5EMKA

Crystal structure of prmt5:mep50 with compound 9 and sinefungin
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emkA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emkA02
3GIWA 5C1IA 4RTJA 1AF7A 1HMYA 5DTQA 2I57A 3SXJA 5K0BA 2YR0A 5LQJA 4C04A 3NVKI 3HCDA 4P7GA 2EJTA 2I62A 4F84A 2ADMA 3VNJA 4BLVA 4DCMA 4ER3A 3HCEA 4XUCA 2R3SA 2FPOA 5EHGA 1QAQA 4ER7A 4OQEA 1SUIA 2PV0A 3OE4A 2HMYB 3NJRA 4CXMA 3LCUA 4ZB0A 4KIFA 4RTLA 1XIGA 5K0EA 2P35A 3KR1A 1O9GA 3LKDA 3SSOA 1I60A 4H0NA 4HGZA 1A0DA 3HVIA 5ICCA 5LQCA 2IIPA 2IP2A 2R6ZA 3EMDA 1BOOA 3LECA 1GW9A 1QAMA 1NT2A 2I6GA 1JG4A 5T6BA 3KQMA 3BT7A 3KBWA 3UJAA 1XIMA 2HV9A 2IGTA 4RVHA 3LMZA 5B1SA 2P1DA 2PVCA 1A0EA 4A8NA 3LCVB 3M6WA 3BWWA 3TOSA 1ORHA 1KR5A 2P8JA 2ZFUA 4CKBA 1ZKDA 4PYKA 2FRXA 2LD4A 3R9XB 1EQAA 4PYMA 2PXXA 4RSRA 4CKEA 2QY6A 4POOA 5H6HA 1XYLA 2B3TA 4DM3A 4PGLA 5E1BA 1XLLA 3TKAA 4YV0A 2WA2A 1YZ3A 5E9JA 3TM4A 4U7PB 2GPYA 2ZIEA 4RV9A 5GM1A 4KW7A 3IHTA 1XISA 3G89A 1JSZA 4Q7IA 3FUUA 4DMGA 3ER9A 4HGXA 1G6Q1 2A14A 4RWZA 5DM2A 2HWKA 3CBGA 1VPTA 5GP1A 2PXAA 2ZWAA 2I56A 3U3HA 4RTNA 2PBFA 5T67A 3M0MA 4LWOA 4E70A 2FHPA 2PT9A 1EIZA 3A4TA 3P97A 1DL5A 1A0CA 3C3PA 2K4MA 2PX4A 3OZTA 4PYJA 3B3GA 4WXHA 1N7IA 3G2PA 3EVGA 3TLJA 1NV9A 3DLIA 5CVEA 3AXSA 3OPNA 1JR4A 4P7FA 4OVXA 2UYQA 3EPPA 4HH4A 4CTJA 7MHTA 1JQEA 4WVLA 3FPGA 4QVKA 3NVMB 2QUNA 4HNOA 5M5BA 1XIFA 3KBSA 1PRYA 2CMGA 5XIMA 2VZ9A 3KBMA 4GC9A 5GWXA 1NBIA 4E2WA 5CD1A 1XDZA 5F2OA 3DX5A 3FPEA 4ATNA 3EVFA 3LHDA 5E1OA 2QM3A 4P7KA 3HCFA 1JG3A 2AOUA 5EC8A 1BHJA 5DSTA 3M70A 3R3HA 1RJDA 3BZBA 3P6LA 1S5MA 1NW5A 1UWVA 3LGAA 5K8VA 4P58A 5E2AA 3LL7A 10MHA 3A27A 1QYRA 2I9KA 5FWAA 4EAYA 1DIDA 1DUSA 3FRIA 4YUYA 3SSNA 2NP7A 3UJBA 3KR0A 3NMUF 3U0HA 1L3BA 3M0LA 1KYWA 4R6WA 3HTXA 3CWHA 3FYCA 1ZGAA 5BW5A 3C6KA 5HILA 5U4XA 4IWNA 4HTFA 3KBVA 1XVAA 3L23A 1F38A 3GGDA 3IV6A 1PJZA 3KBJA 1I1NA 3JWIA 3IUIA 2AR0A 3NTVA 3BZGA 4KWCA 4LG1A 4PYOA 4XIAA 2OPBA 3EMBA 2XYRA 3TM5A 3UZUA 5CCBA 3MHTA 1L3IA 1EJ6A 4PCLA 2IDKA 3KQPA 4M36A 1I4WA 4B17A 2OYRA 1XIDA 3EGVA 2UYOA 2AOTB 4EKIA 4QDWA 3LPMA 5CVUA 1XDSA 3KTCA 5GIOE 4HC4A 4YTUA 2NXJA 3G8BA 1EG2A 3VNLA 3KPVA 2P7HA 3KCJA 4FT4A 5FCDA 2PGXA 3TRKA 2VDUE 3I64A 5K03A 2ZZNA 5DTMA 2GS9A 3K0BA 3NW9A 1KHHA 1MJFA 4E2YA 5BP7A 2H11A 3D2LA 2QRVA 1UFKA 5HFJA 4KIGA 5GINE 3KWSA 4QDPA 2EFJA 1TZ9A 4PNEA 1R8YA 1SUSA 3NDJA 3FUXA 1YB2A 1WXXA 1KPHA 1SG9A 3G5LA 3PB3A 3ITYA 3PS9A 2IDJA 5ICFA 4A6EA 4RTOA 3KBNA 1X1AA 2AOUB 2VDVE 3M0YA 1RI5A 3FRHA 3UXIA 1TW2A 3Q87B 5E9WA 4GJIA 1R00A 3DOUA 1D2CA 3KQYA 2OXTA 3T7RA 3CJTA 4CTKA 4RTPA 1SKMA 3ELWA 3NDIA 4ISCA 1R6AA 5CCXA 3BKWA 1L1EA 3G88A 1SVUA 3HEMA 1D2GA 2XIMA 3AALA 2B25A 4G56A 1VLMA 2XYQA 3A7EA 4YUXA 5DWQA 5FHRA 3KCLA 2AOVA 4FSXA 3V8VA 4E2ZA 3ER8A 4MTLA 1XLFA 4FSDA 4XCXA 5DX0A 3HNRA 2ZZKA 1RI4A 1TPYA 5EIWA 3SVZA 3GNLA 4ZBCA 5TNVA 1L9KA 5DT2A 6XIAA 3JU2A 3SR4A 4AZTA 4AX8A 1IY9A 4DF3A 2P40A 5IH3A 3IYLW 4ER0A 4YMHA 2HNKA 2ONYA 3IUHA 2KW5A 3P9NA 5GIPE 1G60A 1BC5A 2B9EA 2CMHA 2YQZA 3PX2A 3N4AA 3GO4A 3MTEA 3BZJA 3PVCA 4EACA 2QUMA 5FA5A 2GYIA 3IUDA 1M6YA 3KPJA 3EVDA 5GOZA 5K0GA 1NKVA 2PJDA 1VE3A 5EPEA 5FUBA 3KPYA 4QE4A 2QYOA 3BWCA 2Y1WA 1U2ZA 5DLYA 3M0XA 3FPFA 3PFGA 2XINA 4PIMA 2AOTA 3QV2A 2VS1A 5EOVA 5GM2A 2ZZMA 3JWGA 2BH2A 1RI2A 5DSXA 4IV8A 3UJ6A 3QOXA 2E5WA 3R0QA 4X63A 2YXLA 1FBNA 3E23A 3UA3A 3E05A 3DMHA 3PX3A 3SMQA 5K0FA 3R24A 5KS2A 2PWPA 3UJCA 5EMLA 2HR1A 1XYBA 3C0LA 3ITOA 3BUSA 3MTIA 4QVGA 5ICEA 3CNYA 3H2BA 3DXZA 5B80A 1INLA 5FTWA 3VNIA 3UJDA 5BXYA 3B3JA 3O31A 2GA9A 5LSAA 4MIKA 4FGZA 3CQHA 2BR3A 5E1MA 5E2BA 3GRZA 5LQAA 2YTZA 1XXLA 2C7RA 5EEHA 2AN5A 3CCFA 4Z2YA 4C05A 3JWJA 4C03A 5EVJA 3M0HA 3GRVA 3L8DA 4L7VA 4YUZA 2IH2A 1P39A 2G72A 1NW6A 5P8WA 3GWZA 4E30A 2G71A 2JH8A 1QAOA 4GUAA 5K0CA 4GOLD 4OX9Y 2G8NA 2ZLBA 3TC3A 3GXOA 1G38A 3BANA 9MHTA 3KU1A 5K05A 2F8LA 5DRYA 4OA5A 3TPZA 4YMGA 1YF3A 1XLBA 1YX1A 4X41A 1R18A 1P91A 2ZTHA 3DXXA 2G4JA 2P7IA 4PWYA 2GVEA 1DIEA 3ITTA 4J4KA 2EX4A 3KQSA 4E2XA 1JSXA 2IH4A 4PGHA 3HCBA 4BLWA 5EHIA 1S5NA 4C4AA 2ZIGA 3G8AA 1R8XA 3OFJA 1D8WA 4R8RA 5E1DA 1JQDA 4YV2A 1XIEA 3DMFA 5H02A 4HHLA 3EVBA 3LDUA 4QDKA 5HOQA 4Y30A 1XP3A 3CQIA 1MHTA 1XIBA 4GJJA 4GOMD 1G55A 4PCAA 3SGLA 4C07A 2OY0A 3BGDA 5E8JA 2C7OA 1BXBA 3P14A 3FUVA 1JTEA 3VSEA 5T64A 2AVDA 2B78A 3I53A 3OFKA 5DM0A 3DUWA 4DZRA 2ZDSA 2Y1XA 5KQSA 3PTAA 3HA3A 3HA5A 3UWPA 1F3LA 3OZRA 5B7YA 1XLHA 5FQNA 1NW7A 3HVHA 3KKZA 3ELUA 3M6XA 5LR6A 3P2EA 1SQGA 2JHCA 3EVZA 3DMGA 5LQRA 2NP6A 5EZQA 2CKDA 3QC0A 2AN4A 1XLAA 3T7TA 2GB4A 4R8SA 2P41A 3KPUA 1N2XA 4K3ZA 2IFTA 3MERA 3QZAA 5IKMA 5CVJA 3SM3A 1RJEA 1XLEA 1WY7A 5D1NA 3P2IA 2GH1A 5DM1A 5EKUA 1NBHA 1VBFA 3UJ9A 4BP3A 3FPHA 4QEHA 5EGSA 5KYGA 4PIPA 4RTSA 1K77A 1EAMA 1KIAA 2Q02A 2ERCA 2NXNA 1DE5A 2O0LA 3HM2A 3BKXA 3K6RA 3LBYA 4AUKA 4CWAA 1YFJA 2XISA 2OZVA 3CQJA 3QYSA 2P3QA 2OU4A 1KYZA 4HRAA 4E3VA 3V97A 3P9KA 4BP1A 5J8LA 3ID6C 4E31A 4F85A 3FVMA 3WSTA 3E8SA 1V39A 3GDHA 2UYHA 4GOOD 1NV8A 2IBTA 3KR9A 5HIKA 3UBTA 4GF5A 4GQBA 3FTDA 1RJGA 3UJ7A 5FA8A 2PX5A 3LDFA 5FHQA 3ITXA 4YUVA 3ELDA 4RTMA 4Y2HA 1KP9A 1QT1A 2PX2A 4X60A 3ITVA 4C06A 4XSLA 1WG8A 4PONA 4E32A 8MHTA 1XIIA 1RJFA 5CVDA 2BM8A 2PSSA 3GU3A 2XVMA 2HK0A 4FZVA 3OZSA 1B42A 5K0NA 3MAGA 4QTUB 1L3CA 2OB2A 1JTFA 1M0EA 4PINA 3NWEA 1AQIA 3TQSA 3KQTA 3REOA 4W4QA 1WXWA 2PKWA 3UA4A 3M4XA 5EEGA 1JQ3A 3G2OA 4E33A 3ORHA 4KRGA 4EKGA 1XLMA 3THSA 1X1CA 2JJQA 2P3LA 3CKKA 3AWIA 3QOWA 2G1PA 2G0WA 3BXOA 5LQUA 3O7WA 1XINA 4UOEA 2NYUA 1KPIA 1O1HA 2UZ4A 1QUMA 3IEIA 4DQ0A 3OCJA 1XICA 3EVEA 3GNXA 3TR6A 1Z3CA 2PLWA 1XLJA 4ER6A 4EVIA 1AQJA 1Q0TA 1DE6A 3DBNA 1KPGA 2YXDA 3GRYA 4YTTA 1P1BA 3WQOA 1XJ5A 4RVGA 3Q7EA 3C0SA 1H1DA 3KQWA 4PYNA 3UJ8A 3EGIA 2G70A 3EGEA 3RW9A 5HIMA 5LQNA 5AVHA 4P7JA 2IPXA 3PT9A 4RTKA 5DPMA 5HZMA 2NQJA 2QRVB 4GEKA 1XYMA 5XINA 3BWBA 1O9HA 2PWYA 3G2QA 3JWHA 3B5IA 3KQQA 3ME5A 2PY6A 4AZVA 4EK9A 5E8RA 4XSMA 3HCCA 4MQ4A 5E9QA 5K09A 4KDCA 4QQKA 1ORIA 3LX6A 4RVFA 4C08A 4PFHA 4OA8A 3OBEA 4R6XA 1DXIA 5C0OE 1UIRA 1XYCA 1KXZA 1XCLA 2H1RA 3DR5A 2V74B 3U81A 4AZWA 2ESRA 1X19A 1Y8CA 4ZB2A 5CVVA 5CIYA 4DA4A 3P71T 3B7PA 3AXTA 3BWYA 1OR8A 3RODA 1X1BA 4QE5A 3NWBA 5KQRA 2O05A 3CC8A 1JG1A 2HTEA 4EMSA 1MUWA 4LWPA 2ZBPA 3QXBA 2XVAA 4HGYA 3PFHA 2AS0A 2Z6QA 1ZG3A 2C7QA 3CQKA 3UVAA 3FYDA 3TVAA 5EMJA 9XIMA 3AY0A 3MCZA 3RIEA 3TKYA 3DH0A 1NW3A 3M0VA 3BGVA 9XIAA 3A26A 2PXCA 4QEEA 4FP9A 1XLDA 5DM4A 1BXCA 1X1DA 5G02A 1XCJA 1XLGA 3VC1A 4MHTA 3VNKA 4ER5A 1XTPA 3HVJA 3SX0A 3HCAA 3LSTA 5ICGA 2ZVRA 3C6MA 3DTNA 2EG5A 2ZBRA 1I9GA 4A8RA 2BR5A 2GLUA 2N47A 2OBFA 4RTRA 4XIMA 1XLIA 2NQHA 2Q41A 1R74A 3M6VA 4RYLA 5B7ZA 2AOXA 4YUWA 3I5UA 2ZIFA 4K6MA 4X1OA 3TMAA 3XIMA 2YUIA 3CVOA 5EQJB 1YFLA 3VNMA 5FQOA 8XIAA 4YTQA 2QW5A 3BWMA 5ERGB 4QQNA 2FCAA 5DXAA 2B2CA 1O54A 3P9CA 3T0IA 4YV1A 3ELYA 2ZVJA 3KPWA 2GLKA 2QULA 4K1GA 2ZSUA 3G2MA 3OU6A 3EEOA 3FTEA 3XISA 5EG5A 4OQDA 2I7CA 4FR0A 4US6A 4KVZA 3T7SA 1XLKA 2BM9A 2VDWA 3C0QA 2YVLA 5K0LA 1G8AA 5DXJA 4PYQA 2IBSA 1VL5A 2HK1A 2GAFA 2UYCA 2XBMA 1JG2A 1XIHA 3CJQA 1M6EX 1AV6A 3XINA 2DULA 4QPNA 4F86A 3CGGA 1FJXA 3LDGA 2GUBA 3CJRA 2AOWA 3M33A 3OU2A 1DCTA 3FTFA 2X7WA 2QE6A 2O06A 3AYVA 5EMKA 2CL5A 2ZWVA 3B89A 5MHTA 3LKZA 5DX1A 1QTWA 5I7GA 2J6VA 2WA1A 7XIMA 2XYVA 3EEYA 3G7UA 3G5TA 3AJDA 1NE2A 4EQZA 2JH9A 3FTCA 8XIMA 5KVAA 5FULA 4KW2A 3VYLA 4A8IA 3GRUA 4MWZA 2H00A 4QTTB 3MQ2A 3A7DA 1YUBA 4XKMA 3C3YA 1RI1A 5F2KA 5H1WA 5HIJA 2P3OA 2YX1A 2DPMA 4XUEA 2NXEA 5FWDA 1VQ1A 3DLCA 5D1HA 5LQKA 4IKPA 2VP3A 1BKYA 2ZULA 4ZB5A 3GCZA 2PX8A 3TFWA 4BLUA 3VYWA 1MNZA 3C0KA 3UFBA 5CUQA 2FK8A 4XISA 5XIAA 1Q0SA 1VP9A 2EJUA 2NNWB 3A25A 3KR2A 3P8ZA 2BR4A 3ITLA 5EZSA 2IH5A 1XDUA 2Z6UA 3PLAE 2NQ9A 1VP3A 2ZW9A 3VC2A 3GJYA 3AYTA 5JUWA 1WS6A 2NXCA 2PT6A 3ANXA 3E7PA 2HCVA 4LNCA 4HHMA 1RI3A 1YZHA 3LBFA 3MB5A 4V0QA 4LECA 5DX8A 5FADA 5EMMA 5AVNA 2O07A 2FYTA 1XYAA 3I58A 3P9IA 5BW4A 4YTRA 2JG3A 3FUTA 2ZBQA 1ZHFA 2OKCA 3EVCA 2X7VA 4FS8A 5C9ZA 4IV0A 5DTRA 4CKCA 4DUOA 2CWWA 2C7PA 2ZCJA 1QANA 4RX1A 2Z6AA 5CM2Z 3KHKA 4QE1A 3I9FA 3B3FA 2FK7A 3BDKA 4RVDA 3KCOA 3THRA 4GBED 5K01A 4A8LA 4GC5A 5EKXA 1OADA 1EJ0A 4AZSA 4NECA 2ONZA 4R05A 4PGGA 3X0DA 1G8SA 1VIDA 5JR3A 4PYIA 3ERCA 3DXYA 5F2NA 3KQVA 4M37A 4O29A 4FT2A 4QDJA 3S68A 3OU7A 3OE5A 1XLCA 6XIMA 4XUDA 4HTFB 4X61A 2OB1A 3F4KA 4RTQA 4DKJA 5HIIA 1NW8A 3NGFA 1CLKA 2JHAA 4BY9E 3SSMA 4GLEA 1P1CA 3HP7A 4QPPA 1FPQA 5HEKA 4HG2A 1TW3A 2O57A 5EIFA 4OBXA 1N7JA 3FZGA 5DRTA 3LCCA 4HSGA 1ZQ9A 1FP2A 3UU0A 3DP7A 1SQFA 3DULA 3P2KA 4JXJA 4KDRA 5K0JA 1I6NA 3MCTA 2V7EA 2OO3A 2ORED 2YXEA 1HNNA 3FUWA 3GRRA 3MGGA 4GOND 4M7RA 1IXKA 4YTSA 4PYLA 4U7TB 4M38A 2WK1A 4ZTBA 3KQOA 3FPJA 4A6DA 2BZGA 1D2HA 1QZZA 2JHPA 3R6TA 1FP1D 3HA7A 1ZGJA 1XIJA 2AN3A 3BGIA 3HVKA 4V0RA 3AAMA 1WZNA 1IM8A 2AVNA 3M6UA 3O4FA 4DCGA 4OBWA 3EVAA 2AZTA 4DVOA 1T43A
chains in the Genus database with same CATH superfamily
3SYMA 3PNYA 4CVUA 2R8ZA 3FXYA 1IU9A 1LQ0A 3L4XA 1FWRA 6REQB 1MO5A 2HQRA 3X2SA 4I14A 4LUYA 3WK0A 3ZCUA 5BSRA 1GQOA 3D7SA 5DP2A 1KRCC 3OBIA 4X6YA 1W1VA 3SCZA 3PPIA 5DW0A 2QLFA 4WUTA 3UXKA 4FJ2A 1Z16A 3T5MA 3DEQA 2PVSA 4PHCA 1HYQA 4GUFA 3I9V6 5I4IA 1EE9A 1D6NA 3AU8A 1I0LA 5JMTA 3QPDA 2V8ZA 4YLYA 2E9LA 1RA0A 1LL7A 4DMKA 2AQKA 1DZ3A 4PCPA 5CB6A 4UAUA 5T4BA 1EJ7L 3CW9A 1Z4NA 4ZI7A 2H1OA 1L1FA 3LVBA 4JZYA 3SKXA 3HURA 4KJZA 2Y5SA 2CVZA 3VPSA 3OKCA 4DM4A 2H1SA 3K9BA 3MUY1 3I5MA 3T9DA 3TM5A 2YY5A 2PDUA 1SURA 2WVGA 2VSQA 2VNSA 1WW3A 3PT5A 5HUOA 3M6MD 2EFJA 5TARA 2BOEX 1LL4A 1V2HE 1OZMA 4ZI3A 1TW2A 5ALGA 2BHLA 3DD5A 1KBZA 2XIMA 5EU9A 2VDJA 2Y4SA 2I22A 1V3IA 5IH3A 1XHGA 2ISWA 1KOFA 2VR5A 5LB4A 1UXKA 4HMEA 5AIAA 5K0GA 4AS2A 3E1SA 1ISSA 5IBRA 1XBZA 1VI2A 4N6GA 1R6TA 3KUMA 3EGOA 4HFMA 3K4PA 3AVPA 2JZOA 3UJ6A 2X6TA 3GW3A 3N5KA 3VU2A 3ORWA 4Z9FA 4U0JA 4RV3A 3IJEB 1VM6A 4NEGA 4P8RA 5C5CA 2R5WA 2EF9A 2QDXA 4FCWA 4LVOA 1YZYA 3G6WA 4DNPA 8ADHA 5GNYA 3V4FA 2HRBA 1B4KA 1B8OA 4TT3A 4RHUA 3GDKA 1ZUWA 3T9PA 1S8AA 1F6BA 4YJGA 4M7PA 3DG7A 1II9A 1JHPA 1JPJA 4CUKA 1EB9A 3IQXA 4UFMA 2JLRA 4AO7A 5GVJA 1Y1SA 4YHBA 3BBLA 1EZ1A 3W2KA 3GT0A 2PDAA 3HJNA 1XU4A 2GA8A 4CM7A 4DUVA 2WWDA 2CKDA 4RABA 4DR6B 4O08A 3BHNA 3N8IA 3LW7A 4IM7A 3OVPA 1C7SA 4F85A 4HMNA 1ONSA 1V39A 2XUDA 3PHLA 4KMRA 4REMA 1V03A 4I9UA 5HINA 3AOGA 1K88A 8MHTA 1HJXA 1WMAA 1GUVA 1HF3A 3COYA 1SK9A 1Y8RB 4N18A 3PULA 3F67A 4BWLA 3ZT7A 1TIWA 2ZUCA 5DCUA 4IH1A 4MKZA 5HANA 3I9NA 1KZ1A 3EAQA 4AEEA 4OHFA 5GZ6A 1KPIA 4DQVA 1KAEA 1R5BA 4Q8PA 3ZWWA 1PJCA 3TC6A 1GOOA 4RTKA 3TQCA 3DBHA 1MFVA 1V95A 5GJWC 4FFOA 2OO6A 5ILQA 4CEJB 1DC5A 4ZXOA 1X1BA 5ENZA 4WBSA 4LJYA 3QPYA 2ZBPA 1TECE 2ZYDA 2OXEA 2P2YA 1PUIA 4RF2A 9XIMA 1TUFA 3BAWA 3EEBA 3VR5H 3T3PB 3LLDA 3VVCA 5G0SA 1XRFA 3L5MA 4JFRA 4MHTA 4EMUA 3HRIA 4JC5A 1NVFA 3CV7A 4RDIA 1DKMA 5JY1A 1KXQA 2ZADA 3NWJA 2AOXA 3U4FA 3QUAA 3V33A 4PAQA 1NBEA 5GONF 2Q8QA 2HWUA 2OL4A 4Z0TA 3LUJA 1OC4A 3UPTA 2YHIA 3OT5A 4PYQA 3Q8WA 4XSVA 2HLDD 1XIHA 3O47A 3OCZA 4B5LA 1E0TA 5BWLA 3XINA 4FBGA 3G1WA 2BJWA 2X7XA 2GN6A 2EFEB 5FPHA 3EEYA 5DM70 3H26A 1X7ZA 4FFBA 3C7AA 1MAWA 1E4IA 2DW6A 3WGUA 1E0VA 5ALIA 5I4KA 1HT1E 3NH9A 5G1TA 2PEZA 4W7SA 3FSTA 1TA4A 3QE9Y 3A4VA 2I7VA 3LYHA 1EFTA 4LYEA 4F5YA 2PYIA 3VTFA 4B84A 1ENOA 3S1GA 2A2ZA 1A4RA 1TMQA 4KOAA 3FKSD 1OK4A 4GX8A 3B1FA 4DLNA 4ORIA 4AEFA 2C3OA 4BFSA 3AUXA 3GHYA 2J7HA 4N47A 4A91A 1R9GA 3UG5A 2LXNA 5CB8A 5CPOA 3M43A 3FVWA 5EQDA 2ALJA 3EVAA 4B76A 4XZBA 3AUSA 1UB3A 3HR7A 5EJ5A 4DYEA 4CNOA 1XMJA 2QRGA 2R8WA 2R8BA 1L4MA 2J74A 2J7PD 1LRQA 3MS2A 1QWSA 3SR7A 1VYVA 3N4EA 4DBUA 3PNKA 3RHTA 5G1OA 1NJ1A 1WY5A 2WU4A 1XRQA 4GY7A 2I4RA 4ZOLB 1XKTA 5IS2A 1PBNA 2WC7A 3WL8A 4POOA 5C2GA 1S8FA 1S01A 3L77A 3CYFA 4YRKA 2HEIA 3BJTA 1CCWA 3LFTA 2HWWA 2FJPA 2EBHX 2GEBA 1T6NA 1P2TA 3QX3A 2BEUB 2C4HA 1NRWA 3VDNB 1Z63A 3SMVA 3RS0A 4LDQA 4L9XA 4NYIQ 4DYJA 2W8BA 4KE7A 2W9MA 3L4JA 3W7JA 4OI4A 2Y1LA 1B54A 1DJNA 3LLXA 2I1LA 1XZKA 4GI5A 4MRNA 4KE6A 1M03A 5KU1A 3EAFA 3QXSA 3U80A 1I2AA 4B74A 3COWA 4TWJA 5IDZA 1PIWA 4DIEA 3TA9A 4QBTA 2PL3A 3K4AA 4CLEA 5FESA 3DF7A 4Z2JA 3ZDAA 4KIUA 2P7HA 4C3OB 4W63A 1FY2A 3NPUA 3TGWA 1S5PA 4KCUA 3CKYA 4AISA 1P43A 4UFJA 1E32A 1ZRSA 4HDMB 2ZVQX 2H8XA 3NTLA 3H17A 1UK9A 1OX6A 3FWKA 3B0XA 2P3ZA 2YN4A 3BF8A 1DTNA 2YJQA 2DORA 3UTCA 4L8WB 2R6FA 4YONB 2Q01A 3PVCA 3M6IA 2GYIA 4PBSA 1Q3NA 3IV9A 1SVMA 4A3RA 1E3MA 4B5WA 2WLSA 4X1KB 1XZBA 3NA8A 3IXQA 1FBNA 2D5CA 1DV1A 2YV5A 3TD2A 1KOGA 3DGFC 1XPRA 5AJWA 5JDCA 2D5LA 5EE9A 4M6UA 3GXMA 3R25A 5LQAA 4L28A 1GVHA 1UKZA 4C7MA 1ISXA 4I1SA 4GGMX 1OG0A 2NZLA 2Z4SA 3SC4A 3AXHA 1BQ3A 5DRYA 4YMZA 3O9MA 1WPRA 3W7CA 1UBMS 1ULTA 4JYPA 1J8MF 4JR1A 5FBVB 3RDPA 4JODA 2A67A 1FUYA 1QXLA 4Z9BA 4S1VA 4XGQA 2YKKA 1H2BA 1GTL1 5EJ9A 4LJLA 1X7IA 3NNNA 3WP1B 1NVEA 3HA5A 2GPSA 1P2VA 1M67A 3MOGA 3KKZA 3NPVA 2ZZ1A 2B5WA 4RK8A 4PC6A 4QT4A 2FR1A 1UKCA 3WXMA 4LJ4A 4RPPA 3FPHA 1P3Y1 2FG7C 1NI4B 4NBTA 2JQXA 1PL6A 2VTEA 4CWAA 2HV8A 3RASA 1JLSA 3C5WP 1VA5A 3QLUC 4CN1A 1KGXA 5K7JA 2VYQA 2X8RA 4D2JA 3OIXA 1IXRC 2F64A 3GHSA 2P5UA 2IIBA 3AG6A 1AQIA 3UG6A 1BVHA 3L4EA 1KA9F 3ARZA 3WBKA 4I3HA 4E6PA 5FACA 3L92A 4NZZA 2ZRAA 4GX1A 2H65A 4ZRNA 1A3HA 1G7VA 5JNRA 3NQAA 1VKRA 4DBSA 3QEMA 3ZK9A 3NDRA 3A3XA 1XRSA 4R6XA 2POZA 1Y8CA 4MB3A 3V7YA 1ULZA 1P0QA 1DIHA 2AEJA 1UQZA 1HM5A 2EJCA 1XLDA 3GT7A 5JRZA 4RIHA 4ALIA 2HLHA 2E40A 2HXGA 4MRSA 2DLNA 2EG5A 2W5UA 2OBFA 1FZTA 1T41A 2E85A 3KP0A 2CB0A 1L5YA 4NICA 4GWGA 4LRSB 2H2DA 2H5JA 3R2JA 4AJEA 3TZNA 2JJ2A 1EVKA 3AKDA 4NI8A 1GEHA 1FDSA 3HG4A 3DFSA 1KZ9A 1YPIA 3NM6B 3S2GA 1XLKA 1VL5A 4MA4A 3RUDA 3GLSA 1NE7A 2V82A 5M2QA 1XDGA 3QF0A 4O4WA 1AGPA 5FNVF 4BGUA 1G16A 4HAWA 3U2EA 2NZJA 1US0A 4HPGA 4RFSA 3SCQA 3C52A 3S9IA 3OLZA 3AHTA 5CLFA 1K98A 4JYFA 1KYXA 2C18A 2JGRA 1P1MA 3HB7A 4AIBA 5DH9A 5BNFA 4DLTA 1KNQA 4DJFA 3DSRA 4AWAA 4MS4A 5AJVB 1LA2A 1G0NA 5HNTA 5JDIC 5DTRA 2QWXA 3VXGA 1QANA 3RK8A 2E09A 3SHQA 3A32A 3UCCA 1QGDA 3Q88A 4EF6A 2QD2A 3TP4A 4QGGA 1CLXA 4GLEA 3H7UA 3WUBA 4KXQA 5HEKA 1UYQA 4EMTA 5DRTA 4BMDA 4PB3A 4EX7A 1LS1A 1OFUX 2VP2A 4HDNA 4AHQA 2AZTA 3Q7SA 2I9PA 4TRJA 3AEUA 1MUMA 7PTDA 1OI4A 2W6CX 5FJPA 1M1XB 1VP5A 1QCYA 2FUG6 3OJOA 5T6BA 2R1ZA 3D3KA 2QCEA 2TRSB 1J0IA 5JEDA 1NPYA 3NDZA 1X7XB 3WQ8A 1PYFA 3PWZA 4CKEA 1YULA 1EFHA 1KP3A 3WL7A 4Q4OA 4CF3A 5HA7A 3STTA 3RI3A 4F8JA 5G0WA 1W2HA 3FPLA 5KNCH 1Q13A 1EBFA 3INNA 1MX5A 1QG2A 3OZTA 4V1YA 1SFSA 1P0IA 1LPPA 3STUA 2O8EB 1BCRB 2YMPA 4HHHA 1D4AA 4HNOA 3VTZA 2HZ7A 3SX2A 2ZR7A 4PMZA 1FUEA 5CCEA 1N7GA 5DHTA 3B8DA 4PRZA 3CWHA 4D9JA 1GFZA 4JUAA 2QRLA 1TZ7A 1ZALA 4YVFA 3UZUA 1DKOA 2NNLD 3KTCA 2XB4A 3B97A 3IPXA 1I4NA 1S2AA 2Z4RA 2A7QA 2V5LA 3D7RA 1WXXA 1AHNA 1E9BA 2R68A 1VS1A 4Y7CA 4R9VA 2EBNA 4P38A 2QX9A 2G95A 5TC4A 1WKBA 4HDKA 4UB9A 5TPZA 4R5EA 2EDCA 5KHLB 5I7SA 2CYAA 2XNHA 3O6DA 4XPIB 5E3IA 3QQ1A 4ZMGA 821PA 3VM6A 3UA3A 3PX3A 4BKQA 3E9AA 3AESB 4F3NA 1RMYA 2G36A 3SBOA 2WSMA 5FKJA 4GM0A 2F6KA 5HKKA 3EIEA 1KK2A 3NONA 3VGGA 4ZDIA 2INEA 2P5YA 3NHFA 3R6GA 3TC3A 1W6TA 5L9AA 1P5FA 3ABZA 3L41A 4YCBA 4R1OA 3ICJA 1STOA 4PC7A 1JIJA 1WX0A 3L1UA 5JADA 1CBUA 1CXZA 5A6VA 1XIBA 3BJFA 4P3PA 1XRVA 2R2GA 3IIPA 5HF9A 4N9WA 2VF7A 5EZQA 4ZZ0A 3BXWA 5GY7A 1KQYA 1O95D 3C6CA 4HCJA 1RBYA 4WNAA 1YJQA 1QP0A 2NV2B 3UKDA 3VBCA 2QR5A 3T6CA 4M1RA 2EL9A 3FBWA 4MUBA 7ADHA 3O2SB 3AVUA 1FP8A 1G3MA 1RKUA 2JASA 1IHXA 1Z6AA 1A4UA 3GMIA 3HJUA 2SFPA 2QM7A 3BXXA 4YT2A 3W2FA 1VIAA 2ZRIA 2VP0A 1U11A 1W36D 4B3CA 3DDNA 1K7EA 1T13A 4WJKB 4IGIA 2DT2A 1OOEA 3SXUB 3GNXA 3NYWA 1Q0TA 5C32A 2DFNA 2BFEB 4FMDB 4ERXA 3S2MA 5AVVA 1ZPTA 4LYQA 1E2GA 1PFYA 3TFCA 3KB1A 4AZVA 1CUFA 1HSZA 3WG6A 2Z3VA 5C0OE 3N86A 4LZLA 2PU7A 2NSXA 1OCQA 3P71T 3B7PA 4LV6A 4RELA 1N3YA 4AFYA 1TD9A 2YVKA 5KMGA 2HHJA 3AY0A 1ZI8A 1ULBA 5J04A 3AHXA 1XCJA 2WVHA 1X80A 3INYA 1KM1A 4UFNA 1SUCA 4J94A 4OOUA 1VKJA 5E6RA 3LPGA 2JBAA 3NG1A 1GRVA 1Z32X 4ZFCA 3IC5A 1JFLA 4LHYA 1E3WA 3SYKA 4OTZA 3RCBA 1UZNA 3PDWA 2OORA 1DG1G 2HEGA 4CU8A 4UUAA 2N0SA 3I61A 1FRVA 3U5TA 3UH1A 1EQCA 4GWKA 2DPEA 1F06A 2VYFA 3TROA 2E5FA 1IQRA 1YHZA 3SD7A 2NX1A 2ZWVA 1X3SA 2XYVA 1FFXA 4RW3A 4YYCA 4G6CA 4D8AA 1MQ8B 2X9NA 3SZOA 2AL2A 2QLNA 4YY3B 3DI0A 1CDGA 3LBOA 5CH8A 2JFFA 5I6SA 3O6CA 2CHNA 4BBZA 1Q4WA 2BF7A 3NU1A 4X9SA 3ARVA 3DEIA 3S9YA 5KZDA 1K70A 3BSWA 3GHHA 3K8ZA 2E4YA 2FKNA 1BVYF 1Z25A 4AY2A 1XRNA 2X15A 4RY8A 1Z44A 2Y1EA 3NIDB 2CLLA 4G5QA 1D3AA 1WLYA 3UXMA 1AD2A 1PW5A 3INGA 4ML4A 5JBIA 3BLDA 4Z5XA 2Q4TA 3PUVA 3N07A 1TYGA 1CLKA 4D8XA 4GY1A 1EB3A 4AJNA 1HE1C 3ZHRA 5COAA 3JRXA 4ATLA 1WABA 3BW4A 2BOVA 4B3MB 2EP5A 1FFAA 4HPXA 3ESCA 3VOBA 3MJRA 4OH1A 5FNZA 2Z8YA 2ZWZA 5CFLA 1K75A 4A8HA 4A73A 3OOWA 3BLFA 4ZREA 2BVWA 4LCBA 1DXEA 1CNEA 1MXFA 2XW6A 2NN3C 1S1CA 3T7IA 2ZWYA 3HVRA 4HTBA 5CBBA 1PX0A 3KXKA 4ZMRA 1PHPA 1L5ZA 3Q8KA 2HA0A 3U0BA 2WFLA 1TEZA 1WUYA 3DFMA 3E9ZA 5E0KB 1NP7A 2R8RA 2H5IA 2GF0A 1XLTC 4KRYA 4KVAA 5K4GA 1RWNA 3T8YA 1COWA 4JTQA 2EU8A 1ONPA 1H0GA 1U3VA 4LQDA 4LY3A 3WKBA 4PY2A 4ATNA 4JQ3A 3GJ6A 4UCQA 4BO0A 4N82A 4RQAA 4B9EA 3FLBA 4PGMA 4XD7D 2F6XA 1P3JA 3ZWNA 1JCTA 3THXA 4X91A 4PRRA 3NHMA 3MMUA 1K8XB 2HBQA 4RSRA 3KAKA 3HR4A 4LG1A 4PYOA 2QX7A 5FIPA 2JRLA 2FRDA 4H7JA 5ALJA 3RANA 3QU2A 3I64A 5CIQA 3F7MA 3L9WA 4M9XA 3T08A 1PU2A 4GPZA 1R0LA 3S8EA 2OCYC 2OXCA 1Q45A 3GLHB 3ZM8A 1M0TA 4EEXA 4UMBA 1M0WA 1N34B 1CPUA 3AR6A 3NZEA 4UMFA 4LYHA 2Y0DA 2H54A 3IBSA 421PA 5FWYA 4UFPA 3A6DA 5EPEA 3SICE 2QYOA 2X22A 4I5EA 2AKAB 4PG6A 5G0UA 5HRCA 2ODOA 4O8RA 3AR2A 4M1WA 3UJRA 3QU7A 3H87A 5L4LA 3FAWA 4NIRA 4UTUA 4CKCB 4S35A 4R81A 5A5GA 3VD5A 1EEXB 4EHDA 1PJSA 1DKRA 3KDPA 1SGWA 3OKAA 4L7VA 1WW8A 2WW5A 4CD4A 3C97A 2IP4A 2J87A 4RUKA 2VT3A 4GOLD 2X1LA 3SB0A 2VNHA 3EXEB 3P93A 2NXHA 3MTBA 3WLNA 4LVNA 1BQ4A 2BB0A 2ERYA 4JIRA 1EE1A 1R2RA 3BICA 1T9AA 2AK3A 2BXVA 1CBGA 3DHNA 1T3GA 721PA 2X41A 1P1XA 4Y30A 3WQDA 5HMFA 2FQ1A 1QP8A 3FVVA 2XUCA 4RXTA 1AS3A 5JASA 4DUXA 1SQGA 2J7DA 4W5UA 2HU2A 1KO7A 5I6DA 3B8VA 4IIGA 2BY0A 2IFTA 1U80A 4R0MA 2WMIB 4ZYWA 4NMLA 1BX3A 3CLHA 5JRJA 2YRFA 3OEXA 3HLTA 5JYCA 4G23A 4IP4A 3W5UA 4Y2HA 4NV1A 1KKMA 2VJMA 4EKYA 4JYEA 4QTUB 4QLBA 3PFRA 3FFSA 2SECE 3UA4A 1GO2A 3ZU2A 1JQ3A 1QJWA 1XLMA 4EY4A 1VJCA 3W8FA 3L8GA 5CYFA 3PG8A 2PLWA 2AMFA 8AT1A 4IWYA 1Z13A 4KE8A 3N28A 4M8NE 4FALA 2YW9A 1XL9A 4MVJP 2YV2A 4KEVA 3G2QA 3K31A 4DLYA 4NC9A 1YQWA 5DNVA 1MIHA 3WWPA 3DFOA 2AZ4A 3MCOA 5L3SB 2EG7A 2IY8A 5BYAA 2I8AA 3S29A 1AKEA 2ECFA 2WJ6A 4K86A 1KBOA 1ZG3A 3VYTB 4K0RA 4FK9A 2CNKA 2DIKA 2BFDB 2WCSA 4W88A 1JKMA 1BGWA 3K8OE 1Z7AA 4K7JA 4EI2A 5LOVA 1RPKA 4LFCB 4WCVA 3LM8A 1QIJA 2PUCA 4JU9A 1W1TA 1LOQA 1FDJA 2MNRA 1QK4A 3W79A 3ON5A 2QVYX 1DQZA 3T0IA 4KGVA 4F5EA 3AEUB 2PDQA 4DNFA 4E46A 1K6IA 3CPRA 3ZWOA 2QXTA 1BLIA 3IA7A 2DUZA 3K9LA 2R8PA 5B3KA 3LXXA 2OGYA 1OCJA 4ODIA 3WK2A 1Q0PA 1DKPA 5HM8A 5F2KA 3WDMA 2XN0A 3CF4G 1CIJA 4TSRA 3L6UA 4K28A 3ZJ8A 3BXFA 3P8ZA 4WFJA 1QW9A 3KHTA 1W9VA 4F9JA 2O23A 4ORMA 1GTSA 2O8EA 1UDBA 5IZCA 1OHHA 3EX2A 5LMZA 4IXMA 2G50A 1SO8A 4W6QA 3ZHYA 3PYXA 3O9ZA 1MQAA 1X8LA 3U44A 4JT8A 2NVDA 3MJTA 3R7WB 3F6YA 3KQVA 2R6GA 3CUFA 4OGFA 1RZ3A 1ZP4A 1NWHA 3FK4A 1S1RA 2M6LA 3MCMA 4CTOA 1WV0A 4F21A 4GCXA 5CDFE 3ASZA 1SQFA 3Q3HA 2OO3A 3UTDA 1KXVA 3RIMA 1I51A 1FP1D 5IK2A 1TA3A 3D5TA 3AAMA 4MS1B 4OBWA 3A4TA 1ZD5A 1OBHA 4BQEA 2XB8A 5HTOA 2ZQYA 3RT1A 3TLKA 3KEGA 4P0QB 5G0TA 1R3VA 1TVKB 2FETA 4B7ZA 4JL6A 5FBRB 5EIHA 3SSOA 2J0EA 4Q18A 4W5WA 5F78A 4X20A 1QUFA 1MAUA 2NUPB 4A0FA 2GJNA 1Z8FA 1VYSX 3WD2A 3D9QX 3GGCA 3ST7A 4Z1CA 4QJIA 4A1FA 1RLJA 4GRDA 2WA2A 4GLLA 1PSWA 4H2HA 3GK0A 3VR4H 2JVJA 3OQIA 3LCGA 3LZ3A 2FHPA 4J16C 3DTTA 3KFLA 1X2BA 3KSAC 1GJRA 3AIBA 3HSSA 5BXSA 3MBIA 5DYNA 1CVLA 2QM3A 4EPRA 4Q6WA 5HK9A 2DOKA 3PEEA 2WZIA 3LKVA 3L4ZA 1JG7A 1E2MA 2OZLB 1RDFA 3N6VA 1KYWA 5KQGA 2ATIA 4DDMA 1RSZA 4HA1A 3C87A 1T6BY 3H04A 4IIBA 2H16A 2QUZA 5E6UB 3RMEA 1E6RA 1Q6LA 4Z0JA 2ZCUA 3S1UA 1WA5A 5H59A 2PA3A 1G69A 4PSRA 2Z43A 4P98A 1EM6A 3ZW7A 1HKHA 1OWLA 1VE9A 2DKNA 3RYCB 2PX0A 1IXPA 3CMFA 1HEUA 2YY6A 2NPFA 2NO5A 2VPTA 3HJAA 2XCIA 2J5XA 5DM0A 3KX2A 4N65A 3KT8A 4C0QC 2PUZA 3BREA 1QE5A 3JU2A 2BUCA 1EFPB 5BU6A 4DF0A 3PX2A 2V9CA 1FQOA 1ATIA 2EJVA 2Z1SA 4NDZA 5JNLA 4W4TA 3RRJA 3NCTA 4FKBA 5K2ZA 2J4DA 2OCLA 1RI2A 4G1MB 5AVKA 1RXCA 3TLGA 1K7EB 2IXBA 1H5NA 5CLQA 4P1ZA 3LAWA 3VR2D 4ZGWA 3TONA 4PNZA 5JPIA 4IJVA 1PKNA 5D6OA 4EYKA 4O2AB 1K8ZA 1A98A 3JZIA 1NUHA 1YUMA 5AYZA 2ECKA 3RADC 13PKA 1E1KA 1MW8X 4FXRA 1H51A 3CUIA 4BEJA 4O1EA 1W9PA 3KU1A 3WIVA 1CGTA 2GHTA 2AJBA 3OQOA 1ZM2A 4DJFD 2JLYA 1JG9A 2V1UA 3OLYA 3TEJA 2G5GX 4WCJA 3FAXA 1EFDN 3JQPA 2ZYSA 3LT0A 3RVSA 2X8WA 4FMPA 3P14A 4HQLA 4L75A 4JTUA 3R09A 3GVVA 4W8BA 3FOCA 4UPVA 1FFGA 2NSHA 2PWEA 4C3UA 3H2ZA 1LLCA 3TZEA 4QYIB 5D33A 5AZ1A 1R0BA 3UJEA 3X2EA 4DBLC 1T4CA 4S24A 3P26A 3WZ2A 4ARCA 3JUGA 1ZLXA 3Q6NA 3U6KA 2V8OA 4N3GA 4XSLA 5B6IA 5IANA 1A9YA 1MXGA 1UFOA 1SBNE 3MAGA 7ABPA 5K45A 2EQAA 1IVYA 3KQTA 4GPEA 1JJAA 2ZSEA 2ZA2A 1PTAA 1C7JA 2G0WA 3BXOA 4L78A 3II6X 2HISA 1LVUA 5LNVA 4HAYA 3DPUA 3WQOA 2JCVA 3EXAA 2G70A 1GOKA 5HIMA 4KWUA 1TTPA 2DAPA 4BRSA 3DWIA 3QPEA 2XI4A 3OCUA 3QVLA 4RYDA 3RO7A 4Q4JA 1RP9A 1JPMA 1CJCA 2JF0A 2MDTA 3JQ9C 2B4KA 3CC8A 1JG1A 1D9ZA 3BSHA 4UFIA 1RQXA 2A9QA 3ZV7A 1E2NA 2G4FA 5I5RA 5DMXA 3HB1A 3UMBA 1JQVA 1R3YA 3PD1A 3I3BA 3IACA 3RJZA 3NIFB 3NC4A 4ZWNA 1NJGA 3BURA 3TG2A 4MGHA 1DU4A 5CB4A 2NM0A 2R6JA 3LHUA 1ULSA 1XOIA 3UZWA 1KDRA 4PW0A 1KAMA 3NZGA 1M6EX 4NZ4A 2XR1A 1J6UA 4MV9A 3K2QA 3ROXA 1I1OA 2AYYA 1SZGA 3CF2A 3URBA 3MKKA 2QPLA 4IHAA 4Q3DA 5FULA 1X8XA 2INFA 2IUTA 4QTTB 4P53A 1GQYA 2JKAA 3RUFA 1KMHA 3LWDA 1SHKA 3G0UA 4CETA 1R88A 3BMQA 3IR6A 3KLBA 1EH9A 4KEUA 1A76A 3I65A 3BG9A 1WKYA 2BFBB 1J56A 3G0OA 2Q49A 4CIVA 1J96A 3LDAA 2FKAA 1JPHA 4HHMA 4TLEA 1W5SA 1S2WA 4GIAA 2JG3A 2Q3FA 3T4EA 2NYVA 1J2EA 1Z5GA 2P11A 4LNUA 4Y0AA 1RLTA 2ODTX 4HNLA 1LCIA 3F73A 4RL4A 3GJ7A 3G1YA 4I4TB 4P31A 2G1JA 3ASVA 3HO8A 4PVCA 1FCUA 4H4DA 3GDFA 1GVRA 1E2BA 1Z5UA 2QT1A 4DNOA 4D6EA 3SSMA 3UMGA 1L6IA 5F1VA 4F3TA 2PL1A 1OD8A 3U37A 1USKA 2OWEA 3BQ5A 3SJCA 1XP8A 1W9BM 1KOJA 1Y3DE 4UHEA 4D9IA 3K09C 4DCGA 4I9HA 4YVVA 1WHTA 4C04A 3GU9A 3VI3B 3K8MA 4I66A 3LCUA 1QHOA 4LWWA 1H63A 2XUOA 1RADA 3WRYA 3PP8A 5LC1A 4M7TA 5BT8A 3WELA 2QVGA 2IPNA 2V55B 2DZPA 3IP5A 4N9CA 4EKJA 2GKOA 4NCXA 3WEMA 2FQWA 1TIKA 4CQJA 3BTUA 2OTCA 4TN1A 4U10A 4ZYVA 1GOWA 3DMRA 2NQ8A 1MU0A 3QSTA 3KBMA 1RMTA 1EWTA 1MORA 3PYLA 2Q7XA 3QPBA 2GUYA 4OZOA 2WUWE 3EXFB 3O4JA 1ZMTA 3WMRA 4PSDA 1K3TA 4I5FA 1NBMD 5FNVA 3LY5A 1DBWA 4CNTA 4U1RA 4I3FA 1HH4A 4NJEA 4FLRA 4ZQBA 1T5SA 3WKCA 5MFPA 1W96A 4TWIA 1NQ6A 5EJGA 2L5HA 3TNOA 3F5QA 4B16A 1EJRC 3FRHA 4RA6B 4RO0A 5BN5B 4OREX 1QVWA 3T1VA 2WMIA 1SVUA 3EA0A 3AXKA 2FRDC 1AG9A 2E6FA 4R7WA 4NVTA 4AROA 3GAFA 2H4FA 4DM1A 1LBIA 1E4EA 3I5XA 5IDXA 4DXXA 4PPNA 5CSSA 4FGSA 4EPBC 4YWSA 5B7QA 2WHXA 1ICIA 4JQSA 5EB8A 4IV8A 4X63A 1TZKA 1H2EA 3K1DA 2FPPA 3ZXSA 3FLMA 4RK6A 3FNDA 3RU2A 2DV0A 3NZQA 3ZHCA 2Z58A 1ZB5A 3N2GB 1O5TA 1B73A 2RHDA 3MWJA 5A3VA 3OY7A 3DZ1A 1XD9A 2CJXA 2VQSA 4ZT6A 1SR0A 3R75A 3IEMA 2XEDA 4R5MA 1SZNA 2HCJB 1KXJA 3ZDZB 2ZSHA 2D1TA 4QHTA 4PN3A 4ZV4A 4NG3A 4AWEA 2C97A 3QVQA 1AW1A 3BRWD 1WCGA 3GC5A 5J8LA 4AU1A 3RU7A 1W5OA 3FR8A 2WHPA 3UC5A 3C8FA 1QH9A 2NUTB 2F8MA 2PSSA 3LIIA 1TUIA 4JLAA 5F2IA 3WNZA 3AETA 2WT9A 2BEJA 1QHZA 5AZ0A 3ELFA 1C4XA 2OGJA 3IRVA 1HKJA 4RNHA 2DQXA 1IGSA 3G17A 1G9XA 2HU5A 4E6MA 1FYEA 4PTDA 1POXA 4LS2A 4AKTA 3CZKA 2GM5A 4CDRA 4BF5A 1MDLA 3OYZA 4ECLA 1X74A 1P4CA 2DUUA 2AMGA 2OXRA 4U2CA 4PUEA 2QGZA 4COKA 1V6YA 3VVGA 1EI9A 5DBOA 3GMTA 1RM0A 3LXBA 3QEMB 3DUFB 3OIUA 2A3BA 3BRCA 2PXCA 3D43A 1KFBA 3VKDA 2X5XA 5E4FA 3FCOA 2WO5A 3Q67A 2Q4EA 3WLOA 3CR8A 4YTEA 1KDYA 2R7NA 3DTNA 3PC0A 4JBHA 2CXNA 3R3WA 4D82A 1G3IA 1H7RA 2BISA 1LV8A 2QMKA 1H4SA 5DXAA 2BE7A 1OA0A 3L7MA 3VU0A 4PSKA 4HNCA 1B26A 1C0LA 2Q5CA 4DR5B 4DR1B 3KVMA 4HNVA 2RGCA 4D5GA 1JRCA 1PWEA 2JB9A 2FSFA 4A36A 4AF0B 1M83A 1WR8A 2WWVD 1KZ6A 1BG4A 1H05A 4Q1DA 5JATA 1PVDA 1WP4A 3C85A 5AJZA 1BCSA 2GHRA 3VOAA 4AY3A 1RI3A 3PA8A 3PHAA 4H4EA 1DAIA 4HU0A 3H3XA 4J1NA 3H9EO 1PO9A 4I9JA 3H1TA 5FOVA 1AUQA 4RFSB 5FFFA 3ZXIA 3MUXA 5JCJA 1WMSA 3EVTA 3K2BA 5AVUA 4W1SA 4OJKA 1NVKA 1QS0A 1YI1A 4R0VA 3L93A 4R3UC 3VO0A 3FSGA 3SLRA 3TCXB 3UOGA 4NT0A 4AJJA 4OOFA 4CDMA 4KDRA 5D85A 2Q1XA 5CM8B 1A49A 1JCMP 4U7TB 3THYA 1ECLA 4GUDA 4FFWA 3LQLA 1V9SA 2PWVA 2AVNA 2I2CA 1OT3A 3DLAA 3TMLA 3NM5A 1NF8A 1RABA 5DMNA 1EFLA 4ETNA 1D2MA 2XWDA 3QUTA 1N5OX 3HN3A 5C8YF 5EFZA 4PS1A 2QCDA 2IBMA 5C35A 3HJBA 1KI6B 3ZLFA 3KOZA 4Y6GA 4BLPA 5B1SA 1UG6A 3A5VA 4ZAXA 2G08A 3MAAC 1R3SA 2GESA 3R7SA 2BNJA 2ZIEA 1JF5A 2BLEA 3RG8A 3CV1A 1TV3A 3RHZA 1XTUA 3R3JA 1BA2A 3JASB 5D3ZA 3CINA 3EVGA 1XCXA 3QUCA 1N78A 3PY2A 4C9BA 1YVPA 2CESA 1JPVA 4L8GA 3LI2A 2HHAA 2YWJA 4HB2A 4L9RA 3LZ5A 5CD9A 1FVFA 1YDVA 2D0OB 3GZNB 5E2AA 1RKXA 2VWTA 4YREA 2D7DA 3SUWA 4CCSA 3OJXA 5CC7A 5AUNB 3CZMA 1E7WA 3CNOA 4TYWA 4LF5B 5CCBA 1SCBA 3DFIA 4L4SA 3MMSA 2I33A 2EKGA 1V5EA 4OHPA 3EX4A 3AZOA 4V2XA 1TCUA 3CPHA 1GXSA 1EWRA 1WXGA 2C7VA 3ITYA 1PS8A 1X1AA 4WZBE 1U28C 2R4UA 3U2CA 4FSXA 3T4XA 2AF4C 2J8ZA 1WZKA 4FSAA 3NGXA 1MQQA 4IMJB 3FOFC 3EXTA 3TAKA 1FWCC 1YOVA 3AV0B 2W4XA 4EACA 3B1JA 1FPMA 3P7MA 3QLJA 3KCQA 3FLEA 1EP2B 4S1TA 1KFWA 4LDZA 5LNK6 3EDMA 4RH3A 2WIAA 5CA0A 2A4AA 1QIGA 1HE3A 2CN1A 4J3UA 3H23A 5H16A 4FONA 2IPWA 1F6KA 4OJYA 5HQJA 1OLXB 5PTDA 3ZIZA 3UJDA 1DYSA 4QGFA 2O2DA 4BZPA 1W4BA 3B3AA 4KZKA 4ZYUA 1G8KA 4MGEA 2W6JD 2YZMA 5HA5A 4M81A 1PZGA 2W2NA 4HDSB 3O05A 5JS7A 1Q1NA 3GVXA 2FV8A 1WPXA 1G38A 2BFGA 1XQYA 2IHUA 4OHVA 3CLSC 1YX1A 4HAUA 4A21A 5THQA 3WDIA 3NORA 2IITA 4TV8F 3F9CA 4NRSA 5AHOA 4L3OA 3CMJA 2PDHA 2YCKX 2AKZA 3LH5A 4TM8A 2BMFA 4TXLA 2YYYA 2XKBA 1XHEA 4LB4A 4DO6A 2WQZA 2WK2A 2AFHB 2ZYAA 3UJ9A 1GA1A 5EGSA 5A69A 5J4LA 2HT6A 4NLLA 2I3GA 4LXUA 4NZJA 2A0XA 4G37A 4BNKA 1ISFA 2W2LA 1E5LA 2HK0A 1KYYA 4US0R 4J7XA 1RQ7A 3BUVA 3DO5A 3L6BA 2Z0IA 1S8NA 5B2EA 3GJ4A 1Z22A 3WNKA 2QDKA 2H57A 2NZWA 4JPGA 1P0PA 3WYDA 5A6BA 4M21A 5FPYA 4REQA 3L12A 1Q12A 3BLIA 1XEWY 3FHAA 4D56A 1ZDMA 5BVGB 3D6NA 1KMCA 2V6AA 1G94A 4KDCA 3EIOA 3G5MA 5BUCA 3RHGA 4JSYA 4NILA 1RZRA 3OHSX 3RDKA 2VEKA 2V6BA 5FUWA 1SIOA 4OCZA 1YO6A 2IELA 3P5YA 3W3AA 1T9CA 2WU0A 1A5MC 4G3XA 4NSNA 1MSSA 1P6WA 4C2TA 4K88A 1ZL1A 4RGQA 3FLUA 4W8OA 4UVGA 3CX7A 1ZFNA 2DFTA 4YASA 2XUFA 1SAYA 1IRIA 3M3HA 3IUMA 3A1CA 2ZUNA 3FF4A 3CS3A 4BLOA 2ATCA 2AQWA 1U0RA 5CW1A 3BOXA 1NC3A 3T5AA 5DOVA 1HLPA 5AW6A 1B6GA 1JLMA 4KQ9A 4YV1A 2OC4A 4NHEA 4C6TA 1PFQA 2DSWA 2YC2C 1J8FA 3I45A 1HTWA 3A58B 1FWDC 4JR5A 3NATA 4Y8EA 2QJWA 2QV7A 1ADDA 4E07A 5KYXB 4GKAA 1Z0UA 3FXAA 4C0SA 1I5EA 2AFHE 4R1PA 3NEVA 5H8PA 1ISVA 1F8UA 5J9FA 3V7NA 1YMVA 2FOIA 3E22A 1BG9A 4AIOA 4RNCA 4C89A 2WYSA 2QMOA 2H90A 3LGXA 1D8TA 3K9QO 3L7CA 2JGIA 1KWGA 1R0RE 4C6JA 1YZGA 5ADHA 1E7QA 1PL9A 2VPIA 3HGOA 2F6UA 3ROZA 3U2QA 5JPCA 3TQPA 4W86A 4Z1MA 3CT7A 3C8HA 1S8OA 4RVDA 1V3UA 2NU8A 4H7CA 5EKXA 3NDPA 4EEZA 5JR3A 1OA1A 4RPIA 2RE8A 3U3OA 2DVTA 1CPYA 2DH3A 2FW0A 2QZZA 5AQ1A 4I6GA 1UUOA 3EFOA 4MW6A 3ENKA 4V1XA 4Z51A 5KZ6A 3AF1A 2OP1A 4OBEA 2UVQA 3N2TA 1TUXA 4H17A 4LHVA 1RWXA 1YS7A 3MZNA 3TK1A 4D0RA 1TMHA 1Z0ZA 3D8NA 3NZPA 4CXMA 3C70A 1YB7A 3QMMA 1B41A 1BOOA 3ZY6A 1RWWA 1AG1O 2YYZA 2CLIA 1W25A 3N0XA 1MV8A 4FIZA 3T52A 1ORHA 3R9XB 4HU4A 4AZIA 4I1YA 4PGLA 1U1GA 4IOTA 1PDVA 2PM8A 2CUNA 1JSZA 1YVEI 4RZIA 4RTNA 3WH5A 2G82A 3NP7A 2PD4A 3JAKB 3H0KA 1LUCA 2MWMA 1C9DB 4NF2A 1T9DA 4D74A 1X1ZA 4LH8A 4CM6A 3KVOA 4DA6A 1O0BA 1SBTA 2V3GA 4ZZ1A 4J0GA 3QVXA 1JDCA 3SN6A 3THAA 1NF0A 5KYWB 5JIWA 1EFZA 2BTQA 5JC1A 2JLZA 1CUYA 3FB4A 1N33B 1J09A 1L7PA 3M9YA 3TIXB 4PB4A 3V1MA 4CG2A 4PB5A 5CJNA 3NQ8A 2FDSA 1MQ9A 1XZAA 3DBVO 4F56A 2OOGA 4RZHA 3HPAA 4D6PA 2ZBUA 5C53B 3KWSA 4PTNA 3VAYA 3NDJA 1T0BA 4KIWA 4GECA 4MP3A 1NHWA 2ZX8A 1CZLA 3EA2A 1UFQA 2WJWA 1G01A 5CCXA 1ZA1A 2CXXA 2C1XA 3G0BA 1QQ7A 2WFMA 4MTLA 4J49A 2XWQA 1DTEA 1H7OA 1RI4A 4YRTA 4NQRA 4YP1A 5HGJA 2DUMA 1SXJB 4BY3A 1U7OA 2FMIA 4QL3A 3VNYA 1OAKA 1VPLA 4DBEA 4ND8B 2Z1VA 3F7TA 2GVZC 3AO0B 5CBPA 3FNEA 3MCAA 1T3HA 4URZR 1LU9A 3CNBA 4LOLA 3MTIA 1HXHA 1QR2A 2A1TS 4X0VA 1CIVA 1WTCA 2EPHA 5FBHA 4ZPXA 3CCFA 2OAP1 4DSAA 3G2IA 5ALYA 1QKKA 3RSOA 1Y8AA 2NT3A 3BTOA 4RF3A 4J3NA 2VHLA 4I7EA 3TPZA 2LDXA 5EMNA 4KLRA 5DT9A 2E4AA 5NLLA 4PFSA 2JFQA 3U5YA 4Q82A 1XQ1A 2DCMA 4CGTA 5JSZB 3PQDA 3U3ZA 3ROMA 4ASUA 3CQIA 1NUAA 1V3QE 2CCJA 3G7SA 3EF1A 1FNNA 2W6IA 1NW7A 2EPMX 5I7EA 3K96A 4JR2A 2GD0A 3G9XA 2XNCA 4ZIRB 1I3NA 2MSKA 4ARZA 4OPMA 1HL3A 4RE4A 3KVJA 2H1FA 3WLFA 3UGTA 4BKNA 4I55A 1Y3HA 1EOKA 1S3HA 1ZD3A 5D32A 2HTFA 1WQ4A 4LJSA 1H4TA 2BHSA 2YJZA 4D98A 1XVLA 5EPUA 4ZCPA 4PO1A 1E92A 2VDOB 3HNPA 1Z0DA 1WMDA 1GFSA 2HE8A 3W9YA 2C1IA 1WCIA 1JI2A 1Z3CA 4LC1A 3MINA 5FUXA 3RYIA 5IAJA 1ADGA 1FCVA 1M34B 2IPXA 4A2WA 4D97A 1YRLA 1RT9A 3HUDA 1PR2A 4L4ZA 3HCCA 5IKXA 3ONWA 1KDTA 4PFHA 1TTIA 5AYXA 4LNYA 1Q6YA 3GAKA 5I9TA 1RJWA 1OI3A 5AHRA 2W2QA 5AC8A 2B2NA 1GPWA 3M16A 4QBXA 1I6MA 1GTG1 1IBKB 4EZIA 2NT0A 1L7AA 3W3ZB 2C03A 1IAVA 2C9OA 4CR7A 4EGFA 2CBVA 1KK3A 2B4AA 4P92A 4AIUA 1T2DA 1CRLA 4HN9A 1L5NA 2HVOA 2COEA 2GLKA 2X0DA 1EZ2A 3G5EA 1NXPA 1JU4A 5TV2A 4UEWA 3G2NA 5F77A 3H18A 2WE8A 2R7AA 2FGLA 2D2JA 4IMGA 3MGBA 1LB1B 3DG3A 3I7QA 1H0RA 1R6DA 3KP1A 1E89A 5M17A 5IYZB 1G7TA 5CJJA 4PXYA 5EWJB 5EWLB 2D24A 1TX2A 3DYBA 1ZJYA 2O7NA 2DPXA 3N15A 1N2HA 1ZN2A 2QMZA 1FB5A 4Z1DA 5CPMA 2V6FA 5BMVB 3W81A 4QROA 5DX8A 4N40A 2TMKA 3RAJA 5J2TA 4RPCA 2H48A 3MT0A 2C9MA 3OESA 2FWMX 5GPRA 3ORSA 5F2NA 3PZRA 4L7QA 1QH8B 2ZDRA 2B92A 3UXLA 3QTPA 4ALNA 1QZ3A 5FO0A 1H23A 3UEQA 1V96A 1Y9EA 1LDNA 3R2GA 3DO8A 1IJFA 4TUFA 2PQ2A 3U5ZB 4A6DA 2O7RA 3OZWA 1JNYA 2JCGA 3WDHA 4JBNA 4D8UA 5G4KA 1UC4B 4ZQRA 2FR8C 1BHO1 1PZ2A 3VOFA 2PZAA 4B83A 4LFYA 3HJEA 4ZT7A 3BCDA 5HQ3A 4N5NA 3IJ7A 5C55A 1KSHA 4C6LA 2P4HX 4QOHA 2LD4A 2VPPA 3UJSA 1SU4A 2Q4BA 3I68A 5JCOA 3VE7A 3ISVA 4TMXA 1XEAA 1I9CA 4BLSA 3D8TA 4Y2TA 4F06A 2QG4A 5M3BA 1HI9A 1P1KA 1QK0A 3B9QA 3FH0A 3TJRA 3H2NA 4CNUA 4XGRA 4EX6A 4FI3F 4C76A 3T1TA 1ZEJA 1AN0A 2QTHA 3QI7A 4AG5A 4L15A 2QIPA 1WDSA 4DBVO 4P7KA 1POKA 2FHBA 4FNGA 1Z0JA 1NW5A 2GN1A 1HZYA 10MHA 2I4OA 3X1KA 2I4IA 1NJJA 1WU8A 4DLVA 1DQXA 1XH0A 4D4IA 3DQZA 1EM8B 4G0UA 3PNZA 1C9NA 3G8CA 2R6CA 5IDWA 1KQPA 5C37A 3AZSA 2XXJA 1SZRA 4RJIA 2BFCA 3TOZA 4E12A 5B58T 3DM9B 1QRUA 1TO2E 1CHDA 1C7QA 2O0KA 4MA5A 2Q2NA 4RS3A 4OU1A 1NFQA 1UFKA 1DWJM 3A13A 1XGDA 1W4CA 2NTEA 3IWPA 2YXPX 3WKDA 5TMBA 4ZVPA 3AF6A 1EGVA 3G88A 2V1XA 4QHYA 5MN5A 2ZRCA 5LA6B 3LNCA 5DX0A 4EW6A 4AKGA 3QTBA 4Y9PA 4WDQA 3CZAA 3T2QA 2BBOA 4MVJM 2H2FA 3HN7A 1J5TA 5ANRB 1ACJA 3QBJA 4IX2A 1K4HA 2F55A 3L8MA 3F3MA 4AKSA 1AKYA 4C87A 4JJ6A 1ZNXA 3BTNA 4G8DA 2WVJA 3QFRA 5CNJA 3ICVA 1B1CA 1JSRA 2J6CA 3MJEA 3B6IA 1JDAA 2CMDA 4XEHA 2H9YA 3GBDA 3P61A 3JD2A 3MRVA 2ZT5A 5A7HA 1ZOLA 3SOZA 2J31A 2ZYUX 2I2FA 2YKGA 2C13A 4QIUA 2PGLA 4JS3A 1L5LA 5AOBA 3N6QA 4BO7A 3FCYA 5F4ZA 4HWOA 4RPJA 4J29A 2WJZA 3CZEA 1GTVA 4JLBA 3VZSA 2V63A 2WKLA 1PJAA 3OFKA 3VD3A 3ARRA 2WV8A 2XNSA 1XCGB 4ZVKA 1MW1A 5LR6A 4AUMA 1XTRA 2PT7A 1TMKA 5BROA 4JVMA 1KYVA 2C4UA 4KV9A 2GH1A 5G1YA 1RBMA 3LVFO 4QFDA 4TVBA 4DLMA 1F2TA 5H0IA 3TDNA 4YRNA 3KLKA 5CG7A 2IZ1A 4ISBA 5IBXA 3C86A 2YNMC 2EJ1A 3SQXA 2DPGA 2P6NA 4TTGA 5FL0A 1X7ZB 1ZZGA 4KPLA 1PWMA 5I07A 1EE2A 4I9GA 5DRIA 4DLRA 3SJBA 4ZVTA 1FMTA 5C34B 5F21A 1IZYA 2RGAA 1VHTA 3BX1A 2J67A 1WXZA 1TM3E 3W1AA 4DCUA 4MUYA 2PD6A 3W02A 1NFGA 4R0NA 1KNWA 2XITA 3FY4A 1M1BA 1T2EA 3WYGA 1ZHOA 1J9EA 3KB8A 1YL5A 1FWIC 4KKXA 5LDDC 5ALXA 1O1YA 1F6DA 3PPWA 3VU9A 3CEJA 4FN4A 4ND7A 4MKXA 2W3ZA 5CJ2A 4WLVA 1IATA 4OMCA 1Y9ZA 3QUQA 3F8TA 1CLUA 4YRQA 3SZ8A 3OEWA 4IJ5A 3HQ4O 2GKSA 2MSDB 3E2QA 3U40A 4X1OA 2VWQA 3TUUA 6GPBA 2XCOA 3VUPA 1H60A 1YK0A 2BZNA 5DLCA 4DJDA 4TL9A 4RF5A 2V4ZA 1R3RA 3TX6A 1W3JA 3NHYA 4KXFB 4X3CA 3QTGA 2AN1A 1TA0A 3TVDA 1YS1X 3ETGA 2DBRA 3ZSTA 2O4CA 4A6XA 2FHSA 3HHPA 4OHCA 4D9PA 3STVA 4DAEA 5DI9A 2WB5A 4W8AA 5HNKA 3KJQA 3OP1A 3HYTA 3TKFA 1UMBB 4H7KA 1SUWA 3S2SA 3L2LA 5TF4A 3W2NA 2QV0A 4ZT3A 1WUFA 3UOAB 4MV8A 4P3XA 4UOZA 4CM8B 2H92A 3GRPA 4DZIA 2W4MA 4IPJA 2YIVX 4QECA 3R3UA 3AEYA 5EPOA 1DQUA 4PYIA 3RVMA 4M37A 1FFRA 3PXBA 2GK1B 4NZFA 4W84A 6TAAA 4WXYA 3VKJA 2ZUBA 2NXGA 1L8OA 4NRDA 3ZGOA 3VZZA 3FPJA 1DBVO 2XJ7A 1C9EA 1ZN9A 3RPTA 5F64A 1NBWB 2BTOA 4HHPA 3TEMA 4ZGYA 5ALVA 3LLMA 1R8JA 4MW5A 5L40A 4MRPA 4ESEA 3OUUA 3VOIA 1WSBA 5KPDA 2QE7A 3O1JC 2ORIA 4NCAA 4DYHA 5JBQA 1IZ0A 2PU0A 2PTZA 1BMTA 3DFTA 4RGYA 4Q8WA 2GAOA 2J9FA 2VF4X 5JMUA 3G0CA 1LUAA 7MDHA 4Q8UA 2Q3MA 4JQ4A 3B8WA 2N1BA 5DBGA 1SCJA 3SCSA 3C39A 3VE9A 4L8YA 1BHGA 3WP0A 4LE1A 3UESA 1JR4A 5M29A 5J58A 2AUMA 2CDAA 1DO8A 2CEQA 3HJHA 3W88A 1Z36A 1ZINA 3A64A 1P62B 3GH3A 4MROA 3KT0A 1DUSA 1RMQA 4C6EA 1BH6A 3V4LA 1N1DA 5U4XA 4UUPA 2YA2A 3EOOA 4A2SA 4ZEPA 3ABQB 5I9SA 3DCJA 1XNQB 2AH5A 3EDJA 1PX3A 3GRIA 4MQ5A 5K2MA 5K3EA 1VCMA 1XMOB 3GX9A 2ZXDA 3F6RA 5LQMA 3U31A 5EQTA 1JR3D 1V11B 3PWSA 4YUVA 4HO1X 2C07A 4HK4A 5CGMA 1PAMA 2ZXEA 2VZLA 2YL5A 4E2ZA 4RDWA 1TTQA 1GUZA 4LJAA 1IY9A 4UQ9A 4ZQEA 5FCZA 1ZK3A 3P9XA 4E0BA 3N2XA 2RHJA 5CLHA 3FV9A 4U39A 5EIOA 4Q4QA 1NKSA 2ONJA 3TL2A 4IM4A 3H7RA 4MY1A 6AT1A 1M41A 1DWGM 4K6HA 4XWKA 3PYMA 1JH8A 4Q3KA 2CHFA 4ID9A 2QGHA 5TAOA 4WN9B 2JVIA 5EMLA 1GTHA 3ORQA 4IUYA 4E7PA 2J7EA 3V7PA 4YJ3A 2JIWA 3CVUA 2HJGA 1NR7A 1PZEA 4P4SA 3HDJA 3BOLA 1RYBA 4Y2UA 4JL1A 4OU5A 1JZ3A 1I6KA 3B82A 1V93A 3T2PA 4EARA 1FWJC 4OB6A 1Y3FE 4YFYA 1FFWA 1U8CB 1NYQA 2UDPA 1G98A 1QU2A 5I3ZA 1DRVA 2OEKA 1JAIA 2BEVB 5MN4A 3UZJA 1UC8A 5DHAA 1I6WA 3CAWA 4XPZA 2Q2WA 4C7BA 4JDBA 2GJXA 3IPCA 3OIYA 4WK6A 2Q2OA 4LHSA 4H6PA 1DTWB 3NYZA 2N3ZA 5D09A 5CDTA 4DTCA 3BDIA 3EW9A 4AG6A 2FKPA 3M1ZA 5F4SA 2JC3A 3C24A 5L95A 4IIXA 2QTNA 4B71A 3RM8A 4NHVA 4YXWA 1SEVA 1M0EA 5IJ9B 3CC1A 4DFDA 3MANA 1DP0A 1FLVA 5YASA 2Y7DA 1R8SA 1PL8A 5DI3B 1DQWA 2G0NA 4HRVA 2FVXA 4X92A 1W5TA 2HM7A 1XK6A 4QPZA 1GQQA 1QYWA 2PTHA 1YGPA 2Y66A 4L02A 3T4CA 2QS9A 1GCIA 3S1XA 1B0UA 3AXTA 3BWYA 1FQJA 5KQRA 4A2CA 3G6MA 3V4ZA 1LG2A 1ZOOA 3DLTA 3AI2A 3IAQA 2R60A 3EC7A 4B2DD 2EG9A 4NEQA 4XAFA 3ORFA 2B34A 1L5OA 1KV8A 4M87A 3TGLA 4DCSA 1DV7A 4QXQA 5TIIA 4OIFA 1OHHD 2O4UX 3F1LA 1YFLA 1X7WB 2XWJI 5ERGB 3PFWO 1BJRE 3SDOA 3U7HB 4WL0A 3ZZNA 1EPVA 3PZOA 2NPOA 4RIEA 5AESA 4MUZA 2GO7A 4B44A 2OCZA 5DXJA 5IW8A 2CCKA 3S83A 4ZODA 5K3CA 3VIKA 1THMA 1TELA 1EUCB 3GVCA 3M33A 3D7MA 1ACMA 1VKOA 4BQ5A 3CX6A 1VYUA 1AKRA 2QD3A 2RK6A 4BNLA 3O3MB 4B9YA 3W9UA 4IDBA 2C29D 5IK2D 4M19A 1CLVA 4AN0A 1V6XA 3WK1A 4C0BA 3K1AB 4MZDA 3JQ9A 1CF2O 1FJ2A 3IUBA 5IMBA 1D3GA 1OKKD 3QHQA 4HT3B 1UANA 1J90A 1FDVA 1DL3A 3I2HA 3CZLA 4S3EA 4GBED 1OADA 2PF0A 3CRMA 4B8YA 2FX3A 4DXKA 4NP7A 4M7WA 5HF6A 3ZWXA 2PDWA 2HDWA 4ZOQI 3DE3X 3GLVA 4UAVA 1VGQA 3I34X 5EIBC 3AIOA 5TGTA 3RM3A 2GXUA 5JAUA 3RMJA 4P35A 4KIGA 3EA5A 2J6BA 4Z2KA 1JXQA 4QXIA 5EXXA 1OYBA 1CXHA 4QHRA 3LJKA 5BWFA 4DO7A 1XIGA 5CT9A 2PP3A 3UHOA 3ASUA 2IIPA 2G3NA 5CBIA 1UC9A 2PXHA 5ED0A 1DLIA 4Z3DA 3PTMA 3LCVB 4HD5A 2AZDA 3G0IA 4NWIA 2IUUA 4GZ6A 3QF4A 5LBUA 2V30A 1V79A 1CERA 4LGYA 4HQ0A 1V3JA 4BNNA 1P0KA 4H60A 1TT5A 1Q1ZA 3UXAA 2GX6A 1JQEA 1N7HA 3LV8A 1TE6A 1WEKA 2H2WA 5GWXA 1WZEA 3KVRA 5CAEA 3PDHA 3E49A 3V7UA 1MVNA 1B76A 1XO1A 3N7TA 1NTOA 2Q62A 3JTEA 4IGAA 4HIBA 3MN1A 2Q3DA 4ZJZA 4UXDA 3N53A 2P9HA 3EBLA 1LQAA 4UU7A 2M2IA 3ZWVA 4HYEA 3RU3A 2VL4A 4TWAA 4B09A 4AZ0B 3LEPA 1P5ZB 4BX9A 1T36B 1JH9A 4XTRA 2AOUB 4XJXA 1NDUA 3I8XA 1YS9A 1V02E 4H1HA 4XVUA 2J9XB 1QIDA 5DWQA 4XBKA 4EW3A 2MT9A 4NJHA 2D2EA 5C2CA 1EX6A 4FI3C 3FGZA 3QY0A 3EY4A 2CXTA 1F61A 4MHOA 1XDBA 3THWB 1ETHA 5F9HA 5IFTA 2HPHA 2E0IA 3SXPA 4CTMA 5IRPA 2BKEA 4MB6A 3CVYA 2PTDA 3QYPA 1SCAA 3A1VA 4QXOA 4Q1VA 5E0OA 4QWMA 5K0FA 2R8EA 1JGMA 3FIUA 2I66A 2CVFA 1F48A 1B0AA 2KI5A 2O8BA 3CNYA 1JDUA 3SADA 3AJEA 1VZWA 4D1YA 2V68A 1IIGA 2O7SA 4QJ1A 2VXOA 3LQRA 2GGGA 1OABA 4TUYA 1TTTA 1EA9C 4RCXA 3CNNA 5I3JA 2J1LA 1Y6RA 1Q95A 2Y8EA 3H05A 4DV4B 2UUBB 1WPQA 5TIMA 4LBYA 4MI1A 2ZROA 5E8JA 3GIDA 1RQEA 1CLEA 3V5FA 2GBLA 2AMVA 2Y1XA 5TT1A 3NH6A 2W93A 3TUZC 4BDSA 2B4QA 4GQRA 3EXSA 3DW3X 3P2IA 4D92A 5CX1A 1YQGA 2GKGA 4MUXA 1HTTA 1T0IA 3OTOB 5IJWA 1DE5A 2JEOA 2V6JA 4I4NA 4JMLA 7YASA 1KYZA 1ZQ1A 2ZAYA 3QVOA 2I7DA 2XIQA 1DORA 2NYRA 3RROA 2RHTA 3DMNA 2IPOA 4IZGA 1GGJA 5FO1A 3T7AA 3ZX4A 1Q6RA 4AWUA 3DFYA 1Z6TA 1JTFA 5IUNC 3V0UA 3M4XA 5ESWA 4X3OA 4EF5A 5KYYA 3GEBA 4B5TA 3UF0A 4S2UA 2BGTA 2OGUA 3P9RA 1U9JA 4ARIA 5D2CA 4UZFA 1QPKA 1OGSA 4OGGA 4IO1A 2YINC 3IARA 4PYRA 3UZZA 3EOEA 2TYSB 4ZJPA 3NYRA 5CLLA 4WCFA 2ILVA 3MV01 4BQ4A 1NNSA 2A0FA 3GFVA 4JKMA 2OT1A 3LBIA 4G89A 3QFFA 3FN4A 2HYDA 1E2FA 1Q6GA 3FWNA 1UZUA 2ZRUA 4FZJA 4LI0A 3VNKA 3USBA 5ESDA 1N2CE 4D4HA 2QB5A 1E70M 1W9UA 1W35A 2X0FA 3AVXA 1KO8A 3EPOA 3TSBA 2VHXA 3R40A 1JHYA 4R83A 2YMQA 3W5HA 3BPWA 4AZ0A 3CJQA 4GL4A 4YP5A 4V1CA 1PIFA 3LCIA 3HA1A 1C29B 1M1NB 5BXRA 3NIWA 3VV2A 4ZAYA 1CW2A 1YQTA 4JC4A 4WDRA 4R7OA 1T0HB 2FW9A 4ZB5A 4CCCA 1T8RA 4JNKA 1K06A 3I6ZA 3CWQA 1TF2A 1QR6A 5ALPA 3L7KA 2XA9A 3PNBA 3TNBA 1N8SA 2FYTA 1TZ2A 4DLSA 5GV8A 5C9ZA 4MARA 2EKDA 4EHKA 4WK0B 2GXQA 2XCTB 2I2AA 2O8BB 2P5SA 1GDHA 3K9CA 3O21A 2HA3A 1W0KA 4HRXA 4I9FA 2K5UA 4D0GA 3LGEA 4KODA 3GF4A 2E8YA 4RD6A 1RTTA 2FQYA 3CEHA 4QIHA 1VLWA 4NHOA 2YVUA 1WA3A 5ENDA 1D0IA 2VDRB 1SB8A 2VQ3A 2CLOA 2VDLB 2KX9A 3GAYA 4MVJF 1EB8A 3WWYA 3BSYA 3CWNA 3EDRA 3K5PA 4BWVA 1GR0A 1U2GA 2C2HA 4P5EA 4M0XA 4RZ4A 4X95A 4U7PB 4N0DA 2O1WA 2JARA 2OXNA 4YYFA 2IWRA 1A5AB 4IYRA 2I9EA 2FGKA 2CLIB 2I76A 1A0CA 5JDCC 4JI1B 1P6QA 3GG2A 1IOLA 3VIFA 5AJYA 3DVAA 1P9NA 5KTOA 4DG9A 3P5ZA 3EX3A 1NQXA 3SBXA 3VPAA 3CNEA 4YR9A 1EL3A 4X9XA 4RLIA 3JD0A 1X9IA 1OXTA 2Z9DA 3UMFA 4KE9A 2O0HA 1EJTC 3O3NB 1GZVA 2IOFK 2RGBA 3EWWA 3BMQB 5G3YA 5FR1A 4NY2A 1U7DA 3NW9A 3F2CA 1TK2A 3ZQJA 3KWLA 3HBNA 4ZVRA 4IGEA 4ZRDA 1NLYA 1KJWA 4RNDB 4ML9A 3P1JA 2VC9A 4M3NA 1GEGA 2JFUA 1RVDA 2HMAA 5JYEA 1GPYA 3A70A 1S2MA 2P6UA 3QELA 5JJIA 4EYEA 2CIPA 4I9MA 1G66A 4I50B 4V39A 3AF2A 4EB6B 3L67A 3EBOA 2QAPA 4YVXA 1TKAA 3ANSA 1NOWA 5AVTA 1MAAA 4Z4GA 2DZXA 3F98A 2CERA 3R0QA 1M7PA 3STXA 4DA9A 1H3GA 3B8SA 4FB4A 5CFNA 3GCXA 1SSGA 3Q3GE 1EBUA 2E1DA 2W79A 1KARA 1P7TA 4EF8A 3C3JA 3PIIA 2FDMA 3NAVA 3QN3A 3P80A 3GG9A 5F76A 2UUCB 3WBXA 1E3WB 3VC5A 2Y85A 5K9DA 1EX9A 3QFWA 4DCNA 3DMFA 1SVIA 2G80A 2RI1A 4JUFA 5ECVA 3Q12A 3ENWA 1GU7A 3TN4A 3HA3A 2X6QA 3GA7A 3SJZA 4RHXA 2IPMA 1C0KA 4CLMA 1MC5A 2ZX5A 3PCTA 2V5AA 1WCWA 1RJ9A 3QMWA 2Q3BA 3VOSA 1W581 3URQA 2XMZA 3KQUA 4AUKA 1HO1A 4DIKA 5JSQA 2Y2UA 4QGAA 2DSVA 1ND5A 1MB0A 1W5PA 5DXYA 5A94A 2HRWA 4JI8B 1SD5A 3PLNA 5SZIA 3ZTWA 4GD0A 5L9FA 5WRFA 4XUGA 3T0FA 3ARSA 3GBVA 2TMGA 4HGQA 1HDOA 4I1PA 3TNYA 2CKSA 1MG0A 1M7HA 1IC6A 1B3RA 2FW7A 4MCJA 2IS6A 1TWSA 1GAJA 4XX0A 1L6WA 4HNGA 1BHSA 5CPFA 3RTEA 3GXTA 2XDAA 3TSDA 3MG9A 3WF0A 3T94A 2C59A 1FTNA 4K3VA 3HTWA 5EIAA 3F90A 1TLFA 1JSCA 3KIPA 5ENLA 1A5AA 4XZLX 4FBLA 4I4LA 1WB5A 3L7NA 4G65A 1NWRA 4QUJA 3Q37A 4ND5A 1I2MA 2JFHA 1HGYA 2A7PA 3B52X 4JENA 1C0PA 1KBKA 3TV8A 3HWRA 2FP4B 4ATDA 5LP1A 2V58A 1WU7A 1YQ9A 3BBPA 4JUBA 2V5CA 1GRQA 1OFDA 1FRBA 4TXEA 1MC4A 3VIPA 3S5JA 1ZVMA 2QUAA 3LTYA 2FW6A 5AVJA 1W88B 4R2MA 1C8LA 3U9TA 3QJGA 3OOYA 1II0A 1YOVB 4U0KA 1SR9A 4LX4A 4FOUA 1RAFA 3HUTA 1OZQA 3IQHX 4J7UA 4CQBA 3P45A 5B1YA 3EEOA 3SS8A 2GASA 3KUUA 1L6SA 4LC6A 1QQ6A 5EJ6A 1TO3A 3RARA 4LOJA 3GROA 4QT0A 4OTKA 3VU3A 3EDDA 3T0DA 5KNDA 5D6NA 3NBZC 3V5CA 4AZGA 2F90A 2ZT6A 3WJWA 1FXQA 1N8NA 3JVIA 2LKCA 3B1KA 1RI1A 1XMPA 2YFKA 1EGMB 4IFEA 2GJ8A 2YXBA 5JOQA 2VP3A 3GDBA 4F4DA 3H5WA 1OZ0A 3IP9A 3CV2A 2HVNA 2PDYA 1IH8A 1FH8A 3N6RA 2HCVA 3FNHA 2ZR8A 4CT0A 1FS4A 4A3YA 3GIPA 3DV0B 5K6AC 2IIVA 1P0CA 3ROKA 4LRTB 3D8BA 2AIRA 2QTTA 2VEMA 4B91A 5DN9A 4UVEA 2I3DA 3HB9A 4PUMA 3H2HA 1NVTA 3M46A 5FRDA 3GFPA 4HQOA 4LWQA 1Z6QA 4CCAA 4O18A 3HGTA 4XTCS 4KXVA 3E9CA 3GG8A 5HQLA 2FJKA 4P22A 3E84A 1NI5A 3ZY3A 3IJRA 3EZ2A 4IS2A 1TV5A 4M49A 1T43A 5CRIA 2R751 1QRQA 4FNSA 1LOSA 2VOEA 1PK9A 2BGIA 3DFFA 1DZIA 4XYBA 4HA3A 1RQNA 2VQUA 3H2OA 3TIIA 4YAIA 3DN5A 4C6BA 2I6GA 3FZEA 4YDHB 2PLFA 1R9JA 3KQMA 4M0LA 4BE7B 2FFAA 4DIUA 3SBFA 2IZ5A 1QIKA 2XVYA 1CY7A 1SVDA 4PYKA 3A4NA 2AK2A 4Q4DA 1GUFA 2UYYA 1PI3A 1F60A 3ZLVA 2MYTA 3BMOB 2HWKA 3TLGB 3M0MA 3RSLA 4KXXA 5H82A 4JFVA 3VAAA 4QGHA 4E22A 1LS6A 4MQEA 1JQBA 1SW7A 4K6AA 5JNUA 1DX9A 1U5JA 1T2AA 1T96A 3MIZA 2BFAA 5KX5A 3GGJA 4B3GA 3OMWA 2ZRVA 1SZDA 2NP7A 4DN6A 1PJLA 5I3CA 3FDGA 2VXBA 1AGRA 1QPGA 3ZQ6A 3IV6A 3NHJA 1B3YA 4IIVA 1KM4A 4QUHA 2PGEA 2AOTB 3UGJA 2JJ1A 3NOOA 3GZ4A 3QA9A 2GAIA 1NLMA 2Q0QA 1O89A 1E1QD 4I19A 1UWIA 2ZPAA 2NX3A 4A6EA 1Z75A 3H4TA 1S3GA 2VQDA 2AI2A 1DC8A 2VCBA 2BDEA 1KYIA 4HEA6 3K0CA 2ETXA 3VYVA 4BQFA 5IBXC 1AK9A 3OJ0A 5AM1A 1M6YA 1MZPA 1O97D 3AV3A 5HHTA 1HXJA 1DKLA 2JLCA 4CMIB 3UJ2A 1PNO