1PEZA

Bacillus circulans strain 251 mutant a230v
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
686
structure length
686
Chain Sequence
APDTSSSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDVVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTATWEGGSNHTFTAPSSGTGTINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conversion of Cyclodextrin Glycosyltransferase into a Starch Hydrolase by Directed Evolution: The Role of Alanine 230 in Acceptor Subsite +1
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
molecule keywords Cyclomaltodextrin glucanotransferase
total genus 241
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pezA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pezA01
4IS6B 4UILH 4M5YL 1I3GH 3S36H 1PG7L 4ODSL 1RJZB 2WBJB 1YY8A 1KGCE 1G0XA 3U0WL 4NKOA 3WD5L 4NKDA 4U1NB 4Q9QL 3EYFB 4DUVA 4TUJA 2D20A 3WEOA 2O9PA 3BKYH 3NZ8A 4OJFH 4UU9B 5BRQA 4EEEA 2ED8A 5JIWA 1BVLB 1QR4A 5D1QB 4OIFA 1JDAA 2C4FU 2C1PA 4JZOB 1FNAA 1WT5C 4P3CH 3P9WB 4OV6F 1E43A 1GGIH 2GAZB 3HR6A 4IOFC 3L6FB 3L9RB 2B2XH 3KLLA 2C5DC 1KR0A 4G9FE 4OIBA 1GIGL 4I2XA 3S2CA 1HKLL 1MUJA 2X4SB 4MNQA 1BLNA 1SZNA 1OGBA 2AK1L 2N1KA 3GJEA 4CD7A 3M07A 3D87B 2X4RB 3K80A 4YHYC 3U2SA 4MDJB 3GIZL 5C2BH 1EVUA 4OD1H 4BCEA 3N0PB 1N5YL 5FF6A 4B50A 2HMIC 3CZGA 1MAMH 4NQDB 5D2LF 1ROWA 4IBLT 1IL1A 5E6IB 4D6CA 1M05B 3O9WD 1TZGL 5E2TL 2XUCA 5C0BB 4J3XA 1NC2A 5LCVL 3U79A 1M71A 3C5JA 3MTRA 4O02L 2F8QA 4I2XE 2X1OA 5CJQH 3HCVB 4DKEL 2R2CA 1W91A 3MRPA 3WQVA 4TVSa 1CL7I 1MCJA 4GRMA 5CJBA 2C1OB 2EKJA 4R90H 1E1EA 2R56H 1BGGA 1ISVA 2Z0BA 2Q1EA 5DJ6A 3CCHA 4RAUB 1HDMB 5ICZA 1V0KA 1SEQL 2X9WA 2ZCLL 1FZMA 5SX4H 4RAUA 5ICZB 4ODTH 2JB6B 4H20H 2VOTA 2EPLX 3AIWA 3UYOD 3EDJA 3OJVC 2DS4A 1H5BA 2MCG1 4G8EA 2H26A 4HHAA 1XR9B 3L2MA 4XC1H 4OM1H 1IAII 3K8KA 1M71B 3C5JB 3BESR 1JK8A 1DL7L 1H09A 3GMOA 3RFZC 4HLJA 3PL6B 1RIHL 4JDZB 1HYSD 2A6KA 7A3HA 2VAJA 3J7HA 2J77A 2VL4A 5CUSH 1DP0A 1YECH 3ORJA 4MMXC 2NY6D 1FZMB 1CXEA 5E5UB 5FYLL 4LCYB 2DQHL 4OI9A 2NX5A 3Q6FB 5FHAH 1U8HB 1T04A 3VFSA 3RILA 1SYVA 5I1HL 1T1YA 1AE6H 2R0KH 2HA1A 5FCZA 3TCLA 5HVHB 5GZND 1A9BB 2AAAA 3JV0A 1T5WA 4DAGL 4XCCH 1RZIB 3CZLA 1H15B 3MBXH 3T0EC 2Q76A 5HHNA 2WP3O 3ZE2E 1S5IL 1SVCP 1HWWA 5I24A 4G7VH 4ZYKB 4I1NB 1Y6KR 3V8CA 3G04B 4OD2A 5C07B 3VXPB 1R3KB 3ARVA 4YHLL 1WFUA 4WW2F 2QSTA 2AJ3B 1MF2H 1UB6B 2JK5A 2MQCA 4R8WH 4GUPA 4LK4A 2WZHA 4JGJA 4D6IA 3TVMC 1XH2A 4FZ8L 1T7XA 1DEEB 5D8JL 5IR1A 1VFFA 2HWZL 3VXTA 4F37F 1IT0A 5TGBB 1H4PA 4LEOA 1AJ7L 2ENYA 1U3JA 3DX1A 5C8BB 4TXEA 1D9KA 3MRBA 4Z7UF 3MO1A 4V27A 2RAMA 4NC0B 4D9LL 3CZFA 1KTDB 3ISWA 3NOIA 4XAKE 1G9ML 1MCSA 2DTMH 3TN0C 1RUML 3ZQ9A 5GRJL 4J6RH 1NMAL 2FRGP 4FFWD 4JLRA 5L0QC 1IEBB 4L4PA 1M6OA 1RFDL 1J1XH 4MCZB 2DDQH 3NCCB 3HZ3A 1DN0A 2I9TB 3DTXB 2CR6A 2UZIH 2W0FB 2QL1A 1QA9B 1U8QB 4JPVH 4LYRA 4TOQA 3DV4A 5C3LD 1S7UA 3V4VL 3VOCA 1IILE 1EA9C 1FZOA 1WAAA 4ZUTB 3E2HB 4UNVA 4U1MB 2F5AH 5DVOA 2X70B 3LN5B 1CWYA 5BV7H 3NCFB 4ZAKA 3IU4L 3P11L 5J6HA 4NBYB 3HLAB 3IFNH 1EDQA 4J3OC 8FABA 4NRRA 3C6LB 4FLSA 4D6GA 5EORL 3I6KA 4HZLA 3RKDC 1BF8A 4PYSA 1K4CB 4A2MA 5FDYA 3EJPA 1W2PA 4P99A 4JVPA 3D4ZA 3QUMA 4AZ5A 1X5IA 4O58L 2EDOA 3THMH 2GUOA 1ADQH 4W89A 5EU7E 3VIFA 1MRFH 1AQDA 1OT2A 3VFWB 3ARBB 5CGYD 1BAGA 1MHPH 4HS3B 1RPQA 5ETUA 4Y19D 5EC2A 1AGFB 4QXTA 5IG7A 3RKPA 3N1MC 5IQ9B 1KPUA 4LPUA 4YWGH 2F58L 2WANA 3QIWA 5E6ID 5FECA 1ZE3C 4RIRA 4OZGA 4X7TB 3WBDA 4QY8B 2V7NA 1RP9A 4HWEH 3ARFA 2GK0B 4XX6A 4X6CF 3KWXA 2FYYB 2PB1A 1Q9LB 1CDHA 1K4DB 2E7HA 4S1DC 1BM3L 1FSKC 3OBAA 1QLFA 5FHBH 4QT5A 3RVWD 1MREH 1X7QB 4P9HH 1CLYH 5I16A 4OZ4B 2PWGA 3QSKB 1G9MC 3O6LH 3EDFA 1E55A 5FECB 1WZMA 2NY1D 1EBPA 2JIXB 5BZDB 3UZVB 3T0VA 4MNMA 4E41A 4U7SA 1UT9A 4BSJA 2H2PC 4KJYB 4K7FB 4NFDA 4Z5RA 2EE6A 1DWFM 3CDCA 3L7EB 4PJCE 1WF5A 4Y4HC 4J12A 5DC0A 3PHSA 5FV2A 1NBZB 1HHIA 3DSFL 5D72L 3SKOB 4GG6F 1JXJA 3V6FB 1KXVC 1WBZA 1F97A 5JQ6H 1T89C 2V9QA 4IRJD 3QXAB 1CU4H 4KFZC 2XA8L 2WW8A 1U95B 1A6VH 1QFUH 4PJ5E 2AKRA 4HC1L 4XGZA 2ZG3A 3PHOA 4N0YH 5EBMA 3U5YA 4Q9CA 1NEUA 5BQ7B 3TJHC 3T3ME 1VENA 1QX1A 4LSTL 3GSOA 2DT2A 1BD2A 1CICC 2HJKA 1YEIL 4RRPA 2RCSL 4ZUWA 5KTEL 1IGMH 5C09B 4ZS7L 5GGUA 1NGXA 3RBGA 3D39A 3QEUB 5F3BA 3MV8E 5FYKD 4QRQB 5CEZL 1NCNA 1ZTXH 5IHZB 1YC8A 3C5SA 2YZ1A 1HI6B 4L8SB 5IBUG 3IGUA 5D7JD 1K3ZA 3SPVA 2AKRB 4QCIA 5AYUL 1X5HA 4H5SA 3G5XA 5H35B 4DW2H 3VNZA 1FH8A 1P4BH 3FFDB 1NGYA 5T1LD 1UM5H 2K1MA 5DYOB 4OIAA 3ULUH 4D0BB 3DI2B 4X98B 3NFNB 1XD0A 3ZDZF 3LDBC 2DD8H 2MHAA 1Z3GL 1P69B 5IFJA 1Q9WA 3QPXL 1I1YB 5IB3A 2JCCE 3B83A 4QHLA 1IEAA 3IGAA 4RGOL 4JJ5A 1ZHNB 3MACH 2QPSA 3VH8B 2ITCA 2DM4A 1H0IA 5JO5A 1QRND 1HI6A 3D52A 2P5ED 15C8H 3IS1X 4JQIH 5A2BA 1S8DA 1A7QL 2B0SH 5IP4A 4QHNA 5BWFA 1F11A 3MC0A 4QLKA 3P73A 2VLKB 4JZJC 4P2RE 5IFTA 3QG6B 2PI6A 1ODUA 4WJXA 4XPAH 3MRLA 3T77A 4C57C 2OK0H 1WZKA 5GS1A 1X5KA 1UQSA 4APQD 4A6YB 1A7OH 4KRNA 3GNRA 1HK6A 5DT5A 1MPAL 1MI5D 3AHVA 1RJYA 3KYMB 3VD9A 1O5DT 1UD3A 1JN6A 5I79A 3V7AG 1HHGA 3OKNA 2O92A 2KDGA 5IG7B 2F53A 3V2AR 3I2CH 1G7MB 1JHKH 3QIWB 4NP4L 1ZKAA 4ZUSB 3JWNC 4M8VA 5ID1B 1NWUA 5I9QB 3SKOA 4WFFE 4ZS6D 4I18A 3GXFA 3FOMB 3H53A 4YGVB 2HMID 3FONA 4UDUA 5I30L 3ZM8A 4M7KH 2E0PA 3GBNH 3LZFH 1W72B 1S46A 1E4NA 1CWVA 4LLUA 5ERWB 1K4DA 3K2MC 1MW3A 2VN4A 2WSPA 1LF1A 2VC2H 5FGCE 4HUNB 3ZE0F 3L3OB 3UPRB 4PMNA 1Y0LB 2WV3A 4TUOB 5HJ3A 4X80L 3V52L 4LCCC 5HBBA 3PZGA 4LHUG 5TDPA 2CLZA 3LQZA 1OTSC 4PP2A 4WU7A 1M7DB 1X9QA 1UR2A 3EOAB 3MR9B 2G60L 1DFBL 2FHFA 2D4FA 4H20L 4CNIB 1RSFA 3QDMA 1YC7A 3EO0A 5IM7B 4WTZG 3RTQB 3QIBA 2LTQC 3UTTB 3KYAA 5CEXB 1N59B 2R9HC 1JFHA 1QSVA 1OD9A 3VXRE 4W8BA 4FOMA 1NGZB 3NAAH 1YQ2A 3PV6A 2BX5A 3PHQB 1CLVA 2YUVA 1TZHA 5CP3H 3VXSB 5HHPA 1IMHC 1UOKA 1GOGA 3MZTA 2QQKL 4NJ9L 3LPPA 3VWKA 2X1PA 1F4YH 1VGKA 3DHPA 5DA0B 4PTXA 5I1DB 2F74B 1RH9A 5SX5H 2ICWJ 2J7LA 4DO6A 4YDLC 2D22A 1Q9KB 4XX1E 3TV3L 1NWSA 3PGCA 2Z8WC 4L3CA 3SDXE 4NKDB 4U1NA 4YQXH 5IHBA 3WL1A 1YYLL 3C08H 4PSRA 1A1MB 4JHZA 4K3GA 4B3KA 2QQLL 4P46C 1XH3B 4D0DA 2FJFB 1MOEA 8FABB 1PLGL 1CR9H 5GRYA 1BIHA 2BOCB 3VXQB 3CUPA 2RFXA 3QUZA 4WHTB 2DSWA 2PYEB 4XNXL 1WP6A 4JDVA 1GGBL 2B5IC 2F15A 2EYRA 3C5SB 3QXAA 5FYJL 1LL7A 4LPCA 4PJ9D 4F9PA 3O6MH 4MJID 2NXZD 4BFBD 4MNKA 5FYKH 1HIMH 4HZ6A 3DX9B 4N90D 1JXKA 1XRVA 4MJIE 1IAIH 5ABGA 3A24A 4LEOB 5D8JH 3C2AL 2JCCF 3JVGA 1QFOA 1TVBB 3BWAB 1E4XL 4WEMB 3D85A 5T1KD 4BK4A 2E7LA 2HJLB 3CPUA 1CFBA 4PUBL 4KK8D 4YHML 1MFEL 1JIBA 3SQOH 2CHNA 3TN0D 3OKEA 3ZDXE 4GPNA 1QI2A 1OSZA 1PQZB 5JORB 5D7JC 4MZ2A 3DMMC 4WWKA 4PJBA 1MHEA 3IS0X 1E6PA 3CXHK 1YNLL 2YXFA 1D6VL 2D0GA 5BZDA 4S10A 3MMUA 4GQRA 1JRHL 2NX5B 3A6CH 3UJJH 3WIIL 4OLEA 1IEHA 1D2KA 5CHNB 2VXUH 5SV3A 3BVVA 3T08A 3W9DB 3H7LA 4H25A 4JANB 1BQCA 5IT2L 5DD6A 3TJEL 4TX6A 3F5WB 3U6RB 1P7QA 2XRAL 2P8PB 3L1OL 4JQVA 3U4EB 2GTWA 2XTJE 4HWBL 1MFBH 3OAYK 3PWVA 4PJEE 5BV7L 5HYJE 1LJYA 1CD8A 1Z9SA 2OJEB 4WFHE 3SEPA 4YFLF 1RURL 3DBXA 1I7ZA 2IMNA 5HVGB 1NFDF 1JUFA 4AZ8A 1KT2A 2LABA 2EPNA 2Z8VC 1VFAA 1C7SA 1S3KL 2DQTL 3CDYA 3QI9B 4I0KA 4LLQA 1UQYA 5JIIA 3G08B 3QAZC 2UWEE 3RWHB 4LHQB 3OKNB 4OLXL 3RWHA 4YNYA 1JWMA 1L7TL 4WI6A 2NXYC 3C60B 5AUMA 2FR4A 1W9DM 4XWGL 1HDMA 3WQ5A 3MJ7A 2I5YL 1XT5A 5LBSH 4EN3B 1BOGB 2R0LH 5B39A 5A3HA 5ISZA 5FKPB 5AWNL 1FAIL 4L9LA 3EUUA 2DH3A 4NWTH 1AQKH 1MNUH 2CK2A 3CX5J 3MNVA 2PR4L 2R4RL 2Y07L 2FDMA 3RJDA 3RWCA 1HQ4B 4B15A 2DTSA 3HI6L 4S1DD 1D5IH 2KPNA 3K2UL 4YC2C 3ARPA 1D5XA 3RWDA 5F7HA 1LE9A 4UOZA 1XIWD 1OSPL 2Y2WA 2RB8A 4HKZA 4HH8A 5IFAH 2NY3B 3K1DA 4O4YL 1OTUC 3WD5H 4XBPB 4R4FL 1ACYH 1YEKL 1ERNA 4P5TD 5K9KB 4XTRD 5IVXB 3V5HB 3GHEL 5TF0A 4F7EB 1NBVH 5BVJB 2DMKA 3QEGL 2VDMH 1Q72L 2VLKA 3EAKA 2Z9TA 5GGSB 1XGTB 1KPVA 5INCB 3CUPB 2ARJQ 3KS0J 4WHCA 3EYSH 2XN1A 5H8DA 5DFWH 2YPLB 2X5PA 1R3KA 3EJSA 5EO0A 2OTUA 3HPJA 4LKXA 3VMOA 1N26A 3VKKA 1G6VK 3H3KA 3RVUD 4KUZH 2ICWB 1RP8A 2Q3ZA 4FQCL 4M82A 1YPZF 1IFHH 5KVDL 5L6YH 5JR1L 3HNSL 3QT2A 4HJ0C 4LLAA 2BNQD 3QCVH 3QZWA 3G9AB 3CFKA 3LQAC 3OG6B 4Q0XL 2AK4E 4HGWB 4BYHA 4G43B 5DT7A 1HWHB 3IDNA 4N5ED 4NBXB 5AYIA 1I9EA 1XGRA 2BMKA 3LKSA 3VXMD 2IG2H 1LD9A 1V7ML 1HKMA 3N50A 2PYFA 5JXEC 2VDNL 1UVQA 5E7FA 1QSFA 1TA3A 2VX7A 5CEZH 4JDVB 1XIWB 4R0LA 1U93A 2CK0H 5FXCH 1N0XL 1QFWH 1T2QL 4TUKL 5L2JB 3LXBA 2JF6A 1NL0L 2ADGA 1WAAF 4KRPB 3GH7A 3BGMB 1GQLA 4PJ9C 4ZTOH 4KJPC 3UZEA 1X5FA 2G3IA 4ZS6C 1BQHG 1QTYT 5EU7C 1KJ2A 2NXZC 3ZO0A 1OM3L 3ZDYF 3WEXB 5JDSA 4AZHA 4AYFA 2ADFH 1KG0A 1IC4H 2WAHA 3C60D 3KLDA 4IOIA 5HDQL 1W0WA 3MACL 2E9MA 1FFNB 3F7YB 1CG9B 1P4LB 4Z9KB 4DGYH 1PX3A 1NGZA 2PW1A 4PY8I 3T04D 4DGVH 5HSFA 1HHIB 3IDXL 2JALA 4LCUB 1RZJL 4H88H 3DROB 2X1XR 4OTXH 5ADOL 3VIKA 5GS0H 1PGRB 1L0XA 1WGOA 4KWUA 4QKXB 5GJSH 1ZA3A 3X14A 4KXZI 1WCBB 3DC0A 1OTSD 1TQBC 2VQ1A 5IK3B 4AL8H 5DS8B 4QF1A 2AEQH 2NTFA 4IRJA 1KTBA 1MAML 5DUMH 4G6FB 1DLFL 5CHNA 3KPSD 4C56D 5I1HH 3QUXB 1EGJH 5LKNA 5C1MB 3GSNL 3RJXA 4MXVF 3OAYH 2OW6A 3ZHKA 2OM5A 4QRPD 4L8CA 4GKSB 5GRUH 4APQB 2H9GA 2WM0A 2PKDA 3GXNA 4H8VA 1FDLL 2WWMD 4N68A 3BPLC 1MHHA 4DEPC 2BVPA 4KZDL 3PJSB 1KTLB 4LSSH 4NRYB 5DJXB 5SWSB 2GKIA 1JL8A 4BZ1H 2X1WL 2IH1B 4NRZB 1CYGA 1DDHB 4Y19A 2EXYD 2V2XB 3LEXB 1LNUA 1KCSH 3H9ZA 3MV9E 2VC2L 1RUKH 2B4CH 4OZGE 5HYQB 1WIUA 4AD4A 4L4TE 3DXAE 3RL1B 3W39B 1NEZB 2DMCA 3AM8C 3E2HC 3TONA 1B0GA 1F4XL 5DUBB 3TP4A 3ZOAA 1ZSDA 3M17B 4GRLB 5M03A 3BPOB 5ESVA 4LP4A 3VE0B 4FK9A 1BQLL 1AJ7H 5HI4C 2GITA 4ZG1A 1JGVL 1U91A 2YDSA 4P48A 2X42A 4H8HA 1QSEE 1W1YA 5F7FA 4W8AA 1KCUL 2DKMA 3FO0L 2WINB 3QCTH 2XKSA 4MGXA 3ZMRA 1HWGB 1LK3L 1H3PL 3BAEL 2DAVA 3F8UB 4WCYL 4RMRA 1BBDH 2P5EA 2R2HB 2P5EB 3H9HB 4HX1A 4ZPVB 1NGWA 4L5FL 4XZUB 5A40E 4XMPL 4JB9L 5ALCH 1MCKA 2PYED 5EULV 1NCBH 2PO6A 4Y0GA 3U5UA 3MNZA 2Q8XA 2EDKA 4NGHH 2B39A 2CR3A 1KGXA 1KJ2H 3FQWA 4L8DA 4LGSB 25C8L 3IJYB 1RZKL 1A4JA 1WE5A 3WF4A 3MRIA 1H5BC 4HIJA 4QTHB 4WI3A 1H0DA 1JCKA 1CFQA 3DXAD 1TQWA 4QTHA 5CD5C 4S1RL 4WHTA 3PZTA 2AJUH 4M6MH 2G41A 3QH3B 5DLML 1QI5A 3POCA 4U5KA 1OTTD 5DZNA 4YZFE 3S6CA 2AJSL 3VXUE 2E8ZA 3L2LA 4KQ4L 2IAMC 4XCYA 5F9AC 4LHUA 3VXSD 5C0IB 5JXAL 4QTIH 4HIXH 5CWSA 3MNZB 3BVWA 4GW5B 4Z7OF 2J6EL 2WHMA 1SMOA 3UC0H 3TNNA 2A74A 1BQHA 4X6CE 1Z9MA 4UMGA 3GHBL 3VRLF 2OWCA 3HNTL 4U1IA 3ULUD 2JIXD 3RVXD 2CLZB 1QBLH 3FCTB 3QUYD 2QPUA 3N12A 2FGWH 1JNHA 4U6TA 1G6RL 4X8JB 4GXVH 4JM4L 5DMIH 1GNXA 3P0YH 1WV7T 4AMCA 1I7RB 4ODVH 1E28A 3M45A 2ZUUA 1E4XH 2EEDA 2QEJA 5DJYB 2YRPA 2J8UF 3MRCA 4CCCA 5DJXA 3RTQA 5BVJA 5KW9L 3CVHL 3VFOA 4MLSA 3BUQA 1D3CA 3BD5A 4M61A 3ZIZA 5K9QG 5CS7A 2XA3A 4CD8A 3L7EA 2OSLB 5KBNC 2ZJSL 3RM8A 3IU4H 4IJ3C 1E4MM 3MU7A 3QB7C 2EPKX 4F9LA 1GOHA 5JW4N 2I07B 1ZT1B 1GOOA 5DWUH 1RHHA 5EUOA 1RU9H 4RMQA 4GMSH 32C2B 2Y72A 5IEKB 4KJPD 1D9KC 3HAEB 1MFAH 5KSUA 3SCWA 2C3WA 3ULVL 1PG7W 2OSWA 3T2OA 3BC9A 1UXSA 1MFBL 4LCIH 3DETD 4UFIA 3VGHA 3QQ4B 5DEFA 1T1ZB 3RZCB 1G9NL 1AMYA 4PBWD 4A4AA 3MGTA 4EOWH 1KBBA 1UH3A 2GY5A 1F00I 3BAIA 2XA8H 1AXTL 5DTFB 1FYTB 4NO0A 3ALFA 3PWLA 1CGSH 2WB5A 4ML4A 4ZE4A 4TTDC 3PTKA 2KL6A 1T0NA 5EU3B 3TEUA 3CZSA 3MRDA 2KKQA 2JJSA 3SDCB 4JHOA 4R8WL 2QMJA 4F7PB 5LQBL 1FYHB 1ZGLM 3EDDA 5C0BD 3S35H 3THDA 3KWWA 1FLRL 4NQDD 4WO4A 2NXYD 4HJGA 2YD3A 2GFTA 1MJJB 1IC5H 2HWZH 2JEPA 4CUCA 4XNUH 4XRCB 3DUSB 3I3BA 2PWFA 1NDGB 3AFLA 4BSWB 2FCBA 2VRKA 4PJEA 2C3VB 4EDXA 2X9YA 1CGTA 1JGUL 2DQEH 3WNKA 1UKOA 4F33A 2PETA 1FPTH 3MRJB 4FNPA 5B39G 1A3LH 3L4YA 2EZ0C 1P53A 4I5BB 4JHWH 2PW2B 3BJ91 1GPFA 4P57B 4P5TB 2W66A 3WD1A 5BV7C 1C93A 5C6WH 3OHXA 1KGUA 1FL6A 3FZUC 1G1YA 4N0CD 4UDTB 2VAAB 4UT6L 1SM3H 1YEEL 5EU5B 1B0RA 4Z78B 3L4UA 3VIJA 2BSSB 4NZJA 5D1ZA 1H3TA 3MSPA 2P48B 2IGFH 5MENA 4PSPA 3W11D 2WP3T 4QEGA 1U8NA 4HK0A 4PP1C 3VIHA 2GVYA 1YEFH 5KANG 1B0WA 1BJMA 3P30L 5E2VH 2NZ9C 4QOKB 3R0MA 2WW5A 1E4WH 4HUKB 1EBAA 3OHXB 4H1LG 4EE9A 3NCOA 4OGXH 5E2TH 1CD9B 1B3WA 4BELD 4IRZL 4JFQB 3RUGA 3GSXB 4E2OA 3RL1A 3IXAB 4HJ0D 2IFFH 1CDIA 3RHWK 3CFBB 1HXMA 3D9AH 2GT9B 3Q2CA 3LIZL 5HOSA 3EHBD 2DQFA 1Z5LA 4PLOB 3OAUL 2AXFB 4MTVA 2H2SC 4BQCA 4YJZL 4JKPH 1JPSH 4KROD 5E94B 5A6MA 1MJUH 2HN7A 4YHKL 3VXMA 5EBWB 4BQ8A 2ERJB 4XCNB 3SO5A 3TTSA 5HGBB 1RJLB 3ET9F 1QBMH 2EYSB 5CIPH 1J86A 5EZIL 1HHJB 4PRBB 1RULH 2IPKA 1XR9A 3FTGA 3MUIA 1UKSA 1IGIL 1KIRB 5FHBL 3B5GA 4HKZB 5FO9B 2P45B 5DMJB 5J8OA 4YNYB 4RFOL 4AIUA 3CC1A 1TJIH 4DZ8A 1LP9B 3FOLB 3SDDD 4X4XA 3VDBA 4QRSA 2APXA 4UTAH 4XXCC 2AAVA 2CKRA 4Q9QH 5IF0A 1V6VA 4HKJA 3WH9A 4AD0A 4JM2C 2VDQH 1M1SA 1UGNA 2BCKA 3CHFA 4S11A 1Q6DA 4XHJD 3RX8A 5HGBA 1H3UA 4CRPA 2R4SL 2YDQA 1TJGH 1AXIB 2OW7A 3CDGB 3QNYA 1HH9B 5DDHB 2PYEE 4OD3L 2J4WH 5FM8A 4FNTA 1BF2A 3H9SA 4JFHE 1WCQA 1IJ9A 2NTFB 4LPVA 2AVGA 3BCFA 2WMPA 3S37H 1GZQA 2GY7B 4M7KL 1RJYB 3KYMA 2X8RA 3IFPB 3MJ9A 3OKDA 1NCAL 1YNTB 1NGQH 2NNAB 3DOSA 4NQXB 3LKOA 5T3XL 4MWFA 4HP5A 1U2HA 1HJVA 3D69B 1C08A 4D1JA 3DMMA 1JGEA 3CZKA 1QPXA 2A77H 2JFEX 1FDLH 2QADC 5I8OL 3B2VL 1BJ8A 1CFNB 1UJTA 3PZOA 4UT9L 1T0MB 2ARJA 3LS4L 3QFDB 4UILL 5HI3D 4AZGA 2CDFA 4OOUA 1JPGA 3DETC 2EDTA 3VFUA 4ZO6A 4DFHA 5FEBA 4BM7A 1OD7A 3AREB 4K7PX 3FTGB 4X9FA 4JREB 4Z7WE 4WJ5B 1AO7A 5LGKA 1N7MH 3L3IA 3L95A 1CLOL 1G0YR 3C2AH 1UM5L 4MXQC 2ITDA 1G6RA 5GHWL 1HXKA 4KTDL 1QWNA 4PJ5A 3L4VA 1XH1A 1FVCA 5B38G 4ODTL 4JPVL 1B4RA 5DJYA 2V9RA 4X9YA 2BFGA 1J18A 3MROB 2D7MA 3A6OA 4YBQC 3VDCA 1QLRA 2HLAB 2Y23A 3BAXA 3A4XA 2P47B 3TT1L 2JE8A 3IDMA 3OLEA 5A6SA 1GCFA 4X5WA 1Q6EA 3P11H 1PZ2A 2ZXBA 1OAKH 1T80A 2VRAA 3LB6C 4JO1H 4AXNA 3AHYA 3AAZA 5BVPL 3QAZB 4QOKA 1RZIA 5FL0A 4OJYA 4JHBA 1RUPL 3ECBA 4NQCE 3LH2L 4GRWB 3TC9A 5IHUL 4W4OC 4JB9H 2XY2A 4K94H 2O93L 1Q0YH 1Q9KA 3LN9A 4I77H 4Q9BA 1MCPL 4ISVB 5TFSH 1L0QA 3QDGB 3HRPA 1NFKA 1CXLA 1PW3A 2J8GA 4L8BB 1F90L 5F6IC 2D7PA 4RE4A 4Z78A 5AC4A 1HXYA 3FQTB 3KPOB 1CFQB 5J12C 4JO3L 4XCCL 2Z4QB 2IADA 1A4KA 5IJKC 2QHLA 2FX8L 2L0DA 4CVWA 1OTTC 2Q76B 4L4JA 4YC2B 3WD3A 2BJML 3MJGX 4FP8H 4F8XA 4JN2A 3VIMA 4MQXD 5I1AA 5ABFB 2P8LA 2J8OA 1JJUA 4PJEF 3BEVA 5I1IH 1XGPB 4AIZA 5B21A 3V79C 4WFFD 1ZLUH 2YL5A 4FG6D 1BHGA 3W39A 3L4TA 1FNLA 2X4QA 1XGZA 3OJMB 2QSVA 1QOXA 1KIRA 5E4EC 1B31A 1U8OB 1X1NA 1FGVH 2W91A 2XFXA 1CLYL 3WLWD 1FL3A 2C1OA 2V3EA 3SCTA 4XPTL 4MAYB 1IZJA 4XRCA 5AWNH 1OQOA 3P9LA 3WN5B 4EN3C 3AHTA 4HKBB 3IVKB 4P8XA 1X5LA 4WFEE 1TR1A 3EYPA 4NOBA 4V1DD 4LFHG 3DX6B 3X13B 5A6JA 4M61B 4PJ7B 4WF7A 3DRTB 3OZOA 2ZCHL 2FATL 2P7TA 2H1PL 2V38A 4OZHA 4KROC 4JPIA 1WWAX 1BG9A 5J0BA 5MERB 1AE6L 4APQC 3LAFA 1KBKA 1F11B 1G7PB 1PD6A 1RZFL 2HG5A 3H9SB 4FQLH 4WI4A 3TYGH 3INUL 4DOHB 5JXEA 1UCTA 1DVFB 4PLKD 4X6FA 1OF2A 4MB3A 1JD9A 4JR9H 2BNUB 4DN4H 1RVFH 5GS1B 3DECA 4C54A 3VI3F 1FG2A 3JVGC 2ZUXA 1K6QL 3BP5B 3WIFB 3MX0A 2BNRE 4YH6A 3WIFA 1W0YT 3QEGH 3W25A 2FJGA 5F89B 2H9GB 1GQKA 1DBMH 3AI0A 5D4YA 4OUUB 3T2QA 3KYOA 4RQQA 1B2YA 1AH1A 4HA1A 4PGDA 4XHJC 5F1NA 5IIEA 1VF8A 1FORL 1V6XA 3O2VL 5D7JA 3SY0A 2R1XB 3VX1A 4MLIA 2F2HA 3SCNA 2V5MA 2F7RA 4E8CA 3FZUD 4L1HA 5T3ZD 3TFKD 5C0DB 3PP4H 2PF6A 1U9KA 1YYML 2RGLA 1EPFA 5IMLB 2QTEA 3V6BR 2OTWA 3SHSA 3W11C 4ONFH 1HZHH 1DQJB 2W60A 2LU4A 2L7UA 3D3VA 5LXGH 4H0HB 1Z5LB 1ZBVA 3PP3K 5CP7B 5JW4Q 4NN6C 5D2LA 2P5WB 4PGBA 5JUEH 3PF2A 2E9IA 3EMCA 4JFXB 3RCNA 4U1GC 1JF1A 2R1YB 4M7ZC 4JRYA 4QHLB 4ZXBD 4LMQI 4W6WB 5D2NA 4BSVB 4KC3B 3S37X 1ZA6B 1KPRA 4PRAB 5D7SH 1P9MA 2ED7A 1ZA6A 2XZQL 4QXGL 5E4IA 3WH6A 4GKNB 3NCYS 1FE8L 3ZJKA 4R3SA 1IEBA 3VGAC 1JZ8A 1XCQA 4FHBD 1IC4L 3SDAC 1UCBL 3LKQB 2WWKT 1LILA 5C0ND 1QBBA 3KPSE 4HFUH 4KMQA 4QNPE 3MROA 3MRIB 5LGHL 4ACZB 1EFXB 1S7TB 2H32B 4RMSA 5E9DE 3OZ9L 1SFSA 5AY7A 5BV7B 3MXVH 3QQ4A 5DEFB 1X6NA 3DV6A 4P4RA 4B0MM 2BSED 3RZCA 1DCLA 1BEYH 2IH3B 1QI3A 2EDNA 3UP1A 3O4LB 3GSWB 3ZL4H 2CBIA 2J7HA 3AAZB 4OOZA 1DWAM 4FF5A 4JFDD 4I8DA 3IKCA 1YUHA 2FX9L 2V2WB 3I9GH 4QXUL 3THCA 3ARFB 2OP4H 4WU5B 2XYCA 4NNXA 5B8CC 5I6XB 5J13C 5MP6L 4AZ7A 1SEBA 1QP1A 5IV2B 4P2OC 1H3XA 3OR6A 2VERN 1SJVA 5EOCL 5I1EH 2ICEB 4QT5B 4Y19B 2OWXA 1JHLL 1IM3A 3D3VB 2VKXA 4MNLA 3ZR5A 5E0QA 1HYSC 4PJCB 2ESVD 4RGMC 1N6VA 2EDHA 1QZ1A 2DLTA 5F7NC 5GS2D 1G7LB 4PJCA 1I8MB 4ZO9A 1H49A 4W84A 2H2SD 3KPLB 4D6EA 1V5JA 1U92B 1AR2A 4MQSB 4QY8A 3EOAA 4ZO8A 4JVUA 4L29A 2I60L 5GNYA 3DMMD 3W6MA 2DIEA 5DXWA 2A6IB 3L7FA 5E99H 3GH4A 5FA3A 3VRIB 3DUUA 5F7WC 4G8IA 2K9UA 5FKYA 4H1LB 4TVUA 4U3AA 3LEVH 1G7PA 1EVTC 5CINL 4GH7B 4BQ2A 3WUFA 1C92A 1A3QA 5SWSD 1BFOA 1NUGA 4MNHA 4FFZH 4Z0XA 4W7WA 4LDEB 5BXFA 1IGYB 3MI6A 2F54E 1F45A 2VCBA 3MRLB 4K9EC 1A1NB 4MAYA 4Q6IA 3T77B 3WN5A 1S9WB 2E7CA 3GI9L 2X1IA 4UTAL 4FNLH 1KJMB 3M6DA 3SCVA 4FZEL 4GKOA 3FO9B 4HKXB 4RMTA 4OZIF 3UJTH 1A7RH 4LAQH 5BRZB 3TVMD 2ADIA 2A83B 2HFEB 3AY4C 3E3QC 3VRIA 1JP5A 3FQUB 4X5LA 3RVVD 2RCSH 4P2RD 1C8YA 4XPAL 1UR4A 3QEQB 1KB5A 4ZS7H 5E8OA 3UMTA 3SE3C 2YJQA 2YD8A 4URTB 3BQUB 5FOBA 1PFCA 1A7OL 3BEVB 2ZX5A 4PY7B 1X5AA 4N5UA 3ULUE 3ARRA 2C0HA 5FUZL 4PJGB 2VISA 1PY4A 4DCQA 4TULL 1V08A 4FTVE 4JLRB 4M6ML 4JFYA 4F9LC 1BQSA 1QR1A 4OZIA 1ES0B 3GSRA 2AQ1A 2GJRA 5HDOA 2W65B 3C6LC 4KUCF 3B2VH 3BIKA 1C8XA 1UR9A 3KLAA 2H45A 4UTBL 3CFJB 1U8LB 2XIIA 2J6EH 2A6DA 3SGDI 4WW2C 3VRJA 4KHTH 4D0CB 2K7PA 2AJXH 4HQQL 3X3FL 4K94C 3QFJB 3AHXA 3CNKA 4GRLA 4UFHA 3QDMD 2H8PA 4UAOC 3FFDA 3OKEB 3CAFA 3WFHB 1CIUA 2R8SH 3BEWA 3VSVA 1NFIA 3DIFB 1GPOH 5ENWA 4ZDHA 2DKUA 1JRHH 3WIIH 5EBLA 5BS0B 5AG8A 1EO8H 4PRWA 4LASH 5F9JA 3W0WE 4O2CB 3S3PA 4WY7H 2CMRL 1HX0A 3ZKMC 1F6LL 4TX8A 2DRUA 3KPRA 2X4NA 1IV8A 5CPSA 4PREB 4TUJB 5CD3A 1XCTA 2QV4A 4F7EA 2WVVA 4DAGH 5J6GA 1M7XA 1MFVA 4DGVL 3S8WA 1NBYB 3F62A 4XMKL 4KKAC 4LLWB 1NMCC 2J12B 3HG2A 3LQAL 4P5KA 4F9JA 3CLWA 4PMRA 1SBBA 2AJ3A 4YX2H 2ID5A 2FEEL 4N5EC 3RY4A 5I19H 4Q7DA 1WZLA 4NT6A 5F89A 2VISB 4DCQB 1QLFB 3BXNA 4I0PB 2YD2A 1FV1A 2VLJB 3ZTJH 3V6OC 5CKAA 1EXUA 3U7YH 3OPZH 1W1TA 2VUOA 4BFIA 2XYLA 3MCKB 1DQMH 4I3SL 3MJ8B 1ZLVH 4K7PL 3GMRB 4F3FB 1HHHA 4G6AD 2J7EA 4EI6B 4U3CA 3SDDB 1KB5B 3VFUB 2Q86A 4NO3B 3ALPA 4NWTL 3QJFA 1XGYL 5IEHA 3MRGB 4PJAA 3MV7D 2DL9A 3DPBA 2PR4H 2Y07H 3QRFM 3OGOE 1KYOJ 3RZCD 3PWPD 4YK4C 5IVOA 3IU3A 3MV7E 5DD3H 3SOBH 1RJCA 4FG6C 4P9HC 1CGYA 1WBXB 4H0IA 5CPQA 3UPRA 4JDZA 4HDIB 4LIQL 3T0EB 2CNCA 4GRMB 3WLWC 1J1XL 3VTRA 2X05A 2VL5B 4K3JH 5GZOD 3I3DA 4WWKB 4IRJC 5I66A 1VPOH 5GJTL 4EN3D 1J11A 1GONA 1PY9A 3CH1B 1KFAL 1FL5A 1U8PA 2WVUA 1BYDA 3KL5A 1R5IB 5DI8B 3TBTA 3WNLA 1V0LA 2VDML 3FRPA 4GAJL 4PB9H 1Q6GA 2X4RA 2YHGA 3UCRA 1CICD 4KV5F 3BH8A 2Z31B 3RPIA 3WY4A 1QFPA 2YPVL 3VU2A 2R2BB 3P4OA 3OR7B 2PTTB 5EU4B 3ECBB 4IRSC 2RGSA 1PLGH 3MRNB 5BMFL 4JFVA 5C86A 4DN3L 4OKDA 1AY1L 1IGYA 4U6VH 1TMQA 43CAA 4ZXBC 4D6JA 4PRPE 4DKFL 4U1JB 5CMAA 3CZJA 3PZVA 3KPOA 1IM3B 4JANA 1WCGA 4RBPK 3H3PH 5IOPB 3BZEA 3MS8A 5HDRA 3PHAA 2IMMA 2VH5H 4HT1L 5AZEH 3LX9A 1ZV5A 2OQJB 1M7IA 3E1F1 5C0RL 4MSWA 5GS2H 1LEIB 2F58H 5A2FA 1F13A 1JNLH 1VGEH 2NTSP 2ZOLA 4XXCA 1QO3B 4L3EE 1J8KA 4AEHH 2R69L 1P1ZA 1N0XH 5JOFA 3AIBA 1QUNA 1RIUH 3V8OA 4Y1AE 1RZ8B 4YO0A 3T65B 3SQOL 3E8UL 3G5XB 2WCSA 4C55A 3VO0A 1WZAA 4DKDC 4YDJB 3BKCH 1HJQA 1ZANL 1ZHKA 3TESA 2JLLA 2R2EB 3EJRA 4KY1L 3OG2A 1RY7B 5EIIB 4TPRL 1KN2H 4X5XB 5I78A 4NKOB 4XUYA 5I1GH 5FUOL 5IB3B 4XZWA 1E1FA 3GMPB 2X4NB 4UT6H 1T21A 4Y5YA 4P2OD 3RNKB 1VFBA 3WUWG 3QR3A 4P5MA 3A0OA 5EDXA 3IDXH 4XH2B 4M80A 3EJYC 1E4JA 4MD5A 3MYJB 1OCWL 3D2UB 4M81A 1Y7VA 3AIEA 3BKJL 1V3LA 1DLHA 1S5HA 1T7ZA 3QHMA 5JQ6L 3SCMC 5KSAC 2PYEA 3PHQA 3N11A 1KPVB 3EOBA 3BEWB 1IQWL 4PTWA 1CU4L 1DQLL 4WEUD 4JRXB 1A6VL 4M62L 4OM0L 3SQBA 5T3XE 1TETH 3TZVA 3BZFA 3SCUA 2KBGA 4HKXA 3C5ZB 3L5XH 4ZFMA 3OKOB 3M7SA 2DJUA 5A6LA 2HRPH 3MREA 2OL3L 1VDGA 5KAQG 5IMKB 3NCJL 2OLHA 4MWFB 4ZUWB 5BO1L 3SUSA 3RY6A 1D5MA 4M56A 1NH6A 4CU7A 4PJBF 1R87A 3O3UN 2CJUL 5EZJB 1NAML 5KVEH 2JB6A 2CKSA 5DO2C 4JRYE 2ZZUT 2WBWB 3PZ9A 1IFHL 4HIHB 5F9WC 5KVDH 3OIHA 5MHSD 3RIKA 3GRWA 4XB8A 3UTTA 5F88B 4LLUB 5ERWA 1ZT4A 1OGTB 4Z7WB 2GFBA 5BXRA 2E27H 3NDYA 4Q0XH 3GH5A 2EADA 1KTRL 1DQQA 1UB5B 2ATPB 5EPMB 4PMZA 1FLRH 3OXRA 4W4OA 1SVZA 1LMKA 2XNAB 3B6SB 1QNPA 5ESVB 4IHOA 1HNYA 1H8NA 1SYTA 4AJ0A 2VN7A 1I7RA 3W9DA 1KCUH 1UKPA 2W63A 3UYPA 2EKSB 2AJYH 2YPLE 2FLRT 5DD1H 1DQTA 5FA3B 1DSFH 1R3LA 3H42L 4KK6C 1AKJD 4WCYH 1YJDC 2OR8A 5TPWH 3B9KA 4PJ8B 5C6PB 1E6OH 3GXPA 3BPCB 1GVYA 4TSAH 3MUJA 1CFSA 1FIGH 3PP3H 5JORA 5DRXB 3DROA 1RHFA 4YN5A 4MAUL 3QO1B 4PG2A 3NFNA 3DWTA 5A69A 5F8QC 2ADFL 4WTWA 1WKYA 3HC0A 4O2CA 1OBAA 5IMMB 2M1KA 2JJSC 5E1AA 1UADC 4LGXA 4IDJL 5EU6D 5FA4B 4WNQA 1LQSR 2EKSA 3VH8A 3HI5L 1NUDA 2FD6H 4F9DA 5GSRB 3TO4D 3OGVA 1WFNA 4M6OH 4Q6YA 4QXTB 3F7VB 3ZR6A 2EDYA 4K2UL 2C9AA 1JBJA 4MD5B 4P23B 3CZNA 2W92A 3VFGL 3QEUA 2X4PA 3TA3C 5KG9A 5E4EB 5E2VL 5I30H 1FN4A 4NX0A 1TITA 5JXAH 1ZK9A 2YKLH 4HZLB 3U9PL 1G7QB 3TO2B 5ABEA 5E1HB 4EANA 4V28A 5IVZB 4PRHE 3T4AA 2YD5A 1JFQL 4U0QB 4MS8D 4FRWA 1ZHBB 1JFXA 2J1KA 4RAHA 4J2XA 4HU8A 1G84A 2VYRE 2W4XA 5BYWA 2VZSA 4TSBL 5DUPH 3PABA 5B22A 4F2MB 2YN3A 4TRPL 3GMPA 2EZ0D 5ESAB 1NPUA 4LGRB 2YUWA 1JZ6A 1XV8A 4Z5RB 2HT2C 4QO1A 2EACA 1CDGA 3LD8B 5FFLA 4KHTL 5IFPA 5HVFB 3ALGA 5EZIH 5AEAA 3WF3A 1C5CH 2ATKA 2FWOA 2DBLH 1W9XA 3WDIA 2VTFA 4M93C 3HI1A 2ZUTA 1CE6B 1TJIL 3U1SL 1YJDL 4YDVA 3VG9C 4OQTA 2X41A 3JV5A 4F2MA 4X0KA 3W82A 3VUPA 2DT1A 2CESA 4KJYA 4OQ1A 5DQDL 3L3HA 3PQYE 5SWSE 2UV3A 1F90H 3HTLX 4X6DB 2EH8L 3ETBF 3RPIB 3CX2A 4P2QE 4FQLL 5C08A 4PJFE 4OZGB 4X7TA 1UZ8A 3LKRA 3C9NB 4JN1L 1MWOA 1BBJB 3SE9H 1QFWM 1WDPA 1NDMB 3QO1A 3JUGA 3NFSL 1TCRA 5ID0A 5F70A 3K0WA 3ROOA 3BLKA 2WC4A 4PGEB 1RZKH 4NQSA 3ARBA 2XN9A 4PJIF 2B1AL 2FZ3A 3QDME 35C8L 5E2UL 3U0TB 4X6EA 5C0AD 3CSYB 4YDKH 4MQ7B 1WT5A 4PS4L 3D4YA 2PCPB 1EEQA 1G7MA 5FYJD 5KJRL 3SDAA 1ODAA 5HGGS 1O7DC 1E4KC 4XNUL 3CXHJ 1EEUA 5DJ8B 3S96A 4JM2A 4KTEH 4PJAB 1R86A 4QRTB 3IJSB 1JNNL 2WIMA 5D9SB 4UZUA 4EI5A 1BD2D 2QJDA 3T0ED 2UWFA 4KGLA 2OSXA 4KVCH 1OP9A 5CZVH 4GZJA 2HKFL 1EOKA 3HE6B 1TVNA 1FPTL 2OI9C 3VFOB 4KKLC 5HYFA 1RI8A 1FL3B 1DQQB 3RHWF 2OXGA 4LOUD 1RIVH 4MX7A 1DWIM 4ODVL 2ARWA 3HMXH 4M3KB 3FOLA 4R9HA 5T33L 4P7OA 1XCQB 3ARGC 3WXVL 5DHVH 1E6XM 1EUUA 1KG0B 3IFOB 1F6AB 1Z2KA 4G9FA 4P5MB 3N9GL 3HMXA 4HJJL 3C8KB 3GSVA 1UZ1A 3CZFB 3ZHLA 1D5MB 4YHYB 1K2DA 3PDDA 2CPCA 2PW1B 1DWGM 4LMQE 5KAQF 1LVEA 3DVGA 5D4QA 2HTLD 1CD1A 1OPGH 1QSFB 3BP7B 1TA3B 4M4PA 5IROA 1T3FB 4F15C 2R1WA 1S3KH 4XPGH 2J6EA 3A6BL 4OT1H 1E6NA 5F7EL 3CSBA 4OIIL 2IFFL 4URIA 1GZPA 2XWJA 4PGCB 2AEIT 5I8EA 4PUEA 4JO3H 4FABL 3S5LB 2MHAB 4LSVH 3SCMD 1UASA 4Q6IC 2R0LL 4ETQA 1LDPH 2WQ8A 5E9DA 3BYTA 5CSZA 4PJAF 3SO3B 3O6FC 2VDLH 4ZD3H 5T1DL 4DK3A 3G6AB 5EB9A 5LQBH 3OKKB 2Z91B 3QHTC 3CGTA 4XCFH 2IH1A 1YY9D 5HTSA 5IVZA 3U4AA 3Q1SL 1DBJL 3EFFA 2ZKHL 4XP5H 4NRSA 2DQUH 3VRLE 2WBJD 3PGDA 5DMKA 4YUEL 1ZLVK 2ZJSH 4AM0B 3F12B 4HUVA 3BKCL 1CK0L 5IFAL 2GITB 5A8NA 1P84K 2NR6C 2R29L 4N0FA 4M24A 4JPWL 3HG3A 5DK3A 2VABB 4XP6H 3RDKA 2CKBA 3U9UB 1JGUH 2FL5A 3AYRA 4M3JA 4AMKL 4AWEA 5HHMB 1DN2A 3I02A 2ZX8A 2HFEA 2NYYC 1OGAD 5FD0A 2JF7A 1IKNA 3NYDA 3WIJA 5DDHA 1MHHB 5IGXL 3GIVB 4U1SB 5C07D 4D2NA 1J0HA 5CJ5A 3ZKXC 2CBUA 2O5ZL 2XFFA 2DYPD 3MRRB 4NZRH 3STBA 3KNBA 1KIPB 4R4ND 4PY7A 5BZWB 3C6SA 1H3VA 1YN7A 1IAKA 3Q3GA 4KK6D 1E6ZA 1FFNA 1MFDH 3TVMB 3CHDA 1NEZA 1UWGL 4HPOH 4H04A 3BZ4B 1U58A 3VGFA 1UENA 2AEPH 4ENEC 2EIBA 4LYPA 3SGKC 2YUZA 3LSOB 2H2PD 3BUYB 1Z32X 4YEFA 3DVIA 1XF2A 3LKNB 1HVXA 5EBAA 4NCC2 1FRGL 2VDNH 2VXVH 2PXYA 3VXRD 1I7TB 1TZIA 5EFFA 4IM4A 2F9BT 3S35X 5ABFA 3G5YA 1NC2B 1Q9LA 4AD3A 2ZXQA 2VLJD 2JJTC 4NQSB 2EJ1A 3TN0B 2W59A 4NBZB 4PRIA 4JY6A 1PQZA 1Q4NX 4X9IA 4KGJA 4U6HB 4HTYA 1II4E 1YNKL 4U0RC 3RDTB 4G6MH 1MH5A 3RA7L 4IPNB 3MZGB 2I07A 3LPGA 4OZFH 1N82A 1MJUL 2XWTB 1ZB5A 1BGXL 1HKIA 3MRMB 2YMXH 3DARA 3ZTJG 1TVBA 3BWAA 4OCNC 4MNJA 3NH7H 3TT3L 3G5YB 1CVSC 5MEQB 4YXKL 1TQTA 4K68A 4JQXC 1UXSB 5L2JA 5TPWL 3O0RL 4TSAL 4L4TA 2D3VA 3QIBD 3ARSA 1UZ6E 4M4RA 3GIVA 4JRXA 1KJ3H 5E1QA 4NO0D 5K9JL 1SJEA 2YPKA 4LRNH 4ODXB 3QQ3A 3IDGB 1R5VA 5C9KA 5HBFA 3WEXA 3O8XB 4HCRL 3MRHA 4JFQA 1FFRA 2LAGB 1YN7B 1AR1C 3Q3GB 1QG3A 5JW4R 2DLGA 3IXAA 1ESWA 4HFUL 3BUTA 1WO2A 3HC4H 5LYRA 1C91A 3DX9A 4N1HB 1Q0XL 1LO5A 4Y5YB 3RNKA 4KKCC 1NUNB 1C5DB 4G6KH 4LSUL 4ZSOB 4YXLL 1LO5B 4I0PA 3WKML 3RWIA 4IMLA 1BFVH 4J4PA 4MD0A 1L4IA 4KZEH 4U1GB 4QLLA 3TOPA 5ILTL 2EYRB 3WFCL 3ZDZE 2HJLA 4CU8A 4JGMA 2CETA 3IDGA 4UTBH 1R8LA 1LP9E 4EUPB 3HE7B 1R3IL 2C3VA 5FB8A 43C9A 2HT4C 3LKPB 4Y4HA 2LE9A 5ICXA 5E08L 3F5JA 3BT2L 2V2TB 4U1HB 3EIFA 1CL7H 5FM5O 1DQML 2HP4A 1WAAE 4I3SH 1C5DA 4ZSOA 1R47A 2DT3A 5D8ZA 5TGBA 1UWXK 3HUJE 2XQBL 4XI5C 5JHLL 5D5MA 1JGIA 1U91B 2BVTA 4XPTH 1DTUA 3PABB 5E6IC 3OGSA 4AZCB 1H9VA 5FM5M 1S7VB 2QHRH 3D39D 3C09C 4G7YH 5E8EB 5J06A 4NN5B 3QUKA 3SE3A 3C5ZC 3QCTL 2ZSWA 2OL3B 2UWEA 5DJ0A 1AHWC 3CIVA 3DHUA 5CZXD 3W29A 3IDJB 2OR9L 2A6KB 3O6FD 3ARXA 4AISA 4GQ9L 5D7IB 2GJXB 3OF6D 3SKJL 1MCDA 2VR9A 3VA2C 2VXSH 4Y5VA 3MCLL 5D5ME 4DEPB 1H8OA 5IB5B 4J28A 1YJDH 2FO1A 2WMHA 4WWKD 1K9TA 4S1SH 2B7DT 1U8HA 4RGNC 1J7VR 1BVKA 2AGJL 3IAGC 5IEKA 3RM4A 4U4BA 1MQPA 3ARWA 4KKLD 2VE6A 4Q74A 5FOJA 1HILB 1BWMA 4L4VE 1A14L 3IRZA 1RUPH 4NZUH 5IHUH 3STZA 1T6WA 1VADA 2YOCA 4KDWA 3SUWA 2R9HD 5L9DL 4YBLC 4PGEA 1EAPB 2P46B 1J0YA 3U4BL 1JWUA 4UV4H 5B38B 3LMJH 4H8WL 2I24N 3HKFA 5A16A 4IIQC 1GOKA 3HAEA 3BIBX 1B4JH 4R7NB 3QUXA 3TPKA 1UD2A 5IWLC 4NPYA 5KSAA 1KCRH 4IOSD 5IHRA 4W7VA 4XVUC 2D0FA 1VJSA 3BHBA 4D6DA 2OXHA 1NFDE 2HTLC 3MUGB 4E42B 2O9TA 1MCQA 2GSIB 4GXPA 2G9HB 4Y4KA 2WNGA 3JWDL 4JFEA 3S4SG 2UY6A 4OFYA 4W85A 1J01A 5E00A 1U30A 2ADGB 5ISZE 2F19H 1MWAA 1A6WH 1QACA 1YEDA 4ODWB 1GORA 4Y4FC 4GAJH 4MDIB 2FJHA 1P5UA 1EXPA 2UY5A 1LQ0A 4EKJA 3OGCB 3NTCH 4E41D 3MUY1 1YMHA 1EDGA 1UC6A 1MCOH 1UCBH 4LXFA 2XZAH 4JO2L 3BSZL 5I73C 1FH9A 4S3JA 3VI4E 3C8DA 1DUYB 3CBWA 3SCSA 5TE6L 2ERJC 3MLWH 5KANI 3OZ9H 3MJ6A 1C12B 3EFDL 2JIWA 4J3TA 5T3XD 4HS8H 1FOBA 3V4UH 4A2LA 2DWDA 3C6LA 1ZVHA 2NY7H 4AEIL 4E5XB 1BTCA 2PC8A 3AMKA 5EO9A 1OWWA 3VXUA 4FNUA 1ZBWA 3MO4A 1T3FA 5JZ7C 2Y24A 1YUHB 4JO4L 1S7QB 5IW6B 4GO6B 4OKVB 1AGCB 1XR8A 1CDBA 1YDPB 4PJHA 3B9KC 3TNNB 5LVEA 1M04A 4NO5B 3N1AA 1P2CB 1RK0B 3Q6GH 4O58H 3THML 4CGTA 1ZLUK 4MXWL 1A5FH 4HGMA 1P2CA 1RK0A 3BGMA 1HQRA 4ZO7A 3ARZA 1HQRB 4XNQB 5DZLA 3L3JA 3LEYL 3HUJA 4IJ3B 4JHAH 3JTSB 5I71C 5D9NA 1A1OB 5K93A 1FGVL 2D31A 1T2JA 1S7XB 2NY1B 3HC3H 4P4KC 5DVMA 5IIEB 3EDKA 3FQXA 5D2LB 4FNQA 5I76B 1U8MA 1FYTA 4HLZG 1ADQA 1GGYA 4K8RD 4CVXB 1KB9J 2HFFB 1E56A 1I7UA 1HQ4A 1GW1A 4ZAKC 4OB5H 2O5YL 2J8UE 2G5BB 5E95B 2YBRA 1KJVA 1U8IA 5BRZD 3GUTA 4U2ZA 5GIRA 2BNRB 1OIMA 4PBGA 3GM8A 5HD8D 1UWXH 3BKJH 2A9ML 1CFSB 5CLWA 1WIOA 1YMHB 4UIMB 4PRPD 1Q1JL 1GZQB 3HUJF 3P40A 5D70H 4E41B 4JR9L 3TH4T 4KKAD 3SDCC 1JZ3A 1RAMA 5IMOA 4EBQH 4PTMA 1HOCB 1TUXA 1XYFA 1E0OB 1QI0A 4PJ7A 5GGSA 3AREC 3OV6A 3LRLA 1EJOH 2BRQA 1FNEA 4U1KA 5TE7H 12E8L 9CGTA 4G3YL 1N4XH 4MA1B 3W9EA 2B5IB 3QRGH 3PWJB 5I2IA 1IARB 1WUNT 3U46A 1UJ3C 2IPUK 1GL4B 3MKKA 2EH7L 4MA3B 3WDPP 2FD6L 1NLBL 3BE1H 3LQMA 4G6AC 3AXXA 4R2GB 4C7DA 4TULH 2HTKC 5EO1A 4OCSL 2BVQB 4U3HA 3GKWH 4X0NA 4WWKC 2FJGB 4ONFL 3UTZB 3VMNA 5TH2B 3MRQA 4P5TC 3LVEA 4RGND 1FFPB 2EO1A 4R6UA 4PJHF 2OTPA 4L9LB 4QXWA 4M6NL 2GJJA 3TBVB 5E9AA 3DX6A 3S36L 1MCFA 1W8NA 1W2KT 1BFSA 3JWOH 3ULUF 1P6AB 1KEMH 3D0VB 4MAVA 4YBHA 1AKJB 4LSRL 4LLVA 3FRUB 3MLYL 1KXTA 3KPSB 5EA0H 1KENH 2BHYA 3FN0H 4ZFZA 2RGMA 4RFOH 4AZCA 4Z7UE 5EG6C 5IB5A 3IDNB 7FABL 2Y36H 2AERT 2DD8L 4WTXA 1MIEH 2A38A 1ITCA 4U49A 3OG4B 6A3HA 5DRWB 3F7QA 4IRSD 1EEZA 3U83A 1F6FB 5LGHH 3IDJA 1QHZA 1C5CL 2IADB 7CGTA 5CINH 2D7QA 3EFFB 3PV7A 2GYSA 2F61A 3ARDC 4HUUB 4YHIB 3CC5B 1PKQB 3IJ9A 4DO5A 1UWIA 4PJ5B 4RSVA 3ROLA 1A6UL 3WXWL 4C4KO 4MQXC 1NCWH 4Y1AA 2CIIA 3BPOC 1WWBX 4L8DB 4P2QD 1OP3K 5C07A 1EQCA 3G5VB 2MMXA 2PTUA 4J1UB 2Y1VA 3O3BB 1AO7D 2XFRA 3AZSA 2VURA 5HHXL 8A3HA 3RJYA 1BX2A 1RK1A 2WUBH 2Z93A 4JFZH 4ESKA 5I8EB 4O02H 2YWZA 4KKCD 5HHOD 3FQTA 2ENSA 4YFEA 5HVWA 1UACL 3C60C 4X5WB 2DQFB 5DMGC 1DEEA 1AD0B 1JPTH 1JDDA 1GOWA 4PGBB 3SE9L 3MSGA 4UT9H 4E5XA 1E6QM 1OB1B 5C9JA 4HAFA 5SWSA 2COQA 4GLRI 5BJTB 3CU7A 3RO8A 1T89A 2X2JA 3HNVH 1WBYB 4TVPE 3UG4A 4XC3L 5KVFL 5FYJE 3VIGA 2BP3A 3FB8B 1E72M 1HJWA 4HK3J 1BLIA 3S6TA 4D0CA 3BAKA 3RAJL 3L95B 4XPFH 3S4SB 3LEVL 3BHBB 5KJRH 2VXQH 4BZ2L 5T1KA 1M7DA 2D7TL 5J11B 2JELL 3VFRA 4QRRB 2XWTA 1DEDA 3GSRB 1A7NL 1YEJH 4UINL 4OF8A 4X7DC 3EJUA 3QEQE 4F8QA 3RVTD 5KSAD 3C8HA 1MQRA 2EDLA 1N59A 1EV2E 5CILH 4HWNA 4O9HH 2EYTA 4LCUA 3O41B 1OAKL 4Y16B 4WKHA 2NY6C 4ETYA 5C0FB 3WBEA 2YPVH 5CZXC 1BZ7B 2R8SL 5C0FA 3IJ7A 2Z31A 3VXRB 2PW2A 4LARH 5EU4A 1UWEL 3FO1B 3ZT6A 3L4ZA 3B5HA 4LVNB 4HUMB 4UQCA 1OM0A 3PWNB 1KUMA 4NJAL 3QISA 2N56A 4TVCA 2FIKB 1DBAH 1ZGLA 2HT3C 3S3JA 4LCCA 1U58B 3MRPB 1MJ7H 1V3JA 2X2HA 3FO9A 2G3JA 4ORZC 3K46A 1NCUA 3C08L 3GJEB 1IAOB 2QLYA 4TN9A 2BFVH 1JTOA 1KB9K 2X89D 3D18B 1UR0A 3QDJE 4BFIB 4HOZA 2D7OA 2PXYB 4KJQD 4NWUH 3ARTA 1JTTA 1L0PA 3ROOB 1AGEA 1E6JH 4S1QL 1IZKA 4FQIL 4HK3N 3BI9X 3WH5A 1PVHA 3VW3H 3WEMA 2WUCH 1RD6A 3PWNA 4RNRB 1MIML 5DK0B 1J5OH 1C5BL 4Z0BH 1RUAL 3S34L 3VX0A 3SUVA 2A3CA 1T4KB 3TBYB 4GG8B 3NSXA 1EXUB 3GMNA 3RIAK 2B31A 1E70M 4XMLH 1RUQL 3M1BA 3VXOA 2AXFA 2YD9A 1R85A 4RDQF 1I1CA 1NSNL 4XPHL 5I1GL 3PIQA 5E94A 2GUYA 4LASL 3CMGA 5DJ0B 1JV5B 4PB0H 4LNVA 4AW7A 1U8NB 3KYKL 3R8BB 4UU9A 5HGHB 3BVUA 4LIQH 4TTGA 1QI4A 6CGTA 3BISA 1WDRA 3W5NA 5A2JH 4H7VA 3IKCB 3O6LL 4EAMA 2ICES 2YZ8A 5FCUL 2XG9A 2X40A 4J1UA 3L9RA 1W3HA 3K8MA 2XZAL 4YHOL 2WNWA 3MXWH 2Y5TA 2WWCA 1ZJAA 1P4IL 5D2NB 3AC0A 4RL3A 2HLAA 3V0WH 1I9RH 5F7EH 5F1SA 5GS0D 5IOPA 1BVLA 1VEPA 2C7FA 1EO5A 1PBGA 1T0PB 5EO9B 4B3LA 4EQ3A 5BMFH 1GGCL 4JFEE 5EB8A 3A47A 4XPBL 1S5IH 4DWHA 5H37G 5EFDA 4WV1A 4JN1H 4R3SB 3H54A 4PGJA 5JZ7D 2RR3A 4DVBA 5EOQL 5F9OL 2ZXDA 1OP3H 4ZOEA 2YL8A 2BNQA 2GJZA 5IMLA 4HHAB 3DHMA 2VR4A 4LSTH 3IFPA 1TTGA 4OLZL 1AD9A 3BDYL 1T20A 4RGNE 1HZHL 3DXAA 2AEPL 3GO1H 3UTQA 1TCMA 2ZKHH 1R0AL 1QOKA 4UI2A 4EJ1C 4ZQKA 2Y7QA 4MD4B 3MLXH 1SMAA 2PO6C 2DQGH 2XI9A 4GFTB 2YN5A 2DQCL 1JGLH 4OV5B 4N8VB 2RHEA 1QRKA 2VZUA 4W5ZA 4JPWH 4DKAA 5IROC 4CNIA 3WQWA 1KN4L 4ZAKD 5HHOA 5K9OB 5EWIL 3KPMA 5E0FA 2HKFH 3TGXA 3D6GA 4GBXA 3C87A 3P77A 2NY1C 2LU7A 1QRNA 3VFTA 2V5YA 3IDUA 3RVVC 2Y5EA 1YA5A 5F9DC 2XG5A 1GGIL 2FO4A 2OZ4A 4PGZA 1OSEA 4JZNB 4TOYL 4EDWH 1INQB 4CKQA 3QG7L 2E3ZA 2BK8A 5SWQA 5I9QC 3NCYP 4M8QA 1U92A 1TG7A 1V6UA 1NGPL 5IMMA 2EE2A 3AMCA 2VO5A 1DQDH 4L3EB 1TE1A 1BLNB 1YEKH 3KLKA 2ZUMA 3O81A 1I8KB 2A6JA 2BNRD 2V7HA 4W4NA 3O2DH 2A6JB 2V7HB 4NM8L 1X4XA 2Q87A 1KTKE 4ZOAA 3BRFA 4RA3A 1PEZA 3BQUD 1YEIH 5KTEH 3CU1A 1E4KA 4PG9A 12E8H 3HAEG 2XWBA 4FQ1L 3EYSL 4JZOA 1Y18A 4GI6A 5CBAA 2A3AA 3QUML 4WGWB 1KULA 5GGVY 1GXEA 3FO1A 2X6MA 3L3KA 3KDMA 2C3XA 2OL3H 1JGDB 1KJMA 5EC1B 4TQEL 5CJQL 2IALB 3I2CL 3HUJB 1CD0A 4ZMAT 4ZXLA 4N0CC 4GSDH 3A5VA 3MLVH 2B1HH 4GRWE 1HINL 4Y1AD 3L3GA 2GTZB 3K4AA 5CD5D 2AK4B 1G7LA 3WSUA 1GCYA 2EIEA 2IH3A 3FMGH 5HYJA 3P9LB 3FB5A 4DJMA 4TVPD 2ZE0A 3CXDH 4FQQB 2IG2L 3N1FC 3TBSA 1U8MB 2NY0B 5GGQH 5KEZA 2IAMD 4KY1H 4AYSA 1RZKC 5D8WA 4M1CD 1CENA 3D3AA 3L7FB 4JRXE 2DWEA 2J78A 2CKNA 3IF1A 3RIAF 3ZKMD 1QHPA 2X4QB 4J3WA 5MEPA 4TSCH 4LSRH 2PF0A 3ESUF 3D2UA 4JQIL 3VFTB 4YDLB 3ULUC 3ARGD 5JHLH 4K8RL 5DO8A 3WFLA 1TDQA 3B3IB 4XNQA 1EFQA 3QUYC 3A21A 4ZTOL 3I85A 1I8IB 2I9LA 5DJCA 4QYOA 5JIKA 2AJVH 2DQDH 3HRZA 3P9MA 5B3JF 5F7KC 1VIWA 2WC7A 5I75C 2VSDA 4JFXA 3VIIA 5BS0A 1AXSA 1P4LA 1CG9A 4G9DB 4PEEA 4QWWC 4JRYB 5MENB 3IF1B 3ZTNH 1S78D 4GI9A 4HWUA 1W72L 5CJXC 5FUCE 3WF0A 3SKNA 1C1EL 2O61A 4IIQB 4N9GB 3MYJA 1E73M 2V17L 4XNYL 5C70A 1T22B 1U8JA 1F3JB 3V5KB 4JFDB 5GS0L 2PWEA 2FBJH 3MCLH 3UYRL 1B6UA 2ORBH 2DLFH 4GKNA 3GGWA 1ZWIB 1NAMH 5KVEL 1OARL 1UM4L 2E9JA 4YHLH 3FRPG 4S1SL 3TV3H 3AQUA 5DGRA 3REVB 2YLAA 4AENB 2X1QA 4M6OL 3UROR 3EYVA 2FB4H 4XXDA 5GRWA 5HHXH 4PJ9A 4OUUA 1MYRA 3RNQA 1V03A 4UV7H 4JM2D 4B16A 5DMGD 5AAMA 2EEXA 2XIBA 4PJDB 5MEOB 1MJ8H 4RQQB 1GOFA 5C09A 3PJSA 3MRBB 3UPCA 5L2KB 1PG7H 3NPZB 1OGGA 3LMJL 2G60H 5FKPA 2H41A 3PZIA 4HD9A 3O3DB 4UTFA 2Z92A 1R24B 3EOYG 2DTML 2YD6A 2EDBA 4OI8A 3WQ6A 4ZFZB 3HE6D 3G6LA 4OJFL 3ZE0E 1QEWB 4R27A 4K71B 5AZ2L 1UA3A 4M1DL 4KXZH 4LSPH 2ILLA 5FGRA 2ZCLH 1WITA 2UZIL 4OLVH 5E1AB 5C08D 4MA7L 1FHGA 3TBSB 3JWOC 1C7TA 2ZSVA 3TTYA 1A6AB 1CICB 4XBEL 2QADD 4JCLA 1BJ1J 4PLNC 1QSEA 2FYYA 1DL7H 1R3LB 3DX3A 1ECEA 4G5ZH 1Q94A 3NFPA 1KIQB 4JFSA 2HG5B 4QHNB 4G80B 3PWVB 3S97C 4H1LA 3QI9C 4QHUA 1CBVL 4IISA 4PTTA 2AP2A 1Y18B 1F4HA 5C08B 1H41A 2VVSA 2P5EE 3HLAA 1P84J 4JFHD 1ITBB 1KLUB 2IPUG 3ZZ1A 4BH7A 3MLPA 4NNXB 2FO4B 2DEPA 1VSCA 1A0QL 5I71B 1I75A 4ONGL 4Y2DA 2VXUL 2GUOB 3JZ7A 1JUFB 4UV4L 4GOSA 3NN8B 1T20B 1QSZA 3UG5A 4HS3A 3KNBB 2HT3D 3C5ZA 1ZBKA 4HCRA 5LCVH 4JFFE 4P4RB 1K8IB 3VFMA 5EPMA 1IAOA 1KF9B 1CEOA 4PJDA 1DBBH 4W93A 4K7PH 1VADB 1FHDA 1LO4L 4LKCA 4HPYH 3DGGB 4ZNEA 1KPUB 3EJZD 4KJQC 5J9PA 2NZ9D 1ED3B 2VLRA 4NWUL 2OCFD 1SEBB 2AJSH 2ITCB 2APFA 4DTGL 3UDWC 3VXME 1R24A 3WUBA 3NZ8B 1BQHB 3GSQB 3NIGE 4NHUB 3DXAB 4PUBH 4F8TA 3RL2B 2IBZX 1YMMB 1XF5A 3REWB 3PQYB 3GSOB 1BREA 2MKWA 1CL7L 1UXWA 2I5YH 4PJXB 4X6CA 1DN0B 4KPHL 2I9TA 5GGTA 4YDJA 4ZFOA 1G9EA 3QNZA 5F9JB 4M00A 3LY6A 1QLEL 5DVLA 3GRWH 3ILPA 5GGTH 2WHLA 3PBGA 2KUTA 4L4VD 4FNRA 2NQCA 2DICA 4PB0L 1VFBB 4CMHC 3TH3T 4JRYD 3WLBA 2CRMA 3RIFF 3AS3A 4J4PC 3WIHL 1MHCA 4AT6A 5JTWA 4XH2A 1WWCA 1AR1D 3UTPE 2Q8AH 4AZ6A 2DYPA 5I18H 2IAMA 3G6DL 4PCTA 2CIIB 1NGWB 3SDDC 2IQ9H 1QFUL 3IDIA 3KXFA 4R7DB 4NZRL 5HNNA 3WUGA 4L8BA 5LA2A 4CJ1A 3EBVA 4D3CL 3NCMA 4GRLD 4K3HA 2CCRA 5DSCA 2DQJL 1IAMA 4X9HA 1IT9L 3WL0A 1K5NB 3STLB 2AK4A 4ZFOL 1OW0A 2DI8A 3GSUA 4ZFGL 1NJ9A 3LEYH 1T5WB 1NWRA 1UZ4A 1Y6NR 2HFGH 3OR7A 4EIGB 3MLZL 4ZOCA 4YPJA 3VH8G 4AY1A 4QHKI 1KCKA 5D7KE 5C0DA 4FMVA 2A6DB 4UZGA 1GC1H 2G4FA 1BMGA 3LPFA 3A6BH 1J0JA 4RNRA 3AXIA 4MDOA 4NRZA 4PTVA 2BSTB 3WS3A 1UR1A 3BGAA 1UUQA 1D5IL 4PJFA 3QXDA 4MNQD 4LVEA 5CBEB 5I5RA 3G5ZA 3FB5B 1KCRL 4P23C 1Z3GH 3G6MA 5B4MC 1OSPH 3GK8H 4M7JL 3S98A 2H32H 3WO3B 3QZWG 2VLKE 4UB0H 3GB7B 3UBXI 4ELKA 4HEPG 1XZ0A 1XFPA 4P0DA 1NCCH 1RZ7L 4MXVE 1J8HD 3MRMA 3PGCB 5ANME 1XIWC 4NFCA 3V4VH 3VFSB 3VPLA 1MLCA 4HH9A 1P7QB 2P1YA 4EBQL 1MQKL 3OXSA 3SJVA 3TO4C 5IJKA 2J88H 1KCVH 5GRVL 3WS3B 5TDNA 4D9RD 1OAYH 3VWJC 5FYKU 5CEZD 1SJHA 1EDTA 3DURA 4OM0H 1I9JH 4Y5VB 1IRAY 5FGSA 2QMKA 2BCKB 3PL6D 1U8KA 1XZ0B 1AO7E 2X4SA 2HRPL 1Q38A 3VJ6A 5C0AA 1ADQL 1FV1B 4HG4K 3TJEH 2FECL 5KSUB 5C0EB 3OX8B 4ZUSA 5ID1A 2MCPH 4KHXL 3GJFK 3X3GH 1PEWA 3QHZL 3LSOA 5CCKH 1N0LA 3WFCH 3QR2A 4I48B 4WUUB 1I7ZB 3QHFL 3LRSA 4KTYA 3RUGB 2XJ7A 4A6YA 5I17A 1I3RB 2V5RA 4AZBA 3BT2H 3ZJ7A 1IBGL 4LQFL 4HZ7A 1QRNE 1E5JA 3W26A 1ZLWH 1J1PL 5DYOA 4HMEA 1FO0L 1EOMA 2XVKA 2JB5L 5TQ0L 1GZPB 2XWJB 2DQUL 2QSQA 4PGCA 4QP0A 4Z77A 2ZG1A 3GJFB 4KKNA 4Q22A 2BC4A 1WIPA 5EBLB 4Y4FD 3BPLB 4L4TD 3BVNA 4J8RA 3GNML 2J7GA 5JO5B 3D85B 4M1CC 4MYWB 4WU5A 2EYSA 4EXKA 2VLJE 3L5WA 2FGLA 3UETA 4Q58C 8CGTA 3KJ4B 2BNQE 4DGYL 2DKSA 3MRJA 4D6FA 2CDEA 4HV8A 1K8DA 2VXSL 2YPLA 3RPKA 2ZUQC 1B3VA 1OQXA 4HX1B 4UR9A 5ALBH 1TZHB 4K23L 4LCYA 2ZOKB 2XWDA 4QAWA 2W9LA 3QNZB 4CW1B 4L9DA 5F9WB 3SIMA 4BQBA 4PJCF 1LK3H 1BAFH 1R7AA 2AK1H 1JZ5A 3BMVA 3V5HA 1HEZB 3HE6C 2QQLH 4AQOA 1YPZE 1H15A 4NC1C 3WLBB 3H8NA 5DD5L 5T3ZL 4P4KA 4QOKE 3QEQA 3VSUA 2V17H 3MBEC 5KSVB 2FBJL 3BQUA 5FOBB 1BFTA 1FRGH 2WAGA 4GLRH 4JPKH 3A4WA 4EI5B 3FQRB 4IMKC 1KGWA 1I9IH 3PWLB 2V5SA 1JAEA 1FBIL 2SEBA 3PWUA 2C26A 2ZPKH 1MVUB 4MZ3A 4ELMF 2MSPA 5C0AB 2VNCA 1QKZL 3O3EA 5L7XL 4Q9RL 4OCSH 3AISA 5EN2A 3QDAA 3QI9D 1BFVL 4XPFL 3CSYA 2VL5A 4K8RC 3AMLA 4BQ4A 2VZVA 2VCAA 1CTNA 3ULUL 1BVZA 1LK2A 2UVFA 4TSBH 2A77L 2EXYC 5DUPL 4FLOA 4NC1E 5BCAA 5A8PA 1MRDL 4I9WE 3MJ7B 2F1BA 5GRZA 1A7NH 1YEJL 2W38A 4UINH 3S96B 1R3IH 3QIWD 5SX4I 5I8CA 1R75A 1ISWA 1NDGA 3Q5TA 3VFNB 3E6FB 1LL4A 1DDHA 5ECJE 5K59F 1HHJA 4QRPE 5EA0L 1SY6A 1CLOH 1YNLH 2DLHA 1TQCC 2QHRL 5AZ2H 4ERSL 4KTDH 2GJ6A 2VRQA 1S9WA 2GJ6B 4LF3A 5E24E 4LCWA 1F8TL 4QRTA 2IANE 3CUFA 4HCRH 1RHHB 3CVHH 5EUOB 2W5FA 1NLDH 1W0WB 3NA9H 4F80A 1IC7L 1E6SM 4G80A 4D94A 1KB5H 1UH2A 4JDTL 2DPEA 5EZJA 2XWBB 3QPQC 2DQIL 4JO1L 3D0LB 3HJEA 1LO3H 1MFNA 4CD4A 1WCBA 4AIXA 1F3DJ 3UTSA 1WTGT 2G3NA 4YDVB 1NCWL 4ONGH 2QSCL 4D9QD 4BS0A 4H5SB 2DLEA 5H35A 4U7KA 1A5FL 4KV5E 4LLMA 3RNQB 1X44A 2WUBL 2ZNWA 3BP4A 4JFZL 2NXZB 1HHGB 3GSNH 1TVHA 3PL6C 3S34H 1CFVH 3HZYB 4YR6B 1GGCH 1LEGA 4LVOC 4Y2OA 3RX7A 1FVEA 3EJZC 2Z31C 5L9DH 5BXTA 2EDDA 1NOUA 1B3ZA 1S7XA 5KSVA 2N7AA 1BSIA 4WKFA 2NR6D 5C09D 3EGSA 4Z7VE 3U7VA 1AGDA 4XPHH 5C0IA 1YEGL 1E4LA 2XPGB 3ZYOA 3MFFA 4GS7B 3UERA 4Z2LA 4ZXBB 1TQBB 3HPLA 4GW4A 4HAGA 5D93C 4H26B 3F5KA 4W5UA 1GHFL 4O5LL 2NYYD 3HI1B 5T5NF 1RIVL 4WEBL 3ZHDA 1IC5L 2ZCKL 4P49A 2DQGL 1WICA 1LEGB 3EOTL 2ZOKA 4M03A 4KPHH 2IEPA 1V0MA 5IBUB 2CXKA 5I0DA 2UYLA 3RWEA 1F58H 1FNGA 3IJYA 2CDGA 1FL6B 3ARDD 2AV1B 2EPOA 4R5EA 3MO1B 2F8VA 1KPRB 1A6WL 5ICYA 1EHXA 2XPGA 3MSDA 1ORSB 1A3LL 3IAPA 4YE4L 1E3XA 1PYWB 4D71A 1F4WL 3K7UA 5D5MF 3IXTA 3MLUL 1FZJB 3VXSA 3A6CL 5JLZB 2JJVA 3QDGE 1MCNA 2EH7H 1CGSL 1DQDL 2EDFA 1CGWA 1U6AH 3T4AB 3OL2A 2UY4A 1K6QH 2VZ3A 3FQWB 2QLVB 4GRLC 1AFVL 5FKAA 1SYSB 2HJKB 4W81A 2XXMB 1M4KA 3PE9A 3VDHA 3H6JA 4HU0A 4K71C 1N64H 1G7IA 3UTZA 1QO3A 5GSVA 2DSZA 3D0LA 3U30B 5ADPL 1OAXL 3S88H 4KQ4H 2D9QB 5T1DH 2A3BA 3EKCA 4JEGB 1KTLA 3QCUH 3RPMA 5E6ZA 1MWAB 4E0RA 2WWDA 3H55A 5B38A 3MBED 5IQ7H 4HFWA 4PJIA 2FJHB 4RBPH 2F19L 2VSCA 2ZX7A 2WMFA 4JKWA 4PRIB 3ZKQD 5ITFB 4MJ6B 4OLYL 4WI5A 3RZWA 3B5TA 4HOWA 1KLFA 3D48R 2FSEA 2FGWL 2GCYB 1L8NA 5J56B 4NKMB 3C6LD 3ES6B 4LPYA 4RIRB 1ND0A 4KAQL 2WIIB 1H5BB 5HDQH 5JDSB 4ZENA 1ZLSH 1N2RB 3BSZH 1BVKB 3RWGB 4Z7WF 4TSCL 4D8PB 4FMKA 3Q5YA 1PAMA 5L88H 2WZPD 3KJ6H 5IVNA 3PWPA 3L1OH 4OTXL 3U36B 1U2CA 3ILQC 1CLXA 1YEFL 3VWJD 1ONQB 4NNYB 4RFNC 5FUCC 1EAPA 4FQ1H 4XVSL 1CE6A 3QUMB 1AGCA 1XR8B 4B5EA 1ACYL 5DJDA 5FIEA 3LHPH 1JRHI 4OGAD 4WRLA 3OJDA 4ACZA 5ICXB 4IRZH 1CDJA 3TCXA 3OKLB 1CQYA 1I9RL 1RZGB 1FO0A 3W24A 1BZQK 4YHGA 5HVHC 1NCDL 5GGVL 4LCIL 1XGUB 5DHYA 4AIEA 2VLMD 4XHQA 1XGQB 4MD0B 4OFVA 1ZTXL 2H3NA 4PRNA 1NKOA 4LNRA 1PDKA 1U93B 2EC9T 4P2CG 2XKNB 3NIDE 3QPQD 1S7QA 5IW6A 1RV6X 1QD0A 3AMDA 4RMWA 2CUMA 4UFJA 1HJUA 3WH8A 4PJFB 4Y4HB 5EOCJ 3P2TA 1A6ZB 5TDOA 1HL9A 5EU6A 4IRSA 3WDQA 2VDPL 4OBSA 3FAWA 2D7TH 2YLLA 4G43A 5I8OH 4UQ2B 3QXUA 1WZ1L 2L4OA 3JTSA 4JFPA 4G42B 1MXDA 2ITDB 3WS6C 1M53A 5ESAA 1FVCB 5J1SC 3VXOB 2G9HA 4WLCA 5D71H 3GXMA 4TUKH 1R6VA 3U0PB 2NSXA 1MEXL 3RZCC 2Z31D 3BO8A 5C09E 4HIEB 2YK1H 1U42A 1QW8A 1KBGL 4OCWH 4IRSB 5H37H 4PJAE 4L5FH 1L7IH 4OF6A 5ENWB 5A6KA 1UWEH 5B8CA 3BDBA 3TPUA 5GZOC 4GMTH 4ELMB 3UYRH 5TE4L 3FFCA 5E8DL 1OARH 1UM4H 2PBOA 4KI5E 2X44D 3VJ6B 4DQOL 4FNLL 5DQ9A 3I75A 4FQCH 4AY0A 2OJZH 3CH9A 5J1TC 4NO2B 2NT1A 4L8CB 4MAZA 3KWWB 1H11A 1JWMB 2YL6A 1JHKL 4NP4H 1XGUA 2CLVB 3GKWL 5DHYB 5EBGA 3PWPB 2VE6B 4YHPA 3VG0L 1RZJC 2JCCB 3H3BC 1O7AA 5C92A 3OA5A 4YHIA 3TNMA 4X6DF 4RISH 3IYLW 5IB1B 2F1AA 4S2SA 1A6TA 3QWQB 2VLRE 3QQ3B 4QHMA 3HC0B 5TFSL 1QFHA 3AZRA 1LO0H 4M93B 5LWYL 1I9IL 5IDIA 4JY6B 2JKXA 5F6IB 3LKOB 5GRUL 3NUKA 4OCYL 3ARBD 1C08B 5AUMB 5C7XL 2FR4B 5L7XH 4Q9RH 1JD7A 3KPTA 1G6RH 2HJFB 1N7ML 1LP9A 3GJFH 5TH2A 5F7LB 1H1NA 4OF0A 5CPTA 3LIZH 1NC4A 1RUQH 4MD4A 1K9DA 3BGFC 3LKNA 3TZVC 1NC4B 4QRRD 4DTGH 5LA1A 4MXQD 5FO8A 3W4RA 5I8KL 3UO1H 3SJVB 3VD7A 4GG6E 5I1JH 4ZNEE 1QBML 1I1AD 1TQSA 4UBDD 1RULL 4K07A 3T0EA 1G9HA 3AYSA 4H1LH 1IKFH 3KR3H 4XP4H 4GQPH 4F66A 4MJ6A 2F53E 5ADOH 2O5XL 3BMWA 2F54B 3HS0B 1ZS8B 5CP3A 2YFOA 4AQ1B 5GNXA 3NJ3A 1G7HA 2AJVL 2DQDL 4NQVB 3LB6D 5D1QD 1QBAA 2VDOL 1W1PA 3F5WA 3U6RA 3KL0A 3TVMA 3RWGA 2VABA 3UTPD 3V0WL 4E8DA 1OOAA 5JIHA 3EJYD 1JNJA 4JAMB 2BS9A 3H7BA 3HMWL 5EUOF 5ITBL 2NY0C 4EOWL 2JTDA 4LARL 2HT2D 3II1A 4NN7B 2IUZA 2XOTA 1EEYA 3TIEB 1U3YA 4UUJB 4QHMB 5FYJH 1FVDA 1XIWA 4KVNL 5DFVD 4QRRE 2HLFC 5GQBA 3OKKA 4NT6B 4XBGB 2APTA 2KH2B 1KCLA 1B0RB 1V7NL 4UIKH 4KRLB 3MA7B 5CJOL 3N9KA 2R23A 3L4XA 5C0CE 3S4SA 2V6HA 5FGBC 1BX2B 2Z93B 1IAIL 5JA8B 2ZP0T 3BP6A 1QWUA 4X6DA 4PG2C 2AJUL 2MANA 1NGXB 3L3JB 3MLZH 3VWKC 4NZDA 1GHSA 4N0FB 5LGJB 1AGDB 5DO2D 5HY9B 2H3NB 3LS4H 3SDXB 3VNYA 1I1XA 4LRIC 1U3HB 5BJTA 1UJ3B 3FFCE 1OB0A 1KN4H 2XT1B 4L8SC 4OKVA 2CSPA 4XNZC 4OI7A 4LIQE 2DQEL 2HFFA 4IM8A 1C5BH 4Z0BL 4BSWA 1WQVT 5EMYA 4LX4A 3ARED 4OCLC 1H3PH 5FO7B 5B3NA 3QWOA 1HJXA 1N3NB 2IBZY 1A6ZA 3WIHH 5HHPB 3QUZC 4GXVL 1ZS8A 3B9VA 4O5LH 3MQIA 5I18L 5DK2A 4L4OA 4PJFF 5DJDB 2I9LB 2IQ9L 5FL1A 1A1NA 4NQXA 2DMBA 4Q6IB 4DN4L 2PBGA 4M7ZB 3BIAX 3WMSA 3PDOA 4MJIB 3KYKH 3OKLA 4D9RE 2OLDA 2HTKD 4WFGD 1I1AB 2P24A 3TTOA 3FQUA 4ZXOA 3M8OL 1CD1B 1CIDA 3BP7A 3CDGA 5F97E 1YQVH 5HI5D 3BKMH 4LSQH 1XEDA 5CSGA 2RQ8A 3D0VA 4F7CA 5TJWK 1X4ZA 3SGJA 4WSJA 3B9DA 2A2QT 4X4YA 4GW1A 5JW3L 4YIQA 4HKJB 2R0ZL 2Y06H 3APGA 5I15L 3ULVH 1KQZA 3MMEB 5T5NG 4G9FB 5E2WH 3UC0L 1E0XA 1FO0B 1L0YA 4GKSA 4OLXH 5GGSY 5JOEA 3U4EA 1NC2D 4XAKD 4KHXH 3TFKC 1FP5A 5FDWA 3ILQD 3QHZH 5LXGL 4XNMA 5IXEA 1JWSB 2RIKA 3ARFD 5MP6H 5HGDA 3P0YL 4ONHA 4YAQA 3ECQA 1ZU8A 2BJMH 4FP8L 4LFHD 5JUEL 4EI6A 1B1YA 1LLOA 4UOW1 5JDJA 1FNHA 3TIDA 3TBVA 5I6XC 2MWCA 3UTTE 4LAJH 4OLZH 3HE6A 2O5YH 4CAGA 4EQ2A 4AMXA 4OZFA 2EYTB 1RIUL 1UB5A 3GO1L 4OZFB 4LLDA 3S35L 1KXQE 3MV8D 4RWHA 5FYKE 3V6OA 2IJ0C 1S9KC 3MANA 1NARA 5TD4A 5JOPE 3WN6A 3NACL 3ARBC 4UNTA 2CKBB 5ANMA 4DGIH 4KAQH 1KLGA 4OFPA 4FFVD 4OZGF 5M3WA 4NO2A 4OLUH 1A6AA 1CICA 3PXJA 2R4SH 4W6XB 4O51A 4E4PA 2APBA