1PEZA

Bacillus circulans strain 251 mutant a230v
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
686
structure length
686
Chain Sequence
APDTSSSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDVVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTATWEGGSNHTFTAPSSGTGTINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conversion of Cyclodextrin Glycosyltransferase into a Starch Hydrolase by Directed Evolution: The Role of Alanine 230 in Acceptor Subsite +1
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords Cyclomaltodextrin glucanotransferase
total genus 241
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pezA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pezA01
1PKQE 2D73A 4H1LH 3BP4B 3L5HA 2O9PA 4NX0A 2NY6C 2VAAA 3IXAA 3DIFA 3MCLH 4UINH 1VCAA 2W5FA 5DEGB 4NO5A 3T0XA 1PZ5B 1IJ9A 1KELH 4LLUB 1T83A 4HGKC 4JQXC 1QRNE 2BMKB 4HIIA 3WH9A 3NFPB 2VE6B 3RI5K 3WUFA 3G08A 1U3HD 1I9IH 3MV8B 2AJXL 3ZKXC 3DO7A 1OLZA 5KVGL 3N1MC 2ZCKH 4JG0L 4LRNH 4R27A 1HJQA 1HNGA 4JHWH 1UWGH 1KJ2A 1GCYA 2XYCA 1IM3B 2FYVA 2CKBL 3RZCA 1MQKL 1X5FA 2JK5B 4NKOB 1CR9L 3W29A 4P23C 2XA8L 4I9WD 3CK0L 1QI0A 3VXSA 1OW0A 4PSPA 1A9BB 1JHLH 4JN2A 4MJIA 2NY4D 3LPWA 1MFCL 3LQAH 4N9GA 5KBNC 1XSJA 3BUPA 1YY9C 4UT9H 2WBGA 4MNHB 3QWOA 1K6QL 4N0RA 1M7IA 5GS1B 4JHZA 1UUQA 3QUMA 5E2UH 1YMMA 4NN6B 2ARJB 3ZKND 2UV3A 1L9NA 3PP3K 1IGML 4YC2B 1AQ0A 4XT1C 2GAZA 3L4ZA 5JHDD 3REVB 2ZKHH 3HRZB 4PTUB 2VLMD 3DECA 4LL9A 4MZ2A 1LJYA 2BVQB 4LPUA 3OV6A 4WUUE 1S7RA 1E55A 3P30L 4ZOCA 3VMPA 2Y06L 1U93B 2IFGA 4ELKA 2H9GA 2HLAA 1PIGA 3AOFA 1RIHH 4NUGH 3OAZK 1S7VB 4R2GB 3SDAB 1FZOB 3DRQA 1GGTA 3AU1A 3WBDA 4X4ME 3D25A 5E5UB 2XQYK 4NKIH 3NIGE 4PGCB 1BG9A 4G6ML 3D2UA 3VXSD 3PWPE 4R3SA 3X14B 1M7DA 4FQHA 2DIBA 2EPNA 1RK0A 1HCFX 2IMMA 3KLSA 3LD8B 3QJFB 3RWJA 2IBZY 5IB5B 3SIMA 5D1QA 5A8OA 5IESH 4Y4KC 2C1OA 1KPUB 3IDYC 2A2QT 1PY4A 2VLJD 1GAFL 4TTDC 1P9MA 2XN2A 1L9MA 4GMSH 4X6CA 4FQ2H 5LYRA 3CFBB 4NKQB 4UIKH 4HJJH 2VZUA 3C8HA 4JFED 2HFEA 2YD7A 3FHQA 5DRXA 1O6IA 1T04B 3D85D 4Y1AB 1X7QA 4OIAA 5I75B 3KPPA 4FTVD 5DJCB 4PYHA 4R97B 4XMKH 1DFBL 4CVZB 1WAAE 4F7TB 3JV5A 4S1DC 2NR6D 4ODSL 3KYNB 4BSWB 1F3DJ 1V3MA 1TIUA 5HJ3B 2EPOA 3TN0A 2C4FU 3I3DA 3LS4L 1S7VA 5CJBA 5DMIH 4N8VB 5FKPA 3SDAA 5KVDH 2CUHA 4H25B 1C8PA 3Q6FA 2ZX7A 4MCYB 1TZGL 4R4FH 4GKSB 4PJHB 4U49A 4GLRI 1F4YL 2R0WH 3GSVA 1Q1JH 3GIZL 1NJ9A 5F7DA 1D9KB 4K55A 3C09C 4JANA 2V2TB 4PTVA 3U0TB 2YDQA 4QHUB 2V3EA 3DROA 3BGMA 3S98A 2TAAA 4U1KB 1Q0YH 1QLEL 1NP0A 3VUPA 1TENA 4OGXH 5HYJA 4A6YH 3WY2A 4M5ZL 3FONA 5D2LA 5TDNA 2J8FA 2XN9D 5FHBL 3WFZA 3MODH 5AG8A 1EJ6A 1SYTA 3OQ3B 2J7CA 4IPLA 4GW1A 4P3WA 4U05A 1RUAL 3LKQA 5GISL 1IAII 3BD5A 2FWOA 8CGTA 1QFHA 2F58L 3HAEB 1EO8L 1UM4L 3HG1A 3RJQB 3D9AL 4OV5A 2EDWA 3RTQC 4XC3L 3RZCB 4HXAL 1V6YA 4AL8H 3BVTA 2OYPA 4LDOB 3BGFB 2Z35A 5A2LH 3CLEL 4F9DA 3P0VH 2FZ3B 4OJFH 4H5SA 4N8VA 4NFBA 5C6WH 3S8WA 1WB0A 1DBJL 3WNLA 4AQ1B 2J4GA 2DH3A 1JPFA 1KCVH 4TTDD 3LEYL 4XBEH 4BZ1H 2P8PA 3X13A 4AIEA 1CZ1A 3WO4C 2ZX5A 5EUKA 2I07A 3FQNA 1H1NA 3OF6A 4AZBA 5CKAA 1FGNL 1TCMA 1N7MH 4OZGA 3NSMA 2F74A 1MWAH 4GBXC 1DVFC 4HULB 3I2CL 1RSFA 4IOIA 2C7FA 3W5MA 1WLHA 2GTWB 3WNNA 4GG6A 5KZ6A 1AGCB 5T5FH 4JZJA 4RFNB 5CLWA 5EOCL 5SWZA 1DBML 1X3DA 2HT3D 4YHYB 3RVTC 5F7WC 2Y24A 1Y0LB 1V0KA 2AEPH 3VFMA 3AIWA 2DD8H 4PJ7A 5IW6A 4NQTA 4PJGA 2OW7A 2QHRL 3GI8H 1YYML 2CBUA 3KZSA 1IGMH 5JMRA 1QA9B 1JV5B 5I66A 4C4KT 4L4TA 1YMHB 3RHWF 1XGPB 4X9YA 5JW3L 2VLRA 1KXTB 4OJFL 4ZFGL 4K3EH 1JL8A 3PZUA 2DQGL 5D93C 3U30C 4R7NB 3GI9L 1OAXH 2Z35B 4PJ5B 3GSRA 3ZE2F 4PGDB 4J2XA 3HCVB 4L8SA 3I85A 1H11A 4P9ML 2VRJA 4Y4FD 2CO6B 5GGSB 1NDMB 2RFXB 4X6EA 1XGRB 1HSBA 2ADJB 2J7EA 3AZTA 2MMXA 4JM2F 3EYOB 3QQ9D 1GGIL 3I6LD 1A7PL 5EU4A 4K71C 3RPMA 4PUBH 3U7YH 5E08H 5HI5D 1PBYA 3UERA 1ZT7A 1JXKA 2P7TA 2WINA 1A6PA 4Z95L 2E7LA 3MOAH 1CE1L 4OV6F 2VDOH 5BS0E 2DQEL 2MQ3A 1MLCA 5E9DA 3TN0B 1P1ZB 3S88H 3WS6C 4JM2B 4F58H 5J89A 5E7BA 3NH7L 2AI0H 3LKOA 3BH9B 2EICA 4EJ1C 3G08B 2FGLA 5GPRA 1J0YA 4K3JL 3RMEA 4KK8C 2ZX6A 1GZQA 4TULL 5HYFA 5EU6D 4ZS7L 4MA8H 1CN4A 1MJ8H 5I15L 1UACH 3AMLA 3UR8A 3HNVL 1X1NA 2JF1A 1UD2A 4WUUA 4X4ZA 4NIKB 2XXMB 3NACH 2NX5A 2A1WH 3ZTJH 1JYNA 3CFEB 3TZVB 3OLDA 1PY9A 5EOCJ 3SDDD 2FBJL 5AC5A 4NM8L 4JN1L 4Z76B 1A0QH 4U6YA 1FL6B 4JQIL 4Z95H 5IK3A 4DOHB 2ILLA 5D2NE 4UQ9A 1T83C 4JQXA 2P5WA 2DQEH 1F45A 5EZLA 1U8KB 2KBGA 5T3ZL 1VAHA 3T3ME 3I6GA 5EC2A 4KHXL 5BV7C 4B50A 3F62A 2YKLH 4U3CA 4GBXB 4UUJB 1CD1A 1LP9F 4Z7VA 3WDRA 1OL0A 4BA0A 3BQUB 5TQ0L 1AQDB 3MRQA 3EOYG 5F6IC 4LLYB 3CSPA 4M80A 1JHKL 4HS3A 4HXAH 5ENWA 5HYSG 3SE8H 4HPHA 4CCCA 1LNUA 5E0QA 1SVCP 2EXWD 1FYTD 4JDVA 2CKBB 1MFEH 3QXTA 3OAYH 3OGCB 4JZOB 2QTEA 1JRHL 4QDMA 3TO2B 5DD6B 1UWSA 5DHVB 2H8PB 2OJZL 1IEAA 4EEEA 3C6LA 4HUKB 1BWMA 5INCA 3GXPA 2NY0D 3T0EE 2ZKHL 1GNXA 3MYJB 1DL7H 3VX1A 3VFOA 1F4HA 3GSUA 1PS3A 4L5FH 4YDVA 4FN0A 3MSGA 2BNJA 1NSNL 3WY3A 3QPQC 4R4FL 5D1XC 4LRIA 5JLZB 5TFSH 4Y5VA 1K3ZA 3GM8A 2YL5A 1GOIA 3GSOB 4HBCH 4LEXH 5B39B 3I2CH 3VGAB 3FO0H 4Q2ZB 1QKZH 3KS0J 4BUHA 3PP4L 2PXYD 3AM8C 4AZGA 4OLYL 3TEUA 1U8LA 2W9EL 3S5LG 1U92A 2OI9C 3WLWC 3VXNA 2W9LA 4UZUA 2I60H 1KOAA 4YC2C 4MS8C 3OZ9L 4EZMA 3V6BR 3FN3A 4Z2JA 1IL1A 1JGVH 2QJDA 3QRGL 1XCTB 2EDEA 2JB6A 5E8NA 4NN5C 5IR1A 4ZAKA 1CIDA 3ALPA 2VC9A 3KPRD 2CK0L 3OIHA 4MLIA 1LQ0A 1XIWC 3REWB 1JZ6A 2J78A 5T3XH 1CE6A 1T6WA 3DWTA 4LLWB 5DJXA 3ULVF 4H8UA 5D4QA 1FFRA 2PW2A 1ZGLP 1YEKH 2MHAA 4MNGB 5J11C 5E00A 2J4WL 3ARGC 3W0KA 1MCQA 2CLVA 4LEOB 4Z7WB 1ZE3C 2UY7A 5DD1H 4HIIB 3M6DA 4F80A 2FD6H 2WMJA 1FVCA 3BDBA 2AJUH 1W9VA 1IKNA 2R2CA 4UDTA 5KTEL 4RNRB 1EH9A 2DWEA 3C87A 1MCLA 1WEJL 3VDBA 5IHRA 4HSQA 3DI2B 4LHUG 4NGHL 2IH1A 2R0ZH 2XNAA 4PP1C 3EYSH 3OKLA 3NDZA 3KLHD 1EFXA 5FOBB 2GCYB 5BRZA 4Q97A 1F13A 2FIRT 4U1SB 4K94H 4JPIA 3LKOB 3OKDB 3CZ8A 3KWWB 4IIQC 4AYFA 4HKZA 1NCCL 4PJ7B 1FIGH 4CMMB 1FL5A 1Q1JL 1QTYT 1X5GA 1NLDL 4XWGL 1U9KA 2UY2A 4WGWB 4LVEA 2AS5M 1VFMA 3QEQD 1QYGL 4YDKH 3GSXB 3ISWA 5D72H 4DK3A 3BP5B 3HZKB 5J1SC 3TV8A 2DKUA 3MRKB 4WUKL 1V5JA 3TBTB 1NGXA 4LLYA 4LSTH 1U8QB 3V5KA 3LEVL 4WW1B 2UUDK 4JY5H 6CGTA 4KRMB 4NZUH 4JB9H 4QCEA 4GIAA 2QADD 4YHNA 4UQCA 2D9CA 5AWNL 1EO8H 1HKLH 3KYKH 1OTUC 4NCC1 4NGHH 5CZVH 3TO2A 1KN2H 5GIRB 2V5TA 1OM0A 3P0GB 3PV6A 4H8HA 3MR9B 5I19L 3GJFK 1U95B 3NN8B 4NRZA 3S5ZA 4XNYH 4JO3H 3D3VE 4OLUL 5E1AA 2GDVA 2GK0B 3I3EA 2D4DA 1IARB 1CLVA 3CHCA 2DSUA 5M7QA 2JJSA 1YC8A 2DTML 2P45B 4F7PA 1LILA 5TJWK 1OGTB 5DD5H 9CGTA 1W3JA 4P7QA 2OLDA 3BPNB 4EBQL 1Q9WB 3VXME 2QV2A 4NKIL 2HJFA 4PJBE 4NXSA 5A8PA 4XVTH 2E9WA 1DLFH 2ZG1A 2YSSB 1NOWA 1CK0L 2FHCA 2VQTA 4BH8A 1HINH 3HAEH 4NNXA 2R1YB 3BSZL 3VXTB 3WXVH 1J9YA 1VPOL 1EOMA 5BW7A 4WW2B 3IS1X 4DW2L 5T5FL 1ED3B 3ESUF 2EXOA 4P23A 5FO9A 3TA3A 2OXGA 1N0XL 5DQ9A 5EUOF 1A9EB 5IHSA 1CLOL 4GXUM 4UNVA 1UXSA 4XP1L 4BQ9A 4FLQA 5DO2D 3N85L 3N9GL 5IMLA 4HQQH 2VUOA 5LBSH 1JPSH 1T2QL 1CICD 3P40A 1HXJA 3QR3A 5CJOH 3GNMH 4M82A 5JNYB 4ONGL 3N06B 4OJYA 1WCGA 4RGNE 1KB5H 4MNQD 4HKJB 4JJ5B 3C8KB 1IM9D 4RGMC 4S1RL 2VR4A 1XCQA 4JDZA 1NFDF 1O7DC 5FYKU 5EZIH 1EBPA 3SCVA 5F1NA 3OJMB 4K7FA 1B1YA 3MXWL 1NUFA 4ZUWA 2XM2A 3QHFL 5AZEH 4BZYA 5IP4A 2G3JA 4YWGL 3BKCH 1RMFH 4LSQH 2P5EB 1I1RA 2D03L 4JPWH 1N8ZB 5ID0B 4OI7A 1BM3H 3CMOL 3THCA 5LGJB 2VERN 2J88L 4LSSL 2CBJA 1FNSL 1HKMA 3L3GA 3AUVA 3WFCH 2N7BA 5TF1L 2UZIH 4NSKA 1UADC 4YX2L 2E4TA 4AYGA 5DSCB 2XQBH 1WT5C 4G8GA 2FE0A 1OM3L 3S96A 5DD6A 1YECH 2IF7A 1Q0YL 2VLKD 2FYYA 3B9VA 5FV1L 1E5JA 1GOOA 2HRPL 3SCNA 4Y4KB 1I85A 4S1QL 1KTRL 5FGRA 1KB5L 5MP6L 3GSXA 3CVHL 1P6WA 2HT2C 3OG4B 4QOKD 1KJVB 3HMXH 5E0CA 1IM9A 1OSZB 1YZZA 4PGDA 2Z92A 1JMXA 5F1SA 1WEJH 4HG4J 1NEUA 3MBED 1HP4A 2JB5H 4KTDL 4NZJA 2XN9B 2DIAA 4Z6AT 4NUJB 3T0EB 2YL9A 4C56A 3L7FB 5TDOA 5EU6A 4XP6H 5DQDH 1C8XA 4UDUA 4LHQB 4U1MB 1E3ZA 1CPUA 1NC4B 5CJXA 3GMPB 4U2ZA 4S3JA 3QCVH 1HXMA 4GZIA 5BO1H 1Z9LA 4LIQE 2BSSA 1S7UA 3U9UA 1VFAA 3DGGB 4L3EA 3ULVH 4J3VA 4NQEB 4RMRA 5D8JH 4QF1A 5F71A 4WJ5B 5EO0B 4LLWA 3F65A 5J1AB 3U30B 5AG9A 5EIQA 4OUUB 4OFVA 2WHJA 2X44D 5IT2L 5DS8B 1NBVL 1TNNA 3TESA 4OLXH 3P4NB 1F90H 4HU0A 4TUKH 5D6CB 5A8NA 3ARDD 2D7QA 4OIFA 4EDWH 5ADOL 4LPVA 3IKKA 4PY7A 3E6HB 1Q9OB 1WV7T 1KGCE 4FLOA 3G6JE 5A6SA 1CCZA 4NZFA 2DKMA 3TZVC 1YEHH 1OAZL 4AEIL 4OZFA 2XFXB 3SGJA 1C92A 3G5ZB 1WC7A 1WF5A 3AIUA 4LCYB 1HNFA 3UCRA 2YA2A 2F8OA 4AENA 1XGYL 1FYTA 3DBXB 4AIZB 5I79A 1ZEAH 1I8IA 4X6DA 2NY0C 3QR2A 4J1UB 4RBPH 2V7NA 4BK4A 2E9LA 1QVOB 3GRWH 1IAKA 4MAYD 2YLLA 4I0PB 4Y4FB 1QI4A 1MLBB 3VNZA 2A6IB 1D9KA 4L9DA 2X41A 1SZNA 5T1DH 1BLNB 3NZ8B 3CZGA 3MV8A 4HEPG 2WBKA 1GQJA 3C2SA 5I8CA 6TAAA 3U9UB 4X6CF 32C2A 2Z91B 2WNWA 1N3NB 3JBG7 1U3ZA 1KJ2B 1YMMD 1UXWB 3S35H 3U0PB 3LQAL 3TVMB 4BH7B 4E41D 5EB9A 1IT9H 5E08L 5JXAH 4PMXA 3PZNA 4YXLH 1JF1B 3PDDA 1XF3A 1JHTB 5JUEL 4KAQH 3BJ91 4XNQB 5IM7A 4S1RH 2IMNA 4DUXA 2ERJB 2J8UF 3O0RL 2WVVA 4RE3A 4PRIA 4HWBA 4GO8A 2H32H 3TC9A 4E41A 4UT6L 1B90A 4AEHL 5D96C 3FT2A 5I8OH 2YD9A 1IGTA 2O9RA 3IXTB 3Q5YA 4GUPB 4BSJA 5IEKB 1I9IL 2C1OB 2GUYA 1GJWA 3HUJE 3DI3B 4MA3A 1X4YA 1HIMH 3V7MA 3DIFB 3CFBA 2ARWA 4LQ1A 3FO9B 5D9SB 1CGUA 1P69B 2EC8A 3S35L 3S2CA 3MJ8A 4UTAH 1BVLB 4U7MA 4ZNEA 4RDQF 1DQMH 1DSFL 3GJFH 2VDKL 2EEBA 3IK2A 2LE9A 3KPQA 4BCEA 4X9BA 2CBIA 3I6GB 3KEHA 1FH9A 3C5ZC 1FLRL 5CINL 1VGEL 1WPCA 3KPNB 4JO2H 1CXFA 1PLGL 3BAKA 1AO7D 1BG4A 5A2KH 2D9QB 3MO4A 1IILE 5CEZD 5EU3B 3HN3A 5I16B 3BDYL 4RX4A 3VRIA 2GJ6E 1E9LA 3B9KC 1WBZB 5JA9A 5IV2A 5M3WA 1YPZA 1I9JH 1UJ3A 5D1ZB 4XV0A 2Q1EA 3SDCB 4MNQB 2AABH 3MRPB 4Q6IC 3VWJD 4YFLI 2ICEA 3ZDYE 2XACC 4QRPA 1BYDA 1VKXB 4MNMA 2R0LH 3BSGA 4O02H 3G6JB 4DWSB 2ZUQC 4R2GD 5IFJB 1D5ZA 3D0LB 3L1OL 1MH5B 1QPXA 1UB6B 5T33L 3E2HB 1G7PB 5BO1L 4BQCA 1KIRA 4EI6B 4W8LA 3BP6A 1Z3GL 4GQPH 4TVPL 4FTVE 1FVDB 2FIKB 4W86A 1BX2B 1Q9LA 2HMIC 2DSWA 1F97A 5DQ9B 4P5TA 5I1JH 5IESL 1KCUH 3ARZA 2GSGA 5E8OB 4LCWB 3IRZA 2IQAA 3NFNB 1YYMH 1CT8B 1FNHA 3GXNA 5FCZA 1VIWA 4NQCE 3LH2L 3MODL 5E1AB 1R3IH 3FFCB 1LWJA 1X5AA 3GGWB 4UQ2B 2AJZA 3IS0X 5FYLE 4IRSA 3BQUD 1IC4L 4XP4H 4YLQT 1ORQA 3WFEL 1LDPH 4UFJA 3G04B 3IFOB 5J12B 4ELMF 3FL7A 5DYOA 2R8SH 1N0XH 2MKWA 2XKNA 3CJJA 4QHMB 4XCFH 1DQQB 3MLZL 4M48H 3GK8H 5GZNC 4IOIB 4C58B 4PTXA 1NFIA 4DWHA 5IIEB 3C5ZD 4J4PC 1OARL 4XHJC 4D1JA 3TV3H 5EB8A 3NGBB 3QUYA 1M7DB 4FQHB 1HQRA 4QTHB 4CN6A 3DGGA 2YZ8A 4J3WA 1GOHA 4WIQA 4UFKA 2YRPA 3PXJA 5BV7L 1VFBB 3NA9L 3BO8B 5JOPD 1S7TA 3QP3A 1RPQA 2VKWA 4R0LC 3QEUB 1KCKA 1SEBA 3OGRA 4ZE4A 4I5BA 3VCLB 2X4TB 3MRFB 4H88H 2E3ZA 4CVXA 1IT9L 8FABB 2YFNA 1H3PH 3ULVL 4AZ6A 4TYUA 5E8DL 3O3AA 3SCQA 1J9CT 1Q94B 1MWAA 4R7DA 2DB8A 2XWTB 4UUJA 4OQTL 3PL6C 1XAUA 5E09A 3ARDA 3MUY1 5B4MD 1KGUA 3EHBD 4OCRL 4TVPD 1TTUA 2P5EA 1Q9KB 1P7QA 3HZKA 5L7XH 4NHUB 5D5ME 1ZS8B 3TPUB 4GKLA 3HNVH 4P4RA 4PG2A 4KWUA 1UA6L 5HHMD 3QSKB 3VH8B 5K59E 2XKNB 5B21A 1R24A 4AWEA 3ZR5A 5ACZA 3CPUA 1INDH 2XIDA 1QFWL 1YEJL 3IJHA 3S96B 4U7KA 3GNOA 3ZO0A 1TCRA 1T7XA 5J1TC 4F7EA 2ED9A 1L8NA 3OXSB 4G9FD 4OAWA 4P4KC 5FIPA 1F6LL 5E2WL 1QR4A 4O2EB 1H0DA 4GRWF 5D1ZC 3HAEA 3WUWA 4XVSL 3VRJB 3HS0B 5J4MA 3IAPA 5FL1A 3BZEA 3TBWB 1GIGL 1DQML 3TTQA 3QDJA 1SYVA 4HF5L 1DWIM 3PQYB 1RUPH 4P2RD 2ADFH 4D9QE 3B2UD 1LL6A 4BSWA 1UWIA 2BSTB 2X9YA 3U46A 5K9JL 4HZ6A 3W9DB 4MPKA 3V0WL 2Y7QA 2F5BL 1GC1L 3BH4A 1CFVL 2GTZB 1BFVL 5EOQH 4DKAA 4AIOA 3MLVH 3QDMB 3LS5H 4Z0XB 3SY0A 5CEYA 2QSVA 4U1LA 5DEFA 2V17L 3DYOA 1URLA 3QOMA 4P2OD 4GLRH 5MEQB 2P7TB 3ARRA 5BV7B 4OZHB 4UMGA 3JTTB 2Z31A 3LXBA 1NGPH 1UQSA 3KPNA 4GI8A 3V4PH 4AZ5A 3M17B 1CFQA 2YBRB 4G3YH 1GOQA 2WMIA 3D3VB 1RZJL 1D5IH 5CMAB 1H0GA 3K2MC 4DUVA 3WIFA 3GNML 1JDCA 4P9MH 3SKMB 1NMBH 3TYFA 3WDPP 1TZIA 1QRNB 4PY8I 5DQJB 1S7QA 4AD1A 4LEXL 3R1GL 1CBGA 4PUEA 3MMUA 4Z2IA 1ES0A 1M4KA 1KTLA 4M8UA 2ICCA 1CQKA 2YPKA 1PG7L 1NAMA 1PKQB 5IEHB 3ZHKA 1WCBB 1T1ZB 5HGDA 4F9JA 3ABZA 1J0ZA 3PL6D 5DK3A 4QT5A 2D2OA 2APBA 1OAKH 1PQZB 3MOQA 5E1QA 3MUJA 5ITFA 4O5LH 1XSIA 5IB4B 4JFEE 4U1JA 3KPLA 35C8L 1R87A 1K9DA 3PZ9A 3QWRA 4EUPG 1E6OL 4M93C 4FNQA 1KWGA 4CD5A 2J8HA 4NHCL 4KXZH 3NH7H 3WKMH 1DBAL 3EYQC 4MXWL 5IFAL 2XFFA 1Y6MR 2BNRE 1RURH 2Z1SA 2W0FB 4B9YA 1T1XA 2CDFA 5ABGA 1QD0A 4OCSL 5GGRY 4N5UA 4OGAD 3CLFH 4HK0A 4X4MA 4ODBD 4I0KA 2IPKA 5D7JD 1V05A 4OFYD 2VL5B 4JE4B 4L4VB 2A73B 3MRIB 3QQ3A 1A7OL 1E4XL 5SWSD 5CD5C 3JSSA 3O45B 1XF3B 4CKVX 1GQKA 3FRUA 4YIQA 3VFUB 1KEML 2Y72A 3VG9C 2DWEB 4MNGE 4P3DB 1LQSR 1A1OB 1FIGL 4EUPH 3KHOA 1QPPA 3B3IA 2DSKA 5IB1A 5L9DL 1KNOB 2EH8H 2NY6D 3L7EB 3HZVA 5HVGB 5C6PB 4W5UA 4NN6C 3CSBA 2X9XA 4G7VH 4U0RB 4C55A 1OB0A 1ZBWA 4X5LA 4MJIB 3BAXA 1YC7A 5FF6B 3VIPA 2IQ9H 3BZFA 4PV9B 2V3GA 5FGCE 3LH2H 2X40A 1U58B 3EJJX 1WBZA 1L7IL 1V0MA 3ZKMD 3RWEB 4WSKA 1G84A 3WSQL 1UR0A 1D6VH 3MGAA 1NGWB 3K4DA 3ZE1E 2ICEB 1I1FB 2IBGA 3E6HA 4Z2GA 3ARDB 2NW3B 3ZZ1A 4HPYH 4OSUH 5IR1B 5DD1L 2EBNA 4F33A 3TO4D 3Q6GH 5IF0A 5ADOH 5JW3H 3MACH 1XGRA 4NZTH 1LG1A 5HI3D 4LVHB 4X7SH 1A3LH 3OHXA 4M8QA 3HAEG 3PWUA 1HJWA 2VXTL 1G0DA 4ZUUA 4WWKD 3QZWB 2AABL 4IUGA 3TVMC 5C0IB 2NTFA 3AROA 2OWXA 1XC6A 3MJ8B 4GS7C 2YC1A 2H1PH 3NUKA 1LO3H 1OLLA 1RUML 1B3JA 43CAB 4QRUB 3C60D 1CD1B 4X99B 3CFJA 2MANA 5DRZA 1U8MB 5DMYA 5DJDB 5FGBC 3MLVL 3N04A 5B38A 5DEGA 3ALGA 4PJFA 5FOJA 1LNUB 3B9AA 1T7YA 4X6CB 1MHHA 3BWUC 3UTSB 2QADC 3S34L 1ROWA 2A0LC 1K4DA 5GRWA 4LIQL 4JFQA 5I73C 4OCWH 4DJMA 4OZIF 3VE0A 3W9EB 3F5LA 4I77H 3HE7C 3GMQB 3IDJA 4MD0B 3MCG1 4G9DA 2WUCL 2P8LB 3UJIL 5IOPB 3TZVD 1QPKA 4XH2A 1B4JL 5I8KH 4DGIL 4UQDA 1BREA 1BAFH 5GJSH 3WD2A 5HGDB 4E41B 3SOBH 3M8OL 3PWLB 1R33A 3V0VB 2DJUA 4OKVA 5E03A 1A3RL 1OWWA 3IDMA 1F3JA 3C09B 1UD5A 3O0RH 4QGYA 2F53D 3V7AG 5FB8A 4PYSA 1RUMH 1X5KA 2FGWL 1BJ1J 3N18A 2J7LA 3FXYA 3VWKB 3WD3A 1INQA 3MFFB 1CDJA 4W87A 3BP6B 1QNSA 4V1DB 2OQJA 4YUEH 1G1CA 2OTWB 1P7KB 3GJFA 3UTOA 4IRZL 1F3RB 5LAXA 3G9AB 4XX1G 3LAFA 4YX2H 5C0EA 3CVIL 3EKCA 2DDQH 2DQXA 4PRNB 2BC4B 5EZOL 2I27N 1OF2B 5A95A 2IPUG 1UWUA 2HWZH 2VH5L 4ONFL 4P3CH 1ZLSL 2DQIL 4WNQA 5I1AB 1LE9B 1E4XI 3PN8A 1IAOA 4TQEH 1X5YA 2X0YA 2Q20A 1HQ4A 4Z8FL 2MJWA 2PR4L 4CD8A 5C0GB 5D9PA 3EDKA 3HLAA 1FLRH 1RJCA 5CINH 3EMZA 2VURA 2NR6C 3G6DL 5JPNA 4H8WC 2YIHA 3BCDA 3M8OH 3TONA 5A8MA 5CSUA 2EIZA 3VXRB 4OAWB 1AQKH 2CPCA 2WBJA 1HL9A 1NUGA 2YR3A 3FJTA 3WXWL 5JQ6H 5I71B 5F9WC 3V4UH 5KZCB 1J8HB 3P4OA 2ZXQA 3QDJD 4L8CB 3VU2A 3QXAB 1J0KA 3QDJB 3BH8B 2AJXH 3AREC 4PJ5E 4QY8B 1NL0L 4QXTA 3KYMA 4CCDA 4IMLA 1MPAL 2FLBT 5HBFA 1YNLH 1WDSA 4IS6B 3B2VL 1OGAA 2OTWA 3FQUA 1IAIH 4W70A 1L0PA 5I6XB 4PRHE 1XH1A 2J8UB 2HWZL 3T4AB 1KJ3L 2G41A 4IOSD 1OW0C 5EO9B 5I1CL 2FCBA 1CLXA 2EZ0C 4PRNA 1HNYA 3X11B 2K7QA 3CFCH 4EBQH 3TN0C 1GIGH 4P4KD 1B6UA 4R7DB 1SJHB 4MADA 4OLXL 2BOBB 3UYPA 1YQ2A 3OAUL 2X4RA 1AD9A 1YQVL 3D39D 5BXFA 3MJ7B 4LU5L 1MQ8A 1NBQA 1NMAH 3OKDA 1D6VL 2EXWC 2F58H 5HHOD 4ELKB 4K7PH 5MEPB 5I30L 4ZODA 1QHPA 4Y16C 3WD5H 4OZHF 1IC4H 1AP2B 3UBXG 4WCYH 5BOZG 4XH2B 1BQCA 1VRXA 4MJ6B 3IDIB 4GKZA 4NOBA 4YHKL 5LGKA 3KS0H 3WF4A 1I7TA 4R3SB 3T2PA 4XGZA 4LDEB 3X14A 4G6JL 5ISZE 1GPOH 2FECL 2GCYA 5BRZB 1IKNC 1TJGH 3DETC 4WI5A 2R56H 3VXRE 3X12A 2VQ1A 3TT3L 2HG5B 2H26B 1U91A 3S36L 1FL5B 1AKJD 3U83A 4N9OB 4XPHL 5IWLC 2L0DA 4P99A 3O6FC 1U93A 2XA8H 1QW9A 2DSZA 2NT0A 3SCUA 2FJGB 2EC9U 4E8DA 1OF2A 4W4OA 5F21B 5TE7L 2VXQL 5ILTL 1OM3H 3W4RA 2YWYA 3MRCB 4OCXL 1NBVH 5E8EA 3V95A 4QHKI 1CXEA 4HKJA 2QQKH 3QJHA 3JV4B 4H26B 4M4PA 5F7FA 3ROLB 4LQFL 2DQCL 4HHAB 1LO2L 4ZAKB 3O2VL 1QEWB 5C0JB 4XAKD 5I73B 5LQBH 1S9VB 2ARJQ 2BMKA 3Q6FB 4V1DE 5E4EC 1MFVA 4X98A 4YHMH 1HVQA 2ZUQB 3PZMA 3SDAD 4M8VA 3E2HC 4QYOA 1NJ9B 5F7DB 3WJLC 4ZXOA 2M1KA 4MX7B 3VM7A 1BPLB 5GRYA 1H5BC 1FL3A 5F9DC 2YMXL 1VHPA 5DLML 4XP6L 5HGBB 2YS4A 1WFNA 2IXUA 2FO4A 5EBMA 2ZJSH 2DDQL 4L1HA 2DM4A 2VO5A 2I5YL 5HYIA 3IDMB 4LGPB 4IRZH 4DTGH 4ACZB 4APQA 4PJ8D 3TTOA 1DUYB 3SGDH 1KLUB 3LSOB 3PGFL 3BVNA 1BZ9A 2F61A 3S37X 5FA3B 2CRZA 4HWNA 2EDFA 1FVEA 3BXNA 1I8MA 5F9OH 3P73B 1DN0A 3VVGA 1DQDL 4XNXH 1FZOA 3LHPL 4PLJD 4NQEE 4OCYH 4D3CL 2WB5A 4TN9A 1X5XA 2Q3AA 4PD4J 2XTJC 5DHYB 1MFDH 2YL6A 3OGVA 1KB5B 1PJ9A 5ECUA 4Y16D 4Y2DA 3PWPB 3AJ7A 3A4WA 1XD1A 1F6AB 1CDUA 3BEVA 1B3ZA 1EK3A 4O2CB 2JF7A 3MV7E 4EDWL 5HNNA 3T0EA 2ZP0T 2E7BA 1C5DB 4BH7A 1ISYA 3AAZA 2UZYB 1OD8A 5IB5A 3ULSA 2E0PA 2A9NH 2GW5A 3HI6H 3EZ8A 2H9GB 4XNMB 4NOFA 2E9MA 3LXAA 2F54E 3Q5OA 5CHNA 5F3BB 4ZEPA 4LARH 4Y8AA 4S1SL 2XN9E 3WS6A 1XR9B 3TBYA 5MEOA 4WUUB 3MREB 4ML4A 5D7LA 4WEMB 2WVVB 2JEQA 4ERSL 4NZTL 3KPOA 2HYMA 1RZFH 3GRWL 4OD3H 4O58L 2NXZB 2WIMA 5JZ7C 4DN4H 3IRPX 2JCCA 4TVDA 1HN1A 1ACYH 1XF5A 2BSRA 2EDJA 4QXWA 2WZHA 4FNRA 1T1ZA 2NY5H 4PV9A 4EDXB 1R47A 1UYQA 2CNCA 1MFDL 1C16B 3KJ4C 4CW1A 5JPNB 4HS6A 5ACMA 5GGVY 1S5IH 3N12A 1QFWI 1QLFA 1C93A 2B0SH 3QUZC 1NBYB 3Q5TA 5GGTA 3MLTA 3TNNA 4JFFE 3MLSL 1JWMB 4OZFB 5F7LB 1OIMA 4HCRL 2Y5EA 1KB3A 3ZQ9A 3GK8L 3QJHB 1KTDA 4XMLL 3FCTB 2F53A 1U91B 1BOGA 4HBQA 4D0DB 4OZ4B 3WS3B 2ADJA 4TUJA 1CNVA 4D6DA 2F19H 3WQ8A 4G6JH 3VXRD 4DGYL 3EJPA 4PRPD 1P7KA 4DKDC 1B4JH 3BEWA 4OD2A 1BLNA 4LYPA 1S7XA 1T66D 3P4LA 2NW0A 2F8VA 4OFDA 2XVNA 1J05B 5JIIA 3QO1A 5E70A 4PJ9B 1LL7A 3FN9A 4N1CA 3MA9L 3MTRA 3A67L 4B7IA 1S7WA 3L1OH 1KXTA 1UKSA 4TNVF 4X7EC 1CDBA 1A6TB 4LNRB 3WDIA 3B3IB 1E4KA 4M9OA 5JO5B 3JWOC 3F7RA 1E0OB 1C5CL 2OW6A 3WJJA 5CAYB 3DXAD 4OB5H 1NFDB 5J06A 4GRMB 4JHAH 2DT1A 3FAXA 3RIKA 3WEOA 2AXFB 1XH3B 2VXQH 5ILTH 1NMCB 1DBMH 1E6NA 1XZ0B 3P9LA 3QIBC 3LN9A 1BQLL 3QA3A 5D9MA 4MA7L 4Y4KA 1B30A 1WUNT 5D7LE 4GKZB 5J13C 4U0RC 4HV8B 1SMOA 4RGMB 5IW1A 4D2NA 4YEEA 1UH4A 3DSFH 4NBYB 1V6XA 4JQVA 5JDSA 3S5LB 5EUOE 5C08A 1GRWA 4JM4L 4PJFE 3G6LA 4XCFL 3G9VA 4P2QB 1ODUA 2O5XL 3CFIC 1YEGL 3AS0A 4JZJB 4G8EA 2X05A 2ZOLB 3HI5H 2H6PA 4HWZA 1FE8H 4PJDA 4XHQA 1J10A 3RIAK 1A6VH 2CKBA 5JQ6L 3PHOB 2YL8A 3WFDL 2UWEB 3V4UL 5ACLA 2H41A 4R0LA 5IBTL 4MYWB 4NC0B 1QSEE 4W7VA 2HJKB 4FFVC 1EERB 1TJGL 3DDFA 2O92A 5FYLD 4X7SL 1NCBH 3GUTA 2IQAB 2CRIA 3NFNA 1S9YB 3HKFA 2WBJC 1MCPL 3SUSA 1DQDH 2PWFA 2J7GA 5AEAA 4TNWK 1ZLVK 5CCKL 5F1OB 1K9EA 4HKZB 2EEDA 1I85C 1AI1H 1P7QD 5HHNA 2Y7QB 3QFJE 3TFKD 1H2JA 5JXED 5EULV 2HFFA 3DXAE 4PN2A 2CSPA 1U8OA 1V7NL 3FN0H 4FABH 2O61B 4L8BA 3BRGC 2W0LA 1E70M 4Q9RL 1U30A 5F96L 4WLCA 1FL3B 1JWMA 4ZAKD 2RGLA 1D3CA 3H9HA 3I6KA 4F8QA 2A9MH 4NQED 1MYRA 2Z4QB 5D7IF 4LCWA 1CECA 1MW1A 2C9AA 1YY9D 4ISVA 3ZE2E 4HCRA 3F7VB 4KRLB 3AICA 4FQLH 4LSUL 1QQDB 3CDGA 5A6JA 1CE6B 2CHOA 1F3JB 4ZYKB 3OPZL 5EZJA 1E6JL 4OD2B 1MRCH 5D6DA 1FZJA 2ADIA 5JBEA 2Q7NA 2X4NA 5C0ND 4PJAA 2OL3H 1J7VR 3LXCA 1JGUL 1UZ4A 3HMXA 1QO3B 4PGEA 4Z77B 3FCTA 1X4ZA 5AYUL 1FHDA 1A7QH 1RY7B 3WUWB 1I3VA 3W0WA 2XZZA 1H3PL 3OJDA 1MRFL 4PJ8B 5IVXE 5I1LA 3WEXA 1S5IL 1ADQA 3VH8A 5L2KD 4PV8A 1K8IA 1KULA 1TDQA 1KQZA 1G7IB 4OQTH 4HZAA 3G6JA 1W2VA 1PG7X 3L9RB 1RP8A 3AB0C 3THML 3FB6A 1Q38A 4RISH 3FTGB 5C8BB 2Z8WC 4YO0A 1FNEB 3QEHA 1XZ0A 3LD8C 2Y07H 1IEBA 2V5MA 5DFAA 2XI9A 5T3XL 4WI8A 1QA9A 4WV1C 4AZCA 3IDYB 4M61A 1D5MB 1Y6KR 1YPZB 2MQCA 1EZVY 4MXVE 3UETA 1AGEB 1FFOB 5JDSB 4JPVH 4PRIB 4JQVC 3PZIA 1V8HA 4M6ML 1KTBA 3LPGA 2HTKC 2APTA 3L3JA 1LO0L 1F4AA 4YAQA 4ZO8A 3IJ7A 5EPMB 1VFOA 3GJEB 3MA9H 1CLCA 4UQBA 2F8XC 4LAQL 4O9HH 2PWHA 3ELAT 1C90A 4IIQA 3GHBH 4I3GA 3VXOB 4N0FA 1GVIA 1RZGB 2GT9B 1RUPL 3BP7A 3D2UD 4M7KL 3RP1A 5KZCD 1CFTB 1U8JA 2ZJSL 5SWSE 3GBMH 4YK4B 1UASA 4E42B 2B39A 1L7TH 1GGUA 1X5JA 1OSPH 2F5BH 3JWDH 1RD6A 1RUKH 4HA4A 4MX7A 1S7WB 2XVGA 3TO4A 3JTTA 4L1DA 3MZGB 3BYYA 4WY7L 3VSTA 5I1CH 4LCWE 2X09A 3TYGH 4FLSA 2V2WB 3DSFL 3AM8A 1UD3A 4LKCB 4RX4D 5D72L 3ARYA 3L3IA 2XY2A 4U1GB 3RA7H 2VB5A 3F4VA 2QSCL 2E6QA 3SGKC 5A3HA 1J1XL 3LSOA 4P46B 1N5YH 4P7LA 4XPBL 4YXKH 2IALA 4KJQC 3LEVH 3HUJA 3V0AC 3C60A 4QYOB 4PJ9A 1DE4A 2DLFL 4Y19E 1DUZA 3V6OC 2GKIA 2QQNL 1DEEB 4LCCA 4Y2DD 3O3BA 2UY5A 2EYTA 4ZXBC 2ARJA 1UJ3B 5D1ZA 3T0WA 2PYEA 3D3AA 3MLZH 1FFNA 5IF0B 2VRAA 5HOSA 5D2LF 5IXEA 5FM5O 4V28A 4M62H 5DD3L 5JOEA 4JN2B 2VLLB 4IPNB 1D5BA 4K3HA 1F11A 5D7LD 3V6FB 1QFUL 1QG3A 2VR9A 1D5XB 1MY7A 2XXCB 1M7IB 5FYKL 3ZT6A 3PZOA 5J12C 1SM3L 3C6LD 3AQUA 4I8DA 1JAEA 5BQ7A 3GKWL 2J7BA 3QIUB 2XN0A 2QHRH 3GI8L 5BS0B 2YUXA 2D22A 2HTKD 4HGWB 5IGXH 4FQQB 5KG9A 1P84K 3GHEL 5E99H 4ZFGH 2YD4A 4OZIB 2XVLA 4UOJA 4DZ8A 4YHPA 1TZHA 4TOQA 1CLOH 4L4VA 5FCUL 3OF6D 1NDGA 1RJYA 3JWOL 3V6ZB 1C3FA 3WY4A 4I9WE 1RHHA 4PJIF 2J75A 1AC0A 4XP9H 3U4BH 4CW1B 5I1DB 1OAZH 4AEIH 5H2BA 1JDAA 3OPZH 5A8QA 2D7MA 4JRXD 3RPIA 5ISZB 3WE6A 1MW3A 4DWSC 3VFGH 1JTOA 3WIIL 4GW5B 1A7OH 3QQ4B 3H54A 5EH1A 1NAMB 1PKQA 3RZCC 3VFRA 5E6YA 3HB3C 4BZ1L 1FP5A 1N2RA 2EO9A 4QCIB 1U36A 3DX0A 3HC0B 4RMQA 5HVHB 4UQAA 2DMCA 2W0FA 4LLMB 2BX5A 4LCUB 3C08L 2IPUK 1P6FA 4B41A 5LA2A 2Z93A 3OBAA 3H9YA 4JFFD 5HHXH 4AY1A 3B4NA 3E8UH 4OZOA 4URIA 2ZUXA 2OM5A 1CGSH 1RIVL 3EUUA 3AIQA 3DV4A 1C12B 3GXTA 2PR4H 3W2DH 4XI5D 4IRSC 1RJLA 2WAHA 1DN0B 2OZ4L 4UZSA 4CMHB 1HK6A 3MLPA 4XZUA 3TO4C 3WHXA 2DM2A 4NKMB 2Z31B 2JCCE 4H8VA 4FMFA 2YJQA 2FDBP 1U8NA 1UACL 5KN5A 3INUH 2DWDA 1FN4B 2XIBA 1QVOA 2J8UE 4MD5A 4OCYL 3M46A 3CZEA 4M6MH 3PGCA 4YHLH 2J74A 3QDGE 2X1OA 2BERA 3L9RA 1UWXK 3EGSB 3QUKB 4ONGH 3ZKMC 3PWNB 4Z7UF 5HYQA 3GEWB 4PLKD 4MMZC 5FK9B 3VXRA 4RCAA 3AXLB 3HR5A 1T0OA 4FXGB 2QLYA 4ZXLA 1IQDB 4JQIH 3VGFA 3SEPA 1HHJB 1EGJL 2NYYD 4DFHA 1ZL1A 3X12B 1HWGB 1WAAA 1MCWW 3GDBA 2J62A 4CKQA 3HNSL 4L4JA 2PTTA 1X9QA 5MEND 5JXEA 1W9XA 2WKLA 1T80A 1PYWB 2D03H 4GAFB 4JPWL 4RMVA 4Q74A 1HIZA 1FIEA 4KK6C 4P5TD 4GAGL 3EYPA 2QBWA 1VJZA 4Y4HB 4HGMA 1E6PA 3C60B 1ZLSH 4XTRC 1V3KA 3QNZB 3R4DA 4NJ9H 5EN2A 3T1FA 4KKCC 2IADB 4PR5A 3OKOA 5F88A 4W89A 4NKMA 4WO4D 3MRNA 3QG6B 4QLRA 4O5LL 1HXMB 2VI0A 4Z7OF 2IPTH 5SWSB 4KK5D 4KK8D 5I1IH 3PGCB 3ARBA 2Q8BL 4UV7H 4N90D 4ZS7H 3MPCA 3QNYA 4XPGL 5F7YC 2BNUB 4UNUA 2WWDA 3QUZB 4FXKA 4LHUA 2VQUA 5DJ8A 4TSBH 2OQJB 5IFHL 3CUGA 3OXRB 2W65A 4R0LB 4PRID 3GSQB 3H7LA 2F74B 1NGYB 2QQLL 5CGTA 5CJ5A 1B9ZA 2VIRB 4ZTOL 4L8BB 5IVZB 1H3TA 4E41E 2YUZA 1D9KD 1U8MA 4HBCL 3EFDH 3OKMB 1BIIB 1A0QL 2CR6A 1I3GH 1AFVL 2DJSA 4BQ3A 1E4XH 2Z9TA 3CSYB 4UOW0 25C8L 4M1GL 5DURB 5I0DA 1CI5A 1Z9MA 2AW2A 4OD1L 4JZNB 5H37G 2D7OA 1E4NA 4G8GB 4FLRA 1FG9C 3O2WL 2X10A 3W9EA 1R3JB 3ECBB 4XNQA 5I76A 2DL9A 2M8XA 1LG2A 1QBLH 3T1FB 2EIZB 2EDXA 2C3WA 2WBWB 2R4RH 2C7UA 5HGHB 4YXLL 4JKLA 1GONA 5B3JE 3MUGB 3MGTB 4HZ7A 4L3ED 1CTOA 4OI8A 4AXNA 1CF8H 3RWCA 5DFVC 3QIUA 4UQ2A 5ESAB 4GO9A 5DRZB 1JDDA 32C2B 1YJDL 4RAVB 2CR3A 1BQLH 3QUZA 4PJ8A 4KI5C 4LEOA 2V5RA 4Z7WA 3ZKXB 4I2XA 4MHHG 4NRXA 4YDJA 3UBXI 4HUMB 2M26A 4F7MA 1D5BB 1HT6A 4OUEA 3LKRB 1LL4A 1T4KB 1NGYA 1E6ZA 4RNRA 1NAKL 4WW2F 5LAXB 4UZGA 3S36X 4PPTA 1RZKC 1EQPA 2X4NB 4NQDA 1AKJA 4N8VG 1UM5H 4Y5XB 3LEYH 5I8EB 3B2VH 1SYSB 4UAOC 3NPZB 5KSUB 2IAND 1FH7A 1VBRA 4QHUA 3VFSA 3ZHLA 5CEZL 4K8RC 4EXPX 3H7BA 1N8ZA 4LVNC 5F1KC 2V9QA 5ALCH 1QBLL 5ID0A 3D48R 4CMMA 2IBBA 1FH5L 4YQXL 3GZKA 3NVQA 3PWLA 1OPGL 4AIUA 3DXAB 5A2FA 1WBXB 1FFPA 1E0WA 4CGTA 3C9NA 2P5WE 3P4NA 4MXQC 1FRGH 5KSBE 3VXNB 1KPRB 2O61A 3WJJC 1H3XA 3AMCA 4Z0BL 4PRHD 1C5BL 5TGBA 4NQCA 1F58H 4MSWB 3ARDC 2JJSC 2P24A 1UKQA 3VWKD 4MQXC 4XXCA 5IVXA 1JYVA 3WFLA 3DVNA 2DGAA 1WIOA 1KG0B 2ZNWA 1FH8A 3RAJL 5GIRA 3GM0A 3RJDA 4X5XB 4P2CG 5EU5A 2LFGA 1CFNA 1NP2A 3JV6B 4FFWD 3L2MA 3BWAA 1Y18B 3PWNA 4MCYA 1CR9H 2VISB 4JREC 4AEFA 5BRZD 1KTLB 3EJRA 5L0QB 4MAYB 4M5YH 2EDOA 1ADQH 5SWQA 1QOXA 2Y2WA 1K6AA 3VG9B 3VGGA 4JHBA 3WXVL 4U2YA 4UT9L 4FNPA 1IGJA 3U7WH 4JFWA 2QQQA 3IFLL 4LASH 2R69H 2G75A 3ILPB 4Z0BH 4JFEB 2OSXA 4NO0A 3QEUA 5J11B 1A7QL 4Z76A 1T89A 4XCEB 4FXLA 1IBGL 1CU4H 5D2NA 1R0AH 3GKWH 5FYJL 2OK0L 4E2OA 4A3HA 5HDRA 4XZWA 4DO6A 3WUBA 2UY4A 4PRAA 1MUJA 3O2VH 4MDIB 4MSWA 1NGPL 1CTNA 4NQXB 3D4YA 5LJYH 4NN5B 1PPIA 4GQ9L 5ICZB 2Q8AH 4Z9KB 1KFAH 2B1HL 1EAPA 3HI6L 5B8CB 5ICXA 3WELA 2OWCA 3G6AA 1EV2E 3QNXA 4WTZA 2NNAB 1DWGM 2VUYA 1GOGA 4Q9QH 3WDQA 2FBOJ 1JD9A 1PBGA 2NSXA 4ZTOH 4ZUWB 4X6DF 1OSEA 3IJ8A 4EN3C 1JPGA 2E7HA 2C0HA 3WH6A 2ZPKL 2EIDA 1OT2A 3WQ4A 1OQOA 2AK4E 3TNMA 4MAYA 3N13A 5BYWA 1ACYL 4NKDB 3UJJH 1KYOJ 3FKUS 2UUDH 1CYGA 1BJ1H 1SYSA 2WINB 4NPYA 3QULA 5D1QD 5I8CB 3GMLB 3NSNA 2XT1B 2W9EH 4WFFD 3WS3A 2PB1A 4P7OA 3QDME 4KKLD 3POHA 3S4SG 1SYVB 5E9AA 1PX3A 4JKWA 1ORSB 4WV1B 5CWSB 4PBGA 5HYJD 2WIIB 3X17A 4HAGA 2GJXA 2GTZA 4O00A 1FHGA 1GW1A 1KIUA 3DJ9A 3SBWC 3PQYE 3MCLL 2UWEF 2AMGA 3RIAF 3SCTA 3QEQA 4G80A 3F58L 2VDQH 1J12A 4MNQA 5KVMC 5EBWA 3VGDA 1I1CA 4F7PB 5M03A 3D69B 1R3KB 4FQ1L 2FJGA 4DGYH 5J13B 2XWTA 5MENA 2V2XA 3B43A 4PYGA 5DI8A 1IL1B 1IAIM 5D7KE 4G8FB 5GHWH 1KXHA 4MWFB 1J87A 5KJRH 2IPKB 4YFDB 3BDXA 4CDHA 1C1EH 1OIFA 1ZHNB 1TNMA 2H2SD 3VW3H 2W62A 5KS9E 1QBAA 4YQXH 4F7MB 5BRQA 1CFBA 1NGQH 3SDYH 1ERNA 5CEZH 3BHBB 5J6HB 3LKSA 1ZLWK 1QZ1A 3W37A 3VWKC 1S7UB 2GFBB 3WY1A 3DX3A 1AKJB 1QFOA 2EECA 2J6EH 3X11A 2YUWA 4BYHA 3I3BA 1HKJA 3MRKA 2BHZA 4X7CC 5E8DH 4EQ3A 2VAAB 2VXVH 2DI8A 4FK9A 1BEYH 4P9HH 1BF8A 3QXDB 4MXQD 1T03H 2EO1A 1MCRA 4XC3H 1R3HA 3QG7L 4G8IB 4XNMA 3NTCL 1FNEA 2QADB 1NBZA 5D2NB 2VITA 4HPYL 4OSUL 4GINA 4LKXA 1LD9B 2MFNA 1OTSD 1A7RL 1B0RB 4LLVA 5E1HB 5DJAB 2VXUL 5GGVH 5GQBA 1NFIB 4ACPA 5I17B 4PY8J 3S4SA 3RAJH 4HOXA 3RM8A 2E8ZA 4AD0A 4ORZC 4CADB 4GXUN 2YPKB 3JVGC 1JJUA 3ORJA 3D39B 3MBXH 4ESKA 4NZRL 5TD4A 2OL3L 1S5HA 4MD4A 4OI9A 1I1YA 1KG0A 4J3UA 5C70A 1INEL 4YNYA 3IJSA 2XQYG 2YWZA 1OARH 1UQSB 5E4IA 5CBAA 3ARSA 5IVNA 5DT5A 4M7JL 4ZO6A 1WIPA 5CJQL 4G9FA 1PG7H 3LPFA 5IK3B 5EOCH 1AFVH 1L6ZA 2VX7A 4HUXB 1UG9A 3BKML 1I7RB 1S9XA 1KEGL 1ZJAA 1AHWA 2G3NA 4JFTA 1CENA 1M71B 1BX2A 1Q9LB 3MV7D 2V2TA 1FNGA 1U8PA 5AAWA 3T8XA 3AYRA 4Y8DC 3BN9C 4KTEH 4EXKA 4C59B 2E7LC 4XUYA 3EMQA 3DMMC 5KSBA 4K3DL 4NHUA 4JFXB 1AGDA 2ATPB 1UD4A 1KR1A 1KBBA 2VXUH 5GGVL 1ZVSA 1UZ6F 1AR1C 4L4TD 3BAWA 3WKML 4KH2A 3L95B 2P42B 3QPXL 3FY1A 3TA3D 2DWDB 4HPOH 3RCNA 2AEWA 2G5BB 2W38A 3OGSA 4WJXA 3CH1B 1A3RH 5DVNA 2B20A 4Y5XA 3RFZC 4DKEL 3MCKA 4P59H 1WTGT 4KROD 1KN2L 4U1KA 1K5NB 4XB3A 2OZ4A 1A6VL 3H3KA 5E56A 3EFFA 5AWNH 5IQ9B 1EAPB 5B8CA 5E5MA 3HC4H 1G6RA 3QUXA 3KL5A 3BESR 1QSEA 5J6GB 3D87B 4PUBL 3U7YL 1WFOA 3F12A 4W7WA 5J3HC 3CHDA 1SJXA 4FQPA 3TA3C 5C0FB 1F8TL 3PWJB 4LRNL 4MQ7B 2XRAH 1ZA6B 2DLTA 2X4OA 2P8LA 4WKFA 5MHSE 3ZT5A 1BQHG 2YK1H 1G7LB 2YN3A 4Z8FH 1TVHA 3O3AB 5E0FA 2ZG3A 1A4KA 4JLRB 1AO7B 2VDLH 3BSZH 3MYZA 2BP3A 1T2JA 1H15B 3OAZH 4NYLB 5DZLA 2ZIDA 1CK0H 4QKXB 4FS0A 1NLBL 1CICB 3ZDYF 5B38B 5IHUH 1T0MA 1M6OA 3P0YL 3SQOL 4PJDB 1VPOH 2NW2A 5GRZA 2DDXA 3CXDH 4X9HA 4YHNB 2V17H 3L7FA 4FNTA 4W88A 4Y4HD 2IEPA 1EEZB 2X4UB 2NY0B 4MMXC 3BGAA 3LKSB 1C5BH 4G43A 2E7MA 3ESVF 4DVRH 4OF6A 3CX5J 2NTFB 3FFDA 4XMLH 4I18C 4PG2C 3VRLE 4PJBF 1JZ5A 2ORBH 4LSPL 1JZ3A 3OXRA 1P4LB 5T33H 3SO3B 3CFJB 5DQDL 3M1BB 5HHQB 2HFGL 2F7QA 1HDMB 3OKLB 4LCUA 5T1KD 3ULVD 2FZ3A 1YEIH 4AW7A 1RUQL 4HS8H 2DJ4A 2X4OB 2YPLA 4NN7B 4MTVA 1NC2D 1JZ4A 1AD0B 3L5WA 2D1ZA 4U1HA 4YHGA 3VD9A 1T7VA 5CSZA 3SDDC 4M5YL 1II4E 2GJXB 4LPYA 1D6EB 3U2SB 4F2MA 5FUCC 4MNHA 3DHJA 3HZMA 5IHUL 2JJVA 5JIHA 3MLUL 4P0DA 3ZE0F 3WENA 2W63A 2R39A 2ZWZA 2R8SL 4P3DA 3QDGA 4ONHA 1XIWA 1UGNA 1QSZA 2IFFH 3SJVA 2EDRA 3ZDXE 1N6QH 3TTSA 4HT1L 2EDTA 3KVQA 3BE1L 1V3JA 4XP9L 1N3NA 3U4BL 4DZBA 4M48L 3MMDA 3CVHH 2BY3A 1ONQA 2R0KL 2XZCH 1T6VN 5SX5K 4ZFFA 3HZVB 1LE9A 2P49B 3LN4B 2RQ8A 5E8PA 1F2XK 2I25N 4NQSA 2RGSA 4PJ5D 3V6FA 4LKCA 1JCKA 1PZ5A 3AMGA 1BVKA 1T1YB 4GQ9H 2VZOA 3MLWH 4NFCA 5DJ2A 3RGVB 3GJFB 4K9EL 3P9WB 3HB3D 4PBVC 5A2AA 1G9EA 5HHQA 1J0JA 5AY7A 4M62L 2JB5L 4KTDH 5HI5C 2YD3A 1I7TB 5JLZA 4JHOA 3DX6A 4Y19B 4QRPB 3ZJKA 3RI5F 2FHFA 5FKAA 3GYCA 1DP0A 2H1PL 3PHQA 3S3JA 3TCLB 1DCLA 1MWAL 1A7PH 3VFTB 4WI4A 2OZ4H 4OF3A 4QF1B 1RZ8B 3S3PA 2WAGA 4XWOC 1JNHB 5I6XC 4XXDA 4BK5A 5CZXD 3T0BA 2AXGB 2HJFB 5JMOC 2AOSA 3AI0A 1WGOA 4FFWC 5ANMA 2DI7A 2WMGA 2BVYA 3IU4L 4Y5YB 3NJ3A 2HFEB 5EC2B 2ED7A 3GB7A 4K3DH 5EA0H 4YJZL 5IT2H 2AEPL 1FFOA 1W1VA 4YBLC 3OX8A 2X4PA 3FMGL 4JDTH 4OIBA 1MHEB 2OR9H 1LDPL 3O6LH 3ROOA 3U1SL 3BQUA 5DRWA 1V7NH 1J1XH 1N5YL 6FABH 4D9RE 4K3EL 4JREB 3ILQC 5KS9B 1DN2A 3L6FA 5IMMB 2PWGA 3MJ7A 4JDVB 2FLRT 3SCWA 2Q86B 1VEOA 2W65B 1G7IA 2G5RA 4YPGB 3EYSL 2P8MA 2VDQL 1YYLL 4LLQA 3ULUL 8A3HA 3C5JB 5ETUA 4UFLA 1GL4B 1TVHB 2I5YH 3WIJA 2A6IA 4KY1L 3PNWA 4YO0B 4LF3A 1QWNA 3OJ2C 2F1BA 3IKCA 3RNKB 1ZEAL 4QLJA 2F5AH 2JJUA 3VXUD 3APGA 4KQ4L 5A3IC 1QFUH 3AY4C 4HS3B 4PGCA 5ENWB 4PMDA 2GJZA 3FT2B 1E56A 3AFBA 2BY2A 2MWCA 4PP1D 2LU7A 2KPNA 3IDXL 5C08D 4RL3A 1PEWA 4QXTB 1SJVA 5FGCB 3NCYS 5IB3A 4Y5YA 4TUOB 1E73M 3SY0B 1UR1A 1ZA6A 4BQ2A 5C2UB 1KC5H 3D0VA 1XGTA 3IETA 4EVNB 1LO5B 2HVKA 3STZA 5JUEH 4AZCB 1JFQL 3HG2A 2BFVL 3D3VD 2P5EE 1HWHB 4HFUL 1MI5E 3EFFB 4OQTA 5IQ9A 3VWJB 3L3DB 3FQXA 3WD5L 2ZX9A 1PZ2A 2YD6A 5I1GL 5F97E 1FYTB 1R34A 4KV5F 4NO3B 4X6EB 4ERSH 4P59L 5C0JA 4R9HA 3NACL 4QLKA 2A1WL 4L5FL 1OAXL 1XF2B 1HP5A 4KQ4H 2N4IA 4YHZH 2JIXA 4JVWA 1U0QA 3CH9A 2SEBB 5HHOA 5KSUA 1M04A 2O26U 3O2DA 2W9DH 1I9RL 4O2EA 2C3GA 1ZT7B 1XCWA 3PL6B 1XR8A 4N0YL 1IQWH 1KB9K 5GS1C 3WHXB 2EYTB 4O9HL 2EH7L 1KLGA 3A6OA 3HJEA 2IFFL 3KPRE 2DQFA 3QFJB 1R85A 2ITCB 2Y6SC 4K23L 1LK3L 1T3FA 1A2YB 1J11A 4NQDD 2DYPA 3LZFH 5CBAB 3BE1H 4F7EB 3PV7A 2PN5A 5LKNA 3CLFL 2D0HA 1FAKT 1KCSL 4FNLH 5EO9A 4X5WA 3MGTA 3VI3F 2QMJA 4R7NA 1DDHB 3O4LA 4PIRF 4Q0XL 5F44A 3R0NA 1RIUL 3P77B 1AQHA 2NY2C 3WHE1 3BQUC 1YNTA 4CADA 2ZOLA 1QSEB 3WLBB 4PJ9C 3V6OA 3VIMA 4AM0A 5A2IH 1RMFL 4H5SB 1MELA 3NZHH 5JHDA 1RZ7H 3WH8A 1DQLL 1GZJA 5HI3C 5F6HI 1ZHNA 2WW8A 4LSSH 1UB5B 4P2QE 1HYSC 1S9YA 1NL0H 3W28A 1QI5A 5EN2B 4U0QB 2WHMA 3SUUA 2APVA 2DLGA 4GAGH 1ZTXL 3LRHA 1KLGB 3O2WH 3UO1L 3L3HA 4XPAL 1EA9C 1H8OA 4N0CC 4L3CA 4TVPH 5KSBB 3FFCA 3DUSA 2B4CH 2WYSA 4Y16A 2J1KA 3HMWH 1BYCA 1HOCA 2FO1A 2E9BA 4Y5YC 1W0WA 2C26A 4M6OH 5DRNA 3LQZA 3OKNA 5T1LB 5E7FA 1ED3A 4NWTL 5I2IB 4AD4A 1OP9A 3BI9X 3CC5A 3H42H 4BQ8A 1B2WH 2DQJH 3SKOA 3CX5K 1RZJC 4HKBB 4WVRA 1EFXB 4MHHI 4P2OA 2VZTA 4RMTA 4FFVD 2WSKA 4LHJB 1VKXA 3SBWA 5H94A 1Z6JT 3MRGA 4K7PX 1MHPH 1KEMH 2V38A 1U8NB 4JG0H 1NC4D 2R1YA 3VXQA 4X0NA 4GG8A 1FZJB 5GRVL 5TQ2H 2CDEB 4K7FB 1K8DB 1NCTA 1XGTB 4JKPH 1V6WA 3QNZA 3WF3A 4IHOB 5D5MB 2O5ZL 4LVHC 3QO1B 3RM9A 2XWEA 4LF3B 1GZPA 1IMHC 3ULUC 1BVLA 3CLWA 3IYLW 1GC1H 4FQ2L 3VFNA 4Y7MA 1PSKL 2X4SA 4L29A 1QOKA 4NM4L 1UYWL 1NGXB 2HH0H 3WN5A 1JGEA 2Y6SD 1KPUA 4M4RA 4RRPA 2OWWA 4G8GE 5T1LA 5C0AB 4RQQA 2ZUTA 4I13B 1U8OB 3U57A 2DRUA 5ITFB 5ACZB 5DUBA 1GHRA 1T0PB 1JAKA 1T2QH 3OLIA 3AGVA 3G5XA 5E94A 3NIFE 3EJUA 4CD6A 3VRIB 1A1NB 5JW5B 3F5JA 3BPCA 2E5EA 3ULVE 3RNKA 1YEJH 3G6AB 5I6SA 1G1YA 2C7UB 5HGHA 4W8BA 1ZXQA 1P5UA 3KPMB 4GRLA 4RMSA 3FT4A 2G75B 4KV5E 5SV3A 3QYCA 3BFOA 4L8DA 1JYXA 3UC0L 1N5AB 2MPAH 1X44A 3TBTA 4KKBC 2A74B 1I8LA 4Z78A 1GOWA 2DT3A 1YNKH 2JKXA 4KUZH 2XSBA 5EOTB 1T04A 3P9LB 2CUMA 1EBAA 1YMMB 2AJ3B 2HKHL 3IDXH 2FX9L 4NQCB 2FL5B 2N1KA 5IVZA 3VI3E 1I1WA 5C08B 3W0WB 2J8GA 5BXSA 4QEGA 1CWYA 1YN6A 5SWQB 2R1WB 5IROA 3REWA 1G7JB 5I71C 3L6FB 3EAKA 5IMMA 1P53A 1CXHA 4FTVB 2Y07L 3S37H 5ID1B 1CFQB 4MGXA 1T1WA 4FMVA 4WFFE 3NCEB 1T5XA 4P5KA 3HZ3A 1A7BA 2ADIB 2CLVB 3FB5A 1EMTH 1UZ6E 4KRUA 3BZ4B 5HPMB 3NYDA 1UQYA 5DJ2B 3RGVA 3KR3L 4Y1AD 3LRSB 2BCKB 1Q9OA 2F19L 4IOFD 1UH2A 4NFDA 1GGYA 2NY3D 1A02N 4X7FC 4KK9C 1XR8B 4M6AA 4RGOH 2MOVA 1RIHL 1H0DB 3L7EA 1UJ3C 1KXVA 2X0HA 1JN6B 2V2XB 4LCYA 3WN6A 5D71L 4MAVA 3BAJA 2WZEA 5DTFA 4UTAL 3ALXA 3TCLA 1A6WH 1RU9L 1RUKL 3UO1H 4NRXB 1ZTXH 1SBBA 4M81A 1FNSH 1WKYA 2A73A 3MRIA 1BJMA 1QLEH 4NDMB 2X1QA 3WH5A 4RE2A 2YUVA 2O5YL 4IEFB 5ABDE 4KRTA 4PJCA 1HWWA 4GMSL 3D85A 1KXQA 2QSTA 3C6SB 5KAQG 4OQ1A 3ME0A 4PRWA 4MB5A 5FYJH 2M2DA 1PDKA 1A7NH 1BF2A 2BDNL 4TX8A 4EUPA 5K9KA 1N59A 2CCRA 4NUJA 5BMFL 2HT2D 3G6MA 2OSYA 3PWVA 4HP5A 1IGIH 3HE7D 1KYOK 4N5EC 5D9NA 2MTPA 1Y6NR 4FA8A 3OR6B 4XP5H 2R2BB 5BRZE 3HUJB 4U5IA 4BQ6A 5ETUB 3SKJL 4NQUA 1B2YA 2NY3C 1SY6H 4PS4L 1AGCA 1A3LL 5C9JA 4P49A 1H3UA 3OLEA 1S3KH 3BAEL 3DX7A 2I9TA 4KDVA 3DO3A 4XPHH 4A2LA 3ILPA 3C60C 2JCCF 3MSPA 3T65B 4X8XA 4JPKL 4QT5B 3PZQA 4HWBL 1WTLA 3B5GA 1LHZA 5D9SA 1N6VA 1P9MC 3TVMD 3CZNA 2D24A 1A22B 1YJDC 5CG0A 1I7ZA 3WFHA 2EXYD 3W81A 4PRPA 2FH8A 3L5IA 2J88H 5JQHC 4KJPD 5ELIA 4HH9A 4YBHA 4X5WB 5C0CE 3RUGB 5HXMA 4LAJH 4M5ZH 1CBVH 1AGEA 3GGWA 4KQ3L 3DX9A 5A6BA 4QXUH 1GH7A 4QHNA 5D7SH 5F9WB 3UG3A 1I8KB 2VLJE 3MNZA 1G7MB 4GG6B 2V9TA 2XTLA 5MEQA 2YBTA 3TJHD 3ES6A 1QSFE 5F96H 3TVMA 1J0HA 3MRGB 5I30H 4PRHB 1E43A 1T5WB 4JJHA 1QRKA 4XBPA 2A9ML 4MB3A 3TJEH 1HQ4B 2VABA 4GKNB 1NOUA 2AERT 3MRDB 4WEBH 2R15A 1T20B 5KW9L 2EE3A 4HMDA 4KVNH 3CLEH 4PREB 2W1NA 2WV3A 5CZXC 5F6IB 2HJLA 3NA9H 3QDJE 2WXDM 3GZAA 1EXUB 4KDWA 4WI9A 2FEDD 1FZKB 2BVUA 1A3HA 1RK1A 1SFSA 4P4KA 1TA3B 4RSVA 1ZA3B 1ITXA 4KKNA 3MRLA 4QHLA 1BVZA 3IF1A 3RJXA 3BW9B 3BVWA 5A6MA 5I16A 4M02A 2PCPB 5CKGA 4YDIH 5DT1L 4O51B 3QGVA 4QTIH 4H2CA 3HC3L 4QHNB 1RV6X 2A3AA 1YDPA 2DQCH 1ZS2A 4HDIB 3L4VA 4NZCA 2Y8VA 4FQXD 3AHVA 5FYLH 1VACA 4GSDL 5DK2B 4JRXE 5TE4H 1A9EA 2OJZH 2GJPA 5B3JF 1IBGH 4XPBH 4YXKL 4J23A 4OCWL 4ISVB 4ZTPH 3OSKA 5AYBA 4WO4C 3SDCD 5DO8A 2I9LA 5FM4A 4Z7NE 5DWUH 4RGOL 5GGUB 5CPQA 1BFSA 4RFOH 1TJHL 3H42L 3QXDA 1QNZL 5I8OL 2JIEA 4X7DC 5J57B 5HYQB 3G6JF 3EJQA 3AHYA 2VIRA 3DX8B 3LEXB 1KPVB 3N9KA 4HF5H 4U6HA 4Q9CA 4PRIE 1AR2A 5C0DB 3ULVC 1XGPA 1U3HA 3LS4H 4QRUA 3SE3C 4MAUH 2WMHA 2XG4A 1ZHBB 2NXZC 1BGXL 1G6VK 3VRLF 4YHZL 2DBJA 3G04A 3IFOA 4OLZH 1ETZB 3L3HB 4JL1A 4PJ5A 1DEDA 4JKPL 5BXFB 1NANI 2VKXA 4PD4K 1BZ7A 2KQMA 2XPGB 3QJFA 1QACA 2FX9H 1U3JA 4RGNC 1YEFH 3UTSE 3V6ZA 3N1AA 3O6FB 1TZ7A 1NCDL 4X6CE 1SVZA 4JFQB 5BXPA 2BDNH 4N0CD 2AJSL 3HG3A 3W26A 2LV4A 2Z93B 1M53A 1U2CA 1CGVA 3QDGD 1ZANL 4U4BA 5JDJA 4XXCC 2JEPA 2GSJA 4MLSA 1UCTA 4YXHH 1HHIA 3FQWB 3ULUE 3IGUA 4WI2A 3A4XA 4HX1A 3VPLA 4JLRA 3KXFE 5E24E 1VFBA 2WANA 3O6KL 4XX6A 1ZT1B 5DI8B 1FAIH 2CH8A 4DWSA 3BZDA 2PXYA 2NW3A 2WHLA 2MHAB 4MNGA 3EFDL 5E5RB 3DUUB 3SGKA 3VFGL 2D0FA 2PYFA 3L5XH 4XBGA 3FT3B 1OWQA 1OP3H 3VD4A 2ADGB 5ICYA 3VGHA 5C8JA 3PWUB 1FVCB 2C1PB 4XCNA 2YFOA 4GKOA 4RGNB 4OUOA 3TT3H 3QCTL 5KJRL 3HPJB 4HUWA 5IUSA 4G7YH 1FYHB 2WLZA 2BC4A 4U1NA 1WQVT 2L4OA 1KN4H 2XRAL 3UX9B 4B5EA 5E8EB 1MF2H 5ABFB 3RVWD 1S8DA 2NMSA 5IBLC 2AV1B 2WQRA 2PKDA 4Y5VB 4Z7UE 3LPOA 3CTTA 4OF7A 1TFHA 4MJIE 4PJBB 1FCGA 1CVSC 3C8DA 4Z5RA 3VXMB 1U8LB 1F02I 5JORB 1W72B 1NPUA 5BZWB 5C0BA 3TJEL 5EDXA 1T03L 4RIRB 1E1EA 1YQVH 4NT6B 4J8RA 2NPLX 5ABEA 1TTGA 4H7VA 5H35A 2DKSA 1NMAL 5DHXB 4KHTH 3BPOB 1RJLB 4D0DA 4KY1H 1JE6A 5B4MC 3UG4A 1T66C 2R1WA 3MV8E 4ODTL 1TETL 1JGDB 4JGMA 4L4VE 4Z7UA 4F15C 1T5XB 3MRDA 5KSAC 4G6FB 3QT2A 4HH9B 4PJ8C 2GJJA 4DTGL 3B5HA 5EUOB 3KLDA 2BNRB 1ES0B 2R4SL 3U7AA 1DBKH 4ZUVA 5D7LB 1HINL 2B5IB 1UCBH 5EFIA 1B31A 1I8KA 3MNZB 1A5FH 3O9WD 3BEVB 3H9SB 1LEKB 1TG7A 1MFAH 1MCOH 4UB0L 3HI1A 5KG9B 2V5SA 3M07A 4M1CC 2Q86A 1QI2A 4RA3A 3IT8D 4QTIL 5C0CA 4D6JA 4XCEA 4QCIA 2XICA 1Q6FA 5L8KB 2ZWYA 4OF5A 1N64L 1B0GB 3FOLB 3EJZC 3PWJA 2AXGA 5EU7E 3ZDXF 3UTQA 4DQOH 1KJVA 3LDBC 1TJHH 4FFYH 4WU5B 2A3BA 1AXTH 5DWUL 1DWAM 3BIKA 2APFA 3BP5A 4HPOL 3QIWA 4C83B 5DK2A 4TULH 2YRLA 2DLHA 3IXTA 3BVVA 1ZK9A 3I84A 1MOEA 5IBTH 4DZBB 3R1GH 5C0IA 3SPVA 3A6BL 2BNQD 4MAUL 2XTKA 3UAJC 3HNSH 1A6UH 4N0UE 1ZBCA 2VVNA 1KENH 3KJ6L 1V6VA 1FG2B 3BXNB 3HPJA 4HUWB 1KJMB 3O4LD 4XVUC 3ZHDA 1I8MB 3GH4A 3T0EC 2VX4A 2BVOB 1TQCB 4PTTA 5J8OA 4CU8A 4X0VA 4AZ7A 1NUDA 4JFFB 3D5HA 3LKNB 4NRSA 3WEXB 2P47B 3LB6D 1OY3B 3ZMRA 3BUTA 3BUIA 3H7BB 1XCQB 4DW2H 4HXBL 3D3VA 5F9OL 1HDMA 4IRJA 5FO7A 3O45A 3W5NA 3LV3B 4LPWA 4U33A 5C0RH 5HVWA 2ZOXA 1KIPB 3VOCA 2IAMA 3DXAA 1U58A 5GS0C 1J88A 2C1PA 3N17A 5INDB 4KQ3H 5I1IL 5AD0B 2QMKA 4LOUD 3KPSA 1W72A 5C2BL 4JRYA 2NXYD 1WWBX 3IJHB 1QNQA 1OAQH 4YE4L 4NQCD 4MDOA 1RZ7L 4MQTB 3TA3B 3U48A 1AP2A 1I9EA 5CIPB 5ERWA 5F93C 4RMWA 1MFEL 1JD7A 4AENB 3TNNB 2JF6A 2RFXA 3FB7A 4NP4H 2CKNA 3NIDF 3QCVL 4H1LA 5F9JB 2F54B 4QOKE 3UJJL 1UM5L 2AXJA 2ESVB 4LARL 2XG5A 1FORL 1OTUD 2AEIT 1MF2L 2IH3A 3DUUA 1NOFA 5C0CD 2H26A 3O3EA 4BM7A 1KLFA 4QRQA 5D71H 2AJYH 4EIZC 4XVSH 2V5DA 1AJ7L 2HJKA 1P4IL 4JHAL 4PG9A 1QSFD 1CGWA 3FQWA 4P2OC 3MR9A 4ZXBA 4UNTA 3FO0L 4L4PA 5LG1A 3R0MA 1S7QB 4KPHH 4PJXF 4EI5A 4AM0B 1AO7A 3BP4A 2CDGB 3O6FD 1MJ7H 4PGBA 1UM4H 4G8IA 5A6BD 4C56B 2O5YH 1WAWA 4YZFE 5FOOA 2PF0A 1GGCH 5FO8B 2X1WL 4K2UL 1LVEA 2VTFA 4LBEA 4D6EA 3PWVB 1TETH 3TH3T 2XZAH 4EE9A 5H8DA 5K93A 2COQA 1BMGA 1D5MA 1JUFA 4JO1L 3NCFB 1FE8L 2W92A 4O51A 5DD3H 1WSST 4G3YL 5C3TA 3DURB 1RZIA 1LWHA 4QRRE 1JNDA 4LAQH 3QHFH 5A94A 5BXTA 2QQLH 2D7PA 2H45A 1UWGL 3LVEA 1N7ML 3CUFA 2X2YA 1KACB 2BVEA 5K59F 2CEQA 4HLZG 3W9DA 2RAMA 4ETQA 2BV9A 5A40E 1IGYB 4M9PA 4ACZA 1G0YR 1S78C 4X5XA 1XH3A 1M71A 1TQBB 1UZ8A 5D5MA 2JELH 4Y4HA 3QDMA 3NMEA 2MCPH 4WW2A 2DD8L 4OLZL 4PJAB 1AI1L 4KAQL 3S5YA 4OD1H 3OA5A 4F57L 4GRLC 3QUYC 1R6VA 4L29B 3OKKB 2CJUH 4WNQB 4E0RA 4W4OC 1OCQA 4CU6A 3LZFL 5J7CC 5JBFA 1FC1A 5MP6H 3WSQH 1QYGH 4LSVL 1QQDA 4OZ4A 4UIMA 1BQSA 2BRRH 5CZKA 4KDTA 2OTUA 2WMPA 3GBDA 3B8SA 1ZHKA 2B1HH 4IISA 3QWRD 1JPGB 5AD0A 3GI9H 3MNWB 1DBBH 3QFDA 5I18L 4OCMC 5I17A 3K46A 1HHHA 4W6XB 3ZYJA 1HL8A 4KROC 4L9LC 1UR2A 4BQ5A 4MNQE 3U0TA 4PJCE 4KUZL 5DMKB 2WW5A 5I1HL 5CZVL 3RIFF 2DMBA 5ICZA 7FABL 2CIKA 3ULUH 4WI3A 1A6UL 3H9HB 2CLZA 4CMHC 5I19H 4MZ3A 3GSOA 3V7AE 1JWSA 1TVBB 1U2HA 2R4SH 1ZOXA 2VDOL 1OB1B 3RGVD 5IB3B 5EOTA 2V3DA 3VE0B 1WBYA 5DMJB 2BVPB 5GGRB 2D3NA 4POZC 4TQEL 4GW4A 1LO5A 4PCTA 4FG6D 4JFZH 1EMTL 4GRLB 4KFZC 1HH6B 4KMQA 2F7RA 3QI9B 4MD4B 3KL0A 3IDNB 4MA3B 2QV4A 1HZHL 1BYBA 1Z32X 1H5BB 2JE8A 2ZXAA 4PB0H 2QF8A 5D2NC 4BKLA 4PTWA 1JF1A 2YA1A 5IW3A 3O11A 4B3KA 4DKEH 3RWGA 4W84A 4PFEA 5EU5B 3OR7B 1IZKA 2X89D 3MROB 1UZ1A 2UWEA 5CJOL 4JN1H 4Q9QL 4KZDH 2NYYC 4PG9B 3BVUA 4JFHE 3OWEA 1E0VA 4Z2KA 2AJVH 5HGBA 1J8HE 4U6VL 5FCSH 1HIML 2EDKA 4XC1H 4LPCA 3FO2A 3SDCC 4PGBB 2ZG2A 4NT6A 2VLJA 2A3HA 1FJ1A 5F89A 1E6JH 1KJ3H 1MRCL 4BZ2H 2OP4L 3N15A 3W6LA 3KLAA 4XHJD 1GZQB 3RGHA 2EYSB 4X7TB 1LE5B 3DBXA 4AIZA 3SDDB 4D0CA 1U6AH 3MI6A 1DWFM 1JHKH 3WFEH 3GMOB 1ZSDB 1CDHA 4UV7L 5BZWA 2EH7H 3WL1A 5GGTH 3TNMB 2W4XA 3O6ML 2ESCA 4D6GA 3K3QA 1J8HA 4V27A 4KZEL 1UR4A 3O9WA 1ZBKA 1RZKL 1UM6L 5IBUB 4WDIA 4YHLL 3BX7C 4G42A 3FB7B 1A7RH 1FFNB 4ZO9A 1N59B 4RISL 3D9AH 4F33B 1O5DT 4B7LA 3EJTA 3G5ZA 1FZMA 3WO3B 2HAZA 5SX4H 4YXHL 2D31B 2Q76B 5F7EL 4FFYL 1AXTL 1M7XA 3IDGB 1CQYA 4H20H 5C07A 4UDTB 4R5EA 3IJYB 4U6XB 4V2BA 4DFIA 5FK9A 4MDJB 2GITB 2BVOA 1XF1A 3UTQB 2WPGA 4O02L 2FDMA 2AEQH 3QEQE 3HHRB 1IKFL 4MNLA 1JFXA 4GMTL 1IFHH 3RY6A 3VXSB 3UTTD 4HC1A 2J6EL 5J9PB 4D0CB 5FL0A 5E6IA 3FT4B 1NDMA 2ID5A 2BRQA 5D7IA 4IM4A 1EHAA 2W61A 1RZKH 1PX4A 1U92B 1U2YA 4NWUL 2YRZA 3BYTA 2RB8A 3SDXE 2VRKA 3RWIB 1FP8A 3MUGA 5D1QC 4XP4L 2G60L 3L4YA 3I50L 4YPJA 3GH5A 5KSBF 2X4QB 5CD3B 4KJWD 3A6CH 3KPQB 1OBAA 3ZOAA 5C9KA 3QO0A 1AD0A 1JPST 1CICA 1NAMH 1OB1A 2AQ3A 2XZQH 3GSWB 2QQNH 1PZUB 1UWRA 4LXFA 5EBAA 1IV8A 1AXIB 5FA3A 4D6IA 3MNVA 1AIFA 5T3ZD 1AQKL 3C5JA 3CU1A 4JFOA 1I8LC 3RWGB 5EU6E 3TYFB 3D18B 5D7JC 3VXMD 4NZRH 4JRYD 3ARED 2EDHA 3AU1B 1MHCA 4TOYL 4IM8A 5ALCL 1EPFA 1J0IA 1ZV5A 2GSIB 3F7YB 4ZXBD 3TOPA 5BV7H 4QLLA 3T09A 3B2UC 4OM0H 3WNPA 1ODZA 3DGCR 3S35X 4N8CL 5LGHH 2ZXBA 1TE1A 2AVGA 1BFVH 1ETZA 4PGZA 1HILB 3K4ZA 3U36A 2I26N 3HNTL 4Y88A 1XD0A 5JBDA 2BNUA 3ARTA 4HJ0D 1P1ZA 1WZLA 3IU4H 4N42A 3QB7C 4JR9H 4FRWA 4YDKL 5FUZH 2W0PA 4X98B 1A6AA 1Q6CA 4AEEA 1L0QA 3QUMB 3GRWA 1YN7A 4I48B 5T1MB 3CZSA 2ZUVA 3MFGB 1X6NA 1BD2D 2IAMD 1XRVA 3JVGA 1JRHI 1UA6H 3MRBA 4HFWB 2F54D 2VT0A 5E99L 4RFOL 3RX5A 3T3MF 2FWOB 4X6DE 5ISZD 2YD2A 4PY7B 1NQ6A 1INDL 5FCUH 4GQRA 4HC1L 5HHMB 1W9PA 4HKBA 3SKJH 1P2CA 1JWSB 1HSAB 4AMXA 4KI5E 1WC7B 2LU4A 1L0XA 3U0WH 5C8JB 4HHAA 1LO4L 2ZE0A 3ZYZA 4JO3L 1NCUA 5D7IE 2DM3A 3HC4L 2ZCHL 5B3NA 3GTNA 4KRPD 4ORGB 4OT1H 5GSRA 3FQTB 1J8KA 3MGOA 2DICA 4HWBH 3QEGL 5AZ2H 3OXSA 5EU4B 4PP2B 3KDMB 3T8XB 1YNKL 5F7UA 1LEIA 1P7QB 1W3HA 2DQTH 3V8CA 1TQTA 3NOIA 4UIMB 1TFVA 1HI6B 3E8UL 3WEZA 1KC5L 5A2JH 4D3CH 3QHTC 1RPKA 4JGUA 5DZOA 4BH8B 4HAFA 2KZ1B 2XHYA 4PJGB 4KTEL 1MAKA 3N9GH 1TCRB 3KPPB 4X4XB 1UZ8B 3TBSB 1UC6A 4PRPB 2I9TB 2CKSA 1OGAE 4LSVH 3UXFA 4HW6A 1ZGLA 2X4QA 3WLBA 5CD3A 1MWAB 3QQ4A 2Y06H 4PJEB 1QI3A 3UPAA 4P2QA 4JO4H 4AG4L 3IJ9A 1F4YH 1KCLA 2WCGA 5EMYA 1IT0A 2X2JA 1MJUH 1G0XA 3QZWA 5SWSA 1S5HB 3BKJH 3QHOA 1MREH 4NC1E 4S11A 4U1MA 3WH7A 3MRHB 5AYUH 1JGLH 1UVQB 4HK3N 1IKFH 4BFGA 4HUUB 3MGOB 43CAA 1JNNH 1T22B 4OZHE 4LX4A 3REVA 4RBPK 4JFDD 2WZPD 1NUNB 1F00I 1VACB 1CFVH 2R69L 4HJ0C 1W3KA 1B3YA 1K8IB 1NFKA 2GFTA 4S1DD 3CVHA 3DX7B 4JFYB 2V5CA 4BUGA 2YK1L 3TFKC 2WIIA 1ZGLM 5FOBA 2NY4C 3CV5A 3QFJA 2X89A 4OZIA 1E0XA 1N6QL 3NCJH 4PJ7E 4GAJL 5IBUG 5IHZB 4JPVL 2ICES 4PJIE 2JIXB 2OL3B 4X4XA 3BW9A 1W8NA 2HJLB 5CP7B 2D7TL 1Q72L 1CL7H 1ZB5A 3CU7A 3BD4A 2WCAA 1KCVL 2JLLA 2BZDA 3RM4A 1RK1B 2J77A 3L3GB 3CUIA 2VDRH 2A77L 2R1XB 3PF2A 5DEFB 1NC2A 3HFMH 5FF6A 4ZPVB 4Z7WE 2HT4D 1BFNA 4P8UA 1PYWA 4AH2B 2A6DB 4I48A 1IC1A 1H3GA 3JWDL 2X7LA 3MBEB 3U6RA 4K94L 4UT7H 4XC1L 1X7QB 5FO9B 5TPWL 3EYQD 2YD8A 3DC0A 4E4PA 3EBAA 3KPRA 4OB5L 4JPKH 4U5KA 2BVTA 4PCSA 4KUCD 1XFPA 1E4KC 1JK8B 3H8NA 5ESVB 3LMYA 4L3EB 3KE0A 2NLJB 4I77L 4NJAL 1KNOA 5JW4Q 1H8NA 3PTQA 4ZSOB 2Q6WA 3L3IB 4H25A 5CSGA 5DJ0A 2B0SL 5DZNA 3ZDZF 5HTSA 3IAQA 3EOBB 1EXPA 4HFUH 3DETD 4KZEH 3S4SB 2CK0H 2YSSA 5F3BA 1Q0XH 4R90L 1MHPL 1YN7B 4ZUVB 5T5NG 2IANE 5DJ6B 2AK4D 4S0TD 4ODVH 3SO3C 4HOWA 4G5ZL 2HRLA 1DBJH