1PEZA

Bacillus circulans strain 251 mutant a230v
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
686
structure length
686
Chain Sequence
APDTSSSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDVVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTATWEGGSNHTFTAPSSGTGTINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclomaltodextrin glucanotransferase
publication title Conversion of Cyclodextrin Glycosyltransferase into a Starch Hydrolase by Directed Evolution: The Role of Alanine 230 in Acceptor Subsite +1
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 241
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pezA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pezA01
4XXCA 2EPKX 3D0LB 4JY4B 4CCDA 5SX5H 1TQSA 2HJFB 3L3HA 1ADQA 4BQBA 1BD2D 4OZHA 4XCFH 5DK2A 1YY9D 3V5KA 2D7NA 1DBBH 1DE4B 2F53B 1ZT7B 4OZFB 4NHUB 2OP4H 3ZMRA 2ZWYA 1FFOA 4ZUVA 1JRHH 4J23A 4PPTA 2W4XA 1CU4H 2C3WA 3CK0H 1W9BM 1KXTB 4MQ7A 4LAJH 4R4BB 4HPYL 4YR6A 3UJJH 3V7AG 4XPAH 4U1SB 3OB0H 3NN8A 3QNXB 3H0TA 4X6CE 3VXOA 3RBGA 3W9DA 1P84J 5D1ZC 1ZU8A 3MLYH 5EC1B 5IEKA 1YEIH 4AEIL 4PSRA 1NC4A 2XZAL 3SBWA 3ZDYF 4HTYA 1RY7B 3FFDA 2RHEA 4L8DB 1UWIA 5FHAH 1IQDA 2X40A 3UG5A 4JREB 4LEXL 1G84A 2EDOA 3UTSD 3M7SA 3P73B 1QRNE 5L7XH 2BVEA 4JVWA 4R3SB 5FAAA 5E6IB 2ALWA 4RAVA 2WKLA 3WUWG 5C08D 1M1SA 5M5DA 1NEZG 4KAQH 3THDA 5L8JB 4PJDA 3T2OA 4MNQA 1T0MB 3MACH 4WEBL 1YEDA 3ZTJH 2EYTA 3D0LA 3K4DA 4YHYC 4YK4C 1L7TL 3MXWL 2N56A 2AXHA 2E9LA 1JPGA 5I1GH 5D71L 1N64H 1XCQB 3HB3D 5LA0A 1RUKH 2FBOJ 1GGTA 1ORSB 3GGWB 1UWEH 3AUVA 3KL5A 5EU6B 3C60C 1JGUL 5IJKC 3U4EB 4UDUB 1MVFA 4P5TC 1TA3B 4PJEF 4FQQB 4MX7A 4U1SA 1YJDL 5HSFA 2MHAA 1HXJA 1T2QH 4D6JA 3ARYA 1IAKB 1YUHB 5C0JB 2WC7A 5EBWB 2CUHA 1B2WL 3BZEB 1G1YA 1RZKL 2XI9A 3B5HA 5HGHB 1NLBL 2QQNL 4HUKB 5D2LE 4UFIA 3P73A 4PTUB 1HYRC 3VIOA 1BSIA 3KPSB 4G6FD 2X4TA 4R3SA 5E6IA 1T3FB 1IGIL 4P23D 3PTKA 1HTYA 1XSKA 1T0MA 3WN5C 3W0WA 3U6RB 1MCRA 1OB1A 4ODXA 2R1YA 5A95A 2ZOKA 4B3LA 1XGQB 4ZEPA 3VX1A 3CC5B 3CXDL 5BVPL 1XCQA 2A0LC 4M48L 4LYQA 4MNKA 4HPOL 1I1AD 5C92A 1BYAA 1RHHA 3GGWA 3O2DH 4Q9RL 2GSJA 4Z18A 5IWLA 5ID0B 4NNXB 1QLEL 2YFOA 4ZOBA 1KTCA 4OKVB 1NGPH 5LCVH 1IAKA 3LHPH 3TZVD 4D6GA 3VFVB 5C86A 1A3HA 5EBWA 2OJEA 1DVFD 2EDHA 4IOFC 5JUEH 1NFDE 2OTUB 5E6ZA 3ZZ1A 3QRGH 1G1CA 4JGJA 4FABL 3S5LG 1BFTA 4LHUB 3KPSA 5SWZD 1EFXA 1T3FA 1XGPA 3GIZH 3V7AE 1QNZH 1NSNH 4S1SL 4WTZG 1KFAH 1MI5B 3QJFA 1AD0A 3RGVD 5TD4A 4UQEA 1NGQH 2DQCL 4OLEA 5FEBA 1ROWA 4PD4K 4MVBD 1QI0A 4IIQB 2DKUA 1OGBA 4LDOB 3RKDD 5CMAA 4ATWA 3QEHB 1H2JA 3S34L 1K6AA 2PWGA 1CGWA 3INUH 2NXYB 3IFOB 2ZG1A 4RE3A 3QIWC 4PJIF 5CSYA 2CBUA 1Q9OA 4LBEA 5AC4A 3T8XA 4OLWH 1MAML 4FK9A 5FIPA 3D52A 4FFVD 1TQWA 3AZTA 3VIGA 4LSUL 5JBEA 4HJGB 1FV1B 1IAIH 2P46B 3EYOA 4F58L 3SDCC 1NANI 2FEDC 3U9UB 3LKNB 3O4LA 4JHBA 2NCMA 1QA9B 1U58A 2AVGA 2WHMA 1XGUB 5BRPA 4MDPA 1QKZL 1IT9L 4QT5A 1FVEB 1B3JA 1MH5A 4LDEB 2YPLD 1R86A 3EHBD 5ICXB 4V1DB 4YXLL 1CFTB 3JWDL 1BQCA 1BOGB 5JHLH 4JB9L 5F9WB 5I1DA 4UCFA 4WHDA 4HQQH 4XBGB 3BJ91 2YFNA 4QRPB 4JM4L 4FQXC 4W93A 5GSRA 1UKPA 4JG1H 3CUFA 4HC1H 4MDIA 3D0VA 1MI5A 5I77A 2P8PA 2YOCA 1BBJA 1WFNA 2OS7A 4RMQA 3G6AA 2VX5A 2VURA 3BP7A 2PO6D 5GZND 3RILA 3QEHA 1ACYH 1S7QA 3CPLA 1C92A 5DI8B 5M95B 4C59B 5J1SC 1GAFL 3WIHA 3GXDA 4LSRH 1C90A 4JPIA 4PJDF 3O6FB 3TF7C 5KSBB 5E8OB 3TZVC 4L8CB 1BHGA 2BXZA 1IC5L 5GRVK 5DYOB 2VXTL 1UVQA 1DVFC 1AP2B 4KQ4H 1E28B 5CGYC 5F1SA 4DKAA 4Z2KA 1T83A 5E5MA 2PXYA 5CD5C 4EK7A 2CDFB 4P4KB 1MRDL 3L6FB 4J7RA 2EH7L 2ITCB 3L3KA 1IGFL 1OGAB 3WNNA 3LKNA 4I0KA 3MRIB 4HLZG 4R97C 5DEZA 1TG7A 2B1HH 4RWHA 1KV3A 4RCAA 2Y4SA 3RGVC 1QWUA 2NQCA 3ZSSA 4FZ8H 2FCBA 3CLFL 4IOIB 3WDIA 3BPLC 3KG5A 4L8SB 3F7VB 3SJVE 4KUCF 1CDJA 4WUKL 4K8RL 2C1PA 2HTLC 2ED9A 2WQRA 1LL6A 4IRJC 4GO6B 1NP0A 2YBTA 1XEDA 1JD7A 1IBGH 1LJYA 4JKKA 5IFPA 1XH1A 1CZ1A 4XT1C 3L3GB 4JFHE 1JYVA 1RH9A 5GGTH 3GBNH 3MROB 1CGUA 3WS6C 3RWJB 4D0CB 3O6FA 2DWDA 2DBLL 5E8OA 1EUUA 1FPTH 4Z2LA 5BZDB 1RIHH 5DYOA 4IBLT 7FABL 4DZ8B 3EHBC 2WWCA 2Z93A 1Y18B 2Y07L 3L6FA 1G7JB 1OGAA 3QUXB 1IGJA 1TVHB 2XRAH 3WV0A 4F8TA 1P84K 3NTCH 4LLWA 5CJ8A 4PGJA 2AJVL 2QQKH 5B22A 5I16B 2F54B 3QJHA 4LXFA 1DL7L 2XWJA 3RBSA 2OXGA 2DQGH 3FZUC 5F7DB 3VXME 4RE2A 4JM2F 1KTDA 4P8WA 3HAEH 5D1XA 1T4KB 2PO6C 2VRJA 5I24A 4X98B 1BEYH 4OGZA 4N0CD 4G6ML 1AI1L 2G9HB 4NC0B 4XZWA 4AM0B 2EDQA 2ENYA 3RX8A 1HILA 2D7TH 5TH2B 2X9YA 3N1PC 3VFUB 3GXNA 3R8QA 1M7IA 1QSEE 2FO4A 5KSAB 4JFDD 5FGBA 1N2RA 5HI4D 1JV5A 4ELMB 4UTAL 3LPPA 2OWWA 3MROA 5JLZB 3RWJA 2EACA 1L9MA 1INDL 4D0CA 4BCEA 4J3WA 3ULVH 4QRQA 1ZT1B 4U7KA 4PJ8B 5D7JD 5I71B 5T3XE 1I8KB 3QG7H 2ZX8A 4NZFA 4JL2A 4HIEB 1V02A 3MUHL 2GT9B 4HWBA 3DUSB 3QUXA 3RL1B 4NO3A 4F9LA 2FJHB 4KRUA 2P5WB 2R29L 3U4BL 1FP8A 3L4XA 4CD4A 3PL6D 4FLOA 3MCG1 3OR7B 4QRRA 3A4WA 4H88H 2GVYA 3FQRB 2D0FA 1MFAH 3RP1A 5DUML 2BY0A 4HUWA 1FP5A 1MW2A 4BH7A 1T4KA 3HFML 3CZNA 2NY0B 2AEQH 3PZQA 4GQPH 1NBYB 3MRJB 1CE6B 3PTQA 3SKOA 4AM0A 1HCFX 2X4RB 5DUPH 1FGNH 1EHLL 3NDZA 3H9SE 3G6DL 4LASL 3AMDA 4MAYC 2O5YL 5H94B 3KLKA 1S9VB 1TXKA 2NY1D 3GMRA 2CGRL 5KSAA 2J7CA 1V3JA 2PNDA 3RIFK 1NWRA 5ALBH 5F1NA 2F7RA 5JLZA 3DUUA 5D9NA 4AC1X 3KR3L 1I85A 1RSFA 4AENB 2C3GA 4PJ8A 1MFCH 1FDLH 3L3OA 5DVMA 2V17H 4H20H 2Y06L 1JYNA 2EC9T 1ULVA 4HIEA 4TVPH 1EQCA 3DUSA 2HFFB 2X1QA 2HFGH 2JCCE 4LSSH 4ODTH 1CDYA 3RL1A 5CUSH 1AGBA 4R27A 4OZGB 4B16A 1KNOB 4NOBA 3ZL4H 5GGSA 3ARFA 4Q6IB 3KNBA 3BP5A 5I5RA 4L1HA 3HZYB 5D93C 5BVJB 3Q2CA 5JBFA 1INQB 2AV7B 3SCMD 3I84A 3TN0C 4M00A 3CZ8A 4I48B 3QPQD 3KPOB 2XYCA 5ACZA 3NH7L 5HI4C 2D73A 4HA3A 1BZ7B 2J5LB 3UEZA 3VE0B 4YUEH 1NBYA 1TCMA 3CZFA 5CIPH 1CE6A 3VFTA 4LRIA 2V5YA 5BV7L 3FQUA 4S1QL 1SBSL 5I74C 5T1LA 2R56L 3EGSA 3Q48A 1S9VA 2OSWA 1ORQA 3EO9L 5FDWA 4LVOC 3PDOB 3VFMB 3BP6A 2A9NL 4DN3H 3KEHA 2ZNXA 25C8H 5EWIH 4ACZB 1SHMA 4A6YH 4AENA 3B9KC 5BROA 3ZKQD 3PL6C 2GK0B 4N90E 2UYLA 3GBEA 5DJXA 4RIRB 5JZ7C 3WLBA 4OGYH 5HYJA 3N06B 1UWRA 3WF1A 1MCWM 1KNOA 5KW9H 4NUGL 1JZ6A 3CSYB 3NZ8A 3KPRE 1JNLH 4Q6IA 4PMZA 1T6VN 2C3HA 1RURH 4KI5D 3HZYA 4NC1E 3ZT7A 1TZ7A 1BIIB 5IGXL 1INQA 2AV7A 1XGYL 1CECA 4YFEA 3PN8A 3QNZB 4JVPA 4IS6B 2EYRB 4PP2B 3UETA 3FO2B 5DMGD 3UC0H 4ZUSB 4FQJL 3EJYD 4AIEA 1F6AB 4H8WL 1W9UA 3ALXA 4YE4H 1BZ7A 3MMEA 4KDTA 2HMID 2IBGA 3S4SB 1LILA 2BVPB 4M7KL 2VWEE 5EFFA 1U8KB 3OL2A 4OD1L 2AK4B 3MV11 3QA3B 4MA8H 4WLCA 4H25B 3HZMA 4F15B 4GG6B 4LKCB 2DGAA 3DX9B 3MA7B 4NWUH 3VXQB 4U5KA 4UQAA 5IHLB 4GUPA 3ECBB 1AKJA 3PQYB 3ZKND 1TETL 5CSZB 2BC4B 1EVTC 2GK0A 4CMHC 1JPTL 3FN3A 4NFBA 3O3AA 5CEYA 1Q72H 3CLEH 5D7KD 3SCMC 4RIRA 4JG0L 4YDLC 1HJSA 2BNUA 4X9IA 1OQOA 1EEUA 4OFVA 1BZQK 5D5MA 1AJ7H 5I18L 4JKPH 4YZFF 2MPAL 3E8UL 5ICZB 4FQHB 4Z9KB 1FNLA 1WT5C 1A6WL 1RZGB 2AV1B 4PJXB 3SDXE 4IS6A 2EYRA 3BPOB 2MTPA 1QEWB 3UROR 3I9GL 3WY3A 35C8H 1A22B 1F6AA 3T0EE 5FM8A 5C0AB 5IFHH 4UOJA 4XPHL 3GSWB 1D9KC 1J8HB 4GAGH 4JO3H 5MEQA 1NAML 3BEWA 5BW7C 2AK1L 4XTRC 4EVNB 1RZJH 2E7BA 1A6ZB 3BDBA 4KJPD 2BVPA 1DBML 1W8OA 4FQCL 4JLRA 3BT2L 1JF1B 2ZX9A 3QA3A 4H25A 1B31A 3MI6A 1GRWA 3B9DA 4OD3L 3KLSA 5EMYA 3IFLH 1JI1A 5IG7B 1P6AB 3HG1B 3VD7A 2O92A 3CCHB 1ZBKA 3THCA 2BC4A 1SY6A 5IW3A 1R8LA 4PMDA 1A4JB 3FB8A 4O4YL 3BO8B 5HDLA 4M6OH 3FQNA 3VWKB 4KJQC 3TOPA 2DICA 1IKFL 3F58L 3QUYC 1HDMA 3BEVA 5D4YA 4KJYB 3ALGA 3CZSA 2X89A 2PW2B 5D7LD 4AMKH 1G6RL 3LKRA 2HMIC 1RZGA 3OJDB 2WW5A 4PJXA 1RZ7L 1YPZA 3QUZB 3A67L 4OCYH 3W24A 1VCAA 1IM9D 5KZCB 5JDSB 1ZVSB 1GOGA 2RBLA 2QSQA 1V5JA 2HVJB 1J8HA 5IKCA 1NQBA 1GQLA 3BH8B 4N68A 5L2JB 3ZKNC 3HZKB 3VGEA 2VLJB 5C9JB 1JF1A 3IJSA 3MFFA 4MAZA 3IDNB 1I1CA 1MJ8H 2XYLA 4KRTA 2DJUA 5L2KE 1WWAX 2UZIH 2IWGA 3M46A 4D9RD 5FDYA 3O2DA 3GK8H 3HG1A 3VWJC 3BQUC 3GDBA 2XN9D 4I2XB 2YLLA 2GSIB 3GXTA 2JJUA 3DRQB 4P57A 1A4JA 3ZE0F 2AEIT 2Q6WB 3MLXH 4I1NB 1TVBA 3VWKA 1KJMA 3DRTB 2I9TB 3O4OB 4YBQD 5FUCE 2OTPA 5JPNB 3IAPA 4Y5VA 3CX5K 1MREH 1MFDL 4AL8H 4YDKL 1YZZA 3FT2A 1N59A 3CZLA 4L3EB 5I1AA 2PW2A 2IH3A 1R46A 3ARGD 4E41E 1E4WL 1BGXH 3O8XB 4ZTPH 1A0QL 4OI9A 3OJDA 1UWQA 3KE0A 1K8IA 2AEPH 4H26B 3W5NA 1VGKB 3VGFA 3K8MA 3QPXL 3SQBA 1V6WA 3VIFA 3DC0A 2BNRA 4OV6F 3L3JA 4LLVB 3MANA 1R3HB 1T5XA 4KTEL 2QV4A 1C3FA 1IAMA 4JGUA 4PJCB 1UB5B 4A2LA 4PBVC 1T89A 3FOMB 5JQ6H 2ZUVA 1Y6NR 3HZKA 3V0VB 1AD9A 2FH8A 1U33A 4U1GC 4Z7UF 1CN4A 5C9JA 3FFCA 3IDXH 3IDNA 4CUCA 2WUCH 3OAUL 3PGCB 1DQML 5DMYA 4PSPA 5AAWA 2YRPA 2I60H 4MA1C 1ZLWK 1ZHBA 4HW6A 1G9EA 2GSIA 3UYRL 3BAJA 5KS9F 2UWEB 2ADFH 2NY2C 3CSBA 5I8KL 4NWTH 4JFQB 4RMSA 5L8LB 5CPQA 1P9MA 3VUPA 3ES6A 4JFXB 1NUDA 2Y7QB 1HHJB 4XGZA 3UXFA 5EC2A 4PTWA 5ANME 4BSWA 4W5ZA 1FNSL 4GQ9L 1BQUA 1JBJA 5GGVY 3D1MC 1TLKA 4QKXB 1VESA 2CUMA 2FECL 3GKWL 4H26A 4AIZA 1VGKA 4R4FH 4WU7B 2ICEB 5ESVA 5D5MF 5IROA 3MOQA 1MUJA 2X70B 4NM4H 3VFGL 4PJCA 1UB5A 1MIEH 2XOTA 4JRXD 3GJFH 1TZHB 1IVLA 3W2DH 5CGMA 5FB8B 3MV01 1VHPA 1RJYB 3LV3A 1UWXK 1CZ8H 1GYAA 1WLHA 1GJUA 1OAKL 3DWTA 4NHCH 3PGCA 5FK9A 1CD9B 2BCKB 2QSVA 2LAGB 2YHGA 3V6OC 3AREA 1VPOL 4TOYL 1WBZA 1ZBWA 4G7YL 1S7XA 5MEPA 1IQWL 1JI2A 4FTVE 3EYUH 4NCC2 1EDQA 4TUKH 3RX7A 1ZLSL 4JFQA 3FB6A 1NGYB 5IFJA 3S3SA 1UCTA 2NX5E 4XVUD 4Y4FA 1KGUA 1PQZB 2J47A 4M24A 4OUEA 1MQ8A 5C0BB 2R39A 2W0FB 2GEEA 3NCBB 1B0GA 1DN2A 3KXFE 1YNKL 4CRPA 4NQTA 3LN9A 2R0LL 4K94L 3HE7D 1R33A 4KKBD 1A9EB 3NIDF 1TQBB 5E2TH 2L7UA 3QDMD 4BKLB 3PP4L 1ZHKB 3HAEB 1W3KA 2ICEA 3RJXA 4Y88A 3AIQA 2Q1EA 1CIUA 2G3JA 4L4OA 1P4IL 2LU4A 3IRPX 2X4SA 2DQEH 4U1MB 5T5FL 1FZOB 4Z95L 3Q6FA 5CEZL 4J3TA 5EUKA 5FB8A 4QCIA 1RJYA 2D03H 3DSFH 1I3GL 1YPZF 4Y16D 2YK1L 3GMLA 1AXSB 4G80A 1LWHA 2P42B 3EDKA 5GHWH 2BCKA 3BRDA 2Z8VC 32C2B 1U2CA 1ISXA 3CVIL 3VD4A 1H09A 3VXUB 4XB3A 1RFDL 4GPNA 4OIIL 4CW1B 5CEZE 3G6JB 1BVKB 4XPTL 1UR8A 3VFWA 3QH3A 4WUUE 4HIIB 2J79A 3LPGA 3B6SB 2BNQD 3BKCL 5I1LA 1QYGH 1QFWI 3QRFM 3DX8A 1BD2A 1S9WB 1R7AA 4ZSOB 1WDRA 3NGBB 1GC1L 3ZYZA 5FYJL 4NO0D 3T77B 5E08H 4DM1A 5EZIL 4N42A 5GNXA 1ZHKA 3VXNB 2XSAA 1WC7B 3QQ9C 3MV8E 1ZHNB 1AXIB 4YIQA 3M17A 4OBSA 4WFGD 1ZGLM 1FZOA 1X5ZA 3FOLB 5DVOA 3UCQA 1P4LB 1BQSA 4NQCE 1E6JL 2IQ9H 4BYHA 4LGXA 3PNWB 4G8GB 1GPFA 1XGZA 4QRSB 1OAUH 2GIYA 4TNWK 3P4MB 3IDJB 5AD0A 4G42A 1TNNA 1Z6JT 3LH2L 4FFWC 3LOWA 5IB2A 1QHPA 1KB9K 3W82A 1H8SA 1KWKA 4XVUC 5DT5A 1IILE 1CD8A 2GJZA 1CGYA 2V6HA 2WIIB 2ZG2A 3NJ3A 5F72S 5D2NC 4TX6A 1XR9B 1Q94B 2CLRB 3D85D 1X5GA 2PETA 1RZIA 5C08A 4I77H 3QUKB 1NC2B 3HE7C 2IPKA 5DFVC 3ARZA 2KL6A 4KKBC 4LVNC 5ECJE 2ZOLB 4UAOC 4HIIA 1OARH 1BVLB 4MQXC 4HIJA 3ARVA 5LQBL 4GZJA 3KYKL 3MYJB 4LPVA 3AXLB 1U92B 2X4OB 4CU6A 3MQIA 4HDIB 3VGAB 1I8IB 1NANH 2W38A 3MBXH 2HVKA 4P2RD 1U36A 4D6FA 1J1OH 4Y16C 3HCVA 4GKLA 1SBBA 5CZKA 4F8XA 5AZ2L 3ILPB 4Y0GA 2AW2A 4ZFFA 3D18B 1ZHNA 5CIPB 4OQTH 4XVJL 3FOLA 2FATL 3BX7C 1YNTB 2IC2A 1P4LA 5JOFB 3BDYH 4GLRH 4Y1AD 4G8GA 1JGEB 3JV6A 4KK8C 1OPGH 1JXJA 3MRGB 5E5UB 1OBAA 3IDJA 3VI3F 1QTYT 3NA9H 4P3WA 2E40A 5TFSH 1RULH 2BHUA 5C07B 4BQ2A 4NRYB 5DWUH 4A6YB 3DLQR 3TBWA 1XR9A 3UTPE 3AVEA 3CBWA 5I2UA 1Q94A 1ZA3B 1BVNP 4E8DA 4HKJA 4NQVA 2JK5B 4P23A 4GAJL 1IM3A 1NC2A 5HTSA 4C56B 1G7MB 3MNWA 2Z31B 5EU7E 4U3HA 2ZOLA 4AT6A 2GJ6E 2DQXA 1OY3B 2X1PA 2QADB 3O2VH 5ISZE 3ZKMD 4WWKD 3BVNB 3GMPB 3PXHA 1U8OA 3AXLA 3LKQB 5BJTB 1U92A 3JV4B 1FNFA 4JY6A 4LVHC 2X4OA 2AI0H 3TBSB 4U0RB 1OCWH 1CFSA 1I8IA 3EYSL 4GBXD 4XP4H 2A77H 1G7PB 1I1AA 1IFHL 5B3NA 3BLBA 3D18A 3QDJE 5CIPA 3RX5A 1UD6A 1NLDL 5CP7A 3EOTH 1YNTA 3MRKB 4ZAKD 4BQ9A 4PJ5B 4F7PB 1QW8A 2IGFH 3QNYA 6A3HA 1FE8H 4PJFB 1U8QB 3B9EA 1CR9L 4NN7B 1LL4A 3GSQB 1WFTA 4GOSA 4JFFD 4XXDB 2QHLA 2FIKB 3SCTA 3PWPB 2DAVA 5IHZB 4KK9D 2AGJH 5SWZA 4JZNB 3V6BR 4DGVH 1UM5L 1G7LB 2JK5A 5DJZA 1G7MA 2WZIA 4JDVB 4N0UB 4NZUH 1SJHA 1BX2A 1NBZB 5CFHA 5J56B 3GMPA 5BJTA 3WBAA 4PRIE 3JV4A 1ZEAH 5CAYB 1K2DA 4G3YH 1GQKA 1OTUD 4XVSH 1OF2B 4HMEA 2R8SH 1UJTA 3TIDB 1G7PA 43C9B 2BSRB 5K59E 2NY4D 3EUUA 4D0DA 1N6QH 4CNIA 2YUZA 1U93B 4FQIH 1NCAH 4F7PA 1Q38A 3QQNA 2CHOA 3MSGA 4PJFA 5E94B 1IEHA 2XFYA 4ATDA 3GSQA 3U5UA 2DQTH 2YPLA 4M4PA 3O0RL 1PSKH 4Y2OA 2YJQA 2DDQL 4HJ0D 3PWPA 3MCKA 2CIPA 3LX9A 4U1LB 3T0WA 2F8VA 3PWVB 1RU9L 2ZPKL 5E99H 1GNXA 1R3IL 1G7LA 5KAQG 1NMCC 4J28A 4OTXH 4RGOH 5EZLB 1UM4H 3FB5B 4GBXC 4JDVA 4NZTL 1KELH 1T2XA 4WHTA 3L4VA 1FGVH 4L4TB 3GM8A 5DVNA 1LEIB 3AXIA 3CZKA 4AWEA 4G9FD 2VXUL 1A6UL 5HPMB 4XWGH 3OKNB 5MP6H 1OF2A 2ORBL 2YRZA 1ZLUK 4PRPD 4JFZH 3TIDA 4WW2A 2NY7H 3EJZD 1O7SA 2Z1KA 2VZ3A 5JA9A 3CMOL 1A5FL 5E1AB 2BVOB 3K2UH 4RAUB 3NACL 4U1IB 4RQQB 2CK2A 3MC0A 3VJ6A 2WBJD 4HV8B 3SDDB 1U93A 3QULA 4WJ5A 3MNZB 4FFYH 2ZNWA 4U1JA 4K7FB 5CCKL 2RR3A 2HN7B 5E94A 3TT3L 3H54A 3HLAB 5HVHC 2BDNL 2WVTA 3KPMA 5DZOA 3GSXB 3VH8B 1J1PL 5GISL 1S7WA 1A14H 2DJ4A 2DQHL 5MI0B 2NY3D 4I3RH 3W4RA 3QUMH 1I9JH 4DOHE 2GKIA 3ROOA 1J0JA 2CHNA 1KCRH 1FORH 1T6WA 5E8DL 2BK8A 3IXAB 3QQ3B 4LP4A 4AJ0A 1CD0A 3A21A 2WQ8A 4PJ7A 2VH5L 5HHOB 1QVOB 4FLSA 4U31A 1GUVA 4PN2A 1CDHA 1MAJA 2NY4C 4V2CB 3UJIL 4UTBH 2DMBA 2M2DA 3OKNA 4XZUB 3OJ2C 4XP1H 4ORGB 5SWQB 3I50L 1GPOH 1D3CA 2AAAA 1MQPA 5EORH 5CJQH 1J86A 4OSUH 4U1IA 3UTTE 4RQQA 1OSEA 1OP3K 4WFED 1YNLH 4HV8A 3SDDA 2J2ZA 5IMKB 3IFNL 3NCCB 4ODSL 4Z7OE 5INDB 1I7TA 3WBDA 4J27A 5TE4H 2YSSB 1H0DB 2IMNA 3HLAA 1VDGA 1S7RB 4URTB 1QRKA 1BM3L 1IGCH 2HVMA 2GTZA 2NNAA 5FUOL 3T3MF 1UM6L 3C09B 3WSQH 1MJJA 3D39B 4EJ1C 1IV8A 1CEOA 1Q9LA 3D3VE 1Z2KA 4EXPX 3TNMB 3R06A 5I1HH 4ODWB 1UZ8B 5ABFB 1QVOA 3AFBA 3ILQD 4TQEH 1D5ZB 3V5DB 3POCA 3JSSA 4UUJA 1R24B 4Y2DC 4MZ2A 3VIJA 5IFAL 4XZUA 4ORGA 3M8OH 2WBJC 5A16B 2Z35A 5EU3A 2MJWA 4MMXC 1QLFB 1E71M 2W92A 1C7SA 1HSAB 2XNAB 4P5MB 5GS3A 3X12A 5T1DH 4OCXH 5KSVA 3RVUC 2VDKH 5D7JA 3GNOA 1T20B 3BZ4A 3EMQA 2XVLA 2AJUL 3TO2A 2ZXQA 2V9TA 5MENB 1QHZA 2NY3C 5IMKA 1FNGA 3GJFB 3C6LB 4EAMA 1WFUA 5EU6E 5E2WH 2PW1B 3NCMA 4YFDB 3X13B 1JJUA 4JFHD 5INDA 4W7VA 3H9HA 5IMMB 2YSSA 1H0DA 3Q1SH 5BOPA 1S7RA 5DJ6B 4GSDL 4K8RD 3HC4L 2XG4A 1W32A 4P2QD 1JGDA 4ACPA 5E4EC 4HT1L 3WXWH 4EDXA 2Y6SC 2F8OA 4WGVB 4XAWH 2APTA 2MWCA 1JPSL 2EZ0C 2WLZA 4MXQD 3V2AR 3BZFB 4TPRH 3UO1L 3D39A 1UG6A 2L0DA 1G7QB 2B4CH 2PC8A 5F3HA 3FKUS 1MLBB 3S37L 4KV5F 1KCSH 4ODWA 1RZ8A 2CKBH 1UZ8A 1RUML 1MFUA 5ABFA 2MCG1 3WEZA 4PUDA 5TPWL 1BBDL 3V5DA 1D5ZA 1FC2D 2VDNL 5GRUL 3VXMD 5I1JH 1MPAL 4MJ5A 4OCSL 1NFIB 1KTLA 4RGNB 3O11A 3S36X 4P5MA 4CVXA 1CGTA 5DRNB 2YD2A 2PTTB 3S96B 4P5KA 3U9PL 4C7GA 3P4NB 5A3ID 2YPVL 1T20A 4HF5L 5HOSA 3MREB 2JJSA 1PLGH 5MENA 4PMRA 2CRYA 4N0RA 2GCYB 4XNXL 2K7PA 4XCCH 4WW2F 1BVZA 2K3TA 1A7OL 1CG9B 5IMMA 5C8BB 3RUGB 1HQ4A 1QFHA 2HRPL 5HYSG 5DJ6A 3L2MA 3WHE1 1MQKH 3UP1A 2Z92B 5D72H 1IC4H 2C3XA 3D51A 1MJUL 3RZCB 4KU1A 1WICA 1NOWA 3BZFA 4AYGA 4JPKH 5DJ0B 4P3DA 4AEIH 2CLZB 3R0MA 4JZJC 3W9EA 4GI9A 4JO1L 4LSVH 2XZAH 2CKSA 3DXAB 1S9YB 4HGMA 1FJ1B 5TQ0L 3REVB 4K23H 3UPRB 2OK0L 4PJBA 3Q6GH 2LTQB 2IFFH 3N18A 3SDYL 3MZTA 4GMSL 2WIMA 3VDBA 3HMCA 2OWCA 5I1CL 1XF4B 4HS8L 5I15L 4TOQA 5F93C 4PJ7F 5IB3A 4UV4L 5SX5K 2PUQT 1V7NL 3JXAA 4XMLL 4WF7A 3P4NA 3H9SD 3OXRA 2QEJA 1JGVL 3L4WA 4EUPH 2ATKB 4S11A 3BAEH 1KWGA 3CZJA 1CG9A 3GIVB 4Y8DC 3MRCA 3D25B 5J11B 3RUGA 1QSFD 4DUWA 3OB0K 2J6EL 2X4PA 1JGUH 2A74A 1SMDA 4R4ND 4QHMB 3L3DB 2Z92A 2VXSH 3VW3H 1O7VA 5A2JH 1V7MH 4GXUM 3V6ZA 3LZFH 2G75B 1T2JA 5E8NB 4XBPA 4ODVH 5EDXA 5TQ2L 4YAQA 5A94A 1HJVA 4LOUC 4OGAD 2CLZA 5FO7A 5KZ6A 1ZKAA 2QSCH 1Q8MA 1S9YA 1FJ1A 1B2WH 1RZKH 4QRPE 3DX4A 2V5CA 1W8NA 3KLHD 2QQNH 4JO2L 4K3DL 5I1KH 3BKMH 4S1RH 4JGMA 3ROLB 1CICC 1F90H 1OTSD 1WDSA 1C5DB 8A3HA 5ICYB 3X11B 4HUXB 2H2SD 4YWGL 5HGBB 2JEPA 2MQCA 2VKWA 4AIUA 2VL5A 1EBAA 4N8VA 5HGGS 3RO8A 1F4HA 4ZOEA 4ODUB 4PJHF 4X4XA 4GXPA 2FR4A 1WGOA 4NN6C 5KSBE 2ATKA 1IL1A 4XNYH 2E4TA 1UWUA 4BSJA 5BVPH 2D7PA 1BPLB 4RX4D 1A3LL 4HPOH 3GIVA 3SKUD 3GH7A 1K3IA 4LLUB 2EKSB 4LLDA 3VXRB 4LPYA 1RUAH 4M7LT 3ETBF 1MCNA 5IBTH 1CLYL 1FHGA 1U0QA 2XY1A 5FUZL 2G75A 3VFPA 2XQYG 4HJJL 4K3GA 2IQAB 5I1IH 1CYGA 2I9LA 4AZ7A 1M01A 4CD5A 4Y4KD 2EDEA 4F7CB 1AC0A 5D7SL 2J4WL 2F74B 1CXIA 4D1JA 5BXRA 5EIIA 1E6XM 2XQBL 5DQDL 3MSDA 2RFXB 1F3DH 3V8OA 3UYPA 2VCBA 1WAAA 1PGRB 4TNVK 3QHMA 3OGVA 1RMFH 3WMBA 5C0CE 3X11A 3CFDB 1OAYH 5IB1A 3C8DA 1D6VH 1NL0H 3WKML 2FWOB 4XHJC 2BVDA 1GGCH 2DQCH 3DX7B 3EJUA 1MCOH 2ZUTA 4JY5H 3LKPA 3S34H 4PLJC 3QIBB 4OGAC 3C5ZB 2DLFH 5IFTA 1N8ZB 4U6XB 4GQRA 3TTYA 5EBMA 2EKSA 3WJLA 1G5AA 3FO0H 5D7LA 2XT1B 3KLHC 4OLXH 2VZOA 2GJXA 1MF2H 5DHYB 3QWQB 1KGCE 4Z5RB 2VSCA 4JHZA 1OTSC 2VQTA 2V2TB 3A3HA 2NSXA 1IT9H 2AXGB 3FRPG 3TNNA 4P0DA 4F7CA 3FW6A 2ZJSL 4QEGA 1J0KA 1B6DA 4Z2GA 5DD0L 5D7IE 2XUCA 2BHYA 4HOWA 2Y2WA 4FNLH 4RISL 3SGJA 4X6FB 4JHOA 3SCSA 1W72H 1B3WA 2W5FA 1A7NL 2EIZA 4GS7B 3VDHA 3F7QA 3LN4A 1U8JB 3IXTB 1GZQB 3T0ED 4PJBF 3LY6A 1HK6A 3KYNA 3BAXA 1UR2A 1CXEA 4AZ8A 4ELME 4HBCH 4PJAB 1VJSA 1KCKA 2C1OB 1JWMA 1H4PA 3MV7D 2EEXA 5E4IA 4EN3C 4U5IA 1D5XB 3QIBA 4KKLD 1J9CT 2OR9L 3FHAA 5EOCH 4QY8A 4BH8B 2NXZC 3GSOB 5MERB 3VVGA 1ITBB 3D5OF 3JTSB 4P46B 2G2RB 2D3LA 3NPSC 3ZYJA 5HY9A 4P9HL 3MRFB 3IF1B 5ALCH 1IAOB 3A23A 2OL3A 3ARGA 2P5WE 1MRDH 3H42L 4YHOH 2J8OA 5CP3H 1IARB 2EH7H 4WIQA 1S7SA 4Z7VB 4M56A 3RPIA 4NM8L 1IKNA 1J0HA 2Y1VA 5DRZA 1SJVA 4Z7WB 3WEXB 5I76B 2W9DH 2Z8SA 4PY7B 3V0WH 3IK2A 1QNSA 1I7RB 1MNUH 4KI5F 3TVMB 4APQC 4QLJA 2XTJC 5GSVA 3CLFH 4K3HA 3RVWC 2WK2A 1DDHB 3HE6C 3P0VH 3TEUA 5GNZA 4MJIE 1CFVL 4JRYB 3IXTA 3HI5L 1ZBVA 4WU5A 3HUJB 4GIAA 1ES0B 1C16B 3HPLA 4N1CA 3OJVC 1QFWH 4PJAA 5IMLB 4X6EB 1LO0L 2BOBA 1LDPL 3P40A 4ACYA 1MW3A 4UNIA 1CGSL 3LIZL 5IOPB 1D5XA 1G7IB 2B2XL 1Z3GL 2JB5H 4X7SL 3GSOA 3TGXA 4BH8A 5MERA 4D9QD 3ARBD 4P46A 1MEXL 4JFOA 1IAOA 4YHGA 3TH4T 2N1KA 4N1EA 3DMMD 4OZGE 4HP5A 2BOCA 1J8KA 4PJGA 4J8RB 3HNTL 3V95A 3QUMB 3O6ML 5KN5B 2JTDA 3SUUA 2FX7H 1RP9A 1VEPA 4ZFGH 3GFUA 2AJVH 2VOTA 4TULH 4Z7WA 5KS9B 3BRGC 3SGDI 1PEZA 4XCFL 4PY7A 2WWMD 5E9DB 1YDPB 1I7RA 5HI3C 4JRXA 1DBBL 3TVMA 2VZ1A 4YHNB 2X1OA 4RNRB 2OP4L 3RTQD 4CN4A 1L7IH 3RPKA 1F6LL 1OSZB 1JRHL 4EOWL 1CU4L 3CK0L 5JR1L 1RD6A 4XC1H 4GZEA 3P2TA 3D4YA 5EZJB 4XPAL 1KENH 1IGYA 4QO1A 5T3XH 4PJ9D 3MLYL 1LEGB 2NY6C 4WV1C 1YEIL 1ES0A 4EQ2A 1C16A 5CJOH 1H0GA 3G9AB 3RNQB 3CUHA 1YY8B 1WWCA 3OKOA 4KJWC 5FHAL 5IOPA 1I9IH 4AH2B 1MLCA 1QOXA 4H7VA 4W87A 1AO7B 1FCCA 1INDH 3SKJL 3SO3B 1VENA 5L7XL 5DHVH 4AD1A 3E0GA 3LPWA 3PGDB 1NWUA 4KAQL 4M4RA 1N6UA 4S2SB 2XTJE 4BQ8A 4OZIB 4M9OA 5C0RH 4J8RA 2WZPD 2DB8A 3QUMA 5KN5A 3MACL 2VN4A 4MNHB 1J88A 4FXLA 2IANB 5B8CB 3BVTA 3U30B 2R29H 3OG6B 4GRLD 2VVSA 4MB4A 4KFZC 1YDPA 2JF1A 5I1GL 1BQHB 4FN0A 5DMKB 2DTML 5F21B 4HLZH 4MA3A 2J8UE 1RUKL 5LKNA 1OSZA 1UWEL 1H3PH 1QP1A 2DQDH 5IQ9A 5I17A 1OP5H 3F5LA 4WVRA 2AK4E 2FSEB 1T2QL 4FOMA 4LASH 4GG6E 2CIKB 3MRNB 3AS2A 3NUKA 4JZ5A 3G5VA 3RNQA 1CLOL 4J3UA 5HDBE 2CQVA 5K9JH 2DQJL 2OMBA 3H9ZA 3PQYE 4WFHE 1DWJM 5KG9A 3UERA 4Q2ZB 1KJ2H 1L6ZA 3ZT6A 3H6JA 4M93B 3WF4A 4I9WE 3RWEB 4Z8FH 2BNQA 5GGQL 3UBXI 3SUSA 4Y19B 3L9RB 3PGDA 4LMQE 3DO7B 1W1YA 3IVKB 2ZZUT 2JELH 2JJWA 4NBYB 3TA3D 4OZIA 3QO0B 5JO5B 3RTQC 4XUYA 1PBYA 5IT2H 4LFHD 4MNHA 2BVQB 2IANA 2P24B 1AGEB 3SY0A 1HJUA 1PG7H 2GAZB 4DFHA 2XWEA 2CKBB 2J12B 1ONQB 4XCNB 1OW0A 1UH4A 3WN6A 5J12C 4LNVA 4BELD 1OD8A 1PY4A 2ATPB 4L9LC 3WDPP 5C0AE 2F1BA 3L2LA 4AD2A 5A6LA 2AJSL 4LYRA 3SURA 4MB5A 4RFEA 1ODAA 3S88H 4DGIH 5BZWB 4QLKA 1TTFA 2HT4D 4FS0A 5JMOC 2PYED 3MR9B 1OLLA 1KXVC 3WNLA 3WIJA 5GGRY 5BV7H 3WH5A 4X4ZA 1NGPL 5LCVL 1A6AA 1KPUB 2CIKA 2ZSVB 3LHPL 1S8DB 1ZHLA 4NKMA 2WCAA 4OUUA 3POHA 2HFEA 1ZVYA 2B39A 4NT6A 4PG9A 3GSNH 5JUEL 4O02H 1L0YA 1E4XI 4HBQA 1WWWX 2A9NH 5DS8A 3TYFB 3ARRA 5CJXC 5CLWA 4MGXA 3U0TA 1JDAA 3L9RA 3GIZL 1ZL1A 2V5DA 3DO7A 1NSNL 4YDJB 3IVKA 5KOVC 5JQHC 1KFAL 1VA9A 2NW0A 1QRNB 1B0RB 4RZCB 3QO0A 4NBZB 1FBIL 4QHKI 3VGBA 2MKWA 5IBUB 5B3JE 1X6NA 3IS0X 1NGQL 4JFEE 2P24A 4PMOA 4MD4B 4X99A 4ZUWB 1TJGH 1QI5A 2GAZA 1F42A 4XAKE 2HJKA 1ONQA 4XCNA 5DJCA 4FXKB 3INUL 4P3CL 1H15A 2ATPA 5IGXH 2WCGA 4YHPB 3FT4B 1S9KC 1BGAA 4Y1AA 4PJGF 5FOOA 4OLWL 2BMKA 2WANA 3W0KA 4FQJH 5C2UB 8FABA 4L4VB 4X5LA 3RGHA 4DZBB 5FL1A 1IAIL 2VLJE 1G0XA 2ADJB 3MYZA 5IF0B 1JMZA 3WDJA 1BMGA 1VFFA 2WB5A 3RM8A 1VGEH 4NQUA 1UUQA 1MHCA 2FZ3B 3WH6A 1R3JB 3FRUA 4LAQL 5B38B 1DUZB 4X6CA 5FYLH 4W86A 4NQCD 4OD1H 1ZSDB 3L5HA 4RFNC 3KHQA 4EUPB 3U0WH 1TDQA 3TA3C 3CVHH 5FYJD 1HKMA 4FNRA 5JHLL 4HQQL 4GAFB 3H53A 2VC9A 4WWKA 3K81A 2XM2A 1S78D 1NDGA 4YDJA 3FT3A 5D2LB 4HC1L 5EBLB 1ZB5A 1QRNA 3BCDA 4X5XB 3O81A 4P59H 1EEZA 3DV4A 3GMQA 4RGMB 1HKKA 3VOCA 3VNYA 1TQTA 1TZIB 4MD4A 1DEEA 4ZUWA 5I18H 2HT4C 1UZ1A 2A83B 2FB4H 2XGIA 3AHXA 2MPAH 1ACYL 4FXKA 4MYWB 4CMMA 2G3IA 1MW1A 4ZAKA 5EUOF 5T1MA 4FG6C 4KRPD 3L95A 4UIKL 5JIPA 1A6WH 2OSYA 4DTGH 3P9LA 2W61A 2NTSP 2EE3A 3D48R 3I9GH 2W9EH 5D1ZB 4OAWA 2YPKA 3RY4A 2HKFH 4QXGH 1YMME 2ADJA 5IF0A 3A4AA 4AZIA 1E3XA 1EUTA 5B38A 1ZSDA 3CDGA 3BT2H 2QJDA 2VLLA 3ZDXE 5KANG 2B1HL 4EUPA 2R2BB 3MLSH 4I4WB 5DVKA 2WAGA 3W6MA 4FZ8L 1JVKA 3UDWC 4NQSB 4D72A 1Q9KB 3B9AA 2AS5M 3DVGA 2UWEE 4NQEE 1I1XA 1N5AA 4UOQA 2HT2D 1AHWC 3PZGA 5D2LA 3PG2A 1XH2A 1JTOA 4YHYB 1Z9OA 2GTWB 4HG4K 4X5XA 2UZYB 3TFKD 3WENA 1IBGL 1VFAB 1TZIA 2UUDH 5DFTA 1BIHA 4WSKA 2HTKC 5GGTL 3GBNL 1PZ5B 3B83A 1ODUA 1T5WB 3MBED 3P9MA 2F8QA 3WFDH 4HUMB 4RAHA 1JYXA 4P5TB 1RZ7H 1FPTL 5D1QB 1HVXA 1X44A 3JUYA 1IEAA 3UTOA 1EA9C 1NGXB 2IAMD 5GS2D 5I8CB 1CDBA 2X9XA 5C6WH 1EEYB 3WUWB 1A7QH 3ISWA 3WS3B 1NEZB 3QDJD 5FV2A 2VISB 2XRAL 2P5ED 1T80A 2XTKA 1JZ7A 3NTCL 5L0QC 3EW3B 5ITBH 3U0PA 4PGDA 2G3NA 2DQGL 2ZXBA 4UFKA 3MGAA 4GW5A 4HK3J 1UXSA 2H8PB 3PWNA 1K6QL 1NFDA 4AQ1B 2YD8A 2WMJA 2JB6B 3WN5B 4M1DH 1QR4A 4YBLC 5DRWB 3RIKA 1BEYL 1JZ3A 5IW6B 2XKNA 4TYUA 1UQSA 4GRWF 4KRPC 4PRPA 5C0BE 1U6AH 2D7TL 1CDUA 2VKXA 4G6KH 1OAXL 4ETYA 5A8PA 2FGWH 1IEBA 3QOKA 1RZFH 2HA1A 4YXKH 3PIQB 2PWEA 1V0LA 2D7OA 5DSCB 3KJ6H 3I02B 5IJKA 4LDLB 1T5WA 3NFPB 4PRID 3ULVL 4LRNH 4M8UA 5D1QA 1W72B 3QG7L 2ESVE 3CUJA 5AWNH 4KROB 1LP9F 3KPPB 1NGXA 4KTEH 5I8CA 4Z7QF 2Y8VA 4AIOA 3RDTD 2X41A 1NKRA 3WS3A 3A47A 4N5EC 1RK0A 5T3ZL 3O45B 1A6VL 4MXVE 3UCRA 1HYSD 2ZUMA 4ZXBC 1FP9A 2VQUA 3ULVE 1X5AA 2PCPB 3ZYOA 5A2LH 2NR6D 1P7QB 2D0GA 4H88L 3VXUE 1MFAL 2NW3A 4UFMA 1IMHC 3C8KB 4I0PB 3G6JE 3DHPA 2NLJB 2BV9A 4NZCA 4RRPG 4A3HA 1E40A 5DRWA 4JAMB 3UYRH 5T3ZE 4X6CF 4G8IB 2R69L 5IW6A 3IJYA 2NY5C 3PDGA 3MBEC 5I8KH 5A6KA 5DUPL 3SJVB 5JOEA 4ZO7A 2DQIL 2A3HA 5DF0A 2CSPA 4OF7A 5CWSB 3KPNB 2APVA 3PIQA 1Y6MR 3LEXB 1UQYA 1W1VA 3QIWB 1BAFL 4PTTB 5DSCA 1VFBA 2XA8L 5ALBL 2VQ1B 4GQ9H 3EDJA 4X4YB 1C1EH 4NQXB 3GKWH 4MS8C 1MFCL 1FDLL 2QQLH 2YWZA 4PLKC 5E8PB 1KULA 2HP4A 2V17L 4GZIA 4H20L 3DX6A 2F58H 3S5LB 3SDCB 4YN5A 3KPPA 5K9QI 4JCMA 5F9JA 1KR0A 3AHTA 3VFGH 4AD0A 4LSSL 1F6FB 4ODTL 3SCRA 5IHRA 5DMIH 3ZL4L 1KF9B 2Q8BL 2UWFA 5I8OL 3DBXA 4FQXB 1MCWW 4P7LA 4X9GA 1CLXA 3BXWA 1E1EA 4TX8A 4I0PA 5ABGA 5BMFL 2NLJA 3DX0A 1TVNA 3P4OB 4LLYB 4LEOA 1NC4D 4G6JH 3SEPA 4Z76A 1EMTH 2XM1A 4G8IA 4W5UA 4YUEL 3GJEB 1M05A 3WEMA 1US3A 3X17A 3QXWA 3SJVA 3EJRA 4B0MM 3WKZA 1ZLSH 3WQ8A 1GOIA 4V2XA 4MSWB 1FFNB 3ZDYE 1O6IA 2DEPA 3LEXA 3P4LA 3QIWA 3ZR5A 4PTTA 3HR6A 2VQ1A 4X4YA 3VG9C 4DN3L 1QSEB 4NQXA 25C8L 2R0LH 4U49A 5I23A 1M71B 5I0ZA 5JW4Q 1HYSC 4A6YL 5GRZA 2D31A 5IW1B 3KPQB 5E8PA 2WMIA 1FFPB 3U2SA 3WUEA 5C9KA 1LK2A 3GJFK 2H32A 2XTLA 2DLTA 4P2QA 2NR6C 1C91A 5T5FH 4AK1A 4C4KO 3WFLA 1BWWA 4WTZA 4PR5B 4OGYL 1D5BB 4HPHA 2F53D 4UT6H 4NJAL 1KTBA 5CEZH 2CETA 1QQDB 5C07E 5KW9L 5A8MA 1JNLL 1ZS8B 4ONGL 3BPLB 1KG0A 1RURL 3CGTA 2A9MH 3A6OA 1YA5A 1EHNA 1TVDA 4M1CC 3WO4C 3PZIA 1E4IA 3TJHC 5BRZE 4C56E 2FRGP 1X4XA 2EH8L 2J1KA 3CIQA 3GI9H 4LLYA 5DHVB 4PJEE 4GO8A 4IRJB 4YE4L 4M6NH 3VXMA 5F6IB 4GKNB 4D3CL 4JJ5B 5FECA 3GJEA 5C09B 4PS4H 1CTOA 1G0DA 3RRQA 5KVEH 4HS6B 4UT9H 3T65A 3BAKA 4JEGB 1DQQB 4MSWA 4XXCC 1FFNA 4Y7EA 1NP2A 2PYFB 2ZCLH 3KVQA 4HK0B 1NFDF 5E6ID 5ABHA 1NCNA 4MA8L 4Z7NF 2NZ9C 4B9YA 3DHUA 1E73M 3QEQE 2H2PD 1NJ9B 4WI2A 2ZCHH 1GC1H 1PD6A 2G5RA 1M71A 3EYFB 5KVFH 5IW1A 1TENA 1FFPA 3BDXA 5I66B 2ZE0A 3H7BA 2P44B 4A4AA 4JL1A 4PRWA 3CLEL 1GZPA 2J74A 4PR5A 1RJCA 3TBTB 3FQWB 1AGDB 2X1WL 3SBWC 4KUZH 4DVBB 1DHKA 2JCCB 4LCYA 5EU6D 4JKPL 3V52H 1KQYA 4HHAA 4WY7H 5E7BA 1KJ2B 5LBSH 2WP3T 3VXSB 3ZHKA 2OJZH 4PRHB 5DHVA 3WXVH 35C8L 3IDYB 4N0UE 3T0XA 2J8FA 3ARDA 3OKLA 5IFHL 4GKNA 4GAGL 4JO3L 4LK4A 1OAQH 4BUHA 1JWSA 1RZJL 3W53A 1DQQA 5E0CA 3BE1H 1DBJH 2PYFA 3VFSB 2EABA 3KPSD 3H9SA 4XNUL 4U3AA 3BKYL 1NJ9A 3N85H 3MRHB 4QOKE 1ZGLP 3IFLL 4UQ3A 4ZD3H 4YDVB 4ZXLA 3A6CH 1LNUB 5BS0B 4YX2H 1B2YA 3E6HB 3C9NB 3FONB 5AZ2H 4GINA 3BIAX 4M6OL 4XVJH 5BV7B 7CGTA 3K8KA 3OKEB 3TBTA 3RWGB 2CITA 4JPVL 1B3VA 2JCCA 2ICWI 1TUXA 3GSNB 5HBFA 4JREC 5IVXB 1N6VA 4XH2B 3EYQC 3GSRB 3KPRB 2VDRH 2YR3A 2EPLX 4P2OA 4OCYL 1ACZA 4Y5XA 5E6IC 2DI7A 1SJXA 3SPVA 2WMPA 2B0SH 4MAYB 2NW2B 2H2PC 4L4TE 5IMOB 3S3JA 1GGIH 2PN5A 4OOUA 4HWNA 2IPUG 3WUFA 1R0AH 5DQJB 5D70L 5H2BB 2RGMA 2OYPA 4LHUD 3VFSA 3VDAA 3QGVA 1FH5L 3RVVD 1ZA6A 4HKXB 4JFPA 1OLZA 5JTWA 3EOBA 1H1NA 2D23A 4TSBH 5IB4B 4LCWB 1MI5D 2UZIL 3DROB 1KSRA 4Y5YA 4WJXA 5FCZA 1QBAA 3ZJKA 3EYSH 4LPWA 2KQNA 3GK8L 2OQJB 1UZ6F 5IWLC 3QAZB 4YDIL 1CXKA 4HAGA 3P9WB 1D5MA 3UTZA 3AC0A 1HKJA 3O2WH 4TN9A 2WHLA 4YPGA 2XIDA 5F9DC 4XP9L 2NXYD 3OKEA 2APWA 1MREL 5D93B 4AL8L 3RVXD 4GT7A 3TN0B 4F3FB 6TAAA 4Y4KA 5SV4A 4PJDE 1T1YB 2DJSA 2JIXB 1XCTB 3CVHB 2DYPB 3QDGE 1BGXL 3DURA 4ZTPL 5C6PB 5JOPE 3GSRA 3KPRA 1JPFA 2AEPL 3ARTA 4RMUA 1E6PA 2AABH 4TVCA 3UZVB 5I74B 3O3DB 1MHHB 5D96C 5HHOE 2OSXA 2BVTA 3ZSTA 3RWFB 2EE6A 2NW2A 1PW3A 3SDXB 5IMOA 3S36H 3FAWA 4V1DD 3VXTB 4CBPA 1YYMH 5JQ6L 5H2BA 4KMTH 3M1BB 4LVOB 2XA3A 3MUIA 4NF7A 4QRPD 1ISWA 4QCFA 3B9KB 3IKKA 2WVSA 1F4AA 2R23A 2C8NA 2AOSA 5IJVA 5BQ7A 2OQJA 2BVUA 2I60L 4KVCH 4HA4A 5CSUA 2PWHA 4GMTH 3PZOA 3SGDH 5ADPH 1WCQA 4OLZH 3PZNA 2ADFL 3G04B 3AYSA 4HWZA 3HJEA 3KLAA 1FIGH 3IRZA 2CK0H 3O6FD 1HZHH 5ESAA 5BYWA 4F3FA 3AIVA 2JIXA 1X4YA 4P4KD 3TCLA 5HVWA 2DL2A 2CDGA 4K9EC 3W0WE 1OGAD 3OX8B 2WUBH 3MPCA 4OIAA 4LNRB 4YEFA 5A1AA 4K71B 4XC3H 3MLUH 3O3DA 1RU9H 2R0KH 3BN3B 1YMHA 3V0AC 3SDXA 4NM4L 4Z0XB 4MJ4A 3VXTA 4ZS6D 1M7XA 3T0EA 4GRWH 2VXQL 3MLRH 3RIAK 3VIKA 5FHBH 4PMUA 3P0YL 3OTTA 1NPUA 1CFQA 3RCNA 1CZ8L 3B9KA 3D87B 2XWBA 5GS0L 3MJ9L 4NHCL 2ORBH 2X4UA 4LCIH 2AQ3A 4EXKA 4CMHB 5E0FA 4M6MH 3O6KH 3EOAB 2H41A 5JBDA 3QDHA 3HG3A 3N04A 3GMNA 4YDLB 5I0DA 5L2KB 2C4FT 3AU1A 3S7GA 4Z2JA 2OXHA 3NACH 1T83C 1QWNA 2PXYC 3SDAB 1J87A 2AAVA 3G04A 1NAMA 4TUKL 1QLRB 5M7QA 3BLKA 1Z32X 3S8WA 4PUEA 3ARPA 2MQ0A 4D71A 1KLUA 5DT1L 3B3IA 3GMMA 2CPCA 4W84A 4LCCB 4GKZB 2BDNH 1US2A 1J1PH 5F9WC 5GISH 4WFFE 1BOYA 1NDMA 2DQHH 3MRQB 4JQVA 2F1AA 2JLLA 3OX8A 1D9KB 5E2TL 4LNRA 3QUXD 3TTOA 2J3SA 4E41B 3T1FA 1S46A 4NJ9H 2WNWA 3GSUA 2DQEL 1OGTA 2F54D 1KGCD 3AS0A 4B53A 4KK5D 3E2HC 4PGCB 1ED3B 3BUQA 1W0YT 4HWEH 1B4JL 4PY8I 1UWGH 2D03L 3S6CA 2VABB 2QLYA 2E27L 2RGSA 3KGRA 1J01A 3GMOA 1A1NA 5GIRA 3LB6C 3UJIH 5FM4A 1W3LA 5FO8B 2V3GA 3KDMA 3I50H 4W85A 4HEME 5GHWL 3VGHA 3O6FC 2YN5A 3EOAA 2EO9A 2YBRB 3H9YA 4FQLL 3ARBA 5L2KA 2HJLB 3RWCA 4ZFMA 5KSAD 2FECI 6FABH 4LSTH 3BMVA 3SDAA 3F65A 3QUYB 5A2IH 2QV2A 1J5OL 4CDGC 3DMMA 1FO0H 4ZDHB 5DJYB 5DRXA 4OCRL 5A40E 4LLMB 4PJ8D 1NGZA 1QYGL 1HJQA 3PBGA 4LCCA 3DX2A 4CKVX 4GKZA 1INEH 4ZS6C 5HHMB 1D6EB 2HH0H 3AMCA 2DLEA 5E08L 12E8H 1UM6H 3DXAE 1WCBB 4H1LA 5D1XC 1W1TA 4E41A 2P5WD 3ARXA 4CVWA 4XHQA 1S7UB 1V3KA 4X6DB 3BXNB 3HMXL 2GHWB 1IRAY 4EIGB 5LWYH 4Z2HA 1A7RH 1ED3A 4PGCA 1C8QA 4X4ME 1CFBA 1EO5A 4PJ9A 2IQ9L 1J0YA 1K85A 4NXKA 3RQ3A 4BFGA 1YEGL 2VABA 3REWB 4PV9B 1AQKH 1OAUL 5E8EB 5FGBC 1L8NA 2NY0D 3BN9D 3IKCB 4WTWA 2G41A 4CCEA 3VWJB 5FO8A 3BQUB 3RY6A 4HGWB 4GXVL 5C0ND 1ZTXH 2NTFB 2WBKA 4XVTH 2YBRA 5EU4B 4DW2H 3VIIA 5F96H 2CCRA 2HJLA 4BM7A 5I1EH 3W39B 4I77L 2XPKA 3EKCA 2AMGA 1NCBH 4UOW1 4ZDHA 5DJYA 1HI6A 3QUXC 1P6FA 1P7KB 4R96B 1I3RB 4F9LC 1OM0A 2Z1SA 4LLMA 1G9MC 4WKFA 1PZUB 3HS0A 1SYTA 1V0MA 4GRLA 4QF1B 3BPNC 2NX5B 4KK5C 3IDMB 4OJFH 4UTFA 3AJ7A 1E0WA 2QR0A 1X5KA 5ANMA 4TRPH 3KXFB 4OJYA 4FLRA 1WCBA 4N5UA 1J1OL 4ZNEE 3WY2A 1S7UA 1MQQA 5HI5C 1AR1D 5DTFB 3E6FB 3DGGB 3GO1L 4OQTL 4U1GB 2R1WB 1PJ9A 4XNMA 4E5XB 3BDYL 3WIFB 2V3FA 5CBEA 1ZV5A 5KSAC 1B90A 3WDRA 1OPGL 5E8EA 3TTSA 1JNHA 4QP0A 3IKCA 4I18A 5TFSL 4HGWA 2R9HD 3MGTA 5DWUL 3Q5YA 1I85C 4MD5B 2NY2B 4EI6B 4PJ8C 5EU4A 2GY5A 5I71C 1F13A 2YN3A 5EOCJ 3U9PH 3UAJD 3W39A 1CI5A 3AYRA 4WWID 1WF5A 5EH1A 3DI2B 3DV6A 3IDGB 4UINL 1C08B 4FTVA 3VXRE 1MCEA 3O2VL 2XIBA 2VTFA 2XVKA 4TSCH 3ARFC 4WUUB 5E00B 2BXYA 3WF0A 3QQ4B 1JZ8A 2HRPH 2YL5A 4LSQH 2AI0L 1EAJA 3CFEA 1OCWL 4M61B 2PBGA 4ZOCA 4XP4L 2CRMA 4LPCA 4O2CA 2A77L 3SGKA 1CVSC 2CR3A 2D9CA 4XV0A 4MAUH 5K9KA 1CT8A 3E6FA 4LRIC 3L5WA 2R1WA 5C70A 3EOTL 3ZJ8A 1W0VB 3ARUA 1ZJBA 1QI4A 1CS6A 4YZFE 3SDYH 1U95B 4GMSH 1FE8L 2J8HA 5TDPB 1CF8L 3DVFA 3W26A 3VIHA 4M29A 3CLWA 2MCPH 4UIMA 4YHKH 4ZQKB 3RAJH 3N15A 4BQ5A 5I15H 3K3QA 1FN4B 3HNSL 4EI6A 4UV4H 2AGJL 3KYOB 4IRZL 4DGVL 1WIOA 2AK4D 5F6HI 4NZJA 4QRUB 2A3EA 5BO1H 2VZVA 4JFUA 1V03A 4NZUL 4O2EB 2DM2A 3MS8A 4IPLA 1SEBB 3PQYD 4J1UB 1JDDA 4WUUA 1G7HB 4Q6IC 1ZEAL 2EIDA 3DOSA 2WZHA 4G3YL 4MLSA 2R2HB 1T03H 4XVSL 3KZSA 2J6EH 3L3IB 4Q58C 1MVUA 4FRWA 3TBVB 3QCVH 2CKRA 3S37X 5IV2B 4HU8A 5TQ2H 1AY1H 4GRMB 2D20A 2ZUWA 4UILH 5IHSA 4MDJB 1WZAA 5A2CA 4UQ9A 1N6QL 2X89D 4G9DA 4KDTC 4NQDE 3VILA 1UT9A 4FQIL 3RWHA 1NCAL 3FQXB 2ZUQC 1VBRA 3MV8A 4NYLB 4BFIA 5FF6B 1U95A 2WNGA 2XG5A 3K4ZA 4OKDA 5HVGB 2DQUH 5DEGB 3UAJC 1FZMA 4NQCA 5C0AD 3CMGA 2DQTL 1J8HD 1PSKL 1H5VA 1AQDA 3TO4B 5J6GB 1AC6A 1VACB 2YXFA 3NFSL 1MFVA 4YHEA 1K4CB 1FN4A 1WWBX 1U91B 4N0YH 3GUTB 5E99L 2CRIA 1IC1A 1XHGA 4NKIH 1CL7I 5AYBA 1CQYA 4OTXL 1PZ3A 4RGOL 5HD8D 1UM4L 5T33H 1EAPA 3L1OH 2Z91A 3VRJB 5A8QA 5GGSY 1FGVL 3RIFF 3HG1D 1A3LH 2XWTB 4MCZB 1G7HA 1NGWB 2GJ6B 3MV9B 4XWGL 5EOQL 1R87A 3HG5A 4Z7VE 5MP6L 1HNFA 5ISZB 3LKSA 4JFZL 3VWKD 1UD8A 2NY7L 5IV2A 1N7MH 2I26N 3W37A 5HJ3B 3ZE0E 1F11A 3RI5F 1KACB 4GRMA 5J57B 3WELA 1LMKA 1J1XL 4Z78B 2GFTA 3WFHA 2EXYD 1FFRA 5F7NC 3TPUB 1N5YL 1SVZA 4FFYL 2YD3A 3QUZD 5FF6A 2XQBH 5DQDH 4JRYE 5KZCD 2CLVA 3HUJE 2IUZA 5D2NB 4F15C 1CENA 4KHXH 1U8LB 2VC2L 3QFJB 1KBBA 4HU0A 3TO4A 5J6GA 3GSVB 1YN7B 1A14L 2FEEI 2Q3AA 4NKOB 3X3FL 5HYJE 4I3RL 1K4CA 5DHXB 2FGLA 3W11C 1U91A 1KCLA 3G5ZB 4W88A 2VSDA 1I9JL 4LVNB 3GUTA 3CXHJ 2I27N 3LQMA 2VLJD 3SE9H 1KCRL 1FORL 3IGUA 4DJMA 4I5BB 4XP6H 1Y0LB 2CO6B 4M7ZC 4BZYA 4Z7UE 4JN1H 5DUBA 4JIEA 4B7LA 4IHOB 1NGWA 3PWLB 4UTBL 3WF2A 2YKLL 3RY5A 1WBYB 2FJGB 4PV8B 4XP1L 5EG6C 4Y16B 5H35A 1GPOL 2DM4A 2UY2A 4K3EL 5KS9E 5EORL 5HJ3A 2GJRA 5FGRA 5E9DE 1BLNA 1QI3A 5KOMC 3BAWA 4Z78A 2DIJA 1VBUA 5FKAB 4OSUL 5FGCB 4L3ED 3JWOL 5F1OB 4OD2B 2IAMA 4I8DA 4MA7H 3TPUA 3DYPA 1YNLL 2ZJSH 3O8XD 3B5TA 3DUHA 3QDJA 4JDTH 4XB7A 5DD0H 1ZK9A 1NCCH 1UYQA 5TE4L 1Z9MA 3ULUC 3MRMB 1IGCL 1A7NH 1YEHH 1YN7A 4NKOA 1NCDH 3RVTD 3CH1A 5IVNA 3WSQL 3G5ZA 3RL2B 1XH0A 1MAKA 1Q6EA 3SKNB 1NUNB 2G3MA 1EBPA 1MFBH 1E5JA 5ENWA 1AO7E 1KYOK 4NRXA 5I1HL 1Y0LA 3VWKC 5JHDB 4DWSB 1UHVA 2WAHA 3FHQA 2YEZB 2Z8RA 4R26L 4Y5VC 4LVHB 4TQEL 4HKZA 1KIPB 2OR9H 2J88H 4U6HB 3FQTA 2EXYC 4RA0C 2QBWA 5DJDB 2FJGA 4PB9L 3MJGX 4P9HH 1R47A 3BUDA 1FHLA 4K68A 4PRIA 5DQ9B 4DKEH 4ZUUA 3DSNA 5T1DL 5C6TH 4D8PA 2BX5A 1JFQL 2VDKL 4KXZH 2HLFD 1NWSA 4NM8H 5DVLA 5J1TC 4OD2A 1R3LB 1T89C 3RDTA 4CVZA 4GRWB 5E2WL 5ITFB 4HXBH 3WBEA 1R5VB 2YC1A 2D3NA 3CUIA 5DZLA 1FZKB 4ZPTA 3OHXB 1E6RA 1TQCC 3NIDE 3THML 4EKJA 1E0XA 1WZLA 2ICES 3WXWL 1JDCA 5CEXA 1FL6B 1NMBL 3RL2A 5JW3H 3CHCA 1J0IA 2UY4A 2NYYD 4TPRL 3Q0HA 2B4CL 3SKNA 1KBGH 1LO0H 1KCSL 1XV8A 3EMCA 2CKBL 1FHDA 3TIEA 1JN6B 4Z77A 4DWSA 1P9MC 4UZGA 1R5IA 2DD8L 4Y19E 4P7OA 1Z5LA 1A1MA 2HG5A 4X7SH 4DO4A 3IFPA 5JMRA 4DKFL 5I1JL 1JG9A 2Y23A 2A3CA 3EYVB 3IAGC 5DQ9A 1BG9A 3CV5A 1OD0A 4WSJA 5ESQA 1V6XA 4S3JA 3QEGL 4JFSA 5IROC 5C0BD 3N9GH 4QHUA 3RWIB 3LQAC 3T2QA 3ALWA 3B2UC 5LAXB 3UR7A 1PLGL 2VDLL 3TLRA 2C3VA 2OMNA 2DH3A 4XCCL 3UTTB 4NN5C 1A7BA 2RB8A 1R5VA 1WAWA 1QPXA 2DSZA 2IG2H 3VIPA 4MHHI 4Z0BH 4PEEA 1G01A 2WWKO 4EOWH 4KHTH 4UBDC 3OHXA 4NSKA 1KN4H 5JR1H 1MQKL 1YN6A 4LKXA 2EE9A 5D72L 1IC4L 5T5NF 5C8JA 4F33B 1NMCB 3AREC 3RNKA 3KWWB 1B3ZA 4JPKL 1ZANH 1U41A 5F9AC 2BSSA 4XX6A 4LSVL 3SKMA 3BAIA 4K23L 2H26B 4WO4B 1JN6A 3O3EA 4NKQB 5HPOA 1FO0B 3Q6GL 4RE4A 2IFFL 1XH3A 4Y4FC 5TF0A 3ULVD 3D3VB 3NABL 4LCUA 5AUMB 3IDUA 1XRVA 4NNYB 2OTWB 3V8CA 3SKJH 3VXUD 2Z4QB 5GNYA 3OR6B 5DZNA 2UY3A 3CJJA 4TVDA 3EYVA 2F18A 3EOYG 4AD5A 4CN1A 3I6GB 2V5RA 4PRNA 2ZCKL 4JY4A 3RWIA 2HJFA 2DWEB 4TVUA 1G9NL 5DLML 1I8LA 1CLCA 3BFOA 2Z0BA 4UZSA 5HVHB 2DTMH 2NYYC 3BAEL 1DE4A 3UTTA 2F53A 3AIRA 1ZT7A 4OZFA 4L4VE 1UADC 4NHUA 3NZHH 1T7ZA 3CU7A 4O00A 1KXTA 3WFEH 3JTTB 4R4BA 1QNOA 2VXSL 3VW3L 3F5JA 1V7ML 3QNXA 3LZFL 1J12A 4AD3A 4MNGE 4ODVL 5EC1A 3NFNB 1C5CH 4G8GD 1CFNB 2C4XA 2QSCL 4BJLA 1CLOH 4MNLA 2W91A 2H26A 4WO4A 3BAYA 4M81A 4L8DA 2DQJH 5LA2A 3I2CH 1N26A 3D3VA 4UNTA 5F7EH 4AG4H 1K9FA 3VI3E 3D9AH 5I1KL 3BKML 4S1RL 4NNYA 2OTWA 3NSXA 1E6QM 3WHE0 5GGQH 1F90L 2Z4QA 4TVPD 5C0FB 2YL9A 3PHQB 4M82A 2V3EA 2D7MA 1NC2D 5FXCH 1YY9C 5JXED 1A1OB 4DQOH 2JF6A 1TQBC 1VKXB 1H3UA 4UNVA 1RJLB 2JKXA 1A3QA 4ELKB 2DWEA 2KBGA 1JF6A 3TPKA 2MFNA 4XNYL 1NMAH 1BFVH 5FO9B 1HXYB 2YS4A 3FY1A 5D6CB 1ORSA 1M6OB 2AJSH 1OP5K 5EU6A 4TUFA 1RUAL 3MJ7B 1BWMA 3U4EA 4UDUA 4F7TB 2DI9A 2ZP0T 1UGNA 5IBTL 1TA3A 4FQQA 4C83B 1YHTA 5K59F 4X7FC 3NFNA 3HMWH 2VAAB 5FFLA 5I1IL 2EYSB 1X7QB 2WC3A 1YUHA 5C0JA 4F7MB 3Q5OA 4Y2DB 3BZEA 1EDGA 3NA4A 1E6SM 5C07D 5IBLD 3EDFA 5IM7B 2H6PB 4ZPVB 2R4RH 1AE6H 4JE4B 5HGHA 4DCQB 3GBMH 4PTUA 2GK1B 2AJYH 2P8LB 5C0FA 1DWAM 3V6FB 1E3ZA 4C56D 3EMZA 1RMFL 2Z31D 1OAYL 3HB3C 1D6VL 1NL0L 1FBIH 5F9OH 2YUXA 4XCYB 1UOKA 1GGCL 3U6RA 3WNMA 1MCOL 4HZAA 2WMFA 1DR9A 4AXNA 1XGQA 4JY5L 1HX0A 1XGTB 5IK3B 3CC5A 4P3CH 5FO9A 1HXYA 2DLFL 5D6CA 4EDWH 2J78A 1M6OA 5I6XC 5IEHB 2ZSWB 2NZIA 3MJ7A 4G5ZL 4AEEA 4NNXA 5ID0A 3FO0L 4YHLH 1LE9B 4OZHF 2GDVA 4OLXL 3B43A 1W2VA 1HWGB 1MF2L 4PJ5D 3GNRA 3MRLB 4OKVA 2IXUA 2VAAA 1LD9B 4LAQH 1CD1B 3CHEA 3BPCB 4P23C 3VFVA 5J6HB 3DETD 2OTUA 1DANU 4V27A 3PWPD 4DCQA 2XN2A 4FNLL 4LHUA 3ORJA 1W72L 1CNVA 2F5BL 3VGAC 3QSKB 4CDHA 1I1AC 4XNZC 5F7HA 4PMQA 1LF1A 4HBCL 5KSUB 5J89A 1B4RA 3PV6B 2IF7A 1S5HB 4MQSB 4M5YH 1UD4A 1LO2L 4IIQA 5CBAB 4ZO8A 3CHFA 3JVGA 4PG2A 1XGTA 3UTSE 1J10A 1HHIB 4LGRB 3HR5B 3IFOA 4OCNC 5EOCL 1WBXB 1UQZA 3QHNA 4UIKH 4NUJB 3TJEH 4W6YB 3SQOL 1X5LA 2ZSWA 1HF6A 5IVZB 5BXFB 5ALCL 5IBLC 2WZEA 4JZJB 1OP9A 4HJGA 4YHOL 2A6KB 1FV1A 2EQDA 3U9UA 2UV3A 1P53A 4NGHL 1QA9A 2E7HA 1XGUA 1FVEA 2W9DL 3VI4E 4POZD 1KPVB 3ARQA 3V0WL 1V0KA 5ICXA 4V1DA 5F7MC 1MNUL 1CFTA 4QGYA 4TNWF 1BOGA 3J7HA 3SN6N 4W89A 5INCB 1R3KB 2Q86B 4XBGA 2UY5A 4QRPA 4J4PA 2JJTA 4MVBC 2J6EA 3P0VL 3RKDC 1Q6FA 4EE9A 2W1NA 4U0RC 3KL3A 5HYSB 4O2FB 2WVVB 5JW5B 2Z9TA 3WL9B 1U2YA 4L4TD 3WQ5A 3BWUC 5KSUA 3VFOB 1FNAA 1SMAA 1QFWL 3PV6A 5C0CB 4FFVC 2OZ4H 1S5HA 1JHTB 4LGSB 1QBMH 5CBAA 1F58L 4BQCA 1VADB 3GXMA 4LPTA 5DI8A 2ED7A 2JB5L 5DR5H 5KSBA 4ATLA 2GITB 2IADB 4U2ZA 2PR4L 3WE6B 1P5UA 1CLZH 4L8CA 4AZCB 3W25A 1F5WA 5BXFA 2YDSA 1AP2A 4RL3A 1E28A 2IH1B 4FNUA 2BS9A 3AZRA 2CDFA 4P4KA 3SDDD 3WFBH 3BVUA 5HHPB 2ITCA 5DO8A 4U2YA 3U5YA 3LDBC 2FX7L 3GXIA 4ZFGL 1YEJL 3CSPA 2YD7A 3MRIA 4TULL 5A8NA 2DTSA 5D9MA 4DGYH 3QZWG 2F5AH 5J13B 1AQMA 2D1ZA 1CICB 1UKOA 1AR2A 4IOIA 4Q9BA 2JFEX 1L7IL 4AYFA 5DC9B 5GXBB 1K6QH 3F7YB 4L8SA 3T3ME 3F7VA 5JOPD 3ZHLA 4XC1L 5D7IB 2YUVA 5GZNC 3LRLA 2C5DC 4L4PA 2A6JB 5DDHB 1KB5H 3OGCB 4WW2C 2QHRH 1KENL 3S5ZA 4WTXA 5HHOD 3VM7A 5T3XL 3NCFB 4NN6B 1KXQA 2PF6A 2KKQA 2UUDK 2Y72A 2EECA 5CJOL 1OAXH 4I0CC 4R8WL 1JHTA 1FC1A 2EXWD 2KZWA 1RZJC 1I9IL 3L3GA 3QFDB 3MUY1 1LDSA 2LAAA 3V5HB 3IU3B 1I9EA 1H5BC 1UXWB 2GITA 4S0SD 4H5SB 3WE6A 5BZDA 1E4KA 4HZLB 2BJMH 2CNCA 3LQZB 4POZC 4DZ8A 1RIUH 2IH1A 1KBKA 1Y18A 3IGAB 3C2SA 1G7JA 5C0RL 3STBA 5T3ZH 1TVHA 1A6VH 2HRLA 1W1PA 2JIEA 1T1WB 1MSPA 2KDGA 5I16A 2F54A 1FCGA 1U8HB 5F7DA 2XZQL 3IJ9A 4UMGA 5C09E 1H3PL 3D39D 3F7YA 2EIEA 2DQDL 4U1KB 1D5IH 2UY6A 5D7IA 3SCUA 4X98A 1L0QA 2A6JA 3PHSA 5DDHA 2R69H 4ONHB 3VFRB 3OGCA 5IQ7H 2JF7A 2G9HA 3ALFA 1ND0B 2CKNA 3C87A 5TH2A 2DQIH 4KV5E 2VRQA 5L6YH 4MJIB 3VFUA 2B5IB 3MXVH 1MWAH 4FLQA 3I6KB 1MCBA 4FMVA 2DM3A 1U8MB 5K9JL 4ELMA 4TTDD 3SDDC 1BAFH 3BZDA 4R90L 5IDIA 2XA8H 1KJ2L 3APGA 4IMLB 2R0ZH 1ZWIB 1ZT1A 4WI3A 1UXWA 4Z8FL 4H5SA 1XD1A 3PABB 5DURB 1I8KA 2EDNA 3K1KC 3I75B 3LQZA 2DMCA 3AHVA 1VFOA 2JELL 2EAEA 3CUGA 2GT9A 5MEND 3O3UN 1RUPH 3TBYB 3C6LD 3IGAA 1X6LA 1QO3B 5IT2L 4F7EB 2BSTB 2FJHA 2Q7YB 2P5WA 1T1WA 1PG7L 3VXSE 1AXTL 2Q8BH 4KVNL 4N0CC 4PMNA 2EPOA 4PRHE 3OR7A 4U3XA 5I8OH 1U8HA 3BOVA 4HFWB 3FQRA 1LEKB 3BYYA 2VITB 4XWOD 5BMFH 4NPYB 1HOCB 2ADGB 2V9RA 4U1KA 3K8LA 4KTDH 5I9QB 3S88L 1E4MM 1QACA 4DGIL 4ONHA 3MRJA 4KZDH 2X4RA 3C5JB 1PYWB 3EFDL 5JORB 5D7JC 4MJIA 2J4GA 4EN3B 3OA5A 2X2JA 2DLHA 5H94A 1FVDB 1OOAA 1Q0XL 3TH3T 4OV5B 3SE8H 1WB0A 2NXZB 5A6JA 3GSNL 5EN2B 4O02L 4IEFB 4LF3B 3NPSB 5BS0E 4RGND 1E4JA 1C8XA 3UPCA 4IMLA 1OB0A 3ZJ7A 2NY5H 4RMTA 5SWSB 4AZ6A 2WSPA 3I75A 2A6IB 5EO9B 2NT0A 1MHPH 2HFFA 3TBYA 4PYGA 3C09C 3MOBH 3VRLF 4OF8A 1TFVA 1QO3A 2OCFD 2A1WH 3S2CA 1XR8B 1W9DM 4AMCA 1JTTA 4NJAH 4R7NB 4F7EA 2BSTA 5IHUL 2Q7YA 4OZGA 4APQB 4NFDA 2XTJB 4FZEH 5IVXE 1TJGL 5KSBF 3RM9A 3NIGE 4C57C 4G43B 5CSBA 4ONGH 5CSGA 1LQ0A 5BVJA 4F37K 3QXDB 3HE6B 4HFWA 2CUIA 3VSVA 1LEKA 3BIKB 1DUYB 3RZCD 4S0TD 2J8GA 4I48A 1CXHA 2NY1C 3KPOA 1HOCA 2ADGA 2EH8H 3QT2A 4HH9B 4YFLI 5IP4A 2YLAA 3GHEH 3SOBH 2J8UB 3DXAD 5SX4H 3VE0A 4D3CH 3F4VA 1U3HB 1SM3H 1ZMYA 2FX8H 1KFWA 1VGEL 5JORA 3CNKA 2ICWB 4OLYH 4LQ1A 4LCWE 5FYLL 4OV5A 4U6YB 2JJSC 3U0WL 3GBLA 3PDOA 4LF3A 3VFMA 2W63A 3CVHL 3NAAH 1S7TB 1T7XA 1QFPA 4LSPH 1UA6H 3FRPA 3GHBH 4D0BB 3ZIZA 2J7BA 5D8ZA 4B5EA 1SYSB 4ACZA 1OWRM 2ITDB 3F8UB 2A6IA 5GZOD 2LVCA 1JHKH 4HIXH 5FYLE 4PJHE 1DBAH 2CJUH 1QG3A 3LRSB 4P59L 4PMVA 1OM3H 1YEEH 3QPQC 4R7NA 3OPZH 4JFDE 4PRBB 2LFGA 3CSYA 4HAFA 2FB4L 1O0VA 5JXAH 3A6BH 4RDQF 5EPMB 1BAGA 1BIIA 2N7AA 5F44A 1GCFA 3QNZA 4DTGL 4ZNCD 5D9PA 5E5RB 2VL4A 4PP2A 3FO2A 3PWJB 2W9EL 4ZUSA 2NY6B 3RU8H 2J8UA 2B8OT 1S7VB 4RGNC 2HKFL 1U3HA 1IAIM 1QBLH 4QXGL 1V6UA 5DD1H 1PKQE 1U8PB 4Q9CA 1WKYA 4XPFH 5DK0B 5D6DA 1DFBH 3S4SA 2E9IA 5ADOH 2EDKA 5GRWA 2E5EA 4ONOA 1I1YB 2VLKB 4RSVA 1U8KA 3N13A 1RIVL 2AK4A 3OWEA 4M6AA 4FF5A 4WHYG 3MLSL 3MNVB 3BP4B 4XNUH 4QHNB 4GG6A 4LKCA 3DX9A 3BKYH 3MA7A 3VXQA 3VIMA 1SYSA 3ECBA 3MRPB 3QIUB 3PQYA 4JDZB 4OF5A 3MZGB 5CSZA 5EOTB 2WV3A 4KI5C 3T4AB 4BA8A 1DZBA 3NIFE 1P5VA 2XWDA 1ADQH 4HX1B 4ELMF 2CBIA 2CYGA 1FL5B 2C4FU 2D9QB 4JZOB 5DMGC 4UDTB 1HWHB 2D0HA 1MY7A 3EJYC 3N0PB 4JPVH 3VXRD 3LXBA 1K8DB 3CDFA 5EPMA 5ICZA 2LTQC 2OR7A 4FQHA 4JFEB 5HXMA 1EDTA 3WFDL 3EO1B 2AV1A 1WV7T 1QEWA 2FYVA 3G9VA 4UFHA 4MLIA 4D2NA 5C0AA 1UASA 3T2PA 3GSWA 4X0KB 1XF2B 5SV3A 3F6LA 3LCYA 1A7QL 4EVNA 4Q7DA 5DK0A 1A6ZA 1FNEB 5GRYA 5KVMC 1P2CB 5D70H 5J8OA 1CXFA 2J62A 1WTGT 3U7YH 2VZTA 4QHKJ 1C5BH 5GZOC 3RA7L 2EADA 3F5WB 1FH5H 5ITBL 1XD0A 1J05B 4ESKA 4XCEB 3MNVA 2CH8A 5E2UH 4CL7A 2YUWA 1XF5B 3W29A 1MCHA 3UYOD 3QIUA 5IG7A 3PHOB 4DAGH 4W4OA 3CCHA 2F7PA 5F8RC 3LD8B 4M1DL 5HPCA 5FOJA 4YEEA 3OSKA 4YDIH 4BZ1H 1X1NA 4JN2B 2HKHL 3BO8A 3TONA 1VJZA 2VLRB 1RQ5A 1U6AL 4HX1A 4MB3A 4X5WB 3QIBD 4G6KL 4XP9H 4J3VA 2FGWL 1EFQA 3C5ZD 1RZFL 4JZOA 4KC3B 4AISA 4UDTA 4YXKL 4L9LB 2Q20A 4BFBD 4KJYA 4OM1H 1K8DA 3KJ6L 5I30H 4KJPC 4LRNL 3AB0C 3QUZA 3M07A 2W60B 3IETB 5JDSA 1ZVSA 5AWNL 5LGHL 1EV2E 4OZGF 1FYTB 1JNNH 1WEJH 2XFRA 2HVJA 2G5BB 1NBVH 3BH8A 4OFYA 5L2JA 1BQLH 4X7DC 4XMPH 4QYOB 4R0LB 1I1FB 1XIWB 4Q9QH 1YMMB 2VLJA 1E27B 4K7PY 1CWYA 4JQXA 5J3HD 3OLGA 3MJ8B 5LGJB 4FQ2L 4RMVA 2X10A 2LE9A 3WCYA 3GKZA 1M03A 4BK5A 4I2XA 3TT1H 2J7GA 3WJLC 1FAKT 3DRQA 4JN2A 1ISVA 4NQEB 2Q6WA 2A6DB 1DLHB 1WQVT 1ZXQA 3AZSA 3DRTA 2I9TA 5JPNA 2WBGA 2EDFA 5HHME 5A6AA 3QCTL 4P46D 4KMQA 4L3EA 1JWUB 3VCLB 4L29B 1C1EL 4Q6YA 2OW6A 4LLQB 3O8XA 4X6DE 3SGJC 3KPTA 4CAGA 2QQLL 3CFCL 4X9YA 2FX9L 2W60A 2F58L 3MJ6A 4LLVA 1R3HA 4HC1A 5D7KE 3E3QC 2LU3A 2HFTA 3TWCL 3TVMD 1RJZB 4RFNB 3FOMA 3V4PH 2G4FA 3QHOA 2CDEB 2VXQH 3OJMB 4R0LA 5DMIL 1UWTA 3V0VA 4D1IA 3ZE2E 2BP3A 2FBJH 1XIWA 1YMMA 4GI8A 1ZVHA 3K80A 2VUOA 3P0YH 5EFIB 3RFZC 1VFUA 5GS0H 4PBGA 4JHWH 4JRYD 1N0XL 3MJ8A 3MJ9H 3QIBC 2ZIDA 4YBQC 4ZFZB 2X8RA 4L3CB 1T66D 2XPGB 4G6JL 4WEUD 1MW0A 1EMTL 2WHJA 3SCOA 1W0WB 2UWEA 3ARGC 3NCJH 4NQEA 5F7UA 2IFGA 4L4JA 1DLHA 2V2WB 3P30H 4JFXA 5M17A 1UC6A 2Y7QA 1HHJA 1HEZB 1IKNC 3V4UL 4OLVH 5DT1H 5C3LD 4JR9H 3QP3A 3IU4H 3LEVL 4ZS7H 2BHZA 3CHDA 3WQ4A 2XSBA 1JWUA 4B7IA 1KJ3L 3PJSB 3DVIA 3DVNB 3CIVA 3PDDA 3K2MC 1I9RH 3CAFA 4WU7A 4HCRL 2Y25A 5J3HC 1PBGA 2X70A 3WDHA 3OLDA 1KB5B 5E9DD 4YXHL 3P11H 2L7JA 2ESVB 2W67A 4YFLF 1TZHA 4UT6L 2OWXA 1B4JH 1M4KA 2VDQH 4BSVB 2MSPA 1Q9WB 5TE6L 2F7QA 2X09A 3AXXA 4PJXF 2E27H 4K9EH 4X6BB 4QTIL 2A9ML 5GGTA 1AHWB 3SCPA 2CXGA 4ZFZA 4L3CA 4KPHH 4DKDC 3R0NA 4E42B 4P46C 3GI9L 4TNVF 4MCYB 4FQLH 1A21A 4M6NL 4N8PA 4OZ4B 1XT5A 1W0WA 3PWUB 4PS4L 3OF6A 5DD3H 2FH6A 4LHQB 5KVEL 3UG4A 3SUWA 4UT9L 3ULUF 1OWQA 1J5OH 3VNZA 1UACH 5E56A 1AO7D 1NGYA 5HGDB 2VXVL 4OCRH 1PQZA 1HEZA 5HHXH 1U8NB 1QUNA 2ZCLL 2YA1A 5C0BA 3WIHH 1QFOA 3U57A 2W0FA 2I5YH 1JMXA 3OG4B 1U2HA 2IGTA 4LIQH 4HULB 3MLTB 3PJSA 4D9RE 3TVMC 3C2AH 2ZCHL 5KVFL 3GYCA 1A9EA 1HH6B 2XN9E 2YMXH 3WO3B 9CGTA 1M7DB 3DTXB 4BKLA 3HAEA 5L88L 3BH4A 5EIVA 2IAND 2BERA 3AM8A 3OKMB