2WSPA

Thermotoga maritima alpha-l-fucosynthase, tmd224g, in complex with alpha-l-fuc-(1-2)-beta-l-fuc-n3
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
443
structure length
435
Chain Sequence
b'KPRYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNGMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-L-FUCOSIDASE, PUTATIVE
publication title Beta-Glycosyl Azides as Substrates for Alpha-Glycosynthases: Preparation of Novel Efficient Alpha-L-Fucosynthases
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 152
structure length 435
sequence length 443
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2wspA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wspA01
2WKLA 3EJRA 1PZ3A 2D2OA 3DHUA 1DWHM 1BSIA 1QWNA 1UWUA 4PMUA 2OWCA 2F61A 3ARVA 2PB1A 2D23A 3ARZA 1P6WA 3WQVA 1GW1A 1HJWA 4JHOA 1ZBKA 3F5JA 4Z2HA 3UG4A 1UZ1A 4UFKA 1M01A 1K6AA 2EPOA 5HPOA 3SUUA 4PMDA 4V2XA 1J0ZA 3ZSTA 1K9DA 2WKGA 1PX8A 4GKLA 1W3KA 3IJ9A 1UD3A 3ARTA 1HXKA 2J74A 1W1YA 1GQIA 3VX0A 3UERA 4UR9A 4ZE5A 4U5KA 1GJUA 4MDOA 4D6CA 3VDHA 1E9LA 3EDDA 1V3HA 4QLKA 1FH8A 2HVMA 3SIMA 2QLYA 3VIJA 4AISA 1UH4A 4X0VA 2O92A 1JFXA 1XCXA 1SMDA 1R34A 4DWSA 1GNXA 1K9EA 1KBBA 4Z2GA 1XC6A 6CGTA 1LL7A 1OGSA 4W86A 3H55A 2J7HA 4U2ZA 5KEZA 3S2CA 5TD4A 1ZBWA 3VGGA 3PZNA 5IHSA 5A8PA 1W3HA 4GO9A 2J79A 1UKSA 3AMGA 1MW0A 2WHMA 4TX8A 1EDTA 3WDQA 2WMIB 3CPUA 4AIEA 5DF0A 2ZXDA 4EE9A 5BCAA 3BCFA 4WIWA 1NOUA 2EABA 4D71A 1TA3A 1R7OA 4HA4A 3U7VA 3APGA 4YPJA 3WH7A 3VDBA 4P8UA 2BV9A 1LG1A 4GIAA 4NI3A 3GBDA 2ZUMA 2NSXA 2W63A 3FNDA 1A3HA 4WK9A 4D72A 4J3SA 4W8BA 3W37A 2VMFA 2V3EA 3ARXA 1LG2A 1E0XA 2W67A 5AC5A 3EJSA 1C7SA 2VX5A 4XUYA 1UWTA 3K1DA 4UOZA 1UHVA 1FA2A 2VJXA 2Z1KA 4LXFA 1UR4A 1J10A 4AZIA 5BRQA 1E5JA 1AQMA 1PS3A 1UZ4A 4AMWA 3WH6A 1UWQA 4BF7A 3AFBA 1PAMA 3WBAA 4P8WA 1R75A 1WZKA 1E4IA 5A6BA 2NT0A 2WNWA 2NW0A 3GNRA 1G9HA 2DSZA 7CGTA 1GOIA 1JZ2A 1UD2A 4AZCA 3IAQA 5HPCA 4GZJA 1US2A 3IJ7A 1VEMA 2W5FA 5A8NA 4AMXA 4XZWA 3BLKA 3EDKA 1HVQA 1KGUA 4M24A 1HP4A 1HKIA 4BQ4A 2C0HA 3T2PA 1CXHA 2AMGA 1E55A 3WNLA 1MVYA 2BXYA 3HZ3A 1G94A 4UQCA 1JD7A 5KZ6A 3F5LA 3U5UA 2OWWA 1MFVA 1WKYA 2ZWZA 2BXZA 3BUBA 1NOWA 2YBTA 1JL8A 3DX1A 3WEZA 2QPSA 3O9NA 4DWSD 3GH7A 3GM8A 3AROA 4P7QA 1E0WA 1CGYA 3TTYA 3WD4A 3RM8A 1QNPA 1C92A 2YKKA 1QI0A 4PN2A 2WVTA 1IT0A 1PX4A 4ZENA 3DC0A 5I23A 3VIMA 3POHA 2W91A 4B3LA 1JDAA 1H0GA 4FNQA 2Y8KA 3RIKA 2AAAA 3SCSA 3SEPA 2BVTA 1JNDA 3FHAA 3BVTA 1IZJA 5LYRA 3UR7A 4D6DA 3VSVA 4LYRA 4MADA 3BAJA 2EEXA 4ZEPA 1E6RA 3GXMA 1SYTA 3T2QA 4Q22A 4GXPA 1WZLA 4NZFA 4JL2A 2O9RA 4NXKA 1QBBA 4DM1A 2BHYA 1KCLA 3VPLA 3DDFA 1V0NA 1R85A 3PZTA 5HDRA 3LX9A 1TG7A 1Q6DA 1JGIA 1M53A 3D5HA 4AIUA 2VZTA 1J11A 1FFQA 4CU7A 3TV8A 3BUDA 3UESA 5I78A 1MXDA 2Y5EA 3W25A 4HZ8A 4A4AA 1J18A 4X9YA 1NOFA 1J12A 4CU8A 5A6BD 3QR3A 4Q7NA 4H2CA 3WUBA 5CZKA 1K9TA 4L4OA 4BZYA 2JEPA 3CHCA 3VX1A 1UKPA 2BY1A 5BXRA 5A6KA 4OGZA 3U7BA 2WBKA 4UFLA 3F5KA 4D6GA 2CERA 2FDMA 3POCA 2CXGA 4W88A 2VX7A 1E1FA 1BAGA 3WNOA 3NSNA 3LXBA 1B3XA 4JKKA 2Z1SA 1UQYA 5E0FA 3GNPA 3SCOA 1ECEA 5LA0A 3A6OA 1VRXA 4HPHA 4W93A 1QBAA 5D4YA 3U5YA 1RPKA 2GJXA 2IUZA 4P7LA 5ABFB 3WF1A 5FIPA 6A3HA 4JFTA 2EO7A 4JZ5A 3DX2A 1LLOA 3WQ8A 3W24A 1VJZA 5DO8A 3VD5A 3CGTA 3VGHA 4TVUA 3MS8A 2VQTA 3CZJA 2WMHA 1WO2A 3N9KA 4UZUA 2XN2A 4PRWA 4AZBA 1PX3A 1MWOA 1Q6GA 2V3GA 5D9PA 4MB3A 3NSXA 2G3NA 1HL9A 4GZIA 1C3FA 3WEOA 1UD5A 2WHJA 4ZE4A 3EBVA 3WQ5A 1QNOA 4CD5A 3LPFA 1JDDA 1VFOA 1YQ2A 1KWKA 1AMYA 1I1WA 4CVWA 3PZ9A 3AIQA 1EDGA 1W9XA 1ZJAA 5BXSA 5FL0A 5I6SA 4U5IA 4UQDA 4F9DA 3K46A 1TZ7A 4R5EA 1XD1A 1BYBA 3SCPA 1B30A 3DX4A 1Y7VA 3AS3A 5D8WA 4C7DA 4JFUA 1RP8A 4AC1X 3BSHA 4IM4A 2VCCA 1GOQA 3AXHA 3S5YA 2X0HA 2ZX8A 4LX4A 3SCVA 2ZWYA 3M6DA 3OG2A 2F7PA 2XIIA 3WQ4A 4PMYA 4D6JA 2WZEA 4GPNA 5BWFA 3AMKA 1X6LA 3L4VA 3EMQA 3DYOA 2PF0A 3VMNA 1JAKA 2WCGA 5FOOA 1QWUA 2ZUSA 2GJPA 3MANA 2WVVA 2WBGA 1LJYA 1VEOA 2ZIDA 1KB3A 2BS9A 3PTMA 1PPIA 2CHOA 1E0VA 2E9LA 2FHBA 2VT0A 2PBGA 2V3DA 2W92A 3GZAA 4W7UA 3ZJ6A 3VD4A 1BVZA 1EO7A 3L4ZA 3L4WA 2D20A 2YOCA 2OW6A 3MUY1 1ISVA 1CGTA 5F7UA 1HIZA 3VILA 2X2JA 1FP8A 2ZUVA 4FNTA 3BMWA 4YN5A 3UETA 1G5AA 5A8OA 4Z2KA 1OIFA 2X0YA 3ALGA 4UOJA 1EDQA 1XCWA 1XYZA 1HNYA 1QI3A 1PBGA 1DWAM 1E5NA 4QDMA 5ABEA 1A47A 2O9PA 1JXKA 5A6SA 2DSVA 2ZX7A 3AHTA 4TX6A 1WDQA 4TTGA 3NDZA 1B9ZA 1KR1A 2J7GA 2CHNA 4HPGA 3ZT6A 1B1YA 4H8HA 7TAAA 5LA2A 3K8KA 8A3HA 4GO8A 2ZICA 4DWSB 1BFNA 3WMSA 3MUZ1 2EBNA 1UOKA 3SCUA 1JDCA 1UR0A 3QHMA 1VFMA 4PTXA 3BUIA 2W66A 3SCTA 1HT6A 3WNMA 5I79A 3VINA 3RCNA 4FMVA 4Z2JA 3CBWA 1TA3B 4A3YA 1JZ6A 1QNSA 1E40A 1UWIA 1V02A 1FH9A 4W5UA 3FAWA 3D51A 3AZSA 3WD0A 3WY1A 3VNYA 3VD3A 3W81A 3VMOA 4GI8A 2XGIA 1JYWA 2WLZA 1Q6CA 3L4XA 2QMKA 1CYGA 3HMCA 1UKOA 4NF7A 4PMQA 4GQQA 2V38A 1W9BM 3LPPA 2J7DA 3WL0A 4P8XA 4PMRA 1TQSA 4W85A 2D22A 3VTRA 2JIWA 1GOWA 3ECQA 2JIEA 3B9AA 1JYXA 1R47A 1XGZA 4E2OA 2DIEA 1EIBA 1VBRA 2X05A 3OZPA 3VGBA 3A21A 3DX3A 2W4XA 1DTUA 4H7VA 5E70A 1CWYA 5GPRA 4CN6A 4AZCB 1R87A 2YL9A 3BAIA 1GHRA 1G0CA 1EQCA 3GXPA 4MNKA 4ZFMA 1UR2A 3VGEA 3T0AA 3CUHA 2ZXBA 2XTKA 3IGUA 1EHNA 2VC9A 3MUAA 3WD2A 5M3WA 2XM1A 1BVNP 4FLRA 2CYGA 4ML4A 2XFFA 5DEZA 4DUXA 5A2BA 3SCQA 2WSPA 1W9DM 5FD0A 3WFZA 3UG5A 2DDXA 1EXPA 3VIGA 1MW3A 3VO0A 3WFLA 3VU2A 1DWGM 2D1ZA 1JF5A 1GQJA 3THCA 5C70A 1QI5A 3VGDA 5HXMA 2CEQA 3PZOA 3KL5A 1FFRA 2VTFA 1JZ4A 3W26A 1I1XA 3MUIA 2G41A 4MNMA 5IXEA 3WF0A 1TVPA 2Y2WA 1ZBCA 2YDRA 2EPLX 2ESCA 1JAEA 2EPMX 1FHDA 1V3LA 4HA1A 4FLQA 4JFWA 1OGGA 2G3IA 3I3BA 1CTNA 2J4GA 3G6LA 2VQUA 1UUQA 3O6AA 2WMJA 1V3MA 1R86A 1WAWA 1ODUA 4WF7A 1GVYA 1CEOA 3WUFA 1OINA 3WNPA 2XVGA 3GNOA 1RD6A 3H53A 5CJ5A 3WY3A 4WSKA 1W2PA 3BAKA 3BAYA 5BYWA 1F4HA 1V0LA 3RILA 1JI1A 4MNLA 3HJEA 5IDIA 2VR5A 4LGXA 3L4YA 4Z2LA 1OM0A 3B9DA 2OLHA 3PTKA 3BSGA 4NRSA 1QX1A 3VDAA 1MXGA 2GFTA 3AMCA 4AEFA 3IJ8A 4CN4A 1GOKA 1JYVA 2CKSA 2G3MA 2J25A 5A6LA 1JYNA 3TTSA 2ZX5A 4AZ5A 2JF7A 2F2HA 4X0NA 5ABGA 1J0IA 1B3YA 3PZGA 2FGLA 3W82A 1VFUA 3CH9A 4DO5A 2EQDA 1CXKA 2WMKA 4AD0A 4CD7A 4OOUA 3B8SA 2O9TA 1HJUA 2PWFA 4AZGA 2EACA 1V0KA 4LYPA 3I3EA 1UD8A 2YLLA 3WN6A 1NARA 4UCFA 2WB5A 2ZUWA 2PWGA 2GJXB 5CGMA 1QW9A 4JCLA 1UA3A 4CVUA 5BXPA 1JG9A 3HG2A 4W5ZA 1GORA 1BGGA 4AMCA 2X8RA 4QAWA 3DECA 3TP4A 4KRTA 2WHLA 1JD9A 1J0JA 1KWGA 1E72M 2ZX6A 5A6JA 3AHVA 1CENA 3GXNA 3OGSA 4Z2IA 5AYBA 4PSRA 4DUVA 3OB8A 1UWRA 3LXCA 4AZHA 4FNRA 3ZJ8A 1G1YA 3NYDA 2F1AA 3LMYA 1C8YA 1AVAA 1ZL1A 2YA1A 4J3WA 3CUGA 4W7WA 1BYAA 1HVXA 2GK1A 1NWUA 4TTUA 3SCNA 2V5CA 3VM5A 3D4YA 1SMAA 2XPKA 1QW8A 3OA5A 2C8NA 3DDGA 4PMOA 4KRUA 5LA1A 2IXUA 2Y8VA 3OGRA 5DMYA 4MB4A 5BRPA 1JF6A 1DWIM 1QHZA 1JZ3A 4PUEA 3AYRA 1R8LA 2VZVA 1XHGA 1UH2A 1VB9A 3EDEA 3ZT7A 3WIJA 2G8ZA 2ZUNA 2D0GA 3LXAA 2XM2A 2DSWA 4H41A 4TUFA 1OIMA 2YA2A 3BMVA 5HNNA 2F18A 1V6VA 1UR9A 1W32A 4CN1A 2DEPA 3MI6A 1MYRA 3PZQA 4GI6A 3VM7A 4B3KA 2OYMA 2A3HA 1US3A 4W7VA 2B31A 3CTTA 2XG9A 2E8YA 1BG4A 3W6LA 4URIA 2G3JA 1UD6A 1ODZA 2WCAA 1GCYA 4M56A 1DWFM 2VVSA 4LYQA 1CNVA 4RL3A 4CKQA 4EAMA 2YLAA 3N04A 3ZJKA 3FAXA 1W91A 3NDYA 1C7TA 5CSUA 4JIEA 3SUWA 2XVNA 1KGWA 4MPKA 1EH9A 3FHQA 2BNJA 2UY4A 4W8LA 2EXOA 3WH8A 4OIFA 3WF3A 4N42A 2E0PA 1LQ0A 2WZIA 5A95A 2J7BA 5CXPA 3BVXA 2GDVA 1E43A 2CBUA 1KXTA 3MO4A 3ZR5A 1WP6A 1WE5A 1NWSA 2YFNA 2F8QA 3GYCA 2WLYA 1QI4A 4ACYA 3M7SA 3GXFA 1KXVA 3HG4A 2DPEA 1OT1A 2J77A 4CCDA 1W3JA 4TVCA 4CU6A 3K8LA 4JL1A 1HJQA 4PMNA 3KL0A 2E9MA 4ZXLA 2BFGA 3KZSA 2D0FA 2UY3A 4XZBA 3VIHA 3AIEA 2CBVA 1R46A 3AOFA 2BY3A 1FP9A 2WW5A 2CPUA 2PWDA 3QHOA 1KQZA 4CD6A 8CGTA 4MJ2A 1E1EA 3T2OA 1H1NA 1E6SM 4AZ7A 3EDJA 3WUGA 1U30A 2V3FA 1BYDA 4DM2A 1ITXA 5I2UA 3CZKA 2W61A 1B2YA 2AOSA 5DT7A 1KTCA 1HF6A 2DQXA 1HJXA 4DO6A 2OYLA 3CO4A 2JE8A 5HOSA 3W29A 2WXDM 2WVSA 3W0KA 3D50A 4ATWA 4B16A 5FL1A 3LPOA 1GVIA 3MMWA 3A4WA 4HMCA 2TAAA 2C7FA 1LL4A 3AISA 1Q4NX 1RH9A 5M17A 1CECA 5CPQA 1HJVA 2EPKX 1GJWA 2VX6A 3FY1A 2E9BA 2F7RA 5GQBA 1PJ9A 5E9AA 1CZ1A 1M7XA 3CZGA 1ISXA 5GNYA 3VDCA 2CNCA 4JCMA 5IFPA 3FXYA 1EOMA 4ATLA 1SR0A 1MW1A 2X1IA 3FW6A 1TMQA 3MSGA 3N18A 1NH6A 3A24A 1ZBVA 3W38A 1O7DC 1UKTA 3DHPA 6TAAA 2G4FA 2WHKA 1WCGA 4W8AA 3T09A 1HJSA 1UYQA 2E4TA 2OYKA 3N12A 1SFSA 2J8FA 3PTQA 5M5DA 1IV8A 2WC7A 2VZUA 1CLVA 4J3XA 1C8XA 1NP2A 2FH6A 3PZIA 4PSPA 2XHYA 3A47A 3RJXA 1GPFA 1WB0A 4NZJA 2DGAA 1V6UA 5I0DA 2DH3A 2FE0A 1KGXA 3L2LA 3VGFA 1E6NA 3VSTA 1MQPA 3SUSA 3VIFA 5A69A 1GQKA 2BHZA 4LPCA 5AY7A 2RGMA 5HBFA 4MB1A 3HG5A 3MMUA 1B0IA 1MW2A 3TOPA 3GBEA 4HU8A 3MU7A 3GDBA 3RM4A 2E40A 4E4PA 4C7GA 2UWFA 1XV8A 1JIBA 4FLOA 1V03A 4HA3A 4ACZA 1J0KA 3H54A 4MB5A 5CLTA 2VO5A 1BTCA 1CGXA 9CGTA 4FNPA 2PBOA 3GXTA 5E1QA 4D6EA 2YA0A 2XSBA 1OBAA 5CGTA 3WDIA 2XN0A 1UR8A 5I5RA 5DT5A 3SUTA 3D3AA 2DH2A 4IUGA 3OLIA 3ARRA 1C8QA 2XFRA 3N1AA 5EMYA 1ESWA 1B90A 3BUQA 4HOWA 3GXIA 4FNSA 1ZJBA 3BUPA 3KWXA 3EYPA 4FF5A 4MJ4A 3F4VA 3K4AA 3ZR6A 1Q6FA 3WH5A 4U31A 3AIWA 1EA9C 3VIOA 4AD3A 1O6IA 1V3JA 2VNCA 1W3LA 4QLJA 4HMDA 5CPTA 1EOKA 4BCEA 4J3UA 3IAPA 4DO4A 3A3HA 1M03A 2CESA 2WMFA 3EDFA 4OUEA 1UASA 1OCQA 3OGVA 1HTYA 1UD4A 3WL1A 3ZQ9A 1OD8A 1E70M 3GH4A 3VSUA 3QHNA 5FCZA 5CQ1A 1V6XA 2WC4A 1XH2A 4JAWA 2JF6A 4HP5A 1EO5A 1X1NA 3VD7A 5E6YA 4EK7A 2ZX9A 1TUXA 2UY5A 1CBGA 3WD3A 4HZ7A 3CHDA 4KGJA 1XSKA 4J7RA 2YIHA 4U2YA 4PBGA 1L8NA 4K68A 4PUDA 3TA9A 1J0YA 2XGBA 2WK2A 4C7FA 3BVUA 1BLIA 5I24A 1LWHA 3KLLA 4M29A 1C93A 4U3CA 4E8DA 5D8ZA 3MKKA 3G6MA 4OZOA 4L4PA 2WYSA 3HG3A 1KCKA 1PIGA 1OWQA 3CV5A 1M04A 1CXEA 4XV0A 5A3HA 4YHGA 1AQ0A 3S5ZA 1C91A 4N0RA 1JZ8A 2ZUUA 4R27A 1CGUA 1UKQA 3CZEA 3CMJA 1XH0A 3HN3A 4KWUA 2HISA 3NCOA 4BQ3A 5BXTA 3WH9A 3WMCA 4U33A 1HX0A 2Q8XA 1XYFA 4F9JA 1W1PA 1E6XM 2A3EA 1XRVA 3O2LA 3EJQA 1VENA 3VIIA 1KBKA 3A22A 3PBGA 4W84A 4AYSA 1QOXA 1VEPA 2GK1B 1FOBA 5I77A 1Q6EA 3WNNA 1KQYA 4UQEA 5ECUA 2BY0A 5ABHA 1SZNA 5GNXA 2OWXA 1PEZA 2ZXQA 4FNUA 2VL4A 3LPGA 1CLXA 1BF2A 1H41A 1MQRA 2XN1A 4WKHA 4D1IA 1HL8A 3QOKA 1E15A 4S3JA 3PZUA 3AMDA 4WSJA 2QHAA 3TONA 1VFFA 1JI2A 2DSUA 5A1AA 1KXQA 2VUYA 1DP0A 2OW7A 2VX4A 2F7OA 1J9YA 1QVBA 1ITCA 3K4DA 5C8BB 5E09A 1E56A 3AIUA 4WKFA 2J78A 1QPKA 1DEDA 2YL6A 5D9MA 1OD0A 2VI0A 4NSBA 3CMGA 3U57A 5JBDA 2WPGA 2CKRA 3WKZA 3IANA 4M80A 3IK2A 1V08A 3VKKA 1UQZA 1H4PA 3VVGA 4EANA 3W53A 1CDGA 3BAWA 1DWJM 4RE2A 2VRQA 4D6FA 3KLKA 5AYIA 1HWWA 3L4TA 4F8XA 1KTBA 3JUGA 2Y24A 4GI9A 3ALFA 4MAZA 4B9YA 2ZE0A 5JIPA 1V3KA 1L0PA 2VCAA 5E0CA 3ARWA 4OOZA 3ZO9A 2PWEA 2F1BA 3CUFA 3CHEA 4HOZA 3ZIZA 3CZSA 1ISYA 4BQ2A 4B9ZA 1E6ZA 2XVPA 3AI0A 1XSIA 3A4XA 2YL8A 2JALA 3AIRA 1FHLA 2XVKA 1V6YA 3NIYA 4P7OA 4BA0A 1QNQA 3VD9A 3NUKA 3WNKA 3NSMA 5CG0A 3AS0A 3J7HA 5CLWA 4UTFA 3ARUA 4JFVA 4J28A 5D9NA 1ISZA 4H8UA 1TE1A 3ZT5A 3A23A 3ZJ7A 2FYVA 3LRMA 1LWJA 1DHKA 2VOTA 1WDSA 3AICA 2GUYA 4FK9A 4D6IA 3NJ3A 1GZJA 3QOMA 3AIVA 2GSJA 4KGLA 1E73M 4LQ1A 1H11A 2Y4SA 2VVNA 4B15A 3WQ6A 4EKJA 1BHGA 4UFHA 3AS1A 1IZKA 1TCMA 3WENA 1I75A 2WZHA 2XIBA 2VCBA 2X2IA 3BXWA 5EB8A 2VZOA 2FGZA 4MNJA 2WVUA 3K8MA 4QCEA 5EFDA 2VURA 3RO8A 2FHCA 1JFHA 1ZU8A 1UWSA 1JNEA 3ZOAA 4D6HA 4PTVA 2FHFA 4UZSA 3GXDA 3T0DA 3W4RA 3PN8A 3WELA 2WM0A 4JKMA 3BCDA 4NX0A 1H49A 2XWDA 3BGAA 3WSUA 3RDKA 1MQQA 3OBAA 2BVDA 3AQUA 3AHZA 3N13A 5FKYA 4RE4A 3W6MA 2X09A 4PYSA 1C90A 5DFAA 1U2YA 2J7EA 1RP9A 2E8ZA 1E4NA 4ZXOA 3CC1A 3EJUA 2WANA 2J7FA 1E71M 5IHRA 1CXIA 2BY2A 4TOQA 1TQVA 2YDQA 3N15A 3ZSSA 1WPCA 1XD0A 4PCTA 1HP5A 1NM9A 1T0OA 3ARQA 2JFEX 3S6TA 4NXSA 3MMDA 2WVVB 3LRLA 1HKMA 5A8QA 4OBRA 1GOOA 3EMZA 3RJYA 2DT3A 3RM9A 3CUIA 4F66A 1S46A 1UG6A 3PZMA 4KMQA 5GNZA 5AC4A 1QHOA 2D0HA 1TR1A 4UQBA 3WDHA 4AEEA 1D3CA 5A2CA 4XX6A 1HKKA 5I3DA 1KR0A 4ATDA 4AWEA 3UR8A 3WUEA 1BQCA 2ZUTA 2CITA 4XB3A 4S3KA 4GZEA 2EJ1A 1W1TA 4ACZB 3BC9A 5JBEA 1V3IA 3LRKA 5C71A 3N11A 4PMZA 4Y7EA 1PZ2A 1J01A 1BYCA 3WDPP 2BHUA 1W2VA 1J0HA 1BGAA 1H2JA 2OSXA 1BG9A 4UOQA 1X6NA 2WMIA 4UFMA 1CXLA 4HZ6A 5A8MA 2WC3A 3BVWA 3ARSA 1E3XA 1ZB5A 4H04A 5M03A 1UH3A 3OIHA 4QP0A 2XSAA 1WZMA 5JIWA 4UQAA 2YDSA 1OB0A 3KL3A 1R7AA 1KXHA 2DIJA 3A4AA 3KEHA 4TVDA 1TQUA 3EMCA 2CIPA 1CPUA 1LF1A 3VMPA 2VRKA 4W89A 1B31A 3QGVA 2A3AA 4AXNA 1K9FA 4M82A 1F4AA 2WWDA 3MV11 4HMEA 3HU7A 2DT0A 3GH5A 3VNZA 2X2YA 2QF8A 3TTOA 4HU0A 4CD8A 3D4ZA 3CZLA 2OSYA 4WLCA 2WSKA 2EAEA 2CBIA 4W87A 4MDPA 3AXIA 3W27A 2XFYA 4AD5A 4PCSA 3AHYA 1QNRA 4WKAA 2W62A 2UY2A 2F7QA 2WAGA 2YL5A 4CCCA 1YHTA 1XSJA 3OLEA 2JEQA 1D7FA 1NQ6A 2J62A 2J75A 1NP0A 1GUVA 5D9OA 4WJXA 4H8VA 3THDA 1FH7A 3ZM8A 3DYPA 4YHEA 3AZRA 3PZVA 2YBUA 2XVLA 1U33A 2QMJA 2CCRA 4V27A 4M81A 4J3TA 3AXXA 1EGZA 3AS2A 4JHZA 1B3VA 4UNIA 4QFUA 1LL6A 3MV01 3WDJA 4MTVA 2VRJA 1H3GA 3DX0A 4AD1A 5A6MA 4BQ5A 3WF4A 1H0IA 1GONA 3TTQA 2DT1A 1UA7A 3B9EA 3OLDA 1E6PA 4NRRA 3DYMA 3VUPA 5BROA 2QV4A 1GOMA 1EHAA 2PWHA 2DSKA 3W28A 5JUVA 3BAXA 4HOXA 4AZ6A 1OGBA 1JZ5A 4IISA 4F79A 2PC8A 3PHAA 3KE0A 3BLBA 2O9OA 2XUCA 1D2KA 4DUWA 2GJRA 2FH8A 1N82A 2J8GA 1ZS2A 3SCWA 5CPSA 3GTNA 1ISWA 3CZNA 2CBJA 3T0BA 2XJ7A 4J3VA 1KFWA 3A5VA 5EBAA 1OSEA 1QHPA 3I3DA 1E6QM 3N17A 3CUJA 4MAVA 1TQTA 2EPNA 3ARYA 3UG3A 1HN1A 2ALWA 1Z32X 2GVYA 2D24A 2WMGA 3T08A 3WY4A 2V5DA 3FN9A 1V02E 3WBEA 4E8CA 1BPLB 2RGLA 3M07A 3II1A 3VOCA 5A2AA 4PTMA 1E3ZA 1E4LA 1VIWA 5IFTA 1TFVA 3OLGA 3D52A 2VR4A 3WDRA 5A94A 3MSDA 1HKJA 1H09A 4OBSA 3CLWA 2D3NA 3CZ8A 3ZMRA 1JZ7A 2YJQA 3ARPA 2IXVA 4CGTA 5EFFA 4QCFA 4V28A 3AHXA 2D73A 3WF2A 1VBUA 1O7AA 3OZOA 1WNOA 4IPNB 3WQWA 1WDPA 3BLPX 2VZSA 4AYGA 4AD2A 1PIFA 3VIKA 1G01A 3UEQA 3RMEA 4FLSA 1MFUA 2WCSA 4DWSC 4JKLA 4TXEA 1WDRA 3M46A 1CGVA 3L4UA 3SUVA 4P8VA 2J7CA 4JFSA 2X2HA 1H5VA 5E6ZA 4OKDA 3WD1A 1VF8A 1W9UA 3E1F1 3AJ7A 1WZAA 2ZOXA 1XH1A 5ABFA 3AMLA 1W1VA 4PMVA 2XWEA 1CGWA 3UCQA 2NT1A 2PI6A 2DT2A 1E4MM 5A6AA 4P7RA 1NWRA 3AYSA 4PMXA 1V6WA 2GDUA 3L2MA 2A3BA 4GINA 1JXJA 2MANA 3SURA 3VIPA 1HXJA 1TQWA 1B3ZA 2YFOA 2BVYA 4U3AA 7A3HA 3AIBA 4HTYA 4OJYA 2XYLA 4M1RA 2WWCA 3WY2A 1GQLA 4AY1A 1TVNA 4M8UA 1V0MA 5CSYA 2E3ZA 1VAHA 5JBFA 1B3WA 4RE3A 1R33A 1W9PA 3SCRA 4CCEA 4D1JA 2D3LA 4UFJA 3AZTA 4J27A 3BVVA 2J47A 3CIVA 3EJTA 1EQPA 4AW7A 1GHSA 4BS0A 4IPLA 4AD4A 4CD4A 1CIUA 4A3HA 4P7NA 2ZXAA 4PTWA 3RPMA 4PEEA 2OSWA 4UFIA 1CXFA 1NWTA 4UQ9A 4AIOA 1AQHA 4GQRA 4QLLA 2QPUA 1OT2A 1UR1A 3CHFA 3BH4A 2A3CA 1QI2A 3EJPA 2IGTA 2CETA 3WMBA 4KH2A 1VJSA 1W9VA 3WEMA 2EADA 4NZCA 4CUCA
chains in the Genus database with same CATH superfamily
2I7OA 2NY2C 3RZCC 4KUZL 1XLBA 1JGUH 2KPWA 4Y4KD 2D3VA 5FO9A 2X1XR 3SOTA 4WJEA 3FIGA 1XCQA 2W81C 3IJ9A 1OP5K 1O5DT 4XBPA 1TNNA 3GLAA 3SIMA 4GSXA 1N8WA 5T5FL 3E0VA 2H26B 4UTIA 3C5ZC 3V4PL 4Z2GA 2VFGA 4U6VL 3G77A 2J71A 1QFWI 4QHUA 1LTDA 2JLLA 4QDWA 1OGTB 2BIOA 5HYJA 1SO5A 1E4KC 4ZO6A 2ZD0A 2EABA 4W9KC 4GIAA 3UTTE 1NANI 3K81A 1TDQA 3PAYA 7FABH 4TRPL 2NQDA 5FHAL 5IMOA 3DV6A 3C5JB 2PO6D 4KI5C 3QTGA 2EUWA 2W9DL 5CCHE 2ZCLL 3DROA 2C13A 2FUQA 2VW6A 2D2JA 3KCWA 1REQB 2ZSVB 6XIAA 4X80L 2IH1B 2NW0A 3QZMA 1ICPA 2SFPA 5MERB 2AXWA 1KD0A 2YGVA 3QW3A 4D3CH 3EOAB 4XZWA 4YVVA 2AKRB 3ZE1B 3VFSA 8FABB 2J8UA 3L0GA 5EU5A 3FTZA 3SOBH 2VLME 1FQ0A 4LCYA 4UCGA 5D7JB 2W60B 1KB5H 1A50A 1UOZA 2B20A 5F89B 3GH7A 3LKPB 3IJLA 2FO4B 4X4KA 1PCKA 4RNIA 1AAJA 1KYOK 3ITGA 3WS6C 3UC0L 1ZIAA 1NUGA 2QADC 3SB0A 2ZPKL 3S37H 4ONGH 5ENWA 5A6TC 4LVHB 5FW6A 1CT8A 5C0IA 3TYDA 1E6RA 1RK1A 3UD6A 2WNKA 5TQ0L 4JZNB 4XMTA 5HI4D 2Q3RA 2XQ0A 2W88A 3ENEA 3DH7A 3RHGA 1WFMA 1A6ZA 4JRXE 3GFYA 4FEMA 2CUHA 4LP4A 3CSYA 2OCZA 4YGVA 1PKQA 3TV8A 2HVBA 1F13A 3LKNB 4GYPA 3PYCA 4HPNA 3ZDXF 4LC8A 5GS0C 1UC5A 4R97B 4WEEA 2NNAB 4PJAF 5G4MA 5A6KA 3KXFE 4IF2A 3SYCA 3POCA 1JN6A 3FH5A 1PD6A 3AU1B 1B3XA 2NPLX 5E0FA 5J11B 1ZVNA 1VRXA 3P11L 3MLPA 1Z3GH 4W93A 5KTLA 3RY6C 2CDFB 5L7XH 4WDIB 4V1DB 1GY1A 3CGTA 4QRUB 1JPIA 4I13B 4C83A 1X7QA 3B3BA 2Z28A 1FVCB 1XUUA 3D3VD 4DGWC 1MWOA 1MCHA 4W1TA 3GJFK 3QT2A 1RJZB 4S2SB 5DR5H 5IHHA 3LM3A 5BXSA 1P84K 2W0KA 3TN4A 1MHEB 3LN9A 2A1YA 5T8IA 2QTEA 2P44B 3TVMA 3Q37A 3CVHA 2PZNA 4NO3A 3NRQA 4MNQA 2BMBA 3KM8A 5ANHA 4PMJA 4ODSH 1RUKH 2QS8A 1IGTA 4BK5C 1ILSA 2W1NA 3DYOA 4FPSA 4S0HA 5L8LB 3CX5K 3MA9H 4HUMB 3JVGC 4DP8X 4UTBA 1PTGA 3QW4B 3IWVA 3GSRB 4K8RD 4NJAH 2AJSL 3PBVA 4WU5A 3FTVA 2F8OA 1K77A 5HGDB 1XR8B 2DLGA 3DOSB 1ZT7B 5CN1A 1U8KB 3S35H 2DWEB 4QWWC 3JW7A 4JJ5A 5E08L 1TPVA 4BZ2A 2IDFA 1ODAA 5AZUA 4AUJA 1QI3A 1VPOH 1IJNA 1A47A 4QRPB 4QHMB 2VEGA 4KJWC 3AHTA 4TX6A 1B9ZA 5CCJA 1GZQB 4LSSL 5FK9B 1A6UL 4GRLB 4QPEA 1FY6A 1LT7A 8A3HA 4GO8A 5HHMB 2BLFA 3BANA 1BFNA 3CFEB 2ZWSA 2PYFA 4ZUWA 1GGCH 1WHOA 3ES7A 3UZ5A 3FSVA 3ETBF 3S2MA 2YPIA 1G7MA 4GXWA 1EJSC 2X88A 3LEYH 2W66A 2A6IB 5AUMB 5AAWC 3T78A 1F6LL 1L6XA 2ZQKA 2AXFA 3GKFA 2X4TB 5KG9B 4QEEA 4W5UA 4CGUB 2F54D 2E6PA 1BQRA 4H8WL 2O7QA 3VRLE 1EJ6A 1SBSH 2E4FA 1TNMA 5K9DA 3L67A 2VXSL 3M17A 5AL8A 4YL4A 5ADPH 4BKNA 1I1YA 5HVHC 1GHFL 1PTZA 2H6PA 4I0KA 4YZWA 1IBGH 1EFXA 1N8ZB 4YBQD 2MFNA 3OZPA 1QAWA 1FWJC 4AZCB 1YEDB 2FB4L 1R87A 1DHPA 4FALA 1OARL 4WUKH 1HKFA 1J1PH 2FMNA 4IGSA 4JPSA 4EUPG 2Y3NA 2QZ5A 4TF4A 1IWBA 4A3UA 4F3HA 2OXHA 1E9PB 4ZW7A 4QXUH 3V6BR 4DUXA 5HYIA 2X6BA 3SQBA 2X1WL 3KPNA 3O6MH 3HN5A 4NQDB 3HAEB 3R94A 4NRZA 1FC2D 2PR4L 4F7MA 1I6NA 5C70A 2VXUH 3CHXA 3RUGF 3FN0L 1E27A 4MNMA 4HIEB 1XYLA 1B4JH 4OCYL 3FMGH 5B8CB 2ODOA 4AQ1A 1XH3B 3WE6B 4D0CB 4UF7C 1OFQA 1T1XB 4Z76B 1ODUA 1ZDSA 3WUFA 5B21A 2NTFB 3CFTA 1RIVL 4PW4A 1CICA 3WIIH 2ZOWA 3IDNA 1UP3A 1DLHB 1RVGA 3L1FA 4C6JA 1FL6A 4LL9A 5EMMA 4NRSA 4JHWL 4AEFA 2FX7L 2G3MA 3NEXA 2Z92A 3RX5A 1EXBA 1EEPA 5JW4N 1J0IA 4XXWC 1YQVH 3W1XA 3GM0A 1LD9A 1FZKB 1OAYL 2BNRE 2EACA 2Z91B 4MHHG 1G7JA 4UCFA 3THQA 1D6EB 5GS0H 5BXPA 1S9WA 5IJBC 3QRGL 4G9PA 4IX0A 4LLDA 4WO4A 1JSYA 1W6TA 1MSSA 4F0MA 3DVGB 4PR4A 4LUYA 4NFDA 3IGHX 3MX0B 1XLJA 3LMYA 3P73A 1DVJA 1J8HE 1C9SA 1BYAA 3FS9A 2DAVA 2F5BH 1NAKL 2JJSA 1MCNA 1QABA 1CLCA 3NPZB 3QUGA 6FABL 1SN2A 3I4EA 1UZGA 2J3SA 2XTJC 4H6QA 5BOZG 1VB9A 3X3GH 3GU1A 1EYWA 3LN5A 3HQOA 3BMVA 2H32A 5TDOA 1Q2RA 2CAKA 1R2TA 4W7VA 1K8XA 1AJZA 3WKYA 5SWSA 5BZDB 4AY0A 8XIAA 3N2BA 1DWFM 2P46B 3OX8A 4ZNEA 4FLHA 3IMRA 3FHQA 3MO1A 2HG5B 2E77A 4GRMB 3ZQWA 3WH8A 1E65A 3GLDA 3EH3B 2Z31B 3TYGL 3B7UX 1E43A 1WA0X 2EO9A 1NWSA 1BBDH 1IQWL 2YUXA 4RMUA 1Y0LB 3KYKH 4BWTA 4KBXA 2CO7B 1RJLA 4CU6A 2BRRH 1FGNH 1DUZA 1KLUB 1R46A 3E8UL 3QIWB 1ZA3B 3OZLA 3UTTD 1W72B 3T0CA 3AADB 2DJ4A 1V7ML 4HEME 3CQKA 1ET5A 3QPYA 5FOBA 4WVRA 4C58B 3CEUA 3L6FB 5EA0L 1YPZE 2Q6WA 3OKYA 3WX7A 2E68A 4KEMA 3QDMB 5C9JA 3TASA 3CFNA 1CECA 1NCNA 2Y2TA 2F7RA 1KUMA 3FRUB 4J3OD 5J56B 3P9LB 5AAMC 4R96A 1TCRB 2ED6A 3VABA 1RUMH 3VDCA 3H3PH 4NNCA 1EOMA 5D72H 3PP4L 1IIHA 1MW1A 1V05A 3A24A 3BQVA 1SJHA 1J05A 3UROR 2VLMD 2YLKA 3W7GA 4WU7A 5B7EA 2FIKA 1WXZA 4K37A 4MHBA 4PSPA 4R34A 1VS1A 3P0VH 4G7EA 4HHHA 2MUCA 1IX2A 1T20A 5I0DA 1NBQA 5SWZE 2QDGA 4QXVA 5C0CA 2BHZA 4LPCA 4IJ3C 4NZDA 3TBWB 2FX8H 4P4RA 4OCWH 4H9VA 4NOBA 3PL6D 1MI5E 1XV8A 1JIBA 1LO4H 2AK1L 4OE7A 3KW3A 3MLWH 3RDTB 1UP2A 5IK3B 4FZIA 4JRXD 3NK3A 4EXBA 4LUJA 2EINB 4AUUA 3M5ZA 3JYCA 1GRWA 2QXWA 4CSSA 3FGCB 1S5IL 5IJVB 4BCEA 4JANB 4MMZA 3ROLA 1SO3A 2Y07H 4FF9A 3QXTA 4ELMF 3P62A 2DD8H 1T6WA 5CQ1A 2WC4A 15C8L 1A5FL 1EO5A 4PRPA 3TFXA 3TA6A 1TUXA 3PWAA 4AFYA 4EDXA 5D7LA 3S4SB 4ZQKA 4WTQA 4C8XA 5D8ZA 3AITA 3HG3A 3B9OA 4LCCA 3CV5A 4LB3A 1BM7A 5DZJA 3QEQE 1D3HA 1J2BA 3D85D 5F1KC 3IEBA 4PJ7B 4KEZA 5C86A 1LEIB 2NCEA 4P48A 4FIQA 3IU3B 1DSYA 4NLHA 4NNPH 3MRGA 2H1XA 3EYQD 3VNJA 3BVJA 1Q72L 4LEXH 5ABHA 1XL6A 1T66C 3FU7A 1H61A 1I82A 3H22A 1BF2A 3W2DH 3IGXA 1QPOA 1OAKL 4XNXH 1Q66A 4YXLH 1E15A 1JFQL 2GQ9A 4CSZA 5MI0C 3PZUA 1W0YT 1SPDA 1DQJB 2VX4A 4NFCA 2PMQA 1G7PA 1J9YA 3NFNA 2E28A 1O4UA 5AD0A 3MXWL 2AEOA 1UUOA 3MQIA 5D9MA 3G1VA 3R58A 2QJHA 1ZE3H 3KPLA 3ILQD 1ZCCA 4V1XA 4PU2A 4NZTL 3G5VB 4CSPA 4R7NB 3OKKA 1QFHA 3V6FA 3G0UA 4XZHA 1G6RA 2WYIA 3Q01A 4D6FA 2H90A 3ZDZE 4XWGH 4PULA 1AGDB 3AXKA 4HJJH 3UA3A 3QY6A 4CMHB 2Y3AA 4GW5B 3T04D 2XFXA 4D8PA 2EECA 4WUUE 3QPQC 1TKWA 1XSIA 1OTSD 3LRSB 2MNUA 3II2A 2IAAC 1EERB 4GMSH 3CFIC 4DKTA 4OQTH 4WX2A 3GSWA 1XR9A 1N68A 2V9QA 4H8UA 1W5OA 3WN5C 2X5PA 4LOVA 5C0RL 4ODVL 4YVPA 1EA0A 3E9AA 4Y4FA 4YXHH 3NJ3A 2YPVH 1KTRL 1URLA 1FWRA 3C9NB 2C91A 3CV6A 4WNJA 2X4QA 3WQ6A 3HNSH 3RU6A 2YSSA 4L8BB 1QLEB 5DHVA 4PJGA 3SRKA 4RV8A 4PJBA 1HQRB 4QCEA 1KBWA 1OANA 1BGXH 5AOJA 4XNQA 2XG5A 1K5NA 1OX5A 1A3XA 4UTCA 5EO9A 4UBPC 43C9A 4RDQF 2ZZ2A 2IPWA 5ISZE 2E59A 2J7EA 2BDNL 2DI7A 1UM6H 3BUYB 5GGTH 1TQVA 2YDQA 1BAFL 2VWEE 1BQHG 4GRWE 5D1ZD 5FJJA 3LRLA 5KVEE 3FB8A 4AWSA 3OXSA 5E8NA 3FQWB 1KCRL 4KMQA 1F1AA 1I7ZB 5DC2A 2YCLB 5T3ZD 4DEWA 1I8LC 2D2HA 5AHFA 2IH3B 4MZYA 4FTDA 4UUIA 3WQOA 4I5BA 5J1AB 3EX3A 1J01A 3LAFA 2QDHA 3NJVA 1ROCA 1QO3A 4UOQA 1TMLA 4TVPE 4YTRA 1R3JB 1HWGB 3LNFA 5K5YA 5H91A 2WC3A 3VG0L 1AC0A 5B1BB 2VC2B 2FR4A 1RZ7L 1KA9F 4TQEL 1NCHA 2FNWA 1TQUA 5DRXA 3EMCA 4DLFA 2WJ7A 4J1UA 5H6HA 4EE2A 3NURA 3DUSB 3MV11 2R29H 2VXVH 2BNRD 4F2EA 1MY5A 4FHJA 4O14A 5INCB 2BZ7A 2V5MA 1WCBB 4AD5A 3LKSA 1XLDA 4MA1B 1QMLA 4S3BA 2CNZA 5I1JH 3EX1A 1U91B 4JY4A 4HVXA 4FQJL 5IROA 3QLDA 3V4UH 3ZM8A 2I27N 4YHEA 3AZRA 3NQKA 4RBPH 4JFQB 4DQOH 5FM5M 1B4EA 1AJ7H 4W9HC 3WBYA 3FVMA 1WIUA 3LD5A 2VRJA 1H3GA 3DX0A 2XPZA 2OL3A 4KTDL 3WF4A 3HE6D 1QBML 1J8HD 3TA3C 3WUWA 4KPHH 3VUPA 4H0GA 1EHAA 2HPMA 4KK8C 2VL5A 5F7AA 2VKWA 3K2IA 1P4BL 1Q5MA 4S39A 1XEDA 3R7RA 2VDQH 2GBUA 2NUPB 3KE0A 3PS6A 5DLMH 5I5IA 4OGAC 4W9JC 2QQNH 3VDGA 2ZKMX 4WFGD 3CSFA 5D8JH 4U1SB 3N17A 1KYFA 4MMYA 2VDKH 1QD0A 3W87A 4HKXA 2G30A 3D0LB 1FZJB 2BSBA 3FZUC 3GDCA 4BR1A 5KSAD 5KVGE 5I19L 1INDL 1U42A 1NA8A 3ZMRA 1E8XA 4FA3A 2Z1PA 2IXVA 5JMUA 2P5NA 4PJFA 3Q2CA 1KGIA 1TCDA 4GG8B 2R9HD 2APVA 4JCWA 1WWWX 4NO0A 3CXHK 1LNUB 4DZAA 1HGYA 4AD2A 1G9ML 2PDXA 3EWWA 5EF2A 2ZUQC 1WDRA 1CGVA 5C97A 3SUVA 3VKCA 2PD5A 3DBXB 2I07B 3DGGA 3WIHL 3PWNA 5I15L 3PWVA 5E4OA 4PG2C 1CLYH 2XWEA 3EW3B 1UFGA 3U7WL 1CGWA 1YEKH 2NT1A 4ZBCA 3T6VA 2GABA 1Q6LA 5DJAB 1F42A 4E4FA 2G0KA 3GMRA 3LCIA 1HXJA 1F4WH 3KD4A 5HI3D 1VCVA 4U3AA 2GUOB 3H12A 2CCVA 2HVOA 4PJCB 4JQ2A 2F19L 3P0YH 2PXYB 2J6XA 1NAML 3V5CA 2WLLB 2GITB 3G0XA 2RCSL 3WO4B 3KTCA 4Z8FH 3U79A 4Y88A 3NESA 4ONVA 1JGLL 2D7NA 4R6UA 2WINB 4BWUA 1CIUA 4G7FA 4LDOB 2R1XA 4YHNB 1GT8A 5IQ7H 3NP3A 3T6XA 1AQHA 1LVEA 4P5MA 1QSFB 4PJXF 5E6IB 3BH4A 5DLLA 2R9RA 5EUKA 2VXQL 1KN2L 4IRJA 3TBCA 5D7IA 1HILB 2R1WA 1TKKA 2ICWA 4GJIA 4FJZA 2CBPA 2H9AB 2F61A 5SWZD 5EIQA 1P6WA 3WQVA 4B7LA 2XTLA 1OD9A 3DX6B 4A7TA 4V2XA 1W37A 3ZSTA 3RNQA 2GSGB 1QO2A 2RDTA 1YN6A 4Z7QE 1MI5D 4M1BA 1FSKC 4KFPA 1NWPA 2VH5H 3RKPA 3K71A 3MYPA 1R3HA 5AVTB 1P7KA 5DSCA 4IQDA 3W23A 4UI2A 2J7HA 1I7TB 3N9RA 1EVUA 3PZNA 1AZCA 3F1QA 3UTSE 3QZWB 5D2WA 3WDQA 2VLRB 2PF8A 5FF6B 3IN2A 4NJKA 2YCEA 1I1RA 2DQIL 3PFRA 2JQMA 3GBDA 2ZUMA 4D72A 5ESVB 2GC4C 4HV8A 4PGJA 3M0HA 1D7BA 2Z2UA 4I48B 4XUGA 1BOGA 3QEUB 2OT0A 4JQVA 1OCWL 5AYUH 2QR6A 4PJ5B 1UR4A 1G7IB 4FGMA 4LS1A 1I1AC 3MY9A 5MF5A 4F5CE 2CA3A 1BD2B 3BIAX 3CHOA 1QSVA 3EX4A 1GMIA 4PLJD 3UWYA 2VN7A 4Z7NE 4J8RB 5L6YL 1G1KA 1T22A 4XTRC 3HBGA 1VEMA 5BV7B 3D6GA 2GJZB 2BP8B 4ZYKB 4M7LL 4GS7C 3BZ4B 4NN6C 1HKIA 4BQ4A 4O4VA 3QEQD 1JWMA 2DWDA 2PPGA 3OW1A 5FJIA 1QG3A 3NTYA 4XNUH 1JD7A 5T3XD 1J2WA 4K73A 5DZ9A 4TSBH 1UA6H 4GJJA 3R7MA 3DX1A 5D6DA 2QPSA 1C9DA 2F68X 3TTYA 5CSZB 3PWLB 1QI0A 3OAUH 1R2SA 3MRJA 2YX0A 1H62A 5I23A 4JFZH 2DQHL 1KCVL 1JZFA 2H1PL 3ES6B 3G1AA 4AI7A 2WBJB 5LYRA 1DJSA 3DJTA 5I8CA 3LKOA 3SDOA 4NN5C 4E0RB 4X5LA 1FO0H 1QSEA 5C9WA 5T1LA 1HE8A 1R85A 2HE5A 1BX2B 1NBCA 3JSSA 3ISIX 2X7VA 1KV3A 4PJIF 2OLAA 2KYIA 1FDLL 4RCAA 5JO5B 2Y70A 3RFAA 2VZTA 2Z8SA 3QUZD 4YE4H 1CDJA 5FEZA 3PAUA 3BWUF 3W25A 4HZ8A 1KPUA 5I17B 2MOVA 1GVSA 3F4CA 4Q7NA 5DZOA 3ELFA 3VFUA 4NNXA 4AQ8C 1H8LA 1NC2B 3TF7C 2IDTA 5IJDC 2O5ZH 1UM4H 3QHFL 4QOKE 2XFWA 4WUUD 1OZQA 3LNEA 4MLIA 4O4YH 2EH8L 1H8SA 4YHIB 3TIEB 2YB1A 4ZQOA 1CF8L 4DJEC 3A6OA 2XQYG 3OVRA 4X6CB 2R7EA 2IAMA 4XPTH 2Z7KA 3IKKA 2IFGA 1IBDA 2QR0B 1ZANL 5F6IB 3U4EA 2VUOA 1BV8A 2C0AA 4ZUSA 2VQ1A 5EEWA 3CAQA 3A9BA 4MB3A 2EKCA 3OHXC 4HU4A 3FXIC 3NL3A 1JDDA 1KWKA 3M0YA 4F57L 1X97A 2YAQA 5BS0A 4P9MH 3QQ9D 4HSAC 3A13A 2VDOB 3T8QA 5EU4A 4MA7L 4NBZB 1BFSA 2IGFL 4JFUA 3V4BA 3EA3A 1GGIL 1P6AB 2RDWA 5CCKH 4IKKA 4LX4A 1RJCA 2X9WA 2F2KA 1PYWB 4WJ5A 4H9TA 1AHMA 4B5ZA 2YK1H 1DVFA 1AI1H 3HV8A 5BOEA 1LO0H 2ICEC 2JCWA 5FDYA 2WBGA 4NSKA 5EZIH 4L0ZA 2A74B 1CD1B 1YJDL 4OKVB 4KT2A 2V5YA 1TQBC 2E9LA 3W11C 1BVZA 1M7UA 5CPOA 3QNYA 2YOCA 2IG2H 2ZCHL 5A16B 4L61A 3RLGA 2GKIA 4Q9QL 4YN5A 1VFBB 1D9KA 2RFXB 4Y4HD 3KBJA 5ABEA 4EBQL 1HZKA 1KBGL 4BEIA 5ANME 1H60A 2WAHA 3B9KB 3VG9B 5LUMA 3N5AA 1MAKA 1N2VA 5IREA 1XMEB 3D1MC 3W2MA 4K7PL 5KVFL 5E8EA 4XKYA 4TVPD 3MUZ1 1R2RA 3SDDC 3D69B 2BZDA 3SKOA 2F15A 1G84A 4L1HA 1HT6A 3NA4A 3RCNA 4CQ8A 1KB5A 5CMAB 4Z2JA 1S9YA 4ZD3L 4LESA 3ZZSA 3KWWB 1GVQA 4G8FB 5T1MA 3WD5H 3D51A 3T4AB 4KXBA 3WY1A 4EQ2A 3EHBB 4OM0H 1E6OL 3QC3A 4IJRA 3O05A 4NQEB 4JY8A 4NF7A 1XM3A 2QUMA 1XDTT 4YBLC 4O51A 1GOWA 3VKJA 4XN7A 1KXQE 3S96A 4QM1A 4NO2B 2QPFA 4L8CA 2W3ZA 4F9PA 1KIPB 3J2PA 3EIFA 1VBRA 1BQKA 4JPWH 4MDJA 1NDYA 5I1KH 4IRZA 2YL9A 4CKVX 3NAAH 4DBWA 3HI1A 3GHUA 1YYLL 2ICWI 4G9DA 3ZLFA 1DQQB 5G2WA 5LGYA 5KN5A 2V9RA 4HS3A 4Z7AA 5IFJA 1JPTL 4XE0A 5A2KH 1G1OA 2A9NH 1KV7A 2QEJA 4PHXA 4MS8C 1I4FB 4N1CA 4BUHA 4AVJA 1DQMH 1YNTA 3H9HA 1UIOA 1PKOA 1X5KA 4LVOB 1S7RA 2Z1XA 1YRRA 4TPRL 1TEFA 5GJTL 3GHSA 3EUUA 1D5IL 4Q0XH 3T0WA 2MOQA 4UT7H 1J8RA 4K7FB 3QAZB 2VUNA 4OF5A 5D1QA 2X6MA 4YS4A 4OZHB 1MFEL 4PUBL 1HDMA 2EVGA 4L7ZA 3UVAA 2HYMA 2V33A 1IFHH 1JS4A 1J1OL 4U6YA 5DMKB 5J9PA 2VR5A 3CN1A 3B9DA 3K4WA 3IF1B 4LANA 4H2HA 4BH8A 4K07A 2CKSA 3V4LA 2EUXA 5I5JA 2QHRL 1AK5A 4G8AC 2FGLA 3FFOA 2FWSA 2PDBA 5C1MB 2QVMA 5LG1A 3KLHC 1UD8A 3ZMEA 2PTWA 2WB5A 2CLFA 1XMWA 4MA3B 5MEQB 1UA3A 1YX1A 1JG9A 3O6FA 1V54B 3B83A 4FOMA 2EPHA 5EPMB 3STEA 2CLMA 1B88A 2WJZA 3Q06A 4ZMTA 4Z7OF 2V5RA 5IB2A 4JY6A 1AFVL 2UY6B 4O2CB 2PRMA 4POZD 3U2JA 1Z8AA 2P1FA 3NFUA 1J5SA 2B7PA 2CRYA 4MWAE 1YLBB 4Z3EA 3FDGA 5DCEA 1SJEB 1DANT 1NMAH 4OZFH 1O66A 5XIMA 4LSDA 3DHJA 4JRYB 5K7JA 4W7WA 4QROA 2GY5A 1BLNB 4X8JB 2R1PA 3SCNA 4OM1L 1Z9LA 3BPNB 3ARGD 1A49A 3SE9H 4WW2C 3KPOA 3T3PF 5I02A 2J73A 4F2MB 1X4YA 4GOAA 1ZLVH 2FVKA 1YEGH 1XG3A 3MI6A 1DBAH 1WBXB 3GPSA 1N64H 4MSWB 1FTXA 2XLLA 3ZYOA 1MFBL 1N7MH 3OR6A 1NJJA 3W6LA 2V2CA 1FH5L 5F96L 1CNVA 3ALPA 2V5SA 3REVA 1W91A 4CNIB 3P77B 3SD2A 1X5LA 1EH9A 2K4WA 3VA6A 1FPTH 1FC1A 2FBRA 5INDB 1IEAB 4UT9L 3ZBMA 4RNRB 5K2ZA 1EFZA 2HJFB 4KKAC 4ZB5A 4FYSA 2CLEA 5EPDA 4A6YA 4EOWL 2CMRH 5JYLA 3T42A 5EN3A 5KYYA 2WLYA 4QUOA 1TJGL 4OZFG 1UJ3B 3QDGE 1DQKA 3ATDA 3GG7A 4QJ5B 3KL0A 1NGYA 4I1NB 2Q87A 3AIEA 2CBVA 1EJTC 3QO1A 3L3JB 4MNHA 4ANUA 2F54E 4ZXBD 4NJGA 4YSEA 2DEWX 1TG8A 4IFKB 3TC3A 2W61A 1B2YA 5ILTH 3KJ6H 3P4OA 3OA3A 5PTDA 3BURA 1PL9A 4HK0A 2EC8A 2C7FA 5I9QC 2XZZA 3HFFA 1Q9WB 4LU0A 1J48A 1RLCL 2IIJA 3QQ4B 3CDZA 3MBED 4RDYA 2V82A 4JCMA 3GSNH 1NDMA 3JVFC 3ULSB 4S3DA 1NH6A 4KUCD 4XBGB 4MX7A 4Z08A 3W38A 2BXVA 4WNSA 5J13B 4LLUB 3VW3L 5DXXA 5C0GB 3LERA 3DPDA 4Q6IC 3ABMB 3N06B 3JR2A 4JN7A 4KMLB 2GBVA 1T6MA 3X1BA 2FD6H 1FRGH 4AK2A 2G5BB 4XTDA 4FQ1H 1WDWA 1QLFB 3DXAA 4LLQB 4K9EL 3VGFA 5A69A 3UAJD 4LS2A 4RESB 3QZAA 3K2KA 1B0IA 5BUGA 1A5BA 3GBEA 5IVZA 1U4EA 1NIEA 3BZFA 5B39A 2NZIA 5E5CA 4FNPA 3OG4B 1RPQA 4PGEA 2BINA 5C0BA 1BZ7A 3WDIA 4BWLA 3TMQA 1NF7A 4GUPA 1K7EA 2FGWH 3DETC 4B3ZA 1BECA 2R82A 2UWEB 3IJIA 4N85A 3MA7B 1NPNA 4JHBA 2NX1A 3F4VA 3ZL1A 4LNYA 2EDDA 2J8HA 2NY5L 1XF3A 5BW7A 2PGEA 1R9ZA 2PURA 3IJSA 5CJBA 4OGXL 4QLJA 2Z27A 4URTB 2W0FA 3PUDA 3KPSB 3OGVA 4M1DH 4QOKD 4Y9PA 3HRZA 3VSUA 1L6YA 4BKLA 3FQXA 4LDLB 5MENB 4Y2OB 5EOTA 5IMMB 3HFMH 2NXZB 1R30A 1DL3A 4K68A 4OD3L 3WLKX 1TYRA 1FXQA 4WFEE 1K8YA 3GS7A 1U3YA 2WK2A 1BLIA 1LWHA 1FNSL 5JOEA 4ZTPL 2CH8A 4ORGA 3VUAA 4PTDA 3QTPA 1AXTL 1NQKA 5C9ZA 1M7IB 4QRPE 3FBKA 2V2XA 3CO8A 1VQTA 2X1QA 4F91B 5HHME 4C6DA 3WNNA 3ROOA 1AMKA 1IGIL 4RUBA 3IDXL 4FNUA 5DZAA 3K72A 4PREA 3BL3A 1HL8A 3PJLA 4PV8A 2NLJB 2QHAA 3S1WA 3T0EA 1LEKA 3H2OA 3FA4A 3RAJL 2F7OA 1NCDH 2ZZ6A 4M6QA 2GY7B 4XP5L 4GRSA 3MA8A 5GGQL 2WSDA 1FI8C 3SE6A 3S1VA 2A6LA 1N12A 3MRRB 2EDFA 3PQYA 3QQ3B 2CLIA 3PFMA 4RPQA 5KVDE 2JXMB 3W53A 1EJWC 1JWSB 5EF0A 5C7ZA 4XVTH 3L4TA 4F8XA 2GSIA 3QUYC 1H3PL 4IP4A 4PCFA 1X5HA 1DO5A 1KXTB 4DXKA 3GE7A 1F6KA 4LZKA 3WIAA 4NPKA 3CZSA 1ISYA 4XBSA 5IVOA 3ICJA 4N0FA 4YR6A 1JERA 4RMWA 1O9WA 1HZHH 2ZWNA 1R3LB 1UYWH 4L4TB 1BFOB 4JFVA 4NQDE 4UV4H 2QSVA 3F4NA 2ZWLT 3A23A 3NZ8B 1UUSA 3QUXD 3AICA 2GUYA 2KZKA 4P4KB 4E9VA 1N55A 1TITA 3LDVA 3U0HA 4X7SH 2AJXL 3K6OA 5PAZA 1BFVH 1ZK5A 5LGHH 2X6VA 1VYSX 5I09A 2KLSA 4LLYB 3S88H 4WFFE 1ZV2A 2FGZA 3K8MA 1IJ9A 3A3YB 3D2UB 1S2EA 3E3QE 1WFJA 4PTVA 2CO4A 4R3SB 3CLFH 1DFXA 4NX0A 5CIPB 3K5XA 2E6YA 3OBAA 3SGUA 2GGHA 4N0CD 5HHVL 1R3TA 4ORZC 4HF5H 4WI6A 4ZW6A 2UXVA 3MBWA 1OSYA 2CNYA 2P0IA 2BWQA 3ME0A 3CC1A 3H4WA 5DMIH 1PZBA 1CXIA 3T6CA 4HXAH 3CSTA 2WXJA 1ASPA 2VGIA 2L8AA 3MUGB 1IC5L 1PG7L 2JFEX 4KJYA 1HKMA 3L5XL 1FFNA 1KLGA 4HHMA 1S46A 2RQEA 4X2PA 3DOPA 1DJYA 4QXGH 3U9IA 4ZSOA 5A2CA 1T0MA 4PAZA 4NUWA 1JCMP 1RUPL 2NQ5A 4S1RH 1ETA1 3PHOB 2VZ3A 3MBXH 2EJ1A 4FHKA 1I3UA 3C6LC 2R2BA 3EG9A 5JQ6H 3BLLA 5EEYA 3L13A 3KBMA 1TRIA 2X3AA 2J8UF 4WDUA 3W2NA 2PPEA 4G2AA 4KCWA 4JO3H 2FJSA 4NS0A 4ELDA 2HXTA 1G4EA 3EF4A 3AUWB 4UQAA 5B1KA 3D18B 3KL3A 1IBHA 4N6RB 2P8LA 5G4NA 3IUHA 1INEL 4K9JA 4UB0L 3KEHA 2NXYB 1E4XI 2CIPA 1CPUA 4XAWL 2DEYX 5I2IB 2VRKA 2GIXA 5H2BA 2VDPL 3MKGA 5D2TA 1UP0A 2X2YA 1G0YR 3G5YB 4PQXA 4Y9GA 4O12A 1X5AA 4APQA 2L5HA 1KB9J 3SBRA 2B9BA 4WKAA 3NCJL 4UIKH 3BO8A 5FEWA 2GQ3A 5DUPL 2LU7A 4ZQMA 2YBUA 2WXFA 1I1FB 5BPPA 3DFQA 4YFDB 2OTDA 2NY4C 4MWAD 4HWBH 3T8MA 3L3HB 1NFBA 5E5UB 1LMIA 4NB7A 4I2XB 1ANUA 3P61A 2DSKA 3O0RH 3KP0A 3VZZA 4LCIL 5L2KA 3NQ7A 4IISA 2CU9A 2PC8A 4DBDA 3BYTA 4JFEB 2WZ0A 2PO6C 3ZMNA 4XCCH 3J27A 4MAVA 4PI0A 4B92A 3WBEA 1A6WH 1OP4A 2G5RA 3NJGA 1DQIA 3MDJA 4AJWA 4PTMA 1KENH 4BHUA 3EGXA 1RUQH 2YPVA 1ORQA 4MA8L 3QDME 1FG9C 3RO6A 1XI3A 3X1GA 3IJHB 2ZZ5A 2EIEA 3PHQA 3S5LB 4EUPH 3WF2A 1PJWA 5FW7A 3OZOA 3BLPX 1Z5LB 1ADQL 1PIFA 4PA8A 3L5MA 1YXCA 1A8JH 4LPXA 4XH2A 3FO2A 1MHHA 3UBXB 3QDGD 4G1MB 3ENLA 3E1F1 2FWOB 1XH1A 3P3YA 4YHLH 3RU8H 1TEYA 4QY8B 3GJEB 3UCQA 2DKUA 2X70B 1E5YA 4AM0A 5F70A 5GGTA 3AYSA 2CLZB 5AAMA 3WHXA 4MCYA 3VIPA 4GBXB 5EOCH 5HI4C 4OTKA 4MXQC 4G5ZL 5AVVB 3K1KC 1T7LA 3VRJA 3GF8A 3VFTA 3DJZA 3FB7A 2DORA 3U4FA 2XETA 3IS1X 1ZP3A 5L9DH 4JO8A 1V0MA 5BXFB 1TZIA 3FCUB 5IM7A 1QRNA 3QUKA 5LVEA 1MRCH 4MJZA 2FJHA 4INFA 4MFHA 4BS0A 3QORA 3F4WA 3PPHA 2R69H 3HUJB 1EGMA 4NZ4A 1R3WA 3TQVA 2PDWA 3RCMA 4EIUA 4GK8A 5D32A 1CCZA 2A2QT 4IIZA 3BKCL 4BFFA 3ARBC 3L2NA 4L2LA 3LCGA 4NFBA 5FGSA 4P8QA 1OP3H 1Q94A 3TH4T 3DHUA 4PMUA 2VWTA 3ARZA 3LB6C 4DGYH 1GW1A 2XWTB 4G9FB 5T3ZE 5C07A 2R29A 3CQHA 4ZFOA 2J6EA 1JGVL 3HV9A 3G3MA 4N0UA 3C3NA 4MPQA 3ARTA 3VX0A 3NVTA 3UEZA 1ILUA 1WYIA 3EDDA 1TZAA 3R1GL 4UTWC 1YADA 4YZFF 3H7UA 1EO8L 4AMKH 4PUNA 2A7NA 1SMDA 4DWSA 4NQCA 4GY0A 2BK8A 4LVNC 4ICWA 4O1CA 4KWSA 4YHYC 1X7TA 4WEMB 2BVEA 3IETB 2PODA 4EE9A 2YUZA 1JNHB 1PZCA 1B0RB 3C52A 4HCIA 4L4VB 1KM5A 3QNZB 3HPJB 2JKXA 4DJDC 5DDHA 2NSXA 4U1HB 5MEPA 4A67A 2VMFA 2X9XA 3TYUA 1T0PB 4S3CA 4XVDA 5DUML 3LQZB 1UHVA 5TE7H 3KS0H 3QJXA 4NC2B 3NZHL 1NFIB 5DU7A 1KACB 1PS3A 3UBFA 1HCVA 5DEGA 4ZI8A 4WFED 3CDGB 7CGTA 4ZTOL 3BP7B 4PS7A 1EAJA 1YAIA 5CFAA 3GWQA 2R2HA 4OLVH 4NIRA 1WA3A 4L8SC 2JB6B 3IVTA 1KFAL 5FO7A 4QRPD 1IT7A 1I4NA 5K9OA 3MO7A 1UOLA 1K4DB 1WKYA 3EO0A 4GRLD 4H40A 3RRQA 3WEZA 5HHMD 4PVBA 2Q3XA 4Q74A 3U7YL 4KWVA 5E8DL 3POHA 3VXSA 2W91A 4K5OA 1IXNA 4M7ZB 4H9UA 3ECBA 4WFGE 3WLMA 2FAUA 4CBPA 2FQDA 4ADSA 2P8BA 1NELA 3C8HA 4GWEA 1GVEA 1U3ZA 4HEPG 2G9HA 5J0BA 4XT1C 3KBPA 4A66A 4EN3D 1NCCH 2WNXA 4KKNA 2E47A 4FFZA 4YBQC 3LKQB 4I3SL 1IGSA 1JGIA 5FYJL 1NLDH 4IIEA 3TBSB 3KPTA 3QYCA 5HI5D 4Q6KA 3NGBC 3LNPA 2EHHA 2X4NB 4XCEB 2Q7YB 2BSSA 5HGAA 4F8NA 4J6RH 5GS1C 1BZ9B 2OR8A 1CDYA 3WN5A 1X7FA 3U7BA 1TPH1 4IGBA 3EYOB 5D05A 2UY7B 2FDMA 5GZND 2VISB 2ONEA 5LIKX 3NSNA 4C6IA 4V2CB 4KNTA 4P7LA 1PBYA 3WF1A 5EBMB 4NQDD 4YLCA 3FONA 4KFZC 4M0XA 3GB7B 1CTOA 3OJ2C 3VGHA 3R13A 4P3DA 4LCWA 2AS5M 1UWFA 1VGKB 3O2DH 4I7VA 3IFOA 1W1B1 5AVRB 5JXED 1VGAA 1ZLEA 3OMAB 5FIEA 5TE4H 4ZODA 3QCTH 2APTA 3D8MA 5I6SA 4WFFD 3MMEA 1S3TC 4Q9BA 1ZAJA 4PVNA 4PRHA 3O4LB 3MLTB 4L3EB 4AYFA 1KC5H 3IRZA 2VM3A 1OY0A 4Y7MA 4GXFA 3SCVA 2QCDA 1JZEA 3HO8A 1MIML 4XPHH 5AWNH 5F7YC 1IM9B 1U8NB 4NQVB 1F2QA 4ZT1A 5TFSH 3MP4A 3SKMB 3G5XA 5BU6A 3WFCH 1I8LA 4ZS7L 5I71C 2OQJA 5HUPA 1LJYA 4H7CA 4AGQA 3LS5L 4QHLA 4L0PB 3IK4A 4FQPA 4O0KA 1K2DB 5A8GA 2H3BA 1UWYA 1JUBA 4Z2KA 3ALGA 3VC5A 3CXFA 1HNYA 5DT1L 3IUDA 4QYOB 4ZUVA 1EEYA 3Q1SH 5FOJA 4I77H 4HPGA 4IUOA 3ARDD 4LCUB 1O7DE 3QFDB 3USBA 1IE5A 2JKPA 2EBNA 3BAEL 3FFSA 2WXHA 3FUMA 1XF0A 3A4JA 2AJYL 3VH8G 1F8TH 1BM3L 5HR6A 4QF1A 4IPPA 3V4VB 1JZ6A 4NP9A 2C15A 3VD3A 3W81A 2VDNL 2OFJA 2WLZA 3JV6A 1EKOA 2IPTH 5ITBH 2JIWA 3VKDA 5B80A 1FO0A 1JPGA 3VWJA 3CIWA 4OLUH 5SX4H 4X83A 1AOHA 1BQSA 1XB3A 4QTIH 4YPGB 3W9EB 4W9LC 3X14B 4MKVA 2ZP9A 4PJ9B 3MUXA 5ADOH 3LRHA 4LARL 3BAIA 3O45A 1ZT4A 3RPBA 3VRIA 4ZFMA 1UR2A 2R24A 4HWNA 3IGUA 4I8DA 1EHNA 1N3NA 3CAFA 2YUVA 5T3XE 4J40A 5DEZA 5C8JB 3NPWA 3S83A 4JDZB 5CEZL 3VIGA 3FUFA 1KM4A 3I2CL 1GQJA 1SLXA 1MJJB 3BW3A 1TSRA 3VXMB 4FG0A 5ID0A 2OZ4L 4TMPA 3EB2A 2EPLX 1EHXA 3LVTA 2W79A 4HA1A 3N73A 1HFUA 2NXHA 1YTDA 4X7EC 4PJCE 1CTNA 4XN1A 1HU8A 1EEUA 4Q4IA 3BD3A 4J3OC 3EWZA 2F5AH 3L9EA 5HY9A 3UWVA 2HWZH 1W54A 4JM2A 1THFD 2AL1A 1N4XL 3I74A 3QDMD 3EFOA 1YEHH 3T1FB 4F1ZA 2J24A 5K1NA 3BLFA 1KM3A 2X9ZA 3BAKA 3BAYA 2H7WA 3RILA 1JI1A 1KG0B 2PCXA 2GFTA 1H6EA 3U25A 3GG1A 3SDAB 4NPYB 1Q9OA 1P5UC 3W1TA 3HNTL 1KJVB 1BXNA 3QIBB 2CJUH 4TNFA 4CD7A 4ANKA 4HAGA 4PCKA 3DG6A 1KXVC 2PWFA 1V0KA 1V51A 1HSAB 2ORBL 2ZOKA 5CGMA 3UZVA 4F8LA 4HJGB 1KCZA 3MOAH 4ZX6A 1LP9E 3WE1A 1J0JA 1E72M 3QLLA 1D6VH 2H3DA 2XOTA 1UWRA 1OFAA 1BF6A 4WDTA 3IT8D 4DQAA 3LQLA 3T0XA 1SQ2N 4UTJA 3Q1EA 2JTDA 4E2VA 4AC2A 2GGJA 1XGYL 1NGWA 1KMGA 2GK1A 5DRNB 4OFCA 1SMAA 5LA1A 4BI5A 5HHNA 2RHEA 3ZL4H 2VLRE 1RCOB 1XHGA 2FYMA 1NCWH 2QKFA 1TZHB 2KUTA 1JJUA 3WLWD 4G7YL 2OMYA 3DMMB 3CTTA 3HC4L 4M4RA 4WI0A 1GCYA 4C6KA 2WZ5A 2B5IC 5E7BA 2V5BA 3FAXA 1G9NL 1M57B 1BD2E 4LOFA 2BOFX 5CSUA 3QH2A 4S3GA 3O6KL 4IKJA 1O5QA 3RXZA 2PGRA 3FULA 5F3HB 1ML0A 1S7XA 1QR7A 3F7JA 3Q67A 5SWQB 3WTSA 1KY7A 4PJGF 3UWWA 1DDHA 3W1PA 1VFTA 4PJBF 2X1TA 4XWOD 1BTMA 3I7QA 3EYQC 3NCCB 3WJWA 4ERGA 1H6FA 3ULUE 3CX2A 5IHZA 2WPBA 1FLRL 2E9MA 4IJCA 2H0EA 2D0FA 4XZBA 1JNNL 4JHUA 3TBBA 4N9GA 4MJ2A 2J2ZB 2FZ3B 5BRZA 1BYDA 4DM2A 3AW5A 4L2YA 3QXUA 5I2UA 5HD8D 4H0LC 1IIIA 1IVLA 1ROWA 4Z5RB 3QG7L 2IOMA 5GS3A 1I9RL 3D50A 4B16A 1SGJA 3MMWA 5I0XA 4Y9FA 3ILQC 1CT5A 1USZA 1W6LA 3LNGA 1F9CA 3RLSA 3QO0A 3OJDA 4Z7VA 3TV3H 2REQA 3FOMB 3IVKA 2NUWA 32C2B 3O7UA 4NO5A 3OP2A 1FP5A 4Y0GA 4Z3IA 1UKTA 5E1AB 2I57A 4ZPTA 1S6NA 3DGCR 4XHJD 1A6PA 2JJUA 4JGJA 1C8XA 1U93B 2YB4A 1PY0A 3QCVL 3HS0B 2BMKA 3TBYA 1EV2E 5FM5O 3FU0A 1E6NA 1MQPA 1KEGH 3VFLA 1CFVH 5D4HA 4GOSA 4X6CE 3DX9A 2H45A 3KBFA 2QDWA 4JFHE 3CMOH 3W7QA 4PJEB 3H54A 5A3ID 1GEHA 4WZHA 4NGHL 4AQ8A 5TGBA 4OUUA 1BYOA 3CFKA 4ZW3A 3DI3B 2GHWB 3W7KA 2UZXA 3GRIA 3OGOE 2VR2A 4R9XA 1OM3L 3NCYS 1CQYA 3ULAB 5HDQL 5IP4A 2VNCA 2BIPA 1Q65A 3NFPB 1IKOP 1P0DA 1XF5B 4J3OH 3ZVVA 1HGWA 1ECQA 3QHNA 4MYWB 4V15A 2OCCB 3OHXA 5D1ZC 5DJ0B 3CQFA 1NGPL 4K23L 4H6KA 1AR1D 4JTTA 4IZGA 4Y2DA 4FI8A 4N2MA 4PUDA 3N55A 3ZDWA 1J0YA 1UWXH 5I24A 4M29A 3C2AH 4L4PA 2WYSA 8PAZA 3I6GA 2VGLM 1FYTB 3HLAB 3GS6A 3CZEA 4XC1H 1G5GA 4R4FL 3IJEA 4GABA 2ICEA 4NKMA 4LL1A 3HB9A 1XRVA 3KPMA 4PJFF 1JHLH 5I3HA 4W84A 1GVRA 2Y2YA 5C09A 2LU4A 2C4FU 3SCMB 5KSUA 2V8MA 4BZ1A 2IQTA 1QP1A 1R38A 4HLZG 5DRWB 2Y89A 2O6PA 3TJHD 1J9QA 5TPWL 4PRAA 3QWQB 4IU3A 3HZYB 2ZOTA 4J3OG 4HBQA 3FB6A 5LNEA 1CWVA 4DKFH 5E09A 3SADA 3SFWA 1E28A 1E56A 4NQEE 4Y9AA 1OXYA 2HVJA 3BKYL 1EWDA 4JGUA 4NSBA 3SDDA 2ZZ7A 4KVNH 4O9HL 5AFDA 2X16A 4EANA 3AG3B 4TSAH 4IT1A 1U21A 4R7DB 4DELA 2NZ9C 4Y19A 4LAQH 3NOIA 4FKEA 3HE6C 1AKJA 3CL8A 4UDUA 1UBPC 4TUOB 3IU4L 1E5CA 4EF3A 4QI3A 4APXB 1SXNA 2PTTA 1CG9B 2ZONA 3FO0L 3V52H 3MXVL 3X3FH 3RWJA 4H9YA 2VDMH 4LAOA 5CEYA 4CQDA 3LRMA 5D7IF 3BPWA 3IGSA 2OV0A 1ZVYA 4XVOA 1TQJA 4KY1H 4UFHA 3LZLA 2FLIA 2WZHA 3MREB 1NLBL 5D2NA 1YN7A 3HM7A 1U6AH 2FIRT 3I6LE 2JI2A 4FG6C 2EXWD 5EOQH 3S6DA 2NNCA 2R9HC 3TA4D 4FRWA 4BXSV 1QYGH 4ENZA 3CFDA 4AF0B 4GX9A 4R53A 4J4PC 4IHCA 2RACA 1MLBA 3V3WA 5DFAA 3BEVB 3OAYH 2DFAA 1HHIB 2WANA 4DFHA 2EO1A 1U3HB 1L3NA 1W5MA 1AJ2A 2OCFD 4RIRB 2D31A 4Z7UA 1AQFA 1OCZB 3MMDA 4RAUA 5A8QA 1SLWA 3STBA 1GOOA 2NV1A 4N7QA 4MYXA 4H01A 3UT0A 4TUUA 5I1LB 5D2LB 2HWGA 4GGHA 2DLTA 1BQCA 5HDBB 2Y62A 4OFPA 2WZPD 1RVFH 3HG0A 4LKCA 3GHEL 2XV2A 4L1BA 3RWHA 4JFXB 4G6FB 1J0HA 2PXYD 3BQUB 1N19A 5BOPA 3L1OL 1X6NA 4S1SL 4K3EL 1T3FB 3S2LA 4LSTH 2WLMA 1TTBA 1N10A 3BP6A 3OIHA 4P2OB 5DHEA 1LRQA 3IS0X 4J9JA 1MXSA 1R7AA 5JLZB 4TVDA 3QJHB 3Q2VA 3V4PB 3VXNB 4NRXB 4F2ME 3SY6A 1K9FA 5E6ID 2AKMA 4HMEA 5LNDA 4BSVA 5A2FA 4JFFB 1R6WA 4MDPA 2AQVA 2ATKA 2QCNA 5CJ8A 3OOQA 2PW1B 2WQXA 1S5HB 4GUQA 2J62A 3MC0A 4RLDA 1NEYA 1YPFA 5EORL 1UOWA 4NYLB 2E46A 4D0DB 2DLEA 3G1DA 3AS2A 2E6FA 2G0WA 3RWGB 1B3VA 4BCYA 1GKEA 3RGVC 5JW5B 4H4NA 1RLDA 3MRQB 4N6FA 4Y89A 3W2LA 2CIKB 3HVDA 2ATAA 1ZPUA 3UR2A 1QZNA 2VLRD 1DVTA 3BISA 3S3DB 4NBXB 4E5XG 2XJ7A 3MR9A 1ZHBA 1IL1A 3O3BB 4PLJC 4F0RA 3LNMA 2ZA1A 4DZBB 1WOBA 4WDXA 4MQSB 1E4LA 5C2BH 5EYWA 4KDWA 4LOUD 1HKJA 1BD2D 4LAJH 2Q01A 4I0PC 1NOLA 5IUCA 4WFHE 3AM8A 3T77B 1U8CB 4F15B 4QSFA 2HX8A 5CM1A 2FL5A 5DHYA 1BIIA 4DH2A 5T5NG 3MSPA 5DFVC 5AB0A 4US5A 4L64A 2H47C 1ND0A 1HH6A 4JVPA 4QRRB 3ULUD 1JHTA 2Y7DA 1DE5A 1WD9A 2ZOXA 2YPKA 4CC4C 2G37A 3APYA 4OT1L 4OF0A 4YDJB 1MDTA 4H0IA 3EWYA 3G6JB 2PI6A 4S11A 3Q45A 3H2PA 3BGGA 2WW8A 2W07A 3E1ZA 3AB0C 4YK4B 2A3BA 1M7PA 2MANA 1BW8A 3AIBA 4LLVA 4LUTA 3D5OF 4D9RE 2WBJD 1CR9L 1GQNA 1A9EB 2A83A 2RH9A 3BKML 4M8UA 4Q6IA 4Z3TA 1FWNA 3QUZC 1A21A 4RE3A 4CCEA 3XIMA 1TPXC 1SY6L 1P7BA 4LSBA 3OODA 4LB4A 5HJ3B 4O02H 3R8HA 4AW7A 1GHSA 2XWJA 2C9QA 4PTWA 2UWEE 1C5BL 3VWKB 2ICCA 4HS8L 5I1EL 2C1OB 3E2VA 1T7VA 5B3NA 4I85A 1A1NB 1OT2A 3RJOA 4M3KB 2YBRB 1NC2D 3S3PA 3WMBA 5KJ4A 1R19A 1RQEA 2OLSA 4CUCA 1YMME 3SJVB 1VC4A 4HIHA 5JVLA 3OBEA 1DWHM 2OWCA 5MENE 5D1XA 5EDSA 4NQ1A 3WJSA 2D23A 1WEJH 4QHPA 4HG4K 2HKHL 5T33H 4PJ8C 1NF0A 3M8OH 3WJYA 5FCSH 2RA1A 5G2NA 2V81A 4NJJA 4PP1D 3TQPA 3M0KA 2IQAA 4JFHD 3QZNA 1EGJL 3CFCH 1RZJC 3UERA 4Z0BL 1DUYB 2HVMA 1JPEA 1CIDA 3HIZA 2Y5TA 2I69A 5EO0B 3KBWA 1KBBA 1EZWA 5DJ8A 2WMPB 3NIGF 4DJFD 2XKNA 4CVXB 5A8PA 4HWBA 1T5KA 2WMIB 4DB7A 3OQRA 3VI3B 2Q09A 4K8GA 3I6KA 2INEA 2BDQA 1TA3A 5B38G 3APGA 4YPJA 1Z9AA 3INPA 4MJ6A 2J13A 1SYVA 3FO1A 3GUTA 4HX1B 3KYOA 3QQDB 4TOYH 4YDNA 3ARXA 4K3GA 1CFQB 3TQ0A 5DA4A 5IHBA 3GLZA 5CR1A 1P0EA 2VWEC 1T2QL 3BHBB 3MJ9H 4LXFA 2IALA 9RUBA 4AT6B 4RISH 4M6VA 1YNTF 1PLGH 3VA2C 1CD8A 1E4IA 3FSZA 1FE8H 1XGQA 4U1IB 3T9PA 2AJUL 4F0KA 2P80A 3AGVA 3UTZA 5AB9A 2WQRA 2P26A 1DLFL 4QR7A 4EUPA 2ARJB 5J3HC 1UWAA 3B9KD 2XZQL 2QV2A 3IRPX 3RZCA 2DJMA 1BQGA 2TSYA 4R33A 4MYAA 3TFCA 3QRHA 1K70A 4FR1A 3WD4A 5E2UH 5FHBH 1PZAA 1IT0A 5B22A 4A2LA 1TTIA 3VYLA 3IACA 2WXMA 1ES0A 4L4TE 2Y8KA 3W7OA 4ZUTA 1JNDA 2HJLA 4BELD 1LM1A 4HT3A 2R0KH 5EUOB 4UWMA 4HUCA 5I1AB 3C5ZA 3QUYA 1K1DA 3EHBD 4PTUA 3VFGL 4OJCA 3MBDA 1R3RA 1W16A 4NQED 4LRIC 1M41A 1HKLH 3D25B 2ED9A 4GXUM 3L12A 1WFIA 1W1A1 1FWCC 4FQXC 3UESA 3DX7B 3CUZA 1E4KA 3NIFF 3AREB 4MFEA 1OVZA 2IO5A 4AG4L 4H2CA 2X4RA 2NY7H 3ZE1E 3EFDH 3VX1A 4GYJA 2V4LA 3ZHKA 2R69A 4F7TA 4D6GA 3E0IA 4NCDA 3QCUL 5HGHA 5EMUA 1OX4A 1YUKB 1TV4A 3VFWA 4IBZA 3QC5X 1QACA 1XRSA 5LA0A 4FJYA 3TURA 5ABFB 2EO7A 4NWUL 3F62A 4X4YA 1U4FA 2FYYA 3B8TA 2WMHA 2YRPA 1PX3A 2V3GA 2E27H 4OZGB 1OHQA 2GPZA 12E8H 2WNQA 2AEPH 3AJXA 4N0YH 1VFOA 2IPUG 4RGNB 1EDGA 4BEUA 1IFGA 3OGCB 1GKPA 2PTDA 4F9DA 1Z6JT 3VVVA 3W00A 2Y7QB 1FWTA 1C5CH 1BMZA 3O4OB 3I6LD 1YZZA 2MWCA 3T8XA 5E6UB 3GEFA 1OX6A 3ASWA 3RVVD 3MAWA 2X0HA 3WS6A 4MOZA 2JJWA 1F73A 3G5EA 2PYEA 2CR6A 5I1IL 4OV6F 1JCJA 4BE5A 1Y18A 5BWFA 1BBJA 3L4VA 4YFLF 3KHQA 3RVWC 1S7TB 4LF2A 1JGMA 4FP8L 3GUWA 4U1NA 2DMKA 3JQOB 4L4LA 1QLRA 3W1NA 3IBOA 3C6LA 7XIMA 4RXGA 3C86A 2PBGA 2HUHA 3T65A 1C29A 3F03K 1LO2H 4V1DE 1IAOB 4OTXL 1OD7A 4Z7WA 5A8OA 2X0YA 1JULA 3AWEA 5JR1H 3S34H 3MRFA 4F9LC 1HFBA 4YQXL 5LSMA 5A6SA 3M0MA 4BQCA 1LXMA 3CK5A 4Q8UA 1WDQA 4ZMLA 2BODX 3WS3A 3K8KA 3KRBA 2Z29A 4LT7A 4HFWA 5CPMA 3SCUA 2NR6D 3ARGC 2IC2A 3DU0A 3QI9B 3BUIA 2CLLA 3RY6A 2DTSA 3SCTA 3VINA 4I2XE 1RZJH 1NEUA 1UEYA 1DXEA 1NEZG 3DCPA 5CC6A 2DS4A 4XVUC 3P82A 4JFEE 3UXDA 3H26A 3V5DA 4Q14A 2IS7A 4HYWA 3BH8A 4GQQA 2AJZA 2BSTA 5KYWA 1CDCA 3OF6D 4M6PA 4E42B 1ZVHA 3GVGA 5KSWA 3TYBA 3NVDA 3C0JA 2OI9B 1SEQH 2O5XH 4EKXA 4BK5A 4LNCA 1XWVA 2OJZL 4GRWH 5KVEH 2CC0A 4F0HA 1A25A 4ZGYA 3A64A 3NTCL 5KVMC 4OGYH 2XFFA 4X4MA 1DBKH 3PWUB 3LV3A 3JVGA 2SEBB 4Z95L 1I3RB 2QVHA 3F7RA 1WGVA 2ADJB 3MI3A 2CW6A 3RX7A 1OLZA 1YY9C 4WOQA 2QDDA 2NY1B 4UIOA 4Y90A 1P7TA 1CFSA 4LIQE 3MUIA 4FFTA 3WF0A 4TVPH 1ZBCA 2Z7UA 4DP2X 2FECI 2CO2A 2QKIC 2VMCA 3EOBB 5B1JC 1JV2B 1PMYA 1NJ9A 5GGRA 2AERT 2X4OA 1UM5L 1F4YL 5E2VL 4ZW5A 5GGSB 4YSSA 1CCWB 4WF7A 3MBEC 3O2DA 5GRJL 4ABWA 1GW9A 3OVQA 2V0TA 3CH1A 4H26A 4MCMA 4B41A 5J57B 2N1KA 5AAWA 4WFHD