5EMKA

Crystal structure of prmt5:mep50 with compound 9 and sinefungin
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
b'RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emkA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emkA02
3DH0A 3HVKA 2FK8A 2VZ9A 3NWBA 2P35A 4DF3A 3KHKA 4C04A 3HA5A 3NJRA 5EQJB 1N2XA 4ER3A 5DTMA 5IH3A 4E2WA 1UWVA 3VNKA 1GW9A 3KPUA 3OU2A 3M0VA 2DPMA 1XYAA 3OZTA 4E70A 2G71A 5U4XA 3GNLA 2ZDSA 4FSXA 1MNZA 4HTFA 3VNIA 1VL5A 1YUBA 2GLUA 1QTWA 4J4KA 5C9ZA 2IIPA 3LHDA 4RX1A 2Z6AA 3Q87B 2PY6A 3CBGA 4IWNA 3FUWA 5K09A 1TPYA 4RTKA 5K05A 3MCTA 4M38A 3UA4A 1X1AA 3FRHA 4KIGA 4R8RA 1VP9A 2C7PA 1FP1D 5JUWA 2PX5A 5GWXA 5EEHA 3KBSA 2NQ9A 4HHLA 1QYRA 4ER6A 4A8NA 2IH2A 4X63A 5B1SA 1O1HA 1XIBA 5EHIA 1NW5A 2GA9A 2ZTHA 4KW7A 1KYWA 1M6YA 5EZSA 4QVKA 3TKYA 3DOUA 2P40A 3DP7A 3UFBA 1AQJA 1L3CA 1ZHFA 1JG1A 4QVGA 4YTQA 4RTLA 3ITOA 2C7RA 3C6KA 1CLKA 4GBED 2AR0A 2PGXA 2OU4A 5FWDA 2G70A 3LPMA 2EG5A 3RIEA 3LKDA 4BP3A 3UJBA 1KP9A 1XCJA 4PGHA 1DE6A 3FUUA 1WG8A 2PBFA 2EJUA 4ZB2A 2O57A 5EHGA 2PX4A 1YB2A 3G2PA 3BXOA 3PLAE 1YF3A 1XLMA 2XINA 3BKWA 2ONZA 1XYBA 3SM3A 3FTEA 4PYJA 3BT7A 1DIEA 4DVOA 2OZVA 3Q7EA 4FSDA 3UU0A 2UYOA 4LWOA 5MHTA 2FYTA 4EKGA 3GNXA 3OE5A 3DMFA 4CXMA 3OPNA 3P9IA 2PX8A 3FPHA 4XUEA 3CWHA 5DXJA 4HH4A 4PYMA 3EVZA 4DA4A 1AF7A 4GJJA 5EZQA 5K0GA 3O4FA 2ZBPA 3T7SA 3EMBA 4QPNA 5M5BA 3KPYA 3E23A 1DCTA 3P2EA 1NBIA 1UFKA 5EPEA 2B3TA 2WK1A 2Y1WA 3M6UA 5GIPE 3M0XA 3TM4A 4BLWA 3VYLA 5K0BA 3FZGA 4FS8A 5F2NA 2OB2A 2AOUB 2NYUA 2XYQA 4OVXA 3AXTA 3KQSA 4ISCA 3M0MA 4ZTBA 3P9NA 5EMMA 1XYLA 1Q0TA 3KQQA 1XXLA 3TFWA 1KXZA 3KQVA 5TNVA 2XVMA 5LQAA 3IHTA 2AS0A 3OU6A 4CTJA 5LQUA 1ZGJA 5CCXA 3NMUF 1WS6A 1L3BA 5DT2A 2AOTA 3C3YA 3SX0A 1XIIA 4X41A 4AZWA 2OB1A 3UXIA 2ZIEA 1ZQ9A 5DXAA 2PSSA 2C7OA 2O07A 1XISA 1XINA 1X19A 3G2QA 3AYVA 4W4QA 1RJFA 3UWPA 3DLCA 4QPPA 1MJFA 5FADA 5CVUA 1XLJA 1XDSA 3SVZA 5EVJA 1T43A 1XIHA 3DTNA 2NQJA 3BWWA 4FGZA 2P3OA 3UJ7A 2EJTA 3KBNA 1FBNA 1S5NA 3GRUA 1EJ0A 4XKMA 4V0RA 2FK7A 4EACA 5EC8A 3KKZA 4RSRA 4E30A 3TR6A 5E9JA 1XP3A 3A25A 2YR0A 1B42A 3T7TA 4OQDA 3IV6A 4X1OA 5K0EA 1G6Q1 3C3PA 3KBWA 3OFJA 2XIMA 1KYZA 3KQWA 3D2LA 4UOEA 3TC3A 4PYKA 3DXZA 2NXCA 1MHTA 3XISA 1O9GA 2QRVB 3DX5A 5E2BA 2XYVA 2I9KA 3HCFA 2BM8A 2G72A 3CQJA 2R3SA 3ITYA 4QEEA 3ITXA 1NW8A 4PNEA 3FYDA 2Y1XA 2KW5A 3P71T 3HVHA 5BXYA 3OZRA 3N4AA 3TMAA 4FZVA 1NW7A 2Z6QA 1EG2A 4A8IA 2GH1A 5KQRA 4XIAA 5D1NA 5DTQA 1I9GA 1IM8A 2OY0A 3C0LA 2CL5A 3K6RA 5ICFA 1OADA 3BGVA 4R6WA 4US6A 4X60A 4LWPA 1WXWA 4QQKA 3ERCA 3GGDA 3HA7A 5E1DA 3LGAA 2GLKA 3M0LA 5DTRA 1AV6A 3C6MA 1XLIA 3DR5A 3HNRA 4KVZA 1XYCA 3OU7A 5LQNA 4F85A 4RTMA 1QZZA 2IFTA 2H11A 2YTZA 4RTPA 2P3QA 3L23A 4HSGA 5ERGB 3P14A 2ZBQA 3EVGA 2GB4A 3UVAA 5D1HA 3FPGA 3BZGA 5FQNA 5KVAA 3JWHA 2Q02A 1XLAA 2IBSA 3R9XB 1O9HA 2YXEA 1XIEA 3UJCA 1M6EX 3HCEA 2YUIA 5E8RA 4GF5A 3HA3A 3IUIA 5JR3A 3GRVA 1XIJA 3BZBA 4WVLA 2BZGA 4GC9A 5H02A 3BGDA 4PWYA 5K03A 3QOXA 5LQCA 1JG4A 1XICA 2ESRA 2VDUE 1XDZA 4YV2A 4RV9A 3VNMA 5F2KA 4PYIA 2B2CA 5EIFA 4OA8A 3VYWA 3F4KA 2I6GA 5I7GA 3KPVA 3MERA 3OCJA 5E1OA 2PX2A 5EEGA 5E1BA 4P58A 3KQOA 5DM2A 3MQ2A 3MTIA 3NVMB 2H00A 1AQIA 3QXBA 1G60A 3LSTA 3G5LA 3KQPA 4ER0A 3I5UA 2ZLBA 3SR4A 1A0DA 3FPEA 3P8ZA 2AOWA 1JSXA 2IGTA 5ICEA 2NXNA 4HG2A 3WQOA 1NKVA 3KBMA 3OBEA 4JXJA 3LCCA 1M0EA 5HEKA 1NV9A 3FUTA 1P39A 1V39A 3G7UA 3NW9A 1JQDA 3ANXA 1G38A 1QAMA 1A0EA 2H1RA 2PXCA 2ZCJA 4DCGA 4F84A 5GINE 4YUVA 4KW2A 3VC1A 3ITTA 5K8VA 3REOA 3GDHA 4DZRA 2HK1A 2P7IA 2QYOA 3IUHA 2OBFA 3DUWA 1O54A 2X7WA 1ORIA 3MGGA 4C03A 9XIAA 2HR1A 5FHRA 2ZW9A 3K0BA 4XUCA 4RTSA 5DWQA 2UYQA 2Z6UA 1ZGAA 2BM9A 3QC0A 4YV0A 5EGSA 3G88A 3M70A 3SMQA 4F86A 2ZWAA 4OBWA 3DBNA 2GPYA 3GWZA 3NTVA 3CJQA 1XIDA 3P9CA 3O31A 3P2KA 4MWZA 1RJDA 3BWCA 4GLEA 3LBYA 1Z3CA 1DE5A 2AOXA 3LCUA 1G8AA 3GIWA 1QT1A 4PCLA 5B80A 2ZZNA 4EAYA 3FTDA 4PFHA 4GOND 5GOZA 5ICCA 4M36A 4QE5A 4EKIA 5CCBA 5B7ZA 8XIMA 4NECA 1TZ9A 2JHPA 5C0OE 2IH5A 3VC2A 3CQIA 3B89A 3ME5A 4C05A 3EMDA 1JQEA 4M7RA 4A6EA 4XUDA 2K4MA 4FR0A 2OYRA 4CKCA 5DLYA 3VNJA 5H1WA 4K1GA 4RVDA 3U3HA 4QTUB 3KCOA 2Q41A 5KYGA 2VP3A 2XISA 5DRYA 3HVJA 2PLWA 3I58A 2ZSUA 5E9WA 4P7GA 4GC5A 1BHJA 3KCJA 3ELDA 3SSNA 4HTFB 5IKMA 3FPJA 1RI4A 4P7FA 2PT9A 2BR3A 1JTEA 1PJZA 3EEYA 2I62A 4AZSA 2J6VA 2IDJA 3NDIA 5DPMA 4KDCA 3S68A 2UZ4A 3G2OA 3V97A 3FRIA 4LNCA 1VIDA 3MHTA 3EVFA 4EMSA 3LX6A 3ER9A 5DX0A 5XINA 5BW5A 2AOVA 1XIFA 1XLDA 2CKDA 5DX8A 1QAOA 1ZKDA 2P1DA 2UYHA 1DUSA 3AJDA 3CJTA 3GCZA 3LDUA 4KRGA 3B3FA 3UA3A 3V8VA 2JH8A 4DCMA 4ZB0A 1XJ5A 5HIMA 1KIAA 5FCDA 3TQSA 2JJQA 3LCVB 5EKUA 3M6XA 4BP1A 2ERCA 5EG5A 2QM3A 1F38A 3T7RA 3IYLW 3GXOA 2FHPA 1EAMA 5J8LA 2YVLA 2FPOA 3GO4A 3JWJA 2HMYB 4PIMA 1XLGA 1BC5A 2VDWA 2DULA 2HWKA 3MTEA 1INLA 4DM3A 3PX3A 3UJAA 1BKYA 1U2ZA 5T64A 3BUSA 4FP9A 1X1BA 3BWYA 2O05A 4U7PB 4GOOD 4MQ4A 3QV2A 4GQBA 4QDPA 3PB3A 1SG9A 2X7VA 3M6VA 5KQSA 1UIRA 2R6ZA 2QE6A 4KWCA 4HGYA 3C0QA 3AAMA 1VPTA 1X1CA 1D8WA 5HILA 2F8LA 1SKMA 2VS1A 1XLFA 1FP2A 1YFLA 4QDKA 2YQZA 2GAFA 4OA5A 3PT9A 2NP6A 3IUDA 1R8YA 4G56A 3KPWA 3KBJA 3A7EA 3HTXA 3HEMA 2NXJA 2I56A 5B7YA 3FUVA 3H2BA 1N7JA 5G02A 3I53A 5EMKA 3T0IA 1D2HA 4EVIA 2G0WA 4YUWA 2E5WA 4C08A 3PS9A 4YMGA 1R74A 3A7DA 3CC8A 4C4AA 4PCAA 3EVBA 3CNYA 4K6MA 1D2GA 4RTJA 1I4WA 2IDKA 5FUBA 3NVKI 5C1IA 2B9EA 3KU1A 1EJ6A 4GEKA 4Q7IA 1TW2A 4A8RA 9MHTA 3FTFA 3UJ8A 5AVHA 3B3JA 2AOTB 2OPBA 3SXJA 3G8BA 2ZIGA 4POOA 4MHTA 3PFHA 3KWSA 1MUWA 1JSZA 1DL5A 4E2ZA 3HP7A 2PKWA 1SUSA 4A6DA 3WSTA 1XLCA 4WXHA 1SUIA 5DRTA 1S5MA 2HK0A 1VBFA 4HGZA 4FT2A 1DXIA 4DUOA 3DMHA 1RI2A 5EMLA 1RJGA 3TVAA 4YMHA 4RTRA 1WXXA 2OXTA 4E31A 3M0HA 2G4JA 4QQNA 2BR4A 5GP1A 3OFKA 2FRXA 3VNLA 1SQGA 4IKPA 5DSTA 1RJEA 2ZZKA 3U81A 1G55A 3FUXA 3I64A 3QOWA 1XCLA 3RW9A 2NXEA 3PFGA 2GS9A 5CVEA 3PTAA 3OE4A 3BWBA 5DSXA 1IXKA 5LSAA 3GRRA 2PXXA 4PYNA 2EFJA 4DMGA 4QEHA 5EMJA 1R18A 1VQ1A 1EIZA 3KR0A 1L9KA 1FJXA 4KIFA 10MHA 5HIIA 3LL7A 4XIMA 3G5TA 2CMHA 5CM2Z 1XDUA 4HRAA 5FWAA 1I6NA 3KR1A 3P9KA 2G8NA 4C06A 4C07A 1F3LA 4RVHA 1WZNA 5K0LA 3E8SA 2GVEA 3R24A 3NDJA 1XYMA 1SQFA 1XTPA 1BOOA 4ATNA 5BW4A 2GUBA 1L1EA 2P41A 5LR6A 1H1DA 3CVOA 2PJDA 3BGIA 3CCFA 3NWEA 4O29A 2GYIA 4L7VA 3DMGA 1FPQA 3BKXA 8MHTA 2G1PA 5CUQA 1YX1A 1XLHA 1OR8A 2N47A 3G8AA 1P1BA 1KPGA 2UYCA 2JHCA 3ELUA 3A4TA 3R6TA 2P7HA 5FTWA 4M37A 3ORHA 5FULA 4RVFA 3R3HA 2CWWA 2JH9A 3KCLA 1NBHA 5T67A 2ZULA 1JR4A 1RI3A 5XIAA 4YTUA 4R8SA 3TOSA 5XIMA 4RTOA 3DXXA 5EKXA 3KR2A 3L8DA 5FA5A 4OBXA 2IBTA 5LQRA 5K0CA 3UZUA 2ZZMA 4QTTB 3TKAA 3ID6C 2PWYA 2O06A 3EGEA 3KQTA 1QANA 2HNKA 2P8JA 1XIMA 3UJ9A 4P7KA 2PWPA 1L3IA 4KDRA 3LECA 2QUNA 3AYTA 3GRYA 5P8WA 2AOUA 3HCCA 5CVVA 1I1NA 3JWGA 3QZAA 2P3LA 2QULA 3G89A 2LD4A 3SSMA 3QYSA 8XIAA 3KBVA 4PGLA 3ELYA 2ORED 3KQYA 3KPJA 1P1CA 2PVCA 1I60A 3DLIA 2NP7A 4XISA 4EQZA 3A26A 5HIJA 4K3ZA 2ONYA 4YTRA 4CKEA 2EX4A 1IY9A 5K0NA 4BLUA 3HCAA 2V74B 1JTFA 3R0QA 3TPZA 3UJDA 3FTCA 2VDVE 2B78A 3U0HA 3KR9A 3M4XA 5HIKA 3CJRA 3LBFA 2QW5A 4CWAA 3EPPA 5K0FA 3C0SA 2NQHA 1NW3A 1Y8CA 4YUYA 2WA2A 4V0QA 3G2MA 3X0DA 1K77A 4PGGA 4H0NA 6XIAA 4R05A 5K01A 5HOQA 3EEOA 2YXLA 5GIOE 4YTTA 3B3GA 4FT4A 2HV9A 5E8JA 4E33A 4P7JA 4EK9A 1X1DA 4CKBA 2XVAA 4HHMA 3EVEA 2I7CA 2PT6A 3NGFA 1QUMA 1TW3A 1Q0SA 2O0LA 5E1MA 4R6XA 2HCVA 5H6HA 5LQKA 1BXBA 4GOMD 4XCXA 2QRVA 3FYCA 3SGLA 5DM4A 2B25A 1DIDA 4ZBCA 5ICGA 2HTEA 2AN4A 2ZVRA 3AWIA 5E2AA 2QUMA 7XIMA 3EGVA 3P6LA 1XVAA 3P2IA 4B17A 4XSLA 4GOLD 3ITVA 3C0KA 3EVCA 3THSA 3CQKA 2ZFUA 4PINA 1R00A 4ZB5A 2CMGA 1VP3A 1ZG3A 3BWMA 4AX8A 3ELWA 3BANA 2OO3A 4YUZA 4OQEA 2JG3A 4BY9E 1KHHA 3FPFA 2ADMA 1VLMA 5CD1A 2PXAA 3OZSA 1XLEA 5AVNA 2ZVJA 4X61A 2YXDA 4E2YA 2ZIFA 3HM2A 4E32A 2ZWVA 3HCDA 3UJ6A 2IH4A 3IEIA 3THRA 5DX1A 4E2XA 3TLJA 3JWIA 3UBTA 3HVIA 4AZVA 4ER5A 3E7PA 5T6BA 3LDFA 5E9QA 4RTNA 4HGXA 4Y30A 3GRZA 3M6WA 2BH2A 3M33A 2AN3A 1NE2A 5FA8A 1D2CA 1QAQA 9XIMA 3EVDA 4Z2YA 5K0JA 3KQMA 3I9FA 4E3VA 3TM5A 4PONA 2JHAA 3VSEA 2IPXA 1PRYA 3FVMA 2WA1A 3MAGA 1R6AA 3CKKA 3RODA 1YFJA 3LDGA 4PIPA 1KPIA 3P97A 3AY0A 2V7EA 1XLBA 7MHTA 3M0YA 2XYRA 4QE4A 4HNOA 3JU2A 3SSOA 4DKJA 4GJIA 1JG3A 1RI5A 3KTCA 1EQAA 4U7TB 5EIWA 5CVJA 5HFJA 1YZHA 4HC4A 3DULA 2BR5A 3XIMA 3B7PA 1A0CA 4A8LA 2I57A 3XINA 3CGGA 5KS2A 2AVDA 4GUAA 5GM2A 4YTSA 4RYLA 2NNWB 4QDJA 3HCBA 4PYQA 3LKZA 1VE3A 3CQHA 4QE1A 3PVCA 1NT2A 3AALA 3BDKA 1JG2A 3MB5A 1YZ3A 2OKCA 3ER8A 5F2OA 2C7QA 2PV0A 1SVUA 1NW6A 4DQ0A 3BZJA 4IV0A 5FHQA 2QY6A 3TRKA 3LMZA 4ER7A 6XIMA 4LECA 5HZMA 4IV8A 5BP7A 4CTKA 3DXYA 5DM1A 4XSMA 1XLLA 5DM0A 1XIGA 2AZTA 3PX2A 5LQJA 4PYLA 1KR5A 3GJYA 4RTQA 5FQOA 1NV8A 1RI1A 5EOVA 4RVGA 3MCZA 5CIYA 3B5IA 1BXCA 4PYOA 4YUXA 1R8XA 4MIKA 2A14A 3E05A 4RWZA 1N7IA 3A27A 2XBMA 3GU3A 4OX9Y 5GM1A 4YV1A 1KPHA 1G8SA 3ITLA 2AVNA 1HNNA 2IP2A 3EGIA 1XLKA 2AN5A 4AUKA 1WY7A 4QDWA 1ORHA 4AZTA 2YX1A 1JQ3A 1P91A 4BLVA 2FCAA 4MTLA 5CVDA 3O7WA 1HMYA 4Y2HA 3AXSA 3EVAA 2ZBRA 4LG1A
chains in the Genus database with same CATH superfamily
4YAGA 2C2XA 2NT1A 2AI3A 2ZPUA 2NACA 1IK4A 3HA5A 1E18A 4Z6KA 2HTMA 3Q3VA 3EIUA 4LXUA 4HATA 5B36A 3EIHA 2XCTB 2ZRMA 5EZ5A 1XYAA 3K53A 4E70A 4NAFB 4G5XA 2NZLA 3ZJYA 5EFOA 4FSXA 2QMHA 1JHQA 2XF8A 4HA0A 1L1FA 2LZ0A 1JCJA 1MNZA 1QNOA 4R3NA 3FMGA 4A2RA 1XFCA 2XYPA 3QPBA 2F67A 4NARA 1YQWA 3K2QA 3NFYA 2W6PA 1SC9A 5AOBA 3WKAA 3B13B 3UFXB 4G5DA 4HV4A 2XH0A 5K0ZA 4IL2A 2Z56A 1WP4A 3E5HA 2QX6A 4HVLA 1UK6A 4M38A 1FUEA 1X1AA 1WTAA 4ARBA 1W3NA 1HG1A 2W67A 4LYKA 2C7PA 3KXQA 2W4QA 4BOYA 1CU1A 1ZCJA 1WLYA 4XB1A 4YJ2B 4CTOA 1T2AA 3CAQA 4KYTA 4KU4A 1H42A 4US5D 4D72A 2Q3JA 2VCEA 1A47A 4U28A 5G2IA 2GA9A 2GM3A 3LRKA 4FM9A 2AGKA 4U7FA 3WDPP 1KQPA 1VFTA 4B48A 4DRSA 1I0DA 3F3KA 2NPIA 3TKYA 4ENQA 3NHSA 1XR2A 3NYRA 3L4TA 1QK5A 2H8ZA 1ZD3A 2QR2A 4B3ZA 1X6LA 2QUBA 3W7JA 4BQPA 3EW9A 4LAOA 1MRZA 5DMLA 1VEOA 3HKCB 3T78A 1JYNA 3PENA 2X09A 3JQBC 1JHPA 3KBBA 2I14A 4DAEA 4MKVA 4AQDA 2BVNA 3I65A 1UAAA 4PSUA 1TE6A 2GOKA 2RI0A 5JD4A 1WETA 3AH8A 4FC7A 1F76A 3ZWAA 1ONPA 3FNGA 4MR8A 2D0FA 1A8QA 1D4FA 1YB2A 2D2IA 3O8RA 5CPFA 3G79A 5B3JC 5JZMA 1YD7A 4DLAA 3HI6A 1SBIA 4IH9A 3WLFA 1W1IE 1XMJA 1Z38A 1D3GA 2DVUA 2EG6A 1YE3A 2I6UA 5HJ5A 3SN1A 1ZVJA 1D2EA 2HA5A 3NRBA 2G67A 4KE8A 1PVOA 1E0DA 3CYJA 2E5DA 3CEJA 3IKMB 2C7GA 4G4SO 3UMCA 2O52A 4IIVA 2BDUA 1UFVA 1HX0A 1RM5A 3PNVA 3O2NA 4DPLA 2I4NA 4DJEA 2XH7A 5G53C 3UFYA 1G21A 3EBPA 1FFGA 3WE7A 5MDHA 1UPAA 3OHSX 3IO3A 3PXGA 5I8ZA 5JLAA 1A49A 3FTQA 5EUMA 4L7QA 2EQDA 3FYPA 2R66A 4QG8A 4G1FA 1Y9AA 2QIIA 4M8UA 1RC0A 5T91A 1T9AA 1QPOA 2GEBA 1JDEA 3FDGA 3PXAA 3P26A 3ZDXB 3W2LA 4NEHB 2BMFA 1FPMA 5KSYA 4CQMD 1E9CA 4FZ5A 2Q5QA 3KQVA 1D7AA 4LGMA 1H49A 3I37X 1F2TB 4BFYA 1PFVA 4P3OA 2A5FA 4R3WA 5CCXA 1USIA 3OCWA 4QUJA 3TAXA 4N5MA 2J07A 1JG7A 3PHIA 3PTMA 3CX8A 4ZPXA 1L6RA 1JDSA 2MCFA 5DXAA 1GOTA 2A3LA 1RJFA 2FJ0A 2V9CA 4IFTA 4V0SA 3UWPA 2A0FA 3M64A 4F8EA 3QV8A 1NUAA 1XDSA 4RLHA 3PE3A 3T7KA 3WMBA 2V3WA 5JAIA 4AS1A 2HQAA 3CVUA 2BT4A 3UWSA 3ZBUA 4KJZA 4R9XA 1J12A 1FBNA 1E20A 1S5NA 4DUWA 2W91A 5DHTA 1XRFA 3W5VA 2ZR0A 3T8YA 4J3JA 4WJEA 5E9JA 3M4HA 3PUIA 1DV1A 4CNQA 2FF7A 4X1OA 1HLGA 4RIHA 4GIAA 4WZBA 8A3HA 4FMDF 4UW9A 2XIMA 1A27A 4L75A 2OXCA 1YK1A 3QFEA 3SF0A 2PMCA 4YTEA 1DKOA 1YULA 1EC9A 3W83A 2JFGA 1VLVA 3LHTA 1MHTA 1FRNA 3NHMA 1KWKA 3SIXA 2BI7A 1GTMA 4XCVA 4LJRA 2WVHA 3UT6A 2B5OA 3P71T 2PB1A 1XBVA 3TMAA 1NOKA 3DERA 3KL2A 1YYAA 2Z6QA 4UEQA 4ZI2A 1Q2SA 4MJZA 1E1MA 4CKXA 2GM5A 2VYCA 1S9HA 5EJ5A 2WSQA 4O14A 3L49A 4XIJA 3QIAA 3HZZA 1NI4B 1QHYA 2GZSA 1CY7A 4UPVA 4WBNF 4PO8A 4FMBB 3QSTA 1K8YB 4FLEA 1PQYA 5HUJA 3ATYA 1M2EA 3PJDA 2O9RA 4Y18A 3KZMA 3TYEA 3L6EA 1SG6A 4IH4A 3SD7A 1XTUA 2FPUA 2YOFA 2N1BA 3OT5A 4CDRA 1Y1QA 1EP2B 4EFNA 3ED5A 4GSKA 1Z32X 1N5JA 2P9EA 1CE8A 3JQRA 3TWAA 1Z83A 1PSZA 4JB0A 5TQ0A 4POAA 4P80A 1XC6A 1TX2A 2VDNB 1NN0A 2YWFA 1C8VB 4BQ2A 1GL3A 2XCQA 3HGQA 4EGQA 3STEA 5DW0A 4IUDS 4IHJF 2OBLA 2YXEA 4WEQA 5ELXA 5CLGA 1M6EX 4AO6A 3MAJA 2Z29A 2FR8C 2BGLA 4AJPA 3D6VA 1DPFA 1TV4A 2GBIA 5CYGA 4DDWA 3GBSA 1GT8A 3EVNA 4QYXA 1CTNA 1D3HA 3B03A 5FT9A 2AJLI 4ICNA 2VWQA 2HT1A 1K2WA 2WWGA 1LYXA 1XDZA 4B6SA 5DTIA 2ZIXB 3O6YX 1N2JA 1H5YA 4DV6B 4OA8A 4WADA 3Q8WA 4I5DA 2X0HA 3NUKA 3FKKA 3KAJA 1Q57A 1IOLA 1NP7A 2F8SA 5E3IA 2G8LA 2HIAA 4HB0A 1CJVC 4MVCA 1ID8A 3PG5A 2NX2A 1RYMA 1VPDA 3R2GA 2HK6A 4TSFD 4S1OA 5KC9A 1G5TA 1XS2A 5KSWA 3X1KA 2GZXA 3PNBA 2HE5A 3O38A 1XGZA 3QXBA 1C29A 2W37A 3I5UA 3NXSA 4AS2A 3RAJA 3Q3JB 1FRFS 1UMDB 3DAPA 4FR2A 2O1SA 2OOFA 3CPJB 2GJ4A 1JSXA 4NK4A 2Q0HA 3IOBA 4MEJA 1DWPA 2EJCA 5K3EA 2A0UA 4NI8A 1NKVA 2ZX7A 5CNIA 1T13A 5I3IA 1MW1A 2I5GA 4IWXA 3INYA 5CJ2A 1NFBA 1T1IA 5ALTA 3IQHX 3NW9A 1E9EA 2CNNA 4X8MA 3SBDA 3S1SA 1QAMA 4X1KA 1KDOA 4YUVA 4WN3A 4JVLA 5ABTA 3EXTA 2V8OA 3HFJA 3OJXA 4HY3A 4F4JA 1QHNA 1CIUA 4I1VA 3HDHA 3RUDA 2HHJA 4QCEA 5FOUA 4IMIB 4M0KA 3FNDA 1I6MA 4DABA 1UMCA 1PUDA 3H1BA 4WXPA 3TB4A 1X8JA 2IMRA 3LSCA 2DT8A 1Z0IA 1X9GA 2FZLA 1FWWA 1ZP6A 2A0XA 5DI3B 1G7UA 3IS4A 3MWFA 4L0DA 5CDFA 3PRHA 4PQRA 2XECA 2XD9A 4QLBA 1LRNA 1NMSA 2B4KA 3OQMA 2HXYA 4YK7A 2CMFA 1A4UA 1VZ3A 1W0JD 5KPJA 4MWZA 1XNJA 1K4MA 4M5PA 4DUVA 2UZAA 1YCFA 4P3NA 3LCUA 3QKSA 4JI8B 4ZAYA 1ENZA 4YP9A 5IBCA 1WV2A 1I2BA 1YJ5A 3RABA 2XIOA 4J4HA 5DGDA 2WM1A 2YR1A 4FR1A 1AZSC 5C0OE 2QJOA 3IJ8A 4F2WA 4DBUA 3LCGA 4HDNB 4DCCA 4C4SA 2IU6A 4UJ3A 2RG1A 1DADA 1UPTA 5HINA 3AVOA 3RRMA 4LMBA 3USES 4FR0A 1PDVA 5DLYA 1U8AA 5CBPA 3RBVA 1C7EA 4HZIA 3AJ9A 4PSDA 3BHMA 4LVOA 1U8CB 5JDIA 4X0NA 1KFKA 4LUTB 1TK2A 5JAHA 1G59A 1I2OA 4GC5A 2GD6A 2J9FA 1NPDA 5DRCA 4MVJA 2YW4A 4OL9A 4NZ9A 2VCAA 4FEYA 4RS4A 3D4LA 1IV8A 3RADC 1KMHB 1LV7A 3E81A 3E5PA 3UZ5A 1CGUA 2PDHA 3DF9A 3GFTA 3W4RA 3JD1A 4QBXA 4GX5A 1V6SA 1X74A 3UQZA 2GGGA 1F06A 1VIDA 2IYOA 4HNLA 3QKUA 5AD1A 2OZKA 3VFDA 2YZ7A 4X66B 4CNPA 4FKBA 3KQLA 3STUA 1PZ2A 4UHEA 1R6XA 3I9KA 3WLJA 5HNTA 4UC0A 1X7ZB 1OGYA 3LGXA 3JZUA 5F35A 3SHVA 3MP5A 2EVWX 3VPAA 1FK8A 5JARA 4MI3A 3GH5A 1A5NC 1E4NA 4LZOA 3ANMA 1UXIA 4CKEB 5J2TF 4LW8A 2FTKE 4J9VA 2YMMA 1FDWA 2DPLA 2RGRA 2FMTA 1X7YB 3ROEA 3ZCPA 2X3UA 3MTEA 2WMKA 3B9BA 3BGAA 4YAFA 1QYCA 4EPRA 4Z1AA 1BKYA 3FR8A 1RWWA 1U2ZA 3KSUA 2FN4A 4Z9AA 2ACEA 3KLBA 4WNAB 5CW2A 8ADHA 4D8TA 4HWPA 3MUY1 3L4JA 4D25A 1R7OA 2C9ZA 1DVRA 2R6ZA 1DVJA 3ZD7A 3AAMA 4YONB 4TKLA 2WT9A 5FLXA 5JNTA 2W61A 2BEWB 2NQ5A 3M0KA 3UK1A 2DZUA 1I5EA 1VA5A 2HV8A 1US2A 4R1NA 4LVUA 3RWBA 3KPWA 4ED9A 1OVDA 3IBSA 4MA0A 3SQSA 4MAMA 2IUZA 3HEMA 2FMKA 1TTHA 2CZEA 4KMMA 4Q16A 1W2PA 1USKA 5ELMA 5I09A 1V1MB 3SYNA 1LPMA 5EMKA 3P0EA 2GCNA 4XWOA 2AUTA 1NQAO 4U6SA 3TTQA 4YL2A 4PCAA 3VO0A 1W9PA 3IXLA 2XODA 4BIMA 1MRSA 5MKGB 1UD2A 1YB7A 3CBWA 4ILSA 1A5MC 3GY1A 4R2MA 1SU6A 3QP9A 3TFOA 4CMGA 1EDTA 3O15A 4LYEA 1UK7A 4X54A 2HUPA 1ZLXA 1MJ5A 5LYJA 1QX3A 3GZ3A 5GONF 5FJPA 1FDYA 2RDXA 2E4XA 5T4EA 2TRSA 4WZHA 3G8BA 4GZLA 3WJWA 2ACVA 5DV9A 3LOUA 1Q63A 1Z07A 1U1IA 4N9BA 4RMJA 3TIGA 3A4AA 2D2JA 5JBIA 5IK2D 1HA3A 1XRLA 4UTTC 1CXKA 3TA6A 4PTDA 1XLCA 1CRWG 4D9BA 1Z4OA 2F9MA 4DJDA 3IUEA 5J59A 3AFBA 3L2LA 4BNWA 4JQSA 5AK5A 4DWJA 2AF4C 4RD0A 4HGZA 1F8MA 2D1ZA 5CA1F 1L4EA 4KPLA 2DQKA 3NNSA 2YZ2A 2RAUA 1VHNA 4FEGA 5F5LA 1DJXA 2Y1OA 3CT4A 4ZVNA 1OBFO 4P8VA 3WYBA 4OOFA 2LDXA 3V4SA 3OZPA 1LPOA 3R7LA 3G7NA 1ZFNA 5JZOA 5DSTA 4ZJZA 3U4QB 5AN7A 1XCLA 4GVIA 1PTGA 2DV0A 2GASA 3VAYA 3R0JA 5CVEA 2N46A 2ETVA 1WKBA 3GTHA 4YUAA 2O8BB 4JC0A 2PGFA 1LLCA 4P5UA 2R00A 1MAUA 2JKAA 2JGEA 3D2BA 1ZO8A 1PV8A 3EEBA 1XA0A 3NIBA 4NJMA 5BXSA 1E6CA 5AKKA 5K7SA 5JCPA 2Q3DA 2QN2A 3O9VA 1OTYA 1PZ3A 4GUJA 3A37A 3P60A 5HF9A 3TQPA 5LSMA 3L0YA 3J81k 4HLUC 5IDXA 1XZPA 3GQVA 1PR3A 4LZZA 4JGIA 3U5ZB 3DDMA 3CO0S 1A1VA 1O68A 4NX2A 3DE1X 4IKOA 1VPLA 1FQJA 4I55B 3P4UA 2FX5A 3DS8A 4BVHA 3S1VA 4O3MA 1QPGA 4P36A 5JH1A 3S1WA 2X9QA 1G9HA 3LX8A 1MIHA 3DO6A 4OT7A 2VQUA 3G8AA 3LM7A 5C7IO 4R40A 3M16A 2HLHA 1PDYA 3P61A 2JEPA 2XUHA 2GZRA 4WNCA 2C95A 4B7ZA 3ORHA 5KUTA 1VBMA 2P6UA 1SM9A 2NX1A 5GNYA 3H6OA 4M1TA 3OLZA 4GEGA 4BV3A 1WZKA 3WLPA 3W75A 2Q09A 4WKPA 5T3UA 2VZOA 1H2JA 2GSHA 3HUFA 4RTOA 1EA5A 2PAJA 3PDHA 1QONA 3ANYA 3PEEA 5JECA 2GFTA 3DW1X 3NH9A 2ENWA 4GZ6A 2IBTA 2CJYA 2WICA 3OO1A 3BK7A 5K0CA 3TJLA 1R0XA 2ZR7A 1JP7A 2C4NA 4HJXA 1I8JA 3ID6C 4QDOA 4G1CA 4HDQB 3VKUA 3DV0B 4TV8A 4LCQA 2B35A 2I7DA 2WP0A 1XIMA 1AC5A 1FSZA 1GYRA 4MW4A 1XZCA 4KDRA 1XVVA 5CU7A 4CM4B 3TZKA 1Z68A 1H4SA 4P98A 1K8CA 5IT0A 2V0CA 2QRNA 3KP1A 4F40A 2WHYA 2PKCA 4YXWA 2C2MA 4E5MA 1Y3HA 1ZL1A 1QIHA 4OZOA 4UR7A 4ABTA 2V3FA 1NYQA 5E3JA 4R9UC 2D0PB 4Y2YA 3K70B 1L7BA 3KCQA 3KPJA 1RZMA 1L7XA 3A26A 2B6HA 4L4XA 4E3ZA 5ALXA 3C6BA 1V8BA 3NL5A 4K3ZA 1VB9A 4DG8A 1OBCA 4UHHA 3QX3A 4HNTA 5ICSA 2NVAA 5AHMA 4LUSA 1V4BA 1OLSA 3PD7A 4M6VA 1TFRA 5IYZF 1CVLA 2HK7A 3L9XA 4RY9A 2YCBA 2ZUCA 4H7HA 3TWOA 1R5OA 3LP5A 4EPKA 3OLDA 4D99A 4GUFA 2VOMA 1X97A 3N2BA 1QH0A 4I1PA 3L0ZA 3UNTA 4K6AA 4WIWA 2J0UB 5DHQA 1CUVA 5BWFA 2XE7A 2OZ0A 3PWGA 2IHNA 4DWOA 4DGSA 2FWIA 4HA3A 3MSXA 4X2PA 1IPEA 3VAVA 2GEFA 4JUFA 2WB4A 3T5AA 2AC2A 1MVOA 3F4VA 5ALFA 5C1DA 4IGHA 3OFSA 1V3KA 1WUKS 4MRMA 5ECDA 3CNBA 2ZX6A 2I7CA 3FNHA 1DPGA 3LCLA 2UZ1B 4GRAA 2PAAA 4LOIA 4QJBA 4H3KB 4QPCA 3H0CA 1Z12A 4ID9A 1XMOB 2QGNA 3AHIA 3F4LA 5EPDA 1RCFA 2GQ8A 3I92A 1VM6A 4GOMD 4ZEWA 3N59A 4AY4A 4L8LA 2EPLX 2BM1A 1I75A 3EGWA 5EJAA 2O7VA 1M0TA 5CC6A 3AV0B 2IQ0A 4WY2A 2ZRKA 1A96A 2HSDA 1MGOA 1EE2A 2E18A 2XUGA 4IZHA 2PH7A 4Z1CA 2Z2JA 4RV8A 4XVCA 4HK4A 4BEBA 1TU4A 3WJ7A 4UQEA 3CU5A 3H84A 4GOLD 2YBEA 3A6LA 4IJRA 3L4KA 5C35A 3V00A 4MOZA 3SYMA 3HG5A 4JYBA 4KZKA 1UT6A 3MWDA 4HS4A 4WOPA 3JARB 4ZB5A 1HLPA 2CMGA 1UDWA 2FPPB 4Q7MB 5F78A 2Z1BA 1A2QA 2GQ3A 5IP5A 3R5SA 1RD6A 1KAMA 2VELA 3BANA 1FP7A 4GM1A 1UA3A 1B0AA 3MB8A 2HSAA 4BHTA 2PM8A 2V7BA 2FX3A 1F60A 1L1RA 1R9XA 3SURA 5CD1A 5M5DA 2FU5C 2ZZ4A 4ZO8A 5H5JA 3ULKA 1MNAA 1AKUA 1DKUA 2XUJA 1KVQA 3OGSA 3P19A 2O0JA 4MMWA 1SXGA 1GJWA 5TT1A 1MAVA 3PUOA 1TVPA 2BISA 1K7FB 1KDPA 4Y2VA 3NTRA 4JHLA 1ODZA 3QVWA 4DKXA 2QDXA 4GI6A 4URWR 3VKVA 5DX1A 2F1KA 4AJOA 5EJ6A 4O13A 2HPZA 1IHYA 2GARA 4Z8YA 4MV4A 3E7PA 5FL3A 1ECQA 1TJPA 2QDGA 4GNKA 1MRAA 1N2VA 1YRRA 4F21A 1ISRA 1TD9A 5K3FA 1VKZA 2DM6A 3GG7A 3LIIA 4HAXA 1OH5A 2Z1VA 1DQXA 4DNMA 1Z6YA 3RTBA 5B3LA 1HLFA 1X2EA 3ZOKA 2EYUA 1PJ3A 3VSEA 4QROA 5TPWB 2FQYA 1PJSA 3BHJA 1CLUA 3NHRA 3MUEA 3CNLA 4PSCA 3KHSA 2XWDA 4KH1A 2NTYC 2O2XA 2WTUA 1XBYA 4F56A 1MF7A 2C16A 4Q9LA 2QD4A 2Q1UA 5T3YA 3P0RA 2ISVA 5K9CA 1CXLA 4PANA 3AJ7A 1EWQA 1UKSA 3KSZO 4DNPA 2VJCA 1MNSA 3HCWA 3P67A 4LFBB 1RYYA 5CHEA 1VGRA 4HYEA 2WFZA 4DBWA 4BP9A 1Z7WA 5AJYA 1XKLA 4JR0A 4IF6A 3VNQA 4ZI5A 1L4HA 3ETJA 1ADFA 1FL9A 3XINA 1OZGA 1P7TB 3MEQA 3DKRA 2AVDA 3RS8A 3VPHA 2ZP1A 5CT6A 3MJMA 1MZVA 1SXIA 1CUWA 4KF1A 2VJMB 1X80A 4RE3A 3R8FA 4BWFB 1E3QA 4A22A 2D5AA 7REQA 1Y82A 1VE3A 2XW6A 3VH2A 3AVVA 1ISSA 4X71A 3IFSA 1HG3A 3AALA 2DFLA 1B3XA 3TIFA 4ZYZA 4KHPB 3SBFA 1SVUA 3EPRA 4C6RA 4WCFC 3LMZA 2PUDA 1UBHS 1SW3A 2O2DA 2Y05A 4XQ9A 2G25A 2Y8UA 2AZTA 1QGUB 2WM3A 1KKLA 1WO8A 3GJYA 3MP3A 2J0QA 5LP6B 1E6EA 2SICE 2LR0A 4A23A 1JYFA 2PD6A 4YP0A 2FHCA 4BC1A 1HK7A 1IM2A 2PS0A 3BBPA 3AOEC 3AHCA 1QXLA 5FO1A 3WK5A 4NZJA 2CLSA 2GPBA 4KEVA 3ABIA 1HURA 1WMEA 3VIKA 2X7XA 2EFEB 4BZWA 4Y6GB 3G1FA 4MV3A 3R6LA 1NBMD 4JQOA 4U2CA 1DWIM 1XLTA 2I03A 4Z1MA 4DWDA 1DRJA 1WDQA 1BQEA 5BVGB 3DLBA 3VFLA 5H8WA 1NARA 3N19B 4HJFA 4WXRA 4ITRC 3NL2A 3GFGA 5DYGA 4CMCA 2HRDA 3PTZA 4FJ0A 3KVOA 5LJLA 4HCHA 3E3LA 1HL8A 2HD4A 2XXJA 1RKXA 3KDAA 1OIXA 2FZGA 1LUCB 2PRSA 4GMHA 2VSOA 1ACMA 5EJIA 4WQ6A 3VNIA 3IUSA 3W7KA 2SKCA 2OM6A 4R9NA 2GLUA 4TXMA 4ETMA 3DMYA 1N0IA 3S2JA 4PBTA 1RPTA 1JI2A 4G5GA 2R1ZA 2V3GA 4MTCA 3WF2A 4F06A 1X96A 3KVLA 4A9AA 1XDGA 1I2PA 2E6UX 2BZNA 3FUWA 4QYTA 5A8NA 3TBKA 3M1AA 1GCOA 4OMDA 1YPIA 2P9FA 1BXNA 4Q8MA 4MVXA 3I9V6 4L4ZA 4JZKA 1KOJA 1JECA 1EUNA 1J2UA 1ZAIA 1B8VA 1EP3B 4G7FA 1HJVA 5FF0A 5HULA 3KM8A 3OQHA 3TSYA 2UUPA 1UMBB 1AN9A 2X40A 4OJNA 4UVEA 5D2VA 3U7EB 5IW8A 3VYRB 3EODA 3FG9A 3DOUA 3BK0A 4O2AB 4BCDA 4DE5A 1YJCA 1ZNZA 1AUPA 3LUBA 2FW8A 5JXWA 2A5YB 3ICWA 3R7WB 2J6XA 3ME3A 3W22A 4CL0A 5C8YB 3ITOA 4U6QA 4OHZA 2DW6A 3DKJA 3S6DA 4YJGB 1J0YA 3LPMA 2CHFA 1Z41A 5HWJA 1JCYA 4NICA 4GKLA 1LJUA 4RSHA 3OKCA 1G3RA 4BV2A 4GP7A 5JH7F 2GAOA 4DC9A 5TLSA 3H5IA 3QQ0A 2ZE8A 1Z6XA 4O4LA 4O2BB 3UWDA 4EOGA 3PDIB 3FW1A 1IUKA 4DQVA 1A04A 4AWBA 3EOAI 3AP2A 3EBLA 4AKGA 3OH8A 4CF4A 2XD4A 3GGJA 3ZOAA 1D5CA 2GN1A 1GVSA 1NRJB 3T8QA 3HM7A 3CC1A 3L66A 1MYRA 3AOFA 1J2BA 4FHGA 5E6SB 3GNPA 2J8ZA 5BN5A 3OO2A 3BMOB 3STCA 5PNTA 1L6YA 1J42A 4FB4A 3WNOA 1EFVB 2ZBPA 1TO1E 1IZ0A 5BSHA 2HQBA 2J7PA 3FTPA 4QUDA 1G63A 3ZC3A 2WIKA 1WU7A 2YZKA 5BYBA 3UJPA 4OHCA 3S2ZA 1DCTA 1CB0A 1YZNA 3ZGZA 4BB0A 1PFQA 2XUQA 1E7MA 4ZEPA 1SBCA 1KXQA 4QISA 4IXHA 1G6OA 1RJQA 3ESRA 1TRIA 2NYUA 3H9BA 3VSDA 1CXFA 3F5JA 4ISCA 4EHIA 3JQ6A 2RFGA 1A5ZA 3F7MA 4FCWA 1XYLA 4D1YA 2QCLA 3R7AA 4GG1A 2WIFA 3TX6A 4OP2A 1CHDA 1L5OA 1G98A 1ZOOA 5GQSA 2CK3A 4R7JA 4Q8UA 2XIQA 3NMUF 2YYAA 3RDKA 2WHEA 2BMJA 1E3LA 1K2VN 3TMQA 1U0RA 2C7BA 2XZTA 3MSYA 1F9AA 4PW0A 3IJRA 4XO7A 3AYVA 3TX9A 5CSYA 5A4DA 3RLHA 3LUTA 2GYYA 4B45A 1XLWA 3L8ZA 3WUEA 3KOFA 2AAMA 3OQIA 4ZEOA 1OFUX 4M0FA 5HWSA 2PMQA 2QPXA 4RCYA 1DEDA 3OKAA 1L6IA 2I7TA 2ZRPA 3EDMA 4KPUA 2QKFA 4D2JA 1AX9A 2R6HA 3TE6A 1ICPA 5F7ZA 1SFSA 3SXPA 2OHXA 1IZ9A 3VGJA 2I2WA 3VOSA 2QB5A 4GACA 3AF1A 3IPRA 3C3PA 3OFJA 3LXXA 3S5ZA 4KQEA 2RKOA 2EGHA 3TPCA 1OKKD 1X7WB 4BO0A 3W27A 1UC4A 1C3OB 3C4QA 2VQ6A 1JF5A 4ZA0A 3RSZA 5K8IA 1B6GA 4CUJA 1Q2RA 3T5BA 3JQGA 3ZLVA 1EFHA 4M98A 1N92A 2GAIA 3CQJA 1Z0AA 3QWIA 4DWSA 1HQYE 3PJWA 4JHXA 4M8SA 5C5EA 3H26A 2VR2A 4US1R 2A1TS 1U5JA 3I05A 2FV8A 4GBGA 3UNDA 2IZ0A 4JFRA 3DB1A 1XNHA 4JASB 2DE0X 4G5OA 3HWSA 4XARA 3VKBA 2CVZA 5LHFA 3PJGA 5E1DA 4HH1A 4JEQA 1C93A 4Q9JA 1YA6A 3LGAA 1YR1A 2GLKA 5IOBA 4P8UA 1ZJ6A 2C88A 4EMBA 3RX3A 3MV01 1IAVA 3EC2A 4Q32A 5KJFA 4C91A 2YVQA 1A77A 1Z4MA 2SECE 5DOZA 4KVZA 1UUOA 3HJHA 5AC7A 1C7SA 4P83A 4UTFA 1KY4A 1WXYA 1RD4A 1TXGA 4D6YA 1EESA 3L2IA 3DWFA 5H83A 5FOXA 4JYZA 1LNZA 5CPLA 3UYLA 3QSGA 5A6MA 4HSGA 2NUYA 5FTNA 3BF7A 4PMNA 2ZBQA 1HYEA 3VC7A 1PW7A 1T8TA 1TYEB 4BVFA 4X20B 1N5KA 2WSMA 2IPGA 1NWTA 2PBRA 4OU1A 2G1UA 2HA0A 3B9DA 1SNYA 1UQYA 4DB7A 2HCBA 3NBZC 4UNIA 3HDJA 4XOUA 4FIQA 1HE3A 4DSAA 5CK4A 3WQSB 3ZGNA 1N8IA 5J5DA 4XDZA 2PPLA 4RJJA 4DG5A 4NK5A 3AJRA 1HTIA 4AJ2A 1P6WA 4DLSA 1XD1A 4JIRA 3VNMA 3Q1LA 2IHVA 3KLMX 3JQQA 3L7IA 4Q9HA 3P96A 3TV8A 4LYQA 4MA4A 1M6JA 3UQYS 1TV3A 1P48A 3C3BA 3TSWA 1HORA 2HY7A 3A9IA 3N73A 2FOLA 3JQ7B 1S2AA 2J7EA 3NLLA 3VZPA 1AZ1A 4AD8A 4TV9A 3U4HA 4D4JA 3UGVA 2I7GA 2OVLA 3MTIA 1RAAA 3T0AA 5I51A 5I07A 5K3VA 4MM1A 5BMVF 4L5ZA 3K2GA 4E1AA 1Z9AA 2FWPA 4TLMB 3SR4A 3K31A 4EI9A 4GH3A 2H2DA 3ZH2A 2JGAA 2QVHA 2H7XA 1NC3A 3ZGXA 2CJWB 4EVRA 5L3RA 1IVSA 2DJLA 3G7UA 4JUAA 4INJA 2I66A 3WYDA 2J0VA 2DZTA 2GPAA 1G38A 5HKBA 3LHZA 4A3SA 1A0EA 4AP6A 4J7UA 1L6SA 4XUYA 4Q1BA 2QQGA 1UQUA 4BO9A 2PDYA 5ILOA 1YW1A 4Y6PA 1XYGA 2Q5JA 4C5BA 1UUFA 3T0GA 4TUYB 1P62B 3DCIA 3O0KA 4OCZA 2YXXA 3PHAA 2BDQA 5FPSA 4IYRA 5I01A 4KXLA 1VG1A 4FGKA 4C0JA 3TQOA 2FQIA 3W81A 4FYHA 2OCIA 3HXOA 2L69A 4MUEA 1N5IA 2WKWA 4PUWA 2XM2A 1LL7A 1BWSA 2YVUA 3KVJA 3ODGA 4YV0A 6ADHA 3ICJA 5EGSA 2HN9A 2X0EA 2GZAA 1VI5A 1OXTA 2GPYA 4CN8A 4OGFA 1IF2A 3KB8A 1M2KA 1G4UR 3OZYA 3DOHA 2N1MA 2WAYA 4NJKA 4UPEA 3I7RA 1FDIA 4TUFA 1H0GA 1Z4QA 1DE5A 3LTYA 4PCLA 2YSWA 2ZZNA 3U7QB 1SRRA 1PS9A 4GOND 2HLPA 2CXHA 4WV3A 1E63A 4EELA 3DN5A 4ZL1A 3CRRA 4LHXA 4FO4A 3FBTA 5AW1A 3RO8A 4JR5A 3DVAA 1CY2A 1SUCA 3U2CA 1P9LA 1VIZA 3GG0A 3O4RA 2QAIA 4M7RA 2PGJA 5FX2A 1Q0RA 1NMEA 1TTPB 3RYHA 2Z08A 3G2LA 1PIWA 4JI0B 2EC5A 2VIIA 3AQ4A 621PA 3A23A 1SFTA 2GM9A 4RD1A 3SEFA 2IIVA 4JD4A 3M9YA 2G88A 4CIWA 2PDFA 3H4XA 5AXCA 1O97D 3ADCA 3GRCA 1N2GA 1AK5A 1PJZA 4KERA 5THXA 4LY4A 2IDJA 2F3PA 4K9MA 4ZI7A 3UQNA 2CMDA 1W94A 1ZUIA 4LNCA 1H1YA 1P0EA 1O3YA 1MO5A 3QHOA 1ME9A 2B4QA 4BO7A 3ER9A 3DEQA 2G9VA 2NV6A 3NG1A 2WHQA 4QDZA 1RU3A 3G18A 1FXWF 2PA3A 3C2OA 1XSKA 2J46A 3RTAA 2AE2A 2OYKA 2H52A 4KE7A 4D46A 1IL0A 3CSDA 1UWUA 3AWDA 1V5WA 1E2PA 3JATB 3QQ1A 4QS6A 2BB0A 4DZHA 3V8VA 4FDAA 3CRNA 1Q65A 1NUSA 4R7OA 4RW0A 1W19A 1XJ5A 4GVXA 2GOUA 3THQA 1GYMA 2OQYA 4DV1B 3GQBA 1F07A 1Y8QB 5FCZA 3X43A 5J8LA 5LQSA 2VDWA 4KGVA 3HM9A 3KOYA 5SYNA 4LJ9A 1P80A 3A2KA 4BVBA 4UR9A 2DT0A 4UTWA 1GDTA 1GSAA 3JPYA 2FH5B 3V36A 4P7NA 2VYNA 1Z0ZA 2I34A 4GOOD 2IWRA 3V4LA 3CO4A 1YVRA 1VCMA 1J5TA 4E5PA 4XD3A 3QELB 3NV7A 3MWKA 2XVKA 1H0HA 3TBHA 4XQCA 4D45A 1YNYA 4JEMA 5ALUA 3DBLA 2RK3A 3NBQA 5K8CA 3LWZA 1Z28A 3GC2A 3LCHA 4DR4B 4D92A 3G9QA 3CMGA 3CA8A 3RC2A 2CXSA 2IU3A 2YQZA 3JVUA 1YOBA 2GAFA 2NP6A 1VHQA 2IYSA 5FFFA 5J4KA 2P27A 3HU5A 3AY7A 4HH0A 1AGXA 2I56A 4AC9A 2HB6A 2C77A 3I4LA 4M60A 3X3HA 2I9EA 3VDHA 2HBXA 5F51A 5AI6A 3MC1A 2YRWA 1XALA 5L45A 3TG8A 1Q66A 4UTIA 4BFTA 3JQDA 3DR3A 1B73A 1R74A 3CC8A 3CLUD 3H2FA 3QXHA 2BTQA 3VHXA 4A6XA 1H6CA 4GHWA 1ZD9A 2A2IA 3MTBA 1LLZA 3C3DA 3FFTA 2R4QA 3WH5A 1X1QA 3GO2A 2I87A 1LQ0A 4OXRA 3MUAA 2O7NA 2BASA 1K3FA 2L42A 2E9BA 2Y2VA 4J3ZA 4S1TA 3ARUA 1N0HA 1P2TA 3NEPX 4YV7A 2ILTA 2OA0A 3WYAA 5JJ5A 3SXJA 1TKBA 2EEZA 1ZGCA 1KRBC 2PUWA 4PLCA 4YVXA 5JIPA 1J10A 5DYNA 4ZJUA 1WPXA 4TPKA 3AM4A 3GLSA 2PKWA 2XTNA 2WF6A 5JOQA 3BH4A 4IRMA 2FY8A 2B7LA 1DXOA 2FPIB 3CX6A 4PEKA 1ZJJA 4NAFA 4UHFA 1XSIA 1K63A 1THMA 3VU0A 2JJMA 4Q3NA 4QITA 2XHYA 4FN5A 1I33A 2BX7A 3DJYA 4OX9B 3H2EA 4O0MA 1G291 3KJIA 1SQGA 3ZBPA 3PF8A 4IHAA 2ZZKA 3N7AA 3NEYA 1E8MA 5F52A 2ZUSA 1S2UA 5K3DA 4J3WA 3OOSA 1GNXA 1SQSA 2EFJA 3POHA 5EMJA 1VQ1A 3PANA 3JSAA 3U6WA 5KAPA 4CLXA 4YJ2A 4F3KA 4RWEA 1PO7A 3V1UA 4DLFA 1KV5A 4TR9A 3VR5A 4BBAA 3AK4A 5BWMA 4ZT7A 2OCYC 1NAL1 3E22A 1CB2A 1W5SA 1H1TA 2XMSA 4QATA 3OF2A 3LPGA 3NL6A 3P84A 6Q21A 3GDRA 1I7PA 4PMYA 1W76A 1CLXA 2Z0IA 4KUHA 1AMNA 4E4PA 4CM6A 2W6JA 3HF3A 4CFZA 4ZARA 1XNQB 4XD4A 3GWGA 1ZM2A 5F2MA 3HKCA 4B2DA 1S6YA 4MVJM 4TM8A 3NU1A 3AS0A 1K88A 4F1KA 2J5RA 4Z3OA 3H5RA 2QQFA 3A3PA 4JEHA 4IJBA 3EH1A 2VRBA 3DNFA 5D2XA 3LRXA 1R7RA 3L8MA 3DFHA 2VZLA 1WUYA 4PRKA 5KYNA 1LW6E 3UMRA 2Z1DA 3P52A 5TMPA 4U3JB 3PVSA 3DEYX 3T5DA 4M53A 1GKIA 1GZ4A 3WNMA 5H8UA 3FIJA 2G4CA 4LRUA 2J3MA 2PRKA 2DHQA 2G3IA 4YTUA 4R8SA 3WLTA 4GKAA 4YAUA 4V0MA 5T8KA 4QGBA 1N0WA 4D0LB 1KSFX 2YWBA 3GIQA 3NL3A 4KO3S 4DPMA 4ACYA 5LQRA 3EYWA 3E9CA 1JA9A 4KR3A 4WVXA 4HBGA 4AWAA 5F5NA 3WB9A 4MFDA 3MJEA 2YGYA 1VFNA 2I2DA 3PCXA 4X7RA 1J8DA 4K8EA 4HOXA 5I3JA 1RE0A 3I9NA 2HSEA 2V5JA 3GP5A 4U2DA 3JWGA 1B3YA 3HI4A 1HR0B 3FWZA 1JFFA 1ITCA 3GRIA 2I33A 4ZQPA 3SSMA 4MVJH 3LLUA 3LPNA 5AJXA 5AW8A 4LVAA 4LJAA 1JR1A 3D5TA 1Q6YA 2FFJA 4UQDA 4OY3A 1EIXA 3H21A 2B4TO 1UPXA 4ZVJA 2ONYA 3ZNQA 1V9LA 1XJQA 4F12A 1F2TA 4DHGA 4F6RB 3VO9A 3QY6A 4M49A 4NV1A 2VHVA 2CV2A 3AI1A 1MXGA 2XTKA 4UTWC 3D8RA 4H7ZA 4S3CA 3SS7X 2TECE 3MTGA 3M4XA 1KE1A 4J4BA 4JU9A 1YO6A 3V5NA 3EPPA 2GN8A 4N2YA 5CCZA 4DDKA 4ZYVA 2AXPA 2AJBA 5KTRA 1DLIA 4JBHA 4Q9KA 2G97A 2QRHA 5KHLB 3WQ5A 1BMTA 2VFDA 3ND8A 3IAM1 3AUYA 3EVTA 2BHSA 2ZTLA 3O95A 3G8EA 2BGKA 5AHEA 3KL0A 1U7WA 3IC5A 4FT4A 1R87A 4P7JA 3IAQA 1Q3NA 3KTFA 3AEZA 4LZAA 4W5WA 4NBKA 4BJ6A 2PP0A 1O9BA 1GIAA 1OG6A 4KFCA 4RR4A 4DSUA 4FBMA 2B4GA 2CNBA 3TEJA 3CR7A 3S9ZA 2GF9A 4JTAA 1KHTA 3BSYA 5I4KA 1YFKA 1JL3A 1ZUAX 1V95A 1XV8A 1VBKA 4A0HA 2P5NA 5AKIA 1LA2A 2V3VA 1YB4A 4GMEA 3NHLA 4I6JA 5BSMA 2QN1A 1XQ1A 1NA5A 4GIRA 1E3XA 3TCXB 1K66A 2FGKA 3M9XA 2Y5EA 4DEVA 1RWPA 5BNIA 3WL6A 3NTLA 3M46A 1SC4A 5I7EA 4B2PA 4GOAA 3TNBA 2M2IA 1AKRA 1N1DA 4TIMA 2YVKA 3DFIA 1LQTA 3QV1A 4KQ2A 2XV1A 4UNNA 1NI4A 3BXPA 4IIBA 3L4XA 1IIRA 3BWMA 2ZIAA 4JQ2A 4EX6A 3GTXA 5AMXA 1Q11A 4XUGB 2Q2OA 3VZRA 1Y9EA 2HOQA 2G5WA 1KNWA 1BD0A 4OQEA 1KHHA 4XD7A 2HX1A 3VSCA 3IDQA 2DVTA 3K46A 1B4KA 3NOXA 3O1LA 1EP2A 4LBUA 2G1JA 4HEA6 1ME7A 3L6BA 1FWJC 1EPXA 2G9ZA 1DTEA 1XD2B 5IAEA 1NP2A 3DFPA 4WASA 4XJXA 2XRFA 4BO6A 1XQ6A 1C8VA 3B9RA 4H9TA 1NW4A 2FPYA 5AW4A 1CVRA 3ROPA 4BGIA 3OFNA 2BSQA 3SQOA 3W8RA 4YCPA 1WV1A 2O3RA 5JBNA 3U16A 4C2BA 2MANA 2WPNA 3BAKA 2DQ4A 2Q50A 3N0RA 3M33A 3U39A 5I47A 3KLPX 3LBIA 3QOKA 2OGZA 5JZ9A 5JWHA 2HSZA 3LHKA 4RIFA 1QRAA 2ZIXA 5LVAA 2XVNA 2AR9A 1I2ZA 4L56A 3FVMA 1WQ3A 3I4EA 2QCEA 4IX0A 1C8KA 1P1JA 3NRJA 1T4DA 3ROMA 2GKGA 2A4MA 3WO8A 3DIPA 4KVGA 3NC1C 4PIPA 4G9PA 4B4DA 1T2NA 1WSAA 4R2HA 3WF4A 2OLJA 1W5AA 4CQJA 1YQ9A 4H7PA 4XAZA 3ZU2A 2WB2A 1ZESA 2ZWZA 5JSUA 4I4LA 3I45A 5KITA 2E0PA 1E7SA 5KNLA 1F9EA 2P65A 1S96A 2AFIE 1NX9A 3GXPA 1JFLA 2J33A 5FH9A 3UTCA 1AV7A 1XAJA 1Y48E 1UMDA 2ODNA 1GQRA 2V1XA 2O5CA 3GDWA 3BD6A 2EWMA 4JQ3A 1EQAA 3I5MA 4GPIB 4LOLA 5EIWA 2QENA 3D7KA 2XFWA 3IGHX 3LT4A 1RS0A 4PSVA 3FJYA 3EX4A 1E9SA 4DLKA 4OD0A 5EKYA 5H4GA 1C3JA 5DCBA 3CV3A 3KD3A 4LZLA 4DYEA 3NASA 1F5ZA 3ESCA 3DLPX 4FAMA 3GVXA 2XZDA 4QELA 2FW1A 2ZRGA 4J3VA 1TO6A 1HT6A 3UYCA 3AILA 2XN2A 1QI3A 4RVOA 2HTFA 3ZSTA 4EYEA 4BO5A 4AY3A 2I3DA 4B90A 1T5SA 4R1OA 2DAPA 2Y24A 4YJ5A 3UICA 3W70A 3GT7A 3IAUA 4S1PA 4ER7A 4OQ4A 1UPUA 3EIEA 2X23A 1MQSA 3DXYA 4KXFB 3E2RA 2HRZA 5DI3A 4EI8A 5KWIA 1U2YA 4YHGA 1LVUA 3AHTA 3HZHA 1OILA 4A0QA 4Y9RA 5L8VA 3GUGA 1DDGA 5HE8A 3KBOA 1RRMA 2JFNA 2W5UA 3L7AA 3BQ9A 1RBMA 2VFHA 2QI9C 4PYOA 4NZZA 1N6PA 2Q9CA 3U17A 4I5EA 1S01A 4C7GA 2SHKA 4E3WA 5T4FA 4Z1YA 4QG3A 4YV1A 3QX9A 1SFLA 2KMLA 2YX1A 4BLVA 4XIIA 4CV2A 4QNWA 3O8BA 2E82A 4U7WA 4XKJA 3LGGA 1QMGA 2V7UA 3MJDA 5JVDF 4NAHA 4HDNA 1DTNA 2BGUA 3QFHA 4Q24A 1EGZA 4GGOA 4M6WB 4ZV4A 1HO3A 1UH3A 1DSSG 5H7XA 1NFQA 3BW2A 4WLEA 5BWOA 4PZDA 4EZEA 3HUUA 1U8YA 2Z3ZA 5U4XA 4LUTA 5HQLA 1A3HA 4BZQA 3COWA 2QCHA 1Q22A 1AQMA 4XXHA 1KVTA 4UHJA 5DN1A 1GVYA 1B2YA 4DPPA 4X0VA 2Q99A 4GX1A 3T3OA 5K4XA 2F9LA 3VX0A 1Q3KA 1UC5B 3CPUA 2BEVB 4HA4A 2Z1XA 2P9TA 1KMHA 1NBOA 2OXIA 1OBHA 4YI3A 3WGUA 4ZAXA 3H4VA 4KVAA 5T26A 1GZSA 221PA 4B0PA 3QZUA 3Q7PA 5KIAA 1KKRA 2WILA 5SV2A 4DJEC 3C15C 4XW2A 4BCCA 5I24A 1ETHA 1CZNA 1U7TA 3MRXA 3CWCA 4ZGWA 1LSUA 3VNZA 1LQ2A 1AIPA 1U3CA 3E9RA 1V8OA 4KWVA 4OK6A 4WJXA 1X7ZA 4CJXA 4EZBA 5B55A 3W2JA 1O1HA 1XIBA 4LNHA 1L4BA 1ZS2A 4CKZA 3FCEA 1O4UA 3JZMA 5L3ZA 2ZBGA 2VG8A 3HJNA 4PWZA 2PGDA 5BRAA 4HGNA 1TG7A 1DC4A 3NTOA 1XKQA 2H48A 4HK6A 2OSVA 1HG0A 4U39A 3V32A 3NM5A 4RFSB 4CKWA 1YQDA 1OOEA 3KYDA 4KXYA 4IDFA 1Q6OA 1ISJA 3WLLA 1SIWA 4GBED 2QZRA 4F4CA 3NG3A 1X7YA 2PYIA 3BCDA 3B9QA 4JTJA 2YYTA 3H53A 1FFXB 4KBXA 3Q7IA 2QLJA 4I4TB 4MO2A 4ADSG 2OGJA 4HDKB 3OUUA 3IXMA 3PA8A 4B5KA 4C1LA 1WF3A 4R3UA 4HMEA 3BFXA 5AT1A 3LCRA 4RESA 2P6PA 3LV8A 4WNAA 1CHNA 1W29A 4QUGA 5JO9A 1IPFA 3RG8A 3D6NB 3UP8A 3MWLA 3BKWA 4FOOA 4TSKA 1XYBA 3Q4DA 3V7NA 4J0IA 1UOKA 1DIEA 2IOFK 1H3NA 3UU0A 4N6NA 3RF7A 2JIPA 2YKGA 4N42A 2BFBB 3D3NA 4CIDA 3FHAA 4AEFA 4HDAA 2BEWA 1N36B 4GPTA 5FWXB 3TNDA 4HK5A 5A2GA 2RHMA 1G5HA 1EKXA 1NTOA 1AF7A 4YC7A 2WW5A 3L7DA 1LSSA 2C82A 4G2NA 1ZJZA 1HYBA 4DLMA 1ISGA 3WKEA 1UWTA 3LD9A 3LDAA 3A5FA 2CF5A 4MWBA 1DG9A 4NU5A 1V1MA 4PLZA 4M80A 3RAOA 3WV5A 3P2EA 2HQ1A 3VPXA 4XWUA 3FA4A 2Y1WA 3L5AA 3S47A 3TM4A 1FWCC 4NRDA 2JQXA 1YK0A 4NOJA 3BOFA 5MKGA 3O0DA 4F3NA 3VK5A 2O9TA 4K1XA 4ZTBA 4EJMA 2AN9A 4NAUA 3P9NA 3IBGA 3B8SA 3DOFA 5BSKA 3LO8A 4EXAA 4QDUA 3OOEA 2WQ6A 4OH7A 2TAAA 1N2EA 4TROA 5JSYA 2CETA 3SQMA 1L4FA 2YWXA 5DASA 2AQOA 3II6X 5LQUA 2HA7A 3KC2A 4KE9A 2YYUA 3O94A 2NT3A 2Z1NA 3LZCA 4EVSA 4NBLA 4G8CA 2Y9MB 4HDRA 4DJED 1UZHA 2XCUA 4XASA 4FINA 1XINA 4BWYA 3VQTA 3VPDA 5KNDD 3I9V1 1SVSA 2FOIA 4B5SA 1ZXBA 1E0AA 1W44A 4QPPA 5CVUA 1I14A 2X9NA 1GPDG 1XIHA 3HXTA 2GN0A 3B70A 2WMGA 3SY8A 4DLYA 2V8BA 5BSFA 4DNHA 5H68A 1X98A 4W7HA 2BHYA 1C3VA 1YDOA 1QG0A 3I32A 5FKYA 5JISA 1BD3A 4E30A 2JF7A 3A36A 2VOEA 3CW2A 2OBBA 2ZZ7A 3KETA 2F2KA 1CULC 3SLGA 4L8FA 1J9GA 2RHRA 3N39C 2WKPA 1A9RA 3PZVA 1HJUA 2PBOA 3KBWA 2QGZA 4IHCA 3I8XA 1W85B 3MVTA 5CLQA 1BWPA 3EPLA 4NJHA 3OPYB 4F2UA 4AFYA 2JAOA 3UZJA 3R9IA 1X87A 3B0YA 1C7RA 2R8YA 2UAGA 3DXZA 3R79A 2ERXA 3CWOX 2XYVA 3TEVA 1I1OA 1RFGE 2NW6A 2Z8ZA 3VH3A 1M7PA 4YLYA 3KOZA 4CV1A 2XZ9A 4W86A 1JA0A 3OZRA 4MR7B 3D6MA 3FX2A 2HZ7A 2QV4A 2YRXA 3G2NA 4E2VA 4LTDA 4U4MA 4JFSA 1JHZA 2H2GA 3L3BA 4QRHA 1VFMA 3S70A 3RHFA 1H05A 1E40A 3TPFA 1ZENA 3OBAA 2IVZA 1W1WA 2Y0PA 2VEIA 5I78A 4L3OA 4PNZA 4QQKA 1F74A 5FEWA 2ANUA 4I3GA 3BS4A 4I55A 3DECA 3REQB 2WYIA 1II8B 2QXWA 3V48A 3ZDRA 1E7WA 5J47A 2DQZA 3P0FA 3R1IA 4D6HA 1YIOA 4BI7A 2A4AA 1UQTA 5LNWA 3B7GA 3W9ZA 2Q28A 1RP1A 4DLRA 5LQNA 5AYBA 1QZTA 1JZ8A 3H8JA 3UIEA 3SC3A 4AT1A 4A26A 4LRWA 3WGLA 1MA3A 1MO2A 1QR7A 2FMOA 3N0WA 3HGOA 3NWJA 4BNJA 4Z2JA 1JIJA 3I9MA 4H16A 2VA8A 2GJLA 2HT6A 1WXHA 1XLAA 3RS7A 4PTNA 4MF4A 4P9NA 5AIAA 3OQBA 2QLBA 1W1IA 4KRZA 2PDKA 3BZBA 3MGBA 4HAWA 1JG4A 3ZKWB 3LXCA 3UMYA 1SBZA 3DV0A 3FVTA 2VDUE 1EIWA 3KWXA 1QTQA 3W1MA 5F4SA 5C70A 2HQOA 3W1PA 1UROA 1CEYA 4JX6A 4CN1A 1ZR2A 1ZD1A 4CM4A 2PGLA 3OZ7A 1D0VA 2DH6A 4ZE5A 3OKPA 5EE9A 2JVIA 3MUIA 4EA7A 4PO9A 2R87A 1MAAA 3EDEA 2GJAA 1ZICA 3ARVA 3KQOA 5AKLA 1JDBC 3IAM6 1T24A 2UUBB 3VI2A 1NASA 2OFWA 3KQPA 3GW3A 1GKRA 1IBCA 4IDEA 4PPFA 3MWGA 4O1IA 3VBCA 1QIDA 2AHRA 3RBXA 3B9PA 1RLDA 4X7BA 1GYQA 1KIFA 3JZFA 4OV9A 4B80A 5FSEC 3WDKA 5J1TB 2WSPA 4GZ5A 4BUZA 1Z56C 1WX0A 2X1RA 5JDIC 3P8JA 3VC5A 2WYOA 5D01A 1GRCA 2Q45A 1Y63A 3QLEA 4DZRA 2N3ZA 1I4LD 1GOXA 4XZ3A 3C7DB 3VR2A 1M8FA 2NVBA 2QYOA 1YS6A 4CG1A 3E8MA 4IDDA 4MKZA 1UPBA 4D3SA 1ORIA 2DPHA 1YR3A 4KQFA 5FHRA 3OYXA 1KSGA 3KDOA 2UYQA 1N6OA 2F64A 5LC1A 4WFQA 4NHVA 1EFPB 4IY1A 5AYXA 4F86A 4BBZA 2B7QA 5HCUA 3BXFA 4WKBA 3WSWA 1UMYA 2H4ZA 1J0EA 1N1MA 3A1NA 1BTCA 2QTVB 1TE1A 3L6OO 1V5FA 2I6QA 4K0KB 4Q6BA 1K1DA 1EFCA 2R68A 1BD4A 1GK8A 5LD2C 1ZK0A 3H83A 2X8JA 3PDJA 2JAXA 2ADFA 5F1YA 4C3OB 3ZDCA 3QVVA 1TZ9A 4J29A 1V7CA 3SI7A 3ZVMA 2PPGA 5JQGB 5IF3A 3O21A 3GW0A 4ACBA 1ZOLA 1IAQA 2RGUA 4BF9A 2FPPA 3O5AA 2JA2A 3I28A 3NANA 1V3IA 1KO4A 2VFFA 5BUSA 3U3HA 3TMYA 1QO0A 2QS8A 1AL8A 2FCRA 1OI3A 1XEFA 2C3ZA 3I58A 1M41A 4HKPA 3RK0A 4XA8A 1XMIA 4IMRA 1YR9A 3SHOA 1R3WA 5DT7A 4H8VA 2WG2A 3B2EA 4P22A 3SEAA 1BX1A 3ROQA 2PXHA 2FH6A 2YFOA 2XVGA 4Q8VA 5CB8A 4N4AA 3KB2A 2PI6A 1Y7LA 3EBOA 1K7FA 4H4CA 3OPQA 4IIDA 1EX5A 1O95A 3AF6A 4EWLA 4JOSA 1NSFA 1RMTA 5IVKA 2I4RA 1K97A 3UB3A 5DX0A 3M1ZA 1Q0HA 4L07A 4KO8A 2JFHA 3HLKA 3W2EA 4LY3A 2DZWA 3R3XA 1U9IA 1QNQA 3MXOA 1GPH1 3MCUA 4CMJA 3BAWA 1DUSA 2FSHA 1GPWB 2QRLA 1GRRA 1DQRA 3G24A 1E0KA 4G09A 1GQFA 3EGDB 3MYRA 1H41A 1ZUNB 4RVNA 2R1MA 1R6DA 1GQJA 1SXPA 4MYTA 5HR7A 3H23A 1BF6A 1OGSA 1FU4A 5BNWA 1XAGA 1XDLA 4WW0A 4YRNA 1CUAA 2BBSA 1MXDA 4MIEA 2W2VA 4FHFA 4I9UA 3HJBA 2NZUG 2AB0A 5KBYA 3LQGA 2JJQA 1P61B 3IYLW 2WPDD 5K9ZA 4GINA 1AKEA 1T5BA 2GFHA 1J4EA 4JLAA 1UUMA 4R69A 3UKJA 3NA8A 4JHZA 4YHBA 2PZEA 5CLJA 1PJBA 4GLFA 1JU4A 2XCRB 3K1YA 3PX3A 3DHUA 3LJKA 3G2IA 2D7JA 1CSEE 5GJWC 1P45A 2O05A 4DJDC 5KOHA 2Q6LA 2WKRA 4S12A 3PC6A 2HREA 5AWFC 1P7TA 2AFIB 4YRMA 1C91A 2VJMA 1LL6A 1NF2A 2AI2A 2A7NA 3HXQA 1QVWA 4JV5B 3NTXA 3E18A 3P2YA 3VJLA 1I1HA 1FP2A 4JB3A 2WDPA 5MFZA 3F7OA 3MHPA 5DMHA 1WDRA 2XNJA 1E4OA 3V4FA 2XU2A 3L4WA 3OZXA 1E72M 1NNUA 2JK0A 1VCHA 2NXJA 3P2JA 4RJ2A 4CCZA 1YBFA 1FSFA 4J0GA 2ZT5A 1N7JA 2Y66A 4RPIA 3LCFA 3CLVA 1LPPA 3ZQUA 4WMLA 1FP8A 1DE0A 4JI4B 2CC2A 4M1OA 3QVXA 1QGUA 1Z0KA 5LJIA 5HYVA 3DYBA 3S9IA 2R00C 3EVBA 1T8RA 5ITWA 2ZYGA 3N58A 5EY5B 3WBYA 1R30A 5LP6A 1Z74A 2IF2A 4Z9FA 2FEAA 5FUBA 4R27A 3AI7A 1E15A 1ZD8A 3M34A 4OGLA 4F45A 3DDCA 4Z2IA 4N54A 2X8AA 5GOTA 4GEKA 4Q15A 2ODOA 3PX7A 4FX6M 3SLKA 2Q9UA 2XKAA 2DPYA 1W581 5A3JA 1UL1X 4Y6GA 2ZR9A 4UFKA 3FTFA 2Y89A 2CZDA 3KAKA 4KESA 5H59A 2O5VA 4PA8A 1JMYA 4C6IA 3KDPA 2P9YA 1RMYA 5BVGA 1CT5A 3PQ2A 3MP4A 1ZH6A 2X30A 1R4AA 1JSZA 1V0NA 3CHVA 1HWYA 1ZD5A 3SCNA 3M5XA 4LOJA 4N3AA 2GSEA 2W2LD 5KU1A 1VBFA 4M0DA 4GQIA 1EC7A 4OATA 5D7NA 121PA 5JPCA 3O16A 2QLYA 4HUJA 3BL5A 2C1IA 2FR1A 5DNVA 2NMVA 2VSYA 1G7TA 1RXEA 5TC4A 2Q29A 4CD6A 3AMCA 3K8LA 1LB1B 1C0PA 1E94E 1D04A 4O0LA 3VNLA 2RGEA 1GM5A 1T9BA 3QOWA 3DENA 4JXXA 2Q7DA 1XRRA 1UMLA 3QM1A 2O56A 4CLOB 2OLAA 5FOOA 1WCV1 1V5EA 1DIGA 1HL9A 4QEHA 10MHA 2ONJA 3PPFA 2OUKA 3DE0X 4BKMA 3ETGA 5CB4B 4FFRA 3IEVA 1EP3A 3WR5A 4DJDD 1ISVA 5CM2Z 2NTEA 3DZFA 1IIHA 1UMBA 3KR1A 4HU0A 4N0PA 2W98A 3GMSA 2W4MA 5C4IA 1ZALA 2GHQA 2YCLB 3ZS4A 1RAEA 2MSWA 1AMOA 4O2AA 4DS3A 3R24A 2PDCA 2F48A 3OB8A 5IN5A 3R7WA 2C79A 5E4YA 3RAGA 5BW4A 1PL8A 5C8YA 4G07A 1C3FA 4PS1A 5A6SB 3CAKA 1MH1A 1QW7A 2GXAA 3PWZA 4RDCA 5IC4A 1HT3A 3TUUA 2Q3FA 1G3UA 2ICAA 2BHZA 3ETHA 1OCEA 1P2GA 4XJVA 3LS9A 4C9BA 1XH2A 4O2BA 1JUKA 3A4TA 1V7QA 3GNTA 1OTXA 1XCXA 5C53B 4Z49A 5FULA 3G1RA 3R3ZA 3M1YA 4HT3B 2W8BB 4NL4H 4HUTA 3GXFA 2EIXA 1BVHA 1GR0A 1JCXA 2YIVX 5HR5A 3VVMA 1OFOA 1V5GA 2QJNA 3N2ZB 3COTA 2PUFA 5K1ZA 1Y4DE 1F3WA 3DO8A 4J0EA 4DQDA 3TAUA 4DBLC 1JIBA 2IY9A 3BMOA 3KAQA 1W5NA 2YWCA 4E13A 5G1MA 4TL6A 1L2UA 4MH0R 4NG5A 3EX2A 1EFVA 2FJUB 2J85A 2O06A 1CZHA 3QJAA 5E4JA 4TRJA 2XBUA 5AVJA 4A36A 4ZVQA 3FLEA 4O8RA 4INAA 4M7SA 1JLSA 2VA9A 1R8QA 3TFQA 1CDOA 2C0CA 4GMFA 4LAMA 1ZM9A 3LXRA 2Z04A 2KS6A 3G3DA 1BWVA 1A5CA 1X8CA 3EDQA 4ARSA 2HH9A 4ZOAA 3IVCA 3ELYA 3JVEA 3ZHUA 1QU4A 3I2GA 1K02A 3QY7A 3KQYA 1A1SA 1AW5A 1QP0A 2X4GA 3HA2A 3SUVA 4TWIA 1L6GA 5I9NA 1UZNA 3W72A 1NU5A 5FLYA 3RNDA 4Z2LA 4BLUA 5KTNA 2Z7KA 3AZOA 2WNWA 2HNHA 1YZKA 1NY1A 3GCWA 1PT8A 1KVUA 4OYLA 3NDYA 2DUAA 5K6RA 2R6FA 2UUOA 3DVRX 5ESRA 3LBFA 1R3QA 2EFGA 3DU0A 3T9FA 4WERA 1LLDA 1L5NA 1U5CA 4MLCA 5E2IA 2OENG 1OBVA 2AFVA 5AK3A 3BLKA 2I1WA 4PGGA 3SJAA 3E9NA 1SVMA 4PAMA 2C1GA 2A0YA 4I7EA 4KMOA 4FK8A 1XVTA 4L28A 3LLXA 2QORA 1M72A 2MOKA 2BOEX 2P5UA 3TN5A 5HS6A 1G1AA 5JQWA 1X1DA 2PS2A 3MCNA 3URMA 5AW6A 4HHMA 3AV3A 1QUMA 2VBIA 1X7WA 2EAUA 1C3OA 3N9KA 1Q1EA 1A5SB 4AF0B 1FYWA 4LFYA 1Z2PX 1W88B 2C1HA 2H1LA 3N34A 5BN1A 4CCYB 4MCHA 1CIJA 5DCUA 1XHFA 2ZVRA 2HKIA 1I7NA 1J2WA 3CEMA 4AM8A 1JTVA 2OUIA 4JOCA 4X91A 2PT5A 3GLUA 1XVAA 3QNWA 2V65A 2QKYA 3MY9A 2NW0A 4MHBA 4J3TA 1XK7A 1IXZA 4LF4B 3AHDA 3P0JA 4JTSA 1H93A 2NT4A 2HA6A 3K8MA 4QVIA 3CLRC 2P5YA 4L0CA 4J16A 5A2CA 4DA8A 1BJRE 3GFSA 3FJLA 2TSYB 1YPFA 3NOYA 1VP3A 5I7FA 2E4AA 2WD8A 5A3SA 1TIBA 2PL1A 1EZ4A 2EOAA 1QOQB 2WAXA 3URQA 1DXFA 2PD3A 3IKLA 3EY4A 1C1YA 3MWYW 4PC2A 3UV7A 1SYTA 4IJCA 2WZIA 5CA0F 3ZJUA 1WKDA 3OZSA 3GMDA 3L18A 3I76A 4YRIA 3EZ2A 5JCXA 2HADA 2ZIFA 2C2KA 2PF8A 2Q71A 4A29A 1Z34A 4H7JA 5BW8A 1SU7A 1ZD4A 2E4UA 1Y4AE 4YDHB 4QXMA 4X20A 2ECPA 1GOOA 4ZR8A 4QO8A 1OC4A 3THRA 2ZCGA 4K05A 1F4VA 2GCIA 1JSLA 2DPXA 3EJ6A 4W1SA 2WG0A 2ONEA 1A9ZA 5EA2A 2PJZA 4RTNA 2C84A 1XZJA 1ZISA 4UEWA 3E61A 2ZUDA 4LQDA 1JZ6A 5DH9A 4S39A 3AKEA 1XH0A 4OJKA 1U1EA 2NV9A 3A6OA 4C87A 3D1JA 5D9NA 1Q91A 4E3VA 3WIJA 4KOAA 2RBEA 4CVWA 5A5WA 3SAZA 5B4UA 2BVDA 5DMNA 3GNQA 1FOEB 1IFXA 5JZBA 1VDMA 1R9JA 2E67A 3WWYA 1ULAA 4UUIA 4F2GA 2ZTUA 1OSNA 1AJEA 5FOVA 5KNBA 1GYLA 1JAEA 1OB0A 1HT0A 4MYCA 2XYRA 3EOBI 3T9BA 3F5KA 3U0VA 1FW6A 3KS5A 3DZGA 3W7LA 1WB6A 1IY0A 1EIBA 1XLTC 4ALMA 5FLKA 4F72A 5HZHA 2DUNA 2IXEA 1ST3A 4KRTA 4EPVA 1EAYA 5BXRA 5CXPA 3T0TA 1C8BA 4ALNA 1RLJA 1XPJA 1TRDA 4KAXA 3AB3A 5I9SA 1C4WA 2CJWA 3IQZA 2NO7A 1RD5A 2Z8YA 2OEKA 1P19A 5G2OA 1RXUA 2F2HA 1EVKA 2HCFA 4UOQA 3U9IA 3CASA 1F8UA 1WHSB 1O94A 3VR5H 1F2DA 1CB7B 2DHEA 2DUMA 3QFWA 3N14A 1A9XA 2XTMA 2BGJA 2C8LA 2NAPA 2CZ5A 1NBEA 2ZDQA 5FNVB 2DCMA 1HVQA 2PH5A 4RMIA 3AX6A 3L07A 4CEUC 4UAUA 4C4OA 3F4DA 2DSTA 1OASA 2YDRA 4QODA 1KVRA 2QX8A 2HHCA 2ANBA 2B2XA 3W84A 4HVAA 4TT8A 5AQEA 3V8EA 3C4JA 4J3SA 1O4WA 5JASA 3OA5A 4L1GA 1TI7A 1BYUA 3N5KA 2C4UA 3QTBA 4Z0JA 5JXIA 1NURA 4BWLA 3K1JA 2HF7A 1TWZA 1FVPA 3OY2A 1WD5A 3UJHA 4L6CA 2QBYB 3MTWA 3MJVA 4RADA 3SCUA 5GPRA 4RNFA 3WY1A 2VN8A 2XKBA 4HEA1 3S2IA 3NYQA 3DFYA 3G22A 1IJKA 4PHTA 2WZDA 3U7QA 2ZXEA 1QOXA 1GHRA 4ZD6A 2WOOA 4XQEA 2WNIA 1LT8A 3WBWA 2DUZA 1E99A 4KEZA 3ZK9A 4EUHA 4B5LA 5FJOA 2PLNA 1ML4A 4TQTA 3KJGA 4W1PA 2FK8A 4Y6QA 2XYLA 1NVVQ 3MJCA 4ZCIA 1TTPA 1DBIA 4IWYA 3TI7A 1N2XA 4O11A 1XWYA 1T9DA 3LUKA 3O84A 4YCJA 2ZUUA 3QH4A 2DPMA 5BNTA 1HUVA 4XD5A 2A1YA 5K4ZA 1BZYA 1QXSA 2NV2B 3EWNA 4IXXA 4H7VA 1C4OA 3MV11 4LUJA 1OCBA 1U0HC 1ZHOA 3U9TA 3UT5B 1R38A 2IIPA 1J09A 3UWVA 3PQDA 4XQGA 4LZWA 1YVEI 3TNLA 1KLZA 4C6TB 4RTKA 1P81A 1RQNA 1C14A 3AR2A 1W8IA 5EKDA 2OXRA 1M54A 3CTPA 4R8RA 4EB6B 1T0JB 4D81A 3JSXA 1Y5VA 3NBUA 3RCNA 4ZZ9A 3KBSA 4K3UA 4L9AA 1F5NA 4G4JA 3RTEA 2XADA 2AMXA 1GGOA 2BZ0A 4RXGA 4JNYA 2NYRA 5TJHA 1UKPA 2H2HA 2HVMA 3ZVLA 2DHCA 1IK6A 2J3DA 2D1RA 2RDMA 5D02A 1G8JA 3KVYA 1NSYA 1E4IA 4QZVA 4R34A 1XTIA 4Z4QA 4Q22A 3RUAA 4X3OA 1A5LC 1XQWA 1EK5A 4RTLA 4KCTA 5HCIA 3C6KA 2ZBFA 1SZJG 4AG5A 3PQ5A 1Y8QA 3UHAA 2XWPA 4C78A 2E1PA 2OU4A 4HU8A 1OYVA 3N86A 5I45A 4BE7B 1PIGA 1WXQA 3BA6A 3FUUA 2VFGA 3H9GA 4RPKA 4BEQA 1FX0B 3GB6A 5CH8A 3N3TA 3SS8A 3PL5A 4R54A 4Q4SA 1QZUA 2OD9A 2QTFA 1LD3A 3L43A 3K9WA 4F92B 4ZQNA 4IMAA 4FX5A 3V16A 4C43A 1CJKC 3LP8A 1M1XB 3QU5A 3MRVA 3KJNA 1NGSA 4P31A 3QELA 1GUBA 1NATA 5D30A 2NXWA 3LY7A 4FPXA 3AXMA 1NP0A 3FPHA 2ZIUB 2HS6A 1TM3E 1Z0SA 4PRZA 4XUEA 3LUPA 3FHTA 5DGCA 4GI5A 1KBJA 3TTUA 2L18A