5G1TA

S. enterica hisa mutant dup13-15, d10g
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
247
structure length
229
Chain Sequence
MIIPALDLIGGTVVRVVQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE ION
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
total genus 76
structure length 229
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g1tA00
5FI8A 1XBVA 3PSWA 4FF7A 1HL2A 1B57A 3GLCA 3QMTA 1KM1A 4H6KA 1KFLA 3G1XA 3WJSA 3EX3A 3DZ1A 3IIPA 2JBMA 4FEZA 2HS6A 4JD4A 4KWVA 3JRKA 2CZ5A 5AHIA 3SZ8A 4O12A 3EX6A 2ATMA 2CU0A 4JTFA 5D2VA 3NAVA 4DXVA 3DFTA 3EWXA 1KTNA 4LC8A 3V75A 1IXOA 4ALDA 3SGUA 4O1CA 3CB8A 1P4CA 4WX2A 3UWUA 3P7YA 4WY0B 5FF2A 3W2NA 3FJ6A 4MUZA 5CSRA 3KHJA 3Q2DA 4FIQA 1SW3A 5K3VA 3W07A 3HPXA 4GFSA 3NQDA 1XBXA 4JXCA 4CQ9A 1FX6A 2ABAA 1TPB1 4Z0SA 2ZZ1A 4MPQA 2QAPA 4DO5A 1JCNA 3BG5A 5LNUA 2XN0A 3NDOA 3HIJA 5HULA 1MEIA 3I7SA 2QEZA 4XKYA 2GQ9A 1RVGA 1SPQA 5FEZA 3LX9A 3H54A 3O16A 4OQVA 1NVMA 5G1YA 3PUEA 3VCRA 4ZQRA 1OF8A 3GKAA 3MP4A 4I9AA 3NL6A 3P74A 3MI3A 5I3JA 2E68A 3MBDA 3OVQA 2E6FA 3OHIA 4RV8A 3L0GA 1X6UA 1FDZA 1G6CA 3G1HA 2X30A 4GC4A 1Y0EA 1QAPA 2QCLA 2W6RA 5DBTA 5IBXA 2YXGA 3QF0A 1TREA 3HG5A 2CFFA 2Y7DA 3E0IA 4PH6A 5AC6A 1FY6A 2H3DA 1TPUA 1YXCA 2BZNA 2NWSA 3LERA 1TPVA 3O06A 2B0MA 3HGSA 1LLZA 2QJGA 3GNDA 4NNAA 4K8HA 5D33A 4UR7A 5U4NA 3NQCA 1W3NA 4TX9A 3WJYA 2RHGA 5AOUA 2V2DA 3QW3A 3N73A 2FJKA 4PL1A 3T7VA 3UXAA 1JQXA 4WXZA 1EP3A 2VEKA 1OJXA 3S5OA 3U6WA 4EIVA 1IXQA 3W72A 3EWYA 2NX1A 4HIBA 2HMCA 2QCHA 3P67A 4IWWA 5AYYA 2ZRZA 5G2WA 3S9YA 2H6RA 1WV2A 3NO5A 4BI5A 1X1OA 1XDMA 1QNVA 1K02A 1SUXA 3PS7A 1Q6RA 2RDTA 2A7RA 5AB3A 3A5VA 1M7PA 3IIOA 3UWVA 4UTUA 1K8YA 5I3GA 3KX6A 2WPBA 4WOZA 1TRIA 4FXSA 4N9CA 1AW5A 3CHVA 3I7RA 3L0NA 4J9JA 3U2OA 1TTQA 3QW4B 4YCPA 3TMQA 1M5WA 2C0AA 4JTJA 3TDFA 1KFBA 2NXHA 5EY5A 4QITA 2A2IA 3R5EA 3IGXA 2QCMA 3TSBA 1RZMA 4YL2A 3SECA 4L4LA 4UFMA 4AB4A 3HG2A 4QAIA 4O16A 1Z48A 3MI6A 2V8ZA 3P60A 1ZCOA 3NPUA 3S42A 3B04A 3PR2A 4FNQA 4I7VA 3GX9A 4GXMA 3S1WA 2VENA 3TC7A 5G1TA 4HHPA 3DAQA 1OFEA 3C0JA 3CIWA 2BTMA 1GTEA 2QDGA 1L2UA 5LNSA 5J5RA 2VC6A 4TMBA 3L9CA 1G4TA 2W79A 2QAFA 3T44A 3IVTA 1R47A 4ORMA 1VLWA 3CWNA 2YYUA 4ZQNA 4Q32A 4BI6A 8TIMA 2B7PA 1R46A 3TA6A 4MLRA 1VQTA 3W3OA 2I14A 2Y88A 1OVDA 1OFOA 3A9IA 3PBVA 1G4EA 3Q37A 5CPMA 1GVSA 1WX0A 4O17A 4MZ8A 2Y62A 3IVSA 4GRSA 2J6XA 3W85A 2VXNA 3N34A 1KM4A 1I2PA 1W5PA 2CWNA 1LORA 4YXGA 3QQ0A 1WBHA 1SO4A 3W7HA 3TNOA 3CU2A 2QF7A 3FLUA 3LTSA 1QO5A 2DZXA 1JJKA 2QUVA 5DBUA 4Y90A 3BV4A 5EYWA 1SO3A 4D2JA 2G97A 1FCVA 3TV8A 2VFEA 1H62A 4AF0A 4P61A 4DPPA 4OHQA 5EA9A 1OFAA 3HMJG 4MFEA 3GAYA 1DHPA 2DORA 1SSGA 4GWEA 3BLFA 3KVMA 4O10A 2DZVA 2YZRA 1KLYA 1WYIA 1AW2A 1HFBA 3BARA 3W73A 2ZBTA 5G4EA 1GG0A 3NR0A 3W88A 1FXQA 4LC6A 3G1AA 3N14A 1DOSA 3YPIA 1H7PA 2WV8A 3O6DA 5D04C 2H8XA 2ZA2A 1L6SA 4LVFA 3RLVA 3W2MA 4RR4A 3UWZA 1VYSX 4KFOA 1I2NA 2C16A 5C5YA 3LCIA 3L5MA 4UFHA 3NQ8A 4XBSA 1D3GA 3W75A 1H60A 3MHFA 1KM3A 3CM4A 3G3DA 3GNNA 4DF2A 1GT8A 1GTHA 1SZNA 2YW4A 3B06A 2Y70A 3BW3A 4DQWA 4K39A 5G2IA 4GE8A 2P1FA 2C18A 3DFNA 1OHLA 5I3KA 3HBLA 1XI3A 5C55A 4Y6GA 4NX0A 5J5DA 1A5BA 3CIXA 4OT7A 3W2UA 3GXNA 3B03A 5GVJA 1FWSA 1WOAA 5F2GA 5F2MA 4FNRA 2QDHA 2QCCA 3UY8A 2ATSA 5CPNA 4EOUA 3LCLA 1L6YA 1I45A 4P2VA 1JCLA 3G0XA 4LWWA 4PA8A 4XWUA 1K03A 4A3UA 4A2RA 2RH9A 4CLMA 2PURA 2VOMA 4LUIA 1Z41A 1F2JA 2CW6A 1NFBA 1KBIA 4ZMGA 4IPIA 4EWND 5G2HA 3HGJA 4TR9A 3BGGA 3R13A 2GQ8A 4NNBA 5BNKA 4NZJA 2ISWA 1W5OA 3PBWA 4M5PA 2Q3OA 2QUUA 3W7CA 3LLFA 3NPWA 5HNRA 4JTUA 1I2RA 4WOQA 4JIQA 4A29A 2OT0A 1MSSA 1F74A 3N19B 2Q8LA 1P0KA 1Q6OA 5A5WA 2OJPA 3GYEA 4RZ5A 4BK9A 4N02A 2E6AA 3TFXA 3DI1A 4MZYA 3UQNA 3FOKA 4MKNA 4UIOA 3TC6A 3T4CA 1RQHA 3M5ZA 4BI7A 3TKFA 1P0NA 5DN1A 2A0NA 1VR6A 3TXZA 5K9XA 3LCXA 3CWOX 4M6PA 1S5VA 4CQ8A 2E5DA 3C3NA 1SR9A 3UNDA 1S5TA 4UMBA 3S5NA 3QZEA 5G4WA 4ZZ9A 4DF0A 4QM1A 1VYPX 4H3DA 5D38A 4OWGA 4ZQMA 2VEPA 1B4KA 4DBEA 3VFLA 1KM0A 2E77A 3GAKA 4PCFA 3W9ZA 3DFQA 1ZY9A 2GOUA 4MY9A 1G4SA 3TJLA 2J27A 4UC5A 5DXYA 2BSLA 1PHQA 4BWLA 3ATYA 4K7VA 3NM1A 3R8RA 3GVGA 5I3IA 3W2KA 4LVAA 2GQAA 3P61A 3VNDA 1EIXA 2DZPA 2RDUA 1IGSA 3D0CA 2J9ZA 2B7QA 4S1FA 3M16A 5I3FA 5AN7A 2B7NA 3HGRA 3LRLA 3QSRA 4Y96A 5CPLA 5ABTA 3P81A 1LP6A 3O8AA 3KXQA 1G67A 1KFJA 3M44A 3S1XA 4JTKA 3WJZA 1P5BA 2Z1BA 5D03A 4DELA 1JRCA 3MWAA 2C1HA 2C14A 3L68A 3NEVA 2A7PA 4JTTA 5A8GA 3NZRA 4NT0A 4EVZA 5F4XA 5IBXC 3NQ7A 1VC4A 1H61A 2DJLA 1OF6A 1R2SA 1VHCA 4LOCA 4NX5A 1KTCA 5BMXA 4WQ6A 1OFBA 2YSWA 1H7OA 3PG9A 3W84A 3NYZA 4K7YA 4X3ZA 1HO1A 4UCGA 5KINA 4UNLA 1TJPA 2X1RA 2CLOA 1W3TA 3CEPA 3BVJA 3O15A 4M7SA 5C6MA 1B9BA 4O1AA 1G4PA 3L5LA 4KKXA 2XN1A 1YDNA 3PC0A 1NSJA 1W56A 4CNPA 1JRBA 3F4NA 1QR7A 2GPTA 3TUUA 3FKRA 4K38A 1R30A 5DCDA 1KM6A 4UNKA 3LHUA 4ZQOA 4UTJA 1LZOA 1SSDA 4O53A 2CLKA 1XC4A 2NV2A 2R14A 5CZJA 4MOZA 4JX5A 1KLZA 2ZRWA 3U8GA 3P80A 5DELA 4AF0B 4MIMA 1PCKA 1M7OA 3IIZA 1XUZA 3GR7A 4PEKA 3QJAA 1WDWA 3G8EA 4DO6A 4MY1A 2B4GA 2HS8A 4KFPA 1K3UA 1X1ZA 3NPVA 2Y63A 4HNUA 3DXIA 3M5YA 3NOEA 4AH7A 1AL7A 5DLCA 1H1YA 3O6YX 1FCQA 4HNNA 3W1PA 4IMGA 2X2GA 5D09A 3DKLA 3DU0A 3EXSA 4HN4A 3LHZA 4GUFA 3C2VA 1FWRA 3OEXA 5AHFA 4BFAA 4RCXA 4PTNA 1LTDA 5HJLA 3M6YA 1H7RA 3JR2A 3NGJA 3LM7A 4CCDA 1WOBA 3THAA 5AYZA 4AHOA 2NWRA 1JVNA 1OK6A 4AAJA 5F2LA 2YCEA 4IMDA 2YW3A 1WBJA 3W1AA 1ICQA 3MYOA 1OABA 2PC4A 4UTTA 1ME9A 4K36A 2AGKA 3NXFA 2I9EA 5D2TA 4UFJA 3MW7A 3DKJA 3EXRA 5LKYA 1LBFA 3W7JA 1J2WA 4Q4KA 4RZ6A 3GK0A 3CC1A 3N9RA 3H53A 1U5JA 1N8FA 1TIMA 1TO3A 4UMCA 4JDBA 3WK3A 3UWQA 4Z1DA 2Q3RA 4JYDA 2QKFA 4MFDA 3HG4A 3R89A 4E2DA 2VELA 2BWGA 2FIQA 3I65A 1T8XA 4ONVA 1GZGA 4QNWA 5H91A 4NXSA 4FX6M 4M6QA 4QQ3A 5LZLA 2CLIA 1TV8A 4O4WA 3NQFA 4E38A 4JTSA 2RDWA 4LVBA 3GXTA 5MHBA 3ZR4A 1B3OA 4FB7A 5LSMA 4WY0F 3C2EA 1JQVA 3QEZA 4GUJA 1LBLA 4CNNA 5D2WA 4RXFA 1K7FA 2A1YA 2G5WA 2J9XA 2TYSA 2WJZA 1O60A 4LUJA 3G24A 2BX7A 3FKKA 2OZ0A 4OU1A 1EWEA 2VFGA 3W1TA 3W2LA 2ISSA 1VCGA 1TPDA 4N2YA 3LHVA 5D05A 3G1FA 1W5MA 3LHTA 3M9YA 3EWBX 2WSQA 1YPFA 2EAWA 1XFBA 3I7QA 5KTLA 3W22A 3LXBA 4JICA 3HQ1A 4Y8FA 2R91A 3G0UA 3TU9A 3NG3A 4QSHA 1FWNA 1C9DA 3OBKA 5TIMA 2CZFA 2CLEA 4JY8A 3SFKA 1GQNA 3PULA 4NNCA 4Q33A 3MJYA 1ME8A 3LBCA 4JYFA 5K9DA 1VS1A 2PCQA 5KMYA 1Q6QA 6TIMA 1QWGA 3HJZA 3M5XA 3CQ0A 3TQ0A 4ICNA 2R94A 2NUWA 7TIMA 5F1UA 1VCVA 2V0TA 3PM6A 4O0ZA 3BK0A 4E0CA 1XL9A 1AL8A 4RXGA 3SW6A 5HINA 1EB3A 1ZAJA 2Y61A 1LM1A 3HF3A 3WFAA 1CI1A 2TMDA 5L6UA 1K7XA 1FQ0A 5KSWA 2C6QA 3PAJA 4ZVJA 1X7FA 3BO9A 3DHDA 3EB2A 3LRMA 1F7BA 1EP1A 4IQLA 5AHLA 3BGJA 5DCEA 4UTMA 3ABQA 2NLIA 5AHNA 3OVPA 3EKZA 4S2CA 3LDVA 3DI0A 4YMZA 3W1UA 3SR7A 1A53A 1RV8A 1QOPA 3LTYA 3UPBA 4C1LA 4HNTA 1FDJA 5LGZA 3IIXA 2QUTA 2QCNA 3V1PA 1XUUA 2TRSA 5AC7A 2V81A 1F5ZA 3EXTA 2ABBA 5FF0A 3W2JA 3DFOA 4TO8A 2QCGA 4O15A 2G95A 3MP5A 3CT7A 4UFIA 3PSVA 1TTJA 3N2MA 1EP2A 1W5NA 3TJXA 4CCCA 3EWWA 3TSDA 4JTLA 3HPSA 2ZDRA 1LLWA 4XUGA 1DBTA 2Y85A 4X9SA 1KFKA 2YFNA 1O94A 3STGA 3GKFA 4ADSA 3P5YA 2GUUA 3NQGA 3A24A 1TJRA 1DKWA 1C8VA 3GZ3A 4IUOA 5DY2A 3LV6A 3TH6A 1XM3A 4FHAA 4HT3A 3I6RA 4G1KA 2B7OA 1H7WA 4N4QA 3UWYA 2JKPA 3GIYA 2EKCA 3UZJA 3LCFA 3TCEA 2F84A 1B4EA 3F4WA 5H2ZA 3S8HA 2H3BA 1TPFA 1UB3A 2E6YA 3MUXA 2ZCGA 2OT1A 5C54A 4JR5A 1D3HA 3MHGA 4NJKA 4JS3A 1GPWA 3WJXA 2V2CA 2ZZ3A 3TW7A 4PODA 4LU0A 1OX4B 2H8ZA 3OVRA 4ZQPA 4U4MA 5EBUA 3RF9A 4BWLC 2ZZ6A 6ALDA 4IGHA 4O1DA 1AG1O 3NQAA 1LOQA 3GDMA 4X2RA 1K7EA 3ZWSA 3KRSA 2FTPA 3FA5A 3QPYA 3P84A 4CNOA 1DORA 4DF1A 1W5QA 2QJIA 3NL5A 4O11A 3SGZA 5CGQA 4WXYA 1MZHA 3O63A 3QRHA 1GJPA 2J24A 3P82A 3W71A 1NF0A 3BLEA 5F4SA 1SO6A 1ZHAA 4N6FA 1P1XA 5AFDA 3WK0A 3PG8A 4HSNA 3I68A 3ZWTA 4IPJA 4NJGA 3SJ3A 4BR1A 3B4UA 5G5IA 1XBZA 3LI1A 3TSMA 1VYRA 3BW2A 2J88A 2V9DA 2FB3A 3E49A 4NU7A 4PFMA 1NEYA 2J9YA 1GWJA 2O7SA 3FYOA 3LBMA 4AEOA 4NZFA 3E12A 4R33A 4HKPA 3E96A 3IIVA 3BG3A 5EL1A 3KOFA 1OG0A 3IGSA 3NQVA 4OV4A 2A6NA 4O8RA 4HNVA 1H63A 4N6EA 3PBYA 4RJEA 4JN6A 4L4MA 3KVLA 1AMKA 4FX7A 2NX3A 4GUIA 1YTEA 3W7RA 3G22A 1ZNNA 1MO0A 3RFAA 1FWTA 4IOTA 3UWWA 3SI9A 1IF2A 5CZSA 1RR2A 2JKAA 4MY8A 2IQTA 1UBSA 1GOXA 5D2YA 3F03K 4UTWC 1DVJA 1R2RA 1ZAHA 1SO5A 1OYBA 3LTPA 1EX5A 1MEHA 1TB3A 2X1TA 4O57A 4DBDA 4LT9A 5FF4A 1X8FA 4XTIA 1YADA 1MXSA 3STCA 3G0SA 1SZGA 1FBAA 3G1YA 5LGXA 4NXKA 1RQEA 3HGOA 1JUEA 1OX5A 3GR8A 1L6WA 4ZL1A 1L9WA 4TMCA 4MZ1A 4O1BA 1V7YA 3MBFA 5KZDA 5EPDA 3UPWA 2Y7FA 3Q94A 2Y7GA 1XBYA 3C8FA 1PCWA 1O5XA 2P0OA 2CZDA 2PRMA 2QCDA 4O50A 4GUHA 3NM3A 1A5CA 5KZMA 4HSOA 5HWMA 1I4NA 1KM2A 1OFDA 1K8XA 3G1SA 4Y9AA 3OG3A 5DCBA 4ZQCA 1WAUA 2Y6ZA 5LHEA 4K37A 5T26A 1NF7A 1QCWA 2VKZG 5F1VA 4LVDA 5LNVA 4UFKA 2A21A 2Y89A 2E6DA 2QCFA 3HB9A 5HWNA 1V5XA 4NJIA 3NPXA 3EEGA 3HO8A 4JY9A 3W70A 4W9TA 1F76A 2PRLA 3TXVA 2ZZ2A 3UD6A 2DJXA 4CCEA 3GDLA 3P8IA 3FEMA 2KZHA 2A7NA 3GDTA 2WSYA 4LW7A 3W83A 1LRQA 4UTTC 2GVLA 5EMUA 2E1DA 3CTLA 3PUOA 2ZZ7A 3P8JA 1KW1A 1I8JA 1U83A 5HUPA 5EKYA 4XTDA 3W1XA 3TX9A 3FS2A 1BWLA 1QPOA 1VCFA 4LNYA 1T0OA 3PBUA 3NA8A 4Z1CA 4M6VA 1ADOA 4LV9A 4NJJA 2Z2UA 5HQEA 1SZEA 2CLLA 4IMFA 5D37A 2VFFA 3W7OA 5KITA 5E1QA 3H55A 1AK5A 3C56A 4HPJA 4QJ1A 1YDVA 2DZUA 4JEQA 4OV9A 1Q3NA 2QR6A 4KWWA 1OYCA 1LOLA 3AO0A 1JR1A 2E5BA 1W37A 1BWKA 3A5FA 4FNUA 4UTLA 1Z42A 3A21A 5L9FA 1XDLA 3BW4A 1TV7A 5KZEA 3KFTA 4YCOA 4JDYA 2GVGA 3A23A 5E0KA 3S6DA 5D2XA 4O18A 3W7QA 4JTGA 1FUYA 2E09A 1VLIA 1AW1A 4LS0A 1PVNA 3PF3A 1OFQA 3UXDA 1OX4A 2PE4A 3NQ2A 1SFLA 3B0VC 1IIGA 2X1SA 1W1ZA 4LY8A 3EKLA 3W7DA 3O07A 3S5YA 1A5SA 2C19A 4AVFA 1G7UA 3CLMA 1VGAA 1EA0A 5K9CA 3W7EA 3S1UA 2V5BA 1FXPA 2ALDA 3C52A 3MYPA 1GVRA 1TSIA 3KAOA 3T40A 1KBJA 4LRTA 4NVTA 5AYXA 4OGZA 2CLMA 5CZTA 3ZS4A 3RLUA 3F1QA 2JK2A 4YWIA 1H1ZA 1TPEA 1EPXA 2FFCA 1SW0A 2ZFAA 3UY7A 2YYTA 2PRHA 4JTHA 5HR6A 3BG9A 4H4IA 3IRDA 3O6CA 5BMWA 3ABSA 3KVKA 1IXPA 2LLEA 4R34A 3EWZA 3L21A 3EX2A 1FCBA 3NZ1A 2QJHA 4O28A 4O52A 3MI2A 1KFEA 2EF9A 1C29A 4MYAA 3GDRA 4RZ4A 1BKSA 4M19A 3RU6A 3W7NA 1JUKA 3Q58A 2A5HA 3AJXA 1DV7A 3DENA 3T78A 1KA9F 4IMEA 3QQ1A 5AHEA 3LHYA 4E2BA 4RKAA 3WJWA 3PWAA 3N9SA 4OE7A 4LVGA 1KTBA 4JIPA 3QMRA 2NXIA 4XZ9A 4QISA 5SWUA 5CZ0A 4UR8A 2FPVA 1ONRA 1KV5A 3B0UX 2DU2A 1GYNA 3TROA 4FIRA 3GXPA 5TBOA 2WSRA 3M43A 1S3HA 1SU5A 3IVUA 3ELFA 1N55A 2NUYA 3W7GA 5D30A 3EX1A 1LDCA 4S2BA 1EUNA 1N7KA 2OCZA 2DZTA 3M5VA 3SY5A 1G7VA 4MVAA 4C1KA 2X16A 1JCXA 1J5TA 1RD5A 1LYXA 2JGYA 1H5YA 3L2IA 4A22A 4WD0A 5BRBA 4A21A 2NUXA 2R8WA 1SZFA 4DEFA 2ISVA 3STEA 3G1VA 4IX2A 4RLIA 3MMTA 2JKEA 1SFJA 1UUMA 3RMJA 2ZA3A 1F73A 1TTIA 1T99A 1T96A 2NX9A 2FPYA 3FIGA 3HPZA 3MP3A 3G1DA 3M1ZA 2ZYFA 4LRSA 4IXXA 2GVJA 3TFCA 2C13A 4MLJA 1ALDA 2VEMA 2WQPA 1BTMA 3W87A 4AMAA 1QOQA 1TRDA 4UTKA 4PL2A 2QCDB 2FB2A 3C6CA 5FESA 3KRZA 3W1MA 4JYEA 3DBPA 3S1VA 4UFLA 3QMSA 3CPRA 4DO4A 2G96A 3TW6A 1XKYA 3QM3A 3K30A 5FF7A 1VJIA 4TU1A 4U28A 3PB0A 4K8EA 4Z1BA 1TPC1 1ZFJA 3TE9A 1OYAA 3PB2A 2GJNA 1ML1A 4UUIA 1GVQA 3VKJA 1O4UA 5FF3A 2AQWA 1H7XA 2RFGA 3DGRA 1QDSA 1SQ7A 2EHHA 4TIMA 4PC8A 2DP3A 2NXGA 1LROA 3NNTA 2ZZ4A 3M0ZA 3BLIA 2Y7EA 3RNDA 2X1UA 3B0PA 4BF9A 4EF9A 1JCJA 4I7UA 2UV8G 2Z0IA 2NV1A 3R12A 4O19A 4FXRA 1LOSA 2WNZA 3KRUA 3W1QA 1LRNA 4JTIA 1TCDA 2I1OA 1LBMA 3L65A 3ZFHA 1J4EA 2V2HA 2V5LA 1QPNA 4B5NA 5TQLA 3W7MA 4NUWA 4K6AA 2ZA1A 3W1NA 3A22A 3PY2A 4O4VA 3GDKA 3LLDA 4O13A 1D9EA 4JX4A 4YLWA 3LB0A 3W7KA 5K2ZA 3ABRA 3IEBA 1XCFA 4AWUA 1JUBA 1PL9A 4QNEA 1IXNA 2DZWA 3WK2A 3FFSA 2XN2A 1QMLA 4LTSA 3QYQA 2ZTKA 5K4XA 2VFHA 2ZRYA 2C15A 2O7QA 3IGUA 3W7IA 1Q45A 4GBUA 5CG7A 5C2XA 3LI0A 1VRDA 3NQMA 1UUOA 1EEPA 1HTIA 3LHWA 4KFNA 5F4WA 3UZ5A 4CQAA 2BXVA 4ADUA 4R7JA 4ADTA 3B05A 1QO2A 4GUGA 2ZZ5A 2A85A 4QIUA 1QPRA 3ANYA 5K4ZA 2GJLA 4FX8A 3NQEA 1UCWA 4XBKA 1CW2A 3L66A 1W0MA 5E93A 5FEPA 3UYCA 1R2TA 4IXHA 3LCHA 3B8DA 1OFRA 2EGZA 3NL2A 5HMSA 1A50A 3NQ6A 1FDYA 1DJQA 1JCMP 5HWJA 3HG3A 1O95A 3L0KA 4M7TA 4WY0A 5IM51 4O14A 2ZRUA 1JULA 2WKJA 1FWWA 5LNWA 4OBTA 3QPZA 1VH7A 4FO4A 5FEXA 3W1LA 2ZQ0A 1TYGA 3T55A 1OFPA 3W7LA 3E9AA 4Z08A 1K8ZA 2Z6JA 3P5ZA 2Q8ZA 3ATZA 3W7PA 4N9EA 1ME7A 2EPHA 1YYAA 1FCUA 4AHQA 2FQIA 1YLVA 5AC8A 4UMAA 1WA3A 5BW6A 2JGQA 3PVFA 2CLFA 1EUAA 4LS1A 1UASA 2D73A 1KM5A 1YXDA 1RQBA 3L67A 3INPA 2YPIA 3MHUA 1W54A 3WK1A 1VHNA 1YXYA 1TV5A 1F6PA 4JX6A 3ABOA 3C2FA 4WJEA 3OIXA 3E02A 3N2XA 4JTEA 1O5KA 4HPXA 3M47A 1ZENA 2YFOA 2HTMA 3O1NA 4DPQA 2AAMA 3NL3A 1LRTA 1TQXA 2E5CA 3W74A 3VI2A 2DZSA 4RX0A 3W86A 1E51A 1OK4A 3TAOA 4XKYB 5U7SA 2VFDA 3JS3A 4N4PA 4XQ6A 5DY3A 1H50A 2FLIA 4N9BA 3O05A 1TPWA 3KVJA 2P10A 2WOQA 4RK8A 4JGDA 4ORIA 2W0UA 1F6KA 3G3MA 1UJPA 1KFCA 5HR7A 4IX0A 3EWUA 5K7JA 1F05A 1DQXA 1W3IA 4UTHA 4UTIA 4FNTA 4LV4A 4X22A 3HOJA 3VE7A 1CX9A 3TQKA 4A2SA 2TSYA 1H7NA 1I2OA 2OMAA 2YDAA 2FDSA 4GNJA 4LS2A 1JCYA 2WO5A 2ZRVA 3C61A 3NVTA 4FNPA 1PIIA 4GJ1A 3TK7A 5DXXA 3LRKA 2FPTA 5CPOA 2V82A 3SSJA 4EF8A 3FYPA 4Z0JA 3W6YA 1WQ5A 5F2IA 3C4UA 1EWDA 4AWSA 1HG3A 1GVOA 3W1RA 3LOTA 3DHFA 4O54A 1HO4A 3MO7A 1Q6LA 1QFEA 3LXCA 2OX1A 4IMCA 3G8RA 4N9DA 1YTKA 3DFSA 3P62A 4MJMA 1GYLA 2YX0A 4WZHA 3LCWA 1SW7A 3FJLA 2VFIA 3CEUA 1VZWA 1YTDA 4NQ1A 2ZTJA 1XXXA 1W31A 2H90A 1PE1A 4Z1AA 5I3HA 2ZRXA 2WNQA 3USBA 1PS9A 4POCA 3LGEA 2RKXA 3DFPA 3DH7A 1GEQA 1I2QA 2TPSA 5FEWA 1Z44A 4WUIA 5LNRA 2BLEA 1HUVA 2NZLA 5LHFA 3G18A 4UXDA 1BEUA 3TAKA 1W8SA 1S5WA 2F7FA 3VE9A 3W23A 1DL3A 1KV8A 3THQA 3TQVA 2QCEA 1GVFA 5HUOA 1A5AA 3STFA 2A6LA 3LXAA 4FNSA 1YDOA 3S0CA 3IV3A 4I7WA 3SIZA 2C3ZA 1TTPA 1G69A 3TMLA 3C2OA 2XFWA 4O0KA 1MEWA 3OA3A 1THFD 1ZAIA 1YPIA 5BOOA 3N3MA 1OX6A 3L5AA 2CLHA 2V30A 2A4AA 3M41A 1IIHA 1PHWA 1DQWA 3W76A 4MJZA 3QC3A 4R53A 4AWTA 3LCGA 1TMHA 5AHMA 1TPH1 3TIMA 2YR1A 3LV5A 2HSAA 4AHPA 3TR2A 3QFEA 3BPWA 1ICPA 5D32A 4IJBA 4AXKA 4JNMA 3S5ZA 3C2RA 1TQJA 4MYXA 3GB6A 3EX4A 5D02A 1NAL1 5CSSA 3QSTA 2Z6IA 1GG1A 2CZEA 1WXJA 3RK8A 3R2GA 3M7WA 3QH2A 1DJNA 1H51A 1ICSA 4NJHA 4UTWA 1VPXA 2VEIA 1LCOA 1RPXA 1QPQA 3PUDA 1ZJIA 2WNNA 1ZALA 1PV8A 1M6JA 2YGYA 4ML9A 5CKSA
chains in the Genus database with same CATH superfamily
5EB8A 4DO7A 1XBVA 4IPLA 4WF7A 3PSWA 1B57A 4H6KA 1KFLA 1VFOA 2C79A 4PGLA 2NT1A 1V02A 3WJSA 3IIPA 1Q13A 4JD4A 3AXXA 1G9HA 2CZ5A 1DHKA 3HPAA 3AS0A 1WPCA 2CU0A 4C6IA 1T40A 3CO8A 2BXZA 3CNYA 3DFTA 1CLVA 4ALDA 5BYWA 2BVTA 4PCTA 2X42A 3ANUA 3B8SA 4L56A 1TMQA 3WQFA 3SAZA 4I3GA 3VD9A 3W2NA 1CPUA 3FJ6A 2L5HA 4MUZA 3Q2DA 5I23A 2PTDA 3DEQA 1XPYA 3LA4A 1V7AA 1XBXA 3R4IA 4ZODA 6A3HA 3SDOA 4QROA 2ZX6A 4Z0SA 2ZZ1A 3SBFA 1WDQA 3GG1A 3BJSA 3ARWA 3BG5A 3LZ3A 3MCNA 3HIJA 1ZL1A 2GQ9A 3E6EA 2EJAA 3WLRA 6XIMA 1UKTA 4ZQRA 3ONCA 5EFFA 3NFUA 3UESA 2DIJA 3MP4A 2PTYA 5H1WA 3MI3A 2E68A 3MBDA 5C9WA 3PN8A 3UJSA 3ARPA 1GCYA 3BLDA 1W9XA 1JZ8A 2Z1KA 1QAPA 3VDCA 4A8IA 3VNLA 5IBXA 3BAJA 2YXGA 1J11A 3HG5A 3E0IA 5AC6A 3WUEA 2NWSA 3LERA 2YDSA 3OQEA 2GK1A 3EA3A 1W6TA 4DY1A 3HGSA 1VFUA 3GVWA 5U4NA 1BSIA 5AOUA 2V2DA 3QW3A 4M0XA 1P0EA 3ZJKA 3WD4A 4WXZA 1EP3A 1OJXA 3XISA 2BDQA 4EIVA 2NX1A 2WC4A 3P67A 1X1OA 2OGJA 3R8HA 3GNXA 3VKKA 3SCOA 3UJEA 4H8HA 2A7RA 3A5VA 4G1NA 1UR8A 3UW6A 3WF2A 1K8YA 3KE0A 3AS2A 1TRIA 2FZBA 4FXSA 1Q2SA 1M5WA 3WEOA 4B90A 1W9UA 3AC0A 4JTJA 1R3QA 3R5EA 3WCZA 3TSBA 1RZMA 3SECA 3U5UA 3HG2A 3B9AA 4O16A 1Z48A 2PLJA 3CZLA 5E6ZA 3B04A 3PBGA 3TLLA 2OZ8A 4GXMA 3S1WA 2YDRA 4V2XA 2PC8A 4DZIA 3C0JA 1OIFA 4J1OA 1GTEA 2PGFA 1CXHA 3NCOA 4TMBA 2JF7A 3L9CA 1XQLA 1G4TA 2ZWYA 3UEQA 2W79A 2QAFA 1EHNA 3T44A 3IVTA 1R47A 1XLKA 5BRQA 4ORMA 2YYUA 2XWEA 2B7PA 3AALA 5M17A 3TA6A 4MLRA 3W3OA 1RJQA 5CPMA 1J01A 4LANA 3IAQA 1GVSA 3PPCA 2VXNA 5MKGA 2YJQA 5HMEA 2JALA 1IWPA 1LORA 4PB3A 3W7HA 2DFAA 4PYSA 3SUUA 1V0KA 2QF7A 4AZBA 1E73M 5EMKA 2CBIA 4DBWA 1NOUA 2VL4A 2P88A 3VX0A 5A6MA 4DPPA 4M82A 4OHQA 5IXEA 2J66A 3HMJG 1HXJA 5I78A 1F3EA 3BLFA 1IV8A 4XSMA 2YZRA 3QHNA 1PWLA 1KCLA 2INEA 3ZJ6A 1F9CA 3GNOA 3URAA 1GOQA 7ENLA 3FSTA 2NVAA 1AJZA 4TUFA 3MCMA 4FAMA 3BAYA 4GD0A 4LVFA 3RLVA 1L6FA 5DMMA 1VD6A 1I2NA 5C5YA 2A3BA 4UFHA 2VX7A 2YCKX 4JIEA 1H60A 4B3LA 2Q8XA 4DF2A 3IRSA 3NUKA 3B06A 4X9YA 3ZQ9A 4K39A 3GXIA 3AS1A 1A5BA 3PPHA 4F79A 2O9RA 2R1NA 3IPWA 4YWSA 5ABFB 5F2MA 5A95A 3MTWA 3V0UA 4D6CA 4LEQA 4BCEA 4DM2A 1QBAA 1P6CA 3RMEA 3ARVA 2FFIA 1DWHM 1JCLA 2GWNA 1VF8A 4LWWA 2FMNA 2P76A 2XH0A 4LGXA 4PA8A 4XWUA 4A2RA 1JDEA 3LGDA 2RH9A 3PWGA 1E6NA 1D7KA 1RLCL 2XM1A 3ARQA 2CKSA 4LUIA 1Q6GA 1KBIA 4ZMGA 3BGGA 3AXIA 5T9BG 2QUUA 2BHYA 1XLMA 1R86A 4AD4A 3NPWA 4QDMA 4JTUA 3SQMA 1I2RA 2WC3A 2ZUVA 2VDIA 1MSSA 4A05A 1QU4A 2BGSA 2OJPA 3LK6A 5HNUA 4AW7A 4N02A 2X0SA 3UQNA 3TC6A 3TVAA 2DH3A 7XIMA 3V36A 3PNUA 1G0CA 4GY1A 5DN1A 5JU6A 3TXZA 3LCXA 4HZ7A 1Z7AA 2C8NA 3C3NA 1OGSA 3BANA 5A6BD 1BSLA 1XLJA 3CS2A 3S5NA 3IUDA 2P0IA 4Q4MA 1JZ5A 5EMLA 4EXAA 2ZX9A 4JZ5A 3POHA 4R9XA 1B4KA 1M41A 3WEMA 2JE8A 1OD0A 4HCHA 3SCQA 2QJNA 3TJLA 4UC5A 5DXYA 5AECA 4MWAD 4UWMA 4JAWA 2J4GA 3ATYA 3W27A 3ARXA 2GDQA 2PD5A 1CYGA 4Q7NA 4GCXA 5CPTA 2DZPA 5FACA 2OOFA 3NXLA 3EB4A 2B7QA 1M01A 3WDQA 1F4HA 5I3FA 3WQPA 4DWSB 2E1WA 2B7NA 5HMDA 1XQKA 4MADA 1XFCA 3WD2A 1ZJHA 4GISA 4FLOA 4JTKA 3WJZA 3CUHA 3RG6A 3VUSA 3ZT7A 1W17A 4QEHA 3MWAA 2C14A 4JTTA 4YVPA 1OGGA 3HA1A 5LYRA 3T2QA 5JVLA 2VURA 3CMJA 1WXZA 4EVZA 2ISFA 3NQ7A 1H61A 3ITXA 2CIPA 2EG6A 4QAWA 4NX5A 3T05A 5FD0A 2PWVA 1XCXA 4DYKA 2EBNA 2YSWA 4L65A 1UR0A 3EPMA 3TEVA 1H7OA 4DAFA 4GZ7A 3NYZA 4K7YA 3MUAA 2VD8A 3GHTA 1XLFA 3TN5A 2PBGA 3VPLA 3CEPA 5C6MA 2OQHA 4UBPC 3B9DA 2NSXA 1G4PA 3L5LA 1UC4A 3H6OA 3PC0A 1BXCA 4NZ1A 4HOXA 4F40A 4M24A 1XIGA 2GPTA 3MKCA 3ZO9A 5BXTA 3PZ9A 1R30A 1OINA 5DCDA 3M07A 4UTJA 1NDWA 4O53A 3VKDA 1B2YA 2NV2A 2R14A 3U57A 2J47A 4JX5A 1FTXA 3ALGA 4NF7A 4PMXA 5HMFA 5DELA 3SUWA 4IFKA 1YNPA 4ROPA 2PP0A 4DWSC 4CQDA 1D8CA 3WKZA 2B4GA 1DJYA 2HS8A 1UZ1A 1K3UA 4MJ2A 4PMZA 4HNUA 1UJQA 3CUZA 5M03A 1NP0A 1A0DA 4QX4A 1FCQA 3W1PA 4IMGA 2X2GA 2EPKX 2PWUA 3DU0A 3NSMA 4GUFA 2OELA 4I5UA 4BFAA 3O0KA 3CQHA 2OEKA 3LM7A 5AYZA 3B0XA 1TWZA 3VKBA 3ZT6A 4EPKA 9XIAA 1MRQA 1O1HA 1OABA 4UTTA 1IHIA 1F6YA 2AGKA 4B15A 3NXFA 2I9EA 3ZXWA 2Z1XA 1OCQA 3W7JA 1CDGA 3GK0A 1EOKA 4JPGA 3ZVHA 3H53A 1U5JA 2PWHA 4I8YA 5JIPA 1VRXA 4G8TA 3UWQA 1G94A 1MI3A 3HG4A 2VELA 4KERA 3GG8A 2BFGA 4GH1A 4ONVA 4MTVA 5H91A 3T0DA 4H9YA 4FX6M 5LZLA 4Q8VA 1E6QM 2CLIA 2PDYA 1TWDA 1PYFA 3LNPA 1EIBA 2CETA 4C6MA 2FYMA 3S6TA 5MHBA 1Y8BA 1B3OA 2I5GA 5LSMA 4FXFA 3RHGA 1E55A 3C2EA 1JQVA 1O66A 4CD4A 2Z28A 4CNNA 1K7FA 3KBSA 2TYSA 3E5PA 3UCCA 3H2EA 2WJZA 1O60A 4BY3A 4NAEB 2BX7A 1NU5A 3N4EA 2PB1A 3CV1A 4JQAA 2VFGA 2ISSA 4O1EA 1VCGA 3LENA 4PUWA 4J3ZA 4F0RA 2CITA 2TAAA 4L6DA 4JCMA 2WSQA 5I24A 1XFBA 1GVYA 1E56A 3LXBA 4PBEA 4Y8FA 2R91A 1C92A 2JIWA 3NG3A 1XLIA 1WCGA 1RCQA 4IFOA 3W01A 2H9AB 2J74A 2ICSA 3MJYA 2I9UA 4EPEC 1GJWA 3GNRA 1EJRC 1CLXA 1QWGA 6TIMA 3HJZA 2PS2A 3R0KA 5CC3A 2NUWA 3B97A 1VCVA 3WQ5A 5CJMA 5CGMA 1XL9A 3GD6A 4RXGA 5C9UA 4HMDA 3WFAA 1K7XA 4F66A 5TD4A 1UIOA 1X7FA 3DHDA 1R0MA 4C6NA 4UTMA 4A3RA 3M46A 4LB3A 2J7DA 2DSWA 3GXMA 3SR7A 2HV5A 3LTYA 3TZNA 3UPBA 1RLDA 2JIEA 1ZP3A 3IIXA 4GQRA 1XUUA 2CERA 5AC7A 2V81A 4FS9A 4G2DA 4ACZB 4DZ5A 3M0YA 5G4HC 5IHSA 3W2JA 3QV8A 3PFMA 4TO8A 1YQ2A 3MMDA 1ITUA 1NWTA 3PSVA 2QDDA 1EP2A 1W5NA 3KOXA 3TJXA 4CCCA 2VZVA 2QLYA 4KWSA 3WDIA 1DBTA 4ZB5A 2Y85A 1KFKA 1O94A 1Q6EA 3T0TA 3M0LA 3S5SA 4ADSA 2GUUA 3NQGA 1V0NA 1XYCA 4AYSA 2W27A 1C8VA 3UVIA 4OIFA 4XZLX 4IUOA 3CPGA 3LV6A 4HT3A 3I6RA 2VEGA 3UWYA 1H7WA 2BY0A 3GIYA 2D2GA 3DHUA 5H2ZA 3S8HA 2E6YA 3MUXA 4H01A 5C54A 2ACRA 1OSEA 1FVPA 4PMJA 2V2CA 3TW7A 3DBNA 1FWAC 4LU0A 4X63A 3TTSA 4BS0A 2H8ZA 1KKOA 3OVRA 4YHGA 5EBUA 4BWLC 5BRPA 4IIGA 1AG1O 1YHTA 3NQAA 3VINA 3TZFA 3H70A 4PUEA 4X2RA 1K7EA 3KRSA 3WO8A 1M04A 5CGTA 2XFYA 4CNOA 1W5QA 3NL5A 4C5ZA 2DV0A 1J0KA 3O63A 1ADSA 1KKRA 1BGAA 1H0IA 3QRHA 4PMVA 1GJPA 4Z2LA 4HHLA 3IGHX 5F4SA 3BLEA 1P1XA 3WK0A 4PTDA 3WBWA 1CWYA 4HSNA 3I68A 3ZWTA 4NJGA 3URBA 5G5IA 1BF2A 4KCVA 3DN5A 4DNHA 3VGHA 4PFMA 1NEYA 3FYOA 4AEOA 1P7TB 4R33A 4H00A 2OKOA 3E96A 4LY4A 3IIVA 1F8IA 3IGSA 1ISYA 3S4TA 3U3HA 1AFSA 3GU9A 4HNVA 3APGA 1H63A 4GNKB 4JN6A 3KVLA 1US3A 1VFHA 4KF1A 3V35A 3EMZA 3G22A 3R8GA 1EZWA 2XVGA 2J78A 4IOTA 2QW5A 1E5NA 5A6KA 4MY8A 4X0NA 1OT1A 4GI4A 3H24A 3EPNA 1JYVA 2VHLA 4G7FA 3LTPA 2OLAA 1R38A 2QIIA 4ZSTA 1YADA 3G0SA 1SZGA 2D2OA 5LGXA 1JUEA 1OX5A 1YPXA 1WNOA 1UZHA 2XISA 4O1BA 3WQ4A 1WZLA 1HJWA 2A79A 4GPNA 4UQEA 4I9MA 1XBYA 3ERPA 1PCWA 1ZB5A 4D6DA 1O5XA 2P0OA 3AMLA 2WHKA 4O50A 1KM2A 2BOFX 3ZT5A 5A3HA 3G77A 4Y9AA 1B3WA 2AOSA 2Z1WA 4ZQCA 1WAUA 2I7GA 5T26A 4LCRA 2ACSA 1J2BA 5F1VA 4LVDA 4I8DA 2ZUWA 3BURA 3NPXA 3W70A 2WANA 1DWIM 1R3VA 3TXVA 2HBVA 3K4AA 3P8IA 1H41A 3VGBA 1V08A 4AZ5A 3LY0A 1ONWA 3W83A 1XX1A 4GXPA 3VILA 1HQTA 4F9JA 4EKJA 3PUOA 2WBGA 4RDVA 1EZ2A 5DT5A 4MMWA 5HUPA 1ZBVA 1UG6A 2WLYA 1VCFA 3E0WA 1LWHA 1ADOA 1ADDA 2ESCA 1QNSA 4TOQA 2R1LA 1EQPA 1IQ8A 5KITA 1JNEA 4QJ1A 3DG7A 4JFTA 1YDVA 4R85A 1EYWA 2I5IA 1UKSA 4S23A 1KRBC 1ZPTA 2WHLA 2CC0A 2C0HA 3SQSA 1OYCA 3VIKA 5A8PA 2PLKA 1JR1A 2E5BA 3V5FA 4UOQA 1CXIA 1DIDA 3ZMRA 4UTLA 4LYKA 3N13A 1TV7A 3BUVA 4BF5A 3A23A 1GKQA 2DIKA 1U1JA 4A8LA 1AW1A 3WDJA 4HPGA 2V69A 2PE4A 1PKLA 1UMYA 3PZTA 1OB0A 2X1SA 1W1ZA 2PWGA 1SMAA 4F0KA 1FA2A 1PDZA 1FWFC 1ZTVA 1FFRA 1W1B1 3S1UA 1BVZA 2VM8A 3WLIA 3EA1A 1RVKA 3UU0A 3MYPA 3T42A 1TSIA 3KAOA 1VIZA 4YTUA 3AHVA 1EJTC 4NVTA 2QIWA 2YLAA 3UR5A 3VABA 2GGHA 3ZS4A 5GNZA 4CGTA 4YWIA 3UZXA 4K1WA 4NI3A 3W4RA 4W85A 4EAYA 6REQA 2O9TA 4GIRA 1XH0A 2YYTA 4JIIX 4I6VA 2PRHA 2G3FA 4JEJA 5HR6A 4GH3A 3EOSA 1PXGA 2OQLA 5BMWA 5M5DA 3ABSA 2E8YA 3KVKA 5A8NA 2WSKA 1GZ1A 1VPQA 3OIHA 3BTNA 1KFEA 2EF9A 2WMIB 1DP0A 2ZXAA 3EBVA 3VD5A 4ZXLA 2J75A 3A3XA 3BSGA 2A5HA 3AJXA 4N0RA 4PTVA 5A6BA 3PJXA 4IMEA 3RPDA 3WUBA 4TQTA 4GZEA 3WJWA 4LVGA 1YW1A 3RJXA 2XVPA 1LL4A 1KTBA 2AAAA 4KEUA 1IR1A 2Z2AA 3QMRA 1QRQA 4QISA 2R82A 2ZX7A 5CZ0A 4GK8A 1NTHA 3K8KA 3GTXA 3PUGA 1MRAA 3RR4A 4MWAA 1GYNA 2WSRA 4IGNA 1V79A 1V8EA 3M43A 1S3HA 1SU5A 4HJWA 3N2CA 1CB7B 3GE7A 4CD8A 3VMNA 2WPGA 3EX1A 1LDCA 4KCTA 1EUNA 4RPQA 4HD5A 3M5VA 1G7VA 3FA4A 1EL3A 1RP8A 2XWDA 3UBPC 1WZKA 4Z2IA 1IEQA 2XDFA 5LIWX 1EF2A 4TV5A 3STEA 4TVUA 4JNZA 3MMTA 2JKEA 1SFJA 2ZC8A 1XW8A 3L2LA 4XVDA 5H6HA 3FYYA 3MSYA 1TTIA 1LG1A 2BODX 4QG9A 5DMNA 3TFCA 4Z2JA 1M1BA 2ZXQA 1UWQA 4WDTA 4AMAA 3RJYA 2WMKA 1PAMA 3S1VA 4DN1A 1I9CB 1ITCA 4M80A 2G96A 2OGYA 4ES4A 2WJEA 3MKVA 3K30A 5A2BA 1VJIA 4TU1A 3TOYA 4Z1BA 4ML4A 1JDFA 1JDCA 3PB2A 2VGGA 4UUIA 1LL7A 1GVQA 3VKJA 1SJDA 3KP1A 2AQWA 1H7XA 1QDSA 2V67A 2FVLA 4HK5A 3UJFA 3WN6A 3BLIA 3DCPA 3ZJ8A 3RNDA 2WMFA 2QJJA 2YB1A 2X1UA 4EF9A 4I7UA 3TONA 1FKXA 3AWOA 2NV1A 3VD4A 4KEMA 3W82A 1LOSA 2DIEA 2WNZA 3KRUA 2DVTA 5TNVA 2PTZA 3WH6A 2VOTA 3DESA 2I1OA 4K68A 1IEVA 3L65A 2WVUA 2V2HA 5CBBA 1QPNA 1YKWA 3CL6A 3ZYZA 4ZFMA 3H7UA 1LG2A 5HQLA 4F4RA 3GDKA 4YLWA 1XCFA 2PBOA 3PTKA 1UR3M 1IXNA 4ZTYA 8CGTA 3FFSA 4GIEA 4LTSA 1UR4A 2NSOA 2D0HA 2C15A 1NWUA 3IGUA 5LIUX 3W7IA 1Q45A 5A1AA 3PBMA 2G8ZA 2EXOA 1U33A 2X05A 4EPDC 4H04A 1VRDA 1UUOA 2BY3A 1TIWA 4KFNA 4LXFA 3UZ5A 1O12A 4R7JA 3B05A 1MQRA 1W9DM 3AYRA 2AL1A 1QO2A 5FKYA 4GUGA 1HL8A 1UD5A 2ZZ5A 3N11A 1V3LA 3QOMA 2XU2A 1RBAA 3QGAC 5GNXA 4H41A 1TR9A 1CW2A 3IK2A 1W0MA 3UYCA 1R2TA 4IXHA 3LCHA 2INZA 3B8DA 3WFLA 3GC5A 3NQ6A 3N04A 3KZSA 3ITOA 2VR2A 4RDYA 3M0KA 1JULA 4AIOA 1FWWA 2WW5A 3QC0A 2P3EA 4GJJA 1E6SM 3CASA 3KTCA 3FJ4A 1OFPA 4WJXA 1DJHA 4IIFA 4QCFA 3W7LA 3E9AA 3USZA 2REQA 4D6JA 5DMYA 2QV5A 1E1CB 4QBXA 3PTDA 4N9EA 2RJHA 4U5IA 5KZ6A 4EXBA 5JIWA 2E4TA 2FQIA 4KCUA 4ICCX 1LUCA 1SFTA 5H8PA 2GJRA 1NELA 1YXDA 4XV0A 4GMEA 3DC8A 1IR2A 3BWWA 3VO0A 1W54A 1ISWA 4HTBA 3IS4A 3ZSTA 1J10A 5HK4A 1F6PA 3C2FA 3SFWA 4WJEA 3OIXA 4JTEA 4JQ3A 1J96A 2YFOA 2VZUA 1F3TA 3W38A 1TQXA 5DX7A 1GHRA 2DZSA 3DC0A 3QY7A 3CZKA 2WVVB 4KRTA 2NT0A 1OK4A 1TX2A 4XKYB 3JS3A 3BOFA 3QY6A 2FLIA 2ZICA 1VBGA 4XUYA 3VVGA 3O05A 2J8GA 1ZBKA 4JGDA 1JFXA 3QTPA 3G3MA 1MXGA 1JFHA 1EJSC 4H7ZA 3EWUA 3WFZA 1DQXA 3AROA 3N2BA 2Q02A 1W3IA 3BLKA 1Z32X 3PWIA 4UTIA 4LV4A 4ZO6A 1TWIA 2RAGA 1BF6A 3EOUA 2O0TA 1K6WA 4GVGA 4LS2A 3F2BA 4R3UA 2XTKA 1A0EA 4HSHA 3KZPA 3TK7A 2IPGA 4GBDA 3U7BA 4H9MA 1NFGA 2V82A 3SSJA 1WQ5A 5F2IA 3RYSA 1BG9A 1EWDA 3ME3A 2V5CA 4O54A 1ELSA 4IIBA 3LXCA 2OX1A 3G8RA 4N9DA 1FH7A 4MJMA 2WVSA 2E28A 4C65A 4WZHA 1QW7A 3H12A 1EO5A 1JZ2A 3FJLA 2VFIA 3CEUA 4H6EA 1FWDC 4A3QA 4KPLA 5I3HA 4YNGA 2WNQA 1PS9A 4XAZA 4XZMX 1GEQA 1I2QA 3N12A 2HRWA 1Z44A 4UXDA 5E09A 1S5WA 3VE9A 1KV8A 3THQA 1SFSA 1GVFA 1A5AA 2GUYA 1TZZA 1TG7A 3IV3A 2OYKA 1LQ0A 4MF4A 2GSEA 2FH8A 1MEWA 3OA3A 1OZQA 3L23A 2Y5EA 3OVGA 3N3MA 3LYEA 5D9MA 1EJXC 4Q6XA 3QC3A 4BQ2A 4J3UA 4RNIA 5AHMA 3TIMA 1RP9A 3GBEA 2HSAA 4AHPA 3TTYA 3QFEA 3E1F1 4L80A 3NIYA 2D0FA 3SCUA 5I00A 5D32A 4JNMA 4AXKA 1XLCA 1Y7VA 2QVHA 3UYIA 3GB6A 1LWJA 3CK5A 3CZEA 1C8YA 3QSTA 3E38A 1WXJA 5MF5A 3VK5A 4ZEPA 5DQPA 1EKOA 3D3AA 3VIMA 1DJNA 4JL2A 1R87A 1RK6A 1TZ9A 1ICSA 2D20A 2PDCA 4L4OA 4NAFB 1AH4A 2YL8A 5HANA 1SR0A 1JXKA 1RXOB 5AKQA 1PV8A 2XUCA 4X2PA 2VWSA 3FVDA 2OZTA 4MKSA 4FF7A 1W8GA 1MW2A 4IZGA 1E1CA 3G1XA 3EX3A 3DZ1A 3P0WA 2JBMA 1GOMA 3JRKA 4HN8A 5C70A 1ZS2A 4LJ3A 1HP5A 3EWXA 1KTNA 3EDJA 4LC8A 2PWEA 4PMQA 4F0MA 4IP4A 3LQLA 1RHCA 4GY0A 3CB8A 3U2EA 2GOKA 4ZE5A 3N6JA 2XG9A 5DEZA 4WY0B 2CWXA 1AZ1A 1VEPA 1Q7MA 4FIQA 1SW3A 5K3VA 4GFSA 3O3RA 3QR0A 3DG3A 3GTNA 4CQ9A 1Q6DA 1FX6A 2ABAA 3LM3A 2XPKA 4MPQA 3CGTA 4DO5A 2F8QA 4REQB 2YIHA 5HPOA 3Q4DA 2XN0A 3NDOA 5I3DA 1MEIA 4MUPA 4XKYA 1SPQA 3LX9A 4M3PA 3D47A 3O16A 1EOMA 4JBRA 1NVMA 5G1YA 2ZUTA 2E40A 3SUVA 1DJXA 3P74A 3PANA 5I3JA 3AMGA 4DJFD 1X6UA 1G6CA 2Z7KA 2PDUA 2X30A 2Z27A 3QLLA 1Y0EA 2OWWA 2HK1A 2QCLA 2PDPA 4HYVA 2PDXA 2ZX5A 4PH6A 1WZAA 4AZCB 2BZNA 4LFYA 3B8UA 1OGBA 3REQA 4DXKA 3O06A 4D8ZA 2GGEA 1CECA 4NNAA 4K8HA 3B40A 4TX9A 3FGCA 3OZPA 3NO3A 4UR9A 3RGTA 1JNDA 4L1XA 4ACYA 3S5OA 1IXQA 1W3LA 3EWYA 5CLTA 1VP5A 4HIBA 3VNMA 1WV2A 1XDMA 2A3AA 4JFSA 4QG6A 4IIDA 2PDIA 4LUSB 4B5XA 2RDTA 4WEVX 5AB3A 5H8MA 3O7UA 3CL8A 1G1YA 3VC5A 1ENUA 5I3GA 3M6DA 4WOZA 4N9CA 1AW5A 3CHVA 3OU8A 3L0NA 1BRLB 1TTQA 2WHMA 4Q8WA 2C0AA 1HKWA 4KEZA 1KFBA 2NXHA 3K4DA 4QITA 3WBAA 1OWQA 1OG6A 4FOJA 5DANA 3MI6A 2V8ZA 3P60A 2XSBA 4DJED 3S42A 3GC4A 3PR2A 3GX9A 5CSYA 3DFHA 3V3WA 2W4XA 3WNOA 5G1TA 2R9RA 4LB4A 3V5CA 4JTCA 3DAQA 1I1XA 4WSJA 2BTMA 3PZUA 1V4YA 5J5RA 2ZXBA 4Y9OA 3N15A 4TTUA 1VKFA 4BI6A 4Q32A 3QFWA 4FALA 3F4CA 1R46A 1VQTA 2I14A 1EGZA 3MV01 1Z8AA 2QZRA 1G4EA 3ITLA 5FJPA 4BHYA 3RN6A 1WX0A 4O17A 3IVSA 3AXMA 1IEXA 4GO8A 3N34A 3AYSA 1W5PA 2CWNA 3WG6A 4YXGA 4PZVA 3QQ0A 1SO4A 3KBVA 3TNOA 1WKEA 3DDMA 3UJRA 1OY0A 3FLUA 1ZU8A 2PCEA 1JJKA 2QUVA 4Y90A 4C6CA 1BYBA 5EYWA 4JN8A 1FCVA 1BQGA 2VI0A 1E0VA 1XYFA 2UWFA 2VFEA 5D9PA 4AF0A 3OZOA 3R11A 1BPLB 1F8MA 1UHVA 5EA9A 3XINA 2HEJA 1LLOA 4M51A 2BGNE 1SSGA 1ZUAX 3KVMA 4AEEA 4O10A 2DZVA 2GJXA 2ON3A 4RNHA 1KLYA 3WF0A 2Q01A 3WDPP 2ZBTA 5G4EA 3OOQA 1DTNA 3NR0A 3W88A 1FXQA 4PSRA 1DOSA 1JAEA 5D04C 1B3XA 1L6SA 3M7SA 1UQZA 3HQPA 4RR4A 3UWZA 2G0WA 1JI2A 3VIIA 1D3GA 1C9WA 4IH3A 3W75A 2Z1SA 2HQAA 3AHYA 3CM4A 3G3DA 3R58A 3GY1A 2DSZA 5CAKA 4GKTA 3BW3A 3VOIA 4DQWA 2P1FA 4KBXA 3PZMA 2C18A 4AD0A 4PRTA 2ONEA 5I3KA 3HBLA 1XI3A 5C55A 3H4GA 5J5DA 4PRWA 5HATA 3CIXA 3K13A 3KBJA 3W2UA 3GXNA 4YHEA 5F2GA 5I09A 2QDHA 1K9FA 3UY8A 2ATSA 3MCOA 3LCLA 1L6YA 1I45A 4P2VA 2FZDA 3MV11 2X40A 3G0XA 4QQUA 4PCNA 3PPFA 1WAWA 2XGZA 3LPFA 2PURA 1VJSA 2CW6A 3FX4A 1VFTA 3GU1A 3P93A 4IPIA 5G2HA 1KC7A 2I17A 3R13A 4QTGA 2Y24A 2ISWA 2Q3OA 3W7CA 1B0IA 4A8NA 5HNRA 1JPHA 2QYGA 2HDJA 4IHCA 4WOQA 3URNA 4A29A 1F74A 1Q6OA 5A5WA 1GOOA 4JNYA 4H9UA 5A6AA 5A8QA 2E6AA 3DI1A 1FWGC 3FOKA 3HU7A 4UIOA 3ES7A 3T4CA 4B2DD 3TKFA 1P0NA 1VR6A 5K9XA 2HE5A 3CWOX 4CQ8A 1FFQA 1WDRA 1K9DA 4UMBA 3QZEA 4ZZ9A 2UY4A 4DF0A 2ZX8A 4QM1A 1VYPX 5D38A 4OWGA 4ZQMA 4DBEA 2PZ0A 2XM2A 3ANVA 4PCFA 1MMFA 2G4JA 4UQDA 3DFQA 2GOUA 1G4SA 4YVVA 5EBAA 3SCTA 1UH4A 1BTCA 1R7OA 4K7VA 1ITQA 1PKYA 3S2CA 5I3IA 4LVAA 2GQAA 3P61A 2Y2WA 4KH2A 1XLHA 4ZCWA 1IGSA 4DZHA 3D0CA 2VDHA 2BG5A 2X41A 5C8BB 3M16A 1C7TA 5RUBA 4JTAA 4D6EA 4Y96A 5CPLA 5ABTA 1TUFA 1DXIA 4RNJA 1WUFA 2C7FA 1G67A 1KFJA 2PWFA 3M44A 3CV2A 1V3HA 4K8GA 1YE4A 4C60A 2Z1BA 1A47A 5D03A 3TR9A 4ZSUA 4RV3A 3W00A 4J4KA 1T8QA 3CAVA 3L68A 3NEVA 5CG0A 1BVNP 3WL0A 4E2VA 2ZUUA 4ZOCA 1EYEA 4M81A 1X7IA 3UNTA 1E40A 2O9OA 2PDHA 4US6A 1KTCA 4J3XA 1CB2A 3CH9A 2WWDA 3ARYA 4JQ1A 1L2QA 1KGUA 4ZO8A 3PG9A 4K2SA 4X3ZA 3AICA 4UCGA 2CLOA 4WLCA 5HJYA 1LQAA 4GG9A 1SJBA 3WENA 1W32A 3QV6A 4WR3A 4O1AA 4ASTA 2XN1A 3BH4A 2CXEA 1W56A 4C6LA 1QR7A 4IL2A 1OQFA 3TYZA 3P14A 4WK9A 3FKRA 3UZZA 3VDGA 4K38A 3VC6A 2VZTA 3LHUA 3EDKA 1SSDA 1CENA 2R24A 2CLKA 3PZGA 2WMGA 4MOZA 3TW9A 3LSBA 1ZP4A 4D6FA 2ZRWA 3P80A 3CQJA 1PCKA 1E3XA 1M7OA 3IIZA 1BD0A 3GR7A 3QJAA 3G8EA 3AU2A 4DO6A 3MUY1 4MY1A 1X1ZA 2HVMA 3MWCA 3NPVA 3AYTA 4GOAA 4C1NA 3A4XA 3A4AA 3M5YA 1AL7A 3FK4A 5GPRA 5CZKA 1KXTA 4HN4A 3LHZA 5AHFA 4A8RA 2ZE0A 4Z42C 2GJPA 3GWQA 3V16A 4PTNA 5A8OA 3JR2A 1WOBA 3UGRA 2A3LA 4R88A 4UQCA 4AAJA 5F2LA 1XIEA 5CJ5A 2YW3A 1ME9A 1TV2A 4K36A 3PJWA 3H2OA 5LIXX 4H8UA 3DKJA 3WQ8A 4Q4KA 3N9RA 1S3TC 4UMCA 4JDBA 2EPMX 2Q71A 2VR5A 4Z1DA 4JYDA 2E67A 3GHUA 3I65A 4S3KA 3BCFA 3KHDA 3QY8A 4QNWA 3B4YA 3VIFA 3W26A 1E0XA 3H8AA 4QQ3A 1UKPA 2D1ZA 4O4WA 3F5JA 5IFTA 3KLKA 4JTSA 2Q09A 3GXTA 1PX8A 1Q8AA 3R0DA 4WY0F 1DIKA 3G5EA 4NZ4A 3SADA 5D2WA 1QBBA 4RXFA 2G5WA 2J9XA 1C8XA 2OZ0A 4BF7A 4L9ZA 1EWEA 2VGBA 3WH7A 1TPDA 3LHVA 1W5MA 3LHTA 3M9YA 1AODA 1J8VA 1GNXA 1HGYA 3WQCA 3CYJA 3VOCA 2A3CA 4JICA 2VC5A 1UWTA 3C0LA 2YOCA 4WKHA 3G0UA 3PP7A 1C9DA 1DJGA 3B3DA 3FN9A 1O6IA 2CLEA 1GQNA 2PF0A 2HWGA 4FLQA 2V63A 1I75A 1PIGA 1UQYA 4Y9NA 5EFDA 4JYFA 5K9DA 3BAKA 5KMYA 1Q6QA 3MB9A 1QNOA 3TQ0A 3H4WA 1XLBA 4O0ZA 4H6RA 3BK0A 3LU2A 2ANUA 3MANA 1YEYA 3SW6A 4IT1A 2Y61A 1LM1A 2DW7A 1HIZA 1HKIA 4QS5A 1S1RA 3CJPA 4Q6JA 2C6QA 3STPA 1QNPA 3BO9A 1F7BA 3BGJA 4L64A 3LLXA 3M0VA 3ABQA 1J18A 5AHNA 4W5UA 4B5UA 3IJLA 1UA3A 1M53A 3LDVA 1V03A 4YMZA 1A53A 1RV8A 1QOPA 2Y5JA 2QUNA 4CD5A 1ISVA 3BAIA 1REQB 4JHZA 2ABBA 4B16A 1WDSA 2WKGA 3DFOA 2QCGA 4O15A 4MHBA 1G01A 3QQWA 3GH4A 1LF1A 4KRUA 1TTJA 3N2MA 3GFYA 1P48A 2J8TA 1POJA 3K8LA 2D24A 4JTLA 2NW0A 3HPSA 1LLWA 3OZMA 4RDWA 3ZJ7A 3FY1A 2YFNA 1E6PA 1B3ZA 1DKWA 3KDNA 5JMUA 1XM3A 4FHAA 4C6KA 3TNBA 1EDTA 4W7WA 3CUIA 2YXOA 3LCFA 1POKA 1CBGA 1B4EA 1X1NA 1PO9A 2H3BA 3N1AA 1UB3A 2ZCGA 1D3HA 4S3CA 3MHGA 3OYXA 1GPWA 5BOEA 4W5ZA 2PI6A 4FR6A 2VRJA 3RF9A 6ALDA 1NDYA 4CNSA 1ONEA 2GGIA 4HCLA 4E6MA 3T08A 3WQEA 4QR6A 1Z3NA 2Z25A 4DJFA 4GLEA 3S46A 3FA5A 2VEFA 3P84A 4RZBA 2QJIA 3VGFA 1VJZA 3KBMA 2W91A 1MZHA 3WQ6A 2J24A 3CMGA 1E6XM 3GXFA 3QYSA 2WAGA 1NF0A 3UERA 1ZHAA 2WXDM 2ZUNA 4J35A 4N6FA 3V5OA 3TN6A 3SJ3A 1E4LA 4OFCA 2IXVA 3TSMA 4UQ9A 1VYRA 2OO0A 3BW2A 6CGTA 2J88A 3N6QA 2GLKA 2V9DA 2FB3A 3E49A 1ECEA 1GWJA 5A2CA 2O7SA 1UKQA 1VFMA 4XBJA 5HXMA 1FWIC 4NZFA 1UZ4A 2XH4A 3WNMA 2YBUA 3KOFA 3WBEA 3ABZA 2A6NA 5IHRA 4RJEA 2I56A 1NH6A 3C0SA 1YTEA 3W7RA 1ZNNA 2Z7GA 2XIQA 3BAXA 1YX1A 1IF2A 1QI2A 5CZSA 1RR2A 1JAKA 1XS2A 3F5KA 1UBSA 2PDQA 1R2RA 4YJ5A 1OYBA 3OGSA 4MG4A 4J28A 3B8IA 2X1TA 1X8FA 2FZ9A 4XTIA 2BB0A 1MXSA 3STCA 1ODUA 4DJEA 4J2PA 3OA5A 3EB3A 4DYEA 3ZLGA 3VDAA 3MBFA 3H2FA 1XF0A 2Y7FA 1J0HA 4ZB0A 2G41A 2XSAA 4CN6A 1UWAA 3WF1A 3ABXA 5CCZA 5KZMA 1CXLA 3G1SA 1BWVA 3A64A 2Y1HA 4DJDD 4DXXA 5DCBA 2C1IA 4K37A 1NF7A 1YBQA 4UFKA 3GTIA 3KWXA 2Y89A 5AYIA 3I4EA 1W91A 2QCFA 1F3WA 1V5XA 4MDPA 2D3LA 3EEGA 2PGEA 4US5D 4DUVA 4V1YA 1XYMA 3UD6A 1EQCA 1L8NA 3GDLA 1TX0A 1GPFA 4NRRA 2A7NA 2WSYA 1GKPA 4LW7A 4WKAA 1J79A 2VJXA 4V33A 3CHCA 3UETA 3AIQA 2Y8VA 3IANA 2CCRA 2E3ZA 4D72A 5EMUA 1A4MA 5C9RA 3FXGA 1KW1A 1AQMA 3U2ZA 4HBKA 3FHQA 2EG8A 1QPOA 4LNYA 2TODA 3S9ZA 3RO6A 5T91A 1WUEA 2HCVA 4M6VA 3K1DA 5HQEA 4L1WA 4NL1A 2CLLA 5D37A 2VFFA 1KCXA 3ZVIA 5E1QA 5LXEA 1AK5A 1V6XA 4PCPA 3I10A 1JZ6A 3WF4A 1LOLA 4IQDA 4RPPA 1JYWA 1KNWA 3A5FA 4FNUA 1Z42A 1H11A 5L9FA 1XDLA 2V3GA 3KFTA 3HV9A 1VEOA 4DWSD 1FUYA 2VR4A 4CQBA 1VLIA 2VX4A 4F3HA 1CGYA 1OFQA 2OSWA 1B90A 2ZWZA 3VKCA 2AMGA 1S2WA 1E9YB 3NQ2A 3B0VC 1M7JA 3K46A 4LY8A 4G5DA 1UP3A 2OLHA 3HTWA 4GZIA 1TWSA 4G7EB 1T6MA 5HQMA 3KUMA 5AZ0A 3CLMA 1EA0A 3EDDA 5K9CA 2HNEA 3SRKA 2OU4A 4F48A 4LNCA 1GVRA 4WDWA 2NQZA 2GGJA 2FZNA 3AIEA 5AYXA 4OGZA 2CLMA 1QXLA 1MW0A 3RLUA 2PU1A 4E3TA 3ALFA 4W4QA 4YTQA 5M3WA 1TPEA 3F2CA 3E2RA 5CEWA 1R3RA 3N29A 4JTHA 3L7RA 3BG9A 4KIRA 4H4IA 3VM5A 1S1PA 5I77A 4HA3A 1FH9A 4H9XA 3EX2A 1KB3A 4XB3A 2X2YA 4B2DA 3SURA 4P8XA 4MYAA 3GDRA 3APTA 1BKSA 4M8UA 2A3HA 2QDEA 4H9TA 1JUKA 1JEZA 4WSKA 1WP6A 3LHYA 4ZO7A 2VZSA 4RKAA 1KRMA 4OE7A 4JIPA 4HCDA 2NXIA 1E9LA 2ASHA 4XZ9A 3DFYA 5I0DA 5SWUA 1EXPA 3VZYA 1P0BA 1ONRA 3THUA 3VCCA 3B0UX 1KXVA 8RUCA 3FW6A 1HX0A 1WO2A 3VNKA 5REQA 3LD5A 1AZ2A 4JIRA 3L2MA 2DZTA 3PZNA 1PB0A 1TA3A 4L9YA 4MVAA 4S3AA 4JKLA 1LYXA 3L2IA 4AVOA 4WD0A 4A21A 2NUXA 2MANA 2HPIA 4DEFA 1WDPA 3G1VA 2E0PA 1PTAA 4YYFA 3AHZA 3WQOA 2AQOA 3WMSA 3A3WA 3HPZA 4EX4A 3G1DA 2ZYFA 4CD6A 3GZAA 4IP5A 4LRSA 4IXXA 2WHJA 1JZ4A 1EJ7L 4DM1A 1BTMA 1EH9A 4GYPA 5KEZA 2QCDB 2YA2A 5FESA 4Q8PA 3AIBA 4UFLA 1W1IE 4DAIA 4DO4A 3UG3A 4ZR8A 1MYRA 4EACA 1AJ0A 2VVNA 2DSKA 1TPC1 3TE9A 3SO7A 1HNYA 1OYAA 2GJNA 4IG2B 4O8AA 4FI4A 3SUTA 1O4UA 1TVLA 2FHCA 2RFGA 1CGXA 1SQ7A 3MDWA 1GW1A 2DP3A 1LROA 2DSUA 3QV9A 4F2TA 3ZR5A 1RCXB 4BF9A 3N17A 1JCJA 3S47A 2VQUA 1IWBA 3R12A 5KETA 4FXRA 3W1QA 4B5WA 3U4AA 1LRNA 4JTIA 4XG1A 1GORA 2OKTA 3WLPA 2UY2A 3ZFHA 2DUZA 3UR2A 1C7SA 4B5NA 3VGGA 1U1UA 5TQLA 4NUWA 4K6AA 2ZA1A 5A6SA 1YDYA 3A22A 3CTTA 3PY2A 1DWFM 4O13A 5K2ZA 1EO7A 4U10A 1MFVA 1ZLPA 4GYFA 3RCMA 3E3HA 2DZWA 3IAPA 4PRRA 3RX3A 3QYQA 1MNSA 2ZTKA 2VFHA 4GBUA 1JXJA 1FWBC 3EDEA 3NQMA 3SEPA 4B4FA 1NQKA 2WNWA 4RW5A 1HTIA 5I6SA 4CQAA 1W1TA 4LCSA 3W02A 4J40A 4U5KA 4YU1A 3SUSA 3S2NA 1XSJA 1QPRA 1FKWA 4J3TA 4AZIA 3Q45A 1UCWA 3MSDA 5BWFA 5D9NA 5HMSA 8A3HA 3LPOA 1FDYA 1ZBCA 3NQBA 4JN7A 1DJQA 4KCWA 1SZRA 4Y9PA 1IT0A 2AGTA 3L0KA 1E4MM 3IJIA 4LPCA 2WWCA 4PTMA 2WKJA 5LNWA 2WYSA 2AMXA 4B92A 3QPZA 3COTA 4S39A 1VH7A 4FO4A 1A0CA 1DWGM 3W1LA 2ZQ0A 1TYGA 2F6KA 3AMKA 1RK5A 4HQVA 3TTEA 1S39A 4AD5A 1BVWA 1NM9A 3P5ZA 2Q8ZA 4IICA 3E5BA 2Z1VA 1UOZA 1ME7A 3UPMA 3EOEA 4HA0A 1V6WA 4AVNA 2EPHA 1YYAA 3D3FA 1JCTA 1FCUA 2FTYA 4AHQA 3G2GA 1WA3A 3SCRA 5BW6A 2JGQA 1QW8A 4LS1A 1UASA 1TCMA 4B3ZA 1LL6A 3U2CA 1CTNA 4PMOA 1YXYA 1UYQA 3LBOA 3E02A 3N2XA 1Z6KA 1O5KA 4HPXA 3M47A 1IWAA 1FHDA 2VP8A 1XC6A 1KBBA 3O1NA 4DPQA 1GOWA 1W9VA 1LRTA 1US2A 2IPWA 3QHMA 1E51A 2G50A 3TAOA 2VFDA 4XQ6A 9XIMA 1H50A 1MQPA 2IPFA 4N9BA 3I4KA 3AWNA 2IMRA 4RK8A 3PJTA 3CQKA 5B7YA 1PX3A 4Q4QA 1F05A 2B81A 1AD1A 3OW1A 2F2HA 3VE7A 1CX9A 1QVBA 4JFWA 1GW9A 1H7NA 1GZJA 1VPYA 1WKFA 4LAZA 2FDSA 4AU0A 4AFYA 3UG5A 3C61A 3S3GA 4FNPA 3ITGA 1DJIA 4GJ1A 4EE9A 3T2PA 4AY1A 4NY2A 2W63A 1W2PA 1EPVA 3QXBA 4Z0JA 2DEPA 7PTDA 3C4UA 2CHNA 4CEXC 3W1RA 3QKEA 3DHFA 1HO4A 4BA0A 1XH1A 3MO7A 2DZAA 4YYCA 1QFEA 4IMCA 3DFSA 7REQB 2YX0A 3GVVA 3SCWA 3I6EA 1YTDA 3AJ7A 1N8IA 1XXXA 2EPLX 5XINA 1RY0A 1K4GA 3S9IA 1TZ7A 2HROA 3CH0A 4Z2HA 3DFPA 1YMYA 3CUGA 2TPSA 2XSXA 1HJXA 1CGUA 1D2KA 3L4TA 5LNRA 1PZ2A 2BLEA 2NZLA 5LHFA 4AIBA 1QPKA 1R9XA 3TQVA 1R3WA 2YLLA 2AL2B 4FNSA 1YDOA 3S0CA 1PDYA 2C3ZA 1TTPA 1XIHA 3C2OA 2ZUMA 3HURA 3VYLA 1THFD 5BOOA 5LIYX 4B9ZA 1U22A 1NARA 6ENLA 1R3YA 1VB9A 2A4AA 1H49A 3M41A 1U5VA 4IPNB 3L4WA 1W1PA 4R53A 1W1A1 1E6ZA 3CHEA 1PZ3A 2FTWA 1VIWA 2HZGA 2VO5A 2XIJA 3O6AA 1V0MA 5C9XA 3C2RA 3A47A 1TQJA 4MYXA 4Q8NA 3EX4A 3JUGA 5D02A 1J0ZA 2QXWA 5FJTA 1QI0A 3QR1A 4MB1A 3KS6A 1BYDA 3QH2A 3CO4A 2C91A 3FAXA 3FDKA 1X98A 1BG4A 3U5YA 4UTWA 3MVTA 1KBKA 1LCOA 1EX1A 3KL0A 3TYCA 1IZJA 1QPQA 1ZQ5A 1M6JA 2YGYA 4ML9A 4P7QA 3E74A 4H2HA 5FI8A 3GXDA 1HL2A 5FL1A 3GLCA 1KM1A 2VT0A 4RE4A 1MQQA 4X0VA 4FR1A 1EGVA 2HS6A 4KWVA 1BYAA 1UH2A 3VDHA 3EX6A 3LUTA 4V27A 5BU6A 5D2VA 3H22A 2XGBA 3UCDA 2INFA 3WBYA 1IXOA 1EBGA 1K1DA 3SN4A 4E4UA 4O1CA 2NQ5A 3A3HA 1P4CA 5FOOA 3UWUA 5AYBA 3P7YA 3ZIZA 3OLIA 4BQ3A 3CZ8A 2YB4A 5CSRA 3KHJA 3VM7A 1JD9A 3W07A 5ABFA 3HPXA 4GABA 4Z17A 3AIUA 3MO4A 4JXCA 4PUKA 4WSHA 2ISDA 2QAPA 3N18A 1JCNA 2V68A 4PMDA 5HULA 4QG8A 2QEZA 2RGMA 5FEZA 5I07A 4HK6A 4DJDA 2PGRA 4JTDA 4GIYA 4KWUA 3VIGA 2O4MA 1GONA 1VBHA 3WMBA 3GKAA 4CEUC 1CGVA 4I9AA 4GQBA 3NL6A 4US5A 4S38A 3OVQA 2E6FA 3OHIA 1FDZA 4XAPA 4EK7A 1V6VA 4WKFA 2W6RA 4GKLA 4PSPA 3QF0A 1HP4A 3B8VA 2YCLB 2Y7DA 2HPMA 5FA5A 3UVAA 1FY6A 3PNZA 2H3DA 1TPVA 3MT1A 4E5TA 3K8MA 2B0MA 3GYCA 3GNDA 5D33A 3NQCA 1IZCA 3WJYA 4NRSA 3IACA 2DPEA 1O5RA 4JQ4A 3N73A 3UGVA 1XR2A 1Y5VA 2FJKA 3WQDA 1A5MC 1JQXA 2G4FA 3K2GA 3IUHA 4IWWA 2HMCA 2QCHA 5AYYA 2ZRZA 4EXQA 5G2WA 4E4PA 3S9YA 2H6RA 3NO5A 3SSZA 1QNVA 2PF8A 2E9MA 1SUXA 3LPGA 3QVQA 4CN4A 1NY1A 3BLLA 5CC7A 1CCWB 4UTUA 1LJYA 3KX6A 2WPBA 3GS6A 4MB5A 3I7RA 3RILA 3U2OA 3TMQA 4DWSA 2A2IA 4QE5A 3IGXA 3FV9A 4H2CA 2J7GA 4AB4A 1NDVA 3GHSA 5I7GA 3WD1A 4FNQA 1H1NA 4TX8A 3PFRA 3TC7A 1OFEA 2QDGA 5LNSA 3WUFA 2DSVA 4Q7BA 3CWNA 8TIMA 2PAJA 3BSMA 1OVDA 4UNIA 3M4HA 3LPPA 3A9IA 3PBVA 2A3EA 4S3JA 4DJEC 2BGQA 3M64A 2VCAA 5CC5A 2OOGA 3RAOA 2J7BA 4J3WA 4GRSA 3SM0A 3C8NA 4Y9MA 3OBAA 1KM4A 3W53A 1HW6A 1I2PA 2QVNA 4HPNA 2D2HA 1WBHA 3LTSA 1QO5A 5DBUA 3BV4A 4D2JA 3GHRA 1P6BA 2G97A 5BWAA 1H62A 4P61A 4TTGA 3PZVA 1XRFA 1PEZA 4MJ4A 4R27A 4MFEA 5BXSA 4IIHA 2WB5A 1DHPA 3RO8A 4GWEA 1NFPA 4JKMA 4UOZA 5ECUA 3MPGA 5FJIA 4FMVA 4P7LA 2EO7A 1AW2A 2GWGA 3WUGA 1GG0A 2QUMA 3WSUA 4PEEA 2PPGA 4I9JA 2JQXA 3N14A 2I5QA 2WV8A 3O6DA 2H8XA 5A6LA 1UD4A 1GOKA 5I79A 5HDRA 2ZA2A 3W2MA 1VYSX 4C6FA 2C16A 2ZUSA 4XBSA 3OYZA 3WDHA 2WZIA 3MHFA 4KGLA 1KM3A 1OIMA 1GT8A 1SZNA 2FVKA 3LMYA 4HZ8A 2Y70A 1AQFA 3P0XA 3VZXA 4H8NA 4JTRA 1OHLA 4TVDA 3EYPA 4Q7IA 4Y6GA 1Y5WA 4OT7A 3WLSA 1T5AA 3B03A 3QOKA 5GVJA 3UG4A 3FDGA 1FWSA 1WOAA 4FNRA 4IPPA 2XVKA 2QCCA 3AXKA 4FSAA 4TVCA 1VENA 5CPNA 1U1HA 4FOKA 1K03A 3LGGA 3UXLA 1F2JA 1C91A 2W67A 3CZGA 4EWND 1A4LA 3HGJA 4J5NA 4TR9A 2GQ8A 5A94A 5BNKA 4NZJA 3PBWA 3UT0A 5FCZA 4NAEA 4TV6A 3W6MA 3SCVA 3GBDA 2Y5SA 4JIQA 4HNLA 1JL8A 2Q8LA 3RUBL 4Q8QA 3WX7A 4L6HA 2OVLA 3F7JA 4RZ5A 4BK9A 4MZYA 4MKNA 1D8WA 5C9ZA 2MNRA 3M5ZA 4BI7A 1OEPA 4C91A 2A0NA 1KR1A 3CAWA 4B5VA 4S3EA 1PPIA 1H09A 1S5VA 2V6AA 3H2MA 1IGWA 1SR9A 4W7UA 3K1GA 5G4WA 2H9AA 3MMWA 4H3DA 4Q4RA 4GI6A 4DIAA 2E77A 3GAKA 4UCFA 3W9ZA 1UBPC 2X0YA 4MY9A 4IGSA 4PTWA 4C6QA 3L12A 2J27A 5I2UA 1PHQA 4D6IA 4BWLA 2BXYA 4HA1A 2IW0A 3R8RA 3JW7A 3EGJA 4RW3A 3W2KA 3VNDA 5CQ1A 3RPMA 4PUNA 2PDMA 2E9BA 4AZHA 1UWSA 2J9ZA 3XIMA 3BICA 4S1FA 4GZJA 3WLTA 4NYYA 1E4IA 1A5OC 1YNQA 3HGRA 2HVOA 3LRLA 2BOEX 4AIUA 2BHZA 3P81A 1LP6A 1EHAA 1CXFA 1AQ0A 3VGDA 3O8AA 3KXQA 1PKNA 4AC7C 2OQYA 4YIWA 4ACZA 4JQ2A 1P5BA 1CGWA 1JRCA 4DELA 3UR7A 4J2MA 3GRIA 1KO0A 1TUXA 5D8ZA 5DO8A 4XIAA 2W61A 3NZRA 4LQ1A 5F4XA 5IBXC 1VC4A 3AYVA 3ITYA 1OF6A 4O0QA 1R2SA 2J25A 1XLDA 4WQ6A 2GVYA 3AZRA 3NSXA 4Q22A 1XINA 4GGHA 3NYDA 4AISA 4LUTB 2YXXA 1HO1A 2PP3A 5KINA 4UNLA 4X60A 2ZIDA 4HMCA 2DGAA 4HZ6A 3BVJA 2X0HA 3GG0A 3O15A 4M7SA 1QNRA 3T8LA 3GW0A 4XZNX 1UD8A 1V3KA 4GQQA 1EBHA 2RDXA 4CNPA 3F4NA 1E0UA 5MKGB 2E8ZA 3TUUA 3WNLA 4N7QA 1KM6A 1DEDA 1OADA 4ZQOA 3KW3A 5HPCA 4JHMA 3NWRA 1XC4A 5CZJA 2QMKA 3IWPA 1KLZA 3HN3A 3OG2A 1I0BA 4HVXA 1R9YA 3KDOA 1XUZA 3ITTA 3JZUA 1QWKA 3FSUA 5CC6A 2CYGA 2Y63A 4OUEA 5IDIA 1PKMA 5DLCA 1H1YA 2WZEA 3O6YX 1AVAA 2Y8UA 4HNNA 4E2OA 3DKLA 3EXSA 3H4XA 4ERAA 1R6WA 4RCXA 1LTDA 5HJLA 3M6YA 3OLEA 1P7TA 1B3YA 4CCDA 3LNMA 2W9MA 2NWRA 3MMUA 1CZ1A 1OK6A 3GH7A 2Z2BA 4NASA 2YL6A 4S3BA 3CV7A 1WBJA 3W1AA 1ICQA 3MYOA 2PC4A 3F4DA 4LBRA 4WDXA 3MW7A 3EXRA 5LKYA 3T9PA 1LBFA 2R6OA 2R1MA 4RZ6A 2J77A 3UZWA 4OZOA 1TIMA 1TO3A 1VEMA 1J0IA 3T1GA 1GUVA 4DHGA 4RE0A 2Q3RA 2GZXA 4AG0A 4MFDA 4E2DA 1DWAM 2FIQA 1T8XA 3VIHA 4HHMA 3BMWA 1S38A 1GZGA 1Q85A 4LAKA 4NXSA 3RM9A 4H8VA 1WZMA 2CBUA 2RDWA 4LVBA 3TN4A 3ZR4A 4J27A 3ZR6A 3AUJA 3QEZA 1H0GA 3BJFA 1U2YA 1LBLA 4DLFA 2A1YA 3VXGA 4XD4A 3RCYA 3AIWA 2OSXA 4D6GA 3AXHA 3G24A 2JEQA 4QLJA 1TJ2A 5EMJA 4JOMA 3GFZA 2Z00A 3ZM8A 1EC8A 4N2YA 3G1FA 3EWBX 3KBNA 1YPFA 2PZNA 2EAWA 3I7QA 5KTLA 1GQLA 1RJPA 3UZYA 4BEUA 1GQKA 3W22A 4Y2WA 1K77A 3IARA 3AZTA 3TU9A 4QJ4B 1FWNA 3OBKA 1UWUA 3PULA 4NNCA 3VOJA 4LBUA 3I6TA 5IRPA 3AMCA 2RGLA 4CU7A 5HA7A 1UMLA 4XSLA 1VS1A 3HMCA 3GSMA 3VUPA 5JH1A 4QXIA 3M5XA 4ICNA 3FJNA 1I0DA 3NZQA 7TIMA 2EEXA 2V0TA 1XIDA 5DF0A 2DQWA 4E0CA 5G1MA 1AL8A 3C2YA 1M68A 5HINA 2ZVRA 2ZVIA 3DYOA 4U3CA 1ZAJA 3HF3A 5JBEA 1CI1A 5L6UA 3VD7A 5KSWA 2WM1A 3KOYA 3ARSA 3PAJA 4ZVJA 2Y0FA 3LRMA 4IQLA 1AUSL 3OPSA 4NG3A 5DCEA 1GOIA 3R10A 2F6XA 3OVPA 3EKZA 3AOFA 3DI0A 4GC3A 4KRZA 2VX6A 4LUTA 3S2LA 3W1UA 3WIJA 4Q3MA 1HKJA 4C1LA 4HNTA 2QUTA 2QCNA 2OEJA 4A6GA 2TRSA 1A5LC 1F5ZA 3KEHA 5FF0A 4W89A 3R25A 4HZMA 3IJDA 4FZIA 1A5NC 5AVHA 3WQGA 1Q8JA 5LXXA 2G95A 4UFIA 3CT7A 1BXNA 3U9IA 3EWWA 3TN3A 1CT5A 3L4UA 1TVPA 2X8RA 3STGA 3AS3A 3GKFA 1NWSA 3P5YA 3E0LA 3JVAA 2GSHA 2DQXA 4W84A 3BOXA 3KL5A 3CIVA 5AC4A 3GUGA 2DT0A 1TKKA 2EKCA 3UZJA 3TCEA 4CNUA 2F84A 1HKVA 1NOFA 3BCDA 1TPFA 1DE5A 1EJVC 3TA9A 1GVIA 3M0MA 2ZZ3A 4YVXA 4PODA 1XD0A 4U4MA 1EFZA 2ZZ6A