5G1TA

S. enterica hisa mutant dup13-15, d10g
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
247
structure length
229
Chain Sequence
b'MIIPALDLIGGTVVRVVQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE ION
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 76
structure length 229
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g1tA00
4OV4A 1EIXA 1VLIA 3QW4B 5D2WA 4N9DA 4TX9A 1JRCA 2FIQA 4ZQCA 4K7VA 3GX9A 4CCDA 4LS0A 3LCXA 1O94A 3FJLA 1I8JA 1FCBA 1DVJA 2Y88A 2CFFA 1THFD 2QDHA 4I7WA 4O50A 3OVRA 1PS9A 5KSWA 2AQWA 3W2UA 3PAJA 4FX8A 2E6FA 3EKZA 4DF2A 3C2VA 4CQ8A 2QUVA 2VELA 3NQVA 1T96A 3GNNA 1WQ5A 4UTTA 1JQXA 4L4MA 2GQAA 3B8DA 2ZRZA 3QW3A 1JUEA 1MZHA 2ZBTA 4WX2A 3LRKA 1QAPA 3OG3A 2E6AA 1RR2A 2Z6IA 4PL2A 3SR7A 1MEHA 3W7HA 4P61A 3BLEA 4GRSA 3T44A 1LCOA 4MY1A 4QNEA 1H7XA 1M5WA 4LNYA 4GUHA 2QCLA 2ZZ7A 3BGJA 3P84A 1OVDA 4AMAA 3STCA 5IBXC 1AG1O 3PM6A 3N73A 4GJ1A 2NX3A 4N4QA 4FXSA 3R89A 4AHOA 4XUGA 3NM3A 4ADSA 3ANYA 1I2QA 3CT7A 3SFKA 1TQJA 3BARA 2J9YA 5CPOA 1Q6LA 1YDOA 1VRDA 5C54A 3ABRA 3OVQA 4YL2A 2YX0A 3DBPA 2GPTA 3L68A 4P2VA 2E09A 3U6WA 3CEPA 1Y0EA 5G2HA 2R14A 1F7BA 1D3GA 3KFTA 2V8ZA 3JS3A 3W2MA 3SSJA 4WQ6A 2C15A 1UJPA 1ZJIA 5G5IA 3A9IA 3EX4A 4L4LA 1H63A 5BOOA 5HWMA 2P10A 2G97A 1SZFA 2XFWA 4O1AA 4O14A 1Z42A 5LNRA 3QMRA 2DZWA 1K3UA 5AC6A 3C56A 2A1YA 3O6DA 1OX4B 5K3VA 4BR1A 3MYPA 4JTLA 3BK0A 4Z1BA 1OG0A 4NXKA 3W7PA 3NGJA 1G7VA 1VCGA 2X1SA 3WJWA 1EPXA 1QWGA 1RPXA 4OBTA 3FEMA 3ZWSA 2B7OA 4C1LA 1QMLA 4XQ6A 4UR7A 5LNSA 3TMLA 1JCYA 4O1BA 2OCZA 3QMTA 5CPLA 4HNNA 3HO8A 3IRDA 4AEOA 2B0MA 4UIOA 1XDLA 1ZHAA 1TSIA 2CZEA 4MFDA 4FIRA 4EF9A 2RDUA 3GR7A 1SFJA 4BF9A 2P0OA 5D05A 4WUIA 5E0KA 3TXZA 1MEWA 1EUNA 4RZ4A 1O4UA 2LLEA 4E2BA 3LLDA 3QYQA 5EKYA 3TFXA 3DI0A 4UFHA 4O13A 2OJPA 3BG3A 4N9BA 3UWZA 4CQ9A 3SJ3A 1ZAIA 4Y9AA 1SSDA 4J9JA 3FJ6A 3LHWA 2AAMA 1JCXA 1VLWA 3LV6A 3Q94A 4S1FA 1KM3A 2EPHA 1QDSA 2B7PA 2QR6A 4IXHA 1GVFA 1YYAA 4JIQA 1IXQA 1F6PA 3I6RA 2E6YA 3UWVA 1J4EA 4MJMA 4DBDA 2VFFA 1F05A 3QRHA 1VQTA 2QF7A 4QSHA 1RZMA 2TRSA 5LGZA 3GK0A 3H55A 1W54A 3IIXA 2A6NA 3L9CA 4PODA 4NNAA 2CZFA 4AHPA 4JR5A 2ZZ3A 4ZZ9A 1OYAA 1FXPA 2ZRYA 4CQAA 2OT1A 4K6AA 1OX5A 5FF4A 1H50A 2RH9A 4WZHA 1LZOA 1VYSX 5AHLA 5G2IA 2H90A 2TPSA 2QCNA 3KVLA 5D02A 5K4XA 1QO5A 2VKZG 4GUFA 5EY5A 3TQ0A 1FDYA 4ZL1A 2V2HA 4DF0A 1ME8A 1QPQA 1KTNA 1EP3A 4XBKA 4QITA 3HG2A 3G3DA 3WJYA 3LXCA 3IIOA 2I14A 1N8FA 3LOTA 3LTPA 3WK1A 1KTBA 3KRSA 3TK7A 3MI6A 1TPVA 3S1UA 2Q3OA 4JGDA 4MZYA 1F74A 2CLHA 4MIMA 4RXFA 1W1ZA 4G1KA 3WK0A 4ZMGA 3FIGA 3O63A 3BVJA 2BTMA 2A2IA 4K8HA 1OFBA 1BKSA 1QCWA 4JN6A 3LHTA 3TROA 4IMFA 2CLEA 3LCGA 2RKXA 3JRKA 3LXAA 3EXSA 1SFLA 3EXRA 3IEBA 3UWUA 4ORIA 5D38A 3EWZA 4X3ZA 2GVJA 3CIXA 3HPSA 1OK4A 1EWEA 4AF0A 4A2SA 5AC8A 5D2YA 4IMDA 1JCMP 3MP3A 1ICQA 4LT9A 5FF2A 3MBDA 3BW2A 3L65A 5LKYA 3S1WA 3UZ5A 1YXCA 1GJPA 3O16A 5TQLA 3NQAA 3RLUA 4O54A 3UZJA 5AB3A 3THQA 1DQWA 1SR9A 2E5BA 4MZ1A 1K7FA 2W79A 3RMJA 4WY0B 4K39A 5HUPA 1AL7A 4E0CA 2GVLA 1IIGA 3BLFA 5AHFA 1PHQA 4LUJA 2I9EA 2H8ZA 4KFNA 2HS6A 1B3OA 4JY9A 1D9EA 3HG5A 3NA8A 2QCGA 1B4EA 1FBAA 1TO3A 4KFOA 2YYUA 4C1KA 4R7JA 5L9FA 4O0ZA 3NQCA 1BEUA 1PV8A 2JKEA 1H7PA 1H1ZA 4NU7A 2WO5A 4DO4A 1SZGA 5I3GA 1LLZA 4AXKA 1OYCA 1WBJA 1YTKA 1ZAJA 5K9XA 4IGHA 5C55A 4O1CA 5CPMA 1KFCA 3HPZA 3H53A 3I65A 2J27A 3G1AA 1H7WA 3M1ZA 4UFKA 3MWAA 2NUXA 2NX1A 4FNPA 4E2DA 3W75A 3W7MA 1YLVA 3G1VA 3E9AA 4ZQMA 3RF9A 2VFIA 3GXNA 5EL1A 1K8YA 2C19A 2NXGA 3LHUA 4KKXA 3W87A 2WJZA 2ZCGA 3PUDA 3ELFA 1YPIA 2VFEA 2Y7GA 3BW3A 5F2MA 2QCDA 4RV8A 4XKYA 2RDWA 1QO2A 1K7XA 4NX0A 3GYEA 3W7CA 5BMXA 2B7NA 4LS1A 2VEMA 3G22A 5HINA 2Y89A 3IIPA 4MKNA 4NXSA 3HGSA 2NX9A 4NX5A 1DHPA 6TIMA 2CZ5A 3W7QA 3GVGA 4NJGA 1AW1A 2C13A 4R34A 3L0KA 3TIMA 1BWLA 3IIZA 1DV7A 4O12A 3W1UA 1ZAHA 2TSYA 3STGA 4HNTA 1MSSA 3L66A 2ZYFA 5AHIA 3N14A 4FNQA 1UBSA 3EX1A 3GXPA 4N2YA 1F6KA 3MI3A 2E5DA 3NVTA 1W5MA 2HTMA 4AWTA 1LBFA 1AW2A 5F1VA 4JDBA 4YMZA 2NXHA 3VCRA 3GNDA 1TPFA 3VKJA 1KFLA 4UMAA 3NQ7A 3O6YX 3NQEA 1MEIA 1AL8A 4DPQA 1R2RA 2NLIA 4M5PA 3GAKA 1PVNA 1GT8A 4FNTA 1T99A 3I7QA 3CC1A 3LXBA 2EHHA 3C2FA 4M6PA 2V5LA 3GLCA 1LP6A 3JR2A 1KV5A 1VYRA 3VNDA 4CCEA 1OF6A 5AOUA 2BWGA 1P0KA 1QOQA 4CCCA 4LTSA 4LY8A 3GKAA 1GZGA 1FCVA 3U8GA 1QFEA 1LORA 4DEFA 4O17A 1KFEA 1TPC1 4QNWA 1A5SA 3W7OA 2H3DA 1TJPA 4UC5A 1W5QA 3HPXA 3P7YA 2R94A 4Z1DA 4LV9A 5EYWA 4OQVA 1OFRA 2Z0IA 2DP3A 5I3IA 3S1VA 1SW0A 3GKFA 3VE9A 4TIMA 3RLVA 3G3MA 1KLYA 4UXDA 2WOQA 2X1UA 5LHEA 3UWQA 3BW4A 2QKFA 5HWJA 5KMYA 3P80A 3TX9A 3NQDA 1NAL1 2ZTJA 2VEKA 1JJKA 4O1DA 4N6FA 2ZZ6A 1LOQA 2EGZA 3YPIA 1VCFA 2NXIA 4HPXA 3W7JA 3DHFA 3M7WA 1D3HA 2YSWA 3LHYA 1KM2A 5DCEA 3LCIA 5K7JA 2CLMA 4HT3A 4K37A 5KINA 4CNNA 1UUOA 3PSWA 1TV8A 4Y90A 1XUZA 4UTIA 3O06A 5EMUA 2G96A 5FEZA 2YR1A 3Q2DA 1GTEA 2G5WA 2V9DA 4Q33A 2VC6A 7TIMA 3S0CA 3NQMA 4DXVA 1M7PA 5BRBA 3PB2A 1DJQA 4QAIA 1K7EA 3LV5A 3SY5A 4TU1A 2WV8A 3DENA 4BI5A 3DGRA 4GC4A 1KM5A 2FJKA 5MHBA 1IXPA 3TH6A 4IMCA 1LOSA 4NJIA 2YZRA 1FXQA 1H7RA 1HFBA 3F4WA 3PUOA 3W07A 1N7KA 4I7VA 3TU9A 3A24A 4JYDA 4N02A 4Z0JA 3WJXA 5FEPA 5G2WA 3B06A 4O18A 2ABBA 3QC3A 3E0IA 4MLRA 5I3HA 3QJAA 4UTWC 1I2RA 2WNQA 3W7GA 1F2JA 3G0XA 3P8IA 3QEZA 3CQ0A 2HS8A 5C2XA 3LI0A 2YFOA 3S6DA 4D2JA 5AFDA 3LM7A 1OFQA 1XDMA 3UQNA 2FTPA 4FXRA 2WSYA 2GOUA 2Z2UA 4PA8A 3P61A 2CLIA 2JKAA 5G1TA 4RX0A 1EUAA 3C2OA 1XBXA 4PCFA 1G4PA 2XN0A 3LBMA 4JTIA 2YPIA 4UFMA 2FPYA 4UFLA 1F76A 2R91A 2YW3A 3V75A 3LBCA 1W37A 3W1LA 1I2NA 1G6CA 4DBEA 3W86A 5LSMA 3PULA 2QJHA 5DCBA 3W85A 1OX4A 3STFA 1UB3A 4OV9A 4UMBA 5FF7A 3M43A 4GNJA 2E1DA 5G4WA 1W3IA 1GWJA 2QCHA 2PURA 1XBZA 5AYZA 3BPWA 1LROA 1PHWA 2ZA2A 1DQXA 3QZEA 3OA3A 2ABAA 1KM6A 3NL5A 4IPJA 2PE4A 4QIUA 3S5NA 2FFCA 5H91A 3W7NA 5D04C 4IMEA 2W0UA 3AJXA 3P62A 4NJJA 4XZ9A 1TPH1 1NF0A 1JCLA 1ICSA 4UTLA 3TCEA 3NPVA 2PC4A 3NEVA 1DOSA 2DJXA 4GXMA 3SGUA 3HF3A 3MHFA 4LUIA 4GUIA 4NJKA 4O0KA 3G0UA 1H51A 1G4TA 2VFGA 1FWNA 5HR7A 3W88A 2J24A 2C1HA 4MOZA 3C3NA 1VGAA 2NV1A 3MO7A 2ZZ1A 3O07A 3GDMA 3MHGA 3NR0A 4BFAA 1TCDA 1R2TA 3LLFA 1QR7A 1W8SA 1PCWA 4IUOA 3P81A 4BI6A 1ML1A 3UPBA 3UY8A 3W76A 3K30A 3AO0A 1ZY9A 1IIHA 2ZZ2A 1JCNA 1C9DA 4ZQRA 4PEKA 1AK5A 4UNLA 1FWSA 4H3DA 3SIZA 1LTDA 2O7QA 4ORMA 3KRZA 4LVFA 4RJEA 4I7UA 4LRSA 1TRDA 2X30A 3T4CA 5U7SA 4K36A 1LBLA 5D33A 3W1MA 2NV2A 2B7QA 4UTKA 4GBUA 4WJEA 2C18A 5D30A 3NG3A 3QPZA 4FNUA 4UFJA 1IF2A 1TQXA 2WKJA 2WSQA 3HG3A 4LVBA 2VOMA 3NZRA 2GQ9A 3FYOA 4B5NA 3OHIA 2ZTKA 1SO4A 2QEZA 3B0PA 3E49A 4MYXA 4NT0A 5LNUA 1B4KA 4JDYA 1X8FA 3EXTA 4WY0F 3A5VA 5HQEA 3W2LA 1W5NA 3GB6A 3N2MA 1SZNA 4UTWA 1S5WA 2WPBA 3I7RA 3PWAA 2ISSA 1VCVA 4JTKA 3R5EA 1JVNA 1K8ZA 2E6DA 1GVQA 3M0ZA 1L2UA 1U5JA 1XBVA 4XBSA 3TE9A 1EX5A 3PY2A 3W3OA 2VXNA 3NNTA 1SU5A 5FI8A 1SUXA 2I1OA 4EOUA 1W31A 2ZRVA 2DZSA 3UY7A 1SZEA 1C29A 1GVSA 3LTSA 1ONRA 4NZFA 3PSVA 4JEQA 1FCUA 1GG0A 2FPVA 1A5BA 4GFSA 4FF7A 3IGXA 1FUYA 4CNPA 1VH7A 1R46A 1VC4A 2A7NA 3KHJA 1KFBA 2DZTA 3HIJA 4O19A 1XUUA 3NYZA 4RLIA 5C6MA 1O95A 1ZCOA 2V0TA 1K8XA 2HMCA 3TV8A 3NM1A 3P82A 3LERA 2GQ8A 3B05A 3IVUA 5A8GA 3W1QA 3N19B 3W1XA 2QCFA 4XTDA 3E02A 4WOQA 3LTYA 1T8XA 3LRMA 3W7KA 1FY6A 1GTHA 4W9TA 3DKJA 4A2RA 2CLKA 4Y6GA 2FPTA 1L6YA 4UNKA 1JRBA 4OT7A 1XFBA 3O6CA 2BLEA 2YDAA 1H60A 5G1YA 1SO5A 1S3HA 3PR2A 4WY0A 3PBUA 1VPXA 1X6UA 2OZ0A 3M5XA 3PUEA 4O8RA 3PVFA 1DBTA 3NO5A 3S5YA 1G4SA 2JKPA 4O16A 2CW6A 1A53A 1XL9A 4ADTA 1Q45A 3MW7A 2QAFA 4RXGA 4DELA 1H1YA 3PF3A 2NUWA 4FNRA 4WXZA 3G1DA 3TW6A 3DHDA 1VYPX 3M16A 4UTJA 1A5AA 1GQNA 1LRTA 4ZQPA 3G1HA 4JTGA 5KTLA 3G8EA 4QM1A 5GVJA 4UFIA 3NZ1A 4ONVA 2FB3A 1PIIA 1JR1A 5EBUA 5CG7A 1KM4A 1P4CA 1HO1A 5CSSA 2QCEA 2Y63A 4JX4A 3M5ZA 1KFJA 1XXXA 1I2PA 3S1XA 3EWWA 1LOLA 3DH7A 3B0UX 3QH2A 4PH6A 3VFLA 4KWWA 1XM3A 4OGZA 3W1AA 1GPWA 1OJXA 4LVDA 3LRLA 3PC0A 4UCGA 5DY3A 2NUYA 3CEUA 3NQ8A 1DORA 4IOTA 2DZVA 2E68A 5CZJA 3R12A 1NSJA 4WD0A 3NAVA 2WNNA 2BX7A 3GXTA 5L6UA 4Q4KA 2EKCA 1EWDA 1WX0A 2JBMA 4E38A 4A29A 4UR8A 1VS1A 3HQ1A 2CU0A 1KA9F 3TJXA 3G1SA 1H62A 3HGJA 1UCWA 1DJNA 3BO9A 3A22A 3QSRA 3W72A 4O28A 3DU0A 3O15A 1UUMA 3MP5A 4QISA 1SO6A 5CKSA 3KXQA 4K38A 4ALDA 3ATZA 3MBFA 2CLOA 1PCKA 4ML9A 2RHGA 3OVPA 5DY2A 5J5DA 4PTNA 4DO5A 1TREA 1XCFA 5A5WA 3KRUA 3HJZA 3HBLA 4MYAA 5D2VA 3A23A 2A0NA 4UTHA 3EB2A 3HOJA 4MJZA 1XC4A 1TMHA 5HNRA 4HN4A 3P8JA 5LGXA 3C2EA 2ZA3A 1Q3NA 4N9CA 1W0MA 1KFKA 4FEZA 3TSDA 2Y61A 2V81A 4PL1A 5AHNA 4HNUA 5LNVA 5HULA 1XI3A 3W6YA 3W22A 3M44A 4IPIA 3P60A 3ZR4A 1HTIA 3EKLA 4FNSA 3VI2A 1YDNA 2V2CA 4UUIA 2QUUA 4XKYB 3B04A 5HMSA 3C6CA 5ABTA 2XN2A 3UNDA 3L0GA 3DKLA 1SSGA 2VFDA 3G8RA 3H54A 3TC7A 3S42A 1IGSA 4X22A 1FDJA 4U28A 3W2NA 3GDLA 2GUUA 1PE1A 3NQ6A 2Q8LA 4ICNA 4S2CA 4JYEA 1FWRA 4QJ1A 4JICA 3IVSA 4HSOA 4JX5A 2E5CA 2A21A 2PRMA 2Y7EA 1H61A 3SECA 4M6VA 3R13A 4N4PA 4LC6A 4H4IA 1ZALA 3W7DA 4JTUA 1FCQA 3TUUA 4HSNA 2W6RA 5K2ZA 5KZMA 3DFOA 3L21A 2V5BA 4M7SA 2ATSA 4OE7A 3ABSA 4LRTA 5U4NA 3LCLA 2UV8G 1GEQA 4TMBA 3UWWA 1BWKA 1EB3A 3INPA 2DU2A 3SW6A 1WDWA 2QJIA 4YCPA 4RKAA 2J9ZA 3DXIA 3C52A 4BI7A 3TAOA 1V5XA 3G1FA 3L5AA 4UTMA 4EIVA 2DZXA 2QAPA 3LHVA 4MZ8A 3R8RA 4IX2A 5CGQA 4KFPA 2YFNA 1H5YA 1YXYA 2CZDA 1SPQA 1SW7A 3LX9A 3FA5A 3TAKA 3IV3A 1I2OA 4AB4A 1TV7A 3P5ZA 1OFEA 2QCCA 3MI2A 4X2RA 3T78A 3MP4A 3NQGA 4YXGA 1RQEA 1W5PA 3M5VA 4RK8A 3QQ0A 5CZTA 3KVMA 2Y7DA 4JNMA 5AYYA 1V7YA 1R47A 4M6QA 2X2GA 5EPDA 3FYPA 4FX6M 4JXCA 3S9YA 1OF8A 3C61A 1LM1A 3DFNA 3QMSA 3PG9A 3W84A 3W2JA 1L6SA 1IXNA 3S5ZA 4OU1A 4M7TA 2IQTA 3USBA 1CX9A 2VENA 1KV8A 3QFEA 4FHAA 4AWSA 2Y70A 5J5RA 1TTIA 3F4NA 4HNVA 2Z1BA 5D2TA 4NNCA 5E1QA 4NJHA 1G7UA 4DPPA 4ZVJA 1VJIA 4POCA 1X1OA 3ZWTA 1JUKA 4OWGA 2CLFA 3UYCA 1VZWA 3TW7A 5DN1A 4XWUA 1Z44A 4Z1AA 3CWOX 1WV2A 4LC8A 4MY8A 2ZZ4A 5DBUA 2OT0A 1ME9A 4DF1A 5DCDA 3P67A 4WOZA 3W83A 4LS2A 3FOKA 4AHQA 5CPNA 3WK2A 2PRHA 3CB8A 3N9SA 2QCMA 5D32A 3FKRA 3M6YA 3M41A 3MMTA 3W7EA 2ZFAA 4JS3A 5F4WA 1NEYA 1GOXA 3LDVA 4OHQA 1OK6A 2P1FA 5KZDA 1TPUA 5BNKA 4HIBA 3UXDA 4DO6A 5AHEA 3THAA 1DL3A 1RQBA 4JYFA 2ZRUA 3A5FA 1M6JA 3WJZA 4UTUA 5SWUA 1WOBA 3KVJA 1GVRA 3SI9A 4AVFA 1SW3A 1X1ZA 4NNBA 3W71A 1OABA 2JGQA 1HUVA 3GDRA 3I68A 3W73A 2JGYA 3CIWA 2YGYA 3W7LA 3IVTA 5EA9A 3QSTA 3G1YA 3KAOA 1DKWA 3T55A 1L9WA 3B0VC 3N2XA 4HPJA 1B9BA 5I3JA 4LU0A 1PL9A 2V82A 2DZUA 1AMKA 6ALDA 4O52A 1NF7A 2EAWA 5K4ZA 1TV5A 3G1XA 4AAJA 3NPUA 3GAYA 3L5LA 4CLMA 2RDTA 1WAUA 2H8XA 3NL6A 2ISVA 3DI1A 4AWUA 3OIXA 1EA0A 4BWLC 2XN1A 3DFTA 2NWSA 4YLWA 2C14A 3W7RA 3NQ2A 2ISWA 1K03A 3TMQA 4H6KA 4JX6A 2Q8ZA 4JTJA 1J2WA 2DJLA 3QPYA 3CM4A 3T7VA 1OFPA 3ABOA 1BTMA 2BSLA 4ADUA 4LWWA 3HG4A 5HJLA 4TMCA 1SO3A 1KW1A 2YW4A 4IQLA 4PC8A 3TQVA 2ZDRA 3IGUA 1JQVA 2B4GA 3BV4A 5KZEA 3I7SA 2QJGA 1JULA 3Q58A 1HG3A 1YPFA 3CWNA 2X16A 3N9RA 3BG5A 3BLIA 5D03A 4NQ1A 4FX7A 5F4SA 3RK8A 2FLIA 1B57A 3TSMA 2FQIA 2Y85A 2VEIA 3NOEA 5K9DA 2YYTA 2C6QA 4EF8A 1KBJA 3DFPA 1ADOA 4MVAA 4Q32A 4TR9A 3DZ1A 3NDOA 1W56A 3EX6A 5C5YA 4K8EA 3NL3A 1O5KA 4N6EA 2KZHA 2OMAA 1QPRA 3CPRA 4O57A 4JIPA 1JUBA 3STEA 5I3FA 2H3BA 1P5BA 5HWNA 3LHZA 5KITA 3MUXA 3L67A 3OBKA 4O4VA 3ZFHA 4CNOA 3EWUA 3WJSA 3DFQA 3A21A 5G4EA 1X7FA 1Z41A 1A5CA 3C4UA 5DLCA 2HSAA 5FF0A 4RZ6A 3E12A 4HHPA 3FLUA 5AHMA 4R33A 1KTCA 5AN7A 2OX1A 1S5VA 4IJBA 1GYLA 3M5YA 2GJLA 3CLMA 3TDFA 1P0NA 1T0OA 4A3UA 3B4UA 4S2BA 3D0CA 4RZ5A 2TYSA 2AGKA 2D73A 1TPWA 3GDTA 3E96A 4Z1CA 3EX3A 4EVZA 5IBXA 3L2IA 2J88A 3TSBA 1O60A 4X9SA 5LZLA 1YTDA 1R30A 1TPDA 5D2XA 2Y7FA 2J9XA 3C0JA 3NPXA 2Q3RA 4XTIA 4FB7A 4GE8A 1XKYA 4NZJA 4LV4A 5CSRA 5I3KA 4U4MA 1F5ZA 3LI1A 4KWVA 1ME7A 2VFHA 1LRQA 4LW7A 1FWWA 3PS7A 1CI1A 4FO4A 2WQPA 2F7FA 2C0AA 4K7YA 4QQ3A 2X1RA 1TPEA 1K02A 2PRLA 3W9ZA 2F84A 1GG1A 2A5HA 1S5TA 2EF9A 3PB0A 4Y96A 2ZQ0A 3TR2A 1TPB1 3UD6A 3TFCA 3U2OA 4BWLA 5H2ZA 1ZNNA 4MPQA 1LDCA 3MHUA 3GDKA 5FEXA 3PBVA 2WNZA 3CU2A 5LNWA 1U83A 1LBMA 3S5OA 1UASA 1SQ7A 2DZPA 5HUOA 1KLZA 3DFSA 4M19A 4A22A 3EWBX 3OEXA 1KM1A 2YXGA 2CLLA 5TIMA 3HGRA 3W1RA 4DQWA 1ICPA 1WXJA 1OX6A 3M47A 2Z6JA 4MFEA 1EEPA 1W3TA 4YWIA 1YADA 5F2GA 4ZQNA 3TA6A 3TNOA 4A21A 3S8HA 1FDZA 3W1TA 3MYOA 4HKPA 4AF0B 3N3MA 4AH7A 1TTPA 1VHCA 2A85A 3C8FA 3PBYA 1OFDA 3EX2A 3M9YA 3QF0A 1Q6QA 1E51A 4TO8A 3G0SA 4MUZA 3KVKA 2V2DA 1R2SA 2VEPA 1TYGA 4NUWA 2WSRA 1OFOA 5BW6A 3SZ8A 3NPWA 2ZRWA 3LCFA 1IXOA 1MXSA 1RD5A 2ALDA 4JTSA 3SGZA 5FEWA 4UMCA 4JD4A 3Q37A 2BXVA 1H7NA 2A7RA 2Y62A 4O15A 3EWXA 2QUTA 5TBOA 2A6LA 4IXXA 3O05A 3QM3A 3F1QA 4JY8A 1W3NA 4GUJA 5F2LA 5DXXA 2J6XA 1Q6OA 4LOCA 4N9EA 3L5MA 3QQ1A 1P1XA 3ZS4A 3G24A 3HMJG 3WFAA 3W2KA 3ATYA 3MJYA 3W70A 1G4EA 1OHLA 5CZSA 4O4WA 2R8WA 1WA3A 2BZNA 1HO4A 3GIYA 1WYIA 3RU6A 3EWYA 1NFBA 2Y6ZA 4MY9A 1TTJA 2YCEA 5LHFA 3FS2A 8TIMA 5DXYA 3T40A 2E77A 4O53A 4EWND 2V30A 3F03K 3UWYA 3W1PA 1GVOA 4GUGA 1L6WA 1G67A 1TJRA 1WOAA 1TTQA 2ZRXA 1KM0A 1XBYA 3KOFA 1QPOA 4Z08A 1VHNA 4IX0A 1QPNA 4RCXA 4YCOA 4RR4A 2FDSA 1RQHA 4BK9A 3KX6A 4LVAA 1LYXA 5FF3A 3UXAA 4JTEA 1QOPA 4JTTA 5HR6A 2QDGA 1G69A 1TB3A 1FQ0A 2ATMA 5AYXA 2ZZ5A 4O11A 5D37A 4ZQOA 3NL2A 5K9CA 4O10A 3LGEA 1NVMA 2QCDB 4LVGA 4UTTC 2GVGA 1WBHA 1LRNA 2C3ZA 5DBTA 5DELA 1YXDA 5CZ0A 3FKKA 3TQKA 5D09A 3DAQA 3HGOA 1I4NA 1RV8A 1FWTA 3CHVA 2A7PA 1C8VA 5T26A 3O8AA 1A50A 1ZENA 1AW5A 1EP1A 1EP2A 1CW2A 1N55A 3TJLA 5F2IA 1OFAA 3WK3A 3GR8A 3B03A 5IM51 1J5TA 1I45A 1KBIA 1VR6A 2X1TA 1FX6A 3TKFA 4Z0SA 3RNDA 4MLJA 4FIQA 3W23A 3PG8A 2C16A 1YDVA 3HB9A 1OYBA 5F4XA 2CWNA 4NVTA 1TIMA 3V1PA 4Y8FA 3W1NA 2RFGA 2ZA1A 5BMWA 5F1UA 3O1NA 1QNVA 3W74A 3LCHA 2JK2A 1JCJA 1F73A 1MO0A 4JTFA 2A4AA 4JTHA 3TXVA 3TC6A 2G95A 2PCQA 3NQFA 2NWRA 1GYNA 2FB2A 3G18A 3CTLA 1ALDA 4IMGA 3LCWA 1W5OA 3FFSA 4WXYA 3PBWA 3P5YA 1M7OA 3BG9A 3W7IA 3VE7A 3C2RA 4IWWA 3R2GA 1HL2A 1H7OA 2DORA 3P74A 1Q6RA 4PFMA 1RVGA 2O7SA 3RFAA 5AC7A 1TRIA 1Z48A 3IGSA 3ABQA 3IIVA 3LB0A 1O5XA 4I9AA 3BGGA 3UPWA 4GWEA 2H6RA 4R53A 1ZFJA 3GZ3A 3EEGA 2GJNA 1YTEA 3L0NA 5E93A 2TMDA 1LLWA 3N34A 3NXFA 2NZLA 5FESA
chains in the Genus database with same CATH superfamily
1Q2SA 3KCLA 3BQ5A 3QW4B 3MSRA 1FH9A 1JRCA 2FIQA 1WZMA 3PZNA 4JOMA 4KERA 4LAZA 2OEKA 2AQVA 2Y88A 1C7SA 4GINA 2HE8A 4TX8A 5LXXA 7ODCA 1YNQA 4TVDA 3OVRA 3WDQA 1PS9A 2J13A 3VKAA 1EHNA 3PPHA 5KSWA 3HFYA 2QMKA 2E6FA 1VPYA 3J7HA 2VELA 1TVNA 3XIMA 3NQVA 4UTTA 1RJQA 1JQXA 4J2PA 3LBOA 3AFBA 3M7SA 2OEMA 1XLCA 3BAJA 4PCTA 2Z6IA 3GVQA 1MEHA 3W7HA 4P61A 3A6OA 3EBVA 3O6AA 4E3TA 5FL1A 2OLAA 3AROA 4GUHA 4X2PA 4NAEA 3KEHA 3STCA 4DYKA 2Z1SA 2DUZA 3AXHA 3GH7A 4ADSA 4LGXA 2AOSA 4S3GA 2UY4A 1XYLA 3MY9A 3VIJA 4J3SA 3BARA 2DV0A 5HK4A 1XIEA 5CPOA 5HAOA 3URAA 3VIGA 3VILA 1YDOA 4PE8A 1VRDA 3THCA 3OVQA 3ME3A 1BGAA 3CEPA 2QS8A 4LBSA 5H8MA 1F7BA 3CUFA 2VQTA 3W2MA 5A8MA 2RDXA 1UJPA 1ZJIA 1JPHA 1TX2A 3GS6A 5HWMA 1KGWA 3GTXA 4WJXA 4CVWA 2XIQA 4O14A 4M8UA 1Z42A 4O1AA 1K3UA 3MKKA 5AC6A 1G94A 2ICSA 2BBFA 3NEHA 3VOFA 5FJRA 1BPLB 2WZMA 5IOBA 3W7PA 4ILSA 1Q63A 3WJWA 2OYMA 3K4DA 2ANUA 3FEMA 3ZWSA 2B7OA 1W1TA 1T5AA 1T41A 1DXIA 1JDDA 4UR7A 1QHPA 2C8NA 3TMLA 1JCYA 2SFPA 3CS2A 3EB3A 2GZXA 2WKLA 4RPQA 4AEOA 2B0MA 4UIOA 3R0UA 1ZHAA 1TSIA 1V77A 1KXVA 4MFDA 2GUYA 4GY1A 1DEDA 1CZ1A 3GVWA 3CZKA 2P0OA 1REQA 5E0KA 3N29A 5FD0A 2GVEA 4RZ4A 1F8MA 1O4UA 3MUIA 3LLDA 3QYQA 3PZTA 4R7WA 2X0SA 2DSKA 3PZGA 1BG4A 1J0HA 2OJPA 3BG3A 3UWZA 4J3VA 2PDYA 1CXKA 3RM9A 3UGRA 1HIZA 4CD5A 3BUVA 3UVAA 1NP0A 1EQCA 2POTA 2EPHA 4KT2A 1QDSA 2VZUA 2P50A 4IXHA 1GVFA 1GZJA 3BAYA 3R25A 3I6RA 7A3HA 3PWIA 4DBDA 3QRHA 1VQTA 1RZMA 3CO8A 3L9CA 4NNAA 4PB3A 3U2EA 2E0PA 4AEEA 4KWOA 2WZEA 4ZZ9A 3QV6A 2ZRYA 4CQAA 3AWNA 1VF8A 1PAMA 5AHLA 3O0FA 2O56A 4AZ6A 5K4XA 4H6RA 4GUFA 2IW0A 3SEPA 3P93A 4BEQA 3MC5A 4J2MA 2EPOA 2V2HA 2H9AB 1ME8A 1KTNA 1EP3A 4A35A 4XBKA 3IJ7A 3HG2A 1Q66A 3LXCA 2BHZA 4JEJA 4LUTA 1B9ZA 4XISA 1A5KC 2QUMA 3U3HA 3M4HA 4JGDA 4MZYA 4REQA 4H8VA 5M2FX 4D6GA 4WGXA 4XG1A 4RDVA 3O63A 4K1GA 3CL8A 2Z26A 1EH9A 3GE7A 4G2DA 1ZBCA 2PWEA 4HPGA 2VR2A 3LXAA 3IEBA 5D38A 4MWAE 5FJUA 3T08A 2GVJA 4GI8A 1UP0A 1S39A 3XINA 2UY5A 3MP3A 4HNOA 3WLIA 4CQBA 2ZICA 4NI8A 4F0RA 5LKYA 3UZ5A 1YXCA 1FWJC 4H2CA 3RLUA 3LA4A 3UZJA 5AB3A 3GBEA 4DJFA 2J8GA 2W79A 4WY0B 3PZIA 5I09A 1WDPA 2BHUA 4UQAA 5A6MA 2AQOA 1L8NA 1PHQA 1W2PA 1SMDA 3WQEA 4LUJA 4Z2JA 4GVIA 2H8ZA 2HS6A 4FLSA 3HG5A 2VRJA 3WUGA 2QCGA 1FBAA 3UG5A 1TO3A 4R7JA 2XUCA 4ROPA 3UJRA 2Z1VA 3OGRA 3JW7A 4AXKA 3BDKA 3TONA 5IHSA 4LUYA 1EOMA 2CHNA 3RCYA 1ZAJA 5C55A 1EDQA 3H8AA 3HPZA 3NVDA 3G1AA 2HBXA 1IQ8A 1JIBA 3MWAA 3OZYA 2ZC1A 2WK2A 1PEZA 4P8XA 3IARA 3H23A 2XIMA 2BXYA 3KDOA 4GVFA 5DO8A 1K8YA 3W87A 2WJZA 3LNPA 5F7UA 3KBWA 4XKYA 1K7XA 2RDWA 3GYEA 3GDBA 3GHSA 3OG2A 1VRXA 1X39A 5BMXA 3NZGA 4LS1A 1ZB5A 4WF7A 3G22A 5HINA 2Y89A 4PMQA 4NXSA 4EPDC 4PN2A 1P7TB 4NX5A 1DHPA 1CGXA 3UFYA 5CSUA 4HD5A 2PODA 4H9XA 4J1OA 4NJGA 2C13A 3IIZA 3STGA 3L66A 2ZYFA 4L1GA 3QY7A 3URNA 1F6KA 1MZRA 2HTMA 4O0QA 3HQNA 3UJEA 5JBEA 1X1NA 5F1VA 3ZT6A 1MFVA 2VRQA 4HMEA 3BJFA 4UMAA 1RA0A 1E0XA 1E71M 2PC8A 1R2RA 4R9XA 3UR8A 4ZEPA 3GAKA 4FR1A 1T99A 5I5RA 2PDMA 2XVGA 5EBAA 1LP6A 1UA7A 3GTFA 1VYRA 5FSEC 3RLGA 3P6LA 1OF6A 4CCCA 5FJJA 1GZGA 4P7NA 1CLKA 3U8GA 1QFEA 4HU3A 4FPSA 1KFEA 1A5SA 3W7OA 3VX0A 5C9ZA 4UC5A 2O4MA 1VFHA 3T1GA 1V7AA 4CN6A 1XIMA 1UJQA 4LV9A 4NG3A 2YDSA 4MNMA 4DI9A 2DP3A 3RO8A 9XIAA 1EBGA 3S1VA 1SW0A 1CXFA 3GKFA 4TIMA 3DX5A 3A13A 3CGTA 1KLYA 3OYZA 2X1UA 2PTWA 5LHEA 2XPKA 2QV5A 5KMYA 1PUDA 4ZO6A 3TX9A 3NQDA 2PI6A 1NAL1 3TWAA 1H0GA 2F38A 3G6LA 3BE7A 4S3BA 3CJPA 4KS0A 1XPGA 2EGZA 3W81A 3WCZA 1HXJA 4Q4PA 4B9YA 1VCFA 4HPXA 4AZBA 3DHFA 3GH5A 3M7WA 3VCNA 4PMRA 2C91A 4XUYA 1KM2A 4K37A 1QHOA 4CNNA 3QVQA 1TV8A 1G0CA 4PZVA 1TJ1A 1XUZA 4A6GA 4C7DA 1GTEA 5G4HC 5IFPA 2VC6A 3MA8A 4MKSA 4W89A 4Q8WA 3AYSA 1MMFA 3LV5A 1RLDA 3WNNA 4DZ5A 2WV8A 4QCFA 1KM5A 3QR3A 4NIRA 2A3BA 1LOSA 2PSNA 2YZRA 1DP0A 4ROQA 1EJ7L 1N7KA 2HVNA 4NF7A 5C0QA 1YPXA 4Z0JA 1SMAA 3G1RA 4O18A 2ABBA 1NDWA 3V16A 3W7GA 1FVPA 1BXNA 2HS8A 3LI0A 1IEQA 3W4RA 3RR1A 1NH6A 1OFQA 3IJQA 1XDMA 4L9YA 2FTPA 4P8UA 4H9MA 3P61A 2CLIA 1EUAA 4IT1A 3UW6A 2DW7A 3C2OA 1G4PA 3S6TA 2YPIA 2EJ1A 1JZ5A 4UFLA 4GGHA 4GQRA 3W1LA 4W7WA 1FWGC 4DBEA 3W86A 1B30A 2I5IA 4WR3A 1E6SM 4A3YA 2X7WA 4OV9A 4GABA 2R82A 4ZA0A 3UXIA 1W3IA 1GWJA 2QCHA 2GJRA 1XBZA 4XD5A 3HJEA 4S39A 3CV1A 2V5KA 2ZA2A 1US3A 5AYIA 1EZWA 1ZU8A 4S3EA 1V93A 2PE4A 1WDRA 4B5SA 4FLRA 3AJXA 4E6MA 1JXKA 4FR6A 1AFSA 3VFCA 4QG9A 3VZZA 2DH3A 3NWRA 4I5RA 3SGUA 4Q4QA 4GUIA 3VVGA 4O0KA 4ACZA 4GLEA 2J24A 3A9BA 1PTAA 2C1HA 1VGAA 2NV1A 3EDDA 1EA9C 3KOXA 2ZZ1A 3O07A 4BFAA 1R2TA 1NWRA 3VNJA 2CBJA 1T6MA 2D0GA 3MDWA 5TNVA 3UPBA 1GORA 1W1YA 1EC9A 4NI3A 3SIZA 3LGDA 1NQ6A 4IGSA 4DLMA 3KRZA 2WWCA 4LRSA 3QZ6A 3W1MA 1BD0A 1PBGA 1SVDA 1PSCA 5D30A 3S3GA 3NG3A 1CGUA 3QPZA 3WH7A 4E4PA 1R86A 3VXGA 3IJIA 8XIAA 2WSQA 3HG3A 2VOMA 1CDGA 3NZRA 4HN8A 4WSHA 1JAEA 3SO7A 4GJJA 3OHIA 1M3UA 2WJFA 3BZJA 1SO4A 3QOKA 5LA2A 3E49A 3TYEA 3CL6A 4WY0F 4JFVA 4DNHA 4LYQA 3I7RA 2WPBA 3BCDA 1GW9A 2ISSA 1DHKA 4FZIA 3FK4A 1F3TA 4ZB5A 1K8ZA 4WEVX 1L2UA 3BOXA 2QDDA 1EX5A 5BXTA 8CGTA 2Z28A 4PUUA 3N25A 4EOUA 3VNZA 4B5WA 2V5JA 3ISIX 4Z2IA 1W31A 2W5FA 4Q8NA 4AXNA 1GVSA 4NZFA 1J10A 1V6WA 3U4FA 4D9PA 1XLBA 4GFSA 3AMDA 1CGYA 3WX7A 2P88A 4L1XA 2DZTA 3BAWA 4O19A 1XUUA 4DUWA 3OW1A 1E6QM 4L6HA 3VU2A 1O95A 1ZCOA 2V0TA 2X1IA 2ISFA 1V6YA 3VIKA 3W1QA 3NSXA 2QCFA 4XTDA 4WOQA 4ERAA 4GXWA 1T8XA 1XCWA 5BXSA 2OU4A 2D0HA 3PJWA 1GTHA 1UG6A 4AUBA 3T05A 2OSYA 3AXXA 2J4GA 2CLKA 4Y6GA 2DIJA 4F9JA 4FLOA 4OT7A 4LH8A 2F2KA 2YDAA 1HVQA 2EG6A 1H60A 3GH4A 1S3HA 3PR2A 5JVLA 2VEGA 4JKKA 3BLDA 4IJCA 1XRVA 2W62A 4O16A 3A4WA 2VDHA 1GGOA 1N2VA 3A47A 2YL6A 1UMLA 4DELA 1H1YA 4WXZA 3BSMA 3MUCA 3TW6A 3N2BA 5C7HA 3GSMA 3W38A 3UZYA 1GQNA 1LRTA 4ZQPA 2BASA 5A6LA 4DJEA 3G8EA 4KCUA 4QM1A 4UFIA 3KS5A 2PP0A 4I9JA 3R79A 2POZA 1P4CA 3QPEA 2VMFA 1Z32X 4JX4A 1XXXA 5EMKA 3EWWA 3DH7A 3VFLA 3A4XA 2D0FA 3GW0A 1GPWA 3DESA 4L7ZA 1BYDA 5I0DA 3FAWA 3ARQA 3VZYA 1DORA 3DN5A 3QXBA 3LG3A 3R12A 1NSJA 2A79A 3NAVA 3KOWA 4Q4KA 4HK7A 5BRQA 4PTWA 1EWDA 2PDXA 3SRFA 4UR8A 4C6QA 1VS1A 1EGZA 3HQ1A 2X42A 1WDQA 4FS9A 1H62A 1UCWA 1DJNA 3V0TA 3QLDA 3CO4A 3A22A 2HDJA 3QSRA 2Y8UA 2YL5A 3MP5A 1OT2A 2Z2AA 5TF0A 3KXQA 4ALDA 1Y8BA 3MBFA 3JUGA 3BOLA 1H4PA 3OVPA 5DY2A 4PTNA 1RCQA 2X0YA 3CUIA 4DO5A 5A5WA 4QRNA 3KRUA 2G3FA 2OEJA 3QV8A 3BLOA 3UCDA 1LL7A 3HOJA 5D9MA 3ZLFA 4HN4A 4ICCX 3P8JA 5LGXA 3OU8A 3C2EA 2ZUMA 1Q3NA 1X98A 3PTMA 1KFKA 4FEZA 1UP2A 4R85A 2Z2BA 4PRRA 3PPCA 5A6JA 2E1WA 5LNVA 4Q4MA 1RXOB 3P60A 2WMJA 4FNSA 1HJWA 2PD9A 3VI2A 2VGFA 2XH7A 2QUUA 3O0KA 3CBWA 1OSEA 4JNYA 3B04A 5HMSA 2ZE3A 3SDOA 3C6CA 4XZBA 1I75A 3UU0A 3OQ8A 2XN2A 1JNEA 1X97A 3TJIA 1SSGA 2YIHA 3S42A 9XIMA 2VR5A 3PFRA 4BJHA 2BY0A 1JDCA 4U2YA 3N18A 3GDLA 1PE1A 1P0DA 3OP2A 1TE1A 2INFA 3WDRA 1GONA 2ON3A 4YHGA 2E5CA 2A21A 4M6VA 3R13A 3WD1A 3M07A 2GJXB 4H4IA 4J28A 4JTUA 3TUUA 5K2ZA 5KZMA 5AZ0A 3ABSA 1XD1A 3S2NA 3A3XA 2UV8G 4H7ZA 1QI2A 3UWWA 3GVVA 1EB3A 2BOEX 2QJIA 3LQGA 1E0VA 3MCMA 4HA3A 2ZX7A 4EIVA 2DZXA 3GG1A 3LHVA 2VYOA 5CGQA 3UVIA 2WCSA 2YFNA 2Q09A 4UZSA 3W6LA 3WUBA 1MYRA 1DTNA 1I2OA 3R7MA 1S3TC 1C8QA 3FX4A 4U5IA 4RW3A 1NWUA 2J7BA 4YXGA 2OOFA 1SR0A 1E9YB 1RP8A 5CZTA 3KVMA 2Y7DA 5AYYA 4OUEA 4MG4A 3WQDA 5EPDA 3T42A 1KC7A 3S9YA 2WBKA 1OF8A 1E55A 1LQ0A 3ZR6A 1E1FA 1RA5A 3L2MA 3USBA 1DJZA 2C79A 4FHAA 4AWSA 3F4NA 3AZRA 5D2TA 4A8RA 4NNCA 2OXNA 4NJHA 4IIHA 4XZMX 1VJIA 4POCA 1X1OA 1ECEA 4OWGA 7ENLA 1JGIA 3GNRA 1OM0A 1YMYA 1E6RA 4XWUA 2QHAA 3BCJA 5CC5A 2G41A 3BAIA 1CPUA 3KLLA 3W53A 4MY8A 3A3HA 3IRSA 1UA3A 3TYUA 3LQLA 5FSDC 3RO6A 4D8AA 1M68A 3P67A 5E6ZA 4RNJA 1LLOA 3GC5A 3W83A 4LS2A 4QJ3B 4AHQA 4ZB0A 3N9SA 3SURA 3BLPX 1QI5A 3U7VA 3QV7A 5D32A 1MW3A 3WD3A 1XLDA 3W7EA 2QW5A 4V2XA 4R7OA 1EF2A 3K4AA 1OK6A 1BRLB 5BNKA 5T91A 2DDXA 1VENA 4C7GA 2XVNA 3N12A 1Q7ZA 6XIMA 4JN7A 3NURA 3A5FA 3WJZA 3QHMA 5SWUA 3KVJA 4QLJA 4LAUA 1IWBA 3OVGA 1X1ZA 4IIFA 4NNBA 3W71A 3WQGA 1OABA 2PGRA 2WW5A 1HUVA 3I68A 3WF1A 3CIWA 2ZKMX 3GIPA 3IVTA 1FTXA 1CLVA 3L23A 3QGKC 3UETA 3M0MA 3N2XA 1B9BA 3RM4A 2W63A 1J0ZA 2DZUA 4W86A 2OWXA 4JKMA 4ZO8A 1Q4NX 4HPHA 3CZEA 3NIYA 2VCBA 1U5VA 3A3WA 4NAFB 3GAYA 2YCKX 1OCNA 3L5LA 2RDTA 2YL9A 3HPFA 2ISVA 4AWUA 4CU8A 3QOMA 4O1FA 2XN1A 3DFTA 2PDLA 2QNEA 4C6MA 1S2CA 4YLWA 3W7RA 2XIJA 2ISWA 4H6KA 3VO0A 1EXBA 1MVYA 2Q8ZA 4JTJA 1CGVA 1J2WA 2DJLA 1OFPA 3I3DA 3ARZA 5ABGA 5HJLA 4CVUA 2YDQA 1KW1A 3NQBA 2G3NA 4MWAD 3VA8A 3G2GA 3BV4A 3FA4A 3RCMA 5KZEA 2ZOXA 4L9XA 1YPFA 2X16A 4C5ZA 3TSMA 1KQYA 2Y85A 4DBWA 4TX6A 4GI4A 3DFPA 2J8TA 2BVDA 4Q32A 4TR9A 5C5YA 4R88A 4Q7BA 4K8EA 4WGHA 4HSHA 2HCVA 1VEMA 3H22A 4H2HA 4O57A 4JIPA 1FOBA 1K70A 1Z3NA 1XYCA 3STEA 5I3FA 2H3BA 1P5BA 2QT3A 3AHYA 3PFMA 4QLLA 2QUNA 3OBKA 4O4VA 4AIBA 3V0UA 2DIKA 3E1F1 4D6DA 4Z1YA 4EXBA 1Z41A 5DLCA 3CQKA 1P1MA 3C8NA 4RZ6A 1QRQA 2IXUA 5AHMA 5AN7A 4QQUA 4B5TA 3DFYA 2GJLA 2ZUWA 4C6IA 4A3UA 1VD6A 3D0CA 1UW9A 4L6OA 4RZ5A 4Z1CA 4EVZA 3KP1A 2J88A 1T7LA 2WQDA 3AIRA 1E0TA 4U33A 1MFUA 1DPMA 1R30A 2FHCA 3GUWA 3C0JA 3NPXA 2PP1A 1TCMA 3ERPA 4U3AA 4GE8A 4LV4A 4DJFD 1Y7VA 5I3KA 2XIIA 1M03A 1ME7A 1LRQA 2E8ZA 4HYRA 2C0AA 1ESWA 2X1RA 4LY4A 1K02A 2Z27A 3W9ZA 2F84A 2X09A 4LBUA 2EF9A 1I0BA 1TPB1 3TFCA 5BOFA 3U2OA 1E9IA 4MPQA 1RY8A 3AUJA 2BODX 4YU1A 3BTNA 3FNDA 1TVLA 1F3WA 5LNWA 3CYJA 3PP7A 1SQ7A 3OZOA 3G5EA 4V1XA 4G5DA 2ASHA 3OEXA 1KM1A 2CLLA 1AMYA 1ICPA 1UZ1A 1EEPA 1W3TA 2ZX9A 4ZQNA 4WDUA 3NCOA 1FDZA 1E15A 3MYOA 1DWAM 4C6KA 2WZTA 3PBYA 3GFZA 3QF0A 1B2YA 1E51A 4WDWA 4IPPA 3KVKA 1R2SA 2VEPA 2XWEA 1OFOA 2ZC8A 1Y5WA 1V02E 4X9YA 1E6ZA 2ZRWA 4GYKA 5IHRA 1XLJA 1YNPA 5FEWA 1RLCL 3T6CA 3TNBA 1PZ1A 2Y62A 1XLKA 2DVXA 2A6LA 1OY0A 1IWPA 3K1GA 1GPFA 4GY7A 4PEEA 2OFJA 3ZS4A 5JU6A 5HDRA 1UZHA 1FKXA 3WFAA 2OLHA 3BGAA 1XD0A 1YW1A 2VEFA 5IDZA 2PWVA 2R8WA 2BZNA 3BMWA 1TTJA 2GDUA 2CEQA 4HPNA 4GK8A 3URBA 3EOSA 2ZXAA 3UA3A 2V30A 3I10A 3UWYA 1GVOA 4LCQA 2FYMA 3PBMA 5XIMA 1G67A 3ALFA 3R0KA 1YX1A 1H1NA 1J0YA 1QPNA 4RCXA 2R1KA 4RDWA 4LEQA 2FDSA 2J66A 4FA3A 2F6XA 4JTTA 1TB3A 5AYXA 5T9BG 3CV6A 4KH2A 3HV9A 1NVMA 2QCDB 4PMYA 4UTTC 1J0JA 2C3ZA 5C2GA 1YXDA 1Z9AA 3TQKA 1YBQB 4FF5A 3CWHA 1I4NA 5FL0A 5I02A 3CHVA 4IH3A 2DVTA 3RXZA 5TAOA 1VKFA 1A50A 1ZENA 2KAUC 2UWFA 1N55A 1OFAA 4QS6A 1UOKA 4S3FA 2AKZA 1QW9A 2FGLA 4JPGA 1XYAA 3ZVHA 1JI2A 4KBXA 3SN4A 1P0BA 2IUZA 1AJ2A 2WJEA 4Z0SA 5BZAA 3W23A 3PG8A 3LUTA 4WKFA 2CWNA 4AZCA 4NVTA 2V3FA 2PWUA 3OLDA 1NY1A 5F1UA 1W2VA 2DT3A 3W27A 4ERGA 2BVYA 3MDUA 4HU4A 1J8VA 4PBGA 2JK2A 4IHCA 5CCZA 4JTFA 3S46A 1R3SA 3GXDA 4LXFA 5HMDA 2G95A 3AYTA 3TC3A 1GYNA 2HROA 5BOEA 2ZIDA 4AD0A 3S47A 4M6UA 2ACRA 3VDAA 4YVPA 3FFSA 3WF2A 3P5YA 4GQQA 1K77A 5ECUA 3C2RA 1WDDA 4IWWA 3USZA 1HL2A 2DORA 1UD2A 1Q6RA 4IZGA 2J78A 4CEXC 1E43A 3UZWA 3IGSA 3LB0A 4BQ2A 2XSAA 1ISWA 5C71A 3UPWA 2OWCA 1PTGA 3VYLA 3GZ3A 1J5SA 1XLGA 2P8CA 3L0NA 4GA8A 2NZLA 1VLIA 2XH0A 2GSEA 3CAVA 3I3BA 5FA5A 2VZSA 4K7VA 3GX9A 4CCDA 3FJLA 3FGCB 1I8JA 4PTXA 2ZXDA 1FCBA 3APTA 4QE4A 1VFLA 4DAIA 4B5UA 1KGUA 4I7WA 3R8HA 2VX5A 4ZBCA 3JU2A 5I6SA 2NQHA 2AQWA 3W2UA 3PAJA 2GK1A 3EKZA 3HV8A 2ODOA 1DJYA 1M9HA 2D24A 2IPGA 2D1ZA 3POHA 3QW3A 1MZHA 2ZBTA 4WX2A 3VD7A 2J62A 1QAPA 3IV8A 3VUPA 4PL2A 2ZX6A 1E4MM 4MWAC 4L61A 4GRSA 3T44A 2VL4A 4JN8A 4PSRA 5A8QA 1KRMA 1H7XA 1M5WA 1E40A 5IBXC 3PM6A 2HPIA 3CZGA 3LYEA 3CYVA 3CZ8A 3EPOA 5JIPA 3DC8A 1CYGA 3N13A 4RE0A 1A5UA 1H11A 1I2QA 1TQJA 3U5UA 2J8FA 3IGHX 2WLZA 3RGTA 1TZ9A 2GPTA 4P2VA 2E09A 2FHBA 1D3GA 2QPUA 3GXMA 3CQJA 3SSJA 4WQ6A 4FOJA 5A69A 3EX4A 1H63A 3EPMA 4KQNA 2C7FA 2XFWA 2E3ZA 1BVZA 3R1ZA 1MW2A 4M1BA 3S4TA 3VC5A 3BK0A 4KCWA 2QQ6A 3SCNA 4P7OA 2HEJA 4IIGA 3WBXA 4PUDA 4A3HA 3AISA 3MKCA 4C1LA 2PDPA 5LNSA 3ZXWA 1AUSL 4HCLA 4AMCA 4PMUA 4O1BA 1E5NA 2OCZA 3QMTA 3HO8A 3IRDA 1AZ1A 1GOQA 1HP4A 5LIXX 1TR1A 2CZEA 3DG6A 1WNOA 3TN6A 4P7QA 3T2QA 3WBYA 1S2TA 4AX6A 3IAPA 4KF1A 2ZUSA 4DJFC 3AIBA 5I00A 1EJTC 2MANA 4D8ZA 5GNXA 2LLEA 4E2BA 3WN6A 5HNUA 8RUCA 2E4TA 1AH4A 4CQ9A 3REQA 2WPGA 1W91A 1VEPA 3OBAA 2A3AA 3AMLA 3TZNA 4DZAA 1SJBA 4Z2GA 2AAMA 3N15A 1JCXA 2XFFA 4S1FA 1KM3A 1CENA 1I9CB 3UR5A 3GNOA 4AU0A 3FHAA 3N2CA 3GR4A 1QBAA 5BROA 2EXOA 4JIQA 4FOKA 1F6PA 2DSVA 2VFFA 4PUNA 1W1A1 5LGZA 4JFTA 3GK0A 3H55A 3FSUA 4HCHA 2ZZ3A 3ITTA 1FXPA 2OT1A 4MKVA 2BGNE 1OX5A 1H50A 2HV5A 4KEMA 1LZOA 3W02A 5G2IA 1XPYA 3T09A 2QCNA 2XFRA 4HTYA 3U5YA 3S2JA 2DT0A 2NLYA 1OIFA 2J6VA 1P6BA 3TTEA 5CSYA 5JQ9A 4DF0A 3PK7A 3HTWA 3WEOA 3APYA 1BXCA 4QITA 4BQ5A 1E70M 3G3DA 3WJYA 3VKDA 3QKEA 1QNRA 2Y0FA 1PB0A 5D9PA 1MI3A 2Z4GA 3IIOA 3LOTA 3WK1A 1KTBA 2NQLA 3MI6A 1TPVA 3S1UA 1QI0A 2Q3OA 3B8UA 4FP1A 5E0FA 3WK0A 1X8CA 1A49A 2VURA 2ZX5A 3JVAA 3SCUA 2G8ZA 1V3LA 2BTMA 3AMKA 1CB7B 3MV11 1VBHA 2CLEA 3WLTA 1CTNA 1B31A 1W9UA 5DQPA 4PR4A 1TV3A 1SFLA 3EXRA 3K2GA 3UWUA 3EWZA 2WHMA 1YIXA 3QY6A 1EWEA 4AF0A 3EKGA 3KLKA 4LUSA 4IMDA 4P8WA 4GYFA 1ICQA 4LT9A 5A2BA 1O5RA 1RSCA 3K8MA 2CIPA 3L65A 5M3WA 2OWWA 1UKOA 2CNCA 1UZDA 1DQWA 2R9RA 1HJSA 4AEFA 1AL7A 1V6UA 4E0CA 2IQ0A 1CXHA 1DTUA 2GVLA 2CLPA 1MNSA 5CQ1A 1EC8A 4F79A 1EC7A 2Y5EA 2XFYA 4JHOA 1C8XA 5CLWA 2XJ7A 1OC6A 4MGGA 3GM8A 4H1ZA 1B4EA 4D6FA 2YYUA 4C1KA 2BS9A 4QJ5B 3ANUA 3NQCA 2FZNA 1H1ZA 4NU7A 2WO5A 2V69A 5I3GA 1C3FA 1WBJA 2O4QA 4HK5A 1KCLA 4M3PA 5BXRA 5CPMA 2D2HA 1KFCA 3I65A 5J04A 2P0IA 1R9ZA 2P53A 2NUXA 3N4FA 2WJDA 2ZVIA 1B3ZA 4E2DA 3RRAA 5T9CE 3VNMA 3W75A 3G1VA 3VK5A 3E9AA 4ZQMA 1AJ0A 1H41A 3WL0A 4NRSA 4C6PA 2NXGA 4XZNX 4S3JA 2IPFA 1NFPA 2ZCGA 2X40A 2VFEA 3BW3A 1QO2A 1YKWA 4NX0A 1CWYA 4ECLA 1NJJA 2VO5A 4F2UA 3IIPA 3N2TA 2CWXA 3HGSA 5H6HA 4JL2A 2FVMA 2E9MA 3W7QA 3TLQA 3PPFA 4HNCA 3PZ9A 3TIMA 2YOCA 4O12A 3H2FA 4C90A 3AMCA 2GFTA 4WDTA 1I1XA 1A5LC 2BG5A 2GGJA 5XINA 3KM8A 3CH9A 4JDBA 4YMZA 1MRAA 2PDWA 3VCRA 1JF5A 6CGTA 1TPFA 3VKJA 1KFLA 1NU5A 4DHGA 3PN8A 3O6YX 3NQEA 1MEIA 1AL8A 1O6IA 3KDNA 3R11A 1ADDA 4DPQA 3KOYA 1QOXA 3V5FA 2WCAA 5MKGA 1RD6A 3S83A 2BNJA 4FNTA 5E9AA 1HW6A 3GLCA 1OADA 1PJ9A 1KV5A 2PDIA 4CN4A 2EBNA 1W17A 4P7LA 1UR1A 5AOUA 1KR0A 1QOQA 4US6A 1V0LA 4LY8A 3L4UA 2DY3A 3BJSA 1KBBA 4DEFA 4QNWA 2H3DA 1W5QA 1WB0A 4MSSA 4MB3A 3P7YA 1PKYA 5HPOA 5EYWA 4OQVA 5I3IA 2YCIX 5KZ6A 3G3MA 3ZZ1A 2Y5JA 1UZ4A 3PPGA 3UWQA 1EGMA 3BW4A 2QKFA 1V08A 4MB5A 3AXKA 3SIMA 1E0WA 2VEKA 1JJKA 3VD5A 3DECA 1W9BM 1V6VA 2ZZ6A 1LOQA 2JEQA 4C1NA 2NXIA 2D2JA 3LHYA 6PTDA 4H04A 1VAHA 2Y8VA 5K7JA 2CLMA 3AIWA 3L12A 3LPFA 4OOZA 4BQ4A 3PSWA 2GWNA 4Y90A 3O06A 5FEZA 1WKFA 3BL3A 4AD1A 4W8AA 2VUYA 3S0CA 3NQMA 4DXVA 4KMQA 2QGYA 4GIAA 1WUFA 2VDIA 1DJQA 4Y9NA 4HP5A 4MTVA 4XAZA 1XRFA 1ZJHA 5RUBA 1E6XM 4FMVA 4BI5A 5C9XA 4CU6A 2Z7GA 4IMCA 3ZYZA 4NJIA 1YEYA 4JYDA 4BHYA 3WJXA 2EQDA 5G2WA 3B06A 3WQ5A 1RY0A 3E0IA 4MLRA 3K1DA 3QJAA 3SCSA 2DIEA 2WNQA 1GW1A 3GC2A 3P8IA 3UG4A 5LYRA 4OBRA 3PTKA 3TEVA 4DVOA 1Z69A 4GPNA 1ZS2A 1A47A 5AFDA 5A2AA 4F2TA 1W1VA 3UQNA 3UPMA 2GOUA 1IHIA 1OGBA 1XQKA 4HK6A 4YTQA 2JKAA 2VZVA 5FACA 4RX0A 2YA1A 4PBEA 1FWDC 3VOIA 3LBMA 2YLLA 3F2CA 4NSBA 1V6XA 3AYVA 2FPYA 1F76A 3LBCA 1I2NA 1G6CA 3ONBA 3H4WA 5DCBA 1OX4A 3LSBA 3VGGA 4UMBA 3ZLGA 2D69A 4GNJA 5IXEA 2OQHA 4HZ6A 3U0HA 2ZUTA 2PURA 4QCEA 5I03A 3H2MA 3VNIA 1OCQA 1PHWA 3E5BA 4ML4A 3TOPA 3RYSA 3NL5A 2BGSA 3B8WA 2YDRA 4IPJA 2GL5A 2WB5A 4QIUA 3AS1A 3S5NA 2FFCA 3GTHA 3W7NA 1OZQA 3IJLA 1GKRA 4GG9A 4UTLA 1QNOA 1UC5A 2D3NA 1CLXA 1GCYA 4GXMA 4LUIA 2OO0A 4GMEA 3W88A 1BTCA 1W9XA 1XFCA 4ZODA 1XLIA 2PDCA 1N8WA 3MV01 3MO7A 1ISYA 3LLFA 2I5QA 1W8SA 1W32A 1HN1A 3P81A 1UWUA 2E8YA 3SFWA 1TV4A 3LN3A 3VDHA 1OCJA 4GKLA 2QPXA 5LXEA 1XW8A 4ZQRA 1AK5A 4UNLA 3EOUA 1BF2A 4RJEA 3T4CA 1TRDA 2X30A 4K36A 2B7QA 3O2LA 4Z42C 4WJEA 3DCPA 2PB1A 4FNUA 3SCWA 1L6FA 1LG2A 1XH2A 2WKJA 4R9OA 4LVBA 3O3RA 4B5NA 4AZ5A 4NHVA 1TZZA 3MMDA 4X0NA 4NT0A 4PMNA 5LNUA 3MT1A 3EXTA 4IG2B 5HQEA 1H5VA 3N2MA 4P5UA 4UTWA 4QLKA 5FAGA 1NWTA 3R5EA 1JVNA 5GPRA 4KGLA 4EPEC 2WSKA 2E6DA 3WD2A 1XGEA 3FDGA 3W24A 1XBVA 4XBSA 2X8RA 3T8LA 3PY2A 4HU8A 2WXDM 2YB1A 3BV7A 1RPKA 1EX1A 3NNTA 2OPJA 1SUXA 4K2SA 4HVXA 1X7IA 5BYWA 2DZSA 3UY7A 1SZEA 3LU2A 5GQBA 3ZSTA 3V4BA 3IJDA 1ONRA 3PSVA 2OLSA 3E0WA 4HU0A 1JD7A 4CNPA 4A8LA 1VH7A 2A7NA 3KHJA 1KFBA 2YA0A 1TA3A 3HIJA 3U9IA 4TV5A 5A3HA 3XISA 3ZT5A 1FWAC 1K8XA 3TV8A 4GIYA 3NM1A 4GX8A 3P82A 3LERA 4ICMA 2GQ8A 3N19B 3E02A 1KKRA 4HA1A 3LRMA 1L0PA 4F40A 1UR8A 4GKTA 4MDPA 3OHMB 4W9TA 2NQZA 3DKJA 5LIUX 3UA4A 1D3CA 4D1JA 2FPTA 4ZFCA 1JPDX 2Y8KA 3CT2A 2UY2A 2BLEA 1G9HA 2CC0A 1ISZA 4CQCA 1HZYA 4J3UA 1HKWA 4QS5A 4XVDA 4CEUC 5DMNA 1SO5A 2QGHA 2OZ0A 3M5XA 2PPGA 4ZSUA 1UKPA 1C91A 3KL3A 5LIKX 3NO5A 1G4SA 3VD3A 3SCTA 3BLKA 1D7KA 3CLWA 4ADTA 3MPGA 1V0KA 3PF3A 4ATLA 3WMLA 5REQA 2IS7A 1RJRA 1HGWA 1VYPX 4UTJA 4Q7IA 1A5AA 1UR2A 4GZEA 4MNLA 5JMUA 4KW2A 4MJ4A 2EEXA 3AU2A 3IUDA 4D6EA 3AS3A 4JTCA 5CG7A 3MKVA 1HO1A 5CSSA 2Y63A 1KFJA 3H7RA 1UOZA 2OELA 5HNTA 3PC0A 5DY3A 4E3VA 4CN1A 4IOTA 2E68A 4ZSTA 4JTQA 2I57A 2WNNA 2B81A 5BU6A 3WLMA 3CUGA 2EKCA 1WX0A 3AC0A 3RMEA 4E38A 4A29A 4JHMA 3TJXA 3RRXA 2I7GA 4OTKA 3BO9A 2J7HA 2Z25A 2GGGA 3IANA 1QW7A 3W72A 4URIA 1UWTA 3AQUA 2ZADA 3DU0A 1VBGA 3O15A 1V79A 2F9RA 4KIEA 2EPMX 1GJWA 5DRIA 1R9YA 3EWCA 4K38A 5CKSA 3VKKA 3ATZA 1TWDA 5CG0A 4ML9A 2RHGA 2R1NA 4H41A 3TYDA 4JQAA 3EB2A 2I9UA 4PTMA 4PRTA 3GNPA 4MJZA 5HNRA 4B3ZA 3D46A 1PX4A 3NSNA 3WQ8A 2ZA3A 4BS0A 1E4IA 3TSDA 2Y61A 4G7EA 1UQZA 1L6GA 3ZJ6A 4HNUA 4OVXA 1XI3A 4LBRA 3W6YA 3W22A 4GYPA 4KRTA 4IPIA 2I56A 2Z1WA 4MUPA 3WLQA 4Y8EA 4QBXA 3VMPA 4TVCA 4QG8A 1WDSA 3HM7A 1LUCB 5DF0A 1KQZA 3UNDA 5HNNA 4B3KA 3ITXA 4X22A 1FDJA 1UKTA 3W2NA 4YVXA 3NQ6A 4S2CA 5E70A 3OO2A 2G4JA 2IKGA 2WMIB 1FWRA 4JICA 3QLLA 4NY2A 4JX5A 1V8EA 3M0VA 2PRMA 2VC7A 1H61A 3SECA 3D6NA 4V33A 3VINA 3ZVIA 4N4PA 3EGJA 1ZALA 1FCQA 4DWDA 2HXUA 4M7SA 4C65A 2ATSA 4OE7A 2HVOA 4TMBA 1EEXA 3PJXA 3CQHA 1K6AA 2DU2A 3SW6A 1WDWA 1RK5A 2WMHA 4HOWA 3ZO9A 4OBSA 2OYKA 3B0XA 3Q67A 4PCNA 3TAOA 5PTDA 1TJ2A 2QAPA 4RDYA 1E1CB 3WMSA 4UQBA 4KFPA 1HT6A 1NELA 1H5YA 1SPQA 1MRQA 1SW7A 3TTYA 4AB4A 2FFIA 4XAGA 1NOFA 2X41A 2OVLA 1OFEA 2QCCA 3MI2A 4X2RA 1PWMA 3MP4A 3T78A 4IQDA 4AYSA 4RK8A 5CPTA 4CD4A 1XLHA 5E0CA 4KESA 2X2GA 2L5HA 2UBPC 4JXCA 4XZIA 1VPQA 3C61A 3DFNA 3QMSA 3PG9A 1IXNA 3S5ZA 3WMCA 1E56A 4M7TA 2CESA 2IQTA 4WVXA 3ITGA 5ABFB 4FXJA 3TN4A 4QROA 2HXTA 3WMBA 3KL0A 4QE5A 2CBVA 2PTXA 4GNKB 4XIMA 5DN1A 3BMXA 1SM9A 4Z1AA 1WV2A 4TOQA 3F4CA 3LS9A 5DBUA 4J5NA 4A3QA 4DF1A 1PDYA 2E40A 2GWGA 4WOZA 3SY1A 1XIIA 4K1WA 2XH4A 1S1PA 3OTRA 5CPNA 4F3HA 3WLPA 1E1EA 4Q4SA 1J0IA 4Z2LA 3MMTA 4P7RA 1NM9A 5F4WA 1GHSA 4F66A 1Q6FA 4NZ1A 1NEYA 3MZ2A 3CXOA 4QP0A 1PZ3A 4LAMA 3UXDA 2P76A 1RQBA 4JYFA 3NTYA 3WBAA 4DYEA 2ZVRA 1WOBA 1GVRA 4KRUA 4AVFA 3K8KA 1SW3A 4XAYA 3H26A 5E09A 2CZVA 1HF6A 1WE5A 5AC4A 3GDRA 2VVSA 4Q4OA 2V3GA 1R85A 4JIIX 1RBLA 4YNGA 3ARVA 3OA5A 3OBEA 3W29A 4F2BA 5CJNA 4NAEB 4S23A 4ZENA 3N04A 1L9WA 4JFWA 1UWRA 5I3JA 3RX3A 4LU0A 1AMKA 4AVNA 6ALDA 1PX3A 4XIAA 3AS2A 1U1UA 4IISA 4TVUA 3K13A 2H8XA 1VFOA 3OIXA 4HZ8A 4B9ZA 3S9IA 1EA0A 2NWSA 4J3TA 2OR2A 1PKLA 3UWEA 5I24A 1XIGA 3P0WA 2REQA 1HKJA 2WWDA 3QPYA 1XX1A 3T7VA 3ABOA 1BTMA 4UQDA 2IQDA 3V5CA 1F8IA 1YE6A 4AWEA 1J18A 2AGTA 3TN5A 2PA6A 4B4HA 2WMFA 4UOQA 1XV8A 3IACA 1RHCA 4YTSA 3WUEA 3SCRA 1S2UA 1HG3A 2DQXA 3CWNA 4Y9OA 5D03A 3BG5A 4DXXA 2Z00A 4FX7A 1HKIA 4DXKA 2FLIA 2VEIA 3NOEA 5K9DA 3EA3A 1D8WA 2C6QA 3M6DA 1KBJA 3UJFA 5CEWA 3UG8A 4IP7A 1M01A 2PWGA 4M51A 3EX6A 3UR2A 4N6EA 3UR7A 3G77A 3JZEA 1XG3A 1REQB 4PBFA 1JUBA 1N8IA 5HWNA 3LHZA 1C8YA 4C6NA 3ZFHA 1XGZA 4KEVA 1XYMA 3EWUA 4IQJA 4WDXA 1A5CA 2WBGA 4EPBC 1EZ2A 2ESCA 1XH0A 3W37A 3E12A 1UWIA 4Y9PA 3KL5A 4R33A 4IJBA 4LCSA 3KP0A 4MWAA 1FHUA 2WHJA 5H1WA 1MQQA 4S2BA 3POCA 1WZKA 2AGKA 5C9RA 3EX3A 3V0SA 5A6SA 3GO2A 4HHMA 2DSZA 1F07A 5IBXA 4DRSA 4DBSA 1FH8A 3TSBA 1M7JA 1O60A 2EKGA 5LZLA 4G56A 2OQYA 2PP3A 3T0CA 5D2XA 4N0RA 3BANA 3M0YA 2EPNA 4XTIA 2Y2WA 3AU6A 3RIKA 5FJTA 4GZIA 1QJWA 4LCRA 4NZJA 4JZ5A 5CSRA 2G3JA 6REQA 3VM5A 4DLFA 3S9ZA 1K9EA 4KWVA 4IPLA 1X38A 4AIEA 1JYNA 4D72A 2YXOA 4FO4A 1GOWA 5A6KA 4K7YA 3WBEA 2YCLB 1TPEA 2PRLA 1TWZA 3PB0A 1S5TA 2ZQ0A 3R10A 3TR2A 4BWLA 4G9PA 3BH4A 1DJXA 1ZNNA 1JPIA 4LUTB 3UZXA 5I07A 1ZSXA 1DIOA 1OZMA 4B91A 4C91A 3PBVA 3P3BA 3CU2A 3IUIA 3QQWA 1U83A 2VD8A 3MUY1 4REQB 2VTFA 5I77A 2DZPA 5HUOA 3SCVA 4M19A 4A22A 1UKSA 3EWBX 2VT0A 3GUGA 4DM2A 3ABXA 4MMWA 3W1RA 1WXJA 1OX6A 4YWIA 3TA6A 3AHTA 4US5A 3WNMA 4ZTXA 2FMNA 3TJ4A 3WLNA 3W6MA 3N3MA 3TW9A 4AH7A 1VHCA 2A85A 4TO8A 3FV9A 4MUZA 2D23A 1TYGA 2OTDA 2WSRA 2VR4A 3NPWA 2R1PA 3LCFA 1IXOA 2PFHA 4UNIA 4XV0A 4C60A 3H12A 4UMCA 2JIWA 3N11A 2BXVA 1C90A 4UQ9A 4O15A 4MB4A 3WLJA 3EWXA 4DWSA 1QXLA 3KUMA 2QUTA 4F0SA 5TBOA 2NQJA 4NZ4A 1EYEA 4IXXA 4JY8A 5F2LA 5DXXA 4XBJA 3SQMA 1WZAA 1GKQA 2DEPA 3L5MA 1P1XA 1NQKA 2XISA 3G24A 2HISA 9RUBA 3QR0A 3W2KA 3GU9A 5HMFA 2BP1A 3MJYA 3W70A 1OHLA 3NSMA 4O4WA 3EWYA 1ONEA 3FS2A 5DXYA 3T40A 3EYPA 4EWND 5ECVA 2NSOA 5GNYA 1VEOA 2Y4SA 1LQAA 4IFRA 4GUGA 1IEWA 2HWGA 1WOAA 2FH8A 1ZBVA 2ZRXA 2VWTA 1F9CA 3KOFA 4LYKA 4IX0A 1L8PA 2WMKA 4W93A 1LYXA 5FF3A 3UXAA 2ZWYA 2QDGA 1MXGA 3KOZA 3EZ4A 4WKAA 3EWDA 1P6CA 3EOEA 2ZZ5A 4O11A 3SUUA 3D47A 2GLKA 5K9CA 3HN3A 4F0HA 3W26A 4C7FA 3KZSA 4PCPA 5DBTA 2PZ0A 5CZ0A 3FKKA 3IS4A 2F2HA 3HGOA 2GSJA 1RV8A 1TUXA 1C8VA 1J93A 2EO7A 1HGYA 1Y5XA 5CBBA 5F2IA 3NJ3A 3SCPA 3M64A 3CTTA 3ZJ7A 3C5QA 1XYBA 1VR6A 4JFSA 3UJ2A 3VABA 1QTWA 3RNDA 4MLJA 2XU2A 2C16A 1YDVA 1S2WA 1XDJA 3V1PA 4Y8FA 3W1NA 3EMZA 1A3HA 3D5HA 3AICA 2EG8A 3O1NA 5FJPA 3K8LA 4L5ZA 4C6CA 1F73A 1MO0A 2A4AA 1TWSA 1YE4A 1C7TA 3GXFA 4C6EA 4IMGA 2R6OA 3ANVA 4KEZA 1TR9A 3LCWA 4WXYA 4EWJA 3GIQA 3THUA 3RX4A 2O0TA 1EYWA 3W7IA 4HJWA 3VE7A 3OLGA 3GBDA 3MQTA 1H7OA 4EAMA 2BOGX 1TRIA 1JG9A 1DXFA 1V6TA 3IIVA 2ZXQA 4GWEA 1U5HA 4GI6A 3PNUA 3EEGA 4M1RA 5E93A 3TYBA 2TMDA 1LLWA 3N34A 4OV4A 1EIXA 5D2WA 1B54A 4N9DA 3Q65A 2GJPA 1VIWA 3BJTA 4TX9A 2PBGA 1KCZA 3II1A 4ZQCA 4OKDA 1BG9A 1BQGA 3WLOA 1O94A 3V18A 2O92A 1DVJA 2CFFA 3IJ8A 2QJMA 3HFTA 4YWSA 3F7JA 3H2EA 4QJ4B 1XCXA 1PWLA 5KEZA 2BY3A 1C92A 1K8CA 1J11A 3TR9A 5ENLA 3C2VA 3E38A 4CQ8A 2QUVA 4HTBA 4Q6JA 3CAKA 3WEZA 1T96A 1WQ5A 2P5NA 4JCMA 1H2JA 2GQAA 4ZGYA 2ZRZA 1JUEA 3LRKA 4YYFA 2GVYA 3DOPA 2WYSA 3OG3A 1H09A 2E6AA 3SR7A 3BLEA 2IKHA 4IFKB 4J3ZA 3DFHA 3SGGA 5CC7A 1CT5A 4MY1A 1XLFA 2YCJA 2RGLA 2QCLA 2ZZ7A 1IZJA 1OVDA 4AMAA 3EPNA 4JQ4A 1AG1O 3WD0A 4GJ1A 1TV2A 4XZHA 4FXSA 4AHOA 3RM8A 5A6BD 1CCWB 2QMJA 2VOTA 5M5DA 1UIPA 3ANYA 4IL0A 3CT7A 1Q6LA 3VPLA 3FW6A 5C54A 2CKSA 3ABRA 4F8XA 4YL2A 1BWVA 3L68A 4S38A 1FH7A 3U6WA 5CGMA 5G2HA 1Z7AA 2R14A 3LM3A 3KFTA 1XSKA 1Q8AA 2C15A 4RNHA 3A9IA 1UD5A 4L4LA 5DMLA 2P10A 2ZE0A 2G97A 1SZFA 4RNFA 2V63A 2R1LA 1A0EA 5LNRA 3QMRA 2DZWA 3LGGA 2HQAA 3IPWA 4KCTA 2A1YA 1Q7QA 3O6DA 3ARSA 3GZAA 4BR1A 3MYPA 4W7UA 1F6YA 4Z1BA 4A4AA 1OG0A 1V3HA 3UCQA 1O12A 5IDIA 3NGJA 1G7VA 1B3VA 1HKVA 4F48A 1RPXA 1W3KA 2GDQA 1IZCA 4OBTA 1DWHM 1ZRQA 1QMLA 4XQ6A 3BC9A 1X6LA 4M29A 2F61A 7REQA 1LT7A 5CPLA 2IPWA 3WQCA 3AXMA 1XDLA 1K9DA 1TMQA 4FIRA 1QI3A 2DPEA 4CKQA 4AY8A 4EF9A 1SFJA 2E7FA 4EXAA 2J25A 5D8WA 4UOZA 1HL9A 3GU1A 4WUIA 4ACZB 4EACA 4GH3A 1MEWA 1EUNA 4ATWA 5D9OA 3VNYA 5EKYA 5HQMA 4P8VA 4HBKA 4N9BA 2YBVA 3LHWA 1BSLA 4IM4A 1FWCC 3SJNA 3E2VA 1IR2A 3QTGA 2VRKA 4JCLA 2CCRA 1UP3A 1R3WA 4DNMA 3ES7A 2QR6A 5AY7A 4YTRA 4N42A 3CNYA 4W7VA 3GU2A 1PPIA 3UWVA 4MJMA 3DERA 4IICA 4HZMA 2YBTA 3ABZA 1O5QA 2QF7A 1LF1A 4E5TA 1W54A 3IIXA 2A6NA 4PODA 2CZFA 1B5TA 1ZCCA 4YIWA 1OYAA 5FJOA 2PWFA 1K9TA 3WH8A 4K6AA 3A64A 4CNSA 2YZ5A 3BXWA 5HXMA 1GOOA 3IWPA 2H90A 4G7FA 3MMWA 4ACYA 1JZ4A 3KVLA 2GUBA 5EY5A 4MM1A 3WLRA 4ZE4A 5BCAA 5CBJA 1J6OA 1QPQA 4PMDA 3ZJKA 3CIVA 4QG6A 1N8FA 4Q8VA 1XHGA 2XG9A 4OOUA 1DQUA 3TK7A 4F4RA 3TOYA 2FDMA 5C7VA 4ZTYA 4NYUA 1F74A 4MIMA 4RXFA 4A8NA 4CNTA 1W1ZA 2FZBA 4G1KA 3FIGA 3UEQA 2FVKA 1DYSA 3T0TA 1OC5A 2A2IA 4K8HA 1M53A 1QCWA 3TROA 3LHTA 2WM0A 3RCNA 2W4XA 3LCGA 2RKXA 3JRKA 2HRWA 3L2LA 2W67A 1CEOA 3VGFA 1GKPA 4X3ZA 3I4KA 2BB0A 3CIXA 4CCZA 1M1BA 3QY8A 1JCMP 2OB3A 1IWAA 2KX9A 1LT8A 4HZ7A 3MBDA 3S1WA 4KETA 4GXPA 1JEZA 1O66A 4GI9A 3THQA 1SR9A 4MZ1A 3RMJA 2FVLA 4NP7A 4TTUA 2FH6A 5HUPA 2HVMA 4JIHA 1IIGA 3BLFA 5AHFA 1UD6A 4S3CA 2I9EA 1O1ZA 1GQKA 1P0EA 1R3RA 4I3GA 5EFFA 2CYGA 4JY9A 1D9EA 2VX7A 2VDGA 6XIAA 2JEPA 4KFOA 3UG3A 1SGJA 1MUWA 1WCGA 1BEUA 3R8GA 1H7PA 1XISA 3DG7A 3BAXA 4DO4A 1SZGA 1LLZA 1AQHA 2XIOA 1OYCA 1KCXA 1GZ1A 4H9TA 4IGHA 2XM2A 1GVEA 4I6VA 4YPJA 3H53A 2WLYA 4HQVA 1HQTA 4HOZA 3WH9A 4ERIA 4UFKA 2NX1A 4FNPA 5JH2A 1W9PA 5FCZA 1YLVA 4CUCA 3H4XA 3VMOA 3RF9A 1G5AA 5FIPA 3H70A 5EL1A 1RUSA 3CUZA 3E2RA 1TFVA 3PUDA 4Y2WA 1YPIA 2VC9A 2J7FA 2PDBA 5HOSA 1MUMA 4UBPC 3W7CA 1XKJA 2WVSA 2B7NA 5BWFA 1BVNP 2PAJA 1MDRA 5E5CA 6TIMA 1GOIA 3LLXA 3OB8A 2CZ5A 3E2QA 3GVGA 3TP4A 1AW1A 4R34A 1E6PA 2GGIA 3W1UA 4H9YA 1ZAHA 2TSYA 1PXGA 2YL8A 4HNTA 5AHIA 3ITCA 3N14A 4FNQA 1UBSA 4Q6XA 1TMLA 4Z17A 2FTYA 3GXPA 4N2YA 1FRBA 2E5DA 3NVTA 4AD2A 1W5MA 3RPMA 4Q8PA 4GVGA 4RW5A 4AWTA 1LBFA 1W1PA 1AW2A 4KRZA 5CPSA 1OINA 1WXYA 3W0KA 2C0HA 1JPKA 1ZGDA 4DZHA 1UQYA 3VKCA 3NQ7A 2VQUA 3TTQA 4K3ZA 3R94A 1VFMA 3WH5A 1AQMA 1PVNA 1GT8A 3I7QA 5MF5A 3LXBA 1PKNA 4M6PA 2V5LA 5A8OA 4D6CA 3JR2A 4CCEA 2BWGA 1P0KA 1IEIA 4LTSA 3GKAA 1EHAA 1B0IA 4JFUA 4DUXA 1S2AA 1VFTA 3CMJA 4D8LA 1LORA 1GUVA 4J3XA 2O55A 1TJPA 3MSDA 2A3EA 4AFYA 3TA9A 4X60A 3OIHA 2UZ9A 2Z0IA 5AECA 3VE9A 4UXDA 5HWJA 3WL1A 4DJDC 3OQEA 3WNLA 2AAAA 1EKOA 2QIIA 2FZDA 1W3LA 4EAYA 1UPPA 4N6FA 4XK2A 3YPIA 4W8BA 2FZ9A 4K8GA 2NW0A 1NOUA 1D3HA 4QDPA 2PZNA 1XLEA 3W82A 4X0VA 1OG6A 5KINA 2OKOA 3FDKA 1UUOA 4XVEA 4UTIA 2CHRA 1OC7A 1OT1A 3TQPA 5A6AA 3KBMA 2G5WA 2PDFA 1U1HA 4PMOA 5BRPA 1CBGA 2PDUA 3PUGA 7TIMA 2QIWA 3W28A 1ITCA 5I7GA 1S2VA 3FSTA 4QAIA 2PLJA 4GIEA 3B40A 4ZFMA 3SY5A 4L80A 4TU1A 3DENA 3PZMA 1XRTA 2J7CA 5MHBA 3UBPC 3TH6A 1IR1A 1M65A 1H7RA 3F4WA 4I7VA 3CAWA 1AH3A 1POJA 3QC3A 2HJPA 4UTWC 4JKLA 1KB3A 4GNVA 3G0XA 1K1DA 3UT0A 5C2XA 2YFOA 1JYVA 3S6DA 3R6IA 3H2OA 2DVUA 4FXRA 4DB7A 4WSJA 2Z2UA 4PA8A 4LB3A 2W61A 5G1TA 1ECQA 2QV4A 2VWSA 2AL2B 4PCFA 4WHBA 2XN0A 4UFMA 2FKPA 1ZTVA 3ZOAA 4GFIA 2R91A 1Q65A 2ISDA 1DE5A 1DIEA 4KPLA 1W37A 2JF7A 3ARRA 3UESA 4EANA 5LSMA 1OD0A 2XGBA 1UC4A 4ENLA 3CZJA 3WBWA 1UB3A 3EDJA 1GOKA 1YRRA 3AYRA 3WDHA 4OUIA 7TAAA 1SFTA 1LROA 3ORWA 3QZEA 2ABAA 1KM6A 2OGJA 4L65A 5D04C 4IMEA 2W0UA 1TPH1 1AZ2A 1NF0A 1JCLA 4NASA 4ZB2A 1ICSA 3SRKA 1AQFA 3NEVA 2NVCA 3D3FA 4Q8UA 1DOSA 1V4YA 3BMVA 4NJKA 3L4ZA 3G0UA 1H51A 4QDMA 1FWNA 2FGBA 3PAOA 4H6QA 4NILA 4WKHA 2CHOA 4GISA 3R58A 3GDMA 3MHGA 4ZXOA 1QR7A 1PCWA 4B92A 2PD5A 2CETA 4PTDA 1ML1A 2Q71A 3UY8A 1EJSC 3W76A 3K30A 3AO0A 1IIHA 1JCNA 3LENA 4M0XA 3MSYA 1LTDA 2O7QA 1K9FA 4ORMA 5CXPA 5U7SA 3WNKA 5EB8A 1QVBA 1UMYA 2NV2A 4UTKA 1W3HA 4GBUA 1EJVC 2E28A 3RJXA 1UPMB 1DXEA 4DUVA 1IF2A 3SUWA 1EBHA 1ZL1A 2ZTKA 1B4KA 1X8FA 4D71A 2XSBA 2YLAA 3GB6A 4IF2A 3W2LA 3MANA 5CC3A 1ITUA 4JTKA 3QV9A 4F9DA 2CBIA 3MWCA 4IP4A 1GK8A 3M0ZA 2XGZA 4ZOCA 4ZO7A 2H9AA 3TE9A 1IGWA 3W3OA 3LNMA 1R3VA 2I17A 2HNHA 5FI8A 1JAKA 3AIVA 1EQPA 2VCAA 4E8GA 2BVTA 3KCOA