4MJ4A

Human iduronidase apo structure p21 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
614
structure length
603
Chain Sequence
EAPHLVQVDAARALWPLRRFWRSTGFCPDPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-L-iduronidase
total genus 194
structure length 603
sequence length 614
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01229 Glyco_hydro_39 Glycosyl hydrolases family 39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mj4A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4mj4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mj4A02
4PB0L 4GIAA 5A2IH 1HINH 3OPZL 2NYYD 1RJCA 3QR2A 1V0LA 2W9EL 4WEBH 2EO7A 1C5BL 4HOXA 3UYRL 5EFFA 3JXAA 2B1AL 5JHDB 1RZ8B 1WO2A 2WWMD 4NQVB 2W62A 3BH8A 4QTHA 3AIEA 4OF7A 1UQSA 1ISYA 1YNLH 5BRZD 2MCPL 3HJEA 3W2DH 5DRNA 3AAZA 1E15A 1NAKH 4KJWC 3CZGA 5HYSG 3S34L 4JKPL 2IFFL 1Y7VA 2R2BA 2VDKL 2VMFA 3H7LA 3WSQL 5GRUL 4OKVA 5IMOA 3NACL 1KN4H 3WNLA 2LQRA 1UKQA 2F58H 3VXPB 4M3KB 1DSFH 1IL1B 5GPRA 3WFHA 5H94B 4Y19D 2NY0B 4LHQB 2DIJA 2BNQD 3E8UL 4OCYL 5C09D 5E6ID 4JFED 4Y8DC 4L3ED 1ZHLA 5DRXA 1G9NL 1ZB5A 4HKJA 4M3JA 3RA7L 4M62L 3GNML 3O41A 2FJHB 2X4UA 4Z7UA 2XN9A 4HH8A 4NNPL 4DGYH 3IF1B 1T83C 3MNWA 5JW5A 1Z5LB 3F7YA 1ZEAL 1U8MB 5DJ8B 2J1KA 2XQBL 5JPNB 3WQWA 1HILA 2Y7QB 4QRPA 4HDIA 5KSVB 2PR4L 4M43L 2AV1B 2W65A 1TPXB 4OIFA 4BQ4A 3B9VA 1SMDA 1SY6A 2HKHL 5SWSA 3UPRB 4LEOA 1J0YA 4UMGA 2IG2L 4HIXL 1TZHA 3GJFA 4DZ8B 1YEGL 1BGXH 4YIQB 2FECI 1GOOA 1HH9B 3BDYH 3VKKA 1E55A 4J4PC 2WZHA 3T09A 5I9QC 3GHEL 3MLXL 3L4XA 2DM3A 4MJIA 4C55A 4L9DA 2MQ0A 4Z7OE 1QKZH 5BVPL 2PN5A 3IDGB 1QSEE 4R96A 1V6VA 3NZ8A 4PRPE 3VIPA 4WIWA 5EBLA 5JQ6H 3G5VA 1I9RL 4UOW1 4MJ5A 2RGSA 5ECJE 1BWMA 4JRYA 2FATL 3WUFA 1AQDA 5J4MA 2EPOA 4NPYB 3WEZA 3Q6GH 2DQEH 2BNQB 2PXYB 3BKJH 1HT6A 3VMOA 1P9MC 2VLKA 3BPCA 1UVQA 2J4WH 2YPLB 3M8OL 4Y16A 3V0AC 2OP4H 1LWJA 1HHHB 1FC1A 5DI8A 1J87A 4KRPD 1J5OL 4NKDB 5CZVH 3LN9A 2ZX6A 5CGYC 3DETC 2Q76A 1M7DB 2DM4A 4NJAH 1PLGL 1BZ9A 3BIAX 3RRQA 5BRQA 2NMSA 1K4CB 3SE4A 4PY8I 4GBXD 3ZL4H 2IH1B 5CP3A 1FZMA 5C0NC 3MANA 1JGLH 5DD1L 5I1GH 1BFVH 4TVPH 3L3GA 5I8OH 1LGVA 3IDIB 3HZYA 1N64L 4DCQB 1UR8A 2PBGA 5IG7A 1C8PA 1A3RL 3DX7B 3B43A 4KMLB 4MNQA 3I50L 5EOTB 4W4NA 1WQVT 4AY0A 2J7GA 1G7IB 4HAFA 3GIVA 2GKIA 3FZUD 4KTDH 3RWEB 5T3XH 4U49A 5C08D 3M17B 5L88L 4YLQT 2KH2B 2GT9A 4CAGA 4ZPVB 2CDFA 3RDTB 1GJIA 2A3AA 5IVNA 5LAXB 3L4TA 3G5ZA 4LHUB 1RZIA 2A73A 5J9PB 3ARUA 4J3TA 4U1LA 2GK1A 5FKAB 1S8DB 1Z2KA 3FQUB 4XNXL 3VXTA 2VH5H 5DK2A 1BFVL 2IALB 4PP2A 2J47A 4OLXH 4P4KB 1YN6A 1QNZH 5I8OL 2WWDA 4K68A 1EMTL 4G5ZL 2I60L 1XGRA 3V5HA 3VWKD 4H8WH 2IPKA 3H9YA 3ARGD 4JY5L 1JZ5A 2G4FA 3HE6B 4N0FA 1JDAA 2WSPA 2NTFB 1C93A 5D93C 3TZVB 5T3XL 3FL7A 2R8SL 1WZ1L 3THMH 1GGIL 4RA3A 2I9LB 2R1WA 2EIDA 5D7IF 3RVWC 1YDPB 4MCYA 2VXTH 3RNKA 4JFPA 2D0HA 2IALA 1CL7L 1OPGH 2Q8AL 3LMYA 1S7TA 4OV5B 5KVFH 3ROOA 1V7NH 1BOGB 1BVZA 4GG8A 3FO0L 1UH4A 2JCCB 4EDXA 3CMOL 4OAWA 5KSAA 5L2JA 1Q9WA 3AXXA 2EDFA 3U9UA 3L3HA 1A0QL 1K2DB 2G60L 2OL3B 4UQEA 1R3HB 3GMRB 1ZLUK 4CMMB 4TUKH 4F9PA 4DM1A 1EX0A 3MCLH 4X7TB 3RX5A 2BV9A 2V5CA 2VUYA 1OF2B 3EOAA 4NYLB 3TO4D 1TQBB 4PMYA 2WKGA 3WBEA 3AREA 2RR3A 4K7FB 2OI9C 3L7EA 4TUFA 3P9MB 1MF2H 1VACB 3WE6B 2AJZA 4ODXA 3P9LB 4HFWA 5IW3A 4MJ2A 1RHHB 3EOTH 4FTVB 4WHDA 1CZ8L 4NBYB 3IJ7A 1S9XB 1KCKA 3KDMB 2VR9A 4WTWA 1RY7B 1UR9A 1FAIL 4ZUWB 1FNLA 4Q9BA 1EUUA 3D0VB 2FH8A 1DLHA 4CU6A 3LEYL 3QFJA 4IUGA 3GSRB 3VXOB 2PTTA 3NZ8B 1JUFB 4NZTL 4RGNE 1CN4A 4LIQE 5KW9H 1ZGLP 3IU3A 3O9WC 3VCLA 1AD9A 5FA3B 4M29A 1NOUA 1OIFA 2Y8VA 3LQAH 2CK2A 1EHNA 1FDLL 1MYRA 3MRLA 4LPYA 4MXWL 2KPNA 1XCTB 2W0PA 4HZ6A 3VXSB 2FB4H 3MXWL 5AC5A 2DRUA 4IIQC 1NCCH 2BNRB 2AEQL 3S7GA 4I18A 2V2XA 2NSXA 4YFDB 3O9NA 1EO8L 2OR9L 4NRXB 2UYLB 3C2AL 4MAYD 4NO0D 4HXAH 1QPPA 3MNVA 4MB5A 3KPQA 1XGYL 2FX7H 1QBLL 5IF0B 4GZJA 1KGUA 4B9YA 4AENA 2VDOL 1R5IB 4PG9A 5SWQA 1MJ8H 3O9WD 4JO3L 4DUWA 4RBPK 4QRUB 1JPSL 3KR3L 5DJYA 4P23C 1G9MC 4MXWH 1BJMA 4JREC 3D18B 4LCCB 3BKML 2DYPA 3WL9B 2VLJE 2FB4L 1G9NH 2QQLL 3V0WL 2O5YL 3A4AA 4FXGA 3OTTA 4U1IB 1V6WA 3UYOD 3AU1A 3QEQB 4PMDA 4PJDB 1GQJA 2C7UA 5KZCB 1WGOA 5FKPA 4P59L 4B9ZA 2X5PA 4F37F 1O6IA 3REVA 4PJEE 1S7UA 5FCZA 4ZFOA 4RFOH 4WSJA 1U3HA 3VINA 4AEIL 4YXLL 4ZPVA 1W9BM 3RWJA 1OY3B 2DJSA 3K74B 3QCUL 4JG1H 3N1FC 3RL2B 4JR9L 1CQYA 2VX5A 1HKLL 3SHSA 1OGGA 4YDKH 4ZFGL 1UWIA 1EPFA 1ZT7B 5IB2B 3N9KA 2VQ1A 5C0AE 3UZVB 1N6VA 2E9MA 3OGSA 4HIXH 1UZ4A 1BGGA 5ADPH 4XPAH 3N85H 3Q6FB 5ENWB 1N59A 2DJUA 3BGAA 2VLRD 1KCRH 5HHOB 1MFCH 4NFCA 1E72M 1OAYH 1T20A 1I75A 5ABHA 3J8F7 3SCWA 4XHQA 2DQCH 5DS8B 3KXFA 3Q5OA 3M1BB 1NGQH 1A5FH 4KKCD 4MJIE 1NFIB 1XC6A 4CJ1A 4DUXA 3ZIZA 4TTGA 1YEFL 4U1HB 4W5UA 2CIIA 4YXHH 4NFBA 4YBLB 3AXHA 4M62H 4TVPD 2XWEA 5CGMA 5IM7B 3S88L 4NNPH 5FO9B 1GW1A 2EEBA 5B39G 4HXBH 2GFBB 2DL2A 4NKOA 2OR8A 1JWMA 4O4YH 3BWUC 1PVHA 3X3GL 1GGBL 2OL3L 2DQEL 4MVBD 1UR4A 3AFBA 1W3JA 3V7AE 2BXYA 4X6DB 3SIMA 3OG2A 2QV2A 4PGJA 5I79A 4X5XA 2PUQT 3HPJB 2NXYD 3RWHA 3WH9A 1NGQL 3HLAB 4ZTPL 4Q0XH 1MREH 1GZQB 4NQSA 4G7YH 2FO1A 2Q86B 3KPLB 1T1YA 5IXEA 1FNEA 4XXCA 5DO2D 4DTGH 4TUOB 5F9OL 4RGMB 2Y6SD 3OA5A 1IM3A 3BEVA 1W1VA 4GSDL 4PBWD 3QIUD 1BQUA 1FYHB 1HNGA 2X7LA 4JFXA 3BAYA 5BO1L 1R0AH 5CEZD 3DGGA 5HDLA 4YHKL 4UTFA 2RBLA 1B0RB 3LKPB 4EI5D 3MLYH 1AQHA 1YEDB 4UOW0 1OCWL 5D1QC 1HHJA 3I75A 1IARB 2VI0A 3N13A 1SR0A 3MRJA 1NMBH 3FN3A 1VRXA 2ITDB 3WBDA 1LEIB 1G5AA 2IAMB 1N5AB 5F7MC 5I74B 1TETL 4PYHA 4Y4HD 2AKRA 1RUKH 1KPRB 1V05A 3I85A 3U2SA 1A1MA 3QZWG 4HU8A 1LO5B 3V4PL 4S2SA 2W60B 4D6GA 4JDZA 3UEZA 2E9IA 5IVXA 4P0DA 4EN3C 1S78C 5T1MB 3IF1A 3MRRB 2V7NB 1UWSA 1FE8H 4XVTL 5H35B 2YD2A 2O26U 2WCSA 4C57C 4JFDD 3NPSB 3MRKA 3VFGL 3GIVB 1UD6A 2OSXA 2PB1A 4ZAKD 3SOBH 4EUPB 4LNRA 4F7CB 4OZFH 4GFTB 5GS2D 5HDOA 4LGSB 2IPTL 1BECA 3MNWB 1AXSA 4G6KL 5CWSB 3VIOA 3HNTH 2ENYA 5KVGH 4LLDB 1BVKB 1HNYA 1OGAB 3GSQB 2R0WL 4PGCA 5FD0A 3NIFF 5DK2B 5C0RL 3E6HB 3MOBL 4N9GB 3KYMB 5LCVL 1F2QA 5HHMB 1F4YL 3CFEA 4PRIA 3O6LH 5FHBH 5T5NF 3RDTA 2UY4A 3QRGH 3QWRD 2NY7H 1WDSA 1VEMA 4JJ5B 1MLBB 2CGRL 4JGUA 1LL6A 1DDHB 3BMWA 4F9LC 3NACH 4XZWA 3WQ4A 4LSTH 1QLFB 4UNTA 1EZVY 4YNYB 3VGFA 5ACMA 4OLXL 3TA3C 5F96H 4QHKJ 3WF4A 4NQDD 2E9BA 3RAJH 3WELA 2NW2A 3O4OB 3EHBC 3IDYC 4D0CB 3CSGA 1DJSA 3QIWA 4GZEA 3K4ZA 4HKBA 1SYVB 4YEEA 3UAJC 3BSZH 3CXDL 4MA1C 1BX2A 5GRWA 1ONQB 4KK8C 1AE6H 1Q9OB 2P5WA 3VRLF 4ODUB 3NCOA 3KJ4C 2B2XH 1GGIH 2XRAL 3G08B 1KOAA 3TYFA 3CNKA 4Z2GA 1RJLA 1IZJA 3DV4A 2FO4A 1J8HD 3K2MC 5TQ2L 4U1HA 4RA0C 5BXFA 2XSBA 3OKEA 3ZKXB 4EZMA 3D5HA 4U5KA 3GO1L 3MRGB 1G7JA 4P5TB 3OAYH 4PRDB 2YZ1A 4EXKA 4OLZL 2BNRA 4C7GA 4PRBB 1NUGA 5LGHH 3SDXF 2DLTA 2CERA 1CXEA 2BNJA 1HQRB 1HHKA 1C7TA 4RMUA 2OYPA 2IQAA 3C6SA 3ZDXE 3GXDA 2DGAA 3U5YA 3QGVA 1FL3B 1X5FA 3OL2A 3QIBD 3L3IA 3MBEA 4S11A 2EDBA 4XAKE 3IDJB 1HSAB 2OZ4H 4P23A 3WNMA 4PRDA 1F42A 3AY4C 4WO4C 4PJGF 3D0LA 2GAZB 2X9YA 4NNYA 5BVPH 4UT7H 5A16A 1IILE 1TDQA 3MZGB 2ZX8A 5E94B 1SEQH 2FL5A 5I30L 3HI6L 3OHXB 3VTRA 5IB4A 4MJID 4TUOA 4WF7A 1T1XB 2JF6A 3ZJ6A 5IKCB 1JTOA 4P49A 1LO3H 3PWPD 3O6FB 4RSVA 5DHVB 3LN4A 1IM9A 4OTXH 3SCOA 1SYVA 1S7WB 5AWNL 4L8BA 4EI5B 3GSRA 3VXOA 5ISZA 1ZA3A 3GUTB 1UYWH 3ZZ1A 1FJ1A 5D7JC 1C12A 3IAQA 1IL1A 3CFCH 2DSVA 4IIQA 4D94A 2E9JA 3B9KD 3BESR 3DXAD 4DEPB 1BQSA 5C71A 3G08A 3QHZH 3WH6A 5HOSA 2IBBA 3GSWB 4UZSA 1BAFH 5F44A 1WFOA 3QT2A 5C08B 5B8CC 4UQ3B 4G6FD 4AEIH 1F90H 3SQBA 4NO3B 5I30H 4ZXBA 5FO8A 1Y18B 4JG1L 2EDNA 1JPST 4WUUD 4EN3D 3ZE2E 2F19L 2V5RA 4WV1B 4AISA 1JD7A 3IDIA 1JNEA 4D0DA 5FYKD 4XNMB 4B53A 5H2BA 3QAZB 2Q7YB 2XM1A 1MNUL 5I3DA 1XFPA 3QQ3A 4DFHA 4KRPC 2ERJB 1T6VN 3V79C 5FYLH 3M1BA 2APXA 2BJML 4R6UA 4XPFL 3ZT5A 2P1YA 3LOWA 4IOIA 3HZKA 1AC6A 5FYJU 4YR6A 1MJ8L 1E6RA 3FONA 1DBBL 4KTDL 3GBDA 5DGRA 5CPSA 1OP5H 2Z35A 4IS6B 1CGSH 3L2MA 4AQOA 2VDQL 2XQYG 1I1XA 2DDQL 2GIYA 1MFVA 2YPVH 1XD0A 4JPIA 4QTIH 2D3NA 2NX5D 3OKDA 1MIMH 4LMQI 5IMKA 5ICXA 2VE6B 1T7WA 3GK8L 3QBTB 1GGCH 3BN9C 1EFXA 1OGAA 3GSQA 1WT5C 4JAMA 3WKNA 1NC4A 1ZV5A 2F19H 2WVVA 4HG4J 1BZ7A 1RK0B 1OARL 4X5WA 2SEBA 2DSZA 4L5FL 1I1AD 3ULSB 3S3JA 1LP9E 3WIFB 4LP5A 3BP7B 3LDBC 1GHRA 5ERWA 3HS0B 5D96B 2X8RA 4WSKA 2EPMX 2DQUH 4UT6L 5HGBA 4UBDD 4MNHA 5B38G 2DI7A 4HG4K 1LEIA 2D23A 1OD7A 2F58L 4P99A 5J8OA 3IJ9A 4OZOA 4JN1H 5EZIH 4BFEA 5J7CC 4ZUTA 1XSJA 1NGYA 4F66A 4EANA 4J3SA 4UDUB 4QTIL 4H1LB 5HY9B 1A3HA 3FN9A 4JDZB 2DQFA 3DGGB 2V9RA 1E0XA 4Y5XA 2HTLC 1NBYB 4M6ML 4XVUD 1H0DB 2PF6A 2JJVA 3ARBD 5TE4L 1TTFA 3VMPA 3WD5L 5DXWA 4OZGE 4QEGA 1TCMA 3ZYJA 1YEFH 2DQUL 3BSHA 3HU7A 5I73B 1UM5L 1RPKA 1U6AH 1SY6L 1F6FB 1MI5B 3GYCA 3OG4B 2D2OA 4HXBL 4Z8FH 1IJ9A 1JF5A 1IC5L 5JW5B 5KSAD 2B20A 5T33H 1G84A 1GPOL 4YK4C 1MFNA 3MNZA 3LH2H 3SKMA 1W0VB 4XX6A 5JOFB 1TCRA 2W63A 1CFVL 4HHAA 3DTXB 4GRWB 1XR9A 1DFBL 1KTLB 4NN5B 5DMJB 4LDOB 1IKFH 3QO1A 1I1AB 1JPTH 1J0KA 1FH9A 1PBGA 3T1WA 1NKOA 4M03A 2C1PA 1ADQA 4KJQD 5IMLB 2E7LC 2AJSL 2XVKA 4YFEA 2XUCA 3FOMB 1G9EA 2WBKA 1DBAL 2ICWJ 5KW9L 1XH1A 4X9FA 2XM2A 1FORL 5E70A 3MREB 2CIKB 4GSDH 5J3HD 3BZEB 3CLEL 3PBGA 1G0CA 2EBNA 4XHJD 3VH8B 3FCTB 5CHNB 2ZKHH 3BGFC 2ADFH 3A6CH 2YDSA 5DA0B 5E0QA 1MFEH 3QFJD 1H3VA 4CCDA 3GDBA 5BV7H 1N82A 2EDTA 1PSKH 3PE9A 4K23L 4KJYB 2R1WB 4NN7B 2ARJA 3HMXA 1VBRA 5T3ZH 5KAQG 4WU5B 2Y72A 3O11B 1A1OB 1S9WB 3S4SB 3GJFH 4ZFZB 3WD2A 4RFEB 1CXKA 4JHAH 4Y2DB 1U3JA 4GG8B 4FQIH 4M48H 3AOFA 1CWVA 3JTTB 5GSVA 2C26A 1NARA 4POZC 3IT8D 2GTWB 4Z0XB 4ZOCA 5DI8B 4MAYA 4NO0A 1HP5A 1U33A 1XH3B 3VXTB 2W67A 5J1SC 1I9EA 1OAKL 4PRWA 2AJYL 4PD4J 1E6JL 3DVGB 5IP4A 4JEGB 2QHLA 1CEOA 1VADB 2R1XA 4YHGA 1WK0A 4X7SL 3UBXB 2JIXB 4L3EA 2H32H 1W91A 5K59F 3HZKB 3AQUA 3ZKQD 3CFDB 4D3CH 5D2NE 2D20A 1IAIH 3TA9A 1OP3H 2DYPD 2R56L 5HGHA 4CBPA 1IGTA 1VBUA 5IMKB 2I9TB 4BQ2A 3LS4L 4KPHH 5CIPH 4ODWA 3C6SB 4H0GA 5FECA 1T22B 3QO0A 3WMSA 5F7LB 1Q9LB 3NH7L 5E00A 2WWMC 2AJYH 3M17A 5E2TH 3AHVA 1YQVH 1KGXA 1KLUA 4UFMA 5JZ7C 1E9LA 1QRND 5ECUA 3QQNA 1IAKB 4MXQD 3N12A 3AZTA 2Q7NA 1RJLB 3B4NA 3T0EB 3KPSD 1UR0A 1U91B 1MI5E 3C5ZC 3LQZA 1V02A 1CL7H 4PJFF 3BP6A 4O5LL 3P9MA 4MGXA 3RJQB 3DV6B 5F93C 4F15C 4X6BA 2I07A 2OTUB 4JM2F 2OXHA 2J25A 3FO0H 4Q6YA 4JFFB 1E27B 1P5UA 5FKYA 3WFDH 3ZHDA 2WMFA 3D39B 3MLSL 1MRCH 4PJ7E 5CMAB 4UQAA 1QR4A 3ISWA 4OF0A 1PIFA 3GRWA 3MLWH 4HJGA 5FAAA 4O2CB 1E6PA 4Q74A 3HLAA 4LARL 3SDAC 4GKZB 3CFCL 5F9DC 4OM1H 1ZOXA 3CFDA 1MCNA 4ZUVB 5BQ7B 4PRPD 4EDXB 2H2SC 5TH2A 5F7NC 4P2RB 1MIEL 4WUKL 2EDEA 3PIQB 4OLWL 1F13A 5T1KA 1AGCB 3TIEA 3RCNA 4M1CD 4GQQA 1SJEB 5F9JB 4MQ7B 3NIFE 1WPCA 1X6LA 3GKWL 4QWWC 1U30A 3BP4A 1BLIA 4P3CH 3F58L 2APFA 3LS5L 5IJVA 1FAIH 3CDCA 1K3ZA 4OUUB 1R0AL 3AI0A 4I3RL 1MVYA 3HRPA 2Y2WA 4PS4H 5D1ZC 2CITA 1WKYA 4Q22A 3NCYP 2HT2C 3WQ6A 3T0XA 2OSWA 4F7EB 4QRRD 5EFIA 1WNOA 4LLMB 3EJZD 5ESAA 4HUMB 3U1SH 5KS9E 4ACZB 2P7TB 1M71B 5DD5H 1QW9A 1FN4B 1CICA 1UD5A 4OUEA 4PRIE 3MV9A 1ZA3B 3GNPA 2AXHA 4JPVH 3F7RA 3OJ2C 2AEQH 1BM3L 4ZFFB 2OMBA 1AXIB 4ZOBA 4KHTL 5DUML 5C0BE 1K6QL 4GINA 5EBAA 2EPLX 1MCEA 4G6JH 1VFBB 3WUBA 4UTAL 1TZIA 1EERB 3VA2C 1V6UA 1L0YA 3EYOA 3GSOA 3FO2B 1WTGT 5DMIH 3WL1A 4NN6B 5CGYD 5LGJB 4B0MM 4C56B 3NJ3A 3C09C 3JWDC 3O41B 5D70L 3CMGA 3OAYK 3MSDA 4TVSa 4GZIA 3DRQA 5IFAL 2CUIA 5GGTA 3VFOA 1EHLL 4AK1A 4NN5C 5BJTA 1DANT 5D8JL 2YD3A 4G6KH 4IMLB 4J1UB 3VFSB 5KZ6A 4MTVA 2CQVA 1G0YR 2FHBA 5C0FA 5L9DH 1OAUH 1G6VK 3SCMC 2P8PA 1CE6B 2WNGA 3O4LB 3W82A 3RM4A 5MI0B 3K8MA 4QYOB 3K8KA 2F54B 4BA8A 2R4SH 2F74B 4HS3A 3L3JB 1JV5A 4YC2B 3BX7C 1UXSB 1H9VA 5IHBA 3FNDA 4PMQA 1EXUB 3ECBB 5ESVA 1U8JA 1LDPL 4U7SA 1U6AL 1JGEB 4PJ7F 4X0KA 4WIQA 1PKQE 4GXVL 3ULVF 1ECEA 2CR3A 3MFGB 4XB8A 3SCUA 4H26B 1A9EB 4HHAB 2GJ6D 5K9QI 2ZOXA 3DVFA 1U8KA 1WCBA 2HFFB 3TFKD 3G6JB 2C1OA 3WFBL 3ARED 3TCLA 1JL8A 5IEHB 4GI8A 1L7TH 3LD8C 5A69A 5J0BA 2QLYA 4P57A 1UB6B 3I6KA 4KFZC 1IE5A 1CD1A 5IQ7H 4HT1H 2ENSA 1A5FL 3VFRA 4OJYA 4L3CA 1A14H 3FN0L 1AKJA 5IGXH 1NCBL 5F9AC 4ZS7H 4FQPA 4XUYA 4Y16B 4AG4H 5C0DA 1QHZA 1AGEA 5CJQL 5EO1B 3ALWA 3I84A 4XWOC 2J12B 4DVRH 4ENEC 5HYSA 4S1RH 4X80L 4G8IA 1FYTE 2FSEA 3TVMB 1R3KA 1J8HA 2EDJA 1OB1B 2OL3H 4YPGB 2E4TA 4PJ9B 1E4XH 2VC9A 4HPYH 5HHVH 1V5JA 4JZJB 2WUBL 3WF3A 4CDGC 3O2WL 4HTYA 4NUJB 2AEPH 3DXAB 1NJ9A 4JVPA 5F72S 2CK0H 4NCC2 5FB8B 5CPQA 4AL8H 1IV8A 4GG6B 1AD0B 3HE7A 1GH7A 4HJ0C 1QUNA 4P4KD 2EH8H 2XA8L 1BFOA 3D2UD 4I8DA 4X5WB 1YECH 1KR0A 4L4TA 5ANMA 4TULH 1WSST 3RWIA 5C2BH 4WKAA 5JA9A 2EXYD 2IPUG 1JG9A 1KEGL 2O92A 1ORQB 1CFSB 4JLRA 2WC7A 1FQ9C 2LU3A 3GSWA 4NOBA 1B2WL 1LQSR 3PZGA 5D7IA 1F3RB 2JKXA 2H8PA 3E2HB 4LKCB 4LVNB 4PGDB 3TBTA 4QCFA 1FAKT 4XCYB 3PL6A 4XTRD 1Z6JT 5A43C 2W5FA 4LVOB 4D0CA 3RIKA 1MSPA 4KV5F 1ZLVH 3BISA 5FFLA 4V1DB 4W89A 4NKIH 2AOSA 4I3SH 1HH6A 4WEBL 4ZE4A 3OSKA 2X1OA 5DVOA 3NCJH 5D1XD 3QUYD 2BVUA 2DWDA 1I1RA 4P2OD 3QEGL 3FB6B 4LU5H 4OI8A 3QZWB 3HAEA 4M7ZB 1T3FA 3CZEA 1CYGA 2YL5A 4FXKB 5TDPA 5FYJD 2XT1B 4JHAL 3Q6FA 4KZEL 3GH4A 5TDOA 5GGSB 1JF1B 4GPNA 3CTTA 4Z7VB 2VCCA 2VERN 2EH7H 3IFNH 3DO7A 1EEUA 3VXNA 4APQB 3OJDB 4UQDA 1IGJB 2RB8A 4PJEA 2XG9A 4BFGA 3ARVA 4LYRA 2LU7A 3KYNB 3NA9H 4LOUD 1FPTL 4OBRA 1IAOB 3ARTA 4XZUB 3MRQB 2BZDA 4EUPA 1JFQH 1T2XA 4LLQB 4R97B 3B3IB 4U4BA 2XZCH 5IBTL 4E5XA 1MJJB 2XFFA 3VW3H 5GGUB 2PO6C 3STBA 2BNRE 3BN3B 4GKSA 4NKMA 2DBJA 4PRAA 3WHXB 5ICZA 2GSJA 2FZ3B 1WTLA 5E94A 1ZGLM 1WISA 3QRGL 4X8JA 3ZDXF 3VFMA 2GSGB 4J3UA 1CFNB 2EDLA 4NCC1 3H2WA 1KT2A 4Z78A 1ZANL 1J12A 4BELD 5C1MB 1A4KB 3VFWA 1UWEH 3JUZA 4ODVH 4HD9A 1LO5A 3S35H 2XACC 2DQFB 4GQ9L 5E99L 4AZ6A 2J5LB 5DTFA 3RHWK 1EIBA 1HIMH 2HRPL 1QEWA 3NFPB 5BS0D 4JFQB 3QEHB 4WEUD 3RKDD 1KTKE 3RZCB 2CO7B 4CKVX 1NFKA 2ZPKL 4FQ2H 2ZCLL 3VFPB 4QRPB 1F00I 3Q2CA 4YGVB 2ZUQB 4R26L 1BQCA 2B4CL 3PZIA 2YPLA 2X7LB 5CJBA 3VXSA 5JIIA 3DMMD 2J78A 3OWEA 5DEFA 1AVAA 5C0CE 1ND0A 5DD3L 4HMEA 3NFPA 5EO1A 4YHZL 3S35X 1PZ2A 2CRMA 5M95B 2WMIB 3WFCH 1CTNA 3MTRA 2ZJSL 4FQCL 1KLGB 1HIML 2HRPH 3DROB 4NQEA 1CT8B 3QH3A 4WDIB 1L0QA 5CSBA 4DKEL 2LTQC 3LH2L 4OGXH 3MPCA 3TM6A 3RL1A 1CFVH 3UPRA 5I8KL 2QSQA 4LVOC 2NY2C 2WXDM 1KPUB 3QPQD 3WHXA 5ICZB 3QULA 5AG8A 2VDRL 1TUXA 3UEQA 3QUYA 1TJGH 5DVKA 4L9LB 1J7VR 1I9JH 1LNUB 1HH9A 1U8MA 5DJ8A 4H04A 2GCYB 4JDTL 3NSXA 4Z2IA 1UQSB 1TJHH 5H35A 4QY8A 2GDUA 5ABDE 4PJXF 1J01A 4X7EC 3Q0HA 4Q7NA 2D0GA 2M8XA 2R15A 4J8RA 1Y18A 1TVDA 2IADB 5SWSB 3R1GL 1ZGLB 1JXJA 1N0LA 3PABA 4TVPL 3SY0B 1UZ6F 1N26A 1QPXA 2NY1C 4NN6C 2YS4A 5CWSA 2X1QA 1HYSC 1EV2E 1Q4NX 1OAUL 2V2WA 2X09A 5I74C 2BVEA 3MCKB 1TJIH 3H6JA 3V9FA 1QLEH 4MDIA 5F89A 1C16B 1BQHB 4J3OC 5JOEA 1XGRB 2BX5A 3V5HB 2NW3B 1LP9A 1LEGA 4S0SD 4P3DA 3VFNB 3UTTE 4MAYB 4NO0B 3ULUD 2FSEB 2D7NA 3Q5TA 4ONGL 1E4KA 1MLCB 3CU1A 1WZLA 4NQXB 3BAWA 2YR3A 2YA2A 4UTAH 1Y6MR 4PJBF 2P8LB 3QIBC 4XC1L 2I60H 5C08A 4P9MH 3QCTH 1HSAA 1NLBL 1WBYA 4GAJL 5SX4I 4X6EA 1QRNB 1MW1A 4AD1A 2DL9A 1F97A 4NDMA 4E8DA 3BZDA 1SJVA 4DM2A 1KCUL 3Q5YA 1UKPA 2VDMH 4W93A 2ICWB 5IGXL 4MCZA 4KMQA 3BYTA 1AXTH 1MELA 3ILQC 4AD5A 3CVIL 4D1JA 4F33A 1EUTA 3BEWA 3SJVE 1SJEA 4X9YA 3QIWC 3T65B 1UZ6E 1NCWH 5BYWA 3P77A 3WXWL 1SQ2N 3MRBA 3Q1SL 4MD4A 2XFYA 1B90A 3QSKB 1LG1A 5GXBB 3MRIB 5DRZA 1NCAH 4KU1A 1FLRH 3SCVA 3LQAC 2ESVD 2ICES 2WZPD 1QW8A 5I8CA 3P30L 1JF6A 2VXSL 1IMHC 5F7HA 3BAIA 2DMCA 3DI3B 2BFGA 1EDTA 5DT5A 2DMBA 3ULSA 3QIWB 4PRPB 4Z7UE 1QSEB 2XWJB 1VJZA 4M9OA 2W59A 2F54D 6A3HA 1G7PB 1FG2B 2P24B 2D3LA 2NY5H 1LEKB 4RCAA 1M6OB 1UUQA 2VIRA 5J6GB 3EOBB 5TGBA 3I2CH 4E2OA 1XH2A 3LY6A 4PJAE 4CDHA 1W32A 2J7FA 1I3RA 4UZGA 4XBEH 3ZTNL 4MS8C 5C2BL 5GGRB 3LSOB 3MRCA 3G9VA 4ZFZA 4FFZH 1QFUL 4FQHA 4L29A 4I0CC 4P2CG 3DBXA 5J56B 5M94B 1CDGA 4W85A 2HT3D 4RGND 2GJXA 5F70A 1QSEA 2CDGA 2B1AH 4P5MB 1LE5B 1CD8A 3H8NA 5I76A 4QRTA 5MERB 1DBJH 2ZWZA 2H26A 3U7BA 5I5RA 2DSWA 3W28A 2YLAA 3ILPB 3BUYA 4PJGB 2X70B 1ZWIB 4CGTA 4BCEA 2WC4A 4J3XA 4NJ9L 3QJHA 3FT4A 4J1UA 1FVDB 4JN2B 5HGAA 1EDQA 2WUBH 2XHYA 5E1HB 2K7QA 2APVA 1F11B 2NY2D 1DFBH 1NQBA 1CVRA 2X4TA 5LXGL 2XGBA 2W0KA 5GGSA 3UTSA 1NOFA 1U2YA 3V6FA 3KPMB 4X8XA 2KQNA 1MQRA 1Q1JH 5BRZA 4EOWL 1CECA 3GI8H 3B8YA 5F97E 3SJVD 1T7XA 2DM2A 1MCDA 2OK0H 3LKQA 4IBLT 2SEBB 3L4ZA 1T22A 3QO0B 4UDUA 2LAAA 1EAPA 1FN4A 2IANB 3EDKA 3QJHB 1NDGB 4NM8H 4N9GA 1OINA 5CJ8A 5MEOA 3BGMB 1GCYA 5HNNA 3D69A 4U33A 4I18B 1GJUA 1QI2A 25C8H 5JXEC 5DD5L 3W9EB 3ALXA 3W6MA 1TQCB 5F1IB 2V3FA 1YC8A 2NZIA 4LCUA 3T3MF 3GBNH 4JAWA 2QQLH 1AP2A 2GUOB 2PR4H 4M5YH 3FO9B 5HHPB 4JO2H 5BRZB 2FBJH 2HKHH 1RIUL 5GGRA 3VDAA 3GZKA 3OGCB 1HEZA 4NQUA 2HA1A 5F1NA 3VWJD 1AJ7L 1KGWA 1JYVA 2WMIA 5ICYA 2BFVL 4FQIL 4M48L 3H3KA 2NX5E 3D1MC 3C8DA 5KVEL 2NZ9C 3ARFC 2I24N 5EBWB 3O45A 5EZJB 3QXTA 3VCLB 1ZWIA 2F8VA 1C8XA 3RVVC 5C9KA 4AIEA 4WO4D 2OWWA 1QKZL 2VXVL 3MV8E 4HS8L 4GG6E 1QFPA 2YSSB 12E8L 3K0WA 4L3CB 1MI5A 4YUEL 2XWBB 1XCTA 1KCRL 2WVUA 3C8KB 4H1LA 1G7JB 2BY1A 4UIKL 3ZDZE 2PO6D 4Z7QE 2OI9B 4CMHC 3RGHA 1FFQA 2AI0H 5A8PA 5IMLA 5I1HH 2EEDA 3J7HA 4PSRA 1IAKA 2YWZA 5A2FA 2XY2A 1IAIL 1X4YA 4YHNA 5JHDA 1T1ZB 2EC8A 5JNYA 4WUUE 1G1YA 1WLHA 4PJAF 3S36H 3WQVA 5GSRB 15C8H 4UINL 2HTLD 5ALCL 3KPPA 2D7MA 1NMCB 5I1CL 1JRHL 5D7LD 3SDXB 1RZJH 1JZ7A 4JGJA 1YEIH 4NUJA 5C92A 1ZAGA 4JFWA 4GJTB 3EMZA 2BVOA 4OGAC 4HWBL 4NNYB 1M7DA 2GHWB 5EU6A 4G8GA 2Z8WC 4LSSL 4R4NC 3B6SA 5ID1B 4GMSL 2UWEA 4BQCA 1SYTA 3RVTD 3UAJD 3QI9D 3P4NA 4MXQC 4ODVL 5JXEA 2O5XL 3MBXL 1JGLL 5DD1H 4YQXH 2A74A 3IJSA 2EDOA 3CPLA 4EDWL 3EW3B 3GJEB 1URLA 1XGPB 1N64H 3CXHK 5CEYA 1EOKA 1XCWA 4J3WA 1YC7A 5I1LB 4MD5B 1JYWA 1XH3A 2DQHH 3EGSA 1OTTD 4EQ3A 2XKSA 3BVNB 3L95B 4WTZA 3QDHA 1RZJL 4KQ4L 3TTYA 3OKEB 3MLPA 4QRRB 5DR5H 3CO4A 4RFEA 4Z6AT 2UZIH 4AMKL 3EOYG 2IBZX 3HNSL 4LNRB 3T4AB 4F7CA 1UR1A 3EDDA 1E3ZA 3I3BA 3HA0A 4GMSH 5B8CA 2NT1A 1WC7A 3MLZH 3CVHH 4NQDE 5E5RB 1XD1A 3BYYA 1L7IL 2WQRA 2AXGA 1HH6B 3STZB 4PP1D 3WLWD 1K2DA 5CIPA 3WYRA 2HVMA 5E6IA 1YMMA 4LRNH 5IFPA 2YRZA 3SUTA 4HLZH 4XCNA 2QQKH 1KIRA 3B83A 4U6VH 1BGAA 3V2AR 5EZLA 2R23A 5C6TH 1A7RH 4BQ8A 3OJVC 1B4JL 1D2KA 5TDOB 1BEYL 3C2SA 1G94A 4NNXB 1INQA 4NKQB 1UM6H 2LVEA 1IT0A 4TRPH 4PV8A 4XVTH 5DDHB 2NY3B 4PR5B 5JTWA 1ACYL 3JZ7A 2P5EB 2UY2A 2WVVB 2DB8A 4GG6F 4G3YH 1CGWA 1TZ7A 1PQZB 3D85B 1Q9KB 4H88L 3SCMA 5KSBE 4N0YH 5DJ0B 3PABB 3DRQB 2R23B 4P3DB 4W4OC 1FNGB 4N8VG 4CD6A 5CEYB 3MROB 4RAUB 1MFBL 4PJIE 2X9WA 5EZOH 3QEHA 4TUKL 4X6CA 3N11A 2FLBT 1NBZB 2ED8A 4CVZA 1NCDL 1UWTA 3IU3B 1QSFB 2J88H 3BC9A 4I3SL 3MCKA 1O7SA 5E2UL 1DVFA 1O7AA 2GK2A 1NCTA 4WU5A 3ULVD 4FLOA 1T5WB 2FDBP 1K9TA 5ACZB 3VWKB 3PL6D 3VIHA 4AZCB 2B4CC 4PBVC 1WEJL 4M7JL 3DNKA 4CVWA 4K8RH 3ZOAA 1ACYH 2NY1D 4AZHA 5IB5A 3GI9L 2NW0A 2RCSL 5T1MA 2Y23A 3EOTL 5GGRY 1FBIH 1Q0YH 1S7XA 2A2QT 3I6LE 4TSBL 4U1MA 1MW3A 4OCXL 5DQJA 4WI5A 1CLZH 1ZT4B 1KLGA 1JI2A 5F9JA 2AQ3A 2VYRE 3OZ9L 1OTTC 4XC1H 1FZMB 3CUFA 1XH0A 4P5TA 3NA9L 4JM4H 1WWCA 1Z32X 4O2EB 3FQTB 1JNNH 2MNUA 1G6RB 5ITBH 3TLRA 3MRIA 1E6SM 1NWUA 1KCVL 1WWBX 5FO7B 3ABZA 4MZ3A 2V17L 5CD3B 5KSBF 3P0VH 5KSBA 1DQDL 3VRIB 1ZT4A 4S0TD 3BZFA 5ELIA 5IBUB 3RDTC 5L2KB 1F8TL 1C08B 1PKOA 4PGBA 4PGZA 2CH8A 4X6CE 1PG7W 5E9DD 1TE1A 5CSUA 4HWUA 1QEWB 2VRQA 1X5XA 5CCKH 4BM7A 1UD3A 3CDYA 4WI6A 2BOCA 4HIEA 1CLYH 1HHJB 4D0BB 3OAZH 4X4MA 4Y1AD 4UDTA 3WFBH 4BSVA 3LPOA 4UFHA 3ARDD 1Z9MA 4MXVF 3QIUC 5KOMC 3WN5B 4HBQA 5J1TC 5GNXA 5FDWB 1XGYH 1UWQA 3PDDA 4F8XA 3QWQB 1V7MH 4TNVF 4M82A 1RU9L 5E4EC 2OJZL 3KYOB 4OCRL 4GI9A 1NUNB 3KJ4B 1D5MA 4NBXB 2XN9B 3LAFA 4Q9RH 1V6YA 4NGHL 2PXYD 4Z7WA 4NP4L 2IAND 5ICYB 1KJ2H 1KV3A 2B4CH 3DV6A 5SWZD 3QUZA 4L4VB 2XICA 5E5MB 2ED7A 2FIRT 3SY0A 3DI2B 5GS0L 1I8MB 2YRLA 4PMOA 3HI5H 1KIPA 4Y4FB 2WCGA 1S7XB 3WH7A 5JUVA 4W6YB 5CCKL 1NL0H 2YD6A 3C09B 4P59H 3TT3H 2CIIB 3VXSD 3PN8A 3T3PE 4LLMA 5ESAB 1SMAA 2AK1L 3ARGA 3V52H 1CNVA 1ZS2A 5T1DL 2D3VA 4JKPH 2AV7B 2IAMC 5A1AA 5B8CB 3VXQA 1R24B 3EFFB 1N7ML 3H9SB 3MJ8B 4J27A 4LCIH 4NRXA 4V2BA 4G80B 3VFSA 5TPWL 3SDAD 4YJZL 5IB3A 1B9ZA 1D7FA 5KSUA 1RUPL 5JMOC 2ZP0T 1YMMB 2IXVA 3CZ8A 4P2OB 5DZNA 2YL6A 1DTUA 2X4QA 2Y5EA 2BFVH 3FT3A 3WHE1 1G7HB 4RWYH 1KACB 5TFSH 2Z9TA 4TUJA 1W3HA 3VIKA 3VWKC 4C56A 4MZ2A 3S98A 4LPWA 4H1LG 1TVHA 3DXAA 4LVNC 3QWOA 2EJ1A 3DHPA 1JNHA 2ORBH 3A6OA 2YBRA 5IVXF 1T5XA 2QLVB 4P4RA 2WUCL 4GAGH 4IDJL 2IH3B 2ADJA 3MUZ1 4JY4B 1MVFA 3RJXA 2NY4B 4KROC 1CFTA 2IG2H 1CGSL 5ITFA 4OF3A 1E4JA 1I7TB 4ZXBC 3LKSA 3S36L 1MWOA 3S37H 1HHGB 2ZOKA 5IB1B 3SKNA 2VDNH 4M81A 3NCJL 1C8YA 1RURL 5DYOA 3W0WB 3GHEH 1T6WA 4ONGH 5IKCA 2VDPL 3HNVL 4YDIH 3MV7B 1WFTA 3GSNA 3BXWA 4KUCD 4W68A 1E70M 1R7OA 1Z3GH 1DLFH 2R0KH 3M45A 5HHNB 3NAAL 2PWEA 4H8WC 4DW2L 4IDLA 2NX5A 2Q6WA 3HZYB 4DCQA 4L4JA 1JAEA 1IGYB 1E5JA 1U2CA 4P2RD 2FDMA 2AXFB 5GHWL 4JN1L 3ILPA 5EZIL 4GG6A 3G6AB 4WHYG 1SBBA 3BEWB 3SKNB 4L4VE 4OF6A 1KFAL 1HL9A 3WD3A 5JBFA 1J1PL 5C0EA 1M03A 5AYIA 1E4XI 4YUEH 2JEPA 1WT5A 3QUMA 2XWTB 3MA9H 5IV2B 2GI7A 4L29B 3PDOA 3TGXA 4OLEA 3I9GH 4N0CD 5DRZB 2YN3A 3D5OF 4R27A 3AISA 5EPMA 1VIWA 1PEWA 3AY4A 3QJFB 3PG2A 1GOMA 3KE0A 3UBXG 1W0WB 4G8GB 5I8CB 1F45A 1EJ6A 1F6LL 4HIIB 1MWAL 3MLTB 1W0VA 3WS3A 4CVXB 1R3KB 5T1KB 1CDCA 1WFUA 4F58L 5IR1B 5D4YA 2KL6A 1ZANH 2BY0A 4K7PH 3OF6A 2AGJH 1HCVA 2A74B 3BQUA 3NFSL 1YY9D 1U8KB 5DJZA 2XNAB 4HWBH 4F9DA 2HG5A 2ITCA 3IANA 1NFDF 3UC0H 1KSRA 2XYLA 1ACZA 1AGBA 3RY6A 4G8FA 3WFHB 1S9KC 5DRWA 1CD1B 5GRUH 1RUAL 4ZE5A 4JO4H 3QZWA 4YC2C 1QFWI 3VXRD 3RY4A 3ZO9A 1D6VH 3O11A 4TSAL 1J1XH 2IBZY 1ZJAA 1VCAA 1P7QB 4E4PA 3D2UA 4C56D 3L4WA 5D1ZB 1C91A 1ZU8A 1CF8L 3S5LA 4F58H 5KVDH 2DD8H 1RMFH 4V1DE 3OB0H 4HJ0D 4XNQB 3F7YB 1UA6H 3T2NH 3ZSSA 2DSKA 3AGVA 3QI9C 5C0CA 4HC1L 3E6HA 1OF2A 5A6SA 4XP9H 5EFDA 5ADOH 2WSKA 2FX9H 4CMHB 2J3SA 4X9GA 1WBYB 4HZAA 1U9KA 5ACZA 1P7QA 4FQQA 4JO4L 1CLOL 2VISB 1AY1H 4PJEF 3RPMA 1D6VL 1JZ3A 1GZPB 3NOIA 4FABL 4PYGA 4TVDA 5F96L 4Y5VB 1VDGA 1CF8H 1NDMB 5FDYA 5J11C 4OSUH 5CS7A 2Y36H 4NQEB 1F02I 3FHQA 2GJJA 3FB7B 5DVNA 4F7PB 4OZIA 4L8CA 1V03A 4UNUA 1J10A 2FYYB 3GMPB 4NQCA 2BNQE 1TFHA 1UXWB 3BN9D 1ISVA 5D4QA 1VKXA 4GKNA 2VISA 1JHKH 1F3JA 3OR7B 4G8FB 2LABA 5I75B 4HZ8A 2TAAA 4FG6C 4HJJL 4P5KA 43CAA 1V3MA 5IFJB 1N5AA 5J12B 1HZHH 3GSUA 3SJVA 4G43A 4QRQA 4UOQA 1PY9A 1W72H 4XMKL 4WW1B 5C3LD 1WZMA 4ZUWA 3SDCB 4Y4KD 5LGKA 2FATH 4QHUB 1QHOA 5I24A 4A2LA 4GKLA 2OTUA 5DUPH 2DLFH 2VVSA 4ZS6D 3LKRB 4LCYA 1WDQA 4MNMA 3SGKA 5HHQB 2VAAB 4UFJA 2NY3D 2A1WL 2IMMA 4F33B 1IAIM 3N1QC 2FBOJ 2ARJB 4N90D 4NQDB 4PTUB 3FQWA 1OM3H 3RU8H 4WI3A 1VPOH 3UXFA 4WFGD 1G9HA 4JFEA 1BD2D 5LBSL 4FQHB 4X7DC 2HLFD 4GLRH 5JOPD 1YQVL 2WP3T 4OJFL 3HCVA 2VVNA 2A77L 3CK0H 3RKDC 2XN9D 1J05A 2NXYC 3VM5A 1FZKB 3RVTC 1FBIL 1Q0YL 4K3HA 1ZBKA 2IXUA 2OJZH 2ZSVA 5EOCL 3B2UC 3TVMA 1V0KA 4YDJA 3L5IA 1NEUA 3CFJA 4ISVB 1X9QA 2V9TA 4K71B 3ZKNC 5HPOA 3EYUH 4L8CB 3UYPA 5HBBA 4ZUVA 3O0RL 1QRNA 1WIOA 1QBMH 4JO1L 5F6IC 2KBGA 1JNJA 4YPJA 5B3JE 1PW3A 3A4XA 4N0UE 2GQHA 2V17H 1HOCB 4AH2B 1B3JA 2ILLA 2X89A 4R3SB 1Y6KR 1DWJM 4UFLA 3KPSB 2J5LC 3K7UA 4Z0BH 2PKDA 2EO1A 5I1IH 1VFAB 1CFTB 3WD1A 1H3UA 1T89C 1PX4A 3IYLW 3VVGA 3ARXA 3VI4E 4AY1A 2Q7YA 5HYIA 5K33A 2L0DA 5TPWH 1A3LL 2B5IC 4EDWH 4JFFD 2B1HH 2YMXH 1A6UH 2VABA 1EZVX 3KJ6L 2QSCH 4ZUTB 3DV4B 1NM9A 4JFSA 3VXRB 3PL6C 4FQJL 4RWYL 1V6XA 3GM0A 2UWFA 2VQ1B 1R87A 5L2KD 3QI9A 1N8ZA 3IDXL 4P3CL 4DWSD 1OB0A 3P0YL 4JFUA 5CJXC 4PJCA 4LVEA 1R5VA 3L5XH 3QG6A 4U1GB 3FZUC 2BRRH 5BWFA 1Q9WB 3K1DA 2V7NA 1KENH 2D03L 4RGNC 1FNHA 1NBZA 1A6ZB 5HHME 4ATWA 4G80A 2W4XA 3HMXL 1JBJA 1MCKA 3U0PA 1C5CH 1U95A 3NPZB 3QIWD 5ADPL 2AK1H 4NJ9H 1P6FA 1X1NA 3WUZA 4G6AC 1KPUA 1U8PB 4NT6B 5CZKA 3CPUA 1GPFA 2MANA 5IDIA 3QWOB 4KHTH 5DUMH 5BCAA 2W61A 4XCFH 1U3YA 1UH2A 2JB6B 2ZUWA 4PJBB 3P0YH 2IQ9H 1SM3H 4TRPL 4GT7A 1YN6B 3JV0A 3O6FA 4YXHL 3OKKA 4JHBA 3BDYL 4KUCF 2IADA 4O2FB 3H3PH 4N0UB 1DN0B 4TSCH 3QDGD 5BQ7A 1WVZA 4XCCH 3EYFA 25C8L 4HUWB 5K93A 4XVJH 2UWEB 3WN5A 2BDNH 2ZUQC 3C5SB 5IWLA 4KQ3H 4PUBL 1MHCA 4D6CA 4KKNA 1QFWL 2CHNA 3QAZC 1MCCA 2IQ9L 4G7YL 3E3QC 1BFSA 4PJCF 4UIMB 5HGBB 2E7BA 2ZUUA 1OW0C 3DOSA 3MMEB 1LDPH 1QQDA 3GI9H 4WFHD 2CKBB 1GIGH 1US2A 3UMTA 4DOHB 3VOCA 3AS3A 1IGCH 3ZDYF 3FB8A 1NC2D 5BXFB 3MMDA 4NUGH 5KAQF 4ETQB 1LHZA 3OZ9H 3WUWA 1JV5B 3AIQA 5F1NB 4X6EB 3DX6A 3EO1B 2W91A 4JPIB 3AZSA 1H8NA 3CHFA 4HIHA 4UQ2B 1P53A 4GLRI 3FB5B 1NEZA 4RMRA 1E0WA 3BPNB 4MMZC 3PZQA 4JL2A 4UAOB 1KFAH 5I9QB 3KDMA 3OX8B 4PJXA 5SV3A 4PGBB 3KYAA 1JGUL 1JVKA 3O2DA 2QQQA 4ONOA 1BAGA 4PB0H 5C09B 2O9RA 2CHOA 3MA9L 1KCLA 2J7CA 1BLNA 3MV7E 3V4UL 3MKKA 3C6LD 3FFCA 5A95A 2CPCA 1B3WA 4OAWB 5KSAB 4S1RL 3QJFA 4X80H 2CETA 3B2VL 4NQVA 1AXSB 1CFNA 4OFPA 4OZ4B 3I3EA 3CZJA 3FO9A 5HHPA 2YBRB 2GJZA 4RMSA 1BFTA 1A1OA 3SKJH 4MJIB 2VDKH 3WSQH 2FJGB 1ZT1A 1A47A 1E40A 5EN2A 5HPCA 1DQLL 1A9EA 4H26A 3VDBA 2VH5L 4Z0XA 4I0KA 1MCOL 2NTFA 5EULV 4GUPA 4HUVB 1OAKH 1T66C 4AIXA 3P4MA 3U30B 5E8DH 1CICC 5GS2H 5D8WA 4Y8AA 4A4AA 2JK5A 3GB7A 2E7LA 5FIEA 2H8PB 1TZIB 1KJVB 2I5YH 4LKCA 3RMEA 3BAEH 5FOJA 1GQKA 1KPRA 3WKMH 4AENB 3MREA 4IPNB 1NMCC 4G6MH 7A3HA 4CD7A 2KZWA 4NIKB 1YY8A 3O3UN 5C8JA 3V5DB 1ZTXH 3W38A 2EIZB 4C7FA 1MVUB 2NY7L 1RMFL 3FQNB 1UD4A 5HI5C 3CCHA 2ERJC 3IDYB 2WC3A 1L7IH 4M93B 3S88H 5KOVC 5D9MA 1UD2A 2EE3A 4XVSL 1OQOA 4E41A 43C9B 3MBEB 1IT9L 1J8HB 2XPGA 1GOQA 1XGUA 1PQZA 1KJVA 3QDMD 3U0PB 4MA3A 5C09A 3AS0A 3QIUA 1GGBH 1H15B 2X4NA 5CEXA 3U79A 3RDKA 3ROLA 5MHSE 3L3GB 2EYSA 4PD4K 1N4XH 1U8LB 4F79A 4P7QA 5GGTL 5AD0A 3SDAA 2FHCA 5DMKB 1W0WA 1R5WA 4Z7VF 1S3KH 4KTYA 2ZXDA 2ESVA 1TCRB 3V4VL 1OB1A 1W9PA 4PIRF 3L3OB 4L4TE 3HC0A 1YY9C 4MNGB 3IRZA 3MODL 4M8UA 1KIRB 2DI9A 3UG4A 4L3EE 3UTTD 3BQUC 2V3EA 2J7DA 5F9OH 1BMGA 3P11H 2I07B 3BP5B 2E3ZA 2R0LH 5D2LB 3FOLB 3QXAB 4NZDA 2G5RA 3D3AA 3DMMB 1TNNA 1BOYA 5DQJB 1JGVL 1MXGA 4DN3H 4HOZA 3LEYH 4XP4H 5CSGA 1ISXA 1D9KA 4LGRB 3OIHA 1CFQA 3HC0B 4WW1A 3EO9H 4H0IA 5AZ2H 4S1QL 1G7MB 3V5KA 3FT2B 5FYJL 4RGNB 4GRLB 5I2UA 1B0RA 4NKDA 7FABH 1WV7T 5ETUA 4HA1A 1BQLH 1ONQA 3N9GH 3EGSB 4ML4A 5DUPL 2HWZH 4LCYB 2VX4A 4L4OA 3KYNA 5CILL 3B5HA 3W9DA 4UQCA 1LO0H 4OCXH 4MA3B 3LS5H 2OR9H 1TNMA 2P48B 3W0WE 2C7FA 3BIKA 3IKCB 3MGAA 2J79A 4EBQL 4NSBA 3SDCD 2W9DL 2PW1B 3BWAA 3ZKXC 1UYWL 5D7KE 4UDTB 4BSVB 2AP2A 4BK4A 4XP1L 3L4UA 5AD0B 3QWRA 3I9GL 1NSNL 1XSKA 3FFDA 4Y1AE 4PJ7A 4PMVA 1FCCA 2PW2A 1CGXA 3QDME 2LU4A 1BZ7B 1RK0A 4HDIB 3NBNA 2HFEB 5J13B 3MO4A 3KL5A 1C5BH 1KBGH 1UR2A 1ORSA 1NEZG 5DD3H 1K6QH 2FR4A 1G01A 2Z35B 4IS6A 3SGEH 5LCVH 1LL4A 2ZICA 1FP8A 3SDDD 5LYRA 2H1PL 1IKNC 1QNZL 3D48R 4YNYA 4JRXA 5BMFL 2IFFH 1YMMD 2XZAL 1MH5A 2CGRH 2Y24A 1KN4L 3AAZB 1YJDL 5JOPE 1AFVH 3L1OH 1I3GH 1X6NA 1ZGLA 3EFDL 1DBBH 4AIOA 5L2JB 1OAQL 1M7XA 2GJ6E 2X1XR 5MEQA 2VDQH 3M07A 5DJ2A 4YHML 1B0GB 2F53B 1CWYA 1MAJA 4KJQC 2LV4A 4B7IA 3BVNA 4NQED 2IJ0C 3W39B 5LA2A 1TJHL 3QXUA 1WAWA 5FYKU 2YKKA 3WIHL 3JTSA 4JDVB 3GNMH 3C60C 4UB0L 4F57H 4X0VA 1YEKL 2DQCL 1N8ZB 3GMQB 4Z95L 4Q97A 1WICA 5IROC 1N3NA 3FRUB 1D5MB 1DBMH 4Y2DA 1QTYT 1ZEAH 3R8QA 4QXGL 2K7PA 4AJ0A 1HIZA 3NPSC 3VH8G 3LQMA 3WJLC 1DQQA 1GGTA 3UTQA 1TA3A 3MV01 3EO0B 2ZSWB 4J23A 5FO7A 3N04A 1CIDA 3VRJB 3KLAA 2D31A 5FK9B 5C0IB 1U3ZA 1QO3B 4JQIH 3W0WD 4P46B 4Y4KB 3X3GH 2XWTA 5I15H 2DIEA 3IFOA 4DWSB 3EJZC 3EUUA 4R4ND 2C1OB 5ID0A 4UR9A 4M6NH 3WIHH 1XZ0B 2AJZB 4ODXB 2GAZA 4PRBA 2QHRL 4M6MH 3KPMA 3OXSB 1N6UA 3GBEA 4XPBL 1DUZB 2BVQA 1OAXH 1LVEA 5BZDA 1OTSD 1NCBH 4MYWB 1FL3A 4JPKH 3SKMB 5L2KE 1QG3A 2GJ6A 4RIRB 4U6XB 2WZEA 1MHCB 4MX7A 4IRSA 1IC1A 5IW6B 3L9RA 3TJHC 4GAGL 1SEQL 4U31A 5C0JB 2XTJB 4PRPA 1QBAA 4GUPB 1S7WA 5E8NB 1S7SA 1F5WA 1CBGA 3LKNB 4XCCL 3GFUA 3S9DB 4F15B 3LKRA 4S10A 1MFAL 4KTEL 4X99B 3VI4F 4RGMC 4ZPTB 3LRGA 4HV8A 35C8H 1MCSA 2AJXH 1EFQA 1ITCA 4XP6L 1DQTA 4P7NA 2HLAA 1RIHH 4JFEB 3KPRB 3LSOA 3MRCB 3WXWH 4QRSB 4AZCA 1UWXK 1NBYA 1J05B 4BQ9A 1DLFL 2R0KL 3VGAB 1IEAA 1AO7E 1ISWA 2BOCB 5DLML 4YDLC 3G6MA 4Z2LA 1U8HB 3BDXA 4ONFL 3QXDB 4JANA 5FA4A 3DUSA 1FYTB 4QF1A 1VFBA 1IC7H 3ZL4L 4R2GB 3AU1B 1Q72L 3GSVB 4N8CL 2Q8BH 3MRBB 4JHWL 4MD4B 5CKGA 3ZTJG 1OOAA 3AMLA 3QRFM 3CGTA 3UZEA 1AKJB 4OB5L 3BAXA 3KZSA 4XMPL 2NW3A 2VN7A 2I27N 4K7FA 4RZCA 2BCKB 4LCCA 5D7IE 2Q6WB 3SUWA 3T0BA 3TVMD 4PJ5E 1X4ZA 4LKXA 2CYGA 4S1DD 2X4OA 2WVSA 2YZ8A 1YNKL 4MQXC 1ZLVK 1JZ6A 1G7IA 4OCYH 4LSRH 2RGMA 3C5ZA 3ULVH 4WK9A 3MBED 4NKIL 3D69B 1JWUB 4JVUA 3LMJL 3SCMD 4NHCH 2F5AH 2FR4B 4XVSH 4XNXH 1H3PH 1QOXA 4GRWF 3DIFB 4L5FH 2X9XA 1CFBA 2R0ZL 1UT9A 1FIEA 4CADA 2A6DA 3QUKB 1K5NA 4JZOB 2XTKA 1JYXA 1MQKH 3U0TA 1ES0B 1RUQL 3RI5K 3CH1B 3SPVA 3TH2T 2H45A 3WFZA 4CD5A 1UADC 2MKLC 5MENA 3DPBA 5IOPB 3O9WB 3WIFA 4BSJA 2V7HA 2JIWA 1R7AA 2D7OA 1RZGB 4JE4B 1KXVA 3W27A 4ZFOB 3BAJA 5JHLH 1S3KL 4LXFA 1DR9A 1F4XL 2HMID 3PJSA 4RFNC 1I8KA 3K46A 1YPZB 2X70A 5E8DL 4DZBA 3ULVL 4Z7WF 2Q8AH 4GW4A 3GIZH 4DN4L 3RQ3A 5T1LB 5JO5B 3RM8A 2C3VB 2IUZA 3O6MH 4HH9B 1CU4H 2R0LL 2C4FT 3QQ4B 5F1SA 3FONB 3DHJA 5JHDE 4ZNEA 5BROA 5DQ9B 4K94C 5C0DB 3TA3D 3HMWH 3OGVA 1I3UA 5E4IA 2QEJA 4FNLH 5FGRA 4C4KT 3PGFH 4XNZB 1A9BB 3S5LB 3MRNA 1OHQA 3ES6B 7CGTA 1CLOH 3IS1X 3FAWA 4YHNB 4RAVA 4HIJA 1M6OA 1KIUA 2HT4C 3CZFB 4JFYB 2WW8A 4MHHI 4OF8A 5CMAA 1M01A 2J6EL 3FB8B 4XX1G 1E4LA 4DGIH 3KG5A 5EBMB 1H3WM 1BD2B 1ORSB 4KVCH 1KTDA 2JJUA 1RUML 3BRDA 5D71L 2VOTA 4EKJA 4W86A 1I1CA 4DTGL 1PEZA 3G5XA 1AQMA 1OSEA 2XYCA 3OLGA 2QSVA 5GS0D 4ODHL 5GS3A 3BKYH 5K9JH 1U8OA 1UKTA 3CZFA 4JFYA 3MODH 1UZ8A 4A3HA 5M17A 3LKPA 3B5TA 4YHZH 4LLQA 1F4AA 4PJFE 1BJ1J 4GQPH 1RZJC 5TE6H 3QUZD 5GRYA 3LKSB 4ENED 1VKXB 2FEDD 2R1YB 5JR1L 1G6RH 1M05A 5KEZA 2GSGA 1OSPL 1P1ZB 4WO4B 3H7BA 2ZCKL 1UG9A 3GSNB 1P2CA 4LCWA 3MJ7A 4EQ2A 3RU8L 5JW4R 1EO8H 4U6YA 5FYJH 1MHPH 3DX6B 2PTVA 3BKYL 1TJGL 4HUUA 2NX5B 4NUGL 4OM0L 2MQ3A 4OD2B 3DJ9A 5JDSB 3OMZA 3ULUE 2XVNA 4YK4B 4ORZC 3OQ3B 2VDOH 3SOBL 1I9RH 1LO0L 1VFMA 5JW4M 1L0XA 1QI4A 1OAQH 1ZHLB 4QCIA 1HVQA 5BRZE 4KGLA 5DC4B 2XZZA 5JR1H 2YD5A 3U7YH 1WJ3A 3VI3F 3JTTA 5GSVB 5ESQB 1I1YA 3EYUL 5D1XA 4HAGA 2NY6B 3D87B 5INDB 4PG2A 3LPGA 2V2WB 3L2LA 3WNNA 5IQ9B 5F6HJ 3VIJA 1G0XA 1I3VA 1BD2E 5C0CD 4JFZL 2CBVA 2FJGA 3QI9B 4XX1E 3T65A 2VLLA 2FGWH 4P2QE 2RAMA 3QCUH 4I0PA 3LEXA 5MEQB 2AERT 3L95A 5IT2L 3FHAA 3VXMB 1EHLH 3UCQA 4YBHA 5HGHB 1W1TA 2G9HA 3NH7H 2IGFL 1BIHA 1KEMH 3BD3A 4NM4H 3SEPA 3FQUA 1P1ZA 2IWGA 3MRMB 5AYBA 2HJKA 3T4AA 1AQDB 3NCBB 3WLBB 3WNKA 2I5YL 1IQDB 4FQJH 3CXDH 1CLXA 1PJ9A 2JF1A 4XPBH 3NIYA 4NT6A 3CFEB 2M26A 1IEAB 3HUJA 3KPTA 2VRJA 1YEDA 4X9HA 4YHPB 3GMPA 2Z8VC 1FZKA 2R39A 3BXNB 5JW4N 1E6QM 1KIPB 2AQ2A 5E6ZA 3TF7C 3N1GC 1LL7A 4YDLB 3GSVA 1NCWL 2Z91A 4TX8A 2IAMA 3AVEA 4KK6C 3PV6B 3H0TB 3AC0A 3QOKA 4QOKA 5HDQL 4NZRH 1V0MA 2WZIA 3F6LA 4LRIA 3JWNC 5IUSA 2CDFB 4GKZA 3BP6B 4OIAA 2NZ9D 3ARFD 1EMTH 4G5ZH 4JCMA 4QXGH 1CR9H 3JV6B 4RQQB 4TVCA 3EZJB 1RJYB 1QRKA 4JB9L 1XSIA 1T1WA 1YMME 2P4AB 3F6IA 4DJMA 1FVDA 2XZQH 1I7ZB 1I1FB 3LQAL 3VFTB 3AXLA 4PLJC 1C08A 1UWGL 3ZDYE 4G9DA 3H9SE 5DJAB 5DLMH 5F7EH 1XZ0A 4R8WH 4QNPF 4NQSB 4CCEA 5T5NG 1NJ9B 3FOMA 3DRTA 4JHWH 5HPMA 1JDDA 4HZLB 2W0FB 1CR9L 1Z0MA 3SJVB 1NGPL 1J1OH 1FVCA 5CZXD 1INEL 3RHWF 4PS4L 4I3GA 2JELL 2VLRB 4M9PA 5HHOD 5B3JF 5GZND 2Z0BA 3UTTA 1RULL 2EYRA 4OLYH 8FABA 3MOQA 2J77A 5E8PA 1DP0A 1ZHNA 4MLIA 4L8DA 2Y8KA 2P8MB 3VXPA 3HUJF 1H8OA 3QHZL 4KI5E 1W9DM 1MFAH 4KTEH 1RSFA 5HI4C 1P7HL 1XGTA 2XXMB 5HD8D 3O3BB 1YUHA 3IAPA 4MMXC 3O4OC 2A6DB 1E6OL 1A7QL 5DRXB 4MSWA 1U8QA 4WY7L 1FG9C 1B2YA 4K7PY 1QSED 2WHKA 1OGTB 5IFHL 3S97C 4TULL 4XAKD 3BO8A 1A6TB 1RZGA 3HE6A 4N0FB 3DYOA 4G9FB 4MNGE 2Z4QB 4XCEA 4X6CB 2DLHA 1QNRA 3U7VA 1IAII 5K9QG 4Z7NE 1ODUA 1EO7A 5D70H 2XPGB 1SVZA 2EE2A 3BGMA 3AMDA 1BP3B 3HPLB 4Q9RL 2WBWB 4LRIC 5C07A 1AIFB 2AJUH 2Z8SA 1S7VB 4N0UA 4EXPX 4TXEA 3PP4H 5DJYB 5LAXA 4OZFB 1NCCL 4HQQL 1R5VB 3H9SA 1K9EA 3VFOB 4RMWA 1M53A 1F4WH 1OP5K 1E4KC 3TT3L 2AAAA 3VMNA 2X1PA 1YEJH 1IGFH 4NRZB 4BK5A 1O0VA 1VAHA 2WBGA 4LAQH 3F5WB 1WBZB 1AIFA 4J12A 1JYNA 3NN8B 3FQXA 4M43H 4Y4FA 3K3QA 4Y5YC 1XF1A 3EFDH 1U93A 4UUJA 4BFIA 2YPKA 3OKOA 1FO0H 4DZBB 1A7OH 1DE4B 4MDJB 2VDLH 2W1NA 3NDZA 3BKMH 2N56A 3O6AA 1TVPA 4NPYA 2AABL 1UQZA 1NC4D 5BW7C 1OWRM 1A7BA 1YEEL 5HVFB 3BSZL 3O9WA 1JIBA 4OCSH 3TN0B 5HHXH 2JJTA 1KYOJ 2XZCL 3O4LD 3PDGA 5IBTH 1CBVH 1C92A 1F4WL 3U4BL 1K9DA 3WEXA 4WENB 3WNPA 4U1KA 1UWUA 2CR6A 2XVPA 1TZGH 1IC4L 4N8VA 4C59B 2GSIB 3I6KB 1MFUA 2A6JB 3HTLX 5HYJB 1FHGA 3VG9B 1INDL 1CK0H 2BVPB 1KGCE 3FQWB 1L9NA 3ZE0F 4NO3A 5TE6L 3HMWL 4X9BA 3VG0H 1FV1A 1RK1B 5IVZB 4QRTB 3QUYB 5MERA 4LIQL 1TQCC 4OZFG 5EU6B 3JWOH 4QHLA 4XI5C 3EYVA 1YEEH 2BOBB 3M8OH 2WK2A 4E8CA 2QHRH 1KIQB 5I66B 3TTSA 1VESA 2AEPL 3DUHA 1MHPL 2C3XA 2YSSA 3B3IA 1IGMH 5HHMD 1DLHB 2AJ3B 3MJ9L 1PLGH 3QDJE 3HC3L 5D71H 4YO0B 3U9PL 4GKNB 5E9AA 3WQ8A 4TN9A 3VM7A 3IGAA 1JDCA 3BT2L 3E6FA 1CLCA 2EH8L 2XA8H 4HGMA 1G1CA 4N0RA 5F9WB 1OM0A 3WFCL 1AD9B 5FA3A 5GHWH 4BH8A 4MDJA 1DQMH 5KTEH 5BJTB 3CLEH 4PRHD 4HOWA 3MLTA 4YBLC 3WS3B 3ARQA 1FE8L 4FFWD 2CMRH 4MAUL 4POYA 4Z7NF 2MTPA 2VT0A 2ESVB 1YYML 4OZHB 4JRYE 3NSMA 4KDVA 2DI8A 4PRID 4P2OA 2ADFL 2NCMA 1LEGB 2IH3A 3A6CL 2D7TH 3OGCA 2D4FA 2Q8XA 5D7LB 3HS0A 3T04D 5LA1A 1QSVA 2EIZA 1R3IH 1U3HB 4OGZA 3NZHL 4G8IB 4S1QH 4QLRA 4U3XA 2GY7B 3DVNB 3ELAT 1NBVH 2Z91B 4MQXD 3TH3T 5HJ3A 3BPOB 1KG0B 3MJ9H 3TESA 3U9PH 1A7RL 5IEKB 3RZWA 3UJJL 3NIDE 4GW5B 3REWB 1X5KA 5D6CA 1FRGL 3ROOB 4KVNH 1XT5A 4MD0A 3ARZA 3ZJ7A 5BO1H 5TDNA 1I7RB 5JIWA 4LU5L 5A2KH 4GMTH 5E8EB 2HT4D 4RFNB 1EGZA 4NO2B 4KZEH 4Y19E 1H3TA 1QSZA 5HYQA 3UDWA 4TSAH 4PTXA 1FC2D 3L5WA 3OKLA 4PG2C 1SYSA 3MX0A 2I26N 3RL1B 4L4TB 4C56E 4MDOA 3KNBA 4OZGF 1BYDA 1NBVL 4ZNEE 5C07B 2DIAA 4FLSA 2PW1A 3OB8A 5E08L 1UG6A 2QSTA 3GXFA 3TBVB 1W3KA 4FQLH 2VZVA 3WO4B 3QUMH 2VZ1A 4XB3A 1HX0A 3TEUA 1OARH 1T1XA 4Y5VA 1MRFH 2UY5A 3LKQB 2R0ZH 4QWWD 2H1PH 5ANME 3C5ZD 3BZFB 2G60H 3QYCA 5IR1A 3PWPB 2R1XB 3QDMA 4PRIB 3DC0A 5ISZB 3GUTA 4FMVA 4KRMB 4E42A 2R2BB 3IDMB 1OIMA 4AMCA 2LAGB 4HWZA 2BSTB 4Y7EA 3CSYA 1I3GL 4ORGB 5EPMB 4JKLA 1X5HA 4R7DB 3HKFA 1UB6A 3D39A 1NANH 2J7HA 4HKXB 4NM4L 2DM7A 4A6YL 4JFDA 2R1YA 1UWGH 3ZJ8A 32C2A 4PR5A 1B3VA 4Z5RB 3LDBB 4XGZA 3QFDB 1HI6B 1S9WA 1CDBA 5ITBL 1GQIA 4DN4H 2XG5A 4FQ2L 1EXPA 2YOCA 3CU7A 4K8RD 4L3AA 4N5UA 3MACH 2OXGA 3T0VA 1V3KA 1FIGH 4W4OA 2LE9A 1FG2A 2P24A 3HI1A 4DQOL 3DX7A 2DQIH 5BV7C 4PJ5A 4UILH 4YN5A 4ZD3L 1HXMB 5D9PA 5C0EB 4P5TD 2EXOA 2Z92A 4LHJB 3OLEA 3L7FA 1Q8MA 3TA3A 1DUYB 3PV7A 4WU7B 4PY8J 2QADB 3LQZB 2V5YA 5HVHC 2NY1B 1ED3A 2NXZC 3RGVB 5BOZG 1MIEH 4WUKH 5CEZE 4KRPB 4PJ8B 4DKEH 4M6NL 1A4JB 1U92A 3VFMB 3HFMH 3FQRA 4UQ9A 4PJ7B 4YFLI 5I19L 5DMGC 2CLVB 1XF2A 2PWFA 3W6LA 4LSPH 2YBTA 2DTSA 5D7LE 5C0IA 5DZOA 1PYWB 1VPOL 3NGBC 1Y6NR 4NGHH 1FFRA 4P48A 4HWEH 1FIGL 4AL8L 2GJRA 1QFUH 4RE3A 4W6XB 4UILL 3FKUS 5EU3A 5BZWA 4ZO7A 4RMTA 2FX7L 4KY1L 4TTDD 5GJSH 1Z0NA 1Z9LA 5L8JB 3CH9A 1JPGB 3MRDB 3R1GH 2G9HB 1ZT7A 4P46D 4PLOB 3RNKB 5IB2A 5ILTL 1NGPH 1FFNB 3CUIA 3MV9B 4MDIB 5F89B 4BSWA 1AC0A 5BXRA 1A02N 4N1EA 1DWGM 5DQDL 1FNAA 1UCBH 2WQ8A 4LSPL 1P84J 3QUXB 1R24A 3EFFA 4O02L 1U58A 4JO1H 5D7SH 4NKMB 4PRAB 1CD0A 2OZ4L 2X4PA 3EBAA 3TBYA 5BS0A 2CIPA 1QQDB 2NY5C 3W26A 1TXKA 4OGAD 2DQTH 4AZGA 1YEJL 3QPQC 1KB5H 4K3EH 1B1YA 5H8DA 2O5ZH 1H09A 4YDVB 3UESA 3RY5A 3S6CA 2A6IB 2WKLA 2R4RL 1BQHG 4UV7L 4V2XA 4E41D 2C9AA 4W7WA 4QRRA 4ZAKC 2YL8A 3REWA 5HYJE 4PN2A 1C1EL 4PJHE 5GGVH 4YHYB 1XAUA 5DJ6A 1I9IH 4JHOA 2H26B 1FHDA 5I8EA 3VD3A 1G0DA 2YMXL 3UPCA 4CMMA 3QCTL 1MFCL 2WUCH 2DT1A 1P5VA 1T21A 2QSCL 4YE4L 4PJXB 4OKDA 2APBA 3GBMH 1BZ9B 4KJWD 2ZUNA 4JO2L 4PMZA 4BH7B 5GNYA 1UJ3A 4D3CL 1CBVL 4I2XE 3WMBA 4OFIA 2LVCA 5HHOE 5C3TA 4JZJA 1UOKA 1V3JA 4D6DA 2YA1A 4S2SB 2X42A 2FGWL 5M3WA 3S37L 3AM8C 3RNQB 5DJXB 3STLA 4HPGA 1HNFA 4QTHB 3AMCA 1CGYA 4FTVA 3GZAA 5IESL 1B6DA 3MLUL 3OAUH 4QXTB 4YDJB 5L2KA 3JWDL 3PWVB 2FH6A 4AT6A 1NCAL 4BSWB 3LPPA 4YEFA 2NYYC 1UM4L 2C7UB 5F8QC 4I9WE 3W9EA 2FGZA 2YD4A 3WDHA 4GI6A 3RTQD 9CGTA 3RZCA 1G7PA 2J2ZA 5DWUL 5JQHC 3MFFB 4D6FA 1OT2A 1F3DJ 2JIEA 4PTUA 2ZOLA 4X9IA 4R7NB 2AABH 1GGCL 2Y07H 1NANI 2DKMA 2OM5A 1KTDB 1Y0LB 3GIZL 4KK9C 5IHSA 5FUZL 4AD3A 4K8RC 1CU4L 3O6ML 2WMHA 1YEIL 3U4BH 1TFVA 5D1ZD 1JPTL 5B38B 5EMYA 5IB5B 5F7UA 3AIRA 3ZYOA 2CKRA 5SWSE 2QPUA 3VJ6B 2BOBA 2GSIA 1L6XA 1B0IA 2EE9A 1C5DA 4WCYH 4Y19B 5DURB 1HILB 2Y7QA 4G8GE 4K7PL 5CLTA 3KYKL 3WJLA 3IDNB 4LFHG 2GEEA 3MCG1 4QCIB 5GRVK 4JB9H 1RAMA 4NRSA 3L7FB 2AJVH 3KPSE 3LCYA 1SJHB 4DGVL 4MAVA 3M46A 2IH1A 1CDYA 2E7MA 2CK0L 2DKSA 2ADGA 4Z76B 4OLWH 2YEZB 1X4XA 2VZUA 3TNNB 3V4PH 1RUAH 2DQHL 1Q94A 3JWOC 4WFGE 1SBSH 5ICXB 2NPLX 2R2HA 5CD3A 4MHHG 1FL5B 1IGIL 1P2CB 2GITA 3JV4A 4Y88A 1J18A 3ZMRA 4R4BB 1P9MA 1NUFA 4U1JB 3HC3H 1J1OL 4Z2JA 2PXYC 4GKSB 5JQ6L 2EO9A 1I1WA 3UTSB 1MCLA 4NNXA 4Y5VC 1LK3H 2HKFL 1NQ6A 4JRYB 3WIJA 4M7LL 3WFEH 1JNLH 4JM2B 1G7LB 4Y4HA 2E5EA 3KPOB 3VXRA 3IB4A 4LHUD 3GB7B 4LRNL 3OG6B 4KMTH 3OKYA 5A3IC 4IJ3B 1BQHA 5TDPB 4GRLD 4XRCB 4KKLC 4ZXBB 5FO8B 1M71A 2J8UA 3BZ4B 1OWQA 2F8OA 3NA4A 1DHKA 3WH8A 1A7QH 3W5MA 4M5YL 2Y25A 3QUXD 3QG6B 2FBJL 1W72B 1ROWA 3VXUD 3GXMA 2VQUA 1Q9OA 2P5WB 4M4RA 1UQYA 5E8EA 4FTVD 4XPGH 1CFSA 4C54A 3R0NA 4ZFFA 2QPSA 3JVGC 3N1PC 3EYPA 3Q3GB 2JK5B 3AHXA 5GZOD 3D3VB 1T3FB 1QSFA 2V5DA 3LRSB 4P7LA 2JCCE 3D9AH 3LKOB 3NCFB 1PZUB 5EU6E 3DMMC 3MJ7B 2BRQA 3FFCB 5D9SA 3ILQD 3IFNL 5DHVA 2B31A 2DLIA 4HMCA 2HH0H 4XP5L 3VD9A 3MMUA 1JNDA 5E2TL 2JB6A 1OBAA 4ZEPA 5D2NC 4LKXB 3PZNA 5GJTH 3QEUB 5I18L 4FMFA 1MAML 1RZ7H 2X05A 2J7LA 1BFOB 4F9JA 5E7BA 1KTLA 4AZBA 4E42B 4Z7VE 2J62A 1D9KC 3QP3A 4TQEH 2JF7A 2ZUVA 1LK2B 2Z93B 4FQLL 5GISL 5IROA 2ITDA 1HF6A 5KS9F 2JTDA 4G8EA 4NQDA 4P2YA 4WW2B 5IT2H 5JORB 2DN7A 2VSDA 3OAZK 4DVBA 5TE7L 2CD0A 1EGJA 1CCZA 1D5ZA 1BSIA 4OJFH 1S9YA 3K4DA 1FOBA 4X4ZA 4PMRA 3MLWL 5C0JA 3IDGA 4R96B 4N1HB 1S7RA 2XG4A 1D5IL 3MRJB 1S46A 1XMWA 3BOVA 1HWGB 1WZ1H 2P5WD 4Y7MA 3C87A 1GHFL 4XMLH 3THML 5C2UB 4HS6B 1NC2B 3P0VL 2VXTL 3PHQA 5M03A 5D7JD 4JG0L 5E03A 1JZ2A 3KS0H 5KVFL 5K9OB 2EXYC 3O81A 1OP9A 4XWOD 1G7MA 2EIEA 2JCCA 3V5KB 5D6CB 2CRIA 2BY3A 3ZKMC 2AS5M 1US3A 3DECA 4ODTH 1KB5B 3ARYA 4IRJC 1AGEB 3MACL 1EVTC 5AYUH 3VWJA 3ZE2F 2BNRD 1S7RB 3RVXD 5C6WH 1OSZB 3GSXB 3MS8A 1P4IH 5F21B 4N0CC 1HJXA 2Q76B 5FUCC 5I1DA 3MMWA 3MO1A 4HPYL 1TTUA 1CT8A 3QH3B 4WDIA 1NDMA 2AK4E 3DSFL 3O2WH 1ITBB 1ZKAA 3HZVA 3DTXA 4PBXA 3U48A 5I6XC 4FXKA 2P8PB 5E00B 3WLWC 1IAOA 4XZUA 1UCBL 3NVQA 4KK8D 3C6LB 4YR6B 2WHMA 5DVMA 3BW9A 1XF5A 4EIGB 4FQQB 5HI3D 2ARJQ 3IETB 1KJ2L 5LQBH 5HGDB 5E8OA 4H20H 4OD1L 5LXGH 1CZ8H 1U91A 1KC5H 1EAPB 1C16A 4HWEL 1AHWA 2JIXA 2C0HA 1JGIA 1YYMH 1E71M 3UBXI 5FYLL 2X4NB 5CEXB 5IMOB 4PREA 4S1DC 2JELH 5F1IA 2CUMA 4R9HA 4K55A 5IHZA 1LP9F 3HMXH 2YPKB 3OKOB 3ALFA 3BD5A 3PGCA 1WF5A 4N0YL 1UKOA 4XPHH 5D8JH 3IFLL 3WJJC 2WMKA 5FECB 1FFNA 3D25B 2VNCA 3SDCA 4TNVK 5HHNA 4H8VA 2CLRA 1E6OH 4H20L 5DFAA 1W3LA 4M6OH 1SVCP 1I4FB 4E41E 3GKWH 1KBGL 3KXFE 4WY7H 5DFVC 4X7FC 1QI5A 1RVFH 2VTFA 4HX1B 4ODUA 3AXIA 4NI3A 1KTRL 3MV11 5IIEB 1J9YA 2P5EE 3C2AH 4F9PC 2A6JA 2BHUA 4N1CA 4RWHA 3ZYIA 1H0GA 4F3FB 3EJYD 3AYRA 1RIVL 4V27A 5I2IB 3ZYZA 3BE1H 1AKJD 2QADC 4HFUL 3T0EC 4Y4KA 2QR0B 5SWZB 1U8QB 4OQTL 4W7VA 2ZIDA 1EBAA 2P49B 3GGWB 1EDGA 2PI6A 4MPKA 1KJMA 1YMHA 2PYED 3GMMA 1I9IL 1IFHL 1XGPA 5BV7B 4XVJL 5FB8A 1MJ7L 1TA3B 2DYPB 4U1LB 3WL9A 2GK1B 2YUVA 1AXTL 4XCEB 2BDNL 1FPTH 4Y1AA 4JRXD 4EVNA 1L7TL 4KQ3L 3FFDB 2UV3A 1QA9A 4UB0H 5D7JA 2FX8H 4LGPB 4PJDA 1E4MM 1XR9B 2X1WL 3IDJA 1G7HA 4YWGL 4X5XB 1YJDC 5F1OB 4J4PA 5JIHA 3AHZA 3UETA 2ED9A 2FZ3A 2H2SD 3PGDB 3KYKH 4ZSOA 1JP5A 3G5XB 4HV8B 5KBNC 2ZUSA 5HD8C 4KRTA 1PZ5B 1XR8B 4QY8B 3TBTB 4X5LA 1GGUA 2MCPH 3NIGF 5MHSD 4HSQA 4KV5E 1IFHH 1JMXA 2J7EA 3EMCA 4LDEB 4R5EA 1KCSH 4TPRL 2QQNL 3SUVA 4NWTH 3F5KA 1BJ1H 4QHUA 1ODAA 4B3LA 2Z31C 5FYLD 3I2CL 1V0NA 3O8XA 3SO3C 1J0IA 4OCRH 1IEBA 4JZ5A 2DTMH 1I3RB 3X13A 3PHOA 4YWGH 1IC4H 3BH4A 5DYOB 3MJ6A 3W0WA 4PTVA 4JPKL 2VX6A 3T08A 4JM2D 3UJIL 3WXVH 5ID0B 2AGJL 4U2YA 3LPFA 3TIDA 4MNLA 1OL0A 8A3HA 1T66D 1B31A 4DGYL 3ZKND 4CW1A 4NDMB 1R86A 3DO7B 1Q6DA 1M7IA 4NZUH 4U0RC 2X4RB 4ELKB 5BS0E 4AD0A 4GS7C 2KKQA 3WIIH 3DARA 5HVGB 2QTEA 3AROA 4LSDA 2VJXA 1WAAE 1XGTB 2QBWA 3HFML 3F5LA 1MFEL 5HSFA 4GAYB 2P45B 5BV7L 1JMZA 5K9KA 3FRUA 1FGNL 2IFGA 3W53A 1U41A 1I9JL 3JBG7 5LWYH 4OCWH 4BFIB 2VE6A 3GI8L 4KH2A 3O6KH 4WI4A 1S8DA 4MCZB 1GHSA 4X6DF 2WLZA 2CNCA 5KSUB 2P5EA 2MFNA 2BC4B 2H32B 4GW5A 4BJLA 1UJ3B 3UDWC 2YD1A 5BXSA 3KPRD 5ADOL 1KNOA 2DOCA 4WHTB 2VLLB 5MENB 1OW0A 1YY8B 1ETZB 1S5HB 4JFFE 4OKVB 5TQ0L 4PJFB 3QUZB 4L4VA 5E9DA 1QFWM 5C07D 5J11B 2OJEB 4MNHB 2IBGA 5BS0B 2M1KA 4JLRB 4X7SH 3VD5A 5DK0B 1QI0A 5EIIB 2MOVA 5E2WH 3H9SD 1N2RA 1MAMH 3WSUA 4O02H 4I48A 4I4WB 4AQ1B 4WTZG 2PWGA 1E0OB 4OCMC 4FZEL 5JZ7D 5IBLD 1IM9B 3ZT6A 4P46C 1HSBB 4BA0A 3X14A 4NZJA 4X4YA 3ARSA 1CXFA 3GJEA 4KUZH 1VFFA 5EU5A 2XTLA 4I18C 1H3PL 5FM5M 3G5YA 1QZ1A 5JXAH 2VLJB 3CHCA 1MUJA 2DWDB 1R85A 2VITA 4YX2L 3VFRB 5D5ME 4UV4L 2EPNA 3WUWB 4LSQL 4TSBH 1P4BH 1BLNB 1BVNP 3A4WA 3WO4C 5T3ZE 3VNYA 3C60B 5DJCB 1MAKA 3LN5A 4Y5YA 1QFOA 4P5MA 4WGVB 1A4JA 1U92B 3QHNA 5HYSB 2DLFL 3FQNA 4ELMB 2M2DA 4PGDA 4IRJB 4PJGE 2FD6L 2J4GA 3P4NB 3JUGA 3WDPP 2CIKA 3MRFA 3IDNA 3V95A 4M5ZH 1VGEL 3NSNA 4GXUN 4A6YA 1I1FA 3ARGB 4NSKB 3CVHB 5A6BA 2CJUH 2BVOB 2HWZL 4TNWF 3WUWG 3RWIB 1JGDA 4F7TB 4M1RA 2W92A 2BXZA 3RY6C 4Z7OF 2E0PA 2DH3A 2O5XH 2YUZA 3VFWB 2J8GA 2P5WE 2PYFB 1UVQB 3MV8D 5F1KC 1HHIA <