2RHGA

Tryptophan synthase complexed with igp, ph 7.0, internal aldimine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
250
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Tryptophan synthase complexed with IGP, pH 7.0, internal aldimine
rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 89
structure length 250
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2rhgA00
1F73A 3TKFA 1H1YA 1ZCOA 4DO4A 3M44A 5LGXA 4AH7A 3QEZA 4N9EA 2EHHA 4NXSA 3TSMA 3L65A 1HO4A 3PC0A 3P8JA 3N73A 3G1FA 3VI2A 3B0PA 3UD6A 4JTIA 5AYXA 1VC4A 1E51A 2NWRA 4ICNA 5BMXA 4MLJA 4WY0B 4XTDA 1XC4A 3EXRA 3PUDA 3G1HA 5G5IA 1G67A 3GXPA 4Q33A 1OX6A 4AF0B 3W22A 1SFJA 1DL3A 2C14A 4O57A 2O7SA 4HIBA 4JR5A 3C8FA 4AF0A 5HWNA 3L0GA 3BG5A 3D0CA 1ICPA 4N9BA 3W70A 3B0VC 3GDKA 2TRSA 2E6AA 1FWSA 1XM3A 1UASA 1HL2A 2YX0A 4ADUA 2C3ZA 1KV8A 2W6RA 2QDGA 1QR7A 3UWYA 3DHFA 4UTTA 2YDAA 3FIGA 3LHUA 1TJRA 4P2VA 4JTGA 2QCEA 4JS3A 5C55A 2C19A 4LUIA 3GDLA 3W1TA 3OVPA 3NNTA 3ELFA 3N9RA 2WOQA 1VCFA 5C5YA 2QUTA 2E5BA 2OMAA 1Q6RA 3C2VA 1SFLA 1OX4A 3M41A 2NZLA 4GJ1A 3LCGA 5KITA 1DJQA 3GKFA 3NO5A 2C0AA 2FTPA 2R8WA 3HG2A 3MYOA 4XTIA 3M5VA 2ISSA 5DXYA 4XQ6A 3NGJA 1I2PA 3KVKA 3PBUA 2Q3OA 3S1XA 2R94A 5FEWA 1LYXA 5BRBA 5G2IA 3P80A 3QPYA 3P61A 4BF9A 1SO6A 3R13A 2PRHA 2Y63A 2ZZ5A 1K02A 3CB8A 5D32A 3DKLA 2VKZG 4OBTA 3UWUA 3TUUA 1LOQA 3C4UA 4IMDA 4KWWA 2QCNA 3KVMA 1JCJA 3IGUA 4LTSA 3MHUA 3M6YA 1TMHA 1LROA 4FIQA 2B7QA 4H6KA 1EIXA 3STEA 3Q94A 1H50A 1Z48A 2V81A 3LRMA 1GTHA 2QCDB 5LGZA 2I9EA 4MJMA 1TTJA 2NV1A 1X1OA 5KZDA 2O7QA 5AC8A 4U4MA 4O12A 3WK0A 2V30A 3VE9A 1WX0A 1DVJA 4AMAA 3MUXA 2H3BA 1VS1A 4R7JA 1I2RA 4AVFA 4RR4A 1GG0A 4K8EA 4UTLA 1QPQA 3TH6A 2C6QA 3NL5A 4MYAA 2Y70A 3CPRA 3NQ2A 5TQLA 1J5TA 4O0ZA 3A5VA 5EBUA 5LSMA 4NZFA 2HS8A 3L21A 4YMZA 1IXOA 1GQNA 2JKEA 3NPUA 2JKPA 1H62A 3W23A 1C8VA 3IV3A 3MP3A 3PBYA 5DXXA 1TPFA 1QO5A 4DPPA 3NL2A 3O16A 5TIMA 5HJLA 1O60A 4WQ6A 5FI8A 3OA3A 2HTMA 5D09A 1SO5A 4UMCA 5HR6A 3LTYA 2UV8G 4RZ6A 1LLZA 2Y88A 1W5PA 4O19A 3W1AA 3NQCA 2RHGA 3C52A 1RVGA 2DZTA 1SSDA 3PR2A 4FXRA 3M7WA 3P5YA 1XI3A 3EX3A 1F05A 3NQAA 3VCRA 2VEMA 3M5XA 3CIWA 1P1XA 4CQ9A 1GVRA 3WJWA 3QZEA 3CWOX 3MMTA 1KM1A 4IX2A 5F2MA 1SR9A 1UB3A 4LRTA 3S0CA 1DQXA 4O4VA 4JTSA 5AYYA 3S1VA 3W7IA 2ZZ2A 1PHQA 3WK2A 3G1SA 3HMJG 3B06A 4O17A 4XKYB 3WJZA 1N8FA 3HOJA 1UUMA 3MI2A 4QISA 1UJPA 1S5VA 5FF0A 4HSOA 4A22A 4XWUA 2YW3A 4XKYA 4OU1A 1O4UA 1NSJA 1MEWA 4N4PA 4GUIA 1B4EA 4BI5A 2CU0A 2BTMA 2GJLA 3CM4A 3NZRA 1FCBA 3P74A 1D9EA 3LERA 2A6LA 2VFEA 1F6KA 5FEPA 1FCUA 1X8FA 3ZWTA 1OVDA 3KRSA 1VCGA 4G1KA 1LBLA 4JTJA 4KWVA 3W7RA 3C3NA 4DBDA 1O5KA 3G18A 1A50A 1M7PA 2AGKA 4JY8A 1YYAA 2X16A 3MHGA 3SW6A 2QJHA 1VLWA 1OFOA 4GUGA 4LVAA 1TQJA 3LCHA 2C18A 1KM5A 3I68A 3K30A 1I2NA 3TJLA 3B03A 3ZFHA 3LI0A 4DBEA 1KFKA 2OJPA 1KBIA 2ZRWA 3HF3A 2BZNA 3S1UA 3LBMA 3CC1A 2QKFA 2Z2UA 2V2HA 3KHJA 3W7JA 3OBKA 3S5YA 2FLIA 3G3DA 2Z6JA 2CZFA 1JCLA 1GVFA 4UMBA 5KZMA 4MY1A 2V2CA 1OHLA 1EUAA 1H63A 2FQIA 2FPVA 3ATYA 4PEKA 3OIXA 4JN6A 4K6AA 3QW3A 3FLUA 4FO4A 2A1YA 1L6YA 4EF9A 1TV8A 1QOPA 2E6YA 3L68A 2R14A 2QCCA 3A22A 4GFSA 3E12A 3W7OA 1QDSA 4UFLA 8TIMA 5LNVA 4UNKA 1PVNA 2ZQ0A 5DCBA 1GPWA 4GUJA 1NF7A 1FWWA 4NQ1A 3W84A 3QSRA 5ABTA 5HWJA 1TPH1 3BVJA 3LHTA 4FIRA 1ZFJA 5D2WA 2ALDA 1AL8A 3QQ0A 1P0KA 1R46A 1K8XA 3BW3A 3FJLA 4UR8A 4OT7A 2P0OA 3TMLA 1OFAA 5HMSA 4N9DA 5CZSA 4K7YA 2CLEA 5D2VA 3HIJA 2BSLA 3EX4A 4YLWA 3I7QA 1G69A 4MPQA 1H7RA 1GEQA 1Y0EA 3LCLA 1B4KA 3GXTA 4GUFA 4HNVA 3PVFA 1TPWA 2YGYA 3W7MA 2A7RA 1BKSA 3G1VA 2GVLA 4S2CA 4UTWC 1B9BA 1K03A 4BWLC 1YPFA 4JX5A 4JTKA 3VNDA 5G2WA 1EA0A 1QO2A 2F84A 3WFAA 5BOOA 1C29A 2TSYA 4R53A 5K4ZA 4FXSA 1NEYA 1B57A 3C2RA 3NR0A 3LLFA 4WY0F 2NXGA 1ZENA 2E09A 1PIIA 1EUNA 1I4NA 3QM3A 1QNVA 2HMCA 1TPC1 3NQVA 4WOZA 4XZ9A 1AW5A 1JUEA 3LCIA 4PL2A 3WJSA 3CWNA 2V2DA 5LKYA 1YXCA 3GNNA 4O15A 1HG3A 1O95A 4JX4A 1OF6A 2IQTA 2ZA3A 5EPDA 3TV8A 4ZMGA 1VHNA 3UPWA 2YFOA 3C2FA 5DCDA 2A85A 1JULA 3W7EA 2P10A 2HSAA 3PB0A 5AC7A 4FNUA 2YCEA 1OYCA 4WX2A 2X1TA 4LV9A 3NQ6A 2V5BA 3RNDA 4WXZA 3SECA 1JVNA 3ZR4A 1LOLA 3BV4A 4XBKA 1ZY9A 2QF7A 3F4NA 1R2RA 3B8DA 3IIXA 4ZQCA 4IMEA 2YSWA 4LVGA 4UTKA 3PY2A 6ALDA 3FA5A 3E0IA 4WJEA 1FDJA 2QJGA 4AHQA 3FFSA 4CNPA 3NQDA 4YXGA 1H51A 1YADA 1L9WA 2Y7GA 5K2ZA 5EA9A 1TQXA 5T26A 3H53A 3VKJA 1YTDA 2GQ9A 3B0UX 1TTIA 4WXYA 3T7VA 3BLEA 3L66A 3BW4A 4IMGA 2A7NA 4D2JA 1XDMA 3HPSA 3W3OA 4H3DA 3PULA 3O06A 4QM1A 2C16A 4KFPA 4R33A 3ABOA 3T55A 3LI1A 1WBHA 1OFQA 4NJKA 4ZQNA 2I1OA 3AJXA 4AWSA 4NJIA 1SO3A 2VELA 3LXAA 3C2OA 1JQVA 5HNRA 1LLWA 1GOXA 3KX6A 2E68A 1OFRA 4AXKA 1CX9A 1SZEA 1GYNA 4TIMA 5KSWA 3QSTA 1EP3A 1FWTA 3O63A 2JGQA 2D73A 2J24A 5D2XA 3M5ZA 3TW6A 1JCYA 2FFCA 2ZRXA 4HN4A 3BK0A 1MZHA 4Q4KA 3TAOA 3I7RA 1N7KA 2GVJA 4NNBA 4UFMA 5HUOA 4A2SA 2G97A 1HUVA 2YYUA 4RV8A 2FDSA 1KTNA 3S8HA 3CU2A 4UUIA 3GYEA 5K4XA 2PURA 2ZZ3A 3UWQA 1QPNA 3EWBX 2GVGA 4IMCA 3B04A 1Z42A 1A5CA 4Z08A 2J27A 3WJXA 2Q8ZA 4PCFA 1DJNA 5F2IA 3A9IA 1H7WA 3O6YX 3BLIA 3R8RA 5G2HA 3HJZA 3TC6A 3P62A 3LTSA 5F1VA 1PV8A 1ZALA 4CNOA 3FKKA 4O1DA 2BX7A 3QC3A 2Y7EA 1Q6QA 3UY7A 1GYLA 3OG3A 4JNMA 4ZQRA 4Z1AA 2C15A 1LOSA 4LOCA 4IXHA 5E0KA 3TSDA 4WY0A 4IQLA 4O4WA 4NVTA 4UTJA 3NPWA 3N14A 4AHPA 5LZLA 3MP5A 2H3DA 3U6WA 1KFLA 3W7HA 3L9CA 5I3GA 2G96A 3NAVA 1DOSA 5CPNA 1ADOA 3RF9A 1I2QA 3W7PA 1H61A 1ML1A 2V8ZA 3NPVA 3LLDA 2B0MA 1K7EA 5IM51 1EEPA 1XCFA 2VFFA 1W5QA 4FB7A 1LBFA 1XDLA 4JYDA 1D3HA 4AHOA 5J5RA 1RV8A 5DELA 4RCXA 1G4PA 3ZS4A 1LDCA 2JK2A 1HTIA 2Y62A 1JUBA 3MI3A 2VFHA 4CNNA 1TTQA 1Z41A 5HULA 3DENA 3I7SA 5FEZA 4EIVA 1QWGA 2PCQA 4JTHA 4NX5A 3GDMA 4NX0A 1F7BA 1KLZA 5C2XA 2J6XA 3CEUA 3TCEA 3F1QA 3W2LA 1VH7A 1M7OA 5MHBA 3N2XA 4H4IA 4NU7A 5CSSA 5CKSA 2G95A 1TYGA 4JTFA 5EL1A 3TMQA 1L2UA 3GB6A 2Z1BA 2VEKA 5AHLA 3HBLA 3DFPA 2YFNA 4PC8A 2C1HA 5AHEA 1ZJIA 3RU6A 4E0CA 2FB3A 3JS3A 1TPEA 4MIMA 3R89A 1MO0A 3A5FA 2H8XA 5D2TA 3W1RA 3TIMA 3G8EA 3S9YA 4ZQPA 2X2GA 2VFDA 5IBXC 2Z0IA 4Z1CA 2QUUA 3IGSA 4N02A 4QNEA 3NQGA 1FWNA 1VR6A 3DH7A 2Y7FA 2NXIA 3TJXA 4FF7A 4M5PA 4NXKA 2ZTKA 1VYPX 1FBAA 4AAJA 3PSVA 1W5NA 2EAWA 2FJKA 1VZWA 2QCDA 4UC5A 3EWZA 4Z0SA 4ALDA 1JCXA 3EKZA 5EY5A 4LY8A 2DJXA 3W2NA 3FOKA 2QCFA 1VHCA 1OG0A 4KFOA 4BI7A 3GR8A 3U2OA 4MLRA 1GJPA 3CQ0A 5K7JA 1W54A 3NQ8A 4AWTA 1FY6A 4JYFA 4ZL1A 3IGXA 2QEZA 3S5ZA 1FDZA 1GVSA 3C61A 4NT0A 5EYWA 1FX6A 4CQAA 3UQNA 4JX6A 3UZJA 4ADTA 3NEVA 1OYAA 3JR2A 3QMSA 5CG7A 3T4CA 4FNQA 4NJHA 3NQEA 4WZHA 2QAFA 4JDBA 4K37A 3UNDA 5AHFA 3W1QA 5LHFA 3C0JA 3O6DA 1QMLA 2BXVA 4UFKA 4UTUA 4FX7A 3OEXA 1W56A 3M47A 2A6NA 2ZZ4A 4M6QA 5CPOA 5G4EA 4NZJA 2OCZA 3HG5A 4M7TA 3WK1A 3FKRA 3G0SA 3O05A 3QPZA 4IPIA 4FNRA 1YTEA 3O8AA 1PS9A 3LCXA 3G1XA 4I7VA 3N3MA 2PRMA 3IVUA 3N34A 2C13A 4LVFA 1GVQA 3NPXA 3BG3A 1XUUA 1ME7A 2RH9A 1G6CA 1W1ZA 4POCA 1X6UA 1T99A 4Z0JA 3SIZA 1TV7A 3LHZA 3BG9A 4R34A 2JBMA 1W5MA 3P82A 4O1CA 1QCWA 5U7SA 1EP1A 1VYRA 1KM6A 5H91A 1FXQA 1KFEA 4DO5A 5KZEA 3LX9A 4DO6A 3HPXA 1KA9F 2FIQA 2NUXA 4BI6A 4YWIA 4N2YA 3GKAA 5AOUA 2GQAA 3TROA 3W1XA 5LNWA 1GTEA 4X3ZA 1R2SA 1PCWA 2CLOA 2DZUA 3N19B 1IXPA 4WOQA 1KV5A 4JY9A 3RK8A 4PH6A 2ZZ7A 2VEPA 3KXQA 1XBYA 4I7WA 4PODA 4O8RA 3L5MA 3IRDA 3DFSA 3W7NA 4GNJA 4MYXA 1PE1A 2OT1A 3MJYA 4RZ4A 3CIXA 3MBFA 2XN1A 1IGSA 1XL9A 3GDTA 1HFBA 2G5WA 3B05A 3TNOA 3CLMA 1H7OA 1JCMP 3T40A 5D33A 3THAA 3G0UA 3ZWSA 3L2IA 4JGDA 3GK0A 4DF0A 3KRUA 4ORMA 2X1SA 2LLEA 1JCNA 2ZDRA 4CQ8A 3LRLA 5U4NA 3SZ8A 3DKJA 3M16A 3TQVA 1SO4A 1TIMA 4JTUA 4E2BA 5FESA 1A53A 3W07A 3WJYA 1T96A 3SSJA 3ABRA 3W1NA 4IOTA 1VQTA 2ZCGA 3TFCA 3NDOA 4HNUA 5DY3A 2CZDA 4RXFA 2V9DA 2DZPA 1IF2A 1Q6OA 5D02A 2DZWA 3P81A 4MZ1A 4IMFA 1Q6LA 1NVMA 4UNLA 3DHDA 1FXPA 5BW6A 1WBJA 1G4TA 2GPTA 1W8SA 1A5AA 3E49A 2GOUA 2H90A 2ATMA 3W9ZA 4Y9AA 4GWEA 3PUEA 3VFLA 2ISWA 3S5OA 1KW1A 1M5WA 3JRKA 5DBTA 1AL7A 1GG1A 2YW4A 3LM7A 4I9AA 4LS1A 1FCQA 4GC4A 2WJZA 5HWMA 5K9CA 4A21A 3A23A 2WNNA 4K39A 1THFD 3QFEA 2OZ0A 4M6VA 4JD4A 2WSYA 5C6MA 4FHAA 1B3OA 1TO3A 3EX2A 4HPXA 1WV2A 3UPBA 3G1DA 1S5TA 2CLKA 5AFDA 1G4SA 2WPBA 4JICA 2FPYA 3GZ3A 2A0NA 5DBUA 3STGA 2CZEA 4Y6GA 1KM4A 2X1RA 3W71A 5D38A 3GNDA 3TXZA 2KZHA 2PRLA 3EX1A 1XXXA 3CTLA 4O10A 3P84A 4LWWA 1DORA 3G0XA 4W9TA 2B7OA 4DF1A 5HR7A 3VE7A 2YPIA 2CLIA 1XBZA 2R91A 2ZA2A 1OK4A 2A7PA 2ISVA 4O52A 1AW1A 2PE4A 4O1BA 1RQEA 3DZ1A 3LXBA 3BW2A 3N2MA 3P8IA 1W3NA 3EWYA 1ICQA 1TV5A 2GJNA 2CZ5A 2EPHA 3PF3A 2JGYA 3L5AA 4O13A 3P60A 3UWVA 5BMWA 4HPJA 3S42A 3PS7A 3W76A 1U83A 4IX0A 3W7LA 4IWWA 2ZBTA 3LDVA 3DU0A 1CW2A 1TTPA 2QCLA 5FF3A 5AC6A 2TYSA 3A21A 2NV2A 1SW3A 4MY9A 1AG1O 3EX6A 2E6FA 3R2GA 4FX6M 4AEOA 2X30A 4X22A 1D3GA 1KFCA 3EXSA 1EWDA 5HUPA 4UFIA 1ZNNA 3LCWA 1ME9A 2B4GA 3Q2DA 1EPXA 1WOAA 1P0NA 2PC4A 2ZZ1A 3H55A 4N9CA 4L4MA 4CCDA 4OWGA 3QRHA 1LP6A 1TPB1 2WNZA 3TW7A 1ONRA 3BPWA 2DJLA 2ZYFA 1LZOA 3UWWA 4CCCA 4UFHA 1GVOA 3NZ1A 2YXGA 1KLYA 5CZTA 1F2JA 1GT8A 1SW0A 5BNKA 1TREA 3R5EA 4Q32A 1XKYA 2TPSA 2WSRA 2QCMA 3ABSA 3C2EA 1JRCA 4ADSA 1I8JA 4GXMA 5HINA 1TPUA 3LV5A 2HS6A 1DV7A 3TDFA 1AW2A 4AWUA 2WKJA 1VJIA 4MVAA 4EWND 4UCGA 5AHIA 4JTLA 2QJIA 5CZ0A 4QNWA 4RZ5A 1FQ0A 5FF7A 4M7SA 3NA8A 4YCPA 4IJBA 4RX0A 2DZXA 5D2YA 1I45A 1LRNA 3GX9A 4MFDA 1W0MA 5KMYA 1FUYA 3SY5A 3W74A 3W2JA 4MKNA 4JIQA 1XUZA 1DHPA 1SZFA 3FYPA 4J9JA 4RLIA 3IEBA 3M5YA 4EF8A 4X9SA 1KBJA 3ABQA 5I3JA 1ALDA 3LHYA 4L4LA 4UTWA 1V7YA 2OX1A 2V5LA 3MWAA 4E38A 1UCWA 5FF4A 4BWLA 2DP3A 3HGJA 3HGOA 1IIHA 1H7XA 3M1ZA 5I3FA 1K8ZA 3LGEA 3W7QA 3W2MA 5K9XA 1W3TA 1YTKA 3G1YA 2WO5A 1HO1A 3NM1A 3TU9A 2WQPA 4QSHA 5F2LA 2ZRZA 1XFBA 1MSSA 2WSQA 5L9FA 1N55A 1TB3A 2EF9A 3A24A 3DGRA 4M6PA 3QMTA 3O07A 3M43A 3C56A 4O53A 2J9ZA 1K7XA 4IUOA 1A5SA 5HQEA 5EKYA 2A21A 4N6EA 2E5CA 1EB3A 1DKWA 3DXIA 2W79A 3EKLA 4YCOA 2EKCA 2DORA 5CPMA 1FCVA 3H54A 2W0UA 3EWUA 2WV8A 1WXJA 2YR1A 5CGQA 3P5ZA 1LRTA 4A2RA 3EB2A 4MFEA 2Z6IA 4JTTA 2EGZA 3P7YA 3E96A 1M6JA 4QAIA 4LW7A 3GIYA 1SW7A 3QH2A 3NYZA 2A2IA 1K7FA 3PM6A 1KM2A 5E93A 4JEQA 4UTHA 3CT7A 4UTIA 1NF0A 4HNNA 2E1DA 1SSGA 3E9AA 1Q45A 1ZAHA 3CHVA 4QIUA 2Y7DA 4JXCA 1YDVA 1ZAJA 4IGHA 4O1AA 2VC6A 2Y85A 3IIZA 2AQWA 5DN1A 1PHWA 1W3IA 2H8ZA 3SFKA 1ZAIA 2QDHA 3W7GA 3U8GA 2ZRUA 3LB0A 4U28A 3W7DA 3FJ6A 2B7NA 2ZA1A 2ZFAA 1QAPA 1KFJA 4BFAA 3HG4A 2NWSA 1OX4B 6TIMA 3UWZA 4GRSA 3LTPA 3TR2A 4MJZA 3IVTA 3NG3A 4P61A 3W7KA 3NQMA 3GVGA 3HPZA 1TPVA 3I6RA 1R2TA 1SU5A 5CSRA 3G22A 1UBSA 4E2DA 4EOUA 4O18A 4IPJA 4ZQOA 4HSNA 5DY2A 1OK6A 4PL1A 5F4WA 2VFIA 1SZGA 2JKAA 2NLIA 4FNPA 1OYBA 5C54A 4UXDA 2ZTJA 4DEFA 4LS2A 4HHPA 2DZSA 3W1UA 2QAPA 1T0OA 2I14A 4LT9A 4OQVA 3GR7A 1CI1A 2Y61A 1KFBA 1VGAA 4UTMA 1TRDA 1R47A 1WYIA 1BWLA 2NUYA 2A4AA 3TC7A 1H60A 4DQWA 1U5JA 4DPQA 3UY8A 5I3HA 2E6DA 3SGUA 1UUOA 4GBUA 3DI0A 4HKPA 2NXHA 4K8HA 4HNTA 4N6FA 3NQFA 3Q37A 5A5WA 1G7VA 4JTEA 4Z1DA 5FEXA 1V5XA 4ML9A 2QCGA 4LUJA 3TA6A 4UMAA 1OFDA 2RFGA 4K38A 1EWEA 3W88A 3LXCA 2ABBA 5LHEA 3LV6A 1TRIA 2WNQA 4RKAA 2VOMA 3YPIA 4O16A 4PFMA 1F74A 2CFFA 3LRKA 5G1YA 1OFBA 4S2BA 1AK5A 1H1ZA 4FEZA 3G3MA 2NX3A 1XBVA 3EWWA 4CCEA 2BLEA 1LBMA 4LU0A 4MOZA 1L6WA 3HO8A 5FF2A 3RMJA 4O0KA 1FDYA 3QYQA 1YXYA 2J9YA 3OHIA 4ZZ9A 2E5DA 1MEHA 1I2OA 1ME8A 4WUIA 5D05A 1DBTA 4M19A 1G4EA 2VENA 1ZHAA 1QFEA 1RD5A 4LVDA 3S5NA 3TK7A 4HT3A 4LS0A 4BR1A 4RK8A 1RQBA 2CW6A 3PBWA 1X7FA 3WK3A 3HQ1A 4UR7A 1W5OA 5GVJA 2FB2A 3HGSA 1H7NA 1O5XA 1OJXA 4QITA 5LNSA 1VYSX 1RQHA 4WD0A 5LNUA 1VLIA 5AYZA 3DFTA 3SJ3A 1MEIA 3F4WA 3MO7A 1F6PA 3PAJA 2FPTA 1F5ZA 4KKXA 4NNAA 3LBCA 5EMUA 3IIVA 3UXAA 1LORA 3W1LA 3ANYA 4OGZA 4PTNA 3W83A 4AB4A 4MZ8A 3S1WA 3O15A 4OV4A 5IBXA 3KVJA 2NUWA 1YXDA 2NX9A 2Y89A 2CWNA 4RJEA 3THQA 3HG3A 3W7CA 5E1QA 4JYEA 3B4UA 2V0TA 3EXTA 4OHQA 4K7VA 5K3VA 2YYTA 3QQ1A 4TX9A 4JDYA 4XUGA 4ZVJA 3BLFA 1OX5A 4N4QA 1K3UA 1K8YA 1QOQA 1YLVA 3GLCA 1JQXA 1OFPA 2F7FA 3TXVA 2ZRYA 3PG8A 4IXXA 1W31A 3L0NA 2A5HA 3W2UA 4C1KA 1KTCA 4NJGA 3S6DA 3PUOA 3INPA 2DZVA 1BWKA 4LRSA 1RZMA 3MBDA 4MUZA 2RDWA 3CEPA 4NNCA 4OV9A 3W73A 3W1PA 3DFNA 3G1AA 2ABAA 3AO0A 4LVBA 1PL9A 1WOBA 3NL6A 5TBOA 3KRZA 5F2GA 2B7PA 1WDWA 3STFA 1KTBA 3NOEA 3STCA 4GE8A 4XBSA 1P5BA 2X1UA 2ZRVA 1H7PA 3O6CA 3PB2A 3DFQA 2J9XA 4GUHA 1OABA 4DXVA 3SGZA 3QF0A 3T78A 1TPDA 3BGGA 4O28A 3G24A 3PWAA 3HGRA 3GAYA 4LC6A 4KFNA 3BO9A 3HB9A 3FYOA 3W86A 3GXNA 1O94A 3FEMA 1LCOA 2QUVA 2VXNA 1WA3A 4CLMA 1A5BA 3KVLA 4MY8A 1FWRA 3NQ7A 4NUWA 3TX9A 3Q58A 2VFGA 4TO8A 4DF2A 1XBXA 1YDOA 4YL2A 2YZRA 3OVRA 5J5DA 3N9SA 5LNRA 3I65A 4X2RA 1S5WA 1H5YA 4ORIA 3V75A 1SZNA 5F4SA 4B5NA 2ZZ6A 1PCKA 4Y96A 4Y90A 3QW4B 4FX8A 3L67A 1JR1A 5H2ZA 1WAUA 3ATZA 1W37A 4ZQMA 3R12A 5KINA 3M0ZA 5AHMA 1WQ5A 3W6YA 2VEIA 1TJPA 4QJ1A 4O54A 3UXDA 3TE9A 1AMKA 3GDRA 4A3UA 5I3IA 1GZGA 1KM3A 1RR2A 5L6UA 1ICSA 1OF8A 5A8GA 4PA8A 2CLFA 3W75A 4LC8A 3P67A 3KFTA 5CPLA 2RKXA 4S1FA 3GAKA 3MYPA 1YPIA 1IXNA 3IIOA 3NM3A 2GUUA 4DELA 4K36A 3UZ5A 1J2WA 2RDUA 4UFJA 3QJAA 4FNTA 2QR6A 4ONVA 1IXQA 4RXGA 3DBPA 2NX1A 2Q8LA 3SI9A 3LHWA 3C6CA 4LNYA 2H6RA 3T44A 3BARA 1LRQA 2GQ8A 2XN2A 3G8RA 5AN7A 3SR7A 3O1NA 3E02A 5CZJA 3USBA 4BK9A 3QMRA 1JUKA 3TSBA 3DFOA 3IVSA 2V82A 5I3KA 5DLCA 1LM1A 5DCEA 3LHVA 5D04C 4O14A 3DI1A 2Y6ZA 2XN0A 3PG9A 5AHNA 4A29A 2AAMA 3RLVA 3IIPA 5D30A 2RDTA 1IIGA 1VPXA 4Z1BA 3DAQA 3KOFA 2DU2A 1J4EA 1BEUA 4MZYA 1T8XA 2P1FA 3L5LA 2BWGA 3NVTA 1P4CA 5G1TA 1SUXA 4UTTC 5D03A 1EP2A 1NAL1 4I7UA 5AB3A 4O11A 1G7UA 2CLLA 5KTLA 1RPXA 3MW7A 5F1UA 3NL3A 5F4XA 1S3HA 1KM0A 1JJKA 3M9YA 2TMDA 4EVZA 2CLHA 3EWXA 4QQ3A 3L0KA 4TMCA 3MI6A 3TQKA 4LV4A 1QPOA 2J88A 1JRBA 1TCDA 3W2KA 3W72A 7TIMA 4C1LA 3FS2A 1VRDA 3F03K 1VCVA 4Y8FA 1EX5A 1TSIA 5D37A 2ATSA 3NXFA 4NJJA 3TQ0A 5K9DA 3TFXA 2Q3RA 3RLUA 3W85A 2CLMA 3PSWA 2XFWA 3MP4A 1DQWA 1OFEA 3W87A 3V1PA 1LTDA 4TU1A 1C9DA 5SWUA 2OT0A 4FNSA 4O50A 3RFAA 3TAKA 1L6SA 3EEGA 1X1ZA 1NFBA 4UIOA 2QCHA 1Q3NA 1SPQA 2E77A 3KAOA 3BGJA 3UYCA 1GWJA 3LCFA 1MXSA 4TMBA 5G4WA 1QPRA 1SQ7A 4OE7A 3W1MA 3OVQA 1F76A 3LOTA 3MHFA 1R30A 4TR9A 1BTMA 1YDNA 3PBVA 4JIPA 1Z44A
chains in the Genus database with same CATH superfamily
4UQAA 1F73A 3TKFA 4IF2A 4DO4A 4NXSA 2XSXA 4GXPA 3L65A 3WH9A 1XQKA 2VZOA 3DCPA 2YJQA 3P8JA 3N73A 5HK4A 4JTIA 1GOOA 3C0SA 3QY6A 2NWRA 5BMXA 4MLJA 4XTDA 1MUCA 3G1HA 4X0VA 4Q33A 1SFJA 1OSEA 3AS1A 1WZMA 4JR5A 1A5OC 3BOLA 3M0IA 5HWNA 3L0GA 3OZMA 3HFYA 4Z42C 1A5UA 3SJNA 1UWTA 3BMXA 8XIAA 5BU6A 2OWWA 3TOPA 2GK1A 1FWSA 4E5TA 2WM1A 4ADUA 1GJWA 2QDGA 1BQCA 3KS5A 2YL6A 3DHFA 4UTTA 2YDAA 3W26A 1A0DA 3FIGA 3QHMA 1Z69A 1KC7A 2F61A 4GY7A 4IQJA 3GDLA 2OYLA 4AC1X 3V1HA 3ELFA 2WJEA 1R85A 1VCFA 5JIPA 2FZ8A 1VFHA 1SFLA 3M41A 2NZLA 3LCGA 3GKFA 1J93A 2QT3A 3MYOA 2MANA 1CGVA 2IXUA 2ISSA 3BAXA 4XQ6A 1I2PA 1QU4A 2FYMA 3KVKA 2R94A 1LYXA 3RR4A 3SSZA 3P61A 1CZ1A 4HNCA 3OQ8A 4AD4A 2Y63A 4B5UA 3CB8A 3DKLA 1SJAA 2VKZG 4OBTA 3UWUA 3C4UA 3MT1A 4IMDA 1EF3A 3KVMA 1YDYA 3USZA 1K4GA 2OELA 2PP1A 2B7QA 3CHFA 2QF8A 1H50A 3VABA 2V81A 1QNQA 3ARVA 4XISA 4DZIA 5LGZA 4X9YA 4MJMA 2QPXA 3UG8A 2PU1A 3FVDA 4KRUA 5BROA 2OGYA 3CZ8A 3U5YA 1EC9A 3ARXA 3VU2A 2DW6A 4AMAA 4XV0A 4R7JA 4JKLA 6A3HA 3NL5A 1Q4WA 2VWSA 3NQ2A 5TQLA 3FEQA 2D1ZA 2YA2A 5FJOA 1MW3A 4IIHA 3A5VA 2EPNA 5JBDA 2HS8A 3RPTA 2I57A 1DJXA 2IPJA 2PDNA 1GQNA 1P7TB 2Y4SA 2X8RA 3GUGA 3W23A 5EFDA 3PBYA 3KUMA 1P7TA 3VFCA 3O16A 1HJUA 5HNNA 2ZUMA 2VR2A 5FI8A 5EMJA 3OA3A 1SO5A 4GLEA 4DXXA 1PTGA 3NQCA 3THUA 3WDQA 1V3KA 2XIQA 3RU8X 3C52A 3SRDA 5I2UA 2V3EA 4B5WA 1IEVA 2DZTA 5LA1A 3PR2A 4JHZA 2QIWA 4JAWA 1JZ6A 3VOCA 3PN8A 3P5YA 1XI3A 4QE1A 1TCMA 1F05A 3M5XA 3CIWA 1P1XA 4RNFA 2WWCA 1GVRA 4CQ9A 2PPGA 4IX2A 1GKPA 1SR9A 1UB3A 2DFAA 4XIMA 3S0CA 1WP6A 1DQXA 1HJSA 3LQGA 4GHRA 4O4VA 3WH5A 3BZJA 3WK2A 2GYIA 3TNBA 2V69A 1YIXA 3EOSA 1UIPA 1S5VA 5C9WA 3BLKA 4HSOA 3R25A 4HU0A 3T9PA 4I8YA 4GUIA 1B4EA 1UPPA 1V77A 1R86A 2X0SA 3DFHA 3SGGA 1D9EA 1X8FA 1QHOA 1ZL1A 2EQDA 1VCGA 1QBBA 1GYMA 2CXGA 2WC4A 2O9PA 4JTJA 4GJIA 4LY4A 4S3BA 3VDBA 2HEJA 5A6SA 5A6KA 1XH1A 1TVLA 3SW6A 2QJHA 1VLWA 3QTGA 3VMNA 3W29A 2DUXA 2BOEX 4UQEA 5FOOA 1HKWA 3H4XA 4ACZB 3K30A 3TJLA 3PNUA 1XIMA 1Z6KA 4DBEA 4Q4SA 4AIOA 4ACZA 2HDJA 2OJPA 1TZZA 2QNEA 2ZRWA 3HF3A 4XBJA 2BZNA 4C60A 4PGLA 1XRTA 2ZVRA 4WCJA 3S1UA 3LBMA 1D7KA 2PDPA 2QKFA 2JFEX 4U3CA 1EPVA 4IP4A 3W7JA 3DG7A 3G3DA 3BOXA 2CZFA 4NG3A 4UMBA 4MY1A 1E0TA 2XIBA 3MO4A 1H63A 4XZIA 2FPVA 3ATYA 1M41A 3OIXA 1A47A 3GBEA 3LZ3A 3NVDA 3GXIA 4PUNA 1R3WA 4RL3A 1JPHA 2E6YA 4WIWA 5KEZA 2W91A 1Q7ZA 3A22A 4E4FA 1ONEA 4XIAA 3B9NA 3DOPA 1U1HA 1QI4A 5DCBA 1GPWA 2SFPA 4XB3A 3WLJA 1XH0A 3OOQA 1MQRA 3J7HA 3W84A 5HWJA 4HYRA 4FIRA 1ZFJA 2XSBA 3KTXA 2Q6ZA 3PTQA 1NH6A 4OVXA 1R3YA 1K6WA 2P0OA 3TMLA 3VZYA 3CAVA 4Z2KA 2Q71A 1VKFA 4BJHA 5CZSA 1OCJA 1RUSA 2CLEA 3HIJA 3PPGA 4YLWA 5IFTA 1EJUC 1G69A 3VDHA 4H1ZA 1H7RA 1GEQA 1Y0EA 4H9YA 3GXTA 2OKOA 5F7UA 4JFTA 5LIUX 1JDDA 4KMQA 4UOQA 2GVLA 4GGHA 1JI1A 1B9BA 3WMSA 5XIAA 2F6XA 5HBFA 2PLJA 2CEQA 3AIEA 1W1B1 3PZIA 4A4AA 3PJXA 4R53A 5K4ZA 4FXSA 4IPPA 2XGBA 1B57A 4PCSA 1XLBA 4AD3A 3NQVA 4WOZA 4C6EA 1JG9A 4QEEA 3TN5A 1M53A 3WJSA 3CWNA 2V2DA 4O15A 4JX4A 3OP2A 2D24A 3VOIA 5TF0A 2ZA3A 4J35A 3TV8A 1QXLA 2G4JA 4QCEA 2YFOA 3C2FA 4X63A 2P10A 5AC7A 4FNUA 2YCEA 4GIEA 2WANA 4NRSA 4PTDA 4WX2A 2X1TA 3RNDA 1PX4A 4B5VA 1KWGA 1JVNA 5AKQA 4XBKA 3F4NA 1R2RA 2RGMA 3PTMA 2OSWA 1ECEA 2YSWA 3DC8A 4KCVA 3GH4A 3W53A 4LVGA 4UTKA 3E0IA 3L4XA 4RE3A 3L7RA 3PK7A 1EJXC 3EWCA 1EGMA 2V38A 3GSMA 3CZGA 1L9WA 5K2ZA 4GVIA 1LQAA 2PUZA 2GQ9A 3TOYA 3B0UX 3OGRA 4WXYA 4R85A 3MDUA 3T7VA 1ZQ5A 3L66A 4IMGA 3UG4A 1RHCA 5FL0A 3HPSA 1FWDC 4K1WA 4MWAB 5C9ZA 3URQA 4ZBCA 2C16A 3F5LA 3ABOA 4MWAA 1RY8A 1WBHA 1XYLA 1TJ2A 4Q8UA 4NJKA 4ZQNA 2I1OA 3JU2A 3P0XA 3E0FA 3T42A 3GO2A 1SO3A 2DZAA 3CQKA 1O1HA 4ZSUA 1JQVA 3C2YA 5HNRA 2E68A 3K8MA 4TIMA 5KSWA 1GOMA 3MC5A 1GJUA 4PCTA 1FWTA 1ZB5A 3CHCA 3M5ZA 5D2XA 2WMFA 2WKLA 2VEFA 1S2TA 4UWMA 3BK0A 1MZHA 3TAOA 1P6BA 4RV8A 4XKMA 5ENLA 3GYEA 5K4XA 1CWYA 3QTPA 2I5QA 2V6AA 3SQSA 3EWBX 4IMCA 3B04A 5PTDA 4WDXA 2IQ0A 3DIPA 2Q8ZA 1UPMB 3GNPA 2O4MA 3U48A 3A9IA 5G2HA 4U3AA 1ZALA 2E4TA 4CNOA 1LUCB 2BX7A 4GH1A 2J7DA 3QC3A 4JNMA 4H00A 4GI9A 3WQEA 2XH4A 4WY0A 1QNSA 2WCSA 5CZKA 1R9XA 3N14A 4AHPA 1JYWA 1Z9AA 2OR2A 5GJPA 1PWMA 3MP5A 2P8CA 2CETA 1KFLA 1WUFA 3H2MA 1MZRA 3LYEA 4L1XA 4TTUA 3RF9A 3HPFA 1ML1A 2V8ZA 1HKKA 1MNSA 1X6NA 5EGRA 1E4MM 5AC4A 3GFZA 1K7EA 1ZGDA 1D2KA 1XYZA 3H7UA 1LBFA 1VEPA 4JYDA 1D3HA 4AHOA 5AC5A 1RV8A 1AZ2A 1HTIA 4PYSA 2EG6A 4M3PA 1CYGA 5CAHA 1QRQA 1E6ZA 4W8BA 4P5UA 9CGTA 3DYPA 3MVTA 2WZHA 3SM0A 4DAFA 1F3TA 3WUEA 4CN6A 4I9JA 3AMKA 4EPKA 2VDIA 4JTHA 4DWSD 3U7BA 3QQWA 1EL3A 2X0YA 3QGKC 3LBOA 1M7OA 3D46A 1UR0A 2AQOA 3VD4A 1CXHA 3TMQA 3GB6A 4ROPA 1IWPA 4KRTA 5AHLA 2YFNA 4ZE5A 4C6MA 5AHEA 1ZJIA 2VJXA 2VQTA 4E0CA 3R89A 5I5RA 5D2TA 3W1RA 2UY3A 1T41A 2X2GA 3BCDA 2PTDA 2QUUA 2NXIA 4M5PA 3MSDA 4ZCWA 3PSVA 4DWSC 1H11A 1VZWA 4UC5A 3SCNA 1JCXA 5EY5A 1CXIA 2A3AA 3MV11 3SURA 1B31A 4KFOA 3GR8A 4KESA 3UA3A 3E2SA 3WCZA 1JDAA 3CQ0A 1W54A 3OPSA 1FY6A 4JYFA 1E1CB 1DWJM 3S5ZA 3U9IA 1E72M 4X60A 1D8CA 1BG4A 3CO8A 3UQNA 1YE4A 5A8QA 3QMSA 5CG7A 4EP8C 3WBAA 1E70M 2H9AB 3CQJA 2YDSA 1EHAA 3UNDA 3BH4A 4AQLA 4DNMA 2H9AA 3C0QA 3Q45A 1QMLA 1HN1A 1FWAC 4WGXA 5CPOA 3S2JA 3HG5A 3WK1A 3WY1A 3O05A 4KWSA 4IPIA 3O8AA 4C65A 3G1XA 5D4YA 2PRMA 3MVIA 3BG3A 3VIHA 5FL1A 1BXNA 3SCTA 4POCA 3WD1A 3SIZA 1OD0A 2W3ZA 1XQLA 2JBMA 1W8GA 4O1CA 3M7SA 1EP1A 1PEZA 5E0CA 1KM6A 5H91A 5KZEA 3AI0A 4UCFA 4DO6A 1KA9F 2NUXA 2DVUA 1IEQA 1DYSA 4C6FA 1W1IE 2DZUA 2RJGA 4ACYA 4WOQA 4JY9A 2XINA 2HVOA 1PX8A 4I7WA 3GDBA 4ZO7A 3L5MA 3IRDA 4IPNB 1B2YA 1QI0A 3F2BA 3MJYA 2WC7A 3CIXA 1HFBA 2G5WA 3B05A 4IL2A 1H7OA 3T40A 3G0UA 4UZUA 2X1SA 1V6WA 3CNYA 1V6TA 2BOFX 3LRLA 4WEVX 4JTUA 4XX6A 2O9OA 4OFCA 4PBFA 1T96A 4DRSA 3FXGA 1L6FA 1PDZA 3NDOA 4U33A 7TAAA 4W4QA 2CZDA 3RG6A 2V9DA 3VX0A 1AH0A 4CU6A 5CEWA 2UBPC 4AZ6A 1Q6OA 1RPKA 2PDLA 3AFBA 3CUJA 3GC2A 2VWTA 3BANA 3DHDA 3R11A 4GI4A 4A3RA 5C70A 5BW6A 4MWAD 4W5ZA 1JYVA 3E49A 2GOUA 3W9ZA 4CN1A 3S5OA 3T8LA 1I0DA 2PF0A 4DBUA 1AL7A 2VP8A 2WJZA 5K9CA 3ITGA 1DJYA 2YB1A 4K39A 3QFEA 1R3QA 3Q4DA 4M6VA 3V36A 3VD3A 3S6OA 1TO3A 1UD8A 1M03A 4U5IA 3I6TA 1J01A 3UPBA 3WH8A 1G4SA 2WPBA 4JICA 1OGBA 4M29A 3IUIA 3UR8A 2IS7A 3IAQA 3AAMA 5FSDC 3OZOA 3C86A 2D2OA 5D38A 1MRQA 5LA2A 4R7OA 4IFKB 3AMLA 4Y9OA 1EJVC 1KBKA 5HPOA 4LWWA 1PZ0A 2VGFA 3VE7A 4IFKA 2YPIA 1S5MA 2CLIA 4BKNA 1GOKA 1EA9C 3N04A 2PE4A 1XIEA 2X7VA 2WVTA 3OBEA 1AQ0A 2PGWA 3OO2A 4DJFA 1TZ7A 3E2QA 4Q8OA 1ICQA 2WCAA 3U2ZA 2CZ5A 1GVIA 4EWJA 1HIZA 4W86A 1NELA 3P60A 2OWCA 1DWFM 4F0KA 5BMWA 3S42A 1Q13A 1U83A 4IX0A 4IWWA 5GNZA 3DU0A 4M1RA 5FF3A 4NP7A 1GHRA 3IARA 3H4GA 3GVQA 4MY9A 4I6VA 3GHSA 1MXGA 5CLWA 3EX6A 2GGIA 5ECVA 3R2GA 3WIJA 2Y24A 1VFUA 1VEMA 5AECA 3BTNA 4AEOA 5E5CA 4IP7A 2DIKA 3GG8A 4I9TA 2YBTA 2WCGA 4L1GA 2VTFA 3LCWA 2B4GA 3Q2DA 3SADA 2ZX8A 5EMMA 4C7FA 1GOQA 4L4MA 4W89A 4CCDA 4LUYA 3E5PA 3EDEA 4MB1A 3TW7A 1ONRA 3BPWA 4CCCA 3POCA 1GVOA 2HK1A 2KAUC 5CZTA 3AQUA 1GT8A 3VIKA 5BNKA 1QUMA 4Q32A 1UA3A 3C2EA 4YHGA 1JRCA 3L4WA 3LV5A 2HS6A 5KZ6A 4PTMA 3T0DA 1N82A 3UCDA 1VJIA 2J7EA 3VA8A 5ABFB 4AD2A 1Q6EA 3ZZ1A 2IW0A 5H8MA 4M7SA 4YCPA 4IJBA 1CGTA 3TJ4A 4MFDA 1JXKA 3AXKA 1EDTA 2Q09A 4GO9A 5KMYA 4QDWA 4DJEC 3TTSA 3SY5A 2TODA 1PKMA 1SZFA 3TTQA 3VTRA 1QJWA 4GKLA 5BOFA 4H6QA 4JIRA 1KBJA 4X9SA 4DBSA 4LCQA 4DHGA 2OX1A 3M0JA 1TUFA 4E38A 1ISYA 1UCWA 1GHSA 4AXNA 5C2GA 4JQ1A 3EOEA 3POHA 4NYUA 1JEZA 2JEPA 3W2MA 3WF3A 9XIAA 3E6EA 5JUVA 1YTKA 3G1YA 2PGEA 3NM1A 3L4ZA 4X0NA 4QSHA 5F2LA 2ZRZA 1IT8A 1XFBA 1C7TA 1EC7A 1D8WA 4JTCA 1TB3A 3W25A 1M3UA 1I0BA 3A24A 3DGRA 4M6PA 1E6PA 3QMTA 1KKRA 1XKJA 3MSYA 1A5SA 2EG8A 1CXKA 4ERIA 3FCPA 1PO9A 1B0IA 1EYWA 3RCMA 2DORA 5CPMA 3EWUA 4GKTA 3P5ZA 1LRTA 1ZZMA 4D6EA 1U22A 1NP0A 2EGZA 2GQ3A 4FR1A 3E96A 3M0HA 3TN3A 3NCOA 4LPCA 2E9BA 3PM6A 4UTIA 5H8PA 3FY1A 3RITA 1JD7A 1S1RA 3E9AA 3ALGA 4IIEA 4J5NA 1KGUA 4LANA 3LN3A 4JXCA 1YDVA 1ZAJA 1ISXA 2VC6A 5MKGB 4Z2JA 1VFMA 4DM2A 3BAWA 1WUEA 3SCWA 3N3TA 4LB4A 3L2LA 4L6OA 5EU9A 3REQB 1ZAIA 2VD8A 4M56A 4HA1A 3VD9A 1ZS2A 2QHAA 2VURA 4Q3MA 2AL1A 4GPNA 3W7DA 3FJ6A 2ZA1A 4A3QA 2F8QA 1V7AA 3REQA 1KFJA 1US2A 4XAPA 3MWCA 5JIWA 6TIMA 2CLPA 1OADA 3LTPA 1HGWA 4RDWA 1NOFA 2YCIX 4P61A 2PZNA 4PUDA 2DT3A 3NQMA 3SRFA 3GVGA 3HPZA 3H23A 3I6RA 5CSRA 1UBSA 2Q8XA 4EOUA 4JFSA 4AYSA 4MADA 5HOSA 5DY2A 5ABGA 4Q4QA 4PL1A 1B3XA 1R7AA 1VFOA 1W1PA 3VUSA 4EAMA 1J0KA 2BY2A 3W1UA 2I14A 4LT9A 1JFHA 3KP0A 3GR7A 1R47A 2A4AA 1WB0A 3TC7A 1H60A 2ACQA 3E0LA 3M0XA 4GY1A 3TZFA 4LBRA 2AL2A 2ZX7A 4HKPA 3GH7A 4KIEA 4HNTA 2PDXA 3K1GA 5ECUA 4JTEA 1JXJA 4Z1DA 5FEXA 4KERA 3OG2A 4C6PA 4PN2A 5C0QA 4H9MA 1OFDA 1EWEA 3LXCA 5LHEA 3Q65A 2VRJA 1JF5A 2EPLX 2VQUA 1UWRA 1P6WA 3WL0A 1LWJA 1TELA 1QK2A 4FEZA 1XBVA 4I8DA 4LBUA 4LU0A 2FH6A 1NTHA 4V33A 3HO8A 4O0KA 1YXYA 4U10A 2J75A 3GG1A 1W3JA 2X05A 4B5SA 1BXCA 1DBTA 3SCPA 1G4EA 1X96A 3SRHA 4LVDA 3BZGA 3S5NA 4HT3A 2FGBA 1I1WA 4BR1A 4RK8A 4M0XA 3HQ1A 5GVJA 1W5OA 4DJFD 1TJ0A 4XVEA 3OW1A 3U3HA 5LNSA 1VYSX 2V3DA 1RQHA 3GR4A 4WD0A 3WG6A 5LNUA 3S9ZA 4HB7A 3SJ3A 3OYZA 2PWGA 1KB3A 1NWRA 3ANUA 3LBCA 3MB9A 4R27A 2OVLA 3KWSA 3R79A 4AB4A 1A4MA 1E5NA 2NUWA 1M1BA 1OZMA 4RJEA 3N4EA 5E1QA 7REQB 4L4PA 1VRXA 1JZ5A 2CIPA 3AMDA 4ATLA 5K3VA 3QQ1A 4TX9A 4XUGA 2FDMA 4ZVJA 3UZXA 4CGTA 4D8ZA 3U4FA 2J62A 3GLCA 2Z1VA 3PG8A 1XLIA 2PU0A 3L0NA 3QLDA 2QPUA 2A5HA 2W92A 4FP1A 3W2UA 4FLQA 4GC3A 2VVNA 5CJ5A 1OC7A 1MMFA 1W1A1 3PUOA 4QR6A 1GPFA 4HOZA 2RDWA 3CEPA 3UR7A 4PB4A 3B8TA 3G1AA 4QQUA 5GNXA 4L9XA 2WMJA 2XM2A 1PL9A 2VEGA 2D3NA 4YTQA 5TBOA 4UQDA 1JCTA 4G56A 2HE5A 4UTFA 4GE8A 2OQLA 1TVNA 4HA3A 3G77A 4AD1A 1P5BA 1SGJA 2X1UA 4IISA 3O6CA 5CC6A 1ZP3A 4JNZA 5FJRA 1SVDA 1CXLA 4LEFA 3AIQA 2BASA 4D6JA 1YPXA 1JYNA 3Q67A 3ITLA 3WF1A 3VAVA 4GIYA 1CECA 3FEMA 2QUVA 2VR5A 3V5FA 4NUWA 4L5ZA 4TO8A 4DF2A 1XBXA 3KTCA 2YBUA 3MA8A 4YL2A 1JPMA 4X2RA 3FGCA 4OTKA 3MMWA 4F79A 4M1BA 4FX8A 3LMZA 3ICJA 4Q4RA 4ZQMA 1WQ5A 2VEIA 3SN4A 1HQTA 4DYKA 2PTWA 3UXDA 3TE9A 1A5MC 2O4QA 4A3UA 4YVPA 5I3IA 2GJRA 4IP5A 2ZX6A 2GDQA 1W9DM 5A8GA 3B8SA 2CLFA 1Q6GA 4GZEA 3KFTA 4ZOCA 2R1NA 4Q7IA 1OT2A 3O7UA 3IIOA 3TZNA 4DNHA 2QS8A 3H7RA 1J2WA 4CNSA 2RDUA 3DECA 3QJAA 3KBWA 4FNTA 3WD4A 1XYMA 4HOXA 4ONVA 1IXQA 4RXGA 3MKVA 3JVAA 2Q8LA 2QMJA 3LHWA 3C6CA 2H6RA 3CV6A 3T44A 3SR7A 2GQ8A 3O1NA 4GI8A 4KGLA 4BK9A 3I4EA 3QMRA 4Q8NA 3TSBA 3IVSA 2QJMA 2V82A 5I3KA 3B9DA 5DLCA 1F3EA 3AIUA 4O14A 4DUVA 3DI1A 1XJBA 3NIYA 3PG9A 2XVLA 2RDTA 3CTTA 4Z1BA 2HPMA 3KOFA 2PDKA 4MZYA 1ZCCA 1SUXA 4UTTC 1XLEA 1TJ1A 1EP2A 5A8NA 4I7UA 1BTCA 2CLLA 1RPXA 1BG9A 5F1UA 1XPYA 2J4GA 2IQDA 3M9YA 2CLHA 3EWXA 4LV4A 2J66A 4GG9A 3W2KA 3BV7A 4C1LA 5A6LA 3UGRA 4F2BA 4KIRA 5DO8A 1E9ZB 3EMCA 2XFFA 3RLUA 3W85A 5I77A 3WF2A 2XFWA 3V1PA 2EPOA 4FNSA 2G3NA 2YXXA 1G94A 1QW9A 2PTYA 1N8WA 1GZJA 3ZSTA 4NY2A 2GJXB 2QCHA 1Q3NA 4JQ4A 4LUSB 3KL3A 3VC5A 1SPQA 4H8HA 3K2GA 3ZSSA 2GJXA 1GWJA 4ZFMA 1BKHA 1XC6A 3QY7A 1SQ7A 3T1GA 3G1RA 3OVQA 1QI2A 1MQPA 3CV1A 3PBVA 3WQ4A 2ZUSA 1DTUA 1IEXA 3MUY1 4BQ5A 1H1YA 1XIIA 1E43A 3M44A 2BVDA 3CZKA 4C7DA 4ZO6A 1TV4A 1HO4A 4FOKA 1H5VA 3KBJA 5CC7A 5AYXA 1E51A 4ICNA 2PDBA 1I75A 3EXRA 3TJIA 4H83A 3CXOA 5AZ0A 3WZ0E 3GXPA 3FAWA 1OX6A 1DL3A 1U30A 4DZ5A 4ZOAA 2PC8A 3DHPA 3BG5A 4QLJA 1ICPA 3W70A 1TVPA 3GDKA 3EAUA 5BZAA 1KO0A 1ZPTA 4AZCA 1UASA 1HL2A 3SY8A 5KETA 2W6RA 4PMVA 1QR7A 1C8XA 1GK8A 3UWYA 1BVWA 5I3DA 3LHUA 4JS3A 5C55A 2WMIB 3U0HA 4LQ1A 5JXQA 3WUGA 4E8CA 2WMIA 1JDEA 2P3ZA 3BMVA 4INFA 4FI4A 2BHYA 1UKTA 3N17A 4GJ1A 3M6DA 4JEJA 3XIMA 4GBDA 2FTPA 2R8WA 3HG2A 3BQ6A 4CD6A 3UBPC 3QPEA 5DXYA 3ZLGA 5FEWA 2WLZA 3DESA 4HZMA 3CT2A 3DEQA 5G2IA 3K8LA 3R13A 3HQPA 3NZPA 2OZ3A 2Y8VA 4NZCA 5D32A 4D6GA 3ID7A 1LOQA 4TVDA 4KWWA 3DHUA 3EA3A 1NOWA 5E9XA 3S2NA 4G8TA 1KNWA 4E8GA 2YOCA 4LTSA 3VNMA 3MHUA 3UWEA 3M6YA 1TMHA 3VKKA 4FIQA 1BGAA 1SJBA 3STEA 3H21A 1MWOA 3LRMA 2J7FA 2ZUWA 2QCDB 2J74A 2WLYA 3M46A 5BCAA 5KZDA 3ZR6A 5CQ1A 2ZICA 5AC8A 1FKWA 3KLLA 4O12A 1WX0A 2J47A 1DVJA 2NQ5A 3C3UA 3W28A 1EJ7L 1GKRA 3JW7A 3TH6A 3BQ5A 2VX6A 1KCLA 4D1JA 2RUSA 1J5TA 2Y5SA 4BHYA 4CKQA 3ZQ9A 4LYQA 5EBUA 1OT1A 5LSMA 3L21A 5EB8A 4LJ3A 7CGTA 4DJDA 2JKEA 5I78A 3WENA 4S3FA 3RRXA 2VX4A 3U2CA 5DXXA 3MZ2A 3ORWA 5HJLA 2Z1SA 2HTMA 5D09A 3APGA 5HR6A 2UV8G 3PPHA 1LLZA 2Y88A 3IK4A 4LF1A 3THDA 1W5PA 1M65A 3AIVA 2OFJA 2RHGA 4MAVA 4IIFA 4ZSTA 1EZ2A 1SSDA 1YNYA 2HRWA 1QPKA 3AROA 5C9UA 1F4HA 3NQAA 1X7IA 4CD8A 4MNLA 4ZGYA 1CXEA 4ZO8A 3CUHA 4HCHA 4GIAA 1RBOB 5FKYA 5F2MA 4AZ7A 4LRTA 1POKA 2D20A 2GDVA 4JTSA 4PMRA 1BRLA 3TC3A 4HK6A 3IWPA 3M0LA 3BAIA 4QISA 3KDOA 2ZXQA 5EMKA 5FF0A 1QWKA 2AMGA 2WHKA 1V51A 1JPIA 1NM9A 3QV8A 4RPPA 2BTMA 3F5JA 1FCBA 4PMUA 2QVNA 2VFEA 3OQEA 2P0IA 4M82A 1V3HA 4H7VA 1OVDA 3KRSA 4US5A 3C3NA 3KOYA 4JY8A 2GUYA 3MHGA 5XIMA 1OFOA 4GUGA 2GJPA 4LVAA 3LCHA 2I9UA 1YE6A 3AUOA 1I2NA 1UR2A 2QPSA 2XVNA 4OUEA 4WF7A 3LGGA 1KFKA 3EYPA 1KBIA 5A69A 3BJTA 2VD9A 1R5YA 4B91A 2V3FA 2Z2UA 4XAGA 2V2HA 4D6HA 3U2EA 2FLIA 2Z6JA 1HXJA 1GVFA 3UZZA 5KZMA 4W7UA 5A6BD 2XIIA 4JN6A 3VYLA 3LNPA 1TA3B 3L68A 2VYOA 4BZYA 4Z2IA 1RY0A 4UFLA 1RVKA 8TIMA 3CZLA 1TWIA 1PVNA 3FHQA 2ZQ0A 1DPMA 2VC5A 4GUJA 1L0PA 4L1WA 3TA9A 3BVJA 5D2WA 4G7EB 4PZVA 2CWXA 3NO3A 4QHRA 4G7EA 3BW3A 4HQVA 3W27A 3PJUA 1OFAA 2WJFA 5HMSA 4CD4A 4JQAA 4LEQA 4K7YA 2VZSA 2BSLA 2XDFA 4D72A 3RHGA 3R0UA 3LCLA 4HNVA 1EJTC 3W7MA 2A7RA 4L56A 3G1VA 4EX4A 3UPMA 4MAZA 4UTWC 3DN5A 2D0HA 1K03A 4JHMA 4NF7A 1PYFA 1EA0A 4K2SA 1BGGA 3AYRA 4MNKA 1C29A 2TSYA 3N1AA 4YTTA 1FWFC 1KCZA 2Q01A 3CAWA 3LLFA 2NXGA 4KEMA 3QKZA 3WF0A 1S3TC 3LCIA 3HMCA 4B5TA 5LKYA 1V0KA 4PUWA 5A2AA 1MVYA 4PMJA 1FHLA 2PAJA 1OF6A 2G41A 4URIA 5EPDA 4ZMGA 3M0KA 1VFFA 3UPWA 5M2FX 1J18A 2R6OA 4F40A 3PB0A 3TQPA 3ZT5A 3BXWA 4JL1A 2W63A 3UVIA 3SECA 3ZR4A 2OG9A 2QF7A 5A8OA 3SFWA 2IPWA 4ZQCA 4D1IA 2B81A 1YX1A 3PZTA 3K46A 1ZBCA 4RUBA 2BV9A 1KR0A 1XW8A 4CNPA 2DPEA 4DYJA 2XVGA 3MY9A 1VEOA 2WVSA 2GFTA 3KDNA 3VOGA 1TQXA 5T26A 1XCXA 1TWSA 2P50A 1E1EA 4IZGA 3VKJA 3AHXA 7A3HA 3K1DA 1FHDA 4ES4A 3CUXA 2XYLA 4MPKA 3BLEA 4QS5A 3V5CA 3BW4A 1XYBA 1K9TA 3CUIA 3D3AA 1XDMA 4JKKA 3W3OA 2W62A 1ZBWA 1CGWA 1BLIA 3O06A 1MQQA 4KFPA 4L7ZA 4R33A 4PUEA 1VBUA 3T55A 4IGSA 2VC9A 3AJXA 4AWSA 4PSRA 4NJIA 2VELA 2V5DA 3NQBA 3KX6A 4AXKA 1CX9A 1HW6A 1GYNA 1EP3A 3O63A 4XAYA 2ACRA 4RDVA 1DJZA 2ZRXA 3ZJKA 4HN4A 4YS1A 4IQEA 4Q4KA 4A2SA 4NNBA 1VD6A 1HUVA 2YYUA 1KTNA 4Z1YA 3CU2A 2PURA 1RH9A 3TTEA 3PBMA 1EFZA 1A5CA 1B9ZA 4GCAA 4PCFA 1DJNA 3VD7A 3WMLA 4I6KA 4HNLA 3TC6A 3P62A 4JTQA 1PV8A 4PMQA 1S2UA 2Y7EA 1Q6QA 1YNQA 1GYLA 4ZQRA 3UY7A 4J40A 4IXHA 3N18A 3TSDA 4AFYA 1RK6A 1AJZA 2QIIA 4YTSA 3T4WA 1EOKA 2EJAA 2INZA 1EH9A 1E6NA 1B3VA 2XZ9A 2H3DA 3A3WA 3OLEA 2W5FA 3W7HA 4AEFA 3L9CA 3MS8A 1DOSA 3PFMA 5HMFA 1H61A 3RDKA 1R87A 3NPVA 1J96A 1QHPA 2B0MA 4G2DA 4GA8A 3CV2A 1UD5A 3ITYA 4U5KA 1J6OA 3AC0A 1UQZA 2DSZA 1G9HA 1T7LA 1XDLA 1X6LA 3PZVA 4RCXA 1A5LC 3ZS4A 3NXLA 5HULA 3I7SA 3UG5A 5LIXX 3TP4A 1QWGA 4US5D 3M0MA 4NX5A 4LFYA 3QZ6A 3W02A 1F7BA 2CC0A 2E3ZA 1NP2A 1NY1A 3F1QA 1BSIA 3W2LA 1S5NA 4GYPA 5MHBA 4K68A 3N11A 5AYBA 4CQDA 2G95A 4JTFA 4WDWA 1L2UA 1EQPA 2FB3A 4MIMA 1TPEA 1U5VA 1MO0A 1TIWA 3A5FA 3CAQA 3ES8A 3G8EA 3B9EA 4JTDA 3URAA 3S9YA 4EXBA 5IBXC 2RGLA 3IGSA 4HMCA 3NQGA 3CB3A 3MKCA 3DH7A 1VR6A 3VMPA 3TJXA 1AQHA 4NXKA 2FZ9A 5M3WA 1VYPX 3E0VA 1FBAA 4GFIA 1W5NA 2EAWA 2YDRA 2FJKA 4ALDA 3EKZA 4LY8A 3FOKA 4W7VA 4AX6A 2PP3A 2V67A 2QCFA 1F8IA 1B1YA 5A6JA 3PZ9A 1NWUA 4V27A 4MLRA 4FOUA 4UOJA 4GABA 4O8AA 2VNCA 5MF5A 1U1UA 2VZVA 3CAKA 1XLAA 2YL9A 5CBJA 4RW3A 3GW3A 1FDZA 3C61A 5EYWA 1C8QA 2HK0A 5CLTA 4PR4A 2Z2BA 4GINA 4O1FA 2PF8A 4LSBA 3NQEA 3OB8A 4L6DA 4WZHA 3EDFA 1PIFA 4GNVA 2Q02A 4UFKA 5DMMA 4UTUA 3V5OA 2YCKX 3OEXA 2A6NA 2OCZA 2X0HA 4M7TA 3G0SA 4HYVA 3QPZA 1YTEA 1NFGA 3LCXA 1ZJBA 3PZQA 4I7VA 2CCRA 4TV6A 3AU2A 2C13A 2XFYA 2XH0A 5AVNA 1ME7A 1RJPA 3ITXA 5LIWX 1X6UA 1T99A 1ADSA 1M7XA 1XIHA 3LHZA 2DGAA 2PGFA 3LLXA 5U7SA 2PSNA 1VYRA 1ISVA 2YBVA 1KFEA 2E1WA 2JF7A 4C5ZA 4DO5A 2RAGA 4IHCA 1NJJA 3KCJA 3HPXA 4NAFB 1FKXA 3U5UA 3UF9A 2FIQA 2ZADA 4J27A 1CENA 1GEHA 1PJ9A 3GVWA 3WUBA 3GM8A 2GQAA 2E8ZA 1B54A 3R0DA 5CSYA 2DVXA 2IPFA 2J7HA 5I07A 1PCWA 2CLOA 3WELA 3N19B 2J8TA 1IXPA 4IG2B 3RJYA 3B8UA 3VIMA 2O92A 1JZ4A 1C3FA 2VEPA 1XBYA 1LWHA 4IG2A 5BXTA 1VJZA 1S2AA 4S3JA 2XIJA 4MYXA 1PE1A 4RZ4A 4Q8PA 3MBFA 1F9CA 2XN1A 1YRRA 4L9YA 1F8MA 2ZC8A 1JCMP 3SY1A 3L2IA 4JGDA 1GW1A 1C93A 3AXXA 4Q22A 3WBXA 2LLEA 3PTKA 3M16A 1LF1A 1TIMA 1KFWA 4GIRA 3ABRA 1O7AA 3SRKA 3ZT6A 1VQTA 2ZCGA 4R5EA 3TFCA 1V4YA 5C7HA 3UJFA 3BJSA 1IF2A 4IL0A 4M51A 3RX2A 5LYRA 2DZWA 1RD6A 4MTVA 4MZ1A 4IMFA 3BURA 3O9NA 1XS2A 1I60A 1WBJA 1G4TA 1UUQA 3VIGA 4NI3A 1W8SA 4GQ0A 1E73M 2VX5A 4S3KA 2Z26A 4FAMA 4M24A 3R8HA 1SM9A 1GW9A 1KW1A 2C79A 4DM1A 4ASTA 1OGGA 3JRKA 1J79A 1N2VA 3T0AA 1FCQA 2PD9A 4GC4A 4KF1A 2XWEA 4A21A 2EPKX 2O56A 1THFD 5C6MA 1UMYA 1HKJA 1KRBC 2FH8A 2C8NA 3UGVA 2RJHA 1S5TA 4ZOEA 2CLKA 4F9JA 2QQ6A 5DBUA 3STGA 2CZEA 1KM4A 2X1RA 1ENUA 3W71A 3GNDA 3WL1A 2KZHA 2PRLA 1XXXA 3CPGA 3CTLA 3WNNA 2DSUA 4P7QA 1DORA 3WFLA 1Y5XA 5E6YA 5HR7A 1JZ8A 3SCSA 3A64A 4XD6A 3EMQA 2PBGA 2I5IA 1AW1A 2WM0A 2CZVA 4W84A 1RQEA 3QYSA 3BW2A 3N2MA 3P8IA 9XIMA 1W3NA 2GOKA 2CKSA 3BLOA 4BS0A 4TOQA 2EPHA 3L5AA 2P88A 3CO4A 2YIHA 4H6EA 3UWVA 1QW8A 3CK5A 4LALA 3LPOA 1CNVA 4AD0A 4TVCA 1QVBA 3TONA 1CW2A 2F38A 4BCEA 2TYSA 4FS9A 3APTA 3PAOA 3GFXA 1XCWA 2Z28A 1MW0A 4ERGA 1TFVA 2WW5A 3ZJ6A 4FX6M 2NQHA 4KRZA 4WDUA 4X22A 2BNJA 1D3GA 1OB0A 3EXSA 5I02A 4AU0A 1ZNNA 3LM3A 3VVGA 2CHRA 2PC4A 2VZTA 1P0NA 1PKLA 2FVKA 3H55A 3ERPA 4YWSA 1LP6A 4C6NA 3UZYA 1TPB1 2ZYFA 1LZOA 1Q6FA 2D0FA 1TREA 1KGXA 2TPSA 3KP1A 3R6IA 4J3VA 4D6DA 4H9UA 4K8GA 4ZODA 4PSPA 4J3WA 5HINA 2VCBA 1DV7A 1AW2A 3AMGA 3RYSA 3AXIA 1J5SA 4A8RA 4MVAA 1U2YA 4EWND 4UCGA 1HVXA 5AHIA 4DLMA 3DUGA 4JTLA 3SUUA 2HVNA 5FA5A 2QJIA 3VGBA 1AMYA 1FQ0A 2DZBA 3NA8A 3W0KA 1I9CB 3NSNA 4GQRA 3GX9A 1LRNA 4RX0A 5D2YA 3BAJA 1W0MA 3A13A 2BHUA 3PZMA 1B5TA 5JH1A 3WMBA 5GNYA 4MNJA 3W74A 3W2JA 3R58A 4Y7EA 1DHPA 1W3KA 3M0YA 2UY4A 3M5YA 2VDGA 1E6RA 4MGGA 3WN6A 5I3JA 4PMYA 1V7YA 4PRRA 2V5LA 4GH3A 4NASA 1QATA 1IIHA 5B80A 1Q66A 5I3FA 1WXYA 4DX3A 4CU8A 4PUMA 1TX2A 1W3TA 5K9XA 4FALA 3MTWA 2D22A 3E1F1 4MB3A 1HO1A 2GUBA 2HWGA 4HJFA 4GX8A 2NT0A 1Y5VA 2NVDA 4DVOA 1N55A 2C0HA 4GYJA 1FRBA 1ITQA 1K7XA 2E25A 4HK5A 4IUOA 2PWEA 5EKYA 2OKTA 1RCXB 1VFSA 4MNMA 3DXIA 1FHVA 4YCOA 3HFTA 2EKCA 1TV2A 3H54A 4FK9A 4AZBA 1WXJA 5CGQA 2W67A 4A2RA 3EB2A 5FJPA 2A3EA 3H6OA 1CGUA 1SW7A 4GZ7A 3NYZA 3FDGA 3UYIA 3EB4A 5E93A 4FA3A 3VIPA 1JPKA 2OEMA 4HNNA 1SSGA 1R3TA 1Q45A 3CHVA 2GK1B 3VKCA 2C1IA 4IGHA 3UXLA 1Q8JA 3IIZA 3D3FA 2AQWA 2NLYA 1OGSA 2DSKA 1LJYA 5I23A 3DDMA 3ES7A 3SFKA 3R1ZA 2QDHA 2EG7A 2ZRUA 1H3GA 4U28A 5BXSA 1E1FA 3HG4A 4WKFA 1P48A 4GRSA 3KCLA 4PEEA 5DANA 1ONWA 4MJZA 4GACA 5IHRA 4YVXA 2J7CA 1R2TA 4HA0A 1WKEA 5EMLA 1JAEA 4E2DA 3LENA 4O18A 4HPNA 5I00A 4B2DA 2W66A 2NLIA 4EK7A 5C54A 4UXDA 4Z2GA 4LS2A 1ELSA 1S2VA 1DJGA 2QAPA 1T0OA 1KFBA 1WYIA 1BWLA 2NUYA 3N13A 1FVPA 2QULA 4PBGA 1U5JA 1XYAA 3SGUA 1UUOA 4AX7A 4QG6A 1HJQA 4GBUA 4PFHA 4WLCA 4A35A 5D9MA 3I6EA 4N6FA 1H0IA 1AODA 5A5WA 1J0YA 4WSHA 1UH4A 2QDEA 3ARUA 2FZNA 4CNTA 3WLSA 1MUMA 3W88A 4F0RA 2ABBA 4RKAA 3YPIA 3VZXA 3KZPA 2CFFA 3IJ8A 5G1YA 1OFBA 4C6CA 1JNDA 3XINA 3G3MA 3LSBA 9RUBA 1ISWA 2NX3A 1LBMA 1UZDA 3RRAA 3NDZA 3RMJA 1EOMA 1JZ3A 3RPMA 4PB3A 2A3BA 4IGMA 4ZZ9A 3WDIA 1I2OA 1ME8A 5D05A 2VO5A 1AZ1A 1QFEA 4QFUA 3TK7A 3H22A 4W87A 2CW6A 3KOXA 1X7FA 3WK3A 1LL4A 4F0HA 4M80A 2QLYA 1YMYA 2OSXA 1O5XA 3ZVHA 1OJXA 4AYGA 4QITA 1UD2A 2ZXDA 3VOHA 3F4WA 3PAJA 1O1ZA 2XWDA 2GSEA 4NNAA 1S2WA 1DE6A 3R10A 4NAEA 5DFAA 3UXAA 2AKZA 1YHTA 2P3EA 3W1LA 4PTNA 3W83A 3OTRA 4MZ8A 4QAWA 1GOIA 4NZ5A 3O15A 3LZ5A 4BA0A 1YXDA 2NX9A 3GTXA 2CWNA 1GZ1A 3THQA 4DWSB 1D3CA 3GTIA 4JYEA 2X09A 2HNEA 3WFZA 4TXEA 1Y5WA 1RALA 4DWSA 5D9OA 3K4WA 3LY0A 1QNPA 4N4QA 2OOGA 4Z2LA 3ITCA 4EXQA 1QOQA 4I5RA 5BXRA 1JQXA 1OFPA 3TXVA 2GWNA 2ZRYA 4DB7A 2E0PA 1ITXA 4CN4A 1E4IA 1PKYA 4NJGA 3WLQA 2J13A 3INPA 2DZVA 3VNYA 2VCAA 3W73A 3UESA 3W1PA 2PDMA 3SCOA 4KT2A 4LVBA 4CVUA 4OUIA 4WKAA 5F2GA 3VM7A 1WDWA 1UR8A 3STFA 3NOEA 4AY7A 2TAAA 1V93A 3I3BA 1H7PA 3DFQA 3UU0A 2J9XA 3IV8A 5TNVA 4C6IA 4KETA 1NDVA 1PYMA 4O28A 3PWAA 3GAYA 1FFQA 4KFNA 1DIKA 2GGJA 2PLMA 3W86A 1HP5A 2OQHA 3GXNA 2DT1A 2IPGA 1JYXA 1O94A 3AYSA 1LCOA 2VXNA 3URBA 4MY8A 3H2NA 3NQ7A 3MJMA 5H8UA 2OB3A 3HZ3A 4Q6JA 3OVRA 5J5DA 1S5WA 1B3WA 3BSMA 3V75A 2PDUA 1US0A 5E6ZA 3QW4B 2EXOA 2OPJA 1RP9A 3L67A 1LQ2A 1JR1A 4PMZA 1QI3A 1LG2A 4GVFA 3R12A 6ENLA 5AHMA 4KW2A 4NL1A 3U4AA 3TWAA 1W1VA 1KXHA 4O54A 1AMKA 3K4DA 3GDRA 2X41A 1W2PA 1RR2A 1ICSA 4JBRA 3MZNA 4LC8A 3P67A 4H19A 3CMJA 1FOBA 3GAKA 2GGHA 2O0TA 4R9XA 3AZSA 2DUZA 3ANVA 4QCFA 4K36A 2AQVA 1XDJA 4XZHA 3VINA 3AYTA 4LBSA 4UFJA 2GWGA 3AZTA 3QXBA 1VENA 4F2TA 3SI9A 1M7JA 2XN2A 4Q7BA 4GZJA 4U31A 1JD9A 2PDWA 4I90A 4FXJA 1MXDA 3AALA 4IIGA 3ZLFA 4C6DA 8RUCA 5AHNA 1B90A 2C91A 2WK2A 3GNRA 1VPXA 5FD0A 3L5LA 5A94A 4JHOA 2BWGA 1PSCA 1P4CA 5G1TA 5D03A 1NAL1 4L9ZA 2QDDA 3D47A 1EZWA 4R88A 5AB3A 4O11A 2Z7KA 2BP1A 3DBNA 4KEVA 3SQLA 5DX7A 2HVMA 4B2DD 4RDYA 1KM0A 1JJKA 3ARSA 4QQ3A 3F4VA 1RXOB 3L0KA 1IT0A 2Z2AA 4C91A 2PI6A 3E0WA 3F03K 4G5DA 5HAOA 4Y8FA 2W9MA 4BY3A 1BWVA 4IGNA 3MP4A 4I5UA 3G6LA 1MYRA 4QXIA 1C9DA 4LAUA 3QLLA 1L6SA 1YKWA 1AQFA 1E71M 2POTA 3RPDA 1NFBA 4UIOA 1K8CA 2G8ZA 1VFLA 3KAOA 3UYCA 3LCFA 3QHNA 1QI5A 3OA5A 4OE7A 1F76A 4JQ2A 4KGJA 1R30A 2D0GA 1UOZA 3QBUA 1XG4A 1VBJA 4US6A 4DI9A 2PP0A 3L4VA 2PTXA 1E9IA 5LGXA 3FX4A 3QEZA 4N9EA 3TSMA 3S2LA 3HM7A 1E40A 3G1FA 4IFOA 1AVAA 1Q6DA 3U57A 1R8LA 4WY0B 1XC4A 1XR2A 3PUDA 1DWAM 3VM5A 5G5IA 1DHKA 1C90A 1G67A 1MNZA 2KX9A 2NQJA 3W22A 3WQOA 3ISIX 3MSRA 4O57A 3IANA 1DXFA 1DXIA 1V3LA 4DUWA 5DMNA 2V3GA 3D0CA 1O66A 2Y1HA 4N9BA 3B0VC 1WAWA 4HHLA 4P8XA 3EPMA 3KLKA 2E6AA 1XM3A 2PLKA 1AD1A 2PDHA 1S2CA 2X7WA 4AVNA 2C3ZA 3WQFA 3I4KA 4GQQA 3CHDA 3W38A 4P2VA 2QCEA 4I3GA 4LUIA 3W1TA 4H2HA 3OVPA 3NNTA 3S1GA 3UR5A 3TYZA 2WOQA 5C5YA 3XISA 2E5BA 1Q6RA 1OX4A 3R0KA 3AYVA 5B7ZA 3NO5A 1BYDA 3KWXA 4DJEA 1DXEA 4XTIA 3NGJA 2FZBA 3PBUA 3P3BA 4P7NA 1L8NA 2BY1A 5BRBA 3P80A 2F2KA 4BF9A 1SO6A 3GXFA 2PRHA 3A12A 1EYEA 1R3VA 2ZZ5A 3A47A 3TCSA 4EAYA 2POZA 3NSXA 2OTDA 2ZVIA 3MANA 3MUIA 3R94A 3ZLHA 1DWIM 5JMUA 4NI8A 4KBXA 2VGIA 2QCNA 3IGUA 5G4HC 1H4PA 4OKDA 1EIXA 1Z3NA 3Q94A 4UZSA 1EXPA 3GU2A 3M0VA 3VNZA 3GIPA 1GTHA 2Y5EA 2I9EA 3C5QA 1TTJA 1TR1A 1PIGA 2NV1A 1X1OA 3V0TA 4ZB5A 2O7QA 4U4MA 3WK0A 2V30A 2XISA 3VE9A 2CYGA 2OLHA 1G5AA 7ODCA 1VS1A 4AZHA 4UTLA 4GISA 3VIOA 3CPRA 3GZAA 2CITA 5HQMA 1XPGA 2UZ9A 2E67A 5AY7A 1W17A 3ALFA 3BUVA 1AFSA 3GVVA 1XLMA 1XINA 8CGTA 4WRHA 3LEPA 4LNCA 1XGZA 3BLDA 3IV3A 4IICA 3MP3A 4LCSA 1TPFA 3SUWA 3NL2A 4HCLA 5T9CE 3KL5A 4WQ6A 4UMCA 4RZ6A 5CPQA 1UKPA 4O19A 3W1AA 4EKJA 3TYAA 4HNOA 1RVGA 5DRIA 4WK9A 5HJYA 4OJYA 1Q7QA 4FXRA 2DIJA 3PZNA 3R7MA 1MDLA 4KPLA 3VCRA 4QROA 2Z7GA 5EBAA 3QZEA 3MMTA 1KM1A 4PRTA 1P0EA 5AYYA 3S1VA 3W7IA 2ZZ2A 1PHQA 2BGNE 3V3WA 3HMJG 3B06A 4O17A 3VO0A 2YXOA 3HOJA 1UUMA 4XK2A 4PUKA 4XWUA 1EIBA 2D2GA 3WH6A 2YW3A 1O4UA 4N4PA 2GJLA 3CM4A 3NZRA 5J04A 1PPIA 1XIDA 3VIJA 3P74A 2A6LA 3GTHA 4TX6A 1FCUA 1BPLB 4FOJA 3ZWTA 1M01A 1IZKA 1UQYA 1UD6A 2VRKA 4DBDA 1O5KA 1K70A 1UYQA 1A50A 4LUTB 2AGKA 2P5NA 1EBHA 3ZM8A 2BDQA 3P2VA 2X16A 1XISA 3W4RA 2C18A 4HJWA 3I68A 3WLMA 5CC5A 4LUTA 1NFPA 3OLGA 4DAIA 3BJFA 1XRFA 3VDAA 3B03A 4J3UA 3ZFHA 3LI0A 2QZRA 3GC4A 5TAOA 2IKGA 3VPLA 3B40A 3CC1A 1EC8A 1UWAA 3KHJA 3OBKA 2VVSA 2GGGA 4RDZA 1JCLA 3NO1A 3CQIA 4BEUA 1XYCA 3WH7A 1RK5A 4PEKA 1KBLA 1UJQA 1WPCA 4K6AA 3QW3A 3FLUA 3OU8A 1E3ZA 2A1YA 2FZMA 1L6YA 2XUCA 1QOPA 6PTDA 2CHOA 2R14A 2YCJA 4GFSA 5CBBA 1QNRA 5LNVA 3PPFA 4UNKA 1ISZA 3P0WA 4L61A 3TTYA 3LA4A 1S46A 2YA1A 1IGWA 1FWWA 2OYKA 3AWOA 1CEOA 3QSRA 5ABTA 1TPH1 2ANUA 1G01A 2XVPA 4OOUA 4IFRA 3QQ0A 3FJLA 4Y2WA 4UR8A 4WR3A 1A0EA 3CUZA 2FJUB 2Z27A 1EGVA 4MPQA 3C8NA 1B4KA 1WDDA 3VIFA 3PVFA 3QHOA 1TPWA 2YGYA 1XLKA 4YPJA 3HTWA 3D5HA 3N29A 5ABEA 3WBYA 3H2OA 2GL5A 4H8VA 1SMAA 4BWLC 1YPFA 4JTKA 4HU4A 1CGYA 4QS6A 1REQB 2QV4A 3P14A 3GHTA 1NEYA 4OECA 3RM8A 1REQA 3C2RA 3NR0A 3SO7A 4AY1A 4WY0F 1ZENA 3KE0A 4S23A 3AXMA 1PIIA 1EUNA 1ZBVA 5FAJA 3QM3A 2J6VA 3T8QA 1HGYA 1XSIA 1P0DA 2WZMA 1AW5A 1CB2A 3WUFA 1E0XA 2HBXA 1YXCA 3CIVA 1HG3A 2BVTA 4H01A 5DQPA 2ZC1A 4Y9PA 4M6UA 1DWGM 3TYBA 5RUBA 4J4KA 1FWHC 3NUKA 4XSMA 1UR4A 2A85A 1NWSA 2Z24A 2XHYA 3AWNA 3B8VA 2D69A 1OYCA 3NQ6A 4R9OA 1VPYA 1LOLA 3BV4A 2DIEA 3T08A 1ZY9A 3QR0A 4PMNA 4AISA 4KS0A 4AZ5A 2Z1WA 1A5NC 3IIXA 4HU3A 3M4HA 2BS9A 4Q8WA 1SJCA 3PY2A 4YNGA 4WJEA 4DJED 1FDJA 3DERA 3FFSA 4AHQA 3NQDA 2BGSA 4YXGA 3DYOA 1H51A 1YADA 5EA9A 4B9ZA 4EPBC 3EKGA 3H53A 1WNOA 3FA4A 1E0UA 5CPTA 3N4AA 2YA0A 1TTIA 1FA2A 3TYUA 1QTWA 2VOTA 2Y8UA 1O5RA 1ITCA 3TTOA 3W37A 2NQ9A 4WGHA 4H3DA 3PULA 3II1A 4QM1A 3IJDA 1V8EA 1GQIA 4C6JA 2IKJA 3H70A 1EJWC 1OFQA 2ACUA 2X2YA 2OQYA 3UJRA 3LXAA 3MSGA 3C2OA 1LLWA 1GOXA 1L2QA 1OFRA 1SZEA 4GJJA 2FHFA 1UA7A 4Y8EA 2JGQA 3AS3A 1TG7A 2CHNA 4MJ4A 2QGYA 5I24A 2IMRA 4MDOA 3IJ7A 3DX5A 2GVJA 4UFMA 5HUOA 1ZTVA 3ONCA 3SQMA 1HF6A 1J2BA 1J11A 2ZZ3A 3UWQA 1QPNA 2PDFA 2F2HA 2GVGA 1Z42A 4Z08A 1XIFA 5F2IA 2PTZA 1H7WA 3R8RA 2BOGX 2DSVA 3GTFA 5F1VA 2UY2A 5H1WA 1Q7MA 3WLIA 3FKKA 4H7CA 4Z1AA 3OG3A 1RJRA 4I5XA 4LOCA 3LPPA 1OD8A 4ERAA 3VKAA 1VBHA 4IQLA 3MCMA 2DVTA 3KBMA 1X1NA 1JDFA 3F2DA 3EEZA 3ARRA 1XLDA 5CPNA 2GSHA 4C6QA 1UR3M 3W7PA 1BD0A 2AMXA 4F48A 1EEPA 1XCFA 2VFFA 1ZJAA 1UROA 3PHAA 4XZMX 2NVCA 5DELA 1G4PA 1LDCA 1OWQA 4G7FA 4S3CA 2UWFA 2J77A 3FAXA 2PLCA 3ZR5A 1JUBA 3MI3A 3UP8A 3ZYZA 4CNNA 4E3TA 3PWIA 1WCGA 4LAKA 3DENA 4EIVA 5FEZA 3ABZA 1IR1A 1JDCA 3KOWA 3ZT7A 2PCQA 3GDMA 1CBGA 1KLZA 4HTBA 2DT0A 1ZLPA 2ZWYA 2ZX5A 1VH7A 3EDKA 1UZ4A 4BEQA 3WEOA 4H4IA 5IOBA 4NU7A 2HZGA 5EL1A 4LAMA 1MW2A 3HBLA 3DFPA 4CD7A 1O68A 4PC8A 4XUYA 1CIUA 4JL2A 4QSFA 4REQB 3WQWA 3JS3A 3UERA 2H8XA 4PMDA 4HA4A 4REQA 3DG3A 4XD4A 2E7FA 4ZQPA 3EDJA 3CH9A 4QNEA 2ISDA 4PUJA 2HE8A 1RP8A 3N15A 4FSAA 4D6FA 4AAJA 1V08A 5HQLA 5BU9A 4XD5A 4A8LA 3LU2A 1RBLA 3UCCA 3GW0A 2AL2B 3WLRA 4BI7A 5JVLA 3G6MA 2ZKMX 3NSMA 1GJPA 5K7JA 1JFXA 4R3UA 3O6AA 4AWTA 4ZL1A 3CL8A 3WNKA 4CQAA 3EOOA 4JX6A 4ADTA 2PS2A 3UT0A 3JR2A 1WZKA 3T4CA 4FNQA 3U7VA 4NJHA 3VKBA 3F4CA 2QAFA 4JDBA 4K37A 2J7GA 1GQJA 5AHFA 3VCCA 3H2CA 3C0JA 5LHFA 1P43A 2BXVA 5EFFA 1CXFA 3THCA 3GC5A 4M6QA 5BRQA 2G3MA 2JF6A 5G4EA 4NZJA 3FKRA 2PGRA 3E5BA 2WYSA 2QYGA 2XU2A 4FNRA 4MSSA 5I0DA 2Y8KA 3N3MA 4F4RA 1UWSA 1U1JA 3BE7A 3IVUA 4LVFA 3H2AA 1GVQA 2RH9A 4YYCA 4WJ8A 4Z0JA 1TV7A 3JZUA 3T09A 1CDGA 4R34A 3P82A 1W5MA 1XIGA 1MDRA 1QCWA 3CV7A 2VGGA 2C71A 4ZO9A 3TYEA 1ZJHA 1ONXA 4JFWA 1K9EA 4U2ZA 3WLTA 1M68A 3TN6A 3F5KA 3LX9A 4YWIA 4N2YA 3GKAA 3CPUA 1K1DA 4M8UA 3KEHA 1GTEA 1E15A 4X3ZA 1D7FA 5D9PA 4GMEA 3QGAC 2WMKA 3RK8A 3WNMA 3BSHA 1TWWA 2GSJA 4PH6A 2ZZ7A 3KXQA 4PODA 3V18A 4O8RA 3SBFA 3ARYA 3DFSA 3NJ3A 1GUVA 1XICA 2VDHA 4GNJA 1HJXA 2OT1A 3A3HA 1XL9A 3GDTA 4WDTA 3TNOA 4B3ZA 4LX4A 3GK0A 4DF0A