4MJ4A

Human iduronidase apo structure p21 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
614
structure length
603
Chain Sequence
EAPHLVQVDAARALWPLRRFWRSTGFCPDPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-L-iduronidase
publication title Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.
pubmed doi rcsb
source organism Homo sapiens
total genus 194
structure length 603
sequence length 614
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01229 Glyco_hydro_39 Glycosyl hydrolases family 39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mj4A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4mj4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mj4A02
3DBXA 1CVRA 4Y1AD 2IAND 1ZGLP 4O2FA 5E5UB 3MSDA 5ESQB 1S7SB 4HZ6A 2WUBL 1KEML 3UTQA 1XF2B 3ZE1E 4XRCB 1LP9E 4L9LA 5F9AC 2GJ6D 1TZGL 4KRPB 4AMKH 1OSZB 1MUJA 3CLFH 3CGTA 1Z32X 4HUNB 3BZ4B 4YNYA 1KXTB 3BCDA 4TXEA 1NMAH 2BNQB 3VO0A 3ALFA 4JFED 1ZE3C 2FO4B 1LEIB 1XIWB 4UTAL 4EEEA 1UG9A 3J8F7 4MX7A 3GKZA 2NY5L 5JOFB 2ZUTA 4L3ED 1IGIH 2DQTH 4YDVB 3G5VB 5C07B 3SKJH 2C9AA 4J4PD 4JO4H 3UTSB 2FJHA 4NQVB 3AISA 3OWEA 1C90A 4MAYC 2WLYA 3R1GH 4ATLA 1PZ2A 2QLYA 2DQXA 3U5YA 2EYSB 2QADC 1IRAY 5CZXC 4Z7OE 5SWSE 4TUJB 3CK0L 5FL1A 2NY2C 3NZHH 4P8VA 4PJ8C 4I48B 1M04A 4CRPA 2BHZA 2XZCL 1U8LB 1IGTB 3WJLA 1OVZA 3FFDB 1S9YA 2E7LA 2D24A 1HHHA 5B21A 5TD4A 2F53E 2G60L 3FHQA 1QSFA 2DWEB 2X4QA 4JN2A 5F72S 1QPPA 2DQHH 1ACYL 3A6CH 5IFAL 4M29A 3BPOB 4JFDB 2QKIA 3WF1A 1FJ1B 5IBLD 3MFGB 1IT0A 2XYLA 2DLIA 3EGSB 5BS0E 3O9WC 1CE6A 1GOGA 4GW1A 4JVWA 4YN5A 2GQHA 1NDGB 4ZAKB 1MIEH 2ATKB 3EDKA 1YQVH 5I1EL 2Z93B 1VADA 4HG4K 3GJFK 3AMKA 2FECI 1NFKA 3TTOA 3KPRD 1SEBB 5C0CE 3AIVA 3LS4L 5ANMA 2GJXB 3GBLA 2AV1B 1X5YA 2YC1B 1ZJBA 3RWCA 1KCRH 4MZ3A 3RTQD 3TBWA 3IF1B 5H35A 5IOPB 1V3KA 4FQIL 3MCG1 5A16A 3CUGA 2RGLA 4AENA 5DT7A 1OD9A 4RDQF 1WKYA 3D1MC 4TRPH 4UDTA 2IBZY 4JREB 2R29L 3RJYA 2AGJL 1LEKB 4ODTH 2CLZA 4P2RA 1XGUB 1MH5A 2A83A 3MKKA 3QNXA 4WU5A 5JHLH 3BQUC 3L4XA 5KJRH 4FFYH 5LXGL 5SWZE 3GSRB 5T3ZL 1ZT4B 4FLQA 5FKYA 1JYVA 2DI8A 4HIIA 5HOSA 2K7PA 1J11A 4RMVA 4F2MB 1NBYB 2LU3A 3C5ZD 4AT6B 5C0EB 3CFKA 4Z77A 2QPUA 1INQA 5BXFB 4D1IA 1QUNA 2PYEE 5C71A 1OGTB 2OQJA 3LN5B 1A5FH 2OR9H 1G9NL 2UY4A 4PRPE 3I6KA 1DSFH 1GGTA 3N50A 4PJ5B 2CLRA 2DWDB 3K1KC 4DFHA 1JYNA 3IFNL 3OHXA 3WQWA 1P53A 1N7ML 3ARFD 1ZTXH 3SDAC 3QJFA 3W53A 4ML4A 1G7HB 1T66D 5T5FH 2O9OA 1FVDB 4KVCH 5GRVL 4JKLA 1MLCB 3PP4L 5E94B 2YPLB 5T3XH 2P8PA 2DMKA 3GRWH 3H3KA 1ZBWA 2JIXD 4PRWA 4CD6A 5JTWA 4JEGB 4GG8A 4FTVB 4JFFE 1WBXB 1GVYA 4JGJA 4ELKB 5I8CB 4LQ1A 4MD4B 1NMBL 3O4LD 1JPFB 4H20L 4PRHB 4V1DB 3F7VB 5C2UB 2DSUA 2V2XB 1CDUA 3B2UD 4U1SA 4JY6A 2WMGA 2M8XA 5IR1A 1F2QA 1JFQH 5E2WH 2XV6B 4X0KA 3GMLB 3WXWL 4X6EB 1RUAH 1GQKA 4OSUL 2VC2H 4JM2F 4U1JB 1XGYL 1LO3L 2HRPH 4D0DB 5TFSL 2C3VB 4ZFMA 5HYJA 5J6GB 1P1ZB 4RZCB 4NRXB 4RAUA 2FCBA 4M43H 2X9XA 5IQ7L 3NSXA 4F7TB 5DRZA 4ZPVA 1JPGB 3RUGB 4K23H 4NDMB 5DI8A 4A6YB 1K8DB 4G6KH 4FXGA 1PZ5B 4B0MM 5BOZG 2XRAH 5JA8B 2DDQL 1V0KA 1BF2A 2IAMC 4E8DA 1E4WH 1G7LA 3OGOE 3V0VA 2MJWA 1E4XH 4P9MH 1X9QA 1A14L 4H1LB 3DX7A 2ZSWB 4NCDA 5IBTL 5CLWA 4WSJA 2HTKC 2GEEA 4U7KA 2OM5A 1WV7T 2YD7A 5SV4A 1EGJA 2EICA 1ZKAA 5F7MC 1PD6A 1SQ2N 5K9OB 3DBXB 5KANI 1RHFA 1H3WM 4IRJA 4K3DL 4FA8A 1V3MA 4FQCH 3ILQD 3II1A 1YUHB 4M9OA 4ZO8A 4CN1A 1NCCL 1S5IH 1NGXB 1QNRA 3UTQB 5I77A 1ITCA 1LILA 4L9LB 1I9EA 5DK3A 5CSYA 4QF1A 4XAKD 4DJMA 4HSQA 4P8WA 4OZIF 1R87A 1MUJB 2R4SH 4HFWA 5FYLH 3PJSA 1JD9A 4W8BA 2HWZL 4YNYB 5C09A 2BVEA 4LL9A 5DJDA 4JJHA 5M7QA 2EDRA 4GXUN 4CUCA 1GJUA 1TPXB 4J7RA 3MYJA 1LQSR 2I60L 4MX7B 4G9FD 3UERA 1Q6GA 3RVXD 3FJTA 1B0IA 2VR4A 3NA9L 1EZVX 4W4OA 3TJHC 4ZENA 1E6RA 4ZNEA 1IKFH 4WY7H 1KV3A 1QLFA 3U7YL 4FABL 3BCFA 2X9WA 4QRUA 4JHWL 3KPSA 4U7MA 1FCGA 4AIEA 2FJHB 2VLKE 1CU4H 4GAGL 4YFDB 1G9HA 5C0NC 4W6WB 1RHHA 2IWGA 4P46D 6FABL 5EO1A 1Q6CA 1FIGL 5D1ZA 2CPUA 2YBUA 1Z5LB 2FATH 4MCYB 3W5MA 1QLRA 3GKWH 5DRWA 7CGTA 1GOOA 4RGND 3IANA 4XP9L 1MIMH 1S9YB 3LKOA 4JCLA 1HHHB 4B9YA 1MJJB 4JN2B 1RMFH 2X4QB 2NW0A 1IZKA 3VI4E 3GM8A 1GQJA 1VACA 1CE1L 4I0PD 2QKIB 2V3FA 1Q72H 1VFUA 3IRPX 4CJ1A 2YSSB 2LAAA 4G9DA 4PGDA 4R90L 1R3IH 3LKQA 1QNSA 2OTWA 3KJ4B 2X89D 5D7SL 1GQIA 2NZ9D 1BJ1J 3T0EE 2WWDA 3LMYA 4GW1B 1JGDA 2XA3A 1IC5L 2EIBA 4RFOH 1WT5C 7FABH 2R1XB 3QIWA 2XIBA 1I9JL 3WUZA 1E4IA 3EYQD 1VADB 1FH8A 5GS0D 1KIRA 5LCVL 1AC6A 1FAKT 5FB8A 2W1NA 1IJ9A 5BVJA 2V9TA 3RM9A 1NC4A 1A0QL 3JUZA 5JA9A 4AZBA 3GIVA 5ANMB 3RMEA 4CKQA 1DLFH 1YEEL 2I9TA 3RWCB 3TBWB 5H35B 5B39G 1T89C 1DBJH 1QKZL 4BSWA 4L4TE 3L5XH 4I77H 5A16B 3QDJE 2EO7A 4HKJA 1YY8A 4AENB 1ORQA 1OIFA 2FD6L 2YUXA 4F58H 5ISZD 4S3KA 3QIUC 3RVUD 3S6CA 5E0QA 1E6SM 4JZOA 3QGVA 3MV8E 4RBPH 3T0WA 2CLZB 4P2RB 5DD5H 1MH5B 2A83B 4KJQD 3QNXB 4WU5B 3SURA 4LMQI 1V7ML 3IDIA 4MNQD 1R0AL 4HIIB 5SX5H 3VW3H 3ZDXF 4GW5A 3ZR5A 1KXQA 2ZX5A 4LSQL 5EU7C 3D18A 1RJLA 3G08B 3SQBA 3AU1A 1WC7A 3CFKB 4Z77B 5GZNC 1DANT 4PMUA 1INQB 1QFUL 2DKUA 2YPVH 1F00I 1R3LA 4WDIA 1U8QA 2Q6WA 1AMYA 3L95A 4ODBD 5HHOE 1PQZB 3JTSA 3WNLA 3HC3L 5FXCH 1NAMH 2CLRB 2AXGA 3DI3B 3OHXB 1IC1A 4HS8L 5ABHA 3F5JA 2J5LB 4JG1L 4KTEL 1J5OL 4MJ5B 2J7GA 2XTJD 5DFWH 3SUSA 4KRNA 5L2KA 4U0RB 4YHML 1GGUA 4AEFA 1Q9KA 1NJ9A 4XVUC 2Y5TA 3ZDYF 1BOGA 5MEQA 1MVFA 4QLRA 2P8PB 3NDZA 4QO1A 3ORJA 4YHZH 3LRSA 4GG8B 2QHRH 4ALAL 4BK4A 3N1FC 2R23A 4JDZA 4M00A 3OPZL 4CVUA 3MRBA 4YK4C 1X5JA 3K2MC 2OWXA 4A3HA 1N82A 5GNZA 2BVYA 4DWSA 5IR1B 4X0KB 5DQDL 1J1PH 1MCOH 1H0IA 3I85A 5DLML 3BPCA 1JXKA 1RVFL 4O5LL 2Y8VA 4WEBL 3JXAA 5HYJB 3TEUA 3IT8D 5AZEL 5HPMA 2HVMA 1H8SA 1MFDL 5DRZB 3HG1D 4ZPVB 2JF1A 1E40A 5IM7A 1F45A 4YJZL 3CHDA 3QDHA 4JB9L 4DM1A 1KELH 5DI8B 4P2OA 2HFTA 3RCNA 4M5ZH 5BRPA 4FXGB 4L1DA 1KN2L 1RZKH 1WEJL 4LGRB 4RGOL 4APQA 1E6ZA 3QXUA 5IESL 1G7LB 3O2LA 1DL7H 3V0AC 4DWHA 5KSAC 2H9GA 1NOUA 3KS0H 1ZVHA 3DX7B 4R26H 4KUZL 2G3JA 4U0QB 1C5BH 1FLTX 3LPOA 1ZS8B 1UJTA 3V4VH 1FZMA 3I50H 3VXRD 4UV4H 3QUKA 1JZ3A 4KC3B 1F90L 1IC4L 4D6IA 4IRJB 2J79A 4JKKA 4OFYA 2SEBA 4OM0H 3AXIA 1CICA 5DA0B 4EBQH 4MDIA 5FGCB 5C6WH 4AJ0A 1JTTA 4V28A 1QBLH 4F9JA 1EV2E 3EYUH 4HFWB 3PJSB 1FAIH 2IPTL 4M1GH 5C09B 5MENA 2XQBL 4YE4L 1AY1H 1V8HA 2DT2A 4OCYH 1EO5A 4FOMA 2D3LA 1VPOH 5DJDB 3WV0A 3KR3L 2VKWA 3VI3F 4R4FL 4MJ4A 3WUGA 2ADIA 4PMZA 5DFVD 1D9KC 3MYJB 3V6OA 4B41A 1EXPA 4G6MH 4X5WA 4TSBL 2VIRA 3LPGA 5EOCJ 1A4KA 1FGNH 5CSZA 5EULV 3VGAC 3OKDA 3N18A 1BOYA 3TBYA 1FP9A 1NP2A 1U8JB 2EEAA 1FYTE 1QLFB 4QRUB 4YHYC 2CBVA 4OCWL 3SN6N 4BFEA 3MMWA 4XCEA 1BPLB 2X5PA 2CKNA 1RHHB 2VQUA 4MXWH 5EO1B 5D1ZB 1I7RA 1MFEL 3K4DA 4LCCA 4LMQE 2JFEX 3KXFA 4AZGA 3ULVL 1M7DA 2OJZH 1DBMH 3H3PL 1QLRB 1OCWH 4M48H 5DRWB 2GJPA 3BAWA 4IRZH 4Q7DA 2CK0H 3MRGA 4GRWE 3LKOB 2VLME 3KLHC 5GHWH 3SPVA 3SUTA 5A43C 5B39A 3VRLE 5B3NA 3HE7A 2J75A 1AO7E 1VACB 4RIRA 3L7FA 2DD8L 2DJ4A 3D3VE 4LRIC 4TOYH 4G9DB 2EDYA 4PGDB 1NQ6A 3MLSH 2OTWB 5DD0H 5JBEA 4KKNA 4OFVA 5GGUA 1JGDB 1J8HA 4I9WD 2D22A 4PLKC 2GFBA 2PO6D 1BD2D 2EE2A 3QIWB 5DUBA 1IVLA 1UM4L 2Y07H 1MRDL 3LH2H 3L5WA 1OPGL 4OLVH 2HN7A 2Y06L 1KIRB 1NPUA 2E27L 4K94L 3GRWA 1GYAA 4NT6A 3HC0B 2YDQA 3OKKA 5IQ9A 5BVJB 1NC4B 2YWZA 4I4WB 1XGZA 3S2CA 3GIVB 2UY7A 5C0JA 1IAKA 5CJXC 4WK9A 3VFUA 1L0QA 3PWUA 3HUJB 3OF6D 1ADQH 4L3AA 2I9TB 1I85C 4QHUA 2EDQA 4LRNH 4D3CL 3OB8A 1JGUL 4HKJB 1YY8B 4K2UH 1D6EB 5IW6A 4OZFH 1CDHA 4X9IA 1ORQB 5IHRA 4PTWA 4GT7A 4YHEA 5D2LE 1HEZA 2AKRA 4JZOB 2DQGH 2EDJA 3C60A 4X6DF 4AIXA 1FO0L 2VDPL 1CGTA 4JQVA 2J25A 3ZKQD 5KSUB 1A6ZB 3IDIB 2F8XC 2JJSC 3AZRA 1TZ7A 2KZWA 3JV6A 4HS3A 1RH9A 3SCMC 4YBQD 3ARZA 1PSKL 1YMMD 3D18B 1RJLB 4R4ND 3QRFM 2MHAA 1DCLA 2NR6C 3A67H 4NHCH 2VH5H 3O0RL 5BCAA 4WDIB 4XTRD 5K9JL 1U8QB 2Q6WB 3L95B 3WFZA 3FHAA 3QIBD 3JTSB 1BM3H 3RO8A 1BREA 4MZ2A 3W0WB 1MEXH 4LEXH 3TNMB 3UEQA 4P8UA 3IKKA 1A64A 2AXGB 3VJ6A 5AD0B 1BEYH 5E95B 4XVJH 4XP4L 1ITBB 4BCEA 2X1QA 1GHSA 4X5XA 3UJIH 2OTUA 5L2KB 4W4NA 2WXDM 5I76A 3HLAA 1Q9KB 1NJ9B 2AEIT 1BOGB 5MEQB 5F7EH 4PRID 4Q6IC 4EIGB 4JVUA 4PMNA 1UWGL 4F9LA 5HJ3A 3LRSB 4UTBH 3BX7C 2YWYA 2R23B 4JDZB 4RWYL 5E7BA 5J12B 2ZPKL 3VUPA 3HNVL 3MRBB 4FZ8H 1KGCE 2RBLA 4QRRD 4K3EL 3UBXI 1JAEA 1VGEL 2HAZA 3C09B 2NY6C 4R2GB 4W88A 4LDEB 2UY6A 2ZOKB 4P57A 3S35L 3UDWC 3QBTB 3B9KC 5BRZE 4F8XA 4OFKA 4OFPA 3BYTA 2BFGA 1GOKA 3JWOL 3SCRA 2CEQA 4LSVL 2AK4E 2P5WD 2R69H 4XCCH 3HMWH 3I3EA 3QEUA 5HDQH 2APXA 1YJDL 5CKAA 4FQ2L 4OZHE 2EPNA 4NQEE 1IFHH 1W8OA 5IM7B 3W4RA 5EORH 1FH9A 4M7KL 2BY0A 4HJ0D 4KDWA 2J4WH 4P2OB 4YXHH 2H2SD 1GZQA 3PHSA 1CLCA 1C16B 1NLDH 4APQB 3WIFA 1F4WH 3RI5F 4RMWA 5A2CA 2B4CC 2H9GB 4Z95H 1H11A 2PKDA 3G6JE 5K59E 4W86A 3BPNB 3GBNH 4JG0L 1FZMB 4WHYH 2VN7A 1O0VA 3QUKB 1UA7A 3ARSA 2CQVA 1RULH 4Y5VA 3WD3A 1AXTH 1MF2L 4ELME 2SEBB 3SDYL 3FB7A 1CICB 3MV7D 1WFOA 2ITCB 4MDIB 5JQ6H 4OCNC 2MPAL 5CLTA 3MOBH 2Z31D 3VXUD 3NOIA 3ZR6A 1KCSH 3T08A 1L7IH 1S7VA 5C7XH 2NY4D 1RFDH 4NKMA 2DKSA 4JHAH 3WKML 3MRPA 1XCTA 1GGBL 2VLRA 3OKOA 4NZRL 5MENB 5F3BB 2N7BA 3IDNA 4NM8L 2CDEA 4Y4KD 3D3AA 1LO2H 1A7PL 1XF3A 4LCIL 1MHEA 5GPRA 2FLRT 4X83A 4WFGD 3WDIA 3CO4A 3QFJD 1MPAL 4D1JA 2ZG1A 3VA2C 1JD7A 5FK9A 4ODVL 1P4LA 2LAGB 2VIRB 1A4KB 4YGVA 2MWCA 4XPBH 4DVRL 2ZUQB 3QQ9D 1T04A 3K4AA 5AG8A 4HC1L 5DJ6A 2Q20A 1YEGL 5LGJA 2XM1A 2GJZA 4MADA 4XP6L 3AB0B 1A6PA 5EBAA 1JNLL 5B4MC 4F7MA 3ZKND 4I18C 4BA8A 4U6XB 2DQEL 4LCCB 3KXFB 1QI0A 1UKPA 1M7DB 3MRGB 3CUIA 4N8PA 3SPVB 5B39B 4X9GA 3HE7B 1JWMA 3EBVA 4RIRB 3L7FB 4ZE4A 3U1SL 4LAQL 2EXWD 5CGYD 1JFXA 3Q5OA 4MA3A 5FYJL 5JPNA 5DJXA 4WCYL 5FO7A 3AIUA 5GGUB 1J8HB 1GRWA 3K0WA 1DBBH 1WCBA 2GFBB 2VXVL 5DUBB 4PUEA 1LL6A 2OCFD 2CKBH 3L5WB 2XFXA 2HN7B 3CAFA 2DQCL 4OUUA 3UZQA 1CFTB 3FMGL 4N8VG 4RQQA 3EKCA 5E1HB 1DUZA 4U1HA 4UFMA 3OKKB 4AEEA 3PGDA 4MNGA 5IQ9B 3LKPA 3FQRA 4GH7B 5GRXG 5C0JB 5FHAL 3IDUA 1IAKB 1OW0A 1UA6L 5TE7L 3VFUB 2DRUA 1SVCP 1D5XA 3OR7A 2WWMD 2QV2A 2DQIL 3KPMA 4JRXA 5JBFA 5D5MB 5CCKH 1YEFH 5T1DH 5IW6B 1K8IA 5DT5A 3ULUC 2D03L 3TVMD 8FABB 1XGRB 1HQ4A 1HEZB 3GIZL 2AKRB 4MLSA 3LMJH 1SM3H 1T3FB 4HEPG 3FRUA 1TFVA 2D7NA 3C60B 3X14A 3BMVA 1BVNP 4AYFA 1GH7A 4DN3H 3BEVB 5JW4Q 3CDCA 1TA3A 1HYSC 3BGMA 3JV6B 1YHTA 4H25B 5HD8C 5FYKL 3SO3B 1E5NA 5E56A 12E8H 2MQ3A 3DOSA 1YYLH 4LOUC 1LK2A 3T2NH 3Q3GB 5HSFA 4U2ZA 1LDPH 3S37L 3MLZH 4ZE5A 4M5YL 4L4JA 4KTDL 1W9VA 4Y1AE 4O58H 5BV7C 1IM9D 2IANE 1XGPA 3VJ6B 2CRYA 5J3HC 1XSJA 1HIML 5IGXL 4MA1C 2ZUYA 4X5XB 5CKGA 3WFHA 3KPNB 2OTUB 2Q86A 2NY7H 4IMLB 1D7FA 5D7JD 2GJ6E 5I76B 1JZ8A 4RGMB 1QBMH 4ACZA 3DRTB 5ECJE 1OT1A 3BZEA 1OP3H 2VNCA 3BW9A 4MDPA 4M6OL 4JO2L 3BD5A 3RY6C 3VXSD 3SDXA 3MA7A 4XBEL 1E73M 3QPXH 3LV3A 4HXAL 3AI0A 2WW8A 5EIQA 3WDHA 5ABEA 3EYOA 1U2CA 3CVHH 3TV3L 4HH9A 3MLXL 4LPTA 3FT3A 3HHRB 1M7XA 4U6TA 2Z8WC 5HTSA 3TPKA 1GGCH 4P57B 1V6YA 1J8KA 4JANA 4OF5A 4P23D 3RGVD 3K3QA 4KV5F 1FRGL 4D2NA 2A38A 4NO3A 2YOCA 4X7CC 5JLZA 4KGLA 1B30A 1RUKH 3QUXC 5I0ZA 3QEUB 4Y2DC 1EAPA 5I8OL 4WWKC 4YX2H 1X5HA 1CDJA 3EO0A 5MP6H 1H41A 3NH7H 1KB5H 4L4VD 1W9PA 1GZQB 5F44A 4LSTL 1BJ1H 3KYKH 2BVTA 3WIFB 1RAMA 5KTEH 2RQ8A 2PR4L 4AM0A 4P2QE 5K93A 4LFHG 3WSQH 3VFOA 5EUKA 3BP7A 4M24A 1F97A 4EI5A 3CBWA 5A8MA 4QXUH 3QQ3B 4M02A 2V2TA 5I30H 3CVIL 4K8RH 4WKFA 1LO0H 4HK3J 3GMRA 3PDDA 4J4PC 4KDTA 4Y5VB 3BGFB 2JTDA 5DMGD 2WBKA 5CJQH 3SY0A 3FB7B 4LNRA 1MLBA 1WWBX 5F1SA 4UT7H 1KT2A 2BDNL 3K81A 5DJCA 4OLWH 5EU6A 4ZSOE 4DW2L 3KPRE 4NQCD 2WMIB 5DMIH 1S7VB 2BERA 4NKMB 3U30B 3PWVB 2VZ3A 4GBXA 4D9LL 5EZLA 1BWWA 1XCTB 2Q8BL 3MRPB 2VLRB 3SE8H 2WMPA 2YMXL 3IDNB 4HCRH 2CDEB 3WFCL 3V7AG 1XF3B 2Q3ZA 1MHEB 5DFTA 2QEJA 4H0IA 2HFEB 5D7LA 4EQ3A 4BQ4A 4B3LA 3M6DA 1IM3A 5I71B 5E09A 3MRRA 5FK9B 2XN9D 5I6XB 1P4LB 5TGBA 4RFNB 4YGVB 2R0ZL 3EMZA 1KC5L 3RQ3A 1T04B 2O26U 2FX8L 4F8QA 3JWDC 3JTTA 4UV7H 2R2BB 1CLOH 5LGJB 5D96B 3TOPA 2N56A 2GJZB 4W84A 3P40A 4PJHB 4PYHA 4HUXA 4LHQB 2WIMA 3HZKA 4GO6B 4F7MB 2Z8SA 3QZWG 4PBGA 4N8VA 3RNKA 4HUVA 1KQYA 3EDFA 2JALA 4PJEA 3PTKA 1OGSA 3RUGF 3T3ME 1GPOL 3VIGA 5E70A 1AGBA 1EO8H 4OLUL 4ZXBA 1OARH 4MXVF 2QQKL 1T2XA 4XX1E 2XNAA 4YGAB 2RR3A 3TC9A 1JWMB 1L0YA 1A6AA 4FQ1L 2DSKA 4HBQA 2EIEA 2XYCA 1EFXD 4MA3B 4ODHH 5E2JA 3SGKA 5DJXB 3OAZK 5JPNB 4XAWL 4Z7WE 3RWGA 5FO7B 5DZOA 5EBMA 3RDKA 4EZMA 4M7ZC 4OCSH 3EYFA 3OJDA 3MANA 2WWCA 4QCEA 1HKLL 2DLEA 2XFXB 3UG4A 3POCA 2R0WL 4OUUB 1NMCC 2MCPL 1CZ1A 2ED7A 3VFTA 2GUYA 1BYDA 1DUZB 2BOBA 3K1DA 4U1HB 3VE0A 3PGDB 1WITA 4MNGB 1ISZA 3VPLA 2VXUH 3FQRB 3OXSA 1QACA 1BFVL 1H3PL 3OR7B 3ARFC 3KPMB 4JRXB 1FO0A 1KJ2L 3IETA 5LJYH 1OAQL 1OAKH 1A3LL 4XHJD 2WNWA 3A3HA 4D6CA 1K8IB 4K9EC 2VO5A 4PJDA 5GS1C 3V7MA 5DMKA 2I27N 2P8LA 4ORGA 4QLKA 1HQ4B 4OJFL 5CZVL 1HYRC 2B5IB 3GO1L 2CBIA 1WDQA 4IOFC 3FRUB 1H9VA 1OAXH 4HIJA 3X14B 1W1YA 3THDA 2QQNH 3S34L 5D7IE 1WBZA 1GAFL 3TT3H 3DUUA 5HY9A 1X6NA 4N5ED 2P5EB 1U30A 1TA3B 3TYFA 3MACH 2I25N 4FFWD 4XB3A 5KW9L 2OR8A 4I3RH 2P1YA 2UZXB 1R86A 1KCUL 4LVHB 1QFHA 1LK2B 4R96A 1KENH 4NN5C 4NZJA 3RIFF 1VJSA 3PL6D 2DI9A 1KTLA 1AQHA 2R2EA 3HI1B 4PJGF 2EPKX 5I9QB 1GNXA 1XGPB 3WF4A 2DQFA 3MXVH 5IFJA 3B5GA 1OTSC 2EE6A 4FNLL 3PZTA 4OZGA 4IIQC 1EQCA 1RI8A 4EXPX 4NBZB 3WFHB 2YKKA 4UFKA 1W2PA 1DWAM 2NY3B 4XB8A 4N0YH 3QXWA 1QNPA 1HNGA 1QP1A 1UM5L 4LCWA 4XAKE 4ACZB 4PJFE 3ZMRA 3BZEB 3BW9B 1OT2A 3DHUA 2WNGA 5EOCH 4FQXC 3NCCB 3SDXB 3BUTA 3MA7B 3S35X 3LV3B 1QFWL 2WMHA 4JO3L 2DICA 3EYOB 3P0GB 1UXWA 5E8DL 2ZUSA 1U8HB 4HH9B 3SGEI 3FT3B 3ARGA 1WWAX 4G9FE 3QR2A 5F9OL 1J01A 3RDTC 2X1XR 1S7WB 2Z8VC 4JFUA 4G8EA 5JPMA 5BZDA 1XSKA 4ZD3L 1Y6NR 1XEDA 2W9EL 3U36A 3WKNA 3INUH 1U58A 43CAA 4NO3B 3G6DH 3DVIA 1DBKL 5I1CH 5JLZB 4J3XA 3KLAB 3ME0A 2VERN 5FA3A 1EAPB 1FZJA 3WE6B 3CMJA 3VXTA 5I15H 4ZTOL 2VVSA 4NM4H 1X1NA 1W72H 3ARUA 4NN7B 3EO0B 2P45B 3N0PB 1BGXH 5B8CC 4HUUB 2XWTA 3MLWH 1IGML 1QVBA 3MOAL 3RL2B 3DHJA 4RGNE 2IPUG 3VIJA 3D39A 1G5AA 2KQMA 4AM0B 4P5TD 5HI5C 1KCKA 3VFOB 5D1XD 5EUKB 3BP7B 3GXFA 3QDAA 2OLDA 3UJJL 1OBAA 5C0DA 5CAYB 2EC9U 2EKSA 3MJ7A 3RIKA 4ZFFA 4KHXL 3W2DH 2J8UA 3X13A 3GMRB 3WN5C 4AH2A 2W0KA 1PY4A 4J27A 3CUFA 3IAGC 3SY0B 1YC7A 4LNRB 1MLBB 1KT2B 4FFZL 5DJCB 3QDMA 2R0LL 3LS5H 1UQZA 1UJ3C 4PMDA 4I8DA 2UWEA 1UD2A 1L6ZA 1MXDA 4GBXB 43C9B 5EZLB 2ATPA 3BKJL 1FLRL 5J1AA 2DOCA 5AWNL 3QZWA 1LP9A 4NRZA 5ALCL 3MMUA 3W26A 5D7LB 1CQYA 4HC1A 1SJEA 1IM3B 4MAYA 2N1KA 5ISZE 3HMXL 1T20A 3MRRB 2VCAA 2CIKA 1T22A 5TGBB 3FO1A 1EJOL 2OL3H 3HU7A 4JQXC 4U1MA 1B3WA 3ZE2E 5GS0C 3NABH 4HKXA 1CR9H 3JTTB 4ZUVA 3PF2A 3AREB 2DJSA 5GGVY 1H4PA 3FQWA 5F9DC 1BFSA 5F96L 1EZVY 2PXYD 4HUXB 4GRLA 3C8HA 4DKFH 3HZKB 1IC7H 1S3KL 4YEEA 4N8VB 4C4KO 3MBED 3RNKB 1PEZA 5T1KD 3O9WA 3QEQD 4PJEB 2CKSA 4ZXBB 1T4KA 5I17A 4BQ9A 1VCAA 3KDMA 2XNAB 1Y6MR 1XH2A 4KJQC 5SWSA 3AYRA 1A6AB 2EDLA 3ISWA 2C3GA 3GSVA 2XTJE 3ARBA 4KPHH 4F66A 3MV9D 2PYFB 3RWGB 1BWMA 5FUOL 3QH3A 1RU9L 4YHKL 1A6TA 1LO5B 3EYFB 3OJDB 3QUYA 4X7FC 1CFVL 1QYGH 4UR9A 3VFTB 1TJGL 2BOBB 3VE0B 3QJHA 5CMAA 5FYLD 4WU7A 1PIFA 5F89A 1S9XA 1AE6H 4O9HL 3RWJB 5LVEA 5A95A 5I1LA 4KAQH 1FHLA 3OXSB 1W9UA 3IU4H 5DJ0A 3BQUA 3CVHA 4WV1A 5IB4A 1CFQA 1FO0B 3IETB 1RUPL 5C0CA 5BMFH 1I3UA 3EHBD 3LVEA 4PJDB 1G9EA 2X4RB 3KYNA 4CD8A 1X44A 5DMKB 2P8LB 4ORGB 2LU7A 4JY5H 4XH2B 4TTGA 3EFFA 4MDOA 3VDAA 3O6AA 5D72L 3HG1E 1OB0A 1WBZB 4AMCA 3DUUB 5IB2A 3TYFB 1OD0A 3IKCA 1BQHB 2YBTA 3OZPA 1VEMA 3S37X 3NGBB 3FTGA 2G9HA 1U3YA 1ND0B 4KROB 1HJVA 5SWZA 1XD1A 1AD0A 1JL8A 4S1DC 5L88L 5ADPH 4HDIA 1JZ7A 4K7FB 4M3KB 1RK1A 1KTLB 2AJSH 3CZ8A 3VXRE 2R2EB 1A6VL 4F57H 4MB3A 2DQFB 4RAVB 3D0VA 5IFJB 5D2NE 4GRWH 1A7OH 3H9YA 3OV6A 5KS9E 1YNTA 5E5MA 4UT6H 3W9EA 3W5NA 2IC2A 2D0FA 2JB6B 1EHLH 4PGBA 4HUMB 5GJTL 3WH5A 2D4FA 3SCNA 4AL8L 1OAZH 5GXBB 2WZEA 4K3DH 1TENA 4J8RA 2PBOA 4GSDH 5DJAA 1KXHA 1N6QL 1HCVA 1KF9B 2VLJD 5ESVA 2XZQH 1M05A 1UXWB 4XVSH 3BPOC 3EBAA 4WFED 5EBGA 5I1KH 3TH3T 3ARGB 1CQKA 2BK8A 1ZEAL 2AEPH 4BZ2H 2IXVA 4IDJL 4QP0A 4G8EB 1BZQK 5I1JH 3HPJA 5JPMB 5BZDB 3BSHA 2VUYA 3UTOA 1S7XA 2A0LD 3HUJF 1MQPA 3U36B 4DGIL 1UWIA 2KBGA 1U58B 3B2VH 43CAB 2IAMA 2XKUA 3P4MA 4Z2HA 4C56A 2B7DT 4AZ6A 3F65A 5EU5A 5FA3B 4YDKL 1FZJB 4X9HA 4JPVL 1UYQA 4M7LT 3ZE0E 1QBBA 3RI5K 1KPUA 1MCHA 3WUWG 5KANG 5DFVC 2B4CL 2XWTB 5KSBF 1OTUD 4DTGH 1BYAA 2ZWYA 1X5IA 3KAAA 5IW3A 2ZUWA 4AIOA 3D39B 2WM0A 1WAWA 5FOBA 2YA0A 2FHBA 2DIEA 5DGQA 4L8DA 3DX6A 5HYQB 5C0DB 2OJEA 2EKSB 4WEUD 3K2UH 3MJ7B 1I1FA 5IFHL 3HI5L 5DHVA 4ZFFB 2J8UB 2WMKA 2FB4H 4U6YA 4AH2B 5FHBL 2D20A 1DFBL 2G4FA 4I9WE 4AG4H 1BD2E 4BS0A 3WUBA 3STZB 2O9RA 3QDMB 4P4KC 1B3ZA 3KHQA 4S3JA 3SGDH 2UWEB 2D0HA 2NY0C 2VXQL 4PN2A 4U5IA 3Q6GH 2Z8RA 4DGVL 5I18H 2HKHL 3FXYA 1ORSA 2ATPB 4ZS7H 5J1AB 4X9YA 1UH3A 3QZWB 2G8ZA 1TZIA 1DQML 4LHUD 2VDQL 1JHLL 1LP9B 4NRZB 4IRSD 1G0DA 5ID0A 4U4BA 2ZNWA 2RFXA 4TUFA 1FBIL 3ZHKA 5EUOF 2PWEA 2BRQA 1SJEB 4MAYB 5IVOA 5ACZB 1LK3H 1T20B 4FQPA 4HPOL 1T22B 3NPSC 3OAYK 3FO1B 3QI9A 2MANA 2QADB 4ODXB 4XBGA 4U1MB 4KJPC 2JIWA 3MSPA 3P77A 2XWBA 2W0PA 5C0GA 1MXGA 3OXRB 4HKXB 4MS8D 2QSTA 5DXWA 2VMFA 3OLIA 1MRCH 4ZUVB 2YRZA 3FQWB 4HQQL 4X6FA 4FXKA 4ONFH 4UDUA 2G75A 1YMME 3MRNA 2Z0BA 4GRLB 4LU5L 4OCRH 2FEEI 5KOVC 2J6EL 4U6VL 4E5XA 5A6BD 2E7HA 2QLVB 4NC0B 4XVTL 3O9WB 4O51A 2FWOA 2VLKA 4G6FB 4WFHD 1XIWD 3GH4A 1OGAA 2DQDL 5FFLA 4CCEA 5EA0L 3BAKA 1T21A 1T4KB 3B9VA 4LQFL 5I17B 1QTYT 3KDMB 3L4ZA 5SWSB 2E9JA 5JMOC 3BKCH 1WQVT 5GJSL 5A3IC 3ARBB 3EDEA 3SJVA 4KI5F 1TNNA 2A6DA 2HT2D 5C07D 1NWRA 2LV4A 3TNNA 4U3HA 5D1QD 1TQBC 4B3KA 3MUGA 1BG9A 5JR1H 5AC5A 3QH3B 4PRIE 1T89A 5CPSA 1A6TB 4R4NC 1QPXA 5HHXH 3LB6D 3QUYB 2YD3A 1KJ2A 3QIUA 3W9DA 3QJHB 5CMAB 4Z7NF 1KG0A 1EGZA 2FHFA 4QRRE 4CCCA 1S9XB 3FFCD 3AY4A 3WFEL 1OAUH 4ZFGL 5I1LB 2YR3A 1B3XA 1MAJA 5DJ0B 3BQUB 3U9PH 1WBYA 5IB4B 1CFQB 4AW7A 1KULA 4JFDD 5C0CB 1B1YA 2XZAH 3N1QC 4YDJA 1CT8A 2DF3A 2O5ZL 4R9HA 3W0KA 4NCC1 4PJCA 4W87A 1KJ3L 1T7XA 1F42A 1C5CL 2P5WE 4AD3A 4EN3D 3MA9L 2H41A 4C54A 1EMTH 1EX0A 4ZAKD 1J1XL 2F5BH 3QDJA 4OI9A 2PWDA 1JNDA 3H2WA 5HI4C 4JQIL 4EKXA 5IB2B 1OAYL 2AMGA 3TESA 4WO4C 5AYBA 3KLDA 1L8NA 2FJGA 1YC8A 1VBUA 3K80A 3FTGB 2NTFA 2G9HB 3SUWA 1NFDA 2F58H 1AD0B 5BV7L 2BVOA 2VZTA 1V3HA 2Q8XA 1N0LA 1NEUA 4KQ3L 5B22A 3WXVL 1E9LA 5EZIL 1F4HA 3GNML 2OSYA 1FORH 3D0VB 1NCBL 2OSLA 3MV7E 1H5BA 2NNAA 2XFYA 3O2VH 2MTPA 2WHKA 2A6JA 1YNTB 2ESVA 4IOIA 4Y4FA 5E5MB 4U3AA 4GKNA 3VXUE 1OWRM 4UIKH 2ZX7A 4KUZH 1Y0LA 4KFZC 4PGBB 1J1OL 4NP4L 1KBKA 2QL1A 2OP4L 3NCJH 2YPKA 2WBJC 3MNVB 3D9AL 1A6UL 1C1EH 4MJ6A 3O9NA 2VB5A 3WJLC 4J8RB 1F3RB 4MSWA 5I73C 5J6HA 1NGQL 5DJAB 4LYQA 5ESVB 5HGAA 3WUWA 5JIKA 4M1DH 1M05B 4WFGE 2HG5A 3QFJE 5GGTH 1ZGLM 4YWGH 4PJ5D 1RZ7H 4M7LH 3MMDA 3P4NA 2DSVA 5FIPA 1UD6A 3HPJB 4Z2IA 2BZDA 2CDGA 1NC2A 1S7XB 1MFCH 2YHGA 5GGSB 3IXTA 2IAMB 3I3DA 1WVZA 3A6BL 3P4MB 4PG2A 5ELIA 4C56B 5D5MF 4AD1A 2HA1A 4FG6C 3U5UA 5KSAA 5I24A 1T1WB 2YPLD 5EU5B 4PR5A 5IVXF 3OAUL 5F8RC 5E00A 4PY7A 4V1DD 1KPUB 4S1SL 1SFSA 4R27A 5BYWA 4OTXH 4YUEL 1DQDL 1KXVC 5TE6L 3W11C 2EH8H 1OSPL 5FOBB 4UB0L 1QBAA 1J9CT 4L8DB 4OCXH 3DX6B 3EMCA 4KRUA 1CL7H 1Q94A 2OJEB 3BFOA 3QWRA 1V7NH 1HN1A 1ZU8A 3RWIA 3OKNA 1I1FB 5DHVB 3IJ7A 5F7HA 5KOMC 2DGAA 3DHPA 4FFVD 4U6YB 4UILH 4NQDD 2NLJA 4HAFA 3OG6B 1SEQL 5JXEA 3FN9A 3ZJ7A 1G7IB 4OLEA 1JPSH 3VIOA 2PW1A 1ERNA 1D9KA 1BG4A 1INDL 1NANI 3HAEG 1I1AD 3AOFA 3JV0A 3D85D 4NKDA 3T0AA 1ES0A 3I9GL 3VIFA 3HMXA 4GMSL 1ODUA 1ORSB 5CWSA 5FUZH 4MAUL 3PE9A 3MLRL 1TZIB 2XQYG 5ID0B 4FQQA 2RFXB 3DLQR 4CD7A 2W66A 5E2VH 2EDHA 1BFNA 1KN4H 4JZJA 3VXQB 4LGSB 1HH9A 2GDVA 1U9KA 3SDCA 3E6FA 4JFWA 1C92A 3JWDL 4XBGB 4JM4L 3P77B 2XWBB 5C0GB 4JHZA 4L8BA 5J89A 1L0XA 2GY5A 4U7SA 5DO8A 3D2UA 4MA7L 1FYHB 2H26A 1AR1C 4HZAA 4HA3A 4ZXOA 4XBPA 4X6FB 4FXKB 2JK5A 3GJFH 5E4IA 4UDUB 3MRNB 4E5XB 4EDWH 4CL7A 1QVOA 3MZGB 1FYTA 2ZKHL 4KQ4H 3RIAF 3TFKD 1FGVH 4O51B 2FWOB 1J12A 4EXKA 5D70L 3CHCA 2VLKB 4S1RH 5E4EC 2O92A 5DUML 1OGAB 3GB7A 1XCXA 2OZ4L 3U79A 2WCSA 1FE8L 4J3VA 1T21B 2FGZA 2ICWI 2QSCH 1RD6A 1NUFA 6CGTA 5HGHA 1CK0H 3PZOA 4Z76A 4KMTH 3SJVB 3SQOH 1E1FA 4MVBD 1CLYL 1HE7A 2A6DB 1TUXA 1EUTA 3I2CH 3MLPA 1CD0A 3O2DH 3TNNB 5CJXA 3RWHA 3MUGB 3QPQD 3NIFF 1S8DA 1CGSL 2WKLA 4QTIL 3BAYA 4ZXLA 3D3VA 3UP1A 4YQXH 4KZDH 2BSRA 4LSPH 3VXSE 1T7VA 2VZOA 2EXOA 1ZSDA 4J3UA 3V4PH 5E6ID 1KJ2B 2NT0A 4P3CH 3RHWF 3QIUB 5CEZD 4MJIA 2WLZA 4P2CG 3W9DB 1UADC 3SCQA 1WDRA 2P7TA 5C08D 4L4OA 1SJHA 3SCSA 1FG2A 4Q74A 1MAKA 4CKVX 5E03A 3L6FA 1MQ8A 2DT3A 1WBYB 4AZ7A 3X3GH 1MW3A 4OZIE 4YDJB 1CT8B 3SCMA 4PJCB 3X12A 3WSUA 3VD4A 2AJVH 4F79A 2FX9H 5KVEL 4WI2A 2KH2B 3L2MA 1UHVA 5C6TL 1GOHA 4L4VE 1K6QL 2FJGB 2YD9A 3RIFK 2NTFB 5HPCA 2J8HA 2P4AB 1XGTA 1HH6A 1NFDB 4K68A 1N3NA 1IT9L 1OB1A 4PJHF 3MCLH 4O02H 5I1AA 5IVNA 1JMZA 4IBLT 3RGVC 3CFCH 4N8CL 1MELA 2BVOB 1CF8L 4W4OC 4Q6IA 1WDSA 1CS6A 2B1AL 1D5MA 2Z1KA 1CNVA 3MRFA 1UG6A 2HT3D 1NGPL 5L6YH 3RL1A 1YNLH 4OQTL 1FPTL 2PTUA 2OSLB 4U33A 1H5BB 2NNAB 4NO0A 5KBNC 4B53A 2A6JB 2ESVB 4YK4B 4IOIB 1ONQA 4Y4FB 4GKNB 5BW7C 1LO4L 4OI8A 5T1LD 4LF3A 4NO2B 1BGGA 2HT4D 4NQCE 4OB5H 2Q8AH 1HKJA 4JFQA 1Y0LB 5TF1L 5D1ZC 2YPKB 1PDKA 3ZIZA 5EOQL 3TA3A 2EO1A 1ZMYA 3UDWA 2Q7NA 1YYMH 4MJ6B 3B9KA 3RGHA 4MSWB 5J6HB 4J2XA 3SDYH 2AJXL 4QXTA 1NCWH 3BKMH 3P30L 4G8GA 5HGAB 3ZDZE 5CBAA 2HG5B 3NPZB 1AD9B 5SX4I 4O4YH 5HDOA 5DMGC 4X7DC 2XN9E 3NAAL 3QXVA 3AGVA 3P4NB 3U0PA 5LGHL 3VWJA 4X8XA 1KGWA 3L4WA 3BVNA 5DJYA 1HIZA 3MUHL 4W85A 4XMLH 1U3HA 5DJZA 1AFVL 3GSOA 4RFEB 2CDGB 3QIWC 3EYSL 1NC2B 1SYVB 2CSPA 3CPUA 4ISVA 1B4JL 1UWUA 4JY4A 3FCTA 2VABA 5KSAB 1CGVA 3VFNA 3BN9D 4LSUH 4PR5B 4OGYL 4I2XE 2JJUA 3JUYA 2PTVA 4MQTB 5E00B 1ZLSH 4D0BA 1MCSA 2VDRL 4PY7B 2ICCA 2QSQA 1MVYA 2Y23A 4EAMA 3ARXA 3HAEA 1A22B 3CMOL 3WCYA 3UETA 1NKOA 4NQEA 2WBGA 4HA1A 5AC4A 5KEZA 1W0VA 4JDTL 2BCKA 3LEYL 5IF0B 3TO4A 5I1GL 5F1IA 1JDAA 2A9NH 3F12A 1Q94B 4M80A 3DV4A 3ZDXE 4ACPA 3RWIB 4NFCA 3OKNB 1C93A 5J9PB 1FNGA 2DQEH 1SBSL 2UVFA 4LXFA 4BZYA 2NLJB 4KMLB 4XMKL 3WO4B 4BQ6A 5DT1H 3GYCA 1II4E 4HMDA 2O5XH 2PW1B 1AH1A 3UTTD 5J13C 1D9KB 3QNZB 3I84A 1IBGH 4NKDB 5BS0D 1ISWA 1HHGA 1ES0B 4PBWD 1JE6A 2EYRA 4JPIB 5CWSB 3MLTA 3QEGL 4PP1D 1U3JA 3ZM8A 4ZOEA 3AHZA 4EDXA 4OIAA 3C5SA 2AXHA 4W8LA 4FQQB 4QT5A 3B9EA 4YHYB 5D6DC 3N9GL 5L8LB 4NC1C 3ULSB 2G5BA 2DQCH 4P59H 1T5WA 4JZJB 4U1NA 1HH9B 4LPYA 4NC2B 4URTB 5GS0L 4LYRA 1AKJA 1B2WH 2W92A 3E6FB 4XWGH 5F7LB 4GG6E 2J6EA 1QRNB 1G9MH 4AC1X 4L8BB 4X4ME 1QI2A 2DTSA 1R24A 3HE6A 2H26B 4PJXA 5C9KA 3VG0H 1Q6DA 2X1WL 1KYOJ 4XBPB 4CW1A 1YEDA 4NNPL 4LDOB 5GRJH 3BDXA 3CSGA 1C8PA 1QHOA 5GSVA 4WI3A 3AAZB 2A73A 4DWSC 1E6JL 4IOSD 1QVOB 4LKCB 1FYTB 1TJHH 5HYSG 2EEBA 4XHJC 2X4OA 3ROLA 3OA5A 1GIGH 1U91B 2EE9A 3GB7B 5E6YA 2VI0A 2NYYC 4TUKL 2AJUH 3TO2B 4FQHA 1LVEA 1G1CA 3U0WL 5HGHB 1MJUL 4XI5C 4Z76B 4E0RA 2BSTA 4UNTA 4UBDD 2VDLH 1N4XL 1P4IL 5E9DD 1IL1A 4WI9A 4FFWC 3MMEA 1QHPA 2EDFA 1S8DB 4DK3A 32C2A 1U8NA 3MRLA 4N68A 2BJMH 1UYWL 2L7UA 4APQC 2BSRB 2X4UA 4GG6F 4LCYA 3WNNA 1ZSDB 1S7RA 4YHOL 1YN7A 4MJIB 3SCWA 4PUDA 1P69B 4OLXL 3WDRA 2YBRA 2P7TB 1SJHB 1H8NA 1FG2B 3RY4A 1GGIH 3L6FB 4OT1L 4JFXA 5A8PA 1PYWA 1PJ9A 4DZ8A 3CDFA 5AZ2H 1CICC 3CX5K 3SCMB 1KCVH 1MJ8L 3N85H 3LPPA 1LD9A 5IMKA 1JGLH 3NN8B 3F6IA 4XX1G 4X80H 1MHPL 3X12B 2AQ3A 2ED8A 5A2JH 3I6LD 2WUCL 4DKAA 4PB9H 1CBVH 3MROB 2WC7A 1KPRA 3GJEA 1TTFA 2DL9A 3RZCA 4Y16D 5D9SA 2GTZB 5EWIL 1VIWA 4YBHA 1XGTB 1HH6B 3ULVF 3BP6B 2CIIA 3ZJKA 3Q6FA 1N3NB 3V6OC 4AEHL 2LE9A 5B38G 5I1AB 4U2YA 3REVA 5FEBA 3QHFH 4Q9RH 2GCYA 3LRHA 1WO2A 4DN4H 1GORA 1OCQA 4Z0BL 4Q6IB 1WZKA 3ARDA 1D5MB 3SDDA 1SHMA 3MRFB 4PJEF 1B0WA 1UM6H 4GO9A 3WUFA 3RL1B 4GI9A 3BT2H 1EOKA 1SY6H 4E2OA 1BQLL 3BWAA 2IG2H 3AB0C 2JB5H 4NO0B 1YEJL 1BQCA 1ONQB 2AJYH 2LU4A 4Y1AA 4LF3B 2IANA 2DLTA 4G42A 4JFQB 3WIHL 3WDPP 1V0LA 2E9IA 4LCCC 2F15A 3CVIH 4PJ7A 3TA3B 4NN6C 3GTNA 3DSFL 4WKHA 3B9KB 1OOAA 1MFBH 1QLEL 1QNOA 1HJSA 4K7PH 2GJ6A 2ORBH 3PWNA 4R0LC 4HGMA 3MREA 4QXTB 4DUVA 2DQUL 4G8GB 3HE7C 2BDNH 4EOWL 5E8EA 1ODZA 5CBAB 4MMZC 5ADOH 3W0WD 5L7XH 1YEIH 4J28A 3B9DA 3VOCA 4NGHL 3U0PB 4DZBA 2IH1A 1JGVH 3BVNB 5DJYB 3NFSL 5DJZB 1U3HB 2A77L 4DM2A 3GSOB 4JFEA 4J3TA 2I9LA 2AQ1A 2UZIL 4YDIL 4EI6A 2ICWJ 3M1BB 4TVSa 3K4ZA 4JY4B 2X6MA 2PN5A 3FCTB 2VABB 4HF5H 3VFNB 1AIFA 1LLOA 4PJDF 3W25A 3K8LA 4OUEA 4L3EA 5KVDH 1NGWA 1K3ZA 4D0BB 4CADA 4I1NB 2DBLH 3E0GA 1E4KC 3HAEB 3QEQE 4J4PA 5DO2D 1QSZA 1O5DT 2CK2A 2YXFA 2GT9A 3VRIB 3T09A 3GXMA 2P44B 5A2AA 4NQEB 1RURH 4TVPD 3ZYZA 3HNSH 1W0VB 2BCKB 3WBAA 2VUOA 4E41A 2DB8A 3TO4B 5F1IB 2YEZA 4HWEH 2XOTA 4OKVA 3F12B 1MFAH 3DV4B 5FCUL 3KZSA 3QG6B 3MV9E 3UPRA 2DTMH 4JQVC 2Q76A 1FNGB 1CBGA 1CECA 2DT0A 3NFNA 4X6CA 3NIDF 2O93L 4TSCL 4F80A 5HHPA 4DAGH 5FA4A 5DVMA 1Q9WA 3WQ5A 3OLEA 4X7TA 3RY5A 1GSMA 4D6JA 3F58H 4LLQA 3QSKB 4P2OD 3IGAA 5IT2H 4PUBH 5FYLE 1HHGB 2EYRB 3IFLL 1U6AH 3MLTB 3GHBH 2HLFD 4ZSOA 1HHIA 4KI5D 4NPYA 4EDXB 3KPRA 2E4TA 2VDOL 3C5SB 4U3XA 1KBBA 3IDMA 5HYSA 1A7RH 4QT5B 3S36L 5EU3A 4V2BA 2G5BB 1RJCA 1WZLA 1XH1A 1C3FA 1T5WB 4XC1L 4U1NB 1MVUA 2E5EA 3IJHA 2AAVA 3RTQA 4I13B 2H1PH 1AKJB 2X4PA 3LIZL 4D6DA 4NKIL 3STBA 4UZSA 2XXMB 3LZFH 1N8ZA 1F4YL 1FHGA 2FEDD 4F9LC 1R24B 2PETA 3S88H 1E4MM 2ZXDA 3N06B 4R8WL 3FZUD 4PJXB 3SOBH 4YHIA 5BQ7A 3WS3A 1K9TA 4CW1B 2OZ4A 3MV8D 5GSVB 3EDDA 1PPIA 5MI0C 2A73B 4ERSH 4RMSA 1HT6A 3WF3A 2FGWL 2X4OB 3ROLB 3WNKA 1G6VK 4POZC 1FFOA 5MEPA 4GW4A 3C6LD 1MCDA 4QXGH 4FQHB 3HR6A 2YD8A 4E42A 5C1MB 4MCZA 3DMMD 2UY3A 1T7ZA 3O4OC 4KVNL 4GMTL 4E0RB 2BSTB 4JAWA 3WLWC 3TYGL 5CSBA 4Z78A 1IL1B 5HHOD 3MMEB 2ADGA 5KSVA 3M8OH 2EC8A 3P9MA 4YLQT 3U7WH 5MEOA 1ZHKA 2HFFA 2ILLA 32C2B 3ARFA 1U8NB 4JE4B 5KN5A 1VSCA 3MRLB 2J8UF 2X4UB 1LMKA 4UUJA 4BZ1H 4LCYB 1S7RB 1VFOA 1YN7B 5I19L 3T0XA 2NY1B 3PHAA 2VLJE 3KXFD 2VOTA 1PGRB 3N17A 2YBRB 5D71L 4WFEE 2JIXA 3C87A 1GHRA 3U2SA 2DSZA 2JJTC 3PV7A 3VFRB 4M93C 2UWEF 1AI1H 3BAIA 2WCGA 4JFXB 3O4LA 5B38A 2CRMA 1JG9A 1PYWB 3BGFC 4KUCF 4IS6A 2NXZB 1FH5H 1HQRA 3RJDA 3ES6A 5EO0A 4UCFA 25C8H 1I1YA 4DK6A 3TBTA 2ZCKH 5IG7A 1LD9B 3HFML 1T0PB 5IMKB 1J8HD 1VESA 1YY9C 1QOKA 2J12B 1VB9A 1JNNL 1BYBA 4DKEL 2VDML 3U30C 5KZCB 2X1IA 2Z1SA 3H42H 4P7RA 3CCHA 1AHWC 5IMLA 4MHHG 2IGFH 5IWLC 3GJEB 4RISL 5LBSH 4LSRL 5BV7B 3RZCB 3V52L 5T1MA 2BRRH 5D9SB 2J1KA 5D7IA 4MA8H 3PQYE 3GSNH 3G6LA 4IIQA 2CIIB 2V7HA 4JKWA 1BX2A 4OQTA 4Q58C 3REVB 4DVBA 4RFNC 2GCYB 2A0LC 2C7UA 5FUCC 5E2TH 5HI3D 1KEGL 1JZ6A 3MBXL 5J11C 2Q87A 2ARWA 2KPNA 5TH2A 2VZ1A 3SDDB 3ARVA 4KHTH 5TDNA 4YHPA 4NWUL 1MCPH 3C60D 1I3GL 2LTQC 1NSNL 4F7EA 1B0RA 5GRUH 1UZ1A 1LG1A 2FX7L 4MNJA 5HYEA 1MREL 4Z7OF 2IANB 3OX8B 4G42B 2YL6A 3UCQA 1WGOA 4XP1H 3Q1SL 1OM0A 3HA0A 4NF7A 1FL5A 2C4XA 4PJ7B 2RGMA 5CINL 1W9XA 4LIQE 2H45A 3LKNB 1LGVA 3VXMD 3FN3A 4EUPG 1DDHA 1HK6A 5FECA 2GJ6B 5DEZA 2ADFH 5EG6C 3PWNB 4Z8FH 4N1EA 3MREB 2QQQA 2F19L 4TTDD 5DD1H 5E8EB 2D0GA 3TJEL 2WVVA 3SKMA 1VAHA 2VXSL 5LKNA 3L5HA 2XWJA 5LWYL 1N59A 3E2HB 4DZBB 1M6OA 2IH1B 4XGZA 3TT1L 1R7OA 1MSPA 5B8CA 5IIEB 4JFEB 1KLGA 5CFHA 2I9LB 3QG7H 3TLRA 3F5LA 1QD0A 5J06A 4G9FA 4M6NH 2E9BA 1A7QL 1ZBVA 4JGMA 4KKLC 1F6FB 3QHTC 5SV3A 1AIFB 3W28A 4JFPA 1FFNA 1NL0L 3T1WA 1HVXA 4L3EB 1NGWB 4PJ9C 4U1KB 4H88H 5C6PB 1OW0C 5GGSY 1IAII 4NWTH 2BNQE 3WN5A 1HDMA 4M62L 1HHJA 2N7AA 5T5NG 2GT9B 4Z7VB 1AJ7H 3AROA 1JUFA 2B8OT 4JPWL 3RWDB 4YXLL 1T2QL 4GOSA 5CP3A 4PJIB 4PMOA 5I16A 1P6FA 3QUML 1Q4NX 3B3IA 4JKPL 1TIUA 2IFGA 4E41B 1UJ3A 5ILTH 2B20A 2B5IC 2OXGA 2NW3B 3HN3A 1H0DA 2YEZB 4P9HH 3QUZC 4CNIA 3UPRB 4DCQA 5C07E 2HMID 1OD7A 4PMYA 2W61A 3WS6C 4E4PA 5IXEA 3NFNB 4X6CB 3A4XA 1CGYA 2GYSA 5GRZA 4KH2A 4BF7A 5HHPB 3W29A 4I0PA 1Q9WB 4KKBD 4X7TB 1O7AA 1AO7D 4LLQB 3EOTH 1RZKC 2X89A 2JE8A 3IGAB 1VEOA 4LVHC 1UACL 3ALPA 3FFCE 3FN0L 1TR1A 2FEEL 4YC2B 2IMMA 4ZSOB 4NPYB 3KPRB 3E1F1 4XNZC 5I9QC 3IDMB 2YKLL 4JFDE 3SO5A 1I3VA 4GUPA 5L9DH 1N5AA 1P4BH 4OIFA 4OM1L 1VFBA 4J1UA 4FS0A 2V5YA 1DZBA 5D1QC 4OQ1A 4XZBA 1MVUB 3IJHB 3RTQB 5H37G 3V5HA 4B15A 3RAJH 2L4OA 1BPVA 2X4PB 1LWJA 1WZMA 4LPWA 2PWFA 4M1CC 5GRYA 3HB3D 4KDVA 1EERB 5ISZA 1VHPA 2EXYD 4RMTA 5DD3L 4FQLH 3BUYA 3RIAK 4D8PA 4YHIB 4X7EC 5BQ7B 3WS3B 3H9SD 3MXWL 4HV8A 2VLRD 5ALBL 4KV5E 3UZVB 1CD1A 3TTQA 1NLBH 3ESUF 5I1HL 2DLFH 1A9EA 1AC0A 4MNQA 4WHCA 5IW1A 3E6HA 3CD4A 2V5MA 1GHFL 1FFOB 4BUHA 1GQLA 5MEPB 3MYZA 4M7ZB 4GW4B 1JGIA 1ZV5A 1UZ4A 5F3HA 5GNYA 2X10A 4E42B 1MCLA 4MCZB 1NMCB 4JFZL 1L7TL 1X5FA 4PGEA 3AMGA 3RNQA 1KIUA 3RX7A 1B6UA 2B0SH 4ETQB 4Z78B 2CR6A 2VRAA 1UD4A 4LVEA 2ADGB 4NN7C 3MTRA 3NA4A 3P9MB 3CXDH 3RHWK 3PDGA 1ZHKB 3ARFB 5KN5B 5C8BB 3MJ9H 2BVUA 4LARH 1NCDL 3P11L 4G6JL 1FDLL 1FFPA 1U8OA 3RU8H 1HJUA 1YDPA 1O7SA 3KE0A 4D6GA 4HXBH 1FV1A 2NXYC 4EI5C 1EAJA 4F3FA 1CXIA 1HILA 3U2SB 1TETH 4S1QL 2NT1A 3ARWA 4PJ5E 2FBJH 3HCVA 1S9WA 1MWAL 1UCBL 3F7RA 2EDNA 4UINH 5GJTH 3O4LB 5B38B 3VDHA 3HNTH 4IS6B 3GBMH 1HQRB 3LQAH 4R7NA 4EKJA 4C58B 3KL5A 1XSIA 5EO0B 1I1YB 4U05A 4OLYH 5IG7B 3TBTB 1D5BA 1T03L 4M56A 2IEPA 4EE9A 4HGKC 2IFFL 3PZVA 2YPLE 3N1PC 2Y7QA 3WFDH 1NARA 4NN5B 1X5ZA 1F4XH 1WZAA 3CCHB 5IMLB 2XKSA 4Y89A 5TPWH 4ZQKA 2ZX6A 4V1DE 1D6VH 1CG9A 4X7SH 2AABH 3PWPA 1E27A 5EFIA 1S78D 5T1MB 4KRTA 3CZGA 3HG1A 4C55A 1E6OH 3G5YA 3TN0C 4ZTPH 4IIQB 5TDOA 2V7HB 4EUPA 1BX2B 4JRXD 2BXZA 2HKFL 3EOYG 2C7UB 2EDXA 4OBSA 4ZODA 2XIIA 4JPVH 5TH2B 3SBWC 3WIHA 1KBGL 4FQXB 5TDNB 4KJWD 4NQDE 5A2KH 2E40A 1N0XL 4OLZH 2DQJH 1DQLL 3RUGE 1B0RB 3CTTA 4OGAC 2C0HA 2P5ED 4IM4A 1ETZA 4N1CA 3WF0A 4MXVE 5K9QI 3RRQA 4NNXA 1QR1A 2DN7A 2Y9RT 2V3GA 4K3GA 2ZCHH 1FL5B 1RIVH 3SE4C 3VGDA 4PLJD 5KS9A 3REWA 4HH8A 4HJJL 4NUGL 4PJBA 1P6AB 4ZUWA 1DDHB 3THML 5FECB 3QXAB 1RPQA 3DYOA 3WIIL 3O6ML 5GZOD 4QLLA 4ZG1A 3NACH 3QCUH 4RSVA 2CITA 3SKMB 5GS3A 2UY2A 5IB3A 2WVVB 1YZZA 4WW2A 2XWJB 2IJ0C 1M6OB 4XGZB 5B8CB 1CXFA 1T0MA 3NYDA 1KLGB 1N5YL 4S0TD 4G7YH 3CSYA 1PG7H 4TPRL 4P7LA 2NY3D 4G9FB 4M6ML 3TZVD 3VMOA 4TYUA 1FA2A 4NO5A 2X4TA 5DWUH 4RNRA 3G6MA 1A6WL 3MJGX 3QWQB 4PJCF 4JFPB 1FFNB 3U4BL 2XVNA 3UZEA 1LG2A 4OGXH 4O2CA 3NIYA 1FNEA 3WN5B 1HDMB 1R3KA 3EJZC 1HHJB 4XPTL 3MNZA 1JUFB 3BGAA 2FSEA 3S9DB 5I16B 4O00A 3B3IB 2V7NA 3AIBA 5C0RH 3EYVB 3SE9L 1UJ3B 2EYTA 1G6RL 3ROOA 1XR9A 4RX4D 1ZANH 5EO9A 1H0DB 1F58L 1GXEA 4HUWA 2XVLA 4CNIB 1NFDF 3MZTA 4OBRA 1JAKA 4RGNB 4DCQB 4TULL 1BIIB 2ZJSH 4NZTL 1NWTA 5M5DA 3WL9A 3NGBC 4I0PB 2VKXA 3C8KA 4YHGA 1OF2A 4DOHE 3RBSA 3CFDA 1Z9LA 1F3JA 4QHNA 3D25A 5CEZE 4CCDA 1G0XA 4PJGE 4PV8A 4KRLB 2WYSA 2F2HA 4PTMA 1DEDA 3S36X 2PO6A 1BD2A 1IAMA 3LRGA 8A3HA 5H8DA 5CJOL 3AHXA 4BELD 2DIAA 1ESWA 1V0MA 4NSKA 2ARJQ 3T8XA 4RDQG 1MCWM 1X4YA 2W0FA 2CGRH 4X4YA 2JELH 1D5IH 4GUPB 1N5AB 5A8OA 1A4JA 1VFBB 4J1UB 3IRZA 3ZKSD 1AXIB 3V5HB 1QO3A 2VQTA 4IM8A 1WTGT 4FMKA 4KZEH 2R9HC 4AMKL 1C91A 4A2MA 3WFBH 3BDYH 3CLFL 4JAMA 5ACLA 2VX7A 3OAZH 1BGAA 5ISZB 4YFLF 1NMAL 1FSKC 3ULUH 3BUYB 2NX5D 4D8PB 2PUQT 4GBXD 3JVGA 1E72M 4H8HA 4HV8B 1CZ8H 2AERT 1CD1B 3ARGC 2FZ3A 1A9EB 4MNQB 4Y7EA 1HL8A 5IW1B 4HPYH 3T1FA 3O41A 3E6HB 2E7MA 1YMMA 2EECA 4WI7A 5FGRA 1IGIL 2DQTL 5F3HB 5AY7A 3SKJL 4KWUA 5DF0A 1K85A 3PIQA 1FN4B 4JO4L 4NJ9H 4G5ZH 5FF6A 4PGEB 3MQIA 3R1GL 3RNQB 1DBAH 3QIBA 2DMCA 5MHSD 5E8OB 2BY1A 4Z7QF 2CMRH 3ARED 1A7BA 1EOMA 1F8TH 3ULVD 2GAZA 4M61A 2BVQA 5BO1H 3NZHL 2AEQH 1I1WA 3FRPG 1EH9A 2XTJB 2UUDK 1U8OB 5BWFA 4ZNCD 2W67A 4G6AD 4BH8A 3PG2A 2DQHL 4PRIA 3A6CL 3VD5A 3O45A 1FL6A 4F3FB 1HILB 4XMPH 1G7PA 3HCVB 1S9WB 2PF6A 4PGCA 2JJVA 5DTFB 3WD5H 4WO4A 1JZ5A 3MS8A 4QRRA 1MIEL 2D7PA 2CRIA 1YQVL 4R7NB 5A2FA 2BSSA 3ALWA 5I0DA 1JGEA 2EEDA 1D5BB 2ID5A 3BRFA 1I4FA 4JL1A 1T7WA 1AQMA 4BQ5A 2Y7QB 3DETC 1UA3A 2P42B 3OTTA 4KK5C 1CDCA 1Z3GH 1FNSH 4ZQKB 2C3HA 1KCRL 2IBBA 1CG9B 1FNLA 2P5WA 4M81A 4HBCH 3PWPB 1E27B 5EFIB 2GSJA 3F5KA 1ZT1A 3HG1B 2J88H 35C8H 4TNWF 2D7OA 2WQ8A 4TRPL 3KPOA 5TDOB 4EUPB 1US3A 3EJYD 4ODTL 4LX4A 1L9NA 5JHLL 2WBJA 5KJRL 4FFYL 2XACC 3G04A 3ZTNH 1IGCH 3O6FD 3MCKA 1OIMA 5JZ7D 1CDBA 3HR5B 4UIMA 3R8BB 1H15A 1UWEH 4P2QD 5CJ5A 5HVWA 5A6SA 3EIFA 2AK1H 2WP3T 3VXOB 2VWEE 3ALGA 1EVTC 2EH7H 4GRLC 1T7YA 3UTTE 1ETZB 1H2JA 2WC3A 3NDYA 1QR1B 2DT1A 3C5JA 3MV7A 2AI0H 1A5FL 2OR9L 3REWB 2BP3A 4KROD 5IHUH 3WHE1 4PJBB 2H32A 3VRLF 3RVWD 2Z31A 1DSFL 4ZUWB 5AAMA 1CN4A 2CJUH 1BFTA 4ZFOL 4QRTA 1ZTXL 4YFEA 3ARBC 3CXHK 4FP8H 5IB3B 4Y4KA 2XA8H 2YZ1A 5T5FL 5I8KH 1BQSA 4J3WA 4WW2B 2W9DH 2FO1A 4KVCL 1JV5A 4KKCC 3HC4H 1T0MB 5FGCE 5T3XL 4Z5RA 1DN0A 3GRWL 1X5KA 1J7VR 3QFJA 4DEPC 3CSYB 3QUYC 5BVPH 3GK8H 4Z2LA 1KXVA 4PCSA 4YXKH 4HLZH 1KFAH 3BMWA 3GI8H 2JIEA 2X4TB 4RNRB 2PF0A 3QUMA 4KK6D 4JFTA 4M8UA 3AFBA 4TSAH 2O9PA 5SX4H 5E2WL 1JFQL 2D7QA 1FNEB 1RUAL 4WV1C 1R3KB 2VC2L 5E8NA 2I5YH 2A1WH 2XKNA 5BXSA 2FSEB 5CIPA 2HRPL 4AQOA 4WUKH 4UQBA 1REIA 4P4KB 1UR8A 4UOW0 5H94A 5JW4R 1E0VA 2V7NB 4M43L 4XC3H 2EYTB 2OWWA 3ROOB 1XR9B 5EO9B 4GXPA 2NY0B 1A8JH 4HUWB 1M71A 3BSGA 2V17H 3UAJC 4ZNEE 5C3TA 4K23L 5E9DE 4OD2A 4K3JH 3T77A 2BMKB 4G6KL 2OSXA 5ERWA 5E6ZA 4L9DA 3WL9B 1WB0A 1FL3A 1MFVA 2XRAL 1UR0A 4DQOH 3C8KB 5GGRA 3POHA 1OF2B 4LLMA 1I8LC 1E4WL 3CFDB 3WH9A 1E4XL 1F3JB 2EKJA 4QHNB 2DH2A 2ZCLH 3D25B 1RUML 4PV8B 3O6LH 3NPSB 4J3SA 1DTUA 1BD2B 1E70M 1ECEA 4K07A 5C0IA 2OR7A 1T5XA 3CPLA 3GM0A 1CXLA 4NSKB 3T8XB 2VDKH 1BSIA 2W0FB 3LCYA 4FQCL 4X4YB 4K8RC 4HIXH 1AVAA 4GO8A 4UBDC 3R4DA 1A4JB 4Q9QH 2XWDA 3GH5A 1MAMH 1QO3B 1FVCB 3R06A 4FQJH 2W91A 3I6LE 2R4SL 4JAMB 3QQNA 5FYLL 4GAJH 1MY7A 4ENEC 2COQA 3TVMA 4K9EH 5FO8B 1JHKH 4MQXC 4P0DA 5IJVA 4KUCD 5FKAA 3FRPA 3QRGH 2EO9A 3HUJE 1V6VA 2MMXA 4OF8A 5ICXA 2FZ3B 3I75A 4G80A 3I3BA 2N4IA 2XFRA 3VILA 2JCCF 1TQBB 3T1FB 4PS4H 4X0VA 2J62A 1YMMB 3CLEH 4WLCA 1XF5A 1IKFL 4WY7L 5F7YC 1JRHH 5BXTA 2QADD 3PIQB 1H5VA 4XNUH 4B7IA 5DEFA 2NY2D 1CU4L 5CGTA 4UZUA 4PJ8D 5A8QA 4HT1H 3QIBB 5KSBE 1VF8A 4ONGH 3C08H 3AVEA 1PAMA 5E2UL 3DNKA 1IM9A 2BHUA 1DR9A 4M61B 2FJFA 2BVQB 4KK8C 2FATL 4O2FB 5DS8A 1BBJA 5CEYA 1E55A 1MWAA 1WFNA 1JTOA 1MIML 4M7JH 4OIBA 3VFWA 5C0BA 4NQXA 3CUPA 4JRYD 2PCPA 5D7JA 1W2KT 4BH8B 5K59F 3NBNA 3O9WD 3CH9A 1RMFL 2DPEA 3T0VA 4PRIB 4G6FD 1U8IA 1U41A 2Y72A 5FYJD 2Z35A 1FL6B 3W0WE 1H3XA 3UEZA 1Q72L 4GKLA 3VXNA 3FY1A 3VXSA 2ZXQA 3TH2T 1G7PB 1R3IL 1PZUB 4DKDC 2A9MH 1KIPA 7FABL 4WO4B 4RFOL 1W1PA 2HISA 1JF1A 5GIRA 2BSSB 4WI4A 4FZEH 1JGEB 1QNZH 4JFOA 3DO3A 1I4FB 1PX8A 3DGGA 1TCMA 3VFSA 3RGVA 3ZKMC 4OZIA 5EUOE 5JUVA 1DLFL 1RZFH 1HI6A 2P5WB 1DBJL 3V0WH 3L5XL 4I77L 1RP8A 1ZT1B 3AS3A 2CESA 3KG5A 4TVPE 4F58L 3UYRH 3BQUD 4PJXF 3KPOB 2YD1A 5BW7A 1WTLA 4QRSA 3QI9C 1IEBA 3HZVA 4WHDA 3TM6A 4R6UA 5DD5L 1JFHA 1G0CA 3CZEA 3DXAD 2WBJB 1RIUH 3F8UB 2QV4A 3GNOA 5DVNA 3MNWA 4CVZA 1M1SA 3G04B 4WNQA 3MCKB 5FYKD 1R5VA 3TH4T 4UIMB 5I73B 5JQHC 3VW3L 2D3NA 1QFPA 1WAAE 1QSFB 2GSIA 3BEWA 2HH0H 7A3HA 5LA1A 4C7DA 5HBFA 4LAJH 2YPVL 2GVYA 3C5JB 1CE6B 5IHBA 4LLAA 3PBGA 3CX5J 2C4FU 2H32B 3SDAD 3VIKA 2Z31B 3MRJA 4KI5E 1NAML 2BX5A 3BAJA 5IB5A 3VX1A 4HFUH 4NZUH 2QSVA 3LN4A 2UWFA 4IPLA 1KTDA 4OIIH 4QRTB 3ULUF 1HXMA 5DGRA 4Y4KB 2YDSA 3WL1A 2EQDA 2F5AH 2V2WA 2XG9A 2C1PA 3WD0A 1JV5B 4YIQA 4LHJB 3ZTJH 4Z7NE 4Z5RB 1DN0B 4HWBH 2GTWA 1MQKH 4ZUUA 4YHZL 4AY1A 3BZDA 4MMXC 3FB8A 1JYWA 3L3KA 1RZJH 1AGFA 2QHRL 2Y36H 5EFDA 5F9WC 2XN9A 1Q6EA 1I9IH 4UDTB 3T0EC 2F54D 4JN1H 4D71A 2WSKA 3G6AA 4I3SH 2EZ0C 4IDLA 5FM5M 3QUMB 3VGHA 3WEOA 3AY4C 3AICA 3NCYS 1MNUH 3MFFA 3QDGD 1G6RA 1J1PL 1MCOL 3NIGE 2FR4A 3RX5A 4MTVA 5E8NB 3PV6A 4ODSH 1RSFA 3LY6A 1IAIM 2XKNB 4IMKA 4J23A 2CRZA 3MLUH 5CIPB 5C2BH 2ZUVA 2ARJA 2DH3A 2BS9A 1PKQA 3IDJA 5H94B 3GI9H 3TWCH 4NRYA 4EJ1C 1H3UA 2O9TA 3UJTH 1M71B 1NUNB 1DWGM 1CGUA 4FMFA 4BFIA 2OQJB 2IAMD 3OAYH 1VBRA 4F15B 4OD2B 4C56D 1GONA 2VLLA 3T77B 1KELL 5DQ9A 3W6MA 5D8JH 3S3SA 3B8YA 3I6KB 4M5ZL 5FOJA 2HTKD 3D5HA 1FL3B 1RZKL 3CH1A 1CXEA 1RUQH 5GGRB 4OGZA 4LLMB 5D6DA 1TE1A 1EFXA 15C8H 2R0KH 2OYKA 4UT9H 1DL7L 4J6RH 2MSPA 4CMMA 1MYRA 3QJFB 5IEHA 3KXFE 2WINA 4R26L 3U0WH 5E99H 3MR9A 3KPQA 1C5BL 2JLLA 5JW3H 3ELAT 3V4VL 3I50L 5C0IB 3SIMA 1T5XB 3CPLB 2C5DC 4YZFF 2OYMA 4H04A 4UFLA 4UV4L 1HKKA 3DMMC 2IQ9H 4PJ7F 4LIQH 3L1OL 4OM0L 4CBPA 1H5BC 3J7HA 4EBQL 1R3HA 4Y4FC 4U1SB 5C0AA 4JY6B 1QBLL 1J8HE 1J9YA 2J7BA 1Y18A 3R06B 1N64H 5J1SC 4XCFH 3SKOA 3EYUL 1DWJM 1EEYA 1FAIL 1J0ZA 4M1GL 4Y19D 5E4EB 3TVMB 1AY1L 4OCYL 4TOQA 5IJVB 1IMHC 1VPOL 3DTXA 1LE9A 1DE4A 4G8FA 4RAUB 1JNEA 4Q22A 5FKAB 3TJHD 5TQ0H 4X4MA 3W81A 2WZPD 4G6ML 5ICXB 3I75B 4MLIA 4G80B 5KVFH 1OM3H 5D5ME 1FGNL 3MO1A 2IH3A 5IVXE 2YN5A 2W9LA 5HXMA 5C0ND 3LEVH 4C57C 1UWQA 4PG2C 2CD0A 4Z7VF 3V0VB 4Y5YA 1VENA 4ODUA 1K9EA 3SGDI 3AZTA 2VZSA 4MWFA 4PJIF 5DEFB 1URLA 5F7WC 2G2RA 1IM9B 4WFFD 4W8AA 2FJFB 4M82A 5DS8B 2OJZL 1BBJB 1DBML 3L3JA 3RKDC 5CEYB 4V2XA 1OCWL 4M48L 4QRQA 4ZS6C 1YEHH 4CU6A 1MWAB 4IRZL 4X6CF 2CK0L 5C70A 5E08H 1UEMA 1HVQA 3VXME 3VFWB 5C0BB 1J87A 3CUPB 1GOFA 2PCPB 2YK1H 4NQXB 5D7JB 5F6HJ 5GHWL 1OQXA 3BKYH 4CN4A 4GQQA 1WFTA 3LD8C 3LOWA 1HZHH 5DDHA 1BBDH 4QF1B 5IROA 3E8UH 1Z9MA 3RVVC 4TOYL 3VXNB 3VXSB 1KR1A 2FIRT 3MLSL 4TVDA 1LL4A 5DD0L 3ZL4H 1KIPB 3QCTH 4QDMA 5JXEC 3WO4C 5DHYA 4HGWA 2Y07L 3KL3A 4OD1H 1JF1B 5GIRB 3LH2L 3SJVD 1V02A 4OLVL 3NCEB 4JFOB 3VRJA 5D9MA 2AXJA 3PZ9A 4PSPA 3DGGB 5EN2A 2D7MA 3VFSB 1GJIA 3RGVB 4OZIB 2H2PC 3VA6A 3V79C 3QHNA 3BDBA 3DECA 3QIUD 1ADQL 5KVGH 1HI6B 1S7TA 3ZYIA 1RZ8A 3RP1A 1T80A 4LRNL 4ZUSA 2ZICA 1IGJA 4K2UL 2LFGA 5FO9A 3KPSB 3UPCA 3QT2A 1QW9A 2Y25A 4JO1H 3N12A 1ZA3A 1BHGA 1G7MA 4JZJC 1ITXA 2V6HA 4PMVA 1ZB5A 2ZG2A 5CD5D 1UUQA 2DQGL 3SDCC 5H2BA 1IEBB 3HZVB 3QHMA 4PTUA 5AYIA 1F2XK 2DYPA 4X8JA 4P5TA 4CVZB 2K1MA 4WNQB 3F7YA 2EPOA 5D1XA 1Y7VA 3DUHA 4D0CA 1R5VB 3W24A 1KWKA 4R0LA 3BEWB 2H6PA 4PMRA 3VVGA 4OCMC 3A67L 4NHCL 2VH5L 4ZFOA 3LKQB 1KR0A 5CS7A 3KLSA 1BM3L 3A47A 1MEXL 3MRJB 4LEXL 1FFRA 5IB5B 2VYRE 1BEYL 1A7NH 3OGVA 4XPFH 3NIFE 4LLWA 3LN4B 4XVUD 1UR1A 5FB8B 1KTDB 5M3WA 5LQBH 1NCAH 1HINH 1HXMB 3UJIL 3SGJC 1MI5D 1SMDA 4LSSH 2PTTA 2V2WB 3DROA 2GITA 2C1PB 4S11A 3KL0A 1DVFD 3ZHDA 4YIQB 1E4KA 5F7EL 2ESVD 4Q6YA 5GGQH 4BSWB 4ZUUB 1NCNA 4GFTB 4PD4K 3FB8B 4UTBL 1AGFB 3L7EA 2VDOH 3DHMA 3UXFA 3OG4B 4Y4HC 2W07A 2XN9B 3IFOA 2QR0A 3BP4A 1ZL1A 2A6KA 3H9SE 4FZ8L 2WPGA 5ITBH 2VLRE 3G6AB 3VMNA 3OLGA 4Z2GA 5JXAH 3MFFB 2IPKA 4HPGA 1G6RB 3QISA 4YAQA 1OTTC 4NJAH 5F88A 2FR4B 3PV6B 3NTCH 3QHZH 2AJZA 5BRQA 2A3AA 1W9DM 1U8KA 2ARJB 4GW5B 3IDXH 1PKQB 3IDJB 4XPHH 1PBGA 1WPCA 4TUOA 3MBEA 4XCCL 1XAUA 2R69L 5T1KA 3AU1B 3HMWL 5J13B 1WC7B 2ZX8A 4GQRA 4L29A 3PABA 4NRYB 2APTA 1IFHL 1BJ8A 1R3LB 4BFIB 2OK0H 5EORL 4M03A 4WGVB 2ICEA 2VLLB 1OHQA 2VXTH 5KSAD 5DQ9B 1N6UA 5DUPH 1IAIH 2J4WL 4OD3H 4YXHL 4HPHA 4PJHE 5IMOA 1NLDL 3CH1B 4X4ZA 2VDNH 2D23A 1F4WL 5EPMA 2LVEA 1EFXB 5ICYA 4MAVA 1KACB 4N9GA 3VTRA 4Z95L 4CMMB 5IEHB 4HWZA 2Y8KA 3GBDA 3MR9B 1CCZA 5LGKA 3WJJA 3GBNL 2OTPA 1XYZA 4A6YH 2Y5TB 4WI6A 4X9BA 1RULL 2D9QB 2R2CA 3P0YH 1AXTL 5I1IH 3GGWA 2R8SH 2R56H 4LPCA 3A6OA 3QWRD 4H1LH 5CILH 5JQ6L 3MOBL 4UOJA 5C0AB 1AP2A 4FF5A 3SUUA 1KCSL 5T33H 4DWSB 1L7IL 5DURD 1Y18B 5C7XL 3SKOB 4JHAL 5HHNA 1SJXA 4TNVF 3TA3C 1BQUA 3BPCB 5HHVH 4H8WH 3A4WA 4Q97A 1D9KD 4FLOA 4NFBA 1LO2L 1ZAGA 1LE9B 3DTXB 1DE4B 2DM3A 4G8FB 5HPMB 1P9MC 1CL7I 2VRJA 1GCFA 3TTSA 3QCVH 2VR5A 3V4UH 3NCFB 4JRXE 1YNKH 4G3YH 4XPBL 3VWJC 1FVEA 3VGGA 3G9AB 1U3HC 3MO1B 4FLSA 3G5XA 4Y5YB 4ODUB 4PGJA 3PNWA 5IB1A 3RVTC 3F4VA 1QRND 3V2AR 2CIPA 3L9RA 4QOKD 2P5EE 2BVPA 4JZNA 3ARQA 2JJTA 3FOMA 2G2RB 3VD9A 5I74C 3C2AH 3KLHD 3BI9X 3VWKC 3EO9H 3L3JB 3X11A 4QRQB 1NAKH 4KY1H 3K7UA 4XUYA 3CHEA 5L8JB 2L0DA 1RZGA 4N1HB 3TO4C 4PLKD 4XPAH 5DDHB 3O3UN 5CEZH 4HAGA 3M45A 1WNOA 1AHWA 3BIAX 2VLJA 5IWLA 1CFNA 4QFUA 4Z2KA 1DBBL 3CFEA 1ZWIA 4HGWB 4PMXA 3B4NA 1U2YA 2CKBL 4DGYH 2ADIB 3O8XC 5TQ2H 3VRJB 3BXNA 5KAQG 5I78A 3D69A 3UPAA 4AWEA 3LQZA 4X5WB 5EN2B 4G7VH 2EPMX 2QQLH 3FB6A 2Y6SC 4LP5A 4TNWK 4Y8DC 5CSZB 5C86A 3VM7A 1WIOA 3BIBX 2WVSA 1A9BA 1P2CA 3OKDB 4MJID 1MCJA 3GSWA 3TBYB 1S7TB 4C4KT 4PYGA 1RZ8B 3PTQA 4LNVA 5CCKL 1YEFL 1IGJB 5T1DL 5LA2A 5FO9B 4QYOA 4JFVA 5TJWK 3BSZH 4QRPA 3X3FH 1ZA3B 1G7MB 4H26A 3BD3A 1R7AA 4XCEB 3LMJL 1SM3L 1OLZA 4JR9H 5H2BB 4PTUB 4Y2OA 4KKAC 1I7RB 3SCMD 1PLGH 2XT1B 4DN3L 3TZVC 2DYPB 4NN6B 4GQ9H 1F6AA 4P5TB 2Y5EA 4YHLH 1HNFA 1Z0MA 2NR6D 3F7YB 3H7BA 3HE6C 5D1XB 4D0CB 4U1LA 1B3VA 3MLYH 1VKXA 1Q0XL 4OZFG 1QA9A 4R0LB 1KGUA 1PX3A 3QO1A 2H6PB 12E8L 1SMAA 1NAMA 3ESVF 2XTLA 3M07A 1YYLL 4ZFOB 2XY2A 2WWKT 3O3BA 3T2NL 1DLHA 1LDPL 4OV6F 2P49B 3MLZL 5JW5A 4O58L 5I8EA 1WZ1H 1T1XA 4NT6B 4LLWB 1IQWH 1I9RH 3WNOA 4UQ9A 3IJ8A 5CG0A 2NY7L 3P9LA 1J10A 4LHUA 4PJ9A 2PTTB 4Q0XH 3UO1H 3DROB 5CD3A 4IRSA 5F7UA 2GITB 2MKWA 3PWUB 3FN0H 1QBML 3H9ZA 4QHUB 3VM5A 3OJMB 3MX0A 1NBVH 4GXVH 3L7EB 5IV2A 2X2YA 3VFGH 1CFSA 2NX5E 1IARB 2NY6D 1WUNT 2QR0B 2C4FT 3BP4B 3QPXL 2NY1C 4GI8A 2A6KB 5ESQA 1JI2A 3WMCA 1VA9A 3CVHL 4W5UA 2RCSH 3B9KD 2HTLC 3FO2A 1TXKA 3QUZA 3PZGA 4XRCA 1NGYA 2IPKB 3VIMA 4YAQB 1YEKH 2XIDA 3WS6A 1LL7A 1GGCL 3FO0H 5D7LE 4U6HA 2NXZC 3BZ4A 3WENA 4MXQC 1U8KB 4HS3B 1EHXA 2WAGA 2CO6B 1IGFH 4JM2D 4GKSA 4H1LG 5A69A 4TUOB 3P0VH 5AYUH 5T1KB 5DSCA 1RUKL 2MHAB 3S96A 1F13A 4HZ7A 1MJ7H 3PABB 4L29B 2E8YA 2XHYA 4OZOA 4YX2L 1XIWA 5GS2D 3M17A 1W3HA 4XWOC 5MHSE 1E28A 2ICEB 3ULVE 5MP6L 3NH7L 1KB5L 4BKLA 2D1ZA 2D4DA 3RZCC 1B90A 5IMOB 3KYKL 1XCWA 5EPMB 2KZ1B 5KTEL 5ICYB 5ENWA 4H0HB 3TIEA 4N9GB 5D1QA 1NUGA 3QP3A 4PJEE 3AIWA 1L9MA 4HWZB 2C3WA 2ZWLT 4QXUL 3JSSA 3HLAB 5I30L 2FH8A 4BQ3A 2NSXA 3VDCA 4K8RL 2GUOA 1X5GA 4WEMB 3ARDC 1LO0L 3T65A 4ZEPA 3SDDC 3NFPA 4D6EA 5HJ3B 1L6XA 3GSQA 3GGWB 4QWWD 1INEH 5CJQL 1C5DA 1TVBA 1X5XA 3FFCA 4LLVA 4PJBF