2RHGA

Tryptophan synthase complexed with igp, ph 7.0, internal aldimine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
250
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
publication title Tryptophan synthase complexed with IGP, pH 7.0, internal aldimine
rcsb
source organism Salmonella typhimurium
total genus 89
structure length 250
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2rhgA00
1JCJA 3ZWSA 4LC8A 1T99A 2E6AA 1K8XA 2NX9A 2ZTJA 3BV4A 3PS7A 4NJHA 1JCYA 3LHVA 1T0OA 1MO0A 1XL9A 3RLUA 2H3DA 2X30A 5D30A 2YGYA 3UY7A 1G4PA 4UFLA 4GFSA 3H55A 4CCDA 4YCOA 1MEWA 3AO0A 4QSHA 5CPOA 3LCGA 4PC8A 1KFJA 4CNOA 3KAOA 1EIXA 3T44A 3IGXA 3LTPA 3PBYA 1ZY9A 3PUOA 5KITA 5D04C 4I7VA 4HKPA 1KBJA 2I9EA 4AH7A 1OABA 1EP1A 2Y7DA 3A23A 3R8RA 1LLZA 2A6LA 1L2UA 4N4QA 5AC7A 1K8YA 5HR7A 4JTHA 1VQTA 2RDTA 3RLVA 1TV7A 2EPHA 3PWAA 1W37A 1XBXA 3LCFA 3KXQA 2R91A 3VNDA 4LV4A 3I7SA 1H63A 4NX0A 2V0TA 1G4TA 3W85A 4WOQA 4POCA 4Y8FA 4AB4A 2DORA 3R89A 2Y85A 4ORMA 5D33A 4GBUA 2ZYFA 3I68A 3YPIA 1ALDA 3G1AA 5F2IA 1SO3A 3W1NA 1OK6A 4ICNA 1H7WA 3KRUA 4UFKA 5C55A 3DHDA 3G1HA 5F4WA 3HPZA 1QOPA 1L6SA 1XDLA 4UTKA 3M1ZA 4EVZA 1H7RA 3BG5A 3SY5A 3DH7A 5F4SA 2X1RA 3LCWA 4UNLA 3UNDA 3QYQA 1IXQA 1OG0A 4O54A 3W7PA 2ZRYA 3LXAA 5CZTA 3B04A 2C6QA 5HUOA 1YPFA 1GVOA 3UZJA 3MW7A 5D03A 3IVSA 2C0AA 4IMEA 2CZEA 3G1FA 3CEUA 1LOLA 1G7UA 2VEKA 5F4XA 1TPH1 3NQ6A 4NZJA 1I45A 4AWUA 4UTWC 1XKYA 1UASA 2FFCA 2ZCGA 4JNMA 1N8FA 2NXIA 1VGAA 3S42A 3EWYA 3E96A 4EF8A 2Y7FA 3R2GA 2BXVA 3VKJA 4N6FA 3MO7A 1OFAA 1BTMA 4DBEA 4GUJA 2YZRA 2ZZ6A 3GVGA 2Y7EA 1JQXA 4IPIA 3DZ1A 1F74A 2D73A 3S8HA 3W3OA 5D02A 4FX8A 4JR5A 3M41A 1ME8A 4N9DA 4O57A 4X2RA 5K3VA 4M6QA 4WZHA 4FNPA 1TRDA 3NQEA 3TQVA 2ALDA 3VCRA 3TAOA 4BI6A 4MFDA 1A5CA 1GG0A 3S1VA 4JTTA 1W56A 3W7OA 1NSJA 3FKKA 5HWMA 3EX3A 5FEWA 2W0UA 3A22A 3P84A 2X1UA 1SZNA 2E77A 3QMRA 2ZQ0A 3TSDA 2JGYA 1W5OA 3MI2A 3QH2A 3IVUA 1WOBA 3KX6A 2FIQA 3W1XA 4H3DA 1WXJA 3N2MA 3QSTA 2E5DA 1SO6A 4O0KA 4JS3A 2CZFA 4GUGA 4O0ZA 4E2DA 2WO5A 1DOSA 3MBDA 1VHNA 3UWYA 2FLIA 3NYZA 3LDVA 3S1WA 3HQ1A 1UUMA 4LNYA 1DVJA 4MY9A 3QW3A 5MHBA 1TMHA 1DV7A 2QCDA 3GZ3A 3QC3A 4AWSA 3UZ5A 4R34A 1PL9A 3P8JA 3L0NA 4MOZA 4XQ6A 3NL2A 4PH6A 3LHUA 3NPWA 4RR4A 4DPQA 1VZWA 1XBVA 4N9CA 2AAMA 3CLMA 5L6UA 3DGRA 4IX0A 3NNTA 1SZGA 4HNVA 1F05A 2QDGA 4TMCA 1WDWA 1KM1A 3FYOA 3HJZA 3LRMA 3W70A 3PSVA 4C1KA 3N9SA 5G1TA 2I14A 4UMBA 3GX9A 1H7XA 1UUOA 3MWAA 2B0MA 3P80A 4BR1A 4JYDA 1PCKA 3WJXA 1D3HA 5KZEA 3NQGA 3O8AA 3E0IA 3TXVA 4EOUA 5LGZA 4O17A 2QCDB 2JKPA 3IIOA 1QMLA 2PRLA 4A29A 4ADTA 3EWWA 3RK8A 3R12A 3EWBX 2C16A 2G95A 2NUWA 3G3MA 5FF4A 4K39A 1HO1A 1PHWA 3G1VA 1GOXA 5CSSA 3ANYA 3QPZA 2QCCA 2X16A 1I2QA 4GE8A 3UWUA 4GUHA 1D9EA 1RD5A 1TPFA 2C13A 3MBFA 3BK0A 2EGZA 5KZDA 5TBOA 2Z6JA 3O6DA 2YW3A 1OFDA 4BWLA 3W71A 3TUUA 1LORA 1NFBA 1TTQA 3T7VA 5G2IA 1W8SA 1YTEA 3C2OA 1H61A 1NF7A 5CGQA 1O4UA 2CLFA 5EL1A 3KOFA 1YPIA 3C52A 2KZHA 4MJZA 4FB7A 1JUEA 1DQXA 5LHEA 3PUDA 1IF2A 4O14A 3UXDA 1MEIA 3IIXA 5BNKA 4RZ4A 3N2XA 4FNTA 7TIMA 4QM1A 1D3GA 1VH7A 1GZGA 3LCLA 4ZQNA 1K8ZA 5BMWA 3V75A 3DI0A 2PRHA 2A6NA 2ZA2A 4ZQRA 4K8EA 2ZFAA 3OHIA 2QCLA 4UTUA 4NQ1A 4FIRA 5AHNA 4UFIA 3HIJA 3L0KA 1DORA 1IXOA 4CQAA 1VJIA 1X7FA 4E38A 4O10A 1GWJA 2BWGA 4HHPA 1TB3A 2C3ZA 4FXSA 4MJMA 1XC4A 1F6PA 4ZMGA 2ZZ4A 3G8EA 3FEMA 2QCMA 3TA6A 2VENA 1MXSA 1Q45A 2QUUA 2PURA 1QAPA 3GAKA 3L67A 1QFEA 3G3DA 5IBXA 3MI3A 3HG5A 1OFPA 4O11A 2CFFA 4RZ6A 1YTKA 1EX5A 5F2LA 3CIWA 3E49A 1W5NA 2RDWA 1B4KA 2W6RA 3KVKA 3P67A 4B5NA 3HMJG 2VKZG 3R5EA 2EKCA 3B0VC 2CWNA 3MHGA 3T4CA 3HGRA 5C5YA 2V2HA 4DQWA 5CZJA 4R7JA 3N14A 2F7FA 2R14A 1LZOA 5I3FA 1Q6RA 1FCUA 2VEMA 1L6WA 3NG3A 4JYFA 4ZQCA 4HSNA 1H7PA 1HO4A 2G96A 1GVSA 2EHHA 2HSAA 4Y9AA 3W2JA 3FS2A 3LM7A 2QJIA 3GK0A 3LGEA 2GVGA 3Q37A 4JTIA 2NLIA 2ZRUA 4RKAA 2Q8ZA 1LCOA 1OJXA 3W7QA 3KFTA 2CLHA 4ADUA 2NXHA 4NVTA 3W1QA 5AC6A 1P5BA 5K7JA 1VCGA 1GVQA 3IIVA 1CW2A 1EB3A 3DFNA 2OMAA 5KSWA 4IPJA 3F03K 2VC6A 3B0UX 4LWWA 3TCEA 3A5FA 4Z1CA 3B06A 1VLIA 3CT7A 4OU1A 5CG7A 5K4ZA 4Y96A 2OT0A 4QQ3A 3O05A 1PE1A 4AMAA 1PS9A 4LC6A 3THQA 1J4EA 1DJQA 3EX6A 4MVAA 3W7IA 1ONRA 1KTCA 5HJLA 3LTSA 2NWSA 4AAJA 1SW7A 1W1ZA 3C2RA 5G4WA 4DPPA 4P61A 5H2ZA 4GJ1A 2JKAA 2VFHA 3BLFA 5LNVA 3STGA 1TTPA 2Q3RA 3TROA 3ZWTA 3GDKA 3S1UA 4UXDA 1KBIA 2C15A 3B8DA 3M5XA 2V8ZA 3JRKA 5DLCA 1NAL1 3TR2A 3LB0A 4MLJA 1XBYA 1ADOA 1U83A 2ISWA 4ZQMA 3N9RA 5I3JA 1GVRA 2V81A 8TIMA 5U4NA 3DI1A 1DBTA 2VFGA 1ICPA 4LOCA 2NXGA 1OX6A 1P1XA 3L68A 1KFBA 1ZHAA 1E51A 2X2GA 1G4SA 2NX3A 2G97A 1TTJA 3EXRA 1SW3A 3CPRA 3IIPA 4P2VA 1K7XA 1YXDA 3BARA 5E93A 2TMDA 3L66A 4ZVJA 2RKXA 3WJYA 4XKYA 4W9TA 2G5WA 4HT3A 2WSRA 4WJEA 2YYTA 3UYCA 2YX0A 3QQ1A 1JVNA 1XCFA 2VEPA 3E02A 3W23A 5CPMA 3LLDA 2DZPA 3C8FA 1EPXA 2DZVA 4U28A 4RX0A 4ZZ9A 2CLOA 3DKJA 1KFLA 3BG9A 3W7GA 4UTIA 1EP3A 2TSYA 1K7EA 2QCFA 3W72A 3KVMA 3G1YA 4J9JA 5DY3A 3F4WA 4OQVA 3EWUA 4CLMA 5DXXA 3LXBA 2J27A 3OEXA 5D2XA 3GNDA 1N55A 3TIMA 2VFEA 4L4MA 3ABOA 5AN7A 3QPYA 4Q32A 3GR8A 3TQKA 2RHGA 3DFPA 1H7NA 2E6FA 4XKYB 2J6XA 3EB2A 4CQ9A 3TAKA 4O28A 3G1DA 1TPB1 3W1UA 3GR7A 4KWWA 4H4IA 1G6CA 4ZQPA 3GNNA 3G0XA 4G1KA 1A5AA 4TU1A 2RDUA 3NQCA 1KM2A 1KV8A 4MUZA 4UMCA 4UFHA 2JGQA 1AMKA 2WQPA 3H54A 3MYPA 1IXPA 1WA3A 4HNNA 1OFRA 1LBFA 4IUOA 3T78A 4O1CA 3LRLA 3O16A 2VFFA 1PHQA 1XBZA 4LU0A 3UXAA 1WYIA 2QR6A 4FHAA 3LI0A 1GVFA 2AQWA 3S1XA 3SECA 4FNQA 1NVMA 2NWRA 5D2TA 5I3HA 1SFLA 4A22A 2WSQA 3LHWA 4NJJA 3KVJA 4BWLC 5CPLA 1LYXA 3DENA 1HG3A 2E09A 2J9YA 3M16A 4AF0A 2H6RA 3TKFA 2Z2UA 1UB3A 2E1DA 1X8FA 3TDFA 4K8HA 1OFBA 3A21A 1X1OA 4O8RA 4H6KA 3O1NA 4JD4A 1VC4A 3DHFA 3LOTA 2PRMA 3M9YA 4ORIA 3BLEA 3W7KA 1J5TA 4NU7A 1OFQA 5LZLA 4DO4A 2I1OA 4YWIA 1XUUA 4LVAA 5DCEA 5DBTA 3TJXA 1OVDA 3CC1A 5FEXA 1W3TA 2FB3A 3NZRA 4JDYA 3NL6A 4QNEA 1FWTA 3SSJA 1LDCA 4CCCA 5BRBA 4OWGA 3CWOX 4XBKA 4AF0B 3MUXA 1ML1A 1JUKA 5EKYA 2QJHA 3NR0A 3M5ZA 3I65A 1G4EA 3NZ1A 2DU2A 5A5WA 2PCQA 3W1RA 3L65A 1QO5A 1JCMP 3HGJA 5FF3A 4FF7A 4K36A 2H8ZA 5I3GA 1EUNA 5IBXC 3WK3A 4LV9A 2X1SA 4FIQA 1SZEA 1SO4A 1MEHA 2Y88A 5F1UA 1KLYA 2E6DA 5I3IA 1Y0EA 2Y6ZA 1J2WA 2VOMA 5G1YA 4DF2A 5HR6A 1EA0A 1UJPA 1KA9F 2FPVA 2QAPA 1IIHA 2VFDA 1TIMA 1R2SA 1GTHA 3EXTA 1YDNA 1WV2A 2JBMA 3QW4B 1VRDA 5LNUA 4DELA 1YLVA 4NNCA 2NUXA 2YYUA 1T8XA 1LTDA 1LOQA 3O6YX 5DELA 5K2ZA 3C61A 3PB0A 3LXCA 3QJAA 4HPXA 3CQ0A 3NPVA 3DAQA 2ABAA 4JTJA 4EF9A 4FO4A 3C0JA 1R2TA 3Q58A 2NV1A 3ZR4A 3G18A 5L9FA 1FDYA 3ZFHA 5AYYA 1H50A 2ZBTA 4MIMA 3EWZA 3N73A 1HUVA 3P5ZA 2QF7A 4WY0A 4LRTA 1OF8A 1S5WA 1K02A 3NEVA 5TIMA 4WXZA 1FCQA 1ZENA 3LHYA 3WFAA 3SGZA 3HOJA 1G69A 1W5QA 3CU2A 1JRBA 3P62A 2X1TA 1W5PA 1IGSA 4QAIA 1PIIA 4I7UA 4O53A 3W83A 4UTTA 1WQ5A 1O95A 3W2KA 3MHUA 4O1BA 4Z1AA 3QM3A 1FWNA 4E2BA 1Z44A 1B4EA 4ONVA 2DZWA 3NQFA 4JGDA 4ADSA 1SZFA 4WUIA 2J9ZA 4QITA 3G1SA 1FQ0A 2P10A 3TMQA 1KTNA 3NOEA 4OV9A 1JCNA 4Z1BA 1AW5A 3IGUA 4X22A 5A8GA 3W86A 4UMAA 2A2IA 2QCGA 4WY0B 3NQVA 4LUJA 1JULA 2CZDA 4UCGA 1G7VA 2XN1A 1SR9A 4UTHA 4JIPA 3U6WA 3P81A 5E0KA 1FXPA 3GAYA 3OVPA 5ABTA 3W7RA 4O13A 4JX6A 2BX7A 1M7OA 4NJKA 3MYOA 2H3BA 5LSMA 3GDLA 4WX2A 3BW4A 4LY8A 2A21A 3LI1A 1R30A 1JCXA 2EAWA 1M7PA 5E1QA 3LLFA 1LROA 4X3ZA 5LNRA 3MJYA 3NQ8A 3NQDA 4JYEA 4N02A 3NQ2A 3CTLA 5F1VA 4AHQA 2UV8G 3CWNA 3W7MA 3EEGA 1VYSX 3W7DA 3C2VA 2C1HA 2ZZ7A 1TV5A 4PL1A 1XI3A 3UWVA 4CNNA 2YDAA 1FCBA 4Q4KA 1I2NA 3SI9A 2ZA1A 3W1LA 3S5ZA 1SQ7A 1W31A 4GXMA 1K3UA 4TR9A 2OJPA 4M19A 3S9YA 3TQ0A 5HWNA 3BG3A 2YPIA 5K9XA 4UUIA 1Q6OA 3GB6A 3IEBA 4BFAA 1KTBA 1OFOA 3PUEA 1T96A 1RQEA 2LLEA 2ZZ1A 4LVDA 1RQBA 4NNAA 5EMUA 4BI5A 4QISA 1H60A 1XFBA 3O06A 4N9BA 3TJLA 1V5XA 1OYAA 4YL2A 1LM1A 2GOUA 4O1DA 4RLIA 4HNUA 3W75A 4PODA 1ZJIA 4E0CA 2YFOA 3IRDA 4WY0F 4JTEA 4UTJA 1GPWA 4IWWA 4JX4A 3TNOA 1ZAIA 2A5HA 3NL3A 2NV2A 2GJLA 3P74A 2JK2A 2V2CA 3NO5A 3PSWA 5TQLA 1LLWA 1QCWA 3EX2A 1FCVA 3STFA 3OA3A 1KFKA 4FEZA 1F6KA 3W73A 5KMYA 3BW2A 4K38A 4U4MA 1RPXA 3DKLA 1W0MA 4WD0A 5CZSA 4IJBA 2AGKA 5C54A 3OIXA 1SO5A 5FI8A 3NM1A 4Z1DA 3HPSA 1YTDA 1C9DA 4TIMA 4O19A 2WNNA 1TV8A 1I8JA 3L21A 3TV8A 2R94A 3C3NA 4FNRA 2IQTA 1TJPA 4MFEA 4NX5A 4JXCA 3TW6A 2V2DA 3VE7A 4DO6A 2WPBA 4LW7A 4MY1A 1Z41A 3E9AA 4A2RA 3G24A 2H90A 4HN4A 2GVJA 5F2GA 4PFMA 1XDMA 4YLWA 1GEQA 4LS2A 4GRSA 4M7TA 1ZAJA 3QZEA 1KW1A 4LUIA 1IIGA 4JTFA 1QOQA 1VYRA 2OZ0A 3LCXA 3PBUA 4JIQA 3PB2A 1KM3A 4LTSA 3L2IA 4A21A 5LKYA 1KLZA 5CKSA 3LCIA 4S2BA 3TXZA 1A5SA 4AHPA 3USBA 1WAUA 2BTMA 4GNJA 3WK0A 1F73A 3NDOA 1A53A 2B7PA 1VPXA 3S0CA 5HUPA 3NL5A 1Z48A 3U8GA 4JICA 3JR2A 1AW2A 1THFD 2QCEA 3PF3A 4XWUA 3ABSA 1KFEA 3C6CA 5EY5A 3GLCA 1JR1A 4IGHA 4PTNA 3HBLA 2YW4A 3G1XA 4HPJA 3GYEA 3S5YA 3F4NA 2QUVA 3H53A 3BGGA 1RV8A 2RH9A 5HNRA 2FTPA 1AK5A 2GJNA 4JTKA 3LHTA 3P82A 5D38A 1GJPA 2ABBA 4TMBA 4M6VA 5DXYA 1TRIA 2O7SA 1W3IA 1W54A 3M43A 4AXKA 2ZDRA 1BWLA 2F84A 1QPQA 2ISVA 5BOOA 1P4CA 3C2EA 3M0ZA 1FY6A 1K7FA 1P0KA 5AYXA 3RNDA 4DF0A 2TPSA 5CPNA 5C6MA 4CCEA 1PCWA 1Z42A 4LT9A 4ZL1A 2Z0IA 3IVTA 3M44A 3WK2A 4JN6A 3SFKA 1QO2A 3PVFA 3S5NA 3KVLA 3L5MA 3W1MA 3HO8A 3PR2A 4K7VA 4JTSA 4O12A 4LVGA 3L0GA 3W7NA 1TTIA 4FNUA 4MPQA 3SJ3A 5C2XA 1CX9A 5AC8A 2VEIA 2GQ9A 3EKZA 2GVLA 1QR7A 4LS0A 4PL2A 1ICSA 3NAVA 5IM51 3NPUA 1S3HA 1F76A 3V1PA 1VHCA 2DZTA 4NJGA 5D05A 3AJXA 4O4WA 4Y6GA 3F1QA 4NXSA 1XXXA 2CLIA 3LHZA 3FLUA 3EX4A 3CHVA 3W7CA 3ABRA 2WNZA 3N34A 4EWND 5BW6A 4N6EA 3G8RA 1H51A 1RZMA 1ME7A 6TIMA 4UTTC 2E5BA 1A50A 1TYGA 2CLEA 2Y7GA 3W22A 4NZFA 4XTDA 1O5KA 1EUAA 4O52A 5G5IA 2QJGA 3GXPA 3TH6A 2ZZ3A 4UC5A 4S1FA 3PBWA 4MZYA 3W84A 3FJLA 1KM5A 2Q3OA 1HFBA 4BK9A 5BMXA 1Q6LA 5AFDA 3NA8A 3W7JA 3TMLA 4NNBA 4N9EA 1X6UA 3HF3A 4IOTA 3DFQA 1LBLA 4N2YA 4KKXA 5FF0A 3HGOA 3S6DA 1OHLA 1S5TA 4RCXA 3TK7A 5F2MA 1VYPX 3W1PA 5DBUA 3MP4A 2Y89A 3W7LA 1YXYA 5FF2A 3LCHA 3TFCA 3TU9A 3W2LA 3G0SA 3GXTA 2YCEA 3MP5A 2WNQA 1I4NA 1U5JA 4MY8A 1QNVA 1F5ZA 3DU0A 4UFJA 4AHOA 1QPRA 1I2OA 3L9CA 1YDVA 4TX9A 3OG3A 1L6YA 1TQJA 1VR6A 4KFPA 3DFTA 5EBUA 1YDOA 3PBVA 1VCFA 1LOSA 1LRQA 3QMSA 5DCBA 3ZS4A 3BO9A 1QPOA 1H1ZA 2ZRVA 3TSBA 4X9SA 3GXNA 3WJWA 4JY9A 4O4VA 4YCPA 2EF9A 3NVTA 4IXXA 4TO8A 1OK4A 1ZCOA 3FOKA 1FDZA 2ZZ2A 3PY2A 3SZ8A 3W2MA 3TC7A 5J5DA 5SWUA 4OE7A 5J5RA 1FX6A 2E68A 1WX0A 4XBSA 3E12A 4GUIA 5GVJA 1QDSA 3UY8A 1LP6A 2R8WA 2HS8A 1O94A 1B9BA 2VFIA 3RFAA 3R13A 4GC4A 3NQMA 5LHFA 1W5MA 3PG8A 5FESA 1HTIA 1N7KA 3KRSA 2CW6A 3P61A 3T40A 3FYPA 2Z6IA 4M6PA 2A7RA 1W3NA 2HMCA 2HTMA 3C56A 1AG1O 1I2RA 2OX1A 4M5PA 5DY2A 2FQIA 1TSIA 1AW1A 2Y63A 2QCHA 4I9AA 3MMTA 3W9ZA 5DN1A 4HSOA 1TPDA 3GDRA 1R2RA 1ZFJA 1B57A 4S2CA 3LBMA 4L4LA 2V5LA 4UR7A 5D37A 1DJNA 4Z0SA 3UWWA 3W1AA 1TO3A 2FPTA 2WKJA 3I7RA 1AL8A 4QIUA 2Q8LA 2HS6A 3FKRA 3HG3A 4RK8A 2ZZ5A 1VLWA 3PM6A 3QEZA 4OV4A 1XUZA 2CLLA 2A85A 2FJKA 4Z08A 1TJRA 2B7QA 4IMGA 5HULA 4XUGA 4KFOA 5K9CA 3A9IA 1RR2A 4LS1A 1HL2A 1FWWA 2RFGA 1TCDA 2QKFA 5AHFA 2NZLA 3W1TA 3W7HA 1SPQA 4UR8A 2DZSA 1UBSA 3HG2A 5D2VA 3BLIA 2GUUA 1I2PA 4DEFA 1CI1A 1XM3A 2WSYA 4IMFA 1L9WA 2DZUA 1BWKA 1Q3NA 3EWXA 4FX7A 4UIOA 1UCWA 3QF0A 4HIBA 5AB3A 2H8XA 3FA5A 3NXFA 3LBCA 2CLKA 1TPEA 2QAFA 5FEZA 5FF7A 5HWJA 5G2HA 2C19A 3B0PA 5AHLA 1O5XA 1PVNA 1H1YA 1SSGA 4O1AA 2J9XA 4D2JA 2YXGA 4DBDA 5HMSA 5AHMA 3VI2A 4DO5A 4IMCA 3HGSA 4O50A 3M7WA 2V9DA 5KZMA 3BVJA 1JQVA 3NGJA 1PV8A 1GQNA 3P60A 3VFLA 3P8IA 1P0NA 4XTIA 5AOUA 2DP3A 1FWRA 1LRTA 2DJXA 3L5LA 1DKWA 4M7SA 2ISSA 2QDHA 3W88A 3CIXA 1FDJA 2PE4A 3W2UA 3CM4A 5HINA 2WV8A 1GT8A 4O18A 3W7EA 3FFSA 3DFOA 3KRZA 1NF0A 3B05A 4JTLA 3EXSA 4XZ9A 2CZ5A 5HQEA 1BKSA 3K30A 4FNSA 1O60A 3NPXA 2V30A 1JUBA 2DZXA 5LNSA 1X1ZA 1M5WA 4O15A 4PCFA 3UWQA 2E5CA 1MZHA 2B7NA 3W07A 2XN2A 1V7YA 3O63A 4KFNA 3TE9A 3EX1A 3TFXA 2XFWA 1YYAA 1TREA 3O15A 1G67A 2DJLA 1WBHA 1NEYA 3QQ0A 2Y62A 3U2OA 3WJZA 2Z1BA 1OX4A 5G4EA 1GG1A 3SGUA 4IQLA 2ZA3A 2WJZA 1GYNA 4UTLA 3VE9A 3GIYA 3JS3A 4MKNA 2B7OA 2QUTA 3ELFA 3EKLA 1OX5A 2JKEA 5AYZA 1AL7A 1EP2A 2ATMA 3L5AA 3M5VA 4OGZA 3GDMA 4RXGA 1OFEA 4IMDA 5EPDA 4IXHA 4JY8A 4I7WA 3CB8A 2ATSA 4NUWA 5D2WA 5AHEA 3O6CA 1FXQA 3Q94A 4BF9A 4NXKA 5CSRA 4UFMA 1A5BA 3SR7A 1MSSA 5K4XA 5FEPA 1OX4B 3QRHA 3STCA 2Y61A 3M5YA 4WQ6A 1R47A 3G0UA 3RF9A 3A5VA 4OHQA 3RU6A 3TX9A 1SSDA 5G2WA 1GYLA 3SW6A 4JDBA 5KINA 1TPWA 3W2NA 4UNKA 2V82A 3LERA 2NX1A 3C4UA 5LGXA 4UTWA 1Q6QA 3WK1A 2A7PA 5CZ0A 4Y90A 1QPNA 3UWZA 4LRSA 1F2JA 1OF6A 5LNWA 3IGSA 3QSRA 4A2SA 4O16A 3THAA 3HB9A 3O07A 1VCVA 2TRSA 3DBPA 2ZRZA 4EIVA 1ZAHA 2FDSA 3C2FA 5T26A 1EWEA 1KM0A 2YFNA 4QJ1A 2TYSA 3DXIA 1SU5A 1TPVA 2GQAA 1IXNA 3BW3A 1TPUA 4GWEA 1FUYA 4JTGA 3PULA 4ZQOA 3HG4A 3QMTA 2Y70A 3BPWA 1SW0A 4PA8A 4HNTA 4YXGA 4JTUA 2PC4A 6ALDA 2QCNA 1DHPA 3CEPA 4Z0JA 4AVFA 3W74A 4WOZA 3MHFA 2J24A 2OT1A 3UPBA 3RMJA 1RQHA 4N4PA 1LBMA 1H7OA 5D09A 3PG9A 3T55A 2CLMA 2ZRWA 3LRKA 3DFSA 2NUYA 1BEUA 3ATYA 1SFJA 1DQWA 3N3MA 5EYWA 3MP3A 3STEA 5U7SA 1C8VA 3GKFA 2W79A 2FB2A 2GQ8A 4MZ8A 5AHIA 1ZNNA 3NM3A 2VELA 4FX6M 4YMZA 5I3KA 3LV6A 4PEKA 3ATZA 4RV8A 3MI6A 3LX9A 1SUXA 4BI7A 3A24A 2FPYA 2A7NA 4JX5A 3M6YA 2B4GA 3OBKA 3S5OA 4AWTA 1KFCA 3IIZA 3P7YA 5KTLA 3GKAA 5D2YA 3FJ6A 2BLEA 3N19B 3UD6A 3PC0A 3KHJA 2XN0A 2YSWA 1B3OA 2VXNA 4CNPA 2ZRXA 4MLRA 1WBJA 1JCLA 1RVGA 4OT7A 1KM4A 2P1FA 4OBTA 4JEQA 4K37A 3IV3A 3PAJA 3NQAA 3LTYA 1TQXA 3FIGA 3W6YA 4RXFA 2A4AA 4LVBA 1KM6A 1YADA 4DXVA 4NT0A 2BZNA 1ME9A 2YR1A 3NQ7A 3QFEA 1EEPA 1H62A 3B03A 1EWDA 1F7BA 4UTMA 3INPA 2E6YA 2QEZA 1M6JA 2V5BA 1FBAA 1VS1A 2A1YA 1DL3A 4FXRA 4R33A 4Q33A 1JJKA 3OVQA 2WOQA 1R46A 3TC6A 4RZ5A 3G22A 3I6RA 4ML9A 4MYAA 4KWVA 3P5YA 2P0OA 4K6AA 3GDTA 4NJIA 1OYBA 2A0NA 3UPWA 1QWGA 1YXCA 5K9DA 3W76A 5H91A 4K7YA 3BGJA 3I7QA 1S5VA 1ZALA 1WOAA 3W87A 4LVFA 5EA9A 1KV5A 2BSLA 4IX2A 1TPC1 4WXYA 2OCZA 2C18A 4AEOA 4CQ8A 1K03A 4RJEA 3WJSA 5D32A 1FWSA 4DF1A 3LV5A 3TW7A 3HPXA 4QNWA 2ZTKA 3D0CA 4R53A 2CU0A 1C29A 5DCDA 4A3UA 3SIZA 3TSMA 2C14A 3UQNA 4ALDA 2O7QA 1LRNA 1JRCA 1ICQA 3M47A 3ABQA 4MZ1A 3OVRA 1OYCA 4C1LA 4GUFA 2J88A 3Q2DA 1H5YA 2GPTA 3B4UA 4MYXA 1GTEA
chains in the Genus database with same CATH superfamily
2VOTA 3RM8A 3TWAA 4C5ZA 4LC8A 3BV4A 3PS7A 3IARA 4H6QA 4NG3A 4NILA 3KCLA 2PD5A 2PWHA 1MO0A 1XL9A 1SFTA 3H2MA 2VVNA 2X30A 2YGYA 3GU2A 4UFLA 3T07A 3WQPA 1DE5A 3MUIA 4IM4A 2GJPA 3GFXA 1MEWA 3MVIA 1Y5XA 3CV2A 3EMZA 1KFJA 4JNYA 4CNOA 2Z7GA 3PBYA 5KITA 1W9BM 4WGXA 4AH7A 2VL4A 3AIQA 3R8RA 1LLZA 4F8XA 5AC7A 5FJTA 4HYRA 4GX9A 2HBVA 1VQTA 1NWTA 1TV7A 3LBOA 2EPHA 3AMDA 1E6RA 3LCFA 3KXQA 3E2SA 3VIFA 3VNDA 4NX0A 2QGYA 1QU4A 4UQEA 2PLKA 2Y85A 4OBRA 5D33A 3SUTA 3I68A 4PUJA 3S5SA 1ALDA 1ISXA 2V3FA 4BCEA 1UP0A 3CUZA 3G1HA 1WDPA 3H7UA 5F4WA 3HPZA 1L6SA 1ADSA 1XDLA 4UTKA 4B16A 5F4SA 2DIJA 3LCWA 1RCQA 2V38A 1OG0A 4O54A 3W7PA 1XICA 2ZRYA 3BC9A 1YPFA 4P8XA 1GVOA 3UZJA 4ZTYA 2VZOA 2V3GA 3IVSA 5IHRA 1BHGA 1OM0A 1P0DA 1L2QA 4NZJA 3ME3A 1V03A 1OQFA 5TAOA 2Y1HA 3E5PA 1SJCA 2CKRA 3DBNA 5AZ0A 4BQ5A 3EWYA 3K5XA 3E96A 2DFAA 4EF8A 4CQCA 4GCAA 3VMPA 1OFAA 1KGUA 4GUJA 2ZZ6A 3VIMA 4HA3A 2BG5A 2Y7EA 4IPIA 1F74A 1MWOA 4J3WA 4FX8A 5D02A 4JR5A 3M41A 2O55A 4NSBA 2WVSA 3TLLA 4DZHA 2XVGA 3AJ7A 3OA5A 4WZHA 5ABHA 2PZ0A 3L12A 2QPUA 2WJFA 1DWGM 3EGJA 1A5CA 1GG0A 4MFDA 1Z6KA 1EZ2A 1FWHC 3EX3A 2CBVA 1GGOA 4Q6JA 4IFOA 3TSDA 1E0XA 1W5OA 4C1NA 3DC8A 3QKZA 1WOBA 3KX6A 2XGZA 3W1XA 4PMYA 3OZPA 5CCZA 2E5DA 1HF6A 3W28A 5BWFA 2CZFA 3FA4A 4GUGA 5BOFA 2BB0A 3GNRA 3U2ZA 4LNYA 4GI9A 4MY9A 3QW3A 2WXDM 4AWSA 3QC3A 4R34A 1BSIA 1V0NA 1YW1A 3NL2A 4PH6A 3LHUA 1VZWA 4IL0A 3CLMA 4ILSA 3COTA 7ENLA 1Q2SA 3NNTA 4C1NB 4IMAA 1KM1A 2DT2A 4ZEPA 3W70A 3EB4A 4GGHA 2UY2A 2W5FA 5G1TA 1VPQA 1ZP4A 4EANA 4E8CA 2Z26A 1UUOA 2B0MA 4FA3A 1CLXA 4PBGA 3B40A 2I5GA 4L9XA 2DUXA 3VZXA 2CIPA 3NQGA 3O8AA 2HCVA 4EOUA 2HJPA 4X0NA 3ZSSA 3IIOA 4Q7BA 3L23A 2C16A 4GY1A 4ENLA 2OTDA 1HP5A 2PTDA 3BLDA 3WH8A 3T1GA 3S9ZA 3ANYA 1IT0A 3IJIA 4YNGA 1I2QA 2QYGA 3UWUA 1EDTA 3A3XA 3WQ5A 2Z6JA 4REQA 3WG6A 3O6DA 2Y5SA 4BWLA 3VOIA 1Q85A 2ANUA 1W8SA 3C2OA 1TZZA 5CGQA 3KOFA 3NVDA 1F8MA 3UT0A 3C52A 4AMCA 4DJFA 3ALFA 1DQXA 1E5JA 3N4EA 1IF2A 3M6DA 4IIGA 3N3TA 3CV6A 2QZRA 5BNKA 3VAVA 3ITVA 4H1ZA 4L6DA 4QM1A 3U57A 4GD0A 3LCLA 1Z7AA 3S6TA 1XLHA 1K8ZA 4WK9A 3QTPA 2PRHA 2A6NA 4PMQA 1Q6DA 6A3HA 1N2VA 4REQB 2ZFAA 4CU6A 2QCLA 2VD8A 4NQ1A 2WMIA 5AHNA 1XG4A 1QJWA 2ZE3A 4E6MA 4AD1A 3LEPA 3NSMA 3OIHA 1ITQA 1VJIA 4GKTA 3UA3A 1TB3A 2C3ZA 4FXSA 3RYSA 3G8EA 3FEMA 3U2CA 2QCMA 4HU0A 3P6LA 1P7TA 1MXSA 3CL7A 1LQAA 3N6QA 2PURA 5IHSA 3G3DA 5FCZA 3HG5A 4O11A 5M17A 2CFFA 3I6TA 5JU6A 2VC9A 4R9OA 5F2LA 3CIWA 4CD6A 5GQBA 3W38A 1B4KA 1RY0A 1JPHA 4N42A 3GH4A 4FPSA 4H9YA 4PN2A 3WQCA 3A12A 4J3TA 2Z2BA 4H9MA 3HGRA 4DQWA 5CZJA 6TAAA 2IKGA 2EG6A 4HSHA 3PFRA 4CN4A 4CN1A 1KRMA 1UR8A 1P7TB 2XZ7A 3D46A 4NY2A 4AEEA 2INFA 2HSAA 4Y9AA 3FS2A 3LM7A 2GVGA 4JTIA 1WDRA 5CC7A 3KFTA 2WM1A 3W1QA 3T2OA 5AC6A 1P5BA 4H9UA 1GVQA 4BQ3A 3DFNA 5KSWA 2VYOA 3B0UX 3RITA 3TCEA 3VD7A 4ZE4A 3B06A 1O6IA 4I9MA 3AUOA 5IDIA 4V28A 4QQ3A 4DVOA 1PE1A 3L4ZA 2VC7A 5C9WA 4LC6A 1GYMA 4IGSA 2NW0A 3WQFA 4MVAA 3MTWA 3OGRA 5LIUX 1KBBA 4YYCA 5LNVA 3ZWTA 1XPGA 5DRIA 4V2XA 3M5XA 3C0LA 4GI8A 2DV0A 5DLCA 1NH6A 3JUGA 4LCSA 2O9PA 2Y8VA 2J8FA 3AWOA 7CGTA 3A4XA 3OTRA 3WDJA 3DYPA 1F4HA 3L68A 4FP1A 4U31A 5CC3A 4AZGA 4LY4A 1R3VA 4MNKA 2NX3A 2G97A 1TTJA 1E9IA 4Z2LA 1HT6A 1SW3A 3CPRA 1YXDA 4P7OA 2CHRA 5HATA 4DJFD 2TMDA 1M41A 3RM4A 5C71A 3CO4A 4HT3A 4WJEA 3R58A 3TQPA 3VKCA 3LLDA 3WMSA 2DZVA 2VQTA 4RX0A 4WF7A 2CLOA 2G3MA 1GQLA 5F7UA 4AIOA 1UZ1A 3M0IA 3W7GA 2TSYA 4K1WA 2QCFA 3W72A 3KVMA 4J9JA 1PPIA 4TUFA 3VGHA 3F4WA 1HX0A 2QJNA 4OQVA 1IEXA 5DXXA 5LA1A 2D24A 3LXBA 2J27A 5AY7A 1N55A 4B2DA 2OZ3A 5AN7A 1EHAA 2WQDA 1H7NA 4S3GA 1J0JA 4O28A 4CUCA 3G1DA 5EFDA 2HE5A 1XIDA 1ECQA 4QXIA 1G6CA 4U3AA 3RJXA 2VWTA 1OY0A 4G1KA 1CIUA 2OZTA 4UMCA 4DJEA 3E2RA 3ONCA 4YU1A 3MYPA 1IXPA 2WYSA 1LBFA 1HVQA 2DSWA 3O16A 4XD5A 3UXAA 1GKPA 3LI0A 3SRHA 5C70A 4FNQA 5I3HA 4A22A 4MNMA 1I0DA 3ISIX 1TV3A 4BWLC 3WQ6A 1GOQA 2R1PA 2V5JA 1ZU8A 2YBVA 2E09A 1E1CA 3M16A 3EOEA 2H6RA 3L4XA 2Z2UA 1UB3A 2GJRA 1W1YA 1X8FA 5A6SA 1Q66A 3AHVA 3A21A 1X1OA 2WANA 3HZ3A 4UR9A 4ZSTA 3M9YA 3PTMA 3H24A 2QDEA 2ZE0A 2BGSA 1U1HA 4LCRA 4QR6A 4NU7A 2NV9A 5LZLA 2XIBA 4YWIA 1OVDA 2TAAA 4JDYA 3NL6A 1JI2A 1FWTA 2BMBA 3ZJ6A 4OWGA 3QFWA 4L1GA 1E1CB 4GNVA 4I3GA 5FSEC 1JUKA 5EKYA 2IXVA 4MGGA 3I65A 2J7HA 3NZ1A 1H11A 4HJFA 2QV4A 2PCQA 2JF7A 4U5IA 3SCNA 3MANA 4Q8VA 1Q4WA 3SQLA 3T0TA 5I3GA 3M07A 5I5RA 2PWVA 2X8RA 4HHHA 5A3HA 2DUZA 1SZEA 2I9UA 3UG5A 1WDQA 3WMBA 1TMLA 1SGJA 1SJBA 1EF2A 1Y0EA 1J2WA 2VOMA 5G1YA 4DF2A 2FPVA 2V5CA 1REQA 4HNLA 1TIMA 2G41A 1WV2A 5E70A 1TA3B 3QW4B 4MAVA 4LNCA 1YLVA 3VU2A 4EXAA 1T8XA 4JPGA 1VD6A 3WO8A 3QQWA 5K2ZA 3VC5A 1VF8A 4S3JA 1EC7A 3QJAA 1JFXA 4KGJA 3NPVA 2C1GA 2W27A 2WCSA 4WKFA 4DYJA 4QCEA 2NV1A 3N12A 4GQGA 5EBAA 2AKZA 2O9RA 3U2EA 5JBEA 3ABZA 1S1PA 5EMKA 1ZPTA 4MNJA 1HUVA 4YN5A 1REQB 4HPNA 1JZ7A 3LHYA 1UPMB 4FLQA 3BCDA 4PYSA 5CLWA 3P62A 2X1TA 2PTYA 1PIIA 4I7UA 4IFKA 4F2TA 1HJWA 1O95A 3SCQA 5I7GA 5CPQA 3MHUA 4Z1AA 3LMYA 1R3WA 1B4EA 3UZZA 4Q7IA 3C0SA 4ONVA 1EKOA 4WUIA 3CL6A 2PGWA 5HMEA 1FQ0A 1LL6A 3S9IA 3USZA 4B2DD 1BYBA 3IGUA 4GMEA 1JULA 4UCGA 1XS2A 5LYRA 1KR0A 3OVPA 3SCVA 4JHMA 4IFKB 3W7RA 2YCKX 1X98A 4B5SA 4NJKA 1LLOA 2CITA 3AALA 3SCTA 4DJED 1DP0A 4B15A 1XR2A 2H3BA 3NZGA 5LSMA 3A47A 2E8YA 4JHOA 4WX2A 3BW4A 2A21A 1R87A 1VFLA 3GVRA 3AU2A 3LLFA 1LROA 1JD7A 2G4FA 3MJYA 1V3HA 1UHVA 1E6ZA 4P5UA 3NQ2A 3CTLA 4AHQA 3RRAA 3IK4A 5I3DA 1VIWA 3LM3A 3C2VA 4U33A 2C1HA 5CPSA 1FH8A 1PDZA 1NFPA 1XI3A 1BQCA 4CNNA 4XV0A 1FCBA 4Q4KA 3WLOA 1I2NA 4ICCX 4QGCA 3H70A 3KWXA 3TQ0A 1HL8A 3SUWA 3IEBA 4XO6A 3WLNA 5HMFA 1AQ0A 1MXGA 2OR2A 1RQEA 2LLEA 5KETA 1R86A 2DY3A 1PAMA 5IXEA 3LK6A 3T2QA 3UESA 1OYAA 1B3ZA 1HIZA 1LM1A 2HE8A 4E0CA 4XZBA 5GNYA 1FWDC 4JTEA 5I06A 1GPWA 2DSUA 4JX4A 3KUMA 5DMYA 1D8WA 3OLDA 1ZAIA 1WZLA 1KRAC 1J5SA 3NL3A 2GJLA 4C6QA 3KZSA 1R7AA 2ZUTA 2JK2A 3UVIA 1FCVA 3CUJA 1F6KA 1NWUA 1HW6A 3BW2A 2WBGA 5CZSA 1W0MA 4AC1X 5I24A 4GG9A 3HPSA 2CXEA 4DJEC 4TIMA 3TV8A 3WQ4A 2R94A 3MQTA 3O2LA 3THCA 2IQTA 4J35A 4NX5A 3TW6A 4IQJA 3VCCA 1QBAA 1Z41A 4A2RA 3OLIA 4NZ1A 5DMMA 3TVAA 2H90A 3GS6A 1J10A 1FWCC 2CHNA 1XDMA 1GEQA 2HZGA 1VFTA 1WKEA 2BFGA 2HISA 2HPMA 5CBBA 2DW7A 4DNMA 1VYRA 3PBUA 3PJXA 3BLPX 4JIQA 3UGVA 2D2HA 4A21A 4X60A 1KR1A 4JTCA 1H41A 1F73A 3EOSA 5FAGA 3H2EA 1XJBA 1O1HA 3DGBA 1TWDA 1F3TA 6XIMA 3HFTA 3CUXA 4XG1A 1Z48A 1XH2A 3R0UA 2CEQA 4KCUA 5A6TC 3E2QA 3ANVA 3VABA 2UBPC 1NY1A 1PIGA 2GDVA 3C6CA 5EY5A 2YW4A 4AZCA 4JKMA 1S2WA 3BGGA 2RH9A 2QHAA 3RXZA 3QN3A 4AC7C 1PDYA 4JTKA 3LHTA 3KW3A 1BRLA 3M43A 1MW1A 1CT5A 4AXKA 2ZDRA 3EDEA 3S3GA 1QPQA 1TR1A 1DJXA 4M56A 3M0ZA 1K7FA 2J62A 3RNDA 1VB9A 4CCEA 4ZL1A 3M44A 4LB3A 1EF3A 4JIRA 5CBJA 4YTTA 2W9MA 1E73M 3W1MA 4AZCB 2YCLA 4K7VA 1GUVA 3L0GA 3E74A 4FNUA 5JXQA 4JFVA 2J7CA 5C2XA 1CX9A 3TYBA 5AC8A 1WE5A 3VX0A 5T9BG 3NAVA 1RLDA 3F2BA 2OYKA 5IM51 2DZTA 4DM2A 1RJQA 4NJGA 3F4DA 4RPPA 1SVDA 1LF1A 3DG6A 1XXXA 3LHZA 2D0FA 4H8NA 3E0WA 5ABFA 1K6AA 4WJXA 4MM1A 3N34A 5BW6A 1TV2A 4N6EA 1EX1A 4CU7A 1K9EA 1KGXA 2YCLB 2GL5A 3LN3A 4LYKA 4NZFA 4XTDA 1CYGA 5G5IA 2OLAA 1GVYA 2ZZ3A 3AU6A 3VIOA 2BOEX 4MZYA 2OO0A 4XISA 5AFDA 4K3ZA 4NNBA 4N9EA 1R9XA 3TTYA 3N1AA 3DFQA 1ODUA 3EDFA 1OHLA 2CHOA 5ABFB 1S5NA 5F2MA 5GJNA 3W7LA 2YL6A 1US2A 3N29A 5FF2A 3LCHA 3TFCA 1BLIA 3W26A 1EYWA 4B5XA 3G0SA 3RO8A 3PAOA 1RHCA 1F5ZA 3UU0A 1V3MA 3EAUA 4NZ5A 3L9CA 2VT0A 1YDVA 4EPEC 2GSEA 1L6YA 1GOWA 2VEFA 1VCFA 2W91A 1LOSA 3QMSA 3BO9A 3M0LA 3TSBA 3GXNA 1JNDA 4JY9A 4YCPA 3UWEA 5CC6A 1DPMA 2EF9A 4IXXA 3OODA 4Q4QA 3TW9A 1OK4A 2J7BA 4G9PA 3MUCA 4YHGA 3SZ8A 1CGYA 3TC7A 2BHUA 2V3EA 1VFOA 2X7WA 4OE7A 4IG2A 4TOQA 3K2GA 4I8YA 4J2MA 1WX0A 4XBSA 1SMDA 2J74A 3BSMA 4PUUA 4JNZA 2VCBA 3M0VA 1XW8A 1GQIA 3UY8A 1LP6A 2E40A 3QTGA 1HTIA 4BJHA 2PCEA 3TJ4A 4IZGA 4JKKA 1XLAA 4M6PA 4Z2KA 2HMCA 2FVLA 2C71A 4HK5A 3I3EA 4IIFA 5DRCA 2D20A 1B31A 1C90A 1IZKA 1EQPA 2QCHA 3MKKA 5DN1A 4IG2B 1VEPA 2A3EA 3GDRA 3LBMA 1NARA 2V5LA 2I5QA 1DJNA 3SY8A 1AL8A 2Q8LA 4NL1A 4J7RA 1HNYA 2EJ1A 1OC5A 3HG3A 3M0JA 3EDDA 1QNQA 3OB8A 1HJQA 1XUZA 2WZEA 3RHGA 4XUGA 4RL3A 5EMMA 2J7EA 3IACA 4LX4A 1F9CA 1RR2A 1FWWA 3AIEA 3FCPA 2RFGA 2QKFA 5AHFA 1R3TA 4PMOA 3MKCA 4WHBA 5J8LA 3BCJA 3HG2A 2VDIA 1W3KA 2FTYA 1AD4A 1Q3NA 3WQWA 3EWXA 1HGYA 1NOWA 1UCWA 3W6LA 3IJ6A 2YDRA 3RLHA 4LAMA 2H8XA 3FA5A 3LU2A 3RPMA 3DYOA 2YA1A 1XLDA 3NOYA 4L61A 1UWUA 3PZMA 4D2JA 3UEQA 7A3HA 2YXGA 1K6WA 5M03A 4DO5A 4IMCA 3W24A 2V9DA 5KZMA 3QV8A 4RZBA 1JQVA 1V6XA 1GQNA 1E1EA 1O5RA 3P8IA 1P0NA 5JMUA 1FWRA 1U30A 1ELSA 3E38A 4GIYA 4KW2A 1Q65A 4D6GA 3H4XA 3KCOA 2WV8A 2Z1KA 1NP2A 3AYVA 5T8GA 4HYVA 3KRZA 1NF0A 4JTLA 3DOPA 3E0LA 3VIIA 1BKSA 2BDQA 3ZR6A 5ECUA 3URBA 3WUGA 4W85A 1Q7QA 1A3WA 1JAKA 1XRSA 2ZDSA 4DX3A 5LNSA 1X1ZA 3UWQA 5BRPA 1KBLA 2E9LA 4IIEA 5A6MA 3B0XA 3CL8A 1TREA 3I3DA 4FLSA 1NEYA 2Y62A 3U2OA 2E1WA 3WJZA 4RNIA 4O1EA 1OX4A 5G4EA 2YLLA 4I6VA 3SGUA 3IUDA 1GYNA 4JBRA 2GZXA 3GIYA 5G4HC 2QUTA 3EKLA 3M4HA 1VFFA 1QTWA 2ATMA 3VUSA 5EPDA 1G0CA 4JY8A 4W7WA 4I7WA 5DMNA 5D2WA 2XTKA 1FXQA 4XD6A 4BF9A 4NXKA 5CSRA 3GW3A 3SR7A 3LD5A 3RCNA 1OX4B 3DECA 3QRHA 2JALA 1I1XA 1DQUA 3TN3A 3M5YA 1ZQ5A 3UCCA 3G0UA 2E25A 4FK9A 3TX9A 2Z4GA 1MQPA 1G01A 3UR2A 4HCHA 2IPJA 2Y5JA 2V82A 4PUWA 1C93A 3LERA 3H2FA 1UIOA 3NO3A 4UTWA 2XJ7A 4L65A 5DFAA 2PS2A 3AIBA 4S3FA 3FN9A 3IGSA 2XVNA 1Q2RA 3WLMA 1R85A 3UVAA 2PDLA 2QGHA 4A3RA 4ZO6A 4RW5A 1E6XM 3C2FA 2WKLA 1EWEA 1KM0A 2YFNA 5D9OA 1C7SA 3DXIA 3OHMB 4B5UA 1W1TA 2R6OA 2VCAA 3ITLA 3QMTA 1ISWA 2HK1A 2Y70A 1SW0A 2C91A 4YXGA 4JTUA 2PC4A 6ALDA 7PTDA 3CEPA 1IWBA 3RRXA 3TZFA 2UY3A 2J47A 3RMJA 1RQHA 8XIMA 3ARQA 1C92A 4H6RA 1H7OA 3ID7A 3Q65A 1QNRA 1B0IA 3BQ6A 1FH7A 1JDDA 1BEUA 3ATYA 2PFHA 2AAAA 1SFJA 5C7VA 1UZHA 1EGMA 3STEA 3MCOA 3GM8A 1C8VA 1JZ4A 2CERA 2WB5A 4PFHA 1WAWA 3G5EA 3WYZA 4MZ8A 2FGZA 5AHIA 3W29A 3P0WA 1O1ZA 3NM3A 4FX6M 3URQA 1JXJA 1SFSA 4RV8A 4US5A 5LIYX 1SUXA 1W1PA 4DWDA 2FPYA 4JX5A 2B4GA 3VDBA 1E70M 3S5OA 3P7YA 4US6A 4UQCA 3UD6A 1BG4A 1OZQA 4YTQA 4QQUA 4OUEA 4LBUA 4EE9A 1GONA 2VXNA 1XC6A 4MLRA 4QCFA 1JCLA 1KWKA 2P1FA 3VIHA 2NVAA 4JEQA 3CIVA 1Z32X 2PDWA 4XZWA 2XSBA 1VBGA 3FIGA 2OX4A 3CV7A 2A4AA 4PMRA 1KM6A 2PWDA 2J6VA 4MHBA 4NT0A 4HMEA 1ZS2A 1EEPA 1PZ0A 1Q8AA 3CYVA 1XQKA 4QJ4B 1L0PA 1A47A 1AZ2A 1M6JA 3KZPA 1DL3A 4FXRA 4R33A 1JJKA 2PODA 3TC6A 4GZIA 1EGVA 3G1RA 4ML9A 4KWVA 3AZSA 3BMWA 2P3EA 1M7JA 1X38A 3GDTA 4NJIA 4XUYA 2WC7A 1YXCA 4FF5A 2AOSA 1QRQA 2J7GA 5K9DA 1RALA 5H91A 3BGJA 1RD6A 3RMEA 3V5OA 1A5OC 1M53A 5CC5A 2DZBA 1IE7C 2C8NA 4WXYA 2OCZA 1TMQA 1A4LA 2KX9A 4LAKA 3QPEA 1FWSA 1S1RA 3TW7A 2QXWA 4QNWA 3D0CA 3SN4A 2CU0A 3UQNA 2O7QA 2RAGA 3OO2A 3PZ9A 1UPPA 1ICQA 4ZB5A 3HA1A 2GGJA 4MZ1A 1DIDA 3NJ3A 1OYCA 4C1LA 3VGFA 3H7RA 3OU8A 1ISVA 2W92A 1ONEA 2C0HA 1J6OA 2G3JA 2WCGA 3ZWSA 3LG3A 2Q8XA 2E6AA 3IWPA 3TYDA 2NX9A 3HPFA 3ALGA 4MB4A 1JCYA 2FVKA 3LHVA 1FWBC 1HKWA 4HCLA 4S3EA 4DLMA 2ONEA 4U2ZA 5D30A 2F61A 1G4PA 4KGLA 3KL0A 2IPGA 4YCOA 3AO0A 4QSHA 1WB0A 4KPLA 1UQYA 4PC8A 3KAOA 1EIXA 1DTUA 1ZY9A 1EHNA 5D04C 2Y2WA 3CLWA 4I7VA 1KBJA 1NELA 4EP8C 1MYRA 1I75A 4GLEA 1YPXA 1L2UA 4N4QA 4ACZA 2YA2A 4LGXA 3RLVA 4HMDA 3PWAA 1W37A 1XBXA 1OWQA 1H63A 4V15A 3IJLA 3CUGA 2V0TA 1XYFA 2AL2A 1F6YA 1NDWA 2XPKA 4Y8FA 4KEVA 5HPOA 4A05A 2E67A 4IQEA 4GBUA 2ZYFA 3PJTA 4GCXA 4UBPC 1D3CA 5F2IA 3UZWA 1IWAA 1MRAA 4AW7A 4UFKA 5C55A 3DHDA 3PK7A 3VMNA 1FHVA 1LT8A 2IXUA 3M1ZA 4ACZB 1TR9A 4EVZA 3BG5A 5BYWA 3DH7A 2OPJA 2X1RA 5H8MA 4UNLA 3UNDA 3QYQA 1IXQA 1EJSC 4US5D 2OFJA 5CZTA 3WD2A 3B04A 2C6QA 3N15A 3KEHA 3MW7A 1VBJA 3QHMA 3APYA 5D03A 8A3HA 2CZEA 2AL2B 3CEUA 2WMJA 3N4FA 1Y5VA 1I45A 3ORWA 3V36A 3LENA 5HXMA 4UTWC 1XKYA 1N8FA 1J12A 1G5AA 2NXIA 4CQBA 2FGLA 4F4RA 4N6FA 3NURA 4P7QA 1BYCA 2XIIA 3BWWA 3TYZA 3AIVA 3DZ1A 3ANUA 3VNZA 3MY9A 4LBRA 4N9DA 1Y7VA 2WLZA 1NP0A 5A2AA 4W8LA 3TQVA 3VCRA 2PLJA 3TAOA 1W32A 2OGJA 5LIKX 3S1VA 4JTTA 4ZB2A 3W7OA 4GIAA 1FFQA 1YMYA 4AFYA 2W0UA 1OZMA 3P84A 3I4EA 2D3LA 3GHUA 3QH2A 2NSOA 4H3DA 3N2MA 3GXFA 1A5NC 1US0A 2PAJA 1BVZA 1SO6A 4C6FA 4E2DA 1T41A 1DOSA 3CZJA 3ICJA 3W4RA 3AMCA 2DQXA 4L56A 1DV7A 2QCDA 4FMVA 3UZ5A 1D7KA 4L6HA 1PL9A 4CD7A 3P8JA 3SSZA 4MOZA 4XQ6A 4E2VA 4DPQA 3NPWA 3PPCA 1XBVA 4N9CA 3MJMA 1CZ1A 2AAMA 4IX0A 3WQVA 1W3JA 4HNVA 1F05A 3WZ0E 3KBVA 4IP4A 4QG8A 4JIEA 2ACUA 3N9SA 4ML4A 5M3WA 2GLKA 2XH0A 3VTRA 4AZBA 3WL0A 1A5MC 3P80A 2PU1A 2OSWA 3BL3A 1TZ9A 4HZ8A 1OGGA 1D3HA 4K2SA 1FWIC 3A9BA 4E4UA 5LGZA 2QCDB 4B3ZA 4D71A 1PKLA 2YLAA 3EB3A 1P48A 3ERPA 3EWDA 4U3CA 4XD4A 3L2LA 1GOIA 2D23A 4ADTA 4I5RA 3EWWA 1KFWA 1GW1A 1NJJA 5E6ZA 2G95A 1W1A1 3G3MA 3R0DA 4K39A 1H3GA 1PHWA 3G1VA 5CSSA 2X16A 4GE8A 3RX3A 4RE3A 3EZ4A 3WLSA 3XIMA 3NYDA 3O6AA 4GUHA 3VIPA 1CBGA 1D9EA 1RD5A 3KP0A 4W5ZA 4ZXLA 4LF1A 3V5FA 2Q71A 3W71A 1LORA 1TTQA 5G2IA 3ARRA 1YTEA 1LUCA 1ZP3A 3IUIA 2CLFA 5EL1A 1VAHA 3E0FA 1CB2A 1XSKA 2WM0A 1B3VA 1UYQA 3PUDA 4JFWA 2RUSA 2ALRA 4AVNA 1MEIA 2VZSA 3IIXA 4RZ4A 1O68A 7TIMA 3ARUA 1VH7A 1GZGA 4ZQNA 3V75A 3KLKA 4HK6A 4ZO8A 3DI0A 1E1FA 4U5KA 3VIGA 1J79A 1XLBA 4UTUA 1LUCB 4KEZA 2IMRA 5C0QA 1IXOA 1DORA 4L4OA 1ONXA 4ZO9A 4A8NA 3PP7A 4E38A 3N6JA 4W86A 4MJMA 1F6PA 2ZZ4A 2X0SA 5DQPA 4Y2WA 3TA6A 2OKTA 1UWAA 4ZFMA 1KD0A 5KZ6A 2QUUA 1J18A 3MB9A 1QFEA 5IBXA 5EMYA 1QW8A 3EA2A 1C8QA 3TOYA 3REQA 3WLKX 1EX5A 2J8TA 2XDFA 4XAYA 1W5NA 2RDWA 2XFYA 3HMJG 1XD1A 4KIEA 2XH2A 4R88A 3VOHA 5C5YA 4R7JA 4LFYA 1OSEA 5I3FA 3BE7A 1UC5A 4C65A 3NG3A 3IJ9A 4JYFA 3SUUA 1ZL1A 4R7WA 3B3DA 2EHHA 3W2JA 3REQB 4FALA 3GK0A 3LGEA 3ARTA 4UQBA 2P3ZA 2ZRUA 4J3UA 4RKAA 3EA3A 4W89A 1LCOA 4Q8QA 3W7QA 4S3DA 1NWRA 4ADUA 4Y7EA 5FJIA 4S3KA 3AOFA 2OOFA 3GVVA 5K7JA 3IIVA 1CW2A 3EA1A 1S2AA 1PTAA 1DJHA 2YIHA 4I6KA 3B0YA 4IPJA 3F03K 4RNFA 2X42A 1S38A 3KOXA 4LEQA 1EOKA 2J75A 2PDCA 1IEIA 4KEUA 1UROA 4OU1A 4R9XA 3TTEA 5CG7A 3BJTA 1LG2A 5K4ZA 1XINA 1J6PA 1V8EA 4H9ZA 3WD1A 2YCJA 1PS9A 3ITGA 1OT1A 4RDVA 1DJQA 1K77A 3WF2A 3H23A 3C2RA 5G4WA 2OELA 4P61A 4GJ1A 1Q4NX 1FHLA 4C6EA 3OP2A 5FIPA 1SJAA 3STGA 1TTPA 3TROA 3GHTA 3NTYA 4UXDA 4G7FA 3ZM8A 1QK2A 4PULA 3R8HA 2C15A 2CETA 4Q8NA 3B8DA 3O0FA 1MQQA 3JRKA 1QI2A 3UR5A 3B8IA 3AHTA 4QEHA 3BAYA 4MLJA 2VD9A 2BVWA 1U83A 5BXRA 2ON3A 4ZQMA 3N9RA 4CGTA 1GVRA 2I17A 8TIMA 5U4NA 2JIWA 1TE6A 3IS4A 3PZUA 4LOCA 2NXGA 1P1XA 2FJUB 2RJGA 1UMLA 1FP8A 4AY1A 1DJWA 4PB5A 1G4SA 1OB0A 3HV9A 1KQZA 3KHDA 2GFTA 3IIPA 1UWTA 1JD9A 5EGRA 1FP9A 5A6BA 4ZVJA 4DYKA 2RKXA 4IIBA 4W9TA 3HFYA 1E4MM 4DZ5A 2YYTA 3QQ1A 3DERA 3A3WA 1JVNA 1AQMA 1HQTA 4LYQA 3W23A 5CPMA 2DZPA 2A3HA 3AFBA 1EPXA 3KP1A 1BYDA 4UQDA 4DXXA 4U28A 2E9BA 4ZZ9A 5IDZA 3DKJA 1KFLA 1MUMA 3KL3A 4OKDA 1NIUA 3CAVA 1K7EA 3G1YA 3HTWA 5DY3A 3AYRA 1R3RA 4CD5A 5LIXX 3TIMA 5CJNA 4L4MA 3GD6A 4MDOA 3NXLA 2ZIDA 3ABXA 3TQKA 2RHGA 4GABA 2E6FA 1YX1A 2J6XA 3EB2A 2P88A 3CXOA 2PU0A 2P50A 3AXKA 4ZODA 1ESWA 3EOUA 1GHSA 2HEJA 3XINA 1L8PA 1XLEA 1WZMA 1CXKA 1XYZA 3S47A 4AZ7A 2RDUA 1KM2A 3UXLA 4MUZA 2XG9A 2JGQA 1MUWA 3AS1A 3BZGA 4E3TA 2NT0A 1WYIA 2QR6A 2WHLA 2QMJA 2NWRA 5JUVA 4Q4PA 2DZAA 3E1F1 2RJHA 3LHWA 4NJJA 2PMQA 2DIEA 5CPLA 1LYXA 4HHLA 1X97A 5DX7A 4DB7A 1DWIM 4PRWA 4H9XA 5TD4A 4OOZA 3ZYZA 2Z00A 4NYYA 4KETA 1PO9A 3EOLA 3O1NA 4GYPA 1VC4A 5DF0A 3TYAA 4HU8A 3AXMA 1IQ8A 3BLEA 2PA6A 4W8AA 4EXBA 3W7KA 3R6IA 2D0GA 1UKTA 4JQ2A 4DO4A 3UJEA 2P8BA 4LVAA 5FEXA 1UKQA 4ERIA 4GYKA 2WMFA 2W67A 4HZ6A 3SSJA 4CCCA 2UWFA 3CWOX 3N2BA 3UJRA 4C60A 4XBKA 4TVCA 1ML1A 3NR0A 4FS9A 3M5ZA 4NHVA 4J40A 4Q8MA 2DU2A 4DIAA 5A5WA 5BXSA 1EYEA 1JYXA 2OZ8A 1JCMP 3HGJA 5FF3A 4PSPA 4RE4A 5IBXC 3WK3A 2WVTA 3VGEA 1UKPA 2X1SA 2VGBA 3MMUA 1M68A 4B4HA 3VDCA 3LYEA 1MEHA 1KLYA 5HNUA 3IAQA 1VFHA 2Y6ZA 5HR6A 4HZ7A 1KA9F 1RJPA 1R2SA 1GTHA 2JBMA 3TWBA 5TF0A 1VRDA 3BICA 3N17A 4PMNA 3EEZA 2HK0A 1B2YA 2NUXA 1LTDA 1LOQA 3MT1A 3AZTA 2IS7A 1XQLA 2RDXA 4AZHA 1WNOA 3LXCA 2ZX5A 3CAQA 1KKRA 3DAQA 3UR7A 3C0JA 4QE5A 5DO8A 1R2TA 1ZZMA 5L9FA 4HTYA 1PB0A 3M0KA 3VO0A 4FLOA 3ITTA 5A6BD 1JYNA 4MIMA 5AKQA 3N73A 1YKWA 2EPOA 2X0HA 4LRTA 1CPUA 4W4QA 5TIMA 1EJTC 4WXZA 2FZ9A 2BY3A 3VDHA 3IJQA 1G69A 1W5QA 3CU2A 4ZXOA 3H7VA 2VZTA 1W5PA 1IGSA 1OADA 1ZTVA 2J79A 1WQ5A 3BAXA 2WMHA 3H8AA 1FWNA 4MJ4A 4K68A 9RUBA 5HPCA 3NQFA 4JGDA 1ODZA 1QWKA 1SZFA 2PWEA 4XSMA 4Q6XA 5E9AA 4Z1BA 4A8IA 3M0HA 2BV9A 4GYJA 4PE8A 4NRSA 3RILA 3E2VA 1DWAM 1SR9A 1X1NA 4UTHA 3U6WA 1PZ2A 3W53A 1UR1A 1PBGA 1Q6FA 4O13A 1CEOA 3PBMA 4IICA 4DZAA 3JVAA 4JN7A 1R30A 1S39A 4CD8A 3CQHA 4PUDA 3NQ8A 3NQDA 4JYEA 2G4JA 5F1VA 2UV8G 1VYSX 1CGXA 4J1OA 1QT1A 3VMOA 2ZZ7A 1TV5A 2CESA 4PL1A 4GQQA 2YDAA 1Q8JA 5IRPA 1CXHA 1K9TA 1RLCL 3W1LA 1W31A 4IT1A 2E3ZA 4M19A 4D6HA 5K9XA 4UUIA 5A95A 2G0WA 1KTBA 1OFOA 1R6WA 2OEKA 3SCRA 4QISA 4GVGA 1VRXA 3W75A 4R27A 3IRDA 4S3BA 4Q4SA 1SR0A 2ZX9A 4MJ2A 1LG1A 3EOOA 3BJSA 2NV2A 2Z1XA 1E0WA 4EK7A 3PSWA 5TQLA 3STFA 1Q63A 1XH0A 3QY6A 1K70A 1GJWA 5LIWX 1KWGA 3DKLA 4WD0A 1MVYA 3T9PA 3OIXA 5FI8A 3BQ5A 2GWGA 1YTDA 1C9DA 3CHFA 4A6GA 4E4PA 3O7UA 4FR6A 4GGBA 3PFMA 3GH5A 3GU1A 3TTOA 3VE7A 2NQLA 2WPBA 1RAKA 3N25A 3E9AA 4IISA 4KERA 3VNIA 4C6NA 3NSNA 4DLFA 5D9NA 1TZ7A 3ARPA 4M7TA 1JEZA 5I03A 2MANA 4LUIA 1IIGA 4JL1A 3LCXA 1CWYA 4GYPC 4M1BA 1F3WA 1V6TA 2C7FA 1GQJA 3UNTA 1QHPA 2V5DA 3WDPP 3DFYA 1FWGC 1YHTA 4IQDA 5E9XA 3LCIA 3CUHA 1A5SA 4AHPA 4A8LA 3USBA 1IGWA 1GORA 5FJUA 5AZ1A 2XIMA 1GCYA 3MUY1 1VPXA 2HQAA 2VGIA 3S0CA 1XLKA 4A3YA 3NL5A 3G77A 3U8GA 4JICA 3JR2A 3UG4A 1THFD 2QCEA 4HOXA 1XLCA 4B9YA 4GO9A 1KFEA 3RO6A 3G1XA 4HPJA 4XAGA 3GYEA 1QHOA 2QUVA 2OLHA 4D72A 1TFVA 1AK5A 1XFCA 3ONBA 4GHRA 3P82A 4NI3A 4H19A 4M6VA 2O7SA 3V4BA 3ZJKA 2ISVA 1P4CA 3W02A 1EJWC 3APTA 1TUXA 4URIA 1MRQA 1XGDA 4NASA 4AIEA 5CPNA 5C6MA 5HNNA 4PTDA 4LT9A 2Z0IA 1XRVA 1AMYA 2Z29A 4OVXA 3WK2A 3EYPA 4M24A 3HQOA 5HMDA 3S5NA 1RXOB 3KVLA 3HO8A 3PR2A 4QROA 1V77A 1W6TA 5CAKA 3EKZA 4PB3A 2WC4A 1QR7A 1ZBKA 4IIHA 2FMOA 1F76A 3V1PA 1VHCA 5D05A 3AJXA 4O4WA 3I4KA 3L4WA 1U1UA 3SRFA 2CLIA 3VZZA 2Z1VA 1WDSA 2WNZA 4EWND 3G8RA 3AMGA 1H51A 3QGAC 6TIMA 4BQ2A 2WMGA 3D5HA 1AUSL 4B3LA 4R85A 1KCLA 1O5KA 4IJRA 2D2OA 3PNUA 5JBDA 2QJGA 3PPHA 4UC5A 4W7UA 1T5AA 3SURA 4BK9A 4Y9PA 2A3LA 4C90A 3TMLA 1OGSA 3R11A 3HF3A 4M80A 5HK4A 4IOTA 3OGVA 4N2YA 1E6QM 2FH6A 3S6DA 1R0MA 3WBXA 1VYPX 2Y89A 3MP4A 3PBGA 2ZXDA 3TU9A 5HNTA 5A6LA 2DPEA 3W2LA 3NQBA 1WPCA 2WNQA 1I4NA 5T91A 2H9AA 3DU0A 1CXEA 1OC6A 4GIRA 4UFJA 4AHOA 2DIKA 1I2OA 3ZVIA 2J25A 4TX9A 3OG3A 1TQJA 3DG7A 4KFPA 5EBUA 3PBVA 2Z1SA 1W1IE 2ZRVA 4KBXA 5FD0A 3FOKA 3EPMA 3PY2A 2VVSA 3P0XA 4ZOEA 1AJZA 3GHSA 1MUCA 2YDSA 5J5DA 1O5QA 3A4WA 2Z2AA 1B9ZA 5D8WA 4OTKA 3VIKA 5JH2A 3GZAA 2H9AB 3CQKA 1FX6A 1YIXA 1EPVA 1VKFA 4MPKA 3BLKA 3BAJA 3W00A 3ARZA 5GVJA 1QDSA 2HROA 1CGUA 2D1ZA 3T0DA 3UYIA 1EZWA 4QTGA 4WDWA 1N7KA 3C0QA 3KRSA 3T40A 4GH1A 1AA1B 2Z6IA 3B97A 3SN0A 2A7RA 2HTMA 4AWEA 2PPGA 4MAZA 5M5DA 3AXXA 2OX1A 4M5PA 5DY2A 2FQIA 2Y63A 1CXLA 3BLOA 1R2RA 1ZFJA 2ZKMX 4PR4A 3G2GA 1TUFA 2FPTA 3WH9A 3I7RA 3V0SA 1B54A 1KGWA 2HS6A 3FKRA 1MNSA 1F8IA 3UCDA 2ZZ5A 3PM6A 4QX4A 1CLKA 3MSGA 4ES4A 4QE1A 3WFLA 1TJRA 4IMGA 4GBDA 3VD9A 4KFOA 2CCRA 5K9CA 1HL2A 3SCOA 4D8LA 1MFUA 1IHIA 2NZLA 4DWSA 3W1TA 2ZUSA 3W7HA 4UR8A 1LL4A 5D2VA 1Q7MA 1I2PA 4DEFA 4GINA 1CI1A 4C6LA 4AIBA 1G1YA 3VDGA 1BYAA 1DJGA 3UJSA 5CH9A 1Z3NA 1BWKA 1UD5A 2OODA 5AB3A 3QF0A 2WSPA 1PKNA 3PZGA 3NXFA 3W01A 2CLKA 4C6IA 3S2CA 2IKHA 3SBFA 3TYUA 3WX7A 1S2TA 5AHLA 4AZIA 1ITCA 1OINA 3GE7A 3EWCA 4DWSB 3PHAA 3H2AA 5AHMA 2ZWYA 3TONA 3VOFA 4P8UA 3MSRA 1GPFA 3BVJA 3C8NA 4KWSA 4LBSA 1ZLPA 1JCTA 4XTIA 5AOUA 2DP3A 4PTXA 2DJXA 1KB3A 4CQDA 4XZLX 4NIRA 2E0PA 1DKWA 4M7SA 4HOWA 2QDHA 3QLLA 1FRBA 1UR0A 3CM4A 1P6BA 3W7EA 1FVPA 2ACQA 2FDMA 3B05A 4GIEA 3ARWA 1RPKA 5HQEA 4CVWA 1XX1A 4L9ZA 3SN1A 3QOKA 4Q8WA 3ZT7A 3QR1A 2GGIA 1Y8BA 2V30A 2XH7A 1GVEA 1W3LA 2DZXA 4O15A 1MZHA 3W07A 2XN2A 4WGHA 1V7YA 4KFNA 2ZC1A 1C8XA 3TE9A 3WUBA 3EX1A 3GWQA 4NRRA 3KBSA 1G94A 3O15A 1WBHA 1SJDA 2OGYA 5M1TA 3UA4A 3GU9A 2Z1BA 3DN5A 3LNMA 1IWPA 1W9PA 1BAGA 2VX6A 3ELFA 1F61A 1OX5A 4OGZA 4LB4A 3SB0A 3EDJA 4IMDA 3CGTA 3FA3A 3PTQA 2ATSA 2BGNE 3MC5A 1JIBA 1Q13A 4I9JA 3QV7A 3OLEA 3Q94A 3M64A 1A5BA 3OVGA 1MSSA 1RSCA 2XZ9A 1VIZA 2QS8A 2YL9A 4NI8A 3PN8A 4IFRA 2GJXA 4GI4A 3STCA 1DXIA 1XV8A 3CUIA 1ZBWA 2Y61A 4WQ6A 4HB7A 1R47A 4I5UA 4OHQA 3RU6A 4M82A 4DBWA 2JQXA 4YIWA 2FHCA 3CK5A 4IGNA 4LAOA 5G2WA 2OSYA 3CT2A 4JDBA 1TPWA 3W2NA 4UNKA 2OWWA 1JFHA 3H4WA 3MSDA 3WNLA 1PZ1A 1Q6QA 3WK1A 3BH4A 2WCAA 5A94A 4M0XA 3WDQA 3DUGA 3UWZA 2DEPA 5CLTA 1E43A 5LNWA 3QSRA 4A2SA 3AAMA 2GYIA 2GJXB 2TRSA 5XINA 2ODOA 1ECEA 4HK7A 1YDYA 4EIVA 3H6OA 1AVAA 1MW2A 4UOJA 2PGRA 4Q8TA 5T26A 1US3A 1OCQA 4QJ1A 2TYSA 4HA1A 1TPVA 2FZ8A 2GQAA 1J01A 3ZXWA 1K4HA 3LPFA 4JTGA 4LF2A 1VEMA 4M29A 1XLIA 4DWSD 3CMFA 1V0KA 1DHPA 2O56A 1E71M 2XVLA 4GYFA 3L4UA 2DQWA 1GKRA 2J24A 1LBMA 4B5WA 3PZTA 4QDPA 2CLMA 2ZRWA 3DFSA 4WKHA 3T6CA 1DQWA 5EYWA 1Y5WA 4FLRA 4GX8A 3RCYA 4EAYA 2FB2A 1XISA 2GQ8A 3QR3A 4B91A 1X39A 2PZNA 3N11A 3U9IA 1EC9A 4HU3A 1UWIA 1H2JA 4CNTA 2F6KA 5I3KA 3LV6A 3S1GA 3ATZA 3QVQA 2YXXA 3MI6A 4AU0A 3WH5A 5ECVA 3JZUA 4BI7A 1P0EA 1XCWA 2A7NA 3M6YA 4HZMA 3OBKA 4AWTA 1KFCA 3IIZA 5KTLA 3GKAA 5D2YA 3UZYA 1FKXA 3FDGA 1KBKA 2XN0A 4NYUA 3IANA 5KEZA 5I2UA 3MSYA 4CNPA 4XZMX 2WZIA 1WBJA 1RVGA 4JQ3A 3KBWA 3ITOA 2BS9A 4OBTA 1NU5A 3WDHA 4U10A 3CPGA 3IK2A 2JE8A 2WWDA 1E5NA 5FOOA 4LVBA 4WCJA 3SM0A 4CNUA 4XD3A 3WEOA 1EJXC 3NQ7A 4ICMA 3DYMA 1GEHA 4INFA 3QR0A 2E6YA 2QEZA 4DWSC 4DNHA 1FBAA 2A1YA 1RVKA 1UKSA 3OVQA 2VDHA 2O92A 5HQMA 4XK2A 1QK0A 1IEQA 1LWIA 4YHEA 2HWGA 4PMDA 1WOAA 4F9DA 3SFWA 1OGBA 1XCXA 1KV5A 4AZ6A 4IX2A 2Z27A 3CAKA 1TPC1 4JTRA 4AEOA 4HA4A 3WJSA 5HANA 4Z2GA 2BOGX 3Q45A 1EL3A 3HPXA 4R53A 3PPGA 1C29A 4A3UA 3SIZA 4MF4A 3BAKA 4WIWA 5FACA 2GDQA 1LRNA 1JRCA 4LUYA 2YB1A 1GNXA 5BWAA 2PDKA 2GPTA 4PEEA 4EKJA 2XIJA 3URNA 3WF0A 3CO8A 1T99A 1A4MA 3GTHA 2BOFX 4NJHA 3OOQA 4C91A 4M1RA 4LYPA 1T0OA 3TTSA 2H3DA 3RX4A 3H55A 4CCDA 4H00A 2VGGA 1NFGA 2OWCA 1W17A 4KH2A 2NQHA 1OC7A 4Q8PA 3T44A 3PUOA 1QNSA 3C5QA 2L5HA 4Q22A 4DRSA 2FZBA 3UGRA 2I9EA 2HXTA 4BF7A 1EP1A 2J7DA 3WDRA 2OKOA 2A6LA 1ZBCA 1K8YA 1CTNA 3R4IA 5HR7A 1WCGA 3NUKA 4JTHA 2D3NA 1P0BA 2WHKA 2YDQA 3H21A 5I6SA 1AJ2A 1W91A 1EIBA 2ZVRA 1TE1A 1HJSA 1G4TA 3W85A 2G3FA 4POCA 1VFUA 2O4QA 1H0IA 1XIIA 4FXFA 3R89A 4ORMA 1HGWA 2PDQA 3YPIA 5GPRA 3WMLA 2JF6A 4J2PA 3ENLA 3VNLA 1OK6A 4ICNA 3W1NA 3WF1A 1H7WA 1EGZA 3KRUA 2IPFA 3UZXA 3WNPA 5H8PA 1J93A 5D9PA 1UUQA 1QOPA 3VIJA 3VK5A 5D4YA 3SY5A 2ZC8A 2A3CA 3CYJA 3WN6A 1P1MA 3B9DA 4F0KA 1GW9A 3AHZA 3WCZA 1J11A 2C0AA 4IMEA 3G1FA 3DHPA 4I8DA 1IT8A 1G7UA 3FJ4A 1VP5A 3KLLA 2D69A 2PSNA 2WZHA 1UASA 1TA3A 4JNMA 1TX0A 3S42A 4Y9MA 4HJWA 3R2GA 2BXVA 4H8HA 3MO7A 1BTMA 4DBEA 3UR8A 2YZRA 3SRDA 4X63A 3K8LA 4DO7A 5REQA 2D73A 3JZEA 2F6UA 4WRHA 4O57A 4RNHA 2WZTA 3F4CA 4FNPA 4LQ1A 3SO7A 4BI6A 3TYCA 2I56A 3E5BA 2V6AA 3DESA 3VM5A 2QVHA 1RJRA 1W56A 5GNZA 3MMDA 2GUBA 3FKKA 4B3KA 5HWMA 2R82A 2CBIA 5FEWA 2X1UA 2G3IA 3QMRA 2ZQ0A 2JGYA 3MI2A 3IVUA 5REQB 1C9WA 1XF0A 4N7QA 1WXJA 3QSTA 3F2DA 3BZJA 3CH9A 1V3KA 3A4AA 4O0ZA 2X40A 3L7RA 3UWYA 2FLIA 2BHZA 3LDVA 3S1WA 3HQ1A 1UUMA 1S3TC 5MHBA 3MV11 1TMHA 1GHRA 3GZ3A 3PUGA 1F07A 3WD4A 4MB5A 3WNNA 1TJ2A 4RR4A 4H83A 1XYBA 4R7OA 2GWNA 3P3BA 3OYZA 2HPIA 1SZGA 3VGDA 1B90A 2BY2A 2HVOA 4TMCA 5I0DA 3HJZA 4C6BA 2XIOA 2X41A 4B5VA 1KXVA 2I14A 3THUA 3GX9A 2DW6A 4BR1A 3IJ7A 4M81A 3UFYA 1PCKA 4G5DA 3WJXA 2PDYA 3CUFA 2EPLX 5KZEA 2AKMA 4UOQA 1TV4A 3TXVA 2PF8A 1CGWA 4O17A 3KRBA 5CSUA 1R3QA 3SQSA 1HJVA 2PRLA 4RDYA 2PDXA 4A29A 2G37A 3V35A 3R12A 1K4GA 3SCUA 2NUWA 1ITXA 1FWAC 5FF4A 3EPNA 2PP0A 3RPDA 1HO1A 2OQLA 2QCCA 3FAWA 4GC3A 1DJZA 4B9ZA 3CHCA 4KCTA 1TPFA 4AYSA 5CGTA 3LSBA 4WJ8A 3MBFA 3ECQA 5IOBA 4ZSUA 5KZDA 5TBOA 1J0IA 3T7VA 3OBAA 1GVIA 3W82A 1NF7A 3V18A 1O4UA 1BG9A 2GVYA 1QATA 3WH6A 3U4FA 3W37A 3UXDA 2EPKX 3BAWA 2Q02A 1V6YA 1LJYA 3CQJA 1XP3A 3WMCA 1KCZA 4MB1A 2GOKA 3R43A 3VGGA 4GVHA 2VX5A 3TTQA 5BMWA 2YBTA 2XSXA 2ZA2A 2QLYA 3VCNA 4K8EA 5DMLA 2I7GA 2QULA 2QIWA 1AFSA 3UETA 4FIRA 3T09A 1AZ1A 1Q6EA 3B8VA 3CS2A 4UFIA 3L0KA 2J77A 1ZGDA 3SRKA 2QF8A 1VPYA 4JQ1A 4HHMA 3AC0A 4O10A 1GWJA 1GZJA 2BWGA 5I78A 3S2LA 4F0MA 3N6HA 5EMLA 3KCJA 4L6OA 4TV5A 1UD6A 3E0VA 2QJJA 2VENA 2R24A 3CH0A 4CEUC 2NQ5A 3MI3A 2X2YA 2PB1A 3RR4A 4RZ6A 1YTKA 1FHDA 3E49A 3GC4A 3NDYA 2W6RA 4IPPA 3V7PA 3KVKA 4Y9NA 3P67A 4B5NA 4Q3MA 3BOXA 4Y8EA 3II1A 2EKCA 3B0VC 2CWNA 4HYWA 2PTXA 2ZVIA 2V2HA 3APGA 4B5TA 3UG8A 1GOOA 1O12A 2VR5A 3PZNA 1CXIA 3N14A 3FGCA 1LZOA 2J13A 1FCUA 5BCAA 1L6WA 5BU6A 3LNPA 4ZQCA 3LPPA 1UOZA 4HSNA 1HKMA 1HO4A 4TTGA 1GJUA 2JEPA 3VZYA 2ISDA 2QJIA 4BF5A 3Q37A 3GG1A 2NLIA 3GRIA 4FOKA 2Q8ZA 4XSLA 3EBVA 2NXHA 4NVTA 2VCCA 1VCGA 3H2CA 2DDXA 1EB3A 2EQDA 3K8KA 1PX8A 2I16A 2OMAA 2VRQA 4JEJA 4HOZA 2Y8UA 3FGCB 1FWJC 2ZX8A 2Q01A 2VC6A 3AHYA 2GGGA 5CZKA 4PMXA 3O05A 2G3NA 4GH3A 4AMAA 3WLHA 1BF2A 4HCDA 3QY8A 3THQA 1UQZA 2IKJA 2XVPA 4C6KA 1PTGA 1ONRA 4XAPA 3LLXA 4LSBA 1XYMA 4AAJA 2PDFA 1W1ZA 1JDCA 3QZ6A 4DPPA 4F0HA 4ROQA 2VFHA 3BLFA 3GDKA 3S1UA 5JVLA 5IFPA 2V8ZA 3BAIA 2HRWA 4KESA 1WZAA 1NAL1 2OLSA 4PCSA 3B9AA 1ADOA 4C6MA 4HP5A 1WKYA 4XZIA 3DI1A 1IZCA 4BHYA 4G2DA 2PBGA 1L6FA 1OX6A 3UXIA 3UW6A 1ZHAA 1V0MA 1DHKA 3AUJA 3R25A 1X7IA 5RUBA 4P2VA 1K7XA 3GFYA 1QNOA 3GUWA 3VOJA 3SDOA 5E93A 3J7HA 3WJYA 4TV6A 5JQ9A 3ZSTA 4XKYA 1VFMA 3VYLA 1B3WA 2G5WA 4MG4A 2WSRA 1TELA 4HPGA 3SCWA 2YX0A 2CNCA 1XCFA 1M01A 2EEXA 2PLCA 3C8FA 2OWXA 1XSIA 3KOZA 2BXZA 2VDGA 3BOFA 1R9ZA 1L6GA 3BG9A 1V93A 2E4TA 4UTIA 4GFIA 1UH4A 1MMFA 4HU4A 3EWUA 5T9CE 1Q5MA 2W62A 4CLMA 2WHMA 5D2XA 2VFEA 4Q32A 3GR8A 3DFPA 1LL7A 1OCJA 4XKYB 3BSHA 4EX4A 1TPB1 5H8UA 4Q8UA 3GR7A 1MW3A 3QYSA 2E28A 4ZQPA 3G0XA 3QXBA 2PDGA 3NQCA 1KV8A 1DWJM 4OBSA 3H54A 4GI6A 4DZIA 4UTFA 1DIOA 1GOMA 4IUOA 4HNNA 2J7FA 3LRLA 3WLTA 2VFFA 1XBZA 2Y0FA 4TVDA 4FHAA 1GVFA 3S1XA 4F3HA 1NVMA 5D2TA 3LZ3A 3VD4A 2WSQA 1E9YB 4JTQA 1J96A 4TTUA 3VD5A 3H2NA 1YE6A 5XIMA 5LXEA 3DENA 2YB4A 3T2PA 4GQRA 3RLGA 1HG3A 1ISYA 5BZAA 3OQEA 2E1DA 3TDFA 4K8HA 1OFBA 4O8RA 4H6KA 5CEWA 4Z2HA 3LOTA 1UWQA 2PDBA 2PRMA 1J5TA 1OFQA 1XUUA 3VPLA 2F6XA 3A4JA 1UZ4A 5DBTA 3CC1A 4EWJA 3WNKA 5I79A 2FB3A 3NZRA 5BXPA 4HMNA 1LDCA 3PTDA 5CSYA 1M04A 1EO7A 1OG6A 3WLRA 1MI3A 3H2OA 5I00A 4C6DA 1M65A 2V3DA 3L65A 1QO5A 3T8QA 1X6NA 3RJYA 2V67A 4K36A 2H8ZA 4FIQA 2Y88A 2J4GA 8RUCA 3T8LA 2E6DA 4DYEA 1TVLA 2QAPA 2WMKA 1IIHA 1Z69A 2VFDA 2VWSA 1Z9AA 4DI9A 1YDNA 4WSHA 3OPSA 1DWHM 3PZVA 3GVQA 4NNCA 3O6YX 5A8PA 3ZLGA 4UZSA 5A69A 2VI0A 4PMVA 2OOGA 3PB0A 2XH4A 4HPXA 4AD2A 1CCWB 2PEVA 1T6MA 3KS6A 3Q58A 3ZR4A 4BA0A 3G18A 2X09A 3PWIA 3CMJA 1UZDA 4LPCA 3ZFHA 5AYYA 1SMAA 2ZBTA 3P5ZA 2QJMA 4GY7A 1S5WA 1K02A 3RAOA 7ODCA 3GTFA 4CKQA 1E4NA 3WFAA 3GC5A 2ACRA 1JRBA 4NF7A 3WL1A 1UR9A 4O53A 3W83A 4UTTA 3CWHA 3OBEA 1XH1A 4ZOCA 2XIQA 2OG9A 1DXFA 1Z44A 1TWIA 2GSHA 4ZENA 2DZWA 3Q67A 4QITA 1BF6A 2QVNA 3TLQA 3TMQA 1K9FA 4X22A 5A8GA 2VR4A 4XO7A 2A2IA 2QCGA 2WZMA 1TJ1A 3NQVA 4LUJA 5FL0A 2RGLA 5HOSA 1S2VA 1PYMA 3AIRA 2CZDA 1G7VA 5M2FX 1V79A 1Q6CA 3SAZA 1GKQA 4GO8