5EMKA

Crystal structure of prmt5:mep50 with compound 9 and sinefungin
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emkA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emkA02
2YVLA 1NV8A 5I7GA 2IP2A 4M37A 4EK9A 5ICEA 2VDVE 1HMYA 3JWJA 4PIPA 4C04A 4PGLA 3HCAA 3KPJA 4R05A 4V0RA 3THRA 1SKMA 2Q41A 2AOTB 1DCTA 4K6MA 1BOOA 2YR0A 4O29A 3V97A 1AQIA 3CJTA 5CM2Z 5DM0A 4GC5A 2B9EA 3A4TA 2VDWA 3P14A 3FUUA 5DRYA 3VYLA 1X1CA 2O0LA 5EIWA 2ZLBA 2JG3A 2PT6A 3PX2A 4XUEA 2OB1A 1Q0TA 4RTOA 3N4AA 1FPQA 1TW3A 4DMGA 4R6WA 4R6XA 2GAFA 3DLIA 1XINA 3A27A 5EPEA 1NW5A 2G72A 4Y2HA 2HWKA 3P9KA 3THSA 4E3VA 3BT7A 3A7DA 2AOXA 2IGTA 2ZULA 4XIMA 2CL5A 3G5LA 4QTUB 5LQNA 3HVJA 4PFHA 3UA4A 1NW8A 5E9JA 5EC8A 1NW6A 3T0IA 5EHGA 4OQDA 1VPTA 1HNNA 3B5IA 4PYNA 4YUWA 3HA7A 4CXMA 5EKXA 3XIMA 3P2KA 1XIFA 3LDUA 5LQKA 3KTCA 3GRUA 2NP6A 3KKZA 4IV8A 2XBMA 3B7PA 1MHTA 1BXCA 3C0SA 2XVMA 5DM4A 3KBMA 4DUOA 3H2BA 5EMMA 3KCJA 2XIMA 2ESRA 2P3QA 4QE4A 6XIAA 2BR4A 2NQHA 2EFJA 2E5WA 1R6AA 1RJDA 3AY0A 5E1OA 2AVDA 4RTQA 5F2NA 3PS9A 3C0QA 2PWYA 1I1NA 5KQRA 4BP3A 3JWGA 1YZHA 2QRVA 1KIAA 2IIPA 3ITTA 8XIAA 4U7TB 2AOVA 4DA4A 1D8WA 5DRTA 5K05A 8MHTA 2XINA 1WXWA 3AXTA 3LBYA 3CQHA 3TM5A 3SMQA 1QYRA 3G8BA 4AZVA 4BP1A 4CTJA 1XYAA 2GYIA 3EGEA 3QOXA 3A7EA 4P58A 2EG5A 1NV9A 2VP3A 3OPNA 4ZB2A 3DX5A 2NP7A 4Z2YA 3M0YA 1JQDA 4ZB5A 2NQJA 1BHJA 2GH1A 1WZNA 5E1BA 3JU2A 2CKDA 3M4XA 3KBNA 3KPWA 3M6XA 4KIGA 5BW5A 2WA1A 4Q7IA 1D2GA 1TZ9A 4FS8A 4OVXA 3OZRA 2C7RA 1XLAA 2ZVRA 1JSXA 1KP9A 1RJFA 1SQFA 1XP3A 1FP2A 1VL5A 1VP9A 2UYOA 4XUCA 5FTWA 1K77A 5ICCA 4QEHA 4E2ZA 2EJUA 4YMGA 2O07A 3G88A 5DM2A 5DPMA 5K0NA 4YUXA 3LMZA 4H0NA 5ICGA 3QOWA 8XIMA 1XYBA 4FR0A 3GIWA 5FHRA 5GP1A 3V8VA 3T7RA 1IXKA 3TOSA 2ZFUA 2V7EA 2GLKA 3O7WA 1JR4A 2XYQA 4PYIA 3GGDA 3BKXA 1Z3CA 4M36A 2PX4A 3BKWA 5DM1A 3LCUA 1YB2A 3CBGA 5EOVA 3MTIA 3OE4A 2OPBA 3FTEA 4FSDA 2A14A 3ELYA 4FP9A 3T7SA 2XVAA 5H6HA 4P7GA 3AYTA 1RJGA 1RI4A 2AOWA 3U81A 2ZVJA 1A0EA 4AUKA 3TC3A 5DXJA 1KYZA 1OR8A 3BWMA 2PJDA 3CJQA 4V0QA 5B1SA 1XLEA 2PKWA 5CUQA 3P9CA 5EIFA 5DTMA 4A8LA 3MCTA 2PX2A 4RX1A 1DL5A 5K8VA 3BWYA 6XIMA 3NVMB 1R00A 3AJDA 5EKUA 1U2ZA 3O4FA 1R8YA 4FT2A 5CVJA 5KQSA 1XIMA 2BH2A 3ITOA 1XCJA 4PNEA 2VS1A 3GCZA 3KPYA 2NXJA 2P3OA 3G2QA 3AWIA 4FT4A 1S5NA 5DX0A 1VQ1A 5HIJA 3FTCA 2NYUA 4QVGA 2ORED 4HNOA 5F2KA 3RW9A 4AX8A 4EKIA 1XTPA 1G38A 3CC8A 9MHTA 1VP3A 3XINA 4BLUA 1WXXA 3JWIA 3KR1A 4KW7A 3IV6A 3P9IA 2I57A 2XISA 4PYOA 5H02A 1G8AA 2N47A 3T7TA 4POOA 4GJJA 4GOND 3EVBA 4RV9A 3TKYA 3LHDA 1O9GA 4EQZA 4YV0A 4ZTBA 1M6EX 5EMKA 1XDZA 5FA5A 2QE6A 3M0MA 2CMGA 5CIYA 3ORHA 3KBVA 3KCOA 2ZBRA 3BWBA 3EEYA 3HCFA 3LPMA 3OFKA 4HTFA 4PCLA 1JG4A 4RTMA 3GWZA 3E05A 1TW2A 3MCZA 4IV0A 4GLEA 2O57A 2XYRA 3E7PA 3KBJA 3GDHA 3DULA 3FRHA 1R18A 4PGHA 5B7YA 2AS0A 3EVDA 3TM4A 5K0BA 3REOA 3TQSA 3KU1A 4YUVA 2ZZNA 4P7JA 3P2EA 4QVKA 2ZZMA 4HC4A 1XIHA 2BM9A 2BR3A 3BGVA 5CVUA 2G1PA 2PVCA 1XLJA 3DH0A 1NKVA 1XYMA 2PXAA 2QM3A 3OE5A 3C0LA 3UJBA 3FUXA 5KVAA 2YTZA 3BGIA 4QPNA 3SX0A 2H11A 1TPYA 3AALA 3G2OA 4HGYA 2Q02A 3EVAA 3C3PA 5HZMA 5DWQA 5DX8A 4OX9Y 3BUSA 3GRZA 2HV9A 4WXHA 3TFWA 4RTPA 1ZQ9A 3GRRA 2FRXA 1XICA 2JHCA 5ERGB 4EMSA 3SSMA 1JG2A 5GM2A 5K03A 2OBFA 3GJYA 1OADA 5DTQA 1L1EA 3MERA 1XLHA 1ZHFA 1SVUA 1ZG3A 4HHLA 1QANA 5LQAA 1AF7A 2I7CA 2VDUE 4BLWA 1XCLA 4KIFA 1JSZA 2G0WA 1X1AA 2G8NA 2HTEA 4YTUA 1X1DA 4AZWA 3UJAA 3CWHA 4QQKA 5HEKA 5H1WA 4E70A 4E2WA 1MNZA 2ZDSA 3LKZA 4E2XA 3R3HA 3KQSA 1MUWA 3DBNA 3FPHA 1XLIA 2JHAA 3UJDA 2HR1A 3PLAE 4FGZA 3QYSA 5HOQA 3MQ2A 3G2PA 3FPEA 5XINA 3DP7A 3MAGA 2KW5A 3KQPA 5G02A 3UA3A 1UWVA 2GVEA 1JG3A 1XJ5A 2ZIFA 3MGGA 3FUTA 3TKAA 3B3FA 3GXOA 4ER6A 4RTKA 3UJCA 4YUZA 4OQEA 2BZGA 2P35A 3G2MA 4M38A 1NW3A 5FUBA 5HIMA 2B2CA 5DT2A 2EJTA 1L3BA 3KPVA 3UFBA 5MHTA 3BDKA 1B42A 3OZSA 2ZSUA 3M0XA 2Z6UA 3EVCA 1KXZA 4A8NA 2GLUA 1KYWA 1IM8A 1NW7A 1UIRA 3EMDA 3KR9A 5FQNA 5EHIA 3JWHA 3LBFA 2FK8A 5FHQA 2C7PA 3O31A 3KBSA 4PYQA 4A6EA 5C0OE 1P1BA 4HRAA 3EGVA 3X0DA 2B78A 4P7FA 2GUBA 1L3CA 5FWDA 4QTTB 5K0CA 4DCGA 4MTLA 1N2XA 2ERCA 4PGGA 4YV2A 4DKJA 3UJ8A 5XIMA 3TVAA 3KQYA 1QAMA 1V39A 1EJ6A 3BWCA 3R0QA 3CQKA 3QXBA 2YXDA 3E8SA 4XSMA 4L7VA 3UJ9A 5K0EA 3OBEA 1R8XA 4U7PB 4MIKA 4ZB0A 4K1GA 3KQQA 3P97A 5J8LA 4YTQA 4DQ0A 2NXEA 1GW9A 4QDKA 3ANXA 4RSRA 2I62A 3KPUA 3LDGA 2HMYB 5C9ZA 1DE6A 3UWPA 3GU3A 4B17A 3EVEA 3M6UA 4RTSA 1D2CA 1I60A 1DE5A 5GINE 5IKMA 4ER7A 5AVNA 1JQ3A 3VNLA 5E8JA 1YFJA 3C6KA 1QAQA 1XDUA 10MHA 3BZGA 2ONYA 4YV1A 3GRYA 2NNWB 3CJRA 4RTJA 5JUWA 3DLCA 4QE1A 2GA9A 3K6RA 4EVIA 5LQUA 2OKCA 3AAMA 3HVIA 3DXZA 3CVOA 4AZSA 5CD1A 1CLKA 4GJIA 3PFHA 4GOOD 2FPOA 2VZ9A 3M0LA 4HTFB 4PINA 3UVAA 4X63A 3LCVB 3SVZA 3M0HA 2PX8A 1YF3A 4M7RA 3IUIA 3LDFA 4CKBA 4E33A 3QC0A 5FQOA 3P8ZA 3RIEA 1QT1A 2P7IA 2PY6A 5E1DA 5K0JA 2PXXA 3P2IA 4HH4A 1R74A 4GOLD 5LQRA 2QRVB 3OU7A 2G4JA 3KHKA 3NDIA 3OFJA 3VNIA 4YTTA 3F4KA 4KDRA 5P8WA 3FVMA 3DXXA 1XXLA 4FZVA 4LECA 4QEEA 1D2HA 1KHHA 4FSXA 5FADA 2BR5A 5JR3A 9XIAA 1F3LA 1QZZA 3K0BA 5K09A 3P6LA 2DULA 3DUWA 1MJFA 2AN5A 3PVCA 5F2OA 5LR6A 1EQAA 1X19A 1VIDA 2PWPA 5LQJA 1DUSA 3NMUF 2I6GA 3BXOA 3G5TA 3P9NA 4NECA 2YX1A 3LGAA 3DXYA 3M70A 4PYLA 4ATNA 5D1NA 1Q0SA 3IYLW 3M6WA 2P40A 4GF5A 3M0VA 2YUIA 3SSNA 3FYDA 4RTLA 4QPPA 1VLMA 4RWZA 1G55A 2HK0A 1G60A 3I53A 3HCEA 4QDWA 2CMHA 3NWEA 5EMLA 2NQ9A 4C08A 3M33A 3ME5A 5K0FA 3OU6A 2HK1A 3SM3A 1XIEA 2OU4A 3A25A 4WVLA 5BXYA 1XIDA 4R8SA 3C0KA 3Q7EA 3MB5A 2O06A 1O54A 2PGXA 3U3HA 3GO4A 3WQOA 3NTVA 3NVKI 2HCVA 5EZSA 4K3ZA 3A26A 4X61A 3G8AA 4QDJA 2IDJA 4RYLA 3U0HA 1VE3A 4ER0A 2FCAA 2JJQA 2PX5A 4QQNA 1L9KA 4MQ4A 3DOUA 1UFKA 3E23A 5CVVA 4PYKA 3TMAA 3UZUA 3LECA 1G8SA 3EVFA 1KR5A 1N7IA 3LL7A 2OY0A 5DSXA 1X1BA 5EMJA 3ELWA 2IPXA 3FPGA 2QUMA 1VBFA 2AOTA 2ZTHA 3L8DA 5ICFA 1AQJA 9XIMA 1KPGA 4LG1A 2IBSA 4LWOA 2QW5A 1SUSA 2CWWA 3SR4A 2UYCA 5DLYA 4C4AA 1QAOA 3HVKA 3ERCA 4IKPA 2AVNA 5CVEA 5D1HA 2JHPA 2GS9A 1XIBA 5KS2A 1DIDA 1XLKA 1YX1A 3LCCA 4EACA 1I6NA 3EEOA 1WY7A 2FYTA 2V74B 2QYOA 2OXTA 3AYVA 3L23A 5K01A 1YFLA 4C05A 4LNCA 1NE2A 3BGDA 4OA5A 1XLFA 5E8RA 3ITLA 1SQGA 3OCJA 4BLVA 3CNYA 5HILA 3HVHA 5E1MA 3PT9A 1XLCA 2PBFA 3FRIA 4EKGA 1G6Q1 2R6ZA 2J6VA 3BWWA 2EX4A 3HCBA 2ZBQA 1L3IA 4DVOA 5HFJA 3GRVA 2PLWA 2AOUA 2P8JA 3I5UA 4GBED 4KRGA 5C1IA 3UJ7A 3PFGA 2B25A 2AR0A 3HEMA 5FWAA 3OZTA 3TPZA 4AZTA 4ER3A 5E9QA 1BC5A 1RI2A 3DR5A 3NW9A 3DMFA 4KVZA 2PT9A 4RTRA 1XYCA 4UOEA 4EAYA 1XIGA 4GEKA 2IBTA 4X60A 3MHTA 3S68A 4BY9E 4GC9A 2LD4A 2P1DA 3UXIA 1PRYA 2H00A 3ELUA 3R9XB 3EVZA 5CVDA 4DZRA 2Y1XA 2AN3A 3KR2A 3VNMA 1SUIA 3VYWA 5EEGA 3CQJA 1XIIA 1P39A 4GQBA 7MHTA 2ADMA 3FPFA 2C7QA 5K0LA 3I58A 3RODA 3FPJA 4XCXA 3SGLA 2ONZA 3WSTA 3G7UA 4XIAA 1ZGAA 1PJZA 3DMHA 3MTEA 3ID6C 3IEIA 4RVGA 2X7WA 2Y1WA 4LWPA 1YUBA 3NJRA 3FTFA 4KW2A 2G70A 2O05A 1N7JA 3QZAA 1EIZA 2OB2A 2YQZA 1FP1D 1BXBA 1DXIA 3GNXA 2G71A 3ER9A 1FJXA 4QDPA 4ZBCA 1JG1A 1ZGJA 2BM8A 4PWYA 3B3GA 4F85A 4RVHA 3ITXA 5EEHA 3XISA 4PONA 2OYRA 4YTSA 1XIJA 1SG9A 3FUVA 2F8LA 4KDCA 5EVJA 3TLJA 1ORHA 1BKYA 5TNVA 4A6DA 4XISA 5B7ZA 3CCFA 2X7VA 3UBTA 3QV2A 2I9KA 2Z6QA 2Z6AA 3I9FA 2QUNA 3SSOA 4OA8A 4DM3A 5GIPE 1XLDA 3NWBA 2QULA 1XLBA 3HCCA 5FULA 3LKDA 1RI1A 1XVAA 5E2BA 4E32A 2WA2A 5EZQA 1FBNA 3ITVA 4F86A 3ER8A 2PXCA 1XLGA 3CQIA 3FYCA 3VC2A 3HA5A 2YXLA 3Q87B 1P91A 3KQVA 3I64A 3KQWA 5T6BA 5GIOE 3FTDA 3P71T 2XYVA 3R24A 5KYGA 2OO3A 4QE5A 2ZCJA 4MHTA 4G56A 4CKCA 3PX3A 1IY9A 1EJ0A 3D2LA 4E2YA 4XSLA 3VNJA 2NXNA 2FK7A 3GNLA 3SXJA 1QUMA 4CKEA 3VSEA 4A8RA 1KPIA 5LQCA 1A0CA 3BANA 1I9GA 2I56A 1RI5A 2ZWVA 3DMGA 2NXCA 4HHMA 3G89A 3LSTA 3R6TA 2FHPA 3BZBA 4GOMD 5GOZA 1YZ3A 5T64A 1DIEA 4X1OA 4JXJA 4W4QA 4DF3A 2QY6A 2C7OA 1P1CA 2AOUB 2UYQA 2YXEA 4ISCA 5HIKA 5AVHA 4US6A 4PYJA 1M0EA 3UJ6A 4R8RA 3VC1A 1S5MA 4IWNA 4C07A 1T43A 3KQOA 1XLLA 1I4WA 3OU2A 3CKKA 1INLA 2UYHA 2R3SA 4X41A 5IH3A 1NBIA 2GB4A 2ZIEA 4CTKA 1RJEA 1XDSA 3EPPA 2ZWAA 4KWCA 4OBWA 2JH8A 3ITYA 4HG2A 5GWXA 5CCBA 3CGGA 4C06A 4RVDA 2P3LA 5FA8A 3PTAA 1KPHA 5T67A 4YMHA 3C3YA 2ZZKA 3M6VA 4OBXA 2IH2A 5DX1A 5EGSA 3B3JA 1XISA 1XYLA 3BZJA 1JTEA 1WS6A 3AXSA 4ER5A 3IHTA 2WK1A 2IH4A 4HGXA 1EG2A 2P7HA 1ORIA 4HGZA 4PIMA 4XUDA 2AN4A 3HA3A 5E2AA 5DXAA 3DTNA 3TRKA 1RI3A 4A8IA 4GUAA 5BP7A 3UU0A 2IH5A 3FUWA 2H1RA 2P41A 5U4XA 3KCLA 4P7KA 4CWAA 2JH9A 3EVGA 2DPMA 1A0DA 3EGIA 7XIMA 1NT2A 3PB3A 4PYMA 2GPYA 1F38A 1Y8CA 5CCXA 4E31A 2AZTA 1XLMA 1JTFA 5K0GA 3HP7A 2OZVA 1M6YA 4XKMA 5DTRA 5DSTA 3KWSA 1ZKDA 1AV6A 3LX6A 1O1HA 5E9WA 3ELDA 2UZ4A 5GM1A 3HM2A 4PCAA 4RVFA 3VNKA 2IFTA 3KR0A 4F84A 4HSGA 1NBHA 3KQMA 3KQTA 5EQJB 3FZGA 2PV0A 4RTNA 3IUHA 1O9HA 1QTWA 1EAMA 5HIIA 5LSAA 4Y30A 2K4MA 3HNRA 1JQEA 2IDKA 4YUYA 5BW4A 2ZW9A 4E30A 4MWZA 1WG8A 2PSSA 3HTXA 3NGFA 5B80A 3KBWA 3EMBA 3IUDA 4C03A 5FCDA 3HCDA 4J4KA 3NDJA 3TR6A 5M5BA 2ZBPA 5EG5A 4DCMA 1H1DA 5XIAA 2HNKA 2ZIGA 3B89A 4YTRA 3C6MA 2B3TA
chains in the Genus database with same CATH superfamily
4RVNA 1A5LC 3B40A 1Y6FA 1BOOA 1A47A 5TIMA 1SJDA 1EDEA 3H6GA 4R9VA 1FW8A 1G5FA 4F9FA 1MQAA 1X86B 3D4LA 2VUYA 4RZHA 1LB1B 1XQYA 1A7AA 4JKKA 4QTUB 3C5HA 3PC8C 5J4HA 1QOZA 2WD9A 4TXHA 2DSZA 1T10A 3DV0A 1YLVA 2PA0A 3RC2A 1CGUA 3BA1A 1QNRA 4F72A 2CSUA 4JOSA 3L2LA 1CZHA 2I99A 1SCIA 2VT6A 3LGGA 3UT5B 1WA3A 4XARA 1QYRA 1L1FA 2NTEA 5E4FA 1EUCA 3VPBA 3T4EA 2C9YA 2AD5A 5EY5B 2GF0A 5EZ6B 5ABGA 1UXIA 3PJTA 4CM7A 2Y0CA 2XEDA 4RMJA 4WA7A 5LGZA 3OJEA 4C01A 4TZKA 3U62A 4TR9A 3FNDA 4P61A 3H8JA 1OFUX 4TYWA 1VHLA 3DDZX 5HNNA 1C29A 4KAFA 3UBMA 3DKLA 5TV2A 5JY6A 2CNLA 4KX5A 2GD0A 1FX0A 3VZZA 3LBHA 1TO6A 4FP9A 1ZESA 1ZENA 2H8KA 4NAHA 2AMFA 4MUXA 2ZVJA 4JJ7A 5DZSA 4FTWA 3WB2A 4JL2A 1MPTA 4ERXA 3KX6A 2W6ZA 1HKUA 4GIYA 3KDSE 2PDKA 4PHCA 4UHBA 1G8PA 2EBNA 4PMYA 2CD7A 2R8EA 4I5RA 3L7BA 5FA5A 4LY4A 3OFKA 3W81A 3F90A 4M24A 2DZTA 1X1OA 2DT2A 3CZRA 2AS0A 2VFAA 1RUSA 2DJIA 4BVFA 5ALFA 4Y6RA 3DL2A 3GJZA 2JKEA 1PQPA 5CH5A 2J47A 2PWUA 4A35A 3AIVA 4HGQA 4NRRA 3WGZA 1QS0B 3ZE7A 4UR9A 2HF2A 5AJYA 1ODUA 2X2EA 2FN9A 1WAWA 3LSYA 2IYOA 5FBLB 4CCEA 1KWKA 2FQWA 2G3YA 1MJGA 1V6VA 1XZNA 4TWRA 2AQKA 3IL2A 3DM5A 3GDGA 4P0PB 5BT8A 1OU0A 3RI3A 3VM6A 4E09A 4BNLA 4WIAA 3X0DA 3CG0A 3SPXA 3C7DB 5IRCD 3RJZA 1OCBA 3PWAA 3NU1A 3ADCA 4AMGA 1XUZA 4GR5A 3FFTA 4UUQA 1V8DA 2OEPA 4KFPA 2WOJA 1AUXA 4BEBA 2J0UB 3HXPA 4IFEA 1SZDA 2HMVA 1VG0B 2RGDA 4EVIA 3EOBI 1XD0A 4Z0HO 3PCXA 4R27A 1SXJD 2XN1A 1GW1A 3CU5A 4K28A 2YMQA 4M87A 3H26A 4HWKA 4XQ6A 2D2OA 4JQ2A 1Q2XA 4B1FA 3FETA 1XWFA 2ZT7A 1YT5A 2PQ2A 1ULAA 4ZK6A 5DBUA 3W70A 1NF9A 3P2VA 3M0VA 1NN0A 2OXRA 2ECOA 1JJ7A 3G9QA 2I65A 2VHCA 3LIIA 2CXGA 2HK1A 4WDWA 2C7GA 2B35A 1UOKA 1D9XA 4D80A 2R8XA 3QPVA 3VKAA 3H1BA 4B5SA 3OZAA 3OQ6A 1W3IA 2Q3HA 5KZ6A 2C58A 3DZCA 2JA1A 3T3OA 2CXTA 4NZPA 4IFKB 4R0MA 1JGIA 1O1ZA 4RE4A 1JFRA 4F2DA 1JDZA 4HEJA 1BPLB 5AYZA 4V2IA 2RKBA 5CVDA 1II0A 1A04A 3WSTA 1R4AA 5DGTA 1B76A 2VXBA 2MIIA 1IY1A 4COKA 2ATVA 2VRKA 1DQUA 4RVHA 4TKLA 1S2MA 1OIVA 3E58A 1ITUA 2XIOA 2Y61A 3ER8A 4Y6LA 4O4LA 3V4FA 2QVBA 2ZWIA 2JF7A 3KQVA 4ORIA 3WNMA 1ELSA 4Q9HA 1EB3A 2E4TA 3HV2A 3S83A 2AMVA 5JAUA 1VLVA 1KPIA 3JZUA 3BANA 4G0OA 1VL6A 3O94A 3C2EA 2GPSA 5FWXB 4DF3A 5HS4A 4MUJA 5FI1B 2CHQA 4EW2A 3CYFA 1GVYA 1ISSA 3DPIA 4P93A 5ILOA 4FYMA 3EG9B 3L12A 1XDSA 4LN1A 5I5EA 3I5XA 5I7SA 1NONA 3FMFA 4XUDA 1CCWA 1YR7A 1A76A 4P7KA 4I9FA 4EO9A 1ZBDA 4Z6KA 1RYYA 2QP9X 5E9WA 3A6JA 4MAFA 5JPCA 5JCJD 2XCOA 2BEWB 1KR0A 1EWRA 3FAKA 1KRMA 2C0AA 1IEVA 5E70A 5L40A 3W24A 4CUJA 5AI9A 3P9ZA 1N2JA 4K36A 1OT2A 2RIRA 2ZZ2A 2YL9A 2NW6A 3Q9UA 4AICA 3ZVKA 1M6JA 5IT0A 4CV3A 1VPXA 3ZNQA 3Q9LA 2C54A 1B3OA 2C5BA 4NVRA 5FI0B 4C6BA 4EPWA 5DCBA 3K31A 2MOKA 2OGWA 1U0LA 2X14A 1DGQA 2Q6TA 3H24A 2NNLD 3I4KA 1MKYA 1NW6A 4RDHA 1PW7A 2FMTA 4LOCA 3I9JA 8AT1A 4I81A 3R76A 5BMWA 4LXQA 3UJSA 5ALSA 2PNJA 1EE2A 1I0ZA 2OQYA 3R10A 1GVHA 4B8WA 4J2HA 3VI2A 2O59A 1CP3A 1JNEA 3O9MA 4IPNB 5JS6A 1IWPA 5EFDA 2R1KA 1RJFA 2GSDA 4EABA 3V4VB 3S99A 3V75A 1H22A 5HMSA 2WW5A 5E1QA 5F1OA 4CF7A 4FHZA 2IUFA 2OZTA 2QX8A 3N14A 3VD3A 4M9ZA 3W2TA 3FA5A 2GDQA 2WILA 4MTVA 3EXSA 3K05A 1ECGA 3HC7A 1W9UA 4RNCA 5EJFA 3A9BA 1E9EA 4UMDA 1Y8AA 2NU6A 3V33A 2TYSA 4YP1A 4L51A 3TIIA 2ZWOA 5I07A 2H6RA 2XCRB 1ZH2A 1UC4B 4XB3A 3PNSA 4XVEA 1GTRA 4GX1A 3AJ8A 2D2XA 4NAFB 4BKQA 4HTFA 1BQ4A 2QZPA 3CSDA 3TW9A 4U28A 3EPKA 5IPFA 1QO7A 1Z7YA 3JARA 2RGWA 3DHDA 4GAEA 3FKSD 1E4OA 1XU9A 4BGEA 4HYRA 2ZSFA 1N6NA 4M9QA 2WMIB 2Q4RA 5KNCD 3QF0A 3LJKA 4YRMA 1VENA 4GI6A 2QAJA 1UMDA 4H7ZA 1N0VC 2VJQA 3II6X 3FWYA 4AWAA 1IZKA 1IJKA 2R94A 4HHHA 4QOGA 1G20B 4KFSA 2A7XA 1YZQA 1LCIA 1EOMA 4IXMA 2O54A 4PGFA 2PSFA 3SZMA 2B99A 1CXHA 3MP5A 2LCQA 4LVCA 4N0PA 3STFA 2WICA 3W7MA 4QJ5B 4D44A 1W5MA 3MO4A 1WZAA 2YYUA 2I80A 1EXNA 3BWDD 3LPDA 1RP8A 5CD1A 2ZXDA 1KHTA 3WL7A 4NYJQ 2OL4A 4UQCA 5JIPA 1QR6A 2VDLB 4JT9A 3HFGA 2AV6A 2YW4A 4I50B 1MJFA 2V0TA 3ZQ6A 3P8JA 3LX8A 1EWVA 1SOVA 2H7YA 3GW8A 3ZZUA 1YJAA 1CNFA 4AZ0B 5DASA 1HY3A 2XB4A 3KVVA 5KDLA 1XPOA 4DV5B 2VDWB 1G8YA 1JKXA 3RAPR 2FFAA 1C9YA 1B3RA 1JDDA 2NU6B 1K8RA 1LRNA 4AJIA 3T3NA 3G23A 2J7DA 2HK9A 1W5AA 5CC5A 4D9CA 4E38A 4EKGA 1FYEA 1HDZA 4QEDA 1NY1A 2B7CA 1W46A 1WPQA 2Z8YM 1VKHA 2ANUA 2D6FA 3OF2A 1KAHA 4G0NA 4ZOAA 5CZ0A 2KZHA 2H1OA 3DV2A 2BG5A 4S1TA 4ZVRA 1XIIA 3QX7A 1UPUA 1BCSA 2L19A 3VX0A 5JH7B 1H1LA 2QT9A 3FHCB 3I1YA 4DABA 4QOFA 1W35A 3RKUA 2HB6A 4HP5A 2BHTA 1NQ6A 4EKEA 2FWAA 1E5TA 2DUWA 2AZDA 4IFBA 1V3IA 2Z1SA 1E9CA 4G6CA 4R1QA 3ZGVA 2RCNA 3ENWA 5JCXA 3E82A 1VFFA 3FHLA 5B4UA 5B55A 1WOYA 2R2AA 3TWOA 4EUHA 5T64A 2HBYA 4QHTA 4BO8A 3IUBA 3PXAA 1MZHA 1TK9A 4XD7D 1I4WA 1XUOA 1ZFNA 4AB1A 3R3VA 4ZENA 1MABA 2BFPA 1DFGA 3RXZA 3Q5EA 3KD3A 2FGKA 1QK4A 1QBAA 1DBRA 4AWXA 2TSYB 3RCYA 4X2RA 2I2WA 2DT1A 1RI3A 2QUBA 3RTAA 2BEWA 2GBLC 3S2IA 5CDGA 4DDKA 3BCRA 5BQXA 1C7TA 1LK5A 3GN1A 1FFYA 4TT3D 3EBVA 1GQ2A 4IJCA 5G2HA 3W9YA 1YNSA 3GAZA 3AZSA 3V1LA 1DMSA 1ORRA 4U39A 1DB3A 1U90A 2YA0A 5EE0A 2A0XA 1E8MA 3Q3EA 3F74A 1J5XA 2ZX5A 2C2ZA 1U02A 1KI2A 3QFEA 2Z2IA 1GPAA 1KAQA 5F7JA 5LN1A 3IPYA 1NC1A 3B5IA 2VT7A 1M1XB 4NQ1A 1Y9AA 4IUBS 3ZR6A 3B7PA 2P30A 4GYWA 3A6FA 3BSHA 5H4HA 3VDAA 2Z7GA 1W0KA 1AKEA 3RFCA 1AKVA 1H8EA 3CEAA 1CV2A 3GUGA 1JIUA 2G5PA 2ZK7A 1PVDA 3W8EA 2WU8A 1QVZA 1GYRA 1NWRA 3G2GA 4WI1A 3M5YA 1DKRA 1VL5A 3H2KA 5IHPA 1X8JA 4HS9A 2IYAA 4HU3A 1IXKA 3AERB 1VFOA 3PBKA 3QITA 5MKGA 1DEOA 3AVTA 5F5LA 4E5KA 2Y9PB 4E94A 3WK1A 2Q3FA 5KQSA 2Q6VA 3C8MA 2I2BA 5JBDA 5KX5B 4JYFA 4JFRA 2IIQA 2ZPUA 4X94A 3KHJA 1KM0A 3O0TA 1Y1TA 4A8JC 4H9ZA 5ILGA 1JAHA 1BCRB 1IE3A 3EXHA 3ZU2A 2X3UA 2A3HA 1L8XA 1ADCA 2V65A 3H4IA 5BQ3A 2FB2A 1UP7A 2NSXA 4KC0A 2IPMA 3FV9A 5KTOA 2XT6A 3UB2A 3HYLA 3PBMA 1BDMA 1E5DA 3D7MA 2COKA 2CHRA 2I33A 4QODA 3AW9A 3RC7A 2PR7A 4KRYA 2QYHA 3W2KA 2G97A 4BVAA 3NEJA 1RYZA 3K5XA 3OW1A 1ZC3A 1QW8A 1Q2SA 3MVEA 5C7LO 3FPEA 4XPIA 4DUZB 3N2MA 1OC4A 3K8QA 2EX0A 3A1TA 2GAOA 4G4JA 4YV7A 3K2QA 1B43A 3EMDA 2C61A 4BATA 3BSWA 4GC4A 2F59A 4ALDA 1G0OA 1VB9A 4E4FA 2ZANA 3AOGA 1GW9A 2KI5A 3Q6IA 4J3VA 5JHGB 3ZR4B 3WF3A 4BNWA 1KS2A 1OPXA 1UAGA 2BRUC 4MZ8A 3TW0A 1C7SA 4BMXA 4FX5A 1X6LA 1E2HA 3UWKA 4GYJA 3RPMA 5T4FA 2W62A 2R1TA 5FD8A 4W87A 1ZMOA 3OG3A 3M0LA 5ECGC 1CDEA 4JJAA 3UCEA 3F71A 2ZIVB 2R44A 1OFGA 1XZHA 2ACUA 1B0UA 1LK0A 4L8GA 3HABA 1W2WB 4WJKB 1G20E 3MI6A 5LHEA 5HPYB 3AR4A 1J0AA 4CM5A 3A25A 3ROZA 2XGJA 2NVDA 1TV3A 2BHLA 1ECFA 1JZSA 3NVKI 3SSJA 3C45A 4QJ3B 2IXAA 2QNIA 3NHLA 2R8BA 1QK2A 3E5HA 2I7TA 2QMOA 5PGMA 4CQCA 1Q1ZA 4YP0A 1OI2A 2SNIE 2WHMA 2ZGVA 1LJ8A 3UT0A 4RZSA 2Q3BA 2EIXA 2REQA 5JNRA 3OJXA 1EHIA 3HN2A 3H17A 5ECUA 4JJIA 3RK4A 3RARA 3H2AA 1G64A 4JYBA 3OIXA 4HN9A 1WZCA 1ZXXA 5DMXA 2PBOA 3PUVA 1BS2A 2C7QA 4JQSA 3VYUB 4EA6A 2B7OA 1HZZC 1OWNA 3CKYA 1TVEA 5MF5A 1K6EA 3GLHA 4O1BA 3HI4A 5EY5A 3OM0A 4NDNE 2RHRA 4MV1A 3QTGA 2EBHX 5DDIP 4M54A 1A9QA 3GA0A 1MVLA 4G1UC 2HRCA 2QUNA 3L4XA 4D2JA 4CM3A 4YONB 1ACLA 3R1IA 4RPQA 3GY1A 2WMOB 1GUBA 4A26A 4REMA 1JZQA 3V1UA 4GUGA 5DI3A 3H0KA 5AJXA 3FFWA 2VJMA 4PZZA 3DVRX 1V16B 2D3NA 3EMCA 1KDYA 4H6EA 3WSUA 3B8VA 1GVEA 1WKEA 1UKTA 4QL3A 1OZQA 3PWIA 3GL9A 2CJPA 1IF2A 3BZJA 1JUKA 1QB8A 3UPMA 3QTTA 4EH1A 4TX9A 5HS6A 1N2CE 2EG9A 2A59A 3MT7A 1LI7A 4S0ZA 2NZWA 3IJEB 1H51A 3T08A 4ERGA 4O02B 4FNAA 3FYSA 4PXSA 1GXSB 5MDHA 1NPTO 2E67A 4UU1A 3RF6A 3RM8A 5AC6A 1T6XA 2EG7A 2GK3A 4J0GA 2Q6ZA 1WG8A 5XIAA 3C48A 4NDZA 3ZWPA 1ZR2A 1P77A 3CT7A 5JDIA 3KOYA 4NZOA 4R0NA 1X70A 2WI8A 4L64A 1T8SA 3IGUA 2F3TA 3IE0A 2QRQA 2HVNA 3N05A 5EC8A 1US3A 2WHYA 4ZQEA 3IJIA 2BT4A 4G1NA 4H8NA 1JEDA 1OWOA 2FF5A 1Z36A 5GONF 4F1WA 2DQWA 1UKQA 2I7DA 1CZKA 4TOIA 2LPMA 4D6JA 1I7NA 1S8OA 2VXOA 5EJ8A 1P7VA 2OO5A 2XVZA 4PB4A 4F45A 4ZB5A 1E66A 1R0YA 4TL7A 5BW5A 1PHWA 3I10A 4FF7A 2XG9A 4BI5A 4GY0A 3S9IA 3PFWO 1W3NA 2ZX8A 5DY2A 3N3TA 3W1MA 3WB9A 4A7PA 3LCJA 2FN7A 3AI0A 4MJZA 2JF0A 3OPVA 4IGAA 1FTNA 3VPSA 1YR3A 4FFNA 4HJWA 2A5LA 1RJGA 2XV1A 2XQIA 4JYEA 3VHXB 2QENA 3UK0A 3DL7A 2W9XA 3P9QA 2W2QA 4P31A 1Y65A 4NDAA 1E32A 1YYAA 5FAKA 4ZVKA 5F2KA 3H0EA 1XTPA 4PPNA 4HYVA 1EP3A 3U7QB 4ERIA 3E6AA 1LLUA 3U2CA 3BWEA 1D5CA 2Z9BA 4JCCA 3JVEA 5ECDA 4KUHA 2CW5A 5FNVA 5EMUA 1P2GA 1ZN2A 1MRZA 1ZL0A 1ZJZA 1GOXA 3V32A 2QP3A 1OFOA 2A0NA 4ZIRB 2GRUA 3DYIA 2LKDA 1PJSA 2FSIA 1J5EB 1VE6A 3K73O 1IOZA 1V7AA 3ORRA 4CN8A 4AY1A 2FPLA 1O94A 3RO7A 1H65A 2HXTA 3Q3IA 2ZE0A 2BHUA 1FVOA 1E1MA 2A9FA 2PCJA 4HZGA 3GMTA 1R7RA 4C6NA 4D74A 2MR5A 3MQ2A 4ZEXA 1O95D 4DWOA 3D6TB 3V1MA 4J1OA 3HUUA 3KPVA 4ID3A 1E51A 4J9JA 4LQCA 2BCJQ 4KPUB 2H4YA 2PWGA 1F8FA 4BQQA 1J7JA 3PK7A 2VR1A 4YB8A 3E0QA 2XIIA 4F9DA 1HJUA 5T57A 4JGDA 1VHDA 4PNZA 4QXOA 2ZE6A 3N2YA 2Y24A 4Z86A 9GPBA 1EE1A 1NUAA 3L8EA 3RLUA 1FP9A 4Q47A 3VNSA 2HA6A 5HK4A 1JSCA 2HMWA 4F2PA 1FP4A 4QBGB 1A5AB 3HB7A 4IJMA 5LXTB 3WP0A 5JVLA 2LTAA 1ZCBA 2C5EA 5FSEC 5D86A 4B3ZA 4G4SP 4LJKA 5DW3A 4FU0A 1YE5A 4PTYA 1X1ZA 1KO0A 2DY1A 2VJPA 1P0IA 3ESRA 1EJRC 3F73A 3W72A 1UZUA 5AW7A 5BRNA 2PJRA 3B1KA 3TSWA 3ZR5A 2UZ1A 2ZB3A 1WNFA 4ZRDA 5L7YA 4IIHA 4ERAA 3UAWA 5JEDA 4TT8A 1QG6A 2VFIA 3L6BA 4YFVA 4CG2A 3DE6X 2DG2A 1DXQA 5JH1A 3QMMA 9ABPA 2JBHA 5BNKA 1SCUA 1J70A 1J99A 3NZEA 1ETHA 3TNDA 3DVAA 3I6TA 3STHA 5C9WA 2OUKA 2P1ZA 4INOA 1WEHA 3MM4A 3VI4B 2CXXA 4M8UA 2LXNA 1XTKA 3STUA 3AHVA 1ME7A 3C43A 3SGLA 4WDUA 1TQ6A 1KA9H 3W7HA 4DV7B 3RAGA 3ZFHA 3CZKA 4IDBA 2DY0A 1O1YA 1E2QA 1OEPA 3CO4A 3LFTA 3SCUA 1MVNA 4ARCA 3QHNA 4RDVA 3DI1A 3UENA 5LDDC 1MXGA 5I6SA 4W9RA 4A1OA 4KGVA 2SHKA 4GXRA 3DL0A 5KTMA 5J63A 2XR1A 4FONA 4DRYA 2VDMB 1QP4A 3GJ5A 5GV8A 2Y93A 3J7AC 2IHJA 3JQ6A 2ZUSA 3OO0A 1E1RA 2V82A 3EFBA 2A79A 3RT7A 2D59A 4MS4A 5CSUA 5JATA 2P69A 3PYLA 2WZTA 4EVZA 4H1WA 3AVQA 1GDDA 2CUKA 1ZRSA 3KCLA 3B7WA 4ED9A 5HQEA 5KUTA 1BN6A 3QSYA 2V2HA 2C2HA 1H9CA 4PU0A 4HH0A 3QWAA 4MFEA 1E9BA 2RHGB 4ZPXA 3QLTA 1CZUA 1I8TA 2PGAA 3E3NA 3HYSA 5IH7A 2XODA 5BUQA 3BLPX 2R1VA 7CGTA 1CHNA 5H8WA 1PJ3A 3NAQA 5JQGA 3AB3A 4E3TA 1CULC 2W58A 1Q8JA 4JQOA 1JKIA 1ULHA 1KK3A 4EJSB 3K0AB 4JXXA 3LXBA 1JU3A 1OF8A 3LQRA 3G1HA 2EEXA 4KCUA 2P3SA 2GNOA 1SCBA 4MNLA 1ODLA 4LHXA 3D8HA 1CYDA 4F56A 1W2GA 5JSZB 1JW9B 5C35A 5DLDA 4FMDF 3APYA 4R5HA 5E6UB 5I0DA 3DE1X 1EBHA 4L22A 4TLEA 3SS7X 1BYCA 1M2OB 5LA6A 1F0PA 4IEFB 1P5HA 3JZMA 2ZZ4A 4QDZA 2E0PA 3QN3A 3LZCA 4ACBA 2XVAA 3RUFA 1EEPA 4GACA 4B4KA 2OODA 1K4KA 4H00A 2AFIE 1Y8ZA 3L0NA 4I1IA 4ALJA 2VP9A 1PEZA 4N0QA 1OKKA 4EYEA 3GK3A 2EVWX 3GRAA 2E48A 2AXPA 4QVGA 2YDYA 1UJ5A 1LBTA 3H19A 5KZEA 1C7IA 4OQ4A 2DZUA 1ZUD1 3NV9A 4GZEA 2HBRA 4XSGA 5IZ4A 1M2FA 3R7BA 3AS2A 1P6WA 4YYFA 2UAGA 3VXKA 3CAVA 1DCFA 3IAXA 2G1PA 4BV2A 4RELA 2L18A 2BISA 2CMKA 3GZ4A 2ATMA 2GXAA 1WULS 4FD3A 1A27A 4M6VA 4EFNA 3H6OA 4MPPA 1E3MA 4NE7A 4LHVA 2WE7A 3AL3A 3FLEA 1T6MA 1EVQA 1W1VA 1E98A 1HLDA 1IHXA 1J33A 1KJ8A 1CIUA 1FFWA 3N04A 1L5VA 3DNFA 4LF4B 3MRVA 3N2XA 4QDOA 2JFWA 4B6OA 1R8JA 1G59A 2Z6UA 4C0QC 4PGAA 3AL0C 1L6SA 1P1BA 5A5DA 1V11A 2ZUUA 3E8SA 5K0EA 3UIEA 4DLUA 4RV5A 5GZ3A 3PFFA 5FEZA 3TFCA 4JSYA 2HO4A 4G9GA 2YJ6A 3E3HA 1I10A 2HE8A 4MINA 2AE1A 3L82B 5J47A 2DSVA 5BSWA 4DJED 4HJFA 1E58A 3AQUA 2AG0A 5KYVA 1DIOA 2C0HA 2W11A 1N4DA 2J3LA 1W5TA 4MV7A 2OR2A 4EG6A 1Q17A 2P4SA 1P3JA 3BCFA 3DXYA 3W2FA 3DC8A 3BK1A 3IT1A 2YFHA 3OAAA 2XCQA 1UOZA 2ADOA 4HVXA 4GRSA 2AQIA 4WKCA 1IM5A 5L7WA 4IV5A 1DAIA 3VTKA 4AWBA 4K3ZA 3ONVA 4KE7A 3ZVHA 2GXQA 4Z4CA 5KNBD 1CR1A 1NOUA 1II8B 1A5MC 5AYYA 1LZLA 1S5PA 4O1AA 3LCCA 4WKFA 3QYQA 2VPWA 4X9SA 3TTSA 2C4MA 1WUIS 3WF1A 4LYFA 5BMVA 1ISXA 2V96A 2J75A 4Y9RA 3A8TA 4PXYA 1LBEA 4J3NA 1E6LA 4RL6A 3EIEA 1RCUA 2X8LA 3RUBL 5A7HA 1V6WA 1USVA 1FJXA 2E37A 1V2GA 3TCEA 4RMGA 2ZWZA 4PFMA 4QGGA 3K8LA 4NYMR 3W25A 5BNIA 3ITVA 3RILA 5C81A 3OTWA 3D2LA 1TMHA 4TZTA 4YHGA 3F03K 3CNLA 5CDUA 3NG1A 5I9SA 1RI5A 3R6TA 4IF6A 4DWSD 4FJ0A 2NV2A 3T2PA 2WJZB 3I1IA 2OXEA 4L95C 4AQ7A 2H3EA 3HDJA 2XQFA 4MB4A 3KELA 2FLWA 3QTPA 4G63A 1LXCA 3WF4A 4IP5A 5KNBA 4C6MA 5GWXA 4LU0A 1FWJC 2WQZA 3QH2A 4EHFA 4TXMA 2C3OA 3ETDA 1JCNA 5EE3A 3N7AA 1X42A 3DZJA 3HRHA 2VHEA 1QZUA 3UXDA 4PYMA 3LA8A 2GPYA 5TVGA 3KLMX 4L2IB 5F76A 2ODAA 2PDGA 2ZT6A 1JDEA 5G0TA 1P7YA 5K8JB 1LL7A 1XX1A 1P7CA 2UXDB 3O8CA 4ZJPA 1AKMA 4D6HA 2HMTA 3GG7A 3NBZC 1LPBB 1GARA 3II1A 1Z0DA 4H6RA 2YR0A 4FYWA 2X1TA 4MS4B 2JAPA 2P67A 3KE9A 2H1FA 3VFLA 2PDLA 5GNXA 3N2EA 4FCWA 3DFOA 2ID7A 3TDNA 2XN0A 2HCJB 3AYRA 1DELA 1CY7A 3VC7A 5JIWA 5IJAA 13PKA 1XZFA 4MUIA 1XOIA 1Y5XA 1LFAA 1L4GA 3RS5A 2Y85A 1KQOA 2JCXA 4QE4A 3PBGA 5LZ8A 3KUUA 1IJBA 2WM0A 1AZSC 3E5BA 1ZSXA 4FGUA 3KCQA 3W2HA 2VP3A 3L7JA 4DJAA 3E6EA 4F38A 4QXQA 3WHIA 5B57C 1TQXA 2KLHA 5FAJA 3V7NA 5BVGB 2X2YA 3NC0C 4I6GA 4CR6A 4K8RB 4YRAA 3BCJA 2DWCA 5FORA 5AVJA 2X40A 2R24A 4TTUA 1VZWA 2VHVA 3LY9A 4AD5A 2BJWA 4UARA 1VBJA 3H4VA 5KZMB 2HHLA 3UP8A 2V6FA 2GZ1A 1YKSA 3BJZA 4GZ5A 2XMCA 3MUCA 5FT9A 4C6CA 1XGEA 3W22A 1HNYA 4H7DA 4DADA 4BY3A 3UAXA 5KWIA 3PR3A 3THYA 4DLFA 1XGKA 2P79A 2FW7A 5DBFA 4U2EA 4KW7A 4OCZA 1P2UA 3PLRA 3FPAA 1SBZA 4FEZA 2EQBA 3WJYA 3RSOA 1TVLA 3ANNA 3GXBA 3KYCB 1AS3A 1TW2A 2BTMA 1ZD8A 3PKJA 4FW9A 1E94E 2PP1A 2GYVA 3AM3A 3PZBA 3RFUA 3UXLA 3PI6A 4IOTA 4OFXA 4HNHA 2REQB 1XJBA 4LV6A 5M3WA 3DDOA 3ZY4A 3HG4A 1R4MA 3AETB 1B4EA 2Z8XA 4AKEA 1LWHA 3G82C 1HLPA 1XLHA 5HDRA 1OXBB 2QI9F 3SVTA 2Y0PA 1E63A 2PTZA 3PC2A 3R2JA 1NBME 4N3CA 4F4FA 1YBAA 3ITKA 3D4BA 4ER6A 5CAEB 3GIYA 4UBNA 5EYPA 3RT9A 1AXEA 4MIOA 3N76A 1L7MA 3ONCA 1RADA 5DP2A 4NH0A 2XNHA 2OWCA 3OIYA 5J8LA 1VGVA 5HK8A 4K8EA 3ANXA 3NHYA 3CB3A 4Z0TA 1QYWA 1VJIA 5G4LA 4PHGA 1I9CB 1GGEA 1OYBA 3NHFA 2DF8A 3WRYC 3HSSA 4HLNA 3A4WA 4QE1A 4BI6A 2I9EA 2NIPA 1FTYA 4Z3KA 4J35A 4EW3A 3C2OA 5K9ZA 2QQEA 3EGOA 3A4LA 2WWDA 4FFDA 3BV4A 4JD4A 4CNSA 2R25B 1NVEA 1G7CA 5HJYA 2G4CA 4KE6A 1F3LA 1N2BA 1CS0B 1Y7IA 3S2FA 2H1CA 1A9RA 4Y8VA 4DN6A 3RYCA 2APJA 4D4KA 4B76A 4ZOLF 4J3ZA 5IVPA 3WFAA 1OK6A 3TDFA 4DRZA 1OXXK 2RGGA 1QU2A 1EJ2A 2QE7D 4OKIA 3ITNA 3KRUA 3TQHA 4B3MB 4M1BA 2D0GA 2AX4A 1KOLA 1PEDA 3KUCA 1KJZA 3GIPA 5AHEA 1WU8A 2QW5A 1P0FA 1KJNA 2VQSA 4WNIA 5L3VA 1GQNA 4GVXA 1E1QA 4DYEA 1OWMA 2BDQA 3JVDA 1XBVA 4D96A 3V4OA 2WT8A 3URBA 1S3IA 2XDAA 3ZLBA 2V69A 4GL2A 1QOQB 3VUPA 5KC9A 1IAVA 1P7PA 3PFNA 4K46A 1Y63A 2Z7KA 4R34A 2BKVA 4MWAA 3R7SA 2HNHA 5DHUA 2YQZA 1H94A 2G71A 2PO5A 3GEIA 2BH9A 4ODIA 4GDFA 4XTIA 2VPTA 3Q58A 1UC8A 3AILA 2GBGA 3B78A 2ZJ1A 4GX2A 2OO0A 3VKBA 3LTEA 3FBGA 3CF4A 2PTWA 1TIMA 1VFTA 5MKGB 2GA8A 3G3EA 3GBSA 4K2AA 1A0CA 3G6MA 1WSDA 1FYXA 3D1VA 1QB7A 2CFSA 4X1OA 2I4NA 5LA2A 1PL6A 5EWJA 3D2CA 3QBDA 1W47A 1CI1A 2ZEJA 5FWNA 4UEJA 4KWCA 4LPSA 4ZCLA 3CGGA 2ID9A 3E9RA 4AHOA 3ETNA 3SYKA 4RIFA 4MVJD 3VA7A 4D81A 1NIUA 1V6CA 3MDUA 4A2RA 4M1SA 4AZCB 1XWWA 4RM2A 1XLMA 1MQSA 1TKBA 4CLXA 5JZMA 5FRDA 1QI0A 2HOQA 4D99A 4PCPA 3KFXA 1TCCA 1N2CB 3SZRA 3FJ4A 4NTZA 5LSAA 1KJQA 4GP9A 3MMXA 3WIEA 3UGVA 1CSEE 1QHSA 1UXKA 4JBXA 5M5BA 1PLJA 3TTXA 2WKQA 1YHYA 4PYIA 4JEMA 1RXEA 4RH1A 1DCTA 1UD6A 4F4DA 2WJIA 3S5SA 4EM6A 4BPRA 1KKOA 1GGMA 2OB1A 4J9UE 3N4AA 4DMGA 4QGSA 1TE1A 2YZ5A 3IJ8A 4Q7QA 4FSHA 5DNWA 4PLCA 1E5NA 4JZ5A 5D33A 3MPGA 3NVDA 2JLAA 2JVIA 1NE7A 3RHTA 1Q44A 1TQHA 2ZQ0A 3E18A 3G1UA 3U49A 2YW3A 2Q28A 4CR8A 3PPGA 1H0KA 3PGXA 3E2VA 4YRCA 2EKGA 4DA4A 4JROA 4INJA 2GSHA 1FCVA 3S8HA 4B3JA 4NZ4A 4D8WA 1YZVA 2BOFX 2GL5A 2Q4BA 4DM4A 4S3AA 4B3SB 1X97A 1Z5OA 4ZMGA 3HM7A 4FR0A 1NGSA 3WIJA 2GEBA 2YJQA 3BLLA 4RJ2A 2GBLA 1Y0BA 5M2FX 4LYDA 1U9IC 4IW3B 4JXZA 4ZGBA 3AHYA 4LC8A 1CY4A 2J46A 3VIKA 2XZDA 3FCYA 5CVJA 4YS6A 3I5AA 4Q8WA 5M3BA 5HUHA 1JYSA 1LC0A 4NZYA 4CLDA 3VOSA 5ITWA 4ORMA 1ADFA 3NEYA 3I45A 3EASA 3K0CC 1F2DA 3FWZA 4OXRA 3DUFB 3EEYA 1GVSA 4XO6A 4A3QA 1FP8A 4NEQA 4LJAA 3FVWA 1JR1A 3RLFA 4W8LA 1V0NA 3C0LA 2HO5A 1N7GA 4IEIA 4KQ2A 2ON6A 3FCCA 3HYCA 3AVPA 4U9HS 3BUSA 2N42A 2XCTB 3P9YA 1TQ8A 4GI7A 1BS9A 1E3EA 1RABA 4LOKA 3E9QA 3UCFA 1BG6A 3QLEA 2PUDA 1OK4A 2QTZA 1WCGA 3IRSA 2CVOA 3S0CA 4LZAA 3SR7A 3OTOB 4TN1A 2CHOA 2MINA 3EX7C 4P35A 1ZN8A 4BCBA 5C53B 1PZ3A 1Y5MA 1W8IA 1NQAO 5B4VA 3LXXA 4BFUA 4FS9A 1SU8A 4LXUA 1R6VA 3CEPA 4IDAA 3UW1A 2H08A 3MGKA 2D13A 4JLPA 1C0PA 2Q2OA 4KRXA 3LSBA 4PRKA 2JCSA 1RYHA 1O12A 5EZYF 3PC0A 3VABA 2BOGX 1OYWA 4N0DA 2ZCVA 4BFAA 2GO1A 1FX6A 5A3SA 2AJ8A 3UFXB 3RLHA 2ZJ6A 3M9YA 3R40A 1U28A 3RDPA 4M86A 4RX0A 3DTYA 1OROA 5P8WA 4JVLA 4QEEA 2BR5A 4BFLA 5AIBA 4IG4A 3DIPA 1XAJA 2W2LA 4JLKA 5CMLA 3VAZA 1HDEA 4C76A 4CUCA 1VFPA 1E8NA 2O2SA 3KP0A 4NBUA 3C0KA 2O06A 1DXEA 4ZEOA 4NYYA 4V0SA 5JBNA 3HADA 4X61A 5LCXA 1JZTA 1DBVO 3ZSTA 5C8ZA 1N7IA 4OBEA 3E0VA 2P4UA 1UBNA 3E22B 4LJ4A 1XBYA 3JRXA 4LMBA 4URZR 4EWLA 5K01A 4MVXA 1UBGA 1DC8A 2Y4NA 2F62A 4ZVJA 3AIIA 2J6VA 2EX4A 4GNJA 3MS7A 1NWTA 2HS8A 1OTHA 1H4SA 3O3OB 1BC5A 1TB4A 2DSKA 1W34A 3SF8B 1V6SA 3GPLA 3AEKA 3I92A 3NO1A 3WNPA 2E3ZA 4UZSA 5IWCA 5JH7F 2WSQA 4WOCA 2I3DA 4WWHA 4XWGA 3E84A 1DEXA 4RZXA 1O0SA 1L0PA 3PUWA 5ABEA 3SSAA 4A0GA 2XFWA 3AJEA 5HANA 2I9KA 1KRHA 1Z73A 3EDRA 5AI0A 5CJ5A 3OTIA 4RV8A 3RVOA 1VFSA 2J24A 3UXKA 3JVVA 5LQCA 3VOJA 4GOMD 1GDTA 5ESWA 2XDFA 3IA7A 2ZQ5A 1XDLA 4C88A 3UWEA 1HQCA 1D2MA 3UJ6A 4DAOA 3LQQA 2V7WA 1NELA 3EPPA 2NU7B 1K7SN 5BR8B 1STOA 4FI4A 4ZRNA 2NACA 5C5CA 4CEXC 3AROA 5M5DA 3PC7A 4JAVC 3GFSA 3PB2A 2Q07A 1XIVA 2GCGA 3M4YA 3RFXA 1MDBA 3B36A 1I2NA 2WCSA 1CQZA 2HWXA 4KRUA 3IEUA 3PB3A 4I3HA 5IEBA 4BK9A 4N8SA 1FKXA 4N5DA 3ELDA 4TMCA 4IPLA 3ANLA 4NSBA 4HSGA 3PNQA 1QHIA 2P0YA 2WB2A 5JH2A 3NQBA 1H50A 5DRCA 1QHPA 1AJ0A 1QRQA 1JL3A 1QH8A 2E8ZA 3BFPA 2I2XB 4OP2A 4OSPA 3VKDA 1HUQA 3GC5A 3CV6A 5DANA 1TJ4A 5HUQA 1AO0A 5AXBA 3F5JA 4IO1A 1TIBA 1AQIA 1GEGA 5TE9A 3L05A 4CIWA 3ED5A 2QTAA 3QA3E 1DC4A 5HULA 2BZ1A 2Y1HA 4A36A 5DULA 4D4MA 1FF9A 4HWRA 4JD5A 1LOSA 1S46A 2DZSA 3LHZA 4H9VA 4TMZA 1QZXA 1XCFA 1U5BA 2E5WA 4O1MA 1D7KA 2QCHA 1N5OX 4WSOA 3EWAA 2FEWB 4CF4A 3PF3A 4YP7A 1XYAA 5KYUB 1J06A 4I7UA 1KI7A 3C6XA 3SW6A 3FLMA 4Z0NA 3R3JA 1E89A 1LYXA 2ZJ7A 2R68A 3OCVA 4W1PA 3AKCA 3NOXA 1FP2A 1RY0A 3ISJA 5CPBA 3FJ6A 1GQSA 3UZYA 4V1YA 1SOAA 4JQ1A 2FSSA 3E1KA 3E5RA 1SMAA 1AKRA 3T7SA 2A14A 2XE8A 3ES9A 3U4AA 3VH3A 4XDGA 4FDTA 1KYZA 1NOIA 2A9RA 4BJHB 1DBTA 1X6NA 3WO8A 4WBNB 1P18A 2ATSA 2AK3A 1KQPA 3KHDA 2P2NA 2JIWA 4Y90A 4WXYB 4JKLA 1IZ7A 3TC6A 2EF9A 3I0MA 2DDXA 5E3IA 4ZO7A 1T5TA 1J6OA 3WGLA 2NXGA 2XKJE 3HCFA 1EX9A 4IG2B 1DADA 1XRQA 3CZGA 1F17A 3NRCA 1UJCA 1AA1B 4OU5A 3SN6A 4KIWA 4WACA 2FWPA 4WLFA 5CVUA 1L1QA 3TTEA 5DWVA 3HPSA 1AK1A 2JGLA 3VA8A 4LEFA 2N75A 5A2BA 4U8HA 4YIKA 1GORA 1AF7A 4C29A 2RGRA 3AEKB 4N4AA 2ZJOA 5HQ3B 1CHDA 1V0KA 4D8YA 2ZRBA 4B6GA 3EDJA 2HR1A 2VZVA 4DIEA 2CXOA 1RKXA 4WLNA 4D9NA 3WH7A 3GUYA 4DLYA 4BXOA 3JQBC 4KP7A 5HNKA 2BM1A 3M4HA 3OA5A 3ID7A 3LLFA 3T7EA 3TL3A 4FLSA 1DTNA 5DBTA 2Z0MA 4R85A 5KETA 4ZODA 4MA0A 4ECEA 4N3AA 4NXSA 2C2KA 3EXG2 3WBAA 3DW1X 4NZ9A 2UVQA 2XA9A 3FN9A 4ZA0A 1TT5A 1W7AA 2D2VA 2I9PA 5EXSA 2BKXA 2RAUA 4DQ0A 2OORC 3LLUA 3ZLHA 1AMUA 4EZEA 3QKTA 1J0EA 3KZOA 3QZ6A 3HA1A 2EFDB 2PZGA 2NZUG 1HO4A 2WZHA 4UTKA 3KLLA 1DQSA 4R98A 5EJAA 1WD7A 5K3OA 4U00A 3C0JA 5BWFA 2G9NA 3C5EA 3R0XA 4QNWA 2E5LB 3AHDA 3LC0A 2HKIA 2V55B 3K0BA 2EEPA 4UU8A 4JBRA 3ZWWA 2VK4A 4V0KA 1KMHA 1E1DA 1IAQA 4JOBA 5CU7A 4QPPA 4N65A 1WDPA 2P5TB 1WKYA 2VK1A 4W5RA 5B4TA 2ZROA 3TLGA 4Z1BA 4D9IA 3C3CA 3GO4A 1D4FA 3RJ9A 4IGHA 4PH6A 3TNFA 3B3QA 2G07A 2Q1UA 5LWQA 1X8LA 4ZO9A 2CWWA 1FDSA 5KREA 1VH7A 3VH4A 1I6NA 1ULBA 3AFGA 3UMSA 3ZXYA 4NZ3A 2Y63A 5ALEA 1VIMA 4MV0A 5FF4A 1HDGO 4ZQHA 2FG7C 1KF0A 5DO9A 1TT5B 2AKYA 4ER3A 3DR5A 4RTRA 1RXWA 4KR6A 4NNOA 4WKGA 1UBJS 4MKRA 4YRIA 3KR2A 2QTCA 2IUTA 1RP9A 4XWYA 1W73A 1JNXX 3BD6A 5CM8B 1GNSA 3MKVA 2H5JA 3WLQA 4X64B 3CBQA 4BXOB 4P98A 4TU1A 5G2OA 1QPBA 3OGSA 2CCRA 3V00A 4RIGA 1Z4PX 2VJDA 4FCTA 1ZJJA 3VC2A 1U3UA 1XCXA 3LUHA 3L65A 2OO5C 4CKCA 2IPFA 1SPBS 2PRIA 5EJEA 3AYSA 4KXVA 1RCTE 3TD9A 2IOHA 2J8TA 1FFDA 4CM4A 3TTUA 2R1ZA 2PUHA 2IJGX 3DS8A 3BL5A 1XP8A 5HFNA 1VJGA 2Y2VA 4I1VA 2VAVA 3SJUA 3ZIDA 5CA1F 3C3YA 1DX9A 4Q7KA 2HRBA 2A9OA 2WK1A 3MA0A 3DTNA 1DG3A 1Q13A 1NZFA 1QORA 2Z28A 1GGVA 2C59A 3G7SA 2EGHA 5DTRA 4CGTA 2DZVA 3FDIA 3WA7A 3UAVA 5BORA 5HIIA 1A98A 5SYMA 4KXUA 3LPPA 1PUXA 3NGFA 4BJHA 1CCWB 4D46A 1AXGA 2Z3VA 3E27A 1Q7TA 4J7AA 3KWXA 4RD2A 4JBYA 1TA4A 5BOFA 4K86A 2QK4A 1UZDA 3QW3A 4ZJYA 4V0ME 2VTBA 1ZW1A 3WSVA 3L66A 1A5ZA 4ZCQA 4KO8A 4I2NA 2WC4A 4PYNA 4BBZA 4Q3CA 4R53A 5JSFA 1ECLA 3CPHA 1CZ1A 1C9MA 5F21A 2YDAA 3KBMA 4Q00A 3RU6A 1YL7A 3AESB 4WT7A 3ZBTA 3NIFB 5JJCA 1US8A 1OBFO 1Z5PA 1C7FA 3L9CA 1YMUA 2IUSA 1NR5A 4TL6A 5BYBA 2N1BA 3N0WA 4ES4A 1LW6E 5KSPA 4L4UA 3W7OA 4KN8A 5AI6A 4QRNA 4H17A 2PGJA 5D87A 4DRSA 4H41A 1V51A 1VKZA 5ADHA 3QVSA 1XROA 4S12A 1XX6A 2CEAA 5KQMA 4IFKA 1AH3A 2BUAA 1R8YA 3PWZA 7ABPA 5CX4A 5CT5A 3C3MA 3D7NA 3BQ5A 3G2QA 4IUCS 1K3TA 1TQ2A 3ARSA 1DCKA 2QSUA 3CZ8A 4CF5A 2ONKA 3PY2A 2WUDA 2ZDHA 4BMOB 1S3SA 1HT6A 4HQOA 2FDMA 3T6KA 4OHBA 2XM1A 1CUDA 1OT5A 2PXAA 5KKAA 3CZQA 4GYKA 1X1NA 1TM7E 4CM9D 1WCIB 3EZYA 1S96A 5C32A 5LIXX 2IS1A 4WW0A 3TIFA 2Z1BA 1UYQA 1Z7GA 4GDMA 4CEIA 3NDRA 5H68A 1ZUNA 2VBCA 1RAKA 4AD4A 4ND7A 4J0FA 1F2JA 3O93A 3W1NA 3DBNA 3BEOA 1M5UA 2JIOA 2F2KA 5FXMA 1TX0A 3PG8A 1HC7A 4MADA 1SU5A 3EOLA 4EJMA 3PSVA 3S1VA 4I0WB 2YYZA 1C3VA 3GH7A 3U7JA 1EGQA 2Y67A 4JTIA 1DWJM 1U2DA 2BDUA 1EB8A 4EG3A 2V5BA 3KEOA 3KQQA 4JR0A 5DCWA 2ZRGA 1OFRA 1IYXA 1OC6A 3UUWA 2WF6A 2OMKA 2ONYA 3VU1A 4OGGA 2NNWB 3VM5A 5EI5A 4ZTYA 3FG9A 5IDZA 3A9UA 1JBQA 1GRNA 3VR2A 1OH6A 4UTTA 2G04A 3RS0A 2A3NA 5HKBA 4Q4HB 5G5IA 2OILA 3LNCA 2H1VA 2PS2A 3RM9A 4PZ9A 1L6WA 3K9WA 1BA2A 3EA4A 5JCPA 1W9HA 3NX4A 1OIFA 3O7UA 2NYAA 4GXQA 4M0LA 3VGJA 3S7ZA 5DHFA 3PFMA 4CYMA 5FI5A 1MHPA 1NXQA 3FOCA 2B69A 1IK6A 4N5LA 1CB2A 4PN7A 2VFEA 2RK3A 1JVNA 1SB8A 5LQRA 1ZK2A 2QUMA 1M68A 4A2PA 4F4RA 1R4MB 3AETA 2Q7DA 3FSGD 2I91A 4G9BA 4RZ3A 3H5LA 4MVWA 1I13A 1PX4A 3W6YA 1XZDA 2QRPA 1EWTA 4J3XA 1RYBA 3SCZA 1OLUB 2Q5QA 4LYRA 4R9SA 2IVFA 1V4NA 4FF5A 1FX0B 4G2NA 4KO2S 4UHHA 2XXBA 4HOZA 4N7RA 3S1XA 4TLCA 5ALTA 4Z53A 1DV7A 3C6YA 1MVOA 4U2FA 2Y2WA 4E4PA 1BMDA 1WQ1R 3CFYA 3C6BA 3NJRA 2GD6A 3RREA 5BN3A 1I94B 5J2TF 4G1EB 5TIIA 4MWEA 5REQA 2H2FA 2W66A 4X92A 3IAPA 5IVIA 2AD1A 5KMGA 4QXPA 2VXNA 2VJXA 3ADPA 1GA4A 1E6MA 4Z8YA 1EMDA 4RSMA 2FZVA 1PDOA 4EUFA 5LVAA 1QRAA 2NXNA 2I9UA 4O8AA 4EAAA 4JK3A 4AZGA 2WVJA 4FE4A 2XTKA 4ZREA 4B6RA 1H2XA 3BZWA 3PVSA 2AH5A 4JI8B 3CZEA 5I8PA 3ZHVA 4NCBA 3ZHBA 3EKLA 1W56A 4QUAA 1KM2A 1WYIA 4BC0A 1UPFA 4EHIA 3UKDA 5DY3A 1RRFA 3A11A 1A0DA 1MAAA 5DYIA 5ERXA 4DPQA 2H5IA 1ZJBA 2WPBA 1TLTA 5NULA 2GQ0A 3ZZ1A 4CCYA 1D3HA 4ATDA 3MIIA 3HMQA 3QEMB 1NVGA 1TKAA 3ARWA 2GDUA 2NAPA 4XCVA 4Z0SA 5HMDA 1ABBA 2H0QA 2NWRA 3AKYA 5TQVA 1GZVA 4TS1A 1IZ8A 5I7OA 3F1LA 3DUFA 1VP5A 2GCOA 4HMQA 3WK2A 3L7IA 1C29B 4XUEA 5K2ZA 3HG3A 1SKYB 1XMIA 3PUXA 2IT1A 3VPCA 1X7HA 2J4GA 1TQJA 1J8FA 1B2LA 2AL2B 4DIUA 3C6ZA 4YRDA 1ZR4A 2DWQA 1EUCB 1YJQA 1OV4A 1X7XB 1ZL2A 2Z25A 1TYGA 1ZUIA 3HBFA 2QR5A 1UCWA 4D72A 1NF3A 2BFBB 4X6YA 1UZHA 3H2ZA 1GVIA 1YBMA 4TZ6A 4MKHA 4M22A 1IBMB 3NYWA 3HCRA 3WH8A 3EFEA 1Z47A 2WPDD 5KWJA 3RFFA 1UT5A 2V7UA 5IT4A 3RAOA 3BXWA 5F1PA 1NFQA 4I4TB 3NBQA 1X80A 3EUFA 1W6UA 3HU7A 3H1GA 1GNQA 4OHWA 4X5OA 4V3CA 4N8EA 3LCUA 1VDMA 1A9OA 2V3WA 3K1TA 3WXMA 3TW4A 1IB6A 3E9ZA 3LTSA 2YJZA 2VF8A 1KXQA 5B1SA 1LM1A 3KOFA 3GHHA 3B1ZA 4DA0A 5DXFA 1T0IA 4KGJA 1WMBA 2OZLA 3M1YA 3UKOA 3AUKA 2FRDA 4DJ5X 4MKFA 3H4GA 1E3TA 4RY9A 3FNHA 5HBFA 1DPFA 1ONOA 4RV3A 1GUVA 4A3HA 2DSNA 2HISA 3U6KA 5AHWA 3B8IA 4L15A 5I4KA 3T7TA 3L7AA 1V47A 4TUFA 1XE3A 1KSJA 4BFZA 4WN9A 3SR3A 4PCLA 4IJQA 4AVYA 3H5NA 3E7PA 1RZUA 4LRSA 3GP5A 2HA2A 1BG9A 4LBUA 4JCOA 2R7KA 4G3XA 1OW3B 4WXPA 2Q3OA 5CB4A 2QMJA 1Q15A 4P4TA 1BQCA 3CHEA 1EGVB 1PUIA 4UAGA 5HZMA 1M10A 2R6OA 2ZJ8A 2CZDA 1RK6A 3ORQA 2ZBDA 1E5JA 3HDTA 2Z2AA 1ST2A 1FCUA 4JA2A 4DM7A 3FTQA 1GEQA 1YIOA 3BAZA 1MNZA 2E68A 3RRNA 1XMJA 1GWNA 1GIAA 5IF9A 3ZVMA 2E6DA 3KTAB 3ZNNA 4DJJA 3MCWA 4XQ0A 5EWJB 1U0BB 1QNPA 3MW7A 5ANRB 3ROPA 4ALNA 1OWQA 2NAFA 4OXIA 3AUAA 1JYNA 2GFQA 3ZVHB 2WHEA 3P1JA 4NFLA 1VIAA 4TKZA 1EVZA 1E7YA 4C3OB 3LDGA 5CT9A 3ZIAD 4HQLA 2GBPA 1QGYA 3RG6A 5GINE 3M7WA 5LYRA 1GZ3A 4YJKA 1RT9A 1QAQA 1QBBA 2YYSA 1B8NA 1RJ9B 2A84A 3OZXA 2CC0A 4B74A 3PBYA 4LY8A 1VYPX 3W3AD 3NQGA 3HDYA 3U17A 2ZZ5A 1XDJA 4AVOA 4HUQA 3W7JA 5H16A 2ZRVA 4JB2A 1W1WA 3JQEA 1FXPA 1DAFA 4L6CA 5K6AA 4K8GA 5LQJA 2MSWA 2PLNA 2IU6A 3O3RA 4N3GA 5CDSA 3I7QA 1F06A 2DR2A 1R5OA 3QVWA 2RSLA 1JQXA 1OUMA 2QCEA 3DOEA 3IPXA 1OFDA 1QF7A 4K3UA 3B05A 2JGFA 4BB6A 2G9VA 4XYEA 5KTRA 2PSEA 3OUTA 4G0MA 4BNXA 4C4AA 3SHOA 3JYLA 2VR4A 2NGRA 5HKLA 2G3NA 4LW7A 1UR5A 1EJTC 1KQGA 1ADGA 4U2CA 1UDCA 3A9WA 3K1YA 5LD2C 1DX4A 4UM8B 4MJLA 1CS0A 4XDHA 2IYVA 3LT0A 4CIAA 1JWBB 3P0XA 3SE0A 3PQ6A 1KNXA 4PEEA 3B8EA 3V7WA 2I76A 1GGKA 1ZIYA 3SMVA 3PIRA 4OHZA 4XKYA 2OD7A 1ABEA 3S4TA 1L5YA 1JAYA 2R00A 4PWYA 4PPGA 5JDIC 2JLSA 4YGYA 4ZOCA 3NHBA 2VWQA 1TTQA 3LT1A 1WOMA 4DJFD 5EUMA 5HNRA 3N11A 3LG3A 3RS9A 3HU3A 3GJSA 5E6YA 1RYEA 4S1FA 8TIMA 3LTNC 3FGNA 2A1UA 1W1YA 4R1TA 2B4AA 5DWDA 1LF0A 3ZTTA 4UEOA 2C7OA 2WW8A 5LA0A 2CXSA 3R9WA 5BNWA 3CF4G 2VEDA 4YDRA 3BB1A 3WGUA 1D9ZA 1TVCA 4MWBA 2PGDA 4L75A 2PSJA 1ULSA 3CPRA 4K05A 1AT1A 5B7QA 4E31A 3HP7A 4K9KA 2OLAA 3TBHA 3LEPA 3SIWA 3MOIA 1H60A 2O2CA 1UMKA 5KYWB 3TN4A 2YN4A 3U56A 1Z5WA 4RLSA 2XH0A 2JKVA 3K8OE 2AWNA 2B7PA 2BUBA 1COWA 3ZE6A 3DBRB 3F7MA 4UIOA 2J3QA 4BBPA 2PH7A 2ZBTA 1AG9A 3EWWA 4FX2A 3U9SA 1UMYA 2V7PA 4RY2A 3VTRA 2OWEA 5EIWA 4GI5A 5L3SA 4D6PA 1T4CA 4ZT2A 3OZ7A 4P8XA 3KHTA 2FVLA 2Q3EA 3EQZA 2V9PA 3H6HA 4AKTA 3C2QA 2DQXA 2ACRA 5ALVA 5LC1A 1E2FA 3THCA 3SAZA 1T4CB 3VD4A 1JVBA 3TNBA 2FPRA 4TL8A 4Y9SA 3QEAZ 1UROA 1WSWA 1DWUA 5TQLA 1RVDA 3P45A 5IN4A 2NWSA 1E3JA 5AK6A 3PRYA 5SZKB 2PFHA 4YCOA 2CKDA 1N1GA 1X6VA 5TEVA 3Q72A 2Z3WA 1X8FA 1BVUA 3VCRA 2W71A 5B37A 4NJGA 1GHSA 2HBVA 1Z68A 1XJWA 3AFOA 3WDPP 2GLKA 1GV1A 1JHAA 1XBXA 1ETUA 1JDJA 4DWSB 1YDFA 1OQFA 1AA9A 3HY6A 4OHQA 2WM8A 1V5WA 4NY1A 2QAGC 1A5UA 2OPHA 4YXFA 4JTFA 1DJNA 1UDBA 1R0CA 3WLEA 1W5FA 1ZCOA 3SB0A 1KY4A 4N47A 1H5YA 4F9EA 1JLKA 4K03A 4CUKA 3G1RA 2R0QC 4H7EA 3OPSA 1HNXB 1C2TA 1MH9A 4IWYA 1D0IA 3EB9A 2XY4A 4U7WA 3KBJA 2A9JA 1A2BA 1KAGA 4ETIA 2CLHB 2OENG 3EB3A 6YASA 3WQPA 2GNAA 4N6EA 1VG9B 1TJPB 4D3FA 4Q39A 2PMCA 4HS4A 3IQHX 5C7VA 5C8BB 4M88A 1ZALA 3LPFA 1OADA 1VCFA 3KJGA 4UVHA 3U1BA 4E2BA 2DB3A 2RJNA 3BMOB 1HQDA 2AMXA 4HNTA 2YRXA 2VRCA 3HRIA 4WQMA 3KQSA 3GUUA 3IIKA 1ISMA 3W6OA 4O25A 4M8KA 2D5AA 1Z0ZA 2QPAA 2O0HA 4TMWA 1A82A 2ISFA 5JC1A 5AJTA 5LNK6 4S2UA 4E7PA 3USES 3BSMA 2WJZA 3NUZA 4FEYA 2LKCA 2MWMA 4NMXB 4LPCA 2VP6A 4IHJB 2B78A 4QSMA 3WJAA 3AXXA 1KCLA 1TI7A 5FOVA 4KQHA 4PGGA 2DPHA 3CQKA 3OA3A 3AXHA 1R50A 4FNMA 5LXTA 2FF7A 3KKMA 1JHUA 1K8XA 1JLHA 3SHVA 1NYLA 1KRXA 4JU8A 5JXWA 4YWIA 2JLQA 3V5NA 3ZCUA 1YULA 2YW9A 3DXZA 4A8JA 3IBYA 4C7BA 3B8TA 1NYQA 1EO5A 4C0BA 5C1OA 1TRKA 4GCXA 3QF4A 4C6FA 2IXVA 2CE2X 1KQ3A 1SVMA 3RVKA 3WLJA 3OFJA 3DXXA 1YB4A 3HHEA 3JCZA 3UD6A 3UV3A 1H7WA 3PVCA 2ZS8A 1X19A 2YY7A 4LC1A 1O87A 4N7JA 5J9FA 4ATNA 2DSUA 2WNIA 2FPGA 4YRNA 3HWSA 4PCFA 4JEJA 4ZANA 3AMVA 3UOGA 4H3KB 2Y1LA 2PZMA 2HK0A 2R6FA 4M55A 1WZUA 1EC7A 2CMHA 2PH5A 3GZAA 2BFMA 2PDMA 1LBFA 1J0HA 3M6YA 2R87A 3K5WA 2HCVA 3F5LA 3GB9A 1EVLA 4JTDA 1SSDA 3ZG6A 4I4IA 4L0MA 5HXAA 4ZHQA 1OD0A 4I1SA 4E46A 3N9RA 1WETA 1FMTA 1X38A 5HATA 3MWKA 1EK5A 5E1MA 2HYIC 4AC9A 4C7VA 1C91A 3UCXA 5JTTA 3LDHA 3Q3HA 3DFYA 2IYLD 4LYYA 4PSRA 1G17A 1XIGA 1OYYA 2QZRA 5KB3A 5CG0A 1SAYA 1OIXA 3IQDB 2VZLA 4UBLA 1E7MA 5IARA 3H18A 1CUGA 3DYVA 2FZ8A 4Y8EA 5DBHX 4HXYA 2OSYA 1MA0A 4B43A 1QE3A 3ITXA 2QIWA 2Q8PA 5JCOA 5CB4B 4DLAA 3WQFA 1E6WA 4WD3A 3ON5A 2YJ3A 3NQAA 3MY9A 1LROA 2OBMA 3ARQA 3BGAA 4AJ9A 5FO0A 3ABQA 4B5UA 5EKSA 2WNSA 5C2GA 1J07A 5GOZA 1GUFA 1XELA 2WAAA 4YVVA 2GK1A 3EEQA 2G8ZA 5I23A 2FVKA 2D2JA 2PZFA 1YXDA 1H61A 3AYZB 2QRUA 3SIPA 4GISA 4WADA 2BKUA 4C06A 2G3JA 3TECE 4M0XA 2P7HA 3DMYA 4XVRA 5CP8A 1Q7ZA 4YAIA 2O5CA 3NOEA 5BPHA 4C1NA 3BERA 3AOEA 4XVHA 5GPBA 1OBAA 3MSXA 1NULA 2G50A 5FFMA 3F6BX 2BB0A 3GFPA 3TQRA 2C5HA 3D5EA 1VMAA 5HCIA 1V48A 2VPYA 2W2TA 5E9AA 4H3DA 5GQBA 2K4MA 4A0FA 4ZHQF 2DX7A 3X1ZA 1MB3A 2DR0A 3MCUA 2LCIA 5F7ZA 1UR0A 1PJ4A 3G2KA 2GJ9A 1C9EA 1DRUA 4QITA 2AW5A 4YCAA 1NP3A 2XKKA 2WWYA 3U80A 3ZXIA 1EKOA 4XK2A 3QVOA 2FVXA 4UAJA 3E3MA 3ZLVA 1LPAB 1KBQA 3KKNA 3U4CA 2O2DA 4I50F 4F4CA 1N2EA 4HTBA 4YHEA 4MJ4A 2BJVA 4GXMA 5K0TA 3PR1A 1RAEA 3DCIA 3QOXA 4TXNA 3C8HA 2EG5A 2NP7A 1XEFA 2IHVA 1WZNA 2RAFA 1TZJA 2DP4E 4BQSA 5LDGA 4YROA 2JAHA 1TIPA 3K32A 3WLKX 721PA 3RS4A 1HEIA 2ZIXA 1TM5E 2YZGA 1SUCA 4Z3OA 2H57A 2QXYA 1A4UA 2WFZA 3AU2A 2QJJA 4HF7A 1A1VA 1SXHA 3A05A 3KXPA 3G0CA 3BN3A 4N5NA 1TYEB 3WLRA 1EHNA 1II9A 4F3RA 4AMAA 4K9OA 3EWSA 1BJKA 2C29D 2EQ5A 4R1OA 1WKFA 1IZZA 2VHXA 3KJIA 2FZ9A 3QFHA 1EVKA 3ILVA 3JS5A 4DLBA 4KQFA 2G8LA 4K0KB 3NBFA 3KAOA 2ANBA 4DVGA 1KMNA 3EVBA 4L73A 1PQWA 2V6BA 4FQ8A 4DIDA 3R4IA 4OHOA 4V2UA 2BHNA 1Z33A 4RHEA 4BV3A 2E87A 4O54A 1HBJA 2C03A 4MRMB 3EVDA 3WSWA 4GPAA 4NWIA 1QSGA 2B1JA 2C8NA 1YMVA 4HU0A 3DKRA 3IDZA 4NE9A 2CKRA 2QRNA 3GFRA 1EFVA 4E5TA 3S2ZA 4EG8A 3NIWA 2VT2A 2GARA 4DPLA 4BLSA 1JIXA 1SVUA 1N6LA 4GWLA 3GY0A 4CU6A 3B60A 3ZLGA 4CDNA 4KAAA 4DZZA 1HLFA 4DI9A 2NU8A 1V3LA 3VNUA 3HGMA 3T1NA 4PBFA 5EKYA 2E6KA 5DT2A 2D74A 3NETA 4Z1OA 3KNZA 3TKAA 3QVVA 5BV7A 1VEMA 4MJMA 3LXCA 4RHCA 4BUCA 4DZIA 3EWIA 3DV9A 4EYKA 1NUSA 2IIVA 4XQCA 3OCYA 3LOPA 4J40A 5AECA 1H49A 3G8DA 3YPIA 4YK7A 2VGFA 1S2DA 1TF5A 3SJZA 2XCSB 5JAOA 2FOLA 5BMVF 4XIGS 1K70A 1GG8A 3R1ZA 4K5QA 4XLLA 3FMGA 3DVAB 3UW3A 1EGMA 3FCUB 4MA4A 1EIBA 4U0KA 1SURA 3EZFA 1PR6A 3DKKA 4UC5A 4QAWA 1S2LA 2G4LA 4AJNA 1IZCA 2AJTA 2O3UA 5BSGA 2POTA 3QLLA 3MRTA 1FRNA 4BX3A 2WJPA 3GVVA 4Y1FA 5LSMA 4C4YA 2QHAA 5AKKA 2PWBA 5FQOA 5C9RA 2W4QA 1WXJA 4A8PA 2XPCA 2HK7A 2XYHA 4FDAA 4P7NA 1I36A 2OV1A 2YWBA 1HDOA 4LY9A 5F2OA 1PL8A 1W76A 1F7UA 4OKDA 4BO9A 1N8NA 1DWFM 2ZX7A 4DT1A 3A58B 1S2VA 4UFIA 3Q85A 3UJEA 5F4ZA 2HZBA 5CSSA 1OB2A 3ZDRA 3VINA 4PMDA 4DCJA 2I8AA 5AHMA 1Q1NA 4PO9A 3H23A 3LNTA 3UTCA 1EVYA 1QDSA 5DI9A 3HPZA 4NNPA 2OQVA 3ZUGA 1W31A 1A9XA 5KS2A 5LNK1 1UFOA 4PZYA 3AYVA 4LNCA 1UW9A 3AU6A 4XPZA 2M1XA 1NTHA 2AQHA 4F2TA 1R3QA 3DHPA 5KU1A 2BV3A 4ENTA 1WD5A 1N57A 1E71M 2F6KA 1PX0A 4NVTA 3LV6A 1TCMA 4M29A 1O6ZA 5D8WA 2VO5A 4EEZA 2JFVA 2A9KA 1B57A 4RLFA 1YXCA 3EIQA 2VOTA 3G2NA 2L5HA 3NALA 2QD1A 1QRUA 5C8YF 2EZ4A 2AKZA 1K0UA 1ZD3A 1GZ6A 2GDJA 4RUBA 3V48A 3I0NA 2Z8ZA 3EZLA 1CRLA 2FQXA 4LRTB 3PCRB 4PPYA 5GAJA 2DFAA 1GFIA 3U44A 5HZGA 3F46A 5G0VA 1AGRA 1DUVG 2ZIEA 3L68A 1E60A 4J6FA 3FDXA 5CDYA 3P80A 1MBZA 4RIIA 4WIWA 1XD8A 2O3JA 1HQKA 4GZMA 1WBJB 1LSJA 4L16A 4GXWA 2FPMA 1NBHA 1BYAA 1S4QA 3U4IA 1P0CA 4RANA 3SC6A 3OM1A 4OMDA 1G7RA 2GESA 2V67A 3W04A 1ESWA 3E5MA 4HVLA 1VFUA 3DM9B 2P50A 5T4BA 1KH2A 1AO3A 4EK9A 3O8BA 4BEQA 1G0CA 1YXYA 4JI7B 1XQXA 1Y6RA 4LF7B 3CRVA 1XDGA 3FDZB 3AESA 1PT8A 4XWOA 5F52A 2VDIA 3G5LA 1AL8A 4IZGA 5C2CA 3DKIA 1Z25A 1UWAA 1IY0A 4GS5A 3VIFA 3PWSA 1ZHAA 2I4TA 3DKVA 2OT1A 3CUUA 1SJ9A 2SKCA 4HZMA 3PGJA 4ZDJA 5HAOA 2ODOA 3EWXA 2EZ8A 5D9PA 3FF4A 3K8ZA 4JUBA 4LUCA 1J56A 3QSRA 2ZU6A 1QW9A 4CCDA 3ZQUA 1MN6A 4YT8A 1TWSA 2JI9A 4QC2A 2PT5A 5K3FB 5IK2D 2FZMA 1KGDA 1ZBCA 2V9DA 3AIMA 1THFD 3ZM8A 2CUNA 4UUBA 1HXJA 3E12A 4FNPA 4UULA 1QCCA 1RCQA 4AISA 4P7QA 4YLWA 3ZWSA 2HQRA 3K9QO 4XD2A 1YB5A 2RJ3A 4QA9A 4EDFA 2AL2A 1SMKA 3THXA 3L93A 5DX0A 5KQGA 4G8JA 1BDIA 1VP3A 1FWNA 1OFAA 2H2GA 3TINA 2G41A 1HLGA 2GCOB 4AJHA 4ZTBA 4B3BA 1ZZGA 3IBSA 4J75A 3TWAA 4MGHA 4R7WA 2ZM5A 4RMHA 4QVKA 2QYTA 5G41A 4LSZA 5KOHA 3E2RA 1XYMA 2D4AA 5HCUA 2AQ8A 4LTSA 3IJ7A 3ETCA 2OD2A 5JZOA 4OJKA 3K9FC 4RFVA 3NHZA 3IV7A 4NZNA 4XZLX 1XMQB 5TJ9A 3SSMA 4RZ4A 3TR2A 1A4IA 4RE6A 3FGCB 2O7SA 2Y71A 1K6MA 2M6LA 1XCMA 4A6GA 2CD9A 1MO2A 4KTTE 1XRRA 1TPB1 3WWCA 2O8FB 3TFOA 5IUJC 1N2HA 5IAKA 4QP0A 4L9XA 1XWYA 4GFIA 2I2CA 4BP8A 1O96B 2P35A 3I3BA 1EHAA 4M38A 3OF5A 4JKYA 1NVUQ 3R8RA 5I7WA 5A9TA 1LI5A 4X6XA 1I2A