2WSPA

Thermotoga maritima alpha-l-fucosynthase, tmd224g, in complex with alpha-l-fuc-(1-2)-beta-l-fuc-n3
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
443
structure length
435
Chain Sequence
KPRYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNGMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE, PUTATIVE
publication title Beta-Glycosyl Azides as Substrates for Alpha-Glycosynthases: Preparation of Novel Efficient Alpha-L-Fucosynthases
pubmed doi rcsb
source organism Thermotoga maritima
total genus 152
structure length 435
sequence length 443
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wspA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wspA01
1YHTA 1PX8A 1ITXA 5DF0A 3L4YA 5ABFA 3CIVA 3OLDA 4OBRA 5ABHA 1TQVA 2J7FA 2VL4A 1BYDA 1KR1A 5LA2A 4P8UA 1OT2A 3A47A 1E3ZA 3ZR6A 2OSWA 3UERA 3GBEA 3LPFA 1TA3A 1R47A 3W6MA 2XGBA 1H0GA 4XV0A 5I78A 4ATWA 4M1RA 2XSBA 2ZUTA 2G3JA 1PIFA 2WMGA 5HBFA 2G4FA 1CXLA 2F18A 3BCDA 3AHTA 1US2A 3TA9A 4W87A 2YFNA 1JL8A 3WD2A 3EJTA 3AHVA 4D6CA 4J3UA 4QCEA 3WQ6A 4IPLA 3ZR5A 2ZX8A 4WKAA 2WB5A 3UCQA 1W3JA 2W91A 4C7DA 4HA3A 1FH8A 1E4LA 3PZVA 2BNJA 1AQMA 2G41A 3EMQA 3VDHA 2PWGA 3F4VA 2BY1A 1QPKA 1XCXA 2VI0A 2DSZA 3U57A 3LXBA 4AYSA 1HP4A 3OZOA 4H8VA 3RO8A 2J74A 3VKKA 1UH4A 4HOXA 1FP8A 1XH2A 1UKPA 2EPMX 2YDRA 2WHLA 4ACZA 4TXEA 4IUGA 4UQAA 4ATDA 2BXZA 4NX0A 3S6TA 3N11A 1W9XA 2VNCA 1O7DC 3W53A 4AC1X 5A8OA 1Z32X 5EFFA 4HOWA 1JGIA 2XN1A 4OKDA 1W9DM 1QI5A 1J18A 1WZKA 1HX0A 2F61A 3CUGA 3ARZA 2ZUUA 3POCA 3MKKA 5A6BD 1WDRA 1SMDA 1H4PA 1W1PA 3GNRA 4GPNA 1R33A 4AY1A 1UKQA 4EE9A 1OINA 1C7TA 5GQBA 2WMJA 3A6OA 1Q6CA 1NM9A 3QHOA 2WCAA 4UFHA 3VNYA 2DPEA 2VRQA 3AXXA 3VINA 4NZJA 1BYCA 4FLOA 1EHAA 1BLIA 3VIKA 1VB9A 2D0FA 4JKKA 1CXHA 1CXFA 2W4XA 2WC3A 1BG4A 3ARYA 1TQUA 1QW9A 2VCAA 3VM5A 4HA1A 4OGZA 3TONA 1HP5A 2D3LA 1J0HA 1NWRA 3VD3A 1EQPA 2PB1A 2VR4A 1M04A 3SCSA 3SUTA 3GNOA 1TQTA 2F7RA 2VX7A 4AXNA 5BRPA 2CERA 4BZYA 3BH4A 3F5JA 1V3KA 2J7BA 1R85A 3S2CA 2C8NA 4DO6A 1W3LA 1HTYA 1ISVA 2VURA 1V6UA 4LXFA 2HVMA 1WDSA 2WXDM 4W8BA 3NYDA 3K8LA 3TTYA 3BAKA 2YIHA 3DX0A 5M17A 4UQEA 1KQYA 1JDCA 1TVNA 2EPNA 4WKHA 1CXKA 1ZB5A 7TAAA 4D6DA 3D51A 3FNDA 3MMDA 1R46A 1OM0A 4A3HA 1JAEA 4PMNA 1DWJM 1MW1A 3VDCA 2XVNA 5CG0A 3UG3A 3ALFA 2BY3A 3BXWA 1NQ6A 3VPLA 3WQ5A 1JZ8A 3NUKA 2GJXB 5I24A 3MV11 2WWCA 3EJPA 1GVIA 3N15A 1E1FA 2QLYA 1ZS2A 3WF0A 3VGGA 1B3ZA 3ARSA 3FY1A 1J0KA 3K1DA 4PSPA 6TAAA 5BXSA 3PZUA 4M81A 2D20A 1UD2A 4W7WA 5JBFA 3ECQA 1UD3A 3CH9A 1NARA 5A3HA 4U2ZA 2PWHA 2FHBA 4M29A 1IV8A 1KGXA 3HG4A 4RL3A 1EDTA 4AZBA 1E3XA 4PRWA 2OLHA 1UWQA 1JI1A 1QVBA 3QGVA 1TFVA 3L4VA 1KWGA 1B9ZA 4Y7EA 2WANA 5E9AA 3W37A 2DIEA 1HKIA 3IK2A 3VD7A 1B3XA 4JHZA 8CGTA 3CZNA 5I5RA 4URIA 4YHEA 2JF7A 1SZNA 4FNTA 3WUFA 3DX2A 2WYSA 3WFZA 1TZ7A 3SUUA 2VQTA 5EFDA 4HZ6A 4W8LA 1HVQA 1EHNA 1E73M 4ZXLA 3EMCA 4ZEPA 2V3GA 1VEMA 4S3KA 4JFVA 5DEZA 4B9YA 3IAQA 4AZCA 2W92A 1FHDA 3K46A 2DGAA 2AAAA 3WD4A 1MFUA 3WDRA 4OBSA 5CXPA 3AZSA 1F4AA 2CNCA 1QWUA 1NOWA 2WW5A 4TTUA 3N13A 2CBJA 4QFUA 2WKLA 1IZJA 4TUFA 3VGEA 2WMIA 2A3BA 3MV01 5CSUA 4ATLA 2VT0A 2XVLA 3A22A 2A3AA 2XM1A 3WNMA 1GCYA 2X2JA 3ZIZA 4CD6A 2WHKA 1M53A 6A3HA 4GIAA 3CGTA 2BHZA 1CGYA 4CN4A 1VENA 1NP0A 3DYOA 4W7UA 3L2MA 2NSXA 3WDPP 4U33A 2OWXA 2EADA 5FOOA 2VUYA 2O9RA 3WY1A 2WVVA 3AICA 2V3FA 2WC7A 2BVTA 4H04A 2WMHA 5DMYA 3AIQA 2J8GA 1CWYA 4CCEA 3WY2A 3L2LA 3MUZ1 2YOCA 4FNRA 3WH9A 1MW3A 3AIRA 5I2UA 4W84A 2QMJA 4W7VA 4C7FA 1GUVA 3BAWA 3WH8A 1K9TA 5CPTA 3SCOA 3WF3A 1E15A 3RJYA 2WZIA 5LYRA 1ZBKA 4DWSD 4B3LA 3MUAA 5E1QA 3O6AA 3LMYA 1PIGA 4CU8A 1Q6EA 1CTNA 2EPOA 2ZUSA 2IGTA 3RCNA 3FW6A 3U5YA 2CKRA 3VIIA 2X2YA 3H54A 2FGZA 2WPGA 4MB1A 1EO5A 1EA9C 1KCKA 1M03A 3PTQA 1E6ZA 1ODZA 4QLKA 1BTCA 1UD6A 3CUIA 1KQZA 4CCDA 4GKLA 1UYQA 4GXPA 3BLPX 3SCWA 3F5KA 1OB0A 1HJVA 1V08A 3MO4A 2J7EA 3SCRA 3WF2A 2QF8A 1PZ3A 1XYZA 2X0YA 4OJYA 2FHFA 1C8QA 3BSGA 3FAXA 3H53A 1JD7A 1CGVA 2C0HA 1UZ4A 1VBUA 1HXJA 3WEZA 2EO7A 4XZBA 1A3HA 3CUHA 1RP8A 3VMNA 3PTKA 1TQSA 4TOQA 5BROA 2X2IA 1EGZA 3WY3A 3WQVA 5A6AA 4V2XA 3CZ8A 5KEZA 2CXGA 1CLXA 1OD0A 4AD5A 1XRVA 4H41A 1PEZA 3PHAA 4WIWA 4P7LA 3PN8A 3RM9A 3BAYA 4J3SA 2ZXQA 3POHA 5CPSA 1SFSA 3AISA 1R86A 3RILA 2QPUA 4EKJA 2D22A 1BGAA 1QOXA 3A5VA 3WNOA 4QLLA 4NI3A 5CPQA 3GH5A 3D4YA 3CHFA 3E1F1 1MW0A 1C8XA 4JAWA 2VZTA 3KL3A 3AHXA 4J28A 2WM0A 4UQ9A 3VX0A 2QHAA 4HPHA 2ZUNA 2DQXA 1E40A 4ZE5A 2XVGA 3ZSTA 2YL6A 4QCFA 3EJRA 1Q6FA 2D0HA 5A6LA 1WZLA 3I3BA 2JE8A 1US3A 4H8UA 3M6DA 3ZT5A 1BFNA 1MQRA 2YL9A 2W61A 2FE0A 4W86A 5C71A 2VRJA 2FHCA 1RPKA 1TR1A 3VIMA 3N04A 3VIOA 1UD5A 1G01A 1LF1A 2VC9A 4DO5A 4L4OA 4F9JA 4AMWA 2VX5A 4PMYA 3L4TA 2Y5EA 4WJXA 4UZUA 3OGRA 3WEOA 3ZQ9A 2CHNA 2YBUA 3ALGA 1IZKA 3VIHA 1J0ZA 1EQCA 4Q7NA 4AZ6A 1JYVA 2BVDA 2G3IA 2D0GA 1BF2A 3CHDA 3VGBA 1LLOA 1V3HA 3LPPA 1H5VA 1JNDA 2OYKA 4RE2A 5EB8A 4Z2IA 1S46A 3PZMA 5GNXA 5KZ6A 3ZT6A 1NWSA 4X0NA 3BVWA 1EDQA 1JXKA 2O9PA 3OLEA 4K68A 4PUDA 1VIWA 2XFFA 8A3HA 1D2KA 3PZIA 1JD9A 1IT0A 2PI6A 3ARRA 3UG4A 2WC4A 5DT7A 4LX4A 2OW6A 2F2HA 4P7OA 3TP4A 4ZXOA 4CKQA 2G3MA 1V3IA 3T0DA 2D73A 2XFYA 1R75A 1YQ2A 2ZUWA 4LPCA 2ZX5A 4MNKA 3CZKA 3ZM8A 2WNWA 1UR9A 1E55A 1GZJA 1XD1A 3AIUA 3SCVA 3WBEA 1UA3A 3WIJA 2ZIDA 3L4ZA 2BFGA 1J10A 3WSUA 3AROA 2VVSA 4TTGA 3WL1A 3VDBA 3AMKA 1BYBA 1UD8A 4E2OA 3PZQA 1UUQA 2E40A 2CITA 4Q22A 3HG5A 5HPCA 4CD4A 1V6XA 2YLAA 1KXHA 1U33A 2V38A 3O9NA 1QNPA 4HU8A 1ISWA 1E6RA 5AC5A 4XX6A 4PTVA 4CN6A 4JFWA 2UY4A 3GBDA 4J27A 1E70M 5GNZA 2O9TA 3VMOA 3AIEA 1E71M 1ZU8A 4JKMA 4MTVA 1BAGA 1CIUA 1CGWA 1D7FA 4E8CA 4AIUA 3WKZA 3A23A 1W1YA 3VVGA 1W32A 3OB8A 5DT5A 4MNJA 3PTMA 3W29A 3MSDA 1R8LA 4WK9A 1HJXA 1GONA 1M7XA 1ISYA 4JIEA 4U31A 5DO8A 4UZSA 3ARVA 3WDHA 5BWFA 1XH0A 4W89A 2YDSA 2O92A 4UQDA 3VD5A 4FNSA 1C7SA 3VTRA 4J3WA 1HJUA 1E5JA 1UWUA 3LXCA 2A3CA 1FA2A 4N42A 3HG2A 4TVDA 3LRMA 2WVUA 3DC0A 4XB3A 2OWWA 3L4WA 4UR9A 4D6IA 1KXTA 3KWXA 3SIMA 1VFMA 3VSTA 3G6LA 1R34A 2CESA 3EDEA 2ZXBA 3RM8A 4YN5A 1GOMA 3CZJA 4HA4A 2PWFA 2YLLA 2WVTA 2J79A 1SMAA 1VJZA 1JI2A 3OLGA 2DH3A 4QDMA 1UR1A 1GOWA 1E4MM 3S5ZA 2EAEA 1OCQA 4EK7A 2XVPA 2WBGA 1MWOA 1T0OA 4UFJA 3DDGA 5A95A 3T0BA 4H2CA 3ARWA 2CETA 1H3GA 4AEEA 3ZO9A 3MS8A 3BUBA 4H7VA 3PZNA 4NZCA 3NCOA 5IFPA 1JG9A 3WNNA 3FHQA 5A94A 4DO4A 3CZLA 1DWGM 4JKLA 1BHGA 3CBWA 2JFEX 3MUIA 4DM2A 1BSIA 1HL8A 4FK9A 1OT1A 2EJ1A 3SUVA 1QI3A 2YA0A 4S3JA 4X9YA 4PYSA 1I1XA 3T2PA 4PMOA 4GI9A 4HZ8A 4QLJA 2Y4SA 4PBGA 4W5ZA 1WB0A 1E1EA 3W26A 1JZ4A 1WE5A 1GJUA 2PC8A 3BAJA 2W5FA 3VU2A 1MXDA 4DWSB 1XV8A 4BQ2A 3T0AA 3I3DA 4RE4A 3NSXA 3K8MA 1G5AA 5FCZA 2J75A 4D6EA 3VDAA 2FDMA 4M80A 3DHPA 1JAKA 3CV5A 1AQHA 5D8WA 5ABEA 5A6SA 4N0RA 1HJQA 5CJ5A 1FH9A 4DUXA 4UFKA 1U30A 1DWFM 5LA1A 4P7RA 3MMUA 1R87A 1KR0A 1J0YA 3GH7A 4L4PA 1DWIM 5A2CA 1TUXA 4Z2HA 1QI0A 3HZ3A 3DX1A 3EMZA 4MB3A 4AD1A 1CPUA 5BXPA 2JALA 4PTXA 4KH2A 2BY2A 2Q8XA 2WBKA 1E6SM 3NIYA 5E0CA 4QAWA 1UH3A 4KGJA 4YPJA 1JYWA 1LJYA 3W28A 3CUJA 1JYNA 4P8XA 2PBGA 3SCTA 4ACYA 4M24A 3UEQA 1UR2A 3L4UA 1MXGA 4WSJA 3PZTA 1EDGA 5JBEA 5E09A 4AMXA 4UOZA 3WY4A 4GQQA 1ISXA 2D23A 4ZE4A 2X1IA 1V6VA 5AYIA 4D6JA 2XN0A 2RGMA 1BQCA 1C92A 4AZHA 2DEPA 1H1NA 4MAVA 3T09A 2WMFA 1FH7A 4HU0A 3ZJ8A 3SUSA 4NF7A 1TVPA 2A3HA 4AZ5A 2ALWA 1M01A 3IAPA 5LA0A 3KEHA 1H49A 2B31A 3SCQA 1NOFA 1LL4A 2XUCA 4BQ4A 3OIHA 2NT0A 2E0PA 4PCTA 4AD4A 1VFUA 2W66A 2G3NA 2JEPA 2WSPA 4PTWA 1K9FA 2X2HA 1E43A 2UY2A 5HPOA 1OGBA 4AEFA 1HKJA 2CBIA 2VZVA 1DWHM 3N1AA 2CIPA 4F66A 3DHUA 3THCA 1RD6A 2ZUVA 1D3CA 1OGSA 4JFUA 1CDGA 1RP9A 3ARUA 2GDVA 2F7PA 2WMKA 4Z2GA 4U3AA 4PMXA 1JNEA 3RMEA 3VOCA 4DM1A 4DUWA 3K8KA 4BA0A 5A6KA 1U2YA 5JIWA 3VSVA 3DDFA 3VD9A 5A1AA 1WCGA 3CUFA 2PWEA 3KL0A 4OOUA 2Y8VA 4WF7A 5E6ZA 3WMCA 3A4AA 3HN3A 1QW8A 4AMCA 1JZ6A 3WNKA 3SEPA 3D4ZA 2J4GA 3BUPA 4IPNB 1VEPA 1WAWA 4J3VA 1E56A 3OGVA 5AC4A 3AS2A 3NDYA 2WKGA 1GNXA 1Q6GA 2D2OA 2GJPA 3NJ3A 3QHMA 1MYRA 2WZEA 2FH6A 1KFWA 5EMYA 1DEDA 4NZFA 2GDUA 3SCPA 3WQWA 4TX8A 4MNLA 2PWDA 4U2YA 2XGIA 3OLIA 3CLWA 3HJEA 2CPUA 5ECUA 3O2LA 3LPOA 1JDDA 1VBRA 4F9DA 4HOZA 3AOFA 1QNOA 1LQ0A 5TD4A 4UTFA 1B1YA 4Z2LA 1OSEA 1ZL1A 5AYBA 3CC1A 3DECA 1GQKA 3EDDA 2XWEA 5F7UA 2WVSA 3H55A 5A6MA 4D6FA 4YHGA 1UR8A 5CSYA 3U5UA 1J9YA 1WKYA 2DSVA 1E4IA 2VZSA 2CYGA 1QHZA 3MU7A 3OG2A 2VTFA 1AVAA 4U5KA 2EABA 1GHSA 1QHPA 1KBBA 3PZOA 3GXMA 5CLWA 3WDQA 4W88A 2DSKA 1UWIA 1X1NA 2XN2A 2J47A 3RDKA 3W25A 3IJ9A 3LX9A 2WSKA 3AMCA 3AYRA 3AS0A 3D52A 3WBAA 1L8NA 1HJSA 5IHRA 2CEQA 4MJ2A 3VIJA 5A6JA 5E70A 1UKOA 3OA5A 1CXEA 5C70A 3BMWA 4ZFMA 4EANA 4D1JA 1GOOA 2DDXA 2CKSA 1GQIA 1SR0A 1KWKA 2ZICA 1K6AA 1P6WA 1UR0A 1W9PA 1V02A 5AY7A 1UR4A 2EQDA 2DH2A 2GFTA 4WKFA 5CZKA 4DUVA 2GUYA 3IJ7A 2J77A 1XGZA 1W2PA 1GVYA 3UR8A 3SURA 1WO2A 1KTBA 3LXAA 3AFBA 1CXIA 3GXFA 1BVZA 4JFTA 2OSXA 1G94A 1QI4A 4AD0A 3VX1A 2QMKA 1W1VA 1G0CA 4TVCA 1XCWA 1CZ1A 3CTTA 5HDRA 3FHAA 4GZJA 3LRLA 5D8ZA 1HVXA 4CVWA 6CGTA 3MSGA 1OD8A 2Y8KA 1BVNP 2WCSA 1QHOA 3VILA 1TG7A 4M82A 3QOKA 4ML4A 1QNRA 3BSHA 1CBGA 3BLKA 1JZ5A 1CGUA 1GPFA 4CN1A 3M07A 1KB3A 1WDQA 5IHSA 4AZ7A 3VM7A 1HWWA 2XYLA 1Q4NX 2DT3A 3MANA 3VGHA 3OGSA 1G9HA 4R27A 3NSMA 1XD0A 2W62A 2J8FA 3BUDA 3N12A 3D3AA 4UFMA 3WL0A 4PTMA 4B9ZA 2JF6A 1W9BM 1JZ7A 3K4AA 4PMDA 3WH7A 3ARTA 4W93A 2PF0A 1MQPA 2F1BA 3GXPA 2GJXA 3QHNA 4D6HA 2ZUMA 5CGTA 1J11A 4CUCA 4GO9A 1V0KA 4PMZA 1CNVA 5I6SA 3N18A 4AZGA 1TQWA 2FH8A 5I79A 3UESA 1QI2A 2BXYA 1L0PA 2GSJA 3AQUA 3KLKA 2F7QA 2ZE0A 3THDA 3ZJ6A 1PX4A 1PS3A 2E4TA 4NRRA 2EPKX 5A8MA 4E4PA 2WMIB 4BF7A 2VRKA 3KE0A 1JFHA 4HP5A 2DT0A 4PMUA 4MJ4A 4OOZA 1V3LA 1UKTA 1PPIA 2XIBA 1QNQA 4FF5A 3U7BA 1VAHA 4MDPA 1ZJBA 1HN1A 3CMGA 1XYFA 2XWDA 5BRQA 5HOSA 1MW2A 4H8HA 1B3VA 4UFLA 4XUYA 3AS3A 4BQ3A 1XH1A 2FGLA 1I75A 4E8DA 5M3WA 3BUQA 1WP6A 2WVVB 5E0FA 4RE3A 2YL5A 3GXNA 3GXTA 4PUEA 4NXSA 1UWRA 1OIFA 3L4XA 2CCRA 4D1IA 4NXKA 1JFXA 2F7OA 1KTCA 3RPMA 4W8AA 1LG2A 2GJRA 1W9VA 1EOKA 5HXMA 2UY5A 1DP0A 3BAIA 4B15A 3GXIA 2O9OA 3AMDA 3VMPA 5IFTA 4B16A 3WDJA 3W0KA 3ZSSA 4MADA 2X05A 1HJWA 1CGTA 1FFQA 3WD0A 1FHLA 4AZIA 1VRXA 2JIWA 1PAMA 4HMDA 3GM8A 2E9LA 3WNLA 4LGXA 5GNYA 2W67A 5A8QA 2YFOA 2EBNA 4IISA 3VNZA 2J7GA 1B2YA 4UQCA 3ZJKA 3DYPA 1KBKA 5D9PA 3BCFA 1HNYA 2IXVA 4IM4A 2RGLA 3ARPA 2J62A 1XC6A 3B9EA 4PMQA 3SUWA 4CU7A 3HU7A 1UG6A 4CD5A 1H11A 2ZX6A 2EPLX 1E0VA 1MQQA 1V0NA 1W3HA 5A2AA 2XVKA 1V3MA 3WMSA 3II1A 5E6YA 2AOSA 3WH6A 1EXPA 2DSWA 1H09A 2WCGA 4FMVA 1PBGA 2OWCA 1OGGA 4WLCA 1JXJA 1LL7A 5FIPA 2XSAA 1UQYA 3QR3A 1W91A 3WENA 4UCFA 3WUEA 2TAAA 1G1YA 3GDBA 3ARQA 1UH2A 1H41A 3WN6A 4HZ7A 1K9EA 1AMYA 4AISA 3BVUA 2EXOA 2VCCA 3WELA 1QWNA 5BYWA 5GPRA 2E3ZA 1J0IA 1J0JA 3GH4A 5A69A 1HKKA 2OYMA 1RH9A 4D72A 4GO8A 3A24A 1E6NA 1UHVA 4JL1A 3W81A 1I1WA 1UA7A 4FNUA 4BS0A 4PN2A 4GI8A 1NWTA 2FYVA 2IUZA 1VJSA 1B3YA 3CHEA 1NH6A 3RJXA 2JEQA 2E9BA 4BQ5A 4CGTA 1ECEA 4KRTA 4CD7A 5CLTA 2GK1B 5FD0A 3HG3A 3AZRA 4LYRA 3MI6A 1X6NA 2C7FA 1CEOA 2UWFA 1F4HA 4AWEA 1DHKA 2XPKA 1BG9A 3B8SA 2ZWZA 2ZXAA 3A4XA 3W24A 2CHOA 1C91A 3D5HA 4GI6A 1DTUA 4GZIA 4AIOA 1NWUA 1R7AA 1C8YA 2J7HA 2DT1A 5JIPA 2MANA 2BY0A 4WSKA 3ZJ7A 1CENA 1V6YA 7A3HA 1GHRA 4GINA 3PZGA 4LYQA 2F1AA 1V03A 3LRKA 4NSBA 3EDFA 3K4DA 1FOBA 4CCCA 1V6WA 2CBUA 3J7HA 4GZEA 2X8RA 5D9OA 2D24A 2IXUA 2VX6A 3TTSA 3AHYA 4W85A 4QP0A 4PMRA 3KZSA 2YJQA 1N82A 2AMGA 3A21A 4FLSA 3AIWA 3WEMA 3WQ4A 3VO0A 4OIFA 3A3HA 1UOKA 4MAZA 3VD4A 4UOQA 4XZWA 1ZBWA 4JZ5A 1EH9A 5A6BA 1FFRA 3UETA 1H2JA 4EAMA 2VMFA 2WZHA 3BAXA 3WMBA 4D71A 3W82A 1QX1A 3SCNA 2XJ7A 3U7VA 3KL5A 1R7OA 3GNPA 4FNPA 1DWAM 2D3NA 2F8QA 4D6GA 2WWDA 4J3XA 5FL1A 4A4AA 1MVYA 3BVXA 1EIBA 2E8YA 4FNQA 3DX4A 2J7DA 2VQUA 3N9KA 1V3JA 4V28A 5DFAA 3IANA 1GOIA 1VFFA 3W6LA 3WUGA 2OW7A 1HIZA 3BMVA 4X0VA 5ABFB 2ZOXA 3VUPA 1E0WA 3WD3A 3WF1A 5BXRA 5IDIA 4MB4A 3IGUA 4MNMA 2VZOA 3NDZA 3AJ7A 1KCLA 1XSJA 5JBDA 1JIBA 1H0IA 4HMEA 4BCEA 2VR5A 1TA3B 1E72M 3GZAA 3FAWA 3T2OA 5D9MA 1HT6A 1JF5A 4U5IA 2YA2A 1SYTA 2VVNA 1TE1A 1UWSA 4HTYA 4NRSA 4F79A 5CGMA 2J78A 3EJSA 3I3EA 4Z2JA 5A8PA 1KGWA 3EJQA 1HF6A 4UNIA 3DYMA 1LL6A 3HMCA 2DIJA 4FLQA 1ESWA 3BGAA 1V0LA 5M03A 2BHUA 3GTNA 2JIEA 3CMJA 4TVUA 7CGTA 5ABGA 3CPUA 1E6XM 3EDKA 1UWTA 3T2QA 3PBGA 1WZMA 3QOMA 2V3DA 5I3DA 4CD8A 1JF6A 4UQBA 1JZ3A 4PEEA 2XG9A 1W9UA 3AS1A 4JCMA 3W38A 3MMWA 2G8ZA 1CYGA 4AW7A 1GOQA 3LPGA 2VCBA 3TTQA 5IXEA 2ZWYA 5FL0A 4UOJA 4A3YA 3NSNA 4ACZB 1B0IA 4AIEA 4J3TA 1LG1A 3WUBA 3AYSA 1GQJA 1OIMA 2BS9A 3W27A 1Q6DA 4MB5A 2XIIA 3UG5A 2E9MA 3UR7A 1NOUA 1PX3A 5M5DA 3OZPA 1CECA 1VF8A 1ZBVA 5I23A 3VSUA 2NT1A 3B9DA 3CZGA 1E9LA 2J7CA 2CBVA 4M8UA 3ZOAA 4UFIA 1ODUA 1Y7VA 3BUIA 1VFOA 1O6IA 5D4YA 2XFRA 2ZX9A 2OSYA 3N17A 4Z2KA 2QPSA 2ESCA 5I77A 1E6PA 3BLBA 2OYLA 5I0DA 3IJ8A 1OBAA 5JUVA 1VEOA 2NW0A 2X0HA 4CVUA 4JHOA 5C8BB 3EYPA 2UY3A 1QNSA 1WDPA 3TV8A 2V5DA 3PZ9A 2VOTA 1UKSA 5HNNA 1XSKA 1LWHA 1C93A 1HKMA 4JL2A 3FXYA 3WNPA 2DSUA 2HISA 3AXIA 2Z1SA 1JZ2A 1QBBA 3A4WA 1EOMA 2V5CA 1WNOA 2GVYA 3M46A 4U3CA 1LWJA 3BVTA 2YBTA 2A3EA 2VJXA 1NP2A 3EJUA 2XTKA 3WFLA 3JUGA 5A2BA 2E8ZA 1KGUA 1W1TA 1B3WA 1HL9A 1XSIA 1B31A 4OZOA 3VIFA 2Y24A 1E5NA 4PCSA 1PZ2A 3EDJA 1BGGA 4JCLA 2DT2A 1GW1A 1C3FA 2VX4A 3EBVA 1WZAA 1CLVA 4MPKA 5BCAA 2J25A 2WAGA 2Y2WA 3VIGA 1KXQA 3W4RA 2XHYA 2VZUA 1GORA 1KXVA 4KWUA 3SCUA 4R5EA 3BC9A 3WQ8A 2BVYA 1TMQA 3TTOA 4P7NA 2EACA 3VGDA 1TCMA 4P7QA 3ZMRA 1PJ9A 1W2VA 2VO5A 3AMLA 3CO4A 1J01A 2GK1A 1B90A 1FP9A 1WPCA 3AZTA 1GOKA 2BV9A 1O7AA 2XM2A 4FLRA 1JDAA 4DWSA 1C90A 9CGTA 2ZXDA 1GQLA 4LYPA 3DX3A 3F5LA 2ZX7A 3AIVA 2D1ZA 2YA1A 2W63A 1J12A 1UASA 2WLZA 1X6LA 5D9NA 4HMCA 4W5UA 4P8VA 4M56A 3ARXA 4PSRA 1BPLB 4KMQA 3RM4A 3GYCA 1BYAA 4OUEA 3WD1A 1UQZA 2Z1KA 3TOPA 3S5YA 3B9AA 2YKKA 3AIBA 1E6QM 1MFVA 3MUY1 3CZEA 1QBAA 4PMVA 4DWSC 1CGXA 3AI0A 4P8WA 5FKYA 3VIPA 1EO7A 4F8XA 3T08A 1XHGA 3APGA 2PBOA 2YDQA 3AHZA 5BXTA 3M7SA 1UD4A 4KGLA 1ZBCA 4HPGA 3ZT7A 4AZCB 4JFSA 4MDOA 1V02E 4B3KA 2QV4A 1B30A 1AQ0A 4ZENA 3WH5A 3AXHA 3FN9A 4V27A 1ITCA 1GJWA 5EBAA 3RIKA 3KLLA 3CHCA 1V0MA 2EEXA 3CZSA 3GXDA 1E0XA 3AMGA 1ISZA 2WHMA 1JYXA 2WHJA 1OWQA 2WLYA 3G6MA 5A8NA 1K9DA 4AYGA 4CU6A 2YL8A 4TX6A 1A47A 1W3KA 4J7RA 1UZ1A 4AD2A 3BVVA 4C7GA 1HXKA 4LQ1A 3WF4A 1ZJAA 3WDIA 3VGFA 5CQ1A 4AD3A 3D50A 2V3EA 2BHYA 2X09A 4KRUA 3OBAA 4GQRA 1E4NA 2WK2A
chains in the Genus database with same CATH superfamily
1OSZB 5LKYA 3O3DB 5T3XH 1LDSA 3G6DL 3CZFA 5T3ZD 1EB3A 1BVKA 1UQSA 1CFNB 3ZR6A 4GJ1A 2WOYA 2VDPH 5FA4A 1A02N 1KRAC 2G3JA 4O14A 1NIBA 2PDGA 4KVNL 1ILUA 2IPTL 3EEGA 2DVTA 3BSZH 3GSRB 3WEXA 2ZWKA 1S5HA 3T0CA 3FTVA 3SRFA 1V93A 4YUEH 1DE6A 2G41A 1BKHA 3JV5A 2ZRXA 5CJ8A 3MNMA 4H8VA 2WKOA 2YB1A 3SIZA 3C52A 2GTWB 3U2OA 1R3VA 5ANMB 3S9YA 2BXZA 1BD2D 4LCWB 5D96C 1X9RA 5EBWB 4XBEH 2EH7H 4LC8A 4HJWA 1WDRA 5JXAH 1KFAH 4GPNA 4EE9A 2E68A 1IXOA 4Y5VA 2Z8WC 4MKMA 5C0AD 4JN8A 2AQPA 4Z8FH 4U6HA 4FI8A 3QJSB 1GA2A 4DVOA 1VB9A 1CXFA 2W4XA 5AL0A 3LN3A 3V52L 3S37X 3PWAA 3TONA 2DZWA 4GAGL 4PD4K 3GNOA 3O0RL 4WW1B 4JZNA 3QUXA 2VEKA 3S2CA 4DO6A 1ISVA 1FO0L 2CDGA 4BWLA 3WIHL 1U8LB 2IPFA 1FNLA 3VXTA 4J23A 5B7ZA 2OODA 4PJHA 1W5QA 1NLBH 3DNKA 4YSUA 3M64A 4KUCF 3ULVE 4IRJA 4UQEA 3VWJD 1E5CA 3QIBA 3SBWA 1R3HB 5ESAA 3REQB 2H41A 5ETUA 4PTNA 4U1IB 4P9ML 2NR6A 2YXOA 4ZFCA 3UVAA 3WZ0E 2NX5A 1S5NA 1UB5B 1D8CA 3ARSA 3OHXC 1B3ZA 5FYKU 1FCQA 3GSQB 1R5YA 1UA6L 1AD0B 2Q10A 4JEJA 4KY1L 2VR2A 3QJRB 1R0AL 3QJHB 4QHRA 5F0MB 1TETL 4HKBA 3LEVH 1SZNA 1EC7A 5B3NA 2O7SA 2BVOA 4NAJA 5GS3A 1HVQA 3QQ1A 5AZ0A 2AMUA 4E9LA 3ABRA 3QMTA 2GSMB 4J35A 1TX2A 4F37K 4BEUA 4MHHG 3U0TA 3GJFK 5D1XD 2VN4A 2QSCH 4HCRA 4L8SA 5BZXA 3X2QB 3C6LA 4GI4A 1RLWA 3N50A 2UY7A 3NESA 4BHUA 5FF7A 3AADB 2HTMA 2BHZA 4EUPB 2BLEA 4HIJB 1WA2X 1OCOB 4DQOH 5C97A 5GGRB 2ZWNA 4WFHD 5J9PA 1EJ7L 4PG9A 3EYOA 5JO5B 4I2XE 5JXEC 2VEFA 1XGQB 4OQTH 1PKLA 4D8PA 3BDYH 2WXQA 1KPVB 4EAEA 5JA8B 2OCFD 2I17A 3L2LA 4LAZA 1Q6LA 5DA4A 3MUGA 4U1MB 1KB5B 5JA9A 3ZL4H 3PAUA 3IN0A 4ZQPA 5G5IA 1CF1A 1YEHL 2R83A 5C0IB 1CFSB 2OK0H 1PIGA 4EIVA 4R4BA 4D7BA 2NY4C 4L9XA 5H8UA 1E4XI 2CKRA 4X2RA 1I1RA 4QHLB 4P3DA 4GG9A 3PREA 1WITA 1M03A 1ZLUK 1B0RA 1IYXA 1RCYA 3N1FC 4BH8B 3BLPX 4JDVA 4J2QA 4CNUA 3H2PA 1HJVA 3ISIX 3SCRA 1FCVA 3LMJH 4IU2B 3DX8B 4JX6A 4ZT1A 2FHFA 2KUTA 4GSXA 3W7MA 4TOQA 1CICD 1YPZA 5TPWH 3GAYA 4K3JH 4V2XA 4L6HA 1SDDB 4Z7QE 2X2GA 1MZHA 3UTTD 5TK4A 4J3SA 2EHHA 5CHNB 4XMPL 3KCWA 1FFNA 3UY8A 5FYJE 5AUMB 1E0UA 4OLEA 4LB8A 1S2CA 4JG1H 2Q3OA 1KBGL 4JZJB 4Y4HD 2J88H 3LHVA 1E40A 5SWQA 4OCYL 1QBLH 1NGWB 1EXBA 2CMRH 1PNCA 2YEQA 1ONRA 1RPKA 3UYPB 3BQUB 3V0EA 1S2UA 4BFNA 3NQ8A 4ZO8A 3N91A 5DMJB 2O6PA 4DO5A 3QNYB 4JN7A 3MLUH 2BDNH 1GGUA 1A7PH 2V2WA 4DB7A 1IZKA 1Q65A 5K5YA 1RJPA 2EVIA 3M43A 4KCUA 4XD3A 4K94C 4LEFA 4RE2A 1CDBA 4GQZA 4YDZA 2DBLL 5GNXA 3PJTA 1P5UA 2GBUA 4WVXA 3G1RA 3L7RA 3PJLA 1DSFH 1NDYA 1T5WB 3QEQB 2QDWA 1X98A 3D0CA 2PI6A 4TVPH 3SZ6A 5DN1A 1H61A 5KSBB 4P5MB 3AW5A 4DPPA 4P7OA 1CFBA 2LTQC 3CBRA 4FZIA 4O0KA 3WLLA 4YVVA 4MNKA 2Z31D 1SXCA 4Q74A 1A1OA 1AHWA 4OWGA 1YTKA 3PAZA 2DQCL 1G7LA 1HCVA 3WFCL 2A9BA 1HUVA 4ES4A 2XY2A 1TFHA 1I0DA 1XTMA 1T04B 3AMKA 3URAA 4GIYA 4A66A 4G3YH 4K3GA 4QO1A 2CFFA 4IIQA 4Q6IA 2LR4A 4TNVF 3ESUF 4CN6A 4J27A 4M61A 2AP2A 4F0SA 4YDKL 4PP1C 3HW7A 5INCB 5EDSA 2A9NL 4OKVB 4M6NL 2BWQA 2XQYK 4GFIA 4KXCA 4EN3D 4JIEA 4N2AA 2YBRB 3DSFL 3MRGA 4UC5A 5IHZA 4P2AA 2V2TB 3UPCA 1FHGA 4Z1BA 3BJFA 3MRKA 3A64A 1UWUA 3N9RA 4DOHB 1B0GB 1KKRA 5C08E 2D03H 2OWWA 4UR9A 1A6UL 4PGDB 4BH7A 4LNVA 4L23A 2CESA 5CEZL 3LN4A 4Q56A 1POKA 3MOBH 4HSCX 5H37H 3L48A 1XFCA 4P49A 4G2AA 2AJYL 1KEGH 3ZGHA 3QEHA 1H3GA 1FO0A 3BT0A 4P59L 1M42A 4AEEA 3BV4A 1EQWA 3Q67A 2VRAA 5T3XD 2YQBA 3R8BB 2WPBA 4DM2A 1REQA 3GC4A 3SUVA 4Y89A 2EEBA 1MUWA 1G7JB 5C0EB 3U4FA 1ZLVH 2W5FA 1GVSA 1R9YA 4X80L 2L3BA 5GIRA 3L67A 5H91A 4WUUE 3DHPA 3UA4A 5I0YA 3KBVA 3CAVA 4MJ6A 5ABEA 4N0RA 4ZFZB 3WFDH 3MMUA 3UTOA 2DWEA 4ELDA 4CSPA 3EX4A 4PFHA 4ENZA 2XPGA 1OOWA 3D0AA 5D2WA 3PP4H 3KPNB 4JO1L 4PS4L 2J8UE 3NIYA 1QO5A 1LDPL 2X1PA 2BFVL 5D04C 4EXAA 3PNWB 3ILQC 1KTDA 2GSGA 5FO7B 4ACYA 2MCAA 2APXA 1MXGA 5I18L 2Y5TB 3PZTA 4PUBH 5EMUA 2ZVRA 3QPXL 4A7VA 4HLZG 2CSPA 1FH7A 2A3HA 4GG6A 2BP8A 3AY4A 4F58H 4A2LA 3RPIB 1BF6A 2JJSA 2WSRA 4WO4B 4N2MA 3QCVH 3OIHA 4K6AA 4RPPA 5BMFL 1N5YL 4HIBA 3P54A 2FFIA 1KD0A 3STFA 2DZSA 1V7NL 3RDTC 3GRWA 1NC2D 4K3DH 5FYKL 4EF3A 1WDAA 2IDSA 4L4MA 4JLRA 4TN9A 1FWTA 1PL9A 1NCWL 2XRAH 5KG9B 5F44A 1OAQH 3VD9A 3QPZA 2Y8VA 1N70A 1NM4A 1W54A 4PJ8C 1VFAB 1EZUA 4P06A 2VO8A 3RTLA 4PS3A 1E50A 4IPNB 2DQGL 1A5AA 4F3HA 5FEPA 3TCLA 3OGVA 3E38A 3C60A 4PJXA 1FZJB 3NJ3A 4OVVA 1S3KH 2Q3ZA 2GDUA 4HWBA 2ZWLT 3KPPB 5TK2A 3OGOE 1YJDL 4ODTH 3QHFL 4LCCA 3VI3F 3C2AL 5KANG 1ZEAH 1ZD6A 5XIAA 5DJXB 3CDZB 5DLLA 1TZIA 3WFHB 2BP3A 1GQKA 1QFUH 2Z0UA 5BOFA 2OJZH 5LXGL 4D6FA 4OJDH 3JWOC 2ED8A 4KPHL 2YPVL 1D9KB 5CC3A 2XIJA 4C6PA 2E7DA 1X1NA 4Q8WA 1PKOA 2EDQA 3W25A 1I7ZA 1BMWA 1O66A 4FTVE 3IFOB 2ACRA 3D52A 3VC5A 4WI5A 1QW7A 5E70A 5GSRB 1BRLA 3ULVH 2ENQA 4AX7A 2H26B 3LKQB 2CKSA 5IUSA 2YGOA 2Y7NA 2KZBA 1CS6A 5IK3A 4L1GA 1KTBA 3AFBA 2ZADA 32C2A 1FPTL 2QMKA 3VX1A 2FECL 1IGYB 2P5NA 3BDXA 3UL4A 4L9LB 2EDXA 1VADA 1D7KA 4KK8C 1DJXA 4PJ9A 1A6WH 3OZ9H 5DZPA 1EFQA 1TG7A 2IG2L 2BP5M 4PJCA 1GS7A 4ESKA 3WK1A 1UBPC 1KCVL 1XZ0B 1R3IH 3LKNB 3MRLB 3KPTA 4XTRD 4I2XB 1HI6B 1G9HA 1ZTVA 1M6OA 4LNYA 2CNZA 1YNPA 2BNRE 1PKQE 2J8FA 2YXWA 3T2NL 3MLYL 2OZTA 5AW3B 5GS1B 1JWMA 5HR6A 5I1GH 3ARTA 2HNHA 2GJXA 3I84A 1OTSD 4IS6A 4X4XB 5CGTA 4PMZA 1SEQL 3T4AB 3W7EA 2XCMC 1QJWA 1LO4H 1Q0XL 4LAOA 5JW3H 3T77B 4UILH 1ETZB 3NABH 4NO2A 1G9EA 4BJLA 5DRXB 1FFPB 4MKNA 5F4XA 2I32A 4MX7B 2VRKA 3W70A 4KRZA 3UBHA 1TPFA 3HRZB 3L5XH 1HZYA 3GTVA 3MLTB 1ONWA 2XIBA 3V5KB 3TC7A 5EZPA 1HIMH 3BZ4B 1JPMA 2EKSA 3L3IB 3CMGA 3IARA 1R3SA 2XWDA 4JO3H 1A49A 4HIHB 4XUYA 4QISA 3ZUCA 5M94B 1Q4WA 5GGSB 3W7JA 3V4VB 2FZBA 1N3NB 4NXSA 3NIGF 3P4NB 5CP3H 3MDJA 3SBFA 4HT3A 4ZNEA 5D7IE 3L12A 5K69A 2X4RB 3L0KA 4L1BA 1LM1A 1S9YB 4DP5X 3WNLA 4LGXA 1JPIA 3T8MA 3RPDA 4LAJH 3TEYA 1LT7A 2EUXA 4IM4A 1HHJA 1H8NA 3WIIL 4KDTC 1M6JA 4UTMA 1SLXA 3SPJA 1YUHB 3IIOA 5HMEA 2X4SB 4BFEA 1W3HA 2AQ1A 1UMYA 2DQIL 5GGVH 4H44C 5J1AB 1OXYA 4FMVA 3L7EA 4BQ8A 3L3KB 5G4MA 4UCFA 5IHLB 3RVTD 1I1AA 5K4XA 4HZ7A 1F0LA 3D39E 1L9PA 5EOTB 3BVUA 2EXOA 2QQLL 4WFFD 1I9EA 4XO7A 1XKYA 2OYMA 2EEDA 4JL1A 5I02A 1EGJH 2L4OA 1I1WA 2GITB 3B97A 3AB0B 3NOYA 1A4LA 1MJ8L 1FA4A 4IIFA 3AQZA 1E6OL 3ZKNC 1IEHA 4EP8C 3F8UB 4IRZL 5FXCH 3SN1A 1QSZA 3FT2B 2PRLA 1A4AA 2ISWA 4AWEA 3FOLA 1T5XB 3B8SA 1L6ZA 1FORH 1RK6A 2BSSA 2MKWA 3NJFA 2FPYA 2REQA 1KCBA 4AQ8A 4JG0H 1CENA 1GHRA 4GINA 3KPRA 5JW4N 1H0DB 5T1JA 4Y9OA 4NGHH 5AW5B 1NSNL 1IARB 1BD0A 1KLZA 4LL9A 3W1NA 4DKAA 2JKSA 1LLWA 1OP3K 3LTVA 1X5GA 5IB1B 1YDYA 4ICCX 2ESVA 4MAZA 4NC1E 4IMKA 3N41F 5IVZB 3WE1A 2PDQA 1ZGLA 5LIKX 3GBNH 2E1WA 1F4YL 4D71A 2J44A 3KL5A 3LD5A 4D0DB 1R7OA 1AS7A 5I66A 2X1RA 4Q8QA 5E4EC 3L9RB 5TBOA 3W1PA 3B1TA 4C56B 4H9MA 3QUZB 4A4AA 3GNDA 1HEZA 4CGUB 5C08B 1E5UI 4KKCC 1IGML 3UEZA 5JH1A 4QNPE 4J1UA 4Y2NA 2MCG1 1GG1A 3IGAA 3US1A 4N6FA 2JCCA 2GW5A 3ARBA 4AEHH 4BDVA 1SVBA 1H6FA 4HIIB 2BSTA 1DPMA 5C09B 5IVXA 1DQWA 3OG3A 3U6RA 4HD5A 2Q6ZA 3SODB 5LBVA 5KBDA 1BF5A 4LPUA 4IH3A 2VR8A 2ZJSL 2M83A 2QHRL 3U9PH 4YFDB 2VM8A 5IQNA 2Z0IA 4O13A 5EU4B 1P48A 4O8RA 1XR9A 2CCVA 2WWKT 5ISZD 3NSNA 4WUUB 2ZCKH 5C0AE 1GY1A 1LG1A 4B50A 3QZPA 3UGRA 3QRGL 4RETB 5HGHB 1UWAA 3R0UA 2E9MA 1A9VA 1SFLA 3TM6A 4QAIA 3RK8A 4A8LA 4GUPB 1NQKA 3LOTA 1AL7A 3OAZK 2CXKA 4JIRA 3RI5F 5J3HC 3NK4A 2UZYB 2ESCA 5I77A 1O5QA 3EYSL 3C86A 5AC7A 4KKXA 1VEOA 5A7BA 2P42B 2NXYB 3VYOA 3MOQA 3EYPA 3RWCB 1QNSA 1ZVYA 3OGCB 3LCYA 2MPAL 4MOZA 3BP6A 4CILA 4BWTA 2P8PB 1C93A 1BJ1H 2R69H 5JXQA 4R34A 2OL3H 3FTGA 3EJUA 3GVWA 1A5LC 1YNTF 3TXAA 4YVXA 4DEFA 3S3PA 3DFQA 5CSZA 2Y61A 1GGBH 1Z66A 1JQVA 3F62A 4JAMA 3WFEH 3O4OB 2WJDA 4X8GA 3G1FA 3RHWK 3SCMA 2H9GB 3QKEA 4LSVH 3EKZA 5JOPD 3B0VC 1SPQA 4M7SA 4POUB 1X39A 1HAWA 2IFFH 3S5SA 4E4FA 3OU8A 3H7UA 5FW6A 3VIGA 3EUUA 3RLSA 3T6VA 4KWUA 2C4XA 1N59A 4NZUL 1NIDA 3IE4A 4JX0A 1TMQA 1KTJA 5ABZA 4UT7H 4C6IA 3GDTA 3ZMRA 5KN5A 1XYMA 4N2YA 5B38B 1LYXA 5D2LE 3GMLA 3ZIMA 1GQLA 1MI5D 3FF7A 2JJTC 1DQUA 3FB5B 3R1ZA 2D1ZA 3RF9A 3TESA 1TKWB 4HMCA 3RXZA 2VLRE 5HYJB 1IBDA 3APTA 4ODUB 1PDKA 2M26A 3BPNB 3HC3L 1GZPB 2OBGA 4BSVA 4X7TB 5L9DH 3TBSA 1QVOA 1O1HA 4XCYB 3HQOA 2W9EH 4HJ0D 3IUIA 1XIEA 3O6FB 5E94B 1BOGB 2KZ1B 1AQDB 1LO0H 1HQRB 4NT6A 4V1XA 3FN9A 1HHIB 5DHYB 1DBBL 1MNUH 4U1GC 4Z5RA 1TV5A 4NRXB 4FQ1H 2F0CA 2DM3A 5C1MB 3IGLA 4DKEH 5HI5C 2DL2A 3NCYS 1JYXA 4F4RA 2J20A 4HH9A 3ULVD 4F9PA 4PWJA 4Q9QL 4CU6A 5CINL 1VGKB 2YXVA 3FONA 4F5CE 2BPBA 4A1RA 2B2XH 1XCQB 1HQ4B 2Z1PA 3WF4A 3GMOB 1X5IA 4MQSB 4GQRA 3C09B 3BT2H 5HR7A 4DKFH 3RFRA 2KX9A 2GJNA 4LCYA 1KR1A 1E3ZA 3IPEA 3MZ2A 3FRPB 2B59B 1UIPA 3NFNA 4DI8A 5JNYB 4M1RA 5DGQA 3ZKMC 4P9HL 5JQ6L 4ORZC 4YNYA 4XHJC 1US2A 2DW6A 3V0JA 4OCWH 2OCZA 4ZMTA 1TMHA 5I0WA 4GKSA 3BD5A 4OF8A 4KESA 4NBZB 4FG6C 3FT9A 2N7AA 3KVPA 5LNDA 1XBVA 1FH8A 3PZVA 3VDHA 2PWGA 2G5UA 4Q8TA 2H0FA 1XIWA 3VXQA 3BKMH 1KBJA 3CVHB 2H3NB 2HX8A 4PUJA 1OAZH 5LLIC 4KEVA 4NM4L 3RRXA 4IQDA 4PVLA 1OTTD 1PKQB 4S1QH 3L66A 2PDXA 3IKKA 4IRZA 4QJ1A 4M43H 4MQTB 3W57A 3S5LA 1CMOA 4G6JH 4FHKA 4FXGA 2NNFA 4YSOA 3GB7B 2W80C 2YD4A 3QQXA 5HHQA 3MZTA 2EDRA 2X9WA 2OLSA 4O16A 2H2PC 1QO2A 1QLRA 3IBOA 1K8XA 5FW7A 3VI4A 1IEXA 3LKPB 4QRRD 3UBFA 1XM3A 4R8WH 2QAPA 4MNHB 5CN3A 4HTBA 3ZTDC 3ZL1A 1LE9B 2RQ8A 3DPBA 5DXYA 3FO2A 3GVGA 5CC6A 3APMA 1NFKA 3STEA 4P5SA 4I18B 1R3JB 2D4FA 5TE7L 2ICWA 1KY7A 3K8LA 4LQFL 1YBQA 3V8OA 4AE1A 5D7IB 3QRHA 4JFXB 4R7WA 3T07A 1KLGB 3QPYA 4WEBH 4LBRA 3VDCA 2QKSA 3GMMA 5FFOA 2BY3A 2V5YA 5DCCA 1N8FA 4IICA 4O02L 3IXAA 2V5BA 4LKCB 1J0KA 3K1DA 2AGTA 6TAAA 3PZUA 2J55A 2G9KA 3EBHA 1BQLL 2YR1A 4BYHA 3CH9A 4RL3A 4Y2DD 4P4RB 3RJQB 1UWQA 1TFVA 4IX0A 2EGZA 5M7QA 3DXAA 3LH9A 4F7TB 5C6MA 3NQMA 3MRQB 2ZUXA 7PAZA 4Z7UA 3S9ZA 1B3XA 2GVGA 4M6UA 3H4HA 3VFUA 1O7SA 3HV8A 2GUUA 1MDAA 5FYJD 4FNLL 4G56A 3NEEA 1N6UA 2NY5L 4KFOA 3D39B 4NN6B 3WUWA 2AAAA 4OAWB 2Q7YA 4FOKA 1FWXA 4F20A 5LDUA 1QWUA 5F6IC 1AGDA 1AKJB 4XR8C 4NDMB 3TZVD 4IMEA 5CSUA 3A22A 4PV8B 3KBSA 4M51A 1OGTB 2XM1A 4KKAC 2WHKA 1EUTA 2Q3XA 2W9DH 4E9YA 1I8LC 3QBUA 4AQAA 5CBEA 2R94A 4FFZL 1I1FA 5I8EB 1WFMA 4DHLA 4HJJL 4H04A 3JTSA 1J8RA 2HUHA 1ID5I 3WAJA 1YDPB 4YSSA 5LGKA 3H9SA 2H32H 3O2VL 4IDLA 4OH2A 3IS1X 3AIRA 2RHGA 4W84A 1E4HA 4KVPA 2NY3C 4TULL 2NY0C 3FFOA 1K9TA 1ASQA 3IGXA 3CJPA 2QCEA 2QIIA 3M7FB 4U4IA 1NIFA 5FF4A 5EA9A 1S5IL 3MUAA 3S3CB 4ZFOA 3CFBB 5DUPH 4I0CC 4XPBH 3R18A 5DS2A 3H2MA 1B3IA 4EDWL 4IL2A 1IGCL 1E6ZA 2O5NA 3I6KB 5DS8A 2P0IA 1WCBB 1IFHL 2P24B 4A04A 2ATAA 1KBVA 1IAIH 3RTQD 5I75B 2UVFA 1THFD 1S7VB 4AW4A 1ZPLA 3KVKA 2VLLB 2X5PA 4ZDHB 2X0YA 5IBUG 4KJWC 4I77H 2NY7L 3MNDA 3U6WA 1KLFB 1N2RB 4IXHA 3OYZA 2LLLA 4H41A 1MSSA 4WIWA 1S7RA 2G0KA 5FWQA 4F7KA 2DWDB 1R86A 2FT7A 2G30A 4YPGB 1FL6A 4EKJA 4GFSA 3ZGIA 4OD2B 2A9DA 4FXFA 3ERXA 1AA1B 4YDLB 1BD2B 1MFEL 3HNTL 1F13A 4UQIM 4WWKA 4B60A 3AUOA 3GHPA 4Q97A 2OR9H 1G7VA 5C55A 3ZSTA 1XF1A 4DI9A 5IDZA 3EJRA 4PS8A 5FKPB 3KYOA 1US3A 4DEPB 3I02A 3U4EB 3MV7E 3QA3A 3T7VA 2W61A 3THML 2FE0A 1PZDA 5C0AB 4GWEA 3ELFA 3UPRB 4RLIA 1G7PA 1RQ5A 5DDHB 2VC9A 3RY6A 1U8NB 1AG0A 2J8TA 4V1DE 2OSLA 1LO2L 2D0GA 2CIKA 4K5NA 3L1OL 1WTLA 2BW5A 3OKOA 5EB8A 5DI8B 3SDDC 1NWSA 2J27A 1KBLA 4IQLA 5D1ZD 2PDYA 4NASA 4ZPTA 1XDMA 2WD0A 3VWJB 3GIQA 1Z9SA 1JD9A 1IT0A 1CFTB 5F8RC 4W9DC 5DRWB 3BRDA 4ZXOA 4HUWA 1D6VL 1YQ2A 1A9EA 2B14A 5IMLB 4X6CE 4YHNB 3RVXD 5ESVA 4IBZA 3UZQA 2ICEC 1DLFH 3LERA 5CLYA 2AGJH 2JGYA 4PB4A 4U7MA 4CMHB 2Y06H 3R0NA 3NZ8A 3TO2B 3FKRA 3AROA 1OFDA 2PYFB 2B7NA 3STCA 5DRZA 1HU8A 2VITB 5I0VA 1LTXA 4CRPA 3BO8A 1NGPH 5HPCA 1U33A 4PUNA 3WLWD 4BSWB 4U1SA 2QVHA 3CT7A 3HF3A 3QE5A 2HWZH 3U36B 5C2GA 3L0NA 3F4DA 4WCYH 1S3HA 3B7SA 3F84A 3RVVC 1EBPA 4WK9A 4BFIB 3WLMA 3UGVA 3KOFA 3TLQA 4NYYA 4QD2E 4Y7OC 3QV6A 3KHOA 2YDSA 1N10A 5D1XB 4HC1A 4XCEA 3GI8H 2YR3A 4PJBA 3VTRA 1E5JA 1CD1B 1H8OA 1FA2A 2ADFL 2QUNA 4XB3A 4S2CA 1FNSH 1R34A 4XOAA 1QRKA 2E7FA 2WVTA 1T89C 2J79A 3A4EA 3CIWA 4YQXH 4WHYG 2F9RA 2FTPA 2L0DA 1EJ8A 2IGFH 1YTEA 3VA2C 2J1WA 4R4ND 3CLFL 2WO2B 1XF2A 2O6DA 4P5UA 5I1JH 2FSEA 3CZLA 4JKLA 4W4OC 1JZGA 4PJAA 4JPWL 3JZEA 4O1AA 5CM1A 1LYQA 1T2XA 1ONQA 4US5A 4PBGA 2INZA 4W5ZA 4XPFL 2LVEA 2WTPA 5CUSH 2IH9A 3KP1A 3VWKD 2FQGA 4WHDA 2FD6L 4MDJA 3AABA 1BM3L 1XV8A 3T0AA 4O02A 2WUBL 3K8MA 4S2BA 2PXYD 3QYQA 1GYMA 5T1MA 4EI5A 3LNPA 4IDJH 1EF2A 1X7SA 3E9TA 2GI7A 1FZMB 1J0YA 5BUGA 5A2CA 4EPSA 1LK3H 2GB2A 2WIIA 3NIFF 2YD3A 5IEHA 4UQ3A 2VXTH 1TR9A 3VB8A 4MAUH 1A2YB 1A3RL 4X60A 3QV7A 4B0MB 2WBKA 2JELH 2OR8A 1X1OA 4NPYB 3HI1B 4FTVD 3B6SB 3RKDD 4G5ZL 3GUTA 1A4BA 3P4OA 4O28A 1JYNA 1Q63A 1CICB 5EPMB 5E56A 3PHQA 1KENL 4XP1H 1A6ZA 4YHML 1P7HL 3UTTB 4LV4A 2XN0A 4YTRA 2VQ4A 4DAIA 4L1TA 3GJEB 4Y9GA 2F6UA 4AZ5A 3U82B 1E9PB 3A6CL 1FG2A 5DR5L 2IOOA 3NAAL 2WZPD 1JPSL 2OMXB 4Y4HB 2QPEB 5ELIA 1L7TH 3CD4A 3ZXAC 3MMEA 3V4PH 2HX9A 3TIEA 4YL4A 3A3XA 5DD5L 3NIDF 5LN4A 3BEVB 4HQVA 4GHRA 2P8LA 1YPFA 2BNRD 4FHJA 4LHUA 4WDIB 2AS5M 3P0YH 3IS0X 4AT6A 5GJSH 4TVPE 2EDFA 3BGMA 3EO1B 2DWTA 5GRVK 4KAQH 3C5XA 2PABA 3C87A 3HKZA 4UB0L 1WAWA 3C6SA 3W9EA 4Z76B 3NDYA 3AFLA 3AGVA 1KFWA 3S0CA 4HCRL 4MA7H 4Q52A 4GNKB 3TL5A 3Q48A 3NJKA 5CPOA 5JPMC 4ZS7L 4TMBA 2KKQA 4Z7AA 5D93C 4N5ED 4MZ8A 4I9MA 1GS8A 3IETB 2VC5A 4WRHA 2Z31B 2VWEC 2OQJA 4QY8A 1IF2A 4A7TA 2Y7GA 2R4RH 2ARJA 3TJEL 3H55A 5A6MA 2Q3RA 1PDZA 5I3FA 1OZQA 3MU7A 2CO4A 1FC2D 2WJZA 1I9RH 3AT9A 5J04A 5KAQF 1GHSA 1A1NA 2I5GA 5CKAA 3V4BA 4F37F 2J47A 3PYCA 4HCFA 3IJ9A 3UX9B 3TUUA 5ADOH 3G6JF 4H20H 4MLSA 4H9YA 5TAOA 4CQ9A 1BZ7B 3L3JA 3BMWA 1G6RL 3NFPA 4AY7A 4EN3B 3HGSA 5MERA 2HVJB 4IGHA 2DH2A 1CD9B 2J77A 3QZWA 3BIKA 4JHWH 2Z1BA 1MMFA 3O9WA 4OCSH 4R7NB 4ZG1A 3ULUF 1G0CA 4X7FC 2A9CA 5DFVD 4OSUH 4P57A 4YZFE 4XUGA 3VILA 1QHOA 2VDLH 3UTSA 3NDOA 1TTUA 3BLKA 4LEQA 2DYPD 3RQ3A 2Q02A 3RFZB 4WGXA 4RGMB 5DMNA 4H9ZA 1D5XB 4GW5B 1XD0A 1UG9A 4M1GH 1IILE 2P26A 1KM2A 2EDLA 3PF3A 1OM9A 3MY9A 1JGEB 4NHUA 3Q45A 4S2SB 2WIMA 3F7VB 3ES6B 4A2HA 1LBFA 2ZUMA 1Z1WA 2CK0H 5FYLH 4N28A 3NJJA 5BOZG 1EO8H 1BQKA 3KG5A 1SNRA 4NRRA 3M5ZA 1MKFA 3BZEB 1TJMA 4X5XB 3ENLA 2NQZA 4UIKL 4OOZA 2ZYHA 4NFDA 5AAMA 7REQA 3QV8A 1AGEB 4DGIH 4H8HA 2ZAHA 1J5TA 3VFWB 4A6YB 4ETQB 5ICZA 1LHZA 4DJFD 4XMWA 1J8HD 3COTA 1UWRA 4M3PA 4MBOA 5IGXH 1H5BC 1FWDC 2WWOA 1SXZA 2P49B 3DU0A 4P2RD 8PAZA 2GJRA 4P5TA 2UY5A 4IF2A 1CL7H 4Z78B 2Z4QB 5GS0H 2F19L 2GBVA 4K8RD 2QIWA 4AZIA 4HPYL 1CBJA 3KWWA 4X4MA 4CKVX 3KLAA 3CFDA 1WBXB 3DYPA 3G8RA 1AZBA 1Z0MA 2Y07L 1EZSA 5JDSB 1RUSA 2IAMD 4I4WB 1K3UA 1NC2B 1NDVA 5CIPH 4RESB 5JOPE 1H15A 1PBGA 2XN9A 2GUBA 3LNDA 1ZSXA 4WLCA 5HJGA 3H7BB 2IPGA 1UQYA 1C5CH 3WENA 2XWBA 2V8LA 2FJHA 2YGPA 3ARQA 4JFZH 1U3HD 1GK8A 4S11A 2H9AB 3OKKB 4LEXL 2VAAB 3C12A 5E5MA 4JGJA 5I82A 1MI5E 4N2CA 1ORSB 1XH3A 4ORGA 4PG2A 1YRRA 2ATSA 3VCLA 1L0XA 4BF9A 2EXWD 3CHEA 1KJ2H 2CR6A 2WZMA 5BNKA 2H90A 3Q8EA 4KRTA 4ONFL 5CLTA 3CQHA 5FD0A 2I7GA 2VMCA 4MAYC 1QUNB 2AQVA 4PREA 3A4XA 3K91A 4X6CB 4FS9A 2AI0H 2RAGA 1NWPA 4LYQA 7ENLA 2QR6A 1JEZA 1FOBA 5E8DH 3BFOA 2I07B 4G8TA 5F0LB 2IXUA 1GGCL 5J57B 3S1WA 3WLJA 1MHPH 5GRYA 4V1YA 1IEAA 1I2PA 2HTKD 2KLTA 3F85A 4L37B 1P4BH 1EXUB 4JDBA 5IV2A 5E99L 4M1DH 3ROOA 2HRWA 3SCNA 4BKLA 3VH8B 4PGCB 5L8LB 3CXFA 2WWDA 3WLTA 2PZNA 1C8VA 4Q89A 4H6EA 4LLUA 2QVKA 1DN0B 5D1QD 4G1EB 3NL2A 1OAKH 1IX2A 5DWPA 3MRFB 1CLCA 2VR5A 1E72M 2EYTA 3DDMA 4LUSA 3HE7A 4P23C 3G6DH 4PRAB 1VYSX 2DI9A 2HB0A 2VLRD 4TUOB 3L95A 2TPSA 4E5XA 4ABUA 3MGTB 2XFXB 3UO1L 3QIWC 3GTNA 4RZCA 2JIEA 4KVNH 4ERGA 2VSCA 1IC5L 3UAJA 2IPTH 4TLTA 1AIFA 3CPUA 9XIMA 4S38A 4Q4PA 5KYYB 4KDVA 3ULUC 2ZUQC 2VCBA 4Z0XB 1FWEC 3OKDA 3REVA 3GRWL 2BWIA 2V6HA 3UWWA 4JQ3A 4ZL1A 3G0SA 3WLRA 5J1TC 3C8HA 2OQYA 1S7XA 4QRRE 1VFOA 2INEA 2XG5A 2ZX9A 3F58L 3N2CA 3FTYA 4X99A 2DQTL 4NG3A 3K6NA 1G6RA 1CE6A 3PPEA 3OXSB 5ECVA 2W88A 3PZ9A 1IBYA 5HNNA 4JFOA 3QUGA 1HO4A 3F00A 4MXQC 5HGBA 2Z1SA 1QBBA 5I74B 4HGXA 4HWBL 3ROLB 3APFA 4J6RL 5E00A 1BREA 3CN4A 1LWJA 1OQFA 3QORC 2GK0B 3LXUX 1IKNC 3LHAA 4LVEA 4GAGH 4LSRL 4LMQI 3O0RH 4CQDA 2ORBL 1HL9A 5A40E 1B31A 2P4AB 3BKYL 3FQTA 4DQAA 5T33L 1MQ8A 1FO0H 2FQDA 4WNJA 3WIHH 4NEHB 3SJNA 3WLSA 3TTEA 2CWRA 1GW1A 3V9FA 1JJKA 3BN3B 3KDMA 4P9MH 4WU7B 2FPTA 2IMRA 4NIRA 3L3GA 4YLBA 1PJ9A 3U2EA 3KW3A 1L0YA 1Q90A 1GOKA 3ZTCC 4JFQB 2WJFA 2YMOA 1I4FB 4Y5YB 1E27B 1X6LA 5EIIB 1UA6H 1FHVA 5I1CL 4DZIA 3CQJA 2VABA 2OR7A 4KY1H 2GJJA 1CTOA 3C75A 3D9AL 4PVNA 3DTXA 2VCOA 4PJIF 4DWSC 1R0AH 1QFOA 4MMZC 2SEBA 2J9ZA 3RZCA 1AG1O 3NQ2A 5CJMA 1XXXA 2E27L 3G1DA 5EF1A 3GXDA 1NFDE 1O60A 1ISZA 4TNFA 1UFGA 3QV9A 1C5DB 5LDSA 1ZXKA 4J4PD 2WTRB 4AV5A 1RZGA 4KKZA 1UZ1A 4I7WA 2BHYA 3QISA 1E42A 3OBAA 1FZKB 3LQMA 4KHTL 1YHTA 3ARDD 2OPJA 4OBRA 5DJAA 3G1VA 2HT3D 5IOBA 2QKIC 1VCFA 1R47A 3W6MA 3H7RA 2VSDA 1TQXA 3OB0K 4UTKA 5LAXB 4O4YH 1I7UB 3DRQA 5E8OB 2F18A 4PMFA 1JL8A 5JPNB 1XMWA 4X42A 3FCTB 3K2MC 1YYAA 4AG0A 5K33A 4WKAA 1RK1B 1W3JA 5HHNB 1FWIC 3ZE1F 4LAQL 1AQMA 4F3FB 3W9DB 3W02A 2QPXA 4FQXC 2YCIX 2E74C 2FCBA 1F3DJ 5HYIA 12E8H 4U28A 4DT2A 1KYAA 4B96A 3WYZA 1TE6A 4UAHA 3QCUL 1E28B 2GYIA 3FNKA 4HOWA 2MNJB 4Y1AA 4WDTA 5GZNC 3C8KA 3NVTA 3T78A 3GNRA 1JK9B 4IW4C 4G7EB 4HXBL 3TYUA 1OINA 1C7TA 5G2NA 1JCTA 2PGEA 1G9ML 2WMJA 1OFPA 4OLWH 2R0WL 2MQ0A 3D87B 4AGMA 5ISZB 3WTYA 4L8DA 3EYQC 4XMVA 2F54E 3UMNA 4NENB 4XMPH 3V1PA 1H63A 4HA1A 1JGUH 3VD3A 1M04A 3LS9A 3MCG1 2FGBA 3EOLA 4PVMA 1OJXA 1N6QL 2A0LD 3OR7B 1L9TA 5AC6A 5H8MA 3HOJA 6REQA 1IBFA 4OCYH 3DO7A 1JDCA 4QRQA 1TVNA 1IM3A 1ETA1 3PIQB 2X7LA 3W86A 1DKWA 2AJSL 3CFKB 2Y70A 3KYMA 2A2QT 5DVOA 4PUKA 3EFFA 2Z2BA 3NXFA 4LOVA 3TU9A 2HTLD 4TQEL 1QKZL 3D06A 4PUMA 1Z42A 1E1FA 3AAZA 5DVPA 4W7WA 2VDOL 4QROA 5IBXC 4M29A 3MHGA 5FACA 2DBLH 4GP4B 3L4VA 2CUHA 5GGRY 2H6PA 4XIAA 5LGHL 5I1DB 3LHUA 4NIKB 2AVFA 3VFGL 2DZPA 2R39A 4JHZA 1AH0A 1XR8A 3S3JA 4GUJA 3VKBA 4FNTA 5C2XA 2Y22A 4YHPB 3DUUB 1B4JL 2VENA 1U95B 4ZXLA 3D6NA 3HR6A 2WOQA 5DJYB 3IAQA 3BEWA 2VDNL 3CSPA 2P8MA 5E2TL 3VNMA 1MI5B 4XP9L 3WN5A 5D2XA 2DQCH 4F9LC 2OLAA 1XCTB 3MV7D 3WFCH 3N25A 2CXEA 2AXFB 3I85A 1KTRL 1UB6B 2MNRA 5FLUA 4K55A 1CBVL 3VE0B 4YAQB 1L6GA 4ZS6D 1CGYA 4V1DD 5D7LA 1R0MA 2FGWL 3VGAB 4YDKH 4NKIL 2KI6A 3CVDA 4JTSA 3DOIA 3D3VE 2BVTA 3SYQA 3PFUA 2A9NH 4M6NH 3AIQA 5J5EA 5F70A 4H1LG 3PWGA 3DSFH 4HWZA 4R5VA 4PBDA 3VFLA 5C9XA 1Y1DA 1MW3A 1GUVA 5I8CA 4NO5A 1EF3A 1WOBA 4EF8A 2YAFA 3TE9A 2PTUA 4RNIA 3DKLA 4K73A 2OMVA 4P2CG 5J6SA 1X5HA 4EWJA 1TYGA 1A6UH 5E1QA 5CEZH 2Z8VC 3D05A 2MH4A 2OQLA 4KMTL 1KOAA 4Y1TA 3GSXB 2AJYH 3QRLA 3VYPA 5XIMA 4HUKB 4NU7A 1A4KA 1ODZA 4QLKA 4P59H 2OTPA 3CHSA 4KK5D 3DI0A 3IWVA 5F9JB 1OB0A 1HSBB 4RR4A 3QR0A 1XRTA 4QKTA 5F71A 3B05A 2HJLB 1CZ8H 1JD7A 1TVBB 4CNIB 3FQRA 5AB2A 2QUMA 1RP8A 5DJCA 1KKOA 1TQSA 2X2IA 4DWDA 3DETD 4JN2B 3ARFC 2BLFA 1TNNA 5KAQG 2F84A 4ONVA 2FMOA 3HLAB 4J3OH 4DTGH 5BO1L 4FYQA 4C6NA 6PTDA 3SY6A 3AHXA 3IT8D 1SMOA 1F5WA 2K1MA 3IF1B 1LO3L 2IH3A 4JO1H 3O6KH 4PS4H 3O41B 4ILDA 1E4KC 3ZY7A 1LDPH 2BFVH 2C3WA 3WLPA 1GGOA 2AGKA 4ADIA 3QQWA 3ULAB 5FJRA 2V30A 1C12B 1ZPUA 5F7HA 1X38A 3GTXA 2NVAA 2FHCA 2EIMB 5I18H 2R1WA 2GTQA 3QPXH 4ZMQA 4OZHE 4JTIA 2RBLA 5AD0B 2EUWA 2UYLB 1F3WA 4QRRB 5IJKC 4HHAB 1JYVA 2CO7A 1DANT 4JQXA 1JERA 1LLOA 1V3HA 4QT5A 3IIZA 4EZJA 4C6FA 2XYBA 2WB1A 4OU3A 5BMFH 4L1WA 3W0WA 1N5YH 1V7NH 4GH3A 1KV7A 5FYKH 1DJWA 1LUCB 1NGXA 2XFFA 1D2KA 1TZ9A 3HN8A 4NQVB 5DRNA 1X8FA 3MTWA 2Q6WB 3TP4A 1NBYA 4DWHA 4LCIL 4LESA 4NWTL 2PMQA 1KN2L 3ABKB 4GYPC 4P4KB 3DCPA 1NCWH 4I8YA 2P9RA 3F2BA 1YNQA 3ZYIA 4POYA 2Y0FA 1GZJA 3BW9B 3I6GA 5K39B 5I0XA 1UA3A 2ZIDA 3O3BA 3FLUA 1KTLA 4ACTA 3RN6A 3ISWA 2PGWA 2NY2C 4Y2DB 5ERWB 3PZQA 2DQGH 4FEIA 2E40A 3OWRA 4Z7QB 3CSFA 3LRHA 3IIPA 5C2CA 1VFTA 1FHNA 1E70M 4IOIB 3S0PA 2E7MA 1BAGA 1YJDH 3QHFH 4LCVA 3LZ5A 3ZTJG 4XTIA 5C2UB 3C2AH 2H1PL 2DZTA 3AZUA 3NN8A 3B8WA 4NZ8A 4YDJA 2OEMA 3C5ZD 2OT0A 3W7HA 2XBTA 1FWJC 1U3ZA 5GZOC 1U8PA 5LXGH 3VFOB 2BVPA 3RCMA 3IDJB 2NNCA 4KPHH 2YPVH 3TZVB 1EDYA 4L8BB 4B9IA 4Y9CA 2APVA 2JBMA 5IT2L 3L9CA 3KVLA 3VUSA 1JI2A 1PCWA 1MEXH 2CCWA 5K59E 5J1SC 2ZA1A 4WRLA 2QGYA 1GOWA 2V37A 2X1WL 2OPCA 4TVPD 3L65A 1TPEA 1PZ5B 2I7SA 2Y7SA 4HGWB 1SJCA 3MS8A 1BEYL 3KOZA 1ZHBB 5EC1B 2HXTA 1DWGM 1NFDB 1SUJA 3MUIA 5EULV 2OMYA 2ZWSA 1P1MA 2A79A 1MEIA 3N4AA 5DELA 1FPTH 1DCEA 4H0IA 4DF2A 4RE4A 4X8JB 1EEYB 2JWYA 2NLIA 5FCZA 2FNWA 3VDAA 4M80A 3FFSA 4XKYB 2CLKA 2IG2H 1GTNA 5HQEA 1KCVH 2VR6A 5EU5B 3IDIB 4R4FH 2GFBB 5KS9E 2JALA 3RTQB 1A25A 1LCOA 2X44D 5I1IL 1OP5H 1X5LA 3T2NH 5HDBE 3MLYH 1ZDQA 4QG9A 1C08B 5HMFA 1J8HE 4HOMA 2DTML 2BWGA 4PRIE 3MGOB 1BSLA 4RBPH 3T8VA 1SEQH 4MGXA 5IHUL 4RMUA 2O6FA 4NLHA 4P2RE 3MJYA 1Q0XH 4YHZL 2XQYG 2X30A 5AYIA 4L4VE 4XXDA 5BS0A 3P4MA 2OMNA 4B9CA 5FCUH 1H1NA 2WMFA 4JUTA 2WXJA 4OIAA 4O17A 5E2WL 3LKOA 3Q37A 3UJSA 3RLUA 4R7DA 4ZTEA 3CFEA 1K9FA 3ZE0F 3MJ7A 2OXHA 4GUFA 4K3EL 2UY2A 1V10A 5IIEB 5I6MA 3LB6C 4PBEA 4ICMA 1JCMP 2PPFA 3FCBA 3RP1A 3EWWA 1U8MA 4ELMF 2ICCA 4WXZA 1B54A 5GSVA 4GXUM 5EBUA 3PB2A 2XJKA 2QLVB 1U2YA 1G84A 2Z3FA 4GLEA 3G08A 4LGRB 1SQMA 3CUXA 3PBVA 4DXKA 1N0XH 2OL3B 1O9VA 2X70B 3WIIH 2ATMA 3ZKXB 3W7OA 5C3IA 2P5EE 4IFOA 5D1ZB 3OBKA 1NCDL 4TX8A 2DQIH 1UZ8B 4NFBA 2CLVA 1JPGA 2CPUA 4MMYA 1U92B 4DZ8A 3PXHA 2XNAB 4QTHB 2IAAC 3D69B 3QQ9D 4M8QA 2J8UB 4UTFA 1B1YA 2V2XA 2QQLH 1Y0LA 1UPMB 1RHHB 3FO1A 2Z92A 3U5UA 5HATA 1C8PA 5T26A 3CQIA 2DLTA 1MJ8H 4A37A 1R1CA 5CLWA 2NDGA 1E6OH 3ES7A 1IL1B 3TYFA 3PGCB 4IRZH 1S9WB 4IZGA 3HBLA 3VXOB 4Y9EA 1YRKA 1JF1B 4RAHA 5KSAD 4LLWB 2I24N 2ZCZA 2I9TB 4ZFMA 2XWXA 3FSTA 4ZFOL 1HESA 4JIIX 2Z00A 4FQHB 2GFTA 5CZKA 4RX4D 4NKOB 3H9HB 5DD3L 2FYYA 1WO2A 4DAFA 4OLYH 4AZ8A 2A1WL 3KHQA 4JFTA 1QQDA 3QJQB 1GZGA 4JREC 1JPEA 5EH1A 5D1QE 2ZOKA 1UPPA 1NSNH 3SGDI 3P73A 3CTTA 3IDUA 4EOUA 5CSSA 3WQGA 1OE2A 4WY0B 1CUOA 5JOEA 4NP4L 4LEOB 1MCKA 2OMTB 4HH8A 4PR4A 4L1DA 4UWQB 1WDQA 5GGSY 1F4YH 5ACMA 5A5WA 1Q4NX 3HV9A 1BCIA 3WXVL 5F7FA 1YEDA 1QT1A 2DM7A 5AKQA 4PTMA 1KJMB 4PMDA 1S39A 4XMUA 4IWWA 2BOBB 3WOVA 4OCRL 3VWKB 1VACA 2VW4A 1TENA 1IGMH 1QI2A 3AREC 3AQUA 2PXYB 3BPCA 4UR8A 4DNMA 4MJ4A 2N7BA 3NFSH 4RFEA 2Y3AA 3U4KA 1EUUA 2NQLA 1Q0YL 3KBPA 5DJ2A 2JKEA 2BC4B 4K07A 4Y5XA 2ZJSH 2QHRH 1I75A 3E02A 1U3YA 4Q6XA 3BKJL 4FTVB 3CBKB 3GFXA 1OIOA 5JOFB 2Z28A 1NL0L 4NXKA 4HSNA 1WAAA 2W60A 3DOSB 3SY8A 2H3BA 3QRGH 3UROR 2AERT 2GJ6A 5GNYA 2H6UA 4PGEA 3UWZA 4ML9A 2YFOA 2KAUC 2OVLA 1UBSA 1FYTA 3MV9D 3TPKA 1YDVA 3EG9B 5FKAA 4PR5B 1H11A 4YHIA 4F57L 4OCXL 4QXTA 2ZSVA 2HT2C 2MPAH 1EXGA 4KJYA 1JR1A 1HTIA 1JXJA 1JN6A 3O6YX 3FFDA 4LKXB 2BNRB 4OZHB 6TIMA 4MF4A 3EH2A 3FYYA 2VGLM 1Q8AA 5E0QA 1RZ7L 3CEUA 3LGDA 1T7YA 1J0IA 4GO8A 3A24A 1E6NA 3W81A 3R0KA 4BFOA 4IJ3B 3PUGA 4PN2A 2P3YA 4GI8A 4YJ5A 4HC1L 3INUL 3NJNA 4N86A 2IUZA 1UJ3B 1X9UA 3RJXA 5ITFB 1NCNA 1XINA 2Z7KA 1KF9B 2ZQKA 2GC4C 4OI8A 1ECEA 2BOCB 5HD8C 2X4QB 3QXAA 3MI6A 4NZUH 5CFAA 1W6TA 2ZWZA 2WYTA 1D5MA 3R8QA 3T05A 1T1XB 2G9HA 3E8VA 2F1AA 3VXUA 4BV1A 3VI3A 1V03A 4KEUA 3TSMA 4NSBA 3H4WA 2JF1A 2PU1A 3GK0A 4JJ5A 1TZAA 3BVJA 1C16A 3A13A 5I1LA 3BPLC 3HC3H 3NSDA 5FDWA 1QRNE 2CHRA 3VO0A 4P4KD 5EUKA 4JNXA 1GEQA 4S10A 3TYZA 1SJHB 5F3FA 4OY9A 3HUJA 1DBBH 3JBG7 3RGVD 1OX6A 1DJQA 3ZDYE 3X1GA 2CBTA 3A9BA 2OKOA 2F8QA 5JIDA 2PDCA 2O4MA 3U6XA 3EKCA 2OT1A 3VQMA 1G7QA 3S6CA 4DK3A 2W0FB 4HKXA 5LXVA 4Q9QH 2VISB 1XIIA 5CINH 1FCGA 2QADC 3B2XA 4XNBA 3NDZA 4JFFE 5GHWL 1BYOA 1L2QA 1Q2SA 4Z3EA 5B3JE 1EVUA 3GZAA 3MMTA 1JZHA 2NX5E 5AC8A 3U46B 2F15A 2AZUA 1S7TA 1TE1A 3QO1A 4HBCL 2DYPB 1LOQA 1M7PA 5FYLE 5HHPA 3S5NA 1N9PA 4F0MA 3H6AA 1CDHA 1UADC 2CHXA 5BOPA 1DEEB 1V0LA 4BINA 1H6UA 5G4NA 4P9HH 5JQ6H 1FV1A 2YRBA 4TVUA 2OZ4H 3ENEA 1E6XM 3S35L 2EIBA 1UWTA 5HY9A 1WISA 2X10A 1DIOA 3V0HA 2PZ0A 3ZE2E 4XWOD 3PTDA 5I1AB 3SO3C 5C2BH 4WY7L 4HKJB 4JFPB 2VMJA 1KCUL 1YADA 3PWNB 4H0HB 5D9SB 3NO1A 1B3JA 4NM4H 2PW2A 3VFPA 3ZOAA 3OKEA 4QWWC 1FVEB 2BZNA 3V18A 3N19B 1RZKL 1TO5A 2NW0A 1J8HB 4KBPA 4IHOA 1QTWA 5I6NA 4IEFB 2DJSA 3IDGA 4B3EA 2FB2A 4FN0A 1K4GA 2DLGA 4JFDA 3MYZA 4P2RB 1JHTA 3QWNA 1D8WA 3BSMA 3SDCC 1IAKB 2X4TA 4GBUA 2V5CA 3M46A 5LIYX 2WZ6A 4LHQB 4GIRA 3NO3A 3CC5B 4N8UA 3OKNA 5TF1L 4DPCX 3DVIA 4K0OA 1F11B 5IKCA 2K8MA 1S9VB 5F88A 1RJZB 2J8OA 2Q7AA 5E1AA 4DBWA 4TV5A 4O54A 3EGDA 2YX0A 2IAMB 4TUJB 5D6DC 4UT9A 1M7OA 1C3FA 3EBVA 3QFJA 4LQFH 3DKJA 1D7CA 4NQSA 1OFQA 1NOAA 2VZUA 4CADB 4RUBA 4G70B 4LF1A 4O5LH 3LTSA 3HC4L 3TTOA 1RUPL 3FVMA 5AW7B 1U3HB 3IDYC 1IM9A 3TVMA 4O02H 1X7FA 2EH8L 2OAAA 1BQLH 5FCSH 5I1HL 4BGDA 1T41A 4AWUA 2XA8L 5D33A 2F54D 2VERA 3IWPA 3VIPA 2BSEA 4POZD 1Q8JA 4DZHA 5J6HB 4UTUA 3M7SA 2R82A 3PDOA 4O51A 1T8QA 3M0KA 2QV4A 1Y6MR 5C0DA 4FNLH 3OTTA 2NY5H 4OJCA 4HZLB 4JIQA 3RUBL 1Q2RA 2DLIA 1RPXA 1FVDB 3NJXA 1ADOA 1VFBA 3VOHA 3MGAA 4AJWA 3UXIA 1BFVL 5IB2B 4EX4A 1YHPA 4YHOL 1M1XB 3BVVA 3KCOA 3WDIA 3K6IA 2YRZA 1RHCA 1P84J 1CB7B 2H7WA 4PJ5E 3L68A 2COVD 4WKXA 2E6AA 3QXWA 4FFZH 3GMNA 4FQQB 3M6YA 4A21A 1RY7B 2ZC8A 1DQXA 1H0GA 4XV0A 3VI2A 3GTHA 1JPDX 2VSKB 2CDEA 3T9WA 3MYOA 3FQUA 3WU1A 3O2VH 1CXLA 3UZEC 3AHTA 3RG1C 4LCQA 4RDBA 1RZ8A 2XTJE 2GGEA 2ZZUT 5CZSA 4TULH 5D1QB 2WBJC 4E68A 1S5IH 2QGHA 3OVUB 1MCLA 3OZOA 5D2LB 3FUNA 1NMAL 4NP9A 3VKKA 1UH4A 3GWJA 2POZA 5ANHA 4EDWH 1IGCH 3MR9B 2VLRB 4PY8I 4GSQA 4WENB 5H35A 1IFHH 5HI3D 4BK5C 4WUKL 3GIVB 3O6DA 2C1HA 3UBXB 5I07A 4AY1A 2DB8A 5B4MD 1UKQA 1F6AA 1SZRA 4PV9A 2NY7H 1Q6CA 2WSYA 3D3VD 3NEHA 3SY0A 1URZA 1N8WA 4XZ9A 2D2HA 3VIKA 2E46A 1B4RA 3LS5L 1OSPL 2DKMA 3DROA 3OEXA 4IRSD 5DQJA 5F7EL 3ANVA 1PLCA 2FTAA 2MOGA 3BAEL 3MODL 3NSJA 2OTUA 5JVLA 3L08A 1O7DE 3SDXE 1RBAA 3GNNA 3S3GA 3VFNA 5I5JA 4NQDE 2ONEA 3IFNL 5DRIA 3MHFA 4IT1A 4NERA 5TTRA 2NPLX 2ODOA 1L2UA 1K5NA 2VJ8A 4E2VA 2PO6D 5M17A 1KQYA 3THMH 3DLQR 4D6DA 1ITUA 3TFCA 2AF2A 5CJQL 3X1BA 2VWTA 3AUJA 5E24E 1XP3A 3W7QA 3V4PB 2P7TA 5I24A 3MV11 4JX4A 1NDGA 3V5HB 1HWGB 4HZ1A 4FF9A 3CLEL 1LO2H 3NSYA 3R4RA 3L1OH 3QYSA 4W9LC 2FHBA 4L1LA 3C61A 4UOW0 2OLHA 4BKTC 2A77L 1RIUL 4N1HB 2H8XA 2ALRA 3E6FA 2HLAA 3IK2A 3VD7A 4LS1A 4RZKA 3DURB 1OCRB 4OGXL 5G1YA 4MZ1A 4D0CA 1JXFA 3AWOA 1D6VH 4ZEPA 4OLUL 2FKPA 4GQGA 5AYXA 5K2ZA 3P3SA 4JFVA 5DEZA 1VYRA 3SQOL 1YC8A 2WBWB 4YXLL 3QQDA 3RHGA 4HUXB 5I73C 2WLIA 1I8LA 4NX5A 3T3MF 4B9JA 2F5AL 1IZJA 2HLFD 3FBQA 4L65A 3MRPA 1SJEB 4YS4A 3QY8A 4PMEA 3TFBA 3CPLA 3BE1L 4XVDA 2AJUL 5AZEL 2A6DB 1KEMH 4QGYA 3USZA 4W7UA 3WDPP 1JV5A 3FQ2A 5FOOA 1NKOA 2OX5B 1TXKA 4ZO9A 4UV4L 4HN8A 1WAUA 4MKVA 3WX7A 4KNTA 3KYNA 4N4PA 2WP3O 5EBLA 1KXTB 2E56A 1XF5B 2F5BL 2HVNA 2XKUA 2X7VA 4BE6A 2ADFH 3EYVA 2Y7FA 1P7KB 3KCLA 2HVOA 3U5YA 2V63A 3ARDB 3HHSB 1HEHC 3DFPA 1WHOA 2YGQA 3MJ8B 3QDMD 1IR2A 1KCKA 3CLFH 1BTCA 5FAJA 5D70L 6PCYA 2CLRB 5IBLD 3LV6A 2NV1A 3T1FB 1V08A 1LBLA 3CV1A 3RNDA 5MKGB 3W56A 3JV6A 3P9WB 1H60A 4JPWH 3D2UA 2CWNA 1UGKA 4IIGA 4XPFH 2CUAA 4H88L 2FD6H 2ZOOA 4N2FA 4FR6A 5D5MF 3RY5A 1BM3H 2WUBH 3IV8A 1JRBA 2R2BA 2OCJA 1YEIL 3DUGA 1VPOH 1EZVY 1TWWA 3DX9A 1FE8L 1BGAA 4V15A 4FB7A 3RURA 1NEZB 3MNWA 4OZ4A 2EXYD 2EO1A 1NBVL 2FATL 1AFSA 3RO6A 2WM0A 3VX0A 1T1WB 3JT0A 2XQ0A 5ABAA 2W0KA 5I9QC 1LP6A 3M6DA 3HPZA 4G5ZH 2ZP0T 2MQ3A 1L7IH 1YXDA 4HUCA 1KENH 1TR1A 2WSDA 5DJ0B 3N04A 3PWUB 2Q86B