4XVEA

17beta-hsd5 in complex with 3-pentyl-2-[(pyridin-2-ylmethyl)sulfanyl]-7-(pyrrolidin-1-ylcarbonyl)quinazolin-4(3h)-one
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 117
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xveA00
4R9OA 4WRHA 3LENA 2PD9A 2A79A 1RALA 3CAQA 3R43A 4G5DA 4JIIX 3BURA 3UG8A 3G5EA 3UGRA 1YNQA 4JQ4A 4XVDA 4XVEA 1PYFA 3P2VA 4JIHA 4XK2A 1MI3A 4JQ2A 1Z8AA 4LB4A 4EXAA 2IPJA 4JQAA 3R8HA 4LBRA 1YE4A 4AUBA 3UZYA 2WZMA 2HVOA 5LIUX 2PDQA 2BP1A 2ACRA 1SM9A 3F7JA 2INZA 3LZ3A 1EL3A 1RY8A 3QKZA 1S1RA 3WBWA 4Q3MA 4XZHA 3EAUA 4MHBA 3N6QA 5AZ0A 4HBKA 2IQ0A 4WDWA 3GHTA 4XAPA 1AH4A 3DOPA 4QX4A 1LQAA 2QXWA 1VBJA 3LBOA 2FZDA 2P5NA 4DBWA 2ACSA 3T42A 4FALA 4PUWA 3LNMA 3V0UA 1Z89A 1ZGDA 4F40A 2IKJA 2IPGA 1X98A 3EB4A 4GQGA 3D3FA 3DN5A 3UZZA 3V0SA 1T41A 4FAMA 2PZNA 2F38A 4IGSA 3LUTA 5HNTA 2I16A 2PDWA 4OTKA 4LBSA 3BCJA 4XO7A 2ALRA 3WG6A 4WDTA 2PDUA 3M4HA 3UFYA 2PDKA 4WDUA 2PDNA 4GABA 4PR4A 2PDXA 2HDJA 1ZQ5A 2J8TA 2NVCA 3RX2A 4NKCA 3G1RA 2IQDA 2CLPA 3VXGA 3H7RA 1UR3M 4ICCX 5JH2A 2ISFA 2PFHA 4XZNX 2PDGA 3LN3A 3N2TA 3R6IA 2IS7A 4DBUA 1M9HA 3FX4A 4WGHA 4PMJA 4HMNA 3MB9A 1US0A 2PDCA 3ONCA 1AFSA 1IHIA 3ONBA 3LQLA 3R58A 5JH1A 2PDMA 2FZ8A 1AZ2A 4FZIA 4GIEA 4YU1A 4WEVX 2VDGA 3RX4A 1XF0A 3BV7A 4ASTA 1HQTA 2FZBA 4EXBA 4JIRA 2PD5A 3U2CA 3UP8A 3WBYA 5LIWX 4WDXA 1LWIA 2IKGA 2IKHA 1OG6A 3LZ5A 4PRRA 2HE5A 1AH3A 2IPWA 1ZUAX 4L1XA 4ZFCA 4JTAA 1YE6A 4LAUA 2IPFA 3NTYA 4H8NA 5DANA 3ERPA 1PWMA 2DUZA 2HV5A 2BGQA 3CAVA 4Q7BA 1PZ0A 2R9RA 5HNUA 3M0IA 3KRBA 1A80A 3UZWA 4QXIA 1QWKA 4I5XA 4YVXA 1VP5A 3V36A 3GHUA 4PRTA 1EKOA 5LIXX 3Q65A 4GA8A 1S2AA 1S2CA 2BGSA 4PUUA 3H4GA 3R8GA 1QRQA 4JTCA 2FGBA 1K8CA 3CMFA 4JTRA 4GQ0A 1T40A 2FVLA 2HVNA 3EB3A 2PDPA 4DBSA 3C3UA 1EXBA 2ACQA 2HEJA 1X97A 2INEA 3O0KA 4XO6A 3LQGA 2PDFA 3MC5A 1PWLA 4YS1A 1MRQA 3CV7A 3GHRA 4LAZA 5LIKX 3LD5A 1ZSXA 4JQ3A 4H7CA 4QR6A 5M2FX 1JEZA 3Q67A 5HA7A 3H7UA 2AGTA 3O3RA 4IJRA 2NVDA 4YVPA 2F2KA 1MZRA 4GCAA 4RPQA 3GUGA 5LIYX 1RY0A 3CASA 5KETA 1XJBA 2DV0A 4DZ5A 1EF3A 2I17A 3S3GA 4XZIA 1Q5MA 1Z3NA 3UWEA 3WCZA 1GVEA 3R7MA 1S1PA 1YNPA 4QBXA 4L1WA 4JQ1A 2HE8A 2PDLA 1Q13A 4IJCA 3GHSA 3COTA 3UYIA 2PDYA 2C91A 1ADSA 2R24A 5C7HA 2IKIA 2FZ9A 3FJNA 2PDHA 4FA3A 2PDJA 3V35A 2PF8A 3UZXA 4GACA 3R94A 4XZLX 2ACUA 1Z9AA 3V0TA 4LB3A 1X96A 1FRBA 3CV6A 2WZTA 1PZ1A 1J96A 3WBXA 1AZ1A 3LEPA 4JTDA 5AZ1A 3BUVA 3RX3A 2PEVA 1R38A 4YVVA 2DUXA 1XGDA 2PDBA 1AH0A 3M64A 4XZMX 1IEIA 3B3DA 1C9WA 2PDIA 1HW6A 4JTQA
chains in the Genus database with same CATH superfamily
1YXCA 1V0MA 2ISDA 2G3FA 3PWIA 3PS7A 3U4FA 4Z1BA 1V3IA 7XIMA 4QEHA 3V1HA 1HVXA 3BURA 1E72M 3O05A 2PBOA 1Z7AA 3KZPA 3UU0A 4EVZA 1QUMA 5DCEA 4RNHA 5A6BD 3B9AA 4LRSA 2AAMA 3UWZA 1XLHA 1MI3A 4IWWA 3JU2A 3T0DA 2UY2A 3TNOA 3DHPA 2V63A 4RE4A 1JVNA 4IIDA 4NAFA 2ZE0A 4PMOA 2JKAA 4AYSA 4ZOBA 3U7BA 2VCBA 4A8IA 3VIFA 2D3NA 3R0KA 3VVGA 3ZLHA 1UJPA 3EDEA 4US6A 3PZUA 4S3GA 4B91A 3APGA 5CPOA 3IANA 3JVAA 3SRFA 5I2UA 2FFCA 1JPMA 1S1RA 3CQKA 3UA3A 2QCFA 1XPYA 2PGFA 2JE8A 3WLSA 2CITA 3FA3A 3STCA 3IJLA 4U2YA 4NAFB 3AIWA 2KX9A 1JPIA 4TX6A 1LG1A 4JKKA 5SWUA 4KWVA 1WUEA 3UY7A 3FN9A 3LERA 3UEQA 5AHFA 2ALDA 4QE4A 3LY0A 3CYVA 2FB2A 3MO7A 2E8ZA 4XISA 3PFMA 5CJMA 1RP9A 3LPFA 3PBYA 3WLNA 3N2MA 5HMEA 1TTQA 4DI8A 3W6YA 4RZ4A 4XSMA 1N7KA 4GQGA 4FP1A 2BASA 2P3ZA 3QQWA 2WVSA 5HATA 2XN1A 3BG5A 1FCBA 1XLLA 2F38A 5FA5A 4H19A 1Q6DA 1HL2A 4PUEA 5G1YA 1KKOA 5A6KA 4OVXA 4PE8A 1EIXA 1LJYA 4R3UA 2DORA 4ATDA 4AX6A 4WDTA 3QYSA 1ZTVA 1TWDA 3O2LA 2J8TA 2NVCA 4FIRA 5A6BA 2AAAA 3F03K 1W54A 2VXNA 2PFHA 8TIMA 4RE3A 3HFTA 4I9AA 4HMDA 4IXHA 3VOJA 2EJAA 4O1EA 1TJ0A 4PMJA 2VGGA 1US3A 2VX6A 3ITOA 3EEZA 1TV2A 3MB9A 3ZYZA 3B0YA 5JIPA 5D02A 4C6QA 1AMKA 1XIFA 4PRWA 4W84A 4CCEA 4X22A 1DQWA 1PCKA 3K8LA 5RUBA 3IV8A 2WC3A 2XUCA 1TX2A 1Q6QA 2GJPA 5I3JA 3DGRA 1G7UA 1J18A 2JIEA 3UG5A 3BLKA 1C29A 1R9ZA 2XM2A 1PUDA 1MEHA 3RR1A 4GQBA 3BGAA 4HA1A 1BYCA 3KRSA 4Z42C 1C90A 5KITA 3LNPA 3AS2A 5IDZA 3PPGA 1H5YA 3LZ5A 3DFOA 1BLIA 3F4VA 5F2IA 4QE1A 4ILSA 4HB7A 4R7WA 3UY8A 3VDBA 1P43A 2IPWA 2QEZA 2OEJA 4FLSA 4IISA 1TKKA 2V81A 5EMJA 3CUGA 2ZICA 1JDAA 1O5RA 1Y65A 2X1RA 1DWJM 2YXOA 2XINA 3M0XA 6REQA 3N73A 5ABFB 3E02A 3EMZA 1XPGA 1VQTA 4KCWA 4MTVA 5H8MA 1Z69A 1W56A 3MUY1 3CL6A 5FJJA 3N19B 4FX8A 3RPDA 1HJVA 3WD1A 3O16A 4ZGYA 1WZAA 3UZWA 3ZJ6A 4HTYA 1P1XA 2W63A 1KQYA 5G4EA 4LUTA 1EKOA 2G97A 3GKAA 3H4XA 4L61A 3LLDA 4NJGA 5G5IA 3JW7A 3NGJA 4DF0A 4NRRA 3NO1A 9XIAA 3RDKA 2JGQA 3PUDA 4HD5A 3EB3A 2HVNA 1WX0A 1D3CA 2OSYA 1TUXA 2PDPA 3TSMA 4Q4QA 2G37A 3W7RA 1E40A 5FJRA 1EDTA 1OX4A 1RXOB 5EMLA 3TW6A 3Q58A 1VENA 3SI9A 4NX5A 4J28A 4JX6A 2GDQA 3WF3A 2XH4A 5CPTA 1ITQA 2J27A 1H0GA 1J0ZA 3MUIA 4FPSA 1RCXB 4PMZA 3VNMA 1E71M 5BRQA 4J3XA 1MXSA 3BAIA 1ADDA 4QJ1A 1YPXA 3GU2A 3W37A 5HUOA 3TQKA 1M3UA 4Z2JA 3OA5A 4XG1A 4PMDA 2XIJA 1GPFA 1XR2A 4HK5A 1POJA 3WMCA 4AWTA 4U2ZA 1K6AA 3QHOA 3T0BA 2NQ5A 1GOXA 2RDTA 3VPLA 4QHRA 1PBGA 1F7BA 2VI0A 2DIEA 2F6KA 2JFEX 1GT8A 1W8SA 1LL7A 1G67A 3CBWA 4JTFA 2FJUB 1YNPA 2W62A 4FLOA 2ZIDA 4KFNA 3SR7A 3LHZA 3GKFA 2Z2AA 4IJCA 4UZSA 4Q8VA 1QO5A 3U48A 2YCLA 1ZJBA 1EJSC 4NYYA 2VC9A 1XSIA 4U4MA 3VDHA 1KR1A 4A21A 2POTA 2H8XA 4O12A 4ZO8A 2W66A 4C6BA 3KWSA 3LPPA 3M5VA 1MXDA 4LX4A 3SUUA 4O54A 2Z2UA 1Z9AA 5EMUA 3CIWA 1VFFA 4NF7A 5C7VA 3WNPA 1F07A 4X9SA 2DIJA 4F9DA 1P5BA 3L5AA 4Z2KA 2CNCA 2RKXA 2QUTA 4JNZA 3IS4A 1TWWA 1UBPC 4I9TA 2Y7GA 1TV3A 4QDPA 2QLYA 3NDZA 4LVAA 2PD9A 4PL1A 3M43A 2ZUVA 1DJQA 1R3VA 1Q6FA 5M17A 4WIWA 3YPIA 3M0VA 3CUXA 4ZMGA 4F0SA 1CDGA 4YCPA 1JZ2A 4JIIX 3R43A 1S3TC 2BBFA 4Z2HA 2C16A 1LZOA 1VFMA 4UQ9A 2VJXA 1CCWB 4XK2A 5A6TC 4EK7A 4GI4A 1DP0A 3VGFA 2O4QA 4LCSA 4YNGA 4HMEA 3GBDA 2WZMA 1XV8A 2REQA 2EPNA 4WK9A 3SEPA 3CIVA 4AY8A 2GGIA 3O9NA 4ZVJA 4FNUA 1J9YA 2V30A 3F2DA 1PHQA 3MCMA 4QLKA 3LZ3A 1XD0A 2YZRA 1O4UA 1RY8A 3VD5A 4Q6JA 4BJHA 3K2GA 4U33A 1BD0A 3FOKA 1MUMA 4DZIA 2V3FA 3S1UA 4GINA 1O7AA 3ZLGA 1VBUA 4CU6A 3EX3A 4AISA 1SZRA 2CLEA 2QCHA 1PZ2A 1TIMA 3C6CA 3M0LA 4YWIA 2E6YA 4DJFA 4B5TA 3H53A 2X42A 3S2JA 1YPFA 4G7EA 4DWSC 3TR9A 1V3LA 1E4LA 1HGYA 2Z4GA 3I4EA 4FALA 3USZA 3W7DA 4ADUA 2Y1HA 4FK9A 3D6NA 1UUMA 2F84A 2WNZA 3TYCA 3EB4A 4HNUA 2J4GA 2DZPA 4XAZA 2GOUA 3S5SA 2C79A 3N2XA 1E6NA 1TELA 3OLEA 3BCJA 5FL0A 3M1ZA 5AHMA 4GYJA 1X8FA 2CBIA 5CG0A 2PDUA 1VS1A 3NXFA 1V77A 5FCZA 4EIVA 2O9RA 2PWHA 2VQTA 3SB0A 4MVAA 4AZCA 3U8GA 3EDFA 5DCDA 2XWEA 1BWLA 4TX9A 5AHEA 1SW7A 3FXGA 3OU8A 5BYWA 4ICCX 3P5YA 1H2JA 4P8VA 2JF6A 4GY1A 4RW3A 5IXEA 1VBHA 2FPVA 3CH9A 2NV1A 4WGHA 1JAKA 1EHNA 1XL9A 1US0A 1Q6EA 3VOCA 4KGJA 3CUZA 1QBBA 2RAGA 1CXLA 3HG4A 3H24A 4QRNA 1FHDA 4IZGA 1EX5A 2HROA 1IZKA 1BSLA 4A3QA 4CQBA 3WBYA 3TK7A 3K5XA 3E5BA 4CUCA 3P62A 1BYDA 3RN6A 2J7FA 2YB1A 1UYQA 1ZAIA 3O0FA 1RVKA 3VUSA 5HJYA 3UXAA 4A2SA 3IV3A 3B8UA 4O11A 3N4FA 2V9DA 4E2BA 3KAOA 2J6VA 4XZBA 1JYWA 3EWCA 3QV7A 1NEYA 2WSQA 4RR4A 3TA6A 2BGQA 3R79A 3L2MA 4W8LA 2VD8A 4ZE4A 3FCPA 1JR1A 1JXKA 5E1QA 3DI1A 2I5QA 3ARUA 1BGGA 4YVXA 1TCMA 1E55A 3P67A 3W7CA 1AQHA 4UTKA 1J93A 3UXLA 3E5PA 4JTRA 1KFKA 4PB3A 3NQBA 3LM3A 3MP4A 3B0PA 5C9UA 3WLPA 1EDQA 1VFSA 3OEXA 1RP8A 1TWIA 1GORA 3STGA 1TZ9A 3HGOA 4WQ6A 1H11A 3XINA 1XQKA 2DVTA 3ITYA 3KOYA 1LLZA 1XKJA 2E6FA 1HJSA 1DJHA 1JRBA 1JI2A 3RJYA 4DWSB 1PE1A 3C8NA 1WB0A 1VHCA 1EUNA 5FJOA 1F6PA 3MS8A 4IIBA 3L4ZA 5M1TA 3P6LA 4H8HA 1E1CA 1FFQA 4RDWA 3I6EA 4QROA 5LNVA 5DEZA 2RFGA 3N4AA 4C6LA 1WYIA 2HZGA 1RQEA 1SQ7A 2WKGA 4FNSA 1TPVA 1LLWA 3TXZA 4M1BA 4O52A 3ZR6A 2PRLA 4H3DA 5IFPA 3POCA 2BVTA 1XYCA 1UH4A 2UWFA 3UWVA 3RG6A 3AIUA 3KP0A 2QJIA 3OYXA 5CBBA 1K3UA 2TODA 2W3ZA 2WV8A 1C8VA 4GK8A 1PKMA 4MDPA 2BHYA 1WZMA 5C7HA 3E74A 3VFLA 4AHPA 3DIPA 2IKIA 3P7YA 1OQFA 1TX0A 1CGVA 4DF1A 2PDJA 4ACZB 4IQEA 4JPGA 3PB2A 5A6SA 1FH7A 1Y7VA 1MSSA 6TIMA 2A21A 3V0TA 4X60A 1DOSA 3AZRA 3CV6A 1WA3A 1TCDA 3WLIA 3SCSA 1LBMA 3GDMA 2AMXA 2CERA 3BLFA 2EPMX 2YLAA 1F6YA 3FFSA 1FUYA 2A3AA 4Q4PA 3EOOA 3DFSA 3FYPA 3WD0A 3SCRA 2A3HA 4GC3A 2QUNA 3CL8A 2R14A 3QSTA 2XH2A 1ZCOA 2VO5A 1LQ0A 3VYLA 3UJEA 3LOTA 1OX6A 3VI2A 3AUJA 4KWSA 4P7RA 1O68A 4XVDA 4C6CA 4XVEA 1QOXA 3GXFA 5HINA 3B8DA 1SFLA 4AF0B 4OECA 5A8PA 1VFLA 3OJGA 2HVOA 4AQLA 3RM9A 3F4DA 3FEQA 1VJIA 3PNZA 4DM2A 1DKWA 2ZDRA 3P0XA 3OQEA 3G0UA 2E1DA 3QMSA 2YA1A 3W1LA 1PTAA 1KM4A 3N34A 4P7OA 3URNA 4Q3MA 4MY1A 4W5UA 3ZR5A 4O19A 2X30A 2XFWA 4DELA 2QMKA 4AIUA 4PTVA 4LC8A 3RYSA 2E9MA 2J7EA 5FL1A 3T40A 5HULA 3QV9A 3GHTA 1U1HA 1A53A 5GNZA 4H8UA 1H60A 3S47A 3GTIA 2A6LA 2PTWA 2Y0FA 3PTKA 3S5YA 1TVPA 4DO5A 4B4FA 4Q4RA 3P93A 3ZO9A 1EUAA 1M7OA 2PLMA 2POZA 3ZLFA 4QCFA 3GR7A 2VR5A 4JL2A 4DJEA 2HNEA 3E0FA 4DJEC 4FAMA 1E51A 2GUUA 4ATLA 4IGSA 4ZSTA 4CN4A 5GJMA 3GBEA 5I02A 1F5ZA 1JULA 3OPSA 1XLGA 4HYVA 4IG2A 4BKNA 2PTYA 5LXEA 4UB9A 1NTHA 1JCJA 4O1FA 1G4EA 4N02A 3G77A 1RJQA 1IWPA 1SU5A 3L4XA 1LRNA 3P3BA 1S2WA 4C1KA 2PDXA 4AEEA 2W9MA 1IR1A 1NP2A 1XKYA 2IQDA 2ZRYA 4IUGA 2DPEA 3QEZA 4ICMA 1CZ1A 4K2SA 3B9DA 4ERAA 1P0NA 3FDGA 2I5IA 2GVLA 3SBFA 3CNYA 2QCNA 1OJXA 1LT7A 3UPBA 3M07A 3BW3A 1WXJA 1AZ2A 3L5MA 1ME8A 4KRUA 3CT2A 3DXIA 2CHNA 3AI0A 1VR6A 3NQVA 3K1DA 2VCAA 4WD0A 1WDWA 1EGZA 1J79A 4ZQPA 3S1XA 3MZ2A 5DRCA 5ABHA 4AWUA 4DZHA 2YLLA 4GUGA 1O5XA 3K8MA 3F2CA 1IIGA 3QC0A 3ARZA 2IPFA 1OWQA 2VEMA 1PWMA 4ZO9A 3S46A 4XD4A 1OF8A 2OWXA 3FS2A 1GOWA 4HNLA 1ZY9A 3LV6A 4GX9A 2NX3A 4DBDA 4IIEA 1MYRA 1XI3A 2Y5SA 1QWKA 5HJXA 1JUKA 1YBQB 4KGLA 4M82A 3I7SA 3SGZA 3NDYA 4PRTA 4MLJA 5F2LA 1FH9A 4XUGA 1ZRQA 2BFGA 3FJ4A 4JTCA 4ZCWA 1XFCA 4ORIA 1UP2A 2IUZA 1P1MA 3TSDA 3R8RA 5M3WA 3FSTA 4KWWA 2BB0A 2QMJA 2INEA 1E6QM 2R6OA 4GVFA 4CQ9A 2ZTKA 2GQAA 4Y9OA 3SUTA 3QN3A 4LAZA 3CTTA 4HU3A 3WQGA 2OZ8A 3KHJA 2WW5A 4DWSD 5HQMA 4HZ7A 3SURA 5C0QA 3W9ZA 4UTIA 1UD2A 4KEVA 4ZODA 1UD6A 4R33A 3AIEA 2IXVA 3KCOA 4RDZA 1UC5A 3MWAA 3V5OA 1Z32X 3K30A 2ON3A 3EWYA 2BX7A 2VZSA 3WNOA 2VDIA 1UWUA 1E1CB 3H55A 1C92A 1EZWA 2OT1A 3EDDA 3SDOA 1QNPA 4AD4A 6CGTA 4JCLA 4N9BA 2Z24A 4HNOA 3W86A 2HTMA 4L1WA 1JDCA 3PPFA 2BY1A 1EO5A 2DZXA 1K4HA 5E6ZA 3V4BA 1HZYA 4EWJA 3GIYA 3WY1A 2F61A 2TMDA 2XU2A 2FZ9A 4R85A 4JGDA 2FVKA 1SO6A 4H8VA 5LA1A 1EXPA 1VLWA 3ZVHA 2E09A 4J3TA 3CPRA 2V2CA 3VGDA 3M5ZA 4DIAA 3KCJA 3G22A 5TNVA 4LB3A 5LHFA 3W85A 3WLOA 3WNMA 3GRIA 2OR2A 3VAVA 4KBXA 1P6WA 3IEBA 1AZ1A 3AISA 2C8NA 3VDCA 4KRTA 4JTDA 3CUJA 3P81A 2AL2A 1PKLA 4UTWA 4GXMA 3HG5A 2X1SA 4CD7A 1EOKA 4CQAA 4DUOA 1ZJAA 1JF6A 3OBAA 5D2TA 3UBPC 2VRQA 4JTQA 1T0OA 1LL6A 3ECQA 4NJKA 3U57A 3VC6A 3WQOA 3W7IA 4RZBA 3QPYA 3BSGA 5ABGA 1O6IA 2Z2BA 2CXGA 3CAQA 2WWCA 2WK2A 4GIRA 2BXZA 5BRBA 1E70M 3WKZA 5EMKA 1V02E 3TTYA 5JBDA 3L9CA 4IMDA 5FF0A 2QF7A 1UUQA 3UPMA 5I79A 3VIGA 1PVNA 4QQ3A 1HKJA 2QCDB 4ACZA 4K8GA 3N9RA 4AVOA 4JYFA 4HNCA 2V6AA 4Q4SA 4JIPA 2BGNE 5C9WA 2C1HA 3SY5A 2VL4A 5MKGA 3W7JA 3II1A 3PR2A 1U33A 1UH3A 4GIYA 4UIOA 5U4NA 4AB4A 3WBWA 1XC4A 4FB7A 3QTPA 1BG9A 3AXHA 3IJDA 3N14A 3BPWA 1DIOA 5TQLA 2OB3A 2XDFA 3SGUA 1GW1A 1F74A 4FNPA 3W2UA 3EWBX 5A95A 1S2TA 4NXSA 2WMJA 1B1YA 3C5QA 3WL1A 2AL1A 3E0WA 4M7SA 4AZHA 2PI6A 2Q71A 3BAWA 2BTMA 2P0OA 1MFUA 3GC4A 1A0EA 1G5AA 4CCCA 4Q8QA 4QQUA 1Y8BA 2PSNA 2XVLA 1MQPA 3SN1A 1KCLA 5DMLA 4MIMA 2W0UA 1V3KA 4XX6A 1QO2A 4XQ6A 3N2BA 1YRRA 1HTIA 1A50A 2VT0A 1EPXA 4HQVA 4LS1A 2JF7A 3AC0A 3B03A 3PAOA 3W71A 1HX0A 3E3HA 5FESA 1GEHA 3N04A 3VC5A 2GQ9A 2DJLA 1LCOA 2VOTA 1GG1A 3AAMA 4HA0A 2OEMA 3RAOA 1JPHA 4I90A 1E6SM 1X1OA 3NVDA 2GK1A 2JGYA 2W5FA 1BF6A 3GY1A 2ZC8A 4HSHA 3W2MA 1H7PA 4NIRA 3VIOA 1ZBVA 3IUHA 5I3GA 5E9AA 3VNYA 1BG4A 5D9MA 3VZYA 1KM6A 4NX0A 4WOZA 2VM8A 3M9YA 4YTTA 1AW2A 5FAJA 3WD4A 4WOQA 2I56A 1B9BA 2DZBA 2PLKA 1OD0A 1KRMA 4HMNA 2E40A 3SUVA 4X9YA 1VAHA 1W1PA 2G3NA 3PB0A 3OGSA 4B9ZA 1NH6A 2WM0A 3GNNA 4EX4A 2OTDA 4LV9A 4I7WA 9CGTA 4Q8WA 1RD6A 3QJAA 4ZE5A 1IYXA 2VYOA 3LHUA 3FV9A 3KVKA 4U5IA 3A3HA 2WBGA 3MHGA 3OIXA 2Z1WA 4N7QA 4DAIA 4AX7A 3HM7A 4UNIA 1BHGA 4KKXA 1ZUAX 4L1XA 2NQLA 5IOBA 4N2YA 2GDVA 4CNNA 4NT0A 3AWNA 3VNJA 2CZEA 3MMWA 2WPGA 1I75A 4EP8C 5XINA 4LAUA 5GJPA 3DHFA 3N1AA 2OYLA 4H9YA 1UR0A 4IMGA 2DSWA 4KIRA 1TJRA 1JZ7A 3TH6A 1K8YA 3M0IA 1DHKA 4ZL1A 2ZRWA 1F3TA 5JU6A 4DXXA 3LV5A 2YCJA 4RCXA 5C2XA 5FSDC 4IMAA 5FD0A 2YB4A 5DY3A 1DIDA 1NARA 4O1AA 2CZFA 5E93A 1LLOA 3KOXA 3WFLA 1U22A 2O55A 3VZZA 5D4YA 3ABOA 1J0KA 3GHRA 3T0AA 1SO5A 3H4WA 5KINA 5EB8A 2TAAA 3QH2A 1LG2A 1JEZA 3EX1A 2ABBA 2OEKA 4DY1A 1I2QA 3W7PA 4O13A 4I9JA 4LPCA 3A22A 2NT1A 4EF8A 1W2VA 3ZT5A 1FKXA 4LXFA 1UWTA 3RUBL 2Q8ZA 2OQLA 5T91A 4BA0A 2KZHA 4DZ5A 1EF3A 4HCHA 1F3EA 4AEFA 3M41A 4DX3A 4GY0A 1T99A 1YTDA 4INFA 4QNWA 3PBMA 4UOZA 1GVEA 4RE0A 3FKKA 5M03A 4H9XA 3N18A 3D0CA 4PUKA 4C6JA 4OHQA 3LXBA 4KWOA 4O8RA 3LXCA 1HKKA 4GBUA 4Z2IA 1E5JA 3CQHA 3RILA 1H5VA 2YL8A 1HP4A 3RMEA 3WDJA 1B30A 3VD3A 2J74A 5CZ0A 4FA3A 2BSLA 3I4KA 2PP1A 4IXXA 1B4KA 4DWDA 4OIFA 4A4AA 1XP3A 1X6NA 3OLDA 1VFOA 2ZXBA 4REQA 3RLHA 3T0CA 5I3IA 3MYPA 3QLLA 2Y6ZA 3TX9A 1DJWA 4Z1DA 5EMYA 1OABA 1K7EA 1XIIA 1P6CA 1XIGA 1C93A 1SW0A 3LEPA 3C2YA 2VX7A 1G9HA 1UIOA 1X1NA 1AD4A 3GG8A 3IJ9A 3DBNA 2PDBA 2E8YA 2O92A 4XZMX 3GU1A 4K37A 4L6OA 2VUNA 2ATMA 4MJ4A 1TIWA 3LENA 3DGBA 1QPNA 3HIJA 1EC9A 3PAJA 1MEWA 1FBAA 3UG8A 2YA0A 3HZ3A 1EJWC 1GKQA 4DI9A 4IF2A 2FHBA 1UR9A 3BW2A 1R3TA 1BGAA 4IQLA 1A0DA 2AQVA 3GH5A 1V08A 4O1BA 5CLTA 1BAGA 1LRTA 2IPJA 1HNYA 2DW6A 3L4WA 4AUBA 1IZCA 1BWKA 2ZX5A 1XLCA 2DDXA 3V18A 3BK0A 1SPQA 2XIBA 4UOQA 3FAWA 3L0KA 4PTMA 3TFXA 3DCPA 4PA8A 3ZSSA 3UXIA 1EL3A 2ZWYA 1K8ZA 3EAUA 4AD3A 5HR7A 3RMJA 4IH3A 1HN1A 3TROA 2G0WA 1WDQA 4AHQA 1MW1A 2DW7A 2FTPA 2X40A 4RV3A 1EYEA 2ZZ3A 3WLTA 3CAKA 1ZL1A 3H22A 3NR0A 2OOFA 1OYBA 5CZTA 4ZOAA 3LBOA 2DZWA 4UFHA 3KWXA 3RLVA 4IMCA 4ES4A 4MJZA 3VUPA 3QLDA 3TTQA 1C91A 1Q7ZA 4L9ZA 3AIBA 4F4RA 2WC7A 4PSPA 3KW3A 1ISYA 1A4MA 2FKPA 1RCQA 3WNNA 4O4VA 1BKHA 1T41A 1ENUA 2GJXA 2PZNA 4V28A 2V68A 1R9XA 3M44A 2QKFA 2ZRVA 1SJBA 2QNEA 1K77A 5E5CA 4A6GA 3IARA 2GSJA 2TSYA 1SGJA 4LJ3A 4U3CA 3BOXA 4DNMA 4S3FA 2Q8XA 2X1UA 1ZBKA 1W3LA 3FYYA 2NV2A 4JTEA 1WOAA 4B92A 4HNNA 4OOZA 4C6MA 1UR3M 3VINA 3IRSA 5I24A 2GSEA 1EQCA 3FHAA 1U1UA 3W1QA 4GD0A 4DLFA 3L66A 1B0IA 4DXVA 3MMTA 3VK5A 3TYDA 2VTFA 3HPZA 5A3HA 3MP5A 3P74A 4E4PA 3GFZA 1JIBA 1IHIA 1IR2A 1J12A 1XXXA 3CMJA 3S6DA 2WOQA 2PDMA 2FZ8A 3EWZA 4CCZA 1XYLA 4US5A 1G4PA 2VDGA 2PGRA 2DFAA 5AVHA 2Z7KA 2PD5A 3U2CA 1G01A 4MFDA 3DZ1A 1GK8A 2QPUA 4XIMA 3SQSA 2J7HA 3H2CA 3LCXA 2CU0A 4ORMA 3LPGA 5TBOA 1QPRA 3IJ8A 1CNVA 2I57A 3S2NA 3AIRA 1X7FA 3RITA 4LY8A 4NNAA 2CZDA 3NPXA 3I6TA 2A3BA 1DIEA 3NL6A 3TWBA 4HOZA 1KNWA 1TJ2A 3A4WA 5CGQA 3W28A 1RZMA 3PF3A 1GEQA 3LCLA 4GCXA 4HPJA 4AAJA 3MTWA 4L7ZA 4UTLA 5CPMA 3CYJA 4FXSA 1MRAA 1TE6A 2GGJA 2YCEA 4QXIA 2VENA 2YL5A 4N9CA 5FF4A 1FDJA 1KM3A 3QHNA 3UJ2A 3K4WA 2BGSA 1OFOA 2F7FA 3SCWA 1K8CA 2WVVB 2ZRXA 3C2EA 2HPMA 4M5PA 3MY9A 1JZ8A 1UMLA 2VOMA 2PAJA 4AD1A 1X97A 3QY6A 4XO6A 5CPQA 1KBBA 4F0HA 4UWMA 3LX9A 2GL5A 4E38A 2QCLA 3SRDA 4LOCA 3C0SA 3WSUA 1U5HA 4H7CA 5AYIA 2Z1VA 4HN8A 2Z27A 3GG0A 1DJNA 1L2UA 1KTNA 5JBEA 2NQJA 3MUXA 3A4XA 4CD8A 3MUZ1 4DUXA 2GOKA 4IP5A 2P76A 2A7PA 4GCAA 1NDYA 2YBVA 3H12A 1N2VA 1CXKA 1XFBA 3WDRA 2H3DA 1XLDA 1DJYA 2R91A 2VZVA 4FLQA 4XD5A 4AG0A 1C8XA 1UWQA 3FAXA 5E9XA 1XCXA 1OFEA 3MBDA 3G1DA 1NP0A 1XLAA 3MO4A 3GVQA 4CQDA 1GVSA 1ADSA 4E3TA 4P8XA 1ZAHA 3WQ6A 5I3HA 1SSDA 5ECUA 3NIYA 2PA6A 2OWCA 3NG3A 1M7PA 3KOZA 2LLEA 3V75A 1I60A 2QVNA 4GNJA 1JCXA 1GZ1A 4MMWA 1RJRA 3GVWA 3A5FA 4UFKA 4N4QA 3PJUA 2Z6JA 3QF0A 1PDZA 2NLIA 1V0LA 5G2HA 4QITA 3LTSA 1J5TA 3C56A 5D8WA 1K9TA 5AVNA 3FJLA 1ICQA 5AZ1A 2PEVA 3PUGA 3OQ8A 1XGDA 3DFHA 1TV8A 3WD3A 3LMYA 3WMLA 4DQWA 4ATWA 4FNTA 1HW6A 7ENLA 2OG9A 3CZKA 2YFOA 3CXOA 5CLWA 4WVXA 1UJQA 3I7RA 4NI8A 3WL0A 4I6VA 2VUYA 5CPLA 1EFZA 4JTIA 5BW6A 5KMYA 1JCMP 4FOKA 3CHFA 5AYYA 1RVGA 4G56A 4AWEA 1ECEA 3GXIA 4MJMA 2V8ZA 1UD8A 2VZTA 5JQ9A 3P2VA 4WGXA 3ZJ7A 3HB9A 4B2DA 4GVIA 4LS2A 3ES7A 1JZ3A 2FHCA 4M80A 1E4MM 2XFYA 3W7GA 2HBXA 1LORA 5BOFA 3KS6A 4YTQA 1EC8A 4AVNA 2CLIA 3VD9A 2X8RA 3AROA 2R94A 3ORWA 3ITXA 5F1VA 4ZXOA 1RUSA 2EXOA 4ZTYA 2E7FA 2NSOA 4D6FA 1ML1A 3F7JA 2INZA 4UXDA 4EPEC 3EOEA 4GQQA 3HN3A 1UD3A 4IIFA 5H1WA 4AMAA 1QPKA 4MAVA 2D2OA 4DJFD 2WCSA 4MHBA 2W27A 3N6QA 1FXQA 1P6BA 1V8EA 2JKEA 2R82A 2O7QA 4JDYA 5IBXA 1SFJA 4KQNA 5F4SA 4AD2A 3MVTA 2ZA2A 3TONA 3MV01 2OWWA 4B2DD 2XSAA 4QX4A 4IPLA 4ZA0A 3GW0A 3IUIA 3NWRA 4JNYA 1K7XA 2YL6A 3DFYA 3SIZA 3AXXA 4WXZA 3FGCA 1NM9A 4UZUA 4PCPA 3UPWA 1J6PA 4GZ7A 4LALA 3LI0A 1H51A 1QHPA 4E2VA 3VGGA 2VRKA 1IV8A 1H3GA 4L65A 1UKPA 1MQQA 2Y8KA 3TJXA 2H9AB 5TD4A 1S5NA 1PPIA 4GUJA 3QZ6A 4NJJA 2OSXA 4IM4A 1V51A 1JDFA 3OBEA 2D3LA 4OWGA 3UA4A 2AKZA 3PBVA 3IVTA 3CQIA 5CC5A 1E0VA 2NQZA 2G41A 6XIMA 1SR0A 5F2MA 3R10A 2X1IA 3DH7A 2BY2A 3HPFA 3WG6A 3UETA 3BXWA 1R5YA 3TLQA 4PULA 2VFGA 3CQJA 2Z00A 4GABA 4LUYA 4LEQA 2Z26A 3UERA 4E2OA 3W1TA 2BHUA 2GK1B 3OZYA 1BEUA 3M6DA 5A5WA 1LF1A 4MAZA 3RU6A 4CNTA 3AZSA 5FJPA 3P5ZA 1SFTA 2WNWA 1OYAA 2J79A 1W5NA 3T05A 3M7SA 3KDNA 3NZGA 1P0BA 3QGVA 3JS3A 3ARVA 1AFSA 2HSAA 4J3WA 4QFUA 3BMVA 5JH1A 2VNCA 3ZT7A 1PDYA 1FCVA 4EPDC 3LHTA 4H9VA 4YU1A 2QUVA 3PULA 3HPSA 3BZGA 3U0HA 3ARTA 3IVSA 3QKEA 1Q6OA 1KBIA 4S23A 2HS6A 4AZ6A 3HG2A 1XF0A 2X2GA 4DN1A 1HQTA 4O0KA 4JIRA 4F9JA 4E8GA 3UZ5A 3E96A 5HWNA 4WDXA 3G0XA 5BZAA 1OGSA 2QJJA 2J8GA 1LUCB 1H7OA 3TP4A 3OVGA 3BLLA 2QCGA 3DBPA 3G6MA 3BJSA 5C9XA 3KM8A 4V27A 4YWSA 4QDWA 3C0LA 3TCEA 3F4NA 1W2PA 1K6WA 1PV8A 4MM1A 4RZ5A 1GHRA 2E6DA 5AYBA 4Q8OA 1FHUA 5CH9A 1HO4A 3E1F1 4JFVA 1KWGA 3BE7A 1R3WA 1VPXA 2ISWA 3IGUA 3RCYA 2Y4SA 5AC6A 4LUIA 4UTMA 1HKVA 4ZB5A 5C8BB 5HNUA 2ZZ7A 2JIWA 3EXTA 4JYEA 1BTCA 4MWAE 3WLMA 3DYMA 1LYXA 1KC7A 4DWSA 2XVNA 4BF5A 5K4XA 2CPUA 2MUCA 5LIXX 5K9CA 3MHFA 3MW7A 3OW1A 4DPPA 4IPIA 4E2DA 4TMBA 3V5FA 3LRKA 3STEA 4IMEA 4PSRA 2ACQA 2HEJA 4JOMA 1OVDA 3WQWA 1EO7A 3W2KA 3T2OA 3NQMA 3BQ6A 4LYRA 4I5RA 1TWZA 3CM4A 2C71A 1XRSA 2Y7DA 1HO1A 3QZAA 1TMLA 5FJIA 5T26A 3CIXA 3GFXA 4L9XA 4PTWA 3MT1A 1Q66A 2YA2A 4RL3A 4NZJA 2HWGA 3RRAA 4BY3A 1AQ0A 3RPMA 1KXHA 2HPIA 1QMLA 3HTWA 2DVUA 3URAA 1YXYA 3VKKA 1AL8A 1V6VA 1H7RA 3PG9A 1GVRA 1W91A 3HFYA 2EG7A 4JTGA 5LIYX 1L6YA 1PX8A 2V67A 5BOEA 2DV0A 1D8WA 3ICJA 1DQUA 2ZCGA 1VFTA 2PURA 1AA1B 4TU1A 4IP7A 2QCMA 4RLIA 4IHCA 2HE8A 2X7VA 5CSSA 3EOLA 4P2VA 1Q4WA 1SR9A 2AKMA 3UJRA 5LZLA 1WAWA 3W84A 1UQZA 4EPBC 2D1ZA 4LUTB 3UW6A 2KAUC 1AQFA 3CZ8A 1KKRA 4M6QA 2C15A 2NWRA 4Q7NA 4ZSUA 3VGEA 3TN3A 3U9IA 1DJXA 3WIJA 2WLZA 3WMBA 2OLAA 4LAOA 4B90A 2ZC1A 5A8QA 1W0MA 3K1GA 4JTKA 1A5CA 3CO4A 3G1AA 3O1NA 3CUIA 2VZUA 4YHGA 2O9PA 5CZKA 2WMKA 2Y2WA 3L67A 4EPKA 2W79A 1LOSA 1O94A 3NPWA 1R38A 3VIIA 1V03A 2ZXQA 3S1GA 1JF5A 1KM0A 2BVWA 1Q8JA 1OZQA 1ELSA 3W07A 3ARRA 3OLIA 1X6LA 3TR2A 2NUYA 3ATZA 3NQ8A 4O14A 1EPVA 2D2HA 1RALA 4LAKA 1VZWA 3KVJA 1G4SA 2J78A 3MA8A 3S9ZA 5CSYA 4S2CA 5E0KA 1LL4A 1E4NA 1G4TA 3N13A 3AQUA 4K39A 4LU0A 2RUSA 3FKRA 5FIPA 2INFA 2O0TA 3MI3A 3CHCA 5CBIA 2QUUA 4KF1A 1GNXA 4KFPA 3IIXA 2PDQA 3FSUA 3W88A 2ZFAA 4ZQOA 4D6JA 4LBUA 2E68A 1FY6A 3L5LA 3HJZA 4NZFA 3PTMA 3PVFA 3QKZA 1UHVA 4JNMA 2IW0A 3T07A 4DLMA 4DYKA 2XIOA 1VIZA 4C6KA 3QM3A 4MZ1A 2BOFX 4JEJA 1OFRA 4PMUA 5K9DA 4XAPA 4FSAA 1LQAA 4EWND 2XIIA 4K36A 1UA3A 2Y70A 4QS5A 1W9DM 1E6PA 3OODA 2ACSA 3L68A 2X16A 1JZ4A 4TOQA 1PIFA 2BXVA 3QR0A 3RFAA 4U28A 1S2VA 1YADA 4GI8A 4PMXA 4B16A 5JXQA 3A3XA 4F40A 4GYPA 2YW3A 3W53A 3VE7A 5TIMA 1TRDA 3H2EA 1C8YA 4C7FA 5FAGA 4UTUA 1EDGA 2FVMA 1R3SA 2PS2A 2AMGA 3OO2A 2OXNA 3VKAA 4LYQA 3THAA 2XVKA 1Q6GA 1M53A 3EOSA 3AIVA 2WVTA 1KFLA 1OX4B 2V38A 3ARYA 1Q6LA 1DE5A 1ODUA 3VIMA 4O1CA 1NWUA 2AGKA 3N2OA 3TW9A 1FA2A 4UCFA 4W7UA 1E9YB 4NKCA 1QVBA 1P7TA 1R6WA 3DDMA 1CGXA 1FWIC 3GAKA 3UZJA 3QPEA 1B3XA 4XZNX 3OVPA 5DF0A 3ZQ9A 4Q8NA 5HDRA 1KR0A 3GXMA 1H50A 4GGBA 3NEVA 1QFEA 1OB0A 1OGBA 2XGBA 4CD5A 3EWDA 4O16A 4O1DA 3TC7A 1UR8A 2YXXA 1UIPA 2B7OA 1KRAC 3UWQA 1J4EA 1WBJA 4GH3A 2DEPA 1AODA 1OFBA 3M0ZA 3UVAA 4AZBA 4AIOA 5BWAA 2NLYA 3TTSA 3UP8A 1FWCC 3UYCA 4HMCA 2WMIA 3AMGA 3CWNA 3FYOA 3C61A 1NIUA 3QHMA 3N11A 1Q65A 4K8EA 3S5OA 3H54A 5AHIA 3ZZ1A 1VHNA 3T6CA 5AFDA 1LUCA 1VRXA 3SJNA 7PTDA 3WYZA 3AMKA 1YE6A 3ARWA 1IQ8A 3LCHA 4JBRA 3MHUA 3U7VA 4KT2A 1W1A1 5H6HA 3RRXA 5HPCA 3G3DA 2F8QA 3W38A 1YDYA 4GO8A 3W1UA 3POHA 3SY1A 4R7OA 3NOYA 2X0HA 5F1UA 3QBUA 4S3JA 1FWSA 1Z48A 3NO3A 3TQPA 3PANA 2QAPA 1ZHAA 2XSXA 3MSYA 4PUUA 3RNDA 2ADAA 3CMFA 3E0VA 4I3GA 2RJGA 1TPC1 2YDRA 2WMHA 1BYBA 1SMAA 3BICA 3NEHA 1B5TA 1NOUA 4ACYA 1EBHA 1HJXA 1TQXA 4A3YA 1XQLA 2PDFA 3FK4A 2A2IA 2B7QA 4CD4A 4QGCA 3T81A 3LD5A 4AMCA 1LOQA 5LNSA 2WC4A 3C2RA 1EIBA 3NZPA 2WKLA 1AMYA 1N82A 3DECA 5B80A 5DMNA 1R30A 3WUFA 2PC4A 3BDKA 2YBUA 3STFA 1YQ2A 3T09A 3VA8A 5G4WA 3QC3A 1B57A 3GUGA 1RY0A 3UG3A 3FVDA 5EPDA 5HWJA 4Y9AA 5D9PA 2V0TA 2EEXA 1EWEA 4LVDA 1XISA 2DQWA 3NSXA 3GR4A 2X0YA 1D7KA 3T55A 3OIHA 2J8FA 4BZYA 4O57A 1TR1A 1Z3NA 3M5YA 4GXPA 4W89A 4LNCA 4AY1A 3H2AA 4OV9A 3C0QA 3TC6A 1KQZA 3KE0A 4JZ5A 4C6OA 3WJWA 5BCAA 4DNHA 4LH8A 4CU8A 5I09A 3R0DA 2C0AA 2GJLA 3WUEA 4HSNA 1R2TA 2GVEA 2X0SA 4K1GA 5IM51 2G3IA 4UTWC 3IGHX 4PMRA 3WMSA 3GD6A 3BARA 1MZHA 1SVDA 1ICSA 1NDWA 4XZLX 4BI5A 3DESA 2VFDA 1DXEA 3ZWTA 2Y8UA 4Q8PA 1UUOA 4A3HA 3SRKA 4XD6A 3BUVA 2Y7EA 2YFNA 4IQDA 1HKWA 3TYAA 4KPLA 1VCFA 3ABXA 4B15A 5D04C 4AC7C 3WLRA 2PDIA 5L9FA 2QQ6A 4L6HA 1X38A 4PUJA 1ZP4A 1JPDX 4JIEA 4PBGA 5AHLA 1D3GA 1JCLA 4GJIA 1MNSA 2BY3A 4WLCA 1WP6A 5GVJA 5DX7A 4OKDA 4K68A 2G95A 4JFUA 1UR2A 1OK6A 2J7CA 4NASA 3W25A 1EP1A 2ZBTA 4PN2A 4H7ZA 3V7PA 3EA3A 3BTNA 2D20A 1W8GA 4X0VA 1S5MA 3NUKA 5LNRA 3BCDA 1YE4A 1G6CA 1KCZA 3D47A 3QMRA 4LW7A 3E2RA 1UCWA 2WCGA 4E4FA 1XLBA 3SFKA 3GU9A 3AS0A 2I14A 3B4UA 3PSWA 4D6IA 1PZ3A 1CTNA 2QIWA 2ATSA 4DAFA 4PC8A 4M8UA 3WEMA 1IWAA 1JRCA 2Z29A 3QFWA 4ZEPA 8A3HA 1I1WA 1WV2A 3TC3A 3S1WA 4YL2A 1PEZA 4HBKA 1QNRA 3TYUA 2QCDA 4GKLA 1F05A 4V2XA 5A6LA 2WPBA 3IRDA 4WCJA 4NVTA 3IGXA 4QSHA 1RPKA 4PTXA 4MNKA 3JZUA 1PKNA 1UKOA 3SO7A 2J6XA 1X1ZA 3N3MA 3W00A 1WDSA 1XG3A 2PWUA 3VFCA 4NZ4A 3B9NA 1I8JA 3F5LA 3GDBA 3S6TA 2DZSA 3TNBA 4LCRA 1UG6A 5XIMA 3LGDA 4DJFC 1Q4NX 4MPQA 4O15A 1W9UA 1CT5A 1MW0A 3HGJA 2NT0A 1HUVA 3AYVA 2F2HA 4XTDA 2BNJA 5BRPA 2PU0A 4R88A 3U2OA 3M47A 1ONXA 2E77A 1JL8A 4R7JA 5C6MA 4S3BA 2X7WA 2OZ0A 2I5GA 3NM3A 5HK4A 5H8UA 1GJPA 3W1PA 5C2CA 2PDKA 4US5D 3GH7A 1LBFA 1O12A 3VCRA 1VLIA 1ZQ5A 3UR8A 4MGGA 1OC5A 4JTSA 1B3YA 3WQ5A 3WH9A 5EL1A 4Q8MA 1MEIA 4GQRA 1NVMA 5JH2A 4PMVA 2B7PA 1F9CA 4UNKA 2PDGA 3ZOAA 4AD0A 3B97A 4PBEA 1V3HA 3R6IA 3PUEA 4DBUA 3LTYA 2PP0A 1XDJA 4HZ6A 4R53A 4TR9A 2OQHA 4PCFA 1R2SA 1PL9A 4CN1A 3RK8A 4DB7A 2ZZ1A 3BV7A 4YHEA 1L6FA 4Y8FA 1UZ1A 3UT0A 3KRUA 4IUOA 2XGZA 1FQ0A 3IJ6A 2FPTA 4S3AA 4V33A 1VYSX 4W88A 3EEGA 3SADA 4YIWA 1RBAA 2WZEA 2VZOA 4WJEA 4J3UA 4HU4A 2E0PA 4AXNA 2HNHA 4E8DA 2VFIA 1WXZA 5DANA 4H8NA 2DUZA 2HV5A 3L0GA 3VX0A 2D23A 2ZUMA 3B8WA 4NP7A 4TX8A 4V15A 1KCKA 1BQCA 1OT2A 1LROA 1GTHA 1FWJC 3QR3A 3TFCA 1FCUA 1GOOA 2F9RA 1K4GA 1NJJA 4QCEA 1XICA 3SN0A 2WMFA 4MY8A 3OA3A 1F8IA 5LHEA 1BFNA 4P7LA 3L2IA 4FS9A 4Q4KA 5BU9A 4I6KA 1XLEA 4BQ2A 3W2JA 3WLHA 4HK6A 4RNJA 2O7SA 3AYSA 1A3XA 4J35A 1KFJA 4LV4A 3STPA 1GJUA 3NL5A 2V5KA 5H2ZA 1SO3A 5D9NA 2XVGA 3UF9A 3AJXA 2VFEA 4H1ZA 1V0KA 3E12A 4W85A 5KTLA 5GPRA 1KWKA 4FF7A 4Z0SA 4ZB2A 1YNYA 2JEQA 1KXTA 3AIQA 5HNRA 2Y88A 3ZIZA 1B31A 1K9FA 4J3ZA 4HTBA 3D5HA 5A8MA 1R85A 1TFVA 4H6EA 3C0JA 3ZXWA 3AZTA 2I17A 1R3YA 1W1IE 2YOCA 4XZIA 3IIOA 2CKSA 3IIPA 1HL8A 1FP9A 3Q94A 1T6MA 4HKPA 5BXTA 2H8ZA 1XLKA 2GPTA 3WF1A 4H9TA 2PDLA 1W31A 3NQ7A 2REQB 5HAOA 3DG3A 3DYOA 3DG6A 1H62A 5K7JA 4U3AA 1JGIA 2VX5A 1HF6A 3SQMA 3GDTA 3M6YA 3EWUA 2Q09A 2QIIA 3BAXA 3CK5A 4HZ8A 2VCCA 2VVSA 3HF3A 3UXDA 3R25A 3OGRA 3V35A 4J3SA 3OZOA 2WXDM 3SECA 3TTOA 3UZXA 4C7DA 4QP0A 4MKSA 4QJ4B 3L65A 1XSKA 4YJ5A 4URIA 2X05A 3A21A 1DWGM 4LVGA 3GM8A 4MUZA 1AJ0A 4QEEA 1E1FA 3ME3A 4GNKB 1FWWA 3KRZA 1CIUA 1H49A 1OEPA 5A8OA 4M3PA 1REQB 2ZX8A 2XH0A 1UD4A 3ZJ8A 5MKGB 1MW3A 3GUWA 3VX1A 1Y5XA 1AH0A 1J10A 1IEXA 3B3DA 1TTJA 5CJNA 3FA5A 5A2BA 3C3NA 3G8RA 1FXPA 3W1RA 2E67A 2QULA 4GUIA 4JX4A 2E1WA 1TSIA 3AMLA 4GUFA 3QGKC 3SCUA 1TZZA 2A79A 4O18A 2OMAA 4UTHA 1A4LA 1XBXA 3W7OA 4MLRA 1KXQA 2E28A 2V3DA 1YDNA 3GNPA 3HGSA 4NZ5A 1GQIA 3EB2A 5AC8A 4H2HA 1PX4A 2GWGA 2FYMA 2PMQA 2VVNA 3OVQA 2OYMA 4TVUA 3CWOX 2WJFA 4K3ZA 3GXDA 1X8CA 4DHGA 4KH2A 2OQYA 4I7VA 1OHLA 1RCOB 3T1GA 4QG9A 1SM9A 4P7NA 1R0MA 2QV5A 4GX8A 4YTRA 3DC8A 1E0UA 3U2ZA 1GUVA 3ARPA 1I6NA 2RH9A 1TA3B 4C65A 1MDRA 3N4EA 4KS0A 3CO8A 2HXUA 2QJNA 3FJ6A 5EBUA 3AUOA 4Z0JA 1K03A 3CPGA 4KRZA 3NGFA 1NOFA 1JZ5A 1HJUA 3LG3A 3O7UA 3HPAA 1OFQA 1OYCA 3TZFA 5G1TA 1YDOA 1UASA 5DRIA 3T42A 5D38A 2GFTA 5REQA 4MB1A 1E6ZA 5C9ZA 2OJPA 4FX6M 2DU2A 2VP8A 1V6UA 4GYKA 3W6LA 2OT0A 4GI9A 2IKJA 5D32A 5K3VA 1THFD 1K9EA 3RU8X 2MNRA 3E2SA 4UR8A 3VM5A 1EHAA 1KW1A 2YX0A 2RDUA 4HP5A 4LBSA 1R86A 4OFCA 1V6XA 2ISVA 1XBVA 1DXIA 4AXKA 2DSKA 3GIPA 3WNLA 4UTJA 4LSBA 2FQIA 5B7ZA 2FLIA 1UR4A 4GYFA 3M4HA 4B5VA 4BEUA 3T78A 1W3HA 4W7WA 4GBDA 1M6JA 3WLJA 4CVUA 1TPEA 3VXGA 2VFFA 1A5AA 1EOMA 3GWQA 2H3BA 1TPDA 2PF0A 4P7QA 2GLKA 2VEPA 3W7MA 2EQDA 2DZVA 4BF9A 2GUBA 1UPMB 3DAQA 3GE7A 3LLXA 4UTFA 4NRSA 1LWJA 3UG4A 3QGAC 1A3WA 5JIWA 3LA4A 3CHVA 2H6RA 2PRMA 2XIMA 1CB7B 4I9MA 3IIVA 4DM1A 1WUFA 3R58A 1DWIM 4IIGA 4F0LA 4QAIA 3AJ7A 1LM1A 1TG7A 3WQDA 3WX7A 3HJEA 3KOFA 3DHDA 3F5JA 3ID7A 4Q7IA 4MPKA 4J27A 3NA8A 1EC7A 4TV6A 3RO6A 3R4IA 1J0IA 3PPHA 3RLUA 1VKFA 1B3WA 5MHBA 1Q2SA 2WB5A 4XKMA 1H0IA 1OG6A 1XH0A 4XBKA 2O9TA 4Q33A 1VFUA 1KGUA 3W26A 1ECQA 2HE5A 4FO4A 1SJAA 2P10A 4ICNA 1S5VA 2WANA 4OQVA 3P60A 1E3XA 4P5UA 2YSWA 4BQ3A 3RJXA 2Z0IA 1R7AA 2B31A 1GONA 3OZMA 2Q02A 5KZDA 3H2OA 1PYMA 3K13A 4REQB 3IK2A 1M5WA 4B5SA 4F2TA 3PZNA 5I00A 4C5YA 2HCVA 2GQ8A 4JKMA 4JD4A 1VP5A 3UR5A 5DO8A 5AY7A 1A49A 3OYZA 3C2OA 4W87A 1F61A 5DT5A 3ANUA 8CGTA 1BWVA 1JAEA 5MF5A 4JS3A 3T4CA 2IMRA 4LUSB 1HL9A 1VCGA 1J2WA 2VX4A 4AHOA 4BF7A 4DBSA 3EOUA 3RLGA 5DBUA 4BQ4A 3ITTA 1EP2A 2ISSA 3N17A 3ABRA 1QJWA 2E4TA 5KEZA 1YTEA 3WK0A 2D2JA 4XB3A 4M6VA 5EFDA 5LIKX 4HU0A 4DEFA 4X61A 3A6OA 2ZRZA 4JQ3A 3L4VA 4B5WA 4KW2A 2QUMA 3NZ1A 3K8KA 5K9XA 3Q67A 2NQ9A 2W67A 3L4YA 1S5TA 3TMLA 2Q3RA 4L6DA 4MFEA 1O60A 3VIHA 5LYRA 4EOUA 3ZMRA 5LKYA 3TAOA 3MUAA 1K8XA 4JX5A 1ITCA 1UWAA 4Y9MA 3NYZA 3LK6A 2QR6A 2DH2A 3OG2A 1W3JA 1BPLB 4WSKA 3MSGA 4ADTA 3Q2DA 2XHYA 5A8GA 3GHSA 4B5UA 3PNUA 3F4WA 3SCQA 3VNKA 4NZ1A 4JEQA 2FZNA 1XIHA 2R24A 4QDMA 1UZHA 1XYFA 3ABSA 3ARXA 1GOIA 4GISA 1VBRA 1ZPTA 2OCZA 3WF4A 3AS1A 2ABAA 2A7NA 3NOEA 5I0DA 4JN6A 1B3ZA 1T8QA 1M1BA 4QM1A 1K7FA 3H23A 1EJXC 4WJXA 1W9PA 1KB3A 1R87A 4PBFA 4RNFA 1H7WA 2YIHA 1YTKA 3M0MA 3IACA 4XWUA 3ZVIA 1ITXA 1LP6A 4XD3A 1PZ1A 2OGYA 4DXKA 3ELFA 3LRMA 4K7YA 1XLIA 2YPIA 1U5VA 3O6CA 2GJXB 3QYQA 1JDDA 5HBFA 3QXBA 4Q4MA 1OT1A 4CVWA 2R1PA 3B06A 4M29A 2C14A 2WHJA 2CZ5A 4BI7A 3WO8A 5HANA 2A7RA 1OIMA 1FWNA 1QW8A 2J13A 2A5HA 2VR2A 4C60A 1ISZA 1EA9C 3IJ7A 1I0DA 4NUWA 1AJZA 4J7RA 1XCWA 3WQVA 3G5EA 4X3ZA 4S3DA 3TQ0A 1K1DA 4KEMA 3W1AA 3O06A 2OKOA 3INPA 1BVWA 1K02A 4F2BA 3MKKA 3H2MA 4LB4A 1VD6A 1EJTC 1W6TA 3WLQA 1I2NA 2FH8A 3PK7A 3VCCA 4KCUA 4O28A 1I2OA 2D0GA 3GYCA 2BP1A 4GVHA 4M7TA 2PC8A 3RF9A 6ALDA 3GSMA 5EYWA 2WKJA 3CH0A 5DELA 3M0HA 3T8QA 3W1MA 1UOZA 1JD9A 2YCLB 3W29A 1YMYA 4XZHA 1FWDC 3HV9A 2OGJA 1ONRA 1VYRA 4JY9A 3LRLA 3SY8A 2VKZG 3KBMA 1I9CB 4ZQMA 3S8HA 3W7EA 1SZFA 3RM4A 1VBJA 4UQBA 2DJXA 1A5OC 3VOIA 5KZMA 2NW0A 3BLPX 3L7RA 1QT1A 2Y61A 3LNMA 3BMXA 4AZIA 5A6AA 1XIDA 3TIMA 5LSMA 2QJGA 3EXSA 1UC4A 3VCNA 5F2GA 1QPOA 1RJPA 5CBJA 2J24A 1ZFJA 4NAEA 3V0SA 1SSGA 4JHZA 3BSMA 3W24A 4RPPA 2NWSA 3H6OA 3WH7A 2GYIA 3GQYA 1E0XA 3VMNA 4XO7A 4JIQA 2D0HA 1RAKA 5CXPA 1J01A 4G7EB 4PCNA 3MDWA 1BXCA 4YLWA 1DJIA 4ALDA 2Z7GA 3WQ8A 4XKYB 3AU6A 3KHDA 4GO9A 3D46A 3IAPA 1XRTA 1RQBA 1WOBA 1W1TA 3MZNA 1C7SA 3SQLA 1WDDA 2GUYA 3E6EA 3NQ6A 3FX4A 2JKPA 1I2RA 1KBJA 3O6DA 6ENLA 3OLGA 1NF0A 5J8LA 1Z6KA 2QCCA 2I7GA 2XJ7A 3W6MA 3ONCA 2CEQA 3P8JA 3ONBA 2WWDA 1DWAM 2SFPA 2ZX9A 3EYPA 2QPSA 4OGZA 5CQ1A 1E6XM 1IT8A 1ONWA 4XUYA 3TJ4A 5L6UA 1J0HA 3FDKA 5AHNA 4XTIA 3GDRA 2P88A 3IPWA 3LGEA 1R47A 2GDUA 3QY8A 5D8ZA 3SW6A 5LIWX 4J9JA 3M7WA 4MWAB 1E15A 3W7KA 4HT3A 3TWAA 3O07A 1P0DA 1JD7A 3AS3A 4ZTXA 5E6YA 4CNUA 1TTIA 3BANA 4DO4A 3B05A 1KBKA 4HCLA 1M68A 2GSHA 4F0RA 4QISA 3VZXA 1IXPA 4GY7A 3WBAA 3I68A 5HMFA 1AD1A 4L56A 1R3QA 4NU7A 1ISVA 5FEZA 5EGRA 1F2JA 1A5UA 2OZ3A 5BNKA 1RV8A 4PFMA 1XGEA 1G7VA 1FX6A 1BKSA 4OE7A 3ANYA 3E0LA 1L0PA 2GVJA 3EDKA 5I77A 1ZZMA 4MWAD 3A9IA 5CC6A 2DZTA 3Q65A 1QK0A 5C2GA 4B4HA 4AFYA 1CX9A 2VGFA 3R8GA 4ENLA 3KTXA 3NAVA 2VGBA 5E0CA 1Y5WA 4GQ0A 3ALFA 4BFAA 1T40A 3MCNA 3S9IA 1QI3A 2CBJA 4KWUA 2BOGX 4J3VA 2PRHA 3JZEA 2Y89A 2VR4A 1EEPA 3MUCA 1XBZA 3ZR4A 2V69A 3IVUA 4TQTA 1P7TB 3EX4A 2A85A 1AJ2A 1CLXA 4UCGA 1IGWA 3T0TA 1QPQA 1Y0EA 1D3HA 5BXRA 2ZXDA 5HA7A 4PL2A 3THCA 4C6IA 1DWHM 5T8GA 3QV6A 4K1WA 1MNZA 3WEOA 2WM1A 3NURA 8RUCA 4TVDA 3WFAA 1SZGA 2VDHA 3ATYA 5D09A 3UWUA 9XIMA 1MVYA 3PWGA 4H6RA 3JR2A 3QR1A 5HMDA 1DBTA 1P0KA 4I8YA 5FACA 5ABTA 5KZEA 4GI6A 2EJ1A 3GW3A 3PM6A 2FDSA 3TAKA 2X09A 2FGZA 5A2CA 2PCQA 1E9ZB 4X2RA 1R2RA 5REQB 1N8WA 1S3HA 4FNQA 1ADOA 2TYSA 3OZPA 4DJDD 4AEOA 3M0JA 5BOOA 1H1ZA 3C8FA 1D8CA 2B4GA 4UMCA 3GXTA 4UBPC 7ODCA 4WKHA 1E5NA 4A8NA 3H8AA 4G1KA 1GVYA 4Q6XA 5FKYA 1CGYA 3LCWA 1JFHA 1KFCA 1X96A 2NXIA 2J47A 2EKGA 2WZTA 3V1PA 1W5OA 3WDIA 1TE1A 1IEQA 3QW3A 4LEFA 2PUZA 2J77A 3MMDA 1LRQA 2DUXA 3WUBA 4LQ1A 2YDAA 5IBXC 1V6YA 3WK2A 4GXWA 1C9WA 1PIGA 3VO0A 3DKLA 2J62A 1M65A 2WHMA 3HG3A 3BVJA 2BXYA 3T7VA 3P0WA 2QS8A 1VB9A 4OV4A 3WK3A 1B54A 4G5DA 1TR9A 4QG8A 4M1RA 3WJZA 2X41A 1IF2A 4HYWA 4NILA 3KLKA 1PYFA 2Y63A 4JIHA 4HA3A 1FOBA 4I5UA 3FVMA 1E6RA 1NU5A 2EO7A 3MSDA 4LANA 4LBRA 3UZYA 1FFRA 1XS2A 1QOPA 5LIUX 1RBLA 2FPYA 5IDIA 5D2WA 1H7XA 3BJTA 3N15A 3VD7A 3NCOA 4LUJA 3IK4A 3PBUA 1GCYA 1YXDA 4FX7A 3NXLA 3L4TA 4RUBA 4GC4A 1QXLA 3CB8A 4HJFA 3GVVA 5DBTA 2WQPA 1S38A 1C9DA 4XAYA 1GOMA 3O8AA 3PWAA 1V93A 3EA1A 2IQ0A 4IMFA 2PTDA 1B4EA 3SCNA 4IP4A 4YPJA 4JFSA 1KFWA 1L6GA 3SGGA 1TWSA 2C13A 3BQ5A 2WJEA 2PU1A 5KSWA 3B9EA 4D6GA 4MYXA 3UESA 4DJED 4K38A 3LCGA 4HPHA 2O9OA 4WJ8A 1GGOA 1IE7C 5LNUA 1W5PA 1OC6A 4AZGA 2EAWA 2ZZ4A 2QVHA 1X98A 1E9LA 2XSBA 2NX9A 2ZZ2A 3SJ3A 4AD5A 3TN4A 3TJLA 3CHEA 2WVVA 2WBKA 3NJ3A 3LUTA 1CPUA 4BK9A 3NL2A 4HNVA 3F2BA 4C7GA 3FEMA 2XTKA 2XG9A 3S1VA 3KDOA 4QIUA 4W9TA 3TOPA 3CQ0A 1UW9A 3IWPA 3VOFA 3THUA 4RJEA 3P14A 1FP8A 1QDSA 2PDNA 1GQKA 1BQGA 5FF7A 2FMOA 3W7LA 3M0KA 3WN6A 4MB3A 1PO9A 3GYEA 2OPJA 3DFPA 3A47A 1PHWA 1OFAA 4C6EA 1TB3A 3WDQA 3LCIA 2YGYA 3Q45A 2EPOA 2NUXA 5I3FA 3EWXA 3CEUA 3KBVA 1B3VA 4N9EA 4LS0A 4TV5A 2G50A 4K6AA 4MKVA 4R9XA 3TKFA 3WDPP 1QI2A 3MI2A 3ALGA 2Z28A 4HA4A 1KO0A 5H8PA 3RX4A 1VFHA 2PWEA 1CW2A 1IZJA 4GGHA 4L4LA 3PC0A 3CB3A 2G4FA 4MB5A 4RX0A 5U7SA 2QZRA 4MYAA 1IT7A 1WE5A 1LWIA 2IKGA 2GGEA 3F4CA 3S0CA 2WMGA 7A3HA 3VILA 3I3DA 1RLCL 2Y5EA 1YIXA 2NZLA 5CGTA 2RDXA 3A64A 3UQNA 4NNCA 4ZFCA 1TPWA 2VC6A 3ITCA 3AHTA 3GDKA 1I1XA 3TN6A 1EGVA 4B3KA 4EANA 4Y96A 2PWDA 3AALA 3ABQA 1OGGA 4GZJA 4UTTA 1XUUA 1BXBA 4HHLA 4NSBA 3CZGA 3CAWA 5XIAA 4JTTA 2G96A 1IXOA 1PZ0A 1XIJA 3WDHA 2HK0A 5G2WA 1NOWA 3EKGA 3WF2A 4RXGA 4UUIA 5D2XA 3VIJA 4FEZA 4JAWA 4IIHA 2QT3A 2C6QA 1Z42A 2Y62A 1S2CA 2XWDA 1RHCA 4OUEA 1CECA 3KP1A 3G3MA 2VQUA 2FVLA 4JR5A 3AO0A 2R1MA 5HOSA 4WY0B 3C3UA 4HOXA 2YDSA 3LSBA 1AG1O 2CXEA 5D37A 2GWNA 3KVLA 3O0KA 2G5WA 3UR7A 2VEGA 3SIMA 3MC5A 5DQPA 1PWLA 2DSUA 1JGMA 1K9DA 2WZIA 1ZBCA 2P53A 3PY2A 1QI4A 4R5EA 1ISWA 4E4UA 2HQAA 1OINA 5CSRA 1OK4A 2TPSA 2DP3A 3REQB 1IWBA 4UMBA 3BLDA 5T9BG 3U2EA 3P8IA 3WEZA 7TAAA 5EMMA 3CASA 3PSVA 3WELA 3DC0A 3ZT6A 5FF2A 1KTCA 2E5DA 9RUBA 3Q4DA 3MKVA 3DG7A 1LTDA 3PBGA 4XAGA 2UY5A 4PUNA 3UWEA 1BYAA 5GNYA 1ZS2A 3FGCB 3IUDA 3PTDA 4WR3A 4MADA 2CETA 2QF8A 3COTA 1HGWA 1KM5A 4AH7A 4ZXLA 2J88A 1HXJA 3KOWA 2GJNA 5CZJA 3W23A 2A3LA 2HMCA 4GJ1A 3VKBA 4DVOA 3NQCA 3DX5A 1E73M 1ONEA 5DLCA 2OO6A 2PF8A 1ZJIA 1FVPA 1AL7A 4PTDA 4LCQA 3PBWA 5AN7A 5GNXA 3URQA 1CXEA 3A3WA 1UKSA 3VTRA 3WD2A 3WBXA 2V5LA 4TMCA 1W9BM 3JRKA 5B7YA 4EAYA 4YVVA 4Y6GA 5A94A 1D7FA 4U31A 1RR2A 3RXZA 4ZFMA 3M64A 3PZMA 1S39A 1IEIA 3ITGA 3BOFA 4QJ5B 2XH7A 1NFBA 3APYA 2XZ9A 2GGHA 3NL3A 4RDVA 1KM2A 1G0CA 4EE9A 1J8VA 2ZVIA 2J25A 4GE8A 4O10A 4AIBA 2Y24A 4B9YA 1XLMA 3HQOA 1GKRA 1YNQA 3I10A 1O1ZA 2UY3A 1TPB1 2BDQA 4GH1A 5CSUA 3R89A 4C5ZA 3OHMB 3E2QA 3WH5A 1PCWA 3CUHA 4R34A 2PLCA 3VNLA 1Z8AA 3H2NA 1NWSA 4GZIA 4ZO7A 3DFTA 5K2ZA 3QOKA 2QGHA 4RW5A 2DY3A 4HHPA 1BF2A 2ZX6A 4JTUA 4CQCA 3EDJA 1WKYA 4GJJA 1UZDA 3WNKA 4XBJA 3L2LA 3TQVA 2CFFA 4L1GA 2WLYA 1TJ1A 1VEOA 2DZAA 3B40A 3N29A 4D8ZA 4GLEA 3MU7A 3GTHA 4WXYA 1CLVA 1E0WA 3OBKA 4BQ5A 4KETA 3MYOA 1ME7A 1QTWA 2R1KA 3VGBA 1LQ2A 3VMOA 4WDWA 3QQ0A 4XSLA 1R9YA 1AH4A 3VOGA 1MMFA 2V3EA 2DUAA 3A9BA 3CZJA 2FDMA 1W3IA 3PJXA 1AUSL 3P61A 4BS0A 3FIGA 5F7UA 5AECA 4P8UA 5D2VA 2CIPA 5D05A 3VD4A 3PJTA 4A3UA 3KX6A 4F0KA 2X1TA 3BCFA 4G2DA 1DPMA 2D73A 1OX5A 4IX2A 4CCDA 1ZU8A 3W3OA 3DN5A 2ZUTA 2V5BA 1M41A 4FF5A 3H70A 1EP3A 4HIBA 4KERA 1FTXA 3UCQA 5BXSA 4OTKA 2UZ9A 3KCLA 5J5DA 1R7OA 2HK1A 3L21A 2WSKA 3LBCA 4MOZA 4D1JA 2NQHA 3PJWA 2PP3A 4Z2LA 1TMHA 5DY2A 3UFYA 4WDUA 4IGNA 1OZMA 3WH6A 3GVRA 3NQEA 2OOGA 4QG6A 1E43A 3G2GA 2ISFA 2Q3OA 5HQLA 4FNRA 3RGTA 1BSIA 3O6AA 3N2TA 4BR1A 3W83A 3BWWA 3B8TA 3OHIA 1JFXA 2IS7A 1WBHA 5CC3A 1O95A 4TVCA 4IPJA 1HKIA 1WAUA 3WQ4A 1H63A 1DVJA 5FEXA 3F5KA 3VM7A 5G4HC 1OIFA 3W1XA 3SAZA 7TIMA 1CLKA 3PPCA 3TV8A 3BO9A 4WEVX 4Q22A 1LOLA 3VE9A 3GTXA 4ECLA 4MWAC 3IJQA 4IGHA 2PGEA 4HN4A 3NDOA 2J7DA 5AB3A 1EEXA 2PWFA 1KFBA 3TYEA 4ML9A 1H4PA 1KCXA 3W22A 3SCOA 4PRRA 3W4RA 4JHOA 3KL0A 4F8XA 2YXGA 1RA0A 3TXVA 3CTLA 5HJLA 1KLYA 5FSEC 1RLDA 4JTAA 5BROA 1UP3A 1R3RA 1UWRA 4NJHA 1L8NA 2QDDA 4QNEA 2CHOA 2CLOA 3AHVA 2PBGA 3DKJA 5FJUA 2PE4A 5LA2A 5DN1A 3OP2A 2CZVA 2R9RA 3CL7A 3BAKA 3N9KA 3KRBA 3SRHA 5BU6A 4BHYA 1QATA 2XISA 4CLMA 3GHUA 4ROQA 2AOSA 1TMQA 2AQOA 1YLVA 2VFHA 2NSXA 3GNXA 1B2YA 4D6DA 1E56A 3RCNA 3TOYA 1SFSA 4LF1A 1H41A 4YS1A 1KRBC 1QNOA 1ISXA 4ERGA 1MRQA 3A24A 4F3HA 3CZEA 3K4AA 2XN2A 4NXKA 3W0KA 1IEWA 3WZ0E 2ZDSA 4DZAA 1W3KA 3KBJA 1FWRA 2PLJA 4W8BA 3O3RA 3M0YA 4IJRA 3C52A 1MZRA 2XFRA 2R1LA 4FOJA 5KETA 3UGVA 1RQHA 4JDBA 3QY7A 1CXIA 1UWIA 2C3ZA 1BRLB 3TA9A 3W7HA 4XAFA 1LT8A 5CGMA 3NM1A 3QRHA 1WZKA 3R7MA 3FY1A 3B04A 1WPCA 1AK5A 2Y8VA 3L4UA 1Q13A 1TZ7A 1DV7A 2E9LA 3A4AA 1UR1A 2PWVA 3UYIA 2RDWA 3M46A 2PDYA 2DQXA 3SCPA 1RBOB 2D22A 5EKYA 1CENA 3AHZA 1DORA 3VOHA 1CXFA 1RK5A 4F79A 1DHPA 3HPXA 5A2AA 4QAWA 4HOWA 4CGTA 1KGXA 3L0NA 4N6EA 4RZ6A 4KIEA 4GACA 1EJRC 3BLOA 3RR4A 3R94A 1NELA 3BGGA 4A3RA 5DFAA 1ALDA 1IIHA 1JXJA 3SSZA 3S83A 1FRBA 1D2KA 1WKFA 4AVFA 2EKCA 1F3XA 4JY8A 4XV0A 2EPHA 1JYVA 3S5ZA 2UBPC 2NX1A 4C6DA 4NQ1A 1XSJA 3GNOA 2E9BA 3XIMA 4FOUA 3AFBA 3I3EA 3S2MA 5J04A 3LXAA 4RNIA 1GWJA 4R9OA 4WRHA 1W9VA 4WKAA 2DT1A 3REQA 3EKZA 3SCTA 3UCDA 4IGMA 1EJ7L 4RDYA 1HJWA 4MZYA 1AVAA 3G18A 3NVTA 1GYMA 4ZOCA 4YXGA 3HO8A 1RA5A 2OZTA 4WF7A 3EPMA 3S9YA 3N12A 4KESA 4JFTA 3PUOA 3S4TA 2J75A 4GUHA 4DJDA 5TAOA 4HSOA 1T8XA 1M7XA 3LS9A 4P8WA 2WSRA 1EYWA 3AYRA 3BC9A 4JYDA 3MV11 4NJIA 2YZ5A 4ZQNA 1NDVA 1KV8A 3QPZA 4PODA 4YCOA 1SYTA 4FI4A 1EF2A 3WJXA 1V5XA 3CV2A 3KBSA 3KBWA 5H91A 2W91A 3QTGA 3RHGA 4H7VA 1QNVA 4PCSA 3KL3A 1TV4A 4YTUA 1N8IA 4DYEA 2OVLA 2ZWZA 1XBYA 4O50A 3KBNA 4QLLA 3UWYA 4OBTA 4S1FA 2OFJA 2W6RA 1BVZA 4O4WA 4GFSA 5AOUA 5AC7A 1UROA 1CYGA 1US2A 2C7FA 4Q8UA 3GZ3A 3B4YA 1CB2A 1XYBA 1Z89A 5C54A 1ZENA 2DZUA 2Z1XA 5ECVA 4K7VA 1MO0A 2JK2A 1H1YA 3D3FA 3I3BA 4EF9A 3IJIA 4H9ZA 3U3HA 1EB3A 4JCMA 4OOUA 4W93A 1ZCCA 1A0CA 2PDWA 4W5ZA 1QWGA 3G1SA 3TZNA 1Q85A 3NQFA 3QQ1A 3BG9A 1PAMA 5HPOA 2F6XA 2VC7A 1AW5A 3JUGA 4ZO6A 3DEQA 1F6KA 2E3ZA 4PZVA 1JNEA 2L5HA 2G8ZA 2D24A 2QDGA 1YEYA 3T9PA 3D3AA 3N9SA 2HDJA 4MNLA 3MDUA 2YDQA 3KUMA 4O8AA 5FI8A 4ZBCA 1V02A 2CLPA 1E9IA 1EZ2A 1TTPA 1V7YA 3TYZA 2GVYA 4HGXA 4MF4A 7REQB 3EKLA 5ABEA 3U6WA 4CQ8A 1IGSA 3LB0A 2WJZA 1EX1A 3T2QA 2CCRA 4X63A 2OELA 1V6TA 1M9HA 2PODA 5G2IA 3RPTA 3URBA 5EU9A 1W37A 1RPXA 3FXYA 4H00A 4S39A 4MZ8A 1JQVA 2PB1A 2CHRA 2PDCA 3N6JA 3GK0A 1REQA 1QW9A 3CC1A 4KFOA 2B7NA 6A3HA 1Q7QA 4B5NA 1DJGA 1EGMA 2XM1A 2X2YA 4D2JA 4W8AA 3NQAA 2FZBA 1SO4A 4WUIA 1A5LC 5AYZA 5M5DA 3T8LA 2E25A 3GC5A 3G6LA 5ABFA 4QJ3B 1T5AA 3W87A 3TE9A 3ZVHB 1O1HA 1JCNA 3M16A 4KEZA 3A5VA 3ITVA 1OBAA 2CLMA 1W1VA 2PPGA 4S3EA 1AH3A 4QSFA 1XC6A 1DYSA 3CU2A 1JCYA 2ZYFA 4IPNB 5IHSA 2QJMA 1QHZA 5LGXA 5D33A 5DT7A 1ZJHA 4PYSA 1VH7A 4LY4A 3UR2A 3T44A 2J7GA 3N25A 5D03A 1UQYA 3G1VA 4PCTA 1ZBWA 1Z41A 4OU1A 4J2MA 1XDMA 4G6CA 4NL1A 4WSHA 3TN5A 1GQNA 2EG6A 2Z1KA 1YKWA 1GQJA 2OX1A 2AQWA 1BXNA 2PTXA 2JALA 1TPH1 1I2PA 1TVLA 4QS6A 3BLIA 1PX3A 5HUPA 1A3HA 1S2AA 4HZMA 3W81A 3H4GA 2CBVA 3TLLA 2WO5A 3K46A 2A4AA 4LYPA 4LVFA 4Z1CA 5LXXA 4HCDA 1EXBA 1VPYA 4MG4A 5E70A 4F48A 2YL9A 1QAPA 3T4WA 1QI0A 1FDZA 1UA7A 4K8HA 2OLHA 2XYLA 5HNNA 2WHLA 3MWCA 5EA9A 2FJKA 1ZSXA 1A5KC 4LFYA 1NFGA 4C91A 4FR6A 2V2DA 2JEPA 1IXQA 1N55A 4EAMA 3UD6A 2J9XA 4PMNA 4ZQRA 5GQBA 4UNLA 1S5WA 1L6SA 3S5NA 2WZHA 4F66A 5FEWA 4NZ3A 1XJBA 4FXRA 1BTMA 2ZZ6A 4JTJA 2EF9A 3QOMA 3CV1A 4H83A 1P4CA 4CNPA 2V82A 3NSMA 4YN5A 2C1IA 1IEVA 3B0XA 2W4XA 3LCFA 3WCZA 1FWAC 1FHLA 5DXXA 1CXHA 4A8LA 4QBXA 4AY7A 1TPUA 4D6CA 3ARQA 4PMYA 1G1YA 4RK8A 6TAAA 2CWNA 2JBMA 1VPQA 3FJNA 2PDHA 1P0EA 2DSVA 3EX2A 3CPUA 3GR8A 3LYEA 1TO3A 4IFRA 4D9PA 1WDPA 4ZZ9A 5JVLA 4ZOEA 2ZX7A 1FWHC 4HPGA 2VEFA 4KCTA 3V3WA 1SJCA 2XIQA 1POKA 3LLFA 1J96A 4GKTA 1XW8A 3GAYA 2QPXA 2O4MA 1CWYA 2E5BA 4TXEA 1CEOA 1GJWA 3RX3A 3H26A 4H6QA 1QW7A 3BOLA 4KCVA 1GG0A 5C71A 3UXKA 4M56A 1OY0A 1UWSA 5CPSA 1TRIA 1XDLA 3ZSTA 2EPKX 2ZUUA 4WZHA 3W75A 3CGTA 3DERA 3BMWA 1F4AA 1TA3A 1NDZA 4HPNA 2CLKA 3NSNA 1Q6CA 2FB3A 2ZTJA 1GTEA 2YR1A 2BY0A 1V6WA 3NPVA 1OADA 4IJBA 2FIQA 2B0MA 1YBQA 3S42A 3CEPA 3UGRA 5BMWA 2HRWA 4JQ4A 4HNTA 1J0YA 2FGLA 2QYGA 3WQPA 3ITLA 1Z44A 3G1HA 1M7JA 3T2PA 1PIIA 2OYKA 8XIAA 3AICA 4GVGA 4J5NA 3L12A 4ERIA 4IG2B 4JQAA 3U4AA 3N2CA 8XIMA 1MDLA 2RGLA 5C5YA 4MY9A 4PEEA 3WQEA 3CZLA 2ACRA 2CW6A 3H21A 4B5XA 4CN6A 1KLZA 1S2UA 3MJYA 2HS8A 1XLFA 4GIAA 3G1XA 5T9CE 3ZM8A 5EBAA 1LWHA 1KBLA 2ZQ0A 1HP5A 5CG7A 1OCBA 3U5YA 4AC1X 4DBEA 4TTUA 2VELA 5AZ0A 4V1YA 3APTA 2P0IA 4OT7A 2XGIA 3NNTA 4NI3A 1ESWA 3E0IA 2P1FA 4E8CA 1T7LA 3P84A 3PZTA 3W82A 4HK7A 1Q8AA 3W72A 1XRFA 1XD1A 4G7FA 4JXCA 5AC4A 1F76A 4ADSA 2XN0A 2A6NA 5HR6A 2ZUWA 5DMYA 5IHRA 2C1GA 4EACA 2P3EA 2BOEX 3BAYA 2FZDA 4J1OA 4JTHA 3E9AA 3G1FA 2P5NA 4DBWA 1TYGA 4P61A 4PUWA 4KMQA 3USBA 1W5MA 4PFHA 3OG3A 5A69A 1GKPA 3RIKA 2FTWA 3MJMA 1ODZA 5KZ6A 1W1B1 4RV8A 4D6HA 4ZR8A 1FDYA 1O66A 1GW9A 1NWTA 1G94A 1F73A 3GS6A 1MQRA 2CYGA 2WNNA 3BZJA 2ALRA 1L9WA 3GO2A 4A22A 1F4HA 2BWGA 1PTGA 4L9YA 4PR4A 1KFEA 4GG9A 1V0NA 3W27A 4JL1A 1HJQA 1S46A 2XPKA 2BVYA 4UR7A 3W1NA 1XCFA 3H7RA 2PWGA 2VD9A 2QW5A 1GVOA 4LAMA 3R1ZA 2H90A 4EXQA 4DF2A 4LWWA 4HYRA 4M24A 4ONVA 3B0UX 3FA4A 1NF7A 2OU4A 3HQNA 1D9EA 4IFOA 1U2YA 4UFMA 3VGHA 5I5RA 4D71A 1DE6A 2QCEA 2P50A 4IFKA 5J5RA 4UFJA 2BVDA 1PSCA 2I9UA 1NQKA 3Q37A 3DYPA 4FZIA 2O56A 5K4ZA 2VRJA 5E09A 3L23A 4I7UA 2ASHA 3BL3A 3UCCA 1QU4A 4AW7A 1JYXA 2YBTA 1JJKA 1TV7A 2BS9A 4GMEA 1QASA 4HHMA 4C6NA 4IX0A 2IKHA 4GYPC 3KFTA 3TJIA 2ZXAA 3THDA 2DH3A 1OD8A 1KD0A 4LVBA 3MP3A 4TUFA 2D2GA 3GTFA 1OFDA 2WQDA 2TRSA 3MSRA 1XG4A 1A5SA 3S6OA 5EY5A 4BWLA 3QFEA 4W4QA 3NQGA 5FOOA 2Y5JA 2MANA 3TEVA 3CS2A 3UJFA 4U10A 4J40A 2Q01A 4L4PA 2CESA 4CD6A 3C4UA 1XIMA 4H6KA 3HURA 4I5XA 4FR1A 4POCA 3V36A 4UFLA 3H2FA 4JICA 3HU7A 3BJFA 2V5JA 4D6EA 2NXHA 1A47A 2NXGA 1NFPA 4LRTA 2YW4A 3SUWA 1QRQA 4M6UA 3UNDA 3NZRA 3G24A 3KTSA 3GDLA 3T08A 4F2UA 1EJVC 1H1NA 4A29A 2OKTA 1OCNA 4NZCA 1OFPA 2CLLA 3LQGA 1QNSA 4QE5A 3UNTA 3PN8A 4E3VA 5C9RA 1VF8A 2YCIX 2ZZ5A 4PTNA 4QR6A 4B3LA 4L80A 1XH2A 3A13A 3ZJKA 2AGTA 4DRSA 1UZ4A 3TSBA 5G1MA 4L4OA 5DCBA 4FXJA 4XBSA 5I03A 1JI1A 3WF0A 1DTUA 1XIEA 3EMQA 1VEPA 4S3KA 1P48A 3EBVA 3VIPA 3QMTA 4JN7A 3VABA 3E38A 2HJPA 3CHDA 1KRCC 3NZQA 1ZAJA 3AXIA 1Q7MA 3NPUA 1GZGA 1ICPA 1S1PA 4Z17A 3HMCA 5I07A 3GFYA 4ZB0A 3PTQA 5JUVA 2C91A 3AMCA 3LSCA 5HQEA 4MUPA 5IFTA 2NVAA 1QK2A 2GQ3A 3TDFA 3TCSA 4OUIA 1J6OA 4Q8TA 1VRDA 1MWOA 1OC7A 4PMQA 1SZNA 4UTTC 3DFQA 4N0RA 4BWLC 2R8WA 3PZGA 3GVGA 3MQTA 4LUSA 4N6FA 3ARSA 1HT6A 2D0FA 2A3EA 3OB8A 4UMAA 4N9DA 4U5KA 4HU8A 1HVQA 3VKCA 5A1AA 3A4JA 2ZVRA 2G3MA 2ZA1A 3GZAA 2VEKA 3AHXA 1E1EA 1OSEA 5CC7A 2DT2A 1V3MA 2NV9A 1KXVA 1SW3A 1OCQA 3PP7A 4E6MA 1U5JA 4GPNA 2Z1SA 4Q4OA 3IIZA 3CWHA 2A0NA 4R27A 4G1NA 3GC2A 4D72A 3V5CA 5I7GA 3EWWA 5JBFA 2PTZA 4A35A 3LPOA 4YMZA 1IT0A 1JG9A 3TYBA 1DIKA 2HBVA 4O17A 4N4PA 3R12A 1RK6A 3V16A 3VNDA 4Z1AA 2WCAA 1Y5VA 1MFVA 1FCQA 4L5ZA 2J9YA 4JQ2A 4QLJA 3THQA 4DUWA 5C55A 2FMNA 1WNOA 2I9EA 2CLFA 1GPWA 3SSJA 4UFIA 5IRPA 3KXQA 4PB4A 1O5KA 1DWFM 3F1QA