5EMKA

Crystal structure of prmt5:mep50 with compound 9 and sinefungin
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 212
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emkA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emkA02
3KQVA 1KYZA 3CQHA 3FUVA 3ITXA 2Z6AA 3TQSA 3HCAA 1CLKA 3LCUA 2B3TA 4KRGA 2IDKA 2AOUA 5CM2Z 2QM3A 4PYQA 2AS0A 4PYKA 2Y1XA 4WVLA 3CQJA 4GJIA 4YMGA 5AVHA 4BLWA 2JHCA 5FWAA 2G70A 1D8WA 1H1DA 5E1DA 1X1DA 1I6NA 5B7YA 2P3QA 3ORHA 2IH4A 1UIRA 2PY6A 3CJQA 2GPYA 1L3IA 4C03A 3GJYA 5EQJB 3OBEA 4A8IA 3P71T 2WA2A 3BZBA 4G56A 2XVAA 3Q87B 4E2ZA 5DM0A 1VIDA 1P39A 3BKWA 1JG2A 1XYMA 2PX5A 3OFJA 3B89A 1QAOA 5K0GA 3KPVA 1QUMA 4B17A 4K1GA 5AVNA 3KR2A 1XIFA 4E31A 2OXTA 3T7SA 4DM3A 3IUHA 4X60A 2ZBQA 3LL7A 4YTRA 3EGIA 3PFGA 4P7KA 4R6WA 1YFLA 5HILA 3P14A 2GB4A 5LQJA 4BP1A 4Q7IA 3RW9A 4OA8A 3KU1A 5EEHA 2G8NA 3C6MA 3O31A 1ORHA 3NTVA 2V7EA 1ZHFA 3EVAA 5FQNA 3ITLA 4F84A 4YUWA 3FUUA 2AOUB 3HVKA 3O4FA 1F38A 4PCLA 1VLMA 3HCCA 2OPBA 2PX4A 2V74B 7XIMA 4RTMA 3MAGA 2IDJA 3LSTA 3KBVA 2O05A 4ER7A 3SR4A 2YTZA 5H1WA 1X1AA 3HM2A 1PJZA 3LCCA 3EVEA 5H02A 2NXJA 2LD4A 2NQHA 2IFTA 3G8BA 2B78A 1XIBA 3R6TA 1BXCA 1ZQ9A 4QQKA 4LG1A 3AAMA 2I9KA 2JHPA 2Y1WA 3KPWA 2WA1A 3LPMA 2ZZMA 3ITVA 2IP2A 1QTWA 8XIAA 3DMHA 1KPHA 3GGDA 4QEHA 1BC5A 5EKUA 4HGZA 4XIMA 5GM1A 3MCTA 1XYLA 5K0CA 1XTPA 4RTQA 4KVZA 1DCTA 3G5TA 2K4MA 3GWZA 1JG4A 2P7IA 1JQ3A 2YVLA 3QOXA 3DOUA 3OE5A 3HEMA 2ZWVA 2BR5A 2IIPA 4A6DA 2PWYA 5EGSA 3KQWA 2AN3A 2B2CA 2J6VA 3TMAA 1U2ZA 4ER0A 4RTNA 4CXMA 5EC8A 3OCJA 3HVIA 2VS1A 4C08A 5KQRA 5HIIA 3A7EA 3CQKA 1NBHA 5E8RA 2X7WA 1AV6A 1JTEA 1KR5A 3HA3A 5M5BA 5GWXA 2AVNA 4GC9A 3REOA 3M70A 5BP7A 3CQIA 2OY0A 2PX8A 1M0EA 2R6ZA 3C0QA 3TM4A 4QTTB 4A8RA 4E2WA 4ZB2A 3SSMA 2GH1A 1PRYA 4BY9E 4E30A 3FRHA 5BW4A 3KQSA 5CCBA 2YR0A 4IV8A 3I9FA 3VC1A 3EGVA 2P35A 5LSAA 3OE4A 1NBIA 3CGGA 3UJ8A 3DXXA 3GRUA 2Z6QA 1XVAA 4XUEA 5K0BA 1YZ3A 1SQGA 1XCLA 1YB2A 3UJBA 3BZJA 4DCMA 4H0NA 2C7QA 1I4WA 3ERCA 4XISA 4JXJA 3TC3A 3FYCA 3RIEA 3KPYA 3G2PA 3PLAE 1EJ6A 4IV0A 2OKCA 3XIMA 5GM2A 3OZTA 1BXBA 3QV2A 4O29A 5LQNA 3PTAA 3KBWA 4RX1A 1EQAA 4ZBCA 3ANXA 5LQCA 3EMBA 3BWWA 2BR4A 3AYVA 3A27A 5HOQA 3BANA 4EKGA 3C0LA 5DLYA 1BOOA 1SQFA 3HP7A 1XLEA 3K0BA 1X19A 4R8RA 2HCVA 1XLCA 2DPMA 5JUWA 3B3GA 3KCOA 5GIPE 3DLIA 1HMYA 3S68A 4Z2YA 3TM5A 1F3LA 3MCZA 1D2CA 3GU3A 2CL5A 3Q7EA 3M6WA 1SUSA 2UYCA 3M0MA 4QPNA 2HTEA 5EG5A 4R8SA 3GXOA 1RI3A 4K6MA 1A0CA 1Z3CA 2OB2A 2NQJA 5DT2A 2QY6A 4A6EA 1RJFA 1V39A 2QUNA 2G4JA 2Q02A 2I56A 4KW2A 4KW7A 3LKDA 3CC8A 3GRYA 4QDJA 4YUXA 4OA5A 3LBYA 1QANA 4RTPA 3G2OA 4FS8A 2YUIA 5DRTA 3CJTA 2CMGA 1JTFA 1IY9A 2H00A 5FA8A 5FCDA 3V8VA 4EQZA 3U3HA 2VP3A 3FTCA 3NVKI 2P3OA 5CIYA 2C7RA 4P58A 3G2MA 1EIZA 5E9JA 5CCXA 3PFHA 4AZVA 3FPGA 3E7PA 1R00A 2ZWAA 3D2LA 3DULA 5FWDA 3QC0A 3P9IA 2PXXA 3BKXA 1DIDA 3XINA 5EKXA 3BGDA 4OBWA 4WXHA 2E5WA 4CKCA 2JHAA 1XLKA 3SX0A 4YUZA 3BZGA 2I57A 2GUBA 4HHLA 3DX5A 1BKYA 4GQBA 4P7JA 3IUDA 5KQSA 3DP7A 3QZAA 3WQOA 1VP9A 1K77A 4YUYA 3LECA 3A4TA 4P7GA 4MHTA 3UBTA 4DMGA 4AUKA 4YV0A 1WXWA 3K6RA 1RJDA 2EJUA 4ER6A 3IEIA 3AJDA 2HK0A 4KDCA 3V97A 4FSXA 1X1BA 3UWPA 3LX6A 3UU0A 4GOOD 4X41A 3KHKA 3TR6A 5DTRA 3ITYA 4QEEA 2FPOA 4PYOA 3UXIA 4L7VA 2ESRA 2XVMA 3SM3A 5IKMA 3I53A 4E32A 1I60A 3KR9A 2JG3A 2CMHA 3FPEA 1KPGA 1FP2A 2AZTA 2HV9A 2ZIFA 5EZSA 3OU2A 3NWBA 5K0EA 4FR0A 3I64A 1QT1A 5I7GA 4FZVA 1AF7A 4C04A 3FTEA 1JQEA 4HNOA 2IBTA 1D2GA 2IGTA 3C3YA 4ZB5A 3QXBA 1SKMA 2BM9A 5FTWA 3A26A 4XIAA 3FUWA 1INLA 2HR1A 3KCJA 4MWZA 4DKJA 5XIMA 1XJ5A 5LQRA 2NXNA 1ZKDA 9MHTA 5E8JA 3BWCA 5BXYA 2ONYA 2ADMA 1G38A 1G6Q1 3QYSA 1XYBA 5GIOE 2P7HA 4K3ZA 1T43A 1TW3A 2ZIEA 1Q0TA 4QVGA 4EMSA 4PYMA 3DXZA 2FHPA 1YZHA 3G5LA 3CNYA 2VZ9A 3EVGA 1SVUA 1XCJA 3KPUA 3P97A 4EK9A 3LDGA 3M0VA 4HH4A 3L8DA 5GINE 3LKZA 1VQ1A 5CVJA 1MUWA 4E2YA 4HHMA 4KIFA 2P3LA 5HIMA 5HIKA 3LDUA 1XLJA 1ORIA 1VL5A 5G02A 4PYIA 5ICFA 4CKBA 2GLUA 4PYJA 5CUQA 1Q0SA 3LBFA 2DULA 5T67A 5T64A 4ISCA 3NJRA 2GYIA 5C1IA 1NW8A 1XYCA 5LQAA 5E1MA 2PT6A 2ORED 3AALA 5EOVA 2QULA 3SSNA 3XISA 3MQ2A 3KTCA 2GLKA 3P2IA 1XDUA 4RTRA 3P2KA 3FPHA 2YXLA 2ZLBA 2ZCJA 1R74A 3JWHA 2I62A 1XDZA 4PGGA 3AYTA 5P8WA 4YTQA 1RI2A 5FHQA 4XUCA 1P91A 2PX2A 3GRZA 1ZGAA 1XLMA 4RVFA 3G89A 3N4AA 1DE6A 4DF3A 4YTTA 4ZTBA 2ZFUA 4FSDA 2AR0A 1S5MA 2QE6A 3CBGA 4CTJA 3KQPA 3UVAA 3VNIA 1EJ0A 4ZB0A 1IM8A 3MB5A 5EIWA 2I7CA 2OB1A 5KS2A 2NYUA 3E23A 1DXIA 4PGHA 3IV6A 2G1PA 2P8JA 4PFHA 1FPQA 3GNLA 5EHIA 3JWJA 6XIAA 2IH5A 1KYWA 2EG5A 3HTXA 1R8YA 4GOND 4DA4A 2FK8A 4RV9A 1G55A 3R9XB 4POOA 4RVGA 1D2HA 5FADA 2IH2A 5T6BA 5U4XA 3EPPA 3NDIA 1GW9A 3GRRA 4R6XA 3OU7A 3I5UA 5F2OA 2JH8A 1XLDA 4LWOA 3TKAA 3F4KA 4XCXA 2IPXA 4QE5A 3TFWA 1FP1D 5E9WA 1YX1A 4RTKA 5CVEA 4QE4A 4PINA 4PIMA 2C7PA 2Q41A 3VNMA 2HWKA 1KP9A 1FJXA 3BGVA 5C9ZA 1NKVA 1NE2A 5KYGA 4KIGA 3KQMA 2A14A 2CKDA 3AY0A 1XLBA 2ZTHA 3ID6C 1M6EX 1XP3A 2ZULA 2VDWA 3DBNA 3FTFA 3G88A 3DH0A 2P1DA 1P1CA 5DM4A 3X0DA 2OYRA 5EVJA 1XICA 4AZWA 2PJDA 1JG3A 1BHJA 1XXLA 2Z6UA 3C6KA 2ONZA 2YXEA 1RJEA 5E1OA 5HIJA 4EAYA 4ER5A 3FRIA 3EVDA 2ZVRA 5D1HA 4MIKA 1NW6A 2PWPA 3G2QA 2OO3A 4HRAA 3PB3A 4KWCA 1JQDA 3ER9A 1NV8A 3VC2A 2YX1A 3ELWA 1G60A 9XIMA 3ELUA 5HEKA 3M0YA 4DUOA 4YV1A 2B9EA 4CTKA 3G8AA 3T0IA 2GA9A 3OU6A 4NECA 2OZVA 3UJAA 4XUDA 3BWBA 1MNZA 4PYLA 4RYLA 5K05A 3GNXA 1NW5A 3DXYA 2P40A 1G8SA 2UYQA 3C3PA 3M4XA 2O57A 2P41A 5CVDA 3IHTA 5IH3A 2VDVE 5F2KA 4V0RA 1XIDA 3O7WA 5ICEA 5CVVA 5B7ZA 3OPNA 5DXJA 1SG9A 3DMGA 3DUWA 1VE3A 1S5NA 4HC4A 5DWQA 7MHTA 2PXAA 4QDKA 1VPTA 1YF3A 1XIHA 4A8LA 3UZUA 5DX8A 3GDHA 4HTFA 5EMJA 2XINA 1NT2A 5KVAA 3UJ9A 4GEKA 2FCAA 3EMDA 1JR4A 2X7VA 1KHHA 3M6UA 4M36A 2ZZKA 3SVZA 3THRA 3T7RA 5B1SA 3P9KA 4HG2A 3PX2A 4GOLD 3E05A 2AOTA 3HNRA 1JG1A 5DX0A 4QVKA 3FUXA 5FQOA 4W4QA 3ME5A 3KR0A 2C7OA 3TPZA 1MJFA 1UFKA 3CCFA 1O54A 3VYWA 1M6YA 3JWGA 1NV9A 3WSTA 3U81A 1L9KA 3GO4A 3LMZA 3P8ZA 3TVAA 2UYOA 5ICCA 1R18A 2EFJA 4AX8A 2H1RA 4X61A 2VDUE 9XIAA 5DXAA 3BT7A 3HCBA 1NW3A 2N47A 3A25A 5EPEA 1O1HA 5FA5A 1ZG3A 4OBXA 1O9GA 3KQYA 3SSOA 4X63A 4US6A 4FT4A 3GCZA 3AXTA 2WK1A 5K8VA 3BWYA 4GC5A 5EMLA 4MTLA 3M0HA 4HTFB 3CWHA 1RI4A 1VP3A 3MTIA 2NP6A 10MHA 3MGGA 5EEGA 3FYDA 2AOVA 3CJRA 4EKIA 1I1NA 5F2NA 3M6XA 3ELDA 4YTSA 3E8SA 2HK1A 1B42A 3KQOA 5K0JA 4GOMD 5K0FA 4GF5A 1NW7A 1O9HA 1FBNA 2XYQA 3QOWA 3EVFA 3NWEA 2AOTB 4DCGA 2NP7A 5BW5A 3ELYA 3MHTA 4C07A 1TW2A 5J8LA 2CWWA 1RI5A 3B3FA 4A8NA 1XDSA 4FP9A 3KPJA 4Y30A 2NNWB 5DSTA 2ZW9A 2FK7A 1UWVA 2QRVA 1R8XA 3R24A 4BLUA 3UJDA 1EAMA 3CVOA 5DTMA 2BZGA 5LR6A 3DR5A 1WXXA 5E1BA 3GIWA 4DVOA 4DQ0A 2IBSA 5EHGA 3R0QA 5HZMA 1XLIA 3UJ6A 4PWYA 5XINA 4C05A 1XIJA 2QUMA 2AN5A 2G0WA 2PXCA 3P2EA 5D1NA 2NXCA 2YQZA 3NMUF 3LDFA 1XIIA 2EX4A 4E2XA 3JU2A 2PV0A 4E3VA 5EZQA 1WZNA 5K0NA 3LHDA 2GVEA 3NW9A 4PONA 2B25A 5E2BA 3H2BA 3MTEA 3JWIA 4Y2HA 4M37A 5CD1A 1AQIA 3OZSA 2ZDSA 4EACA 1X1CA 3EVCA 4M7RA 5DTQA 2ZVJA 1DIEA 4ATNA 1AQJA 4GBED 5CVUA 3VSEA 3DTNA 3PX3A 3PT9A 5EMMA 1IXKA 3KQQA 2ERCA 2PLWA 4QQNA 4QDPA 4PIPA 3VYLA 4OQDA 4QDWA 2QRVB 2PSSA 3P9CA 5HFJA 5ERGB 3TKYA 4QPPA 4R05A 2BR3A 3P6LA 5K09A 3FPJA 1WY7A 2ZSUA 3SMQA 4M38A 4E33A 4LNCA 4BLVA 3U0HA 3NGFA 4F85A 4UOEA 3KBMA 4MQ4A 2HMYB 3HCEA 5XIAA 3UA3A 4HSGA 4RTJA 3FVMA 3FZGA 1A0EA 5TNVA 3BDKA 4RWZA 2BM8A 4LECA 1Y8CA 2XYRA 4U7PB 2NXEA 5DM2A 4IWNA 2AOXA 3EEYA 3B3JA 2O0LA 2G71A 1P1BA 1OR8A 2XBMA 5FHRA 3IYLW 3G7UA 2NQ9A 2QW5A 1KIAA 1DL5A 5DX1A 1OADA 5K0LA 3BGIA 3PS9A 5EMKA 2QYOA 5DSXA 3HVHA 4QTUB 5JR3A 1L3CA 4GJJA 2UYHA 1L1EA 4E70A 5H6HA 1EG2A 4FT2A 1KXZA 3VNLA 3DMFA 2HNKA 4CWAA 2JJQA 3ER8A 3MERA 3LGAA 3THSA 3IUIA 4RVHA 5GP1A 3RODA 1QAMA 2O07A 5LQKA 2PGXA 3M0XA 5B80A 1XLAA 4YV2A 1XIGA 3KBNA 2PT9A 3HA7A 2G72A 1N7IA 2PKWA 1TPYA 4RTOA 4V0QA 3UFBA 2I6GA 2JH9A 4BP3A 4AZSA 2O06A 2FYTA 3HVJA 3HA5A 5FULA 3EGEA 3UJCA 3VNJA 4PNEA 3BXOA 4AZTA 3B5IA 3OFKA 3KBSA 5DRYA 3FTDA 1HNNA 5DPMA 1N7JA 8MHTA 3C0SA 3KR1A 4C06A 2GAFA 4X1OA 4U7TB 4RVDA 3M33A 5LQUA 1JSXA 2XYVA 3C0KA 4PYNA 4XSLA 3ITTA 1XIEA 2R3SA 1QYRA 3P9NA 1DUSA 1DE5A 1JSZA 3DLCA 3KWSA 3TRKA 3SGLA 4F86A 5MHTA 2AOWA 2F8LA 1XLLA 8XIMA 5C0OE 4P7FA 1VBFA 4XKMA 4PCAA 1XLFA 5DM1A 3UJ7A 1L3BA 4EVIA 3KQTA 2UZ4A 3EVZA 1WG8A 3NVMB 3I58A 2OU4A 3VNKA 3KBJA 2PBFA 1XISA 5E9QA 2KW5A 3EVBA 4IKPA 1XIMA 4HGXA 1G8AA 3TLJA 3UA4A 2AN4A 1RJGA 2AVDA 3HCFA 1R6AA 5FUBA 2XISA 3SXJA 5ICGA 4QE1A 4XSMA 3FPFA 2ZIGA 4HGYA 4ER3A 3M0LA 3R3HA 4FGZA 3BWMA 2H11A 1RI1A 4YUVA 4YTUA 3HCDA 5K03A 1I9GA 3KKZA 4YMHA 4PGLA 4RTLA 1ZGJA 2YXDA 3AXSA 4OQEA 3A7DA 3B7PA 4GUAA 2ZZNA 2XIMA 3BUSA 4RTSA 5GOZA 3EEOA 1N2XA 4GLEA 1YUBA 3PVCA 3CKKA 1QZZA 2ZBPA 4OVXA 1QAQA 2GS9A 3LCVB 2OBFA 3NDJA 3KCLA 3FUTA 4RSRA 1YFJA 1A0DA 2ZBRA 4C4AA 4CKEA 4DZRA 1TZ9A 3M6VA 5EIFA 3L23A 3GRVA 1SUIA 1XLGA 3OZRA 1XYAA 3ITOA 5K01A 4J4KA 2FRXA 1XINA 3T7TA 4OX9Y 4LWPA 3AWIA 2BH2A 1XLHA 6XIMA 1KPIA 4KDRA 5E2AA 3TOSA 2PVCA 1WS6A 1MHTA 2EJTA
chains in the Genus database with same CATH superfamily
3R20A 2DBVO 2FEPA 3OEWA 5DHQA 2HBQA 2VAMA 3EEFA 1K3UB 4HQKA 2R5NA 1EDZA 4TS9A 1VCIA 1K8XB 4RZ6A 2BOEX 5ULLA 1YHYA 1W9MA 1X6LA 1CUGA 4TRJA 2VNJA 2A79A 2HEJA 2JHCA 3L1IA 4OBEA 1ISHA 5E1DA 3N5CA 5B7YA 4Q5IA 1F8MA 4WAUA 3AU8A 4O4JB 4ML9A 3I4LA 3G2LA 1IJBA 3BMQB 1FE8A 4EA9A 4C5AA 1GKKA 3LUTA 1N3YA 4P22A 5HS4A 3PPIA 1PK9A 4E1VA 4DLTA 3C8UA 4YJFA 1JLKA 3R8XA 1BRMA 1SZJG 3G23A 5ABFB 3R9IA 5D2TA 2XVAA 2YYSA 2WWVD 3Q87B 3RBVA 3CLRC 4E2ZA 1AVTA 1YW1A 3LI2A 3VNAA 4A0HA 1DLJA 4CEHA 5HZGA 1GZHB 3LX4A 4O52A 5IEBA 4EKYA 2V54A 3VPBA 3I92A 4AB4A 1V6TA 5TPWA 4ILSA 1NQKA 2QRGA 1Z5PA 1V7CA 3CSUA 3NRBA 4JTIA 4MWSA 2GB4A 3F6CA 1YZLA 2EGUA 1WNOA 5DYWA 1W1TA 3J7HA 4Q3CA 2G9RA 3STPA 4X1KB 3W2FA 2ZYAA 3DFKA 2BI4A 3CZMA 4AQ7A 4NJKA 5KYYB 2EIHA 3A5FA 4KMQA 1N75A 4IL0A 2RGWA 3SEFA 4CKWB 4Z3OA 1CZKA 1HXJA 1KAMA 5AW7A 2G28A 7XIMA 3WG6A 4BF9A 5HQMA 4ER7A 1I0IA 5JUVA 5BN3A 4X8HA 1ATZA 3HJGA 3EWCA 3RYIB 3CAVA 1RIFA 3FF1A 2QMZA 2RDXA 5A3QA 1UA3A 1N33B 2X0NA 1TCCA 2Q5EA 4OI4A 1E3LA 2VOEA 2GEKA 2V38A 2VDMB 1TV2A 4ADSA 3A3WA 5D00A 1N9ZA 3D5QA 2Y1WA 5CEJA 5E7JA 4PCPA 4B79A 3TH6A 3T3HA 4NCXA 3SGZA 4CU5A 1KCLA 1FFDA 2OWEA 3N39C 1JFSA 2G3MA 4S35A 4RTQA 1F5ZA 5LBTA 1O95C 2ZX5A 3G5TA 2YHSA 3OE5A 3SRHA 3QOMA 2IQTA 1TE2A 3G59A 3CVVA 3O8OB 3WGQA 4IICA 1IIBA 3FKRA 2J6BA 3LQ4A 3BSMA 1HL3A 3GUZA 3ZXUB 4Y2GA 4UNSA 5JFGA 4K9MA 4HNCA 1DV2A 2WZIA 5EC8A 1XYZA 1H7RA 5G1NA 1GTVA 5JJIA 1T8QA 4YRTA 1GFIA 2Z3VA 1J9GA 4GKVA 5IJAA 2YWCA 3M1ZA 3RROA 1NW4A 4YBRA 2QDEA 1UMYA 1P8AA 4KHZA 3KSBC 3DHPA 3IODA 4BY9E 2BI8A 2GN1A 1W88B 3FRHA 4JI0B 3KQSA 2W0SA 3D0QA 4QHRA 4J8PA 3P3BA 4D3DA 4F4UA 3ZTYA 3QV9A 1YR8A 2I4IA 1YVRA 3ZX4A 1MGPA 3KB1A 1MB2A 3KVYA 2G83A 2P5YA 4LJ4A 3TOPA 3IUBA 4E4YA 1MP0A 4OI2A 4TV5A 1E2LA 1G8MA 4A5SA 5K9CA 4UREA 1JLRA 2XGJA 1U8ZA 3HO6A 1IXRC 4JTGA 1BS9A 1T5DX 1I4WA 3GDKA 2ZBEA 2Q2NA 4RAQA 2VN8A 4XJVA 1IN7A 4DDUA 2UVDA 1AUOA 4NCKA 3GMDA 3LS2A 1SC4A 2FUNB 3QVOA 4QEDA 2PLMA 3RARA 3EA5A 4YK7A 1N8NA 3C6YA 5I01A 3QEMB 1WXZA 3R0UA 4O16A 2PWGA 4WNCA 3A2KA 2ONCA 5T8KC 1U1UA 1SULA 1UZNA 3L7MA 5DLYA 2IS6A 1SQFA 3STFA 2AYXA 5LA6F 4KQ1A 4J0FA 1C4KA 3ESRA 4JBRA 2HCVA 5D30A 1O89A 4PFQA 3UQNA 1TSIA 1M7BA 1U1FA 2DPMA 2PUJA 4YQEA 2KX7A 4PHGA 4DT1A 1ADBA 4Q4QA 3H4GA 3MW7A 4JUFA 2F3SA 1DAIA 5AVZA 1EDDA 2W83A 3PD0A 4QXPA 4GI7A 3SCTA 3RS2A 3FWPA 1NUSA 1VJRA 2M98A 5A7GA 3CRRA 1HTIA 3FVDA 3N05A 4CN6A 1CUJA 2X77A 1Z3CA 4MS3A 2WAAA 2OEMA 1WCWA 2OB2A 3JYOA 3L6CA 4CMIA 3RITA 1KJJA 1U1JA 1QYXA 2XXBA 5A0FA 1XTRA 3R58A 2Z00A 4Q4MA 4S1FA 4DUWA 3N04A 4UDOA 1ESMA 3K1DA 2VO1A 4RTPA 2Y0EA 1K92A 2HF9A 1PGJA 2ZXFA 3E8XA 2EZUA 4GI2A 4O25A 4D81A 1XKXA 4AIEA 4AD4A 4REQA 1RXYA 3D81A 1E9FA 5LDGA 2V0NA 4PO9A 4TYMA 4C91A 2W27A 1LROA 2KB0A 4DYEA 4DYDA 4G3XA 2Z2YA 1XQ1A 3WE7A 1ZN7A 3VKAA 2AFIA 1TA0A 2ODTX 2I6TA 3MQTA 4HX9A 3CMJA 3VR6D 1YTDA 4TMBA 2O50A 2B0MA 2QLBA 5HS6A 3VR5A 4WXHA 3ZH9B 1ODIA 3ZHBA 4B16A 4EIVA 1FXSA 4U0KA 3VKHA 4JCMA 1BMFD 5HF9A 2X16A 1Q6GA 4XM0A 2CIPA 1BQ3A 4YALA 4ZV4A 1BKYA 3OT5A 3RM3A 3S70A 1J1IA 4ECEA 2L2QA 3QFSA 4BNFA 3IELA 1IYXA 4YUYA 4JD5A 3E0WA 1U65A 4DHGA 4BTVA 2BEKA 3RFVA 4YV0A 4OK6A 4MPTA 3IEIA 1ELOA 3I6QA 4N0PA 1V77A 2HK0A 1JHDA 4HCLA 1CDDA 3IJDA 4B3MB 3CT2A 2YV4A 4I36A 4P80A 2DQSA 1R5BA 5HULA 2IGBA 3I6IA 2RKBA 4QEEA 2XCUA 3QKRA 3SQMA 5ALUA 2WTAA 2GN0A 4FJ1A 1KK0A 1MFZA 5LIPA 4OP1A 3UVEA 1RZMA 1QT1A 3AIUA 3A6PC 4R16A 3MMUA 1DAGA 5HTKA 4HZ7A 1KTVA 4MSSA 4XIAA 2AE2A 1Z4JA 1H1LB 2HR1A 4QYIA 3V4VB 4AJLA 4DKJA 2HQAA 2A0WA 3ZGNA 4EUHA 3O38A 3FOWA 3NURA 1VAHA 4ND8A 3SXUB 3V6LA 3IRVA 4CPDA 4PSPA 2PD5A 3IIJA 4K68A 3BLPX 5TPZD 4F45A 2H3EA 3OAAA 2WIJA 5G3ZA 4I1UA 4GQQA 4BQOA 1JEQB 4PN7A 1RZVA 2VZ9A 2PD9A 3RC9A 1K6WA 1WM1A 3GY0A 4ILEA 2FLVA 4KBFA 3UJ3X 4OJNA 4GKKB 3KOMA 4QBFA 1BDBA 3TE7A 3U4QB 3P97A 2E6AA 3UHAA 3O0FA 4L65A 1A50B 1LNQA 4XZMX 3OQOA 4M0XA 4E6PA 4V02A 5GINE 3STGA 3Q67A 2OR2A 1OLUB 1XH1A 1TK2A 1MDBA 2WVVB 4RORA 2VG8A 5HIMA 2JASA 1TPZA 3DKPA 3D8BA 1CVLA 3OZXA 1VL5A 3ZE6A 1QFJA 1SVIA 2BEWA 5EP3A 3VMFA 2ZX9A 2GM3A 4D9FA 5T67A 1FSGA 3LQKA 3S2LA 5JT1A 3GG7A 1RZUA 4XW2A 5KSZA 3EWSA 4PEEA 4WA7A 3RBZA 1E7QA 3GHUA 5M2QA 3REFA 3EKLA 3GCGA 3UANA 1W3HA 3TRDA 1NWRA 4C7XA 5A0TA 3EC2A 1EK6A 5KINB 2FQXA 2D3TA 1KQFA 3T3IA 4IMRA 3ZNOA 2Z5VA 4CCWA 4MWDA 4I8XA 2F43B 2HJGA 3LT1A 3GNOA 4UTWC 2DT8A 3FLBA 4FFBA 3JZFA 1P6WA 3OBKA 4CYMA 5AKIA 1SBHA 3TDFA 4PLFA 3WLQA 1E7WA 3NZ1A 5LNK1 5KYTA 3BMWA 1SC3A 1FXPA 1T4BA 3WK3A 4EANA 1T9BA 2FKPA 1UBTS 4KU4A 4NZ5A 1C0PA 4TX8A 1NHWA 1Z0AA 1B0PA 2R44A 5SZJA 5CA1F 2PMKA 1MW3A 2O52A 3IE2A 2N3ZA 1SQ6A 2YXXA 1OFEA 2RAUA 3JXEA 4DXDA 3K4AA 4F12A 1ZISA 3KD2A 1YMUA 3L3BA 2X1VA 4NAUA 4CL2A 2NM0A 4MB3A 3R6LA 3TOCA 2EG5A 1TF2A 2PRYA 4QJ3A 6YASA 3NZPA 4DA4A 5DJ5A 4U4AA 4AROA 1O4UA 3R9XB 4RVGA 2GJNA 1SRQA 2O2XA 1M1YA 1EPXA 4HB0A 1U8AA 2XI4A 3NZGA 1PV1A 1LDYA 4YAFA 2F61A 5AK4A 2XTNA 3VO8A 2H48A 2RBKA 3BG9A 1UBFA 4XCXA 4QE5A 4DRYA 2QUJA 4JBLA 3GY1A 4Z2IA 3CG4A 2MYTA 1C2TA 4MS4A 4RJKA 1UC5A 1TMHA 5CYPA 3WKEA 4NE7A 1M9NA 4MZYA 3N28A 4QE4A 1ORTA 4IP7A 2I4LA 2Y7EA 1KDYA 2RGCA 2D0FA 4CQMB 4KLNA 2VM8A 1NL3A 4P4UA 1QO2A 1K02A 3VGFA 1CUCA 5D37A 1M2NA 1SCAA 2DUUA 1JCXA 1LDEA 4GGOA 5C9ZA 5KYGA 2OQLA 2XZLA 1JXMA 3TLGA 4N4QA 2QVLA 3QBJA 3THXA 1RLTA 2NW0A 1RRPA 3WQWA 1CW2B 1EYEA 3ER6A 3SSAA 1DKUA 2HWWA 1UWTA 4D02A 3P9ZA 2W9XA 4BEQA 4DO7A 1X8CA 1KBKA 3IJQA 4IG4A 2C5FA 1SM9A 3C3EA 3WQDA 3AEQA 3H75A 1BHJA 3ZI4A 4GBJA 4MNLA 2DZTA 5ITZB 5G1TA 2C97A 3II1A 1Z68A 4JQCA 4NEQA 4BS9A 4DIAA 4Z2AA 2EX0A 3EVDA 5LNRA 2PWPA 2VF8A 4RE4A 1Z0SA 4Q1DA 3ZCUA 1Y7TA 1E0JA 1FUKA 3MJVA 2WVUA 5CH3A 4FXPA 1ADCA 1VKNA 2Q1WA 4B2DA 3HBAA 1HDXA 3OZFA 2QD1A 4TMFA 5G3YA 1D7KA 4HVTA 5DK6A 4YV1A 3VIFA 4RVNA 5HNUA 2OZVA 3D1VA 3UJAA 3KSDO 4ARZA 4GT1A 1QUFA 4UFLA 1DWAM 4OB8A 4TS1A 4ESVA 2BHRA 5HZKA 4NZNA 2UU9B 3APYA 3DL0A 2CLIA 1I4TD 1GM5A 2WU4A 3M4XA 3C0JA 4M4SA 4XLTA 3W6UA 4A27A 4ONVA 3W2GA 3PUEA 3AUYA 5IYZA 5F2KA 5FUQA 5ICEA 4B3XA 1PLJA 1F0KA 1W36C 1CS0A 2O8FA 4TQAA 4DWSD 2VTKA 1UOEA 4IBOA 4BWYA 5CPMA 1V6AA 4H0FA 4MSUA 3WKBA 4UWMA 3D7SA 3L7JA 2ZRJA 4TVBA 3C8NA 1RC8A 2W6JD 3BIJA 4BBAA 3EWNA 2GN8A 2IOHA 4Z0NA 4NVTA 3TAXA 1FQJA 1P61B 2JF0A 3OIXA 3GBSA 4OMDA 1DIHA 5BRJA 2WSKA 4U5XA 2CJXA 4Z0TA 3SYTA 3T4UA 1YB6A 4XR9A 2H85A 1PYFA 3P8JA 2BV3A 3SVZA 3M4YA 4XJSA 1IATA 5KOIA 1GD1O 3G1SA 3RX2A 3BK2A 4HG2A 4JCCA 3HNRA 1YONA 3FGZA 5CZJA 4M54A 3CWOX 2R8BA 2WHQA 1YB5A 2IHZA 2EF9A 4I9UA 1FXUA 1U8XX 2I9EA 1Y8AA 5BOOA 4UVIA 3CISA 4N9QA 3WSTA 3RJZA 4EW1A 1BX0A 1MZHA 2PBOA 4GVGA 2ARKA 1WTAA 2WI8A 2QPSA 1KSGA 1K4HA 1MF7A 1LEHA 2HIAA 1JR1A 1T0IA 2J09A 1CT5A 2N47A 3HFYA 2A1TR 4YR7A 1KFKB 3KS5A 3GQBB 2YWDA 3IPCA 4PPGA 1PVNA 3R7WA 4HWSA 1GTRA 4BWFB 3N0WA 1XEWY 5KOHA 2R25B 3VKWA 5GQBA 2IX9A 2WCAA 3UHJA 4FIRA 3H04A 1NP6A 4MTLA 3KSRA 3V1NA 4NAVA 4ZHQA 4IMJB 5D85A 3PXCX 1Z4NA 5JRZA 1W2PA 3DAHA 3M6XA 4W7VA 1L5GB 4L1XA 4ZMBA 1PGOA 3WWCA 1V0JA 2YIJA 4LHWA 4U2CA 3TJXA 1V5WA 5FI8A 3V0SA 3G79A 3PT5A 2B82A 3KV1A 3TFXA 4F1JA 4BJ1A 3D6NB 3UNTA 2CLLA 2OBXA 1QTNA 4HPGA 1RI5A 5LZ7A 2W79A 4BO8A 2AI1A 3KPJA 3RFFA 3FDZB 3B8EA 2ZW9A 1P1JA 4LYJA 3GPCA 3KDPA 2C16A 3W81A 4ZTXA 1TM4E 1TXGA 3MFQA 2CYCA 2BZGA 5DEIA 1FNCA 2BKAA 1JH8A 5E1BA 4BYMA 3L1UA 3ZDYB 9ATCA 1T4CB 1J2JA 4YP9A 4Y7EA 1WW2A 4C76A 3EUFA 2NT4A 1BGAA 1E9CA 1OFHA 3LSBA 4Q48A 5A6SA 3ANLA 1K7XA 1ZCCA 1OFTA 3MA0A 4U4MA 5DXFA 3FLEA 2NXCA 3VPFA 3S1LA 5EY5A 1OWPA 4JLAA 5ALIA 3GLIA 3QW3A 4UZEA 3OCZA 1LDGA 1YB1A 3QVGB 1GIAA 2Q4BA 1WZNA 2COEA 3K9LA 4X85A 2YBDA 4XKYA 2W4MA 1UXIA 4PRKA 4DZZA 4DNQA 1H3GA 1DIGA 2OZLB 1S9DA 3RK4A 4PZYA 3U48A 5HGJA 3K09A 4M6PA 1AQJA 4AZIA 5B53A 4RYDA 3PWSA 3KOUA 5M7EA 3QA9A 2ODEA 1HKIA 5JSFA 5IJ0A 2GJ8A 3R77A 2DWUA 4FOJA 3P61A 2RI0A 4WZHA 3VYLA 4U7HA 4NX2A 1GU0A 2A5GA 4Y9SA 2V63A 2HRBA 2EKBA 2IQDA 3B6EA 4DPKA 3LGDA 5LIWX 1JPUA 3AIOA 3TWOA 4HZUA 1RXEA 5IT5A 2EGZA 1VIVA 4DNOA 2A6PA 4C7OB 3COSA 1EFHA 2ATXA 2YW2A 3P6LA 1WY7A 2AI3A 3FIJA 1CYDA 3MO4A 2B99A 3TNOA 4X6UA 4F85A 4M0LA 4K9DA 1XZJA 5BV0A 2OCZA 2AJBA 4M9CA 1P7YA 1PLKA 3ZD6A 2ZB4A 821PA 5KSYA 1F9EA 2PP0A 3FVMA 3Q8WA 4QTZA 1AZLA 4WXEA 3TN7A 3WLTA 3EQ9A 1KY4A 1J5XA 1RM5A 1TTQA 1LL4A 3QVKA 4O2BB 5IT0A 1XG3A 2BSLA 5EYWA 1USKA 3BAYA 4N5NA 3K92A 5FCZA 3PTDA 3E4CA 3WLAA 3TFQA 2FPGA 1KBZA 1DIBA 3RANA 3K4PA 1J99A 2DBRA 3C8HA 5DDIP 2NOAA 4LUCA 4ES6A 4PG5A 3VO9A 2E0IA 1ZNWA 3BGIA 2ZIVB 5BNZA 3VNDA 3PCTA 4P53A 2AJCA 4IJKA 2WSQA 2YA0A 2ALDA 3G0SA 4GJJA 1HC7A 1H7XA 1EG2A 3NXKA 2G9UA 2P0AA 2WSYB 2Z1XA 2GSWA 4L4XA 4H9GA 4RPQA 2YVKA 3THSA 3EGDB 3ZZUA 3PNKA 1BHQ1 1AJ0A 2ZE6A 2JJ8A 3RU6A 1TLLA 3RODA 5BUZA 4TOIA 1D04A 4JOSA 1I6KA 5JEDA 1JIQA 3S2EA 1XIGA 2RGEA 2VSXA 4PFSA 2OHJA 5HWJA 3I6YA 3MJCA 2CV2A 3EXAA 3AESB 2Q2QA 4H6KA 3PKJA 1V3MA 1P0MA 1T34A 4ZSUA 4N5HX 2J3IA 2Z2KA 5ALZA 1FFXA 4L56A 2FGJA 3KQKA 1KC7A 2GJKA 2BJVA 5A6BD 1P7CA 3FKKA 3G1TA 1B6GA 3VZXA 1K5PA 1SZPA 5GPBA 5H3CA 4MV9A 3OFKA 3PRKE 1D4FA 3LHYA 4R2HA 4HGQA 4W5WA 3OE7A 1FFYA 3VIGA 4Q4SA 2AG0A 4LHZA 1GYPA 1IGSA 8MHTA 3AHVA 2H18A 2E7ZA 2BKVA 2CLFB 3VD4A 3VDNB 4ANFA 4EDHA 4OUDA 3R7MA 5EE0A 4I1SA 1XIEA 2QXUA 4PGMA 1WV2A 1E9BA 4D26A 1Z34A 3DMRA 1Q2UA 1AQNA 3DU0A 3TD9A 1TTTA 1NU5A 3UB4A 5AHNA 3U7RA 2XNSA 3T55A 1VDZA 3PPVA 1KQYA 4KO1S 2B8TA 3D3QA 3H97A 4LMRA 3TSOA 4CKZA 1OX4B 2E85A 2V8OA 1FX1A 2RC6A 4PGAA 4WKFA 4B43A 1ZINA 4E5NA 1OU4A 3EZ2A 3TMYA 2EPNA 2PL1A 1GQLA 2H4ZA 3CRMA 3L7OA 1NVDA 3OSZA 1EE1A 3G2HA 1KMIY 2CYBA 3RMEA 3ZDFA 4KUGA 3CL7A 4AM8A 4KQ6A 2FB3A 1FWAC 1X8KA 4OY3A 2PA3A 2JL1A 3VNKA 3TLMA 2CC0A 4C6LA 4E4FA 1XISA 1BG4A 5ABHA 4JYZA 4ZFCA 2F1OA 2WNSA 4H7VA 1KGDA 3CUSA 3ZK8A 3L4ZA 2XGZA 1XVUA 1ZYUA 3U7GA 4KVFA 2YZGA 3BXXA 3OBAA 4GE8A 2XISA 1I7DA 2JAWA 1W93A 4F3NA 1EZ1A 2QMJA 3M0LA 3PUVA 1JPJA 2PXHA 2A4AA 1BWLA 3P0WA 4Q4LA 4MHSA 3EFOB 4LY4A 3SW6A 4YTUA 3O1NA 1PCWA 5EWMA 1H5QA 3NYDA 2OV1A 1EP2A 1MJNA 1NYLA 1PZFA 3F7JA 1QPKA 3B0VC 2QR5A 2WWCA 5A8MA 4N0RA 2V7WA 2C2WA 3DLBA 2H1CA 3WGLA 5IBQA 3CEHA 1HO1A 5GOZA 3IDOA 4UJ5A 2ASEA 3NAVA 1N8IA 4K6CA 1FFBA 2OCXA 4U33A 3NBKA 3B36A 4NARA 4PF1A 2RGXA 2AXNA 1DWJM 3OKCA 1SW7A 5CSSA 1UJNA 4YCNA 3MLAA 1EFZA 3BPSA 2WNQA 1FDSA 5H3LA 3H9UA 2E4UA 1E60A 3FCXA 3VU9B 4ERGA 4KFCA 1ZUHA 4UAJA 5HKKD 1WBHA 1JR3D 4G7EA 1BRTA 3DAOA 1Z6XA 2FUEA 1WQ1R 2VA9A 3CUXA 4G4JA 4BC1A 2C03A 1OYAA 3SJNA 4BMDA 3WJYA 5E5CA 3S2JA 1TCAA 4C2AA 1ZY2A 2PVCA 3LM8A 3TF5A 1Y5MA 2XNKA 3EFHA 5DN1A 5DH9A 1Q2RA 1XZIA 4R9UC 3Q3VA 2VGFA 1TT7A 3N6JA 5JH7A 4TTRA 3EAUA 2XVZA 4BBJA 3B6MA 3LXBA 5KZMA 3FN9A 4GX0A 4EPVA 1G5AA 4Z51A 3OVGA 1U1IA 3HRIA 4TXLA 3FYOA 3TSWA 2DPEA 3K2IA 1TMQA 3VR2D 2OOKA 4CQDA 4LZWA 3NDRA 4DHEA 5GV7A 4GJIA 3ZWMA 4YMGA 2PSJA 1QKIA 1NF9A 1NXOA 1TB4A 2H5LA 5FLYA 4V1CA 3H22A 2Q1XA 4ACZA 4AIOA 4ZOLF 4YL2A 2QSZA 1UQRA 2DQZA 4EJSC 4HMCA 5CYOA 3UMMA 2BGJA 3ZZ0A 3WSWA 3T78A 1A5KC 1YFZA 2WA2A 1ZX1A 3OQBA 1L7DA 2RHCA 2VIIA 2DWQA 4HK6A 1JEYA 1XXHA 2JVJA 4MQFB 4KEMA 3NH6A 2WJIA 2QCFA 2FRDC 4CKQA 1KS2A 2PX5A 4HMQA 3DZ8A 2O2DA 2PI6A 1QUMA 2IF0A 4RY2A 2NVAA 5AK5A 1YASA 1SEVA 3RS8A 1J8VA 4D2IA 2WHLA 2GFHA 2E3ZA 3K2QA 5BSRA 1GV1A 3ITKA 1UYQA 3RS4A 3C5QA 4PRTA 5DP2A 1E1RA 1M6JA 2VZSA 4YB8A 2V3CC 1BQCA 3N11A 4PTYA 2G76A 4GQGA 1E4YA 4J2HA 2ZXBA 2QP3A 5I3KA 4N01A 3K4HA 3E5BA 4YYZA 1B3WA 2Q9AA 4E7PA 3IPXA 1YTUA 5AUOB 1YUMA 1I3KA 4MJ7A 3DT9A 2Y3IA 3MSCA 4DELA 4A1FA 3GD6A 2WPBA 3RILA 121PA 3WQPA 4P8VA 5AYYA 1K8YA 3NPUA 3DEHA 1C8QA 3NKLA 5HWNA 2GAOA 2WA1A 1OC7A 2YGYA 1UR8A 4EPBC 2Q9CA 1C7IA 2X3FA 3QLVA 3A4VA 1TO6A 2LXNA 4HADA 4LJ3A 4FOSA 1VGAA 1WZAA 4DARA 3RFTA 1FVXA 4QU9A 1ODJA 3KYCA 1S2CA 2IYLD 2VDKB 1Q2SA 4PRLA 2IRWA 3HCNA 1KI2A 2E6YA 3TC6A 2VJCA 3PXEA 3OZDA 3AO0B 2YCIX 2G04A 4PR3A 5CFOA 1JR3E 2ET6A 4XXHA 2VZLA 4GUDA 3S7TA 1P4AA 1H5UA 5I3FA 2FSFA 4H9YA 3M46A 2BFBB 1AXGA 4L8FA 2JBHA 4O1HA 4TIMA 1AV6A 3VGBA 3CAQA 3EA3A 3I0ZA 2QX9A 4J7AA 2LW7A 1ONWA 4XYMA 4DCTA 1W4AA 4FXJA 3FJOA 3ZHUA 3C0QA 2IKSA 1Z89A 4PE5B 5ADWA 2XUCA 4UBIA 2CVZA 3RB8A 2HU8A 1NI4A 3DHDA 5I7SA 3CUVA 2PZ8A 3T0TA 3HDGA 3RV4A 4BMVA 2I7VA 5CCBA 2ZJFA 4AP9A 4AYXA 4YIHA 3W2TA 2Y70A 5LNUA 2ZZ1A 3W27A 2E9MA 3K70B 2GXQA 1UHVA 3ITCA 1TUEA 4QC2A 5K0BA 5FLEX 1XCLA 2NYRA 2ODPA 3LWZA 2GD1O 3BZJA 2GFIA 1JHYA 2OVLA 4D6IA 5F1VA 3FZQA 2VQ6A 2I1LA 3N70A 4CCDA 4QA9A 4FLMA 3NQBA 7A3HA 3PR1A 1NNUA 4HQOA 2GPAA 3PLAE 3PNSA 1NQVA 2QUTA 4MOWA 5KYNA 5GTDA 5LQNA 4UDXX 2KHZA 5KWIA 4XWWA 3OX3A 1S2GA 1CGXA 4QROA 3U4FA 1R4AA 3TLCA 1Q44A 4P4SA 2LKCA 4MTCA 4MIEA 4C0BA 4LWQA 2C3UA 4S3GA 2IZ5A 3RF6A 1RYFA 4R1QA 3D8RA 1Z6AA 1C93A 1A4LA 2YSWA 3ZW8A 5J4YA 4K0KB 3Q0TA 2CITA 4BFCA 4MWTA 3GU3A 2JEQA 4MUAA 1SBNE 2XX3A 4UPEA 1GN8A 4QLLA 4QPNA 1D2MA 5JJLA 3ZHOA 1LQAA 2RONA 2R4UA 1AXRA 3S4YA 1CRLA 5FYDA 2Z24A 1A0CA 1JQAA 1PHRA 1J2YA 1WXJA 5JCJA 2MNRA 1ENUA 4UDYX 3BHMA 4B75A 3LKDA 3H19A 2H1HA 2JGAA 5FNVA 3HR8A 1AGPA 2VXCA 4H8NA 4DW8A 1N6LA 2DJLA 1FMTA 4J0DA 2ZA1A 2YUIA 3W7JA 2CLMB 5I5EA 3MU7A 2B8JA 1BYUA 3M1IA 3W87A 2JGDA 3A9BA 4KXXA 4J0QA 1HZJA 2V6GA 2QPLA 4N8DA 4O0MA 4R3UC 4JKYA 3B8UA 2VBCA 4CQMD 3D7KA 5AM5A 2Q8PA 1U04A 2IIBA 1KEVA 5MKGA 4XD7A 3KJHA 2CXSA 4XYEA 4OFCA 2XRYA 4MR7B 1BIFA 4KI7A 1T2DA 1QU3A 4RJLA 1PT5A 4ZEVA 3ZS4A 4DSAA 4UOJA 1JFFA 3NBZC 4FXFA 1EWEA 1TTPB 3B05A 2OKTA 3OIVA 3T08A 5EKXA 1F7UA 3D8UA 4OTZA 1J39A 3E0VA 1UM9A 2EBFX 3Q2KA 3S1AA 3IL2A 3CZEA 2EHJA 3JW7A 3KLLA 3W2HA 3QEOA 2X9QA 4QBXA 1A8SA 4K6AA 1S46A 5BQ3A 5J40A 4Z2HA 4GQAA 4GFSA 2XJ4A 4AF0A 1FY2A 1W1ZA 2QK4A 4N9DA 3S0CA 1ZBVA 1GEGA 2XCRB 4LYRA 2JGRA 4A23A 4MGKR 1PWYE 1XAHA 3DBIA 1SCQA 2Q4OA 2WMYA 4NXKA 3GW8A 5IJWA 1EWYA 1EUYA 4YDRA 2GZHA 1CIUA 3IHKA 2QUZA 3QTLA 3FJNA 4DQUA 4Z4GA 3CYJA 4LMPA 1Z8AA 2BPOA 3LHVA 3CF4G 2ZZ2A 4D72A 5UKDA 4ZREA 3P2YA 5HDBB 1M6VA 2V7QA 1H63A 1I2CA 4P32A 2XOKD 2DT0A 1Q5MA 5D05A 1K9FA 3A1CA 4L22A 3OPYI 4XQ0A 3VZYA 4HD8A 2XD4A 1A9XA 2C14A 4C90A 1NDZA 4H8HA 4UDNA 1UMCA 3E22B 4ZCPA 1VFLA 4UTTC 1WDMA 4KFUA 3ZM8A 4CKCB 1UWAA 1TUGA 3BERA 5JIWA 1CY6A 1KARA 4M83A 1SGWA 3MMTA 4I3GA 2OGTA 3STYA 4L80A 5EE1A 3SN4A 4PHFA 4B7XA 2AX4A 5KBYA 1H4QA 1JJAA 1FF9A 3B70A 2A3CA 3DOPA 4YGYA 2CZVA 3BMNB 1H2RS 4JJEA 5H8UA 2ZAGA 1BFKA 3PRHA 3AEUB 1V1RB 3N9SA 5KTTA 3GJZA 4XVHA 4K36A 2Z2XA 4LYKA 2F1RA 1V3LA 4EK9A 1NQWA 3G1AA 4K8HA 3L8DA 2A59A 3IKJA 4Q0MA 1VTKA 1YBMA 4MO2A 4ZMSA 2WNHA 3MRVA 2OLSA 4E2YA 1U80A 1DX9A 4AS1A 1PV4A 2P3LA 5BOSA 4P4LA 5HIKA 2GBCA 1TAQA 1ORIA 3TVTA 1N5LA 4AYGA 1TKBA 2IUTA 2RGYA 4AVNA 4DS3A 2WBLC 4Z0HO 4FLOA 2H0AA 5JAMA 4IFBA 2GJLA 4EA6A 5C31A 2JFWA 1SBTA 4JWKA 3NHRA 4MROA 1AGXA 3HBNA 4YRSA 5FFMA 5KMGB 4RZ5A 3QZUA 3NQ8A 4C6KA 1SAYA 3PZIA 1KOGA 1R4NA 3RAOA 2GERA 4O15A 1A2OA 3DDSA 4DEFA 2BKXA 1UPCA 5EJ5A 1PZ2A 3QJAA 1YA4A 1EFVA 3F2CA 5CAHA 4PLVA 3Q8XB 1YCHA 3PM6A 1LY1A 3AIKA 2REQA 1R6BX 2D2JA 4IHCA 3OJ0A 2CNNA 2P0OA 4FHEA 1O66A 4GPZA 5LUAA 5ALJA 2B1IA 1V6XA 1VFOA 3H11A 4RVFA 3RVDA 3VR1A 1QR7A 3ORFA 4FSDA 2F6XA 3KVOA 3DC8A 4WECA 3LRPA 3AR2A 5A6MA 3BL5A 4PLWA 2R94A 1GUBA 5KQGA 4BYGA 4ZAYA 5JH1A 3U4AA 2WF8A 4IXTA 3B6IA 2CYGA 1MQQA 1E3XA 1M2KA 1PJ2A 3JQ8B 1QB8A 1SMKA 1A5OC 2HMAA 2FG5A 3PQ5A 1KYWA 2QN3A 4DCNA 4V38A 2DRIA 2C5AA 4B82A 4B0OA 4Z1OA 1T0BA 4GQIA 2RG7A 4NS1A 1MX3A 3L7KA 3QXGA 5J63A 2HX1A 3IAAA 1PTGA 1FJHA 4IX0A 3GRRA 1LTKA 2MR6A 3LY8A 2G5TA 2C9DA 2VDGA 4C20A 4H1VA 4EFLA 3JYQA 1G8KA 1BGVA 5I4CA 2IS2A 1NX6A 3LCRA 3N8GA 4FXOA 1JA1A 1ICQA 1F6WA 3DDWA 1CIJA 4D5EA 3NB0A 1YX1A 3NCTA 4M1QA 3MUEA 4REOA 3C7CB 2QTBA 5JY6A 1BXGA 2ZI7A 4CD4A 2BMBA 4UHEA 1TADA 2XGMA 3W5UA 5EXXA 4FUTA 3ST7A 4EY4A 1CQWA 2XF2A 3KSUA 3H99A 3PWIA 4X6YA 2PTWA 1I7PA 1S9HA 3D0KA 1JLHA 4JYDA 4C6FA 4M1ZA 2GOYA 4MB4A 1KBIA 3PDHA 1Q95A 3VC6A 2AG1A 4K46A 3T9CA 4BO5A 2K5UA 1VFSA 4Q82A 3L0NA 4ZI3A 5COAA 2IDZA 5CGZA 1XBYA 3T5GA 1XXXA 2G1AA 5HNNA 2NZLA 8LDHA 1P8JA 3DZKA 3SLRA 1G8HA 1YKGA 2IU4A 4ENLA 4HX5A 1MSSA 1RRCA 4D9EA 4HT3B 1B31A 5E1OA 2NVDA 4ER5A 1KO8A 3CVWA 1H3NA 1LUCB 3UJFA 3HV0A 1SG0A 5HQLA 2BKUA 3H0KA 2OO3A 2X2FA 1ST2A 5F76A 3RLFA 4FMBB 3PZRA 4AZBA 2EVWX 1NV8A 5DHUA 4L16A 1Z4OA 2R86A 4LCBA 4YJKA 4P31A 3WL1A 2OQYA 1AURA 1XRLA 1SUCA 3I7RA 1NUPA 1KXJA 1CEEA 1QXSA 1IHDA 3UXHA 5ABTA 1YTKA 3RIGA 2LE0A 4R98A 1FEZA 4DUGD 4I5GA 4NMXB 1YC5A 1V11A 5C5CA 1RQRA 5FBLB 4RHUA 4B3DA 5A3VA 1FXWF 3CV1A 4RYLA 1KW1A 2HA0A 4LTNA 2O0TA 5I47A 2I2DA 2P40A 2WLTA 3S2MA 4NG4A 2MT9A 2I2CA 4UASA 1Y5VA 1DRWA 3S5UA 3O7WA 3IIPA 4KR7A 4X94A 2IYYA 4C30A 1H4PA 3GLCA 2CFSA 3TZNA 1Z36A 3GDMA 2P68A 1QFSA 3TQTA 3C43A 5T3YA 4KAJA 1HF3A 4MRMA 5D4YA 2VKQA 3R0VA 4J43A 1YA6A 1KS9A 1YF3A 3SDZA 4I0WB 2P9FA 3FV9A 5AM1A 3PFIA 2VKZG 3QQ0A 3ME3A 3H2AA 1SFSA 3NEJA 5AKQA 2BVWA 1J0YA 4IRMA 3A32A 5E93A 1DWQA 4NE2A 2DPYA 5FBHA 2QCGA 1MFVA 3L4XA 1V7PC 2V5AA 3SCQA 3C8FA 3DFIA 2RH9B 3U3KA 5IJ9A 3F5SA 3NGJA 2E4TA 1PJRA 4ZRDA 5B64A 3WNDA 2CLHB 3UZYA 3RM9A 2RJNA 4XDYA 3N7AA 4ZVNA 3W25A 5IHXA 3OQ6A 4F2GA 3QWAA 2CLDX 1V8PA 1L9KA 2YMQA 3B8DA 3DOCA 2VWGA 2OZTA 1D2EA 1JALA 1CSEE 4OQZA 5TEWA 3VOJA 5HK4A 3HCBA 4P4GA 3DUGA 1XWIA 1MO3A 5LP1A 2LNDA 1CLXA 3ADBA 2Q3JA 3FVRA 3B82A 3X1WA 3ZHVA 5IF9A 3W3ZB 1KXQA 5KNDH 2JCXA 3C97A 5F4SA 4FT4A 4F93B 4JTTA 4JHLA 4D5GA 4A22A 3BWYA 5B1HA 1Q7BA 1ZHHA 2AEJA 3HG7A 2EU8A 2GCOA 2NZ2A 2PA0A 1U9ZA 1ULZA 3B1ZA 2ZADA 5ALHA 5KB3A 2UZ1B 4W5JA 4JEMA 3GKFA 3FYYA 3WK1A 2C58A 3AZRA 4YJ3A 3HYSA 4D0RA 4UCWA 1U2SA 3FSGA 2G25A 5J1TB 5K0FA 1MG5A 2LCIA 3ZJKA 3GT0A 2XKKA 1GL7A 3D8HA 1WUFA 4D0NA 3PHJA 5IXEA 1WHTA 1ZY9A 4KL8S 5AHEA 3BREA 3FVTA 5TVKA 2ZKLA 5AZ1A 1V16A 4L0QA 2DQ4A 3NQAA 4PCSA 3T1VA 4B0PA 3HXMA 1NLFA 1SPQA 3CSSA 4FPSA 3G9QA 4KRUA 4F9GA 3CB3A 1X39A 1E6SM 1WXXA 5G4LA 2HPZA 4NJEA 1RW4A 5CPLA 2H8ZA 2XEXA 1NF8A 2IBSA 3FLAA 4LNUA 2CLKA 1WSBA 1FRVA 1Z2NX 1J24A 1OXVA 4HDKB 1PDYA 4MJMA 1BRLA 3LT2A 4A8TA 3GDWA 2RB5A 1GVOA 4MITA 4C6RA 3ZY5A 3ZEAA 4LDJA 3C6XA 4DJ5X 1B3BA 2H16A 5CJPA 1B1AA 2IYPA 5I23A 4QX6A 1OKKD 2Z3ZA 3A24A 3GZNA 1LCIA 3IP9A 2IEYA 3VZCA 1B16A 1VYVA 1NARA 2PE4A 2GKGA 4Q1AA 3GR4A 2A3NA 1YQTA 1FBAA 2IPOA 5I9LA 1KAOA 2MDTA 4GGBA 5L3SB 4RNIA 4QLBA 5K4ZA 3QFRA 4RLHA 5DY2A 2AWNA 4ERNA 4FZ5A 4JVSB 4OH1A 4QJ4A 1IDN1 2Q3FA 3CE9A 3ZXYA 2PSHA 4UTOA 5EMMA 4XSGA 1KQPA 1OA1A 5AYVA 4QQNA 3UGQA 2WD7B 4BQ3A 2CVHA 3L7LA 3HU2A 3TL3A 2CBIA 1H0IA 4UVDA 5F5LA 3DLTA 2RHOA 2IHNA 3WJAA 2CHEA 2Y62A 4EXBA 4GDFA 1E6KA 1CVRA 2FSIA 1EX6A 3VRHA 3FOAA 3OFSA 1IB0A 3CEPB 3UPTA 1EXMA 1L6GA 1EX7A 2W2LA 3RUAA 1RD5A 4BLVA 3WH5A 3SAZA 3PJTA 1LVUA 1RXWA 3TBKA 5FWXB 3B97A 3RUEA 2PLKA 2YJNA 4E0BA 2C83A 5I4KA 2R0QC 1XZFA 4GSLA 5CYFA 3O92A 5A6AA 4YMTA 3H6KA 2CLSA 4IXHA 5TNVA 4JQSA 2Y7FA 1J5PA 1BWPA 1PIWA 3STWA 3UN1A 2OM6A 5D3ZA 1P80A 4DRXB 1GU1A 3TQQA 2VBIA 1JYVA 2BVTA 1YE8A 3E8MA 3UWKA 3W1MA 4A0FA 5F3DA 1OFUA 4ADSG 1OVMA 1KIAA 1DL5A 5BVHB 1E8DA 3A6FA 3BXFA 4A03A 1ISMA 4W5UA 2VNIA 3VGEA 2FP4B 1T2NA 2FDRA 5JR3A 4YRQA 4E70A 3VNVA 3OLWA 5TVGA 1DJOA 1F3EA 3WGMA 2KMLA 1MO5A 5FUXA 1Z3IX 3UH0A 1M8PA 1JGIA 4K0RA 2NV2B 3DP9A 1LLOA 3MGBA 4HQ6A 3KZPA 3MBFA 4ARIA 2I7GA 1XLAA 4DIBA 4YV2A 1EMDA 1QR6A 1UPMB 2EP8A 3DZDA 1NSJA 3D4BA 4QSFA 4FHAA 4AY8A 4J3SA 1U02A 2YL5A 1QF9A 4R0VA 3O8BA 3NDYA 4LXHA 4IUCS 3U0BA 3DE0X 3LO5A 2FN8A 1TVLA 5AKEA 2XXAA 1UA7A 4IGNA 4OXNA 3QFWA 1JDSA 2Q4TA 4AAJA 1EAYA 1PQUA 1NZJA 4C4ZA 1I45A 1QNQA 5H2ZA 3GH4A 1HTTA 3VNJA 4C6CA 1H23A 4AZTA 3KBSA 3T2QA 1M34A 3IXMA 4LOAA 3HDYA 3LC0A 3I1FA 1UPXA 4ITUA 3C70A 4JI5B 4OP3A 4JXXA 5EUMA 4ZOBA 2XQGA 5KU7A 5H70A 3TTTA 1U3FA 4GBMA 1E96A 1NVWQ 4PRYA 2C29D 4O0QA 2WHJA 4LGYA 5I7RA 3F6RA 1TOAA 4IH9A 2YDQA 1C0EA 3DR3A 4ZEPA 3F5QA 1ZZGA 2QBYA 4Q4PA 3B0UX 2MWMA 4KOAA 4REMA 4UFOA 3VVMA 3DG9A 3R5SA 5A71A 3WBKA 2DMRA 2Y5JA 5ALQA 5BYKA 1JFVA 1SUEA 2ZUMA 2PGWA 4G26A 4RJTA 4AULA 4GH5A 1ISXA 2NZ8A 4EVIA 2NSJA 1JCYA 3AUJA 1RKBA 2QRKA 2ISFA 3VMMA 4H83A 4YP0A 1E56A 4QDXA 3B85A 3SZOA 4CD5A 1B8OA 1KU6A 1WDKA 3BSSA 2ATEA 1T41A 3F3SA 3L46A 1Q1NA 4IKPA 4DRZA 1UBGA 4UFHA 2QQFA 1GOWA 4NJMA 3LOTA 3ENVA 3V8MA 2OCAA 1W17A 4JR5A 3R0IA 1Q4NX 3UAOA 4KGJA 2Z1KA 4DDKA 1GPLA 1AKEA 4NG5A 5CPSA 5BR7A 5JS2A 4D46A 3K70D 4MUZA 3DKJA 1JW9B 1PW5A 4N6FA 4ZXLA 2VF7A 4XB1A 2H2HA 4Y6SA 4YI3A 4JITA 2XCLA 3RIYA 1NVMA 4ZGBA 2EJCA 1P4JA 3A7DA 3X1ZA 5A4JA 1TYDE 4QFMA 3BB4A 5A4MS 3G0OA 2DIEA 1S0UA 4PUEA 5F1UA 4IJ5A 4ZT2A 2IS1A 1R9ZA 5JXGA 3F7NA 2R6CA 4LF6B 1AZWA 1GDDA 2UY2A 1CT9A 1WB5A 3LCVB 4F2UA 5COBA 3CCBA 4OHQA 4E3TA 2NV9A 1BE8A 1PVDA 1UWCA 3H2IA 4EHDA 1HFJA 2ZBRA 4KACA 5D2WA 4FX5A 1TI7A 4YASA 2C0QA 3M4ZA 1XLGA 3QLLA 4HSEA 2H52A 1J8DA 1XYAA 3BQ9A 1ZR2A 1Q3KA 1ULTA 2QU8A 1FTNA 4PA8A 2FPVA 1BW9A 3BXZA 3O21A 2RD2A 4YWIA 2I4MA 4LRQA 4EF5A 1YC2A 1X7XA 3I65A 1IZ8A 3V32A 3ZK7A 1FOEB 1ENOA 5TEVA 3AZSA 4O10A 3CR7A 3H5OA 3DA8A 4L61A 3PICA 4Q7LA 4LFAB 2VP0A 2CCJA 5BNTA 4WXYB 1TUFA 3K9CA 3SZRA 1II0A 3HCAA 4JY8A 5ECDA 1CLKA 2HS8A 1WW3A 4JLDA 1QJCA 1QFZA 2AOUA 1DAMA 2VFEA 1GRQA 4CL0A 1RZRA 3UW3A 4GPBA 2PHZA 3X1MA 3C6QA 1ZJZA 3D2CA 1XELA 5DTIA 1DOHA 4FCVA 2C4TA 2C9ZA 3ARPA 3ORHA 3BQMB 2OGSA 1LOSA 4FNUA 3JAMA 2PNFA 2ONJA 1TQ6A 3TYDA 1R47A 5JVDB 3THYB 2X0FA 3HKCA 3NOEA 4JGBA 2R6FA 4E4TA 1O95A 3S6TA 4UZUA 3R7AA 3C2EA 3QP9A 3IJEB 4M89A 3HGMA 3K9WA 2PUCA 1XNQB 2W4IA 2YIHA 1T13A 3MB8A 3KLPX 3ARTA 1JG9A 3VTRA 5AVNA 3IP6A 4O2AB 3TW9A 5KWJA 3G49A 4QUEA 2OQHA 5GJPA 5K20A 2PH5A 7MDHA 3A4YA 2E4XA 3IJ8A 4ZVVA 3L4YA 1P9OA 2J30A 1HJVA 3OF3A 3D54D 3ZDQA 2E4YA 1XMVA 4C43A 4HLCA 4PUDA 4Q8VA 5BWLA 3G3MA 2FTPA 5C71A 4BLTA 3WL5A 2XIQA 3H9EO 3QLDA 4ASUD 1V5FA 3MEQA 1I0DA 1JDVA 2AL2A 4IXXA 5IDYA 2IK8A 3LCCA 1Y8RA 3HJCA 4TMXA 1NXQA 4F7WA 5B30A 1S3HA 3G6KA 3L40A 1N32B 1RMQA 3N8IA 4NRSA 4AYSA 4MDHA 2NAPA 4CF5A 2VZ0A 3ETGA 4CEXC 4Z7QB 1PR4A 3EIEA 3GI1A 5FIPA 2JHPA 4XR4A 1WOAA 1L5HA 5FJRA 2VYND 2Y1FA 3O0KA 3CB8A 1HJQA 3DMHA 3GGDA 4MVJA 2JLBA 3HWRA 4NDZA 5BUQA 3EBLA 4HGZA 5KAPA 4D6JA 4IHAA 5T8KA 2C9MA 2C31A 1NW9B 1XTPA 4I1YA 4XSHA 1HYBA 3EXIB 3GLHA 4BNVA 1U8TA 2O8CB 2WV9A 4F0RA 1LBQA 4TKMA 4QG8A 2ERXA 5SZKB 4ER0A 4RTNA 5TRTA 5CC3A 4Z2KA 3S7ZA 3KL2A 4OHVA 4RPIA 3DM5A 2BHNA 4KEZA 3NFYA 1QGUB 5C5DA 2QT0A 1G5FA 1LGYA 2B0CA 2VJDA 3BE4A 5DNVA 4ZIRA 3FKSA 4LHEA 3E2PA 3ZU6A 1G8PA 2FMTA 3GLGE 4XD3A 3FETA 4Q8QA 1ZU8A 3N2EA 1LSOA 2O7SA 4EI7A 1N9KA 4AKIA 3O0TA 5FESA 3LTNC 1CPUA 3W26A 1M01A 2W6ID 2C71A 3NX4A 3L8HA 3GJ6A 4D42A 4O54A 2PAFA 5F3RA 4YT2A 4PZDA 4QGGA 2JAXA 3VD9A 5K0ZA 2YJTD 3T38A 3BDAA 4I6EA 1DCKA 3RASA 2DZDA 2YWHA 1E5JA 3GRUA 3AF6A 1H94A 2Z6QA 3AW8A 1CRZA 4MQEA 2WPGA 4XZ9A 1KVTA 2OEKA 2GM4A 1IRIA 4M81A 3KOZA 2N46A 5CJ2A 1XF0A 4PQGA 1VI5A 4O1DA 5L40A 1AKQA 4D6XA 3WIEA 2J27A 3PZOA 1J93A 3L8CA 1XMSA 3L0ZA 2EAWA 3AXKA 4RE3A 5IXSA 1JEEA 4MKZA 1SB9A 3M6YA 3LK7A 3UWQA 4S3FA 4GH1A 4MMWA 1XNJA 1E3DA 4QSHA 2W2KB 4KE7A 1CIVA 1A82A 1SCNE 2H2AA 3HGTA 3VV2A 2XZTA 1HMYA 3RVSA 3DTTA 4FAMA 3ENNA 1WNTA 4XYGA 2W42A 2GI4A 2JIRA 3EKZA 2Z25A 3THCA 1O96B 1UZMA 3IJRA 3N3AC 4MKFA 4JVNA 2DW6A 1MZPA 1OV4A 1Z2OX 4QR6A 1EINA 4O19A 3SM0A 1E1QD 3LFTA 4G8DA 3H42B 1REQB 1CLVA 3L0CA 2W6ZA 2V3VA 2IHTA 4PUJA 1Y8BA 1UDWA 3SCOA 3EIWA 3M9LA 4YCCA 4GKBA 2RE8A 4H4CA 1K8QA 4OA5A 4XFKA 4QXRA 3OWOA 3MJEA 4EW2A 2CHFA 4FFOA 2Z4SA 3ORSA 2H5EA 5KI6A 1OFUX 1SC9A 3IJ6A 3DAFA 4MUIA 1TJPA 3JQ7A 4HY3A 2B20A 3OCXA 1ZIDA 1VIMA 1E2KA 4LDRA 3IVMA 2P3OA 4XTRA 4F4JA 5CGQB 4WINA 3TH5A 2P2SA 4AJ1A 4JJFA 5GZ1A 4R2MA 1C41A 4R8KA 3CUWA 5H16A 5FTKA 5CLGA 1SZFA 3BGGA 1FFRA 4JHMA 3GPIA 2NUXA 3VIOA 3U4DA 1YNSA 1TT5B 3D2LA 3WHPA 1Y6QA 3R2GA 3E02A 3UJ2A 5A0VA 3ZBUA 1C3VA 4CIAA 4D8ZA 3NM1A 1CEOA 3OLCX 1DX4A 1J9YA 3CTMA 4OL0A 4OKNA 2CNDA 2Y5EA 1JXOA 1G63A 1GHTA 2EWMA 2DJIA 3S1WA 1FS5A 3D9QX 3F1QA 3F1LA 5AWFC 1EDQA 3QZAA 3LECA 1EF2A 1MV5A 5FI5A 1DKPA 1KO1A 4KO8A 1Y4UA 2VHZA 2NYAA 1HFKA 3W24A 1KP2A 3E5MA 4OIMA 3WYCA 1OILA 1DC8A 3VDXA 4XA8A 4KCGA 1VP5A 1F07A 1E3JA 2ZWOA 5CFMA 3DHFA 2PDWA 4CLMA 3GQYA 3C6CA 4UHKA 3L8YA 1GKPA 2MCFA 4GXQA 3TYZA 2JCGA 1NBEA 3OFVA 3LHFA 4DILA 1UUOA 1AQYA 2FPOA 4PYOA 1CY7A 5LOVF 3W23A 4MB0A 8AT1A 4QOIA 2PWVA 5A1JA 4IHKA 2JG3A 4H1HA 4Q39A 2WUEA 3H1AA 1AD4A 1PX4A 2GOUA 1KTCA 4OH7A 3L0BA 4UTWA 2VXYA 5I7GA 3LNCA 4FZVA 3OQ1A 3KWXA 3VUSA 4OMCA 1KVQA 5ER9A 2NVUB 4WOQA 4ZZ1A 1R38A 4HNOA 1E4IA 4P08A 1YZKA 1QX3A 3PNLA 3FUWA 4RD2A 2YWFA 2JLWA 1B30A 1YQWA 3WL6A 1GOQA 3BWCA 3PEUA 1J00A 3I2IA 4WD3A 1IXYA 1KZ7B 4FMVA 1XYBA 1YAJA 2FZ4A 3O9VA 2P7HA 2Z1BA 2CXXA 4AI6A 1RFLA 4QLAA 1J49A 2P4EA 1CEYA 3VHXB 1YXDA 1SUFA 1N3LA 2C8LA 4IIJF 2HL6A 4HBZA 5A3SA 3QH2A 2CUTA 4MYUA 4QOEA 4LJ7A 3HH8A 3QQWA 1D5CA 2YFQA 4ERXA 2P79A 3PA8A 3E0FA 3MUNA 4Q3NA 3M0VA 4K9RA 5EZYA 1GJWA 2I33A 3KEQA 5CVJA 4I81A 2CBGA 4KQ9A 5TMPA 5ALEA 1Q6CA 1XUOA 1SU4A 1NY5A 1V35A 2ZYGA 3WFIA 3LBFA 1TDJA 4AKGA 3U7JA 3W7AA 2HWGA 2F17A 4AWEA 4GMDA 1D6NA 5DGHA 2A2ZA 2QZPA 3MM4A 5AC5A 4BI7A 4RXTA 5JCXA 3M7WA 2CWNA 4ZV7A 1V03A 2BEVB 3RKUA 3GBPA 4GWGA 4F91B 4MNMA 1ESEA 2UWFA 4EHKA 4UXJA 1Y65A 4BKPA 4JP3A 1JJKA 3S1GA 1UAGA 1FP9A 1Q0LA 1TV3A 5DLCA 4C0JA 2XB4A 3O4JA 6CGTA 5KDOA 5P8WA 3F96A 1L6SA 3VMPA 2F8TA 2C91A 2YCKX 3H9BA 3QVSA 3UFYA 4HOXA 5CJNA 2Q4RA 4PLHA 1GG5A 2W2XA 4JENA 3OVRA 2BV9A 2P6MA 3QE9Y 4EBBA 1V47A 2VWPA 3IIEA 5CB4B 3QIAA 2CNBA 3KB2A 1DE6A 5FD8A 2B1RA 2PO5A 1P2DA 1NFFA 1S5MA 3WC4A 4WIAA 4L8WB 3O4IA 2QLNA 3THWB 3Q6NA 3ZTWA 1BDJA 1HL7A 3NJ3A 1MAVA 2D5LA 2I2XB 4ZB0A 5M04A 2W6CX 3U61B 3ANSA 3D7NA 4HBGA 1FUIA 2XNHA 4CDGA 1APBA 3IUNA 1FTXA 4WJXA 1A7JA 1M7OA 3KDNA 2R24A 1TF5A 1I8JA 6XIAA 4L1KA 1IM5A 3U19A 3VH1A 3O84A 4HEA6 5JIPA 4LE1A 1Z6ZA 2XHZA 4IRXA 1YJ8A 3DPSA 4QDTA 1SZCA 2PKEA 4IGHA 3EPPA 3H05A 3MFYA 4W89A 1COZA 4KH1A 4R6XA 2Y8VA 3OPQA 1E9VA 1XLDA 1RA0A 4UTUA 2BF7A 3VKFA 2VFAA 2CKRA 4TV8F 4GKTA 5EZ6B 2W71A 3EEQA 2VH2A 2CE2X 2C4KA 4ICCX 2XUZA 2QLYA 4RESA 4LV8B 1UPFA 1HT2E 3QJGA 1TO3A 2ZEJA 2V3GA 2HZ7A 3NSNA 5FWYB 1BDIA 3WNCA 3BEDA 5IDXA 1QLHA 2AW3A 2C7PA 3GGGA 5J5RA 2D5BA 2O6LA 3I72A 4N40A 4UHHA 4OOUA 4JC8A 5D7BA 2P2ZA 4L9AA 5LD2B 2BFGA 3AXIA 3WK9A 4WCVA 4M8NE 5CBPA 3WKDA 5H3HA 3DLHA 3E9ZA 1P7TA 2YB1A 3UR2A 4OXKA 1PQPA 1U7TA 3DLPX 2QGFA 2TPSA 2JLXA 3WK7A 1V6UA 1CTNA 4MGHA 5C2GA 3OT1B 3H2EA 3CO4A 4AX4A 4KSYA 2ONZA 3OEHA 4N3CA 3VC3A 2XZDA 1ESNA 2R5FA 1TL7C 3PZBA 3GVHA 2JIDA 2P77A 1W5AA 4DO5A 2AMJA 3WBXA 1LVGA 4BNZA 2FZCA 1JQDA 1GQNA 3ER9A 3TE9A 3I32A 4KQ2A 4B3RB 1GPWA 4YVPA 3VC2A 2HD4A 1MJHA 1DIRA 2QVYX 2YX1A 3B13B 3ZV3A 4WJ8A 3ZE1B 1KCZA 2BGNE 2ZSJA 4NNCA 3F4LA 4YCPA 4TLBA 3CWNA 4CIBA 2WJDA 1J5EB 2HVMA 2BVYA 3PXDA 1VCMA 3MA8A 2O57A 3T35A 2XVKA 1HJUA 1P0DA 1TRHA 1JWLA 4H6EA 5K8LA 4GUIA 5JFOA 4FYJA 2YDRA 3WF4A 4J3FA 4QYSA 2A84A 1W5OA 2B81A 1J0XO 3CZLA 3BOXA 4WFKA 4BRSA 4I4TA 1ORDA 4JLPA 5J3JA 4AZ0A 1WXQA 1LRLA 2H3BA 2W93A 2Z30A 5EIBC 3SBEA 1TMOA 2WMNB 2I1WA 3DFHA 2QZZA 4ZYUA 1D5WA 4AIIA 5HK8A 1KKMA 3W2UA 3A22A 3EEZA 4BEUA 2HA5A 2VZ8A 4G0MA 3EC1A 3OBIA 2Z1SA 2VT0A 5JZOA 5FEMA 1MA3A 1U6IA 4B40A 4JCOA 2QT9A 1L2QA 3OW1A 4JAWA 2WIKA 1SQ5A 4MLDA 4HPHA 3KSZO 2UVQA 4ZCIA 3EDKA 1RQXA 1EHAA 3FNIA 5BXQC 1CGVA 2C7OA 2V6JA 1JZ2A 1K0FA 4FNQA 2ADOA 2GDZA 1DL3A 3AL2A 4CQLA 4CQNA 3PPHA 4WCFB 4PLTA 2A78A 2DUAA 5AJZA 1DWPA 3PG5A 4NNAA 2QVCA 1PWMA 1X8LA 4NZ1A 2CZDA 3QH4A 4AX8A 4EW3A 5G1MA 4E2BA 5TE9A 5JBDA 2B0JA 1ZEJA 4G37A 2YWBA 1GJRA 1UBSB 1QHZA 5K4XA 2JEPA 4EKDA 3MOIA 3C3BA 4B35A 3SADA 4EPDC 1ILWA 2VBFA 1U6KA 4AKHA 3LT4A 1JF8A 4HVCA 2H5JA 2C7FA 4JTKA 4X63A 4IUOA 3STEA 3DVAB 3AUTA 1J8MF 3DB2A 2KI5A 2WK1A 3FIGA 3WJWA 3RYHA 1OB5A 3AW9A 4KQEA 4KIRA 4UQ9A 1S2AA 3UKJA 1ONNA 3WJXA 2FDXA 1YS4A 2UAGA 3KTAA 3CJRA 3DYVA 2JKVA 2EW1A 1BN7A 3EXFB 3PZMA 3URBA 1IE3A 2Z1NA 4GF5A 1E71M 1NW7A 2ZRPA 1QOPB 1VBNA 3ZBQA 2AQIA 2H54A 4W85A 1SG6A 5A7FA 1KA9H 2OHXA 2OSYA 1AU9A 2YYZA 1E0AA 1YZGA 3H26A 3KJIA 4CW7A 3VIIA 1THGA 1WW8A 4HS4A 2L19A 4EG5A 1MNSA 1B93A 1IHOA 4YV7A 4QJ5A 4GFDA 3TNYA 1JZTA 3LE8A 1WDPA 1N7KA 2N75A 3CF2A 3DYMA 4KGVA 4EY3A 5HZMA 1N2EA 2YYAA 1K7EA 4MAMA 3POCA 1G6HA 4G7FA 5IAAA 1T8WA 2PMFA 4M9QA 5JI3E 4BNLA 2OGWA 2OX4A 4FGWA 2C5HA 2QYTA 4UCXA 3Q9LA 221PA 3UJNA 2OCBA 2FFRA 4BFAA 5GONA 2O2CA 4C6HA 2RDTA 1EX9A 5K8JB 4R7ZA 3JWIA 4Y2HA 4J27A 4MOZA 4ZENA 3BHNA 1R2QA 2FV8A 4Z17A 4DYKA 4MW5A 3M2TA 1I7LA 3KTDA 4IGEA 2XYHA 2W22A 3IS3A 3WD1A 1XFCA 1S2WA 3N73A 5A9TA 4H3HB 1NP3A 2ERCA 2OWDA 4O57A 4Q4KA 4M88A 1YMYA 4OQDA 1JQXA 3E2SA 3W5CA 3AI3A 5AECA 1JIVA 4I55F 3GRFA 4F2PA 4AY3A 3V1HA 2O8EB 4B5XA 1JPIA 3TPCA 3PJRA 1KEUA 1AHNA 3Q3EA 3B8VA 4AUBA 1HJWA 2IHUA 4HU0A 4PO1A 4K2AA 3EBOA 3KXPA 4CFYA 1HIZA 4EPTA 5GGXA 1BD0A 3L0DA 1E2IA 2XCIA 1VZ2A 1EU1A 2HE8A 3RLUA 1XCFA 3MW8A 2WVSA 4EXAA 4QU0A 1KC3A 3MWYW 3HLKA 1K70A 4AY2A 3FWHA 4B3TB 4IQLA 3OWHA 3PQ6A 2BBSA 2VAPA 1PVOA 2Q3DA 1Y8CA 5KX5F 3EC7A 2QSYA 2XUHA 5EIEA 3RX3A 1GQOA 3PR2B 3ZDCA 4YCDA 2CU0A 1R87A 1NWSA 1S5WA 2I1OA 4LJ6A 3RR2A 1P1BA 1YJQA 1G8YA 2V59A 1KM4A 1P43A 1IG0A 2UUCB 2FMNA 1KEEA 4WWHA 4J2TA 3GC2A 5DX1A 3A36A 3PS9A 4LE0A 3HVHA 2UY3A 1A4UA 3R9WA 1L9XA 3LA6A 1FVPA 3RT1A 4W8GA 1O1ZA 3L8EA 4UUOA 2ATSA 3P62A 1KIMA 1LF1A 3D1JA 5MFZA 3IUIA 4H7IA 2O19A 2VP4A 1A53A 3HN2A 1I2BA 4H9ZA 1SYTA 2VFGA 4I19A 4DNFA 1TPYA 1S8OA 4AZCB 3BD6A 3EZFA 3EG9B 3OJGA 5AQ1A 1E0WA 3F3KA 2PJUA 3MPUA 2V68A 1ZOSA 2R7MA 3P5SA 4IMFA 2GOKA 4TL6A 1TR9A 3EUWA 2HA2A 3T4WA 3IJPA 1JBQA 4RH1A 5K45A 4KYIB 4TXMA 1BDHA 3UJCA 1IN8A 4L8YA 3WNOA 3IILA 4FMCB 3UB3A 3AJEA 1NI5A 1QYVA 2HCJB 4Q66C 3FBWA 3RTBA 3KKLA 3C0SA 3T7VA 4TUYA 2G3JA 4O2RA 2XWPA 3EOOA 4H9UA 1Y3CE 1QONA 1KK1A 3FFBA 3ZHRA 3GFPA 5SICE 4GWKA 5F1PA 3FWNA 3GFRA 4GP7A 4PYNA 2OAEA 3GNPA 4NFYA 4LVOA 2K7FA 1TZBA 3NHFA 4IJRA 3WELA 2WHRA 4ZZ9A 3TUJC 1N4AA 1SR8A 2PGLA 1TYCA 3L4WA 5MHTA 3A1FA 3Q7IA 2F8LA 3E81A 4Y1RB 3USBA 3Q3GE 5TQ2A 2C4NA 4DR4B 4MARA 2Z2BA 3UQYS 4G1KA 3GLGB 4GUGA 1IHXA 2HBYA 1VHWA 1WG8A 3HFRA 1Q20A 3VFDA 3UKDA 3V8BA 2XKAA 3A1SA 2JIEA 1D4OA 3DMPA 1F8FA 4TLLB 2FQWA 4IIEA 1I6LA 5I5RA 2QN8A 3PPYA 4O4IF 1UT5A 4HGXA 5B58T 5DO8A 1XD1A 4RE5A 4OHUA 1QGOA 2QTNA 3T3OA 3FVQA 3AUSA 2C2ZA 4F72A 2EF1A 4QE1A 4IFOA 2BMWA 1DKRA 4TRMA 3FNEA 2QIIA 3R3HA 2FZKA 1T99A 4YACA 1EUCA 3WRWA 3RFCA 1LBTA 1B0AA 3QEAZ 2JGIA 3ED5A 4CR6A 5AXBA 1BXKA 5JYEA 2FPIA 4EJSA 1K3FA 5TARA 4ALNA 1QFXA 1V1MB 1DIKA 4I7WA 4RPHA 2ZAOA 4CD8A 3W7LA 2EHDA 1DO2A 1G2QA 3E1SA 2BYTA 1R66A 4LF4B 4U8HA 2BFEA 2ZOXA 5FUYA 3D3NA 5BO5A 3IE1A 4DLWA 4Z1MD 5A2GA 5EE3A 2HLDA 2FRDA 4RHFA 3ICCA 1SCKA 1ZUIA 3VR3A 1I30A 4BB9A 4ZAZA 3FUTA 4RSRA 3ZJUA 4O4LF 1RBMA 4CTNA 1C8XA 3L2OB 1YDOA 2RAGA 3QPAA 5A5VA 3EFEA 1TVPA 1ZW1A 3HCPA 4G1NA 4KERA 1LH0A 4HAUA 4GYFA 5CW2A 1UD5A 2F6KA 3GRVA 3K9FC 2DFTA 3MUFA 1ZGZA 2FRXA 3SN0A 1L8OA 3MJHA 1V3TA 4JP5A 2QZ4A 4OECA 2O7NA 1S1RA 1EJ2A 3JR2A 1XZDA 2EKQA 2WTNA 1WPRA 1WVGA 3ZIAD 4ZC1A 2UXDB 1A04A 2X8BA 4Q7JB 2GO1A 3PGLA 5DGIA 2BSXA 4KN9S 4PHHA 1WLYA 4PO8A 1KFBA 1PSZA 4LCRA 3UGRA 4U31A 4WLNA 1C4XA 3T1NA 3SGGA 3FTQA 3HKEA 1LPPA 3RVQA 2F3PA 5LYJB 4QUKA 2Y1XA 2F2TA 2PJZA 2VYVA 2JFQA 4Q3OA 3ZGLA 1C3OB 1F4PA 2Q3HA 1CUDA 1IXPA 5FWAA 5B7GA 4GZLA 4BFVA 2QUVA 2OV3A 2PY6A 1PHWA 3WH8A 4C6IA 2GF2A 4P3NA 1OH7A 1W5NA 1E2QA 5F4XA 1L3IA 5EQJB 1ZH2A 3B7WA 1GZ3A 4CI0B 2X5KO 2XMQA 3B3AA 5GZ6A 1UBNA 4FHZA 3Q7RA 4MKVA 3B1KA 3MY9A 3LUDA 4HMNA 1BVNP 4FOPA 5LNK6 1BA2A 3HYLA 1P39A 4EP8C 1ZMXA 3W1XA 4BFWA 2GD2A 4KQNA 1O6GA 1Z5ZA 1GL6A 3X2FA 1POXA 4TU1A 4X20B 3VDRA 2FWRA 3SIWA 3KU4A 4B47A 3KFLA 3LL7A 1X7WB 1QF7A 2CW5A 5B55A 2BGGA 1EUDA 5HILA 4Y18A 5A1TA 3K8ZA 5BMVB 1K6JA 1E61A 3VZSA 1EHNA 4OA8A 2IIQA 3KU1A 3NS7A 5JNWA 3N29A 5BYWA 1RK6A 4EG7A 3EHEA 3L8FA 4DR2B 2PBRA 1ZHFA 4PCFA 2I7XA 1C4WA 2PDUA 1DLIA 2CHGA 4DNHA 5LP6B 3RRAA 2IOYA 1T6NA 2FJUA 1VLMA 1K66A 4WKPA 3H3FA 4IIHA 3RV3A 2A0KA 4ZYLA 2A88A 1QBAA 5CLQA 3CF6R 3W3AH 4QO7A 1A5BA 2WY2D 4C1NB 1FWHC 1P1RA 3DI0A 2JFZA 3B52X 4G25A 2VJMB 1KXVA 3G7SA 2NXJA 3WL0A 3RC3A 3IOCA 4WXMA 1N3IA 1UDRA 2GZ2A 1ZH6A 2O8DB 3KPWA 1US0A 5HQTA 4LVGA 4BN5A 2IP2A 3QU7A 4CUJA 1T1RA 1E72M 3P5BA 4BFTA 5C4GB 1TPB1