5EMKA

Crystal structure of prmt5:mep50 with compound 9 and sinefungin
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emkA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emkA02
4RWZA 4M7RA 2B25A 2QRVA 3DXZA 3BWCA 4PYMA 3K6RA 3PX2A 4MIKA 1SQFA 2CMGA 2BH2A 4XSMA 1XDSA 4DCMA 4CKBA 4A8NA 4Z2YA 1EQAA 3G2OA 3UJBA 5XIAA 2VDVE 3DR5A 1XIMA 1XINA 4PIPA 3UJ9A 2NP6A 3A7DA 3FYCA 3S68A 5DSXA 2ZBRA 1FJXA 5C0OE 1G8SA 3IYLW 3NMUF 2G70A 6XIMA 1SUSA 2AOTA 4JXJA 3HCAA 2O07A 4ZBCA 3KCJA 1RI5A 2A14A 2OBFA 5D1HA 3M70A 3CQJA 5B7ZA 1XYAA 2PXAA 3AAMA 3LPMA 5DRTA 3NWEA 1VLMA 1TZ9A 2R6ZA 3EVZA 1R8YA 2ZZMA 1UFKA 1SQGA 3V8VA 3PVCA 4EK9A 3KQOA 4RSRA 2FPOA 4BP1A 5CM2Z 1VQ1A 2YXLA 3HCEA 4HGYA 5CVDA 2C7RA 3HVHA 4YUWA 4HNOA 4YUYA 4K6MA 2HK1A 5K0CA 5FQOA 1RJFA 3BWBA 2NP7A 4P7FA 2ZVRA 5LQJA 3Q87B 4O29A 2Y1XA 5F2KA 3OCJA 4RTOA 5IKMA 3NGFA 1GW9A 2UZ4A 2NXEA 1FBNA 3HNRA 2WA2A 5D1NA 3WSTA 2HR1A 4OA8A 3G5LA 3ER8A 1NV9A 4QE4A 3FUWA 2B3TA 2VDUE 3SX0A 3FPJA 3UA4A 2IIPA 3X0DA 5LR6A 4E2XA 1NV8A 1T43A 2VP3A 2IGTA 1NW7A 1P91A 4GOOD 5DLYA 2QYOA 3Q7EA 2Y1WA 2GA9A 4QDJA 4CXMA 3TC3A 4OVXA 3M0VA 3B5IA 3MAGA 4GF5A 3CJRA 3DULA 5FTWA 4RTRA 2ZCJA 3MTIA 2EJUA 4HSGA 1BXBA 2ERCA 1ZGAA 4BLWA 4RYLA 5LSAA 2HV9A 2GAFA 5ICFA 3ERCA 3G8AA 5E1MA 3KU1A 3GNLA 4PYQA 5K05A 5I7GA 3EMBA 2IPXA 3GJYA 1H1DA 1JQDA 2AS0A 4YUVA 3TKYA 1VP3A 3L23A 2B78A 3OE5A 4DA4A 1NE2A 4GUAA 2OB1A 5CIYA 4DM3A 1YF3A 1DXIA 1KIAA 3EPPA 1EG2A 4V0QA 3UBTA 3OZRA 3FUUA 2P1DA 1D2HA 4HGXA 3P9IA 4ZB2A 3C0KA 1XIJA 4PFHA 3HTXA 4GC9A 3SXJA 1KR5A 3AWIA 4E31A 4R6XA 4C04A 4EACA 4M37A 3FRIA 5T67A 1JG1A 4C4AA 3ITTA 3HVIA 3VC2A 3LDUA 1XLLA 5H1WA 4R8SA 3OPNA 3LHDA 1ORIA 2V7EA 4HC4A 5CVJA 2JG3A 4GJJA 2QULA 3KCLA 5FA5A 3ITOA 4AZVA 3C3PA 2PX8A 3KBWA 3RODA 3TQSA 4IKPA 4C06A 4KDRA 3ITYA 1N2XA 2CL5A 2PT9A 5KYGA 4KW7A 5E2BA 3UXIA 1XDUA 1BC5A 4HTFA 2YR0A 3ORHA 4E2ZA 3M0MA 2PT6A 5EHIA 2YQZA 3JWHA 4OA5A 3IUDA 2NXJA 3BANA 1O9GA 4KRGA 3TFWA 4RX1A 4M36A 2GPYA 5GIOE 1RJDA 2I62A 8MHTA 1XYCA 3CBGA 3KKZA 3VNLA 1XLCA 5K01A 4W4QA 4QQNA 3U3HA 5H6HA 5U4XA 2IP2A 1XIGA 2NQ9A 3P97A 1HMYA 2G72A 4XIAA 3BWWA 1KHHA 1WS6A 3KPUA 3TM4A 2I56A 3PB3A 3AY0A 1DE6A 1D2CA 2AVDA 3ITVA 2P3QA 1KPIA 2C7QA 2XYRA 3P9CA 1INLA 2BM9A 2HTEA 5EOVA 3TRKA 3P2KA 1R00A 2H00A 2F8LA 2OYRA 3FUXA 4RTQA 2XISA 3I64A 4ER3A 2UYCA 3KPWA 3BZGA 1M0EA 3P14A 2I9KA 4A8LA 4GQBA 4P7JA 3KQYA 5EMKA 4PWYA 4P7KA 3BT7A 1XIIA 4XCXA 3E05A 3A26A 3VYLA 4KDCA 1X19A 4OBXA 3A25A 3R0QA 3I58A 5T64A 5DRYA 1XLGA 3GRUA 1YB2A 3DH0A 1AV6A 2HK0A 4MTLA 4RTNA 4GOND 3MQ2A 5E9WA 1SUIA 3DX5A 1TW3A 3SMQA 1XLDA 5E1BA 3NW9A 1YFJA 2ZZKA 3OU2A 3O7WA 1QAQA 3KBNA 1EJ0A 2GB4A 1QT1A 3DMFA 4G56A 3BWMA 5B7YA 1VE3A 2QY6A 2YXEA 3LMZA 3QOXA 2H1RA 4CKEA 4RTJA 3A4TA 4OBWA 2XVMA 3AJDA 1SG9A 4FP9A 7XIMA 2JH8A 5F2OA 4XUCA 3KPYA 1I1NA 3JWGA 3EVGA 4PYNA 1FP2A 2ZBQA 3DMGA 4KWCA 4X61A 3VSEA 4PGHA 4K1GA 2VDWA 1XYLA 3HCFA 4X41A 3FPHA 1R6AA 4U7PB 4AZTA 4RTPA 2XVAA 2EJTA 5FHRA 3VNMA 4DCGA 4X63A 1X1AA 5HIMA 3T7TA 1B42A 2EFJA 5E9JA 4M38A 3B89A 3PFGA 1OR8A 1XLMA 2Z6QA 3HEMA 3FPGA 4E30A 1XCLA 3G2PA 2P3LA 5K03A 2DULA 3CQIA 2UYHA 5M5BA 2B2CA 2QM3A 4AZWA 3DLCA 3GCZA 3NDJA 1S5NA 3QYSA 3BXOA 2JHCA 4FS8A 3T0IA 3ME5A 3KQTA 5FA8A 2XYQA 3KWSA 4GC5A 4DQ0A 3PTAA 3TM5A 5H02A 3ELWA 3LKZA 2AOVA 2QRVB 3FTFA 5K0NA 5GOZA 3SSMA 2EX4A 5GM1A 1I60A 2GH1A 1QYRA 2QW5A 5T6BA 1A0DA 2ONZA 1JG4A 2DPMA 2G0WA 4PYIA 1XIFA 4J4KA 4PIMA 4QQKA 1RI3A 3EVEA 1DCTA 3GRVA 2IBTA 1R8XA 1XP3A 1IXKA 4RVDA 2FHPA 2EG5A 2WA1A 3BGIA 2P7HA 2AN3A 3KR1A 3CJQA 2JHAA 3TLJA 1NT2A 2AOTB 2PBFA 1XLKA 3B3FA 2PXCA 3LBYA 4BY9E 2X7VA 2I57A 5EGSA 3P9NA 4AZSA 1ZGJA 1ZHFA 3CJTA 4GBED 1D2GA 2ZZNA 3KR9A 4BLUA 4F86A 3A27A 1IM8A 4PONA 4FGZA 3IUHA 4YTTA 3CKKA 4V0RA 2QE6A 3ITLA 5FUBA 4A8IA 1P1CA 2ZULA 3O4FA 3C0QA 3ELYA 3UJDA 4RTKA 1QZZA 2O0LA 4C03A 5KQSA 1V39A 3DUWA 4K3ZA 4YUZA 4PCAA 1QAMA 2PY6A 5K0BA 5J8LA 1KYZA 2AOUA 3KBSA 5XINA 5EMMA 4ZTBA 3G2MA 3LBFA 3OU7A 3V97A 4PCLA 3NVKI 3KQQA 1NW8A 3KQVA 2JHPA 5GINE 2FK8A 1RJEA 2YVLA 2GLUA 2ESRA 4OQEA 5EIFA 5G02A 3RW9A 5KS2A 3WQOA 2FCAA 2C7OA 3E8SA 3FTCA 5LQAA 2I7CA 4QPNA 5DTMA 3U81A 1NW6A 3P6LA 1N7JA 4ER7A 3BKWA 3LCVB 4QTTB 5DTRA 4YTQA 2V74B 3GIWA 3CVOA 1XTPA 2J6VA 3AXSA 1XYBA 5EIWA 4YTUA 5AVNA 3OFKA 4QVKA 4YUXA 4PYOA 4PYLA 3LGAA 4GOMD 3KCOA 4YMGA 3O31A 3GRZA 1YZ3A 1L1EA 3LCUA 3AYTA 4GJIA 1WY7A 4LNCA 1XLAA 3R9XB 4KIFA 3G89A 5B1SA 3M6UA 5LQUA 5HFJA 4E33A 2VS1A 3M4XA 3C3YA 4HG2A 2IDJA 5GM2A 3BGDA 1BOOA 1MNZA 4OX9Y 5E2AA 4FR0A 3XINA 3ANXA 1JTEA 1Z3CA 5EMLA 2HWKA 4F85A 2N47A 3HCBA 3R3HA 5AVHA 3EVCA 3JWJA 2PKWA 8XIMA 1PJZA 10MHA 3KBMA 4HHMA 4BLVA 5DM4A 3NVMB 9XIAA 5EKXA 3EGVA 5FCDA 3SGLA 1F3LA 3GWZA 1P39A 3UJAA 2AOWA 3SVZA 4H0NA 3UJ8A 1XYMA 3UU0A 5EC8A 5K0FA 3VC1A 1L3BA 2AOXA 3G8BA 4AUKA 5E1OA 4POOA 2OKCA 1Y8CA 5DPMA 4BP3A 4C07A 2CWWA 3NJRA 4DKJA 2WK1A 3A7EA 3HM2A 3M0YA 4FT2A 5BP7A 2JJQA 2BZGA 3C6KA 2I6GA 1XIEA 5HIJA 5XIMA 2AN5A 5EKUA 5BXYA 3KQSA 3BGVA 5FWDA 3ITXA 4QDPA 4Y2HA 4RVGA 5ICCA 2G8NA 5FHQA 1XVAA 3T7SA 3AALA 3TR6A 3CQHA 3P9KA 2ZSUA 1JSZA 5DXJA 4GOLD 5FWAA 2ZIEA 2BR5A 1FP1D 4DF3A 1XLEA 1BXCA 4F84A 2QUMA 3GXOA 3K0BA 1M6EX 5K8VA 1JQ3A 3M6VA 1G55A 4DVOA 2ZVJA 2VZ9A 4RVHA 3G7UA 1EIZA 5K0EA 3SSOA 3DMHA 2AZTA 3ELDA 2C7PA 3FTEA 5CUQA 2OPBA 3U0HA 3UWPA 4U7TB 5DWQA 3PFHA 5DX8A 4A8RA 4EAYA 3MTEA 2NNWB 9XIMA 1DIEA 1SKMA 4CWAA 4ATNA 5HILA 3KHKA 1JR4A 4MHTA 2PXXA 3LSTA 5HIKA 2ZLBA 3MHTA 5EG5A 5GIPE 1DUSA 1KYWA 1BKYA 2P3OA 3I9FA 3IV6A 3MB5A 2P40A 5ICEA 4CKCA 4QPPA 5FULA 3NTVA 4E2WA 2OY0A 4R05A 5CD1A 4C05A 3HCCA 1A0CA 2YXDA 4YV2A 3P71T 3TVAA 2O05A 3M0HA 2PWPA 4QDKA 1ZG3A 5HEKA 1X1BA 1BHJA 3OFJA 3OE4A 8XIAA 3QC0A 4LWOA 5E8JA 1G60A 3GO4A 4ER5A 5C9ZA 4YV0A 2ZDSA 2X7WA 5DX1A 2P8JA 2ZWVA 5LQRA 3ER9A 2OO3A 1MJFA 1JG2A 1FPQA 2O06A 1XICA 2PX4A 2YX1A 4PYKA 3CGGA 2E5WA 3NDIA 3BDKA 2PV0A 2XINA 1NW3A 2G71A 3ID6C 1ZKDA 4IV8A 4YTRA 3EVDA 1I6NA 1RI1A 3DLIA 3I5UA 4XUEA 1I9GA 2NYUA 2OB2A 1DIDA 2ONYA 5CCBA 3M6WA 1R18A 3KPVA 3PLAE 7MHTA 5K0JA 2FYTA 1XXLA 2OZVA 5ICGA 2ZBPA 1WXWA 5MHTA 3E23A 5B80A 3PX3A 3M0XA 3PT9A 2YUIA 5EVJA 5K0LA 1VIDA 4AX8A 4P7GA 2GLKA 1NBIA 1RJGA 1VL5A 4QDWA 3CC8A 4Q7IA 4PINA 1HNNA 3TOSA 4ZB5A 3KQPA 2YTZA 5LQNA 4LECA 3LL7A 3E7PA 3HA5A 1QUMA 3UJ7A 2BR3A 3DOUA 2Z6AA 4CTJA 3DXXA 1TW2A 2Q41A 1NBHA 2IFTA 2QUNA 1AQIA 1AQJA 1L3IA 5EQJB 1F38A 3P2EA 3RIEA 1G38A 4WXHA 2BR4A 3G88A 3MERA 4YV1A 2PVCA 3C0SA 3JU2A 3DTNA 3UA3A 2XYVA 2P35A 1X1DA 2FRXA 4EMSA 3UVAA 4MWZA 5ERGB 2IH4A 3CNYA 4MQ4A 1YUBA 1UIRA 1P1BA 3L8DA 1XCJA 2PX5A 5DXAA 3VNIA 4L7VA 1KPGA 1O1HA 3NWBA 3AXTA 5FQNA 5GP1A 3R6TA 3REOA 1PRYA 2H11A 5DT2A 3CWHA 4P58A 5K09A 2K4MA 5HOQA 5E1DA 2HCVA 5C1IA 2XBMA 3KTCA 1KPHA 2PSSA 4EKGA 2O57A 1XLJA 3BZJA 4A6EA 3GU3A 3FUTA 4PGLA 2ZWAA 3EVAA 3QXBA 1KP9A 3XISA 2IH5A 1NKVA 4Y30A 3M0LA 4QEHA 2AN4A 5EZSA 3FTDA 5DM0A 1KXZA 3PS9A 1XLHA 3UZUA 1MHTA 3LECA 1O9HA 3EGEA 2BM8A 4GLEA 3THRA 2AOUB 3F4KA 2PWYA 3DBNA 3I53A 2G1PA 3GRYA 3MCTA 3SM3A 1XLFA 3QZAA 1NW5A 2NXCA 1G8AA 4QVGA 4KVZA 4XISA 3HCDA 3B7PA 3OU6A 3TMAA 3OZTA 1DL5A 3IEIA 1M6YA 3DXYA 1JG3A 5EZQA 1JQEA 3TPZA 2UYQA 5GWXA 2GVEA 1RI4A 4ER0A 4DMGA 2ZW9A 6XIAA 5BW5A 4EVIA 4ISCA 4E2YA 3JWIA 2PLWA 5DM2A 4KW2A 3EVFA 4XIMA 3KPJA 1VBFA 3LDGA 4ZB0A 3BWYA 3LDFA 3SSNA 5KVAA 4QTUB 1WXXA 1I4WA 4FT4A 4E32A 4RTSA 3SR4A 1WZNA 5CCXA 3G2QA 3FPEA 4PNEA 1EAMA 3KQMA 4RTMA 3P8ZA 9MHTA 3B3GA 3N4AA 3OZSA 3KBVA 2Z6UA 1U2ZA 4FSDA 3THSA 1O54A 2ZIFA 1R74A 5FADA 1XLIA 3FUVA 2HMYB 4FSXA 2ZFUA 4DUOA 4C08A 1QTWA 4PGGA 3BZBA 4EQZA 2IBSA 1L3CA 2ZIGA 4HRAA 3BKXA 5IH3A 5BW4A 1Q0TA 1QAOA 3LX6A 3LCCA 3VYWA 4QEEA 2NQJA 3FYDA 4KIGA 5JUWA 3FZGA 4X1OA 3LKDA 1XISA 1A0EA 5LQKA 2P41A 3FVMA 3R24A 2IH2A 1S5MA 4XUDA 5TNVA 1VP9A 3BUSA 1XDZA 1CLKA 5LQCA 2GUBA 4RVFA 3C0LA 2GYIA 2XIMA 3H2BA 3EGIA 4HGZA 2ADMA 4CTKA 3CQKA 4UOEA 3ELUA 4FZVA 3MGGA 5EHGA 2Q02A 5DM1A 3KR0A 4LG1A 4HTFB 2UYOA 2LD4A 1RI2A 3HVJA 5EMJA 3XIMA 1OADA 5CVUA 2OU4A 3GDHA 3KQWA 2AVNA 1L9KA 1IY9A 3B3JA 1SVUA 3KBJA 5K0GA 1Q0SA 5E9QA 1ZQ9A 2CMHA 3EEYA 2PGXA 3FPFA 3HA7A 3EEOA 4R8RA 1K77A 3EMDA 5KQRA 4US6A 3VNKA 1XIBA 4QE1A 1VPTA 3G5TA 3QOWA 2OXTA 4YMHA 1AF7A 3VNJA 3TKAA 4ER6A 4B17A 3QV2A 5DTQA 3OBEA 3EVBA 5DSTA 3M33A 3UFBA 3IUIA 3M6XA 4XSLA 4IV0A 3IHTA 4A6DA 1XJ5A 3AYVA 5EEGA 3D2LA 3UJ6A 4DZRA 1QANA 3HP7A 4R6WA 3C6MA 3HVKA 3HA3A 5P8WA 4RTLA 2CKDA 2R3SA 2IDKA 2ZTHA 2FK7A 1D8WA 2PX2A 4IWNA 2PJDA 3T7RA 4OQDA 2AR0A 1XIDA 3P2IA 5F2NA 4QE5A 4XKMA 4HHLA 2G4JA 3CCFA 5CVVA 4NECA 5CVEA 2JH9A 5EPEA 5E8RA 4PYJA 4GEKA 3UJCA 3DP7A 2B9EA 4LWPA 3FRHA 5DX0A 5HZMA 5JR3A 1YX1A 3GRRA 1ORHA 2NQHA 2HNKA 1JSXA 1YFLA 2NXNA 4E3VA 2P7IA 1EJ6A 4EKIA 1DE5A 2KW5A 4X60A 5HIIA 3KR2A 1WG8A 4RV9A 1X1CA 1MUWA 3MCZA 4HH4A 1XIHA 2GS9A 1G6Q1 1TPYA 1N7IA 5EEHA 4E70A 3GGDA 4YTSA 2ORED 1YZHA 1JTFA 3GNXA 1UWVA 1XLBA 4WVLA
chains in the Genus database with same CATH superfamily
1US8B 4MJMA 2C0PA 1ZY2A 2RKWA 3HDHA 4WUVA 2PEYA 3C52A 1U0TA 2H7VA 1EJSC 2J09A 4P82A 4CM8B 3CE6A 5A9TA 5LKAA 3M2TA 2ZZ6A 1GOWA 4DCMA 4WKFA 5FL1A 2B61A 2DPYA 3M9LA 5FUWA 3PKZA 1NNUA 3PNYA 4H1ZA 4M46A 1R3WA 1OREA 3QJYA 3MF4A 4BNZA 1KM6A 2XUKA 3R4VA 3LD5A 3IYLW 3L12A 1PHRA 1PTDA 1F8XA 3NBUA 2ZX7A 2G70A 3UNDA 3WQVA 5HNTA 1E6SM 4GVIA 4R3NA 1YGPA 2O07A 4OJMX 4DXAA 4WMLA 3NEYA 4LX0A 2QMOA 3LUPA 3W3OA 3C4QA 1WKYA 2ZXFA 4HDAA 3Q8LA 2I3ZA 4S3CA 3U9IA 1G5IA 2G80A 4BDSA 1J09A 4XZHA 1Z6ZA 1GVEA 4FMVA 1W2HA 3NHYA 4M82A 3TK1A 4GK8A 3AKYA 1E0KA 4JEMA 4ZQHA 2MSCB 1XKLA 1WV2A 3T9EA 3S99A 2VLIA 2D2JA 3PGJA 3K9FC 1XJ0A 3MT0A 5DIZA 1GLNA 3HVHA 3H3JA 4RZHA 2BJWA 1YBQA 2VJQA 4WGFA 2A3HA 4AWBA 1WMSA 3MGBA 4NRRA 5IKMA 2K6GA 3QFTA 4CN6A 1GW9A 2X8WA 3FIJA 2CN1A 1AU9A 4YRQA 4II2A 2YWBA 1W35A 3W90A 4ALNA 1IT0A 4DMLA 3HKCA 1Q7EA 1GRCA 4C6BA 2QG9A 5IU6A 2H1HA 4OGFA 1AODA 2PWZA 4M0CA 1H9AA 2EFGA 4XPZA 4KL8S 3QY8A 3CIXA 1P8JA 2CEQA 3CVVA 1ZMBA 5IDQA 1N8SA 5LOVA 3NJ8A 4L7QA 1OGGA 3MUZ1 3Q9SA 3UT5A 4K6CA 5ED4A 1VRXA 4QYTA 5KTYA 4LYFA 4TTUA 1GPJA 3CXOA 3RSQA 2J9ZA 1F05A 4E94A 4RZ2A 3QEAZ 1GT6A 3SW6A 3G2GA 2NT0A 3LEPA 2WG1A 5IRCD 1TIKA 5F1VA 1FVXA 3QEBZ 2HVMA 2D59A 4PYQA 1XZLA 4LYJA 2PVPA 3PXUA 1KXVA 2XF2A 3ZOKA 4UBIA 2E4TA 3B5EA 1D0SA 1MBZA 3OE5A 3Q7RA 3ZVMA 3DQPA 3GYEA 3W71A 2L82A 4GI6A 5KNCH 2PHZA 1GOOA 1QB7A 3D6AA 4NNJA 1QHYA 4NF7A 2RHMA 3PZRA 5ERXA 1XTSA 2B5OA 2JGLA 2V0CA 3VE9A 1DV1A 2WAAA 4QO8A 1D4FA 1Q1EA 2BB0A 2ON3A 3DP9A 1FH8A 3TPCA 3TLQA 1SSDA 5CLQA 3OEED 5BZAA 2AQWA 2C19A 2QKYA 5KSYA 3VUPA 1WXGA 3QVOA 3LVQE 1L5ZA 1P8AA 2ADOA 2IQDA 1SELA 1ECEA 3H42B 3H5IA 3Q2KA 1TB3A 3W1QA 4XM0A 4C6KA 4RSGA 3TNOA 1R88A 1DJIA 3GGCA 3APGA 5FBRB 4YJ2A 3CNLA 2Z08A 4RJEA 2B7BA 3QQ5A 3VVMA 3TLZA 3VPLA 3D1VA 4RYDA 1GLGA 2WIDA 4BBZA 2WLYA 2J07A 2PODA 1BC5A 4CU2A 3N8IA 3PLNA 4HUQA 4MVAA 2H85A 3E5HA 1KKMA 3FOCA 4UQPA 1JUBA 5DP1A 1O9GA 4NU7A 4AMCA 4RZ4A 3K5XA 1LRTA 3ZKWB 3DUGA 3HE3A 4PC1A 3ZV3A 1MX5A 1KRCC 4PZEA 3JQAD 3TLBA 3FDXA 2KI5A 1NRIA 4DELA 4N03A 4QQNA 2QMQA 3BCJA 4MB6A 3K4PA 4LKRA 1DIAA 4K5QA 1SZGA 4EJFA 1WS6A 3TM4A 3OQOA 2EBUA 1HX7A 1BWSA 4QNRA 1JE0A 5HQEA 3AESB 2P3QA 3OIWA 4YRKA 2GGEA 2ZI3A 2BGWA 2OXIA 4ITRC 1OE0A 2HTEA 2P9BA 3HMKA 4WKCA 3GR7A 2JJ2A 3CYFA 2VRJA 2A78A 1TG7A 1C0LA 3U1BA 2Z1NA 2W71A 4BX2A 4QG7A 3W3AD 4DHGA 4E5TA 1QP4A 1E2GA 1CS0A 1IATA 2UYCA 4FE7A 1UZ1A 4BN4A 3WDIA 1OHHD 3THYA 2B30A 1N1MA 5KEIA 4Z1CA 4RJIA 1X86B 3NHAA 2Y1FA 4YJHB 4B8YA 3EPJA 2DPLA 2VRKA 2IPAB 3SZOA 5G41A 1XCBA 3F6YA 1VLWA 1OX4A 2PS2A 2ECPA 3N6RA 2EAWA 3EIQA 2A3CA 1G5PA 1BVWA 3R0QA 4WNIA 3KYIB 3G1VA 2WMDA 1K7YA 2CXOA 4LFCB 1B3RA 1TJ4A 2YPIA 4UUPA 5JSUA 2D1RA 2JGEA 1UBNA 4ZCTA 2E18A 1EIWA 3RS2A 4GXMA 2RDWA 3RH0A 5CA1A 2D69A 1TJNA 1QI0A 2ECOA 3KS5A 5DU2A 1KBIA 3NGMA 4S3DA 3GJRA 1EEXA 3T06B 4N41A 5LL6P 1ELSA 1SN7A 4NR0A 3GXPA 3W5VA 2RGMA 5E38A 4W5OA 1ODTC 3RU2A 3HQPA 1WDWB 1VL6A 1IEWA 3EBVA 2PWBA 3K0HA 1B6RA 1YA6A 1Z45A 4TXHA 3GVQA 1BXNA 1T41A 1V6CA 2VHVA 2ZUNA 3K5WA 2C92A 4OQPA 2XVMA 4ETNA 2GYWA 1PDYA 3GXDA 1UDAA 2QIIA 1JQ5A 4G0ZA 1GAQA 1GA6A 1W4LA 3WNVA 5A04A 4KXYA 1ACJA 3C5HA 3D31A 3ZZ1A 5BW6B 1T8TA 3PNBA 5LQDA 1Y6FA 4LJ4A 3EUAA 4KTVE 1IWPB 2JDIA 4MVJG 4X61A 1EU1A 3ZWVA 2B20A 3ANNA 4K8HA 2H06A 2PMEA 4IQEA 3R6DA 1GL7A 1Y8QA 5KEZA 2GRAA 3OE7A 4RXUA 1IF2A 4RIIA 1T26A 4IIFA 4FOSA 5HIMA 1BTMA 4L4PA 5JRZA 3R5HA 2CBZA 3EFBA 1DO8A 1L8AA 2VYFA 4NMWA 2ORIA 2EFJA 4JD5A 4WPGA 3RRBA 1QCCA 3RS3A 3U6KA 2HWUA 4MJ4A 4BV3A 1XBZA 2JFUA 4TVKA 1EM6A 1ORTA 4YWJA 2RIPA 4RUKA 3TFOA 3JARB 4HBGA 2VXYA 3DGEC 5AXAA 1UXIA 2OV2A 3PTAA 3ARXA 2AG0A 1BTCA 3B2QA 4IIEA 4LUSA 3IX7A 4L0CA 4QXAA 3D7LA 3K0AA 2GH1A 3OJFA 4K81B 1AIPA 1VH7A 4DPQA 2HFJA 4E2FA 1WHSB 4PYIA 2VYVA 1DJXA 3V7WA 1A5AB 4ZOLA 2WMIB 3EZYA 4UREA 1U4NA 4QQKA 1UEIA 1Y6JA 1W37A 3PTMA 9LDBA 3ZU4A 5C51B 1WTAA 4WDXA 1AZTA 2R11A 1WOBA 2PX0A 1X7XA 3I9LA 1X1OA 4NPAA 5EE3A 1NP2A 4GBJA 2OV1A 3PZQA 5BN1A 3G6LA 3EKLA 1ENPA 1OXVA 1GFWA 3OFND 3RFAA 3SXPA 3OJOA 1YKWA 4GZ6A 5JS2A 1UC5B 3EXFB 5CAEB 4Z4FA 2V5AA 1X6UA 5HANA 4PCNA 2C57A 2P4EA 2OZLB 3NH9A 3WD3A 4PLVA 4S12A 1RUSA 4UHBA 2BW0A 4ZOAA 3ZDQA 2IEBA 1TJ0A 2G9ZA 5ADWA 3C3AA 3DUWA 2VFHA 2W6CX 4ZVOA 5JQ9A 1YS7A 1F60A 5KSWB 3WELA 1C0IA 2Y89A 3LOTA 3WWYA 1ULSA 1E1EA 4TKLA 1KFJB 3G2MA 2WFAA 2QTCA 5CT9A 3SEZA 1TQ2A 4WLNA 2R1TA 3INPA 1A5UA 2ZJZA 3I6ZA 3ICPA 4HDRA 3BOSA 5ALQA 3VR3D 2XTAA 2C3ZA 3QA9A 2Y68A 2YWRA 2CL7X 4KP7A 4HYYA 1FWJC 4FX8A 2H51A 4RKQA 3NHSA 1TF5A 1AQ6A 4UVHA 2FFHA 3L4BC 4OOZA 1TSIA 2DFVA 2I7CA 1O6GA 2JANA 4BO2A 5GVSA 2JGDA 3GFOA 5F5XA 3FFXA 4FC6A 1WUTA 1RLMA 3JASB 2UKDA 3RIYA 4IT1A 5JG7A 2R8EA 2O1EA 4WZ6A 4C4PA 3KJQA 4H27A 1QW9A 4LRTB 2QA5A 2GM3A 1Z82A 1SM4A 3ITDA 5IW8A 2FZCA 4F9JA 3AXSA 1BGXT 3QM1A 1XYBA 2D74A 2WJJA 1OZGA 4NCXA 1XWYA 3HUUA 1P5RA 1V5XA 4GRIA 4OKDA 3LLMA 1E9SA 5A8QA 4CF5A 4ZQNA 1GVNB 4WOJA 5BMVA 2WWCA 3QN3A 2YWDA 1L1EA 2C14A 3LCUA 3AYTA 3QFSA 2HK7A 1OJXA 2HA7A 1XT6A 2A30A 1B30A 2PQ2A 5DIFA 5HFJA 2DT0A 3FN9A 1KMHA 4CCSA 1HWYA 4AJOA 1E4LA 1X92A 1RY0A 4V0ME 4A1FA 4MI1A 3H83A 3XINA 2BEUA 4IMJB 2E9LA 1OH7A 4A2RA 3W1XA 5B12A 4EFLA 4H8HA 3KG2A 4LHEA 4Q4DA 4NMHA 4PW0A 2X9QA 3M0EA 4Q33A 4EKEA 1QNFA 4QDMA 4H6WA 3Q65A 5M34A 4RKRA 2WSPA 4G86A 1W30A 2I7XA 3JD4A 4O2BF 3U4QB 4DYJA 1G8JA 1FSGA 2CNKA 1Y9ZA 3EW9A 2JIZD 4S39A 2BI4A 3NQVA 3SVZA 2E0PA 1Y37A 4BKPA 3ZWYA 1XEAA 2BM0A 3WKAA 4GNJA 4FB4A 4OSPA 2W79A 2VF2A 4UZEA 4IRXA 1KC7A 4YCLA 2HRCA 3PNSA 2ET6A 4AVNA 4O50A 2OKCA 4IMFA 5CJJA 4PC7A 4KOEC 4OUEA 1PKMA 3EH1A 5I5RA 2HHJA 3KTXA 5CH5A 1N3BA 2BZGA 3H2CA 3WLRA 4EUNA 3SFTA 4C6PA 4DX3A 1WOMA 5LIWX 2QB5A 1KMQA 1E0TA 1P62B 5HAOA 1H0RA 1IBCA 3KQSA 4O19A 3EIXA 1K27A 1EBHA 3GT4A 1YQ9A 1GZ5A 1HG3A 1XMSA 2Z9CA 1EBBA 1QRRA 3RS9A 3T7SA 4CN8A 3Q2DA 4PO8A 3PFMA 2P88A 3HYCA 4ILEA 4V0MA 4PSVA 4ZYUA 4MY1A 3D3WB 1S02A 1RRMA 2OBNA 3V7FA 2Q4RA 3AHVA 4Q0MA 5JVDB 4RMJA 4JQYA 3HU2A 2OAQ1 3LIIA 4EBBA 3ABXA 4LHZA 2HSJA 2NWRA 1V6UA 4LYAA 4ZVKA 2VZ9A 3LQFA 5ICSA 4MRSA 1KCZA 1HFBA 1PL9A 4BKRA 4BCCA 1EIZA 2I17A 3VOFA 4DRYA 1JEAA 1GHRA 3OP4A 4M0UA 1I3LA 5GJMA 5DGHA 3LY9A 3PPXA 3ELDA 2EBHX 4Y6RA 2B9VA 1X42A 4F72A 4A8JC 1QB8A 1T0IA 1R15A 5NLLA 3MD9A 4KE7A 3ILXA 3U09A 3MTEA 2V9PA 3VX3A 4D9BA 4MQLA 2WNSA 4TMVA 3ESDA 3OHSX 3QVMA 4Z4CA 1SVMA 3KZPA 2HDHA 1ZH2A 1A5MC 2W67A 5EG5A 4FYPA 4LE0A 4YJKA 1KYWA 1F8MA 1SG6A 2QTTA 4H15A 3FSEA 2DHCA 2PGDA 2XNSA 3BAIA 5BUCA 3VH3A 3IV6A 1VLLA 4H9VA 3ATYA 4S2CA 3LUDA 4B3SB 1FSFA 1KB3A 3OZAA 3BTOA 4IHJA 1J79A 1W2GA 1D7OA 2NV6A 2WHYA 4BX9A 3HU7A 1V7PC 2QMZA 1GNRA 1Q91A 3VJMA 3PZUA 3CH4B 2I7VA 2VXOA 4F48A 3GMTA 3MPOA 1AQYA 2Z1DA 4FK8A 1R7OA 3VNVA 1JXQA 4ZZIA 5AC8A 1TVMA 1SHJA 4H59A 2ZDSA 1TVCA 1GOIA 3C8NA 3QV7A 1F2TA 4NYMR 2RBGA 3VKJA 2FMFA 4I6GA 4D3ZA 3NX4A 2UY4A 4L9SA 4E0BA 3WWPA 3CGGA 4AIBA 2D8AA 1Z22A 4DY6A 2VH2A 4HLUA 3NL5A 4PZVA 1FUUA 1NW3A 2Z1SA 1I3KA 3N18A 2NV2A 1RI1A 5TC4A 3DLIA 4KR2A 4RD3A 1QK3A 5C7VA 1V4NA 2OXRA 1PL8A 2B2NA 3DFYA 1FH9A 5HJXA 4IRMA 1OYOA 5L6LB 4PQRA 1XXLA 2NM0A 3FA5A 5BYJA 3M0XA 2WNNA 4R34A 4U5KA 4NZPA 5K0LA 4L72A 3LY7A 3WLKX 2QLNA 3MTGA 1O1YA 1TA4A 1KI1A 5HZHA 4DZAA 3CRVA 4F1JA 1W59A 3ORFA 2OLSA 4PRZA 4YRRA 1SC3A 2BKLA 1PLJA 1TW2A 2QW0X 2VJNA 1NBHA 1BD0A 3R7AA 5AYBA 1EJBA 5EQJB 6TIMA 2JJMA 2F61A 3G49A 3C3KA 4CTMA 3A6JA 5DN9A 5T9CE 3OZ7A 1ZIYA 1I32A 2AZXA 3BV4A 1UH5A 1WHTA 3NSMA 3NOXA 3RG2A 3CB2A 1NM5C 1EIXA 2XZDA 2RSLA 3F7OA 3L2IA 4MQ4A 2Q1YA 3ORYA 3ICOA 4G1UC 2VDPB 1DQYA 4XYMA 2FP4A 3K70D 4P8XA 1O1HA 3USBA 3A3KA 3VAZA 4KJXA 3QXXA 1VPEA 1RCOB 1PRYA 2V6BA 1USKA 5G4HC 5K8LA 4IGMA 1GG8A 4NOJA 1Y5VA 4Q8WA 4II7A 4K38A 1ENUA 4L4SA 2OXFA 2JW5A 3GXIA 6ADHA 3G59A 3RFUA 3AYRA 5A7FA 1AQFA 3DZKA 2XI4A 4Y2XA 2PZGA 1VENA 3D9QX 4KAAA 1V16A 1EESA 2VFDA 3BAWA 5JAHA 2L2QA 2IL1A 4JIMA 2Q8NA 4URZR 1LDYA 1ECFA 1M5TA 2NU9A 3UZUA 5JY1A 4XD7A 1RAEA 1KIFA 2IPWA 2YFOA 3CFYA 3PB2A 2JLAA 1EUDB 3N0WA 3F4KA 1ZGHA 1YMVA 4V3BA 4ACBA 5C7YA 2E5DA 4TTAA 5JARA 2IZ5A 1JHDA 3QEKA 3BHMA 2G1PA 2NAPA 3A6LA 4HX5A 2O8BB 2DV0A 5K6TA 1AQUA 2YKGA 1QPNA 4XIFA 4IIYA 4CMEC 4FZ5A 1YH3A 5K7JA 3WOVA 3B7PA 2BOFX 1UJQA 5MGBA 1YIAA 6PTDA 4BRSA 2YMPA 1M6YA 3VIFA 1BFKA 1Y81A 1T5DX 4IF2A 2H90A 4A2QA 3ZY4A 1GTVA 4CI9A 3VINA 3ZGYA 1MUCA 1G8MA 1VFPA 1JAYA 3OQVA 2X1IA 3R9KA 3VU8A 5AYYA 3CZ8A 4M98A 1VG9B 3CURA 2L17A 4ZEWA 3SN6A 5CX1B 3P4YA 1XTBA 5DBEX 1GQLA 1ATZA 2UBPC 1ODKA 3P2OA 1MXSA 3K05A 5FPYA 1E55A 1XCOA 3GUUA 4CUJA 1WZNA 5CCXA 2GVJA 2FMXA 4RH0A 1UP6A 4PV7A 2CFSA 3HR8A 1PVVA 3U9SA 2EHJA 4O4LF 4GABA 4BKNA 3VVLA 2BTQA 2Z6UA 3QU4A 3ZJTA 3BS4A 1PJSA 4Z1OA 1TELA 1N4AA 1AHNA 1R74A 3W88A 4BO1A 1QH9A 3O94A 4V15A 1WQ3A 2OHOA 2FVXA 2ZRHA 1ZESA 4QBFA 3L5LA 3IKVA 4YJ5A 1ZMOA 5TPZA 3OYXA 2D2VA 4LCBA 2VF5X 1QAOA 3VHQA 1RK6A 1XTKA 3NDRA 2J7GA 4WBSA 2VOEA 3RI3A 4JBLA 2LDXA 4TL7A 2IU0A 3WQ6A 1EFUA 1T6BY 3C7TA 4XLLA 4D7AA 4ARSA 3HV9A 1HPLA 3Q0EA 3UMVA 4YP6A 2V5DA 2QF7A 2IZ1A 1TDJA 5LP6C 9GPBA 4IDDA 1SKBA 2Z09A 3VGFA 3BIJA 5KUTA 3M5PA 1SBYA 1Z9AA 2ZBFA 4JFRA 3P1JA 3RREA 5CC3A 4YJ2B 1KSGA 2V68A 4K8EA 1X7YA 1T8XA 4MQ5A 1CG6A 2AI3A 4J5NA 3FVWA 1RM5A 4NPCA 2DERA 3ZHTA 1R6BX 5ADUS 2BDEA 1Q2RA 4DWJA 2ZKMX 3BLFA 3UXYA 4G5GA 1U5CA 1Y3CE 4HUQB 1II9A 3TQCA 1H3FA 1XDGA 1WKVA 4A27A 3ID7A 2VYCA 3ALFA 3NM6B 4IMAA 1EUYA 2QTMA 4LNYA 3V1MA 2YOHA 1TU3A 3BJFA 1GR0A 3VDBA 4PG5A 4UR9A 3JQ6A 1PSDA 2OWDA 3LX8A 1K7SN 3CHVA 2COUA 3QKUA 3K0CA 2RGAA 4AJ4A 3UV3A 1FNMA 2HA5A 3IEUA 3O74A 3C56A 4LY0A 4E5UA 1E3JA 5A4AA 1Z5ZA 2I9UA 5I45A 2Q1SA 5JNRA 3G0OA 3L1IA 4YCMA 3LHWA 4XAYA 4X91A 2BHTA 5DRCA 3QV2A 3R43A 1UR9A 2PL5A 5E4TA 3FV9A 4ROTA 1XRMA 5IZ4A 1YEYA 1OXMA 3IJ6A 1GILA 3EPRA 4IV0A 3E70C 5ELXA 1RVGA 5IT0A 1YNPA 1W4AA 3A2LA 3AEYA 2X5JO 4HFRA 1J0EA 2X0IA 3T3IA 1N0VC 3OCXA 4DIDA 2QF8A 5HTKA 3ZQ6A 4M19A 1GFSA 4I7WA 4LUCA 1GG0A 3N6JA 4D0LB 3BWVA 3T7JA 3MI6A 1RWOA 1PQWA 4IWNA 5GVJA 3UV6A 5ALJA 2WK2A 1Z3NA 1QGYA 3NNTA 1V3VA 5JMWA 4RE5A 2PUDA 1ML1A 4S38A 1OQFA 3QSGA 3OVMA 4V2UA 2DSKA 2G3IA 2B9EA 1CLXA 4ZD6A 5K9ZA 4CQNA 2M1ZA 1SO6A 1C41A 1V41E 2IXUA 1GNXA 4AS2A 4KESA 1HFKA 1QVBA 3ZJVA 2NSHA 4B2PA 3NFUA 2GPJA 3BMOA 4RV9A 5FL3A 2P6MA 3KRTA 1WAWA 2GS9A 4HYQA 1HVQA 3KHJA 4ONEA 1W5EA 3QPCA 5EEHA 3E18A 3RLIA 4ZEXA 4O4IA 4Y2SA 3ZDAA 2VPTA 1DZ3A 1BCSA 5G1OA 1H1LA 3FIGA 5JCJD 1GTEA 1P31A 1D2KA 2LLEA 4BO7A 3H2KA 3UWQA 3DM9B 4WX2B 5JCOA 3LHTA 2O5EA 2B25A 1DQWA 3B0PA 3EG9A 1LBIA 1XCXA 5D2WA 2YN0A 4G0NA 1Z0KA 3QVLA 2D0PB 3WQGA 4Z86A 3IVCA 4AFYA 5F7XA 4XARA 1AS3A 3NR0A 3PRKE 4J3VA 1OC6A 2G37A 1JR2A 3T5BA 3ZLHA 4KQKA 4LVCA 4EUHA 4D6YA 1VYVA 3JPYA 1Z16A 5AW3A 2H5JA 1X8JA 3UW6A 3SQLA 2PD3A 3CLMA 2ATCA 4ZBCA 3VH1A 5B3LA 2O50A 3B8SA 4R1SA 4M49A 1JX6A 3KZNA 5B1HA 2HZ7A 1D09A 3CQJA 2XQJA 1VL8A 3QNUA 4NJJA 4Y9SA 4DMHA 2MOKA 3NWEA 4FDMA 1Z7WA 1TZ9A 2Q3RA 1E96A 1DKPA 2ZZMA 3UGRA 3MWFA 5D04C 2G4CA 1IM2A 5IM5A 3LMYA 3HGJA 3W7PA 3AVTA 3T9PA 4F04A 1CY7A 4ERXA 3BTNA 2HK1A 5HWNA 2OO7A 4HTBA 3H99A 1OY0A 1AKYA 3EXSA 1A9OA 4EA7A 1JQXA 5F2KA 2WVJA 3HFSA 2IHTA 3G6WA 2UZ4A 3MJTA 4KXUA 2NQLA 1Q20A 4JX8A 1E99A 4BI5A 4C7FA 1KBQA 4BE9A 4F8YA 4M99A 4F4JA 4RXMA 2C98A 3N1AA 1YQQA 4DKXA 3SOZA 3QMSA 3V7NA 2IPLA 4JU9A 2H2WA 3QE3A 3HB9A 1COWA 3DCJA 3T2PA 4I0WB 4JQ2A 3P9QA 2QVZX 4PXSA 3WYDA 3AC0A 5AH0A 1SEPA 1NKSA 1EHCA 2D4AA 4FLRA 3GUYA 1PCKA 3CJRA 2PG3A 1FDZA 4X1KB 3B9DA 4KCUA 1E4EA 3AEKB 1G2PA 4Y9UA 5LSAA 1IQ0A 1S4MA 4WASA 4XKJA 4FFMA 1QRAA 1KFKB 3P5YA 3UCFA 3SDOA 3LTEA 1VLQA 3HDVA 1VYSX 1OROA 1WM1A 4PB3A 4NCIA 1FRNA 4H00A 2WM9B 3BPWA 4LK3A 3FNEA 4UOQA 3BXEA 3NUGA 4QASA 1QX3A 4LB3A 3R41A 3WH9A 2WBLC 3E7WA 3TA9A 3CNHA 3A13A 2PDXA 3LZDA 3SBDA 5I3FA 3K71B 4XCQA 5H8WA 4YJ3F 1TJ3A 4DLXA 1J7JA 5A2CA 3ITCA 5J40A 1IXZA 2LTAA 3OZRA 2DQWA 2V3DA 1PJQA 1BVUA 5BMVB 3OHIA 2QUAA 4JSRA 3P9IA 1KRMA 3E5BA 1T9DA 4PFHA 5DCYA 1XD8A 4E31A 1O89A 3MO7A 5E4YA 1KMHB 3NWJA 1MJGM 1X9IA 1SIWA 3PHCA 1QORA 4JELA 4H9YA 2W2LD 4MS1A 3TMKA 1YMYA 2ZX9A 3KVJA 3MUNA 2XM2A 2GUGA 4AUNA 2DT1A 3GH1A 5C46F 1PJCA 3PFNA 5D9MA 5JYEA 2J8TA 5DMXA 2RAUA 1MIOB 2ZJ1A 4O59O 5BSGA 1TYBE 5B55A 4OIMA 1E2BA 2JLSA 5AUQA 2H1CA 4C4OA 3GD7A 1P5ZB 1P0PA 2XMPA 1C7TA 1EDGA 3R0UA 3ENZA 5HF8A 4RF2A 3A1SA 2FPIB 4QWWA 3M81A 2CU0A 3LCLA 2EFDB 5KOJA 1VMEA 4BFSA 3IUDA 2EOAA 3UPBA 1RR2A 1W4BA 1LFDB 1K7EA 1Z4IA 2OELA 3I61A 3VMNA 3HJBA 4L8LA 5H59A 4X20A 2BFCB 4H4DA 4Q4MA 2D1SA 3U9LA 4JI4B 1KEEA 5KX5A 3HL0A 4FQ8A 1UP0A 1HJWA 1TM7E 3KHDA 3Q94A 4QO7A 3OKPA 3E12A 5BWOA 2EGHA 5CPMA 2BG5A 4MJ3A 3RUAA 3U2CA 4W9NC 4OVKA 4X1YB 4EA9A 3ACCA 1YXCA 2AQOA 1KBKA 1IK4A 1A82A 2C4MA 3R5JA 4ZVNA 4UIOA 2XLCA 2BBOA 4YAGA 2DJIA 1OFEA 3DWEX 2FLIA 2CLIB 3OWXA 4Q3MA 1M0EA 4WESA 1E1KA 4UARA 4QQRA 2VC5A 1YT5A 3IILA 2WUGA 4EPBC 3UG8A 1NWSA 5TQ0A 1DAGA 4V2XA 3VH4A 3WLLA 1WBJA 3AHCA 3DDUA 3MRSA 3HPSA 4MI6A 2IKSA 2MYNA 4Q3KA 1L5FA 5CEWA 1LLUA 4XDGA 2X1VA 1ML3A 3A25A 2RI0A 3CAVA 4A6PA 2QMHA 5I7SA 2FUNB 1TWIA 1EMDA 1UKCA 2NPFA 3W28A 1KZYC 2OJPA 1F4PA 2EP7A 1F4AA 4RD4A 3DTYA 3GD6A 1TW3A 3ZJ6A 5E1BA 3G1UA 4U2CA 4CNUA 3O92A 1GYNA 1YFJA 3O7WA 1GYQA 2EKZA 3UWEA 1EJ0A 2GCPA 4G56A 3VR4A 3TE6A 3T8QA 5EJAA 2BVNA 3LMZA 3RT7A 3RVQA 4XXHA 3ADKA 1LPBB 3GIDA 3B1VA 3G8DA 1QC5B 5IAGA 3LRKA 4X90A 4CF4A 4TYYA 1TPDA 1PK8A 3AJDA 4C1NA 3A31A 2JALA 2NSDA 1YI8A 5TARA 4YI3A 4UFIA 1OC5A 1L7PA 4MV9A 4TWRA 4Q3DA 4PYNA 3DTVD 2PIDA 1VFNA 2ZBQA 1YBVA 3SKYA 3VSEA 1DDGA 2J5XA 3OQNA 1FUYB 5I7FA 3ASYA 3EIEA 3H6OA 3T07A 4BQ2A 1L8XA 5DT9A 2C3MA 1PD0A 1B54A 3R74A 1FTNA 4WKOA 5CX4A 2R8BA 2ZB8A 2NVBA 4KFSA 1FEZA 2AL2B 4OATA 3ZY3A 1L5OA 4RJTA 3WRYA 1F2TB 4M38A 2OFPA 1XXHE 2R44A 4JAVC 3NOQA 4FNUA 3WF2A 1YNOA 5G5IA 5F3DA 3TW0A 2W6OA 4KS0A 4E30A 4L1WA 2DULA 3ETLA 3Q0IA 4H2DA 5ECGC 1RMYA 4WDRA 4OCZA 5JJLA 4OAOA 3VJRA 4U6NA 4CIXA 3BQ5A 4MXDA 4Q3CA 2AEFA 3KQTA 3VKUA 4GC5A 5FPKA 1BYDA 2PZKA 3W04A 1VCOA 2VG8A 3ARTA 2IYZA 2DSZA 4LRSB 4BO8A 2DDXA 2IKJA 5FJJA 2YWGA 4TT3D 4CLOA 1IZKA 1K08A 1ZITA 5FSDC 2AF3C 3K9BA 3O06A 4XR4A 2ZRGA 3ZWOA 1JTVA 3TIMA 3VGPA 2BEVA 1H1ZA 1C80A 3EVEA 2WT4A 4RL6A 1KW1A 2Z3ZA 2VT3A 4BJ3A 4G85A 1C29A 5ECWA 1JKJB 4ID9A 2Q0QA 4DG5A 5IDZA 4EY8A 1ZXXA 3LUTA 1ODUA 4D0NA 1E8MA 2I6QA 3B0UX 3WZ2A 1U81A 3DE2X 4NG5A 1VPDA 1QHHA 2PA3A 4XQEA 4JVLA 4KZKA 4GWEA 3KVMA 2OHHA 1LW7A 5TQLA 4L16A 1X2BA 3NO3A 4PONA 2ZAOA 4YTTA 1EBFA 4KEUA 4JL1A 2XSZD 3SQXA 2PZFA 3NAMA 3OEHD 3GLIB 4GZEA 3GVGA 5FF0A 2TRSB 3ETCA 5ER9A 1MW1A 2WTBA 5D3QA 2VQ3A 2HJPA 3KBOA 3LP6A 3TECE 4LZNA 2ZQ0A 5HJ2A 1E1CA 5BY2A 1JZ6A 4UFLA 3C4VA 4U2KA 3SSZA 3I6MA 1RHRA 1KYZA 4FMPA 3VFDA 3BSMA 1E2MA 4M29A 3TDFA 3WHLA 4M0KA 3ZE2B 2QIPA 2AI1A 1EB9A 4M9ZA 3OI7A 1ULTA 1PPIA 2C94A 1GV1A 5LNK6 4HI0E 3SY5A 4EB6B 3KQVA 5A0VA 3QE2A 1WCGA 1EM8B 1FCQA 1HYEA 2BIFA 3OLZA 3WGVA 1DKOA 1VPWA 4ZCPA 2PM8A 2XYHA 5C8XA 3CTMA 2NU9B 1KK0A 3CUYA 3GZNA 3L4ZA 1LVGA 4G7FA 2V8BA 2Q5HA 1BGVA 1R4NB 5HF5A 1RYMA 2ZZ4A 1G3QA 4U3AA 2ZKLA 2KLBA 4QTTB 1XH1A 2VCYA 4UXIA 2N1BA 5DTRA 2EX0A 5GZ6A 4ZAXA 4NEGA 3TI9A 3S5ZA 4TVBA 1VEMA 1FFHA 3MTBA 3MKVA 4A35A 1SZDA 4OBRA 3H5TA 4R8LA 2OQHA 3NC4A 5EQFA 2WNWA 4URXR 4HYTA 1KYXA 1X1SA 3E7FA 1X0XA 1ZVKA 4UBKA 3PKIA 4YRTA 3HC7A 5FWXA 1SQ6A 3PE4A 5DMNA 3WBWA 2BONA 3V80A 4X92A 1X74A 3G89A 1UBPC 2PT7A 3M6UA 1ADJA 1UR5A 2BFMA 3KUKA 2FGBA 1RVKA 5GM2A 4D9HA 3BGDA 4RNIA 4B3KA 5CPLA 1HTWA 1UKTA 2PA6A 2YVKA 3RJYA 3BIXA 3TO5A 1V08A 4RS3A 1HIZA 3C8MA 1D4ZA 2Z1VA 4GQ0A 3HWWA 1UKEA 2WFZA 1R9GA 1LLWA 2I5GA 2OLHA 3LJKA 2O7SA 4EYSA 3I9V6 1M75A 3VR5D 3G3DA 3W26A 3JWJA 3E8MA 1EXMA 1TZMA 3DHYA 4H01A 1TA3A 2A2ZA 2DT8A 3D8SA 4NFHA 4F06A 4AEEA 4E1VA 2O8VA 2X2OA 4EENA 2GLTA 2OUKA 5M3WA 5IFLA 1FFAA 3RV3A 2NT1A 2WUDA 3D3AA 3TUUA 2Q4EA 1NFFA 2RCYA 4HS9A 1QHXA 4ARCA 4CEXC 3RX4A 1KBOA 2C00A 1J4EA 2O2ZA 2WWWA 4DKJA 1C9EA 3UWOA 3CW9A 2H0RA 1XD2B 3MRXA 4ZVJA 2CHUA 3PZNA 5LU8A 1IJKA 5KZMB 1SWVA 1X7YB 2A4KA 3NZ1A 4AKIA 4KQFA 3CZRA 4BNDA 4CHGA 1DXFA 1IPFA 1CEOA 1X14A 2H7YA 2FEMA 1IXNA 2RDXA 4B3LA 3A04A 4P3XA 4K8GA 1KZ6A 1IK6A 3Q10A 5EWMA 1OFQA 5IM51 5EJ5A 3WY1A 1JP7A 4OHFA 5LWHA 3AUYA 4DF3A 1MLDA 1O5TA 1R9MA 5D01A 1GPWB 1ILWA 5K8VA 4IH3A 2WDZA 1RPAA 4QQ8A 4MYCA 4PYRA 1RCTE 3JQ9C 3SIRA 3JS3A 1F76A 5GAJA 1HK7A 3PA8A 3OG9A 1JW9B 2VDOB 4ZREA 2BY4A 4A73A 4FYHA 3WQRA 4XWTA 1NF3A 1VA4A 2BWJA 1BEEA 2C4NA 4B44A 3WEOA 5BR1A 5IC5A 2P2CA 3DO6A 2MR6A 2C78A 4CMKA 2OGJA 3GQVA 4DJ5X 1FX0A 1NP7A 3BX1A 5MN5A 4A8RA 4NCNA 2DJLA 5EUCA 3W6OA 4RETA 2UVPB 4CWAA 5M04A 3O8QA 2JHFA 2HMAA 4EHLA 3BTVA 1DU4A 3D4PA 4AZ6A 2J59A 4IJVA 3FDGA 4EP1A 4N7BA 3BRQA 1UUQA 2W66A 1ZNWA 2ZI4A 2GK1A 1NI4A 2NADA 2VTBA 4F11A 4IDAA 2R1UA 1S3FA 1WXDA 1T1EA 4AJEA 3OQMA 1K8YA 5CXQA 4D79A 3X44A 3GFRA 1YAHA 4ZFMA 1SRQA 4EHIA 3MI2A 1EHNA 3PR3A 3M0HA 2XDQB 1TLLA 3PXCX 5JRJA 3KQKA 2A7PA 3N29A 1IY0A 3DE0X 4BFZA 3OE4A 7GPBA 1T0UA 1Z56C 4ZVQA 5ALYA 4LYGA 1AUPA 1E6PA 2HU8A 5BN4A 3MRVA 1EJVC 2ZWYA 2VEPA 2FJ0A 3C2OA 1Q14A 3NURA 4QLKA 1JMKC 2GASA 3WLAA 5KTOA 4F91B 2WD9A 3CK5A 3TTTA 1SMAA 4RY8A 4ZZ2A 2WWFA 3JCZA 3UBMA 4RMGA 2DHQA 2RKOA 3E0VA 2CBGA 1NAIA 3G8CA 2XOXA 2ZOSA 1E6WA 3KUDA 4Y9MA 1GU7A 3I5UA 2R87A 3W7JA 2PUFA 4O4JA 4GOAA 1RHQA 1NJ1A 4Y6LA 1SCJA 3GHUA 1V6TA 1C7RA 1H1LB 4GRDA 4YAKA 5ICGA 3U39A 2WFLB 4MR7A 3ZCSA 4R2HA 1KM3A 2ASEA 4MLDA 1RLOA 4F40A 3H5NA 4HVLA 2J1LA 3STVA 4PE5B 1W54A 1PTAA 1RA5A 2G1JA 2AHOA 4CQMB 5CC7A 5BROA 4BHTA 2VCBA 2ZWPA 4LECA 3IAM6 5AM3A 4GIBA 4WLVA 4LZOA 3UJ7A 1E9RA 1SUFA 3TAUA 4F60A 5CBJA 5AW2A 3WYAA 2OCBA 2GO1A 2F1RA 2VT7A 4ZDWA 1REQB 1ENYA 4IGAA 2GZRA 3DVQX 3A36A 2D2IA 5EGRA 1UMBA 4G0XA 4PX3A 4ZAGA 3TRJA 3P2EA 5DH9A 1A95A 1TUFA 2Y88A 1Z7BA 2J32A 4JXZA 1XRNA 1FY6A 1JYSA 2RC6A 3S8MA 3CV1A 3GUCA 1GQNA 4JXKA 4NBLA 5ETJA 3HF3A 3L65A 4C1KA 2EP8A 2CBUA 1NBEA 1EQUA 1LK7A 5DOZA 3ZE9A 3T99A 1RFLA 4NEQA 3EDJA 2G5GX 4C5BA 5LM3A 3LXMA 2Q0HA 4HA1A 1MHPA 2ZVIA 4YS6A 2GYYA 5JNUA 2QGFA 5FQNA 2W4XA 4ZPJA 4GM0A 3JQEA 2C2WA 2DBRA 2ZROA 2V6IA 1WUJS 5LNWA 3FNQA 3ZDRA 5DI9A 1XZAA 1YTEA 3ZWKA 4B79A 5IFKA 1JWLA 2FHFA 3TSCA 1W17A 2X8AA 4MQMA 4TMFA 1FFWA 2WKGA 3QVGA 1OLUB 1EEHA 1J0KA 3MY9A 3X1JA 5DW3A 2GSWA 2Z26A 4R5HA 3VMMA 1QHEA 2PD5A 1G6KA 4KH1A 4Q4SA 3JATA 5AI5A 4ASUD 3U4AA 5G1YA 3C15C 4MS4A 1WVGA 1N2JA 3CU2A 3BA1A 3MJDA 1OOEA 4AURA 4XO7A 3PPYA 3KFXA 3B85A 4KVZA 2G04A 4HQOA 2WABA 3L0SA 2WWVD 3E48A 3GR8A 4MAVA 3R4IA 1DL5A 3S1VA 2ZU6A 4URHA 4MR9B 1O03A 1VFLA 2Z98A 2IDZA 2JA2A 2B37A 1ISJA 2VH1A 4DEYA 1GKUB 2HQSA 3JD1A 3KUMA 1FVFA 4IJMA 3WRWA 4IDPA 2I67A 3SZ3A 1Q15A 4ZQFA 4OKNA 3E5MA 2C18A 3KJZA 4ISCA 3KOZA 1P0BA 2C04A 1IEQA 3UMCA 1CDEA 2GEJA 4CMCA 3DENA 2IDMA 2HSGA 3EVFA 1YKSA 4UUMA 13PKA 4EI9A 3S0CA 3COJA 3BMNA 1YIXA 2WM1A 4MICA 2QGNA 1XM3A 3CH0A 4YYZA 2VEDA 4JIGA 3OOHA 3DFIA 4MVWA 3EZ6A 2ZJ7A 3FW6A 3ZEAA 4QOHA 1BCRB 2VVSA 2X9GA 3F1QA 3STCA 4EHJA 2VUIB 4BQ3A 2EJVA 3P8ZA 2XMZA 3H11A 1GTG1 3Q8WA 1HVXA 4RPGA 3W77A 3PGMA 1XZEA 2YY5A 4J75A 3QBUA 4ZO9A 2FLWA 3HXLA 3AM3A 4KR7A 3O3RA 1SIUA 1ISYA 3OKAA 3R4CA 4C08A 1O94A 3AUJA 1I1QB 4OUDA 1VJTA 3VZBA 4WJZA 4S23A 2JKZA 4QULA 1L3CA 3MVEA 2AT1A 3U3XA 3R2GA 1GQSA 3T34A 3E3NA 1ZOLA 3UR5A 2JGRA 3CRQA 1TCBA 3OT5A 1EFPA 5JJCA 3OA3A 3LKDA 4XGKA 2WJ3A 3E15A 4F7DA 1NYLA 2VZSA 4RQAA 2GCEA 2ZATA 1N92A 4BNJA 2VR5A 4INZA 4TS4A 5D7NA 3WMGA 3IAM1 1GPNA 3RF7A 1NAHA 1VI6A 3ZJUA 3Q4DA 1EKXA 1ONXA 1E6NA 3R6LA 3K2GA 5JFTA 4RHEA 3Q88A 4ZCQA 3IB6A 3NO4A 1WZCA 1JAZA 2FZGA 4R83A 4G5HA 1WRBA 5KOJB 1RI2A 3DOPA 1UMDB 4BFXA 1LWNA 4ND8B 4MV0A 3PBWA 1ZXLA 4C0LA 7ABPA 1K9FA 3CB8A 2G8LA 4D9CA 4MMXB 3C4UA 1B1CA 3KSDO 1F8GA 6TAAA 4DM1A 1KK3A 4I4IA 5FD8A 2RJ3A 4NAUA 4V39A 3COZA 4BVKA 1ZCOA 2Q1WA 1I36A 1EFVB 3OPMA 4BU1A 1P4JA 3BICA 5IC6A 4KPFC 4FFLA 3N2KA 4FHEA 1SBTA 3OCWA 1CT9A 4OKIA 4MDOA 4H3VA 4B3RB 3SRFA 3CASA 4JQSA 3ZIAD 1HOXA 1YO6A 1PQPA 4JOQA 5DSTA 1WNTA 2RGGA 2PRLA 3HCOA 2H6RA 4C1LA 1TZZA 3QEJA 4UJ3A 5DOVA 1N3IA 2VGBA 3DH7A 1CTQA 3OMWA 1HT0A 4HATA 1N2VA 1WD5A 1XUUA 2J4CA 5DT7A 4CMJA 1UKOA 4B5WA 3NHJA 4MV6A 5G1NA 2PKRA 2QQEA 3ZDEA 2GK3A 3ZK9A 4HLNA 3QOKA 4DMCA 4DV3B 1R0YA 1NBAA 5DNAA 4BEVA 1R0CA 3B3QA 3OZOA 4OQDA 5FBWB 3S46A 1I2ZA 3L0NA 2X5NA 3ZUPA 5LNVA 1XFDA 3BRWA 4AU0A 5CPQA 3RLVA 3H2OA 4EOGA 2ZI9A 4UVDA 5DBUA 3VTKA 5T8KA 4Z1MA 1KVUA 3M5ZA 2ZSKA 3IOEA 4DZTA 4W85A 5JFGA 4C89A 1F8IA 3ROGA 3DUFB 4LX4A 5A05A 3NL3A 2BJHA 4AD2A 2O1WA 3T0GA 1RCUA 4DVJA 2Y0FA 2DJ5A 3KB2A 2W6QA 2BS9A 3K6SB 3LRPA 3MCZA 5H5JA 4FCVA 1H41A 1I2DA 2Y1LA 2IXVA 3G23A 5JFOA 1D2AA 4AMVA 1PN3A 4KSYA 2QG6A 2INEA 2VTKA 4HJFA 2PDPA 4N6GA 3W05A 3G1FA 3AVOA 4W5RA 2GOKA 4R9VA 1PFYA 2YHIA 4HGYA 4TUYF 1OG0A 3TN6A 1FVOA 1MZRA 5J2UB 3NAZA 5IFTA 1L5QA 4YJFB 2HPMA 3P61A 2GFQA 2ZJ0A 4ZI7B 4JA2A 5LP6F 2KX9A 2CMGA 1BAGA 4FLQA 1GG1A 3L6BA 4F3YA 1VB9A 3PNZA 4JVNA 4K9KA 1L4NA 2A5HA 1LSUA 1EQAA 5LD2C 3UCXA 4CYMA 2OVLA 2IE8A 4C0AC 1ID8A 2PS0A 1BKHA 4NYMQ 1ECPA 1RQRA 4I66A 1SJAA 3CUFA 3ONEA 3H12A 1WE5A 1RU3A 3Q3JB 4LKOA 1GKPA 1RI5A 2A14A 2IXEA 2H2FA 5JSZB 5JIPA 1XQKA 2Y61A 2QG4A 1JUEA 1PNRA 1WXZA 2X1HA 3V1NA 4PX2A 1TTPB 4X7MA 1UANA 1K70A 2HF7A 1BTOA 3TZQA 3PUJA 1RYFA 2VYOA 3RVLA 3AU6A 3V8VA 1L1RA 3OPQA 1Y89A 4DANA 1VQ1A 3KVNA 1KXTA 2GVNA 3QFEA 3K9HA 2XZOA 2V4UA 4HB4A 4KQ6A 2AE1A 3RLUA 3DG3A 2XSAA 4LYYA 1QASA 4G1MB 3KTAA 3BWBA 5M7EA 4NZNA 4NJMA 4QL3A 2ERXA 2TYSA 1JSRA 4GKKB 4OV9A 1ZW6A 1ZZGA 3WGGA 3HIJA 3HLKA 1ADCA 1U2DA 3I9KA 5G0SA 5KNBH 2RJOA 3M3DA 4QELA 4YXGA 4Y2PA 1UKAA 3L67A 3DOHA 2ZR7A 3MWLA 4GR9A 1EBUA 3F6PA 3PCTA 1PCWA 2YZMA 1E1CB 2H2IA 2Z2YA 2G9QA 2JIDA 4UTFA 3GWGA 1SOUA 2IGTA 1OD0A 4WCDA 5TLSA 1D2RA 2CJWB 3IUBA 1P4HA 2GA9A 2I8CA 4PLYA 2QPAA 2PF8A 1GOQA 3PAJA 1SQSA 4O8CA 2EL9A 1J8QA 2V9ZA 4LA4A 4HKTA 3BREA 3JZDA 3AERA 2D2EA 3W9BA 4KCWA 4A2PA 2R1VB 3WF4A 2IU3A 2Z8YA 4RQBA 3ZG6A 2OCYC 3UAYA 3CV3A 3QRWA 5FEZA 5ILGA 1Z4MA 5I7GA 1VFFA 2AK3A 2J9XA 3OZVA 3IEMA 2CLKA 3IOYA 4M0EA 3UMGA 1AVAA 2I99A 1C90A 1E51A 4GHWA 3QTBA 3U5TA 1J1IA 4F56A 1APBA 3PRHA 5CW1A 3U7GA 5LZ5A 3AV3A 1XEXB 3I5MA 4WZAB 2ZAIA 2BMJA 1RRVA 4QATA 4R2WA 2VTFA 4G2DA 1ODFA 1L2QA 3ED5A 4FWBA 1XMOB 4ERGA 4O5AA 2ZS9A 4EGJA 1Y6ZA 3PTQA 4IY1A 4V0QA 3RGGA 3H1FA 5JOQA 1KYTA 2OSYA 3TOCA 2ZSAA 5HVNA 2I1OA 5FWXB 1DBQA 2IYAA 3X1DA 3QA3E 3A22A 1XIJA 3NUZA 1ISFA 3EARA 4X3ZA 1J2BA 3H8AA 1U98A 4DA6A 4QOIA 1CY2A 4X1IA 1IN7A 2FXVA 4RJJA 1PFVA 3I62A 1Y4AE 4EACA 4Z7QB 2CLCX 4RKEA 2WSLA 4QP0A 3W5IA 4A7PA 2FQWA 3IANA 3G18A 3S6DA 2X4LA 5H1WA 2W0SA 4IFEA 3ESCA 4YXWD 2XNKA 2OGZA 3LM3A 1ECGA 5KQPA 3ITOA 1HT3A 2F3SA 4EL5A 2J8ZA 4XH9B 3UOAB 1AM4D 1Q77A 1V0JA 1YPFA 1RIFA 3UGVA 3ZWTA 3HSKA 1QM5A 3W86A 2DCMA 4Y8FA 3TOZA 1X8XA 1SB9A 2WHQA 2ZREA 1E69A 3VX0A 2PDIA 1OX6A 3VYSB 3THWB 3KOUA 3FSGD 2R96A 1FP4B 3M47A 1W1PA 2IPJA 4ND2A 3U0BA 3QR3A 2Y7DA 4YN5A 3ZWSA 3L2OB 5JSQA 1XLCA 4MYAA 1SB8A 3U3HA 4X6XA 5KCMA 1XJCA 1ORDA 2DP3A 3GGOA 3D0RA 2RONA 5LQMA 5GOTA 3MSCA 1FWFC 3MC1A 1XE3A 2GJNA 3VIKA 1UDXA 3ASVA 5CYPA 4AQDA 4TU1A 1WVMA 3TLKA 2H18A 1KNWA 1OEPA 2VRBA 5BSUA 3ZHYA 1INLA 2D2GA 3D6NB 3NQCA 1ZU8A 1WYIA 5EBAA 1J8DA 4X85A 1SM9A 2V55B 3KTFA 2V96A 3HQNA 3ES8A 1XJBA 5D9PA 1JCJA 1LWJA 1LRKA 1MH9A 5JE8A 3DBVO 1YDOA 3QW3A 3NZQA 4ZOEA 3M6DA 1DT3A 3AP1A 4DCVA 2FVYA 2BYTA 2WQ6A 4GQBA 4OXKA 1EZWA 3DF7A 1PJAA 4ZRMA 1KO0A 4WLCA 1QMPA 2ZANA 4AJ9A 5E1QA 1FYEA 3MCAA 4GYPA 5KETA 5K9CA 3DKKA 2ISWA 3EQ2A 2PDMA 1PR3A 5IAAA 1OF1A 1BU8A 5EP4A 3DZIA 1XQYA 4RS4A 4E0CA 4FUQA 1NHGA 3FFBA 3GUZA 4FD2A 2N46A 4IHQA 3YASA 3CV6A 1AL8A 1B4EA 2DGDA 1NAL1 5AQEA 1JL3A 3GFFA 3MAJA 3M8KA 5IBXC 4JIRA 1NT4A 1XLWA 2WG2A 2YYTA 4P8VA 4GU5A 1T2DA 3WQDA 3CLSC 3T2QA 4LAFA 1D3AA 5FBLB 4OK3A 4K9QA 5E6SB 2JBAB 1YULA 4CR8A 3T7VA 2P0IA 3BILA 3PD1A 4GRSA 4EPDC 1R9JA 4RVCA 1HFJA 1KM2A 2HISA 1QLJA 5EMNA 3GNSA 2XGGA 5FPQA 3QQ1A 3NXLA 2NPOA 3HCFA 1TC1A 3MOGA 1QWOA 3TQTA 1KTNA 4U7GA 4PMZA 5FIPA 2O4UX 4E5DA 4HBZA 2VDRB 3LPDA 1QYVA 2VPIA 4F6RB 4PNZA 5KC9A 1JECA 4YN3A 1E9VA 4JLMA 1H09A 3IAXA 2DH2A 2B21A 2X7HA 4MINA 3KHUA 3DLCA 3QYSA 4TKUB 2W58A 4FS8A 2I0FA 5BVGA 2Y1CA 1FFXA 5FA8A 4UBJA 2FMNA 2X4DA 3DA8A 5K0ZA 4GX5A 1ZLXA 4YWSA 2WC1A 4G09A 4WGGA 1X1NA 2Q5QA 3C3BA 1HYGA 4GINA 4H19A 3SSMA 5L45A 2IIVA 1SQ7A 2FFBA 2VCCA 3QX8A 3DZDA 3WKCA 2ZIZA 2OCDA 3L1VA 5CSYA 1W85A 1FWNA 3CF6R 2WWTA 4V1CI 3AG6A 1SOAA 1W3KA 4A6XA 2YJTD 3IULA 5IEJA 3LO8A 3FF4A 1QH8A 2A0WA 1GSOA 4U3CA 2EWMA 5FIUA 2WYVA 2DEUA 4QDOA 3RE1A 2BGRA 1XLKA 3B3FA 3O8RA 2A6LA 1QQ7A 1FCBA 1ZBQA 4F86A 1XCFA 2A0FA 1U1UA 3C24A 5G53C 2WWYA 3CKKA 3C1AA 1SURA 4MRAA 4OQMA 2J3IA 1GUYA 4UTUA 1LBQA 4Y8EA 3GG0A 2GOYA 1JLMA 4QUJA 4AAJA 1KM5A 4HU8A 3HLYA 1WUHS 4C03A 1PLKA 3GOHA 4IJRA 2O4CA 4RD1A 1C3VA 1VI5A 2Z24A 1YBQB 3N6HA 2JA1A 3BH6A 3TRDA 3AIKA 1YD7A 3V0SA 4O1AA 1MX3A 3MQFA 3CTTA 2QHXA 2TMYA 5T4HA 3G8YA 2X15A 4KKVA 3S2NA 3OT1A 3IL2A 2WSSA 1GTL1 3QWIA 1KLYA 1NQAO 4FXFA 1FQ0A 3HKCB 3CZLA 4W8LA 4Z3OA 1O5IA 4Y6PA 1XTRA 1PL6A 3TKLA 5LQAA 5HNRA 4CIDA 2IZ0A 3GY0A 3GT3A 1U5JA 1TTQA 2FWIA 2GARA 3IRDA 2VQ6A 2IOHA 4MS4B 3ZDXB 1E89A 3IAHA 1J1UA 2A79A 3WTBA 1KH1A 2Z29A 3EQ8A 2HSEA 5AI4A 4FKMA 5LOVB 4X65B 2WIJA 3UT5B 3OP1A 1KCXA 1ZY9A 3O8AA 4UUOA 3WBBA 4B83A 1TMKA 4LK2A 2ATEA 2J9ZB 4JI7B 1QDEA 8OHMA 3DHVA 4PYLA 1EG7A 2HXTA 5KO2A 1R86A 2H5IA 3LLFA 1XLAA 5CB4A 2J3EA 3COYA 4CCCA 5DB4A 3GFVA 4RMNA 4HK5A 1W8IA 3W9SA 1ENOA 1UK9A 1WZUA 2V6GA 3EFHA 4MRMA 5SY6A 1H93A 4ZOBA 3MYPA 1HC7A 1GL6A 3BHNA 1CULC 4BFWA 1FX1A 3CUHA 2ACUA 3N13A 3V1UA 4OX9Y 2P6OA 3MMZA 2ZJ5A 4UQ9A 2PAJA 1R5BA 4LBVA 1Q6FA 3C1TA 1E6QM 2XIIA 4AIOA 3SYKA 2WAMA 1N32B 2E4UA 3IA7A 3EVCA 2FUKA 1VB5A 4W86A 1B3OA 5ALRA 3ZYCA 1T1SA 1C0KA 5EXSA 3GG8A 1G1MA 4CHTA 1NWCA 5DM4A 1Z26A 5TF0A 4ZYVA 3SGLA 2SFPA 1DJZA 3BC1A 3LV6A 5FUMA 5AUNB 1EKOA 4OUDB 3WJ2A 4BE4A 3GFTA 2PAAA 4OHMA 3BFPA 4ZFNA 1PEZA 1Z39A 2Q6VA 5HCIA 2O59A 1XYMA 2X1LA 1ABEA 2PGWA 2XF8A 2VJPA 3P0HA 1FYVA 2HPHA 2VWQA 5D87A 3WMEA 2V7QA 3H04A 4F3HA 1MO6A 2JLUA 2CHQA 2W8BA 4AS1A 2FWBA 1NMQA 2EHDA 4CM3A 5HPCA 5CDYA 4QJIA 2Z5FA 4MDFA 2FPKA 4L4RA 3SSJA 4P98A 1VGVA 4Y9TA 2Q2OA 3G0IA 2O5RA 1CB7A 3Q3IA 3F5JA 3COVA 3VD3A 3I6IA 1U0RA 4U9UA 2B6HA 5ESXA 5KJ1A 1US0A 4B6QA 3GJ4A 4BKOA 5C37A 2EYUA 4UMFA 1J8VA 2GNPA 2XTJA 2ZIEA 4RDCA 4Q3EA 2A3EA 4QFUA 3DBLA 1LPNA 4MMWA 5AB3A 1LV7A 2CVQA 3RC9A 3FOEC 2R62A 5IVIA 1ODLA 3M6VA 2XNDD 1JKFA 4FB7A 1MJNA 3M9YA 1DHRA 5AVXA 3OVQA 3VO0A 1PX3A 4PSDA 3NAVA 2OFFA 3S7ZA 3PBVA 2VAVA 3FPSA 3GTIA 4YRIA 5HWSA 1HE1C 3D0OA 1K6EA 3HG2A 1YTLA 4GZ5A 4B4KA 2J0UA 1NJSA 2C8JA 4YK7A 3ARVA 1USGA 5EZYA 3W06A 1VAHA 4LFAB 1SKMA 3HZ3A 1CS0B 2QP9X 3V0TA 4YI5A 1W5OA 1DX4A 4FXSA 3THYB 3VPDA 1SU5A 4TOQA 2VFEA 2ZWMA 1UBFA 4CE6A 1DSSG 5CGZA 1XCWA 2H8GA 2A9VA 2G7MC 3K2IA 1OX4B 1YDGA 2B36A 3OFNA 2W4MA 1Z32X 2Z4GA 3GLQA 1RDFA 1P7WA 2D3NA 4Z5XA 1M2KA 4AIUA 1G9XA 1V1RA 4OHBA 3QY6A 2PBOA 1RYDA 2B0CA 2VPPA 2P9ZA 3WLMA 4GPEA 4UD6A 3P0JA 5AI8A 3H4XA 1G41A 5CA1B 2HJ9A 2GJXA 3AFGA 1Y48E 1EEXB 1PGNA 4CF6A 8XIAA 2FW0A 4JICA 1CI1A 1LK5A 5DNVA 2AFVA 4U02A 3ZWDA 4M56A 4ENVA 4R1PA 4YPFA 1KOFA 1TJ5A 5DX1A 3MUIA 1ZGGA 4AVFA 3LYHA 1GGHA 1T5BA 2YUTA 2Q3FA 2AH5A 4TTJA 5FBVB 3K0EA 4E4UA 3C16C 3W1VA 1YKGA 2OENG 3I05A 4AZ3A 3WB1A 3ROKA 4ZVUA 4IZIA 3TN3A 2NVDA 5I5GA 4TV8A 1LG1A 4GL2A 1ME8A 5CT5A 5TSDA 4DR2B 2ZDGA 1Y8QB 3W01A 2YCJA 3OZEA 3I9MA 3B0XA 3HY6A 1NY6A 2VDJA 4DSNA 4IS2A 1CNVA 5IYZA 1GPLA 4LJ5A 1M7OA 1K0UA 1ONPA 1GQ2A 3C8UA 4BO0A 3ETJA 3MUFA 4KIUA 2JEYA 3U7FB 3L5KA 4XBJA 3DONA 3KKQA 3GH4A 1VCFA 2VJDA 3UNXA 1SU4A 4O1IA 2VZLA 3JSXA 3O5AA 3R7NA 2VP4A 2YTZA 4UEJA 4GKBA 3UXHA 2HHAA 2JHGA 1QUMA 2E25A 1XL1A 4A6GA 2J46A 3GBDA 1K8XA 1Y3BE 2R14A 3PEVA 3QX7A 4QT0A 3RKSA 1S2AA 3QXSA 1V6YA 5JHGB 2IFTA 1C5KA 4LUSB 2V3VA 2EFYA 2XCOA 4NL1A 4HNCA 3V46A 1QIDA 3KELA 3RIEA 3K0AB 5LVAA 3DDNA 1XGKA 3ULKA 5JXJA 5HWJA 4G1VA 4UMAA 4EHKA 2P35A 4BAUA 4ZOLB 3ZU3A 5ERGB 3EGDA 3L46A 4WACA 2Z83A 1UIRA 3HJAA 2NG1A 4NG3A 4GGBA 3VNIA 1A8HA 4LGCA 4Z53A 1X7XB 3K1AA 1HG0A 1JZSA 5GP1A 4D9FA 4L9YA 5FOXA 4HYRA 4FMCB 3QOMA 1R3UA 3HEAA 3CWHA 3G17A 2GK7A 2UXDB 4U0KA 3UC5A 4F6CA 1OYBA 3IPXA 4IDNA 4R8MA 4UNIA 2JIZA 3GLTA 1NW9B 2BF4A 2NXHA 4A6EA 3T5GA 4KPLA 2YHSA 5AK5A 1BH6A 5I7HA 1KBBA 4JFTA 1E60A 4WCFA 2AWOA 3QRHA 3B36A 1O3YA 4NBNA 3DT8A 1XF9A 5ALWA 3EKZA 3UMJA 4MYTA 4OB8A 4UTWC 3SDBA 1ZLPA 3THRA 4MEJA 3CUZA 3BVJA 1WF3A 2BGGA 4YAIA 1N5OX 1YFZA 5JD5A 3TLGA 2O2DA 3U6WA 1TQHA 2BI7A 5HRUA 4ZK2A 2GDVA 4MRPA 4M86A 3NYZA 2R1TB 2ZTVA 1K86A 4HDRB 2CZVA 3SJCA 3B4YA 1JG3A 3Q45A 2WIGA 2F59A 4RIFA 2FPSA 1JI3A 4P7NA 4EYKA 2CUNA 1S38A 1MO5A 5EFZA 4MQBA 4YVPA 1A8QA 1NI3A 4QM6A 4D80A 4KW2A 2JGDB 4BNGA 1ZN8A 2J6CA 4PQYA 4BAZA 5D8DA 1HEYA 3UZZA 1EYEA 2HNAA 3UPUA 3O90A 4OB7A 3LF2A 1WO2A 4HLQB 2AG8A 3SCQA 1EVQA 1CFJA 4J9VA 3F4VA 4KPUA 3R75A 3BJIC 5IF9A 2HVNA 1E9ZB 2ZC8A 3B3GA 6Q21A 2E6AA 1A7AA 2XR1A 5DF0A 1P2VA 3FSJX 2ZUDA 1U2ZA 3KSRA 3MUY1 1Z0AA 4LC9A 4OFXA 3MTQA 1QPBA 1STOA 3LTSA 3UPMA 3IWPA 3NV9A 2YN2A 4CU8A 3WKDA 2E5LB 2GN2A 3EMQA 3EDDA 3TTUA 1UBLS 3P5BA 1ZD3A 3LNMA 5C8YA 5IH3A 3KRSA 4UTMA 1CNMA 4LJAA 4QTXA 3LCCA 5CSUA 2NQJA 3HB7A 3CS2A 2PGJA 4ZHQA 3VXGA 3S9YA 2BEUB 2C59A 1H0HA 1NZDA 3ZDYB 4P5UA 3LX5A 2VRCD 4MIYA 1V45E 4GDMA 3H55A 3VOIA 4AD4A 3C0LA 5H2ZA 3ARZA 1KWGA 1FRVA 1W2WB 1U5AA 5LYJF 6YASA 2BEKA 2G7ZA 2Z57A 4KXVA 3WDSA 1NXSA 3IV7A 3FYSA 3EN0A 1OT1A 1YIDA 2Q02A 2IHYA 1CFZA 3QF0A 1OCBA 4TQGA 3STUA 4AKGA 2QLJA 1BJTA 4PG7A 3PSHA 3L1HA 2C83A 3HA2A 3QX3A 2ZUUA 2VZ0A 4B92A 5CVUA 2OU4A 3R7BA 1VXRA 3KQWA 3D5EA 4B4OA 4DJTA 5CLGA 1KQZA 2RFGA 1QGOA 1J5PA 4BYMA 1IY9A 1YJBA 1MO0A 3T3HA 3BLEA 4FIDA 4N0EA 3MPUA 4J7AA 4M6VA 3ZCVA 2YW2A 3K1ZA 1H7WA 2CF6A 1BH2A 3ELBA 4H35A 2OLAA 4GGOA 4DF2A 2FZNA 3ZTYA 1UA7A 3L8GA 4IPIA 1T25A 4ERAA 1RQNA 4WK9A 2FTWA 3VKKA 2G0TA 1OGIA 2BHLA 3H9UA 1X13A 1PHPA 5I9MA 4DLWA 1EJXC 2O9PA 1K3FA 1UQZA 1ABFA 1WUKS 3CEUA 5BN3A 1FP8A 4BCEA 4CD4A 5EPUA 3TKAA 1ISXA 3HCPA 4F93B 4J1TA 4DSAA 3OBEA 1EWEA 3EVBA 4I55A 2X13A 5BR4A 2OQLA 3FY4A 3M6XA 4MV8A 3AP3A 4Q3NA 3RQIA 3ESQA 2XMQA 5H91A 4QXQA 4IF6A 1KM1A 2OP0A 5CBIA 4W5HA 2Q99A 2Q0XA 2VUTA 3O7MA 2EZTA 5GPBA 4H3DA 3EIFA 1GL9B 4GUDA 1BQ3A 2YFYA 2ZTHA 2QN6A 3O93A 3CA8A 3O4IA 4DRXA 4O8AA 4MMZB 3FF1A 1Q1AA 4D0GA 2YJ6A 1GPBA 3M0JA 4HHLA 4NECA 1ZFNA 1RWQA 3SD7A 1CF4A 4D9IA 5T6MA 2DYKA 2QX9A 4B31A 2QVNA 4PCTA 1W47A 5HZMA 1FTGA 3E5RA 2J41A 1YMUA 3B51X 5C71A 4ZO6A 1RE1A 1ZSXA 2A84A 3VSCA 3BD7A 3M07A 1DQUA 2PLRA 1K9SA 5CNIA 1IHYA 1O97C 3IBSA 3DZBA 5HIIA 2GT1A 1Z0DA 4IHJB 3RHGA 3ZFHA 1VYHA 3GNDA 4Q19A 1CXFA 4E8CA 2FN7A 3X1ZA 3QGKC 3AIRA 1NTRA 1Y9EA 1G6Q1 2BRUC 2HK9A 4QOSA 3IB3A 1UPTA 2VP9A 1X6LA 2FHBA 4NAVA 2GQ8A 3HGSA 3B7GA 2WF8A 1N36B 1RZ3A 1V1MA 2W48A 4MX8A 1CCWA 3R0XA 4WVLA 4RWZA 1R8SA 3RK1A 1Q0RA 4M7RA 3AUAA 4M1MA 4NONA 1VECA 3DXZA 4XR9A 3WA6A 2NZYA 3TXZA 1VBRA 2BPOA 2B81A 3S2MA 1V7ZA 3BJZA 3GFSA 3U7RA 2IGBA 3OVPA 2IA5A 1HZZC 4WY5A 4U31A 1A27A 1GARA 3DE3X 3BWDD 4MVXA 2Y05A 2BH2A 2DTDA 2GF2A 5EBUA 2GPAA 4JYFA 1QDSA 1Z25A 1GEHA 4JMLA 4FCTA 2NV2B 2OMKA 4R3UA 3EZLA 3KSUA 1CGXA 4QRHA 3WGJA 3W7QA 4BQQA 5GY7A 4GA8A 1XG4A 4AULA 1QQTA 1FFXB 5THKA 2I2BA 2I2FA 2RHTA 4NPHA 5EKSA 4CKWA 1W29A 1UPUA 2Y70A 4B5KA 4LTSA 3II6X 4PY2A 4BV8A 2OORC 2RG7A 3M70A 4JEIA 3L41A 5DY3A 2D00A 1FBAA 5B7ZA 3CMCO 1EH9A 1U28A 1VLMA 4C2UA 1I2QA 1QRDA 3T6CA 1U7ZA 2FPUA 3PVCA 1YADA 4H7CA 1W85B 3QELA 4W1QA 5LZ8A 2O1SA 3GPBA 1Z0UA 1DXOA 3GDGA 4OHZA 3DXFA 2RE8A 2C7RA 2WT9A 4TLMB 1JHYA 5A5DA 2E4XA 4TTGA 4ORIA 2ACQA 2CDAA 5CB6A 3HV8A 1EGQA 1WHTB 5C31A 4ZYTA 2PTHA 2J79A 1S5VA 2XUJA 2P0EA 2C1IA 4V02A 4KXQA 4OTKA 2D5BA 3TJRA 1XXHA 1E5VA 2V2HA 5D1NA 3WSTA 3FRJA 6ENLA 3NI2A 2QTBA 4Q9DA 1O77A 1MIHA 2FP4B 3IUEA 3O7UA 1GTJ1 1EBGA 5CT4A 4QXMA 3ME3A 2F6XA 1A3HA 1T43A 3EBOA 1QCZA 3WRXC 4N65A 4MWDA 4WBNA 1IT8A 4D9NA 2XE6A 4TMWA 1SKUA 2IYLD 4H6XA 4LDJA 2ODQA 2RGXA 1V16B 1ATIA 3OT1B 4HSGA 3W8DA 2PUEA 4RYLA 4DI9A 4TTSA 3LT2A 2R94A 4GXRA 4DYVA 1BKSA 3OM1A 2VC2B 2M6KA 4KN9S 1H2FA 4YY3B