4XVEA

17beta-hsd5 in complex with 3-pentyl-2-[(pyridin-2-ylmethyl)sulfanyl]-7-(pyrrolidin-1-ylcarbonyl)quinazolin-4(3h)-one
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 117
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4xveA00
1VP5A 5AZ0A 2A79A 2IPJA 1VBJA 4L1XA 5LIUX 3BUVA 2PDPA 2IKJA 3LZ3A 2IPGA 2WZTA 4L1WA 4IGSA 2PDBA 3R94A 3WCZA 4RPQA 4YU1A 3M4HA 4FALA 4GQGA 4PMJA 1MI3A 1HW6A 3GHTA 4QBXA 1IHIA 1AZ2A 3DOPA 3UZXA 2PZNA 3C3UA 4GA8A 2PDMA 3LEPA 1YNQA 4G5DA 2HVNA 1ADSA 3FJNA 3BURA 4JQ2A 3CAQA 2R9RA 3QKZA 4XZMX 3EAUA 5LIKX 3BCJA 4H7CA 3UGRA 4JIIX 2BGSA 3CAVA 5M2FX 3MC5A 4WRHA 1JEZA 4PRRA 3UFYA 4GACA 3CMFA 4AUBA 4HBKA 3U2CA 2P5NA 2PDCA 1US0A 4YVPA 4JQ3A 5LIXX 3V0TA 4EXBA 4MHBA 2INEA 3LN3A 5DANA 4EXAA 2PDQA 3LENA 4WDUA 4JIRA 2IS7A 2ACUA 1YNPA 4XVEA 3ERPA 3LUTA 5AZ1A 2FGBA 2HV5A 4WDWA 1XGDA 4LB3A 1UR3M 3N6QA 1MRQA 1ZGDA 2PDFA 4WDXA 4ASTA 4JIHA 2PDXA 2VDGA 3LQGA 2FVLA 4OTKA 1ZUAX 4XO7A 3RX2A 2PDKA 3CV7A 1PWLA 2PEVA 3WBWA 4JQ4A 4Q3MA 3R58A 1EF3A 3UP8A 1XJBA 3V36A 2PD5A 2IQDA 4XAPA 3R7MA 1PYFA 5LIYX 2IKIA 1Z9AA 1PWMA 2IPWA 4XZNX 4QX4A 1YE4A 2BGQA 1R38A 3CV6A 3UZWA 2ACQA 4XZIA 3MB9A 1EKOA 4IJCA 3F7JA 2ACRA 4FZIA 1QRQA 4JTCA 1ZQ5A 5LIWX 2HVOA 4R9OA 1AFSA 2HEJA 4FAMA 1LWIA 3O0KA 4H8NA 5C7HA 2FZDA 1RY8A 4DZ5A 2ALRA 1GVEA 2HE8A 2ISFA 3RX4A 2I17A 4JTAA 5HNTA 4WDTA 1ZSXA 2FZ8A 3LNMA 2ACSA 1PZ0A 1RALA 3V0UA 2FZBA 4XZLX 1SM9A 3R6IA 4JTDA 2F38A 5KETA 1T41A 2PDHA 1S1RA 3KRBA 3LZ5A 2PDUA 3GUGA 4XK2A 1C9WA 4IJRA 3GHRA 1X97A 4JTRA 2IKGA 3O3RA 4LB4A 4LAUA 1Z8AA 4PR4A 2IPFA 4F40A 4DBSA 3B3DA 3V35A 1J96A 2I16A 3GHUA 3RX3A 3R8GA 2R24A 3GHSA 1S2AA 4PRTA 2NVDA 4GABA 3CASA 3LQLA 3S3GA 2DUXA 4YS1A 1A80A 4DBUA 4XO6A 4QXIA 1FRBA 1X98A 2WZMA 3FX4A 4QR6A 5HA7A 3ONBA 5JH2A 1PZ1A 2AGTA 3R43A 1RY0A 4PUWA 2PDGA 3H7RA 2HDJA 4YVXA 4I5XA 2PFHA 1K8CA 1QWKA 3COTA 3LBOA 2HE5A 4XZHA 3D3FA 1EXBA 1EL3A 1LQAA 3WBYA 2PDNA 1IEIA 3NTYA 3EB4A 5JH1A 2PF8A 4XVDA 2PDIA 1Z89A 3UYIA 4JQAA 1M9HA 2PDJA 1XF0A 3UZZA 3T42A 3P2VA 1AZ1A 2CLPA 4Q7BA 1Z3NA 1T40A 2DV0A 2FZ9A 3DN5A 4NKCA 2IKHA 2IQ0A 4YVVA 2C91A 4WEVX 1MZRA 3WBXA 4DBWA 4LBRA 4PUUA 4WGHA 3UZYA 4JTQA 1HQTA 2INZA 2J8TA 4ZFCA 3WG6A 3UG8A 3G1RA 4GQ0A 4LBSA 3VXGA 3ONCA 4JQ1A 3M0IA 3Q67A 3LD5A 4GCAA 2BP1A 3EB3A 3Q65A 3UWEA 4FA3A 1OG6A 1AH4A 1YE6A 2PDWA 3BV7A 1S2CA 3R8HA 1AH0A 1S1PA 2QXWA 4ICCX 1Q5MA 3V0SA 1AH3A 3G5EA 3H7UA 2F2KA 1X96A 2PDYA 2PD9A 4LAZA 3N2TA 3M64A 2PDLA 4GIEA 5HNUA 3H4GA 2DUZA 4HMNA 1Q13A 2NVCA
chains in the Genus database with same CATH superfamily
3TU9A 1QJWA 1RR2A 4LWWA 5B80A 3GVQA 1G4SA 1JCMP 1BF2A 1ITQA 1O66A 1EHAA 4UTTC 3E49A 5J04A 2BXZA 1H1ZA 1OFEA 3H24A 1TTJA 2NXGA 1MI3A 5I07A 1S2UA 2VX4A 2E9LA 1TYGA 4INFA 1E0UA 1MNZA 3W7IA 1OG0A 2WM1A 3WLKX 4GC3A 1OFQA 2PDMA 4RPPA 3SCUA 1AJZA 2WKGA 3DC0A 3WNNA 2REQA 4Q6JA 1RJRA 3BQ5A 4KH2A 4ATLA 3LM3A 4KGLA 4YTSA 3N4FA 4ZA0A 1M53A 2JF6A 2ATMA 3MY9A 3NQ8A 4M51A 5G4HC 5AFDA 3RPDA 1Z41A 1W9XA 4UBPC 1DWHM 4HPJA 3R89A 4JTSA 1MFUA 4H6KA 4JX4A 4NNBA 1ZP3A 3ITVA 4BKNA 3WEZA 4GACA 3KBSA 4HK7A 1QW9A 3N15A 3FXYA 3QBUA 4HPHA 3SY1A 3QW3A 1O1ZA 3OYZA 3N2XA 1MDLA 1U1UA 1Q6LA 4OHQA 3VC5A 1D7FA 4YXGA 4ML9A 2C16A 1KM1A 1PAMA 1JPIA 1RZMA 3GR8A 4I9TA 4ZQOA 4PBGA 5ECVA 4NJHA 5I3FA 4X0VA 1K6WA 4DNMA 3WD4A 4K8EA 4AWEA 2QV4A 3TFXA 4UOQA 1ZAHA 4XVEA 1T5AA 2RDXA 4DZHA 2FGBA 3TJ4A 3GG7A 4DJFC 3RHGA 1EX1A 1GUVA 4Z1AA 3NSNA 3VO0A 1QW8A 1ZPTA 2GUYA 3SI9A 4PMOA 1T8XA 4WDXA 1Q8AA 4CD5A 1EDTA 2V5JA 1DJQA 4Y8FA 4FR1A 3PPHA 4QCFA 2FVLA 3OA5A 3VDHA 1KA9F 2DT3A 4WHBA 3WH9A 2JE8A 1Q6EA 1E0XA 3P0XA 4K1GA 1JPKA 4QG9A 3NZRA 3ABZA 1OVDA 2LLEA 4Z2IA 2PWGA 2RGLA 1QI5A 4IMGA 2CLKA 3MUAA 4M6QA 5U4NA 3UWUA 4UOJA 1RVKA 2VEKA 4LC8A 5DY3A 4MAVA 3A3WA 1FP9A 2BOFX 1Q2SA 2BASA 4FZIA 1AMYA 3PBWA 4WJ8A 1VLIA 1GPWA 1NQ6A 4TX6A 5F2GA 2WPBA 2ZUNA 3OZPA 3E0IA 3MSYA 2QS8A 2ALRA 3DBPA 2HE8A 1A5NC 2ISFA 3T6CA 5CZJA 3T2QA 1TPUA 1NDWA 2YCJA 2XGZA 4NJKA 1BD0A 4P7OA 3LLXA 3LV5A 1UBPC 2V5CA 1TPH1 1DEDA 3KHDA 3GXNA 3M7WA 1V79A 3QV9A 3GC4A 2DZUA 2XINA 1Q6FA 3UXLA 3LYEA 3A12A 4GYPA 1SQ7A 4IMCA 6PTDA 5CPQA 1XH2A 4XK2A 3HPZA 2AMGA 3BAXA 1X7IA 2JFEX 2V3FA 1NVMA 4MWAB 4D9PA 3RRAA 2O4QA 3LHYA 1PKYA 2OWXA 2GPTA 1JF6A 1ZJIA 4UCGA 3U4FA 1IXOA 4F0SA 2OQYA 5DMNA 1UJQA 3WUBA 2OWWA 1TKKA 4JCMA 1HT6A 4LGXA 3B9OA 4C1NB 1JJKA 2R1NA 4L9YA 1UW9A 3NQVA 3M46A 3W26A 4B2DD 1F73A 4REQA 3DI0A 1PTAA 1GQIA 4TMBA 1OFRA 1QI4A 3BAJA 1XLAA 3BCFA 3KOZA 1GW1A 1XPGA 3M6DA 4E5TA 2WV8A 1CTNA 4LEFA 4YS1A 1TWDA 5JBFA 1W32A 2WNNA 5JMUA 4DLFA 1C90A 3SCVA 4KCWA 3M47A 3ONBA 5JH2A 1TR1A 4QS6A 3G1HA 4LCSA 3T09A 1DE6A 3FGCA 4GQQA 3RPMA 1RPXA 2ZX5A 2YW3A 2D0GA 3CZEA 3NPWA 3JUGA 3RLVA 4LYQA 4WCJA 5KMYA 2V3DA 1OD0A 1XGZA 4ZOCA 3W81A 5I3JA 4MJ4A 1XHGA 2WJDA 3QV6A 1AW1A 5FJIA 4EPEC 3LNPA 3AISA 5C9UA 3AWOA 1HGYA 3FXGA 3TNOA 1P1XA 3PAJA 5EFFA 1VFOA 4YVVA 2C91A 3MCMA 4YWSA 1OHLA 3WBXA 4V33A 4GFIA 4LBRA 3H53A 2QLYA 3NQAA 3W71A 1VAHA 1OIFA 3W2MA 1UR8A 1HQTA 4JTQA 4O4VA 3FDGA 1KM0A 1VJZA 3I68A 3PBYA 3GDMA 4BF5A 1JFXA 1NARA 2DVTA 2GDUA 3TONA 1Z32X 1AMKA 4IPNB 3EA2A 1EJSC 1E6QM 3EB3A 2DGAA 4ZXLA 3DYMA 1E6PA 3S5NA 2VC5A 2D0HA 2VX7A 2A6NA 1OF6A 3O6YX 3T05A 3NQFA 5E9AA 4OE7A 3WEMA 3KOFA 5D2YA 2PDYA 4GVFA 3MQTA 4LAZA 4XKYB 1LRQA 1KD0A 5HNUA 1ME9A 1I75A 3A47A 3CV1A 2BOEX 3M0ZA 1SJBA 1ZFJA 1LL7A 4JGDA 3QW4B 1CW2A 4E2DA 4GKLA 4RK8A 3DCPA 3SCOA 4N6EA 1B54A 3H2FA 3W7HA 4RW3A 2ZUVA 3A13A 4Y9PA 2OEJA 3QQWA 1XX1A 2ZQ0A 3ICJA 3BUVA 2BNJA 2WNQA 3SO7A 4POCA 4JFWA 3WUEA 2O0TA 3CO4A 4RDZA 2QUNA 3SCRA 2GVEA 1SJAA 3G8EA 1JDAA 3GE7A 5HOSA 3HGOA 1KM6A 2VFEA 3ZLFA 4QBXA 1V6VA 3MI2A 4ENLA 2CLIA 1ISZA 2OELA 2CFFA 2YYTA 1R47A 3QOKA 3CAKA 3IPWA 1EX5A 1V0LA 3NM3A 4JQ2A 3WY1A 1RD5A 2HJPA 2X16A 3MJMA 2VJXA 4AY8A 3T0CA 1ITUA 3UPMA 2HBVA 2C13A 2ZXAA 4C7DA 3EEGA 3QLDA 4UFMA 3WF2A 3MC5A 3H6OA 3OP2A 4KW2A 3LERA 3SN0A 1DL3A 7TAAA 1LG1A 2UY3A 4JKMA 1UZDA 2PRMA 3B0UX 1CPUA 2FZNA 4ML4A 4Z17A 2CZFA 4US5D 1B3YA 4DQWA 2YJQA 3DGRA 2Z1KA 4UC5A 1HKIA 3TTOA 1IIHA 3G2GA 4HU8A 3RYSA 1SFLA 1J0YA 2VC9A 4BCEA 3LOTA 2YCLA 4PH6A 2VRJA 1TELA 2DVXA 3AMCA 3OHMB 4Q7NA 1YTEA 1UZ1A 1L6FA 3GTIA 4QLLA 6TIMA 1Q3NA 4DJEC 3HBLA 2VZOA 3CNYA 2YSWA 4IGHA 2ACUA 3W1LA 1GEHA 1EZWA 5AZ1A 4YNGA 4E4UA 2HV5A 2O9OA 4F4RA 1Q6DA 3KP0A 1S2TA 3OZOA 4OV4A 1FDZA 2FPYA 1H0GA 3D6NA 5DFAA 3V75A 3OG2A 5REQA 1JZ4A 1TZ9A 1M7JA 2C79A 2P3ZA 1TPVA 1LLZA 2WZEA 3O1NA 4E8CA 1BF6A 4DWSD 1CENA 3VUSA 4PCNA 3RX2A 1JZ5A 1YXCA 5F2MA 1IT7A 2X7WA 3B8SA 3A22A 4IPLA 2D2HA 4BWLA 1F3EA 1R5YA 1XXXA 2B31A 2X09A 3N73A 2PMQA 3V36A 3TLLA 3OHIA 1NJJA 3RM9A 2GWNA 1E6ZA 3SECA 1KLZA 2PTZA 4AXKA 3DFSA 3H4XA 1DVJA 3C3NA 1R9ZA 4ALDA 5FJPA 1WUEA 1NTHA 1EKOA 2ACRA 4Q8VA 1C9DA 2PBGA 1BWVA 3KTCA 3MTWA 2YCKX 1PX8A 2W67A 2BHZA 4O1FA 4JN8A 4IP4A 4N9EA 1AUSL 5BOEA 3VM5A 2WZIA 2ZA1A 1SSDA 3W7MA 5FL1A 1FWFC 1PKMA 4C6KA 1MQPA 5BXTA 4NASA 3IIOA 2WYSA 4AZHA 2F38A 3AHZA 4UQCA 4X9SA 3KRBA 4HOWA 3KOYA 1CEOA 2D1ZA 4ACZA 4C6DA 3AXKA 3EOLA 4JTRA 4GGHA 3DHFA 4JYEA 4LALA 5D2XA 1R86A 3AAMA 3F5JA 2VC7A 3S42A 3M0HA 4NG3A 1VBGA 1H2JA 4ZB2A 1Q2RA 2UWFA 2VCBA 1G01A 1FX6A 3SZ8A 3W73A 3BL3A 3W38A 2YXXA 3PJWA 1R6WA 4GABA 2BY2A 2E5DA 4ECLA 3L4YA 1PDZA 1QT1A 2XH7A 1NOFA 1XRSA 3MJYA 1LUCB 4DBUA 3CQKA 2YPIA 4FLQA 3B8VA 3VDBA 4DM2A 4CVWA 2YR1A 3GNRA 4HPXA 3CWOX 5BMWA 3TQVA 2ADAA 2IMRA 3N9RA 1L2QA 3WFZA 3QV7A 4I5XA 1OX4A 2ZBTA 1DE5A 2DZXA 3QC0A 4MZ8A 3E74A 1XRTA 1R2TA 3W6LA 2YXOA 1R3TA 3PWIA 2WKJA 3SY5A 3IAQA 3KZPA 2FGZA 1F76A 3KVJA 2PLKA 3PZGA 4UTWC 1V6XA 2FPVA 1KBIA 1WDRA 5KITA 1K8XA 4Q7BA 1ENUA 1DHKA 4PE8A 4QEEA 2VDHA 4PUKA 2R1LA 3STPA 5HK4A 1M04A 4MGGA 2ANUA 3NQEA 1BSIA 3AZTA 1Q63A 4V15A 4IH3A 3PP7A 2OR2A 1KR1A 3B05A 3ZWSA 4ZR8A 5AOUA 4DBWA 4PUUA 2SFPA 2GWGA 3WLNA 3TJLA 4LCQA 3VIFA 2J8TA 1UP2A 2EPHA 4PMYA 5I3GA 3OW1A 4JEQA 1QNPA 3EWBX 1PL9A 1HTIA 4Z0SA 3S47A 2V0TA 3MO7A 3URBA 2QULA 2CBUA 4A21A 3AUOA 1H50A 3USBA 3UWEA 4DIAA 4GHRA 1ZCOA 4KPLA 1YE6A 4GYJA 3R8HA 3MANA 3QZEA 1KFJA 2J74A 4QEHA 3ZR4A 3MCNA 3OB8A 1H63A 1KM5A 1R3VA 2WO5A 2YZRA 3WK3A 1MRAA 1SFSA 3I4EA 3QH2A 4CU8A 1ALDA 3GS6A 1YYAA 1PHWA 4UTJA 2X1TA 2IPJA 5LHFA 4CNPA 1GVIA 2WSRA 4PB4A 3LGGA 2J88A 5D9MA 4DO7A 3KOWA 3LZ3A 3R0KA 2VFHA 3RJYA 1KQYA 4IPPA 1EJWC 5G5IA 4A2RA 1W5QA 1REQA 1Q8JA 1YXDA 2OTDA 3GDTA 1IHIA 4HHMA 1AZ2A 4NZFA 3SR7A 2V69A 1CGVA 1QFEA 5B7ZA 4RE4A 4YTUA 2GJPA 3FV9A 4LQ1A 4X61A 3TQPA 3WBEA 4LS0A 3F2BA 1GVQA 4TX9A 2BZNA 4EF9A 1TB3A 2QPUA 5HWNA 1G4EA 1JDFA 2YL5A 4GG9A 5K4ZA 3HGSA 4P2VA 5CC3A 2OZTA 3HJZA 4C6BA 5A6LA 1NFGA 1A49A 5LXXA 3K5XA 1NF7A 4IISA 5CBIA 2EKCA 4XZ9A 1GHRA 5TIMA 4AUBA 1XSIA 1FWAC 1L6YA 4EPKA 5PTDA 2WMIA 1W17A 2GQ9A 1EC9A 5F1VA 1KM4A 1I0BA 2CLHA 4QLKA 3V0TA 1HL8A 4JN6A 1K70A 4D8AA 1ME7A 3QR0A 3MCOA 5FOOA 3HB9A 1W5NA 1EH9A 1DHPA 1KXQA 2YA0A 1KWGA 4A8IA 5I7GA 3NFUA 4BZYA 1C93A 4AZCB 3NDZA 3GYEA 4I8DA 2OZ3A 2WM0A 4J5NA 3N2CA 5LKYA 2EEXA 1R7OA 1OYBA 3DX5A 3IANA 4WQ6A 2GQAA 3P5ZA 4LRSA 2DDXA 5HQLA 4C6NA 4AWSA 1IV8A 2YL8A 4PTDA 5DF0A 1QNSA 4GVIA 5AC4A 2NSOA 3CV7A 1UD6A 1XFCA 2QKFA 2VEPA 4A29A 5AVHA 4KFPA 3WNMA 2WHJA 3WMBA 5FEWA 3R11A 2BLEA 1VF8A 2CHRA 1JCLA 2VOTA 4PL1A 3A4WA 2XH4A 1DV7A 4HNCA 2NQJA 1TA3B 4AAJA 4IPJA 1FCQA 2OGJA 3T1GA 3BOXA 3BAIA 3RCYA 5FJUA 3F7JA 1E40A 5E0CA 1YDVA 4ZB0A 4NILA 4X2RA 1IT8A 5ABHA 4E38A 1QNRA 1XV8A 4UMBA 1VYPX 2Z29A 1GVEA 4FXFA 1VIZA 1P0BA 1WV2A 4IMDA 2I17A 4QAWA 1M7XA 1R3QA 4CNOA 3CEUA 4IUOA 1G69A 1H7RA 4JTKA 4AD2A 2OSXA 2EG7A 4BF9A 3DIPA 1J0HA 2BMBA 4UWMA 1V77A 2XYLA 1I9CB 4HHLA 4DM1A 2CKSA 2CXEA 2VC6A 1UD4A 3GHRA 3I65A 1QNQA 3IARA 3T2PA 2QDDA 2GVYA 4Z1DA 1XIFA 4F79A 3T7VA 1W1A1 4R34A 4LB4A 3QOMA 3BG9A 3XISA 4FNSA 3I3EA 1GCYA 3PTMA 3V3WA 1PZ3A 4RE3A 3QGAC 3S5ZA 1WAWA 4BQ5A 3V35A 1HO4A 2QJIA 4JFSA 2B81A 3STGA 2HMCA 3MP3A 4XZWA 2GK1A 2R24A 1MW1A 1X6NA 2WJFA 2GJLA 3SRDA 1UD8A 5CLWA 1K77A 1P6WA 5D09A 3R2GA 4L9XA 4K36A 3WMLA 3DUGA 4K6AA 2REQB 5LNRA 1XGEA 1ZENA 2YL9A 4CQDA 4D6GA 2YZ5A 1TTQA 1W9VA 3RMJA 1K9EA 3ZIZA 2BDQA 2PDGA 4KWOA 3ARUA 4FO4A 4YVXA 2VWTA 2VKZG 2XHYA 4A4AA 3R1ZA 1QUMA 2ZYFA 3NDOA 4AVOA 4M1BA 1OC6A 1QMLA 4O1DA 3RLHA 3HZ3A 4L64A 3UXIA 3O6AA 3VK5A 3EB4A 4Q22A 1M7PA 1CWYA 4Q33A 3DI1A 2PDJA 4IUGA 2CLPA 1LCOA 4H4IA 1OBAA 3E2VA 5BRBA 3GX9A 1HXJA 1XSJA 3JS3A 2CHOA 2XGBA 4Q8OA 4MMWA 2C71A 2J7CA 1K7FA 2JK2A 1PHQA 3VVGA 1XP3A 3GC5A 1TPB1 3CQHA 3N3MA 4UQDA 1DJNA 3MWCA 1J5SA 4J28A 2NW0A 3RPTA 2A3HA 3CZLA 1VPYA 4HPNA 3FA5A 3IK4A 3UWZA 4IIBA 3GXFA 2HROA 4DWSA 1KGWA 1DYSA 5AN7A 2OXNA 1F74A 1AH4A 1P48A 1S5MA 2CW6A 1PIIA 4O0ZA 1WE5A 1FHDA 4XUGA 3S2NA 5H8MA 3DZ1A 4C6JA 3BQ6A 4Q8QA 2GOUA 4QJ4B 4O13A 1IXQA 4ZQMA 2ZWYA 4LY8A 1YX1A 4H9VA 1FXPA 3HG2A 4I8YA 2BY0A 2DUZA 2QAPA 1UP0A 4AEFA 4XAGA 1G6CA 2NV9A 2JKAA 3C2FA 3GG1A 1E6RA 3NQDA 3U5YA 3CHVA 5I02A 1C3FA 2WSYA 3E9AA 5LIUX 1TJRA 3L4WA 4U3AA 3UERA 4PGLA 1YBQB 1G67A 1Z48A 5FD0A 5K3VA 3UWYA 4V27A 3II1A 2X42A 3UY7A 1T99A 1B5TA 4I9AA 4RPQA 1POJA 3UNTA 3UZXA 4M0XA 1V3KA 3MYOA 3RM8A 4FX7A 4HNNA 3ATYA 4UR9A 3SUUA 3L0NA 3ARVA 4FNTA 4GZ7A 3ORWA 4G7FA 3VINA 3EX4A 3WFLA 1TUXA 2BBFA 4UFLA 3WO8A 1X1NA 3TC3A 3MMWA 4R7WA 3MVTA 4F48A 1MXGA 4NUWA 2WMGA 5FA5A 3SFWA 3V5FA 5BRQA 4I90A 1VB9A 1XIJA 2YFOA 1J2BA 5FSDC 2ZE0A 1EGZA 4PRRA 2WQDA 3TP4A 3UFYA 4X60A 4F9JA 6ENLA 4O1BA 1O68A 1WZAA 3NEHA 1LQ0A 3UWVA 1XBVA 1K9FA 1PB0A 1T0OA 4DO4A 3W7JA 1R9YA 3KTSA 3VIIA 2CXGA 5I78A 3P14A 1V5XA 5AC5A 2JKPA 2WPGA 1GKRA 4REQB 1SW0A 3I6EA 1B9ZA 4UTMA 3L21A 2QGYA 5JBDA 1OSEA 4JNYA 3TIMA 3TA9A 1GG0A 3VC6A 2ZZ6A 2AQOA 1RD6A 3G18A 1QI2A 4NNCA 1TCMA 3LUTA 2PCEA 5CKSA 3ARYA 2YDQA 2C1GA 2YYUA 1AG1O 1J0ZA 2OOFA 2R91A 3ZOAA 3FGCB 3G3MA 3SCQA 3PVFA 2ZRYA 4I7WA 2PRHA 4R27A 2GJNA 4C5ZA 2QF8A 1P6BA 1B4KA 4O28A 1R3WA 3W22A 4XD4A 5H2ZA 4DF2A 3UPWA 1AW5A 3W2UA 4LOCA 1LBMA 3WDPP 3UA3A 4IIEA 1C8YA 3OTRA 3RR1A 1XJBA 2G4JA 2J7FA 4Y96A 5EPDA 2WKLA 4OVXA 4E2BA 3HF3A 3ZT5A 3GDLA 1LT7A 4G1NA 4ERIA 1HFBA 3IJIA 3PZMA 2ZZ7A 2OO0A 4D6FA 1PIGA 5DT5A 1ONXA 3UR2A 2D69A 5A95A 3TN6A 3KLKA 4HK5A 4R33A 3LHUA 2WMKA 3EX6A 4Z2HA 5CXPA 1TIWA 1GOXA 1RV8A 4QP0A 3M16A 3TYAA 4CCZA 2F9RA 2G41A 2HPMA 1HJSA 3HURA 2ZVIA 1R7AA 3DG3A 5D32A 1H7NA 4PYSA 1MEHA 2BODX 4O0KA 2DZWA 4K8HA 2AKMA 1A5CA 1RALA 2FZBA 1K4GA 2L5HA 3N9KA 1SM9A 2JALA 2J79A 2Q3RA 1JYXA 2IXVA 1VYSX 2BB0A 2P0OA 2VEFA 2PDHA 1YPXA 1AD1A 1Z69A 2A3AA 3W7EA 1DJWA 2IKGA 3ARRA 2PF0A 1BQGA 3OVPA 3BGGA 3SGGA 4LAUA 4PA8A 2P10A 4HMDA 2WBGA 4ZBCA 3UR5A 3CB3A 2ICSA 5FF7A 3M1ZA 3CUJA 2ODOA 3LHZA 3PR2A 3TXVA 3KXQA 2HK0A 3GYCA 1EPVA 1UR2A 1W1IE 3SAZA 1EUNA 2PUZA 2GSHA 4WY0F 4PFHA 1OCJA 4ONVA 3A4XA 1O95A 4DPPA 4MY9A 4GO8A 4EWND 2H8XA 3FKRA 3H7RA 2Y2WA 2ZUSA 3NUKA 2E67A 2VQUA 4NJGA 3OG3A 1RHCA 2Z6JA 1O60A 4JFVA 1ZJHA 4CD6A 2ZRXA 1BKSA 1OGGA 1EXBA 5B7YA 2HTMA 1XIGA 2V8ZA 4AZBA 1I1WA 3P60A 1WKDA 4AHPA 4XVDA 4J3UA 4JXCA 5LSMA 1KLYA 1XUUA 3RCNA 3L5MA 5L9FA 3HQPA 4GI9A 4S23A 1QXLA 2I5IA 1HL2A 3IEBA 2NX1A 1FKWA 3DENA 3OU8A 4NP7A 4ZTYA 2YCLB 1HVXA 1KFWA 4UOZA 1EPXA 3VKAA 2D22A 3P84A 3WH8A 6CGTA 1UIPA 3EPMA 3RF9A 1OY0A 3H2NA 4J3WA 3WLOA 5CGMA 4Z2GA 2YOCA 3UXKA 4GQ0A 5EU9A 3OLDA 4NJIA 3QMTA 4GGBA 3R12A 1HKVA 5F1UA 3RMEA 5MHBA 3EB2A 2O55A 3P74A 2Q8XA 3VIPA 1KXVA 4L4LA 1UKSA 2BP1A 2YX0A 3GU1A 1EWDA 2DH3A 2ZRZA 5REQB 3NSMA 1A4LA 2A7PA 2VZUA 4UIOA 5A6KA 3W01A 2D2GA 3T55A 3T2OA 1OX5A 2Z2BA 4ICCX 1W9UA 1F6YA 3FK4A 1ZJBA 2NX9A 3FY1A 3G5EA 3QXBA 4JIQA 1ZLPA 4O0QA 1Q6OA 4JHOA 2PCQA 4H83A 3N25A 2PWVA 4U33A 3UG5A 1TPDA 4QG6A 3W1UA 2NWSA 3TW6A 2XFRA 5C2XA 4HA4A 4MNKA 1E5JA 5F4WA 1V51A 1AD4A 4AMCA 4A8LA 2OSYA 5LZLA 5E9XA 1MW2A 3AOFA 4IF2A 4XZBA 3ZR6A 3TTSA 1SZRA 3QRHA 1DQWA 2FVMA 1QHZA 1EUAA 3M4HA 1G5AA 2VCAA 1GVYA 3FKKA 4MNLA 1S5VA 5GJMA 4O16A 1OM0A 5I79A 5BOOA 2UY5A 5CSUA 1NDZA 4GISA 3S1XA 3ITGA 3GU9A 4IG2A 4KQNA 5FEXA 2QJHA 2POTA 3LHWA 4BEQA 3U6WA 1IZKA 4XZMX 2ISWA 3BICA 4QIUA 3W70A 2CZVA 4LAMA 5BWFA 1WDSA 3PBVA 1YTKA 3SGZA 4BQ4A 4WZHA 2WK2A 4ACZB 4Y9OA 1Q4NX 3E2RA 1R2SA 3EWCA 3URAA 3RO8A 1GZ1A 3GY1A 3IJDA 2VVSA 4IP5A 2BG5A 2DSVA 1AK5A 3GBDA 1TE1A 3BJFA 2JEQA 3ZS4A 4OT7A 4DYKA 2E6DA 4HT3A 3E0WA 3AQUA 3TX9A 4TVCA 2BSLA 3CT7A 1K03A 1E0VA 2HWGA 4XBKA 3VOHA 5K9CA 3W87A 1RA0A 2A1YA 4U28A 4DHGA 2Y61A 1DKWA 3CL8A 4FX6M 1BTCA 2WOQA 3LCWA 3WYZA 2I5QA 4NZJA 4KWWA 1R9XA 3VCCA 1TSIA 4LBUA 5I3HA 2PDQA 2DU2A 3HO8A 3NPUA 1JCTA 4I3GA 2IS7A 1TV3A 5HDRA 3S83A 5KZMA 3ERPA 3PFRA 3O15A 3O16A 2GSJA 1S5WA 4QQUA 4UFJA 2E1WA 1VENA 1W9BM 2OLSA 3H22A 3RDKA 3DG6A 4Y90A 4O50A 5DEZA 1OX4B 3OGVA 4GC4A 1W8SA 1I2NA 1PTDA 4HHHA 3WJZA 3AYTA 1ZBVA 2VDGA 5G1YA 3L5AA 2PDKA 2G37A 5G1TA 4FNQA 3IUIA 1UASA 2Y85A 3OBKA 2V5LA 5D2VA 3R7MA 3IIPA 3F03K 5A8PA 1W9PA 1DQUA 2IKIA 4IXXA 1G1YA 4D2JA 2J27A 3WQWA 3NGFA 3B03A 5HBFA 5FL0A 3R13A 3WJWA 1ZBWA 4IJCA 2ZDRA 1UH4A 3GIQA 3SIZA 3TTYA 3AWNA 1LWJA 2HVOA 3CPUA 3MDUA 4AD1A 4H8NA 1A0DA 3G1FA 1V4YA 3I6RA 3AS3A 1FDJA 4EK7A 3LLDA 2PPGA 1E3ZA 2XGIA 2OZ8A 5A6MA 4JTAA 1ZTVA 3MKVA 1UR0A 2BY3A 2VFIA 2EGZA 3MUY1 1I1XA 4JKLA 2DIEA 4UTLA 3L2MA 5BU9A 1UKQA 4JTDA 4F0RA 4K38A 3BCDA 3F2DA 1ODUA 1L2UA 3NQ7A 1A47A 1VCGA 1YW1A 2DIKA 3GQYA 3MHFA 3NL3A 5CPOA 4GLEA 1H62A 3W0KA 5MKGA 1RBOB 5I23A 1E4NA 1O94A 3P61A 8RUCA 3ITTA 1FY6A 4GIYA 4KETA 3VOIA 3BW3A 2J13A 1H0IA 3BDKA 4GE8A 5FF3A 4M6UA 1J11A 3SCWA 2X2GA 3ISIX 3PWGA 3FDKA 4D71A 4Y6GA 3CJPA 1CECA 3P67A 4KEUA 1J0JA 1KW1A 5D4YA 1GW9A 3HTWA 3AXHA 2YB1A 4E4PA 1CLXA 1D8WA 4QJ5B 4HU3A 4LNYA 3CUFA 5E09A 3QSTA 1E4IA 3WIJA 4KRTA 4ADSA 3RN6A 3BH4A 4MM1A 3W02A 4OU1A 2QUUA 3B9DA 7A3HA 4G8TA 1RY0A 1O1HA 3ANVA 1W9DM 1QHPA 4FI4A 3DC8A 5AC8A 1E4LA 4ZTXA 4HHPA 1K8CA 3IV3A 2Y0FA 2CESA 1EL3A 4AX7A 4RXFA 1SW7A 1BKHA 2A3EA 4FOUA 4LYKA 3LTYA 3WSUA 4IJBA 3SN4A 4O10A 3MKCA 3TOYA 1VCFA 3IIVA 5C71A 3PG9A 1QWGA 4PMRA 1E43A 4E3VA 4A8NA 4ZVJA 5M3WA 3JVAA 3T42A 1OFPA 2XH0A 4ATDA 2WMIB 1LT8A 5GNZA 3THCA 3ZVIA 1DP0A 2PP1A 3AS0A 4NKCA 3GWQA 2OB3A 4M8UA 3AIBA 3CUGA 5JUVA 3NXLA 1F6KA 2HNEA 3QKEA 5JIWA 4H8HA 4PEEA 2F6XA 1X1OA 2Z24A 1H7WA 4AIOA 4WVXA 1POKA 1OK4A 2A2IA 3N1AA 3VNIA 1KGUA 4UFHA 3G1RA 5FAGA 3TTQA 4LUSA 3B40A 1XLMA 4Z42C 4A3RA 4BA0A 2KZHA 2VGBA 3M0IA 1BWLA 3VTRA 3U2EA 2C19A 4LYRA 2FYMA 3CLWA 3SGUA 4NZ3A 4JTGA 3TNBA 2CLFA 3DXIA 2PC8A 4O8AA 2Z6IA 4L56A 4E3TA 2EPLX 3UJ2A 3QPEA 1WPCA 5E6ZA 4ZSUA 2VXNA 3TYBA 2PD9A 2X41A 2PTDA 4AEOA 3PN8A 3GNPA 1UG6A 1NP2A 4WK9A 1W1VA 1ONWA 3AROA 2YCEA 5AYXA 1A0EA 3CBWA 1SUXA 1WZMA 4HN4A 4KRUA 2J7GA 3NEVA 4ZZ9A 1BAGA 3LI0A 1U22A 4HCHA 5EMKA 2Y5JA 2PDPA 3VU2A 3THQA 4JTEA 3NDYA 5HQEA 1H4PA 1TJ0A 3ZT6A 3KL0A 3RRXA 1YMYA 3A3HA 1ZY9A 3A4AA 4OBSA 2Y8UA 1RCQA 3O9NA 5TBOA 1JZ3A 5K2ZA 3FJNA 4O15A 3LRKA 2R9RA 2FH8A 1YKWA 3M07A 1XDJA 1K7XA 1XCXA 2OLHA 2DIJA 2IQTA 2FDMA 5BWAA 1TV7A 4M19A 1DWFM 2V67A 4S3JA 3PANA 5KEZA 2YBTA 5M03A 4HP5A 3UYCA 3BANA 4HMCA 4KEZA 4D6JA 5MF5A 1V3IA 4XBJA 1YDOA 3CWHA 2DEPA 4DYEA 3HV8A 3MI3A 3UJSA 5KZDA 3CMFA 1PO9A 1JD7A 4C6OA 4B91A 3GK0A 2GK1B 2Q09A 3I3DA 3GVGA 1FWDC 2HS6A 3DYOA 1GOMA 3WD0A 3RJXA 1ISXA 4I5RA 4UTKA 1EJTC 5HATA 2E5CA 4KGJA 3FSUA 5HNRA 1W6TA 2PGFA 1QW7A 2AGKA 3LENA 5CSYA 3VIOA 1W3IA 2O9PA 7REQA 5M17A 2BHYA 4W5ZA 1XSKA 1A5AA 4NZ1A 1YLVA 4O1CA 3WLJA 1KQZA 2EG6A 2JIWA 4N42A 4Q7IA 1GQLA 4CN1A 4YHEA 1TO3A 1NY1A 2Z2UA 3JW7A 2B0MA 2YDRA 3MUCA 1BLIA 3PB0A 1U33A 3IACA 3WBWA 3FNDA 2QPXA 1MSSA 3QZAA 3FCPA 1PYFA 4GJ1A 3W88A 5GJNA 4GPNA 2IPWA 5D02A 2WSPA 4B15A 1JYVA 3WEOA 2WJZA 1LLWA 2ACQA 4IIDA 5CZ0A 2HK1A 5G4EA 1P0DA 2XISA 3W7LA 4NAFA 2NVAA 3T8QA 4B5TA 1BYAA 4CCCA 3W76A 4F0MA 5C7HA 2DZVA 5EMUA 2QCFA 4U5IA 2PGRA 3LPFA 1IT0A 2FPTA 2VWSA 4DWSB 1T7LA 5BOFA 3GXTA 1PTGA 1SJCA 4L1GA 1TCDA 4M80A 3CMJA 3V5CA 9XIMA 3O0FA 1V6YA 3WDHA 3AIRA 1PXGA 2PRLA 4L80A 3O07A 3T0BA 2BOGX 3W72A 3LX9A 1VGAA 4ICMA 4LUIA 2QDGA 3M44A 1F3TA 3F4DA 3FSTA 4MF4A 5CZSA 1E1CA 1EDGA 4JX6A 2EPNA 1XCWA 1Y5VA 2VEIA 4F40A 4AHQA 1GT8A 1FCVA 1GORA 3P8IA 1ADOA 1Z7AA 1GZJA 3L0KA 3GHUA 3FYPA 2J9YA 1VFLA 3NQBA 4WX2A 1MUWA 1TVLA 3TJIA 4PUMA 4LF2A 3INPA 4AZ6A 3BXWA 5A8GA 1KFBA 4TTUA 4ES4A 5BROA 5D03A 4MSSA 1O4UA 3UZJA 9CGTA 4XX6A 4AC7C 4ZEPA 4XO6A 2W79A 1B9BA 2QVNA 3GBEA 3CL7A 3FX4A 2HQAA 2WAGA 1PS9A 3N14A 1R2RA 5EY5A 2VZTA 3C8FA 1XKYA 2JIEA 4HQVA 4R88A 3ZT7A 3MV11 4CNUA 2J25A 3LBOA 2UZ9A 4MIMA 1GKPA 3EKLA 3WD2A 4GNJA 4B5VA 3B0YA 3TZNA 1ZZMA 5JH1A 5CLTA 1WO2A 2VGFA 3BV4A 4HD5A 2PF8A 3VKCA 3HQOA 4V1XA 1JQXA 4LNCA 2VEGA 3NYDA 2VL4A 4YYFA 3WDJA 1VEPA 4PCFA 2W6RA 3WUFA 2NT0A 5TQLA 5IFTA 2Q8ZA 1T40A 1IIGA 4PN2A 3LMZA 3PBGA 7ENLA 3W53A 4CD4A 1LLOA 3U7BA 1HG3A 3P3BA 1PKNA 4IL0A 3QEZA 3S1WA 1MZRA 1ODZA 3WK1A 3LM7A 3MWAA 1VS1A 3ARWA 1B3XA 5HULA 3WLRA 3N11A 3GIYA 1JR1A 3MKKA 4PZVA 2UV8G 3OBEA 1V6WA 2X0HA 3O6DA 4QNWA 4ZOBA 3CH0A 2WSQA 3HPAA 1EF2A 1QOPA 4JR5A 3C2YA 3AMLA 4GCAA 4QNEA 1T96A 3SM0A 3VDGA 3G0SA 3P62A 3N19B 1LQ2A 2GGJA 3LBCA 3SN1A 1MO0A 1IEQA 3UQNA 4MB1A 1QVBA 2VFFA 3W7OA 3T0TA 2CBJA 3GRIA 3CK5A 3WQOA 4K7VA 4QHRA 2HNHA 2HS8A 3QC3A 4GUJA 1Q6GA 4UNKA 3CQIA 4ZQNA 2OZ0A 3FA4A 1AA1B 5FJOA 1U2YA 1XD0A 3ITLA 3VMNA 1N55A 4O17A 5GNXA 4AIBA 1WKFA 1DTNA 2Z1BA 2CLMA 1SW3A 3MP4A 1XYZA 2WZTA 3FYOA 4ZMGA 5BCAA 1P6CA 1MW0A 3W84A 2NXHA 3HMJG 3GHTA 3O2LA 3EYPA 4EVZA 3PTKA 4XIMA 3T07A 5AHMA 4H8UA 4GQRA 2O92A 3Q37A 1FTXA 1YNQA 3AYRA 1V3HA 1UQYA 2VGGA 2QUVA 5AYIA 3WKZA 1IZCA 3WUGA 2QR6A 4H7CA 3VUPA 2OYKA 7XIMA 3QN3A 1PPIA 3U7VA 3GG8A 3F4VA 4PUNA 3BTNA 3MMTA 1LG2A 4MADA 1TWSA 4GNKB 1SO6A 3H7VA 4EIVA 4JYFA 2BY1A 1EBGA 3AHYA 3IJ6A 3F2CA 5HPOA 3OOQA 3W83A 2DP3A 4G7EB 1V0NA 3MPGA 4NAEA 1FWEC 4DN1A 2DZSA 4CNTA 4RX0A 2G0WA 3IVUA 2HZGA 4Z1CA 4EXBA 2V82A 1S2VA 4LY4A 3WF0A 3G1XA 1R3SA 4IQJA 2AAAA 3AIWA 5A6JA 4QRNA 2CITA 3L23A 4JIRA 4LSBA 1QHOA 4WJEA 5FESA 1WDQA 4S1FA 4HJFA 4XAFA 3UETA 1TJ1A 1WUFA 2YBVA 2FMNA 3W2KA 3PBMA 4LB3A 3KRSA 3I10A 4Q4MA 4FNRA 1MRQA 1WDWA 3ME3A 2NLIA 4XD5A 1RJQA 3S5SA 3EWUA 3L67A 2E77A 3ARPA 1OWQA 3IRDA 5D8ZA 1EQPA 4UQ9A 1JDCA 1EA0A 1UPPA 1VIWA 4DZAA 1DJHA 1EF3A 3TN5A 1YXYA 3NSXA 1FCBA 2DORA 3H12A 5AYBA 2BHUA 5G1MA 1XWYA 5EMYA 1UMYA 2QDEA 1BVNP 2Y6ZA 3B06A 1SFTA 3MB9A 4O18A 2PWDA 2GQ8A 4S38A 4Y2WA 3C2RA 3YPIA 2VNCA 2GVGA 4P8VA 5DCEA 1LWIA 3GTXA 5AKQA 1UROA 1BTMA 3PZNA 3CT2A 2QQ6A 1MYRA 2FHFA 1YHTA 1V7AA 3RX4A 2ZXDA 1B0IA 5LYRA 5FAJA 1E15A 3BWWA 4HYVA 2FZ8A 4LVGA 3W2LA 3LS9A 1XR2A 3U2OA 1B30A 1VPXA 4H6QA 1SR9A 2QNEA 1W31A 4C7FA 2GGEA 3VPLA 4JAWA 2X40A 3M43A 4IJRA 5C0QA 2F8QA 4MWAC 3MO4A 3VD3A 2DY3A 4WD0A 4HTBA 1KXHA 4PMXA 4KESA 3QQ1A 1LORA 4BF7A 5ENLA 3PUOA 4L4OA 2G3NA 4DBSA 4H7ZA 4TMCA 1H5YA 3B3DA 1CB7B 1GOQA 4TQTA 3ZYZA 1TVNA 1XRVA 1J0IA 1VEMA 5U7SA 5DCDA 3NZQA 3LDVA 3T40A 1BWKA 1IYXA 3S5OA 2EBNA 3M7SA 4M5PA 1XRFA 1MNSA 3RG6A 1YIXA 5F4SA 4LV9A 1EJXC 1YEYA 3U0HA 3BMXA 3CIWA 3S3GA 4JEJA 3QM3A 4KCTA 2J77A 4PTWA 3W1TA 4IICA 4QXIA 5IBXA 6XIAA 1EGVA 4AXNA 1PZ1A 6TAAA 4PUJA 3N2BA 3IJQA 1W5PA 1JXJA 2OWCA 4HTYA 4NJJA 3T9PA 3ZJKA 2WSKA 4U3CA 1G0CA 1UR9A 2RDUA 1A53A 1H5VA 4JD4A 4NHVA 2W66A 3WLQA 1IEIA 3KBNA 1RAKA 3CYVA 2O56A 1TFVA 1V3LA 1K8ZA 2PDIA 2EO7A 5EBAA 4QAIA 3H26A 3KWXA 3AYSA 1VFFA 2YW4A 1KFLA 4LANA 2R8WA 5BMXA 3LHTA 3O7UA 2UY2A 3P80A 4AMAA 3APTA 4J1OA 2F7FA 5CAHA 2Y5SA 4HKPA 1TUFA 1JCNA 3UBPC 2VI0A 4U10A 4H9YA 3DEQA 1S2WA 4JKKA 3W2JA 3UNDA 3LSBA 3PHAA 2G96A 4D6CA 3QFEA 5M5DA 1ONRA 1IEXA 2PAJA 2DQXA 2RDWA 5I6SA 1I2QA 3ITOA 4D8LA 3NOYA 4DEFA 3L9CA 5BXPA 1CXKA 4GX9A 3MZ2A 2PZ0A 1JZ8A 3G1AA 3WX7A 3IV8A 4OV9A 4GXPA 2BV9A 1P4CA 4NY2A 1GEQA 1W3LA 4K7YA 4F66A 1UD5A 1ZL1A 3FFSA 3SUSA 3L7RA 4C1KA 3M0LA 1UUQA 5LNUA 3T8LA 3MBFA 3DGBA 1W3NA 4PSRA 1V08A 1KRCC 5CPMA 1CYGA 1HNYA 4M1RA 3W7QA 1XLEA 3H55A 5T9BG 2I14A 3WNKA 1E56A 3PB2A 4FXJA 3G8RA 5AB3A 1JDEA 2PURA 2IPGA 4H04A 4NNAA 4DUWA 4YTRA 1V0KA 3TE9A 3TK7A 4B4FA 1GOOA 1W56A 5AHLA 3BJTA 1UJPA 1RP8A 5I3IA 5G2IA 1ADSA 3HM7A 1DWAM 3CEPA 2BGNE 3AHXA 3G1SA 4RJEA 1PEZA 3B0PA 1KGXA 4R85A 1DXFA 4KMQA 2PU0A 2VURA 4M81A 1QPQA 4CD7A 1RLCL 2G8ZA 1AW2A 3LCIA 3NZPA 3DFNA 1OGBA 5MKGB 2RH9A 5FEZA 2R1MA 2QJJA 3TH6A 1LWHA 1V7YA 1MXSA 3NNTA 1KBLA 1GK8A 4F0HA 3BO9A 1E5NA 3UJEA 1TX2A 3WLTA 3MZNA 4C5YA 2P5NA 3TKFA 1A3HA 4GNVA 3CYJA 1JAEA 3PJTA 4CCEA 4H41A 1QOQA 4IOTA 2EJ1A 1OADA 2HRWA 3SRHA 4IXHA 3K1GA 3W37A 2E1DA 3L4TA 4O14A 5DRIA 3WLPA 1ICQA 3I7QA 4BQ2A 5ABEA 3KX6A 3DHUA 4E2VA 4EXAA 4QROA 3VKJA 4WKFA 2BFGA 3K30A 3C5QA 4I9JA 4HMEA 3GG0A 2JBMA 2Z1SA 1BRLA 3FEQA 1JZ2A 6REQA 3S2JA 2VD8A 1KFKA 4PTXA 2WVTA 1M6JA 1ZGDA 4HK6A 3TC7A 4ROPA 3WQEA 3TC6A 2PDXA 3OVGA 3VX1A 4URIA 3TOPA 4Z08A 3LCGA 1TWWA 1PWLA 3EOUA 3WK0A 2OEKA 4IQEA 3UEQA 1RH9A 3KFTA 3QY6A 2ATSA 4PUDA 4JQ4A 4W84A 1FKXA 2QCEA 4XAPA 3HGJA 3U8GA 5LA1A 5DQPA 4XZNX 3ZQ9A 4JHZA 5BXRA 2DT0A 1OYCA 1SR0A 2J7BA 1UKTA 4NZCA 2RJGA 1ZQ5A 1CIUA 3ARZA 3QV8A 2FTPA 2P88A 3VOJA 1DIOA 3O0KA 4LV4A 3DG7A 3S2LA 2OODA 4AY1A 4GRSA 1WOAA 1UH2A 4LUSB 4PB5A 4PEKA 1NFPA 5ABFA 3W7DA 3ECQA 4U2YA 3C61A 3W1RA 3P82A 1H60A 3WNOA 4BI7A 4TV6A 2E68A 5F7UA 1VBUA 1VHCA 4XQ6A 2V5BA 1SZGA 3OYXA 1UOZA 2NV1A 3RM4A 1UR4A 4ZSTA 4W87A 4YHGA 2H90A 1W37A 2QJGA 1B3VA 5CSSA 1C92A 1T6MA 2W63A 5C2GA 4IT1A 4PBFA 2NUXA 4CQCA 4Q8TA 1JDDA 4S3BA 3OQEA 4B5NA 2X05A 1LZOA 2FDSA 3MI6A 3TR9A 2QF7A 3WLSA 4M56A 5CZTA 3WK2A 2WVSA 4H9UA 2WMHA 3CTLA 1OEPA 3SURA 2ESCA 2W3ZA 2H9AA 4PULA 4RDVA 1SO5A 4KWSA 3S6TA 1FVPA 4UQAA 2FKPA 4MDOA 1DQXA 4H7VA 3BSMA 3PSWA 1VBHA 4MB5A 1WKEA 1DPMA 3CASA 3KCOA 3V7PA 3W7NA 3WL1A 3GD6A 3LQLA 3NGJA 3PTDA 4UXDA 3AHVA 3E96A 4R7JA 4CQBA 1SPQA 4AZGA 2MUCA 4AH7A 2Q6ZA 4HB7A 1RCXB 3EA1A 2YDAA 4DJFA 2XZ9A 4CU6A 4FOKA 1ZU8A 4N9CA 3OLGA 5CGQA 3GIPA 2IUZA 3AYVA 1RPKA 4FX8A 1PDYA 3TCSA 2HE5A 3D3FA 4GYFA 1QBAA 4AW7A 5CJNA 1NFBA 2G4FA 3SFKA 3H54A 3G77A 4IPIA 1QO5A 4RZBA 4BY3A 1KXTA 3S0CA 2Q3OA 4Q4RA 1BYDA 3NQ6A 3B4YA 5F2IA 2DVUA 3NIYA 3AUJA 3M41A 5A3HA 5E6YA 3KL5A 4IFKA 2NXIA 4KCVA 4NYYA 5FACA 3SY8A 1RLDA 4O12A 4NT0A 3P6LA 3A4JA 4B5UA 2VYOA 4Z2LA 3NXFA 3P8JA 4ZQPA 2ZX8A 3N2OA 3STCA 1WCGA 1BGAA 1W1ZA 1OFAA 2CZDA 3ITXA 1H7OA 4WXYA 2Y62A 4WGXA 1QDSA 5L6UA 5DO8A 4PRWA 4J27A 7REQB 1JPHA 3B97A 1N82A 4OGZA 1KM3A 1BQCA 2ABBA 1H51A 1KV8A 4C6PA 2ZUMA 3QR3A 2QMKA 3M0JA 3Q65A 5I5RA 4EAMA 1J6OA 2J9XA 4DB7A 4GJIA 4RV8A 3B8WA 1AQMA 3AO0A 2XSBA 1IF2A 3BG5A 3VA8A 3QF0A 3LPGA 1R0MA 3QGVA 4A6GA 2OO6A 1A5OC 2V3EA 3WELA 3AXMA 4JDYA 4H9MA 1LBLA 2A79A 3ZO9A 4E0CA 3LY0A 4LVDA 4I5UA 2XIBA 3LI1A 1HUVA 3VOFA 3HIJA 3QPZA 4A3YA 4UCFA 1H41A 3LMYA 4HSOA 4O19A 1N8IA 4GI4A 1KFCA 4NAFB 4B5XA 1IEWA 3C2OA 1CXFA 1U1JA 3WQ8A 3VILA 5E0FA 3AJXA 2OCZA 2ON3A 2NQHA 2PZNA 5IHSA 3QLLA 4XD3A 2CBIA 2A6LA 4GCXA 1F07A 4X2PA 1TRDA 1M3UA 4NX5A 1QASA 3LA4A 1N8WA 2QCHA 4CQAA 4TX8A 4WY0A 3THUA 3UGRA 4EP8C 2WW5A 1E70M 2Z1WA 1X6UA 3CXOA 4P5UA 4QM1A 4DXKA 1F8IA 4HA1A 2XDFA 3NJ3A 4HA3A 3GXPA 3LRMA 1WYIA 2TPSA 3SQMA 4V1YA 1J4EA 3UZ5A 2XFWA 1CDGA 3TWAA 1KRBC 3CHCA 5LXEA 2Y7GA 1XYFA 3B8IA 1O12A 5JBEA 3HU7A 3W4RA 5HPCA 5TNVA 2NZLA 3BLDA 3ZLHA 1PV8A 1XD1A 2OSWA 5IFPA 3KUMA 4FPSA 3PZVA 4NI8A 3FLUA 1ME8A 1I2PA 1MVYA 3UJFA 1PYMA 1WOBA 1JUKA 4ZO7A 2QAFA 4S2BA 1M65A 4H6RA 2EF9A 1J8VA 1XYCA 1CCWB 1FH9A 3PZTA 4GUGA 3IJ8A 3QHOA 1TMLA 4N9DA 1YNYA 1WKYA 3GDKA 4S3DA 4W8AA 3ZFHA 3NL5A 1OZQA 2V2DA 3OZYA 1AL8A 4LRTA 3M9YA 5CPLA 3QJAA 4AU0A 2XIMA 4XO7A 4Z1YA 2CWXA 2ZXBA 5HXMA 4L4PA 3R79A 4CN6A 2ZTKA 3IGHX 3GTHA 4UTFA 5BW6A 2GGIA 4P7LA 4I7VA 4UZSA 4XTIA 5T9CE 3ZSSA 3MHUA 3VKBA 5C2CA 4NXKA 1UWQA 4PC8A 1PIFA 4X22A 3KAOA 3UVIA 1SO4A 2ZVRA 1QR7A 1YE4A 4IGMA 3C2VA 3L4VA 1LUCA 2BGQA 3VNJA 4XZIA 3RO6A 1EXPA 3TUUA 4RZ6A 2VCCA 2YFNA 2XVKA 3U57A 2P8BA 4NVTA 4AD5A 2Y5EA 2GDQA 3WQ5A 1LRNA 3NWRA 2Z00A 1OINA 2CU0A 1GVFA 4AISA 3ID7A 4FLOA 1E0WA 2Z27A 3AU2A 2WC3A 3OJGA 1TX0A 3POHA 1ZSXA 2OJPA 2ACSA 3ZWTA 2WWCA 2WBKA 1JUEA 1LDCA 3RIKA 4MWAE 3EX3A 1SZFA 3VAVA 2XN0A 2QCNA 5KETA 5J8LA 2AAMA 1NELA 2FGLA 1XLBA 2PDUA 3CO8A 1FCUA 3AALA 1Q6CA 1XDMA 2DPEA 4GY1A 1X1ZA 1OQFA 4MB3A 5EKYA 2FTYA 5LA2A 1B90A 2QCDA 1L6SA 1KKRA 4I9MA 1B31A 3RX3A 4EOUA 5DLCA 1NIUA 3U4AA 5C9WA 5CSRA 2Z25A 3MVIA 4B9ZA 1FWIC 3IGUA 4GBDA 3T08A 1K6AA 3LBMA 1GJWA 2WB5A 4XAYA 3BLIA 1HKJA 1GKQA 2HISA 4DJEA 3NURA 3BLOA 3B0XA 1X98A 3FHQA 1UWAA 3FJ4A 5FF2A 1OT2A 1JULA 1MZHA 4HCDA 2ZRWA 2H8ZA 4L5ZA 1EQCA 1UMLA 2C0AA 2XUCA 4QE1A 1LRTA 2V68A 3DHPA 1UKOA 1RK6A 4RUBA 1LQAA 1DJIA 2CHNA 2PB1A 2CPUA 3M5ZA 3EMCA 4WXZA 4A35A 3M5XA 5CJ5A 4LVAA 1KRMA 1M9HA 3Q2DA 4JIEA 5HJLA 3BMVA 3SIMA 4NQ1A 3KEHA 1AZ1A 1L6WA 4Q8WA 4QQ3A 3E5BA 4NAEB 1LJYA 2DH2A 2X1UA 2IQ0A 1HIZA 4WEVX 1L9WA 2ZUUA 4LH8A 2YLLA 1GOWA 3E38A 5D2WA 4FP1A 1ZJAA 5HR7A 5A2CA 1TV8A 1TWZA 1TR9A 3AS2A 1D9EA 5HJXA 4JTHA 2DSUA 2E6AA 4IL2A 1JCJA 1YPFA 4JQ1A 1GTHA 2JGQA 3R0UA 3RLUA 3CQJA 3P5YA 5DT7A 5C54A 1OG6A 4CU7A 5AVNA 1E9IA 2C14A 3U48A 4AWUA 1NP0A 1KB3A 2WNWA 2H3DA 4AZ7A 1AH3A 3H7UA 1VFTA 3S4TA 1EJVC 4DAFA 4K2SA 4F2BA 3IJLA 4CNSA 4A3QA 1E71M 2PLJA 1W2VA 4ATWA 5HMFA 2A4AA 5AZ0A 4EXQA 4QFUA 2O9RA 4PFMA 3HV9A 3EXTA 4P7QA 1UCWA 1Q6RA 3WH7A 2ZRVA 2WHLA 1HO1A 1XW8A 4ILSA 3QGKC 5A94A 4WJXA 1VQTA 3R94A 5EL1A 4CLMA 3R25A 3WJXA 3A5FA 4KS0A 5EGRA 4GQGA 4PMJA 1F3WA 3U5UA 3DFTA 3QMRA 3LXAA 1UPMB 5HQMA 1Z42A 3CQ0A 4RE0A 3ZR5A 4TOQA 3M0MA 4LXFA 1TPWA 3GXDA 3CAQA 1EEXA 2X1RA 3WD3A 3EAUA 2PI6A 4HNUA 3GKAA 3LCLA 4GYPC 5D38A 1THFD 3WBAA 2OGYA 1JI1A 3PZOA 3OZMA 3OIHA 4OBRA 2VFDA 3VDAA 1H49A 3NYZA 3SUVA 1Z44A 1SFJA 4UNIA 2ZZ1A 4CNNA 4LT9A 4WRHA 1V0MA 1QNVA 4B16A 1GOKA 4FOJA 3TSMA 2FJUB 4LFYA 5ABGA 3W25A 3H21A 4PTVA 5EFDA 1Y8BA 3QY7A 4GJJA 4G6CA 3R10A 3PZQA 1DWGM 2GQ3A 3GFXA 4KERA 3CB8A 1FWHC 1UBSA 4ORMA 4QTGA 4JTTA 4RCXA 4C7GA 1EP2A 1IXPA 4RL3A 3STFA 3SUTA 3TCEA 1HF6A 4GFSA 1HL9A 1A3WA 2BTMA 3ARTA 1H61A 4TVDA 1G9HA 3G6MA 2YA1A 2GOKA 2E6YA 5AHEA 1Q4WA 4GUHA 1NSJA 2PLCA 3C2EA 3KBJA 2R82A 4XKMA 4ZL1A 4IGNA 4GZIA 1Y7VA 5ABTA 1EA9C 2TODA 1NAL1 1F61A 2YCIX 4DLMA 1PJ9A 3EDFA 1H7XA 2GUUA 1NDVA 4WLCA 1TTPA 1AJ0A 2Q71A 3BLPX 2G97A 3CPRA 2PTWA 4Q4SA 4GZJA 4D72A 2ZUTA 1XFBA 1GTEA 5DELA 3ARSA 1RXOB 4RKAA 3CV6A 1ITXA 4RV3A 3W1AA 2FQIA 2ZE3A 2J8GA 1GZGA 3H8AA 2HEJA 4AHOA 4XSLA 2B4GA 1X39A 1Y65A 4RW5A 3ZSTA 2HXUA 4OZOA 1EJUC 2ZRUA 4S3AA 1QBBA 1ZNNA 4AZIA 4EWJA 4ERGA 4J9JA 5I24A 1W3TA 1I6NA 1QI0A 5IHRA 2AL1A 4H1ZA 2E5BA 4RXGA 3R6IA 4W88A 1YDNA 2CWNA 3EXRA 4C60A 5GJPA 2V9DA 3NZ1A 1JCXA 4H9ZA 1M01A 5EYWA 2A3BA 2BXYA 1TJPA 3CU2A 5DCBA 2ZFAA 2QGHA 3MS8A 4Y9MA 4HPGA 1IE7C 3N34A 4ACYA 5J5RA 2YB4A 4R3UA 4ZQRA 3IUDA 2CBVA 3O63A 3TAOA 4LPCA 3BPWA 1SGJA 1ZP4A 1MQQA 2IPFA 1E1EA 1SMDA 3FAWA 1C8XA 4NL1A 3OVRA 1EWEA 3LG3A 3THAA 3HJEA 4TV5A 4Q4QA 1OC5A 3FIGA 1BXNA 1M41A 2J24A 1A5UA 3NPXA 4QDMA 4WOZA 5DBUA 3WD1A 4HOZA 4IFOA 3WF3A 1KKOA 3MHGA 3O05A 1Q65A 3AXIA 3PAOA 5FSEC 1DXEA 4Q8UA 3EWWA 2XIIA 3TTEA 1J93A 4YCPA 4DX3A 4OQVA 2CZEA 1E6SM 2RUSA 3F4WA 5D2TA 4DVOA 2QCMA 1A50A 1TRIA 2W0UA 4WSJA 2AGTA 1UWRA 3A64A 1XLHA 3GH5A 4PUWA 4Q6XA 2HDJA 5DMYA 4CCDA 3NPVA 3W1XA 4CEXC 2DSWA 4ZFMA 3QFWA 1O5KA 1L8PA 4IMFA 1YBQA 3CHFA 1B3ZA 1WQ5A 3WBYA 4KFNA 1QPRA 3POCA 2E25A 5A2BA 3GO2A 3C52A 4KKXA 4PODA 1QO2A 5FF0A 1JZ7A 2ZWZA 4MNMA 3GXIA 3LTPA 4IIGA 3KOXA 4S3EA 4MJMA 4V2XA 2XM2A 2J8FA 1XBXA 2PU1A 3DN5A 3GZAA 3AI0A 1U5HA 3LSCA 3W86A 4B5SA 5AHNA 5D37A 2Y70A 2QW5A 3SDOA 3T0DA 1V03A 4FF5A 3OPSA 5D9PA 4WGHA 3VI2A 3PULA 2CEQA 2ISDA 2XFFA 1J0KA 2INZA 3E2QA 3TWBA 3TAKA 2J7EA 1ZHAA 3CZJA 2Z7GA 3PG8A 3FA3A 3S6OA 3MUZ1 2CERA 1BRLB 4O54A 4XWUA 6REQB 3WENA 3W07A 1X6LA 1V6TA 3S9IA 2QXWA 2I5GA 3EDKA 3BZGA 4EACA 1A5BA 5DMMA 1X96A 1QPOA 3BMWA 1VPQA 1E51A 1BXCA 3VNYA 4BWLC 4JHMA 5CBBA 5CH9A 1DIKA 3G6LA 3CUHA 4H9TA 5LNVA 3G1DA 1IGSA 2J62A 1O5QA 4P8WA 2NVCA 1PE1A 3NQMA 1VFSA 3NOEA 3B8TA 1VBJA 4QSFA 2P3EA 3N17A 4GX8A 3F4NA 2EPMX 2X0YA 3FEMA 3LB0A 4MY8A 2VP8A 3KCJA 4HGXA 3PTQA 4L1WA 5A8NA 2ZDSA 3CPGA 2V2HA 1XG4A 3KBWA 4YU1A 1HW6A 1T8QA 2FH6A 5ABFB 4QCEA 3ZM8A 1D2KA 2V5KA 2TSYA 2PWFA 1X8FA 2QMJA 3W9ZA 4NI3A 3LEPA 1X7FA 2RAGA 4A8RA 3BURA 4NU7A 2OX1A 2GVJA 2Z0IA 1FWWA 2PC4A 1Q85A 5A6AA 5KINA 5KTLA 3DFPA 1ISWA 3IJ7A 3MUXA 5CZKA 1H1YA 4HYRA 3JRKA 1W2PA 4KF1A 4AB4A 1E73M 3GR4A 4L6OA 3CAVA 1K7EA 2V63A 4U5KA 5HWMA 4NZ4A 1JEZA 3VIKA 2W62A 2HCVA 2D3NA 3VIGA 2ONEA 4JOMA 3ENLA 4MDPA 2AQVA 2W9MA 2J6VA 4M6PA 4Z2KA 4MZ1A 4ADUA 1O6IA 3BAWA 4HBKA 1W0MA 2H9AB 3U3HA 3V1PA 2XU2A 2YLAA 2A3LA 1ZBCA 4DWDA 3MDWA 3GKFA 4KCUA 4MHBA 1TV2A 1XCFA 3TXZA 2ZA3A 3ABOA 3G0XA 1A0CA 3FJ6A 3LN3A 4AVNA 4GINA 5DANA 2YL6A 3JU2A 4J3XA 1FA2A 2QCGA 3NVTA 1DBTA 3ANYA 3TYUA 3EPOA 2EQDA 1PX4A 2Y63A 4FLRA 1VFMA 2OMAA 2P1FA 3WQPA 5G4WA 3N29A 4WDWA 4UZUA 2O9TA 3W82A 3A6OA 3A21A 2DZTA 2PDFA 4JIHA 5G2WA 4O11A 3W24A 3W75A 4HNTA 2R6OA 2GZXA 4FNPA 2F84A 4OUIA 3SCSA 4DPQA 2E8YA 2B7PA 3I6TA 1LBFA 8A3HA 5LGXA 3WQ4A 2H3BA 5C55A 3F5LA 1XH1A 4CEUC 3S9ZA 1OFBA 3RGTA 3TYCA 4IFKB 1Z9AA 3WNPA 3QHNA 5I00A 5AC7A 4PB3A 3NO5A 4ZE5A 1R38A 5EMLA 3R4IA 5HINA 3URQA 9RUBA 3G3DA 3TROA 5G2HA 4UR7A 1EFZA 4QSHA 5LIWX 1S5TA 1V02E 3O06A 8TIMA 4UB9A 3UWWA 3VM7A 3DFQA 1CLVA 2FZDA 2ISSA 4HNLA 3H2EA 3LGDA 3MU7A 3F4CA 1UH3A 2VX6A 3VOCA 3GDRA 4AG0A 2JEPA 2JF7A 4WDTA 1TJ2A 3QYSA 1QK0A 3P93A 1H3GA 4DRSA 1CGUA 1VLWA 3VOGA 5I77A 3WLHA 3T4WA 3KWSA 1DWIM 2ZIDA 4N4PA 3NCOA 4LCRA 3CWNA 4LS1A 1M03A 3KBVA 2Q8LA 2VUNA 1Q45A 2DJXA 2E6FA 4ZB5A 1EP3A 3SCPA 1JRCA 3IWPA 2C6QA 2W91A 1V8EA 4IQLA 3W28A 1ZCCA 4LAOA 2OKTA 3H2CA 4H2CA 1CXIA 3RNDA 3W1NA 3BE7A 3KLLA 3AU6A 1M7OA 2D0FA 4DY1A 1KCKA 3IVSA 3T44A 2VTFA 2QJMA 3HG3A 4QLJA 4IIHA 2I16A 2I1OA 5FJTA 3SQLA 1LOSA 5JU6A 3KVMA 3PC0A 4AQLA 3UA4A 1A3XA 3OGRA 1I4NA 2Z28A 2XN2A 1EEPA 1AVAA 3ZZ1A 1ITCA 3SADA 6XIMA 1P1MA 3L12A 1U5VA 3GVRA 1R30A 3W1QA 4RZ5A 3PJXA 3H23A 4OUEA 4N0RA 4P8UA 3SB0A 1E72M 4GKTA 3G0UA 4ZQCA 1LP6A 1SO3A 5LA0A 3MW7A 1WXYA 4DAIA 3TJXA 2EXOA 2FZMA 1RP9A 4WY0B 1R46A 2XG9A 4GMEA 4HNOA 5CGTA 4CGTA 3KRUA 1W3JA 1VJSA 3EKGA 1UA7A 2VOMA 1LM1A 4PMQA 5E1QA 3V5OA 3MSRA 5A1AA 1H11A 1DWJM 3IIZA 3ZLGA 4GY0A 2ZTJA 2WC7A 1CBGA 1Q7ZA 2NV2A 2XVLA 5FI8A 5FJRA 3EBVA 3D3AA 2DUAA 2KAUC 5GQBA 3P2VA 3VGDA 2X1IA 1Z3NA 5IDIA 1SJDA 3Q58A 3VNDA 4OECA 4G9PA 1FBAA 3H2OA 2WC4A 3RILA 4F0LA 2A7RA 5DXYA 1UC5A 1P0NA 4YYCA 2DQWA 3UD6A 2IKHA 3MV01 5CCZA 4J3SA 5I09A 5DRCA 3OA3A 3NO3A 3UVAA 4LVFA 1JPMA 1RK5A 5HMEA 3R8RA 3RAOA 1HVQA 3PPCA 4AVFA 2I7GA 2ZUWA 4B3ZA 1SMAA 3ONCA 4W85A 2B7QA 3Q67A 8XIAA 4YLWA 4IMAA 1UKPA 3UT0A 5C8BB 4DXVA 3KTXA 3VD9A 1L8NA 4EX4A 1S2CA 1H7PA 3EOEA 5D05A 3N4EA 3TA6A 3WF4A 1EYEA 1E3XA 2F2KA 3MUIA 3N18A 3MSDA 1W1PA 3N2TA 3HN3A 4OKDA 2DSZA 1E4MM 2PDLA 2Y1HA 3DAQA 3W7PA 1G4TA 5DBTA 1IWAA 3K8MA 3B9EA 3ALFA 4R9XA 3OGSA 3AHTA 1HJVA 4BS0A 1IWBA 1PKLA 4GWEA 5GPRA 3HQ1A 1ZBKA 4O53A 3ABXA 1XLDA 1FHUA 3AC0A 4W86A 3K4AA 2Z4GA 3BZJA 1MUMA 2QHAA 2CYGA 3E5PA 4I7UA 3DERA 3TYZA 3VFLA 2A85A 4J3ZA 3EWDA 2BVYA 3DOPA 1XC4A 4YCOA 1JL8A 2OVLA 5DX7A 4QE5A 3N9SA 3M0VA 2QZRA 3CZ8A 3S1UA 3A23A 3WJYA 2HBXA 2BVWA 4WR3A 5D9OA 3QKZA 4CUCA 1C8VA 2ASHA 4B3LA 3IAPA 3VNLA 4LF1A 1UP3A 2DW7A 1UB3A 3QZ6A 4GUFA 5I0DA 3HMCA 3UU0A 5H6HA 5M2FX 3HG5A 1TPEA 4MKSA 2DT1A 3E3HA 3V1HA 3LU2A 5IXEA 3S2MA 5AECA 1KCZA 1TZ7A 1EB3A 1XYBA 1FH7A 2QCDB 4FSAA 1JNDA 4J35A 2PODA 4US6A 1A4MA 1CXHA 4GUIA 2VX5A 3GM8A 4E2OA 1RBLA 1FHVA 1JQVA 4GOAA 3D5HA 1JIBA 2OYLA 1IWPA 2D24A 3GDBA 1DTUA 1XQLA 3ZJ6A 2VEMA 1I2RA 4WDUA 3IGXA 4E8GA 1W54A 1YNPA 2V3GA 3HOJA 1OIMA 4ERAA 3PJUA 1B2YA 4AD4A 2ZX9A 1I60A 3UCQA 1WNOA 4TU1A 1IQ8A 1UR3M 3MT1A 1L6GA 1REQB 2FFCA 1F8MA 1WX0A 4ASTA 3QVQA 2ZX7A 1NOUA 3DFHA 1VYRA 3UG3A 4OTKA 1XLJA 1DJGA 1EHNA 1EJ7L 5CQ1A 4P7RA 4M7SA 4CVUA 3VNKA 3BVJA 3VD5A 4QISA 4MKVA 1KCXA 1W5MA 3FS2A 3WQ6A 3WLIA 2WHKA 2FB2A 4MUZA 5HAOA 5LIYX 4JPGA 3IS4A 5C9XA 3CZGA 1OT1A 4IP7A 1WAUA 4GI6A 4F2TA 1HJQA 3FVDA 3HA1A 1QRQA 3W6MA 3HQNA 3M6YA 4HSNA 3BARA 3ALGA 2X2YA 3TV8A 1RY8A 4DJDD 1ZRQA 1K02A 4W89A 1OCQA 1UZHA 3VZXA 3OLIA 5ECUA 3V16A 4YTQA 4DWSC 3A24A 4C65A 3UESA 1MQRA 1PZ0A 3N4AA 4GQBA 1NQKA 4B2DA 4XZLX 3W23A 4W93A 4RNJA 4AIEA 2A0NA 5C7VA 2VRKA 1FWGC 2ZXQA 1LOLA 2I57A 3CGTA 5LNSA 3NL6A 3PF3A 1J01A 2YXGA 3B0VC 4U4MA 1NWTA 4ZE4A 1ADDA 1DOSA 4F8XA 4H6EA 1C29A 1JD9A 4UFIA 1U5JA 1BPLB 2X1SA 3E0LA 6A3HA 4MFDA 3OEXA 3S6DA 1WBHA 5H1WA 4X9YA 1CB2A 4HZ6A 1S2AA 3KHJA 4B90A 5BNKA 4L61A 4P8XA 4IX0A 2AOSA 2Y89A 2W27A 2PS2A 3E2SA 1PCWA 1OFDA 2TRSA 5RUBA 1FHLA 1A80A 1UHVA 1EO7A 1GNXA 4B92A 2WZMA 4L6HA 1XQKA 5JXQA 4C6CA 2R94A 1CXEA 2VD9A 3R43A 4ZGYA 1GJUA 4EPBC 3OBAA 4J2PA 3VMPA 4DUVA 5IDZA 1XINA 4UNLA 1MDRA 1CGYA 2BVDA 2C8NA 2QEZA 4L65A 4DXXA 1TMHA 1KC7A 3N3TA 4V28A 2ZA2A 4O57A 4Y7EA 4UQEA 4PBEA 5E0KA 1K8YA 4F2UA 3UW6A 5K4XA 2Z26A 2EHHA 2GYIA 1MXDA 4R7OA 3Q45A 3K1DA 3GNOA 2FVKA 3IUHA 3BSGA 2OQLA 4EPDC 3B04A 4HN8A 2W61A 4N9BA 3UCCA 1BXBA 2XFYA 1QAPA 1KBJA 5HUOA 3GR7A 2DZPA 2P53A 3GAYA 1ISVA 3GH4A 4BK9A 1GYMA 5C70A 3LCFA 1HKWA 4E4FA 3CTTA 4KRZA 2QUMA 1ICSA 3UZYA 1QCWA 4IQDA 2HSAA 5D30A 2TMDA 3QY8A 1UOKA 1ICPA 1B3WA 2RHGA 5I3KA 1X38A 3CLMA 2OT0A 3LD5A 1MEWA 5BZAA 5A8QA 4KFOA 2NQ5A 5K9XA 1D7KA 1AH0A 4W7VA 5XIAA 2ZX6A 3L2LA 3LRLA 2DZAA 1NOWA 4H01A 4PUEA 4JZ5A 4GY7A 3NM1A 3M64A 2NT1A 9XIAA 3ITCA 5BXSA 1FWNA 5AHFA 1J18A 4O4WA 2PGWA 3LK6A 2WVVA 3D0CA 3V18A 2J4GA 2ZZ2A 1E9YB 3N13A 2R1KA 4L1XA 4C91A 5CC6A 2I9EA 3FN9A 1BYCA 4TTGA 3APGA 1GYNA 1R8LA 3FW6A 4HYWA 5HUPA 2Y88A 1XS2A 4RE2A 3KBMA 4C6QA 1VHNA 3GFZA 3LTSA 4LUYA 2FB3A 1WDDA 1VR6A 1TQXA 4DYJA 1I45A 4W8BA 1PSCA 2V30A 4US5A 1UZ4A 2CC0A 3C3UA 3CIXA 2C3ZA 2XVNA 1E1FA 4GA8A 4OOUA 4XD6A 3VCRA 1QOXA 4XB3A 4NZ5A 5E93A 4L7ZA 3DFYA 5AY7A 3L0GA 5HMDA 3GXMA 1RQEA 1JGMA 5LIKX 3ZXWA 2BXVA 1VBRA 4N4QA 2INFA 4YJ5A 3P7YA 3PPFA 2ZOXA 3PUDA 4H3DA 5CAKA 2Y7FA 2NQ9A 2BGSA 3UXDA 1XYMA 2Y8VA 4HVXA 3BLKA 4OJYA 4MAZA 2J7HA 3FOKA 1FH8A 2XVGA 1XUZA 2E7FA 2V5DA 2Y7DA 1FUYA 1CGXA 4HNVA 5EMJA 3DYPA 1QNOA 1TIMA 3G1VA 2PDCA 2C1HA 4OFCA 3UR8A 3KCLA 1A5MC 1F3XA 4U2ZA 3PM6A 1D3CA 4P7NA 4MLJA 2ABAA 3TYEA 3CMGA 1YDYA 5C6MA 4Y8EA 3STEA 3ZVHA 4L9ZA 1CX9A 2NX3A 3WN6A 1IZJA 3APYA 1E55A 4KEVA 3BW2A 2TAAA 4KT2A 4DO5A 1R85A 5HNNA 1XGDA 3AIVA 4FLSA 1A5KC 1GVSA 2OG9A 2GFTA 3V4BA 1O7AA 3I3BA 4X0NA 1ZUAX 4W5UA 1HJXA 4PTMA 5EB8A 2AMXA 4H19A 3CS2A 4C1LA 1TVPA 4EF8A 2VVNA 2VFGA 2PD5A 4QG8A 1OD8A 4JTLA 1HJUA 4JN7A 3ABQA 4MG4A 3UZWA 1LF1A 1FWSA 2OOGA 4MWAD 2EPOA 3WL0A 3M0XA 4FNUA 3C6CA 3S1VA 4R9OA 4GBUA 4DZ5A 1VFUA 2A5HA 1AQ0A 3W1PA 3W29A 4GVHA 1NF0A 3TQKA 2XIOA 2E0PA 2VZSA 3Q94A 1M68A 4QJ1A 3GC2A 3LNMA 1XBZA 4G1KA 1HKMA 1U83A 4Q4PA 3EKZA 3V0UA 1W8GA 2CLLA 3NAVA 4D8ZA 2GJXA 4DUXA 2VZVA 5HANA 3GNXA 2E4TA 3VGEA 3WFAA 3C8NA 3W2NA 1S1RA 1OGSA 1IXNA 1CLKA 5HMSA 1UA3A 2D3LA 4FK9A 1G94A 4AEEA 1F05A 1UWSA 3UF9A 3TVAA 4IZGA 2QDHA 3W7CA 4BEUA 4K39A 4JFUA 3NZGA 1K4HA 4X3ZA 3UCDA 1AQHA 3LLFA 3TN3A 4UQBA 3UGVA 1P0KA 1RA5A 3EDEA 3WMSA 4EKJA 3WJSA 1VD6A 1ZAJA 3R8GA 3VFCA 3DESA 5A6BD 1JI2A 3VIJA 4N2YA 3GHSA 3IRSA 5E5CA 4FB7A 3BLEA 2NWRA 3F1QA 4E8DA 2XPKA 2Y7EA 5C9ZA 3WMCA 5EBUA 2X8RA 4Y9AA 1RQBA 3EOOA 3KL3A 4AX6A 2CLEA 4QR6A 2BS9A 2QJNA 3AIEA 4CKQA 1EYWA 1LL4A 3KDOA 2VMFA 1CGTA 3CL6A 2CKRA 2E8ZA 2W92A 5KZEA 3TLQA 1MW3A 3TMLA 1U1HA 3WQCA 2WMJA 3MMDA 4ZO8A 4YTTA 1BGGA 2AL2A 3NTYA 2ZZ3A 3DFOA 1GWJA 4WSHA 2PWUA 2PP0A 4JY8A 1IR1A 3KRZA 3LXCA 2J6XA 4DNHA 2DSKA 2XSAA 4JQAA 4C6MA 1NWSA 3B8DA 3LXBA 1BYBA 1VCVA 1EGMA 4HZMA 2FZ9A 4M3PA 4UTHA 1E9ZB 1E9LA 3AMGA 4PSPA 1UD3A 2EAWA 1IEVA 3BAKA 4JFTA 3VX0A 1JCYA 1CNVA 3WNLA 5FKYA 3PPGA 4DJFD 4MNJA 3EMQA 3GU2A 3EWZA 4XISA 1F9CA 3WG6A 3UG8A 2RKXA 4GO9A 4TO8A 3C86A 3REQA 3WLLA 5H91A 5CG0A 4B9YA 2WWDA 3TR2A 1ISYA 4FA3A 4TR9A 1F4HA 4AFYA 1NDYA 4JY9A 1US2A 1C91A 5I2UA 2BWGA 4WF7A 1S1PA 4G7EA 1W3KA 1OFOA 1TPFA 4R5EA 1FWTA 4MJ2A 4DF1A 3GLCA 1FOBA 1RUSA 1J9YA 4GIEA 3EX1A 3H4GA 3CUIA 2GL5A 2PE4A 4HMNA 1Q13A 3L5LA 1A5SA 3TW7A 1CXLA 1R3RA 3AJ7A 1US3A 3DBNA 3W7RA 3SJNA 1LROA 1XKJA 3FAXA 1K3UA 5KSWA 5K9DA 4ROQA 4A3HA 4DJDA 1JPDX 1HP5A 5DXXA 4M24A 3BAYA 3SRFA 3NR0A 3OVQA 4XG1A 4XSMA 4IGSA 2PDBA 1WB0A 3WCZA 3GVWA 3ABSA 3W3OA 4X63A 1B1YA 4FALA 5A6TC 4HU0A 3A9IA 3GTNA 4AD0A 4LUTA 1RBAA 1GPFA 3CZKA 3PZIA 3N12A 4KEMA 3D47A 1B57A 1BEUA 3H70A 4JBRA 1SZEA 2A21A 3VDCA 2X7VA 3OLEA 2ZZ5A 2YBUA 4M7TA 4MVAA 1S46A 5M1TA 3WF1A 5TD4A 3ARXA 3ARQA 1O5XA 4H2HA 1UC4A 1AQFA 3CH9A 1XIDA 1SYTA 1J79A 3XINA 1X8CA 1YPIA 1I2OA 2VGIA 3K4DA 4UR8A 2P76A 5T8GA 4GYKA 1EO5A 2VR2A 5H8PA 3BSHA 4GZEA 4Q8PA 3L66A 1ECQA 4FR6A 3BLLA 4IX2A 1K9DA 3E12A 4RNHA 6ALDA 3WH6A 4WSKA 4N02A 1ECEA 1N2VA 5F4XA 4IIFA 4GD0A 4W7WA 2KX9A 1WDPA 2FHBA 1P7TA 3WZ0E 1YADA 2WMFA 3DDMA 4XBSA 3IK2A 2P8CA 2VR5A 4JQ3A 3OODA 5LIXX 2ZCGA 1S38A 5T26A 3PNUA 1V3MA 3J7HA 2DFAA 4JTUA 1HP4A 3RK8A 4GXWA 2X30A 3GSMA 2GSEA 4FMVA 1EIXA 1NH6A 3SCTA 2PGEA 1EIBA 4H9XA 1HN1A 2QYGA 3E0FA 4AF0A 3TSBA 4BI5A 4JICA 4AYSA 4N6FA 2PWHA 3B9AA 5FCZA 2PA6A 2WVUA 3BJSA 3VD7A 2J9ZA 2VENA 3RU6A 3Q4DA 1W91A 2XH2A 3UY8A 3VZYA 3JZUA 3IJ9A 3MMUA 3ES8A 2WZHA 1F7BA 5CPTA 2WHMA 1UWUA 1VEOA 5A2AA 4K3ZA 2OFJA 3SSZA 2ZC1A 2FJKA 4IG2B 3OO2A 2V38A 3TYDA 1Q7MA 2OT1A 3NG3A 1R3YA 2IQDA 3WQFA 2XIJA 3IVTA 3S5YA 2GLKA 1WXJA 3C0SA 2C0HA 4N7QA 5CC5A 3MSGA 1OABA 4JCLA 2CETA 1XLGA 4D1IA 1SU5A 3QQ0A 4JTCA 3HG4A 4GVGA 3ITYA 3KS6A 3LHVA 1VC4A 4S39A 4FAMA 5LHEA 4LVBA 1UWTA 2F6KA 2OPJA 1JZ6A 4J3VA 1V6UA 3SUWA 3LPOA 3NQCA 1OF8A 1FP8A 2Y4SA 3TQ0A 1KBBA 3CAWA 4C6IA 1QPNA 1KR0A 4M82A 3UR7A 1HKKA 4JIPA 5EMMA 4MPKA 1Q6QA 4S3FA 4B4HA 4J3TA 5KZ6A 3EX2A 5HJYA 3SCNA 3JR2A 1T41A 5AYZA 1BVZA 4O1AA 3LZ5A 4K8GA 1I8JA 4DI8A 1W3HA 1E0TA 3ZMRA 5LGZA 1MEIA 4DZIA 4NIRA 4D6DA 3M5YA 1X97A 3C0QA 3T4CA 1EC8A 2WCAA 4ZOAA 1XBYA 3ES7A 1P5BA 3UWQA 1GOIA 1Y5XA 1J10A 1UD2A 3EOSA 2H6RA 2V6AA 1KBKA 1XYAA 3CIVA 3E1F1 3PZ9A 4ZCWA 3FVMA 1DJXA 1EJRC 2E28A 3I7SA 1ZB5A 5FF4A 4C6FA 4HJWA 2J66A 4RLIA 1HJWA 2R1PA 3S8HA 7TIMA 4WKAA 3WDIA 5DY2A 2XJ7A 4FIRA 2JQXA 3VIMA 5HA7A 4W8LA 3CHDA 4MOZA 1QPKA 2ZICA 3L68A 4RNFA 2Z1VA 3SEPA 3LCHA 1QWKA 3RR4A 1V3JA 1W1B1 3GNNA 1H1NA 3BGAA 1TV4A 4HZ8A 2F61A 1NWRA 1KWKA 1OK6A 3NVDA 4W4QA 5A6SA 2EPKX 5IRPA 1XIEA 2YKKA 1UYQA 1Z89A 3KVLA 3UYIA 3WDQA 3DU0A 3UZZA 2QVHA 3P81A 4LU0A 1XLFA 3VZZA 2DV0A 2QIIA 1H09A 4L6DA 4C6EA 4J2MA 4DJED 1BVWA 5BYWA 2XIQA 4YN5A 4KIEA 3N04A 3BLFA 3QMSA 2FLIA 1TE6A 1V93A 2WCGA 4B5WA 1WZKA 4ICNA 4LTSA 4MY1A 3H2MA 4QITA 2DJLA 3E6EA 1C7TA 3L65A 4JTFA 1RVGA 2NQZA 1SVDA 3OQ8A 5AYYA 3G24A 2PDWA 4K37A 5IM51 5LNWA 4PTNA 3KZSA 3RITA 3PWAA 4WKHA 5XIMA 1SZNA 4FHAA 2O7QA 2YGYA 2GDVA 3OIXA 2OQHA 1B4EA 1VH7A 4IHCA 3VYLA 4RDWA 1XLKA 3UJRA 3URNA 2XTKA 4MWAA 1GG1A 1HX0A 1XL9A 4PCSA 2TYSA 1I0DA 3EGJA 4G2DA 1VP5A 3SRKA 4DELA 1KTCA 2EG8A 4LEQA 2HXTA 1Y0EA 3VNMA 1GHSA 4LS2A 5I3DA 2IKJA 4UFKA 3CUXA 4UMCA 3HFYA 2O7SA 4C1NA 4GH3A 4JS3A 1WBJA 3L4UA 1E6NA 4F3HA 3U2ZA 4HCLA 3GZ3A 3W1MA 3KP1A 1XIHA 1UQZA 3XIMA 1QK2A 3TDFA 1FXQA 3WH5A 2YIHA 3QTGA 3E0VA 4O52A 1PBGA 3IGSA 1MFVA 4YL2A 4GI8A 2WLZA 1FFRA 2HVNA 4HOXA 4CN4A 1SSGA 1D3HA 4F0KA 4IWWA 7CGTA 3B9NA 4UTTA 3ZJ7A