5G1TA

S. enterica hisa mutant dup13-15, d10g
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
247
structure length
229
Chain Sequence
MIIPALDLIGGTVVRVVQRDYGNDPLPRLQDYAAQGAGVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIGSTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVSGWQENSGVSLEQLVETYLPVGLKHVLCTDISNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Isomerase
molecule keywords PHOSPHATE ION
total genus 76
structure length 229
sequence length 247
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5g1tA00
1HO4A 3LB0A 3PWAA 1XM3A 1VCGA 1PE1A 4GBUA 3EWWA 4NJKA 5CGQA 1A53A 1KM1A 3W7CA 3GK0A 3RNDA 1Z42A 4O54A 3NYZA 3TW6A 1WV2A 4UMAA 3LCWA 3W72A 4G1KA 3CB8A 3MI2A 3VFLA 5HWJA 2CWNA 3CWOX 2DZVA 3NNTA 4ZQOA 3T44A 3CQ0A 4MY8A 3TSBA 4LOCA 3DENA 4M7TA 4ADTA 4JTLA 4XWUA 1ZFJA 3TSDA 2GVJA 4BI6A 2FTPA 2B7NA 1TTJA 4ZQRA 1GVOA 3B04A 3KX6A 3GXTA 2YX0A 4M7SA 5KSWA 1GVFA 1VYPX 1W0MA 1SZEA 2XN1A 3W7QA 1OABA 3NDOA 4QSHA 3W7JA 1Z41A 5I3KA 4BK9A 3W1UA 3GDTA 2B7OA 1TMHA 2R14A 3HIJA 1ICQA 1YYAA 3F03K 3UQNA 3QH2A 2EF9A 5FF3A 1SW3A 1UCWA 2V30A 1G4EA 1T8XA 2A7RA 3IV3A 3INPA 3O07A 3W1TA 4XTIA 5BW6A 2NUXA 1YXDA 6ALDA 1QNVA 3ZWSA 3STCA 3BLIA 1F76A 1TYGA 2KZHA 1Q6LA 1F74A 3C3NA 1H7OA 3M1ZA 3W1QA 3ZFHA 2BLEA 5I3FA 2QDGA 1OJXA 3W6YA 2WJZA 2PC4A 3TW7A 4Z0JA 3STFA 1BWKA 1KFCA 1SSGA 4WXZA 4UUIA 3P8IA 3BG5A 5L9FA 1DQXA 3C61A 3IIVA 1K8ZA 5HUOA 3CIWA 3LM7A 3LERA 3WJSA 3PG9A 3L0GA 1ZY9A 2A4AA 5K9DA 3UD6A 5G2IA 2H6RA 3GR7A 2RDTA 3PY2A 3R5EA 1WYIA 1RQHA 3B4UA 2V5LA 3DI0A 5D37A 4YWIA 5C55A 1KBIA 1O60A 1K3UA 2EAWA 2BWGA 3MHGA 3KVJA 4OGZA 3TQVA 3W1LA 2WO5A 2J9ZA 2A6NA 4WY0A 1TRIA 5I3HA 4UFLA 1QMLA 1RV8A 4O4VA 5BNKA 1KFJA 1WBJA 2TPSA 1XDMA 1YXYA 5D2TA 2OX1A 2NZLA 3Q2DA 3NR0A 5GVJA 5H2ZA 2V2HA 2QJGA 3LXAA 4QNEA 4LRTA 4A22A 5DLCA 5EL1A 2QCDA 3HPSA 4LNYA 4O1CA 5AC6A 4YCPA 1EA0A 2DORA 3DBPA 2J9YA 3TKFA 1DHPA 4ORIA 2LLEA 3GX9A 2CFFA 1FDJA 1MEWA 2TMDA 4BF9A 1AW1A 5D2WA 3FA5A 1IIGA 4FB7A 4MJMA 3S8HA 3OBKA 1TPUA 5F2IA 5MHBA 5CKSA 1VCVA 3N9RA 3P62A 3KXQA 5FF2A 3EX4A 1LRQA 1O94A 3NZ1A 4MYXA 4JDYA 1JQVA 3UYCA 4O14A 5F4WA 1H7XA 2YZRA 5EYWA 4HIBA 4NX5A 4OT7A 2YYUA 1KM6A 4UFKA 1OFEA 4GUIA 3C4UA 1ZAHA 2ZDRA 5D2VA 2CZDA 4BFAA 3N9SA 1WX0A 1H1ZA 3HG5A 1YTKA 3MBDA 1HTIA 2RH9A 5FI8A 1G4TA 2NXHA 3M5YA 1QPOA 1EWEA 3HPXA 2FDSA 2YFOA 3TE9A 3CHVA 3THAA 1QWGA 1DVJA 5CPNA 3B8DA 4AAJA 1EB3A 3L2IA 3MYOA 1W3TA 3DKLA 1NAL1 4LUJA 1IXPA 3P74A 4QJ1A 3N14A 3EEGA 5KZEA 3O6YX 3M5ZA 8TIMA 3A21A 3PUDA 3PUEA 3A5VA 3ABOA 5BMWA 5LHEA 3TQKA 3W1XA 3KRUA 3SECA 3H55A 5K7JA 1I8JA 1H7PA 1LYXA 1TV7A 1T0OA 4GRSA 4ZQMA 2CZ5A 3UWQA 2WSYA 1KM4A 3QFEA 3NQ6A 2BTMA 4Z1DA 2PCQA 1LTDA 1GYNA 3LCXA 3GNNA 3W84A 1ZHAA 1EEPA 1OHLA 4DF1A 4O4WA 1THFD 2VEKA 3EX2A 3W85A 4M6PA 3IGSA 4ML9A 1FWNA 4JXCA 1JCJA 4WD0A 3O6DA 5E1QA 4O0ZA 3W70A 5CZ0A 4QITA 4M19A 4LRSA 3LLFA 2JKEA 3OA3A 4S2CA 4UTTC 4PTNA 1HO1A 3L66A 1AW2A 4BWLA 3P8JA 4UTKA 1XUZA 4UTLA 3SZ8A 3N2MA 2ATMA 3E96A 2Y61A 3W7NA 2VEPA 1CI1A 3DFTA 3EX1A 3W23A 1TPB1 5BMXA 1ZAIA 4POCA 2CLMA 3STEA 1P0NA 1BKSA 4DO5A 3P5ZA 4FHAA 4MLRA 3UPBA 4O28A 5HJLA 5SWUA 4DPQA 5T26A 3UXDA 3GIYA 2QCLA 3UY7A 4LVFA 2ZFAA 1JCYA 4X9SA 2E09A 3O8AA 3RK8A 4R33A 3E49A 3NPXA 4M5PA 2A5HA 1PCKA 3L9CA 2PURA 4Q4KA 4WOQA 1YTEA 2QCGA 1AG1O 2ZZ7A 2EPHA 1LZOA 2OZ0A 3OVPA 4NUWA 1QAPA 3NPUA 1EP1A 1YDOA 2NXIA 3LRLA 2QJHA 3N2XA 5KITA 1S3HA 4Z1BA 1ONRA 4N4QA 1YTDA 4IMCA 1VPXA 4JTJA 3W7LA 3S6DA 5CSRA 5AHLA 2TRSA 1DQWA 3GXNA 1OG0A 1K8YA 3EB2A 3QPYA 4R34A 5DBUA 1DL3A 4XQ6A 4NQ1A 2ALDA 2ZQ0A 3TJLA 3GNDA 3MUXA 5G1TA 2F84A 2YW3A 3W83A 4W9TA 4ORMA 1B4KA 2Y7EA 3CU2A 3EWYA 5C6MA 4K7YA 2YFNA 4Z0SA 3KFTA 4JYEA 5I3IA 3W86A 4PL1A 1GZGA 3P61A 2E6FA 3UWUA 3RLUA 1SPQA 4TO8A 3Q37A 3TJXA 3W2LA 4LWWA 2VC6A 4OU1A 4WZHA 1NF7A 2CW6A 2Y63A 3SFKA 1L6YA 3WK0A 3S9YA 1UBSA 4GXMA 1PV8A 1QOPA 3TFXA 3LDVA 4EWND 3B0VC 1H7WA 1VH7A 3W2KA 3AJXA 5KZDA 2HS6A 3IRDA 3FLUA 3BK0A 1I2OA 4L4MA 1GTEA 4HPXA 3DI1A 2WNZA 3L67A 2ATSA 3MP3A 1MXSA 3ANYA 5HINA 1SFLA 3NL3A 3C2OA 1T99A 5C2XA 2JKAA 4E0CA 2FJKA 3LBCA 3NQDA 4FEZA 3W3OA 1GEQA 1O4UA 3HGSA 2H8XA 1LBMA 1XKYA 4JYFA 1A5CA 3W1MA 2H3DA 5CZJA 3EKZA 2P0OA 4X2RA 2JGYA 4NNBA 1QPRA 2V9DA 3LCIA 4UCGA 3GXPA 4N4PA 1UJPA 4FNSA 3A23A 3GDLA 2CLOA 4JY8A 5LGXA 3LRMA 2GOUA 3CIXA 3MW7A 4MLJA 3RFAA 1R2SA 3IVTA 3LGEA 5AFDA 4AMAA 4ZQNA 2FPTA 3I6RA 3QMSA 5AC8A 1G7UA 4JTTA 4MZ8A 5D2YA 4JX4A 2YGYA 1SFJA 4UC5A 3NQVA 4MY9A 5KMYA 4P2VA 3LHZA 1GVRA 4LY8A 3HBLA 1NFBA 3EWXA 1GWJA 3CT7A 3CTLA 3FYOA 3TUUA 2YDAA 1G7VA 1TPDA 3SIZA 4OQVA 4UFIA 2NWRA 3MHUA 1FWTA 5IM51 1XBZA 4K7VA 1M7PA 2NUWA 4DBDA 3I68A 4ONVA 1V5XA 2JGQA 5FF0A 3GDRA 1H50A 1DJQA 3DZ1A 4XKYB 1FCUA 4EF8A 4JX6A 3BW4A 3NAVA 2AGKA 3GYEA 3GAYA 4JDBA 3L5MA 3NQ2A 5KZMA 2Z1BA 4MJZA 3LCLA 2OT1A 1GTHA 1WXJA 1K8XA 1L6SA 4A29A 1FWSA 5D02A 2A1YA 4I9AA 2ZYFA 4O16A 3W76A 2J88A 2QAPA 1KM2A 1W5QA 4LC8A 4O12A 3WJYA 4UTJA 5FEXA 1VC4A 5D03A 4MFEA 2ZRXA 3BG3A 4UTWA 2X30A 1TTIA 4R7JA 4XUGA 2VXNA 1VR6A 1XUUA 3SSJA 1F2JA 1KLZA 3NM3A 4HHPA 2ZRUA 5AB3A 3E0IA 1SR9A 1PL9A 3LTSA 3W9ZA 5LGZA 1JCMP 5AYZA 4WJEA 1ME7A 4PC8A 4GC4A 3I7RA 2ZTJA 1H1YA 3PAJA 1VGAA 1C9DA 1QOQA 1SO4A 3W22A 4LU0A 1OYCA 3V1PA 2B0MA 1YADA 2Z6IA 2VFIA 3LCHA 2ZRWA 1I2QA 4IXHA 2WOQA 4ADSA 4O15A 1OK4A 2W6RA 4MZ1A 2H90A 3UY8A 4ADUA 4MY1A 3O16A 3RLVA 1JR1A 4LVDA 2G5WA 4RJEA 3PBWA 3G1VA 3G1YA 2C0AA 1LP6A 2O7QA 4YCOA 3W1RA 3NOEA 3DFPA 3BPWA 1KFEA 2GUUA 1TPC1 3TQ0A 1LM1A 2C18A 5BOOA 3M44A 3HF3A 1DV7A 3O15A 4IQLA 4K37A 4JYDA 1W5OA 4N9BA 3G1SA 4UFMA 4Z1AA 2J27A 2YYTA 3PS7A 2FPVA 1XC4A 3NL2A 3ABSA 3HQ1A 2A7PA 5TQLA 3MYPA 1B4EA 1GQNA 3QSTA 5AYXA 3S42A 4KFOA 4PH6A 5LNVA 4PL2A 1P4CA 1VRDA 3F4NA 1XXXA 3KOFA 4JTEA 3C0JA 4PEKA 4JEQA 5DCBA 4AB4A 4A21A 4HNTA 1TSIA 3EXTA 3LHVA 3S5ZA 1LBFA 4HT3A 4S1FA 2X1RA 4RCXA 5HQEA 5C5YA 4IMFA 3W07A 3A9IA 2Z0IA 4DO6A 3T7VA 5D05A 5HNRA 2NX9A 3LX9A 4HPJA 1W31A 1KTNA 3LCFA 4RZ5A 5F4SA 4QISA 1XL9A 1X7FA 3IGUA 3TH6A 1N8FA 2X16A 2E6YA 3VI2A 3UZ5A 3TCEA 5HMSA 4UTTA 2V2DA 1R2RA 3IVSA 1Q6RA 3JRKA 1SW0A 2C14A 2GQ9A 5K9CA 5AHIA 4MZYA 1YDVA 1JCLA 1TQXA 4QAIA 2GVGA 1K7XA 3A22A 1MSSA 1UASA 3W7RA 1X1OA 3QMTA 4HKPA 2GPTA 3SI9A 2VFEA 4K6AA 4WY0B 1PS9A 1LRNA 2Q3OA 5G2HA 3ZR4A 4IXXA 3G22A 2Z2UA 3W7MA 4LVAA 5I3JA 4IMGA 3NPVA 1KBJA 3M9YA 2YPIA 2CZFA 1Z44A 3CC1A 3HGJA 4GJ1A 5HR6A 5AYYA 3G1FA 5D38A 3CLMA 4O13A 3EX6A 3PSVA 2GJLA 3I7QA 2ZZ6A 1VYSX 3LI1A 3G24A 1JRBA 4NJIA 1A5BA 3WFAA 3KRSA 4BI7A 4O11A 2Y89A 3NEVA 1XBXA 4I7UA 4JTIA 1IIHA 3HO8A 1GVSA 4A3UA 5KTLA 3B05A 3OIXA 2RHGA 1SW7A 4NNAA 3A5FA 1W8SA 4OWGA 2A6LA 5J5DA 3HMJG 1F05A 3DH7A 1XBVA 1XI3A 3TX9A 2ZZ2A 3W2NA 2BSLA 2QCCA 3MHFA 2DZPA 3PF3A 3V75A 5D2XA 2C15A 1MEIA 1NVMA 3DXIA 2QKFA 2VELA 4RK8A 3L5AA 3IIOA 1OF8A 2NV2A 3LTYA 3FOKA 2C13A 1AK5A 1W1ZA 3BLFA 3IGXA 1LCOA 5K4ZA 1FDYA 2FIQA 3DFSA 3TFCA 2E68A 2A0NA 7TIMA 2VEMA 3UNDA 5DELA 3UWZA 4YLWA 2EGZA 1PCWA 2YW4A 2WSQA 1FXPA 2XN2A 5F1UA 2W0UA 4YL2A 3LXBA 4UNKA 2ZZ3A 4RR4A 5IBXA 3QF0A 1IXNA 2B4GA 2QCHA 2G96A 3L21A 1WAUA 3EKLA 3W7OA 4JN6A 3DKJA 3TSMA 1FX6A 5EA9A 1TV8A 5AOUA 2QF7A 1VCFA 4UR7A 3W73A 1KFBA 3HG2A 3UWWA 2NWSA 3G0SA 4PCFA 2NX3A 5U4NA 5CPOA 3RMJA 1ZJIA 4Z08A 5AHEA 4XBKA 3KHJA 3LV5A 1B3OA 1LRTA 3G0UA 3EWBX 4LVBA 2RKXA 3U8GA 5EY5A 1JUBA 1FY6A 3QJAA 1OX4B 3IIXA 5FEWA 4KWWA 3LBMA 4HSOA 3NQMA 4OV4A 2ZA2A 1HG3A 2O7SA 4HNUA 3FIGA 2VFDA 2CU0A 1J4EA 1HFBA 5AHMA 1UUOA 4JTGA 4QIUA 1FBAA 4FNQA 3THQA 3SY5A 1SO5A 4O19A 4UFHA 1FWWA 2I14A 4FX8A 3WJZA 3QC3A 5CPLA 4LT9A 3QM3A 2ZZ1A 1VLWA 3DFNA 1H7RA 4K36A 4DF0A 3CEUA 2V5BA 1HUVA 4RZ4A 2PRLA 3BVJA 2XN0A 4MIMA 1D3HA 1VHNA 3NGJA 3W75A 1H5YA 2QDHA 4DQWA 1M6JA 1S5TA 1DKWA 3W7KA 3PULA 5A8GA 1F6KA 3O1NA 2QJIA 3O05A 3BW2A 1OYAA 3BGGA 3DHDA 3PUOA 1TIMA 3DHFA 5LNWA 1SZNA 3M5XA 4K8HA 2DP3A 1ICSA 2E5CA 4XTDA 5K2ZA 2Y70A 3LHTA 1IF2A 4DELA 2WKJA 3H54A 1RZMA 3ZS4A 3R12A 1ALDA 4XBSA 4AHQA 3NM1A 4UNLA 1DOSA 1KW1A 1FCBA 1H63A 3FFSA 3MP5A 4CCCA 2VENA 4TIMA 2QEZA 4RXFA 2YCEA 4ZVJA 2ISVA 3P84A 5K4XA 5HULA 4MFDA 3EX3A 3LOTA 3U6WA 3GZ3A 1YPFA 4S2BA 1AW5A 1MEHA 1SO3A 3TIMA 4NXSA 2RDUA 5DCEA 4GUFA 1I4NA 4AH7A 4EOUA 5CZSA 2GQ8A 1TRDA 5D04C 3EXSA 5G5IA 4AF0B 4CQ8A 3OEXA 3MP4A 3O06A 5G4EA 1DJNA 4H3DA 3UXAA 4GUHA 4ZL1A 1BTMA 4FNRA 5BRBA 1LDCA 4AWSA 4NXKA 1RPXA 3LLDA 4A2RA 1B57A 3MO7A 2E5BA 1VZWA 3OHIA 1IXOA 3G1HA 1LLZA 1VJIA 4IUOA 1GJPA 1GOXA 4FNUA 1RR2A 3MI6A 1J2WA 2VOMA 2XFWA 3S1XA 4Y8FA 4H4IA 2B7QA 3ATZA 3S1WA 3DU0A 3RF9A 3FKRA 3CM4A 3LRKA 2B7PA 4KFPA 3QPZA 3P67A 3PM6A 3JS3A 2CLIA 3EXRA 2VFGA 2A85A 3W7HA 1GVQA 2V82A 5HUPA 1ME8A 3P5YA 5CG7A 4NZFA 2ZBTA 1OFPA 3NQ8A 1YLVA 2RFGA 4OV9A 5D32A 5LNUA 3QZEA 1ML1A 4E38A 3M5VA 3LXCA 4IGHA 1JVNA 4DF2A 4JNMA 4U28A 5IBXC 4FO4A 3M47A 2GJNA 2DZWA 3G1AA 1IXQA 4IPIA 1LOSA 1EIXA 2CZEA 4O57A 2HS8A 2A7NA 1ME9A 4BR1A 1KTBA 4QM1A 3B0PA 5DN1A 1SU5A 2QCEA 4N6EA 1Z48A 4FNTA 1W3NA 1O95A 4P61A 3QEZA 2ZA3A 3LHWA 4JS3A 4ZMGA 1FWRA 6TIMA 1FQ0A 2Y85A 4JICA 1OX6A 1K03A 3SW6A 2HMCA 3NQFA 1S5WA 2E77A 2ZCGA 5FF4A 4O0KA 2Y7FA 3GKAA 2FLIA 1TCDA 2A21A 1GT8A 4FXSA 3E02A 1PHQA 3W71A 3PBUA 5K9XA 1ZCOA 3IEBA 3PC0A 3C8FA 2Y88A 1EUAA 3NL6A 3EWZA 3LHUA 3QQ1A 2PRMA 4K8EA 5TIMA 1QPQA 2VFFA 1SSDA 4X3ZA 1GYLA 3M0ZA 4ZQPA 1T96A 1RQBA 4EF9A 4CNOA 2CLLA 3IIPA 4KWVA 1YPIA 3S5YA 3CEPA 3R8RA 2VFHA 2ZZ5A 3BARA 5F2GA 1VS1A 4O8RA 4BI5A 3L0NA 5D33A 4JIQA 2ABAA 3PB0A 4MUZA 3E9AA 2Y7DA 4JTFA 2DZSA 4MKNA 4XKYA 3M43A 4IX2A 4AEOA 2ZA1A 1P0KA 4U4MA 1M5WA 4FX6M 1MZHA 1BWLA 1RQEA 3G3MA 1I2RA 4D2JA 1C29A 1ZALA 2EHHA 3TAKA 1GG0A 5DBTA 4M6QA 1TJPA 2BX7A 1GG1A 3FS2A 1LLWA 2Q3RA 1EPXA 2I1OA 4DPPA 1KM5A 1JCXA 1OFDA 2DJLA 3HJZA 3PG8A 4HSNA 1SZGA 5C54A 1KA9F 2DZXA 4JTKA 3W74A 2V8ZA 2VKZG 3NQAA 2H8ZA 2R94A 3O6CA 3T4CA 2TYSA 3FYPA 3O63A 3YPIA 2Q8ZA 4LC6A 1D3GA 3GB6A 4IPJA 1S5VA 3M6YA 3KRZA 4MVAA 4HNNA 2J24A 3WK3A 4GFSA 4K38A 3AO0A 4NU7A 3Q94A 3UZJA 4UIOA 3W7EA 2R8WA 1G69A 1W5NA 4ZQCA 5G4WA 4JTSA 1IGSA 1OFRA 5G1YA 4TU1A 4O1DA 3L5LA 2ISWA 5I3GA 3UWYA 4GUJA 1DBTA 3DGRA 3ELFA 1LROA 4GWEA 4J9JA 1DORA 2VEIA 1QDSA 1KV8A 1WOBA 2E6AA 4DEFA 4TMBA 2ZRYA 4MOZA 5F4XA 1OFOA 1RVGA 3KVLA 4FNPA 1ADOA 1A5SA 4X22A 3PBYA 4JY9A 4NJJA 3C52A 1SUXA 1M7OA 1TQJA 4C1KA 3WJXA 2Z6JA 3GDMA 2C6QA 2JBMA 4DO4A 1EUNA 1JUEA 4LTSA 4AWUA 3C2RA 2QR6A 3TAOA 3NA8A 2TSYA 1F73A 3GR8A 4MYAA 1W37A 3QW4B 4AVFA 5K3VA 1PIIA 3W2UA 4N2YA 4MPQA 3E12A 1N7KA 2FB2A 4WXYA 1PHWA 3MBFA 1XCFA 4GUGA 3NG3A 3IIZA 5FESA 4YXGA 5CSSA 4LUIA 2CLFA 2HSAA 5LSMA 3GKFA 4TMCA 4NZJA 1F6PA 3K30A 1SZFA 2A2IA 3G1XA 3OVRA 4WQ6A 3W1NA 1QPNA 4WOZA 4O10A 2P1FA 1KFLA 1O5KA 2G97A 4PODA 3NQGA 4TR9A 4DBEA 4LS0A 4NX0A 2NUYA 1VHCA 2V0TA 3FEMA 2D73A 3G0XA 2ZRVA 1A5AA 2BXVA 3STGA 5LNRA 3HGOA 3LCGA 2NX1A 3EWUA 2WPBA 4Y6GA 4UTWC 3ZWTA 4UTIA 5EBUA 1FDZA 4H6KA 2JK2A 5U7SA 3N3MA 1EX5A 2NV1A 5E93A 3QMRA 5CZTA 5DXXA 2QCDB 1EWDA 1KV5A 2J6XA 1H61A 3G8EA 3GDKA 4QQ3A 1I2NA 3W7DA 3NL5A 5DY2A 3KVMA 3HG3A 1R2TA 3QW3A 4JTHA 2OT0A 3UPWA 1P5BA 1I45A 2C1HA 4WX2A 3TV8A 1TPFA 4YMZA 1TJRA 4RLIA 3P81A 1L6WA 3VCRA 4JD4A 1VYRA 1XFBA 3VE9A 4O18A 5ABTA 2QCNA 4B5NA 3B0UX 2GQAA 4N9EA 4WUIA 1H51A 1X8FA 2FB3A 3SGUA 3T78A 3WK2A 3IVUA 2J9XA 3W2MA 1UB3A 3P7YA 4M6VA 5HWMA 2WV8A 3BGJA 4UTMA 4LV9A 2ZRZA 4Q32A 4RKAA 1TPH1 1OYBA 3DFQA 3R89A 3NQEA 3LTPA 1G4SA 2PRHA 4JTUA 3LV6A 3T55A 4GE8A 1G4PA 5LNSA 5H91A 4I7VA 1HL2A 4N9CA 1OX5A 1VQTA 3RU6A 1W5MA 2CLEA 1WOAA 4NJHA 1NEYA 3B03A 3OVQA 1OX4A 1G6CA 4JGDA 1P1XA 3FJLA 1W54A 2PE4A 1ZENA 4ICNA 3SJ3A 1GPWA 2ISSA 4AF0A 3QSRA 4QNWA 3TU9A 2YXGA 4LS2A 3MI3A 4O1BA 2WSRA 5E0KA 4LW7A 1WA3A 1NF0A 1K7FA 3TXZA 1J5TA 4KKXA 3B06A 4CNPA 4OE7A 1Q45A 1R30A 3TDFA 3L68A 3W7GA 4UMBA 1Q3NA 4HNVA 2ZZ4A 3TC6A 5KINA 1F7BA 1W5PA 4IJBA 4PA8A 4IWWA 1I2PA 2AAMA 5F2MA 3KVKA 1AL8A 4N9DA 4O52A 5A5WA 3HB9A 2F7FA 3D0CA 2Y6ZA 3W87A 2QCMA 4RZ6A 4UTUA 4JR5A 3TMQA 3W88A 1LOQA 2DZTA 1L2UA 3NQCA 4HN4A 3HOJA 1AMKA 2FQIA 4CCDA 1SQ7A 3SR7A 3MJYA 2P10A 2QUTA 4IOTA 3BO9A 1QFEA 3QRHA 4IMDA 4AHOA 4N02A 2AQWA 2WQPA 1ZAJA 3N73A 4FIQA 3HPZA 4JIPA 1A50A 1O5XA 3NQ7A 3W7IA 2X1TA 2YR1A 3PR2A 1W56A 1CW2A 3G8RA 3TXVA 1YDNA 1TPWA 2CLKA 1FXQA 2RDWA 4FF7A 5EKYA 4CLMA 3M41A 1TV5A 1TB3A 5AHNA 3WK1A 2NLIA 4NJGA 5FEZA 1N55A 3PSWA 2V81A 3TR2A 4IX0A 3USBA 4EIVA 2YSWA 1CX9A 1LORA 1G67A 1X1ZA 3VKJA 4UR8A 2E5DA 3CPRA 1FCQA 1X6UA 1OFQA 3GAKA 4Y9AA 2BZNA 2W79A 3M16A 3S1UA 3TROA 1H60A 3I65A 2R91A 3C2EA 3MMTA 2EKCA 3N19B 1F5ZA 4RX0A 3W2JA 4WY0F 1K7EA 3L65A 3DFOA 1LBLA 4RV8A 3DAQA 3NPWA 1L9WA 4DXVA 2NXGA 5L6UA 4CQAA 1QCWA 2Y62A 1XDLA 2UV8G 3GVGA 3FKKA 3BW3A 1B9BA 3VNDA 3TA6A 3U2OA 4R53A 5CPMA 5DCDA 4BWLC 3S0CA 3MWAA 3A24A 4XZ9A 5AC7A 4NT0A 3WJWA 3QYQA 3HGRA 1WDWA 1EP3A 3ABRA 4L4LA 1E51A 1BEUA 1TREA 3S5OA 5AHFA 5D09A 1R46A 5LZLA 4UFJA 4IMEA 1ICPA 5F1VA 4PFMA 2WNQA 3F4WA 1QO5A 1KM3A 3I7SA 3C56A 1QO2A 3PVFA 3HG4A 3JR2A 3CWNA 1FCVA 3L0KA 2X1UA 3TNOA 1XBYA 1V7YA 1W3IA 5D30A 2DU2A 3R2GA 4Y96A 1SO6A 1RD5A 1TTPA 2E6DA 3W1AA 3T40A 1D9EA 3N34A 3P82A 3S1VA 4K39A 3P60A 2C16A 3NXFA 3BG9A 4TX9A 1Q6QA 2CLHA 4FXRA 3LI0A 5EMUA 1OVDA 1K02A 4RXGA 1WQ5A 2C3ZA 1OFAA 2Y7GA 2FFCA 3SGZA 4JX5A 2ABBA 2QCFA 1U83A 2DZUA 1KM0A 4CQ9A 2HTMA 3C6CA 1LOLA 3R13A 1EP2A 4Z1CA 4OHQA 4A2SA 5HR7A 3UWVA 1JCNA 3ATYA 1Q6OA 5DY3A 3BLEA 2Q8LA 4O1AA 4E2DA 3G18A 3F1QA 3LHYA 1WBHA 5EPDA 3GLCA 1TTQA 1TPEA 1R47A 2JKPA 4FIRA 2IQTA 2C19A 4UTHA 1Y0EA 1JUKA 2OMAA 5AN7A 1OK6A 2WNNA 4Y90A 1JRCA 3OG3A 2H3BA 1C8VA 3TK7A 2I9EA 3ABQA 4N6FA 1TPVA 1H7NA 2OCZA 4O53A 2X1SA 1VLIA 3G3DA 1FUYA 4LVGA 4C1LA 4AHPA 1OF6A 3BV4A 3P80A 3W7PA 1H62A 1UUMA 2DJXA 3PBVA 1KLYA 3C2FA 5G2WA 4CCEA 3VE7A 4ALDA 2G95A 2GVLA 4CNNA 2QAFA 5TBOA 1NSJA 4ZZ9A 2E1DA 3H53A 4UXDA 1MO0A 2FPYA 4O17A 4UMCA 3C2VA 1AL7A 1ZNNA 4LS1A 3FJ6A 5LHFA 5J5RA 5LKYA 3KAOA 4NVTA 4O50A 1PVNA 3NVTA 1YXCA 3NO5A 3Q58A 5F2LA 1TO3A 4LV4A 3G1DA 5FF7A 1JQXA 1JULA 1KTCA 3W1PA 2V2CA 1OFBA 4OBTA 4GNJA 2QUUA 4Q33A 5HWNA 1QR7A 4I7WA 4NNCA 2OJPA 1JJKA 3PB2A 3TC7A 4FX7A 4AWTA 1KFKA 4AXKA 4E2BA 2QUVA 5FEPA 3NZRA 2ZTKA 3S5NA 3M7WA 1U5JA 2X2GA 4EVZA 3TMLA 5DXYA 3QQ0A 4KFNA
chains in the Genus database with same CATH superfamily
3SCSA 1XH2A 4ZR8A 3K4DA 4GBUA 4WKAA 2RDXA 2DV0A 1A53A 3TONA 4GISA 3RNDA 1Z42A 1QBBA 4GI9A 4Q6XA 2E9MA 4UMAA 2AL2A 3M46A 3LCWA 4YVPA 2ACQA 2EJ1A 3WD2A 4WSKA 2JALA 3VDCA 2CWNA 3CWOX 4G7EB 1VBRA 3AZTA 1REQB 3DENA 2XVKA 4ZTYA 3VOFA 2PDMA 2FTPA 3PJWA 1TTJA 3UA3A 3NEHA 1GZ1A 4YVXA 4GQRA 1OZQA 3LNPA 1V3IA 5XIAA 3W7QA 1OABA 3MMWA 4QSHA 4IPPA 4V27A 1SJDA 4D6GA 3W7JA 4R9XA 1Z41A 5I3KA 4ACZA 3ONBA 3W1UA 5FACA 3IACA 5T9CE 3LU2A 3AROA 2EF9A 4UQAA 1G4EA 1T8XA 1XX1A 4KWUA 4WDWA 2R1LA 2NUXA 4HHHA 4E3VA 1YXDA 6ALDA 5M5DA 2KZHA 2RJHA 1H7OA 5I3FA 4Q8TA 1OJXA 2J47A 4CKQA 2V3DA 1DXIA 4JL1A 1UKPA 3TW7A 3VD9A 4Z0JA 4RV3A 1BWKA 3IIVA 5GJMA 3LERA 3WJSA 2A4AA 4JAWA 3RIKA 3UD6A 1VFFA 2H6RA 1JGIA 1X98A 2V6AA 1WYIA 4I9JA 4DM1A 4PBFA 1CZ1A 1TFVA 4JKMA 5C55A 4CNSA 3HFYA 2EAWA 1J8VA 1FWDC 2NVAA 3LYEA 1TRIA 1QMLA 1QHOA 1MUWA 2QUNA 1RXOB 1SMDA 4RW3A 3P3BA 4P8WA 1HKWA 3CAQA 4PRWA 2ADAA 4H7VA 2NZLA 1AFSA 1ITCA 5HJXA 2R1MA 3WN6A 3NR0A 2QJGA 4PFHA 4ZCWA 3VA8A 5DLCA 3DC8A 3RCNA 3TLQA 4CEUC 1ADSA 1JZ2A 2Q09A 1Q4WA 1DHPA 4ORIA 4ZBCA 2OWWA 1FDJA 1GZJA 1XRTA 5FSDC 4HZ7A 1NELA 3FA5A 4C6IA 7ENLA 1B5TA 4ERGA 3G1RA 4XUYA 1UROA 1TPUA 5C2GA 5MHBA 3SQMA 3N9RA 3P62A 3GNXA 1EPVA 3N17A 1B31A 3BCDA 3UYCA 3VTRA 1H7XA 3N1AA 4PMRA 3L4UA 2XWEA 4IIHA 4Q4PA 2VR2A 1V51A 1KM6A 3CT2A 4WEVX 2VCCA 1JYNA 1H11A 1WX0A 1H1ZA 4E3TA 4OOUA 2Z27A 1NU5A 4NZ5A 2NXHA 1QPOA 2EQDA 4KBXA 1EWEA 2OPJA 3THAA 1QWGA 5RUBA 3B8DA 1KNWA 4AAJA 3L2MA 1JI1A 3VILA 3DKLA 1NAL1 4LUJA 1TWZA 4DJFA 4QJ1A 1BGGA 3EEGA 2YDQA 3L2LA 3O6YX 3OOQA 5JIPA 3PUDA 1JF6A 3PUEA 2EPOA 1OT1A 3OG2A 4X9YA 1RK5A 4ZQMA 4ZOEA 1U1UA 3ARSA 4DJDC 2BTMA 4TVCA 1GYNA 3LCXA 1QOXA 3GNNA 3PBGA 4DF1A 4S3DA 3GFXA 3IGSA 2NQLA 4JXCA 4GK8A 2IXUA 4HZ8A 1UD8A 3W70A 4XKMA 4CCZA 4LRSA 3MTWA 3OA3A 4S2CA 1CXHA 1HO1A 5ABFB 1AW2A 3T9PA 3P8JA 2P0IA 4F8XA 5A3HA 2HXUA 1XC6A 3RUBL 4K1GA 3E96A 2Y61A 3W7NA 1ZP3A 1TPB1 4POCA 3KOXA 4DO5A 3MY9A 1K9TA 1KB3A 2O9TA 3PZIA 4ATWA 1KR0A 1JCYA 4X9SA 2YA1A 2E09A 3TTSA 4B5VA 1PCKA 3IUHA 4C6DA 3L9CA 4PB3A 1AA1B 4GG9A 2PURA 3WBEA 2J66A 2QCGA 1LJYA 2OZ0A 3NPUA 1EP1A 4PCNA 2ZADA 4QG9A 3LRLA 5KITA 4B92A 5CGTA 3SN4A 1S3HA 3U4FA 2J7BA 4FLQA 4AC1X 1VPXA 4YNGA 4JTJA 3W7LA 1GQJA 2HXTA 4G6CA 3AS2A 3GXNA 1HZYA 1K8YA 3EB2A 4Y9OA 1QI3A 1OZMA 4XQ6A 1JYXA 5JIWA 1YPXA 4NQ1A 2ZQ0A 1C8XA 3JW7A 5G1TA 2YW3A 4ORMA 2FGBA 3CU2A 4M29A 4K7YA 2YFNA 2PPGA 3ALFA 2J13A 3KFTA 4A8NA 4AEFA 5GNYA 4DYEA 4HGXA 2X2YA 2DGAA 4PMVA 4TO8A 4F0SA 2FH6A 3TJXA 4YHEA 1LF1A 4L5ZA 4OU1A 3H7VA 2WAGA 4P8XA 1NDYA 4C90A 2CW6A 2Y63A 1ISXA 3TFXA 3B0VC 4V1YA 1H7WA 4KESA 5HPOA 5KZDA 2HS6A 3IRDA 5BROA 3ES8A 1EYEA 2WXDM 4QG8A 5E0CA 2WNZA 3L67A 4TTGA 2ATSA 2VL4A 3PTMA 3KS6A 5I03A 3TA9A 1QI0A 2W5FA 1GK8A 3I3BA 3HPFA 3AXIA 2H3DA 2PTZA 1DWJM 3PTDA 5FAGA 1X39A 2AGTA 1QPRA 3LCIA 4UCGA 1RHCA 1BXNA 2WBGA 1UJPA 4FNSA 1EH9A 2OOFA 2CLOA 4JY8A 1BVZA 4NRSA 1YBQB 4MLJA 1R2SA 4PUDA 2YLAA 3REQA 1AQHA 2XFRA 3QMSA 5AC8A 2YGYA 4UC5A 1BHGA 4P2VA 4JQ1A 2PI6A 4LY8A 3OVGA 1AUSL 3WX7A 1MW3A 1CEOA 1EDQA 3BLOA 3FYOA 2YDAA 3R4IA 1G7VA 4RNHA 4FA3A 3SIZA 3GFZA 4UFIA 2NWRA 1FWTA 5IM51 3TEVA 4Z2GA 4K7VA 3I68A 1UD3A 5IXEA 1V5XA 1KRCC 3V16A 1A47A 4H9YA 4Q22A 2JGQA 1DJQA 3V18A 4XKYB 4EF8A 3BW4A 1C8YA 1VKFA 3GYEA 1XLBA 1ZQ5A 4OJYA 4KS0A 4RZBA 1VBGA 1VFTA 2F6KA 3LCLA 1ZTVA 1L6SA 4ZODA 5CPQA 1V6VA 2HCVA 4I9AA 3NSMA 2QAPA 1HIZA 1S5NA 4LNCA 2YIHA 2XWDA 2PDIA 5D03A 1I1WA 4MFEA 2ZRXA 2ZUSA 4QCFA 3BG3A 1PDZA 4O8AA 4D1IA 4NL1A 5E6ZA 1VR6A 4AX6A 4DZHA 3TYBA 3NM3A 4XZBA 5AB3A 4LSBA 5LGZA 1AODA 1JCMP 3ZSSA 2I16A 2OSWA 2OR2A 4WJEA 4PYSA 3CMGA 5LXEA 4PC8A 1EJTC 3HQNA 4W86A 1PIGA 3R0KA 4LU0A 2WKLA 1OYCA 3V1PA 1S38A 2VFIA 4Q8QA 1TZ7A 1I2QA 2DSWA 2WOQA 4ADSA 4O15A 2H90A 2Y2WA 5C9ZA 2VC5A 3UY8A 4ADUA 1YDYA 1E72M 3ZLHA 5B7ZA 3O16A 3WQPA 3RLVA 3CYJA 3UU0A 4NP7A 2PLJA 4RJEA 4K68A 3OODA 1N2VA 2E9BA 2O7QA 3BOFA 5FJPA 4JIRA 1C93A 2XVNA 3TQ0A 4FLOA 2C18A 4YIWA 3O15A 3O7UA 3A13A 4JYDA 3G1SA 4HTBA 4KRTA 4UFMA 2CIPA 4GGBA 4OIFA 3MUCA 4L6HA 2D2OA 2W61A 2YYTA 2VGIA 3RDKA 3MB9A 3QBUA 2A7PA 3AIBA 5A6TC 3MYPA 5CJNA 2JF6A 2DW6A 2WYSA 1GQNA 3N2CA 3L4ZA 3GG8A 2UY5A 1E0TA 1GCYA 3GNPA 1VRDA 1XXXA 5FL1A 4JEQA 4AB4A 2VP8A 4MWAA 1YIXA 2NQHA 1YNYA 2DIKA 3S5ZA 4A6GA 4KIEA 1LBFA 4S1FA 1MFUA 3W07A 3VXGA 3A9IA 2W62A 4TXEA 2Z0IA 3RJXA 5D05A 3VGEA 5HNRA 3LX9A 4GXWA 3LCFA 3IJDA 5M1TA 4RZ5A 3W0KA 1HQTA 2HBXA 3D46A 3TH6A 3VI2A 3UZ5A 5HMSA 1J5SA 3LQGA 2V2DA 3BE7A 3K8KA 3IVSA 3JRKA 5K9CA 1U5HA 4BF5A 1JCLA 4QAIA 1J9YA 4LUTA 1K7XA 3T05A 1ONWA 3WH6A 3PFRA 5A2BA 1WDRA 3SI9A 1CGVA 1LRNA 3O0FA 3VCNA 2Z2UA 3W7MA 5CH9A 1JCTA 1FWAC 4R3UA 3KHDA 3CH9A 3L4WA 3EPOA 3WLMA 4RE4A 2BBFA 4JOMA 4O13A 2GUYA 3ZJKA 4LYKA 2ZZ6A 4NF7A 4ATLA 1JRBA 3U7BA 3LGDA 2Y89A 4I7UA 1GVSA 3B05A 3OIXA 2RHGA 1SW7A 3URQA 1DTNA 4B3LA 3UNTA 1F05A 1PEZA 2XUCA 1QASA 3APTA 1A49A 3N4FA 2ZZ2A 1HVXA 2BSLA 1LWJA 5I02A 3PF3A 4BQ4A 2E8YA 1UZHA 2C15A 5D2XA 3V75A 3EDFA 3L5AA 3VO0A 3IIOA 1FKXA 1P6BA 3LTYA 2WMIA 2C13A 4WSHA 4URIA 2Z1KA 3ZMRA 4MWAD 1HP5A 1XRSA 5DELA 3A9BA 5FD0A 1EF2A 4AG0A 2XN2A 5F1UA 5TD4A 3EA1A 1S2VA 3QFWA 2ZZ3A 1Q6EA 3CLWA 1MUCA 1LL7A 3MCOA 3QF0A 2B4GA 1QW7A 2QCHA 2ZE3A 3CYVA 1W1IE 1FX6A 1WKDA 5AOUA 3BJFA 1BYAA 3CZ8A 4ZSUA 1NQKA 3VZZA 1KFBA 1KCLA 4XG1A 4PCFA 2NX3A 5U4NA 5LYRA 3OYXA 3RMJA 2VZUA 3H8AA 3VNYA 3KHJA 1CNVA 4LVBA 3AIVA 2RKXA 4DNHA 3V4BA 3HV8A 3PZUA 1FY6A 4WIWA 2V5JA 5FEWA 4JKKA 3LBMA 3QV9A 3NYDA 5IFPA 1PKLA 4OV4A 1GOIA 2O7SA 2CU0A 4UCFA 1E43A 2QPSA 3FDKA 2OVLA 2OU4A 3THQA 4UFHA 1FWWA 2I14A 1W17A 4WKHA 3QC3A 4MM1A 1Q7ZA 3DFNA 1H7RA 2PFHA 4DXKA 4TTUA 2WZHA 2F6XA 4RZ4A 1HGYA 1YE6A 3WLJA 2OYLA 3ZR6A 4IFOA 3IJ7A 1VHNA 2BG5A 2YDSA 2CBUA 1UQZA 4PMNA 4MKVA 3EEZA 2V68A 3UF9A 5A6BD 1MUMA 1DKWA 1R9ZA 3WMSA 2Q8XA 1F6KA 3MS8A 2QJIA 2WZIA 3BGGA 3DHFA 4GY1A 4PMDA 3KEHA 1OADA 4UOQA 1AQ0A 2PLMA 2PGEA 3UETA 5CBJA 3CUHA 4DELA 1TX2A 5IFTA 3QZAA 2C91A 3NM1A 3RILA 1GJWA 1KW1A 1UA3A 1ZB5A 1V79A 4CCCA 4TIMA 2QEZA 4E8CA 3P14A 2ISVA 4DWSB 4AZHA 4ZENA 3WLRA 3E74A 5JBEA 3IS4A 2YCJA 4MFDA 3DIPA 3U6WA 3GZ3A 1TA3A 1W9DM 4S2BA 2V3GA 4K3ZA 4EP8C 4EOUA 1NY1A 4PGLA 3EXSA 3B9DA 3L4YA 4AF0B 3OEXA 4ASTA 4O1FA 4H3DA 5A2AA 3UXAA 4LQ1A 5JUVA 2W4XA 2DEPA 4H04A 3KZPA 4NXKA 1UR9A 2BVTA 3IJ9A 4A2RA 1B57A 4AIUA 2OLSA 3FW6A 2GYIA 3QLLA 2PF0A 4HK5A 4R88A 1XH1A 1GOXA 1J2WA 2VOMA 3M4HA 4Y8FA 2BHUA 3ATZA 3S1WA 3M6DA 3CM4A 2B7PA 3P67A 2DZAA 2ISFA 3SCWA 2A85A 4IL2A 4Q3MA 3W7HA 4PUUA 4D8LA 1GW9A 3A4JA 4O0QA 4DVOA 3ABXA 2ZBTA 2A3AA 2Z29A 3NQ8A 4D72A 4BY3A 3DX5A 1W6TA 1EJXC 2XVGA 4M51A 2PDNA 4JNMA 5HNTA 1XIJA 3QV8A 5A8OA 2PDXA 1LOSA 1EIXA 3CL6A 1ME9A 4BR1A 1KTBA 4QM1A 5DN1A 1SU5A 3QR0A 2PTWA 4HYRA 3CUJA 1TV2A 3UCCA 3LHWA 4ZMGA 2VMFA 4S3CA 1NH6A 1CXFA 3O6AA 1XKJA 5AECA 3NQFA 1XIHA 2CHOA 1IEXA 1PBGA 2BGSA 2A21A 1W1B1 1GT8A 3T09A 1ZCOA 3MSDA 1WDDA 2PRMA 1QPQA 3NQBA 1SSDA 3VNKA 1RQBA 2J7DA 2Y24A 1JZ6A 1YPIA 3BWWA 3S5YA 1OSEA 2WB5A 4DI9A 5CC3A 4KF1A 1IWBA 3PNUA 1VS1A 4O8RA 4BI5A 1JDDA 2YBVA 3MV01 4RNJA 4GJJA 4JIQA 3PB0A 2BY1A 4JZ5A 4HSHA 3TYCA 5GPRA 2PS2A 1EQCA 4RDYA 4AEOA 1P0KA 2Z7KA 1UJQA 5CC7A 3OYZA 1MZHA 2VC9A 5BYWA 1US3A 2ZUMA 4M6QA 2CCRA 1LQ2A 4GY7A 2QNEA 1V3MA 4EACA 1KCZA 4DJED 1IZJA 4GX9A 5C54A 2V3EA 4GABA 1KA9F 3SRFA 4IM4A 2WSPA 1VEMA 2VEGA 1ZP4A 3ZM8A 1CGWA 4EX4A 4NZ4A 3YPIA 3CV2A 4IPJA 4UQCA 3ES7A 3KRZA 2FGLA 3UZJA 2XISA 1E71M 1V77A 4ZQCA 2VDGA 1U1HA 1IGSA 2VZTA 1OFRA 5G1YA 3K2GA 1B3YA 1QI5A 3L5LA 4EPKA 1TE6A 3UWYA 4HK7A 3CZLA 3ELFA 4J9JA 5A69A 1DORA 2AKZA 1EQPA 3AXHA 1PXGA 4AUBA 3BGAA 1RVGA 4E4UA 1ADOA 3N2OA 2FKPA 4P7OA 3TYAA 3BAWA 2Y5JA 3KDOA 1TQJA 1W1A1 5LIYX 3R0DA 1FH8A 3GDMA 2QW5A 1FRBA 1FHUA 1PKYA 4NAEA 1FP9A 3WH8A 3SCUA 4L1XA 3C2RA 3NA8A 4H41A 3BAXA 3BMVA 3CPUA 1S3TC 4AVFA 4CNUA 3E0WA 2X0HA 4N2YA 1QNRA 1RCXB 4GUGA 5A8MA 3GU2A 2CBIA 5HMFA 3EGJA 1UH4A 3EMCA 2CLFA 4KEMA 2J75A 3U57A 3OVRA 3VOHA 3DCPA 1RY8A 3AU6A 3GIQA 3SCPA 3UXLA 4C1NB 3AUOA 3W1NA 4O10A 5CAHA 4PODA 2OWXA 2G97A 4TR9A 1QATA 4LS0A 2OQLA 1R87A 4NX0A 5M3WA 3H24A 2AAAA 1W3JA 3FEMA 1E4IA 5GNXA 2BXVA 5C9RA 4IISA 1L8PA 4LBRA 4XISA 2NX1A 3EWUA 2WPBA 2Y8UA 1POKA 1O68A 3NVDA 3QTPA 1XD0A 2ZXBA 4PMUA 1EX5A 1IR1A 5B80A 3KS5A 5E93A 5CQ1A 1AD1A 4MNMA 4QCEA 2QCDB 1KV5A 1T6MA 1PDYA 3GDKA 2XYLA 4R7WA 2ZX7A 1I2NA 4H8UA 2O9PA 5DY2A 3WY1A 1XG4A 1R2TA 3GW3A 2C1HA 3WBAA 2Y0FA 1TPFA 1Y8BA 1TJRA 2FMNA 4DYKA 1FFQA 1XIDA 4L9XA 4G5DA 1L6WA 3ZQ9A 1XFBA 1IEIA 4U31A 3TC3A 2GQAA 4ES4A 2R82A 1H51A 3SGUA 3S4TA 3P7YA 3BGJA 1LT8A 3L4VA 4RE2A 1CWYA 5A8PA 1LT7A 1TPH1 1OYBA 1I9CB 1QNPA 3T55A 4AEEA 4W89A 5I24A 4GE8A 1G4PA 5H91A 2Z1VA 5DF0A 1DIDA 1XLDA 1HL2A 3WQOA 4PMJA 3GM8A 4XD5A 1WOAA 1YEYA 3PHAA 3OVQA 1G6CA 2C8NA 1AZ1A 4WCJA 1TWDA 1P1XA 3EA2A 3WMCA 3SJ3A 3NZQA 1GPWA 1Y5XA 3TU9A 2YXGA 3IUIA 3GXIA 1CXKA 4OUEA 1NF0A 1WXYA 3TXZA 1J5TA 1GVIA 4DX3A 1OY0A 1J96A 4CNPA 1GOWA 3H7UA 1PZ2A 1UKQA 4DJEA 1DEDA 1NFGA 3QOKA 4IWWA 1I2PA 3D3FA 3BMWA 1AL8A 4O52A 3AYVA 3TYZA 3IANA 3WF2A 3D0CA 2WBKA 2VX6A 4RZ6A 4QLLA 1P0BA 3T07A 4IPNB 5I0DA 2FQIA 1SQ7A 3SR7A 4AY8A 1E5NA 1E9LA 2EEXA 1E5JA 3MJYA 1NWUA 1TMLA 2WWCA 5CBBA 4NIRA 3MV11 4H9TA 2QUTA 4NAFB 3TTQA 1V3JA 1KD0A 3SUTA 3LZ5A 4N02A 2MUCA 3WENA 1A50A 1OCQA 4H1ZA 3W6LA 1HJXA 3TXVA 2BMBA 1TPWA 4OBSA 1KBBA 4O1EA 2FHBA 4KCUA 5AHNA 3FGCA 4GQGA 3WK1A 2NLIA 5FEZA 1RJQA 3WBWA 5J04A 3IJ8A 1LORA 2QF8A 3UG8A 1VP5A 2E5DA 3CPRA 5JH1A 1X6UA 4ICMA 2UZ9A 3LN3A 1ITUA 2FVKA 4XV0A 4PB4A 3SBFA 2W79A 3TROA 3S1UA 4DYJA 1H60A 3MMTA 1GORA 5I6SA 1BXCA 2ZXQA 2J62A 4RX0A 4IJCA 4XBJA 1K7EA 1LBLA 6A3HA 3DAQA 3NPWA 2HDJA 4DXVA 2HVMA 8RUCA 3V5OA 3F2CA 2QIIA 2WM0A 2E3ZA 3TA6A 3U2OA 5CPMA 5DCDA 2CEQA 3VM7A 1Z8AA 3A24A 1SJCA 4JFVA 4YTRA 3FJ4A 1SMAA 1JFXA 2ZWZA 3ZLFA 2WCGA 3ABRA 1O5RA 2E4TA 4L4LA 3PN8A 5DX7A 2ZUWA 1R46A 5LZLA 1W9VA 3F4WA 1E6NA 1ISWA 3EZ4A 4ZFMA 1V8EA 1D7KA 4JFTA 4KCWA 3TNOA 4Y9PA 1XGEA 1FHLA 1KR1A 1EOMA 2DDXA 2DU2A 4Z2IA 4IT1A 3JU2A 3DFHA 1HF6A 3W1AA 2QJJA 3CH0A 2NT0A 5CJ5A 3S1VA 1W2VA 1FWCC 1S1RA 3BG9A 2CLHA 5H8PA 4JL2A 1VFUA 1AQFA 2ZXDA 2HTMA 1IEQA 4J35A 4Z1CA 4A2SA 5HR7A 1T41A 3GYCA 4MB4A 2VWSA 3G18A 2D24A 1WBHA 3WUGA 1ZPTA 4XIMA 2PEVA 2WZTA 2JKPA 1TPEA 1HN1A 1OINA 1VFLA 1JUKA 5A6LA 2OMAA 5AN7A 1OK6A 2WNNA 4Y90A 1QW8A 3TK7A 2PWHA 2OCZA 3EWCA 1VPQA 2X1SA 3UFYA 3CB3A 3S83A 3BV4A 2YL8A 3B8VA 4Z17A 5DANA 3B3DA 2DJXA 3LSBA 4CNNA 4KEUA 1FH7A 2E1DA 4UXDA 1JIBA 4O17A 3C2VA 1V0NA 4LS1A 1RBAA 4GO8A 4I5RA 5J5RA 5LKYA 4Y8EA 1PPIA 4DIAA 5F2LA 2G3JA 3H26A 2NQ9A 2P3ZA 4AFYA 4D71A 4IP7A 4ZO8A 1M7XA 4W85A 3CUIA 4NNCA 2PODA 1MRQA 1JJKA 2IPWA 1JL8A 4PTVA 2UY2A 3OPSA 2PGFA 1V0MA 4GKLA 1KFKA 2I7GA 3P93A 4UZSA 3WLIA 4IIEA 8XIAA 4HK6A 1TWWA 4DM2A 2ZTKA 3M7WA 4LBSA 4F0HA 2REQA 1CYGA 3UWEA 3WQCA 1E1CB 3VD3A 2XPKA 1RY0A 3LB0A 3PWAA 3ZVHB 4ICCX 2EPKX 3EWWA 4NJKA 5C2CA 3PTQA 4Y9NA 3CMJA 3ECQA 1ADDA 4J27A 4G1KA 2WC7A 3MI2A 5HWJA 4Q8OA 1HW6A 4PSRA 2DZVA 3TSBA 4LOCA 4M7TA 4ADTA 1A5NC 2E25A 4XWUA 1ZFJA 4DZ5A 3AHYA 3GC5A 4ZQRA 1GVOA 2YX0A 3TWBA 2Z26A 4M7SA 3H7RA 1NM9A 4DLFA 3FXYA 4GH1A 1GVFA 3UR7A 3ITGA 3SO7A 4MJ2A 2PDCA 3E5PA 4RL3A 1XLMA 3WO8A 1DJGA 4J2MA 1ICQA 1K9DA 2OX4A 2E9LA 3UQNA 2VVNA 3B8TA 5FF3A 1K9EA 1S5MA 3O07A 5BW6A 3CUGA 4HOXA 3IGHX 1D7FA 1VEOA 5DMYA 1XQKA 3ARRA 3BAIA 1IZCA 3STCA 2OKTA 2KAUC 2QDGA 4Z2KA 4DUOA 3Q45A 4BEQA 3DBNA 1P0DA 3STFA 3AXKA 3VNLA 1EGVA 1S39A 4WXZA 3DG6A 2X7VA 4C1NA 2ZC8A 3C61A 1WPCA 4CN4A 5HUOA 1B30A 2W27A 4BHYA 2QHAA 4UB9A 3VMPA 4EXBA 3RM4A 1RLDA 2VR5A 1TA3B 3GR7A 2RDTA 1KBKA 2VM8A 3EWDA 3PY2A 4GIEA 1XD1A 3OBEA 3BURA 5C0QA 1GGOA 1RP9A 1B54A 1RQHA 3CL8A 1C91A 4YWIA 4ZEPA 1UWTA 2WMFA 5BOFA 2Z7GA 2A6NA 2PA6A 3FA4A 1W91A 5I3HA 4I6VA 1MXDA 4IZGA 4QDPA 2PDFA 2TPSA 3CPGA 3WQ5A 2XZ7A 2J8GA 3HFTA 3Q2DA 3L12A 4LRTA 5BZAA 4AD1A 3HPSA 3I4KA 4LNYA 4LCRA 4YCPA 3DBPA 2J9YA 1UIPA 3ZZ1A 3KE0A 2CFFA 1PWLA 4HYVA 4DHGA 2PWGA 5JH2A 3AMGA 3F4DA 1EXPA 9XIMA 1IIGA 4NZCA 3PJTA 4MJMA 3SRKA 2VX5A 3S8HA 5F2IA 1E0UA 5CKSA 2EKGA 5FF2A 3EX4A 1LRQA 3A3XA 1JQVA 2GSJA 2YZRA 3H70A 3WLSA 4HIBA 1E40A 4NX5A 4GUIA 2HQAA 3UJFA 3C4UA 3EDEA 3AALA 2ZDRA 4BFAA 3N9SA 4G7EA 4DBWA 3OA5A 2PDLA 4M56A 1FWJC 2RH9A 4X2PA 1TJ1A 1OGGA 1XYAA 1G4TA 1X97A 1R3RA 5JBDA 2FDSA 3CHVA 3KLLA 1DVJA 3N13A 4WDXA 1AZ2A 4DAIA 3CUFA 4OKDA 4C6FA 3Q65A 3NCOA 4CD7A 8TIMA 3A21A 1DIOA 2WCAA 3A5VA 3ABOA 5BMWA 1E6XM 3FHAA 3TQKA 4QG6A 3KRUA 1HKMA 4WF7A 3SECA 3W27A 3H55A 1BPLB 5K7JA 1LYXA 1H7PA 1KRAC 2CZ5A 4PCSA 3UWQA 5REQA 2WSYA 4W5UA 1SZRA 3FK4A 4QTGA 1G94A 1LTDA 4QJ5B 2EPMX 3AAMA 2NT1A 4EK7A 1F3EA 4E4FA 3W85A 3VIOA 2J7GA 1FWNA 4KW2A 4GA8A 3T0TA 1AQMA 3AIRA 4PEEA 4O0ZA 5E1QA 3REQB 1PB0A 3IJQA 3N6JA 4UTTC 5HANA 4HMEA 2AKMA 4BWLA 4UTLA 3TLLA 3VGDA 2ATMA 1QRQA 4NZ3A 2J7EA 3R58A 1CI1A 2Y8KA 3PAOA 2ZXAA 3STEA 3EPMA 4FHAA 3II1A 2CXEA 1XIFA 4O28A 1AH4A 3GTXA 4DPQA 2VYOA 5T26A 1P43A 2QCLA 4W87A 3AS3A 3UCQA 3DG3A 4RDZA 3WH5A 3E49A 2OYKA 2GDUA 2OYMA 1AG1O 4X0VA 2ZZ7A 3XIMA 4B16A 1EJVC 4ZE4A 3OVPA 4NUWA 1V6WA 4CD8A 3QOMA 2YLLA 2INFA 5CC6A 1MXGA 2NXIA 2J79A 3KBVA 1BWVA 4DJFD 3MANA 5CCZA 2QJHA 1R3TA 1ONRA 4QLKA 1G1YA 2E28A 2OLHA 3E38A 4PN2A 4C7GA 3S6DA 5AVHA 1MVYA 3DDMA 2TRSA 3GSMA 1DQWA 3QPYA 4GH3A 4R34A 5DBUA 2CYGA 3LZ3A 2J77A 3TJLA 3GNDA 3PWGA 5C6MA 1YRRA 4JYEA 1UPMB 4XAGA 4PL1A 2E6FA 3VX0A 3V0TA 3TR9A 3T2QA 3OO2A 4PMYA 3VAVA 4F2BA 4WZHA 1T5AA 5IHRA 1GVEA 3S9YA 1UBSA 4PUMA 4EWND 3LDVA 1EDGA 1E6QM 2IS7A 3W2KA 2ACRA 3FLUA 3BK0A 4JN7A 4L4MA 4HNOA 3UW6A 1UD2A 3ANYA 1SFLA 1CCWB 1JXJA 1PJ9A 5C9UA 4E0CA 2X8RA 2PTYA 3OGSA 2FJKA 4PTWA 1LBMA 1XKYA 4N7QA 2BXZA 4H9UA 1NDVA 1PTGA 2JIWA 3WLPA 1DYSA 3WEZA 3GH7A 3K46A 3A23A 2I5GA 3GDLA 3F4VA 5LGXA 2P8BA 3LRMA 1VJSA 3FVDA 3MW7A 3PZGA 5I78A 3RFAA 5AFDA 3CASA 4ZQNA 3GVQA 3I6RA 5D2YA 1X8CA 5KMYA 3NQVA 3P0XA 4FMVA 3RAOA 1GVRA 3RM9A 2GGEA 3HBLA 1VJZA 3EWXA 3GBDA 4IGNA 4XK2A 3CTLA 1JDCA 2GK1B 2JFEX 1EBHA 2P5NA 4U2ZA 5AYIA 2G41A 2NUWA 4DBDA 4FS9A 5FF0A 3GDRA 1H50A 1FCUA 4JX6A 3NAVA 4S3BA 3ZOAA 4JDBA 2Z1BA 3DC0A 1ZJBA 1QI2A 5DRIA 3WUBA 3V0SA 2AL2B 3AFBA 2W67A 3TTYA 1J0HA 1UIOA 1FWSA 3UXKA 5BRQA 1FH9A 1V6UA 1UWIA 1O6IA 2ZYFA 1UP0A 4L9ZA 4U33A 1KM2A 4XB3A 7XIMA 3ZT7A 5CAKA 3RPTA 4C6LA 4UTWA 3NDYA 2Q02A 2DY3A 1J0ZA 1XUUA 1G9HA 4DO7A 4LX4A 4MNLA 3LTSA 1O1HA 2A3LA 3U2EA 1E56A 2F61A 1VGAA 4GVGA 3BXWA 3IWPA 1C9DA 3W22A 2E0PA 1UQYA 5EB8A 4ZSTA 3VNJA 4WSJA 2Z6IA 3B0XA 3EBVA 4S3FA 2ZRWA 4W8BA 3VNIA 2FMOA 1CXIA 1OK4A 3E2VA 4MZ1A 1MI3A 5HQLA 4K2SA 5M03A 3QQWA 3G1VA 3VC6A 2XU2A 2XSAA 4DBSA 3OZPA 5ECUA 3BLDA 4IUGA 4RUBA 3DFPA 1KFEA 1M3UA 3AYSA 4JFSA 1TPC1 1XDJA 5BOOA 2D23A 4D6CA 4Q7NA 4IQLA 5BWFA 4ZXOA 3MT1A 3AWOA 2J27A 1XYMA 3PS7A 2FPVA 1XC4A 3QTGA 3HQ1A 1WB0A 4DRSA 1Y5WA 1ZBKA 3QSTA 1DWAM 2OELA 4KFOA 5FKYA 3G6MA 1M01A 3KOFA 3C0JA 1R5YA 3LHVA 1DWHM 1TJ2A 1NP2A 4HT3A 4TX6A 1ENUA 4RCXA 5C5YA 4C6BA 5EMLA 3T7VA 3AIEA 4NRRA 2XM1A 1R3WA 1KTNA 2PC8A 1E6PA 2X16A 4KT2A 4KEZA 2E67A 1KO0A 3TP4A 3TCEA 4J1OA 3CWHA 4MWAC 3UERA 1Q6RA 2ACUA 2C14A 3WNPA 3LENA 3P6LA 5KZ6A 4MZYA 1YDVA 2Z4GA 3DYOA 1TQXA 3HU7A 1JPHA 4MADA 3WQWA 2O92A 1MSSA 3W7RA 4LUSB 2P3EA 1BRLB 2VFEA 3LPPA 2PU1A 1PS9A 3L4XA 4LVAA 4IMGA 1TR1A 3NPVA 2UY3A 1PAMA 1O7AA 1PZ1A 1ITXA 3MO4A 4WLCA 2YPIA 1Z44A 5HR6A 4XAZA 4K8GA 5D38A 4W7VA 1TZ9A 3EX6A 1J79A 2CKRA 3TNBA 1Q13A 3I7QA 3U5UA 3TYEA 4NASA 3QY6A 3WFAA 3EOSA 3MVIA 1XBXA 3MVTA 4JTIA 4DUWA 4A3UA 4Q4MA 4IL0A 3A5FA 1W8SA 3GC4A 2A6LA 3HMJG 4QE5A 1XBVA 1XI3A 3PPHA 3W2NA 3FNDA 2Z00A 4GX8A 3VZYA 2X40A 4HA4A 2F38A 1U5VA 4I9TA 2PDPA 1OF8A 3T4WA 1AK5A 1W1ZA 1A3HA 2QMJA 3CQHA 5AY7A 4F0RA 1J0IA 1UZ1A 2WVVB 3VDBA 2BS9A 4INFA 2IKJA 4PMQA 2GJXB 4YLWA 3A4XA 4B15A 1PCWA 2YW4A 3QVQA 2WSQA 4QLJA 1U2YA 4YL2A 3LXBA 4GZJA 1FVPA 4GVFA 3QR3A 2GVEA 3TN5A 1Q85A 3RU8X 2G96A 2IW0A 3L21A 1WZKA 3EA3A 4JN6A 2R9RA 4L6DA 3TSMA 2QF7A 1JGMA 3ZVIA 4DBUA 2OKOA 4U3CA 4PUEA 3N12A 3HG2A 4I5XA 1BF2A 2DUAA 3G0SA 1ZJIA 3A64A 5IDIA 1Z69A 2PGRA 1EGMA 3EWBX 3U8GA 1VB9A 1JUBA 3NIYA 1FWEC 4YYCA 3UJ2A 1UWQA 4H8VA 1E6RA 1XYBA 2P8CA 3OW1A 4HSOA 3NJ3A 2VFDA 4E2VA 1J4EA 1JDEA 1HFBA 1UUOA 3DECA 4G9PA 1FBAA 1TIWA 2VUNA 4LT9A 1VLWA 3KTXA 4GXPA 4K36A 4DF0A 7CGTA 1UZDA 3CEUA 1HUVA 3BVJA 1GOOA 1PIFA 1IHIA 4GLEA 1IGWA 1ZS2A 2WM1A 4PB5A 3SDOA 2QDHA 1M6JA 2VRJA 2DT3A 1EJ7L 4XZNX 5A8GA 1JD9A 1LG2A 1W9XA 1XCWA 3N4AA 3O1NA 1TIMA 3M5XA 3BCJA 1UC5A 4GIYA 5K2ZA 3LHTA 4MWAB 3C2YA 3H54A 1RZMA 5AZ1A 1PTAA 1DOSA 3H2AA 1H63A 1A0DA 2OB3A 3BH4A 3SURA 4F79A 2VD8A 4ZVJA 2JF7A 3RPMA 3W6MA 3WD0A 2CETA 1IT7A 5C7HA 5JVLA 2H9AA 2YA0A 1AW5A 2G0WA 2RDUA 1M53A 2PLKA 3BAYA 1CT5A 4P7NA 5CZSA 1ONEA 3GHTA 3CTTA 4H9VA 5D04C 5G4EA 1DJNA 1U1JA 2REQB 1JDFA 2WKGA 5BRBA 2X0YA 4CUCA 1ZBWA 1DE5A 1H0GA 3MO7A 4Q8WA 4WJXA 1VZWA 3OHIA 1F4AA 1IXOA 1LLZA 3PZVA 2BGQA 2QULA 4IUOA 1RR2A 3MI6A 4I8DA 4WKFA 4H4IA 3DU0A 3RF9A 3LRKA 4REQB 3I3EA 2Q01A 4IIBA 2V82A 5HUPA 1A4MA 5FIPA 3P5YA 5A6BA 4OV9A 1YLVA 5AKQA 2WVTA 3LXCA 1JI2A 3WELA 2E8ZA 5EU9A 2YBTA 4HD5A 4DF2A 3TJIA 3CL7A 4OTKA 3CZKA 3OQEA 4FO4A 1Z7AA 2DVTA 4MNJA 2DZWA 5A6MA 2XZ9A 4H2HA 5FOOA 3T8QA 4O57A 3ZSTA 4BJHA 5C9WA 3B0PA 3PZQA 2ZIDA 4JFUA 3BUVA 3LY0A 1MNSA 1W3NA 5IOBA 4NYUA 3ME3A 2BVWA 4E8DA 1QI4A 5E70A 1OX6A 1P7TB 1TVPA 3SW6A 4MDPA 1S5WA 5HK4A 4LUTB 1S2WA 4LJ3A 3GH4A 5FF4A 3RCYA 4O0KA 2YDRA 1JYWA 2YA2A 3VC5A 4FXSA 3PBUA 3C8FA 4KEVA 2C1IA 4LY4A 1EO7A 5FJOA 2VFFA 3SEPA 2CLLA 4KWVA 3F5LA 1Q2RA 4HMDA 3THDA 2VFHA 2ZZ5A 5F2GA 3SIMA 3R6IA 4MUZA 1NWRA 2WPGA 1SFSA 4JTFA 4J3SA 2FGZA 4AZIA 5ECVA 1KBLA 4U4MA 1A5MC 1M5WA 1I0DA 3G3MA 1ZALA 4NKCA 1LQAA 3UR5A 1GG0A 2DQWA 5DBTA 1EHAA 1PWMA 1TJPA 3SY1A 4YJ5A 3LS9A 1A3XA 3NUKA 4EANA 2J7CA 3VOCA 4ERAA 4DPPA 2XG9A 1SZGA 4JTKA 2D3NA 5C7VA 5FAJA 5C70A 1HJQA 3FXGA 3NQAA 2H8ZA 2R94A 3T4CA 4LUYA 3OTRA 4LC6A 1D3GA 3GB6A 1S5VA 1UOZA 1J12A 1L0PA 2PDYA 4HNNA 3C0SA 4L7ZA 4YWSA 4OBRA 1EYWA 5CJMA 4JTSA 1N82A 4TU1A 1XLEA 5I3GA 4GUJA 1A4LA 1K1DA 3TVAA 2YBUA 3LPFA 3QLDA 1KV8A 1WOBA 2E6AA 3N25A 1W3KA 5F4XA 1BD0A 3PBYA 4PBEA 4GJIA 1SUXA 1M7OA 3DEQA 2IPJA 1OC7A 5IHSA 2JBMA 4DO4A 1JUEA 3A3HA 1NDZA 2OOGA 1KWGA 4EWJA 3TAOA 2TSYA 5K3VA 4MPQA 1N7KA 2D1ZA 2NLYA 3CV1A 3MBFA 1LWHA 5HPCA 3KTSA 1XCFA 5D9PA 1J0JA 2YKKA 3NG3A 3IIZA 3OLEA 1TELA 3U5YA 4AZCB 1JEZA 4FF5A 3GKFA 4TMCA 4NZJA 4IGSA 3G1XA 3OZOA 2Z1SA 4WQ6A 3AC0A 2E40A 4GI6A 3RITA 3W38A 4WOZA 1KFLA 3S2JA 1E15A 1W9PA 3UBPC 2XSBA 1P7TA 5EFFA 3WF3A 1VHCA 2I56A 5HXMA 2QQ6A 3WQVA 3G0XA 2XHYA 3STGA 3CUZA 5A8QA 2PUZA 4QRNA 4AZ5A 4OECA 5FJTA 4E8GA 1EGZA 4H6KA 1H41A 3THUA 3T08A 3AQUA 2NV1A 2G3MA 3ID7A 1XRFA 5CZTA 3RRXA 1S1PA 2OQYA 1AJZA 2I5QA 2J6XA 2P88A 1H61A 2F8QA 1HGWA 2FFIA 1PX8A 2VZOA 3NL5A 3GVRA 4NAEB 2VGBA 3D5HA 4AZCA 1KC7A 2OT0A 1TMQA 3UPWA 3WH7A 4UQDA 4YTTA 4HYWA 4J5NA 3FAXA 3QY7A 3VCRA 4BA0A 1AJ2A 3MKVA 1OIMA 2QCNA 3B0UX 3R11A 3F4CA 4N9EA 4B2DD 4WUIA 1X8FA 4LB3A 5EGRA 3IVUA 1UB3A 4M6VA 3MUAA 3UZYA 1OCBA 4GKTA 4J7RA 1BYBA 4UTMA 4LV9A 3ITCA 3SY8A 2ZRZA 4GINA 3FEQA 2EXOA 1NWSA 3ORWA 1G4SA 2OEJA 3H6OA 1UH3A 3O9NA 3R7MA 4I7VA 4FSAA 1OT2A 3PZ9A 2WMKA 1W5MA 2CLEA 4NJHA 3W25A 1DWFM 2F6UA 2EG7A 2PE4A 3APGA 5BXPA 1GQKA 6REQB 4AF0A 1PZ3A 4QNWA 4Q8UA 4LS2A 4O1BA 3SGGA 4N42A 3ITLA 4UQEA 1K7FA 4MUPA 3LPGA 2VNCA 4KKXA 3B06A 3AWNA 2G4FA 2CPUA 2D0FA 2DT1A 1R30A 3L68A 3W7GA 4E4PA 3TCSA 4HNVA 2ZZ4A 3R1ZA 4PA8A 2J4GA 4KETA 4AY1A 2MANA 1FA2A 4N9DA 4DWSC 4UQ9A 5A5WA 3HB9A 3ISIX 5E0FA 2QCMA 4UTUA 3N6HA 1A0EA 1LOQA 2DZTA 4M0XA 2XGZA 2BFGA 1OCNA 2P10A 3TTOA 2ZOXA 4H7ZA 3JZUA 3EPNA 1OGSA 4AHOA 4HPGA 3N73A 2PD5A 4FIQA 3HPZA 3KWXA 4JIPA 3VYLA 3NQ7A 1XS2A 1W56A 3WH9A 1BAGA 2GJPA 3O3RA 1CTNA 2CLKA 2C71A 1TE1A 4B2DA 4C6PA 1XIEA 3PJXA 2RGLA 5EKYA 3M41A 4NYYA 1TV5A 3NO1A 1YE4A 4JTQA 3CS2A 1C90A 2P50A 5AC4A 3ZJ8A 3PSWA 5DQPA 1DIKA 3USBA 3GZAA 1CX9A 3NDZA 3KCJA 3VKJA 4UR8A 4XX6A 3GAKA 4RDWA 3M16A 4MB1A 3I65A 4FXFA 3N19B 4JFWA 3W2JA 3L65A 2XDFA 3K8MA 4RV8A 4G8TA 4CQAA 1CPUA 2Y62A 1Z3NA 2UV8G 4EPBC 3GVGA 2QZRA 3ITVA 4ILSA 1H4PA 2WHMA 3W24A 3AMLA 3ZYZA 3S0CA 2G3FA 3GUWA 3MWAA 3QYSA 1RK6A 1TV4A 4KGJA 5FJUA 1XLIA 3IARA 4JIHA 1E51A 1TREA 2EPNA 3VMOA 1ICPA 5F1VA 4W7WA 3WDPP 1KM3A 1RSCA 4REQA 3HG4A 2X1UA 3D6NA 1ISZA 2FZ9A 1W3IA 3R2GA 3I6EA 3VIHA 4Y96A 1RD5A 2ZX6A 3H2EA 1OQFA 4WGHA 3T40A 1D9EA 4DAFA 2OZ8A 1HL8A 2HK1A 4M6UA 1XISA 4JIEA 3SCNA 4TX9A 5G1MA 1BTCA 5EMUA 1OVDA 4RXGA 1OFAA 1XGDA 2Y7GA 2FFCA 1JAEA 2QCFA 4PBGA 3BC9A 1R86A 1US0A 1TR9A 2D0HA 4CQ9A 4R9OA 4C6NA 3SADA 1M7JA 3GNRA 4D8ZA 1OM0A 3ATYA 5DY3A 3UWVA 4O1AA 2AMGA 3LSCA 3PANA 5TAOA 4HQVA 3F1QA 3LHYA 1W1YA 3GLCA 1TTQA 4MAVA 4DWSA 3PZMA 3MDUA 1BYCA 1W9BM 1XLGA 2IQTA 2C19A 1OG6A 1Y0EA 5HJYA 3BTNA 1QTWA 1JRCA 1NFPA 1C3FA 1ECQA 1X6NA 3OG3A 3U2ZA 2H3BA 3ZO9A 2VRQA 3BZGA 1TPVA 1TVNA 1I75A 4O53A 4QBXA 3WYZA 2I57A 4AHPA 4W8AA 3M7SA 3P80A 4QE4A 2NQ5A 3PBVA 1KLYA 3C2FA 1EFZA 4CCEA 5GNZA 2G95A 3SAZA 3N04A 5TBOA 2FHCA 4HP5A 4ZZ9A 4PE8A 2FPYA 4P7QA 3SCVA 1EBGA 1AL7A 5A1AA 5LXXA 5LHFA 5F7UA 5D9MA 4NVTA 2YCIX 4O50A 1SGJA 1PVNA 1CGXA 1TO3A 1WKYA 1UW9A 4PRRA 1JQXA 1JULA 1LQ0A 2WZMA 2QUUA 5HWNA 1QR7A 4I7WA 4OVXA 3HMCA 1SJAA 2OJPA 2W66A 4M3PA 3SSZA 4JPGA 3MSGA 1IR2A 2XFYA 3TC7A 1G5AA 3S6TA 4AWTA 2GLKA 4AC7C 1VBJA 4GIRA 3GHRA 4AXKA 3R94A 2OLAA 3GY1A 2X2GA 3AHVA 3DUGA 4L4PA 4E2OA 5DXYA 1HO4A 3VGHA 4Z2HA 1VCGA 4ECLA 1Z6KA 3NURA 2OODA 2QIWA 5CGQA 1JPDX 1KM1A 4TV6A 1FWIC 2PTDA 2BY0A 3QGAC 4J28A 3T81A 5D8ZA 2NVDA 1BVWA 1UR3M 3NYZA 3TW6A 1WV2A 4GOAA 3W72A 2FZBA 3CB8A 3WQGA 2FJUB 3KLKA 3WMLA 3NZPA 1XSIA 3JUGA 3CQ0A 4LXFA 4QJ3B 4GNVA 4JTLA 3TSDA 4BI6A 2B7NA 1EJUC 4QDMA 3EDDA 4C6QA 3KX6A 3GXTA 1XFCA 2IKIA 3CHDA 2DW7A 5KSWA 1VYPX 4QXIA 1SZEA 1R9XA 3T42A 4JEJA 1E6ZA 4BK9A 5D9OA 3H12A 2B7OA 2QUMA 1TMHA 3HIJA 4GACA 3EDKA 3PK7A 3F03K 4IGMA 3QH2A 1V4YA 4AZGA 1X6LA 1SW3A 2V30A 2NW0A 2H9AB 4Q4SA 3W1TA 3WDJA 3TTEA 2GOKA 4KGLA 4R5EA 5LA0A 3ZWSA 1F76A 1TYGA 1Q6LA 3C3NA 3M1ZA 3W1QA 1E1EA 2BLEA 4H9ZA 3W6YA 2WJZA 5XIMA 2OWCA 2O56A 4FAMA 4H6RA 1VFSA 4I6KA 1DXFA 4I5UA 3P8IA 3BG5A 5L9FA 1DQXA 4R27A 3PPFA 3SUVA 5HATA 3AU2A 3SCRA 4I90A 4IQDA 2Z1WA 3PG9A 4C6KA 3L0GA 1F61A 5K9DA 3ARXA 3H21A 5G2IA 2YB4A 1UWSA 3R5EA 2PDBA 1WUEA 5D37A 4R85A 1KBIA 1K3UA 3H2OA 2BWGA 3KVJA 3TZFA 3TQVA 4PMZA 3W1LA 2J9ZA 1XSJA 3DESA 4AWEA 4Z1YA 1JZ3A 4D8AA 4O4VA 1WBJA 2CHNA 4AZ7A 1WP6A 4BZYA 2OX1A 5ABEA 1T8QA 3P2VA 1AH3A 5H2ZA 2V2HA 3LXAA 4QNEA 4A22A 5EL1A 3GR4A 2IPGA 2BHZA 2Y1HA 1JZ5A 4O1CA 3GU1A 5AC6A 4Q4OA 3H4XA 1EA0A 2DORA 5EMMA 3TKFA 4YS1A 2X41A 5DMLA 1U33A 1MEWA 3CIVA 1S2AA 4LYRA 4LCSA 3GW0A 1PX3A 1AW1A 5D2WA 2VHLA 4FB7A 2DVUA 4RNIA 4S3AA 2QDEA 4TV5A 1Q65A 3OIHA 2PDQA 1V93A 3KXQA 3NZ1A 1O94A 3VKAA 2DSUA 3E1F1 4MYXA 4AU0A 4JHMA 5F4WA 4PMXA 3WG6A 4BQ3A 2X09A 5EYWA 4P7RA 1IV8A 2YYUA 4PCPA 3WDRA 1V3LA 4L4OA 1U22A 1GKRA 4A3QA 2DUZA 4LF1A 3HG5A 1YTKA 1HTIA 3UVIA 5FI8A 1F3WA 4KWSA 3M5YA 2IKHA 2OZ3A 4W8LA 2YFOA 3HQPA 4CD6A 5CPNA 1A5LC 1EB3A 3W01A 1G01A 5HMEA 6REQA 3GD6A 2C79A 3SB0A 1IXPA 5BXSA 1JDAA 3N14A 3AXXA 1R7OA 2YJQA 5KZEA 2VGFA 4WRHA 1RH9A 5LHEA 4GZEA 3UR8A 1Q6FA 1I8JA 4GRSA 1T0OA 1BVNP 3VDGA 3K1GA 3NQ6A 3W84A 1ZHAA 2Y5SA 2HK0A 1EEPA 5EMKA 1OHLA 1THFD 2VEKA 4QS5A 4FLRA 4HHLA 4M6PA 1A0CA 2ZC1A 2PTXA 3WLHA 2QT3A 1JCJA 7ODCA 1IYXA 3V3WA 2ZX8A 3ZR5A 4QITA 4M19A 3NGFA 1F6YA 2JKEA 3CZEA 5FCZA 1VFHA 4UTKA 1XUZA 2Y5EA 4MAZA 3SZ8A 2WJEA 4ACZB 2VEPA 4Q7BA 3DFTA 1LUCA 2PBGA 3W23A 5BMXA 1XLFA 2CLMA 1P0NA 3WQDA 4MLRA 3UPBA 5HJLA 5SWUA 3FJNA 2A3HA 3NTYA 4TVDA 3M0JA 3UXDA 3GC2A 1Y7VA 3RR4A 1S2UA 2V3FA 4P8UA 4NHVA 3O8AA 3NPXA 4M5PA 4H2CA 4LAUA 3N2TA 4MHBA 1KXVA 3C0LA 3WNKA 4Q4KA 4X60A 2IMRA 3VIFA 2FYMA 1GPFA 2ZWYA 1H09A 3AHTA 1HT6A 2EPHA 1LZOA 1S2CA 3CHCA 2QDDA 1QAPA 5T8GA 2XJ7A 1YDOA 4CGTA 3CV7A 3SM0A 1ONXA 4HB7A 4FOKA 3SCQA 2VURA 3N2XA 4Z1BA 1RPKA 4N4QA 1YTDA 1H49A 4IIDA 4IMCA 2P76A 3VIJA 2VCBA 4HA1A 2PMQA 1FP8A 2NVCA 5AHLA 2DIJA 4L1WA 1XCXA 1VEPA 3RLGA 2ALDA 3CK5A 4RPPA 3MUXA 3W83A 2IUZA 4W9TA 3GE7A 3EWYA 2PGWA 3T0DA 2EPLX 3B8IA 5A6AA 2VD9A 4Z2LA 4JNZA 3UWUA 1SPQA 4H8HA 3Q37A 4H9XA 3R8HA 1P0EA 1Z32X 3SFKA 3WK0A 4GXMA 1PV8A 1QOPA 1Y65A 3RHGA 4HZ6A 1VH7A 4GQ0A 4QJ4B 1QNOA 1I2OA 3VU2A 4HPXA 3MP3A 2PWDA 5HINA 3C2OA 1X96A 2ON3A 1T99A 4RE3A 2DQXA 5C2XA 4EKJA 1UD6A 4MG4A 1BXBA 1JAKA 1OC6A 3OGRA 2QJNA 4FEZA 3HN3A 3W3OA 4DN1A 1GEQA 2ZVRA 3HGSA 5D8WA 1BGAA 2XTKA 2NSOA 2AQOA 2WVSA 3W1MA 4Q8VA 5CZJA 2P0OA 4GZ7A 4H00A 3N2BA 3AHXA 4X2RA 5FL0A 4NNBA 4G1NA 2V9DA 2V63A 3R25A 1JNEA 1AH0A 1Q66A 1RBOB 1KCKA 3T2PA 4JQAA 4GQQA 5EMYA 3LGEA 4AMAA 4AIEA 4B9YA 4W84A 4HPNA 4ZB5A 1UKSA 3UPMA 4JTTA 2UWFA 5DO8A 1SFJA 4MY9A 4HMNA 3THCA 4Z42C 3KL0A 3H2CA 1GQLA 3TWAA 1H5VA 1R3YA 3LK6A 3EB3A 1H0IA 1VBHA 3TUUA 1DJHA 1EL3A 1TPDA 4Q8MA 4FLSA 1CGUA 4QGCA 2AL1A 4JNYA 1GOMA 3V5CA 1NARA 3DZ1A 2AGKA 4ZA0A 2OZTA 3NQ2A 5KZMA 3RPDA 2BV9A 3K13A 2PBOA 1WXJA 2YL9A 4A29A 3D3AA 1J01A 1NOFA 2GK1A 4EPEC 4O16A 3JZEA 4LBUA 3W76A 5REQB 1GQIA 2GVYA 4LC8A 1W5QA 4O12A 3OZMA 2X30A 1TTIA 4K1WA 1GUVA 3N9KA 2VXNA 5D4YA 2WC4A 3GUGA 3SSJA 3RJYA 1F2JA 1KLZA 4HHPA 2ZRUA 3E0IA 4IIGA 2FZMA 2XH4A 1ME7A 4FPSA 4U2YA 5LIWX 1K4HA 2PDWA 2ZTJA 3PAJA 4HZMA 2BP1A 1PTDA 3AUJA 1QOQA 2OFJA 3EMZA 1YADA 3LCHA 3OQ8A 3E6EA 4LEQA 2W6RA 3WD4A 4MY1A 1EC8A 1OWQA 3PBWA 2WZEA 3WNOA 1GW1A 3BSGA 3MSRA 1REQA 2POZA 2GWNA 3NOEA 2CLPA 5B7YA 3WL1A 3HF3A 1DV7A 4K37A 1W5OA 4N9BA 2HVOA 4TX8A 3GRIA 3LNMA 3RX2A 2EBNA 2CKSA 3M0XA 5TQLA 2GGJA 1UZ4A 2X42A 1UUQA 2C7FA 3S42A 5AC5A 4S23A 3AIUA 3DHUA 3UZZA 1E4MM 4HJFA 3KW3A 4PH6A 1EDTA 5LNVA 3UCDA 1PZ0A 3F4NA 4JQ2A 1DP0A 4JTEA 1SJBA 4PEKA 1BG9A 4A21A 3EXTA 3UVAA 1JPIA 4AD2A 4QFUA 3V7PA 3VZXA 4IMFA 4EXAA 2FTWA 1XGZA 2NX9A 3M07A 3IRSA 1VIZA 4PTXA 5F4SA 4LYQA 1XL9A 1L2QA 1X7FA 3IGUA 4UTTA 1ODUA 3GTIA 3EYPA 3W82A 2CESA 2GQ9A 3CQIA 4OOZA 3HJEA 1QU4A 1O1ZA 4F2UA 4C6JA 5JXQA 1UASA 1X1OA 2QPUA 4HKPA 1QK0A 3GH5A 2W3ZA 1RJRA 3T1GA 1UKOA 1E9IA 2GPTA 3ARUA 3T8LA 4K6AA 3NO3A 3M0MA 1PKMA 5G2HA 2POTA 3ZR4A 2ZKMX 3G22A 4IXXA 3WKZA 3LQLA 1KBJA 2GJRA 5CGMA 3MWCA 3H4WA 7REQA 4DB7A 3GO2A 1XIIA 3CC1A 3HGJA 4GJ1A 5AYYA 3CLMA 4JHZA 3E0LA 2X7WA 2HE5A 3LI1A 4NJIA 3APYA 8CGTA 3KRSA 2UY4A 1C9WA 4BEUA 3UG5A 1IIHA 3S3GA 4J3ZA 1MZRA 5HAOA 5KTLA 3S2MA 1WNOA 3HV9A 3WLKX 5J5DA 2WMHA 1XSKA 3TX9A 6ENLA 2PZ0A 4GY0A 3RGTA 3MHFA 1MEIA 1NVMA 2XVPA 3DXIA 2QKFA 2VELA 4RK8A 1F4HA 2Y4SA 2CITA 4DJEC 3IGXA 1LCOA 4A3YA 1ZCCA 1ZBVA 3DFSA 1XQLA 3WDHA 3WQ6A 2A0NA 2VEMA 1E6SM 3K8LA 4QP0A 3UWZA 4JN8A 1YW1A 4ZFCA 2WHLA 1BRLA 1RJPA 4F3HA 2W0UA 2WHKA 4UNKA 3VMNA 3DYPA 5T9BG 5IBXA 2BASA 1WAUA 3R8GA 5HMDA 3DKJA 4ROQA 4S3JA 1C7SA 3FY1A 2VDHA 4CD5A 1B1YA 3UWWA 3G6LA 2NWSA 1O66A 2CERA 2G3NA 4UBPC 5I09A 3ZVHA 4HU4A 4XBKA 3LV5A 1B3OA 3GTNA 3G0UA 4LAMA 3KRBA 1ELSA 1HL9A 5PTDA 1A5OC 3QJAA 1TJ0A 3LMZA 2XIIA 4GYKA 4HMCA 1HXJA 2XIJA 2WLZA 3NQMA 4XAPA 1CGTA 5FJIA 1RCQA 3EOEA 4JTGA 1HJWA 4FNQA 3SY5A 1UMYA 3HPAA 1DXEA 1YNQA 3RYSA 3W02A 3VD5A 2Z28A 2QYGA 1BYDA 4KH2A 2C0HA 4A8IA 2PRLA 4MIMA 3M0HA 2FVMA 3NGJA