5EMKA

Crystal structure of prmt5:mep50 with compound 9 and sinefungin
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emkA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emkA02
2R6ZA 2QUNA 3Q7EA 1KR5A 4P7JA 1NW8A 3ELYA 1EG2A 1VL5A 4XISA 4F86A 5ERGB 4P7FA 3M0HA 1NW5A 4QE1A 3LGAA 3C0KA 3FZGA 2UYHA 5CVDA 1OR8A 2KW5A 2ZW9A 5FA8A 3V8VA 3OU6A 1SUSA 2Z6UA 3UJCA 3EVAA 2J6VA 3TR6A 3GCZA 2H00A 3UJ7A 4E33A 1DL5A 3DP7A 2O0LA 1FP2A 3KCLA 3FTCA 4C04A 2CMGA 3TMAA 3I64A 8XIMA 3M6UA 2G1PA 5GIPE 5KS2A 3KQMA 3UBTA 2NXEA 1VQ1A 2AVNA 3A27A 1RJDA 3GO4A 2YXLA 3G5LA 3PLAE 3GXOA 3R9XB 5K0EA 4PYNA 5K0JA 2P3LA 4DUOA 4P7GA 4EMSA 1XISA 9XIAA 4PCLA 4PGLA 4QE5A 2QUMA 1FBNA 2FRXA 2O05A 3P6LA 4IV0A 1Q0SA 4FS8A 3NTVA 2B2CA 3QC0A 3TOSA 9XIMA 1VBFA 3THSA 1VP3A 4O29A 1SUIA 4R6XA 1X19A 1WZNA 1JSZA 3IEIA 2NP6A 3I9FA 2UZ4A 1ZGAA 4E31A 2PXXA 3C3PA 2PJDA 2ZWAA 3K6RA 3EPPA 3HCDA 3R24A 2IP2A 4LECA 3GRUA 3CQHA 3GNLA 4RSRA 3DH0A 2YUIA 5J8LA 1BC5A 3BGVA 3E8SA 4PONA 2ESRA 4FZVA 4HGZA 3LBYA 4EAYA 1TZ9A 3OU2A 5KYGA 4GOOD 3NWEA 3UA4A 3CJRA 1XLLA 4AZSA 3GWZA 3U3HA 1NBHA 2QRVA 1WY7A 3KR9A 5H02A 2P7HA 3KR2A 1MJFA 4LNCA 3ANXA 2HNKA 5IH3A 1O1HA 3OCJA 2NXCA 3FTDA 1KHHA 2EX4A 1XINA 3AXTA 3GRZA 1RI3A 3IUIA 3VC1A 3PFHA 1XIGA 4CXMA 1UWVA 4QPNA 4Y2HA 1OADA 1DIEA 1XDUA 4GOLD 1I60A 3CNYA 4AZTA 3VNJA 3BWCA 3IYLW 1I9GA 1RI1A 5CCBA 3HP7A 1XLEA 2YQZA 3LCUA 1DIDA 3T7TA 1VE3A 3RIEA 5LQRA 2GVEA 5DX1A 2IIPA 1XIJA 2XINA 2QRVB 1RI2A 4PYJA 1ZKDA 2XVAA 1R18A 2A14A 1G8AA 4U7PB 3OZSA 4R8SA 2O57A 3ITXA 3ITLA 5DTMA 1S5MA 1G6Q1 2AZTA 3OZRA 3JU2A 4RVHA 1QAQA 3RODA 2PVCA 1R00A 3NVKI 1UFKA 2UYQA 3M0LA 2V7EA 1CLKA 2OZVA 2EJTA 2G0WA 2Y1XA 3DXYA 2Z6AA 3KCOA 1XXLA 1NW7A 3JWHA 3DOUA 4IV8A 7XIMA 3M0MA 5K0GA 1AQIA 4YTUA 2I57A 5K0LA 1ZG3A 3BZJA 4RTJA 4PYKA 3M4XA 4PGGA 1UIRA 4EKIA 2BR3A 5B7YA 4QTTB 3FTEA 3VSEA 5CIYA 2IDJA 5DXJA 4RTRA 3O4FA 3P9IA 4YTQA 2FYTA 5B7ZA 2OU4A 4F85A 3KQYA 10MHA 3DR5A 2HR1A 3M70A 2ZBQA 5FADA 4W4QA 5EZSA 2ZIEA 5E2AA 1XIHA 2GYIA 1RI5A 1N2XA 1JR4A 3G2MA 3FUVA 3ITOA 5KQSA 4AX8A 2B9EA 5BW5A 2ZIGA 1RJFA 2NXNA 3VC2A 1XLAA 4E2XA 3HA5A 3U0HA 1XYBA 5HZMA 3E7PA 2ORED 4HG2A 2OPBA 5FHQA 3GRVA 3G7UA 2ERCA 2I7CA 3BWWA 1YB2A 4P58A 2ZTHA 3ID6C 4IKPA 1NW3A 1XLCA 1ORIA 3HA3A 4RTPA 2ZVJA 5ICCA 3FPJA 1XLIA 3P9KA 1L9KA 2OKCA 1L3BA 1R8YA 2OB1A 2ZZMA 2VDVE 4B17A 5EG5A 1XIEA 3DX5A 4GLEA 4GC5A 3BANA 2HK1A 2UYCA 1NW6A 4RTOA 5E1BA 4RVDA 3UJ6A 2NQHA 3TM4A 4ISCA 1XLFA 3KBSA 3C6MA 4QVGA 3HVJA 4V0RA 4HNOA 3REOA 3UJ9A 2I9KA 5E9QA 1JG2A 1DXIA 3FPHA 4AZWA 2PT6A 1DE5A 4PCAA 4U7TB 1DUSA 4FP9A 5HOQA 5LR6A 3PVCA 4E70A 4Y30A 3U81A 3P8ZA 3GJYA 5AVHA 4POOA 2ZULA 3FRIA 3SSMA 3P2EA 1JTFA 3KPUA 2WA2A 3TKAA 1GW9A 4K1GA 3MCTA 3KU1A 3ITVA 3EMBA 1D8WA 1F3LA 2ONZA 5EKXA 4EQZA 5K03A 3HVHA 2HWKA 4A6EA 3HCCA 2ZLBA 3DTNA 2HMYB 4OBXA 2NQJA 1I4WA 4LWPA 2OBFA 5DRYA 2YXEA 5DSTA 3FVMA 4RVFA 2ZFUA 1AV6A 3KBNA 1EJ0A 2I6GA 4CKBA 2YR0A 1QANA 3ERCA 2B3TA 3HA7A 1JQEA 3PX2A 1NV8A 3FUWA 4G56A 1P91A 4YTRA 4KIFA 2Y1WA 1SQFA 3UJDA 2C7PA 4HHMA 1AF7A 3NJRA 5LQJA 3M0XA 3FUXA 4CKCA 1RJEA 3HNRA 4PIPA 5MHTA 5EHIA 3BKXA 2ZIFA 3KQSA 1XP3A 5B80A 1R74A 3OBEA 4QEEA 4E32A 1SKMA 2G70A 4JXJA 3ITYA 3KKZA 5EEGA 1XIMA 3QV2A 4QQKA 3SX0A 3G2QA 3G8AA 2V74B 5E9JA 3EVBA 5K05A 3EGVA 3D2LA 4XUEA 3B3GA 4A8NA 4FSXA 4PYMA 4XSLA 2GA9A 3LCCA 1NKVA 2ZSUA 5HIIA 4HH4A 2XISA 3UZUA 4E2YA 5T64A 1PJZA 5XINA 4E30A 3I58A 3BWYA 3BDKA 2R3SA 2ZWVA 4OX9Y 3GIWA 1FJXA 4YUVA 1ZHFA 4GJJA 1XDZA 2PSSA 3BWBA 4ER5A 1ZQ9A 5GM1A 4QEHA 3VNMA 2HV9A 2C7QA 3O7WA 3MAGA 4YUWA 5K01A 3B7PA 2ZCJA 2FK7A 1KPHA 5GWXA 1EJ6A 2FCAA 5LQKA 2JHPA 3MQ2A 3LSTA 1D2HA 2XVMA 3LDUA 2XYQA 5EIWA 2IFTA 1NV9A 1MHTA 2VZ9A 4V0QA 1ORHA 3K0BA 3KPJA 1QT1A 2H11A 3NGFA 5FA5A 5I7GA 3CKKA 4QDJA 2NXJA 2PT9A 5GINE 3ORHA 3BZBA 1TPYA 5K0BA 3MTIA 1FPQA 3DMHA 1R8XA 4PYQA 5CM2Z 4DCGA 4GBED 2Q02A 2VDUE 2O07A 2AOXA 3A25A 4QE4A 3VNLA 3A4TA 4X1OA 3P97A 2H1RA 2ZZNA 3CJQA 5EMMA 5LQCA 4AZVA 1KP9A 5EVJA 1N7IA 4HC4A 1JG4A 2ZVRA 4RTQA 3UFBA 3R6TA 2NQ9A 3AY0A 2PXCA 3MERA 5DM4A 1XCJA 1IY9A 4BLUA 3KBMA 5T67A 3CVOA 2JHAA 1SG9A 5BXYA 3MHTA 5DXAA 2IPXA 3NDIA 1L3IA 1O9GA 2AOVA 3LX6A 4FT4A 4EACA 4BP3A 2PXAA 3G5TA 1JSXA 4GOMD 5DWQA 4RTNA 3B3FA 2GH1A 5ICEA 5EGSA 3CQJA 5K0FA 1G60A 1IM8A 3I53A 3P14A 3OPNA 3E05A 1TW2A 2NP7A 3LKZA 1HNNA 3UU0A 3EMDA 5CUQA 1X1BA 1X1AA 3TM5A 1XICA 4RYLA 4XUDA 3TLJA 3ME5A 3I5UA 3IV6A 3G2OA 1BXBA 2PGXA 3DUWA 1JQDA 4E3VA 2FPOA 1JG3A 4KVZA 1YF3A 3P71T 4KDCA 4OVXA 5GIOE 2GAFA 3UJ8A 3LBFA 4XKMA 2GLUA 4EK9A 4PNEA 1SQGA 4AUKA 1XIBA 5DTQA 4BLWA 2ADMA 5E8RA 3UVAA 3QXBA 2JH9A 3ITTA 4H0NA 5EZQA 9MHTA 3HM2A 3GGDA 4DM3A 1VLMA 4HGYA 5H6HA 3OZTA 3SVZA 4ER7A 3EVCA 7MHTA 2G71A 3CGGA 1VP9A 1IXKA 3OE5A 4C05A 5DM1A 5D1HA 4X63A 1YFJA 1NE2A 3O31A 2YX1A 3LMZA 1VPTA 3TC3A 1A0DA 4F84A 1U2ZA 2AOUA 3MB5A 3L8DA 2AOTA 3UXIA 3EVDA 2GS9A 3TVAA 2I62A 4M37A 2WA1A 1XVAA 2BR4A 2ZZKA 4QDWA 2NNWB 4HTFA 5LQAA 4DZRA 5C0OE 2CKDA 3M0VA 2FHPA 5E2BA 2AS0A 3BKWA 2P35A 2G4JA 4QTUB 3Q87B 3SM3A 3C0SA 3HEMA 2JG3A 4YUYA 3AYVA 3AALA 3P2IA 4OA8A 3DLIA 5M5BA 3M6WA 3BT7A 1XLJA 4BY9E 3A26A 3JWIA 4KW2A 2AOUB 5U4XA 5DTRA 4CTKA 1G8SA 2AOTB 2PX4A 3THRA 3LL7A 4RV9A 3SMQA 4C08A 5FTWA 4GEKA 3VYWA 3KPWA 3G8BA 2AR0A 4RTLA 4DA4A 3CQKA 2CMHA 4GQBA 2Z6QA 1T43A 5K0NA 3HTXA 4HTFB 1S5NA 5E1OA 4PIMA 1KPIA 3HCEA 1QTWA 1L1EA 5CVEA 5FWDA 1PRYA 2ZBPA 5P8WA 3G89A 4R6WA 4FGZA 5K0CA 5HIKA 4ZB5A 2YXDA 3FTFA 1Y8CA 4A8IA 4OBWA 2GLKA 5XIAA 1RI4A 3M0YA 3NDJA 5F2NA 3PFGA 5ICGA 2BM9A 4IWNA 1XYCA 3KQWA 2AN4A 1D2GA 5CVUA 2P40A 2P8JA 3ER9A 3FYDA 4CTJA 3HCAA 4C06A 1MNZA 1M0EA 1XYMA 5BP7A 1XDSA 2OO3A 4YTTA 2GPYA 4EKGA 4GC9A 2IH2A 2K4MA 3CBGA 3AJDA 2PX2A 1BXCA 3NVMB 1B42A 3NMUF 5EHGA 4FR0A 5AVNA 5DX8A 3QOWA 4HGXA 1V39A 4PGHA 3LECA 1X1DA 1QAOA 1P1BA 2QE6A 3RW9A 5CVVA 1XCLA 1EAMA 3QYSA 3KQTA 2F8LA 2XYRA 3T0IA 2CL5A 4X60A 5XIMA 2P7IA 2CWWA 3PT9A 4LWOA 4FSDA 4HSGA 2PV0A 4J4KA 1A0CA 3XIMA 4KWCA 2OB2A 3M6XA 1NBIA 3UJAA 4FT2A 3FUTA 2DULA 2VS1A 4Z2YA 3FYCA 1P39A 3NWBA 4CWAA 4OQDA 4YUXA 3FPGA 3R3HA 4PWYA 3FPEA 2BH2A 4MIKA 4A6DA 4KW7A 4ZBCA 3PX3A 1EIZA 2PWYA 1XLDA 3E23A 4NECA 5DX0A 2WK1A 1JTEA 4DCMA 4X41A 4XIAA 4XUCA 1F38A 1QUMA 2B25A 5EQJB 5D1NA 4MHTA 5HIJA 4YV0A 4CKEA 4E2WA 4YMGA 2I56A 4UOEA 4ATNA 1DCTA 2HCVA 5K09A 3G2PA 1I1NA 4X61A 5EMKA 2VDWA 4C03A 5LQUA 1XTPA 4K6MA 3AAMA 5LQNA 3EVFA 5EOVA 3BWMA 4ZTBA 5HFJA 2YVLA 2EFJA 4WXHA 2HTEA 3KTCA 1HMYA 4HHLA 2PY6A 3IUDA 5C9ZA 4YUZA 1K77A 4ER0A 2PKWA 5FWAA 4R05A 3ELUA 3ELWA 3G88A 3SXJA 4YV1A 3FRHA 1VIDA 3N4AA 2QW5A 4A8LA 4MWZA 3SR4A 1XLMA 3EEYA 1QZZA 2OYRA 3GNXA 1Q0TA 3A7DA 3L23A 3LHDA 2PX5A 4LG1A 1QYRA 2XIMA 5EEHA 3EVGA 5IKMA 3LPMA 3S68A 5FQNA 3C3YA 5DPMA 3LDGA 5E9WA 3OU7A 2X7VA 3GU3A 5FHRA 3ELDA 3QZAA 2NYUA 5G02A 4Q7IA 4YTSA 2AVDA 4BP1A 4OQEA 2B78A 5FCDA 3NW9A 2XYVA 3DULA 5GOZA 1SVUA 2PX8A 4GUAA 3B89A 4DMGA 5CVJA 3OE4A 2G8NA 3SSNA 2AN5A 5EIFA 5C1IA 5LSAA 5T6BA 4ZB2A 1JG1A 3SGLA 1YZHA 8XIAA 3FUUA 3M6VA 2ZDSA 3XINA 6XIAA 5CD1A 1FP1D 3TFWA 4PFHA 5DRTA 3KBVA 3BGDA 5E1DA 1WXWA 3B3JA 2P41A 1KYZA 3DLCA 2X7WA 3IUHA 2EG5A 5FULA 5DM0A 4GF5A 1R6AA 5H1WA 1O54A 2JHCA 1BHJA 2N47A 3PB3A 1XLHA 1XYLA 1NT2A 3JWGA 3CQIA 3HCBA 2XBMA 4QVKA 4C07A 3WQOA 3B5IA 4DQ0A 1KYWA 1M6EX 2ONYA 4RTKA 3P9NA 4YMHA 3T7RA 4A8RA 1KIAA 2IH4A 3EVEA 3SSOA 5K8VA 3R0QA 5KQRA 1I6NA 2QM3A 4M36A 3KQVA 4KRGA 4OA5A 5DLYA 3TQSA 4R8RA 3VYLA 1XIIA 2DPMA 3AWIA 3XISA 2P3OA 3DMFA 1YZ3A 4US6A 3OFKA 3GRRA 3PTAA 2HK0A 5FUBA 4DF3A 2IH5A 1MUWA 3EGEA 2PBFA 1D2CA 1L3CA 2IBTA 3X0DA 5JR3A 6XIMA 3LCVB 3P9CA 1YX1A 2YTZA 5E1MA 3DMGA 4C4AA 1AQJA 3KCJA 3HVIA 2PWPA 3CJTA 2P1DA 3AYTA 2OY0A 1XIDA 1KPGA 3VNKA 1RJGA 5GM2A 4QQNA 3GRYA 1YFLA 5DM2A 3QOXA 4M7RA 4QDPA 2BR5A 5EKUA 3C0LA 3KQQA 3P2KA 4RWZA 4DVOA 3KHKA 4PYLA 1YUBA 4ZB0A 3KBJA 4E2ZA 1G38A 4GJIA 3OFJA 4WVLA 3MCZA 1ZGJA 2GB4A 3CC8A 1X1CA 5EMJA 2O06A 4RVGA 4XCXA 2IBSA 2EJUA 3KPYA 5DSXA 2AN3A 1H1DA 4RTSA 3A7EA 3BUSA 3GDHA 1KXZA 1Z3CA 5HIMA 3LDFA 4PYIA 4XIMA 1A0EA 3UA3A 1N7JA 1WXXA 5DT2A 5F2KA 3KQOA 2QULA 5TNVA 1JQ3A 5GP1A 3DXXA 3M33A 2JJQA 3F4KA 4KDRA 3MTEA 4K3ZA 3VNIA 3HVKA 3BZGA 3EVZA 4ER3A 3IHTA 3FPFA 4MTLA 5BW4A 3LKDA 3KBWA 1QAMA 4HRAA 8MHTA 1WS6A 2C7OA 2Q41A 4YV2A 5B1SA 4P7KA 2LD4A 3C0QA 1XJ5A 4ER6A 3BXOA 4XSMA 3PS9A 4KIGA 1XIFA 1TW3A 2VP3A 3UJBA 5CCXA 3KQPA 3CWHA 5JUWA 3H2BA 4DKJA 5HILA 3KWSA 2UYOA 2BM8A 1XLKA 3ER8A 2P3QA 4QPPA 3TKYA 5EPEA 3V97A 3BGIA 5EMLA 1INLA 3EGIA 2PLWA 5F2OA 3EEOA 3TPZA 1BOOA 2OXTA 5KVAA 3DBNA 2AOWA 3DXZA 4PYOA 1XYAA 4BLVA 3WSTA 3T7SA 5HEKA 3C6KA 5E8JA 2IGTA 1P1CA 2QYOA 2GUBA 1XLBA 3UWPA 3JWJA 3KR1A 2BZGA 5FQOA 4MQ4A 3AXSA 2IDKA 1G55A 3HCFA 3KPVA 1BKYA 2E5WA 2C7RA 3MGGA 4QDKA 1WG8A 2QY6A 3CCFA 5ICFA 2ZBRA 3KR0A 4M38A 4EVIA 2JH8A 4RTMA 1EQAA 1M6YA 2G72A 3TRKA 1XLGA 4GOND 4PINA 4RX1A 2FK8A 4L7VA 5EC8A 1O9HA 1DE6A
chains in the Genus database with same CATH superfamily
3ANTA 3VO1A 1QH1B 5DYWA 1RCTE 4UFOA 1PUJA 3ZZTA 3BXWA 1QFZA 3E22B 1WLSA 1ZVJA 5K4HA 3AJ7A 4EW6A 3TR2A 4P0TA 3EMCA 3W74A 1K7EA 3HI4A 3HFSA 4LYKA 3REQB 2CD9A 4ZCRA 4GWLA 5A0VA 3W5AA 1Z8AA 3TD2A 3QEMB 1K7SN 3C0KA 4Y6OA 1F8XA 1RHQA 2FV8A 1LPSA 5JBIA 5AC4A 3DAPA 2A0UA 1QF9A 2TSYB 4OQ4A 2Q5CA 3TN7A 3PULA 4BNVA 5CA0F 3AROA 4RHEA 3TR6A 3RM4A 5D9PA 4LOIA 2V5JA 5DY2A 2V3FA 1LWHA 3CPSA 3EXHC 3ZU6A 1DLJA 1UMCA 3R4CA 2WMFA 1ZJYA 2ATXA 2WWFA 4DJEC 1AHNA 1IUPA 2CBUA 5CLIA 2JFUA 3MJEA 2ZWPA 5KMYA 2WINI 1STOA 3N2LA 4D6DA 1D03A 2Z98A 5A4JA 1K7EB 4FXRA 1Z08A 3VJLA 4DUOA 2PWDA 1ONBA 3R12A 5LVAA 2I4MA 1TYAE 1FQOA 4D99A 2V5DA 4MY8A 2RGNC 1PDWA 3B60A 2BEKA 5FF3A 2ZRNA 4HZ7A 2FFQA 1TM3E 4FS8A 3QW3A 5IWCA 3R44A 4F4RA 3C14C 4DPQA 4GBJA 3V75A 4S3JA 1MC4A 2BGIA 3OQPA 3WGKA 3W5HA 1R7RA 3DHFA 3IV9A 3QNWA 1WZNA 1EUYA 1VKNA 3C3PA 3PP8A 2PJDA 3EPPA 1P1HA 2QTCA 1BAPA 2IP2A 5ICSA 3KUCA 4XPZA 5BV8A 1Z4PX 1VMEA 3GFPA 5SZHB 1BC5A 4O10A 1F0YA 3LS2A 2OSBA 3NZRA 4QASA 2R62A 1NOFA 1RRMA 4FZVA 3N53A 1UZDA 4BUZA 2OWCA 4HFJA 3AUJA 1GKKA 5K4ZA 3FK4A 1DQRA 1XLLA 1W5FA 1VPWA 3GWZA 1Z0DA 3R8XA 3KIPA 1LVGA 2PC8A 3FKKA 4D3XA 5IULC 5HM6A 1ZEJA 4FX6M 4CU6A 5KSPA 5IU6A 4CMJA 4Y1GA 4ALNA 4YPJA 1A5ZA 1LNQA 2B69A 3VX1A 3VPHA 5GPBA 3IUIA 1GEGA 1TA3A 3PFHA 2DUAA 5AW8A 4HWSA 1QFJA 1G20B 4RNDB 1BYIA 3L41A 1GHTA 2QDHA 3SAZA 4BLQA 2RGRA 3BW4A 1QHHA 3EOEA 2G97A 3R23A 3LWZA 2PZFA 3IQDB 3SSJA 2B92A 3BC9A 3EIXA 2OHXA 2AHRA 1NUAA 4DRXA 2H0RA 4CN1A 4A10A 4Z4QA 3PWZA 2XCIA 4O2AA 2FDCA 3G9QA 1AGNA 2VNJA 5JBNA 4DJJA 4NQ1A 5I7AA 1G8AA 2FETA 5JS2A 1GPBA 4AD8A 4DF0A 3OZSA 4DLAA 4YJHA 3HC7A 3G3MA 3CZKA 3JRKA 4E1VA 5FEPA 1TA3B 1A7AA 3G0BA 4M0EA 4R3NA 2W22A 4FFPA 3G0GA 2QJNA 4HT3A 2O0MA 1G20E 4HQ6A 4NCAA 4IWXA 4EXBA 3IP8A 1OLXB 1M5UA 1PK9A 1W8GA 4XX6A 4W6QA 4JTIA 4RZ2A 4TTJA 3OIWA 3WLKX 2IXFA 2GSJA 3RITA 3WK6A 2G95A 3DOUA 1OJ7A 1Q7BA 1AQIA 1XJQA 2F43A 5L3VA 1FTQA 3EQ6A 4L8VA 4PYKA 2W00A 4HQNA 3W7RA 3BLKA 3D1JA 4BO4A 3USBA 4BFAA 1S9DA 4I66A 3DE1X 1KK1A 4IDOA 1H7NA 2FG7C 2CIPA 4L78A 3OBKA 1E20A 3HI6A 1KEEA 4HNRA 4IHJA 2XWBF 4AY6A 1NXPA 5KYKA 3RC3A 2GYIA 4C7OA 2XMQA 3X1KA 5EVCA 5BYBA 2RJOA 2OCKA 4HU4A 3MAJA 2GUGA 4FCCA 4JBYA 3PUEA 1A27A 4PVDA 2PA6A 2BGNE 4IZGA 2J3KA 2F43B 5E4JA 2O5RA 1GL3A 1E6WA 3G7UA 2CETA 2O2ZA 3HXKA 2I7CA 3KB1A 3SC6A 1DAOA 3NXSA 1XN1A 3BILA 5KC9A 5FNVB 1COWD 1NURA 2C1IA 3ZE7A 1YXDA 1VZ2A 4RTPA 2GAJA 1FCVA 4MAZA 3SIWA 3IMCA 3PFBA 1KEEB 3AF6A 3EOZA 2OKCA 5BQPA 4P84A 3RV3A 3MT8A 1C2TA 4G1VA 2VDVE 1P1JA 1O12A 2VAVA 3H1BA 1J42A 2VKZG 4J2OA 3ARYA 2VDQB 3ZJKA 5E1BA 4QG7A 3PC8A 2QTBA 1S5VA 3JQEA 1WPQA 4R5HA 4F9TA 1X7IA 2C9DA 4PMUA 5BSMA 3QLVA 1UD2A 3GT4A 3T99A 5E7JA 1NPTO 2V4UA 1NQUA 2F8MA 4M2LA 1N9GA 2QTRA 2E6UX 1Y6JA 1DJYA 4JWTA 3L93A 3BOXA 1EQPA 2H85A 5JFGA 5BV2P 2QV4A 1L5WA 2XNCA 1XTJA 2LCQA 5IC5A 5LR6A 4NZ1A 2C59A 1TRKA 2JFZA 5J2TA 2E21A 3Q0IA 4HK5A 3I28A 1Z6TA 4M87A 2QIPA 1Z75A 3ANSA 4POOA 5CCZA 3T78A 4MPKA 2POTA 3DHNA 4W7WA 1YTLA 1VBKA 3TTSA 4CNNA 3FYUA 1IVYA 2G36A 2ZRBA 4NKRA 5CC5A 3GLQA 1XQ9A 3Q2DA 3T55A 4CMIB 4B5UA 5CU7A 5JIPA 4Q3CA 4C4RA 1ZMTA 1T1EA 4YP1A 1ULUA 2CXNA 4LISA 2XUQA 4OTKA 3C8MA 2E9SA 3DTNA 2HMYB 1HO4A 2YXEA 4Y0AA 3WNPA 2DQWA 1BRLA 3UAXA 2JW5A 1W17A 5D3QA 2OO7A 4LVNA 5KWIA 5LZ8A 5EJ4A 3G02A 5J2TB 4JNYA 4S2BA 1QNVA 2EDCA 1VIAA 4YRDA 3F96A 2R8WA 1FTNA 2WUVA 1F20A 4G56A 3ZV5A 3W28A 1QNOA 4KI0A 1WDQA 3PC6A 4F1KA 1ST3A 3WGVA 2OSWA 1Q12A 5DOVA 4LBRA 3S0CA 4LYEA 1PGPA 2ODEA 3KO8A 5LIYX 3CLUD 5BYWA 1LT7A 1G2IA 3UY8A 3BLPX 1UKQA 4WKOA 3LNMA 3NWOA 1LEHA 3APTA 3L7MA 2WZBA 3VX4A 4CCZA 4CT5A 1HEYA 2Y4SA 2NSDA 2QAGA 1DWUA 2GASA 4N02A 1S8NA 1BRLB 1F3TA 4G7EA 2PUZA 2W2QA 3DKLA 3PHLA 3W25A 3T5GA 4IIVA 4CMEA 5E6YA 4QUJA 1RCQA 2CEAA 3I39X 1ELSA 4UHFA 5I9MA 3FS2A 2VJLA 2ISCA 4EUHA 3NGLA 4F7WA 4U2KA 4AZIA 2BONA 1PEAA 2Y71A 2XMGA 3K2EA 1XMIA 1N8WA 3ENWA 4Y2RA 3VKJA 1G2OA 1YJAA 2ZIXA 3GU9A 2IUEA 4BEJA 3JD4A 4UQDA 4PTNA 3PR2A 1XBXA 3J7TA 1WUHS 3MKKA 1SO5A 5F5LA 3G8EA 3IOYA 3F5MA 3T9BA 4ZARA 5J23A 4HR7A 4A27A 4NCHA 4GLLA 5K3BA 4G7EB 1XZAA 2W6NA 3X2EA 5JZMA 1CZLA 3PNSA 2V6GA 4V0QA 4J0CA 1LPNA 3DQZA 4ATWA 3VC3A 1TYDE 3BV4A 1G5IA 4NKCA 1EO7A 2PD9A 5D87A 5IC6A 4G07A 1WMSA 1V0LA 3S5UA 4PBTA 1Y3HA 3I73A 4H8HA 1MEOA 1T1IA 3NP9A 4U2ZA 4PZCA 3NIFB 1Y80A 2YBDA 3Q2IA 1KHTA 4LRWA 3VKKA 1MH1A 1EWYA 3EG5A 4GZMA 2Q8LA 2EBFX 3JQDA 4G0NA 3GJ5A 5ILOA 3DSRA 1PAUA 1ENUA 1N0UA 3VHXA 5EVJA 4G0UA 1F12A 2ZXQA 1RMYA 2LV8A 3OYZA 5C3MA 3VD9A 3UGQA 1L7OA 4LOKA 4JTAA 2OG9A 3KVVA 1J0CA 2SCUB 2J9YB 2GJAA 4F3KA 2CNDA 1UHVA 3GVCA 1ZBWA 2QTNA 2JHAA 5GONA 2XMZA 3L7LA 1VRVA 1SQ6A 5C54A 3ZWWA 4DG9A 4DV3B 5BV0A 1CGYA 1L4UA 3LSCA 5KOJA 2V0CA 2JI8A 1U2QA 5EGSA 5ICEA 3GU2A 5DBUA 2MSCB 1GZ4A 3GXNA 4DLTA 4GK8A 3OPNA 5J43A 1QHSA 1OB5A 1SG6A 5AKJA 5FP0A 2Y8KA 4KI7A 1O0SA 2YIJA 4BNUA 6YASA 5CM9C 4RW0A 2ZIAA 4XRRA 5KWJA 2OXCA 4N41A 3AI0A 4KR7A 4C3VA 4BLPA 2VDRB 3VBCA 1N6RA 3G79A 1QJ4A 4TVUA 1W4BA 3EFHA 3MRVA 3JATB 2V03A 1SURA 2AJDA 3H6OA 2FB9A 3DFMA 4E5SA 1ISFA 2WJPA 4KVZA 4OHFA 1KQYA 1PNVA 3NR2A 2CXRA 1ZY9A 2FMTA 4E4TA 1WZIA 1RPZA 1LDGA 5GIOE 1EC7A 2BDUA 5I07A 1AK1A 2JK1A 3NKVA 1TM4E 1GG1A 4M86A 3IIJA 4YYZA 3R6GA 2JHGA 3L0IB 1TO1E 2NWSA 2H57A 1BWVA 4MVJH 3ZXXA 2K2QB 4G9BA 1WTCA 2A1TR 5TQ0A 2BMBA 3E7WA 3ITTA 4RMHA 4CM1A 3PUHA 4ARSA 5CFPA 3WYGA 2QUBA 1E1DA 1OU0A 5CFOA 4B4OA 1Q0ZA 1HF6A 5I8PA 3UUWA 5BUZA 1T15A 2D5IA 1TPC1 2DSKA 4CI9A 5DMNA 4C05A 1SZGA 1UEXC 3RVSA 1JH9A 2NZVG 2X2OA 1XCOA 2WYUA 1WD7A 1YASA 1RE1A 1NOIA 5BSUA 4DZZA 2YZMA 1Z0SA 2BWGA 1E79D 3EAGA 2VX6A 2N46A 3ZXUB 2WV8A 2GS9A 2VSNA 3QFWA 5EGNA 4LOAA 1II8A 2IPFA 4D6IA 5IANA 1X0VA 1A2KC 1E0KA 1F6YA 4FR1A 2OQYA 5AXAA 4BMYA 3V48A 4DBSA 4BU0A 1PHWA 1XEXA 4RC9A 3BKWA 1K97A 4FYPA 4LZNA 1XD9A 3JSAA 1QPQA 3NVAA 4HXYA 3UKDA 2CK3A 3KDPA 4B0PA 4Z2JA 3B6JA 3HQPA 3ZT6A 3AERA 5JCOC 3IWPA 1L2UA 3VNZA 2J7PD 4DPKA 5DCWA 3A26A 2OOGA 3TJXA 4J76A 2EX1A 4D3YA 3LL7A 4CN4A 5DN6D 5DXFA 3QX7A 2BKXA 3BXFA 1TVMA 4ARUA 3WQ5A 4R71A 1W5MA 3VZPA 3BAJA 1NQXA 4QAQA 2J6XA 1HBJA 4KS0A 3K5IA 2I80A 4NJOA 5K99A 1NN0A 4BZXA 3GA0A 4KE7A 3U7VA 2CV1A 3DL0A 3AF0A 2YFQA 5K6AA 3HUTA 4V03A 4BB0A 2WNQA 3FTFA 3I6RA 1QC5A 2UZ0A 4ES4A 4EFLA 1R85A 5EJGA 2FCRA 4LZAA 2REXB 3EQ2A 4OV4A 1DJIA 4OLJA 1I32A 3EJ6A 4RMIA 4ESOA 4WXPA 2JIBA 2ACWA 1L4EA 2IH2A 2K4MA 2JANA 3DVQX 9GPBA 1RVGA 5C1DA 1PL0A 4XTIA 2NU9A 1UK7A 1NULA 1QJCA 4Y9RA 3QU4A 2QUIA 1EEPA 1X1DA 3U9IA 4OIMA 5DMLA 1BYUA 2Y0CA 2YDYA 3F97A 4PS0A 3UWKA 3EWZA 1N32B 1EFPA 2PK3A 2R44A 2L69A 3UT6A 1HNXB 4PRRA 4JI6B 3PNOA 3RC8A 2NAPA 1ZSXA 2Y61A 1VMDA 4GKJB 3DBHA 1EYWA 4QPDA 4RXTA 3OETA 4ERNA 2Z2YA 3MYPA 5FT9A 4JUCA 4JI2B 3XIMA 3F74A 1RC0A 4XZIA 3F5QA 2FPIA 1SVKA 4JODA 1T2NA 4IX0A 2CU0A 2VFIA 5AYBA 4UQBA 2J5BA 1VZWA 2ODOA 1YR1A 3VHQA 3PB0A 3E5NA 4Z2YA 4TZTA 2GSWA 5CURA 2EFEB 4Z51A 3HNOA 1GWNA 1T5BA 3GYGA 3FOCA 3CYVA 3CEUA 5JFTA 1UOOA 3WY9A 4JZKA 1F8UA 1I4LD 4X3OA 3PC3A 3UTDA 1I10A 5DJ5A 4OQPA 3GJ7A 3DNFA 1Z07A 2YS6A 1XEFA 3KTDA 1G7UA 2H9IA 3DBHB 3LUCA 4GR5A 5IJ0A 3RT9A 2LCFA 1LM1A 4OHYA 2XNDA 3LXMA 1IR1A 2BMAA 3EEGA 1CXZA 4NYMQ 2HU5A 2WMNB 2X7HA 4B79A 1XFCA 1E77A 4LX0A 2WJWA 4IUBS 3EX7C 4UR8A 2J62A 3HE3A 3L8GA 4XIIA 1GNTA 4URXR 4PSAA 4R1OA 4C6TB 1DU4A 3M9WA 1K1DA 3TZNA 3QYQA 2HRCA 1N75A 1JZ4A 4MI3A 1JHOA 4CGZA 1NMZA 1KGXA 2HCRA 3CKLA 3RARA 3G88A 4DNPA 4OK5A 1H4TA 1NSYA 3N2CA 4CM4A 2IRWA 1Y5MA 1S8OA 3KETA 2QJMA 5IJ0B 3QPUA 1WPGA 1XZDA 1MJGM 2A5LA 3Q3JB 2IXAA 1XRSA 3V8EA 3WN6A 5ABTA 4F3YA 4EF8A 4HRXA 2PX5A 4LG1A 2BFPA 1D4AA 2EV9A 4FYIA 2H1IA 1J2EA 1KA9F 2FIQA 1FC0A 3CVUA 1RM4A 3I2IA 1GSAA 3V1TC 2JJ2A 3R58A 2XX3A 3ED1A 3FGPA 2ACRA 1L5HA 2O2CA 1TTHA 2PGIA 5AVYA 1L6FA 5AHMA 3A9WA 3UMJA 4QGSA 3NCOA 1CE8A 5J5DA 4RAOA 5HUOA 2WKJA 2YW2A 2O2DA 4CM4B 1L2TA 4QE3A 3RRXA 2F55A 1HJVA 1WZKA 4UC0A 5D6OA 3W90A 3PIRA 3ZY3A 2HGSA 4V1YA 2PZGA 3MUEA 3G8RA 3SYMA 2ZCVA 4KE6A 1JWAB 2JGNA 1WXWA 3U39A 2HXTA 3DLCA 5JPIA 4AWAA 4GZ5A 2XUIA 1T5HX 4Q4KA 4MRMA 3MT1A 3WD2A 2D7JA 2X2EA 2O3UA 1EBBA 2ZT7A 3MV01 5CG7A 2PAJA 1SUEA 1NMXA 4I7UA 3CUWA 1E0DA 4XJVA 2JKPA 1EK2A 5TPZD 1OF8A 2WM2A 4DLPA 1CE8B 1ZCZA 3WQOA 2OQ2A 3FDXA 2WKRA 4POCA 1EPUA 4B3LA 4E46A 2XUFA 4RTKA 1Z2DA 2Q5HA 1J8VA 5A6VA 2IH4A 5EESA 5K3CA 5I0DA 1VOTA 2IOFK 2P6UA 2QCGA 2FP4A 3GDTA 1FWGC 4MP6A 4KRGA 4WOQA 3DFHA 3ZR4A 3WWCA 5T3YA 4U7FA 4RPGA 3KJIA 1Z17A 3AQ4A 3C8HA 1P77A 1WDSA 4MRMB 4DEVA 3KWFA 5FUBA 3THWB 3IE0A 3NM3A 2HVMA 2Q09A 2VNAA 2PZLA 3SHVA 3HXLA 1L8LA 2OV8A 2LDXA 3PEWA 4OHWA 2RGUA 3DFQA 2IBTA 4GCXA 2R8YA 5I7RA 3VAYA 4RPKA 1E2KA 2V7PA 1VCOA 4KSBA 2WP8J 3EPHA 4PZUA 2I8AA 4C4AA 3EUWA 3ESRA 3HVIA 1YACA 3T38A 1V6YA 2CLIA 4QGFA 3AYTA 4U2GA 2Q4RA 1KPGA 2FPXA 5TJ9A 1Q44A 3ZR4B 1OW3B 2OECA 3C0LA 3AGPA 3DA8A 4EVZA 4C6PA 3G1YA 4W9MC 1YA6A 4Z0TA 4ZCTA 4GKBA 3OMXA 2PDKA 2QEZA 4FO4A 4UNRA 4A5SA 3FAWA 1SOUA 1V79A 2GB4A 1T0PA 3CC8A 4XCXA 1ZK3A 5JMPA 1KGDA 3SC2A 1UIOA 2DHRA 4PN7A 4MPQA 2VH2A 4UTFA 1G8JA 5DSXA 1B30A 1FWDC 4HNTA 4CVWA 4RK0A 4KPUA 4O5OA 3KJQA 4KN6A 1LK5A 1FWIC 3X43A 3W2KA 2FE4A 3T44A 2OZ0A 4W86A 3DENA 1Q0PA 1XKXA 4B5XA 3ESBA 4F11A 2GK1B 3UXEA 5CLFA 3CH9A 3OHMA 2NLOA 3HR4A 1VIYA 3UMSA 3VV2A 4OOEA 3TN6A 4G3XA 5F2KA 3AIKA 4J28A 1V4VA 1GRNA 2JB9A 4QG3A 1GVEA 1NF3A 1WCWA 3ZZMA 2VC7A 1O94D 3ROZA 4G23A 3LBAA 2Y7DA 3VDNB 2OWWA 3UCCA 3I9KA 3ARWA 1CF2O 3PNUA 4B3MB 3AZRA 3LH5A 1WZEA 5HP4A 4C6MA 1RXWA 2JKAA 3W7AA 3COYA 4OSOA 2GQ9A 1NWHA 5ER6A 4Z0JA 3R41A 3ILSA 1R3QA 1R5OA 1WUYA 3JTMA 5DISB 2MSLA 1AJZA 2TMKA 3RM3A 1W0JD 4YRGA 5T57A 4GRSA 4R3UC 3E2PA 1N6NA 3K09A 2QZSA 4PRKA 1NJ1A 1ZIXA 4P7OA 1QVBA 1YR8A 3HZRA 5ALZA 2BODX 1GPDG 3C8FA 1ISPA 3NDRA 4GE8A 1WBBA 5DU2A 4WSHA 1BQ4A 5HRAA 2DFNA 1TE6A 1E9DA 1MR3F 2NUWA 2GTPA 2DQSA 2K6GA 5GQBA 1Q77A 1XKLA 4IHQA 3CZQA 1XYAA 1R0BA 3KG2A 2IP4A 4ILKA 2PWBA 1XWWA 3WSTA 2QS9A 4C88A 4JQAA 1P7CA 1O68A 5FJOA 4PAGA 3LY9A 4BB9A 1K5HA 1EP9A 2BKAA 1QIEA 2HAEA 721PA 1IPFA 3KR1A 4G63A 3I05A 2GEVA 4B4KA 5EA9A 2HKIA 4DCVA 1Y3FE 1V6AA 4RGVA 4ZCPA 4HVCA 2Q3CA 3CF4A 2A9QA 5CPNA 2VDPB 3ZQ9A 3EA0A 4HB0A 4N0MA 2WNZA 3S9ZA 4IQJA 4NIRA 3I7SA 4I6KA 4JOCA 1SZEA 1ZTVA 2VDJA 4TUFA 1W4RA 2ZQZA 5JD3A 3QMPA 3TLGA 2QMZA 2WE7A 1XLGA 1CYGA 4RX1A 2AX3A 1EDEA 4LBSA 4HATA 5ECDA 3EY9A 4K9QA 3PSAA 4JNCA 2X1UA 1BGAA 3VR6D 4MJ3A 4F5ZA 2XMSA 2YL2A 3ANLA 3ZT7A 4JJGA 4EYSA 1M7BA 1ND6A 2AH5A 5HR7A 1OSEA 4LBVA 3RRJA 5BRNA 1Q0RA 3OF3A 3VGEA 2R1NA 5B1IA 3A1DA 1VI2A 5FI5A 4PF1A 3V8VA 4DO5A 2NV0A 1U9IC 1RW4A 4A36A 3EVAA 3FN4A 2G0NA 3ZTTA 4KUGA 1GVQA 3X3HA 1KVUA 4X8MA 4OJQA 3WO8A 4S2UA 1KMIY 2E40A 4R3WA 4DV5B 2KE5A 5CSSA 3W7OA 2WZIA 1XTSA 1ZRQA 3K13A 3BOLA 4FQ8A 3TLGB 3DYMA 1FMFA 3II1A 1ZBVA 4CETA 3M6UA 2JLQA 4QUDA 4P8XA 1U3DA 1G8MA 5GIPE 2J9ZA 4BNJA 1HZZC 4JDYA 3WUGA 4WVXA 3LLDA 4JITA 1KYYA 5C9WA 2YNMC 1E6LA 1DV2A 2X6TA 5DBHX 3HL4A 1C3VA 1ODTC 3IEXA 2ZRUA 5KJ1A 3PWIA 4TVBA 4QE5A 2QDGA 4JEHA 1VC4A 1TKKA 5H1YA 3P6LA 5A8QA 1U1HA 3DTTA 4RY8A 3TEJA 3NTVA 2O59A 4QBKA 2ISSD 4KK3A 9XIMA 3R5JA 4GI1A 4KWOA 4CDGA 3AL2A 1ADBA 1SUIA 1YI8A 4R6XA 1S1MA 3RTGA 1C29A 1M6VA 3L49A 4MUGA 2NP6A 1LDNA 5L9FA 4V02A 3BSFA 3TI7A 3F9CA 2YZ5A 2WILA 4Q4QA 2G5GX 4JFWA 2WVGA 1MO4A 3H3XA 3K1ZA 1TUXA 4PPFA 3I6MA 3NWPA 1YKFA 2FZDA 4LXGA 3OU2A 1XKJA 4YJDA 4FR6A 3TQFA 3CKYA 1GN9A 4AZSA 5IDWA 2I5QA 2MSNA 4DIDA 3LN3A 2NUYA 2BHNA 2PDQA 1BNCA 4AF0B 5EZYF 2DUUA 2ZAIA 2EFCB 4QO8A 2QR6A 1XINA 1FWJC 5E1QA 1K1EA 1UWVA 1A9RA 1A8QA 2FMXA 3GLGA 3VC5A 4XJXA 1G8GA 1B41A 3IGFA 2EQDA 3VNJA 1JRLA 1NX6A 4F6LA 3KVKA 3DMDA 2VQFB 2P53A 5EI5A 5ALIA 2OEJA 1JCYA 1A8SA 1W9MA 1RUSA 2WUWE 1QI4A 1TYEB 1FVOA 4TXJA 4DIAA 4H3VA 4X65B 4EHFA 2XVAA 3GEEA 2O20A 2VYND 3C8UA 4R8SA 2AFIA 2O57A 4GIYA 3ITLA 1RM0A 4KV7A 1WEKA 5ALEA 1CC1S 4JNZA 1XUZA 3C3CA 3A2MA 3E0LA 2A59A 2O3QA 1FWHC 1R6WA 2C18A 2VT3A 2G80A 3ICVA 3GLGB 4AIOA 1C8XA 3GMSA 1P9RA 3M0LA 1RYNA 3TAOA 2CBIA 5AYIA 4N9WA 3UCQA 3WDRA 4QTZA 3G5UA 3L04A 1RQPA 1K5DA 4P61A 3B9DA 1EP2A 4TTQA 3ZCPA 5IBCA 3GA7A 4HVLA 3LV6A 3PAOA 3V8BA 3IILA 2PP0A 1DUIA 1ZP3A 4J3VA 2OVLA 2XOKD 4DQDA 3FNIA 3BZJA 2OV3A 4RFVA 3ZR6A 2V9ZA 3M0ZA 1I8TA 4DX3A 3VUFA 2FMKA 3B97A 2PS3A 2WG2A 1KZ9A 3UXDA 1HRKA 1XRRA 3EZ2A 2AFIB 2P4HX 3N1UA 1E3MA 1NFFA 4NZNA 5MFPA 2VTKA 1V8ZA 2J66A 3D6MA 3WQHA 3KQYA 5SY4A 4L6OA 1M8JA 2Q5OA 3M70A 1HQDA 4EX4A 4RGBA 1DC5A 3GB9A 2B7LA 1SHLA 4BU1A 4R85A 1OT5A 4K7YA 5BW5A 5F73A 1AVAA 2EPLX 2NXNA 3CRZA 3HH8A 4YRPA 3INRA 1THMA 1EP2B 2RHMA 3LFUA 3IRVA 3GTNA 3CGWA 3CLSC 4QJ5B 3KNZA 4US2R 2HS8A 5FHQA 3ZIAA 4NCXA 1GA4A 3SRDA 4RS3A 1IIBA 1Z9BA 4A0QA 4DA6A 1NJGA 1EEHA 1YB2A 4FOUA 2OAP1 4HMEA 1TTPA 5LIKX 4CNQA 2OYMA 4Q4RA 1NDVA 2OLHA 4EF9A 4XB1A 1BYAA 4IMPA 1R3SA 3UHOA 3RF7A 4LXUA 5K3FA 2Z5FA 3CVXA 3I5XA 2XXBA 3VVBA 1ZXLA 3BTUA 2MNRA 1CD5A 3GJ6A 4JMPA 1GGNA 4N5HX 2UY2A 4EA8A 4J7UA 2YB1A 5FD0A 1C9JA 5JMWA 2POZA 4FYVA 4I6VA 1ZBKA 3OFSA 1W52X 1M76A 1U5VA 2H90A 2GBGA 4GY1A 2RGLA 1BX3A 2DVMA 5CYGA 3VO0A 1XRNA 4YCCA 2N3ZA 3G2JA 1ZUNA 1TTPB 1QK2A 4D44A 1U7ZA 1UADA 4N8SA 3VNRA 1ORTA 3LHKA 3PN8A 1UL1X 1XZKA 4AW9A 3SSMA 3MOSA 1TV2A 1ZNYA 4XKJA 4GZ3A 3AUOA 2PPLA 4Y2GA 1ZOSA 3B05A 1P8AA 2CJXA 3AB8A 3MJVA 4PSCA 1U6IA 1Q7MA 4GZJA 4EQZA 1WBHA 2CHRA 3IE2A 1NOWA 1V3TA 3I3BA 2TYSA 1BVRA 5A3SA 4K2HA 1SC6A 3IP5A 1TZ2A 3W5JA 1KSJA 3AG6A 3W1XA 4WUTA 5HATA 4KH0A 1ZUNB 1OY1A 4KQHA 3UW1A 4WCFA 2JIZD 4GOXA 4YASA 3OKFA 3R11A 3F3MA 4EZBA 4YPVA 1KE2A 1VE7A 3UWSA 1MAAA 4O8AA 4I81A 4P08A 3O47A 4JEMA 2XSBA 3DEIA 2HZGA 4O1CA 3HKEA 1HT0A 1KFEB 2IYWA 3VBEA 2GZHA 1FH7A 3WIBA 5JSZA 2XZLA 5TGZA 4MNLA 2Y9MB 1U1CA 1KAEA 4ND4A 2QRPA 2MOKA 3MWEA 5I02A 5CGZA 2R1VB 1UKPA 2P78A 1JDAA 3SGGA 2AR7A 3FUXA 1SJCA 5JI3E 4M0XA 1MOSA 5EHIA 2MSWA 1JZ6A 2RHDA 3KQSA 5FLYA 3VNUA 5HQTA 3WJWA 3OBEA 2TYSB 4A5OA 3ZHSA 3A21A 4Q48A 2PC4A 1YRRA 4DBLC 2R84A 5FA6A 1DZ3A 4XLTA 1N5IA 3V7UA 4XCVA 4MWTA 3BH0A 3CT2A 5A4FS 4HCHA 4RD4A 4DEYA 1P2SA 5IF3A 4WCFB 5K05A 4XZMX 1SFTA 5AJVB 3AEKA 5FNVF 1EBHA 4ALDA 1BCSB 2W0MA 2I66A 2ZJAA 2BZ1A 5A2CA 3COJA 3A23A 1DBSA 1XTRA 1LSOA 3GBVA 4S0XA 2Q5QA 1M7HA 4OP3A 4O15A 3JASA 1N2CA 4H8UA 4CL8A 2X9LA 4FNGA 4M55A 1PJZA 3E7FA 4PX9A 4Q9NA 3VR4A 4Y9OA 2ASHA 4RV4A 1G4TA 4UM9D 2P9EA 3KU4A 5TAOA 3MWYW 2NZJA 3LTNC 2QM0A 2QSYA 2VUHB 2XVKA 2WJ3A 2ROQA 3GPCA 1R15A 4BBPA 1KPHA 3LCXA 5LQKA 3DPIA 3PY2A 2X0IA 4UJ3A 3RUBL 1E3SA 5ENZA 2P9YA 2ZAMA 5CH9A 2NUPA 3HNPA 2VJOA 3AEKB 5EJ7A 4OM8A 2DEUA 2P9ZA 4U00A 4GL2A 3H9EO 1OGSA 4XUGA 1O6GA 3NHZA 3FY4A 3LT2A 3PL5A 3IUJA 2Y2VA 1VECA 3CKKA 3OO1A 5ELMA 2Y3IA 1TA0A 3JASB 5IVDA 4A35A 3FSGA 2VDWB 1J8DA 4NYMR 1RCFA 4WNCA 2QE7D 1NR1A 4JZYA 2H59A 1TPYA 3L3BA 3T3GA 3EVTA 3CMFA 2IEYA 2Z2IA 3LGSA 1W54A 2FPMA 3DDMA 3I04M 2H2IA 3PXBA 1GILA 5CIWA 2XE7A 3P3BA 1EX1A 5LMZA 1JYSA 4B4WA 1RQ7A 2BTOA 2EZTA 2A3LA 3MB9A 1U0SY 4Q00A 3RLVA 2X8WA 2BKEA 2ENWA 4OATA 2WW5A 2PMQA 4MARA 1OWQA 1KP9A 3PITA 1V7YA 3TSWA 5C5CA 3AY0A 1XCJA 5FJIA 3UXLA 1GNRA 1UK9A 4ZVOA 2NQLA 4JY9A 1HR0B 1MZPA 3VRHA 5GTDA 2FFIA 3T3NA 3NDIA 3WMBA 4DIUA 2KLHA 5E7QA 3LPOA 1JSXA 5KHAA 2Z8ZA 4DA7A 2GQ0A 2XCQA 2H7CA 3BIFA 3E53A 2GI4A 5CPQA 3EWWA 4OAPA 4LVGA 1IPHA 4YS6A 2BMVA 3C1OA 3LHTA 5KZMA 1BS9A 1Z2NX 1LSJA 3WS7A 3JQAD 5DMMA 5DOZA 5F5NA 4B40A 1BF6A 1Y89A 1XICA 2OD9A 3EHEA 3I5UA 4GC3A 1ZONA 2G08A 2G40A 5B1EA 2AE2A 2INGX 4XKYB 3SOZA 1RA0A 3L4UA 1JQDA 3OUTA 3FNEA 1B8UA 3D6UA 3ZLFA 5F21A 3GFOA 4KDCA 2Z95A 3MRXA 3LCRA 3KYJB 2YWDA 2OBMA 2WO5A 3OAAA 1RQBA 4LSZA 2DQXA 1WDKA 3AXKA 3ZY4A 1Z0ZA 1GOWA 4GVFA 3S2FA 4QISA 2QVNA 1BMQA 1FWFC 3IJ9A 1B0IA 3D4NA 2BFNA 2QAPA 1UDCA 2FW8A 4KAJA 3Q94A 4FF5A 5ALFA 6ADHA 3GGDA 3D8NA 1N8KA 2PI6A 2WSQA 3NHBA 1PCXA 1H85A 3SVZA 3TB4A 2HDWA 1Z6YA 5GY7A 2ADOA 3TI9A 3EGJA 3N75A 3B6KA 4RZHA 4DMFA 3T9CA 5E6UA 3OJOA 5GJBA 4IIGA 3CTPA 4X63A 1JEJA 3VOIA 4RE5A 3DHUA 3VKVA 2V7QA 3JR2A 4PQGA 2VBGA 4JHMA 3TC7A 1RLIA 2XEXA 3GG9A 1A0DA 3K9WA 3PXAA 1JQ5A 4AZ3A 1ODKA 3MB5A 1NVMA 1E6RA 4F45A 2HQRA 5ERYA 1QDUA 4Y9NA 4NV0A 1AQMA 5HUHA 3AT1A 5B2ZA 2IYYA 3QQ0A 4Q1BA 2GQAA 5LHEA 1ZKMA 3RU9A 3CL8A 2E1DA 5DW0A 4JGIA 4QQRA 1V0MA 5ES4B 4W84A 3EODA 3DLAA 2ZRQA 1FXQA 3P67A 3HEMA 3RS2A 4D9PA 1RM3A 1XGDA 1LNSA 2YGYA 5E6UB 2PRHA 4DYHA 5JNUA 4C2BA 1WSWA 3CRVA 4RJKA 3MD0A 2DQKA 1WLYA 3K70B 1WHTA 2G5PA 4KCUA 2XZOA 2V6JA 1PFQA 1CB7B 4R7JA 1PG0A 2L42A 4GX1A 4TUYF 5M2QA 1XBYA 1NVMB 4BP9A 3S4TA 1KRBC 3ZLUA 4EG5A 1ZL0A 3KJGA 3EAUA 3GPBA 1VRCA 3PU6A 2B2NA 4LUSB 4GQBA 1FYXA 4JLJA 1W9PA 2RKWA 2R5NA 3AYZB 5HJEA 3PXEA 1HOTA 2P4SA 5H2ZA 3GLRA 4LZZA 4F56A 2ZB4A 2ZBPA 4J3WA 5P8WA 3I8OA 2HQBA 2BL4A 3RLUA 3L4BA 3O07A 4AL4A 4OHXA 4W1PA 4EI8A 1JJIA 5GADl 2YL5A 4HWPA 2V8ZA 3PFGA 1RZUA 1RRPA 3V5NA 1NYRA 3L1JA 1WHTB 2V38A 2ZXDA 3M7IA 5CVUA 2J5XA 3IIMA 2P8JA 4FDUA 2X5KO 4O57A 3BORA 3DLPX 4P9NA 1TVLA 3CYJA 1BQGA 2H2WA 2HMSA 4KPYA 5D7BA 1KAMA 4XYLA 4LEIA 4BLOA 4GW3A 3S2GA 3IRUA 4BQSA 3RYCA 1CPYA 1C81A 5BRBA 4AF8A 4U2CA 1Y8BA 1K5PA 1D4FA 4XZ9A 3DYPA 2QHAA 1OCNA 4Q21A 2EARA 2KMLA 4BNYA 1CXLA 2CXXA 1OXTA 2BEVA 2LNDA 4DUXA 3CHYA 3AEQA 3MGCA 4FBGA 4X00A 4ZYXA 4B6QA 4HZUA 1WCYA 1Z2OX 1UROA 1YQGA 2J6IA 4TT3A 1MAUA 3KJFA 4P82A 2JFBA 2AC2A 3GQBA 3T4PA 3FCXA 1YQEA 1Z39A 2R1UA 3PRKE 2Q4TA 3LT0A 1YZNA 2YPIA 4JCOA 5CZ0A 1SWVA 2CUNA 3SECA 4XD7D 1T1RA 4KB5A 3BQ6A 3PBYA 2NU8A 4GM1A 2FPGB 3LUHA 4COKA 3PC8C 1DIOA 5BOSA 5TMPA 1V7PC 1JYXA 1H3NA 1I4OA 3DERA 3DHDA 5LQSA 3URBA 2EU8A 4ALMA 1I6LA 4QFMA 3GEHA 4J75A 1U2PA 5DP2A 3AEQB 3KBBA 2NU7A 1YDYA 4AO6A 4UTTA 3QM1A 3TD6A 2F2KA 5M2FX 3ITDA 4HZUB 3DE0X 2A4MA 2CW5A 4DBLE 3OQMA 5T41A 3OD1A 4Q02A 4RK4A 1NDQA 4CQNA 3GQBB 3WYNA 4ZGGA 2JJ1A 3WQGA 3O2JA 4ZYUA 4DW8A 2WHRA 2WWDA 1WXGA 4F92B 4IXMA 1H2JA 3WYFA 3TQVA 2ZRJA 3N6HA 1JI0A 2M32A 1F5SA 1DIOB 1V6XA 2E9MA 5CFNA 1O6FA 2JBAA 2Q62A 2VHYA 1G9SA 2YDRA 3VD7A 1RBAA 3FH0A 3GFGA 3BB3A 2WHKA 1PSZA 3FPBA 3P2VA 3ELUA 4HSEA 1B73A 3FKJA 4HO1X 2NU7B 5C9RA 1E9BA 2V67A 3LHZA 2HREA 3AUXA 3IVMA 2B0MA 3WQ6A 2HCBA 4TTVA 1IR2A 3USES 1XLMA 2PXHA 5F52A 4HTAA 1P6CA 2JIWA 1U1EA 1UP6A 3HXPA 1XRMA 3K5HA 4UM5A 5J4VA 4U5KA 2J3DA 1LGYA 3E8XA 1J2RA 5EJ2A 8ADHA 3NBUA 3TAKA 4D0SA 3FMPB 1V5GA 5FXMA 4KWVA 2GHRA 4WAUA 1XQYA 1UMCB 4JTUA 3FB4A 1P4HA 3GR4A 4CYMA 2JBAB 5DI9A 2JGRA 3T1OA 1Q1QA 4MOZA 2JCYA 4UTIA 5FCDA 3D0CA 4D9KA 2E7ZA 4X97A 1R6BX 3QPVA 4OFZA 4UBIA 4CQBA 3OVQA 1KKMA 2DZXA 1YKGA 3LXAA 4MAVA 2JH3A 3D0QA 2ILVA 4IKOA 2VNCA 2ECFA 1VC2A 2FUKA 4GCAA 4CMEC 3CG0A 1DMRA 2B31A 2QTZA 3CAQA 3RM8A 3ESDA 3HJEA 4JJ8A 3A70A 4IFOA 2XFWA 1D1SA 3OHIA 3IUHA 4LGMA 5GVRA 3I6EA 3SC3A 1TJYA 1XYYA 2E25A 4FOPA 3O3NB 3WWEA 4TWIA 1DARA 2G4VA 3DBIA 3TW6A 2JHCA 2GCOA 1RT9A 3OOYA 1DKMA 3W82A 1O0BA 5JRJA 3ES8A 3NKFA 4DF2A 2H9AA 5IP5A 2PKCA 3EX6A 4BQOA 3EZYA 2Q7XA 2DUJA 3ZBPA 1POWA 3KSZO 3BAZA 3HCBA 4Q32A 4MQFA 4MWCA 1KKLA 5FOWA 4PTLA 2YDAA 4FALA 2HS6A 3P9XA 1MXGA 3VYUB 2VH1A 3G68A 3AUJB 4CCEA 5B6JA 5C5EA 5K8VA 2A57A 1XZPA 3POHA 2E4XA 1NKSA 4UM7A 2HL6A 4O16A 2JE8A 3WEMA 3ZS8A 1Z4KA 3VGHA 4OA5A 3T05A 4YUAA 5JYCA 1NT4A 3VOTA 3D59A 3A4AA 1X13A 2CHOA 3EMVA 4OG2A 1YJCA 3TVDA 2O56A 2C29D 1GG2A 5FTMA 1G4HA 2H9AB 1JNYA 1A96A 1D2CA 4J9VA 4WQMA 1N2JA 1E3WA 3IPRA 1QHHB 5AHIA 3SUTA 3VDBA 3F1LA 4MQFB 4D6GA 4HAXA 4BQRA 1SJDA 4YJ2F 4ZT6A 1LPMA 3VDXA 1WAUA 4UBNA 1LI4A 4NDAA 4DRXB 1J8QA 1UBNA 3CW8X 4FFDA 4PLHA 2DZTA 2Z1VA 3H5OA 2PDHA 2D8MA 3W7VA 4YRTA 1GLGA 1GPKA 4O2AB 1JU3A 4Y2UA 5BQXA 5D8DA 3WBFA 3F4NA 1QE0A 4QQNA 3BF7A 4EUEA 4F0MA 3ZWVA 3RG6A 3AILA 1KK2A 4ZJYA 1O95D 1GPLA 2OOFA 3OCVA 4YJHB 4DO4A 1ZCAA 1A50A 4WQ6A 5JECA 4DCPA 3ROPA 3S0JA 1Y7HA 4RPHA 1TA9A 1W6RA 1PIFA 1RV8A 4GJIA 4BTEA 3HV8A 2B82A 1DQUA 1EFAA 1RZMA 5CSYA 4HT3B 5KCMA 3L5OA 1E3WB 1SKAA 3RX3A 3N12A 4DZIA 4MI1A 3SADA 1HDIA 1H4PA 5TIMA 1C3XA 4EDFA 1PQYA 4EW1A 4W8GA 2Q3DA 3NOYA 1U9YA 3VNSA 4OLFA 4EQ6A 1J7JA 4LF1A 3LRXA 1WMDA 3KL4A 5J59A 1N7KA 4PMQA 5ESRA 2PMDA 3WMLA 1VYHA 3OGRA 1VFFA 2WF9A 3FHAA 3TTEA 1YS1X 2REBA 1B93A 5CZSA 2RGYA 4MZDA 2CUZA 2DSVA 4IHJB 2ODBA 3L6DA 4KAXA 2FSUA 3LRTA 2Y1GA 2O5CA 4LF8B 4F66A 3H65A 4C7OB 1C41A 5JIWA 5E4YA 2DQZA 4RH3A 3V7PA 3B1XA 1RHRA 4J16A 1HPLA 2IX3A 3LMKA 4YV2A 4QEZA 5L6MB 3AONB 5JXIA 2XWSA 4GPNA 4YYEA 4DVJA 3RUAA 3C2FA 4IQLA 4U1RA 5L4NA 2VDLB 4RD2A 2CJFA 1HFKA 1PVNA 2VP3A 3UJBA 4V33A 1V4NA 1P18A 3ZCXA 4S1TA 4BF9A 4I4IA 2GJ4A 4DYKA 2XQJA 3AUAA 3UBMA 3IP3A 3P8IA 3ONDA 4UJ5A 3BB4A 5HILA 1KXVA 3M89A 2P3QA 1M73E 3QWAA 2YOGA 1BD3A 3WDHA 1XNHA 1INLA 4ENVA 3I3SR 4K28A 5I7SA 3N2MA 2PLWA 4GYPA 1FNCA 2SFPA 4RBNA 1XLVA 3TZFA 1Q3TA 2Z7KA 3TPZA 2SBTA 4C4TA 3DYVA 2A21A 2X05A 4XVHA 3OP2A 3OEEA 4Q9DA 4AMYA 2BBFA 2QN2A 3KWLA 3IELA 2YJTD 4A91A 2E28A 1N9GB 2ES4A 1C0KA 2I4TA 4AY5A 3GXBA 3UWPA 1P0QA 3JQGA 4ZVKA 2I33A 4EMUA 5FQOA 1XVIA 2GEBA 1G55A 1SCKA 1M7XA 1PE0A 1VIMA 5DHUA 3QBTA 2QK4A 3AHGA 4GLBA 4BV3A 4RKYA 4HEJA 1KLZA 3R8HA 1CF4A 4X6YA 5L9AA 2W2MA 4M7SA 3FYUB 4PLPA 3RRYA 4NCIA 5CEWA 4F2TA 4ZJZA 1L5OA 1MB0A 1UBEA 5IG2A 2E4YA 2EJCA 1P4GA 3I2GA 1U0GA 5TC4A 3L1IA 4K7JA 3LY7A 4Z4FA 1MQQA 1SR0A 3DPUA 4CN6A 1E98A 5K6AC 5GV8A 1NW5A 3WD4A 1E0JA 2QWXA 1XGKA 5EXEA 3JQGB 2FMFA 3ZX5A 1WZ2A 5C7IO 2WVJA 1W56A 1IN1A 4PSRA 5DM70 5EGRA 3UJCA 3K2QA 1W5EA 3OE7D 1EQ2A 3D0KA 3WXBA 3FMIA 1MAVA 1GKPA 4ZIRA 2O0LA 3B6IA 3I9JA 4MADA 4FN4A 3BREA 4ZV9A 4AUEA 3QSYA 2E89A 4NBKA 3NPXA 1TV5A 5JXJA 2Q2NA 2CFIA 3V8QA 4N48A 2BDTA 4XG1A 2JCXA 1FVHA 1O96A 1E1QD 1EXBA 1UR4A 4N7RA 4FGUA 1QIIA 3KQMA 4J0JA 3W7IA 1FFWA 3DYOA 1IBSA 3LC0A 4F9EA 3FEMA 4F12A 1BWLA 4BO6A 3PZUA 3V8NA 1E1NA 3KAJA 3GXOA 5JLJA 3BWDD 2C4VA 3OIGA 3P5SA 3LCFA 1M0WA 3FSTA 3SEFA 1ZP6A 1N92A 1Z16A 4QXAA 4KEVA 1SJAA 2QAGB 4DHWA 4MHBA 3I6BA 2YJZA 4IGEA 3KX2A 4BXOA 5CPOA 1AGYA 4ZIRB 3TUJC 2AXNA 2W67A 3H04A 6CHYA 3TOSA 4EWND 2Z9CA 2J48A 2FMOA 1VP3A 2A7PA 1JP7A 5P21A 1POJA 2FZMA 4C6HA 5IZCA 3KB6A 3FYOA 1DWPA 2EFYA 4OI1A 2HV5A 5HRUA 4AT1A 3WK7A 3AU2A 1VE1A 1DFGA 1B6TA 4AJIA 4IPPA 3UPWA 1GQYA 2HE5A 2B6HA 4BFVA 4NYYA 2ZIXB 4COOA 5AVSA 3UZ5A 2VJQA 2ERXA 1EVLA 2C5FA 3TW7A 3PR2B 1PR0A 3LBYA 3V0UA 1YKSA 1RSCA 2E4TA 5CC3A 3TDFA 1HJXA 8ABPA 3WGYA 4L4UA 3UN1A 4BXOB 4EY8A 3RFCA 2P7HA 2B4YA 1LF1A 3I0MA 4FNMA 3W70A 1S5PA 3IAM6 3OSUA 4Q4MA 5IH3A 2R8EA 2Q7OE 4GPAA 1ZENA 1ADSA 1IJEA 4CXMA 4R9NA 4KX3A 4H18A 4K9RA 2DFAA 3AYRA 4ZMGA 4OHUA 4EEXA 5BR4A 3WISA 1AB6A 1LDCA 3WK9A 1U7PA 2OZTA 1GDTA 1TCAA 1QI3A 1Z28A 3NC1C 4NL1A 3AW8A 4QNEA 3IAHA 3VHXB 4GX5A 1IZ9A 5H68A 2PQ0A 2V97A 2WSRA 4M19A 1R10A 5KU1A 1JWBB 2IIVA 3GG1A 1H5NA 2HLPA 4E3WA 3NIBA 3CNOA 1T9DA 4AIUA 3D3JA 3TQQA 3GUCA 3S2MA 5FI1B 1WO8A 2R00A 1E7WA 2BUCA 5GONB 1TLLA 1VLWA 1Z44A 1SVSA 1A5LC 3UH1A 4A4DA 3DVSX 5JYEA 1U0OC 5KOJB 2FGJA 3W2NA 1A82A 1L6RA 1XHEA 4LXQA 1Y6ZA 2QF7A 2QZPA 4YMIA 1Z0AA 2X9NA 3E2VA 1TZKA 1J79A 3OQ1A 5C2JB 2BEJA 1NW7A 4GBMA 4G6ZA 3M1AA 1V6CA 4IV8A 1LUAA 4IRUB 3JW7A 4FF7A 4XVUA 2ZBDA 3O03A 4IH1A 1U63A 3KZ1E 2ZXUA 2JF7A 1J8MF 3KE0A 4MXDA 4PGGA 1DDGA 2YXXA 2Y5JA 4F4HA 1E8NA 3NVTA 1U80A 4KBXA 2WU4A 5CFRA 2XQKA 2YWHA 3NYQA 1GPFA 1J8FA 3LLSA 4IXDA 1DRKA 5DXJA 5ARDA 4RTRA 5HDQA 1UBFA 1R30A 4ZCQA 3OZUA 1SHKA 1DX6A 4AY4A 2F38A 3MSCA 3NHFA 3TROA 4UXDA 5CB4A 2NX1A 1S2VA 2V45A 2NVUA 4DAIA 2E77A 3CE6A 2NTEA 5H7XA 1G5AA 1KFJA 4RF4A 1XLAA 2CVQA 5TQ0B 2NPFA 2D73A 4JTJA 3A9CA 3JZIA 1V5XA 5CG0A 4EATA 4F3TA 2YZRA 1BVNP 3AR5A 4KGXA 4ND2A 1T34A 4GZ6A 2NO9A 3M16A 4JL6A 1SN7A 1DQXA 2GM3A 4KFOA 3IUPA 2YIVX 5BV7A 1ORIA 3EOBI 5FPTA 3MS8A 4UEJA 5C51B 3VR5H 2VATA 2QU7A 1SSDA 2J7KA 2GK4A 4TS1A 3MCVA 1Y4UA 2EKGA 1Q6RA 3BMNA 3P52A 4I4NA 3SHWA 3DFFA 4A2PA 4Y98A 1RR2A 1II8B 4UBJA 1TYBE 2Q1SA 1U8CB 4OXXA 2V3WA 2NVUB 2MYUA 4BZPA 4IZ6A 2PSDA 3TM4A 4BN4A 1WU8A 1KFJB 3GN1A 3W7NA 2G3JA 3KVJA 1WULS 4L4RA 2Y7FA 1ZFJA 5G3ZA 4QLOA 1YVRA 1RP9A 5A5DA 1XEXB 3HZZA 3PTQA 2DY1A 4QECA 2ZUUA 1W2GA 4RJTA 2DEPA 2IA5A 1JKIA 2Z0MA 1BDJA 4NNJA 2H17A 3UF0A 2ID9A 5F76A 3ORQA 4UZFA 2ZDQA 3AERB 4OQYA 4S3KA 1L7EA 1CRQA 4KT2A 4GKKB 4JYPA 1ONSA 3KPUA 3STHA 4OFCA 4EJFA 1MIHA 1R6VA 2Q6ZA 4KE8A 3BVPA 1NDZA 2EHJA 1BOFA 3EMBA 3PPIA 2NYVA 4EJ6A 3G8YA 4WUIA 1YNYA 4CM3A 1BE0A 5JHHB 3FTQA 1NM9A 2FTPA 1CUIA 4MV6A 4EUFA 3AWOA 2NQJA 2BY0A 2WYWA 4RVFA 3FYSA 3AY3A 5HOSA 2PMBA 5FPPA 2F84A 1MX5A 1QC5B 2Q8QA 2QROA 2VFHA 1P0DA 1TZJA 2UU9B 4US5D 3UXAA 3TZ6A 3GUWA 2J0SA 1W34A 1AHIA 1OFIA 2P9JA 1GT8A 1P91A 2WAAA 1H9CA 3OM0A 1J9GA 2VR5A 5DYGA 5KPJA 3UJNA 1EWKA 3E82A 5JARA 3A4WA 3RK0A 2JJYA 4PC1A 5JSFA 1XP3A 2B7NA 4L0CA 2PL3A 2NU9B 3DEHA 3ZJ7A 4ARIA 3OA2A 5EEGA 1WZCA 5LJIA 5HCUA 1J4EA 1EFPB 1CSEE 5E9JA 4RZ5A 4AF6A 3PPHA 4I36A 1T3SA 4G1CA 4M81A 4UREA 4AH7A 1BXNA 3K09C 3OJEA 1S3IA 1SKUA 3R10A 5BUSA 1G41A 1Q6OA 1RBYA 1P0BA 2DSUA 2VHXA 4UTWA 2FPIB 5DHTA 2J7HA 2P2GA 3OIVA 4ICNA 5KQLA 4OX9Y 4MIYA 1LROA 1ZHFA 1H09A 2QR3A 1REQA 1KGSA 3NDYA 1O5QA 1OREA 4F40A 1HFBA 3KEFA 4BQPA 4INJA 1P5ZB 3TLEA 1FW8A 5CC7A 1XWIA 3I4LA 4CHTA 1SUAA 1B31A 3E0IA 2B1JA 5JH7A 2JHPA 3CIXA 3M47A 4IL0A 3G23A 3AIIA 3THXA 4GMKA 1JDFA 3EXTA 1E7RA 3V34A 1FYEA 2UVDA 3W3ZB 5FDFA 4EX6A 5IF9A 3IK4A 2C3PA 3D8RA 1MLDA 5SYNA 3DBRA 3R75A 1I2MA 1GWJA 3LVFO 4WDXA 3QH4A 3S1VA 1KO0A 2NW6A 2OC4A 3L9XA 3LCWA 4EFMA 4J1SA 1IZ7A 4I7EA 3T3EA 4GYWA 3HDGA 1JR1A 4GFSA 1A3HA 5ADUS 3HDVA 4AHQA 1MFZA 2D20A 1M2FA 1EHIA 1C1DA 1GKIA 1GV0A 4AYXA 2GYUA 4PO3X 1X1EA 1R0XA 5I7OA 5JH7B 9RUBA 1KO4A 4J4TA 3SY8A 3RJTA 5H82A 3VI4B 2O8BA 5DRIA 4Q01A 5AYVA 3LRKA 4R1PA 4MKSA 3WP1B 1TQ4A 5D8ZA 1JHDA 3R6TA 2GFIA 3E48A 1HDRA 3OBAA 5LXXA 3DBRB 2R8BA 1Q84A 2WG1A 3BG9A 1A80A 1XRSB 2OQHA 3CVOA 1MZRA 1RZVA 3FY1A 3MQ4A 2ILTA 2JFWA 5A4KA 1LI5A 2AOVA 3K0HA 3LMYA 4XE5A 2ODAA 4GOMD 3PYMA 1QRQA 3ZU5A 3UGVA 3G6KA 2FH6A 4JSTA 3PJWA 1H8HD 4XAYA 6REQA 1L5HB 2NP7A 4B71A 2LE0A 8OHMA 4DXXA 1VPVA 3HGTA 2VZUA 3HJGA 1ZC3A 2VP9A 5BOVA 5LZ4A 2RGCA 1ECCA 1BJKA 2QRNA 3R3JA 4EY3A 1W0MA 5FACA 3UAYA 3CLWA 1AO3A 4JSRA 5IM4A 1EGZA 2PQ6A 5ARBA 4LBWA 4AZBA 3JW8A 2I4OA 2QTLA 4IFIA 1S8AA 2JPDA 3PWSA 3HMJG 1QQ5A 1D2EA 3IQIX 2FPOA 3RJ5A 3NQ8A 4K0KB 3AI3A 3N04A 1JCLA 1XI2A 4CD5A 4AUBA 1GO2A 4D4JA 1HEIA 2I71A 2PGOA 4OYYA 2GLUA 3FHCB 1OD0A 3R7MA 1EVYA 1IFXA 1U0EA 2F1HA 1VPEA 2ZI7A 3STUA 5DTQA 4HY3A 6REQB 1U1DA 4AZGA 4DMCA 4JL2A 3EPKA 1JUKA 3NOXA 2GL5A 3VMOA 1QG4A 4ZN6A 3T81A 3PGVA 4IIEA 3VGFA 4OHOA 2DT1A 3VE7A 4HEHA 4ZVMA 4I1RA 1KDPA 1QDLB 1H5UA 2XNKA 1ZHHA 1Z13A 1UZNA 2VQ6A 5LSMA 3POCA 1QYCA 1Z5UA 5FPSA 3N3BC 4ZDJA 3T0DA 4IXWA 2FP4B 3QPAA 3ZE6A 2BYTA 5PNTA 4GZIA 3C97A 5DV9A 4WK6A 3S8YA 1DX9A 4RKEA 4NJJA 3BVJA 1EVKA 4HX5A 4AEFA 3FBGA 4F72A 4B7AA 1BZYA 4DZ5A 1E6EA 4HQVA 3LYEA 5LXEA 5EP4A 3RVMA 3ZIUA 1FHLA 3SM3A 5AK6A 5HK4A 2FOLA 3L4EA 1WY5A 4B15A 2CLIB 4B74A 1QR2A 4PCUA 1SOMA 4FLEA 2ZTJA 3WH6A 4BY9E 4QS6A 3SJCA 3GLUA 1H6AA 3VGJA 4RV5A 1W4LA 2VHLA 4MKZA 1X9GA 1VJIA 4OI4A 4K9DA 3CSUA 2H3BA 2LP4Y 4KO8A 1YB5A 4Z86A 3FGZA 3LOUA 3M83A 3ND9A 4IYJA 4PHCA 4U0KA 4FTWA 5KAMA 5CNKA 2GSEA 5K8CA 2DHEA 2EJBA 4J3XA 3D8SA 3SC2B 1IXPA 5DNCA 4UXHA 2PSEA 4ZQGA 5FWDA 1FFQA 3VPAA 2BOFX 4KPUB 4BPRA 1JBQA 4RIEA 3NIYA 4DMMA 3WL8A 1B3RA 2R751 4ZE4A 1P3DA 1CZOA 2F59A 3H7VA 4EHHA 4QXOA 3TNDA 3HLKA 2NT0A 3OHMB 3D4BA 3Q41A 2P77A 3PPCA 1DJWA 1XXHA 1NRXA 1M0EA 2AIRA 3M3PA 4Q7LA 4DG8A 5B4TA 3CW2A 1A9XA 3EKGA 1EZ2A 2AQKA 3F1QA 1ULBA 5AVNA 4W82A 2QV5A 1EGQA 3AF5A 1BW9A 2AE1A 3KZNA 2W4XA 1ZLYA 4L72A 4H6EA 2VTDA 1PEDA 1ONWA 3K9NA 1U11A 1OBOA 3T7CA 2J87A 3MDWA 3EMZA 5AKQA 2C2HA 1XCLA 1EAMA 2MDTA 4PNHA 2Z00A 4B7UA 3SEZA 3AHYA 1F0NA 1TQDA 4UU7A 4LBYA 1OT2A 3JVUA 4N7JA 3MSYA 4Q7BA 4BGIA 4FSDA 1MO3A 1S2AA 3PAJA 1CUDA 2XDAA 3LPLA 4O50A 2JEPA 3N39C 3OG2A 5C7HA 1ACMA 4URYR 3D3EA 2HLDD 5DX7A 1NBIA 5A6LA 4MP3A 3A3PA 3BICA 2XNHA 2ZATA 3Q88A 3RGWS 4JPGA 3L0NA 4BVEA 3T2PA 3DOIA 4QSMA 4PWYA 1X7GA 3S8HA 2CZQA 4MCHA 2NSLA 2Q6VA 1HYEA 2PRZA 4K3UA 2VEPA 2J3IA 2B25A 2Z4RA 5ESDA 1CJUC 2V98A 3K6KA 4BV2A 5H91A 3U13A 1Y4ZA 2HOQA 3ESCA 3IV8A 1LYXA 3G1HA 1HG3A 2D5BA 1XL0A 4L1GA 3LLMA 5LQUA 1OABA 3O73A 2UXDB 3TN5A 2VJPA 4GSLA 2VSFA 3RC1A 3GTFA 2J31A 5LB2A 2X23A 2DPEA 4HDSA 2FN9A 2PY6A 1M66A 4I9AA 1A5BA 1Z74A 4NE7A 4Z9YA 2AC7A 1F4LA 3ARPA 3SS7X 3IAM1 1K77A 3SCQA 3MBDA 1XHGA 1XHFA 4N3BA 3AIWA 4WD3A 4FJ0A 5DMHA 3I61A 5HJYA 3EZ9A 4A8LA 4EMTA 4ZQEA 4OKIA 5E7MA 3VSDA 1BG6A 3KKOA 4WCFC 3UMFA 1N77A 3WEOA 3A36A 3KLOA 2OYRA 5IFTA 1D0IA 4YT4A 2W43A 4AJPA 1KXJA 1Z22A 1EX7A 1BCRA 4KTVE 1YCFA 5IKMA 2EG9A 3H99A 1R9GA 3C3YA 2FEWB 1WXQA 4P3XA 3VIPA 3IJEB 4ZO7A 3OU7A 5CX1A 4H2CA 3M0EA 1XA0A 4HDSB 1FF9A 2IW1A 3BLFA 4HMNA 4G0YA 4CNTA 4B6GA 1A5BB 1H0SA 2REQA 2J9ZB 1CJKC 1VHLA 1V37A 2GM9A 4WY0F 1KSGA 3VH1A 2PDMA 4GMEA 2V0GA 3BW3A 1NQWA 3NU1A 1L1RA 3N9RA 1OE0A 1FYDA 2DCUA 1C92A 2OQVA 4JJZA 3W6NA 2ZRFA 5T8KA 2Z4SA 1UPBA 3RIYA 2QI9C 4HA3A 2V2DA 4UAJA 3TTQA 3FUUA 3OBBA 2IXGA 4UOJA 1S7CA 4L61A 5CITA 4KEMA 2VPWA 4G4JA 2QQGA 2Q1WA 3LZDA 3ITNA 3F7MA 4DDTA 1GRRA 3KXDA 3SHTA 1B3YA 3HV0A 5CX1B 1C29B 1M6VB 2P67A 5H1WA 2OAGA 4LDZA 4RKAA 1O54A 2N47A 3WK2A 1OJXA 3PB3A 2Z6JA 3PHCA 3CHDA 1ZD8A 3BCUA 5CTAA 4OCZA 3MMTA 5I9LA 1V3KA 4BQNA 1FCUA 1ZB5A 3QA9A 4U6NA 4P4NA 4ML4A 4GDMA 1A69A 1W1A1 1UKCA 1X80A 4HNGA 1PL9A 3UPDA 3OIXA 4IG4A 1JVNA 4PCVA 5JTUA 3WFJA 3QKEA 1E6SM 5DF1A 3PUVA 1WUKS 5FBHA 4R2LA 4MUJA 4L9YA 1DCFA 2H65A 1I2CA 3WQ8A 1H22A 3OG9A 3EGWA 2ZSJA 3L9WA 3RABA 3AS3A 3ZXYA 1M7OA 1QLHA 1U3UA 1GNXA 1FE8A 3F5KA 4RF2A 4C1NA 2ZSDA 3AWIA 3DMFA 1YZ3A 3SZLA 1U94A 4US6A 4LY4A 2Z43A 1HYHA 4WNAA 4O25A 5F5XA 1MOPA 3HU1A 2I1WA 3CCBA 3D1VA 4GX8A 4JSYA 2GM5A 1LJYA 5J4KA 1P1XA 2GARA 4KE9A 1J96A 2ZFAA 4DWSD 4HXEB 5BY2A 1U5BA 1FCJA 1X80B 3GRFA 1NQVA 3QBEA 2B7PA 1P0PA 4ON9A 4CLOA 3CB4A 4RYDA 5HWNA 1BVZA 2AV6A 4A6PA 2VEOA 1D04A 4Y3UA 4EPKA 4R2IA 2QN7A 4QFUA 1RJGA 5HGXA 3D5EA 4QNNA 3GSMA 1W19A 6ABPA 2PYDA 3A1VA 2EEPA 4F48A 3ZE2B 5GNXA 3ISTA 5A4DA 4X2PA 1GCUA 4C1NB 2HMWA 3D2BA 3GLIA 5EHXA 3DMTA 2ZR8A 3KE8A 4LQ1A 1EDOA 4ZB0A 2NWQA 5BZAA 2ID4A 3CLTD 1AUSL 3WQPA 2PDFA 5KTYA 4WDRA 5JEDA 3GLGE 3FFXA 2QVBA 3ZI0A 1TC2A 3B9AA 1CB2A 1J1IA 2A9FA 2FGKA 1U5BB 1VI6A 5I4CA 1XVVA 1FUEA 4Q34A 4MQBA 4CLOB 3UJRA 5L6LB 4UPDA 1E5JA 3PF3A 1Y1PA 2I5PO 3FCUB 3QK7A 2BW0A 3N7AA 3RCYA 2HSJA 4LVFA 2HDOA 1XU9A 4LF2A 1U9CA 4AHOA 5HX7A 1P60A 4DR3B 4JBNA 2AZXA 4RL6A 2OUIA 2J24A 2IY9A 2HWYA 3RTBA 4ZODA 4JB0A 3C4VA 1NY6A 3VPDA 8A3HA 3GLIB 1N5JA 2AFIE 2CLOA 3C8DA 2YHSA 4CN8A 3ZWXA 2AEMA 3HJAA 4CIVA 4HWGA 3GAZA 4KBGA 1VSBA 1UR9A 3R9KA 4YBZA 1DMSA 1JEAA 1EJRC 4IR7A 5HUQA 4G85A 1OMOA 2Q8ZA 1PGQA 1QAMA 5FO1A 3VPXA 4EPYA 4LXIA 4ZOBA 3ZIDA 3ZJ8A 3NJ4A 2OCPA 1Z68A 3FBTA 3R25A 5ECUA 2VHJA 2FW1A 1ENZA 3ZGXA 3BXOA 2ZJ1A 2A3HA 1G6OA 3RSOA 2ZJBA 4NC9A 4WD0A 1QWKA 3BWEA 1JDNA 3DOPA 5CBPA 5CH8A 3K70C 4IUOA 5EP3A 2G5TA 5FWYA 4DGSA 4TRMA 3VAAA 2CLOB 5ITWA 4QPPA 4S1FA 4KQIA 3UMRA 1JU9A 1RBLA 3V5OA 1VJ5A 2X4GA 1JFVA 4EKYA 3H1TA 5H3LA 5K3FB 2BHYA 3DD5A 2PR7A 4AZCA 2PJZA 1HKJA 1EFCA 1Z5NA 2BBWA 2YHIA 2AQOA 2G83A 3GC5A 4HQOA 2VD8A 4CPDA 3LQ2A 1RWOA 4X91A 3GXPA 2YV5A 1JAHA 4AHPA 3BXGA 4Y9TA 4JLOA 1DO0A 4C4PA 5HF8A 1Z7AA 3JVDA 4N6GA 3NTLA 2O4QA 2GUBA 3PE3A 4F9GA 5DI3A 4FOLA 4EW2A 3FFTA 2YJQA 2IDKA 5CBPB 1XYGA 4LTNA 4NZ5A 3FDJA 3DL2A 3CRNA 5FWYB 4YAEA 2QY6A 1QOZA 3KR0A 1Q3HA 2H63A 1G5RA 4CZ2A 1QASA 2PSHA 2JH8A 3VHLB 3DG9A 4K6OA 2C3ZA 4DIEA 4C0WA 3PFCA 4AZCB 4YREA 2OCAA 4A23A 4IIUA 1DE6A 4F9JA 3N2IA 3OQJA 2Y0DA 4AZ5A 2JGLA 2VEDA 3KFXA 2DKOA 4B5KA 1CUYA 1KH1A 1W44A 5EQTA 1Q6QA 3W22A 1AH3A 1X15A 3KM0A 1E6NA 3Q8XB 4P1ZA 5T4EA 2DMRA 1YGPA 3VO2A 1ZUIA 3CPHA 3MA0A 1VM6A 3E3LA 3L4BC 3TDKA 3VE9A 3BG3A 5DI3B 3ZJTA 5AIAA 2AL2A 4JVMA 3NH9A 2IHJA 4NILA 2R11A 1SPQA 3DNMA 3NDZA 3SIMA 1OT3A 1JL3A 3PK0A 4BV9A 5HDRA 3HKEB 1G3UA 2QIIA 3C5HA 2ZUCA 1E3ZA 4OBSA 1G2PA 3H18A 3AO0A 5JSZB 1TT5A 4GE3A 4UQ9A 3MWEB 2IDZA 2AXEA 1CLXA 3NQCA 3H4GA 3TD9A 4GXRA 4RE0A 1RJDA 3NEJA 3AVTA 4DUWA 3U3XA 3IODA 2BBSA 1VHNA 4WBSA 3QKRA 4I8DA 2RDWA 3OGVA 5KYTA 1I0LA 2O8CA 1J93A 2GQ8A 2G67A 1NFPA 3FNRA 3BH4A 1SCAA