1PEZA

Bacillus circulans strain 251 mutant a230v
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
686
structure length
686
Chain Sequence
APDTSSSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDVVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTATWEGGSNHTFTAPSSGTGTINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Cyclomaltodextrin glucanotransferase
publication title Conversion of Cyclodextrin Glycosyltransferase into a Starch Hydrolase by Directed Evolution: The Role of Alanine 230 in Acceptor Subsite +1
pubmed doi rcsb
source organism Bacillus circulans
total genus 241
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pezA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pezA01
4DEPB 1FLTX 2DQIH 4OQTH 4W4OC 5IVZA 2P5EB 1E3XA 1PBGA 3MSDA 3BYTA 2BNQE 4I8DA 5DMGD 1P53A 3QI9A 4XNMB 2X70B 1FPTL 4L8DA 3CH8A 1F42A 4YFEA 5EU7C 3IAQA 4QHUA 3O6KL 5DHYA 4NGHL 1KQYA 3NIFF 4MJ4A 2J88H 3CDFA 3CDYA 3VXMB 5F9JB 1HF6A 4EKXA 5IKCB 3UEQA 1VBRA 1JFQL 3O3BB 4XNYH 2K3TA 1JK8A 3ME0A 2QMKA 3H42L 4RNRB 4K7PH 3WJLC 2QSCL 4Z9KB 4OGAC 4OCSL 3KPMB 4Z18A 3RL1A 2XZAL 2P47B 2M26A 1DQJB 2ICWB 4K7PY 5E00B 1YUHB 2JCCF 1U36A 4G7YH 2P8MB 4XNUH 5EU6A 4JANA 4X9GA 3RL2A 5KANG 1UM4H 1BQHG 1T3FA 3NFNA 4HC1L 2VABA 3L3GB 2OSYA 2VO5A 3QFJE 1TQVA 1E27B 2WZIA 4F2MA 5ACMA 4JL1A 1UR1A 3F7YB 4WUKH 3G08A 3ULSB 5C6TL 5GNYA 3QUMB 4NO0A 3GHBH 3QG7L 4PTVA 2ZUSA 4HMEA 4LF3B 5GNXA 3OB0H 4XVSL 2GT9B 3MV8A 1JDDA 3A4AA 4MD0B 1QACA 3TJHD 5ISZE 1BX2A 5GGSB 1KG0B 4QY8A 5KOVC 1UB6B 2CRZA 5GHWL 5IF0A 2GCYB 5CP3A 2ARJB 1ZTXH 3EJZD 1J1PL 1CCZA 3V5HB 2VDKH 4KK8C 1OLLA 5DHVH 3ARBA 4Z95L 3C6SB 2X9YA 2G3NA 3ZDZF 3FCTA 3QDMA 5TQ2H 1XCXA 5I8OL 4YR6B 3BXNB 1FORL 3CUIA 2B0SH 4PJFE 3IDXH 3KS0J 4DUWA 4A2LA 5JA9A 1ACYH 3S9DB 3AC0A 3F7VB 3O0RH 4RMQA 2Q86B 1RP9A 1RZJC 3LPOA 1DBKL 3FHQA 4PD4K 2W0LA 2CLZA 2V9RA 3LOWA 5HVGB 1RZ8B 4UTBL 2OZ4H 4ODTH 5IHRA 3U7BA 3SE8H 3ZKMD 3B5HA 4FXGA 4ZO7A 4PEEA 2IJ0C 4MJIE 4QRTB 4G6JH 4U1LB 4JPKL 1W8OA 1MFNA 2HFFA 3BISA 3LRKA 3U7WL 2DQDH 3K46A 2YK1L 1OARL 4X98A 1D5MB 3BVUA 1KTDB 3E1F1 1D6EB 3SQOL 3HUJA 2FGZA 2PYFB 4M43H 1DWGM 3HS0B 4MA1B 3FOMB 4HUWA 4LLDA 1W9DM 1J88A 1OPGL 1OAYL 1OQOA 1IAKA 4PRIB 5IB3A 2E7MA 3QXTA 1YJDL 4PJDE 5JA8B 2WKLA 1MHHA 1RAMA 4OF3A 3WFLA 3PXHA 2D7MA 2O9TA 4QRPD 5C0BB 4D72A 2ESVD 4JZNA 1YN6A 4ACYA 2FJGB 1FNLA 3ARED 3WDPP 5L2JA 5KSVA 4W81A 2P5EE 3O8XD 5CD5C 5CG0A 3GNMH 2ZUNA 5F88A 3HB3C 2A77H 2HMID 4YE4L 2ZX8A 4KUCF 5F6IC 3KPRA 3V0WL 3VW3L 4B3LA 4QFUA 3FONB 4Y5VB 1IGTA 3D3VD 3GKZA 3RWCA 4KRNA 3GKWH 2YMXL 5EB8A 1KPUB 3DX8A 3VXME 5I2UA 2GYSA 3QPQD 1FA2A 2BVEA 2VDRH 3GMRB 5IB2B 2OMNA 5IQ9B 1FNGB 1XGPA 4JO2H 3ARWA 3S4SA 2YBUA 1P5VA 4POYA 4CJ0A 1GGIL 3SKMB 5KG9A 3NH7L 2KL6A 5HDQH 1WFNA 3X3FH 2LTQC 3EBAA 4Z2JA 1LO3H 2APVA 1T04B 1ZVYA 2JJSA 5ECUA 2A9MH 3FRPG 5I1DA 4P9HC 2CBIA 3IAPA 3QXDB 3K2UH 5JPMB 5A2BA 5JHDB 1D5BB 2AVGA 1DUYB 3QUYD 4GOSA 1T0MA 3QDJD 5IROA 4OCRL 4DQOH 4KTDH 4HCRA 1LL6A 3WF2A 1QEWA 2Q8AH 4OFVA 5L8LB 4ZFGL 2WANA 1BLNA 2JE8A 2X1OA 4PB9H 3W53A 2CDEA 4HT1L 4MA8L 4WFEE 4ODHL 5DT7A 1RUKH 1PD6A 3ARXA 1CLOH 2W65A 3IYLW 4RMWA 4H8HA 5DJXB 3M17A 5IHUL 3HI6H 1GQIA 5KSUB 3DVGB 4X4XB 5EZOL 3WFBH 2GSGA 4FS0A 4OB5H 4OLWL 2V7NA 2HLFC 1I1AD 1BQHA 4DWSD 4ONFL 2YD4A 3O9WC 1JGUH 1BQSA 1R87A 3LRLA 1J11A 4OD2A 3C6LB 1A7PH 1HSBB 2G5BB 2C3HA 2DT0A 1H3PL 4BUHA 3AXIA 2P24B 4KJQD 4NZJA 3H7BA 2J7EA 4NDMA 4MHHG 2CKBA 1PJ9A 1FVCA 3L5XH 3OKNA 4R7NB 2I9TB 3TYGH 1PZUB 1H8SA 4OIBA 2D20A 3O9WB 1BZ7B 5SX4I 2FJFB 1JDCA 5IT2H 4HGMA 1DLFL 1VFOA 1FH7A 5IR1B 4LCWA 4HUMB 1F3JB 2YWZA 1G94A 3D69B 4OUEA 1WT5A 3FFDA 1SJEA 3KPOA 5IWLA 3QXUA 2B20A 2AI0H 2HRPL 4IIQB 1MJJA 2W4XA 3OKDA 1JFHA 1NFIB 1ZEAL 2P1YA 2HJLA 5BZWA 3RWIA 1F97A 2P7TA 2W07A 3EJYC 2YL8A 3FQXB 3GMPB 2XN1A 4FFYH 4BH8B 3CPLA 3RZCC 2B7DT 4PRIE 1FJ1B 4UDTB 3BSHA 1OTSD 1IILE 2D2OA 3S5YA 4JZJA 4ZS6C 4ZUUA 5C0BE 1V02A 1TJGH 3MUY1 4XP6H 5L7XH 1MI5B 1UASA 2AAVA 4LDLB 5AUMA 3UTPE 5LQBH 3RZCB 4ATWA 2WWKT 2QQNL 3LS4L 4RGMB 5DK3A 3BUBA 4LASL 4XAWL 1U8LB 3VG0L 5JQ6L 3QEUA 4AEEA 3CHDA 4DGVL 2A6DB 3WJJC 3GB7A 3IJ8A 2ZXDA 5BRZB 1VJZA 1CF8L 1KB5A 5LVEA 3T8XA 4Z6AT 2O61B 5F21B 3V8CA 2V5TA 1GGBL 3ARDC 3NDYA 3AVEA 1VF8A 4OZFG 3STLA 4YXKL 3P0GB 4BSVA 4GXUM 5A2CA 3APGA 3TO4A 3VVGA 5I0ZA 4YHML 1L9NA 1SHMA 5EG6C 1ZT1A 4JPVH 5CWSA 4IMLB 1EGJA 5F7EL 5EOTB 1C8PA 4M5ZL 5JHDE 5MHSE 5IB4B 3DO7A 4YUEL 4RMTA 3LVEA 2PTVA 4LHQB 3U0TA 3A4XA 2D24A 3THML 5JUEH 3LEYL 5F7KC 5HVWA 3U9PL 4U1NB 1IFHH 1ES0B 3NGBC 1UHVA 3CFEA 4WFHD 2A6KB 2DAVA 2TAAA 1ZVSB 4M1GL 1QFUH 1R5IB 4G9FA 1I1RA 3ELAT 5J57B 1E4IA 5IB1B 4ATDA 3DNKA 4KJYB 1K3IA 4PY8I 2VXUH 4RFEB 2UVFA 5EU6D 3MJ8A 1CNVA 4TSAH 4ORGB 5EFDA 3HRPA 2VERN 3HE7C 3BP7A 3EO0B 5CJQL 4HQQL 5EC1B 2ADJB 2H1PH 1B2WL 1A7RH 3NGBB 4P9ML 4G6KH 3C8HA 3KE0A 4RZCA 4LBEA 2ATKA 4PMNA 5ABGA 4NO0D 4FP8H 4WTWA 3UO1L 4P2OA 3JZ7A 5D7IA 4NM8L 32C2B 3IETB 5D1ZA 4MDJA 3MV8D 4JM2C 5DVKA 3VGGA 3AMGA 3HE7B 1UVQB 4PGBB 3WL9B 3PHQB 3S2CA 1YEHH 3CUPB 3PGFH 3L7FB 3W39B 1L7TL 4RFOH 1JPFA 1VKXB 3VH8G 3EGSA 4LSVL 3MLRH 5EUOB 1CFSB 2WNGA 4YZFE 5I2IB 4CVUA 3SDAC 3ARBD 1KT2A 3WXVL 3CLEL 4JM2B 3DYMA 2L0DA 2Q20A 5TQ0H 3QDMD 1G7QA 2BC4A 3QRGH 1VBUA 3D0LA 3P9LA 2VI0A 3PZOA 5JW4Q 4IMKC 3REWB 3WS3A 2EIEA 1MOEA 3MFGB 5FGCB 2YD5A 4JFQA 5BXRA 3DGGB 3KHOA 4PJ9A 1UKSA 5SWSA 3SDAB 1D5ZB 5D9PA 5KVFL 3WN5C 1KBGH 1MPAH 3TO2B 1N6QL 1H5BA 4MJ6A 3FO0H 3T08A 3JVGC 4K8RC 3WLWD 2A3BA 2SEBA 2EPKX 5KJRH 3NCJH 4OZOA 1FE8L 3V5DB 3ZT7A 3AZRA 1HZHH 2ESCA 1MI5E 1CGUA 4LYRA 3O3UN 4WSKA 3QDAA 4FQ2L 1IZKA 3FQRB 4HIXL 3RVXC 1FRGL 3LIZH 4HFUH 1GOHA 4KVNH 2EPNA 4WO4A 3WN5B 3P30L 1T83C 1CK0H 2OXGA 1MHEA 5DHVB 3KDMB 4ODVL 3T0AA 4P59H 1I7ZB 1GIGL 2MKWA 5BRZE 2JEPA 3MUGA 1FAIL 4Y16D 4JKLA 3D0VA 1BSIA 4AD4A 3D2UB 3TTYA 3P0YH 4HWEL 4QLJA 2NW2A 3RPIB 2N4IA 4FQIL 5DYOB 4LSDA 4YGVB 1SEBB 1AXSB 4D6HA 4OJFH 4UQAA 3HC3H 2W9LA 4ELMA 3T2PA 4K7FB 4YHPB 1JIBA 1ZHNB 5C0AB 3ZSTA 1VEPA 2WMIA 2A0LD 1P2CB 3CSBA 2Z93A 1EEUA 2YC1B 1QRNA 1Z5LB 4J8RB 1WK0A 3G5YB 3KLSA 3FQTA 1BGXL 4ZXBA 5C0RL 1YPZB 1N64H 2J5LB 1QLRA 2XZCH 1E0WA 2HTKC 3CZGA 3WBAA 2OS7A 4JHWH 3FMGH 5LXGH 2O93L 2Z92B 3DYPA 5FCSH 1A6UH 4FABH 3A4WA 4L4TA 2EXWC 3VFSB 4UZUA 4X6BB 3FOLA 1OVZA 4LDOB 1NH6A 5EH1A 1EZVX 4E42A 2XYLA 3CSGA 3QEGH 4FQXA 2AK1H 4DW2L 5CZKA 2ZSVB 3IFPA 1ZHLB 4ZO6A 5DMGC 4L8CA 4S1QL 3NCYS 2JCCA 5C7XH 4PJEB 4PJ8D 4HLZH 3NCYP 3MV01 4K3JH 1YECL 4AIZB 4XMPH 4MYWB 4X0NA 1LQSR 1AJ7L 3BJ91 3N1MC 2YA1A 4PY8J 5L0QC 2V3GA 3WYRA 2D7NA 4ZSOB 3QQ3B 3MI6A 3TA9A 3QEQA 4QTIL 2D7PA 5KS9B 1PZ5A 4KXZH 1RZ7L 5EWIL 3V95A 4ZFFA 1SM3H 3R1GL 3QAZC 4IPNB 1HWHB 3P11H 3OBAA 3LPGA 5HI3C 4FG6C 3QXAA 3FT3A 5I19L 1I1FB 3SOBH 5EUOE 5C0GB 4OAWB 3C60C 3OLDA 5L0QB 4ZE4A 3DRQB 1QKZL 3X12A 1DBJH 3HAEG 3KWWB 1U91A 2YDRA 3F12B 3TJEH 3SBWC 4H26A 1OF2B 2XIIA 4HJ0C 4F57H 4X4MA 4PGDA 1UXSA 4WHYG 3D51A 5FGCE 4PY7A 2HVJA 1A3RH 2WBJA 2R0LL 1E73M 2DEPA 3C60B 3P4NB 1QBAA 2R2BA 4OCNC 3C9NA 2VH5L 3T65B 4PJ7A 5JOFA 4CCDA 3FAWA 3GMQA 3BZEB 3EFFA 4RQQA 3UG3A 3WF1A 4BS0A 3WUZA 5FOBA 4J4PD 4XCNB 3DTXB 3X14A 1U42A 3QPXH 3WO3B 3O4LD 1F4XL 4W4NA 4WK9A 4R6UA 1CLCA 2ZJSH 4ODSL 2QQLL 1GJUA 2NXZB 2GKIA 3QFDA 4PG2A 1W9BM 3LH2L 1HE7A 2DQFA 4WHDA 3RUGB 2Y06H 3TCLA 1UWRA 1ZHKB 2X4OB 1JPTL 4G9DB 4XXDA 3RDTA 1CWVA 4QCIA 2ARJQ 2ERJC 1OD0A 3ZKMC 3VXRA 5DJZA 1CXHA 4WV1B 1I3GL 2HYMA 2J4GA 4O2CB 3GI9H 2DLHA 4POZC 4ZFZA 3SQBA 4H0IA 2XGIA 5HVHC 1JUFB 3KPLB 4HK0B 2VXSH 4YBQC 3HG5A 5C0AE 1CZ1A 1R3HA 1NOWA 4IHOA 2CRMA 5DLML 5HYQA 3QCTH 1IKNC 4CD5A 4NI3A 5CBEA 2EDBA 3IDIB 1YPZE 5EO0A 2ERJB 3DROA 3BWAB 1JXJA 4JGJA 3T77A 3MGOB 3SDDA 1D5XA 1CE6B 1F4YH 3QQ4A 5GRWA 1GOFA 1X6LA 5A3HA 4JG1H 5HVHB 4WI5A 6A3HA 2X4QA 2Y36L 3OKKA 5D9OA 2W63A 2PR4L 4TTDD 4KI5F 5JIHA 3ULVF 3AREC 1IKFH 2DQEH 1OWQA 3VD5A 3LMJH 2QMJA 4I0PB 1VEMA 3A67L 3MGAA 3MZGB 5C0DB 1UZ1A 1LG1A 4PJEE 2WQ8A 3GH5A 2EC9U 1L6ZA 2VSDA 4E5XA 3DARA 3RVVC 4JRYB 4DN4H 1Z9OA 2F53A 2BOCA 4JJHA 2D7TL 1AC0A 4U3XA 3S5ZA 1JWSB 4M24A 5FYKU 4PJGA 2AKRA 4X9YA 3QHZL 2DMBA 4ZSOE 1D9KD 1VFAB 1HP5A 4MNKA 3OKYA 5C08A 4G9FD 5KS9E 2VLRB 1R46A 3QXWA 4TVSa 1GGCH 5E99L 2YPLA 3N9GH 1PIFA 2VT0A 1QSFA 4NQVA 3WD1A 4GAYB 2IG2L 1SQ2N 4S11A 4UT6H 2V2WB 2UYLA 1GORA 1INEL 3OLEA 3Q1SH 2AEPH 3IDJA 1WFOA 5CS7A 5MERB 1C5DB 3IS1X 1DE4B 3SE9L 1K8IA 4AQOA 1NJ9A 4CNIB 5JLZA 1ZBCA 4D6JA 4HS6A 4FLOA 3L5HA 4NBYB 3S3JA 1JHTB 3C8KA 2CDGB 4PRDA 1YEFL 1GAFH 1VADB 1L7IL 3HC0A 3HG2A 25C8L 1IM3A 2E7CA 5D1QA 5C92A 2P4AB 5I6SA 4HJJH 3IKKA 2FB4H 4UQ9A 5GGVH 3G6AA 4WJ5A 4F8QA 2RR3A 4G8EA 2PWEA 1A6VH 4K3EH 1HH6B 1S7TA 4YBLB 3GIZH 1I1XA 1Y18A 2W91A 3TBVB 2JELL 3OR6B 1ODUA 5F70A 5F97E 2FO4B 5GGVY 4XNXL 3O3DB 3WD5L 3SCNA 3P9MA 4YHGA 4DZBB 4UAOB 3GO1L 3LSOA 3OSKA 1RZJL 4TVDA 1XF2B 5IB5B 2D03H 2VDNH 3LKQA 4Y4FA 5E1AB 5I76A 2OL3A 4OSUH 3HAEA 1JMXA 2J7HA 3KHQA 3DUUA 5I30L 1HJXA 5IQ7L 4JIEA 1IQDA 5LA1A 2IAMA 4UNVA 1T1YA 1MCIA 4PJ9D 4MDOA 1NMAL 3RUGE 4C57C 5SWSD 3BZFB 2DWDA 2Y07H 4KJPC 2DMKA 4QGYA 1CDUA 3L5WB 4I3RH 5DEFB 2ZUMA 4UOW0 3GXTA 4OM1H 1QD0A 5DJ2B 1VGEH 4TRPL 4OZHF 2DT3A 5DDHA 1JL8A 3H3PH 4MQ7A 1OSZA 4WO4D 3SUTA 4NM4L 4PV9A 1D5IL 2J8UA 3B9VA 4UTAL 1HYSD 4DCQA 3BUPA 3MJ7B 1NCWH 3CZSA 2JK5A 3OB0K 4IDLA 2ZX5A 4GW1B 5BVPH 5B4MD 5D7LA 1CFQB 1FGNH 3B5GA 4AH2B 4LIQH 3FB8B 1V03A 2Z8VC 4YO0B 1UWUA 1RI8A 1Q9LA 1KELL 4GZEA 1OAUH 3RGVB 1XH1A 2WC4A 2VZTA 1KGCE 3LKNA 3JWNC 2AEIT 4Q9BA 1OP5K 3QNXB 4QRQA 1BQCA 4WKFA 1QA9B 1CBVL 2WP3O 3CZFA 1QRND 3IJYB 4ZXBD 5KSBB 3Q6GH 4P49A 2QV4A 4JRYE 4YHOH 5DK2B 5FYKD 4MQTB 1WQVT 3MZTA 1AGCA 4P9HL 1A5FH 2FO1A 4L4TD 3ZT5A 2ZP0T 3GK8L 3V52H 4R4BA 1I1YB 1CYGA 1X44A 2UWEF 3UJIL 3R0NA 5CEZD 3Q5YA 4FQXD 4TQEL 2VLRE 3DRTB 5EOCL 1QR1B 4AD3A 3ILPB 3O81A 3QI9C 2DDQL 3W4RA 4HUVA 2X4UB 2YUVA 4U05A 1UD2A 1KOAA 4UV4L 2X4RA 4PG9B 3KYNA 2MPAL 3OZPA 3GSRA 4I2XA 5DJAB 4UFJA 1A22B 3E3QC 3AXLB 3O3EA 4KZDL 4W68A 1P7QD 3U6RA 4PLKD 3QEQD 3HNVL 1E4MM 3EYQC 2PC8A 2YD2A 4NHUB 1NAMH 4U3AA 3U4EA 2ZCKL 1LEIA 1BAFL 4PS4H 1MSPA 2E9MA 3RM8A 1OTTC 2F19H 2FWOB 3OG6B 2F7QA 3ZE2E 5IBUB 1FZOA 3E6FA 4NOFA 1SYVA 4DN3L 1FNSL 4MXQD 4QOKB 1YN7A 4LGRB 4YK4C 1WBYB 1KJMA 1YYMH 4BKLA 3V0VA 1LJYA 2HKHL 4UINH 1ZLUK 3A22A 3RL2B 3HI1A 4MAVA 2AXGA 3DVIA 3L9RB 1T3FB 1RZIB 1DZBA 4LRIA 2VITB 4ERSH 4PJIF 1INDL 3MBXL 5EULV 4RWHA 1JMZA 3BQUC 1E6NA 4YK4B 1FG2B 3RKDD 1MFUA 4K2UH 4QHNA 5HXMA 2BZDA 4K3DH 1HWGB 1MWOA 1R47A 3PABA 1FHLA 5FUZL 2FGWH 1HIZA 3P4OB 2VLME 2XNAA 2PTUA 3QHFH 2MTPA 4HLJA 3S36L 2AQ1A 3IDGA 4ACPA 5DO2C 5EO9B 3VI3E 4GQQA 4XCYB 3C5JB 5E03A 5F7WC 3VXQA 1XGQB 3BQUB 5TH2A 1ZGLP 1XF3B 5IF0B 4HGWB 1QFOA 3ULUC 1NC4B 4DKEL 4TVPH 1XRVA 3IF1B 2BP3A 5ADPL 4PCTA 1M71A 4O2FA 4EVNA 4NRSA 3BEWA 4EBQH 2JIEA 1LEGA 1Q0XL 2A73A 3BUYA 2YDQA 1Q6FA 2XKSA 1QVOB 3PL6B 4M5YH 1E1FA 3VXRD 4Z7UB 2MHAA 4HHAB 1TTFA 5JDJA 2FEEI 4R26L 1YNKL 5IFJB 5LA0A 5ITFA 5C09D 2DSWA 5C0IA 2AJ3A 1KGWA 1DWIM 2VRJA 4KV5F 3DDGA 4M82A 3F5WB 4OFKA 3SO3C 2JJWA 1OGTB 5KSBE 3ZO9A 3PWLB 1BWWA 4ZDHA 3TESA 1BIIB 4KUCD 1PEWA 4DZ8A 3SDDD 1SR0A 3LN4B 4LVNC 1XF1A 2DQHH 5GGRY 1OIMA 1OAQL 2Z91A 3K4AA 4XP5L 3UX9B 2X41A 2VC9A 3EYOB 5C2BL 2Y6SD 4AD5A 1C7SA 4ZAKC 5IG7A 2EH8H 1JNHB 3FO2B 2GJZA 4P2CG 3L4TA 2BOBB 2VOTA 3SO3B 3PDOB 1ZVHA 4WFGD 2DQIL 3HPJA 3T2QA 2XXMB 5F8RC 5IB3B 4D0BB 4GW4B 1AIFA 5BMFH 2A0LC 3G5VB 1TJHH 4ZAKB 2F53D 4OLUH 1KGUA 1FQ9C 2QBWA 4PBWD 1PDKA 5LBSH 4JZNB 5JW5A 1WCBA 1MCRA 2J88L 4FFWD 3OXSB 5FKPA 3MRCA 1Q9OB 4NKOB 4XNYL 5L2JB 1OY3B 1B30A 4K7PL 5A6JA 1N8ZA 5GS2H 1EHXA 1JCKA 3CXHJ 5C08D 4ZYKA 3QDGB 5E6ID 2Q8XA 4B7IA 1EEZA 2YPLD 4M00A 3PTKA 3KPRB 1CDGA 1QSFD 1C90A 3OKMB 3NCOA 3IU3A 6TAAA 1DL7L 2JJSC 3VXSB 3H3KA 5FV2A 3SE4A 1ISZA 4G7YL 4S1SH 5CINH 4XNUL 2W61A 1GPFA 4PN2A 1UM4L 2VLLB 3ZM8A 3DX3A 5CEXB 3G5XB 1Q9KB 4QOKE 3O2LA 1V7MH 2DICA 1ODZA 3RCNA 3BHBB 4WUKL 5I16A 3ZKQD 3GHBL 3WENA 3L1OH 1EVTC 1DBMH 3MRHA 1QBML 5D7SH 4J6RH 3OX8B 1RP8A 4OJYA 1N7MH 3ZSSA 4MB1A 1G7JA 1JPGB 1BJMA 4G43B 1H3XA 3CZEA 2OBGA 4LSTH 1FH8A 2J25A 1ZTXL 3GSNA 4UQ2A 2VDKL 4Y4FD 2KZWA 1JV5B 1KIQB 4AZ5A 2XQYK 1E4JA 4XPHH 4C83A 4NXSA 4RMRA 5TQ2L 3M17B 3BKMH 2PUQT 2IAMD 4PBVC 3OTTA 3QZWA 3TBWB 2EDJA 4PCSA 4H8WH 2LVCA 1ECEA 1U0QA 1DBBH 1AD9B 2B0SL 1CD8A 4HMCA 4YHIB 2PWDA 4GIAA 4P7RA 1HHIA 4ETQB 1ACYL 2V9QA 4PJCF 4WUUA 3GNOA 3O0RL 2B1HL 3WD2A 4D6GA 4PJHF 3TN0A 4LOUC 1LO2L 1ORQA 4AEIH 4JFEA 3S35H 3KYKH 2ICEB 4XAKD 3K1DA 2AV1A 4F37K 3SGDI 1MCOH 5JNYB 4ODTL 4QRRB 3SE8L 2V9TA 4Z7UE 3GXPA 1PZ2A 3WFCH 5IBTH 3NIGE 4G6JL 4PJAF 1Z32X 1H11A 4MPKA 4NFDA 2P5WB 3W11D 5D9MA 4XNQB 2DQDL 2Y72A 3TWCH 2AV7B 4LVEA 4TVUA 1FFOB 2CK0L 5HYFA 1U8QA 4FFVC 4M43L 1KPVB 4MAYA 5HHOB 3PGCB 3PWJB 1CG9A 4AK1A 3CFBB 3GSUA 4L8SB 5D7LD 1U8PA 2CETA 5JO5B 2OWXA 7TAAA 3RNQA 1UA7A 1Q94A 3FFDB 3MCLH 3AOFA 2X7LB 4CN6A 4JZJC 5EIIA 3M8OH 1VPOH 3H9ZA 3MJ9H 3EDEA 5CMAB 4DOHB 2R23A 3GHEH 5J8OA 4WDIA 3CFJA 1I9JL 4EDWH 2A77L 1ED3B 5DJ6A 1FN4B 3MRRB 4KH2A 4LPXA 1QFWI 2YN5A 2XN9B 4JZJB 3FT2B 5HGBA 5I73C 4TUOA 1VACA 2VDRL 1XZ0B 5F93C 4MQSB 1NBVH 4GPNA 5EBAA 5T1KA 1GOWA 2DQUH 2ZICA 1HIMH 1NUDA 4N0FA 4JO2L 3N13A 3QDGE 1EJ6A 3WN6A 1CGSH 3C08H 3KPRE 5HDQL 3AS0A 2NZ9C 3TO4C 3X3FL 4D0CB 3AFBA 1QSVA 1LO3L 1XF5B 3VXSE 5I73B 2A9ML 1S7QA 2HP4A 2PF0A 4R3SA 2Q7YA 1F00I 3R06B 3S37H 3A6OA 4Z0XA 1QPPA 3K2UL 3E6HB 3BFOA 2B4CH 1QFHA 1N0XH 2ENYA 1C1EH 1T1WB 4KKLC 5FO7A 4KTDL 2K7PA 4Y5YB 1A2YB 2Q8AL 4DO4A 4OZIF 5CJ8A 3ES6A 4OCMC 1MWAH 4PB9L 3KPSA 1CLZH 3UC0H 5I24A 4HUXA 4NN6C 1RUKL 5CWSB 4OIAA 2XPGA 5F3HB 2VQ1A 3HR5B 5CIPH 5BRQA 3HI6L 2GFTA 4EI6A 4QXGH 4WWKA 3L95B 3WFBL 3OLIA 3LKOB 4HOWA 2DQXA 3OHXA 4OB5L 2CIPA 2PWHA 4KWUA 3GZAA 2UUDK 3DIFB 1XCTB 4PBXA 4LHJB 3T0EC 4FXKB 4NN6B 1IGYB 4JPIB 1JGUL 3IB4A 5J13C 5DJ0B 4U6TA 4P2OC 1EXUA 2GJXA 5ICYB 1A7PL 1F6LL 2ZOKA 5D1ZC 3MRLA 1SMDA 3AIVA 4Y4KC 5IJKC 3BAXA 3SUVA 1EMTH 3MRNA 3HG4A 3C5ZC 3OXRB 3D52A 3OGVA 3BP7B 3KYMB 3DX1A 1P4LA 3WEZA 4P2QB 2Y1VA 4O02H 5HY9B 3L5XL 3T0EB 2GDUA 1UA6H 3TYGL 1KF9B 2O92A 5HD8C 1YY9D 3U4AA 1UADC 2APXA 1S7RA 5J13B 2LU4A 4QRRE 2GTZB 1XGUB 4P2OB 1LLOA 1NAMB 1PPIA 4AZGA 1IEAB 2WBKA 5D1ZB 3BIBX 4A6YA 4Y4KB 1QP1A 1X5FA 2P5WE 5ECJE 3C5ZB 3DMMA 2AI0L 4OZHA 4MD4B 5JQHC 1GL4B 3D85D 1AP2B 2H2PC 2IANA 1X9QA 5DVNA 3OLGA 3WFDH 1C3FA 4PTUA 1A6WH 4GRLC 2ITDB 1R24A 4OI9A 5HHOE 1I8LA 4FFYL 1FFPA 4JFXA 2VZOA 4LHUA 4Q9CA 4X83A 5JXEA 1KIUA 4D9QE 2ADIA 2DM4A 2R2HA 1H5BC 5D4QA 2WYSA 1G7QB 1JI1A 1S78C 3IFNH 4I77H 4CDGC 2Q6WB 4U6VH 2ZUYA 3CHCA 1KGXA 1TJGL 4ZD3H 1OP3H 4OLEA 5L7XL 2F7RA 4EDXA 3QWOB 5DSCA 4GRLB 5FDWB 4OOUA 4NFBA 4DOHE 4X4YA 3VWJC 4MAUH 5LQBL 1ZK9A 1FL3A 3MRKB 5LAXB 3ZLQC 5CPTA 3EOTH 4N1CA 1H5BB 4PB0H 3FQUB 3U57A 4Y5XC 2Z31A 2XN9E 2J7LA 3JV4A 4BZ2H 2UV3A 1V02E 2G3MA 4QRSA 4KJWC 3BT2H 2GFBB 5I8EA 4HC1A 1NBYB 1YC7A 5FUOH 2IBZX 2GJRA 4ZXOA 2QHAA 3V4PH 3KZSA 3VWJB 3ARGB 4NZUH 5HHPA 5E7BA 3VM5A 1FAKT 1OB0A 4GRMA 3K2MC 4J3TA 4MNGA 5BXFA 3N1FC 4KROC 1RPKA 2G5RA 4Y5XB 3L5IA 3GSWB 3QR3A 3FZUC 4LIQE 2ZNXA 4JPVL 4JR9H 1MCDA 2HN7A 1K5NA 4JHAL 4PREB 1QX1A 2H3NA 2ZG1A 5C8JA 2PYEB 3RWDB 1NDMB 3TT3H 1XFPA 2G9HB 2VIRA 5D8ZA 1YEKH 5GGRB 1UYWH 1YMMA 3TPUB 1NGZA 4KROB 1CLVA 3N1QC 1XIWA 5JUEL 1KWKA 2WMIB 1HH9A 2GUOB 2KBGA 4MZ3A 4UNUA 1QPKA 1AO7B 2W62A 4FQXC 1QFUL 3ESUF 3HA0A 5J6GB 5LGKA 2MQCA 5KZCB 3EOBA 1YDPA 1HKFA 2HT3D 3FN0H 4DVRH 2VXUL 1NPUA 3QUZA 1O6IA 4TSAL 5TF1H 2PBOA 3VFUB 3KPPA 3LEVH 5ID1A 4PGJA 1KLUA 4HIJA 1CGTA 3CH1B 4BELD 1DVFC 2H1PL 2BVYA 1A7RL 4ZUWB 2H32A 4G6KL 3MODL 2ZKHH 1RZGB 2NY0D 4FP8L 3IFLH 1HXYB 5E24E 3O6FA 2NX5B 5CQ1A 5SWZB 4MNQA 4PJDF 3CXDH 4MNHA 2R39A 1US2A 3ZR5A 1V3LA 5E0FA 4HBQA 4L8CB 4FNPA 1KJ3H 2UY3A 1A3HA 4RE4A 1M03A 4U0RC 1B0GB 2CJUH 2CHNA 4P2QE 1YEHL 5KSAA 1DVFB 4LSSH 4M9PA 4XRCB 2Y9RT 4RFOL 5LYRA 4MCZB 2W92A 3T0EE 2EC9T 3A47A 4NQXB 4PJIA 12E8H 3QNZA 4GAFB 1XGRA 3MLRL 4P4KB 4G42B 4PP2B 4QRUA 1TQUA 4CMHC 2LE9A 4MXQC 1EHLH 3GMLB 1XSKA 3RJDA 2A1WH 4OZGB 1FGVH 4OV5A 1QO3A 1PFCA 1ERNA 5IV2A 1U8OB 4QYOA 1I3VA 4KFZC 1BMGA 2OTPA 3IJHA 4M6ML 2BNRB 1VCAA 4U0RB 2NXYC 35C8H 3PNWA 1NUGA 5TQ0L 5IIEB 1RIHH 5BJTA 1LO0H 4PYHA 4P2RA 2DT1A 2WBJC 2EYSB 2XA3A 4O51B 4WUUD 4H1LB 4QO1A 4CMHB 4I9WD 3QXVA 3A6CH 3K0WA 3P77A 4PRHA 1CVSC 2BV9A 1U91B 1RJLB 4NUGH 1KBGL 1MPAL 2XYCA 3UTOA 1XR8A 3FO0L 2NXYB 2X4PA 3GBMH 2OP4H 5FGRA 2HFEA 3QG6B 5KJRL 3NCJL 4BA0A 2WHKA 3PHOB 4HZ6A 4E9LA 1HZHL 3TBTA 3W0WA 4GS7C 1U93B 3C9NB 3RWEB 1B2YA 2EDQA 4KVNL 4PJ7B 1PG7H 4MDPA 5BS0A 1WVZA 4MAYD 1GHFH 3BPNB 5JOPD 2EDKA 3CZ8A 1CK0L 1NGXA 4FMKA 2BCKB 4GO8A 5ELIA 4HFWA 5FOBB 4DUXA 4XTRD 1GHRA 3RDTC 5AG9A 5AC5A 4IRZH 2IH3B 3BP6A 3P0YL 3N04A 2GSJA 4LLQA 2DKMA 1NCAL 4HG4J 5AYBA 1FFNA 3MMEA 4TVPE 3RA7L 3BUTA 4APQA 1I7TA 1QSZA 3JV5A 3VRJB 4JLRB 3BIAX 4OJFL 3HC3L 1WUNT 4KI5D 3WNKA 2ZIDA 2DQGH 4U1KA 5IEHA 3MRIA 1W3KA 3QJFB 4FQHB 2NY4B 3U36B 1Q4NX 2A83A 4ZTOL 5DVLA 4QNPE 5FA4A 1G9MC 1N64L 2PYEE 3ECBB 1OP9A 1MRCH 1CD1A 1K85A 1F3DH 4JHWL 3FMGL 3VE0A 1Q9WA 5LXGL 1NDGA 5J12C 2F2HA 4BFIB 1A6UL 5T1KD 4FABL 4CJ1A 2Z4QB 1BQUA 1XHGA 3OIHA 4WW2B 1S8DA 3L3IA 5DT1H 5CBEB 1G7MB 3RX8A 3QEGL 1AO7E 1F2XK 3RVUC 5C6PB 3MRPA 2PXYA 2AK1L 4M4RA 1G9NH 4MX7A 5F96H 4GG6A 2E7BA 1D5XB 2D73A 1WEJH 3HHRB 4GKLA 5C7XL 3VXPA 5FHAH 3TPKA 1G5AA 2BSSB 2A3HA 4XMPL 3ZKXC 4OBSA 1ZGLA 3BRDA 3AIQA 3AMLA 1OGSA 1LNUA 3PN8A 5I1HH 4QF1A 2MCPH 3QIUA 4QXTA 1NCUA 3FO1A 3KPSD 1MVFA 2NX5E 1UM5H 5SWZE 1Z6JT 2C3VB 3CGTA 4WI9A 1T5XA 2B39A 1JZ2A 1J0HA 1F4AA 3QUXB 4Q74A 5DD0H 4JFTA 5EUKA 1WDPA 3V6OC 5I74B 4ZUTB 5BOPA 4OBRA 4U0QB 1SM3L 3ZKXB 3V6ZA 5IGXH 4UQDA 3P11L 2Y8KA 1EAPB 5GQBA 4OKVA 4WWKD 5FYJH 3D25B 2KZ1B 2QTEA 1KCUH 4N5EC 3SOBL 5A2IH 2AKRB 4P4RB 3X3GL 3NUKA 1FLRL 3VGEA 3K3QA 1EHAA 1M4KA 4R4FH 4OZGE 1BFTA 3KLHD 1E55A 3GJEA 5HYSG 3PZIA 3GZKA 4LCUA 3WEXA 4JAMB 4AT6A 5GISH 2BDNH 2BNRE 1CXEA 4JG0H 3TJEL 4M4PA 1T7XA 1A7NH 5D1QC 4AMKH 4F57L 1CIDA 4EN3B 1ONQB 3WUGA 1UCBH 3AIBA 1A3RL 4DFIA 3U7VA 4XX1E 3M46A 1MCBA 3QHNA 1FIEA 2B2XH 3MACH 5IMOA 3IGAB 1GOGA 4P8WA 3CJJA 5HDLA 3GNPA 3JWDH 3ALWA 1U41A 1MWAB 3B2UC 4JFDD 3G04A 4NWTH 3ECQA 2R0ZH 3C8KB 1BVZA 1VFFA 3EMQA 4R4ND 5DEGA 3BP4B 4PJHA 3RY4A 4UCFA 4PLOB 5DQJA 2W0FA 1U95A 1ROWA 5CIPB 3UZEA 3G6AB 3INUL 4WJ5B 1WLHA 4OLYH 5JW3H 2FBOJ 3QPXL 1J87A 3DMMD 4I5BA 1S7TB 1R5VB 3MREB 4PJAA 4I4WB 2EIBA 5F7HA 1RHHB 2CYGA 2ZJSL 1EOMA 3T3PE 4PJ7E 1Z9MA 2IAND 3TYFB 5J9PB 2D7OA 4CVXB 4EXPX 1HJQA 3BOVA 2IAMC 3QA3A 1DLHA 1KLGB 4LHUD 2Y06L 5JXED 5CILH 3RP1A 3WNPA 5FK9B 3TZVA 2OL3B 4JFOB 5I1CH 2P8LB 3EJQA 5EBMA 2YXFA 2X4NB 3BVNA 4NJAH 4G6MH 3QEHB 3DUUB 3AMCA 3MUJA 4W8BA 5FGBA 3GI9L 3MOQA 3X13B 3W11C 2VXSL 1V08A 2I60H 5AYQA 1E6RA 3P2TA 1QI5A 4JVWA 2HH0H 3QCTL 3V6BR 4WVRA 2HA1A 3S34H 2YR3A 2Z31D 4WSJA 3ZKND 1HKLH 3WIHH 3JTSA 3ZTJH 2W1NA 2FL5A 1F4YL 2DSUA 2F8QA 3T2OA 4HWNA 4JG1L 3S88H 1HK6A 1UKQA 2VX7A 4RBPK 1QWNA 3G6JB 2FCBA 1T7YA 1H09A 4L9DA 5BZDB 4JFUA 2J8UB 3BH8A 2XN0A 2AK4A 4ODWA 4HJGB 4YZFF 1IKFL 2DQEL 3ROLA 5KEZA 2DRUA 2HAZA 3NACH 1ZBWA 5ABFB 3BN3B 1Q0YH 1C5CL 3OKLB 2VDQH 3BAJA 2QV2A 1HX0A 5I1LB 1HQ4A 5ESQA 4DN4L 3L3JB 4ENED 1J10A 3KNBA 1WSST 5HI4C 1LVEA 1YMMD 1A14H 5BVJA 2XI9A 4F66A 2OR9H 3OJVC 2PW2B 5MENA 4KPHH 4LYQA 3LB6D 1H8NA 4R7DB 1TFHA 4OZIA 5D6CA 2BVOB 3S5LG 1GGCL 3N9GL 5IW3A 1FL6B 4K23H 4Y1AA 3N11A 3N9KA 1FZJB 1U8NA 5J89A 4UT6L 2I07A 3Q1SL 3EYFA 4MVBD 5H37H 2AEPL 4L4VB 1MJUH 1X3DA 5L9DH 2RGMA 4TULH 3QIBB 4P46A 2IALA 4KK6C 4B0MM 1UG9A 3SUSA 3FT4A 2WIIB 4W85A 5A6BA 4NQCA 5F7DB 3V6OE 3O6FD 1GAFL 1AQMA 1PQZA 4MNQD 4ZOAA 1SVCP 3VFTA 1JTPA 4HJJL 4HZLA 2FB4L 5GGVL 3UBXB 1OQXA 2DH2A 3TBSB 1A6VL 4K3EL 3BAYA 5KSAD 3GIZL 4HAFA 3HFML 5SWQA 1DN0A 3RIFK 2WHLA 3SURA 1SBSL 3OGCA 3WHXB 2CD0A 2NY3C 3A23A 3KEHA 1A6AA 1U9KA 1UZ8B 1KLFA 2ZNWA 4FTVB 4PGEB 3UPRB 1RUQL 1A47A 3M45A 4F7MB 1BD2B 5C0JB 1KPRA 4Z76B 2BNQA 1HILA 4NRXB 1IT0A 2CDFA 2D03L 2VDNL 3C2SA 5IK3A 5HPMB 4D1IA 3MUHL 4U1SA 1WDRA 3SY0A 1TQTA 1S9KC 4P2RD 3QB7C 3EDDA 4NC0B 2NY3B 5F9WB 5DJ8B 3BZ4B 1GOIA 5DK0A 3UYPA 5F1NB 5IW1B 4LLUB 4PRHD 2AXJA 3MOBH 4F3FB 4NRZA 1YN7B 5AD0A 4MADA 2Y07L 1AGEA 1WCQA 1VGKB 2X10A 1WZAA 1YY9C 1U8HB 4I3RL 3E2HB 5BV7C 2XXCB 1KNOA 4NX0A 4N9GA 4MXWH 4P5TA 3W9DB 1VGEL 3W0WD 4GLRI 1IL1A 2W59A 4NQSA 4ZS7H 3H3PL 1I3RA 4HA1A 3U5UA 3ZDYF 2C3XA 4EUPA 3QFJA 3MA7A 3OF6A 1N2RB 2VXQH 4YDIH 3CFCH 4W6YB 1NCWL 4ELKB 4PTXA 1A6ZA 5AWNH 3RVTD 3A0OA 5BVPL 3W37A 1DANU 3F5LA 1MQKH 1FGNL 3RO8A 4LIQL 3OPZL 1KYOK 3GIVB 2DF3A 4APQD 1W32A 3G6JE 3RWFA 2YKKA 5EUOF 3PIQA 4EXKA 2J8UE 5ISZA 1RK1A 3SGEI 2ED8A 5C0EB 2RFXA 2C9AA 4V1DD 5L6YH 4NO3A 43CAA 4O2FB 4JM2F 1ZHBB 1EO7A 8CGTA 1HHHB 5CUSH 1WTGT 1DEEA 2HT2C 1ZA6B 4MJ5B 3Q6GL 4MSWB 2KUTA 4QHMB 4YHOL 4DO5A 4FMFA 4I13B 1OM3H 3P0VH 1JZ7A 2C7UA 3QCUH 1A5FL 2IF7A 1MLCB 3V52L 4IRJD 5C0IB 4PJFA 3OQ3B 5GZOC 1CU4H 5I77A 3LPPA 4MCYA 3TC9A 1UENA 4LLYA 4S2SA 2PXYD 1O0VA 2E9BA 4LLVA 5JDSB 2EEXA 3FB5A 4DZ8B 4CU6A 2DSKA 4JFHE 4YN5A 4URIA 4CU7A 2DJUA 4MJIA 2YRPA 3MYJB 4L29A 4MS8C 4X99B 2FLRT 4L4VE 1FO0H 3HU7A 5EU5B 2OSWA 1XV8A 3CC5B 3RHWF 4XI5D 4H20H 3PG2A 3PP3H 5DA0B 2GK2A 1PIGA 3SJVD 1DWFM 1CXFA 3S96A 4MQXC 4Y7EA 2R4SH 4AYSA 4IOIA 4PD4J 2W5FA 5H94A 1N6UA 5ACZB 3TNNB 4PJDA 5I1AB 1WBXB 1LO5A 1NAML 1EV2E 3KLAA 3S97C 3POHA 3SE4C 3V4VH 3S5LA 1NANH 5JW5B 3WY4A 1VESA 5HGDB 4L3EB 4GSDH 4PS4L 2OW7A 4H7VA 4FTVE 4Q7NA 1KQZA 5E5MB 1BD2E 2P5EA 5H35B 3AUVA 4G3YH 4N1EA 5T1MB 1LMKA 5E9DD 3I9GH 5CCKH 4XNMA 4PRNB 2X70A 1YYML 4LGXA 2F7PA 4FLQA 3C8DA 4HUUB 3II1A 3ARVA 3VIKA 5GS0C 2HFGH 5LCVH 4GXVH 2IPKA 3DV6B 1GJIA 4TX6A 2NW0A 5F9JA 3VXMA 4G8IB 4UUJB 5IKCA 3VXUD 2V38A 4FZ8H 3O3BA 3IANA 4W4OA 4ERSL 4RNRA 3SCVA 1YEEH 2PW1A 2WWMD 4QDMA 3KPMA 4Y4HA 1NCDL 5JXAH 3HC4H 4K2UL 1G0YR 4K3DL 4XXCA 2ICWA 5E00A 1YUHA 1G7PB 3O3AB 1J8HB 4PJEF 1GHSA 2P8MA 4PPTA 3QHFL 1GNXA 3ARRA 5LKNA 1UD5A 3AHXA 4Q6YA 3BAWA 3WDIA 1Q6CA 3L3GA 1J0KA 1KIPB 3QIWD 3JWDC 1E27A 2JF7A 3GSNB 4KY1H 4TVPL 3RTQB 3O45A 3ULSA 4MB4A 4Z77B 5KS9F 3HPLB 3TN0C 3T3ME 3TZVD 4EBQL 1QNZH 2VL5B 3SCSA 4OF5A 2GVYA 3NFPA 3IDYB 3MV9D 1T6WA 4M5YL 2GT9A 2ADGB 4URTB 4N90D 5I71C 2BY1A 4FQ1H 4KRMB 4HGKC 5DC0A 1KG0A 3D3AA 3QOMA 2GCYA 2EZ0C 3GM8A 3OAUH 3VUPA 2ARJA 3TN0B 3V5HA 5A2JH 4UU9B 1P4BH 4JFEB 4LSRH 3C6SA 1X5KA 4P23C 1BBDH 2JEQA 3GSXB 2DQHL 1QSEB 4XTRC 3OAYH 3SUWA 4YR6A 2GJ6B 2ICWI 1EO8H 5T5FH 2EH8L 5M5DA 3F7VA 4OI8A 2YKLH 2AK4D 2CRYA 2Q86A 3Q6FB 1UYQA 5DRXB 2FZ3A 3DX7B 5A3IC 3LKRB 3VM7A 2QR0B 1CD9B 2APWA 4P23B 1RZ8A 3OB8A 1F02I 1S7XB 1F4HA 2C4XA 1VB9A 1TJHL 4QRTA 5I1EH 4U1LA 2G3JA 4XZUB 4C4KO 3IK2A 4OLUL 1JYWA 3NPSC 4L9LC 5LBSL 1PKOA 1IGCH 3IXTB 4N0CD 2EPMX 4YNYB 2WLZA 2DKSA 1J18A 2V5RA 3RUGF 3BW9B 1KTDA 1D6EA 1EDQA 4K07A 4HDIB 1U3YA 5MEND 2PYFA 5DO8A 4GQRA 5LWYH 5E2UH 1U8MB 1AR1D 1XD1A 4H88L 4PRIA 2EACA 4DM1A 3MO1B 2Q76B 4Y1AD 1N6VA 5TGBB 3SDXB 1OP3K 5TDPA 3NPSB 4L9LB 4LNRB 1GZQB 2M8XA 5CINL 5C0BA 4L3EE 4GQPH 5DRZB 3VWKC 5IMMA 4M6NH 2FJGA 4P46D 5T1LB 4UZGA 1FNFA 3F65A 3EYUH 1H5VA 1NLDH 2BSTB 4KDTC 1V7ML 3OJ2C 4FQJH 3V0AC 2BMKA 5A6BD 5E8PB 3LRHA 2DD8H 4NQCD 1MFAH 2IXUA 3JUYA 4MD5B 2COQA 2KPNA 3O2DH 4Y5VA 3B8YA 2CUIA 5A8QA 4QWWC 3I3DA 5IUSA 5A6KA 5FL0A 5K59E 1KPUA 4NN7C 3VWKB 1DBML 2PNDA 2FYYB 1KACB 5D7SL 4J6RL 3LN5B 3GMRA 1B0RB 5IB2A 5IQ9A 1FNGA 2X4TB 1OWRM 2X2IA 1WIOA 1N7ML 3DURB 4F7EB 2E3ZA 1QOKA 4WWKC 1W9VA 3SKMA 4LSTL 4D6FA 4JFYB 3ZTNH 1HL8A 2BNQD 4PRAA 4M80A 1T04A 1J8HE 4NN7B 2EIZB 1R3LB 1YY8B 5FYJE 2XZZA 4XPHL 5JPMA 1D5BA 3BN9C 3BKML 4EI6B 1WAAE 5ICZB 4N8VB 1JHLH 2FECL 4FXLA 4H8WL 4OZFH 5CLWA 3VTRA 2EH7H 1DBBL 3ZE0E 4NKIH 2OTUB 4Y16B 1BGGA 3NCCB 1TQCC 4AEIL 4X9BA 3S35L 3KYKL 1JPST 1MCOL 3RIKA 4JVPA 4P5TD 5DJXA 1J05B 3WFCL 5IBTL 1IM9B 1K9TA 2NYYC 5KSUA 3DVGA 3SN6N 4CVWA 4XPTH 5KTEL 2CXGA 5ERWB 2ZG3A 4FQPA 5DD1H 1QNRA 1M01A 1WWAX 3TWCL 3MUIA 1E6JH 1TQCB 3QFJD 4YXLH 3QRFM 3OF6D 1T20B 4H0HB 4JFEE 1I1CA 5K9QG 2FIRT 1I8LC 2Z9TA 1F5WA 1T89C 4MLSA 5BQ7B 3C6LA 2XY2A 1QSEE 3L4WA 1HSBA 1H3UA 2GJ6E 4N0UA 2WVVB 2G5BA 4U7KA 3MCLL 2G75B 3IJ9A 2C4FU 2P24A 4JO4H 3W82A 2J78A 4P8UA 3NCFB 1GJWA 4WIQA 3M8OL 1WFUA 1VPOL 5ISZD 4FNRA 3MJ9L 3TFKC 4R7NA 4JEGB 3O9WA 3BX7C 2FJFA 4OCXL 2EDHA 5EIVA 5EU4A 4PJ8B 2W0PA 1RULL 3I3BA 1MCFA 1LGVA 2CO6B 3MRJB 4EDWL 5IR1A 1HTYA 3VGFA 3BKJH 4EIGB 1F3JA 3D69A 4R2GC 5K93A 2CIKB 1CDBA 4IIQA 3ZKNC 2FJHB 3RI5F 2BVUA 1NFIA 4V2BA 5I8KH 1PY9A 3BCDA 2W9DH 2VZVA 2VCAA 4CVZB 2IGFL 3FQXA 4Z7VB 1F58H 1NBVL 3GMPA 3BLBA 3WHE0 2DQUL 1HIML 4BH8A 1BECA 1SEQH 4PYGA 2YPVH 1FL3B 1UKOA 2NR6D 1FJ1A 1CGSL 1X5GA 3C08L 5J6HB 4R2GB 3SDXE 2J3SA 2WINB 5JUVA 4YWGH 3L7EB 4MJID 1I7UA 1INQB 1FBIH 1UWEL 2YJQA 4OCLC 3VI3F 1MI5A 1LK3H 5FYLD 5ITBH 3T0VA 2E6QA 2ZG2A 2B4CL 3KPTA 3MV11 3O2VH 3RZCA 4PTTB 4HZAA 1C1EL 3DX2A 3MJ6A 2QPUA 1U92B 4GRMB 2G41A 1U8LA 3GBEA 4JRXB 1XIWC 2EIDA 3NPZB 2RHEA 1MWAL 3RI5K 1U8JA 1M05B 2VLJB 3VCLB 2A6DA 1CLZL 2GAZB 3UC0L 3LB6C 3MV7B 4HKXB 4LPVA 2MOVA 3KR3H 1H1NA 2O61A 2IBGA 1YEGH 5JIPA 3U9UB 1KXVC 1K6QH 1N59B 3QUZC 4BM7A 3UR8A 1XEDA 1NGPH 3S36X 4QXGL 1LQ0A 4MVBC 2P5ED 1MCQA 3RKPA 3MROB 2EE9A 3O4LB 5GJTH 4QLLA 1NKRA 5KSBF 5GIRB 3WJJA 4KTEH 1YNTB 5IESH 4XHJD 3D18A 4IMLA 2WMJA 1M7IB 5EOTA 5JPNB 1BYBA 3QUZB 4PMXA 1FO0B 4D3CH 4EK7A 1KJ2H 3VXMD 1X5AA 2OL3L 1L0XA 3HRZB 4XGZB 5DA4A 5IB4A 5IHZB 3GUTB 4WNQB 1EMTL 4R8WH 1UWGH 1KLUB 4WTZG 3T0WA 5KSAC 3ALGA 4O02L 3ZHLA 4U1NA 2H32B 1ES0A 1UA6L 5GPRA 3WCYA 3CZKA 1QQDB 2A6KA 5E2JA 1ZANH 1ZVSA 3D48R 5FIPA 2FRGP 2F8VA 1YJDC 5IB1A 3DBXB 3HZVB 4KJYA 5GRJH 1CLYH 1K3ZA 5ESAB 4RFEA 1P5UA 3BGMB 2EC8A 2XWBB 2DLFH 2WHMA 3MS8A 4HV8B 4Q2ZB 4ORGA 1Q38A 4OGAD 3IU4H 1F6AB 1RD6A 2X1PA 3EO0A 5ENWB 4TNVF 2ADJA 4P3DB 2IGTA 3AZSA 5C3TA 1A6WL 2AJSH 4OGZA 4KZEH 1BTCA 1DQQB 3WEMA 4OV5B 1XH3B 3ALXA 4WFED 2BSED 4GKNB 3STZB 3TM6A 5HHXH 1UXWB 3IETA 3IFNL 4I77L 1DDHA 1UVQA 4PGBA 5CGYC 3WL9A 2BVQB 5DI8B 2V2XA 3CUPA 2XG9A 3L7FA 3W39A 4ZD3L 2DBLH 1F45A 4G6AD 4TSBL 1VKXA 4X6DB 5EUOA 1C08B 4R96B 4MAUL 1CFSA 1A1NB 5AC4A 1QFWM 5I2IA 4YPJA 3W9EB 3EOTL 1XR8B 4K7PX 5FGSA 2H41A 4PB0L 4JM2A 4JDZB 3VXTB 4BZ2L 4PJ5B 3PZGA 1E72M 4NRRA 3BT2L 3REWA 1D9KB 1FZMB 1W72H 5FUOL 5C71A 4EAMA 3V4PL 2HG5B 4Z7VE 3DGGA 2E9WA 4X80H 1OSEA 2XTJC 4NZUL 1UB5B 2ZUWA 2RAMA 1UD4A 4KK8D 5BS0B 3B5TA 1D5ZA 3SDAA 1MW3A 5E70A 4O9HH 3TO2A 3RX7A 1H0GA 4Y2OA 1JGLH 1NSNH 3NN8B 3F4VA 3ROOB 3V5DA 4JR9L 1UKTA 4YHEA 1NC2B 1UR2A 3BUIA 3FQRA 2XTJB 2BVDA 4QXUH 4J28A 1HN1A 3UERA 3TT3L 2FBJH 1YEKL 1UYWL 4JRXE 1FNAA 2F54A 5DHVA 3KDMA 2VLJE 4PRID 3WY1A 3JVGA 1JFXA 1I7ZA 3MV7E 2EDXA 3CAFA 3MLWH 2PXYC 2V3FA 4Z7UF 1QI4A 3D2UA 5FA4B 3FN0L 4DVRL 4TX8A 3NIGF 5EFFA 2VQTA 4MNJA 5C0BD 4JPWH 3ULUF 3RPIA 1M6OB 3SEPA 1SJXA 5DYOA 2AJXH 4P0DA 5TF1L 4HSQA 4YGVA 3LEVL 1SEBA 1NDGB 3VFOB 1AXSA 1US3A 5EFIB 3UTPD 2DQTH 3BDYL 4K7FA 4YHPA 1F13A 5C0AA 4R0LC 3EJUA 3FNDA 1JF1B 1IGIH 1J5OH 3HN3A 2OZ4A 1TQBC 1P2CA 2QHLA 2ZKHL 3EJJX 4K9EH 1Z5LA 4J8RA 3G5YA 3LAFA 3QIUC 5JW4N 3IFLL 1YPZA 5EZLA 5F71A 4YGAB 4GG6B 3CXDL 5FD0A 1OWWA 3C09C 1XR9B 4EI5A 2Z92A 1LP9B 2EDRA 3NZHH 1ZWIB 4P57B 5D6DC 3VFSA 2CJUL 5CD5D 4X6BA 1A8JH 4LSSL 4R0LB 3SKJH 3F7PC 4ONGH 4ZFMA 3HB3D 3HUJF 1TQBB 1FYTB 12E8L 2N7BA 5DUMH 2EDDA 2ZSVA 3VMOA 5GRYA 4U1IB 2A1WL 1FGVL 1ZHLA 1RY7B 1P7HL 3C09B 1G7IB 2R4RH 1LD9B 2WAHA 4E41D 3O2WH 2PBGA 3WD3A 1ZOXA 1WGOA 5JHDD 4NN5C 3CDCA 5MHSD 4AIZA 3PP4H 1LO0L 4ONHB 1H8OA 2A6IB 3DX9B 4WKAA 4W70A 1CN4A 3NYDA 1ZSDB 4HIHA 1MW0A 4YHKL 4KHXH 4ZSOA 3A6CL 3QQ3A 4WTZA 3G9VA 4LCUB 4NUGL 3RJYA 1T1ZB 2MQ3A 5KS9A 3GBML 2OP4L 4NN5B 1KB9K 4JDTH 1U3HC 3I6GB 4R27A 1OGAB 3EJSA 1G6VK 2XFFA 4P2YA 4X6DE 2WC7A 1I1FA 5K9JH 2YD1A 5C0GA 1JGDA 4OAWA 4JY6B 4J3SA 1W1VA 3DRQA 1UWXK 2R8SH 3UAJC 2YBTA 1PG7L 1YEIH 4W8AA 3KWWA 1GHFL 4G8FB 3MNZB 3F12A 3FKUS 2W0FB 1U95B 1U3HB 4PJ5E 1OF2A 3MRQB 4PJXB 5A43C 4N5UA 4IUGA 2VCBA 1IC4H 4Y19A 4OZFB 4XB7A 3C60A 3P4NA 1KULA 1MLBB 2HLFD 4NC1C 2XOTA 4KKCC 4GXPA 3T65A 3CMOH 3O9WD 5BS0E 3QA3B 3PWVA 4JJ5B 4OM0H 4TOQA 1CQYA 2O5YH 5D8JH 3PTQA 2DQGL 1JNEA 2VMFA 4BQCA 4XWOC 4XCNA 3DTXA 5EBMB 5DHXB 3BVNB 3MUZ1 2OJZH 3GBNH 1PYWB 5IOPB 4OGYH 2XTJE 1E4NA 1P7QB 2FHFA 3MNWB 3HJEA 1MRCL 1A6PA 1V05A 4M1RA 2GITB 3HCVA 1NLBL 3ARTA 1H4PA 4RSVA 1XYZA 5HDOA 3RUGA 4PP1C 1I8MB 1EDTA 1FFRA 4IM8A 1ZHKA 1JWMB 4G9DA 4MLIA 1HEZB 5DRWB 4OZ4B 2OYMA 3E0GA 1AY1H 3VIOA 1G7HB 1G9NL 3B3IB 1EXPA 3QNYB 3WH6A 4NIKB 5F96L 5EMYA 4AISA 3EJYD 1MI5D 4MMXC 4WV1A 1WEJL 5I75B 1N3NA 1D2KA 3BAKA 3A24A 4HTYA 1BBJB 1JUFA 3KPLA 4HK0A 3RZCD 1DANT 1KCSH 3OR7B 4YXHH 1CR9H 4M7JH 2DYPB 2AABH 5I1HL 2MCPL 2WW5A 3IDIA 2AEWA 4FFZH 1WNOA 2L7UA 5EC2B 1UM5L 4ZS6D 3RU8L 4GG6E 1ZU8A 3BWAA 2OWWA 5BRZD 3MGOA 5DD0L 2HVKB 4OFPA 1DN2A 1CE6A 4GO9A 3VIFA 1HQ4B 3ZKSD 1LP9E 3WUFA 4M81A 3VH8B 2D0FA 5IGXL 3NSNA 3UJJH 4X9IA 1FYTE 5FYJL 1IKNA 3L4VA 1J9CT 4ZXLA 1KCUL 5BVJB 4N1HB 5TE7H 2VQUA 4I0PA 5D2LB 4R4FL 1OTUC 2WWKO 5C0DA 3GSNL 3O11B 5FUCE 5GISL 2BDNL 4JG0L 1LF1A 2GK1B 3BXWA 1A7NL 4AMKL 5GJSH 1YYLL 1CFTB 4I18B 1A1OA 1MFVA 1UCBL 2X6MA 4NO2B 2C7FA 2C1PB 1JWSA 4HA4A 2B2XL 2IALB 1QLEH 4WU5B 2A2QT 1IAIH 3VILA 5F1IB 1I4FB 3JWDL 9CGTA 4NWTL 1VFAA 2VLRA 7FABH 1PQZB 3SKNB 5I6XB 2J7BA 3VFTB 5ADOL 2WVUA 3VRLF 1R34A 2HLAB 4GAYA 1OGAE 4AENB 1PSKH 3H3BC 2WQRA 5IBUG 2V2WA 4OLYL 5JW3L 4XBGB 5JW4R 4Y2DB 3AU1A 3D1MC 1KCVH 5MERA 1C5DA 3I85A 1DE4A 1S5IH 1XT5A 4CNIA 4ZOBA 3WY2A 3ZDXE 5IVXB 2E9LA 1XGTB 5DMKB 3UTSD 1NARA 1JHTA 4J3WA 2CDGA 2L4OA 3BP5B 1VADA 1KPRB 1E9LA 5CILL 4PJXE 3SKOB 2O5ZH 1E0XA 3HE7D 5IK3B 5I1CL 1N82A 3VIJA 4NJAL 1HH6A 5F44A 3L4YA 1A6TB 3TBVA 4KU1A 3OR6A 4P5TC 1JGIA 2Q3ZA 2FO4A 1Z0MA 3O3DA 1N5YL 4DZBA 1A7OL 2I60L 4GBXC 1W3HA 1AGEB 1XF2A 3WIIH 3ARUA 5IB5A 1MHCB 3L6FA 3PDDA 4JM2D 1NFKA 4D71A 1ZE3C 5E1AA 3S34L 4BQ2A 3AY4A 4UNIA 3HMWH 1HKLL 4F15B 3WIHL 1RJZA 1CS6A 3FAXA 4NC1E 1A1MB 3D5HA 1KCKA 4M29A 2H26B 4ZQKB 3MRGA 4NQSB 1NM9A 1IAMA 3S88L 4NFCA 4RMSA 4GI9A 4TTUA 1U8KB 2X9XA 3PWPD 4GBXB 3ORJA 1G9HA 3BZFA 3SDAD 5J1AB 5A6SA 1X5IA 2GQHA 2D9QB 4N68A 3TBYB 3NACL 2DGAA 4UFLA 5D7IF 3L5WA 3AMKA 5DEFA 1Q0YL 3V5KA 4NBZB 1LDSA 4R97C 1C7TA 3L3OB 5DJ2A 3B4NA 4M7KL 5HHNB 4R9HA 5C1MB 3VO0A 1KB3A 3LCYA 4B50A 2IMNA 1BYCA 2VLKB 1XSJA 3ZDZE 4YJZL 1OCQA 3BUDA 1GOKA 1A14L 1G7LB 4XNZC 4RX4A 3PZUA 2LV4A 2OR9L 1A3QA 1CQKA 1UA3A 5SX5K 4LNVA 1CICC 4R97B 1TITA 1SY6H 4KDVA 1DEEB 5FKAB 3D2UD 4GW1A 5DMYA 2DJ4A 1W72B 1CFQA 2NLJB 4K23L 3RVXD 1KJVB 4AH2A 2EEBA 3FB8A 2UY6A 4YO0A 4F7TB 3ALFA 3GBLA 2EDTA 4PLJC 2BRQA 3RGVA 1MJUL 5L9DL 5A6MA 2ZOLB 5C0AD 3AXHA 2EO7A 2FE0A 4HKZB 3QNXA 1AD0B 1S9WB 1CT8B 1QA9A 5D2LE 1CICB 4S2SB 2IFGA 3IJYA 3SDYH 3VSTA 4AZHA 1GQJA 1LDPH 5IBLC 3CLWA 2Y7QB 4DGIH 5L8KB 1E4XH 1RFDH 5DK2A 4BA8A 4LFHG 2VISA 5LGHH 2DOCA 3UETA 1KEGH 4JY5H 4UT9H 3HMXH 3U48A 3U5YA 5I15H 1A64A 1T66C 3ULVH 1I1YA 3GJFH 5IHLB 4HPYH 2YDSA 1DJSA 5F7NC 4DEPC 3DRTA 1HNFA 3TONA 4BZ1H 1QR1A 3IJ7A 4W7VA 4FHBD 1PAMA 3H6JA 3ILPA 4U4BA 3WMSA 4F9PC 4QNPF 4UOQA 4JVUA 3ZYZA 2CGRH 5KBNC 2EXWD 3WMBA 3S4SG 1A7BA 5DEZA 4PG9A 4M6AA 2W60B 3CVIH 5EA0H 3T0BA 5DJAA 5IVXE 4C7GA 3AXLA 2XG4A 4K94H 2XZQH 4JB9H 2B31A 2X0YA 4HKBB 4CDHA 4YH6A 1NMBH 3MOBL 4Y4HC 4JM4H 2GSIB 4XXCC 4M1DL 4U6XB 5FOJA 4LAQL 1IEBB 4NHUA 4NZFA 3WD4A 1E28B 4PV8B 2IPKB 3MRDB 4B9ZA 4H5SB 4KVCH 3EDFA 4HXAH 5ILTH 4ZS7L 3CVHH 3GMOB 2FWOA 4A4AA 1MCPH 2PW1B 1V3MA 1LEKB 4NRYB 4QOKA 4Y4HB 3HG1B 2VXQL 1WBYA 4YDIL 1WKYA 1HNGA 1NAKH 1W0YT 2X5PA 1DUZA 4U31A 3NVQA 5D7KE 5HI3D 3HLAB 4WU7B 4FG6D 5ACLA 3K8MA 5L8JB 3WQ8A 4AXNA 4ZOCA 1MQKL 3C60D 3EOYG 3L9RA 1RZIA 5E94B 5F9OH 2VITA 4F80A 1E4LA 4D8PB 1FG2A 4G6AC 5L6YL 3O45B 4JHOA 1FIGL 4LCIH 4HJ0D 1IE5A 4BUGA 1VIWA 1FNHA 3P4OA 5CUSL 3KXFB 1AHWC 1YEDA 3NFPB 1KTCA 5A2FA 1R75A 1OD8A 3WH5A 5EO9A 4XCYA 5EORH 3C5JA 3P0VL 3VDHA 1XGQA 2VLKE 4UOW1 1T03H 5E2WH 3BQUA 3QCUL 3SE3C 1XF3A 2VL4A 4HGWA 1JXKA 1NC4A 1FH5H 4LSQH 3LMYA 1CU4L 3IF1A 4JQIL 1UT9A 3AYRA 3HI5H 1AHWB 1OP5H 3KAAA 2OJEB 1QVOA 1GSMA 3PL6A 3MLXH 5CBAB 4XVTL 5TE4H 5FHBH 1UQZA 4Z7UA 1MEXL 4HHAA 2YD7A 5E08H 2B1AL 5IFJA 1FO0L 3T3PF 4PJ7F 2KQNA 4ESKA 3TH3T 2FZ3B 3F5WA 4H20L 2C4FT 4J7RA 1OGTA 4XPGH 3OKOB 2YA0A 3PWLA 4MA1C 4TSCH 1E6QM 3AMDA 1FV1B 1BIIA 1E6XM 3LN4A 2R4SL 2XA8H 1XGYH 3QH3B 3QDHA 2XZAH 3MLYH 4LEOB 4POZD 4YBQD 3EYOA 2F9BT 3L3KB 4KXZI 3V4VL 4P7QA 4XCCH 1JNHA 3FO2A 5F7LB 4GSDL 4L3CB 5D93C 2BOBA 1UR9A 1KGCD 3PDOA 1KCRL 1JG9A 3ZR6A 4I0PD 4H8UA 1T1XB 1VERA 2J8GA 4NXKA 1AE6H 4G3YL 4D0BA 2GY7B 4GW4A 3GMMB 5CCKL 2WIMA 3FB6B 4ZG1A 3G5VA 1A0QH 1W0WB 5TDPB 1B1YA 1ZBVA 4JRYD 4Y5VC 4ZAKA 4R5EA 2FIKA 2HFGL 5LCVL 4HULB 4GXVL 5C6TH 3GXIA 1MCSA 3BGAA 5IMMB 3OXSA 5D93B 3GXDA 1Q9OA 4NKOA 5EZIH 2J8HA 1WWWX 3CD4A 5AZ2H 1CFNA 3NIYA 1YEEL 2QQQA 3VGDA 2BMKB 2EDYA 1W9PA 3THDA 5JXAL 1MF2H 4GG8B 3HC4L 1FHGA 2VLRD 1X5XA 3QDGA 1ZMYA 1DTUA 3BSZH 2DLIA 5FCUH 1KFAH 3RVVD 5GS1B 3NA4A 3OKMA 3U1SH 3QO1A 1UUQA 3MKKA 2HRLA 3VXSA 1J1PH 2LU7A 4WEBL 1FSKC 1ZLUH 4BCEA 1EHNA 2VLLA 1MQ8A 2FHBA 5CEXA 3G5XA 1AGBB 1Q9KA 4WI6A 3AISA 2NY1C 4YDLC 3HG1E 4KK5C 3PV7A 2GHWB 4D9LH 4HH9B 1NEZB 5TDNB 2ZUQB 5I8OH 1TVNA 3BHBA 1IGJB 4KY1L 4G8GB 3D4YA 4PRAB 4ZE5A 4HPOH 1PZ3A 5I9QC 3RWJB 1QNZL 4CL7A 1FSKB 2I26N 5MEOB 2A9NH 2ID5A 1M7DB 4RGOH 3OX8A 3DETC 2CCRA 4FQ1L 2NY1B 4YDLB 1ZV5A 4PJGF 4YHLH 1WDSA 1JPGA 3LS5H 4G43A 4ZEPA 3NSXA 3OA5A 3TIEB 5B38B 1RV6X 5I9QB 5JW4M 3H7LA 5E8DH 1XAUA 4DWHA 1P4BL 3KXFE 4OIIH 4PFEA 1JV5A 3I6LE 1KIQA 4OFYA 5F9AC 1BBDL 1MRFH 2J62A 1T5WA 3C6LC 3MRFB 1VEOA 2X40A 1B3XA 1OAYH 2FHCA 3TBWA 3F5JA 4PJBB 5T5FL 3PZTA 1AD9A 5T3XE 3DI3B 4YHIA 3QGVA 4ETQA 2YUXA 4X8JB 2YKLL 2X05A 2LFGA 1A02N 5L88L 4JFFB 2N56A 1I8KB 2ICEA 3BEVA 4Q58C 4X5XB 2VRKA 4J3OC 5IFAH 5JNYA 4QRRA 2VLMD 5TDOB 4RISH 1EFQA 4N0UB 5I1EL 5DQ9B 2NTFB 3RPMA 3BKYH 2P5WA 4XNQA 2NY0B 4IIQC 1JWUA 4YPGB 2AV7A 5ANMB 1FFOA 2YMXH 4RAVB 4JQVC 4CRPA 4KJPD 4RX4D 1H3VA 3HE6B 4U1HA 1KPVA 3G5ZB 5EU4B 5HHOA 5B39B 2YEZB 1H41A 3PGCA 4GAJL 5E2UL 5LWYL 3PWJA 1B0WA 4BH7B 1UH3A 4J3XA 3CFBA 4L8SA 4GW5B 5D2NB 2F8OA 4AM0B 5JO5A 2XSBA 3O6AA 5F3BA 3REVB 2X7LA 2Z35B 4ODUB 3FQWB 4QXWA 5DMJB 3B6SB 1TZIA 1KTRL 3QYCA 2ITCB 3RGVD 4M6NL 2XACC 3K7UA 5GGQH 3BC9A 3AHYA 5CMAA 4DO6A 4YIQB 3EYUL 3DECA 5M7QA 4RGMC 1NLDL 1TZ7A 4FQJL 3UZVB 2YL5A 2DD8L 3T1WA 1MFAL 2P45B 3S6TA 1ED3A 1FN4A 3MRRA 1X4ZA 5DZNA 3O2DL 4M7LH 2VZUA 1EFXB 2XJ7A 2XN9A 3FT2A 5KVGH 1I7UB 3QHOA 5FB8A 3QO0B 1DWHM 4HT1H 1XZ0A 5DFVC 2J8UF 5CJXA 4AZ8A 5E4IA 4GMTH 1LWRA 1J0JA 3ZTNL 1U8JB 4D0CA 1ZA3B 1GONA 4OLWH 1XF5A 5GRXG 4CBPA 3P4LA 4TUJA 2VAJA 5KVMC 3R06A 4LKCB 2FLBT 3NMEA 1IT9H 1NP0A 3E6HA 2IFFL 1JVKA 3EYPA 2CBJA 1T1WA 4Y5YA 1AQDB 1A2YA 1JHLL 4XH2B 2EH7L 4XP1H 4G8GE 3GXFA 3F7QA 3WF4A 1C91A 1J86A 3QI9D 3S3SA 3D18B 4X6CB 4CCEA 5F3HA 3K8KA 3ZYOA 1JNDA 1DBAH 3HR5A 3VX0A 3GJFB 1YEJH 2F74B 3D4ZA 3GH4A 4XPTL 4K94C 3L95A 1E43A 2G4FA 3LKOA 5DD1L 4QOKD 3H9HB 1E6JL 1R5WA 1WBZB 1S9XB 1TCRB 3DIFA 4LP4A 4YXLL 1L0YA 5MEQB 3PTMA 2WWCA 1XCTA 3JBG7 3EYQD 1B90A 2P43B 4FXKA 3OJDA 4IM4A 1IGYA 4PGCB 4JZ5A 4JPIA 4AD0A 2IH1B 5DJ0A 5ICYA 1T7WA 2YFOA 3GSQB 1OTTD 4JE4B 4UIMB 3WL0A 4H1LG 4YDVB 2WMPA 4PJBE 3OG2A 4KQ3L 3OXRA 4OTXH 4JO4L 3KYMA 1AGDB 4P2QA 5HY9A 1B0IA 3EBVA 3T0EA 1QR4A 4JFFE 1I7RB 3IKCB 1AGFB 4NZTH 2NY2C 3WQ6A 2GTZA 1XGUA 3Q48A 1NAMA 1K9FA 4N0UE 1IEAA 4O58L 5FF6B 1ZBKA 3BKJL 1WPCA 3BGFB 1X6NA 4Y4KA 5IJKA 2X2YA 1DDHB 1MAJA 3C5ZA 1RIVH 5GGTH 2V2XB 3HZ3A 2L7JA 3BQUD 5ANME 4MD4A 4IEFB 5I8KL 1CVRA 1XCQB 1AP2A 2W9DL 5I5RA 2ITDA 4AIUA 2NY2B 1SEQL 2YPVL 1BQLH 4QGTA 1Q72H 2EE3A 3RM4A 1QOXA 1IJ9A 3PL6D 5DO2D 1FCGA 4U7SA 1UD3A 4Z2LA 3H9SB 2Q6WA 2V2TB 4YWGL 3VGHA 3V9FA 3ULUD 4D6EA 3QWOA 3GFUA 4HU8A 4IS6A 1G1CA 3SCOA 4GRLA 5FDWA 1ZS8B 2FX8H 2EE6A 3O2VL 5CKGA 5F7EH 3RVWD 1JZ8A 3MRKA 5LAXA 3GH7A 3T3MF 4KK9C 1LWHA 3FQUA 2ZE0A 4GO6B 3RM9A 1MW1A 2V17H 1DFBH 3IFOB 2GFBA 1W91A 2Q3AA 1NBYA 5HGHB 3KR3L 4JFDB 1O7AA 1YEGL 1DCLA 3ARFC 2R1XA 3VWJA 1K6QL 3SGJC 1PX8A 1NGPL 2QADC 3ARGA 5CD3B 4A3HA 1QPXA 2F54B 3D50A 1ZLVH 5GJTL 4Y5XA 3VFGH 1V6WA 3GSWA 4XP9H 3SO5A 1FC2D 1T80A 3LQZB 2FX9H 1B2WH 4KTEL 3VFPB 4ZAKD 2XWEA 5IESL 2OLHA 2NW3A 2I9LB 1CPUA 1CXIA 3ARFB 4PREA 1E1EA 2EKSB 2J5LC 4D3CL 2XN2A 2PYEA 2YWYA 3RWDA 2DDXA 2QADB 5CEYB 1NDMA 3K74B 4NKDB 1BP3B 2G9HA 2CKNA 4LFHD 1BVLB 2VYRE 4EI5C 4AD2A 3WXWH 4R8WL 5FAAA 1UWGL 5GGRA 5FO9B 3TPUA 3C2AH 1BFOA 1QG3A 2AJZB 2ATPB 1W1TA 3BUQA 2XQBH 3QDGD 1U8IB 3SCTA 2YUZA 2GUOA 3AS1A 4J1UB 3KPRD 2CHOA 1WFTA 1ND0B 1ZANL 2HKFH 2UUDH 1AO7A 4GRWF 4X6CE 1MCCA 5J6GA 4OT1H 5EZLB 1Q1JH 5GRJL 4Q0XH 3VXSD 4Y8DC 3U82B 3ULVE 1I1WA 2DLFL 3VFUA 4EI5B 2WUBH 3KGRA 2YD6A 1TVHB 3L3DB 3IU4L 5CGMA 2NY5H 3CH1A 1KXTB 3K1KC 3O4OC 3X11B 5DC4B 2LAGB 4IJ3C 3I50H 1GUVA 4ACZB 4ZUWA 1RUMH 1RZGA 2AJSL 1TFVA 1FDLH 4KZEL 1BAGA 1HXYA 1MJ7H 2NX5A 3QCVH 5SWZA 3BAIA 4CADB 1NL0H 2HT4C 2CR6A 5HHXL 1HHJB 2UWEB 1P6WA 4P5MB 2NSXA 4M62L 3T09A 1NCTA 4KKNA 1B88A 1B0GA 1HI6B 3BKCH 1DVFA 3O4OB 4XRCA 5BO1H 5LG1A 1LG2A 2DLGA 1IAIM 4MCZA 4IJ3B 4NQXA 1E3ZA 1FE8H 1JYVA 4HIHB 2RQ8A 4P4KA 4G42A 3U46B 4PP2A 4JFPB 4FQ2H 1ETZB 4KKBC 4HIXH 1FRGH 3VA2C 1IBGH 3GMLA 5BOZG 3QULB 4OZGA 2XM2A 4AZCA 1U8OA 4OFYD 4JDVB 3TNMB 2BNRA 3POCA 1BVKB 5K59F 3SUUA 5IIEA 1IC5H 4N0RA 1J12A 1CXKA 4L8BB 1W72L 1A4JB 1GIGH 4C7FA 3DC0A 2EYSA 1JGDB 4O51A 4X80L 3NIDE 4H1LA 3D39B 4KKAC 3HNTH 1UG6A 2OSLB 1RJLA 4O9HL 5E5UB 4FLSA 5IFTA 2FSEB 4LRNH 1JGLL 1NSNL 3H9SE 4QRRD 3SPVB 3QG6A 1LWJA 1Y6NR 3P3YA 3S6CA 3VX1A 3PHOA 2P5WD 1EPFA 4DGYH 4Y19B 1JRHH 2VZSA 4P3CH 1BGXH 1WAAF 3ALPA 4JL2A 4QXUL 5C0RH 1U93A 3RWEA 4LOUD 2FBJL 1IQWH 3I6KB 1W0VB 3GSOB 3PWVB 2NXZC 3QISA 1CD0A 4HWBH 3CPUA 1CGWA 1R7AA 2BCKA 5DQDL 4D9QD 5HYJB 3AIRA 4LCWD 4ZFOB 3IDMB 3BIKB 3WQWA 3F58L 3MLWL 4JFDE 1JNJA 2CEQA 2IH3A 1WAWA 2PO6C 4JPWL 3H8NA 4MA7H 4JGUA 2GW5A 2GTWB 5KW9L 1GW1A 1N5AB 2AJXL 3HCVB 4WV1C 3EO1B 2DL2A 3CFKB 3VRJA 3OKEB 4JLRA 2E7LA 1U2HA 4FFVD 4U49A 5HSFA 3U0WH 1HNYA 3PZ9A 4S1QH 5B8CC 2F54E 3B8SA 2ZZUT 2HJKB 5CSYA 1DQLH 2ZWLT 4MXVE 3HZYB 1FG9C 1DWAM 3B9AA 1IGIL 4RMVA 1J5OL 2DWEB 3QJFA 4FQHA 2WLYA 5ALCH 3EYSH 3U36A 1KTLA 3JSSA 1UR8A 2PO6B 2XN9D 2APFA 4D0DB 1B6DA 4U6YB 3ECBA 1VFUA 2RCSH 4NHCH 4ODXB 3S35X 1FVEB 1N3NB 5IW6B 3EOAB 1O7SA 2WZPD 4S3JA 4BFIA 3NZHL 5B8CB 3W5NA 1CFVH 2Z4QA 3VXOB 3SKJL 4ONGL 1S46A 1TVPA 4MA3B 4U33A 3QBTB 4WW2A 5DUML 1AKJA 1G7MA 1ZLSH 5FL1A 4I0PC 4M9OA 3N18A 3KPQB 3UJTH 2R4RL 3CCHB 4BFGA 3O2WL 5C8BB 2ZX7A 3MJ9A 2VZ1A 1P84K 4LQ1A 2BSSA 1G6RH 3PP4L 2NZIA 5DJYA 1QNOA 3MYZA 3W6MA 3WH9A 2NZ9D 3TO4D 3L3HB 4ZPVB 2FECI 5FECB 2GY5A 3UBXG 4KHXL 3J7HA 2C3VA 2A6JB 4D2NA 3QUXA 2UWEE 3U0PB 3TA3B 5FYLH 2GDVA 3T04D 1K4DB 4JDTL 4ZUTA 3CU7A 4IRSC 4V1DB 4KKLD 1A1OB 3AIWA 2LU3A 2XHYA 1EAPA 1F8TH 1B9ZA 3D25A 5K9JL 3DXAB 4P4RA 5JBDA 3W26A 5E5RB 4UFMA 2R8SL 5JMRA 1YEIL 1FVDB 1JD9A 3ZJ7A 3RNKB 5T3XL 4JAMA 5DS8B 1OLZA 3V6OA 3TT1H 1A4KB 5IJVB 1V0NA 4IRJB 4IRSB 3FJTA 1AVAA 5C0FA 3BH4A 4EN3A 5L2KB 1ONQA 5KN5B 3FXYA 3GJFK 1GH7A 2X2HA 1IC4L 3AU1B 3RX5A 5ETUB 4YBLC 1KSRA 5CSZB 4P2QD 3ZQ9A 1CENA 3IGAA 3DX6B 2ZOXA 2QSQA 3HNSH 3CFDB 4NYLB 3T0ED 2DI9A 1W1PA 1MWAA 3D39E 1FOBA 3L5JA 3S37X 4OM0L 5E2VL 2HISA 3BP4A 3QWQB 4UAOC 2O5YL 4JN2B 1LO4H 1GVIA 4P2OD 3VKKA 4JKKA 5D1ZD 5CIPA 4Y4KD 5TE6H 2IWGA 1I9EA 3C5ZD 4Y19E 3AY4C 2OJZL 1UZ6E 1R5VA 3MREA 5DRNB 4OGYL 4I4WA 1RHHA 1WV7T 2CBVA 1EUUA 5HD8D 3TYFA 4PSPA 5J9PA 4CVXA 3EZJB 3GNRA 4GUPB 1TXKA 5C2UB 1KLGA 2CLRB 3ARSA 4LSUL 5I1GH 1IC7L 3V7MA 5HYJE 4OD3L 3L6FB 5A8PA 5FK9A 2QKIB 1MHPL 1BZ9A 4MDIA 2IPUG 4JFOA 1AY1L 2P8LA 1BOGB 4KAQH 2X4NA 3MRMB 3QEHA 1RJZB 1A9EB 3ZJ8A 2H2PD 5AAMA 4HX1B 2D4FA 4PRPB 5TPWL 5I17B 3CUFA 3MRGB 2VC2H 4U6HB 2V6HA 4GRLD 4O4YH 4TOYH 3LRSB 1TQSA 4RIRB 3X13A 3AGVA 4Z5RB 1YQVL 3QUMH 4X0KA 3VJ6A 3FQNB 1KENH 1KCSL 4YXHL 4B5EA 4X7TA 3RQ3A 1CR9L 4M7JL 4CD8A 3VFRB 2AABL 4S1RH 1S78D 5DZLA 1QW9A 2YL9A 2E8YA 3VXUB 2JJTA 1AXTH 1HSAB 3V5KB 2YIHA 1JNNH 1YNLH 3WIFB 4YHZH 2YRLA 1SJHB 3S8WA 3VWJD 2ZXAA 5A1AA 4TVPD 3M6DA 2FX7H 4NQUA 3G6JA 3UJJL 5KVDH 5J3HC 2YLAA 5CJOH 4NP4H 5GGSY 5AEAA 5EB9A 2DN7A 1C12B 3IDUA 3RGVC 5BZDA 3FFCB 2WBGA 4HJGA 5TE7L 1CDCA 2ZSWB 5ABFA 4KJWD 1L0QA 3AZTA 4LDEB 3OKLA 4NO5B 3ESVF 1KBKA 2J1KA 3QOKA 1RVFL 5ICXB 2X1IA 1FC1A 5I1LA 4WW1A 2A3CA 4W89A 2PYED 5JIKA 1YEFH 3L3JA 4L1DA 25C8H 5JZ7C 1AI1H 3VRIB 2OMBA 2G2RB 3KYOA 4KROD 3U4BH 1KYOJ 1P6AB 1WP6A 5F1SA 4NKMB 1IAIL 3FZUD 1Y7VA 4WHTB 2PW2A 1FZKB 1QFPA 3WE6B 5HHMB 4R7DA 1AO7D 3GXMA 3E8UH 1JN6B 2QEJA 4QLRA 4XNXH 2BVOA 7FABL 4WI2A 2O9RA 1X5HA 1FL6A 2F5AH 3AI0A 3WLBB 4XV0A 4HKJB 1FZJA 2X4SB 4V1DE 1U3ZA 2VISB 3B9KB 1PSKL 2WKGA 1RZJH 1TETL 3QUKB 4BSJA 2WK2A 1OBAA 4L4VA 1KCVL 3DXAE 5DVMA 3QIBA 1S5IL 3MSGA 3V79C 4M03A 4RRPA 3PJSB 3SCMB 4F7PB 2WIIA 4WI4A 4Z2GA 1GOMA 4X5LA 1H2JA 1Q6DA 5F7DA 2ED9A 1JZ5A 2NX5D 1RIUH 4GAGH 1M1SA 5L2KE 2XTLA 3UBXA 1I85C 3VMNA 5EOQH 4PUBH 1ISWA 3TBSA 2CESA 2PI6A 1DVFD 5GS2D 5K33A 3V6FB 2NY5C 3WHXA 2NTSP 4P4KD 1UZ8A 4FTVA 4PGEA 3UPRA 4OOZA 1MCLA 2QHRH 4KRTA 4F7MA 1S9YB 1BD2A 3NTCH 5C0JA 5I66B 3H0TB 4Z76A 3WIIL 4JZOB 1BYAA 3TVMC 1CZ8H 3RDKA 4NRXA 4RFNC 2BNRD 3CHEA 4DKFH 3LXBA 3HMWL 3W81A 5HPMA 2H6PB 5DJDB 2JB5H 4LVOC 5D71H 4G80B 3VPLA 2HWZH 1HHGB 4K71C 4LEXH 1T22B 1BVNP 5DJ8A 1CL7H 3BZ4A 2CKSA 3GYCA 5EBLB 5F1NA 3I84A 5IW1A 4LLUA 3MBEC 5EDXA 4F3FA 2WM0A 3TVMB 1EOKA 1IZJA