4MJ4A

Human iduronidase apo structure p21 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
614
structure length
603
Chain Sequence
EAPHLVQVDAARALWPLRRFWRSTGFCPDPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-L-iduronidase
total genus 194
structure length 603
sequence length 614
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01229 Glyco_hydro_39 Glycosyl hydrolases family 39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mj4A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4mj4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mj4A02
4LKCA 4J12A 2PBOA 5FYLL 4P7OA 3DX9A 3VI4E 3LV3A 1A1MB 1GXEA 3SJVB 1CZ1A 4WV1B 3HMXA 1W8OA 3SDXF 3WS6A 2CBIA 1T2XA 5DTFA 1O0VA 5BS0D 4BM7A 2YKKA 5HGAA 4LCWE 5E08L 3RBSA 1U2HA 1EIBA 1OLZA 3AAZB 1WDRA 3MBED 2CXKA 1HSBA 4XNMB 1S7QB 3I3EA 3CU7A 3NCOA 5BRPA 3QQ3B 1HJWA 5IF0A 4CNIB 4U1JA 1C93A 2F8QA 3B9EA 4G7VH 1YPZF 2A73A 1GC1H 1B31A 1R0AH 4MNKA 5F3HA 4KXZI 3C5ZA 3UMTA 4Y0GA 1AKJD 5ENWA 5GRJH 4MAYB 2NCMA 2VL5B 5A95A 5L2KB 1YQVH 4P8WA 3D6GA 4Z95H 1NCBH 3WNMA 3TIEA 4DVRH 1G7JB 1FH5L 1YYML 2EDYA 2V9QA 2VXSH 1R3JA 4MJIB 4EVNB 4AMCA 1AH1A 4XNZC 2P5EA 4X9YA 3MRRB 1ZT7A 2G8ZA 3C2AL 2CDGA 1CIUA 5FUOH 2C7FA 4J8RB 4P2QD 2JF7A 3WL1A 4NKMA 1C5CL 4XCYB 4CUCA 3RA7H 4PJIA 5FYJD 1JMZA 4Y4FD 1Z3GH 4H20L 15C8L 3CFCL 3O3AB 4M61B 4PB0L 1L6XA 1UXWA 3ZHLA 2EZ0C 5IB4A 4TNVK 3GTNA 2VITA 2AEQL 4LPCA 5CFHA 4HPGA 25C8H 2UY7A 2ZSWA 5DD5H 5ISZA 3G08A 3FT3B 2ERJC 1IGYA 4P57B 1J7VR 3HLAB 4GAJH 3NSMA 1RIVH 3WUWA 4Q58C 2DLHA 3EOYG 2BNQE 3ZR5A 5SWSA 3ARXA 1JGVH 2V17L 3T1FB 4GUPB 1DBML 2FD6H 5K9JH 4YHPA 3DYMA 1GGIH 4UNTA 1EVUA 4YBQD 2XG5A 1RURL 1DE4B 1KTDB 2EDWA 2Q6WB 3FCTA 3RP1A 2A6IB 1HXYA 3KYMB 4W8AA 2KZ1B 5H8DA 1DANU 4YFDB 2YPLE 3S6CA 3RZWA 3P4OB 1KBGH 2UV3A 1J0HA 4RE4A 4S3KA 3PF2A 4NSBA 4KUCF 3S9DB 3B2VL 1YNTB 4BQ8A 5C0GB 5HSFA 1MXGA 1KIRB 3G5ZA 3PGCA 3TGXA 4G9FB 5EB9A 3MXVL 5M3WA 1MHCA 2X4SB 5JIPA 3P73B 1KQZA 1DBMH 4CU6A 1I8MA 4HP5A 3L95B 3IETA 4N0FB 1JNHA 2J47A 2D9QB 3DIFA 3QUXC 1R0AL 2HFFA 4GKSB 2EDHA 1Q9OB 3IDXH 3PWPA 1CICD 1V7ML 3C60C 1TXKA 3OHXA 3MTRA 2J1KA 5GS0L 2GTZB 1RJYB 3AYSA 1QR4A 1VGKA 1P6FA 3EW3B 1AC0A 3HNTL 5D70H 1CGUA 4XCFL 3WFDL 4JG0L 3T65A 1J5OH 2D24A 3W2DL 3VM7A 3CIQA 3B3IB 4M02A 5BV7C 4OUUA 2VC2H 2YMXH 3DXAE 1YYMH 1G0CA 4NYLB 3GMLA 5FK9A 1NGYA 4W6WB 3PZTA 2VL4A 4RQQA 4NFCA 2X0YA 3QEQA 4U2YA 1CTOA 5I1LB 3WKMH 1NAMA 3BKJH 4HKZB 5BRZE 5GS2H 4QF1B 4CADA 1MEXH 2QBWA 4CKQA 5D1XA 1HXYB 4JQIL 3IAPA 1FVCA 4RAVA 4KK6C 1WCGA 4ODSL 4HA3A 5D1QD 1U58B 4O00A 5J9PA 4WWKB 4EI5C 1HH6B 3VX0A 1VIWA 5HYSB 3HR5A 2Z8VC 3RDTA 3W2DH 4NQSB 3LRSA 4QHMB 2YHGA 4XP6L 2Q7NA 3D85B 1RIVL 4O5LL 2OP4H 2AMGA 1BOYA 4I5BA 4WFGE 5EU6A 2E6PA 2DIAA 2ZSWB 5A2FA 1RQ5A 3GMOB 1GGIL 4LCUA 3F58H 1I3UA 5FKAA 1FYTD 3ZTJG 3VH8G 3VRIA 1RURH 3SGKA 3KZSA 4Z78B 4HWBH 4QTIL 4CMMA 2VZOA 1W72H 4RAVB 5SX5K 1LEKA 3JV4B 2G4FA 2ZUUA 2DH3A 3QUYC 1J0KA 3ES6A 5I1CL 5KSBB 1KBGL 1LP9E 2BNQD 2VURA 5I6XB 3CHCA 2DAVA 5GIRB 4RIRA 1J0IA 4U5KA 1TVHB 3RTQB 3KPRB 1U95A 4E0RB 3T4AA 3MROA 2FX7L 2PXYA 5FK9B 4MDOA 5D2LB 2DMBA 2ITDB 1UWXH 2FJHA 2CKSA 1FVDA 2ZWLT 4PYHA 1NDGB 1OW0A 5ESQB 5F89A 4N5EC 3QIUA 3OR6A 5DFVD 4X6DE 4HIIA 5FL1A 1W91A 1QI2A 4TTDD 5DZOA 3NSXA 2D4FA 3OB8A 4L8SA 3VWJD 4Z7WA 4DK6A 1VRXA 6TAAA 2R29H 3UAJD 3GSVA 5D70L 3WLBA 5HHNA 1N4XH 1D5BA 1U95B 1T7VA 3LY6A 3MNVA 2E9BA 1HSBB 3UYOD 1A4KA 1IM9A 2GI7A 3UTTD 4PJ7E 4HC1A 2EH7L 4G8GA 3PXHA 2XT1B 5ESAB 1H15B 3WSQH 4F7MB 2EYTB 3SKJL 2PKDA 1BREA 1WBZB 5HI3C 2CLZA 1UEYA 3IK2A 1CT8A 3IKCB 3EJZC 4GKOA 1U8JB 1U33A 3THDA 2VLRB 2V5TA 2NR6C 5DJXB 3P11H 4U0RC 3O3DA 1Y6KR 4F7PB 4ZFGH 5ISZD 1IGJB 4D6FA 4JRYB 3WQVA 2WANA 4APQB 2ATKA 1U6AH 4YDJA 3QCUL 3FW6A 3MGOA 2JB6B 3HG1E 4PJ8D 3S5LB 2J25A 4K8RD 1NWRA 2Z1KA 1GUVA 4XNQB 1MJJA 3GMNB 2OSLA 2F2HA 1MFNA 4JFFA 1EQCA 3R06A 2Z8RA 5DURD 1QPPA 1M7DA 4N0UA 1H8NA 1FH8A 2G5BB 3FHAA 2X09A 1LWHA 3L1OH 4Z2GA 2FR4A 3RVVD 4XVTL 3SCMD 5CZXC 4WFGD 3SCOA 1ED3A 2G2RB 2QJDA 4XNUH 5DJDB 2XTLA 4S1RH 2WBGA 3SCWA 5CP3H 2Z92A 5IOPB 3IJYB 2YRLA 1N6VA 3O4LB 4UDUB 3W6MA 1LL6A 5HI4D 4JHAH 4FQIL 1KJ3L 2XQYG 1U6AL 4AT6B 1B0GB 3NFNB 5IHSA 4HQQL 1E3ZA 4W8LA 2AABH 4C83A 5I1DB 1S7UA 3NA9H 8FABA 5EO9B 1ZA3A 2WW8A 2BSTA 3QI9D 4NQTA 4PLKD 5CJXC 5BZDB 5A6AA 2Q86B 2DIJA 4EDXB 4AZCA 4NN7B 3VXRA 4RA3A 4P3DA 4KRPC 3WBEA 1UFUA 5T3XH 1WITA 3IU3B 3BN9C 4MCYA 3ARDC 3D39D 4RFNB 2OZ4H 4YZFF 3C5ZC 3VRLE 2DYPA 2ZG2A 4MMZC 1K4DA 1WT5A 2XTJC 4WTWA 1V0LA 1AHWA 1XYFA 2VQ1A 1F3RB 3L3IB 1EMTH 5E6IB 1KGUA 2K9UA 2VH5H 2R1WA 1DEEA 1ONQA 4K7PH 4JGUA 1G7LB 4Y2OA 2H9GB 1KPUB 1QSFD 3SE8H 1E4JA 1AD9B 3DJ9A 4HQQH 4HUWB 4OD2B 5DI8B 3BJLA 3SCMC 3OKKB 4NSKA 1FYTA 5EN2A 1GHSA 1BBJB 5E03A 1TZGL 5K9KB 2JIXB 4RZCA 4YC2C 2K7PA 4OI9A 2IPUK 1ETZB 1CGVA 3WIFB 3IDMA 3BH8A 1CNVA 3Q6FB 2YUVA 3JWOL 2Z91A 4ODUB 1SJHB 5ALBL 4OCWL 2JJSC 1YEDB 3TYFB 3PWVA 3WV0A 1HJQA 2OYPA 4MXVF 3TN0B 1PBYA 4LKXA 2HN7B 1A14L 4CCDA 3SCSA 4J1UA 4Z7NE 3F12A 3NOIA 4ZFGL 4HXBH 1MUJB 1FZKA 3KNBB 5DYOB 2FECI 3ZE0E 1VFBB 4ODBD 4OFIA 4N90E 4RNRB 3TFKC 5CIPA 2C9AA 5DRWA 1WGOA 2CRIA 3QDME 3JWDL 3DRTA 1VFAB 3SQOH 5CSZA 3MYJA 2CLVA 1VKXB 5A8PA 3OB0H 1JNEA 4R90L 1B90A 4HPYL 4D94A 3FT4A 1DDHB 4KQ4L 4XAWH 3I2CH 4CN4A 1DVFA 3SE4A 2OL3L 2EEAA 3L6FB 1N59B 1T6WA 5IG7A 3QHFL 5B22A 1G7IA 1N5YL 2C26A 2H2PC 2HT3D 3MYJB 2YPLA 3OAYK 5EU7C 4UOZA 5DRNA 1LO0H 3PZNA 2BSRB 2YA0A 3DMMD 5CEZH 4JHAL 2A6DB 3CLEH 1F13A 5K59F 4JPVL 5J6GA 3T3ME 3CVHA 3UJTL 1U8HB 2QQLL 1RHHB 2D9CA 4LCWD 1K9TA 3BEVB 2AJXL 4MAZA 4WHTB 4Z18A 3C08H 3SURA 2XWEA 4KGJA 3UDWC 4OZGE 3I2CL 3IDYC 5JUVA 1S7QA 4M6OL 4ODUA 5GGSY 4DUWA 1RU9L 5KBNC 1U3JA 4M8QB 1QD0A 4Q7NA 5IBLD 5HGHA 3NJ3A 2VZVA 4WV1A 2UVFA 1INQA 2ZOXA 5C70A 5DFWH 2PWDA 1HVQA 2ZXDA 4JL2A 5C7XL 1B6DA 5E8OA 4M5ZL 2DQIH 3C60B 4A6YA 1R87A 4HGWA 2JJUA 3VGAC 1CDCA 1AGFA 1S7RB 3SPVB 3CO4A 5FM8A 4YWGL 5EOTB 3ZE0F 3C08L 3QDJA 4DK3A 3Q2CA 3AIVA 1P53A 5ESQA 2QLVB 1A6UL 2BY2A 2CRYA 3BDBA 1M03A 3LSOB 2GAZA 2OTPA 2APVA 2Z31D 2XHYA 3M8OH 5JQHC 3ZKMC 4DKDC 4PJFF 5E99H 2OX5A 3ZE2F 1GZQA 2DJ4A 3KR3L 4OCXL 3L6FA 5F8RC 5ADPL 4PJGF 2EDQA 3GGWA 2R69H 4NBZB 1U2CA 3RVUC 2RGSA 4C7FA 3CCHB 5DRNB 5ID0B 2RFXA 1WLHA 3MNZA 3UC0L 3S36H 5ID1A 5C7XH 2EYSB 1RZIB 5J13C 2BRRH 3BSZL 4G7YH 1TZHB 3BVNA 5J3HC 3JWDH 4XBEL 3WJLA 4EN3B 3BDXA 1C3FA 2DH2A 4YWGH 4EK7A 2BOBA 4M4RA 2NMSA 4XPGL 5FKAB 2V7NA 4NQEB 2AJ3A 2V3DA 3WF0A 4NQDD 4F7EA 1NAKH 1KB9K 1I1AC 3Q48A 4JHBA 4WFFD 4IPLA 4KQ4H 4XAWL 1H11A 3ULUL 4PRHE 2YL8A 1NMCC 4DZBB 4HIEA 2WUCH 5IVZA 3WJJC 4WWID 2V2TA 4X6CF 5BXTA 3ILPB 3SY0A 4Y16C 3GXMA 5J1SC 3AXHA 3FAWA 4MADA 4ACZA 3OKNA 5IEKA 4DWSA 3UC0H 1OB1B 1OGAE 5MEQA 1JHTB 4P4RA 1FCCA 3UJTH 4CRPA 5IK3B 5KN5A 2BHZA 1G9HA 3VIJA 2DQHH 1V02E 4P9HH 3WEXB 3IJHA 5E8NB 3PZ9A 5D7LA 3EMQA 4S1SH 4IDLA 2AEIT 1BAFL 1IEAA 5E8DL 4NZUH 1MJUH 3T04D 5A1AA 4XPGH 1Y0LA 5DDHB 1HI6A 4OB5L 2P24B 4TPRH 1LO3L 4M6NL 4RDQG 2OMBA 2A74B 5IGXH 2XPGA 4OFYA 1QPXA 4PGJA 1W3HA 3V6ZB 4X6DA 1WAAF 1N64L 3HZMB 5BV7H 5EU3A 1CZ8L 1HXJA 4JRXA 1BX2A 3LPFA 3LQZB 3ALXA 4U1HB 4YHZL 1F3JB 5MI0B 2F54A 4RFEA 4PJFE 3O2VH 2R1YB 5DQJA 2Y23A 3VD5A 4OIFA 5M17A 3V52L 3U48A 2OYLA 1SEQH 2MHAA 2E4TA 1QNOA 2FGWH 4E5XA 2P1YA 4GW5A 4YHOL 5JUEH 4NZUL 3QWRD 4P2OD 4D9QD 1N82A 1KPVB 4Y16D 4JM2F 4YHLL 1KACB 1NC4D 3W5NA 2GJPA 5EU4A 2ED7A 3NAAH 1JUFA 3A67H 2IANE 4X7TB 3K2MC 4P4KB 3RFZC 1KG0A 4ELMF 1J0YA 3QEHB 2OLDA 4JFED 3QZWA 2VIRB 1TVHA 3AMCA 2ICWB 1YN7B 4BKLA 1XH2A 4HCRA 4JDTH 4MB1A 1ZLUK 2BOCB 5J12B 5I6SA 4PFEA 1W0YT 3BPOC 3KDMA 4NZTH 5HBFA 4M7JL 3X14B 3BLKA 3WSUA 5DGQA 1A02N 3WFHA 4X6FA 4XBEH 4HIHB 4J3UA 1Q38A 1ESWA 5ABGA 1TTUA 3MGOB 3GJFA 2WMGA 3D2UB 3HG1B 1NCDL 4FTVB 3VKKA 5FCUL 4XI5C 1ZE3C 3ARBD 4JFFB 4Q0XL 2EPMX 1Q9KB 4XTRD 3LEYL 5I16B 4PR5A 2YD9A 2AXHA 4F9PC 3VXRE 1K5NB 3OGSA 3RDKA 1UKSA 5SX4I 1U3YA 4XBGB 5M94B 1CBVH 4JQVA 3VCLA 4QNPE 2Q76A 4PJGA 1OGTB 4YHIB 3GUTA 5F7KC 4BQ6A 3MV9B 4QHMA 3MANA 5F1NA 3AISA 3BPCA 1ZA3B 3QRGL 3DXAB 2D7OA 4LCYB 4LK4A 4UILL 5C0DA 2Y72A 4WVRA 4U6XA 2BVUA 5TDOA 4G8GD 3NCCB 1UB6A 1B0GA 2CKNA 4LARH 3WENA 5T3ZD 4FABL 3CZFB 1LK2B 3GBLA 1NAMB 2BJMH 4N9GA 3ZJ6A 4OB5H 1RY7B 1T20A 4D8PA 1IGFL 1KQYA 1U8QA 1UM5H 5C8JA 1F6LL 1W0WA 4GXUN 3ZMRA 2DN7A 4XPTL 5I0ZA 3IXTA 5F89B 1S7XB 2JCCA 3TP4A 4E2OA 3WN5A 4HUWA 1Q6CA 3JSSA 2VKWA 1SEBA 5F1IB 1AE6H 4XWGL 3MV8B 4MAYA 1UH4A 4HCRL 3RPKA 4D1JA 1NGQH 4PJBA 3RJXA 4KJPC 3O11A 3RL1A 5D96B 5FYLE 3TBSB 1MAJA 2J8UF 5C0IB 3N17A 4E41B 2GCYA 1IC4L 3QQ3A 1EEUA 4EUPH 4LASH 1T6VN 3NAAL 5EIIB 3S37H 1QZ1A 3P0YL 3QEGH 1HZHH 12E8L 1A3RL 5IHLB 3WY1A 5CPQA 3RWJA 2ZUWA 3TESA 3HTLX 4N0RA 4HH9B 2ATPB 2LFGA 5C2BL 3PZMA 3V8CA 3VXSB 3WNNA 4H2CA 1I75A 2OR8A 4YNYA 2YN5A 2PW1B 1ZMYA 3EGSB 1IZKA 4MXWL 5IJVB 5CD3A 3EFFB 3ZKND 1QO3B 4LVNB 5D9SA 3ZT6A 5HHXH 1AIFB 4HCRH 1RMFL 4HWZB 3BXNA 3GMPB 5JO5B 3WCYA 4GG6A 3FTGA 3MV9E 5C0IA 5MERA 5H94A 4XHJD 3D2UA 4HJGB 3E8UH 3NH7H 3PUCA 5C6TH 4HAGA 2H45A 3ALFA 1AQDB 5M7QA 3HMXL 1TDQA 4PLOB 1Q9KA 2UY4A 4XPAH 3TO4A 4HT1L 1UR0A 3VXSE 4P2YA 2DT3A 1MFAH 1XR8B 3C09B 4Y89A 4HU8A 1H5BC 2WK2A 5GZOC 1RFDL 1RUPH 4PS4L 3ULVH 5F8QC 1Q1JH 2WP3T 4MX7A 3PP3H 5HDBF 1K85A 3SCTA 2CR6A 3TOPA 4HIJA 4GW4A 1VFUA 5KANI 4GQRA 1M6OA 4N90D 4HWNA 3V6BR 3BAXA 1XR9B 3Q6GL 4X5LA 1MLBB 2CUIA 4WENB 1FYHB 1QBAA 4RMRA 4UT7L 2HFGH 3O4LE 4J8RA 5GRVL 1UJ3C 2F74B 5FB8B 1B0RA 4MA3A 4OKVA 4HZ6A 5HDOA 1HKKA 4Y4KB 3VXMB 2GSIB 4KGLA 3V4VH 2DBLL 3VCLB 2DTMH 4WLCA 3WKZA 1C16B 2CPCA 1RUPL 2DKMA 2X4OA 3PJSB 3G6AB 4HAFA 1PQZA 1JXJA 4F2MB 1FC2D 3H9SA 4P48A 1OOAA 2PWHA 2YPVL 5JW4M 5MENA 2F61A 2DM7A 1PSKH 1AY1H 4P8UA 2WUBL 1IVLA 3VNZA 4DWSD 3RPIB 4JFZH 3EYOA 1J1XH 1S7SA 3RVWD 4UT6H 3CU1A 3U0PB 3DRQA 3UR8A 4UUJA 4A6YB 1MFVA 4MJ2A 4I4WB 1FJ1A 5KS9E 3WEXA 1HHIB 3G6LA 1FNEA 5B21A 3QEQB 1MWAA 1IAOA 3I75B 5ACZB 4RIRB 4YHNB 3P30H 2IPUG 3EUUA 4EDWH 1H5VA 5BS0E 1KCSL 3GMLB 3EYSL 4MXWH 3SJVA 1H0DA 1GIGH 2VXTL 1M04A 4L4JA 1MFCH 2Y2WA 3T65B 3U7VA 3VFWA 5HYIA 1GRWA 3PABB 4IOFC 2DQJH 4OTXH 3RY6A 3BZEA 4P23C 4HV8B 4NKIH 1BZ9B 2XRAL 1GHRA 2OQJA 3MMEB 3TV3H 3IFPA 4ZG1A 2BVYA 1T0NB 5GQBA 1RVFH 4CVWA 2EPKX 5HI4C 4H04A 1Z9LA 3A4XA 1M05B 1NEUA 1T5WB 5D7LE 5ISZB 4XRCA 5DK2B 1VJSA 4IMKA 4DWSC 4DEPC 1N59A 2Y07L 5ICXB 2CUMA 2FB4H 1CR9L 5CUSL 1OGAA 3SJVD 4P46B 2ZJSL 1GIGL 4HIHA 4W87A 4D0BA 5D7JD 3ZDYF 3H6JA 4POZD 3ROLA 2EE6A 5HHOD 2IG2H 5TF1L 2AV7B 4PJ7B 2RFXB 4KTDL 4ACPA 4L8DA 5MEND 1YEGL 3B9KC 3LCYA 2G9HA 3RGVB 1I85A 1NQBA 1I7UA 2IAMD 1QW8A 3BC9A 2VL5A 5GGTA 3OLGA 5EPMB 4XB8A 43C9B 3MRDA 3A4WA 4PCTA 3WUZA 3HZKB 1DE4A 4GG6F 3VA2C 1PY9A 2W07A 2X4QA 1ZS8B 3O4LD 4UNUA 5E08H 4MAYD 2HA1A 2EXYC 2P7TA 5D7KE 4UV4H 4Y88A 5I9QB 1NSNL 5F6IB 3BP5B 1NUDA 4ELKB 4FK9A 1XSIA 5CUSH 3W53A 2ZUQB 1CG9B 2AP2A 2VT0A 4KPHH 4R5EA 1IGYB 2NY5C 5KVEH 1D5MB 1UXWB 3GIZL 4AH2A 4P7LA 4ZNEE 1OD7A 1BVLA 1JTOA 1UCTA 2XA8L 3I3DA 3X11A 2LU4A 4BH7B 4JO4H 1JAEA 5L0QB 1B0WA 3U4BL 5HGAB 4FQHB 1MQPA 3P77B 4NC1C 3WFEH 1MREH 4HGMA 5I78A 4HG4K 3ZYIA 3N1FC 4EXPX 5B3JF 2DYPB 1QRNB 3FKUS 3CDFA 2VXQL 4FNLH 3PJSA 4QRQB 3IYLW 3DPBA 4CD6A 5EU6D 2CCRA 3G9AB 3OR7B 1EUTA 3ARYA 4IRJB 1C5CH 3RA7L 4J3SA 2Q6WA 1JWSB 1CGYA 3CFKA 5HHMB 4IS6A 5BO1L 3FJTA 1AXSA 3MODH 3MLPA 5ENWB 1IAIL 4KZEL 2HT3C 1S5IH 5BXPA 4LQFL 5K9QI 5E9AA 25C8L 4MD5B 4JCMA 2H8PA 4TRPL 2EO7A 3UR7A 5HVFB 4ONGL 1NFIA 4KUZH 2XG9A 5BQ7A 5GS0C 4YHKH 3BYYA 2A9NH 3RJYA 4PLNC 3DRTB 4LF3B 1JGVL 3RDTD 3CXHK 2WVTA 4D6GA 1OAKH 4C55A 1ULVA 4CVZA 1LDPL 1MCDA 1L9MA 4U6HA 2WMFA 3C6SB 4MZ2A 1E28B 5JORB 4WI9A 1BZ9A 5TF1H 3KS0H 1I9IL 2PYEA 5D9MA 3R06B 2G41A 4IJ3B 1HT6A 1IAIH 2J77A 2V7HB 4G6JH 3UTSD 4LCCC 1WUNT 1IBGH 4UU9A 4NGHL 4JM2A 2ARWA 3FO9A 1Z6JT 2A6DA 5IBUG 3X12A 3D0LB 4ONGH 4MCZB 2OXGA 1KYOJ 1MCWM 2JF1A 1BJ1J 2WBWB 4EQ3A 4UFLA 3I6LE 3CFIC 4YDLC 2ZSVB 5HBBA 1YEEL 4BZ1L 2DJSA 1OD9A 4LU5H 2FDMA 4FQXD 1BAGA 5DJ6B 4WEUD 5KZCD 4XB3A 4AWEA 2PXYD 3RWEB 2ZCHL 4YN5A 3W81A 3WIIH 5KS9A 3D39E 2XIDA 1KEGH 3NACH 1K4DB 3GIZH 3EMZA 5EZOH 3AFLA 4JPKL 4PBXA 4P99A 2XA8H 2NTFA 1HIML 3CFBA 3JVGA 3DV4B 2X7LA 1VESA 2IAMA 4NGHH 2F8OA 4EIGB 3WFDH 3MNWA 3A6BH 4HC1H 4UQCA 1MREL 2NY0D 2Q20A 1LF1A 4CBPA 2GFBA 3DNKA 3CIVA 4LRIA 3MSDA 2YMXL 3ULVD 4UCFA 4JY5L 3SDDA 5C1MB 2NW0A 3BP5A 3O4LA 4M00A 3X13B 3STZA 3TN0A 1G7MA 1MCWW 5GS1C 1HE7A 3TLRA 4WI2A 2FRGP 3N04A 4JL1A 4XB7A 2FBJH 5F9WC 4U2ZA 5BVPL 4ZTOH 5D7IB 3BI9X 3WKML 3MROB 3L3DA 4F80A 3WNPA 2AKRB 4Z0BL 3FO0L 3H2WA 5DQDL 1BEYH 4RZCB 3T0AA 4AG4L 2Z31B 3JWOC 3WIIL 3UCQA 4AD5A 3MODL 4BS0A 1T1WA 2VVSA 5F3BB 2EH8L 4ODSH 1C90A 1ZBCA 3STLA 5M95B 1RZJH 4RGNE 1ZLUH 1KJ2B 4TRPH 4Z76B 2GK2A 4Z77B 2Z8WC 5EZIL 3NN8B 4OI8A 2BCKB 2CIKA 5IBTH 1AFVL 5EZJA 2VQ1B 1V6XA 1A4JA 3KPSB 4D9QE 4GQ9H 4PJDA 1DWAM 1NP2A 4U7MA 4S2SA 5E4IA 4M1CC 2P5ED 1UVQA 1ISXA 3GUTB 2X0HA 1X6NA 1E27A 4UNVA 2FBJL 2KKQA 4TUFA 3NCBB 4GKLA 4UDTA 4TX8A 5DJAA 3O9WB 4CD4A 1G9NH 1MFEL 5MEPB 1X5IA 2AK1H 2NY0C 4LLDA 1WAWA 3HUJB 1H15A 4P5MB 4WW1B 5M03A 1N8ZA 5DRZB 5J9PB 3N9KA 4BZYA 3PABA 2NZIA 1M7IB 3TCXA 1WJ3A 3NN8A 1HCFX 4D6CA 1TJIH 4X7DC 2R2EA 4MNMA 4XP9L 3C5SA 5HDQL 3BP6A 3W0WB 1AGBA 2NTSP 4MVBC 4OZGF 1LO5A 4M1GH 5AD0B 5BW7A 1RIUL 1T1ZB 5DJ2B 3BH4A 2NXYB 4X0NA 3TT3L 5AAWA 4Y4KC 2XVLA 1LK3L 1ZANL 4KRTA 4I0PB 5T1KA 2H41A 3ZDZF 3OAZH 3ARFD 3NZ8B 5DUBA 4NUGL 4YDIH 4L29B 1NGYB 1BFSA 3DURA 2X2YA 4WUUD 3QUYB 4M7KL 5E8EB 3VIHA 5EZOL 1QOXA 3S3JA 1KNOA 3QIUB 3JTSA 3TNNA 1MJ7L 5IDIA 3D3VD 2DM2A 4JB9H 1B2YA 5I17A 4I77H 4EXKA 3U9PH 5BZWA 3T0DA 2PCPA 2PXYC 3ORJA 4JY5H 5J0BA 4OSUL 2V2XA 1ACYL 3WSQL 1Q0XL 3DWTA 1BG9A 4RFEB 1UT9A 1X5JA 2J6EL 1I1AA 1OW0C 1Z5LB 3VFGH 1H0IA 4ZPTA 4UQ9A 2Q3AA 3RY6C 4XI5D 4GMSL 4LEXL 5BVPH 1UADC 5FYKD 3BP7B 4ZS6C 3AZTA 1P7QB 3GBNH 1WBXA 4X6DB 3MYZA 3WJJA 3GJFK 2R15A 4H7VA 1ORSA 5LQBL 3MRFA 4RGND 1OD8A 2P24A 4KKAC 3MCLL 4AC1X 3P9LB 4FMFA 3WLWC 5JW3L 5DVKA 4OLVH 4ZUWA 3CTTA 1UCBH 4L8CA 4AIUA 1RZJL 4TUKH 4OCSH 1BVNP 1P9MC 3OJDB 2GK0A 3HAEG 1N3NA 1NFDA 4MLIA 2X10A 3QEUA 4PJ5E 3RX8A 4XMPL 4QCIA 1VPOL 4X6BA 2VX4A 1G9EA 4M62H 1Q0XH 1LE5A 5F1IA 1P2CA 5HJ3B 3M17A 5DEZA 5EZJB 1MFEH 4BQ3A 1AQDA 4JZNB 5A2IH 5D2LA 1UOKA 4QFUA 4HIEB 4GRLB 4X6BB 2J6EA 1OIMA 5HHQB 3UERA 4PGZA 4MZ3A 4JRYE 3SDXA 5HVWA 3H9ZA 4MA1B 1P7KA 4X4XB 3H9HB 1EPFA 2IPKA 1GJWA 1JPGA 1FN4B 3H9SE 4XGZA 5ALCH 2B39A 2PBGA 2YOCA 2AABL 3CHFA 1A6TA 3MKKA 1TJIL 2Q7YA 1Y18B 4M5YL 5E6ID 3U30C 3QEHA 3QNYB 2PO6A 5DEFA 1E4NA 1L7IH 4AMKL 3QHZH 3ULUE 2QPUA 1QSFB 2ATPA 4ODXA 4RISL 4DUXA 4H0IA 5ECJE 1IMHC 4G9FE 1JK8B 4HZ8A 1BIIA 1UB5A 4HX1A 2C3HA 4XCNA 5A6BD 3SCRA 1XF2B 4JLRA 2OZ4L 4JKPL 4LP5A 5C08B 1KJ2L 3P40A 1UD6A 3TTYA 2OTUA 2ZX9A 2EE3A 1V0KA 1NGPL 5C0JA 2QSCH 2Y5TA 4EBQL 3OMZA 5E2VH 4AIXA 4LHUD 3SE8L 2AI0L 3ZR6A 2VDKH 2VE6A 3MOAL 3U1SL 5IW1A 3LRGA 1ZU8A 3FQNA 5D7IF 1WFUA 3U83A 1S7RA 3SPVA 3IB4A 4JRXB 3RX5A 1MIML 2BS9A 4AMKH 2ITDA 3BWAB 5GGQH 4XAKE 3WN5B 3VTRA 1PG7L 2LABA 1FHDA 1SYSB 1UXSB 2CEQA 4CCCA 3QQ9C 1J0JA 2W0PA 4K3DL 5FUZH 3KWWB 1A6WL 3WO3B 1GOQA 5C09D 4NQVB 2PF0A 1PIGA 2ICWA 2GK1A 4HS6A 3ZKQD 2HT2C 3AB0B 1UZ1A 2WSPA 1GOKA 3SCPA 3HS0B 4ELME 1KXQA 1FG2B 4TNWF 4QCEA 4J2XA 1P6AB 4G43B 1FQ9C 2VDMH 1I8LC 4HXBL 2YA2A 4N8VB 1HCVA 1LEGA 1JZ7A 2WC7A 1N7ML 3FFDA 1A2YA 4YHPB 2R39A 3DV6B 2BNRD 3BKYL 4N1HB 3GO1H 2UZXB 1ZEAL 3JUZA 1MIMH 1XCTA 3L7EB 4GRMA 3N15A 3KYNB 3SDYL 3M1BA 4RE2A 4U6YB 5DD1L 2DD8H 1AO7D 3BIKB 4PRPD 1HWGB 1MFBH 2AK4B 2GY5A 4RGNC 1A6WH 5IBLC 1MRFL 1XF2A 1X5ZA 4D0BB 3WQ5A 2VITB 3MV7D 5HDRA 3WQ4A 5FCZA 3SGJC 3ARPA 4P46A 3VXUB 3EYQC 1QFOA 2BFGA 4J23A 1LO0L 4Z76A 3ALGA 3U6RB 3GH5A 1AD0B 4MSWA 4CADB 2IADB 1NARA 4AL8L 2HAZA 2QLYA 3NCYS 3QXWA 4GT7A 4IJ3C 2PTUA 4QXUH 1PZ3A 1LVEA 1ZT7B 3O6FA 3EOBB 4JFEA 2AJXH 3RZCC 4IRJA 3UO1H 3NFSL 1AI1L 1FRGH 3SDYH 4L1HA 1W9BM 5DT5A 1MFBL 2X4PA 1TCMA 4D71A 1P4BL 2A77H 4JKPH 2X9WA 4KZDL 2V2TB 4UQEA 2F58L 3RRQA 4OFKA 1G6RA 1SQ2N 1FNSL 4NBXB 5LAXA 4Q6YA 2X1WL 3QG6B 2IF7A 5E2VL 4WU7A 5C0FB 5BS0B 3F7PC 1D9KA 1BVLB 5EBLA 4NKDB 2XZZA 2GK1B 4QXUL 3CD4A 2FH8A 5C07E 3VFPB 1DQJB 5IWLC 4GAFB 3R8BB 3EOTL 4GQPH 1VFFA 1T2JA 3T2NL 3QIWA 4DGVL 1TR1A 3CZKA 4KTYA 1K4CB 4X5WA 1FRGL 3D25A 3W38A 1U2YA 4NOBA 5CGTA 4D0DA 4YAQB 2F54E 4S11A 1Q6EA 3M8OL 1RUQL 2PYED 1M71B 3LKPB 2X1OA 2JF6A 3Q5YA 3CMGA 1A21A 4OV5B 3I50L 5ADPH 2CSPA 2FZ3B 1YY9D 4XWOD 3IJSB 3ARRA 3WD4A 3MRMA 4PP1D 1AXIB 4HF5H 5L8LB 5FGSA 2VLKE 3KJ4C 4PRDA 1ZTXL 2GHWB 4JFXA 5HHOA 3V9FA 1W9UA 1RP9A 1QFWM 1UYWL 4NF7A 5IK3A 5KN5B 5B8CA 1KN4H 2APWA 4MJID 2WZHA 4G5ZH 3NTCL 1YEJL 4IPNB 4FQJL 5D2NE 3EMCA 1PGRB 3CFEB 1GJIA 5CZKA 1S78C 2EDOA 3FN0L 3BLPX 3HAEB 4NPYA 3VE0B 4M80A 1FV1B 3RWDB 3HC0A 4X4YB 5K33A 5E24E 5DD1H 2DICA 3NCJH 3S97C 1A6AB 2VI0A 1YA5A 4G6ML 3BOVA 4KTEL 5IOPA 1U41A 3HI1B 1RUQH 3VMPA 2WHLA 4P9HC 4IMLB 2GUOB 2RBLA 4PTVA 1JGDA 2YKLH 4G9DB 1E3XA 3TTOA 3CK0H 1Z2KA 3WDRA 4PIRF 1ZGLB 2AJ3B 4J28A 4K3EL 2QADD 4WIWA 3PTMA 3OAUH 4GXVL 3ZQ9A 1ZLWH 3IFPB 3MLXH 2AOSA 1W72A 3HFMH 5C92A 3R4DA 3THML 1T1YB 3SDDD 2VQUA 2W60A 1CL7I 4P9HL 3AXXA 1WBYA 5BW7C 1P4IH 4X6EB 4WHDA 1NCCH 3HZKA 4AK1A 3RMEA 2PNDA 2J8UE 1JE6A 4B7LA 1WK0A 3REVB 3LIZH 1FORL 2ZCLH 4M6NH 1NMCB 1H41A 2H26A 4NHUB 4DTGL 2J5LC 3U0WH 2WMPA 5EUOA 3O0RL 4Y1AB 4TOYH 2VLKA 2BSRA 5T3XD 5JXED 4KRLB 4QXTA 2YXFA 4ZUUB 5GRXG 4S2SB 5F1OB 4GIAA 3CUGA 2ZUMA 3FQRB 1CN4A 1HJVA 1UZ4A 2BNQA 4WU5A 4BK4A 3GNPA 1S78D 3SKUD 3I02A 2BSSB 1V03A 4D0DB 4JPIA 3QDGE 4I18C 1QA9A 2Y06H 5EIQA 1OAYH 2H2SD 5DMYA 3OA5A 3DOSA 5GGUB 2ESVD 2ZX7A 1GVIA 1UQSA 4X80H 1NEZB 3JV6B 4YHYB 5CIPB 3TZVC 1CGTA 4AD4A 5C0CB 5JOPE 5BZWB 3HE7B 3G6AA 4PJCB 3RWDA 3UTSA 4NDMA 4DTGH 2F53D 1HWHB 2YK1H 5EOCJ 1MUJA 1PYWB 4M6AA 2DQTH 3MLWH 3KJ6H 1G6RB 5D7JA 2HTLC 1KTRL 1G01A 2DDQL 5CBAB 1H1NA 4PG2C 4TVUA 3VGDA 4QRTB 1QR1A 1HQ4B 3QPQC 1DWIM 4PGBA 1IGMH 4LCWA 1BLIA 1HSAB 3VW3H 4RAUB 1JNNL 2DSWA 4JO2L 5D9PA 5FUOL 3SDAD 2GJXB 2IALB 4KWUA 4NZTL 3WH9A 4N8VG 3KL3A 3LN5A 4OZOA 1NFDE 1FCGA 4PJ5A 1PW3A 1I3VA 4G5ZL 3MV9D 5GISL 2WB5A 1NFKA 4P49A 4QRRE 3QIBA 3MPCA 1FGNL 1N2RB 2WMKA 3DXAD 4MSWB 4UOJA 1W9VA 1RULL 5MP6L 2O26U 5C0BA 4MD4B 2HLAA 4LSDA 4Q0XH 4R4NC 5H2BB 1GPOH 5DJZA 1GOOA 3LEYH 5D2LE 5KSAB 3BPLB 4R2GD 2DQTL 5FF6A 4FXLA 3KJ6L 1CLOL 3ARGA 3LH2L 3EYVB 4N1EA 4PRBA 3HUJA 1IFHL 3A47A 2CKBB 1IGML 1J8HD 1C1EL 4GFTB 3F4VA 1OSPL 4F9DA 1QW9A 2QR0A 1KXQE 3QA3A 4U33A 3RVTC 5TE7H 1XCTB 3BAKA 3D3AA 3THMH 1GC1L 3OF6A 5D8JH 5MERB 3OZPA 5IMLB 3EBVA 4KRPD 5L8KB 4MA1C 1BIIB 4QLJA 5J8OA 2F54D 3KLAB 3H3PL 2BVOB 4D9RD 4W6YB 3WNLA 1JBJA 3LIZL 2HN7A 3PL6A 1BM3L 3FN3A 5CHNB 2W38A 5DEFB 4JEGB 2YLLA 1DQQB 4U05A 4UIMB 3N85H 2Z92B 5C6PB 4NCC2 3ZJ7A 1PD6A 1RZFH 2L7JA 4UQ2A 4RFNC 3W9EB 5IFJB 1ZSDB 5DMJB 4XVUD 2G2RA 4KKLD 1IFHH 1A47A 4LRIC 2XI9A 2BVDA 4NZRH 1QYGH 1IKFL 3RGHA 3WQ6A 5D2NA 4C59B 1HL8A 3SDCD 4PJAA 4BQ2A 4ONOA 4KQ3L 3T8XA 3BYTA 3UYPA 2HLFC 5EZLA 4XPHH 1EHLH 2D23A 4HKXB 5E94B 4WGVB 4YDJB 3S37L 3CSYB 1VHPA 4M3JA 4OLXL 4FF5A 4M93C 1C16A 5MENE 3FB7B 5BROA 2R1YA 3OSKA 3SKMB 3WD2A 4OLEA 3KPRA 5L2KE 3FMGH 4WEMB 1YNKL 4IRZL 4QRSA 4JY4B 3DROB 2O5YH 3P73A 2CIIA 2QHAA 2EXYD 2ZUYA 4YHEA 2ZKHL 1IT9H 5JPNA 1BFVL 3X3FL 2H6PB 3P77A 3RY4A 1E4LA 1KIRA 3KPLA 2XWTB 3BKJL 2CPUA 1KB5L 5C0GA 3TEUA 4HWBA 3TA9A 3GI9H 1CGWA 3DXAA 4NQUA 3EJYC 4UIKH 1UKQA 1ZT1B 2CR3A 4E41E 3VIIA 4Y2DC 5BXRA 3DVGA 3HMXH 3G6MA 1UACH 3SGJA 4IEFB 2OR7A 4GG6E 2W9EL 1RD6A 1MCNA 1HNYA 1JYNA 4N8CL 4Y5VC 2J7LA 1A3LL 4APQD 1OL0A 5DJ0B 1T0PB 1CLOH 3BGFC 3MXVH 3BHBA 1VGEL 3FQNB 1IAIM 3FQTB 2O9OA 3HHRB 3JV5A 4JAMA 3GH7A 5F44A 1R3HA 1ZVSB 3BIAX 4IRSC 1NOFA 1DLHA 1W2KT 4FRWA 3WD3A 4FXKA 3BZ4B 1FH7A 4WWKD 1DTUA 2ZG3A 4FQCL 1WC7B 3DVNB 5ADOH 5C0EA 2VRQA 4R3SB 1EGJL 2DDXA 2M26A 3DVGB 4NBYB 1YJDC 1B1YA 5DJCB 3IJ8A 3IAQA 1MH5B 1K2DA 3MLSH 1G7QB 4UZGA 3C5SB 1QOKA 4Z7VF 3UTZB 5INDB 2W5FA 3IFOB 3MRFB 1UACL 5KSAC 3MGAA 4EI5A 4XP1H 3ZE1E 1XH1A 3PIQB 3K80A 4JG1L 2HJLA 1H5BA 2OI9C 1D9KC 2OSWA 1EGJA 1B30A 4HZLB 3BPCB 4HOZA 4WW1A 3BZFA 4CMHC 1RUKL 3UTOA 2VDPH 4PMRA 2B0SH 2W63A 1SJXA 4XRCB 3ZDYE 1E6QM 1VERA 2XQYK 5GHWL 1DWFM 4XBGA 3FB6A 5IMOA 1YEIH 3GSVB 3SE3A 4OZIF 3DI3B 3L5XH 4Q9QL 1J9YA 2YRZA 3QOKA 3VMOA 1EXPA 1OCWH 3RIAF 4W86A 3Q0HA 1X1NA 1OF2B 5IV2A 4O58L 2R29L 4L9LB 4JFQA 2XSAA 1C8XA 4N8PA 3AZRA 2PYFB 3CSPA 1T66D 4KKAD 4ALAL 4X7SH 3HPLB 4XP1L 1YZZA 1JGIA 1AQKH 1IEBB 1NLDL 1MCSA 4O5LH 5I1JL 5BMFL 1N2RA 3CXDH 4RGOH 2XPGB 3FMGL 2DEPA 3CMOL 3EBAA 4UB0L 4D6JA 3OLEA 2O5YL 4R8WL 2XZQL 1GCYA 3MLZL 2JIXD 4GXPA 1B0IA 1HHKA 5BOPA 2D2OA 3L3OA 3O9WC 1NMBH 5SWSE 2XSBA 2W0FB 3GKWH 1FL3B 2W65A 1KCVH 5EBWA 4AD3A 2FDBP 3GI9L 4TVCA 2CIIB 3CDYA 3WS6C 4O58H 4WI3A 3RVVC 4UIKL 3PTKA 1S8DB 3MUHL 2PWEA 3AROA 5I8OH 5F1NB 1GOWA 2WM0A 2DLTA 2I25N 5JBDA 1AQKL 1ITXA 4X7FC 5C0CA 3HMCA 5EO1B 3MUIA 2C4XA 4RGOL 2JIWA 2QR0B 2Y07H 43CAB 3SDAA 3G08B 4AD1A 3GBEA 3ZE1F 3K8KA 3WF3A 4FLOA 1ZK9A 4Y4KA 1H3PL 1T66C 4OBRA 4PJ8B 5A16B 3S3PA 2IG2L 2BP3A 5A2KH 4S1RL 2HJLB 3LPPA 3V6ZA 3IFLL 1KCVL 1LDSA 5L7XL 4FQIH 4JANB 5ANMA 5CSZB 1FBIL 2KUTA 3K1KC 3MLSL 1E55A 3MBEB 1LO5B 1N0XL 2I9TA 1M05A 1F11A 5BXFA 2CERA 1MCEA 1ZHBB 2YPKA 3S88L 5CD5C 3QXAA 4YXKH 4Z0XA 4MX7B 4JG1H 3VD9A 3LKQB 1JHTA 1NSNH 1TMCB 1PX4A 2V7HA 1CF8L 5C9JB 4X7CC 5DHVA 4PTTA 3UROR 5JXAL 2XFXA 3C8HA 5D1QC 3DX7B 5A43C 1TNMA 4QHKJ 3QDGA 4JPWL 5T5NF 4Q2ZB 4KRMB 5GHWH 2ZPKH 5CEYA 3H9YA 3PWNB 4PTUA 4BFIB 3IFLH 4QCIB 4OGAC 3LS4L 1XF5B 3U4EB 2A73B 4K7PL 4LLMA 3GSOA 4LEOA 1FBIH 4IRJD 3CHEA 2NTFB 1S5HB 3G9VA 4JE4B 5JA9A 4OM1L 4N42A 4NNYB 2R23A 3QH3A 1Q94A 4ZXOA 5GGUA 4M6MH 4OOZA 2DQDL 5DFAA 1FO0B 4P5TD 3QXUA 3ARSA 3AAZA 1JRHL 1CDJA 4PSRA 4G3YH 3RM4A 3DUSA 5BMFH 1FP9A 4HOXA 3SCNA 1MAMH 3BPNB 1CF8H 3HZMA 3QAZB 4QNPF 1UWTA 2VXQH 1BHGA 3BEWB 4V2CB 5A3HA 5ALBH 4HBQA 5SWSD 1HQRA 1YEFL 4CVXB 5C71A 4AZIA 4MWFA 5SWQA 3O41A 1BWMA 4RGMB 3LMJH 1DL7H 3S34H 4E41A 5ABDE 1NBYA 4GAYA 5D7LB 3QDMD 3AGVA 2JIEA 3NSNA 5C09B 4PJEE 1DBJL 1XGRA 3PWJA 1Z0NA 4XCCL 5DHVH 4JHOA 3LRHA 3FCTB 3WNKA 2Q8BL 1EQPA 5MEQB 4UAOB 3LN4B 1EDQA 1HXMA 5DFVC 1OAXL 3BE1H 1XGQB 5EOQH 1REIA 2WNWA 4Y5YA 4V2XA 4R7DA 3UTSB 3WNOA 3GMMB 1UH2A 1I8KA 3PGFH 4PEEA 1KT2A 2Y25A 1QFHA 1MLBA 4OF6A 4IRJC 3TWCL 4U5IA 2XZCL 3KPRD 3WN6A 1CFSA 3BSHA 5CWSB 4JVWA 1FC1A 4Q9CA 3HI1A 1CG9A 4HJ0C 4M7LH 5DTFB 5B4MC 2VH5L 3BSGA 4F37K 5CQ1A 5DZNA 5KOVC 3U82B 4XV0A 1FE8L 2QQLH 5F7MC 2Q8BH 1ACZA 5D4YA 1N0XH 1CGXA 1CLYL 1Z9OA 4MJ5B 3WFCL 4UTAH 2Z35B 4I13B 4Z7QF 5IQ7L 3LKQA 5EOQL 3SCUA 1EHNA 3B4NA 2R0WL 5C07D 4PJHE 4UFKA 3EDKA 3PGFL 4DJMA 1VACA 3GSUB 5IMKA 4NC1E 5I30H 1JZ5A 5JHDA 4KI5C 5JXAH 5DJAB 5LCVH 2Z4QB 3S96B 1EFQA 5FYJH 1GQIA 1BD2D 3SCVA 3PZGA 2P8PB 3BIBX 2IXUA 1QTYT 2C7UB 5I1IL 2ZCHH 1HOCA 4P3WA 4ZPVB 5DJZB 3CZLA 4BZ2H 1BYDA 4Z5RA 1I8LA 1KPUA 1I1FB 2D20A 4MJ5A 1CEOA 2FJGA 1T0MA 4BSVB 2DQDH 4HC1L 1ZA6B 4PJAF 3QUXD 5FYJU 2MQCA 1JRHH 5K59E 3OLDA 1UEMA 1YEHH 3RIFF 1OTSD 1CDIA 4R90H 3CLFL 5E6YA 2VDRL 3D69A 1KG0B 3N1MC 3UDWA 4MQTB 3KPMA 4D0CA 5L6YH 1M4KA 2EDNA 3D3VE 5D7SL 3MJGX 4N68A 2VZ3A 4ETYA 2ZUNA 3C9NB 4QRTA 4HFUL 1XIWD 3RL2A 1KIQB 1VBRA 3LMJL 4P7QA 2WCGA 3GMMA 3OKMB 3AIQA 1MCHA 1SFSA 3STBA 3D85D 1V05A 3IU4L 4ZNCD 1EA9C 2ZOLA 3BFOA 1RH9A 1QSEA 2EH8H 3W37A 4AZ6A 1JHKL 1WTLA 4NQDE 1IAOB 1MI5B 4P23B 4HUMB 2G9HB 2BNJA 4G7YL 4MVBD 1HHJA 2FWOA 5AYUH 4DN4H 3SDDC 4F3FB 3R1GH 1AFVH 4G6KL 4DOHB 1FJ1B 3GXDA 4PMXA 3OXSB 2Y7QA 1U8KA 4ZAKB 5F9WB 1DEEB 4MWFB 4Y5VB 5SWQB 1NLBL 3AYRA 1ND0B 4M6OH 1B3WA 1HQRB 4WHCA 3SUVA 3BGFB 3KYAA 4ZTPH 2O61A 1DQJA 2JALA 5HPCA 3D2UD 4Z7OE 1D6VH 4B3LA 1GZPB 5GZNC 4I3RL 3T0WA 3DO7A 2MCG1 4ZDHB 5JHDB 4U6YA 3OV6A 2VCAA 4W84A 2DQIL 2VRAA 3B9KB 3AQUA 3LRSB 3OG6B 2R2CA 4WUUB 4HV8A 2UY6A 1WKYA 2KQNA 1KCRH 3F12B 1DUYB 5CZVH 3WELA 3SIMA 4ZO7A 5E8DH 2DQCH 1MJUL 3KPPB 3VFWB 4CAGA 4LRNH 5DK0B 5CLTA 4F7MA 5CEYB 4A3HA 4GG8A 2X05A 4BUGA 3SBWC 2QEJA 2X70A 3KDMB 2DLIA 4C7GA 3VXQB 2O5XL 1T80A 3MLYH 1CZ8H 4IOIA 1MYRA 3WF1A 4KXZH 3WFLA 1ORQB 2V7NB 4NQEA 4S0SD 5C6WH 2BMKA 5IR1B 3WEMA 4BZ2L 1XGUB 3WE6A 1T89C 2E6JA 4JM4H 1NEZG 4OZFA 4YK4C 1ERNA 2FGWL 1AR1D 2R56H 1GL4B 1DVFD 3OZ9H 8CGTA 1HH9B 5IFPA 4HLZH 2IFFH 4L9LA 3ULUF 1XH3A 2HRLA 2BRQA 1RPQA 2CDEB 4JDVA 4ORGA 3VI3F 4KKBC 4M93B 4TQEH 4Z2JA 3D18A 3OKDB 2J6EH 3MMEA 5HGGS 4JRYD 3ULUH 3S98A 4KMQA 4GJTB 4OCMC 2VDNH 1FVEB 2A9ML 2QMKA 1MCKA 1MHEA 1S8DA 4TSAH 2Q86A 2CGRH 2J8UB 1F3JA 1F02I 3TPUB 2ZICA 1O6IA 4GAGL 5FUCE 1K9EA 1BPLB 3O2LA 1GOMA 1UWIA 3BP7A 4JFUA 3V5HA 3L4UA 2FEDC 3HE6B 4TUKL 4AZ7A 3IJYA 2XM2A 1LL4A 4LP4A 5DMIL 2HH0L 1VEPA 4G6KH 2WC3A 1PY4A 3BUYB 4W7UA 4LBEA 3V5KA 4HWEL 3ZOAA 1WWCA 3V6OC 2EDLA 5FYLD 2Q8XA 4UZUA 2V5MA 4GSDL 5HYJA 1A7RH 4FXKB 5CILL 4OIAA 5INCA 1YECL 1XIWA 4YHZH 1P4LB 3ILPA 3SY0B 3L4ZA 1KC5L 4P8XA 2VNCA 1V3KA 3MRIB 1A22B 4G8IA 4FXGA 4QXGL 1I4FB 1A6ZA 4XNQA 3DURB 4RFOH 3WUWB 4FTVD 1CDGA 2HVMA 3V52H 1CL7H 1T7XA 3PQYB 4ZS7L 1FLRH 5J6HA 1DLFH 2WCSA 4FHBD 2XYLA 1D5XB 1N3NB 3AREB 4U1LB 1MRCH 4OD3L 3GSNB 1BQCA 1FGVL 1U42A 2ZCKL 2CLZB 2R0ZH 1C7SA 1EK3A 1MLCB 2HVKA 3EFFA 3VXPB 5ITFA 3KPSE 2R2HA 3QI9A 1RZIA 2Q7YB 4YE4L 4MNGE 4NM8H 2A6KB 3VXUA 4Y4HD 1WPCA 5DRZA 1G7QA 3B3IA 1X44A 3H9HA 1KC5H 4N0YL 1Z5LA 1L4IA 5EUOF 4YBLB 5GRUL 5H37H 3D39A 3NIGF 3PP4L 2AXJA 2DQUL 4XWGH 1CXEA 1NGWB 3BN9D 1W3JA 4G42B 4YXLH 2BK8A 1NBVL 1MCQA 4PR5B 1OAZL 3VXRD 1DLFL 3VD7A 4NC2B 1KLGA 2HJFA 3V8OA 1NDMB 1AR2A 1NBZB 2J4WL 2FCBA 3QUZD 1NL0H 1MRCL 5E94A 4WW2A 4ORGB 32C2A 2VN4A 2XTJD 3TA3D 1JF6A 3IETB 1GAFL 2ICWI 3LQMA 2D03L 2CMRH 2ZCKH 2CIKB 2RCSL 5DWUL 3SDCB 3LOWA 3WQWA 1SJEB 1A3RH 5DF0A 4NP4H 2FIKB 2L7UA 4D3CH 3IXTB 2ICEA 5I1AA 4QOKD 4DGIH 4OQTA 1UWGH 3VIKA 5JXEC 1YN7A 3G5XA 1UZ6E 4OUOA 2QKIB 4D8PB 1R7AA 4YEFA 2P5EE 2D7TL 3HE6A 4E41D 5FKYA 4UILH 3AHTA 1G7HA 4NYLA 3QISA 4I4WA 5KSBA 5KVFH 3MV11 4WWKC 3H3BC 3DLQR 4ZPTB 4GINA 3E3QE 2UYLB 1RIHH 3QNXB 1QVBA 1U8MB 2NY5L 1RJLB 3OTTA 2D03H 4ETQB 1F6FB 3V5HB 1G6RH 3QCVL 3A6CL 3RWFA 5LWYH 3DV4A 5GGSA 1UQSB 4OZHB 1AJ7L 4NO2A 2R0LH 1ITBB 3SKMA 2YSSA 2AEPL 3DX6B 3N11A 2WBKA 2D7QA 3GM0A 1KLUB 4X99A 5IB4B 3NIDE 3R8QA 1NM9A 1B2WL 5T1DL 4NWUH 3TBVA 3D9AL 2PB1A 2QV4A 3QPQD 1NC4A 5EO0B 4ZS7H 4AEIL 4QCFA 5IHUH 2DKUA 3VX1A 1A9EA 3BN3B 2FJFA 2A3AA 4UQAA 5CS7A 1JNLL 2NY5H 1IC4H 3VI4F 1L0QA 2L4OA 3W9EA 5I76B 5HHPB 1G6RL 2V3EA 4NFDA 1HYSD 5E8NA 3IRZA 3MLVL 1FHLA 4NQXA 2VERN 4NN7C 3LN5B 5LGHL 4KJQC 2X44D 5T5NG 1FZKB 3KNBA 2R2BA 3QFDB 2DTML 2EE2A 1ZKAA 4NO0D 4EUPG 2GVYA 5I1HL 4O02H 4X99B 4O2EA 1I3GH 1PEZA 3PG2A 3LMYA 2PYEB 2ADJA 4XP5H 3X13A 4LGPB 1MHHA 2XN9B 3QRFM 1AY1L 5HVHB 3PXJA 4R27A 4ERSH 5IHUL 2V2WA 1OT1A 4FFVC 3T2NH 1LMKA 4UDTB 4HUKB 4Y4HC 2ADIB 4JFDD 4KV5E 2EKJA 4ELMB 3UEQA 4JM2D 1JNLH 3JV6A 1OGSA 4DM2A 1RAMA 3X17A 2RCSH 4PRNB 4H1LA 4XPAL 1A6AA 2BNRE 4PV9A 4YC2B 1T04A 2NY7L 4QYOB 1IQDB 5GS1B 1IGCL 1MFAL 4G8GE 5JW4Q 2J2ZA 2H6PA 3ZL4L 2BSSA 3TM6A 4RBPH 5FCSH 2BDNL 5C0AE 4AEEA 2J7FA 1Q1JL 1G9MH 1MWAL 1JWSA 3CFKB 3E6HA 3H42L 3U46A 1W9DM 1NCNA 4KKLC 5L2KD 4FP8H 5JNYA 1UR2A 2JFEX 3BRFA 3TO2B 5BRZA 3G5VB 3VFVB 3GSXB 1MCIA 2FWOB 3TV3L 3LKSB 1W1TA 3NA4A 4P4RB 3TTSA 1NKOA 2M1KA 1AC6A 4PJBB 1TQCC 3SDDB 1GQLA 3MV8A 1C7TA 4F8XA 4NZDA 1BFNA 4FQHA 3ZDZE 1OP5K 5FOJA 1CXKA 5I77A 3D69B 2YKLL 3LQAL 1KSRA 1HQ4A 1WO2A 1FO0A 4K3EH 4Y16A 5E5MA 1QFWH 2FHBA 2HKHL 3MX0A 4X98A 1AXTL 2XY2A 4WFFE 2ZJSH 1IT0A 3S35L 2H2SC 5JW4N 4WKAA 4QTHA 2FO4A 3UBXB 4KK5D 5DC4B 1HEZB 1W1PA 2E8ZA 4Y1AE 4JO3L 1NFDF 4F9LC 2OR9H 4ZXBD 1YEGH 1J1XL 2D0HA 4X4YA 1H3GA 2WHJA 1NCCL 4BFBD 4OZGB 3MR9B 4YH6A 1BGAA 3GMRB 5IVOA 3RILA 1YQVL 4BFGA 1E5JA 1TA3A 2XM1A 2YA1A 3O0RH 5FA4B 1W0VB 4PRWA 2A0LD 3AZSA 2AK4E 4ZFFB 4XC3L 3ROOA 3LEXB 1ADQH 4NQEE 1ISYA 3WHE1 1NBYB 5GGRA 2P49B 5EFIB 3O6FB 5HOSA 4HK3J 2R4RH 3C2AH 2MSPA 2J8HA 1KB5B 2AJUH 5FGBC 5D2NC 5ANMB 5CEZE 1E73M 1CE1L 1W9XA 1V3HA 1A7NH 5KANG 1T1YA 1KGCD 2Y6SD 5SX4H 3W11D 4OAWA 2XVPA 4ZFFA 3NIGE 3FAXA 1H3TA 4JY6A 1FVCB 3BDYH 5GZOD 3WFBL 4WSJA 4BK5A 5KVMC 5T1LA 5TE6L 5HNNA 4R2GC 3BQUA 4QLLA 2KDGA 3O3EB 5E7BA 2D3NA 4IM4A 3VH8A 3M1BB 2WHKA 4OT1H 5CCKL 1I7RA 3V0WL 4X0KB 3JUGA 2ZUXA 2X4UA 3P9MB 1IQWL 1CR9H 1J8HA 4GPNA 3KPOB 1KJVB 4IOSD 4P5TB 3VXNB 1QRNE 1IC5H 2AJUL 1FZMB 1KIQA 3LV3B 3TPUA 3QDGB 3LN9A 5GS0D 2X4RA 3PWJB 4K7PY 1BQUA 3RAJL 4JFFD 4YHYC 1ZBKA 1RJYA 1J8HB 4LAJH 3BEVA 5IVXF 1FGNH 4Y19A 4R0LA 1BF2A 1WTGT 5KG9A 3QHNA 4HS6B 3HZVA 1C08A 3MRHA 1OM0A 1YY8A 1XGRB 2YUWA 5F1KC 1XH3B 1C5DA 3KE0A 4LPWA 3HU7A 3VM5A 4D9LH 4ZAKC 2P44B 1BQHG 3O45A 4KUZL 1F8TH 2F54B 2FJGB 2IADA 5DMKA 4AEHL 2B2XL 5CJBA 3ILQC 4UUJB 1WIUA 3TBTB 1JYXA 2EE9A 2FSEA 1OGAB 4IHOA 4Q97A 5LGKA 4NO5B 1IC5L 1YMMA 5EH1A 3BEWA 3F5KA 3SUWA 5D1QB 4G6FB 2AV1B 1VKXA 4O2FA 5D8JL 1V7MH 4M8QA 1Z3GL 1HHGA 4H20H 4Y5XA 4F15C 1EVTC 4E4PA 3D0LA 5DRWB 3KLHD 1YMHB 4PRID 3AREC 2FLBT 1IBGL 2BVQA 4FG6C 3QGVA 3WYRA 3MOQA 4XCFH 3RDTB 4AIZA 2XFXB 5BS0A 5I71B 3VIOA 3ALWA 1QLFA 3SGEI 5IB1A 1IKNC 5B38B 2R9HD 2YWZA 1D3CA 1WZ1H 2WLYA 1PKQB 2WQRA 1GONA 3QO1A 3UTZA 2FD6L 4ZUVA 3OKEB 3Q6FA 1RSFA 3QDHA 1D7FA 1WQVT 4KJYB 1A7NL 1JDDA 5EU7E 4R3SA 4JREB 3OG2A 4J4PC 1MEXL 3QFJB 2YRPA 2FGLA 2VRKA 3G6JF 2Y36L 2ARJB 5ETUB 3ARFB 2A38A 4KUCD 5IM7A 3PDDA 1A9BB 1LE5B 1H09A 4XCYA 3EYOB 1EEZB 3W25A 2OSLB 1OIFA 1B3JA 5EFDA 5EFFA 4TVPE 3RNKA 5LA2A 2HVJB 5KZCB 4I2XA 3LKSA 1BQLH 4NFBA 2NY3C 1II4E 4NNXB 2NLJA 1NGZB 1YNKH 4IRZH 1FAIL 4QLRA 4GAYB 1I9JL 1OAKL 1ZWIA 4FQ1H 4JAWA 1NPUA 5KSUB 1FP5A 1UG9A 4F33B 4CL7A 4NJ9H 1I9IH 4HWBL 4QTIH 5DQDH 2NY0B 4YGVB 3C9NA 4L1DA 1MWOA 5EBWB 4QY8B 3CVHH 3WO4B 4YAQA 4G6JL 2J7CA 4L4PA 3T3MF 1P7QD 5A6JA 1H49A 2NT1A 4H88H 5IROA 1E0XA 2XPKA 4FFWC 1E0VA 1WWBX 3IFOA 2G60H 1D5ZB 3MNVB 4AIOA 1YN6B 3MRNA 4RGNB 1JRHI 1PLGL 2W65B 4J4PD 1JNDA 1JTTA 1FFQA 4EAMA 2EIZB 3FRUA 3L3HA 3K8MA 3BP4B 3GSNL 2GJ6E 1QVOA 4X9HA 2EDBA 4GRLA 3RL1B 3JTSB 4RL3A 3H0TB 3A6OA 4Z7UE 3AJ7A 2P43B 5CGYC 5D5MF 2AJZA 2AK1L 1VF8A 2DT2A 2BVPB 5DJ8B 3T1FA 4BH8B 4UQ3A 2HMIC 4YDKL 5F96L 3PHSA 3CVHL 3KPSD 3IT8D 5IVXA 3FO2B 1HDMB 4H88L 2DWEA 5JOFB 4GG6B 2YPKB 1JN6B 3U7AA 3SCMB 5GNXA 3GSQB 1DQTA 1JK8A 1J86A 1PLGH 3CH1A 4MD0B 5JHDD 3DHMA 3IKCA 3K7UA 1LEIB 4CN1A 2A3HA 1JHLL 5CJOH 3MV8E 2OMNA 3U9UA 4F7TA 3CJJA 1R5VA 2IWGA 3BUTA 3UBXG 3EKCA 4NO0A 4Y4HA 3PWUB 3ZKXC 1JPGB 1QRND 4QRSB 3IDXL 1TZIA 5JMOC 3P11L 1FFNA 3QI9B 2E3VA 4Q7DA 4ZUSB 3X3GL 2Y36H 3IDJB 5I8CB 1Y18A 3QA3B 5EU6B 5I1CH 2OTWB 4OGZA 5F7EH 2CKBH 1T2QL 4O51A 1UVQB 2CK2A 2IPKB 4ALAH 4U6TA 3W26A 5JLZA 5EZIH 5ELIA 1DFBL 4HFWB 1KIPA 5EORL 3L5JA 2C3VA 3F7YB 2HFEA 4MJ6A 2NXZC 1YPZA 3V0AC 5I75B 1ZHNA 3H3KA 3M07A 1V3IA 4R8WH 1TVBB 5F7UA 2BV9A 5BRZB 4FQ1L 3HRZA 4MXVE 1NP0A 1FNGA 1CFNB 3FQTA 3K81A 2VLRA 3MRNB 3RTQA 4WIQA 3C6LD 3LKRB 5C2UB 1DSFH 4NRZB 3BP4A 1NFDB 3MCLH 4L5FH 4WNQA 4HXAL 3W0WA 2RR3A 3BWAA 1UCBL 1LK2A 4XAKD 2C8NA 4P7RA 1M7XA 3BUYA 5BRQA 1YN6A 2J88H 4R26L 1G84A 5CBAA 1L7TH 4Y5YC 1ZOXA 4CMMB 4PRAB 3F7YA 4MJ6B 1V6UA 3ARWA 4H1LB 5EORH 4DVBA 2WAHA 1JWMA 2WVUA 5T3XL 3AICA 1PYWA 3P0VL 5MENB 4RX4D 5IMLA 5D9OA 4DGYH 1OTTD 1X5AA 1XC6A 1QFUL 2FGZA 3FFCA 3MRGB 1QLEH 1H3PH 2IAMB 4MCYB 1JZ3A 4I5BB 3O9WA 2IBZY 4HBCH 4Z7OF 4PTUB 3MCKA 3N1QC 4HD9A 3GSWA 4P2RE 1JYVA 4JZ5A 3OGCA 1TZIB 1WB0A 1AP2B 3V4PH 2Y1VA 4E42A 4G9FD 4MXQC 3G5YB 4FLRA 3MV7B 2VLLA 3I02B 3PGCB 4U4BA 1GVYA 1R5IB 3QWRA 4P2OA 4MPKA 2YBRB 4POZC 1VADA 1MLCA 2HVKB 3OKLB 4QF1A 1MNUH 4P9ML 1UG6A 3BD4A 1Z0MA 4PRIE 5AD0A 4C58B 3ARDA 3TA3C 1ACYH 2DWEB 5JOFA 2VIRA 3CH8A 5FV1L 5C0EB 3OLIA 4XVTH 5KTEL 1MIEL 2JEQA 3KYKH 2ZPKL 4XNUL 2MQ3A 1TQBC 5I73C 1EAJA 3P2TA 3AMLA 5HVHC 1E6XM 4S1QL 1P4LA 2DYPD 2AI0H 1BD2A 2NZ9D 2PO6D 1Q6DA 1XV8A 4CVZB 2AEWA 5D6DC 4AW7A 3KPNB 4OCSL 4M6ML 3NA9L 1J11A 1RZGA 4ZXBA 4FMKA 1U0QA 3MREA 2WZIA 1I1WA 5T1MA 4R7NB 3SKNB 1FL5B 2KQMA 4EN3C 1K6AA 1EXUA 3MRKA 3FO1A 5AUMA 4WWKA 2EXWC 4XHJC 3WS3B 1JIBA 1QA9B 3HAEH 5DUPL 1X4XA 2H32B 1MIEH 3FFCB 4X4ME 4P2CG 1XCQA 1X5FA 1PG7W 4G9FA 5ESAA 1P7QA 1LNUB 4R0LC 5IB3A 3MJ7A 4JZOB 2CITA 5K9OB 4KKCC 5D1XD 2KBGA 4YR6A 3QB7C 3UP1A 3QCUH 5FIEA 2HRPL 4FFZL 1FNGB 3SKOB 4J7RA 4ZUTA 4D1IA 1JI1A 3OGVA 1L7TL 1JPST 1MCJA 1O7SA 1OAXH 3WMBA 1T83A 5DVLA 4IM8A 4L8SB 2YLAA 1QSED 3GHBL 4OV5A 4R96B 4RISH 5A6MA 3AM8A 1DVFC 3SE4C 4KHXL 4OCWH 1OARH 2X4UB 4LCIL 1RU9H 1XF4A 4I2XE 5E0FA 1KLGB 4HBCL 1KCUH 3ABZA 3ECBA 5IB2A 3PN8A 2JELL 3GRWA 1FAKT 5DS8B 4KJQD 1MJ8H 2QSCL 5HY9B 4F37F 1EBAA 3GIVA 3RTQD 2RGMA 4I0PD 3NCYP 4LCCA 5B39A 3TBYA 1ZSDA 5I2UA 3OZOA 4PMOA 4NQED 3L4VA 3E3QC 4KMTL 4M5ZH 1E4IA 4PJCA 1JF1A 4ZD3L 2AK4D 1EAPA 1F90L 3OIHA 1TZHA 3BVNB 3OBAA 1ZA6A 4FQXB 4YO0A 2J74A 4MNQA 4L3AA 3U9UB 1YNTA 3ULUD 1WWWX 1HF6A 3U57A 4NKMB 2PW2A 1A6UH 3DX8A 3FQUA 4NT6B 1X3DA 4FZEL 1T21B 3PWUA 5LCVL 2W0KA 3S35X 3DBXA 4WUUA 4AZGA 2JJWA 1CD1B 4GZEA 2OL3H 4EQ2A 4KZDH 1KJMB 1Q9LB 1N5AB 5I15L 4ZOEA 4WI8A 3HZYA 4ZOCA 3MFFA 4B9YA 3AS3A 1KB5A 1S9YA 3QCTL 3BZ4A 5HD8D 4HKJB 3AMDA 1N7MH 2PETA 3BPOB 3BCDA 1QQDB 4L9LC 2C4FU 4NT6A 1WBYB 5LBSH 5HYQA 2J12B 3S4SG 4KDTC 1EERB 2XN9D 3ME0A 3BT2L 2X4TA 4Y19E 1BOGA 1CTNA 2DD8L 3LPWA 4MNHB 1E28A 4H8VA 3JWOH 4AQOA 1ZHLA 5C09E 4HUXB 5D7SH 2B1AL 1E6JH 4JFDB 5L2JB 3ECQA 1I8KB 1IGIL 4DKEH 5FO8A 5J7CC 1I1YA 3C8KB 5IEHB 4J3TA 2ZP0T 1WV7T 1ZLSL 2EPOA 4ZYKA 4ATWA 3SJVE 4C4KT 4FA8A 2VLJD 4ONFL 1N6QL 9CGTA 3EJZD 1QNPA 1UYWH 4LSVL 1JHKH 2NR6D 4EVNA 1XF4B 3GZKA 5F72S 2GFBB 2QQKH 3EO1B 2XA3A 3DHUA 4XMKL 1F4WL 3S5LG 5IEHA 3E2HC 4GW5B 4HG4J 5I5RA 3EZ8A 3QIWC 5IESH 3GHBH 1UWUA 3NFSH 4OLUL 3GHEH 3BT2H 4OQ1A 1ZHLB 3GYCA 2P47B 4JFDE 4LNRB 1KXTA 3MXWH 3SUUA 1CI5A 5EZLB 2VZUA 5TDNA 3RHWF 2ORBL 1MCCA 3OKKA 5E99L 1E6JL 5FKPA 5BV7L 1AGFB 4DKEL 3OAZK 4A6YH 2KL6A 2EEDA 4JZOA 1AKJA 3WMCA 2OWWA 4K3GA 3VGGA 1WISA 4KC3B 3NIDF 3WD5L 4NKQB 1XD1A 4KMTH 1X5KA 4BQ5A 4KAQH 1OP3K 6CGTA 2CBJA 4QP0A 5D5MB 1XF5A 3U4EA 2NQCA 1SEQL 2HG5A 4H1LH 1RUMH 4KK9C 3P4OA 1T4KA 3RUGF 4DGVH 3HZYB 4DCQB 5EA0L 1KCRL 5DSCA 5TPWH 1DHKA 1D5MA 2IFGA 3BXWA 5DUML 3VWKB 3ULSB 3UTQB 5BZDA 3WUFA 5HGDB 3GSRA 4U3CA 3S7GA 4Q6IB 2I07A 4LKCB 3L3GA 3WDJA 4OGYL 1B4RA 1FA2A 5E1AB 5C0BE 1TVNA 3MRBB 3EFDH 4LKXB 4YIQA 5TE4H 3BQUC 2NW2B 5C86A 4HWUA 2AJSL 1JD7A 5AG8A 1ZLVH 3IF1A 4LLAA 2D0GA 1JF1B 1XCWA 1WDQA 5A8MA 3ULUC 1F11B 5BXFB 2R8SH 3NBNA 3DC0A 3NFPB 4Q6IA 5HDBE 3VIFA 2UUDK 1HKFA 4KAQL 4WFHD 4OI7A 3ARZA 2UY5A 1G9NC 2VR9A 4HDIA 3ARFC 1UYQA 1V8HA 2DQHL 5IG7B 3ZIZA 1OAYL 1QLRA 1RUML 4B7IA 2WIIA 2R56L 3AY4A 2YD2A 2H8PB 2IPTH 5DI8A 3ZHDA 3MRCB 1SVZA 1FDLL 3G5YA 5LBSL 1U3ZA 5DGRA 2I9TB 1DDHA 2LAGB 4QHNA 1P2CB 3VMNA 3NABH 2ADFH 5HD8C 1XD0A 2OBGA 1F4YH 4K3JH 1HL9A 3PTQA 2WHMA 3MZGB 4F3FA 2OYMA 2VDNL 3BPNC 4YZFE 5TE4L 4CW1A 1IGIH 1LO2H 2CBUA 5DRXB 1FZJA 2DDQH 2NY2B 3AXLB 2ZE0A 2CGRL 4B0MM 3QPXL 2XG4A 4XBPB 4Q9RH 4NI3A 4GAGH 2C4FT 3VGAB 4NQDA 4D6DA 43CAA 5C0CD 5A8OA 1G1YA 4MNQE 5CINL 3E6HB 2MQ0A 2F53B 2VZTA 1JYWA 4ZFOL 2QQKL 5CJ8A 4PBWD 4IDJH 4K8RL 2X1PA 1J0ZA 2R4SH 3MJ9H 3IJ9A 3P9MA 1B3VA 3EDFA 4UOW0 3VA6A 1CK0L 4WCYL 3HE7A 2B4CH 1SMDA 5HHVL 1IGFH 1MHPL 1JZ4A 3DSNA 4B9ZA 3A3HA 4M7LT 3DUHA 2ORBH 3DMMB 2YC1B 2GW5A 2Z93B 5IFTA 1A7RL 4W4OA 4V1DB 5EU5A 3VDBA 5I66B 2MNUA 1C12A 2HFTA 3EDDA 1JGUH 3SKOA 3D87B 4X0KA 2FX9H 3HNVH 1WAAA 3TNNB 4PJFB 3GRWL 1OSPH 3L7FB 3QO0B 4JZNA 1PKQE 4HK0A 3KWWA 2H2PD 5FGBA 5TE7L 3GNMH 5HXMA 3WF4A 1U3HA 2FEEL 4M7JH 4PD4K 3TYGH 2CH8A 4Z7VE 4BF7A 5K9QG 4MNGB 1TVBA 1BZ7A 2H1PH 3TA3A 4HK3N 4Z8FH 4QRRB 3O2WL 5E4EB 4K2UL 1U8LA 4LAQH 1GYAA 2VZ1A 3LEXA 1W32A 4Z9KB 2JLLA 3VXRB 3VFUA 4E8DA 4HZ7A 4RCAA 4AISA 3QUZB 2JKXA 2UY3A 4TTDC 4WDIA 4PRIB 3ROLB 5C2BH 1J05B 2XKNB 3MJ8A 3PZVA 2XKUA 1LO4L 4TVPD 2AXGB 5GRUH 4LVOB 3DTXA 4KDVA 1W8NA 1JNNH 2R8SL 1HP5A 4XNZB 2I9LA 3F8UB 5KJRH 2NNAA 4PUDA 1MH5A 4LHJB 4DQOL 4MNQD 1ZGLA 2CLVB 3NIFE 1R5VB 1MW3A 1JGDB 4G9DA 4XNXL 1XGYL 5GISH 4YQXL 1J05A 2XKNA 2NY1D 1FDLH 2QADC 3VWKC 4IIQA 5C6TL 1MCPL 4OZFG 2XKSA 4B53A 1OSZA 4JIEA 1RULH 1F4YL 4K3JL 4R97B 3QFJD 1FNFA 1BGGA 4OLXH 3A67L 4GOSA 1CDBA 1JWUB 3TO4B 1HDMA 5HHQA 4OLYL 1C8QA 4ZSOE 4QDMA 1LO2L 2UUDH 3I3BA 1NUFA 4DGIL 4Z77A 1A6PA 3PWVB 3TVMA 1A7QL 2HT4D 3M7SA 1HINH 3FZUD 3M17B 4OLZL 2CO7B 1P9MA 1IGJA 1MFUA 3FN9A 1ODUA 4LQ1A 1LG1A 3LB6C 4PMUA 3IJSA 2VX5A 4APQC 4PRPB 3Q6GH 2DGAA 4K7FA 2XIIA 4WO4B 4YPGA 3WXWH 3TBWA 2ICES 4AY1A 2R4SL 3MJ9L 4OCRH 4F15B 3O8XC 1BM3H 1MRDL 3FQXA 5HHVH 3PHQA 3JV4A 1CE6B 4H26A 3MACL 3A0OA 4WHYH 5H37G 5C0BD 3STZB 1X5XA 3K2UL 1MHEB 3UCRA 4HKBA 2IXVA 4NN6B 4OLYH 2W61A 2R23B 3QH3B 3V4VL 4F8TA 2R0LL 3BGMB 3IKKA 3L3KB 4XBPA 2F5AL 3TFKD 1D9KB 2FX9L 2VZSA 4N0UE 4PJ9A 4NNXA 4Y1AD 3OKYA 2X4OB 2BNUA 3ELAT 2X8RA 1K5NA 4GBXB 4K7FB 5HHXL 3V7AG 3MMWA 3DVFA 1CFTA 4G8FA 3BAEL 3CH9A 1E72M 4XCNB 1MQQA 3RWEA 4JREC 3O2WH 1AGDB 4L4VD 4WUKH 3QUYA 3E8UL 2BJML 3NH7L 1E15A 4BQ4A 3C5ZD 3RUGE 1HH9A 3UBXI 2BMKB 3D5HA 4UDUA 1UM5L 1L0XA 2CRMA 3LS5H 5LGHH 1HI6B 2VDQL 1DBKH 1GCFA 1KV3A 3ARDB 5GIRA 4KJYA 4P8VA 3HA0A 4UQ2B 1EH9A 3ULVL 1YUHB 3RKPA 3HC3L 5I2IA 4YJZL 1KENH 2J78A 4YPJA 2EKSA 1FFNB 2C3XA 4JN2A 1FZOB 4LX4A 1NC4B 5EO0A 5KOMC 3FOLA 3N06B 4M1DL 3L5XL 1WFOA 1LQ0A 5GJSH 1OTSC 4XPFL 4JAMB 4NKIL 3GSWB 4F8QA 3C6LC 3SDAB 1A5FH 2NW2A 1IM3B 2HFGL 5ILTL 3TC9A 2K1MA 5I16A 1OGGA 1LP9A 2W9EH 3UPAA 3PV6B 4MAUH 3WLWD 5B3JE 4L8CB 1A3LH 5IHZB 3ARGB 3HR5B 2ZXAA 2XFYA 1A2YB 4LVOC 1ZBWA 3RHWK 1WWAX 3BZDA 4PGDB 4F58H 2J7HA 3CMOH 4HLJA 5GGVH 4FMVA 1HINL 3VDHA 1G9ML 4AYSA 3RWFB 1KENL 1GOIA 2VUYA 3I6KA 5I19H 4LIQH 3GMQB 4R4BB 5DVOA 4HH9A 5JPNB 1GGUA 1U36A 3EOAA 3MNZB 4PB9L 2CNCA 5ACMA 5D96C 4M1DH 4FQCH 5D8WA 3QYCA 3SEPA 1EGJH 3KGRA 3THCA 4XWOC 1QFPA 4P2RB 5C3TA 1ZAGA 4OCRL 5I8KL 4RQQB 4J27A 5ILTH 1MRDH 4TSBH 2PCPB 4L8SC 3FRUB 1ADQA 1OINA 4NZJA 2QSTA 4V1DA 5I8OL 1YY8B 2ZX6A 3QG7L 2V5YA 4LNRA 4U6VL 4IMKC 3TVMB 2CJUL 3K2UH 4ZO9A 4WFED 3VU2A 1G7PB 1MVYA 3HI6H 3U2SB 1UA6L 3LZFL 4JFHD 2DSKA 3ARBC 5E2JA 5HHMD 1KJVA 5IW1B 2JEPA 4F58L 4LFHG 2Y6SC 3W11C 2HKHH 4LLUB 4W89A 1XYZA 2VDPL 5FO8B 3S35H 5J3HD 1MFCL 1E56A 1ZHNB 4O51B 1XZ0A 1NUGA 1PAMA 1V7NL 4EANA 2GSGA 2UZIH 5I1GH 4HOWA 1Q8MA 4WUKL 3QJFA 5T1LB 5E7FA 1MHCB 3ZO0A 2HJFB 3U4BH 2ZOKB 3VXME 2ILLA 4WGWB 1GOHA 4X7SL 3B9DA 3QG7H 4AD2A 2P7TB 3PL6B 3HI6L 5I1JH 5ID1B 5KSBF 3UTTA 4Q6IC 4DWHA 5CG0A 4R6UA 4P59L 4MD0A 1FN4A 1AGCB 4XGZB 3W29A 3MFFB 3GMOA 1JPSH 3DYOA 3JWDC 4RAHA 2NSXA 4KVNH 2ZIDA 1HOCB 1FNAA 2EXWD 4XZUA 2ITCA 4LVEA 4ZFOB 4PY8J 4ODTL 5LJYH 3KPRE 1HHGB 4ZFZB 1H3UA 5GJTL 2J8OA 4TSCL 5FYKL 1KCLA 4PV8A 1I4FA 1R3KA 1EJ6A 3N0PB 3QR2A 4M8VA 1KN2H 4GKZA 5I1GL 3L9RB 1ZVSA 2P5WD 4UT6L 1JFHA 5D72L 4OZIB 3QO1B 1U3HB 3TH4T 1H3VA 1A5FL 5INCB 5TE6H 3VXSD 1KB9J 5JTWA 5FA4A 5KVGH 1QLFB 3LPGA 4U1IA 1NWSA 3STLB 5E8OB 5DMKB 4ISVB 5HGDA 3V0WH 2A9NL 4WY7L 3HC4H 4KY1L 1I7TB 5LGJA 4BJLA 1GHFL 4UINH 1U8PB 2XWBB 4X4ZA 2FHCA 1SBSL 5F93C 4FQQB 4WKFA 1MVUA 3TCLB 1CLXA 4FFVD 4PB9H 4OLWL 2EYSA 1DL7L 3KJ4B 4RSVA 5BQ7B 3NZHL 3QIBC 4YGVA 4R2GB 3ZTJH 5I8KH 1RVFL 2I26N 4Z7VA 4MDPA 4CU7A 1JP5A 3ULVF 1G7JA 5E5UB 4D9LL 2ENSA 3BESR 2B2XH 3MRQA 4K9EC 1KOAA 2EC9U 1QPKA 2DQEH 3L2MA 3HZVB 4U7KA 1GHFH 4UINL 2YWYA 5KSUA 1OM3H 2UWEA 3KYOB 5D1ZC 3FT2B 1YJDL 5JNYB 1H0GA 4QHNB 5HDLA 4ZFMA 4QRPB 3U0TB 2H32A 3C60A 1UR9A 3TPKA 3F7VA 3DYPA 1TQBB 3NZHH 1B3ZA 4M7LL 1JZ2A 5IF0B 4MJIE 3O6KH 5C3LD 4OUEA 1HIMH 4XTRC 2X9XA 1SYVB 4FLSA 5FOOA 4OFVA 5DJ2A 2P5WA 1K4CA 1CLYH 3WFCH 5GPRA 3IAGC 2VXUL 4Z2LA 4XNYH 2QF8A 4GG8B 2XN9A 1AQMA 1Q72H 2A3BA 3QWOB 3MRBA 5FO7A 4I18A 2OWCA 4URIA 1I1RA 5DHVB 2WKLA 1JL8A 2W60B 4KVNL 1R24A 1SY6A 3P3YA 5DMGD 4LLWA 1SVCP 1LDPH 4KDTA 5I74C 3WIJA 2Q8AH 3JBG7 4ELKA 4XHQA 3CC5B 5D6CB 4Z0BH 2MMXA 3ETBF 4PMQA 1TLKA 4PRHB 5HHPA 3VFRA 4WHTA 2X4PB 3BKCH 4I18B 3O6KL 3MRLB 5EBMB 2BVQB 4ZQKB 4E9LA 3UETA 3D48R 5F9OL 1YUHA 2OI9B 4LOUC 5C0RL 4XNYL 1U8IB 3OG4B 2IMNA 3S3SA 3VFSA 1IKNA 4M8UA 3IDNA 3PGDA 5CP7A 5IBTL 5I76A 3CUPB 3FRPA 1Q72L 5D5MA 4MD4A 5TGBB 1BQLL 3VIGA 4NWTL 5SWZE 1IARB 5E6IA 4HS8H 3ULVE 4LSTL 3VD3A 1YEEH 1KR1A 1H8OA 1V0NA 3BIKA 4LHQB 4LU5L 5HHME 1DVFB 4X6CB 5L9DL 1XSJA 1G9NL 2GJJA 1EAPB 3KYNA 1H3WM 4QRPA 3U0TA 2WWMD 3D3VB 1F3DH 1R3LB 3UXFA 1GZQB 2YPLD 4H8WL 3BKCL 4KZEH 3P4MB 2O9TA 3CGTA 2VYRE 4NO2B 1T5WA 4IOFD 2F19H 1RZ7H 1YMMD 4PG9B 4BSWA 8A3HA 4HUVA 1JZ8A 1F45A 3L3KA 4TULH 5AYUL 4ONHB 5IQ7H 2VLJB 4RWYH 5FDWA 1B6UA 1DUZA 2R0WH 3LD8C 4JDZA 2MANA 3WUBA 4PV9B 1N6UA 5E00B 2BX5A 3TT3H 3HE6D 4H26B 3RWGA 3CZJA 3RGVD 2XUCA 4MNHA 4PJDF 1VFOA 4OGXL 1U8NB 4HS3A 1V3LA 1IEBA 1ZV5A 1D6VL 2H32H 4JPIB 5F96H 4GBXC 2OM5A 4YDKH 4N0UB 2XNAA 5LAXB 5A2CA 1NDGA 5IXEA 2ESCA 4UV7H 1S7VB 3ILQD 2JJTA 3IS1X 4RWYL 4YK4B 1DP0A 4EJ1C 1CICA 4LLVB 5DZLA 1DJSA 2WMHA 1WDPA 2HTKC 4LMQI 3LKNB 5EUOE 3VFGL 5FA3B 3K46A 1GPFA 4PV8B 4GMSH 3QUML 4FFYL 4K23H 4LEXH 2OSYA 4AIEA 5BYWA 4OGXH 1OB0A 5GNYA 2JB5H 2WKGA 1NGWA 4OQTL 3PDOB 4LSRL 2D7PA 1LEKB 4P3DB 5GSVB 4NNPH 5INDA 4JPKH 1DWJM 4C56A 3GSNA 5F7EL 4Y4HB 2RQ8A 3GSQA 1IM9B 3S8WA 5DMGC 3MR9A 1FG9C 1UR4A 5E95B 2R2HB 3C6LB 3SDAC 4PYSA 1D6EB 4OCYL 1E4WL 1KLFA 5GGSB 4AZ5A 2J8FA 4NQXB 4ZXLA 1WFTA 5FUCC 4W7WA 2ZWYA 1DLHB 1CD9B 5DYOA 4LSTH 2R1XA 4ETQA 3PHOB 4G80A 1VADB 4PP1C 3ZKXB 1E71M 5KVDL 3PQYA 4AZBA 1ES0B 4MXQD 2XWJA 1QVOB 2QL1A 1F6AB 5FYKE 1BEYL 4AG4H <