4MJ4A

Human iduronidase apo structure p21 form
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
614
structure length
603
Chain Sequence
EAPHLVQVDAARALWPLRRFWRSTGFCPDPYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into mucopolysaccharidosis I from the structure and action of alpha-L-iduronidase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-L-iduronidase
total genus 194
structure length 603
sequence length 614
ec nomenclature ec 3.2.1.76: L-iduronidase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01229 Glyco_hydro_39 Glycosyl hydrolases family 39
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mj4A03
2.60.40.1500 Mainly Beta Sandwich Immunoglobulin-like Glycosyl hydrolase domain; family 39 4mj4A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mj4A02
3KPRE 5F71A 1P6FA 1H3WM 4N1EA 4ZUSB 4J4PA 3BC9A 3Q5YA 4IRJD 3LQAC 4WW2F 3VWKC 4KHTL 5D2NE 3IKCB 3ULVL 1I4FA 4JY5H 2CBVA 4Y4HC 4X9GA 1KTDB 3HMWL 4EEEA 5CEYA 3CZKA 3U46A 1G7JB 2FDBP 4LLVB 1YMHA 1GSMA 5BQ7B 4W6XB 2XI9A 5F9OL 3M45A 4UQ9A 3DXAB 3WJLC 1IFHH 3RWCB 3IDJA 4LIQH 4WK9A 1RIUH 1CQKA 2OX5A 4Z76A 4XCNA 4KV5E 4JEGB 3V6OC 4AJ0A 1RIHL 3JWNC 1OLZA 4NFCA 5JXAH 3I6KB 1EAPB 2BVPB 3VXRA 3GIVA 3T0EE 2VDPL 3CTTA 2HVKB 3FZUC 5A6AA 4ZYKB 5EU6B 2XWTB 4XP9L 4JFXA 1SYSA 5I8EB 4HA3A 2NR6C 3QPQC 4ZXBD 4OIFA 3U7AA 1G0DA 1BFVL 3GZAA 2JF1A 3FOMA 3F6IA 4QNPF 5I6XC 3I02B 2D0HA 2HWZH 1WWBX 4OZGA 1XR8B 5KVMC 2PCPA 3VIKA 2NY4B 1W0VA 1WEJL 1XGYL 4OZ4B 1C5CL 2P8MB 4JPIB 5DC0A 1IQDB 1NBYB 4QHLA 5JIHA 2VSDA 5ILTH 2P8MA 4JPIA 3NDZA 5E8EA 1BFNA 3MV7E 4HFUH 4PD4J 5FECA 1I9IH 3L4WA 2DQEL 4XMPL 4Z7VE 4NYLB 4YHPA 2G4FA 4N0UA 4QRPA 2QSCL 1DWIM 1U93B 2UWEA 5GZND 1CVSC 4KI5E 1DWGM 1KXVC 2PW2A 4WHYG 1V0KA 4ODTH 1OAUH 2L7UA 2DQDL 3CSPA 4LSUL 3S3PA 3REVB 5KW9H 4XXCC 5T3ZE 1Q1JH 5L2KB 3MU7A 4M4PA 4UV7L 5JOFB 1SBSL 2NY7L 5GGQL 3I50L 1MQQA 3GK8H 4OFYA 2QLYA 4HPYH 4JZJC 1OD7A 1YQVL 1JTTA 2FGWL 3AMKA 2VC9A 1AQMA 1JTPA 1XH2A 5GNYA 4LLQB 3D3VB 1AH1A 1OQOA 25C8H 2M1KA 2R1WB 2B20A 2EICA 4YQXH 3D48R 5KSBA 3AIVA 4UB0L 3WFEL 2AEQH 1DL7H 1EHLH 2CETA 5AZEH 2V7HA 5JLZB 5GGRB 4AD3A 2E9LA 4UILL 3D2UA 4PY7B 2EYSA 4TX8A 2BNQB 2XYCA 1AD9B 3D69A 4NJAH 3H9SD 1KIQA 4YPGA 4U0RC 2O9OA 1DEDA 3BISA 4DN3H 1KN4L 3LN5A 2BJML 4YPGB 2VISB 4N0CD 1A7NH 1ZHKB 4MNGB 2V3EA 3MQIA 3RWDA 1P7QA 1WJ3A 2VRJA 4JJ5B 4XNXH 1WCBA 1ISYA 1E27B 4HUXA 2B4CH 5DQDL 3GMLA 2DQHL 1KJ3H 3PXHA 4GW1B 4NWUL 4HIXL 2FJFA 1PYWB 5C0DB 3ARXA 3WELA 1PG7H 4ZUTA 3HB3D 4D0CA 2EDKA 5E2VL 1PBYA 5F44A 2EO7A 4OCSL 5BXTA 3VRJB 2AEIT 4E5XB 3JWOC 4E41B 1N0XH 3HU7A 3L95B 1CR9H 4E8DA 3GYCA 3RIFF 1OP9A 2BMKB 4M1GL 2SEBB 3GSRA 5DT1H 5A43C 5IB3A 1BP3B 2F74B 5J11B 4HP5A 3IRPX 2RFXA 2WIIB 4MMZC 5GSRA 3IJ8A 1HCFX 4PGCB 3BKYL 3K74B 2GY7B 4TOYL 4XMPH 1T21B 4MQ7A 1CICA 4X0KA 1A0QL 1KJMB 3IDIB 2O92A 1YZZA 3MR9A 5JIKA 1KACB 4FFYL 4B16A 5JMOC 1M7IA 2N56A 4PRHD 2QQKH 4ZXLA 4LARL 3SDCD 4JZJB 1WZMA 3X11A 5FOBA 5A6MA 4NJ9L 2O5YL 5I5RA 4MAYB 2CKNA 3ZDXE 4MCYA 2AJ3B 3SDYH 4WHTB 3SCRA 4QF1A 5FM5O 3S34L 1JPTL 3EFDH 4IRZL 1H8OA 5MEPB 2FATH 1AY1L 5DD5H 2DQJL 4HH9A 4Y88A 4TPRH 2J8UF 5GS1C 5INCA 2QHAA 4LF3A 4CCEA 5IJVB 3WHXB 5F7FA 4B0MM 3BEWB 1AE6H 3WH8A 3FT3A 1HJWA 4YDLB 3QZWB 2HTKC 5JIIA 4M7ZC 4D6FA 3S88H 1PQZB 1N3NB 2VDMH 3PQYA 4P5TB 4PJCF 1QNQA 5I16A 5FEBA 4X6EA 5HYFA 3GNOA 3AIQA 3OJDA 3FO2A 1UWGH 1W8NA 4JY6B 1IGCH 1J5OL 5EO9A 3ESVF 4KXZI 2XWJA 2NXYD 3WS6C 2A77H 1C91A 1R8LA 3BAXA 2XN9A 3OF6A 4OQ1A 2VN7A 4YZFF 4CMMB 4GUPA 4F8TA 4U1NA 2NW0A 2FH8A 4APQD 1ZGLB 4C59B 3LQAL 3P0YL 4TSBL 2ZOLB 1EGJL 2CK2A 4LNRB 4F2MA 2OCFD 1HNYA 4XGZB 3MXVH 2YBRB 5DFTA 2HJLB 2AEWA 3GI9H 1XGQA 1GXEA 1UA6H 2R0WL 5A69A 2ERJC 1EBAA 4I3GA 4HFWB 3EZJB 1U8NA 3PQYE 2P46B 4YUEH 5DJYA 3FO9B 4X99B 4H8UA 4XRCB 5K9JH 2OWCA 2XWBA 4OD3L 1IC4L 2NYYD 3IKKA 4V2CB 5EO0B 4R27A 2WP3O 2YRPA 1LO3L 5D5ME 5DFWH 2CEQA 4HWBH 3PQYD 1NJ9A 5DUML 2ZX8A 1CGXA 1DDHA 3IETB 5C07E 2J47A 1EFXA 1WK0A 1YNKL 4L4TE 1IC4H 3B9KC 3T1FA 4Z0XA 5CSYA 3VWKB 3QFDB 4JHAH 3TBYB 4WV1B 1KEGH 3FB6B 3TGXA 1BAGA 1H5BB 3N85H 4UFHA 4YDKH 4HBCL 3MLZL 3O6FD 4QAWA 5BXPA 5C07D 2JB5L 5ESVA 1B2WH 4HK0B 1RUKL 1TZHB 3QEQD 1T0NB 2J4WH 1OGGA 1FZJA 4M80A 5CZVH 4XVUD 1P6WA 5KG9B 5GRYA 2NY5H 2AOSA 4FQ1H 2BHYA 3LD8B 1X5XA 4NSKA 3ZR6A 4ZFOB 1YECL 5AAMA 1DLFL 4MD4A 2XZQH 4GRMB 5HGHB 4IOIA 3MJ7B 2BVUA 3AXHA 2M2DA 1ZBWA 4KK9C 3WXWH 1MJ8L 3WH7A 2R56L 1IJ9A 1BLIA 1QI0A 1D6VH 3D5OF 5HI3D 4WFGD 1DLHA 1JVKA 5GS3A 2JJTA 1E3ZA 5KOMC 2Q7YB 1FNAA 3ARZA 5HDOA 1CFVH 3HB3C 3ARPA 4AZCA 3V5HA 2WBJA 1YA5A 2YWYA 1V3MA 4PJBF 4Z7QF 1SR0A 3DX9B 5LGJB 2Z35B 4G5ZL 2Q76B 2YA2A 5AY7A 5I30H 1Q72L 5T5FL 3IGAA 4OFYD 1CF8L 3PWPE 5CJQH 1JPGB 4QRPE 5T3XH 1WP6A 3QJHA 1P4IL 3U1SL 1DFBH 4DZBA 1I1CA 1YY8A 2VLLA 3DUHA 4GQ9L 4XZUB 5DHXB 3L4ZA 1QHOA 3MC0A 1TZGH 1CI5A 4I48A 3BMWA 5D2NA 1AGFA 3L3OA 4WO4B 4Z7QE 1N4XH 3BGFC 4QRPD 1KG0A 1B0IA 1XR8A 1H3UA 1R3KB 3MV9B 1P4LB 4PLKC 3X3GL 3WBEA 2ZXQA 3TA3D 4L3EB 3SE8L 4WHYH 1L4IA 4Y16C 4LMQI 1T89C 3KJ4B 4G6FB 3ULUF 4U3CA 4OZIF 3ZKMC 5ICYA 2WB5A 1S9XA 4NJ9H 1FNSL 3SGKA 1EMTH 1B0RA 3O6FC 4M7KH 5TQ0L 3W6MA 3WCYA 5IVNA 4JFDD 1R85A 1XF4A 1JRHL 1FA2A 3SHSA 2J4WL 2I9TA 2WQRA 4EIGB 3MUHL 3Q5OA 5JQ6H 3MRIB 1INDH 3WKNA 1E55A 2BCKA 4C7GA 4MCZB 1W3KA 1PKQA 5IHUL 4RAVA 1HNGA 2DKUA 4KDTC 3U9PH 1H5VA 4JFDE 1CEOA 4HOWA 4XCEA 3ZDYF 3VJ6A 3HC0A 3VXPB 3GBDA 3QEGH 5BJTA 4OSUH 3F12A 4I9WD 5D93B 1DL7L 1E70M 4NHUB 3B2UC 4ZFZA 1CICD 1RULH 3X12B 4FFVC 3BKCH 1N4XL 2ZCHL 3ZDZE 3EW3B 5ADPL 4L8CB 1ZB5A 4XCYA 4M1DL 5BZDB 3B5GA 3ZT5A 2VT0A 5KS9E 2XM1A 3D2UB 3NUKA 5E94B 4JDVA 1E9LA 1KXHA 4GRWE 1VENA 2PO6D 3RWGA 1NGZB 1SBSH 2HLAA 4I77L 4OQTA 4U1GC 5I1CH 4NRRA 5FUZL 3H3BC 3OGOE 3MUZ1 4LGPB 1B4RA 2R0WH 5ICZA 2ZOKA 3JWDH 2NX5A 4K7PH 4HF5H 2AW2A 2WXDM 1FDLL 1PYWA 1N82A 3QUYA 4OV5A 4LDEB 3WFEH 3UYRH 4I5BA 1QNZH 5FHAH 1JIBA 3TFKC 1PIFA 1UUQA 3NZ8B 2WMHA 5KANG 1YPZF 1CN4A 4N8VA 3ILQD 2EYTA 4ZAKD 3BAYA 3SIMA 2BMKA 2PXYB 2SEBA 1KT2A 4P46D 4DOHE 4PJDE 2Z0BA 3V5DB 1ND0B 4WU5A 3W0WB 2CNCA 4HKJA 1FLRL 3KYMB 4A6YL 1KWGA 4B3KA 1TVPA 1RPQA 3T3MF 3CHEA 3X13A 4JO4H 3BP7A 3G5YB 3H9ZA 5K9QI 3C2AH 1F4YH 3E8UH 2PC8A 2NX5E 4CVUA 1A7BA 3HPJA 5LCVH 1DJSA 5IROA 1Q9LB 2AEPH 5KVFL 4N5ED 4KK5C 1K5NB 1A1OA 3THDA 3G9AB 2R56H 1L7TH 3RNKB 4I4WA 2W63A 4G6KH 2NX5D 4MVBC 4XH2A 1CDHA 4G8IB 2R8SL 4NQTA 1Z3GH 3U4EA 3UCQA 3VI3F 4A3YA 1YYLL 5FKPA 3ZJ6A 1FH9A 1DBKH 2QR0B 2BK8A 2ADJA 4WTWA 4HX1B 2DTSA 2HG5B 1TITA 5E8OB 2E7HA 4YO0B 2Y72A 1B6DA 1Q38A 3CXHJ 4X0NA 3NFPB 1RIHH 2E8YA 1OSPH 5E2VH 2VLKB 3EFDL 4IRZH 4JFPA 4Z7WF 3VXOA 1T20B 1CBVL 1P69B 3BD5A 4WEUD 2PYED 1E4WL 2XV6B 5IB4B 4M7JH 5M03A 4OJFL 5D1XA 1U8PB 4JM4L 2LAGB 3DLQR 4CKQA 3N1QC 3MRNB 2P5ED 4YBHA 5IF0A 2F5AL 1B2YA 3OGVA 4Y5VA 1KPVA 3HZKB 2BVQA 3L3HB 4U1HB 2EBNA 2PYEE 2O61A 1FE8H 5B39B 1I9JL 3CUPA 5DRNB 4D0BB 1C1EL 5IK3A 3UYRL 5B39A 5A2IH 1KPRA 4NWTH 5A16A 5JHDA 1WPCA 4XP6H 2APTA 2GTZA 1RULL 1NGXB 1JUFA 2PB1A 1LO3H 1MFEL 4HUWB 3K3QA 3SJVD 3KAAA 5IG7A 2EQDA 5J0BA 2DM3A 3QXTA 1TJHL 2C3GA 5HI5C 3VD7A 3HE7B 4TSCL 4BSVB 1B0GB 3B9EA 1QVOB 4V1DB 2D3VA 2Q3AA 4U7KA 3SE3A 1A14L 5TPWH 5KTEH 2EPOA 3MROB 4O4YH 1GNXA 2C3WA 2ZUVA 3OB8A 3LIZH 2WWDA 1U8LB 1XCQB 4HWNA 4Y7MA 3T1FB 2BNJA 4W68A 3TBYA 1N26A 3FRUB 2NTFB 1BZ9A 3O2WL 4F33B 2GT9B 1FH5L 2ATPB 1GCFA 5F3BB 1UR4A 1FNHA 3TESA 1LK3L 4POYA 4U2YA 4MZ2A 1IGJA 3S3SA 4QXGH 1QSEB 1NDGB 1G6RL 2EPNA 2W5FA 1QD0A 1U2HA 1JHTB 1EO7A 1R5VA 4PYGA 4Y16A 1HYSD 2Y5EA 1I1AB 3ARDC 5IHZB 3IDNB 4WRLA 3WSQH 5TGBA 5JXEA 1GC1L 3FY1A 5C08E 4O51A 5HGAA 3EMZA 2J7FA 2W4XA 1NFIA 3UZEA 5JORA 1QEWA 5HYJE 3PIQA 4O51B 5HGAB 2ERJB 3TYFA 3MRBB 2DSZA 3SDXE 3VXQB 4XZWA 4ZD3H 2B2XH 4CAGA 1B31A 1TJIH 3K4ZA 2VC2H 3CXDH 4M8QA 4HCRH 3P11H 4YXKL 3VW3H 4K7FA 4AC1X 2R9HC 4IOSD 5BRZD 3HFML 4JL2A 1DQJA 3A6BH 3HE6B 4JB9H 2EE2A 5EOTB 3IAQA 5F96L 2P47B 5AD0B 1E4KC 4IRSB 3SKUD 1NLDH 2CIKB 1NP2A 4QYOB 3BJLA 4H0HB 3KPRD 4LSPH 2AXGB 3SDAB 2NW3B 1MH5B 3WUZA 2Y1VA 4WUUB 3HZVA 3DX9A 1ZS8B 3MV8E 5HGGS 4JZ5A 2Z35A 2IPKB 4V27A 2AXFB 2I9LA 1I8IB 3ZKND 2XVLA 3WE6A 1H0DB 2XKUA 3I9GL 4KMTH 4HUUA 1QQDA 3QEQA 1F3JA 1TQCB 1NUFA 4GSDL 1HXYB 3QRGL 4HUUB 1FZKB 3NTCH 5EBMA 4OKVA 5I1DB 2W61A 5DSCB 5I71C 1ZLVK 5IT2L 1J8HA 1DBAH 3IT8D 4CVXB 1H41A 3N18A 2EE3A 1W8OA 3U7VA 3T77A 5HHVL 5L0QC 2DN7A 3L3DB 3F4VA 1FYTE 1Q0XL 3MLYH 3EDDA 4YHIA 5C8JA 1FGNL 5F7NC 3IDMB 2VX7A 1JDDA 2QTEA 2APVA 2C1OB 1M71B 4Y1AA 1FFPB 4YK4B 2L0DA 4ODHL 3C87A 2V2WA 2ZG2A 3CFDB 4G8GA 5DJ6A 1GYAA 5HVHB 4JKWA 4JE4B 2BX5A 2F2HA 4NN5B 4GKZB 1MVYA 5DJ6B 3MXWH 1GC1C 5DD3H 3A4WA 4BZYA 1AP2A 5HJ3A 1ZT1B 2VQ1A 4TTDD 4J6RL 1A2YA 1DR9A 1MVUA 1GOHA 5IHUH 1JPFB 4LVOB 5F9OH 1A3HA 4W70A 4X6DA 2X4NA 3TO2A 5C70A 4PJGA 4X9YA 3HE6C 5KANI 4ZTPH 4X5LA 5IW1A 1SJEB 4R3SB 2XIIA 4HK3J 5EZOL 5I76A 1SJEA 1JP5A 4FZ8L 2A77L 4NDMB 4D1JA 4JFTA 5TH2A 4OOZA 1NCAH 3WKMH 4PY8I 5GHWL 1NC2A 4U1LA 2GK0B 3E6FA 2OS7A 1QNPA 2G8ZA 3EZ8A 1M7DA 1Y6KR 4JFHE 4P23C 5GZOC 3LOWA 4M7ZB 4WUKL 1NEZB 3QIUD 4JO1L 3OBAA 1MFNA 4PLOB 5AZ2L 4W7WA 1T0PB 2F58H 1E4WH 3QNYB 3SURA 5AUMA 1R5WA 1JF1B 4IRJA 3VIPA 4PRIB 3BXNB 1ODZA 1TZIB 2JF7A 3CK0H 1D9KC 4JFHD 43C9B 1NGZA 4QXUL 2ID5A 3RX7A 2Z31A 4J3XA 3BRFA 5IESH 5DT7A 4XVSL 3BP6B 4WHDA 3OXRA 4OM1L 2XGIA 2E9WA 4IMKA 3MRGB 4NGHL 1MELA 1LNUB 5AZ2H 3WENA 1MFAL 3LKPB 2E9JA 4OI9A 5JBEA 4GXUN 3MRGA 1OIFA 1WNOA 3ZDZF 2V3DA 2XGBA 1QRNA 2APWA 4PRDA 4LGXA 1CXFA 2Y36H 3FN3A 1I1RA 1HHGA 3GBLA 1UZ4A 5D8WA 3OKNB 4AW7A 1QLFB 3PP3K 5T5FH 2DQDH 3O9WA 3C60B 3P73B 2NY4C 4EE9A 5CHNB 5F7EH 2B0SH 3BDYH 1HOCA 4Z7OF 7FABH 4N8VB 3MV7B 4NKOA 1ODAA 3LCYA 1UADC 2OQJB 1CU4L 3CSYA 4TRPH 1CR9L 3RA7H 3ULUD 3WF3A 1WTGT 5IVXF 3W39A 4ZSOB 3PZTA 1AQ0A 3VDBA 5GZOD 5T33H 3C2AL 4ETYA 2XTJB 3JWDL 3ZKSD 2UZYB 3QEGL 3VM7A 1HKJA 5TFSL 1GZJA 3MXWL 1SYSB 2OR8A 2Y07L 2YPLB 1OTTD 3RGVC 4AENB 4X80H 1UR2A 5J1AB 2DM2A 1QRNE 3FOMB 2FECL 3P11L 4YXKH 5KVDL 3MNVA 2WUBL 4Q9CA 1FL3B 3EOTH 3BE1L 2IXVA 2XRAH 4XPFL 3QHTC 4TOYH 3EHBD 4XP9H 5D7IE 5HHOA 3LRGA 1M05A 3VXUD 3VH8G 4NC0B 1AY1H 5DD5L 1YEJL 1IGIL 4ODWA 1IARB 5JXED 1S5HA 4MQXC 2IADB 3MJ6A 3O3EB 3BSHA 2E3VA 3TN0C 1NGPL 2R2HB 5E0CA 4N0UB 3KHOA 2CIIA 25C8L 2BNQE 5HYQB 4YQXL 4O58L 2WQ8A 3ARDA 5GGSA 5E56A 4QXWA 5IMLA 4Z7NE 5GGSB 4P3CH 3REVA 3SPVA 3FB8A 3BIAX 5C6TL 4ODVH 2HH0L 3FONA 5B39G 5I3DA 3NACH 3Q48A 1UZ8A 5C2BH 2R8SH 3U1SH 3ARFC 2J7LA 5F1IA 1H4PA 4K9EC 4B41A 4KTDL 4PJCE 4FA8A 3LY6A 3UTPD 1BQLH 2HKHH 4E0RB 1K9EA 1FO0L 2CO6B 5KSBB 3CMOL 1QI5A 2DKSA 2XPGB 4NNYA 4ZOCA 4QXTB 1KTKE 4Y2DB 5I19L 5E2TL 2DQCH 4HOXA 3HI6H 1IEBA 3NBNA 5KSVA 5KSVB 3UTPE 2EDYA 3P0YH 3WUFA 1RP9A 1DVFA 4PUDA 1UOKA 3TT1H 1XGYH 1RZGA 1NC4B 3GKWL 4LPYA 3HLAB 3CHCA 1US3A 1MJUL 5SWZA 1C08B 1W0WA 3P0VL 3ET9F 2B31A 3G6MA 1NCWL 2P44B 3E3QE 1GOIA 3X3GH 1KIRA 2JEQA 1BZ9B 1T1XA 1F4XL 4XAKD 3AZRA 4F7EA 1N5YL 2QSCH 2A3BA 1UCBH 3JZ7A 5DRWA 3PNWB 4D0CB 3DX8A 5HHPA 2H2SC 4JAMA 4WW1B 2NT1A 5SX5K 4PYHA 4L4TD 1BX2A 4OT1L 2ZXBA 2C7FA 2EYRA 3ARVA 3QIWD 1UD3A 1FPTH 2BRRH 1XH1A 3D18A 3AIEA 1U8QB 1HKFA 3WKML 1HX0A 2VABA 4AL8H 5IFAL 5CINL 1BOGA 1EHNA 5JW3L 1OM0A 3QEQE 4JG1L 2BOBB 4DZ8B 4KU1A 2FHFA 1HWGB 2XTJC 3RJYA 2WBKA 2JCCA 3TT1L 2NY1B 4A4AA 4WU7A 4ORGA 4MNJA 4YHZH 4H5SA 4HIEA 4PJBB 5F89A 3C6SB 4XX6A 1HHJA 1TG7A 4LBEB 4FLSA 1E6JH 3O4LE 5DTFA 1GAFL 2AXGA 2WZEA 4LVHB 3QDGB 4JKPL 3OAZK 2XVPA 1ZOXA 4G80A 1VADA 4YWGL 1IZJA 5C0BB 4KHXL 4O9HH 3C09C 1HT6A 1FNGA 1JN6B 1RK1A 3BN9D 4WY7H 3GSVA 1INEL 3CVHH 3VRIB 3BHBA 4F9DA 1LWHA 3UPRA 5EBMB 1HL9A 1XHGA 1KQYA 2Z31C 3QQ3B 2VNCA 3VRIA 4HKBB 5M7QA 3POHA 3PWVA 4JDZA 2QQQA 4QOKA 4HLZG 4UZUA 5A8MA 4IMKC 1T6WA 1WISA 1MCNA 5CEZH 5IIEB 4PJ7E 2OI9C 3WL0A 5C8JB 1RUQH 2BC4A 4M00A 2CCRA 4YBQC 4IIQB 3VA6A 3GSWB 4AIZB 1UR8A 1CFBA 2X8RA 4OCXH 1TDQA 2F19H 2DQIL 5E4IA 1OT1A 4LYQA 2IWGA 4KY1H 1MLCB 3M46A 4K3EH 3LDBC 4Q7DA 2V2WB 4GRLB 2ICWB 1S7VB 3QNZB 3IVKA 5GGRY 1U95A 2PNDA 1UWXK 1UD4A 3JTSB 4GMSL 1E0XA 4JQIH 1T5XA 3H6JA 4PRNA 3EOTL 3PL6D 1T5XB 3L3KB 3S34H 4U33A 4GG8A 3V6ZB 3EFFA 3AC0A 3RIAF 3OG2A 1JF5A 5T1DL 3OZ9L 2V6HA 4JRXA 1A64A 1FN4A 2PTTA 1E6PA 4Q9BA 4OAWA 5GGSY 4GG6A 1QR1A 5C0CB 3WL9A 3U9PL 1NBQA 1P7KA 4N8CL 3FFCB 2PR4H 4GAYA 2JE8A 5DT5A 5J56B 4OUUB 3FFCA 5B21A 3LKNB 2XWEA 2RGMA 1HILA 3IXTB 3AQUA 1YMHB 2F8VA 2R4SL 4NM4H 3D39D 3TO4A 3OLIA 3AIBA 4HPOH 4G7VH 5EPMA 1MIML 5B3JE 4FFZH 4PB0H 1T7WA 4D6GA 3TH2T 3WXVL 1Q6GA 3G5VA 2A6JB 1UJ3A 4KXZH 4FABL 1A7OL 4P5KB 4WJ5B 3SKOA 4W7VA 3C8KA 4P5KA 4WJ5A 3SKOB 3ZR5A 1DQLH 4YHYC 4J4PC 1MIEL 4GO6B 1NOWA 3FO1B 4GKSB 4GW5B 1QPKA 3UG5A 5BXFA 4JPKH 4IOIB 1J7VR 2P8PB 1R3IL 3U36A 2NXYC 4RFOL 1QLFA 1A1NA 4OZGB 3V4PL 3MLRL 3VFOB 3FFDB 5FCSH 3SUTA 1V3KA 3KL3A 4F3FA 3CUJA 2FZ3A 1BOYA 3NPSB 3OGRA 2H2SD 5GS2H 2KUTA 3BZFA 1I85C 5D8JH 1GGBH 4JFQB 3VD4A 1HP4A 4RGNE 4G9DA 4ZS7H 2KBGA 1F8TL 2IMMA 2CHOA 3TO4D 1A4KA 2YC1B 4FZ8H 3CUHA 2DICA 2G60H 3AMLA 3ZE1E 2DBJA 4LRIA 4WNQB 4JRYB 1MRFH 4Z6AT 3BPLC 4YWGH 3F62A 3ZYZA 3MFFA 2J8FA 3NZHH 4JCLA 2XYLA 4P2QB 3EYQC 5FOOA 4JO2L 2ZSWB 43CAA 1LILA 4C56D 2XWTA 4P2QA 4ZFMA 2IJ0C 4HJJH 3FCTB 4X7EC 5JNYB 1QVBA 3WSUA 4XPTH 4RNRA 2R29L 3DIFB 1JAEA 1PG7L 3QUKA 2HVMA 3WD0A 1W3JA 4ZO8A 3NPZB 4L4VB 1ZT4A 5ESQB 4BFEA 3NZHL 1KLGB 4MAYC 2CO7B 3BP5A 3LRHA 4JO2H 2XFXA 5INDA 3CPLA 4ODHH 4Z7UE 5KSAD 4QLKA 5FECB 2ITDB 2ARJB 4G42A 1ZA6A 4R97B 4L4JA 1BD2D 1IQWL 5ENWA 5FYJU 3VIFA 1BHGA 4PP2A 5HHQB 4GRWB 3BRDA 3MLXH 4HIJA 4KVNH 3T2QA 1F4WL 1KIQB 2NTSP 4OUEA 2OTUB 1S9VA 4P5TC 4UU9A 2X09A 1U3ZA 4XI5C 3S35L 1V7NH 4LSRH 1S9KC 4EDWL 2IH1B 5T5NG 3EYUH 2OMBA 1BVZA 2QPSA 2GIYA 4MAUH 4NKIH 1T0MA 5J13C 1XSIA 1TQCC 1EHAA 4NN7C 2VX5A 1LO0H 3IDGB 2DQJH 4PRBB 5TF1H 3QISA 1NFDA 2R1YA 4BH8B 3UEZA 4NFBA 1O0VA 3FQWB 5GS2D 4U3AA 1GUVA 3FQWA 3HI1B 3PWUB 4Z7NF 4GXPA 3TPKA 4Y19E 3VDAA 3S2CA 4M62L 2V2XA 1DBBL 1FO0A 3MO1B 3SGJA 1KCRL 3MLVL 2ADGA 3P9MA 2MANA 1FO0B 3MO1A 1CG9A 3D69B 2DDQH 4X0KB 4MNQE 3H7BA 3AIRA 1SJVA 3AI0A 3GKZA 4KQ3H 3UBXA 3QIBC 5C08A 2VZ1A 1H9VA 3FT4B 4N0FA 4ZD3L 3FB5A 4I2XB 2LTQB 1TCRA 3GMLB 4KV5F 3UO1H 3QQNA 5FOBB 2CD0A 1NMAH 2GSIB 2X89D 5J7CC 3GMMB 4UOZA 3MLVH 1UXSB 2W07A 4JFVA 2X7LA 4QCIB 2NY0D 3GNPA 2X7LB 1J87A 4XV0A 2ZWZA 1XCTA 4TTGA 1A3RL 4LPUA 2GJ6A 1IAKA 2DYPA 2E9IA 3OPZH 5INCB 5FD0A 4I18A 5CSBA 3VE0B 3OZ9H 2J4GA 3O45A 4PJAF 3CHFA 2VR5A 4HUKB 4JFEA 4RGMB 2E0PA 5ABGA 2CKBL 5HY9B 5K9KA 1DN0B 3QXWA 2OL3A 3U48A 5DVMA 1SFSA 2HISA 1P1ZB 2XTLA 3IXAB 1Z5LB 4U0RB 3ZTNL 2Y7QA 1RU9L 4ENED 1MRCH 5DUPL 1R24B 5IDIA 2DYPD 4GAGL 3DROB 1F6LL 4UV4L 3MR9B 3QP3A 4JFED 5EORH 2EH7L 3KG5A 2CR3A 1IGIH 2ZIDA 1FNEA 3ULVC 4A6YB 3ZTJG 1J9YA 2CITA 5IM7A 4HIEB 4TVPE 1PEZA 3ZHDA 1LP9A 5C09B 1NCTA 5C08D 4UDTA 3BE1H 2OI9B 5IV2B 2Y8VA 3WHE0 3HRZB 2X89A 3QDHA 1JZ7A 4HH9B 3I50H 2Q1EA 3HUJE 4KWUA 3W28A 5I2UA 2JB6B 1JD9A 2XFFA 4DWSB 5JW4Q 3IAPA 5T1KA 3BEWA 1OB1A 2XFYA 4JFZL 2VLRD 1ZLSH 5SWQA 3GXFA 5D2LF 1C16B 5LWYL 1CGVA 5IGXL 4EANA 5DFVD 5I16B 1A6VL 4X9IA 1CXEA 5C7XL 4JL1A 2I07A 4HLJA 3B5HA 4FLOA 4UB0H 4YO0A 4W89A 2VE6A 3RA7L 4R4FH 3ULVF 4CUCA 4UFKA 4ELKA 1JNJA 1RSFA 4KUZL 4P46A 4V1DE 3GIVB 1QLRA 1CYGA 3VGAB 3VG0L 5GRUH 4JFXB 5D1XB 5IMMB 3N04A 4L5FL 1CE1H 3KL5A 4PLNC 5GS0D 4P8XA 4C55A 1Q0XH 5C6WH 1CFNA 3AMDA 2AJSL 1ERNA 1Y0LA 1JDAA 4CVZB 4IM4A 1E6SM 2XZAL 4JLRB 4LASH 2VN4A 1EXUB 1G7PB 3DO7B 1KPRB 5CGYD 3WQ6A 5DK2B 2QMJA 1YN7A 1PFCA 3GH4A 5EZLA 3FJTA 3U0TA 3S6TA 3I2CL 1MHHB 4PRNB 4PJEF 5D71H 1E28A 2DQEH 2FYYB 5KSUA 3BD4A 4PJ7F 3FOLB 3L7FA 1W9PA 4ZFOA 3JUZA 5FCUL 4RA3A 1EVUA 1KC5L 1PLGL 4W7UA 1E4IA 4PY8J 3WFBL 2X0HA 1A6WL 2R0KL 1NAKL 1QBLL 3T0DA 1Q1JL 1J0IA 4UIKH 4Z0XB 4MA1C 2O9TA 1E15A 3WUBA 4Y4HB 1CL7H 1Q9OA 4UDUB 4JQXC 1KGWA 1H3GA 5B4MD 3MRFB 2V3GA 1JD7A 3CGTA 3ULUH 1TJGH 3SCVA 3VO0A 4UCFA 1IGJB 4AIOA 3O0RL 2ZNXA 4HSQA 5H37H 3QAZC 1MJJB 5F6IB 1U91B 2YD7A 3RPIA 3BVNB 1ROWA 4WFHE 2AGJH 1BGXH 5H35A 5FUZH 5JUEH 3HG1A 1UWXH 1CS6A 2MKLC 3UP1A 2PWDA 1PZ5B 1OAQH 5A6LA 4HV8B 3ZDYE 3IJSB 3O9WC 3PWNA 5FIEA 1Q8MA 2P8PA 4I48B 1XF2B 3QDMA 3KLDA 3G6AA 3MA7B 4KKCC 1A6TA 1S3KL 3N06B 3ULVH 3QXAB 4P49A 4RFNC 4PTMA 3GTNA 1A6TB 1MJ7L 2EEDA 3PE9A 2ZKHH 3LN4A 4X4XB 3U7YL 5C0DA 3GMOB 2A6IA 5I1HL 3PP3H 2PO6A 3LN4B 4G6AC 3RAJH 3FMGH 3GMOA 4LLUB 1A3RH 5DURB 1XFPA 2X4TA 1FFQA 5E8EB 4ZXBB 3MV8A 3CX5J 3F7RA 1NM9A 4NKQB 2VH5L 4LIQL 1G7HB 1YNLL 4OI8A 4YDKL 4Z7VB 2G2RB 2VUOA 1MQ8A 4KGLA 1CL7I 5DMKA 1D6EB 2J88H 5I1AB 3OKKB 5SV3A 5GSRB 3VGFA 4NT6B 4JN2A 4OZFA 1AQHA 2FR4A 5KJRL 4JHWL 5MP6L 3P30L 2A3CA 2YEZA 4CVXA 2HFGH 2YS4A 4MJ2A 2CH8A 3DYOA 2AVGA 3HC0B 3VXPA 1T4KB 4RWYH 4UFJA 1MVFA 3SY0A 1A7QL 1JNNH 5H2BA 4LDLB 4JFYB 4NI3A 5DMGC 1EK3A 3CPLB 5FYLE 3VPLA 2J6EL 5MEPA 2ARJQ 3STZA 4MXVF 2OSLB 1UA6L 3PBGA 5HDQL 4NC1E 5ITBH 2X4QB 4NKMB 2X6MA 3SGKC 1IAOA 2VXVL 4Z2KA 5LAXB 5DO2C 4PJXF 3THMH 4LGRB 3MRKB 1T3FA 4P4KD 4XC3L 1K4CB 3MTRA 5FYLD 3ZE0F 4MB3A 1TR1A 4W8LA 4RFEA 3QDJB 4NO2A 2MCPL 1UD5A 2F58L 5EIQA 4NC2B 4LCWA 3RTQD 1BF2A 5D71L 3HKFA 2VISA 3QWRA 4UAOB 5MEQB 3PTQA 3AM8C 2VZSA 1A7PL 1IGMH 4MNGE 3UTTB 2ATKB 2I5YH 1G6VK 3VXNB 3LAFA 3EYSL 3P2TA 4G6KL 2BNQD 35C8H 1NP0A 3OXSB 3P9LB 5IKCB 1CE1L 4HUVB 2C1PB 3ARBB 1IC1A 4Z95L 4HUVA 2GK0A 3E6FB 3SDXF 2GAZB 4C7DA 1U6AH 4HS8L 1MCRA 4OZFH 5ERWB 4H2CA 4NM4L 1AO7B 4KUZH 1S3KH 4P7NA 2YBRA 2JEPA 1ZLVH 1E6RA 4XPGL 4EUPA 3ZKQD 3V5DA 2HJKB 3QUZA 4P0DA 4ZSOE 4L8SC 4EDWH 2D24A 3VFTB 3JWDC 2F74A 4UQAA 1BZ7A 1KB9K 3K81A 2WIIA 4YIQA 5IJKC 4J3UA 3DSFH 1M04A 2IALB 3BKJH 3FKUS 3G5YA 4RIRA 3MBED 1IC7H 3SCNA 1LNUA 2OJZH 4E41D 1RPKA 1XCXA 2YPLE 3ILPB 1XR9B 4WIWA 2F61A 5ID0A 1QRNB 1NMCB 4NWUH 5C9JB 5D8JL 3KL0A 4O58H 2YZ8A 4G8FB 5CCKH 4QF1B 2BNRB 5D7IB 3P40A 4NUGH 4PJXB 4R90L 4F15C 1BG9A 4W4OC 5FK9A 3ZJKA 1AXSB 1K4DA 2YSSB 3PZVA 4RGMC 4MB5A 3V0WL 3WEXA 2WMIA 4GKLA 3IJHB 4KRUA 5ESVB 2OQJA 5DVKA 1OD9A 2JJVA 4HJJL 3F65A 4WF7A 1VFAB 5E09A 3WFZA 2W91A 4UNUA 1F5WA 1UWIA 1X6NA 2Y7QB 2ADJB 4XVTH 4XAKE 4N90E 1M7XA 1CT8B 2FB4L 3EHBC 5JDJA 4KRNA 5GGVY 4HS6A 5I15H 2PYFA 4M1DH 4MQSB 1OAZH 4AENA 5CS7A 1T66D 3EYVB 1IGYA 1FRGL 2E6PA 2W9DH 4ALAL 4X4ME 1EDQA 4XVTL 3O3DB 3EJZC 3O9NA 5J12C 4PCTA 4DWSC 2OMNA 2R4RH 5AAWA 3Q6GL 4UILH 1US2A 5JUEL 1VAHA 2Q20A 3WFLA 3VXME 1IAII 1IMHC 5FDWB 2QJDA 3KDMA 2IADA 3AAZB 5CEYB 2C3VA 4OCYH 2CPUA 5BZWB 4XP4L 1PZ3A 3V5HB 5DJYB 1CFQA 2R9HD 1N6UA 3IDJB 3CMOH 5ALBH 1MWAA 3HHRB 4YFDB 1HI6B 4U3XA 2AABL 5GS0C 3DV4A 1B3WA 1UEMA 1MYRA 4J3WA 4R4BA 1OINA 1ONQA 4F9LA 3I75B 3CUFA 4JFFE 4Y7EA 4OZIA 2VUYA 3ZOAA 4M6OL 3FONB 2W9EL 3BYYA 3BEVB 3LD8C 4JO3L 1UKPA 4RX4A 2MCPH 3CC5B 2AJSH 5EDXA 3IDUA 1I9RL 1E43A 2RJMA 1OAZL 3PL6A 3B6SA 2D7TL 2RHEA 1CZ8L 4GH7B 4K3JL 3B2VH 1OPGH 1R3HA 2DQIH 4IDJH 3BCFA 3TT3H 3WF0A 4MX7A 1W0VB 4ZE4A 1EUUA 2VDKH 2ICES 2HT3C 1FP8A 4M3KB 1U30A 4UBDD 2VVSA 5E1AB 5FO9B 3GNRA 5ICYB 1U8KB 1TTUA 2VERN 2XOTA 4U1MB 1AR1C 1RZGB 5BO1H 3WBDA 1G9NL 1KXTA 4BF7A 3FW6A 2W0FA 2RAMA 1CLYL 3KPRA 5I1KH 3TO4C 1PKQB 2VRQA 3NIGE 5I15L 1IGFL 1TNNA 4KRLB 1S7SA 3NAAH 4F7EB 1UWEL 1CLOH 2ZUQC 3HR5B 1UWRA 4HZ8A 3WS6A 1RK0A 3F12B 1NGQL 4S3JA 2GCYA 1QSEA 4QKXB 2YD2A 3NVQA 2VAAA 2QHLA 2VAAB 4PMRA 3EOBB 3VI4E 4DCQA 3JV0A 5C0BE 4DN4L 3A4XA 1X44A 4M48H 5GGRA 4YR6B 3M17B 2WVSA 3BXWA 4S1QH 4JREB 3RWGB 2ZX9A 4DZBB 3K4AA 4F57L 2OXGA 5D9MA 5J1TC 3U4AA 2ZP0T 3FZUD 2Y36L 3ECQA 4HZ7A 5SX4H 1F90L 4ZTOH 1PZ2A 3CIVA 5K9OA 2UY6A 1JHLL 2PUQT 1FORH 2A83B 4I3RL 3L3JB 1B3XA 5F3HB 2AEPL 3MLRH 2D03L 2MHAB 4UUJA 4UOJA 3EAKA 1P4BL 5DK3A 4Y5YC 2X4TB 4UQBA 1CZ8H 2W62A 3RTQA 4LP5A 4QWWD 3O3BB 1U8IA 5EBLA 3BPNC 4HWBL 4WO4D 1DQQB 3A6CL 4P2RD 3AYRA 3ARYA 3D85D 4NO5B 3C09B 1WITA 3LS5H 2NZIA 2YBTA 1Q72H 3W25A 3NA4A 1AI1H 4RRPA 4GW4A 3RDTC 5T3XL 1ADQA 3AY4C 5FB8B 4PGCA 2F53D 4H41A 1YQ2A 4YFLF 1URLA 4XVUC 5CWSA 4PB0L 3G5ZB 4ODTL 3DUUA 2CK0H 1V6UA 2WWCA 4D94A 4RGND 4OT1H 1LQ0A 1TA3A 2J1KA 3QHZH 5C0CE 1CGTA 4JFDA 3FFCE 4JFDB 1W2PA 3QUXA 3T09A 5DO2D 4OF7A 5CFHA 4PYSA 4DAGL 4LYPA 2HT3D 1KCVL 2ED7A 3CK0L 3X3FH 32C2A 1IBGL 4WHTA 1XH0A 3K7UA 4C56E 4BA0A 2WC3A 1N8ZA 4QRQB 2Z8RA 1EO8H 3RFZC 4G8GE 1UVQB 4OLEA 3MGOA 2DD8H 3NSXA 1UVQA 3DVIA 2EZ0D 4M62H 4CD7A 3ZLQC 4LSTL 1L9NA 1NAKH 1OGBA 5E94A 3ZE2E 1E1EA 5GGUA 4ZAKC 5CUSL 1GZPA 3BOVA 3TIDA 3NN8B 2HYMA 5KVGL 1C93A 3U7YH 5I8CA 3NN8A 2DWEB 4G8GD 5CLWA 4AH2B 3BIBX 5A2LH 3G6LA 3SN6N 3D85A 4WWKB 4G9FB 2XSAA 4B53A 5DJCA 5DI8B 3TVMA 1JG9A 2AJVH 3VXNA 4PJFA 2FD6L 1HVQA 5IW1B 3IFLH 3QUMB 3D2UD 2P5WE 4FMFA 4JFPB 1NQBA 4BSWA 4NBXB 2W65B 3F7PC 3T65A 1VF8A 1EA9C 5FYKU 5J12B 3JWOH 3CVHB 3BUYA 4AEHL 1HQ4B 4L9LC 3O4OB 3SGJC 4Q7NA 2FX7H 1WT5A 2J6EA 1HOCB 2G3JA 5F93C 4R0LB 2AJVL 4NKOB 1DQDL 2V5RA 3DXAA 3LB6D 4EUPB 1II4E 4PJ9C 2PXYC 4IRJC 5AUMB 4XCNB 3PXJA 4DOHB 3EYFA 2OJZL 4PJDB 5L8JB 1BYAA 5BV7B 43C9A 3ARFD 4B9YA 2YA0A 5DUBB 2XKSA 4QWWC 4BQBA 1XH3A 1MXDA 2YKLH 3O41A 1X5AA 4MJ4A 4P2QE 4YDJB 1LF1A 2EH7H 3WXVH 4F9PC 5TF0A 3Q2CA 3BAWA 3T4YB 4Q97A 1E3XA 5B38A 2EDHA 3WL1A 1BIHA 1V3JA 5FCUH 1KIUA 4XPGH 1PEWA 5D7KE 2NMSA 4L4VE 5E2WL 1ITXA 1UWEH 3DMMD 2GT9A 2IBZX 2H2PC 5FDYA 5T1LB 1JRHH 5E0QA 3EUUA 1E6OH 5M17A 2A6DB 1B3JA 1I1FA 2H32B 2MQCA 1I7RA 3GSUA 1QP1A 2EKSA 2PYEA 1UD6A 3WIHA 1A21A 5C0NC 4Q22A 2KZWA 3O0RH 1WEJH 3R0NA 1LE9B 1WDPA 4HDIB 1E4LA 3O9WD 4GBXB 4AQOA 3L4YA 1BREA 4EN3B 4J27A 1FVDA 2VXSH 1ZANL 3UBXI 4Q6YA 4OF0A 5I2IB 2KDGA 1QBLH 5JPNB 5JTWA 3HMXL 1XF1A 1KENL 2ZUYA 2AKRB 1BSIA 1A9EB 1UH3A 1ZHLB 2R2EB 4JPVL 5FO8B 3MRCB 4QXUH 5A8OA 5A6BA 3PV6A 3CLFH 4HA4A 5C0AB 3U0WH 3PV6B 4F7TB 5BS0A 2OSXA 5GGVL 5IFHL 1WWCA 1OSZB 4I3RH 3WFHA 1IRAY 5FDWA 3VIHA 3DURA 1LEGB 1E6XM 1W1TA 3HCVA 1AHWB 4QXTA 1UGNA 1DLHB 2DB8A 3T3PE 1BVNP 5IK3B 2D3LA 3TN0A 3PGCB 3MZGB 3MRRA 4XWGL 3QULA 3CDCA 2YD8A 3QFJB 1J1PL 1QNRA 1PDKA 5HDLA 4XXDA 3C6LC 2I9LB 2J8UA 4RE2A 2JIXB 4UU9B 1NC4A 2Y24A 4JJHA 3OQ3B 1W9UA 1ZHKA 2AK4A 1MI5B 2RGSA 3QIBB 4ML4A 2VLRE 1NKOA 1WV7T 2P48B 3AIWA 1VIWA 4QRTB 4B9ZA 5FL1A 5F21B 4OCNC 1JL8A 3GMPB 3PGFL 4BFIB 3SJVB 6FABH 3LPWA 3SUUA 3BZDA 4EJ1C 4AD4A 2XNAA 3L3DA 4OKDA 1MCFA 3VFWB 3HE7D 3QUMH 3V6OA 4OZOA 4V1DD 4QP0A 3TTOA 4Q6IA 1KJ3L 3M07A 3ALPA 2B1AL 2VDOH 4R4ND 4DGYH 2DH3A 5A3ID 2Q8BL 3L2MA 2W0KA 4U7MA 3C5ZB 3ULVE 3OWEA 1EDTA 1DP0A 4MTVA 2O93L 2A0LC 5L9DL 5JO5B 1UQYA 3O4OC 1T22B 4PMUA 4Y89A 3NFNB 3DMMC 1IT9H 4CJ0A 4B50A 3HZMA 2E40A 1F3DH 3RVTC 3IANA 3RGVD 4DN3L 3QHNA 2VWEE 5IEHA 2O5XH 3ULVD 1RIVH 1BD2A 3L5XH 4TSCH 5HYJB 3KYNB 3IJYA 5EUOB 1S7QB 2UY2A 3LKOB 2VDLL 4KVCH 1JTOA 3NA9L 4P5MA 5L8LB 4LOUD 4PJDF 3UDWC 1IT9L 4A3HA 1T04B 4MA8L 4ORGB 3NCOA 1ES0A 3BX7C 3RNQA 4K2UL 3GHBH 1C5DB 3W5MA 2ENSA 3LEXB 2HJFA 4XC1L 2ZKHL 3F7VB 4KK9D 2GJ6E 1OGAE 1WZ1L 1KJ2L 1ORSB 4H8WL 1OD0A 4XHJC 5I24A 2HTKD 2BSRB 1JGIA 1DN0A 2QQNH 4QT5A 2EEAA 3T0ED 4X0VA 5JW4R 2JK5A 1KXVA 1J18A 3T08A 4FQ2H 2XFRA 3T4AB 2CLVB 4YXHH 4DEPC 3R4DA 1LDSA 3BKMH 3D18B 1NGWB 4PV8A 4RISL 3NSMA 1R3JB 4WKFA 3ARTA 1NGYA 1U8QA 1GGIL 2CGRL 2CR6A 3HR6A 1FGVL 4LCIH 4AIXA 3OAUL 3QHMA 5C0FA 3SDAD 4S0SD 1Q0YL 5E6ID 1AGCA 2XN9B 1QNSA 1A6ZB 2FHCA 4Y16D 4JGMA 1J8HB 4EN3C 1KF9B 2ZOKB 4W84A 3THCA 3BJ91 2A83A 4XAWL 4X5WA 4IIQA 3NH7L 1KJ2B 1PSKL 5KZCB 1B0WA 4I77H 3SBWC 3JXAA 1E6ZA 4Y1AB 4PD4K 4F8XA 2WCAA 5E0FA 1I3RB 5ETUB 5F7DA 3RL2B 1GOWA 1GVYA 1GPOH 1NBZA 1VKXB 1UM4L 1U95B 2ZWYA 3OTTA 3SKNA 3T3ME 5I8KL 1QNOA 3LMJL 3PG2A 4PJ9B 2J77A 3T2OA 5F1OB 2PXYA 5F7YC 1FNGB 4YGAB 4Z76B 2F8XC 4P2OB 2EXYC 1UD8A 1QBML 2CMRL 1HZHH 3GJFB 4P2OA 3UPRB 3DJ9A 2OBGA 1OTUC 2ZUMA 4JDTH 3VCLA 4PMOA 4JVWA 4R8WL 1B1YA 2DQTH 4P7RA 3MYJA 4GAYB 4JM2F 4U6HA 3LPFA 4G7VL 2IQAA 3AB0C 2UV3A 2CBUA 1ZGLP 5DMJB 1Q9LA 1G7QA 3S36H 3GHBL 4ODUA 4DW2L 3QRFM 4S1QL 3UAJC 1KGCE 1YEFL 3MMUA 1UXWA 3ZE1F 5MP6H 1AKJB 3KPQA 1MAKA 4G8IA 2ZXAA 1WTLA 3KPQB 4KTEH 1R5WB 1RZ7H 1ED3A 2OLDA 5EOQL 1YYMH 2VSCA 4P8UA 1VHPA 5CP3H 1TLKA 4PRIE 4ACZB 4FQXB 4FQQB 4FQ2L 1QTYT 2F9BT 3QIUB 1YEEL 3GXIA 4JAWA 2RCSH 2Z8VC 4ENEC 3NIFE 3RPKA 1J10A 3CMJA 4KTEL 2ZUNA 3LB6C 2NY5L 1WB0A 3KPOB 2WYSA 1P7KB 4PRID 5GS1A 2VLKA 3DPBA 4TVSa 2K7QA 4WCYH 1PW3A 1V0NA 1MOEA 3JV6B 3GK8L 5IBLD 1NOFA 3RM8A 5D2LA 2ICEA 3VXRD 4FXLA 4GRLC 2CDEB 3MJ9A 3MRNA 1YJDL 4L8BA 3GB7B 2ZJSH 3O8XC 4UOQA 2DBLH 5F6HJ 2WBJB 3GNMH 3VM5A 1UACH 5AC4A 4PMYA 3W39B 3S37L 2DJUA 3UAJD 2OM5A 3KXFD 2JALA 4KQ3L 1ZSDB 4WNQA 1GOMA 2UWEE 2X5PA 3I6KA 2XTJE 2F54D 1ZHBB 5C0IA 1HKIA 1FSKB 5F88B 3OHXA 2EDEA 1ZHBA 3BIKB 1O5DT 3MRHA 1GQJA 4FLQA 2HVKA 1G0YR 5CD3B 5IFAH 4RMVA 3NJ3A 1OD8A 4ZDHB 4G7YL 5SWZB 2AMGA 5BXRA 1CFSA 2GSGB 1GHRA 4AISA 2B7DT 2EH8L 3V4VH 3MROA 1VA9A 3DRTB 4LCCC 5TE6L 1V0MA 1G7IA 1OAUL 3LS4H 3BSZH 3AOFA 4YHNB 1P4LA 2PTUA 1GJUA 1BLNA 3L5WB 2YPLD 5A8NA 1CK0L 1C3FA 4YJZL 5BXSA 4F66A 3TBVA 4NZUL 3OKEB 5E9DB 5IB1B 4OCYL 1S9YB 3RDKA 1J86A 5D96B 1BGAA 5EULV 1HXJA 5HYSG 2D4DA 4G3YH 4MA8H 5EU5A 4GBXA 1EEZB 5DJ8B 3VOCA 3RVXC 4NUJB 3GH7A 5J6GA 5IB3B 1Y18A 3QDJE 4NT6A 2WSKA 1UACL 3D0VA 3B9KA 3IDNA 3TCLA 3E2HC 1BVLA 5F72S 2ICWI 3B9KB 2AKRA 2BHUA 4YHLH 2NXZB 5JNYA 2IAMD 2BNUB 1RJLA 1L0PA 2A73B 5JOFA 3QCTH 1S7UB 3F7QA 1RFDL 3EJZD 4M8QB 1OAXH 4PR5B 1S7UA 4MAYA 5HPCA 4OFVA 3HC3L 5F89B 1WWAX 3G6JE 3TJEH 4Z78B 2QMKA 4B5EA 3V5KA 3CDGA 1UG9A 4E0RA 5IESL 1AHWA 1GGCH 3KEHA 1S7TA 4Z7UA 1QOXA 5EBGA 2ARJA 4G42B 4UQEA 1KTLB 4CN6A 1UG6A 1IEBB 1BEYL 1ZS8A 4LPXA 1HSAA 3RVXD 2FIKB 1YMMA 4TXEA 2OR9L 4R96B 1WSST 3SUSA 2B39A 3PL6C 4YBLB 1BVKA 1OAYH 4PJFE 3RWDB 4Y2DD 1BVKB 4OZHF 4QHMB 1FAIL 2XZCL 1SVZA 3KS0J 1B4JL 5T1KD 1GQIA 3RWEA 4XZBA 3D39A 4FTVD 1W2KT 4BJLA 5FA4B 4JFOB 4AG4L 4FP8L 1WDSA 2XQYK 3FQNA 2QKIA 3B9VA 1I7UA 3NTCL 3QO0A 5F7UA 1A5FL 1MCWM 3BH8A 4HJ0D 3V4PH 1M71A 1J0HA 3VRJA 5B38G 2VDKL 4LSQH 4RQQB 5I1LB 3TJEL 4IOFD 2CJUH 1CGWA 2NLJB 1U8NB 4MSWA 4QRRA 1Y6NR 1YUHA 2RFXB 1YY9D 2D7TH 4J4PD 1V08A 4UQ3B 3IU4L 3TLRA 2G75A 1KCKA 1A7OH 5DQ9A 1XGPB 2HP4A 5HYJA 1XR9A 3LQZA 3Q0HA 4N0FB 5ID1A 4Y2DC 1ZJAA 4A6YA 1MW0A 4HA1A 3K1DA 1ITCA 1FL6B 1YMMD 3LEXA 4HMEA 1IGCL 3MV11 4KZEL 4YDVB 1GIGL 4RMQA 3VWKA 4UR9A 5E03A 4I18C 2V38A 3VXMB 1MCJA 5ALCL 3K2MC 1LEKA 3S4SA 1AGEA 2IANA 4E4PA 2H3NA 4PJEE 3O45B 1ITBB 3FAWA 4D8PB 1PY9A 3PWPD 3U46B 2OTWB 4XPBH 2QL1A 3LQAH 5TJWK 1NEZA 1UB5B 1WC7A 4ONFL 2D31B 1D5IH 2X4OB 4FFVD 1GCYA 5F70A 1A5FH 1JN6A 1AFVL 1YY9C 4CNIB 2CQVA 2Z31B 3RI5K 4LPWA 5DEFB 1HDMA 4NOFA 3SDXA 3TNNB 4QOKB 1OWQA 5CPSA 1CDYA 1TTGA 1KCSL 3BN3B 1SMDA 2JCCE 3RTQC 1JGEB 3GBNH 5ACZA 3NCJL 2A2QT 3OAZH 1UKSA 3QWOA 1DVFC 4J3OC 1OLLA 1FYTA 4UOW0 5E7BA 5AC5A 5IVXE 1RZJH 4YPJA 1GHSA 5A3IC 3FFDA 2DWDB 3T1WA 2VH5H 1NBZB 4WWID 4OFKA 4GRLA 3QNZA 5FYLH 4OIBA 3MRDB 3G04A 2BVOA 4KMQA 3MRDA 4X7SL 3DWTA 1E28B 2FYYA 4K23H 5LXGH 4GQQA 2UVEA 3C2SA 3ZHKA 4O2FB 3WDPP 4GG8B 5DQJA 1BJMA 3I75A 1K6QL 4K07A 3QUXC 3BZ4B 4P2CG 1B0GA 1YEGH 4V1DA 5D7IF 4YHMH 1NL0H 4I9WE 1MAJA 2VDOL 3VCLB 2A9ML 3BP4B 4PMDA 4UTAH 1AR2A 1D5MA 3L3GB 2DSKA 2YKKA 4DUXA 4J8RA 3PL6B 4LIQE 4RNRB 2PW1A 3CZFA 4I3SH 2G5BB 3DUSA 4JVUA 4XBPA 1EJOL 4LSVH 2AGJL 3ARED 5GJSL 5FYKE 4LCCA 1LWRA 1RURH 1JI2A 2A9MH 1MJJA 2XXMB 3FFCD 1FZJB 3ZTJH 3P4MA 2ITDA 4KJPD 1W9BM 1M01A 4JO4L 4D9QE 2P43B 3CFKB 5FYKD 3UC0H 3PDGA 3ES6A 3DV6A 1S9XB 2E5EA 1C5BH 1P7HL 3HG1B 2PI6A 2IEPA 4J7RA 1T1YB 3WUWB 4XPHL 3TYFB 1RZKL 3PWNB 3DETC 5DO8A 4U0QB 1FIGL 1GH7A 5IMLB 3V2AR 1JGDA 1L7TL 3BN9C 1JGDB 4MHHG 4R4NC 4U6VH 4UV4H 5HGHA 4DKFL 1H5BC 4CU8A 1V02A 4Y4KB 2QHRL 2A6IB 1KNOA 1LD9A 3VFOA 4UFLA 1QBMH 2FJHB 3N9GH 1NFDB 5C3LD 3L1OH 3UPAA 4ZNEE 4KK8C 1UR1A 4JO3H 4AZCB 5CQ1A 2HFTA 4K3DH 4DKFH 2EDBA 3GMNB 4CGTA 3I84A 2C26A 4Q58C 3GSNL 4WI5A 2WWMD 5DMKB 2GYSA 4PRHA 4FABH 3R06B 1QFOA 4J1UB 1QA9A 4LASL 3HUJF 4G7YH 3OHXB 1JPGA 2C7UB 2WLYA 1R7OA 4HV8A 1FZKA 3TA3A 1MW2A 3LS5L 3GI9L 5MENB 4R0LC 3WF2A 2FEEI 1G9MH 2K1MA 1Y6MR 5D1ZC 5TE7L 4NP4H 1CWYA 2OSYA 2YRLA 1W3LA 1CLZL 3GMMA 5K9QG 4KZEH 2FJGB 3TNMA 4OCSH 2GUOB 3F58H 3EDKA 5MEOA 2COQA 4P2QD 3NYDA 1N7ML 3MCKB 1HH6B 4C56B 3CH8A 2YXFA 1M03A 3VMOA 4H26A 3ROOB 1G7HA 1S7WA 4PJHF 4H7VA 4L4VD 1PGRB 1FG9C 1P1ZA 3RGHA 2EYRB 1JPFA 3GSRB 5I1AA 4WU5B 4AEIH 3QUYD 1W91A 3KYAA 4WEBL 2Z8SA 4X9BA 4RMRA 1FVEA 3MV01 1OIMA 5HXMA 5KSAB 1VFUA 1X5LA 4YC2C 3VWJB 3HMXH 5J6HB 5GXBB 1UWQA 3IF1A 2UY7A 3POCA 2CDFB 4XMLL 3PWJA 1MQKL 1NFKA 3BP7B 3V4UH 2P5WB 4O2EB 3AHTA 5TE4L 2CLRB 2APFA 2X41A 3PDOA 5LA2A 5I1CL 5EOQH 3ZSSA 1KTRL 3CUIA 5H2BB 3RDTD 2UWFA 1VGEH 3AFLA 4P23B 3WFCH 3QHFH 3C6LA 2ZOLA 2M26A 4ZPVB 2VXQH 4XCFH 4NKMA 2B5IC 3NDYA 4BKLA 4ZEPA 1E73M 4L3CA 4Y19B 4JANA 3RJXA 4YHLL 5A6JA 1T3FB 5KOVC 2BFGA 1Z9MA 3K4DA 1G1YA 2Z4QA 4Y5XA 4I0PC 1GAFH 4LHQB 3PZIA 1SEQL 3BSGA 5JA9A 3F5LA 5CJ5A 3T8XB 1C8YA 3PF2A 1E4KA 3VVGA 5A2AA 3K8LA 1KC5H 1S5IL 2DTMH 4Y5YB 2XWJB 4RMSA 2YLAA 3GSOB 1EFXB 5IB4A 4LRIC 3ARBA 1EDGA 1D9KD 1J1OL 4IDJL 4CMMA 5MHSE 4CCCA 4LCYB 1BAFL 1YQVH 4HJGB 4H1LA 4XNUL 3AXIA 4UZSA 3HMXA 4MA3A 1J0YA 3L3HA 4U1HA 3R8BB 4JIEA 3GFUA 3GSQB 4HPGA 1EXUA 1G7PA 3TJHD 4FTVA 4CDHA 1F13A 3ARQA 5D1QA 5MHSD 3DO7A 2AV1B 3LH2L 1SM3H 3A67H 4XTRD 1N7MH 2X4RA 4M8UA 2AV1A 4K3DL 5DMGD 3MLTB 4PRPA 1A6AA 3FL7A 3QA3A 3F5WB 3BH9B 3PWLA 3L3KA 1P6AB 4X4MA 5DS8B 1QVOA 3UEQA 4JRXB 5I1JH 3MNVB 3G08A 2ZX5A 4U6VL 1DDHB 3IETA 4N0CC 2JB5H 2X10A 4Q2ZB 1CTNA 1QR1B 3VFSB 1J0KA 1KYOJ 5DYOA 5ANME 2DI7A 3RVWD 3WNKA 2AI0H 2JB6A 4DGIH 5CIPH 4P9HL 2EC9T 2VI0A 4EI5C 4HWEH 4DN4H 3HMCA 2WHLA 1FAIH 1VFAA 2R2HA 4G3YL 3B3IB 4ODBD 1QFHA 5DT1L 4PRPE 4EN3A 5JZ7D 5HPOA 3M8OH 4U1IA 3TYGL 2VRAA 1NCDH 2Q76A 4LCIL 5KG9A 1HQRA 1AGBA 4PLJC 1KFWA 5C0EA 15C8L 5EFDA 1VCAA 4Z7UF 1JGLH 4XTRC 3S3JA 3PIQB 4PJHB 1CE6B 4FMVA 4PN2A 1IFHL 1KQZA 4YDLC 1LL7A 5C0AA 4M7LL 2J8GA 1ZMYA 3ZE0E 5I8EA 4K7PX 2J7DA 3RCNA 3SO3B 4M9OA 4O02L 4F80A 1DUZA 1DQJB 5IF0B 5ADOH 2PBOA 5EOTA 4TSBH 1R3HB 4AQ1B 1LEGA 2J8HA 2IANE 1GOQA 4GINA 4J28A 1VRXA 4IRSA 3MV9A 2PCPB 2DQGH 4MS8D 5EOCJ 2P7TB 1OF2A 3HZYA 2FZ3B 2UZXB 3MA9L 5IOPA 4CMHC 4GXVL 2BFVH 2BJMH 2MSPA 2XIBA 2IAND 3AHVA 4JFQA 1PX8A 1P7QD 2EDXA 4U1KA 5DQJB 3QGVA 3UROR 4YNYB 4ZTOL 3N85L 1SJHB 2XT1B 3O6FA 3QH3A 4HBCH 1XF4B 1YN6B 5C3TA 3WEOA 3MA9H 4MDPA 3MUJA 4TUOB 1XYZA 4LKCB 4OLVH 3TA3C 1PAMA 1YY8B 2WZPD 4M5YH 1AVAA 4WCYL 1YJDC 3PHAA 5A2JH 4KJWD 3QJFA 4CU7A 5D1ZA 4F33A 3HPLB 1T5WA 3LV3A 1OGAB 1RUPH 2ED9A 5IFTA 1NWTA 5M5DA 1LL6A 2A1WL 5IBTH 5BW7A 1T2QL 3VMPA 2J12B 4NHUA 1ZAGA 1V5JA 2X1WL 1OY3B 3O3AB 1A6UH 1UYWH 2DLIA 3VD5A 4F58H 3QQ4A 4GI6A 4FFZL 3NIDF 4PB9L 4XCYB 2CLZA 5E8PA 4XB7A 1OGTA 5HHQA 1RZJL 4Q9RL 4CD4A 4V2BA 1UB6A 5GRVL 3C5JA 3IDYC 3K46A 2DGAA 5I8KH 2V9QA 4RFEB 4FXKA 2R0LL 5ISZE 3IU3B 4P5MB 3S96B 4CBPA 4CJ1A 1HHIB 1T04A 3R1GL 2XZQL 1G9HA 1NC2D 2IH1A 1HHIA 2QV4A 4BQ8A 3L9RA 1U33A 4JR9H 5CPTA 4G5ZH 3N13A 4URTB 2G3MA 4CADA 4PRBA 4Y1AE 4RX4D 1DQTA 1H09A 1RZFH 3MSPA 3PUCA 4U1LB 1U3HD 1H1NA 3CCHB 4KFZC 5CJOL 3ARSA 4CCDA 2DM4A 4LEOB 2ZZUT 4G43A 2CLVA 1LO0L 2HT2C 3INUH 5E4EB 5EH1A 4FHBD 1UH4A 2AXFA 3QNYA 2WM0A 4LSQL 3BGMA 2WV3A 4Z2HA 3DVNB 3UMTA 5DJXB 5CXPA 3SKMA 3BHBB 2Y6SC 4N8VG 4GXVH 1GW1A 2ADIB 4NQDA 2PWFA 2B8OT 2C0HA 4X7TA 4NQCB 1C8PA 1KJMA 1OCWL 3IDIA 2DLEA 3TBWA 2FLRT 3BT2H 3KXFE 2YBUA 3T77B 1EJ6A 5D9SA 1CTOA 2VXUL 1F45A 3KPNA 4KI5F 4XP5H 3MUGA 1BQHA 4TN9A 5D7IA 1PIGA 3RNKA 3W9DB 1WCQA 4XBGA 2VL5A 4ODSL 3VE0A 2O5ZL 4WTZG 5FYKH 1Z0NA 5FHBH 2R0KH 3RDTA 3JVGA 2ARWA 3PJSA 4NQEA 4OGXH 4TVPL 1ZLUH 2Z91A 1DTUA 1ND0A 5CKGA 2IC2A 1CLZH 3P4OB 1LMKA 2Z91B 4AEFA 4Y2OA 1UZ6F 5J6HA 4PUBH 4OLYL 5DJCB 1TMCB 3TVMB 2CKBH 1X5GA 3G5XB 4U1SA 1MLBA 4P9HH 3KPMB 4S1RH 2H8PB 2I60H 3IFPA 2YPLA 4OLXL 2CLRA 2ZCKH 1NDMB 5CP3A 3QHFL 4F7CA 5IKCA 4YXLH 1KN4H 4TNVF 5TH2B 1CXIA 1S9WB 1LP9B 2PWEA 5F7MC 3V0VB 1N8ZB 2VCCA 5EG6C 3Q6FB 4KK5D 3HC4H 4LNRA 5GGTA 4F2MB 4Y5VC 1IEAA 3NFSH 2DSVA 2AXHA 1H3TA 3QUZB 2VXVH 1T7XA 1U8JA 2H41A 5CJBA 1E4XI 1UR9A 5GJTH 2PO6C 1OM3H 2HTLC 4TYUA 3E3QC 3INUL 5CJOH 4X98A 5EFIB 2GJXA 2BERA 5I1EH 3HAEB 2BHZA 4PP1C 4DGVH 3BP6A 4WI9A 2NY6C 2VITB 4C58B 1TZGL 3D25A 1XAUA 3QPQD 4ZXBC 5SWZE 2JJSA 4QY8A 2X70B 4NRYB 3MCG1 3RKDC 3SCMB 3GDBA 3MJ8B 4AD1A 2PTVA 3AICA 1Q4NX 3LEVL 3SCTA 3MRPA 4ZNEA 1SY6L 5FHAL 4O5LL 2AJXH 3MREB 1W72L 3PHQB 1ZT7A 1GOFA 5DDHB 2WAGA 4XPAH 3BZFB 1F4YL 1KIPA 3KVQA 3QNXA 3U82B 4HJ0C 2X44D 1FBIH 1LE9A 3QUXD 4N9GA 3QNXB 3OKMA 5D96C 3SDYL 1ZKAA 5I19H 4LHUG 4MWFB 4FF5A 4RMWA 3RWFB 5HD8C 5JHDB 1S5IH 5DHYA 2Y06L 4MD5A 3GNML 3RWFA 4PTTB 1XZ0A 5ICXB 1U92B 3WN5C 5J1SC 3TONA 5FGCE 5BS0D 4OCLC 2Z1KA 1E5JA 3VX1A 5HPMB 4Y8AA 1YEKH 4M24A 3L7FB 5I9QC 5JXEC 1QZ1A 1AI1L 3C5ZC 5FOJA 2VXQL 9CGTA 4PJAA 2VLRA 5I1EL 4WFGE 1VGKA 3QPXH 3N12A 5IEKA 1T1ZA 3S4SG 3GZKA 4BCEA 5BS0E 1BPVA 3M7SA 4K9EL 5IEKB 3HRPA 4YHNA 1RD6A 4QHUB 3UERA 8A3HA 1BLNB 2KQNA 4PJCA 1HF6A 4L1HA 3DURB 5AD0A 3MRFA 5F7KC 4RGOH 1I7ZB 4MLIA 4FP8H 1VPOL 5BV7C 1BBJA 1CFQB 1XIWB 1LO5A 2D2OA 2VIRB 4LEXL 1FG2A 3N15A 5LGJA 4R7DA 3E2HB 1OHQA 1E1FA 1ONQB 4LU5L 5EUKB 4ZFOL 5A2BA 1KB9J 1PPIA 3JUGA 2ITCA 3WBAA 1OCWH 4MXQD 2BOBA 1OAKL 4BFIA 5EWIH 1TPXC 2VLLB 4DZ8A 4PGDB 4PGEA 3QDMB 4F7TA 1A02N 1YPZE 2YIHA 5C71A 1EJOH 3TV3H 1P9MA 4MDJA 4JQVA 4PJGF 4JPWL 3GBEA 2BDNH 1CWVA 3MNZB 4M8VA 2Q86A 4KK6C 4LLUA 4OCMC 3GJEA 1C12A 3MNZA 4HS3B 4U3HA 4XP4H 2KKQA 3AS0A 3SDAA 4L3EA 3KS0H 4WUUA 5I17A 1MJ7H 3OKDB 2CSPA 3FNDA 5B22A 2FBJL 1ZHNA 1ZTXH 1ZWIB 3C9NA 3PN8A 4AIEA 5I1GH 2GJRA 3GSVB 1CDUA 5FYLL 5ISZA 2OL3H 5C0RH 3APGA 4JDZB 1IKNA 4MCZA 4JN1H 3DHJA 4PTUB 3TZVB 3AISA 2XNAB 5GNXA 2E3ZA 2EKJA 4IM8A 4LLDA 2ZUQB 2XXCB 4K3JH 4YAQB 4DTGH 4I18B 4QLJA 3L1OL 5GRJL 2YK1L 2DI9A 3OAUH 1AGDA 4QT5B 5KAQF 5GIRA 1B88A 1OQXA 1N0XL 2OL3B 2VDQH 4JN1L 1F2XK 4WUKH 4UBDC 3TV3L 2NLJA 4OGYH 1SM3L 3PDDA 5HHMD 2DLHA 2DD8L 3RZCA 2IPUK 5BZDA 5TDPB 2NW2B 5KW9L 4GKZA 3MODH 3DVFA 2FX9L 3K0WA 5F96H 2X0YA 4ZQKA 4UQCA 5DQ9B 4QCFA 1AP2B 5HJ3B 1DQMH 4LKXB 1T2JA 1VFOA 3VDHA 4YBQD 5CJXC 4JY4A 3T0EC 1QI3A 2HLAB 3UDWA 1GZQB 2ZX6A 1EVTC 4LSSH 5FAAA 5HHME 1FL6A 2BVTA 5TF1L 1F58L 3UTTA 5IFJB 4TTUA 1HKLH 2F5AH 4PJBA 2PR4L 3T65B 5KN5A 1W0YT 2EC9U 3HRZA 3RL2A 1KELH 2DIAA 1MWAL 2APBA 1JWUA 2GAZA 2DMCA 5CILL 3P73A 3W5NA 3T4AA 4X6FB 1UHVA 1Z9SA 1ZVHA 5HGDA 1K9TA 3VIOA 3H0TB 3RU8H 1U6AL 1R86A 4M6MH 4LVOC 3QI9B 4X7DC 2LAAA 1KLFA 2E27H 2J75A 2ED8A 2B4CL 2MQ0A 2ZCHH 3CXHK 1KLUB 1UKOA 1Z2KA 2WZHA 5L88H 2YUZA 1EH9A 4BUGA 3HE7C 2O5XL 3ZT6A 4CD5A 1Q94B 5LG1A 3U4BL 1JAKA 1BBDL 3MUGB 4OD1H 5D7JD 1EGJH 1INDL 2H26A 5DA4A 5HHNA 1W1PA 32C2B 3MXVL 1TPXB 2E7LC 1MLCA 5BRPA 1G9NH 1WIUA 1AXSA 1PVHA 2H32A 5D2NC 1K4DB 2YSSA 3RVTD 5IR1A 2GJPA 2B1AH 4DGYL 5D4YA 5FM8A 5JIPA 7A3HA 1KBGH 3CZGA 4ZS7L 5FKPB 3DGGA 3EOAB 3HG1E 3LHPL 3OX8A 2EEBA 2OTPA 4MQTB 5EZJB 4U6YA 3EFFB 2XWDA 1ADQH 5HYQA 1P5VA 4OGZA 2WZIA 3OIHA 4XI5D 1E4MM 3ARDB 3G5XA 4DKEL 3TTYA 2EPMX 4HMDA 1RHFA 4XUYA 1GJIA 4HKXB 2FCBA 3HNTL 2DIEA 3WL9B 1NDMA 4HXBH 5C0CA 4Y4FD 1X5ZA 3MRLB 1LK2A 1G6RA 3LKQA 4PBGA 3MRLA 3D3AA 5T3XD 4EQ2A 2DT0A 6A3HA 2DLFH 5EIVA 2VLJE 4TPRL 3RX5A 3ZIZA 3MMEA 4Q9RH 2BSED 4G9FD 4I0PB 4HPHA 4FQJL 4DKDC 4MNQD 4KTYA 5CINH 2LV4A 4I0PA 3ZZ1A 4JO1H 1AIFB 3KDMB 1IL1B 3UTZA 3NCCB 3UR7A 5T3XE 5FO7A 2D3NA 1WWWX 2R1WA 3QWRD 1UWGL 2NY2D 3SCUA 1IQWH 2VLMD 4R26H 1Z9LA 1XGRA 3BO8B 3VIJA 4FQXA 5FM4A 5C0IB 5F88A 3RWHA 2ZSVB 2J8UB 1QFUH 5A8PA 3II1A 3D25B 3U57A 2WVUA 1ZVSA 4GZEA 3O11A 1HCVA 2GJZA 3CZLA 5CSGA 3KYKL 2XQYG 4BSVA 4AZ8A 2AJXL 3QXAA 3B5TA 5FHBL 3WDQA 3GMRA 3VFPA 3KPLA 2YN5A 5D2LB 4HAFA 3OL2A 1KB5A 1ZLSL 4MD0A 3FRUA 3BLKA 1KB5B 5EUOF 1MCCA 2YD9A 4MD0B 5C7XH 3S7GA 1I1YB 2BFVL 3EJJX 1WAAF 4UTAL 2GFTA 4JFSA 3OGSA 3C08L 4ZMAT 4OLXH 3QUYC 3BAEH 4QHKI 3BWAA 2XA3A 3RIFK 1VGEL 5J89A 1LO4H 1T22A 3SDAC 2OXHA 3DMMB 2V2XB 1FHGA 4GXUM 3GI8H 1U2CA 5BRZE 3N17A 1G9NC 2WMFA 1DBAL 3VFVB 3VI3E 4L3AA 4UIKL 2HAZA 4YC2B 4KKLC 3RY4A 3KJ6L 1CBGA 1TUXA 3G9VA 4JZJA 5FF6B 3K8MA 1V7MH 5HHXL 4QHUA 3SY0B 1I8LA 3KPSE 5FF6A 5ESAB 3RAJL 5IWLC 1F2QA 5LGHH 1NANH 4BQCA 2WCSA 5DJ2A 5KVGH 2XFXB 1OW0C 1S7TB 4Z7WE 2QEJA 4WGWB 2NY7H 4BK4A 4PUBL 5E70A 3ZJ8A 3GSNA 4D72A 1F4AA 2BSRA 1V0LA 1DCLA 3MKKA 3N11A 3KPSD 2NW3A 5M95B 5DXWA 2IPUG 1BX2B 2EIDA 3EOBA 4AZ6A 5EBAA 1Y18B 3QDJA 3QFJE 4NO2B 4WHCA 5AWNH 4MNLA 1A6WH 1R3JA 4EUPH 5JZ7C 3OLEA 4N0YH 2GFBA 3QEUA 1BJ1J 1EZVY 4UFMA 5A1AA 1EHLL 1FYTD 3MS8A 2NY2C 4JGUA 1JGLL 5D6DC 5D5MA 1I9EA 2EE6A 1E4XH 3BYTA 3GI8L 1T7VA 1QFUL 2A73A 2YDSA 3PABA 3RQ3A 2DQCL 4CDGC 2Z93B 3PABB 1D6VL 4LNVA 4OJYA 1O7SA 5IIEA 2EDWA 3ORJA 5JPMA 5J9PA 4MDJB 1HJSA 1MI5D 3VXSB 4YHIB 1LDPL 1HHHB 4S1SL 3VXSA 1LO2H 5GGTL 5SWSB 3N1MC 2KQMA 5ETUA 5F7DB 2DQUL 4JM2B 2HKFH 4JKLA 1OB0A 5JW5B 2OYMA 2GITA 3ME0A 1RZ8A 4XVJL 1OP3H 4HFWA 5IMOB 3HFMH 5I17B 4MSWB 4QRRB 1MUJA 1C16A 5E8NA 4QLRA 4D6EA 1CG9B 4YDIL 3OKLA 5HVGB 1WVZA 3HS0B 2FWOB 3MGTB 1XF5A 3WY1A 3IDXH 3C5ZD 3KWWA 3RVVC 4AMCA 1QBAA 4J3SA 3IJ9A 5JW4M 4JRXE 1VPOH 1E6QM 3DX6B 1C5DA 2ZCLH 3GBML 4GG6B 3DX6A 3V7AE 4LCWD 5EORL 3RGVB 5IUSA 1KBGL 4NNXB 3VXMA 3FQNB 4FFYH 3S4SB 2Q7NA 1ORSA 4WSJA 3VRLE 2NY5C 1FFOA 2HTLD 3SE3C 4HGKC 3SGEI 1FFOB 2EDNA 3SE4A 5I1LA 3UTSD 4U7SA 4HK0A 4M5YL 1TMQA 1BAFH 1UKTA 4HUNB 5ADOL 4DEPB 5CGTA 3LVEA 5TDPA 3MGOB 1ACYL 1IM9D 2BXYA 4R9HA 3PWLB 4X6BA 1IT0A 4ACZA 3CVIL 1TZIA 4M1GH 5IFPA 3ULSB 5DJ0B 3PZGA 3V6ZA 4GMTH 1A7QH 5BVJA 1NCDL 4PFEA 4D1IA 1YECH 3OXRB 1JGEA 5ACZB 1JGUL 3KYKH 3LKPA 3IKCA 4FZEH 2DQHH 3D0LA 4YHZL 4UDTB 3MJ7A 4D3CL 1QSFD 5EMYA 4TSAL 1J1PH 2ZPKH 3PZNA 2XN9D 3OF6D 3QCTL 4M93C 3DHPA 1FLTX 5IT2H 3MRQB 1QSEE 3LMYA 1KXQE 2WBWB 3TBTB 1WICA 2KH2B 1QSFE 3MV7A 5DVLA 4PS4H 4I0CC 3RMEA 5J4MA 5F9JB 5I77A 3VGGA 2YD5A 3MRMB 4GQPH 1TNMA 4Y1AD 4QRSA 3S6CA 3GM0A 2DEPA 3DTXB 4JPKL 4NRZB 5DEFA 3GJFK 4YDIH 4IOFC 5CD5C 4MJID 1CENA 1JNDA 3EDFA 1UWTA 3W11D 3VXUE 2DSUA 4Z7VF 1X5FA 4NC1C 3CZFB 1DUZB 2J78A 2EEXA 1A1MB 1MHPL 2W9EH 4YEFA 1O7VA 3SDDD 4KRMB 2BOCA 3ARGB 5DJDA 3R1GH 2I26N 3VIMA 1IBGH 3VD9A 2VCAA 3H9SB 4AZ5A 1EO8L 4WUUE 2GSJA 3MV8B 4NQDD 1QFWH 2VR9A 1S5HB 1PG7X 3DXAE 3ES6B 4NYLA 3WNMA 1FL5B 2R2BB 5ENWB 5HYSA 2QADC 5C8BB 4PP2B 4Y0GA 4W85A 2V17H 5HYSB 1MFCL 3OJ2C 1KR1A 1UYWL 4F58L 5HBFA 4QNPE 3O2DA 3OKKA 4PG9A 1I9IL 3U4BH 5EBWA 3BDYL 4TUOA 4DGIL 4O2CA 3BI9X 5BV7L 5LGKA 1L0YA 3Q6GH 4O2CB 5F7WC 5FYJD 5EU6E 3MO4A 5J06A 1LK2B 2YL8A 1KN2L 3MRCA 3LSOB 4FXGB 3UXFA 4H8HA 1FH5H 1Q9OB 3U83A 4LFHD 1MY7A 2ICEB 1RQ5A 2FDMA 4LCCB 2UUDH 4M43H 4AYSA 4OZHA 4XCFL 5F1IB 5GRJH 2WINB 5C0JB 1R3LA 2DOCA 4ELMF 1UZ6E 1LVEA 1R5IA 3AXLA 3BAIA 4PRHB 4K7PL 4GPNA 2BP3A 1V7NL 2B1HH 3AGVA 4RRPG 4KQ4H 1N0LA 1XF3B 2NY4D 1UB6B 3EYUL 4EBQL 3KLHD 1BBDH 1W1VA 4JDVB 1WFUA 2ESCA 3DARA 3BPNB 2WBJD 1YNLH 5SX5H 1JPSH 2AEQL 4GOSA 3PP4H 4LCUB 1A3LL 1ZTXL 4NZTH 3QIBA 1I1XA 3KXFB 1FV1A 5H94B 1V02E 5HDBF 2FO4A 4Y4KA 3KPLB 3RM9A 4GW1A 4P2OC 1NL0L 5F8RC 4AYFA 4OD3H 4LLMA 5E2WH 4RBPH 1PY4A 4OB5H 1OTSD 2WC4A 3GXDA 4JR9L 5HBBA 4OM0H 2CUHA 4F9LC 2XKNB 2IFGA 4OSUL 3MLUH 4U2ZA 3C5ZA 3RUGF 3V0AC 5LBSL 3BPCA 4AXNA 1FYHB 3L95A 1RJCA 5IB5A 3NFNA 5D72L 4H88L 1X5JA 1WBYB 5CZKA 1W72H 5FFLA 2ADGB 3P9MB 4W88A 3WNOA 3D3VD 3KYMA 5JA8B 1XGZA 3MUIA 4DFHA 4APQB 4NO0A 5FYJH 1CDCA 4AZIA 1D5XA 1I8KB 1QYGH 1JWSB 2C8NA 1K6QH 1A6UL 3W4RA 2FECI 3OJMB 1FNEB 3N0PB 3RUGE 4QO1A 4JHZA 1IGML 3TJHC 1VERA 4WSKA 3QIUC 4LAQL 5DD0L 2BNRA 5A3HA 4ZODA 3HNVH 1BQUA 2UVFA 4M6NH 4LBEA 1XGTA 1KBBA 1S7RB 1G0XA 1NCBH 3GSNB 1TVBB 3Q1SL 3KYOB 5IJVA 1A4JA 2YRZA 4JFFD 1S7WB 2F5BL 2NZ9D 4KAQH 2VX4A 2DT1A 5LKNA 5CEXA 1SY6H 4G80B 3WIHL 1N3NA 3PQYB 1HSAB 3HC4L 2JF6A 2R39A 1DBKL 1HH9A 1DQLL 1UCBL 3IFOB 4M6NL 4C7FA 3VWKD 5JBFA 3IFOA 1OGSA 2IH3B 5JR1L 3SKJH 1RK1B 5D5MB 5BMFH 4PJFB 1FCCA 4LSUH 2DDXA 1C7SA 2Y06H 4MHHI 4Q74A 2EDRA 1IAIH 1V6XA 3BH4A 1CGUA 4HIIA 4KC3B 5I18H 3HMWH 1OARH 4C83A 2NSXA 4HIIB 4OLYH 3EMCA 1RUML 3GKWH 4MB1A 1FVCA 1PX3A 1H0IA 2DLFL 4WY7L 4UT6H 1VSCA 5ERWA 1KJ2A 4M81A 3GSWA 2CBIA 5SWSA 1RURL 2OZ4L 3N50A 4N0YL 4OD1L 4FTVB 3WNPA 2R2CA 2VZOA 5IW6B 4F9JA 2JKXA 1DBJH 4MAYD 1YN7B 2AQ3A 2V5SA 3U0TB 4APQC 2I25N 1A8JH 1L7IH 2YMXL 5B8CB 4CN4A 1RH9A 1BWWA 1ZL1A 1U36A 1JYWA 4QY8B 1YEGL 3I3DA 4Y5YA 1IKFL 3NIYA 3O2DH 1H15B 2CRZA 2M8XA 3LKSA 3D39E 3MRJB 3PP4L 5DRZA 4JFWA 4NBZB 2WAHA 2W60A 4KK8D 3CAFA 3SQOL 1JYNA 5ITFB 4OUUA 4XB8A 1UM5L 1OP5H 1KIPB 4OJFH 1T83C 2DL9A 15C8H 2UYLA 2ESVA 1RZIB 2F54A 4JHAL 1T0NA 4JLRA 4MWFA 2UYLB 2OYLA 4PMXA 4P7QA 1MCWW 2YD3A 5EU7C 5BRZA 1F00I 1R5VB 3CFKA 2N7AA 4UOW1 3I6GB 3PWPB 4UV7H 1IM3B 3PWPA 1HVXA 1CDIA 3ZO9A 1A9EA 1FLRH 4U6TA 5FO8A 2VDNL 4XMKH 4HPYL 4NQVB 2ILLA 1ISWA 1MIMH 4Z0BH 4QOKE 3LDBB 4PJ8B 4M02A 3SKJL 4JRWA 1V6WA 1XF2A 4KJYA 2GK1B 1GRWA 1J1XL 3B4NA 5DHVA 2Q87A 2Z31D 2EXOA 4UMGA 1MCPH 3A0OA 3LZFH 4QOKD 1DBMH 3UBXG 3WIIL 5CMAA 2Q7YA 2OLHA 1GORA 2F53E 2E7BA 1K8DB 2BVOB 1MEXL 4UT6L 4OF8A 3MBXL 3TVMC 1BZQK 1L8NA 4NN6B 1JFQH 4U1IB 1YEIH 1HI6A 4N68A 3OMZA 3SGDI 2J2ZA 3O6FB 3QH3B 3DV4B 1YN6A 4J1UA 1EAPA 3U2SB 5CKAA 1IAMA 1GHFH 4AY0A 4OGYL 3WNLA 1J5OH 3QEQB 4Z2IA 2FBJH 2EC8A 3QJHB 3NACL 4M5ZH 1XMWA 3SJVA 4NM8L 2J8OA 2ZSWA 43CAB 4X8JA 2VB5A 4NCC1 4FQIL 2CJUL 4XBEL 2PW1B 3G6AB 1SJXA 3UJJH 1OGAA 1HINL 5D72H 3L3JA 2BOCB 2XY1A 3ARGC 5F3HA 1KG0B 5FIPA 3O4LB 3BESR 1FO0H 2PO6B 3VA2C 3WF4A 4XPTL 3RWIB 2J6EH 3VILA 4LLYA 2XY2A 3RP1A 4M9PA 4RCAA 5I8OH 4LLYB 2RQ8A 5EIIA 5E8PB 1ZHNB 2GEEA 5LAXA 1EEZA 5DJ8A 3O2LA 5CCKL 5D9PA 5A8QA 3SDDA 1DZBA 1OVZA 3S35X 2QLVB 1W9DM 1MCIA 3SGEH 4L9DA 3L2LA 3KNBB 4D9LL 1I3GH 1FVEB 2ZCKL 2PW2B 1H8NA 4PMQA 3KPPB 1ODUA 4M48L 3ARRA 3VWJA 4M7KL 1B2WL 5LYRA 4NNPH 1GC1H 5DJZB 2DTML 3HG1D 1RJLB 4PJ7B 5CJ8A <