5G1TA

S. enterica hisa mutant dup13-15, d10g
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
247
structure length
229
Chain Sequence
MIIPALDLIGGTVVRVVQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHATE ION
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
total genus 76
structure length 229
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g1tA00
5D33A 4QJ1A 2V2CA 2QCDB 3KVLA 3UWYA 1SZGA 3B0PA 2QUTA 1EX5A 3VCRA 3W2JA 4Z1CA 1KV5A 2ISVA 2BSLA 3W7EA 4ALDA 2QKFA 1FXQA 3WJZA 2P10A 4KFPA 5K2ZA 1R30A 3F1QA 3HO8A 2F7FA 2YX0A 4N2YA 3EWUA 3LBMA 4RZ4A 1GZGA 1Z44A 4NJGA 4BR1A 1NVMA 1OFBA 2WSQA 5EA9A 1H51A 4ZQCA 1O95A 1RV8A 3PBWA 1I2NA 1VPXA 3QM3A 1YDOA 1H1ZA 5DN1A 1P1XA 2V82A 1YDNA 4ORIA 4CCCA 3ELFA 4RZ5A 4GC4A 4AB4A 3H53A 1TPH1 3NG3A 3HMJG 3E02A 3MHGA 1A50A 3SR7A 4LUIA 1MSSA 4AMAA 1SW3A 4FF7A 3PVFA 4N9BA 4DXVA 1XKYA 3IVTA 1VJIA 1RQBA 1LOSA 3M7WA 3QFEA 1XBZA 2WKJA 3MP4A 3W1LA 1DHPA 1SSDA 1VLWA 3P84A 2VC6A 2Q8LA 4GFSA 4Q33A 4LWWA 3KX6A 4CLMA 1KFLA 3ATZA 3BPWA 8TIMA 1JCLA 3NEVA 2YXGA 4POCA 1I2RA 3PR2A 2C14A 2FDSA 3MJYA 3OIXA 4HSOA 1QPQA 4O15A 1JVNA 4K38A 4KWWA 1LBLA 4UFKA 4GUGA 4GUIA 4LS0A 4JTEA 5BNKA 4CNNA 2V5LA 1TV5A 1TRIA 4TIMA 3TXZA 4OWGA 4MLRA 3KOFA 3SI9A 1VYRA 4I7VA 3RU6A 3M43A 4LVFA 3L67A 1OHLA 4CCEA 1JQXA 3R5EA 5AYZA 4R53A 5FEPA 4HN4A 4M7SA 2A85A 2WNNA 3UYCA 3F4WA 1EP3A 4N9CA 1BWKA 2FTPA 3MW7A 3W6YA 1H7XA 3TDFA 3FA5A 3NPVA 2C16A 4DPPA 4UR8A 2Z0IA 3FKRA 4ZQMA 2YDAA 2ABAA 2ZRXA 4K37A 5H91A 5LNUA 2Z6JA 3G3DA 3W72A 5E93A 3NNTA 4M5PA 3O63A 3V75A 1O60A 3GB6A 3TW6A 1G4PA 4NU7A 2PE4A 1F73A 4KFNA 4UMCA 3QH2A 2TRSA 4BFAA 2RH9A 3QQ1A 3OA3A 3LRLA 1Q3NA 4IWWA 1UASA 4AWUA 3S5YA 4E38A 1DJNA 2KZHA 5H2ZA 4M6VA 1Q6QA 4KKXA 1SQ7A 4C1KA 1H63A 1B4EA 2YW3A 2G96A 3W84A 3A24A 4QIUA 2H3BA 2ZRWA 1YADA 2R94A 3NQAA 2FPVA 2QCFA 3W7IA 3TK7A 1TV8A 4JR5A 1R46A 5AN7A 5EPDA 4HPXA 1FWWA 3UWUA 1GVRA 1ZY9A 3C2RA 5FF0A 1ZAIA 2VELA 3ABSA 5EL1A 1THFD 2ZRVA 3TR2A 3PSWA 1TSIA 4GJ1A 3I7SA 3GDKA 4EF8A 4NNBA 2V8ZA 4PEKA 3ABQA 4FEZA 2NV2A 3GXPA 3IIXA 3WK0A 3IIOA 1JCJA 2F84A 3G8EA 3NL5A 1TMHA 1XFBA 3BLIA 3N9RA 4HNTA 1Z41A 4X3ZA 4CNOA 5F1VA 3F03K 3GNNA 4GBUA 3W3OA 3BVJA 3G1YA 1OX5A 4FX7A 3R89A 1YPIA 3NDOA 3QF0A 2YFOA 4OBTA 3UY7A 4WD0A 1GPWA 5IBXA 4AH7A 1LRQA 1W8SA 1M7OA 2I9EA 3T40A 1OK4A 3EX3A 3FJLA 2RDTA 3TSDA 2BX7A 1GJPA 4WJEA 3UD6A 4K8EA 5LNSA 2E6FA 4UTMA 1BKSA 3HG5A 1EP2A 3AJXA 4JXCA 2A0NA 3PWAA 4UTHA 2DP3A 2GVGA 3TCEA 4FIRA 1W31A 3DU0A 2E6DA 2VXNA 3S5OA 3PC0A 3W7CA 1YTDA 1HL2A 1I45A 3M0ZA 5HMSA 3F4NA 5IM51 5FF2A 1WDWA 3SW6A 3B04A 4WQ6A 1W5MA 4UTTC 1A5SA 4UTJA 4E2DA 3AO0A 4IXXA 5EBUA 1MEIA 4UFMA 2CLHA 3IV3A 1DL3A 3MBDA 2R14A 1MXSA 3HGOA 3G0UA 3B8DA 1J5TA 3C2FA 3CTLA 3CEPA 1OX6A 2Z1BA 3MHFA 1MO0A 4I7WA 1I8JA 2Y61A 1KLZA 4MIMA 3W70A 4QSHA 5BW6A 4O57A 3SSJA 4N9DA 1TPEA 1D3GA 1W5OA 3L0GA 1SW7A 3W73A 5DY2A 1F05A 1WYIA 2GVLA 2Y88A 2FB3A 3HQ1A 1VYSX 5K9DA 4PTNA 2FPTA 3QMTA 4XBSA 3QZEA 5EYWA 1GVSA 1OFRA 4J9JA 1QOQA 3M47A 5CPNA 2QJIA 5D32A 4QISA 2I1OA 5FEZA 1LOQA 1PIIA 1W54A 3N2XA 4MFDA 5CZ0A 3HF3A 3PULA 1YDVA 1PE1A 4UTLA 3P67A 3TQKA 4LVDA 4JN6A 2ZQ0A 3W71A 1V5XA 3M5XA 5I3JA 3MMTA 5C6MA 3S5NA 4XKYB 4L4LA 2HSAA 1EA0A 4R34A 4K7VA 4FNSA 3MP3A 1VQTA 3UWVA 2PRHA 5DCBA 4PA8A 1FCQA 3PM6A 3G3MA 4IMEA 2GJNA 2QCEA 5HQEA 3DFTA 1IXPA 3UQNA 1EWDA 3IEBA 4OGZA 4FNRA 2XN2A 4M6QA 3W22A 2H6RA 3L2IA 3VE7A 3FS2A 3M6YA 2QR6A 3GR7A 5D04C 1FCVA 4IJBA 5AHEA 3WJXA 4O4VA 3O07A 1LROA 2Y7GA 2AAMA 3PG9A 1I2QA 3L65A 1H50A 4PCFA 1HTIA 5G1TA 3LTPA 2JKEA 1K8ZA 4ZQOA 1EIXA 4ADSA 4LS2A 4K8HA 3HJZA 3T44A 4O16A 1KTNA 4MPQA 1FWRA 1T99A 3OVRA 1K7XA 1WXJA 2ZZ6A 3T4CA 1XBXA 2J9XA 1LBFA 1N55A 1RPXA 1X1OA 3LTSA 2X1SA 4RKAA 3S5ZA 1SZNA 5MHBA 1VCFA 3B06A 1JRCA 2FJKA 2X16A 3TE9A 1RD5A 3TA6A 1J2WA 1HO4A 4O52A 5J5RA 1IIHA 3PBYA 3UWWA 4YXGA 5EY5A 2EPHA 3IVSA 1LCOA 1FCUA 5LHEA 4O14A 3LCIA 3DKLA 4LC6A 3DI0A 1GQNA 3G1HA 3LGEA 3INPA 3WK2A 1JUKA 2BTMA 4TR9A 2JGYA 1W3NA 1G7VA 3G1VA 1CI1A 4UNKA 1G4EA 1H7RA 3DFQA 3A5FA 3N34A 2WPBA 1C9DA 1WOAA 3LOTA 3GKFA 4O1DA 3M16A 3MI6A 4LW7A 1S3HA 2C0AA 3EWBX 1KTBA 5K9CA 3P82A 3C61A 4MLJA 3CQ0A 4WY0A 4HKPA 5KINA 4A21A 3LLFA 4GXMA 1ALDA 2XFWA 2ZRUA 2QCCA 1YXCA 4Z1BA 4QNWA 1ADOA 3C8FA 5FEXA 3NQMA 4NT0A 1FWNA 3LHYA 1AL7A 3CPRA 4UFJA 3SZ8A 4UTKA 3W9ZA 1TJPA 3ABOA 3QJAA 4UTIA 1F6KA 3LHVA 3TMQA 4E2BA 1NEYA 1RR2A 1OK6A 3CT7A 2O7QA 4Q32A 3N3MA 1G69A 3L0NA 2WJZA 2ZTJA 4UFHA 2PCQA 2JKPA 2A6NA 4O54A 1UB3A 1F6PA 5D37A 4JTFA 4Q4KA 4O8RA 1Q6RA 2BXVA 3KVKA 4ADTA 3EXTA 5EKYA 2Y6ZA 3QQ0A 3GDRA 4PODA 3E49A 1OFEA 2A7NA 2QCLA 2R91A 2J24A 2ZZ4A 3EKLA 4Z0JA 5EMUA 4S2CA 5F4SA 1TTJA 1XL9A 1DQXA 1SO4A 1PVNA 2VKZG 4X2RA 3CIWA 3GYEA 1IXQA 2FB2A 2DZWA 4MFEA 4OHQA 5TIMA 3W1RA 3EWWA 4LV4A 1AK5A 2WSYA 2TPSA 1FDZA 3FEMA 5FI8A 5BMWA 4GUHA 3QW3A 4BWLA 2V81A 4H6KA 3C0JA 3VNDA 3NQVA 2TMDA 2ZRZA 1VS1A 4A29A 2Y7EA 1L6SA 3W2NA 4O1CA 4HHPA 3FYPA 2Y63A 4L4MA 1A5AA 3O6DA 1QCWA 1TREA 4S1FA 1YXDA 1F76A 2VENA 1TJRA 3U8GA 4P61A 3W2LA 5G1YA 3PBVA 1JCXA 3G1SA 2DZTA 3P61A 1T8XA 2ZZ1A 1W1ZA 3I7QA 1V7YA 2VEMA 3N2MA 2ABBA 3L0KA 4YWIA 5IBXC 4JD4A 3W2KA 1T96A 4CCDA 5CGQA 3DENA 2P1FA 4UXDA 2ZZ2A 3R2GA 2OX1A 4DO4A 1AW1A 1EP1A 2DZVA 3THAA 3P8IA 3W7LA 3WFAA 3SIZA 1SO5A 3B0VC 1OVDA 2Z2UA 1YTEA 1OF8A 1W5NA 4IX2A 4MZYA 3KXQA 4O0ZA 3M5YA 3PSVA 5LKYA 2JK2A 4JTJA 2E6AA 1XXXA 3KFTA 1GEQA 3C56A 4H4IA 3IIPA 3VE9A 2CZFA 1VH7A 1QAPA 1KM1A 4ZQNA 5AB3A 1O5KA 4JTIA 4LNYA 4NUWA 3UZ5A 4HNNA 1TV7A 1OX4A 1QFEA 3YPIA 5DCEA 4UR7A 1KFBA 1SU5A 3DFNA 3WJYA 2JGQA 4UCGA 4O50A 4KFOA 3MUXA 4FNPA 4WOZA 3FFSA 2J88A 2QCHA 5KTLA 1AL8A 3BG9A 1O94A 4A2SA 1N7KA 3BGGA 1VHNA 3TKFA 3W7DA 3TAKA 3GLCA 3HG3A 2GQAA 1O4UA 2W6RA 2G97A 3TW7A 2C3ZA 3G18A 1I2PA 2CLMA 3QSRA 1YYAA 3W76A 3NM1A 4FIQA 3GVGA 1JJKA 5LNVA 4RXGA 4WY0B 6TIMA 1TPC1 1YTKA 3W87A 2E5BA 4A3UA 4C1LA 1C29A 4JTLA 4UMBA 5HWMA 4Y90A 3TROA 1SR9A 1D3HA 3PY2A 3NQDA 1H1YA 2Q8ZA 1LORA 2CWNA 4GUFA 2YCEA 1VCGA 3ATYA 3RK8A 2QEZA 1ME7A 2H90A 5CZSA 1TPB1 1Y0EA 3MP5A 1GT8A 1DBTA 2CZDA 3GK0A 4MZ1A 2FPYA 4HPJA 1WOBA 1NAL1 1ZCOA 4DO5A 3S1XA 2JBMA 1KFEA 3TC7A 3WJWA 3KVMA 3S42A 5G2WA 2VFHA 5LNRA 3IRDA 2X2GA 2WQPA 1IXNA 5AHNA 3P7YA 3I7RA 4YL2A 2FLIA 3KRZA 3FKKA 3KVJA 4JYDA 1H7WA 2QJHA 2VEPA 3BK0A 1OG0A 3BG3A 2ATSA 5D2VA 2HS8A 4IMFA 4A22A 3DHDA 4ZVJA 1H7OA 1HO1A 2V30A 3CC1A 2NLIA 3BARA 2DORA 2QAPA 3W7QA 2W79A 2C19A 1FXPA 3BV4A 1VCVA 1TPDA 4UMAA 4CQ9A 1LBMA 3VFLA 1H60A 4H3DA 2G5WA 4IX0A 3DI1A 4FHAA 3B05A 2O7SA 4KWVA 3PBUA 1K7EA 1F2JA 1GTEA 4BF9A 3C2OA 4FO4A 3LHUA 2PURA 4IMGA 3OG3A 2NUWA 1M7PA 2Q3RA 4JIPA 4XBKA 1OFQA 3QW4B 4P2VA 4QITA 1FY6A 1CW2A 3FLUA 3NPUA 4JTHA 4OE7A 3ZWSA 4AWSA 3HG4A 3GXTA 3JR2A 1X1ZA 4ORMA 2Y85A 2YPIA 5AHIA 5DELA 3HPSA 3JS3A 1G67A 3CWOX 3I68A 2VFFA 3T7VA 3W88A 2Y70A 2TSYA 2VFDA 3STEA 2NX1A 5AOUA 3TSMA 1A53A 1HFBA 4AHQA 2CLIA 3ZWTA 5DXYA 1R2SA 3EX1A 3NQ7A 3OBKA 4TMBA 3UNDA 1ME9A 1B57A 1MZHA 3NZRA 2QDHA 2C6QA 2E68A 1OFPA 2I14A 3NOEA 1HG3A 3NGJA 3NL2A 3S1UA 4UTWA 1SZFA 1FDJA 1LLZA 4YMZA 2QAFA 1I2OA 4JTUA 3KAOA 3B4UA 3I6RA 3LHTA 4O1BA 2E6YA 4D2JA 3R8RA 4RX0A 3QC3A 2E09A 3G1XA 1F5ZA 2FQIA 1FUYA 4GRSA 2QDGA 3B03A 1OF6A 1QMLA 3LM7A 3CWNA 3UPWA 2YR1A 1OYAA 3DFSA 1IF2A 4YCPA 1RQHA 2ATMA 3O05A 4EWND 3W85A 4ZZ9A 5LGXA 2GUUA 1UCWA 1OX4B 1RZMA 5C54A 1GG0A 4OU1A 1KFJA 1K03A 2EF9A 2VEIA 2QJGA 4M7TA 5DBTA 3C4UA 2ZZ7A 2X1RA 4Z1DA 4AAJA 1X7FA 3DBPA 5HWNA 2VFGA 4JGDA 3S6DA 3GDMA 3EX4A 1OYBA 3Q58A 3ABRA 3GAYA 4HSNA 3EXSA 3M1ZA 2PRMA 5AC8A 4MOZA 2QUUA 1W0MA 5HUOA 3USBA 1R47A 1SO3A 2A5HA 4LOCA 3R13A 1LLWA 1A5CA 1L9WA 3WK3A 3M41A 3PAJA 1VYPX 4MUZA 3W1XA 4ZQPA 1H61A 4EF9A 1PCWA 4XTIA 4BWLC 5KITA 3BGJA 1GVQA 1LM1A 5AYXA 1FWTA 4O17A 3IVUA 1BWLA 1Q45A 3MI3A 1T0OA 3QPYA 4WZHA 1UUMA 2V9DA 3W86A 1QWGA 3LXAA 2UV8G 2IQTA 3HOJA 1G6CA 3EWYA 1QO5A 4Y8FA 5L9FA 2ISSA 3TXVA 4FXRA 2OT1A 4WUIA 4WY0F 4AHOA 3EB2A 3K30A 1D9EA 2GPTA 3LV6A 1NSJA 2NX9A 3NVTA 2E1DA 2ZA1A 1DORA 1QNVA 4UTUA 4R7JA 1TRDA 4S2BA 3NQ6A 4N02A 1TPWA 5G5IA 5D2XA 2EGZA 1XUUA 2NUYA 4N4PA 5CZTA 5U4NA 4RK8A 4AXKA 3QMRA 3DHFA 4G1KA 4K7YA 1O5XA 3W07A 4ML9A 1YPFA 4O4WA 3OHIA 4RZ6A 4BI5A 3P5ZA 4Y9AA 1K8XA 2NXHA 4RXFA 3A5VA 5C2XA 1ONRA 5I3FA 3NQGA 1SSGA 5CSSA 3STFA 3LV5A 3P74A 4AEOA 5TQLA 4LS1A 1AW5A 3FYOA 3W7GA 4JTSA 4UC5A 3NYZA 1EB3A 4TO8A 4UFLA 1UUOA 3FJ6A 2B7NA 4LTSA 2VFIA 5TBOA 5DLCA 3GX9A 3UY8A 5CPLA 3E9AA 5LHFA 4CQ8A 1WQ5A 3EX2A 3STCA 1L2UA 1TPVA 4OV4A 1TB3A 3NQEA 4M19A 5D2TA 3W1UA 1NF7A 3PUDA 4OT7A 1I4NA 2C13A 4N6EA 1JCYA 4JTTA 4JDBA 4N6FA 2DZUA 5LGZA 4U28A 2A2IA 3H55A 2ZBTA 3LHWA 4AF0A 4IXHA 1X6UA 2NX3A 3M9YA 1JUBA 3BW4A 3S9YA 2V2DA 3D0CA 1IXOA 1UBSA 3L68A 4DF2A 3GR8A 1J4EA 2QCGA 3B0UX 1VZWA 2ZZ5A 6ALDA 5FESA 2DZPA 4LVAA 1FBAA 3SFKA 5CSRA 4UNLA 1P0NA 1MEWA 2VEKA 4FXSA 3SECA 3NXFA 1RVGA 2OCZA 1TO3A 3T55A 5KSWA 3M5VA 1KLYA 3BLEA 3TH6A 1L6YA 1P4CA 2H3DA 5G2HA 2DJLA 3IGXA 4IOTA 3W1AA 2CU0A 3A9IA 2YGYA 3C2VA 3ZS4A 1GTHA 1S5VA 2NUXA 1SPQA 1EWEA 1XBVA 3RF9A 1XI3A 2NXGA 1EEPA 4O11A 4UTTA 3TJXA 4UIOA 3G0SA 3NQFA 1KM0A 2J27A 1KFKA 1YXYA 2ZTKA 3G0XA 3P81A 4NJKA 4JYEA 3LHZA 3MYPA 3N9SA 5F1UA 2QCNA 2B7QA 3HGSA 3KHJA 4UFIA 1QPNA 2YZRA 4YCOA 2DJXA 5AFDA 1X8FA 3PUEA 1JCMP 2CLLA 3W23A 1TTIA 4LRTA 4Z08A 3BG5A 1WX0A 4JTGA 4DF0A 1QPRA 2RKXA 4E0CA 3UZJA 4BI6A 3TU9A 4QAIA 2A7RA 3W7MA 3UXAA 1XBYA 3LI1A 4HIBA 2ISWA 4M6PA 2C18A 2H8ZA 5HINA 1A5BA 4FX8A 4BK9A 3W7NA 2RDWA 5I3IA 4LC8A 3EX6A 1QDSA 5FF7A 5D38A 1K3UA 1HUVA 3IIVA 4PL1A 4NX5A 2CFFA 3CU2A 2VFEA 3W75A 3UPBA 3IIZA 2C15A 4NZFA 5HWJA 3CEUA 3QEZA 4NNCA 5KZEA 3NL6A 3W2UA 4EIVA 1H62A 3NAVA 4WXZA 3LXBA 4XWUA 5A5WA 1RQEA 2LLEA 1U83A 1SZEA 1OFDA 3LB0A 5AHLA 3TX9A 3SY5A 1Z48A 4MYXA 3LTYA 3A22A 2WNZA 3MWAA 1SFLA 3W2MA 3EXRA 3VKJA 1LTDA 3O06A 2RDUA 4DF1A 5KMYA 4FNQA 5CG7A 2GQ8A 5E0KA 1FQ0A 5K4XA 5D2YA 1GYNA 5K3VA 4NJIA 3TMLA 4OQVA 1UJPA 1TQXA 1B3OA 3L5MA 4IGHA 5BRBA 2GVJA 1K8YA 5I3GA 3LCHA 3PUOA 3MBFA 1ZENA 2CLFA 1B4KA 1KM3A 3MYOA 4ZMGA 1TPFA 4DQWA 2CLOA 3KRSA 5DXXA 2E77A 4UTWC 2G95A 1KBJA 1VC4A 3OEXA 1W5QA 1L6WA 3LCXA 5L6UA 3L66A 3W1PA 1LRTA 3DFOA 1P5BA 3IGSA 4LVGA 4XUGA 2B7OA 4JTKA 1FWSA 1WBJA 2EHHA 2Z6IA 2RHGA 3TC6A 3LRKA 2J9YA 4JX5A 3CB8A 1QPOA 3JRKA 4RLIA 2Y62A 4IPIA 1G4TA 2X1UA 3EWZA 4MY8A 1B9BA 3QYQA 4Y6GA 3UWQA 2X1TA 1NFBA 1H7NA 3TFXA 3MO7A 4ICNA 2DZXA 4PH6A 1VR6A 5I3HA 2PC4A 5K9XA 3CHVA 3ZR4A 1ML1A 2A1YA 4GNJA 5K7JA 1JCNA 3HBLA 1KM2A 2A6LA 1XDMA 2ZDRA 1G4SA 1XM3A 3LRMA 3U6WA 3O6YX 3TV8A 3GXNA 4NX0A 1TIMA 4DO6A 3L21A 2V2HA 4Y96A 3EWXA 4NXKA 5AHMA 1SFJA 3VI2A 1U5JA 1BEUA 2XN0A 4HNVA 1QOPA 2YYTA 5HR6A 2P0OA 4JYFA 4XKYA 4A2RA 2AGKA 4AF0B 5HUPA 1K7FA 2ZA3A 3GIYA 2TYSA 2OJPA 3O6CA 5C5YA 4IQLA 4EVZA 3C3NA 1EUAA 4TU1A 5HR7A 3GDTA 4JY8A 2ZZ3A 5BOOA 3DH7A 1E51A 1F74A 1S5TA 2CZEA 4NJHA 5U7SA 5DBUA 2QCMA 5BMXA 1TQJA 3WJSA 5LNWA 3W1QA 4CNPA 4AWTA 3PB2A 3NL3A 3L9CA 1KM4A 4LUJA 3LDVA 3LCLA 2PRLA 4BI7A 4PFMA 4O18A 3Q2DA 4LT9A 4AVFA 1OFAA 3QPZA 1DVJA 5I3KA 4HNUA 2AQWA 4O12A 3TQVA 2J9ZA 2OZ0A 1TYGA 4MY1A 5G4EA 4GWEA 4RJEA 1IIGA 4K36A 3O15A 3TFCA 3DFPA 4WX2A 1GYLA 4MJMA 1GOXA 5D2WA 4HT3A 3FOKA 5F2MA 1JULA 3LERA 2B0MA 2OT0A 1LDCA 1VLIA 2ZCGA 4O19A 4Z1AA 3G22A 3SGZA 5AYYA 1P0KA 3M44A 3LLDA 2CW6A 2DZSA 3PB0A 1KTCA 1QR7A 3C6CA 2YW4A 4MY9A 3DGRA 5DCDA 3GDLA 5CPOA 3PF3A 1M5WA 1XUZA 1H7PA 1NF0A 2CLEA 1JRBA 3CIXA 3MHUA 3QMSA 3Q94A 1VGAA 3W7JA 3S1VA 3A23A 3DXIA 1TCDA 3NM3A 5D03A 3DAQA 3GZ3A 3OVQA 2BWGA 3KRUA 4XZ9A 2B7PA 1W3TA 4XQ6A 3I65A 3LCWA 1GG1A 3ZFHA 1SO6A 3W1NA 2Y7FA 3LBCA 4MZ8A 3EKZA 2ZFAA 3HG2A 4LVBA 1G7UA 1LP6A 5AHFA 1BTMA 3W1MA 2JKAA 3LI0A 2R8WA 1H5YA 1WAUA 1TTPA 1LOLA 5CZJA 1AG1O 3DKJA 2C1HA 3TJLA 1KW1A 1F7BA 4MKNA 5F4WA 2CLKA 3S8HA 4LY8A 4FB7A 3EEGA 2BZNA 3P8JA 1YLVA 1CX9A 1ZJIA 4MJZA 1W37A 2A4AA 5LSMA 3HGJA 1ICSA 1LZOA 3W74A 5FEWA 2HTMA 1SW0A 5ABTA 1PS9A 3DZ1A 4WOQA 4JEQA 3W83A 1KFCA 3N14A 4NZJA 1LRNA 3N19B 1Q6OA 3CM4A 1AMKA 2EAWA 1KV8A 5F2GA 3C52A 3TSBA 5K4ZA 1GWJA 3CLMA 1C8VA 4XTDA 3NA8A 3PS7A 5D02A 2RFGA 2E5CA 3M5ZA 1Q6LA 1XC4A 3TQ0A 1ZAJA 1KA9F 1ZALA 3FIGA 4JNMA 3MI2A 4O13A 3L5AA 1XDLA 1ZAHA 1JQVA 2HMCA 3NPXA 4DBEA 3HPXA 4MYAA 3BLFA 3HB9A 1LYXA 2Y7DA 4O0KA 2EKCA 2QF7A 2WO5A 2QCDA 3R12A 3QSTA 1TTQA 4I9AA 1FCBA 1XCFA 4QM1A 4NXSA 4I7UA 4K39A 5J5DA 2YYUA 1ZFJA 4O1AA 2YFNA 4IMCA 5KZDA 1W5PA 2H8XA 3G1AA 3GAKA 3RFAA 5KZMA 4FX6M 3W7OA 2ZYFA 3O1NA 3BW3A 1Z42A 4PC8A 5F2IA 4NJJA 5E1QA 1DJQA 1FDYA 2X30A 3P62A 2W0UA 1VHCA 3W7RA 4GUJA 2NWSA 3BO9A 2QUVA 3BW2A 5A8GA 3TIMA 4DEFA 3C2EA 1QO2A 3TNOA 1GVFA 2WSRA 3H54A 2HS6A 5FF3A 5G4WA 1FX6A 3ANYA 3QRHA 2GJLA 2BLEA 3LCFA 5CKSA 2ZA2A 1OYCA 2Q3OA 4RR4A 1WV2A 4DPQA 4AHPA 3TAOA 5AC6A 1VRDA 5CPMA 4NNAA 3A21A 1PHQA 3V1PA 3Q37A 1KBIA 4UUIA 5FF4A 1K02A 1WA3A 3G24A 3W7PA 4N4QA 4NVTA 4EOUA 5HULA 3NR0A 3T78A 4TMCA 1PHWA 4CQAA 3NPWA 1N8FA 4O10A 3UWZA 2NV1A 2OMAA 1ICQA 3IGUA 3L5LA 4JIQA 1JUEA 3NQ2A 3E96A 3NQ8A 3THQA 5AC7A 3G8RA 4W9TA 4MVAA 3N73A 5HJLA 2A7PA 3W1TA 1M6JA 5D09A 3W7HA 1ZHAA 4ONVA 3NO5A 4JX6A 1DV7A 3LCGA 2ZRYA 3UXDA 1ZNNA 1PCKA 3LXCA 3P5YA 1KM6A 4NQ1A 4TX9A 5HNRA 1DKWA 4X9SA 4ZL1A 4IPJA 4B5NA 4FNTA 2Y89A 3GNDA 3RMJA 4JX4A 1MEHA 2A21A 2V5BA 2YSWA 1IGSA 2NZLA 4N9EA 4JS3A 3E12A 1AW2A 3SJ3A 3U2OA 4LU0A 2D73A 4O28A 1W3IA 4U4MA 2DU2A 4OV9A 1EUNA 1SUXA 1OFOA 1ME8A 3HIJA 2NWRA 1ICPA 1OJXA 1W56A 4QNEA 5C55A 3TUUA 5T26A 2WNQA 3STGA 5LZLA 4PL2A 4GE8A 1PV8A 3WK1A 5D05A 2J6XA 1PL9A 5DY3A 1DOSA 1WBHA 5G2IA 3HGRA 3RNDA 3S0CA 1JR1A 3RLUA 5GVJA 3W7KA 4Z0SA 4ADUA 4LRSA 3GKAA 4YLWA 2ALDA 4WXYA 2GQ9A 4DELA 3G1FA 4IUOA 4ZQRA 3SGUA 3PG8A 2E5DA 2FFCA 3LX9A 4O53A 3OVPA 3S1WA 2VOMA 5D30A 1R2TA 3NZ1A 1OABA 7TIMA 4K6AA 3RLVA 2GOUA 2CZ5A 2V0TA 3P80A 2NXIA 5F4XA 3NQCA 3P60A 4FNUA 4LV9A 2XN1A 1S5WA 4JDYA 1EPXA 4R33A 1R2RA 1DQWA 5SWUA 2FIQA 3HPZA 2WOQA 4DBDA 4RV8A 3O8AA 4JY9A 1GVOA 4RCXA 2WV8A 3G1DA 3O16A 3E0IA 4X22A 2B4GA 4JICA 5F2LA 1KM5A 1TPUA 4QQ3A 4IMDA
chains in the Genus database with same CATH superfamily
6PTDA 2QCDB 3UWYA 3VCRA 2RDXA 4B5WA 3W7EA 2YOCA 2VRJA 2P10A 4KFPA 3WFZA 4N2YA 1GZGA 1Z44A 3TYBA 4BR1A 1MRQA 3PHAA 1TX2A 1E5JA 2BV9A 1RV8A 4TX6A 1EGMA 3G77A 1VFTA 3TN6A 4FK9A 2ZUSA 3WNMA 3ARPA 2ZVRA 1V51A 4LYKA 4RZ5A 4JEJA 3B40A 4WF7A 2V3GA 4AVOA 3QC0A 4MB4A 2ZX9A 3NG3A 1DXIA 3WEMA 1R9YA 2PWUA 1LQ0A 2XISA 3VX0A 1XIDA 1VJIA 2HPIA 5JUVA 1XRFA 3ES7A 3MP4A 3W1LA 1DHPA 4YWSA 1D8CA 1FP8A 3CGTA 3WSUA 3PAOA 3KX6A 1KFLA 1E1FA 1VBRA 5AY7A 3NEVA 3A3XA 3MJYA 3BMXA 1DJWA 1JVNA 4UFKA 4GUGA 4IG2B 5FD0A 1RD6A 4CNNA 1CGUA 3ZLHA 2WXDM 3KOFA 3OGSA 1NDZA 1VYRA 3AICA 2JEPA 3KZPA 2PZ0A 2BXZA 4CCEA 3R5EA 5AYZA 3GQYA 3NTYA 5FEPA 4C6FA 3TLLA 4HHLA 3DCPA 3IJDA 3W00A 1J11A 5BZAA 4L9ZA 3ZSTA 8CGTA 5LIXX 2IUZA 1WB0A 4DNMA 3FKRA 4PE8A 3EKGA 3ORWA 1K9EA 3UF9A 1G01A 4K37A 2Z6JA 3W72A 5B7YA 3O63A 2X0YA 1BQCA 1WAWA 4E8DA 2ZC8A 1DWGM 3SCVA 3OA3A 3T2PA 1E56A 1UASA 4INFA 2GJXB 3S5YA 1Q13A 2WCGA 4F0LA 1E9LA 1Q6QA 4KKXA 3VKDA 3VKCA 2QT3A 4C1KA 3A24A 2VX5A 3AQUA 2ZRWA 3KZSA 2WMHA 1M04A 2QCFA 2X2YA 3A4AA 4H8NA 3N2TA 4IJCA 5AN7A 1XIJA 2OKOA 4HPXA 3WQOA 3HURA 1FWWA 1H49A 1GVRA 3UWUA 1DIDA 1ZY9A 1ZAIA 3GSMA 4CVUA 1THFD 2VZTA 1NU5A 1EJVC 4GJ1A 3CAVA 3I7SA 4M8UA 4EF8A 3KDNA 3VUSA 1Q4WA 3H23A 1E15A 3MZNA 3WK0A 4NYYA 1EDTA 1TMHA 1Z41A 4X3ZA 4ZA0A 4GYPC 1VPQA 4CNOA 4EX4A 3EA2A 3F03K 1EBHA 1UP3A 1HGYA 3W3OA 2HRWA 1A80A 3G1YA 4MAZA 4RE4A 3RLHA 1RP8A 3QF0A 2YFOA 3BAYA 3UY7A 3VIGA 1C92A 4NIRA 4HMCA 4AH7A 1ZUAX 1EHAA 1M7OA 1FH8A 3L4WA 3FJLA 3VNLA 4Y2WA 3TSDA 3UD6A 4UTMA 1BKSA 1UIPA 4HYWA 4H9ZA 3V5OA 1CTNA 1UR4A 1CXFA 3DU0A 3AMGA 1NQKA 3S5OA 3EB3A 1RVKA 3W7CA 3F4NA 2XIMA 1PAMA 4ZCWA 4PMDA 3W01A 2F8QA 3RGTA 1LWIA 5FF2A 3SW6A 4WQ6A 3T0AA 5DRIA 4UTTC 4IIGA 1UKPA 4E2DA 1BPLB 1Y5WA 2JFEX 3AISA 4IXXA 3F4VA 4L1WA 3BMVA 2DV0A 4WJ8A 2R14A 2QPSA 3FN9A 3WUFA 1FA2A 4HSHA 2YLAA 3BLOA 1MO0A 2V67A 1I8JA 4FLOA 2XG9A 3QTPA 1V0NA 4MB5A 5BW6A 4RDYA 3UZXA 3RDKA 1QNQA 3CV7A 3EDFA 4MADA 2B81A 2YL9A 1AODA 5B7ZA 2Y88A 3A3HA 5K9DA 3WMBA 3CMFA 2YCKX 4GVHA 4ERAA 1I1WA 3UCDA 1QOQA 4KCUA 2QJIA 5D32A 4J4KA 2SFPA 2HISA 3UP8A 1PIIA 3WEOA 2PDJA 3C5QA 4JN6A 1V5XA 4ACZA 3SRHA 3OLIA 2BNJA 3S5NA 1XYZA 2HSAA 1EA0A 1RSCA 2MANA 4PBEA 2PRHA 3GM8A 3PM6A 3S2MA 1TWIA 1IXPA 3W26A 1CLXA 3UQNA 2AMGA 2XN2A 4ZOAA 1EJRC 2EKGA 4Q8MA 2BG5A 1BVWA 3VE7A 5CLWA 5AHEA 3WJXA 2Y7GA 1I2QA 3QY8A 3L65A 5E6ZA 1CGVA 3PTQA 4PCFA 3ANVA 1DWIM 5G1TA 4NZ4A 2JKEA 4HBKA 2Y8VA 3PZNA 2ZX6A 3QY6A 3S2CA 1KTNA 4EANA 4MPQA 3AUJA 1T40A 4BZYA 1K7XA 4JFWA 3T4CA 1XBXA 2DSUA 1N55A 3OIHA 2PF8A 4DM1A 1SZNA 5MHBA 1VCFA 3Q67A 4DWSC 2FJKA 2X16A 3KTXA 1OT1A 1W91A 2WHMA 3EDDA 1IIHA 3PBYA 3OVGA 1KGXA 1DJXA 1NH6A 1E4MM 3IVSA 4GY7A 3T09A 2DSZA 2OZ8A 4FP1A 2RJGA 3GFZA 1OZQA 3WF2A 3DKLA 3DI0A 3DYMA 5C0QA 4A6GA 3UJ2A 3EPMA 2BTMA 4TR9A 4HU8A 1XV8A 1G7VA 1CI1A 1PZ1A 1JDCA 4UNKA 1G4EA 1UQZA 3A5FA 3GC2A 3N34A 3VABA 1C9DA 1WOAA 3RR4A 3QYSA 3UNTA 2BVYA 2HNEA 1F3XA 2GDQA 2D20A 3ALGA 4J3TA 1IEQA 4XZMX 3H7UA 4GVGA 3LLFA 4ECLA 2PGWA 2F6KA 3QV6A 1RJQA 1ALDA 2KAUC 3GVQA 4K1GA 1ZRQA 5EFDA 2WNWA 3WZ0E 1HX0A 1OZMA 1XLGA 4UFJA 3SZ8A 4UTKA 1G1YA 3E3HA 3W9ZA 5C9ZA 3T6CA 2P88A 4L6HA 4HGXA 4E6MA 1F6KA 1OK6A 4HTYA 3AUOA 1VEMA 4Q32A 3KS6A 2WJZA 1A5OC 2V68A 1CGTA 7XIMA 4O54A 3WDJA 3IANA 3L4ZA 1CXLA 3GG1A 3KVKA 3EXTA 5EKYA 1IR1A 5CPTA 3SO7A 2R91A 3EOUA 2Q09A 1A5LC 3WUEA 2FDMA 2X8RA 4Z0JA 3N2CA 3VGFA 1PSCA 4S2CA 5IHRA 1EDQA 5FAGA 3CIWA 3I4KA 3LENA 2HK0A 1IZKA 4J3VA 1KRBC 4LV4A 2WVVA 2VX6A 3FEMA 1MNZA 3IJ6A 4B2DD 3R4IA 1ZJBA 4BWLA 3HQPA 4H6KA 2VDHA 1YX1A 3GHUA 4A29A 2V3FA 4GFIA 1L6SA 3FYPA 1B90A 4XX6A 4ACZB 4S1FA 4KMQA 3U8GA 3W2LA 5G1YA 3G1SA 3E1F1 4AYGA 1TWSA 4PCTA 3TR9A 4H00A 2ABBA 5IBXC 2DPEA 4BHYA 4DJEC 2P1FA 2OX1A 3APTA 3LK6A 3EMZA 2DZVA 1QNRA 2UWFA 1VFMA 1SO5A 3B0VC 1YTEA 4IX2A 1E9IA 1UH2A 4PTWA 4O0ZA 3M5YA 2EJ1A 3KFTA 4LXFA 3IIPA 1VH7A 1XLBA 1TR1A 2ZWZA 5IRPA 1HT6A 4NUWA 3CYJA 3MY9A 3QLLA 1M7JA 3SN0A 3S6OA 1OX4A 2YBUA 5DCEA 4UR7A 3HZ3A 1F3EA 3DFNA 2WZMA 3BLPX 1UPMB 2VC5A 3T1GA 3WO8A 2OLSA 3MUXA 4I9MA 1XICA 4AIEA 1KCLA 4D6EA 3K8MA 2ZADA 3ZJ7A 1OCQA 1N7KA 2E40A 4ZB0A 2J79A 3W7DA 1TMQA 3L4YA 2ZOXA 1E0TA 1O4UA 4GABA 2G97A 1BSIA 2ZXDA 1KRAC 3GS6A 4YTUA 2CLMA 1UD5A 1MW3A 1YYAA 4FIQA 2P3ZA 1BGAA 3A9BA 4PSPA 1RXOB 3QPEA 6TIMA 1K70A 3W87A 2E5BA 4C1LA 4ERIA 2P5NA 4Y90A 1D7KA 8A3HA 1IYXA 1B3YA 1SR9A 4J35A 4RNFA 1LORA 4PR4A 3WUGA 1NY1A 3MP5A 1GT8A 4JIRA 3GK0A 4MZ1A 1YNQA 4GX9A 3WBYA 2IPFA 5GJPA 2R24A 1GHSA 1NAL1 1ZCOA 3S1XA 1TV4A 3MA8A 3KVMA 3S42A 4E3TA 5LNRA 3IRDA 3CZEA 3I7RA 1EJUC 3KRZA 2Y5JA 1H7WA 2QJHA 2YJQA 4E8GA 1OG0A 2NW0A 2VQUA 2HS8A 4IMFA 4FPSA 3SRKA 2ZUVA 4GGBA 2J7EA 2NLIA 4GXWA 3BARA 2DORA 4JQ3A 2W79A 3UETA 2C19A 1FXPA 3BV4A 1TPDA 3KRBA 4UMAA 2HZGA 2OU4A 1LBMA 2Y8KA 2BGQA 1KRCC 4IX0A 3B05A 2O7SA 4LYQA 1BGGA 1GTEA 4XSLA 4BF9A 2PURA 2PGRA 2OGJA 5A6KA 1E73M 1M7PA 2Q3RA 3QW4B 4Q8WA 2WVVB 4QITA 3S2LA 4IIBA 4JTHA 2BVWA 4AYSA 3URAA 3RCYA 3OGVA 3HPSA 3CWOX 3I68A 2VJXA 4ZENA 3T7VA 5I24A 2Y70A 4Z2JA 3AS2A 5AVNA 4WDXA 4GXPA 1HFBA 3AHTA 4DN1A 3BURA 1R2SA 2ZXQA 3OBKA 4PUNA 2FH6A 1OIFA 3GFYA 4P7RA 4AUBA 1EQCA 3ABXA 1M03A 2QDHA 4H19A 4ZR8A 2GDUA 4Z2HA 4MAVA 3NGJA 1SZFA 1EZWA 2PC8A 3SCSA 1XGDA 2IQ0A 3WLKX 1V6WA 2PPGA 4KCWA 2HCVA 4RX0A 5EBAA 4J3WA 3G1XA 1F5ZA 2FQIA 1OBAA 2WC7A 4TVCA 4QX4A 4FLQA 2W92A 4PMXA 2PDGA 3B03A 2J7BA 1OF6A 1UP0A 3LM7A 4XD5A 4ATDA 2A3EA 3BUVA 3GH5A 3W25A 1OYAA 3DFSA 1TE6A 1VFHA 3RRXA 3H26A 1G94A 4XZHA 1JF5A 1UWIA 2BS9A 4QJ4B 4ZZ9A 2AL1A 3HQNA 3MKKA 2WZEA 2PLMA 1OX4B 4AXNA 1B54A 5C54A 5A6BD 2O56A 1GG0A 3L7RA 1R86A 4M7TA 3WLJA 2ACUA 4Z1DA 1GOIA 4AAJA 3W6MA 4JKKA 3B3DA 4Q4SA 3TZFA 3S6DA 4NZCA 3GDMA 3EX4A 4NY2A 1QTWA 3F5JA 2PRMA 4WRHA 4MOZA 2QUUA 1W0MA 4PRRA 1JD9A 3UR2A 3V35A 1Q6GA 4PMOA 2DVUA 4EAYA 3R10A 4ZQPA 4EF9A 5AYXA 4O17A 5FOOA 4ZXOA 4DJDC 1P6CA 1ZZMA 1UUMA 2V9DA 3IUIA 1TJ1A 3W86A 1J10A 4GOAA 4XZWA 1L8PA 4FA3A 1KXVA 2D2OA 4FI4A 2G3MA 4Y8FA 2G0WA 5L9FA 3TXVA 1ENUA 3EB2A 4S3CA 4KETA 4PZVA 2HEJA 3GFXA 2J62A 2NX9A 3NVTA 3K13A 1TRDA 1EFZA 3WH7A 4IP5A 5D2XA 1IT8A 4RK8A 3T0BA 3F2BA 5BWAA 3AXKA 3ARXA 3RO6A 4K7YA 1PXGA 1FWHC 3W07A 4ML9A 1TVLA 1YRRA 4QBXA 4RXFA 5HK4A 6REQA 5I3FA 1SSGA 5CSSA 3STFA 3B8UA 3P74A 2DIEA 4CN6A 3NUKA 3L23A 4TO8A 3FJ6A 3SUTA 2DSKA 2NQ9A 2FGBA 1BD0A 4PBFA 1WQ5A 4M19A 3W1UA 3EAUA 2FZBA 1I4NA 1E43A 3NZPA 5I6SA 4JTTA 1JI2A 2V5JA 2I5QA 2ZBTA 3ITXA 2ZDSA 1X6UA 7ENLA 1JUBA 2V2DA 3D0CA 1IXOA 3POHA 4DF2A 4C6LA 2VL4A 2ZZ5A 2DW6A 1NDWA 4UNLA 3S9IA 4PMUA 3GTXA 2BHYA 2PWEA 1MEWA 4A05A 2V6AA 4KWOA 1N8WA 1XINA 3NXFA 2OCZA 4MWAC 1TO3A 3T55A 5KSWA 1WPCA 3AALA 3BLEA 3TH6A 4B9YA 1GTHA 1I60A 1XBVA 4CEUC 2VT0A 4UTTA 3TJXA 5BOFA 4YTRA 2QNEA 2J27A 1KFKA 3M0VA 1XPYA 3SRFA 1YXYA 4H83A 3P81A 1JYXA 4DBWA 1M7XA 2B7QA 2PD9A 2YZRA 4YCOA 1RY0A 1GOQA 3PUEA 1JCMP 2VC7A 4Z08A 3OLDA 2HJPA 3N6HA 3UZJA 5GPRA 3TVAA 3M0HA 1OGSA 2BODX 3RM8A 1LG2A 2H8ZA 3RN6A 1A5BA 1KKRA 3VOIA 5I3IA 2GUBA 4LC8A 1QDSA 3FDGA 4PL1A 2VFEA 2FYMA 3PPHA 2VURA 3NURA 3NL6A 1UD4A 3B4YA 1WDSA 4KRZA 2Q01A 1H62A 3GD6A 5HMEA 4WXZA 3LXBA 4XWUA 5A5WA 4KESA 4EK7A 1U83A 5LIUX 4YTSA 5I79A 5AHLA 3WLQA 3SY5A 1GVIA 3LTYA 3MWAA 3D46A 3W2MA 4UOZA 5T9BG 3O06A 2RDUA 5KMYA 2IKHA 1FHDA 3T0CA 3VGBA 5E0KA 1FQ0A 4FALA 5BCAA 5K4XA 4XKMA 3VD5A 4WKAA 4OOUA 1Y65A 4R5EA 4YYFA 3KUMA 3MPGA 1B3OA 3L5MA 1DP0A 4IGHA 4P7NA 2WWCA 4EPBC 3VNKA 2PAJA 4R85A 3VGDA 5A2CA 1TV2A 5CBBA 2E77A 1YNPA 3NXLA 4HOZA 1YDYA 1PTAA 1VC4A 2GJRA 2QMKA 3BMWA 3O6AA 1L6WA 3CAKA 4JNZA 1V6UA 3L66A 3WQ5A 1LRTA 3SN4A 4LVGA 4DWSA 1AQMA 4XUGA 5CC7A 2B7OA 1FTXA 4CU7A 4JQ1A 3MV11 4JX5A 4GYFA 2VCCA 3D5HA 2VGBA 3EWZA 1HF6A 1W3LA 1O66A 4DYJA 3UWQA 6REQB 3MO7A 3HU7A 2OSWA 5K9XA 1BG4A 3GIPA 3HBLA 2A6LA 3M46A 3AIWA 1G4SA 3AHXA 1GONA 2DGAA 3U6WA 4CKQA 4E2OA 2I7GA 3TV8A 4CD7A 3PN8A 1TIMA 4DO6A 3EWXA 4NXKA 5AHMA 5E09A 2IKGA 2R1MA 3TW9A 1W1TA 3QHMA 3LMZA 1PO9A 2P0OA 4HJWA 4JYFA 4XKYA 5REQA 3B8IA 5D9OA 5CSYA 3DYPA 1F3WA 1L2QA 3UEQA 3GIYA 2TYSA 2WJDA 2OJPA 1SGJA 1EEXA 1WDQA 4CQCA 4LCSA 4M6UA 1REQA 4Q4MA 4EVZA 1FH9A 4PTMA 2PGEA 3WQVA 1E51A 1UD2A 1S5TA 4NJHA 5HJXA 3W1QA 2WSPA 4V28A 3UESA 1ZQ5A 2P8BA 3ITOA 3NL3A 1KM4A 4LUJA 3IJLA 3COTA 3LCLA 2PRLA 2ZICA 4TVDA 4BI7A 3Q2DA 4AVFA 4KS0A 1Z3NA 1TYGA 4JIEA 2GGIA 4D9PA 3N2OA 1S2CA 4RJEA 3LSCA 4K36A 2EPNA 3HQOA 1X8CA 2IXUA 4W8BA 1GOXA 1D3CA 4HT3A 5D2WA 5F2MA 2D24A 1JULA 3LPGA 3N3TA 3DOPA 5CPSA 1WNOA 4O19A 1XD1A 3RMEA 3SGZA 3O0KA 3GVVA 1XLCA 2NQHA 4J3SA 2CW6A 3RILA 1EJSC 1KTCA 5EMKA 2Y2WA 4L9YA 1XIIA 2YW4A 4AZ6A 3GDLA 3PF3A 4REQA 4B3ZA 3CXOA 3GXIA 2CLEA 5GNXA 3VKAA 3MHUA 3QMSA 2DT0A 2OWCA 3GUWA 4JBRA 3W7JA 3QGAC 2PLKA 3KLKA 1CPUA 3DFYA 1W3TA 3I65A 1SO6A 3W1NA 4GHRA 2R1NA 4JFVA 3GW3A 4DJEA 1PTDA 3ABZA 4LVBA 2IPGA 3OZOA 4KQNA 1E3XA 3WMLA 4I6VA 4KGJA 4PUKA 3WFLA 1AZ1A 4HCDA 3NQBA 1L6FA 1ISWA 3ZJ8A 3TJLA 1KW1A 3RM9A 5F4WA 3VDBA 2PU0A 3H24A 4FB7A 4HMDA 5HANA 2BZNA 1FP9A 2OO6A 1W37A 2C0HA 4ZB5A 4D8AA 4TTGA 5FEWA 1XLLA 5ABTA 1DTUA 4O0QA 4CD8A 4JEQA 4EPDC 4DWSB 1LRNA 3HPFA 1HJSA 3EB4A 3KBJA 2EAWA 4X0VA 3H4WA 1KV8A 3C52A 2D22A 3S5SA 3V5FA 4H6RA 2JIWA 5E5CA 3WD3A 4C7FA 2G3IA 3NA8A 3M5ZA 1KA9F 3FXYA 3MI2A 1ZAHA 1JQVA 4LH8A 4DBEA 4HP5A 3UG4A 1SJDA 4O0KA 2PDKA 2EKCA 4BKNA 3SRDA 3PZOA 3OP2A 5A69A 3QSTA 1TTQA 1RA0A 1XCFA 2UY2A 1JPIA 4K39A 4V15A 4DX3A 1L8NA 1JZ5A 4O1AA 2YFNA 3ZQ9A 3TC3A 4GMEA 3NO1A 2CKRA 1QBAA 5REQB 3M0YA 3W7OA 2ZYFA 1XQKA 3BW3A 1Z42A 4F79A 5E1QA 1H3GA 3P62A 1H0GA 3W7RA 4IL2A 3WMSA 4B5VA 2E9MA 3WF1A 2DSWA 2NVCA 3UXLA 3VUPA 5LIYX 1JZ3A 3VD4A 2DZBA 5AECA 2XIQA 3H54A 2Z25A 2HS6A 2B31A 5G4WA 1R3RA 5HPOA 3QRHA 4QGCA 2BLEA 2I16A 3NZQA 1EC7A 3AS3A 3VIJA 3WBWA 4GZJA 5AC6A 1RP9A 4MPKA 2O92A 3BCDA 4H9MA 3ZVIA 2V5CA 2EG6A 1KBIA 3BSGA 3FSTA 3BSMA 5FF4A 4NVTA 3GXFA 2ONEA 4I8YA 3TYEA 1RBAA 2OSYA 4TMCA 1PHWA 2OXNA 3VDAA 1OC5A 3MT1A 3CV1A 3NPWA 1Z7AA 2NV1A 4JIQA 4IIHA 3NQ8A 1JUEA 1H4PA 2J8GA 4X61A 5AVHA 3CO8A 2YLLA 4W9TA 1V08A 4F66A 4BCEA 1YIXA 3N4EA 3VIPA 4ONVA 4JX6A 1DV7A 2P3EA 3N9KA 1ITUA 4L9XA 2ZVIA 4FNTA 4QJ3B 4RDZA 3BICA 3H7VA 4JX4A 1Q7ZA 4QG6A 4HN8A 1S2TA 3TWAA 3E12A 1US3A 1ONXA 1U5VA 3CWHA 4G7EA 1W3IA 3R58A 1V8EA 2JEQA 4W88A 1ECEA 1IEIA 1BSLA 1OFOA 2YIHA 6XIAA 3E5PA 2VO5A 2GDVA 1W56A 4Q4PA 4QNEA 5C55A 1JYVA 2XGZA 1R7OA 2J6XA 5C71A 3RNDA 4V1XA 2VNCA 5GQBA 1JR1A 4F0HA 4GJIA 3RLUA 5GVJA 3THDA 1D8WA 2MNRA 2GQ9A 4DELA 1UOZA 2CXGA 1S38A 1XGEA 1UKQA 3WENA 2EBNA 1BQGA 3PG8A 1TWWA 4V2XA 1MZRA 4B15A 1B3VA 3RM4A 5BXPA 3VCCA 2DUZA 7TIMA 3RLVA 2CZ5A 1C93A 5F4XA 3OBAA 2NQ5A 3ZIZA 2GYIA 1R2RA 2BMBA 5SWUA 3OHMB 5ECVA 3FVDA 2AGTA 3CIVA 3FCPA 2FIQA 4DY1A 2WVUA 3EMQA 3O8AA 4JY9A 1XYMA 4TVUA 6ENLA 2DUAA 4S39A 3W81A 1PX3A 1TPUA 3B8SA 1V6XA 4DPQA 4QCFA 1E9YB 4C65A 4QJ1A 4WK9A 2QULA 4JFTA 4DJDA 3UA4A 1GK8A 1F61A 1KV5A 4AY7A 1FXQA 1VP5A 1KGWA 3UW6A 2F7FA 3EWUA 3LBMA 4NJGA 3E0FA 5JH1A 4AD0A 3SFWA 1NVMA 2WSQA 3U4AA 3LNPA 4CUCA 4ZQCA 4DLFA 4IT1A 1MW2A 1UWQA 3PBWA 1I2NA 5JQ9A 3QM3A 1XPGA 1YDOA 1H1ZA 2XPKA 5DN1A 1E0VA 5A6JA 2QJNA 2J8TA 3C0SA 2V82A 4IP4A 2E1WA 1PIFA 4W4QA 2EO7A 4HA3A 3MCMA 3A12A 3RIKA 3E02A 4V27A 3MHGA 5CGMA 4LUIA 4PB4A 3WEZA 4FF7A 4HA4A 2ZIDA 2WHJA 1A47A 3EDEA 3VD3A 3MUY1 3WELA 1RQBA 5C9WA 1LJYA 1ZP3A 1LOSA 4GJJA 1E40A 3LUTA 1SSDA 4KW2A 4I9JA 2VC6A 2Q8LA 2HXTA 3HPAA 4PCPA 4CLMA 1JCLA 4X2PA 2IW0A 2YXGA 3PR2A 4V33A 5FL1A 4YTTA 3RCMA 1KB3A 3VTRA 4JTEA 1GJUA 1UROA 4IF2A 4TIMA 1J12A 3KL0A 4QFUA 4MLRA 4S3AA 4MNMA 4S23A 4LVFA 3LA4A 4D1JA 4HN4A 3CV6A 3BLKA 3EYPA 1EP3A 4N9CA 2CETA 1BWKA 2FTPA 3MW7A 3W6YA 5T8GA 1H7XA 1B1YA 2C16A 4Z2KA 1OGBA 2NQZA 4UR8A 2YDAA 3ISIX 1IR2A 2YA2A 4TUFA 4MWAA 2ABAA 3MO4A 2ZRXA 3RX2A 2O0TA 3OBEA 3ZOAA 1MFVA 4M5PA 3GB6A 4C7GA 5LA1A 2X7VA 1BYCA 2XUCA 4E4PA 3TW6A 1G4PA 4K2SA 2FHBA 2PE4A 1F73A 4UMCA 3QH2A 1W1IE 1RY8A 4JTQA 1Q3NA 3M4HA 5GJNA 3MV01 4E38A 2KZHA 2J6VA 4RW3A 3BTNA 5LXXA 4DUWA 1XH1A 2W3ZA 1B4EA 2YW3A 2G96A 2RAGA 3W84A 5CLTA 2ACQA 4M0XA 1LUCA 2R94A 4HOWA 3W7IA 1TV8A 4DZIA 1QK2A 1QBBA 3RJYA 1R46A 2YL5A 5EPDA 2PD5A 3H2AA 2FVLA 5IOBA 4XB3A 3ABSA 5EL1A 4WJXA 4WSHA 2XIIA 2ZRVA 1PKNA 1TSIA 4PFHA 4NNBA 2V8ZA 3ABQA 1B2YA 3GXPA 1NWUA 1OWQA 3LSBA 3NSNA 3G8EA 1A5MC 4Z2IA 1XFBA 1CGWA 4PMRA 2YL6A 5C9RA 4H1ZA 4OZOA 1OX5A 2WSKA 1XCXA 2Y4SA 3VZZA 3R89A 4DJFD 3NDOA 3OO2A 4FOUA 4OBTA 1G5AA 4WD0A 1W8SA 3MVTA 1MW0A 3UG5A 4CQDA 1TKKA 4CU8A 1CLKA 2XIOA 3NOYA 4J2PA 2BX7A 4QG9A 4WJEA 4P5UA 3T81A 2D2HA 3N2BA 4K8EA 1ISVA 3AJXA 1ITXA 4UTHA 3H7RA 1CZ1A 4FIRA 2PDYA 1W31A 2WM0A 1GW1A 2F2HA 3UZZA 2DY3A 3WN6A 3M0ZA 1I45A 3K4DA 4OKDA 4OJYA 2J25A 4UQBA 1BVNP 2OYLA 5LIKX 1W5MA 1R3WA 1TWZA 2Q02A 4JQ4A 5LXEA 3CHCA 5EBUA 3VIFA 2CLHA 3IV3A 2J7GA 2XSAA 3MBDA 4DRSA 3HGOA 2Z7KA 3B8DA 4D8LA 3FGCA 4U5IA 1Z9AA 3W29A 1VJSA 3CEPA 1OX6A 3GDBA 2J13A 4D1IA 2PFHA 2VOTA 1F8MA 5IFTA 1P1MA 4O57A 1UWSA 4NL1A 2E8ZA 4H6EA 3WD0A 3QMTA 3IK2A 2BOFX 4O1EA 1OFRA 3I3EA 1KD0A 3M47A 3R0DA 4CCZA 5E70A 2I1OA 1W54A 3HF3A 3BZGA 1R0MA 1YDVA 1JNEA 1PE1A 4UTLA 4LVDA 4LALA 2ZQ0A 3W71A 4F0SA 1EGZA 1X1NA 1X38A 1H09A 1IGWA 2RUSA 1BFNA 5ABGA 4R34A 3WQWA 2EG8A 4K7VA 3UWVA 4PA8A 1CGXA 1FCQA 4ICMA 4IMEA 2XJ7A 1EYEA 3AYSA 4FNRA 2G4FA 5A95A 4JN8A 3W22A 3LG3A 1FCVA 3APYA 1C7TA 4O4VA 3O07A 1FWEC 4N42A 1E1EA 1UR8A 5IFPA 1GORA 1K8ZA 4ZQOA 1EIXA 1ZBCA 2PDLA 4K8HA 1KO0A 3FHAA 2OQLA 1T99A 1WXJA 4PUMA 3S5ZA 4E8CA 3B06A 3T0TA 3TE9A 1RD5A 3KBWA 4XD6A 3WKZA 2PBGA 3UWWA 2HWGA 3UVIA 2EPHA 1E9ZB 1LCOA 1FCUA 5LHEA 4O14A 3LCIA 3ERPA 3WK2A 3A6OA 1JUKA 1GZJA 3G1VA 1NDYA 4DZ5A 3DFQA 4XAPA 4YPJA 2WMIA 1QW7A 3LZ5A 5XINA 1XLIA 3M16A 1KTBA 3OG2A 4YIWA 3P82A 4LCQA 4MLJA 1V77A 3DHUA 3RLGA 3PJXA 3CQ0A 5D8ZA 1AD4A 1CNVA 2INEA 5ABFA 3WIJA 5HJYA 4R27A 2WC4A 4QNWA 4ZTXA 1ADOA 3REQA 1SJAA 4CU6A 3EA3A 3AYVA 2QVNA 1FHUA 3ABOA 3QJAA 5HNTA 4UTIA 1N8IA 1CYGA 3TMQA 4E2BA 1KC7A 3ONCA 1RR2A 2DVXA 3AIVA 1Q6DA 1G69A 4Y9NA 5HOSA 2A6NA 4DHGA 1UB3A 3DFHA 4JTFA 2EPMX 4O8RA 2BVTA 4D6IA 1BF2A 2UBPC 3FGCB 3E49A 1OFEA 2QCLA 2J24A 4Q7NA 2GK1A 2ZZ4A 4ZO8A 3EKLA 4ZE5A 1XL9A 1SO4A 5DRCA 4M1RA 2VKZG 4X2RA 3GYEA 1IXQA 2FB2A 4OHQA 2POZA 4NKCA 3M7SA 5DF0A 1EO5A 3QV9A 4DI8A 2TPSA 2D3LA 1FDZA 3KLLA 1PYMA 3ZJKA 4RE3A 3QW3A 2WW5A 2V81A 4GGHA 2VYOA 3P93A 2Q6ZA 3VNDA 1VS1A 1E6QM 1C3FA 1A0DA 1E70M 2V5DA 2Y63A 3O6DA 2GZXA 3WH6A 1QCWA 4LY4A 7PTDA 4DUOA 2CXEA 3PBVA 1T8XA 2PDIA 2ZZ1A 1FWJC 3N2MA 4ZEPA 3L0KA 4DYEA 3W2KA 1T96A 3DENA 3EEZA 1XG3A 2ZZ2A 4DO4A 1EP1A 3THAA 1LG1A 1MXDA 1CECA 4Y8EA 2C1IA 3P8IA 1NOWA 3WFAA 1RA5A 1S39A 4I9TA 2XIJA 1CXHA 3MSRA 5PTDA 1OVDA 2Z2UA 3H4XA 1OF8A 1W5NA 4MNLA 1PB0A 1PZ0A 1OCNA 5H8UA 5BYWA 3GU2A 2E6AA 3C56A 3FJ4A 2X0HA 1XH0A 5DEZA 1QAPA 1KM1A 2I56A 5I03A 1WDPA 1O5KA 1RBLA 4ASTA 5FJJA 3UZ5A 1TV7A 3WBXA 5CBIA 2JF7A 1XRVA 2OQHA 4GVFA 2DH3A 1K9TA 4P8UA 3RCNA 3FFSA 2FHCA 3ITVA 2J88A 1AL8A 2XH2A 3BG9A 3QQWA 5FJIA 4AD2A 4A2SA 4OTKA 4NILA 1HZYA 1BYDA 4KERA 3TKFA 4QDPA 3GLCA 4F0RA 3CJPA 1SVDA 3Q45A 1XC6A 3QSRA 3M0IA 4C6JA 2FZDA 3GVGA 4KH2A 3S4TA 4AMCA 1JJKA 4RXGA 1TPC1 4G7FA 4A3UA 1EF3A 4JTLA 3ARRA 4BQ3A 1WP6A 4HYRA 3TROA 5ABFB 3AU6A 3JVAA 4LF2A 1PKYA 4GUFA 3ATYA 3RK8A 1KXQA 3OW1A 3REQB 2H90A 5CZSA 1TPB1 2VUNA 3SBFA 4ATWA 1QW9A 1P0DA 1RALA 2WZIA 2FPYA 3QVQA 4HPJA 1WOBA 2JBMA 1KFEA 3TC7A 1P7TA 3VC6A 1S3TC 5A6TC 4CNSA 4W8LA 1QJWA 2OG9A 3KVJA 2J7HA 1YMYA 3CUXA 2I57A 4HCLA 3BK0A 3AS0A 3BG3A 1OM0A 3W28A 4NRRA 3VC5A 4L1XA 1CWYA 3DHDA 3GG7A 2PTWA 1H7OA 4TXEA 2QAPA 3W7QA 1EC9A 1S46A 1QXLA 4MB3A 2A3LA 4BEQA 4QTGA 1GOOA 2GK1B 2PWGA 2G5WA 5FSDC 3DI1A 1ZCCA 3HMCA 4KWVA 1IV8A 1R3QA 1ECQA 3CT2A 2ODOA 3WF0A 1EF2A 3MKVA 4A8NA 1I0DA 2VD8A 4XBKA 3PNZA 2PBOA 4C6EA 3FLUA 1UG6A 3ZWSA 4AWSA 4H9YA 3JR2A 4ORMA 1QHPA 3II1A 3BANA 3CZKA 3MVIA 1G67A 3JS3A 2VFFA 3TYDA 3OODA 1H0IA 1O1ZA 3STEA 4X0NA 1C90A 1A53A 3B8VA 1K6AA 3LS9A 3NQ7A 4TMBA 1BG9A 4J2MA 1UWUA 1ZJHA 3SUVA 1ME9A 1MZHA 3K1DA 1X96A 1SM9A 2C6QA 4R9XA 2FKPA 3NL2A 3S1UA 1FDJA 3FAWA 4JTUA 4YTQA 3LHTA 2OWWA 5A94A 3LM3A 1ISZA 4E4UA 1MUMA 4GX8A 4US6A 4CEXC 4GRSA 2QDGA 5HNNA 1MQRA 1KCZA 4Q8UA 3U2CA 4ZXLA 2YR1A 6TAAA 1IF2A 3BWWA 1RQHA 2ATMA 3O05A 3C2YA 1EC8A 5GNZA 1CB2A 1YQ2A 3UYIA 1GCYA 3LQLA 3W85A 4ACYA 2ICSA 5LGXA 3CZ8A 4M81A 2GUUA 3WUBA 4MG4A 1RZMA 2VGFA 3ZXWA 4OU1A 1KFJA 2VZOA 4HQVA 2QJGA 1J0YA 1TCMA 1Q6FA 1E1CA 2VR5A 2NT1A 1E6PA 1UD8A 2VFGA 4JGDA 1RJPA 9RUBA 3UBPC 1W2VA 4CQBA 3ABRA 3GAYA 1UKOA 5BOEA 2XTKA 5HUOA 3I6TA 4YN5A 1R47A 4G56A 4Z2GA 2NQLA 3R13A 4WHBA 3WK3A 3PAJA 4MUZA 3RJXA 1H61A 1TVPA 3ICJA 4BWLC 2QMJA 3BGJA 2G4JA 1LM1A 3GZAA 4DNHA 3BCJA 1Q45A 3Q65A 4BS0A 1T0OA 4B5XA 2GSEA 5AYIA 1JDEA 3GTHA 5DQPA 5AYBA 1A3XA 2VCBA 1JDAA 1QWGA 2ACSA 2UV8G 4WCJA 1ZBWA 1XLAA 1RAKA 1G6CA 1XLHA 1J6OA 9XIAA 4B5SA 1QOXA 2ISSA 2D0GA 1VBJA 3N29A 2QLYA 4AHOA 1XSJA 1D9EA 2GPTA 4KEVA 5FJPA 2R1PA 3KTCA 2FMNA 1EHNA 3HA1A 1QNVA 1UWAA 3D3FA 1IEVA 4S2BA 7ODCA 1CCWB 2W91A 4MKSA 3NQ6A 1DJGA 5G5IA 4J28A 3WQEA 5CXPA 2EGZA 2BP1A 4AQLA 1EX1A 2ZC1A 3PFMA 5TD4A 4KCTA 4LCRA 3QMRA 3DHFA 4G1KA 2OKTA 1YPFA 4XO7A 4RZ6A 1AD1A 1QI0A 4HPHA 2NXHA 2PDFA 2X42A 1SZRA 2ZX7A 5C2XA 3G5EA 3NQGA 4ZOEA 3FHQA 5TQLA 3WQGA 3ARWA 1OT2A 2CPUA 3BAKA 4JTSA 3NYZA 1EB3A 1UUOA 2B7NA 1NWRA 3UY8A 4CN1A 4LAKA 3WBAA 3EX2A 3STCA 3EPNA 1L2UA 4OV4A 4U2YA 4XD4A 1NF7A 4RE0A 2O9TA 1UYQA 3KP1A 4XAZA 2PP1A 2QGYA 1JCYA 2WANA 2YCIX 2YBTA 4JDBA 3ARSA 4JL1A 4N6FA 3IWPA 4PUEA 5LGZA 4U28A 3F5LA 2GGJA 3LHWA 5D9PA 3TJIA 4QLJA 2NX3A 3M9YA 1UBSA 4NZ1A 4HYVA 3GR8A 2QCGA 3W6LA 1VZWA 2VRQA 5FESA 3PFRA 4LVAA 1QUMA 1FBAA 1HKKA 4AC7C 4FXSA 3SECA 3VOFA 1PX8A 2PDQA 5FCZA 4I5XA 5G2HA 2DJLA 2QHAA 4IOTA 4WDTA 2CU0A 4GK8A 1F4HA 2NUXA 3MSGA 2Z27A 2HVOA 4QCEA 5AKQA 3RF9A 1AQHA 2BY0A 1A5UA 1VENA 3SCNA 3CS2A 2ZTKA 2GJXA 1V0KA 4PCSA 1MWOA 4GD0A 4NJKA 3N9SA 1HXJA 3CUZA 5KEZA 4UFIA 2UY5A 4DUVA 4IP7A 5FJRA 1ZGDA 2CLLA 3W23A 4LRTA 1TTIA 1E5NA 1HGWA 1I0BA 3I6EA 4RPPA 1UOKA 2YB1A 3W7MA 3RITA 4HZ7A 1E72M 5LIWX 1UPPA 4AISA 4M6PA 1SYTA 1OD8A 4BK9A 5BWFA 1W1VA 2XYLA 3EOEA 5FF7A 1JAKA 3BLLA 4NX5A 2CFFA 2V3DA 4AD1A 3W75A 3IIZA 3S1GA 1E1CB 2XH4A 1EXBA 1A4LA 4NZFA 3TTYA 4TX8A 5HWJA 1XIMA 5KZEA 3W2UA 4P8WA 2VX7A 4C6BA 4EIVA 3QZ6A 3NAVA 4W7UA 1XF0A 2HXUA 1RQEA 1SZEA 4EXQA 1OFDA 2J75A 2GGHA 2NSOA 7TAAA 3LPPA 1VFOA 4FLSA 3LPFA 3TX9A 3A22A 4PN2A 2NLYA 1V02E 3EXRA 2XZ7A 5D4YA 1Z32X 4FNQA 2GQ8A 3CZLA 3WLHA 3DDMA 1GYNA 4NJIA 4PTDA 4LB4A 2NSXA 1TJ2A 1TQXA 3FEQA 5BRBA 1WUFA 3GBEA 1W6TA 3MBFA 2Z28A 3GC4A 1KM3A 4ZMGA 1JZ4A 3BCFA 3WBEA 5EMYA 2OOFA 1SJBA 3UT0A 2RGMA 2G95A 1KBJA 3USZA 2QIWA 2VI0A 3W1PA 4OFCA 1ZSXA 4RL3A 3F4DA 4J7RA 1XCWA 5I00A 1WBJA 3SM0A 3WNNA 4ZSUA 4HNOA 3B8TA 3PTMA 3ENLA 4C6QA 5ABEA 5HQMA 3PBGA 2PWHA 4W7WA 3F7JA 4ES4A 3QYQA 3M64A 1XSKA 1US2A 1H7NA 4PH6A 3ZR4A 3ARUA 4GNJA 5K7JA 1JCNA 2WPGA 4UWMA 2ZDRA 1XM3A 2VWSA 3O6YX 4UQ9A 4U31A 3GXNA 1Q85A 4NX0A 4PRWA 3AXIA 3L21A 2V2HA 2BDQA 4DJDD 2YCLA 7REQA 3VI2A 1U5JA 1R85A 2OLAA 2Z1VA 4OBRA 5JIPA 1MMFA 4IICA 1IEXA 3QY7A 5A3HA 4OECA 5HUPA 2J7FA 1UZDA 4R9OA 2ZA3A 2O4QA 1XQLA 3PWIA 4IQLA 4HTBA 1ZPTA 3C3NA 5BOOA 1LL7A 1F74A 3IJQA 3EDJA 4QEHA 4Q8TA 1NTHA 5DBUA 2QCMA 2OFJA 5G4HC 1TQJA 3WJSA 5LNWA 3CPGA 4A3HA 5FL0A 2YXOA 3A3WA 1VFUA 1GZ1A 2FZ9A 4RPQA 1BXCA 3CAWA 4C60A 4BQ5A 2VHLA 3LDVA 5JMUA 4KWUA 5I3KA 1TZ9A 2AQWA 4O12A 2J9ZA 3UG3A 3VIHA 3AXMA 4K8GA 2WYSA 5G4EA 4J5NA 4UR9A 3GYCA 1FOBA 2VVSA 3O15A 5I5RA 3DFPA 4WX2A 3TYAA 3XIMA 4H8HA 1U2YA 4GYJA 1GVEA 1JL8A 3LERA 2B0MA 3U2EA 4M56A 1EO7A 4BJHA 3GVRA 3G22A 1CXKA 5AYYA 3GNOA 3THCA 4GQ0A 3M44A 3TWBA 3OOQA 3LLDA 3PANA 3PB0A 4MY9A 3DGRA 1R5YA 1U30A 1XUZA 4MDPA 1JRBA 1YE6A 3CIXA 1QNPA 5EU9A 3S1VA 5BRPA 3LGDA 1C8XA 5CJ5A 3NM3A 5D03A 3VNYA 2VZUA 1JZ6A 4LUTB 1UUQA 1I75A 3OVQA 2BWGA 3KRUA 2AKZA 2FH8A 4XQ6A 3H4GA 3PZGA 3DC8A 2Y7FA 3DESA 2PU1A 3IGHX 2EPOA 1AJ2A 4HMNA 1UR9A 1G7UA 7A3HA 2Q8XA 1KGUA 5AHFA 2VWTA 1WAUA 3R0UA 2CZVA 3CL6A 2XVLA 5CZJA 3AYTA 4PUJA 4X63A 1F7BA 4ZODA 1YPXA 1J0ZA 3EEGA 3J7HA 3UJSA 1JXKA 2A4AA 5BXSA 2POTA 5LSMA 2GVYA 3TYZA 3W74A 1SW0A 4WGXA 5C7HA 1KFCA 4NZJA 1NJJA 4AEEA 1F4AA 3ZZ1A 5RUBA 4R88A 3CM4A 1AMKA 3M0KA 4R3UA 5HDRA 2DFAA 5F2GA 4PMYA 1GWJA 1C8VA 3PS7A 2RFGA 3H12A 2XU2A 1ZAJA 1ZALA 4JNMA 4O13A 3EGJA 1K8CA 1HKIA 1DYSA 3K4WA 2WKLA 2PWFA 2VCAA 1LYXA 3HM7A 2WVSA 1HKWA 3R12A 3BH4A 3L4UA 4JL2A 4QM1A 4LBSA 1DHKA 4JAWA 4I7UA 2YCLB 4XZBA 2GSJA 7REQB 2W4XA 3U5UA 1ZFJA 2OYMA 4IMCA 1E4IA 2PSNA 4UQAA 1MUCA 4FX6M 5H1WA 2O9OA 1DJQA 1RBOB 2W0UA 4M24A 4PSRA 1QATA 3C2EA 3TNOA 2NVDA 1BRLA 1UQYA 2WCSA 5HMFA 4PULA 3AIRA 3E2SA 4W93A 3LCFA 5CKSA 4B5TA 2BHUA 1OYCA 4QP0A 3BOLA 2CBVA 5GNYA 1Z8AA 1WV2A 4AHPA 2DVTA 4L7ZA 5CPMA 4GIAA 4KIRA 4B3KA 3ARVA 3N13A 1PHQA 4FLRA 4UUIA 1K02A 1A5KC 1LQ2A 4JPGA 1T41A 1H11A 3GTNA 4DBUA 4L5ZA 3B9OA 1JXJA 5JIWA 4EOUA 2R6OA 5TAOA 2OB3A 1CGYA 4QLLA 2PDMA 1HNYA 2C1GA 4PMJA 4B4FA 1N8FA 2VTFA 1GKPA 4NSBA 2OMAA 3IGUA 2IPJA 3L5LA 3NQ2A 5AC7A 3CL7A 4MVAA 5DMLA 5H6HA 1M6JA 1W8GA 3W7HA 1POJA 3NO5A 4HA1A 4B2DA 3EA1A 4F2UA 3UXDA 1M9HA 1KM6A 4GIYA 3LNMA 4NQ1A 4TX9A 4X9SA 4MM1A 4DZHA 4ZL1A 4B5NA 3WL1A 2DUXA 1F3TA 2V5BA 2YSWA 3PPGA 1VBUA 2NZLA 1JG9A 3GR4A 3WNPA 1AW2A 3URNA 3SJ3A 2Z1XA 3FAXA 1TZZA 4QDWA 3LY0A 4LEQA 1EUNA 1ME8A 3DBNA 1DWAM 1TE1A 1HVXA 1TJ0A 3TUUA 5T26A 2V38A 4K3ZA 3CUFA 1PBGA 1OY0A 1PL9A 5C9XA 3H2OA 3ECQA 3AMLA 4Z0SA 3W7KA 3T0DA 3VZYA 2A79A 3SCWA 1JPKA 1JNDA 4WXYA 2PTYA 1RCXB 3AI0A 4ZQRA 1KQZA 2CERA 4YHEA 3WD4A 3FA4A 2FFCA 4DAIA 4NRSA 2VMFA 7CGTA 3S1WA 4D6FA 2OR2A 1OABA 3BOFA 2VRKA 2FGZA 1XLEA 4MGGA 2NXIA 5C2GA 3P60A 4FNUA 2XN1A 3W82A 4G2DA 3WD1A 3WL0A 3OYZA 4JCLA 3PK7A 1DXFA 1AQFA 1QK0A 4RV8A 3VIIA 4E3VA 3QHOA 4S3JA 5F7UA 5F2LA 3E0LA 4GA8A 1UC4A 2V3EA 4FOJA 2OOGA 4ROPA 4QQ3A 2F6UA 5D33A 4CN4A 2VR2A 2V2CA 4IGNA 1SZGA 2QUTA 1EX5A 3W2JA 2QKFA 1HL9A 5E0FA 3WJZA 1J5SA 1XFCA 3F1QA 1UA3A 4RZ4A 1TV3A 1ESWA 4A8LA 2OSXA 3KOXA 1H51A 4GQQA 1QT1A 4YU1A 4MUPA 4DZAA 1J01A 3EZ4A 4I5UA 2PZNA 1HQTA 1YDNA 4PMZA 1JZ2A 3ELFA 4ENLA 4U33A 1DQUA 4GC4A 1X6NA 4AB4A 4NG3A 1SFTA 1TVNA 1BRLB 4J3XA 1E6ZA 1V3MA 3VO0A 2G3NA 3WG6A 4LUSA 4AMAA 1SW3A 1FWBC 4N9BA 1GHRA 3CUJA 1XKYA 3PUGA 3IVTA 1W1A1 3SY1A 3M7WA 4W84A 2WKJA 2XVPA 1WZAA 3MJMA 3ID7A 1VLWA 3P84A 2ZKMX 3QFWA 5H8MA 4GFSA 3QR3A 4LWWA 3E74A 3ATZA 4POCA 1I2RA 4GI8A 1NQ6A 4H7ZA 4HSOA 1QPQA 4K38A 5IXEA 4GUIA 4LS0A 1E3ZA 1CDGA 4HOXA 1JPDX 2V5LA 1TRIA 1LT8A 1HVQA 4OWGA 3SI9A 5D8WA 4PB3A 4NI3A 3M43A 4XIAA 3LN3A 1KXTA 4KEMA 3B8WA 1GUVA 4M7SA 4MJ4A 4BQ4A 4FS9A 1XLDA 3NPVA 2E8YA 4R7WA 4DPPA 2Z0IA 4HHMA 4I5RA 4ZQMA 3KDOA 3QR0A 4Q22A 2ZUUA 2HROA 5H91A 1KBBA 3M07A 5LNUA 3G3DA 1O60A 4MB1A 4KFNA 3NFUA 1VAHA 2RH9A 3AS1A 4AWUA 1DJNA 5TNVA 4IFKA 1NM9A 3BAJA 4M6VA 4QQUA 2P8CA 4XVEA 1H63A 2H3BA 4GNVA 1RH9A 1YADA 3JUGA 3NQAA 3TK7A 4JR5A 3I3BA 3JZEA 3CQIA 4JIHA 1Q6CA 1DTNA 4AZCA 2GWGA 4QDMA 4HZ6A 4AD4A 2VELA 2ZUWA 4IUGA 4UCFA 3PSWA 5A6BA 4LSBA 2NV2A 3IIXA 3NO3A 2F84A 3SAZA 3BLIA 3N9RA 3TNBA 5F1VA 3R94A 3D6NA 2Y8UA 4LNCA 2A3AA 3C0QA 4HCHA 3ZLGA 3MB9A 1QI3A 3RO8A 4L6DA 1LRQA 3PWGA 2I9EA 4Q4RA 4YYCA 3BXWA 3THUA 2RDTA 2F2KA 1DJYA 1GJPA 5JXQA 5LNSA 3UVAA 2A0NA 3ZJ6A 3NYDA 1HJXA 1R7AA 4PCNA 2VXNA 2E25A 2ISFA 3N6JA 1PWMA 2HE5A 1W9UA 5HMSA 4AD5A 3WH5A 1A49A 3WQPA 2Y0FA 4ZOCA 1WDWA 3B04A 1A5SA 2W5FA 4UTJA 3KCJA 3WF3A 4RV3A 4UFMA 1KCXA 3KWXA 3VDGA 4NI8A 4RZBA 3JU2A 1MXSA 5DMYA 3G0UA 4EXAA 4LUSB 2ISDA 3C2FA 1OQFA 3CTLA 4AWEA 2XM1A 3WLIA 2QS8A 1KLZA 4MIMA 3AFBA 4QROA 1ZL1A 1W3JA 1TPEA 3RPTA 1UWRA 3W73A 5DY2A 1F05A 1WYIA 2GVLA 4IJRA 2FMOA 3APGA 4H8UA 1C8QA 4ZB2A 3HJEA 6A3HA 4NZ3A 3QZEA 5EYWA 4J9JA 1ISYA 4JTDA 3VMNA 3DX5A 5CPNA 1JIBA 1AJ0A 3BAWA 2GWNA 5FEZA 4Q8VA 2A3BA 2WBKA 4A3QA 1FWGC 4MFDA 1M68A 8RUCA 2WZTA 3E0WA 3S9ZA 5I3JA 1FWIC 3OYXA 4HMEA 2ZUMA 3VXGA 3UGVA 1UP2A 1OG6A 4C6OA 4FNSA 3MP3A 5DCBA 3CUHA 2GJNA 2QCEA 3HTWA 5HQEA 4P8XA 1EWDA 3SCUA 3IEBA 4M6QA 2VP8A 1PYFA 1LF1A 2E9LA 4QHRA 4ERGA 3WLMA 1EL3A 3L2IA 5A2BA 2QR6A 4PBGA 5D04C 4JTRA 4TV6A 4F0KA 1J0IA 3TA9A 2AAMA 1HKMA 5A1AA 3CAQA 3VDCA 2KX9A 2WHLA 1EQPA 1GW9A 1Q66A 3BJTA 4Z42C 2A3CA 1EJ7L 4LS2A 3HJZA 3T44A 1V7AA 3SQLA 3QBUA 1FWRA 3OVRA 2ZZ6A 3R1ZA 4IFKB 1V93A 2J9XA 4KEUA 1LBFA 4OUEA 4H9XA 4F3HA 1TUFA 2PMQA 2X1SA 1E0UA 1ZBVA 5BU9A 1O1HA 3WY1A 3TA6A 2QUMA 4KEZA 1Q6EA 1HO4A 3C86A 5J5RA 1NFPA 4YXGA 3TEVA 4UQEA 1R8LA 4AZCB 3RPMA 3T8LA 4YJ5A 1GQNA 1B31A 2OPJA 3AXHA 3MZ2A 1IWAA 1H7RA 2W27A 3W27A 2OVLA 3IRSA 4DIAA 5JBDA 2WPBA 5A8NA 2C79A 3LOTA 3N18A 5LYRA 4LB3A 5CAKA 4L80A 2X05A 1S3HA 2PS2A 4EXBA 3EOSA 4B92A 1TELA 4HKPA 1B3ZA 1FWAC 3AMCA 4A21A 2QUNA 2DH2A 1W32A 2GSHA 4BY3A 4DJFC 2ZRUA 2WCAA 1YXCA 4KIEA 5CQ1A 1UR3M 1DJIA 3C8FA 1FWNA 4US5D 1S2UA 1LWHA 3CPRA 4C6MA 3VD9A 1P0BA 3WNKA 4URIA 3PJUA 1TA3B 3VA8A 4DI9A 3LHVA 3RRAA 2PLJA 4RNHA 4RW5A 2O7QA 4WVXA 1AQ0A 1IQ8A 3ANUA 1CBGA 3L0NA 3MKCA 4DXXA 3MDWA 4KRUA 4EP8C 4NP7A 3WF4A 2JKPA 1XLFA 3K8LA 3BL3A 5TF0A 2PODA 3WNOA 1E6SM 5D37A 4Q4KA 2REQA 2O9RA 1G9HA 2BXVA 5XIAA 3QQ0A 3CUIA 1XISA 2J7DA 4ZSTA 4YHGA 2PDCA 4GNKB 4PODA 2A7NA 4S3KA 4XSMA 3FNDA 1ISXA 3B9AA 1PIGA 1ZJAA 1IEWA 1M65A 5T9CE 1TTJA 3UJEA 1LWJA 2Y5SA 2W66A 1PVNA 2OEMA 4QR6A 5AC5A 3W1RA 2XIBA 3EWWA 1AK5A 1M1BA 2WHKA 1GKRA 2BB0A 3TN3A 2D0FA 3ZT7A 1Z6KA 5A2AA 4IFOA 4GUHA 1ZB5A 4UOQA 5CPQA 2PA6A 1OIMA 4O1CA 4QJ5B 2ASHA 4HHPA 4L4MA 1A5AA 3H2MA 1L0PA 1QI2A 5D9NA 1OEPA 2VX4A 1V6YA 3S2JA 1JCXA 2DZTA 3P61A 3DEQA 2OYKA 3CYVA 3OJGA 3I7QA 4W86A 2JE8A 2VGIA 4ZOBA 4YWIA 1XLMA 4CCDA 1F9CA 4UXDA 2W61A 2P53A 3KBVA 3WLLA 1QU4A 4NAEA 4HK7A 1BYAA 4AY1A 3V0TA 1BAGA 4W87A 3KXQA 2Z1WA 2JK2A 4JTJA 3TP4A 1XXXA 1ZU8A 4H4IA 1GEQA 3DECA 1WE5A 2CZFA 4GO9A 1TMLA 1V3HA 5AB3A 4JTIA 2ZX8A 4M1BA 4HNNA 1QFEA 1UD6A 3YPIA 4D6JA 5M5DA 2IMRA 3R7MA 1R6WA 4H9UA 4ROQA 4UCGA 2GJPA 1UR0A 4FNPA 3G6MA 2QCHA 3GHTA 3MSYA 4H7VA 2G8ZA 1E6XM 1O94A 3STPA 3BGGA 3B97A 2EEXA 3TAKA 5BROA 2GQAA 1OD0A 2W6RA 1GKQA 2C3ZA 1NOUA 3G18A 1I2PA 3P0XA 2CHNA 4W89A 3WQ4A 3AWOA 3VD7A 2XVKA 2PDWA 1W9DM 2WJEA 4MKVA 5LNVA 3ME3A 1C8YA 1CXEA 4UMBA 1J18A 2PTDA 3RAOA 1D3HA 1H1YA 3V7PA 3NWRA 5DANA 1ME7A 3WD2A 4UOJA 4HHHA 1QNSA 1Y0EA 4IGMA 1DXEA 1DBTA 4P7OA 1Y8BA 2E67A 2XFFA 4NHVA 4DO5A 1DIOA 1R38A 4F8XA 1UWTA 3WJWA 4ZFCA 2VFHA 1FH7A 4GC3A 3WDHA 1EOKA 2WQPA 1IXNA 5AHNA 4YL2A 2FLIA 1W9XA 3FKKA 3PPCA 3R8GA 4HZMA 3AMKA 2L5HA 2WMGA 2ATSA 3C0LA 1AZ2A 1E0XA 3B9NA 1KKOA 4A22A 2REQB 1HO1A 1W1PA 4HU3A 2QJMA 2VR4A 4L61A 3V0SA 3LZ3A 5EGRA 3WQ8A 3U5YA 1VCVA 3MQTA 4O1FA 2QV4A 3VFLA 3SCOA 4FHAA 1Z69A 3PBUA 2ZE3A 1BVZA 4G6CA 2WWDA 3ZT6A 3A4XA 4P2VA 4TQTA 3KBSA 1W2PA 4J27A 3NPUA 3PNUA 3F5KA 3K46A 4OE7A 4W7VA 3HG4A 4B90A 3WQ6A 3D3AA 5HMDA 3U0HA 2Y85A 5AHIA 5DELA 4J3UA 3CO4A 3WH8A 3T2OA 2NX1A 5AOUA 3TSMA 4LJ3A 3W37A 3TJ4A 4AHQA 3T08A 3EX1A 1X98A 3UNDA 1DE6A 1B57A 3NZRA 2E68A 1OFPA 2I14A 3NOEA 4H2CA 4UTWA 3I10A 4D8ZA 3OLEA 3SCPA 1LLZA 4Z17A 4AZHA 2QAFA 1I2OA 3NDYA 3B4UA 4O1BA 4NAEB 3R8RA 3C8NA 3E2RA 3QC3A 2E09A 2HNHA 5E9XA 4QEEA 4ZGYA 1E4LA 2H9AA 1QMLA 3CWNA 2GGGA 1J8VA 1GEHA