4MJ4A

Human iduronidase apo structure p21 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
614
structure length
603
Chain Sequence
b'EAPHLVQVDAARALWPLRRFWRSTGFCPDPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-iduronidase
publication title Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 194
structure length 603
sequence length 614
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01229 Glyco_hydro_39 Glycosyl hydrolases family 39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mj4A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4mj4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mj4A02
4TSBH 2Z31A 3MV7B 4ENEC 1IGYB 3RBGA 3LPFA 1AR1C 1U6AH 3NCFB 3WKNA 5DI8A 2YL6A 1LGVA 1KIRB 3CUGA 1GIGH 5EU3A 2ICES 3BZEB 4JY5L 2XKSA 4DEPB 3AGVA 3NFNB 4EDXB 4WFHD 3IDXH 3QNYA 2J88H 3T77A 5JLZA 4O2FA 1T22B 3VGEA 3MGOA 1B3VA 4E4PA 1LD9B 4E5XA 1N0XL 5GS1A 1DUZA 1QRKA 4M7ZB 2ED8A 1CLZL 3A4WA 5C09B 4L8BA 4ESKA 2P5WB 4FMKA 3W5MA 3CFCL 1CD1A 1UB6B 3MACL 4YBHA 2GJZA 2HVKA 4XCFL 3RX5A 1OW0A 3SE4C 1A1NB 5T33H 2W0FA 3V5KB 2X70A 4I0KA 2E8ZA 5D2NC 3K2UH 2H1PH 1RHHB 1FAIH 2A74A 2ZG2A 2AV7B 4IJ3C 5BOPA 1S7XB 5HI5C 3T8XA 3D85A 3QI9A 3R4DA 3IDIB 2FB4L 4U6HB 1R5WB 4D9RE 3CH1B 5EIIB 5CJQH 1OGAB 4BKLA 1MQPA 1M7DA 1KSRA 2XVPA 2R0KH 2YN5A 4Y1AD 2WUBH 1H0GA 2FJHB 4M62L 4L9LC 4LRNH 4LU5H 4CADB 1E73M 4UU9A 5F1IA 1CXIA 3WIIH 3KNBA 4X7TA 5KSUB 4N8VA 3RM8A 3QDGA 4Z7UF 2NTSP 2L0DA 2FX8L 1I1YA 5DSCB 4GKZB 3OKDB 3OSKA 2ADFH 3DTXA 1DHKA 2NXZC 4WCYH 3KL3A 4ZNEA 2CK0H 1YJDL 1JYWA 1FO0A 4GBXC 4N0CC 2DKMA 2IWGA 3O3BA 4JZJB 5J12B 2QADC 3REVB 3T0EB 3UG5A 4FTVA 5C07B 1Z9OA 3LQAL 3RY6A 1NWUA 2V5CA 3W82A 1QNOA 3CUHA 1HCFX 5ICZA 4JFVA 2DPEA 5F89A 4X6DE 2ZJSH 4RAUB 4D0BB 1Q9OA 2ZSWA 3ZOAA 4F9PC 1R3LA 3O6AA 1ZHBB 1OM3H 4B7IA 4J12A 2YL9A 3LN9A 1WNOA 4ELKA 5KW9L 4RZCA 4O2EB 2EH7L 1KXVC 3LZFH 1YEHL 4EUPG 4JEGB 4ZOEA 3ZZ1A 5F7KC 2ICWJ 1UR0A 3GRWH 5CCKL 3P0VL 1JNLH 4WNQB 1MH5A 4DW2L 5I0ZA 4CJ0A 3MFGB 1ZGLB 1AFVH 2NW0A 1L7IL 3V7AG 4JPWL 4J8RB 3X17A 2NX5A 3BJLA 4PMDA 5SWZE 2XFYA 2FDBP 3LN4B 4P4RB 3VFUB 2Z0BA 3L5XL 4JHWH 4KK5D 5BOZG 5L8JB 1NGPL 1GGCL 4UINH 4NUGH 1ZLUH 1JWUB 4KRLB 3WYRA 2A1WL 1UWXH 3ZE0F 3RTQA 2NY1B 3BAIA 2YPVL 1UWUA 1D5MB 1F6AA 5I23A 1A7PH 3MROA 2F53E 1Q9WA 5B8CC 1KFAL 2EDWA 4ZG1A 4CW1B 4HT1L 3TVMC 1UH4A 1SYTA 2FX7L 3BYTA 4RNRB 4URTB 3GBNL 1L9NA 5JXED 3PWLA 2W1NA 3E6FB 3CVHA 2HFTA 4ZUTA 5IFJA 1HNFA 1GZJA 3BKML 1OARH 4TOYH 3NH7H 3C8KA 3QUMA 4X6EA 5C0AD 3PL6B 2GTZA 4LP5A 3LMJH 4HBCL 3TN0C 3VU2A 3AXHA 3IJSB 3DV4A 5DUMH 4AZIA 3GGWB 1INEL 1LEIA 1F4WL 2HTLC 1H2JA 4X0KA 3KG5A 2VE6B 4U6YA 1M05B 4LMQE 3SGKC 4M1RA 1QVOB 1WKYA 4EXKA 4GQ9H 1BEYH 4TPRL 1T2XA 2YBRB 3NTCL 5IJVB 1Q8MA 1MRDH 3PWPD 3GDBA 4M24A 3D39B 4E41B 2IBZY 4LYQA 1VKXB 3MA7B 3CFBB 1RULL 5C0BD 5IEHA 4NHUB 2BHYA 2JIWA 4HPGA 3WO4C 4HIXH 4OCSL 5A40E 2ICWA 3HG1B 1V0KA 4Q58C 5H37G 5L2JA 4NDMB 3UYOD 1LK2A 1NC2D 5I18H 1OPGH 4ODXB 1P2CA 3MXWH 5DD0L 4UNIA 3Q48A 1CFTA 3S97C 3ARVA 3TEUA 3CIQA 2F74B 2PO6A 2X1PA 3UTSB 2VLJB 4WKHA 1D5XB 4OLZL 5EG6C 3DYPA 2VURA 1QKZH 1S7QB 4APQD 5T5NG 4ODTH 4PRIB 4YGAB 3DX6B 3RU8H 4QCEA 2FLRT 4L8DB 5LCVH 2DD8L 4E9LA 5ERWB 5GJSH 1CR9L 1JRHI 1T7WA 4ZXOA 5DVKA 5ESAB 5J11B 5A3ID 1OLLA 4Z18A 5GQBA 4EVNA 4PMOA 1PX4A 4TTDC 5IHZB 4ODSL 4LGXA 4DVBA 1T1YB 3RA7H 1KLGB 3CLEH 5CZKA 4LXFA 4GLRI 1ZT7B 5I16A 3F5WB 3M8OH 5KSAC 1UKPA 1U0QA 5DS8B 4QRPB 1YEDB 3F4VA 2EPOA 3UG4A 1TR1A 4XX1E 2DLGA 2WBKA 4ZENA 3QJHB 2BJMH 3OZOA 3V2AR 3QEHA 2IBZX 4JGUA 4MVBD 4DKFL 1EOMA 1HNYA 2W0LA 3RJYA 3BQUC 5J0BA 2AI0L 3JXAA 4OQTA 1A2YA 3OXSA 4YR6A 4F7CB 4WUUA 2CESA 3QHNA 5E56A 2OP4L 5A6SA 3F7VA 1X1NA 4JPKH 2IQ9L 4P5TA 2EE2A 4ORZC 1JHTB 1A6UL 4FQ1L 4X99B 1DE4A 1X6LA 3C2AH 3VXMA 3QB7C 4OLVH 3JV5A 3WKML 3QO1A 4V1DD 4AEHL 3RIAK 5E09A 2W61A 3FB7A 1DBML 3T2OA 2ZG3A 5ADPH 2WSKA 4QCIA 4ZE5A 4EIGB 1F02I 4X9HA 3QG7H 4HEPG 3QDME 4OZFA 5I74C 2BVPB 5EU7E 1J1OL 1U8KA 2PCPB 2EDFA 5BRQA 2VXVH 2AXJA 4LCCC 5K93A 3TONA 2AW2A 3MRLB 3CUPA 1UA3A 4OLYH 1H9VA 2BVQB 3LD8B 5KVDH 1EXUA 4BFBD 2FECI 3MRBA 4TTGA 4OCMC 4HS8L 4XAKD 1TENA 1LO2H 3MJ8A 3H3BC 1A7RL 3BLKA 1S9XA 1JHLH 3QUYB 3CZ8A 2VDLH 4WFFE 3RI5K 2P48B 4UIMA 5D71H 2WMIB 4DZ8B 4XBEH 1YMME 1Y6KR 5BXRA 3BD3A 1GOFA 2W07A 4P2RD 3GMRB 5I1KL 4BK5A 3BYYA 5FO9B 3G5ZA 3T2QA 4FZ8L 3L4WA 1I7ZB 1PD6A 3FB6A 3MLWH 2EDRA 4JO4L 5HGDB 3ARBB 4F7PB 5JO5B 5CWSA 1C1EL 3QDAA 4OCWH 4LP4A 2V3GA 4I18A 3WH8A 2QEJA 3NIFF 2VLRA 3U4BL 3EOTH 4B16A 5I1IL 4DN4L 5FYJH 4RMQA 5D6CA 1UM5H 3HMXH 4JL2A 4ZE4A 5D7LB 1Q1JH 3ZSSA 4Z6AT 2ENSA 4WY7H 5HYIA 1C08B 4U1LB 5DRZB 1S7SB 1ITXA 3GSNH 3WSQL 2J1KA 2O26U 2CRMA 4XPGH 3N85H 1QACA 1SEQL 2ZCLL 3MGAA 3WNKA 5I75C 2ESCA 2R1XB 5IFHL 3U7BA 5L9DL 1S5HA 4LARL 3CCHA 3SEPA 3AS2A 3H42H 1G7HB 4WKFA 2WMJA 4LQ1A 4ODHL 5M17A 1HWHB 1YECL 1QRND 3ZYOA 2P4AB 1NCWL 5KN5A 3N13A 1E6ZA 4M5ZL 4UV4L 4JFTA 4ZUSA 1MFNA 5HYSA 3SDDA 2X4UA 4OD2B 4S1SH 3DHJA 4EQ3A 3B43A 1MJUH 4HKXA 3SN6N 5ISZD 3BH4A 1P5UA 2I9TB 1RK1A 2XQBL 4O2CA 4IMLA 1E6NA 4HZLB 3O45A 2GJ6D 5EBAA 3R1GL 5DD1L 2ZG1A 3QPQD 5JMRA 1EEZA 3G9AB 5E7FA 5I1CL 3AAZA 3ARGC 1AO7A 7FABL 4MQXC 2XN9A 3IFNL 3WBEA 2B8OT 3OPZL 3L3GB 5E8DH 1CL7L 3OTTA 3QO0B 4OV5A 5FOJA 1QHZA 3GI8H 2AS5M 3ES6B 5AUMA 4YO0B 3ZR5A 2H2SD 3W11D 3OX8A 5TDOA 3A67L 3UTZB 1GONA 3EJZD 5T1LA 4OT1H 4O9HL 2AK1H 4NZDA 4I0PD 3ZJ8A 5C2BH 5DQ9B 1V3HA 3BAXA 1KCRH 4K3EH 2HKHH 1MRFL 5EZOH 4U2YA 3DVFA 1OOAA 2WWDA 4N5EC 1NAKL 3HE6B 3Q5TA 1JGDB 1ZHKA 1TCMA 4HSQA 5SV4A 3B2UD 5E9AA 4TNVF 1CGVA 1Q9KA 1WWBX 4OKVA 3IFPB 5GZOC 4OFYA 5K9OB 4L5FH 1D5BB 3KJ4B 4MAYB 3BPLB 3L5HA 3MZTA 3QDJE 4OLWL 1L8NA 1QW9A 1S7UB 3TO4D 4PYGA 3RL1B 5EBMB 3MRDB 4FQHA 1EAJA 3JVGC 4NKIL 4H26B 1IAMA 3AREC 3GMMB 3BRGC 4V2XA 4E0RB 1T0PB 3TNMB 3PBGA 3RVUD 3OIHA 4P5MA 3TIEB 1BM3H 2YBUA 4H8WH 4JJ5A 1EFXA 2A0LC 4OZ4A 3MYJA 4L4JA 3S8WA 4XP5L 2I24N 3I2CL 1IAKB 2VDRL 5EU6D 4WHYG 1SJEA 5I8OL 3SUVA 3BPOB 3LQZA 4LX4A 5KOMC 3AQUA 4FQ2L 4ZTOL 1ZE3C 2YL8A 43CAA 3BGFB 1A1MA 4KKLD 1N59A 4L3AA 4EKXA 1S46A 2XQYG 3WNMA 1QNRA 1V0MA 2CKBH 4S0SD 2G8ZA 4OZGB 3HCVA 5D7KE 2XUCA 4D1IA 4P46B 3LHPH 2XA8H 4GO8A 3HZVA 1BJ8A 1VIWA 2VVSA 3LRGA 3VDCA 4A6YH 1QLFB 1I8IA 3TGXA 4FLSA 5HPCA 3VG0L 1ZTXH 5SWSD 2BSSA 4HH9B 2PYEB 2D7TH 1ZBVA 2WZHA 3VMPA 4OLUH 4YBQC 3UX9B 4Y4KA 1IAII 4I2XE 4PY8J 4XX1G 1CEOA 1MVFA 1WT5C 4G8EA 1NQ6A 5FKPB 4JFFA 4AQOA 1MJ8H 4PJBE 4KKAD 3D6GA 4U1NA 1OQOA 4FLRA 1V6YA 1NFDE 5IQ9A 1BMGA 1HKFA 5DZLA 2XOTA 2VH5H 5CGYC 4LLDB 3HC3H 3LRSA 4L8CA 3W9DB 2H6PA 3I6LE 5E6IC 2OM5A 3O3DB 4LAQL 3G6JB 3O8XC 4KPHL 2IQAB 4JFPB 4NO3A 4F58H 1Y0LA 3IAPA 3GSUA 2EPNA 3UYRH 3HLAB 5EWIH 5F7DB 4YHNB 5J4MA 5J56B 2WPGA 4P8VA 5DK0A 1VB9A 3MLXL 2GY5A 1FL5A 1E6PA 1B0RB 5FL1A 5E2VL 4CU6A 5I1GH 3ABZA 4R90H 5L88L 2VABB 2HFFB 5D70L 3DO7B 3ULSB 3P4NB 4B41A 2NX5E 1OAQH 4OM0H 4RCAA 4O4YH 4FS0A 2BNRB 4XPHH 4JN1L 3LKPB 3U46B 2PW1B 4NQCD 2CYGA 4OUEA 1VPOL 2C9AA 4NM4L 4IM4A 4HMEA 3U7YL 3S3PA 5KVEH 1IZJA 1R3IL 2OL3A 5HPMA 3MANA 5L6YH 3ET9F 1WITA 1E4WH 3FT3B 5IV2B 5JOEA 3RILA 3UESA 4LSQL 4NQED 2VLJE 3MCLH 1DFBL 4JKKA 3GMLA 1U8PB 4MSWB 5TFSH 5C8JA 4NKQB 3TIDA 2I07A 5BW7A 1I7UA 4U6XA 1W3HA 5JHDA 2V17H 5I9QC 4AMCA 1VFAB 3D3VA 4W84A 2I60H 5IHRA 5E8NA 3WDHA 4Z5RA 4PJAB 4DKDC 4TTUA 5EC1B 3GHBH 4ZSOB 1BQHA 4JLRB 4KAQL 3MO1A 3U1SL 2PKDA 5IB4A 5FKYA 1Z9SA 4NO0A 5ABFA 3RWGB 3FONB 1S3KL 1IEBB 3PP4H 4LK4A 5BXFA 2AV1A 2IPKA 2NR6D 1R87A 4WFHE 1GGTA 2UV3A 2Z93A 2VITA 3LDBC 1F5WA 3U7AA 2DLEA 1W3KA 3LKRA 4UTAL 4XPBL 2DQFB 1HXYA 3CUIA 4EUPH 3B3IA 5HVFB 5DRWB 1QRNB 2VL5B 1EO7A 1TG7A 3K8LA 2DMBA 1PBYA 1MELA 5FO8A 1Q6DA 4JFZH 4IUGA 3QHOA 4PRPA 3OJ2C 1I9JL 5IT2H 3WUGA 4LNRB 1LP9F 4NKOB 5ISZB 1TVHB 4XP1L 4R5EA 1KIPB 5GSRB 1A7NL 5JBFA 4JO1H 4QLJA 2GJ6B 5FYKD 1FVEB 1IC7L 2EDDA 1H3VA 4LPUA 4TVCA 3DI3B 2FHFA 1JGVL 4LCYA 4AY0A 4Y1AE 2PTTA 3MRKB 4PJGE 1F2QA 1T04A 2XM1A 3PIQB 2PWDA 2NY2D 2N1KA 1A6ZA 4KV5E 3THML 1ZJBA 2VXUL 1TETH 5FIEA 3D69B 5BS0A 1UEYA 5FHBH 4K23H 2QLVB 4GG8B 4JFQA 1DSFH 1YA5A 5A8NA 1GGBH 1X4ZA 2CR6A 3MZGB 2YC1A 5CLTA 1EHXA 1KEML 4HPHA 3A6OA 1WGOA 2VRAA 4GAFB 1MVYA 3CHFA 3H3KA 3BMWA 5GZNC 4OFDA 1MCOL 5INDA 3CGTA 4QRQA 4RE4A 5TE4H 2DGAA 3ZDYF 1B0GA 3B9KD 5K59E 3HZMB 4ML4A 1AH1A 1DP0A 5T3XD 4FF5A 4KVCH 3TLRA 1JRHL 5DVOA 1TMQA 2DKUA 4A2MA 4E42A 3SCWA 3VDBA 1W9BM 5D7SH 3I6KA 1RMFH 5FOBB 5E2WH 2AEPL 3RBSA 1MCNA 2VXTL 1QFHA 3RZCD 2AKRA 5GRVK 3NPSC 3TFKD 3VNZA 4X5XB 2G9HA 1K9EA 1FP5A 3PE9A 1TLKA 1AGBA 3BWUC 1UB5A 5H37H 3GH4A 5EU6B 5DF0A 4XZUB 4JDVA 2XPGB 2ZUNA 3IK2A 2DQJH 3Q6FB 4Y2DB 2QQLL 4CGTA 1FNAA 1KENH 1B0IA 1Z2KA 5GGTA 4W87A 3HNVH 4OFPA 4Q9QH 3EFFB 2DLIA 4U1GB 3RL2A 2GHWB 2WSPA 3I85A 2XT1B 1Z3GL 1ONQB 1HIML 5HOSA 3W39B 1T2QL 5D7JA 1NUDA 3T0XA 3LKOB 1FFOA 4WU7A 2CDGB 3PABB 2C3VA 2ESVB 4OGAD 1ZA6A 1NWRA 5T5FH 1KJVA 2E7HA 2VCAA 4LVEA 3OR7A 3LPGA 3VW3H 4N0UB 4ZQKB 5MHSD 1XF2A 4PBGA 3QFJD 1US3A 3RZWA 2PXYB 2P44B 1CK0L 1MFBL 4KMTH 3ARSA 3VI3F 4HIIB 1P4BH 2FATH 4JFOB 4PBVC 4OIIL 4F79A 1MRCH 4GKNB 4GKOA 2OSLA 1CE6A 5IHUH 4HJJL 4GAGL 5C0AE 4ORGB 3A3HA 1W72B 1DQDH 4MD4B 2J7GA 4BZ2L 4GFTB 1GGIL 3QIWB 3JTSA 4R4NC 2BCKB 3B9DA 4LSRH 2UZXB 3EZJB 4H88L 1RUMH 1E0WA 1XHGA 4GW5A 1NCBL 4QGTA 1VSCA 1ZWIA 4HS6A 5KJRH 1D9KD 1ZEAL 4MHHG 3P9WB 1KT2B 3RWDA 2CKSA 2FECL 1W72L 3BVNB 3L2MA 5FDWA 2WCAA 2VLRE 3PWPE 3QWOB 5KSBE 4G7YH 3KDMB 1FYHB 5LWYL 5C0BE 1BLNA 3WBAA 1INDL 5IHLB 5C0DA 3MJ9A 2MCG1 5T3ZE 5D5MF 1MCEA 1EO5A 1DWHM 3EJYD 3Q3GB 4F66A 2FEDC 5FIPA 2FH8A 3H0TA 5IIEB 3RWCA 4YUEL 2AVGA 3AU1A 2HFGH 3VWKB 5DURB 3UC0L 1T1WA 4HA4A 1LO5A 5TPWH 4LPXA 2HT4D 4FQJL 3VD4A 1T1XB 1S7TA 4WUKL 1FORH 3SKMB 4NQEB 3JWNC 2J8UF 4L8SB 4NP4H 1SR0A 2YD9A 5I3DA 1F58H 5J1SC 1A7OL 3IXTB 3ELAT 3VRIB 5K9KA 1JZ5A 3UPCA 3FB8A 3Q5YA 3RGHA 3QEQA 3X3FL 1JGIA 5JUVA 3O6LL 1DLFL 4N90D 3RY4A 5IXEA 4PV9B 5BXSA 4JG1H 1Z5LB 5EC2B 2VNCA 2ZUQB 1N8ZB 5FUZL 1JAKA 2B20A 3O2DH 1MQRA 1OGBA 4CVZB 4Z0BH 1UD8A 3B5TA 1IT9H 2ZUUA 5F9WB 3O6MH 4M1GH 5BV7C 1G6VK 2GCYB 1QNZH 3VG9B 5IFAH 4Z2HA 3AM8C 5H94A 1AY1L 1PBGA 3WEMA 5F3BB 3MOAH 4NRZA 2DWEA 2EC8A 1E6XM 4M8UA 5BROA 5C0IA 3GBLA 4YHZH 3QXDB 2X4PA 2A6JA 3N9GH 5IMKB 3PHAA 2VAAA 3MCKB 2A9ML 4UILL 5IK3A 3W0KA 3NIGE 1A9BB 4H0HB 4KTEH 4LHUA 3A4XA 1JI2A 2HLFC 3MRCA 1RIVH 1UYQA 1BYAA 4LSTL 1DBKH 5GISH 3DX8A 4V1DE 4M7JL 4RDQF 2QQKL 2ICEA 2QMKA 2XYLA 2H8PA 3VH8B 3PGFH 2CKRA 4MDJA 3WH6A 4Y19B 4MXVE 3E6HA 3G6JE 4W5UA 5JW5B 2DQTL 5DJCA 5D2LB 2H45A 2Q20A 4HF5H 3QEUB 3ARDC 3SDXE 5ADOL 2V2TB 5LGHL 2W67A 4XVSH 3QAZC 4LKXA 3ARFA 2RCSL 4Z7WA 1HQRA 4EI5A 3TV3L 4AH2A 3WQ6A 4RIRA 1BBDH 3LEYH 4RGNC 4DGVL 1BGXH 1UR4A 4DWSA 5IWLC 1HOCB 3QJFA 1WBYB 4K8RH 3RIKA 4XAKE 4M1CC 4XWGL 4Q9BA 1T2JA 1SYSA 2B1HH 4BZ1L 4FFWD 4BK4A 4X9YA 1YPZB 2CBJA 2NY5L 4KQ3H 3T1WA 3GUTB 1HNGA 4Y4HB 5DJXB 3VWJB 1UZ1A 4H8WC 3RPMA 3W0WB 1GZQA 3RWHA 5EFIA 4P2RE 3FO0H 4DFHA 5IB3A 4JO2H 5FGBA 2XGBA 1OSPH 2DN7A 3O4LA 5DJDA 4PJXF 1EBAA 2A73B 4K7FB 1U3YA 3PF2A 4L4VD 4OUUA 5T1DL 5I6SA 2MSPA 1PG7L 1WTGT 2E3ZA 3RZCB 2VISB 32C2B 3NACL 2Y07L 3GMOA 4KXZH 1V5JA 2DKSA 1NGQH 1UWEL 1UJ3A 2V5DA 1CN4A 2A3AA 3ZKXC 4PN2A 4KQ4L 4RQQB 5EZIL 3OHXB 4XCYB 2OYLA 4Y4FA 3TBYA 5DRNA 3MRHB 4Z0XA 2XG5A 3DOSA 5E2TL 2VO5A 3BDXA 3GSVB 3HC0B 1VRXA 2VDNL 1JPFB 2R2HB 2PETA 1CDCA 2ZPKL 1Q9LB 3CZGA 1IGFH 1OSZA 3HUJA 5CJOH 3FQNA 1UM6L 2MHAA 2W0PA 1A14H 3STLB 1TZ7A 1QA9B 5C6PB 3FQRB 1IAIL 3AMKA 3SGJC 4TULH 3QUXB 4ENED 2H32B 1RUKL 4JR9H 1EBPA 4PYSA 1SJXA 4WHYH 1C93A 4KDWA 2VLKB 4QXTA 4Z7VE 3OF6A 4MDIB 5BMFH 2DI7A 3LEXA 4CL7A 2YXFA 5ISZE 1IARB 3C8HA 3SE3C 4OSUL 5IEKB 1SBSL 4PJFB 5EU4B 2GJ6E 4Y5VA 1X5HA 1DVFB 3N1FC 4KMLB 4ONGL 2XICA 12E8H 4UNVA 1IMHC 4X5WB 5TE6H 2ZCHL 1FPTL 1OB0A 2R29H 1V0LA 2JCCF 2Q6WA 3DVGB 4GRLD 4NT6A 2OJZH 2D3NA 2JB5H 5E6YA 4JVPA 5JPNA 5D1ZB 4NQTA 1I3GL 3PN8A 1F00I 3DSNA 5EOTB 5D9SA 4JZOA 5DUBA 5E0QA 1FDLH 4LF3A 3V0VA 4C56A 1I9EA 1DBJL 3FQWB 5I76A 1G9NH 1OD9A 4PGCA 4GSDH 5DQJA 3BT2H 4ODVL 5HI5D 1YEIL 3U4EB 3MV7A 5HI4C 4PBWD 1UUQA 3K8KA 4HG4J 4XP6H 1KIRA 5A6AA 1CFVL 2YUXA 3UDWC 2CXGA 1HHJB 4LFHG 4HQQL 3ZO9A 3BZEA 2D3VA 3FL7A 3MNZB 2ZSVB 1PJ9A 3NFNA 3TT1L 5CSGA 2OZ4H 4HUWA 4YGVB 1T22A 3HE7C 2D0HA 2EDOA 1LD9A 3GIZH 2NXZD 5AC4A 3BEVA 1XH1A 4C7DA 2VJXA 1KB9J 5C09A 1NBVH 1KTKE 2FBJH 2X9XA 1AGEB 2P5WA 2VCBA 3AZRA 1BVLA 4AXNA 1RJLB 3ZKMC 4N0CD 3N04A 1UB6A 3I3EA 2QADD 4QRUA 1U8OA 4PMYA 2QLYA 3V5KA 1H5VA 1MQKH 1K5NB 1N6UA 5EU6E 3V6OC 4OZHF 5SX4H 1I4FA 4P2QD 4WSKA 1EH9A 5D72L 5F9OL 3GXDA 1RHHA 5HDBE 1X3DA 5HYQB 3PTQA 5D9PA 4CD5A 4RFOH 1S7XA 2EDBA 2IH1A 1CE1L 2BXZA 2VWEE 3IDIA 3IT8D 4JRYA 4U6HA 1R5WA 1BFTA 4YFDB 5DR5L 5EIIA 1XCQB 1OGAA 4E8DA 3VMOA 1O5DT 1QBML 2NW2B 4UNUA 4PGBB 3MV9D 1F4YL 3WE6B 5ID0B 2YD3A 3IFLL 4J3UA 3AVEA 3PTMA 4M4PA 5BS0E 5SWSE 2EKSA 5ANME 5IBLC 4GKZA 1SYVB 4Z78B 1ZLVH 4MNJA 3KE0A 2ZUWA 3OKDA 3W2DL 2DJSA 3RWFB 4X4ZA 5EZLB 4AL8L 4KZEL 4ZNCD 2ARJB 4MD5B 4ALAL 5GS2H 2J6EL 1YQ2A 3REVA 3V6BR 3T0EA 1NAMH 5EBGA 4JZNA 5HGBB 5C07A 1EOKA 2R0ZL 4ELMB 4PJ7B 4P7LA 4HIHA 1QFOA 4JY5H 4MNGE 4BSWB 3AXIA 2JELH 4NOFA 3F12B 4RAUA 1URLA 4K2UH 4D0BA 1BFNA 3MCG1 3FO2B 5F7FA 2XFFA 1OTTD 2EE3A 3RUGE 1WFUA 2P1YA 1CLZH 3V0WH 3WUFA 1CLCA 3TVMD 2Y2WA 5EZJB 3LVEA 3GSXB 3QRGL 3C5JB 3CFCH 1Q6GA 2AXHA 4C58B 2UWEE 1HKIA 1KXQE 5I1DB 4R2GC 1U3HB 3QG6B 2WBJD 4NN5B 3VIJA 5I0DA 3ZTNL 2D1ZA 3MMUA 1KCUH 2ZCKL 4O5LL 6FABH 5IHBA 2A3CA 3IB4A 4J8RA 4HMCA 4NQCE 1S9YA 3ORJA 1REIA 3PJSB 2RGMA 1DLHB 1MAMH 5EN2A 3VFUA 4LSVL 1XEDA 4TUJB 3ZKND 4I5BB 2DQEH 3K1KC 1BVKA 3QWRA 1UH2A 1JWUA 2RIKA 4PTUB 2A38A 1WWAX 2UUDK 4PJ8D 5IP4A 2CCRA 1HKLL 4NO2B 1MI5B 1WIPA 4JM2C 3ZE2E 4PG2A 4F2MB 1YJDH 2C4XA 5LA2A 1DJSA 5H35B 4RNRA 2VC2H 4UFMA 4JVWA 1T83C 4D6CA 4JM2F 4J3VA 3LQAH 2YJQA 4U7KA 3PL6A 3IJSA 1MPAL 1EGJH 3QQ9C 2JJTA 4OKDA 1GZPB 1M05A 1V02E 4F37F 4PJEF 3IU4L 4K9EC 5T5NF 1G7PB 4LKCA 4NQXB 5HVWA 1V3JA 4XPAL 4I3RL 5A2KH 1P84K 5HYEA 4LEXH 3WJJA 4OTXH 1BFOB 4XCEB 1CFNA 3CFDB 3MO4A 4N9GB 3D39A 3RJDA 1YEHH 4E41A 1W0VB 1U30A 1VKXA 2ERJC 3CFBA 3BAYA 3F8UB 3P0VH 4JHAL 3HG1A 4JKLA 4ZAKC 4HUXA 1M6OB 1L7IH 4MLIA 1K8DB 4JPWH 5MENA 4DTGH 4NDMA 5E99L 4MMZC 4ODXA 1G84A 3SUUA 3L5XH 4ISVB 5FYKE 1TJHL 2VKXA 3CK0L 1IJ9A 3SCNA 1FLRH 1NGPH 1BJ1J 4XHJC 4PLJC 5EPMB 3VGAC 3SKOB 4M8QB 3BLPX 3UCQA 4AM0B 3OKOA 3BAEL 3UTSA 3C6SA 4GT7A 1S7QA 4Y16C 5E1AA 3QHZL 3AIBA 3I84A 3DX6A 4R4FL 4YHPB 5H8DA 5M5DA 4NCC1 1KFAH 5D2NB 3V5DB 5ERWA 2AERT 2EDNA 3TBVB 3M17A 4NN7C 2F54B 5ESAA 4XMKL 2JK5B 4IJ3B 2R39A 4LL9A 1ES0A 4Z7UB 3VFPB 3BKMH 2ATPA 4P59L 1WQVT 1E3ZA 3QIBD 1DL7L 1P53A 5J13C 2IUZA 1YPZE 5I6XC 1ZT7A 2J7HA 3F5WA 3PHQA 4L9LB 5IB2B 1GGUA 3OKMB 1F4WH 3CFJA 4XBPB 4Z76B 1M4KA 4QRPA 1GQIA 1LL7A 2YRLA 4KFZC 5T3XE 2AK4B 2PW2B 2NXZB 3DGGB 3WHXB 5FFLA 1CF8L 2LV4A 4W6WB 4TPRH 2JJVA 3NTCH 1ZGLM 4GAJL 4XPFL 4BQ8A 3RIFF 4GBXB 5M95B 3OAZH 1GOMA 4UIKL 3ARRA 5EBLB 2QADB 1RULH 2AJ3B 4F7CA 3VFRB 3AIWA 4N68A 4J3WA 4OCSH 1UR9A 5ALCL 3WUWB 1JHTA 4P2QB 3TP4A 4X99A 5A2CA 5F8RC 4K3DH 4LQFH 3WN5A 1NLBL 5DRXB 3TBSB 5DD0H 1PAMA 2X4QB 3T65B 1T7YA 3WMCA 4HULB 2MJWA 5EB9A 1OIMA 3EO1B 4L3CB 1XGQB 5E6ZA 4KI5C 4LASL 1L9MA 4BF7A 1QG3A 1B3YA 3AZSA 4H7VA 1QSVA 5AYBA 4TYUA 4RWYH 4YHEA 1T3FB 4G9FB 2PCPA 5IFPA 1IAOA 1UZ6E 4C4KO 1ITCA 4H8UA 3D87B 1UKOA 2HKFH 4KI5F 1E40A 2DD8H 4I1NB 4D3CH 4GINA 2WVTA 1CR9H 4XB8A 5MHSE 1F97A 3QFJE 1BOGA 2CO6B 4GKSB 3DMMC 2Y72A 4MNKA 3QNXA 4WGWB 5EOCL 4PJFE 4ODSH 3IJ7A 1KIUA 4HBQA 4QXGL 4QXUH 1A6TA 3QUYA 1C16B 1RZIB 2CR3A 1UGNA 3C5SA 2F2HA 5HHMD 2ZNXA 1YEEH 4UI2A 5LXGH 4DZ8A 1JG9A 2EPLX 1PGRB 4MCZA 4MZ2A 4WO4C 2VXSH 3GMRA 1KELL 4R3SB 4RMWA 2DSKA 3S6TA 5B8CB 3WIHA 1X5GA 3JV6B 5HGDA 3ARBA 5DT1L 4F7PA 3TVMB 5DEGB 2P42B 2DSWA 2DM4A 3DGCR 1ISYA 2J79A 2HT3D 2OP4H 4PJHA 1CECA 1TA3B 3RWJA 4PBXA 5D7LA 3ARGD 1I1AD 3TN0B 4FQ1H 1C08A 4MQXD 5DRZA 4XHQA 1S7SA 5CUSL 4HPYL 3UPRB 3VFWB 2Y23A 3UERA 4QEGA 1DBMH 2YZ8A 2G41A 4V28A 1K4DB 3NZ8B 4PJCF 3GZAA 1QI0A 2VZ3A 3O11A 1II4E 1FP8A 2XIBA 4WLCA 1G7HA 1NSNH 1GJWA 1JPTH 1FNFA 3WJLC 1J1OH 4UQ3B 5BZDA 1QPKA 2BNQB 1F8TL 4JG0L 5ICXA 2NY4C 5DFAA 1MHCB 5EO1B 3MMEA 1UWSA 1W8OA 3SBWA 1BJ1H 5DHXB 1I75A 6A3HA 3QR3A 4N90E 4PJ9C 4YHOL 2WWCA 43C9B 3SDCD 1FNGB 3OWEA 2I9TA 1OAXH 4HGWB 3MXVH 3SOBL 2E7LC 1A7RH 2GVYA 4X4XA 4MNQA 2P24A 5GGRB 3IJHB 1V3LA 1O7VA 3UJIH 4Z95H 3KLAA 4S1QH 1PZUB 4ZUUB 1KG0A 3BDYL 4GW1B 1V08A 3L3GA 2UVEA 5A8OA 1CICC 1NGXB 3QO0A 3QSKB 2A0LD 5SX5H 3ES6A 4W8BA 2WVUA 2VVNA 3RAJL 3UTZA 2J5LC 4AG4H 1RPQA 2KL6A 4R26L 1HK6A 5L0QC 3N1MC 1S7WB 3KPNB 1T6WA 1EQCA 5AC5A 5M94B 4HWBL 2V7NB 4KU1A 1C1EH 2DS4A 4XNZC 5FECB 3A6CL 1FC2D 5I1IH 3HE6A 4NNYB 1JGDA 2O9RA 1F90L 3L6FB 2YPLB 3B9EA 4KUZH 5B3JE 1RJZB 1D2KA 3MLUL 5BRZD 3WQVA 2VRKA 3U79A 5KSAB 2IC2A 1CXKA 5DWUL 5K9OA 4L4OA 4LDLB 1I9IL 1D5BA 4MAYA 4OLXL 2HFEB 1NPUA 3FNDA 4FQIH 1S7UA 5TF0A 2WQRA 3RL1A 5EBMA 3QCTH 4OUOA 1EX0A 4YDLC 5ITFB 5IFHH 4UQEA 4B3KA 4H26A 3TC9A 4XVUC 3GMMA 4YHLH 3LIZH 3TA3D 5K9QG 1QPPA 3CTTA 1NMAL 2CDEB 5C2UB 4ODHH 1ND0B 4ODBD 4E8CA 1MY5A 4P23C 4YBQD 3N06B 2WWKO 2ZWYA 1WSST 3BQUB 3QQ4A 2V7HA 4P2OA 2YXMA 4JPVL 3TIEA 3KYOB 3CDGB 2COQA 1V7ML 4UV4H 3VH8G 1FC1A 1E6QM 3AMGA 3TYFB 2DJUA 3KXFD 4NYLA 3MRGA 4MQ7B 4PMXA 5E00A 2FGZA 1I8KB 3AXLA 4HFUL 5CGYD 1PLGH 3II1A 1BP3B 4QO1A 1RZFL 3SCQA 3MBEA 5E6ID 5GGVY 4JRYE 2XJ7A 3R1GH 3ARUA 3QDHA 5DYOB 2VDPL 1JK8B 5I74B 5I1CH 3VGFA 4ZODA 4OZGA 3QQ3B 1PKQB 3T4YB 4P46A 3SE8H 3KYNB 3OPZH 3QHMA 5IHSA 3V8CA 2JEPA 4HDIA 1JAEA 4LLAA 3OGCA 5FKAB 1PVHA 4LCCB 1QLFA 1JTPA 1A3RH 4ONHB 3QUZB 4YHKL 5I66A 3A67H 5EU7C 4K7PY 1OCWL 3EOAB 1J0IA 1GUVA 3F62A 5F1SA 2PYEA 1J01A 4IMKA 4I77L 2AJYH 4L4VE 4R4BA 3QXTA 3S36L 3FQTA 2EZ0D 1MRFH 4CN6A 2ITDB 1FGNL 3IS1X 5FKPA 4Z2LA 3O2WL 4PG9A 4JQXC 3MV8A 3OAUL 1EHAA 4XGZB 1J0JA 1EK3A 2D2OA 1XR9B 5DC9B 5DMGC 4IDJH 2H9GB 4WDIA 2IXUA 1CIDA 3WHE1 4PUEA 1JZ7A 4HAGA 4LLDA 3W9DA 1OAUH 5LJYH 2R0WL 1G7JB 3O3DA 4JFPA 4HV8B 4C4KT 4YHNA 3GBMH 3DURA 1B0RA 4LVHB 4BSJA 5I2UA 5C86A 4XCCL 4ZTPL 4U1HB 4BZYA 3GXMA 1SVZA 2WW8A 4OB5L 4TQEL 2HFFA 4ZXBC 1UVQB 1G6RB 4JAMB 3ULSA 4H41A 4H1LB 3P4NA 1T0MB 2K7PA 2FZ3A 3NABL 3WL0A 4FQ2H 1I7RB 2BNRA 3LKPA 3CPLB 2XWTB 2NMSA 5HHNA 2Q8AL 3TTSA 5LBSL 5I75B 2I25N 2PWGA 4ACZB 1G6RL 1WCBB 1FFRA 3VMNA 5HI3D 5HHMB 3FT3A 4BH7B 5IV2A 4ZUVA 3MTRA 4KK9D 2Q86B 3BGAA 1A6WL 2OTWB 3VG0H 5JZ7C 1U8PA 4NM8L 4MSWA 4PGDB 2BP3A 4X98A 2P47B 4H8HA 3HI5H 4OZIE 4PGZA 1KYOJ 1OWQA 3J8F7 4KRPC 1YNLL 2BFVL 4JFWA 3QYCA 3BD5A 1VFAA 4HWEL 1AXSA 1ED3B 2CJUL 4PJAA 3BO8B 2O61B 4X83A 1OP3H 5A8MA 1P7KA 4ZSOA 3VIIA 1BHGA 4JLRA 3OZ9H 3ARGB 3CVIL 4P5KB 3IJ8A 3NCYS 3H7BA 4ZFZB 4PRNB 3FONA 1IEBA 4IIQC 3BEWB 1Q6EA 3DC0A 3SJVD 3MRRB 1HVQA 2DAVA 1I8LC 1WZAA 4FRWA 2DTML 1PQZA 2E6QA 4JFDD 3DBXB 2DQFA 1AKJB 3BIKA 4PPTA 1QSED 4P9HC 4U49A 1HHKA 3MLXH 3W5NA 1DANU 3OXRB 1C8QA 5I24A 2Z91A 1CBGA 1EUUA 1QBBA 2R9HC 5GZND 4H04A 1CWVA 2EE9A 4LNRA 5DDHB 4OCXL 4KGJA 1IBGL 3S35X 1SJHA 4NKOA 2R1WA 3QXUA 2CSPA 4P2QE 1KIPA 4TNWF 5B38B 5CEZE 1JPSH 1W0WB 2EC9T 2J77A 1FVEA 3AREB 4D0CB 3CHCA 3VXNA 3BMVA 2Q1EA 2YN3A 1AXTL 4IBLT 4BUHA 3JUZA 4Z7QF 3MR9B 3WHE0 2BVOB 4LCWD 5H2BB 1C8XA 4M1DH 4S11A 1GHRA 1XMWA 2AJUL 2ZUSA 3BZ4A 4U3CA 5HHOD 5L7XH 3OJDB 3MRKA 3MV9E 3VXSD 4PTWA 3PIQA 1JHKL 2DM3A 3TH2T 2BK8A 2ZOKB 3BRFA 1MCPH 1N5YH 2EYTA 3SPVB 3QPXH 2BSRA 5HGHB 5DLML 4KJPD 1A5FH 5DTFA 3LPOA 3D69A 1G0XA 1CT8B 4GG8A 4Q74A 2HWZH 5DK2B 1EUTA 1GIGL 1JZ2A 5DD3H 4UQ2B 3H9SD 4R0LA 3QI9C 2YS4A 5BRZB 3U1SH 3IDXL 2J88L 3MJGX 1Z0MA 2ZXQA 2JIXB 3TH3T 3TZVC 4EXPX 1I1XA 3NFSH 4NRYB 2XHYA 1J05B 3OL2A 3WFZA 4XVJL 3HZMA 5E24E 4WW2C 4KK6C 5CQ1A 2WWKT 2QPUA 1ZVSB 4XPBH 4LCUB 3WMSA 3RI5F 3V79C 2D23A 4N1CA 5T33L 1EIBA 5F7EH 2FH6A 4QHMB 1KQYA 2XTJC 1XGUA 4WW2F 4QOKA 3KJ6H 3AMLA 4P8XA 4X5XA 1U91A 1I9JH 3T0VA 1AGFB 2GJRA 4PB0L 4R9HA 4QXWA 1U92B 4J1UB 4EIZC 1R5VB 2ED7A 4XZUA 1LEKA 3Q6FA 4Y2DA 2VN7A 1C5BL 1EHLH 1KPUB 1Q0XL 5FGSA 5GGRY 1MJJB 2R0KL 3LSOA 3RGVB 3S96B 4D72A 3EFFA 4HUUA 1F6FB 3O8XB 4LU5L 2IFFL 1W9PA 4FNLH 3WIIL 2ZX5A 2J7DA 2RHEA 3NN8B 4PJBF 3VCLB 1K85A 1E4JA 5INCB 3W39A 3DIFB 1AGCB 2ADFL 3FRPA 3PABA 2ESVA 5EFDA 1W2VA 2CIKB 3BDBA 3N1GC 3JV4B 1XSIA 3M6DA 1XZ0B 4PJDA 1P9MA 5C0GB 4N0UA 4ZQKA 4G43B 5IG7B 1MHEB 2FEDD 4PRHD 1AMYA 5ETUB 3LKNB 2OCFD 4N1HB 4CKVX 2PXYA 4QAWA 2C7FA 2YLLA 4HIIA 3DYOA 5DC0A 1J18A 5T1KD 1JNNL 3F5KA 4GKNA 5EUKB 3S5LB 3MV01 4ORGA 1NCCH 1W72A 4MD4A 1WZLA 1OM3L 3QIWA 2BCKA 5BQ7A 2X2YA 3RTQC 3FCTA 2E40A 2WNGA 1JRHH 3LZFL 3ILPA 1KT2A 5I9QB 4JO3H 3BVNA 3T4AB 1JNLL 4PUBL 1J11A 2VXTH 3QWOA 1T5XB 2J25A 1CG9B 2P45B 1I1FB 1NM9A 1AFVL 3VPLA 1MW3A 4CUCA 3KDMA 1IRAY 4OGXH 5C0JA 1HQ4B 3V9FA 3C5ZD 4CMHC 4BFIB 3KPSB 3GKWH 1ZLWK 4AD4A 3WNNA 1ZT4B 1HHHB 4JHWL 5C0RH 3KPRB 3L7EB 1ORSB 5DQDH 4UINL 4NUGL 5IIEA 2RAMA 2ENYA 1SVCP 3CPUA 2J78A 3LDBB 3VWKA 5JDJA 2HT2D 4FMVA 3AOFA 4FZEL 3L95B 3UZEA 4NSBA 1Z3GH 1T1XA 1WDQA 3L4TA 1LP9B 4JIEA 3SKMA 2P5EA 4X6FB 1T2QH 5JIIA 3QCUL 2YD6A 4NFBA 2F8XC 1QLEH 3IXTA 3ZTJG 3VRIA 1RUPH 5CIPB 1PX3A 2C3XA 1MCIA 3GNRA 4PV9A 1OARL 4TOYL 1Z5LA 3NH7L 5IQ7H 4Y88A 4L4PA 1NCDL 1WWWX 4W70A 5KZCD 4ACPA 4Q6IA 3KYKH 1AR2A 3Q6GH 1INQB 3ROOA 4GAGH 3ZIZA 2Q76B 3ARDD 4BZ2H 2OJEB 3BI9X 3UTTB 4C57C 5BYWA 5DJ0B 4BCEA 4H88H 3SJVB 1BEYL 1MCWM 1NCBH 2CBIA 3WDIA 1DWAM 1MRDL 1U41A 1HKKA 4MXWL 5F3BA 5I8EA 5BVJB 1VJSA 4P49A 3MRFB 4B7LA 4RGND 1GSMA 1JP5A 3H9HB 2XNAB 4XVTH 5IMKA 4PJGF 3LV3B 4M1CD 4MCYB 5LG1A 1TMCB 1PSKL 3VFTB 5D96C 1TZIA 2R2CA 2Y7QA 4KV5F 4NZTL 1HF6A 1T7XA 3X13A 3WL9B 4JRWA 4O51B 3BUYB 2O9OA 1BLIA 4JHOA 3VFSB 3GK8H 4Y19A 1HH6B 2VMFA 2YUZA 4FQJH 5JW5A 5D2LA 4WUKH 4PY8I 3RU8L 3QEUA 4GQQA 5LCVL 5IM7B 2V2TA 3NPSB 1IC1A 4OBSA 2WAHA 3UG3A 3BPCB 4QNPF 1PIGA 1ETZB 2P8LB 4HJGA 5C3TA 1N82A 2X09A 5DHVH 4BQ9A 4M6AA 5IMMA 1WIUA 3RA7L 4JN2A 1HOCA 1TCRB 5FUZH 5DJAB 1OLZA 3M8OL 1AD0B 3H9SB 5FF6A 3PGCB 3SIMA 5DD5H 5IGXH 2CETA 1CXFA 5FGCB 3D0VB 5HHME 1NCTA 4Y4HA 5DJXA 3VWJA 2BJML 2YKKA 3EO9H 1YEJH 3CFKB 4UTBH 3W0WA 3UTQB 1V6UA 1AY1H 3NJ3A 3K80A 1CLOH 4GO9A 4JFED 1SEBA 3T09A 5CSUA 1QPXA 4FXGA 1MJ7H 2DQUL 2AJZB 4NQDD 1RP8A 2A73A 4NQUA 2J7CA 1KYOK 1RSFA 4CCCA 1A6AB 4X7FC 2IAMB 3MLVL 3EMCA 1IKNA 1J8HB 2VISA 2A9MH 1QP1A 1KLFA 4UILH 2G4FA 5JIKA 4FQLH 3OBAA 2B0SL 1LJYA 5D1QA 5DJYB 2ZKHL 1XIWD 3IDGB 3VXOA 4LSTH 3OHXA 2WB5A 4JFHD 4RGMC 5I1EH 1NOUA 3UR7A 3HC0A 1H5BC 5HDLA 1JPFA 1J1XL 1Q9LA 3D9AL 2XVNA 5D5MB 5KG9B 1D6EB 3STLA 1GL4B 1QA9A 5FYKH 5LGHH 3QUXA 1MFEH 4OLYL 2DLTA 4WTZG 5HI4D 5KVDL 2PF0A 1HHGA 1HHIB 5MEOB 2QR0A 3TV3H 1ZBWA 1SY6H 2VLKA 1LO2L 1KN2H 2ID5A 3GSOA 5IVZB 4MDIA 3FQUB 4PRHB 1P1ZB 2HJKB 1JHLL 4YBLC 2J8UB 1IGJA 4AZ8A 4PJ5A 1ZA3A 3IDMB 5FK9B 3HC4H 3BC9A 4MQTB 5IEKA 3WFCH 5EU4A 4XWGH 4XBEL 2E27H 5KSBF 3P0YH 2V2XA 3PZMA 1DVFA 4BZ1H 1F3JB 1QLRB 3SCVA 3D5OF 3BP7B 4GUPB 1PW3A 2X89A 4X5WA 2XWJB 4IOFD 3MLWL 1JN6A 3ZKMD 3DVGA 4DK6A 4F33B 5AY7A 5D1ZA 1BIIB 5EOTA 4OCWL 3GSNB 2EIBA 3EOTL 3FQWA 3SDDC 5T1DH 1QBAA 5FYJL 3C9NB 1B3XA 2WC3A 5I1HL 4QY8B 5M7QA 1U93B 5ABEA 3HMXL 3MX0A 3IJYB 3F6LA 3PQYD 3P40A 2DDXA 3NACH 4NIKB 5T3XH 4WY7L 4FHBD 4PB9H 3ULUE 3GSNL 1UWEH 4PRWA 3AI0A 4MB4A 3VXPB 3P9LB 2DQXA 1P6AB 1HHJA 1RK0B 2ARWA 3OKEB 5BV7B 3DXAA 3HZYB 5EFFA 1WZ1L 3MNZA 1OQXA 2ZSVA 2IPTL 3H42L 5B4MC 2VDNH 4XX6A 5C08D 4YGVA 4M48H 2ZPKH 4DGIL 5CEXB 5IBLD 4HC1A 4LVOC 1T89A 3QIUD 4Z7NE 5BV7L 2OS7A 1V05A 2P8MB 2F9BT 3MODL 4J3XA 1AGEA 2E9IA 4S1SL 1RJLA 1QEWB 1MJUL 5HDQL 3KXFE 2XY2A 2PR4H 2D03L 3GFUA 3LEVH 1K5NA 3LS4H 4J6RL 2H32H 1MVUB 4PTVA 5HYQA 1J9CT 1YZZA 1LL6A 2WMGA 5E8DL 1FSKC 4AYSA 1MFCH 3KHOA 2FEEI 3GI8L 1S78D 3NIGF 5E9DA 5HYJD 1B4JH 2FD6L 1UKQA 4PGBA 4OI7A 3WO3B 1FN4A 5KSVB 3QAZB 4LCIL 3WE6A 4PP2B 1FZJB 1I3GH 4TUOB 4R2GD 5C2BL 3UEQA 4GAYA 4Y5XC 3ARQA 2J6EA 4K3EL 4GI6A 5FO7A 5EZOL 1SYVA 4Z78A 1AQMA 2HN7B 1D6VH 3PWUA 3PGDB 4MXVF 4RGNB 2UYLB 4G6MH 5TF1L 3CSPA 1Y6MR 5IJKC 5EZLA 3OA5A 5DK3A 1YEIH 2ARJA 3VRLE 3WFHB 3SDXF 3SE9H 2FJFB 4L5FL 1A7BA 2JTDA 1XGYL 4U0RC 4PJXB 1CFVH 5HGBA 1SMAA 3G08B 2CHNA 4ELMA 4PJ7A 2R4SL 1CDJA 1A1OA 4BSWA 1EMTH 4I48B 4OF0A 3VUPA 1CFSB 3WD3A 4X9BA 2N4IA 1ZSDB 3F12A 3CSBA 4JRXD 4D6EA 4UFHA 2NNAB 4YAQB 4H8WL 4JM2D 2WXDM 2HYMA 3P4OB 2X0HA 3S3SA 3V5HB 5EZJA 4QOKE 1J9YA 1GOGA 3T3MF 2KDGA 3GSXA 2X1WL 3C5JA 4FFVD 2FNBA 4Y4KC 4R8WH 2DSZA 2ZX9A 5A6KA 1ZV5A 1U3HA 3ZL4H 1RZGB 1KJMB 4LMQI 3GJEB 2E9LA 1X9QA 5F9OH 2Q8XA 3MUAA 2NT0A 3QQ9D 4KXZI 4WEUD 2R8SL 3IFOB 1UACL 1U8IB 4HZAA 2CEQA 1BECA 1DLHA 3K4AA 3PWNB 5DR5H 2EEXA 2C0HA 4TUJA 5ESVB 1XCTB 3MUJA 3BZFB 4H1LG 1QBMH 4YN5A 4NUJB 4D6IA 1I85A 3GXIA 1P7QD 4PTUA 3TCLB 4Z2GA 2DBLL 4NQDB 1O7SA 1MI5A 5A2IH 3SGDH 1HSAB 3W6MA 1RURL 5CKAA 2M26A 4P3CH 4F2MA 1MJ8L 2JCCB 3EOBB 4TSCL 4IRJA 5J1AA 4Q22A 3FRUB 1ZKAA 3VDAA 3L3JB 1CDGA 2WIIA 4U1MB 1KPRA 2AXGB 2VH5L 4C83B 1B2YA 4PLJD 4QRRD 2R0ZH 1QUNA 1G7MB 2UWFA 4Z7VF 1KNOB 4F58L 2FL5A 3BIAX 4Y16D 2F5AL 4YDVB 3PDDA 2WWMD 3SJVE 1GZPA 3UYRL 2PTVA 5EWIL 1JNDA 3FZUC 4FN0A 3UP1A 2WLZA 4JFDE 4LHJB 5BW7C 5I1GL 5JIHA 2IEPA 2H2SC 3W11C 4JCMA 5A2FA 1QSEE 4PMRA 3CFDA 3EJZC 3GEWB 1JZ4A 1W0VA 1EO8H 2V5YA 3CFIC 4I0PC 4OM0L 2H26A 3BP4A 3OKNB 3ZDYE 5C0CB 2FWOB 2VI0A 2HJLB 2JF1A 3R0MA 3WDJA 4NHCH 2R2EB 2ZCKH 3CSYB 3BIBX 3M07A 2V9TA 1M6OA 4D9RD 3GH7A 3EKCA 1K8DA 5KVEL 3MUIA 2I27N 1DQJB 1H3UA 4FFYL 3DHUA 5L6YL 3HE7B 1H1NA 2Q7YB 4ISVA 2CQVA 4WI4A 1MOEA 1AD9B 3RHWF 1WC7A 2APBA 4O00A 4WU5B 2P5EE 3TO4C 3SKOA 4LCWE 5E08H 4AM0A 3UJTH 5HHOE 4MJIA 4WWKA 4LAJH 1LE5A 3VXSE 5B38G 4U1IB 2V17L 1VFBB 1B2WL 3RVUC 2VRJA 5F8QC 3PV7A 1HSBA 2I60L 5EULV 2RB8A 5D2NA 3S88H 3G6MA 2NY3B 5IVOA 5GGQH 3GHBL 2F54A 4LBEB 3BP6B 2DH3A 4MJ5B 2YD1A 2EDHA 5IB5B 1EEUA 2Y6SC 4Z7UA 3WQ4A 3PP4L 5SX4I 3VFPA 1QW8A 4EUPB 3O2VL 2DYPD 1FZMA 3S37X 1BWWA 4KI5D 4WENB 4YPGB 2BS9A 4KKLC 1CD0A 1ISWA 1MPAH 2CHOA 3OKMA 2LAGB 1VGEH 4XBPA 4Z76A 2LFGA 1DWJM 5HDBF 2R23B 1FYTD 3SCUA 3VI3E 4BH8B 2AK4A 4XPAH 4I3RH 3U0PB 3DGGA 4NN6B 3WHXA 1U33A 4JFZL 1IQWL 3IDUA 1FH7A 2CPUA 4M56A 4AC1X 4GBXA 2OQJB 4B0MM 5EBLA 5GRUH 2Z4QB 2AJ3A 3VFRA 5IBTL 4MNMA 2J12B 3FOMB 1C3FA 4JO1L 3RVWD 4NBXB 1AJ7L 2YMXL 4GJTB 3WUWA 5F97E 4WO4D 3JUYA 1FBIL 1OP5K 2G3JA 4Q7DA 5DRXA 3TBSA 1ITBB 1ESWA 4F9PA 1E4NA 3T65A 3SCMD 3GKZA 1WPCA 2OR9H 3EO1A 4BJLA 1BF8A 1CVRA 1S9WB 1XGQA 5HYJB 5D5ME 5A69A 5JDSB 3D2UB 3ROLB 4EOWL 3KWWB 3ZTJH 5B39B 2XA3A 3MQIA 4G9FA 3QHZH 1NANH 4R2GB 5FHBL 2I26N 3PXHA 1KWGA 4RFEB 3DETD 1ZT1B 3WENA 3U6RB 3V0AC 1DSFL 2A6IB 4P4KD 4LLMB 5CSYA 4MAUH 1GGBL 3C08L 4HK3N 2R4RH 3RUGF 4PRHE 4WI6A 4GKSA 3IU3B 2VDQL 3FQXB 4L3EB 1MCWW 2CRIA 3L1OH 3AS1A 2UWEF 1H41A 1R86A 3WCYA 4KTDH 5CP7B 1C16A 3N0PB 4YXHL 4X8XA 3UBXB 5I17A 5CPTA 4KVCL 4JREC 2JJSC 2NY4D 4L4TB 3S35L 2RJMA 4HFWB 5E0FA 4WJ5B 4R3SA 4U3AA 35C8H 2FIKB 5D7JC 4JKPH 4OIFA 4KKBD 5D7SL 1WCGA 4JRXB 5DXWA 4EEEA 5B8CA 4JM2B 1CF8H 3JV6A 2XZQL 2XTKA 1RUQH 4G3YH 2DQCL 4PJ9D 3QWQB 5DEGA 1CXHA 4XPFH 1I8MB 3VNYA 4XXDB 1RH9A 2VQUA 3SCTA 4JY4B 5F9AC 1HWGB 4PJEB 4BQ6A 5JR1H 1KENL 2OYKA 1KLUB 3NA9L 3CX2A 3HNVL 3ULVC 2GDVA 3WQ8A 3TN0A 3DRQB 5L2KB 2J7LA 1CICD 3UPRA 3ZE2F 4LIQE 3HRZB 3VX0A 6TAAA 1M04A 4HLZG 3NZ8A 1UADC 3HS0B 3ULVF 1E72M 4DZBA 1YN6B 1BPLB 5T5FL 4FXKB 1P7QB 4RSVA 3VW3L 2IBBA 1W1TA 2BNQA 4K9EL 2ERJB 2F8VA 1MHCA 5EO1A 1N64H 3FB5B 4WEMB 5GNYA 4ZAKB 4AT6A 5AYIA 1P4BL 2FATL 2WKGA 4HP5A 1WTLA 4JCLA 4YDJB 2ZXBA 43C9A 4PREB 1FNGA 2GFBB 1VADA 3K46A 2C7UB 4HGWA 5IHUL 3RKDD 3B5GA 4WI5A 2Z1SA 1DQDL 4QP0A 4ONFH 4QXGH 3OGRA 2DQIH 5GGRA 4UFJA 5CZVH 3IJHA 4LSRL 3VGAB 1RUML 5DJ6B 4PP1D 4U1KA 4ZUUA 3THDA 5KJRL 3X11A 4HWBA 4Y16B 1CGSL 1VAHA 1MWAH 4FP8H 3BE1H 1VEOA 1YUHA 1U3ZA 4G7YL 3VX1A 2QPSA 2ZNWA 4NN7B 3SDYL 4RGNE 3GZKA 2V7NA 5FECA 8FABB 1CDIA 1T80A 1JL8A 2EEBA 3IVKB 2W66A 3O9NA 3L4XA 2BVYA 4Q0XH 3W26A 3HR5B 5HHXH 3L6FA 5I19L 2YPLA 3VXUA 1RJZA 5BZWA 5J13B 1KCLA 5I6XB 3SURA 2D9QB 4PJXE 4D0DB 3WF1A 5KSAA 1IM9D 1XH3B 5TPWL 3P3YA 3O9WA 5HHQB 2HFEA 3GMPB 1H15B 1FORL 1CDHA 3JV0A 2IPUG 1F58L 3K74B 5D8JH 2LTQC 2CDEA 4X0VA 1ND0A 2IANA 5D1XA 4MHHI 3BQUA 1F8TH 3CDGA 5DT5A 2XXMB 2CLZB 1VEMA 3BFOA 2V9QA 2GW5A 4GPNA 4X6BB 1V8HA 2LQRA 4JB9L 2W92A 1C8YA 4K71B 4MQ7A 4KROC 1I8KA 4Z0BL 1ZBCA 2NY7L 1NC4B 1BVZA 1IT9L 4PJIA 3GH5A 3O6ML 1QNZL 5IFAL 1T03H 2J47A 2CLRB 4LPVA 3QQ3A 4G9DB 1PKQA 4MXQC 3T4YA 3KYNA 3NFPA 1JYXA 3BJ91 5TGBB 1EDQA 5FKAA 5D7IA 4X80L 5A6BA 4LCCA 1FYTB 4JFEE 2HMIC 4DUXA 4PRAB 2EXWC 3QUZA 4ZXBD 1UD4A 3RAJH 2QSVA 2C1PB 3UJJH 3EOAA 1BAGA 3PV6B 4NQDE 4EI5C 4U6VL 4OGAC 4Q9CA 1GAFH 3DMMB 4KTEL 1QO3B 4DWSC 2B1AH 1RIVL 2ITDA 4HWZB 4QHUB 1F90H 1JWMB 2FEEL 1PZ2A 5SWZB 5C0FB 3MLUH 2Z8RA 2V5TA 3QFDA 4ZFOB 4OGYL 2IMNA 1XR9A 4RBPH 5DWUH 5F9DC 1SBBA 3PGFL 4WO4B 1OWRM 3KWXA 1NBZA 1JDDA 4JFHE 1YEFH 4OLXH 3C6LB 5JZ7D 4D2NA 1J88A 1G7JA 4ZFOL 1H09A 5FYLD 5MI0C 1EGZA 4XVSL 2GFTA 2F53B 1N3NB 4HV8A 4JHBA 4W5ZA 4OJFL 5F6IC 3CZFB 5I79A 3NCCB 1PIFA 1BBDL 1FL6B 2EYSB 4QRSB 3WS3B 1WO2A 4U1HA 1BGXL 5LA0A 1IEAB 2L7UA 4MMXC 2I9LB 4PJCB 3TTOA 1UVQA 1G6RA 1UJ3C 1T0MA 3POHA 3QGVA 1QSFA 3GIVA 2GIYA 3SQOH 4D8PB 3FFCD 3CPLA 2XWTA 3O3EB 4KQ3L 3ESUF 3TJEH 2Z8WC 2KZWA 4CVWA 1E5JA 1WCBA 4HXBL 1TTFA 1G7LB 3FO0L 4JO2L 1C91A 1CENA 4BH7A 1X4XA 4WFGD 1JV5A 1OSPL 3CDFA 3KYMB 4OZHE 4ETQB 2HT4C 2NY4B 2OTWA 2Z31D 2GUOB 4YHKH 1GW1A 2ZWZA 3DPBA 1OCWH 4PGDA 2R9HD 4YHIB 2EEAA 1RY7B 4PJ9B 1T1ZB 1NGQL 4CNIB 3QHFH 3VXQB 1I7TA 4P2CG 3RX8A 3PQYE 1FGNH 1ED3A 4GXVH 1ECEA 4F7MB 2O61A 3UTOA 5ICYA 2B4CC 3OAUH 4J3OC 4P5KA 4ZFZA 1LO4H 4PRNA 4HMDA 1CICB 2GK2A 2D24A 4XWOD 3BEWA 4AY1A 3T04D 4BELD 1ZMYA 2OMBA 3MRRA 5EOQL 5CJXC 1RI8A 4PCTA 5C08E 3MFFB 1IE5A 2J5LB 2P8PB 5L0QB 4D9LH 2PI6A 1MW2A 1ZHLB 1AKJA 4EQ2A 5CZXC 5DHYB 4KI1A 1SMDA 1W0YT 4UQCA 5I2IB 3OXRA 4ZTPH 3EYOB 1CGUA 5BMFL 3D85D 3QI9D 3WDPP 4NNXA 3V52H 4ZUWB 1UKTA 4W4OA 3L7FB 2M8XA 5D7KD 12E8L 2Q8AH 1W0WA 3MU7A 4RDQG 3ZJ6A 4YDLB 1OB1A 3QUKB 4KK6D 2R29L 3QDGD 1KTLA 3AREA 4H1LH 1XRVA 2JB5L 4WIQA 5ENWB 4P23B 2BVOA 5H2BA 5B3JF 5HYJE 1A6WH 1FDLL 3DROA 2XTJD 4M8VA 1JGEB 1E4KC 4NM8H 2ZOKA 3SUWA 4Z2IA 4LNVA 2FX9L 3BT2L 5HGHA 3NIDE 9CGTA 4FTVD 4TVPD 4LYPA 2BFVH 3WF4A 2A77L 1VERA 5HBBA 1UOKA 5DK2A 3EYVB 3SCPA 4WW1A 4UQ2A 4Z8FH 2O9PA 4NSKB 2DQDL 3CVIH 2JIXA 3I6GA 4KJYA 1IC4H 3QDMB 3O6KH 4NRYA 3GIZL 1HJXA 3U7VA 3HPLB 1S7VB 1UA7A 1OTSC 1NBVL 4JRXE 4PD4J 3GJFH 3LRHA 1ZVSA 5I1AB 3K7UA 2F8QA 4YDKH 4LCUA 3RNQA 3L9RB 4F8QA 2QV4A 1OAZL 3NUKA 4W7WA 4QT5B 2NX5D 1MQKL 1N26A 4NKMB 2FSEB 5AD0B 2CUIA 1X5FA 4X4ME 4PJEE 3OAYH 1E4IA 1AGFA 5JORA 1WE5A 4OCXH 4QFUA 1U92A 2CRYA 2VB5A 1R5VA 2FDMA 1C7TA 2YPKB 5KS9A 1F2XK 1B3JA 1KPUA 1YMMB 1MJJA 3S96A 3RGVA 1JUFB 2MPAH 3RTQD 3VFNB 4ZFFB 2VX5A 3O8XA 4JANB 2YA1A 3AJ7A 4NQVA 4NZCA 3QOMA 2FJGB 4YFLI 3NN8A 3ME0A 3VCLA 3JWOC 2ZE0A 4F15C 5INCA 3BAJA 3DIFA 1U8LA 3KPLB 1GRWA 4HX1B 3A4AA 1AGCA 1NAMB 3VVGA 2I5YH 4H0GA 3MOQA 1WZMA 3PDOB 5DLMH 1G7QB 3MLZH 2NQCA 3JV4A 2VZ1A 3QH3B 5IG7A 1UR1A 1MHEA 5A16B 3LCYA 1BAFH 1NAML 3LKNA 2C1OB 3MREB 5AG9A 2XWEA 3KL5A 2ICCA 3WD0A 2JELL 1A6VH 4G6AC 5EUKA 3S5LA 2Y36L 4QRRE 2DICA 4K2UL 3AMDA 4F57H 2QQNL 3GRWA 4LLVB 4GG6A 3V0WL 4XVJH 4OCRH 4M93C 1J1PH 4YEFA 3HZKB 5ACLA 2YD7A 1R3KB 3O81A 4CVUA 3WD2A 4GRLC 1JMXA 4MB1A 4KRPB 3O41B 3MNWB 1CCZA 4PG2C 3OKLB 1T5XA 1CG9A 1KCUL 6FABL 4UDUB 1I1FA 2YRPA 3D25B 5CLWA 5FYLL 1UKSA 4P57B 2WP3O 1QYGH 4PCSA 1HQ4A 4ERSH 4PB0H 4BFIA 3BESR 3KPSA 2PO6D 1RP9A 1TZHA 1MAML 3OR6B 5E5MA 4IIQB 1HHHA 4OZIF 4MLSA 2GK0B 1C5BH 3KPRA 1Q0XH 3L7EA 1ORSA 2DQEL 4M81A 2OWCA 1MQQA 4WKAA 2IFFH 3BWAB 1E6SM 3ZKSD 1FOBA 4GQPH 3SY0B 2CLVB 2H2PC 4LGSB 1W9XA 1LP9A 1VACB 3KGRA 4NWUL 4X6FA 4HZ7A 1J87A 2F15A 4JGMA 3WJJC 3STBA 2ORBL 1KCKA 3Q1SH 3VFGH 4R7NA 1GOKA 2ARJQ 2J62A 3U30C 5DI8B 1KPVA 4J7RA 2X4SB 2WMKA 2VC2L 2IF7A 4NQSA 4P9HL 5AAMA 1O6IA 5FA3B 3VFOB 5EU3B 1XSJA 2Y24A 2LU3A 4BQ4A 1TDQA 1JPST 5ILTL 3ZKQD 1LO0L 1A64A 3QNYB 1NBYB 2VIRA 5HYFA 1K9FA 3QDJB 1EGJL 2KZ1B 1JNNH 4E5XB 5DVNA 5C9JB 4KI5E 1DUZB 4JQIL 4F9JA 3H6JA 4L8BB 4S0TD 2Y5TB 3UTTA 5DJ0A 5KOVC 1CD1B 4LEXL 2DL9A 4WUUD 1FYTE 4OTXL 4GI8A 1WDPA 2UY6A 1FHLA 3N9KA 4X4YA 1FZKA 3CMOH 3MRFA 4P5TD 3EYPA 4GIAA 1FZOB 4OCYL 4W7VA 2QQQA 4PUBH 3H9HA 3VXMD 2XNAA 2A74B 2DMKA 4N0RA 3UO1H 3VXUE 5IROA 4MA1C 4MCYA 1TTGA 3QI9B 4FQQA 4DTGL 5JW4N 3VFTA 1NWSA 4QTIL 4P7RA 4YEEA 3TZVB 3E1F1 4BKLB 5D9NA 3PNWA 3DI2B 3WL9A 4MX7B 2XKNB 5ABDE 3BUYA 1FLRL 3OG2A 4O58L 3JSSA 4HLZH 1XF4B 3VFSA 5F1IB 4X7TB 4KK8C 4WW2B 1VCAA 4KKNA 4FZEH 4TNVK 3OV6A 1B6DA 1I1YB 2DI8A 1HH6A 2IANE 3DTXB 4YJZL 4U31A 5CEYB 3WLBB 3BSGA 3MRJA 3QCUH 1PZ5B 4UQ9A 1OTTC 2XTJB 4HOWA 5IM7A 1FO0B 5A43C 1HINH 1PY4A 1MNUH 3BPCA 1U8MB 1B6UA 4I2XB 5D6DC 4PJCE 2W63A 3KHQA 4PJBB 3VD7A 2WBJC 4PJIE 1NFDB 1FO0L 4XNQB 3O6FB 1TCRA 4JGJA 1NCDH 4OIBA 5B39G 5CIPH 5DJAA 2EXOA 3WN5C 1AD0A 3VO0A 1F4XL 4X9GA 5HVHC 1W8NA 4TVPL 1R3LB 4AENA 1EJOH 2VT0A 1I1WA 3BP5B 1X5YA 3D0VA 1W3LA 1B3WA 2FR4B 5D7IE 4EZMA 4RZCB 3ZKNC 4EN3A 4MA8H 2H3NB 3UTQA 2VSDA 1UD3A 2VLRD 5J6GB 5I8CB 4MXWH 5CBEB 2QSQA 2D4DA 3K8MA 4PJ8C 1MH5B 1UXWA 2OYMA 2PTUA 4OI9A 1A6AA 1YEGL 2IAMA 5T3ZD 1EPFA 3UBXG 1L0PA 2WM0A 4PR5A 2NX5B 3MRIB 5E1HB 1J8HA 3B9VA 1U2YA 7CGTA 1DDHB 1PSKH 4LPTA 1ZJAA 1KB3A 4K3DL 4LQFL 2CH8A 4NZTH 1QNQA 3MUHL 5DJYA 1Z32X 3CXHJ 1VFUA 5GPRA 4P8WA 3CHEA 1FV1B 4NBYB 5CINL 4ZFGH 3MSGA 1E27B 1RJCA 4FQXA 3RTQB 3IYLW 2ZOLA 4W88A 1BZ9A 4RWYL 2FGWH 3MROB 4R96A 1JNEA 1Q9WB 1XCXA 1CLYH 3SDDD 4NKDA 2CRZA 3QCVL 2A3HA 2HKFL 3AY4C 1TTUA 4JPIB 4D3CL 3BXWA 2SEBA 3QA3A 4LLUA 3UPAA 1J12A 2GAZB 5MEOA 3EBVA 4ZUTB 1X5XA 4CMHB 5IFJB 1M53A 1R3JB 1QSFE 3QUMB 3CZLA 4HHAB 2VUYA 5IVZA 1A4JB 1AO7D 4XMPL 3FQUA 4CJ1A 1P1ZA 2HJKA 4QXUL 2XN9D 1OT2A 2G75B 1LEIB 5FK9A 5B4MD 2CERA 1X5KA 1YEEL 5KVFL 5LXGL 1R7AA 1U3JA 3JWDH 2BC4B 4PJHF 5ID1B 2EEDA 2VXSL 3QUML 3CNKA 1F3JA 2DRUA 3BP7A 3DWTA 5T1LD 3MC0A 3I9GL 4GUPA 5FM8A 1SM3H 2XWJA 4GMSH 5C0EB 1HKJA 3HMXA 3VFVB 3L5IA 1R3HB 3B5HA 1BIIA 2DQUH 4L29A 3GSNA 1GQKA 3LAFA 4WHTB 3Q2CA 4RGOH 3WIFB 5GRZA 1BX2B 1V3KA 3MLVH 3C9NA 4JFYA 4OFYD 4W68A 2WP3T 4AEEA 4YHML 1LK2B 4M80A 4G42A 2AQ1A 3WDQA 2B0SH 1ZLSH 4M6MH 3U36A 2ZKHH 3P9LA 2ZX7A 1RK0A 2CNCA 3OKEA 4XZBA 3GSRB 2XG9A 2GQHA 1T5WB 3HZYA 1HH9B 3AM8A 3QIBC 4NC0B 5EUOA 1J0YA 2G5BA 4ZO8A 4Y1AB 1MYRA 4PJGB 1EFXD 1NSNL 2X7LB 1JPTL 4WI7A 4XC1L 1J1XH 3D9AH 5CEXA 4PD4K 4DN3H 1PX8A 2H41A 5EMYA 5D93C 2CDFA 3QZWA 4JY6B 1FAKT 2G60L 5IVXE 1OHQA 4EVNB 4Z2KA 4OM1H 5CP3H 1OAYL 1ZLUK 2KBGA 4NOBA 4X9IA 3HE6C 1WCQA 5D96B 4DVBB 1OAXL 1UWXK 3IDYC 3MXVL 4MAZA 3TOPA 4M9PA 5DEZA 2FO1A 5IR1B 2ADGA 2OK0L 5I16B 1U8NB 4FFZH 4DK3A 3SHSA 4UT9H 1MVUA 1UCBL 2ZWLT 1Q6CA 1C5DB 1U8QA 3UJIL 4Z95L 4S1QL 5FD0A 2QV2A 4MAYC 3BPLC 1MWOA 5C71A 3STZB 1MCCA 1YNTA 4HS3B 5IOPB 5JPMB 2N7BA 1MF2L 1QI2A 5K33A 1KJ2H 4YXLH 4YDIL 4O02H 5FUCE 4AG4L 4UNTA 5KSVA 4P2OC 1NGZB 4Y4KD 4PP2A 3OXSB 5IF0A 4UTFA 1FZJA 1TNMA 3HFML 4AIXA 5I73C 4JFFD 1UA6H 2D22A 4JHZA 3EYUL 2D0GA 3PGDA 4KVNL 5I1HH 4KUZL 5JIPA 4G8GA 4HIEB 2O9TA 3FB7B 5JNYA 3MBEC 4MWFB 4QCIB 4R7DB 1JWSA 2A9NH 2FJFA 1UD6A 1FE8L 2IFGA 1MFDL 2PBGA 4FQIL 4RL3A 5ALBH 4OZFB 3QCTL 1OM0A 4U4BA 3UZVB 1S7RA 3BKJH 1WZ1H 3VE0B 4YHLL 2IPTH 3LIZL 1HYSD 1CFSA 15C8H 3VIOA 4X6CA 1BQUA 4DGIH 1ZSDA 2V5MA 3CUPB 1WP6A 5FYLE 5FEBA 2NNAA 4YAQA 5BV7H 1IT0A 4LIQH 3MODH 3V5HA 1LO3H 5MEPA 5GGSB 2D0FA 2FYYB 4NCC2 1OD0A 1YY9D 4P7QA 1M01A 1HXMA 2CKBA 4NNPL 1NEZA 1WBZB 2IPUK 5HDQH 3MJ8B 2BVDA 1HX0A 1PLGL 2Y9RT 3AHXA 2DQGH 4N8CH 2D03H 1DBBH 3QXWA 3WUBA 1G1CA 2HT3C 3ALWA 3S34H 4A6YA 4J6RH 4RX4A 4OZOA 4RGMB 4GZIA 4KC3B 4S2SA 3FFCE 5C0AB 1J5OH 1H5BB 1I1AC 2X1OA 3IFOA 2V3FA 1FVCA 2V38A 3SE8L 3FZUD 5ESVA 1XCTA 3GO1H 4PMQA 3BCDA 3BZFA 1A3RL 1CGYA 2A6DB 5JHDD 2FD6H 3KPPB 4WFGE 5CWSB 5K9QI 4LCIH 3TCLA 1ISZA 2AJYL 3D3VD 3BKYH 2VLRB 2W0KA 3PWPB 5DC4B 5TJWK 4X7SL 4PSRA 5KSBB 5D6CB 1M7XA 2IG2H 5C0BB 1HSAA 4QYOA 1IM3B 4NO0D 5TF1H 4YBLB 4Z7QE 3SE3A 2JCCA 3OLIA 4IDJL 3L3JA 1NC2B 3SDCC 3IDNB 1XGYH 4U1MA 1S5HB 3OB0H 4DKEL 2YL5A 3CCHB 5T3ZL 1OAUL 1UT9A 4FK9A 2R4SH 3G5XA 1G7MA 4N0FA 4AZ7A 2NZ9D 1KNOA 1KGXA 2QKIB 2XKUA 5KN5B 4XNXL 1IKFL 4LHQB 4APQB 3GBML 4PRPD 1ACYH 3SDDB 2X4UB 1QR1B 5CHNA 1HXJA 4YXKH 1J8KA 3AIQA 5IMOA 2EIDA 4Z77B 5ABGA 4PUDA 1JZ6A 3GMQA 2YSSA 1JIBA 4O2CB 4D94A 4YK4C 3OKNA 2Y6SD 5C0CA 2FWOA 1LDPH 3MLRH 1YEKH 3UDWA 2R2EA 3ULUC 3IKCB 1ODAA 3VDHA 3WFEH 2R8SH 1UACH 1B31A 3L2LA 4PJAF 3WNOA 3HE7A 5HD8C 2Q7YA 2R56H 3U0TA 4JZ5A 3QDGE 2WKLA 4LVOB 3OX8B 2FO4B 1AD9A 3ULUF 2ZXAA 4WU5A 2BRQA 5BS0D 3L3IB 4ZNEE 3SO3C 1GVYA 1N2RB 3TA3C 3HI5L 2Z8VC 2XTJE 2AJSL 2YD5A 3AMCA 1ZHKB 4U1IA 1VFBA 4G8FA 2DBLH 1MIMH 4GKLA 1RURH 3M1BB 4FTVE 3QXAA 4OKVB 4TVPE 3UXFA 3V6OA 1G9HA 3VXRA 4Z7NF 2EO7A 1BYBA 2DQHH 1RV6X 4D71A 2MWCA 1LQ0A 3OZ9L 4LBEA 3BP6A 4TSCH 5GS3A 1HDMB 2B2XL 4MJ5A 4AD5A 1OL0A 3RPKA 1FSKB 5IB5A 4V1DB 4EUPA 1KWKA 4YPGA 1U36A 2BOBB 4J28A 1D5ZB 4P5MB 2HH0H 2F5AH 4HWUA 2E9MA 5DJZA 3CC5B 7TAAA 1Y18B 2R23A 3FN3A 1BD2A 4Y5XB 3MYJB 3SDXB 3CU7A 4BH8A 1PFCA 3C60A 3INUH 2C3WA 1MFVA 5E94A 1SJEB 1OY3B 3LQZB 3ZQ9A 4HAFA 2VZUA 3HNTL 4UQAA 4FOMA 3M7SA 4LRIA 2OQJA 1Z0NA 2Z4QA 43CAB 3NAAL 4U0RB 1N59B 2EZ0C 3L3OB 1KB5H 4R0LC 1JPSL 1DR9A 3MUZ1 3TYGH 3FY1A 4XBGB 1HKMA 3CXHK 1XYZA 4FFYH 3RCNA 5D7JD 1EAPA 4M1DL 1I8IB 2EKJA 4RAVB 4XRCA 5L7XL 4IOIB 1J0HA 4P2RB 3VRLF 1AP2B 1KIQA 4PIRF 1WFTA 1S9WA 3CZKA 1QFPA 1MCPL 1N5YL 5JDSA 3D2UA 3QPXL 1A5FL 4Y4KB 3KWWA 5B39A 3N17A 4WV1C 3LKSB 1B2WH 4QTHB 1ZT1A 4RFEA 3TO2A 3U6RA 3NYDA 2HWZL 3I75B 1WISA 4LLMA 3VI4E 3ULVD 2X0YA 1FH5H 1ORQB 3K1DA 1LEGB 5DD3L 3BAKA 5IQ9B 2TAAA 3CMJA 3KPQB 4LSPH 4L8CB 1AHWA 3NGBB 1E28B 1HCVA 3FQXA 2H6PB 4L3EA 5J9PA 3NFSL 2A3BA 3O2VH 4XTRD 2RFXA 4NO3B 5CP7A 1GOQA 3MA9L 1WBXB 3IXAB 3WSUA 1G9MH 5I1JL 5MERB 1CD9B 5GGVH 4MJ4A 5HI3C 1HN1A 4KRNA 4L4TA 1FL5B 4HFWA 4WJ5A 2FIKA 3FN9A 4KK9C 3ZDXE 4H2CA 5F7EL 4AIUA 2YIHA 2VLLA 3DX7A 3W27A 1G0CA 3KJ6L 1IQWH 3EFDL 2VC9A 2DSUA 4POZC 2R2BA 4Z7VB 4XXDA 5FCSH 5I77A 1XF1A 4K7PH 3SGDI 1T83A 5IBTH 3AB0C 1WVZA 2E9WA 4PJDF 1EHLL 1AJ7H 2OL3B 3ZYJA 2YMXH 3W9EA 5BCAA 2BOCB 3VOCA 2E7MA 2LU7A 5DMIL 2EXYD 3DRQA 5L2KA 4DQOL 4FNLL 1FBIH 5CGMA 2IXVA 3HRZA 4YNYB 1KXTA 2D31B 2OL3L 4I13B 5E8EB 1TJGH 3HS0A 3TIDB 3QEQD 3VM7A 2JFEX 1OAKL 4XNMB 1YN6A 4PEEA 2W60B 3WN6A 1QOKA 2X4OB 2VXQH 1XD0A 4FXKA 4EOWH 1DEEB 2Q3AA 3CD4A 4I0PB 5CSBA 1G7IB 5ECUA 1MFAH 5E8NB 1EXPA 4Z5RB 5F88B 3UR8A 5IB1B 4FABL 1A9EB 2MMXA 1MCFA 3TPKA 1XGPB 4ZAKA 3C08H 3MO1B 1F3RB 4GXUN 4OD1L 2DIJA 4CU8A 1KBKA 2Q87A 4PREA 2VDQH 2AV1B 2IPKB 3WXVH 2C7UA 1LLOA 4U6TA 1T21B 2VITB 1NCCL 3WUZA 2DLHA 1AC0A 1T66C 4QNPE 3MRPA 3TO4B 4JFSA 1H8OA 3ZLQC 4FQCH 4YXHH 5DJ6A 1B1YA 2WUCH 2C4FU 2GK1A 3S35H 4DFIA 4JO3L 5GS0D 5FO8B 4HGKC 4M82A 4WUUE 2BHZA 3ZYIA 3AYSA 4J2XA 4PRPB 3QHTC 2XZQH 4LHUD 2DQCH 4KROD 3BSHA 4OGXL 3D3AA 2B5IB 5LGJB 4KJPC 3VXME 3JWDC 4WRLA 3GKWL 1SQ2N 3T08A 1WAWA 2AQ3A 1U8HB 3IVKA 3CZEA 5IMLB 3B2VH 2B7DT 5C0RL 3VIMA 4D6JA 3HR5A 1YN7B 5DQDL 3NA9H 4Q6IC 3BGMB 4LCYB 3ARZA 5HHVH 1JYVA 4MXQD 4H8VA 1E6JH 1K8IB 5EUOE 1DEDA 1XH3A 3D0LB 2Y1VA 2EYRB 1T04B 3WH7A 1ERNA 5HHQA 3GMPA 2HMID 1H15A 2EXWD 3HMCA 1GOIA 5IBUB 3ARFD 1L7TH 2AP2A 4EI5D 1NCUA 4LEOB 1QLEL 3B83A 5BS0B 5SWSB 1RUPL 5ANMB 2QSCL 4B3LA 3G5YA 4NO5B 4DWSD 1AQ0A 3O2DA 2EDLA 1TVDA 3U5YA 1RZJC 4K9EH 1MHPH 2ITCA 3TBTA 5TD4A 2CLZA 2YC1B 4BA0A 2E6JA 4N8VG 4MB5A 1JMZA 1US2A 5IQ7L 1MAKA 4AISA 2JKXA 4WEBH 3AHYA 5ACZB 1HILA 3DUUA 3KYKL 3Q6GL 4TVDA 1ZU8A 4QRQB 1H4PA 1FFPA 4RMVA 5HJ3B 1NC4A 4MNGB 1NFKA 1LWHA 2BX5A 5IESH 4HCRH 3O4LD 4HKBA 1HIZA 4X6DA 5IVNA 2YLAA 4E42B 4YC2B 3RUGB 3I6KB 2QL1A 3IF1A 3QULB 4OCLC 2QHRL 2AGJH 2W9LA 5TGBA 1CGSH 1RZ7L 4YX2H 4PTTA 3HJEA 5DFVC 1H8NA 2G9HB 2GSIA 2UWEB 4XVTL 3CH8A 2Q3ZA 5JQ6L 3PV6A 3U9UA 3SDYH 1JNHB 1E4XL 1NANI 3IETB 1Z9MA 3DMMA 4OF7A 2XRAL 4Y4FD 1QO3A 2PBOA 2CUMA 1FG2B 3CU1A 1IC5H 1JWMA 1E6OL 4NQCB 5I19H 5SWZA 5C0FA 3RL2B 1FJ1B 4Y0GA 3GK8L 1DQTA 3HB3D 1MQ8A 4JREB 4P3DB 4Y4HC 2UY3A 1FNLA 5GGTL 3SKNA 5D7JB 3C6LA 3MGTA 4WU7B 5DHVB 1NJ9B 1S9VA 2YD2A 1A7QL 1WAAA 3OR7B 5KANG 3MMDA 3OF6D 3MS8A 2F53A 5C7XH 5JOFB 2WVVA 3CZFA 4FA8A 4QRSA 1ADQH 1IKNC 2F19L 3WS3A 4Z7OE 2HVJA 5F1KC 4G80B 4JB9H 3BSZH 1VDGA 2PUQT 5D1QC 1UR8A 2OSLB 5F1OB 2NY0C 1AO7E 1PYWA 5DD5L 5IGXL 2XN9E 3C5ZC 2NY7H 1OGGA 3O3EA 2J2ZA 4XV0A 3W24A 2EDQA 3EO9L 4GW5B 1YEJL 4KY1L 3ULVL 4UTBL 4HZ6A 4HS6B 3VKKA 5HY9B 3B8YA 1CLOL 3P9MA 4C56D 4V2BA 4B50A 2ATKA 5CZXD 2HT2C 1ZHNB 1MJ7L 2VZSA 3WJLA 3KYMA 1RHFA 4X80H 4S3KA 5DVLA 3MV7D 4MNLA 2GUOA 1FL3B 5CJ8A 3GTNA 3VGDA 4CU7A 1FHGA 4YHIA 3VD3A 4XP9L 3WEXA 3OGOE 4U6VH 3HI1B 3GMNB 5F44A 1AQDB 3NDYA 4FQLL 1T1ZA 4CNIA 3H0TB 4NFDA 3VXQA 1G0YR 2NW3B 2J4WH 2X05A 2X40A 1T1WB 3MJ9L 4LPYA 3GI9H 4OGYH 5I1EL 1ZXQA 1S7TB 2VZVA 2OTUA 2HG5B 3TF7C 1XT5A 1DQMH 5C09D 2OLHA 2P5WD 2B31A 4ZYKB 3PP3H 4L1HA 3HU7A 5K9KB 3MFFA 5D1ZC 2XZZA 2NY2B 1DCLA 2P8PA 3FB8B 3EDJA 3O0RL 5FYKL 3RJQB 1CZ8L 1MFEL 1QQDA 5AAWA 1OCQA 2J7BA 5HTSA 3N50A 3GNPA 4LGRB 1WWCA 4OJFH 5DHYA 3HNSH 2Y5EA 2YD8A 4V2CB 4AIEA 1SY6L 3S2CA 1KN2L 1C12A 1XGTB 4F37K 3EYOA 5DUPH 1NCAH 1FP9A 2WC7A 1TQBC 5DJ8B 5B3NA 3NCYP 1FFQA 4JRYD 3HC4L 3FN0H 3WFCL 3V7MA 2OWXA 3GB7B 2W59A 1OGSA 1OGAD 2E27L 4F9LA 3P0YL 2HRLA 3RM9A 3L7FA 4Q7NA 3T3ME 4KJQD 1OTSD 5GRJL 3QUKA 4HXBH 1HYRC 4ODWA 3B9KB