7A 4QJ1A 2DORA 1S5VA 2VKZG 4H6KA 4AH7A 1WBHA 1O60A 2BXVA 3H55A 4JYEA 5I3JA 2V2DA 1WXJA 1IXNA 1ZJIA 1AL7A 4U4MA 4O0ZA 1YTEA 4GRSA 1DVJA 1G4EA 2WSYA 2OCZA 3HF3A 5A8GA 2V5LA 3EX4A 3MW7A 4BWLC 5G5IA 4RK8A 3W7PA 5EKYA 3DI1A 2VFEA 4PCFA 2X1TA 5TBOA 3G1SA 5F1UA 1SZFA 3LRKA 3GR7A 1KFCA 1RQBA 4UIOA 2J24A 1FWRA 1D9EA 3IV3A 3QC3A 2F7FA 2FJKA 1K3UA 1VHCA 3DU0A 1LLWA 2OX1A 3PVFA 1VGAA 5EYWA 3G8EA 3QF0A 3PULA 2A6LA 3DXIA 3P74A 1SU5A 3E49A 3N9SA 3GXTA 4MYXA 3B05A 1IF2A 3HO8A 1FCVA 2A1YA 5C2XA 2W79A 4ZVJA 1WX0A 3NQ2A 3NZRA 3TQVA 2QR6A 3MHFA 1W8SA 1S5WA 3N3MA 1KV8A 4MZYA 1VCFA 1D3GA 3MHUA 4HNUA 3M6YA 2CWNA 4O13A 2Q3OA 1WOBA 1UBSA 5E1QA 3I6RA 4OQVA 1EUAA 3LM7A 2YFOA 1EA0A 1H1ZA 5LGZA 1K8ZA 4GUIA 3O6DA 3UY7A 2V2CA 3MMTA 3GX9A 5AOUA 4S2BA 4AMAA 5DCEA 3LERA 3VNDA 3T7VA 3DHDA 4LV4A 3NQMA 4A3UA 1XBYA 5FEWA 1SQ7A 1OABA 4UFMA 5D37A 3M44A 4FF7A 5LNSA 3OG3A 4IOTA 1XBXA 1PVNA 3NQVA 1A5CA 4K8EA 5K2ZA 1Q6QA 3W23A 1PCWA 4NT0A 3W7JA 4BWLA 4X2RA 4RJEA 2R14A 3DFQA 2OJPA 3PAJA 3EKZA 1JCYA 5L6UA 1QWGA 2VOMA 4XZ9A 4JS3A 2X1UA 3NQ6A 4LS1A 3GYEA 4NQ1A 3V1PA 1E51A 3MWAA 1H63A 1F73A 1FDZA 6ALDA 3PBUA 3L0NA 2GVJA 2NWSA 1KTNA 3G8RA 2VEMA 1OX4A 2ZZ5A 2BWGA 5CSSA 5H2ZA 4IXXA 1N7KA 3CQ0A 4QNEA 4UTIA 1DV7A 4RLIA 3M9YA 3W7IA 5IM51 2P10A 1MXSA 1IIHA 1KW1A 4N9DA 2VXNA 2H8XA 1DKWA 5BW6A 1HTIA 3TH6A 2HS6A 2G5WA 3IVTA 4JY8A 1YYAA 2CZDA 2YR1A 4MFEA 2B7QA 4K7VA 4OHQA 4O53A 4AF0B 2H90A 3I7QA 4PC8A 3GZ3A 3TU9A 4UTJA 3O8AA 4GC4A 1R30A 5DBUA 3IIVA 1NVMA 4NZFA 1N55A 3QW3A 3LXAA 1SW0A 5HNRA 3P62A 3LHVA 2ZTKA 1ZAHA 3P5YA 4EVZA 4XKYA 2NUWA 1TRIA 2BLEA 3NO5A 3STEA 1FUYA 1NF7A 4R7JA 5KZDA 5FI8A 3TDFA 2FDSA 3AO0A 3MP5A 1IXOA 1YLVA 2A2IA 5CZ0A 1JULA 1JCLA 4ORMA 5LZLA 3HJZA 4LW7A 3R12A 3Q94A 3MI2A 1QO5A 1OK4A 1FY6A 3A23A 4HPJA 1GZGA 2QCEA 2V9DA 4GJ1A 3W1QA 1XXXA 1ZAIA 4NXSA 4NJKA 3STFA 3GVGA 4YCPA 1K7FA 3DFPA 1MEHA 1KBIA 3GAYA 4JR5A 4LS2A 1W3IA 4UNKA 3IGXA 2A85A 5FF0A 4FNSA 1JUBA 4M5PA 3E96A 3TAKA 4NNAA 3TW7A 3O16A 2B4GA 2YZRA 2B0MA 4O0KA 4WZHA 3QZEA 4I9AA 3CEUA 1ZY9A 4UTKA 4FIRA 4WOQA 3G1YA 2A21A 3NL2A 5I3IA 1OFAA 1VQTA 2AGKA 2QAPA 3S9YA 3G1VA 1W5MA 2ZZ3A 2RFGA 1TPWA 3CC1A 1TB3A 4PL1A 2NXIA 3INPA 3W2MA 2X1RA 5U7SA 5HWJA 5CZJA 3WK0A 4Z0SA 1AK5A 3W2UA 3LI0A 4YLWA 2QCNA 3TFXA 3L5AA 4O52A 4WOZA 5AN7A 1OYBA 3O6YX 3M5YA 3T55A 5EMUA 4BFAA 1ZNNA 3SI9A 3E9AA 2WPBA 1M5WA 3GIYA 3LB0A 4LVGA 4YL2A 1UUOA 2ZZ2A 1WYIA 1W56A 4JTGA 3RFAA 3TIMA 1A50A 4RCXA 3P81A 3KRZA 1FCBA 4LOCA 4M6QA 2W0UA 3P80A 3C2RA 1W5NA 4O4WA 2JKEA 1KM6A 3U2OA 1JR1A 4IMFA 4WXYA 1LYXA 3IVSA 3HPXA 5D05A 1MEIA 1RQEA 3W1RA 3W7MA 2HMCA 3G3MA 1XM3A 4EF8A 4IJBA 3QFEA 3A5VA 4HNVA 1FCUA 1T8XA 3W6YA 4QAIA 3SJ3A 1I2OA 3ANYA 3R5EA 2PC4A 4Q4KA 2A7NA 1K7EA 2YW4A 4OGZA 4UR8A 1XCFA 3HG2A 7TIMA 1H5YA 2GPTA 1IXQA 1QNVA 4P2VA 1FWTA 5C5YA 3NQFA 2DP3A 1XBZA 5DLCA 3EXTA 1U83A 1KFLA 2YGYA 5F2LA 3W07A 1OYAA 4JIQA 1I4NA 5LHFA 3LV5A 2E68A 3NG3A 2ZA1A 3ABQA 1F76A 2O7QA 3FFSA 4ZQCA 3UZ5A 1SPQA 3KAOA 1KM2A 3T40A 1MEWA 2FB2A 1SR9A 2Y62A 1LOQA 4WX2A 3W7EA 4LVAA 4MOZA 5BNKA 3FYPA 3W1AA 4RXGA 3KRSA 3QRHA 4IUOA 1KM3A 5K4ZA 4LUJA 4QISA 3RK8A 1B57A 2V5BA 5J5DA 3LCGA 2JBMA 3CWNA 3GXPA 3C2VA 5HQEA 4C1LA 3W88A 2ZFAA 4NX0A 3LOTA 1JCNA 4CCCA 4GE8A 4OV4A 4MY8A 3K30A 1WAUA 4ADTA 3PS7A 4AWSA 2E5DA 3W7CA 1X6UA 4S1FA 1SSDA 5HWMA 3O05A 2ZRYA 2YYUA 3M16A 4DF0A 3D0CA 3Q58A 2I9EA 3BW4A 3SY5A 1T99A 4AHPA 3BPWA 5D2TA 4IX0A 3CHVA 1SZEA 1R47A 1WDWA 3QMSA 4GUHA 5T26A 1QMLA 4QIUA 3TXZA 4Z08A 4PFMA 1GTHA 2XN2A 3RNDA 4EWND 1NAL1 5D2VA 3DZ1A 4OU1A 3GDLA 3SFKA 3VE7A 1RD5A 3B4UA 3NM3A 3O07A 3IGUA 4R33A 5EL1A 1K8YA 3Q2DA 4WXZA 4FX6M 3G0UA 3PSVA 1PL9A 4R34A 4UFKA 1H7OA 3TROA 3JRKA 3LRLA 2E5BA 4CCEA 4XTIA 3BW3A 5BRBA 3LX9A 4DBEA 3OA3A 5DY3A 2YCEA 3TK7A 1RPXA 3LCHA 2QAFA 1ICPA 2ZRUA 4NJIA 2ZZ4A 3WK1A 1ONRA 4N4PA 3EWWA 1N8FA 3NZ1A 4H3DA 2PURA 4RZ6A 2NV2A 4A21A 4IGHA 1KFBA 1OK6A 4A2SA 1H7XA 1J4EA 1VYPX 2A4AA 2JK2A 3OHIA 1ADOA 2G95A 3G1DA 1TSIA 1F7BA 3PBYA 1ML1A 3UPBA 4IWWA 2C15A 2ZQ0A 4N9BA 1X8FA 5IBXC 3PC0A 3KHJA 1RR2A 2E1DA 4O1DA 3HGSA 2ZA2A 1TPUA 4OV9A 1JRBA 1EUNA 1UJPA 5I3KA 1LLZA 2Y6ZA 1OVDA 1LCOA 4ML9A 3W2KA 2CZFA 4E38A 1LOLA 1TYGA 5EBUA 4N6EA 3QH2A 3EX2A 3GLCA 1WBJA 4DPPA 1AW2A 3BG3A 4YCOA 4UMAA 3M5ZA 5F4WA 2VFDA 2ABAA 2BX7A 3EWXA 1EIXA 1G7VA 3DENA 4XUGA 2ZCGA 4MVAA 2WSRA 2DU2A 3C8FA 2CLMA 1OYCA 2CLKA 3KVMA 5FF7A 3W7OA 2DZPA 4TIMA 1QO2A 1S5TA 2ISWA 4IX2A 3ABOA 3F1QA 4AEOA 1W54A 3PB2A 4UTLA 4FX7A 2R8WA 1ZALA 1TPB1 1L2UA 2YXGA 2ZRXA 1RZMA 1XUUA 1QR7A 1GJPA 5LNUA 1NEYA 5D03A 4UTWC 3TKFA 1Q6OA 3IIOA 4LT9A 4LRSA 1AW1A 1P1XA 3ZWSA 3UZJA 1F5ZA 3GAKA 3I65A 1EPXA 5AC6A 3W7GA 1R2TA 1C9DA 1OFRA 3NXFA 1DOSA 3LBMA 1VCVA 4Z1CA 5I3FA 2FPTA 2XN1A 2WOQA 4NJGA 1VZWA 1BEUA 1UUMA 4ZL1A 5KITA 2WNQA 4I7UA 1JCXA 4AHQA 1G4PA 1O5KA 1DQXA 2GOUA 2FPVA 4NJHA 3GDKA 4RX0A 3CT7A 1H1YA 2QKFA 2CZ5A 4UNLA 3PB0A 3L68A 1KM1A 1GEQA 4DF2A 4EF9A 2Z2UA 5LNVA 4UUIA 1FXQA 3CU2A 1TTQA 3GDMA 4WJEA 4BR1A 5C6MA 4JY9A 4XWUA 3W3OA 5BMWA 3E02A 4L4MA 4UMCA 4FXSA 4KWWA 1YXDA 2AAMA 4WD0A 2JGYA 3EX3A 2NX1A 4GFSA 2QUUA 1H50A 5CPOA 4ZQMA 3S6DA 4QSHA 1F6PA 3S5NA 3BV4A 3DKJA 2QCDA 4JX4A 2X1SA 5HUPA 2JKPA 5J5RA 1TPDA 2F84A 1TPFA 4A2RA 3MUXA 4JN6A 3BVJA 3HB9A 3IIZA 3QM3A 1Q6RA 2PRLA 1K7XA 3PBWA 4PL2A 3C3NA 2FLIA 4RZ4A 4FNQA 1QPOA 4LTSA 4TO8A 1RVGA 1FBAA 2D73A 2CLIA 3LRMA 4UTWA 1P5BA 2E6FA 3N73A 4UMBA 1PE1A 3UWQA 4E2DA 1I2QA 1W5PA 4GNJA 5D09A 2ZTJA 4LY8A 4NNBA 1K02A 3MO7A 4LC8A 4MPQA 2QUTA 4QM1A 5HULA 4CQAA 2V81A 1B4KA 2WSQA 3STGA 3W1TA 1PIIA 5EA9A 4Y6GA 4WQ6A 2GUUA 4JICA 1TPEA 2WJZA 5F1VA 3W84A 2QUVA 3UPWA 3QPYA 2JKAA 4YMZA 3IIPA 4NXKA 3RMJA 3EWUA 1JUEA 1AG1O 3QMRA 4FNTA 1DQWA 1QCWA 3FEMA 5G4EA 3W71A 4FEZA 2HSAA 1F6KA 3EEGA 4O11A 3QMTA 3S5ZA 3W1XA 4BK9A 1W5QA 5D2WA 1LP6A 3N2XA 4LC6A 4HHPA 2CZEA 1EB3A 4Y9AA 1KV5A 4CNOA 3UXAA 1PV8A 2EKCA 2CW6A 3THQA 3WFAA 2NX9A 5E0KA 4LVBA 4K6AA 3QQ1A 3MI3A 3THAA 1TJRA 3ELFA 3BG5A 2J9XA 1TRDA 3PUEA 4JTEA 2NUYA 4N9EA 3ZFHA 1QDSA 5E93A 4M6VA 4JYFA 1TO3A 3BARA 3L2IA 3W7DA 3C2FA 3W74A 4ZQOA 5D2YA 2VEPA 1XL9A 3C4UA 2CLLA 4WUIA 4QNWA 2BZNA 2QJGA 4NNCA 3C2OA 5KMYA 1MO0A 1QPQA 3TA6A 5DXXA 5HUOA 1T96A 3W7RA 1I45A 4MFDA 3WK2A 1B4EA 2B7OA 4K37A 3M43A 3EWYA 1F74A 3P7YA 4HIBA 5ABTA 1VLIA 3NNTA 4JYDA 1THFD 2VEIA 2VFHA 4KFPA 1R2RA 4MIMA 3HG5A 3ABRA 1C8VA 2RDUA 3EX6A 4Z1AA 2Y7DA 1H7PA 3WJXA 4P61A 1BTMA 3I68A 4Z1BA 4CQ8A 3NOEA 4IXHA 1FWNA 1VR6A 1GVFA 4O19A 2V82A 1SZGA 3MHGA 4WY0A 3N34A 4A29A 4DXVA 2Y70A 3E0IA 3M7WA 2ISSA 4Y96A 4O15A 4Z1DA 4O14A 1L6SA 3L66A 1XDMA 1VYRA 2E5CA 2EF9A 2ZRVA 1LTDA 2Y89A 3OEXA 3F03K 4M7SA 2DZXA 1L9WA 4AXKA 3P84A 3FYOA 3UXDA 2UV8G 5FF4A 1SO3A 3ZS4A 2NZLA 4IMCA 1Q3NA 2B7PA 2NX3A 3N9RA 2WO5A 5CPNA 4O57A 3RLVA 1QPRA 2GVGA 1DHPA 3RLUA 3QPZA 1H60A 1QFEA 3G22A 1A53A 1YXYA 3VFLA 4AHOA 4O8RA 3S1VA 3NQCA 1JCJA 1KLZA 1WA3A 4RZ5A 3W1UA 2Q3RA 5BMXA 1PHQA 3YPIA 1XKYA 3TE9A 3UNDA 1TJPA 4JEQA 3EB2A 4C1KA 1C29A 3RU6A 4MKNA 1JJKA 4HN4A 2J88A 3UD6A 1GVSA 4IMDA 4POCA 3S5YA 4JTUA 3QSRA 1TPH1 1TPVA 5EY5A 3P60A 2ZYFA 1P0NA 5HJLA 3W70A 2QJIA 3PR2A 1QAPA 1X7FA 4X3ZA 1I2NA 1SO4A 2BSLA 4PA8A 3TC7A 1IGSA 5HMSA 2QCCA 4JTFA 1SFJA 4KKXA 4GUGA 3VI2A 1ME7A 2I1OA 4RV8A 3TX9A 5FEXA 3UWVA 3CIXA 5AHMA 2FPYA 5TQLA 5AHFA 5C55A 1LM1A 2G97A 1I8JA 3SZ8A 4Q33A 3W1LA 8TIMA 4O18A 5CPMA 3C61A 4MZ1A 3LHUA 5G2HA 1NF0A 3A9IA 3W7KA 3LHZA 4U28A 3L0GA 4WY0F 1EP3A 4BI6A 1ZENA 4LVFA 4O4VA 4O1AA 1F05A 3JR2A 3L9CA 5AHNA 1LRTA 1OFDA 1VHNA 2ZRWA 3LTPA 2NWRA 2YDAA 2CLFA 1XUZA 3RF9A 1GTEA 2C14A 5AYZA 3HG3A 2P0OA 3VE9A 3TFCA 2ATMA 4RKAA 1EWDA 4A22A 3BGGA 4D2JA 2V0TA 3TSBA 1OX4B 3W86A 3QYQA 4JD4A 1T0OA 4LV9A 3F4NA 2RDWA 3LHYA 3TQKA 3HG4A 3LLDA 4DO4A 3T4CA 3W1NA 3N2MA 1G67A 2FFCA 1GVOA 1ZHAA 5CGQA 3SIZA 3LI1A 4KFNA 4Q32A 3S5OA 3L5MA 3NGJA 2QCGA 4BF9A 1W1ZA 4N4QA 4FNUA 2YW3A 1GG0A 1LRNA 1V5XA 5BOOA 4Z0JA 4JDYA 4GUJA 2NUXA 4UXDA 5K9DA 3SW6A 2DZSA 1VRDA 3H54A 3IRDA 3N19B 3HGJA 1GOXA 4K8HA 5I3HA 5TIMA 3BLFA 1M7PA 4QITA 1IXPA 4HSNA 3EXRA 3DI0A 2P1FA 5HR6A 3C52A 1DJNA 2Y85A 1ICQA 1FCQA 1NSJA 3LCXA 2CLEA 4LUIA 1DBTA 3TSMA 3FOKA 4XKYB 3I7SA 4O12A 1TTIA 4TX9A 3STCA 4XBKA 3BO9A 2PCQA 3FLUA 3LXBA 1YPIA 2Z1BA 4G1KA 1FQ0A 5GVJA 1DORA 2OT1A 4ONVA 3W87A 5LKYA 4OBTA 4LWWA 2QCMA 3M1ZA 3NDOA 2VEKA 1U5JA 4AWTA 3ATZA 2C19A 4EIVA 1OFOA 1PHWA 4NVTA 1O4UA 3EKLA 5FEPA 2C6QA 1OG0A 3NA8A 2GJLA 4YWIA 4AVFA 1R46A 3S8HA 3OBKA 4N9CA 3DBPA 3W1MA 3HOJA 3M5XA 3O1NA 2VFIA 3BK0A 3TMLA 5KZMA 3LCIA 2A0NA 3IGSA 5DCBA 1GQNA 2C0AA 3TV8A 3PG8A 3B0PA 3E12A 2BTMA 1SSGA 4JTJA 3HPSA 2YX0A 4JTHA 1FWWA 2QCHA 1WOAA 3G1AA 1A5SA 2QDGA 3NL6A 1PS9A 2Z6JA 2H8ZA 3DFSA 1Z41A 2WKJA 2ZDRA 3QEZA 4K38A 1H7WA 3MBDA 1AMKA 4AF0A 2AQWA 3CEPA 2QF7A 4ZQRA 4DEFA 4EOUA 5CPLA 2FIQA 4R53A 2C1HA 1TCDA 4O10A 1MSSA 3BW2A 4UTHA 3M0ZA 3FKKA 3ATYA 3AJXA 5HINA 1LRQA 4IMEA 1VCGA 3LXCA 1TPC1 1J5TA 3O63A 5AHLA 4OE7A 5G2WA 4RR4A 1HUVA 3VCRA 3T44A 3R89A 2YYTA 5KINA 1XI3A 2RH9A 1OX5A 5I3GA 3L67A 3TAOA 3TR2A 5KTLA 2VFFA 4MJZA 4ZMGA 2VENA 3DFOA 2GVLA 2B7NA 3W7NA 1VH7A 1JCMP 4QQ3A 2DJLA 5D2XA 1GVRA 2GQAA 1RQHA 1KFEA 2CLHA 3PSWA 5FESA 2CLOA 5DCDA 3GDRA 4JTTA 2Y7EA 3SR7A 4BI7A 3NL3A 3B03A 3HPZA 1UCWA 1JUKA 2R94A 2YSWA 1CW2A 1HFBA 3DHFA 1H7RA 2HS8A 4NZJA 3LBCA 3GDTA 4ICNA 3HMJG 4ZZ9A 5CKSA 3M41A 1EEPA 1VS1A 3TSDA 3GKFA 4YXGA 5AB3A 4FX8A 1W3TA 1O94A 5IBXA 5F4XA 3UYCA 1XDLA
chains in the Genus database with same CATH superfamily
1QK2A 3LTYA 3CQKA 2PE4A 3EPNA 1A5UA 5D02A 3KBSA 3LYEA 1LZOA 1T5AA 1NARA 2IS7A 2CBJA 1E6RA 3AOFA 2H3DA 3GNNA 4JTLA 1YE4A 3SECA 4CNUA 3VDCA 3DIPA 3U9IA 2WAGA 4NRSA 3EA3A 5BU9A 3W9ZA 1TVLA 2X30A 2VEFA 4MUZA 4YIWA 3A24A 1XCWA 1MXDA 4V1YA 3UJSA 1FWSA 3GNDA 1ZRQA 3EDKA 4KCWA 4DELA 3W73A 2W66A 3TZFA 4RPQA 4KIEA 4FP1A 2QEZA 3CPUA 1VC4A 1FDJA 2FJUB 2BOGX 1OIFA 4JTKA 2PU1A 4RDZA 2X2GA 4LCRA 3F5JA 4ZO6A 1K70A 3VD5A 5DBTA 3TYEA 1HL2A 3L0KA 1NM9A 2O56A 1W5OA 1TVPA 4AX6A 3C6CA 2RKXA 3G3DA 3ORWA 1KFJA 3NO3A 3DFTA 3A3XA 5IXEA 3APGA 1V3MA 3HV9A 2ZA3A 3KE0A 3A64A 2Q6ZA 3WG6A 3I4EA 3IVUA 5A8OA 3EDFA 4N2YA 4QSFA 4V2XA 3M0MA 1SMDA 1Z48A 3GQYA 2GSEA 1BWLA 2E09A 2E6DA 5AHIA 5C54A 3W27A 1UR0A 5DMNA 1JL8A 2R9RA 3B97A 3WF3A 3M5VA 4D72A 4FNRA 4PFHA 4ENLA 4N02A 4UR7A 3TA9A 3KOXA 3WDPP 4DXXA 2HNEA 1AD4A 1OF6A 3KVKA 1ZAJA 4A6GA 3WQEA 3LZ3A 4R3UA 1Q6GA 3RHGA 2INZA 1GYLA 3HGOA 1DWFM 3G1HA 2QCFA 3OZMA 3OTRA 4PN2A 1B1YA 1YDVA 1MVYA 2A5HA 1O5RA 2FFIA 4HYVA 3WH8A 1N82A 2OLHA 2QDDA 1V02E 2GUBA 3L4WA 1DYSA 3PPCA 3R79A 5A5WA 4XD3A 1H7NA 1XG3A 2CERA 2ZADA 1J5SA 4C6PA 1IZCA 4ZE5A 2YOCA 5D04C 5ABHA 5AYYA 5GNZA 1DL3A 2DV0A 1TIMA 3H2EA 1A5BA 3CV1A 2ZE0A 4PBGA 4DO5A 2BHUA 1GOOA 2OMAA 4TTGA 1M6JA 4KFOA 2BVYA 4PTNA 3A22A 3A12A 3A5FA 5G2IA 3TMQA 1KCKA 2BMBA 4UQCA 1CGXA 2C18A 4HPNA 4W8AA 4U3CA 3VD4A 3UESA 3NVTA 1LORA 2XDFA 1R8LA 2A7PA 3H2NA 4A35A 1WV2A 4R9XA 3QSTA 1CXLA 3VNIA 3UG4A 2WPGA 7ENLA 3CLMA 2NT0A 2WNNA 5F2GA 1B0IA 2VGGA 5HMFA 2ZX9A 5A6BA 2BHYA 3LU2A 1YIXA 4Q4RA 4QEEA 4NIRA 3F2BA 4JBRA 2AQVA 2XIIA 1GT8A 3KTCA 1PIGA 2JFEX 3BANA 3T0CA 3OVPA 2PWFA 2WZTA 3BAXA 2XN0A 3KL0A 3K8MA 1P7TB 2GQ3A 4JQAA 1KR0A 2EPKX 4L64A 4DHGA 2TRSA 3AXMA 4JFVA 4OWGA 5DY2A 1K03A 1KTBA 4HK7A 1OGBA 3CXOA 3B04A 2PPGA 3FJLA 1E4LA 4XAGA 5A6BD 3GK0A 4AZCB 3L2MA 2NV1A 5C7VA 2E0PA 1EGZA 3PZNA 3QQWA 4DO6A 4RUBA 7CGTA 2RHGA 2ZUWA 4IPNB 2OWWA 2Y61A 4GH3A 5K7JA 5ECVA 2YBUA 3HGRA 2PMQA 4DBDA 3M0HA 2VC9A 2PWHA 4CU7A 4YVVA 1PKYA 4C65A 2YKKA 1FXPA 1JZ4A 1SFLA 2EPHA 1W3KA 4J3UA 3WNKA 3PBVA 4PMDA 1KLYA 3P82A 3R6IA 5C9WA 2HJPA 3CT2A 4H2HA 5I03A 4HA0A 1EA9C 3KHDA 3ZLFA 3FJ6A 1SFSA 4WVXA 2O7SA 4B5NA 4IMGA 1RBLA 3E2VA 3NYZA 3KVJA 2F6KA 4F2UA 3B06A 4LVDA 1BSIA 3CB8A 1HGWA 3DGBA 4UFJA 4GX9A 3KOFA 4LBUA 3WF4A 1AZ1A 1HO4A 2AOSA 2WXDM 1FKXA 2C3ZA 3UCQA 4FHAA 1K9FA 2ZZ6A 1YDNA 3S1XA 4WDXA 3EOLA 4MGGA 4D6HA 1B3ZA 5GNYA 5CZSA 3DKLA 4X63A 1O95A 4RNJA 1JGMA 2IUZA 4MAVA 4AXNA 1GORA 3TYBA 1DJYA 1BSLA 1E6ZA 3MZ2A 4UFHA 4W88A 4GNKB 4K2SA 1A47A 3IK4A 3PZQA 2DUXA 4X60A 5LIXX 1BWKA 4BF5A 4AAJA 4RE0A 4O17A 2J27A 3MJMA 1P0EA 3OHMB 4UZSA 1P0KA 3Q67A 1YE6A 5GQBA 4IQLA 1YPFA 3FS2A 5FF3A 1KTCA 1P1MA 1YW1A 4IUGA 3NSMA 4ZODA 4TR9A 1A5KC 1IZKA 3OU8A 5CC5A 1ZFJA 3MYPA 5E9AA 2P76A 3KVLA 1XGZA 3EX1A 3GHUA 2ACQA 2TSYA 4CNSA 3URNA 1KBJA 4ZBCA 2Y7FA 3FIGA 3QLDA 4J3VA 3RCNA 3I3EA 1XIHA 2XIBA 3HV8A 3PWAA 4KBXA 3V36A 1UR4A 1O5XA 1GG1A 3H12A 4MLRA 1XG4A 4XX6A 3UWZA 2GGGA 4EPKA 1ZTVA 4AD3A 1W9VA 1PCKA 1OFQA 1Q4WA 3ARXA 5EMYA 4ZXLA 3IACA 4D6IA 3UQNA 6ENLA 4GXMA 4HBKA 1XYCA 3KDOA 1VAHA 3TC3A 4S2CA 3SY1A 3CPGA 1BQGA 1GQIA 1H62A 2C16A 4DBSA 3ZXWA 3VMPA 3ZSTA 3XINA 5ECUA 4ZTXA 2QDHA 4D8AA 3CPRA 3EDDA 2E6AA 3WMCA 5LSMA 2E6YA 2E3ZA 3NZPA 1K6WA 3W76A 1A0DA 1QBAA 1U30A 2VURA 4LU0A 4US6A 3DAQA 9XIAA 2WMGA 3R7MA 3R8RA 1LBMA 4YTQA 1I1XA 3WL1A 5SWUA 4LEFA 6PTDA 3CBWA 2X05A 3GR8A 3AS1A 1JD7A 4EPBC 3CB3A 3BLIA 1GKRA 3M64A 5HNNA 3UA4A 3T78A 4PMNA 3ERPA 2PDCA 2VKZG 4YTRA 5JXQA 1ECEA 2V2DA 3WF0A 4PUNA 1ZJIA 3CHEA 3WUFA 2WSKA 2WMIB 4W7UA 3ALFA 4DJFC 3RM9A 5A8GA 2V5LA 3EX4A 5G5IA 1YBQA 4RK8A 5C9ZA 4NAFB 2QMKA 1OC7A 1PYMA 4IH3A 5HQLA 1KFCA 5FA5A 1E1CA 3K1GA 1FWRA 2E9MA 3IV3A 4PB3A 3WNPA 3TP4A 4Z2IA 3PVFA 2L5HA 5EYWA 3S9IA 2OFJA 1AUSL 2A6LA 3WQ8A 3P74A 3E49A 3TTSA 3LD5A 3GXTA 3PN8A 3B05A 4UOZA 1FCVA 1MFVA 2HROA 4TX8A 1OD8A 3A13A 5C2XA 2W79A 3A6OA 4ZVJA 3WDIA 1B54A 1EF3A 4QEHA 4MZYA 3CASA 1K4HA 2POTA 1XKJA 3W38A 4O13A 1J01A 2Q3OA 1WOBA 1UBSA 5E1QA 3SCTA 3UNTA 1F8IA 3DEQA 3MWCA 3SUWA 3W00A 4S2BA 2DIEA 5FEWA 1NWRA 4UFMA 3M44A 3WLRA 1WZLA 2DH3A 3DESA 4IOTA 1PVNA 1A5CA 4HA3A 2DW6A 4NT0A 4BWLA 4RJEA 2R14A 2OJPA 3CHFA 5BOFA 1LLOA 5L6UA 4HOXA 4JS3A 1NQKA 1V6WA 3NQ6A 1BG4A 4LS1A 1ECQA 4NQ1A 3V1PA 1E51A 3MWAA 1PKNA 1FDZA 1Z7AA 3VOIA 3UJ2A 4GI8A 2NWSA 1OZMA 2NSOA 2J7DA 3R11A 1QW9A 4H7CA 1ZBCA 4ERIA 3VD3A 1Q7ZA 1N7KA 5CJNA 4IM4A 4RLIA 3RPDA 1TUFA 1MXSA 2P10A 3VIPA 5C8BB 3BH4A 4RW3A 4B92A 4WF7A 3LMZA 1W9BM 2W62A 2G5WA 3R43A 5FSEC 1E6SM 4H1ZA 1W9XA 2PLCA 3GTHA 3VFCA 1EFZA 3V4BA 2PDMA 4QROA 3QKEA 4GC4A 3CZJA 2ZX8A 5DBUA 2HE5A 1NVMA 2PLMA 4C6QA 4EVZA 2WZMA 2GWNA 1LT8A 2GZXA 3PBGA 1V6TA 3STEA 3QY7A 4QS6A 1R3VA 5KZDA 3ARVA 5FI8A 2FDSA 3O0KA 4S23A 1IXOA 2QT3A 1S5MA 2WMFA 4ATWA 5JBEA 3MI2A 4S38A 4E8CA 4F3HA 1UYQA 4HPJA 1XXXA 3CV2A 3STFA 1LF1A 3RCYA 1KBIA 4AEEA 3SCWA 4P7LA 4PSRA 1XH2A 4GNVA 2D2OA 4FNSA 5CCZA 3E96A 3FN9A 4DBWA 1GOWA 1UWIA 3N2BA 4NNAA 2DQXA 3QZEA 1VP5A 5HA7A 1BXCA 1ZY9A 2GK1A 4HMDA 1BLIA 1OWQA 3WUBA 3S9YA 1XW8A 3TOPA 1DWGM 3NTYA 4PL1A 3INPA 2REQB 4MDPA 2OPJA 4RDVA 2X1RA 4OOUA 1RPKA 4HHLA 1AK5A 4DLMA 2JIEA 3W2UA 1BXBA 4OECA 4S3CA 1PX4A 3ARPA 1W3LA 3L5AA 4YHGA 5J04A 3CUHA 3CH9A 4O52A 5AN7A 2JF6A 3M5YA 2W3ZA 3GTXA 3GNPA 3SI9A 4ES4A 1R3SA 3JZUA 3EBVA 1SVDA 3GIYA 3LB0A 3PNUA 4YL2A 4IFKA 2HWGA 2E4TA 4LAUA 1WYIA 4JTGA 3BTNA 5BZAA 4YVPA 1E9IA 4GQRA 5AKQA 3TIMA 4ICCX 2PBOA 3MVTA 4RCXA 3KRZA 1EOMA 3BQ6A 5A8PA 1HT6A 1GQLA 2JKEA 1KM6A 3U2OA 4B4HA 2CKSA 3SAZA 2CYGA 4HHMA 4N7QA 3W1RA 2CPUA 1BHGA 2HMCA 1WP6A 1XM3A 4EF8A 4P8WA 4IJBA 4WK9A 1FCUA 2OSWA 4HNVA 3C5QA 4QAIA 2OO0A 4L9XA 4Q4KA 2A7NA 2Z4GA 5CLWA 4S3JA 1QNVA 5C5YA 3NQFA 4NZ4A 4QLLA 1T7LA 1EXPA 2WK2A 1PZ0A 1U83A 3OQEA 1S39A 2YGYA 1OYAA 3EKGA 3EOUA 5LHFA 4M24A 1F76A 3VKKA 5CBJA 5DX7A 1SR9A 2Y62A 2DVTA 4WX2A 3MTWA 3W7EA 4OVXA 1EBHA 2PI6A 1UD4A 1VEPA 3L2LA 4ACYA 4JNZA 4D71A 2UY3A 4RXGA 4IUOA 5K4ZA 4LUJA 1JIBA 5LA1A 3VU2A 2JBMA 3CWNA 4LQ1A 3BWWA 1IHIA 1QK0A 1KRMA 3LOTA 1JCNA 1WAUA 3E38A 3TYCA 3L4VA 5EBAA 5AYIA 3NCOA 4S1FA 1SSDA 5HWMA 2ZRYA 4XAZA 3BV7A 5A94A 4EAYA 4NP7A 3BJTA 3D0CA 5A1AA 2OODA 1S46A 4RV3A 1O7AA 1M01A 3U5UA 3PWIA 3AMCA 3QMSA 5T26A 1RSCA 1GTHA 2PDBA 5CH9A 2WSPA 1D7KA 5D2VA 4G5DA 1RD5A 3O07A 1NOFA 3IGUA 4R33A 3Q2DA 3GFXA 1ZL1A 1PL9A 1SJAA 3VC5A 2VDIA 3DC0A 1PKLA 3CQJA 3JU2A 5A2CA 3SCNA 5BRBA 2E1WA 3DG6A 1BRLB 4IIBA 4DBEA 3TK7A 3LCHA 4AIEA 1XWYA 5ABEA 3E2RA 3FA4A 4ZEPA 5I07A 1W1B1 5KETA 1ONRA 1TX0A 3K13A 4H3DA 2PURA 3WQ6A 2POZA 2NV2A 3OYXA 1JPMA 1QTWA 4RNIA 5HBFA 3VGBA 3BJSA 3XIMA 4DJEA 1E4NA 3EA1A 4CCZA 1DJHA 1XLBA 5A8MA 1F9CA 4J2MA 1I6NA 1UKOA 4PCNA 4FLOA 1BVNP 4PUWA 4GVFA 2XISA 3KBJA 1LLZA 3F2DA 4GYJA 4L4OA 3UT0A 3R8HA 2ZC8A 1DXEA 2D1ZA 4N6EA 3EX2A 4Z2KA 4DJED 5AVNA 4PTVA 3WD2A 1I60A 2HBVA 1JPIA 3QPEA 3GHRA 4YCOA 3M5ZA 3PK7A 4LFYA 3B0XA 4JIRA 4IIEA 4G2DA 2PDYA 1G7VA 2ZCGA 2P8BA 3VK5A 3ZT7A 1KBKA 2AKMA 1QO2A 1S5TA 2ISWA 4IX2A 3TTOA 3AMKA 3HN3A 2FDMA 4M8UA 3MSRA 1WZMA 2R8WA 4V27A 1L2UA 2YXGA 4GIAA 1KXVA 2VL4A 2DSZA 5D03A 3IIOA 2ACSA 3ZWSA 3I65A 1EPXA 1M41A 5AC6A 3FVMA 3W7GA 2PDNA 1R2TA 1C9DA 1OFRA 1DOSA 2DPEA 1EJTC 4NJGA 1VZWA 4GCAA 1TG7A 3GR4A 4XZMX 3WBAA 1G4PA 2PP0A 3ES8A 2WMHA 1FWBC 5IDIA 2GOUA 4GYPC 2FPVA 4NJHA 3PFRA 2C0HA 4H9XA 2NQHA 3PB0A 4P7QA 3L68A 4DJDD 2PLJA 1BD0A 4F9DA 3W53A 1FXQA 1R6WA 4BR1A 3RU8X 2IPWA 4JY9A 3W3OA 1R38A 2R82A 5BMWA 3E02A 2F2KA 1P7TA 3W26A 4GH1A 5AZ0A 2AAMA 2WZHA 3I6TA 3EX3A 1NDYA 1H50A 1HF6A 4QSHA 1QRQA 1VBJA 5CEWA 2J47A 1CGVA 4JX4A 3AXKA 2X1SA 1UZ1A 5HUPA 3VDAA 4AZCA 1TPDA 1XLDA 1MDRA 1TWWA 1T41A 4OJYA 3P0WA 1E73M 4L6OA 2FZ9A 3PBWA 2FLIA 3S9ZA 3QC0A 4NI8A 3BURA 1LG1A 1ISZA 3GG8A 2I9UA 3KEHA 2GJRA 3N73A 3RUBL 3UG8A 3WYZA 1UWRA 2C91A 2XIJA 1I2QA 3VNJA 2A3BA 3ZJ6A 1CT5A 3WBXA 4CD4A 3OBEA 4CQAA 3D3AA 4QX4A 1REQB 2V3GA 4JICA 1TPEA 3DECA 3RILA 4YMZA 1P43A 3AUOA 4OUIA 1DQWA 1QCWA 2HEJA 4W4QA 1L6FA 4FEZA 4O11A 3EEGA 3FK4A 3S5ZA 1AA1B 4G1NA 1W5QA 1LP6A 2PUZA 4HHPA 4S3AA 1NDWA 3VOFA 2NX9A 3TCSA 5E0KA 4K6AA 1PIFA 1ODUA 3MI3A 3AHYA 4ZR8A 2C1GA 1EH9A 1XH1A 3POHA 1IR1A 3PUEA 4LYQA 4EX4A 4PULA 1QDSA 4XBJA 4TV6A 4LPCA 3L2IA 1EYEA 2DVXA 1XL9A 4TV5A 3U4AA 3T09A 2RAGA 3BOXA 4PTWA 1MO0A 2YIHA 4QG9A 4BCEA 2V5CA 1T96A 4MFDA 1QI5A 2O9TA 3QV7A 1BGAA 2FHBA 1YNQA 1Q65A 3P7YA 1VLIA 1QU4A 1JG9A 4JYDA 4KRTA 1THFD 2VEIA 2VFHA 8RUCA 2YCJA 3ABRA 1Z6KA 1C8VA 3U3HA 2Z2AA 4I5XA 1HJSA 3SGGA 4LGXA 2R6OA 4FA3A 5CXPA 1KB3A 4CQ8A 1GPFA 1FWNA 1J12A 1J10A 3GXFA 1TX2A 5M5DA 3MHGA 3SN1A 3N34A 2J79A 4A29A 4DXVA 3WUGA 4C91A 3E0IA 4Q22A 4Y96A 4PTDA 2EF9A 3DCPA 4IMAA 3OEXA 4E2VA 4AXKA 2J74A 1ITXA 2VRKA 3TN6A 2X7VA 4PRWA 3L12A 1KQYA 1UR9A 4GIYA 2NSXA 1XLMA 4DYKA 2CXEA 3RLVA 1QPRA 2GVGA 3SCRA 4WKAA 3G22A 1YXYA 1D2KA 4AHOA 3NQCA 1JCJA 1KLZA 1V6YA 1WA3A 3B9OA 2Q3RA 5BMXA 1Z32X 1O12A 1PHQA 3YPIA 3LSBA 4AUBA 3KRBA 3VNZA 1XKYA 3SRKA 3EB2A 4C1KA 1C29A 1JJKA 4HN4A 4H8HA 1NH6A 4JTUA 1TPH1 4QQUA 1TPVA 3TYUA 1B3VA 2DEPA 2BNJA 1P0NA 4U10A 3BCFA 2QJIA 5IDZA 1P6BA 4HNOA 4AD0A 4X3ZA 2J7CA 3GG7A 1SO4A 2BSLA 2GSJA 4CGTA 4L4PA 4I8DA 3TC7A 3WD1A 1IGSA 1ZJBA 5A6JA 2QCCA 2C7FA 3N1AA 2ADAA 3CZGA 2WMIA 2XWDA 1M53A 1BTCA 4AZ7A 3SCOA 1E4MM 2VWTA 2I1OA 3AXIA 4W85A 4DNHA 1GKPA 5JBDA 5C55A 4NAFA 4MZ1A 3LHZA 4U28A 3XISA 2O9RA 3WH6A 1M03A 3CQHA 1LRTA 3MUZ1 3LTPA 1BF2A 2QMJA 1Q6EA 2NWRA 3O9NA 1GTEA 3HG3A 3SQMA 2J7BA 2P0OA 3VE9A 1C3FA 2ATMA 4A22A 4D2JA 2PDXA 3QYQA 1XSJA 4LV9A 1CZ1A 2RDWA 3LHYA 3TQKA 3VDGA 2HXUA 2EPMX 3O0FA 3ALGA 3LI1A 3EB3A 4Q32A 3L5MA 1J18A 3KCOA 2HCVA 4MMWA 3KLLA 3P2VA 1KQZA 4UXDA 5K9DA 2DZSA 2EJAA 3CNYA 2YA0A 3HA1A 5I3HA 2X09A 2QXWA 3KZSA 3IGHX 1TCMA 1KFWA 1VENA 5ABGA 4AX7A 2Y85A 3NOYA 2CLEA 1KWKA 1ZZMA 3RDKA 2WC4A 5A6LA 3TSMA 3AWOA 5CBIA 2DW7A 1F61A 2DT3A 3VKAA 3DFYA 4XBKA 3LBOA 1FHUA 1YEYA 2WMKA 1ELSA 2YDSA 2GLKA 4QG8A 5MKGB 2FYMA 2JIWA 2PDHA 3KUMA 3FSTA 2QCMA 3R4IA 3OLDA 1A3WA 4MB5A 3W4RA 4MKVA 3C2YA 1U5JA 1UW9A 1I9CB 2C19A 3WD0A 2AL2B 3QV8A 3EKLA 3RO8A 3G6MA 5FEPA 1JZ6A 1RLDA 1R46A 2G3JA 5EGRA 4J3SA 5KZMA 3IGSA 3WY1A 5I77A 3PG8A 1N8IA 3B0PA 4J40A 1OIMA 1GVEA 3WUEA 1WOAA 3G1AA 2OEMA 4B5SA 1ZB5A 1VIZA 1JDDA 2ZE3A 3QEZA 4K38A 1S38A 1H4PA 3MBDA 3CL6A 3VM7A 3CEPA 2QF7A 2C1HA 1KO0A 3MKCA 3BLOA 3GHTA 4JEJA 1PO9A 3EPOA 1R7AA 1JGIA 1MRAA 3O63A 2Q09A 5G2WA 3TQPA 4B2DA 4RR4A 1DTNA 2GGEA 1AQ0A 3RJXA 4HA4A 1E0XA 4PMJA 2X2YA 3TWAA 3KS6A 1CTNA 2QS8A 3KZPA 4MJZA 3QN3A 4QCFA 4ZMGA 1UJQA 4PMOA 1OC6A 1FWGC 3GVVA 1R86A 4CN4A 4M81A 2DIJA 1XX1A 4IT1A 1EKOA 3VMNA 4QQ3A 2DJLA 5D2XA 1GVRA 2GQAA 3L4XA 4IIFA 3UR2A 4LUTB 1I0DA 5DCDA 3OZOA 4JTTA 1E1EA 4B2DD 3ARSA 4BI7A 1OC5A 3BDKA 3HPZA 4FOUA 1D3CA 3DHFA 4E4PA 5I2UA 5CKSA 4ML4A 1NU5A 1XIDA 1VS1A 3VDHA 5AB3A 3STPA 4FX8A 8XIMA 1TZ7A 1O94A 3GM8A 1J2BA 4ATDA 1OT1A 1SW7A 3U6WA 3UY8A 2ISVA 3NPVA 3VKDA 3LCFA 3AHVA 3TN5A 1J96A 2REQA 3KOZA 3NM1A 4MY9A 4UC5A 3U2ZA 1KKRA 3VZYA 3M46A 3NL5A 1H0IA 4LXFA 3W82A 3WJSA 3GUWA 5IHSA 1I2RA 1DIDA 3LPGA 1P48A 3H4XA 2HTMA 2VGBA 1W9PA 2NLYA 2VC5A 3BLPX 3TONA 1WDSA 1LOSA 1JF6A 5LIYX 1NFPA 3UVIA 2G0WA 3HU7A 3B8VA 1JZ7A 2WCAA 4HD5A 2D20A 1EDTA 2A6NA 3B8WA 4C6OA 5D30A 3MP3A 3RM4A 1TREA 4LAKA 4Q8OA 1W0MA 1M7JA 2Y8VA 3M47A 2OYLA 4K36A 2CNCA 3O6AA 4QR6A 3GD6A 3KX6A 2VX5A 2GJNA 4ERGA 1JQXA 3GG0A 3O6CA 1EP2A 2Z1WA 4JTAA 3PZTA 2PRHA 1KRBC 2I14A 4AISA 3W6LA 1A5NC 3N6JA 3CIWA 3PJXA 3HQ1A 3SB0A 3R94A 1XDJA 3P67A 1UKPA 1CLKA 1TZ9A 3W85A 1XINA 2Y8UA 3P61A 3LDVA 4CVUA 3S46A 3MY9A 4AIBA 1NP2A 3R2GA 3QOKA 4CEXC 2E40A 3CTLA 3EDEA 3PG9A 4FB7A 1SUXA 5KZ6A 3WO8A 3QZAA 4MADA 1FFQA 3AHTA 5XIAA 1R2SA 5BROA 5K9CA 4WJXA 3CAVA 4ADSA 1J0YA 1SGJA 1YXCA 1WNOA 2GSHA 3GKAA 3I3BA 3PPFA 1V7AA 3UWYA 4UTTC 4S39A 3C3UA 1OFBA 2G50A 3NQ7A 2YFNA 1BYAA 1NTHA 3UVAA 3U5YA 1VJIA 3WBYA 1JAKA 3L65A 4Q4QA 3W24A 3MT1A 4NJJA 1OBAA 1CX9A 2WZEA 1M1BA 2D22A 3UPMA 3WJYA 4LCSA 2NXHA 2BBFA 4B4FA 4EXBA 3B8SA 5HR7A 2WJDA 2PODA 3RLHA 3VIMA 3ZJKA 1BRLA 1O66A 3AQUA 3LCWA 1WKFA 3AZTA 2PWVA 4XB3A 1KM5A 4KCUA 2Q01A 1ALDA 2CU0A 3F4DA 1V3KA 4PRTA 4W7VA 3P93A 4LRTA 2CBUA 1RUSA 2DZTA 1L6YA 1W3HA 5F2MA 5T91A 3AIUA 1DHKA 4EXQA 4JTSA 2HNHA 1PX8A 5AC8A 1TKKA 3HFYA 5DELA 4UTUA 1V6VA 4PTMA 2UWFA 3NDYA 2FZNA 3F4WA 6TIMA 5LA2A 4JKMA 1FA2A 4CNNA 1ICSA 2DZVA 2WCSA 3SGUA 2PRMA 2J6XA 2OQHA 3LTSA 3PUOA 2HVOA 3NAVA 1JCTA 2LLEA 5KZEA 3TLQA 1S2VA 1TV7A 1XRSA 1J0ZA 4FR6A 2OLAA 2XJ7A 5E9XA 2G96A 5TAOA 4PUMA 3GU1A 1IEXA 1IWBA 4H6RA 3S4TA 1S3HA 2QVNA 2WNZA 1E6PA 4WHBA 4H7ZA 3VIHA 2GQ8A 1TZZA 3B8TA 3NUKA 1RCOB 4LUYA 3WJWA 3P3BA 3WSUA 3NGFA 3W1PA 3G18A 4Q3MA 3FGCB 3H8AA 1KM0A 3OPSA 3LEPA 3U7BA 3CGTA 4L65A 5I02A 1UMYA 4IQJA 4GQ0A 2QJJA 2GUYA 1T8QA 3HIJA 3GW3A 4ALDA 4C6EA 1TMHA 3LQLA 1GYNA 1B5TA 3B9EA 1JRCA 3HURA 4O28A 1V3JA 1O6IA 4ZB0A 1OJXA 4RW5A 4TU1A 1CENA 4QE4A 3QR3A 3LM3A 2Z0IA 2HVNA 1W3NA 3DYPA 1RK5A 2V8ZA 2YB1A 4HPXA 5HMDA 1BYBA 3LSCA 3W22A 4HSOA 2Y4SA 3OG2A 1ZUAX 3U0HA 3NPXA 3KTSA 3WK3A 3L4YA 3H4GA 1JZ2A 1FTXA 4O50A 3VA8A 1JVNA 1CBGA 4H9ZA 3E3HA 1BWVA 3H26A 4H41A 3S42A 3GO2A 3HBLA 2GQ9A 4FALA 1QNPA 4LAOA 1T40A 1TWSA 3TVAA 3DH7A 4M29A 3W02A 1VFMA 3SN4A 3WIJA 2Y8KA 3W2NA 2PFHA 1PDZA 2ZOXA 2DJXA 3MKVA 2VRJA 1VPYA 3NQGA 1G6CA 4JN7A 3AXHA 3MJYA 3RX3A 4Q8WA 1DJIA 1PJ9A 3SSJA 5DFAA 3V75A 2Z1VA 3G2GA 2AKZA 2VHLA 2XH4A 4E4FA 3V7PA 1QHZA 1GYMA 4JIPA 4HOZA 3GG1A 1EQPA 3VNMA 3LGGA 4LNYA 3WQFA 3ITVA 3LG3A 2ZZ1A 3EDJA 3FDKA 3FX4A 4TMCA 2CHRA 1V3IA 5C2CA 1FDYA 4LY4A 4RXFA 4JDBA 4LALA 3UWUA 1REQA 3EGJA 5JMUA 4UFLA 4IPJA 4Q8PA 2PTDA 4OT7A 2RJGA 5LNWA 1CXHA 2XFYA 3ZLGA 5JBFA 3VGDA 3R13A 2R91A 2BY2A 3L5LA 4DPQA 1ZBWA 3NPWA 2WKGA 3DHUA 1G7UA 2D0HA 3IARA 4US5A 3WLOA 4DLFA 3W2LA 1GOIA 1MYRA 3DFNA 5LHEA 3HTWA 2OXNA 1PKMA 1EL3A 4HP5A 4BQ2A 3WMBA 1HJXA 2VC6A 3MP4A 4DO7A 4CU8A 4EACA 1G1YA 1JDCA 2D3LA 1V7YA 3N2OA 2XVLA 1M7OA 4J28A 1UB3A 1OHLA 2JF7A 4PODA 3FKRA 1RV8A 1W31A 3ZO9A 1IE7C 1CYGA 1R9ZA 1J11A 1TQXA 1W8GA 2VFGA 3OVQA 1S1PA 1QUMA 2VNCA 1K8XA 1OFEA 3P8IA 1RHCA 3OW1A 4AG0A 1QOPA 3G0SA 3ABZA 5LGXA 2I5QA 1G5AA 5CQ1A 1GZJA 1PZ2A 2ABBA 1VB9A 2OR2A 4QGCA 4JNMA 3L21A 2PGFA 1JZ3A 3WH5A 3B0VC 4HZ8A 1ISYA 3JVAA 2EHHA 4B5VA 3FJNA 3EMZA 3EB4A 3LY0A 3UBPC 2PA6A 2ZZ7A 1TE6A 5H8MA 1WXJA 2BP1A 4QG6A 5AYBA 4U4MA 4O0ZA 1YTEA 4GRSA 1DVJA 2C8NA 4ZOCA 1PDYA 2WSYA 2OCZA 1DQUA 2VDGA 4GY1A 1US3A 3W7PA 2QDEA 5EKYA 3GH5A 2WJFA 3SM0A 5IFPA 5F1UA 4Y9OA 3TTYA 1IV8A 3EA2A 3QC3A 4FLSA 2F7FA 1VHCA 3DU0A 1LLWA 2V5DA 3W28A 1X8CA 5E0FA 2OGYA 3G8EA 3PULA 4ZFMA 1SU5A 3GIQA 1BFNA 5HAOA 4D6DA 3HO8A 1UWSA 2A1YA 2FHCA 3VNLA 1XISA 2QR6A 3MHFA 1RXOB 1S5WA 1UC5A 4I9TA 1KV8A 4HPHA 3HM7A 3RXZA 1VCFA 4IGSA 4HNUA 4H9VA 2VJXA 3M6YA 5AZ1A 3L7RA 3I6RA 1EUAA 2NQLA 2E67A 3UCDA 4GUIA 5A6MA 3MMTA 1M3UA 1RCQA 3LERA 3VNDA 3DHDA 1AQHA 1XBYA 3GIPA 1K6AA 5LYRA 2YJQA 3GE7A 5LNSA 3ITOA 1XBXA 1S2TA 5TNVA 3N3TA 3VGHA 4K68A 3NQVA 2J7FA 4K8EA 4DJFA 1G01A 2J7EA 3W23A 1PCWA 1OSEA 1HVXA 1PZ1A 2NV9A 8XIAA 3U2CA 4AD1A 3EKZA 1JYXA 1JCYA 2Y5SA 4IIDA 1XGEA 2VR2A 4HCHA 5H6HA 3R1ZA 3SIMA 1H63A 1F73A 1EJXC 3L0NA 1F8MA 4IP4A 3THCA 4NG3A 2BFGA 2VX7A 3DERA 4HNCA 4DJFD 1XIMA 2QJMA 4AY8A 4WRHA 2BWGA 2XM2A 5CSSA 4EP8C 5H2ZA 1CDGA 4IXXA 3CQ0A 4UTIA 4S3KA 1DV7A 5IM51 4XZWA 4U33A 3AALA 5BW6A 2GFTA 1EO7A 3WD3A 4GHRA 1HTIA 4Q7NA 2OOFA 2XGBA 5M03A 2PLKA 4HU3A 4MAZA 1VRXA 1YYAA 2CZDA 3C0QA 4AF0B 4ZGYA 1F3XA 3GZ3A 3O8AA 4FS9A 3HQNA 1N55A 3MQTA 5CG0A 4IIGA 4DM2A 1MQRA 3BLLA 1PAMA 5C7HA 3P62A 1M04A 1ZAHA 2WQDA 3T0DA 4UQDA 5GJMA 3N11A 1FUYA 3U7VA 2B31A 1NQ6A 5HPCA 1ITCA 3PZ9A 5MKGA 3WQOA 2WM0A 3UR8A 4ORMA 4LW7A 3S2NA 4AD4A 2DDXA 5BXSA 3A23A 2AL2A 2V5JA 3A4WA 3W1QA 1BVWA 2XINA 5CPQA 1AVAA 3DFPA 3V5FA 3VCCA 3WD4A 2Z28A 3IGXA 3S5SA 1ZJAA 3OB8A 4L6HA 3TAKA 1EC7A 1A80A 1GQKA 4O0KA 3NZGA 1UR2A 4WZHA 2FH6A 1MMFA 4JHZA 4WOQA 2HK1A 2YBVA 1OFAA 3JW7A 3CC1A 1ITQA 2NXIA 1MWOA 4EXAA 2G4FA 2Q8XA 4ZO8A 3GFYA 5E5CA 1O5QA 5CZJA 3WK0A 1XQKA 5E6YA 2QCNA 3W6MA 3TFXA 1OYBA 4JIIX 4DZAA 5EMUA 3LQGA 1ZNNA 4LB3A 1FP8A 4TVDA 1M5WA 1ODZA 3SCUA 4UQBA 3BLKA 1E71M 4RDWA 3VIIA 4JKKA 1W3JA 3EWCA 3IJIA 4TQTA 1E4IA 4PB5A 3C2RA 2V68A 3ARWA 4IMFA 1LYXA 2FMNA 3AU2A 3C8NA 3G3MA 3NSXA 4WSJA 3A5VA 1T8XA 3SJ3A 3K8KA 1K7EA 5D4YA 1UD6A 2WW5A 4U3AA 5KEZA 1TJ1A 1TV2A 1Q7QA 2DP3A 4GOAA 3CZ8A 5DLCA 2DSUA 4XUYA 3GW0A 5C71A 2FVLA 1KFLA 2GVEA 4JIQA 2ZA1A 2O7QA 3QVQA 3UZ5A 3KAOA 4F0SA 1SFTA 2PP1A 1MEWA 2FB2A 3AMDA 4K1WA 4A8RA 5HPOA 1LOQA 3TYDA 4WJ8A 2PF8A 1NWTA 1R9YA 1JZ5A 5BNKA 2W63A 3FYPA 1B2YA 3QRHA 1KM3A 5FL0A 3RK8A 1B57A 3IJ7A 3BOLA 3LCGA 2RGLA 3C2VA 5HQEA 1YHTA 4C1LA 3W88A 2ZFAA 4NX0A 1KCXA 4CCCA 2J78A 3EMQA 4QDMA 2NW0A 4MY8A 4D6GA 3UZZA 2DZBA 4AWSA 3CK5A 2GJXB 2E5DA 1ZSXA 2Z27A 1RJRA 4FXFA 3O05A 2VR5A 3M16A 3R10A 4DZHA 1VPQA 3AISA 2CEQA 2XH0A 2VGFA 1T99A 1QNOA 2HZGA 1UWQA 4GX8A 1UZ4A 4GUHA 4Q7IA 1BYCA 1B3XA 1QNSA 4XAYA 2H9AB 3DZ1A 4M51A 3GDLA 3SFKA 3VE7A 3B4UA 3NM3A 4JQ3A 2KAUC 1W9UA 5D9MA 4WXZA 4FX6M 4UQAA 3PSVA 2XSXA 1AH0A 4R34A 4LUSB 3TROA 4Q4SA 3ENLA 3JRKA 3FYYA 2E5BA 4F2TA 3UETA 5H1WA 4IP7A 4MJ2A 1XHGA 2YCEA 5G1MA 2VX6A 2QAFA 1ICPA 1QW8A 2VI0A 4NJIA 2ZZ4A 3QGVA 4B90A 1LL7A 1R0MA 3EWWA 4B16A 4RZ6A 4IGHA 4QAWA 1H7XA 1XYBA 1J4EA 1VYPX 1RP9A 3RIKA 2A4AA 3UG3A 1V08A 1O68A 2C79A 1ADOA 3UXIA 3N29A 2WMJA 6CGTA 1F7BA 1FWIC 3PBYA 2JQXA 2YLLA 3N6HA 4A8IA 2I5IA 3PC0A 2E1DA 1UQYA 1XIBA 2ZIDA 1TPUA 4B5UA 1JRBA 5I3KA 4Z2GA 1F3TA 1OVDA 4Y9PA 4ML9A 2CZFA 4E38A 1LOLA 3MSYA 4X2PA 2PDLA 3QH2A 4PBFA 4AZBA 3GLCA 1A5LC 2G3NA 1GHSA 1UA3A 4RE3A 4A05A 4J27A 2P88A 4QHRA 4IFRA 3DENA 2VGIA 4XUGA 4F0KA 4MVAA 2BOFX 2J77A 2WSRA 4J35A 3C8FA 3GC5A 1XGDA 2RDXA 1PWMA 2CLKA 3KVMA 3KOYA 3CJPA 3W7OA 2DZPA 3TWBA 1GGOA 4AU0A 1V3HA 3ID7A 4AEOA 1W54A 3AS3A 1A0CA 3AFBA 3CMGA 1X39A 1H41A 1ZALA 4HPGA 2ZRXA 1RZMA 4ICMA 3MZNA 3CO4A 4UTWC 1Q6OA 3UZJA 1XYFA 3SEPA 4BA0A 3LBMA 4J7RA 4DX3A 5FKYA 1UUMA 2Z26A 3BOFA 2WNQA 1E72M 1O5KA 4C5ZA 1DQXA 3RRAA 4DUOA 3TLLA 3CT7A 1H1YA 4UNLA 3OO2A 1V93A 3QV9A 3I4KA 3FVDA 2BOEX 2Z2UA 1UWUA 2DSKA 1FH7A 3CU2A 1TTQA 5I0DA 3GDMA 3DFHA 1BKHA 2F6UA 1Q6CA 2O4QA 1DE6A 2J13A 4L4MA 4LNCA 4U5KA 4GYFA 1Y65A 1YXDA 3QR0A 4S3GA 1BGGA 4WD0A 3FGCA 4MWAC 3O3RA 4XVDA 3S6DA 1S2AA 1F6PA 3DC8A 4FLRA 5J5RA 1TPFA 4A2RA 4QJ5B 1X6LA 2XFRA 3MUXA 3DDMA 4U2ZA 3BVJA 3HB9A 1UD2A 3QM3A 1Q6RA 2E25A 1K7XA 1S5NA 3C3NA 3RR1A 1RVGA 4P7OA 1ONXA 1P5BA 2E6FA 1A5MC 2QJNA 1EJSC 1EDQA 4GNJA 4S3DA 3DYOA 2ZTJA 2WKLA 4LY8A 3PP7A 4AIUA 1Z9AA 3ARZA 3AZSA 4G9PA 2VUYA 3E2SA 4LC8A 4NI3A 3OLIA 2QUTA 3T9PA 5CJMA 2BODX 4KEMA 4ASTA 1TMLA 3STGA 2PB1A 3W1TA 2Q71A 4GYPA 4FZIA 5A2BA 1NY1A 4WQ6A 1P6WA 5F1VA 3UPWA 3QPYA 1H09A 3AIQA 4L61A 4NXKA 2R1LA 3EWUA 1D8CA 4A8LA 2MANA 1AG1O 4FNTA 3FEMA 3D6NA 4F48A 3W71A 1W2VA 1LL4A 4CQBA 2IW0A 5A6KA 2EG7A 3N2XA 3AU6A 4ZTYA 3MO4A 1UH4A 6REQB 1PV8A 2EKCA 2VC7A 4EANA 3THQA 1ZBVA 4LVBA 3VGFA 3GU2A 1Q66A 3T0AA 4AY7A 1MDLA 3ELFA 1J8VA 3AS0A 3BG5A 1VFSA 2NVAA 1C8XA 4AVNA 1HP4A 3N4AA 1GVYA 5EFDA 2NUYA 4N9EA 5D8ZA 4ILSA 4M6VA 3S2JA 4B5WA 3EOSA 3R0DA 2DT0A 4DY1A 3GTFA 4ZQOA 5D2YA 2V3FA 3C4UA 4WUIA 1A4LA 1K1DA 2DZAA 1H49A 1QPQA 3CHDA 5DXXA 5HUOA 1UWAA 4XG1A 1I45A 1B4EA 4JFWA 1BPLB 4K37A 2PTYA 3EWYA 4XV0A 4HIBA 4AVOA 5ABTA 4MIMA 4IF2A 1FKWA 1CWYA 2PSNA 4I9JA 3EX6A 3WJXA 3WENA 2ZX5A 3V0UA 2YA1A 1U2YA 1KBLA 3I68A 1GW1A 1OADA 1RBAA 3NOEA 4IXHA 3F5KA 2V82A 4PMVA 4BEUA 1SZGA 4LH8A 3UJFA 3H24A 1J79A 3KS5A 3M7WA 4Z1DA 4BJHA 4O14A 3ZVHB 1L6SA 4H9YA 4HU0A 4DN1A 1LTDA 2ZUSA 3WLLA 3WH7A 3F5LA 1YRRA 3F03K 1JPKA 1L9WA 4PR4A 3FYOA 3UXDA 3CAWA 5GPRA 1SO3A 2JEPA 3CAQA 3O7UA 3ZS4A 3IK2A 1GJUA 3IV8A 2B7PA 2GWGA 4ZENA 1OINA 2WO5A 2IKHA 2ZC1A 3W25A 5CPNA 4JIHA 4S3FA 1A49A 3VABA 3OVGA 1DHPA 2GL5A 3LENA 4O8RA 3S1VA 4FLQA 4PMRA 1JXKA 1Q6DA 4B3LA 4HYWA 1XSKA 3TE9A 1K77A 3UNDA 2ZXQA 4JEQA 2YA2A 1E0WA 3RU6A 1EC8A 5CGMA 1GK8A 3IS4A 4IMDA 4LB4A 5JIWA 1XYZA 1B30A 4PRRA 1ZPTA 3GDBA 2A3AA 4MJ4A 4F0HA 5EY5A 3P60A 1F4AA 3W70A 2ZUMA 3QFWA 2BY1A 3PR2A 5FCZA 1X7FA 2F38A 1W2PA 4I3GA 2Y1HA 5HMSA 5E09A 3UYIA 3VI2A 1GJWA 4L9YA 2QPSA 4RV8A 5FEXA 2VP8A 1XRTA 3EPMA 5AHMA 4GACA 2OSXA 1LM1A 1I8JA 3SZ8A 2HQAA 1KGXA 1PSCA 4UZUA 4C6CA 1XCXA 3A9IA 5I09A 4GO9A 4WY0F 1ZP3A 4LVFA 2WJEA 4O4VA 1MUCA 7REQB 3JR2A 1V6UA 4IFOA 1OFDA 5A8NA 1VHNA 2ZRWA 3KBWA 1TR9A 2CLFA 1XUZA 3RF9A 5AYZA 3ARYA 2V6AA 4AC7C 1S1RA 3R25A 3TSBA 1OX4B 3W86A 4JD4A 1B90A 4AYGA 3F4NA 3HG4A 2BVWA 3T4CA 2UY5A 3T81A 5DRIA 1HKMA 4C6KA 5CGQA 3SIZA 2CESA 3S5OA 3VKBA 3KP0A 3NGJA 1W1ZA 3T1GA 4N4QA 2YW3A 1XFCA 1YDYA 4GUJA 1MFUA 3TTEA 4KIRA 3WL0A 3IRDA 3N19B 4K8HA 5TIMA 3I3DA 1JFHA 4TXEA 1M7PA 3GTNA 4QITA 1WZKA 2QIIA 4RDYA 1MRQA 2YL5A 5EB8A 1E15A 4P8VA 2ZX7A 3LCXA 4GABA 4YJ5A 1DBTA 1XIIA 1VFOA 2FVMA 4XKYB 4R27A 3I7SA 1W1TA 4LF1A 4TX9A 3STCA 3BO9A 4XD5A 2WHMA 2Z1BA 3APTA 3M4HA 5GVJA 5C2GA 1JDFA 4ONVA 3NDZA 4LWWA 4LYKA 3E74A 3WFLA 3N4EA 3M1ZA 3NDOA 3RMEA 2AQOA 4TVCA 4CN1A 4AWTA 1TWDA 4KGJA 1OFOA 1PHWA 3PPHA 4RPPA 4HJWA 5HOSA 2B81A 3NA8A 1NWUA 4AVFA 4QBXA 1WXZA 3W1MA 4HGXA 3HOJA 2XH2A 5A6SA 3CQIA 4GO8A 1CNVA 4DZIA 3E0FA 2DIKA 4HYRA 3TV8A 3E12A 2BTMA 3MPGA 1FWWA 1A5SA 4H8NA 1GOKA 2QDGA 2DVUA 2PZNA 3ZLHA 2H8ZA 4FF5A 3DFSA 2ZDRA 2GDUA 1H7WA 4AF0A 3WMSA 2DT1A 1MSSA 1POJA 1CLVA 3M0ZA 3N6QA 3FKKA 2X8RA 5DANA 1WE5A 1RJQA 1TPC1 5AHLA 3ZOAA 1HUVA 2WC7A 1Q8JA 2PZ0A 3MUIA 4HA1A 3UP8A 4Z17A 3VCRA 2Y5JA 3R89A 3T44A 4E3TA 2RH9A 4KWSA 4W5UA 1MW0A 5I3GA 3L67A 2EO7A 3TR2A 1C93A 1YX1A 5EU9A 2VENA 2OO6A 4MNMA 3W7NA 1VH7A 3VTRA 2DY3A 3GC4A 1TV3A 1KFEA 2BV9A 3PSWA 1SJCA 5FESA 2CLOA 2BXZA 2WWDA 3T07A 2CETA 1FOBA 2Y7EA 2V5KA 3B03A 1JUKA 2R94A 1HFBA 2PDQA 3K46A 4I8YA 3IUIA 4HU4A 4HOWA 3V3WA 2ISFA 3GKFA 3FJ4A 3PJTA 1W3TA 4DAIA 5IBXA 3VKCA 1HX0A 4YYFA 2AL1A 2PDPA 3HJEA 1KBBA 4P8UA 3UZXA 5CBBA 1ME8A 2XFWA 1X38A 4LEQA 3VKJA 5I7GA 1OEPA 4UOQA 3WEZA 1FWFC 2XTKA 4B5XA 3W83A 1PXGA 4M1RA 2WV8A 4IL0A 4O1FA 3ITCA 4MNJA 1X1NA 3CYVA 1H11A 4MB1A 3PY2A 2ZBTA 1ESWA 2QCLA 4NZ3A 1TA3B 4IJCA 4PZVA 2CHOA 1TVNA 4C6DA 4KGLA 2XH7A 2PTZA 4DUXA 3U48A 5I23A 2Q8ZA 1UIPA 2IXUA 3MUCA 2FTPA 1BVZA 2H6RA 1KD0A 3OOQA 2GDVA 4HNTA 5PTDA 5FAJA 1NJJA 5HK4A 1CECA 3SGZA 5CSYA 2QQ6A 5DN1A 5IOBA 3S1WA 4D6EA 1DXIA 1GQJA 3R0UA 4W8LA 2Z25A 1JD9A 2OWXA 3E0VA 3A4AA 3HMCA 1TV5A 2A3EA 5AHEA 3VIFA 3BG9A 4M1BA 1YNYA 4XAFA 4CVWA 4ZOAA 4Z42C 3PUDA 2DT2A 4M3PA 5D9OA 1B9BA 3MYOA 4R9OA 4R7WA 2ODOA 3B8UA 1BF6A 4O8AA 4MY1A 3B0UX 2YCIX 4GI4A 3AC0A 2EAWA 2ZUNA 1UD3A 1PYFA 4OUEA 1TIWA 1Z8AA 3V18A 5A6TC 4KMQA 4EE9A 1BAGA 3FHQA 4I6KA 4DNMA 3TYAA 4ACZB 2X16A 4KWVA 4C6JA 3IUHA 1W1A1 2CIPA 3S2LA 2D2HA 4HTBA 4DM1A 4P7RA 3NQBA 2V2HA 2Y2WA 9XIMA 2ZRZA 4CCDA 3MMUA 2Z1SA 3G1XA 3IJ9A 1FVPA 4JX5A 4Y8FA 2GJXA 3G0XA 1J6PA 2I57A 1LBLA 2YPIA 1ZU8A 2VTFA 2NLIA 3IPWA 5E6ZA 1IIGA 3GXMA 4HZMA 2V63A 2P50A 4GZIA 4QLJA 3FV9A 4ZB2A 4HZ7A 4HK6A 4FR1A 1ZJHA 1C92A 5CG7A 1C9WA 3W01A 2H9AA 3T0TA 3IUDA 2VELA 3BGAA 4MSSA 4F9JA 2ALDA 3TNOA 3RAOA 3HFTA 4N6FA 1Q63A 2I7GA 2V30A 3B8DA 4LUSA 3BICA 1LJYA 5U4NA 2D3NA 4PMQA 1L0PA 1Z44A 4HZ6A 5CAHA 2Z6IA 1QI4A 1OZQA 1F2JA 5FD0A 5FJPA 1AQFA 3BMXA 3WNLA 3CUJA 1NFGA 4X9YA 2DGAA 2AMXA 3MV11 1H0GA 5FOOA 1VYSX 3USBA 4P7NA 1YTDA 2E77A 2O0TA 5LNRA 4AB4A 3ITTA 3D47A 4H4IA 1P0DA 3QLLA 4GCXA 1DIEA 2Z1XA 3RCMA 3UR5A 3NURA 3PF3A 5ABFB 2PWDA 4L4LA 4GUFA 4HMCA 4F2BA 1G94A 4UTTA 4ZO7A 4HMEA 1HVQA 4G56A 1WKYA 3WQ5A 3WQGA 4V1XA 3VOJA 1HKWA 4J9JA 4R7OA 4DUVA 1Y0EA 4BS0A 4UFIA 1R3RA 1TQJA 4HB7A 1AODA 3QY6A 2Y88A 3QOMA 2EG6A 4E2BA 5D33A 2CBVA 1J0JA 4PCPA 4FXRA 3UXLA 2CBIA 2WHJA 4LJ3A 4HKPA 1WPCA 3SRDA 1X96A 2J7GA 1Q45A 3R8GA 1OX6A 3VIOA 1GPWA 5DXYA 3WLNA 3ITGA 4CLMA 3AIRA 3KBVA 5FACA 1V0NA 2OZ0A 2VOTA 4NRRA 5C0QA 1DJQA 1YTKA 4DF1A 4CQ9A 2ACRA 3LHWA 3Q45A 1Q8AA 1PWLA 2TODA 2FQIA 4XVEA 5CSRA 1B3OA 1W1VA 1EP1A 1POKA 4X22A 4KPLA 4CQCA 3II1A 3N14A 3ZWTA 1IWPA 4PEKA 2QVHA 4ORIA 2Q8LA 4BKNA 4KEVA 5FF2A 1UR8A 1LQAA 3TC6A 2VM8A 2QV4A 3G1RA 3LGEA 4CD8A 3KXQA 3H22A 3ZZ1A 5EMJA 3BMWA 3AMGA 3BMVA 4ECLA 3RX4A 4I7VA 1OY0A 4GPNA 1RY8A 5AC7A 2IKGA 2OLSA 2Z7GA 4IPPA 4G8TA 2DQWA 2EGZA 2EPLX 2QNEA 1XFBA 3LV6A 3OYZA 1WUFA 2WQPA 3RPTA 4GWEA 2ON3A 4X61A 4ZFCA 3IAQA 1NWSA 1L6WA 4E0CA 4MWAB 2G3MA 3C56A 2G8ZA 4XKMA 4Y90A 1FWEC 3MC5A 1UMLA 4M6PA 1AJ2A 4XQ6A 1SZNA 3SURA 2VT0A 1G4TA 4MDOA 2G4JA 3NQEA 4AZIA 5CLTA 3RG6A 4UCGA 3H2FA 4JTDA 4LSBA 4F4RA 2PDIA 1FH9A 3TJXA 1ADDA 2O92A 3W7LA 3OQ8A 2D0FA 3GH7A 2PGEA 1R3YA 1MUWA 1R7OA 1E6XM 1ZS2A 3DGRA 3KBMA 2F9RA 5FJUA 1SW3A 3DUGA 1TTPA 2W91A 2BASA 2A3HA 2XSBA 3W7QA 3MBFA 3WLSA 3BLEA 1Q6LA 4K1GA 2PWUA 2D2JA 4W84A 3N4FA 1L6GA 1XLGA 1LL6A 3OIXA 1TV8A 5EPDA 1HXJA 1EO5A 4PYSA 3GB6A 1XLHA 2O9OA 3MMDA 3FAWA 3EXSA 4JFUA 5LIUX 2EPOA 5G1TA 1QASA 5M17A 1TR1A 2VRQA 1TUXA 2DZUA 2P8CA 5AVHA 1K9EA 4V15A 3K4AA 4NYYA 2ASHA 6REQA 1WDPA 3EWBX 3TXVA 1NIUA 3G24A 1M65A 3LUTA 5DMMA 4W7WA 4YYCA 3CMFA 1RLCL 4L1XA 1JI2A 3W0KA 1Z69A 1F07A 1OQFA 1D3HA 5KSWA 1LDCA 2QZRA 4IISA 1QOQA 4C60A 5K4XA 3DX5A 3WNNA 1HO1A 4NF7A 3FA5A 4PMYA 4GZJA 1JDAA 2ATSA 5AFDA 3WEOA 3UFYA 3QY8A 2CCRA 1QT1A 2PP3A 4MYAA 4REQB 3QZ6A 1CIUA 2E28A 2TPSA 4GQBA 2ZICA 3GFZA 2O55A 4NSBA 1M7XA 2TAAA 3NQDA 2OQYA 3CZLA 4PCTA 3L23A 2P5NA 2OYMA 3PBMA 1H2JA 3C2EA 4D1IA 1X1ZA 3U8GA 4ZQNA 2TYSA 3NZQA 2VZTA 4C6LA 5D32A 4QJ1A 2DORA 1S5VA 3AIBA 4AH7A 1O60A 2BXVA 2OKOA 1KCLA 4DWSC 4JYEA 5I3JA 2PWEA 3AI0A 1AL7A 1I75A 4L1WA 3N25A 3ZVHA 1EOKA 3VNKA 5CAKA 3HF3A 4J2PA 3ZJ8A 4KEZA 2PDGA 3TW9A 3MW7A 3HQOA 3VO0A 4XZNX 4GXWA 4PCFA 2D2GA 5TBOA 1SZFA 1RH9A 2XIQA 2YDRA 3GR7A 1RQBA 4UIOA 1E5JA 3UGRA 4MPKA 1XPGA 1K3UA 2IPFA 1W9DM 3QF0A 5EMMA 3DXIA 2YLAA 2YZ5A 5HDRA 1L2QA 3VCNA 3URBA 4MYXA 1CPUA 3HZ3A 3BE7A 2PTWA 1UKQA 1W8SA 1NDVA 1R87A 2R1KA 4CU6A 1KR1A 3MCNA 4OQVA 3LM7A 1EA0A 5LGZA 1K8ZA 3CHCA 3GX9A 2WVSA 3UEQA 5DCEA 3T7VA 4A3UA 1QATA 1XPYA 4FF7A 4OKDA 3AIVA 3H23A 1TWIA 5K2ZA 1ZBKA 1QPKA 1Q6QA 2AMGA 2VQUA 1A3XA 3GVWA 1XD1A 4JHOA 3W7JA 3DFQA 4ZO9A 2X0HA 5DF0A 4XZ9A 1MZRA 3V0TA 3GYEA 5HJYA 2FKPA 4DYJA 7REQA 4PBEA 1PEZA 2OWCA 6ALDA 4YTSA 3FDGA 3GXDA 1BYDA 2GVJA 3CUFA 3MKKA 1CGWA 1KTNA 2OGJA 3G8RA 2VEMA 2Y0FA 3RLGA 1OX4A 4MG4A 2ZZ5A 3FCPA 1EGVA 3DG3A 5DMYA 2P3ZA 2XYLA 3RRXA 4CD6A 4QNEA 4HCDA 3M9YA 4GGBA 3CMJA 1CXKA 4J3XA 2GJPA 1IIHA 2EQDA 5HANA 4JCLA 2HS6A 1DIKA 4MFEA 4Z2HA 4K7VA 1PTGA 2IKJA 3VD9A 4O53A 3BZJA 2WANA 2GDQA 3N12A 4H8VA 3I7QA 2DUAA 4GY0A 1RD6A 1KC7A 2WVUA 4GFIA 1R30A 5CJ5A 4QXIA 4NZFA 3W29A 3LHVA 2G41A 2MUCA 4XKYA 1Y5VA 1PUDA 2G3IA 4D8LA 1TRIA 2BLEA 2HDJA 2FTYA 3TZNA 3NO5A 3WN6A 3V1HA 3WQPA 4E5TA 1OCQA 3MP5A 3S6TA 2F61A 1YLVA 4H6QA 1UC4A 5CZ0A 2W67A 1JCLA 3ME3A 5LZLA 3PZGA 3HJZA 3Q94A 2ZXBA 1QO5A 1SR0A 3URAA 1GZGA 4A3QA 1ZAIA 4NXSA 5HNUA 1VFUA 1WB0A 3GVGA 4YCPA 1K7FA 1XLEA 1XLLA 3GAYA 3OIHA 4LS2A 3K4WA 2F6XA 4UNKA 1HJUA 1PX3A 4CD5A 2ZUTA 1JUBA 4M5PA 3KP1A 3K5XA 2B4GA 5EMLA 2B0MA 3SQLA 3CEUA 1WKDA 4JOMA 4UTKA 4FIRA 3MDWA 3G1YA 2A21A 5I3IA 1VQTA 1B3WA 1W5MA 3ZSSA 2RFGA 1TPWA 1TB3A 5U7SA