4XVEA

17beta-hsd5 in complex with 3-pentyl-2-[(pyridin-2-ylmethyl)sulfanyl]-7-(pyrrolidin-1-ylcarbonyl)quinazolin-4(3h)-one
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 117
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xveA00
4LAUA 5KETA 3CMFA 4JIRA 3WBYA 1SM9A 1PZ0A 4XZIA 3G1RA 1ZGDA 1PYFA 4OTKA 4XZMX 5LIYX 4XVEA 4JTAA 2PDUA 3N6QA 2WZMA 3EB3A 3ONBA 3LQGA 4GABA 2I17A 1T41A 1K8CA 3LZ3A 2IPJA 1Z8AA 4XVDA 1HW6A 2ACQA 4GQGA 4YVPA 1RALA 1GVEA 2PF8A 1S1RA 4DBSA 2HDJA 3G5EA 4PUUA 4PUWA 3VXGA 1XJBA 4DZ5A 4LAZA 3UZXA 1FRBA 4YS1A 4JQAA 1AZ2A 4GQ0A 1Z89A 4AUBA 5LIWX 2INEA 2ALRA 1S1PA 2PDGA 4Q3MA 4FALA 2IPWA 2IKHA 2PDMA 3CASA 3UYIA 5AZ1A 3RX4A 1X96A 3COTA 2R9RA 2IPGA 2FGBA 2PDJA 4GIEA 2HE5A 2PD9A 2F2KA 2PD5A 3CV6A 2FZ9A 1YE6A 2FVLA 3LN3A 1XGDA 4JQ1A 1EKOA 4WEVX 1A80A 4JQ2A 1ADSA 2ACSA 1XF0A 4R9OA 3ERPA 4EXBA 2DV0A 1C9WA 3UWEA 4JTDA 1EXBA 4HMNA 4PR4A 4IGSA 4PRTA 1EL3A 2HVOA 4G5DA 4LB4A 3BUVA 3RX3A 1YNPA 3MB9A 3LBOA 4H8NA 1HQTA 3QKZA 2A79A 1X97A 3LUTA 5LIUX 2IQDA 3UZZA 3UG8A 4H7CA 1MZRA 4JQ3A 5JH2A 3LZ5A 1J96A 1QWKA 1LQAA 3UZWA 2C91A 4WDUA 4JTCA 2QXWA 3BURA 2ACUA 1US0A 1RY0A 4QXIA 1Z9AA 2WZTA 3V36A 2IKGA 1YNQA 3CV7A 3CAVA 4ASTA 2ACRA 3KRBA 2FZBA 2IS7A 4LBRA 4WDWA 2PZNA 1OG6A 3H7UA 3M64A 3NTYA 1Q13A 1R38A 4ICCX 2J8TA 3P2VA 3LENA 4PMJA 3UFYA 2DUZA 4QX4A 3R94A 1VP5A 4JIIX 1LWIA 3H4GA 4ZFCA 3D3FA 2PDHA 1MI3A 1IHIA 4IJCA 1ZQ5A 4XO7A 2INZA 4PRRA 2FZ8A 3UGRA 2P5NA 4JTQA 3O0KA 1S2AA 3FX4A 3S3GA 3EB4A 1Q5MA 3R58A 4EXAA 3LD5A 3R43A 3GHSA 4YVXA 1AH4A 1RY8A 4JTRA 3C3UA 4WGHA 2PDLA 4FZIA 1ZSXA 1ZUAX 4DBWA 3V0SA 3V35A 4GACA 3M4HA 1S2CA 2F38A 4DBUA 3MC5A 3R8HA 4NKCA 3U2CA 1AZ1A 1Z3NA 4LBSA 4YVVA 4YU1A 5LIXX 3CAQA 1EF3A 5C7HA 4XO6A 1T40A 3BV7A 4FA3A 1M9HA 5DANA 2NVDA 4XZNX 2I16A 3Q65A 5AZ0A 2AGTA 4L1XA 4WDXA 3LQLA 3GHRA 3N2TA 4IJRA 3DN5A 1PZ1A 4MHBA 4QBXA 3R7MA 4JQ4A 2PDXA 1AH0A 1IEIA 2PDQA 3GHTA 3UP8A 3WBXA 4JIHA 3H7RA 1PWLA 2VDGA 3GUGA 3V0TA 2R24A 4XZHA 2FZDA 2HEJA 2HVNA 1QRQA 5HA7A 1PWMA 4LB3A 3Q67A 3LNMA 3FJNA 1YE4A 1MRQA 3WCZA 4XZLX 3B3DA 1UR3M 3V0UA 3R8GA 2IPFA 2CLPA 2HE8A 2IQ0A 3M0IA 3O3RA 3ONCA 2NVCA 3EAUA 3F7JA 5LIKX 2BGQA 2PEVA 4XAPA 2BGSA 2IKIA 4RPQA 3DOPA 3WBWA 2PDIA 4WRHA 2IKJA 2ISFA 3T42A 4FAMA 2PDYA 2BP1A 1JEZA 2PDPA 1X98A 3UZYA 5HNTA 3GHUA 4XK2A 4WDTA 4I5XA 2PDBA 4GCAA 4HBKA 2PDFA 3RX2A 2PDKA 1AH3A 2PDNA 4L1WA 5HNUA 5M2FX 2PFHA 3WG6A 4F40A 4Q7BA 2PDWA 3BCJA 1VBJA 2PDCA 4QR6A 2DUXA 3R6IA 4GA8A 3LEPA 1AFSA 2HV5A 5JH1A
chains in the Genus database with same CATH superfamily
3BLKA 1DJQA 1QO2A 1EJWC 1RA0A 3GIPA 1LLWA 3ALFA 1VFSA 4G7EB 3C0JA 3C8FA 4OTKA 1IZCA 3MO7A 4HHHA 3IK2A 4HZ7A 4UQAA 4M1BA 1SW7A 3F2DA 3AOFA 4S3GA 5C2XA 2PUZA 4MWAA 1OEPA 3VILA 2V30A 3NAVA 3ARPA 4IL0A 4M3PA 3P0XA 3VD3A 4GABA 3E0LA 4O15A 4A8LA 2D2JA 4P8XA 5D2VA 3IIZA 2Z2UA 3O6DA 2HQAA 4WZHA 2PP1A 3O16A 1GZJA 3URQA 3G5EA 1DOSA 1TREA 4JTEA 2ISDA 3B8SA 5AB3A 1UWSA 2VP8A 4GH3A 4XIMA 2YCLA 4HK5A 3AISA 5FACA 5A2BA 2J66A 1A3XA 5J8LA 2J9XA 3JZEA 1TUXA 5I23A 1WZAA 4XTDA 4P5UA 3GXMA 2WNZA 3AIWA 3HOJA 3C2OA 2KAUC 4O4VA 2XTKA 4LUYA 3WLOA 2QCHA 2BBFA 1K7EA 3UR7A 4J2PA 3C52A 1BWKA 1XR2A 2A6LA 4Y9MA 3BMVA 4O1CA 3WUBA 2I56A 3N12A 3OYZA 4IOTA 3C6CA 1M6JA 1S5MA 4Y90A 3TZFA 4EAMA 1SFSA 1EO5A 1KM4A 2XVLA 3CJPA 3GDMA 3SRFA 3FA3A 2DV0A 3WUEA 3NSXA 4BI6A 3DESA 2GGJA 4A3HA 3PK7A 3NO3A 3HO8A 2D24A 4IPNB 1TV8A 1E70M 3FNDA 4KRUA 1DJXA 1DVJA 1W5MA 4DJEC 2BVYA 4UNKA 4S3CA 1YPXA 3LS9A 3KEHA 5DY2A 4ALDA 2WMIA 3NZ1A 5CJ5A 3DFPA 1UH3A 3UG8A 1VKFA 3MANA 3T4CA 3LI1A 3NDYA 1R0MA 4ZE4A 5KZ6A 3PWAA 1XKYA 1J0KA 3WF4A 4MY1A 1Q6EA 2VGIA 4TX9A 1KR0A 2FB2A 1KBIA 3THAA 3A4AA 1RY0A 1WAWA 4R53A 2X7VA 3CK5A 3M46A 2AQOA 3M07A 1LJYA 3GVWA 5TD4A 1RJRA 2ACRA 2YCJA 3VIMA 3WNOA 3B9OA 4F48A 4WDWA 3SZ8A 5A6SA 3WLRA 4R34A 1XBZA 1RP9A 3DUGA 3N9RA 5EY5A 2VGBA 1E1EA 2QDHA 4JDBA 3W7PA 5EMLA 3MYOA 1XC4A 3N3MA 4B2DA 4UFLA 1CPUA 1V8EA 3MKVA 5EL1A 3ZIZA 4PC8A 4PBEA 3H4GA 1W31A 1QXLA 4R3UA 2I5QA 1RHCA 3AJXA 3TYCA 4F8XA 4XO7A 4TVUA 1CT5A 1FXPA 2P76A 3WD4A 2P5NA 2QF8A 4LRTA 1GWJA 1ZJIA 3R58A 3R43A 3SN0A 1EEPA 4JTGA 2V2DA 4OT7A 2G97A 2XN1A 1QHPA 1XV8A 1KRMA 4CEXC 4R33A 3KW3A 4CD7A 1TO3A 2NXHA 2YXOA 1DWHM 1W91A 3LLFA 1ZUAX 4JYFA 4O8AA 3EDKA 4O13A 1XIEA 1OFDA 2X1IA 3S5NA 4WF7A 3DFHA 4FPSA 5F1VA 5I3GA 4DBUA 1YBQB 3SGUA 3CIVA 5ECUA 4HHPA 1V03A 1DWAM 3QN3A 1AZ1A 4YU1A 4GI6A 3W84A 7A3HA 1YXDA 4JFSA 4MWAE 1EJ7L 5HWJA 4GNJA 4CN4A 1DIKA 5LNVA 1FWRA 3AHYA 1EJVC 4G8TA 3TSMA 3TJ4A 3LCXA 5XIAA 3KTXA 1PZ2A 1FWNA 1YYAA 4X2RA 1B4KA 2NVAA 5LA2A 1H7XA 3CAKA 3GZAA 5AYZA 4E3TA 1B31A 4WDXA 3LQLA 4LVBA 1ZJBA 4PEEA 3OIHA 1LLZA 2D73A 2PDXA 4KCWA 3O9NA 1LDCA 3CTTA 4AC1X 1R5YA 4DWDA 1EFZA 1NM9A 5DO8A 3SJ3A 3UD6A 1EPVA 2W66A 2A2IA 5MKGA 1RK6A 4MDPA 3R11A 2HEJA 1SVDA 4GKLA 4IIEA 3NVDA 3D0CA 5E0KA 4UTWA 4O52A 4RR4A 3CUJA 3L23A 4XUGA 2G8ZA 1R2SA 3W24A 1UMLA 2GQ9A 3B3DA 4M19A 3R8GA 3O6AA 2NVCA 1PKLA 1X7IA 4HCLA 3AALA 3NFUA 4HYRA 2E0PA 2ZRZA 1PTAA 1UR4A 1AW5A 3CWNA 4TMBA 3T0AA 1ZP4A 1B9ZA 4A3YA 4ZCWA 1TB3A 4D1JA 4NL1A 4I9JA 4LUTA 1FWEC 5CBBA 2P53A 5C9UA 3WNKA 3CB8A 1K8ZA 2E5DA 1UD6A 3QHNA 2X8RA 2PDFA 4LC6A 4JKKA 3INPA 3MPGA 4HNCA 3C56A 4L65A 4RV8A 3UU0A 3BCJA 3DYOA 4GD0A 3KBWA 3NSMA 2XVNA 3E3HA 4Q6XA 2HBVA 2D0GA 2C14A 2RKXA 1B0IA 2DT3A 1RQEA 3GXDA 2JALA 3F2BA 3IRDA 2XIOA 3RRXA 1OINA 3WQWA 1DHPA 1ZALA 2AMGA 3GC5A 1HKKA 5GNYA 1DIOA 2ZZ1A 3UBPC 1NFBA 4YXGA 3M9YA 1PZ0A 4O12A 3PBMA 2P1FA 1RV8A 1H49A 3EB3A 4OBTA 2HWGA 3LB0A 1H7WA 4UOZA 5DF0A 3UNDA 3L5MA 5LA0A 5DMNA 1XKJA 4IJBA 2OVLA 1BF2A 2C3ZA 1FWBC 2DZAA 4PL1A 1LM1A 4TXEA 1XW8A 1R3WA 1VPXA 1J12A 2O9OA 1MVYA 3VGHA 4H9VA 1TMLA 1UH4A 3WMCA 4LAKA 2WVVA 2ZZ6A 3FA5A 4IG2A 4HTBA 4A8RA 3GNXA 4N4PA 3TLLA 3DYPA 4PUUA 4EAYA 4DZ5A 3GWQA 3LRMA 5I3DA 4TVDA 4YS1A 1HFBA 1KWGA 3W7MA 2DZBA 3HG4A 3IJ8A 3HGOA 4E2VA 1B30A 3ZSSA 3VE9A 4RLIA 1IE7C 2X41A 3VD9A 1EP1A 3L65A 4WSHA 1J11A 1J4EA 5AHFA 2E5BA 5BW6A 3HV8A 2Y61A 4R5EA 4JX4A 2OODA 1DQXA 3CQJA 2JIWA 3VX0A 4X63A 4CNOA 4G1NA 1UPPA 2FVLA 2P0OA 4OBSA 2NQJA 3S5SA 4E2OA 1DJZA 3LERA 4WUIA 1A80A 3UCCA 4GJ1A 3WQDA 4TU1A 1EQPA 1U33A 4HN4A 3O07A 4MB4A 4QJ5B 1HP5A 3ITYA 3KS5A 4EXBA 3RF9A 2PWVA 4RZ5A 1HF6A 4EVZA 2CERA 5AVHA 3FJ6A 4O16A 1EXBA 2O9RA 4PR4A 3KBSA 5FEPA 4GCXA 3RITA 3NO1A 2HVOA 4G5DA 1XINA 2YGYA 1OGBA 1YNPA 4DVOA 3Q37A 1FWHC 1IEQA 3LBOA 4FOUA 3CWHA 1CZ1A 5FF4A 3U5YA 1XSIA 1CGWA 3SCQA 1OFPA 2Q8XA 5DQPA 3HGSA 5BZAA 1XPYA 4NY2A 3VNMA 1E0XA 2EF9A 2WKJA 2QXWA 3GK0A 3W1XA 1E1FA 3FOKA 5DT7A 1XIMA 3TAKA 4TX8A 4HT3A 9XIAA 3JVAA 4QXIA 3N9KA 5E5CA 3QV7A 5G2HA 4PSRA 1E6NA 4Z1DA 2J6XA 4KS0A 1SJAA 4GJIA 1C91A 4R9XA 3WLPA 4ECLA 3SSZA 3BG3A 2WHMA 2I5IA 5TAOA 2Z1KA 2TAAA 3TH6A 3IUHA 3UFYA 1NOFA 2DT2A 5FF3A 1J0IA 1IR1A 3R94A 2PURA 4GI8A 1L2UA 3SQMA 4V27A 3QQ1A 3CUIA 4GIRA 2PDHA 3R5EA 3W7DA 3EBVA 4K37A 1Q45A 2GGGA 1WV2A 5GJNA 4IJCA 2WM1A 4D9PA 3CPGA 3KFTA 1VH7A 1K6AA 2DH2A 3FX4A 4S1FA 4B4FA 2HS8A 2ZE3A 4ZB5A 6A3HA 3KRSA 4ZZ9A 1D3GA 3R0KA 1PBGA 4B2DD 3CQHA 5CKSA 3W76A 1M04A 1KR1A 5BMWA 4AZ7A 1IWBA 2V8ZA 1TFVA 4UTLA 4FZIA 2E8YA 2E8ZA 1JL8A 4PMXA 2ZTKA 4GACA 1UD4A 3DFQA 1OD0A 2UBPC 4LAMA 1D9EA 4LC8A 2A3EA 4IGNA 2VC9A 1WNOA 3RPDA 2VYOA 2XJ7A 3U2OA 4D72A 1FWGC 4LBSA 2XFWA 1GVRA 1UR2A 3EMZA 4PCSA 4XAYA 1RJPA 3W86A 3HV9A 5RUBA 4XUYA 1VHNA 4Z2HA 4DPQA 1VBUA 3GG7A 1QPRA 1WE5A 1TTJA 4L4MA 4FO4A 3IK4A 2J7HA 3GM8A 1CXKA 1WZMA 4L1XA 5JVLA 1I75A 1W56A 3MO4A 5DBTA 3DHFA 1DJHA 2FH8A 1MW3A 3BAKA 1NARA 2R6OA 4L4LA 2NSOA 4D8ZA 1BGGA 2YXGA 3VCRA 1AH0A 2PDQA 3N2BA 3L0GA 3UP8A 2CBJA 3AU6A 1IYXA 4PMOA 1BYBA 5DMYA 8TIMA 3QRHA 4RZ6A 3BANA 4N9CA 1XD0A 4HVXA 1XP3A 4WKAA 4WJEA 1ODZA 4M1RA 2WW5A 3NOEA 3WCZA 3ZM8A 3H12A 1BRLB 4L6HA 3S2JA 3XISA 4NRRA 4LVFA 2Q3RA 4UMAA 1S39A 1ALDA 3NOYA 3R13A 4H9TA 4UQDA 1JUKA 2HTMA 1V0LA 1FHVA 2DSZA 3MW7A 1LTDA 5DMMA 4UFMA 1GHRA 3P7YA 5K3VA 4DJFC 3PSVA 1G94A 4GQBA 1NWUA 5U4NA 1TSIA 3ES8A 3T2PA 4O4WA 1F6PA 1PX4A 4QJ1A 3LBMA 1KBBA 3S4TA 4C6EA 4ENLA 5M2FX 2PS2A 3ZJ7A 4Q7BA 2NQHA 2VI0A 4B3ZA 4L7ZA 3UA3A 1W9DM 4HCDA 3A9IA 1E4LA 5L9FA 4AWSA 3R6IA 2J47A 1UZ1A 5K9XA 4UB9A 5CXPA 3F4DA 1VJIA 1AMKA 4GE8A 1SM9A 3EPMA 2ZA1A 1PYFA 4Z1CA 3LXCA 1W3HA 3N6QA 1BPLB 2AMXA 1VFUA 2CIPA 4QS6A 1UQZA 4LY8A 1H7OA 1UUQA 1XRTA 1VZWA 2C16A 1B3ZA 4FOJA 3RPTA 2OPJA 3W27A 1TPEA 4WQ6A 1KD0A 4M6PA 2DZUA 3RR4A 3BZGA 3VOFA 4L4PA 3B9EA 3NGJA 3CV2A 4E3VA 2VT0A 5G5IA 2PF8A 2ZUNA 3DI0A 3G1YA 3U9IA 2H6RA 3EDDA 3UESA 1FCBA 4YMZA 2QT3A 3K4AA 6REQB 4GQ0A 2NQZA 1G7UA 3UCQA 2Z1XA 1EJUC 2VO5A 4NXSA 3OBKA 2QDGA 4LQ1A 1O60A 2PDGA 2BTMA 3HPAA 1F8IA 3TMQA 4FALA 1OYAA 3AMLA 2OX1A 1SZRA 2OEMA 3BXWA 4J27A 2QCGA 3W2MA 4I3GA 4O0KA 1X96A 2HPMA 2A3AA 1U2YA 2G50A 1H7PA 3R0UA 4U2ZA 1ESWA 4NIRA 3WFZA 1R46A 1GVYA 2PD5A 3GAYA 3LI0A 1KB3A 2JEQA 4IPLA 2NX9A 4QG6A 4DJDC 1OX6A 3USZA 4WEVX 3NL5A 1ZENA 4N0RA 1B1YA 5PTDA 1S2WA 1VBRA 3HU7A 4LXFA 4AVOA 3PUEA 3ZVHB 2DU2A 2ACSA 1M1BA 3KWSA 1LORA 3FSTA 3PUDA 1TE1A 1XIDA 2A85A 5E6ZA 1OT1A 1OCJA 3GS6A 3VC5A 4DO4A 1J93A 1R87A 1S5WA 2V81A 2G41A 1BYAA 1GPWA 1HJWA 1EJXC 1JCXA 2QUNA 2VGGA 1TWSA 4PUKA 3THQA 4YHEA 4H6EA 1I2NA 3ORWA 3DHPA 3RO6A 3P5YA 1R7OA 2WQDA 4IH3A 2VFHA 1A0DA 3U6WA 1ISVA 3L4UA 3QXBA 3RMEA 1E5JA 5I06A 4GYPC 1QMLA 3UZZA 3U3HA 2H90A 3GNNA 1GOKA 3K8LA 1DE5A 3W0KA 4C6NA 3W6MA 3NDZA 4LVDA 3GNRA 3KZPA 5H8UA 4DX3A 4AZCB 1GYMA 3W1QA 4IIDA 1CI1A 3THCA 3L2IA 3CV7A 4ML9A 5CZTA 3AROA 2I7GA 3W1AA 4IP7A 5LYRA 3ZOAA 4DI9A 1E1CB 4OVXA 2VC5A 2CLFA 1ISXA 3ECQA 2QULA 2VELA 3P2VA 3MVTA 2HZGA 1Q66A 3WNMA 3VABA 1UKSA 3G0XA 3BGAA 3CT2A 3D3AA 5ENLA 1R9YA 3S46A 5JMUA 3M0HA 1DEDA 3L4TA 4H8VA 4CNPA 4D6IA 3VKJA 1THFD 1UG6A 3I3EA 2EO7A 1H41A 1KFJA 3L12A 1Z69A 2ZX5A 1ZBVA 2TSYA 4AIEA 2P50A 3K13A 2ZRWA 3WYZA 1ONRA 4WKFA 2BV9A 3E2RA 2VZOA 3T8QA 2ZDSA 6TAAA 2NX3A 4WX2A 1HL8A 1RH9A 1Y5VA 2A3CA 4AMCA 4MSSA 3ZT6A 3PBUA 3WLSA 1JZ3A 3R0DA 1UWIA 3WF1A 2GQ8A 4XWUA 3RCMA 2YCEA 2OOGA 2R1KA 1TV5A 1XLLA 1A3WA 2DVTA 3GDBA 3NIYA 3UXAA 3ZR6A 3KRZA 3NXFA 4O1EA 4B5WA 2G95A 3Q65A 5AZ0A 3S2MA 1TTIA 1FP9A 1WP6A 4KGJA 1KXVA 2PWUA 3ARZA 4B5TA 5C9RA 3G3DA 2R82A 5EMKA 3R7MA 5DXYA 2PWDA 4JCLA 1SMDA 4MUPA 3HPXA 5CZSA 4MWAB 3B03A 2NUYA 4E4PA 4UOQA 3QBUA 1FDYA 5A8MA 1K9EA 3TTOA 4KIRA 2VDGA 1S5VA 2Q09A 3P60A 3EPOA 4B5SA 1F4HA 3WD0A 1PKMA 2CHRA 3SCUA 2CLMA 3IJ6A 2PTDA 2R1LA 3CMGA 2EHHA 3W3OA 3SUVA 3PBGA 2NQLA 4YJ5A 4PB5A 6TIMA 1L6SA 4MJMA 3W23A 1CLVA 4XX6A 1LP6A 1TUFA 1E9IA 2BGSA 2PBOA 3G1SA 4E2DA 1T99A 1JG9A 2V9DA 4LRSA 5JIPA 3LCWA 3F4WA 2ZDRA 1E9YB 3VIIA 2PDPA 1P4CA 1WZLA 4K6AA 3EKZA 2JF6A 1FOBA 4CD5A 4LS1A 1VYRA 3TN6A 3H6OA 2TYSA 1JNEA 4RZBA 5I3KA 3AAMA 3KDOA 3PTKA 1AH3A 3DCPA 3PZVA 1OD8A 2PFHA 3WG6A 2JIEA 2PDWA 5JXQA 2QAFA 3CAWA 4UQ9A 3M5VA 4M6UA 1A5NC 4GYJA 2CESA 2O92A 1GKRA 3CZLA 1ICSA 1Q85A 4W86A 4GYKA 3ZJKA 1HUVA 1ME8A 4BFAA 2V82A 2FPTA 5CPSA 3ARVA 3DBPA 5DRCA 4CVUA 3WJZA 1KXTA 3P14A 5DRIA 1ZJAA 1TJ1A 1V6TA 3DYMA 2E7FA 1KFKA 2WSQA 3DG3A 5ABHA 4XZMX 3TXZA 4MAZA 1L8NA 2PC8A 1QNOA 2OGJA 3LU2A 4CUCA 4E6MA 4NVTA 4ZB2A 2WMIB 1KQZA 3FYOA 1KWKA 1B3WA 1YTDA 2F61A 1VRXA 3B8UA 3QPEA 4V15A 3LZ3A 4JS3A 5EMYA 3W7KA 3HJZA 3CO8A 4XVDA 1JUEA 5D8WA 3NPWA 4A3UA 1TX2A 3W1LA 2X2GA 4QM1A 2ZUWA 2VNCA 4PTMA 1FQ0A 3MBFA 1JRBA 1UOZA 3WBAA 3BLOA 4FEZA 3PN8A 4ZO8A 3W81A 2C19A 1VCVA 3IAPA 3B8IA 2OT0A 1IXOA 3O0FA 3LV5A 1OB0A 3AMGA 3A24A 3OVGA 4HU8A 1VB9A 3AWNA 5HAOA 2DSUA 3WFLA 3C61A 5KEZA 3W2KA 2CLOA 2OU4A 1GTHA 4NRSA 3BG5A 1OJXA 3LCGA 4GLEA 3PNUA 4JXCA 4I90A 1S2VA 2YL9A 3OLGA 1KA9F 3UWZA 3W87A 2PD9A 7XIMA 3CZGA 3AIVA 5FF0A 2PGWA 3WMSA 4DELA 3IS4A 3EOUA 2WSRA 1GW9A 4AZ6A 1HKVA 4MM1A 3TE9A 2O4MA 2GGHA 3KOXA 1JI2A 5CSUA 4XB3A 3P8IA 1W6TA 3ITTA 3BGJA 1VCGA 5HBFA 4GIAA 4OJYA 1XGZA 3H2EA 1FH8A 4HKPA 4NG3A 1EC8A 3IVTA 5FEZA 3WKZA 2A79A 3RM9A 2GK1B 1L2QA 1KNWA 4KESA 4OHQA 1R8LA 1TPWA 1E73M 2BMBA 5MHBA 5AYYA 1B57A 3SCVA 2H3BA 2ZUSA 2ZXAA 3HG2A 1H3GA 4QP0A 4AF0A 4D71A 4MB1A 4JTCA 4YTRA 1G67A 2V63A 3H22A 4R85A 1Y65A 4B9ZA 3VDBA 1UP0A 2XISA 3WZ0E 3TJIA 3BOFA 2Z2BA 4M51A 1IIGA 5A8PA 3S5ZA 2FZBA 3HGJA 2PZNA 2FGZA 3GTNA 2I57A 1ZJHA 1OZQA 4LCRA 1YADA 1BWLA 2YBTA 3AS0A 3LMYA 1M5WA 4DZIA 3GTFA 1OCNA 3L9CA 4WGXA 1UJPA 2O4QA 3CHCA 3VZXA 1MRAA 3NL6A 4R7JA 2WKGA 3UWQA 1V7YA 4ZFCA 3EOEA 4NJGA 4PB3A 1VIWA 1I2PA 3SY5A 4ZR8A 3VNLA 1OC7A 3SCRA 3UGRA 4E38A 4UBPC 2W4XA 3O0KA 1VFLA 2VMFA 3U2EA 2J13A 3EB4A 1W3TA 4FNTA 4A2RA 4F66A 2Z6IA 4IQLA 5MF5A 1XLJA 2VDIA 3HMCA 1ZFJA 4LFYA 1J0HA 3KOWA 3RLGA 4ZB0A 3WLJA 2WNNA 4LUTB 4GOAA 3EX2A 3URAA 3ZJ8A 3SDOA 3EA2A 4PE8A 3LM3A 1OG0A 2V3DA 4P7LA 4GWEA 3MMTA 1XLIA 1XSJA 3M1ZA 3TUUA 3AHXA 4ZQCA 3BV4A 3I4KA 4D6JA 3R8HA 3KCOA 1HXJA 2GGIA 3OODA 5D4YA 1UKPA 3SGGA 3ZYZA 1CW2A 3LXBA 3G1FA 4G2DA 4Q4SA 1ISWA 2IMRA 1Q6CA 4HYWA 1EDTA 3PNZA 4MOZA 3GXIA 1H62A 4Q4PA 3N18A 4MMWA 3LLXA 4PMDA 4DN1A 1GVIA 1VD6A 4UIOA 2FDMA 2E6DA 1GYNA 1DWIM 2EJAA 3PPFA 1M03A 3KLKA 1LL7A 4XD3A 4WCJA 2WANA 3UG4A 1XIJA 1O5QA 1LG2A 4OQVA 2ZRUA 2CHOA 4KPLA 2YYTA 2WCAA 2R24A 3KM8A 1OVDA 4US6A 1UBPC 3AUOA 4DO6A 3CZ8A 1U5HA 4Z0SA 1FH7A 2CC0A 2WVVB 1ZBWA 4ACZA 3EDFA 1G4TA 3TJLA 2QJHA 1F61A 1WKDA 2YOCA 5XIMA 4MFEA 4H7ZA 1HG3A 3GB6A 4EXQA 3KL3A 1R47A 1GKQA 4HU0A 3M0IA 1DTUA 4PULA 2RDWA 3UR5A 3WUGA 1O1ZA 3WF2A 4Z2KA 1TYGA 3PSWA 3KVKA 4M5PA 4NAFA 3T42A 3NQ6A 3BJSA 3E38A 3LM7A 1SR0A 1QBBA 1OHLA 2ON3A 4UMBA 3URBA 3QM3A 1A5UA 5HR7A 4HD5A 2F6UA 4ZQPA 4AZGA 4DJEA 4U2YA 4X61A 4MDOA 4OOUA 4M82A 1C90A 4L1WA 4IMGA 3FDGA 2AL2B 3ARRA 3IJ9A 1JPIA 4L9YA 3EWZA 2BY3A 4M6QA 2GSHA 3VMNA 1DHKA 1HJVA 1MW1A 1FWTA 4XSLA 4XD4A 2QKFA 1W9XA 4J3UA 1FWIC 4RNHA 5BXPA 3DFTA 3WENA 3DGRA 1WXZA 2XZ7A 5HMEA 4UFHA 3R12A 3GC4A 2VEFA 1JZ7A 1TVLA 2E1WA 2OLSA 1EXPA 3NL3A 1TWWA 1E0WA 3V3WA 2D0FA 2CLKA 3CMFA 4PGLA 3MMUA 4ERGA 4AVNA 1W1ZA 1TZ9A 2Z26A 4NJIA 2RAGA 2BHUA 3LTPA 4H6KA 2D22A 3AS2A 4ZQOA 3WNNA 4YPJA 4YTTA 4J3SA 3TAOA 3GE7A 4ATWA 2XIIA 4WOZA 3VGBA 4O19A 3ONBA 4WXZA 2DDXA 3DHUA 3LNPA 5TNVA 1NY1A 4UTTC 4C1NB 3PULA 4C6FA 5B7YA 4CNUA 4PMVA 3KL0A 4ROPA 5M1TA 3MDUA 3PY2A 2EKCA 1B3YA 4DXKA 1RPKA 2WAGA 3TZNA 1JFHA 1UKQA 2BZNA 3M0XA 2VXNA 4UTIA 3UZXA 4IX2A 4IFOA 4Q4MA 4LV4A 3J7HA 1XQLA 1QFEA 3Q94A 4PZVA 3BLIA 3CB3A 5AC6A 1UB3A 3B9DA 4WD0A 1V77A 2EEXA 3I68A 3NQEA 3GH5A 4K1GA 4ORMA 5E0FA 3H2FA 5AZ1A 7CGTA 3KP0A 1K7FA 1ONEA 3PVFA 3SJNA 3S1VA 3RJXA 4XD5A 3H53A 4QISA 1MFUA 1YX1A 5LNRA 4FF5A 2PGFA 1H0IA 1P0EA 4LPCA 3WO8A 2BY2A 1JPDX 4AYGA 4HA0A 4GH1A 4CNSA 5LNSA 3MUAA 5HMSA 3BLPX 5F4SA 1W37A 3CUZA 3CZKA 3IWPA 5IHRA 1NSJA 1IXPA 3BK0A 2EKGA 4ZBCA 2FJUB 4PMYA 4D6EA 1W1IE 5IDZA 4DUOA 4P2VA 4F0HA 4J7RA 4IGSA 1FDZA 4O57A 3EOLA 2YLLA 3OTRA 4UOJA 1Q2SA 2CPUA 1W3NA 3BICA 4FNUA 3UJSA 2NSXA 3QV8A 3RILA 1VLIA 3ALGA 1VFFA 3WD1A 1QASA 1XFBA 2OLHA 3VM5A 2VEIA 1KFCA 1E43A 1CENA 3K2GA 3NGFA 3PTMA 4I8DA 1V3KA 1GOWA 4H7CA 4H9YA 4LV9A 3WLKX 3BH4A 3JRKA 3HPFA 1SQ7A 4H6RA 1PV8A 4JTHA 4ZMGA 5EBAA 3CUXA 2BASA 5TIMA 3W26A 5J5DA 1YNQA 1HT6A 2PP3A 4FIQA 1J5SA 2YFNA 3S1GA 3VI2A 5M5DA 1IEWA 5HPOA 2Z29A 1UR9A 5HK4A 3T7VA 1YXYA 1EPXA 3SCWA 3OW1A 1OF6A 2E6AA 2FPVA 3B4UA 3EWWA 1DORA 1WQ5A 4D6FA 1EP2A 3W73A 2ZRYA 4LAOA 4CCDA 3IAQA 4BY3A 1P5BA 3VFCA 2FZ8A 2WO5A 1GYLA 1S2AA 4D6CA 2WWDA 2VC7A 2PODA 2WZHA 2GYIA 4HYVA 2YPIA 2EPNA 3U57A 4DWSB 2PGEA 4POCA 4W7WA 1XLCA 2I14A 3C3UA 2VX4A 1TQJA 3S1XA 4IQJA 3GG0A 2DEPA 1XCXA 2DZVA 4NZFA 4DBWA 2VKZG 3O6YX 1S2CA 3VDCA 1W54A 1H1YA 2VEKA 5KZEA 3EZ4A 4DM2A 1HKWA 3I65A 1Z3NA 1B3XA 2J8GA 4G6CA 3RM8A 3WELA 4QG9A 1E6ZA 3GR8A 3QOKA 1T40A 4AG0A 4YWSA 2DQXA 4JFWA 1WUFA 3MMDA 1OABA 1V6XA 2OQHA 4RX0A 4ZSTA 1R30A 2F2HA 1TX0A 3RG6A 1IT8A 4HZ6A 1JIBA 1YLVA 4FX7A 1DV7A 2BHYA 2FKPA 1LL4A 2WHLA 2Z7GA 1OFQA 1FBAA 1KQYA 4S3KA 1CB2A 1ME7A 2CKSA 1RP8A 2YA2A 4QBXA 3Q58A 4IIHA 1QUMA 1W1TA 3UG5A 1XRVA 1PUDA 4JIHA 1ZL1A 4AD5A 1AL8A 4BF9A 2XG9A 3GUGA 4IGMA 1XQKA 2AAAA 1T6MA 3P61A 4AZIA 5BXSA 2DP3A 1VEMA 4R88A 3IGUA 3P82A 3LNMA 2C1GA 2PWGA 1DBTA 2GJNA 2HMCA 1MYRA 1CNVA 1T96A 3MY9A 2FVMA 3A12A 4W7VA 4HU4A 1C8QA 2BGQA 2KX9A 1KCZA 1EZ2A 3DOPA 2HJPA 1EWDA 2Y5EA 3BLLA 2IKJA 4HK6A 1NF0A 2H8XA 1F3WA 2BP1A 3IUIA 3F5JA 4ZXOA 3VGEA 3LX9A 2P3EA 2QMKA 3NQ7A 1K4HA 4PFHA 1SSGA 2V5CA 3RX2A 3GRIA 1QW7A 1C9DA 4NZ3A 4LNYA 3WIJA 3U7BA 1RVKA 1D3CA 1GQJA 1VBJA 1Y0EA 3GR4A 2NT0A 4Z2LA 4UTHA 4MUZA 4LYRA 4JIQA 4JY9A 3VX1A 3QMSA 1SFJA 2WLYA 3IUDA 2ESCA 2C1HA 1WUEA 4IUGA 1A49A 3SN1A 4DJED 1YXCA 4RK8A 5I6SA 4W85A 4F4RA 2UZ9A 1QBAA 1RCXB 2BOFX 4ROQA 2OEJA 4REQB 1RZMA 4H8UA 3N04A 2E3ZA 1Q3NA 2UY4A 3TWAA 2PDUA 3OBEA 1HGYA 4H41A 3PWGA 2E28A 1V51A 4DO5A 2BXVA 5K4ZA 3NXLA 3RO8A 3HTWA 5LKYA 1P1MA 3NDOA 1W3IA 3DENA 1U1HA 2CEQA 3SQLA 2QS8A 1V6VA 2V2CA 4AAJA 1G5AA 1W1VA 2IPJA 4MLJA 3B8DA 2PTXA 1YQ2A 4O17A 5A8GA 1RALA 3W1MA 1E4NA 1KBJA 2VURA 1DKWA 4RZ4A 2YL6A 2O56A 3E5BA 1WDPA 4Q22A 2ZWYA 3IGSA 4H9MA 1AODA 1W3KA 2X16A 3JZUA 3CPRA 3R4IA 2DSKA 4QCEA 5BCAA 3TMLA 2XZ9A 1A3HA 2QAPA 2XH7A 4JFVA 4PUJA 3WUFA 3P6LA 1K9FA 1CX9A 3TCSA 2X09A 3KOZA 3O6CA 1GQLA 1I60A 4UNIA 1W9VA 2EAWA 3N4AA 4RDYA 3AQUA 1V3LA 3BAYA 1B90A 1V02A 2HE5A 4DBEA 4PYSA 3UVAA 5G1YA 3V1HA 3V75A 2FHCA 4ZENA 3BZJA 2ZE0A 2WBGA 1SJBA 4XKYB 2QUUA 4Y9AA 1RVGA 1XI3A 4XAZA 1PYMA 2WHKA 1EGZA 3FJLA 4DAIA 1TVPA 2CFFA 3IANA 3TYEA 1XBVA 5A5WA 2R94A 4TOQA 4O8RA 3LG3A 5F7UA 4LS0A 2FH6A 2WBKA 1R2RA 1W9UA 3NPUA 4KWWA 2D2OA 3THDA 3VOIA 4Q7NA 4Z1YA 5D05A 4DHGA 3MYPA 1K77A 3LUTA 5D9PA 3IEBA 3QZ6A 5AFDA 2J27A 2XUCA 3MUIA 3KWXA 4JR5A 1EDQA 2A5HA 1E0UA 1EGMA 4Q8NA 3T78A 2FDSA 2VFFA 4GIYA 2V3GA 1KCLA 3B0YA 3N34A 2CZ5A 1WZKA 4OOZA 5I79A 3TFCA 3QFEA 4ZTYA 1H7RA 4HU3A 2Z7KA 4JTTA 3ES7A 3M0ZA 2CXEA 3CAVA 4N2YA 3ARQA 1J10A 3MSGA 4UCFA 4CN1A 5D04C 3H7UA 2CLHA 1XIFA 4MY8A 1GEQA 4DJFA 3QR3A 2GWGA 1TJRA 4MZ8A 4W8BA 1QHOA 1PE1A 3H2NA 5AVNA 4WIWA 9CGTA 3B04A 5FL1A 1SYTA 3UT0A 3UXDA 1J0YA 4KMQA 3WLLA 1ZB5A 1JCYA 4ZOEA 5AC8A 1L6FA 2AGKA 2BX7A 3RGTA 3S1UA 3USBA 1OY0A 2GQAA 3SN4A 3N15A 3S3GA 4ZSUA 3FN9A 1BKSA 4A4AA 4HNVA 3LTSA 4UFJA 2EJ1A 3W37A 1DIDA 3SM0A 3ZO9A 1EO7A 1LOSA 2JEPA 1KGUA 2WB5A 2PLJA 3AI0A 2YDQA 3SW6A 3WK0A 1TCMA 1BD0A 1A0CA 2W0UA 2YCKX 3P0WA 5I78A 2ZXQA 4X9YA 4BJHA 1H4PA 4XV0A 4RPPA 1D8WA 1ICQA 3TA6A 5A8QA 3CS2A 3N1AA 4OWGA 1MDRA 3HZ3A 1YRRA 5LIXX 4C6QA 3MCNA 4ZOAA 5H91A 5LNWA 3A3XA 2BDQA 2I1OA 3ITCA 1C7TA 5BXRA 2PCEA 2DIEA 3MUCA 1X7FA 1RBAA 1A47A 5I3HA 2HXTA 4AY8A 3UERA 4BA0A 1DXFA 3CWOX 5CC7A 2Y7EA 3DN5A 1UQYA 2VD9A 2Y7GA 2XGZA 1LBFA 3AIRA 3ANYA 3H21A 4JQ4A 1VF8A 1E9LA 1NU5A 2PB1A 2W6RA 3NEHA 1JQVA 4U28A 3PB2A 2QVHA 1VEOA 3WJYA 3SQSA 1GORA 4NNCA 4KIEA 5I3IA 4MWAC 3HQOA 1LG1A 1PWMA 3OZOA 1DJGA 2VZTA 4Y2WA 2BG5A 5FAGA 1TTQA 1KW1A 3VCCA 3EWYA 2RJHA 4M7TA 4HJFA 3DH7A 2O0TA 3KCLA 3PZGA 1L9WA 4WY0A 4LF2A 4AH7A 2IQ0A 3NUKA 3FAWA 4BF7A 1O4UA 2X05A 1US3A 1TJPA 3WH7A 1XYBA 3EDEA 3M43A 3FAXA 1Q6OA 2P3ZA 5BROA 4DLMA 3KTSA 1IXNA 4TV5A 4C6DA 1EYEA 2YSWA 4MNMA 1GUVA 2PDBA 4GCAA 4IF2A 1K03A 3IRSA 3C0LA 3M7SA 2A7RA 1RD6A 1JAEA 4QNWA 2VX6A 4GYPA 3CYVA 3M0VA 1FXQA 4U31A 3VMOA 2CBUA 1DP0A 4PCNA 1Z44A 3G1VA 3W7HA 3E0VA 3AS3A 3PG9A 1ODUA 1AW1A 3RYSA 3HA1A 1M7XA 4CCZA 1RAKA 3ZWTA 1M68A 1GONA 3IJ7A 5HJXA 2VRJA 3PPHA 4JIPA 3SRHA 4NAEB 4NP7A 3F03K 4DNHA 3K8MA 1UOKA 2WPGA 3SUSA 1MNSA 1YDYA 4QJ3B 3GC2A 1JPMA 2J8FA 1REQB 1Z42A 2WZMA 5DFAA 1JF5A 2I9EA 2YDAA 3C2FA 4DZAA 3H2AA 4UFIA 1FDJA 3GKFA 2VX5A 1J01A 1NDYA 3GU2A 4HNLA 1E4IA 1XGEA 3E12A 1T41A 2BY0A 2J7CA 2HVMA 4NZ4A 3RK8A 3L4ZA 4ILSA 3G24A 4CD6A 4HA4A 4DF2A 1HW6A 1Z41A 1HJUA 1A4MA 1TRIA 5FAJA 1PIIA 4Y96A 4PCFA 3TYAA 4PUWA 4Q8UA 1CECA 1FVPA 2QCDA 1WKFA 2VWTA 2WM0A 4FHAA 2FGLA 3VD4A 1BVWA 2PC4A 1VFMA 1Z89A 4S3DA 2QW5A 5CCZA 3CL7A 2DT0A 3UF9A 3QHOA 1LLOA 1E6PA 1PAMA 5TQLA 4TIMA 2WVSA 2CZVA 2ZZ7A 4O1AA 5HJYA 1TIMA 1O94A 3B05A 5J5RA 3UYIA 1XSKA 1L6YA 2RH9A 2G5WA 2ZZ3A 2XM1A 3DG6A 5CC3A 1YKWA 4C6KA 3VNJA 1IWPA 2BXZA 3SI9A 2W27A 2WCSA 3BAJA 4CNTA 1E3ZA 2FZ9A 1E0TA 1YE6A 5EBUA 1SZGA 2ZUUA 4DUXA 3FIGA 4MPQA 4WSKA 2G96A 4AWUA 2AAMA 3DFSA 3EWBX 4KF1A 3BO9A 1R86A 1TJ0A 1PXGA 4GUFA 2J7BA 4FS9A 3O15A 1OC5A 4J5NA 1XLBA 3O06A 2G3FA 1OGSA 2JGQA 4ORIA 1UP3A 5C54A 4HPJA 1LWJA 2VJXA 2QEZA 3MWCA 2CZDA 3O2LA 7TIMA 2P8CA 3WF3A 3NPVA 1PO9A 1MWOA 3DI1A 3ZR5A 3TU9A 1MZRA 5BWFA 4KWUA 2ZC8A 4LUSA 3VZYA 1J96A 1M7PA 2Z2AA 2V5DA 1J79A 4WDUA 4DQWA 4BQ5A 4US5A 3AU2A 2GQ3A 3ARSA 4QLKA 4BQ3A 4UQBA 3S9ZA 1TPFA 1CEOA 4LYKA 2ZBTA 4F0SA 1F8MA 3TTQA 1F73A 4H01A 2QCMA 2OYMA 5H8PA 3C8NA 4LBRA 3QC0A 2C15A 4JN8A 4MB5A 3M64A 2OB3A 1U1UA 2FQIA 4TVCA 4AXNA 1GEHA 5ABEA 3WQCA 4L9ZA 1OFRA 5U7SA 4JTSA 1NQ6A 1XLGA 1S5TA 1EHNA 3I7SA 4ACZB 4HTYA 1QI3A 1M7JA 1UMYA 2V5KA 3HB9A 3SCSA 4MG4A 1QCWA 1P7TB 2DZTA 3PAOA 3WL1A 3B97A 4DJFD 5LZLA 1O5XA 4F3HA 4UTWC 3N11A 3B0XA 3CZEA 4AXKA 1E9ZB 4URIA 3WDJA 9RUBA 1EOMA 2ALDA 4J28A 4M0XA 5G4EA 1FCUA 1WXYA 4KT2A 3GLCA 3NYDA 4GGHA 3N13A 1N7KA 2PU1A 1E71M 1N8FA 3KL5A 2GFTA 1FHLA 5E70A 1YPIA 2J74A 3LY0A 1G01A 2O7SA 2Y4SA 1YPFA 3K46A 3B0UX 4S3AA 5EMUA 1VPQA 3CHDA 1DQUA 3K30A 4WJ8A 3AXIA 5CGQA 4YVVA 1EF3A 3L4WA 4C7DA 3LHYA 3GVQA 3VPLA 3MHUA 2FJKA 3XINA 2D0HA 5E93A 1WDRA 3VM7A 1EUNA 4IFKA 4UFKA 4S2CA 1XM3A 4XG1A 3GXPA 5DXXA 3MA8A 1I4NA 2QJIA 2R1NA 1UJQA 3GTHA 2Y85A 2FMNA 3WQ6A 2VWSA 3W7CA 1XL9A 4NI8A 2DPEA 1IEIA 2ZX9A 4HOXA 3O63A 2YBVA 3FFSA 4UUIA 5IDIA 1V0KA 4FLOA 2CXGA 3PZQA 4ADSA 4R7OA 1HL9A 2ZVIA 1TG7A 3OA5A 2XPKA 3CLMA 3TOPA 1A5KC 4U5IA 3QYSA 1TWDA 2HVNA 2A0NA 3CL6A 5HA7A 1JCJA 3Q67A 3RCYA 2ICSA 3FJNA 2L5HA 5EU9A 4L5ZA 1XLHA 1CLKA 3PTDA 1UIOA 4JN6A 1OX5A 3SCOA 1C8XA 1IGSA 2ZVRA 4MVAA 2MANA 2PEVA 1OF8A 4RPQA 3W7RA 4K8EA 1XS2A 2VR4A 2X0SA 1FKWA 2OKTA 2ISFA 3NM3A 4KFNA 2VZUA 4GUIA 3EYPA 4ATDA 2WOQA 2A1YA 2OWCA 3FEQA 2Z28A 1BEUA 3S5YA 4O11A 2E68A 3HBLA 3WLMA 2B7OA 5BOFA 4GUGA 4YNGA 4I9MA 2Y89A 3ISIX 4O1DA 2PDNA 2YDRA 5A6MA 2YJQA 1US2A 4XISA 4GYFA 3NVTA 1BXCA 2EXOA 3R79A 1BTCA 2D69A 1KLYA 1XLMA 3G1DA 3N14A 4JNZA 4NNAA 2DUXA 2QDDA 4GJJA 4BWLA 5DMLA 2HSAA 2W3ZA 2WYSA 1JUBA 4IMEA 1OZMA 2QJNA 1LROA 2ZOXA 3QOMA 1QPKA 4ZO9A 3PZNA 4XZIA 1ZGDA 2OMAA 1TQXA 1MQQA 3BPWA 2PLKA 4A3RA 3OVQA 1B54A 3LHWA 4HB7A 4X2PA 3R2GA 2QGHA 1F3XA 4C91A 3PFMA 4EX4A 2QCEA 1OM0A 4YTUA 3LQGA 5FEXA 2VGFA 1FUYA 4FF7A 4TUFA 2JE8A 4N02A 4ICMA 1GT8A 4PODA 1Z8AA 4J3XA 1W2VA 2VEPA 5CZ0A 1AMYA 3CH9A 2ACQA 3T9PA 4GINA 3QW3A 3H4XA 5D02A 3S8HA 1DYSA 4HMEA 3QY6A 2OX4A 5FSDC 5BOEA 2DW7A 1XYLA 2HDJA 4IPJA 1F6YA 4DYEA 2ATMA 3W38A 3F4CA 2W61A 5B7ZA 4EF8A 4ML4A 1FRBA 2B31A 3HG3A 1KLZA 1ITUA 2QVNA 2OWXA 4OV9A 2ALRA 4D6GA 3NYZA 3P62A 1S1PA 1VYPX 5A6JA 3E9AA 2WSYA 3ZLHA 4FLRA 3GX9A 4R7WA 4JHMA 2BHZA 4DEFA 1ZPTA 2WKLA 3E49A 1XLDA 2R91A 5I24A 3AICA 1M01A 1PVNA 1NP2A 1MUCA 1YBQA 3OHMB 1HX0A 1GOXA 4J35A 4UTUA 3ATYA 1HTIA 1NIUA 2WHJA 3YPIA 3W82A 4C60A 1XF0A 1RD5A 3DFNA 4MTVA 3T44A 2OWWA 1YDOA 4B5UA 2B7PA 4WLCA 1J9YA 4F2UA 3VMPA 3GG1A 2NUWA 2E4TA 4UZSA 5K4XA 5A94A 4H8NA 1QNRA 3QKZA 1EF2A 4GZ7A 2Z4GA 4N9BA 3BCFA 1HGWA 3ZXWA 2ISVA 3A3HA 5CLTA 2H9AB 4F0KA 3A64A 3PPCA 1DWGM 1LUCB 5IFPA 3TX9A 2VEGA 4DUWA 3UZWA 2C91A 4PEKA 1QR7A 3VA8A 4FX8A 4PTVA 1GQNA 3DDMA 1UBSA 2C0HA 5AOUA 3LPGA 4I7WA 1IT0A 2HK0A 5DCEA 3M0KA 3M0MA 3BLDA 3VK5A 1C29A 4Z2JA 1H1ZA 4LGXA 4ZOBA 1KKRA 3QJAA 1AJ0A 2OG9A 4K68A 2GSEA 3SUTA 4ONVA 1JDCA 4US5D 3W1TA 4CQDA 5FESA 3AO0A 5D9OA 3E6EA 1XFCA 2V69A 3TQPA 4Q8VA 9XIMA 4QG8A 4UC5A 2E9BA 4JIIX 1QNSA 3GDRA 4E0CA 3L68A 3OZPA 2DH3A 3AIQA 5IBXC 4QITA 1X6NA 4MNLA 1SO4A 2H8ZA 3EX3A 1H2JA 4R27A 4M8UA 1QO5A 5A2AA 1XIHA 4AD0A 4QLJA 1Q5MA 3C0SA 3FS2A 1XDJA 3W9ZA 4LALA 1VIZA 4ZL1A 1GOMA 4Z2GA 3P8JA 3T0BA 4GO8A 5D2WA 3HQ1A 4ZQRA 4WGHA 1PCKA 4MF4A 4MADA 1AK5A 3BARA 5E0CA 3M5XA 2YDSA 1V6WA 3M4HA 1WBHA 4DWSC 1DQWA 1UWUA 3FXGA 5LHFA 3IIPA 3FGCA 3PJTA 5A8OA 4UTTA 2BVWA 3HG5A 3BW2A 2FB3A 4JEQA 4L56A 3CAQA 4LYPA 3PUGA 4K3ZA 5C7HA 3IGXA 3AYTA 3M47A 2J7DA 3QYQA 2VR2A 1KFBA 1QPNA 4BCEA 4JY8A 1FCVA 1GZGA 2F8QA 1X8FA 4MJ2A 3A4XA 1W8GA 4AHQA 4DF0A 2A3BA 3PBWA 5CAKA 2P10A 1T8QA 3WQ8A 2E5CA 2GJLA 3GHRA 2NWRA 2A6NA 1WKEA 1JPHA 1OX4A 4MHBA 4GZEA 2H3DA 4NYUA 1EZWA 1JNDA 1G9HA 1O12A 4O18A 4IZGA 1Q6LA 2Z25A 3H2OA 4AD4A 3T0TA 1ZCOA 1UA3A 4L61A 3EX6A 4UTFA 2ZUTA 2Y5SA 1EDGA 1R3QA 1R85A 5IFTA 1JGIA 2PLMA 4RJEA 2XFRA 5LXEA 1OT2A 3LDVA 1VGAA 3HFYA 2BGNE 2XVGA 3LK6A 2YW4A 2IPFA 5D32A 3WLNA 2HE8A 3OO2A 1W5OA 4YYFA 3E2QA 1JXJA 4N4QA 3TA9A 3K5XA 3XIMA 5T8GA 3UXIA 5REQB 1UR0A 4Z1AA 1FWWA 4YCPA 1EB3A 1FKXA 1GOIA 1NELA 1F5ZA 3N29A 4IFRA 5AYIA 2VZVA 4PBFA 3EDJA 5KSWA 5ABFB 5HNUA 3LPFA 4GBUA 2P8BA 1JDEA 3GDKA 4M7SA 3VIOA 1ZAHA 4M80A 4JTFA 3ANVA 5FSEC 1W2PA 4LY4A 2YYUA 5I00A 4BEQA 2DT1A 2XWEA 2RUSA 4IICA 5FD0A 4GA8A 2BB0A 2YL8A 3ITVA 2OZ3A 1ZTVA 3OA3A 4V28A 1VAHA 4NZCA 5FA5A 3T8LA 3EOOA 1WDWA 3T09A 3GVVA 2REQB 1J8VA 5DY3A 1DTNA 3GU9A 1F6KA 3VNYA 2GGEA 5I03A 2BXYA 4KETA 1FY6A 2X1UA 3LPOA 3WF0A 3NG3A 4EPDC 4JTAA 4AEEA 2DVUA 4DXVA 5F2LA 4K2SA 5HULA 2PZ0A 3VKDA 3OBAA 4NHVA 5D09A 3C4UA 4XKMA 4H9XA 3SBFA 2ZZ4A 1BKHA 1N82A 4LEFA 3W4RA 3KAOA 2E9MA 5F2IA 3QGKC 3JUGA 4XZ9A 1X1OA 4TR9A 4KFOA 4PUNA 1CWYA 3WEMA 2PWHA 1JGMA 4K7VA 1QPQA 2QGYA 4I5RA 4AUBA 1B9BA 1J0ZA 3FVMA 1KRCC 2QZRA 1CXLA 2WWCA 3CZJA 5AC4A 4RL3A 1JDDA 3A47A 3TDFA 3OQEA 3SUWA 4P7RA 1CBGA 2CZEA 4O50A 2VFGA 3GTXA 1EJSC 1Q2RA 3QH2A 3LCLA 2ABBA 1E6SM 4HPNA 2W79A 3VD5A 5I09A 1GTEA 3TV8A 4JPGA 4H6QA 1SSDA 1IGWA 4HA3A 4Y9PA 1U30A 4QE1A 3M6YA 3LHVA 1A50A 3W83A 3S0CA 3WEOA 4J3VA 4H2HA 3C2EA 3KVLA 1N2VA 4HMNA 2QCFA 3A22A 1WCGA 3ANUA 1MNZA 2C13A 2W91A 3ITXA 2IUZA 3MI6A 2CLEA 3WL0A 1CIUA 4PN2A 3MB9A 2YCIX 1HQTA 1SUXA 4GXMA 1UH2A 1UPMB 5LIUX 5GVJA 4KCUA 2OELA 1UW9A 3VNIA 5BRQA 1QWKA 4RDVA 4DF1A 2NWSA 2QUMA 3V5OA 3E96A 3VNDA 2QJJA 3BURA 3GNOA 4C5ZA 2WC7A 4PL2A 3RJYA 3WJWA 5D8ZA 4IM4A 2PRLA 4YYCA 4L1GA 1E6RA 1T5AA 3Q4DA 3ZT5A 1EIXA 1WOBA 1MMFA 4QFUA 2WC3A 3S5OA 3WK1A 3B8WA 3W01A 2JFEX 2J25A 1MO0A 1A53A 3ARYA 3MJYA 3W74A 3POHA 2ZZ2A 5T9CE 2C79A 5T26A 7REQA 4B90A 1LWIA 3D3FA 1B3OA 1UWTA 3E0FA 4RXGA 3VDGA 1WDQA 1ZAJA 1QPOA 3NSNA 3TC7A 2ZC1A 1KCKA 1FFQA 1RBOB 3AHZA 1B4EA 3WQFA 5G1MA 1QOPA 1VFTA 3B9NA 1R9ZA 4GRSA 1G7VA 4S38A 1UASA 2A7PA 3B4YA 1GOQA 1BF6A 3TK7A 3WBEA 3WDIA 3UWYA 4QJ4B 4PMNA 1XCWA 3QGAC 3MHGA 3QQ0A 3W29A 1HNYA 2BOEX 1ZHAA 3UGVA 2X0HA 4MGGA 2VEMA 1IZJA 1Q6DA 2Q6ZA 4O0ZA 3CUHA 2W67A 2XH4A 2GOKA 1YDVA 1KTCA 1O66A 1K70A 4M29A 5HINA 4RW5A 4QDMA 4NKCA 3U2CA 1AD1A 3LHTA 3PZTA 3BVJA 4Q4QA 4RNJA 2P0IA 2ATSA 3GNDA 1OSEA 2Y62A 1S5NA 4PCTA 5AC7A 1YNYA 4CCCA 4AY7A 4FSAA 4XZNX 2VC6A 2O7QA 1AA1B 1NJJA 5F2GA 1Y8BA 4S3EA 4FX6M 3ABZA 2CBIA 5A6KA 4DM1A 3U4AA 3V16A 3G1XA 3G22A 3WJSA 3WSUA 4OFCA 3GO2A 3SB0A 5C7VA 6REQA 4NT0A 2E6FA 3S2LA 2CWXA 5BNKA 4QEEA 1H7NA 3CH0A 1MW0A 4XQ6A 3ARTA 5HR6A 1F76A 3WD2A 1ADOA 3IV3A 4KEUA 1W5NA 3TC3A 4QCFA 5ABGA 4AFYA 2QR6A 2QCDB 1XHGA 4A29A 4YHGA 4RE2A 3KBJA 2Q02A 1H11A 3W7IA 3EAUA 5LIKX 3LLDA 3NWRA 2O55A 4H9UA 3VDHA 3WBWA 4DLFA 3AFBA 4OZOA 3CEUA 2NX1A 4U33A 3RAOA 1SZFA 5KMYA 3GHUA 5DCBA 1I1XA 2J24A 3M0YA 3GBDA 4I5XA 4CU7A 2XHYA 2PDKA 4C5YA 3MBDA 3SRDA 4ADUA 1CDGA 2XWDA 5HQMA 5F4XA 1KFLA 1CXIA 3AWOA 3C2VA 4JYEA 4FR1A 4YTSA 2AL1A 3TP4A 2NLIA 5L6UA 2GJXA 3H23A 2FTWA 2ZX6A 2F9RA 3S2NA 3GSMA 5CJMA 3OP2A 4DNMA 5DCDA 2E09A 3IARA 2FMOA 3I3DA 3WDHA 4B9YA 2CHNA 2DGAA 1CYGA 1E6XM 1TPVA 1GG0A 1TWZA 4PSPA 4IXHA 2Y6ZA 3WQOA 3TN5A 3L66A 3M0LA 3PANA 1K1DA 1UUOA 1EIBA 3I6EA 3KVMA 4LUSB 2GVEA 3SSJA 1DE6A 1RA5A 4GUJA 1ITQA 1X1ZA 3MHFA 3ZVIA 2C71A 2HNHA 1TKKA 1XXXA 4DBSA 5EB8A 3AXMA 3PR2A 1JCNA 4ZFMA 3IJIA 4FXSA 2RDUA 1KM1A 5CG7A 3WQPA 2G3MA 4IWWA 3G3MA 1V0MA 2XIQA 1Q4NX 2Z27A 2XYLA 4EPKA 1W5PA 3BW4A 1GPFA 3W7QA 2SFPA 3AMDA 2OZTA 2WVUA 2QCNA 3RX4A 1Q7MA 4XTIA 1KTBA 2XIMA 2CYGA 2D23A 3COTA 4J1OA 3QFWA 1RBLA 2Y24A 2DJLA 4GIEA 3W00A 4MYXA 3CV6A 2RGLA 4BF5A 1XGDA 1ITCA 4UNLA 3QTGA 3QQWA 3FKKA 5HUOA 3GW0A 3LCFA 1KO0A 3WLQA 4R9OA 2E6YA 3W70A 5HJLA 4KWVA 3TSBA 3R89A 3E0WA 5ABTA 3HIJA 4GX8A 2VUNA 4PRTA 1EYWA 1YIXA 1EL3A 4MYAA 5H6HA 1HKJA 3A9BA 3IACA 3MSDA 1TV4A 1OFBA 1UR1A 4LX4A 3S9IA 3REQB 3SO7A 3HM7A 4GY1A 1LQ2A 3DG7A 1Z7AA 5FJPA 3W22A 1EWEA 2D2HA 4WOQA 5CSSA 1Q4WA 4AIBA 4IP5A 1L8PA 4PMQA 2Q8ZA 3KUMA 4HNNA 2I5GA 4IFKB 3QY7A 4V1XA 3HPSA 3VCNA 3NPXA 4UCGA 4HOWA 1Z9AA 4JX5A 2IXVA 1JVNA 7TAAA 4RW3A 4UMCA 2NW0A 1HJQA 2BLEA 2DZSA 4C6IA 1ZNNA 2PTWA 1OG6A 2WJEA 1K02A 2FFIA 3BAXA 3R8RA 2PGRA 5CZJA 4LWWA 1R38A 1QK2A 2CLLA 3W7LA 3EA3A 3P81A 1QNVA 1PDYA 3GW3A 2J4GA 2VOMA 2GSJA 3BLEA 1VEPA 3RM4A 5CSRA 3NQCA 2XINA 4Y8EA 2OEKA 5DLCA 4C6CA 5TBOA 4UQEA 3UPMA 2YCLB 1H5VA 5H2ZA 2INZA 4DIAA 3G0SA 4PRRA 3PG8A 3AZTA 5DT5A 3VZZA 2NT1A 3SCTA 2XSXA 3W71A 2CZFA 5CC6A 5AHLA 3FV9A 4IHCA 2FLIA 1XCFA 5I5RA 1BG4A 1BYCA 1VFOA 3PZMA 2PDLA 4H00A 3T08A 3ZMRA 3MP4A 2RHGA 5G2WA 3WDRA 4EF9A 1UWRA 3MS8A 3V35A 3VKKA 3RCNA 2F38A 4GISA 3S2CA 1K9TA 4AD2A 4Z1BA 4HZ8A 1YDNA 2CKRA 3PC0A 2HRWA 2OTDA 4XBJA 5CGTA 5FF2A 1I2QA 1EQCA 4HPXA 2IQTA 3GYCA 3N19B 4O53A 2GJRA 3G6MA 1OGGA 1HVXA 2DIKA 3EB2A 1GNXA 1KM0A 2QHAA 3HFTA 3AYVA 4CKQA 2WJDA 3LA4A 4IL2A 1V3IA 4PRWA 1GQKA 2XFYA 5CPLA 4GZJA 4OKDA 1O7AA 3L4VA 3BAIA 5EMJA 5C2CA 4A8IA 4Y6GA 3I3BA 2E1DA 3L5AA 3WH8A 1I9CB 5ECVA 4DYJA 3STFA 4PTXA 3BQ5A 3ZT7A 3HQPA 3RR1A 2FZDA 3T55A 1J6PA 4K7YA 3QHMA 1EUAA 4LB3A 4GI4A 1PIFA 4A6GA 4B5VA 1WAUA 3II1A 2ZXBA 2B7QA 4XZLX 3VOCA 2OR2A 3H8AA 1M3UA 3EEGA 3MWAA 3ONCA 2VL4A 1Y5XA 1OBAA 3A4JA 2HNEA 5FF7A 4HN8A 3MSYA 3KLLA 2V38A 3L2LA 3WEZA 3KDNA 3FHQA 4A8NA 2NXGA 5C2GA 3TKFA 4DPPA 1XIIA 5BMXA 1I45A 1M7OA 4TO8A 3PJUA 4ZVJA 4H19A 1BXBA 3GXTA 3LSCA 4AC7C 1H60A 5JU6A 1KBKA 2ZTJA 1LZOA 1H61A 1TZZA 1EHAA 4F40A 1ZP3A 5C70A 2YA0A 2XVPA 2X40A 2PWEA 2PSNA 3W75A 2GK1A 4J4KA 3TR2A 3W1UA 1FA2A 4A3QA 5JQ9A 4HP5A 2GLKA 4ICNA 4O28A 3H24A 5KETA 1CLXA 1LOQA 3TEVA 3DXIA 3NQDA 3TQVA 4Q4OA 1K3UA 2QPSA 3PJXA 4GY7A 5G2IA 1V3MA 5EGRA 1JDFA 3U0HA 2ZCGA 4F2TA 2D3NA 2OZ8A 2J9YA 1RK5A 4LANA 1EC9A 3KZSA 3ZQ9A 5CSYA 1TJ2A 5JBDA 1F07A 5DELA 4AMAA 4BS0A 1QATA 4QNEA 1Q6FA 4GHRA 4GI9A 5HMDA 1W1YA 3MCMA 3FY1A 1TPC1 1S1RA 4MLRA 1KM3A 6CGTA 1XUZA 1NOUA 3P93A 4LU0A 3BSGA 4LAZA 1XH0A 4L80A 1TIWA 3BDKA 1K8XA 3G0UA 1OIFA 4G7FA 1W1A1 4OU1A 1NFPA 5MKGB 4B5NA 2EPHA 4Q3MA 2IPWA 3NQMA 1PX3A 3NJ3A 4Q6JA 1V3HA 1PKYA 2DY3A 1XIBA 3DC0A 1YHTA 4GQRA 3AYRA 4KW2A 1A5SA 1WPCA 3CLWA 3OU8A 1EA9C 1VJSA 3I6TA 2IPGA 3LRLA 3F2CA 3GBEA 1K8YA 3BOXA 1I2OA 3LN3A 3DZ1A 4AWEA 3QLLA 4H3DA 5CH9A 3BAWA 4FP1A 1NFGA 4HNTA 2BS9A 3ZLFA 3WJXA 1SMAA 4PCPA 2FHBA 2OCZA 1QOXA 3ERPA 2W62A 2YZRA 4RE0A 1C9WA 3CYJA 4RDWA 3WH5A 4LB4A 2XH0A 3OLDA 2OO6A 3BUVA 3RDKA 4WSJA 3FGCB 4IT1A 2Y0FA 3VGFA 5KINA 3V4BA 4A21A 5A6BA 4U10A 3P84A 2Y88A 1JD7A 2YB4A 1X97A 1N8WA 1RLDA 5H1WA 6PTDA 4IIBA 4MJ4A 1KKOA 3EWXA 1KXQA 3QZAA 4F9DA 4I5UA 1IQ8A 3LZ5A 1Z6KA 3CV1A 4HSHA 2VQTA 3NQ8A 2EG8A 3QTPA 1QW8A 2C18A 2FZNA 4E4FA 3W02A 2WK2A 1ECQA 1XLEA 4HMDA 4I7VA 3FHAA 1HVQA 2HCVA 3VIJA 1OX4B 4YIWA 5FKYA 4GY0A 3CQKA 5LGXA 2JGYA 2J62A 4KRZA 3SRKA 1EC7A 1UD5A 4MWAD 3WLIA 2Y2WA 3G18A 3NTYA 4H2CA 5CBJA 4QSFA 3UNTA 1Q13A 1A5OC 2OYKA 2A7NA 2F7FA 4KQNA 2J8TA 4X3ZA 3NL2A 1XIGA 3W07A 2DUZA 1GW1A 1DPMA 3M7WA 2ONEA 4IG2B 5FJJA 3TYDA 4J3ZA 4ADTA 1Q7ZA 3MUZ1 2V5BA 1TV7A 3VIPA 4PUDA 3NA8A 1RR2A 1KM5A 1JDAA 2Q8LA 1S46A 3W88A 4QE4A 3U7VA 5C55A 4JTQA 1D7FA 1PKNA 2Y8KA 3TTYA 5GJPA 2AL2A 2VRKA 1W1PA 1A4LA 4V2XA 1AD4A 2QJMA 3U48A 4Q8QA 3VVGA 2J6VA 1JZ2A 3IVUA 3AIBA 1OFOA 3JU2A 3V0SA 3ICJA 3M5YA 3TIMA 2ABAA 3W2NA 4QEHA 1WX0A 4N6FA 3TTEA 4ERAA 2OSWA 3L2MA 3EWUA 1ML1A 2BVDA 5EA9A 4AEOA 1TMHA 3ZWSA 1XDLA 3ME3A 4XO6A 3W72A 4YWIA 5KZMA 2A4AA 1UZDA 4HGXA 1B3VA 3EX4A 4C1NA 3ARWA 3VNKA 2FTYA 1D3HA 2J7FA 3QMTA 4JEJA 1T7LA 1NH6A 4P7NA 3GKAA 3VUPA 3A6OA 4JN7A 2UY5A 3RFAA 2GL5A 5M3WA 1M53A 4FNQA 8XIMA 1PWLA 4B3KA 5A2CA 1JJKA 1TR9A 3UZJA 3NR0A 3PTQA 2QYGA 1BFNA 3BSMA 2YXXA 1V93A 3GR7A 3SUUA 4B92A 1XYAA 4MPKA 3TONA 5FJRA 1YE4A 2Z0IA 5XINA 4LOCA 3OIXA 1MRQA 4F9JA 2RDTA 1XISA 4M24A 3O3RA 4GGBA 2BY1A 2B0MA 5JUVA 1KM2A 3UR8A 2WJFA 2VVSA 4LEQA 1ISZA 1LRQA 1E0VA 5F2MA 5C8BB 5K7JA 3W1NA 1VPYA 2X42A 5A8NA 1U5VA 3AZRA 1NWTA 3WLTA 2PRHA 4TMCA 3EX1A 3PB0A 4HPHA 1QNQA 4PUMA 3W1PA 1SR9A 5BXTA 4F2BA 4Q8OA 3TOYA 3TYUA 1G4SA 3FA4A 2BVTA 3DFYA 4Q4KA 1R7AA 1P0NA 4IPIA 1NOWA 3PS7A 3SADA 1BSIA 1A0EA 1XDMA 1PHWA 4ZTXA 2BWGA 5HATA 1NQKA 1CB7B 4BI7A 4MB3A 1WO2A 5C5YA 2B7NA 4GMEA 3N6HA 1SO6A 3C0QA 4U4MA 1HKMA 4LJ3A 2UV8G 3WLHA 1R2TA 2CBVA 3VC6A 4JIRA 4NU7A 3IVSA 4JTJA 4NSBA 1OCQA 3GQYA 4Y7EA 3E2VA 2R1MA 3T1GA 3W25A 3H55A 1FWAC 1JXKA 3NZQA 1S2TA 3GFYA 4E8CA 4JGDA 3HN3A 3VOHA 4FK9A 4NJKA 5IBXA 1EH9A 3LXAA 2ASHA 3MP3A 5AHMA 3IJQA 3VIGA 4NI3A 3D5HA 1NP0A 4PTWA 5GJMA 2GUUA 3C2RA 2QNEA 3KBNA 5E9XA 1PIGA 1JYVA 4GPNA 2GPTA 1TV3A 3QV6A 2IXUA 5GNZA 1O6IA 4UZUA 3VINA 1MXGA 2OOFA 5LIWX 1QI0A 1KV8A 1NDVA 2INEA 3W6YA 5I77A 4C6LA 4QGCA 3MZ2A 2Z24A 3TROA 2IKHA 3OVRA 1UYQA 4ZA0A 2W92A 4DWSA 3FW6A 3DERA 7REQB 1W5QA 2V3EA 5LNUA 3CT7A 4F0MA 5CAHA 2DVXA 4MY9A 1NWSA 1L6GA 4K1WA 3ABRA 5HWMA 1SPQA 4DO7A 3AHVA 3SURA 5HPCA 3NCOA 1BVZA 1DWJM 3W2UA 2VCAA 4AYSA 2X1SA 1ADSA 2G3JA 3GVRA 5CLWA 1O5RA 1LF1A 1LRTA 2R14A 1OYCA 1F7BA 3GUWA 2XFFA 3KP1A 2JBMA 3LGGA 2Z1SA 2BFGA 2WPBA 4QSHA 3QPYA 3R25A 2Q3OA 2WMFA 1IR2A 5CPOA 2XVKA 2G4JA 4X9SA 3BOLA 4XAFA 1C8VA 4FI4A 1UD2A 3URNA 4N7QA 3VFLA 4JFTA 2WZIA 2PTYA 3TNBA 3OG2A 5AYBA 1LCOA 2BNJA 3RPMA 3VUSA 3W85A 1UROA 3E5PA 1I1WA 2XIJA 3GY1A 4K36A 3FCPA 4QLLA 1VHCA 3NQAA 3TW6A 4WK9A 3O8AA 1GVQA 2WV8A 2RDXA 3EXRA 4WVXA 4LH8A 2YFOA 3PBVA 5FJTA 2O9PA 1MQRA 4KCVA 3OLIA 2ACUA 3UPBA 3MKKA 2CCRA 2DIJA 3KBMA 1QT1A 5A6BD 4TTUA 3UZ5A 5AHIA 1OC6A 3KRBA 5D2TA 2A3LA 1EX1A 2Y63A 2INFA 3H2MA 3GIYA 4AVFA 1JYWA 4AB4A 3WY1A 4BK9A 1QAPA 3UCDA 4Z2IA 4LT9A 3LENA 2W5FA 4PMJA 2CLIA 5HOSA 1F3EA 3RLHA 1KCXA 2VQUA 2FVKA 3CPUA 1MI3A 1HJXA 4D8AA 2PE4A 1UWQA 1O95A 4JFUA 1ZQ5A 1KTNA 1TCDA 5A1AA 3VOJA 2FIQA 3CBWA 1AQ0A 4O1BA 3W2JA 4X22A 1IV8A 1G6CA 5SWUA 3GHSA 1QVBA 5I0DA 1AH4A 1YEYA 4QDPA 3N4FA 2VFEA 7PTDA 1ZBCA 3UWWA 1AL7A 1J18A 3W7GA 2Z1BA 3T6CA 3PHAA 2ZA2A 1KGXA 1JAKA 3MT1A 1WDDA 1W17A 1IWAA 2WXDM 5DEZA 5DN1A 4ZO7A 5DX7A 3AC0A 3H4WA 1OWQA 4CQCA 2ADAA 3LOTA 4REQA 4PBGA 2AKMA 2ISWA 4LUJA 3WQ5A 4EK7A 2E40A 2DQWA 1W32A 4YTQA 2GJXB 3ID7A 3MV11 1S3HA 1J2WA 2Y8UA 3T05A 3ZLGA 1JFXA 3NNTA 5K9CA 4IUOA 4DXXA 1IEVA 4OE7A 2WMHA 4FLQA 4RDZA 1PCWA 1AW2A 2KZHA 2GJPA 2Q71A 2OSXA 4BI5A 1XYFA 1POJA 2CU0A 1TPDA 1DXIA 3DGBA 3QKEA 1RLCL 1QI4A 4A35A 4M81A 3W7JA 2PMQA 4HOZA 4QIUA 1NWRA 2R1PA 3A4WA 4GZIA 5D33A 2G0WA 1Q6RA 1PHQA 3CO4A 5F1UA 3UJFA 3IIXA 5JIWA 3E02A 3EGJA 3E74A 5CJNA 1VENA 3WQEA 1OQFA 1QI5A 2VVNA 2PI6A 1AQFA 1AJZA 3NQFA 4FB7A 1H0GA 3AXXA 1SU5A 2FZMA 4JDYA 3TJXA 1F05A 1EP3A 1VS1A 4XKYA 3MDWA 3N73A 1F4AA 4RXFA 2JK2A 3EXSA 1X98A 1ZZMA 2G37A 3UZYA 1F74A 3M44A 4NUWA 2NQ5A 4XK2A 3KCJA 4WDTA 4I9AA 1KFWA 4QDWA 5CQ1A 3MQTA 1VQTA 3UQNA 5LA1A 3CEPA 3A5VA 2WVTA 2UY3A 3MTWA 4HA1A 2CNCA 4AEFA 1VLWA 3N3TA 2QLYA 2ZYFA 2J7GA 1L0PA 1LWHA 3PZUA 4PFMA 2J9ZA 4QR6A 1TR1A 4LUIA 1JYXA 3OLEA 4W8LA 5HDRA 2NQ9A 2OZ0A 1BQCA 2WC4A 4ZE5A 5G4WA 4K39A 3AHTA 1VCFA 4RKAA 3N25A 3V5CA 3OOQA 4XVEA 2HK1A 4E8GA 2ZIDA 4LSBA 3L0NA 1XC6A 3STCA 3EXTA 3QSRA 2UWFA 2NLYA 1CGXA 2PTZA 3C3NA 1W9PA 5FIPA 1WDSA 5D2XA 2WLZA 1LYXA 4GVHA 1GG1A 3KOFA 3UY8A 4ZQMA 3C86A 5EFFA 1Z48A 4CN6A 3G8RA 3VXGA 4HMCA 4JCMA 3PP7A 2E77A 4J2MA 3KVJA 2DSWA 1H09A 1SJDA 3FJ4A 4JQAA 4Y9NA 3RXZA 3T2OA 4QAIA 2EG7A 2CETA 1XUUA 2FHFA 1IT7A 1BHGA 3R10A 2WMKA 4MNKA 3OZYA 1QI2A 3NQ2A 2Z1WA 3EWDA 3GH7A 1JQXA 1UHVA 3L0KA 2A21A 2NZLA 4DRSA 5KITA 4LCSA 2JKEA 4GFSA 3UXKA 5KTLA 3UEQA 1QDSA 4O10A 5LXXA 4NNBA 3FSUA 1PDZA 4DUVA 3S42A 1MEWA 2R9RA 3AXHA 1ZAIA 3AJ7A 2F2KA 5AECA 5FJOA 3CXOA 4PTNA 1R3SA 2C7FA 4WJXA 2F6KA 1OCBA 4YLWA 4GNVA 3QW4B 4XAGA 4XBSA 3VOGA 1SW3A 3RRAA 4DWSD 1FFRA 3DKJA 1GVOA 3HURA 2VZSA 4HSNA 1TWIA 4C1LA 1V08A 4DI8A 3ARUA 4NQ1A 1KXHA 3UWEA 4ERIA 4JOMA 4FLSA 4H7VA 1X6UA 4F0RA 3DHDA 3UJEA 1J0JA 4GXWA 3S6DA 2FFCA 1BAGA 4FXRA 2J77A 5A6LA 2O9TA 5G4HC 2G4FA 3DBNA 3Q2DA 3UETA 3BE7A 1H5YA 4UQCA 3SEPA 1IF2A 1TZ7A 2D1ZA 3QR1A 3G1HA 2V67A 4NX5A 3B9AA 3DKLA 3MU7A 1LOLA 5JH2A 4XSMA 1EA0A 5K9DA 4IISA 4AX7A 3S9YA 3AIEA 2UY2A 1A5BA 3V5FA 2JF7A 3VAVA 3HGRA 1BLIA 1BGAA 1R6WA 3PPGA 2IKGA 3CQIA 1T8XA 1JCMP 2OT1A 5IRPA 1I2RA 2NXIA 2XSBA 3BTNA 1F3TA 3GG8A 3E0IA 3M16A 1P6BA 1VYSX 5AKQA 4MKSA 4OECA 1S38A 1XH2A 3GFXA 4JKLA 4GBDA 3VKCA 4HK7A 4DJDA 2YZ5A 1BG9A 3W28A 1FX6A 4BEUA 3EWCA 1H50A 2E67A 1AG1O 3RN6A 1Q7QA 4Q4RA 2J75A 3L5LA 1V02E 3MV01 4ZODA 4AISA 1ICPA 2MNRA 4EXAA 1HJSA 1CCWB 5D03A 3KXQA 4IMAA 2IW0A 4I6VA 1RY8A 3OVPA 3CHVA 3BMWA 4P7OA 4JTRA 2Z00A 3EKLA 1RXOB 3LHZA 2ZRVA 4OUIA 4ACYA 1D8CA 3TN4A 1ZY9A 3KS6A 1V3JA 3A23A 3KOYA 3RMJA 4QQUA 3NZRA 4L6OA 3VIFA 4NAEA 4A05A 1XLKA 3KX6A 4NF7A 1DJNA 2OFJA 2JQXA 3WQGA 1TE6A 1TPH1 4IGHA 3B0VC 4Q8TA 4MFDA 4P8UA 4JHZA 1REQA 2WNQA 3OPSA 3IPWA 3I6RA 2P88A 1Y7VA 1K4GA 4W89A 1XLAA 5FOOA 5DANA 3K1DA 2NVDA 3WMLA 2I16A 1S2UA 2ZICA 3NURA 4DBDA 1ONWA 2W9MA 3WH6A 3IIOA 4Z0JA 1RPXA 1HP4A 4GUHA 4BWLC 4UTMA 2WNWA 1V0NA 4EWJA 1ZLPA 4GVIA 1TVNA 4F79A 1OK6A 3VE7A 5C71A 5F4WA 4S3FA 4D8LA 3TNOA 3LCHA 4W84A 4AF0B 1TTPA 3AMCA 4EWND 4RV3A 1P48A 3B8TA 8CGTA 5CG0A 1UR8A 4KWOA 4S39A 2WMGA 2CWNA 3AXKA 3NZPA 1WXJA 1PS9A 5LHEA 1QWGA 1UCWA 2X1TA 3AS1A 3MZNA 3T40A 2XIBA 3FXYA 4MAVA 2Y7FA 2V3FA 1XG4A 2ISSA 4AD1A 2IKIA 1CTNA 2Z1VA 4XZBA 1RQHA 5AYXA 3TWBA 5A6AA 1PL9A 4CQAA 1G4PA 4NZ5A 4FAMA 3PFRA 1GJPA 1GOOA 2GUBA 4I6KA 4MNJA 3UY7A 1VRDA 3PAJA 3ZZ1A 5D9NA 4Z08A 3TLQA 1TA3A 4NX0A 5HNTA 3P3BA 1OADA 1K9DA 4B16A 3THUA 4OV4A 4JX6A 4DB7A 3ARXA 4OBRA 4TQTA 1E15A 2DZPA 4B15A 3T81A 1S3TC 1JF6A 3D46A 4EKJA 5BRPA 3H26A 1XBYA 5FL0A 4NYYA 4DAFA 4WR3A 1SO5A 1Z32X 4NXKA 1O1HA 3SY1A 4OIFA 2HPIA 2VFDA 3VNZA 3CNYA 3HPZA 3O1NA 4JICA 3GAKA 2OXNA 3LYEA 4LAUA 4P61A 4Q33A 4Q8WA 1A5CA 1YTEA 1E3XA 3G1RA 3CM4A 3V7PA 2OLAA 4W5ZA 5LIYX 4C90A 4W88A 3U5UA 1JZ4A 1ZBKA 1BTMA 3MSRA 1GKPA 2XH2A 1UA7A 3GD6A 4KH2A 4G56A 2VOTA 5IM51 2HXUA 2PF0A 3K4DA 3ZJ6A 4J3WA 4H8HA 5E1QA 2X30A 1XICA 4EANA 1A5AA 1U83A 1MZHA 3GTIA 1J5TA 4YVPA 2ZZ5A 2VHLA 4X0NA 4L9XA 2FTPA 3TC6A 1MEHA 3AIUA 3VD7A 4ZGYA 1GVFA 5E6YA 8RUCA 2EPKX 4ZXLA 2DZWA 4IMFA 2W63A 1P7TA 3G77A 1UC5A 1E55A 3EMCA 4W87A 2D2GA 3MP5A 3APGA 2ZX8A 2X0YA 4CQ9A 1ZRQA 4TTGA 3ABXA 4C6MA 4E4UA 3T0CA 4RCXA 3M5ZA 1V6UA 3CASA 1R9XA 2MUCA 1W0MA 4FIRA 3I4EA 1EOKA 4EPBC 3STEA 1UUMA 2GZXA 1G4EA 4KBXA 4I9TA 4KEVA 4AD3A 2JKAA 3BG9A 5JBEA 2POTA 5CC5A 2PDJA 1ELSA 3P5ZA 4EACA 2GVYA 3W7EA 5HNRA 2NV2A 4AWTA 3KE0A 4JQ1A 4AY1A 4NAFB 2YA1A 4ZQNA 4H83A 4JQ2A 4QROA 3BW3A 3UXLA 4W8AA 4HIBA 3IJDA 5BRBA 3UA4A 3ELFA 3PZOA 2GDUA 3UR2A 5BYWA 2E25A 1W8SA 5DBUA 3IGHX 1JI1A 3WQVA 4GXPA 4FNRA 2TPSA 4CNNA 5CBIA 4G7EA 3LCIA 3C5QA 4PB4A 3TW7A 3H2CA 4E2BA 1PTGA 3BMXA 3U4FA 5G1TA 3TVAA 3JW7A 1NDZA 1XYZA 4GVFA 1P1XA 4DZHA 4JNYA 2C8NA 4AW7A 1V79A 1LQAA 3AYSA 3G1AA 4B4HA 2DSVA 4CQBA 3AUJA 3NQVA 1US0A 2X7WA 1U1JA 2PRMA 2R8WA 4FXJA 1NVMA 3V36A 2E9LA 2VD8A 1T0OA 4ASTA 5EPDA 3TSDA 1POKA 5D38A 4IP4A 1XH1A 3SAZA 3A3WA 1TRDA 3N4EA 1K6WA 3NZGA 3LGEA 1JCTA 3WNPA 3CIXA 1CXFA 1DJYA 3MKCA 4QX4A 1VJZA 3DX5A 3MUXA 2NV1A 1GVSA 3TYBA 1CGTA 1IZKA 1HZYA 4QE5A 4AZHA 1RSCA 1E40A 3RHGA 4AZBA 3CUGA 4LW7A 1O5KA 1M41A 3QPZA 1MDLA 3K4WA 3PZIA 1V7AA 4AHOA 4HHMA 1U5JA 2ZA3A 4FR6A 1P0DA 3LD5A 3KBVA 3RLUA 1BSLA 3GDLA 1XPGA 2QF7A 3OGSA 4KFPA 4KEMA 4DJDD 4P7QA 2Q01A 2ZUMA 1MQPA 1AVAA 4RE4A 4H1ZA 3CHEA 1TELA 2GWNA 1WYIA 1Q6GA 4S2BA 2QDEA 1I6NA 4LBUA 2PLCA 2DW6A 2J7EA 1C3FA 4YN5A 1AQHA 3BV7A 2EPMX 2QIWA 3L7RA 4IMDA 2VCCA 2J78A 2QJGA 3TFXA 3SY8A 4FA3A 1I8JA 4RNIA 3FYYA 4C6PA 3BC9A 4K8GA 3F4VA 4LYQA 1FTXA 3RIKA 4ZOCA 2AGTA 5FJIA 1PJ9A 2A3HA 2HBXA 3NQBA 1P6CA 4L64A 4IPPA 2TODA 4IJRA 1PZ1A 1FHDA 3MVIA 2ZFAA 3PUOA 5GNXA 2GDVA 5CPMA 3L67A 4KWSA 2PU0A 2YR1A 3H7RA 5HQEA 3N9SA 4W5UA 3DAQA 4IQEA 2QPXA 4KGLA 4EP8C 2QQ6A 4KKXA 3DC8A 3Q45A 1YMYA 4CLMA 3K8KA 4HHLA 1I0DA 4P8WA 3PF3A 1R3YA 3A5FA 1C7SA 4FOKA 1G1YA 4NZ1A 5CPNA 5GQBA 5H8MA 5HQLA 1L6WA 3BWWA 4CU8A 2QPUA 4EE9A 2ZUVA 1HKIA 2V68A 3F7JA 3M0JA 3K1GA 2D20A 1KRAC 1X1NA 4W93A 1HO1A 1MFVA 3U8GA 1JRCA 3OJGA 1ZU8A 1CGUA 3WDQA 2PDYA 2WJZA 1X8CA 1XG3A 1C93A 4H04A 4D2JA 1LBLA 3GVGA 5I2UA 4QRNA 3T0DA 1QTWA 4PMUA 4XD6A 3WN6A 2WMJA 3OHIA 1ME9A 1MUMA 1NAL1 1QU4A 3M41A 4EPEC 4C65A 3OB8A 3QF0A 3TCEA 3O05A 1E72M 3LHUA 3BQ6A 5E09A 2YLAA 4HQVA 4OUEA 4PA8A 4X0VA 3SCPA 1AFSA 2H9AA 3A21A 3GNPA 5JH1A 4HNUA 2AQVA 1LUCA 2EPOA 4ZEPA 4MKVA 1E56A 1KFEA 3WBYA 2J88A 3VDAA 3T07A 3D47A 3LMZA 3LGDA 1TMQA 1BXNA 2C6QA 4RNFA 3NM1A 1FWDC 4F0LA 4LNCA 3SGZA 2ZQ0A 4NASA 5KZDA 4CGTA 2GUYA 4JL2A 3CUFA 1TPUA 3VIHA 3FLUA 5AHNA 4AQLA 4IX0A 3FK4A 1R3RA 1JCLA 2I17A 2WZEA 2PP0A 3QY8A 3PBYA 3OZMA 1HL2A 1GJUA 1EJRC 2QV4A 4BQ2A 3SIMA 4B91A 1VFHA 4GQGA 2EQDA 2PA6A 1U22A 4NJHA