2WSPA

Thermotoga maritima alpha-l-fucosynthase, tmd224g, in complex with alpha-l-fuc-(1-2)-beta-l-fuc-n3
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
443
structure length
435
Chain Sequence
KPRYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNGMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE, PUTATIVE
publication title Beta-Glycosyl Azides as Substrates for Alpha-Glycosynthases: Preparation of Novel Efficient Alpha-L-Fucosynthases
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 152
structure length 435
sequence length 443
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wspA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wspA01
2V5CA 3EJSA 1BYBA 2WBKA 1OGGA 4FNRA 4PTVA 2VRJA 3SCUA 2CBUA 3L4TA 3KL0A 3IJ7A 5BXTA 1JNDA 1CIUA 3A3HA 1TA3B 4IM4A 4DM1A 3BUPA 2ZE0A 5I5RA 4XX6A 2VURA 1C90A 2WZHA 4NRSA 3CMGA 2FHCA 4WKAA 3GXMA 3K8LA 2F8QA 3AXXA 5D9OA 1BAGA 2F7QA 4DWSB 1US2A 4DWSC 5D4YA 5KZ6A 5A94A 1M7XA 2J75A 3BAIA 4E4PA 3WDJA 3W37A 1GW1A 2VQTA 3MU7A 5FCZA 3N04A 3WF4A 4PSPA 3AI0A 3D52A 4OKDA 1WDPA 3W28A 2X8RA 4M24A 3WSUA 3WFLA 2QV4A 4FLSA 1MVYA 2W61A 1GCYA 1CGWA 1UR0A 1VEOA 1SFSA 2OYKA 1V08A 2DT0A 3POCA 4HPGA 3SCRA 2J74A 1SR0A 4D6DA 3EJTA 1H4PA 4HA3A 1PEZA 4V28A 5EB8A 2WSPA 1UQZA 1M01A 3EDEA 1OIFA 1BF2A 1GOOA 3CBWA 4D71A 1B90A 1DHKA 2YA1A 2X2YA 4OGZA 4PEEA 3ZT5A 5KEZA 4NI3A 2XGIA 3SCQA 2D0GA 2VNCA 3CZKA 5CZKA 3ARRA 3AMCA 2XFFA 1KGUA 3GH7A 1XH1A 3L4ZA 1FHLA 4BF7A 1XD0A 2GDVA 5M5DA 2CPUA 3CZGA 1GOWA 1UKQA 4DO4A 3TP4A 3WNKA 2PBOA 4OIFA 3L2LA 1KCLA 2PC8A 1GQKA 2G4FA 4UR9A 5AC5A 3BMWA 3F5LA 2WBGA 3VIIA 1C8QA 3ARPA 1WB0A 3ZR6A 1B3WA 2D22A 2QF8A 1K9TA 2GVYA 1R87A 4RE2A 1KWGA 4BQ3A 4AD5A 9CGTA 2OWXA 3VSVA 2YA0A 3FY1A 3BVTA 2YOCA 3BLBA 1UYQA 5FKYA 4DWSA 3VD9A 1F4AA 2FGLA 2UY2A 4HZ6A 4J27A 1ISXA 5A6BA 2VC9A 4JCMA 2QPSA 2DSKA 2J77A 3WD2A 2YL6A 4Y7EA 1E6SM 1GUVA 3AQUA 1XSJA 3HG5A 5FL0A 1HJQA 2CXGA 4QLKA 1QNOA 2EQDA 2Y5EA 3WDPP 4KRTA 2WAGA 2WK2A 2WVTA 3GXDA 3WMSA 3WNPA 2BVYA 1K9EA 3W29A 4A3HA 1E6ZA 3CMJA 5HPOA 1E4LA 4P7LA 1I75A 2JF6A 5DFAA 3GNOA 2WKGA 2XPKA 3BCDA 4MADA 1WZAA 1BYAA 2XVLA 3DECA 3IAPA 3DC0A 5BXPA 2CBVA 4UOQA 1R34A 4WIWA 5D8ZA 3M7SA 1H49A 2XFYA 3W81A 1V3JA 3MMDA 2DIJA 2ZWYA 4ZEPA 1JZ6A 2DGAA 4UFKA 3QR3A 7TAAA 1QNSA 3VDCA 2XIIA 3EJQA 2QMKA 5A2BA 5I6SA 3S6TA 4HOZA 2DSUA 3VDAA 4U3CA 3BCFA 1HKIA 3TTSA 3CPUA 4PMNA 5EBAA 2O9RA 3VIGA 3WUFA 1XSIA 1UKOA 3WH7A 4GIAA 1TQSA 4P7NA 3QGVA 4B3KA 4D6IA 4AZ6A 5EFFA 2QHAA 4H7VA 4U2YA 4K68A 6TAAA 3NDYA 4A3YA 5BYWA 4GXPA 1DWAM 2FH6A 5A2AA 4ZE4A 2BFGA 2WCAA 4X0NA 3NJ3A 3WUGA 1UASA 3UESA 3DX4A 3QHNA 2W66A 1VJSA 1JYNA 3U7VA 1J0IA 1FHDA 1BHGA 1ECEA 2D3LA 4JFWA 4QFUA 5D9NA 2D3NA 1VFOA 2WVSA 2B31A 2WXDM 2Y8KA 3AROA 1HJXA 5A8QA 1E4NA 3I3DA 3CHFA 3MUIA 2G8ZA 1E55A 1J18A 3GXNA 3M46A 2D0HA 3AS2A 1JIBA 5HOSA 1E3ZA 1QHOA 4UQ9A 5LYRA 4Z2IA 4AWEA 1EO7A 1QWNA 4MNMA 4AMXA 2A3CA 2WKLA 1BGGA 4XZWA 2FHBA 3EMQA 2TAAA 2YDSA 4MDOA 5IXEA 2GDUA 1KFWA 1LL4A 4NF7A 4MNKA 3RPMA 1G94A 4PMVA 5JUVA 3AICA 3O9NA 4MTVA 1UR9A 1EOKA 3VSTA 1NOWA 5DO8A 3OGSA 3GXIA 1HJUA 2CKRA 5HDRA 3WENA 4PUDA 1HWWA 3POHA 1TQTA 1US3A 2BVDA 1C8YA 2VVSA 2EADA 3A4AA 3VIHA 4ACYA 2G3NA 4GKLA 3AIVA 3IAQA 2G3IA 3H54A 1R7AA 1ZB5A 3WNMA 3VUPA 1KXQA 3A5VA 5E9AA 1GOMA 4HZ8A 1NH6A 1EGZA 4CCEA 1MWOA 3U7BA 1AMYA 1B9ZA 1KBBA 3WD4A 1TFVA 3SURA 1E6NA 3WF1A 1E71M 4UFLA 2W67A 5DT5A 3ALGA 4PMDA 2J7HA 3T08A 4B9YA 3T2QA 1QW8A 4WLCA 3THCA 1XRVA 2EJ1A 2XYLA 3WEOA 1NOUA 1JD7A 3MMWA 3NSXA 4DWSD 3BH4A 4MB3A 4J3SA 2J8GA 5A6BD 2VZTA 4D6CA 3VDBA 1TVPA 4W7VA 5DF0A 1R46A 1OBAA 3IJ9A 4BQ4A 1XSKA 3OLDA 4NZFA 5GNYA 4AMCA 4J3XA 1UWSA 2ZXAA 3WFZA 1MQQA 3KL3A 1OWQA 2OYMA 3VGGA 4HMEA 1ISWA 1M03A 4JL1A 1Q6EA 3M07A 1HL9A 3ARUA 1ZJAA 1UH2A 1HKJA 4B3LA 1E43A 2E9LA 3WH6A 3SCOA 3ZMRA 3MSGA 3PZMA 1LQ0A 1A3HA 4Q22A 1KR0A 2YL9A 3WELA 3N17A 2F18A 3SUVA 3BVVA 2DSZA 1HKKA 2WSKA 2ZXQA 3II1A 2PI6A 3GXTA 1H3GA 2J7CA 2D24A 4CN6A 2GUYA 1YQ2A 5E70A 2DIEA 3KZSA 1CZ1A 2VZVA 4BCEA 5M03A 2W92A 3KLKA 4AD4A 4JIEA 1H11A 1NWUA 1TQWA 2W5FA 2JEPA 3OA5A 4PCTA 2ZXDA 1JZ7A 1UKTA 2WPGA 1NQ6A 4J3VA 3AIQA 3DDGA 1V0LA 2FE0A 2CERA 3D5HA 1ZBWA 4W93A 3ARVA 4UQDA 4AEEA 3FN9A 3CUHA 3HZ3A 4WF7A 1V0MA 1X6LA 2W63A 3LPPA 5AY7A 3FXYA 1UKPA 4P7RA 3PTKA 3LRLA 7CGTA 1JYXA 5IFTA 2XVKA 1UR4A 1VBUA 2CBJA 1W1TA 1WDSA 3LXAA 4P7OA 3WNNA 2WVVA 3WDIA 2C0HA 5A8NA 1EDGA 3PTQA 3W6LA 2XM1A 1W2PA 3BVUA 5LA0A 1SZNA 4KMQA 2JFEX 2CBIA 1BLIA 1MW3A 1NM9A 1VENA 4N42A 2CITA 4CN1A 1GJUA 2EPNA 4WSKA 3EYPA 1V3HA 3CZNA 3LXBA 5AYIA 1NARA 4YPJA 4D1IA 2IXVA 1PS3A 4GZIA 1C93A 2WZIA 3LRMA 1B31A 3VMPA 3GTNA 3J7HA 3RILA 1UR2A 4U33A 3FHQA 3AS3A 4W7UA 1ESWA 3M6DA 2WHLA 2A3AA 1VEMA 4ZXLA 1H0GA 1JL8A 2VVNA 4AYGA 1VAHA 2ZX9A 1UQYA 4CU8A 1E5NA 3ZO9A 3A6OA 3OLIA 3AMKA 4M1RA 1R7OA 1W1YA 3ZOAA 2ZIDA 1J0HA 2XN0A 1R86A 1WAWA 4D6EA 1I1WA 2F1AA 1H41A 4IUGA 3D51A 3LRKA 1HVQA 1EQCA 4MDPA 3ZR5A 1W3LA 2BY3A 3CHDA 5C8BB 3GNPA 3WQ6A 2EPLX 5IHSA 3DX3A 4IPLA 1EXPA 2UWFA 3W25A 2F61A 4MJ4A 2ZX6A 1NP2A 2VR5A 2YBTA 1JXJA 1E15A 1VRXA 5CQ1A 3W4RA 1JZ5A 4CVWA 2PWDA 1ITCA 3AIUA 4J3UA 1TVNA 4AXNA 3SCNA 5LA1A 2C7FA 5A8OA 2O9PA 1KB3A 1V6YA 1AQMA 1VEPA 4U3AA 1G5AA 4OUEA 1CLXA 3S5ZA 1WZLA 5A6KA 1WPCA 3VO0A 5JBEA 1A47A 3L4VA 1V02A 1JFHA 3VGFA 1QWUA 3LXCA 5A6LA 4C7DA 3PBGA 3BGAA 3TTYA 4P8VA 1JAKA 1E1EA 3DYOA 4TVUA 1V3MA 3AYRA 3GNRA 1J12A 3VVGA 1CNVA 1GZJA 2XSBA 2Y2WA 3WNOA 1KGWA 1UWRA 2AMGA 2DH2A 1JDDA 1LL7A 4UQBA 2J7BA 4CD7A 2G41A 4Z2KA 2PWEA 1UD4A 1TR1A 2CHOA 1KXHA 3EMZA 4D6HA 4TX8A 1CBGA 3WY4A 1GVYA 1W1VA 2X05A 2DT1A 2Y4SA 4M29A 5I2UA 3N9KA 4FLOA 1QOXA 1JI2A 4PRWA 5FD0A 3AS1A 4R27A 1E73M 2J25A 3RM8A 4XUYA 4F9JA 2EXOA 1ISYA 3DX0A 1QNQA 3QOMA 1CECA 1ZJBA 3W53A 3O2LA 1B0IA 3WDRA 3TTQA 4UQEA 3SIMA 3OG2A 4MAVA 1OT1A 1R8LA 4MB1A 4FK9A 1TCMA 3B9EA 3LPFA 1XH0A 4WKFA 3L2MA 3N18A 3ZJ6A 1V3LA 5GNZA 4LYPA 3VIOA 4W87A 3U5YA 4MNJA 3MUAA 3SCWA 3BUBA 7A3HA 2J4GA 4NXKA 5GQBA 1BQCA 5I77A 4CD4A 3VINA 2FHFA 3LPGA 3TTOA 1E6QM 1R47A 3SUTA 4AISA 1UA7A 4CUCA 1TA3A 1B30A 3SUWA 2CCRA 5BROA 4AZ7A 2E8YA 3RDKA 1GNXA 1GHSA 3VX1A 1MYRA 1M53A 2VX5A 2ZUSA 3AHVA 2V3FA 2A3HA 4JHZA 3VD7A 4AIEA 1JYVA 4AIOA 1E70M 5IHRA 5D9MA 4W5UA 1V6VA 1LJYA 4BA0A 3WNLA 3D3AA 2RGLA 1FH9A 3CZSA 3WF0A 2JF7A 5CPQA 3UG4A 2GFTA 1K6AA 1HP4A 3BAJA 3VNYA 2CIPA 1J0ZA 4M56A 3MANA 1R75A 2VT0A 3VNZA 2CEQA 3NDZA 4TTGA 4WK9A 3WQ8A 1MFVA 1ISZA 5CXPA 2D1ZA 1FOBA 4JL2A 1J11A 3BVXA 3JUGA 5CPSA 3FAXA 4UOZA 4CVUA 4V2XA 3UR8A 1PIFA 4JFVA 1DP0A 1DWGM 4P8WA 1HXKA 1JDAA 3MSDA 1HJVA 4UTFA 3BAWA 4GI6A 2O92A 3N12A 3D50A 1FFQA 1PJ9A 2F7PA 5FIPA 2CESA 3T09A 1JD9A 3RM4A 4BZYA 4GINA 1W9UA 4H8HA 2ESCA 1HNYA 2WLZA 3A47A 2J8FA 4CU7A 1ODZA 1GONA 2ZUVA 3PTMA 1RP8A 1R33A 1WZKA 3VU2A 2X0YA 4HPHA 4PMRA 1QX1A 3AIWA 3UG3A 3DYMA 4IISA 1WP6A 4GQRA 1DWHM 3CV5A 3S5YA 3RJXA 4CD5A 1XD1A 3FAWA 1W32A 4ZE5A 1JF5A 2VQUA 1LLOA 3PZGA 2F7RA 1PAMA 4GQQA 2X2IA 2DQXA 1QI3A 1H0IA 1RH9A 4DUVA 6CGTA 4KRUA 2VI0A 4J3TA 1FH8A 3D4ZA 5ECUA 3MUZ1 3IJ8A 2GK1B 3HG4A 1T0OA 3AMDA 3LMYA 5E09A 4UZUA 2D73A 2WHJA 1B3VA 3F4VA 2ZXBA 2YA2A 3BC9A 1XH2A 2QLYA 5HXMA 1JFXA 1PX3A 4HOWA 2YBUA 3VIJA 1JXKA 1OGSA 4MNLA 4H8UA 3O6AA 4W84A 2EABA 4UZSA 4LXFA 4M82A 3EJRA 4ZENA 3UR7A 5M17A 2VUYA 2A3EA 3WBEA 1B3ZA 1FFRA 5A6AA 2WHMA 1G0CA 3UG5A 3A22A 3OBAA 2J78A 2E9MA 4AY1A 3EDFA 4GI8A 5I24A 2F1BA 1UWQA 3TV8A 3T0BA 1D7FA 3AXHA 1YHTA 4OZOA 2D20A 1GQIA 5CLTA 1SMDA 4EKJA 1XCXA 2XVPA 4LPCA 2XVNA 4J3WA 4AZGA 4UQAA 4MB5A 2VCBA 1FA2A 4UFHA 1UWIA 3AIBA 3VX0A 2ZX7A 3AJ7A 3VM7A 2GJPA 2WMFA 2WVUA 4FNUA 2X2HA 3A24A 1GHRA 4S3KA 3E1F1 4Z2LA 3UCQA 1CGTA 2GSJA 2WMIB 3T2PA 2CNCA 3AIEA 1CGYA 1E56A 3T2OA 1J10A 4AIUA 4GZEA 5A3HA 4KWUA 4JKLA 2VZUA 2BHUA 2WW5A 5E1QA 1W3HA 1ISVA 2ZUTA 4AW7A 2IUZA 3F5JA 5I0DA 4UFMA 3GH5A 3ARZA 2X1IA 5JBDA 1LG1A 2WMKA 3KL5A 3WH5A 2WMHA 1NWSA 1WO2A 1E3XA 3ZT6A 2IXUA 4AZCB 1EIBA 3OLGA 3BSHA 2VX6A 3GZAA 5E6ZA 4JKMA 3K8MA 1PZ2A 2PWFA 1RPKA 1EHNA 2XM2A 3A23A 1EDTA 2YKKA 3WIJA 3I3BA 1E0WA 4NRRA 3W26A 1CPUA 1CEOA 3BAXA 4B16A 2XTKA 3HJEA 1E1FA 4E8DA 3SUUA 1W9DM 2ZICA 3L4YA 3MO4A 5A8MA 3W24A 1E0VA 3GXFA 4D6JA 3MS8A 2DT3A 2D23A 6A3HA 5I3DA 2XIBA 1E6PA 1HL8A 1V6WA 4PMYA 2F2HA 3VIKA 5E0CA 1DWIM 2V5DA 3PZOA 3CUFA 1TMQA 2JE8A 4UNIA 1QI2A 3ECQA 5A8PA 3RJYA 4H41A 2WCSA 4LQ1A 1J9YA 3WMCA 4Z2GA 1JAEA 4CD8A 4F79A 3VPLA 1UR1A 3BLKA 1O7DC 1UD5A 1B2YA 4QAWA 3KEHA 1O7AA 1QPKA 3NCOA 3MI6A 4ML4A 2NSXA 2WMIA 1TQUA 2YFOA 1MQPA 1GJWA 2E0PA 3GBDA 4AYSA 1Q6DA 3NIYA 3WD1A 1QBBA 1QVBA 2WC3A 4M8UA 3BLPX 5I79A 3AHTA 4UQCA 4W5ZA 3GXPA 3HMCA 1VIWA 4ZXOA 2OLHA 1UD3A 2J62A 2WB5A 1PX8A 3VILA 3B8SA 1PX4A 1RD6A 3FNDA 3CZ8A 1GOQA 2PWGA 3AZSA 3OZOA 1F4HA 1JZ4A 3T0AA 1S46A 4FNPA 2VTFA 1OD8A 1TZ7A 4BQ2A 4JFUA 1D2KA 2RGMA 3WDQA 2DDXA 3OB8A 3WD0A 4ATWA 3AMLA 2EACA 4W85A 1KTCA 2QPUA 4DM2A 1ITXA 3EDDA 1W3JA 2XHYA 5ABHA 1MW0A 1J0KA 4B15A 5I23A 3BSGA 1O6IA 5ABEA 1CLVA 1ZU8A 3A4XA 3HG3A 4C7FA 4MPKA 1V0KA 1HTYA 4TVDA 5LA2A 3OIHA 3VMOA 1V6UA 2YL5A 1NP0A 2OWWA 4UOJA 1WDRA 3W0KA 2ALWA 4CCDA 2V38A 2Y24A 2EEXA 5CGMA 3GBEA 2EPKX 5FOOA 2VX4A 8CGTA 4YHGA 5A1AA 2VCCA 1EH9A 4DO5A 1ZBVA 5EMYA 1LF1A 1CXFA 2ZUMA 5A69A 3WH8A 1VB9A 2PBGA 2BXYA 2YJQA 4TOQA 2DT2A 4C7GA 1UH4A 1C8XA 3CO4A 2BY1A 1Q6CA 3WL1A 1KQYA 1E72M 4V27A 4NX0A 3ARTA 1M04A 3EJPA 1QHPA 1DWFM 1UR8A 4AD3A 3VMNA 3EJUA 3PZ9A 3WQ4A 1ZL1A 1UWTA 2YIHA 1UG6A 4PTMA 8A3HA 1BG9A 1Q6GA 5DT7A 2XWEA 1PZ3A 5FL1A 4NZJA 5GNXA 1UOKA 2YL8A 4PMQA 1XYZA 3EMCA 1G1YA 1BVNP 1VFFA 1NOFA 5EFDA 1VFUA 2XSAA 1WNOA 2A3BA 1GPFA 4R5EA 3HN3A 2WZEA 1WCGA 3W82A 4FLRA 1KTBA 4KH2A 1ZS2A 2F7OA 3BUIA 1KQZA 1WDQA 4D72A 3CH9A 4S3JA 3FW6A 4IPNB 1OM0A 5HBFA 2E4TA 2JIWA 1JYWA 2EO7A 1TG7A 3SCSA 1RP9A 4AEFA 5CG0A 3BVWA 1HIZA 4FNSA 2BS9A 3CZJA 4HMCA 1E5JA 4DUXA 1FH7A 5ABFB 3ARXA 1K9FA 5CPTA 1W9BM 3AZRA 5A6MA 2W91A 4Q7NA 4GO8A 4U5IA 3MKKA 4OBSA 1SYTA 2WC4A 3CTTA 2EBNA 4OBRA 4AD1A 1DEDA 1XCWA 4DO6A 3K1DA 2JALA 1UH3A 2WNWA 1TQVA 1JNEA 4ATDA 2BY2A 1W3KA 3CHCA 1XYFA 1E0XA 1Q4NX 3BAKA 1HKMA 3HU7A 1LWJA 4QDMA 4HMDA 4N0RA 1EA9C 1QI0A 4EE9A 3WEZA 3FHAA 3WUEA 1X6NA 4QCEA 2ZOXA 2VL4A 3DHPA 5IFPA 2BHZA 3I3EA 4P7QA 3WY3A 1CWYA 1VJZA 4CKQA 1B3XA 4PMUA 4UFIA 3SCVA 4FMVA 3A4WA 3UETA 4HP5A 2Z1SA 2OW6A 3L4UA 2VO5A 3QHMA 3RCNA 1H2JA 3VGHA 3EDKA 3LX9A 1V02E 1IT0A 2JEQA 5BWFA 4XZBA 3GYCA 3ARQA 1UKSA 1LL6A 2E8ZA 3VGDA 3WD3A 2WWDA 1BG4A 1HJSA 1WE5A 1Y7VA 3WY1A 1BPLB 2YDQA 4JKKA 3HG2A 4MAZA 4QCFA 5A95A 1EO5A 2XFRA 3K46A 4W7WA 3VGBA 1H09A 4D1JA 1OSEA 1QNRA 5BXSA 2JIEA 1HVXA 3BAYA 1E40A 1SMAA 3SUSA 3AZTA 5ABFA 3LPOA 2PF0A 2XJ7A 1WZMA 4HZ7A 3PZIA 2ZWZA 1TE1A 4P8UA 2DSVA 4P8XA 2NW0A 2XN1A 3L4XA 3ZIZA 1H5VA 2WYSA 3PZQA 2IGTA 4RE4A 1C7TA 4YN5A 1CGVA 2AOSA 3IK2A 1UD2A 3H53A 1E6XM 2ZUUA 4X0VA 4J7RA 3CUJA 2XN2A 3OZPA 1U33A 4B9ZA 2V3GA 1CXIA 3EBVA 5DMYA 4LX4A 3N15A 3A21A 3WQWA 3U5UA 1EDQA 3B9DA 1KR1A 3ARSA 4ACZB 1EHAA 4QLJA 4TTUA 4EANA 2DH3A 5CLWA 2DPEA 2WWCA 1JI1A 1NWTA 1XC6A 2HVMA 4NSBA 1L8NA 2Q8XA 1IZKA 5D9PA 1CTNA 2EPOA 1UZ4A 4W86A 1C3FA 3VSUA 1CXLA 1MQRA 2VJXA 2XUCA 3KE0A 4LGXA 2XVGA 2GJXB 1IZJA 4E2OA 3WKZA 1UD6A 5F7UA 1JZ2A 3ALFA 3ARWA 1JZ3A 4PSRA 2Z1KA 3UEQA 3AXIA 4TX6A 4U2ZA 3PZTA 1OT2A 1C92A 2VRQA 3BUQA 2CYGA 4JFTA 1MXGA 3AFBA 3L4WA 3KLLA 1PBGA 1GORA 2BNJA 4RE3A 3NYDA 2G3MA 4J28A 4GI9A 4PYSA 5HNNA 1Q6FA 5IDIA 1U30A 3CUGA 1V3IA 4PTXA 4GPNA 1JGIA 2O9TA 5BCAA 4CU6A 1CXKA 3PZVA 2XG9A 1HXJA 1GOKA 4H04A 1CGUA 2BVTA 2YDRA 2C8NA 5A6SA 1KBKA 2FGZA 1TUXA 2VX7A 1G01A 1K9DA 2CETA 3BUDA 3W27A 1GQJA 2OW7A 4KGLA 4F8XA 2WANA 4FLQA 3H55A 4XB3A 4D6GA 4HOXA 1X1NA 4CGTA 4NZCA 1AQ0A 5HPCA 1JG9A 1FP8A 1QI4A 3WF3A 4AMWA 2VMFA 1BSIA 3NSNA 4JHOA 4L4PA 3SCPA 1B1YA 1OINA 2OSYA 3TOPA 1MFUA 3WN6A 4ACZA 4CCCA 2EAEA 3NUKA 1GVIA 1E9LA 4MJ2A 5CSYA 1LG2A 1V0NA 3QHOA 4FNTA 4XV0A 3RIKA 1HX0A 5TD4A 1EQPA 3WMBA 1UD8A 4PMXA 1QHZA 3VDHA 3WQ5A 1HT6A 1V03A 3WY2A 2E3ZA 3G6MA 3ZSSA 2DEPA 4ATLA 3W6MA 1BFNA 2GJXA 2VOTA 2OWCA 4PMZA 4UCFA 4KGJA 2OSXA 4WJXA 4L4OA 2YFNA 3DHUA 4FF5A 2UY3A 2VCAA 4HU0A 2WHKA 2FH8A 5ABGA 2J79A 4AZIA 2BV9A 2WCGA 4WSJA 2WC7A 3N11A 4UFJA 4YHEA 1IV8A 2EPMX 4U31A 1DWJM 3AIRA 4AZHA 4CD6A 5E6YA 3QOKA 3PZUA 2WM0A 3ZJ8A 2OYLA 4M80A 4AC1X 3VTRA 2CKSA 3W38A 3RM9A 4Z2HA 4LYQA 1ODUA 3S2CA 1MXDA 1E4IA 3AHXA 1CXHA 2HISA 2E9BA 1CGXA 1KXVA 4NXSA 5BRPA 4AZBA 4H8VA 3WBAA 3WUBA 4RL3A 4PN2A 3GM8A 1BVZA 3BMVA 1BYCA 3CZEA 4MB4A 5JIWA 1L0PA 2XWDA 1UA3A 3IANA 3ZSTA 5BRQA 2DSWA 4W8AA 3DDFA 1GOIA 3WL0A 3AS0A 2GK1A 2BY0A 1D3CA 3CIVA 1OGBA 4D6FA 1ZBKA 1VF8A 2WVVB 4U5KA 3CLWA 2X0HA 3WH9A 2WLYA 3ZJ7A 1UHVA 4HU8A 1VBRA 4W88A 2MANA 4PUEA 1V6XA 1JZ8A 1W91A 1MW2A 4F9DA 1XHGA 4E8CA 4EAMA 5AYBA 1W9XA 2X2JA 4M81A 2Y8VA 3AOFA 3VKKA 3PN8A 4TXEA 4TVCA 3PZNA 1AQHA 3CHEA 1WKYA 5JIPA 4Z2JA 1KWKA 1H1NA 3VGEA 4TUFA 2QMJA 1OB0A 1J01A 4AZ5A 3TA9A 1HF6A 1V3KA 3UERA 3OGRA 1P6WA 2AAAA 2FDMA 3RMEA 3U57A 3SEPA 1ZBCA 3VM5A 3NSMA 1QNPA 1W9PA 2VRKA 2NT0A 3VOCA 5C70A 1C7SA 3N13A 1BTCA 1KXTA 4GZJA 1W1PA 1BYDA 4PBGA 3KWXA 2ZX5A 2PWHA 1W9VA 2WMJA 3DX2A 3CZLA 2ZUWA 1KGXA 2V3DA 3TONA 3T0DA 3VD3A 1QI5A 2O9OA 4W8BA 5D8WA 4W8LA 1QW9A 2X09A 5M3WA 1BGAA 1EOMA 1HP5A 4JFSA 4ZFMA 4F66A 4EK7A 3OLEA 4A4AA 4JZ5A 1UWUA 3ZM8A 2J7EA 3GH4A 1DTUA 2J7DA 1FP9A 1CYGA 5E0FA 2WMGA 4JAWA 3ZJKA 2YLAA 4AZCA 4FNQA 3MMUA 4HA4A 3B9AA 3WEMA 1UZ1A 3PHAA 3VIPA 1PIGA 5CJ5A 4BQ5A 4HA1A 3DX1A 2V3EA 3K4AA 1QBAA 4AD0A 2BXZA 1PPIA 2CHNA 3VD4A 2OSWA 3MUY1 1CENA 3MV01 4URIA 2XGBA 5A6JA 3G6LA 5AC4A 3CUIA 1AVAA 3ZQ9A 4HTYA 2BHYA 1UUQA 1J0JA 3THDA 3WDHA 3GDBA 4BS0A 1GQLA 3K4DA 4PMOA 1Z32X 1JF6A 4PTWA 1HJWA 3MV11 1G9HA 3ARYA 1VFMA 1HN1A 1LWHA 3EDJA 2VZSA 2NT1A 2ZX8A 1N82A 3AHYA 4QP0A 4WKHA 4GO9A 2YLLA 5JBFA 3VD5A 4H2CA 3OGVA 4CN4A 2D2OA 1E4MM 2PB1A 2W4XA 2UY5A 3N1AA 1MW1A 3AYSA 2J7GA 2FYVA 1W2VA 5A2CA 3DYPA 4OJYA 4PCSA 3VIFA 4JCLA 1XV8A 3AMGA 3WF2A 3AISA 1I1XA 1OD0A 2VZOA 2D0FA 1C91A 3VIMA 4AD2A 1B3YA 3SCTA 5BXRA 4QLLA 1KCKA 1R85A 2UY4A 1JDCA 5C71A 3D4YA 3RO8A 2GJRA 2J47A 1OIMA 5CSUA 1E6RA 3CC1A 1NWRA 2J7FA 4OOUA 4W89A 1U2YA 1J0YA 2E40A 2VR4A 3F5KA 5I78A 4OOZA 3APGA 1OCQA 1XGZA 2ZUNA 5DEZA 3BXWA 1CDGA 4X9YA 3K8KA 4LYRA 3IGUA 1CXEA 2G3JA 5GPRA 3WQVA 3ZT7A 5CGTA 3CGTA 3AHZA 2W62A 4DUWA
chains in the Genus database with same CATH superfamily
5IIEA 4JG1H 4ABUA 1OGGA 3C09B 1EANA 2NUXA 4AQZA 3LZRA 4K8RD 1NDZA 5A3ID 1UQSB 1YLVA 3IFOB 1CZ8L 4QGCA 2ZZ5A 1WAUA 4ZFOA 1XLFA 4XTDA 3C2RA 2FHCA 2P52A 4BQ9A 3VZZA 2FFCA 3CUZA 5D4YA 4AHPA 1YA5A 3BAIA 4E4PA 2A6DA 4C58B 1HHHA 3ZIYA 1CFBA 1QO3A 2X8RA 2EYSB 3KH4A 4FTVE 4POCA 4CQAA 4Q4IA 5CIPA 1UR0A 1Z5HA 4DKFH 3SCMD 5CGQA 1Z1WA 4LE8A 3VFPB 2JI3A 1NEPA 3HZMB 4ZS6C 4MKMA 5FEZA 4DZBB 2R82A 3D69B 4JDTH 4P5KA 1CD1B 4XZIA 5GS2D 4FNLH 4UTJA 4LWWA 2XFFA 2ATPA 3IMRA 3AB0C 3WLIA 5HVGB 1XD0A 4LCWB 3MP5A 2J5WA 4JHBA 2VD8A 4RRPG 4NNAA 1JRHI 5G2NA 4UR9A 5ESQB 3BMWA 2O55A 4MYWB 4XNUH 5BS0B 1QUNB 2EKGA 1KWGA 4JQAA 5DK2A 4WNQB 3BVTA 4F8PA 1HKWA 2G60H 1Q9WA 2XTJE 5T5NG 1L6FA 3VI4F 1RAMA 3A67L 2H2SD 4DBEA 4ZUWA 4PRPD 5FK9A 5T33H 1TPDA 1W8GA 4H4NA 5I71B 2W38A 1E6ZA 1ZGDA 3QJHB 5C0AD 4AGOA 3RITA 3ZZQA 2E7HA 1UJPA 1HI6A 1L9SA 2VR9A 5GSVA 1NGZB 4YWGL 3M6YA 3NTCL 1CFQB 2DIJA 4IKJA 1VIZA 4WI6A 4MYPA 4K7PY 3BK0A 1BZQK 4CGUB 2XIIA 3AG4B 4FQ1L 3U48A 3TTSA 4FABL 2V2DA 3T2NL 3N1PC 5CBEB 3O0LA 1KA9F 3HZKA 3ATFA 4UYQA 1AW5A 3VB8A 5DD5L 4LNRB 1T7XA 5A2AA 2BFGA 3O3RA 3WUGA 2V2HA 2ZVIA 4JB9H 3U7VA 4TQHA 1FC2D 2DYPB 4AMKL 3AROA 2CFFA 5HHOA 1G7LA 4PP2A 3CNKA 4S1DD 1K3ZA 3P2DA 3HQNA 4MJIA 5CN1A 2FZ3B 1RLDA 2AQ1A 3VE9A 2BVUA 4X6DA 4KRPD 1V10A 4N2DA 3OMZA 4MTVA 3GSWA 4LCIL 5LXXA 4GG9A 2X28A 4YC2C 3O8AA 1Z9AA 4HB7A 4R85A 3P30H 4HZ8A 3BANA 5KITA 1DR9A 3ECUA 3WD4A 4JDVA 1RIUL 1W72B 1WXYA 4O02L 4OLYH 3GTFA 5BNXD 2X4RB 2DYRB 1WIOA 4GE8A 4RZBA 5CBJA 4AEOA 3KW8A 3TJIA 3OOQA 2BOFX 1JP5A 2IAMA 3EGXA 1M9WA 1ZT1B 5DF0A 4DYJA 5FW7A 2JJUA 3GY1A 1BQHA 1SSGA 2C6QA 1E3FA 2NCMA 2FLRT 4HMEA 3EOLA 1VPQA 3FB7A 3ARUA 5HVWA 3QHFH 1W5NA 4E2DA 4BUHA 1JCLA 1GYLA 2Q02A 4GC4A 1JNJA 3MSYA 5C3LD 3APMA 4GO6B 1YXCA 3KOZA 2R0KH 3QHTC 2GGIA 4IIZA 2DIEA 4K3JL 2X1RA 2FAUA 2OJZL 2DQHL 3H8NA 2WP3O 2Q7AA 1DCLA 2FZDA 3BKYH 4U1MA 2E75C 5DMNA 4YVNA 3PWVB 1DSFH 4GRLB 1QMUA 1RD5A 3GKWL 3HE6A 1GAFH 5CEZH 5LCVA 3M0YA 3LPPA 1E6OL 5F72S 1JGLH 3V10A 1XXXA 3KW7A 3MYJB 4QBXA 3MJ9A 3WDIA 1YC8A 1HOCB 1IM9A 3A4EA 3F3HA 4M5TA 4QEGA 2TMDA 4OZIE 4PJ5E 2FJKA 3P73A 3K6DA 3TH2T 1MW3A 1DIOA 3FCSB 4DKEH 4F4RA 1ZA3B 4KI5D 1MY5A 3RHWF 1X6UA 3BEVA 3LRMA 1OD7A 1FO0A 2CHXA 2R29L 2VDRL 4YMZA 5L8JB 4OH2A 1TPB1 4Q6IB 2WNZA 1LEKA 3MLVH 3QIWC 3TPUB 1E5NA 5SWZA 5TQ2L 4KCTA 1EHXA 3G5EA 3FTGB 1RPUA 5T1DL 1UP2A 1J0HA 2XN0A 3F01A 1R86A 5DUJA 1IU1A 3LRKA 4PGBB 4H01A 1RZGA 3M0ZA 4O50A 3WKML 3Q01A 2LVEA 3FS2A 5D1ZA 3GLCA 3NQIA 3EWCA 5D2NE 3LLXA 4GG6F 1N4XH 4FKHA 4MG4A 3MODH 5FWQA 1IM3B 1KN4H 2HRPH 3BLIA 1JBJA 4E36A 4JYFA 4GIRA 2DQFA 4U3AA 4HISA 5AZ0A 5ENWA 1WPCA 2F8XC 1MPAL 2BNUB 1ZLEA 3C8KB 1A4JA 1UENA 5FGCE 1GH7A 1OGAD 3OSKA 3PWPB 5DGQA 2I1OA 4C6FA 3FMGL 3GNRA 3GO2A 4GMTL 4H8PA 4DP4X 3WNOA 5LGHH 5CWSB 3KHQA 5KETA 1FSKB 4PV1C 1W72H 2G41A 3FT4A 1SJHB 1TR1A 4RNRA 1U41A 4MQ7A 4UILL 4KK9D 2B7DT 3QJSB 1ZPUA 4NT6A 5I2UA 1NDGA 1YNPA 5GS0L 3AS1A 3AQYA 1SU5A 2MEJB 5D1QE 1A7NL 3IYLW 4V1XA 3DX0A 2DQUH 1AYOA 1MKFA 1YTKA 5AZEL 4URKA 1U92A 4MFHA 2YZRA 2G96A 4LYPA 3EYFB 3BUBA 4NXKA 4YYFA 1XBRA 3TBWA 4GA8A 5G5IA 4AISA 4HSCX 4CBPA 3IN0A 4KK5D 3GTXA 2VXTH 1GW0A 1KLGB 2WB1A 4WWPA 4KNTA 2LVCA 1GNXA 4EIBA 1FE8H 2QLVB 2A3HA 1LE9A 3SO3B 3VD7A 2GGJA 4GABA 1LJYA 4JTRA 5I1AB 2DZBA 2I5YH 5KYUB 1MWAB 1IC5L 4XPBL 2NXZB 4NM8L 4M56A 2PTXA 3MANA 3QZOA 5CZXD 2UZIH 1MAML 1AGBB 2J73A 4LFYA 3N9SA 2HSIA 2B9BA 6REQA 1ZIBA 5I9QC 3WLSA 1I8IA 4B50A 1BXAA 3QFGA 3N1FC 3RPIB 3BT0A 3KM8A 3TBBA 2ED7A 5EO1B 3DRQA 3V0AC 1SDAB 2UYLA 2A74C 1RU9H 1IUZA 4MFEA 1HNYA 4C6PA 2BH0A 4Q9CA 1N2RA 3MV8E 3QUKA 1YMMB 2XINA 1IE5A 4J40A 5DJCB 4DGIL 1HK6A 2C15A 3WIHA 3OX8B 1OO2A 3UBGA 2C79A 5E00B 4JHMA 4NHCL 5TTRA 3PBYA 1JZFA 4HUVB 1RH9A 1I8LA 3PUCA 4EXBA 1WDDA 1DLFL 5AYZA 2O5YH 4KTGA 3RUGE 1B3VA 1G1CA 3WE1A 4WY7L 2VXUH 3AY4A 4NERA 1QSZA 1FRGH 3OL2A 4QHLB 1FGVH 3JTTB 4FIRA 1J9CT 5LLIC 1O12A 2NZ1A 4R6UA 2JF1A 2REQA 5C08D 4YEFA 3Q58A 4HOMA 4NO3B 1OVDA 1T7WA 1KBVA 4GNKB 3K2KA 3HOJA 3D85D 2HJFA 1Y1DA 4JO4H 4AXWB 3ZTDC 4FYSA 1HILA 4QXIA 2WVUA 1UT2A 3QNZB 3QY8A 4LLVA 4Z3HA 1IWPA 2TODA 4P07A 3QI9B 1TVLA 2BHUA 3LEXB 4L8BB 2XDHA 3KBFA 4KI5E 4Z3TA 1ICQA 2XSXA 3WLOA 3KL5A 3HAEH 4RDWA 5TF0A 3ONCA 4P06A 5JMOC 1LP6A 3R10A 4N0FB 2XA8H 1EJ7L 3EWXA 5AFDA 4FQ2L 1UC6A 3TEYA 1I53A 5DURB 4HJWA 4V1DA 4NO0D 1YEFL 2P0IA 3UJIL 3FU9A 1JK8A 1YN6A 2YPKA 5LNSA 5I1GH 4DIAA 4RWHA 3PPHA 5C92A 3CFKB 2XPZA 1KUMA 4IRSD 1CDIA 2WYTA 4AKOA 2KLRA 3ESPA 4J3OF 6XIAA 4L4VA 2WCSA 3UYIA 4O2CB 1JAEA 5TFSL 5IRPA 4ODXB 3P4OB 5GJSL 2P5WA 2N7AA 3G8EA 2WMIA 3LRHA 5KSVB 4AXKA 3VTAA 1Q6DA 4D8OA 4JO2L 3L0GA 5IEHA 4GSUA 4TQEH 1ZLWK 1MWAH 2R2CA 2ZCGA 1HO4A 1F74A 3PY9A 2OLHA 1UD3A 4WDTA 1QLEL 1O6TA 4B3ZA 1OGAE 1W0VA 1S1PA 1FVDB 5F97E 3W7OA 1OD8A 2IH8A 4OCWH 3LENA 5D1QC 3WDQA 4XMLH 4BQ8A 2D7MA 4JFHE 2G37A 3VABA 3EWUA 3TZVD 5D7IA 5ABEA 3VACA 1ICSA 1L6YA 1AH0A 2K7QA 4PJ7A 3GNXA 4FQLL 1B4KA 5JIIA 3KFTA 4F8OA 4NBXB 2VFHA 4US5A 1ZALA 5CBBA 4Z7WB 1GIGH 1Z48A 2BP3A 2PBGA 2PYFA 5L7XL 1KY7A 4NX0A 3SDXA 3JV5A 2E7LC 4R7OA 4PJ9B 3QXAB 2ZWNA 3C60C 2YIHA 5HGHB 5HDQL 2FZ8A 3KYNA 4XVUD 2YD2A 1VFFA 3DI0A 4HDIA 1XI3A 5BW6A 4YVPA 1BTMA 2J8UE 3OGOE 1HJBC 2FO4A 1KQZA 4S3JA 4IPNB 4RA0C 1S7UA 2PP8A 4AVOA 4AEFA 5CG0A 5FCUH 3PAVA 4QYOA 1IAIH 2EEDA 2OMUB 5DJYA 2B3RA 5DR5L 1MCOL 3MKKA 1V77A 3NZHL 1S7SA 3EYUL 1KZYA 3CFDA 2GK0A 5BRZA 1AJZA 3VRIA 3C0LA 3QHZL 4RMBA 3HVNA 1KCSH 3U0WH 1FZKB 4HWNA 2X5PA 3S0PA 2OMNA 3GFZA 1TTRA 1VJZA 3ASWA 3P3UA 3UETA 2HKHL 2QL1A 4HP5A 4XP9H 2B4CH 4EN3C 5DO2D 3V36A 3MXVL 5LXGL 3LHYA 3QDHA 5C09E 4BUGA 2HE5A 5EZOH 4M3PA 4ERSL 1EJOH 1QDSA 4K8HA 3B2PA 1R24B 1Q9KB 3EYVA 3VGBA 1SOSA 1OSEA 3UCDA 5BXSA 3ZDYE 2JIEA 1U36A 5E5CA 1HKLL 1TX0A 1JPDX 5J6HB 4FZEL 3Q1SH 1LO4L 3QEHB 5EF3A 5C2XA 4L37B 2QCCA 2DSVA 3ZIZA 1AQKH 2IV9A 4C4BA 4DZ5A 5AW6B 5ADOH 1HYRC 1E67A 5JHBA 3KH3A 2NY6C 3RWCA 3LKNB 5C08E 1ML0A 1GSMA 1JI1A 1XC6A 4OGYH 3RPBA 4OGAC 5FV2A 5HJLA 4ODWB 5GIRA 3ULVF 4GUQA 3P5YA 2CIIB 1DBAH 2FB4H 5KBDA 5D1XC 4FXFA 4NKIL 4K5LA 5JH2A 2Z9TA 3ALFA 4XCNA 4U28A 2Z1KA 1C5CH 4AM0Q 5K9JH 4HIBA 3HBPA 3WLMA 5DLCA 2YBVA 3FKUS 4HD5A 4MA3B 3L54A 1JGIA 3T8MA 5JW4N 2VYOA 4DP6X 1RK6A 3L7RA 5FJUA 1GOKA 4YXKL 3PQYE 3STZB 1ZVHA 1OF8A 3EFOA 3DGBA 2VGIA 3UTZA 3JZUA 4N9GA 3MGTA 4EZJA 3DOHA 5HYSA 1JG9A 4XHJC 4A8IA 1MZRA 5AECA 5AW2B 1NFGA 1OINA 1QEWA 3M88A 3NPXA 2YD6A 3FSTA 3BH8A 3T9WA 4NRXA 5TD4A 2E27H 3KRSA 4KHTL 1UROA 1UM5L 1P7HL 4QXTA 3KRUA 3A6CL 4WSJA 2MCG1 3Q6GL 2FQEA 5M94B 3PZUA 2IDSA 3VXTB 4MUZA 2PR4H 2WM0A 3BUTA 4KAQH 4NC0B 3MOBL 4UTWA 3DVFA 5FAAA 1HKVA 2CRYA 4L6OA 2Y7QA 4DGYH 2ISWA 4TNFA 3VRJB 5BRPA 2OMAA 3VGAB 3WUBA 4F7EA 3CZEA 2D8KA 3BLOA 5CZRA 5JXAL 2Z2UA 3AXKA 5EOCJ 1FVCA 3XIMA 4F8NA 3NL3A 4UTAA 2J56A 1AOHA 4FKEA 1MH5B 1R5VA 5F9OL 1NFKA 4RESB 1XHGA 2QYGA 1YDNA 1G9MH 4M5ZL 2PXYB 1PZAA 2ZOKB 2HXUA 2P8BA 4OI9A 5JPMB 5D6DA 3SY1A 2JV6A 2G4GA 3IFNH 2V2TB 3GMRA 4G6JH 2AZUA 1D9KD 4Q9BA 3MUXA 3FCTB 4HWEH 5EBLB 1OJXA 4N2BA 1QNPA 4PP1C 1ZA6B 2VZ1A 3Q6FA 1SDYA 1MHPH 5H4ZA 2A9NH 1J8HD 3DX2A 4O17A 1VRDA 4ZW8A 4AGMA 4R2GD 4JY6A 4ZFQA 2C1OB 2V6AA 4FEIA 1FP9A 1YN7A 1FG2B 4NQCB 3WEMA 1JE6A 2CDGA 3N29A 3MP3A 3NQAA 4QSFA 1TO5A 1QBAA 2FVLA 3AALA 2WBXA 4ADTA 2QDWA 3C8DA 3RVWC 5A5WA 1SUXA 4I5XA 3G6LA 1SVDA 2HMIC 4POZD 3AREA 1XKJA 1OF0A 4HHMA 4XBJA 5DD3L 3RLHA 3NYZA 3FTZA 5GHWL 2YQBA 4ORZC 1LHZA 4GACA 3ZTJG 2OGJA 3UW6A 4PBXA 3UWVA 4JTGA 1U1HA 3OKKA 2WO2B 4JR5A 4AYEC 1OD0A 1F02I 1AH3A 2Q8ZA 4QTHB 4G80A 2CK0L 4BE5A 5BUPA 1AO7A 2ODIA 1JUEA 2ALDA 1CDGA 1J9RA 3KJ6L 2TYSA 4LMQI 4UT6H 4A55A 4H88H 4WFED 2YARA 1T96A 4RZKA 2QCEA 5IB3B 4R90H 1DQQB 3KLAA 4Y4KB 2P5EB 2YAEA 4N8CL 3NVDA 2EUWA 2EDXA 4XZUA 1JK9A 2UZYB 4JIPA 3KCPB 4KJWC 2XH0A 5F71A 4LSSH 4LRNL 2NY7H 5AKQA 2BW5A 4KEMA 1ANUA 3VCLB 2J2ZA 5J57B 4X7DC 1NEYA 3WF4A 3BJFA 4TUOA 4Y9AA 1SDDB 4UM9A 1GK8A 5KVDH 2PD9A 2RCSH 4I1PA 3N4EA 3OQEA 4GIEA 4PJEB 2P76A 2WXNA 1SFSA 1IKNC 3X1EA 4BI5A 3TT3H 3ILDA 2AKRB 3IKCB 1IRAY 5F1KC 2P44B 4HNVA 1OIFA 5D2YA 1GOOA 1TJGH 3BZ4A 2ZKXA 4NN7C 3CDCA 4RNIA 7PCYA 4APQA 4E5XG 3LDVA 2BIMA 4WHTB 5I0XA 5KTEL 1Y18A 2W65A 5GGRY 4R7WA 4BF7A 2VEPA 3DKJA 4JXCA 4XG1A 3JXAA 3OAZH 4PJIB 3LXUX 4EDXA 3I7QA 2OMTB 4IWWA 1I1AB 1T0NA 4P2OD 1PKQA 1T4KB 1X5LA 2B1HH 1AR1C 3WTSA 5TQ0H 4AD5A 4WHBA 4LANA 1EJRC 3VW3H 1F4AA 3CV6A 1XC4A 3RTLA 1F11A 3VXSA 1AH4A 3WD2A 1GUVA 1OF6A 1NGQH 4XC1L 4DERA 1ET7A 3ABQA 3CPLB 1MNUH 1DBBH 1WC7A 2Q8AL 5MEND 2WNKA 1FWGC 4OGXH 3UY7A 3IAPA 2R9RA 4UOQA 1R34A 4E6MA 4K3DL 2BOLA 3EXLA 1TQXA 4EE2A 3MGOA 3U6XS 2EILB 2ITDB 4WWKC 1INEH 2VH5L 4P46D 1X44A 2HG0A 4WI5A 3AAMA 2PO6C 1DWAM 1RJRA 4Y16A 9PCYA 1I8AA 1F2XK 2D3LA 1N59B 3W88A 3HGJA 1ZIAA 4Q4PA 4Z8FL 5IF0B 3NOIA 4Q9QH 3NJVA 5IQ7L 3T42A 2PTWA 4ZUUA 1MI5D 1QHOA 1CFMA 2GSEA 5TDNB 3KPSA 3G04B 2WKLA 3G2GA 2IS7A 3KXFE 1X5FA 4JG0H 5AOLA 4JFDA 3GW0A 5JUVA 4QXGL 4X98A 1PJWA 3BD4A 2FEEL 3DAQA 1HJUA 3EW3B 4XNYH 1QQDB 4PUDA 1J48A 2FVMA 4J3OC 2BP1A 1DN0B 4IICA 2G3IA 3CHXA 1CMOA 4LLAA 3WNMA 2X6UA 5DK0B 4BCZA 4GAGH 3E96A 2H3XC 1A3LL 3WG7B 4JN6A 1RL1A 1E71M 2FT7A 2QF7A 2L8AA 2ZZ1A 1K4CB 4RMTA 2J7HA 4MIMA 1QW8A 5E8PB 3TL5A 3OW1A 5KSUB 4UI2A 4NILA 4FC3E 2O93L 1I3RB 1AMKA 4XVSH 4FFYH 2YPLD 4HFUL 1GTHA 1TPC1 3VFGL 2I9LB 1M05A 2ZXAA 1CGSL 3SPCA 1FAIH 1FWSA 3WBYA 5E6UB 4JL1A 1CFVH 3AQXA 1ZJAA 3GIVB 1YEIH 3SR7A 4NZDA 4B3LA 2E9LA 3NJHA 1WV7T 4RFNC 4PU2A 1IZCA 4LP5A 3U4KA 3HPAA 3UTTA 5KJ4A 2ZXQA 3TZNA 1XDJA 1TVDA 3QXTA 1IL1A 1TB3A 1N64L 1YQ2A 1NCTA 1AOZA 2CLZA 5D7LD 3FK4A 2AHIA 2WBJC 2YSSA 4FTDA 5BZZA 8PAZA 2PDWA 4YL9A 1EA0A 1ZBWA 3GQYA 2CR6A 4NZUH 4F2MA 1MF2H 3WG6A 2OTDA 4Y8DC 1UJ3A 5IR1B 1SXCA 2GY5A 2NY5H 3H4WA 3PJLA 5KZDA 1BMGA 1DPMA 1GVOA 2AV7B 5FOBB 2CKBL 1NM9A 2HH0H 1W0MA 5DTFB 4QOKB 3M8OH 3WHXA 3OJ2C 1IBHA 2A0NA 3B8YA 4Z7NF 4JQ4A 3DNKA 2AQOA 3AWOA 1DUYA 4MOZA 3TLLA 3W1RA 3RILA 4F8LA 1ETJA 4N1EA 3AS3A 4MYXA 5ABZA 1TKKA 4E41B 5MERB 5HPMB 3R2GA 3BSMA 4RZ5A 4HIJA 4P4RB 6FABL 1Q72H 4XAFA 4AV0A 1G4RA 5HGBB 1P1XA 5F9JA 2PYED 5CM1A 3QUGA 4G7VL 2Q7YB 3CHDA 3WQ6A 4OZFB 1RK1A 5IHSA 5DVNA 3UU0A 5AUMB 4KUCD 3TA4D 1B9KA 4LASH 5E23A 1KV5A 1NC4B 1E15A 1L0QA 2X0UA 3H0TB 2PWDA 5B7FA 1QPPA 4OTXL 3SCNA 3MCLH 1YVLA 3RGVC 3C09C 3MREB 3ZKMD 1DJSA 5TE4L 2ILLA 3CPGA 3S5ZA 1DJYA 4KQ4L 3SKOB 4N1CA 1YY8B 3UC0H 5SX5H 4OLVH 3GSOA 4H9ZA 3EOTL 2DLEA 3N43B 4TVUA 1AZZC 4QRUB 4OJFL 3VVGA 2Z93A 4UM8A 5D05A 5A6IA 4Y5XC 4W6YB 4R26L 1COBA 4I0PC 4PRWA 1YW1A 4MNGB 1YDPB 1U5JA 1BBJA 3JV0A 5DMJB 3ULVC 5B38G 3EEGA 3WK2A 2PEVA 2HT4D 4FFVC 1W37A 3EYOA 1KZQA 2J3SA 4MYAA 3FTWA 3QUZB 3B9EA 3L2MA 4OCRL 3RWDB 1UGKA 4IS6B 2J9YA 1ZHBA 5GRWA 1U8LA 4S11A 3T77A 2DICA 1XFPA 4BSWB 2FSDA 1GOHA 3QQ4B 1ND0B 5DHMC 1TWWA 3ELFA 4QGYA 3JBG7 3AO0A 5I06A 2CLRB 3CLEH 3EWWA 4EI6A 1M2OA 4OQVA 2XZ7A 4HLZH 1OK6A 3QIUC 2N1KA 1IJNA 3KXQA 1FH9A 3U2SB 4TUJB 4Y1AE 5I71C 3MROB 1BGXH 2VT0A 1YNKL 3WFHA 3DIVA 3MRBB 3TCEA 4XBEH 1OFPA 4L80A 3X1FA 3O2DH 3M47A 4NIKB 1PIFA 1EFZA 3ROLB 1Z42A 5IJKA 5BZAA 3F7YB 3SDAA 1R9XA 2Z4GA 1CIDA 1BFVH 3SGEH 4DZ8B 1HXKA 3H23A 1D7KA 1KJ3L 1T1WA 5DJXB 2A83A 3TROA 4GGBA 4LHUD 1T8QA 4DVRL 1XQKA 3E2VA 4KITB 3I85A 3IJSB 5CCKL 3CWNA 4NBZB 3W7LA 1YSOA 4H8HA 4E0CA 5C9ZA 5CR1A 3CXFA 5DHEA 1F9CA 35C8L 3DOIA 1PY4A 1FKWA 3OAUH 1MHEB 4JIRA 1W6TA 5FO8A 1WP6A 4NUPA 3CV5A 5KUKA 3EX3A 2ZWKA 4ZE5A 4F7CA 3N25A 3BN3B 3VKJA 3E0LA 2X2IA 1E2ZA 4L9YA 4DUVA 1ZTVA 4G8GB 3R12A 5E6ID 3W39B 3FVMA 4JHWH 1QBMH 1A5AA 3TWYA 1FJ1A 4UIMA 2Y07H 4OZFH 3V5HA 4CLMA 1XRTA 3D07A 5EZIL 3LMYA 5K1NA 1SXAA 1VFAB 1RUKH 4XP1L 3DFQA 4A63A 3NIDE 5IT2L 2EABA 5BMWA 2QPDB 3PJNA 3SY8A 4GKNB 2JKRM 4JDZB 1XWYA 2XTJD 4E2VA 1MFDH 3EB2A 3HQOA 3ZKXB 5I5JA 1I4NA 2X4TB 4CW1A 3WL9B 4YLCA 4ZB5A 3N2TA 2OQJB 4FO4A 5JNYA 2RALA 4L9ZA 3FYEB 3P54A 5F1UA 2D20A 1XCXA 1A6ZB 1PZ5A 4NI6A 4S3CA 3BWAB 3BP5B 5CJXA 4R0LA 1C5BL 3QRGH 1GHRA 1CGTA 4XVTH 2BB0A 3T2OA 4O5LL 2Q3AA 4G8FB 2KZKA 2ZYIA 4I85A 3GTHA 2E76C 5F96H 1AKJB 2UWEA 4AQAB 4ZTOL 2YCLA 2W59A 3D46A 2HVJA 3D39A 3MV7A 2ITEA 3UGUA 3CMFA 2WMHA 2F53B 4GW4A 3BW9A 1JHTA 4NNXB 3OLGA 4NOFA 5LNUA 1QRND 4X5XA 5E5MB 1OD9A 2X4UA 4LB4A 1IAOA 3MRMA 5AHEA 2X4NB 1CEOA 4HBCH 4MS6A 4FDWA 5AHLA 3PWGA 3L4YA 3E49A 4MX7A 3GXFA 3DWTA 3LAFA 4ZNCD 4UXDA 3WFCL 1E5YA 1E6PA 4HAKA 3B9OA 3BZJA 2JE8A 1FH5L 5HWMA 1NCBH 4Z2GA 4GRLC 2Y1AA 1TRDA 3UWYA 2AK4B 4ML4A 2NSXA 4GIYA 1TQUA 5D7EA 3WLKX 3WD1A 1A14L 4OCSL 2WNQA 1XGYH 2K6ZA 1AGCA 4M6NL 32C2A 4QRFA 3SKMB 3FNDA 3EAUA 4RFEB 2PWGA 4UMAA 3MA9L 3ZL1A 4IU2B 1AGFA 3S98A 3AT0A 4UQ3A 1KYDA 1KTCA 5GZOD 4TIMA 4DF2A 4NRZB 5I23A 4N0CC 4XIAA 1CLVA 4A7VA 2C1IA 43CAB 4YH6A 3BWZA 1QVOA 3QJFB 2VUKA 2OTUB 1A2YA 2H1PH 5F89B 2EEXA 3N73A 5HHMB 1Z9SB 3U4EA 5KBLA 5BZWA 1KSRA 2EDQA 2WUBH 4LVNC 2BXYA 2HDJA 3EX6A 1NBYB 4Z7NE 3L5XH 4GP4B 3HHSA 2R15A 4GG8B 4GXWA 5IM7A 1PZ3A 3NSFA 3H2OA 3TO2B 2LFEA 3O6MH 3QM3A 3KTCA 2ID5A 1U6AL 3JS3A 1WDQA 2Q3RA 4D72A 2DLHA 5BVPL 3NRPA 3LHVA 1A64A 1G4SA 4YSOA 1TG7A 1EDHA 4DY1A 3VNJA 4UIKL 4GOAA 2XV3A 2R1YA 4X8CA 4BFNA 2WXFA 4Q7NA 4D8AA 5BXFB 3V0SA 3LIZA 1I45A 4G8IA 4PJ5D 5DWUL 4Y4HA 3JWNH 4QTIH 1Q4NX 4MCMA 1A6TA 4N0RA 3KM2A 3QUXB 4QCEA 4LVDA 3F84A 3I3EA 1EERB 3QC6X 5GISH 2XN9A 5DD6B 4Q8VA 1FDLH 3ITXA 3FUNA 3CAVA 5C54A 5ISZE 3WD3A 3KR3H 2WWDA 1B0GA 5DQJA 1QKZL 4KDVA 3QFDA 5GS3A 4X4XA 2RFXB 4ICMA 2J8TA 5ALCL 3ZDZE 1A7BA 2VLJD 3V6ZA 3TC9A 1IE4A 3SZKC 1URIA 3OF6A 4A21A 1OSZA 2FR4A 4PRAB 1U8MB 3E2SA 1E4JA 4FNLL 3SO3C 1TE1A 4P8XA 4M0XA 2FJHA 3FJ4A 3L1OH 1T89C 1XB3A 3PZQA 4NQDA 1C7TA 3QEUB 3H4FA 4PJ8B 1UD2A 4NN5B 1T20A 2NXZC 4J7RA 4JZNB 3AFLA 1WT5C 3IIOA 1HHJB 4XNUL 3FKKA 4P5TC 4NX5A 4J3BA 1X5HA 5DYOA 2ZRVA 1ZS8A 4PJEF 4YDIL 1KFJA 1M6JA 2IBBA 1I1FA 4IG2B 3TN3A 4HHGA 1DSYA 4GRWE 5IQ9A 4F3FB 5IBUG 3KRZA 5JHLL 1MQRA 4PRRA 3KE0A 4LGXA 2RDUA 5J9PA 3WKZA 4TX6A 1Q13A 1GYWA 3FPYA 2Y2YA 3P3RA 3VXMA 2QJDA 4NJHA 5D1QD 4PJIF 2W0UA 4JTQA 5BVJB 4WUKH 3ARDC 4U1SB 3BFOA 1F3JB 1SQ2N 3S88L 1G1OA 3NCMA 3GDLA 2VDHA 1XLDA 3I7SA 4UV7L 3LBOA 1L9NA 2VX7A 3KGSA 5E94B 2NX9A 1QRNE 4KGLA 1DSWA 1NCHA 2EGZA 2ACSA 5JDSA 2FECL 4ZTXA 3SCPA 3WS6C 3RVXC 4OZHB 3R11A 4UT7H 1AP2B 4DNLA 4CCCA 2DAVA 2HVOA 3AABA 3I6GB 1UXLA 4JB9L 3LQLA 4FNTA 1DUZA 1V03A 4GRMA 4GXMA 3C60D 3PS7A 5DZJA 2X2GA 3G0UA 3Q43A 4GVFA 3F7PC 3BG9A 2CO7B 3H42H 3DPBB 4N6QA 4DJEC 2C19A 3RNDA 4M9OA 3QO1A 4JFPB 3TN6A 4XO5A 1MCLA 2VN5A 4Y19B 1R3RA 3TYCA 4NM4L 1A5KC 4HAFA 3E6EA 1XXDC 4Z2HA 1MZYA 5FF7A 5I26A 3UAAA 4LVGA 3PWLA 2IGFH 5JHMA 2H9GB 3MZ2A 3QI9C 4DAFA 3FOLB 3P30L 2HX7A 2GG1A 1J4EA 2WMPB 4F15B 3DSFH 3MV9A 4WD0A 4AIZB 1D3CA 2E4FA 1VH7A 4D6FA 1ZBKA 1RK5A 3FLUA 1OAYH 3MV8D 4BWWA 4JS7A 4DGWC 3MCKB 1HWGB 1LWIA 1YDOA 2CBPA 3QPQD 2X4OA 3S3GA 1IGIH 3A4JA 3AOFA 4GW5B 4R7JA 2JB6B 4F8QA 1YTDA 4I3RH 4Z2JA 5FJTA 5JDJA 4CC4A 3ULVL 2ZRUA 1H1NA 3RU8X 3VI2A 4HHAA 4GYPA 4AZ5A 4PRHE 5I1JH 1ONRA 2KHAA 3GRGA 3IGAA 1U3YA 1WFTA 4IJCA 3G1HA 1XMEB 3SBRA 3LKOA 3VOCA 5C70A 1C7SA 4NSKA 1KM0A 3P3TA 3HS0A 3Q2WA 3LERA 1WKFA 4Z0XA 1FORL 2IPTL 3M16A 4C56A 3ENEA 1EO8L 4Q3MA 2OM5A 2E6PA 3GBNH 2A6JA 3RFZC 4JJ5B 2FPYA 4XAPA 3P0WA 1AZRA 3LKSB 3ITLA 4AG4L 2NY6D 4LGSB 5CJ5A 3SJVE 1J87A 3FO0L 3K4AA 1KN2H 5IIEB 4M6AA 1JGLL 1W15A 2O61B 4TTDC 4URIA 5JQHC 5ESAB 1AVAA 2AQQA 5D1XD 1UUQA 1ZPTA 3H12A 2O7QA 3P6LA 3FUJA 2RQ8A 4NYYA 3FT3B 5A43C 1QRQA 1ETZB 1EP3A 1N82A 3UPCA 2YLLA 5JBFA 3FQXA 2P24A 1XLCA 4BH8A 5FUOL 1SY6A 3T0CA 3GVVA 4OJYA 2QJHA 1TSRA 2JQAA 4PJ9C 1E4KA 2VLJE 4XBMA 3OZ9H 3CC1A 2GK2A 5IHWA 1J1PH 5I78A 5GGQL 2DM4A 2H3NA 3D8MA 1M57B 5I1KH 5GPRA 2L7EA 4QHRA 3ZT7A 3AAZB 3RN6A 4EAEA 2ATPB 3ZDXE 1AK5A 2GHWB 3RX4A 4K71B 1FWEC 4FNRA 3SCUA 2BP0B 3FXGA 4DVBA 5BXTA 1W6WA 3CHPA 1CN4A 5FPIA 2ZTBA 2WQ8A 4NHUA 2ZE0A 3MODL 4FHBD 1UMYA 5IOKA 3HC2A 4X4MA 4PJCA 1LJMA 3K8LA 4DP1X 2XUWA 3IDIB 5AYQA 4IMKA 4L05A 2VQTA 3TO4A 3M0IA 4MZ2A 4GYJA 3U2ZA 5C0GB 4JFHD 4PWFA 3LLDA 1X5GA 2ZCHH 3SCRA 2GTWB 1PEZA 1UM6H 1HI6B 1W72L 5IBTH 3HAEB 1YPZA 1F8IA 1BAFH 4ANUA 1BF2A 1T1YB 3PABA 4LSUH 1HS6A 4PA8A 3VFRB 2XGIA 3BQ6A 4LSDA 1YC7A 1XIWD 1ZOXA 3B2DC 2DQUL 2X6VA 4H8QA 4OIFA 1NBZB 1MG3C 5B1AB 4JCWA 1LT7A 3EFDH 5EV7A 2R91A 2VDMH 1OVZA 1WB0A 4ALAH 1R87A 4X7SH 3JU2A 5I6PA 2XZCL 2OEKA 5BW7A 1TQBB 3FY1A 3DURB 4JKNA 4LAMA 3BPLB 4RQQA 4DWSA 2EH7H 1R3HB 5HHOB 2DSKA 3GG8A 3DJRA 2YL6A 2X6AA 3RVVD 3DIFA 1DBKL 3D7PA 1CF8L 1RK7A 4U7SA 1E42A 3RTQD 4L3EE 2BSDA 2WQPA 4DI9A 4XN5A 1D2OA 4JTHA 1FZOB 3U7WH 2HT2C 4U3SB 1RJYB 2Y5QA 1MLBA 4Q8PA 5F9WB 1ZHKA 1QTSA 3N6QA 1NCOA 3CAQA 3PUOA 2Z6IA 7TAAA 3TVMB 2DWDB 3ULSA 4JN1L 3VI4E 3QYMA 2FDSA 4AM0B 1HKIA 4PMNA 3CPUA 1VCBC 3WUFA 5ESVA 1QRKA 4B3KA 3WJYA 3K0YA 4KVCH 1KCZA 1FBAA 1UOWA 2ZPKL 3FN0L 3G5WA 3WTYA 1H61A 1G69A 5C09D 1FHDA 1ECEA 4NO5B 1J7VR 1PTAA 5ACLA 3MHUA 5BZDB 3S2NA 1QATA 2CDEA 3W1AA 1CI3M 3EGXB 5CIPH 1WXJA 4WQ6A 3G6JB 1DVUA 3NEXA 3MRDA 4UQ9A 1EO7A 5I8KL 4IBUA 2GZXA 4BV1A 1M2VA 1IEIA 3ZLQC 4MNMA 4C6NA 3RJDA 2QAPA 1BGGA 4XZWA 1NBQA 5TGBA 4HJGA 3TN5A 2D31B 3FB7B 1R5YA 3GAKA 4NF7A 4A7QA 1G94A 4PMVA 3I7RA 2L3BA 4OB5H 3G0SA 2FQFA 3OGSA 3RJQB 3VIHA 1FRBA 3IAQA 1K5NB 3MNZB 3OP2A 3A5VA 3EUUA 4FF7A 4KRNA 1MWOA 1JVNA 4XNZC 1ACZA 4A1RA 4UFLA 1I31A 5CZ0A 3AU1B 5GGVY 5DD1H 3VGAC 2VP8A 3PJXA 4KJWD 5DEFB 4FG0A 3KEDA 3ITCA 3H2WA 3DX8A 4HG4K 5FDWA 1OHLA 1KOAA 2EIZA 4ZFFB 2VZTA 4D6CA 4BELD 5D1XE 2PMZA 3P0XA 2ENPA 1R46A 3IJ9A 2W88A 5BOJA 5GNYA 5T1LA 1W8OA 3LU2A 3PQYD 5GRUH 3ZE2B 4OWGA 4DFHA 2CSPA 1NU5A 4NUMA 4OFDA 3BZ5A 3VTTA 4FQJH 4I9AA 1KB9J 3T05A 1TIUA 1H3GA 3FEMA 2D24A 2ZSVA 5ICXA 2XA8L 4AD4A 4G7SB 4POUB 4C6IA 4OFVA 1LO5B 1F13A 5J13C 3SRKA 3A0OA 4R5TA 3GLDA 3DDGA 1K6QH 2BLFA 4HPOH 4BD4A 4C90A 2EPHA 2QTEA 3KWWA 4H25B 2VN7A 4NQUA 1N2VA 5DFVD 2ESVE 5IFTA 2GUOA 2CBJA 2R0ZH 1EMTH 2XIMA 5ANHA 1XLGA 4W4QA 3G1AA 1BJ1J 2MTAA 3L3GA 4IUOA 2V9QA 4CNOA 1RURL 1EDGA 4AHQA 3GE7A 4GJ1A 4K9JA 3LNEA 2Y88A 4TQEL 1MWAL 3CSTA 5EPDA 1J96A 4BK5C 2HS6A 2IANE 5ENWB 1CDHA 4R7NB 4GX9A 2Y7MA 3IRDA 3NFNB 1IQDA 1MQKL 5C2GA 2CJUH 4FAAB 1U8HB 1QSFA 2GVJA 3RZCA 5C0QA 2E9IA 4XAYA 2Y61A 1MIMH 4U33A 3RBGA 3QTPA 3V5FA 1JCNA 3PNZA 5KSAA 2NLJB 2OA9A 3D2UD 5KYYB 3PBMA 2V5RA 4WWKD 4J1OA 3U1SH 1WAWA 1I1WA 2AANA 1GZGA 2OMWB 2JH2A 2E1WA 5I8CB 4PWJA 5CAKA 2F84A 2WNNA 3L7EB 2EE9A 1OW0A 5DCCA 3LNPA 3JT2A 1U92B 3GRIA 4GH3A 4J3UA 4MJ5A 4ZK8A 4NGHL 1BD2E 3NCYS 4Y4KC 2O9PA 3WTUA 1V6YA 4ZS7H 1DIKA 5E4OA 3PP4L 1VYSX 3VO0A 1KGIA 3FQ1A 3WGVB 3SJNA 4F33A 2YCIX 1Q0XL 3BVNB 3U3HA 3VXUE 3FC8A 2FGBA 3VWKA 3CN1A 3RFRA 1LE9B 3QLDA 4RW5A 4J3OD 3W84A 1OP5K 4WWNA 3UZEA 4L1LA 2R2HA 1WCBB 4GG6E 4BK8A 3RWJA 1W1VA 3UQNA 1IAIL 2VERN 5LCVH 2A99A 3PGFH 5FFGA 3N9KA 1QOXA 3SE4C 4R27A 2CC0A 4F9JA 2V2XB 1QNQA 3EBIA 6REQB 3KLSA 5TDOB 3UPMA 3RYMA 1B6DA 4AI7A 1I8IB 1NCAH 3IJLA 4BIKA 4EVNB 5GNZA 1TVBA 3MPCA 3VIOA 4JGNA 1NL0L 2PPGA 3HPZA 5GQBA 3DRQB 3H9HA 1UJTA 2X87A 2ICWJ 3W9EA 4RVBA 3VCRA 3DDMA 2OOFA 1QYGL 3SN0A 3QIBA 1TZZA 2CCRA 5HR7A 3H56A 1FO0H 3IUIA 1UWXH 4PB5A 3BPCB 1SLUA 4AT6A 3MJ8A 4ZQTA 3GYEA 1JCJA 2ANUA 1A50A 2NR6D 1EJOL 3VXPA 1EJXC 1V6VA 4DEUA 3C0SA 1BEYL 1EJ8A 1LYXA 2BSRB 2WBJD 4M9PA 3UG4A 4ADIA 1S6NA 3UBPC 3B43A 3VFMA 3NCEB 3V4BA 4TTGA 5LO7A 5DZLA 1FOBA 1P5VB 5AB0A 2WXHA 5FYJH 4IXXA 4HPNA 5ADOL 1GKEA 1CO1A 1IAKB 3X3GH 3U8GA 5DA0B 4FQXB 2C4FU 4GJIA 3DVIA 2YC1B 2XTLA 4MMYA 4OIIH 4EN2A 2A5HA 4OGYL 5AAWC 4ZTPH 2OR9L 3STFA 1V4YA 4GINA 1W5QA 5AAMA 2FB4L 1FXQA 2Y5TB 5DRZB 1HHIB 2XTSA 5F4XA 5EL1A 5EEWA 5HHXH 1GA2A 4HNNA 1HCZA 3AIWA 2HFEB 3OWEA 4FMKA 2WTPA 2JK5B 3S5OA 4ETQA 5K9JL 3RJXA 4LLVB 3RB7A 3QV9A 2C3HA 3FZUD 3PZGA 2JVUA 2BDNL 2XWTA 1EZUA 1BCIA 2HE8A 4LZKA 4RISH 4NDMA 2QEJA 4EOUA 4YHNB 4B5VA 3ZMEA 5JIHA 1S9YB 2JFCA 4O0ZA 3WJMB 4QDGA 3N42B 2P43B 4IOIA 1FVEA 2YOAA 4ZENA 4O13A 3KOXA 2YPKB 3SKJH 2APVA 3NDYE 2VIRB 3ZYIA 1OPGL 3UG5A 1JF1A 4TN9A 3T1FB 1OAZL 1LROA 3RGVD 4WI0A 5EWIH 3L17A 3XISA 3FQRB 3HTWA 5DI8B 4KT2A 4MVBD 5I1HH 4EKJA 1JRHH 2Q8LA 1ZXKA 2VCBA 2RMNA 5HMSA 3AIBA 4J39A 5C0BD 3L3OC 5C3IA 4MSSA 3X17A 1O66A 3E1F1 4ZUVA 5H37G 3BDYH 2WMIB 4L5FH 4L1BA 4S38A 1XR8B 5IEHB 3S1XA 4NIYE 3GQFA 1Q66A 4IDJH 2R2EB 1CX9A 1SO5A 4AB4A 4PB4A 2WWMC 5C9XA 1P84K 4JFED 3PAYA 5JBDA 3WH5A 4I0PD 1D5IH 1N55A 4OZHF 5EFIA 1QU4A 4MKTA 2GCYA 3IETA 4EO5A 3RZWA 4EUPA 4Q2ZB 1A7QH 5D7IB 4U4MA 4C1NA 5IJCC 3WAKA 3FT2B 4MWAB 3PJSA 2K4WA 3GSXB 4LCWD 3UGRA 4ADSA 4UTMA 4PJ7B 4UTKA 2VDPH 3NM3A 4KUZH 4LNYA 3E9AA 4QWWC 2F2HA 4XMZA 2PGRA 3PP3K 3UBXI 3KXFD 3V3WA 1H3UA 3ECQA 1FNEA 1DJGA 4TOYL 3WIHH 4E5TA 1B4LA 3DCPA 1BQRA 3L3KA 1K70A 3UDWA 1K5WA 2EDBA 1DQWA 4L1SA 2EH8L 4Q8UA 3QIUD 1M7DA 3HMCA 5F7HA 3RHGA 1V7NL 4P9ML 3ARGD 1VCVA 3TBYB 3AZSA 4GFIA 2E09A 1BJMA 1SW3A 3LH8A 4AAJA 4JM4H 3N0PB 3TN0A 3ILPA 3L16A 2ERJB 3VXOB 2LW3A 3CFCH 1KC5H 3DO4A 4ZBCA 3CVDA 3I6RA 1EHLH 1T5XB 3SN6N 4ZPTA 5G4HC 4HUXB 3VH8G 4Z18A 5DMKB 1S7SB 1L5GB 1UUOA 1ZJIA 3CFDB 2AQ2A 3WXWH 4HCIA 2VWTA 3L0NA 2NDGA 4F93B 4BFIB 1HXMA 4L29A 4NFDA 4H8WH 4DN3L 3ETBJ 1Q6CA 5F7FA 3LEVH 4AKQA 1PFOA 1DZBA 3EJUA 2F5AL 2GJ6A 4F8TA 3WQ4A 3MHZA 8A3HA 2HAZA 4NLAA 3N44B 4ZZKA 5KYXA 1G1YA 3RURA 2G9KA 3BP6B 4GJTB 3WKQA 5J12C 1FCVA 5EA0H 1W3TA 3K2IA 4LDOB 4L8SC 3CH9A 4Z7IA 3RB5A 3GC4A 1TTIA 4GVHA 3NQ6A 4GZ7A 4FFZL 4JKWA 4Y4FB 4X7TA 1DVFD 5BMFH 1E1CB 4AGPA 1WA0X 4QDPA 1ES0A 4TVPH 5DXWA 2W91A 5A6MA 4U5IA 4PZVA 4IHCA 4R90L 4GLRI 4OBRA 4B9IA 1BZ7B 3FFCB 2CU9A 1DEDA 3I9GL 4DO6A 3DARA 3DV4B 5GS0D 2G5UA 1XYFA 1S7TB 1E0XA 2OZ0A 1KFLA 3BAKA 4QDMA 4G9FA 2ADAA 4HC1A 2R69A 4D7PA 3GSNA 1QJWA 3DHPA 4WO4D 2PD5A 4TNEA 2NY7L 3ZVHA 3GZOA 1NFIA 2XQBH 4WDIA 1EAOA 3QWQB 5C5YA 4NQ1A 3SPJA 2IXQA 3QUZC 2KERA 4YFLF 5IESH 1A6VL 3WD5H 1JN6A 5REQA 3W7JA 5KVDL 4XZBA 3TNMB 2YW3A 2RCSL 2Y7LA 1Y5WA 1BOGB 4O1DA 3F6IA 4S1QL 3KBEA 1T0PB 3IPWA 1QASA 2X89A 1FWDC 5FGBA 1H09A 1N7MH 4L4JA 1HVXA 3DFYA 3L1EA 2JBMA 2XFWA 1OM3L 2JI1A 4ZMPA 2P3EA 5CJQL 3UABA 4HU2A 2A73B 3OQ8A 3TJEL 4AVIA 5C0CE 5IVOA 4N9GB 1C12B 2P7TA 2JB5L 2Z6JA 2RJHA 4EIGB 5HYSB 3O8XB 3I9IA 2Y8UA 1AMXA 1U33A 3NIFB 4LSPH 1QEWB 5DLMH 4Q6JA 1MCWM 4YUEH 5IV2B 2QDHA 4NRXB 1Q8MA 3HC0A 4HEPG 1RHFA 3JTSA 5C0BE 4RRPA 4Y2DA 3CFJB 5DUPL 3FBKA 3AXIA 2ASHA 3E5PA 4GXFA 3VFVA 1KFKA 1C92A 1IC1A 2VFEA 5D70H 3AFBA 4A2MA 2BNJA 3WJJA 3RY6C 3QCVL 2G3MA 1TJXA 2PP7A 4HVBA 3CUGA 1UZDA 2UY7B 3DO3A 1B4JL 1EJTC 2V9RA 1TPWA 3NGBB 4JFEE 1UXWA 2ZCKH 1RPXA 1DIEA 2VDOH 4N0CD 1BXNA 2C8NA 3EYSL 2OLDA 5C97A 3ULVE 3KTXA 5SWSA 3QKZA 4C65A 3OAYK 3VK5A 3GHSA 5HUPA 3EX1A 5AD0B 3L3HA 3KJ4B 2ENQA 3DVNB 1FVCB 3DG7A 4RAUA 4L4PA 1XYMA 1PZSA 1M65A 1IFRA 4LCWE 3E3QC 3GO1L 4OD2A 2RUSA 4ZR8A 3BV7A 3WMBA 1DVXA 2E5BA 3GW3A 1VESA 3PHQA 4JEJA 4DQOH 4Q9QL 1MO0A 4NZ8A 4MMZB 5KWYC 3B0XA 3ZSSA 5BS0E 1BFNA 4MMXA 4GSDH 4UCFA 5KSBB 4KPHH 1IM3D 1EFXA 2HVKB 2G50A 3TASA 4Y1AD 1WFIA 2J13A 3QQ9D 5AW1B 2WXKA 2XX1A 4H26A 4H20L 3HTLX 3BQ5A 2HZHA 5GGRA 4MS8C 3OO2A 2J21A 1F42A 4P48A 3W9DA 4ZXBB 5F2LA 4XNYL 2H6OA 4U6HB 5C55A 4XN4A 1QFWM 1I8KB 2BC4A 3QH3A 4MDRA 4AZBA 3OJDA 4H8VA 3EKCA 3WBAA 3MLPA 1IXOA 4YDVB 3L5JA 3NO1A 5JIWA 1ACCA 5T9BG 4R4BA 5CZVH 3G6JF 1HJCA 4RAVA 1ECZA 4JPIA 1I7ZA 3C5JA 1KJMB 1PCSA 2HEJA 1KNOA 1JWUA 3F2CA 3B8WA 2XOTA 3OB0H 2X10A 2YAMA 4TLSA 3CV7A 4XVSL 3GEWB 4G7YH 2EUZA 3OYZA 1D5XB 4Y0GA 1CC3A 2HKAA 1LGVA 4ZS6D 3N85L 5DMIL 12E8H 1FAIL 3UERA 5KVEL 2FJFB 3SY0A 2R23A 1CFVL 2FD6H 3QPKA 2P45B 4P2RB 4NPYA 1XP3A 4M62L 2DQDH 2VGLM 3UBXA 3OA3A 4HK7A 2PWHA 2CZFA 2HT3C 4DEPB 5A2KH 4H5SB 4LVHC 4EK7A 1UB6A 1DJWA 4I7UA 4BK9A 4DQWA 1OK8A 4ZD3H 1PFCA 2OMYB 4P5TD 3RY5A 3UTPE 3DX1A 4ZNEE 3KGTA 3MA8A 1NFDA 3KLAB 3VXQA 3IF1B 2D2GA 4WGKA 4I3SL 1G6VK 4ZOCA 3LKPA 4X6EB 4U7MA 3OMIB 2DZSA 5H4YA 3IVTA 4CBZA 4MLIA 1G9HA 3IDUA 5JXEC 1TZIB 5K59F 2DQGL 1JNLL 4PJBA 3NQEA 3MRHB 5I6KA 4RFOL 1PWLA 5C07A 1U22A 3ARDD 3T0TA 5J3HC 5JO5A 4G6AC 4N02A 1C91A 4J8RB 4M48H 5TQLA 3V16A 5E99H 5CSUA 1NWRA 3DO7A 3U46A 5FF0A 4UTAH 3BXWA 1Q72L 1OALA 5HMDA 4APQB 1XCFA 2IBGA 1USQA 3RVXD 3AHZA 2W62A 1PHQA 4S1RL 2HWZL 2HWGA 3ZHLA 4H0IA 1NJ9B 4FR6A 2OZNA 1T0NB 4IM4A 1UZ6F 2Q76B 3ZVIA 4DXXA 5G2HA 2XNAB 3GR7A 4WKAA 4O16A 4DJDC 4B92A 1BAGA 4DJED 2J75A 2X7WA 3UC0L 1D7CA 5FCZA 3N04A 3LPWA 3QUXC 3F58H 4K3EH 4Q14A 5CU9A 2P8LB 1VFHA 2BVOA 3BE1L 4FLSA 4Z7WF 1I7UA 3THAA 4A7SA 1BSLA 4XCEA 4HPGA 1AG6A 4BFFA 5D04C 4D6DA 5I1CH 1CFTA 1KDJA 3TEZA 1UQZA 2J5LB 3GSUA 1NINA 3M0VA 5I09A 3UADA 4IGSA 4XWGH 3I6EA 3LIUA 1OG6A 3WS3A 4ZVJA 1YECH 3WUWG 3PUEA 1XX1A 3ZT5A 3AMCA 2WNGA 5DRNA 3CXHJ 4WY0A 1I3UA 1E28A 4FRWA 4EF8A 2X41A 5CCZA 3HRZA 4W9CC 4F9PC 3JUZA 1RALA 5D33A 1K9TA 4C5ZA 3KPNA 2C7UA 3K71A 4HHPA 4RXGA 2XRAH 5LG1A 3VSVA 3QQWA 4NN5C 4X5WA 2INFA 4J5VA 3UO1H 1GGIH 3I2CL 2NLIA 4JY4A 1H3PH 1MELA 3NNTA 1BZEA 2Y5EA 2JNZA 1P4BL 2BVYA 4EI5A 3KPSB 5D32A 1XTMA 3FRPA 3SGJA 5JOFA 4YDJA 4O58H 1A21A 2VITA 3KCWA 1U42A 3EG9A 5FR3A 4OM0H 3RRQA 1VDGA 4G8EA 3M7SA 1EXHA 2KYIA 4X98B 3PWPE 2NDFA 4KCVA 3S8WA 3INOA 2WLMA 4UUJB 2ZWYA 4PY7B 1ZSDA 3W2MA 4P4KA 4HIQA 5BQDA 2EDOA 3PHOA 3S6TA 1SO6A 3RWFA 1A65A 5TE6L 2KL6A 5LKYA 3TT1L 1XGUA 3O0RH 5EFFA 6TAAA 2COVD 1E8XA 4EJ1C 4TM9A 1K4DA 3KBVA 4DGVH 4GW1B 1GRWA 4Q7BA 4JZOB 5ISZD 1R9FA 4ZDHA 4ES9A 4Y89A 7REQA 3B6SB 4OT1H 1E4NA 4J8QA 2YN3A 1CTMA 3QIWD 2D0HA 1MJ8L 25C8H 5J0BA 4US6A 1E9PB 4UMGA 4EF9A 2UZ9A 3IRSA 1PG7L 2YDSA 3S9ZA 4FGMA 4CCZA 1TRIA 3BUVA 4F7MA 1KFWA 1LL4A 3S42A 4NJAH 3R13A 4JHWL 8RUCA 5HNUA 1J1XH 2Y07L 3NJGA 1YADA 4L1WA 2X1QA 3P84A 1P0NA 1HWWA 5C3TA 3GUWA 2BVDA 5CSRA 1RUKL 1IL1B 3WBDA 2YMOA 1RHHB 3B4YA 2AGJL 2DQIL 1KXQA 4HIHA 2QQNL 2A0LC 4PUJA 4UQ2A 4ZW5A 3SW6A 3ALGA 2GGGA 3T08A 3E2QA 4B9YA 2EJ1A 3FU3A 4F15C 1FI8C 1UJ3B 2WUCH 3LMZA 3BH4A 3HFMH 1CBJA 4MB3A 3BVDB 3PTDA 2PSNA 2ZTJA 2I07A 5I76A 2BJMH 4XVTL 4PWHA 1JPSH 4KTEH 2WPBA 3BOVA 3QJAA 3GGWA 4ABVA 4OM1H 5IFJB 3DKLA 1M03A 5GXBB 1IGCH 5TE7H 4QGTA 4QXUH 4P2CG 3N42F 1YMME 4D9PA 1YEYA 2F8VA 1F8TL 3MT1A 2VQ1A 3P4MB 1WTGT 2GFBB 3K72B 2GPTA 2DLTA 5IREA 1I4FB 1JCVA 2YW4A 1CFNA 3IWUA 1CZ1A 3S34L 4YHPA 1H11A 1NWUA 4RDZA 2HXTA 4QR6A 3HMWH 1XLLA 5IQMA 5MEPA 3U30B 4HBCL 4HS3A 4LVFA 2AXGA 2P88A 4X61A 3KYKH 3PGCA 5LGZA 3O6LL 2EINB 1OADA 5F1IA 2ZVRA 3ZDWA 2XWBB 3WE6B 3M45A 4P7RA 3LRLA 2IVFC 1NGWA 3Q2DA 3DH7A 1JULA 3TIEA 3T4CA 2H45A 2D2JA 4LLWB 1J93A 3EO9L 3BWWA 3E02A 1EAJA 3BVUA 1MSPA 4D0CA 4TLTA 2QVNA 1DQML 1FBIH 3CHRA 4BF9A 4NBYB 2QGBA 1QEXA 3X11B 4GKZA 5DT1H 1PDKA 4EZKA 3G6AB 1R3LA 4JAMA 4H9YA 4I1NB 2VXVH 4G7FA 3DI3B 1EGMA 1E5ZA 3W9ZA 4MCYB 3NCJL 4Q6IC 3MUHL 3FB6A 4AYGA 2I9EA 2H8ZA 3ZO9A 5IY5B 3UPAA 4B41A 3NFSL 1U93B 4HIEB 4G43A 2FQIA 1BBJB 5F7EH 1XYLA 1LDPL 2DYSB 4KRZA 1R3JA 4Y8FA 3DXAB 2GLKA 4PRHD 3H1ZA 4M02A 2UWFA 5IZ7A 5MKGB 2MNWA 1NP2A 3TC7A 2YBTA 1ZT7A 5CQ1A 4S3FA 1JZ5A 3IU3B 2K70A 4NS0A 3AIUA 3E1ZA 3VFLA 3BRDA 3RAOA 4P5RA 3O2VH 4YBLB 4ZYKB 4QRAA 3T77B 1CLXA 5CPNA 1JNHA 3TMQA 5DFWH 4M7JH 1WIPA 4FL4B 2MOQA 1T7ZA 1A6WH 4P8VA 3HG1A 3D6NA 3O6ML 1MOEA 4EI6B 3LSOA 3AM8C 4HK6A 3SJVD 2D2CC 1FSKC