1PEZA

Bacillus circulans strain 251 mutant a230v
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
686
structure length
686
Chain Sequence
APDTSSSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDVVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTATWEGGSNHTFTAPSSGTGTINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conversion of Cyclodextrin Glycosyltransferase into a Starch Hydrolase by Directed Evolution: The Role of Alanine 230 in Acceptor Subsite +1
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords Cyclomaltodextrin glucanotransferase
total genus 241
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pezA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pezA01
2BC4A 1RFDH 1CICA 5T33H 2DIBA 3OKLA 1ZTXH 2X89A 2W61A 1P4IH 1NFDF 4WV1C 1YEEL 4G6MH 5ETUA 3RX8A 1X6LA 1GGTA 4MXVE 4MX7B 4Z95H 1FZJB 4KI5E 5HNNA 3GSQA 4X80H 4HLZH 1R33A 1TQSA 3IDUA 3PTKA 2FX7H 3CVHA 3RIAK 4BA8A 2HJKB 3ZTNH 1YEEH 4HWZA 4KV5E 3FOMA 4ONHB 4RAVA 3SGDH 3BUDA 1HZHH 1E4MM 4I48A 2BDNH 4M61A 2W60B 4GI9A 5I8OH 4K8RH 4AQOA 4Z7QF 3VGEA 3TO4D 3MCLH 4JZ5A 2YWYA 4PD4J 5IEHB 2B1HL 1VPOH 4JKLA 1CGWA 43CAA 3D4ZA 4JG1H 4Q58C 1UJ3C 4DK6A 3EOTH 1Q9OA 4EQ3A 1CBVL 2BVDA 1RU9L 1JFQL 4FMKA 5J3HC 5DD1L 1VKXA 4U1GB 4KHXL 3F12B 4UNIA 4HUMB 3L95B 3IF1B 3VXTA 1CR9H 4QRQA 1S7QB 5CPSA 1F58L 3AS0A 4OZIF 3PWNA 3BUIA 4RISL 2EE9A 5DMGD 1KG0A 4IMKA 4W85A 4QLKA 1QBML 3BH4A 4U4BA 2ZUNA 5GNXA 3FQXA 2I9LA 3FFCB 2V2XA 1UD5A 3GRWH 3BGAA 3BW9B 2JCCE 4H41A 3GMOA 1HKLL 1CLZH 4L3CB 1TQBB 2R2EB 4G8GB 4WI3A 1FBIL 2VR5A 1DBBL 4POUB 1H3VA 1CFTA 3WLBA 3JWOH 2BVOB 2VH5L 4O2EA 3UR8A 3D3VB 5E4EC 1DFBL 5HGAA 3PZQA 1BG9A 3FQWA 4Z7VE 5F88B 1FCCA 1T66C 3ARBB 2WVTA 3RKDD 5AYIA 3QI9A 4N0UB 4U2ZA 4GRWB 4LX4A 2VN7A 3P0GB 4FZEH 1WZAA 4C58B 3F8UB 1K3ZA 3WDIA 4AD4A 1IGCL 4ZXBC 3RX5A 4ENED 5DC4B 4L8BA 3EZJB 3SJVA 4UT9L 2D7PA 1BSIA 3S8WA 1L0QA 2ENYA 4OD1H 1WDPA 4FFYL 3ZHKA 1CQKA 2NY2B 3IXTB 5CQ1A 2FEEL 4JFPA 3G6JF 1QKZL 2XQYG 3GHEL 1UENA 2BOBA 3RCNA 1XGRA 1MCJA 4JLRB 3QHFL 4OLXH 5DFVC 3RIKA 1TETL 5E24E 2CUMA 3VXUD 4HWEH 2R0LL 4HGKC 5D1ZC 4MD0B 3QZWB 3MFGB 4OLZH 4KMLB 1UR4A 3CSBA 4HIEB 1TJIL 4XNQA 2IMNA 1MCLA 4H26B 1OGBA 2PXYC 4FZ8H 1I1AD 1QACA 3CZJA 3BP6B 4JHZA 2DDQH 1QUNA 2ZUWA 1OGGA 2ARJQ 3QWRA 5BJTA 3DO7B 4LSVL 1J9YA 3FRPG 4RFNB 4D1JA 3LDBC 2YSSA 4JRXD 5DURD 1K4CB 3K7UA 5L88L 1UWEH 4KMTL 2IFFH 4DKFL 4MNJA 4W84A 3EFFA 4GQ9L 1M6OA 1RJZA 2V7NA 5DEZA 5EUKA 1QKZH 5LA2A 4D1IA 4TN9A 5DDHB 2ADIB 3L95A 3C5ZB 3BUQA 4W93A 1KNOB 4L3ED 4GAJL 3BAYA 1PDKA 3MRIB 4NUGH 4RQQB 3KPTA 4FNLH 1B0RA 2Q7NA 2XHYA 3QWOA 3WQ6A 5KSUB 2DB8A 3LMYA 5KSBE 3H8NA 1RPKA 1B0RB 1XV8A 2YPLB 1I1WA 4I3GA 3HCVB 4YPJA 4U5KA 4YBHA 1KNOA 1KIRB 3EYSL 1AGDB 4Y2OA 3O2WH 4IRJC 2VLKD 1QW8A 4PJAE 1UQYA 2ADIA 3QDJE 5JW4N 5FO7B 1I8IA 4Z6AT 4MS8C 1IBGL 5H35B 5CPQA 4X6EA 5IJVB 1R8LA 3D52A 3SKJH 1K4DA 1GL4B 1XCQB 1WIPA 3BIKB 4KZEH 5C9KA 1B4JL 2Y7QA 5L2KA 3BSHA 2A2QT 1OTUC 4MA3A 3QEQE 3IAPA 3VNYA 2JB5H 3CPLB 3BKML 4YHYB 1GVYA 4XWOC 1I7RA 5KZCD 1FYTA 1MI5D 2A83B 5T1KD 4DZ8A 1OIMA 2CBUA 2J8UE 3M8OH 5J0BA 5F1SA 3T0DA 1O0VA 4JM4H 3WFLA 3UG5A 4LBEB 5GGTH 3MRLB 1B3WA 3VDHA 1T3FA 4HUVA 1Y18A 1MRCH 1IKFL 5K9JH 3VWKC 5IV2B 1KFWA 4KRUA 1S7XA 3FAXA 5SWQB 5EBAA 5CZKA 4YE4H 4TNVK 2VDRH 4K9EL 2WBGA 1FHLA 3MBEC 3HB3C 5DD6A 2AXHA 1L7TH 4UAOC 3HR6A 5ITBL 3RVTC 3STBA 5LVEA 2OJEA 1T1ZB 1X7QA 3UJIL 1XH3A 3VI3E 1G01A 4QRUA 1CFSA 2ADGA 3ARDB 3NZ8A 4XP1H 2UY6A 1J1OH 2EIZB 4P5MA 4Q6IB 1XGUA 5I8EA 5IKCA 4GJTB 3AAZA 4Y16C 3BESR 2ZUTA 5GQBA 1AQDB 4XVTH 2WBJD 4PJFB 5CD3B 5E9DD 4XPTH 4NZTH 3QI9C 4LSPH 5CFHA 1T21B 4Q0XL 1DE4A 4AG4H 4PJIA 2NY0D 5GSVB 3W82A 2NXZC 4JANB 4KMQA 5HYSB 1Q9KB 3VXSE 1LE9A 3NSNA 2AS5M 2ZNXA 1KIQA 1WO2A 4C83A 1A3RL 1A6TB 2B8OT 2XY2A 2YKLH 3GMOB 1ORSA 4QFUA 1CD1A 3CSYB 2YC1B 1C8QA 2GSIA 3RWEB 3WE6A 1QEWA 4H25B 3MJ9A 1S8DA 2Q76B 4JFOB 3ULSB 4NRSA 3OKOA 5C0RL 2UWEA 4N68A 4O4YL 1KG0B 5I1CH 4G6AC 2DQJH 5A69A 1GGBL 2WB5A 3PZOA 3VXTB 2QHLA 3IF1A 3P73B 2CJUH 2AJUL 3F12A 3MXWH 3QQNA 1XF3A 2CH8A 5GHWH 5LCVL 1MVYA 1CU4H 4PJEE 5IBUB 4GRWE 5IB3B 3M6DA 1GGCH 4U2YA 3HI5H 5BRZE 5DR5L 1OW0A 1OWWA 1F4WH 4DAGH 3I75B 1CICC 1I9EA 3FL7A 5M03A 3TV8A 4C59B 1JZ4A 4WW1B 1IT9L 2X44D 1ACYL 4PJ9B 2V5RA 2HJKA 4JFEA 3FB5B 5D72L 4QYOA 3VXQB 2RGMA 3ULUH 4OQ1A 4OZGB 2H1PH 2Z8RA 4FQCL 1QRNA 5I76A 3QIUB 2BY0A 4LRNL 4KROC 1C5DB 3D0VB 3L3DB 1AC0A 2VLJD 3WH5A 5I3DA 2EIEA 3HC3H 4ODSH 4WNQA 2FJGB 2NY7H 4WWKC 3O3BA 3VG9C 4K23L 3VG0H 4M29A 3S37H 1C7SA 5I71C 1F3DJ 4FQCH 2X1OA 5GS0H 3R06A 4QXTA 5E4EB 1PLGL 4J6RL 4OZHF 1G6RB 4HPYH 5DHYB 4OGXH 4WI8A 1I3GL 4JN1H 3OGRA 4IRZL 4HXBL 3HA0A 4P5TC 3BLKA 1ZT1B 1K85A 3N1QC 5HDOA 3BJ91 4V1DE 4X0NA 5GISH 2DT3A 3NPSB 4TX8A 3VCLA 2YA1A 4HS6A 4XNMA 2G60L 4MAVA 3JBG7 3TA3C 5DVLA 1N82A 1LL4A 2GK1A 5MEOB 1MCNA 3RM4A 1BBDH 2GUOB 3HI6L 2XN1A 3MRFA 1GVIA 3IS1X 3V4UL 4HT1L 5E8DL 4MXQC 5EOCJ 5SX5K 4JB9L 5HTSA 5I1CL 3F5WA 4HUNB 2J4GA 3IXAB 1LMKA 2KQNA 1O7VA 1CFQA 1BVKB 3ARYA 3S96B 4P9MH 3N85L 5KOVC 4EDWH 2AK1H 2YWZA 4HC1H 1AD0A 4E2OA 2ICCA 2Z4QA 2D7TH 4JPVL 2NW3A 1TFVA 4P8WA 3VH8B 1IQDB 4D9RE 5C08D 1JHTA 2FO4B 2EDWA 2C7UB 3NABL 4GLRI 1O6IA 5ESQB 5IHZA 3GXTA 2JKXA 3MV9E 1KB5H 2C7FA 1A6AA 1L7IH 1PGRB 1EO7A 1U92A 1ZBVA 1BBJB 5DK2A 4MCYA 4XPTL 4P8XA 1IC5L 3ZJ8A 4XP5L 2DLFH 4EKXA 2J47A 4D6FA 2JIEA 4GAFB 4TUOB 1MNUH 4DKEH 5CSUA 4ERSL 3W81A 3LV3A 2AQ1A 1G9EA 3OKDA 2VCBA 2DKSA 5GGSB 2ADJB 4XMLL 3UEQA 4WWKB 5DJ0B 3UC0L 1RK0A 1FP8A 3O4LD 1RJYB 1LGVA 2AJVL 4LVHB 3LPGA 5I73B 4KRMB 5DJZB 1IV8A 5GJSL 3BKYH 1ED3B 2ICES 4K07A 4NXSA 2OW6A 1OSPL 3OGVA 1JIBA 1OPGL 3U9PL 1WDRA 4A6YL 5BVPH 3O6FC 1WQVT 3DURB 2PXYA 4ZFFA 3OXSA 4Y1AA 4DGIH 5IT2H 5C0AE 3S9DB 4WV1A 3QDMB 3KPMA 5MEPA 2X4UB 3NFPA 1MCOH 2VN4A 1FFRA 1O7SA 4WUUB 5IFJB 3AHYA 4LCUA 2WWMC 1HWHB 3KLHD 4S1SL 3C2SA 4N8VA 2CLRB 3VXOA 1VFAA 1BGXH 2CGRL 5AUMB 1FJ1B 5E0QA 5EZLB 4ZMAT 3TO4B 5EBLB 3W9DA 4ZSOB 1FRGL 2A74B 2N1KA 3HG3A 3L4VA 1RP9A 3GNRA 1BFOA 3BCDA 4BQBA 3DRQA 4HQQL 1BPVA 5JOFA 4FS0A 3WV0A 2DMBA 2ZG1A 2M26A 4PJBA 4WHDA 3R0MA 1XFPA 3GNML 1G7JA 1IAOB 3GJFA 4L4VA 3CHEA 1IM3B 1S5HB 3TJEL 4P99A 1CIDA 4ZFGL 1YEGL 3VXSB 5GIRA 4YDLB 1TNMA 4ESKA 4D72A 5I78A 4NJ9H 1NCCL 4JFQA 3IJ7A 3CLFL 3G6JE 3WS3B 1JWMA 2CQVA 5JNYB 3MRDB 3WUGA 1GQKA 1ZJBA 1D9KA 3MLXH 1EXPA 3RO8A 4QXUH 1FO0A 4M93C 5DMYA 4FG6C 1AP2A 3H0TA 4H8VA 2Y4SA 3U4AA 2I9TA 4JFTA 2GHWB 5JTWA 3OSKA 5ALBH 4JDTH 1C16A 2FB4L 1TR1A 5EN2A 1Q0XL 3QOMA 8CGTA 1JZ8A 4PMQA 1I7UA 3MTRA 2QSTA 3HPJA 5D7IE 5GRUL 4FQ2H 1SMDA 4J2XA 3RKDC 1OTSC 1J8HA 4LLDA 5A6JA 3MREB 2X4UA 3NFPB 2V2TB 4XNYL 2X1IA 2EYRA 3VWKB 3QEGL 1TA3A 5IGXH 3GSXA 4KKBD 4OLZL 4Y8DC 3LEVL 1B2YA 4PJ5E 3AGVA 2BXZA 2FH6A 5JIWA 3FHQA 3WN5C 3MZGB 1WTLA 1NGPL 4QHKI 3FN9A 4XXDB 4PMNA 3H3KA 4MA7L 5H94B 3DXAB 3VFMA 5CEXA 3LKNB 1JV5B 3BSZL 1JYNA 2R1WA 4JRYB 3SDYL 2W65B 4M02A 4FMFA 2XWEA 4F58H 3W39A 4Y19D 3CFBA 2X0YA 3NGBB 1UUQA 1S5IH 1TZIA 4JE4B 1SEQL 3EBAA 2A1WL 5F97E 5IFTA 4WIWA 1PKQE 3BXNA 4Y5XC 4K7FB 4TXEA 1L0YA 2D31B 5SWSB 5BVJB 1AQMA 1WCBB 5FYLE 1FFNB 4O58L 3QIBA 1J88A 2DMCA 3J7HA 5TDOA 1AGFA 2YK1H 1D9KC 5HDQH 3C5SB 3OR6A 1B31A 3QO0A 1RIUL 4DN4L 3FT3B 3ARGA 1KEML 1JNJA 3JV4A 1BVKA 5FYJE 1UADC 3S96A 2B4CH 3MNZB 5I1KL 4U1SA 2CERA 2X1PA 3MUY1 1XIWB 1F3JA 2E9BA 1UVQA 3M1BA 4P7QA 1RIUH 4JRWA 3AREC 3MJ8A 1A7PL 1R7OA 2BOCB 2JF1A 2E40A 2GK1B 4AMKL 4XB8A 1A8JH 3ILQD 3RWHA 2XV6B 2D3VA 4LMQI 2D03L 5C09E 4NQCE 4KHTL 3RBSA 3VE0A 3WF3A 2VISB 4P57A 1MHHA 4NN6C 4UFHA 1FAIH 4MQ7A 3FT2B 4J3SA 5CUSH 5EA0H 1MH5B 3HG1E 4X6DE 3ZE2E 3MSDA 2QMKA 1DLFL 2OR8A 3HE6D 4RX4A 2EIDA 3ZJ6A 3T08A 3BSZH 4NSBA 4J3TA 1NCNA 1NBVL 2PTTB 1ADQA 3MV9D 3K8KA 3L3DA 4PJHF 1CLYH 3RZWA 2IGTA 4XCEB 4Z5RA 4PMDA 1YJDL 1T22A 3RY6A 1T7ZA 4ZUWA 1DUZA 1FIGH 4PJHA 2XGIA 2GW5A 5ERWB 4D9LH 3RUGE 4D0DA 3GSRA 2NQCA 5AZ2H 3AIEA 2XWJA 2EH8L 1I1FA 5D8JL 1U95A 3UR7A 2V2WB 1QFWM 1Z0MA 3UESA 4KJPC 3LXBA 2NY2D 1AQKH 3BD3A 1OAQH 2FDMA 4HS3A 3TV3H 5I1AB 3QGVA 3CUPB 5ACZB 3IFPB 4TULH 4S1RH 4FABH 4PJXF 4U0RB 2R4RL 4NWTH 4LHUG 3MA9H 5JW4R 2GK2A 2OTWB 3GSVB 3RJDA 4PYHA 5I2IA 3O9WC 1UEMA 1NJ9A 3FJTA 1CTNA 2PTVA 1KUMA 1MW2A 2ZG3A 4JM4L 1VFBA 4R26H 5DRZB 3WEZA 5DJAA 3AHXA 3Q3GB 1LD9A 2VXQH 5BVJA 2D31A 3HE6A 2F1BA 5DMIL 5KVFL 4FMVA 4OF7A 3S6CA 1PKOA 3BYYA 5E8NB 3JWOC 5I6XB 3OJ2C 4LEXH 1JNLH 4KK5D 2EYSB 3S36H 3IAGC 4NIKB 2ZUYA 3CMGA 2W65A 4UU9B 3AZSA 3ELAT 3PTMA 2R2HB 3QP3A 2WUBL 4L3AA 4V2CB 3L5IA 2F5AH 2DL9A 3QCUH 2AXJA 5LBSH 3IVKA 5H94A 4RFEA 4KY1L 1PX3A 1X3DA 2FLBT 3OAYH 4NN5C 3L5WA 2IBGA 3U7WH 1MXDA 1MJ8H 1MPAH 1EFXB 4Y1AE 4N1EA 2HT4D 3TTSA 1UM5L 2JJUA 5CG0A 5JOPD 3D69A 3DX7A 4DWSD 3QCUL 4D3CH 3U82B 1CFBA 3PWPB 2K7QA 5DEFB 4PB0L 3U0WH 1PSKL 2DKUA 1F11B 2L4OA 4GQPH 2X4OA 3WLWD 2OJEB 2CITA 1BTCA 3NCFB 1H3XA 4PRIE 1NKRA 1FZKA 2J8GA 4NQCD 5KBNC 1DBAL 4NQEB 5C09D 4D0BB 1FL5B 4X6CE 4OIFA 3VMNA 4LCIH 3ARFD 4JO2L 2ZPKL 4PV8B 1U8IB 4NQSA 1MJ7L 4FTVB 3WXVH 1A4JA 4AD0A 3KPSE 1Y18B 3MMUA 2I9TB 4P2QB 1KB9K 4B9ZA 1E0XA 4WFEE 3EJPA 3AREB 4AZCA 1MIEH 5HHQA 3RTQD 2ESVB 3VU2A 4W6YB 5HHVH 2P45B 1G9HA 3SBWA 3KNBB 3LEYL 3WFZA 1E4XL 3IRZA 5J1SC 1XCXA 3LXCA 4EK7A 2F8OA 4Y2DC 1WF5A 4AZHA 4F2MB 1AHWB 4Y5XA 1UWUA 4F9PC 2CK2A 4LLWA 2J5LC 4HJJH 2PC8A 3CHFA 2P5EE 1JWSA 4JO1L 5DJYA 5C07D 2OR9H 1IM3A 1S5HA 3RJXA 2ZOLA 3BP4A 4XP5H 1Q4NX 4MLSA 1MAJA 4WJ5A 4H5SA 4HOZA 4FA8A 5SWSE 4IOIB 1JWUB 4LLYA 1V08A 2AEIT 4P2RD 3HRZB 1BJ1H 4RCAA 5JXEC 1S9WA 3ROLA 2A74A 2P8PA 4ZFMA 3G6DH 3CC5A 5GXBB 2GT9B 1RUPH 1KFAL 2F74A 3GSUA 3X14A 3OGOE 5JDSA 5A8NA 4JKPH 2I60H 1CTOA 4XZWA 3VUPA 1YPZE 1MHPH 4EN3D 1N2RB 1KXQA 4WO4D 4ELKB 3P0YL 4WUUA 5IFJA 3X3FL 4ZXLA 1M6OB 1RJZB 3HZYA 4TVCA 1F4YL 5TH2A 3RRQA 5DD5H 4PJCA 5C7XH 1WKYA 3T0AA 1LO5B 1KCSH 4PJDF 3FQRA 4M5ZL 5A8QA 1MHPL 2J7LA 5ANMA 1M53A 2HWZH 4Z7WB 3MRBA 2G60H 4EI5B 3BPCA 3NA4A 1BQHB 1AGEB 1S9VA 4LPXA 1F4YH 2QQNH 4U6TA 4EI5C 3I2CL 3RVVC 1AJ7L 4ONGL 2VLJB 5T3XE 1LP9B 4HLZG 3WNOA 4HPYL 5FYLH 4OB5H 3S4SA 1YEJL 1RUPL 3B9DA 4JPIA 1QQDB 5DC9B 3OF6D 2W62A 3MLSL 3QIUC 3T2QA 1OF2A 3VRJA 1NQ6A 3VDAA 2FEDD 5KZ6A 4H04A 4MQTB 2MWCA 1ND0B 2R4SL 4GKZA 4WHYG 2DQIL 3PQYD 2XRAH 2VXVH 1SJXA 3L3JA 2Q6WB 3L9RA 2ED9A 1PAMA 1CLCA 4UINH 2RGLA 5DMKB 4JZJB 4L1HA 1ZOXA 3MYZA 3QNZA 4HV8B 4FP8L 1MIEL 1LQ0A 5L2JA 1R3LB 1ZANL 1HHJB 4P3WA 2YDRA 1B2WL 5EO0A 4JPKL 5HGBB 1DL7L 1EERB 5JW4M 2PYEA 4LASH 4XPAL 5T1MB 4OLYL 1U6AL 4XPBH 3CZKA 3EJYD 2AOSA 1KXVC 4M03A 5CJXA 1P4IL 3Q1SL 4JFZL 1KJMB 4XP9H 1C8XA 3U57A 5ISZE 3U0TA 3MJ6A 3NCYP 1AH1A 3TJHD 4EEEA 5BRPA 2DSWA 1BFVH 1H8OA 5EO9B 3VKKA 3UTPD 5HI3C 5E95B 3WIFB 3BPNB 3MRJB 1AC6A 1IFHL 1UG6A 2BERA 2VZOA 4OUOA 2Y5EA 1FH5H 1I8LA 1PLGH 4R4FH 2WZPD 4TYUA 4XRCB 4AZ7A 4MJ6B 1IC4L 4M8VA 3VXRE 2DQDH 2DD8H 1XRVA 3WXWL 2A73A 3INUH 3QFJB 2AEQL 3CCHA 1NBYB 1NFIA 2AK4A 4UT6H 4NZRH 4AG4L 3QG6A 4R9HA 4GMSL 1G7MB 4UDTA 1Q9OB 4NPYB 4JAWA 4YUEL 3B9AA 7FABH 2ZCLL 1FH9A 5CSBA 3L6FB 4YXKL 2CETA 1U8PB 3PZMA 2DQEH 1MUJA 5CMAA 1GOFA 1UYQA 5L6YH 3CBWA 5CJXC 1F2QA 3FOMB 4TPRL 3WCYA 3QXDA 3UDWA 1PZUB 1U93A 3C60B 1I7TA 4KVNH 3WNPA 1OP5H 1KCUL 3OTTA 1FAKT 4O02H 5FUZL 3MUAA 4Y2DB 3L6FA 4JQVC 4X6CB 3GKWL 1BJ1J 3MXWL 2J7CA 4MB4A 3JV5A 1LWJA 1AY1L 1H8NA 2HVJB 2A6IA 4ODWA 4AL8L 4RDQF 4QLLA 3ETBF 1CE6A 2VMFA 1QSFB 2EQDA 3QFJA 3SE3C 1GGIH 1GIGL 5HGHB 3EJRA 4JZJC 1IM9B 1E43A 1ZBCA 3O41A 3BKJH 3QQ3B 4NO2B 5DS8A 2XN0A 3VFUA 5GS0D 2JJSC 4HZLB 2Q86A 1QBBA 4S0SD 2ZCHL 4CGTA 5HYSA 3PZIA 5EOTB 4L5FH 3GJFH 1EHLH 2D23A 5DT1H 2EDRA 1U6AH 3FQNB 1KJMA 2EZ0C 3KPOB 3I02A 3OHXA 1I1AC 1J5OL 4IDJH 4JPKH 4YHIA 1QZ1A 1KTLA 4IRSC 4U49A 5TDPA 2PYEB 4HK3N 5FGRA 5T1MA 2AJZA 1EIBA 1V02E 4YZFF 3AAZB 4F80A 5L7XH 2NX5A 5ANME 2JJVA 5JHDA 4RAUB 3S2CA 1IEBA 1H9VA 1IGCH 1BOGB 1MCPL 1WISA 1NCUA 1QHPA 4XNUH 4IBLT 5H2BA 3KYOA 43C9A 3TT1H 1BJ8A 1JI1A 3KR3L 1N64H 5E99L 5F9OL 4AY0A 4PRHB 1HXJA 2FX8L 1BEYH 4WJXA 3MRPA 1NCBL 2IGFH 3PJSA 4CVXB 2O5XL 3IS0X 4CU6A 1YPZA 3I50L 3NIDE 5D70H 1P7HL 3MODL 2VT0A 2E8ZA 4H8WL 3BZEA 2W07A 3VWKD 2NW2A 3GMNA 5F3HB 4BH7B 2H8PB 3REWA 3QIWB 1NQBA 3Q5OA 1A02N 4YHPB 5ESVA 2VLJA 1FNGB 3LKRB 5CSZA 5LGKA 1HYSD 3QUMB 5JORA 1GPOL 1QTYT 1E5NA 3TZVA 2DQTH 2W9LA 4NKOB 3WFBL 4Z7OF 4UZSA 5CGYD 4W8BA 4NHUB 1PY9A 5A6AA 1W1YA 5LCVH 2I5YL 1JL8A 5HHME 5T5FL 4P4RB 4Z7WA 3SDDB 2Y7QB 1UG9A 3W29A 2IMMA 3MRQA 4Y2DA 2DQXA 3N9GL 1QLRB 5F1IA 4TULL 2QJDA 1WWAX 3QHFH 4WGVB 3TV3L 4KK8C 3NAAH 2HJFA 3D39D 1WE5A 4OGYL 1E6QM 4UR9A 3PZVA 4UUJB 1UQSB 1NEUA 3Q0HA 3TBYB 2P49B 5ADPH 1R0AH 1RZGB 4OD1L 1NM9A 1CDGA 3NCJH 1MVFA 5KSUA 3BN9C 3SO3C 2ORBL 2P8PB 4RQQA 2EICA 1IGFL 2DLGA 4QTIL 3O2DH 2GJ6E 4Y19A 3IRPX 3MCKA 4QAWA 1ZLSH 4WWID 1HTYA 4GRLC 1Q6DA 2P5EB 4XHJC 2HFFB 3UTTB 1HJSA 4G6AD 1TE1A 3E6FB 2BJMH 3IDNA 5I77A 3RNKA 1OLZA 3WN6A 3DIFA 1F00I 4J8RB 4LLWB 3EJJX 3GJEA 2AABH 5FECB 4XNYH 1ERNA 5JW5B 4I4WB 1A1NA 5IBLD 2ESCA 2DQCH 2G8ZA 1L7TL 2NY3C 4NRRA 3WF1A 1JRHH 2HT3D 2NY6C 2ESVA 1GAFL 4HIEA 4JGMA 4LFHD 4M1CC 5ID1A 4KPHH 4WTZG 4HJ0C 2QMJA 1QSED 4A6YA 2JB6A 5E5RB 3F5KA 2MQCA 3U7VA 3AZTA 5IJKC 4BKLA 4MLIA 2WVVA 3LPFA 5KSVA 4KWUA 2VXUL 3BDXA 3RBGA 3MA9L 1YECL 1V0MA 1GCYA 1RUQL 1U8IA 4PV8A 1JUFA 4JL1A 3AHVA 4OIIH 5FM5O 1ODZA 5KS9A 4LCCC 4EAMA 1S9KC 4I18B 2EDTA 4IMLB 3BAJA 3B9KC 4AZIA 4F79A 2O5ZL 2YKLL 4YBQC 5M5DA 1PW3A 2GJRA 1W0YT 4M8QB 3LPOA 4ZODA 1ZEAL 4EVNA 3P9LA 1KB5A 2LE9A 3PHQA 1E6XM 2VSDA 1QSVA 1TQBC 4PJ7B 4PRNA 4TTDD 4CN1A 3V6OA 4YDLC 1HQRA 2WMGA 1YJDH 3VXUE 4G6KH 4RFEB 3EBVA 2PETA 4JREB 3TZVC 3K4AA 4BFIA 1TJGH 5AWNL 3NCCB 5D9SA 3WO3B 1DWJM 3SDYH 1B90A 3RWJA 1D5IH 4UIMA 4DN3H 5CUSL 3MJ9H 4FNLL 1AQHA 5J6GA 3ZL4H 1QSEE 1R0AL 3I84A 1PZ3A 1AKJD 4X7DC 2H2PD 2G41A 1D3CA 2OK0H 5M94B 2V2XB 1LD9B 4GQ9H 2NY6B 4LYRA 3G6LA 4LCCA 4YFDB 4MDOA 4WTZA 2WIMA 4QY8B 1AO7A 1MHCB 2EE6A 1OM3H 5I2IB 5D1QC 1P7KA 4Z77B 2X4TA 4IIQC 5ABEA 4PMOA 2EC8A 2BY2A 4G7VH 1U30A 4YHGA 5D7IB 4GG8B 2KQMA 4P46A 2ARWA 2WBJB 4X4MA 1MCSA 3DYMA 5ISZB 2DLFL 3BVTA 3VGGA 3CHCA 2W60A 4LLYB 3BJLA 1JWUA 1AGCB 5DZOA 2B31A 2M8XA 5IG7A 2PWEA 4NQVA 1ZE3C 3RTQB 4P2OA 1MHEB 3GSNL 4Z7WF 4NQXA 1OD0A 2YR3A 5I1LB 3MV9B 3BPNC 2RR3A 2EE2A 3HUJF 2XACC 4D6GA 1RZKL 1NLBL 5HHPA 4XTRC 4OCNC 4WFED 1ZTXL 2ZSVB 4LPWA 4OZFG 1UT9A 1RHHB 3UETA 3O6FD 5GGTA 2H26A 4ZOAA 1KCRL 3SO5A 1T4KA 4AY1A 1W3HA 3V5DA 5C0CE 2IPTH 4WUUE 4BQCA 3AREA 5CBAA 4AZCB 2F8QA 1ITCA 2AK1L 1PKQB 3GXDA 4YQXH 1GHFL 1G0DA 4WU7A 4OKVB 4UQ3B 1PEWA 3ZDXF 1OAXH 4QCEA 3LXAA 3W4RA 5CD5D 2N4IA 4QF1A 3BZDA 3C09C 3P0YH 4NQEA 4NO0A 5ECJE 1ZLVH 3PDDA 3VM7A 5BRZA 3T4AB 4RE3A 3CSGA 4U31A 4OZHE 2CR3A 2XKNB 4JM2A 1RVFL 4E41B 5F71A 1NMAH 5C0CD 1XIWA 5DMGC 3BVUA 3MOQA 3L7EB 4PJGF 5GRVK 2QSVA 3QEUB 1OW0C 2UY2A 3SOBH 4KZDL 4IRZH 4Z8FH 1GHRA 1KIUA 3EGSB 4NUJA 3QWRD 4XUYA 3LQZB 2GJXA 3UYRL 5CINL 3C5SA 4U33A 1XCWA 3A0OA 4XBPB 3H3PH 5F7NC 3TO2B 2WC3A 1R34A 1J7VR 1Q6GA 4AK1A 4ZUUB 3D1MC 2YEZA 4PJ7F 4DAGL 4JHAH 3QXAA 5C9JA 4H8UA 1Z3GH 1HXKA 1YEDB 1C08A 2YBRA 5F7LB 4ZUUA 5GJTL 1UHVA 1KPVB 1JPFA 3BOVA 4PGEB 3IETB 5AD0B 1JV5A 3EKCA 1NJ9B 1CXEA 1SMAA 2OZ4A 1VGEH 1TVBB 2DTSA 3HFMH 1OGTA 2R29L 4F3FB 4HA1A 1VSCA 3SGKA 2WC4A 4D9QE 5JPNB 5HYJB 4NRZB 2H3NB 3CK0H 1EFQA 5DT5A 5DEGB 3CLWA 3HI1B 5DJ6A 1PBGA 1JFHA 5BV7L 5KSAC 4UNVA 1FRGH 3P0VL 5JA9A 1FO0L 1AXIB 1W0VA 3N18A 4LOUC 3HC4L 1WC7B 1T1WB 4PJBE 5TD4A 4FNSA 1UQZA 1S7TA 5F1NA 4ZE5A 1T0NA 3RGVC 3T4AA 1KPUA 5J1TC 3O6LL 2HTKD 4L29B 1PVHA 1IAMA 2ICWI 4LARL 5FYKD 1A1MA 4HKZB 3IAQA 4Z2JA 1MIMH 4X99B 3NFSH 1CK0H 4NZTL 1A3QA 1MFEH 4P5TB 4PMZA 4NNPL 3V0WL 1T22B 4XVUC 3O0RL 2BVPB 2J8OA 2IPKA 1U3HC 3BO8A 3ARGC 3VXRD 1KSRA 4QXUL 3SE9L 2H9GA 5HHOB 1GXEA 4BELD 5F9JB 4W7VA 5E4IA 1CR9L 5DQ9B 2COQA 2CDEB 1LEIB 3GDBA 1SQ2N 1BZ9B 2XIDA 1CCZA 2WMIA 5CLTA 3ECBA 4KGLA 2XFXB 3V95A 4Z7NF 4EE9A 3CFCH 4KKBC 1ACYH 3DLQR 1PIGA 2ATKB 3FQTB 1R46A 3JV6A 2HJLA 1U3JA 1QLEL 4YC2C 1HL8A 4N8VG 1RULH 1J05A 4UDUB 5DRWB 4V2XA 1UCBH 3LS5H 4NQXB 5FD0A 2X7LA 3S5LA 3V6BR 4WDIA 2AJSL 2PR4H 1GRWA 2C3GA 4J12A 5SWZD 1MQPA 3DMMC 3IYLW 4XBEH 2DQIH 2MFNA 4N9GB 4HULB 4YDKH 2FL5B 4R90L 3BE1H 4GAYA 4B5EA 3BHBB 3RDTC 4U1SB 4MS8D 4ODHL 5J8OA 4XPFL 1MWAH 2ZSWB 4M43H 4POZD 3W0WD 5D6CA 3EOBA 3AIQA 3QO0B 3NSXA 1QBLH 2WMHA 5DZNA 1K9EA 1WBZA 2NY4B 3U0PA 2OL3A 3KWXA 4OT1H 1E27B 1DWAM 1RZKC 1EMTL 1M03A 1Q9LA 4XT1C 5IK3A 3HE7A 5D9PA 3PTQA 5CLWA 4HZAA 3BVWA 3NSMA 3BXNB 3CFEB 3O2WL 2GY5A 4S1QL 1KGCD 3E6HA 1OM0A 3UTQA 3I6LD 4GUPA 2QSCH 4LLAA 4PBGA 1D5BB 1DSFH 1CECA 5IJKA 4M6OH 1XF2A 2P46B 1AIFB 1CL7H 1NDMB 4NM4H 1HF6A 3P11H 1QFWI 2DWEA 2R15A 3BISA 4XXDA 1YPZF 3WJJC 4YBLB 4B7LA 3D39E 1HQRB 4GO8A 4UILL 3SDCA 3O8XA 1CXIA 1OWRM 3PHQB 1H3PL 1MRDH 3VXME 3VG0L 1UOKA 1E1EA 3CJJA 3QO1A 1NGWA 2VNCA 4NNYA 2Y8VA 5JBFA 4MCYB 4M80A 1W9PA 2WLZA 3L5XH 4K3GA 1YMHB 3BH8A 1RY7B 2XICA 4XP1L 3IJHB 5C07A 3D5OF 3U0PB 3WKMH 1KTBA 1DEEA 4JPVH 1M1SA 4D6DA 4JY4B 1HOCA 1MSPA 2IWGA 2FJFB 3GUTB 4YN5A 3DV4A 5D7SH 5ILTL 4PRBA 4LIQE 1G7IA 1XYFA 1QRNE 1Y6MR 3TYGL 4UFJA 1HHGA 4HZ8A 2PWFA 1GCFA 4NO0D 4KFZC 2ICWJ 1WVZA 3H55A 4HA4A 1V5JA 1ETZB 2DDXA 5TE6L 2HFEA 5DUMH 1R3IL 1YYLH 3NZHH 2JTDA 4HWEL 4GRLB 1P84K 1P4LA 3VFRB 2R39A 3BQUA 2DGAA 4HDIA 4GW1B 1HSBA 5F7MC 3SUSA 3BVNB 4L4OA 4JO2H 3DGGA 4N8CL 2FNBA 4NHCL 3OLEA 3GMQA 5T5NG 5D93C 1AD9A 1FGVL 5SWSD 2AERT 2VWEE 3SO3B 5ICZA 3VO0A 3HS0B 4G43B 3JV6B 4LQ1A 5D2NC 4Z7OE 2X2JA 2DS4A 4JO3H 1YDPB 5IMKB 4URIA 3CVHH 4XHJD 3VGDA 4JY5H 1OSZA 2OTUA 4D8PB 3KYAA 4D3CL 4QRRA 3DRQB 2D2OA 4KH2A 1J8HE 2BVEA 2FJGA 3BPLB 3T0EB 2VL5B 4YHLL 4HW6A 1HXYB 2AXFA 3GEWB 4ZSOA 2FH8A 3ARQA 2IFFL 1MEXH 2BVPA 4U1MB 4YC2B 2YD5A 4Y4KA 3CH9A 3PNWA 2HT3C 2AEPL 2JCCF 3VXQA 4HSQA 4M00A 1RIVH 1NANI 4N8VB 1ORQB 2O61B 4KXZI 1A7NH 1HKKA 4BSJA 3VWJA 1TZGH 1INDH 1U58A 3TF7C 4OZIE 3H9ZA 3A6CL 4B41A 1OM3L 2BFGA 3E3QC 2XZZA 1L9NA 1G84A 3D51A 2PXYB 3DURA 4GAGL 4LF3A 2EPLX 2V6HA 3SKUD 3SDDA 3SUVA 3H3BC 4NRZA 4NF7A 4KKLD 3OZ9L 4JN2B 1TNNA 3OKMA 5E70A 5BZWB 4F3FA 1YC7A 4NKOA 5T3XH 3TZVB 3RGVB 1VACB 2AJ3A 3FFCD 4EDXA 1FFOB 5J13C 3TA3D 5DJ0A 4XNZC 4LXFA 1KC5L 4UOZA 4NJ9L 4HCRA 5T1KA 2VZVA 1VPOL 2EH8H 3R0NA 1LDPH 3EJZC 5HJ3A 4I0PD 1ORSB 3BZEB 2YL8A 4G8FB 4WFHD 3MANA 3C6LA 3OV6A 2VLLB 2XWTA 4ODBD 1RZKH 2HRPL 1TMQA 1P5UA 1YPZB 5J1AB 3ZTNL 1EK3A 2HFTA 4WTWA 1JYWA 3ARRA 3WHE0 4HWBL 4CAGA 4Z7UE 3F6LA 4YPGB 2H2PC 2N7AA 4L8DB 5FCUH 5L2KE 4ETYA 3EW3B 5EOQH 4CJ0A 3WENA 2WUCL 3EFDL 3F5WB 4HPOL 1I3RA 2RBLA 5I74B 3UX9B 3GK8H 5D71H 1JTPA 4DWHA 1HSAA 4P4KC 1T0OA 3KPOA 1X9QA 4QRPD 1JTTA 3MRHB 5AG9A 3QH3B 3PWVA 5ID0B 1HKJA 3GYCA 2YPVH 3A6BH 5C8JA 3D3AA 3MUHL 3QBTB 5JQHC 1U0QA 2MQ3A 5GJSH 3AVEA 2CK0L 4NZDA 2B4CL 3KYNA 4M48L 4NO2A 4BQ6A 3P9MA 3QR2A 4CCCA 3O9WB 3WEXA 1G6RA 4Q9QH 3D85A 4N90E 1E6PA 5F89B 3SCVA 3D25A 2XPKA 2NZ9C 3UTZA 3ISWA 1CE6B 2ZZUT 4DKAA 1ZA3B 2YRZA 3GXNA 1TPXC 2GYSA 5IMMB 1XMWA 2AKRB 3I50H 4DWSB 1J11A 4OGAD 3V6OE 5B38B 5MENB 1WBXB 1XIWC 2YK1L 1F8TL 3HG1D 3RKPA 5HDQL 5LAXB 3E2HC 2FHFA 3HE7D 1YYMH 2YN3A 4K3JH 4X6EB 2RFXA 1OAKH 5HHXH 4JRXB 4F7EA 3BQUC 4MNQD 4S1DD 3V4PH 1LF1A 4OGYH 1BYDA 2PO6C 4AMCA 1B0GA 4NNXB 5INCA 4RGND 4FHBD 3W26A 3UPCA 4HS8L 3V5HB 2VOTA 1LDPL 3A24A 4PSPA 4GG8A 5D7IA 4Z7UA 4YHKH 1SYVA 3O3EA 4ISVB 2J7EA 1G7MA 1GOQA 5D1ZB 5CPTA 1CGSH 2LTQB 4PGBB 2A6KB 1Z5LA 2ID5A 1Z2KA 4N0FA 4NRXA 5FGBC 2V3FA 5KVEL 1E5JA 1MCBA 1JZ2A 2DT2A 5I8KH 1A7OL 1S3KL 4XRCA 12E8H 1T2JA 1NP0A 1BREA 2DT1A 2CIKB 2HH0H 5IR1B 1GUVA 4G80B 4M48H 3HUJE 5LWYH 4IJ3C 3OKKA 1WAAF 3QOKA 3VD9A 1TQUA 2Y07L 4Y4FD 3U0TB 5LXGH 2CLVB 1UACL 5DK0A 3U7BA 3IJ8A 1TQCB 4DGVH 5C71A 5KG9B 3SIMA 3UPAA 1CFVL 2Q8AH 5F44A 3PGDA 5GSRB 4GZIA 2MKWA 3A4WA 1DBKH 3GIVA 1U36A 1UH3A 4PJ7A 3A4XA 4PRNB 3W2DL 3QPQD 4QHUA 2E7BA 2F61A 4Y5YB 3QISA 4ZDHB 1EEQA 3K74B 1SZNA 1WWWX 5DSCA 1HHJA 3V79C 1BD2B 3F58L 2PW2B 2BOBB 2W0PA 4QRUB 2V5MA 1JBJA 2D73A 3SGKC 2GI7A 1DQJA 1TMCB 5F7KC 3VWJC 2PO6A 2YZ1A 4B50A 3ZR6A 1A7QH 1JPGB 2ATPB 2C1PB 1C5CL 4MQXD 1JD9A 1NC4D 1J01A 1XR9A 1QPXA 3W25A 1BD2D 3L9RB 1VEOA 4M93B 3QUML 3SJVB 3SKOA 4F33A 5FA4A 4KI1A 3QUKA 1A1OA 4MA8L 3SKNB 5IEKB 5KSVB 5TQ2L 3TTQA 2XG9A 1MAKA 4U1GC 4OM0H 4BKLB 1PZ5B 2ITCB 4HUUA 4JPIB 1EV2E 4F66A 3HI6H 1T80A 4PG9A 3I6LE 3H9SE 3ARBA 3QEGH 1Q9WA 1KLFA 1AE6H 1G6RH 2X42A 2ZUQB 4PJDB 5E9DE 3IFNL 5IF0B 3EYPA 3PXHA 2V5YA 3WUBA 1QOKA 1A1NB 4I4WA 4BH8A 5C0DA 1AGEA 3G6JB 1UXWA 4PJXB 1E3XA 5L2KB 3CHDA 4L3CA 1BLIA 3L4WA 3SDAC 4NGHH 4OFDA 2F15A 3WFDH 1GIGH 4ZFOA 1X5LA 2W38A 2Z9TA 3FFCA 5IJVA 1I8KB 1AXTL 1SJHB 4QRSB 3TIDB 3CUHA 1OSPH 2FD6L 3NIYA 1DL7H 3JWNC 4HUXA 1Z5LB 5F7DB 4XAWL 4YXLH 1RUKH 3O4LE 3IANA 1KIRA 1JGDA 1RUML 2ZUUA 2NLJA 2WCSA 3EDEA 3GXMA 1YEHH 3LQMA 4CD8A 3W6LA 1FH7A 4HFWA 5CIPB 4TVPH 1KTKE 5IEHA 2RAMA 4HKBA 3O6FB 1JGDB 1UH2A 3QHTC 1Z9OA 2NY4C 3MBXH 3VDBA 3FFDB 4HUXB 5F7DA 5LKNA 5DDHA 3MOAL 2A38A 4I0PA 1YMME 1MFAH 5EBWB 5HYIA 1XGYL 4MDIA 3RDTD 3VNZA 1H3UA 4LVHC 4ODVH 1KGCE 1J0HA 2MQ0A 1JE6A 1RV6X 5LQBL 1CK0L 5GPRA 1WBXA 2D9QB 1UD2A 1R3KA 1W3JA 1U3HB 2GK0A 4G9DB 4P4RA 4PJXA 1RZFL 3AXIA 4CD5A 4OM1H 3ZMRA 4HAGA 3VRLF 5L8JB 4HC1L 3GI8L 1NEZA 4X8JA 3L1OL 1N6QH 2R8SL 1OT1A 4XNQB 3RPIA 1Q9WB 3OBAA 4XI5D 4JGJA 3C6SB 3WUWG 2RQ8A 2NW2B 3GMNB 4PG9B 5F3HA 1NGXB 1B88A 1EJ6A 4M6NL 1GNXA 3FCTA 1D7FA 1URLA 1UR0A 1NAKL 1PG7X 1QFUL 2J6EL 4DVRL 4YDJB 1R75A 3GB7B 5C92A 5JBDA 1MFAL 1ZHLA 4JFPB 2NR6C 4G6FD 2XN2A 3MMEB 3PJSB 4CVXA 4D0CB 1XYZA 3G9AB 1ZLWK 4JRXE 4BFEA 1N5AA 4OZ4B 4TNVF 4QHKJ 1M7DA 4WKHA 5HI4C 2KZWA 3HZKA 5FKAB 2YL5A 3LRSA 2VTFA 1MREH 4WFGD 1ZANH 2BSRA 2DH2A 1Q6FA 3D69B 3TT3L 4FP8H 2CRYA 1DQTA 1BLNB 2VI0A 1PX8A 1LILA 2AJZB 3OWEA 3OA5A 1FGNL 4XH2A 4HCRL 5EIQA 4MSWB 1QR1B 4PMUA 4NNPH 4Y7EA 4RGOL 5GSRA 1ACZA 1ZV5A 4LCWA 1FDLL 3LKQB 4V1DD 4UQDA 4OCXL 4MD4A 5FKPA 3KJ6L 5IVZB 2ZOKA 4ZAKB 5C0GA 4YGVA 4M1CD 2OYKA 4NN7C 5FCZA 1FL3B 4NCDA 4XP6L 3STLB 1KXHA 2R2EA 5A43C 3VFPB 4GRMA 1FO0H 5LA1A 4KK9D 4OZFA 3U30C 3IFNH 5E6IA 4ZOBA 3TBTB 4F7CA 2LU4A 2Z31B 2FR4B 4EXKA 1A6VH 5HGHA 2CUHA 3DVGB 4GW5B 5DRZA 1VFBB 1EEZB 3OB0H 1E28A 3PWNB 3AIRA 1JNHA 4S2SA 5CILH 3HNSL 1FFOA 4N0FB 4MYWB 5D1ZA 3ULVD 1R6VA 2OTWA 3B9KD 1LO0L 4I5BA 1MCCA 1J1PH 3DBXB 3JUYA 1EDGA 4X6CA 3TYGH 4U7KA 5CEZE 3HHRB 1IGML 5MERB 3HNSH 5GISL 1R5WB 4H88L 4PJ7E 4JHAL 5CSYA 5I15L 2BNJA 2VZTA 1U8LB 1KGUA 4NBYB 2GFTA 1LLOA 2LTQC 1K2DA 2D4DA 1BFTA 3N1GC 2R1YB 3V6FB 1YZZA 1N0LA 1G7LA 2MSPA 3SCNA 4CUCA 4KAQH 3RTQC 2YOCA 4F7TA 4YDIH 4BA0A 3VFSB 1BF2A 4Y4KB 4GS7C 5HHXL 3NDYA 5E2TL 2IAMD 1YEKL 2CLZB 2VDNH 1ISWA 4PRAB 3FQUB 2JE8A 4ELMF 4U6XA 1MCWW 4J3XA 3SDCC 1CE1L 3F7PC 4X7CC 1E4WH 3MRMA 1HILA 5BRZD 1CICB 3D25B 4HCRH 4PLNC 3OKEB 1FBIH 3VFWB 1BX2B 2JF7A 3VXSD 4MJ6A 4GG6A 2QSQA 3ZE1E 2ZCKL 1YNTB 5ICZB 1L8NA 2FIKB 2DDQL 4KKLC 4WUUD 2QLYA 3T3PF 2CRZA 1PD6A 4KJYB 2YD3A 2FZ3B 3OGCA 3TBSB 3ZDXE 1UWQA 4QHLB 4LVNB 3FRPA 3AMCA 5BROA 1F13A 5T3ZH 3BQUB 5L9DL 3VXMD 2CKBA 1EEUA 5A6LA 4R3SA 1KCLA 3MJ8B 4MHHI 5F96H 1HXMB 4RL3A 4RWYH 2C3XA 2VDOH 4PG2A 2DL2A 1BP3B 1A9BA 5DGRA 2OK0L 2EJ1A 1CZ1A 4LAJH 3LSOB 2EKJA 4NZUH 5EUOE 4U3HA 1F3JB 3WXVL 4DZBA 1NCWL 3KPRB 4YNYB 2BNUB 1WAAA 1QO3B 4PJAA 3WH9A 3ARGB 5A3IC 3C08L 3MFFA 4L8DA 1A3RH 1UM5H 4IEFB 5BQ7A 5F7UA 4JY4A 3DHUA 1IM9D 2XKUA 4ALAL 2C4FT 4I3SH 2IAMB 5DMKA 3PZNA 3WD5H 1D6EA 1HVXA 1GQJA 5C3TA 1T2XA 4K7PY 3HTLX 1KJ2B 4M9OA 4PREB 2Z93A 4AW7A 3BH8B 3N12A 1G7QB 5SWSA 3C8DA 4PP1D 4F9DA 5HHOE 3WS6C 1MJ8L 1VAHA 4NNYB 1A21A 2D0FA 4HH9A 4G42A 2YMXL 1SMOA 2XNAA 4KTEH 3DX8B 3CFBB 3WFHA 2VR4A 1KN2H 4LRIC 4HIIA 3GGWB 4OFKA 3MUIA 1HWWA 5DMIH 3QNXB 2WINA 1UD6A 4PYGA 4UQBA 4HFUH 1BFSA 4Q22A 1T5XA 1YQ2A 4JRYD 2FX9L 2XPGB 4PBWD 5IM7B 3OKMB 3SE8H 1HJVA 1WPCA 1T7VA 4YDVA 1N8ZA 5A1AA 3E6HB 4PGZA 1S3KH 2VQTA 3F65A 2VLKE 3LX9A 3WDHA 4OCSL 5D71L 2BXYA 4HUKB 3WNMA 2Q7YB 3DDGA 1NDGB 4RSVA 5C0EA 4RRPA 1ZA6A 4ELKA 2LVCA 3IFOB 4PRIA 1DUYA 4LFHG 2XVNA 1ZSDB 4KRLB 4OZHB 1G1CA 3MO1B 1MELA 4EUPH 4FFVD 4HLJA 3AMKA 5FCUL 5C0FA 4ATDA 5JA8B 3ZDYF 1D5IL 1S7UB 5IQ7L 3QDJD 5K9QI 2R0LH 3EYFA 3BHBA 1HXYA 3V4PL 3ES6A 3BEVA 2E7LA 1IGIL 4N9GA 1NBVH 1E6OL 3HZ3A 4K68A 3GZAA 2VDML 4D8PA 2YPKA 3AXLA 3DUHA 4H5SB 3CDCA 2UY7A 5DI8A 2ZOXA 1T2QL 2AQ3A 4RZCA 1T89C 5IHSA 4MXWL 2WWDA 4NO3A 2OI9C 2H2SC 4HOXA 2ZICA 4Q7DA 4TUKH 1MFUA 3AI0A 3MC0A 3QG7L 1QFOA 5JPMA 1NAMA 1KYOK 3VD7A 3NTCH 5JXAL 3FRUA 3VA2C 2WMIB 3H9HB 1MFBH 2QR0A 3AIWA 5D2NA 5DQ9A 1LEIA 4L8SB 2D03H 5FYJH 4JFUA 4K3DL 4K71C 4M24A 5HYSG 4HXAH 1JNDA 1A4JB 3MXVH 1Z9LA 2WP3T 4YXHL 4ZUSA 5LA0A 4NI3A 1NPUA 2FJFA 4TQEH 1FG2B 2P5ED 2DM4A 2AXGA 2HKHH 5B4MC 1AQKL 4BQ4A 1MFCL 5ICYA 1A7OH 5I8KL 1UKSA 2Z1KA 3E8UH 1YMHA 3ARBC 4Y16A 3S97C 1T7XA 4X7SL 2HH0L 4D71A 2LABA 4GKNB 3O45A 2Z91A 3T04D 1NGWB 3QO1B 4HGWA 4HIXL 5E56A 5HGGS 4DEPC 1KYOJ 3VRIA 4XZUB 2CBIA 3SJVD 3NH7L 5GS0C 4JHWL 4UZGA 2W59A 1QI0A 4WCYL 1OQXA 5FOBB 3KLAA 3QJHB 1WV7T 5BYWA 4PJ8A 3AROA 3RQ3A 3HR5A 1MREL 3QEQB 2WC7A 3N0PB 4PFEA 4UU9A 4GMTH 2EYSA 2FGLA 3HG1A 4X6DA 5DVOA 3QUXC 5F7YC 4OKDA 1ZS2A 4M81A 1V3LA 3O6MH 4GUPB 4TUFA 4IRSD 1T2QH 3RI5F 3QPXH 5DFTA 3ZSTA 4RMUA 2GJJA 4NQCA 4X7TB 1OAUH 2X70B 4WHCA 2D3NA 3Q3GA 5GRWA 4NX0A 4JFDE 4GI8A 4G6ML 5FF6B 3GM0A 1YJDC 4P2OC 2LFGA 4D6IA 4IRSB 1A14H 4BM7A 2OL3B 3ULVE 2IAMA 3CX5J 3PABA 4PEEA 1HIMH 1I1AB 2X2YA 5K33A 1TVDA 4M7JH 2R8SH 5TE7H 1CVRA 1KXTB 5D2LA 2QLVB 3BN3B 1UZ6F 1CPUA 3VD3A 1MRFL 2E27L 2FBJH 5JQ6H 3NIDF 4PLJC 4E8DA 1D5XA 4JQVA 3L2MA 4MNHA 1TUXA 1HKLH 1WEJH 4E41A 4ODHH 3GO1H 5EULV 3DX3A 5GGQL 3K2MC 4H8WC 3M07A 5F1KC 4C7GA 4R90H 2GUOA 3QHMA 5E00A 1QA9B 5H37H 5EO1A 4WLCA 1KJ2H 1OLLA 4UDUA 5HD8D 3MBXL 4PY7B 3RDTB 1JTOA 2D3LA 3H7BB 4PTVA 5FUCE 1R3JB 3OXRB 5JXEA 4RMTA 4JFDD 4S3KA 4Y5VA 3EMQA 2VLKB 1CT8A 2DLTA 1KLUB 4TSAH 3V0VB 4UNTA 1XF5B 2FECI 2IBZY 2QEJA 5CBAB 2XVPA 4OCYL 1RZJH 3GNOA 4HPOH 1NC4B 3UJTL 4DM1A 1NCCH 2YLAA 3QHZH 3BPLC 5HHNB 4WEBL 4MQ7B 3DETD 4W6WB 3O3BB 4KKCC 5EIVA 5JO5B 2X4SB 3V0VA 1FVCA 4ZFGH 4WU5B 1E6SM 1NOUA 1D6VL 4U6XB 4OJYA 3FQUA 3CLEH 4U1HA 3EJSA 1JZ6A 4KC3B 1C5DA 3D0VA 1MYRA 4GKSA 2FATH 1C91A 2ZXQA 4J7RA 2VVNA 3GH7A 1HH9A 1OSEA 5FHBH 2AEQH 1HIZA 3MV9A 4X99A 2CRIA 4RFNC 5EO1B 5K59E 1MQ8A 2DIJA 4PJEB 5DT1L 1VFUA 4LHJB 2AEWA 1K2DB 1HHHB 4RX4D 3QJFB 2IH3B 5GRYA 3LAFA 8FABB 2Q1EA 3Q6FB 2IADA 5DHVB 3W0WA 3HZVB 4PTTB 1AR1D 4GS7B 4M4PA 3ET9F 3BKJL 5IB3A 1RQ5A 5D2LB 1KXTA 4I5BB 4HT1H 1XF3B 3K81A 5A95A 2VRQA 1IL1B 4A6YH 2JIXD 4RWYL 3IFLH 5BVPL 3OR6B 4U6HB 3G5YB 3EMCA 2Z0BA 4WFFE 2BZDA 3U4BL 3VIGA 2GTWA 4M7KL 3AM8C 1JFXA 3IETA 2G5BB 2YZ8A 25C8L 3MROB 4UNUA 2NY3D 5FF6A 5D9OA 2XG5A 4PJGB 3VFVA 4DFIA 1CD8A 4X7TA 4Q9BA 1IMHC 5ESAA 1JRHL 2JIXB 2C3WA 5EU4A 2QKIA 4RFOL 2VAJA 5IW3A 2WBJC 1V0NA 2PTUA 3LQAH 3CFCL 3G04A 1BFNA 3L3OA 5FYJD 3W39B 4YGVB 3LKQA 3K1DA 1DE4B 3HC3L 4TSAL 3AUVA 1L7IL 4UOQA 3GNPA 1Q38A 4QHNB 4HHAB 1T04B 3S3JA 2XVGA 3LZFL 4XP4L 3PQYB 4OCLC 1MFEL 4O2FA 3ARPA 4O9HH 3QCTH 1BPLB 2VUYA 1XGUB 4NN7B 4YAQB 4YBQD 3T0EE 5CJ5A 1XD0A 2YD7A 4HAFA 4APQA 3LCYA 3ORJA 3DUSA 3QT2A 2BSRB 2BY1A 2CGRH 3JWDC 5MHSE 5DTFA 5IHRA 1WJ3A 5ICYB 5IMOB 4Y19E 4P23B 3MMEA 3MA7B 3HG5A 1U2HA 4OZIB 2VDPH 1SJEA 4U6VH 2FRGP 4XPBL 3R8QA 2YL9A 1CLOL 3OQ3B 2UVEA 4PY8J 2R29H 4PR5B 3BGFB 1YMMD 3MRLA 3KZSA 4DVRH 1FHGA 3MRNA 3OKYA 4L8SA 1QX1A 4LMQE 2G2RB 2R1XA 2A83A 2AJVH 1NAMB 1ADQH 1DQLL 5K9KA 4AEFA 1UWRA 3QDGE 2VABA 3VH8G 2EO1A 3VXSA 3KDMA 2G9HA 4ZYKA 4AZBA 4C56E 1GOHA 2YFNA 1PFCA 1NFDB 3QHOA 3GJFB 4L4VB 4PJIE 1SYSB 2HLAA 5ADOL 3WQ5A 5JW3H 5IFHH 4F37F 4YHOL 5F9AC 1BYBA 4C56A 3OB8A 3AXLB 4MDIB 5JOFB 5AYUL 4XBGB 4UBDD 3SE9H 3QDGA 4EI6A 1K9FA 1DQML 4L8CA 4C7FA 1JVKA 3V6ZA 4K3EH 2YA0A 2EADA 2XWDA 4LPUA 4ZEPA 4XPHL 4GBXC 3F6IA 3RL1A 3UTSA 1UD3A 4KTDH 2MMXA 2YD2A 4TVPL 3NN8A 2VR9A 2OJZH 3MRIA 1ZLUH 5J9PA 3P11L 4XZBA 4LEOB 1X4ZA 1AI1H 1KJVA 4MXQD 5DVKA 1K6AA 2GTZA 4KI5C 1W32A 1B3YA 5DT7A 3EFFB 5TQ0L 3KXFE 3AS2A 4OF5A 2MCPL 2JJTC 4PJ5D 4IDJL 4RBPH 5BV7H 1K4CA 1TTUA 3PZGA 5F1IB 3SGDI 4ZFOB 4KKNA 1I4FB 5A3ID 1KF9B 1NAML 1NFKA 3EFDH 1N0XH 3FB8B 3LKPA 5CHNA 2ZX8A 2E9WA 2J8FA 4U1NA 5C08B 5DA4A 4FXKA 3NTCL 5EFFA 1CFNB 1N6QL 3LB6D 5JORB 2JJTA 1RK1A 2WNWA 5I1EH 1QBLL 4BFIB 2NMSA 4YHPA 5ESVB 2F2HA 2UY4A 3GGWA 5BO1H 1QLFA 3SE3A 1KB3A 4S1DC 2AGJL 1TJGL 3GBNH 3QZWA 1YN6B 3M17B 4R0LC 4XB3A 1SM3H 1Q6CA 2YBTA 3LV3B 2XT1B 3HMXL 4YR6B 4XGZA 2Z93B 3IXTA 4KQ4L 4MWFA 2OX5A 3BAIA 1CENA 3PBGA 1AO7E 5ESQA 1JD7A 1CLXA 2HVMA 2OS7A 5IHUL 4IMKC 1B3XA 1H09A 4BF7A 4LKXB 2W63A 1MCKA 1U8JB 1S7SB 2H6PA 4R96B 5H2BB 2F18A 4LPVA 3OMZA 2IANA 1J1OL 5A8MA 4WK9A 1QYGL 2NXYB 3QUZC 2C0HA 3RI5K 2DOCA 2ED7A 3H42L 2B5IB 4UI2A 1HJQA 1RVFH 2ZCLH 3IXAA 5BS0A 2C8NA 4MAUL 4Z7QE 1NCTA 5DF0A 1J9CT 1P53A 1EX0A 1MJ7H 4TSBH 4X6CF 3T3MF 2J6EA 5CEZD 3I3BA 1D2KA 4PTWA 1RHFA 2Y6SC 1HXMA 4PUBL 4OB5L 3H9YA 4OLEA 3PE9A 1PQZA 4P4KB 4KGJA 4X4YA 3PV6A 3DXAE 4X4XA 4QOKB 1BZ7A 1T66D 2J78A 3AFBA 1CDJA 2BRRH 2WIIA 1NGYB 2H32B 4BK4A 4FNQA 4W88A 5E08H 4J8RA 2YUVA 3UEZA 1RUAH 3O11A 4GG6B 3PDOB 1LEKA 1O7DC 1YNLH 5HPCA 5BV7C 3QIWD 3SKJL 12E8L 2CRMA 1FIGL 1GGUA 3VWJD 1QSFA 4OTXH 4Y19B 5LBSL 4GXUM 3CFDA 4XNZB 2X4RA 2P5WE 1FP5A 4PRAA 1A9EB 3RILA 3DARA 2IANE 4A3HA 2DEPA 2X4NB 3I9GL 1S9XB 3P4OA 1FGVH 2R0KH 3MJ7B 1DLFH 5DJCB 1ZS8B 4N90D 4RDQG 1E0VA 1OTTC 3TBYA 4DW2L 1M05B 1TZ7A 3G6DL 4WFHE 1NCAH 1H5BC 1SBBA 4PJ9A 3N17A 5GGUA 3QFDB 3S36L 3DXAD 2CKSA 4HWZB 4NKMA 5DFAA 5EFIB 5KJRL 4OFPA 4JRXA 4FQQA 1YUHA 3CVHB 4R7NA 5F21B 5CEYA 1MUJB 3V52L 6TAAA 1S9XA 3P4OB 1ITBB 5C86A 5HYFA 2Y2WA 2EC9T 5A2BA 3PGFL 3GXPA 3PIQA 2AKRA 5ETUB 5IQ7H 4TVSa 4LYQA 3M46A 1E70M 2APWA 4E42B 1UACH 2IUZA 3LN5A 1NLDH 1DANU 2KPNA 3QUMA 1E56A 2BFVL 2Q8XA 1HH6B 2YIHA 3O6AA 1GPOH 2A3CA 1CLVA 1YY9C 3DVGA 4GW5A 4LLMB 1S8DB 4PSRA 2Z31A 5ABFA 1G94A 2JIWA 5ITFB 2YC1A 1OB0A 1X5GA 4NQUA 1WGOA 1RJLB 1NGYA 2WIIB 1DVFA 4PJGE 5LYRA 1EAPB 3GSOB 3C9NA 4QOKA 2HA1A 5D8JH 3U48A 4K9EC 1MVUA 4PS4H 5FKPB 5IVZA 3MRHA 1GC1H 4LSSH 1HSAB 2K7PA 1NH6A 2C4FU 4ZOCA 5FOJA 3MGTB 4QGTA 3CFJB 4UTAH 4YHNA 4RGMC 3QDJA 2DI7A 3QDAA 3B9EA 5I0ZA 3HZMA 3LRHA 1BLNA 3HLAA 4WHTB 4DN3L 2VRKA 4JO3L 3B2VH 1HJWA 1U33A 2EIZA 3MV01 3U36B 1JZ3A 2R0KL 2XQBH 4R4BA 1EGJL 3QDJB 5TDPB 5DWUL 1M7DB 3MGTA 3A67L 2RCSH 1T1ZA 1KCVH 1SEBB 3N1PC 4LAQH 1PY4A 4HC1A 2VX5A 1AGBB 1JJUA 3G5ZA 1X5YA 2ZJSL 5F72S 4JFWA 3B5HA 5IQ9A 5IOPB 1TFHA 3OJDB 3C9NB 2HG5A 5TF1H 2L7JA 4Y5VC 4AJ0A 2Q86B 4IRJD 2YL6A 1DN0B 2YPLE 1I9IL 3CZFB 4LEXL 1T3FB 2QQKL 4OUUB 4UOW1 1A6PA 5DUBB 3MLTA 3UJJH 5MI0B 4Q9QL 1FFPB 3K1KC 3TBVB 3PQYE 3TA9A 1WNOA 1OAZH 3MU7A 4FNUA 1X5AA 5DD3L 4G6JL 4P2RE 4X7FC 3BAEL 4E5XA 3DV6A 1FYTB 1KPRB 5C09A 5BZWA 2BFVH 2UZYB 3CPLA 4XCCH 1A0QL 3PWLA 1VB9A 3A6BL 4MDPA 2QHAA 2BJML 3PIQB 1OL0A 1R3KB 4D6CA 2SEBA 4AIZA 2OP4H 2IH1A 4OCRH 1IQWH 3KYMA 1UZ1A 3GBML 3NACL 3GFUA 5I1GH 1U93B 4HOWA 5J13B 4Y16D 1G7PA 4QT5A 3U9UB 3WNLA 3O2VH 2ZUQC 3PWUA 5I8OL 5CMAB 3BAXA 5HGDB 4JFYA 3MLYL 3WD0A 4AD2A 1JYVA 4JHOA 2F19H 1HKIA 1JPTH 5E8PB 3HB3D 2NXZD 1NANH 3QWOB 4U1MA 3ZKND 2X2IA 3ZE0E 3GIZH 5D9NA 5I71B 2X4RB 1IC7H 5HYQB 1W1VA 4MB1A 3QDGB 4IRJB 4IOIA 3SE4A 5EC1A 3P3YA 5CJQL 4JFFE 4P2QE 3JXAA 3VJ6A 5IMKA 3UTOA 3PL6B 1QOXA 3WQVA 3KJ4C 4NQDD 4MCZB 5KVDL 3RU8H 2XTJC 3HC4H 4LLVA 2H32H 4TOYH 4ZPTA 1ROWA 2DM3A 3FHAA 5C0DB 4BH8B 4HDIB 3BD4A 1JNNL 1TXKA 1U8MA 1MWAL 5IF0A 2KH2B 2F54A 3L1OH 4AEHH 1E55A 3SCQA 3B2UD 2HKFL 5DURB 1MFDL 3AFLA 3U1SL 4B0MM 4ZNEE 4XV0A 4OFYD 1B9ZA 2PB1A 3Q1SH 4JFZH 5I75B 1FL6B 4LHUB 1HHGB 2FB4H 5EU7C 5HGBA 1U8NB 3VI4F 3WSUA 3QNYB 3DSFH 3N1MC 4XCCL 3SKNA 1JGUL 4ODVL 5IEKA 32C2A 1FNLA 1CS6A 4PTUA 1BM3L 4MNKA 1U2CA 3OZPA 3BEWB 1RZ8A 1LO3L 3KPNA 4WW2C 5IVXA 3A5VA 4H1LA 4RMRA 5KSBB 1XR9B 1LWRA 2ATPA 3CLFH 2VDKL 3KJ6H 3MI6A 2Q6WA 3MRCA 5FCSH 1IC5H 1INEL 1ND0A 4GKZB 2ZXDA 1OF2B 3UO1L 3QZWG 4MNQE 4KTYA 4HKJA 5DJXB 1TJHL 3EO0B 1BEYL 3QI9B 2J3SA 5FO8A 1C12A 1QLFB 4QHNA 1A6ZB 1KJ3L 5EZJB 2EPKX 1UA3A 1FNAA 1L9MA 4KAQL 1C92A 4F58L 3DHPA 2GDUA 1XF2B 1UKPA 3QXUA 1DR9A 5EUOA 4K71B 2G3IA 4IIQB 2BVOA 1D5BA 1B3ZA 1CIUA 3ZE0F 4FFWC 1J1XH 2F8VA 3CFKA 1GOWA 3UTQB 3TM6A 2AV1B 3FO0H 3IKKA 4DGIL 2DTMH 5SV3A 1B3VA 5EU4B 3AICA 3FQRB 4I3RH 1I8MB 4MJID 1NAMH 1LJYA 1J0KA 2VRJA 3BUYB 5D7LD 3LMJL 4QRQB 5HHOD 4UQCA 2DTML 2IPTL 3MYJA 4J4PC 3O3AB 4LIQH 4MJIB 3NIGF 4FQ2L 1AKJA 1KR1A 2CKBL 4ZNEA 3OG2A 1K3IA 4M8UA 3CU7A 1CYGA 1MFVA 2ZSWA 1ZGLP 3LOWA 3MRRB 4EXPX 4OM1L 3SGEI 4JZOB 4BSVB 5MEQA 3G6MA 3BWAB 1EO8L 4L9LC 4UBDC 8FABA 1WZKA 3CUFA 4CVZB 3ZKMD 1MLCB 4XNXL 4JFSA 3QJFA 3WQ4A 4I48B 4M61B 4FXGB 3I6KA 1ZGLA 3KL5A 1H11A 1IKNA 5C6TH 3BI9X 4WUKL 3IDXH 4WDIB 4DKEL 4Z9KB 3WEOA 1EEYA 4AD3A 1H5BA 4PJ9C 3W24A 2BSSB 4NBXB 1NFDA 2PF0A 1T5WB 3K8LA 1MCIA 2V9QA 4YDIL 3GSQB 1XZ0A 1ZMYA 5JZ7D 3BDYH 3P9WB 3B3IB 1G0CA 4FRWA 4HMEA 5C6TL 1KBGL 1U91A 2HJLB 4U3XA 1ZVSA 1IAIM 3JTSA 1YEIL 3VIPA 3WF4A 1QVOA 1A6UH 4YX2L 1R47A 1VIWA 4XNUL 3QEHA 4FLRA 1I7ZB 1J10A 2H9GB 5HHOA 5D8ZA 3TYFA 2XXMB 2CIIA 5EPMA 3JTTA 2JK5A 4PY7A 3X13A 3TFKD 4FTVA 5DK3A 2ZIDA 4MVBD 4PPTA 1SJEB 1NL0H 5MI0C 1E0WA 3OAZK 5I30L 1IE5A 2V9TA 3VIIA 2A6DB 2XY1A 2Q87A 2EDLA 3THCA 4MZ2A 4U6YB 3OGSA 2VXSL 4RMQA 5AWNH 1CXLA 2XXCB 4Z0BL 3VD5A 1J1XL 2EACA 2DMKA 2P8MA 4HWBA 3TH4T 4NZJA 5M7QA 1UA6L 2NNAA 4R97C 5IWLC 2H3NA 3PQYA 1A3LH 3L5WB 2H2SD 1I1AA 1T04A 4HHAA 4LSPL 3KLHC 5LQBH 4MAYA 3GXIA 3FOLA 4PCTA 4QNPE 1KR0A 2J62A 1KN4L 4FFZH 5E94A 3K2UL 2P8LA 3HMWH 5C0JA 3C2AH 1OARH 2X1XR 4JFFB 2WYSA 5I2UA 1R87A 5E2VL 1J8HD 1TCMA 5E8NA 3B43A 4FN0A 3VMPA 1MNUL 2OI9B 3WHXA 4NJAL 3SDAB 3S5YA 4Y89A 3DGCR 4GLRH 2CKBH 4ZXBD 1N7MH 2R1WB 4JRYA 3TO2A 4XBPA 3HAEH 5E8OB 5TGBB 1GYAA 3LKNA 3Q6GH 3MV11 4P8VA 4EDXB 5FOBA 4ZPVA 2FHCA 1XF4B 4TNWF 1C7TA 4P46C 1EGJA 4Z2IA 4N0CD 3L2LA 2NNAB 2YPVL 1F97A 2BMKB 3CUPA 3O45B 2YD6A 5CP7A 1DTUA 3BAEH 2MTPA 3QIWC 3Q6FA 4L1DA 3GTNA 1SFSA 3X12B 4Z7UF 1QNOA 4YHZH 1BVNP 4AMWA 5FDWB 2NY1B 2QQNL 3JVGA 4XVJL 5EZOH 2O61A 5I8CA 2VLRB 3KLSA 1XC6A 2HTLD 4PJEA 1A14L 4PJ5B 3VX0A 4K94C 2E6QA 2OXHA 3X13B 1F45A 4MJ2A 1A22B 2AV7B 2EDNA 1UR2A 4Z18A 1ES0A 3QUYB 1RZIA 3T0EA 4UAOB 5FV1L 5I18L 4P3CH 5HHNA 3MR9A 2PN5A 3EYSH 2DQFB 2DYPA 3EJUA 3B9KB 2XTJE 3QXWA 2ZNWA 4QCFA 1JNLL 1A6WL 1DQQB 5T5NF 2F58H 1X1NA 4N5UA 4JHBA 5GGVY 3LHPL 1PG7H 1IGTA 2IQAB 4OF3A 4LNRA 3B3IA 1CDUA 3T8XB 4NQTA 3RDTA 4IJ3B 1JMXA 5BW7C 4R8WH 1P4LB 1JI2A 4RA0C 5T3XL 4X7SH 3IJYA 4JRYE 1C1EL 1MLCA 5EU3A 3P4NA 1S7WA 3M8OL 4NSKA 3W27A 2VKXA 4JFXA 4L4TB 3VD4A 4ZXOA 1WT5C 1EHAA 1FG9C 4YHMH 4LPTA 2CUIA 4XCFL 4KJWD 1E4XH 1QFPA 3B4NA 2D7TL 5DGQA 4KDWA 1RP8A 4N0UE 1X5FA 4AEIL 4NWUL 5B38G 3IFOA 3UG3A 2DKMA 4G5ZH 1AGFB 5TF1L 2UWFA 5AZEL 3CX5K 4ZSOE 5C0EB 3MNWB 4H0HB 2X4QA 5GS1A 3CO4A 1M71A 3NVQA 3V4UH 4LDOB 1NCDL 4XMPH 1KWKA 3SCWA 1CGSL 3ROOA 3TLRA 1MWAA 2GJ6D 4ZO8A 15C8H 1N8ZB 2QHRH 5IBTL 3SY0A 1E4KC 2VL4A 5EOQL 2DLEA 2J77A 4R7DB 1BGAA 4OD2B 3QYCA 2E7HA 3BVVA 3LN4B 1T5XB 2EECA 4GAJH 2VYRE 2WINB 3VIOA 3QEQA 5HDLA 4TUKL 5IBTH 4HIIB 4ODXA 3IDYB 3RVTD 3EO0A 1DQDH 4KUCF 3RVUD 1NARA 1KB5B 3P9LB 4M6AA 2VIRA 4V1DA 1MWAB 3KPLA 4JQXA 4NOBA 3VWKA 5L8LB 4RMSA 1FZMA 3V5KA 4UFIA 2X4QB 5GS1B 5L88H 1E27A 4OQTL 1IAIH 1RSFA 1EXUB 1V3MA 3C5JA 3EYVB 2GCYA 2V7HA 4OV6F 3O9WD 4NT6A 3TBWB 1FH8A 4HJJL 3ZZ1A 4CU7A 3VFTB 5F9WB 1HINH 4DN4H 5TFSL 2A77H 1W72A 2XZQH 2QQKH 4P3DA 2MCG1 4R26L 1GGCL 1QWNA 1OD8A 4DZBB 3VSTA 2FL5A 2FIRT 3RUGB 3UTTD 1NOWA 1F90H 4BZYA 1A9BB 4K3DH 2C1OB 3FRUB 2VDLH 3D39A 3ABZA 2X7LB 4R2GB 3S5LB 4M1DL 4AYGA 1X4YA 1FN4A 3GBEA 3MRKA 3BN9D 3WS3A 1H3PH 2A9MH 4G8GE 5J6HA 3S98A 5GIRB 1WZ1L 2LAGB 5GNZA 3MCLL 2IEPA 4LNVA 3ULVC 3UTSD 1EQCA 2BVTA 1UC6A 4NQDA 3E6FA 3ZR5A 1QSEB 2OXGA 2W9DH 3FQTA 2HFFA 2P5EA 1U8KA 2E8YA 1FAIL 3NCYS 3VFWA 3SURA 3SCRA 3DO3A 2R69L 2WHKA 3PHOA 4HWNA 2YS4A 2OWWA 2F8XC 5JLZA 4PRPB 3WLWC 3INUL 3MLRH 3AC0A 3BEVB 4LLQA 4QCIB 3K3QA 3CZLA 2VDMH 2IPKB 1PJ9A 4YBLC 4N5EC 3VIHA 4AH2A 3FZUD 3FY1A 5K93A 5DMJB 3GIZL 1Z0NA 3GZKA 2CPUA 1F4HA 1PG7W 2NY6D 4F7TB 2IAMC 4PRIB 1B0IA 2FGZA 2DQGL 2VLRA 2A0LC 5T1LB 5FHAH 1GW1A 3H6JA 4X6BA 3JWOL 5I79A 3KPPB 4MHHG 1IJ9A 4LKCA 1U8LA 1G7PB 2R0WL 1T0NB 4N0RA 4RGNE 2AJYH 3V9FA 3E1F1 1ESWA 4Y4FA 3G9VA 4JKKA 1G0XA 4DO6A 4PS4L 3I3EA 1WDQA 2BMKA 3X11A 1F6AA 2N7BA 1IVLA 1UWGH 4N8PA 5C0IB 4YZFE 1N4XH 1T0MB 2CPCA 2J8UB 5JPNA 3D87B 1LNUA 2VURA 3AIBA 1ED3A 5C09B 3MLUH 5E2UL 5FA3A 1RJYA 1JNHB 4S2SB 3TNNA 5AD0A 1I9JH 4WWKA 1EEZA 1QHZA 2GJZA 3I3DA 4MMXC 3IDJA 4XCFH 4DJMA 4FXLA 1C08B 2B1HH 1OAZL 3WKZA 3ALWA 5D7JA 3PWJB 4OD3H 4P2QD 3T77B 1CE1H 1KBBA 3NIFE 3KPSB 4R4ND 4Y4HC 2XRAL 3AXXA 4OLWH 1P4BL 4JVWA 3N06B 1GHSA 2VRAA 1CVSC 3WYRA 2P8LB 5IQ9B 4O58H 3STZA 3FOLB 2O5XH 2GEEA 1A7RH 5IIEA 4KI5D 2R69H 1I85C 4PJFA 5CD3A 1FP9A 3CXHK 2OZ4H 1H3GA 1Y6NR 2GJXB 4I3SL 1BGXL 4L3EB 4M6OL 1A5FL 1WSST 4OSUL 1SM3L 3WMBA 4HMCA 5TPWH 1IEAA 4UV7L 4OBSA 3O4LA 2BNUA 3KPQA 2YDSA 2ADGB 3ARDA 1DEDA 3LRSB 2KUTA 4RMWA 1XH3B 1HEZB 4WEMB 1BQHG 4YHIB 2Y8KA 5GZOC 3F4VA 4W7WA 2NY5H 3UYOD 3FQNA 4DVBB 3Q5YA 4TVPD 4AMKH 1KELH 3OLDA 1MVUB 5CILL 2EKSB 3B8YA 2C9AA 5JIIA 4BQ2A 4I0KA 1VBUA 3GSOA 4QF1B 4U3CA 2VCAA 2I5YH 5SWQA 4MNQA 5IB2B 4AD5A 5CSGA 5I17B 4WO4B 2HYMA 3TVMB 2MCPH 5FYJU 5C0BD 3RAJL 4XCNB 3O41B 1AR2A 1SJVA 3QIUD 4M43L 3LVEA 4M5YL 4X0KA 1I7ZA 1BAGA 4HKXB 5F1OB 2R56L 1W0WB 1UH4A 4MAZA 4CD7A 5D6DA 1NUDA 4NOFA 1BYCA 3MSGA 4QNPF 2AABL 3JTSB 4K55A 2AJSH 2PR4L 2HVJA 4BZ1H 1U3HA 4G9DA 2KBGA 5HHPB 1P69B 3KJ4B 2CIPA 3NIFF 1UB6B 1M01A 4JO1H 1MI5E 1EFXD 4OZGA 1FDLH 2XM1A 4MD5B 3ME0A 1QLEH 1IARB 3PUCA 5JW3L 3LHPH 4X9IA 1A7BA 2EYTB 1H4PA 5AY7A 1O7AA 2BNRE 3QRGH 5I1IL 1BMGA 5T3XD 1BWMA 1U8QA 1JPSL 4W68A 2WBJA 4MVBC 4PBVC 5MERA 1V6UA 4NO5A 3VVGA 4NQEE 1DQLH 3UBXA 4NPYA 1US2A 1WWBX 4S1SH 2CKRA 4YXKH 1A9EA 2X4TB 5J11B 4C4KO 4XHQA 1J5OH 1HHIA 4YUEH 3P73A 3C5ZA 1KLGB 2J4WH 4M6ML 2EEXA 4OF8A 1YY8B 1DBJH 4LCCB 5BO1L 4W6XB 1G9MC 5A6BA 3AISA 1I8MA 3L3KA 1T1YA 3RM8A 3TVMC 1A6TA 5BJTB 4C83B 5J7CC 4BYHA 3STLA 1ZU8A 1DCLA 1LE9B 1Q0YL 3CFKB 1BZ7B 4UIMB 1V6XA 4IIQA 4X4YB 1A5FH 4OSUH 1W3LA 4NC1E 5BWFA 4OI8A 5I1JH 4W5UA 2G3NA 3BE1L 4GG6E 3PXJA 4AL8H 1FZOA 1KBKA 2UUDK 3BT2H 4ACZA 1C12B 4H8WH 1ZT4A 2C3VB 4XH2B 4MD0A 3SDXB 5DJXA 5GJTH 4XP4H 4KHXH 4ACPA 2OR7A 1UJ3A 1V7MH 4CKVX 3BXWA 3LQAL 1CFSB 1FNFA 4GFTB 1T1XA 5LGJB 3KL0A 1N64L 5E99H 5F3BA 3TCLA 1A3HA 2I25N 3NDZA 1KN2L 3GNMH 1Q1JL 3QFJE 4OZGE 1EO8H 2YMXH 4N0CC 5I5RA 2B0SH 3M45A 1YEGH 2P4AB 1WICA 5FIPA 3U4BH 4P3CL 4F9PA 3QUZA 4YR6A 3PP3H 1BD2A 2MPAH 4KDTC 5CIPH 4G8EB 2AJUH 3SEPA 4EIGB 5F6HI 2WVVB 5IBUG 1H3TA 1WP6A 1U8NA 1QQDA 3M17A 4G8IB 3ULUD 2C3VA 3FN3A 3WH6A 3RFZC 2O92A 2HTLC 3FT4A 3PGDB 3VILA 1BIHA 3KS0J 3HNTL 3FO2A 1ADQL 1F5WA 5EBMA 1MJUH 2O9PA 3W38A 3ZLQC 1U8MB 4OLUH 5FAAA 4JG0L 3CMJA 3RZCB 2Y1VA 1CDBA 4LVEA 3BPCB 3BRFA 1GOOA 4G80A 1HIML 2CIKA 5D8WA 2E3ZA 3EDKA 4HGMA 3DPBA 4LSUL 1CLOH 2WANA 1GQLA 3EDDA 3QULB 1MPAL 1NC2D 3HZYB 1ZHKA 1YY8A 3IDMA 3ZDZF 2GTZB 1NL0L 1KLGA 3Q6GL 3QPXL 1HDMB 2DPEA 4Z0XA 2NSXA 1VKXB 3HCVA 2F19L 2XIIA 5CEZH 5JDSB 2V3GA 2FCBA 3ILQC 1KBGH 3CC5B 5E8PA 4UMGA 4GZJA 4Q6IC 4BZ2H 2NLJB 2MANA 1S9WB 3ROLB 4E9LA 4JJHA 4Z0XB 1LE5B 4KKAD 4ODTL 4OJFH 2WCGA 3S36X 4X7EC 1MCFA 4NUGL 2F54D 3MV8A 5EU6A 4OF0A 2Z1SA 1ZHKB 3GSNH 3IDMB 1G0YR 4M1DH 2WZIA 1ISVA 1REIA 1DQMH 3AOFA 1IC1A 5CJOL 2VXUH 4UQ2A 3MLSH 3FKUS 4JAMA 3DETC 3BMVA 1UB6A 3DO7A 4XVSL 5DQDH 4Y4KD 4R5EA 3IDGB 1RAMA 3FB7B 3U7YH 1IT9H 4NHUA 4MJ4A 4BFBD 4FABL 5JUEH 3N85H 4HIHA 1OGAA 1FHDA 2XZQL 3UTZB 1P9MC 5C0AD 4Z0BH 5EBMB 3W11D 2W4XA 2EH7L 3FMGH 3ARSA 2NXYD 5EB9A 3WEXB 2DF3A 2VCCA 1IAIL 3MRNB 4QKXB 3G5XB 1NBQA 4PR5A 1N3NB 4HF5H 4ZS6C 3T0XA 5C0AB 1EQPA 3QUKB 5FGSA 3WUZA 4Y0GA 3QUZB 2ALWA 1VGEL 5BCAA 4FQPA 5EUOF 3D9AH 1BHGA 3GSWB 4D0BA 5ID0A 2ARJA 2P5WA 3ARFA 2RCSL 5TDNB 4OOZA 1AGBA 1JF5A 3GMMB 3BP5B 1T6VN 4Z7NE 2X9XA 2Z8VC 2VQUA 1FOBA 2X4OB 3DOSA 3RVXC 1DQJB 3ILPA 4JKPL 1OOAA 2P44B 1T1XB 2DWDA 5LGJA 4GRLD 2HT2C 4P59H 1JN6A 4L8BB 3DUSB 4WY7L 3ZHDA 3CMOH 1DDHB 5A2FA 5D7KD 3UMTA 3RL2A 5C2UB 2J12B 4QRRE 2VJXA 4M1RA 1ZT4B 3EJTA 3GIVB 1VFMA 1KJ3H 5IMLA 1FZOB 1UWEL 2APVA 3STZB 5F88A 4K3JL 5KG9A 1YYML 1B4RA 3MRGB 2GSGB 2YUZA 5E1AB 5J4MA 1GQIA 2FDBP 3VXPB 5K59F 2BNQE 2IQ9H 4X5XB 3MOBL 3WD4A 3SDXE 1TPXB 3WFCH 2F53D 4TQEL 1YEJH 4X9BA 3DWTA 3VFUB 2EDOA 5ITFA 2HT4C 3A4AA 1AMYA 3VFVB 3L4TA 5K9QG 4LLMA 3RNQA 3BVXA 1HT6A 3BKMH 1S7QA 1K6QH 1VACA 4PGBA 3RGVA 5DJ2B 5JHLH 2X41A 4FLOA 2HWZL 3F5LA 4HXAL 5C0CA 5INDA 3ALFA 1HNGA 2EDXA 1IBGH 2R0WH 5BMFL 3RWGA 1H0DA 1I7TB 1FFQA 3PG2A 1WTGT 2P24B 1MOEA 4TTDC 5ABDE 3QXDB 2WAGA 2V2WA 1SBSH 1U95B 3UAJD 3WKNA 2ITDB 2XWJB 1S78C 3SCTA 5D2LE 2Z92A 1XSJA 5LAXA 2VDQH 4M82A 2MHAA 1IGIH 4GKSB 5B38A 4W87A 1OAUL 4X9FA 4PTMA 3WNKA 3DTXB 3WIIL 1K9DA 2EXWD 4HG4J 4F15B 1XGYH 3AB0B 3SCPA 1FVCB 1MQKH 5HVFB 4IUGA 5IW1B 4PRPA 4Y7MA 4EQ2A 2VDQL 3HAEA 4QRPB 1IC7L 5E1QA 3CXDL 3PHOB 1P1ZB 2EIBA 1U8KB 2YRPA 4MAYD 1KLUA 2EDYA 4JJ5A 3VGFA 2ICEA 1LL7A 2HKHL 3W6MA 5JMOC 3OXRA 4J4PD 4WO4A 5AEAA 1O5DT 3IJSA 5I17A 1QPKA 3CDGB 4LGRB 1JK8A 3BUPA 1U9KA 3VI3F 3MXVL 4PN2A 5HOSA 1GC1L 3PWVB 5A3HA 4I13B 5MENE 3THMH 4IM8A 1PPIA 2WW5A 4J3UA 5E00B 3SCMD 3S35X 3L3HA 4ZO9A 3PGCB 2HVKA 2OP4L 1CGTA 2E0PA 1I75A 2FYYB 4ZAKC 4P9HH 5CWSA 5EO0B 2FLRT 4LLUB 3K46A 3VXNB 4FK9A 3HPLA 1EBAA 1IGYB 4Q9CA 3GUTA