2WSPA

Thermotoga maritima alpha-l-fucosynthase, tmd224g, in complex with alpha-l-fuc-(1-2)-beta-l-fuc-n3
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
443
structure length
435
Chain Sequence
KPRYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNGMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Beta-Glycosyl Azides as Substrates for Alpha-Glycosynthases: Preparation of Novel Efficient Alpha-L-Fucosynthases
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE, PUTATIVE
total genus 152
structure length 435
sequence length 443
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wspA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wspA01
3O2LA 3B9EA 3VSVA 5FKYA 3AIWA 3L4XA 2ZUNA 2VT0A 4JHOA 1WE5A 2V5CA 3WEOA 4AD1A 4E2OA 4H7VA 4F9JA 4OIFA 3NSMA 4EAMA 2VQTA 1EHAA 3WD4A 1KXTA 4X0VA 1Y7VA 3MV11 4QLKA 1UR4A 3OLGA 2YL5A 3HN3A 3ALGA 1QWNA 2OSYA 3CZJA 4TTGA 2VVNA 1E0WA 2VNCA 2IUZA 2UY3A 1F4HA 3TTOA 4DUVA 3KL5A 2WCAA 3SUSA 2CYGA 1JDAA 2BY3A 1QI4A 4D6HA 3LXCA 1V03A 3ALFA 4FNSA 4WLCA 4RE4A 4C7FA 3HG2A 1UR2A 3AIEA 4F8XA 3DHUA 3EJQA 2ZUVA 5BROA 1BYBA 2O9TA 1BVZA 3CUGA 4CVWA 3SCVA 3LPFA 1C91A 5CSYA 1UWRA 3U7BA 3OLIA 2UY5A 1A3HA 4JL1A 4MAZA 4UQ9A 3GBDA 3S5ZA 1V02A 3AXXA 3EYPA 1TVNA 5ECUA 1M03A 3N15A 2NSXA 2YL8A 4JIEA 4ZXLA 1RP9A 4CUCA 3OIHA 5DEZA 4TX6A 5M3WA 1C92A 3I3DA 1CDGA 1JXJA 3VDBA 2DT0A 4WK9A 1CIUA 3BAIA 3WQWA 2DEPA 3CMJA 2J7DA 4UR9A 2G4FA 1HIZA 1FFQA 2XM1A 4F9DA 1VEOA 3T2QA 3EJTA 2GSJA 2OW7A 2PBOA 4TX8A 1XV8A 1V02E 4CD8A 3AI0A 2X0YA 3ZSTA 1HKMA 4PMOA 3A23A 3PZGA 3S6TA 2F2HA 1XH2A 3LRLA 2WHJA 1ITXA 5I3DA 1VFOA 4ZEPA 1KBKA 2WMJA 2D22A 4QLLA 5A6SA 4K68A 1J0IA 1EH9A 2O92A 2DSUA 4D6GA 1JYVA 4WJXA 4Z2GA 1HNYA 3LXAA 7A3HA 1UD6A 1BF2A 3PZMA 2O9PA 5IXEA 4LQ1A 4CKQA 2WC3A 3DECA 4BQ2A 1MVYA 1JDDA 2WK2A 1WCGA 4J3WA 3MV01 1VBRA 3T2PA 2WSPA 3AS0A 4FNQA 2HISA 4IISA 3DDFA 4RE2A 1J18A 1OWQA 1GW1A 1R34A 2VJXA 1DHKA 4CU8A 4H04A 4S3JA 4P7NA 4D6IA 5E0FA 1W3LA 1KCLA 3ZT6A 1NOUA 4ACZB 1CGVA 2YDRA 4AIOA 1H49A 1OB0A 2FH8A 5AYIA 1HJQA 2EPMX 1SMAA 4JFWA 2YL9A 1GORA 3ARTA 5FL1A 1OCQA 2OYMA 3CHFA 1E43A 1H2JA 3VX0A 5BYWA 3LPOA 1UH3A 4HMDA 3IAPA 2BXZA 3WF1A 5E6ZA 5A2CA 3VIGA 3ARPA 5KZ6A 1XC6A 1H1NA 1VFFA 3CUHA 4OBRA 3ZM8A 2E9LA 5A3HA 4PN2A 1MFUA 3BAJA 1KR0A 2VZUA 1KCKA 1SYTA 4GZJA 1WO2A 2XN0A 1KWKA 4PTWA 2EPLX 1TQWA 3RM9A 3D5HA 3RJYA 4M29A 4AD4A 4FK9A 2OLHA 4CD6A 1ISWA 1C90A 3BAKA 1B3YA 3WQ4A 4BA0A 2DSKA 3VX1A 3WH9A 4DUXA 5A6JA 1CXHA 2ZUSA 4YN5A 3K4AA 1UG6A 2XJ7A 2YDSA 3N1AA 4MNMA 1G1YA 4DUWA 1GOQA 2ZICA 1QHOA 4AIEA 2WCGA 1FH7A 1OD0A 1LL6A 4FNTA 3GXPA 4AZCA 4LGXA 2WVUA 1W9XA 1TE1A 4MB5A 4D6CA 1BSIA 2YKKA 1K9FA 4HP5A 4W8BA 3PZOA 3T0AA 7TAAA 1CGWA 4WSKA 4MDOA 3ZQ9A 3VGDA 5A6BA 4HMCA 2A3HA 3AS1A 3H54A 1ECEA 2DPEA 2BXYA 1DWGM 3FHQA 4W5ZA 3WH8A 4B15A 4AZHA 5IHRA 4FMVA 3WF0A 3IJ8A 2WZHA 4Z2HA 4P8WA 1UR9A 5CG0A 3NUKA 1KFWA 4Q7NA 4OOZA 4HA3A 3DHPA 1CTNA 2XWEA 1WP6A 1EOKA 3KE0A 3OLDA 1FH9A 2YFNA 3WUBA 4AZGA 3AS3A 6CGTA 3W25A 2WANA 4HZ7A 4PMQA 3TV8A 5CZKA 4CVUA 1US3A 1J0ZA 3WEMA 3N12A 2VVSA 1BG9A 4LYQA 1YHTA 1XH1A 3TTYA 2YLAA 3KEHA 4P7OA 4WF7A 2WVSA 1PPIA 2BY1A 1BYCA 4U2ZA 5CXPA 3VGGA 2ZWZA 3PN8A 3WQ5A 3WY2A 2XG9A 3AICA 2EQDA 4GXPA 2WMFA 5ABFA 1C3FA 2ZIDA 1CNVA 2OSWA 4U31A 4FNPA 4JKKA 5D4YA 2PWGA 5DFAA 1QI3A 1R85A 2WSKA 3BUPA 1DWHM 4W5UA 1ZB5A 5A6BD 4HU0A 1RP8A 2FH6A 3WNPA 1JG9A 2PWFA 2DQXA 1C8XA 3BH4A 3GNPA 1KTBA 1OT2A 2C7FA 1CECA 2EBNA 2ZXQA 1R7AA 4EK7A 5ABEA 3EDFA 1QX1A 1JYXA 2FGZA 2XTKA 5ABHA 3VMPA 1W3JA 1GNXA 4LYRA 1OGGA 5AY7A 3N18A 4ML4A 4W7UA 3WL0A 4H8HA 2D24A 3SCNA 3WUFA 4JFVA 4D6FA 4XZWA 2ZWYA 2A3CA 1LJYA 5BRPA 1ZU8A 4QAWA 3NIYA 2F18A 1MW2A 2Y4SA 1QOXA 4V27A 2DIJA 4ACZA 1DWAM 4KMQA 2G3NA 5LA0A 3MU7A 1KXVA 2BVDA 1V6VA 2D73A 2YA1A 3WDIA 4MJ4A 4QDMA 3BUQA 2FDMA 1TQTA 5ABFB 2WYSA 3BXWA 2BVTA 5E1QA 3TTSA 2WMKA 4BQ3A 4UQAA 2QPUA 1CBGA 2DH3A 3B9AA 1UWUA 4KGJA 2GK1A 4OJYA 2EADA 1RPKA 5E9AA 1GOKA 1WDRA 1KGXA 1NWUA 2V38A 2MANA 1H0IA 3IJ7A 3GBEA 3AZRA 4PSRA 1OBAA 1JI1A 3LPGA 3KLLA 2G3JA 1EOMA 2A3EA 4P8XA 1CENA 4UFHA 2W66A 3WQ6A 3FAXA 5DF0A 1YQ2A 1IZKA 4DWSD 4GPNA 2VOTA 1J01A 2EEXA 2Y8VA 1QBAA 1UYQA 1XD0A 3AIQA 1E72M 3OZOA 2F7OA 1P6WA 1UWTA 2XM2A 2J7FA 5I0DA 3DC0A 4MADA 2XSBA 4ZXOA 1CGTA 1J12A 4RL3A 3A47A 3WMBA 1EXPA 1E5NA 4FLSA 1QNQA 5JBDA 3ARZA 1FHDA 5TD4A 5A6LA 4FLOA 2Y8KA 3AS2A 3T2OA 4MTVA 3CUIA 3MKKA 1LG2A 2X05A 3VSUA 2CBVA 3WUEA 4KWUA 2XGIA 1FA2A 1J0JA 3L2LA 4NZCA 3VGHA 3APGA 3OLEA 4AYGA 1D7FA 3UESA 5C8BB 3W28A 1VBUA 2EACA 4NRSA 1DEDA 2PF0A 3ARWA 1XSKA 1HJXA 1UKOA 2G41A 3RDKA 1GQLA 3EBVA 1V0LA 2YFOA 3ZJ8A 1PEZA 4D6EA 4XV0A 3BC9A 4MNJA 1JZ5A 1E5JA 4LX4A 4PMZA 1XHGA 3THDA 1V6YA 4OUEA 4LYPA 2DSZA 3QHMA 1BHGA 3BCFA 4ZENA 1UKSA 1XSIA 1E6XM 1JAEA 3DX1A 3CUFA 5A8PA 2YOCA 4BCEA 3SCTA 3VKKA 3PZQA 4M82A 3RIKA 3LMYA 1E1FA 1G94A 3ARSA 1ZS2A 3CZSA 3IGUA 3VNYA 3WQ8A 4DO6A 2F7RA 3EMQA 4HZ6A 4UTFA 4FNUA 2EPKX 4AEFA 3WNLA 1EHNA 4W84A 3WD2A 3UR8A 1BGGA 3CBWA 4EE9A 1H0GA 2WVVB 4L4OA 2QLYA 3KZSA 4UOQA 3J7HA 4B3KA 2ZX5A 1TFVA 2V3DA 5KEZA 4DWSB 3BLBA 2BHYA 2WM0A 4CD5A 1VJSA 2VI0A 4UQEA 2OWXA 1GCYA 3OB8A 3M7SA 1LG1A 2EJ1A 1OGBA 2CHNA 4V2XA 1JZ7A 3L4WA 1V3JA 1E6ZA 5E09A 5AYBA 3SURA 4UZSA 1OD8A 3EJRA 3UEQA 3PTMA 3UR7A 3EDDA 5BXTA 4UZUA 2BHUA 4M1RA 3VIIA 1E56A 5A95A 1OM0A 1OGSA 1CXFA 3SCRA 2WWDA 2QF8A 2AAAA 4IPNB 3T08A 5A94A 3CHDA 5CGTA 1B3XA 1NWSA 2Z1KA 5LA2A 1R7OA 4YPJA 3NDYA 4MDPA 1UWSA 4P7RA 4PMVA 4C7DA 4X9YA 1OIFA 2NT1A 2V3EA 4GI9A 3WDQA 2EO7A 1R46A 1ZJBA 3VIMA 1GHRA 1R75A 2IXVA 1R33A 2IXUA 1UHVA 5A8MA 5A8QA 3U5YA 1JYNA 3CIVA 3RILA 4EANA 1CZ1A 4D1IA 3VO0A 4F79A 2E9MA 2X8RA 3G6LA 3EDJA 3K8LA 3AMCA 3WDPP 4AMCA 3A4XA 5CGMA 3I3EA 1ZBKA 1R8LA 5IDIA 3ARRA 4MAVA 5D8ZA 3CO4A 3SEPA 1E3ZA 4AZIA 1JDCA 3LRKA 4AD2A 3TOPA 4BQ4A 4OBSA 1E6NA 1WZKA 5A2BA 2RGMA 3OGSA 3GM8A 1V0KA 3NJ3A 5A2AA 4YHGA 5HOSA 5BRQA 3WN6A 3D4YA 4PBGA 4DM2A 2JEPA 2DT3A 3BMVA 5I77A 2W92A 1B1YA 1DWIM 2ZXDA 3UCQA 4J3XA 4AYSA 1QBBA 3BAYA 3CZLA 1VF8A 3VOCA 4JFTA 4WKAA 4AISA 3SCSA 1E4NA 1TQVA 1W1VA 3ARXA 1GZJA 3DYMA 3AHYA 3EJPA 4AIUA 2E9BA 3A6OA 2ESCA 3AZTA 2BNJA 5D9OA 5GPRA 5CSUA 1A47A 2GJXA 5CPSA 3DX3A 2W62A 3WH6A 2F1BA 4V28A 1CYGA 1LWJA 2JALA 3ZR5A 3CTTA 4B16A 2ZUMA 3HU7A 3AOFA 2D3NA 2WHKA 4GZEA 3EMCA 3NCOA 1HT6A 4JFSA 1QNPA 2EXOA 3ZO9A 5BXRA 1CXLA 1OINA 2WVTA 1K9TA 3BVVA 2CETA 3CZGA 1L8NA 1QW8A 5D8WA 3HG3A 1V3KA 2D0FA 3N04A 1AQ0A 3MI6A 1TUXA 3ARVA 4X0NA 2ZX9A 1W32A 5C70A 3VIHA 3VIPA 3AMLA 4JCMA 2CERA 5IFTA 1NWRA 1WKYA 1X1NA 1E40A 3K8KA 4WSJA 2VTFA 3CGTA 2UWFA 2WPGA 4HU8A 5JBEA 2X2JA 2F8QA 2OWWA 3SUTA 1TZ7A 1MQQA 2FHFA 3CPUA 1EQCA 2JIEA 3VDCA 1S46A 3K8MA 1GQKA 1UWIA 4W7WA 1JFXA 1ISVA 1W9PA 4W93A 3CV5A 1ISXA 1E0XA 3AMKA 1PZ3A 3A4AA 3CHEA 1CXIA 2XFFA 2VC9A 4W89A 3B8SA 3FNDA 1CXEA 5EB8A 5I2UA 4IUGA 3POCA 2OW6A 2GUYA 4H41A 4W8LA 1ISYA 1TVPA 5AC5A 1NOWA 1X6LA 4TVCA 4JL2A 2JE8A 1TA3B 1W3HA 4U2YA 1K9DA 1HJVA 3CHCA 4GO8A 1HVQA 3AQUA 2VRQA 4IPLA 2XIIA 4D6DA 3AXIA 3ZJ7A 4XX6A 3W24A 4CN4A 3BSGA 3GH4A 2DT2A 3VDHA 1W9VA 1UZ1A 3BMWA 1V3MA 3ZIZA 5HBFA 1KR1A 2JF7A 1KGUA 1NP0A 5GNXA 3SUUA 4LXFA 3W4RA 3U7VA 2GFTA 3ZJKA 3KL3A 2PB1A 5FD0A 1WDQA 2ZUWA 5HPCA 4PRWA 2J74A 3CC1A 2VZOA 3L4UA 3U57A 2ZE0A 1R87A 4J28A 4TOQA 1G9HA 1T0OA 2B31A 1UKQA 2QV4A 1UH4A 1I75A 1W1TA 4UOZA 2JEQA 4AD5A 3QR3A 2WNWA 1C93A 1H3GA 4PTVA 1LWHA 7CGTA 1GJWA 1NARA 1E3XA 1US2A 4A3HA 1KWGA 3ZT7A 1R47A 2XVKA 1GOIA 4JKMA 3GTNA 1KXHA 2IGTA 3VGEA 4AXNA 5CJ5A 3O9NA 3W26A 1NM9A 1QNOA 3N11A 3K46A 1H41A 2XN2A 4M80A 1KQZA 4GO9A 4QCEA 4BF7A 1E6PA 4ZE5A 2CIPA 4ZFMA 1NOFA 1W3KA 2WHLA 1V3HA 3GZAA 3AHTA 1Z32X 2WKGA 2J8GA 3BVTA 2WWCA 4HA1A 1PBGA 2YLLA 2ZXAA 1MQPA 4MB4A 2GJPA 3PZIA 1K6AA 2QHAA 5DO8A 2W4XA 4Z2IA 2V3GA 2PWHA 3T0BA 2Y5EA 1BQCA 1EQPA 4Y7EA 4L4PA 2XVPA 1J9YA 1QPKA 2C0HA 3UG4A 4MPKA 2EAEA 3WY4A 2VUYA 4UFJA 3WH7A 3A21A 1HN1A 2XSAA 1CPUA 1VFMA 4CN1A 3EJSA 2BFGA 2CXGA 2X0HA 2GDVA 3WIJA 3MMDA 5M5DA 1W91A 2CITA 2J77A 2E3ZA 4AD0A 5BXPA 4AY1A 1W1PA 4E8CA 3IAQA 4NRRA 5FOOA 1WDSA 3WH5A 2CESA 5EMYA 1B9ZA 5AC4A 2PWDA 3RCNA 2J7GA 3F4VA 1N82A 1B30A 1B31A 1M53A 1XCWA 2ALWA 5E6YA 3MMWA 4JFUA 2J47A 4B3LA 1HTYA 3L4TA 3VIKA 5IHSA 4GI8A 3N17A 4UQCA 4LPCA 1FHLA 4AMWA 1H5VA 1QNRA 1PX8A 2E0PA 1I1WA 3ARYA 1BPLB 1JI2A 2AMGA 1CGXA 3ZMRA 4JCLA 1BAGA 3AJ7A 1RD6A 1JFHA 4UFKA 4GZIA 1MW3A 2WVVA 3VD4A 5DMYA 1HVXA 1IZJA 1HJWA 1W9UA 1E1EA 2J7CA 3W0KA 3JUGA 1BGAA 5A8OA 1C8QA 4GKLA 1MXDA 1Q6DA 1JGIA 5HPOA 1WNOA 3CLWA 2X2IA 3B9DA 5I6SA 3BVUA 4HOWA 3UG3A 3RMEA 5E70A 4XUYA 5IFPA 3SUVA 1HKKA 3AIVA 2OYLA 3VM5A 3F5JA 2D20A 1UWQA 4M81A 1TCMA 2OSXA 2W67A 1CXKA 1ODUA 5C71A 3KLKA 1Q6GA 2AOSA 2X2HA 3BUDA 3VGFA 2J25A 2YBUA 2CBUA 2VX5A 3VU2A 3D51A 1WB0A 2E40A 4RE3A 1IV8A 3CZEA 4J27A 2J7HA 4D1JA 1JAKA 1QHZA 4W8AA 2Y24A 1PX3A 2XGBA 4NI3A 4FF5A 4R5EA 3MUAA 4A3YA 1JYWA 3AIRA 1UR8A 5CLWA 2W61A 3M07A 1PIGA 1LF1A 1E9LA 3BCDA 4R27A 3OBAA 4W7VA 1BFNA 1VRXA 1EDGA 1UH2A 2VURA 3D3AA 3PZNA 4J3SA 1GHSA 2VCAA 2NT0A 1HKIA 1E4MM 4J3UA 1FP8A 3MS8A 4P7QA 1G01A 4ATDA 4HZ8A 3H55A 3CZ8A 1UA7A 1C8YA 1CLVA 1KXQA 5A6AA 4PMRA 2FGLA 2D23A 3W81A 4CGTA 1VIWA 2BY2A 3HJEA 1EDQA 1UR0A 5DT7A 1LQ0A 1M04A 4HOXA 2G8ZA 3EJUA 2WMIB 2ZOXA 2WKLA 1J0KA 2WLZA 3DDGA 1VAHA 3VIFA 1CLXA 1HXJA 4PSPA 4TVDA 2EPOA 4N42A 3SCPA 2D0GA 3A4WA 4ATLA 4PYSA 2DT1A 2E8ZA 1QI0A 4PUDA 3IK2A 2W5FA 1G5AA 1UASA 3D52A 3AIUA 1HWWA 1U33A 3W29A 2VZVA 2GK1B 2WBKA 4D71A 2DDXA 2A3AA 2ZX8A 1UOKA 3AMDA 2PBGA 5M17A 3SCQA 1L0PA 2PWEA 3WD0A 1GPFA 2XPKA 4W87A 1QI2A 1KQYA 2VX6A 2ZXBA 3DYPA 4P7LA 1VEMA 5A6MA 2X2YA 3GXTA 1JD9A 1NWTA 2EPNA 1E6SM 2J62A 2WMIA 1HP5A 4GI6A 3VUPA 5DT5A 3WELA 4AW7A 3CH9A 2XFYA 4UOJA 3RPMA 1GQJA 3BAXA 3WMSA 1GQIA 4M24A 4H8UA 3LPPA 1E55A 1V6UA 4DWSC 4PMYA 4CU6A 2J8FA 5EFFA 1UUQA 1I1XA 2DIEA 1ISZA 1VENA 3WY1A 1W9DM 3HG5A 1F4AA 3GXNA 1XRVA 1O7DC 2CHOA 4JZ5A 3RJXA 1EIBA 3VD3A 1MYRA 3EDKA 4P8VA 2UY4A 5EBAA 4U5IA 4PUEA 3ECQA 1JXKA 3TONA 3I3BA 2DGAA 1GONA 2CBJA 3KL0A 2QMJA 3W37A 5M03A 3WNOA 5D9MA 1B0IA 1V0NA 3MO4A 5JIPA 3F5KA 2CPUA 3L2MA 3LRMA 3GH5A 2WBGA 2W91A 3PZTA 5CLTA 3VDAA 3VILA 5EFDA 1M7XA 5HXMA 1UKPA 1U2YA 3RM8A 2WB5A 1OSEA 1FOBA 2WW5A 1HP4A 3WF4A 3L4ZA 1QWUA 4UNIA 3MMUA 2VO5A 2XVNA 3OA5A 4HTYA 5JUVA 5FIPA 2QMKA 3DX2A 2DSVA 3SUWA 1W9BM 3K4DA 4EKJA 3AMGA 1B3VA 4N0RA 2G3MA 2E8YA 4NXKA 1V3LA 4NZJA 4IM4A 3MUZ1 2V3FA 1EGZA 4KH2A 4TUFA 3WMCA 1XYZA 3GDBA 3VM7A 2Z1SA 4XZBA 4DO4A 3AYRA 4PMNA 4OOUA 3SCWA 5JIWA 3VIJA 1Q6CA 4NSBA 3NSXA 4PCTA 4UFMA 1E71M 2YA2A 3WNMA 3SCUA 3CUJA 4ATWA 1J11A 4AZCB 1WDPA 5ABGA 1MWOA 1B90A 4QP0A 4ACYA 1J10A 3RO8A 1ODZA 4JKLA 1ZJAA 4U3AA 3W82A 3BUBA 4HA4A 2XVLA 1AQMA 1ZBWA 2W63A 3DX4A 3MANA 4TTUA 3BUIA 3W27A 3IANA 3W53A 1VJZA 4AZ6A 4DWSA 4CU7A 1JF6A 2J78A 1E4IA 2VZSA 4OKDA 4C7GA 1ZBCA 3S5YA 4AWEA 2D3LA 2CBIA 4Z2JA 4BZYA 8A3HA 3VTRA 1WPCA 4U33A 1FFRA 4URIA 1BLIA 1PIFA 1SZNA 3MSDA 3GYCA 3WBAA 2XYLA 3NYDA 3VD5A 1R86A 2GVYA 1QI5A 2D1ZA 3AYSA 1HX0A 1KGWA 1JZ2A 2JF6A 1SMDA 3L4YA 4FLRA 1GVIA 1MW0A 4AD3A 1MFVA 4H2CA 4PMDA 3EDEA 1HJSA 1EA9C 2WZIA 1TQSA 3WBEA 1WZAA 2YL6A 2CNCA 2GJRA 3W38A 3GNRA 3ARUA 1OT1A 4Q22A 5D9PA 4FLQA 1O7AA 3VSTA 1XD1A 2Y2WA 5F7UA 3KWXA 1XCXA 1JZ8A 1AMYA 3N13A 4QFUA 1GOMA 3WF2A 2WMHA 1J0YA 2BVYA 2F1AA 3ZOAA 3MUIA 1Q4NX 5I78A 4WIWA 1ITCA 3DX0A 4TXEA 1BYAA 3THCA 1GOWA 2J7EA 2VQUA 3ARQA 5I79A 1W2PA 3QGVA 1KBBA 1B2YA 3T09A 4KRTA 1H09A 3CZNA 3WFZA 4NXSA 1V6WA 3GXMA 3AISA 3NDZA 3K1DA 3D50A 2J75A 3PZ9A 1DTUA 3WQVA 4PMUA 3VPLA 3VVGA 1CGYA 3M46A 5A69A 3GXIA 1C7SA 2YBTA 3BVWA 1V08A 2WLYA 2FE0A 1E4LA 1KB3A 3AHXA 4HMEA 5JBFA 1ESWA 3D4ZA 4OZOA 4B9ZA 3MUY1 1B3ZA 2A3BA 1E70M 3WNNA 4KRUA 3WY3A 4PTMA 2D2OA 4CD4A 6TAAA 4PTXA 4JHZA 4MNKA 3HMCA 5HDRA 3OG2A 3VINA 3FXYA 2NW0A 4F66A 1X6NA 2Q8XA 1PS3A 4W85A 4E8DA 3WL1A 4AMXA 4ZE4A 1LL4A 1JZ6A 2CKSA 4Z2LA 1DP0A 2YIHA 3AHZA 4S3KA 1PZ2A 5I23A 2BV9A 3PTQA 1JZ4A 1RH9A 3N9KA 2XVGA 2VL4A 2YA0A 1JNDA 4PEEA 2J79A 3FY1A 3BLPX 2EABA 1JIBA 3FW6A 4BS0A 1XYFA 3ZR6A 4U3CA 4HPGA 3A24A 3S2CA 5A6KA 1OIMA 2ZX7A 3VNZA 1H11A 4NF7A 5FCZA 3L4VA 2WMGA 1HF6A 1NH6A 1UQZA 1UR1A 5E0CA 2XUCA 1V0MA 1E15A 2XHYA 2HVMA 1EDTA 1WZMA 2WC7A 4B9YA 4W86A 2FHCA 1NQ6A 5A8NA 2VX4A 1O6IA 1HL8A 3BAWA 1CGUA 4AEEA 5I24A 3WFLA 1TQUA 4NX0A 4A4AA 3DYOA 1HXKA 1JNEA 1XGZA 1CEOA 2GDUA 4MJ2A 3W6MA 4Z2KA 4UFIA 3WNKA 1PJ9A 1HJUA 4CCEA 3PHAA 1VEPA 3PZVA 5CPTA 3U5UA 1W1YA 1QHPA 3ZSSA 3EMZA 1Q6EA 2F7QA 2X09A 3T0DA 2WXDM 1ZBVA 2JFEX 1QVBA 2VRJA 4M8UA 4WKFA 2CCRA 2DSWA 2OWCA 1JD7A 1JF5A 2ZUUA 3PTKA 3F5LA 1ZL1A 2CEQA 3WEZA 1KTCA 2TAAA 2PI6A 3TTQA 1TMQA 3W6LA 1Q6FA 4KGLA 1BVNP 2XN1A 3FN9A 2ZX6A 4P8UA 1JL8A 4DM1A 3H53A 3G6MA 1UD3A 4J3TA 4BQ5A 4OGZA 3BSHA 4E4PA 1E0VA 2F7PA 1BTCA 1GOOA 2WZEA 1VB9A 1EO5A 4HPHA 5CQ1A 2JIWA 1PX4A 5LA1A 2BS9A 4D6JA 5CPQA 5I5RA 4GQQA 4DO5A 2WC4A 3GH7A 5GNYA 2D0HA 4QCFA 3AHVA 3WUGA 3VMOA 2FHBA 2X1IA 5BWFA 2VCBA 1UZ4A 3WDRA 4CCCA 2VRKA 2PC8A 3GXDA 2XWDA 2V5DA 4UQDA 1V6XA 2O9RA 1UD5A 4U5KA 1QNSA 3AFBA 2E4TA 9CGTA 1PAMA 2GJXB 4D72A 3WD1A 2J4GA 3LX9A 2QPSA 1FP9A 3PBGA 1MW1A 3TP4A 3AXHA 2WCSA 3A22A 1FH8A 3BLKA 3FAWA 1MQRA 3OGRA 1BYDA 1AVAA 1GVYA 1HL9A 4JAWA 1WZLA 3WDHA 2G3IA 1XH0A 5GQBA 2VMFA 1C7TA 4MB1A 4XB3A 4W88A 1E6QM 4UFLA 3WKZA 3WF3A 1K9EA 1LLOA 3TA9A 3WSUA 1H4PA 3WD3A 3AZSA 3VGBA 1E6RA 1IT0A 3VD9A 1SR0A 2YDQA 3M6DA 2O9OA 4MNLA 1D3CA 3FHAA 3A5VA 1UD4A 1G0CA 3HZ3A 4PCSA 3UG5A 2ZUTA 2BY0A 2UY2A 1W2VA 2F61A 3GXFA 3IJ9A 5HNNA 3VIOA 4M56A 5GNZA 2DH2A 2C8NA 4MB3A 3CZKA 3BVXA 4PMXA 4AC1X 4AZ7A 3MSGA 1TA3A 5D9NA 4CD7A 1DWJM 3ZT5A 3PZUA 6A3HA 1UD8A 5A1AA 2XFRA 4YHEA 4HOZA 1UA3A 2RGLA 3GNOA 1CWYA 4GIAA 3SIMA 3O6AA 3AIBA 3QOMA 5FL0A 4CN6A 2WAGA 4J7RA 3QHNA 1UQYA 3OZPA 2VCCA 1AQHA 1QW9A 1WAWA 1NP2A 3E1F1 5LYRA 2FYVA 2VZTA 1DWFM 3WENA 2J7BA 3BGAA 4UCFA 4AZBA 3OGVA 1BG4A 2BHZA 3CMGA 1D2KA 2XIBA 4WKHA 3LXBA 4GINA 3QHOA 1HKJA 4QLJA 3HG4A 1E73M 1M01A 3ZJ6A 2CKRA 1TG7A 1GJUA 2YJQA 3II1A 4NZFA 8CGTA 1UKTA 1XSJA 1LL7A 3A3HA 3VMNA 4H8VA 1U30A 1EO7A 4J3VA 1UD2A 1MXGA 2VR4A 1J0HA 3AROA 2OYKA 4UQBA 1GUVA 1JZ3A 1SFSA 3WDJA 2WHMA 3POHA 3RM4A 1B3WA 4TVUA 5BXSA 1VFUA 3UETA 3QOKA 4CCDA 2VR5A 4GQRA 1V3IA 4AZ5A 5BCAA 3NSNA 3VD7A 4FNRA 3UERA 1TR1A 3SCOA 2VX7A
chains in the Genus database with same CATH superfamily
2BIQA 3O2LA 3D25A 3L3IA 3VSVA 4CW1A 4R2GC 4AHQA 1WE5A 3CL8A 4MXWH 3D25B 2F5BH 3L3IB 3PAJA 3M0MA 4B95C 5DBUA 4PJIB 3JWDH 5KVMC 1YEWA 3O9WC 1WC7A 4GFTB 4WGKA 5KS9A 2OQHA 2QJNA 3NL5A 3NN8B 4HK3J 4TLSA 2X6MA 5IVOA 4FX6M 4IIDA 4K8RD 4MMXB 4LSUH 4PVMA 1J5OH 4XXDA 1TJXA 5D7LE 2DKMA 3PPHA 1UIOA 4MJ6A 4HEMA 3MV11 3SBFA 1TTUA 4MLJA 4QEHA 2NXYB 3WIHH 1OFDA 5AOIA 3C5JB 2BMBA 1R3LB 3P69A 4RSYA 4F37K 2NNAA 5DFVD 4JG1L 1E0WA 2VVNA 5A2IH 1BD2A 2VNCA 3FB5B 2VMCA 5KVDE 1LRTA 4X2PA 1F42A 3MV9B 4JDTH 1F61A 3QRHA 4EF9A 2EDYA 5IGXH 3ILQD 4H8NA 4PG9A 4WEBH 1MAKA 4GPVA 1G7MB 3QUKA 3I74A 4D0CA 1RUAH 3D8MA 3K5XA 1SNRA 2BNRA 4R7NB 3D4CA 1ZS8A 3BDKA 3WLMA 1S7RA 2TRYA 1IM9A 2OLAA 3VXTA 4WGXA 1JOIA 1NDTA 3G6JE 4HAKA 4IIQC 1XUUA 1V03A 3WQEA 3V4UH 4HSAC 3ALFA 2IAMC 3HG2A 1UR2A 3QZOA 4DPCX 4PGCB 4FQ1L 4ZS7L 3ZKXC 5JYLA 1R3SA 1TPWA 1CT8B 4LNYA 2YARA 5HNRA 3BIKB 1QA9B 3QDGD 2ZUVA 4I3GA 1OCOB 3Q58A 5LXVA 4UR8A 1XLMA 1U3HC 5BROA 3LKPB 1U5HA 4NYLA 2JSFA 4IMEA 5FOBB 5J13B 1IMHC 2PXYB 5DHMC 3IDYC 3LPFA 4GY0A 4F33A 5T26A 1UWRA 1G87A 3U7BA 5TE6L 4EE2A 1EXHA 2UY5A 4B5NA 3P4OA 4KX9A 1FUNA 1DQDL 5B8CA 1DFBH 1I3UA 1JVOA 1A7BA 3NDZE 4UQ9A 3GBDA 3S5ZA 3VE0A 2GVLA 2NNCA 2EDDA 3KHQA 3O8XC 5FHBH 5FUZH 5MEOA 4C6BA 1THCA 1V02A 1MUJB 4EN3C 4I9XA 1KBPA 2CPCA 3QW9A 4X4XA 5ECUA 3S3GA 4LSQH 4LNRB 1M03A 4P2OD 2OCJA 2YL8A 2DZBA 4QTHB 3KBNA 4JIEA 4JQIA 1F5WA 1LD9B 1ME7A 1MNZA 1AJZA 5DEZA 3VWKD 5DYOA 3TBCA 3U7YH 3KP0A 4O4VA 2F53D 2X7VA 4EF3A 3HZVB 3D18A 1ME8A 3I3DA 1A5NC 4XVSH 2GIYA 2QXWA 1YEEL 3JXAA 5FCUL 1ONRA 5GGSY 5AKQA 1IE5A 1Y1DA 4G6KH 3DH7A 1GAFL 2J7DA 3LQGA 4S2BA 5HHMB 2R0LL 3RU8H 2HV5A 3R25A 4PLNC 4NJIA 2JCCB 1FFQA 4R7WA 5KTEL 4FA8A 4M3JA 4G7SB 4X98B 3P14A 4IPJA 3CWHA 1K2DA 3AGWA 3K6SB 4NKDA 5E03A 1P4IH 3IFNL 4JFZH 3CVBA 1KM0A 4IIHA 4G2DA 1A5KC 3QCTH 1AH4A 3ANUA 1PL9A 3TCEA 3DV6B 4F7KA 5BZAA 3MP3A 5H6HA 4AKQA 5AHLA 3RZCC 3LHWA 3W2DL 1C5CL 4XQ6A 4D0DA 2C14A 3BLOA 4I9WE 4NAEA 4GK8A 1G0YR 1XV8A 4LL9A 3I10A 1A6VL 4HUWA 4F2BA 4CD8A 2CKBA 1PE1A 3LB0A 2PXYA 3GXUB 2X0YA 1H15B 1YEDB 2Y1ZA 3FO9B 1HKMA 4PMOA 1VJIA 3A23A 4Q0XH 4OWGA 3G1YA 2IPUK 5IEHB 3S6TA 5CWSB 3FJ6A 1XFBA 2MOQA 1CT8A 4K23L 3HR5B 4IOSD 4XCEA 3HMJG 4DW2L 4MZYA 1F0LA 3SGDI 2R94A 4Y2DA 3X1FA 4QLLA 1EFXA 3D46A 7REQB 1PY9A 5LBSH 5A6SA 1S5IH 2HRPH 1OFQA 2O92A 1EH9A 3L5HA 4NQSB 2JIXA 3CPLB 4MNQD 4XHJC 2Z7GA 2VFDA 2PD5A 1KCRH 3VWJC 4XG1A 4HUVA 4EZLA 5C6PB 3LN4A 4NOBA 5IHBA 4Z2GA 1LL1A 3KXFD 1MCCA 4NNPH 1C5CH 5MEQA 3B3BA 3L95A 3WU1A 4PJBE 1XGPA 5F0MB 1IEVA 5IXEA 3FONA 1FWHC 1HHHA 2IBZX 3TS8A 5I00A 3OTRA 2J24A 3MBED 2EXTA 5T1LD 3B7RL 3EHBC 3LQZA 3ML8A 5JPMC 1Q9OA 1VR6A 1MCPL 5EH1A 5K1NA 1A4KB 1CJYA 3C5SB 3X12B 4PWHA 4PFEA 3RNDA 5D7KE 1IVLA 3C08H 4X7SH 1OPOA 4GYKA 3T3PF 2HH0L 2M1KA 2QHRH 3QDMD 1I60A 1U8OB 4N2BA 2E9GA 1JDDA 4JD4A 3QZPA 5GIRB 4DEPC 3R1GL 4XK2A 4PMEA 2ITCB 5CLZA 1UB3A 5K7JA 5D7LD 4J3WA 1JHTB 1OWWA 3KGSA 4KX7A 4HWZB 1EGMA 4M6VA 2R1NA 3QQ9C 2BW4A 2JB5L 4FNQA 5HI3D 4KROB 2I5GA 1RQEA 2QEZA 3NPZB 2IDSA 2B1HL 4FOKA 3E3QE 3HNTH 4WIQA 2EUXA 1D5IH 3GJEA 5KN5A 2F84A 2Z1PA 4BSJA 1Z41A 3DDFA 3SN1A 2DEXX 2V30A 4Q4SA 4OH2A 4C4KT 1J18A 5DTFA 5KYYB 4LQFL 4NHUB 3KRZA 1SEQL 4B9GA 5MKGB 1R34A 2XZAH 4ZFGH 1E2VA 5AHFA 4JFYB 2QIWA 3UADA 3DTXA 1QLRB 5HGAA 1A4JB 2APBA 3QUMH 1E28A 5C0AB 3ABQA 2FJHA 2JWYA 2X1XR 4H04A 12E8L 4KXZH 4YLBA 1FC1A 2YPLD 3U2IA 1DOSA 1WXZA 1B6UA 3X14B 1VFLA 2P88A 3OZ9H 4QRTA 4EZKA 4IQEA 3E9TA 5D30A 2EG6A 3DFSA 2X41A 3TEXA 3QYMA 3SBRA 1NOUA 2DQFA 1EBAA 4QHLB 4BH8B 1XDJA 3PRZA 4OQVA 1XTMA 2YDRA 3SJVD 3VA8A 4L0ZA 1IKFL 4PMFA 5LDSA 1DZBA 3RFZC 1A5BA 1V7YA 4BQ2A 4P49A 1HSAB 1HFUA 1V93A 4IMLB 4NNYB 2WLLB 4A7UA 1P5VA 1TO4A 4XNAA 1MI5D 5DURB 2VENA 4BGDA 3N85L 3RGVD 2IPFA 3O3AB 4HKXB 1Q9WA 5FM5M 2IANB 2OL3H 3VX0A 3ZL4H 1FE8L 2Z8WC 1YMMD 2QUVA 3LPOA 1YY9C 3MRCA 4XMLL 2RJHA 3IAPA 5K69A 2H32H 5CEXB 2A0NA 3ZGIA 1JCNA 1PZ1A 1V77A 3LBMA 3M17A 5DQ9A 5DR5L 2CA4A 4LCCB 1MNUH 3U0PB 4C4BA 1ZTVA 1RPXA 1SDDB 3MLTB 1OLZA 4LLYB 1H1NA 1P5VB 5C9UA 4MVBC 4NCC2 1CCWB 3RKDC 2DZUA 3R8BB 1OY3B 1WAPA 1C08A 4TN9A 3PHQA 2K78A 4HSNA 3PWJB 1H3XA 3GMRA 1F1DA 2XN0A 5JZ7D 5IFAH 1J5OL 4XCCH 2QS8A 2UBPC 4PTWA 3EZ8A 3KVQA 3RM9A 1X6UA 4FJZA 1KM4A 3O9WB 2CG9X 4QPEA 3ITTA 3RPTA 3N3MA 2DL2A 3QEQA 3IARA 4NQXB 1GC1H 1HZYA 1JWUB 1T0NA 3L23A 3DV4A 4FK9A 4DB7A 1VQTA 1HIML 5KTLA 4LCSA 5FEXA 3IIPA 1RIHH 4U0RB 4N2HA 4DIAA 3GSQB 1CL7H 3NCEB 4YR6A 3BAKA 1LTXA 2DW6A 4NQVB 2XFWA 4WU5B 3OAYK 3NQEA 5EU6B 2EEDA 4OGAC 3NOEA 2Z0IA 1M6OB 1UACL 2ZF9A 4LF2A 3TN0A 4QNWA 3FT2B 4BE5A 4U7SA 3MLRH 2XJ7A 2YDSA 5LIYX 4MNMA 5D71H 1GOQA 1Q7ZA 4HWZA 3S0CA 1MEHA 2BVOB 3WE6A 3A12A 3C12A 5JHAA 3N43F 2F38A 5IUSA 3S2JA 4YHYB 4N25A 4LH8A 1P5UA 1LL6A 1QBMH 4ANXA 4XAZA 3NPSC 2Z9TA 2OS7A 4IPIA 4JMXA 3LIUA 1PKYA 2J88L 3FOMA 2CLRA 4ZT1A 1D6VH 1L2UA 4LC8A 1SEBB 1BSIA 1G7IA 1Q9OB 5FYJL 3PZOA 1CGWA 1UCBH 1QBLL 1TWWA 3RAJH 3ZQ9A 1M7IA 2E09A 1AGEB 4BK4A 5EA0L 2O4MA 3EA3A 1FL5B 1EZLA 2A3HA 3R0UA 3F64A 4OECA 3ZQXA 5SWZA 1ECEA 3ETSA 5GGVH 2BXYA 5K39A 5D7JA 2AAMA 1JGLH 3BK0A 2OODA 2DQCH 1QSVA 2N59A 2ZKYA 3LH2H 2JKRM 3QH3A 4JZJA 5F1OB 3SDXF 1MMFA 1SFDA 5LNDA 4KC3B 4QSHA 1BECA 3FSWA 3IJ8A 3K5RA 4DEWA 5F6IB 4Z8FL 5CZTA 4IDLA 4P8WA 3SKMA 3DNKA 1KFWA 1PLGH 3BH8B 3N06B 4HZLA 2Y5JA 4K7FB 4U1HA 3S2MA 1MF2L 2GSGB 2OQJA 2FVLA 4RA0C 1XR8B 3H4WA 2OMUA 2VMJA 1EOKA 1SFJA 1JPFA 4XODA 4N2GA 4S0SD 4PJFF 3L13A 2YFNA 3QK0A 1FH9A 2QZ5A 4WEUD 3VYOA 3WUBA 1MDTA 4BKLB 6CGTA 3P11L 1MCQA 1MFCH 2R7EA 1V7MH 2WANA 2CKBB 3NJKA 4PB0L 4Z3HA 3QW3A 3QNXB 1US3A 1FPTH 3IGAB 3PP4L 3WEMA 4XSLA 2EYTA 4MJIE 4IBWA 4B92A 5D02A 1DDTA 4AV4A 3ULUL 3BESR 3TTYA 5IHZB 3EJYC 2JELL 4XWGH 3V16A 4P7OA 1GZHC 4FFVC 5I6XB 3DUGA 4A39A 4U4BA 2FB4L 3GUWA 4P2CG 1G4RA 1RIUL 1O5QA 5ID1A 1PPIA 2BY1A 5IR1A 1F11B 4TM9A 3WQPA 4QF1A 3V55A 1A5FL 4A2SA 4GRSA 3P54A 4HXBL 4JO3L 3RJOA 4Q4IA 4H1ZA 4L61A 3PSWA 4NZ5A 1HZHH 1P4BH 2KMWA 1CDJA 4U2ZA 3OIXA 3WS3A 3NZ1A 3TBWB 1Q2SA 5JOEA 1ZVYA 2R2EA 3BFWA 4Z1CA 3FO2A 3L3GB 4U05A 3TA3A 3WY2A 3SE3C 2QR0A 3AICA 2B2XH 4B91A 4BFBD 3ARFD 3BKJH 3FRPG 1PTZA 4IGHA 4X7SL 1VHCA 2ADJB 3TO4D 1XRFA 4RKAA 4JRFA 4JE4B 5C9WA 2AL1A 1JRHH 4TLUA 1TWIA 5D4YA 3UWYA 3NVDA 1GKRA 3UWZA 4RGOH 5FKAB 2N0KA 1LK3H 2CUMA 1QWHA 2WJ5A 1AMKA 4NZ1A 4B5SA 3LBOA 3HE7C 3VG0L 3STBA 4KRPD 1X5KA 1I1FA 3S8GB 4J2QA 3GS0A 3BQ5A 1NBQA 2ZOKB 4LY4A 3WNPA 1UJ3B 1YVLA 2W0KA 4NFBA 3KLHC 1JG9A 2C19A 3K6IA 4S1QH 2PWFA 5I71C 2DQXA 2ZZ5A 3L1EA 1A3RH 3BH4A 1E7VA 2DQMA 2GTWA 4GQZA 4UT7L 4QXGH 3V4VH 3O0FA 3GJFK 1R7AA 4JHMA 2NUTB 1EZVY 4UV7L 5HDOA 5B3SB 1T03L 2BODX 2FGZA 3LNMA 3WIFA 3CMOH 3LAFA 3P0VH 3TN4A 1OAXH 1JCKA 2PETA 2ZWLT 3RVTC 3U1QA 4S2CA 2BP8A 1W3JA 3QI9C 2N1KA 1GNXA 1RALA 3HRZB 4ALDA 3DK0A 2C3WA 2NR6C 2GGGA 1FXPA 1OGGA 2Q6ZA 5EPDA 4LEOA 4XHQA 5AY7A 4ML4A 3EYQC 4FFZH 5K9KB 5E2VH 1XXFC 2D24A 2DQIL 5I76A 5T1DL 4L8SB 3FCBA 3FA4A 4TUKL 5K93A 3WUFA 3TT3H 3UDWA 3PUGA 3Q48A 5EULV 2QW5A 1S7RB 5BWAA 4XZWA 3DUUA 2A3CA 4K73A 2UXFA 1BW8A 4NQCE 1ZU8A 4IMLA 4LDLB 2VIRA 2W80C 1MW2A 1UW9A 3ZKNC 1HL2A 3AYVA 2R0LH 4JAMA 3PBWA 4ZNEE 2OKOA 3GT6A 4ACZA 1UB6A 1OAYL 4OUUB 2KERA 1IARB 3QXVA 4N2EA 4A67A 3OZYA 1SF5A 2AXFA 2WLKA 4YNYB 2CGRH 5BZWB 3BWWA 3N9SA 1MZYA 1SXCA 1A5UA 3MJ8A 1M4KA 3WKQA 4NUGL 1CURA 3UYRL 3PWPD 2Y7OA 1D8WA 2DP3A 1MLBB 2YA1A 1TJMA 1ZT4A 3BISA 4FKEA 3C86A 4C5YA 2MPVA 3MV8B 3TYFA 2ADJA 2W38A 5I1EL 1O6VA 2QDVA 1MJJB 3FU5A 2ZZ3A 2A1WL 5AC7A 4YGVB 3Q4DA 3UAFA 3O3UN 2DOCA 4HGKC 4RNIA 3FN0L 4Y5VA 3ZLFA 2WMKA 2ZOWA 5BV7H 2QSCL 1WBJA 1AHMA 2RAMA 4GLEA 4HGWA 3B9AA 3LPWA 5FYLL 1C9SA 4O1DA 3WQFA 2ED8A 4PJ9B 3X13B 5I30L 2GK1A 1EGJA 1PKQA 3WIIL 2IWKA 5E9AA 4TO8A 3FQ1A 3LTVA 4L56A 4KKNA 1GSMA 3E1ZA 4NUJA 1ZUAX 1WDRA 1G69A 1J8RA 3URNA 1NWUA 4AC1X 4TUKH 2V38A 3JVGA 4YSTA 1TJPA 3DFOA 4OSUH 5DC2A 1OXYA 1YQVH 2JQZA 2HT3C 1TOXA 1YJDL 2Y3NA 2YZ8A 3M88A 4HZAA 3T2NL 1ORSB 4MQXC 4PSRA 3TBTB 2R7EB 3X12A 4ALAH 5JXAL 1MLCA 3G5WA 4FZ8L 3ZTNH 2XN9B 1W16A 4PP2B 3EYOB 5IQLA 2ZG3A 1FNEA 3MRMA 4AOFA 3G3DA 1FYTE 2IWFA 4IOIB 5E6IB 1S7VB 3PV7A 2G3JA 5DVPA 4YFDB 3VI3A 4G9PA 2XZZA 6REQB 4MCYB 3WO4C 5MENE 1T5XB 3FUMA 2ENQA 4NJHA 4J5NA 3LI0A 1CENA 2Y62A 3PJSA 1WICA 4U3XA 2W66A 4K7FA 4XO7A 1IGCL 4Y5YA 3WQ6A 1U92B 3DLQR 3CN2A 1PLCA 3WJMA 2QCMA 1N0XH 3IDJB 3QJHA 2O5NA 3IRPX 1IZKA 3VE9A 1MF2H 1RJLB 2X70A 1TCRB 1IC4L 3MBEC 3E0GA 2VOTA 4L48A 4HBQA 1S2AA 4IH3A 4R7JA 4XNBA 2EEXA 2ZXEB 1G43A 3GDCA 5DN1A 3WK0A 1SSDA 4FXSA 3D12B 5CWSA 4V1DD 1UYQA 1TO5A 3AY2A 1A4LA 2F7OA 2IH9A 3RP1A 2OKTA 2PMQA 1KY6A 2NY2B 5GGVL 2YJLA 2XM2A 5D1ZC 5BU6A 4GSRA 2R1WB 3MNVA 1WAEA 2ATPB 4INFA 3SY8A 4LC6A 1A6TA 5LUMA 3K3QA 1XBZA 2VM9A 5I0DA 2QQNH 3TJ4A 3C5ZB 1DBTA 2HT2C 5HHQA 2EDFA 2PP0A 2XSBA 1FGNH 1VESA 3DX7B 2I26N 2HN7A 4JO4H 3A47A 3MCG1 2OZ8A 1S8DB 3SD2A 1AW1A 4DYKA 4EXKA 4OUIA 1E5NA 2Q76B 3K6SA 1CDCA 1NCNA 4KJWC 5JBDA 3ARZA 2H41A 2AJUL 4F58L 5KBMA 5ACLA 1FWAC 1KM3A 1VLIA 5AN7A 1FHDA 1U83A 1WD9A 2RB8A 4WY7H 5FW8A 5B1AB 5A6LA 1QTSA 2F9RA 2QJIA 3S42A 2F1EA 5I75C 4RZ6A 4Y19B 5LSMA 3TO4B 1PYWA 1PTAA 3QQDB 3TZFA 1I4FA 1PWMA 1LG2A 2X05A 3DGBA 4XCNA 5FHAL 2X4QA 5EKYA 1R3WA 2I16A 4RDVA 3TBYB 4YTSA 3VZZA 1JZEA 1D9KA 1HXYB 3OXRA 4BHUI 1WX0A 4AYGA 3LGGA 4YR6B 4YDLC 3NQIA 5FJTA 1NAL1 3GO1L 3QRLA 4NRSA 4UWMA 5HMSA 4JNMA 1DEDA 1URIA 2J1KA 1QR1B 2AQWA 4FXGA 1ADDA 2H1PL 1UKOA 2J12B 2NSQA 4JO4L 4NRXA 4OVUA 3UPCA 3TOYA 5GS3A 4IJ3C 5CEZH 5I3FA 1KTDB 4PJBA 5D1QE 2NUYA 3PAYA 1MFNA 1SUXA 3CNYA 4CQBA 3UJTH 3CQQA 1RVFL 2AQRA 1LXMA 4LVOB 4LCIH 2R8WA 2H6UA 2YS4A 2QQ6A 3FUIA 2AERT 1DO5A 1WT5A 3MLSL 4FQHB 4ZO6A 5F7YC 3SDXE 2QULA 4RDWA 5AHMA 1MDAA 1KRCC 3UA4A 5F21B 1H3TA 4O2FB 1XHGA 3THDA 2LAGB 1YY9D 4YVXA 4RNHA 3EYSH 1CD1B 2DSZA 4E38A 3H9HB 3DUUB 4FQXA 3B8IA 3BCFA 4ZENA 3SQOH 4A66A 1UKSA 4HK5A 3M17B 1E6XM 1PKNA 3SFWA 3FRPA 2Z65C 4L8SA 2X4TB 3KPLA 3DX1A 5L4IA 2X4UA 3ULUE 2D4DA 1KW1A 3H2MA 4L64A 1N0XL 4NC2B 3CUFA 2YOCA 2XI9A 5MP6L 3VKKA 3A4DA 1OD7A 2HCVA 4PTTB 4M82A 1WISA 1KLGB 5CZVH 1JXFA 4HHPA 2YKLH 4GEJA 1G94A 5BQ7B 3RWHB 4KO7A 3CZSA 3WIFB 3JWNG 2PYFA 4NPYA 5EIIB 3WJSA 4XNXL 2HZGA 3CYJA 3DVNA 4MD0B 2HLFD 4Z42C 4KUCD 1IKOP 2EPKX 4A2HA 3DOSB 5AAWC 2CLOA 5DRNB 5HD8C 5F7EL 3EOAA 3MLWL 3OGCA 5JXAH 4MKVA 4BJLA 4IPPA 2BSSA 1EHNA 2CDFB 4HEME 1N3NB 1A9EB 2AJXL 4NO0B 4AQ1C 1BGGA 5FA4B 3DXIA 5IDZA 4EE9A 3KH3A 2H9GB 5LNEA 1GG1A 3H1ZA 3R4RA 3GBML 2NZ9D 5IB2B 5LGKA 1VPQA 3SE9L 1YPZA 4KEUA 2QLYA 1RH8A 4R33A 3I9PA 2LT9A 4B3KA 1WDDA 2HVJB 3IIVA 3UFYA 4NDMA 3GMQA 5FAJA 5FUOH 1KMGA 4FFWD 1MRAA 4G1KA 4GI4A 2ITEA 2B7NA 4W9DC 3BLBA 2BHYA 3MOQA 3LA4A 4DP5X 1NAMB 2WXPA 2MWCA 1JUEA 3VTTA 3VXUD 4JQVC 4Q9BA 1RI8A 2IOOA 2OWXA 1P53A 4N2MA 4P59L 4QTGA 3FYYA 3DUSA 4WFEE 3TZVD 3M7SA 2BCKB 4I7UA 1R3JB 1RVGA 5AVXB 4E9TA 3C2VA 1HYSC 3A13A 4QG9A 5E09A 1V3JA 1KY7A 3VI2A 4MUPA 3BP7A 4P46C 1FZMB 4LRTA 4PUWA 3HHSB 4M7TA 5IQ7H 2CBQA 3N1QC 5EEYA 2BP5M 2ZUQC 2AANA 3H7LA 5LN4A 3BV4A 5CBIA 5BXTA 4N2IA 1SLWA 3QNYA 2CKNA 3E8VA 1BFSA 1KJ2B 1EUUA 1UGNA 1U8NA 5C9JA 3F7JA 1OARH 2EPHA 3QNXA 1E9QA 2FB3A 4NBZB 1IAMA 4JG5A 2EE2A 4PLJD 1BRLA 4G7VH 5DA0B 4QIUA 4HOMA 4MXVF 1CXFA 1I2QA 4LLDA 3P67A 4GSQA 3BN9D 1NSNH 3P3YA 5EOTB 2R1XB 4FQLL 3SCRA 3VCLB 1O60A 3KLQA 2IPTL 4RPPA 3S46A 4OB5H 3QLLA 2GYSA 1ZAGA 4E41B 1B2WH 2DQJL 2NY2C 6PCYA 3ZE1B 3FU3A 4MOZA 3TH6A 4OCMC 2WO5A 5IQMA 1OP5H 1XGYH 3TV3H 1BOGA 5TNVA 5LXXA 1NWSA 3BKMH 1OP4A 2Z1KA 3CJJA 5I8OH 5A16A 5LA2A 2NTSP 2YD2A 2HXAA 3FPYA 4XMWA 1FL6B 4PL2A 5EO1A 1UWSA 4UINH 2BNQB 1T04B 4YVVA 4X9HA 2MPAH 4Q6KA 3GBLA 4GC3A 1WIPA 3H3BC 3V5DA 3EB4A 3MMTA 1PVNA 1T6BX 4M02A 2V3EA 5AAMA 1DQTA 3UZXA 1DQLL 4ZCWA 1ZJBA 3QA3A 1Y0LA 1GHRA 3DI0A 4R96A 4Z1AA 1PZ5A 1DL7L 4MNHA 4A2LA 4G9DB 4N6QA 2OMZB 5IVZB 4XIMA 3U5YA 4D7PA 2DQGH 3NPSB 3M6YA 2BS8A 4LAQH 2JB6A 4JW3A 3ESOA 4RGOL 5BZDA 2FECL 2VXSH 2IO5A 4LLVA 5EORL 2NV9A 2GQ8A 3N44B 4NUGH 5HWMA 1MWAB 3ARBC 5H37H 3NA8A 1Q94A 4N86A 3G08A 1FRBA 2EVGA 3T8VA 1NBZA 1ROWA 3LKNA 3QDMB 1T0PB 1KT2A 2ZYFA 1NCIA 3GQFA 4BZ1A 3CO8A 1MREL 3QSTA 3WDPP 4AMCA 1A4BA 4ZSOB 2MRYA 1HFBA 1D7DA 1JUFB 3I3EA 4D9QD 3A4XA 3HF3A 3LZ5A 3ARRA 5IDIA 1C9DA 4B9JA 3U30C 1PG7L 1RPUA 3IXAB 2PTVA 1SOXA 3VVWA 4AZIA 2HVKA 5GRVK 4F8LA 5LJYH 1TETH 2R0ZH 2G3ZA 4EIUA 1LBLA 2X1UA 2ICWJ 3PWLA 3VFRA 2KL6A 4IQDA 4GP8B 1RCXB 3QEUB 3QNZB 3VI4B 1XLDA 1ECZA 2IFGA 3QDHA 4WUIA 3RBSA 4MHHI 4R83A 3QJSB 4WK4B 4DFHA 4FCAA 1AO7E 3BGMB 5EORH 1F3EA 2RGMA 2RUSA 5GRXG 1V0KA 3NCYS 5BJTA 2HX7A 5HPMB 2Q7YA 2RFGA 1ANUA 3KM8A 5E4OA 1IGTB 4O14A 4S1SL 3CDGB 3C6LC 4IKJA 5DHEA 1S9WB 2AMUA 5F72S 5EO9B 1DQLH 3NFNA 4K3EH 4Z5RB 4J5VA 2Y70A 2AZAA 3Q6FA 5TE6H 5CSGA 2XTJE 3L16A 3VG9B 4N8PA 2I07B 3HS0A 5IT2H 3BOVA 3KPRB 2PDKA 4TXVB 4Q0XL 4I88A 5D72H 5I18H 3BQUD 1B1YA 4CMMA 2ZXDA 4AYSA 4J3XA 2J8UB 4XNZB 5DD3H 3CZLA 5D93B 3QJFA 4CJ1A 3GRGA 3Q5YA 1GGIL 3IFPB 2IANA 1YO4A 3RJQB 2IXQA 1RZGA 4WUUD 1XT5A 4WKAA 2IQDA 4QDPA 4AISA 5AW3B 5MEPA 4S3BA 1LO0L 3E5BA 3BQUA 1OGAD 1W1VA 2PWUA 4J3ZA 3ARXA 3DURA 2WSDA 2O5YL 4RISL 1HZLA 3ZE2F 4ZA0A 4NAJA 4AIUA 4JUSA 3EA2A 1IKNC 3O6LH 5EN2A 3HUJE 3QIWD 5D2NE 5EMKA 15C8L 1FH5H 4BE6A 3TYEA 4NRZA 2BNJA 3GZ3A 4K07A 2V2WA 5GPRA 2ONEA 3BYTA 4XBPA 4BEUA 2CM5A 1JJUA 1RUML 2QV2A 1OANA 1SJXA 4M7LH 2GJXA 4PRRA 1DQJB 1I8KA 1ZLEA 3DX3A 4TTDD 5GJPA 2MKWA 3KYOB 2F1BA 4LAUA 4V28A 2WQUA 3THML 4MAYB 2R2HA 4QRQB 2WV8A 3CTTA 1TX0A 4ODHH 1MQKL 2J4WL 1ADQA 2ZUMA 4GX8A 4L8SC 4GZEA 2CM6A 5E5MB 4OTXH 1DUZB 3WLBA 2WJ7A 5EO9A 4NZUL 5CJOH 4Z5RA 1FDYA 1RZ7L 4JFSA 2J13A 1F4XL 2X9ZA 2VGGA 3EWZA 1OCWL 3IWVA 5KJ4A 2RBLA 3GI8H 4YPGA 1W6WA 1DN0B 4GT7A 2NLIA 5BXRA 1Z7AA 1VBJA 3K2GA 2DD8H 3KBEA 3TC7A 4Y8FA 5BJTB 1AD0A 5A6TC 4NWTL 3HG3A 2YXXA 4WI5A 2DLTA 2Z8RA 1DE6A 2D0FA 3ECBA 4FQ2L 1P43A 1KJ3H 1IM3D 2FFIA 2KLSA 3FCGA 1XKJA 2PDUA 3TFXA 1TUXA 4MQXD 2QKIB 3ARVA 3K74B 4X0NA 4O12A 3GPEA 5ALCL 3PVFA 5KBDA 5CS7A 4FTVA 1ZTXH 3L3OB 3BJFA 3AREC 2K4AA 2Q3XA 1NC4A 2YAHA 3GLZA 1A1NB 4JCMA 5D2NC 5EV7A 2NSMA 3P4NB 5AAPA 3EJCA 1K8XA 2IKGA 5EUKA 3WAJA 4TUUA 4J4PD 3MRBB 2AW2A 5FV1L 4FAMA 1EZUA 2N01B 4R7DA 3TIDA 3MRQA 2QQNL 3PBUA 3HI5L 1YRRA 5BNKA 3CSTA 3K8KA 5DQJB 3VI4F 3MB9A 3KG5A 4WSJA 3SYPA 3B04A 2BNQD 3O4OC 4PODA 5K2ZA 4U3SA 2WPGA 2FL5A 3D69A 2SEBB 4GMSH 3U9UB 4BM7A 4HU8A 2BB0A 5JBEA 1MCRA 4PRNA 3CPLA 3MBXL 4MCMA 4XWOC 5EZJB 1S2UA 2F8QA 3AWNA 4JN8A 2EILB 4RRPM 1Z48A 3MCLL 1YC7A 1E65A 3HC3H 2NNXA 3QORD 4IBTA 3HGOA 2BIPA 2MKLC 3SKOB 3SFKA 2PDQA 3A4EA 3CQIA 4X6DF 3TBSA 2EF9A 3ZFHA 2NX5E 3WYRA 2A2QT 3LSOB 4OT1L 1Y6MR 1VPOL 2X89D 3NJLA 1ISXA 2HJPA 1KNOA 4RGNE 1L8PA 2Z1WA 3PS7A 3BJSA 2IAMD 5DLCA 4BFIB 4BA8A 7ODCA 1QFUL 3V0DA 3ROOB 5E6IC 1NY1A 4Q7BA 3QWNA 2VC9A 5IROC 4FQ2H 3U6RB 3Q8BA 3FNDA 4DESA 1A6UL 4PRNB 1P0NA 4MY9A 2EG8A 5G4WA 5ANMA 2OW6A 2H2SD 3HFML 4IOSA 1GC1L 4MD5B 1KCSL 1N0LA 1N18A 4WHDA 4A2MA 1W6LA 4AYFA 3TF7C 5AC5A 2A2IA 4UB9A 4OZ4A 3MLYH 1K7FA 3MJYA 3AU6A 1HHGB 5DZPA 4WTXA 4F7MA 3LY0A 3LZNA 1VSCA 4LRIA 4Y4KB 3JRKA 4TVCA 3DRTB 3KAAA 1W3HA 1EDHA 3HZMA 4LHUA 4P5TD 4FA7B 1BRLB 1V55B 1HJVA 4MJID 3CHCA 3KP1A 2A77L 1T66D 3VYPA 3H2FA 3CFQA 3N6YA 3TIMA 4DERA 3HS9A 2VN3A 1UC6A 3TLQA 4OF5A 3TNNB 1BYOA 1ICTA 5I1JH 1N8IA 2R91A 2ZZ1A 1H60A 1J5TA 2WB1A 1A4MA 4ZX6A 2A73B 3ZJ7A 2IWGA 4QTHA 4XX6A 1JUBA 2GJNA 2NW2B 4I1NB 4I7ZC 4PJHB 4AXWB 2W0FB 4X4XB 2JJTA 3ARGD 4XMLH 4CVXA 3BSGA 5AENA 4GUOA 3WCYA 1BLNB 2QHRL 1Z9AA 2DT2A 3B9KC 3EKLA 4RX0A 2IAAC 3QO1A 3U36A 2UZ9A 1V3MA 1PDYA 3ZIZA 4WO4A 1KV7A 3D0AA 5F9JB 2O0TA 1KR1A 5EYWA 3SQSA 1NMAH 4Q8MA 3UY7A 1KGUA 2PXYC 4HDIB 5CSBA 5GNXA 4PBXA 1QVOA 3RVUD 3KPPA 2VFFA 1WLHA 3UD6A 3W4RA 4L6HA 5CC6A 5EOQH 4IS6A 4W9ZA 3KL3A 1WUEA 2AI0H 4WY0A 3ZJKA 1WK0A 3DGRA 1I7UA 5CLYA 1IEHA 1QFWI 2JV6A 3EYUH 1H3WM 1HH9A 2H1LM 2HVJA 2XV6B 4MNGA 4XBMA 5C3LD 1IE7C 4OFYA 4NRYB 2FIQA 4PGCA 4D8LA 2DLFL 2J74A 3LV6A 1B3IA 1ROCA 4L37B 1JPMA 5EU6E 3KOFA 1GRWA 2VDOL 2ORBL 2ZNWA 3E3QC 2YUWA 3P9MA 2GB2A 4OCRH 5C9XA 3B56A 5IMKA 4XBPB 2ZC8A 2EDWA 1XF5A 4J28A 1SJHA 1RK7A 2ROXA 1R9ZA 2VGIA 3QCVL 3WTSA 3T1FB 4RDYA 5BQDA 2H26A 2X0WA 2DWEB 4HJJL 4XXCA 4RFNB 1G9HA 3T2NH 3TC9A 5J56B 1T0OA 1RZ8B 4LUSB 4MFDA 1XIHA 4Z7UF 2QV4A 3THAA 4KKCC 5E7FA 5I9QB 5E2JA 1I75A 4LCUA 1OOAA 1XLAA 1T80A 2X1WL 3LNHA 5AW9B 4E4FA 4S11A 4LPVA 4IU3A 4GAAA 2IXQB 4XO8A 4MLRA 2YBRB 1G7HA 3UGRA 4OZHB 4G1MA 2WNWA 3SYOA 5HP5A 4YHPB 4E9VA 1EEYA 3DI2B 2VE6A 5F9OH 1GJWA 1J9QA 1QMLA 1I8IA 1TJ0A 3PAZA 5GRJL 4L6DA 3IYLW 5FAAA 1HL4A 1HNFA 3W70A 3EHBD 1WA1X 3KYKH 2NY1D 1CD1A 5FYJU 4DPAX 1IAKA 5HI5C 1KWGA 3R8GA 1LMIA 5DZOA 2XVKA 3D87B 3G0XA 3VDGA 2A1WH 4HDIA 1FWJC 4LLWB 5HNUA 1GQNA 3IRZA 1GOIA 1I1AB 1W3TA 15C8H 4JKMA 4NC0B 5FGCB 1BXUA 1D7CA 3BAEH 1BQSA 3GTNA 3NVQA 1ZLDA 2FNWA 4ELMB 1E7UA 3FCUB 2YQGA 4GC4A 3SGGA 1DXIA 5LQBL 3TN6A 1EJ8A 1CYWA 3K2UH 3QRBA 5IG7A 3X3GH 1KJVA 2UVEA 1IJ9A 5AW7B 4EUPB 1BAWA 1QNOA 5A2FA 3IXTA 3ZHDA 1K6QH 3K46A 1H41A 1VGKB 3E12A 3HQ1A 4IT1A 4WOZA 4N2AA 4QJ4B 5DC9B 4FG0A 1J1OL 2NY7H 3NSDA 4CADA 3P60A 1XG4A 3A6BL 3I9AA 4HPOL 1H5YA 3ISIX 3FH5A 5I17B 1EJTC 3UTSE 1F97A 1T1YB 5EY5A 1FWXA 1X7SA 3CWOX 3DFHA 1MHPL 2QVTA 3MRLA 5DMGC 2JKTM 4DBSA 2PRMA 4ZFMA 4OF7A 1SHWA 1YPZF 5E99L 1W3KA 2OJPA 5CP7B 2YD8A 1Z32X 1A7OH 3BVTA 1P9MA 4RGND 4XB8A 3TH4T 1GC1C 3VFPA 2J9XA 1WTLA 3QBUA 5ANMB 1CK0L 4C56A 4HIXL 3GIPA 2IKJA 1PBGA 1TEYA 2YLLA 3NO5A 4N90D 3I6TA 3GAKA 5TF1H 2W5PA 1OCBA 3U6RA 3V4UL 4NNAA 3G5ZA 4H26B 4G9DA 5IVZA 4K1GA 2V17H 4FEMA 3H8AA 3PZIA 4O28A 1WFTA 2H6OA 4OV6F 5CILL 3UF9A 3LK6A 4GUPA 4Q8WA 1WEJH 4G6CA 1UOZA 4S2SB 3NZ8A 2PWHA 3S36H 3T0BA 4JG0L 2Z91B 2CCLA 2WXGA 1LO3H 1J5IA 1O5DT 1WIOA 5I8KH 1EQPA 4HCLA 4U6HA 5D1XC 4DQOL 2UV8G 2DQUL 3CXHJ 3RPKA 1LE9B 1M5WA 1FNHA 3NQGA 4CAGA 3IPEA 4N68A 1W31A 4LLMA 5DK3A 4WW1A 5FUCE 4WQOA 2D2HA 4UTMA 3J07A 4MPKA 4X5LA 5DURD 2ZA2A 3WH7A 3A21A 3X3FH 2W9EL 1HILB 3TH2T 3E49A 3FYOA 3GMLB 3URBA 4DJEC 2ZTBA 4KHXH 1EF2A 4LJ3A 1L9MA 2XN9E 1FSKC 1QZNA 4U3SB 4YNGA 5DXYA 3WIJA 4QR7A 1IIIA 1W91A 2MH4A 1ZHBA 2J88H 3QDJD 4NJAH 4QHUB 2J77A 2PSNA 3KBVA 2YQ2A 2Z7ZA 4JLRB 4YE0A 3S5LA 5GS0L 1FLRL 4E9LA 3S5OA 4XMPH 4L1DA 1W1PA 4GKSB 3GIZH 3ZDZF 2UYLA 5IJBC 1WDSA 2ATKB 3WH5A 2CESA 1B4RA 2ZRUA 4OQ1A 3TQPA 1A3ZA 2XIDA 1MAJA 5J6GA 1CDIA 4PI2A 3SJVA 3FCTA 3SQLA 3N3EA 5T33L 4LLQA 1N70A 4V2CB 4A7GF 5CJXC 5D70H 5DVNA 4WW2B 2KBGA 4Z0XB 4X80H 5I1HL 1B30A 5B7EA 3FV9A 4ZGYA 3TN0D 3O9WD 1M53A 4QY8B 1RK6A 4YHLH 3M0HA 3TZNA 3C52A 3UYCA 5E6YA 3MODL 3ALWA 4JFUA 5FM5O 2ENPA 2J47A 2FRGP 4PJ7B 3VIKA 5A6BD 4GI8A 5F3HA 3C09C 1IEXA 4AK2A 3FQXB 3HJZA 2VXUL 1YYMH 3VI4E 1W0WA 1HTIA 4G6AD 4PUBH 4KTEL 3M0XA 1PD6A 2B20A 2XPYA 2PDMA 4JDTL 4XCFL 1KLYA 3U0WH 4HSHA 5LLIC 4LHUG 3KHJA 4JO1H 4A6YL 1LNUA 3MGOA 3O6FA 5C0FB 2BNUB 4PW3A 4NX5A 1T3FB 4WJ8A 1J2WA 1AKJB 2IALB 3LSCA 4JFEA 1T89C 4X6DE 5C55A 4PJHF 3REQA 1F90L 3BWAB 2YPVL 3CXDH 4A2DA 3GTHA 1HVXA 4M9PA 3RDJA 2P5WB 3CUXA 4TSCH 1OP5K 1IXQA 3JUGA 1DVTA 5D1QA 2CRMA 4IRJC 4QM1A 4K8RH 3D30A 2A1YA 4HK3N 1UCBL 2X53A 1O4UA 5T3XD 1WNOA 1BM3L 2H0EA 2X2IA 5F3FA 3S88L 2QJHA 4NPJA 2ZVRA 4P23D 5DX7A 3CFEA 4HOWA 1ZK5A 3I84A 2PYFB 3RMEA 1QBLH 1S6NA 2QKFA 4JTEA 1QFHA 5DK0B 4XCFH 5LBVA 1PCKA 4DVRH 3UR2A 4F5CA 1D5RA 2V5YA 3PWNB 4WO4C 1KLGA 1W5PA 1BBJA 3LCWA 1LBMA 3TBVB 4XZIA 3SUVA 2HUHA 5LNVA 3KPSB 2Z25A 3B40A 3HPSA 3CFMA 4M6PA 1XIIA 3A3WA 3F5JA 4TOYH 5F96L 3ATBA 4HPXA 2Z7UA 3MRKB 1UWQA 5DJZA 3G8EA 4M81A 3L9CA 4HD5A 2RACA 2ZCKL 4HH9A 1KYOJ 2MJWA 2O30A 4NCDA 4P99A 5EBWA 4CMMB 3MRDA 2OB3A 5TGBA 1A9BA 4KBXA 3KPRA 4PJCA 1XFCA 1ODUA 1P7HL 1TXKA 3ZKXB 4EN3D 2OTPA 3CFDB 4WV1B 2EVHA 1WBZB 2GTWB 4R0LC 3W11C 4FQHA 2QVKA 2PYEA 1T6VN 2AOSA 1WXYA 3VGFA 3EO9L 4QMEA 1BWKA 2J25A 5GGRA 1R3YA 3IVSA 3NJJA 3VKAA 2NQDA 4KQ3H 2VX5A 3D51A 4PJAB 3FUFA 5E9DE 1XS2A 5SX4I 2ADGA 3E6HA 3L0NA 3PNUA 3RWJA 4KO9A 4BFNA 4DWHA 1E0TA 1PDKB 2B0SL 3I6LD 1XICA 2ID5A 3DMMB 4OGXH 4HC1H 1F2JA 5C0JB 1HIMH 1L6ZA 2B5IB 5AD0A 4J27A 4KEMA 4QAIA 3C5ZC 3F03K 2F74B 2XJLA 1GS8A 2HFFB 3L5JA 3S83A 3RTQA 3EOOA 3UJEA 1N2VA 2Y24A 1GMEA 4JR5A 5IHHA 3CQ0A 2P4AB 3RYMA 3OBKA 4IKKA 4M6MH 5GGRB 4XCNB 3MUAA 3NIFB 3FO2B 3L3GA 1J8SA 4Z1BA 2FZBA 3RY4A 3TLLA 2VDNB 3QAZB 1PIGA 3CIXA 4NC1C 1J79A 5DY2A 3LKNB 3B7TA 3QDMA 3U0WL 3TFKD 1E9LA 1HHGA 3C87A 1S9YA 4L3EA 4M7LL 1BFNA 3L68A 4L4TA 4R88A 1B88A 2G9HB 3GNMH 3B8VA 2PN5A 1AGCB 1UH2A 4QGCA 3D3AA 2VL5A 1R9XA 1C8VA 4GXVL 2B7DT 1H7XA 3IKKA 2AJ3A 4HPYH 3SIKA 1N4XL 1QUNB 1R3IL 3F8UB 4ZW5A 2I57A 4HSCX 4J3UA 4DP2X 3NJFA 4WAFA 2XA3A 5HHQB 4YSRA 1FP8A 1G01A 2NV1A 1QK0A 1K8DB 1M9WA 3D2UB 4HZ8A 4ATDA 1WSST 3CZ8A 1UA7A 1KCRL 3T8XA 2V0AA 4FQIL 4C83B 1C8YA 2NQ9A 1KXQA 4FQPA 4JVPA 4KRPB 5FECB 1U0QA 4PRHE 2TODA 1YJDH 1MFEL 2BJML 4P3CL 1C29A 3F7RA 4Y4FB 3LERA 2Z64C 3GPSA 3N6JA 3ETBJ 3CH1A 4WEMB 1Q0XH 4IIGA 4NKCA 2BY2A 1EDQA 4XN2A 2BNQA 2V5BA 1BZEA 2DKUA 1MEXH 1QPRA 3W2LA 2YN3A 1RJZB 3V4VA 3KPMA 3RBGA 4HOXA 2G8ZA 1K3ZA 3E0IA 3EJUA 3G1VA 3L5MA 4M3PA 2VR6A 1IB5A 1FDLH 4EZMA 2WKLA 1J0KA 5FKPB 3FA5A 2GGJA 4GQBA 3A6BH 5K9DA 4OCYH 3WS6A 1M1BA 4NJAL 3D0VB 3PB2A 2Z0BA 1ED3A 3OG4B 3RVXD 4DCQA 4PREB 5E1HB 4BJHA 4ALAC 1XDMA 2B08A 4G2AA 4RDQF 3HNTL 2Z7WA 3L08A 4PJAE 5E9DB 1L9OA 4TVPH 3RPDA 4ZMGA 1ZT7B 3BEVB 4KQ4L 4TL5A 8PAZA 5GS1B 1Y5WA 3AO0A 4L05A 1I0DA 3P80A 4HN8A 2HX8A 4N42A 2W65A 2XXMB 5EUKB 1OADA 2NWSA 5H4ZA 1DBMH 3MRFB 4UM8B 3SCPA 3ARGC 5ECVA 4FQCH 4QRRA 2F58L 3QQ9D 5ITFB 3CBRA 2E8ZA 2W9EH 2PTTA 2XINA 4HHGA 4PUDA 5IBXA 2O6DA 4NJ9H 1BAFH 2XQBH 4YAQB 3D52A 1KCWA 1FZMA 5A3IC 1SQMA 1UZDA 5IIEB 1ZT1A 4NQCA 3K5SA 4U6TA 3MI3A 2H1XA 2VZVA 4ENEC 2WBKA 4KK8C 3L3JA 2DDXA 2QGEA 1U1UA 4H00A 4AEIH 5DMLA 1UOKA 4JG0H 1S39A 1L0PA 3NJXA 1XIWD 4ZUVA 2XPKA 1A5SA 4MY1A 3X11A 3QUHA 1B4JL 1E5YA 3ARBA 4X6FB 4EAEA 3HEIB 1IBFA 1U8KB 3DJ9A 1QI2A 1KQYA 4BZ2H 1XYLA 2VC6A 4RXFA 3GSQA 4AH7A 2ZXBA 2DMGA 3DYPA 3GIVB 5DMKA 3PL6B 2PDXA 1U8HA 3P0VL 4XB7A 3M5XA 5EF3A 4GNVA 3VD0A 2X2YA 3MR9B 2PTWA 3M0KA 2UWEB 1NWTA 1D9KD 4EEEA 1E6SM 5BOOA 3MJ8B 4WWPA 1I8KB 5FFGA 25C8L 5GZOC 1HP5A 4D7BA 5T1MA 3N2JA 3VUPA 3KYNB 4AW7A 1SW7A 4O2EB 1RLDA 4XKYB 3GMRB 1NAKL 3LMJL 3N50A 5CJXA 4LMQI 1PU0A 4S1QL 1XLEA 1MIMH 4MS8C 1DIKA 4H1LB 2XWBA 3GSXB 1AXSA 5AHIA 3KOXA 3QUXB 5BV7L 5DJ6A 5B38G 3I4KA 3MV8E 3OSKA 2FWOA 4H8UA 3QZ6A 5EGRA 3W39B 1VFHA 1OTTC 4OI8A 3X3GL 4GOSA 1NAML 1NTHA 5HVWA 4PJ8D 2IMMA 3M0VA 3TNOA 4Z7IA 1QUNA 3E6FB 3QIWB 2J21A 2PTUA 4KVNL 2VXQA 1A8ZA 4XMTA 5JZ7C 4WWKC 4Q8TA 3I6LE 4IL0A 4W6WB 3RB5A 1F4AA 4I9MA 4WTZA 2V2XB 3GX9A 5DJ2A 4JO3H 4GUGA 4K7PY 4S1DC 1X5YA 4K9EL 2Q5BA 3ABXA 2DJUA 3GHSA 4JDEB 4PJ5E 2NVDA 1KFGA 5AW0B 1NEZB 7PTDA 3LHZA 2X9YA 2F58H 1A5MC 5EBAA 1T1YA 4C56B 2ZYRA 4IYKA 3RWIB 3QY7A 4PUEA 1F73A 3WYZA 3GF8A 3RU6A 2XICA 4L5ZA 4L1SA 1VADA 4LF3A 2HFFA 4BEQA 4L1HA 4JX6A 1GONA 4JTSA 3W37A 2D3JA 1KC5H 4LOUD 3QDGA 2BZDA 5EMUA 1PFCA 2MQGA 1B0IA 1OZTG 3WLNA 1G6RL 1OCNA 4O02L 4JIHA 5CD5C 4Z7UA 2F7IA 4AB4A 1Z66A 1QEXA 4GMTL 1RK0B 2FTAA 3TYBA 2CPUA 5BMWA 3GDKA 1OE1A 3GH5A 5EU7C 5HGDB 3STZA 3NZSA 1HCYA 5CGBA 5EBLA 1RU9L 2LVEA 2E9JA 4ICMA 1R38A 2YMXH 3RM8A 1RUQL 1FOBA 1H19A 3CFDA 4WV1A 1O5RA 1PYFA 1RIVL 4WDUA 3WF4A 4ZTPL 2FGWH 5CSRA 1F58H 1ZE3H 4JK0D 1YMHA 4QF1B 4U0QB 4UNIA 4US5A 1HU8A 3NK4A 1IBGL 4DTGH 2B59B 3B3IA 4ZNEA 1VHPA 3RFZA 4LLVB 2J8OA 3T6VA 4HTYA 4Q74A 2QMKA 2XXFA 2NOYA 4PRIA 5DQDL 2GEQA 3MRKA 1TSIA 3DX7A 4A7SA 2BC4A 5D37A 3TCSA 1W9BM 1NEZG 1I82A 5CBEA 4J1OA 4K39A 1HEJC 3VJ6B 1B3VA 1E1CB 1I7ZB 2E8YA 4NXKA 3GSWA 3CN3A 1L7TH 1AHWA 3TNMA 1R9YA 2IPWA 4RMWA 2R1KA 1YECH 1Z9PA 2X42A 3IDIB 3C8FA 5EN3A 3SQBB 2XZCH 3CC5A 1UT9A 1BMWA 4LALA 1GIGL 1NCDL 3GDBA 5JDJA 1MVUA 3BKJL 3NCWA 1LOQA 1IT9H 5IBUG 3VM7A 1JPTL 1VPYA 1H8OA 5KSAA 1M3UA 5JMRA 3P82A 1UWXH 2O72A 2Y72A 3KLAA 3L1FA 3LN4B 1T83C 5D71L 4UTAH 3W7KA 2J9ZA 4DO4A 3AYRA 3QZWB 5BVPL 1D5XA 1TJRA 5T8GA 2PFHA 2E7LC 3G1SA 1H1YA 3OAWA 5CUSH 4GG6A 1A6WL 3RGHA 4OOUA 2EXYC 3QH3B 3SCWA 1P84J 5CN1A 2B4CC 1WYIA 4EQ3A 5EZIL 2BNUA 2VW7A 4JEJA 4G8GA 4FZIA 3UC2A 1WHPA 4K3JL 3FB7B 1QEWA 2AV7B 1SLUA 1B4LA 1IIKA 2NZ9C 4P57A 3CUJA 4W9KC 4NQDA 1GG0A 4N1CA 4C8XA 5CKAA 3FB6B 1J11A 1EA0A 4X7EC 1RFDL 3S37H 4DFIA 4DNMA 1YN7A 4IM8A 1ASQA 3O6KH 4DJFC 3HG1B 3RO8A 3S9ZA 1RL1A 1JF1A 5TQ2H 2W60A 1N9PA 3BDBA 3RAOA 5F2GA 1OSPH 1YUHB 4XPHL 1GPOH 3R0NA 1T6WA 5F0LB 1OALA 4HSQA 4YHKL 5TJWK 1AQMA 3PJLA 4V11A 4ZDHA 3TNNA 2PCFA 3K2KA 4GRWB 3TT1L 4YJZL 2AQ1A 3ARGB 5J06A 3QDJE 3EOLA 4FPSA 3ILEA 4UM8A 1H9VA 1T7VA 1W56A 4XN4A 3MANA 2W65B 1O6SA 4Q9RL 3GSMA 5H2BA 4WENB 4MXVE 2VITB 3P2VA 3VFUB 4ADUA 4DVRL 3FFOA 2OMYB 3OKKA 4O18A 4AZ6A 2XZ9A 3MV8A 4CU7A 5D7IF 1H9DA 5CO1A 1I1CA 1JF6A 2ADIA 2F53B 1E4IA 1EC7A 2UV3A 1F6PA 3R12A 1XBDA 1MSSA 4NNCA 4C7GA 1ZBCA 4DGIH 1T7LA 2CBIA 4NM8L 1XR9A 4K0OA 1NUNB 3O2DL 2CO6A 4MZRA 4M7ZC 2AJZB 1F4YH 4BZYA 1EUNA 3EWWA 3VTRA 4BI5A 1RHFA 4QE4A 3QZWA 3TWCL 2O61A 1GTEA 4W4OC 2TRSA 3INPA 1FFRA 3IGFA 4OFDA 1MCIA 1SZNA 3MSDA 4URIA 5DJYB 3MFFA 4APQC 1XLLA 3SB3A 3WLRA 3GEFA 3KLAB 4P3DB 1ZZMA 1IKFH 3FKKA 3EGDA 4RDZA 3PHQB 1XIJA 5TDPA 2F6XA 1FIGL 2VDPH 2GSIA 1OJXA 4I5RA 3SYQA 5AW8B 4N9GB 4GISA 5E4IA 4F1SA 4YX2L 4NYLB 2Z35A 3ZIMA 1XYCA 1KN2H 3RLVA 1XH3A 2V2HA 4I0PA 3IWUA 4HT1H 5GS1C 5JHDE 2JF6A 5K1JA 4PJ5D 1S3TC 5KSAD 3WO4B 2QDGA 3T8XB 2K4WA 4M5YH 1SFHA 1SMDA 3L4YA 5I76B 1QFEA 4N2CA 3H7RA 3MLZL 4I6KA 3ITYA 1NGZB 3ZKND 3CUZA 1MW0A 1SVCP 3AALA 3WCZA 1MFVA 4L9ZA 1UM6H 3TZVB 3FKRA 4PMDA 5DC0A 1JNLL 4HIJA 3UNTA 2I5YL 1XGQA 2TSBA 5DJ8B 2XY1A 4CKVX 2DQWA 2XTJC 2V81A 3BZ4A 2B9AA 5AKVA 1RUKH 4N2LA 1WCBA 2OMNA 4H8WL 5B1CA 1MZRA 5DRWA 4ABUA 4LVHB 2XPGA 4N4PA 5CC3A 3P74A 4E68A 2CLFA 5EZLA 3BP4B 4XBEH 3VSTA 3D3VA 2HTLD 2Y2WA 5C2BL 1FWCC 2YOAA 1RXLA 3KWXA 2WUBH 1X5XA 2Q8ZA 3BW4A 3NOYA 1BFVL 1H6TA 1T4WA 4HB7A 1JPTH 2VABB 3GUFA 4XX1G 4F2EA 4QRAA 3Q3GB 1GOMA 4QISA 4OZGB 2WMHA 4WCJA 2HH0H 1YXDA 3QKZA 3GC3A 4JFPA 4NGHL 5DWPA 5EUOE 4OFPA 2X88A 4TL4A 4MSSA 3UXDA 5JIIA 4D8AA 4K8HA 1BQHA 4LSVL 1CFQA 3DUHA 5D2LA 3S8FB 1BYAA 4JQIH 1I85A 3MAWA 3CIAA 5I79A 2VDGA 1K85A 2Y06L 5DMMA 4M3KB 1SZEA 3QGVA 3JWOL 1MIML 3PWPE 1UT1A 3T09A 1LO0H 1XIFA 1CGSH 4D8PB 1KM2A 5CU9A 3GKZA 5IB5B 2WTOA 4F9PC 1NEYA 3W1LA 3VFCA 2NRDA 5AKRA 1F3DJ 5BUPA 3LIZA 1N10A 3QJRB 4LDEB 2QQKL 3WFZA 3ZRSA 4Z7NF 1NDWA 2GVGA 2W6RA 3QEQE 3B3DA 4TV6A 2J75A 5IFJB 1Z8AA 1DTUA 4ZTPH 3V5OA 5CCKL 3SBWA 3TUUA 3D9AH 3FVDA 2C3VA 2VYRE 1QT1A 1SXAA 5A69A 1X4YA 2YGNA 3MRGB 3GXIA 1C7SA 1XEUA 3SO5A 4UTHA 2E74C 4W81A 2CMRL 3BSMA 1BVNT 4OVXA 5KJRL 1V08A 2RJGA 1DJXA 5HHNB 4IK6A 4O58L 4U1SB 2V69A 3BLLA 5JBFA 4OZOA 2YBRA 2EDOA 3IIOA 5AYTA 4GSDH 2R1WA 3MNVB 3K4ZA 4G8AC 5LZLA 3W39A 2LE9A 2X4SB 2A3BA 3BQUC 3WNNA 4KRUA 5ALBH 4AQEA 3CVDA 4Q8BA 1YX1A 2IPTH 4H5SB 4ZZFA 4CD4A 4H88H 1I0BA 1JULA 1MRQA 3SRFA 3EW3B 4LAJH 1JXDA 5KYNA 4OV4A 4XMZA 1EKOA 5DHXB 3ZTJH 3AG2B 3AU1B 5HDRA 1FYTD 4RUBA 2X70B 3U46B 3ENEA 5F7LB 3VINA 4F66A 5L2JA 2VJ8A 3P9MB 1CX9A 5AEAA 1U2CA 3QJFB 4I0CC