5EMKA

Crystal structure of prmt5:mep50 with compound 9 and sinefungin
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emkA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emkA02
3CKKA 4QTTB 3AAMA 2AOXA 4U7PB 2P40A 3B5IA 1BHJA 1VL5A 3BZGA 4DM3A 1JR4A 3HCAA 5GIOE 3UJ6A 3B3GA 3CBGA 1QYRA 3M6WA 3EEYA 3KTCA 5IKMA 4RTKA 1D8WA 3CGGA 4ZBCA 4C4AA 3FZGA 4FP9A 1YX1A 1BXBA 2ZZMA 1JG2A 1WZNA 2PT9A 5GP1A 5E2AA 2JH8A 3SSMA 3LBFA 4CWAA 3UJ9A 4DCGA 2G8NA 5FUBA 5EQJB 4QDPA 3REOA 2UYHA 3M6UA 4PGHA 4E2WA 2HK0A 4OA5A 4PYQA 5E9JA 3TKYA 4F85A 1WXWA 4RYLA 1I6NA 4YUYA 3M6VA 2ZWVA 3AJDA 5F2KA 1INLA 3KCJA 3KCOA 1JTFA 3FTFA 1RI2A 3M0YA 3KQVA 4GC5A 3SSOA 4WVLA 5DT2A 5M5BA 4UOEA 3DXXA 5EOVA 5C1IA 4CKEA 4FR0A 2HMYB 1DE6A 5EIWA 3C0KA 1R74A 3QV2A 3A7EA 1QTWA 4GBED 4RWZA 2OYRA 3OZRA 2BM9A 5ICGA 4EAYA 2C7QA 1FPQA 3P6LA 3E23A 1TPYA 3G5LA 2P3OA 3NTVA 1NBHA 2HV9A 3A25A 4KVZA 4RSRA 1XLGA 4IV8A 2G4JA 5FCDA 4FSXA 2PVCA 2IFTA 2UYQA 4PYOA 6XIAA 2NNWB 3I58A 1P91A 4RTLA 3P9IA 1I1NA 2B9EA 1X1BA 5K09A 3S68A 3PTAA 8XIAA 1YZHA 2PWPA 1M6YA 3HVKA 3FUXA 5JR3A 1QUMA 3I64A 2XIMA 2PJDA 3HP7A 5CVVA 3FVMA 1XCLA 3EVZA 2IDKA 5D1NA 4K1GA 5DM1A 1R8YA 3B3JA 5E1OA 5ERGB 2OZVA 2ZWAA 2AVDA 3CQIA 2P35A 4HGYA 4X60A 2IP2A 2OXTA 4DZRA 4EQZA 5DRYA 1OADA 2NQ9A 3VYLA 2VDUE 4R05A 4F84A 1ZGJA 4Z2YA 2UYCA 1NW6A 1SQGA 4FGZA 3E7PA 4E33A 4P7GA 1G38A 4PINA 2P1DA 4FSDA 3HVHA 4R8RA 1GW9A 2IH4A 4HC4A 3XINA 4P7JA 3HVJA 1XYBA 3ITTA 2EX4A 3ELDA 1MNZA 2O05A 2PY6A 2CL5A 2HWKA 4C06A 3ID6C 3L8DA 4FS8A 4KDRA 3TR6A 3N4AA 5AVNA 4E2YA 1F3LA 1PJZA 3FTEA 8MHTA 4R6XA 5AVHA 2J6VA 1DE5A 4HRAA 5K0BA 5FADA 3GRVA 3TOSA 5DTMA 3XISA 4ER3A 1A0DA 1YB2A 3KBMA 3UU0A 4DMGA 3X0DA 3LCVB 2NP7A 2P7HA 4AX8A 5J8LA 1X1CA 3LDGA 2ORED 2GA9A 2IDJA 1I9GA 1DCTA 3THRA 5ICCA 4KIGA 4C03A 3BWYA 3GO4A 1QANA 5E1DA 5FHQA 3FUTA 5GOZA 5EKXA 4E2XA 5DSTA 4ER0A 4KWCA 4A8IA 4YTSA 1XLMA 3HNRA 5LSAA 2B25A 2XYQA 4MHTA 3SX0A 5DM2A 4HHLA 5LQCA 4A6DA 1IY9A 1G55A 2P3QA 3GNLA 1T43A 4YV1A 5T67A 3C3YA 1NV9A 3TKAA 2YVLA 2YUIA 3UVAA 2PWYA 2YR0A 3HEMA 4U7TB 4E32A 5BW5A 2VDVE 2JHPA 1M6EX 3ELUA 3XIMA 3UA3A 3TC3A 3LMZA 4IKPA 4QEHA 1O54A 1QAQA 2UYOA 3ELYA 3FPGA 4RTOA 1XYLA 4OX9Y 3L23A 2Z6QA 3LCUA 5FTWA 3IEIA 5BXYA 3AYTA 5K0LA 3BUSA 2EFJA 2I62A 3U81A 2NXEA 1XLHA 3MTIA 1JSXA 3F4KA 2H00A 4C08A 2JHAA 1RI1A 1XIBA 4C04A 3AXTA 4RX1A 4V0RA 3RODA 1JQ3A 4QE4A 1RJDA 2O0LA 2PX4A 3VNJA 2PXAA 3EVAA 3NJRA 3PX3A 5ICEA 4XSMA 2YXLA 3C3PA 3O4FA 2ZBQA 1EG2A 4R8SA 2ZIFA 4YV2A 2A14A 1DIDA 1JG1A 3CJQA 3GCZA 3ITLA 3P9NA 4KRGA 4XUEA 3T0IA 3G2PA 1NW8A 4FT2A 2IBTA 2PX5A 4XISA 2ADMA 3JWGA 1BC5A 2YTZA 3ITVA 3CNYA 3LECA 3HTXA 3G89A 3BWBA 5CD1A 2GLKA 2H11A 3OU2A 4GOOD 2OY0A 4E2ZA 4HH4A 1XIIA 4PIMA 5K0FA 2ZCJA 2ZIEA 3KQPA 2AOUB 4A8NA 1S5MA 2VS1A 3DMFA 2OKCA 4RVFA 1B42A 1FBNA 3PT9A 3MERA 3TM4A 5C9ZA 4PNEA 1JG4A 1WG8A 1XLEA 3P14A 5I7GA 3AY0A 5KQSA 4DKJA 1H1DA 2ZVRA 4YTUA 3ERCA 3OU6A 4QVKA 1YFJA 1R18A 3CWHA 5K0CA 4PWYA 3QC0A 1NT2A 3G5TA 3MQ2A 5E2BA 3KWSA 1VLMA 4AZTA 1DL5A 1HNNA 5DXJA 1YUBA 2PKWA 2K4MA 2I6GA 3CQHA 3CQJA 2FPOA 4RVHA 4OQEA 5HOQA 2FCAA 5BP7A 2Y1XA 5K0JA 1AV6A 1KP9A 3HA3A 1OR8A 2FYTA 2B2CA 3DUWA 2G72A 2AVNA 5GIPE 3FYCA 2IPXA 3DBNA 3BGIA 3LHDA 3KPJA 5HILA 2OPBA 2WA1A 1JQDA 3OZSA 1VQ1A 3UA4A 2YXDA 3A26A 3LPMA 4OA8A 4QQKA 2ZIGA 3M0HA 1ZGAA 2PLWA 6XIMA 1O1HA 3NWEA 3OFJA 3CVOA 2PGXA 2VZ9A 3UJCA 4KDCA 2QUNA 1RI3A 2QYOA 3U0HA 3JWJA 2V7EA 4DVOA 3HCEA 3KQTA 5E1MA 5HFJA 3ITOA 1O9HA 2ZBRA 3DH0A 3KQOA 2R3SA 4K6MA 4EKIA 4RTRA 1QT1A 2ERCA 2ZDSA 4EKGA 7XIMA 1BXCA 1YFLA 4A8LA 3IUIA 4GJJA 1P1BA 2HNKA 3G2QA 4MWZA 1ZQ9A 3SVZA 1XINA 3KQMA 3DP7A 2GUBA 2HTEA 1JTEA 3FYDA 4XUDA 4POOA 1DIEA 4HSGA 5XINA 3FPHA 3EGIA 1XTPA 3KHKA 1I60A 3OE5A 3PVCA 2AOTB 4PIPA 3SR4A 5E8RA 4ER5A 5B1SA 2P3LA 1XIEA 4K3ZA 4ISCA 3AALA 4CKCA 3OFKA 5FWAA 1N7IA 2ONZA 5K01A 1KYWA 3CJTA 3P9CA 4GUAA 3RIEA 3FTCA 4Q7IA 2F8LA 5CM2Z 1F38A 5XIMA 2WK1A 5K0NA 3HCCA 4QVGA 4DQ0A 4GEKA 4PYMA 4E70A 3O7WA 7MHTA 2JHCA 2AN5A 4PONA 2IIPA 4P7KA 5FQNA 1Y8CA 3VC2A 3EEOA 4RVDA 1EJ0A 8XIMA 3P2EA 3BWMA 3QXBA 3B89A 1Q0SA 4ZB2A 4MIKA 1VP9A 3BANA 2CKDA 1A0EA 3M4XA 3R6TA 1ZKDA 3BGDA 4LG1A 5E9QA 3UFBA 1M0EA 1IXKA 2GB4A 1XIDA 2EJTA 2XVMA 2GYIA 9XIMA 5H1WA 1I4WA 3LSTA 4L7VA 4BLVA 4CTJA 1EQAA 4F86A 4AZSA 1EAMA 1NKVA 2O07A 5E9WA 1WXXA 1XDUA 5MHTA 4GOMD 4XIMA 5KS2A 4YMHA 5DTQA 3BXOA 3T7TA 3DLCA 5LQRA 3IHTA 3KBWA 3AYVA 3EMDA 4R6WA 3TPZA 5LQNA 2QRVA 5EMJA 2Q02A 3E05A 3KBSA 5B80A 5LQJA 3GRYA 3JWHA 1JSZA 4HTFA 5HZMA 2UZ4A 5FQOA 4EVIA 1L3CA 1XICA 2XINA 3CCFA 3DULA 2XVAA 5CVUA 4YMGA 5K8VA 3DTNA 2BM8A 1X1DA 4BY9E 2NXNA 3GRUA 5DPMA 3IUHA 1UFKA 2GAFA 3K6RA 3UJBA 3EVCA 3FUUA 3Q7EA 2OU4A 3EVBA 2G1PA 4XCXA 5HEKA 5KYGA 2JJQA 2B3TA 2B78A 1VE3A 3MCTA 2WA2A 1XP3A 1MUWA 4M38A 2HCVA 1UWVA 3KKZA 4H0NA 4P7FA 1VP3A 2HK1A 4ZB0A 4QE5A 2IGTA 3HCBA 3M70A 3B3FA 1XLCA 1U2ZA 2IBSA 3TVAA 1RI4A 3M33A 3WSTA 4OBXA 3V8VA 4AZVA 1WS6A 4P58A 2C7OA 1G8SA 3THSA 1K77A 2BR4A 2N47A 2BZGA 3GGDA 3P8ZA 3BT7A 2OB1A 4PYIA 1FP2A 3GXOA 3M0XA 3UJDA 4MTLA 2P41A 3BZJA 4E31A 2XISA 4GJIA 2BR5A 4ZB5A 4RVGA 2PSSA 5BW4A 5E8JA 2VDWA 1X19A 1UIRA 2G71A 2PT6A 4QPPA 2PX8A 1CLKA 1XIGA 4ER6A 1L9KA 2PXCA 3C0SA 1VPTA 1XLFA 1EIZA 3QOXA 2BH2A 5EMKA 4GOLD 4XUCA 4PGLA 2QY6A 5HIIA 4PCAA 3WQOA 4EACA 5EHGA 1JQEA 3I5UA 4HG2A 1RJGA 3KQSA 4RV9A 1ORHA 4GLEA 4RTPA 1TZ9A 3R3HA 1NW3A 2XBMA 2EJUA 1XLDA 3KBVA 3AWIA 2DULA 4X61A 3OBEA 3OCJA 4E3VA 4YV0A 3K0BA 1XDSA 3G8BA 1KHHA 2YX1A 3BWWA 1HMYA 3MAGA 3CJRA 3GWZA 4XIAA 2JG3A 3BZBA 3G2MA 1ZG3A 2OB2A 4YUXA 5CCXA 5EC8A 2V74B 2GVEA 1L1EA 4ER7A 3VNKA 1G60A 4YUWA 5FWDA 1D2CA 5EEHA 3KBJA 1R00A 4QE1A 1SG9A 4IWNA 5K0EA 4BLUA 2QW5A 1SUIA 3MGGA 3BWCA 3NDJA 5KVAA 4RTJA 5EZSA 2NQJA 4DA4A 4NECA 2ZZKA 3KPWA 3TQSA 1D2GA 1V39A 3R24A 3LDFA 1QZZA 3CC8A 1D2HA 4M7RA 3B7PA 3BKWA 3PB3A 4QEEA 4ZTBA 5DTRA 2CMHA 5EVJA 4MQ4A 4ATNA 1NE2A 3VC1A 5DXAA 5H6HA 1G8AA 3ITYA 2YXEA 3QZAA 3T7RA 4GOND 4HHMA 3P97A 3ANXA 4IV0A 3ITXA 3DR5A 1IM8A 3ER8A 3NW9A 2PBFA 2KW5A 4C05A 1R6AA 3BKXA 4M37A 5CVEA 5F2NA 2FRXA 3LL7A 2AR0A 3KPYA 3R0QA 4X63A 3QYSA 3KCLA 1KIAA 1XYCA 4YTQA 3A4TA 3FUVA 4C07A 3VNLA 4DCMA 5LR6A 1XLAA 3NVKI 2GS9A 3KR1A 5DLYA 5EHIA 1JG3A 3UJ7A 3IUDA 3JWIA 4QDKA 3EMBA 4QDWA 3V97A 4CTKA 5K05A 2X7WA 1VIDA 2O57A 5EEGA 1Q0TA 5DX0A 4G56A 3G88A 2Z6AA 2AZTA 1VBFA 10MHA 4W4QA 1KPHA 3SXJA 3AXSA 5E1BA 5CUQA 3H2BA 1XLJA 1NBIA 4LWOA 2G0WA 2C7RA 5EKUA 5EGSA 3PFGA 3TM5A 3NVMB 1G6Q1 3G8AA 1MJFA 3KR9A 3SGLA 1XDZA 3KPVA 4HNOA 3P71T 4B17A 2NQHA 3DLIA 3UWPA 4YUZA 2IH2A 2ZULA 3BGVA 3LDUA 4X41A 2QUMA 2AOVA 3DX5A 5DWQA 5B7ZA 2QE6A 3G2OA 4HGZA 3I53A 3UJAA 1Z3CA 3SMQA 2ZLBA 5T6BA 1O9GA 4YTTA 3M0VA 1FP1D 3GJYA 4A8RA 4AUKA 3KR2A 5FA5A 1KR5A 5HIKA 1P1CA 1QAMA 2NYUA 3GRRA 2Z6UA 3PX2A 1XIFA 5JUWA 3EPPA 5GWXA 4O29A 4QPNA 4KW2A 3FUWA 4HGXA 3OU7A 5K0GA 5CIYA 2OO3A 3ORHA 5G02A 3Q87B 2DPMA 3U3HA 1R8XA 4LNCA 5TNVA 4US6A 3DXZA 3SM3A 3UXIA 3SSNA 2NXJA 4GF5A 3LKDA 3C0QA 5GM2A 4RTMA 3FPEA 5EG5A 4OBWA 4GC9A 3GRZA 1ZHFA 4RTNA 3BDKA 4QQNA 4DUOA 1XCJA 3EVFA 2BR3A 3G7UA 1XIJA 4QDJA 3RW9A 2NP6A 1X1AA 1ORIA 2AOUA 3HA5A 2ZBPA 5KQRA 5XIAA 1XIMA 1XXLA 3I9FA 3MCZA 3TMAA 4X1OA 2LD4A 5LQKA 3VSEA 1NW5A 3EVDA 1SKMA 2OBFA 5F2OA 4M36A 4FZVA 2GH1A 2H1RA 5GINE 1WY7A 4WXHA 5HIJA 1XLBA 2FK7A 2JH9A 2I9KA 4JXJA 3NWBA 2VP3A 1AQIA 5GM1A 2AOWA 2NXCA 3M0MA 3D2LA 4OVXA 1SVUA 5LQUA 3TRKA 5P8WA 3KQQA 3EVGA 2XYRA 3MTEA 4Y2HA 1QAOA 3P9KA 1EJ6A 2PX2A 5C0OE 3EGVA 1N2XA 5FA8A 2C7PA 1DUSA 4PYLA 2R6ZA 4J4KA 2ONYA 3GU3A 1A0CA 3IYLW 2IH5A 2EG5A 4PYNA 2I7CA 2I56A 9XIAA 1NV8A 3DXYA 4PGGA 5CCBA 3IV6A 2E5WA 3HM2A 3KPUA 3KQWA 4Y30A 3GIWA 5DM0A 1XISA 1XVAA 4KIFA 4BLWA 4OQDA 3JU2A 3PLAE 5H02A 2CMGA 3VYWA 5U4XA 3FPJA 1MHTA 3A27A 5EMMA 4EK9A 4BP3A 5CVDA 1XYAA 2P7IA 2YQZA 3KU1A 3NDIA 4AZWA 2ZSUA 1S5NA 2ZW9A 3FPFA 1XLKA 3M0LA 5EIFA 4LWPA 4PYKA 3MHTA 2X7VA 2GLUA 3QOWA 1AQJA 4XSLA 3A7DA 5K03A 4PCLA 3E8SA 2I57A 1KXZA 2G70A 2O06A 2ZFUA 4RTQA 4CKBA 3DMGA 2AOTA 3C6KA 1YF3A 2FHPA 5CVJA 3UZUA 1SUSA 4YTRA 3FTDA 1FJXA 1XJ5A 3HVIA 4PFHA 2ZZNA 2Y1WA 3UJ8A 3KR0A 1L3IA 5D1HA 3KQYA 3MB5A 2QM3A 1SQFA 4KW7A 2QULA 1BKYA 4FT4A 1TW3A 3O31A 5DM4A 3TFWA 3VNMA 9MHTA 3P2IA 5DX1A 3C6MA 5FHRA 1RJFA 3PFHA 3GDHA 5DRTA 5B7YA 3R9XB 5EPEA 1AF7A 3M6XA 3CQKA 2CWWA 4E30A 5DX8A 5EZQA 3OE4A 2AN3A 2XYVA 2ESRA 1KPGA 3HA7A 2GPYA 2P8JA 2ZTHA 3FRHA 1DXIA 1BOOA 1PRYA 1RJEA 5IH3A 1YZ3A 1RI5A 4V0QA 4EMSA 3P2KA 2ZVJA 2PXXA 1P39A 3ELWA 4YUVA 4DF3A 3PS9A 4PYJA 2AS0A 1XYMA 5ICFA 1KYZA 4A6EA 3OZTA 3LGAA 5T64A 2PV0A 3GNXA 3TLJA 3ER9A 2Q41A 3T7SA 3FRIA 4CXMA 1TW2A 4LECA 3EGEA 5LQAA 2QRVB 5EMLA 1XIHA 3C0LA 3OPNA 3UBTA 3ME5A 4HTFB 3LX6A 4QTUB 3EVEA 3LBYA 3LKZA 3DOUA 5DSXA 3NMUF 1NW7A 2FK8A 1L3BA 5HIMA 5FULA 3VNIA 3LCCA 3HCFA 4BP1A 3HCDA 1XLLA 3KBNA 4RTSA 4GQBA 4XKMA 1N7JA 2AN4A 2HR1A 1XLIA 3DMHA 3NGFA 1KPIA
chains in the Genus database with same CATH superfamily
3CH6A 2ZU0C 1VYUA 1ZS9A 1EKOA 1E9DA 1YR8A 2D0PB 2IC5A 4F6RB 3SBDA 4LY9A 4Y9NA 2Y7GA 3GLKA 4IX9A 4N7MA 2C99A 3C0KA 4U28A 3OZRA 3L5KA 2EXXA 2C1HA 2FPRA 4Q9LA 1T4CB 2RHHA 3AMKA 1E6NA 4M9QA 5CQ1A 2OBXA 2GNOA 5F1UA 4PAOA 3WRXC 4OHXA 5EESA 1OC5A 4L4XA 1UQRA 1FXUA 3FHCB 3ZZNA 4YI5A 4QELA 3E2MA 3LYAA 2HMSA 2IY9A 4HPJA 4WSJA 1SHZA 5JAHA 1X70A 2R1VA 4URVR 1VYHA 4TRJA 4URHA 3ARXA 1EFPA 5ABPA 3Q3VA 1KBBA 2IPNA 5BW5A 1VFTA 2PB1A 3UA3A 4DQXA 1YCFA 4ND6A 2PGAA 4YGXB 1T5DX 1DARA 3GMDA 1KOJA 1H4VB 3L6DA 4IIYA 4DMUB 5HGJA 1U6KA 4LA4A 4DV4B 3DOJA 3QJ5A 3T78A 1U33A 1RYZA 4G1EB 1NBEA 3VHXA 3HCNA 1YJXA 1OLXB 4BZPA 1NTRA 3D6NB 4UNRA 3QMTA 1G4UR 1FHUA 2NQLA 1C29A 3AFMA 4G0PA 2J08A 3PZBA 2CLMB 3GF4A 2VCHA 4EA7A 3E22A 1H2AS 5TPZD 1TC2A 5IABA 3IERA 1UP7A 4L16A 4D9PA 4FLEA 4Y1EA 4QPZA 1PG2A 3PITA 4I81A 4BQOA 3A6FA 4DNPA 3PTKA 4X71A 3UNXA 2YCIX 1YFLA 1M54A 4EKGA 2ZDSA 4HDSB 5LA1A 2H1IA 2XKJE 2CL7X 5KZMB 3GGPA 3UMRA 4HGNA 1AMOA 4NZFA 5FFFA 3MCMA 3W5IA 2HCFA 3L7NA 3CLWA 4BO4A 1N7IA 2Y1GA 1H1YA 5AI6A 5FRDA 2SKEA 4P2VA 2WWFA 1VE9A 2HLHA 3UPBA 1FFEA 2QLNA 5ECYA 5I7UA 4G2NA 4MYTA 4RKWA 3IB3A 9XIMA 1NDWA 2P69A 2W6ZA 3CF4A 2QDXA 3HCWA 3LTEA 2JCSA 3ER6A 2YIJA 4ID3A 4Q7BA 4JIHA 2VVTA 4GPD1 3RR2A 1N6KA 3UICA 4XA8A 3ROTA 2WIAA 3OCVA 4PYRA 1BRTA 4D9GA 1R0SA 1UDWA 2NX1A 1KM5A 3RC3A 4O4IF 1E5DA 2PE4A 1WU7A 2C1GA 2V6AA 3IIIA 1UP3A 3T7CA 3AUXA 3A32A 4O0ZA 3M0XA 1NNEA 2CETA 4M5PA 2PSSA 4MDEA 1VDZA 2XSBA 2R5NA 1T8SA 4PS0A 4BO2A 3TH6A 1JR3E 1RQXA 3D5EA 5FESA 5BV1A 4JB2A 1MH9A 2YN2A 4Q1BA 4QLJA 2IIQA 2O7RA 1SZPA 3RGGA 4KWSA 4LWWA 3K70C 3QTPA 2GJAA 1O2DA 1ADBA 3TSDA 4WCJA 3QELB 3PX7A 3HJHA 3RQIA 3N18A 3WGYA 3FPLA 3QOMA 3MYOA 2E1PA 3RC7A 5TF0A 1B1CA 4C14A 1WB9A 1SIBE 2OZ0A 3RR1A 3GPCA 2AD5A 2Q2VA 3T4CA 1TJYA 3WAKA 3D2BA 3W1VA 4FDLA 2FWRA 3QV1A 1Y63A 4JYDA 1Z15A 1H3NA 1FQKA 1RHCA 2RG1A 1HVQA 1CQIB 4IQ4A 5FF2A 4EYKA 3CLMA 3K73O 2QV5A 4EVRA 1KMNA 4N5IX 3B2QA 2QMQA 2W6NA 3M43A 1V4VA 2X0IA 1E3IA 1YKSA 1XRTA 3MHUA 2CUNA 4LCSA 4GO9A 1UZNA 1S8OA 4JX4A 3T9AA 2JH9A 4DJFD 2ZXFA 4LC1A 4P4GA 3U9LA 3D4OA 2CLOB 4IL5A 2FA9A 3TGPA 2QTFA 4FVTA 3S27A 5CSRA 3RU6A 4MF4A 3OGSA 3E96A 2X3YA 2BPOA 4UBPC 4E2DA 1Z73A 4C4OA 4UTTC 3TFXA 4AEOA 4ITVA 1JA1A 3RG8A 4TKVA 4Q4LA 1LF1A 1GPKA 4QLBA 3PC0A 2VQFB 3WGZA 1NNSA 3UMCA 4JKMA 4I4LA 3RM4A 2A5JA 1BN7A 4M4SA 2CLHB 1K27A 3AICA 4KW7A 3FA3A 2HW8A 2ZJAA 2P0IA 2G6BA 4QG3A 4CN6A 4Z2LA 4JXXA 4FGKA 1DELA 5LDHA 3MKKA 5IJZA 4AHPA 3SJUA 3G6LA 2HMAA 4F8XA 2YFNA 1XKYA 3LCIA 2DFAA 1ZGDA 5ITZA 4QTUB 1UQTA 5KI6A 3DCNA 2VRCA 3LY8A 3SC3A 2QQFA 3C5WP 2QGHA 4MWAC 1NVWQ 4RLQA 4XWYA 3SAJA 4HBKA 3AEKA 1EYWA 4BS0A 1R0WA 4Q82A 1LYXA 3RS4A 1ELSA 1X80B 5D5HA 1FHDA 1C7JA 2ZTMA 2XGGA 3ACBA 4Y2SA 4CQJA 3OJWA 2QV4A 3C70A 5EJIA 1NW9B 4JBNA 3DFPA 5JH7A 2ZE6A 2VQUA 3KVKA 4IGNA 4XM1A 1BVNP 4KXMA 5LXTF 5F2IA 1AK1A 2NO9A 3O1NA 3R1ZA 2D74A 4NX5A 2VCYA 3LCFA 4UM8B 1K9VF 3QQPA 4AJ2A 3EQ8A 5A2AA 3FLMA 1OHLA 1T8RA 4E33A 4YXFA 2QCMA 1JXQA 3PZVA 3PE6A 4CCDA 3ZHCA 3ITTA 2R96A 3K9BA 3A4NA 3WEOA 3HKCB 4WI1A 3AHTA 4L22A 4HNLA 2WFLB 4OYHA 1SVOA 1QANA 4ZQMA 3MVEA 3VMPA 3LHVA 2F9MA 4GIYA 2BBTA 1Q14A 2DUJA 2WFAA 4BMCA 5JECA 4Z9FA 3TNLA 4L6AA 3W8FA 2RHRA 1MD9A 2M6RA 4MVJE 3UVAA 4U7TB 3BAZA 4JLMA 4IKPA 1RM3A 3TQRA 3IJIA 2W2PA 4Z9BA 3LU2A 3FGCB 1T2FA 3AHIA 4ZGGA 2GCOA 1VD6A 2C2YA 4BKMA 1X8CA 2X8AA 3B9RA 5AP9A 4A05A 2P3EA 4GOOD 3LXUX 1AO0A 1TX4B 3NC1C 4RZXA 3RDKA 1GOIA 1UD2A 4A3UA 3PDJA 4IDAA 2J7HA 4QDOA 2X0FA 2NO4A 4I1YA 2OVFA 1GAJA 5AHKA 1VF8A 5CSSA 3I7QA 4KCVA 1C2YA 3NUZA 5JBQA 1W9DM 2JLBA 1PFQA 5ENDA 4D0LB 1JPHA 1Y80A 4IUOA 3ITOA 1L4FA 3CK5A 1Y42X 1E7RA 3MN1A 2VHLA 3B7WA 5IFKA 5C46F 4Y2GA 2J9FB 2AUNA 5I06A 3G1XA 1DIEA 4CMIA 4DXVA 1ZHHA 2CFCA 2E4YA 4S23A 4UUAA 1JKXA 1WKCA 5B7PA 2JCGA 4BFCA 3BEOA 2FEKA 1RJ9A 1LS6A 2IYLD 4B0OA 2B30A 4DBLC 2WT9A 4M9SA 1HYEA 3ONDA 2INZA 5DTQA 3ZNPA 3MB8A 3K2QA 3FYUA 1S1CA 2YH2A 3BH0A 1M2WA 1TZKA 2R6FA 5BSWA 2JFBA 2PWVA 1XP3A 3MS2A 4D2JA 1GPUA 1PR3A 3P5BA 2P1ZA 3LLCA 3TD9A 4NYUA 4EY6A 1J10A 1L9WA 1ZJYA 1H93A 4LXXA 1TVMA 3W3OA 3UO8B 3VC5A 5BRBA 2VJOA 1SUBA 2WU1A 2CLEB 3CPUA 4I55F 3WJ7A 2ID4A 2HBVA 4M19A 4ZI5A 5CYFA 4G0QA 2HHJA 2JE8A 1OT5A 3GWZA 3S28A 4MYRA 4F45A 2EPKX 4GKLA 4Y6PA 4D6HA 3MGGA 4ALLA 5AM3A 3W84A 4Z7OB 4F06A 4UE6A 3ZHSA 4ASUA 1DC6A 2DPGA 5HWJA 4MQMA 1BEUA 1IEWA 3ZX5A 3RS5A 4YK7A 4EYSA 3I3OA 4Y1RA 5AI0A 1ITUA 4F8EA 4NBNA 4E5UA 1V2HE 4RK8A 1CLUA 4TTIA 3ILVA 4GCAA 5HS4A 1XH0A 5BW6B 3SJ3A 1C5KA 4HPNA 1YI1A 4HU8A 3O82A 3Q72A 5CSYA 5G2WA 5LZ4A 1LPOA 4QJ3B 3S8MA 3A9CA 4O29A 3BHIA 3IIKA 1G3UA 5TNVA 1E71M 1DP0A 2CLLA 3ANLA 3V1HA 2B7OA 2HXUA 4MUKA 3SGGA 4S2CA 1TUEA 4KFTA 3TKLA 4NZOA 4WKAA 2V7UA 4EECA 4UTFA 3ICQB 2C4UA 3R3XA 2IF0A 2IKJA 4NYJR 1NT4A 3T38A 3N3TA 4CQLA 4LB4A 4DCNA 4WFKA 4HTBA 4DO6A 1GZJA 2ZRFA 2BVYA 5FOUA 1KR2A 2FR8C 3E5PA 3RJTA 1GJUA 2QCFA 3FD8A 4H8NA 3ZTWA 5JBNA 5JI2E 2QRKA 4XO6A 1EX6A 1SA0A 1I2CA 3EXFA 1WPQA 1GA1A 4HNCA 4PSDA 2Z09A 3A5VA 4KO4S 5JPIA 3LWZA 5J2TF 4LT9A 4ZT3A 2I29A 4NAFA 5KZ6A 4CTOA 2ZA1A 5ADHA 4QT4A 3OE4A 3RB8A 4C9BA 4OHPA 1IHIA 4F79A 2DT8A 5HFNA 2XIOA 2BKEA 4EFDA 5MF6A 3C8HA 4L1KA 2A33A 4O1CA 3H2HA 3O16A 2EPOA 2O9TA 4CQ9A 2H52A 4G0XA 2VI5A 3NHYA 1M8FA 1OIXA 4NP6A 1CS0B 5JLJA 1I3NA 3TNFA 1E3WB 2X0HA 5EXDA 2RH8A 3G8DA 2A92A 3M6WA 5H83A 5CBJA 2QL9A 5K8JB 4M7WA 1GNLA 1XQKA 1SC6A 3GFZA 3GS6A 3TW4A 2ECPA 1RQRA 2WQ7A 1A9QA 4QHRA 4Y6OA 5BQXA 4QARA 4LVGA 2AWNA 4OCZA 3NUQA 1FFAA 2PJUA 5BVHB 4DHWA 1SCDA 2QRQA 1NBHA 1R66A 4CCYA 5IJXA 4ZAXA 1ZNYA 1OBOA 5BOVA 4YS1A 1KFCB 2BMEA 3PJTA 4IO0A 5CDTA 1WMSA 1BA3A 4F97A 3UWQA 1FDWA 3OKPA 4PINA 5MKGA 4CKXA 4NENA 4RIGA 2EX4A 1XKTA 2GASA 1TPWA 4HBZA 2QJNA 4YRFA 5F73A 3CHEA 1QE3A 5C80A 3KQLA 3W72A 2WU8A 1LBLA 2WOOA 5E1DA 5HF5A 3ZUPA 2WSMA 3JD4A 3NHRA 1H3GA 5HR6A 1TIPA 2WABA 2ZYGA 2F67A 3DB1A 4DQLA 1WVIA 3MTBA 1MAHA 1AJ0A 3IIOA 4TM7A 4MCJA 1ZCOA 4TROA 3C2YA 3OJ0A 1LPBB 4ZQNA 2IYVA 3TLXA 3N2CA 1D6NA 3OODA 1Z2AA 3I39X 3K9CA 3HPSA 3UMMA 3SQWA 3EQ2A 4GOJA 1QX4A 1UZDA 4NIRA 4Y6LA 1R2SA 5IHSA 2GLKA 1YB7A 1VRDA 5EAIA 4N6OA 5C7IO 2YYAA 3JQPA 3DEJA 3IVSA 4FAMA 3BIJA 3CR3C 1TPFA 3W27A 2D4AA 3W7CA 2XTMA 3TTWA 1O57A 1HMPA 1XBZA 1IHDA 1Y3AA 3M6AA 3L8FA 3KTXA 3UJCA 4RPHA 4M1ZA 1C9DA 4NZPA 4D3ZA 5EMHA 3LUGA 4S1NA 4OYYA 3KKOA 3U0VA 1GZ1A 1T5LA 1PJAA 4Y67A 2VNIA 4ZFNA 2G9VA 1X8JA 3SD7A 4NR0A 4PX9A 1TRKA 1KYWA 1MRSA 5EA2A 2ZSJA 4O52A 5K3CA 3IRVA 2EYQA 2WWYA 4JIQA 3JQ8B 2CXOA 1L2TA 1FMJA 3CAQA 4YMHA 1NDQA 3AWDA 4M56A 3G1VA 3L0OA 4FJ0A 2DEUA 5A2QA 3ZY3A 2GD2A 1IT7A 4UD6A 5GZ1A 3HB9A 3RVOA 4TZ6A 4IJWA 1S1RA 4ZVOA 4JLVA 2HK1A 3VGEA 3AB7A 3EB4A 4I7EA 2OAEA 3VTAA 4RABA 3UUEA 5C4IA 1T8TA 4M0KA 5JJLA 2JDID 3DZDA 2G71A 5JHGB 3UV6A 3UQNA 4S3CA 4PGMA 3EOOA 3SECA 1DXHA 2EP8A 1A95A 1GZ4A 2HA5A 1Y3IA 4GY0A 1FCJA 1CVIA 1OAOC 3QWFA 1V6AA 4DVJA 5JD3A 3L9XA 1PEZA 2E1DA 2XMSA 3RFXA 3I2FA 1UD4A 1W8DA 3GJZA 3VKVA 2L82A 5AHOA 1Z29A 3ZHRA 3L6OO 1WBHA 3LCGA 2NN3C 4JQ4A 3QVTA 1P4AA 1E0AA 5ABTA 4EIVA 2L42A 2CZFA 1HORA 3QY0A 1FVHA 1H0HA 5DHTA 3QYSA 2ZJZA 5LKAA 3F90A 4Y2VA 4QG6A 3I01A 5F33A 1EJ7L 2VDMB 4QDKA 4JTQA 3NAGA 4DM2A 2BM1A 3JW7A 3BPSA 3E3LA 5C34B 5IAGA 4DJDD 4RK6A 2QDGA 3CZLA 4PG5A 5AB3A 4UB9A 5LL6P 3RN6A 4F1WA 4PUEA 1QPKA 1MHPA 4QPNA 1P0CA 4JGBA 4ND1A 4YAFA 3QEJA 1QNFA 3B9EA 1KI1A 4AY8A 2CNOA 2ODNA 3I68A 4O33A 3OWXA 4GC9A 1ZBDA 4DCPA 4Z4EA 4BNIA 4D02A 3TMAA 1U7TA 1GQLA 2WF6A 4NMMA 8ADHA 2XQGA 2P5YA 4NDZA 5E4YA 5AR1A 2VP3A 1GZ3A 1F2UB 3GG8A 5P8WA 5TLSA 3BTOA 4B8YA 1MO3A 3M89A 4G01B 2OKTA 1W35A 2GAAA 3G85A 3JQBA 3SGUA 4A5SA 3LQ2A 3HKBA 5D3MB 2HSGA 4OJTA 3GPIA 3A27A 5HWSA 2UU9B 3LV5A 2OXFA 5DBGA 2L5HA 4WV3A 2BVDA 4WLVA 3B8SA 3AZQA 1AJ2A 1S2MA 1TA3B 1MB0A 4R1SA 2ZYVX 1N34B 1QOPA 1CQJB 1B93A 2Z1WA 3FB4A 2A86A 4V24A 2K87A 4D6YA 4MS4B 1PX0A 1TXGA 5IH7A 2AKAB 3BA6A 2GPYA 2XXJA 5G4KB 4ZARA 3RUCA 1ZUHA 4JU9A 4LYEA 2OGSA 2OGWA 4OV4A 1L7DA 4MXDA 1T4BA 2QJFA 5BVGB 3MMUA 3LCCA 4LDPA 2QX6A 3I9MA 4MICA 1YX1A 2WBLC 4U02A 5EP2A 5EXSA 1O96A 4C5BA 2R8OA 5I2UA 3PNKA 4P31A 2NW6A 1GFIA 3NTYA 1UBSB 5IU6A 3STPA 3AJ9A 4FR0A 2JATA 3BAIA 2WZCA 4M0DA 3DPUA 5LYYA 1RRGA 4QUEA 3R8GA 3EUFA 3M5DA 3BYZA 4FOPA 5K09A 3FFTA 3VGGA 4NHEA 2ISVA 1DB3A 1VHQA 2XGSA 2OXTA 4AP5A 2D2VA 4CFSA 1G38A 4XCQA 1NVBA 2WDPA 3VUEA 3H5NA 2GRAA 3IK4A 4YT8A 4H7IA 3OE1A 1W29A 3O0TA 3W6LA 4Q03A 2RGCA 5IZCC 1K9DA 2A5FA 5CLLA 4CKWB 3O06A 2YA2A 3DKIA 1CGVA 3CV1A 4V0MA 5CPSA 1HL8A 4RZ5A 5IDXA 3BJZA 4I9NA 2E40A 3FN4A 5MN6A 4W8GA 5LU8A 1HE8B 2XLBA 3M1IA 2XIIA 1FDVA 5I47A 1G19A 1NMZA 2I2FA 2ENUA 1RJDA 1E9RA 1GOTA 3EDKA 4JEQA 3GCZA 1EFTA 2E49A 1W1ZA 2IHZA 3HKDB 1TAGA 3DQQA 3DYOA 1PS0A 1XCXA 2BP7B 2G07A 2V59A 4HP8A 1T1SA 2OKCA 3H04A 5KQSA 2ZRHA 3GQVA 4IVPA 3W1TA 1A5AB 2HNHA 4HEA1 3IC5A 1V8ZA 2QU7A 2VAPA 4PPYA 1YBHA 2XT9A 3R0ZA 1Y4SA 3CLHA 2VNCA 3QEKA 2Z00A 3MY9A 1I5RA 3WIJA 1G16A 1WB6A 4DJEA 2R7MA 3B60A 3QF4A 4AAJA 3WL5A 1QS0A 3U4QA 3ITDA 3HCOA 1IZCA 3F5QA 1K4HA 4UQDA 1HQTA 3WH7A 2PEVA 1TDJA 4E70A 2JHCA 1XA3A 3IV8A 4K37A 1EVLA 3IS3A 1H62A 3UFBA 2CYCA 2EJTA 3DOEA 1G8KA 4ZDJA 1L5FA 3NGMA 3DR3A 4O50A 1L3CA 2TMKA 3OLEA 3WV4A 4QUKA 4YJ3B 1URPA 1K8XA 3BCFA 1WZ2A 4NXMB 2Q6KA 1Q22A 2MSCB 3BT7A 1TFVA 2P41A 2C0QA 1PQUA 2D1ZA 1QR2A 2O5CA 2ZSDA 2WW8A 4WXMA 2PWEA 4R9VA 4RQUA 4JTDA 1QQ5A 3TJRA 3QV9A 4RPJA 2W6ID 4FIZA 3AUTA 4XZNX 1F3TA 5SYAA 2DT5A 1UDRA 3QUBA 4HFRA 1EGAA 1J8MF 5M04A 4CRWB 4A7PA 1OZMA 3X1ZA 2Q46A 4HV4A 2GFHA 3BAWA 5DGHA 1LOLA 1MV8A 4LOHA 1M03A 1CZNA 3GAAA 3NBFA 4P8RA 1QR6A 3PHCA 4AZ0A 1MRZA 1XJQA 2QM8A 2EAUA 1SM9A 4L9AA 2YXEA 2YY5A 1U2DC 2Z3ZA 2OLKA 2EQ5A 4LJLA 2ZIZA 5GJBA 2C2GA 4MLRA 1EXBA 2GK7A 4BI5A 3OO2A 4QD3A 3TTQA 3GB9A 5E1BA 4NL4H 3THAA 3D47A 3UWVA 2W2VA 4NZZA 1TJ2A 4RHXA 1MEIA 3MSYA 2XVKA 4KE8A 1B8UA 2QTVA 1A2KC 4C6HA 1FRNA 2YXGA 1PBNA 3JRNA 1OFPA 3V0UA 5T8GA 3TAHA 1IYZA 4AWBA 5GJPA 3CXRA 3FJ4A 1GN8A 2AFHE 3ZDRA 1XRFA 3QH2A 1MXDA 3PD7A 1JEJA 2RGNC 2KJQA 4CLOA 1PFGA 4IFRA 2NW0A 4L0MA 5DIFA 3PWIA 3I1IA 3K9LA 4ZA0A 3NETA 3MTEA 4CF3A 3DAFA 2I1OA 1AA9A 1XRQA 1JFFB 3VTKA 1L5NA 1GG9A 2OA0A 2XGZA 1OI2A 4C5AA 4QO8A 1QHPA 1IXZA 4AKTA 2JJ2D 3ZXYA 1ODCA 1J23A 4QCEA 4M9RA 2P65A 1K86A 3SHWA 4IS2A 3SX2A 2GA8A 3KL5A 5IBQA 5LNK6 8A3HA 2BDTA 2PSJA 2FSFA 4UDYX 5DX7A 5BYBA 1HFBA 3GEHA 4LXQA 2QLTA 3DKLA 2QXUA 1BKSB 1MX9A 5FH9A 3JVVA 4HNNA 4AY2A 1IIRA 2JQXA 3Q6NA 5BMWA 3L0CA 5JJIA 2FP4B 3EGEA 1LU9A 1V6SA 5DHRA 4F2TA 4DV3B 1VIZA 3HEBA 3RCYA 1LX6A 3L0ZA 4G0OA 4W5ZA 1XZKA 4MWAD 4YMZA 2E77A 1XR3A 1KFBB 4MW6A 3L49A 2JH8A 2Q1YA 1EZWA 3V32A 1P74A 1ICIA 3OM9A 4B45A 1W36D 4N6FA 3CRNA 2O2XA 3VAAA 2B6NA 5ICGA 4B2DA 2OYRA 3DKPA 1ZMTA 1Q7RA 3AV3A 3UPTA 2DYKA 1FWDC 1S3TC 1E2QA 3L0SA 2HRZA 4FEGA 2J0QA 1MENA 2YXNA 1OXTA 1BWRA 1NQXA 2QKYA 3FUXA 4EEXA 5E7JA 2INGX 3VPGA 4I3HA 1O6IA 3PC2A 3OZWA 4AU0A 3VPDA 3JQDA 5CYOA 4B6FA 3TXZA 1FLNA 5EIOA 3VPHA 3SSJA 3C15C 4JLSA 1S01A 1Z62A 1UR8A 1K5PA 1L6WA 4RLFA 1KCKA 3D59A 2CC2A 4DN6A 3M5XA 1WBBA 4FF5A 2DT0A 4BECA 4MW4A 1XZLA 4NS1A 2JGIA 3TKAA 3PC6A 2M98A 5JBEA 1YI0A 3W2LA 5FTWA 3BUSA 4MQFB 1RI1A 1BFKA 4LZOA 1KP3A 1H05A 1VXRA 3UK0A 1NYRA 2V54A 1D2MA 5JZOA 1F6KA 3P26A 3GR7A 3NEAA 4GLFA 2B98A 5M1TA 1KAQA 3BSHA 4YWHA 2H9AB 2IUUA 1Z75A 4TMBA 2YHAA 3I9V6 2GPWA 2ZYWX 2QSJA 1UZHA 1Q63A 3ZE2B 4B43A 2V55B 3TBFA 4IUGA 2P78A 1E2BA 1RW4A 1USUA 1USWA 3D3NA 3RS2A 4TXLA 4COKA 1Y48E 3TE6A 1DTWA 2IQ0A 2J7KA 3Q45A 5IK2A 3H42B 3NC0C 4L4YA 1LBSA 3MPUA 3SZ3A 3SYMA 4DTCA 2JGRA 2WZQA 4Q4JA 3AM4A 1O60A 4EPKA 3GAYA 3COJA 4GUDA 2IOHA 1LDEA 2KX7A 1AQLA 2N46A 4GQQA 4QOHA 1GVOA 3R5FA 5GJCA 2I1LA 5ED0A 4EAQA 1UPUA 4ICNA 4J3WA 2G9ZA 4CCZA 4B6GA 3NVTA 3NRJA 1R3WA 3GLHB 1X7XA 5EJ8A 2KLHA 4BEJA 2ZADA 3U56A 2Q8XA 2WWHA 4FDMA 1IBKB 3PZMA 5D04C 4O0KA 4FYPA 3EWUA 5BORA 1AHIA 2GZDA 1JCNA 4AF0B 2HF8A 1DRVA 1PE0A 4W4TA 2WM0A 5EA9A 1XLTC 4XYMA 4C6OA 1ISVA 5CT9A 1U22A 2FEXA 1OWNA 2ZIUB 2F6UA 3KHJA 3WYNA 4KCUA 1OI4A 1WUKS 2IZ1A 4Z1OA 3PJDA 4L02A 1RD6A 4LC0A 5DT9A 3S5ZA 1FQ0A 1FZTA 4QO7A 2FGBA 4KWOA 2HRBA 4GM0A 3VU0A 4YT4A 4Y6GB 1EI9A 4MR9B 3QPBA 1DKOA 4L4RA 1IZYA 4U6QA 3L4KA 1J09A 1N75A 4E21A 4X8OA 2OHFA 1D3CA 2W2XA 2B1RA 4FLMA 2P5TB 5DXAA 2HNEA 2WC7A 1QGUB 4EPDC 5JUVA 1FJHA 3HY4A 3CYFA 1G3RA 1IXNA 3PDCA 1TZCA 5KKCA 4XYEA 4Q24A 1QC5B 2ZXDA 3AG6A 3LE8A 3NAMA 2VSOA 5GONB 3ROZA 4QU0A 1DUVG 3KPVA 3TLEA 1RQ7A 3WDJA 3V2HA 5B7ZA 1V6VA 3EDJA 3D31A 4LPSA 5FIUA 2G3NA 3QVSA 1KJYA 4AZ7A 2O1EA 4Q4PA 1O97C 2FEAA 4M1BA 4CDNA 4U6NA 1D9ZA 1MVYA 3PUYA 3L7DA 4AJJA 3AXMA 2PLKA 5DT7A 1CJSA 3CYJA 4R8MA 1DBIA 5F2OA 3ZY2A 1W4LA 3UWDA 3EY9A 4H3HB 3PV0A 4WBNB 4Y9AA 2ZRAA 2V7QD 3IT3A 4HS4A 1S7CA 3S2UA 1WUEA 5SYMA 3GLFB 2XB6A 3W88A 3FNRA 3BTVA 5AHIA 4LRUA 3SX4A 3UFXB 1D0IA 4N8SA 1PD0A 3U1VA 1NDUA 5K6AA 1TPH1 1XJ5A 2Y1WA 2G36A 4FQ8A 1TV3A 3N14A 5KINA 1YQUA 1YZ3A 5IF3A 4Q7JB 3ORFA 1EA7A 5CA0A 3VM7A 2G4CA 4US0R 7ADHA 5T64A 1WLSA 4LECA 2YJ4A 3ME5A 1OCEA 1J0IA 1CUAA 5EYWA 4XSHA 2RGYA 3H12A 2H51A 3K32A 2OG2A 1BHJA 4F3KA 3G49A 1ZSVA 3G0OA 3HE3A 1IWAA 1E4VA 1TCMA 5DNVA 1WO8A 2QAFA 4F85A 4RDCA 4R54A 5FPSA 3DF9A 1EGZA 4KUHA 5AW5A 1XYGA 3WBBA 3H8WA 1R74A 3WG9A 3SIZA 2P88A 2Y3IA 2FMNA 1OKKD 4FSXA 1HFJA 5H70A 3S44A 5FA6A 1YZHA 3G02A 1ZAIA 2QYTA 1MDLA 3LT1A 4HX5A 4HGYA 2RC6A 4MV5A 2Z26A 5B2FA 3DE5X 2CLPA 3QW3A 2J6VA 1CCWB 5K8UA 1P73A 4PW0A 2WHPB 2VP5A 4N9WA 3W90A 1M33A 3UMYA 3NP9A 4RIEA 4EH1A 3T5AA 4ME6A 3ZWQA 3ASUA 4EJMA 5A3QA 1CY1A 4JC8A 2C18A 3EZ6A 3D4BA 1PT9A 1JNEA 3IP8A 3ADCA 3IX7A 5F52A 1ISFA 3OA2A 3JWGA 1XDWA 2ZYIA 4AB1A 3ARVA 3BDAA 3ENZA 4MKXA 5K0LA 2ZQZA 1E92A 3WDLA 2H1OA 1I45A 4PUJA 4IIJA 1F9EA 4U9UA 4XX0B 3EZ7A 3FDGA 5D3QA 1VI2A 3FXYA 1VPLA 4PTDA 3WYCA 3NYZA 2AMLA 5FV7A 2PC4A 3HZOA 3AIEA 4UTOA 1QO5A 1LRJA 3W77A 4URUR 4ZVMA 1TVPA 3QK7A 2C03A 4C6KA 2JEQA 1WCIB 3TM4A 2VNJA 5E9XA 3ZBTA 2WF8A 3AB3A 4B4FA 3AIUA 3ZE1B 2BD0A 2JD1A 1LY1A 4K8HA 4N0PA 2QRMA 2HE8A 2R4QA 4E5TA 1ZCFA 3CLTC 4PSVA 1H7RA 2E0PA 3R3VA 3K8QA 1O94A 3WBEA 1B0AA 2R8ZA 1SEVA 1VQ1A 2XRZA 3PXAA 1ZGAA 4LH8A 1HT2E 4G8CA 5B4TA 3D7MA 2E09A 5ALLA 3H7RA 4BO9A 2WKPA 4A16A 4MUZA 1ZUWA 2PSDA 3ZLBA 3PFCA 2Y0FA 1KI4A 3GVVA 2O9PA 4NYIR 2YKGA 1NAIA 3DZCA 2RARA 4GMXA 4RVDA 1EJ0A 3OQBA 1A0EA 4TLBA 1J25A 1QUEA 4BGUA 3LSTA 4RKEA 1CULC 3OOSA 2O07A 4FN4A 4Z51A 2WVGA 3K6SB 1X39A 3L4SO 3MFQA 3RJMA 4E12A 5LQNA 1J1ZA 3NNNA 2QNBA 1PKNA 2I7VA 2JJ2A 1QTNA 3E27A 4G07A 3E0XA 3GRUA 4M99A 5B58T 4H17A 1Q0LA 4JD5A 4P7NA 2R2GA 2IQDA 2QR6A 1WS6A 4EITA 4H7DA 4U5QA 3FCXA 5DK6A 1GYNA 4QRDA 4WBXC 3AYRA 3BWXA 3IEUA 2CL0X 3M9XA 2QUAA 1RQHA 3GNSA 4AD1A 4PCAA 3KAJA 4AZ6A 4JBLA 3AHEA 4XASA 2B2XA 1BAPA 2XBMA 1XLDA 1QNRA 2R6R1 1W4ZA 4MNTA 3G8BA 3FSUA 1Z4NA 3TLQA 4FOOA 3N9RA 3IPYA 5C3UA 3WWEA 4L0DA 4YRDA 3B03A 3X2EA 2OXNA 4GI4A 3WP0A 1JRCA 4PC8A 2R9RA 2P9GA 4F4HA 3KHTA 2IS1A 1TZJA 2HYIC 2Q6ZA 1HSOA 5FOWA 1SUWA 1F74A 3ANXA 2X4DA 1P0DA 4EI9A 1AU9A 1LA2A 4EB0A 1KIAA 1F2DA 4A03A 5C8BB 2CFTA 4ZYUA 2C1IA 1B4DA 4D45A 3GP3A 4G8JA 1HL9A 1KPHA 3QP9A 5EIHA 2OT0A 1E3QA 2FMOA 3KR9A 4TVUA 1SUEA 4GVPA 3RUIA 1KY4A 4H9TA 1IWBB 4YDSA 3W6UA 3PNYA 1FWSA 2WNQA 5A1JA 2GSEA 1B8VA 3LRLA 3W4KA 5I3IA 5H0IA 3RW9A 4LISA 2J5QA 5A6BD 2AOUA 3HA5A 1BCSB 4W63A 1EJRC 5D38A 2YC2C 3TEFA 2IHTA 3HN6A 1QIMA 3HXQA 1H8HD 4DIUA 2DLCX 1TMLA 3B6IA 1RMYA 2EATA 5CYGA 3LA4A 1E6CA 4TM8A 4ZQHA 3GMTA 3TDNA 4C6TA 3LXAA 1LCIA 2OYCA 4K2AA 1EUDB 3S8YA 1XYAA 3ZS9A 1UBHS 2JFXA 3ZM8A 4QRIA 4BUZA 3KJHA 1IN4A 4KEUA 1VJZA 4JFWA 4YDRA 2XFRA 2A7NA 3MTJA 2WTNA 4PQRA 4NOJA 2QUUA 5CG7A 1PL7A 1RJFA 2H0QA 4LYQA 1SBYA 4E30A 5C52B 3RX3A 1TU0A 3NEPX 2VD9A 4UZUA 3ELWA 1VZ2A 1JR6A 3TECE 3GNXA 2HCRA 3ZWMA 4CR8A 5I7AA 2EKCA 1OU4A 2HQ1A 3WL4A 2DZPA 5JBDA 2ZT8A 3ZHTA 1LT7A 3AWOA 3HACA 4RTKA 4HXEB 4TKUB 3EYWA 4Y2UA 2GEDA 2E25A 2YOHA 1OGIA 1HW6A 2I91A 1DE0A 2QPXA 1W94A 2XITA 5EE3A 2HI0A 1OT3A 3OGRA 3PSVA 4G25A 1BHSA 3TWOA 1JZ5A 5GVRA 3F3YA 3MRSA 4CDRA 4KGZA 1SU4A 4Q22A 3PNVA 2IYQA 3NTLA 2YXOA 3BFXA 1OLUB 4PZYA 3PQ6A 3VILA 2Z2AA 2PGIA 2VRWA 7ABPA 3RCNA 4PVCA 2O0HA 4H6EA 1IPEA 3IIXA 2LNDA 3EJ6A 1P29A 1L7XA 4EKEA 5EUMA 1KEEB 4WCFB 4E2YA 1YUMA 1E98A 4O8AA 3W6YA 4AMCA 2WYVA 1TTIA 1HJVA 2VHZA 4CM8B 4WKBA 5ICCA 3KOWA 1A72A 1E1RD 4R8KA 5HUHA 1JMYA 5AO9A 5EQDA 4YMIA 5AM5A 4JBYA 4XQEA 1T3GA 1T43A 3MEQA 3LCXA 4NXSA 2B4QA 1T4MA 3XIMA 1CR2A 3EWYA 2XN1A 4DRZA 2BVWA 3QGKC 1SC1A 1FTNA 4O63O 2V7WA 4TMTA 3FMOB 2IP1A 1R8LA 1UW9A 4Q9NA 5JTTA 1NOUA 1U83A 3NL6A 3EEGA 1XPYA 1J8VA 5AXAA 4FHDA 3BG9A 4BN0A 3G89A 1RTKA 1BVUA 2QS8A 1TWWA 4FNGA 4YVXA 3POHA 4KITB 3IA7A 2OCPA 1MNAA 3FZYA 2DSVA 1GKYA 1NT2A 4Q8TA 2VF4X 3ESYA 1T10A 2ZJ4A 4MUYA 4N76A 4X6XA 2EEPA 3CM0A 2YVAA 1EZ2A 1RADA 2IPLA 3CTTA 5IKMA 3EEZA 1RVV1 3DYVA 2WYSA 5HS6A 5CB4F 2ZRXA 3ZKWA 4X1YB 1VGAA 3B0YA 3Q98A 2Q50A 3U4GA 1PKLA 4YIWA 3FOBA 5FL3A 1LLZA 3RIEA 2NLIA 1CX9A 4B3LA 3I6QA 3DENA 4KPUA 1GOMA 2X05A 3Q94A 2FJUB 3B53X 1US8B 4MK4A 3CRRA 5L3QB 3BGDA 4ZCTA 3E03A 3OQHA 4ZE5A 2HB6A 1DRUA 3D2CA 2X6RA 1P2SA 3EXG2 4ZVSA 2HJPA 3GRYA 4ZMRA 2YWRA 2VCBA 3B12A 5CBPA 3T9BA 2Q5LA 1DG3A 1O4VA 4WCVA 4IMCA 4RKYA 2JEPA 2Q8QA 1G8PA 2V68A 3DOHA 5D8DA 3V8VA 2JFVA 3JQ9C 3ZWBA 1WZCA 3E53A 2Y2WA 4F6RA 2BY1A 4UTPA 1UKBA 1W2PA 4ZOAA 4LRTB 1XG3A 1U28A 1R6VA 1LSUA 1VHLA 4GAEA 1ANKA 1SJ9A 4AKGA 2FGZA 1WXQA 4Y90A 2BGGA 1QLWA 3PUOA 3BIWA 1JHXA 2FSVA 1S3IA 4HDAA 3N39C 3OZAA 3U48A 4FXFA 1GAEO 1SXJD 2XUHA 3M7WA 4RGQA 1SBZA 2HNBA 1FVPA 4EAAA 1VTKA 1LK7A 1QFXA 4A0RA 1AS0A 1MUMA 4AP9A 5IBRA 3EOLA 1IAVA 2CVHA 4GVXA 3RT9A 3H05A 4ZDKA 1DVRA 2OFWA 3KWJA 1J39A 4C2BA 3KR1A 1TTQA 4Y7DA 2PKXA 3KFXA 3JD3A 3FF1A 1RAEA 3NQMA 3AXSA 5CUQA 1N8KA 4R01A 2D1RA 3PPIA 4OWGA 2PWFA 4OAOA 4IWXA 1GKPA 1XWFA 2J3JA 4Q01A 3PWKA 2RDUA 2ZLBA 3ILYA 5D30A 3WMFA 3CE9A 2J6BA 2Z6UA 1W46A 5BYJA 1XKQA 5CIYA 4B33A 4MWEA 1OQFA 3EPMA 2A7RA 4OQMA 5K3FA 2Y1DA 4NQRA 1AMUA 2LV8A 2Z1SA 1QIHA 3H2YA 4O17A 1C29B 1XEXB 1JP7A 3TFQA 3T7AA 1KMHB 2RH9A 5CFZA 5JMTA 1P8JA 1E5LA 4TXEA 1N5DA 3VVLA 5D03A 3RX2A 1CGTA 3G1YA 3JZEA 4F2DA 3EWDA 5BWMA 5JPDA 4IAOA 3MMXA 3WX0A 4MWCA 2Z30A 4UFIA 2NZ2A 2EG5A 3BUVA 3BX1A 1P1KA 3KQWA 3LFHA 4JJ7A 3NI2A 2AZDA 4GVHA 4WSKA 4EI7A 5JSKA 2LDXA 5KZMA 4E2FA 4KB5A 1UC8A 4NP7A 2Y5JA 4YTRA 3GFSA 1E1QD 1W3HA 5JNLA 3O05A 1FWNA 2AYZA 2REXB 5TQ2A 5LKRA 1W52X 4G5SA 4PRRA 1UKEA 5KWEA 2I0FA 2H7VA 1SD5A 3VINA 4YJFA 3F6EX 1WP4A 3T7SA 3NQDA 4KSYA 3NVDA 1UC5B 3TVDA 1JU4A 4AIBA 1ZU4A 3LKZA 3PEYA 4XYLA 1Q7GA 1U3UA 3TSBA 2A9JA 3DQPA 8LDHA 4OGFA 5KO2A 5EERA 4R81A 2HJSA 2ZUNA 2VK8A 3KWXA 4ES4A 5GP1A 2EJCA 2V7QA 3NEHA 4HNTA 2IHBA 2A3NA 2JLZA 1AB6A 3H7IA 5B30A 1G291 4DDKA 1KLYA 3QLDA 2ZTVA 1EQCA 4RWZA 4C7MA 3T1HB 3VVBA 3PCRB 4YVFA 1TKRA 1S5PA 1UZ1A 1MSSA 1E6RA 1AK5A 4DG5A 3FVMA 1X96A 1CGYA 5EHNA 3IOCA 3QU2A 2BEWA 2VOTA 3NB0A 5FWYB 5EUCA 3UYLA 3W7RA 3EWSA 2Y66A 2JFYA 2VUIB 4TLMB 2ZUUA 5K4ZA 3VC7A 1E9FA 2RHGA 1L5ZA 1JDPA 4QAQA 1H09A 1U8UA 1QW7A 1NF9A 4ETIA 1K1EA 5GGYA 1X7ZB 4OOZA 1SVLA 3B70A 3OWHA 3DBLB 3KW3A 1NHWA 4A6DA 4JZYA 1GTHA 1IG0A 3GNLA 5BT8A 1YCGA 1W6TA 3R4VA 2W79A 4MGIR 1UP6A 1UPXA 3AYTA 2F84A 3RK8A 1J9EA 4EY7A 3OVPA 1LP6A 1CR6A 2ZBDA 2QVBA 2QMUA 4C6DA 3VVGA 3CNYA 3MW8A 2DQXA 3PKZA 4DDMA 4XAPA 1YFJA 3V4BA 2NVAA 3HUFA 1OZHA 4K9MA 3NG1A 4MQ6A 4ALIA 2PR2A 2EG7A 1IY1A 2AVNA 3T1NA 2JKVA 3A1TA 4AYWA 5AUQA 2QZSA 1O9HA 3HYCA 4Q6WA 2HNKA 3TSCA 3FJ6A 1IM5A 4HDNA 1YR3A 4HR7A 2I4IA 4PIPA 2VCEA 1J97A 4GUAA 3KO8A 1UZMA 2CLHA 4F0RA 1MOQA 4MR8A 1UKAA 2JEOA 1E3EA 2TYSB 2Y4OA 3UN1A 4D46A 3VMFA 1EOMA 4RLSA 4WADA 4AZSA 5CB6A 1S8NA 3DTVB 4FM9A 3BILA 1ATIA 4FP1A 3TE9A 2J5XA 3HYLA 1RZVA 2QMOA 3BK1A 3R10A 2ZYDA 1HTIA 4A73A 1BPLB 4RQBA 3ZPXA 1LZOA 1JDUA 4A9AA 4ZE4A 4AUEA 3OZMA 3TTSA 4Z3DA 4LGXA 5F2GA 4QE5A 3DLTA 3SPXA 1L5HB 4TL8A 4R7GA 3RM3A 3T8YA 2BR4A 1F0NA 2BZSA 1JJAA 2YDSA 4WJXA 4LX4A 3QG5A 1X80A 3HG7A 1ECPA 1XZNA 2E89A 4XB2A 5G3YA 1KM2A 2QZRA 4J3UA 2I4RA 3ORWA 4D80A 1RWXA 2A0UA 3DL0A 4GOLD 2IX3A 3NFRA 3CUUA 4HB2A 4WHBA 5DCEA 4F56A 1BSLA 3ROXA 1QCYA 3QEOA 3A9RA 5FOVA 5AI8A 1VSBA 1GG0A 4YMWA 3NGJA 4P61A 3LD5A 1G60A 3WFLA 4R7OA 4PLWA 3SBEA 4OATA 2XE4A 4AY7A 2VZVA 2XQJA 3ZWXA 3INNA 4XK2A 3EOZA 3LU1A 4TXNA 1CVLA 2V1UA 3ZJ8A 5KHLB 2FETA 3W0KA 5HUQA 4XB3A 4HHMA 1I3MA 1MX1A 4B3CA 4BVLA 3UB3A 3C0JA 2WB4A 5EJ2A 3IIPA 1N3YA 5JCJD 1VLIA 1HDIA 3INRA 3L6CA 2C2ZA 1ISJA 4YMVA 3VIIA 5EGSA 3F49S 2GZRA 5JYBA 3PRKE 1MJFA 3W00A 3RUAA 5KNBA 1JAYA 3CT7A 3B1YA 3ADPA 1WP6A 3FGCA 4DIFA 2ZBVA 4H3DA 2PGWA 3L5AA 3V3WA 2XEDA 4S3MA 2PUWA 4WDWA 3WHKA 3DE2X 1CR0A 3WY9A 1S2TA 1X1QA 1T6XA 3EXHC 3I12A 2COUA 1ZK2A 5FEPA 4YRKA 2BTQB 1UPAA 3TZBA 3I5XA 3LBIA 1QP4A 3N53A 4HYWA 3C7AA 3EYPA 3EPRA 5G1MA 3S2CA 3GU3A 4ORMA 2F8MA 3VR1A 1B6SA 1IC6A 2IEZA 3A36A 3GGJA 3TUUA 1TB3A 2NO0A 1JUBA 3N28A 2YW3A 2JGKA 2BGSA 1JXKA 5FBRB 4V0ME 3B6MA 2J9FA 5CX1B 1BKHA 2PU5A 3BFJA 4IMIB 1PZFA 3UANA 5CDSA 3FR7A 3WJ1A 1FU4A 1ORDA 3OKFA 3QFEA 3A9BA 1EVEA 4YJ5A 5DRTA 1YXDA 3L7YA 5JJBA 4I36A 1R2TA 1BRMA 5IH3A 3W9ZA 2N1BA 3C4VA 2QPOA 4FHGA 1CTNA 1VR6A 3QHAA 4Z0TA 1XYFA 4ZYYA 4DWSC 3FYUB 1X9IA 1O12A 2QCDA 4LNHA 3R7SA 1SBIA 4U7FA 5A9TA 3W2JA 3C52A 2A5LA 1Q13A 2QJIA 3AU8A 4CN8A 1HLDA 4LXHA 2E37A 4I4TA 1MZVA 5ECUA 4IPPA 3W34A 5E9JA 1KHTA 3DOIA 4UFMA 3DGBA 2J8TA 4NI3A 3UW6A 5E6ZA 2EFHB 1FIUA 1K0FA 3VD9A 2M1ZA 2ZKLA 4CMHA 3COWA 4DRXB 4FZ3A 3CQ0A 1MAVA 3L40A 3AKCA 2RGEA 2I3GA 1ZD4A 1T2EA 3WLPA 4BFWA 2G1JA 1I1XA 5LMUB 5EFOA 5LP6F 1E15A 3LOUA 2XZ7A 5JY6A 2W98A 2VQTA 1LM1A 4KWUA 3DZ8A 3T3PB 5CA0F 1OZ0A 3SN4A 3PCXA 1R3UA 3ZU3A 4F3TA 3GGCA 2XA9A 1W6UA 2WYHA 1M7BA 1LBHA 2X14A 2VJPA 1WCV1 2CEKA 2JFGA 2PZEA 3L8ZA 3B7GA 2GK4A 1SC3A 4DSUA 2HA2A 4V02A 2YV2A 5I8PA 3ZWNA 2OCXA 3F5FA 3ROQA 3TRDA 4DBVO 3HEMA 4A27A 4B91A 5BW6A 4G0ZA 4KH1A 1WCXA 4R3WA 4O4VA 1S2VA 1U9YA 2NWQA 4UAUA 3TI9A 3JPWA 4JIGA 3GI1A 4V03A 4EATA 5LB2A 2HKIA 4ZO7A 4XISA 1L7RA 5KU7A 1XFBA 3HYRA 4HH4A 5IM4A 4J28A 2O1WA 4CFZA 5JCOC 3HFJA 1KRXA 1OB2A 2PBLA 5KHAA 1VLMA 4Z2KA 4PMRA 1U8CB 4EPBC 3HADA 1HT1E 3Q58A 2GVJA 2NUWA 3GAFA 1TQDA 1WDTA 5CHYA 2PSEA 4TWAA 3PZNA 3U0HA 1DAMA 2I6QA 3II1A 1SA0B 3B1FA 5AICA 4BV3A 5FCZA 2FPGB 4ZVTA 1ZMOA 1TEXA 1N5MA 1G5HA 4LMRA 4Q7IA 4DV7B 3SE0A 5KYXA 1IN5A 4Z6KA 2NT0A 2YW2A 3DXFA 3IE0A 2CW5A 3ZKAA 4CTJA 3B05A 3CPEA 1WXXA 4NNBA 3OZPA 1TFUA 4R6WA 3IHLA 4AY6A 4PMYA 1HJWA 3TIMA 4AYGA 4FZIA 2AQKA 2YPIA 3CNBA 5BN5A 2COKA 4KMRA 3AVQA 3WWOA 3AS0A 1XG5A 4CIDA 1F8UA 3B13B 1VE6A 5HWMA 5BROA 3VD4A 2DFNA 4J91A 2WBGA 2FXIA 3EB2A 3A58B 4P9NA 2L17A 1PYFA 1PFWA 1WDDA 4X9YA 4QPPA 1W49A 2DZSA 1VPTA 4BQPA 1WXJA 3N0XA 4V1CB 4PGLA 3SSZA 3DZ1A 2ACQA 1QRUA 4OQVA 4HFMA 3TEJA 3KG2A 2I3ZA 3B9QA 5L7YA 3VGJA 1R85A 4ERXA 5ALTA 3I3SR 3HJEA 2HBXA 2VWPA 1E94E 4GG1A 5TQLA 3PUVA 1SUIA 2JAXA 4AWAA 3Q7SA 2IYOA 1ZCJA 4MDPA 3RH0A 3ZIZA 2WTXA 4O2AA 3SQLA 3I0MA 3OOJA 4K5QA 2ZWMA 3CZKA 1DRJA 4LF5B 1H2WA 5KZDA 1RWQA 3M2TA 5JZMA 3H6HA 4ZXFA 1UHVA 3DT9A 4M37A 3MD9A 2ZCVA 1E79A 2RHLA 1DC4A 3CGWA 2NOAA 2O1SA 1P7TA 3IRDA 1RE0A 1C0PA 1XLJA 3ZW8A 3A0UA 3QF7A 4UNQA 2I14A 2HRQA 1CGWA 4LE2A 1PR4A 2EL7A 3KZNA 5HQJA 1TK9A 1Z3CA 3O1HB 1VFLA 3V18A 1MVLA 1NM9A 1IN7A 4RXGA 3NOXA 1Y5IA 4YMUA 5CJJA 4G23A 4D8TA 2IZ7A 4JZ5A 4MB1A 2YN0A 3FVDA 4J1QA 4MLZA 3HGQA 4EUFA 1KBIA 4DDUA 1MOZA 3GVWA 2XRYA 2Q5IA 4HAZA 4EB6B 3WBYA 2WJIA 3USES 3A3XA 3FOCA 5IDYA 3JVAA 1IN8A 4AUNA 2C8VA 1UINA 2ZDGA 1BHO1 1DV2A 4F0SA 2O0KA 1BW9B 4LSWA 3D46A 1ZGGA 1B6TA 1YR6A 4J16C 5CVDA 5DMNA 5H7XA 4RFSA 1KXHA 4IP5A 3NL2A 2BAGA 3KVMA 5IT0A 5DF0A 2PV7A 3AR3A 2HWYA 4QBIA 2Q8ZA 4N6GA 3NEJA 3WO1A 2VGFA 5CCDA 3KQYA 2IKGA 1QGED 4S1OA 2JA2A 2ADAA 4EIWA 2GEFA 3SY5A 4LJ5A 2QZPA 3A6JA 4DBSA 3VR4A 3RVDA 4N9CA 1FEZA 4TOIA 4DNFA 2X1IA 4RXTA 3WI7A 2WB2A 1Z48A 2R97A 2PKQP 3OHSX 4Y6RA 3DOUA 2O4CA 2JL1A 1NW7A 5EHZA 3GJXC 1U4NA 4NBRA 4X64B 5ILQA 2WJEA 4DDWA 5JAMA 3BWEA 1P19A 4RETA 4N7JA 3SSMA 2BHYA 3REOA 5GONF 3RFVA 2PZAA 4K86A 3UXLA 4YUYA 1G9HA 1ML3A 1PLLA 5BSKA 3QUQA 3I32A 4NY1A 5ER9A 4Q4SA 3UJFA 1GEEA 2D6FA 5C5IA 3FK4A 5TQVA 2KZHA 4QFMA 3NT4A 1EHNA 2WLTA 4GNJA 3NASA 3FAWA 3VC3A 2J9YA 5DRYA 3M3HA 2H48A 3RK1A 2WNSA 4F84A 4QM7A 3OCYA 5KOHA 2E6FA 3H70A 2NQ2C 4O4IA 3I3EA 4ADSG 1BGAA 4F4UA 1GOQA 4H0FA 3EIQA 2A88A 1A5BB 1FFQA 4L5CA 4B3MB 1FRVA 3EMCA 4TGLA 3OT1A 5JOQA 5DSTA 1COWA 1MRNA 2JGAA 5KNCH 4CM9D 1JIBA 2NO7A 3LLUA 1FRZA 4F40A 3QHMA 1NP6A 1M2HA 2BMAA 4QLOA 3UWZA 1ZVKA 4XZ9A 3KQKA 3V9AA 1I2BA 3IBCA 2ZBFA 3T5CA 1JA9A 1AUXA 1E96A 1A5UA 4GE0A 1OFHA 3RX4A 3LTPA 1EDZA 1SU7A 4RFLA 3ESXA 4M1YA 2ZUBA 1NPDA 2XHZA 2G77B 3CSSA 1HO4A 5ENLA 4UFPA 4TYNA 3I2GA 1HLGA 1MN6A 4FR2A 2B7PA 1KK0A 4QTXA 1N77A 3OMLA 3U2OA 1F2UA 1U3FA 3QMMA 1PT8A 2ZIXA 4YJ2B 2D2XA 2WZDA 3UA4A 3POCA 4TL9A 4ZZ1A 1KVUA 3C2OA 4R1QA 5DN6D 2JASA 2EZUA 3CZEA 5ALQA 1K7XB 2V5UA 3DL4A 4A0FA 3G2QA 4B9ZA 1JAKA 4M1EA 3S7TA 3L7JA 1L4LA 5M34A 4O5AA 4S1VA 4XD7D 2J47A 3OPYB 4P35A 4CMCA 3ZV7A 3LY7A 3ZWVA 3Q6IA 1OZFA 1T9ZA 2QW1A 5KMGB 1Q45A 3G5EA 1IY8A 3AVOA 1G21A 3D6UA 5KVVA 1T3TA 2QUHA 5G4KA 5AC6A 3UJPA 3IJ7A 1PEKE 1A9YA 4HH1A 2QHXA 3QWBA 3VV2A 1K98A 2A57A 4LXYA 3EAUA 5LYRA 4LXUA 2FQIA 2FQWA 5C5YA 5GNZA 2DC1A 3OIGA 2WKLA 2P6PA 3MMTA 3ZIAD 1U0NA 2ZRNA 3PWSA 4FYXA 4WF7A 2J77A 2ZATA 5D4YA 1HKMA 4MJ4A 2FOLA 3UYIA 2GF9A 3TTTA 4OLFA 2E5LB 1D3GA 4UREA 3W0LB 1QYCA 3D7SA 1NR7A 4HEJA 3KLNA 2ZA2A 4TTPA 3KJFA 2G8LA 4TUYF 1E6PA 1RALA 3P84A 5AOBA 2DUXA 2Z8YM 3FUCA 1QZUA 2G3IA 2FPLA 3NC4A 4J8PA 4FNTA 3HM7A 5C0QA 1CR4A 5JO0A 4PEKA 4Y6SA 3LM8A 5EGRA 3F3MA 3RIHA 3VR2A 3TN4A 2VH5R 4G86A 4X54A 1A2QA 2E4AA 3BAXA 2WHXA 4UAVA 5BT9A 3DOCA 5JWOA 2LCQA 3IRUA 1FWHC 4AJPA 3TTXA 10MHA 2VQ3A 4N0MA 2X77A 2R91A 4S3JA 3IAQA 3DLIA 2C5AA 3MSRA 3BD6A 3MYRA 2EBWA 3MWEA 2Q3MA 3V2GA 2W66A 2V8BA 4IQ0A 1FW6A 3HO1A 2Q1UA 2XCLA 3C6YA 4HGXA 4PMOA 2GBIA 4GHRA 2X8WA 3AL0C 4LHEA 4Q9JA 2ZRUA 2FKNA 1RV8A 3B85A 3OLDA 3VSEA 3D1LA 3T9CA 4KFRA 4O15A 4GZIA 3TTVA 1CK4A 3BXZA 2E8ZA 5C31A 4MWTA 3VKBA 2A3BA 3IUMA 3IJQA 4DLWA 3TWBA 3CIOA 1UH3A 2XCSB 4DO5A 3OOHA 3LBOA 3D9QX 1W0KA 2H0AA 4U00A 4OHUA 4WZAB 1QIGA 3C8ZA 1GUZA 3HL0A 4RS4A 5JISA 3QC3A 3U3MA 1U63A 3DONA 3SIXA 3V1UA 1U2GC 3ZZ0A 3WLFA 5BXPA 3QV7A 4LPKA 1HQCA 4GZLA 3EA1A 1U2PA 1I75A 2FUKA 1M2OA 3I10A 3F03K 4FGUA 4HN9A 5A3RA 2WOJA 2OMKA 3EWWA 4N7QA 1CSEE 1RT9A 1NDZA 5LVAA 3B9NA 3TX2A 2HZGA 4Y7CA 1OXBB 3LQKA 2SFPA 4I8DA 3ZGVA 1RC8A 2F90A 2AG6A 1U9IA 3BLFA 3ARPA 3GNNA 1OB5A 3R6WA 1OIMA 1QRSA 5CPBA 3M6UA 2BHSA 2R65A 4K7VA 2DZTA 1BXRA 2FTKE 3TZNA 2IUTA 1Z7WA 4XM2A 5C8VA 4GVLA 1JEYB 1KZHA 3ICVA 1Q2SA 4IPLA 2NNWB 2H2IA 1CUVA 2GHIA 4MH0R 1CETA 4UE2A 1MBZA 2GLXA 4IFKB 2IDKA 1TMGE 4X60A 4Z1MA 3AM3A 2ZRZA 1YTEA 4NHOA 1W1WA 1Z3NA 2DZDA 3GLGE 3UWSA 4A23A 2FQYA 3NIBA 3WNBA 5HK4A 2WJPA 4FFOA 2IYYA 4TYQA 1J5EB 4K6GA 1XNRB 5HKOA 4JTTA 3BWYA 1WZAA 3VTRA 4IT1A 5DM2A 3VE7A 4XD6A 1S2IA 3LVQE 1RLOA 2OM2A 5F4SA 2YVLA 2JGLA 2X42A 3D8SA 1RHKA 4QEHA 2HU7A 3VSCA 3F4LA 4J03A 3C3AA 1C4OA 3DC2A 2XIQA 3B8EA 4DR4B 2CNWD 3LCJA 3T5DA 1GYRA 4IIBA 2O0LA 4JP2A 1M2VB 5ICEA 2HHHB 1IEIA 3JQAB 5HMSA 1T6BY 5HF8A 1CY2A 2LUOA 2DR2A 4L28A 2EW8A 1BHQ1 4B84A 1XHGA 1ITZA 1LRLA 1Y3BE 3PCTA 1PUDA 3OTGA 3CGTA 5MF5A 3ZNNA 1JPUA 4A2QA 1A88A 3HB7A 5AUOB 1XQ9A 3U9SA 4K0RA 3OZSA 3GT7A 1S9HA 3G2JA 1A4LA 1Q7CA 4A6XA 2NUPB 1I2ZA 5JLAA 2PCLA 4GBDA 5C8YF 2FQXA 2ANUA 4CN4A 3DBRA 3GJ6A 1ZI6A 4WSOA 5E8RA 1YV9A 2ONZA 1F38A 5F35A 3GEDA 2Q1SA 1FW8A 2AN5A 4BO8A 2GXAA 3CN9A 2BGJA 4YRAA 4J1NA 1P2TA 1RAAA 4KS0A 4OXIA 2PZGA 2QB5A 5FPTA 1DAOA 1UZ4A 4K03A 5MN5A 4EVIA 5DY3A 3DFMA 4JJZA 2CHOA 5EFDA 4XGIA 3NQ41 2Q9BA 3MP3A 3DE4X 4H0NA 1RPKA 2DTXA 3FNDA 4TVBA 5TARA 3UHFA 3EH1A 3RYHA 3NO1A 5AK4A 2CKMA 3MK31 1OZAA 3GZNB 1LKZA 3PJFA 3EXIB 2BVTA 2XYHA 1MEOA 4KQIA 2P4HX 2BH2A 3ISJA 2VEPA 1E62A 1OV4A 2YHBA 3GOQA 3LTNC 3W7PA 3DP9A 3L43A 3FYTA 3W04A 3W81A 5CB0A 4LVAA 4DSAA 2CJFA 3TQ0A 3BZBA 4YO7A 4OIMA 5DXXA 2OE2A 2DFTA 5SWUA 2QTWB 2YW9A 1T36A 5BXSA 1Z33A 4QXMA 2XNHA 4I55A 1T1IA 4NZMA 3R8CA 1RQGA 3QRWA 3WYBA 1IBMB 4LEQA 3ZE9A 4FMBB 4N0EA 4MW2A 4CM5A 2XAAA 2C7BA 4UAGA 3F67A 1X8FA 1Z0JA 3EA2A 3JQFC 3P0HA 1LDCA 1XJBA 3EWXA 3AZOA 5T6MA 1GJPA 2Q1XA 3AZRA 1L7MA 3VNZA 3IE1A 4EW3A 4ZSUA 2MJLA 1CKEA 4YTTA 2R6CA 3GJYA 4IFEA 5GZ6A 4XIIA 1K4MA 1GEGA 3EVNA 1S39A 2XWJI 1TQ6A 2WSRA 2YXPX 4XZMX 4IFBA 2PC8A 1G4AE 4CEJB 3GXBA 3SW6A 3TOYA 1A53A 3PXXA 1HEIA 5CB8A 2IOFK 2PA6A 1T3ZA 3UF0A 4QG7A 4BGDA 1SHUX 4BVEA 2HPMA 3MP5A 3LERA 2HMWA 3P9KA 4ZQIA 1XDLA 4DLUA 1RBYA 1R7OA 2I7CA 1XNQB 5CEFA 3FSGA 1ESMA 3GEIA 4ZCRA 4DLRA 1ZITA 3VH1A 1V41E 3NS7A 3VXGA 3MHTA 4JKOA 4B6SA 5AKQA 3CQ9A 1SMAA 2WBKA 1I7QB 3U17A 2PX3A 4KO2S 1HRDA 4LTSA 5BPFA 3MI2A 1ONEA 5EZQA 2MU1A 2IXTA 1LSSA 2FEPA 2XCQA 2E9LA 1UPBA 4YU1A 3MBKA 2A78A 4Y8EA 2XY4A 1NM5C 1C0EA 1R47A 2EEXA 3KZCA 1WO2A 4CNNA 3ET4A 4K9OA 1WXGA 4DG9A 1N2EA 3JYNA 3QQ0A 3DECA 4O2AF 2UYHA 2E82A 2ODTX 3A3HA 4YAIA 1X1SA 1O5RA 3OPSA 3GFPA 1KDYA 1PO9A 1MIHA 3NHBA 4CMJA 3MCOA 3G2NA 3UHPA 3HP1A 3VUSA 4NCKA 3SP1A 1SQ5A 8XIAA 5MFZA 5D7BA 4V38A 1FNCA 5AVRA 3DE1X 3ZVHA 3HYSA 3TNOA 3GNTA 4Z2YA 2D73A 3FNBA 4URXR 1YZYA 1GL9B 3LQ4A 2ZIAA 1XVVA 3GARA 1AKUA 4PLGA 3UOWA 2QD3A 2DBZA 4RE2A 1SHTX 5DBUA 1NQ5A 4PE5B 5LQCA 5FF0A 3A1UA 2G95A 2QTRA 1V1RB 2RB5A 4AY1A 2WKGA 3MLAA 4XVCA 5HNRA 3RVNA 2IV2X 1XLHA 4YRQA 3TXXA 4IZOA 4I2VA 1JQ3A 2HMCA 4Z5XA 1LPAB 3S55A 2ZJ6A 3OTWA 3TLAA 2HK7A 1CJVC 1BE1A 1V7ZA 1EP2A 1K8ZA 2OQIA 3DEHA 1I94B 3WGHA 5H8UA 1R3SA 1R3QA 2ZE0A 4O57A 4J2TA 1Z6YA 1KKMA 3N8IA 4ZPXA 3SZOA 5K3OA 5E6YA 3W2EA 3CAVA 4MROA 4EF4A 5TS3A 2J6XA 1JQVA 2JIZA 4DHEA 4JR5A 4DGQA 3K1YA 4KG7A 4KUGA 2Y85A 1I4OA 2QL5A 1UFRA 4ROSA 4R3UA 2C3YA 2W8ZA 4H9MA 5IJ9B 2VQDA 4ZAGA 4LZLA 3V4FA 4I7UA 1ESNA 1XBYA 2Z2XA 2VFIA 3W5UA 4WKFA 4BXOB 5D3KA 3R6TA 2J9ZB 3IIZA 4BEWA 1SVSA 2Y5EA 5LN1A 1FBTA 2VP9A 5AWFC 1ZAYA 5IFPA 3T4UA 4FMCB 5KJCA 1KBJA 4ZODA 3KM0A 1SSGA 4UBIA 4WNCA 4LWZA 3MBIA 3TQHA 3KVLA 1X1DA 2GXUA 1E20A 3UW1A 3ZQ9A 3QR0A 4A3HA 2CZVA 4FE3A 2FRDA 1NH6A 2WD8A 4Q00A 3NM3A 3IEXA 1W30A 2I6SA 2N47A 1EPVA 1TRDA 3KUKA 2YFOA 2RD2A 1PGNA 5TD4A 3W71A 3PUKA 2E67A 1H9CA 5PGMA 2WTEA 2C3OA 2WIGA 3M4YA 1D09A 3E3OA 2HRCA 4AW9A 2O6LA 1OPXA 4H6VA 1ETUA 4EHBA 4E3VA 2BL4A 1VXOA 2Z9DA 3M7IA 2HK9A 3TL3A 1OG0A 4G1MB 1ZG3A 4B7CA 1JD7A 1PHQA 4ESOA 4Z3OA 3UMBA 4N42A 4XPIB 1VFNA 3BWCA 3WCZA 5BSRA 3KZMA 1LTQA 4IF6A 5LYJA 3H3FA 1POJA 2A35A 3P94A 2WHPA 3BLDA 5B1DA 5HQEA 4DMMA 4IQEA 4WXEA 5I7HA 3HLTA 3X1YA 2IHVA 3MTWA 4LDZA 4H6WA 5KHOC 1WEHA 4G67A 2W4XA 3QN3A 2F48A 5ABHA 5JAUA 3LN3A 5J40A 1Y9DA 4MOWA 4LBZA 1ISSA 3OA3A 4UC0A 5A6VA 1N3LA 3KAPA 3D02A 2Z56A 5ERYA 2FFAA 3NNTA 4Y2WA 1P6BA 4S04A 1Y9AA 4BNDA 2IBMA 4S39A 1QIJA 1H11A 3Q7RA 1ZM3A 3G9TA 2PT5A 3OEEA 2QD2A 1DEXA 1NF0A 1NUAA 2VD8A 4E4RA 1AT1A 5D01A 1I2MA 3DXYA 1NV8A 3DKJA 3PXDA 2XWSA 1UPFA 2PYIA 3BL5A 2GDJA 3M8KA 2BRUA 3AQIA 1JCMP 1GL7A 3QWHA 5A0FA 4AZWA 2IEDA 5D02A 1GPAA 2ZANA 4RVUA 3SHTA 3TI7A 4F3CA 3VOHA 1BJRE 1J1IA 2AGKA 2ARKA 3FMGA 1AIPA 3TYUA 3ONVA 4M6UA 1R8SA 4X9SA 1AQUA 3GRIA 4WPGA 5JH2A 4TZTA 3MQ4A 5FEMA 1M1NB 5SY6A 3FSJX 2P3ZA 5REQA 2OGUA 3SI9A 2X4LA 2F3SA 3OZ7A 3EASA 3H55A 5KX5F 1XK7A 1W2GA 3M4JA 4GI3A 4ZEWA 2G9NA 4IR7A 3OPNA 4ZO9A 4IZHA 5CAEB 1PZ1A 5EIEA 3HXTA 1JMKC 4WZBA 3IVXA 1GTEA 2FR8A 5LXTA 2Z1NA 3O8RA 1TJ4A 3CSDA 3LX8A 2ZZMA 5EJGA 2NU9B 5DNEA 3MHPA 1ZH8A 5E7IA 1T29A 1PF7E 1NPTO 3NTOA 3AJDA 3CZJA 3RKRA 1N8FA 4G9EA 2HLDA 4TVDA 3KEMA 5TXGA 3ZLTA 3GPBA 3DFYA 2VOEA 4MEAA 3K0AB 3K8LA 3M9YA 1TPYA 2PAFA 4OFXA 1XEFA 4ZOBA 4NIMA 3FNQA 6XIAA 1WUHS 5A9SB 3RAEC 4WQ6A 4FSAA 5IFTA 3ND6A 1UYQA 3TLBA 3SVTA 2Q6TA 3BMVA 2CLIA 3DDNA 2FFIA 3GVGA 3ZO9A 1NU8A 3PWZA 4MVAA 3F2CA 1DHPA 3N07A 3T0DA 4Y8VA 4O2RA 1O6FA 1GKRA 4HQLA 2OB3A 1JGTA 1NTOA 2WWRA 4GFSA 3N8KA 4IG2A 1BRLB 1Z6AA 1L5OA 4UCWA 4EKNB 4FLOA 4FC6A 2WHQA 1CDDA 1OW3B 3KETA 4R85A 4QE4A 2WP8J 4QQ3A 5HJXA 3H4VA 2VN8A 3N86A 4XSMA 5JAIA 4L4MA 1O8CA 4AJ4A 4X7M