4MJ4A

Human iduronidase apo structure p21 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
614
structure length
603
Chain Sequence
b'EAPHLVQVDAARALWPLRRFWRSTGFCPDPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-iduronidase
molecule tags Hydrolase
source organism Homo sapiens
publication title Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.
pubmed doi rcsb
total genus 194
structure length 603
sequence length 614
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01229 Glyco_hydro_39 Glycosyl hydrolases family 39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mj4A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4mj4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mj4A02
2YKLL 1MI5E 3MRKB 5DRNB 4AIUA 4N0UA 4LEOA 4Z7WE 5J6HB 5C3TA 3NIYA 1YEJH 3RNKB 4KMQA 1QEWB 5FA3B 3UAJD 1EFXB 4N8VG 3AHVA 3LZFH 2YD6A 1IM3B 3GMOB 4POZD 1EV2E 5ACLA 1JGUH 1U3HC 1Q6DA 1UOKA 4XWGL 5FHAL 2C1OB 1EJOH 4JO3L 4DEPC 3MV8A 1X6NA 3VA2C 1G7LA 1EHLL 3X3GH 1YZZA 2W9EL 1JPFB 4ORZC 4MZ2A 2RIKA 3DV6A 3RIFF 4MDOA 1S9VA 2BJML 1ZA3B 1HP4A 1CE6B 4HWBL 2J8UE 3TO4B 1YEIL 4OGYL 2O5ZL 1U36A 3AUVA 5IJVA 1DANT 2YPLB 4MNGA 1G7QB 1PDKA 4PREB 4YHOL 4ODUA 1NAMB 5KN5B 1VBRA 4WNQA 3PZIA 3C5JA 3BGMB 1MJUL 1JNDA 1VF8A 1SEBB 2O9OA 5HHOB 1FO0L 4NBXB 4E0RA 2IANE 1LK3H 4TQEL 1KXVC 5D70L 4TOYH 2GY5A 2YPLD 2AEWA 3UP1A 3BQUA 3JWDC 2FHBA 3EO1A 3VFOB 3MRIA 4H26B 3DTXA 4DFHA 2DAVA 4WENB 3W9DB 2GSJA 2CCRA 2VLKB 1OSEA 3O2LA 2ZSVA 3L7FB 3NA9H 4C59B 3IDJA 1LGVA 3CVHL 2ESCA 1BX2B 1EHLH 1ACYL 2DWEA 3EOTH 1U42A 25C8L 5F7LB 3MXWL 2JEQA 1ZVSA 4HWBH 1ONQB 1MNUH 4GKNB 1Z6JT 1AQDA 4L9DA 4K23H 3GO1L 3G9AB 4JZOA 4OD2A 2QLYA 3MOBH 1BBJA 1BOYA 1JPGB 4H0HB 2DM3A 5IHRA 1CN4A 2BMKB 1LDPL 4ELMB 4TOYL 4BJLA 1B90A 4GAGL 3B2UD 2Q7YB 2PO6D 3WN6A 3ARPA 5DFWH 2F8QA 4CRPA 5MP6L 5CKGA 3IJSB 3BPOC 1FFOA 5IVZB 4LXFA 4JFYA 3FB8A 5DZOA 4U31A 4FLQA 4X6CB 3S35L 1QLRB 2G2RB 2X8RA 5HPOA 5EFDA 4X7FC 5A2FA 4OI8A 4JVWA 1JFXA 3SCMD 1I9RL 3WFBH 4ZE4A 3VI4E 1AGEB 3GRWH 3EOTL 4PTMA 2W0FB 1FLRL 4ETQB 4JFZL 2R0KL 3TJHC 1ZHKA 4Z7VF 5JMRA 1M01A 3HMCA 1HEZB 3G6DH 4JO2H 1I8MB 2DIEA 2DKUA 3TN0D 5MI0B 4UINH 2F53E 2V3GA 4NHUB 3OG4B 5D7IB 3Q5OA 3T77A 2VLRB 1QPPA 1R3LA 1SM3H 5F9JB 4UFIA 4HUVA 5HTSA 2QPSA 3QDME 4ZPTA 1U93B 2BCKA 5DDHA 3M17B 1E6XM 2ZWLT 5TE7H 1YEFL 2X0HA 4PSRA 4HCRH 2ITDB 4X99B 1CECA 2VCAA 1IGJA 5D7LE 3RDTB 4N8VA 5D4YA 3WEOA 1BFNA 3A4WA 3L4VA 4L8BB 5C0BD 2MTPA 3F5LA 4Q6YA 4HXBL 2E0PA 2VH5L 2WZPD 2P47B 2VQ1B 4IIQB 5J8OA 3NTCL 4JFEB 4F2MB 2WWKO 1FLRH 3ARZA 4UT9H 1MCNA 4HA1A 3BMWA 3H0TB 2JCCB 4IOIA 2XWBB 3TBTA 3VFPA 3VGBA 4PJCE 4UINL 3UTSD 1MVFA 2YA1A 1L7TL 3MUJA 1HNYA 4N0RA 4YN5A 2KZ1B 1RZIB 5HI3C 3MSDA 2XXMB 1K4DA 2W0KA 4Y2DB 1NL0H 5E70A 3DHMA 2YL9A 1JF1B 1VACA 1SJXA 1YC8A 5TE7L 3GBMH 1YEFH 4BH8A 1YN7B 5JUVA 1W9UA 5I1IH 2VDOL 2ZE0A 3DI3B 4HUXA 4D6DA 3ULUD 5B3JE 3S96B 2P5WB 4GQRA 2D31B 3FRUA 1B0RB 3DGGA 1S7WA 3S37H 4XWOD 2DM4A 1W8NA 4R4BB 5D2LB 3SDAB 1HKLL 3NCJH 4HXBH 4Y4HD 4CD5A 1H0DB 1II4E 3BPNC 1FFPA 5FM8A 3OIHA 4OLXL 4PRIA 1RK1A 2Z1SA 4MB5A 1WF5A 2ZX8A 4JANB 5CJQL 5FK9A 1E4MM 2AK4B 2HMIC 1Z3GL 5HD8C 1E40A 1QI2A 2DEPA 5M3WA 5LWYH 3BH8B 3OR6B 2FGZA 4OF0A 1EQCA 12E8L 1DBKH 5I8CB 1MY7A 5EZIH 3AMGA 4P7LA 4NRXA 1CQYA 4Q9CA 3PDOA 4OF6A 5C0GB 1Z5LA 2V2WB 2HN7B 4I3SH 5I30L 5ENWA 1CBGA 3RHWK 1KR1A 1WDQA 1WSST 4XCYA 3S37L 1V7NH 4Z7UA 1LLOA 2MANA 4XX6A 4KKBC 3BSGA 3ZO9A 2P8PA 3MRPA 4H04A 1Y0LA 1A6VL 4OIFA 4RCAA 5D1XC 3U7YH 4K8RC 5IQ9B 5EIIB 1LNUB 2OWWA 3FRPG 2YPVH 4WU5B 2DLFH 3MRLA 2I26N 4M1CC 1T22B 3LIZL 4QCEA 1OTTC 1N5AB 5C08A 2B1HL 3GXFA 4PP1D 4HW6A 1V6YA 5B22A 1WT5C 2XFYA 4RGNE 1KJ3H 3BX7C 1MREH 3PZOA 4NM8H 4PGJA 3AS2A 2R0ZH 1FVCB 3IRZA 1E71M 2NY5C 5JA9A 1GGIL 4CKVX 2BSRA 2X4RB 4QRUB 3TCXA 5HYFA 1QD0A 3MLUH 5E6IA 3VFNA 3TBWB 1E4WH 3L4YA 5A2BA 4YHKL 3WBEA 1UXSB 2PWFA 1HYSC 1HCVA 4FXKA 1FG2B 4DUVA 5FIPA 4D6GA 4P23D 3WXVL 5EZJB 3RWJB 3VXMB 5JDSA 1V7NL 2PW2A 2C8NA 4EUPA 2WMHA 2J7FA 4X0NA 4GI6A 4S0TD 1A3RH 4YQXH 4PJ8A 3ARFB 5F6IB 4M4RA 4NN6C 4G7VH 2A83B 1E1EA 1KGCE 2FJFB 3KZSA 1OAUH 3HC4H 5HYJE 2X70B 2YUWA 3RAJL 3VRIB 1RJZB 3ZYZA 4G8IB 3UR8A 3N0PB 3U1SH 1A0QH 2J88L 1D2KA 2AJYH 4PRWA 3BLPX 3WQ6A 2DLTA 3S2CA 4OLUH 1MREL 1EOMA 1V6UA 2OBGA 3O8XD 2PETA 1I1AD 1FYTE 1A6AA 3FQRA 3EAKA 3BH9A 5K9JH 2IBZY 1FE8L 4TVDA 1HSBB 5ICYA 4K9EC 3W0WA 1DE4B 2GFBB 3MRJB 4CGTA 1KBBA 2LVCA 4MNJA 4NZDA 3C2AH 3S3JA 5DVMA 1G01A 2YDQA 1BVZA 3QDHA 5MI0C 4M24A 4HD9A 4P3DA 4L3CA 3HNSL 3V7AG 3VGGA 2VZSA 4YHLH 5JBFA 3QDMA 1WZ1L 2IAMA 4TVPD 4QY8B 3SDDB 3IRPX 4NO5A 5BS0D 3RAJH 2J47A 4X8JB 3U1SL 3ES6B 2XFRA 4N8CH 1TA3A 3FQNB 5A6KA 4Y2DC 1OGAD 2BVTA 2XNAB 3SCPA 4NWTL 1CXKA 2DQIH 4LSVL 3W0WB 5DYOA 5DWUL 1A7NH 4U1NA 2R2HB 1S7SB 3V2AR 1IC4L 2CGRH 5DMGD 1Q0XL 7FABL 3MV7E 3ABZA 1KBKA 1VGKA 1ADQL 2ED8A 4FHBD 1FL3B 3VRLF 3U0TB 4JDTH 2E7HA 4B7LA 4P2OA 3RKDC 3C87A 2YK1L 4ELKA 3ZQ9A 1H0IA 3B43A 1TFHA 1J0JA 1RJZA 4PJ8C 3AIRA 3BD4A 4ZODA 1S9WB 4LLUB 4ZUTA 1AFVL 5FYKD 2J7GA 4KTDL 3RWCA 3SGJC 2OZ4A 2J2ZA 2JKXA 4YXLH 2DBLL 1F90H 1OIMA 1D5BB 2AXHA 4N8CL 2V17L 1XH3B 5F6HJ 3MNZB 4XZBA 5EZJA 4OJFL 2VISA 1CR9H 1OPGL 2HTKC 4CD6A 3W24A 2VDPH 3CZGA 2B31A 1P4IH 4L8DB 3MPCA 4NKOA 3WNPA 1JNLL 4P2CG 4KMLB 3DNKA 5IB1A 2VYRE 3QWOA 2X1XR 4WUKH 2VR5A 5CAYB 4PJDB 1QRNA 4G8FA 2VLKE 3GJFK 1WQVT 2VAAA 1AY1L 4U1GC 2F54E 15C8H 3MLRH 4Y5YC 2CR6A 5DJCA 3VIFA 4NC1C 2J25A 1INDL 4K94H 4PYSA 1WT5A 5C9KA 4WFFE 3G6JF 4I0KA 5DD0H 1E15A 4EI6A 1HIZA 3O6KL 1KC5L 4XCCL 3OLEA 4UI2A 1GHFL 2V5MA 2AGJH 2VRQA 4WV1A 2PN5A 3FN3A 4YXLL 3O2DH 2PTTB 5JHDE 4G8EA 3HR6A 1HHJA 3FQTB 9CGTA 4LQFL 4M1DL 1M71B 3NA4A 3ULVL 2P42B 3AIVA 4Z6AT 2F74B 1KENH 2IAND 1OAZL 4MA1B 1HJQA 5ENWB 1S9XB 2YPLE 4F7PB 2VVSA 4UNTA 2OMNA 3MBXL 4JY4A 2DSKA 4LRNL 3SE8L 1QPXA 1I7ZB 3LAFA 3WFHA 4OF7A 1YMMA 2BRQA 4JFQA 3M1BB 3E6HB 2VN7A 2X10A 3RGVC 1XFPA 3MRGA 2ORBL 1FVEB 5ADOH 3OTTA 4LASH 4CKQA 3VDHA 1YC7A 4Y4HC 5BV7B 1KGWA 2LFGA 3AI0A 3G5VA 3VRJA 3OR6A 2NT0A 5F1IA 4I2XB 4NNYA 3LDBB 4XHJD 3WL9B 4KAQH 2UZIH 1F2QA 1KC5H 4XCCH 3BLKA 3TYGH 3WL0A 1NAMH 2MNUA 3UYPA 1Q6CA 4U3CA 1EAJA 1JBJA 2E3ZA 4DKFL 2XQBL 4U0QB 3W82A 3ZKSD 3B4NA 3UC0H 4TXEA 5IHUL 4R4BA 5CJ8A 5E7BA 3O2VL 1ZL1A 4N42A 3IDNB 3QPQC 1KCUH 1GC1H 4CU8A 1QLEL 4ACZB 5GGTH 3T4AB 3VFGH 4OCLC 4AEFA 4JFXB 2J6EA 3GK8L 2IPTH 1JGIA 2OX5A 2ZUYA 1YN7A 3EDJA 3CXHJ 3O8XB 3T0ED 4I0PD 4EDXB 1MRFH 4GXUN 2R15A 4U2YA 4KI5C 4Y2DA 4M5YH 4UFHA 5ADOL 4DOHB 4LASL 3S4SG 3G08A 4AEHL 3VGDA 4KRPD 4XPFH 1MUJB 3W5MA 4JQXA 1TVBA 4J4PD 4OGZA 4K7PH 1OSZA 3DV4A 3KXFA 4PTTB 1PIFA 3AHYA 3I6LD 1NAML 2P24B 4I9WD 3TT1H 4PJCB 2BC4A 4Y7MA 4PJ8D 5C0FA 4IIQA 3RY5A 3RM4A 3AIUA 1WZAA 3B9KC 4NKDA 4YX2L 4M29A 1NCDL 4OZFB 4Z7VB 5HHPB 5TE6L 1LEGA 3QUKB 5TQ0L 2VE6B 3HUJB 3QDMD 5GS3A 4PJ9D 2AKRB 1IFHH 4BFIB 1F8TH 5CJOL 4P7QA 2W67A 1PD6A 3OXRB 5DJ2A 4NPYA 1KXVA 5HBBA 4PGDA 3GM8A 2BNUB 2BSSB 5TQ2H 2XKNB 4K71B 1GONA 4PJ9B 5D7LD 2ZKHH 3JBG7 4BQCA 2WMFA 1T20B 3QDJA 3BMVA 3T77B 3AS1A 3P0GB 3WNLA 1FP5A 3AQUA 5D7LB 3BKJH 4N1EA 4AT6B 2JELL 1T0MA 4M48L 1HEZA 1E0VA 4HC1A 3WEXA 4KVCH 2AK4E 5TFSH 1Q1JL 3UTSE 3MO4A 3C5SA 4BK4A 3C60B 5EPMA 2JJTA 2CDGB 1LF1A 3VWKB 5F1KC 3S37X 1BGAA 4X6CA 4OTXH 1BBDL 2IAMD 3RZWA 1CZ1A 2PF0A 1XR8B 4PJEA 5INDB 4YFEA 3D3VD 3MLTB 3EFFA 1DTUA 5D7SH 1WC7B 5GS0C 3NPSB 4XWOC 5L2KA 3MRCB 3V6FB 2YMXL 2BMKA 3WFCH 1H4PA 1IC5H 1H0GA 1HHKB 5E2VH 3PWVA 2R0WL 2MHAA 2ZSWB 1U91B 4XXCC 4X4YA 5JIIA 5K9OB 2HMID 3BIKA 3SJVA 1ONQA 3L4XA 2P5WE 1JWMA 1H8NA 4UV4H 4RFNB 4BKLB 3MRFA 4XP1L 5ABDE 3MLSH 4QNPE 1FZJA 1EERB 5DEZA 4PJCF 2QADB 1EXUB 5IB4A 1NGPL 3QO1A 2VDKL 1N3NB 2ZSVB 2YXMA 4LMQE 2WQ8A 2CIIA 2Y36H 3W9DA 1YMME 3NDYA 1FIGH 4H26A 5J13C 3BQUB 2B1AH 4GKSB 5CP7B 4XC3L 5CGYD 3D2UB 4YAQA 3KYNA 4ZXBD 1A6ZB 2R23B 4Y8DC 5C0IB 3DMMC 1QRND 5ABHA 1E0WA 4U1SB 1VFUA 3IU4H 4JFED 3T4YB 3UTPD 3L4WA 4AZ5A 1EGZA 1CT8B 3QEGH 2O5XH 2WLYA 2YBRA 3LQZA 3P0YH 4GS7B 4MJ6B 4XNMA 3N1AA 1NUNB 4XP1H 4WHTA 2C1PA 3TIEB 4V1DE 5E1HB 4IIQC 2IBZX 5KBNC 3VGFA 5J6GA 4F57H 3WL1A 4JFHE 3W0KA 4AZCB 5T5FL 4HOXA 3O81A 5DT1L 1IV8A 2R29L 4MCZB 5FYLH 3AMCA 2FJHA 1HYSD 1W72A 3LKQA 4FQ1H 4EAMA 4J3WA 3HE7A 3SGEH 3PP3H 5J6HA 2DDQH 5HGHB 3EYFA 2P8LB 4JO1L 3GSWB 3L3HB 1QUNA 4GSDH 4PJGB 2H3NA 5C07A 1V3MA 1JHTB 4QT5B 5C1MB 4BQ8A 2ZOKA 5I76A 2NZ9C 2CD0A 3OJMB 3ZZ1A 1VFFA 1YNLH 1EAPA 5HYJD 2C3WA 5KS9B 1HH9B 5CJ5A 3RVXC 5EU4B 2WWKT 1FH5H 3MJ7B 4QTIL 1JV5B 1C3FA 5IQ7L 5IMMA 3FMGH 4JHOA 2A6JA 4AD5A 2W65A 2BZDA 3ZKXB 5DRWA 5DHVA 5DZNA 3UZVB 4LAQH 3QHTC 3QI9B 2XOTA 3ZMRA 3QNYB 1ZANL 1T5WA 4LIQE 3KPMA 2FEDC 2L0DA 5AWNH 3U36A 3O6MH 1A7QH 1UG9A 3U4BH 3RVWC 2PWGA 3S6TA 1PVHA 1IVLA 3ZLQC 4LHUG 1S5HA 1RHFA 2DQTH 4L8CB 1DBJL 2X44D 3LOWA 1B0GA 2W9LA 4G3YH 3LD8B 5E2TL 2X6MA 4J7RA 5DVKA 4NO2B 3A4AA 3IXTB 5JR1H 1YJDL 5I8KL 3S5LA 4BFGA 1LE5A 2RHEA 3IXTA 7A3HA 3WQ8A 1G84A 1RPQA 1S46A 1UH3A 3IETA 4P2YA 2HRLA 2Z31D 3NABH 4BYHA 3VXPB 2YLAA 5HVFB 4FTVB 1RUQL 3IS0X 5C6PB 4L8CA 4UFMA 1GZPB 1H3TA 3RWFA 1XHGA 1KTDB 1AKJD 3PUCA 32C2B 3VW3H 1YMHB 4O9HH 1ZAGA 2DTMH 1NCCL 1ZANH 2VUOA 5IMLB 3O6ML 1WGOA 2QSCL 3QUYD 2NW3B 4J4PC 5DHVB 5TF1H 5DRWB 1OT2A 1AGCA 5HHQB 2VZUA 1BAGA 5E6ID 2VDQL 1J1PH 1ZT1A 2FB4H 3IDYB 3THDA 4KJQD 1CLOL 1JFQL 3TNMA 4AC1X 3BZFA 4JFUA 1JHLL 3H9SB 5E2TH 3D0LA 1BEYH 4L9LC 5IHBA 2GCYB 4BSVA 2HT3D 5EB8A 2EIBA 2Q1EA 1UR8A 2O61B 3NABL 1AQKH 4GAJH 2OSLA 4XBEL 5GZOC 2H3NB 4PJGA 4NZUH 4Z78B 3LEYH 4N0YH 3PABA 4O9HL 2X4PB 2Y5TB 2I9LB 4JRXE 5GZNC 3U4EA 5EA0H 5HGHA 2QSCH 5I1LA 5EC2A 4OD1L 3SKNA 1FNAA 1V0KA 5KSBF 1I3GL 3WELA 4D2NA 3SE3C 3GZKA 1B0WA 1M6OA 4LDOB 4Y8AA 3S3SA 2CKRA 1S5IH 2APFA 4YK4C 3BP4B 3RZCC 3TZVB 3CSGA 3HAEA 4DZ8B 2I9TB 1WJ3A 3H7BA 4BUHA 2OL3B 1BEYL 5J6GB 4PBGA 3GSRA 4HWEH 1WWAX 1Q0YL 5CFHA 3NOIA 4HQQL 1CXEA 4U6YA 1E6PA 2P7TB 3SGKC 3KLHD 1W0VA 4NJ9L 2C3GA 4U1SA 5BZDB 1JP5A 2EJ1A 2SEBA 3QYCA 2BP3A 5DMYA 3TYFB 3FTGA 3FXYA 4YAQB 2BHUA 3GMLB 4X4XA 5FOBB 3ARXA 3DYMA 4XHJC 2Z9TA 3HNVL 4JM4H 5DVNA 1FHLA 5SWZD 3WIHH 1XH2A 1FNSL 2J7DA 2VKXA 1KN2H 3T0WA 1QO3A 5DJ6A 3GGWB 4XVJL 3RWHA 1LHZA 1DFBH 5EO1B 5J9PB 1EGJA 1S5IL 2DYPB 3T3PE 4KJPC 4M7JH 4FQXB 4MSWB 5SWZA 3E2HB 4MJ5B 3O3EB 1MFBH 3PL6A 4ZTPH 4TNVK 4JHAH 3W6MA 5D9OA 1AIFA 1AE6L 3RRQA 1JWMB 5ADPL 1ZHLA 4Z7WA 3HG1D 5BS0A 3CUIA 3AGVA 4NJ9H 3KPOA 4XNZC 4X7DC 1GJIA 4OBSA 3GMPB 4HS8H 4YHZL 3IJ9A 3G5ZB 4XPTL 1ZKAA 1LO3L 1N6VA 2APBA 3PF2A 2Q8BL 5DJYA 4L8SC 2BVUA 3I6KB 3TH3T 1GOQA 1BQLH 4PRPD 5D1QD 3SDXF 1ZJBA 4GZJA 1KN2L 5D9NA 3TBVB 3VXRA 1MIMH 2EDBA 1J1OL 2HTKD 3CPLA 4ZUUA 4HH9B 3P4MA 1AH1A 3L6FB 4UNUA 3MR9A 3LMYA 4JFDE 1VGEL 2HJLB 3QJFA 4W81A 2DMKA 2ITCA 4Y0GA 4DKAA 3QDAA 5HDBE 4H8WC 3C60A 2C7UA 1GOOA 4ZXBA 1OCWH 3HR5A 5E6IC 4CW1A 1MFBL 1JZ6A 2EIDA 2G9HA 3OPZL 1FGVH 2B8OT 1AHWC 4PJXF 2X40A 4I4WB 3IFLL 5ITBL 3B9DA 2VCCA 2JFEX 3B9KA 3W2DH 1QVOB 4HUUA 2C3HA 4MB4A 1OD7A 3W0WE 4YHZH 4OOUA 5JZ7D 1NEUA 5ISZD 5L0QB 5JIPA 2JF7A 3KR3L 1BREA 3SOBL 3IAQA 5LCVH 3T1FB 4AIXA 5GNZA 3TIDA 2BNUA 3MZTA 4WI2A 3RTQC 4P4KA 1UR4A 5DA4A 1SY6L 1CDUA 3GJFH 5F9AC 2XZQL 4NYLA 1MIML 1VAHA 3MV7D 4R90H 1X5YA 5BQ7A 1KGUA 2CLRB 2Y23A 3RX7A 1X1NA 4OCXL 2G3IA 4OUUA 1QNQA 3MA7A 2DSZA 2R1YA 4EOWL 3NCYP 5TE4L 3L3IB 4HS6B 3DVNB 2J12B 5BXPA 3HI6H 4PJXA 1UADC 3QOKA 3EJJX 1NFIB 2J79A 1PQZA 2WBJA 4LX4A 2EXYC 5JW3H 2EDQA 5GNXA 1MRDH 5FYKE 3MV11 4CL7A 3AXXA 2ZUXA 3MROB 4HFWB 1LL4A 3QSKB 3N9GL 4HIXL 1SMOA 3PV6A 5TF0A 1WZLA 3KR3H 2Q20A 4BZ2L 3GXDA 5D5MB 1YEKL 4YUEH 4PRHA 1AGBB 5HHOD 4AH2A 5IOPB 4PMXA 1E5NA 5DS8A 3ZKNC 4MLIA 4I5BB 1FSKC 3CJJA 3DWTA 1X6LA 5ID0B 3FFCD 4JFXA 4GIAA 4GINA 1TIUA 4JFFA 4BH7B 1MJ8L 2DQGL 5E99L 3QXAB 2YXFA 3VFRA 1T89A 5FYJE 1DQLH 3R06B 1V3LA 4MMXC 3MJGX 3POHA 1QW8A 3J8F7 4UIKH 3S36L 3RL2A 4JGUA 2EICA 4LDLB 4AY1A 1BIIB 1KWKA 3QEQA 2E9IA 1XGYH 1P4LB 3P9LA 1JF5A 4NZRL 4U1HA 3O3AB 1UWGL 5C2BL 4Y19D 2O5YH 4LHUB 4UBDC 4H5SB 4LARL 1B88A 3RVVC 4WLCA 3RVUD 1FL5B 1MHCB 4G9FB 1T1YA 2D7QA 2NMSA 4LF3B 1BG9A 3MV8D 3QNZB 5GGVY 1FVEA 1YEKH 4YUEL 1WCBA 1DQQA 4NN6B 2VO5A 4KTEL 2G60H 2XN9B 4NQSB 4PB0H 5TH2B 4JFQB 1D9KD 4PGZA 4GRLC 1MH5B 2COQA 4GBXB 1R3IL 4LGSB 4M80A 4GW5A 5K9QG 1LE9B 4Y89A 4P2QA 1ZGLB 5HYSB 1MCOL 3UTPE 1RUAL 4L3EE 5D1QC 4O02L 3D39A 5E00A 2B5IB 3HPJA 5F96L 1G7MA 1UM4L 2JJTC 3G6AA 4LOUC 1EBPA 4HUNB 5I2IA 5D6DA 4G7YL 1X5LA 4I3RH 4V1DD 4G8EB 4JHWL 2PTTA 1TTGA 1XD0A 2ZXAA 5C70A 1AD0A 3KPTA 2NTFA 4NUGH 3S36H 1XYZA 1FRGH 5DJZB 1XGYL 3UJTL 1ISWA 5I75C 4NZRH 3HPLA 2XTLA 3OKEA 5A2JH 5DHYB 4DVBA 4FRWA 5E09A 1NUFA 4TUJA 3NSMA 1H2JA 3V0WL 1BQHA 1BZQK 1A7RH 1BZ9B 1P2CB 5CEZH 3RVTD 2VAAB 3JTTA 3GMQB 2X2YA 4FA8A 1U8OB 2G60L 3QJHA 4RWYL 4DUWA 1VKXA 3QP3A 4OM1H 8CGTA 4LCUA 3PDGA 4UZSA 4HFUL 3KS0J 2XPGB 1MCOH 3KLSA 5FKPB 2ATPA 3ZE1F 2VISB 2WBJC 3VGHA 2V6HA 4PJ7B 1MQPA 4ZUVB 3WF2A 4S0SD 4OKVA 5GGSA 3G5YB 3WKZA 1D5BA 3S34H 1BJMA 4CD4A 3O45B 4NUGL 4M7LH 5I73B 5FECA 4ONHB 3EDDA 2CIKB 5E56A 4ZUTB 4U6XB 1E27A 1FFNB 5DK0A 2FH6A 1K8DB 1RP8A 3F12B 3I6LE 1FG9C 2NY7H 3ARFC 1TJIH 3PZGA 3WD5H 4F7TA 4KRUA 4W4OC 3HHRB 2ZCHL 1CK0H 4X6DF 1BECA 4K94C 4MDIA 1OGSA 1H41A 5DEGA 3KL3A 3ULUF 2VZ3A 3PWUB 1GOHA 5TD4A 4MD0B 3GSVB 4OCMC 1ITCA 4OD3L 4H1LA 4FZEL 1JL8A 3LKPA 4ZFGH 4GRLB 3IDXL 2R2HA 1TMCB 4U1NB 2A6KA 1HQ4A 3BZEB 4BA0A 4HWNA 5I1GH 3H3PL 4TUKL 4Y4KA 4N5ED 5JQ6H 2CK0L 2FATL 2DRUA 1ND0A 1S7RB 4X8JA 4NOFA 3GB7A 3DMMA 4ZXBC 2IF7A 1NFDA 4OCSH 5A40E 3CK0L 4IISA 2WC3A 2WUCL 1TJIL 5BJTB 5IEKB 3ZDXE 2ED7A 4KK8C 1ZXQA 4UOJA 3GHEH 5TPWL 2Y07H 5M95B 3PZMA 5I15L 1DJSA 5IBUG 2J6EH 2DQHH 4PTUA 3WD3A 4R7DA 1QQDA 3C9NA 2X4SB 4EN3D 3PZUA 3H9HA 4DKEL 2OCFD 2HKHH 4ZAKB 4OD3H 3K8LA 4IRZH 4FZEH 1I1YB 3BKCH 2IBBA 5D2NC 1EXPA 2DQDL 1A5FH 4R2GB 1EBAA 1PZ5B 3DROA 5T1LA 3WMCA 1MHPH 5GGQL 1KCVH 2JCCE 4PRNA 4X80L 2NY0C 4F7TB 1DEDA 1W2KT 2R4RL 1WWBX 5B21A 1D3CA 3RPIB 3ECQA 5IHZB 5KVGL 5HI4C 4YE4H 4L4VB 5D9PA 3CFCH 4U6XA 5CLWA 3KAAA 2AQ1A 3CK0H 3SGDI 5I8OH 5FECB 1LG2A 2OK0L 3QG7L 5IIEA 5EU6E 4UOZA 2BVQA 2GUOA 3MYZA 4HJJH 1B2YA 2BSTB 1T2QH 4YZFE 1J88A 4F9PA 1N5YL 4ZFMA 1QI5A 1IL1A 4F9PC 5CD3A 3RWJA 3VXMA 4G43A 1VSCA 4OAWB 1FNHA 4A6YL 4S3JA 2BNRB 2J6EL 3BISA 5A6BA 4HS3B 3QG6A 1KGXA 4QHMA 1NMAH 1YMMD 1Q9KB 3BXWA 2YUZA 2ERJC 1MFAL 1BZ7A 2DQDH 5FF6A 1DP0A 3L4ZA 4TTUA 3R1GL 4MGXA 3GMQA 2NY3B 3ALXA 3U46A 4FZ8H 3L5JA 3QIUA 4I18C 3FONB 3BHBA 3EZJB 5A94A 1EO8L 4PG2A 5T33H 2ARJQ 2HRPH 2MQ3A 4YFDB 4QWWC 1N5AA 2R8SL 3GSNL 5KVGH 3LMJH 2AK1L 3KGRA 5AUMA 3MRLB 3KLHC 1IILE 2EDYA 2EXYD 5IQ9A 5C2UB 5AYBA 3WH9A 5CZVH 3OQ3B 1Y0LB 3VMNA 4PJEE 4WI6A 5DC0A 2IPUK 1N64L 4WY7H 2HFGH 3SCOA 3Q3GB 5AYIA 4WW2A 4X8XA 1LO0H 4FFWD 2PYFA 1K6QH 4JFHD 4HV8A 4HBCL 1JHKL 3RO8A 3OKDA 3QUYB 4FABH 1TETH 3BW9B 2VDML 3O41B 1CFVH 3ARTA 5JXAL 1EGJH 3VWJA 3T0BA 3MODH 2EKJA 3FOLB 1WCBB 4MA7H 2Z93A 4YDKH 1HX0A 1MW3A 3VXUA 4CCCA 3LQAL 3QNZA 3H6JA 3LEXB 1MEXL 1F4WL 3T2PA 1HKFA 5D7JD 4TSBH 4J12A 5DMIL 1XSIA 4N5UA 4DM2A 4BELD 3DURA 2DWDB 2Z1KA 2ZUMA 1C93A 5ERWB 1BLNA 1VADA 1DDHB 2A73B 3MJ8A 2Z4QB 3BXNB 3V7MA 2YL6A 3IKCA 3KE0A 1G0CA 1LO0L 3DGGB 5F7YC 2D31A 4HBCH 1JHKH 5D8WA 3CUHA 3H42H 3QB7C 5CZXC 1I7RB 2UY2A 4ATWA 3DUHA 4P48A 2CITA 3BAKA 3NCCB 4YGVA 5IMKA 1YNTA 4X6BB 5C0CE 2H6PB 4OLZL 5E9DE 2ADGB 1TJGL 1L4IA 4PRHB 4AH2B 5E8PB 4GAYB 1A1OB 4OZHA 4YDKL 5KSAB 2HP4A 4BQ2A 3O4OB 4RAHA 1BOGA 3CDGA 3FO1B 5FD0A 4S10A 2P43B 1C12B 4PMQA 3CFBA 3SCNA 4XTRD 3IFOA 2JJSA 1MAMH 3ZO0A 1CFSA 5KSVA 3TBTB 5HI5C 1NFIA 3ZT5A 4PJXB 2AJUL 5FO8B 3G6JE 4JQVC 3D9AH 3ECBA 1E72M 5JHLL 4ODTL 4JQIH 4OGAC 1ZMYA 2V2XB 3R8BB 1E6ZA 3ZR5A 2J7EA 2NSXA 3T0AA 1BGXH 2V5TA 4M6OH 3PWPD 2ZWZA 1JNHB 3ZE2F 4OLZH 2FCBA 1AD9A 2QADC 3AZRA 5EZLA 3BSZH 2IH3A 2GJJA 4LVHC 3OGVA 3EYOB 4I77L 1AVAA 1OD0A 5ILTL 2EH7H 1HIMH 4OFDA 4LKCA 2VLRA 4WEBL 1QVOA 4HUUB 1E9LA 1TJHL 3OLIA 3BFOA 4FXGA 4NHUA 1X5FA 3SDCA 1GC1C 2W0LA 5EWIL 3SDCC 5BZWB 3C09B 2GK0B 7TAAA 4W86A 1RV6X 4ETQA 1BJ8A 2G9HB 1KEGH 2AJUH 3PTKA 3BAYA 2P8MB 5ECUA 4TULL 4ODBD 2C7UB 1R24B 1KIPB 2H2PD 4ODTH 2C5DC 3QUZD 2HJLA 3QJFB 1WIOA 5EULV 3NIGE 2V3DA 4JFYB 1CF8L 5HHOE 4HH9A 4KHXL 1OTUC 1PLGL 3WQ5A 3TBVA 5T3ZL 1JDAA 1EFXD 2R2EB 3PHAA 5HDRA 3M45A 3QUZA 5E5MB 1S8DA 2ZUNA 4JRXD 4XNYL 4RRPG 1SJVA 1CIDA 3B9EA 3HKFA 3G5ZA 4UQ2A 3RUGF 4WIWA 3CLEH 4HZ8A 4KHTL 1HYRC 2F53B 4LCIL 3S97C 4JZOB 4Z0XA 5EWIH 3IJ7A 3A3HA 3ZL4H 4YWGL 5I1EL 3C5ZB 4Y19E 1C08A 4QYOA 5KJRH 1YEHL 2NY5L 3O3EA 4A6YA 4BSJA 4WFGE 3AYSA 3K2UH 5I1DB 5TGBA 4P5TA 3L7FA 2WIMA 3MLYH 4RE2A 2ZX5A 5MEOA 2JB6B 3GHBH 4DN3L 3WFEL 3X11A 3CVHA 2NQCA 1RUML 1F4XL 3GRWA 4X7SH 4XVUD 3T0DA 1CLZL 1OTSD 3P4OB 1T66D 4GLRI 4W8BA 1P7KA 1VFOA 3VH8A 3DPBA 2ZUSA 4BK5A 5BVJB 2AI0L 2J4WL 3CPUA 1J11A 2OXGA 2RFXA 4YZFF 2OSYA 5L8JB 1DLFL 2JIXA 5IVXA 4D0BB 1CZ8L 5DD3L 5C0EB 3ZL4L 1JDCA 3DV6B 1XF4A 1I8LC 5JXED 3ZYOA 5M5DA 5DO8A 1YEHH 2NY5H 4WUUE 1LK2A 1NAKH 1NGQL 2FX9H 2QSQA 2ED9A 4MXWH 4WHYH 1CYGA 3O6FB 1QHPA 5ALCH 3BP4A 4P99A 3TZVA 3ZDZF 1QSFA 2YBUA 3GMOA 1Y6MR 4U4BA 1PEWA 5JDJA 4P3CH 5TDNB 2YD4A 4KPHL 1Q9LB 2DI9A 3ZDYF 5T5NG 4CU6A 3NGBC 2DMBA 2VL5A 3JVGA 4WCYH 5IFHH 4JJ5A 3SJVE 3MFGB 4Z7VE 3F6LA 2PYEB 1R5VB 4GS7C 4PMDA 1CLZH 1UWRA 3HC0A 1KJ2L 2YS4A 3RDKA 3VWKD 4MAYD 4Z78A 1P7HL 3L3GA 1MCJA 2Q76A 1XSJA 3NCFB 1RZFH 4NRYA 5KVEH 1Q6GA 4GXPA 2ARJB 2O61A 2J4GA 4XNQA 2PWHA 2IMNA 3X12A 5E1AA 4IRJA 4X98B 1L0QA 5GRVL 1PX3A 4MXWL 2YKLH 3ZM8A 3H9SA 3B3IB 4ZFOB 3CFDB 4RWHA 4ZO6A 1BQCA 1YEJL 1ES0B 4MDJB 4KVNL 4HK3J 2V5CA 1TCRA 4U1KB 4QXUH 1DWAM 1M4KA 4P3CL 3BZ4A 4R26L 1J8HE 4PJAB 1H8OA 3DSFL 4KUZL 5IFHL 4Y16A 4UBDD 4ELMF 3EJZD 1INQB 4LAJH 5ISZE 1GOIA 4Z7QE 4S1QH 3BIAX 1N0LA 4JPVL 4MD4A 4OLYH 1YMHA 1KJ2H 1MLBA 3GSQA 4GKLA 1OAKH 4Y1AA 4XPBL 3AAZB 3RWFB 5BO1L 2I07B 1ZS2A 3Q0HA 1FFQA 3SHSA 5BV7H 4Q6IA 4XBPB 3QGVA 4W6WB 4J6RH 4KKCD 5E03A 1TE1A 4OQTA 2WLZA 1I7TA 5BOZG 2DBJA 1NBVH 4X6EA 2EEDA 4K8RH 4DQOH 4JFPB 3APGA 5FOJA 3DETD 4H25B 3HNTH 4F8XA 3T3ME 4KVNH 1B0IA 1KTLB 5EFFA 1ODAA 1AR2A 3WH7A 3JTSA 1HF6A 3GH7A 3PV7A 4NWUL 3W53A 4HIIA 3TBYA 1LP9F 2YHGA 4GG6B 4DWSB 4JM2A 3W28A 2EH8L 1BD2B 2OYMA 2BNQA 3GSXA 2X4TA 3MLWL 3WXWL 5DJXB 1XIWD 5HGAB 4PB9L 3V8CA 2B20A 3MXWH 4XPBH 4FG6C 4TSCH 2VAJA 3V5DB 4HJ0D 3QHFH 3TA3C 3SE9L 3MJ7A 2BSED 3BGAA 1JK8A 3CFDA 1KLGB 1QP1A 3MOBL 4KKAC 1K2DB 4JRYE 3MGTA 4XC1L 4GG6E 1CNVA 1UR1A 2FGLA 3D3VA 5J1AA 3QRGH 5E1AB 1NH6A 2X89D 3GKZA 4K8RL 1RI8A 3SKMB 1U8MB 4PEEA 2A9MH 2XI9A 3SDAC 2P45B 1QSFE 2X1QA 4JDZB 1UEMA 3AXIA 3BEVB 2BY2A 3KJ6H 4WSJA 1UA7A 5I1AA 4OJYA 3E2HC 2VLJE 3ILQD 5HVGB 4QRQB 5ESAA 3L3HA 1G9MH 1JZ4A 4FFYH 2R9HC 3RHWF 4FN0A 4X9YA 1G0XA 1YQ2A 4KJYB 2HLAB 2R4SH 4JJ5B 1GJWA 4K7PX 4CVXA 1GQKA 4P4RB 1OM0A 5EZOL 4ZS7H 4KQ4L 3PGFH 3TV3L 2F19L 4PRDA 1CGTA 2AVGA 2RB8A 3K8KA 2VABB 3VDBA 1QBLL 1A2YB 3O6FA 1CDYA 3OB0H 3VFUA 3WIFA 4JFOA 3CZLA 1YPZB 3KPRA 2F58L 2R39A 1PPIA 2NY3D 4OFIA 5JOFB 3KYKL 3PP4L 4P2RE 2YBRB 2RFXB 43CAB 3QR2A 4F66A 4NN7C 4P2QE 1P7KB 2VSDA 3KJ6L 4PD4J 2CDEB 3FT4A 3PP3K 1QNSA 5D2NA 3ALWA 4DFIA 4V2XA 1NBZB 3K7UA 1BLIA 5ICZA 1KPRA 4NQDE 1VJSA 3RZCB 4JQVA 3GI8H 4ZAKC 4IRJC 3HRZB 5KVFH 5EUOF 1BYAA 1BQSA 4UT9L 4D3CL 5F7EH 3TN0B 2UZXB 4JJHA 4M1GL 3UR7A 5MENA 1YEDB 2CIIB 4QRRA 3N18A 3D48R 1UT9A 2XVNA 3TA3B 1CCZA 4TSAH 1U33A 3F4VA 3BKYL 4EZMA 4A6YB 5A6LA 2A38A 2EDEA 3F5KA 5FCSH 1U8NB 2AOSA 5IGXH 1N6QH 1NCAL 1GPOH 3DC0A 1KG0B 3GBML 5K9OA 2NNAB 1EEQA 3CU7A 4RX4A 1U91A 4KU1A 5EU7C 4QEGA 4ZOBA 2YJQA 1HJSA 4PY7A 1XIWB 2XTJE 3V6OC 5IWLC 4UQ2B 5F44A 3S98A 4N1HB 1U3JA 5E9DD 2D4FA 2IFGA 1HKLH 3MRCA 1JGEA 4L3EA 4UDUA 2IXUA 5LQBH 3KLAB 1DEEA 4F9LC 4PJHA 1NWSA 2IANA 3QIWD 4IJ3B 3HC3H 5A16B 3QRFM 4NO3A 4KKLD 5LWYL 2ZX9A 1NKOA 3ALPA 1R24A 4AD4A 1T0NA 5KVMC 1AKJA 1YEGH 3QFDA 1IEAB 5EZIL 1FAIL 4EDWH 1MAKA 1P4BL 4OZGB 3QEHA 4XP9H 4NN5B 1U95B 4I3SL 4KRLB 2OR9L 1E6NA 1RIHH 4FXGB 3NUKA 4I0PB 5KZCB 3MNWB 5DVOA 4YJZL 3SDAD 3ZTNH 2K7PA 2I27N 4LK4A 2VJXA 1WAAA 3HB3C 4PJDE 1PX4A 1S78C 3IAGC 4LU5L 3ARBD 2F54B 3OXRA 2D0HA 3SUTA 4NOBA 3G6MA 4HOWA 4K68A 2DLFL 3ARWA 1VDGA 3C6LA 1KFAH 3ISWA 3K4DA 4RIRA 3IJ8A 3F7QA 2BK8A 3BPLC 3OAUH 4O2EA 1QZ1A 3LPOA 3RIKA 5L2JA 1EK3A 4FTVE 4XCEB 4KV5E 1E4KA 4POUB 5FO8A 4EDWL 1BG4A 1YNKH 2XJ7A 1Q94B 2B0SL 2QQKH 2FR4A 4X9HA 4XP9L 5KSVB 5D6CA 5JO5B 5I18L 3VXRE 5BXSA 4GPNA 4M62L 4ZFFA 4GRWF 1P6AB 3RJXA 3FO1A 2I24N 1BVKA 2VITB 3D25A 4LSTH 2YD7A 3PWLA 5C09D 2FX8H 5HVHB 2Y2WA 5IM7A 1A1OA 4GAYA 1CFNB 4P7OA 4AZBA 4G42A 3BP7A 4EDXA 1HWGB 3PJSB 5JLZA 2YRLA 3O8XA 3TJEH 3VVGA 2OTWA 3EBAA 2WW5A 2Z8VC 1R6VA 2CKBH 3W4RA 4ZNEE 3LDBC 4KK5D 1E6RA 3WD1A 2AQ2A 1HSAA 1V6XA 1FHGA 5DHXB 1U8PA 3V9FA 4UFJA 3NN8B 3IKCB 5EBGA 1MCCA 1N59B 2VCBA 3PIQA 1J87A 3IANA 3MRNB 1T04B 1ZSDB 1X4XA 3DX6B 1UZ6E 3DURB 4WFGD 2B0SH 1DHKA 2R2CA 3V4VL 3U0WH 3MV9D 1R3KB 2OLDA 1IM9D 5I18H 4NNYB 4M62H 3O0RH 2BERA 3RUGB 5F9OL 2Q3ZA 4ODSH 1OTSC 3EFDL 1DL7L 2DD8L 3OKKA 5HHVL 3SKJL 2Y6SD 3TVMB 3KPPB 3BRDA 2Z93B 1NFDF 2P5ED 4FQ2L 1ORQA 2Z92B 5IBUB 3VWJB 3C8KA 5D72L 4JY4B 3BW9A 2X4QA 1WZ1H 1TZ7A 2W59A 3DIFA 1G6RB 1D6VH 3BO8A 2WINA 4DM1A 2CUMA 5JXEC 2DGAA 4I0PC 2PWDA 4AZ7A 3IFNH 5GGVL 3S6CA 2VURA 3JV6B 2YSSB 1GIGH 4Y4KC 2J1KA 3OWEA 2AMGA 4FQLH 4FMFA 4WV1B 4KKLC 2WBGA 2VIRB 4QO1A 5DFVC 4JFDB 5IEHA 3QBTB 4MMZC 2Y24A 3BAIA 4B9ZA 4S2SB 4OQ1A 4KROB 5A6MA 3P11H 5D1XA 1EH9A 5EOTB 2J8OA 1A9EB 4ODSL 3FONA 3SKJH 4JQXC 3ARBB 5I6XC 4U49A 3TH4T 4FLSA 1BPLB 4HG4J 3U7WH 1SYVA 2YK1H 1IT0A 4FQ2H 5A8OA 1A4JB 1XGRA 3LHPL 3MCLH 4L5FL 1E6OH 5IB1B 1QBMH 3FHAA 1FIEA 4JZNB 1MI5B 1Z9SA 3UO1L 5CSYA 1G9NL 4LL9A 4TUOA 5C0CD 4UR9A 4OAWA 1KOAA 5E8NB 5E5RB 1XH3A 1QACA 5CINH 2V17H 4F9DA 3LH2H 1RIVH 1WWWX 3AHXA 2WW8A 2BVQB 3NFNA 1N6UA 1RZKH 4RRPA 4JGMA 4KI1A 4EK7A 1WNOA 3DXAA 4HKZA 5IHZA 3O6FD 1RZ8A 4WUKL 1Q9OB 1VEPA 3EJZC 3UDWA 4LSPH 2APTA 4UQAA 1QFUH 1WV7T 3CH8A 1YY8B 1D5XB 1J8HD 3ILPB 1FL3A 4DGIL 1AXTH 2IG2H 1OP5K 2A3CA 5FYLD 5B4MD 1WK0A 5DD0L 4L5FH 1RD6A 1CIUA 3FRPA 1MJ7L 4ZAKA 5IFAH 3V4UL 4DK6A 3MRQB 1S7SA 4KKCC 3PWPE 1QQDB 3RU8L 1G9NH 1FV1B 4EE9A 4QCIA 4FQQB 1PZ3A 5CSUA 3AXLB 4GG6F 5CINL 1OAXL 2CQVA 4WWKA 2MMXA 5DO2C 2Y8KA 1FNEA 1KB5A 1VESA 1AQHA 5EBLB 1P1ZB 1KELL 4LEXL 4D6CA 1JPSL 3IFPB 1E3XA 3L7EB 4NO5B 3N06B 1T66C 2IAMB 5DGQA 4BSWA 1KJVA 1YEEL 2NZ9D 3VFWB 3MV7A 1TTUA 2FZ3A 1KCRL 1P1ZA 1E6QM 4P23B 1T3FB 2WVVB 4J3TA 3OB0K 4Y4KB 1KF9B 4WHDA 3DHJA 2A6DB 5FV2A 4DGIH 1HQ4B 2MJWA 2A6KB 3BZEA 5F88B 4QCIB 1FV1A 3MYJB 1DBBH 1MWAL 4M7ZB 1MAJA 3D3AA 3BT2H 4MCYB 3BH9B 4KRPC 3V5HB 1ZGLP 1EMTL 2XQBH 3ILPA 2Y9RT 4HC1L 2BY3A 4PJIB 4ZFOL 4JRYD 4LIQH 4L4PA 1KCUL 2X41A 4PR5B 1RZ8B 4P0DA 4YDIH 1MCFA 5E2UH 4ZDHB 3E0GA 1U2YA 3JWOC 1ZT7A 4ONHA 3LPFA 3CUFA 5DRZA 1RMFL 1OINA 3NFNB 3ZJ6A 4RGMC 1J7VR 4M5YL 3IAPA 3MJ9L 3TFKD 2BV9A 4PJ7A 4K7FA 3EYVB 1NDMB 4ODVH 4OZOA 5SWSD 1JXJA 4XPHL 4E41D 2VOTA 4K7PL 4YGAB 4V28A 4QLRA 2CKNA 1RY7B 2FGWH 3SQOH 3VFNB 4JZJB 4RMWA 4AD1A 1YECH 2BNQD 3EOBB 2X4RA 3TT1L 3KPNB 1PG7W 4LLWA 3MBED 4RFEA 2N56A 3ARBA 4JM2C 4HC1H 1NCDH 3EO9H 3QDGB 4QRSB 4XP4H 5C08B 5DR5H 5DHYA 4YDIL 5E2UL 1IFHL 1ZEAL 2VXVH 4XMPL 1F8TL 4XWGH 5FHAH 5IEHB 4K3EH 4F7EA 2ICEB 2JTDA 3PQYE 4OZ4B 2J78A 5IROA 1RMFH 3EHBD 4B3KA 2O9RA 5H94B 3Q5TA 2WSKA 1EJ6A 1JUFB 3JV6A 1JF6A 3MJ9H 1CXHA 4R8WL 3G6AB 4UIMA 4XI5C 1Z9OA 4Y2OA 5GS0D 2O5ZH 3DIFB 5HDQH 1U8JB 3QWQB 4XPHH 4P2QB 4J3XA 1ZGLA 1GOWA 3BKJL 3SQOL 1MWAB 2QKIB 4GBXA 4XCNA 1W1TA 1K8IA 3C8KB 4KDTA 3SURA 2XN9A 1DQQB 3F7PC 4NQSA 4CNIA 2LV4A 4UU9A 1DWHM 3KVQA 3WN5B 3VM5A 4M82A 1ZTXL 1HT6A 2GTZB 4WF7A 1CGSL 2ZJSH 4G9FA 1FL5A 1MHCA 1T1YB 3EO9L 1DR9A 1I8KB 4X0VA 2W5FA 4DW2H 3MLZL 4ZO7A 4ETYA 3UTZA 1ZEAH 2VXVL 4XMPH 2DH3A 3O3AA 4S1DC 4LPVA 4PMVA 3QQ3B 3RZCD 1O7AA 4HPOL 4F33B 1WDPA 3SUSA 4KDVA 4P57A 3ZKMC 4LVNB 4BFBD 3DX8B 2HT4C 3RKDD 1Q6FA 4U2ZA 3R06A 1G9MC 4Q0XH 3QPXL 1S7WB 5INCA 1YDPB 5DVLA 5E2VL 4K23L 3GO1H 4YR6A 5HHNB 3RY6C 5A2IH 2IPUG 3PZNA 1LO5B 4XCFL 6FABL 5IW6B 4WK9A 4K7PY 5JLZB 4UV4L 4E8DA 1JF1A 4WUUA 4NGHH 4YXKL 5IOPA 2WMPA 1CFNA 2R56H 5KANI 5MEQA 4LNVA 3D25B 5BRQA 3ZKXC 5CMAA 2XXCB 5IB3B 4HFWA 2QF8A 4ZFFB 2H2SC 2VDKH 2KQMA 2E3VA 4MNKA 4XXCA 4DCQA 1NCBH 4XX1G 1PQZB 1A64A 4CD7A 4HPOH 4KH2A 1FIGL 4JFEA 3KHOA 3BJLA 3U30C 4POZC 1BFSA 1I9RH 2BOCB 4L1HA 3QA3A 4O2EB 5IF0A 3SEPA 2OJEA 3FZUD 4QRPD 3G6DL 4JO2L 4JG0L 4E5XB 4P46B 4XRCA 1WBXA 3IU4L 5EOCH 4X99A 4LSUL 3QNXB 4GBXC 5I66B 4P4KB 1BJ1H 3QCUH 2N1KA 1HCFX 3T1FA 5FOOA 1A6WH 1H3WM 3DECA 5GZND 2IC2A 1IQDA 2BNRE 2HKFL 1OW0A 2QMJA 4M1RA 4HUVB 1YYLH 4XB3A 3CFKB 4QXGL 2AV7B 4JKKA 5BV7C 5ITFA 1KWGA 3W11D 5F71A 1EUTA 4NQEA 3DVGB 4G80A 2CO7B 3AU1A 4Z2LA 1NANH 4WTXA 4EXPX 3QFDB 2DDQL 1KPVB 1BMGA 2Y5EA 3NTCH 3DX7B 5IT2L 3WH6A 3FQWB 5DHVH 1BYBA 3HMXH 3VXSA 4GSDL 5IFTA 3NACH 5C09E 2OM5A 3FB8B 3MR9B 3L6FA 3P4MB 1LEIA 5EOCL 3IJSA 5BW7A 2E9BA 4LSUH 2DLGA 5JW4M 1T2JA 3K3QA 3QDJE 1AXIB 3VE0A 1JWUA 1MFDL 3QCUL 5TDOB 4HZLB 2DQJH 2QQNH 3D18B 4X6DA 3I6KA 4X6FA 2VLJD 1PG7X 1YNLL 5F7KC 1SR0A 2HKFH 2XKUA 1YYLL 3VXNA 2JIEA 4PTVA 1G6VK 4RGNB 4A4AA 2IJ0C 3C6LD 4ACYA 1ZHBB 1OP3K 3JWOL 4TTDC 2BFVH 1KPUA 4Z7WB 5BS0B 3ARSA 4KI5D 3B5HA 5F9WB 2GITA 2WAHA 3NFPB 2H9GB 4NKQB 3PL6B 3WUGA 2Y7QA 3CGTA 1BX2A 4OBRA 2XM2A 4DAGL 3NJ3A 3IDJB 4AG4L 3HMXL 3EYQD 1OF2A 4UQ3B 5EN2B 4P59H 1NGWB 4WDIA 5E08L 1KXHA 2P5EE 5LXGH 2NX5A 3UBXI 1VCAA 3SCSA 3MS8A 5JNYB 5FCZA 5T1KA 3O9WD 4QLKA 5FGRA 4PJDF 1H11A 1DBKL 2GT9A 5HYSG 4MB3A 1UR9A 2X7LB 2J7BA 1G0YR 1UC6A 5ICZB 5AC4A 5HHOA 2WHJA 3FTGB 4BZ1H 3IF1B 2ESVA 1BVNP 1VFBB 4ZYKB 4K8RD 1A6TA 2GSGA 4ALAH 2JJWA 4MNGB 2YPLA 5KSUB 1R0AL 3ARUA 3FN9A 4TNVF 5GSVB 1GOMA 3N1QC 5SX5H 4RZCB 2ZUQB 1NLBH 4X5XB 4ZOAA 2BFVL 5JOFA 1QFWI 1A47A 1S9VB 3ZSTA 2H2SD 3VW3L 1JPFA 1PSKH 4JFOB 4HHAA 3VNZA 3MV8B 4OIIH 1B4RA 3K80A 2GEEA 4YDJB 4W8LA 4DZ8A 1U8LB 2NCMA 3HAEB 2YPVL 2C4FU 2VABA 2DQUL 4PRDB 1AGFA 3MRMB 2QHLA 1WE5A 3MOAL 4TOQA 5D6DC 2JK5A 1UJTA 4FQHA 3RNKA 2X1IA 5EC2B 1ZLVH 4TUFA 1YYMH 4W84A 1KTKE 4IS6A 1CL7I 2IALA 5C8JA 4OZGF 3X3FH 5BRZE 2OL3H 1UD2A 1JI2A 2GTWA 3EIFA 4MA8H 3AISA 5E2WH 2XGIA 2CO6B 1I1AB 2APVA 1JTPA 1R0AH 5K93A 4JDZA 4HIHA 2J8UB 3UG3A 4F37K 3EHBC 1EZVX 4XNZB 2EZ0C 1FJ1B 1U8KA 1I3UA 3K81A 4O51A 3ULVC 3GSNB 1A3RL 1QNZH 5F1NB 1GSMA 3QXUA 3KPQA 5EU5B 4YQXL 4IDJL 3D0LB 1K2DA 1U2HA 5FL1A 5C0CB 3GMMA 5J3HD 2IFFH 3VI4F 4MTVA 4PLJD 2Q6WA 5L2KD 3ARDB 3LKNB 3VFSA 3RBSA 4M3KB 4U6VL 3MV9A 5D7JB 5HHQA 4KRTA 3REWA 4Z77A 5H35A 4ODWA 2VLMD 1DLHA 2NW3A 1YYML 3GIZL 3HFMH 3QULB 1FDLL 4NQCB 1S7VA 3P30H 3GSXB 5DTFB 1OLLA 3RDTC 1TXKA 5FO7B 4JREB 3QCTL 2L7JA 4CADA 1KTDA 3MBEB 4HQQH 4HIIB 2YA0A 3G6JB 1EEYA 1NOFA 3FJTA 1EHAA 2J74A 4QOKB 4LPWA 1TNNA 3STZB 1TVHA 2Z91B 3L3JB 5CGYC 3ARYA 3C2AL 3FB6B 4OGXL 2YD9A 1S9YB 1T4KB 4NRZB 5F3BA 3V6ZB 5EUOA 5F21B 5LGHH 1I7TB 4TTDD 2QV4A 1CICD 5HPCA 3T08A 4UFLA 1C7TA 1KV3A 3L3JA 1TVHB 1HP5A 1YUHB 5IW1B 4P9HH 4D71A 1ZLUH 3WIHL 5ACZB 2ZX7A 3B5GA 4ZSOA 3VXQB 3CCHA 3PZQA 1CD1B 2J77A 2A0LC 1PKQB 2XFXA 4U6VH 4OZHE 4XZUB 5EOQH 3HJEA 1T5XB 1MWOA 3ZDXF 3ZT6A 4ERSH 3ESVF 3KPMB 1JNJA 1INQA 4A2LA 5JHDB 6TAAA 5FDWA 5LG1A 2IUZA 2CGRL 1OHQA 2H41A 4UDTB 4PJAA 5H35B 3MGAA 3REWB 4U7MA 3SY0A 2YL8A 1JGVL 4KY1H 4FS0A 3VFSB 1MFNA 5CJXC 1XCTB 2HVKB 1ADQH 4U1KA 3O4LB 5JIWA 3THMH 3GUTA 1RZ7L 4H8VA 5B3JF 4UILL 4C56D 1US2A 4IRJB 4NZJA 1IGFL 1OM3H 2X9WA 1TVPA 5I79A 1QSEB 4KTDH 4NRYB 1J8HA 1E4XH 3FT3A 2WM0A 2DBLH 3L3GB 4W4NA 2B2XH 4WI4A 1CFQB 5EOQL 3C8HA 3X14B 3G04B 3WQVA 3MMUA 3OKOB 3ETBF 1CR9L 1OPGH 3W39B 1UM6L 4S1SL 4LGPB 2R1XA 5E8DL 3A4XA 1Y6KR 4PJ5E 1Q9LA 2P1YA 2EDDA 2FWOA 4HK3N 1AC6A 3RWDB 4MCZA 1DSFL 1V6VA 3D5HA 1WFUA 1XGPA 2FD6L 4UTAH 1R8LA 3DRTA 1M53A 2DSVA 4FF5A 1OAYH 1QRKA 1IMHC 1INDH 4U1LB 1N2RB 5HGGS 5I1KL 2DL9A 4WHTB 4PV9A 1EA9C 2ILLA 5DD1H 1PYWA 4U3HA 3SCQA 2JIXB 4ENEC 5C0RH 5EBWB 2AGJL 4MNQB 4TTGA 1IAKA 1AJ7L 2MQCA 3VH8B 3CH1B 4JM2F 2AJVL 5GS2H 4R90L 1FO0A 1LP9B 2W38A 3LB6C 5FKAB 1BM3H 3BAEH 3INUH 2ESVB 2YRZA 3L4TA 2WCAA 1N8ZB 3MREA 1LILA 4PGCA 4EOWH 4RISL 5EUKB 4R7NB 2ZIDA 3N1PC 2VXQL 4OT1L 3FFCA 3DX9B 4LRNH 3SE8H 1VJZA 4JLRB 2MWCA 3CVHB 3HUJE 3X11B 3H3KA 1F58H 3O6AA 3VH8G 1B4JL 3BQUD 4TPRL 4WDIB 5JW3L 4RDQF 2HT4D 5IVOA 4P5TB 5I1DA 4PLKD 4IEFB 4M7ZC 2LU3A 4HPYL 2QR0A 2ATKA 1IJ9A 1HHIB 1U3HD 1OAYL 2QBWA 3GI9L 3P77B 3TJHD 1NQ6A 4BZ2H 3GXIA 2F15A 3T0EA 3NFPA 2GITB 3RL1B 4QF1A 3MRFB 1FNFA 3I2CL 3K4ZA 3BIKB 1A7PH 1QNOA 1V3JA 1ZV5A 4DKFH 2CBIA 5IFPA 2AJVH 1UWTA 1DQML 1GZQA 5C0JB 3PWVB 3K4AA 3U7AA 5IHUH 4GRLD 2DQGH 1XCQB 3NCOA 1I8IA 1JNNL 4IRSC 2XFFA 3O4OC 2PR4H 5TDOA 4AEIL 5F89B 1WC7A 5GRVK 4U1MA 5GZOD 4JKLA 3I50L 3HZKA 4LCCB 5T3ZE 5ID1A 1FH7A 5FYLE 3TTOA 1VFMA 3ZDZE 3U48A 1B6DA 4TVCA 2OP4H 5E6YA 3BEWB 3UYOD 1XR8A 2PO6A 4PJEB 1UD4A 1U8IB 3O9NA 4NNPH 4NZTH 1QBAA 1MJJB 3RJDA 2V9RA 4M61A 1A22B 2P8MA 4NSBA 1XT5A 5D7JC 5JZ7C 4HJGB 3AZSA 1KYOJ 2B4CC 3WEXB 4NZCA 4CD8A 3MUY1 3KPRE 1A7PL 4N90D 1BFOA 5BZWA 1NWTA 5D7LA 5ITFB 2BY1A 2EDXA 1V03A 4J3UA 2B5IC 2VERN 4HLZG 2XTJC 1KACB 4KZDH 1UM4H 4FMKA 3W27A 3KPSB 3UJIL 5AEAA 5EFIA 5EZLB 3OR7B 2PR4L 4AEIH 4J27A 4UOW1 5IP4A 2FEEI 3I50H 4YDVB 1WBXB 2OP4L 3LKSA 1ORSB 5LAXB 2V2XA 1HDMB 4QDMA 1QFOA 1UJ3C 4YHIB 5IVXF 4X9GA 2QPUA 2OJEB 1A6UH 4OZFA 3CC5A 1BFVL 4MNQD 1M05B 4M9OA 3BWAB 4M8VA 2LQRA 4KKNA 4YFLI 5IVNA 1NC2B 2BC4B 4PLJC 4RWYH 2IPKB 2BOBB 2MFNA 1H3PH 5F1OB 1CD9B 5IKCB 4KVCL 3CLWA 1KCLA 2MCG1 4K55A 1OSZB 1AQ0A 5CP3H 3IFOB 4ZXLA 4WU7A 1FGNL 4HOZA 1XCXA 5TJWK 2XWEA 1HI6A 1CXIA 2ZG2A 3MZGB 2W92A 3LRSA 4FFWC 4L8SB 1N0XL 4HF5L 1EZVY 5IMKB 4M7LL 1IC7L 2F8VA 4XP5H 4Q74A 4YK4B 5ESVB 4Q22A 3GKWL 4YR6B 3SCUA 3HZMA 4KKBD 3L3DB 3WFCL 4NQDB 1G9HA 3VWJC 2ZXQA 4XVTL 5E94A 3U5YA 1BFVH 3UESA 3SKUD 2A73A 1DDHA 5HGDA 5ICXA 1E4XI 5GGSY 3LRHA 2BDNH 4ZOCA 5IMOB 1XF3A 4QHUB 1RP9A 2OMBA 3LV3B 3D6GA 3MLSL 1U6AL 3D85A 1CI5A 1FGNH 5DQDL 1LO2H 1NPUA 2GTZA 3HZVB 3BUYB 4LVOC 1A1NA 3WN5A 1I1RA 2CK0H 5A3IC 5DJ8A 1CVRA 4YNYB 4FOMA 3I3DA 3EDFA 3WFHB 1UH2A 3O41A 1FYTD 4JFSA 4HUWA 3KYOA 4S11A 4H88L 4AK1A 2AAAA 4PJ9C 1U8JA 4URTB 4B5EA 4XC3H 3NCYS 4OCNC 4HIJB 2A77H 2VX4A 2XACC 3LN4A 4LPTA 5GS1A 1C7SA 3BWUC 4GZEA 2FLBT 4K9EH 3FQTA 5HHXL 4OKDA 3O9WB 4MNGE 3T2QA 1C5DA 4GOSA 2DQHL 4OZ4A 3P0YL 4BQ4A 3RMEA 4Y88A 3RVTC 4F7EB 3KEHA 1WBYB 4JB9H 2HKHL 1SHMA 4EI6B 4I3GA 3ELAT 4IRZL 3W11C 4YHGA 4N8PA 1AR1D 4ODXB 4PYHA 2CLZB 2A3EA 4JY5H 1MQKH 3TA9A 4QRSA 3VKKA 5BMFH 3DYPA 1MHPL 1G1CA 2DQFA 4N0UE 4YHMH 2R29H 5B39B 4RAUA 1RJYA 4NQVA 4KQ3L 4NSKB 1RURH 3QWOB 5FGSA 3UERA 1F3DJ 4H88H 4HS3A 5I8OL 4MHHG 4JO1H 4TX6A 3B6SB 3EYVA 5ESQA 3QEUA 4Z76A 1NC2D 1IL1B 2WBKA 1N5YH 3SDYH 1JTOA 2BSTA 5GGRA 4XAWH 4PRAA 1E6JL 3CIVA 5EIVA 3NZ8B 1DQDH 5DRZB 4LLMB 2PBGA 1GNXA 2YBTA 4LSSL 3C2SA 3P2TA 4OZHF 2BVOB 3SGDH 4R0LC 1V8HA 4RMSA 3UPRB 5L2KE 2XIBA 3HI1A 5L0QC 5CUSL 4KI5F 4NF7A 1LVEA 1CTNA 4GQ9L 2WSPA 1NP0A 1OTTD 4X9IA 2CPCA 3DROB 1HNFA 1PZ5A 3T04D 3FMGL 2CBVA 3FFDA 1RURL 1VGKB 5DQJB 2AK1H 4JKMA 3CHDA 1QI0A 4MCYA 4FLOA 4DVRH 3U57A 4W68A 2IXVA 5KOVC 3D39D 3C9NB 2UVFA 1W3KA 4D6EA 3GEWB 3EMQA 4GQQA 3WO3B 2A6DA 2ZX6A 4GXVL 4UNVA 2X4UA 5I17A 1E56A 3WHXB 3SDYL 2EDWA 4JRXB 3V5KA 5IEKA 4NQEE 5BJTA 2BNRD 5E8EB 1X5KA 1UHVA 2EEXA 4W89A 2CKSA 1KJVB 3VFWA 1ZT4B 2GVYA 3G5XB 5FUCC 3A0OA 4LSSH 1CENA 5I19H 2EQDA 5DD6B 4F7CA 2WK2A 3L7EA 5JR1L 3UZEA 4P3DB 1S7RA 4Y5YB 4WWKB 1OIFA 4G6ML 5FYJU 6CGTA 3WHXA 1OP9A 2ICWI 3NH7H 1YA5A 1SYTA 3QUYC 5L8KB 1DZBA 3AXLA 1JXKA 2VLRE 4ZD3L 3ZE0E 4DGVL 5ICYB 1HSBA 3MRQA 2QQQA 1PKQE 2YUVA 2CPUA 3GSVA 4IRSB 3BRGC 4ISVB 2VXSL 2Z8SA 4WRLA 3PWUA 1NCCH 4F37F 3NVQA 2IGFL 2GK1B 4XH2A 1J0KA 1NCNA 4KRPB 2XUCA 3KL0A 4XVUC 4U6TA 4CN4A 2ZNXA 4M7KH 2BVPA 1JN6A 1Q9OA 1QSZA 3CFEA 4F15B 5JW5A 1K8DA 1GGCH 4HKZB 3DXAB 1CLOH 1JFQH 2LU7A 2A83A 5K59E 1IAOB 1K4CB 1H5BA 4PJ8B 4ZMAT 5TDPB 4ZG1A 2YIHA 4PRAB 2E6JA 3G5YA 4CDGC 3EZ8A 4LVOB 3B8YA 4G6MH 4O58H 2VR4A 1C1EL 1P9MA 1F00I 2QEJA 3EKCA 1QSEE 4QXTA 5ESQB 1PZ2A 4UQCA 2ATPB 1ROWA 4ZD3H 4W5ZA 5I78A 4DGVH 4NHCH 3O3DA 2XPGA 4CVUA 2IBGA 4JZNA 3DRQB 5ELIA 3LEYL 3TBWA 1U92B 4LCUB 5F7NC 4JL1A 1KBGL 3N1FC 1JJUA 1GOFA 4NSKA 4PJ5D 2VXSH 3WJJA 4F9LA 1H8SA 5B39A 1HHHB 2CRIA 5DEFB 1FVCA 2ENSA 2HLFC 5L7XL 2DQFB 1WIPA 1UD5A 1DUYB 1TZHB 2QSTA 3HA0A 4M7KL 5C0ND 3LQAC 5AZ2L 1I3GH 2CLZA 4XBGB 1NKRA 3OKEB 1GGCL 4ZENA 3MUIA 1WBYA 3WF3A 2VIRA 4KKAD 1NFKA 2NTFB 1AD0B 2J62A 2P8PB 3MRPB 4HWEL 1KJ2A 2CIPA 2YSSA 1Y6NR 4RDQG 2XRAL 4O58L 1H5VA 3DI2B 4I77H 1NUGA 2EH7L 4HIJA 1UWXH 1URLA 3GBEA 3D39B 2WINB 3BO8B 1AO7A 4NHCL 1VPOL 2XV6B 5HYSA 1G7PB 4HUWB 3J7HA 1UR2A 4JY6A 2CDFA 5E95B 2VT0A 1CL7H 5J7CC 4YNYA 5FYKL 4G9FD 4YHPB 1ETZA 3K74B 3QUXC 5BRZA 3OLDA 3LRGA 3KPPA 3GMRA 3C60D 3BUYA 3HZVA 3HNVH 4JM4L 1NGXA 2KPNA 5I8CA 4UQDA 2DL2A 3BH8A 1KFWA 1G6RH 1AMYA 4G6KL 1WTGT 5FK9B 1SJHA 4XAKE 5JOEA 3TEUA 5IMOA 5F1SA 3ZJ8A 5FV1L 1Z32X 5DJAA 4PRPA 5D1QA 5ICXB 2WNWA 3VXSD 1NJ9B 1ZHNB 4K3GA 2IH1A 1CLYH 5IB5B 3I02B 5JBEA 1H0DA 3OV6A 4MXVE 2V38A 2WZEA 2EDFA 4EBQL 3VFRB 2AS5M 4RAVA 3UDWC 3MUGA 4FQJH 4AM0B 3S96A 2B7DT 3LS5H 4JFFB 1I1WA 1QOXA 4Z2KA 3HZMB 3IDUA 1BD2E 3TT3H 5ID0A 2A3AA 3BDBA 3BDYH 3PWNA 3PTMA 4XTRC 5CS7A 3AREA 3EO0A 4XPTH 4XMLH 3VD3A 4NIKB 2FYYA 4DWSD 3BP7B 4POYA 1OARL 3N11A 1K4DB 5D5MA 2KZWA 3PWLB 5D9SB 4PS4H 2X4NB 4PBVC 1P5UA 1KXQA 4N9GA 3RGVD 1TVDA 3I6GB 1G6RL 4JRYB 5JO5A 3MLYL 2ZUWA 5IKCA 3TVMC 3ZE0F 5JPNB 2YEZB 1XGZA 1NC2A 4F2MA 1RUMH 5E0QA 2VUYA 3NIDE 4IHOA 3DVNA 3BC9A 1IGYA 3BWAA 1M05A 3BUTA 1GCFA 1E4JA 3BI9X 4FQIH 1XYFA 3TBSA 4D6JA 4Q9RL 5HYJA 4B16A 1GHRA 2JALA 4MAUL 1OVZA 2CLRA 2XGBA 3F7RA 3ROOB 1Z0NA 3TESA 2PC8A 4JPIB 5AG8A 1AXSA 1T83C 4NYLB 1V3HA 3FQXA 1JRHH 1ZA6B 4OFKA 4XMLL 3ZE1E 1CZ8H 5DD3H 5I0DA 2OZ4L 5LCVL 1K9TA 4R4FL 4NKMB 1U93A 4M43H 3NFSH 3VU2A 1MFCL 4EIGB 1F42A 5KW9H 1UACH 2OTUB 4I0PA 3O4LE 2DKMA 5D7IA 2UYLA 2NY6C 3B9KB 1U95A 1U3HA 2RGSA 3U82B 5IB2A 3EW3B 4P7NA 2VDRH 1DVFC 3N1GC 2AW2A 4AWEA 2JB5H 4HJGA 1AGEA 1UCBL 2DICA 1US3A 1IEAA 4PRHD 2EDOA 4BQ9A 1EJOL 3HR5B 1HXYA 3EGSA 4FQIL 3UZQA 4NP4H 2BFGA 4RGOL 2HAZA 1I4FB 3W6LA 5IVZA 1FFOB 2ARWA 4PJHB 5KTEL 3RM9A 4OGYH 2H45A 3BN9C 5FXCH 1ZOXA 3ROLA 5DURB 4G6FD 4P5MA 1F45A 4R96B 5DJYB 3F5WB 3REVB 1ZWIB 4JO4H 1U8QB 1UACL 1WITA 3GMPA 1XIWA 4Q9QH 2Q8XA 3ARBC 2MOVA 1ERNA 3KPOB 2GI7A 1G94A 4U5IA 2HYMA 3QFJD 4GKNA 3C60C 2ZZUT 1BF2A 4L4TE 5KANG 3I3BA 1QTYT 2VDRL 1KG0A 4QXUL 1AIFB 3VIMA 4PJHE 3RL1A 1DQLL 2DWEB 4JCMA 4H7VA 3Q1SL 4OCYL 3CVHH 4R6UA 4MSWA 3VCLA 4N0FB 2QR0B 1OBAA 2IADB 2JLLA 1D9KC 1K3ZA 4GG8A 4RGOH 2WHMA 4OLYL 3SO5A 1XEDA 2PXYC 1H09A 2GFTA 4RNRB 25C8H 4LARH 1A3LL 3E6FA 5EU6A 5JMOC 3GGWA 3RA7L 2FDMA 5KTEH 3MC0A 4PRIE 3VFOA 1RUPL 3EO1B 5BV7L 2E8YA 3LN9A 5FOBA 1Y18A 3RZCA 3OKNA 4OGAD 2WNGA 3MREB 4PGCB 1UWUA 1LO4L 3HN3A 1NBVL 1Y7VA 5D2NB 5E8OA 2YD8A 4NDMB 3BGMA 1TUXA 1D5ZB 2SEBB 2F5BH 3FT4B 5C0AB 1FO0B 1LP9A 1RZKC 4Q9QL 1G7QA 1ZK9A 2EYTB 3VFTB 1IAKB 4MNQA 5T5NF 1RUAH 1E0XA 5F96H 4KK5C 1Z0MA 1CE6A 1ED3B 1S7QB 4U7SA 5D2LE 2E7CA 3S35H 1CDGA 1CVSC 3Q1SH 2BRRH 1CDIA 3MLWH 3TVMD 5B8CB 3VFUB 3VFMB 4KFZC 1FRGL 1GUVA 2XVGA 3UJTH 1I8LA 3WFBL 4LSRH 5HGBA 4HZ7A 4OUEA 3RPMA 5I6SA 4NC0B 3U79A 3NYDA 3II1A 1EFXA 4TSCL 4ONGL 5F70A 3WS3A 3ZT7A 1RUPH 3SE9H 4LDEB 1RZGB 2PKDA 2R1XB 3KLDA 2J8GA 4XC1H 3BRFA 1KNOA 1S9KC 5E2JA 1SM3L 3W39A 4ONFL 2YLLA 4XX1E 4QRQA 3G04A 1S78D 4LYRA 4BFEA 2G3MA 3CX5J 4AENB 3JUGA 1JE6A 4GH7B 2YWYA 1NBYB 5LGJB 4P5KB 5FAAA 4PJEF 1U8MA 3AMLA 4MDPA 3SKMA 2AERT 4M02A 3GNRA 3OKMA 1MSPA 3VJ6A 1EDQA 2HVMA 3WDJA 3ARDC 4TRPL 5I0ZA 3GUTB 2R4SL 3BZFB 3MCKA 2HG5B 2ZUUA 3V5DA 3KPRD 5CZKA 2WC7A 2BNJA 1FVDA 3CD4A 1PY9A 2O26U 2WV3A 2ZCHH 2AXJA 5DJXA 3WDQA 2FX7H 4N5EC 5IMLA 4MJIE 4W5UA 2X4TB 4GO6B 5GIRB 1T1ZB 3WDPP 3UBXG 2EPKX 2EXOA 1JGLH 2WWCA 1F4YH 4GG6A 1NL0L 3WUFA 4DWSA 5CJBA 2XFXB 4MQ7A 4WKFA 1NEZB 4APQB 4FTVA 3JTSB 3VXQA 5KSBA 5A8MA 1ZLWK 4MS8D 5IW1A 1CG9A 1YUHA 2CUHA 2VDOH 4H25A 5JQ6L 4D0CB 5F8QC 5DSCB 2G8ZA 1UB6A 2E40A 2EO1A 4HSQA 3VD7A 1F2XK 4IOFD 4NRZA 4PN2A 4JE4B 1B30A 4QHNB 3ULSA 1QR1A 4N0CC 1NLDH 3VXOB 5KVFL 2R0LL 1EEYB 3BKML 4AW7A 4CADB 2CHNA 4W8AA 5KEZA 4RMVA 3OKLA 5C0AD 5MHSD 1QFPA 5I15H 3K2MC 3S5LG 3U36B 2DQXA 4MD5B 1H9VA 1IKNC 5BXFA 3PXHA 4ODWB 4DKEH 4WW2F 4H8WL 1F4YL 4Y5XB 5T1MA 1WO2A 5E4IA 1GPOL 1NCAH 2D03H 5JXEA 4W87A 1L9MA 4JAWA 2JE8A 3F58H 5GSRA 4UOQA 3K46A 4CVZA 2JIXD 5K9KA 4QGTA 5EU4A 2HFFB 3KPQB 1R3JB 3O3BB 1R5WA 1TVNA 2PWEA 4JFTA 3MRRB 1LEKB 2ADJA 4IMKA 2X4OB 4R0LA 3CFCL 1E4IA 2NYYD 5T1KD 3BJ91 2C3VB 2ARJA 3CSPA 4KMTH 3RPKA 5LGJA 5HVWA 2R0LH 4AIOA 3WD4A 1IQWL 1CWVA 3TTQA 1HJUA 4AZ8A 5CD5D 1T2QL 4P2OC 4P8UA 4Y2DD 2CRZA 2P8LA 2PYEA 3TCLB 3CZ8A 1AC0A 1BJ1J 1YEGL 1FZKB 4NQXA 3FCTA 3BGFC 2RGLA 2VL5B 1AO7E 4FQHB 1FAIH 2D03L 1T21B 3V8OA 1EO7A 3SPVB 4IMLB 1NDGA 1E4WL 5C07E 4YHKH 3I75B 4Q2ZB 2GJPA 4HHAB 1H3UA 1IAIM 3CH9A 2PF6A 3GSNH 5IJKA 3LMJL 4KK9C 1S7QA 4WTZA 5SWQA 2C1PB 1XF4B 3TIEA 1D5IL 1UYWH 4U05A 3IYLW 4MJ6A 3LY6A 4XNMB 2JEPA 4D0BA 3H9SD 4X5XA 2YOCA 4E41B 2EIZA 5M03A 4FQXC 1CT8A 1NMCC 2OR8A 1IQWH 5KSUA 5BVJA 2XY1A 4I48B 2GJ6E 3R4DA 4LLVB 1JCKA 4FP8L 1ZLVK 3VXUD 1VFBA 2Z31A 4NDMA 3W0WD 1IAII 2BHYA 3RY4A 3CMJA 5F7DA 1HQRB 1UWIA 2GT9B 4MAYA 5HYEA 4ZO8A 1YNKL 5DRXA 1QI3A 5JNYA 5JXAH 1WB0A 3C8DA 3CHEA 3DUUA 1N3NA 4XAKD 3LQAH 5KZCD 1GCYA 2IADA 4PJ7F 1NSNH 5IB4B 1C16A 1IGMH 5KVDH 1OLZA 1OGAA 2FX8L 2H9GA 2YD2A 1GAFH 1D5IH 2ICCA 2EYSA 1F5WA 4Y19B 5F7UA 3TJEL 2IQAB 4YHLL 4X4YB 2NY0B 5I1JH 1KTRL 3NSNA 1K9DA 5EO9B 1FZMA 4FP8H 3VXNB 3BESR 5DLMH 5E24E 1R7OA 4JG1L 3HMXA 4PJ5A 5ABGA 4QTHB 5EORH 3D18A 4NT6A 4NWTH 2R2EA 2V3FA 3EFFB 5A2CA 2OQJA 3LQMA 5I5RA 4NI3A 1Q0XH 5INDA 7FABH 4GFTB 4L4TA 4OZIF 4LCCC 5L6YL 1KB9J 5D1ZA 5I9QC 4M6AA 3O0RL 1W9PA 3DX7A 3RBGA 1RFDL 5A2AA 1IGML 3SBWC 3AROA 3FT2B 5I16B 4H2CA 3PE9A 1W9VA 2GK0A 1IKNA 4G80B 3CMOH 5IB2B 4QWWD 4XPAH 4UV7L 4XPGL 5D4QA 3V95A 3ZDYE 1AFVH 2UYLB 2G75A 4K3DL 1F4AA 4M81A 3HAEH 2OTUA 1JGDA 4OF5A 3RTQB 5GGVH 4NKMA 4MWFB 2YZ8A 1U58A 5EORL 1JYNA 1SEQH 1HXJA 5AYUH 3PGCA 2VLRD 4OJFH 5JA8B 3T0XA 5I66A 5J06A 2VDPL 5DJ2B 3ARQA 1XAUA 2GDUA 1ZB5A 2UY6A 1GZJA 4XRCB 4CMMA 4P46A 3FO2A 2VE6A 3HUJA 2CRYA 5ILTH 5E4EB 2Q8AH 4YLQT 3UTTD 2HH0H 4Z7VA 2BOCA 1AY1H 3UTSB 3CIQA 5C0FB 2LE9A 4EQ2A 1NOUA 1H5BC 4S1RL 4K94L 2EKSA 3KXFB 4PTTA 5JBDA 3RVUC 1LL6A 4JPKL 4DCQB 2VQTA 1OCQA 5ABFB 3DUSA 3HE6A 4UV7H 4XPGH 3HMWL 3T0VA 3UO1H 2DDXA 3I6GA 3KDMB 1I85C 3B9KD 3CFBB 1C12A 5IB3A 3G08B 4D9LH 4HPHA 3GJFB 5MEQB 3MNVA 5ETUB 2YD1A 1O6IA 4IPLA 1CF8H 1FCCA 2ADGA 4LFHD 4WUUB 3ULVH 1PEZA 4KHXH 5AYUL 4X6BA 5IW6A 3PWNB 2V9TA 1W2PA 1Q6EA 3NIFE 5HHNA 3KYMA 2EDRA 2APXA 4MNMA 4AL8H 4AM0A 4XNYH 4Z7WF 1SMDA 4EI5D 2E6PA 4PBWD 2VXUL 1L6ZA 4O5LH 3S4SA 3QXTA 4Z5RA 1FOBA 2ZCLL 4LCIH 1F6AA 2B4CL 3BXNA 2Z4QA 3MJ8B 1MHHA 4LHJB 1NJ9A 1RJCA 4S1RH 2LAAA 2IG2L 4F33A 1X5HA 3QQ9D 3L3OB 5E7FA 3ZJ7A 1FP8A 5HXMA 5HHMD 3HMWH 3WL9A 3SCVA 2I5YH 3P0VH 1I8KA 3RNQB 2PCPB 3LEXA 4PRID 1KCSL 1F3JA 1NGZB 1NGXB 3K2UL 2FJGA 3VXUB 2Y25A 4EN3B 5HHMB 3FOLA 4BF7A 4YHPA 1ZBCA 1GC1L 3TN0C 1QLEH 1EQPA 2QKIA 3M07A 1K3IA 1MWAA 1NCWL 3N1MC 4JY6B 4PGBB 3BD3A 3GK8H 4PRBB 2IEPA 3OKDB 3GMNA 4W6YB 4AL8L 5D1ZC 4GQPH 1Q38A 1MRFL 4YPGA 1M71A 5C6TL 1KEML 1KJ2B 1JIBA 4WI3A 4F9JA 2B4CH 3ARGB 3MTRA 1IEBB 3QUMA 1T03H 1TZIB 4HBQA 4OUOA 1FL6B 4NN5C 5DMGC 3UG5A 1UWEL 4AY0A 1VA9A 1UKTA 3ME0A 3UEZA 4YHNA 5E4EC 2WYSA 2XG5A 3BHBB 1KCSH 1DUYA 1TZHA 4X7CC 3THCA 2W60B 4EUPG 2R1WA 3WSQH 3WKMH 4ZFZA 4YX2H 5HJ3A 1HHHA 5DEFA 4BQBA 3NPZB 5TQ0H 1VB9A 1IGCH 1PJ9A 3EJYD 1D9KA 4JZJA 3KG5A 3PNWB 4GUPB 4H8UA 4OFPA 2H8PB 2BNRA 1NDMA 4QXTB 1IE5A 3X3GL 1UM5L 4B15A 1LWHA 1IKFL 3O6FC 3DVFA 2P5EB 4LMQI 2KUTA 2E7LC 2JF6A 1CPUA 5DUMH 1YEIH 1H5BB 2EC9T 2O93L 4HT1H 2VRJA 4NNXB 4RGMB 2PUQT 2D1ZA 4ZDHA 1UWEH 1C5CH 5JW5B 3O8XC 1EOKA 1E28B 5C71A 3TO2A 1WLHA 5EU6D 3T3MF 5IV2B 3UROR 4PRNB 4PJIA 5GS1C 1HINL 3WSQL 5T1LB 3WKNA 2GK1A 1NGYA 3JWDH 1X5XA 5F7WC 4ISVA 3P4NB 1IGCL 5FGCE 4PP2B 1RULH 1F3DH 4PJGF 5JORB 4DK3A 1QI4A 1UCTA 3NA9L 1XR9B 2DIJA 5DYOB 3ZHDA 3AIEA 4PTUB 2Y6SC 4JPVH 5JPMB 2DT2A 4LCWE 4WFFD 3UPAA 3W9EA 1ACYH 1O7VA 3SDDD 1TA3B 1IKFH 4CCDA 4XV0A 2WVVA 1T3FA 3GBNL 4OF8A 2GY7B 1UENA 3NCEB 1IC5L 4XP6L 3MV7B 3A6BL 5GS0H 4N68A 5DD6A 1D6EB 4F7CB 3UETA 1XMWA 4HT1L 4WJ5B 5EIQA 3JVGC 3HLAB 3G5XA 1D6EA 5FGCB 2XVLA 2AV1A 1WTLA 1C5CL 1XRVA 4L3CB 1FNEB 5LKNA 3HNTL 4PRHE 4V2BA 5I17B 5JPMA 3WUEA 4G6JL 2ZJSL 4DN4H 1GPFA 3E1F1 1H3GA 4HJ0C 4H1LB 4U1JB 1RULL 2NZIA 5DQJA 5FM5M 1U8HB 3STLA 2EH8H 1NGYB 3P3YA 4RBPK 2OJZH 4PJXE 4AISA 2AQ3A 3OA5A 1YY8A 3QCVL 3JZ7A 4PB9H 3PL6D 5FKYA 3A67L 4JFZH 3GBNH 1RJLA 4NKIH 3HI1B 4XP6H 4G8IA 2WAGA 3F12A 1OL0A 3EYSH 5D1ZD 4NNXA 2FJFA 2K3TA 1FNLA 2CIKA 1TQBC 3QFJE 4L4TD 4GT7A 3ARFA 5HVHC 4HULB 4XCFH 6FABH 4JFVA 3QRGL 1DWFM 2EIEA 3IU3B 2R56L 3BPNB 5FHBL 4YC2C 3R0MA 2A9ML 4FQCL 4UTBH 5CIPA 5CLTA 4HWZA 4HCRL 1FG2A 4DN4L 4FXKB 5CCKH 1YY9D 1MI5A 1J10A 3L3KB 4P9ML 1UB5B 3IKKA 1FP9A 3N04A 4QRUA 1VKXB 1Q72L 1A4JA 4NQVB 3VG9C 1RJYB 4NRSA 4FQ1L 1JFHA 3U2SB 5C07D 2W60A 1Q4NX 4HZ6A 1BQHB 1A9EA 3QCVH 5EOTA 4OOZA 1CDCA 2PTUA 3TH2T 4YHNB 2DYPD 5D1XB 4APQC 4JPWL 2AEQH 4C7GA 1W8OA 5DGRA 4WU5A 1FL6A 1RHHB 4FK9A 1QBLH 3VTRA 3H9SE 3FO0L 1C5DB 2AJXL 4Z7NF 3JUYA 1TZGL 2GJ6D 2CHOA 5I2IB 5FHBH 2V9QA 1GGBL 2OWCA 4XCYB 1G7MB 3HPJB 5E00B 1I1FB 4X6CF 3RJYA 3B9VA 2PO6C 5I8EB 5I1IL 1WAAF 4P9MH 1MCLA 2GJ6B