2WSPA

Thermotoga maritima alpha-l-fucosynthase, tmd224g, in complex with alpha-l-fuc-(1-2)-beta-l-fuc-n3
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
443
structure length
435
Chain Sequence
KPRYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNGMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Beta-Glycosyl Azides as Substrates for Alpha-Glycosynthases: Preparation of Novel Efficient Alpha-L-Fucosynthases
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords ALPHA-L-FUCOSIDASE, PUTATIVE
total genus 152
structure length 435
sequence length 443
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wspA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wspA01
1XCWA 3GXFA 4TUFA 1IT0A 2CPUA 6CGTA 2W91A 1UG6A 4NXSA 1C91A 4WJXA 1CGUA 3DHUA 3DDGA 4ATWA 4DWSC 2OW7A 4OIFA 4FNRA 2WAGA 3L4XA 3MU7A 3AQUA 2XYLA 2X1IA 4AD2A 2YA2A 2Z1SA 1J0JA 4UQCA 1NOWA 1WZLA 1EHNA 1GOIA 3IAPA 2VUYA 1ZJAA 1E15A 2ZUTA 2YBUA 3HG2A 3BXWA 4BQ2A 4H8VA 1I1WA 4MAZA 1GVIA 3SUUA 4UFJA 3SCQA 1GORA 4AZCB 4UCFA 1JZ4A 2ZX6A 3WF4A 3WQ6A 4FF5A 2HVMA 3VIJA 1W9DM 2WVSA 3SUWA 3LXBA 4H2CA 1KBBA 1W2PA 4JIEA 1JZ8A 2OW6A 4R5EA 1E6PA 3N12A 4GZJA 4M56A 2XPKA 5EFDA 5E70A 1XHGA 3GNRA 4DO4A 1NOUA 1ODZA 4UQ9A 2RGMA 4U3CA 3EMQA 4D6DA 1V08A 2V3EA 3WNNA 2WSPA 3RIKA 1JYWA 5HXMA 5I23A 1GQJA 3CUFA 2VX5A 3H54A 3RCNA 3RPMA 3GXIA 3ARZA 1KR0A 1W1YA 1EQCA 1J11A 2ZUVA 3VGFA 3BVUA 2JEQA 3U7VA 1E71M 3AIVA 1T0OA 3S5YA 1DWAM 2ZUMA 3W37A 2XJ7A 5DEZA 3HJEA 4LQ1A 1A3HA 4BZYA 1OD0A 3IANA 4OUEA 2PC8A 4PBGA 4UZSA 3MMWA 2DDXA 5I5RA 3VO0A 2ZOXA 4CU7A 2XVPA 2WVTA 2WCGA 1OT2A 1ITXA 4TXEA 4B15A 1KB3A 4UOQA 4W85A 1BVNP 3LXAA 1HXJA 3NSXA 3DX4A 1E4LA 4P7NA 3LRKA 1GOQA 2J79A 4C7DA 1ZL1A 1BQCA 3RILA 2XN0A 4PTWA 3VNZA 2BFGA 4AD5A 4MAVA 1M53A 2NT0A 3B8SA 4CU8A 3VGEA 3A4WA 4ZXLA 4QCFA 4Z2GA 1L0PA 3PZQA 4UOZA 1OD8A 3CHCA 1W3HA 1K9DA 2W62A 1C8YA 1FH7A 4D1JA 4P8XA 4LPCA 3K4DA 3ZM8A 2D20A 2YJQA 2V38A 1XD1A 1GQLA 4W86A 2J7HA 2BXZA 4ZE4A 3DX3A 2X09A 3W6MA 4F9DA 3PN8A 3WEOA 4DUWA 1J01A 2Y5EA 2ZUUA 2OWCA 3T09A 3VIKA 4NZJA 2VX6A 2CHNA 4HA3A 4H8HA 1MW0A 2DSZA 1FFQA 1FH9A 2FGZA 3GDBA 4X0VA 4XZWA 4W89A 3VD9A 1HXKA 5CXPA 2BY2A 3TONA 5A6MA 1QWUA 3IJ8A 3WUGA 3WFLA 3AMDA 2DQXA 2J75A 1JAKA 2AOSA 1OGBA 4AZBA 1E4MM 2J74A 4JHOA 3CZLA 4M82A 2CEQA 3ARQA 2EPNA 4BQ4A 3MO4A 4RE2A 1E3XA 1LG1A 2GUYA 2F8QA 4D71A 3RM4A 1JYVA 3ZIZA 5CGMA 5LA1A 2PBOA 2IGTA 1V03A 2O9OA 1UWSA 1H5VA 2VZSA 4AZCA 1U30A 5E0CA 5A8NA 1QI5A 1QBBA 2WWCA 1TVPA 1QW9A 1EH9A 1FP9A 1OGSA 3TP4A 4U5IA 3HG3A 3ZOAA 3VIIA 3UCQA 4KGLA 4D6CA 3LPPA 3HZ3A 1E4NA 1IZKA 1B30A 4PMQA 3DYMA 3D52A 1TCMA 3BAWA 3FHAA 3GXMA 3TTYA 1HF6A 1UR0A 5A94A 1XCXA 5GPRA 3AOFA 3ARTA 4KMQA 1CLXA 1ESWA 4C7GA 1Q4NX 2CBIA 1GHRA 1KGXA 3IK2A 2YL5A 4F79A 1B1YA 3K4AA 3SUTA 1E9LA 3ZT7A 1B3XA 4UQAA 4OKDA 1SFSA 4HZ8A 4J3UA 3RMEA 3WDRA 1ZS2A 4AD1A 3AI0A 3WF3A 2UY5A 1QBAA 5GQBA 3UESA 3EJSA 4Z2JA 5LYRA 5AC4A 1NWSA 3GH4A 5ABFA 4F8XA 1NP2A 1FFRA 2VCBA 3MV11 3WD3A 1CENA 4PMDA 2Y8KA 3AS3A 3AS2A 2UY2A 1EO7A 1NARA 1E3ZA 2D73A 1JFXA 3M46A 2MANA 3UR7A 2BHUA 3VM7A 3ARRA 2J8FA 3AIEA 1KQYA 3OBAA 1D3CA 2EEXA 1OINA 4M8UA 2W4XA 3DX0A 1W9PA 1JZ7A 1WZMA 1MFVA 2QV4A 4WF7A 3AIWA 1X6LA 3AISA 4OZOA 2G41A 3ZQ9A 3WDIA 3A23A 1W3JA 3OZPA 3PZOA 1ZJBA 1MW2A 5CQ1A 1ZB5A 3F5JA 4N42A 4CD6A 1RD6A 1V0MA 4U2YA 1TZ7A 4CCCA 2CBJA 2W61A 4BQ3A 5BRPA 4AEEA 4BCEA 3OGVA 3U57A 3MI6A 3WQ4A 1UR1A 2YL6A 3BVVA 8CGTA 4F66A 3VIPA 1GOWA 4AEFA 3CTTA 3AZSA 2J77A 4W8LA 2XGBA 1KR1A 2EADA 1WCGA 2CBVA 2CKSA 2GJXB 3OLDA 4NF7A 3JUGA 1AMYA 4QCEA 5E6ZA 3PTKA 3PZMA 3RDKA 2A3HA 1CXEA 1VFMA 1W2VA 4MNJA 4RE3A 4YHEA 1XSIA 1UOKA 1J0HA 2JALA 4E8DA 4W88A 8A3HA 2XSAA 4DWSA 3BSGA 4P8UA 3VGHA 3GNOA 3DC0A 3CGTA 1KCKA 1E72M 3BVTA 5E09A 4PMNA 4RL3A 4GQQA 2G3NA 2WHKA 3GTNA 3CUJA 1PBGA 3A47A 4WSKA 4HPHA 3LXCA 1HWWA 2IXUA 4M1RA 1E6QM 1WP6A 1V6VA 5CPTA 2X2IA 3SUVA 5JUVA 2XGIA 3T0BA 2C0HA 7CGTA 1EOKA 4TTGA 2FH8A 5I2UA 4XX6A 2YA1A 3GNPA 4ACZB 1QWNA 2WMGA 1G9HA 5CJ5A 3TV8A 3G6MA 1V3LA 3S6TA 2YLLA 3W27A 1YHTA 3J7HA 4UR9A 2ZXDA 2X0YA 1E5JA 1UH3A 4QP0A 1J0KA 2VZVA 3W24A 4UQEA 1GQIA 5EFFA 3WMCA 3WNPA 3QHOA 3AZRA 1WZAA 2J7GA 5BCAA 3AMLA 1VIWA 1H0IA 1R86A 1UR9A 4NX0A 3AJ7A 3O9NA 2VX7A 4E2OA 4AXNA 2V5CA 1N82A 3OB8A 4Z2KA 5BWFA 4HA1A 3N11A 2ZWYA 1V6YA 3N9KA 1E55A 1UZ1A 1G5AA 1W9BM 2OSYA 5A8PA 4WLCA 2Y24A 4MDOA 2YDRA 1HL8A 3AXIA 3WY4A 3N13A 4YPJA 2WNWA 5M03A 3N18A 2FGLA 5HNNA 1UD4A 2OSWA 1P6WA 1R46A 1F4AA 3CH9A 4QLLA 5FKYA 3WFZA 5E9AA 1WPCA 1CZ1A 3WY3A 2VURA 3ECQA 2Y8VA 4AZ6A 4AZIA 2ZE0A 3WH9A 1MVYA 2WWDA 3K46A 1QHOA 1V3MA 1E56A 2WHJA 3VD7A 1V6UA 3K8LA 1XSKA 1H1NA 4JFWA 4TVDA 5A6KA 2WMJA 3VU2A 1UH4A 2WCSA 1H11A 3EDKA 2F18A 2TAAA 3WN6A 4KRUA 1YQ2A 4HMEA 3WMSA 6A3HA 1E4IA 3A24A 1BVZA 4MB5A 1UWTA 5D9PA 2B31A 3MANA 2DSKA 3EJPA 2WMIA 1GNXA 4U31A 3BVXA 2XN1A 2GJXA 2VCAA 1R33A 2BHYA 3WMBA 1US2A 3SCWA 3EMCA 4E8CA 1LG2A 1VENA 3QOMA 5KEZA 2XIBA 2AMGA 3VUPA 3VGBA 5I77A 1R7AA 1E43A 1R47A 1VEMA 2VCCA 3QOKA 2WPGA 1D2KA 3OA5A 1KXVA 1TQSA 3AHVA 5I79A 4PEEA 4DWSB 4FNQA 1PIFA 1QOXA 2DIJA 5DO8A 3U5UA 2DT3A 3EJUA 2CHOA 3LX9A 3THDA 1Z32X 3WL0A 1O7DC 3WNKA 5ABFB 1J18A 2PB1A 1E0VA 2W5FA 3T2PA 1TQVA 3BAKA 4JFTA 2EABA 4HMCA 1M01A 4LX4A 1UUQA 2X2HA 2PWFA 2OYLA 5HPOA 3KL0A 5JIWA 3EDEA 2DT1A 1JDCA 3PZTA 5A69A 1ISZA 1BYAA 5I6SA 3GXDA 4CGTA 3ARWA 1KTBA 4QDMA 3N04A 3OLGA 3MSDA 4PUEA 1VB9A 3K8KA 1GQKA 1JGIA 1KWKA 1J0YA 5LA0A 3CMGA 4GXPA 4J3TA 3QHMA 4GINA 3DHPA 3ARUA 2QMKA 3O6AA 4MB3A 3MUY1 3BAJA 5CPQA 2EQDA 4HU0A 3BLKA 2CBUA 1C92A 4H8UA 2EPMX 4CU6A 2VR5A 5CLTA 4NI3A 2XFYA 3W82A 1JDDA 1CDGA 3EBVA 1JFHA 1HKMA 2D24A 1GJWA 3VMOA 1V02E 1WB0A 3HG4A 4FK9A 3A4XA 2FE0A 4P7QA 4P7RA 3FAXA 4UFKA 4P7OA 1C7SA 3VILA 2VTFA 3WBEA 5CG0A 3SCOA 1WDSA 2EPOA 4OGZA 3AHYA 3HMCA 3AMCA 1VF8A 4PN2A 1LL7A 2D23A 2J4GA 1QNSA 4YN5A 5AC5A 1LWHA 1AQHA 3BSHA 4NRRA 2EAEA 2ZX9A 4D6IA 4UOJA 5JIPA 1TR1A 4B9ZA 2WHLA 1CNVA 3FAWA 1OB0A 1WE5A 2XN2A 4ACZA 1UQYA 3LPFA 4GO8A 4PCTA 2PWGA 4DO6A 1IZJA 4GQRA 7TAAA 2WLZA 1UR8A 5I78A 1LQ0A 4AYSA 4PTXA 1XV8A 2Q8XA 3VSTA 1KTCA 1K9FA 1B3YA 1L8NA 2O9RA 2DT0A 3WQ8A 5GNZA 2ALWA 2CITA 1CBGA 1V3HA 3BLPX 4PMVA 3A5VA 4AMWA 4UFLA 5FD0A 3HU7A 3BVWA 4MNKA 3WNLA 2D3NA 3WY2A 4AMXA 2OWWA 1GZJA 4AZ7A 5CSUA 3AXXA 3CMJA 4NZFA 4JKKA 7A3HA 3VTRA 1JAEA 3CZGA 2G4FA 1UD6A 3ZJKA 3RM9A 1CEOA 1HP4A 4RE4A 1QVBA 5HOSA 1CPUA 4PCSA 5GNXA 4J28A 1KGWA 2NT1A 4NSBA 3ZJ8A 3VKKA 4LYPA 2EBNA 5AYIA 1VJSA 1KGUA 3CIVA 3ZMRA 1UR2A 3L4YA 5FOOA 4CCDA 2PF0A 3VDBA 3T0AA 2ZXBA 1OWQA 3PZ9A 1ODUA 3OG2A 1CGVA 5A8OA 2OWXA 3POCA 2X2JA 1NWTA 1TQUA 1KXTA 1UQZA 4AWEA 4NRSA 3KL3A 1UKPA 3MV01 5M3WA 2W92A 1TA3B 1RP8A 5FL1A 2CXGA 2VNCA 1HVQA 3T2QA 5M5DA 3ZJ7A 2V3FA 2EPLX 1PJ9A 3CHDA 2WZEA 1V3IA 3DX1A 3NJ3A 3M6DA 3VNYA 4JAWA 2WVVA 4CD8A 1Q6GA 3L2MA 1BSIA 3ZSTA 4UQBA 1I1XA 4D6FA 3VSUA 3WD2A 3M07A 3ZO9A 2BVYA 1W1VA 3WDPP 4U33A 4GZEA 1CXKA 3S5ZA 2D0GA 4PTMA 1X6NA 3WEZA 4D6HA 4KWUA 4PMZA 3BMWA 4JFSA 4JZ5A 4ZENA 2DH2A 1PX3A 2VRQA 2BY1A 1QNQA 2XUCA 5DT5A 3WY1A 2QPSA 1V02A 3WBAA 3HG5A 3EJRA 3OLIA 5A6BD 1PX8A 4IUGA 2D2OA 4CCEA 4HU8A 1JF6A 1JZ5A 3VSVA 2E8ZA 2ZXAA 3AICA 3W53A 4XV0A 1J0ZA 4FNUA 3EJTA 1XH0A 4J3VA 1VFFA 4AZGA 3CZSA 3VPLA 3NDYA 4Z2LA 1DWGM 1JI1A 3AS1A 3B9EA 3L4UA 1UWUA 4F9JA 3LRLA 2J7CA 4QLKA 1HX0A 1R34A 4PYSA 4CD4A 3MMUA 2BVTA 1W9XA 4R27A 1V6WA 5A6JA 3SCRA 1EGZA 2GDUA 5A95A 4UNIA 3QGVA 2WMHA 2QLYA 5A8QA 3LRMA 4EK7A 2CCRA 2VL4A 1H49A 1K9EA 2J7FA 3AIUA 3II1A 2JIEA 1BYDA 2QF8A 4Z2IA 1DWFM 4H41A 3WDQA 2VRKA 1QI0A 2X2YA 2VX4A 1XSJA 2XVNA 3G6LA 3UG5A 1HJUA 4HMDA 2XFRA 3A22A 5E6YA 4GPNA 5A6SA 1W3KA 1O7AA 3W6LA 1JG9A 1QHPA 2J78A 4KGJA 2XWDA 1C3FA 4MJ2A 1DTUA 1CGWA 5ABEA 1GUVA 4W7WA 3TTSA 2GK1A 3PTQA 1NOFA 3PHAA 1E70M 2F7QA 3AHXA 3PBGA 2EACA 4AYGA 4WK9A 4W7UA 2WKLA 4GI6A 5I24A 3VD4A 3AZTA 1ISXA 3UERA 1HJWA 3WF1A 3H53A 4GZIA 4U2ZA 1TA3A 3ARXA 1E1EA 1CGXA 2WZIA 1G1YA 1I75A 3AS0A 3VOCA 2E3ZA 1ZBKA 2IUZA 4MJ4A 3GBEA 2CKRA 1JXJA 4TTUA 5I0DA 3TOPA 1KWGA 4GIAA 2DSVA 3AIQA 3WH8A 4MNMA 1R7OA 3GXNA 4C7FA 4UFHA 4HA4A 4JKLA 4S3JA 5C8BB 4EE9A 3AMKA 1BGAA 5BYWA 3OZOA 1TFVA 4M29A 2VMFA 2VO5A 1QI4A 3FY1A 4JCMA 1CTNA 3OGSA 1QX1A 3WDJA 3OLEA 1OSEA 2WW5A 5DMYA 1WO2A 4FNPA 3PZGA 2E9MA 3A6OA 1JIBA 3WDHA 4H7VA 3VX1A 3NSMA 5A6AA 2XVGA 2E9LA 3EDFA 1FH8A 3SCNA 3BAXA 2VVNA 3F4VA 3A4AA 3VIOA 4EAMA 1XYZA 2BNJA 4IISA 3U5YA 3UG3A 5IHSA 1EIBA 2A3AA 4ZFMA 4FNTA 1HL9A 3D51A 2VOTA 1XYFA 2XHYA 1JNDA 4JL2A 1BTCA 1G01A 1UA3A 3SCSA 4OOZA 1F4HA 3MKKA 1D7FA 3WIJA 1MWOA 1BGGA 1B3ZA 4WKAA 2WBGA 5FL0A 1JD7A 2VI0A 4TVUA 1VEPA 2X8RA 4J3SA 1B90A 3M7SA 1ECEA 3SCUA 5CZKA 1JYXA 3WL1A 1XRVA 1RPKA 3NSNA 1UHVA 4ZE5A 3CZJA 1X1NA 3BUQA 1US3A 3EJQA 2O9PA 3CUIA 4PMOA 4AD0A 4CVUA 1FHDA 4M81A 4XB3A 3CBWA 5HPCA 2W66A 4ATDA 4MADA 3LPOA 1H09A 1OIFA 2CNCA 1UR4A 1JZ3A 3NCOA 4ZXOA 2XVLA 2F1BA 1Q6FA 1HT6A 4W5ZA 3UG4A 4PMYA 4OBRA 2XVKA 4ML4A 3KEHA 2CERA 1MW3A 2DPEA 2E8YA 1HNYA 1JDAA 3F5KA 1B0IA 3ZT5A 1HTYA 3ZR5A 4B16A 2ZUNA 1JNEA 2OLHA 4FLRA 4WSJA 5A2CA 3MUIA 2D3LA 4IPLA 1M04A 5FIPA 4Q7NA 4CN1A 5DT7A 2JE8A 1W3LA 4AIUA 1GHSA 1FP8A 1UKOA 3FNDA 3WUFA 1KQZA 1BAGA 4V28A 2Y4SA 3A21A 1MQQA 1KFWA 1W91A 4M80A 1CXHA 3EDDA 4H04A 4X0NA 3VX0A 5ABGA 3RM8A 1XC6A 4MPKA 3WNOA 1HKJA 2JIWA 2J62A 1H0GA 3BCDA 2WC4A 2WHMA 4W87A 1C7TA 5M17A 5DFAA 4A4AA 4BA0A 5D9OA 3BUDA 2YIHA 2XWEA 1A47A 1J10A 2WK2A 1VBRA 3POHA 4W8BA 4D1IA 1OIMA 4CD5A 1VAHA 4B3KA 3ZSSA 2O9TA 4JL1A 1E40A 4D6JA 1GOKA 5IDIA 4QLJA 3GXTA 1JXKA 1TQTA 3DECA 2YFOA 1VEOA 2EJ1A 1KXQA 3BAIA 5DF0A 1EXPA 3CHEA 2YOCA 2GVYA 1EDQA 2XFFA 1WAWA 1V0NA 1ZBCA 3VIMA 1UWRA 2E4TA 2NSXA 2VZOA 1E6SM 2A3EA 3K1DA 3WQVA 1ISWA 6TAAA 3N1AA 4YHGA 4AMCA 2FHBA 1LJYA 1E0WA 1CXFA 2XTKA 2UY3A 3VIFA 3BH4A 3UETA 4HOWA 3TTOA 5C70A 3B9AA 1J12A 2Y2WA 2ZXQA 4PTVA 3W4RA 2F7OA 3GYCA 3OGRA 4V2XA 2PWHA 1UWQA 3BAYA 5CLWA 2GK1B 4OBSA 2A3BA 2VC9A 2WCAA 5EMYA 1PX4A 2WMFA 4MB4A 3WD4A 3VIGA 1VFOA 1JF5A 1Q6EA 3F5LA 2GFTA 3MMDA 3EYPA 4KH2A 2WANA 3VGDA 1C93A 1EA9C 1OGGA 2XSBA 1VJZA 5D4YA 2BV9A 3WH6A 5JBEA 1ZU8A 5C71A 3WH5A 2WM0A 1MQPA 1J0IA 4HOXA 3WQWA 4W8AA 4FNSA 5A6BA 1U33A 4FMVA 3ARYA 5D9MA 3L4TA 3PTMA 5AY7A 4FLSA 3ZT6A 1FA2A 1TQWA 4KRTA 2X05A 3AYRA 1FOBA 2OSXA 1ITCA 2VZUA 4CD7A 3GBDA 1CGYA 1E0XA 5BXSA 4DUVA 1WNOA 3RJXA 1MQRA 1ZBVA 1EHAA 3E1F1 2AAAA 1JZ6A 5EBAA 2PWEA 4HZ7A 4ZEPA 5CGTA 2VT0A 2J8GA 3SCTA 3GXPA 2ZX8A 2BVDA 2V3GA 3LMYA 1XH2A 1TUXA 3ALFA 1O6IA 3BUIA 4QAWA 1W1TA 1Y7VA 2OYKA 1MXGA 3NUKA 3CPUA 1DEDA 1TG7A 1RH9A 4AZ5A 1CGTA 3WD1A 4NZCA 4V27A 3HN3A 3MUZ1 2GJPA 3N17A 2PWDA 1E73M 3VIHA 4L4PA 2WBKA 3TTQA 3ZJ6A 1PAMA 4Y7EA 1KBKA 5A2AA 4LYQA 4EKJA 3WUEA 1GVYA 1BG9A 1BG4A 3VMNA 1WKYA 2EPKX 2J7BA 2VVSA 4X9YA 1LL6A 3PZVA 3L4ZA 1H4PA 1HJSA 2CETA 4JKMA 5A1AA 1CXLA 1MYRA 1LLOA 3W26A 2XG9A 3SCPA 3KLKA 3FXYA 3WNMA 2GJRA 2YFNA 1B3WA 1K6AA 1Q6DA 3KE0A 4DUXA 2ZIDA 4K68A 2DH3A 2YKKA 1B3VA 1EQPA 3BC9A 3BUBA 2XIIA 2PBGA 4LYRA 3A3HA 3IJ9A 4M24A 3DYOA 4AISA 5JBDA 5IFTA 1VRXA 3QR3A 4WKFA 1NM9A 3AYSA 3ARPA 2D0FA 3ARSA 5IXEA 1UD2A 1R75A 1HVXA 2YDQA 1KXHA 1G94A 1HJVA 3MSGA 3CHFA 1M7XA 2F7RA 1UYQA 1U2YA 1UKQA 2DGAA 5TD4A 3CZEA 1H3GA 5BXTA 1LF1A 4MTVA 3W25A 3WQ5A 4QFUA 1UKTA 4WIWA 3SURA 3OIHA 4CN6A 4PSPA 1RP9A 3WELA 2YL9A 2YL8A 3NDZA 1BPLB 2F2HA 1VFUA 2WVVB 1HKKA 3VVGA 1TE1A 4XUYA 1HIZA 5KZ6A 4MB1A 2E40A 3GM8A 3T08A 4B3LA 1TVNA 1JI2A 3KZSA 3KL5A 1JYNA 1S46A 5I3DA 4P7LA 1R85A 4AZHA 1JL8A 4OOUA 4GKLA 9CGTA 1JD9A 1C8QA 2G3JA 3N15A 1E6NA 4LGXA 4J3WA 1H2JA 1BYBA 4U5KA 2J25A 4UQDA 2G3IA 5HDRA 2V3DA 1PS3A 3NIYA 5D8WA 4A3HA 2DSUA 2UY4A 1PZ2A 3VINA 1GW1A 1SMDA 1DWJM 4ATLA 1JZ2A 1UH2A 2F1AA 2QPUA 1MFUA 4PMXA 3W29A 1K9TA 4AY1A 4HZ6A 2GSJA 3FHQA 1DWHM 1SZNA 3WD0A 4DWSD 4P8VA 2WSKA 5CSYA 1UA7A 2QMJA 1MW1A 2UWFA 4GI9A 3THCA 4N0RA 1QNOA 5LA2A 1AQMA 3UEQA 5A8MA 3AXHA 2DSWA 1G0CA 3L2LA 3GZAA 5BRQA 1CYGA 5ABHA 1OCQA 4AIOA 5E0FA 2XM1A 2A3CA 3VDAA 1QW8A 1PEZA 2RGLA 4EANA 1V6XA 3PZNA 2ZUWA 1OBAA 3DDFA 2EXOA 5A2BA 3AFBA 1BLIA 4B9YA 1PZ3A 4DM2A 3WEMA 1GONA 3FW6A 2VRJA 5BXPA 1MXDA 2WVUA 1AQ0A 3T0DA 1ISYA 4BQ5A 4DO5A 2J7EA 3I3DA 4Z2HA 1B9ZA 3GH5A 3H55A 4CVWA 3D4ZA 3D3AA 4J3XA 1V3KA 3BCFA 2ZX5A 1OM0A 1QNPA 4PUDA 2NW0A 4URIA 5EB8A 4HOZA 4JHZA 1EOMA 1UD3A 1E6RA 4FLQA 2G3MA 1H41A 3I3EA 1J9YA 1SYTA 3KWXA 1FHLA 3B9DA 1XH1A 1DP0A 1HN1A 3CZ8A 3QHNA 3WKZA 2E0PA 2QHAA 4L4OA 2FYVA 3CLWA 1C8XA 5E1QA 2FHFA 2BHZA 1UKSA 4IPNB 4AD4A 4GI8A 1CXIA 3RJYA 1B2YA 4AC1X 1V0LA 2V5DA 1UD5A 1WDRA 4P8WA 5F7UA 5ECUA 1HP5A 4AIEA 1OT1A 3T2OA 3VM5A 3UR8A 1BF2A 1BYCA 4OJYA 3SUSA 3CV5A 3SEPA 1GJUA 5IFPA 1QI3A 2ZWZA 1C90A 5BXRA 4E4PA 2D1ZA 1LL4A 3RO8A 1KCLA 2BY0A 3NYDA 2VJXA 2WZHA 5HBFA 4JFUA 2DIEA 1DHKA 2ZUSA 5A6LA 1LWJA 4W5UA 2ZX7A 1PPIA 4W84A 3W28A 1WZKA 1TMQA 3AIRA 1CLVA 4TVCA 2BS9A 1BHGA 1NWUA 5GNYA 3DX2A 4CKQA 1B31A 2HISA 5D9NA 2X0HA 1W32A 1XD0A 1SMAA 3ARVA 1GOOA 1NP0A 2JEPA 2YA0A 3CUGA 3BMVA 2WC3A 4BF7A 2JFEX 1HKIA 2D0HA 1Q6CA 4ACYA 1E1FA 3D5HA 2YBTA 4HPGA 4MDPA 1VBUA 2DEPA 1NH6A 3IAQA 1EO5A 3KLLA 2F61A 3AHTA 3AROA 3VMPA 3CO4A 4TOQA 4DM1A 5D8ZA 1W9VA 1UASA 4U3AA 1V3JA 1HJXA 2WYSA 1ZBWA 1DWIM 2DT2A 3SCVA 3APGA 4UFMA 3WSUA 4UZUA 1E5NA 3VGGA 4XZBA 4HTYA 4S3KA 1UD8A 4AD3A 3PZIA 1SR0A 3SIMA 1WDPA 3TA9A 1XGZA 2D22A 2FDMA 3W81A 1BFNA 3CZNA 5CPSA 2VQUA 2WMIB 2VQTA 3BUPA 4TX6A 1CWYA 4HP5A 4AW7A 2C8NA 1E6ZA 4CUCA 4Q22A 3DYPA 4NXKA 1QNRA 2EO7A 2BY3A 1EDTA 4D6EA 1GOMA 3U7BA 5A3HA 3D4YA 3WH7A 2XM2A 3AIBA 2Z1KA 4PSRA 2VZTA 4MNLA 4PMRA 4JFVA 3WF2A 3ZR6A 1V0KA 3ALGA 1UWIA 1ISVA 1CIUA 3L4WA 4W93A 1EDGA 4UTFA 2BXYA 4TX8A 2CIPA 5FCZA 1GPFA 3GH7A 4CN4A 1W9UA 3AHZA 1QI2A 3IGUA 3BGAA 3FN9A 3WF0A 2CYGA 3LPGA 4PMUA 4LXFA 3O2LA 3CC1A 3EMZA 1IV8A 3W38A 4UFIA 1QHZA 4PRWA 4J27A 3VDCA 2ZICA 2IXVA 3D50A 3MS8A 5BROA 3K8MA 2WKGA 1E6XM 4IM4A 4A3YA 3PZUA 2F7PA 2ESCA 2PI6A 3W0KA 2J7DA 2JF7A 3BLBA 1R87A 1M03A 1NWRA 2WB5A 3VDHA 2GDVA 5AYBA 2YDSA 2VR4A 2JF6A 3WUBA 4JCLA 3VD5A 4W7VA 2E9BA 2YLAA 2G8ZA 4FLOA 3IJ7A 1R8LA 1W1PA 2FH6A 2WXDM 4BS0A 1PIGA 4D6GA 3EDJA 2W63A 1AVAA 4WKHA 1NQ6A 3MUAA 3CZKA 3I3BA 4J7RA 1CECA 2C7FA 3WENA 1QPKA 1UZ4A 4GO9A 2OYMA 2O92A 1HJQA 2WLYA 3VD3A 5JBFA 2WMKA 3S2CA 1GCYA 5IHRA 2CESA 4D72A 2W67A 3CUHA 3L4VA 2WC7A 1WDQA 2J47A 2FHCA 3AMGA
chains in the Genus database with same CATH superfamily
3FFDA 3KJ4C 5DHXB 3QV9A 3UPRA 1AZUA 2CPUA 3RY5A 3B8VA 3ABXA 3HA1A 3DGDA 1UG6A 4NXSA 2CLZA 3ARFA 4MXWL 3D9AL 3ZDZB 4LSSL 3C0SA 1HFUA 3WHXB 3INUL 3NTCH 3L17A 4LEOB 4OZFH 1SXZA 4Y2LA 4YTTA 3IJEA 4PJFB 2V9TA 3DHUA 3DDGA 3ZKMC 4KXCA 4YU1A 4L3ED 4XC3L 1INEH 5DMGC 2O5XL 1UUSA 4ZXBC 3TROA 2JB6A 4ZFOA 1XGDA 1DBJH 3QV7A 3H56A 4DAFA 4DWSC 3EJZD 4IIQB 2PGWA 4NILA 3BDKA 1BEYL 2XZ7A 3MBWB 4S2SB 4LPUA 4ORGB 2YA2A 4DX3A 4UQCA 2Q3AA 3QDMD 3G77A 4DPQA 1G1OA 5DZOA 5KSAB 3RZCD 1GOIA 4W6WB 3NQMA 5F1IB 1H3TA 2PUQT 3JZYA 2ZUTA 5GGRY 1EGJH 1MI5A 3SDXE 5EOTB 5DBUA 3PXLA 4D8LA 3HMWL 3M9YA 4X6FB 2QW5A 5LQBH 3X12A 3MRFB 4H8VA 1I1WA 2DMBA 3FQNA 3MLSH 1NAML 4N90E 4D8OA 3SUUA 2GYSA 2Y7QB 3GMRA 3PP3K 4GZ7A 2I17A 3NZGA 1GORA 3QMTA 4DVBA 4K2UH 3KTCA 1G6RB 3JUZA 4Q33A 3VXNB 1R19A 1JZ4A 2QCFA 3GRIA 4QISA 1XYLA 4LCCA 2QQQA 4P0DA 2HVMA 1E9QB 3D69A 4WI3A 1B0GB 5JXEA 3U8GA 2FBJH 4P2OB 5FHBL 1W9DM 2WVSA 3UPAA 3HPFA 3PFUA 3SUWA 2JLLA 4B2DA 4OZIE 2HAZA 2FDBP 1W2PA 1VFBA 3KWWA 2XZCL 1J1XL 1XGUA 2PO6B 5L8LB 1JRCA 4JHVA 1ZLPA 3C56A 1M05A 2CPCA 2JIXA 3OKDA 2WBXA 3KHQA 2JKXA 4TS6A 5IOPA 3FV9A 2WB1A 1XHGA 3GNRA 3GB7B 5AALA 1NFBA 1K3ZA 4NQXB 4JX6A 4D6DA 5JUEH 3MLTA 5CC3A 1H60A 2V3EA 4F9LC 3H2WA 5HHOE 3NA9H 1A3XA 4P4KA 3DVGA 3RIKA 2V7NA 3ANUA 2E67A 4N3UA 3QIBC 1PLGL 1B88A 3N1FC 4OLZH 5FK9B 3RIFF 5I23A 5HXMA 1JYWA 3C0JA 4ZQNA 4ZA0A 3BYYA 1INDL 1ZKAA 5JLZA 4YTSA 3IFLL 4FKEA 4PWKA 2YC1B 5HMFA 2WQAA 4I9AA 3AXLA 3S5NA 5AWNL 2IKJA 4HV8A 4MA3A 4RRPG 1NFPA 3DSNA 4KXBA 5JHLL 3E5BA 2KBGA 3U7VA 2KX9A 1AOZA 1K7XA 4QJ3B 5JQHC 3IGKA 3AUWB 1BVNT 2X6MA 3K5SA 1T0OA 3S5YA 2DM2A 1DWAM 1QT1A 4RFEA 3I4KA 1EFZA 1AGCB 3P81A 2OR8A 1D5ZB 5H2BA 1V77A 3O2WL 2H4EA 4JJ5B 5DJ6B 1DVFB 4LLUA 4G7RB 1A3HA 4OUEA 1BZOA 4PBGA 1YTDA 1EVUA 2PC8A 4UZSA 1PY9A 1ZT1B 3ATAA 4H5SA 4HFWA 3DU0A 3MMWA 4LVAA 2FEEI 4PJ9A 4CU7A 4B15A 2WVTA 5D2NE 1JGDB 2BZ7A 1R9FA 3V5KA 4TXEA 3SRFA 3U2EA 1BLNA 4W85A 3H8AA 1UYWL 3MJGX 2IFGA 3PABB 4EMZA 5AZ2L 1I7RB 1WQ5A 3SQMA 4XVSL 2FIKB 1F4WL 3LRKA 2BX5A 3FRPG 2B5IB 4L0PB 2TMDA 4FABL 4N7QA 4MASA 4F57L 4QHLB 4LPYA 2FJFA 1IE7C 4PTWA 1AC0A 2X41A 1N8FA 3ZZQA 3L5AA 4U0RC 1OZUA 3TJHD 3QFDA 4DGVH 1QSEE 4U4IA 4MAVA 5CAHA 1PFOA 1XF3B 2DQGL 3KCPB 3RUGB 3WEAA 4PW3A 4MIMA 1FWCC 4CU8A 4ODUA 1BX2A 3UTPD 2GYIA 5M2FX 5T3ZD 3OKKA 1JPGB 2VSDA 4CNNA 3W07A 2VXQL 3E0FA 2VEKA 5IOPB 1OD8A 4GUHA 3WS3A 5CINL 3IK4A 3CHCA 1KNOA 3IMVA 3H7BA 4OLYL 1SNRA 2ISSA 4J3OF 3DURB 3Q94A 5DMGD 4Q7DA 2PO6D 1X39A 4LPCA 2EDHA 1QD0A 1XB6A 5CJQL 5T33L 4IPJA 3U4FA 4KI5E 3G8RA 2Y62A 2V38A 3ASOB 3V7AE 5DX7A 3UFIA 2GITA 3IXTB 3P11L 4KHTH 4KHXL 3U0PA 1PKMA 4W86A 4RGND 5MENE 5F6IC 2C3VA 3DBXA 3IDYC 4QM1A 5F1VA 5I28A 1I1FA 3T0EC 1CLYL 3NAAH 5BOPA 2KUTA 1NWPA 1TB3A 3PN8A 4NC2B 3KOFA 3LOTA 2MTPA 1HQRA 5F4SA 4QHRA 2Y5EA 1J8HB 3T09A 2ZUQC 1SOXA 3OZMA 2OWCA 4A8LA 2BSEA 3RY6A 1MSPA 1XPGA 2FSEA 2XC8A 4IRJB 5DURB 1B4TA 1KBGL 4ZFGL 4P46A 1DVFA 4LLUB 2OJEB 5CMAB 1E6OH 1TJ2A 2BY2A 5EEUA 4Z78B 1XIWA 3B56A 4X6CB 3G6DL 1DIDA 2Y2YA 4NIRA 4LNVA 3QARA 2YYUA 3GNML 1J5DA 4U1JA 2FRGP 3OSVA 2DQXA 3KOXA 1NQKA 2X44D 3GMNA 4N2DA 2H5UA 3AG1B 4HCGA 2ICWI 4N90D 5D2LA 4P5SA 4A6YA 2AOSA 3XINA 3RFAA 2AJZB 1WTLA 1OGBA 2X7VA 2XISA 4JUTA 5DVMA 1ACZA 1J8SA 3AG4B 2Z7WA 3CZLA 1JPKA 1KFLA 1F13A 3LHTA 4JHOA 3A3XA 1GIGL 5KSVA 4GVIA 5E8OB 5F1SA 2N4IA 4C83A 4YJ5A 1W72A 1KGIA 3GIVB 1B5TA 2ERJC 1U83A 2FB4L 3S4SA 3Q5TA 2KI6A 2Z1VA 5FYKE 4LVHC 3WNIA 2H41A 1HO4A 3CHRA 2Z8SA 4FXKA 5ID1B 1RBAA 3RM4A 1REQB 2ZKYA 4ZDHB 3HBGA 1YJDL 3CVDA 4KITB 4Z1PA 1JYVA 1MMFA 3UZJA 3WFAA 3QH3A 1RCOB 1UT9A 3S35X 3SCMA 5J06A 1S3TC 3RA7H 4R9OA 4DUOA 3TV3H 3D0LB 4KEUA 5I3HA 2R1YA 4JTTA 5GGTL 2VZSA 1H5VA 1X9RA 4GUJA 1VZHA 1SJEA 2XHNA 3G04A 3VSQA 2DLFH 1BIHA 4XCYA 1I2RA 3QCUL 4B60A 1BXVA 1QBBA 2WZTA 4HHPA 2WN3A 3QDGE 5IV2B 4JPWL 2WTOA 1FN4B 5F9WB 1LT7A 2VCOA 4XOCA 2HVJA 4DAIA 3W1XA 3RTQA 1OP5H 3SN0A 1OGSA 5C55A 4I0CC 1JVOA 1Q2SA 3HB3D 1RMFH 5BWAA 5I3JA 3FUKA 3KGSA 4U5IA 3HG3A 2VKXA 5F7MC 2AGKA 1VRDA 2F38A 2D3JA 4UILL 4ZPVA 2ZBTA 3B8WA 2J9ZA 4OW6A 1QUNB 3LPPA 5ESQB 1B30A 1THCA 1TMHA 4PMQA 4QNPE 2H0PA 5ADOH 4YHZL 2JF1A 1TCMA 3F01A 1S5VA 4IMFA 3FU0A 3UCDA 2R7EB 4XPAL 2PDXA 1VKXA 3GJFH 5FECB 1W3IA 3O6CA 4HSAC 1UB5A 3Q8CA 3DGCR 2P8CA 4KMQA 2R51A 2VDRL 4X80H 4F5CA 1CLXA 2FPVA 5I30L 3WLWD 1GJIA 3UXAA 4M6MH 3LIZL 4AWSA 2QPXA 2WXQA 5DHVH 3FEQA 3O2DH 2VDOL 5G2WA 4TLUA 1P0KA 1OSPH 2ZCKH 1Z5LB 1PYWA 3K4AA 1E9LA 1OGTA 4XNZC 5HNRA 3ZT7A 4Z7WE 2FD6L 3FYIB 1RURH 3VTTA 4L18A 1B3XA 1JHTA 2HFEB 5EIIG 1KYOJ 3UY8A 3HMJG 1K5WA 4MX7B 1F6AB 4AD1A 5C7HA 1KTLA 1AZ2A 3GI9L 1AUSL 3CH0A 4XPHH 3L3OA 4L1TA 4LSTH 4ODSL 4HPYL 2PPAA 3HC4L 2BNRD 5JZ7C 5K9JH 5I1GH 3K30A 3TYGH 3VJ6B 4Q32A 3EO1A 3LKQA 4J3BA 1VADB 2AV1A 2VDPH 5F7LB 5AVNA 2YZRA 2VCBA 4Z3HA 2C3GA 3MV11 5D1QD 4M3HA 5EZIH 4Y4HA 3ESPA 3V5DA 4BRJA 4N0UB 3PDGA 5EF0A 4DNLA 4HJWA 4ORMA 5TAOA 1I8LC 3G24A 1CENA 4DQOL 1Q8MA 5I74C 4PMDA 1KOAA 5CD3B 3O0LA 2Z8RA 2FB3A 3DBNA 1QRNA 4G8TA 4LHUD 2UY2A 5GGSB 2V5TA 1Y07A 5KVFL 2O93L 1NARA 5TF0A 1JDEA 3SD2A 1CT5A 2LU3A 2HBXA 4IMKA 1B4LA 5ACMA 3TCTA 3AIEA 2CCWA 1OINA 4BEUA 1I53A 4EXQA 1ONQA 1XR8B 1BLNB 2DDQL 3NWRA 4FJZA 1IGTB 3PAYA 1GVFA 3CLMA 3C08H 4U7SA 3DO7B 1KO0A 1KG0A 4Q2ZB 2VEPA 5DZJA 5C2CA 3BPCA 4MG4A 4OLWH 3GLCA 2A1YA 4ELMA 1M57B 3M4HA 3FQNB 4UBPC 1KRCC 1DJGA 2XIMA 1HESA 4HEPG 4KO6A 3F7KA 2PW1B 3NA9L 1AJ0A 5DZAA 1QA9A 4NC1E 2DW7A 3H2CA 4OU1A 1AMKA 1QLRB 3BWAB 4YWSA 4PVBA 1EX1A 3NSCA 4EWND 4GQZA 5CUSL 1MW2A 5PAZA 4KUCF 1AP2A 3LN3A 3F5JA 4X9BA 5IGXL 1OARH 2WOBA 3MUAA 1K4DA 1RPQA 4KK9D 2ARJB 4YVXA 3H26A 1BRLA 2NY5L 4DPRA 1V0MA 4AL8C 3VYLA 1GKRA 3MRFA 3FKKA 2VDQB 1H7NA 4CCCA 2BX7A 5EU3A 3SIKA 2W61A 1G4PA 4M7ZC 2D3VA 4M8VA 1Z9NA 2FQGA 3C5QA 4AEEA 2ZRVA 2W79A 2AERT 5DRZA 1L6WA 4RRPM 5FGCE 3IACA 4B91A 1T22B 3FSOA 1G6RH 2ED7A 3HUJF 3O4LA 4HWNA 4LNRB 4FFYH 8CGTA 3WFCH 4JQ3A 5GRYA 2F53D 5IRPA 4N1CA 4KDVA 3BGJA 1GOWA 2ZP8A 2YPVL 4IIZA 3S37H 4XNAA 5IM7A 5EF1A 2GLKA 2IMMA 3IS4A 2B9BA 1JPFA 1OD7A 2QKSA 4MVBC 3AZSA 2J77A 3S1UA 1KLZA 1YNTF 3ILPA 1AR2A 3GMPA 2Y7LA 2FEEL 4IBLT 5I1AA 4IJBA 4EQ3A 1GHFL 4JPIA 5CP7A 1Z7JA 1WCGA 4NZDA 5SV3A 4YNYB 5D1XD 2CBVA 1GW9A 3IGAB 3LCGA 3MA9L 3KR3L 2ARJQ 1ADSA 3JUGA 4NOFA 1WAAE 3MTXA 2MQ3A 4S1DC 2R4RH 2HT4D 2VN6A 2A3HA 3RDKA 1VFMA 3CFNA 4P5KB 3H7UA 35C8H 4LB4A 4MNJA 4PFMA 2O1AA 3QPXL 4C83B 3DVNA 4O2FA 1Q9WB 2NX9A 1IMHC 3ESOA 4J4PC 1KM4A 5KYNA 1WOAA 3IE4A 1FF5A 4PIBA 4PW4A 3G1YA 4ODHL 3D46A 2IGFL 1XSIA 6A3HA 3QG6A 4LVGA 4Q4OA 4AQ1A 3ZK0A 5DS8A 4AY8A 5C0CA 5T5NG 4KVPA 4FSAA 3EGSA 3QRLA 1M56B 3WO4B 5FI8A 4E41A 1NCDL 3BI9X 3WUZA 1ERNA 3QUXD 4NZRL 2XSAA 2CCLA 1W54A 2HWGA 4JQIL 1EJ6A 3S35H 3OU8A 4JIRA 3MN8A 3SQBA 2QJJA 5ALBH 3DC0A 5EMUA 4R7XA 1V51A 3RGTA 1E72M 3P02A 1EBGA 5L6UA 2R2EA 5A2IH 5E09A 4GJIA 1MLBA 4XAFA 4X63A 2EUWA 3ARFC 4D3CH 4YXLH 4GQQA 2G3NA 4P9HH 3ARDC 5JOEA 2EIMB 4M6NH 3FTWA 4GP4B 3DETC 3GTNA 2QAFA 4TL5A 4P3DB 2OG9A 3S4SB 4C6JA 2DICA 4UT6A 2LLEA 5DJ6A 4IIQA 1IFRA 2I1OA 3GLEA 3A47A 4IRSA 1U8NA 1DQKA 4F33B 4WSKA 1GYWA 5ID1A 5ISZE 4JHMA 1RY0A 4BR1A 4NC0B 2EIEA 1KBJA 1CDIA 3KDMB 2J8UE 4XRCA 5EBWA 4S0HA 1FRBA 5KSAA 1V6VA 3FQYA 5CPTA 4BWLA 1T20B 3WCYA 1UQSB 2H2PC 4BUQA 2D7TH 1BBJA 2FJGA 3QUMH 5DEGA 3FX4A 1YJDH 1A5NC 2AANA 2JI1A 5KBPA 2Z1XA 2JK5A 5L2JB 3FJ6A 2F53E 4TTGA 2BOGX 4H44C 2FUQA 3G1DA 2IH9A 2ZE3A 5I2UA 3TJXA 1UM5L 4XXCA 3R8RA 1OAYL 1ZT4B 1UB3A 3GNPA 2Q8ZA 4ACZB 3KLDA 1FL3B 4ZOBA 4Y4KD 1SLWA 5CJ5A 1TPB1 4TNEA 1SJVA 3S6TA 3UR7A 4W9TA 5FCSH 2R56H 2YLLA 1XMWA 1KCVH 1XDMA 3FONB 3W5MA 2GSEA 1T2QH 5JORA 2I5YH 2I57A 4WEBH 4HEMA 2WQVA 2A2QT 3O8XB 4JPVH 3BRGC 5C08A 2F2KA 4DGUA 4ZTOL 3LERA 4EVNA 3FJ4A 4XXDA 5E03A 4RFNB 4G7EA 2R2BA 3N4EA 3NGFA 3URBA 5SX5H 4ODWA 1U3HC 3A6CL 5EFFA 4P5KA 3WMCA 1DDTA 3UDWA 2JNZA 1R5VA 3VXSA 3WNPA 3T8LA 5AQ0A 4WGVB 3EYFA 3RRAA 1IL1A 1AYOA 1KTDB 1VIWA 3AMLA 3LZOA 2JFCA 3AJ7A 1NFGA 1S2TA 1I7UA 1NJ9B 1V7NH 2XX1A 5GS2D 2MOQA 1ETB1 2PP1A 3Q2LA 1XQKA 4RDZA 4AXNA 1DVXA 4FQ2H 4V1DB 4B5SA 2V5CA 4DBDA 1N82A 1B0RB 5KSUA 4PRBA 1VBJA 4DPAX 5EU5B 3ZWSA 3F2DA 1V6YA 5C9JA 1ANUA 4JO8A 2HFGL 5BVPL 5JPMB 1G5AA 5A8PA 2NVCA 4JFEA 3VFRA 3PBUA 2BZNA 3MTRA 3TCXA 2DYPD 4NNPH 1FIGL 15C8L 4KZEL 4LASL 2E5EA 3HE7C 4BZ1L 3V9CA 1I0BA 1QYGL 3GU1A 4ZQMA 3TCEA 1DCLA 3S36L 3F6LA 2OELA 5EZLB 3KLSA 5DK3A 1F4AA 2VDNH 2HXUA 1TJRA 2Q01A 3ESMA 5IVZB 4IRSB 5LB1A 4JDVB 3SDCB 3CN0A 4PY7A 4NUWA 3WFZA 5E9AA 3O0FA 1Z41A 3WY3A 1NGYA 4BQ5A 4YZWA 4LKXA 1DANT 5C0FA 2JGYA 4HQVA 4FCHA 3UXDA 4AZ6A 1RUMH 3I9PA 1EJRC 1YNPA 1GZQB 4AZIA 2FQDA 4QRSA 3MLXH 4BF9A 4RX4D 4C4KT 2ZE0A 1MVYA 1W56A 4OVVA 1DQUA 3LQAH 1E27B 1F0LA 3CDZB 4PJ9B 1E56A 4UYPA 2OSLA 1O6SA 1NCOA 4S1QH 5FA3A 1V6UA 4ZTPH 1EC8A 5LNUA 1IGTA 1BJMA 2OL3L 3ETBJ 2EVGA 4Q6IC 2C91A 3GIVA 3KW3A 1D6EA 5D5MA 4OJFL 4AGPA 1IE5A 1MIEH 4XPBH 5JOPD 3R19A 1WAUA 1BAWA 4LBAA 4IH3A 4R4NC 4JFHE 2WGXA 4R4FH 7FABH 2V5SA 1B4RA 3IIPA 1P9MA 3O6MH 1DQVA 2A3TA 4ORIA 2IQTA 4AQ8C 3HJ0A 4WHYG 3GC4A 4UZGA 1I8UA 5F88B 3SSJA 4AF0B 2X9XA 3RWIA 4AZ8B 4WUUA 1FZOB 5CP7B 1I3GL 3PUOA 3A24A 1JV5B 2YSTA 4X5PA 3EYFB 2IOIA 4GBUA 3VC6A 5CC6A 1R4XA 1X5IA 3QIUC 2I9LB 1WXYA 1NJ9A 3EOSA 1F8TL 1E4KC 4IBQA 5J1AB 3LSBA 5HVFB 1WBZA 2HNHA 2WZ5A 3PJTA 3P3BA 4O2FB 2X2UA 5FJUA 5ADOL 1T22A 3U6XS 1DHPA 3UGVA 3F4NA 2HTLD 4FQCL 1SJHB 4PUNA 2MNUA 4JM2F 4YHIB 3C8DA 3MV7D 3BVXA 2J4WH 1F8IA 5KJRH 2H3BA 3DDMA 2XN1A 4IMDA 2VCAA 4KCWA 4NHVA 4PL1A 1R33A 3GHEL 3ZYZA 4RAVA 1BD2B 1PYWB 5IQ9B 3G0UA 3UEZA 4TTDD 5IWLC 2E5DA 1NIDA 3QJRB 3BO8B 3FMGH 5IHZA 3SCWA 3R6IA 4LHQB 4UFJA 3DETD 2WJ5A 2I32A 3EUUA 2XIBA 2ACSA 4KMTH 5H4ZA 2C9XA 2WMHA 2Q5BA 1QATA 2LLNA 1PVNA 4ANVA 3S1XA 1NIAA 3K6IA 3QOKA 4L1GA 1YYML 1MRDH 1I7TA 2A74B 2X4TB 3LM3A 4QRTB 2CUMA 1ZHLB 5H37A 2UZPA 2W80C 5FB8B 3AU0A 5H35A 5C0BD 3AHVA 3WTWA 4ZXBB 5CEZD 1GVRA 1BWMA 3HGRA 1EERB 3N19B 4DWSB 3FQUA 4PJ7B 1H15B 1EC7A 1A6VH 3UP1A 2IXQA 3K72B 3ZTCC 2Z1BA 1TZHB 3CAKA 4M1CD 2I7OA 3L21A 2YR3A 4LVNB 2CHOA 3TNMA 4KF1A 5ANHA 4YHLH 1P4CA 1T2JA 2X1PA 5FW8A 3PWVA 2E59A 1QFUL 3FDKA 5D4JA 5GGSA 1Q8JA 4IRZL 5HQLA 1DVYA 4GRLB 5FM8A 5I1LA 4ZFQA 1J18A 4HWZB 4APQC 4WV1A 3V5OA 5LAXB 3TYDA 2P5WD 4L5FE 1DJYA 1X7TA 4JFTA 3CSGA 2EABA 2C13A 3Q6FA 1QFPA 4U1HA 5F9AC 3KYNB 4FR1A 4GB9A 1UOWA 3LKRA 4FFZL 2DM7A 1E8XA 1YEEH 2VEMA 4ZDHA 4LCUA 4YXKH 3KL0A 1O60A 4J8RB 4QYOA 5MENA 3W2DL 4HX1B 1ID5I 4EVNB 1IM3D 3SCMB 4GACA 2CZFA 5JYMA 5HSFA 1T7WA 4YSRA 2N7AA 4GS7C 3GRWL 2AXJA 1WUEA 2ZZ3A 5I6SA 2IBZX 3KPMB 2HK0A 3TNBA 1FVCB 3RX3A 3UTQA 5EZOL 1JE6A 1KIRB 1KCRH 1K5NB 2PCEA 5E8DL 4Q6IB 2XQBH 3KPLA 4LLAA 1CLOL 2MOGA 3QA3A 1RALA 1HJCA 4JHUA 2W8CA 1G84A 2FTPA 5H8UA 2E47A 1ZT4A 5HWNA 1TLKA 5LBVA 3K5XA 1JGIA 1KXVC 3CFBB 4RXGA 1WFUA 2P50A 2VDNB 4GSQA 3FQXA 3H12A 3CMGA 4YBQC 4M4RB 4MNGE 3T0ED 4PTUA 3G18A 1IILE 3QHMA 1AP2B 4GLEA 2QMKA 1EEXA 1EFXD 4ZX6A 1PTDA 4X5QA 1I1YA 1NMAL 2HG0A 1T4WA 3BOLA 5IMKB 5HJXA 2FWLB 3THML 4JLRA 1LOLA 2NXYB 4R0LB 3PRZA 1RJCA 5I75C 3V79C 1MI3A 3N2CA 3T0WA 2E46A 4F7PA 5DURD 3U4BL 6PAZA 3TPUA 3GD1C 4G6JL 1NCDH 2G3XA 3MRBA 4QI3A 3WLLA 1DPMA 1JGEB 4NI3A 4NQCB 4B9CA 3NDOA 1XL6A 1JDDA 1JFHA 1RVKA 1VFAB 1KULA 3C5XA 3D39B 3QO0A 1GJWA 2BVWA 2MRYA 1ND0A 1JK9A 4L6HA 2XG4A 3SRDA 1XGRA 1OM9A 1A1MA 2OL3B 5E2UL 4K3ZA 3KPRB 2GG1A 1L7IH 1U92B 3L5JA 4FQLL 4B5XA 4Y2DA 5AZEL 3WIAA 3FAXA 2XYBA 3RL2B 4WGWB 1U3YA 5I3IA 5GGVY 3LY6A 3HG1A 1C7SA 2PTTB 7PTDA 1OAYH 1PAZA 4JO3L 2R9HC 5DJDA 5F0JB 3WMLA 5CG0A 4GXVH 2PWUA 4NPKA 2Z4GA 3M0YA 4TSBL 3UYRL 1WDSA 4Q0XH 5LVEA 1I8MA 5JPNB 3HMCA 3KUMA 2VDLH 2DQIH 2ZOKA 5HI5C 3VC5A 1RZ8A 3NQDA 1MVUA 4PJ8D 5LNWA 3S36H 2D23A 4IP4A 1U8JA 1ZVYA 2KHAA 3I4EA 1HAUA 3W0WA 1G7HA 3RF9A 3T6CA 1OYCA 5TE4L 1AKJB 5K59F 1QLFB 3U9UB 1RK6A 4IMLA 4LV9A 4F4RA 3S6DA 3OHXB 3M1CA 1EFQA 4UOW1 2GQHA 1TG8A 5EIVA 1AQHA 2VUNA 3KTXA 1V7ML 1QPPA 2K4AA 3HLAB 1IBGH 3ALPA 3GIZL 3QZWA 4PV8A 2GW5A 2WSRA 2XIQA 3H21A 2ZX9A 1YZZA 4F8PA 1FUNA 3JWNH 1G7QB 2A4ZA 4AE1A 5I1IH 5IVXF 3P84A 2HS6A 3AM8C 5L2JA 3TTEA 2WBJC 4F15C 1PLAA 4Z7QF 3FPXA 5I8OH 4P5TC 4PS4H 1WE5A 4NCC2 1A0CA 3EBGA 1ZNNA 2ZYSA 2MUCA 2XN2A 4R33A 1XG4A 4FB7A 1KSRA 5E6ID 1PKQB 2WLIA 3DIFB 2Z92A 5EZJB 3NJVA 1PDKA 3WOVA 1VS1A 4HPOH 3KWSA 2M26A 5DY3A 2PWGA 3NEOA 1YEYA 4QE5A 1TIWA 2OXHA 3IMBA 5LNEA 4QNEA 4B5ZA 3PGFL 2VFGA 2IFFL 2GGJA 4UB0H 4DTGH 3O8XA 1SJAA 4XISA 2ARJA 4LU0A 4HZLB 3RWDA 4AYSA 1O94A 4PTXA 4D2JA 1JCLA 2Q8BL 3LSCA 1UC4A 1P1VA 2GKIA 4LIQH 1KKOA 1S5HA 1K9FA 4MAUH 2P5WA 3UIZA 5GNZA 2ALWA 2CITA 4BFIA 4WFEE 1A7BA 2G75B 2IDFA 4ZOCA 1C8PA 1JMZA 2MFNA 4PMVA 3A5VA 4AMWA 1FWTA 1T83C 4NQEE 1GOXA 1RUML 2B4CC 2Y6ZA 3B3IB 1NBCA 3EWBX 3WQCA 4UFLA 3BVWA 1P4BL 1YEIH 2D3NA 5LXEA 5GZNA 4G6KL 2OWWA 1I1AC 2QDVA 4K8RC 1OLLA 3VXSD 2AEWA 5JA8B 3LGDA 3PJUA 4RNIA 3JSSA 3UYIA 1ZP4A 3VTRA 4XNQA 1ETA1 4IDJH 1YEHH 1JAEA 2ZCHH 1VGEL 3AALA 1MCLA 4GMEA 4CDHA 2H2PD 5D71L 4S3GA 2CM6A 3QSKB 3X1EA 2Y7NA 3F6JA 3FT1A 4RGMC 5AECA 5AW3B 5C1MB 1F4WH 3U1SL 4AE0A 1RAKA 4JG1H 1AD9A 1YNLH 4K3DL 4XO9A 4PRBB 1NCWL 2H8XA 3QJAA 4GH1A 4RE4A 1CPUA 1SHMA 1UA6H 2UYLB 4WTZG 2DY3A 5GNXA 4GKNA 3S7GA 1K7FA 2GK2A 4NSBA 1ZPLA 4HUXA 5DYOA 2EBNA 5AYIA 4MAYC 3NGBC 4BWLC 4MDJA 1MCEA 3W1AA 1O6VA 3LCFA 3L4YA 4U1MB 4WTQA 4XPFH 1M42A 3OM3B 4N5ED 3O3EB 5MHSE 3B0YA 3BURA 5DJXB 4DKDC 1UP0A 4UTAL 2ZXBA 1OWQA 1XCQA 4NPJA 5FX3A 1DE4A 2WGNB 4GUQA 4BZ1A 2Z92B 1Q72H 2Y5QA 1T66D 3L6FA 1ZTMA 5EZJA 1O5KA 2OZ4A 1F5ZA 4BI6A 5A8OA 5JH2A 3POCA 4R5XA 4YOKA 3LHPL 3DXAE 3MJ8B 4PZVA 4GXUM 1RJQA 3HFMH 1UKPA 5M3WA 3K2KA 2VXUH 1GTNA 3M0HA 1TITA 1TA3B 4R7DA 1XWYA 5FL1A 3EGXB 2H9AB 5IOBA 1Q4WA 2LU5A 4Y2DD 3T2QA 5KAQG 1HVQA 3LBMA 1RKRA 1M9HA 2BGQA 1XCTA 3HB9A 3Q3GB 1QNIA 1ZJIA 1K5NA 2PPGA 4IQLA 1PJ9A 3NZ1A 3VFOB 3MRMB 2W65A 3EH1A 3OXSA 2CLMA 3BLOA 5FF0A 4L8SA 1MFAH 4N0YH 3D39E 3TURA 4HHAA 2PWVA 2ATAA 1R3LA 3VNYA 1SMOA 5DI8B 4KO7A 3HAEB 1T41A 3V0WH 1THAA 3EA1A 4ODTH 4D6FA 1HCYA 1LZOA 4UDUB 4MZRA 2M8XA 1W72L 3F4CA 2C26A 4RX0A 1BJ1H 4X5XA 1ZXQA 1SGJA 1VH7A 1H1ZA 3S5ZA 4W6XB 1XLFA 3LBOA 2DEWX 4TVPD 2A9BA 4S11A 4HS3A 1F2XK 4KRPB 1EEYA 4D6HA 5LXVA 4PMZA 1QEXA 1R24B 1U21A 3BMWA 1WWAX 3KYOA 4Z3GA 5C0JA 3H7RA 3RHWK 4JZ5A 4N2LA 4K8RD 4AWTA 1QMLA 4DJEA 2YAHA 4LBRA 2NW2B 3GPSA 2VM8A 3WD5L 2Q7YB 1ZT7A 2V9DA 4NYUA 3MHUA 4NQCA 4FOJA 4L4VE 1S7TA 3IFNL 3WBAA 3HE7D 3VXME 3GB6A 3OLIA 1SN0A 3FK3A 3WXWH 3GMNB 3N5AA 5F1NA 5HYSA 2X3BA 1JK9B 1MKFA 3PIQB 4F20A 2ADAA 2VM9A 1HXMB 1H3UA 4NQDB 3NBNA 1EEQA 4ZODA 3RPKA 2P43B 4FFZA 1QRKA 2ACUA 1LO2H 2GZXA 3GZ3A 3EEZA 4QRTA 1O6TA 4Z7AA 3I68A 1G7QA 1J0ZA 1X5ZA 4HC1L 1XLHA 3E74A 4JICA 4XV0A 2NVDA 3VABA 1L9MA 4DNHA 1HHHB 4JTKA 3Q1SH 1VFFA 4AZGA 4HK6A 2Z65C 2GQ3A 3V0JA 4OQTA 4PR5B 4M8QA 1AK5A 3H4GA 3B2XA 4MWFA 3KS0J 2V2XA 3CJJA 4FMFA 3WLBA 1XUZA 1OX6A 4Z7OF 4LSTL 4ZT1A 2J7CA 3IRPX 1JNNL 4X6CE 3V2AR 4QLKA 1HX0A 3FH8A 4UTTC 4MUZA 5L2KB 3P4OB 5FXCH 2MCPL 4DKFH 3LA4A 3UWWA 3VKCA 4LLVA 1R34A 4O5LL 4D8PA 2EAWA 3MMUA 4PYSA 3FBKA 4N9EA 4B5TA 5BMXA 3LGGA 1OKEA 1W9XA 5EC1B 2OPCA 3BV4A 4BJHA 1NY1A 3MRDB 1OK8A 4ENLA 3SDOA 3GSRA 1YNQA 5BQ7A 3QGVA 3ULVL 1BQSA 2QLYA 4N6RA 2GT9B 5FLUA 1I3UA 1YEKL 4JY4B 4V2BA 5CSBA 5CFAA 4YSEA 1S7QA 1F7BA 4XCFH 4AH2B 1VCBC 1MF2H 2YGNA 4HJEA 1G69A 1GCFA 3ZL4L 5AW5B 4F91B 4DK5A 3AIUA 4DF2A 4PPTA 3CQ0A 2CLVB 3NJGA 1UP2A 4OH2A 1MCOL 2C4FT 1QK2A 2PTZA 2VJ0A 4IS6B 2ODHA 3II1A 4U1NA 4AK2A 2JIEA 3TN4A 2VM3A 3GO2A 2QF8A 1RURL 3RVVC 3HNTH 3BW2A 4DELA 5EDXA 5KANG 3L1FA 1UYWH 4WFHE 4XNYL 5DUMH 5B21A 1O4UA 5I71C 3BE7A 2OMXB 1XSJA 2VIRA 3CBJB 4TVPL 4BXSV 1KY6A 3L5WA 3LN4A 3ZLGA 2V9RA 2P80D 5FF6A 1UUMA 3HPXA 3N9GH 1T80A 4P46D 4Q56A 1Q0YH 3A64A 3FU3A 4PRHB 1V55B 2OQJA 3KEDA 4Y9CA 5E6YA 1S5MA 2TRYA 2H90A 2EDWA 3W6LA 4HS6A 4XBGB 2HMID 3GTTA 1MJJB 2Y9RT 1LK2A 1QHPA 4INFA 1LORA 4QG8A 3LIZA 4ZEPA 4OGQC 1IT7A 2J78A 4LAJH 4YVNA 1C3FA 4KFMA 4MJ2A 1KLUB 4N0CC 1IXNA 5ABEA 1UVQA 3WAKA 1GUVA 4GH3A 3TF4A 4QRNA 4W7WA 3P6LA 3TTSA 2Z4QA 1SDDA 2R1WA 5JA9A 5F97E 4S1SL 3PTQA 1NOFA 2VDRB 4TOYH 4LSBA 1B6DA 2VHLA 4C60A 3RTLA 1Y18B 2QQLL 1P69B 4O9HH 1QFEA 3AUOA 3ITTA 1I7TB 2A74A 5TE4H 1AJ7L 3RTQC 2XINA 3EZ8A 2BS8A 4BCZA 4KJWD 2R23B 3SBRA 1T8QA 4XMKL 3L12A 4LC6A 4HIEB 4XVTL 3CWGA 4GLRI 5AKSA 2F6XA 2PDUA 3TH3T 1ME8A 4FJYA 5DMIH 2NY3C 3TN0A 3QY6A 4FYQA 4FEZA 2WM1A 5EA0H 4Q9RL 4ADTA 1PNDA 1UZHA 3VI4B 4U2ZA 1OQXA 4BKLA 1OFPA 1K02A 1U5HA 2B8OT 3AWNA 3LTVA 1TA3A 1G7JA 2Q10A 2KT6A 2LABA 2TRSA 1CGXA 1XGQB 3FTGB 1I75A 4HKZA 4W9FC 3G5XA 2WZIA 3VOCA 4Y19E 2VZ1A 3GJEA 4XN4A 1GA2A 1T1YB 3DI3B 1XMEB 5IJDC 4A37A 2NY6C 3W72A 4RAUB 3ULSB 1JXJA 3BZFA 5C0EB 1JBJA 3VFPB 5JR1L 5SWQB 1TTIA 1GOFA 2P26A 1F05A 2N01B 4LCQA 2QHRH 4R7JA 3WH8A 4MMZA 1E3FA 1A4LA 2VFEA 4JM2C 4HG4K 4LCYA 1N7MH 3PP4L 3BAEL 4RZKA 4U3XA 4Z95H 4L64A 3W0WD 5CZTA 3KYNA 1SFHA 4DN4L 2VLJA 4LLYA 1A5KC 5BJTA 1O7DE 3GNMH 4JPQA 1SOQA 2PD9A 3P5YA 4J12A 5DFTA 1JCNA 3ZUCA 4DI9A 5C92A 3EX6A 4JVWA 4UMGA 2DZSA 4KDTC 1NAMA 2JSFA 4U4MA 4YDNA 3ZDYE 4XNZB 2P3YA 4EIZC 1CI3M 1IE4A 1VYRA 1S7UB 1QI4A 2FL5A 4JTEA 4LFYA 3WMBA 3W85A 4Y16D 3EZJB 4JDEA 3QBTB 4B0MM 3FUHA 2QV5A 3HVDA 4Z76B 1IVTA 5HDBE 5F9JB 1FCBA 3B9KA 2QQ6A 3TDFA 4I77H 1W6TA 3UTSE 4A6GA 3BH8B 3KBPA 4ZO8A 3T65A 1C8VA 4ZBCA 4Y4FD 4UF7C 4OZIA 1XIBA 4KNUA 3BGGA 1O7VA 5KYYA 1ZCCA 4UTMA 1YBQB 1UVQB 1NFDA 3VX1A 3L9CA 3MXWH 5A6AA 4NM8H 4GRMA 3K2MC 3ZLHA 1F3WA 3G6AA 3B3IA 5LZLA 2MCMA 4HJGB 1CB4A 4HK0B 4TNFA 1EZWA 1M6UA 3SCNA 1NCIA 4NBXB 4RMVA 4K3JH 4OTXL 2HPOA 3FB8A 3RNQB 3WTYA 3D0CA 4JTFA 5FOOA 2X1QA 4C1NB 4UTAH 3GBMH 3FFCA 3GI8L 3VIOA 3NZUA 5D1QA 3BYTA 1BAFH 4XNQB 3UAAA 3PR2A 1UCWA 1U8KB 1BOYA 4I9WE 1TPWA 2Q20A 4XN1A 2AK4E 1AL7A 4ABUA 4POZD 4UWQB 2BSRA 2E68A 2VOTA 3D51A 4QJ4B 4I2XE 5FYJL 4DHLA 3W1PA 3EYSL 4G8IA 2GJZA 4JM2D 2FQIA 1I4FA 4LLDB 4XPTL 4JL2A 3MA7B 1JNDA 3IMTA 2H2SC 1A4CA 5C0IB 3MFFB 5DQ9A 3QF0A 4UTTA 1U42A 4M7KL 4PTTB 4B90A 2C79A 3L3HB 1F4HA 3MKKA 1CFTB 1D7FA 5EMLA 3UPMA 3MRDA 2Y69B 4ZS7H 8TIMA 2EYRB 2Z93A 5C0ND 4A2FA 1GC1C 3MRKA 4XBEH 4BXVA 1W6LA 5HHNA 3QQ1A 4MMWA 1OJXA 2CO6B 3GTXA 4JN6A 4N8PA 3DV4B 4OJAA 1V6TA 2PDJA 3M0KA 3VXMD 3FUFA 1SYVA 3A67H 1JYXA 4HKXA 3UR5A 3FT3B 4IBYA 3WL1A 5J12B 1P6AB 3QUYA 4I6VA 2HLFC 3C6SA 1RPKA 1J7VR 4YVPA 3ECBA 1F02I 4XZUA 5D9SA 1IIHA 3HAEH 4I90A 1X1NA 1P6FA 3BUQA 1ACYL 1FPTL 3VQ2C 1US3A 4XAWL 1GZGA 5MHBA 2OP4H 2P8MA 4N6QA 2XH2A 3F83A 3EBIA 3HFML 4XB3A 3ZQXA 3M7OA 1FHDA 5BOJA 4IQEA 4ATDA 3LEYH 4MADA 4LAUA 3MGTB 5IJKC 1XBRA 1U3HA 4PJ5E 2K7PA 3QI9B 1LO0L 1H09A 2YR1A 1NCBH 1Q9LB 2OA9A 3NOEA 1JZ3A 5DLML 3NCOA 2P4AB 4GRMB 3AUJA 5IIEB 5J6HB 1ZK5A 1THFD 4YGVA 1OY0A 3CB8A 4W5ZA 3UG4A 5FYKL 4PMYA 1FRGH 4OBRA 3TYCA 1Z9MA 2Z8VC 4HYTB 1LYXA 3KFTA 1SQ2N 3EKGA 1TQXA 1J86A 1MW3A 3BIKB 2L7EA 4R7NB 5CBAA 3MTWA 3CN3A 3GQFA 4RDQF 1DVJA 5HR6A 1DSYA 1U8IA 2XICA 3BG5A 4F9LA 4IGBB 1AZNA 4UTBA 1A7NH 1OW0A 3E5PA 1MRFH 3QQ3A 4P2RD 1JDAA 3S3BB 3SPHA 1UB6A 2ZZ7A 5F96L 3RX5A 3F5KA 3OPSA 4HNTA 2XV3A 4WFFE 3ARBB 4NRYA 5C2GA 4RNRA 5D7LA 1P2CB 4B5EA 1KCUL 3ZR5A 4TU1A 4B16A 1OGAB 3SDDD 4XODA 5BZWA 3D6GA 4E41E 5ABZA 4R7OA 1ZENA 2OZ0A 4WSJA 4FFYA 5A2CA 4Y5XB 3HI5L 1DBBH 2MCPH 3WKQA 2W88A 4I3SH 4EI5D 2GQ9A 1WXJA 1IJNA 2JLPA 3UACA 4CSPA 4LLWA 2WYIA 4JDZA 4QTFA 3N9RA 1JWMA 1VHCA 2EYRA 1W3NA 3USBA 1VZWA 3HC3H 1NDMB 4GIEA 4PR4A 4ZNEE 5C8JB 3MRPA 5E9DB 1FCVA 5D1ZC 2I5QA 2WWMD 3MLSL 1W3LA 1GTFA 3FVDA 4LVOB 5E94B 4A1RA 4AGOA 2X7WA 2R23A 1XIIA 4C57C 3NA8A 2BIQA 3RJDA 1P4UA 3S9DB 4QRRA 1FP8A 1UKOA 3PHQA 2DVUA 2Q76B 2E77A 3FNDA 2Y4SA 1KFWA 3L67A 2YDAA 1FYTD 3LU2A 5T3XH 3KOZA 1TTQA 3EAKA 3EDDA 4JY6B 4PLJD 2V2XB 4X0NA 3V8OA 4XWGL 4NJ9H 3MCOA 1F6FB 1I8KA 3G5XB 1N2RB 4PRTA 3ZWTA 4I2XA 1Z6JT 4L4TA 4XC3H 3J27A 5C0GB 5LJYH 2NQJA 1DBJL 1VLXA 2JJVA 4KESA 4E9WA 2XACC 5TH2A 2GABA 1L2UA 1WCBA 3HNVL 1KV5A 1C7TA 4JHAL 4KWOA 1JFQH 2JI3A 3STFA 4HSNA 4MWAD 2CGYA 2C16A 3KWUA 3C6EA 2ZOLB 1NAL1 1BGXL 3O6LH 2L5HA 3A9IA 4QAMB 2FZDA 1J10A 3ELFA 4I9JA 1VBRA 4OUIA 3U82B 4K07A 3TW7A 4N5EC 1I9RL 1F6KA 2LV4A 3WYZA 3U46B 4FAAB 4HLZH 4JDYA 1IC5H 2Z6IA 2X89D 3GR4A 2V0TA 2YAOA 2DWXA 2H32H 3BAEH 4D6JA 4UTHA 5EN3A 3VUSA 4N8CL 3LB6C 3OWRA 4QF1B 4LT9A 1V27A 3C2OA 4OB5H 1YDVA 1ZEAL 4WY7L 5IDIA 4QLJA 4CQDA 3GXTA 3QIUA 2YFOA 3U6WA 2WBWB 2YD5A 2Z31B 2AK4B 3VXOA 2W94A 3L7EA 3RHWF 5F89A 1ZY9A 4LEBA 2WNGA 4NHUB 3UAJD 4IX2A 5D7LB 3DRQA 2P0IA 3UC2A 1NDWA 4QSHA 3CHEA 2GVYA 2XFFA 2WCPA 3OPZH 4NYLA 1YE4A 4FG0A 4S23A 4YSUA 4U1NB 4CQ8A 5GGVH 2GOKA 4MPQA 2JTDA 3OC5A 5HANA 2NSXA 4N2CA 1KCSL 1QFWL 4AM0A 1MAML 5FM4A 1U22A 1WDWA 2JCCA 4PJ8B 1O68A 2A3EA 3EWUA 1U3JA 2OO6A 3PB0A 4PEKA 3LNIA 2FHBA 4UTBH 3HPJB 2X4PA 3PPSA 3KYOB 4X5LA 5D04C 1T40A 3QFDB 1RIHH 3WIHL 2AABL 4WO4A 1VGKB 4PJXF 1OAZL 1TZAA 3NRFA 5HBBA 5CFHA 3IJHB 1SVDA 3TTOA 5HHVH 2CWNA 2GJLA 1JN6A 2B5IC 4P5TD 5TQ0L 1LBMA 1DJHA 1IEVA 4TRPH 5JW4M 5LIXX 1EGVA 1CIDA 1FWHC 2PWHA 4RX4A 3GSXA 3OR7A 4MD0A 1EANA 1MJ8L 4QHLA 1UWQA 2B0SL 4LPWA 4JTDA 3IKCB 2YD2A 3B6SA 3H2MA 4O18A 4QRPD 4F7EB 5D5MF 2A3BA 4NQCD 1FQ0A 1GY2A 2WCAA 2GB2A 5J13C 3O3DB 3EO0A 1TCRA 2B59B 5HHXL 2ZZ2A 4RZ4A 3E9AA 2BVQB 2AHIA 2E5CA 3G5YA 2F68X 5FM5M 3T9PA 3WD4A 5E8NA 1W1A1 5GRVK 3VIGA 1RA5A 5FF2A 3UBGA 3FRPB 1ICTA 4DFIA 3MUXA 1Q6EA 1JJKA 1RJRA 4P4RB 4K6AA 1NFIA 3TH6A 4PJIA 2A7RA 3FN0L 3UJ2A 4MAYB 2CQVA 3SDDA 4LCUB 4PMFA 5E5UB 4J5VA 3K3QA 4CCDA 4FXGA 2BSTB 4RUBA 1EA9C 1OGGA 1VJZA 4GIYA 5AUMB 4XP6H 1PCXA 1XIGA 1SXAA 5JBEA 2WXOA 3F4WA 4LGRB 3CO8A 3VTMA 4IIEA 4QG9A 2DAVA 3WQWA 1N3NA 4FMVA 5AVRB 3O3UN 3QIBB 3DVGB 2YGVA 4I0PB 4FLSA 1IC7H 2R0KH 3HFFA 5E00A 3O3AB 2IAMB 4W9DC 4L0ZA 1XS2A 3GNXA 2QCLA 2JK2A 4KRTA 3EOYG 4LSQL 1ORSB 3QZBA 2BBFA 5HJLA 2A4EA 1N8WA 1DXEA 1P0SE 1JPST 1G9NC 1ZK9A 4RV3A 3D2UD 4RCXA 4DK3A 1N8OE 3CBKB 4WWKA 3T0EE 1WWWX 2MJWA 3GS4A 5DTFA 4HU2A 1HK6A 4H8NA 5LG6A 3OVPA 4Q9RH 4LVBA 4C91A 1N7KA 4US5A 4NO0D 3TA3A 3BHBB 2IQ9L 5BW7C 3O0KA 1CD1B 2GHWB 3TVMB 1MO0A 4L4LA 3CZFA 3PAJA 2VDOB 3E1F1 3GSNL 1NFAA 2C18A 4OF6A 1JZ6A 1UCBH 2PWEA 3RGVB 2DPKA 5EWIL 4CNTA 4JMXA 4YHPB 1EF3A 4HPOL 1RA0A 2J8GA 4L37B 3IVSA 3LH9A 1Y5VA 2E7MA 2V5BA 5E94A 3VK5A 1FIEA 2DJ4A 2F08A 1UMLA 2VLJE 3WTSA 4K7VA 1GC1L 1RBOB 3ALFA 1FJ1B 4XN9A 2YAMA 4G7VH 1O6IA 2EDYA 4GBXA 4QAWA 5DSCB 4HEME 4IJ3B 1W1TA 2FTYA 3L7FB 3UU0A 5JIKA 5FA5A 5FCUL 5EUKB 4JTLA 1ECZA 5FOBA 4Q4QA 4KFZC 1A6UH 4ERIA 4DKEH 1TG7A 1RH9A 4AZ5A 4M5TA 4L4TB 4X7SH 3VE0A 4Z3TA 5C0BB 2BGNE 4NZCA 4V27A 5FV2A 1CFSA 3MUZ1 2PW2B 4TUKH 1OHQA 4L9LA 3APNA 2WQRA 4N1HB 4TYUA 4QUOA 1L9QA 5F2LA 1NGPL 2GJPA 2CKBB 2V8MA 2XN9E 4L8BA 5E6UB 4RMQA 5D7JB 5JPNA 1CFNA 1YEIL 2PWDA 3BP7A 4FQCH 3IEBA 3L2IA 4R7VA 4I8DA 1E73M 3VIHA 1EJ8A 4HIEA 5FLVA 3CK0H 3AO0A 3KRSA 3RBSA 5HHPA 2I7SA 3HTWA 4D94A 1JOIA 1VQTA 4E5XG 3H7BB 1KBKA 2P7TA 4ALDA 1YEHL 1QWGA 2GK0B 3AB0C 3JYCA 5A2AA 5IB5A 3O05A 1ZLEA 3MV7B 3WUEA 4M1DH 3TV3L 1DO6A 3VFMB 3GJEB 1BG9A 8PAZA 5J13B 1BG4A 1GVYA 4DVOA 3KPRE 3LXUX 4QLWA 2DLEA 1W5MA 4UC5A 3D7PA 3QIUB 1OP4A 1X5JA 5C54A 1J5TA 4UWMA 4G5AA 5CP3A 3NXFA 1I60A 4WO4D 4X9YA 1BXUA 3NSDA 5F89B 4K7YA 3MV9B 4X80L 3ENLA 5D1ZI 3PAOA 3MRIA 1H4PA 1HJSA 3RITA 4FNLL 1M68A 1U3ZA 1D9KD 5KSBB 3DTUB 4EJ1C 3NRQA 5C86A 3TYFA 1KPUB 2VW4A 4P5TA 1F1DA 5A1AA 5AHIA 4PRAB 1G9EA 2VN4A 3IEAA 4AJVA 4BQBA 1F6AA 1JCYA 3FLUA 1EFXA 2APXA 5I6XC 1KBIA 3GC5A 4GC3A 2OVLA 3TSMA 3NACH 3S83A 1E28A 2ODIA 3T07A 2E9JA 4K1GA 3WNMA 3F00A 5E1AB 1A7NL 3CQQA 4JKPL 4R2GC 4V33A 1QK0A 2J1YA 3QIWB 4HZLA 1UFUA 1NF0A 4Z42C 1J9CT 3D4GA 1K6AA 1P7HL 1OADA 2ADFL 2AKRB 3IDJA 4AQAB 1T04B 4P3WA 3EXLA 3T7VA 4K68A 3ZTJH 4TULL 1NGWA 4YFLF 5I8KH 1B3VA 4HH8A 3LHAA 5I1KL 3RFZB 1T0MB 1BKHA 5IBXA 3DK0A 4PYGA 2G75A 3WTUA 3OKMA 4L8CA 2PBGA 2WQPA 2VAAA 4LYRA 3EZ4A 4QGCA 5A5WA 4A6YB 3S47A 1ZIBA 1FNSL 5D2LF 5KSWA 3P4NA 1LILA 2IPTH 2XWJB 4X6BA 4YHKH 3IIVA 3FPYA 4F0RA 3L7FA 4YGVB 4GOAA 3E3QC 2HH0L 1UA6L 1FL5B 3TWCL 4E5TA 5LIYX 3HRPA 3DSNB 3MY9A 4S10A 3ARSA 4YDLB 5EOCL 1UD2A 3C8KB 3BDBA 1ZLVK 2RAMA 1H8SA 4U6XA 2YDQA 1MFBL 4PRDA 5DVLA 4EP8C 1T5XA 4HD9A 5L8KB 2WB7A 3NFNB 5B38B 1ET5A 2YEVB 2APFA 3NJLA 4FEIA 3E6HA 5K9KB 3O9WC 3CX5K 4DN1A 5A7BA 1P0EA 2WJZA 4GY0A 3PFQA 1U2YA 4JY9A 3WQVA 4DO7A 4NJ9L 1R3WA 1GGUA 1MN4A 1Q0XH 3P2BA 1U8KA 5TFSL 3PANA 4UTIA 4Z3JA 2E27L 4ZB0A 3DX5A 3TAKA 1ZVSA 5BXTA 4ZYKA 4PJEF 4AOFA 3QR2A 1UXSB 2YOAA 2WSDA 1PSKL 1LF1A 3PY2A 1K4DB 3G5ZB 1B2WL 4NO2A 4US5D 3KPSB 4OFDA 2Z2AA 3N41F 4YSTA 3ISIX 3VFNB 4MZ3A 4NQEB 2P5ED 3K1KC 1IWAA 3E8UH 3H9SA 4JDZB 3OIHA 3H3BC 4OCMC 5TE6H 1VPYA 1ADWA 4XBKA 1RP9A 2XTJE 1QA9B 3MR9B 3WELA 3QJTB 3LZNA 4JY6A 2YL9A 4KH9A 1A6ZA 5I1EL 1NMBH 4PTTA 4J3OD 4ZQKA 2YL8A 4E9LA 1XB3A 2YKLL 3N2JA 3O3AA 4IGSA 4TMBA 1HCZA 3V36A 1Q1JL 3ZN6A 1VFUA 3KCJA 3VVGA 4MB1A 4B4HA 4HNNA 5F1UA 1DL3A 4EOUA 1CICA 1FYTA 4PB0L 2BRRH 1LE9B 5I3DA 4GUCA 4ODXA 4Y4FC 4Z77A 3C2EA 1RJZA 1JL8A 3CFTA 5GRJL 5BYWA 4UT7H 5IJKA 3KG5A 3X1NA 1KIUA 3OP2A 3Q65A 3O8XD 4IBTA 5TQLA 4KAQH 2DF3A 3KRUA 1JD9A 2IF7A 4GY4A 4TSAH 2G3JA 4CJ1A 1LO5B 1S78D 4JS7A 4PJGF 4K5OA 5FGBC 2PDYA 4I3RH 2Y61A 1HS6A 3BPNB 4GSDL 4J3WA 4HK3J 4K39A 1MRCH 4E2VA 4XD6A 2ESVE 4Y4KB 3PPEA 3AWGA 2ZCZA 1FYHB 1OE3A 1ZIAA 4F7TB 1NEZB 5T1MA 3F7PC 3GWQA 3CX2A 3UZYA 5HDRA 3MROB 1R2SA 2V3DA 3IJYA 3OHMB 1NIEA 5CLXA 1UM4H 4OIAA 4X50A 3HF3A 4QEGA 2AQRA 3P3RA 3GRGA 1U3HB 3RVTC 1XIJA 1Z3GL 1WTGT 2ZNXA 2EE3A 3MLPA 5SV4A 2UY4A 1PZ2A 3VINA 1XLMA 1JWSB 3D06A 1RIVH 3BP5B 1SMDA 3DXAB 3ECUA 4G8GD 4JBSA 4XVJH 2AABH 3L3JB 2WZ6A 1JNLH 3NZSA 4L80A 1AA1B 2CO3A 2OYPA 1JZ2A 1UH2A 3QGAC 2QPUA 4QEHA 4Y4HB 3O1NA 1R6WA 3JTTB 4PMXA 1FNGA 3KBEA 3X11A 1K9TA 5DRWA 4B95C 1ICQA 2XNAB 2XUWA 2R15A 1FV1B 2YJLA 3ELAT 1SFLA 3QVAA 4HZ6A 2H32A 5EC2A 1AC6A 2B39A 3FHQA 4DGYL 1A6TB 4X4MA 2GSJA 4Q8MA 3FT2A 4CQCA 4MZ2A 2WV3A 4A2MA 3HM7A 2R2EB 4LARH 1UA7A 5CSYA 4EF9A 4KRPC 3UTSD 2UWFA 4MKMA 2X7LB 4WEVX 4LS0A 4GI9A 3GK0A 2ITCA 5DC4B 3CFDB 5CBEA 5T5NF 3OJDB 1G4RA 5DT1L 1JGLL 5BZWB 1QNOA 3VD1A 3STCA 3RJOA 3TX9A 2NY1D 1V5XA 2WWMC 5A8MA 1B6UA 2JKNA 3IS1X 1IKNC 3QZPA 2DSWA 5K9CA 4YDLC 4DTGL 3ZLFA 3QPKA 1ZANL 4V1YA 3S3CB 2Y7GA 3L2LA 5DY2A 1CVRA 5BRQA 1OX4B 5ABHA 1R3IH 2HSAA 1DEEB 3CFMA 2EE0A 3URAA 4HDIB 3DIPA 1IC7L 2R0KL 4LCWB 1ZEAH 4WY7H 1YPFA 3MAWA 4MAUL 1A25A 3DX9A 3JZEA 1ZAJA 1CYXA 4LF3B 1GZHC 3RKPA 1XF1A 5BXFA 3LH8A 4GIOA 3AY2A 1Q63A 4WEEA 5BS0D 2J27A 3TF7C 1JK8B 1PCWA 4UIMA 4XAYA 4BV1A 4G7YL 4ROPA 4WW2B 2VQ1A 4I5BB 4NI8A 5BU9A 1ZTXL 3D0LA 2PYFA 3PWJA 3HFYA 3WS6C 3AFBA 3MWAA 3D1MC 2YAFA 3RCYA 4B3ZA 3BN3B 2AXGB 4GFTB 3PB2A 3MNWA 4U0QB 1PZ3A 1PZ1A 3V4VL 3OZLA 2YZ1A 5I15H 1PV8A 3HS9A 2B7OA 1ZA6A 3T8VA 2XKUA 1LE5B 3R4DA 4CVZB 4ODHH 2P24B 3GMMB 5BXPA 1MFEH 3WLIA 2MPAH 3TQKA 1E8YA 1AQ0A 4TMCA 5C2XA 2E9GA 2R69L 3X13A 1J05A 4MLIA 3CQHA 4U28A 4JG1L 5AOJA 1IARB 2MH4A 2CUHA 4H2HA 4X9SA 3MRCA 4HWBH 5I19H 1R9ZA 3EPMA 4JRLA 3GRWA 4Z2HA 3BLFA 2QVMA 3ZY7A 1CLCA 3OZ9H 2YXVA 3H55A 3EOEA 3QN3A 4CVWA 2E7FA 2A6DB 3E6FA 3D4ZA 4D3CL