2RHGA

Tryptophan synthase complexed with igp, ph 7.0, internal aldimine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
250
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Tryptophan synthase complexed with IGP, pH 7.0, internal aldimine
rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 89
structure length 250
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2rhgA00
1S3HA 2NV2A 3QH2A 5E1QA 4ZVJA 3TMLA 1QPNA 2JKAA 4JYEA 1VYSX 5L9FA 3G8RA 2RHGA 1G7UA 3M5YA 1HUVA 3UPWA 4JEQA 5TIMA 4JDYA 2RDTA 2VEPA 1PVNA 3QQ1A 3TW6A 2E6YA 3D0CA 6TIMA 2Z2UA 3IIPA 5A5WA 2YGYA 3B0VC 5AHEA 1L2UA 2ZRVA 3LX9A 1A5SA 5DCEA 4UIOA 1A50A 1SO3A 4IMDA 4KWVA 3TV8A 3UXAA 5E0KA 2QJIA 3GNDA 1R47A 3L2IA 4ZMGA 1I2NA 3MHUA 3W88A 1LOLA 3BLEA 4A2RA 3S8HA 1FCBA 2IQTA 4NNCA 2H6RA 4LUJA 4JS3A 5LKYA 3PUEA 3NPWA 3TXZA 4NJHA 3W6YA 3AO0A 3VFLA 5C55A 1IXNA 3STFA 1QPQA 5CGQA 3DFNA 3KRUA 3NPVA 1WQ5A 4DF0A 4WZHA 2ZZ1A 2J9XA 3GLCA 4O13A 2XFWA 3M9YA 3I7QA 2F84A 3BARA 3CB8A 2E6AA 3G22A 2Q8ZA 3ATYA 4X22A 1O94A 4O14A 2NX1A 4EOUA 4UNLA 3OIXA 1X7FA 4HSOA 5G1TA 1Z41A 4ZQMA 3SECA 5HR6A 3BW2A 2FB2A 4DF2A 2NXGA 4GUGA 1TREA 2B7OA 4O57A 3TROA 1O5KA 3LOTA 4UTTC 3HQ1A 3M1ZA 3HG4A 5IBXC 1QWGA 2HS8A 4MYAA 1QO2A 1GG0A 3PB0A 5K9CA 5C54A 2WOQA 5EYWA 4Z0JA 3W1NA 2NX9A 3W7PA 4YL2A 1M7PA 4DBDA 2AQWA 1WYIA 2GJNA 3F1QA 1JQXA 1LORA 4K7VA 1JCNA 4KFNA 1EX5A 3LBMA 2VOMA 2DZXA 4YXGA 1H51A 1VS1A 5FEZA 5LNRA 1JCXA 1GG1A 2VEMA 3BG9A 2A0NA 4Z1BA 1OX4B 3LHTA 5G5IA 1EP1A 2A6LA 5EA9A 2RDUA 3PB2A 5KINA 2A2IA 1IIHA 1G4TA 3P74A 1GVSA 5FF3A 5CPLA 2Q3OA 2HTMA 2B0MA 2YW3A 3EEGA 3KXQA 2ZA1A 3QMRA 3G1FA 4LS1A 3CQ0A 1ONRA 1EIXA 1XUUA 1FDJA 4H6KA 1WBHA 3HF3A 4MVAA 3HBLA 2OZ0A 3GDTA 5KSWA 4P61A 3W7MA 4UFIA 1THFD 1SO4A 3NQAA 3W1RA 4MZ1A 2VFFA 3G8EA 4TMCA 1H5YA 1H7WA 1TPB1 3FFSA 3U2OA 3DFTA 2YX0A 1T96A 1ALDA 1B57A 4OV9A 4DPPA 3BG5A 2A21A 1OF8A 1OVDA 3EXSA 5CSSA 4ZQPA 1P0NA 5F1UA 4FIQA 2CZEA 3WK1A 2PC4A 3LTSA 3A5VA 2QEZA 4UC5A 3OVPA 4QITA 2QCHA 1QR7A 3TAOA 3EWWA 1XBVA 4LC6A 3TA6A 3T7VA 1XDLA 5G2HA 4ORMA 3G0XA 1MEIA 1K8XA 1KBIA 1W37A 3LI0A 4I7UA 1WOBA 1LLZA 3L0GA 4FIRA 2C18A 4LUIA 1P0KA 3W9ZA 1JRBA 5HWNA 1VZWA 2V2HA 4NT0A 1HFBA 1LBMA 1NVMA 3TXVA 4JTJA 1XDMA 4I7VA 4ONVA 1DBTA 1F5ZA 1Z42A 5U7SA 3N73A 2O7SA 1KV5A 1NEYA 3IVTA 3G24A 1ADOA 4FX6M 3LCFA 4N4PA 4M19A 3GX9A 4R34A 1QCWA 2QCDA 2TPSA 2LLEA 2ZBTA 3KVKA 2BXVA 3M44A 4AHOA 5AYZA 3TUUA 2NWSA 4UMCA 4WQ6A 4ZL1A 3C52A 3PM6A 3TW7A 4P2VA 1SO6A 4MOZA 4B5NA 4CQAA 4JD4A 3O6YX 3W1UA 1L6SA 3G18A 1CI1A 1LBLA 3IGUA 3IEBA 4FNPA 3Q58A 4QSHA 1WBJA 1SW7A 3IIXA 4Z08A 3TC7A 5D38A 4MJZA 3S9YA 3C2OA 2QUVA 4JTFA 5HUPA 1O4UA 2XN0A 3N2MA 5K4ZA 1X6UA 4DEFA 4NZFA 1BTMA 4S2CA 3W86A 2X1SA 3MMTA 3W3OA 3TQ0A 1EP2A 1RR2A 4PH6A 3QMTA 3W74A 1F73A 2EF9A 2WQPA 1TJRA 2H90A 5HINA 3SGUA 4E38A 1HO4A 5IM51 3PBVA 1W8SA 1T0OA 1J5TA 3B8DA 1YXYA 1DJNA 1JULA 1H7XA 1SO5A 1TB3A 1I2QA 1WXJA 2OMAA 1D3HA 3W7IA 3E0IA 1QDSA 4I9AA 2E5BA 2GUUA 1AG1O 3CTLA 3RLUA 1FDZA 2W0UA 3PULA 1RPXA 2HMCA 4O8RA 3QFEA 1TRIA 4PA8A 1DORA 3W7JA 4JX6A 1SZNA 2OJPA 5BRBA 2GPTA 1V7YA 3QZEA 3N2XA 4IMEA 4JR5A 1KM3A 2ZA3A 2FLIA 1R2TA 2D73A 1KFEA 2ZCGA 1YDOA 1IGSA 3MHFA 3HG5A 2P0OA 3EB2A 3IV3A 3WJWA 2EGZA 1WA3A 2E5DA 3INPA 4XBKA 2E5CA 3TNOA 3NXFA 1DL3A 3W76A 5GVJA 2CLFA 5DXYA 1GOXA 1VYPX 3QMSA 4TMBA 2E1DA 3NL6A 1I2OA 1KFLA 3IGXA 2A7NA 3STCA 2VFHA 3STGA 3U8GA 4BI7A 3R2GA 4MYXA 1P4CA 1GT8A 2E68A 3NL5A 4O19A 3PSVA 3CIXA 1TJPA 4IQLA 3W22A 2B7PA 3LHUA 3NO5A 1W3NA 3IGSA 3N19B 5D37A 1GYLA 1KFCA 3CEUA 1GYNA 2O7QA 2I1OA 5I3HA 4S1FA 4MY9A 2QCCA 5LHEA 4KFPA 4NXSA 2YDAA 1H50A 2VFEA 5AHIA 1MEHA 3SY5A 4BI5A 3BV4A 3R5EA 1VCVA 3NNTA 3C8FA 4OQVA 5EBUA 2KZHA 4JTIA 4QNEA 3NA8A 5LNWA 1ICQA 3S5ZA 4RXGA 1JUBA 2H8ZA 3H54A 3C2EA 1GJPA 2I14A 2Y88A 3W7LA 5FESA 2CZFA 3GXNA 1JCMP 4UTWC 3TCEA 1VCGA 1GWJA 1JCLA 4ALDA 3W1PA 3LCWA 2NX3A 1T99A 3THAA 2WSYA 1UUOA 3DENA 3UNDA 1ML1A 1SZEA 1YDNA 3LLFA 1TYGA 1SR9A 5A8GA 1GTHA 2EHHA 3CIWA 5D04C 5AB3A 1FWTA 3OA3A 4RJEA 2FB3A 3VI2A 2J6XA 1EWDA 4AF0B 4UFLA 3C61A 1K8ZA 3NZ1A 5DN1A 1VQTA 4PL1A 5DELA 3UQNA 3NL2A 3W7OA 3PSWA 3R12A 2ZZ7A 3UY7A 2Y85A 3HGSA 3HO8A 2YR1A 3HPSA 2DP3A 3KX6A 2QUTA 2ZA2A 1FWWA 2VEIA 4HHPA 4XWUA 1YPFA 5G2WA 1QOQA 2PCQA 4Z1AA 3HPXA 4AWSA 4N02A 1MO0A 3EX6A 1ICSA 4A2SA 1I8JA 1VHCA 2B7QA 3USBA 1IXQA 3BK0A 3G1DA 4UTLA 5DBUA 2CU0A 5HWJA 3L5LA 5F4WA 5D05A 4DO6A 2ZDRA 3LXCA 1EWEA 3W83A 1TPVA 1O60A 3KAOA 4FX7A 3G1SA 4UFKA 4ADSA 3VKJA 1K03A 3W7DA 4ZQRA 2QAFA 3W1TA 2ZTJA 1ZAHA 2CW6A 4Y8FA 4JGDA 4LRSA 2E09A 5D2VA 3Q2DA 1XBZA 4C1LA 5KMYA 4BK9A 4FNTA 3PC0A 3PG8A 3TJLA 1HO1A 3NM1A 4GFSA 4H3DA 1KLZA 4E0CA 1RD5A 3NGJA 3CLMA 3THQA 4IMCA 2CLMA 3TR2A 4ORIA 1KTBA 3M6YA 1FBAA 4O1BA 1VH7A 4NNAA 1ZFJA 2QJHA 4O1AA 1GTEA 1XFBA 1QMLA 1X8FA 1FWNA 3W7KA 4UMAA 1VLIA 2XN2A 2E77A 2QCEA 1OYAA 4HNVA 4JTUA 4JY8A 4AB4A 4LV9A 4C1KA 3LHZA 3L66A 4MKNA 3FYOA 3L67A 1HL2A 2TMDA 3GVGA 3TH6A 1LRTA 1Q6RA 4HNNA 2R94A 5LZLA 1TPUA 1EA0A 3PWAA 4A29A 3LM7A 1NFBA 3W7CA 2FDSA 1ZHAA 2A85A 3GAKA 3PF3A 3C3NA 1WX0A 3VE7A 3A24A 4M6QA 1G6CA 3QRHA 2AAMA 2QDGA 1JR1A 1N7KA 2VC6A 5U4NA 3W72A 4UNKA 4FEZA 4ADTA 3I7SA 4U4MA 5FF0A 5HR7A 4YCOA 4UFJA 2ZYFA 3LERA 1PL9A 2VEKA 3O6DA 2W6RA 3EWBX 3BW3A 4UTMA 2X1UA 4UUIA 2ZRUA 2CLKA 4ZZ9A 3GXTA 4WY0A 3V1PA 3EXTA 1GPWA 4EWND 5AHMA 4LW7A 3NVTA 3TQKA 1GVRA 3A22A 3PS7A 2V2DA 2JBMA 4ICNA 4QISA 4ZQCA 4Y6GA 1PS9A 2QCMA 3A21A 2X1TA 1O95A 4WXYA 3N9SA 1X1ZA 1U83A 1G7VA 4JDBA 3WK3A 4MUZA 5CPOA 1OFEA 4IXHA 3MBFA 3W7HA 1SSDA 2NZLA 5KZDA 3VCRA 5C2XA 1LP6A 3CWNA 4GUHA 1DV7A 1L9WA 1V5XA 1PHWA 1LROA 1W0MA 3UPBA 2FIQA 1J4EA 2CLHA 1AMKA 3P84A 1C8VA 3M7WA 3M41A 3UXDA 5D32A 4IX0A 5E93A 1H1YA 4K6AA 1NAL1 1TMHA 4O1DA 4FX8A 1X1OA 3VE9A 4CLMA 3G0UA 1VLWA 3LHVA 3M43A 2GJLA 5HULA 1JJKA 2A7PA 1TPFA 1GQNA 3HJZA 2QCNA 2VFDA 1WV2A 3G1XA 2WSRA 1SW0A 1YXCA 4N4QA 5CZ0A 4WXZA 3GKAA 4FXRA 4RZ6A 1D3GA 2WKJA 1QFEA 2V30A 3DI0A 3W7QA 2J88A 5AFDA 1KFKA 3S1UA 4CCEA 4Y9AA 5SWUA 4LS2A 4NJKA 4HPJA 2FJKA 4PFMA 3WK0A 3BPWA 2QCLA 2G96A 4U28A 1OK6A 3P61A 3SSJA 2H3BA 1FY6A 3Q37A 3W07A 1G4EA 2X2GA 2H3DA 3M5XA 3UWQA 1EEPA 2OX1A 1DJQA 4WY0F 2DORA 4LTSA 1XI3A 1JUKA 3TJXA 3LI1A 4TX9A 5K9XA 1ZCOA 3P62A 4UFMA 5FEPA 1TQXA 3SW6A 5FF7A 4AMAA 2QJGA 2GQ9A 4O50A 1VCFA 2CWNA 3PBWA 1DVJA 1H7RA 3NOEA 1Q3NA 2V81A 1WDWA 5LGZA 3P82A 2ISVA 1YPIA 3QEZA 1DKWA 2ZRYA 4NVTA 1SFJA 5K4XA 1H7OA 2C15A 3W2MA 3GB6A 1RQHA 1TPEA 4ADUA 4M6PA 3W2KA 1YYAA 1E51A 3NPXA 3G1HA 1R46A 1ZY9A 1PCWA 1OFOA 4Z0SA 4WUIA 4K8HA 2G5WA 2W79A 4LC8A 3ANYA 3LHWA 1H1ZA 4O28A 1RQEA 1PV8A 3LDVA 2BX7A 4OE7A 3HPZA 3ZS4A 3MP4A 1OFDA 3NQ7A 4O15A 2ABAA 3HGJA 3NQVA 8TIMA 1KV8A 2CLEA 1WAUA 4X3ZA 4LVFA 3NEVA 3NZRA 3TIMA 3NG3A 1LOQA 3KVLA 3IRDA 4M7TA 4NXKA 1KM0A 1P5BA 1KM5A 4BWLA 5EMUA 4POCA 4L4MA 3UZJA 4MJMA 5I3KA 5EKYA 1TIMA 2X1RA 4JTLA 5FEWA 2ZRZA 3L9CA 1H7PA 1TPWA 5D03A 3PAJA 3QW4B 1JCJA 3L65A 3PUDA 4AH7A 4N9DA 4RLIA 2E6DA 2X30A 3IIVA 1R30A 2V0TA 1IF2A 4E2BA 1G69A 5J5RA 1YTDA 2VFGA 3P8JA 2QUUA 4PL2A 3MYPA 3DFQA 5D2YA 1W5QA 4O0ZA 5G1YA 4CQ8A 2H8XA 3ZWSA 3LLDA 3P81A 1JUEA 4K37A 4PC8A 7TIMA 1QPRA 4XKYB 1T8XA 1I2PA 3QSRA 4CCDA 5KZMA 1FX6A 1PIIA 3OHIA 4DPQA 2HSAA 1OJXA 3VNDA 2WJZA 3DH7A 3EXRA 2J24A 3NQ2A 3PG9A 4UCGA 3UZ5A 4FF7A 4O52A 3WFAA 4NJGA 4O17A 5D2WA 2TYSA 1SFLA 3EWUA 4Q33A 1Q45A 4PODA 1ZAJA 4UTJA 1W5NA 3O07A 1R2SA 3QM3A 3LBCA 4RXFA 1FCUA 4GNJA 2QF7A 3L68A 2VKZG 4MFDA 1XUZA 4O11A 4HPXA 3GDRA 3IIZA 2A1YA 3W1LA 1OX4A 3LRKA 2ZFAA 4JTTA 1XBXA 1YXDA 2WO5A 1SUXA 3P80A 5TQLA 3UD6A 4JY9A 3FJLA 3CWOX 1OF6A 4JIQA 3O15A 4O0KA 5LNSA 3GZ3A 4WD0A 5DY2A 1F6PA 1Q6QA 1SZGA 1VYRA 3B05A 5F4SA 2YFOA 1BKSA 2Y6ZA 4R7JA 4GE8A 6ALDA 1OX6A 4XZ9A 3IVUA 2B4GA 4N9BA 2WSQA 4YLWA 5FEXA 2JKPA 5HQEA 1TV7A 3GKFA 4IUOA 2WNNA 1NSJA 2RFGA 1GZGA 4GJ1A 4N9EA 2JGYA 4EIVA 4JX4A 4HNUA 2CZ5A 4QIUA 5DBTA 5LSMA 1OYBA 5DLCA 5C6MA 2NUYA 2V9DA 1OK4A 1M7OA 3LHYA 4KFOA 3W2JA 2JGQA 2DZTA 5K9DA 4D2JA 5F4XA 3CU2A 2C14A 3S5OA 4UR8A 3ZFHA 5CSRA 1GVOA 4GC4A 3CHVA 4CNNA 2CFFA 2V5LA 3MI3A 4FNRA 5D2XA 2ZRWA 5AYYA 1AW2A 3MHGA 4LVDA 1Q6OA 1KFBA 2WNQA 2DJLA 2GVGA 4MFEA 1FCQA 3RU6A 1XCFA 1W3TA 5D02A 4JTEA 5LHFA 4K36A 3T40A 2VXNA 4N2YA 1VR6A 3B06A 1Z48A 3N3MA 4HT3A 1IXOA 4AAJA 3EX3A 3DFSA 3NR0A 3S1XA 4LU0A 4Z1DA 4JYFA 3W23A 4K7YA 1W56A 3QPYA 3W84A 1XM3A 3K30A 4X2RA 3E96A 2OT1A 4TIMA 3MO7A 3PUOA 3NQ6A 2XN1A 3DHDA 2NV1A 3FIGA 4OV4A 4AWTA 1S5TA 5CZSA 3F03K 4XTDA 3SZ8A 3B0UX 5EY5A 4YMZA 1DQWA 4JX5A 5CKSA 5BW6A 4LNYA 4EF8A 1EUNA 3DGRA 3SFKA 3O6CA 2A5HA 3H53A 4IPIA 3EWZA 3IIOA 3DI1A 1VHNA 1FCVA 3TMQA 5AN7A 1IXPA 2P10A 4QQ3A 1Z44A 2JK2A 3A9IA 4YWIA 1H60A 3PY2A 2ISSA 4EF9A 2RDWA 3U6WA 4LOCA 4ML9A 1RZMA 1TO3A 3SI9A 4N6EA 1W5OA 4O18A 1KTNA 3G3DA 3NM3A 3NQGA 4UTHA 4O4WA 3P7YA 3R13A 4WOZA 4W9TA 5K2ZA 3I65A 1OFPA 4GRSA 3I6RA 3O63A 4J9JA 2G97A 3TU9A 1RV8A 3S1VA 4E2DA 3GXPA 3E49A 4QAIA 1A5BA 2ZZ4A 1R2RA 4JYDA 4JTSA 2GVJA 3S5NA 3W73A 3BO9A 4JNMA 3HG2A 3S5YA 4FNQA 3JR2A 2YFNA 3NQCA 3E02A 5G4EA 2UV8G 2G95A 1SU5A 4OHQA 3PBUA 2A4AA 1H62A 2YW4A 2Y61A 3V75A 4MY1A 1SZFA 3LXBA 4AHPA 2R91A 3PBYA 4WX2A 1AL7A 1TPC1 2ZRXA 3RF9A 3T44A 4MZYA 3CPRA 1JRCA 2X16A 1S5VA 2CLLA 3KVMA 1SQ7A 4S2BA 3UWUA 1O5XA 2VFIA 4LVAA 4UTTA 3N9RA 5T26A 4FNSA 3UWYA 2BSLA 5HUOA 2Y62A 1UB3A 4AHQA 1A5CA 5H2ZA 4NX0A 4O54A 4MLJA 4O10A 4XBSA 3LRMA 3LRLA 5BNKA 4CQ9A 3T78A 2A6NA 2DZPA 2HS6A 5AC6A 4JXCA 3QPZA 2WNZA 4UR7A 3MI6A 1TV5A 4GUJA 5DY3A 3TC6A 2DZSA 4NUWA 4MIMA 2YSWA 3HMJG 4FXSA 4JICA 4H4IA 1BWKA 3G1AA 4BF9A 5FF4A 4GUFA 3BLFA 3W87A 1LTDA 3R8RA 1DQXA 1F76A 5KITA 4AVFA 3EKLA 4OBTA 4Q4KA 3W2LA 2FPTA 1VGAA 3YPIA 3UYCA 4HN4A 1LBFA 4LY8A 4OWGA 1XKYA 5LGXA 1BEUA 3GK0A 2ZZ6A 3GIYA 5J5DA 1KM1A 4RZ4A 4MZ8A 4O12A 2QKFA 3BGGA 3MW7A 4N6FA 5BMXA 1GVFA 3F4WA 3LTYA 1LRQA 4BR1A 5AHFA 4NNBA 1FUYA 2YZRA 4X9SA 4CNPA 3MI2A 1OABA 3I68A 1PCKA 4Q32A 3TFCA 2J27A 5F2GA 1I2RA 1ZNNA 2ZZ3A 2QCGA 4WJEA 1OFAA 3UY8A 4KKXA 2FQIA 3DKJA 3EWXA 4JTHA 2YYTA 4XQ6A 4I7WA 3GDMA 1U5JA 4XUGA 1ZENA 3LCHA 1LCOA 5HWMA 3W1QA 4RX0A 3CC1A 3F4NA 3P67A 3UWZA 1G4SA 1JVNA 2BWGA 4MLRA 5DCDA 3LB0A 3I7RA 3HGOA 5F1VA 5CZTA 4A3UA 3W7RA 4AF0A 4LVGA 4Z1CA 4G1KA 4IJBA 3RFAA 3NDOA 4DELA 3T4CA 3KFTA 4PEKA 3L0KA 3C0JA 2Q8LA 2QCDB 3SR7A 3C4UA 3HB9A 3KVJA 4R33A 1FXQA 3L5AA 3TFXA 3QQ0A 3EX2A 1W31A 1QOPA 4QNWA 3UWVA 1OHLA 2DZWA 2NWRA 3MYOA 4TR9A 3W1AA 3W75A 1LDCA 2F7FA 4O1CA 3O06A 3P8IA 1CX9A 3W85A 1RQBA 3TE9A 3TAKA 1NF0A 3ELFA 3HIJA 3JS3A 3O16A 3RNDA 1LZOA 3R89A 1KM6A 2Y7GA 1GVQA 4Y96A 1D9EA 4XTIA 2Y7EA 2C19A 5I3GA 1P1XA 3NAVA 3NL3A 1F05A 1H63A 1OG0A 1PE1A 1RVGA 3H55A 3MJYA 2EKCA 2ISWA 3FKRA 1YLVA 2ATMA 1M6JA 4NQ1A 2VELA 2GQ8A 3B0PA 3DAQA 4N9CA 3DFOA 1I45A 3PR2A 2ZQ0A 5G2IA 2PRMA 4UXDA 3M5ZA 4UTKA 3QC3A 4M5PA 4FNUA 2FFCA 4NJIA 4O4VA 1C9DA 3O8AA 1FWSA 1QNVA 1H7NA 2C0AA 2C3ZA 3RK8A 3W70A 3IVSA 4IOTA 3JRKA 3TSBA 4AEOA 2VENA 1VJIA 4QJ1A 4QM1A 3AJXA 3MUXA 4K8EA 1UCWA 2Y70A 3NYZA 1LLWA 5ABTA 3W1XA 2WV8A 3FLUA 4UMBA 5LNVA 5D09A 4RR4A 1XBYA 2B7NA 1TTPA 1TPDA 3WK2A 1TTIA 3RMJA 1JCYA 4PCFA 5L6UA 5KZEA 4LS0A 1ME8A 3CT7A 2BLEA 1G67A 2C6QA 1FWRA 2QAPA 2V8ZA 2EPHA 3FA5A 1EB3A 2QDHA 1B4KA 1MZHA 4IXXA 1FXPA 4M6VA 5KTLA 3EWYA 4EVZA 3P60A 3SIZA 3PVFA 4BFAA 1TTJA 4DXVA 2GQAA 4WOQA 2CLOA 2ZTKA 1FDYA 4PTNA 4O53A 4KWWA 1ME9A 5F2LA 3CM4A 2PRHA 4O16A 5FI8A 3WJZA 3WJSA 1KFJA 1TSIA 4BI6A 1KLYA 4HKPA 3BW4A 3ZWTA 4YCPA 1KM2A 4JTKA 4RZ5A 1FQ0A 1UBSA 3G1VA 1YTKA 1K02A 2R8WA 1A5AA 2CZDA 4Y90A 4MPQA 1ZJIA 5TBOA 2OT0A 2BZNA 3KRZA 3M47A 5F2IA 3GR8A 5BMWA 2TSYA 3NQ8A 3LCIA 3TQVA 5DCBA 1J2WA 5I3JA 4A21A 5AOUA 2NUWA 3G3MA 1UASA 1SW3A 1KTCA 4RCXA 1K8YA 3CEPA 4NU7A 4DQWA 1QO5A 3W7NA 5FF2A 1YTEA 1HG3A 4LV4A 5C5YA 3FYPA 2CLIA 2DZVA 2J9YA 5AC8A 4UTWA 5EPDA 3NQMA 1K7XA 4K38A 3T55A 3RLVA 2A7RA 1N55A 3S1WA 3FS2A 4ZQNA 1TRDA 3A23A 3ABRA 2J9ZA 1B3OA 3HGRA 3QW3A 2TRSA 1XXXA 5I3FA 4NJJA 3ABSA 3B4UA 3LXAA 3DU0A 1KA9F 3ZR4A 2ZZ5A 4DO5A 2JKEA 2DU2A 4IGHA 1AK5A 1F2JA 3A5FA 5AHNA 1C29A 3DXIA 1MEWA 3L0NA 4UTIA 5HMSA 3W1MA 1W1ZA 3P5YA 3W2UA 3DKLA 5K7JA 1KW1A 3QF0A 1ZALA 4IMFA 1ICPA 2R14A 3SGZA 4GWEA 3EX1A 3TX9A 2Y89A 4JTGA 3GYEA 5K3VA 3GAYA 1W5PA 2FTPA 1W5MA 1F7BA 2GVLA 2OCZA 4LRTA 3DHFA 2PURA 3QJAA 1MSSA 3KRSA 2Y63A 1TCDA 1LOSA 1TV8A 1KBJA 1OFRA 3KHJA 3GR7A 4IX2A 1G4PA 3MBDA 3N34A 3S0CA 4AXKA 1DOSA 2C13A 3ATZA 2AGKA 3OVQA 3NQFA 3W7EA 1K3UA 3N14A 1QAPA 1XL9A 2ABBA 3OEXA 5CPNA 2I9EA 1Y0EA 5MHBA 2E6FA 4RV8A 2Z1BA 5AYXA 4FO4A 5D30A 3C56A 4IWWA 3M16A 3G1YA 4OGZA 4IPJA 3TK7A 1OYCA 5CPMA 1LM1A 5EL1A 3C6CA 4FHAA 3GNNA 3WJYA 1SSGA 4GXMA 3LGEA 3BLIA 3NQDA 1L6WA 3C2FA 3BG3A 5D2TA 1HTIA 2QR6A 3E9AA 1SPQA 4TU1A 4NX5A 3FEMA 4AWUA 3C2RA 3MP3A 4OT7A 3BGJA 2NLIA 2WPBA 5H91A 2Z6IA 4BWLC 1F6KA 1EPXA 1F74A 2PRLA 3C2VA 4IMGA 3O1NA 4HNTA 3GDLA 2P1FA 3Q94A 1WOAA 4LT9A 4DO4A 2Z6JA 1QPOA 2FPVA 2Z0IA 3NPUA 3BVJA 1BWLA 1VC4A 3LTPA 4HIBA 5HNRA 2Q3RA 4GUIA 2FPYA 1W3IA 2ATSA 3S42A 5CG7A 2ALDA 3GDKA 4UFHA 3DFPA 3SJ3A 3STEA 3WJXA 5CZJA 4NZJA 3M5VA 3TKFA 4WY0B 4MY8A 2V5BA 3TSMA 1UJPA 1N8FA 4LVBA 1OX5A 1Q6LA 3OBKA 5G4WA 3TSDA 3FJ6A 4XKYA 3QYQA 1K7FA 4LWWA 2PE4A 4K39A 3FOKA 1TQJA 3OVRA 4DF1A 1OFBA 4JN6A 4DBEA 1VPXA 3LCLA 1EUAA 3LCGA 3FKKA 3HOJA 1AW1A 1W54A 2ZZ2A 1AL8A 1KM4A 1IIGA 1VRDA 5F2MA 3LCXA 1K7EA 1OFQA 2GOUA 3P5ZA 5HJLA 1S5WA 1TPH1 1YDVA 4HSNA 1CW2A 2NXHA 1LYXA 2YCEA 4OU1A 1B4EA 3EKZA 4FB7A 4JIPA 1A53A 1UUMA 1B9BA 5AHLA 2Y7DA 3DZ1A 1ZAIA 1PHQA 2DJXA 2YYUA 3MWAA 5AC7A 2EAWA 1LRNA 3HG3A 2Y7FA 4TO8A 2V82A 2BTMA 3B03A 5IBXA 2RH9A 1JQVA 1YADA 1GEQA 1M5WA 1ME7A 1TTQA 3W71A 3UWWA 3LV5A 3EX4A 5D33A 2C16A 1I4NA 2YXGA 3L5MA 2RKXA 3O05A 1EP3A 1XC4A 3LV6A 4CCCA 1DHPA 3TDFA 2NUXA 5DXXA 3W7GA 1NF7A 4UTUA 3B04A 2DZUA 4L4LA 3L21A 4M7SA 5I3IA 3DBPA 4RKAA 2C1HA 3MP5A 3W2NA 3NQEA 4CNOA 4RK8A 3QSTA 3M0ZA 4A22A 1H61A 5BOOA 3S6DA 5LNUA 2QCFA 1MXSA 3KOFA 3ABOA 2YPIA 3ABQA 3G0SA 2V2CA 3E12A 3OG3A 4R53A 4GBUA 1AW5A 1L6YA 4ZQOA 2NXIA
chains in the Genus database with same CATH superfamily
1YIXA 2DT1A 3TMLA 4DJDA 1LUCA 1GVIA 2VRKA 1DQUA 1E5NA 1UMYA 2V3EA 3G8RA 1BF6A 1W9VA 3T6CA 5GQBA 6TAAA 1FWCC 2RDTA 4JDYA 2VEPA 2E6YA 3S6OA 3CL7A 4AY7A 3BLLA 4DWSA 3ZIZA 3MV11 1R3TA 3SY8A 2YGYA 4GZ7A 4S3CA 1US0A 3EOUA 1L2UA 5IFPA 2Z1KA 3LX9A 1A5SA 5DCEA 4YIWA 4KWVA 3TV8A 3UXAA 1QK0A 2QJIA 3FHQA 3L2IA 1R47A 3UVAA 4EAYA 1I2NA 1LOLA 3BLEA 1RLCL 1FCBA 5GNXA 1IZCA 3GFZA 1BVWA 4LUJA 2VX4A 3A3WA 1MMFA 3NPWA 3TXZA 4NJHA 3W6YA 4H9ZA 4DYEA 4JL2A 1IXNA 3STFA 5CGQA 1VJSA 3MC5A 1PUDA 2QULA 3HM7A 5E0FA 3VNYA 2D2GA 1HJQA 2WLZA 4WZHA 4D6FA 1DXIA 3EAUA 3EDEA 1DWFM 2AL2B 3V7PA 2E6AA 4FR1A 3G22A 2VRQA 3AMDA 4CQCA 3WMSA 1HN1A 4O14A 3LD5A 2YOCA 3OIXA 4HSOA 3NEHA 1H1NA 3SECA 5CC6A 2ON3A 3OODA 4O57A 2J4GA 1O5KA 1K9EA 1EGMA 1RA5A 1OINA 3RM9A 1HVQA 3BDKA 3HQ1A 1QWGA 2ZX8A 3PB0A 5C54A 3TR9A 1R3RA 3DESA 3DGBA 3SN1A 3WQPA 3RMEA 4C6PA 2W91A 1WDRA 2WANA 2DZXA 4EACA 2Q8XA 1C3FA 1GG1A 2WMFA 4HHMA 3BAIA 5JBDA 2A0NA 1OX4B 4WRHA 2A6LA 2VX6A 2J25A 3E6EA 2GGHA 5H8MA 3CB3A 4HCLA 1E6XM 1GVSA 3UJ2A 4KT2A 3M0HA 3EEGA 4G6CA 3KXQA 1DJZA 3QMRA 3WFZA 3OPSA 1BVNP 3H2EA 1EIXA 2PDXA 3GVWA 3AZSA 2J75A 1WBHA 4BJHA 2PF8A 4MVAA 1ITUA 2OZ0A 5KSWA 4P61A 3W7MA 4PMUA 2OB3A 3NQAA 4H8VA 2VFFA 1F07A 3EYPA 1JGIA 3RJYA 4W4QA 3HZ3A 4F0SA 2GK1B 1XWYA 3DYPA 1T96A 1W1TA 3A4AA 3VCNA 4DPPA 4IMAA 1C7TA 1EHNA 1OVDA 4DJEC 5EMYA 2WVVB 3D46A 5AY7A 3CAQA 1VP5A 2BOGX 2GGJA 2PC4A 3LTSA 1XIIA 3VAVA 4UC5A 3OVPA 4OTKA 4QITA 3RR4A 5FSDC 2O55A 3SEPA 2WMHA 4ACZB 4ORMA 5FKYA 3CV6A 4PUKA 1KBIA 2XSAA 3BTNA 4I7UA 1VFTA 1LLZA 4KH2A 3AUJA 1MRAA 4GY0A 5HWNA 3DDMA 1OY0A 1LBMA 4RL3A 4JTJA 1XDMA 1UWAA 1S39A 3WDPP 1Z42A 5U7SA 1NEYA 2VC5A 2VZOA 4FX6M 4P8UA 3L4YA 1QVBA 3SRKA 4NP7A 1D2KA 1QCWA 2TPSA 2LLEA 3GIQA 3S4TA 2ZBTA 1CT5A 4IISA 2CNCA 4NIRA 4BQ3A 5AYZA 4WQ6A 2BG5A 2VEGA 3A64A 4HMEA 1BKHA 2IUZA 4MOZA 4CQAA 1PYMA 5JBFA 3G18A 1RHCA 3Q58A 1J01A 3DERA 3QFWA 3PTDA 5A6LA 2ZXBA 4QSHA 1TVPA 4QDPA 1WBJA 3AROA 1R38A 1P0EA 3WUFA 3PZVA 4AU0A 1O4UA 2UWFA 1V4YA 4DEFA 1B0IA 4S2CA 2XVNA 3WQOA 1R9XA 4Y8EA 3TQ0A 4PH6A 1VBRA 2XIOA 3QMTA 4M80A 1NARA 1F73A 3UP8A 2EF9A 3AYSA 3DIPA 4Q4PA 5D4YA 2H90A 5HINA 2KAUC 1HO4A 3UA4A 3WL0A 1YXYA 1Q6CA 1DWAM 1SO5A 1I2QA 1UP2A 4AZ7A 2FHBA 5H8UA 3RO8A 2E5BA 4Z2HA 3RLUA 2W0UA 3WIJA 1ZUAX 2XVKA 2HMCA 3QFEA 3LGDA 1DORA 4AZCB 4PMXA 1XIJA 2BGSA 4H00A 3OZPA 4KWSA 1SZNA 5BRBA 3QZEA 2ZA3A 4I6KA 2FLIA 2DH2A 3UVIA 4BCEA 4GHRA 4J28A 1IGSA 3JVAA 3HG5A 5E9AA 5CAKA 3QKZA 4H01A 3GXIA 1A5OC 2Z1XA 2E0PA 1L2QA 4W7VA 1NDVA 4XBKA 3TTQA 3TNOA 1GKRA 3NXFA 3W76A 1DE6A 4LCSA 3PN8A 3QMSA 3MUCA 4LYRA 2FJUB 4GXWA 4PSPA 3E0FA 4BI7A 4MYXA 1JF5A 1P4CA 2E68A 4O19A 3CIXA 3VZXA 1XLLA 2INFA 2J13A 1Y5VA 1GOOA 4OUIA 3CEUA 1GYNA 1LT7A 4WHBA 1U33A 4S1FA 1PDZA 3KCOA 3VGFA 1JDAA 1VFHA 4GO8A 1H50A 2VFEA 3ITXA 1F4HA 4KF1A 2XVLA 4KCVA 3R5EA 3UERA 1S2CA 1A3WA 3NNTA 1FOBA 1F3WA 3OJGA 1AZ1A 4PTMA 4QNEA 4LUTB 4AZ6A 4CQDA 5CG0A 1JUBA 1QHOA 2H8ZA 3H54A 2I14A 2Y88A 1UR2A 3ZMRA 1EEXA 1XLMA 4GH3A 3TCEA 1JCLA 4ALDA 2NX3A 1KWGA 3THAA 4B15A 4HOZA 1JG9A 1VEPA 1GZJA 5C70A 4KETA 1X98A 2VM8A 9CGTA 3WD3A 1KR0A 3E2QA 4CQBA 1C8QA 3N9KA 2V38A 2F6XA 3DBNA 1DIDA 4PBEA 4YS1A 4J5NA 4Z17A 3PK7A 2XJ7A 1VQTA 3VUPA 1XIDA 3NL2A 2VR4A 3B0XA 1ZJAA 3W29A 4PEEA 2ZA2A 3VNKA 4XWUA 5CPSA 5G2WA 3C3UA 1HL9A 1PBGA 2PCQA 2PPGA 1UWTA 1V3KA 2EBNA 3CASA 2XM1A 1XICA 2DQWA 1OB0A 2B7QA 5DBUA 3BV7A 4QLKA 2ZX6A 3W83A 5CAHA 1TPVA 1O60A 2FMOA 5LIYX 1GZ1A 4H2CA 1J0HA 1M65A 4UFKA 1K03A 4MAZA 3UBPC 1UWRA 1ZAHA 4AX7A 4LRSA 1JZ6A 1UD5A 5D2VA 1XBZA 4U5KA 2WM1A 1ZP4A 1F8IA 3PC0A 2E7FA 1HO1A 3NM1A 4GFSA 4E0CA 1QT1A 3B8SA 1P7TA 3KS6A 2VNCA 4UOQA 2IQ0A 2IKJA 3RCYA 1SYTA 5JIPA 4M1RA 3K8KA 3GTFA 1B3YA 2BVTA 1DJWA 3NVDA 2XVGA 4GVIA 3TA9A 2Z25A 1X8FA 3R79A 2ISFA 1VLIA 2XN2A 2E77A 3QR1A 3VMOA 1OYAA 3RHGA 4QE5A 4HNVA 2GL5A 4JY8A 4HA3A 4JIRA 3L66A 3N15A 3GH5A 1E9LA 2TMDA 1AJZA 1LRTA 4JBRA 2ZXDA 2HXTA 4DIAA 5LZLA 1EA0A 3VDBA 3WBYA 1KGXA 8A3HA 3LM7A 3MKVA 3C0LA 2VGIA 4WVXA 3BJFA 3A24A 1NU5A 3B8WA 1XYFA 4C6BA 1NJJA 1CGTA 4UNKA 4ADTA 4PCSA 5D9MA 4C65A 3EOSA 4NI3A 3LERA 3W0KA 3K1DA 2VEKA 3O6DA 1XLJA 4J35A 3BW3A 3AMLA 1RH9A 2PLJA 2BHZA 4ZZ9A 1CXIA 1TA3B 3ZZ1A 4V33A 4XKMA 4F0LA 4EWND 5C8BB 1H11A 2V2DA 3H2FA 1CXLA 1RK6A 2JBMA 4H19A 5IXEA 4AC1X 4ZQCA 1RY0A 1WXZA 4Y6GA 3NFUA 2QCMA 3WLMA 2X1TA 2VC9A 5LXEA 1X1ZA 4WDTA 1GOQA 1G7VA 3WK3A 1SJCA 3NSMA 4MUZA 4Z2KA 4I8YA 3BQ6A 1SSDA 3WDIA 4F0KA 3MS8A 3CWNA 3O3RA 1DV7A 1OD0A 3QTPA 1KQZA 4NHVA 1PHWA 1LROA 3UPBA 1EC7A 3LQLA 2PWEA 1C8VA 3W01A 1XISA 3BZGA 4B5TA 4K6AA 1NAL1 2F2HA 4X0VA 3RITA 4O1DA 2OSXA 3BMWA 4JHMA 3RPMA 3G0UA 1VLWA 2PDFA 1NELA 1KCKA 4LF1A 5HATA 1JJKA 1TPFA 3NZGA 2VFDA 1WV2A 1L8PA 3GHTA 1SW0A 4N4QA 4MG4A 2VR5A 4FXRA 4GGBA 3C0SA 4EAMA 1QFEA 3W7QA 5AFDA 4C6FA 1F4AA 2OO6A 1XLHA 3P61A 2VTFA 3A3HA 4Q4QA 4BQ5A 3S6TA 1FA2A 1G4EA 3UWQA 3M5XA 4QE4A 2OX1A 3TJXA 4TX9A 4UFMA 4F9DA 1PX3A 3UJFA 3WYZA 2GQ9A 2OSWA 3M0JA 2XWDA 3MSDA 1DVJA 4HBKA 3FSTA 3S9IA 1J79A 1RPKA 2RUSA 2J7GA 4PTVA 3IK2A 4PZVA 1DKWA 4G2DA 1SFJA 1F9CA 3FX4A 2C15A 3VU2A 1NFPA 2D0GA 1UA7A 2PP3A 4M6PA 4ADUA 1GKPA 1R5YA 2E8YA 1PCWA 3U7BA 4Q7IA 3LSBA 1X8CA 2ACQA 4WUIA 4Z0SA 3BQ5A 2G5WA 2W79A 3S46A 1UIPA 2FZDA 3LHWA 1EJVC 4AVNA 1Z89A 3BSHA 4IG2B 1EXBA 3BJSA 1C8YA 2E28A 8TIMA 3HGJA 1B3ZA 1PDYA 2DZBA 3NZQA 2NLYA 3GVVA 4LVFA 4P7NA 1LOQA 2HRWA 3KVLA 3IRDA 4NXKA 1KM0A 4DO7A 3GC2A 4W84A 3GR4A 4BWLA 3WLJA 4POCA 2AL2A 5I3KA 3AIWA 3L9CA 4YVVA 2BASA 3SRDA 1TPWA 3CIVA 5D03A 3ONBA 4WSHA 3QW4B 6REQB 3L65A 1QWKA 2OYKA 4N9DA 4RLIA 3MUAA 2E6DA 4QGCA 4IFOA 7CGTA 1B30A 4GNKB 4D8ZA 2NV9A 1PYFA 1ZU8A 4O0ZA 5JBEA 5G1YA 3LEPA 1J12A 3O2LA 3LLDA 3P81A 3BICA 1ZL1A 1QPRA 3GDBA 4XKYB 2ZICA 1Z69A 2O9RA 3T2QA 1HP5A 3SUTA 4DPQA 1OJXA 4QR6A 1MW1A 2WSPA 4US5A 1CYGA 3VM5A 4UCGA 3UZ5A 4FF7A 4O52A 5TF0A 3WFAA 5BYWA 3TVAA 2W27A 5A8NA 3WQ8A 1JYXA 2C1GA 1EQPA 4NAEB 3WQ6A 4FMVA 2D20A 4RXFA 4TVDA 3LBCA 1GW9A 1FCUA 4L80A 3L68A 1RK5A 4MFDA 3IIZA 2A1YA 5I06A 4XB3A 1OX4A 1FWFC 2P3EA 4B4FA 2GZXA 4AZHA 4JY9A 4TTUA 3FJLA 4JIQA 3QY8A 5LNSA 4WD0A 1VYRA 2FZNA 3B05A 2Y6ZA 2W62A 1UC4A 3D5HA 6ALDA 4KGLA 4HHHA 3TCSA 2XPKA 2WSQA 4HU4A 4YLWA 5FEXA 5HQEA 1TV7A 2WNNA 4DHGA 1ADDA 4UQAA 2XIJA 4M29A 2JGYA 4JX4A 3U4AA 1OYBA 4LANA 3ZT7A 2GK1A 1EC9A 1R3SA 1H5VA 4GQ0A 4L1GA 3N04A 3C0QA 1V6UA 2WVVA 1Z6KA 3F4DA 1IT0A 5F4XA 5GJNA 3LSCA 2DVTA 3ZLGA 1RCXB 2BFGA 2QHAA 3BAWA 1YE4A 5EMKA 3UR5A 3KCLA 5D2XA 2ZRWA 1W1VA 5EGRA 1Q6OA 2YBUA 4MFEA 3DFHA 1XC6A 4JFWA 1B90A 1PB0A 1XCFA 5D02A 1N8IA 3V16A 4W7WA 2VXNA 4MB5A 3N3MA 1PZ0A 3EX3A 3DFSA 4Z1DA 4JYFA 3W84A 4K7YA 1XM3A 3THCA 2PAJA 4X2RA 2XGBA 3MO7A 1C90A 1W32A 5JH2A 2QUNA 2ZE3A 3SZ8A 1E0WA 2QZRA 4YMZA 5CKSA 1ZJBA 3SFKA 1DYSA 3EWZA 3ABZA 3LS9A 1N2VA 2D3LA 3NQBA 1E71M 3VGDA 5A8OA 4QQ3A 3A9IA 3PY2A 3RX2A 3LG3A 3BAKA 4HA1A 5KZ6A 2WJFA 3G3DA 4YJ5A 2ZIDA 3R13A 1OFPA 1Q6GA 3I6RA 1EJ7L 1UZ4A 1AMYA 2PWFA 4WR3A 3VD3A 1D7FA 3TU9A 2DY3A 3GXPA 3E49A 4E8DA 4QAIA 1A5BA 3WD4A 2GVJA 2IPJA 2ZUSA 4U31A 1V02A 3BO9A 4JNMA 1XSKA 3HG2A 3S5YA 4ILSA 1OC6A 4F9JA 2A4AA 1H62A 2IS7A 5CBBA 1K1DA 3MY9A 3R1ZA 3LXBA 2POZA 2R91A 3WQGA 4WX2A 3UWEA 5HAOA 3RF9A 3T44A 3CPRA 5M5DA 1S5VA 1SQ7A 1TWIA 2GFTA 7XIMA 1O5XA 2VFIA 1FH8A 3QVQA 5T26A 3LQGA 3FJ4A 2YDQA 4BQ4A 1EYEA 1BWVA 3QXBA 4O10A 4XBSA 4DB7A 1BAGA 5AC6A 1KKOA 1PWLA 3TC6A 2DZSA 4NUWA 2XFYA 1FKXA 3M0LA 4FXSA 3ALFA 4GYKA 1BWKA 4J1OA 4ZODA 3RDKA 3BLFA 2H9AB 1LTDA 1DQXA 2O56A 4IT1A 1OIFA 4AVFA 1AZ2A 3S2JA 5CC3A 4OBTA 4Q4KA 1TCMA 3TJ4A 3GVRA 2HWGA 4HN4A 3THUA 2R82A 5LGXA 1JDFA 3BLDA 1QUMA 3IJ8A 2ZZ6A 4Q8OA 3GIYA 3GSMA 5J5DA 1KM1A 4MZ8A 4O12A 4GQBA 1I9CB 1W2VA 3QV6A 2QDEA 5CJNA 4UZSA 2AOSA 3ARZA 4LUTA 1R7OA 2Z4GA 1PCKA 2PTYA 1ZQ5A 4R88A 3M4HA 5F2GA 2W5FA 1R86A 1Q7MA 3VD4A 1BYDA 3WNPA 3UY8A 3QLLA 4AWEA 4MNJA 1QK2A 2PSNA 4HVXA 4CD8A 4M8UA 3VC5A 3C8NA 3CAVA 4J2MA 4XUGA 3AXIA 4CN4A 4ZO8A 1LCOA 5LA2A 3T9PA 1ZBVA 2BMBA 3ZSSA 4QJ4B 2XWEA 1J8VA 2ANUA 3HGOA 3W6MA 3D3AA 4AC7C 2ZDSA 3AXMA 4LCQA 1M04A 5B7ZA 1SR0A 4DELA 3CZ8A 3KFTA 3L0KA 3C0JA 4BHYA 3GG0A 3AHZA 1NOFA 3C4UA 1TZ7A 3HB9A 2DSKA 4C5YA 1XIEA 2FHFA 4E5TA 1W31A 5DT5A 4GI6A 3BUVA 5E0CA 1J5SA 3W75A 2F7FA 3I3BA 3O06A 3P8IA 3G6LA 1RQBA 1JNDA 4NASA 4B91A 1VFFA 1VRXA 3ELFA 3O16A 1U30A 1JXJA 1UWIA 3CXOA 2Y7EA 1E4IA 4A8RA 1F05A 3B8IA 1RVGA 3H55A 1EJRC 2ISWA 1YLVA 4NQ1A 5CSUA 3DAQA 2GQ8A 1TKKA 3DFOA 1Q13A 2ZQ0A 3AHYA 4AX6A 2PRMA 4JFSA 3QC3A 4M5PA 4H9TA 2FFCA 3GG8A 1WUEA 4MSSA 1C9DA 3VKDA 3R8GA 3LN3A 6XIAA 3CZEA 3EBVA 1TR9A 1XIGA 4GINA 3WEOA 3TSBA 4NY2A 2VENA 1VJIA 3OIHA 3ZT5A 4K8EA 2Y70A 3EA1A 4KESA 1T40A 3FHAA 5ABTA 3WH8A 3AU6A 1UPMB 1QNQA 5I78A 1TTPA 2X05A 3HPAA 4OIFA 4YU1A 1YEYA 3E0LA 5KZEA 2BLEA 5CCZA 2GJRA 2V8ZA 1RBAA 1B4KA 4ZBCA 3M0MA 4M6VA 4OBSA 4A3YA 1R9YA 3WY1A 5KTLA 3Q4DA 1EA9C 3KBWA 2GQAA 4WOQA 2UY2A 2ZTKA 4GI9A 3AU2A 5C9WA 3MB9A 1ME9A 2VHLA 5LA1A 5F2LA 2PS2A 3W25A 4QS5A 4PTWA 1CB7B 4RPPA 1HNYA 4O16A 2VCAA 4BI6A 1PKYA 5JMUA 9XIAA 1GOKA 1Y65A 4YCPA 3FGCA 3V35A 1TA3A 4G7EB 4L6HA 1UBSA 3G1VA 5M03A 1X1NA 1EJXC 2CZDA 3QYSA 1WDSA 2Q01A 4Y90A 1ZJIA 3BURA 1S3TC 2GVYA 3APGA 4W8AA 1ADSA 5BMWA 1UKTA 2EPOA 2VDGA 3EWCA 2XSBA 5ABHA 2NUWA 3K4WA 3TYBA 1SW3A 4LEFA 4DQWA 2EEXA 4ZB0A 2E3ZA 4WK9A 1EBHA 5MF5A 3FYPA 4QRNA 4Q8WA 2WLYA 4S3AA 1NDZA 3HFTA 3MVIA 5ECUA 5A6BD 4LNCA 3KW3A 4K38A 3T55A 3ZQ9A 3CZKA 1XYZA 1JF6A 3S1WA 4J3VA 3RRXA 2CXGA 4JHOA 3HGRA 3QW3A 1RALA 3GU2A 3T8LA 1N82A 4UTFA 3GW3A 3WLIA 1W9DM 1F2JA 2R1MA 5BRPA 5BXRA 5HMSA 3W1MA 3P5YA 3QF0A 4IMFA 3H70A 4JN7A 4JTGA 4U2ZA 3ARXA 5K3VA 2FTWA 3GAYA 2FZ9A 1SJDA 3SDOA 1E3ZA 2GVLA 1GQIA 1QI3A 2PURA 1RA0A 4WJ8A 3FNDA 3OLIA 4REQB 3KRSA 1LOSA 1KBJA 4RE4A 3MBDA 4D6GA 3N34A 3BE7A 2CLPA 4AXKA 1DOSA 4MJ2A 3REQB 3N14A 1QAPA 3MJMA 1XL9A 3OEXA 4X63A 3VILA 1WNOA 2OODA 5D30A 4IWWA 4FLOA 2YJQA 1E70M 3TK7A 2F2KA 2FGLA 2FGZA 2AKZA 4DZ5A 3RO6A 3GRIA 3FVDA 3AS3A 3VMNA 1S2WA 3ECQA 1BPLB 1ZZMA 4GKTA 2QR6A 3E9AA 1SPQA 4QCEA 4IG2A 4TU1A 3TYEA 2XHYA 2GSEA 4BA0A 1Y5XA 2NLIA 2WPBA 5I6SA 3BSGA 1JEZA 4IMGA 3WH7A 4MGGA 3GDLA 1WOAA 4LT9A 4Q3MA 3UZYA 3RX4A 1EF2A 4QJ5B 3I3EA 4A3HA 1X7IA 1AA1B 2WVSA 4DJFD 5IRPA 3E0WA 4P8WA 4PBFA 5A6KA 1W3IA 3IUDA 4CU7A 3SFWA 1BFNA 3V0TA 3S42A 2PTZA 3GDKA 1XG3A 6REQA 4R27A 3DFPA 3WBXA 3U2ZA 3KP1A 1JCTA 3STEA 5CZJA 4QCFA 4Z42C 1LWIA 4GZJA 1IEQA 1A0EA 3UYIA 4B16A 1OX5A 1V6TA 3SCPA 1MNSA 5T8GA 3CYVA 4XKYA 3QYQA 2DPEA 3ZYZA 3FOKA 2G3IA 3WQ4A 4Z2LA 1FWHC 1CXEA 1A4MA 2BNJA 1IT8A 2YDSA 4B2DA 1PIFA 3CUJA 1XF0A 1W1B1 2ZZ2A 1AL8A 2HK1A 1O68A 4JAWA 1XS2A 5F2MA 3LCXA 2YLAA 1OFQA 2GOUA 4NAEA 1S5WA 1YDVA 1CW2A 2NXHA 4MHBA 3FXYA 1B4EA 4FB7A 3EWDA 4JIPA 3VX1A 2WZTA 5I77A 5AHLA 4HZMA 4S3FA 2DJXA 5AC7A 3QR0A 3WLNA 4DNHA 4R3UA 3HN3A 2WHJA 3KOXA 1YE6A 2EXOA 3PPGA 1JQVA 4HB7A 3TOYA 3GE7A 4HU3A 3UWWA 4MTVA 3EX4A 4FLQA 5D33A 2FFIA 3HJEA 2GDUA 1UZDA 1NQKA 5DO8A 1YBQA 3H4GA 1EPVA 1EP3A 1B2YA 3HMCA 4FSAA 1GQLA 3I4EA 1XLEA 2AMXA 4AY8A 2HXUA 3W7GA 5AC5A 3L21A 2PGFA 4K1WA 3PFMA 1G9HA 2E1WA 3PP7A 3UR7A 3M0ZA 4A22A 2QCFA 1VF8A 3KOFA 2YPIA 3ABQA 3E12A 3CYJA 1AW5A 2XH4A 2DUZA 1S3HA 1VAHA 1R3YA 3QH2A 4ZVJA 3LK6A 3EEZA 1FP9A 3GTNA 1EOKA 4XAFA 3ZSTA 1HXJA 1R9ZA 4Q22A 2RHGA 1G7UA 3M5YA 3QTGA 4JFUA 3L2MA 2J7FA 5TIMA 4F0HA 2VMFA 1KGUA 2Z2UA 4TX8A 1SJAA 5AHEA 2ZRVA 1WAWA 3N11A 3WLTA 1IWBA 3OU8A 3AMKA 2W4XA 2OGJA 2OVLA 3KZPA 3W88A 3S8HA 2G41A 4JTCA 3AIEA 3PZOA 3OOQA 2WVUA 4KS0A 1UD6A 5LKYA 4LF2A 1GHSA 3AO0A 1FWJC 1ISXA 4ZSUA 1WKDA 3DFNA 5TD4A 3KRUA 4YTTA 3LENA 1GUVA 1WQ5A 3M6DA 3KBMA 4BEUA 3WDRA 6A3HA 1CNVA 2J9XA 5IHSA 1Q4NX 3CB8A 2CYGA 2Q8ZA 3ATYA 5M17A 1J6OA 4EOUA 4E8GA 2VVSA 1MNZA 1X7FA 4DJDD 1GONA 1QI5A 4A8NA 1MZRA 3NJ3A 4CU6A 3SCVA 1TZ9A 1TREA 2B7OA 3TROA 4UTTC 3UXLA 4D72A 2UZ9A 4F2UA 3UCCA 1LL6A 4XD4A 3M1ZA 4I5RA 5IBXC 4EPBC 3GHSA 1REQA 2HS8A 4GZEA 3VM7A 1XW8A 5EYWA 4Z0JA 3W1NA 2NX9A 3WDJA 1J0JA 4YL2A 1G94A 1H09A 3GXMA 2WMGA 3T1GA 3FYYA 4PMJA 4K7VA 1Z32X 1QNRA 2UY5A 1EKOA 4JKKA 3VIMA 1WO2A 2OGYA 1EX5A 2OELA 3DFYA 1H51A 4AZ5A 5C9ZA 5LNRA 4MMWA 2VEMA 3KOZA 1CGYA 5EA9A 1VFOA 3PAOA 5KINA 4YTRA 3P74A 1XIHA 5FF3A 5CPLA 2Q3OA 2B0MA 3VNZA 1SMAA 2H9AA 1ONRA 2SFPA 1MW3A 3HF3A 3DEQA 2VDIA 3GDTA 5E09A 1VFSA 4D8LA 4M0XA 4HTBA 3W1RA 4MZ1A 4TVCA 3G8EA 3R6IA 2BVYA 4EE9A 3NO1A 1TPB1 3FFSA 3UJSA 2IW0A 2PD9A 1TMLA 1B57A 3TYCA 4OV9A 3BG5A 2A21A 3VOIA 3T8QA 3EXSA 5CSSA 5I07A 1M3UA 4FIQA 2QV4A 1KQYA 2QCHA 1QR7A 1YRRA 3TAOA 3ANVA 2QW5A 3TA6A 2Y1HA 5G2HA 1DWHM 1MEIA 2F6UA 2OZTA 4Q8TA 3W9ZA 2NQJA 2QUMA 1GVEA 2Z1VA 4NT0A 1UD8A 5M3WA 3ITCA 4ONVA 4FS9A 2A3EA 1W1PA 3IVTA 3G24A 1ADOA 4H7CA 1HJXA 2BXZA 3LCFA 1BXNA 4E2OA 2IMRA 3GX9A 2Y5JA 3ARVA 2BXVA 3VPLA 1SM9A 4UMCA 4AZGA 3C52A 2AQVA 3TW7A 1V3HA 3L4VA 3MT1A 1L6SA 4BS0A 1LBLA 2ACRA 2YBVA 3KLKA 3UA3A 3NXLA 1S2UA 3IIXA 4DBUA 2QUVA 1V6YA 2XN0A 1X6UA 1UUQA 4NZFA 7REQB 5XINA 4HHLA 2PTXA 5IHRA 1RR2A 3TEVA 3WLKX 4PR4A 1TJRA 1ITXA 3NURA 4L7ZA 4PRWA 4S3GA 5I79A 3SGUA 1J5TA 5FJRA 1QI2A 1DJNA 1WXJA 3GUWA 3W7IA 1E6ZA 3E0IA 1MXGA 4I9AA 4B4HA 1AG1O 3KWXA 1FDZA 3MA8A 1Q85A 2RAGA 4M3PA 4Y7EA 3GBDA 2WXDM 3WEZA 3N18A 1J6PA 4W93A 2GPTA 2ONEA 2PWGA 1KM3A 3CUIA 1XLCA 2WNWA 4NZ1A 1MQPA 1VFUA 3WO8A 4GFIA 3IV3A 1E3XA 4K8GA 2WJDA 1R85A 2CLFA 5AZ1A 1GOXA 1MUMA 5HK4A 4PN2A 1GOIA 4ZTXA 3IGXA 3PZIA 3STCA 2V3GA 2VFHA 3STGA 3OG2A 3R2GA 1GT8A 3NL5A 1LT8A 4L6DA 3E1F1 1QASA 4IQLA 2B7PA 3NO5A 3N19B 2CESA 5D37A 2G8ZA 5J04A 2I1OA 4YYFA 4HZ6A 3K1GA 5LHEA 1XFCA 1XHGA 4Y9OA 2X2YA 1MEHA 2XIQA 3BV4A 4S3EA 1VCVA 4ZTYA 3C8FA 4D9PA 2VJXA 2C79A 4OQVA 4G7EA 3I6TA 5REQB 3O7UA 1ELSA 1QJWA 1PO9A 3N1AA 2KZHA 1GORA 1K9TA 5LNWA 1ICQA 1MQRA 1P6CA 4AD4A 3IJLA 3C2EA 3QV8A 3L4UA 5FESA 2CZFA 3GXNA 2DEPA 3PBMA 3DYMA 4LYKA 4GVGA 4UTWC 1GWJA 3KL3A 3W1PA 3LCWA 1UUOA 3FA3A 1I0BA 1GGOA 4K2SA 1ML1A 2NVDA 1YDNA 1TYGA 1TV3A 5A8GA 3L12A 3VKAA 4F2BA 2EHHA 3QBUA 2WMJA 4YNGA 1UD4A 4ZFMA 3OA3A 4ZE4A 1XLBA 4RJEA 4XZBA 1NP0A 2FB3A 3UCQA 1L8NA 4JPGA 1E4LA 2J6XA 3C61A 4HPHA 2G3FA 5DN1A 2Z27A 2Y85A 2CEQA 3HPSA 1XD1A 2NQZA 2QUTA 2BV9A 2HE5A 2GSHA 4AIOA 2HVOA 5HA7A 3IJ9A 4EK7A 4N02A 3OB8A 2V63A 1ICSA 1I8JA 3WQVA 2J7DA 4DJFC 3BK0A 3G1DA 2Y0FA 2CU0A 1J11A 4PCPA 1X38A 3ID7A 3L5LA 3ITOA 2JFEX 4LSBA 3OA5A 4JCLA 1US2A 5D05A 2ZX5A 4DO6A 2OQLA 2ZDRA 4W89A 1EWEA 3L4WA 3V18A 3E38A 3VKJA 5AZ0A 2C91A 4BZYA 1B54A 1UROA 4REQA 2E09A 3Q2DA 3AALA 4XBJA 2HZGA 1DPMA 3ZOAA 5C9UA 4RPQA 3REQA 4H3DA 2DSUA 1XH2A 3CLMA 1RCQA 5EFFA 4IMCA 2DGAA 1T7LA 2CLMA 5FCZA 1EF3A 3GM8A 3TR2A 1CLXA 2QIWA 1KTBA 2HPIA 4ZA0A 3GW0A 4OZOA 4NNAA 1ZFJA 4O1AA 4PMDA 1OSEA 5FJTA 3V0UA 2X0HA 4UMAA 2DIJA 4WCJA 4D6HA 1DWIM 4NG3A 3OW1A 1E55A 4XAYA 1UR4A 3LGGA 2IKGA 4FAMA 3SQMA 5A8PA 4MKNA 1HL2A 3GVGA 1Q6RA 4AMCA 2D22A 5M1TA 4FOUA 3PWAA 2HE8A 1GKQA 2HVNA 3KTSA 3W7CA 2A85A 1CTNA 4HCDA 3BANA 3PF3A 3JZUA 4IUGA 3MUY1 3QRHA 4E4UA 1JR1A 4IIHA 2NT0A 5HR7A 5CLWA 2PGWA 1AJ2A 2PGEA 1PL9A 3OBEA 4FF5A 2W6RA 3ZM8A 2VCBA 4UTMA 3FAXA 2I56A 1JIBA 3F5JA 2X1UA 1XDJA 2VQTA 4OKDA 2ZRUA 4E6MA 3KRBA 3CZLA 4LYPA 1XLKA 1IEXA 4DI9A 2D69A 2QVNA 1R6WA 1IQ8A 4DY1A 2NSOA 3NVTA 1GVRA 1RCOB 3PS7A 1NDWA 1OT1A 2RJHA 4H7VA 3TQPA 3W27A 1JZ3A 5LIXX 3VIPA 4V15A 2FGBA 2QNEA 3N9SA 3CWHA 4JDBA 1HQTA 1A4LA 3THDA 1TVNA 4XD5A 3MQTA 3MBFA 5KZDA 1G01A 5C2XA 1CXHA 1L6FA 5C2CA 3P0WA 3TYDA 3WF1A 1AMKA 4GI4A 3GIPA 3P84A 3PJTA 3CMGA 3F2CA 4DVOA 5D32A 3ARSA 1WB0A 4UOZA 2QJNA 3PJXA 1JNEA 1EO7A 5JH1A 1FFRA 4FX8A 1XPGA 2GJLA 4H04A 2A7PA 3GH4A 5HXMA 2OYMA 5XIMA 1YXCA 4Q6XA 4WXZA 2JALA 2XIMA 1D3GA 1MDRA 1JDEA 2OG9A 1JPDX 3DECA 3BPWA 3DHUA 4RNHA 4U28A 1OK6A 1EXPA 3FDGA 1PKLA 1UH2A 3Q37A 4DJDC 2FHCA 2X2GA 1GJUA 2H3DA 1DJQA 3NDYA 5E5CA 4LTSA 1UWUA 1XI3A 1TMQA 1UR1A 2J8TA 2E9LA 5FEPA 4DWSC 2PDNA 3CAKA 3SW6A 1S1RA 5FF7A 3IV8A 4O50A 3PZQA 4HK5A 1TX2A 2CWNA 3WSUA 3PBWA 1H7RA 1Q3NA 4BQ2A 3VGBA 5LGZA 3P82A 2ISVA 1YPIA 2OZ3A 4NVTA 3VNMA 5A6BA 4MB4A 1TPEA 2UY3A 1G1YA 2PDKA 3WUEA 4LC8A 1H1ZA 1UWSA 2XDFA 4O28A 4OE7A 1PV8A 2BX7A 3HPZA 1GQKA 1OFDA 2OXNA 1Q63A 4O15A 2ABAA 3NQVA 1V0KA 3TTOA 3TNBA 4OBRA 2QJMA 1O12A 3T4WA 4RNJA 2AQOA 4Q7BA 4M82A 2RDXA 2J47A 1P5BA 1KM5A 1MI3A 5A8QA 4L9ZA 4L4MA 3UZJA 4KW2A 3P6LA 4TQTA 5EKYA 1TIMA 2X1RA 4JTLA 3AICA 3TONA 5FEWA 4GACA 3CHFA 3IJ6A 1EGZA 1JCJA 3GY1A 4ZE5A 2ACSA 2X30A 4E3TA 4J2PA 4DI8A 3OGVA 4W88A 1YTDA 2VFGA 4XISA 2QUUA 4PL2A 2XH2A 2H8XA 3ZWSA 2I5QA 2D1ZA 1U1JA 1JUEA 1EJUC 7TIMA 1KB3A 1WZLA 3VGHA 3QSRA 1I2PA 4HGXA 3W28A 3OHIA 2HSAA 4H41A 4C6DA 3VNDA 3EXRA 2J24A 3RRAA 3NQ2A 2PCEA 4YN5A 1A80A 3PG9A 4AUBA 4L56A 4H9YA 4GYPA 4IH3A 4GPNA 4C6JA 4NILA 2VD9A 5C71A 4Q33A 1Q45A 1VFMA 2VC7A 1W5NA 3T07A 3L7RA 4TUFA 1E6PA 1DJGA 2QF7A 2VKZG 5TAOA 1J0YA 1UMLA 3GDRA 3ZT6A 3W1LA 3OQ8A 2ZFAA 1K4GA 1YXDA 2WO5A 3VX0A 4KEMA 3H22A 3IS4A 3CWOX 1DE5A 3O15A 3VOJA 3CQKA 4HOWA 4CNUA 3ARUA 1SZGA 1V0MA 5F4SA 3AMCA 1T8QA 1JZ2A 3MO4A 1BKSA 4CVWA 4ERIA 3GXDA 4XSLA 1OX6A 1GQJA 4XZ9A 3IVUA 1XX1A 2JKPA 3GKFA 3EOLA 4IUOA 4DLFA 1NSJA 2RFGA 2OLSA 4GJ1A 4LJ3A 4EIVA 1V51A 2CZ5A 2ZXAA 5LSMA 5DLCA 2BVDA 3R0UA 1B31A 1OK4A 3WH5A 3ARRA 4KFOA 5A8MA 1B3XA 1P7TB 5HNUA 1FVPA 3CU2A 2C14A 4UR8A 4UNIA 1GVOA 1V0NA 1ZP3A 7ODCA 2HPMA 3HFYA 1ZGDA 2CFFA 4PSRA 2V5LA 3MI3A 3DN5A 3AWNA 1EDQA 1IE7C 2WNQA 1PJ9A 1E9ZB 2I17A 1FCQA 2O4QA 3RU6A 1V0LA 3GXFA 2VX7A 4GVFA 1KNWA 2WHKA 3UZZA 3K13A 2P88A 1OCNA 4TIMA 3PUOA 3NQ6A 3FIGA 5CZSA 2PU0A 5BWAA 4XTDA 4GO9A 1JZ7A 3DGRA 3D3FA 1FKWA 2A5HA 3H53A 4EANA 4HPGA 3GYCA 3IIOA 2NT1A 3ISIX 1F3XA 4CD5A 3BL3A 5AN7A 1IXPA 4YYCA 3T09A 3LPGA 1JZ4A 1QNOA 2JK2A 4U2YA 3L4TA 5HNNA 2ISSA 4EF9A 2QVHA 1RZMA 1TO3A 2PMQA 3SI9A 3ZR5A 1W5OA 3B40A 4O18A 4UTHA 4O4WA 3P7YA 4INFA 5XIAA 4WOZA 3H23A 2Z1WA 7REQA 5K2ZA 4Q8NA 1WE5A 4GRSA 4NAFB 1KC7A 1PSCA 2P53A 4CD7A 3TTSA 3WELA 2ZZ4A 4GKLA 1R2RA 4PMYA 4JTSA 3U4FA 3EDFA 3W73A 2AAAA 1S1PA 2A3AA 1OD8A 1FFQA 3DX5A 2RGLA 2Y61A 3V75A 2GDQA 4MY1A 1XRTA 4XAPA 4AHPA 3AYVA 3CV1A 3PBYA 1AL7A 1TPC1 4X60A 1JRCA 1WZAA 1BTCA 3KVMA 4S2BA 4XX6A 4A4AA 1DJXA 3S2MA 3UWUA 1V02E 1CCWB 4J4KA 4GJJA 1QBAA 3UWYA 4Q7NA 3PUGA 1TWZA 2FZBA 2YDRA 5HUOA 2IPFA 3CLWA 2Y62A 3N6QA 4AHQA 4KCTA 4PUUA 1A5CA 1XGZA 2QS8A 4NX0A 2Q09A 5E70A 4J3SA 2DZPA 4QLLA 3EMCA 3KLLA 4IF2A 4LGXA 1TV5A 1PX4A 5CSYA 4E3VA 5C9RA 3RG6A 2IXUA 3AXKA 4GUFA 3VABA 5ABFA 2VR2A 1F76A 2PZ0A 5A69A 3QPEA 1FHVA 3ZVIA 3WQ5A 3EKLA 3H6OA 3MSGA 2OSYA 2EQDA 4PMVA 2ZWZA 5FACA 4KEZA 1LBFA 2PTWA 3B3DA 3WH9A 1BEUA 3GK0A 4XUYA 2YL5A 4ICMA 2BOFX 3BGGA 1E0UA 5REQA 4OECA 4Z2GA 2IKHA 4NNBA 3T81A 1FUYA 2YZRA 4X9SA 3MI2A 2QPSA 3I68A 4Q32A 2J27A 4WF7A 1K6AA 3R11A 3ZXWA 3IPWA 1I2RA 1W1IE 4WJEA 2FQIA 3DKJA 4JQ1A 1UR9A 4RE3A 2BVWA 1UJQA 3SJNA 3AFBA 4I7WA 1U5JA 1F3EA 1ZENA 3LCHA 5HWMA 4ZFCA 2XFFA 2O92A 3FEQA 3N2TA 1IZKA 3H12A 3PNZA 4FOKA 3T42A 3WLLA 4DX3A 1XCXA 4LX4A 2ODOA 4A3UA 3B8UA 3WDQA 4HZ8A 1MFUA 2GUYA 2VZSA 4FLSA 4Z1CA 2OZ8A 2YIHA 4ZXLA 2HDJA 2IPGA 1M68A 2QCDB 4R33A 1HKIA 2X0YA 4ERAA 1XLGA 2WZEA 1YPXA 3QQ0A 3EX2A 5EMLA 2UY4A 1OHLA 2PDQA 2NWRA 4TR9A 3W1AA 3KUMA 1LDCA 4O1CA 3R10A 3N13A 4XD3A 3TAKA 1NF0A 3PFRA 4HTYA 2Y7GA 1D9EA 1P6WA 4UQDA 1K77A 5I3GA 1XLDA 3QY7A 1PTAA 3SY1A 2WJEA 3NL3A 1XYMA 1PE1A 2FZMA 2VELA 1RY8A 3EPNA 4N9CA 3BXWA 1I45A 3PR2A 3RR1A 4OOZA 3TZNA 1C93A 4S3DA 3A9BA 3OLDA 3M5ZA 1J93A 4B90A 1M7XA 4KERA 4FNUA 1HJUA 1PIGA 2D2HA 3O8AA 1DXFA 1FWSA 4OJYA 2C0AA 4CUCA 3OGSA 3M0YA 2JQXA 3UGRA 3FJNA 3ZLFA 3MUXA 2BY1A 5IDZA 3TN3A 2Z2BA 1PXGA 3GFYA 4J40A 5LNVA 1XRFA 4RR4A 4J3XA 1TTIA 3N2BA 3RMJA 1V3MA 1EJSC 3WCZA 3PNUA 4P8XA 4YHEA 4S3BA 2QAPA 2Y2WA 3FA5A 1EB3A 3ITLA 4PGLA 2XG9A 4IXXA 3IUHA 4GQRA 3WLSA 3IARA 1A5UA 1TTJA 4HYVA 2CLOA 2WPGA 4Q4SA 4KWWA 4C91A 4HYWA 1UPPA 3GHUA 2PD5A 2G4FA 4C6EA 4WKFA 2OOGA 2FTYA 3O0KA 3H21A 3RAOA 4B9YA 1M03A 2YA2A 1K02A 1A5AA 4GK8A 1XYLA 4MPQA 2OT0A 1CDGA 4UQBA 3TQVA 2BBFA 3IK4A 4MUPA 5I3JA 4L65A 5AOUA 5BXPA 3RILA 1TELA 5T91A 3LLXA 3FY1A 3SO7A 3W7NA 4UCFA 1YTEA 1HG3A 3VVGA 2CLIA 3K2GA 3H2NA 5EPDA 1MDLA 3KEHA 4PUWA 3RLVA 1GVYA 1EJTC 1JI2A 2A7RA 1N55A 2BY2A 4ZQNA 1TRDA 4HMNA 4Q4MA 2CC0A 3WENA 1DIOA 1B3OA 3ES7A 1LQ2A 3NUKA 3HQNA 5I3FA 3RPDA 3ABSA 3LXAA 3C86A 3ZR4A 5IDIA 3D47A 5J8LA 3VK5A 3ZJ7A 2W63A 1VBGA 4MDPA 1R0MA 2PDYA 1QW9A 3A5FA 3GNXA 5AHNA 1C29A 1MEWA 1W9UA 3L0NA 3ITYA 3VIKA 1W1ZA 5DANA 4HPNA 4IIBA 1ICPA 2R14A 3SCUA 2GWGA 3EX1A 3VIGA 5D9PA 1V3JA 4URIA 2FTPA 3WLRA 3DHFA 1MSSA 1RD6A 2PA6A 4QTGA 1TV8A 1F3TA 1MW2A 4IX2A 1CPUA 2G50A 3S0CA 4HU0A 4Z1YA 3W38A 3LM3A 1QU4A 1IR2A 2XH7A 2I9EA 4GD0A 2EO7A 1Y0EA 4G7FA 2CZVA 3N2OA 5MHBA 2E6FA 4RV8A 4YPJA 1WKYA 5AYXA 3C56A 3Q67A 2Z7GA 1LM1A 1WDQA 1RLDA 3GNNA 1SSGA 1UIOA 3BLIA 1L6WA 4GISA 4BF7A 3E0VA 4B5WA 3MP3A 3IJIA 3BGJA 3BAYA 4G9PA 2Z6IA 4BWLC 5CQ1A 1EPXA 3C2VA 5FJJA 1CENA 2VGGA 4ZO9A 2FPVA 2Z0IA 1XRVA 2WZIA 1BWLA 4HIBA 3MKKA 1M9HA 2Y24A 4GUIA 4OFCA 3O9NA 1A49A 2HCVA 5CG7A 3URAA 2J8FA 4QXIA 3PPCA 4UFHA 4IP7A 1EO5A 3VA8A 2RGMA 3M5VA 3TKFA 4LEQA 4WY0B 3SCSA 1UJPA 4LVBA 4AEFA 1EIBA 1Q6LA 5G4WA 1VD6A 3TSDA 3FJ6A 2BOEX 1K7FA 4I9MA 4LWWA 4K39A 1TQJA 3OVRA 3AQUA 3UEQA 5I00A 4JN6A 5FD0A 1VPXA 3LCLA 3CS2A 1UR0A 3MDWA 2WC3A 5C7HA 4DM1A 5A6SA 2FYMA 4JOMA 1KM4A 1VRDA 3BZJA 2WWCA 3MANA 1AH4A 8XIMA 5A2BA 2F9RA 1FWEC 3COTA 3KTXA 1TPH1 3MUIA 3MMDA 2XGZA 3EKZA 4M56A 1UUMA 1EDTA 2PDHA 3PZTA 2Y7DA 2VWSA 2YYUA 1TUFA 5D8WA 1LRNA 3H7RA 3QZ6A 2Y7FA 4WSKA 4TO8A 2V82A 1J10A 2ZE0A 5IBXA 3ZLHA 4KWOA 3POCA 1ZTVA 1BYBA 1TTQA 2R1LA 3QQWA 4YTUA 4S3JA 4MWAC 2C16A 3K5XA 3L5MA 1ONXA 3GZAA 3GNRA 2RKXA 3O05A 3FW6A 4EPEC 2X41A 1XC4A 4CCCA 3TDFA 3ITVA 3UR2A 6ENLA 4ZOCA 1XGEA 3AZTA 4UTUA 3B04A 4M7SA 1UQYA 3DBPA 3NTYA 1CGXA 3W2NA 4B2DD 4X61A 8CGTA 4B3ZA 3ABOA 5DRIA 3UU0A 3G0SA 2V2CA 1C91A 1MQQA 4GBUA 2BODX 1RAKA 1QPNA 2JKAA 3R43A 4JYEA 4NL1A 5L9FA 2QT3A 3GUGA 2X7WA 1HUVA 3R0DA 4A8LA 5I02A 1D7KA 1PVNA 4EX4A 3QQ1A 4KEUA 4YWSA 5FJOA 4PTDA 5A5WA 5LIWX 1JPKA 4B92A 2XVPA 2ZUVA 4UIOA 1A50A 1SO3A 4IMDA 5E0KA 5BOFA 3ZVHA 3GNDA 2ZC1A 4PB3A 3WLHA 1XCWA 2IQTA 5JXQA 3E5BA 1Q4WA 1X39A 4NNCA 2H6RA 4JS3A 1ONEA 4P7LA 1KBLA 5A2AA 2E67A 4J3TA 1ECEA 3A6OA 3VFLA 3FGCB 1QPQA 3NPVA 1EDGA 3SCQA 2TODA 3GLCA 5FJPA 1FWBC 2XFWA 4NAFA 3CUHA 3ZO9A 3F2DA 2NX1A 5BZAA 3HV8A 5DF0A 5G1TA 4NI8A 4ZQMA 1ZBCA 3BW2A 2PODA 1NP2A 3LOTA 5F7UA 5BRQA 1V79A 2QIIA 4UQEA 4YHGA 1L0PA 2MUCA 1GJWA 3LNMA 4NRSA 3QOMA 1WPCA 4L64A 1J9YA 4GZIA 1HGYA 1M7PA 2QF8A 4DBDA 2AQWA 1NOWA 3IACA 3NYDA 1JQXA 3M0XA 4I5XA 3SCWA 1JCNA 2O9OA 2VOMA 4NRRA 3PPHA 4A05A 3BLPX 2L5HA 1JCXA 1AJ0A 3BG9A 4Z1BA 3LHTA 1EP1A 1KGWA 1XR2A 2RDUA 1VPQA 4DM2A 4TV6A 3H8AA 1G4TA 3IRSA 1ZS2A 1XG4A 2HTMA 3LY0A 2ZA1A 1GEHA 3RM4A 2V67A 4EWJA 3JUGA 3CQ0A 4V2XA 1FDJA 5I5RA 4ATLA 2ZX9A 4UFIA 1THFD 4QLJA 5JQ9A 1FHDA 1KRCC 1IWPA 3V5OA 2OKOA 2Z2AA 4DN1A 1H5YA 4FOJA 3DFTA 4IP5A 2YX0A 3B8TA 1ALDA 4US6A 2J79A 1OF8A 3ZJ6A 4K3ZA 4M24A 3SM0A 1F8MA 7ENLA 1P0NA 3DC8A 1SFSA 5CJMA 4H6RA 1O1ZA 2CZEA 2OQHA 4JL1A 4QG9A 2QEZA 2A3CA 2WMKA 4JTAA 2D0HA 1E4NA 3EWWA 2A3LA 1XBVA 4NYUA 4M1BA 1OGGA 2VO5A 1XDLA 3T7VA 4KRZA 4OVXA 1JYNA 4IP4A 3Q65A 1W37A 3KL5A 3LI0A 3L0GA 1CBGA 2C18A 3FAWA 4LUIA 2CITA 1JRBA 1VZWA 2V2HA 3NCOA 4DRSA 1NVMA 3TXVA 4LPCA 1GOMA 3SUSA 4HJFA 1NIUA 4I7VA 1UKSA 1EYWA 3KP0A 1F5ZA 3E2SA 1SJBA 3CV7A 3GG7A 3GC5A 1KV5A 5KEZA 4B9ZA 3ERPA 2IQDA 1S5NA 4DNMA 3HQPA 2NVAA 3W81A 2DH3A 2QCDA 4IQEA 3K8MA 3KVKA 1PKMA 3OGRA 4RE0A 4MNLA 3TUUA 2NWSA 3OTRA 4ZL1A 1FRBA 4XO6A 3WNLA 1R87A 1IZJA 4B5NA 4EKJA 3L4ZA 4JD4A 3O6YX 5G1MA 3W1UA 4AZIA 1CI1A 3IEBA 2ADAA 4FNPA 1QHZA 1A5KC 1XYCA 4AYSA 1SW7A 3GC4A 4Z08A 4AZBA 4MB3A 3TC7A 3S5SA 1GCYA 2C7FA 3LZ3A 4H7ZA 3C2OA 4JTFA 3S9YA 5GNZA 3N2MA 1AQMA 3CNYA 4JIEA 1BTMA 2X1SA 1G0CA 3MUZ1 4IPPA 4C1NB 1DWJM 3SGGA 3V36A 2DIEA 1YMYA 1KXQA 2WQPA 4ROQA 4A3RA 1YX1A 2OQYA 3PBVA 3B8DA 2PGRA 1YQ2A 2J62A 2OMAA 1QDSA 2GUUA 2R1PA 5CPTA 1KCZA 1RPXA 1M1BA 1F6YA 1TRIA 1RSCA 4JX6A 2OJPA 2EJ1A 2ZUMA 1V7YA 3N2XA 4IMEA 4MF4A 1R2TA 1DP0A 4RDYA 1HF6A 2CKRA 3WQCA 2PB1A 2ZCGA 2QV5A 2EG7A 2P0OA 3EB2A 1UZ1A 2E5DA 2VEFA 5LA0A 1YBQB 3QN3A 5GVJA 5DXYA 1VYPX 1XPYA 5HPOA 4TMBA 2E1DA 3NL6A 1I2OA 4AISA 1H0GA 5H6HA 2DW6A 4D6IA 3UXIA 3A3XA 5BWFA 3PSVA 3PZUA 1P48A 1TJPA 1RP9A 3W22A 2GJPA 3S47A 2XTKA 1B3WA 3IGSA 1GYLA 2CBVA 4IGSA 3VIIA 1Q8JA 4A8IA 3MVTA 2QCCA 3SN4A 4NXSA 4IPLA 2YDAA 4LAKA 3VOCA 2Z7KA 3F7JA 3WKZA 2WCSA 1WZMA 1O66A 2KX9A 4XZIA 9XIMA 5BU9A 2WK2A 1B1YA 4JTIA 3S5ZA 4ERGA 2ASHA 2X1IA 4RDWA 3CQJA 1YNYA 3W7LA 3WNKA 4F3HA 3CGTA 4JZ5A 3M0VA 4IHCA 4RUBA 5I03A 1JXKA 1SVDA 3DENA 4KEVA 1SZEA 3O6AA 1SR9A 2W66A 4QROA 4GVHA 1FWTA 5AB3A 3M07A 4ATDA 2V3DA 1R7AA 2GYIA 2QDDA 3I4KA 1ZCCA 3VI2A 4P7QA 2JF7A 3VOFA 4WKAA 3AHVA 2F61A 4GMEA 4L1WA 3PWIA 1DJIA 3UW6A 4PL1A 4ZB5A 3R12A 3UY7A 1EC8A 3OP2A 2YR1A 2DP3A 4CN1A 1FWWA 4V1XA 4HHPA 1PKNA 4Z1AA 2QGHA 1MO0A 3EX6A 2WHMA 3WLQA 2WAGA 3EGJA 1EH9A 4IIDA 4UTLA 4MADA 2W67A 2W61A 4C60A 5HWJA 3CUFA 3LXCA 1B5TA 1REQB 2OX4A 4C6CA 1BXBA 3G1SA 1LQ0A 3PZ9A 4HK7A 5I0DA 2R9RA 2QAFA 3WH6A 2ZTJA 2G4JA 4MNMA 3XIMA 4Y8FA 1XLIA 1US3A 4YVXA 3CO4A 3N29A 3MDUA 4C1LA 5KMYA 4BK9A 2YB1A 4JTQA 4KRTA 4GIYA 1KLZA 4B5SA 5I7GA 5A6TC 4U3CA 2WW5A 2VX5A 3WBWA 5DMMA 3WLOA 4L5ZA 4O1BA 1TFVA 1GTEA 1QMLA 1CXFA 4Y9NA 3W7KA 2OU4A 3WQWA 2QCEA 4E4PA 2HNEA 4FK9A 3AXXA 1P0DA 3WMLA 4AB4A 4LV9A 4C1KA 5A95A 2BHUA 3L67A 2V68A 3TH6A 2R94A 3IAQA 3AC0A 4FI4A 1NFBA 1BXCA 2FDSA 1ZHAA 4I8DA 1VKFA 3GAKA 3H7VA 3VE7A 1DIEA 1G6CA 2AAMA 2QDGA 4I90A 1LLOA 5HNTA 1M7JA 3AYRA 4EPKA 2VC6A 5U4NA 3W72A 1HKVA 4KWUA 3GNPA 3I7SA 4U4MA 2WSKA 7TAAA 2I5GA 1OADA 4YCOA 2ZYFA 4GX8A 5AC4A 4PCTA 3EDKA 2EPMX 2DSWA 1ENUA 1OCQA 4UUIA 2VT0A 1WUFA 4WY0A 1PWMA 4ECLA 2HQAA 2CIPA 4J7RA 3EXTA 1GPWA 5AHMA 3A22A 4AFYA 5JUVA 2EG8A 3A21A 3FCPA 5DT7A 1ISYA 2XIIA 1O95A 2BDQA 3B9EA 4U3AA 4XAGA 2NSXA 1U83A 3W37A 5CPOA 3VD5A 1CECA 4IXHA 2ALRA 3VCRA 1KCLA 3EDDA 1L9WA 3G5EA 1V6VA 1J4EA 2I57A 2CLHA 4YTQA 5D8ZA 3M7WA 3VNLA 5EB8A 5FOOA 5E93A 1RJPA 1TV4A 5FL0A 2PI6A 4CLMA 3LHVA 3M43A 4L61A 1UP0A 3I10A 1C92A 4AXNA 2ICSA 4KCUA 3SCNA 4S3KA 5CH9A 5CZ0A 4LB3A 4D6JA 2EG6A 1PX8A 2WKJA 2V30A 3DI0A 3LBOA 2J88A 1HP4A 1KFKA 2YCLB 4Y9AA 4LALA 1EL3A 2ZVIA 3VDCA 4IJRA 2FJKA 1BQGA 2I7GA 5H1WA 4J3WA 5BXTA 2G96A 1SGJA 4NZ3A 1B9ZA 3EA3A 2H3BA 3U48A 3SRFA 3U57A 2PP0A 4WY0F 2DORA 3PBGA 4W87A 4AIEA 3TTYA 2V5CA 1UQZA 3LI1A 5IFTA 5K9XA 3CHDA 3P93A 1ZCOA 4MWAB 3CQHA 1VPYA 3VIJA 2CHRA 4S23A 2WM0A 1GW1A 1OIMA 5T9BG 3NOEA 3SADA 2V81A 3USZA 1E0XA 2I16A 4L9YA 3V3WA 3G1RA 5K4XA 4GIAA 4QQUA 1H7OA 3PZGA 3QR3A 1EZ2A 1RQHA 1RBOB 3B4YA 4F4RA 3CZJA 3GU9A 1AUSL 3W2KA 1YYAA 3AHTA 1E51A 1KBBA 1ZY9A 2HJPA 1KD0A 5CLTA 1YNPA 1MRQA 1RQEA 3LDVA 1AQ0A 3AS2A 1T6MA 3UG8A 3ZS4A 2IPWA 3MP4A 1LF1A 2CKSA 2Z1SA 3VFCA 4W7UA 4F40A 3T0DA 2CHOA 4X3ZA 2PWHA 3NZRA 3TIMA 1ITCA 2ZUTA 4HZ7A 4TX6A 4M7TA 5C0QA 1NDYA 4GA8A 2B31A 1J18A 1XYAA 4E4FA 3SURA 1H7PA 3CPGA 1X97A 4FZIA 1M41A 1PZ2A 3PAJA 3WNNA 4AH7A 3VZZA 1LJYA 3IIVA 5HMFA 1R30A 4ACYA 5J5RA 2I9UA 3P8JA 3WF4A 3DFQA 5D2YA 4WDWA 3OLEA 1UH4A