4MJ4A

Human iduronidase apo structure p21 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
614
structure length
603
Chain Sequence
EAPHLVQVDAARALWPLRRFWRSTGFCPDPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-iduronidase
publication title Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 194
structure length 603
sequence length 614
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01229 Glyco_hydro_39 Glycosyl hydrolases family 39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mj4A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4mj4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mj4A02
2E7MA 5I3DA 4GQ9H 4PLNC 3PZQA 3CCHA 4PTTA 3OR7A 3HU7A 2V3DA 2BY3A 5IWLA 2BVQB 3LVEA 5IFAH 1GHFH 3QEQB 4CNIB 2XTJD 5K59F 1XGTA 4I77L 4U6XA 5FHBL 4WW1A 3QZWB 4G7VL 2A77H 1V8HA 5HYFA 2ENSA 4IPNB 2CHNA 3BP6B 5LGHH 3OAYH 4RFEA 4S1QH 2E40A 5CPQA 5JW3L 3MRDA 2XPGA 4F3FB 3X14B 1U8MA 5E00B 5I1AA 5A8QA 5A3IC 4HZ6A 2YA2A 5GRYA 2ZCKL 1UACH 2R0LH 4ZS6C 2GFBA 4BFGA 1EDTA 4LYPA 3T4YA 3UEQA 4F15B 4X7EC 2CDGA 3FOMA 1E56A 5ETUB 3RDTA 5DC4B 1FHGA 1U2CA 2ZPKL 4NPYB 5CD5D 4P3WA 4P0DA 1Q9WA 1ITBB 2ESVD 1L7TL 3L3JB 3ZYIA 3I75A 3BXWA 2XGIA 1JGUH 4FMFA 4O2CB 4M1GL 4MAUL 4NHCL 3X3GH 5SV4A 2DQCL 4MVBC 5ICZA 1K2DA 3OX8A 3MRCA 4G7YH 3QHFH 1NGWA 3IFOB 4L4VE 1UWEL 2GYSA 1TPXC 4MNKA 3S4SG 3UJJH 3SCMD 2J74A 2JIEA 4OJYA 3HAEG 4PRBB 4HQQL 2GDUA 4F8XA 1J7VR 2WBJD 3HN3A 1B2YA 5DVOA 5I8KH 2NQCA 2PO6B 1J87A 5HGBA 4WUUD 4G42A 4AMCA 2M2DA 1JPTL 5JA9A 3KEHA 2YRLA 4WFHE 1ZLSH 2ZUTA 3ILPB 3E2HB 5CZVL 3SE3A 1T1ZB 4MDIB 1OLLA 1XZ0B 5T3ZD 2VLKE 5FF6B 3MNVA 5D5MB 4OF8A 3TNMB 5KG9B 1UR2A 1TJGL 1YYMH 1OB1A 1ZE3C 3RWEB 4QHKI 4ERSL 4U1IB 5E7BA 1S5HA 2OSLB 4LPYA 3CZLA 2O61B 1IM3A 3IDUA 4I8DA 1WWAX 2AV7B 4P23A 2QHAA 1Q6CA 2Y2WA 5L8JB 1E4LA 4H0HB 4QXWA 3L3OB 3O6FD 5CSUA 3S88L 1IKNA 2ZJSH 3TJHD 2Q8XA 2G3NA 3ORJA 5I78A 2QQQA 4U1MB 4AIEA 3QNYA 5BXSA 1CPUA 3MV9D 5I1LA 1AHWA 3ZT6A 3WY1A 4OLUH 3EIFA 1C1EH 3T0ED 4ZFOA 2EEXA 4HLJA 1IGJA 1SFSA 4ORGB 3F5LA 1AR1D 2VABB 1YEEL 4JPIA 3W26A 1T2XA 3O8XB 4KXZI 2VLJD 3CGTA 4WW2B 4B41A 1HCVA 1KB5H 1T0NA 1YUHA 3L3HA 5FIEA 1I8LA 3EYOB 1EXPA 4WNQB 5IB1A 2JJUA 4HK3N 5BRPA 2F9BT 4E5XA 3MGOA 1I1AB 3T0AA 1ADQL 35C8H 3PV6A 2BNQE 1P69B 4ALAL 2V7NB 4ZNEE 3OKEB 1NC4D 2ZOKA 3SDYH 3V0AC 2AJVL 4XB7A 5AAMA 5C0ND 4NQTA 2E3ZA 1NDGB 4IIQB 1MCSA 4HC1L 5E0QA 3VGEA 4G8EA 1KN4L 1CDUA 1UWXH 3RIAF 4PD4J 3RVVD 2ZG2A 4RX4A 4UT6L 1BBJA 2VOTA 1MFDL 3EFDH 4S1SL 5JHLH 3MLRL 3JSSA 4JR9H 3HE6B 4NQCA 3VI3E 4XCFL 3IXAB 4DKDC 5I73C 4NZTH 5MEPB 5BWFA 1TNMA 1JFHA 3K8LA 4QLKA 1ZVSA 1QOKA 5IOPB 3QXAB 3PGCB 3DYOA 1XMWA 5BO1H 2YS4A 2IADB 3BKJL 1FGVH 2VDLH 1VADB 3PBGA 3DTXA 5EWIL 4ESKA 4W7VA 4KTEL 3QEQD 4IOIB 3OLGA 4MAYC 4P46B 3L4WA 5AZEL 4X8JB 4D9LL 2YD2A 1BQSA 3IU3B 5D70H 1YJDH 1ZVHA 4Y1AB 3CLFL 3T0VA 3DI2B 4CDHA 5DK0B 1JP5A 1P4LB 1C5DA 5F6IC 1ISVA 3RM9A 1U41A 2P49B 1OQXA 1B4JH 2AXJA 1GHSA 3THMH 1Z9MA 4PYHA 4P3DB 5HDBF 2D20A 5ALCH 1T20A 5D2NB 5DUMH 5KEZA 1XR8B 4U4BA 2G9HB 4PMZA 4OFPA 5DURD 4UIMA 3RZCA 1HNGA 5DJXB 5E1AB 4EI6A 4JRXA 3SGKC 4M24A 4HK3J 2DWEB 4IUGA 4MA7L 1EO8H 1E4KA 4FN0A 4Q0XH 4HXAH 1C93A 3SUVA 3DIFB 5CD3A 4JRYE 1HIZA 3ISWA 4TNVK 2NTFB 2P45B 2OK0L 5AG9A 4PRIE 2EXYC 3LS4L 3B83A 4FMKA 3ZMRA 4D71A 3C6LB 5E2TL 2BRQA 1IGTA 3OHXB 3BYTA 1MCPH 5C3TA 2I5YL 4A3HA 5TDOB 3L4XA 2FL5B 2FX9L 2QSCL 5EU4B 3UBXG 5EN2A 1T22B 2UWEF 1UVQB 4WTWA 5EBGA 2DTSA 1KCSH 2DN7A 3VXQA 1ZHLA 3GHEL 3ET9F 4U1SB 1C8XA 4P8WA 1C5BL 5KJRL 4PTTB 3OR7B 4G6ML 1UR0A 3QO1A 3AC0A 4Z7UA 2PO6D 4P4RA 4F7MB 5A2KH 3LIZL 1JD9A 3WIHL 4XXCC 3CLEH 5IVNA 2NLJA 1J1XH 3DGGA 4RAUB 1UWGL 2MWCA 1A9BA 3VD5A 1V7NH 3MRGA 2QLYA 3FO9A 5EORL 3OG2A 2NYYD 4QY8A 4NCC1 3OPZH 2DT3A 5HPOA 1J18A 2XPGB 4ZOCA 2FCBA 4LOUD 5DRNB 3TH3T 2XQYK 3CO4A 5LXGH 2VXQL 1BQHB 2QQLH 4RMVA 4LEXL 5DHVH 4N8VA 3WEMA 3TBSA 1O6IA 4NOFA 3MUIA 2GSGB 3T4YB 4Z7WE 4U7MA 3C8DA 3AXLB 1BLIA 2EZ0D 3VIMA 2UY2A 2CDGB 3GFUA 3PZGA 4Z0XB 3DHJA 4OF3A 1L0PA 1KCKA 1H3WM 2HH0L 3U7WL 4Q6IA 1X4ZA 3HI5L 1QLEL 1MFAH 3FJTA 4F7PB 5EIIA 4XPTH 1XR9B 2VXSH 3MZTA 3V4VL 5BJTA 4FS0A 3IKKA 5JXAL 5GJSH 3QRFM 1CZ8L 1JPGA 3ZDYE 2CIKA 3MYZA 2XY2A 1RIVL 2IAND 1E0WA 3CJJA 3BPLC 2ZUXA 1II4E 2WINA 2Z8VC 1K2DB 3OX8B 4ZUUB 5KVEL 3MRCB 2A6IB 1OAZL 5DMGD 3S7GA 4Q7NA 1I1AD 4FF5A 2IWGA 1T2QH 4XP6H 4NM8H 1OP3K 1KJ3L 4PJHB 3GNRA 4PCSA 1FAIH 4L9DA 5HOSA 2XG9A 2CQVA 2DQHH 3MX0A 3O0RL 4K23L 4ZO8A 3VD3A 4ZUSA 5ICYB 5A6AA 5D96C 4W6WB 3BE1H 1HZHL 3BSHA 3LD8B 1MEXL 4KUCD 4OCLC 3P11L 4PJCE 4G8GE 4J12A 1J0IA 3T0DA 2QSVA 4G42B 2UY7A 2WM0A 3F12A 1IFHL 4JZJC 2YRPA 5C2BL 1U0QA 4M7LL 5KS9A 2ERJC 4HUNB 5F9OL 3QHTC 1A47A 5T3ZH 2JKXA 4PJFE 3QHZL 5IFHL 3MJ9L 1GC1L 4GBXD 3KPPB 5CWSA 2DLTA 3HE6D 1QSFE 3L7FB 5IHBA 2YR3A 4K2UH 3GSWB 2C3HA 4PMOA 3B9KD 3EHBC 4N8CL 4F2MB 1S5HB 1X5HA 1X44A 2XIBA 1IM3B 2H32H 5AC5A 5KSAB 3ZHDA 1F3JB 2WP3O 4P23B 4YHOH 4NZDA 2DTMH 2IMNA 1CVSC 3INUL 4AIOA 3QGVA 3WXWL 1LP9E 1ZHKA 4KK8C 4PRPA 5A16B 5IHZA 2MTPA 2L0DA 4WI6A 4BZ2L 4PGCA 5HHVL 4Q9QL 4W6XB 4HGWA 4WO4A 4H8WC 4X6DA 4P46D 4FFZL 1AHWB 5BQ7A 3S36L 1NUGA 1HCFX 2JJSC 1IGJB 4MA1C 1U8HA 1HHKB 4Y1AD 1YQVL 5SWZE 5D7KE 4JPIB 3B9VA 5C7XH 3SDCA 1MCOH 5JZ7D 1XF5A 5SX4I 4OZIA 5EC1A 2W91A 4D0BA 1DFBH 1QNZH 2P5WE 1MLCB 1MCDA 1S9YA 3T04D 1ZV5A 5T1LA 1YEJL 4NSKA 5IB1B 3HR5A 3MGOB 4J8RB 1KV3A 3S34L 4D6IA 1RULH 1N82A 4MDOA 2ZOKB 4POYA 3VXSA 1G0CA 2E6JA 4D94A 2VDOL 3U0TB 3WH7A 3A6BH 1HOCA 2R1XB 4QXUL 4P59L 5I24A 4RISH 2ZX5A 4D0CA 4OCWH 4PTVA 4LNRA 2GK1A 4OM0H 4G8EB 3EYUH 5IB2A 3WFHA 4Y16B 5F3BA 3IJ9A 4YHGA 4LCIH 3RM8A 1BGXL 1S5IH 3IETB 2F74A 4R4FH 1BBJB 1X5AA 1GCFA 1VPOL 1MHPL 2NY4B 1N8ZA 2AJZB 3C6LD 2O93L 3MROA 1BEYH 4X9HA 4WJXA 3BSZL 4MD5A 5E5MB 3U46A 4Y5YC 1AQDB 2VITB 2Q86B 4UFHA 4JL1A 1ZSDA 4F57H 1ZVSB 3DMMC 2CIPA 2QHRH 4UIKL 5HVGB 1KJ2A 4F7TA 4I2XB 1XYFA 3ABZA 3GB7A 4R7DA 5ESVA 5TQ2H 4UOZA 5CSGA 5C08A 4RGMC 1KCVH 2FEDC 4W87A 4GRWB 2AKRA 4XPFL 3FONB 5A43C 5EO9A 5T5FL 4FQJH 4J6RH 3SUUA 1G9NH 1FFOA 1E4IA 3WDJA 4PJAE 1UZ6F 3ZKSD 2YJQA 3RP1A 3BD3A 2H2PC 3GSUA 5DMKA 5LGJA 1T20B 1EBAA 1HINL 5E70A 4WKHA 5GRVL 2WMHA 5ENWB 4UIMB 3E1F1 4E9LA 3RZCB 1W9PA 1K9FA 4LGRB 1D5ZA 1CLCA 1D6VL 1RZGB 1U91A 2EH8L 6CGTA 1YECL 2B4CC 4U2ZA 4EI6B 5MEOA 1I7TA 4QWWD 1NFDF 4HFWA 3WQ8A 4LGPB 3NSMA 1TCRB 3VXUB 1KF9B 3F7PC 3TO4A 3BO8B 4AEIL 1KEGL 5GGTL 2UZIH 2AK1L 1BYAA 4TSAH 5DVLA 3D3VA 4Y4KD 4CJ1A 5J13B 1TVBA 3HZVA 4EKXA 4OAWB 3MOQA 5DHYB 3RAJH 3PDOA 1IGTB 2AEIT 4XPBL 1AR2A 2O9OA 1UD5A 2XGBA 3GO1H 3I02B 1FAKT 4KY1H 1UD4A 5I5RA 1S7WB 1EAJA 3VXQB 1FORH 5FM5M 2OI9B 4DGYH 1OP3H 3I84A 1G7IA 4X6CF 2EDOA 4KDTC 3SE4A 1T1YA 2P5EB 1G0DA 1K3IA 1JPST 1WDQA 4P4RB 4KK5D 3AYRA 3GBNH 4NKQB 5J8OA 3E6HA 4KI5C 2W5FA 2NLJB 2Y06L 2ZXDA 3HUJF 2DQEH 4NQEB 4HT1H 1MXDA 2DQTH 3UESA 1A9BB 3MRGB 3RKPA 1XD0A 1L6ZA 3KPOA 1A7QH 3T09A 2LTQB 4IS6B 4QY8B 2D0HA 3G6MA 1I9RL 4OB5H 4P3CH 5JIPA 1RURH 5B3JE 4PJIA 5CPSA 1NCCH 1BZ7A 2HFGH 5CJQH 2Z8RA 3BXNA 1ZS2A 1KELL 5KSAD 3ZTJG 4O5LH 4P23D 4X7SH 3TBSB 4XNXL 4K68A 2AQ2A 2A73B 1H3VA 2WHKA 2MQCA 2F5BL 3VOCA 2D7TL 2EIEA 2VXVL 2X9XA 4FFWC 2WMIA 3OL2A 4JPVH 1OHQA 5CCKL 4XNUH 4PRHA 2Q8AL 1U8NB 1B1YA 3GRWH 3I6LE 5EIIB 1WDRA 4H5SA 1WC7B 2GJJA 5BJTB 1JDDA 3QIBC 3G6JF 2V2WB 1E0XA 1JPGB 2CIKB 1FZMA 3OF6D 3WXVL 1BIIA 1CK0L 2CMRH 5DJCA 5HHPB 5KANG 4HX1B 1W2PA 4TPRL 5JOFB 1IVLA 5TE4L 4P57A 3K4AA 3VXOA 1X3DA 4MHHI 3BH8A 4OQTA 5D8JL 1R3LB 1RJCA 4BQ6A 32C2A 3QUXB 4ODHL 4GXVH 4ZUSB 1FNFA 1FVEA 4X7FC 1K4CA 1MOEA 2BVEA 3P0YL 3F12B 2JIXD 1FFQA 4XPHH 1T03L 4Y16D 3A6CH 4Y4FA 5KS9B 3MNWA 4KDWA 3KPLA 1BYBA 2NY4D 1RJZB 4NUJA 5CWSB 1TTGA 5CKGA 5FK9A 4L29A 4GRLA 4IRJA 1W3JA 1RZKL 5KSBA 1KPRB 3WS6C 3W5MA 3LQAL 5CUSH 1FYTB 4P4KC 1OGAE 3I9GH 3CFCH 1L8NA 2GEEA 5CLWA 4O00A 3MRPA 1U8KA 3D6GA 5EUOA 1EZVX 5IHZB 1GGCH 2FJHA 4PGCB 2HLAA 4HGWB 1B3VA 5HVWA 4F66A 5BQ7B 4HOWA 5IR1A 3AICA 1NEZA 4ZE5A 4DN3L 1E28B 4PS4L 1TJIH 3Q5OA 4BKLA 3IF1A 1OAKH 6FABL 3LY6A 3SDCB 1TITA 3CFIC 3SDAA 1DBJH 3S3PA 4OZIB 3L3IA 4D0BB 4J3TA 1UR9A 1F5WA 3RVTD 2PWHA 5T1LB 4JPKH 5EDXA 4NSKB 4BH8A 5I1DA 3HR5B 3UX9B 5J1TC 5E2WL 1UCBL 3RZCD 1YYLH 4WFGD 3RWCB 4QRPE 2H2SD 3R1GH 4GIAA 3NA9L 3QRGL 4UQ9A 3HG1A 2E8YA 3SUTA 5FYKD 1MRDH 3VXUD 2EDHA 3PZTA 4HCRL 4X9BA 3ULUD 4D0CB 1CFSB 4FK9A 1HHJA 5ADPH 4LNRB 5J1AA 3SOBH 2GK1B 2ZKHL 5I1KL 5SWQA 5FCUL 4WWKA 1GIGL 4J3UA 5F3BB 4HFUL 2DH2A 2WMKA 3WJLC 2R8SL 2F74B 3IDIB 5CIPA 1N8ZB 3BGMB 2OJEB 3BAKA 1WAAE 4XBGA 4XP4H 4XMLH 1SR0A 1JFXA 4MD5B 4URIA 1MFEH 1NC2A 2G41A 3CMJA 5T3XL 4JG1H 1I1FA 4M7ZC 3CC5B 1ZSDB 3BT2L 4NIKB 2VDQL 1CL7L 5E08L 3ULVC 4PYSA 1X6NA 2CXGA 1MI5E 2P5ED 3TTOA 1D6EB 3BEVA 4FP8H 3MV7A 4AY1A 5ESVB 3VRIA 3TVMC 5EIQA 5HI3C 4MDJA 2H8PA 3BH9A 3O2VL 1TVHA 4NQED 2CGRL 3P0VL 1F13A 3N9GL 3LZFL 3OAZK 1FFOB 5EFIA 4F9LC 3NAAH 4M6ML 4KRLB 4YC2B 1A5FH 3N11A 15C8H 3RA7L 5DD3L 3GZKA 1DBML 3GSUB 5LGJB 1P4IH 1V3HA 1YEIL 4TX8A 4XAWL 2EDBA 2CBUA 3LS5H 4P5TB 1K6QH 3VGHA 1D5ZB 1U91B 3D25A 2CBJA 2C1OB 5MEOB 3MO4A 1GQKA 3VXRE 4JY6A 5GSVA 4HFWB 3BX7C 2PI6A 1NAKH 4KROB 4JM4H 4TUJA 4YXKL 1BHGA 1RU9H 2N7AA 1JPSH 4HK0B 3WELA 2VAAB 4UCFA 2I07A 5JR1H 3D0VA 2WKLA 1M71A 3D39A 4Q97A 3NABH 3HZVB 3HNTH 2FEEL 3G6DH 3MV8E 3PDOB 3GJFB 3G5VA 2ZCHH 1IC4H 1VJSA 1R24B 4G6AC 2XJ7A 5BW7C 7CGTA 3LQZA 3BISA 1I3RA 3QIWA 3ZM8A 3O9WC 3QUXD 4NT6A 4NFDA 2DIAA 1G7IB 2GI7A 1DWGM 2ZE0A 1T1YB 5DJ6B 3KXFA 4ODBD 1LO3H 5GISL 3RVUC 1EHNA 4LHJB 2X0HA 4LPXA 2DM2A 3MUZ1 1R5IA 3CFJA 3QPQC 5JDSB 1JNLL 1I1RA 3E6HB 4PV9A 1XC6A 1QKZH 1VFAA 2VMFA 3UTSA 1HHGB 2VC9A 3RI5K 3KPOB 3B9AA 3FT3A 5DR5H 4LFHG 2YN5A 4IOFD 4M62H 2V5RA 4WW2F 5IVXE 1ADQA 1WEJH 3ZE2F 4YHZL 1G5AA 3OGVA 5IMOA 1CE1L 2EEAA 4UDUA 3TJEH 3ZTNH 1RMFL 5T1MA 2WMPA 1FYTD 1K5NA 4NKIH 1ZT1A 4L4PA 1A3RL 1MJ7L 4DGIL 3LEYL 4TSBH 3FT2A 3ZO9A 1B3JA 1ZLVK 4HC1A 5DD0H 2GAZB 5FECA 2FO4A 4EIGB 5J3HD 4DGVH 2WMIB 1NCAL 2BNUA 4RDQF 1BF8A 2J8UA 4H04A 4MXQC 2XOTA 4PRHB 2WUBL 1F4XH 4U5IA 5HI5C 2BXZA 4LARL 1VAHA 3RY6A 3PWLB 3SDCD 4XUYA 3HE7A 4WSKA 2XXCB 3CFKA 4W8LA 1UWRA 1MWAL 3BD5A 1GAFH 2W60A 4G3YL 3WL0A 3WF3A 1BIIB 5DJCB 1KGCD 3QOKA 4K3DH 3BCFA 5BZDB 1HKLL 1VRXA 1MAKA 1DQDL 3REWA 4KTDH 2O9RA 1RZJC 3VXOB 4LSRL 4JN2B 4PJ7B 1FJ1A 3BH8B 5I1GH 2GJ6E 3LAFA 3U30C 5EU5A 2NXZC 3K1DA 1A7OL 2OYPA 5JW5B 1QACA 3FO0L 3FFCD 4K55A 5ECJE 4OZHE 3WE6A 1B0WA 1BG4A 3EDEA 4JFDB 1K4CB 3QIUA 3MRHB 5C0DA 5JPMA 1ECEA 4JFHE 2KL6A 2XWEA 1N6VA 3OKOA 2X6MA 1V7ML 1YC7A 1M7DA 3RWHB 3TPUB 4EDWL 2R56L 4K7PY 4U05A 2ZXBA 1T0MA 4LSSL 1KPUA 1A7BA 5I17B 4ONFL 4NUJB 2JFEX 1GSMA 4P7RA 3IDYB 3RHWK 4IRJB 3SO3C 3W0KA 2OMNA 4EN3A 3FB6B 5KSBB 4UDTA 3CHDA 2X5PA 2DQFB 1HKFA 3QCUH 4NN5C 3WCYA 1TETH 2AP2A 2GHWB 4NZJA 4YHML 3LH2H 5JUVA 1U8QB 4HKZA 2B2XL 5EUOB 3R8QA 4E41A 1ZK9A 4PB9H 2FJHB 3MKKA 4AH2A 1JNHA 2HLAB 1PD6A 1U3HB 5D7LA 4D3CL 4AT6A 1C8QA 1NFKA 4RQQA 4OCSL 4W84A 4NQSA 2UYLB 4KAQH 5IR1B 4BFIB 3UTQA 1BVLB 1N59A 4GLRH 1T89C 1J11A 3KLHD 5I2IB 5DJ0A 4IJ3C 2OBGA 3OAZH 1XCTA 1TFHA 1A9EB 2ICCA 4IMKA 5IBTH 4ONGL 3GI8L 1LMKA 2GJXA 5A95A 5KZ6A 1JWUB 4BH8B 3BEWB 3JVGC 3RUGE 2BV9A 1NLBL 5HJ3B 3DBXB 5ID1A 2R2CA 4P5TD 1NCUA 2MNUA 1GGBH 5JOPE 4YK4B 5TE6H 1A14L 3WIHA 4M1DH 5A6KA 2QJDA 1PQZA 5FAAA 3HG1B 5FYKH 3NZHL 3PP4H 4CN1A 4UILH 4XVSH 5DGQA 4J3OC 3ULUH 4H1LB 4KROD 1DQMH 5K59E 1UR4A 4M6OL 1HHJB 4XP9H 3WDHA 1E3XA 1OTTC 3K4ZA 3MUGA 3MCLL 4KWUA 1KFAH 4R2GC 3T8XB 4W8BA 3OMZA 4P99A 3QFJE 4WWKB 1BM3H 4KKBD 1G6RB 3RTQD 4N5ED 3UAJC 2F54E 3Q6GL 2FB4H 2QADC 4L8SC 2D0GA 3H7LA 5CIPB 4ML4A 3OJMB 5EU7E 1FL6A 2LU7A 3GSOA 2QV2A 4MJ6B 2HTLC 1NANH 1MCBA 1NC2B 3MC0A 2MPAH 1UM6H 5FL0A 1I1FB 4OIIH 4MLIA 5GJTL 4GW1A 2PETA 3I50L 1JZ6A 4G8FA 1RZIB 4GSDH 4UI2A 5IKCB 1EUTA 2HLFD 4XWOD 1KTDA 4LLYA 5D7JC 1WCQA 1R85A 3QUZD 1DQQA 1UKPA 1F2XK 2VVSA 3MV7B 4XRCA 4R97C 2WW8A 3N06B 3C9NA 3QG6A 4FQLL 2H8PB 1NWRA 3BH9B 1PLGL 4LVNC 1HYRC 4H88H 2FX7L 4FABH 4OCRH 1VGKA 2FSEB 4M43H 2HFFB 2NW0A 1C7SA 5EFIB 2BVPA 4KVNH 3MNZA 2EE2A 3LMYA 1XF2A 1WZ1H 2VERN 3FOLB 1FE8L 1K9DA 2BDNL 4NO0D 1IC1A 2IQAB 4RGOH 1NWTA 4CCCA 3D9AL 2X1WL 1KTRL 4JFYA 3WUGA 3D25B 3MLUL 3K2UH 4I0KA 1ZLVH 5GSVB 3BN3B 1ACZA 2K3TA 2XA8H 1G9MH 3S4SA 3MJ9A 4RE2A 2V7HA 3HAEA 4JQVA 1RUAL 2BNRA 2WSKA 3GGWB 5DD6A 4L3EA 3IKCA 5IG7B 3TV3L 2I07B 1OTSD 2AK4E 3D0VB 3GJFK 3UO1H 3B6SB 4W5ZA 2AS5M 3D39B 2E9WA 1RHHA 1DDHA 2PWEA 3FY1A 1F4HA 4LAQL 3KJ6L 5C92A 1BX2A 4GFTB 2YD3A 3STBA 3DUSA 3AAZA 4AJ0A 5H8DA 1ZEAL 3LQZB 3NH7H 1I3RB 3NCEB 3ARGB 3QIWB 3NOIA 1O0VA 4LK4A 3O4LA 1WO2A 4NT6B 4RZCA 5DUPH 2VVNA 2ZUVA 5FHAL 4JFDD 3WDQA 1QSEE 1MCWW 1P7QA 2Y23A 2NY5C 4ZYKB 1CLOH 5I1EH 2VLKB 3CFJB 4QCIA 3Q1SL 3CU7A 4PV9B 3U2SB 3G9VA 1CQYA 4J3SA 1VFAB 3TN0C 4NJ9L 2WIIB 4H25A 3IJ8A 5BROA 3F7YB 2HRLA 4K8RD 5GXBB 5CSYA 2OTUA 1WIUA 4WI5A 4NRZB 4U0QB 3BD4A 4TN9A 3BIBX 4HJJH 4KKCC 3FW6A 5DF0A 2YD1A 4YLQT 3OZOA 1ZT1B 4XVJL 4OOUA 4P2QE 1A6VH 4NNYB 3OZ9H 4RNRA 3FT2B 2CUHA 1UD2A 4M1CD 3HMXA 1MIML 2A0LC 5CBEB 4OLZL 5JOEA 4ZE4A 5FECB 1U3HD 2XZAH 4KV5F 2BNUB 2DQXA 7TAAA 2J8UB 1B30A 2VL4A 4FFVD 1E71M 3QCTH 5IMMB 3G6LA 4WJ5A 1G0YR 2E8ZA 4YGAB 3U0PA 2EICA 1FL5B 3GBDA 3B2VL 2BNJA 1YNKH 3MCKA 2VDPL 4XCNA 5GRZA 5GRWA 4JFSA 3U5UA 3CFKB 1DQJA 1YN6A 4DTGL 3AXXA 4OLEA 1IGIH 1F58L 3O2DL 1SVCP 4DKFL 2BNQB 3P40A 4KC3B 4QAWA 3P9MA 1JIBA 2ADIA 5B8CA 2HT4C 1HHHA 1FZJA 4U6YB 3PHSA 1UH4A 4QRRD 5DJAB 2AI0L 5EU5B 3ARXA 3HG1D 2RCSL 3RNKB 3VFUB 2B8OT 4Y4HA 2EYRA 1UQZA 1C7TA 3VWKC 2APTA 3WE6B 3VIGA 3C5ZB 4ZFZB 3WO4B 5A2FA 3P9WB 4H7VA 1EK3A 1GZQA 5C0DB 3SPVB 3TC9A 3VFVA 2NNAB 2X1PA 4WWKD 1CVRA 3OKOB 2DIJA 4GRWF 4IHOA 3V7AE 2A74B 5C6WH 2YKKA 1MREH 1M7DB 2DICA 4GXUM 4PGZA 2QMKA 1KPUB 5AWNH 4LSTH 3MODL 4YUEH 3VXNB 3KYNA 3VFGL 2A3EA 3QHNA 4XC3L 3MCG1 5HDBE 5T5NF 4EN3B 4K94C 1NC2D 2DQDL 4X5LA 2FWOB 3EOAA 5F1NB 5IHUL 1DWAM 2Q20A 3SJVE 4G6JL 1S7XB 1BFOA 4ZODA 2DOCA 3H7BA 4X4XA 2GCYA 2W38A 3QWQB 5GGTA 3KYMB 2PW1A 3IFNL 3MV7D 4Q58C 1VBUA 1QSZA 4KVCH 1JNHB 4AH2B 1WT5C 3EO1A 5D7LB 2JTDA 4K7PH 1Y6KR 3KDMB 2VDNH 2J2ZA 4RQQB 4Y89A 5GHWL 1XRVA 4HIHA 3ULUF 3UTQB 5T33L 1H3XA 3P77B 4OF0A 4H8VA 1N59B 1KNOA 4BYHA 2WYSA 3EO0A 5INDA 1IAIL 2ICWA 2IPKA 2BS9A 1X5LA 5EG6C 4LFHD 4AZIA 1FVCA 4TUKH 5A6BA 3KNBB 1TJHH 4LU5H 3ZKMD 1LF1A 1MCLA 3MLVH 1QYGL 4EUPA 4OCXH 5DQDH 5ID1B 4R4BB 2E7LC 2UWEE 1UA7A 2ITCA 3TBVB 3OBAA 2DB8A 4OSUL 25C8H 4D6CA 1J12A 3IDXH 2EO7A 4JRYB 2MQ0A 4JZOB 2XTKA 5C09E 3UBXA 1OM3H 2X4TB 4M5ZL 3V5KA 4Z7UF 2EDQA 5C0JA 4NO5B 1NGQH 3W2DH 4YDIH 2X4QA 4U6TA 1GGIH 3VFNA 2UZYB 1UJTA 3D39D 1ZOXA 4L4VD 3KYOB 1MCIA 2V5YA 3JXAA 4JANA 3LKPA 5ADOL 3GJFH 1QFWL 2G3IA 4KKAC 4Q2ZA 1FL6B 2OYKA 3GSOB 3KJ4B 4EXPX 3BKCL 1CT8A 1H5VA 4P8UA 3M8OH 4Q22A 1MY7A 1HSBA 4C83A 4ENEC 4GW4B 4GW1B 5DD1L 5FXCH 4DW2L 3OKMA 3ARGD 3QIWD 1AKJA 1MJ8H 4WFHD 4HEME 4PJ5E 1DQQB 2VWEE 1KXVC 3NMEA 4HPOL 1XGQB 4X0NA 2WHMA 2G2RA 4DAGH 4ETQB 2VLKD 2VLME 4QHMA 3GKWH 2WAGA 2LV4A 5FGCE 3TCLA 4NJAH 1RUQL 1VF8A 3UBXI 1E6JH 2I60L 1TZGH 3MNZB 4J3WA 4P8XA 4OCYL 1XF2B 2YC1A 1SBSL 1EA9C 3TWCL 2EPLX 4DKAA 3FO2A 1L0QA 3GIZH 5HYIA 4Z7WB 4GW5A 1BJMA 1WFTA 5BV7C 3IDGB 1BAGA 4M80A 5CAYB 2XFFA 1P7HL 3NTCH 3D85A 3P73A 5MERB 2F53A 3SCSA 3W11C 4R0LA 4A2MA 1C5CH 5IV2A 4HA1A 5CJXC 5ILTL 1G0XA 1LO0L 3EMZA 2YXFA 4UUJA 1VACA 4QHUA 1TG7A 5JXEA 1QHZA 2V7HB 3BPNC 4KRMB 1XF1A 4L3EB 1WCBA 3IJHB 4JLRA 5LWYH 3BZFA 4AL8L 5KS9F 5M5DA 1H9VA 2DQGH 4ZAKC 5H35A 3MXVL 3GXDA 3SIMA 1RHHB 1DDHB 4JHWH 2BNQD 4DEPB 1BX2B 1MQKH 1F4WL 2KQMA 2ZSVA 5E0CA 2JJTC 4NUGH 1ZTXH 5D9MA 1N3NB 1CGVA 4OQTH 4PIRF 4ODUA 4ZQKA 5EFFA 2XN9A 1PX4A 3AAZB 3DUSB 4I4WA 4P2OB 5EU6E 4JKPH 4PLOB 4MB1A 1RI8A 1XGYH 1FCCA 4BQ5A 3O4LB 4O58H 4RZCB 4XCCH 4I0PA 4KZEH 1K9EA 1A3HA 1S78C 2X2YA 1BYCA 1P7QB 3O6ML 3C5ZD 4PJFB 4QCIB 4X6DF 2PBOA 1GZPA 5IROC 5EULV 4F8TA 1QSFB 1XGPA 2B20A 5GGVY 2VDRH 4EK7A 4NO3A 1A4JA 3ZJ7A 4H25B 4JN1H 4FQQB 4Z2IA 2J8FA 1FNSH 3PGDA 4K8RH 4S1RH 4W7WA 3KL3A 4EN3D 4OZIF 3UROR 4LXFA 3AB0C 1FHDA 4V27A 4FFYL 1QNQA 4X5XB 5C0BE 3V6OC 3E8UL 4IDJL 2WNGA 3PV7A 3GNML 4HCRA 3BKMH 4RNRB 2YA0A 2OSXA 4PLKD 2CBIA 3SQOH 1TA3A 4KZDL 4GKLA 1AXTH 1LVEA 4TTGA 1AGEB 2P8PB 4YHPA 3U36B 1AC6A 2JJVA 5J9PA 1YJDC 5MP6H 5HGAA 1Z0MA 3DV4B 3GH7A 4LCWA 3DRTA 3W28A 4OTXL 1BBDH 1R5WA 4M48H 1UKOA 4Z7NF 1DUYB 5D8ZA 1D7FA 4IM4A 1SVZA 5I1HL 4XCNB 4U7SA 3H42H 3W39A 1DQJB 1C8PA 2WXDM 1MHHA 2EIDA 5KVMC 2LVEA 5DLML 4JKWA 1L0YA 3VDCA 1A8JH 1DP0A 3TYGL 4OUUA 1V03A 5B8CB 5DUBA 1HHHB 3EJZC 1FZJB 3HCVB 3AS0A 3BZEA 3ARBA 1O7AA 1XH3B 1BP3B 4G7VH 4JRYD 3WF4A 1GOFA 4H1LH 3QI9A 2WPGA 4WFFE 2FGZA 5I71B 4B9ZA 5K9QG 1SQ2N 4ODSL 1J8HE 3GKZA 3SCPA 4EOWL 1E9LA 3IDJA 2Z1SA 1EJ6A 3MLWH 1G6RH 1T1WA 5JLZA 5CEXA 2BRRH 1KXQA 5DEFA 1Q38A 1UZ6E 1CD8A 3KYNB 1U36A 3VX0A 2CKBA 3MA9H 1X1NA 1QHPA 5L2KA 1U8LB 1RP8A 4H41A 4Z2LA 4K3EH 3LKSA 1D5MA 2AOSA 1CG9A 5E6YA 5K9KB 2N56A 1E27B 3FQNA 1WBYA 2NX5E 2XTJC 4NQDA 2R29L 2O5ZL 3P4NA 4KUZL 4ZFFB 3VWJA 3H7BB 4X4XB 4GXUN 2DS4A 1ACYL 1NFDE 2CO7B 3FN9A 2OSWA 2PW1B 3CVIL 3QDGE 5SWSE 2GUOA 3WN5C 4NHUA 3X3FL 5HBFA 1OP5K 5AZ2L 1A3LH 1HNFA 4PR5B 4M1GH 4MAUH 3QUKA 2DGAA 3G5YA 4HIHB 3NCMA 3RPIA 3EO0B 3SKOA 3DUUB 5INDB 3WIFB 5BXTA 1D5IL 1JF6A 3G9AB 2ICWB 2IPKB 4OZGA 3HI6L 1JFQL 3AY4C 1Q1JL 4LIQL 5EIVA 4KRNA 5C0AE 4CL7A 4HQQH 1FVDA 5E09A 2HVJB 1MH5B 1EJOH 2ZG1A 5BXRA 3EFFA 5J0BA 1F6FB 2ITCB 5TGBB 5CZVH 5A69A 4QEGA 2YPLA 4X6CE 1VFMA 4X7TA 2D7NA 3DXAE 3W9DA 1T21A 3DWTA 5CD5C 4Z77A 1WB0A 3V5KB 1BZ9A 3HUJE 4QTHB 1AGFA 1CLZL 3MUHL 2V9QA 3WHXA 5E6ZA 1OM0A 4JPWL 1H5BC 4DUVA 1I4FA 1J10A 4UNVA 5GSRA 3VFNB 1YEGL 3NN8B 2CLZB 4JHAL 2BJML 4JANB 2LU3A 1H3TA 4BH7B 3SCMC 3S88H 3FQRA 1HE7A 4JGJA 2VH5L 1CT8B 4PJIF 5IJKA 4P2OD 1S9XA 1JV5A 1P5VA 5AD0A 1IM9A 3MLSH 1ZBWA 2P42B 5EB8A 1F90L 1BQLH 4M7LT 3B9DA 3O4LD 1AKJB 3MLPA 1R3HB 4PJ9A 1KLUA 4AY0A 1YEEH 1ZANH 3K8KA 5F1KC 3W82A 3VNYA 2ADFL 1P7QD 3REVB 1LWHA 3UETA 4GRMB 4YX2H 4MA8H 4QHMB 3WSQL 4K3HA 2X4PB 3FQUA 2UY3A 1MWAA 5EMYA 3LPFA 1P9MC 4MADA 1QSFD 3IVKA 1J0ZA 1SHMA 4Y5VC 1LQ0A 2Y7QB 4UTBL 3G6JE 4L9LB 1UWSA 3KS0H 5CXPA 2EIZA 5BZWA 1YY9C 3QEGH 2E27H 4QOKE 4R26L 4ALAH 1OL0A 5T3ZE 1UB5B 2YC1B 1D9KA 1I8IA 2VRKA 2E9IA 4C4KT 2B31A 3KYKL 3FO2B 1RZ7L 3O6FC 1TZHA 1U30A 5DWUL 2AJVH 3ZT5A 3TJHC 4HJGA 4JFQA 1WSST 5KN5B 1GZJA 3AJ7A 1PY4A 3ULSB 3VFWA 3P73B 2DMCA 1QTYT 5IV2B 3C6SA 4TSCL 1RHFA 3T0EC 5C0FB 5SWZD 1PFCA 5D7KD 3SBWC 1AR1C 4UUJB 1MFDH 1VACB 2AXGB 3S3JA 4X6BA 3WSUA 1HQ4A 2P5WD 3LOWA 3RX5A 4RWYL 4I3RL 2I9TA 1AGBA 4P9ML 4PTUA 3CSGA 4W8AA 4JLRB 5C86A 3BZFB 2PCPA 4JDVA 5H35B 3WJJA 3BKYH 3QHMA 1XF3B 2VX6A 5EWIH 4KTEH 2ZSVB 5CEZL 1NEUA 4DFHA 5TQ0L 3WYRA 5KSBF 5FOBA 4ODUB 4ZQKB 1UQYA 2Y36L 3THCA 4WF7A 5ITBH 5AZEH 5C0NC 5CHNB 4HPYL 4X4ME 4X6FA 4PFEA 1CDCA 3RWFB 2HTKD 1CICA 3MOBH 4I0PB 3VMOA 5EUOF 3TO2B 5KANI 3RVVC 3RILA 1SJXA 3TONA 5D7IE 1I7ZA 3HLAB 5I8OL 4XHJD 3WNOA 4C56A 5E94B 4YDLB 1KXTA 1TNNA 1XGPB 3RWGA 5MI0C 4ZOEA 4NO3B 2YK1L 5CMAA 4KMTL 4N0YL 3PGDB 4LPUA 3RNQA 5I19H 2UVEA 1GUVA 1I3GH 2YEZB 4MB3A 1BVZA 1FDLH 3RWJA 4MA7H 2OCFD 2CESA 1AXSA 1ES0A 5KSVA 2MOVA 5EZIL 2UY6A 3ME0A 3RGVA 4TNWK 1IT9H 4PSPA 1KR0A 4M03A 3JTTA 2G3JA 4QLJA 3R0MA 5GGVH 1XGUA 4MNGE 4AM0B 2OK0H 1UKSA 1G9NC 3LS4H 1SEBB 1DBAH 3CNKA 4LCWB 3DRTB 5E2TH 1A6UH 3O3EA 2XICA 4QT5A 2J8GA 2I5YH 1U8OB 4WU7A 4XNMA 1RVFL 3O45A 3CZFA 5JPNA 4J1UB 3C60B 3B2UC 4LHUA 4NFCA 5GRJL 3BW9B 3VPLA 3GJEA 5TDNA 1VHPA 3GHEH 3NPZB 3SGDH 3U48A 3WF0A 4QRPB 4F15C 2A9ML 1H8OA 2BCKA 4G6MH 4OUUB 3WIHH 2VQTA 5TE7L 2YUZA 3BZEB 5LKNA 5E8NB 3ZKND 1F4YL 3RPMA 2P24B 3FHQA 1UXWB 3EOYG 1H3GA 2CKNA 3AHYA 2AEPH 3RIKA 5IB4A 3AQUA 1PW3A 3ECBA 1ODZA 4R90L 3IDJB 4NKMA 1ISYA 4G5ZL 2RIKA 1MPAL 2VXQH 3WBAA 3S9DB 1ND0A 5JLZB 5CEXB 3DRQB 3L7EB 1LDPL 4YQXH 5JBEA 5DMIL 5I30L 4C58B 2A3BA 2PYFB 2H1PL 1MCNA 1JHLL 4NN7B 2Z8SA 3S96A 1T5WA 4YHLL 4Z0BH 5L2KB 1CXIA 3RM4A 1MI5B 2XM2A 3U7WH 4LHQB 2PO6C 1AKJD 1WBYB 1SMAA 4OM1H 4FLQA 3TZVA 3P4NB 2ADJB 2FGWL 3X13A 1ZB5A 4IPLA 3E2HC 3OKLA 5HYEA 3AFLA 3B4NA 5JXAH 2WV3A 4UNTA 1DWFM 2FYYA 1JGVL 2GUOB 4NHUB 1M7IA 3QXWA 1MW1A 5L9DL 1UM5L 2NYYC 3PUCA 4YPGA 1X5ZA 1Q0YH 3BIKA 5E1HB 4LOUC 1E4JA 1M05B 2IUZA 1HVXA 4GJTB 4GPNA 1UJ3A 1KJ3H 1W1TA 1Q72H 4N0UA 1R3JA 1X5KA 4NOBA 2DDQH 3AZTA 2XWJA 3S6CA 3UG4A 3PP3K 2BXYA 5ISZA 4R3SA 5DEGB 2EZ0C 1AMYA 3P11H 1TZ7A 4BQ3A 1P4BL 3EFFB 3VXMA 4PGDB 4GKSA 4XNYH 2BK8A 1IFHH 1HIML 3MBXL 2YPLB 1FFNB 3IXTA 5F9OH 8FABA 2XPKA 3ZJ8A 3HFML 4HV8A 2Q3ZA 2VDML 2QLVB 3O8XC 4WW2C 4L4JA 5E6IB 4FFWD 1NCNA 2A6DB 2OR7A 2R0ZL 5E8OA 4OZFA 5EPMA 3MACL 5D71H 4QRUA 4PJXA 3S6TA 5DMGC 4HS3B 4OV5B 4YIQA 1I1AC 3VRLF 2ZSWB 1E4XL 1LWRA 1XV8A 3ZE2E 3WUBA 2V2XB 2G75B 3QWRA 4XBPA 1FRGL 3GXFA 4YNYA 4BZ2H 2W62A 2PYEE 3W0WA 1JV5B 2FH8A 1S8DA 1Z5LA 2W65B 1FFPB 3V4UH 4IIQC 5CGTA 1PX3A 3AM8A 1CDYA 3UYRL 4A4AA 1OY3B 3PWPA 4I0PD 4P5MA 1QO3A 1MFBL 4KRPB 4H2CA 4NWUL 4Q9RH 3EUUA 3QEUA 1P2CA 4XAKE 3QULA 3FQUB 4XX6A 1F00I 2J8UF 3GMRA 3N15A 4NQUA 3HE6C 4E0RB 5IVXB 4CN6A 1VB9A 3C8KA 3DO7A 4HIJA 1MCCA 3O2DA 1WWWX 1ZJAA 3OJ2C 2WVUA 1EXUA 5I8EB 1CGXA 3ESVF 3OKNB 1OGAD 5GIRA 3S34H 2EIZB 1QLRA 2WANA 4GH7B 5BZWB 1D9KB 1UENA 3GSXB 2IH3B 2WQ8A 1FH5H 3EOTL 4M9OA 4M8QA 4QGYA 3KPSA 4HJGB 3L3GB 4MLSA 4LSDA 1FH7A 4CMHB 4JB9L 3VFWB 4P4KD 4P46C 3VI4F 3FHAA 1A7PL 3C6SB 5ABFA 4HU8A 1QNPA 1BGXH 5KOVC 3PZOA 4IDLA 4UV7H 5IVZB 5HHNB 4F79A 2P8LA 5JZ7C 4LCWD 5ABDE 3M1BB 5E99H 4X6BB 1LD9B 5D1XB 3JV5A 1H15A 1YEDA 3RWDA 1JHTA 5D2NC 2YZ8A 3WEXA 1AGBB 3C60D 4PTUB 3BDBA 4G6KH 3WNMA 1L9MA 3MSGA 4RRPA 5FO7A 4GS7B 3H3KA 4M6AA 1YMHA 3WFDL 4MA3B 4QRPD 2FECI 4OLVL 5DZLA 4YDJA 2GJ6B 3VD4A 1E6ZA 1FNEA 1A6TA 3QG7H 1QHOA 1JRHI 3VIPA 4GT7A 3KPRA 3OKKA 1RZ8A 5D2NE 2CBVA 5FOBB 2DQUL 1TQCB 5FYLE 2W9LA 4OZHB 2ARWA 4X6FB 4XPFH 1KB9K 5A8OA 5T5FH 4N5UA 3I6GA 5H94B 1CICB 4HUXA 2CD0A 3GBMH 1MRCL 1A4KA 1CFVL 1PBGA 4UQEA 1NJ9B 2L7UA 1I7ZB 5EOCL 1QBLL 4GMSH 3C6LC 4PBWD 5HYJA 3AXHA 1QRNA 3RWGB 5ID0A 1WBXA 3HRZA 3HC4L 3WH6A 3AIQA 3WNNA 1QFOA 1UCTA 2O9TA 5CMAB 1T6VN 3ZLQC 2XSAA 1TXKA 1BOGB 1YECH 5B22A 1GJIA 2X4NB 4NBXB 4F7EA 1T3FA 5E0FA 3RWJB 1MI5D 5KBNC 1AXSB 1ES0B 5KSVB 5IWLC 2CIIA 4MDPA 4RAVA 2J6EL 3PHQB 3RGVB 5BMFH 4ZXLA 3VIOA 1KEGH 4HBQA 5GGTH 3CFEB 4AMKH 4HXBL 1C92A 3JTTB 4HZAA 3W9EB 1PZ2A 2ZUSA 3TTYA 1NMBH 3GSRA 4HMCA 2DMBA 3THDA 3BAJA 1BD2A 5KTEH 2COQA 4RGNB 5EZOL 4JM2B 1EFXA 4OF6A 2PTTA 4QT5B 4XPBH 2Y72A 1AQKH 4XNMB 1U6AL 3CFBA 5JPNB 4CAGA 4RL3A 2EDXA 3QDJA 1R5VA 4N1EA 3GJEB 2J88L 3RUGB 3S37X 3TM6A 4PY7B 3UJIL 3PWUA 1JGIA 1JAKA 4TTUA 4AENA 2BCKB 2BY1A 2BSSB 4DVBA 4BZYA 2W61A 1KTKE 4XB8A 5L7XL 5JIHA 3O3UN 2YD4A 2YSSB 5DFWH 3EZJB 2IXUA 2B4CH 5M3WA 4YHIA 2H26A 2GFTA 4WUKH 4WU5A 3CTTA 4OFYA 5E6ID 4Y5XB 4ZD3L 2F54B 3ECBB 2JK5A 1I3UA 5IBUB 5I9QB 2F8QA 3MV8D 1CGYA 1ND0B 3QEHB 2D7QA 5LQBH 4XNXH 1LEKB 1DL7H 1UFUA 3ARSA 4MAYA 4APQA 3S96B 5A6SA 3SKJL 2HKFH 4PB0H 4CJ0A 4OT1L 3HNVH 3LD8C 3KPQA 4GO6B 5CILH 5CCKH 1G7JA 3LN4B 4KK5C 3EO9L 3BVNB 3TZVB 1DWIM 1V0KA 3X13B 4UV4L 2DF3A 2XWTB 4OFVA 4KRPD 4AEHH 3SE3C 3O9WD 3F6IA 3RL2A 2WKGA 3UTZA 4LP5A 3IU4H 1CK0H 4OZ4A 4YPGB 1LK3L 5ACZA 3BIKB 3AMCA 5LA1A 3QPQD 3U5YA 3PNWA 1OIMA 3V2AR 2Z8WC 5C9JB 1WP6A 3CHFA 3B5TA 5HYSA 1UJ3B 5B3NA 5KSAC 2R0KL 3LHPL 4P23C 1BJ1H 4N0UB 1D9KD 1R3JB 5A2LH 2XWJB 2V17L 1IKNC 2VURA 5ISZB 4HIIB 4AQOA 3FN3A 3V6ZA 1KBGL 4LLAA 2J4WL 1AHWC 3NIYA 1T03H 3SGDI 4JDZB 5JDJA 5D2LA 8FABB 5T1KA 1N5AB 4HV8B 3ZDXF 3GMNA 1E70M 3W6MA 4XI5C 4FQ1H 2DLFL 1L0XA 2B1AL 4HS6B 3EMCA 5D1XD 3S36X 5L0QB 1RZKH 4OZFB 4WV1B 4LGXA 1CF8L 4P2RA 1PIFA 3MRLA 1H8NA 1MQRA 3V6FB 5IHRA 4PJXB 1AJ7L 3SKNB 1PG7H 3KLAA 2GJ6D 5DRZB 3ZJKA 1A6AA 4YBQC 2D1ZA 3CX2A 3IAPA 5EBWA 4KPHL 1LNUB 2GTZB 5CGYD 3W0WB 5DI8A 2FJGB 1MAJA 1Z5LB 1DWHM 2EPKX 3C5JA 1QBMH 3T2NH 1NP2A 5BS0A 1CICD 6FABH 1QO3B 4PMUA 4WCYH 4Y16C 5EBAA 5L2JB 4KV5E 5HVHB 5F1IA 2DKUA 2HRPL 2YDQA 2EE6A 4LVOC 3T0XA 3SCQA 4AD2A 1C3FA 3NCJL 2NY4C 4MZ3A 3GMRB 2XI9A 4I3GA 1CFTA 4NWTL 4W7UA 3CXDL 5E2WH 5GGQH 1JK8A 4POZC 3PL6B 5GIRB 4JFZL 4DCQA 2CERA 2XQBL 3NA9H 4P2QB 4P2CG 5DTFB 5AEAA 5DT1L 2ORBL 4M8QB 2EE9A 1OLZA 3KPSB 5EZJB 3ROOA 2ZUWA 4NQCE 4HCRH 5IQ7H 1LL6A 5F96L 3RGVD 2J7BA 2EYTB 4KJQD 4P5KA 4HFUH 3DROB 3DNKA 3BDYL 4J3VA 5E8EA 1HX0A 3SKMA 1NLDL 2IAMA 2ICEA 2Z92A 1FL3A 2P8LB 3VU2A 1FZKB 1CECA 2WUCH 4L1HA 5IJVA 4G8IA 4JM2D 1HXMA 2XVLA 1H15B 1YEDB 1OINA 4GRWE 3RWDB 3WEXB 3RVTC 1A0QH 3D48R 1N6QL 3BT2H 2EDJA 1AE6L 4KQ4H 1SM3L 3A0OA 3QDMA 2VDQH 1CL7H 5E08H 5A3HA 2EQDA 4TX6A 3RZCC 2EEBA 1YMHB 3TH2T 4JZJA 4NP4L 2EECA 4V2CB 5JOPD 2H2SC 4YDJB 2XIDA 4DN4L 1FO0L 5A6LA 5B38A 1R3IL 3KPRB 5A8NA 1RZ8B 4WEBL 1PZUB 3EDJA 4ZO6A 2N1KA 4ZDHB 3CDYA 1NL0H 2PW2A 3O2VH 5A8MA 3VXTB 3QUMH 1E4KC 2CGRH 3U9PH 3ULUC 1NDMA 1DBBL 4ISVA 3WFBL 3F6LA 2ZOLA 2YUXA 3I6GB 3QFJD 4HUXB 1DTUA 4JRXE 3DVGA 2NR6D 1MUJA 4M6MH 2F54D 5J13C 1DVFB 5DD3H 2W1NA 4M56A 1J9YA 3ULUE 4XAWH 3MMUA 3B9EA 3L4VA 2ZNXA 2KUTA 1J5OH 4P9HL 5E95B 4ODWA 3ETBF 1DLFL 5BVPL 1JZ2A 2VNCA 4M1RA 2JJSA 6TAAA 3UAJD 5C0EB 1KPVB 1PKOA 4O9HL 4AIXA 3CUPA 4F7EB 1T3FB 2OI9C 1HKKA 3TGXA 2NY5L 2OWXA 1E6QM 5IEHA 2GJZB 1DWJM 4TVPL 1OF2A 3IJ7A 1M6OA 4W5UA 3QR3A 1MCHA 1VCAA 2VXUH 4AD3A 2VLLA 1MVFA 3FTGB 3CK0L 1BJ1J 2G5BB 1ZA6B 1G7LB 3MSPA 2LTQC 1EAPA 2YD5A 3I2CH 4Z7UE 1BD2B 5DJZA 1I7RB 1JYNA 1U8JA 1I75A 5DFVD 2PTTB 4LLQA 2D7OA 3H0TA 2Q6WA 2GY5A 2W07A 1DCLA 3QDJB 1R5VB 3MBEB 3N1PC 3JUZA 2YMXL 3JTSA 2RFXA 3H3BC 2J7LA 3PWUB 1UG6A 1H11A 4D0DB 3Q6FB 2WZEA 1KLGB 2YIHA 3LKNB 5BRZA 4O2FA 1JGLL 2WWCA 5FUZH 1UQSA 1ZWIA 5C09B 4LCUB 1G9MC 4Y5YA 3MANA 4YHIB 4YWGL 2H26B 3WMBA 4WU5B 3RJYA 5F8QC 2APWA 1LE5A 3ZHLA 4NNXA 4YE4H 3VILA 4H26A 3DI3B 1HWGB 2F8VA 2JK5B 4X9GA 2VZSA 1DSFL 1A1MA 5JORA 2C5DC 1RMFH 4WY7L 2V2TA 4HH9A 3N85H 2F58H 2DSUA 1MJ7H 5ITFB 1LG1A 3OB0K 4DGIH 1AY1H 1T4KA 2IPUG 2R4SL 3EGSA 1KB9J 3QWRD 5L8LB 4APQB 2VCBA 1F11B 2X05A 3BP4B 1TVDA 1CD9B 1US3A 3QUXC 3POCA 2AEQH 2YPKB 4PJ5B 3T0WA 2DRUA 1NCAH 4X4ZA 3BLKA 5T1DL 1PKQA 1G7JB 4C54A 1U58A 2WUBH 5E8DL 3W29A 5K9JH 3MXWL 1NFIA 3OGSA 4PJGA 4JGMA 2ARJA 3RL2B 1CBVH 3FQTA 4K7FA 2V38A 4AZCA 2IMMA 4G3YH 3S2CA 4PP2A 3LN9A 3BDXA 1FPTL 3QQ4A 1YNLL 1S7SA 4OZ4B 5JBDA 4GQ9L 1DQDH 3DV6A 2ZG3A 3RY4A 4Z7QF 4LSRH 3L9RA 5KS9E 5HYSB 5IFAL 3PL6D 4P2QD 4M8VA 1A7OH 3LKRA 1N4XH 1ZT7A 2D4DA 4PYGA 3D2UA 1O7SA 3KPSD 2XY1A 1WFOA 2VXTH 5LGHL 1E5JA 1IAOA 4WDIA 3V6ZB 4S1QL 5J3HC 3HJEA 4BSVB 1E6XM 5LCVH 5EOQH 4CRPA 3AS1A 4K3JH 1SJEB 1MFUA 5D2LB 1NCDL 2HJFB 5T1KB 1KCUH 3WF2A 1JNEA 1AFVL 5IW6A 4PRPE 4S11A 5E8PA 3SDCC 4ONFH 5D1ZB 4AQ1B 1XCQB 5IF0B 4X4YA 4PP1C 1OW0A 3N18A 4X6DE 1ZHBA 2KQNA 2I24N 4KDTA 1WBZB 1J05B 4P2RB 4IISA 3MRLB 3MRIA 1CD0A 4U1GB 2M8XA 1JUFA 3QUYB 3U7VA 3KLAB 4QRSA 4OZIE 1A6AB 1Q9LA 3P0GB 1TENA 3QH3A 3VE0A 5DJYB 3KPRD 3WFZA 4CVXB 4EQ2A 2CDEB 2WVVB 4JFVA 1EV2E 1UG9A 3GUTB 1FV1A 1JGUL 4HG4K 3MO1B 5D7IA 3X3GL 2W9EH 4MXWH 5BS0B 4N0FB 2BVOB 3WKML 2R2BB 1Q9KA 3QXDB 3QHFL 5H37G 4U1KA 5F1IB 2VT0A 2WBKA 3JV6A 1GJWA 5IMKA 1DVFD 3VXSE 1YY8A 5DYOA 2AQ1A 3WL1A 2QBWA 5FIPA 3MRJA 3CDCA 4JVWA 1O5DT 1CFTB 3GI8H 2W0PA 2EH7H 3WBEA 4WHYH 4Z7NE 2YWYA 4UNUA 4U1HA 2CLVB 2LFGA 3HB3D 1LO4L 5DS8A 2VX4A 3RVWD 1JK8B 5JHDA 4DCQB 4DZBA 3VIFA 1EHXA 1S7RA 4FQ2H 5FA4B 1ZT4A 2D9QB 4Y19A 3NYDA 3IDNA 1VFUA 2FATL 4G9DA 3UR7A 4LQ1A 2YL6A 1IAKA 1YYML 1P1ZA 3RIAK 1GGYA 3MPCA 4ZUWB 4P5KB 2I25N 3FL7A 1CXEA 5DJDA 1UEMA 4DZ8A 3PWJA 2Z9TA 5E8EB 4PGBA 1UC6A 1HQRA 1IEBB 3NZ8A 3U4BL 2EYSB 4Z5RB 4WLCA 2IAMB 3K1KC 3GBLA 2KZ1B 4KQ3H 3ZYOA 1T66D 1HEZB 3A67L 4YC2C 4G8IB 5C08E 2C26A 1MVUB 4LLVA 2ZJSL 4BJLA 3VFSA 3OR6B 1IGML 4KGLA 1AXIB 5GJTH 2PKDA 3I50H 2BOCA 3MBED 3S3SA 1IILE 4HULB 4LLWA 3QJFA 3QDMB 3DYMA 2D0FA 4OLUL 1QSVA 4P5TC 1C1EL 2EXWD 1S9VB 5C0GA 1BECA 1OCWL 2X40A 1L4IA 3L2LA 5B38B 5JQ6H 3O2WH 1HH9B 1IAIM 5F88B 1HJSA 5C09D 3TBTB 4KROC 4ZS7H 3WS6A 3HKFA 1E6NA 1J8HB 1NGYA 4BQ4A 2AJUL 1V3IA 3GMMB 4AK1A 3O41B 1QI3A 3QQ9D 2MHAA 1W72H 3DVGB 1XYZA 1MUJB 3MJ7A 4KKBC 4OLWL 4WI7A 4DK3A 1K85A 3L4ZA 4PSRA 5IEKA 1BREA 3ZO0A 3BJLA 5FV1L 4XZBA 4KK6D 4FNLH 3U79A 2GSIB 1WWBX 4YDKL 3BZDA 3SDYL 2VN4A 4LSQH 2VCCA 3D9AH 2BSTB 4HSQA 3D3VE 4ODWB 3CSPA 1BGGA 4KKNA 3MLUH 3CUPB 3DX6B 3S5LB 3SCWA 2NX5B 1EEYA 4OZGF 4XWOC 3T77A 4PJ5D 5K9QI 1G7MB 3Q3GA 3SE4C 5IEHB 4NN6B 1J9CT 3QDGB 3EFDL 1OF2B 1YMMA 5JHLL 1QFWM 1M6OB 2OM5A 2VLMD 3MOAH 4ENED 1HT6A 4IRSB 2WNWA 1RUAH 4JR9L 3NCOA 4M8UA 4OUOA 1IBGL 1I85A 4EAMA 1IV8A 3TV3H 2ID5A 4NZTL 5ICXB 9CGTA 4E2OA 1DBKH 3V52H 2DIBA 3OAYK 1EAPB 4OGAD 2PTUA 1NARA 5DT7A 5BO1L 1FGVL 1FN4A 1YA5A 3BHBB 1JTTA 4LLQB 1W0WA 2J12B 2RQ8A 2E3VA 2DDXA 3H0TB 5C0AB 1PBYA 3RVXC 1YQ2A 2P4AB 1XCWA 4ODXB 1YJDL 5MEQA 5FHAH 4PJIE 4X6CB 4JG0H 5BRZB 4O2FB 2BSRB 3TIEB 2CDFB 4GUPA 1UQSB 3THML 3TA3B 1NOUA 3OLDA 3T08A 3ARTA 1QNSA 1A6ZB 4HIEA 5DUML 5T1KD 4NJ9H 3SHSA 2F8XC 3H9HA 5D1ZD 3T4AA 2PF0A 2DYPB 4BQ9A 4S0SD 4H26B 5FKPB 4LCCB 3WH8A 1MLBA 4PRHE 1A1MB 3E6FA 2V2TB 3C5SB 2V9RA 1ZKAA 1QPXA 2EPOA 3QUYD 4U5KA 1WVZA 1T4KB 5EU6D 4BZ1L 1F02I 4Q0XL 4HXAL 2A2QT 1N0XL 5HPMA 4OLZH 4KKLD 1NQBA 2R2EA 2W0LA 4TOYL 5MENA 1VDGA 4F9LA 2IBGA 2V5CA 2YBTA 5J6HB 3EYQD 1PKQB 3MRQA 1LEGB 1U58B 2FJFB 3V0WL 2WWKO 4AG4H 3FQXA 2V5MA 1TLKA 5D1QA 1HSAA 1TVNA 2APXA 3VRJA 1JN6A 2IGFH 3PIQB 5DSCA 2VDPH 2ARJB 1OP9A 3S35X 3FQTB 4K7FB 3RY5A 3PG2A 2XM1A 4DTGH 3II1A 3ARDB 3G6JB 3JWDH 4HZLA 4PP2B 1KCRH 2GT9A 1S7SB 4U2YA 3IDYC 5CSBA 3PQYA 4IRJC 3FMGH 4QOKB 4K8RC 3CHEA 2NZ9D 4ZOAA 3L9RB 4CVZA 5C0BD 4YO0B 1LJYA 3TP4A 1QPKA 2OTWB 3CLEL 3EYVA 1HWHB 4HKXA 1BVKA 2RCSH 3LKRB 3IGAA 3D2UB 4M1CC 2WK2A 4HUUB 5IK3A 1G1YA 5C0CA 3IRPX 4NZUH 3OPZL 1U3HC 2CH8A 1JMZA 2QF8A 4FMVA 4FFVC 3MR9A 3V4PL 3W4RA 4S3KA 4BS0A 5LXGL 4YXHL 1MWOA 2QQLL 1WKYA 3WFLA 4LGSB 5EUOE 1DQLL 5IW6B 3H9YA 5F89A 3MODH 3P9LB 3PDGA 5EO0A 5I79A 2TAAA 1ZHBB 4E42A 2C0HA 4TULH 4PRNB 4TVCA 1B0RB 5DRWB 3D69A 1BZQK 4O51A 2HJLA 8A3HA 1ETZA 4G6JH 5BOPA 3QDMD 1UZ4A 4MJIA 4FQPA 4XNQB 2J6EA 2WC3A 1HILB 1L7IH 4YK4C 4QRSB 1MFAL 3KWXA 4R8WH 4XPTL 1Q9LB 3QH3B 3VE0B 4RDQG 1PX8A 3IFNH 4Y2DB 1R87A 3W81A 5C07A 5GJSL 4QCFA 3N04A 1DUZA 4WFFD 3AREB 5JNYB 3L5WB 1MHCA 5D7IB 3UZEA 3DX9A 1J8HD 5FDYA 4LSUH 1CXFA 4HIXL 4WWKC 1UWXK 2OL3B 3HG1E 4ZSOA 3OZPA 4CBPA 3L5XH 1KTLB 4AD4A 1T2QL 1EMTL 2P43B 1IAIH 4XP6L 5HGDA 1X5YA 3SDDA 4NM8L 3SE8H 1U8IB 1YY8B 2NZIA 5DYOB 3GMOA 2ICES 3IAQA 2EO9A 5DO8A 1CR9H 1FAIL 3MRJB 3PZNA 5J7CC 4O02L 7FABH 5GZNC 1Q8MA 2OP4H 5F7KC 3BE1L 3QQNA 1QYGH 3IDMA 4HF5H 3UYOD 4S2SA 5GPRA 5DS8B 1M1SA 2CRYA 5DDHB 3M45A 2VR9A 4OGYH 4R9HA 4UU9A 1AD9B 3AUVA 5JHDB 1M04A 2JB5H 4JZNA 1AI1L 3G5ZB 4OSUH 4Z7VA 4YEFA 2NX5D 4FA8A 5J56B 4GG6A 3U4AA 4N1CA 5IB5A 2XVNA 4XCEA 1YHTA 5E56A 5SWSD 3IDNB 3QDGD 1OOAA 4IRSD 4MNGB 3V6BR 3KPNA 4K2UL 1P1ZB 1KC5H 3H3PH 5DJDB 3PWJB 5ESAA 2FLRT 2OQJB 4LASL 4PGBB 1HQRB 2HKHL 3NZ8B 1QNRA 2O5YH 4YHOL 2DTML 3MV7E 1JGEA 4LDEB 5FO8B 1QFWH 2DL9A 3GM0A 3NGBB 4YHNA 4LLVB 4I3SL 4Z9KB 3O3AB 5C0AD 1WQVT 3HZKA 4JZ5A 4DW2H 2PNDA 3DURB 3ZKMC 1T83C 4LLWB 3QJFB 1IJ9A 3JV0A 3BUYA 1KIQA 1SEQH 2XIIA 5C0GB 4HPOH 12E8H 4KMLB 3WLWC 5C7XL 4W81A 5BRZD 3W24A 1UXSA 3HC0B 2KH2B 4BSWA 3DXAD 1MCOL 3LN5A 4LLMB 4GAYA 3WD1A 4M7JH 3AMGA 1U3YA 3TA3D 1DFBL 1QNZL 1AD0B 4U1LA 1RUQH 1CDBA 4RAHA 1NGYB 4TUOB 1T6WA 5A2AA 3ECQA 2DYPD 2I60H 3I6KA 3CBWA 4GAFB 3LPPA 4OCYH 4X5WA 3SCNA 4NZCA 1SBSH 3TWCH 4OKVB 2YL5A 1D5XB 1QD0A 3RJDA 1H0DA 3SGEI 4RISL 4I9WE 2IPUK 4FQXB 1DLHB 5DD5L 3ARGC 4JY5L 3QIWC 3D39E 4QHNB 1U9KA 4HP5A 3VIKA 1LO0H 1T89A 3WD5H 1EEYB 1FZOA 3T77B 4IRZH 4LCIL 2DPEA 3LCYA 3BQUA 4R4FL 4JFEA 3BPCA 2X1QA 1UB6A 5GS0L 2VKWA 4HWBH 2Q76B 2JLLA 2AGJL 3VX1A 4ZPVB 3WQVA 1JYWA 4UB0L 4WHTA 4OI8A 1W9DM 4AL8H 5HBBA 4JFOA 4LLDB 4PPTA 3ARDD 4XMPL 1W2VA 3KXFE 1EEQA 4CADB 2QHRL 4HGKC 5EZLA 4QOKD 4EVNA 1HVQA 4UT9H 2JJWA 3BRDA 1FN4B 5KW9L 1GRWA 3ALWA 1BQHG 1W0WB 1BTCA 4JHBA 2HP4A 5CEZD 4BM7A 5TQ2L 4BSJA 1HKMA 3UTSE 4AYFA 2QQNH 3DARA 1EH9A 3GSQA 4PJXF 2CUIA 4XC1H 5GGUB 3VRLE 4YBLB 5C1MB 3D2UD 1YY9D 4G80A 2OR9L 3F7VA 4WTZA 4J6RL 3RWIA 2CXKA 1NGZB 3MRBB 4L8SA 1BQUA 1V6XA 5BV7H 1JMXA 4GUPB 3UDWA 3MA7B 4HIEB 3DOSA 1RV6X 1QEWB 4LSVL 4PGEB 2BERA 3RY6C 2KDGA 3H9HB 5D72H 1JG9A 3T4AB 4HDIA 5D7JA 4UMGA 1NBZA 1MLBB 3QPXH 4L4TA 3QQ3A 2J8UE 4MNQA 1CXLA 3CMOL 4AZ7A 3SE9H 3LRSA 3E6FB 4FFYH 1FLRH 3FO1B 1V3MA 4IDJH 1B2WH 2ATKA 1MNUH 2PYEB 3GNMH 1M7XA 3U7YH 4LDOB 2DLGA 3QNZA 5BRQA 2XG4A 3NFSH 1K8DA 4Y2DD 3CX5K 4HUKB 4TSAL 1T1XA 2R2EB 5JW4M 2JF1A 1ZHNA 1ZGLA 3GNPA 3AIBA 3MRQB 4QNPF 3ARUA 3ARED 1BLNA 3CH9A 1JF1B 1C12A 4MD4A 3C5ZC 3WO4C 3VI4E 3RAJL 4OTXH 5D1QB 3WD2A 1HSAB 2OYMA 5I2UA 2KZWA 4I48B 3VRJB 1JN6B 2KKQA 3MV01 1GVIA 4JO4L 2HVMA 3GDBA 2VAJA 3L3DB 3VH8A 4Z8FH 2E9LA 1XSKA 1QVOB 1FORL 4XNZB 1OAXL 3PQYB 2I27N 4EN3C 3TYGH 1KGUA 4OKDA 3JWOL 1FO0A 1NGPH 5F7DA 2XNAA 1PY9A 3MRMB 4XP5H 3EYVB 3NCFB 5KZCB 4HKXB 1BVKB 2QQKL 2DQEL 2Y5EA 2KBGA 4HT1L 4PLKC 4P8VA 2DQTL 1PIGA 1E4MM 5B39A 3STLA 1INEH 5IK3B 4UFLA 1UR8A 2LVCA 4ODSH 1LO5B 1JZ4A 2FX8L 1P6WA 4OB5L 4JHOA 3VVGA 4MQ7B 1RURL 1NCCL 3VM5A 1QUNA 2HFGL 3F7QA 3MR9B 4AZGA 4MX7A 1Z2KA 1JGDB 3J7HA 4O5LL 4E41E 5EO0B 5D7LE 4LVHB 2ITDB 5I1IH 3MSDA 3D87B 4YFEA 3QP3A 3D69B 1XGZA 4KTYA 1URLA 4O51B 1RUKL 1ITXA 1KG0A 3L1OL 1Y18A 3K7UA 4WIQA 1GHRA 3OQ3B 4XNUL 4NKDA 4M61A 2CCRA 2R29H 3B2UD 2O5ZH 4KUZH 3GRWL 4DWSA 3TN0A 2E9MA 4X9YA 5J11B 3CVIH 3JUYA 3ARFB 1TIUA 5LA2A 3PGFH 3N9KA 3X3FH 3FRPA 4Z95L 5LG1A 2YWZA 3MMWA 2CMRL 4JAMA 1B9ZA 1K4DA 2B1HH 4CGTA 1D3CA 4LLUA 5H2BB 4YJZL 2E7CA 1B31A 3PXHA 4ZSOB 5KVFL 2Y25A 3EYFA 1U92B 3R4DA 4PRDA 3SDDB 5HGDB 1ORQA 1JFQH 2X70B 3G5XB 3GMOB 5HHXL 4LIQH 1S7QB 4Y0GA 5KOMC 4XB3A 3UG5A 3BAEH 3KJ4C 2ILLA 2V5SA 3IDMB 5BVJA 1KLFA 1KN2L 1JXKA 3WIIH 2Q8BH 4FQXD 4ZUTA 5L6YL 2X4OA 4HW6A 4UU9B 1GQJA 2W67A 4UAOB 4NM4L 4Z7VB 3A47A 3BN9D 1IGYA 4F9JA 1WZLA 4XPHL 4GG6B 4ZUVA 2H9GB 4XCEB 3NSXA 1X4YA 4PV8B 2DM7A 1CXHA 3QAZC 1IQWL 3CCHB 2IG2L 3O6AA 3KPNB 2A1WL 4MPKA 1CLZH 3KLDA 3BAXA 4JPWH 5EBLA 5ESAB 4S1DD 1YEGH 2BVUA 1S3KL 1XGTB 3V5HA 4U6XB 3LQMA 5E4EB 4WW1B 4JHAH 2WC7A 3I9GL 3CFCL 5T5NG 2AJSH 1S7VA 4X99A 1OD0A 3AMDA 5GS1A 4YHNB 4M5YH 5IMLA 3MUAA 4RFEB 1GGCL 2BC4A 3MRDB 3S37L 2CK2A 3HZKB 5JMRA 2LE9A 1F90H 1KJMA 1U8MB 4KDVA 1HH6A 5I1AB 4D6GA 4X98A 1E0VA 2QL1A 1W3KA 3CSYA 3BUYB 2CEQA 1KIQB 5CEYA 3AIWA 3RKDD 1N2RA 1TJIL 2GFBB 4NSBA 2ADFH 1UXSB 5FO9A 4BSWB 2C8NA 3WSQH 2WWMD 4GAYB 2P7TA 2X1IA 1DBJL 4QTIH 3FOMB 1QI5A 4ELMA 3A4XA 2WHLA 3RDTB 4JPKL 1V08A 3GXIA 2E4TA 1QR4A 3I6KB 3F5WA 4MAVA 4XXDA 4CUCA 4X5WB 3O8XD 2WZHA 2Z35A 1Q9WB 2R69H 3OG4B 3ARRA 3KYKH 1RZ7H 3PTQA 3I75B 4DEPC 1HDMA 1XGRA 2D23A 1WT5A 5JUEH 1YPZA 2BNRE 3JV4A 1DANU 1X5JA 2PYED 4L3EE 3L95A 1A02N 4P2OC 5ICZB 3FB5A 2LQRA 1NGWB 5ADPL 1UHVA 2PXYA 1FC2D 4LCYA 1C16A 4LPTA 2XXMB 2DQIL 2VIRA 3BQUB 3V79C 2UY5A 3BPCB 1UB6B 4XAKD 1UM4H 4GMTH 4RWYH 4XP4L 4XMLL 4I3RH 3TBWA 4P9MH 4LAJH 5I77A 1MFEL 5HGBB 3O4LE 1M01A 1QR1A 3H2WA 1W3LA 2E5EA 3ZDXE 1PSKH 3CPLA 5D2LF 3AS3A 3BWAA 1YN7A 5H37H 5FKAA 4F33A 4KJWD 3PQYD 4GKOA 3AMKA 5CP7A 3H9SA 3CFDA 1F8TL 3MNVB 5CEZH 3SN6N 2F5AL 5TQ0H 4N8VG 4FP8L 1N5YL 1BF2A 1OB1B 4YBHA 5KZCD 4HPYH 3GSQB 3PHOA 3L5HA 3F58H 2JF6A 4JVUA 2AXFA 5DC0A 5E03A 2UZXB 2PUQT 4G80B 3VGAB 2X44D 5ANMA 2QMJA 3ELAT 3NAAL 3IB4A 1A5FL 1H4PA 2DQJH 5SV3A 15C8L 2IBBA 2FIKA 3BIAX 2AV1A 1N64H 1RJYA 2CLRA 3QNYB 1P4IL 2UVFA 1ZVYA 2OXHA 4HWNA 5GRUH 1WFUA 5I1LB 2YLAA 4RMRA 4C7DA 3LS5L 2Z0BA 4JO2L 4ZFOB 2QKIA 4HDIB 1K6QL 4HBCH 4L4TB 2F8OA 3QQ3B 1KXVA 2WMJA 3WIJA 4ACZA 2L7JA 3QSKB 4F58H 4OFIA 3MUY1 3LRSB 3KR3L 1LEIA 1TUXA 1T0NB 1YUHB 3L3HB 3KHQA 1CGUA 1NUDA 2ADGA 2E9BA 5EZIH 4KHTH 5B8CC 4EJ1C 2R23A 2X1OA 5FYLD 3QNZB 5GZOC 4E5XB 3CZ8A 3ARFD 3MRKA 3ARPA 3PV6B 2X4SA 2HTKC 5JR1L 1IKFH 2YDRA 1IEHA 1KEMH 5I71C 1MFCH 1BLNB 1RIUL 1B4RA 3NABL 5HHOA 5F9JA 2E0PA 2NT1A 4WI2A 1NSNH 1NBYA 4MD4B 5GNXA 3UTTA 2OL3H 3PWNA 4XHJC 3DETD 2ZCHL 3L2MA 1IC4L 3HMXL 3SDDD 3N17A 3VH8B 2NY7L 5CJXA 4RMTA 5C8JA 3GMPA 1YZZA 2A9MH 4HJ0D 4LVOB 3UMTA 2NY3B 2VZUA 1BAFL 1FO0B 1LO3L 1UYQA 5F7DB 2X4RA 4URTB 3NACL 4J4PA 5TE7H 4V1DA 5CINH 1E6SM 4NQCB 4GAGL 4ONOA 4TUFA 5IIEA 2PC8A 4RFNB 1QKZL 1F4YH 3VNZA 5E2JA 4ZAKA 2WW5A 5DR5L 3N1QC 4M62L 4HHAA 1ITCA 1WEJL 3DTXB 4FG6D 3VG9B 1MF2L 5DVKA 2WWDA 1VEMA 4U6VH 3TJEL 4MX7B 3ZTNL 3VG0L 1LDPH 2VUOA 3L3KA 3CDGA 3SCTA 2H1PH 3U4EA 5IHLB 3KL0A 1JHLH 4R4ND 4TSBL 2GTWA 4YHLH 1OIFA 4NRRA 1C5DB 2WAHA 3CU1A 3IT8D 1FH9A 1RPQA 2VLRA 4W85A 3ES6A 4OGXL 4JQIH 1KG0B 3TBYA 4DGVL 4OLXH 5J6GA 1BFTA 1V0LA 1OARL 4NKDB 43CAA 1F4XL 3NA4A 3ROLA 4DWSB 3BRFA 1JGVH 5IHSA 1SJVA 3ZKNC 3WHE0 2XYLA 5A6MA 1W0YT 1GAFL 4JRXB 5ALBH 4PJBA 1K4DB 3WKZA 3RDTD 5IGXH 3HC3L 4KTDL 3V6OA 3MREA 4LLUB 3H9ZA 3FT4A 1AO7A 5GNYA 1J0KA 4HS8H 4I1NB 2V5DA 3EYFB 5CD3B 4PRDB 4L8CA 4PJEA 4MYWB 1ORQB 4BK4A 1B0GA 2X8RA 5E2UL 5I1JH 3TCXA 3RMEA 1LK2A 5IVOA 1W1VA 3RDKA 3C2AH 5JW4R 2H6PA 3MBXH 5EN2B 5I66A 1FIGL 4ZUVB 2VDMH 3GMQA 1Q4NX 1ZHLB 5IXEA 2NY0B 4ACYA 4M82A 1FNLA 2VZ3A 2R0WH 2WMFA 1C90A 6A3HA 2DD8H 3QO1B 3LDBB 4Z7UB 4PBVC 4N9GA 3LV3A 1F6AA 3P4MA 4X80H 1S7TA 4ZXBA 3QCUL 3V5HB 4Z2JA 2APBA 3DGGB 5EO1A 3NCYP 1TETL 3QXUA 4L9LC 3Q0HA 1T5XA 1A7RL 1EQCA 1S7VB 4YXLH 3LH2L 4X99B 3FO9B 5GS1B 5DT5A 2FD6H 5I15L 4W4NA 5IMLB 2ZOXA 4PB9L 5IESH 2W59A 1OGBA 3U7AA 2BOBA 2F61A 1JYVA 1HH6B 3BGFB 1K6AA 3DX7A 1EX0A 3CSYB 4KAQL 4N8VB 1MFNA 4NZRH 4JO1L 3UYRH 5FB8A 3OKDA 4GKZA 4UTFA 4NWUH 1IQDA 3OJDA 3IS0X 1C08A 5FUCE 3WMCA 4MNHA 5EU3A 2CK0H 4ELMB 3WUWA 1JBJA 2J7CA 2F53E 1R7AA 3P30L 2ZUUA 5CP3H 4Q6IB 1RZKC 1NMCB 2Q87A 2E7BA 4PJGF 4M6NH 3F5WB 4L4TD 3C09B 5JQHC 2CPUA 1GGBL 2EKSA 3CH8A 4XI5D 3M7SA 1NCTA 1LDSA 5FYKL 1HDMB 4Z7QE 5KVDL 3EJJX 3AU1A 3JV4B 4XVSL 1OWRM 3L95B 2WINB 4XGZA 4XP9L 3FB5B 4LQFH 4YAQA 2PXYB 1A7PH 4PG2A 1KFAL 5I23A 3ZOAA 4LCYB 1BM3L 4I0PC 1FLTX 5DHVA 1A1OA 4YBQD 3AY4A 5A1AA 1M03A 2XN9E 4Q9CA 2GVYA 5D6DA 4EBQH 3ZYJA 2RGLA 4YDLC 4XHQA 3WN6A 1KULA 2MPAL 5A94A 3CZEA 3OAUL 3BWAB 5IUSA 4GSDL 3WFDH 5FYKU 4RX4D 5LAXA 3CFDB 1WV7T 2NY3D 4LRIC 1EHLL 1NMAL 3CUJA 2DQUH 2ESVA 3VINA 2VQ1A 4NQCD 3PHOB 4MGXA 4KI5F 4POZD 3U6RA 2AXFB 2CPCA 1H5BA 3OKYA 4UQAA 4FABL 3LSOA 1VA9A 5J06A 4OCRL 3WENA 4EIZC 4M43L 2HFEA 2K1MA 4WHDA 4JJ5A 1KENH 3AIVA 2OJZH 1CFVH 2RJMA 1SJHA 4RFOH 1ZHKB 4AXNA 4KVNL 5EOCH 4PRPB 3SCMA 2IFFL 4WKAA 3A6OA 1GNXA 2X42A 1E72M 2FIKB 4WO4B 4PGJA 2AV1B 4JFTA 1RJYB 4MD0A 4X6DB 2K7PA 1CS6A 5D7IF 3HC4H 4UINH 3W37A 1A64A 2WBJA 4RGOL 2Z91A 4XT1C 3UR8A 3C60C 4PG9A 2QKIB 1U8HB 3EAKA 1VERA 4WUUA 3BGAA 1RAMA 3UCQA 3HPJA 5ACLA 1VEPA 2XKNA 1CD1A 3LEVL 1XF5B 3K2UL 4LCWE 4ATLA 5EC1B 2HMIC 4LX4A 4UOW0 4R27A 2XA8L 2WZPD 1OD7A 2ZP0T 3PWVA 5FYLH 1P9MA 1S9YB 4TVPD 1EGZA 1OWQA 4DWSD 2YL9A 5T3XE 1OSZA 1RZFH 5DJ8A 4W88A 4HXBH 2EDWA 3PZ9A 5I76A 1ESWA 3WFEL 4K9EL 4EI5A 1DN0A 1JVKA 3O3BA 4MS8D 4JRXD 5ECUA 2H32A 4Y8DC 5HHOB 5F9JB 1AIFA 4JQXC 1NBYB 3O6FA 3VXSB 1PG7X 3UTTB 2Y07L 1U93A 1RD6A 1YEFH 4HZ7A 1HOCB 1U6AH 4XVUD 1G7PA 3FKUS 4B53A 3VUPA 1DE4A 1PVHA 1S9WA 2V3FA 3MV9A 5A2BA 1YEKL 2XKSA 3WFHB 5IB2B 3UJIH 4OI9A 4NN7C 3T0EA 5ERWA 3SBWA 2ZUNA 2WCAA 3C08L 3ZYZA 1JD7A 4XWGH 3MROB 2VLJA 3EW3B 4WEUD 2X4RB 3O4OB 1QI2A 5I1EL 1CLOL 1KXQE 5L7XH 3H6JA 4K07A 4V1DB 3U46B 5IT2L 3GSVA 5DA4A 3QBTB 5I8CA 1BVNP 1ZLUH 5FD0A 5L2KE 2Y9RT 4HPHA 2NY0D 4ZD3H 2SEBA 1KJ2B 1MRFH 4F7TB 2GDVA 3GB7B 1NEZG 2OMBA 4R7DB 4JAWA 1NC4A 4N1HB 4RSVA 1JI2A 2DL2A 3QFDA 4KJPC 4NQDE 5C08B 1XH2A 4HJJL 4GINA 4JDTH 2WSPA 2AKRB 3G6AA 3L3KB 1A6VL 5EO9B 3U4EB 4FTVA 4OD3L 3ZIZA 4M4RA 2DM4A 1KB3A 3STZA 3SKJH 1E43A 1JCKA 4OT1H 4U3HA 4Q74A 3TBYB 2XZAL 4ATWA 5J6GB 1NAML 5DMKB 2FHCA 3NCBB 1GH7A 3QCTL 1PZ3A 43CAB 3ROLB 5D4YA 2NW2A 4NO2A 5GGSA 4OZGE 2CKBL 5CSZA 43C9A 3NIDF 4H1LG 1N0LA 2CKRA 1I7TB 3ALPA 4PJBB 5E6IC 1W0VA 1IGIL 4B50A 1OAYH 3CZKA 4PUEA 5M17A 3ZQ9A 1LO2H 4PREA 2B0SL 2BVQA 3TO4B 2YPLE 3FT4B 4HWEH 5FCZA 1YNTA 2R0KH 2WVSA 1T7WA 3DO3A 1QW9A 4L8CB 4PJEB 3D3VB 3QZWA 2BY2A 1KQZA 4C4KO 4Q9BA 3VGBA 1MFVA 1OPGL 2Z31A 1TVBB 2K9UA 3UPAA 1E73M 1KBGH 5IJKC 5L88H 1S7UA 1Q6DA 4KRUA 4PUBH 4F3FA 1N7ML 3GH5A 2PXYD 3X14A 2G3MA 5E00A 3RIFF 3FAWA 4MTVA 5FA3A 1MREL 2XG5A 5EB9A 4KRPC 4LSPH 2EDKA 5AWNL 1Z9SA 4YUEL 4ETYA 1CF8H 4WI3A 1FCGA 4N9GB 3P4MB 4ZXBB 4KRTA 4OIAA 5ETUA 5E2VH 5EA0L 5F7EH 4N0CD 2VCAA 2GKIA 1R0AH 2J3SA 1D9KC 3NIFF 1IC5H 4DOHE 4KPHH 1JPFA 5C70A 4B0MM 2EJ1A 1WLHA 4KVCL 2PWFA 2YLLA 2BOBB 4PJIB 1BZ7B 4TQEL 4K7PL 2F2HA 2AJ3A 4CMHC 2VDNL 3BXNB 5LA0A 4M9PA 1IRAY 1SYTA 3IFOA 3OKDB 5E4IA 4GKZB 1HK6A 2XKUA 4FXGA 1C08B 3UPRA 4PRPD 4P7NA 4MNHB 1V6VA 1UA6H 1OAUH 3WDRA 5FM8A 1X5FA 4EE9A 4WO4D 1QFPA 1BPVA 4PRBA 4NWTH 2FGLA 5D1XC 3CXDH 3WUWB 2XZZA 1A21A 4UBDD 2BHZA 4LU5L 1KIUA 2AJYH 4OCXL 5DQDL 2VB5A 4JFZH 2M1KA 1RFDH 2PN5A 4H5SB 4GS7C 3ILPA 2EKSB 4GZIA 1T1ZA 1MCFA 1XAUA 25C8L 3FN0H 2NMSA 4PP1D 5F7LB 1Z3GH 3LB6D 3IDXL 1N26A 1FZMB 2MKLC 5D5MA 3HRPA 1TQCC 5CGYC 4XGZB 5T1LD 1JE6A 2W92A 3RU8H 3F8UB 2VISA 4P57B 1NGQL 4XP1H 3KE0A 2OSLA 3W2DL 4YDIL 4JFFA 3VMPA 4F37F 1QQDA 3BDYH 1CICC 2AV7A 1NLDH 4U49A 32C2B 4KHXH 5HHOD 1IZKA 3ZE1F 3VXSD 2RGMA 3S35L 1FVEB 3MLZL 2WMGA 2GK0A 3HMWH 2HAZA 3O6LH 4N68A 3M8OL 1GOMA 4U1MA 4GAJH 1AE6H 1UA3A 5IDIA 2B5IB 1RUPH 1VSCA 4Y4FB 2YKLL 2J77A 2A9NH 3MNWB 1MJ8L 3GRWA 1CLVA 1UKQA 3KPLB 1R3IH 4C56E