1PEZA

Bacillus circulans strain 251 mutant a230v
Total Genus 241
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
241
sequence length
686
structure length
686
Chain Sequence
APDTSSSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDVVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKSNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTATWEGGSNHTFTAPSSGTGTINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cyclomaltodextrin glucanotransferase
publication title Conversion of Cyclodextrin Glycosyltransferase into a Starch Hydrolase by Directed Evolution: The Role of Alanine 230 in Acceptor Subsite +1
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 241
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 2003-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pezA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1pezA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1pezA01
1YEFH 1MW0A 3U2SA 4WHYG 2OMNA 3MCG1 3TCLB 3B8YA 3QQ9D 1BFTA 3QP3A 3OGCB 5L2JA 2B1HH 2X4OA 4DKAA 4FNQA 1D5IH 5D2LE 3RWDB 1SMDA 3GFUA 4Y4KB 3QEQE 5I8KL 3WUBA 2JLLA 1UQZA 2AGJL 5D2NC 1I3GL 2XKUA 3CZFB 5H2BA 1I1FA 4MA8H 4Z7WA 3QIWD 5EU4B 2YPLA 2AI0L 4J3UA 1KBKA 1JL8A 1F8TL 4NWTH 4YBLC 4O9HL 5CGTA 2ZCHL 3HA0A 4WW2C 4UQBA 1Q9OA 3MBEC 4JY4A 2X4QA 3AREB 1YMHA 1UJ3A 4ORGB 3ESVF 2QQQA 4ODBD 4JM2C 4FMKA 3R1GH 4AJ0A 3ILQD 3T2NH 5T1LA 3QHOA 1IL1A 5CWSA 4QRSB 3BGAA 2W65A 2E8YA 5A1AA 2X4UB 3T04D 1QOXA 3O4LB 4RFEA 2IADA 1JGVH 1UXSA 4QRPE 3ZT7A 5IFAL 2Y2WA 2FX7L 3UYPA 4F8XA 1NCCL 1MI5A 2JJUA 4R90H 4CAGA 2NT0A 1MQKH 2AJXH 1CG9A 2DIBA 2R2EB 3LZFL 1WIOA 4HC1A 3CFJA 4WI6A 5HYJB 5HDQH 4JLRA 3TIEB 4KXZI 5FO7A 5BRZA 1T7XA 2YBRA 5FCUL 3RWGB 4OZFA 2GJJA 3D0VB 3ARDD 5I18L 5HVWA 5AAMA 2AP2A 4I9WE 4CMHC 4HMDA 2GJXB 4U2ZA 3W26A 3FXYA 2VR5A 5IBUB 4F9LC 4NRSA 1DCLA 4BQ9A 3ZZ1A 3OXSB 1X6LA 3MV01 4LOUC 1VGKB 1W3HA 2CITA 4JFFA 2PYEA 3FCTA 1RUPH 4QRRD 3AQUA 1PZ5A 2JJTA 3O4OC 1T1ZA 4N8PA 4OFVA 3RTQA 4Q7NA 3OKNB 3QUXD 4MNHB 4NQVB 1PY4A 1FYHB 1A7PH 3MJ7B 5KVEH 4WUUE 1WC7B 3SCNA 3PP4L 2QQNL 1XF2A 3QO0B 1ZHLB 1QI2A 3T8XB 1HYRC 5DURB 5HBFA 3FTGB 3MOAH 2IFFH 5DO8A 3QIBB 4X6BA 3T08A 2C4XA 2W59A 3DMMD 2A3AA 1RZJC 2IQAA 3G04B 2IEPA 4QRTB 1W3LA 2OYKA 3CUPA 1EHAA 4H8WC 3VIHA 1M71A 3U4BL 2FHFA 1BYCA 1U93A 4G8IB 3KPNB 4GAGH 1BQUA 4JFXB 4PSRA 3QIUA 3VA2C 4RZCB 5GGTH 4MZ2A 5IV2B 1YN7B 2R0LH 2NY7L 1IKFL 2XTJC 4N68A 4XVUD 1UM6L 4HUKB 3WH5A 2WB5A 1MJJA 5A2CA 1FZMA 3PABB 5T1KB 2HJFB 2DLEA 4R6UA 2BSED 3GSNB 3FQWA 5TDNB 1HHJB 1P7QA 3TNMB 1YC7A 1A6WH 3FFCB 3B9KC 1FZOB 3KG5A 3L4WA 1FFPB 5C2UB 3MRQA 1GJUA 3WUWA 3D39B 3RJXA 1OP3K 2YPVH 3B2VH 4FA8A 2E9JA 2FDBP 1F4WL 2ESVD 1SY6H 4H1LG 1Q0XH 5C0CB 4KI1A 2D4FA 5FIPA 2QSVA 1KLUB 3I02B 3K46A 2CLZB 4MAUH 1KLFA 4P2YA 4RMQA 4MNQA 1E70M 3SE8L 4IRJD 5KSAA 3MV11 5ESVA 4JRYD 1CDIA 4QWWD 2WV3A 1OT2A 1WVZA 3BKYL 3AB0B 4D9RE 3G6DL 5ADOL 4U3HA 3FT2B 4MQXC 4IMLA 2NMSA 4UTAH 3ARQA 1S9YB 4CMMB 5BRPA 5IW6B 4WKFA 2DJ4A 4YFLI 5TE7L 4PEEA 1KEGL 2DM3A 1INDH 2B20A 3IF1A 3KNBB 1NBZB 3NSMA 4U0RC 2BERA 2N7BA 1AGCB 1OCWL 3FN9A 3WN5C 4DZ8B 3X14B 1JWMA 5ICXA 4O51A 1W3KA 3PXJA 1QRKA 2GUOA 5GRVK 1V6VA 2DI7A 2XA8H 4CGTA 4NQEE 5JBFA 1NDGA 4HUNB 1NGQH 3DJ9A 2YD2A 3EYUL 5GJTH 4EDXA 5CLWA 2WMJA 3QULA 3T0WA 3VM5A 4ETQA 3O4LE 1KXTA 4NO0B 3L3GB 1TJIL 3CD4A 3SOBH 1GIGL 4NKIH 3SKMA 1JYNA 3MRPA 3TH4T 4U6HB 2IAMA 5TF1H 3KPQB 5GZND 1EHLL 2QHLA 3OKDA 1W91A 1ZA6B 1BYBA 3FQTB 4WFFE 4MCYA 4JR9H 5SX4I 1AQHA 5I23A 1T5WA 3JWDC 5HYJE 2FIRT 1AKJB 1NQBA 4X80H 3R8BB 4HOZA 1I9IL 3VXRD 5AG8A 1U36A 3BFOA 4U2YA 1UYQA 3NCMA 4CD7A 3TBYB 3ZE2F 4UV4L 4K23L 4UOZA 3HNSL 4LBEB 1HSAA 5EZJA 5CSGA 5M17A 1S3KL 2V5SA 4ZFOL 4FXLA 3S5LG 3F7YB 1H8NA 4WIQA 3VFRA 4KVNL 3VRJB 4OCXL 4N90D 1LE9A 5GJSH 1P53A 3MYJA 2YS4A 4W8LA 3VUPA 3P73B 1CFTB 3AHXA 1FIGL 1V3KA 1QR1A 4PJHB 4PPTA 4OFKA 2IGFL 1CLZH 4JB9L 1FYTB 3D3VB 4X7SL 3A67L 2W4XA 1E4WL 3GXMA 3CFCL 4LVHB 3D51A 3KDMA 3OKOB 5C0AA 1S5HA 5K9QI 2OL3H 1BD2A 3CH9A 3UO1L 2H9GB 4H5SB 1IAIH 4QTIH 2NZ9D 1TCMA 1K8DA 5C9JB 4WRLA 4S2SB 4ZXOA 3LDBC 2J74A 2DYPB 3HZKA 3QR2A 4ODVL 1B3XA 1NGPH 3WBEA 4ZUSB 4JY6A 2OLHA 4LLUA 1S9XB 4OM1H 1JPFB 4LIQE 5I0ZA 1YC8A 4HA1A 1T20B 4GUPB 5D7JA 1CF8L 4P9HC 3GB7B 3D2UB 3JWOC 4YC2C 3MRHA 4YDIL 1RUML 4XPGL 4FZ8L 4LLAA 3U6RA 4HGWB 1A7NL 1HKLH 3M8OL 3WO4C 2NW3A 4BQ8A 1NMBH 3V0WL 3UC0H 1FO0B 4HWEH 1FP8A 2YOCA 2W66A 2PW2A 1PG7H 4LCWA 1JGUL 2DDQL 3BZFB 3Q5YA 4FOMA 1C8PA 3HI1B 4CUCA 1CL7H 5DD3H 4ESKA 3UZQA 1ED3A 4JFDB 4NNYA 1PIFA 1ETZB 3R06A 4HCRA 1FNSH 2WBWB 4XGZA 1EGJH 2AERT 3BXWA 5EN2A 2ARJB 3U1SL 3BUYA 4P5KB 1KPUA 3TYGL 5LAXA 3FONB 1AHWA 1NFDB 2DWDB 2M2DA 4MJ6B 2VISB 5CPTA 4LGPB 1G7LA 1JK8B 5D7IB 2JCCB 3UJIL 1KR0A 3TV3H 4AH2A 5JW5B 3CVIH 2G3IA 5SWSE 5I1CL 2FJHA 4XNYH 2Q20A 4RFNC 4RMRA 4URIA 4M00A 5DUPH 3PZMA 4KZEL 2YDSA 1DBBL 1OSEA 1SEBB 1ESWA 3P30H 5L2KA 4NXKA 5BVJA 2ADJB 4IIQC 4JFZH 3VFMA 4OUUB 3T4YB 2E5EA 3WNLA 3FO1A 5JUEH 4HEPG 4EK7A 4HF5L 5I1LB 1KACB 2AK4B 5A40E 1MW1A 2A77L 5MEPA 1JI1A 3VX1A 4NSKB 4D3CH 3TA3B 4QXUL 3ZE2E 4LEOB 1YYML 4DAGH 5JHDA 2P5WD 2OMBA 1QBMH 3MV7E 2VDLH 5HI5D 5M3WA 4AZCB 4E41A 2CIIA 3UTTE 2QF8A 2A6IA 3NCJL 4N8CH 3ARFD 1HEZB 1NUFA 2VR9A 2Y5TB 2QBWA 1VGEL 3FFDB 3BIAX 3CFKA 4FN0A 3PZOA 1KB5A 4EI5C 5KVDH 5DMIL 1UKQA 2FX9H 3HZYA 4L4VA 4CU7A 4PGDB 1BQSA 2YMXL 2EH7L 4LX4A 2HMID 5D71H 5LXGL 1KXVA 4QFUA 3JXAA 5DJDA 4GI6A 4HMEA 4ONOA 1FL6A 3MCKA 4PRWA 4PJFB 2AVGA 4E9LA 2XWJB 2E9MA 4GLRH 3KPOA 1I75A 5FUCC 5CUSH 1FL3B 2BJMH 5TFSL 5EOQH 3W0WB 1JCKA 1BWMA 3BP7A 3BPLB 5B3JF 4W85A 1HILB 3IXTB 4UDTA 1XHGA 3QUZD 4UNVA 3A23A 2DS4A 1XGTB 2GTWB 3WQVA 4CADB 1C16A 5HYSG 1WP6A 1JDDA 4GAYA 1UWIA 4YPGA 3SDCA 3JUZA 3RDTA 3ZE0E 3HC3H 4PS4H 4Q6IB 3QPQD 1I3VA 1MHEB 4IOFC 3G5YA 4W5UA 4K68A 4Y4HB 4MB3A 4I0CC 3K0WA 1CGSL 1VEMA 3MUJA 4HPGA 1Z5LA 4U1NA 4D8PB 4XT1C 4K71B 1IGTB 3CZNA 4K8RH 2DQTH 5ABFB 5DJ0A 1I1YA 1MWOA 2WINB 1MJUL 4ATDA 1CU4L 1P4IL 3CSPA 5JXEA 1T7VA 4RWYL 1JWSB 4NUGL 4EN3A 5D1XB 1RAMA 2P47B 1N5AB 3LRHA 2B39A 3DRTA 5H8DA 2WWMD 1DQQB 5LGKA 3QEHB 5I76A 3RVTC 4PTWA 2PI6A 4Y4KD 4JRXA 2IPKB 4GXPA 1OP3H 1KN4H 1QFOA 2O5YL 2AV1B 3WIHH 4OZIB 2VZ1A 1IJ9A 3BPOB 2EKSA 4X5XA 4EUPH 3E6FB 1NCAL 2XIDA 5B4MD 2ZE0A 3D25B 5A2BA 1QW9A 5HHPB 5BVPH 1R5IB 5J56B 4Y8DC 4U1LA 1RH9A 4HV8B 3GMRA 1U8IB 3VFPB 1IEBB 2GFBA 3TN0D 4HPOH 2Z8WC 3FQNB 1R7AA 4X6CF 3QXTA 4JFDE 4XCEB 2VDPL 4JANA 3CX2A 3RWJA 1FSKC 4MA1B 4E4PA 5KSVB 4YR6A 2OTWA 4QLJA 2WP3O 4WHTA 1J86A 5CJ5A 2QTEA 1OTTC 2CIKB 1XGQA 2L7JA 4RISH 1NFDE 2X70B 2AJ3B 3O4LD 4WV1C 3IFOB 3IK2A 2JCCE 1UR4A 2VLRA 1SM3H 4QT5B 1OINA 3SCQA 4L9LB 1MF2L 4YZFE 4YDVB 2ZUSA 2WXDM 1NGZA 4KQ4H 2WHMA 3C5ZC 5HYJD 1TQVA 3VSTA 2QKIB 3Q2CA 2H1PL 2NW2B 2B0SH 3FN0L 2BCKA 2VUYA 1T21A 5KOVC 3QI9C 3CJJA 3SE3A 2IALB 4MB4A 4NRZA 3BRFA 4N9GA 3EYOB 3GSUB 2DRUA 4NHUB 1MYRA 1US3A 3QISA 1BTCA 4PJXE 5BXPA 2NY2C 1D5ZA 2QR0B 1IZKA 2X7LB 5I8OL 4FNPA 4HX1B 3RU8H 4KROD 1U2YA 3T65A 4P7LA 1QZ1A 3HE6C 1DHKA 4Y16A 5JW4N 4WVRA 2FJFB 3WY3A 4TOYL 3C6LA 1KIUA 1FA2A 1G0XA 5DUMH 5B3JE 1XGUB 4GRLC 4RAUA 2NY6B 3RNQB 5F9JA 4V27A 4PJBF 4AEHL 1WPCA 1W1YA 4TUFA 4B3LA 3H9YA 1TFHA 5C09B 4PJIA 1MWAB 1NGYA 2EDWA 4FNLH 4UQ9A 3H3KA 4PN2A 2YRPA 4NT6A 2D7NA 2P8MA 5E95B 5F6HJ 3CZEA 4JG1L 3K8LA 5DURD 2CJUH 1AXSB 3CPLA 4ELMF 3B8SA 5KZ6A 1UWUA 3V0VA 4NO5A 5C0FB 4PJFE 1B4RA 1A0QH 2ARJQ 3QIBD 1KQYA 1UB5A 1XC6A 2Y72A 4DEPC 1TE1A 2VC2H 4S1SH 1KGWA 4DKEH 2X2HA 2I60H 1TMQA 5LKNA 4NI3A 3S98A 5HD8D 4KV5F 3UAJD 1U3YA 1MCSA 4PJDA 4Z78A 3WSQL 4OQTL 1SZNA 5MHSE 1DDHB 5I17A 3ALXA 1F02I 3LEYH 3WLWD 5T1KD 4CVUA 2F5BH 2MTPA 2PF6A 4LHUA 3ILPB 5DLMH 2WW8A 3VWKA 2YZ1A 4PV9A 4R26H 4N1HB 3FFCD 5A3IC 4ZTPH 4NGHL 1CFBA 4FXKB 3U2SB 5BZWB 3STZB 4JFHE 1IAKB 1K9DA 3D39D 3RY6A 1FG2A 4OD1L 1CBVL 4AZHA 2XT1B 5L2JB 1PQZA 4QHNA 4X6CE 2X4OB 3MA7A 4M62H 5HDOA 4JVWA 5C0CD 3W0KA 1FHDA 2YWYA 5FXCH 1FQ9C 2PTVA 2E7BA 1ADQL 1QBBA 3M45A 1JG9A 5H2BB 1I1FB 2YUZA 5KW9L 2YPLB 4N0UE 4NKMA 4ZODA 3BIBX 2YN3A 4OZGF 2BVEA 4F2MA 3V5DA 4CDHA 1Q9OB 2XN9E 2EC9T 1S7SA 4JY4B 2MCG1 3A3HA 5IB3A 1YMHB 3H3BC 1NEZG 4U1JA 1UJ3B 2EXYC 5AYQA 4TUKL 5TE4H 4PBGA 3CMGA 1LF1A 2XFYA 2YD8A 3OF6A 4XNXL 1L7TL 3VI4F 3BH8A 4UTBL 4PJCF 5IVZB 1I8IB 3LH2L 1IL1B 1K4DA 3DGGA 3N85L 4OD3L 5CWSB 3CBWA 4PLKC 3RMEA 3PNWB 1J1PL 2Q6WA 2JK5A 2YKLH 1R24B 3FB6B 4S1RH 1UKTA 3V6FA 4RFEB 1TVHB 1LL7A 1V3JA 2IADB 1R3IL 1UXSB 1I1AC 4M3KB 4MQTB 3UTTD 3QDJE 1MI5B 3GMQA 3PV7A 5E2TH 2PC8A 2E40A 1TDQA 1CG9B 4WI7A 4NO0D 4HZ8A 1MY7A 4ENEC 4NIKB 4ETYA 4XX1E 3CFJB 2NY1B 3CLFH 3BDYH 5BO1L 4F58H 4FNUA 1X9QA 5J1TC 3QCUL 4JLRB 4MADA 5FO7B 5BRZB 1G5AA 1CDCA 4GRWB 5T5FH 2V17H 2YBRB 5F93C 4OZFB 4XNQA 1E9LA 5T3XH 5GSVA 1R5VA 4UILL 1AKJD 3VGDA 3JUGA 3WH8A 4DGIH 5C0IB 4LRNH 5KEZA 3UTQA 4H20H 2XA3A 4KPHL 5EB8A 4GKNA 5C0RH 3L5HA 4TVUA 1ZXQA 3RIFK 3SO5A 5FHAH 1D5BA 2BVTA 4JFFB 2PYEB 5LCVL 1ZVHA 5D2NA 1JZ2A 1KCKA 3N1QC 1PZ5B 1MCPH 2XSAA 5DSCA 2VDNL 1B0GA 3C09C 1BG4A 1T1ZB 4LGRB 4OB5L 3REWB 3DOSA 4LSSH 4X8JB 1J18A 2D7QA 2FHBA 1HNGA 3BEWB 4H04A 3DETD 2CHOA 1FYTD 3D3VD 4PRPA 1SMOA 3C9NB 5EIVA 5DQ9B 1N26A 2Q8BL 4WW2A 5FUOH 3NFSL 2HLFD 2NY0C 2WMIA 5F6IC 4UR9A 4JM2A 5E6YA 4M4RA 2AJVH 3GJFK 4ONGH 4U1GB 4WEBH 4JEGB 2PETA 2DYPD 1RFDL 2PR4L 4X6BB 3NIDE 3KYKH 1DL7L 2VX5A 3WUGA 4CVWA 2IQAB 4EOWL 4U1SA 4ZUUA 2DIAA 3CUPB 1QSVA 3O3EA 1M71B 5DVKA 4YFEA 3L1OH 1FNEA 1QWNA 4W87A 2ITDA 2Y7QA 1BGAA 1XH3A 2F19L 3D2UD 4F7PB 1IM9A 4JJ5A 2R0ZL 5BXFA 1U8OA 4XC3H 5FYLE 1WDRA 2HH0L 5F1NA 3L3JA 4HK3N 1FZMB 1GQKA 4C58B 2YEZA 1I7UA 3FQWB 3OZ9L 1W1VA 1P7QB 4R4BB 3ZHLA 4JFDD 1A3LH 3E0GA 1JDAA 1EEQA 5DD0H 4F9LA 3MRQB 4POYA 3WUWB 1LQSR 4XB8A 3S35L 2QPSA 1PVHA 4QGYA 3BVVA 3HE7A 4PY8I 3I75A 4G7YH 1SVCP 4K7PH 4KKBC 3OB0K 1TNMA 1FVEA 4GO6B 3JTTB 3VSVA 1U30A 2ZG1A 4OCLC 2ZNWA 1S78C 4IDLA 3VI4E 1F3RB 2IH3A 4ZNCD 5IJKC 5KSAB 1EGZA 5ESVB 1CYGA 1E4LA 3WD3A 3FHAA 4NN7C 1A5FL 3NABL 5I6XB 4JGJA 4XCCH 3WKNA 4G9DA 4IMLB 1E4XI 4Z7WE 2YPLE 4XPHL 4AD5A 3TTYA 1SYVB 3VJ6A 2W9EH 4F7EA 2J4WL 3U0TB 5EO9A 1T1YA 5A2JH 1W0VA 3U9PH 4LSDA 2AK4D 3MYZA 1S7XA 4U49A 1JWMB 3N1PC 4HXBL 4O51B 5ICXB 1HHGB 2GUOB 4UCFA 2MSPA 2C7UA 4YBQD 1FDLL 3TA3D 1FORH 1IQWL 3WF0A 2HKHH 5HPOA 3WKZA 2EADA 1A4JA 3VRIA 3QULB 5HI4D 1J88A 4ETQB 1KXTB 3SCSA 1RIUH 1B0IA 3ZJ7A 1XGRB 3SKMB 1T1WB 2IANE 2QQLL 3MRPB 3NTCL 2X89A 1ZBKA 3OKDB 3RVWD 3DV4A 2J7BA 2AXJA 4PJ9D 3BN9C 1K9TA 1FV1A 1DLFL 4Z0BL 3HG2A 1T5WB 4MNJA 3D50A 3IJ8A 5ANME 1MJ8H 3GH7A 5GGSA 3FQUA 2GFTA 5BRZE 1GGTA 1DE4A 2Z35B 3EJQA 1D5XB 4GRWE 3JWOL 1FZJA 3RWIA 3L3IA 1Z6JT 4X4ZA 1H0IA 4AQ1B 3BKMH 3MNZA 1XSIA 3VFRB 4DO4A 2VAAA 1CFQA 3UG3A 1ZLUK 3MYJB 4CJ1A 1CLCA 3FQRB 4S3JA 4EEEA 1OY3B 1QFWI 1QR1B 3HNTL 3VXSA 2J8GA 3F58L 3IKCB 3BGFB 1AD0A 2PYEE 4I3SL 3WHE0 4Z2JA 2JB6B 2HTKD 2X5PA 4Y1AA 1KBGL 2G8ZA 3KDMB 1Q9WB 1S5HB 1SYTA 4MQ7A 3ZKQD 1AR2A 1BD2B 2P45B 2X1PA 2ICWJ 3AY4C 1K8DB 4Z7VA 5IWLC 3W9EA 2VZ3A 1JF1A 3TT1H 2DQDL 3CSBA 3OX8B 3VDCA 4Y4HD 1T03H 2HJLA 4L3EB 3HZKB 5F8RC 1PD6A 1VCAA 4JY6B 4LLUB 4QHMB 3EJRA 1MWAL 4LASL 4ZYKA 1XGYL 2IQ9H 1C7TA 1N6QH 4TVPL 3N11A 5D1XD 4R7NA 4LLWA 4I48B 3W38A 3MRHB 3OQ3B 3CLEL 4KKLD 1JRHL 3U6RB 4FNSA 2NW3B 1A7QH 2OZ4A 1EEUA 3IU3A 1LEIA 3DIFB 4HIEA 2PW2B 4LCWB 2P5EA 4JO2H 2A9NL 1MFBL 1ED3B 1TITA 1W2VA 4NNYB 3VD4A 5E2UL 1H9VA 2G75A 3R06B 3F5LA 1T22A 4HIXH 4XGZB 2O93L 2J6EH 4PMYA 2X1OA 2G3JA 3GGWB 4M7LT 5EN2B 1E6RA 3BUYB 2J7EA 1CICC 3SDAA 5JMOC 1R3KA 1B3YA 1KPUB 3MODL 1U8MA 5FKAB 1AHWB 1XF4B 1X1NA 3OMZA 3KWXA 2XPGB 3U46A 1FOBA 1G7LB 2A3EA 4M7KL 4AH2B 1A6UL 1V3MA 3SCRA 5DR5L 2DTML 3NIFF 3VGEA 4X5WA 4MNQE 4G9FA 4YHLL 1GONA 1PSKL 5IKCA 3NSXA 3HRPA 3QPXH 5L2KB 1E15A 2CUHA 3X3FH 5BVJB 4PUEA 3VFMB 1CZ8L 5K59E 1T66D 5IM7A 4MXWL 1JYXA 3FO1B 2VRJA 1DBAL 2JIXA 2Z91A 2EO1A 1OHQA 4HU8A 1BGGA 4H2CA 4EXPX 3WNKA 5LBSH 2FD6L 3VFOA 4QOKA 5MENE 1AVAA 3EAKA 5EU6A 2XGIA 1AP2B 4UFIA 5BXRA 1HH9A 5E8PA 1O6IA 3MLWL 1WAWA 2FO4A 5JHDB 2PWEA 4YHPB 1E6PA 1WIUA 3MJ9H 4E41B 3EOTH 3QNYA 5DT7A 4G8FA 1NAML 2P48B 3O6MH 1VACA 5DEZA 4NRXA 3CFKB 4HOXA 4H8UA 5DZNA 1KJ3L 1JF5A 1EJOL 3G9VA 3ISWA 3V4PL 1KJMA 4L4VB 4WDIA 5ALBH 4N0YL 5DZOA 3VG9B 2NY6D 4XTRD 3BT2L 4HC1L 5D9SA 5C08E 3ZDYE 5I8KH 1QI3A 1EO7A 5JR1L 2R15A 2AGJH 1I3GH 2XRAL 3MCKB 1RUKL 3QEGL 4IBLT 4U7KA 3RM9A 2AI0H 2X2IA 3OLDA 2BY0A 3GMPA 3AS3A 1F8TH 4ZOCA 1G7HA 4O9HH 4UINL 1P9MC 2AQ2A 2ZCHH 4WSJA 2X9XA 2DQIL 1OF2A 4PBWD 3GJFH 3T3MF 5CD5C 4UDTB 3M07A 3KPPB 1UC6A 1UM5H 3WXWL 1MNUL 4GAYB 4YPGB 4KHXH 2F7OA 3SDCB 2V7NA 5BXSA 4Y88A 3MLPA 3ZTNL 4AL8L 4WLCA 1T6VN 3ZDZE 5C0AE 2JB5L 3G5YB 5IFAH 1AQ0A 1BD2E 1MELA 2ZWYA 3SIMA 1Q1JL 4HWZA 5I74C 4JKPL 4OOUA 4ZFFA 1Z5LB 3LZFH 4U1NB 3BRDA 1CK0H 1O5DT 1X5IA 1AO7E 2MJWA 2IXVA 5DJ0B 5BOPA 3GHEL 43C9A 2EYRA 5D8WA 1WQVT 3P4OA 2N4IA 4O5LL 3DRTB 1F3JB 5FCUH 4EVNB 1WEJH 3OGSA 5I76B 2H26A 3MFGB 2YRLA 2WAHA 1V0NA 5I18H 5ENWA 4JRXB 4X0VA 4LLYA 1U8NA 1F4XL 2EKSB 3OB0H 4X5XB 4B5EA 4EI5A 1GCYA 5GISL 3ZLQC 2ZX6A 2YPLD 2C4FU 3OPZL 5ISZA 3MRBB 2TAAA 4LCYA 3V9FA 3ROOA 3QUML 3T0EE 4LCWE 2ED8A 4U1LB 3VDHA 3GMRB 2VQTA 4PJAF 2GFBB 4R2GB 5C71A 2EEAA 4MXVE 2EACA 1OD8A 1I7TA 4D6FA 5C1MB 1CE1L 4JANB 1ZLVK 1KB3A 2DSVA 4XB7A 3AISA 4ZXBC 5T1LD 1S9WA 2XIBA 4YR6B 2OTWB 1ZA3A 5CKAA 3PP4H 3DX4A 1XGQB 3VGHA 5I1EL 1OQXA 1R7OA 2ZPKL 4AIUA 1D3CA 3DLQR 3VIGA 1N3NB 2V9RA 1MI5D 1NCNA 4E0RA 5MEQB 2OXHA 4Y2DB 2EDDA 3BD3A 2I27N 1U2CA 5C0GA 3U82B 2JIWA 3DSFL 3CH1A 2QLVB 2WC4A 2NY1D 2HT3C 3OGOE 4JFPA 4M3JA 5L2KE 3BRGC 3U4BH 3L5IA 3UR7A 3AIUA 2BCKB 1H09A 5FDYA 1T21B 3FOLA 5BRZD 4BF7A 3C5SA 3BUBA 3HI6L 4G8EB 3EDDA 1A3RL 1KR1A 4NRZB 5DHVH 1UOKA 2NY7H 1IKFH 3OAYK 4N9GB 1YY8A 5EUKA 1UM6H 2CKRA 4LF3A 1F90H 2FDMA 3MRDB 2BX5A 5DMYA 5FAAA 1CDGA 3HB3C 4RQQA 4PCTA 1D5ZB 3PN8A 3WL0A 4U6VL 5ABGA 2EE3A 3UPCA 1CNVA 4JFFD 2PYED 5JHDE 3T65B 3VGAB 4Y16B 4PJ7A 3RHWK 3HC0A 3C6LB 2YUVA 4BQ3A 2EDRA 2W92A 1F4WH 5F7NC 1ZLUH 4P7RA 4ZO7A 3T3ME 4YK4B 2GJZA 5F9JB 4R8WL 3SE8H 1U8LB 2X40A 4HUUA 1EDQA 4GQQA 4L4VE 2H32A 1E1EA 4PJIB 1NGYB 3SO3B 1DVFC 3EOYG 3BKYH 4NT6B 1U3HA 2P8MB 1IILE 4S11A 3QUYC 3MSPA 5EWIL 4UQAA 3G6DH 2J4GA 3FRPG 3CPLB 4LCIL 2VQ1B 4I2XB 1LEGA 3KPRA 3V0VB 4NO5B 4PGCB 1MLCA 4N5EC 3HZ3A 5C7XL 5TE7H 1R3HA 1UB5B 5HYQA 3UYRL 1KEGH 4KKCC 1ZHKB 1WCBA 2VVSA 4B15A 1UKSA 4BFGA 4BELD 1A1MA 4AY0A 1OCWH 1HWHB 3V8CA 4EI6B 4PJDB 4JFOA 4Z78B 2QPUA 3SCPA 1I8MA 3QIUD 5I17B 1GOFA 3N50A 1T2XA 4B50A 5ID1B 3EYUH 3N9KA 4R0LC 2V3EA 8A3HA 3QI9A 1SJVA 4LHUB 4KK8C 1GIGH 4PV9B 1YEEL 5D70L 1P7QD 4PJ8C 2ENSA 5IF0A 1BX2A 1MVUA 5E5UB 4XPFL 1XSKA 3LKPA 3DDGA 1EHLH 4Q9QL 4JHAL 4HMCA 2A0LC 4D71A 2XYCA 1FG2B 4NBXB 5ILTL 1PQZB 5CJOL 1T0NA 3MA7B 2DM7A 3P77A 3Q1SL 1I9IH 1PG7W 2BSRA 4KK9D 1EUTA 3BAKA 4UV4H 4K23H 3HE6A 4IPLA 1I4FA 3HNSH 1UR2A 3HMXA 1WT5C 5D1ZB 1S3KH 5KSAD 3B2UC 3MX0A 4OQ1A 3LIZL 5GSRB 3UX9B 5CD3A 1OLLA 3ECBB 4HTYA 4GRLA 2NXZC 4NKMB 3NMEA 4OCXH 1W2KT 3ZHDA 3GXTA 4XP6H 3RHWF 3U48A 4TOQA 1R8LA 4KDVA 4F2MB 2E27L 5CP3H 2XNAB 1FIGH 4FQLL 3V5DB 1H49A 1S7SB 2EO7A 3MLZL 2R2CA 5IB3B 4U1JB 3UTZA 2IGFH 3AJ7A 4CD8A 5A6BA 3O2VL 1LEKB 2G9HA 4X7SH 4XCFL 3A67H 4XVSL 1E4WH 3BH8B 3CFCH 4GSDL 4X9FA 1ZOXA 1ES0A 1K4DB 3DGGB 5EO1A 4L8DA 3UO1H 2Q6WB 2JK5B 1PKOA 2D3NA 4QHKJ 2WIIB 3V6FB 1ZE3C 2AW2A 4WIWA 3X13B 4NJ9L 4MDOA 1EAPA 5IMOB 4B41A 2WCGA 3GMQB 4ODVH 5JW3L 4X6FA 1JYVA 2XFXA 3RAJL 4LVEA 1VAHA 4ODTL 1LLOA 2BNRB 1MRFL 2HWZL 2VLRE 1XGPA 4PJ5E 1B2YA 4M7ZB 1F11A 1RV6X 3VIKA 2WZEA 4CNIB 1CF8H 2F1AA 4YDIH 3VGFA 5GSVB 3RVUD 1RUMH 4XPGH 1O0VA 4FZ8H 3QCTL 1A7NH 3M8OH 3MCLL 2ENYA 4K7FA 4H0HB 2DT3A 2D73A 3UTQB 1R34A 1U92B 5D7KE 3P0VL 4GKNB 4K94L 3VIPA 4UFHA 3AM8A 3S5LA 3N04A 1HYSD 4X4XA 5DJXA 1W0YT 1D5BB 1CCZA 2XZCL 3AIQA 4OGZA 5CILL 5D2NB 4EDWL 2XKNA 4RGNB 3O6LL 5I66A 3U1SH 1B0GB 2QHRL 3TYGH 4MJIB 5TQ0L 2GAZA 4PRPB 4EZMA 4YBLB 3DX7A 3C60C 5FOBA 5KVMC 1QNQA 1R6VA 4WW2B 5C0AD 3UJIH 2K7QA 1BD2D 2XG9A 5I1CH 1S8DA 2DN7A 4F79A 3WFZA 5I75C 2WLYA 3AYRA 3I6LE 5CMAA 5HHXL 3M46A 3F7QA 4PMRA 5C2BH 4KZEH 1KIQB 1UWGL 4Z95L 1DBBH 4HKZA 4JCLA 4L3ED 3O3DA 2CQVA 1IGIL 3CVHL 1IC7L 3K4DA 4NNXA 4XXDA 4U1HA 4L4PA 2F8OA 1I1AA 2HYMA 2E9IA 1CLYL 3LEVL 4ODXA 4ZUUB 2JJSC 4YFDB 3VD3A 4H0IA 4HF5H 1Y6MR 1VFBA 3KLDA 3O3EB 2A6DA 5E5MB 5D7JD 2ITDB 2A77H 2Y7QB 1XH3B 3QDGB 1IM9B 3DURB 4JJ5B 1EV2E 3AU1A 2ZP0T 4FQCL 4MXQC 3EDEA 4P48A 3PHOA 5SX5K 5LJYH 4BS0A 4QXUH 5F1NB 1GPOL 4HIJB 5ESQA 3IXAA 4PJDE 2O9OA 4ODHL 2YEZB 2CKBA 1YYMH 4G43B 1I7UB 5DGRA 4LCWD 4PJHF 5EULV 1JN6A 4ZSOB 3A6CL 3HR5B 3NCJH 4FFZL 4JG0L 2DT0A 1GOGA 3BVUA 3WYRA 5DRZA 3RJYA 2J12B 1VGEH 3KWWA 2H2PC 2LU3A 1LDSA 4WWKC 3HE7B 2NY4B 3I75B 3U4EA 4GO9A 1XT5A 4K3EL 1CGXA 1FVEB 2YMXH 2EH7H 4KZDL 3WMCA 1BIHA 5LXGH 2F53A 4JKKA 3VFGL 1YHTA 3PZNA 4N5UA 3RBSA 4JY5H 1EOKA 3TVMC 4DKFL 1LO2L 1ZLVH 4POZD 2ADFL 2ITCA 5M03A 4LU5L 5IXEA 3M1BA 5TFSH 3P9LA 4G9DB 3ZKNC 3LKQA 3B43A 1ZVSB 43CAA 4NX0A 5L2KD 3GZAA 2PWFA 4PG2C 2NY5L 4UNUA 2WM0A 5D96C 1TVPA 4Q7DA 1F2XK 3O9NA 2CGRL 5EO9B 5SWZA 1AD9B 2Z8RA 3A0OA 4HAFA 1LJYA 1W0VB 1S7XB 1YQVL 4X4MA 4HG4J 2L7UA 5H94A 3NCYP 2VAJA 2C7UB 2FLBT 1ODZA 4X98A 2CKNA 1MW2A 2Q3ZA 1PDKA 1A4JB 3VRIB 1YDPB 2AMGA 2VH5L 3NDYA 1CGSH 1HHHA 1UA3A 3OAYH 5JHDD 1U8HA 1BP3B 2CLVA 4CD4A 2A3CA 3D48R 4E41D 3FT4A 4TTDD 4P5TC 1MJUH 4H88L 1CU4H 1P4IH 1YEIL 3PXHA 3AZTA 3KE0A 3DV4B 3BESR 4RWYH 4NUGH 3PF2A 3WL1A 5D7IF 4XB3A 1M03A 5EZOL 4NYLA 2XVGA 4MLIA 4L4VD 5GGSB 1AGFA 3VG0H 3FQUB 1DE4B 1KFAL 2O5YH 3RWIB 1FZJB 5FM4A 3L3IB 5FD0A 3P11L 3DX0A 4YGVA 1NCAH 1RZKL 3ZOAA 3MNZB 4LK4A 4Q2ZA 1QFPA 1BVKA 1UZ8A 4TQEL 3H53A 2GYSA 3G6JF 3CPUA 1AGBA 3EJZC 3MMWA 3FB7B 4H41A 3VXSB 3BVWA 3NACL 5E1AA 2VDPH 1AD0B 1W1TA 3PWVA 5EO0A 3PWNA 4Y1AB 5D2NE 4RFOL 4ZUVB 4PJGF 4MQ7B 5HYSA 4DQOL 3BUDA 3SDCD 3HZMA 3RDTD 1KC5H 3RO8A 2WUBH 3HUJB 5DD6A 1DANU 4PRPE 4MCZB 2FEEI 3F7VA 2BRRL 4Z7VB 1JF1B 2HJLB 5H35A 1MF2H 2ZX9A 3S3PA 1BVLA 1QLEL 1JXJA 4IM4A 3GIVA 4OCMC 3KJ6L 3TV8A 2WMPA 2H1PH 1GJWA 5JXED 4ZO6A 3FN0H 3LD8C 3CUIA 3EYQD 4R7NB 4LLWB 4QCEA 2J5LC 1TNNA 5J6HA 3SGDH 3UMTA 2ZSWA 5FF6A 3UJTL 4DKDC 2O92A 4GQPH 1FVCB 1SVZA 3QO1A 3H0TA 4YHEA 4JRXD 4JREC 1LEIB 1ZL1A 1QR4A 2FH8A 5GS0L 3HS0B 5I8OH 2CMRL 2P5EB 4EE9A 1X4YA 3RP1A 2YHGA 4DJMA 1T22B 2OI9C 5DGQA 4FTVB 4R2GD 2M8XA 2D2OA 3RCNA 4TOYH 3SDAB 1R3KB 4DUVA 5KVFL 4OAWA 3UTSA 2FGWL 3PWPA 5GS2H 1ZHBB 4PRNB 3U46B 5D7SL 3BCFA 2J78A 4HWNA 3CIVA 1F6FB 4FLQA 1T7WA 6CGTA 4X6DA 5AYBA 2NY3C 3BYYA 3CZ8A 4JG1H 4X5WB 3S5ZA 4P5MB 4G9FB 3TPUB 1DQLL 3CDYA 5IKCB 3DX9A 3W6MA 1E28A 1K2DA 4Y2DD 3TH2T 3GBEA 3AY4A 2VNCA 3TIDA 4PREA 5IWLA 5A8PA 3MZGB 1NBYA 5DD1L 4D6DA 1XIWB 5AD0A 2JIXB 2Z91B 4PLJD 3CZSA 3CUFA 1H3XA 4P46B 4WENB 3SGEH 1Q72L 1KPRA 4IJ3B 1AC0A 2G3NA 2DQUL 3MRMA 2OSLA 3WSQH 4OQTH 4XWOD 4N42A 5D7KD 2D9CA 4QOKB 3GBLA 5DO2D 5KVGL 3TWCL 2PXYA 5EU6B 1UH4A 3V7AG 3TGXA 4B16A 5E8PB 1Z9LA 5LGHL 3PHSA 1KOAA 5DFAA 1JPGB 5HPMA 1M01A 1GVIA 1HOCA 2CERA 3MLYL 5K93A 1HIML 5FEBA 1X5YA 4NRXB 3FZUD 4Y16D 3VOCA 4OD1H 3DYOA 2DTSA 3C6LD 4O2FA 1II4E 1KJMB 4WDIB 5FYJE 5D9SB 1ADQH 3CMOL 3P0YL 3O2WL 3ARZA 1CICA 2DL2A 4FXGB 1FGNL 5KW9H 3ZR6A 1Q6EA 2EH8L 4ZMAT 1T7ZA 3FQXA 2UVFA 4RNRA 4X9BA 2BSSA 4KUCD 4NZFA 3QYCA 1D6VH 1G7HB 4GBXC 3VCLA 2A6JA 3ZKXC 5T1MA 3OWEA 1IC5H 1G0CA 3WH9A 4KQ3L 1CLVA 2EJ1A 25C8L 1MRDL 4PIRF 3V6ZB 1IFHL 1Q9LB 1L7TH 1V03A 3A47A 2LAAA 4K8RC 1BF2A 4UTBH 4RSVA 4Y19E 4Y5YC 4RE3A 2EICA 3LH2H 4PYHA 3N85H 1A3QA 4OD3H 5GS0D 3VXSE 2V7NB 1HNYA 4YHIB 3MXWL 4U6XA 3N06B 4LVOB 4NKQB 3EYVA 2ZUQC 1NWSA 1RZ8B 4RDQF 2WUCL 5CBAA 2XHYA 3BEVA 5CPSA 3M6DA 5I2UA 1PIGA 2VN4A 4S0SD 2FGZA 5JTWA 1QOKA 4HWZB 1KENL 1F6AA 1K8IA 3FT3A 3KPLA 4ISVA 4LHUD 3PJSA 4HKXA 2UY4A 5SX5H 4ZFFB 3VWKD 5KN5A 2RHEA 1MH5A 5BO1H 4X9IA 5HHME 2XVNA 3QCUH 1DEEA 1TCRA 2E3VA 2EYRB 1R75A 3P4OB 2YD5A 1FNAA 1E4MM 4WJ5A 1U8JA 3NUKA 2H26B 1EEYA 5ENWB 4W70A 5JZ7D 1U8NB 4L1DA 4UB0L 5BWFA 4KPHH 4EQ2A 1ISZA 2BVUA 5D1ZD 4EI5B 3KZSA 4JQVC 1TMCB 3MNVA 2O9TA 8FABB 5ISZB 2ED9A 2DLFL 4LCYB 3X17A 3HC4L 5LCVH 1G01A 1HWGB 2FSEA 2VDNH 1S9VA 2EYSA 4OB5H 5I1KL 1I7TB 1NEZA 2VL5A 3OF6D 4UT6L 2X4TA 1P9MA 1JFQL 4GS7C 1S9WB 2Q8BH 1NCWH 3GBDA 4LL9A 3NFSH 4OLUH 1ZA3B 2RJMA 3IDXH 3W81A 5TQ2L 5BW7C 2ZUNA 2NX5A 4WTXA 4WGWB 1OAQL 2YSSA 3N12A 1Q38A 3IU4L 1RFDH 4E0RB 4AIZA 1J5OL 5GRJL 1DL7H 4BQ5A 4AD0A 5E8EA 2GIYA 2DD8L 2BNRD 3CH1B 4EOWH 3SCUA 2EABA 2XOTA 4JFPB 1PGRB 3O2DA 4QDMA 2Z8VC 3FOLB 3C5SB 1AJ7L 2F19H 4E42A 1FAKT 3RPKA 2R0ZH 1YMMA 3KVQA 2YBTA 3MOBL 2DMBA 3KJ4B 2I07A 5EUKB 1YY8B 2HH0H 4LF3B 3QAZC 2APTA 1XH1A 3I84A 2R29L 4LKCA 3LXBA 3WFHA 1KCLA 3LKSA 1FH7A 5DEGB 3GEWB 5F3BA 1XCTA 3TH3T 4AZIA 4JPIA 4RQQB 3OZ9H 5HTSA 2KDGA 2H2SC 5EU6E 4N0CC 3U0WL 4JHZA 3UG5A 4HS3A 3O41A 4RMSA 5GXBB 3DYMA 1KUMA 4LVNB 3GTNA 5J13B 2W62A 5TGBA 3PHAA 2F58L 4RGND 2DMCA 3HC0B 1ZU8A 1DWGM 4V1DA 2GJZB 4PRPD 4W68A 4L8SC 3MJGX 2R1YA 2ZX5A 3ZQ9A 3U7YL 2H32B 1J8KA 1HXKA 3ARTA 5CG0A 1U3HB 1FSKB 4JM2D 5FECB 1UH3A 4ZXBA 3K4ZA 5H37H 4AZ6A 4G6FB 1UADC 2XN0A 4BQ2A 5I8EA 1MLCB 3R0MA 4XPHH 1KCVH 1E71M 4AT6A 2VZOA 1T0MA 4KTDL 5HYQB 1QSFA 2PWDA 1G9ML 3OB8A 2VRKA 2EQDA 3LMJL 1G7JB 1WCBB 3W39B 3EBVA 4PJ7F 4FFWC 4R90L 1HF6A 1FFOB 1E6JL 1A1MB 1AI1L 1JIBA 3NIGF 3ES6B 5GGSY 4M02A 3ZR5A 4HXBH 4JFOB 3JVGC 4W6WB 1I8MB 1IM9D 1KCRH 3QXWA 3GSXB 3W37A 1FDLH 4TUOB 5IHUL 2OWCA 2OP4L 3MBXL 5D1QC 5E9DA 3H55A 4IDJH 1HQRA 2QQLH 5IF0B 1BX2B 1MVUB 3BO8B 3NTCH 3LKPB 4C7GA 2JEQA 4PMOA 1H5BC 3LQZA 3BIKA 3RY5A 2VE6A 3BN3B 2CCRA 3BOVA 1DLFH 4Z0BH 3POCA 1M7IA 2EC8A 3HE7D 2NY4D 3IDYC 1E43A 3CHEA 1T0NB 1WAAF 3IFPA 3P77B 4LOUD 1T2JA 4GG6F 4ATLA 3ULSA 3H8NA 4H1LB 2OW6A 1VJZA 5FV1L 3HE6B 4BFEA 1I4FB 4QF1A 1B0RB 4EBQL 5AYUH 4WU7A 5CD3B 2G2RA 2P8PA 3EJJX 4GRLB 3NA4A 3GSRA 1A7PL 4B9YA 4P3DB 1MHPL 4OCNC 1DUZB 3W9DB 1GOQA 2VIRA 1MCQA 2AXFA 3IAGC 1OGBA 1NM9A 1D2KA 1A1OA 2GT9A 4G6AC 5ISZE 3HNTH 5GIRA 4YXHL 3F58H 3UTZB 1RJYB 4I3SH 3QUYA 3AAZA 3SUUA 5AUMA 2G9HB 3AS2A 3EFDL 4XBPB 5MI0C 4OV6F 3K4AA 3TBVA 3KXFA 4K2UL 5E99L 2CDFA 5FUCE 1KSRA 3EJUA 1P5UA 4DEPB 1N64L 3AS1A 4PGZA 1A7RL 2DL9A 2DQDH 1EAPB 1LO5A 3H9HA 4YHNA 3WFDL 4GAGL 4X6FB 3MLXL 5INCA 2XFXB 2QJDA 5C70A 4WI8A 1MWAH 4LASH 4APQC 2PWHA 3WDIA 1XGYH 5KS9A 3SQOL 2X89D 2DSKA 4G6JL 4GXUM 3SUWA 1F11B 3U7BA 1QNZL 1LWJA 1LL4A 5FYJD 5DQJA 3Q6FB 4M1GL 1A6WL 3CLEH 4PJ8A 4HWBL 4DFIA 1JZ7A 1JRHH 2CBVA 3GMNA 5B8CC 4R7DB 5C8BB 3HLAB 1M05A 1ISWA 1UG9A 4K7FB 4A3HA 4R97C 1INEH 4I0PC 2EDKA 5IB4A 3OKEA 2NQCA 3I3EA 4XCYA 1WBXA 1PX4A 3W5MA 3S5LB 2F18A 2A9NH 4X4XB 5DJXB 1MFBH 3EYSH 3KLAA 4MD0A 5DJCA 2A6KA 3BE1L 1F45A 4U7SA 4ELKB 1WT5A 2XM1A 3AUVA 5IEKB 1E0VA 1KG0A 3VFTB 5KANI 1OGTA 3OHXA 3A22A 3VXSD 2OLDA 3HPJA 2GAZB 3L4ZA 3FO2A 3N0PB 4Y1AD 5BCAA 4PJ7E 5FOBB 4M7KH 1A6UH 5DR5H 1F5WA 1S8DB 2DTMH 4J3WA 4DZBA 2DLTA 5T33L 1FJ1A 5F7HA 2EPNA 3TTSA 4YHLH 3RVXC 2D9QB 1CS6A 2GY7B 4H25A 4HKZB 3O3DB 1JGDA 1N5YL 1PW3A 1TFVA 3RWEA 4NNXB 1CZ8H 4XXDB 1UD5A 4U1HB 1QI0A 2DBJA 1I1AB 4GFTB 3KPRE 4MXWH 4ODXB 1DBAH 2X4SA 1IAII 2YD1A 3TOPA 1DWJM 3VGGA 4S0TD 3C2AL 1QWUA 2B5IC 3J8F7 3L4YA 3WDPP 2WMGA 2FD6H 3KEHA 3AU1B 2C3HA 4XP5L 4GG6E 4DWSC 5C3LD 3PHOB 2WMKA 3SKJL 5ESQB 3QEQA 4JR9L 4G8GA 1WB0A 4PGEA 2DKUA 4P8XA 1JN6B 3VFVA 2R8SL 1E1FA 2HA1A 1NANH 2P5ED 2X44D 4BK5A 4ZTOL 1GGIL 1NAMH 1WFTA 3RX8A 4WEUD 5DRZB 3UJJL 1UQSA 1N59B 3KWWB 5FB8A 5BZDA 3ARGA 3ELAT 4U3CA 1UR8A 3SCVA 1J8HE 3CFEA 3S2CA 3N13A 1KJ3H 2V2WA 2UZYB 1EJOH 3IGUA 3SDAD 3V4PH 2OSXA 2FBOJ 4N0YH 3BZEA 3LX9A 3CH8A 3BT2H 4HC1H 4YAQB 3S4SA 4NKOA 4RBPK 5JR1H 2DQEH 1QG3A 4FG6D 4GZIA 2XRAH 5ETUB 1RUKH 1VFAB 4E5XB 2ITCB 5J3HD 4ZD3L 5FOOA 3M1BB 4LLQA 2J8UA 3C60A 4GT7A 4OGAD 3PL6B 4G9FD 4QRPA 3P9LB 4UINH 4F7CA 4F7TA 4F9PC 3ULVE 3LKQB 4HK0A 2DQIH 2NY0B 2ARWA 3CIQA 43CAB 1QQDA 3RX7A 4FFVC 1C08B 3WJLA 5FKYA 4RAHA 5GGTA 5CEZE 1C5BL 3MROA 2W0KA 4W4NA 5SWZB 2JIXD 3WXWH 1NQ6A 5AEAA 1MNUH 3L7EB 3BKJL 5MEOA 4HH9A 2D7PA 3ZTNH 5GZOD 2V2XA 5H94B 1K6QL 3WS6C 4JZJC 2MHAA 2IPUK 4QOKD 2JB5H 5B38G 4FNRA 1ZT4A 4V2BA 4X98B 5EU6D 1BVNP 3KAAA 3NVQA 4KKAC 5IG7A 1Q1JH 3TBTA 1HVQA 1P69B 4JKPH 4Z7OF 3DC0A 1OP9A 2NR6D 4QKXB 1U8HB 2CLVB 1FFQA 3CDCA 4M48L 4N0FA 3GHEH 3PWJA 1NMBL 5BQ7A 4HWEL 5EMYA 3RGVC 1G7IA 3DTXA 4OIAA 1CL7L 3GNMH 3QDME 3ARBC 1AGFB 4BSWA 4L9DA 5F1KC 4MHHI 5DJAB 4WUUA 1F4XH 2YL9A 4YGVB 1BJMA 4WWKA 1J1OH 5GISH 4JKMA 3QDHA 2R69L 3WS3A 2P46B 2ADGA 3QQ9C 1DQDL 5C0NC 4Q2ZB 1FZKA 2I26N 3PTQA 3VKKA 4U4BA 3KR3L 3DSNA 1BVKB 1UZ8B 3TVMA 3IDGB 1CD1A 1AGBB 1B90A 4NO3B 3MUAA 3MR9A 1I7ZA 2L0DA 3VU2A 5E1AB 5BXTA 4NN7B 3DX8A 1AY1L 1CE1H 2X10A 3QIWC 5EO0B 3PWNB 4LSPL 1WBZB 3P9MA 4MDIA 1TQSA 5HYSB 4XBEH 1XZ0B 4GLRI 4L4TB 3HZMB 4PG2A 4GPNA 5FGBA 5I1EH 3BAIA 4RE4A 3F7VB 4Q0XL 2ZPKH 1XYZA 3PUCA 2MCPL 2IH1A 1YEJL 3RZCC 4ODWB 1V3HA 2AK1L 4M43L 5H35B 1N2RA 3ILQC 3LS4L 4HZ7A 3K8MA 5JMRA 1UG6A 4W81A 3GO1L 3DO7A 1EHXA 3EIFA 2FBJL 3DSFH 1LGVA 3KPTA 3ARVA 3AZRA 4PG9A 5TF0A 1MFAL 2Q76A 3HI6H 4N0RA 4XRCA 5J6HB 4YUEL 4JDVA 2ZSWB 3R8QA 3CU1A 5EFIA 1A3RH 2ZXAA 1VHPA 3A5VA 3KPSE 4P5TA 4YHML 3TZVC 3EJSA 4Y8AA 5ESAB 2R2HA 2QLYA 4AK1A 1QNRA 5K9QG 5KVDL 3RIAK 2XTKA 2FX9L 4EI5D 2HT2C 4MD4B 2NW0A 4U6VH 5ISZD 5AC4A 3ARDC 2R2BB 2VCBA 4OBRA 5I16A 3INUH 2OL3A 5J0BA 5E0FA 3H9SB 1FC2D 5CUSL 2BJML 1JV5A 4OAWB 1CFNA 4R8WH 2DICA 2OR9H 4WKAA 3ARXA 3ET9F 4KMQA 4XMLL 1QFWM 1ZS8B 4CKVX 1Y7VA 2F53E 4X6DB 4MNKA 3V6BR 1BFVH 4M9PA 2E3ZA 4NQEA 3QUXC 4LCIH 5E7BA 1VJSA 3RDKA 3DX9B 1E28B 3HC3L 1K2DB 1DWAM 5C7XH 3QG6A 3S3SA 3UYRH 3TIDB 4PREB 2D3VA 4IOFD 4HZAA 3B6SA 5J12B 3LQMA 5AD0B 3P0GB 3GHBL 3OA5A 4NC0B 1KPRB 3O81A 5GGQL 1HCFX 2VXTL 2OSLB 3IGAA 2N1KA 3G6AA 5SWZE 2PXYB 3MUY1 1OP5K 4Z7UF 5F21B 2LTQC 5EUOF 1X5LA 4X4ME 5DTFA 1Q94A 3ARUA 5JO5A 3LVEA 5HPMB 5D70H 3RVTD 1I7RA 4Y5XA 1KIPA 4XPFH 1T0OA 2HVKA 5F44A 5HGHA 4Q9QH 3WIHL 2DJUA 1QFHA 5ILTH 3VD7A 2JIEA 1WV7T 5CJOH 2BXZA 4D9LL 3Q1SH 5EPMA 3RIAF 1ZLSL 4MD5A 5I71B 3QB7C 1ZEAL 4HFUL 3ZE1F 3RGHA 1EUUA 3O3BB 4NCC2 2F8XC 1HK6A 3DVNA 4ZXLA 3TO4C 3QHMA 1KT2B 3FQXB 4Q6YA 4RNRB 2BSSB 1U3HD 2C7FA 5CJXC 2A6JB 4G6FD 4RIRA 3VFWA 3FRPA 1UUQA 2E27H 3BDXA 4FQLH 1JD9A 3MLZH 1OTTD 4WWID 5K9KA 4X6EA 4XCFH 4QWWC 4XVSH 4GSDH 3TA9A 4J3OC 4HCRH 4LLVA 3VFUB 2FWOA 2UYLA 2XXMB 4U6XB 2WAGA 2VMFA 1LMKA 3EYVB 1WIPA 2CEQA 4NN6B 1VRXA 1AQDA 1Q0YL 3BEVB 2FZ3A 4ZOAA 2EIEA 1MFDL 1L7IL 3LQAL 3RWHA 5JIPA 3QXVA 4UQ3A 3QI9D 1F6AB 1K8IB 3KPLB 4ISVB 4MA3B 5EORL 3PJSB 3SPVA 4MAZA 1W9PA 5CJQL 4ODTH 5J1AA 5KN5B 5JDSA 4LPTA 1MRFH 2HWZH 3U79A 3UDWA 3CSGA 2YD3A 1DEEB 1TCRB 2XQYK 1GQIA 4HZ6A 2YL8A 2AEQL 5F7MC 2WBKA 2AKRA 4WJ5B 1GGCL 1U8JB 1ITXA 2YPKA 5KG9A 4XCNA 1EEYB 3CK0L 3FW6A 3QCTH 3QCVH 1OM3L 3MCLH 2C3WA 1INQB 3QJHB 4WI5A 1IARB 3HE6D 4HJ0D 2C3VA 2R9HC 3P0VH 3ULVD 5KSBF 2A73A 4K94H 3MNVB 5F6HI 3VMNA 3ZHKA 3F65A 1JHKH 4MAVA 1RZGA 4GRLD 4RBPH 2XZCH 4W5ZA 5CILH 5CEZD 4YDLC 5FHBL 4EDWH 2NNAA 3O6LH 1S9VB 2EYSB 1F4HA 1UT9A 2MKLC 4YO0B 2QHRH 1NEZB 1BQHG 4IM8A 4AZ7A 2CJUL 4GBXA 2X4TB 1E72M 5HVHC 1XCXA 1UA7A 2V38A 4Y5VA 5IP4A 3TLRA 3F5KA 3EO1A 3UTSE 1TLKA 3DDFA 2FLRT 3HG5A 3PWPE 5ACZA 1JYWA 5HHXH 2NX5B 1CWVA 3SCMC 4DKEL 4CJ0A 2YSSB 4Z7UE 2D23A 1OLZA 5EUOE 1UWGH 4Z95H 1ZS2A 5D5MF 2VXUL 2HP4A 3ZSSA 1CWYA 5TDPA 4X6DE 1IGIH 2EE6A 3CVHH 4FQPA 3MV7A 3C5JB 3LEYL 5E8EB 2E7MA 2NZ9C 4MMXC 4Z6AT 3VDAA 3LEVH 1CLYH 5ADPL 5GGUA 2IG2L 2WWCA 3ZJ6A 2PCPA 5I9QC 3PE9A 3OJ2C 4J3VA 1GHSA 3MUZ1 3N9GL 4E42B 3RA7L 1R33A 4RA3A 3EOAB 3V0AC 4ZTPL 4FQCH 3QT2A 4BSVA 1UD6A 5A3ID 2I07B 1YEDA 1GPOH 2GTZA 4LPWA 5FUZL 4QHLA 4LKCB 2Q86B 3LKSB 4ODHH 3ZE1E 5F3BB 1X5KA 3G5VA 1XCTB 4JPIB 1UVQA 5I8CA 3A6CH 4LCCC 1ACZA 2CBIA 4AD2A 1IEAB 4NZDA 4FFZH 4JG0H 2BY1A 4FLSA 5LGJA 4HS3B 4QAWA 3O41B 2HVJA 3NH7L 3JV6A 2VOTA 2HN7A 4JQVA 4P2OC 2GUYA 3W4RA 4TUJA 2VXQL 4KHTL 3R4DA 1CGWA 1YY9C 3ARYA 4O00A 5ICZB 2GW5A 4KZDH 6FABL 3VFGH 3ZT6A 3HMCA 2R1YB 4DKFH 4O2EA 1LO2H 1PBYA 2EXYD 2P1YA 5JW4R 2ADFH 1HVXA 3UPRB 4LU5H 4WFHE 5FK9A 1H8SA 1MVFA 2NLJA 4ZXBB 3NPSC 1TQBC 4MSWA 4JAMA 4PLKD 1OTSC 5DK0A 5I8EB 5DVOA 5BW7A 1GC1L 4AT6B 4L4JA 4CBPA 1T0MB 3SGKA 4YIQB 2NY5H 5FKPA 5JW4Q 1QSFB 1GGUA 5IVOA 1I1AD 2VLKB 2CGRH 2F7QA 1CT8B 4MJ2A 3MV8A 3DX3A 5LA1A 2GK0B 3DMMB 1YQVH 1I8KA 3FMGH 4ENED 1NCBH 3FJTA 5T5NF 1IAOB 3DUSB 3GXNA 5KOMC 5E9DB 5IHLB 2VH5H 1CFVH 3AS0A 1HXJA 4DM2A 1E4NA 5EB9A 3WHXA 1HQRB 2W9DL 4QHUA 32C2B 4WK9A 1YEIH 4PSPA 4LRIC 1WWWX 3U9UA 2FIKA 3BIKB 2VE6B 2WWKT 5CCKL 5EZOH 1M7IB 2EYTA 3OR7A 4I13B 3FO9B 3IFPB 4GMTL 1TTFA 5HI5C 2YRZA 3ULSB 1H3VA 3MLTA 1KFAH 5ERWA 5GS3A 4A6YB 2ZUXA 4QF1B 3P11H 2RR3A 4XPTL 1BZ7A 2ESVB 1RZKH 4LSVL 3WIIL 2G2RB 4UT7L 1F00I 3GSRB 3KL3A 1Z2KA 1GHFH 1TZHA 1ZT1A 2VIRB 3PL6D 4IRJB 4P59L 2AXFB 4TQEH 4J27A 1B3VA 4JRYB 1A1OB 2GT9B 2NY0D 1UZ6F 1LP9B 5GIRB 4JE4B 3NACH 1PS3A 3QUYB 3AAZB 5AUMB 3OGRA 1EBAA 4RFOH 3VWJA 5J8OA 3KXFB 5SWZD 1AXIB 4KJYA 3VI3E 4DQOH 2CDFB 5AZEL 3WIFA 1YUHB 3NCEB 3H9HB 4YHNB 4C7FA 4ERSL 3L1OL 3HCVA 2FH6A 5DHYA 3ULUL 3ZIZA 1TVDA 5INCB 1QLEH 1AXTL 2JKXA 3A4AA 3JVGA 2NX5E 2HLAA 3PGDB 1OP5H 3LB6D 1ISXA 4LYPA 1JHTA 3KJ6H 3BC9A 5KS9B 5C8JA 2F54E 2GK1A 3MMEA 3L4XA 3MA9L 1U8PA 1PLGH 5MP6L 1MREL 1XYFA 3UJTH 4PJ8B 1H5VA 3EHBD 1JPST 5FYKL 4L8BA 5DD0L 4PRIB 1M05B 5IB5A 3BQUC 2V2TA 1C5DA 4K55A 5HDBF 2XVLA 4RGMC 3FB8B 1YMME 4XXCA 5GS0H 4KDTA 3OKEB 1WBXB 5JHLH 2WWMC 1EMTL 3KLAB 4IOSD 3QWRA 1GGYA 4L5FL 1S78D 4GXUN 2A6KB 4LAJH 1H8OA 5DJCB 4ZAKA 4Y4KC 4WO4A 1KG0B 1P7KA 3OHXB 2WSPA 2MQ3A 2EC9U 3FN3A 4HSQA 5EOCL 2BVDA 4IPNB 5KVFH 3HPJB 2FGWH 3OAUL 4AM0A 3FO2B 5B4MC 5D7SH 5T3ZE 1S46A 4HS6B 5GS1A 4L4TD 4V1DE 4DUWA 2DM2A 3V52L 2ID5A 4DZBB 4LPVA 5IB2A 1A8JH 1FJ1B 3AREC 4H7VA 4WY7L 3TJHD 1DQLH 4TNVF 1HSBA 4H25B 3S6TA 1FC1A 1U8QA 3KPMA 3RBGA 4UTFA 2V5DA 4DO5A 3B5TA 3RWEB 1UR9A 1L6XA 1XAUA 1YNTA 4OLYL 5DD1H 1WFNA 2X4SB 5L6YL 2VVNA 2XYLA 3D18A 1Q72H 2ZUWA 1QSFE 2DQUH 2HRLA 3UPAA 4APQA 5FA3A 3AIVA 1JNLL 5KVGH 4X6CA 3TWCH 3OAZH 2G3MA 4F80A 1A9BA 3ROLA 3TTQA 1MAKA 3QEQB 4G8GB 2MWCA 4JJHA 5LGHH 4PGEB 5BMFL 1ITCA 1LO4H 1NUGA 3VFVB 2VABB 4M4PA 1B6UA 4FP8L 1XSJA 4N0UA 2BVOA 4ZFZA 1LVEA 4OLEA 1RHFA 4XVTL 3MLYH 4XX6A 1HIMH 1UQSB 4I0PA 5A69A 5FB8B 3ARGB 3AICA 3CFEB 3K74B 3H54A 2ICEA 2XN9A 2V2WB 3BKML 1MCLA 3HUJF 4PP2A 1CGUA 2KQMA 5FA4A 3BZEB 4L3CA 3D52A 2OWXA 3CMOH 3P0YH 4NKOB 1V0LA 1A6TA 4NQCA 3SGJA 4KJWC 2CLRA 1FGNH 2EO9A 3IDNB 2FR4A 2EH8H 4UZUA 3OV6A 2Y8VA 3H7BB 4QRPB 4F7CB 2D31B 3FKUS 3QDJA 5E8NA 2W38A 4HK0B 5IQ9A 3POHA 4KQ3H 2R4RL 1QQDB 1MQRA 3BWUC 1BPLB 1MRDH 3JV4A 5DFVD 1IFHH 5FYKD 5B3NA 3HG4A 3TT1L 5D9NA 3ZDXF 2ORBL 3BSZL 3RUGF 3VXNB 4ZS6D 1T03L 3GKZA 2J79A 3O9WC 4ONHB 4NDMA 5TD4A 2K7PA 3KYOA 4QGTA 2A83B 3MXWH 5MEOB 4HH9B 4R4NC 4BZ1L 5IR1A 1UACL 1BLNA 1DUYB 2MHAB 2WUCH 4E8CA 3QIBC 3KXFE 1JZ8A 3QG7L 2PXYD 1BAGA 5KTEL 5IG7B 4K3GA 3TBTB 1KENH 4H26A 1IVLA 4PJBA 5HDBE 1ZGLA 4LKXA 4RMUA 5TDOA 2K3TA 4TNWF 5HD8C 3UAJC 4NQSA 4DWSA 4H8HA 4NQDA 4N0FB 1A7QL 3PWJB 3WY2A 5BQ7B 1CE6A 1DLHA 3GMOA 3WLWC 4ELMA 1G7IB 3QRFM 3QHTC 5A2AA 3DTXB 3WQ4A 3SKOA 2VXVL 1DQML 2D20A 3EMQA 1CECA 3PBGA 4BSWB 1VDGA 3I2CH 1P6WA 4UB0H 1VFMA 2WSKA 4WUUB 4WWKB 1CICD 4Z7QF 3WS3B 3PZVA 2ADGB 1J11A 2DLFH 3U0PA 4RDQG 2R1XA 1FZKB 1A7OL 2XTLA 3HC4H 4X83A 3PIQB 5A16B 4GKLA 5M5DA 4KWUA 3MR9B 1I7ZB 5I1KH 1B6DA 1BQLH 5FGSA 5B21A 4UT6H 2YC1A 4I3GA 2COQA 4MYWB 3UP1A 4MDIB 1OPGL 1G84A 3X3FL 5IMMA 1KTLA 1JJUA 3MZTA 1UFUA 3VXMA 3B4NA 5TQ2H 1K85A 4QYOA 2C8NA 2AXGA 2J75A 5D96B 2DQGH 1OAQH 3GH4A 5FCZA 1OCQA 2RIKA 3FB5A 3IU4H 4K3JL 1RULL 1J5OH 3DO7B 1QSEA 5GRJH 4HH8A 4OFPA 3WS6A 1T04A 4TSAL 2DD8H 1HHIA 7A3HA 1KWKA 2XZQH 5J1SC 1S5IL 5IBLC 4NKDA 1UM4L 4PG9B 1NOFA 3O6KL 1MHCB 4OZHF 4LHQB 4OZGA 4P4KC 4XRCB 4JDVB 4PRAA 3MOBH 2ATKA 1TVBA 1GAFL 1K5NA 1TQCB 2XI9A 4YX2L 3GSOA 3O6ML 2R29H 1NGWA 5DFTA 1LO0L 4PJCA 3BUQA 4JVPA 1ORSA 5ALBL 3ARBA 1RZ7L 2VITA 2Z8SA 5HYEA 3U0WH 3WUFA 1WLHA 4G8GE 1G6RB 5IFHL 5IT2L 5I16B 4WUKL 4DN3H 1RZIB 2F58H 5BRQA 4ZPTA 3L4TA 3PV6A 1JDCA 4BQBA 2WBGA 1VFOA 1JV5B 1CFNB 3MV9A 3NYDA 1NL0L 3NCCB 2DEPA 3TN0B 3AMLA 5ICYB 4ZO8A 3F5JA 3FRUA 7TAAA 4DOHE 4QY8A 3U7YH 1U42A 2CO6B 5I15L 3S36X 4OJFL 5CD5D 2NX5D 5L0QC 3PZGA 2E4TA 1AR1C 1UM5L 4NQEB 3BP5A 3G6LA 4KHXL 5BYWA 3E3QC 5HGDA 4A6YL 1RMFL 1Y0LA 2UWEF 4KTDH 3QG6B 2HLFC 2J8UE 3JSSA 1G9MH 3LMJH 2IANA 3RZCA 4AMCA 1MCHA 3B6SB 4Z2IA 1E6JH 1W32A 1AI1H 2RFXA 2Y4SA 4OZ4A 3W5NA 1CK0L 1J05B 2ICWA 3IGAB 1RPKA 1FH8A 5ANMA 1OWQA 3NPZB 7FABL 3G6AB 5IHUH 2OP4H 3GSWA 3MBXH 1IT0A 4YN5A 5JXAL 3LD8B 2J6EA 1Q94B 1HN1A 5DTFB 4AZGA 5CBEA 4UNIA 1B2WH 1WEJL 2NT1A 3PGCB 5MERA 1KELL 1I7RB 4Y5XB 5F88A 3TZVA 5JLZB 4AYSA 1C3FA 1KIPB 1TJHH 2HVKB 1VADA 1KFWA 2WK2A 5T3ZD 3JV0A 4KROB 1QHPA 2EE9A 5EPMB 3UR8A 4LQ1A 4MD5B 4AZBA 2OI9B 1S9KC 5CSZA 1HE7A 4EBQH 5CIPH 4Z2KA 5J9PA 4D1JA 2FCBA 1PAMA 2OCFD 1E5JA 4OF0A 5ALCL 5IHSA 1MHPH 4ZXBD 1ZTXL 4RIRB 3VFWB 5HBBA 4XP9L 3WQ5A 3U7AA 3F12A 4QRRA 4JFTA 4LHJB 1E0OB 4YXHH 1U91A 4JO4H 1QSFD 1PEWA 5K9KB 3C8HA 3EFDH 4X6EB 2Z1KA 2VLKD 4K2UH 5E99H 2RGLA 1V08A 1W72A 1G7MA 2FWOB 2UYLB 3NCOA 1N64H 3MJ9A 2B31A 5A8NA 4PYSA 1AQDB 3RWHB 3WMSA 1A7RH 2FZ3B 1JNEA 5F9DC 3GXIA 4RGOL 4WFED 4YDJA 2XUCA 3WFDH 4UQ3B 3MLXH 3Q3GA 5E9DD 4FQXA 5FOJA 3BLPX 3SPVB 3MO4A 5I24A 3DVGA 2BFGA 3WSUA 5J1AB 4LSUL 1F90L 3BAEL 1L0QA 3NA9H 3QWOA 3SQOH 4I77H 3VXPA 4G6JH 2ADIA 4FRWA 1VBUA 1QNZH 5I1DA 3CFBA 4ZE4A 3HB3D 3TA3C 3S36L 2CXKA 1D5MB 4LSQL 3PDGA 4M1GH 5DVMA 4XUYA 4HWBH 3W82A 2YPKB 4NQXB 4XCNB 2E6QA 1HZHL 1H15A 4GRMB 5KJRL 4HJGA 4MX7A 2FEDD 1H11A 2CDEA 3GNRA 4ZE5A 3BPNB 3RVWC 2FJGA 5ID0A 2W9LA 2A73B 2NTFB 5SWSB 1A3HA 3H7LA 2GCYA 4KI5F 3BE1H 1NCTA 2GITA 5EU7C 1OWWA 5CGMA 3L9RB 3TO4A 4LMQI 1IGFL 2UWEE 5KBNC 5IMLA 3QUYD 2YD4A 5CJXA 4BYHA 3ZKXB 2DPEA 4UFMA 4Y5VB 1TZIB 3KXFD 4GW4B 5T33H 5ACZB 3GNOA 4PJEF 1K4CB 1MQ8A 3BISA 1TA3A 3EBAA 5MENA 2V9TA 2C26A 3BAJA 2FYVA 2HTKC 1DBJH 4LPUA 2WBJC 1B9ZA 5FGCB 5TDPB 5M95B 1N5YH 5JQ6L 3MV7B 4MGXA 4XNZB 1CDHA 3UTTB 2UY3A 2BOBB 5HGAA 1CR9H 4Q6IC 5GGUB 1PYWA 3TCXA 1RHHA 3C2AH 1X3DA 3W27A 2RBLA 4U3AA 5TPWL 4KK8D 3BSHA 2DLHA 4ZG1A 3WFEH 4PJ8D 1GXEA 1MVYA 3LXAA 4XP5H 4BSVB 1YEDB 2CR3A 3SKJH 3UTPD 2XSBA 2GTZB 2A0LD 4PRID 5C08A 1MW3A 3L6FA 4IOIA 3G5VB 2R8SH 5D1XC 4Q9CA 5IW1B 4ZTOH 5BS0A 1GGIH 5EBMA 2P42B 3LKOA 3BX7C 4YWGL 2HVJB 3UJJH 3JV6B 2EE2A 1MCEA 2BY2A 1LL6A 4PFEA 1LD9A 3DXAA 4P3CL 1JAKA 3WFCL 1HXMB 2GSIA 4XP6L 2YL5A 4MJ5A 4KRTA 1J0IA 1Z32X 1HKJA 1I1CA 5DDHA 4QHKI 2WWKO 5DJ2A 4WHYH 2B7DT 4LYQA 1I8LA 5FO9A 1FRGL 4ZD3H 5J6GA 4IEFB 5FK9B 1FHGA 1S7RA 4WF7A 4JAMB 3V95A 1BMGA 4MA1C 3T2QA 1MHHA 3VXTA 2H8PA 1G7QA 3SCMA 3EMCA 1C5BH 1AO7A 5AZ2L 1QKZL 2IFGA 2Z0BA 2ZIDA 3ZO0A 3BKJH 3QXUA 3T77A 1MCOL 3DBXA 5CHNA 1UENA 1K6QH 2VC9A 1I3RA 2O26U 3QNZA 4F33A 5JQHC 1ISVA 4C56A 1T66C 2X4PA 1C8QA 3QEQD 4G8GD 2VDMH 3WFLA 1V3LA 3Q6GL 3S3JA 3WCYA 4I4WA 3WHXB 4QHUB 4M48H 7CGTA 2P43B 1KNOA 3U9UB 4R96B 3T0EA 4KK6D 1LNUA 3ARGD 1O7SA 3IETB 3IDMA 4LAQL 1URLA 2AJYH 3OR7B 4LCCA 3QR3A 4X9GA 3MRCB 4BSJA 1FN4B 1E6QM 2FECL 3MLTB 1SJEB 5ERWB 3B9AA 4KRPB 4P2OA 1BZ7B 4XMPL 1SBBA 2R69H 3L95A 4MB5A 4LCUB 2X2YA 1NP2A 1DQDH 5IUSA 1YPZF 4D6IA 3SDXF 4HUWB 1EJ6A 3MLVL 5INDA 3C60D 1TZHB 3KR3H 4QRPD 1KIRA 2NY6C 4PV8A 2UY5A 4P8WA 5C86A 1NBQA 1RIVL 5ABDE 4IISA 1AY1H 1S7WA 4LSPH 5C2BL 4YH6A 1Z0MA 3VWJB 3DECA 1G6RL 4KJYB 4U6TA 5F7EL 2K1MA 3WIFB 5LA0A 3QXDA 5DQDL 3LHPL 4LXFA 4MNMA 4FQJL 4Q0XH 3UXFA 2MCPH 3G5ZA 3C2SA 1YEJH 3LV3A 1IGCL 2AK1H 3WFBL 5B38A 4M43H 3HCVB 1JP5A 4I9WD 3LS4H 1JXKA 2ZX8A 4PJXB 2I9LA 3GO1H 4NP4L 5EZIL 2H32H 4XH2A 1JHTB 2VX4A 2FBJH 1XD0A 3GMMA 3BD4A 2JELL 5C8JB 2GK1B 5E6IA 3MMEB 5FGCE 4M03A 4GO8A 1MFAH 4F8QA 1U8PB 3DARA 3ARSA 4M8QA 4XNUL 4YUEH 4ZFOA 4NPYA 1JGLL 4XPAL 1UD4A 1GL4B 1NMCB 4YHMH 1B1YA 2R56L 2IMNA 4L8BB 4LRIA 4PJ9B 1UCBL 2V2TB 1C5DB 4TSBL 3ZJ8A 3HPLA 4WUUD 4UOJA 1ORQB 5CP3A 4WWKD 1IKNC 3IDYB 4KFZC 2RB8A 1JMXA 1J1XH 4RRPG 4ZAKB 1IE5A 4JY5L 3LPGA 2LAGB 2JF1A 2ERJB 1A7BA 4WO4B 3TVMD 2DKSA 2W0LA 2EEXA 1P7KB 1MFNA 4D6HA 1F4AA 1RUQL 4P57A 2CETA 3KLLA 3TNNA 3CDGA 4L29A 4JQIL 1HCVA 1I3UA 4X7TA 4XMLH 5GS1B 2FATL 3IT8D 5IB2B 5HVGB 4ZFMA 2HFFA 5MI0B 5ELIA 2JTDA 3GSQA 1RK1A 1WWAX 4H1LH 3NSNA 4JFYA 5E4EB 3ARPA 1U8QB 3KPMB 3ULVH 4NM4L 3FAXA 1WUNT 1YNTB 5KSUA 3X11A 2EPMX 3GHBH 3D18B 4CVZA 3MRKA 4QNPF 1NH6A 5GGQH 3MRIA 2VXTH 2OJEA 4PJAA 5FA3B 4X6CB 1LQ0A 3PZTA 2F8VA 3MV8E 1A9BB 2BFVL 3H2WA 1K6AA 4LIQL 3VMOA 2NY1C 4BZYA 1H41A 5HYIA 5AC5A 3V5HA 3OKKA 2ZOLA 1GQJA 1VENA 4N0UB 2BVOB 4ZFZB 3VG0L 2XWEA 2XV6B 3BAXA 3ZM8A 3SDXE 3BQUA 4D9RD 3SGDI 5D8ZA 2Y24A 35C8L 1X4XA 2ICEB 2XN9B 3ABZA 1EZVX 4D9LH 4L3AA 3QFJA 3D0LB 4I18C 1NFIA 3OGCA 2D7OA 1ZLSH 4L3CB 4TPRL 3CC1A 1GORA 5DXWA 2X1WL 2DH3A 1ZEAH 4HFUH 3WDRA 1W9BM 3P4LA 2AABL 4QLKA 1A6TB 3GSNL 2JJTC 3CZFA 1A6AA 1IV8A 2NYYD 1B88A 1VKXA 3AMKA 4NQED 3IDIA 1JZ4A 4C83B 1E5NA 2GI7A 4AIXA 1N82A 4BQ4A 3QDJB 5E8NB 2J7HA 1WITA 1KC5L 2WUBL 5E00A 5F72S 2BC4B 2QHAA 4AIEA 3AREA 1EVUA 4NZCA 1JTTA 2BK8A 2EIBA 4XP4L 3S88H 4PJ5A 3D4ZA 4NDMB 3BVXA 3KYOB 4WFFD 2WNGA 1F42A 1L4IA 4N9OB 2VYRE 5IR1B 4FZEL 4NZJA 5HGBA 1BLNB 3S96A 1Q0YH 1E6NA 1MFDH 1L7IH 3LQAH 3BVNA 4XAWH 1IAIM 5GRZA 1ZGLB 2P7TA 1TZGL 5EORH 4LKXB 1VEPA 3RILA 5CJQH 5A94A 4NQSB 4NQDB 1REIA 3SGEI 4AD3A 4GZEA 4KK5C 2R2EA 4UFLA 4BK4A 3ULUF 3GMOB 2AEQH 4NCDA 1EEZA 2H41A 2HT4D 5IVXF 4C57C 1GGCH 1A6ZA 3SKOB 3CK0H 5EA0L 4DK6A 1QBLL 1OM3H 1KJ2A 1OSZA 2ZX7A 3E8UH 1MRCH 3AYSA 1H0DA 3OG4B 3O6FC 1T83A 1NDMB 3MO1B 2YWZA 4D6JA 2DMKA 2Z31B 4V28A 3HG1A 4XNMA 3U0PB 3SCWA 1GZJA 5FHBH 5CZKA 3RL2B 4KK9C 1FP9A 4Z8FL 4WI9A 4CRPA 3WEOA 5KSAC 1ROWA 2E6JA 4J4PC 3OKNA 5D93B 3MJ7A 5I6XC 4QNPE 5IMMB 1KTLB 1AGDA 1WC7A 4X7CC 2LFGA 4QYOB 4G42A 3WN6A 2F61A 2AXGB 3V4UH 3BLBA 4W8BA 1E3XA 3O9WA 3FB5B 3LKRA 3VO0A 2VXUH 5F97E 2VLLA 1QSEB 1A47A 1EFQA 2PTUA 1T04B 3QIBA 2DIEA 5EU5A 4I8DA 3QUKA 1SJHA 5ADPH 2IG2H 1JZ3A 3G04A 4QRTA 4NKDB 1EFXB 4I1NB 4LP5A 3N9GH 5T3XE 4Z18A 4OZGB 4O2CB 3RA7H 1EZVY 4XC1L 3GH5A 1NLBL 1UD2A 1A1NA 4GKZA 1TVBB 1K5NB 1FG9C 2M26A 1T89A 2J2ZA 3GSOB 5FUZH 5IV2A 3EYPA 1NGWB 4KUZL 4PJCB 3GJEA 3WH6A 2ZXQA 1AFVL 1WO2A 1ORSB 3ARBB 4WHDA 4WW1A 5SWSD 5TDNA 1HHJA 1JUFA 3RVUC 3NH7H 3PG2A 5ITFA 15C8L 4KTYA 4X7FC 4Z7WB 1CIUA 1HJWA 1X5ZA 2VXQH 4KHTH 1GJIA 1D6VL 4S1QL 1BQHA 1LG1A 6FABH 1HYSC 1IC5L 3IRPX 4P23A 2JF7A 1FO0L 3I02A 2X4QB 4QY8B 5GNXA 1RU9H 4BFBD 2IPTL 1JZ5A 4Y4FA 4NBYB 1DSFL 4K8RD 5T1LB 3BP5B 4NQCE 1GVYA 1QYGL 5HGDB 4HT1L 3MGAA 1Y0LB 2W65B 1RQ5A 1GC1H 2X4NA 1NAKL 1CZ1A 2DWEA 3MV7D 3X3GL 2IANB 1I85A 5D72L 3RZCB 2XWDA 4PRDA 3DHUA 3LPOA 3WLBA 4R4FL 4CD6A 4AXNA 2KH2B 2RFXB 2NXYC 1I1XA 5A8MA 2ICWB 5ANMB 1DANT 4OF8A 1DQTA 1T1XA 3GSWB 2XQBL 3A21A 3OZOA 1WWCA 5CBEB 1B3ZA 4P4KA 4M93B 3WXVL 1WDQA 3Q5OA 4GH7B 4NCC1 1N0LA 2V5YA 5HVFB 3OKLA 2W9DH 5F88B 5AYIA 3V7AE 4B7IA 4BH7A 4PJBE 4U6HA 5E09A 2VZTA 1ZT7A 1JFHA 3W29A 5CCKH 4POUB 3VXUE 2ZUUA 3SDYL 4NQDE 2VWEC 4GMTH 4UIKH 4TULH 4CCCA 3FCTB 4ELME 5DC9B 5GQBA 3KLHD 3AHVA 4XPTH 1PBGA 3TBYA 1AC6A 4LBEA 3RTQB 5J9PB 3HFML 4LSVH 3ZYOA 3WIIH 4UFJA 2BVPA 4UT7H 3OL2A 5I1IL 2CSPA 1OL0A 5T5NG 2AJZA 2F15A 3MBEA 1NCWL 4P59H 1NWRA 2BHYA 2IJ0C 4OLUL 3VRJA 1AHWC 1LO3L 4KV5E 3SJVE 3MU7A 3GBML 4AEIL 3IDXL 1XF2B 3NBNA 4OT1L 1MJ7L 4PJHA 2EZ0D 2EXOA 3L3DA 5K9JL 1QFUL 1MPAL 1FYTA 1F3DJ 1ODAA 1A22B 1W72B 3OKOA 5AZEH 1G7MB 4FMVA 2H9GA 1CVRA 2YA1A 1BPVA 1WZMA 2Y06L 3RWCA 5F8QC 4ERSH 5C9JA 4YDJB 1F13A 1U93B 3ULUH 4WI2A 3VXME 1H3UA 4K9EL 3ZYJA 5J06A 1AXTH 3QIUB 4FQXB 5EOCJ 3TFKD 2C5DC 3DVGB 1GUVA 4K94C 1GCFA 1MJJB 3QWOB 3VXPB 5JNYA 2ADIB 3C08L 3CFBB 4UNTA 1QSEE 3MA9H 1HJVA 5MP6H 1QNSA 1T20A 1MREH 3BW9A 3HAEG 4GAFB 2H2SD 1U9KA 5FYKH 5GNYA 2X09A 3LRLA 1H15B 4OZGE 4MX7B 4HULB 1F3DH 1G9NL 4KRPD 3IS0X 5ID0B 2Y8KA 1T2QH 1X5FA 2A9ML 1EMTH 2GCYB 2QADB 3HI1A 4KC3B 5L7XL 4L5FH 4PJCE 3RIFF 4MNQB 2GITB 4QXTA 2CXGA 3VG9C 3EDKA 2CIPA 1XD1A 3TO4B 4DGVL 1PJ9A 3LKNA 1IT9L 1FIEA 2ARJA 5EOCH 5IMLB 3VIFA 2D7MA 3OAUH 3VWJD 3GM0A 3JBG7 1D7FA 4OLVL 4EJ1C 5C6WH 4NF7A 1KCVL 1IQDA 1ZANL 5AY7A 5D7IA 3V52H 4Z0XA 3MV9E 5JW5A 1TR1A 2G41A 3IF1B 4LSTL 1TA3B 1UWEL 3WDHA 5MENB 4WY7H 1JE6A 4FFWD 4J2XA 3THCA 5CAYB 1W9UA 3I6KA 1ND0A 1HP5A 4PUDA 1KCRL 4M1CC 3NOIA 1WFUA 3SDCC 4BCEA 1NDGB 2ADJA 4OLYH 5HGAB 5E8DL 2F7RA 5L6YH 4EDXB 1PYWB 4U1KA 1RHHB 4ATWA 3SQBA 4PMUA 4IDJL 4NWUH 3G6JA 1X5XA 1QLFA 2IAMB 1JNLH 3S9DB 12E8L 4HP5A 1DN2A 3SDDC 4AZ8A 3TA3A 4MCYB 4PP1D 5C08B 1CD8A 5TE6L 4PJGA 5BMFH 1LP9F 3B9KA 4MDPA 2CH8A 4JL1A 4FP8H 1L9NA 1UZ4A 5BS0B 4XVTH 5CGYC 5LG1A 3L5XL 2RGSA 3IAPA 5EBMB 2J7GA 3LKOB 4ZAKD 1HSAB 4YQXH 5EZJB 3VILA 1HEZA 4BM7A 1JRHI 5AYUL 1JMZA 1AE6H 3C8DA 4WO4D 1JNNH 4JFQA 1LD9B 3DXAB 2NY5C 2GSIB 2OXGA 4MJ5B 1H3PH 2PYFA 1LE9B 4Y19A 4ZFGL 3NGBB 2IF7A 5DDHB 2YFOA 1ISYA 4NFDA 4G6AD 5DJ2B 5DVLA 1E73M 4CN4A 1DN0A 1GZQA 3WF1A 2GJRA 5FO9B 4R2GC 5J6GB 2X4RA 5MHSD 4GKOA 2APWA 5C0AB 5LQBL 2XWJA 3T3PF 1CGVA 4XP1L 2R4RH 1RJLA 3W0WA 1MHHB 3VXTB 1OIMA 2RQ8A 1HKMA 2DSZA 4U05A 2H8PB 1G7QB 5T3XD 2ORBH 3BSZH 3I3DA 5E2WL 5A6KA 1AO7B 4KJQC 1HILA 1WKYA 3WN5A 4QRRE 3LY6A 2WBJA 1NP0A 4ODSL 4CADA 3TONA 3T77B 4JFHD 3DBXB 1J7VR 4BZ1H 1SHMA 1UACH 4LP4A 1I3RB 4Y2DC 4Q6IA 1WZKA 4ZOEA 1BSIA 4Y2OA 1FFRA 3QG7H 3QNZB 4LARL 4HDIA 4JFUA 4C56B 5KTEH 5I9QB 2X4PB 5D7JB 3OKMA 2A3HA 4HK3J 4S1DD 3UEZA 3GXFA 4M80A 1NARA 1O7AA 1RZKC 1KTBA 1QBAA 1INEL 5DO2C 1KNOB 3I85A 4MNGE 1OARL 5FYLL 3T0EB 2B1AL 1LNUB 1CENA 4KGJA 3IDMB 4WFGE 1HJUA 2VURA 4LCCB 3F6IA 2XN9D 1WCGA 3D5HA 3GI9L 2VXVH 2BNQA 1DQMH 3WD4A 3EYSL 4M6NL