1PEZA

Bacillus circulans strain 251 mutant a230v
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
686
structure length
686
Chain Sequence
b'APDTSSSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDVVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTATWEGGSNHTFTAPSSGTGTINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclomaltodextrin glucanotransferase
publication title Conversion of Cyclodextrin Glycosyltransferase into a Starch Hydrolase by Directed Evolution: The Role of Alanine 230 in Acceptor Subsite +1
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 241
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pezA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pezA01
2Y8VA 1U3HD 1I3GH 4FOMA 3KGRA 1VA9A 4R96A 1IARB 4YXLH 5DJAA 2YBUA 4X7DC 5J6GA 1OVZA 2W1NA 4PTTB 3GIZH 2CKRA 4WTWA 3ILQC 5DQDL 4ZFOA 2O9OA 1XGTB 4P7OA 3AHXA 1A7PL 2D22A 4I3SL 2Q7YA 3IETB 4WV1C 5DZLA 4XRCA 1N0XH 2P24A 3FT4A 5ADOL 4HUXB 1NANI 1EEQA 4G6JL 1V5JA 1I7TB 3K7UA 2ATKB 4HWBH 3QDGD 4WHTB 1NGQL 2ZUQC 1UXWB 4XGZB 4FQ1H 1NC2B 3V6FB 3HG1D 5ITBL 2F7RA 4LCYB 4Z7UF 4PJDB 5TQ2L 5KW9H 5L6YH 1TVBB 1QX1A 4HOXA 5FA3B 3UYRL 2YBRB 5TE4H 3PZVA 1CCZA 2H8PA 3CXHJ 3TN0D 3Q2CA 1UR4A 4GRMA 3IFOB 3KPPA 5FKAA 1JGVL 1AXTH 4AZHA 4FQHB 3E6HB 3G6JE 3AY4C 2LU7A 1CFVL 5DC0A 3PHOA 4OZHE 2Y7QB 4KJWC 3WQ4A 4I48A 4M93C 1HCVA 4QRRB 4R4ND 1I4FB 2GSIB 1X5LA 2E6JA 3WJJC 2YIHA 5JOFA 3BAYA 4HP5A 4D6CA 1JHKL 3HC4H 2D7NA 4HH9A 4ACYA 3PGCB 4FQ2L 1HIZA 4U1NA 2VDML 1C3FA 1I9RH 4DTGH 1E73M 4LLDA 4OCMC 3DMMC 1UWRA 4G8GD 3MLTB 1I7ZB 2E9MA 3P4MA 4J3OC 2HMID 2BRQA 2UWEA 2HFFA 3MUZ1 4M8QB 3O8XC 1WV7T 3OGCB 1E6PA 4JL2A 1OSEA 1E3XA 3VIIA 2EDKA 4K71B 3K8MA 4HIIB 2VZVA 2A3HA 4JHOA 2A6IB 1R24A 1YEGH 5DYOA 2DLFH 5F9WB 3TBYA 4LSVL 1PBGA 5LAXA 4YBQC 1NEZG 1WZ1H 1KYOJ 2VN4A 3EYOB 4QOKA 3LN5A 4BKLA 4N5EC 3CLWA 2YD7A 1KTDB 4XCNB 1L6ZA 1T5XB 1FQ9C 2ZUUA 1JGLL 1MJ7H 2VOTA 3VGEA 3F7YA 3ALFA 1NOFA 4NRYB 4P5MB 4PGEB 1HZHL 5B21A 5EU6E 2V5RA 5IMKB 3OKNA 4UDUB 3TVMA 3QR3A 4PMXA 1G9EA 3OJVC 3MNWA 4DN4L 2R29H 1LO0L 3TC9A 4OCWL 4PJFA 2JF7A 4RA0C 2AXGB 4XXCC 1DLFH 4IRJB 1KTLA 3KLKA 2IXUA 3WELA 3MSPA 1Q9OA 3QHMA 2VL5A 4BCEA 4JM2F 3HE7A 3HMWL 2G3JA 3EHBC 2AQ2A 3RY4A 4JO4H 3CUFA 4KK9D 1Z9MA 4XMLH 1GGCL 1SEQH 2GAZB 4HPHA 4Y5YC 1TNMA 3RNQA 3AMKA 4KI1A 1HKIA 1X4YA 1A4JA 3ZTNH 3ARZA 4LASH 5FM5M 2EADA 1YN6B 2NX5A 3AZSA 2JB6B 4OTXH 1LG1A 3IF1B 4XP4L 4Y5VC 3MA7B 1UZ1A 3PP4H 4HG4K 1E4NA 4LIQL 2VUYA 1JDAA 3FT2B 4O51B 4YHKH 4R3SB 4KK5C 1MIMH 4H88L 1I9IL 5I73B 2N7AA 3HUJE 4RNRA 1CWVA 4PJHE 3RPKA 4X6DA 3HHRB 3W37A 1P7KA 5EULV 3ZQ9A 1EGJA 4K7PL 2DJSA 3IU4H 4IRJD 3KG5A 4JFQA 5A3ID 1U8PB 4U1JA 4BFIA 3BP7A 4DZ8A 2PYEB 5IHBA 5A6BD 1YEDB 3WFCH 1F3RB 2E7CA 3BAKA 4OFVA 3QAZB 1CK0H 1YUHA 5E99H 1JYVA 4EI6A 1KNOB 4X4YA 3WNNA 5FUOH 4LFHG 2FO4A 3QFDA 2FIKA 3HC3L 5KS9A 3MANA 1MCPH 1GAFH 3DRTA 3VXUA 4FXKA 4MJ4A 4B41A 3D4ZA 4RGMC 2V7NA 1UC6A 4Z0XA 1EHAA 4PJAB 1MXGA 1AP2B 1MHHA 4PP1D 3DUUB 3MNVA 3SPVA 3KXFA 2VXSH 5IESL 4OGZA 2YEZB 4XWOC 2UWFA 1OPGH 3GH7A 2R0WL 5GGSY 1EGJH 3FB6B 1N7ML 5BRZB 3QHTC 4Z7OE 2YWZA 1F02I 5KSBA 3CDYA 3VDCA 3QXUA 4NNPH 1IAIM 3NCJL 1UA7A 4MAUH 3S8WA 1EVUA 1QNRA 3O6KH 4UOW0 4G7YH 3DVFA 3R8QA 3WH9A 1UWXK 2XWTB 3LD8B 5HHOA 4XPHL 5IMOA 2D03H 4CNIB 3GSRB 1JNHB 1J1PL 5C0AE 1EGJL 2AKRB 1XYFA 4MZ3A 3UO1H 2Q7NA 1S7VB 1QR1B 1YNTA 4NGHH 3ULUC 1PEWA 3HG3A 4AD1A 2CKBA 4Q9QL 1OINA 1WK0A 1N6QL 3DGCR 3WCYA 3IXTB 4JFPB 2YD1A 2B0SL 5FA4A 1NL0H 4IRSB 4HUVA 4JDVA 1I1AC 5IGXH 4YHNB 4FTVA 4AENA 1CGSH 2CIIA 3C2AL 2OR7A 3D0VA 1D9KD 4RMQA 3KL3A 3AZRA 4WJ5A 4PGBA 2WWMC 1KGXA 1CDCA 5IB1A 4XNMB 1E0VA 3DI3B 2VXUH 3VE0A 1PSKL 4TVSa 4WSJA 4OBSA 4MDJB 1MIEL 1SQ2N 4X5WB 4W8BA 1BLNB 4AL8H 5DS8A 2Y07H 4LLAA 4PRPB 2EKSA 3A4XA 5HDRA 5DK2A 2VCAA 1ZWIB 5CEXA 4G6AC 3H9HA 3MRFB 5C0GA 1DEEA 1BEYH 2VXUL 1D5ZA 4HGMA 5FK9B 1EHNA 2Q1EA 5CSYA 5EU4A 4F7EA 2BY3A 3QUMB 1C5BL 2CMRH 1AY1H 2UWEE 2ZICA 2CKBH 5E9AA 3QDJD 4GRWH 2BVOB 1K8IA 4Y1AB 2VERN 3QNYB 3LX9A 2XG5A 1BEYL 3OZPA 5J12C 2DM7A 4X99B 4HFWA 5I1CH 1N59B 3G6MA 3H7LA 4Z76B 1ZHBA 3VWKB 3K1DA 1INEH 4GQPH 3NA4A 4QXWA 1B4JH 4IRSD 4KUZH 1DANU 2GY5A 1MJUH 3J8F7 3BZEB 4X9FA 4TSAH 1G7LA 1KIQA 4JRXA 4W6XB 5D7LE 3DHPA 3ME0A 3WKNA 5GRUH 1UVQB 1FFRA 4F7CB 4BJLA 1QQDB 1UWIA 4OCSL 1K9TA 4UNUA 3RDTC 1MJUL 4NSKA 1MRFH 4PJFE 2WWDA 3F7VA 3QG6A 1JPFA 3BUDA 4LEOB 1VGEL 1WTLA 1Y6KR 2A77L 2FJHA 2NNAB 5DJ8A 1QBLH 3V0VA 2DQJL 3BUTA 1U6AL 4YUEH 4QF1B 5IB4A 4BFEA 3WF2A 4U5KA 1D5MB 2X2HA 4R27A 1JI2A 4MQ7B 4WU7B 2V2WA 4FFZL 2IPUG 1OQXA 1BZ7A 2NR6C 5D5MF 3MLXL 1DBBL 3WF1A 1I9EA 3INUH 4D3CH 3QDHA 1H5BA 3TBTB 4QRQA 2JF1A 3OAUL 2VABA 4MYWB 1QNOA 2HH0H 3BAEH 1QBLL 3BOVA 2NX5E 1BIIA 4H0IA 4R7NB 1SM3L 4OLXL 1W2KT 3CIQA 4U6YA 4P8XA 1H41A 3VFRA 1CTNA 1P4BH 3VWKD 2X4QA 3MXWL 1HINH 5GS1A 4JR9H 4DFHA 5IVXA 4TNWF 3TESA 3VXNB 1JF1B 3LKNA 5EA0L 5C0CB 3WUEA 3QIBA 1UA6H 4CRPA 1MFCH 1L9NA 1BLIA 3O11A 3F12B 3UCRA 3RWFA 1XF5B 3EYQD 1MFVA 4D9QE 4GMSL 4X6DE 4ZOEA 2VL4A 4HK3N 4J6RH 1LEGA 4G6FB 2FL5B 4Q2ZA 1ISYA 4WWKC 1SJHB 4P2RB 4ZAKD 4NYLB 3VFPA 1TA3A 3DX8B 1WZLA 1XRVA 3PZMA 3MS8A 3ARFC 1RK0B 4CVXB 3SO3B 4LGSB 4WFGD 3DVGA 4LLMA 4H1LG 1LP9B 4NDMA 1EV2E 5BQ7B 1D5IH 4J6RL 4UOJA 2OXGA 5BV7L 2OYMA 3W39B 1KXQE 3VIHA 2FBJH 5I71C 2F7QA 1Q9KA 1MH5A 4M6OL 5DR5H 2ILLA 4U33A 5F3HB 1C5CL 1PYWA 4Z7VE 3WNOA 4C56E 2OZ4A 3FQWA 1R5VA 4WI9A 1X5AA 1FVDA 4G6KH 4MZ2A 2VISA 4U6VH 3H55A 5CMAA 2DDQH 1RZFH 3F7RA 3I2CL 3ZT7A 3IJSA 1KF9B 1QWNA 2HJFB 3SDAA 2XQBL 1JV5A 3FB7B 1P2CA 3OJDB 3C5SA 3KXFE 5C0CD 1FP8A 1UA3A 3FQTB 4LRIA 5DMIH 2V5CA 2VLKB 5FDWA 5HOSA 3FQUA 1KCLA 1C08B 1K5NA 3FO1A 1PG7X 1FO0A 3MLSH 4AIXA 3CX5J 4RGNE 5FL0A 3GMMA 3AXXA 2IFFH 1QSEE 4LCUA 4NQVA 3ES6A 4O2EA 3IVKA 3WUBA 5FHAH 1BQHG 3L3JB 1FJ1A 1ESWA 4FXGA 2BSTA 2D73A 4P2RD 3WHE0 1R3KA 5HHOE 1K9DA 4WW2C 5IP4A 2YD2A 1WITA 3VO0A 2DSUA 1U8NA 1MFAH 4WKFA 3KS0J 1KPVA 1PGRB 3ZO9A 1W9VA 4OSUH 4GRWE 3BKJL 3DX7A 5TDOA 3BO8B 4PJIB 3O6FB 4LLQB 3IDIA 4NUGL 4KZEH 2XWJA 4W4OA 3BN3B 3MRHB 2CIKA 4UDTA 5I1HH 1W72B 1E4WH 5CWSA 3CSBA 5HXMA 2E7BA 1WNOA 4M43H 3LQAH 4R26L 1FO0H 5IEKB 2OZ4L 3WN5A 2DQXA 4KDTA 3SDDC 2Z93B 3FN9A 3V79C 2Z8WC 1CBVL 3WQ5A 4AY1A 1WF5A 4N8PA 4E41A 4Z2KA 1MW0A 3CFCL 3BN9D 4OUEA 3QIWD 2DKUA 1DE4B 3RWHB 2EEBA 1N4XL 2E9WA 2R56H 2QQNL 2VAAB 1LE5B 4E0RB 4I0PA 1DUYA 2I07B 5TE7L 8FABB 1KXVA 4PN2A 1IFHL 4GS7B 2PBGA 3PV6B 4XHJC 4U05A 3WIHA 3ZE1F 4U1LA 2B2XH 2OR8A 3BUPA 2R1YA 5EO9B 2H2SC 4FS0A 5CD5D 4X6FB 5DMGC 2XPKA 2D31B 3OKYA 3MLWL 1RUMH 1VDGA 2L7UA 5F8RC 1BQSA 4RQQA 3O6FD 5JHDA 4AEHL 2HVJB 3H2WA 3SDXF 4IUGA 3DTXA 1I8MA 2VWEE 3VI4F 1MJJA 1LDPH 2QQLL 1UZ8B 3DURA 5HGBA 5F1SA 2J8HA 1JD7A 5GNYA 2ZOKA 4UV7H 4BS0A 1C12A 2NW3B 3B2UD 1AGDB 4U1IB 3RTQB 3FRPA 4PTXA 2F54A 5E70A 3ECQA 5KANG 1CQYA 4FLRA 4WFED 4HIJB 4GW4B 1PVHA 1HH9B 3BUYB 3PGDB 4OT1L 1DBAH 2A9MH 2PXYD 4MA3A 5T3ZH 2ARJQ 3WIHH 4QXUH 2YA2A 5C0EB 1KLUB 4F9PA 4ONOA 5LGJB 1EFXB 4OLWH 3LRSA 3MOAH 1TDQA 4MB3A 2EEAA 4X80H 5DD5H 5C08B 1FA2A 2EO7A 3DHJA 2AEQL 5FF6B 5CEZL 3MUY1 5KVFH 2OW6A 4UZUA 2GFTA 2YDRA 1LL6A 2W61A 3B9AA 1XF2A 2CQVA 2LVEA 4HBQA 3WIHL 3UBXB 3D39A 3QHOA 4CN4A 5D2LA 5TDNB 3VWJA 5T33L 1W32A 1ISZA 5CBAA 4WFFE 3KLHC 1FZKA 3RNKA 1I75A 5JA9A 5JBFA 4HA1A 3VGGA 1QKZH 3NDYA 2P5EE 4PP2A 1IGML 3RTQD 3OX8B 3A21A 5DRXA 3L7FB 1B31A 2OLHA 1KTKE 4E9LA 5MENB 5C0JA 4LSRL 3MLZH 1F4AA 2BNQB 5ICYA 4HPYL 4TSCH 3GB7A 2WVSA 1UG6A 3MXVH 3PTMA 3ULUF 4S2SA 1MCSA 5JZ7D 1VBUA 1DANT 2WHLA 5C6TH 4LPYA 3BZFA 4KY1L 4NHUB 1U30A 4RDQG 1EFXD 1E0WA 2DT1A 1JCKA 4LARH 2FH6A 1TTUA 5C08D 4TSCL 3WFHB 3CIVA 5CJXC 4CVZB 1RK1B 3O2WL 3TVMC 2WW8A 3ZE2E 4JG1H 5D6CA 1A1NA 2WYSA 5GGVY 3PNWB 5C6TL 4W8LA 4ZUTB 3QRGL 1MHPH 4QYOB 3MCKB 4D9LH 3NIDE 3I6GB 3IANA 1CXHA 5CEYB 4HS8L 4LARL 2EIEA 3HE7C 4EQ2A 1KUMA 3THML 4NKIL 5I1KH 2GCYA 3ZHDA 4ELMB 4I13B 4HKZA 5IFPA 4KZDH 3LXBA 1CICA 3QXVA 4F58H 3POCA 1MCRA 2FGWH 4YH6A 1MHPL 4B9ZA 1JZ7A 3CUIA 3DYOA 3B9KA 2MJWA 3DO7B 3NCYS 4MSWB 5JIWA 3O3EB 2H6PB 4B3KA 3N1MC 1CZ8H 2AJUH 5MEND 4LLYB 4KQ3H 5LCVH 4XTRC 2BNQD 4HGWA 4F15B 4G9FB 4AH2B 3BIKB 4RX4A 2DIBA 4ZUUB 3UETA 4TN9A 5D7JA 4MS8C 2DD8H 2EEXA 3EJZD 1XZ0B 4QLKA 2HG5A 1WCBA 4PRBA 2AJUL 4BSVB 1EVTC 4CDHA 2C1OB 4XP1L 5DF0A 4NO3B 4GSDH 3RJYA 3PV7A 3RWEA 5A95A 2VUOA 4NOFA 3H0TA 3U4EB 3A6CH 3ARXA 3RX8A 4QNPE 1T7VA 4FFWC 1QD0A 3K8LA 2DWEA 2YPLA 3W9EA 1YEIH 1BBDH 4KVCL 4MJ5A 3RL1B 3FFCA 3BZ4B 5JPMB 3GSNB 1Q9WB 1RJLA 3S34H 1VF8A 3QOKA 1QSFB 2WBKA 4HZ8A 2HA1A 2F5AL 4E41E 1T21B 3H9ZA 1U8LA 2W9LA 2D7TL 2W62A 1PIGA 4X5XA 1UFUA 4M56A 2ZUMA 4CCCA 2FBOJ 4NT6B 2GJ6A 3EYSH 4D6GA 4UINH 2VDPH 4ODVH 3NIGF 4AZBA 1VFAA 4M6ML 4RWYL 2A83B 4P48A 1OD0A 3ZYJA 4DCQB 1OHQA 3VXOB 4ALAH 4RBPH 1GSMA 4OOUA 1HX0A 4UU9B 4OZFA 2FRGP 4GG6B 4I2XB 5IB3A 2HLAA 3QO0B 1A6VL 4UTFA 3FNDA 3WF3A 3QEHA 4HGKC 3VM5A 4ODVL 3QNZB 1UQYA 1V3IA 3HI5L 4UQ2A 3POHA 1BMGA 1FGNL 2IPUK 4FQIL 1NCCL 3M6DA 1N64L 1IGCH 3VFOB 4H5SA 4BM7A 3W0WB 1ITXA 4GKNA 2GSJA 4N1CA 3OKLB 4N0UE 4S1RL 3P0GB 3VFSA 3LKPA 5INCA 1TJIH 5FYLD 1YMMB 3L3DA 3I02B 1RJZB 1GHSA 1GCYA 5I6SA 3BJ91 4MAZA 3PZQA 2FWOB 2F54E 2XACC 1QSFD 3AU1B 3RUGF 4UB0H 1FZJA 3ARWA 5D71L 2VLMD 3D4YA 2WC3A 3MRJB 4L4OA 3QXDA 1PAMA 1EXUB 5T1MB 2XY1A 4YDJB 2XN1A 4I3RH 2XA8H 2NY3B 3UMTA 2OWCA 2PCPB 1MLBA 2OTPA 3BKML 4DM1A 3O4LA 4JDTH 5ETUA 4E4PA 3KPLB 4OZFH 1UWGH 3VFVA 2G3IA 2IAMB 4K7FB 3RY6A 1C93A 1NGWA 5I6XC 3OLGA 3VIMA 3BPOB 3Q5YA 5I1GH 5I16B 1U8IB 4M5ZH 1KBGL 1CFNA 2W60B 2W07A 1VPOL 3CNKA 5AYUL 1KN4L 3T0AA 1NJ9B 3C9NB 2GSGA 4JZNB 2E7LA 3D39E 1EDQA 3MREA 3IDMA 2EDDA 1EAJA 5HI3C 4NM4H 5DT7A 1CDJA 4APQB 5D2LE 1WE5A 3Q6GH 4CMMB 1CWYA 1U3HA 2QV4A 5FIPA 3WN6A 1NAKH 4HCRL 5I1GL 2J6EA 3W0WD 3U4BL 3D3VB 1FYTE 5TF1L 3S6TA 5AC4A 1G6RA 1YMMD 5HJ3A 4NO0B 3WD4A 3DIFA 4K9EL 4MNGB 3VG0H 4DK6A 4LCCB 4I0KA 1E43A 3GZAA 3KPQA 4OF8A 4AQ1B 1EAPA 2W91A 4I18B 2F53B 4WW2F 3LKSA 3CMJA 4YJZL 1W1VA 2FEEI 4Y8DC 1MRCH 1WLHA 3DARA 4HIEA 1LG2A 2ZCKL 3ROLA 3QDGA 1TETL 5HHMB 2HRLA 3I6LD 2NXYB 4M6NL 1FLRH 3MGTA 2GYSA 3HG1A 1LO5B 3BX7C 2X4OB 2QR0A 2N4IA 1H0DA 2IAMD 4IOIB 2PETA 3QQ9C 4XBPA 5CIPA 3S36H 3WS3B 4HPOL 5IG7B 5DUPL 2GTWB 4NZJA 2O5YH 3TN0A 3SJVD 2G5BA 1ZSDA 3WNPA 2VZSA 1INQA 1JDCA 2J6EH 2A6DA 4U1KB 5GRVK 1CDIA 4K7PX 5EOTA 2VRKA 1FPTL 2YKKA 2QV2A 1JWUB 5IFAH 5D8ZA 2EZ0C 1I1YB 1V0KA 5ENWA 3EOTH 3PZNA 1OAZL 4APQD 5C2BL 4U2ZA 4PSRA 4KI5C 1U2YA 3DXAE 1G6RH 2ZWLT 1AGEA 3GXPA 5JA8B 4OFYA 5F72S 3VXTA 1GIGH 2RCSL 3FO0L 4PTTA 1DQJB 3A23A 1XGTA 1HJVA 3K4DA 1E9LA 3U9UB 2Q20A 5ILTH 2OYLA 3EOBB 1AGFB 4EJ1C 4G8GA 3IETA 2HRPL 1QP1A 1G6RL 2F53D 3HC0B 4HUXA 1ZANL 4MNQE 1F11B 4CKQA 1JPSH 1X5YA 1HXMB 1BJ1H 1XR8A 3CX2A 1FC2D 4PJBB 4WHTA 5GS1C 3T0WA 2OK0H 3LB6D 5CIPH 2MKLC 3HZVB 3O6ML 1UXWA 3MLRL 2NXYD 3G6AA 4LRNH 3V6FA 5ILTL 5BVPL 5E6ID 3QIBC 2VXTL 1DP0A 3ARGB 1NUNB 4LCYA 2ZNXA 1TVBA 4FFVC 5BS0B 5EOCH 5FA3A 2WMKA 3FQRB 2GUYA 1HJXA 1ADQA 4X0NA 2VKWA 3SURA 5I2IB 3FZUD 2ZSWB 5ESQA 3V6OE 3KEHA 1H3WM 5JW3H 4G3YL 4FQHA 2YA1A 4URTB 4XNYL 1VFFA 1T7XA 2Y7QA 4M02A 1KB9J 3BSGA 4ZQKB 4Q9RL 4QCEA 5IKCB 3BFOA 1I4FA 5JTWA 3ZSSA 5BMFH 4LVEA 1EEZA 1NLBL 3LS5H 1DWHM 5JO5B 2B7DT 1JNDA 3PL6B 1YHTA 1WDSA 2NPLX 2XRAH 5LWYH 4QHNA 4RDQF 3VJ6A 1EO8H 2GJ6E 1W3LA 1XSJA 4OM0L 5EPMB 5K33A 1JGDB 2XYCA 3EIFA 4RA3A 2YXFA 3U0WH 5MEQB 2BK8A 4LDOB 1XF3B 4YHOH 3VXPB 1MCHA 3F5KA 5F7MC 1LEIB 1RY7B 1ADQH 2GW5A 3IFPB 4LRIC 5CJOH 2A6IA 4XH2B 4YHZH 4ZXLA 3VXSE 3K0WA 2WC7A 3LQAC 3ARGD 4HBCL 3MRLB 5FEBA 3EJUA 2JK5A 4YHPB 4MDIA 4BSWB 2J5LB 5DGRA 5BS0D 2D24A 1RZJL 3FOLB 3EYOA 1NFIB 1NARA 5GS0L 5E0QA 2UWEF 2W59A 1KTDA 2APWA 4XCNA 4FMKA 5F9DC 2D7OA 5KVEH 5L9DH 4H8VA 4PUBL 1BFOB 2X9WA 1NFDA 1RZGB 4P5MA 2ENSA 4PGEA 1LO3H 3RU8H 2GJXB 4ZE4A 5IMKA 4UDUA 5GHWL 1D6EB 3CPLB 4YWGL 1UASA 1HHJB 4UFJA 2WCSA 4AK1A 4GLRH 1MELA 4XB3A 1V0LA 3SDCB 4IRJA 5I18H 2WWKT 2MCPH 1MJ8L 1S7SB 3V5KB 1ERNA 2R0ZH 3NPSB 3P77A 4CU8A 3VRJB 3VUPA 3PL6D 3IAPA 1C7SA 1CFTB 5FYJD 5A1AA 1YN7B 4I9WE 5CAYB 5A6BA 3FRUA 3LN4B 3V6ZA 4W4OC 1QYGL 5M17A 3O4LE 2GAZA 1Q6CA 1ONQB 4NPYB 1HWGB 3GNPA 1KJVB 2ZJSL 2XZZA 1TE1A 2RIKA 4NBXB 3U4AA 4W7VA 1AO7E 2HJKA 4LX4A 4CL7A 4XNZC 1NSNL 1YN6A 2DYPB 4KDTC 5AD0B 5E5MB 1DTUA 1TNNA 4WI3A 4ZOBA 2EDNA 1C8QA 3WD1A 3F65A 1OCWH 4LCWB 3IF1A 1MCEA 3MA7A 5JHLL 1WAAA 35C8L 4OD1L 3BIBX 3DHUA 1OQOA 4J1UB 4UI2A 4OD3L 5HPCA 2AJYH 1JK8A 2ZCHH 4I0PC 4R3SA 4L3AA 4B16A 5JQHC 1E28B 4GKSA 1KXVC 4WTZA 3RP1A 3BESR 4MD0B 3SN6N 5I3DA 4YHLL 3QUXB 3WQ6A 2HT2D 3UESA 5HDBE 4OZ4B 4NX0A 3SDCD 2ZUVA 4P9ML 1U8PA 4O4YL 1G7HA 1T1ZB 1QI3A 4OV5A 2JIXD 1MYRA 2ERJB 1YEDA 5IM7A 2HJLB 3MZTA 3P9WB 4QHLB 1MHCA 3W29A 1MAMH 4Z8FL 3WFEL 3HNSL 1MREH 1HCFX 3TA3C 1R75A 1EJOL 1EMTH 5TQ0L 5CJ8A 5FGCE 1AE6L 3SKMB 5IBTH 2Q6WB 4JFZL 1AQDB 1X1NA 4X4XA 5DA0B 1D9KA 1NH6A 5E8DH 3ISWA 4GRLD 1K8DA 4PTUB 4YFLI 4HUKB 1KELH 2VZ1A 2ICWI 5JIKA 3L1OH 1YNKH 4PJAA 3X17A 3DUUA 2J8GA 3BHBB 1C1EH 3TZVD 3FB6A 5DFVC 5KS9F 4FQLH 4QRUB 4KJYB 4IRZH 2KH2B 3BIAX 3QUXD 3QJHB 3GYCA 1TFVA 4G8GE 4TUOB 1HHIB 3L3IB 4LU5L 2NYYC 2R1WB 4PBGA 1JNHA 5C0NC 1C1EL 3MMEB 3MRKA 1FP5A 1OT2A 3QDJA 3RVXC 2AKRA 4OQTL 4LSUL 3WLBA 2BDNL 3MMUA 1V7NH 1ZEAH 4WUKH 3ZJ7A 3SGDI 1S7VA 3S35L 3W5MA 5D7KD 1QR1A 4IRZL 4BA0A 3U83A 3ZHLA 5DD3L 5KSBF 3V4UH 3C8KA 3QUZB 3IXTA 4M00A 4S1SH 4JFPA 3SGEI 3GXTA 5ABFB 4HH8A 1QSVA 4IRSA 2GITA 4LVOB 4PLNC 4YHNA 1FVEB 2VDRH 4JFTA 3HZKA 1LO2H 4C83B 3CMGA 2Q3AA 5HVHB 1VEMA 3FRPG 4OF7A 1RAMA 3O4OB 4XNMA 1OARL 4I5BB 5HSFA 1K6QH 4Y4HC 4FZ8H 4RFNB 1UKOA 4MDJA 3BYYA 4X5WA 4XP5H 3VIKA 2WMHA 1BLNA 4NRXB 4BQ5A 2VDRL 4O9HH 4XVJL 4HQQH 3UAJD 3IS1X 3GHEL 4YPJA 1BYDA 2UUDH 2IXVA 3MRFA 1AHWA 1A3RH 2V2XA 2IG2H 1LGVA 5H2BA 5K9QI 4HU8A 1DWGM 4BFGA 4QTHB 3QUMA 4TSBH 3T2OA 4DEPC 3OR7A 4X6CF 4QRTB 4TTDD 3ULVD 3KYKL 1O0VA 4JHBA 1EHLL 3ZZ1A 2ZUXA 4F9DA 2BVOA 1A7RL 3QNYA 4XI5D 3MJ6A 4AM0A 3BDYH 4M48L 3CMOL 5IIEB 1MI5D 1N59A 2VKXA 4NN7C 3VM7A 1CICC 3VWKA 2V2TB 5JBDA 1JHLL 2IGFL 3BI9X 5A6KA 5E9DB 5D4QA 1P4IH 1IC5H 3B9KC 2DKSA 4PG9B 3ZDZE 3WL0A 4DVBB 5F7DB 1UVQA 2XG9A 2ZCLH 4F7CA 1AQKL 1NFDE 1RIHH 1QQDA 4A6YB 1YY9D 5E4EC 2ZOLB 1MW3A 1BQCA 2VJXA 2WC4A 4FLOA 1B3VA 1IC5L 2K1MA 4OCLC 5FOBB 2RGMA 4ZAKA 2JELL 2KUTA 3QUMH 3QG7H 2UY6A 3S5YA 2NY2C 15C8H 2NNAA 2NY7H 2TAAA 1BYAA 5F96L 5CCKL 1CGVA 3WNLA 4EDWH 4QF1A 3MBXH 2DJUA 3N50A 4Y4KB 1D5MA 1F6LL 3M17B 4MQ7A 4WU7A 4YGAB 2IF7A 3JV6A 4FQXB 5AG8A 4UZGA 3JTTB 1KGCD 1ZHNB 4JFOB 4KMLB 4YFDB 2GJZB 4XCCL 2NY7L 4F8QA 1YC7A 4S1QL 5CJQH 5C1MB 1RZIB 4P8WA 1VRXA 4OZGB 3QPQC 5ERWA 3WS6A 4GW5B 1JRHH 3IJ7A 2VX5A 4P2OC 5IUSA 4KI5F 4NXSA 5I75C 4U1HB 5JR1L 2CLVA 3VXNA 1JF1A 2J7CA 1NCWL 5C0CA 4LQFL 2EDRA 1S9YB 5JW4Q 5KOMC 3X11B 3MYZA 3MV01 5AZEL 1J87A 3F12A 1JNNH 1J7VR 3DDGA 1XF5A 1SYVA 4OOZA 2WK2A 4ZE5A 5GRJL 1UADC 3U7WL 3KLAB 5TFSL 2VR9A 1F00I 2FX7H 1QO3B 2FL5A 3GBNH 1J1XH 3OJMB 4L1HA 5DRNA 4L4VB 4LSQL 3WFBH 4KKNA 4P2RA 4NYLA 5LQBH 1PKQE 1MFUA 3DX8A 5IVXF 3HG5A 4QEGA 3EYVB 5I1JH 1E27B 4CVXA 3AB0B 2EDEA 4LPWA 2XVLA 1OGBA 1LE9B 1S5IH 5IF0B 5BQ7A 5HYSB 2VITA 3WH8A 1J1XL 3T2NL 4K9EC 4GPNA 4FQXD 3BP5B 1UXSB 1AGCA 3W6LA 5CS7A 3W39A 1ODZA 4GAYB 2YKLL 3QZWA 2DSKA 4HZ6A 1HYSC 1A9BB 4H0HB 3ORJA 3PTQA 3ZDXF 1HSAB 4ODSL 2EIDA 4NZRL 4XPFH 1FNSH 2MCG1 1TITA 1TUXA 3SCVA 1IRAY 2QSVA 3PABB 3SKUD 3D48R 2HJFA 1UB5A 2H26B 3OJDA 1V3HA 4KRUA 3FQTA 3NA9L 5T5FH 2QSTA 3HR5B 3T1FB 1MFEH 4EVNB 3DSFH 3NACL 4O2CB 4OCXL 4XP9H 1DWAM 3EMQA 4WUUE 4WKAA 1IAIH 4ZS6C 3RY6C 4XPFL 3QIWA 3RFZC 4A2MA 3CZNA 1W9DM 2OJEB 3PZGA 3WIJA 1RIUL 1ZJBA 1CLZL 4ZODA 1B30A 1F5WA 3HZMB 3U82B 3TONA 4PY7B 1LL4A 5C0DB 3U1SH 2BRRH 4L4VD 4OZFG 2MTPA 4F33B 5HD8C 1DBJL 4D6FA 1CL7I 1A2YA 1RP9A 3FONB 4KJQD 3EYPA 1MFEL 2E7LC 3MYJB 2H45A 2QHRH 1FNFA 1ODUA 3QDJE 2FCBA 4P7LA 4PGDA 4CN1A 3VXRB 1U3HC 2O92A 2VX6A 3RWDB 3UTOA 3HAEH 4XUYA 1J18A 3B6SA 1CE6B 4PJ7E 4MGXA 3U48A 3BO8A 4UAOC 5JORB 3DETD 4PJIA 4TVCA 2IADB 3O6FA 2IUZA 2AEIT 2Y5EA 4LLQA 2ZPKL 3QCUH 1FOBA 4TVPD 1QEWB 3V5DB 3MRHA 1ZGLB 1W72A 1QPKA 3NCEB 1YNLL 1MWAA 3OGSA 1L7IH 3DVNB 4LVHC 4CJ1A 1JUFA 4P2CG 5IEKA 2YD9A 3HZYB 4L9LC 1WGOA 3VD5A 5EBWB 1KBBA 4N0YH 2ZUQB 1WBXB 3LY6A 1L7TH 1H8OA 3RWHA 2F58H 3PHSA 3AXLB 2PXYA 3QQ3B 2VLLB 2HP4A 1LE5A 3MLYH 1NEZB 4E0RA 1LO4L 4XC1H 3TN0C 2WBGA 5EZJB 3U7BA 1W1YA 1G7MB 1FVCA 4LNRB 3EJJX 1GVIA 2XSBA 1TQBC 3QWQB 4EE9A 2GUOB 3OKMB 4LIQE 1U8JB 1KACB 3OKEB 4L5FL 3VXRD 1HKLL 1K9EA 5KEZA 1Q0YL 1XF4B 2GTZB 1FFQA 5EO9A 2V3DA 4R4NC 1TQCB 3T4YB 4Y2OA 1A6UH 1MVUB 1W72H 2R2HA 4ZDHB 1MWAH 5FFLA 3W28A 2P1YA 3DV4B 4HZAA 3MLUH 1YPZE 1FZMB 3DX2A 5FCZA 5D9OA 4XPBH 4S1DD 1P6FA 5IHZA 4P3CH 2HWZH 3MTRA 4KWUA 2ZSVB 3QHZH 4MVBD 1UZ8A 5I1AA 2HMIC 3T3MF 3PHQB 2JEQA 1DHKA 3AIUA 2XGIA 2DF3A 2X89A 3D0LB 2NW3A 4U1IA 5E00B 3RTQA 3RM8A 1Q1JH 4S11A 4H8HA 1RZJC 4XPBL 2EDXA 1R3IH 3RVTD 4MXVF 5CPSA 5GIRB 4GW4A 2V9TA 5EIIB 4AZCB 3BUYA 1P7QA 1BECA 4KQ4H 5EZOL 1S3KL 4DW2H 2G8ZA 5L7XH 4KGLA 5C0EA 3H54A 1KLUA 4GI8A 1NLDH 3A24A 5F89B 1EFXA 2V3FA 4YE4L 3L5XH 3SUTA 2WV3A 5IQ9B 1CVSC 1SYSB 5C08A 2XGBA 1BGGA 2A1WL 3P9LB 5E56A 2QQKH 5FF6A 1JNLH 4ZENA 2AJ3A 3IKKA 5IEHB 2XV6B 2A6KA 3UBXA 1AVAA 4CJ0A 1NLDL 1P1ZA 5HNNA 5I79A 5TDNA 5TJWK 3TH3T 3N04A 1Y6NR 4LHUG 3WDIA 4HC1L 4KK9C 4NQCB 4AYFA 3RM9A 5I1DB 1DBKL 3OB0H 3BDBA 5FGBA 4RAUB 1QHOA 4J8RA 3BGFC 1ZA3B 2P43B 3OX8A 3ARBD 1GQLA 1NGPH 4K71C 4OB5H 4XHQA 4B7LA 5HHQB 3PN8A 2BNQA 3LS4L 3WSQL 3OMZA 2H1PH 3Q1SL 5F9WC 2XIBA 2JKXA 1QLEH 5ACZA 5EWIL 1T0NB 4YDIH 3CO4A 4A2LA 1JBJA 3HI6H 4LPTA 4PJXE 1ZHKA 2QHAA 4JPWL 1C7TA 3WFHA 1TZIA 2CD0A 3U2SA 4NQEB 4CVZA 3W4RA 4N0RA 1RK1A 2H1PL 3RGVB 4P4KD 3EUUA 3LHPH 2Y5TB 1LEKB 1NCBH 4UQDA 1TTGA 4IIQB 4PJGF 3PNWA 4JO1H 1CG9A 4IRJC 3PGFH 2DDXA 4AISA 4YDIL 3FTGA 4UV4H 3MCKA 2VI0A 2D0HA 4HIHA 5CZXD 5A3IC 4NRRA 4G5ZH 4FNPA 3VPLA 1OLZA 3ESUF 3OPZL 1NOWA 3LEXA 2NCMA 5JUEH 2PBOA 4JO1L 3DBXB 4ONGH 1RZ7H 3BEWA 2CHNA 4U7SA 4LFHD 1ZXQA 3D3AA 2YOCA 4DOHE 2XN0A 4YHGA 1WC7B 1B88A 2BVQA 4YDKL 3DO7A 4MSWA 3O3EA 4HJGB 4JFHD 2CRZA 2H6PA 3PWPE 4G8IB 5E2VH 1Q72H 3RWIA 5DRWB 1LWRA 1XSIA 2XVGA 2EACA 2QKIA 4ZUUA 3SDYL 2HYMA 4PP1C 5J8OA 1T3FB 3GRWA 3DGGB 5GGRA 3SCMB 1JFHA 1X5JA 1FIEA 2EEDA 2R15A 3X3GH 5MERA 2XVKA 3IJ9A 2R4SH 3AJ7A 3HNVL 5IVZB 4BSVA 4CGTA 2FB4H 2C1OA 2DBLL 5I73C 3D9AH 4NO3A 1HH6A 1BQLH 3U4EA 2IALB 2FHBA 3N06B 2DMCA 4DWHA 3OKDB 4H8WL 1ZTXL 5IK3B 1R5WA 5AAWA 2WP3T 1S9XB 3GSNA 5F8QC 3TO2B 4L8BA 3I50L 2VH5H 1Q9WA 2V38A 5F9OL 3TNMB 3QCVL 3QEGL 3W9DB 4K2UL 4PS4L 3QAZC 4LPVA 2FSEB 1YYMH 1VFBB 2R0KH 1T21A 5IB2A 5EORH 3H6JA 4LKXB 3X3FL 3MV8B 4NT6A 5GGUB 1S9KC 2DPEA 2CR3A 3W26A 1D9KC 4M7JH 5C6PB 3WEXA 1UR9A 3GRWH 5ABDE 3NZ8A 1E56A 2WNWA 4DCQA 1T03L 2R39A 3GMQB 3VXOA 1KN2H 5KTEL 4UU9A 2PO6A 1MQPA 3QPXL 4I2XA 4KRMB 3STLA 4Z2IA 3SCMD 3QO0A 3AXIA 1U8KB 3BJLA 3SGJC 1B3ZA 4Z77B 3W2DL 3SCQA 3QNZA 4NZUH 4WTZG 2D3NA 5CZVH 2CDEB 5FYLH 2AVGA 12E8H 4Z7QE 1JZ6A 3VFOA 4KKAD 5E94B 3W0WA 1PG7W 5GZOD 2X09A 3OGVA 4PMNA 1GGYA 4HS3B 2E9BA 1Z0NA 1IKNA 1QLRB 1I8KA 3DROA 5IHUH 5A6MA 3LD8C 1BBJB 3OZ9H 1S9VB 4NQSA 2NY6B 1YMMA 3WBAA 1E6OH 1HQRB 1RJZA 3C8HA 3I02A 5BOPA 1XH1A 1P69B 3VGAB 1AD0B 2WCAA 2FWOA 3B9DA 3AU1A 1JZ5A 2AW2A 3GSNL 5I8KH 4KPHH 3S5LB 4G9DB 2GT9B 2VXVL 3MRJA 2X1PA 1EXUA 2K7QA 5T1MA 4IRSC 4YDJA 4UILH 3FN3A 2PCPA 3MV8D 3VA2C 3RWJB 3MLVL 1UZ6E 2EO1A 5HHNA 3KHQA 3O6LH 2ITCB 3TBSA 4J3XA 1V3JA 2AEPH 2VQUA 3KPLA 4JAMB 4OIIL 3WO4B 2F5BL 4K7FA 3DX4A 2H2PD 3FCTB 1OTUC 5I8OL 4EANA 4ODUA 2I27N 1U8IA 2CKSA 2AMGA 1KGWA 1FORL 3B3IB 3SJVA 2W60A 3MSGA 4DQOL 3D69B 2F19H 1A02N 1J05A 4U0RB 4OLYH 5MP6L 4RBPK 1FHGA 1NJ9A 5DHVB 3C9NA 4JPKH 5F21B 3A47A 3WUGA 4APQA 4CMMA 4UFIA 2Q8BH 3QB7C 2VQ1B 5FXCH 1DDHB 3WFZA 3R0MA 3DUSA 1K85A 5FO8B 3AUVA 2F7OA 3ARTA 7FABL 1LK3H 3MMWA 1MAKA 4Q22A 2YN3A 1OIMA 1LWHA 1U8HB 2NY6D 4JJ5B 3UP1A 4LYPA 1H3TA 3EO0A 4MNGA 3CFKB 3WDJA 3G6JB 2OJZL 5HHXL 1Q94B 5A2AA 1HJUA 1YQVH 2Q8BL 3CVHA 4I18A 4OZHB 2F53A 1HHGB 3QNXA 3WL9A 5J13B 4R97B 5LGKA 1F4WL 2BNQE 1A3LH 5INDB 3VWKC 1FE8H 2YZ1A 2JIEA 5J3HD 1VADA 4GBXB 4PBWD 1B3JA 3W53A 5D4YA 5E6IA 4QP0A 1WISA 1LO5A 2VTFA 1FNAA 2H41A 2X4OA 3LZFL 1FSKB 4BZ1L 4IOIA 1KFAH 1C8YA 4LGXA 4R4BB 3EYQC 5C0BE 3WS3A 5IG7A 1ORQA 4OIAA 3V52H 2XA3A 1MFBL 4LAQL 1ZA6B 2YPVH 4QFUA 4L4TE 2GY7B 3CHDA 2NLJB 4U1KA 4ZAKC 4ELKB 1JWUA 1SBSL 1N5YL 1RZKL 1UH2A 5GJSL 1KFAL 5F7KC 3BPNB 5SV4A 2WWKO 4NNXB 2CBIA 2OX5A 3L7EB 1RIVH 1FC1A 1KB5B 2OQJB 4DWSB 2PR4L 2PW1B 3CVHH 5ADPH 1DQJA 2R4RH 3CC5B 1B6DA 4DAGH 4DO6A 4CW1A 3C6SA 1N6UA 2JE8A 3S7GA 1AJ7H 4HWNA 3EOBA 6FABH 1AGFA 2OCFD 5K9JH 2EDTA 5EU6B 1A6ZB 4JY5L 4XC3H 1UWEL 3DV6B 3P11H 1GOMA 4KVNH 3WS6C 4OZIE 5D1XB 1U91B 1EQCA 1HXMA 1TVDA 4PJBA 4GFTB 2BVPB 2CLRB 4GBXD 4ORGB 3O0RH 4X7SH 5LXGH 2XJ7A 4WFHE 2CERA 3VH8G 1XGYH 3IFNH 3ARGA 5JOPE 4PGCB 2E8YA 3PXHA 1EA9C 2JLLA 5BS0A 3GXFA 2EQDA 4PMZA 3N13A 4LHJB 3VFMA 3MUGB 5I2IA 4FQCH 4FP8H 3WBEA 3A3HA 4K23L 5FHBH 3TTQA 4JM4H 1UM5L 2X4RB 3NIFF 2F1AA 3CK0L 1W1TA 4AD4A 5FYLE 3L2LA 1U92B 4JZJB 3UEZA 3SO3C 4MNLA 4MB1A 3TT1L 3QBTB 3S35X 3JVGA 2ZZUT 3QEQE 4PJDF 4DWSD 1ZJAA 1JAKA 1CIDA 5JO5A 3UCQA 1HJWA 5FO9B 1KSRA 1BFVL 3PL6A 3TH2T 3CUGA 2BNRD 4OQ1A 3I9GH 2GIYA 1FIGL 5CSUA 3HUJB 4PJHB 5EU6D 1JGDA 1DN0B 1RUQH 2YRLA 5E2JA 5BW7C 4GIAA 3NTCL 3AIVA 1WUNT 5D1XD 5MEQA 1IGYA 1KTCA 2YSSB 3RO8A 1UH4A 4JRYE 1LEIA 1T83A 3MFGB 4X9BA 3IFPA 4YZFE 4XH2A 5JW4M 4D6EA 1P4LB 4NN5B 5D96B 3M07A 3MRLA 5BXRA 4YHPA 4AIZB 4BSWA 1RUQL 3BN9C 3QWOA 3E3QE 3QIWC 1XGUB 1NFIA 4R90L 1NQ6A 3QQ4B 2J7EA 2VZ3A 1BSIA 2DIAA 1F90L 3MRPA 1MVYA 5D9PA 1BFOA 5DQ9B 4W86A 3RJDA 1IT9H 1RZGA 2MKWA 3CPLA 4AMKL 1OF2A 1HHJA 2D2OA 5T1KB 3CJJA 5T5NF 5FYJH 2KKQA 1YQ2A 5HGGS 1DWJM 1E4MM 4BA8A 2NTSP 4JVUA 4P46A 5CD5C 1UKQA 1S7SA 3V5KA 2YUWA 3VRJA 2JIXA 1FFPB 4R96B 3KYMA 1CFTA 3O6FC 5DJAB 1R6VA 3HE6D 2IAND 2XT1B 1C90A 3LN4A 2CH8A 3I6LE 3HAEG 4P3DA 4ZFGH 3QZWG 4TNVF 1RURL 1ZS8A 1WBYA 1KJVA 2YMXL 3KWXA 1OD7A 1LL7A 1ND0B 3B2UC 3MMDA 3L3HB 2P24B 3FT4B 3RQ3A 5C0AB 3T4AA 1GPFA 3SJVE 5AD0A 5E5MA 4GRLA 4MB5A 3EJQA 1Q8MA 2AJVH 3A6BL 3FHAA 4XVSH 3LMJH 2JALA 1FDLH 2OM5A 3H9YA 4J1UA 5C0RH 2ICES 3NZHL 2PXYC 2XTLA 4HOZA 5GGTL 3F6IA 5JDSB 3TZVA 1G1CA 3NPZB 1T1YB 5F7EH 1F4YH 1E6RA 3FO9B 4RGOH 4MD0A 4GS7C 4LP4A 1KV3A 4WCYH 3MQIA 4GRMB 3T09A 4ZXBB 3MRRB 3QYCA 4XP6L 5CHNB 3CGTA 5FKAB 5KG9B 3QUXA 4W7UA 4NWTL 2NXZB 5D8JH 2O5ZL 5T1KD 4MNGE 3PZ9A 5I2UA 1XGRA 4OZ4A 1BVNP 3A67L 5JQ6H 2F53E 3RX5A 4ZFFB 1WAAF 5D7IE 1T1ZA 5FV1L 1FH5L 4RGOL 1GUVA 4JPVH 3FJTA 2HJLA 1NCAL 4HH9B 4QHLA 4P7NA 4JLRB 3EO1A 5DT1H 1GOKA 4R4FL 3BC9A 2IH3B 4U1NB 4FNRA 5GNXA 4POZD 3BCFA 1PX3A 3SKMA 2C4FU 3CHFA 3RTQC 2UWEB 5C0AD 4EK7A 2HFFB 3D5HA 5JUVA 2AAAA 1MNUH 3MRNB 3W38A 4LP5A 3MSDA 5KVGH 3L5WB 3KPOB 4EUPG 2UYLB 5JZ7C 1HXYB 1ZL1A 2PUQT 1TVHA 5H35A 3BQUB 3BHBA 4KK8D 4U3XA 2X1OA 1WZMA 3AMDA 4BKLB 1A7NL 4QRUA 4KJYA 4TQEL 1V02A 4AD5A 3B4NA 3HB3D 5D7LB 1V03A 4ZXBD 1AC0A 3CVIH 3I3BA 3QJHA 1T2QH 3JV4B 4TUOA 5KAQG 1HHIA 3L3IA 1Q6FA 1HWHB 3V4PL 3HI1B 2R1WA 4PJAF 1KXTA 2ADFH 4PJFB 5IQ7H 5TPWH 4HJ0D 2C7UB 4PB0H 3O2DL 5IJVB 1W2VA 1Q9OB 5DZOA 2DT3A 2C9AA 2X9XA 1S46A 4FQJH 1SVCP 4C57C 4DVRH 3GI8H 2NY4B 3CFJB 1MI5A 4LL9A 1JVKA 3CLFL 1U41A 3O2LA 1TQTA 1OCQA 3ZJ8A 4GAGL 2PWEA 1FVEA 4C83A 3UR8A 3FAWA 1M7IA 5TPWL 4ZUVA 1I8IB 4EDXA 4XBEL 1J10A 1BFNA 2C1PA 2HTKC 4PLJC 4UR9A 3CZJA 3L3KB 4DVRL 2FEDD 4NNYA 2NX5B 5GGSA 4HAFA 2GVYA 2DQGL 4D94A 4KTYA 4QHUB 5EUOE 5E8EB 4RWHA 4NRXA 1A6WL 1JN6A 3BQUD 1F58H 3LEVH 2CGRL 3EJZC 1ZHLB 4ODHH 5FAAA 5E0FA 2ZX7A 3CH1A 4U6TA 5D7LD 2MPAL 5IHRA 4K07A 3WY2A 2IEPA 4TUKL 4D6IA 4H8WC 4BQCA 2VC2H 4RNRB 5E03A 5A6LA 4X6DB 4OF5A 4QTHA 1JP5A 5I15L 1P7KB 1UACL 2Z9TA 3UBXG 3VIFA 1KT2B 1I3RB 4D6HA 4JFQB 4Z7WA 3ULVL 4U1JB 3O3AB 2IBZY 4YDVB 5IIEA 3BCDA 3GBMH 3OTTA 4R6UA 4DZ8B 2NY4D 3PWLB 2PI6A 2Z8VC 4PMRA 3ECBB 2X6MA 4YX2H 3VOCA 1H15A 4X4YB 3BKYH 2FO4B 3QFDB 2DJ4A 1KENL 1I9JL 1SJXA 2HKFH 5F7DA 4F15C 3H9SE 4Z7VB 4KTEH 4C56B 4A6YA 2NX5D 3G6DH 2ZOLA 4YX2L 3LRHA 5FYJU 3RWCB 1NBYA 3WUZA 5DJYB 4MXWH 1T04B 3OGRA 5FOBA 5DJCB 3QHFH 4FZEH 3FL7A 2OL3A 3MNVB 3KXFB 4JKLA 3VFWA 3MGOA 4X7FC 4RGNB 2UUDK 1QSEB 4Z0BH 1XR9A 3M17A 4N0FA 3K4AA 4D9QD 1A0QL 4JO2L 1CDYA 3P73B 2HLFD 2V5DA 4W68A 4TPRH 1X5IA 4FQXA 1B0RA 1YEFH 2P8PB 2WMGA 3T2PA 4JFFE 3JTTA 3TWCH 4NFDA 4AG4H 2GJZA 1A8JH 3UTQB 1JZ3A 4URIA 4EKJA 1RZIA 4HA4A 2P49B 1M7DB 4OZGA 4XAKE 2FHCA 2HAZA 1RPQA 1YEEH 5FKPA 5HHPB 4HPGA 1CTOA 3O2VL 5CPTA 3CDCA 1ZE3C 1UWQA 3QEUA 2CKBB 4GRWB 4A6YH 1MW1A 1R7OA 1MCJA 1S9YA 2BSED 1P9MA 3SGKA 2NZIA 3E2HB 2N1KA 1A9EB 4EKXA 2CIIB 3DO3A 3RAJL 5M95B 3IS0X 4NKQB 4C56D 2OL3H 5IT2L 2XZCL 1WT5A 4H8UA 4WJ5B 4NQDE 1XGPB 4PGBB 1QNZL 3SEPA 1E4XI 2EICA 2P5WD 3KLAA 4LNVA 5KSAB 2WNGA 4WK9A 4L4VA 4JB9H 3MJ9A 1XCTA 5GISL 2CITA 3VE0B 2AJXH 2WQRA 2E0PA 5A2BA 3AMGA 1OAKH 5JLZA 5CFHA 1CDBA 1FFNA 1UGNA 4KTDL 1E27A 3GTNA 3LIZL 2R0LL 4RGND 5CEXB 4HZ7A 4RFEA 7TAAA 1QSED 5HYSA 2G5RA 5I0ZA 1IKNC 2VDQH 4JB9L 5H8DA 2EDWA 1D6VH 5BJTA 4IJ3C 2WAHA 5F1NB 2C0HA 4OD2A 4GAYA 4F7EB 2DGAA 4XNUL 3ZTJH 2G9HB 5IFTA 1A9BA 1VJSA 1HSAA 2PKDA 4ML4A 4BUGA 3EJPA 4ZNEE 5A8QA 5L0QB 3S97C 3PABA 2X2YA 4R7DA 5A8NA 3OLIA 2K3TA 2NY3C 3P0YL 2GJJA 1S8DB 4JFYB 3PDDA 3SQOH 3HR5A 1U8MB 3T1FA 4OCRL 3MJ9H 4OLZH 2IAMC 5IBUB 5HVWA 4UNVA 1G7LB 1V02E 3BPOC 1BAFH 4CUCA 3HZMA 4TTUA 3AREB 3H7BB 2VN7A 5KSAD 3C60B 5J1TC 1RZKC 5J6HB 4NP4L 3FONA 2ZUSA 3H3PH 3PIQB 3UEQA 3TJHD 4AZ6A 1JYWA 1T2JA 5FCUL 3EOYG 3F7VB 4APQC 2FECL 1GVYA 2WKGA 4M1DH 1MLCB 1BAFL 2KQMA 3RWDA 4X0KB 1YDPB 1DQMH 4TVPH 4YN5A 3GMOA 2DQHH 4UMGA 1MI5E 3V0VB 1CR9H 5IB4B 1N8ZB 5J56B 3M8OL 2IADA 4TXEA 5K59F 2V2WB 3V0WL 5CBEB 1QEWA 3CAFA 1BZ7B 3V5DA 3GK8H 1E72M 2ICEB 1MCOL 4KMTH 1H5BB 4I18C 3LKQB 5DEZA 3SOBL 1QOXA 2X44D 3DVNA 3MACL 1A21A 4Y2DB 2V5SA 4HUWB 3DPBA 2XKSA 1QFWL 2AK1H 3LB6C 4U6YB 3HR6A 5EBWA 1VB9A 2NXYC 4J7RA 4MA8H 3GBEA 5DTFB 1SY6L 5E6IC 3SO5A 1WBXA 4PJIF 3UC0L 3ZL4H 4ZPVA 2HFGH 5GQBA 1IAMA 2VLLA 3UJJL 3K3QA 4Q0XL 3ARED 3RWFB 3FZUC 2P5EB 1EZVY 2WIMA 3C60D 2O61A 3GSXB 3BLBA 1G7MA 3TV3H 5E2UL 4NN6C 1OGSA 4JN2B 1H8NA 1FAIH 2GUOA 1A7QL 4Q2ZB 3BVTA 1U8JA 1KGCE 2SEBB 3OKEA 4AEEA 4JJHA 3VFPB 1MCKA 2DTMH 1TA3B 4Z7WE 1XF4A 2GTZA 1G5AA 1T22A 3EJSA 3RI5F 1Z9OA 4KUCD 1DQTA 2V6HA 3H42L 5BOZG 3NSXA 3DVGB 4ZDHA 3TV3L 5E08L 4NDMB 5EBGA 3DV4A 1KBKA 5I30H 1FZMA 1FBIH 5DHYA 1TQWA 5E1QA 1PW3A 3MCLH 3F58L 3W82A 4HULB 2DTML 2ZSVA 3O9WB 1XD1A 4HJJL 4M82A 1DBMH 3PHQA 4Y2DD 1GOQA 3CZSA 1PYWB 2HFTA 3D0LA 4U3CA 5ECJE 3BSZH 5E00A 2OSYA 4PMUA 4XWGL 1R5VB 1NGYB 5EUKB 25C8H 3HFMH 3ARBA 2HKHH 1IEBB 3WFDL 2K7PA 3BH8A 4N8CL 4R0LA 5I30L 1B1YA 1NCDL 3FMGH 2CNCA 2X41A 1R3HA 4WFFD 3SDAB 4FNQA 3ARGC 5EFFA 5EIIA 4AZCA 4Z7QF 1L0XA 5SWSE 1XCQB 3HTLX 1CN4A 3L4XA 3FO1B 1FO0B 3LKRB 1MSPA 2P5ED 2AK4E 1P5UA 2BX5A 3U7YL 4NQXB 5F89A 4LCUB 4NQVB 3ES6B 2DAVA 1TJHL 4KHTL 3ZKMC 4U1SB 1KIUA 1QFUL 1SYSA 1FJ1B 4U3AA 5EN2A 4FXGB 3P9LA 3NCMA 2XTJE 1R3KB 4P4KA 3ARSA 1XAUA 3HA0A 2JJUA 4JFXB 4BZ2H 5B3NA 5IEHA 3RIAF 3JVGC 4WSKA 5T3XH 4JDZB 3VGFA 4WF7A 2OTUA 2OYKA 3UROR 4MPKA 3PL6C 1KPVB 4PSPA 1S7UB 3ZE0E 2WBJA 3JWDH 2B1AH 4BYHA 4J3UA 4NOBA 3DX7B 5C92A 3SE9H 2F2HA 2R9HD 1A14H 4AD0A 4LSSH 1IQDB 3O9WD 2ICWA 3B2VH 4U0QB 4RAUA 2CIKB 2E9JA 4UDTB 1TPXC 2ZG2A 1BWWA 1UB6B 3RX7A 4RMUA 1M05B 2PWFA 2IPTH 3RI5K 2X40A 1T83C 5A2FA 5HHQA 1X5FA 3P30H 3WN5B 4QHMB 4HUUA 4LSSL 2J5LC 3B2VL 1OWRM 5EBAA 2DM4A 4W8AA 4C59B 1YECH 1T0NA 3MUHL 4C55A 1Q9LB 3FFDB 1AXSB 4ORZC 2QSCL 5J9PB 4HUNB 1KCVH 4I0PB 1A1OB 2EDYA 1CLYH 4Y16B 3PF2A 2Y1VA 1UZ4A 4M5YH 1B9ZA 2RAMA 2HT2C 4TVPE 2Y5TA 1LEKA 1BVZA 1FL3B 1N2RA 6TAAA 4IIQA 3SDCC 2CKNA 3BLPX 2D7PA 3DYPA 3NPSC 2R1YB 1MF2L 5F7LB 3LH2L 2XSAA 4J27A 1E1EA 3JUZA 2YR3A 5SX4I 1CXLA 4XVUD 1TZ7A 1ZLSL 5ABGA 1W8OA 3GO1L 1U58B 4RQQB 2XM2A 1F4HA 3U9PH 2VE6A 4TVUA 1ZT1B 3DTXB 1UD8A 3LMYA 2AJSH 4BF7A 4DGVH 2YUXA 4N0UB 1WC7A 1AI1L 1NAMB 3OB0K 3DURB 4K3JL 4WHCA 5HGBB 5J1AB 2ZOKB 4HJGA 3HRZB 3M45A 3RIAK 1X5KA 4GRLC 2EJ1A 1CNVA 2F54B 5DRWA 1MRDH 1HKKA 5IBLD 2YS4A 3FN0H 4ELMF 1G6VK 5E5UB 1T3FA 3DGGA 1Y6MR 5JXAH 2NY1B 2XIDA 3Q0HA 1R0AH 1QFOA 3TZVC 2VDOH 4MA3B 4QCIA 1CGTA 2BOCA 1KFWA 3AHZA 1UD3A 4N1HB 1Z9LA 4F57L 1DWFM 2BFVH 4Y16D 1R33A 3QUXC 5EZIH 4YBHA 2IALA 5FUZL 5D70L 3C08H 4RE3A 1DZBA 4XXDA 3OKDA 5E2WH 5HDLA 5IK3A 2ADJB 3GSUB 1S9XA 5IMMB 2BP3A 3ZR6A 4ZTOH 3D39B 2ERJC 3WXVL 4L8SB 5D2LB 3EAKA 3VWJB 2FSEA 4UFMA 4NQUA 7A3HA 1I1RA 2JB5L 4MHHG 4NZDA 3RNKB 1OAYL 1RVFH 1L9MA 1A7BA 1CE1L 2QL1A 5DQJA 5DVOA 5GGUA 1CZ1A 1UYWL 1FYTB 3GHBL 1QBBA 3DC0A 1KEMH 2KZ1B 2VT0A 1F8TH 1JGUL 4PTVA 4AMCA 1BVLB 4X9HA 4PFEA 3GMQA 4OLVL 4LCIL 1JPTH 5C0JB 5GGVH 3HG4A 4HS6B 1RVFL 4EI5B 3HMXL 3GB7B 4HMCA 4NM8L 2GDUA 3SUVA 2NY1D 2V7HA 1MHEB 1U8KA 3IGAA 4PMYA 1FL6A 4S2SB 5FYKE 4Z77A 4PBVC 3PWUA 3OLDA 3UAJC 3EMCA 4JGJA 3CH9A 1F8TL 1BM3H 4HHAB 3U0PB 5IOPB 3OKOB 2CDEA 1DFBH 3ARVA 1IJ9A 1I8LA 3DJ9A 1KCUH 2DQDL 1FG9C 2X4NB 4RMTA 4W5UA 1QLRA 5T3XE 1DVFB 5TE6H 2J4WH 1X5GA 4TTDC 3ULVC 1PQZB 1A1NB 5BO1H 2IH1A 1CU4H 4GG6F 3PBGA 3W11D 3N9GH 1S78D 4XI5C 1AD0A 3D39D 5EZLB 1JDDA 1YEJL 4PRWA 3DXAB 3S5LA 4BH8B 4LVNB 3QUZC 2GT9A 2CBUA 3HNTH 1Y0LB 1D2KA 4LVOC 1H8SA 5EO1A 1C92A 3SCUA 3U6RB 1J86A 1KJMB 1VIWA 3ZOAA 3CUJA 3UJIL 1QI5A 1J0JA 1FYTD 4U1GB 4WEMB 5HVHC 5D72L 4JAMA 1SR0A 2UZYB 3O4OC 1IGJB 4OGYH 3QISA 5EU7C 3DI2B 4ODTL 4RFNC 1YY9C 4MNQB 4HGWB 3B3IA 4EI5D 3D69A 4S0TD 1WO2A 1IM9D 2IJ0C 3GZKA 2E27L 2OYPA 1WEJH 1B3XA 3OB8A 2CBJA 5IFHH 3WQVA 5D7JB 3DMMD 4ZTPH 4M80A 1T1WB 1FH7A 3L95B 2VQ1A 1H49A 1DDHA 1RUPL 5IWLA 1DVFD 1RUAH 4YNYB 5F71A 3V2AR 7CGTA 3H0TB 2DSZA 2YLLA 4JJ5A 4J3WA 1MY5A 4YK4B 3CFKA 2C3XA 3G6JA 2WMPA 4L8DB 1Q94A 4OZHA 2YK1L 3MUAA 1HHGA 3DXAD 3K2UL 4HXAH 4WHYH 5INDA 5BXFB 4HTYA 1RV6X 4ZD3H 4MLIA 4P59H 1UM4H 4GBXA 5DDHB 5F1OB 5TD4A 1IGFL 4R8WL 1U8LB 2NW0A 2NY0B 1IC7L 2BY2A 1ZT4A 4ZUSB 2VLJE 4XCFL 3LV3A 2GJ6B 5I66B 4R4BA 1DL7H 3AS1A 4L29B 2EYSA 4MNQD 4QHKJ 4ZD3L 1ZA6A 4GG8A 2O5XL 3WIIL 2EE6A 3VFNB 3TO4B 5L88H 2EABA 2NLJA 4E8DA 1NCNA 3LPWA 3P9MB 3EHBD 4OZFB 3P0VH 5HGAB 4HFUL 4QCFA 4C7GA 3VXSB 4XZWA 3BVVA 2G4FA 1IC1A 4JG0H 1A3QA 4NNXA 4Y4KC 3L7EA 4PRHE 1CBGA 4DWSA 2GJPA 3ALGA 2PW1A 2Y36H 1W0WB 1IEHA 3CC5A 4FQXC 2R69L 4BQ3A 3BVUA 5BROA 1XD0A 1WWBX 2BNRA 3U36B 1S9WB 1BGXH 4F8TA 2XICA 3NFSL 1MCLA 5EU6A 1A6ZA 1QTYT 3DV6A 3ET9F 1ORSB 3L3DB 5EC2A 3G04B 4TUFA 4M7KL 5D1XA 2XFRA 1CL7H 4ETYA 3W24A 1U91A 2J47A 4HEME 3C5JB 1M04A 1FZJB 5ISZA 4Z78A 2BVPA 2CLRA 1NBVH 3GMRA 3IFLL 4KK5D 4YLQT 4HXBH 1E6JH 4RISH 3FHQA 2NY0D 3QXDB 2LQRA 3CXDL 1MQKH 2P44B 2AAVA 3SGKC 1ZK9A 4WEBH 1M03A 4OV6F 1Q0XH 4PGCA 4RCAA 3O4LB 2GJ6D 2C26A 3PWJA 1RJYB 4NBZB 3HRPA 3GKWH 3BUQA 5L2JB 1WT5C 2XQYG 2OP4H 3MA9H 5AZ2L 3S5ZA 3VFVB 4P8UA 3MUGA 1NGWB 4M61A 1TJGH 1NBVL 3TO4D 5KVDL 1TZGL 2FGLA 1AO7B 1E6JL 1E40A 4R9HA 3WKML 4LF3B 1J01A 4KJQC 4PJBF 1CIUA 8CGTA 2X4RA 3QUYA 1KJ2L 2A9NH 1Q0XL 1U92A 3KLSA 3VXSD 2DEPA 4W7WA 3AB0C 3MREB 4AY0A 4GI6A 2UZIL 4WGVB 4P7RA 1ES0B 5HVGB 4D6JA 3ZHKA 4YIQB 1QBAA 3ZDYE 5GRVL 5IW3A 3WNKA 3DETC 5AC5A 1CECA 1KB5L 3HE6A 2IANA 3THDA 5C2UB 4IEFB 3HUJA 4LBEB 4PJHA 5HJ3B 1Y7VA 3KPQB 4PJCE 1EJ6A 1EAPB 2DQIL 4B53A 3LKSB 2YSSA 3G5XB 4KRNA 2LAAA 3ZTJG 5ID1B 2DIEA 1PLGL 1JI1A 3AM8A 3ROLB 2XFFA 3EYFA 5SV3A 2FDMA 4AIZA 3DX9B 3O4LD 3QIUB 4XMKH 1XGUA 3QA3A 5EU5A 3HJEA 4PTWA 2QR0B 1H0DB 5MI0B 4MDOA 3TT3H 5FGCB 1T0OA 5CIPB 4WI7A 4M1GH 1AO7D 4AEIH 3BH9A 1A3HA 2V17H 3AHYA 2OW7A 4LEXH 3RBSA 2E4TA 1DQDH 1INQB 2A6DB 5GJTH 4UZSA 1UCBH 4E2OA 5EOTB 5DEGB 5T1KA 3VRLF 1TQBB 1BVKB 2FATL 3KDMB 3PTKA 2RB8A 2JJSA 4LOUD 1EBPA 1A64A 3RRQA 5HYSG 3UR7A 3O41B 1FFPA 5LGHH 1AGEB 1UQSB 5T1DH 4OM1L 3VXTB 2V17L 5J06A 1IBGH 4LHUB 1F4XH 3CHEA 4S1DC 4MTVA 1RUKH 3WD2A 1CFQB 4MVBC 3LN9A 1KJ3H 4KAQL 4YC2B 4UOW1 4G8GB 4YEFA 5IFJA 1ND0A 1I1CA 1I3GL 3L3HA 2EPOA 3EOAB 5C0AA 5C07B 4YXLL 1LVEA 1BZ9A 4K8RH 3PG2A 4M8VA 1XR8B 3GIZL 3SCTA 2W0FB 3NCBB 1HILB 3RVTC 1QR4A 3IKCA 3V6BR 3U5UA 3G6AB 3QIUD 4M4PA 3BP4B 4JY4A 1KJ3L 3BD4A 2F8OA 1UYQA 3P40A 3N1QC 1N0XL 1AMYA 1AD9B 3CSGA 5JDSA 5LA0A 1R86A 4P2QE 1CPUA 4AZIA 4NO5B 2AV1B 1T1YA 5FOOA 2CO7B 3FO9A 4HWBL 5ESQB 3REVA 4ZXBA 3MRRA 3OKKB 5CHNA 1UCTA 5F7FA 5KG9A 4FQ1L 4FABH 2ZUWA 3V8OA 3TCLB 2X2IA 4UT6H 4XV0A 5KW9L 2AGJH 3VCLA 5L6YL 1TQCC 4ZFFA 3AIWA 5FV2A 1GC1H 4K68A 5TE4L 4C7FA 1EEZB 1V7MH 4OFYD 3EGSA 4WI6A 2GK2A 1AXTL 4LHUD 3RGHA 1G0XA 1G0DA 2ENYA 4JLRA 2ZE0A 4QHNB 1QI2A 1MOEA 1U8OB 2IH3A 4UT6L 5JIIA 2AGJL 4PYHA 5HPMB 3RDTD 3VJ6B 4ZFOL 1G0YR 5LJYH 4CCEA 3NBNA 3JWDC 1V05A 3QFJE 3V7AE 4OI7A 3ARBC 5C07D 4R0LC 2Q8AH 3HC4L 3BGFB 5FUCE 1G84A 3MRNA 3RWGB 3KPRD 4NIKB 1I9RL 5CINH 4DTGL 1PZ3A 3L5WA 1UR8A 3KPOA 2XPGB 3EZ8A 3DYMA 2UYLA 1HXYA 1ZOXA 4PJ9B 4UQCA 2JK5B 2BCKA 1YEHH 4MDIB 3BQUA 5BRQA 1V08A 3JSSA 4D1JA 3MCG1 1BG9A 5K93A 3THCA 5D7LA 4D8PB 3CZFA 4XAWH 1W8NA 2RFXB 2BNRE 4KV5F 4P4KC 3JV4A 1NFDB 1YEGL 2DLFL 1JYXA 3HI1A 1DQLH 1WZ1L 5F6HI 5CZXC 2PTTA 2C7UA 4Q58C 2W0KA 3LDBB 5IJVA 5LVEA 3BMWA 5ISZE 5E7BA 5HTSA 3N15A 3FO2B 3P77B 5C8BB 2XZAH 1MJ7L 3T3PE 3CFJA 3FY1A 5F9JB 3FRUB 5EB9A 1ZMYA 3V6ZB 2GFBB 2R29L 1FH8A 2J77A 5E09A 1WAWA 1DLFL 2P46B 5KZCD 1I8IA 3OR6B 3ULVF 3SCOA 2XN2A 4TX6A 3L3KA 2HJKB 3GMPA 4J3SA 2X4TA 3LQZB 4MJIE 5F3BB 4JO4L 5AYQA 3EFFB 3UG5A 4XMLL 4QHUA 1SEQL 4PJ9D 5E8EA 4HUMB 4P2YA 2P8LB 1YEKH 4LLWB 3PQYA 5BYWA 3S3JA 1ZHLA 1QW8A 3LRKA 3ZTNL 4KDVA 4LASL 1JK8B 1G9MH 3T77B 3IXAB 1S7XB 3E8UH 4GKSB 1XC6A 2IANE 4OLEA 3B43A 3RGVC 1A5FH 1U3ZA 2J88H 4OTXL 3KYOB 4XVTH 3TNNA 3TP4A 4UNTA 3OL2A 4IIQC 4QTIH 3CLEH 3OXRA 3TLRA 3PP4L 2G41A 1HIMH 4UQ9A 1KT2A 3BRDA 4ODXB 1I3RA 4XPAH 4JE4B 5J0BA 1PKQB 3BVXA 3OIHA 4MNJA 4YHKL 3O3AA 5D7SH 1G7HB 1MIML 4YDVA 4OV5B 4Z7NE 3BYTA 4DKAA 3PWLA 3PZOA 5IM7B 1ISXA 3ECBA 4BUHA 2QADB 1HXJA 1MHCB 4QO1A 2BERA 2G60H 3QCTH 2F61A 2FYVA 3ETBF 4AZ7A 3IU4L 4GMTH 1KXQA 2J25A 2Y6SD 1I3VA 3D52A 3P4OA 4X4XB 2V9RA 4Z7VA 1D9KB 4C56A 2YL8A 3WFCL 1K8DB 1PZUB 5H94B 4GQ9H 2CESA 4DKEH 1R3JA 1CK0L 2P5WA 5E99L 2DQCH 3RWCA 5JIHA 5DJYA 5FUOL 1CF8H 3SCMC 1T04A 3RL2B 1GZPA 5DJCA 1GYAA 4GMTL 3WUFA 5I1EH 1H2JA 4Z7UA 1MCPL 1GAFL 5A43C 3R8BB 2WIIA 1KEGH 1UKTA 3VNYA 2RHEA 2DS4A 4WUUB 4I4WB 2Z8SA 3TPUB 4GQRA 2OSXA 1QSEA 1N0LA 4KKAC 1KC5H 5GZOC 3P73A 4NFBA 4PY8I 2P8PA 3FW6A 2VXSL 2P7TB 5BXTA 1OPGL 4KFZC 3UTQA 3MRKB 3WHE1 3HPLB 4WO4B 1A6PA 2YXMA 3QDJB 1M7DA 3WLBB 4DUVA 4NNPL 2OMBA 1OGAD 4MAUL 2EH7H 3WF0A 5HHPA 3O6KL 2QADD 3AIQA 1OSPH 4G7YL 5CD3B 3C8KB 4JQIH 5DJ0B 4PJ7B 2CDFB 4J3VA 1CLVA 2JJWA 2D03L 4KKCD 2GITB 4Y88A 2EPMX 4YAQB 3TGXA 3F6LA 2R8SH 1A9EA 3TH4T 3HZKB 2FJGB 4K3GA 2EXWD 4YXHH 4OFKA 4OCYH 2H2PC 3UO1L 1FRGH 4C58B 1XGPA 5A69A 1OGTA 4QRSA 4NGHL 4OZGF 1MEXH 5KSAA 4JQIL 1NL0L 1UHVA 5IGXL 1CGSL 3BD5A 4YXHL 4OJFH 2EDJA 5I19H 2IPKA 4YHYB 1FRGL 4WUUD 1I8LC 4YFEA 1AHWB 2V2XB 3II1A 3FKUS 2BNUB 5H2BB 2OMNA 3NDZA 2DQEH 5F1NA 3MRQA 1JZ8A 1TCMA 2NY6C 4AL8L 4PRNB 2Y07L 2G9HA 3D1MC 3OR7B 1VGKA 3ULSB 3CSYB 3VGAC 4WO4D 2CHOA 2BHYA 2XTKA 5C6WH 3L5IA 5JNYA 1U3JA 5A2LH 4QLLA 2BMKA 2MOVA 4YQXH 1OWQA 4O58H 1OAQH 2YHGA 3PP3H 1A47A 5I1IH 4AM0B 3GSWA 4HV8A 5J3HC 4ZO9A 43C9B 2WVVB 1S8DA 4JFYA 1EXPA 4N42A 2CMRL 1U8MA 1AY1L 2ZX8A 2CKBL 2XQYK 3GFUA 1IGIH 1YPZB 3WO4C 3VH8B 1AQMA 1HI6B 4TOYH 3T0EB 5CLWA 2B4CH 2FYYB 3AREA 3H7BA 4HG4J 3C60A 4ZUWB 5I1CL 3CHCA 4WENB 5JIPA 3N85H 4U0RC 3QUKB 5J6HA 1INEL 3AOFA 1B4JL 4QT5A 4X83A 4KUZL 2V3GA 3PIQA 3MV7E 2DL2A 4TSAL 4ZAKB 1J9YA 1MLCA 2C3WA 2ARWA 4X0KA 1YDPA 5GRUL 4HOWA 4KXZH 5IWLC 2I26N 1KIPB 1N8ZA 3IK2A 1MRFL 4IMKA 5CBEA 3JV6B 1JMXA 2VSDA 2ICEA 3LKQA 5A8OA 3F4VA 5J13C 4R97C 4Y2DA 4AC1X 4NFCA 2QSQA 3HG2A 4HUWA 3FXYA 3S5LG 4YUEL 1VACA 5ERWB 4HT1H 4GBXC 3MJGX 1GHFH 1Z0MA 2UVEA 5SWQA 5DTFA 2CLVB 1W9UA 2QMJA 3PQYE 3INUL 4D3CL 2ZNWA 4KJPD 4WHYG 4XNXH 1FSKC 1ED3A 2HH0L 3BAEL 2E3ZA 3T0ED 2VCCA 4B15A 3BRGC 1GPOH 2P5EA 1QA9B 4PRDA 5CSZB 1NC4D 4MD4A 3GSXA 1SYVB 1P4BL 2WSPA 2DQTH 4PG2C 4PTMA 1HINL 4JR9L 1N3NB 4JN2A 4NQTA 3RA7H 5DRNB 4K3DH 4NCC2 4GXVH 2SEBA 4Z2JA 4NJ9H 3BPNC 1UA6L 2A3AA 1MFCL 3MRGA 4PYSA 5LYRA 5BXPA 2BY0A 3PHAA 4DWSC 3BPLB 3TYFA 2VITB 2VAJA 4MAYB 4PJXB 2X4UA 1FN4B 4N8VB 4RMVA 3X12B 3TJEH 4JO3H 5BRPA 5DD6B 1AGCB 2VR5A 2CUMA 3HAEB 3O9WA 5E5RB 1D7FA 3QZWB 5DUBA 2QJDA 1YYLH 3C09B 5D1XC 1L0YA 2WMIB 1NGYA 4F3FB 5EUKA 4JHWH 2W0PA 5KOVC 1IEBA 1D5IL 1S5HB 2P5WE 2XVNA 4NZTH 1RD6A 3BAWA 4GT7A 4B3LA 1UB5B 2FBJL 4Z7UE 5DR5L 3KS0H 3STZB 3LEYH 1XCQA 4OIBA 1S7QB 4F9JA 3LKRA 1CS6A 3T8XA 3QIWB 4G6KL 4U6VL 4DOHB 4NQXA 3MROA 5D9SA 2DDQL 1RZFL 4B9YA 3N17A 3T0BA 4U1SA 4CD6A 3PWPB 4AZ5A 1IZKA 1J5OH 4JZJC 4R2GD 5DMIL 1A2YB 2B1HH 3BDXA 1RH9A 4JFXA 3N1AA 3MLSL 1PBYA 2W4XA 3EDKA 1SBBA 4PGDB 2IFFL 1MUJB 4JDZA 5C7XH 4HD9A 1I1FA 3BGAA 3B6SB 3MRDB 5FHAL 1S7UA 4MAYD 1B4RA 3BW9B 2HVMA 3HE6C 4S3KA 1EHXA 5DHXB 3T0DA 4KMQA 5DWUH 4G80A 3QT2A 3VXMA 1IQDA 2GK0B 3G6LA 3VIOA 5B8CB 3Q3GB 2BJMH 1MFAL 3EBAA 4HKXA 4LSPH 1LK2A 5JW5B 3RCNA 4PGJA 3RHWF 2X10A 5CILH 1MWAB 1UB6A 3ALPA 4JKPH 1M05A 1JUFB 4OSUL 2ED7A 3OG4B 2W65A 3GSOB 1SJVA 2CPUA 4QHMA 4NN5C 5EBMB 2RGLA 5D96C 2ESCA 2B5IB 4KZEL 4K3EH 2ADIB 4O5LH 3TF7C 1D5XA 1ZVYA 1F6FB 5KBNC 5I1HL 1E4WL 4EUPB 2LE9A 1Q9LA 3FFDA 3VD7A 4OGXH 1AXSA 3GXNA 2PXYB 4M43L 3LQAL 5GZND 5J9PA 1FO0L 4PJEA 4FK9A 3PWPD 1A1OA 1Q6DA 5HHVH 1DUZA 4YHMH 4Y16A 1GXEA 1FVCB 1FGVH 4O5LL 1NWTA 2EDHA 1FL3A 1OAXH 2CO6B 4RL3A 4ZO6A 3DX6B 3NFNB 1ACYH 1T6WA 4YXKH 5D1ZB 2R56L 1M1SA 1ZGLP 3UZVB 2BSRA 2VDLH 2R2HB 4M29A 3NCFB 3MUJA 4RFOH 1U58A 1NMBH 1OP5H 1G7PA 1ZT1A 1E5JA 4POZC 3T2QA 4YHIB 5IHZB 2B2XL 3I3EA 2HTLD 4N0UA 1KLGA 1NAMA 5I1AB 3VI3F 5J1AA 2PNDA 1QG3A 2D7QA 1JTOA 3HRZA 3VD9A 4AXNA 3MOBH 1RUML 1VKXA 5SWZA 4LGPB 3VW3H 2ORBH 4HK3J 4EN3B 4EOWH 3HS0A 3H3KA 1LDPL 1HSBB 1HKFA 3UPRB 4KK8C 4UV7L 5IVNA 1P7QB 2LU4A 1US2A 3MV11 4FF5A 2EC9T 3RHWK 3HB3C 4ZXBC 3T0XA 2NXZC 2F74B 2B31A 3N12A 3WYRA 2KBGA 3S88H 1DBAL 2ADJA 2A9ML 4QAWA 5D1ZD 2EYTB 2AJ3B 5T3ZL 3GSUA 5IMMA 5DUMH 2ZG3A 4HJ0C 4QXUL 2A6KB 3BRFA 1T2XA 4L8SA 1P1ZB 4OLWL 1NAMH 3MOAL 3JUGA 3QXAA 5DD5L 4X80L 4F9LA 5KVFL 1QVOA 2EDFA 3GIVB 5E95B 4KU1A 1FYTA 4ERSH 2EKJA 2X89D 3U46B 2QQQA 4J8RB 1BVLA 4EIGB 4OUOA 2FEDC 5B3JF 1JL8A 4TRPH 2EBNA 3WJJA 4HS6A 3RKDD 4EN3D 1JFXA 4EI5A 4W6YB 1Z3GH 3IDNB 1MHEA 3BQUC 4BQ9A 1IM9A 1H3PH 1QKZL 2BY1A 2V9QA 5J57B 1P7QD 2NT1A 4NO2B 4IDJH 4PUDA 5ACZB 3VD4A 3DMMA 3MC0A 4HHAA 2YJQA 1E4LA 3TCXA 5IOPA 3OKOA 3U0PA 3VFUB 2XUCA 2AABH 1ZHKB 1KCRH 1KTRL 3MLZL 2X4NA 5C0BB 4G7VH 2J4GA 1KWGA 1TZIB 3U2SB 3LSOB 1DVFA 3MXVL 1Z3GL 2DOCA 4L4TB 4XPGH 1PQZA 2W0LA 4P3WA 3WD3A 1NBQA 1AH1A 4IDJL 1XH0A 4NCC1 1CG9B 3GSVB 4B5EA 3FTGB 5EZLA 4HIHB 3GXIA 1KTBA 1UM6H 1UT9A 4FG6C 1PD6A 2X8RA 2NY4C 1NMCB 3DXAA 4BH8A 4G7VL 3WJLA 2FX8H 1Y0LA 2NZ9D 4ZO7A 4LYRA 1HHHA 3LEXB 4JG1L 3U6RA 2MSPA 1KJMA 2N7BA 2XFXB 1OIFA 3FQXB 5MEPB 4AW7A 3KPSE 3BEWB 4D9LL 3WDHA 3U7AA 2BVQB 1IGJA 4PRIE 5I23A 4L3EE 1BF8A 1J0KA 5I1KL 4XXCA 4MNQA 4OZIB 1ETZB 4W93A 3WFLA 1AXIB 4DKFH 4Y19D 1ZLUH 3RWIB 4KZDL 4F58L 2EIZA 2QKIB 2FGWL 1DQQB 4RMWA 5GGRB 1T1WA 5LA1A 1RFDH 1FHLA 1UKPA 4WIQA 3L95A 5MERB 1CZ8L 4Y5YA 4KQ3L 5LCVL 5C0BD 5DA4A 2E5EA 3BEVB 1RU9H 1RZ8B 4YNYA 1HH6B 3VXME 3UTTE 3V6OA 2HLFC 1T0MA 4PR5A 2W63A 4L4TD 4KHXH 4BK4A 4X7TB 4H25A 2QEJA 2DD8L 3MODH 5D6DA 4HKJA 1FH9A 4L8DA 1R5WB 1E4XH 5ALCH 3WQWA 1D5BA 2WXDM 4L8BB 2CCRA 1MW2A 5DK3A 5BXFA 2I60H 3RJXA 4GSDL 3ZYOA 3QEQB 2WZEA 5DDHA 3A6CL 4UT9H 4PRAB 5L2KD 4W87A 5IB2B 3ZLQC 2VXQH 2BOBB 4JFED 1GGBH 3X13B 1YEIL 4ZUSA 1BBDL 2VURA 1BX2B 1U8QB 5E1HB 4PJEE 5I66A 3G6JF 1N26A 3WEXB 4L29A 3S34L 1QNSA 2P48B 4GKZA 3CC1A 3NZ8B 4OZHF 3GKZA 3TO4A 3VFNA 2YFOA 1FP9A 5HYJE 1NBZA 1P6WA 2PO6B 3KR3H 3P9MA 4JRYB 4X7EC 5HGAA 4WFHD 1BQUA 3GMLB 3STLB 1IM3B 3GJFA 1IGTB 3J7HA 3VXSA 3LXCA 3EYSL 2F1BA 5JOPD 1F3JB 4UINL 3S37H 2VDPL 4RGNC 4GXUN 4AMXA 1GGIH 2M1KA 4XCYB 4UCFA 1EPFA 1ZAGA 1W0WA 4ALAL 4FNLH 4HWEH 1Q6GA 4JN1H 2E40A 2K9UA 1CFSB 1I8KB 1S9WA 3DROB 3U36A 1J1OH 4IJ3B 4QY8B 3TTYA 3D85B 4NQSB 1ORSA 3S37L 3B8SA 1SEBA 4LSTH 4RE2A 3G04A 5SWZE 2XXCB 4U4BA 3C5JA 3QEQD 5T1LB 1IGCL 4D9RE 2IBZX 5CEZD 1X9QA 2W9DH 1XFPA 1NP0A 4EAMA 1TJIL 2W9EH 4H20H 1UOKA 3E2HC 1KG0B 4LSTL 5HHNB 1RJYA 3TBSB 5L2JA 3K8KA 4X9IA 3SUSA 2LTQB 5EBLA 2JCCA 3C6LD 3GJFH 4UB0L 1OP9A 2BVYA 5KSAC 4DGYH 3HZ3A 4ODUB 1AO7A 4PIRF 4LF3A 2PO6D 4JRYD 3SJVB 1CLCA 1T5WB 4GAJH 4I3RL 4JANA 2XA8L 3TJHC 1J05B 3NCOA 4JDTL 5LA2A 3TBWB 3T3PF 4UQAA 3I6KA 4QDMA 4FRWA 3Q6FA 1UWGL 4RIRB 2DQUH 2V5MA 3EMZA 5CKAA 1B6UA 3BPCB 3OJ2C 5FM4A 2X0YA 1ES0A 3CZLA 3VA6A 4YIQA 2IQAB 3GNMH 1MQRA 1BWMA 4M5ZL 3DUSB 3NABH 1PG7H 1XGQB 4M62H 2R2EB 4LGRB 4OZOA 4LBEA 3JWNC 3V0AC 3D85D 3CUHA 2DQUL 3EO0B 4NM4L 1WB0A 2VRJA 5L0QC 3VTRA 3Q6GL 3BT2H 1YJDH 5HI4D 1NAKL 3CVHB 3FAXA 3G5XA 5T1LD 3QNXB 3WL9B 3S9DB 4N0CD 5ID1A 5D7IB 3FB5B 5E8PB 2H3NB 4UTBH 4FFYH 1A4KA 2QTEA 1VADB 1RHHB 4UNIA 3DX9A 3QIUA 2VWEC 3VG0L 5E6IB 3HUJF 4PJHF 3MRBB 1LLOA 3R1GH 3VFTB 3AREC 3C60C 4S3JA 1MRCL 2X7LB 1ORQB 2DBJA 2BV9A 5M3WA 5ALBH 1V6VA 2DM2A 4MA1B 2CK0H 2CUIA 1UUQA 3W25A 1FLRL 2AI0H 3BXNB 4NN6B 5DEGA 1BVKA 5C3LD 3WMBA 3KDMA 1LWJA 1HP5A 4Z2GA 4KKLD 2AXHA 3S36L 1QLFA 3O41A 1RMFH 1UQSA 2O5YL 3L9RB 4L4JA 2AQ1A 4IMKC 3F8UB 2J6EL 4LHUA 2M26A 2AI0L 3EW3B 3IB4A