3U5UA

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
501
structure length
470
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Raucaffricine-O-beta-D-glucosidase
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 178
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u5uA00
4KH2A 5A8OA 3OBAA 2GUYA 1GZJA 1VF8A 4PTWA 4CD6A 2VI0A 4ATLA 2D0FA 2XVPA 3WD2A 1Y7VA 2D1ZA 3NUKA 4LYPA 1HJSA 1CECA 1GOIA 5ABGA 2Z1SA 4AEFA 5A95A 1UOKA 2B31A 5CJ5A 4FLSA 2E9MA 3VNYA 3VGFA 1CGVA 4NRSA 1ITCA 3N18A 4PMXA 1KQZA 4UFKA 2CITA 4E2OA 3VD5A 4X9YA 5E09A 3D3AA 5JBFA 1B3XA 3AI0A 2YDQA 2VX4A 4L4PA 5CPSA 1JZ2A 3WNKA 3AQUA 3DHUA 3CZ8A 3OA5A 4P8WA 1DWGM 5HBFA 3FXYA 2BY0A 1ISYA 1BLIA 1GOWA 1XRVA 3D5HA 3AMDA 2YLLA 3WF1A 4BQ5A 2VRQA 1J0YA 5AYBA 4HOXA 3GTNA 2WBGA 4UQEA 2OSWA 4IPNB 4HA1A 4D6FA 1E5NA 5D9PA 5D8ZA 2ZE0A 4TOQA 1J9YA 1G5AA 5GQBA 1BF2A 1R7OA 4GI8A 3GH7A 2OYMA 1FHLA 1UYQA 4U31A 2ZX5A 2XFFA 1UH2A 2YDSA 4P8UA 4WF7A 2A3CA 3M07A 3T2QA 3SCOA 1LL7A 2WMIA 3WFLA 3VIHA 1HL8A 4W5UA 3VGDA 2Z1KA 3BAXA 2UY5A 4M29A 5KEZA 3VX0A 2BVDA 1V6WA 1YHTA 1S46A 1L8NA 1CIUA 5IXEA 4TTGA 3W38A 4V28A 3UR8A 3MSDA 1XHGA 3AZRA 1UH4A 1CGWA 3VTRA 5DFAA 2F8QA 2X1IA 4H2CA 2AOSA 3ARTA 4PTVA 2J8GA 4V2XA 1UD6A 4QLKA 4R27A 3KL5A 3UG5A 2F61A 2G3IA 3L4TA 1Z32X 3L4ZA 1LLOA 1JYXA 2G3NA 3SCSA 3FY1A 5A69A 5BRPA 3HU7A 4Z2IA 3WDPP 4C7GA 2HISA 1E9LA 4OOUA 3U7BA 5CXPA 1HKJA 2VCCA 4MAZA 1P6WA 3TTOA 1JF6A 3DYMA 1BYCA 4OOZA 2C8NA 4Z2JA 2J4GA 3T2OA 4ZENA 1CGXA 3GH4A 4PMNA 2J7CA 1NWSA 3SCUA 3ZIZA 1HVXA 4FLOA 2IXVA 2XM1A 1E4LA 4ML4A 1CXLA 4LGXA 2BXYA 4PMZA 4PTXA 2EPNA 3CMJA 3PBGA 2EO7A 2WMGA 3UESA 5EMYA 2GJXB 3BLKA 1KQYA 1UR4A 4JFTA 1J12A 2WK2A 4Q22A 1VEOA 5IFTA 4FLQA 4WSJA 3PTKA 2XSAA 4U5IA 1UR2A 3AMGA 1HNYA 4X0NA 4DUWA 1UD8A 4NZCA 3GBEA 1HJXA 1JZ5A 3FW6A 4XUYA 4OJYA 1IT0A 3BAJA 4CU6A 2FGZA 1OGGA 3AMCA 3RMEA 1SR0A 2XVGA 1QNQA 5HDRA 1J0JA 2GDUA 1C7SA 1J10A 1V03A 2PWHA 5E9AA 4HP5A 2G3MA 4H8VA 2AMGA 1KWGA 3FN9A 1PPIA 3LPFA 3TTYA 3N9KA 2D3LA 3VD7A 3THDA 1HJUA 5A6BD 5A1AA 2X2YA 2YJQA 2XUCA 3OGVA 1W2PA 2BV9A 5LYRA 4GINA 4PN2A 5AYIA 1MW0A 3TONA 3FNDA 5DT5A 4FLRA 1WCGA 3WNNA 5A3HA 1HXJA 1QI2A 2WCSA 3W0KA 5I23A 4UR9A 1XV8A 4FF5A 3WH5A 1JNEA 2W92A 2X0YA 3HJEA 4QLLA 3NSXA 1UA7A 1KBBA 4JCMA 4JKMA 1DTUA 4EKJA 4YHEA 3ALFA 3DECA 4ZE5A 1OINA 4HZ6A 3LPGA 4W88A 2VZSA 2Y4SA 1DHKA 1BG4A 2EEXA 3U5UA 4D6JA 3KZSA 1VFFA 4W93A 1JZ3A 2D20A 1JNDA 2ESCA 3WDIA 1OIFA 1E3XA 3N17A 3K8MA 2VCBA 3L4VA 5ABHA 4PRWA 5BXTA 4UFLA 1KR1A 1I75A 2J75A 3WNMA 1FH9A 2CBJA 4JFSA 3A6OA 1H0IA 1J0IA 3WBAA 3PZ9A 2WMIB 2GJPA 2O9PA 1F4HA 2CBUA 4RE4A 2V5DA 2WCAA 2BFGA 5FL0A 2V5CA 1W9PA 1G1YA 1H09A 4WSKA 4QFUA 3WNPA 4KWUA 1GVIA 2WYSA 1E72M 1E6PA 1E15A 3LPOA 3AIBA 3AHZA 1GJUA 1Q6CA 3BMWA 4HMCA 4W85A 2XIBA 4B3LA 2J77A 1EXPA 1QBBA 4MB1A 1MWOA 3NIYA 1LL4A 4AMCA 2YA1A 2CERA 3IAPA 2WMJA 5BXRA 1GOOA 3GZAA 2W5FA 2WLYA 1EO5A 1E4NA 1ZBWA 5DO8A 2YL9A 1QI5A 2BS9A 1E0WA 4H04A 1HJWA 3ARZA 4UQ9A 3WMSA 1JD9A 1UKSA 2FHCA 1LWJA 1GNXA 1J11A 3HN3A 3WL0A 1JFHA 2Y24A 4M24A 1B31A 1JZ6A 4J3UA 2VC9A 2DPEA 4AY1A 4DM1A 1E56A 1EA9C 4CU8A 2W67A 3AJ7A 4OKDA 3WEOA 3W6LA 3UG3A 3CZKA 2VR4A 2ZUWA 3ZSSA 2W4XA 1NP0A 2XGBA 3N11A 3A4XA 3PZOA 2D22A 1V6YA 3MMDA 2BNJA 4CD5A 4UQDA 1UR9A 4W84A 3WF0A 4U2ZA 1QNSA 3VM5A 1PAMA 2DT3A 4S3JA 1K6AA 2J25A 3DYOA 4GI9A 3AIUA 3VINA 2J7BA 3MMWA 1JI2A 2X05A 1LL6A 4L4OA 2XVLA 3GYCA 4QDMA 3I3BA 1C93A 1CBGA 5HPOA 3NCOA 1WPCA 1AVAA 4MADA 3VD9A 2GK1A 1CLXA 3WUBA 1EQCA 2E8ZA 1W9UA 5C71A 4NF7A 2PB1A 5A8MA 1Q6EA 2ZUVA 5I78A 1UKOA 3AZTA 5JIWA 1WB0A 2D23A 4AIUA 6CGTA 5D8WA 1B3YA 3MUZ1 3SCQA 3VNZA 5JBDA 4WKHA 4GI6A 5DF0A 1BPLB 5TD4A 2BXZA 3JUGA 1TCMA 2FH6A 2OSYA 2DSKA 4JL2A 4BQ2A 2ZX6A 4J7RA 2CETA 6A3HA 5E70A 3W26A 2CEQA 4CCCA 3WUFA 5BXPA 1BVNP 4WJXA 2VMFA 1W3HA 4GZJA 5IFPA 4W5ZA 1E0XA 3VGEA 5BYWA 2QLYA 4DUXA 1UWQA 1UWIA 2WMKA 5E0CA 1KXQA 2XSBA 2VUYA 4LYRA 4YHGA 1HP4A 1MYRA 1G9HA 2EPOA 2TAAA 3N1AA 2FHFA 4Q7NA 3MANA 4ATWA 1W9XA 1V0LA 3RCNA 3WDQA 3ARXA 2A3AA 1VRXA 3NDYA 5A8PA 1KR0A 3VGHA 5GNZA 2J62A 3PTMA 3VD3A 4GXPA 2WZIA 1H2JA 3AS2A 4A3HA 4KMQA 2J74A 2GFTA 4P7LA 1UKQA 5CG0A 4EK7A 4HA3A 4UQAA 3CHFA 4CKQA 2OYKA 3WENA 1WZAA 2JIWA 1AQ0A 3CZGA 4IPLA 2WHLA 3GXIA 1G01A 4CVWA 4WK9A 1E43A 1M03A 1OIMA 4D72A 1HJQA 4M82A 3ZQ9A 3CBWA 3W24A 1CENA 1X6NA 5CSUA 1DWIM 1V3KA 1VFUA 3BLPX 4J3XA 1GORA 1GOMA 4P7OA 1ZBVA 3WQ6A 1WDSA 5CQ1A 4HMDA 1ECEA 1JAKA 3VM7A 1W1YA 1OGSA 1HP5A 4HU8A 7A3HA 1EQPA 3WL1A 3L4WA 3RO8A 1ZL1A 3PHAA 2EPKX 4AYSA 1VFOA 3ZJKA 1X1NA 1BGGA 1UZ4A 1NQ6A 1ISXA 2VQUA 1UWTA 2YDRA 3QOMA 3OB8A 4AD5A 3F5JA 3RM4A 3WF2A 1ISZA 1US3A 3WSUA 3L4YA 4CN4A 1XCWA 1CXIA 3VX1A 3FHQA 4OIFA 3K4DA 3SUTA 3RPMA 5BROA 3WBEA 2WSPA 3S2CA 2CHNA 2Q8XA 4PMOA 1B3WA 2BHYA 4M56A 1OT1A 4GQRA 3L2LA 5A6KA 1UD4A 4P8XA 3QGVA 4P7NA 1BG9A 1CXKA 2WZHA 1JIBA 1I1WA 4MAVA 1BYBA 2WVUA 1CLVA 1EOKA 1B2YA 1M53A 1R8LA 2YL5A 3BC9A 2GDVA 4BZYA 1NWUA 1UQYA 1UR0A 2NW0A 3W25A 4M1RA 1CEOA 4JHZA 4J3WA 3UEQA 2WBKA 4YPJA 4UQBA 4Z2GA 2JIEA 3VOCA 2GK1B 1E40A 1V02E 3VIIA 4W8LA 1OGBA 5D4YA 1W32A 1OCQA 1E6RA 3PZNA 3IAQA 1E0VA 1JL8A 5A6JA 3GXMA 3A47A 3EYPA 4M80A 4MNMA 1HF6A 3I3DA 2WM0A 2ZICA 2CESA 2J7DA 4FK9A 1N82A 4AW7A 4MB5A 1FP9A 5AY7A 1VJZA 3O9NA 4U5KA 4BQ3A 1LF1A 3ZJ7A 2X8RA 4W86A 3T09A 1B3VA 1LJYA 2OWWA 1GOQA 3BAWA 3SUVA 2G3JA 2WC4A 5A8NA 3PZUA 3EDFA 1KGUA 2XTKA 1UWUA 1W1TA 4Y7EA 3CUGA 3T08A 3ZR5A 3O6AA 1M7XA 5FIPA 3WD0A 4AZIA 4ZFMA 4EAMA 1WKYA 3WDJA 3L4UA 2CNCA 3ARYA 3A3HA 2V3DA 2WVVB 4PSRA 3WELA 2PI6A 5HPCA 2NT0A 2W62A 1H11A 2VURA 3ZT7A 3NJ3A 1TA3A 3VDHA 1VIWA 4B3KA 4HOWA 3AMLA 1I1XA 2XIIA 2BY2A 2CKRA 3CH9A 5EFFA 2JFEX 3IJ7A 3LMYA 3ZR6A 3T0DA 3BH4A 4N42A 2XPKA 1UKTA 1C8YA 3BMVA 4AISA 4MJ4A 4BS0A 2EPLX 3L4XA 1HX0A 3NSMA 3PTQA 1QW9A 1CWYA 1GJWA 2XWEA 4A3YA 1DWJM 3VDAA 1B90A 1HKMA 3EBVA 5CLTA 1EGZA 3K46A 3PZIA 3W37A 3WQ4A 4CD7A 1BVZA 1FHDA 3QHNA 3VIKA 5AC5A 3SCVA 4E4PA 3ZT6A 3AXHA 1C92A 5A8QA 5AC4A 3VUPA 3OGSA 3VIOA 3AIEA 1B1YA 1UA3A 4W7VA 1JYVA 4MPKA 1G0CA 2ZXDA 1H0GA 4WKFA 1E71M 4D6EA 5A2BA 4AEEA 2YKKA 2DT1A 3POHA 5BXSA 2XVKA 3OLIA 1MW1A 2DH2A 1JXKA 2FGLA 2VRKA 1W3KA 2ZXAA 1C90A 1NOFA 5D9NA 1OD0A 3OIHA 1EO7A 4J3VA 1AQHA 2XJ7A 2JF6A 5C8BB 2WWCA 1VJSA 2E0PA 3J7HA 4N0RA 2YL8A 4JZ5A 1V0KA 1KFWA 2V3FA 2VL4A 4TTUA 1BTCA 1SMAA 3K8KA 5BCAA 1UH3A 2C7FA 1ITXA 2ZUUA 2D2OA 4NSBA 3IJ8A 4CD8A 1NWRA 4J27A 1JDAA 3GH5A 1OT2A 1ZB5A 1JI1A 4M8UA 4MJ2A 1LG1A 1HIZA 4GKLA 4MDOA 5I0DA 5FKYA 4J28A 1O7AA 4TVCA 1W9DM 3G6MA 1KXHA 1HKKA 4OBSA 4JFWA 4W8BA 4PUEA 5BWFA 3AFBA 4LX4A 2FH8A 1E70M 1NOWA 1QBAA 3VIFA 4TVDA 3RJXA 1XYFA 1D2KA 4WIWA 1H3GA 3EDEA 4TX6A 3WUEA 5FD0A 1B9ZA 5M17A 1Q6FA 3EDKA 4JFVA 4F79A 1BSIA 4URIA 4CVUA 4FMVA 3VIGA 1WDPA 2G41A 1ZBKA 3PZGA 1E6ZA 4QP0A 1JZ4A 3BCDA 4J3TA 1DWHM 3FAWA 4QAWA 1LQ0A 5I77A 5ECUA 2QPUA 4D1JA 3VDBA 3MSGA 3WUGA 1DEDA 4Z2KA 4PMUA 1PBGA 1O6IA 2WXDM 5ABEA 2NT1A 1C3FA 3O2LA 5HNNA 1UHVA 4MNJA 4AIOA 4GZIA 5EBAA 8A3HA 1ISWA 2XGIA 2CBVA 1MQQA 4PMDA 1WZMA 2VVSA 4DWSA 1ZJBA 2DH3A 2IXUA 2DT0A 4BF7A 1K9EA 1XYZA 4NI3A 2VZOA 1JGIA 3VGBA 3AHYA 1RP9A 3BXWA 4HZ8A 4AZCA 1FH8A 1E73M 3LPPA 1NM9A 3VO0A 4LXFA 5A6LA 1U2YA 1J0ZA 1V0MA 1R7AA 1LWHA 4KRUA 2FDMA 1TA3B 3FAXA 2WVSA 4PCSA 4UZSA 1DP0A 3F5KA 4HTYA 2Y2WA 1QI0A 5E6ZA 3OLGA 4AWEA 1K9FA 2NSXA 3N15A 1CYGA 1CDGA 2QF8A 1CTNA 4LYQA 3BAYA 2WC7A 1JG9A 2VOTA 5CPQA 1UUQA 1WDQA 4TVUA 4HZ7A 4HU0A 1PX4A 1ZBCA 3AYRA 4MB3A 4XZBA 1R87A 3ZMRA 1XH0A 2VTFA 3T2PA 3CZJA 3WEMA 3RM9A 2EBNA 5IHRA 4AZ7A 2RGLA 4PMYA 4AD0A 3T0BA 1GCYA 1VBRA 4U33A 1XSJA 1W1VA 2X0HA 4ATDA 3UETA 4NRRA 4OBRA 7CGTA 2VT0A 4MDPA 4GIAA 2G8ZA 2VZVA 4W8AA 5LA1A 2CIPA 4ZXLA 1JFXA 1UD5A 4GO9A 1W1PA 3RDKA 5DT7A 2YL6A 2PBOA 2ZX9A 1EOMA 3VD4A 1B0IA 4OZOA 4W7WA 1BQCA 1CGUA 1KB3A 1OBAA 2E9BA 1IZJA 4UFHA 4HPHA 5A2CA 3CZEA 4E8DA 4ACZA 1KCLA 2XFRA 3AXXA 3UR7A 4ACYA 4CN1A 2E9LA 1V6VA 1KXVA 1TMQA 1EIBA 1V3JA 4CGTA 3W53A 4KGJA 4KRTA 1E4MM 2QV4A 1CNVA 1TE1A 4D6HA 2WLZA 3SCWA 2XM2A 1VB9A 5IHSA 2WWDA 4CD4A 4W87A 3AICA 3ARPA 2BVTA 1C7TA 3WD3A 4D71A 4WLCA 4P7RA 4EE9A 5HOSA 3CIVA 1MVYA 1MW3A 4YN5A 3MV11 4QLJA 2IUZA 1WE5A 3B8SA 3WMCA 4E8CA 2WPGA 2WVVA 1KGWA 4CCDA 4B16A 3KWXA 1JD7A 3WDHA 5I2UA 1RPKA 3VMPA 2ZUMA 1EDGA 2DDXA 1NWTA 2DSUA 4BCEA 1E6SM 1V3HA 4LPCA 1L0PA 1GOKA 1PEZA 1TVNA 1V3LA 3AIRA 3VIMA 3WEZA 3SUWA 4BQ4A 1J0KA 3AMKA 3ARWA 1AQMA 2JALA 2UY4A 3WH9A 3WMBA 3CUHA 2QMJA 2BVYA 1UD2A 2OLHA 2G4FA 4AZBA 3F5LA 4EANA 2VCAA 2WANA 1UQZA 2DIEA 3AIVA 1WAWA 4PYSA 3BCFA 4IUGA 4B9YA 5FCZA 3A4WA 4GQQA 4XX6A 4MNKA 3TOPA 5I6SA 3WNLA 3K4AA 5GPRA 1ESWA 1RD6A 3E1F1 2WB5A 1ODZA 1BHGA 1UG6A 3ZT5A 1EHNA 3OG2A 2J7HA 3T0AA 2VQTA 3WQWA 2D0HA 4D6CA 4DWSB 5GNYA 1XC6A 1H1NA 2CYGA 3WH6A 1QNPA 4JKKA 4AZCB 2VVNA 4H7VA 2BY3A 3WF4A 2ZIDA 5CZKA 2DIJA 3VVGA 3WQ8A 3BAIA 5ABFA 1CZ1A 1GHSA 1CGTA 1M01A 3AZSA 5GNXA 1W9BM 3SCRA 2A3BA 1C8XA 5KZ6A 3RJYA 2W91A 4AD3A 1H4PA 3UERA 4B15A 4D6GA 1GVYA 1VENA 3VU2A 1W9VA 2F2HA 2QPSA 1W3JA 3CHDA 3VILA 1OD8A 1QVBA 4C7FA 3CZLA 4AD2A 5A6BA 1TG7A 1US2A 2ZX8A 2D24A 3SURA 4CN6A 1BYAA 1CGYA 2ZOXA 3U57A 1ZJAA 5CPTA 5D9OA 4AD1A 3QHMA 1PIFA 1E4IA 2XFYA 3GBDA 1ODUA 1JDCA 4IISA 3BGAA 1B30A 2WHKA 3ZOAA 2PWGA 1J01A 1IZKA 1QI3A 4UTFA 2VX6A 1KCKA 1QOXA 2OYLA 3AXIA 2XG9A 4PBGA 1VEMA 3KEHA 1EH9A 3RM8A 4UFJA 1XGZA 2AAAA 2ZXBA 1V3MA 2O92A 1XD0A 3DC0A 4ACZB 1V0NA 2XYLA 2W61A 1SYTA 3SCTA 3MUAA 1GQIA 2J47A 5JBEA 2V38A 3OLDA 2X09A 3CGTA 3CPUA 4PSPA 4TXEA 1OB0A 1K9TA 5A94A 1WP6A 4MNLA 1A47A 3AS1A 1QNOA 5CGMA 1QHZA 3GNOA 2ZUSA 4CCEA 1NH6A 3WDRA 5A6AA 4PEEA 1XCXA 2GVYA 2W66A 3F4VA 2V3GA 2VZUA 2WW5A 5E0FA 3RIKA 1E1EA 3KL3A 1RH9A 4AIEA 1FOBA 4UQCA 1DWAM 3TA9A 4CUCA 3G6LA 2A3HA 4H8UA 1GHRA 3ZJ6A 3EDJA 2RGMA 4JAWA 4Z2LA 4ZE4A 4V27A 2E3ZA 2WZEA 2DQXA 3EMZA 1QHOA 1GQKA 2BHZA 2Y8VA 1OSEA 1C8QA 1KBKA 1UWRA 2YLAA 3WF3A 3AHXA 3BAKA 4AZ6A 2PWEA 2WC3A 1B3ZA 4UOJA 4HMEA 4UFMA 3CTTA 1FP8A 3ZSTA 1JZ8A 5M5DA 3AYSA 1WO2A 3CLWA 4PUDA 2J78A 2UY2A 1V6XA 3WFZA 2WMHA 1OM0A 1HT6A 5A6MA 1JYWA 2ZX7A 1U33A 5E6YA 3SUSA 2FHBA 1TVPA 1CXHA 1E3ZA 3W81A 3K8LA 3WY1A 1Q6GA 5DMYA 2XWDA 3TTSA 3ZM8A 3VPLA 3CHEA 1HL9A 3WN6A 2VR5A 2DSWA 1H49A 1E6QM 1OWQA 3BSHA 4UFIA 3B9AA 2DT2A 1NOUA 1PZ2A 3MUY1 1QHPA 2WHJA 1FFRA 4P7QA 4D6DA 1BGAA 2VO5A 4W89A 4GPNA 5EFDA 1V08A 1JZ7A 5I3DA 1BYDA 3MUIA 5IDIA 3SIMA 4MB4A 5ABFB 1J18A 3CO4A 2PF0A 2GJRA 2BY1A 2XHYA 1W3LA 2A3EA 2JEQA 3WH8A 1QI4A 5A2AA 4CU7A 1U30A 1XH1A 1W2VA 1KWKA 4PTMA 3W6MA 4H41A 4W7UA 3RILA 3OGRA 5CLWA 4AZHA 4P8VA 3QHOA 3WQVA 1UD3A 1JYNA 3B9EA 3ARVA 2ZXQA 3NDZA 5A6SA 4DM2A 3M7SA 1J0HA 1WNOA 4F8XA 5JIPA 3ZJ8A 4PMRA 3APGA 3VIJA 1HN1A 5FL1A 1ISVA 1IV8A 3SUUA 5FOOA 2DEPA 4GO8A 3HMCA 1MW2A 3S6TA 1ZS2A 4AZ5A 2BHUA 1BAGA 2O9RA 1E5JA 4AC1X 1MFVA 3ALGA 2YBUA 4AZGA 3WD1A 1KXTA 4HA4A 1GONA 1W91A 2D3NA 3BSGA 3VKKA 8CGTA 5I24A 1GW1A 2EQDA 3UCQA 3WQ5A 4X0VA 1Q6DA 2JEPA 6TAAA 1YQ2A 4UCFA 2PWFA 1NARA 3AIWA 3SEPA 4JIEA 3POCA 2D0GA 2UY3A 4HOZA 9CGTA 3QR3A 3VMOA 3VDCA 1F4AA 3ZO9A 3NYDA 4D6IA 3AOFA 2VX7A 3GNPA 3CUJA 2XVNA 2J7EA 2ZWYA 5CSYA 2ZUTA 3FHAA 2WVTA 2DGAA 3OLEA 1M04A 1RP8A 2YOCA 4PMQA 3W29A 3OZOA 3DHPA 3EMCA 1MXDA 4F9DA 2EXOA 5BRQA 2VJXA 7TAAA 3GXFA 2VNCA 4R5EA 5I79A 4ZEPA 1E6NA 3M46A 1TUXA 1V3IA 4K68A 2JF7A 3OZPA 1MQRA 4H8HA 1UR8A 1TZ7A 5EB8A 1A3HA 5M03A 1WZKA 1PIGA 2PC8A 1G94A 4U3CA 2J7GA 3W27A 1JAEA 3MV01 4U3AA 4F9JA 2WKLA 4XZWA 4UOQA 1R86A 3EDDA 2WAGA 1QNRA 2W63A 1TFVA 3K1DA 3SCPA 2J8FA 1R85A 4J3SA 3WKZA 1VFMA 5LA2A 2OWCA 3VMNA 3AS0A 3MU7A 4UZUA 1E1FA 1GPFA 2YA0A 5I5RA 1K9DA 1Q4NX 1PX8A 2WKGA 2WSKA 3N13A 3CHCA 1BFNA 3II1A 3IK2A 4DUVA 3GXDA 1TR1A 1MXGA 1EDQA 1FFQA 5HXMA 1VAHA 5F7UA 1FA2A 4TUFA 1GUVA 3MS8A 3MKKA 2CBIA 4LQ1A 1HJVA 4BA0A 1LG2A 5M3WA 4PCTA 3U7VA 2EPMX 2MANA 1KGXA 2DSVA 4UOZA 1H41A 3KL0A 2Y5EA 3IANA 3AROA 1WDRA 1EHAA 4WKAA 2J79A 2ZWZA 3QOKA 2WCGA 3KE0A 3ECQA 2O9TA 3WH7A 3PZQA 2CPUA 1VBUA 1V02A 1CXFA 2C0HA 4JCLA 3U5YA 3VIPA 3EMQA 3CUIA 2YA2A 3DYPA 3PZMA 3MO4A 2ZUNA 4XB3A 3ARUA 1H5VA 3N12A 5CGTA 3PZVA 3W28A 1E55A 2CCRA 4RL3A 4HPGA 5JUVA 2DSZA 4ZXOA 3N04A 1VEPA 3W82A 3PZTA 4JHOA 4TX8A 3A4AA 1GQJA 2PBGA 4S3KA 4RE3A 1UZ1A 4QCEA 2QHAA 1NP2A 1QW8A 3L2MA 3ARRA 2OSXA 4KGLA 2JE8A 2CKSA 3AHVA 3TTQA 3M6DA 3GNRA 4JL1A 3CUFA 4D1IA 1JXJA 5D9MA 1EDTA 3GDBA 3THCA 2OWXA 3MMUA 4OUEA 4JFUA 4AD4A 1QPKA 1MFUA 3WD4A 1AMYA 1XH2A 2GSJA 2YIHA 3AHTA 2VX5A 4PMVA 3NSNA 4M81A 1CPUA 3VGGA 1WZLA 1DWFM 1CXEA 4JKLA 4Z2HA 1V6UA 3ARQA 4A4AA 5LA0A 1E6XM 1GQLA 3AIQA 1PX3A 4DWSC 2UWFA 3WNOA 4MTVA 3SCNA 1JF5A 1ZU8A 2V3EA 1XSIA 3B9DA 2VZTA 2PWDA 2E40A 1XD1A 3TP4A 4XV0A 3CMGA 5DEZA 1HKIA 4RE2A 4AXNA 3I3EA 1MQPA 4U2YA 2WMFA 4IM4A 3WIJA 4QCFA 4GZEA 1X6LA 2HVMA 2YBTA 2CHOA 2CXGA 4F66A 3UG4A 2Y8KA 2EJ1A 2QMKA 3IJ9A 2O9OA 3PN8A 2GJXA 4DWSD 1XSKA 2J7FA 2WHMA 1SMDA 5C70A 1C91A 1JDDA 3W4RA 1SFSA 2E4TA 1D7FA 1D3CA 1PZ3A 3AISA 3AS3A 3GM8A 1UKPA 4UNIA 1UWSA 4C7DA 2E8YA 2VRJA 4B9ZA 2WNWA 1PJ9A 3ARSA 1UR1A 1HVQA 1FH7A
chains in the Genus database with same CATH superfamily
3UXKA 4CQAA 4KBXA 5CKSA 4C6DA 1TV8A 1IWBA 1VF8A 2VI0A 4GHRA 2VFEA 3WD2A 2VYOA 1Y7VA 3NUKA 4LYPA 1CECA 5ABGA 4AEFA 5A95A 1UOKA 2V30A 4XAZA 5CJ5A 4FLSA 3VNYA 1GTHA 4NRSA 4PMXA 3H2EA 1SJAA 2EAWA 2CITA 1W3IA 3VD5A 4X9YA 3S3GA 3P74A 4KFNA 2XH2A 1XIGA 4MSSA 3GW0A 4POCA 1A5UA 4L4PA 1JZ2A 3AQUA 3DHUA 3CZ8A 3OA5A 2I57A 2QJHA 1BLIA 3L21A 4HCDA 2J88A 4IPNB 1RA0A 4D6FA 3C4UA 3PPCA 1E5NA 1AZ1A 3V5CA 4UTIA 1J9YA 1R5YA 5GQBA 1R7OA 2DJXA 3ABXA 1SFLA 2QUNA 3M16A 2YDSA 4YL2A 3M07A 1XYMA 3T2QA 3AWOA 9XIAA 3C52A 4HQVA 5LIYX 1DQWA 4W5UA 3SB0A 5K9DA 1L6GA 3OYXA 3B0UX 2UY5A 4M29A 5KEZA 1YIXA 4IL0A 5JH2A 3LXCA 3W38A 4V28A 3UR8A 3MSDA 3B4UA 3AZRA 3HFTA 3VTRA 2DIKA 3HGOA 1FUYA 1OVDA 1GK8A 4V2XA 1SGJA 1UD6A 8XIMA 5HNTA 4QLKA 4R27A 1X7FA 3KL5A 4AEOA 2G3IA 3CWOX 4XD3A 4GBDA 3TYEA 4PODA 4C6NA 1RK5A 2XZ7A 4C7GA 5LIWX 2CZ5A 1XLBA 4JIQA 3A9BA 3V3WA 2AGKA 1HKJA 4MAZA 2C8NA 4Z2JA 3CIWA 1YE6A 4A8LA 2J7CA 2IPGA 1J2WA 1J2BA 5HWMA 4FLOA 1IT7A 1TRDA 1M9HA 4ML4A 3KLKA 4PL1A 2BXYA 1REQA 2VGFA 4PTXA 4H7ZA 2GQ8A 4WQ6A 3VOHA 2GJXB 3UPMA 3PWAA 4ZO8A 2RHGA 4NT0A 3DXIA 1IXOA 4JFTA 4US6A 1J12A 2WK2A 5IFTA 4FLQA 3PTKA 2ZC1A 1UCWA 3H26A 4QNEA 2YXXA 1HJXA 3FW6A 4G7EA 1CB2A 1H7PA 4OJYA 2O4MA 5IOBA 3SDOA 3T7VA 2RAGA 3AMCA 2LLEA 5HDRA 1C7SA 3A12A 4RZBA 4HP5A 2G3MA 3REQB 1GJPA 1PPIA 3LPFA 3TTYA 2D3LA 3CC1A 4WDUA 2INZA 1J93A 4FOKA 1QW7A 3RNDA 3ERPA 1R9XA 3E2VA 1AL7A 2B7QA 4GINA 4PN2A 3TONA 4L6DA 1BXCA 2O7SA 1GYNA 3JR2A 5I3GA 3TNBA 2FGBA 2WCSA 1OYAA 3M0VA 3S83A 2QJNA 3W0KA 5I23A 4UR9A 1XV8A 4FF5A 3G0SA 3DFSA 4DJDC 1KBBA 4GQ0A 3NQAA 1DTUA 4MY8A 3RUBL 2E7FA 4ZE5A 1OINA 4HZ6A 7ENLA 4ZB2A 2VZSA 3HOJA 4O11A 1DHKA 2EEXA 4D6JA 1OX4A 1VFFA 1D8CA 2D20A 2I14A 1IQ8A 4C5ZA 3WDIA 4AY7A 1PZ1A 2VCBA 1ZHAA 3L4VA 1EP3A 3GVGA 5ABHA 2NVDA 3RU6A 4LUSB 3R13A 2CZDA 4ERAA 2NX3A 1TV3A 1L2QA 4FSAA 3WBAA 1OC6A 4WSHA 4HA0A 1V93A 1JRBA 2A3LA 2QCDB 4DYEA 4EIVA 3P3BA 1F4HA 1LRQA 1VPXA 4R88A 4YVXA 2BFGA 1D8WA 4LB3A 3UBPC 1KRBC 3WNPA 4KWUA 1GVIA 2C1HA 1GJUA 1Q6CA 4L61A 3GIYA 4HMCA 2XIBA 3O6CA 3WK1A 2VM8A 3JW7A 3CM4A 1EXPA 1SSGA 1MWOA 3NIYA 4B5VA 1LL4A 2G0WA 2YA1A 3N3TA 4DN1A 2CERA 3IAPA 2NVCA 2W5FA 2WLYA 5CBJA 1VR6A 5DO8A 5C9UA 1W1IE 2YL9A 2OLSA 1QI5A 3FJ4A 2NZLA 4L1XA 2C71A 2R94A 3GVVA 3L12A 4S39A 2Z0IA 5DQPA 2QUTA 4JOMA 1JCTA 1UKSA 2GGIA 2FHCA 1GNXA 4KEMA 1J11A 1W1A1 3WZ0E 2Y24A 2IW0A 4GH3A 4DM1A 4H8NA 2NWSA 5I07A 2CHRA 1SVDA 3MKVA 4ZL1A 2W4XA 1NP0A 2A0NA 5AKQA 1V6YA 3MMDA 4W84A 3WF0A 4U2ZA 1QNSA 1CB7B 4X63A 3RLHA 1B4EA 3QZ6A 2NUYA 2J25A 4GJIA 3H12A 2J7BA 2B7PA 4C1NB 1KTNA 3HG3A 3I3BA 1C93A 4ADTA 1CBGA 1WPCA 2C13A 5GJPA 4MADA 1EX5A 5G4HC 1XLDA 2GK1A 1CLXA 2W27A 4KWOA 1OFEA 4O53A 1IWAA 4N9BA 1DPMA 3OODA 2G3FA 3TUUA 3W7MA 4H1ZA 3SN0A 1A5BA 4ZQNA 1XL9A 5A8MA 3SN4A 2ZUVA 4F2BA 4I7UA 1QXLA 3AZTA 3R0KA 4EPBC 2F9RA 3P93A 6CGTA 3MUZ1 2PD5A 1W1B1 3T40A 5DF0A 3G1AA 5T9BG 3MJMA 1BPLB 3V36A 3H4WA 2BXZA 1TCMA 2FH6A 4IG2A 4BQ2A 3NVDA 4N4PA 2ZX6A 1KC7A 4J7RA 3A21A 2CETA 3W26A 2ZTJA 3FS2A 4JIPA 4WJXA 2EHHA 4GZJA 1N8IA 1XLGA 5IFPA 4W5ZA 3L67A 1KLZA 4YVVA 4IP4A 4DUXA 5E0CA 3IRSA 3QQWA 1Y65A 1BSLA 4GUGA 5HJXA 1ICPA 2TAAA 2FHFA 1YYAA 1F7BA 4Q7NA 4H6QA 4ATWA 5U7SA 3HGSA 4ICMA 1Y0EA 3MYPA 1VRXA 4ZR8A 5DLCA 4Q8PA 1NDYA 1POJA 5I09A 5F4XA 3FX4A 2Z29A 1PKMA 4QSFA 4UQAA 2JQXA 1A3XA 4CKQA 3WENA 4LRSA 2JIWA 2BOFX 4K37A 1AQ0A 4I9MA 4HN8A 2YPIA 2WHLA 1XX1A 1GPWA 4LW7A 3LGEA 4WK9A 3K5XA 2ZBTA 4D72A 1HJQA 1R3VA 1FX6A 4M82A 1X6NA 5TAOA 5I02A 1LCOA 3OBEA 3BLPX 3C86A 4KQNA 1GORA 4I5RA 2QXWA 4O14A 4HMDA 1W1YA 1DV7A 4GVIA 1PO9A 1HP5A 2YFOA 2ISFA 3WL1A 5KZDA 4JN8A 5DXXA 4AYSA 3PJWA 4S38A 3IVTA 2PZ0A 4UTTC 2Q3RA 1BGGA 1UZ4A 2V5BA 3BLOA 4AHPA 3G77A 2A2IA 2IMRA 3OB8A 3O05A 1US3A 2C0AA 3ZR4A 2F84A 1XCWA 3FHQA 4HB7A 3MTWA 3BMXA 3K4DA 3NZRA 5BROA 1SO5A 1RPXA 3PBMA 2Q8XA 4DIAA 4H9XA 4M56A 5G4EA 4GQRA 3KHDA 2CC0A 4ZOAA 1K8XA 4KS0A 2QCEA 1JIBA 3H54A 4XKMA 2Q6ZA 1VCFA 2X16A 3WLJA 2WVUA 6XIAA 2YCLA 1EOKA 3NO5A 2YFNA 1M53A 1R8LA 2B7OA 3KBNA 1W8SA 1YDVA 2Z25A 5DN1A 3W25A 2OG9A 2ZVIA 5CEWA 1DHPA 3QFEA 3UP8A 3HFYA 1TJ1A 3BQ6A 1UIPA 3IGUA 4UQBA 5DBTA 2DZAA 2JIEA 2XSXA 4HPNA 1V02E 5I3FA 2ZZ7A 3VIIA 4W8LA 1OGBA 3OIXA 3IAQA 1S5VA 1H51A 3A47A 4M80A 4R7OA 2B81A 1HF6A 4GE8A 3GR8A 4FK9A 2CESA 2J7DA 4AW7A 3FJ6A 4KERA 1QDSA 1V8EA 3JVAA 1N7KA 1W6TA 2WNNA 1S2VA 4BQ3A 5I06A 3ZJ7A 4W86A 1LJYA 2E68A 2X40A 5FJIA 5A8NA 1RBOB 3PZUA 4B5WA 1T6MA 1KGUA 2XTKA 1W1TA 3CUGA 3ZR5A 3DESA 3W87A 4IFKB 5FIPA 3QKZA 3VI2A 3WDJA 3A3HA 2OLAA 3WELA 4WEVX 5HPCA 1H11A 1NAL1 3NJ3A 4NJKA 1TA3A 3ICJA 1Q8AA 4EF8A 3VOJA 2Y85A 3TOYA 3YPIA 3IJ7A 3LMYA 3ZR6A 3PAOA 4Y8FA 2C6QA 1UKTA 3T42A 1W56A 2UZ9A 3DG6A 3KUMA 4HHHA 1EJXC 3L4XA 4HBKA 2FJUB 3PTQA 3TC3A 2XWEA 3M0LA 4S3FA 1DWJM 1BQGA 1RVGA 1B90A 3ITCA 3GS6A 3D0CA 4H19A 3PP7A 4PEKA 3K46A 4NNBA 4I6VA 2Z27A 4JTRA 4AG0A 4CD7A 1BVZA 4O54A 3Q45A 3QHNA 4RDVA 2J24A 3ZT6A 5AC4A 3OVGA 3AIEA 1B1YA 4NZFA 3UJSA 2JKAA 3LCFA 4F0KA 4MPKA 2ZXDA 1E71M 1XBVA 3C2VA 2DT1A 3S4TA 2REQA 1E0TA 1VYPX 3B8DA 1JXKA 1I4NA 2PDGA 1XXXA 3LD5A 1E0UA 3UZJA 2V5KA 3OIHA 3ZVHB 4UC5A 1GG0A 2XJ7A 2PWVA 2WWCA 1N8WA 4IXHA 1KRAC 3NGJA 2AL2B 5BCAA 3BL3A 2C7FA 1ITXA 3CYVA 4NSBA 1QO5A 1H7OA 1JI1A 1R3RA 3GHUA 4GKLA 1DYSA 4TVCA 3TWBA 4U28A 3W1XA 3WQDA 4WHBA 3G6MA 1KXHA 4FNPA 5C2CA 4W8BA 1EB3A 4PUEA 5BWFA 1Q8JA 2XINA 3HG4A 3M41A 5LKYA 1W8GA 1VP5A 2ZDSA 4O16A 4Q32A 1MEHA 4UTLA 1XYFA 3L0GA 1ONWA 2PCQA 3E3HA 4FX6M 1PWLA 4TX6A 3W7HA 4ZVJA 1I45A 2GLKA 3F2BA 3P5YA 5FJJA 3K2GA 4FNSA 3UWVA 3R89A 4JFVA 3EKZA 4F79A 2PDBA 4JN7A 2D73A 1NIUA 2YCIX 4GVGA 3PZGA 1E6ZA 4OGZA 1DWHM 3FAWA 3URQA 5CAHA 1FBAA 1LQ0A 5I77A 1X8CA 2QVNA 1P1XA 3VDBA 3WUGA 3LCHA 3TCEA 2TODA 4JTFA 1C3FA 5HNNA 2PTZA 2PS2A 2XGIA 4PMDA 2CBVA 3DAQA 3LCXA 5AN7A 1PZ0A 4DWSA 1GEHA 3FXGA 2VGBA 1KM6A 3S5OA 4ZOBA 1Q2SA 1XDJA 5B7YA 1F2JA 1ZNNA 3LCLA 2DT0A 2KX9A 1EGVA 2VZOA 3E96A 1XWYA 1RP9A 4HZ8A 1IEWA 3VO0A 1NM9A 1FWGC 3CV7A 2HEJA 2PLKA 4PTNA 1R7AA 4KRUA 2FDMA 4B91A 2ZRXA 2WVSA 4PCSA 1DP0A 4HTYA 4LBSA 3ZYZA 3CB3A 5L9FA 3LTSA 4N9EA 4DHGA 1X98A 4FALA 4MWAB 1AMKA 4O1FA 1K9FA 3G3DA 4TQTA 1CYGA 3ABSA 1R2RA 3R8RA 1IR2A 2VOTA 1XC4A 3U2EA 3WJYA 4C6MA 4PFHA 4TVUA 3IGHX 1PX4A 4Q8MA 4MB3A 4LUJA 3P0WA 1RCXB 3ZMRA 1A0EA 3UZXA 1XYAA 4AZ7A 4I8YA 1J79A 3QV9A 4RXFA 1KM0A 4U33A 1XSJA 5FSEC 3M4HA 1KV8A 4NHVA 2GGJA 4Q4OA 2G8ZA 3M5VA 4W8AA 1D9EA 3HF3A 1XIIA 4E38A 4ZXLA 4NVTA 3FVDA 4GX8A 2AQOA 3RDKA 1WUEA 3EWBX 4HKPA 2YL6A 3VD4A 4KEZA 4QJ1A 1CGUA 4YU1A 1OCBA 4UFHA 5KTLA 1FDJA 3HPZA 3AAMA 2QGYA 2OQYA 4Z08A 3MKCA 2JBMA 1V6VA 1H62A 2PAJA 3AALA 1EIBA 3NQMA 1V3JA 5H8MA 4GD0A 4J2PA 2VXNA 4KGJA 2BLEA 4Q7BA 3OQEA 2CWNA 3EWYA 2WLZA 2HPIA 3NQ2A 4HK6A 2IPJA 2XM2A 1VB9A 3W2MA 5IHSA 3KCJA 1WA3A 2X0SA 3AICA 1TPEA 4RX0A 1RCOB 4P7RA 5HOSA 3W6YA 3W7LA 3P80A 5B7ZA 1F61A 3QVQA 2E5CA 4YN5A 4RZ5A 4DO5A 3B8SA 5LZLA 4ZQOA 3EWCA 4Y9AA 5F2IA 2WVVA 4UXDA 2HROA 2ZUMA 4WRHA 4NU7A 1S38A 4XD6A 2DSUA 4BCEA 2X42A 1E6SM 4LPCA 1L0PA 2PDYA 3APTA 3PBUA 1TVNA 1IEVA 2NWRA 3K1GA 3SUWA 1XBYA 1J0KA 4BQ4A 3AMKA 3WH9A 4N4QA 2ZA2A 2BVYA 1UD2A 4AZBA 1QR7A 4EANA 3AIVA 4IUGA 4XX6A 2VFHA 4Z0JA 4YWSA 3TOPA 4EWJA 5I6SA 1YE4A 4QDPA 4J2MA 1RD6A 1ODZA 2YXGA 1EUNA 1EHNA 3WQWA 2CLFA 2XH4A 2HS6A 3UZ5A 5MKGB 4LOCA 5L6UA 1QNPA 3VUSA 1RSCA 4H7VA 2FZ9A 1XJBA 3DI0A 3BW3A 3H70A 4A3QA 3Q94A 2WJZA 1ZP4A 3NQVA 4INFA 3SCRA 1YTKA 4IMDA 1Q6RA 1TPC1 4XBSA 1EBGA 2A3BA 3CH0A 2P0IA 4LSBA 3RJYA 4US5D 1V79A 1DJIA 4AD3A 3CAQA 3GVQA 3VU2A 5EU9A 1W9VA 3PK7A 2NVAA 2PGEA 2P5NA 2Q8LA 2D24A 3SURA 3DERA 1PCKA 1YDYA 2PDPA 1ELSA 6TIMA 4JEQA 2W6RA 4ZO9A 1E4IA 2GWNA 4EACA 1XLAA 1NJJA 1JDCA 3BGAA 2WHKA 3ZOAA 1UB3A 4N6FA 1QOXA 5HULA 2XG9A 7TIMA 4D8AA 4TMCA 2QDGA 4QX4A 4BHYA 3FEMA 3O3RA 5EPDA 3RM8A 3IACA 1SUXA 2O92A 2OQHA 3LX9A 3T78A 1GQIA 2DZXA 3OLDA 1S5TA 3CPUA 4PSPA 4WVXA 1OB0A 2XIOA 4MNLA 5CGMA 2ZUSA 4CCEA 1F07A 1XCXA 3G1VA 3PC0A 1LBMA 1PL9A 4HJWA 1U1JA 2AQWA 3V75A 1OFQA 1RH9A 3NO3A 5T9CE 2GDQA 2XISA 5C5YA 4AVFA 3EOUA 2FVKA 1UP3A 3SECA 4H9TA 2QYGA 4LUTB 4ROPA 3S46A 1RZMA 3NQFA 3RRXA 1JJKA 4QE1A 4MLJA 1Q6OA 3ZJ6A 4DF1A 4Z2LA 4ZE4A 2DU2A 2QJJA 3TYUA 2E3ZA 3AWNA 1QK0A 1ALDA 2HDJA 1QATA 2DQXA 1X8FA 1QHOA 4NAFB 3EXRA 3H21A 1EZWA 1UJQA 1UWRA 1XKJA 4AZ6A 3WLPA 3UA4A 2PWEA 2WC3A 2G50A 1SZEA 3ZSTA 1XW8A 5M5DA 3WQPA 3AUOA 6PTDA 1V6XA 3FGCB 1HT6A 1CT5A 1JYWA 3DBPA 3NTYA 1Z44A 1U33A 4RW5A 1P7TB 2ALDA 3TYBA 3FK4A 2A85A 3TSMA 3B06A 5BWAA 4DXXA 3IJ6A 3K8LA 3TR9A 2WNQA 1Q6GA 4B90A 3TROA 2DSWA 3V16A 3TN5A 3B9AA 1IIGA 5LXEA 2QQ6A 5ECVA 3MUY1 3L7RA 4P7QA 1BGAA 1JZ7A 4E8GA 1BYDA 4IQEA 3UWZA 3C56A 3R0UA 4WY0B 3S0CA 2PF0A 3K4WA 3GHSA 4PGLA 1T0OA 3EX2A 2XHYA 3OW1A 2JEQA 1X38A 4WJEA 3WH8A 4AYGA 4PB5A 1FKWA 4L4LA 3A64A 1PYFA 2PRLA 4H41A 3NAVA 1AZ2A 5G1MA 4IWWA 2BODX 1TWZA 3CPGA 3WQVA 5MHBA 3ZWSA 2PE4A 3K30A 4DBDA 1TPDA 3CTLA 4V33A 2RFGA 3B0VC 3VIJA 3U4AA 3LMZA 2ZRVA 3SUUA 1SW3A 4E2DA 5BOOA 5AZ1A 4FX7A 3S6TA 1ZS2A 3TW6A 1W5NA 4AZGA 3WD1A 3WLNA 3BSGA 3W1RA 1XLCA 4R53A 2OZ8A 8CGTA 5I24A 2W9MA 3DI1A 4GJ1A 3KTSA 2EQDA 3WQ5A 4X0VA 3PB2A 1YQ2A 2VDGA 2GUUA 3CL6A 1WYIA 3TTEA 4F4RA 3AIWA 1RQHA 4JIEA 3POCA 1WDWA 2UY3A 9CGTA 2VC5A 3VMOA 2Y63A 3ZO9A 4IP5A 4L56A 2VX7A 2C1IA 4QM1A 5CSYA 2Q01A 4K38A 1UZDA 2WVTA 3DUGA 3M9YA 3BOLA 2WSQA 3R6IA 3TMLA 4FF7A 4HK7A 4UR7A 3OZOA 4JNYA 1TVLA 2WOQA 3FYPA 1EPXA 4ZGYA 3QM3A 2VJXA 4Q4QA 1YADA 4JGDA 2PP3A 5E0KA 3OZPA 4MWAC 4H8HA 3KWSA 1M1BA 5M03A 1WZKA 3ONCA 1PIGA 4OE7A 1R47A 3FA5A 5BNKA 4F9JA 4HNOA 2WKLA 4XZWA 2HJPA 3HURA 4GXMA 2WAGA 3K1DA 3M64A 3UZZA 3PULA 5G2IA 3NZ1A 1OFPA 1KFLA 3VMNA 4UZUA 5I5RA 2P88A 1K9DA 1Q4NX 3LLXA 3WK0A 3IGXA 3CHCA 4WXZA 3VABA 3LK6A 3RPDA 4RDWA 4DUVA 4PRTA 4Z1CA 1R38A 5F4SA 5HXMA 1P43A 1SZGA 4GOAA 1JUEA 4WY0F 1ZPTA 3BGJA 2CBIA 3GC4A 2G5WA 2IPWA 3OU8A 3NL5A 4BA0A 1F8MA 1XPGA 1EA0A 1D3GA 1S3HA 4EOUA 3U7VA 2EPMX 2QCMA 4NP7A 2XIJA 1KGXA 2DSVA 4UOZA 1T8QA 3KL0A 3VYLA 1SO4A 3IANA 2BG5A 2PTDA 2PZNA 3B40A 3E2QA 1EIXA 4XUGA 4LEFA 1EHAA 6ENLA 4WKAA 4EAYA 3BVJA 4IQLA 2OODA 1OFBA 3EX3A 4O28A 3TN3A 1ONRA 4AC7C 1IF2A 3CQKA 4N6EA 1P0NA 3LG3A 4JCLA 3NQCA 1UROA 1O1HA 1RCQA 5E93A 4NUWA 3MO4A 1I2PA 3UWQA 3N12A 3DBNA 1WXJA 3PZVA 2CLMA 1G6CA 3SQLA 1FWEC 2CCRA 2DSZA 3W82A 4JHOA 4RK8A 4Z1AA 5AYZA 3UGRA 4U4MA 4QCEA 4MKVA 3BARA 4GC3A 2R1NA 2OSXA 2JE8A 3TTQA 3AHVA 3TFXA 4IJCA 2XDFA 4JL1A 3S2JA 4GABA 1I0BA 2DZSA 1EDTA 4O1BA 2V2CA 3I7RA 1CW2A 3ID7A 1AJZA 4N2YA 5CZSA 1IGSA 3M5ZA 3LU2A 1Z42A 4CNOA 4ROQA 4DO7A 1MFUA 3WD4A 2CZVA 1PVNA 3T8QA 2DQWA 3SGZA 3NSNA 2Y88A 1RLCL 3FKKA 1RQEA 1WXYA 3VGGA 2OZ0A 3QF0A 4XZNX 1XG4A 1QOPA 4JKLA 4DJFA 1EYEA 4GA8A 1Q65A 4A4AA 1EPVA 3KM8A 3AIQA 4S1FA 3URAA 3WJWA 2PDMA 2VHLA 3THQA 3LBOA 3UWYA 1JF5A 5I03A 3B9DA 3CWNA 2X1TA 1XD1A 1I2QA 1IXNA 4IM4A 4QCFA 4AFYA 3UG4A 2WKJA 2EJ1A 3E49A 1ZTVA 1OF6A 3PN8A 2ZRWA 3ITVA 2EG7A 3B03A 1AFSA 5C9RA 3W4RA 1SFSA 4REQA 1OZQA 4FP1A 5CC7A 2QVHA 4HD5A 3GM8A 3S8HA 1YDOA 3DENA 1HUVA 3T0CA 2VRJA 3MHFA 1K03A 5D2XA 1E1CA 4F0RA 3ARSA 1UR1A 4H9MA 1QPRA 4KH2A 3Q58A 2NQJA 3FCPA 3MYOA 3OBAA 2GUYA 1QO2A 4CD6A 4O8AA 1DJWA 3HGJA 3W7DA 3THUA 3AYVA 4CNNA 4YWIA 3GHTA 4H6KA 2D1ZA 5GJNA 1HJSA 3KTCA 4DZHA 3RGTA 2Y5SA 1ITCA 3GB6A 1ADOA 1X39A 4M0XA 1BXBA 1E51A 3EOOA 3D3AA 5JBFA 1Z7AA 1O95A 2YDQA 3H22A 4MZ8A 4JX4A 1BWVA 5CPSA 3WNKA 4P8WA 1FDYA 1DWGM 5HBFA 2DZVA 4R9XA 1ISYA 1GOWA 3DDMA 2BB0A 2YLLA 1AODA 2IKIA 3VNLA 4BQ5A 3LCGA 4NZJA 3GTNA 4EXAA 2WBGA 2OSWA 4GVFA 3V35A 3GZ3A 5BMXA 5DXYA 4TOQA 4FR1A 4J1OA 1UMLA 4ZMGA 1V7YA 1G5AA 1BF2A 1EL3A 1KV5A 3W7JA 3MUXA 3QY8A 1UYQA 4U31A 2ZX5A 3I7SA 2CLEA 3E0VA 2Y7DA 1UH2A 4WF7A 3P2VA 4JYEA 4YYFA 1K7XA 1LL7A 3GNNA 1UP2A 3BAXA 3S2LA 4DJEC 1NSJA 1V6WA 1YHTA 1L8NA 2X7VA 4AWTA 2O55A 4TTGA 2YR1A 1XHGA 1CGWA 5DELA 4RKAA 3NQGA 4HYVA 4PTVA 4XZHA 1AJ2A 4Q4SA 3U9IA 2NQ9A 4Q8VA 2F61A 2RJHA 5HR7A 4UTUA 3VAVA 4K36A 3L4TA 1JYXA 2EGZA 3PF3A 3SCSA 2UV8G 3GIPA 5BRPA 1OF8A 1GOXA 4IFOA 5AVHA 3DKLA 4EF9A 1TR9A 1UBSA 1QT1A 3EXTA 1JF6A 1DJYA 3DYMA 3LENA 3PNUA 2CZFA 3GH4A 3GR4A 3D3FA 5D02A 5K9CA 1NWSA 3KP1A 3SCUA 2VGGA 1HVXA 3NG3A 2XFWA 4Q3MA 2FPYA 2PP0A 1MNSA 4LYKA 1GKPA 2BSLA 3PBGA 3LHYA 2OKOA 3CB8A 4DI9A 1I6NA 4L9YA 2Y1HA 5EMYA 4C1KA 1A5AA 3BLKA 1KQYA 1UR4A 2Z4GA 1RJRA 1VEOA 4ZFCA 3QY7A 1MO0A 4X0NA 4DUWA 4IF2A 2VELA 4XUYA 1O12A 4QNWA 1IT0A 3BAJA 2ONEA 1TTPA 4KWVA 2QZRA 1RXOB 4QHRA 1OGGA 5C55A 4GBUA 3E0WA 3SRKA 3UVAA 3ITYA 4IPJA 2Z2UA 3EWZA 4KETA 2XVGA 1B3OA 3LTYA 4K7VA 2VGIA 2GDUA 3SRHA 3JRKA 4H8VA 2AMGA 1KWGA 2VD8A 3N9KA 4G56A 1AL8A 3VD7A 1XINA 2RH9A 1ZJHA 5A6BD 5A1AA 2P53A 2X2YA 3FSUA 4KWSA 3UJRA 5HWNA 2XUCA 4O19A 3V0SA 3MT1A 1YXCA 5AYIA 1MW0A 4FLRA 3E0FA 1TWSA 2GGHA 3WNNA 5A3HA 4RV3A 4XBKA 3AC0A 3LDVA 3LCWA 1UBPC 4I8DA 3B3DA 3ZVIA 1JNEA 3HJEA 3P8JA 3DFNA 4JKMA 3GXNA 4W9TA 5K9XA 3DECA 4J9JA 1LYXA 4QJ5B 2OEMA 4FI4A 3FYYA 2FB3A 1TCDA 1JNDA 3HJZA 1M65A 1LBLA 1MUMA 3UW6A 3K8MA 4C6OA 3GG1A 4LNCA 3NVTA 3WLSA 5HINA 4PRWA 2YW4A 1I75A 4DJDD 3A5VA 4Y96A 5G2HA 5AHNA 1FH9A 2CBJA 3V5FA 1MMFA 1SZRA 1H0IA 2NUWA 3PZ9A 3RF9A 2GJPA 2O9PA 4ZQCA 1NVMA 2CBUA 2V5DA 3M0XA 2QAFA 1T7LA 1G1YA 4WSKA 2FTYA 3G22A 1XGDA 4Q6JA 2HSAA 1E72M 1F9CA 3QBUA 1TJ0A 3AIBA 2Y7FA 4W85A 2V2DA 2HK1A 2ICSA 4A8RA 2DVUA 4CQDA 2NV9A 4Q8TA 4QQ3A 3NQ6A 3EWDA 3VNKA 5FJRA 4HNTA 3UXIA 3W7RA 1ZLPA 3M47A 3NQEA 3ME3A 2QPXA 3H2OA 2BS9A 1XFBA 1JQXA 1MRQA 2E5DA 4FO4A 4GNVA 2AMXA 1FDZA 5M1TA 3TR2A 1JD9A 3SN1A 4GACA 1LROA 5AB3A 4Q8OA 3BCJA 3HN3A 4MZ1A 3FDGA 4M24A 2RDWA 5J5DA 1C8VA 2VC9A 4JQAA 1E56A 1EWEA 2J9XA 2R82A 4PRRA 4QTGA 3O16A 1REQB 1JR1A 1DJGA 3UVIA 4B5UA 1YKWA 3GDRA 3N2TA 1PUDA 2BNJA 4CD5A 1TIMA 4ECLA 3SSZA 3QKEA 1QTWA 4MOZA 3VM5A 1XDMA 3XIMA 2DT3A 4AQLA 2BP1A 4TV6A 4S3JA 4G7EB 3ITTA 1VBHA 3FOKA 3VINA 4GYFA 1RLDA 4UTJA 4DY1A 1QUMA 3GYCA 2PUZA 4KESA 1LLWA 3LRLA 3NCOA 4W4QA 1VH7A 3MO7A 4IT1A 1W9UA 5C71A 5CBBA 3W75A 4NF7A 2RDUA 3H2MA 5PTDA 2C15A 1UKOA 3CWHA 5D37A 2D23A 2WJDA 1R9ZA 3QQ1A 3U3HA 4JTIA 3KVMA 1B3YA 4MHBA 1GG1A 1MDRA 5JBDA 2J8TA 2EG8A 1JUKA 1TB3A 3QRHA 4GI6A 3ZZ1A 1U5HA 3JUGA 4ZQRA 3LI0A 2OZTA 4CNSA 6A3HA 5E70A 1XCFA 3WUFA 2FYMA 1BVNP 3N6JA 1LTDA 5G5IA 4FNUA 2VEFA 1SW7A 4IZGA 3H4XA 4DVOA 2QLYA 2R9RA 4R7JA 1TPFA 5KZEA 1UWIA 2XSBA 4NZ5A 4YHGA 4RXGA 1OX4B 2VUNA 1G9HA 1NU5A 5K7JA 4G2DA 3N1AA 4Q8UA 3P62A 4LNYA 3MANA 1HQTA 3BQ5A 2QF7A 3PFRA 4UTMA 4JEJA 4M7SA 3QSTA 3LB0A 2PD9A 2J62A 3GSMA 5C9WA 3VE7A 4XO6A 2WSRA 1H2JA 3HB9A 2GFTA 1E9ZB 5CG0A 4NYUA 4D8LA 4X2PA 1AG1O 2H8XA 3NNTA 1KKOA 2I5QA 1O5QA 3GXIA 3N3MA 4WCJA 4G1KA 4D8ZA 1KTCA 3ZXWA 4GYJA 1OIMA 3E5BA 4XZ9A 4LAOA 3CBWA 5CSUA 4IHCA 1DWIM 3CHVA 1G4TA 2WQPA 1GOMA 1P4CA 3WQ6A 1WDSA 3LZ3A 5CQ1A 2I7GA 3QGAC 1JAKA 2ON3A 7A3HA 2GVLA 4B2DA 1EQPA 1T5AA 1ZL1A 2Y89A 1EJSC 5TF0A 1VFOA 3UXLA 3HG2A 2VQUA 1F73A 2YDRA 4XKYA 4EX4A 2A6LA 4AD5A 4F2UA 5CPNA 4ZA0A 3TMQA 1WDDA 1KD0A 5G2WA 3L4YA 4XD4A 2C79A 4BI6A 1ENUA 3IV3A 3KAOA 4M3PA 3A9IA 3LSBA 5H8UA 3WO8A 4BFAA 3TWAA 2QJGA 5FEZA 4NIRA 1IIHA 4QS5A 1B3WA 4BY3A 3L2LA 5A6KA 1UD4A 4P8XA 1Q6LA 4KEVA 4P7NA 4YLWA 3RX4A 3NM3A 4X61A 1I1WA 4MAVA 3G8RA 1CLVA 4Q4RA 7XIMA 1YBQA 2QT3A 3V4BA 2NW0A 4NJIA 1GTEA 2F6KA 4A21A 4J3WA 3UEQA 4Q6XA 4YPJA 4LCSA 5A5WA 5I3KA 2GK1B 3PFMA 3VOCA 1W37A 4MG4A 1OZMA 3QTGA 1P0DA 2PA6A 2KZHA 1OCJA 1K8CA 4PULA 1YNYA 4ERIA 3OVPA 4LY8A 4RR4A 5A6JA 1XICA 5AC6A 3EYPA 3NPUA 1GVSA 3N73A 3STEA 2WM0A 5FJOA 4DZ5A 1N82A 1VC4A 1LUCA 1PHWA 1FP9A 3A22A 3R25A 5AY7A 1VJZA 3UXDA 3O9NA 5CZJA 5IM51 4U5KA 3MCMA 3RR4A 2OT1A 3KOZA 3RLGA 4IG2B 3E74A 3EWUA 1GOQA 3SUVA 2YBVA 2G3JA 2WC4A 3U8GA 1EF2A 3SIZA 3EDFA 1UWUA 3QMTA 3U0HA 4EXQA 1M7XA 4RW3A 3WD0A 2QDEA 1WKYA 3GVRA 1K4GA 4UMCA 3BUVA 2C1GA 4UTWA 2VURA 3QTPA 2FTPA 1DXFA 1UWAA 3GRIA 3AMLA 2BY2A 1EXBA 3FFSA 4QGCA 2P8CA 5EFFA 1XLHA 1K7EA 4MYAA 3BH4A 1XUUA 4N42A 2SFPA 1XBZA 2XPKA 4GIEA 4C6CA 1LT8A 3W02A 4DBSA 4FX8A 1HX0A 1QW9A 4JQ4A 3SBFA 4A8NA 1BKHA 3WLRA 1VGAA 3W37A 2YB4A 1P48A 1KTBA 2XN2A 5AC5A 3SCVA 4E4PA 5F2GA 5JU6A 5A8QA 3VIOA 1CLKA 4W7VA 3P6LA 4WKFA 3MP4A 3ENLA 2P8BA 3WLLA 3POHA 2XVKA 3OLIA 3W3OA 1MW1A 1VCGA 2DH2A 2FGLA 2RJGA 5D05A 1W3KA 1FXQA 2ZXAA 1C90A 1NOFA 5DANA 3Q65A 4OT7A 1WXZA 2R91A 1EO7A 1DQXA 4J3VA 1L6YA 1W0MA 2E6YA 1GVFA 1UR3M 4GGBA 4HU3A 1J6OA 1L9WA 1VJSA 4N0RA 3J7HA 1TPUA 2YL8A 2QJIA 1V0KA 3PAJA 2VL4A 1SMAA 3K8KA 4BF9A 3C2RA 2ZRYA 3TH6A 3UZWA 1BWLA 2YXOA 2FPTA 1JDAA 3GH5A 3F1QA 3ZS4A 5XIMA 1HIZA 5FKYA 3U4FA 1Z8AA 4HPJA 1A5LC 3CV6A 1IT8A 1HKKA 4GFSA 1LOSA 2FH8A 3PJUA 2ZTKA 1E70M 5C2XA 2ZADA 2J6VA 4IGMA 5D38A 3WUEA 1LM1A 4ZO7A 5FD0A 3GDMA 4N02A 3MP5A 4ZTXA 1I2RA 2X7WA 3VOGA 4PL2A 2R1MA 3OVQA 1WDPA 2G41A 4E3TA 2E77A 4QP0A 4J3TA 2FFCA 3LUTA 2CW6A 2F2KA 4PA8A 2W3ZA 1ZZMA 1PKNA 3B9NA 3LHVA 4JTSA 2P10A 2NQZA 4Z2KA 4PMUA 2VWSA 1B5TA 1PBGA 1O6IA 2QCHA 2Y0FA 5ABEA 2NT1A 1JVNA 4DPPA 1UHVA 4MNJA 4GZIA 2VD9A 1ISWA 3P60A 2VVSA 4MKNA 1ZJBA 3R8HA 2DH3A 4BF7A 1XYZA 2QNEA 4O8RA 5B80A 3BXWA 1H7RA 3R43A 4AZCA 1E73M 3LPPA 3UQNA 4LXFA 5DY3A 3G1YA 1SM9A 1J0ZA 2PDXA 1TA3B 3FAXA 1SPQA 1M6JA 2I5GA 1QI0A 3W88A 5E6ZA 3OLGA 4AWEA 4AMAA 3N15A 1CDGA 2QF8A 1CTNA 3TV8A 1FWCC 2WC7A 5ENLA 1U5VA 5CPQA 1UUQA 2GYIA 4JHMA 4KCVA 4HZ7A 1XKYA 4HU0A 3AYRA 1VPYA 4XZBA 3EX1A 4M7TA 1C9DA 5LIXX 5EMKA 4AUBA 3WEMA 2VTFA 3CZJA 4LRTA 3E02A 2RGLA 4PMYA 2IKHA 2J13A 1B4KA 1ZENA 4PCNA 1Q2RA 4ATDA 3UETA 3R1ZA 4OBRA 2Z28A 4HK5A 4V15A 2CIPA 4JTCA 1JFXA 3VFCA 2REQB 2JKPA 1EOMA 1PYMA 4ZSUA 1G7VA 1T41A 1BQCA 1KB3A 4LVDA 7REQA 4L65A 3PY2A 3TSBA 4ACZA 1SZNA 3WQCA 2WZMA 3QV6A 4CN1A 1KXVA 3DFYA 1R46A 1G4PA 4KW2A 4CGTA 4F48A 1TYGA 3W53A 4KRTA 4NX0A 4KWWA 1CNVA 1HGWA 2GSHA 1TE1A 3IUHA 3W85A 3SCWA 1S2WA 4PCPA 5DY2A 2VC6A 1U1UA 3L5MA 3GTIA 4D71A 4EE9A 2WJFA 3WLTA 2QEZA 2NXIA 3L9CA 3HO8A 1JDEA 4QLJA 2IUZA 5CBIA 4L6HA 1WE5A 3W00A 2ZZ1A 3H2AA 1KFCA 4HNCA 2I56A 1JD7A 5AHLA 4MY1A 1RPKA 1EDGA 1DJXA 1NWTA 1ML1A 3R58A 3P14A 1QRQA 1EJVC 1GOKA 1PEZA 4FNTA 1V3LA 3VIMA 1XGEA 1SFJA 3WEZA 3MZ2A 2A7RA 4C6JA 1AQMA 3ARWA 3WMBA 3GR7A 3GK0A 4QSHA 3ITXA 4NAEA 3CUHA 3UGVA 3NEVA 3GHRA 3GY1A 4GXWA 2ABBA 2PRMA 3UYIA 4YTQA 1CCWB 1DVJA 2VEMA 3H4GA 1UQZA 2GQ3A 1FWSA 3IIXA 4PYSA 5FCZA 3A4WA 2BDQA 4EVZA 3DG3A 2GVGA 3MHGA 1LZOA 1R9YA 1A4MA 1ESWA 4H4IA 3E1F1 4NNAA 3RXZA 1BHGA 2J7HA 4R34A 3T0AA 3MA8A 3W01A 4DWSB 5GNYA 4RE0A 5EMLA 1XC6A 4IPPA 2VVNA 2BBFA 3FJNA 4DZAA 5ABFA 3HV9A 1GWJA 1CZ1A 1V6TA 3QH2A 5GNXA 1W9BM 1VFLA 3OTRA 3VE9A 2OMAA 1S5MA 2FMOA 2F7FA 1C8XA 4KCUA 3TQKA 3UERA 2DORA 4YVPA 2F2HA 4WXYA 3SJNA 3S9YA 1W3JA 1TPWA 1QVBA 4C7FA 1JCYA 4QG8A 3BICA 1TG7A 1US2A 2ZX8A 3EX6A 4CN6A 1F6YA 1CGYA 3U57A 3BANA 4P5UA 1G7UA 4Y9PA 1QWKA 3QHMA 1GYMA 4Q4KA 4LY4A 2HBVA 5CC6A 4QRNA 2Y62A 2HPMA 2OELA 1QI3A 1FWWA 5BU9A 3GDLA 1YX1A 2OYLA 1XRFA 1TQJA 1KCZA 2D69A 3W1NA 2GQAA 4IX2A 2AAAA 2PGRA 1V3MA 1JCNA 3DC0A 3SSJA 1V0NA 2W61A 4GFIA 1AJ0A 3L23A 5JBEA 2VEPA 1W31A 4XZMX 2V38A 4A29A 4TXEA 4GRSA 5LNRA 1HO4A 1QHZA 5A6AA 3WDRA 4OVXA 4A6GA 2OGJA 2V3GA 1E1EA 3GU9A 3A3XA 4AIEA 1SFTA 4HYRA 3HGRA 1FOBA 4CUCA 4K39A 3LTPA 4Q7IA 5H2ZA 2RGMA 3TC6A 4JAWA 1I8JA 1GKRA 3UWEA 1EZ2A 2WZEA 5DCBA 3DOPA 4HNVA 1UC5A 3IVUA 2A7PA 3N9SA 2BHZA 2IQDA 3KBJA 1C8QA 3IRDA 1KBKA 4DO4A 3N29A 2YLAA 3WF3A 2PSNA 3AHXA 3BAKA 1KM2A 3PPGA 3PBVA 4UOJA 2GWGA 4QIUA 1B9BA 3WFAA 1NDVA 1FP8A 1JZ8A 2Q8ZA 3AYSA 1WO2A 4K3ZA 5C9ZA 3WFZA 3STPA 3VC5A 4QG9A 1TJ2A 5T26A 3DFQA 2ZX7A 3THAA 4DB7A 4A8IA 5E6YA 4OBTA 4ZCWA 3SUSA 4XTDA 3RR1A 1E3ZA 4FB7A 1E9YB 3W81A 1SO3A 3WY1A 4ZODA 3VPLA 1JUBA 4YTSA 4JX5A 5TIMA 1H49A 1E6QM 1PSCA 3BSHA 1PZ2A 3WG6A 3U2OA 3RO6A 1QHPA 2WHJA 1FFRA 5EFDA 4JTHA 1GYLA 5I3DA 4GJJA 2W79A 4NILA 3SIMA 3S47A 3WJXA 1IR1A 1U22A 5FF4A 1ONXA 1TTQA 3IUIA 1VYRA 4AWUA 4LAUA 2A3EA 4H9VA 1QI4A 4CU7A 1XI3A 1XH1A 3CUXA 3XINA 4PTMA 3DKJA 3QMRA 2VDIA 1UPMB 4FOJA 1WKDA 3R5EA 4KF1A 4E2VA 2PMQA 4ALDA 3QN3A 3W7QA 1AD1A 3ARVA 2ZXQA 5A6SA 4DM2A 4PMRA 4HHMA 4WDWA 3APGA 3IPWA 1GW9A 1IV8A 3MWCA 5FOOA 4LC8A 4JTAA 3LEPA 3HMCA 2W0UA 3MBFA 3VNIA 2O9RA 1BAGA 3T8LA 3KBSA 1MFVA 4C5YA 4HA4A 1GONA 2D3NA 3VKKA 3G18A 1FWJC 1OFRA 2DZWA 4FPSA 1U1HA 1Q6DA 4I3GA 5JMUA 2PPGA 3WQGA 1VJIA 4O0ZA 2HZGA 2D0GA 4A05A 1F4AA 5FEXA 4FXRA 2OT0A 1FCQA 4G8TA 3TQVA 3JU2A 3GNPA 1EGMA 5CCZA 3CUJA 2XVNA 2J7EA 2A21A 2ZUTA 1ICQA 4YYCA 4FAMA 1K3UA 4QAIA 1TSIA 3GC2A 4PMQA 1I2NA 3PWIA 3W29A 1KM3A 3CK5A 3WJZA 3DHPA 4IL2A 4O10A 5BRQA 2VNCA 5I79A 4ZEPA 1E6NA 3M46A 1LLZA 5LSMA 1TTIA 4AWSA 1TZ7A 5EB8A 1LORA 1F3EA 2QUMA 2PC8A 5EMUA 3H2NA 2J7GA 3VXGA 3W27A 1JAEA 3MV01 3SY1A 1NFPA 3TW9A 4XAPA 2OOGA 2E6AA 1Z9AA 3Q2DA 2EKCA 3RU8X 3M0IA 1QNRA 1TFVA 4CNTA 3CL7A 1K02A 1OC7A 3E6EA 4AX6A 1G69A 1PXGA 1Q4WA 2OWCA 3TK7A 1JPHA 3AS0A 1IWPA 1W5QA 4E6MA 3ZWTA 1E1FA 2YA0A 2XIQA 4MWAD 2WKGA 3DC8A 1U5JA 2ZZ2A 1YDNA 4IICA 3VCCA 4MWAE 4IX0A 4GY0A 1TRIA 1H7NA 1EDQA 2E67A 3LERA 1GUVA 3MS8A 4QQUA 2HE8A 4LQ1A 1NY1A 3AYTA 1QASA 4XZIA 1O60A 3C5QA 3T1GA 4FZIA 4PCTA 4MKSA 3G1HA 1RY0A 4EPDC 1H41A 9XIMA 3S9ZA 3RITA 2YW3A 1XIMA 2V68A 1WDRA 3B0YA 1TX0A 2J79A 2ISWA 5DRIA 3NEHA 3G5EA 3ECQA 3TYZA 2O9TA 3QSRA 1V02A 4NZ1A 1SJBA 1FWAC 3VIPA 3BURA 3EMQA 2YA2A 5CGTA 4DF0A 3W28A 3M0JA 1R3SA 1XR2A 1A5SA 5XINA 5JUVA 4Y90A 2WSYA 4IMGA 3QPYA 4LUTA 3BLIA 3LLFA 3P61A 2PBGA 2DJLA 3LLDA 4K6AA 4S3KA 4RE3A 2QHAA 4JTTA 1NP2A 1HZYA 1R2SA 3M6DA 3C3UA 4Y9NA 4CQ9A 3CUFA 3GDBA 3TKFA 3TAKA 4ZSTA 4S3BA 2OWXA 3MMUA 5F4WA 2ZRZA 4JFUA 4JTQA 5FACA 1AUSL 1TUFA 4YJ5A 1XH2A 2YIHA 1KM4A 3KBVA 4JQ2A 4IIGA 1CPUA 1IXQA 3QZAA 4LF1A 1WZLA 1LWIA 5D30A 3UNTA 4HVXA 1R2TA 4JNZA 2H90A 4Z2HA 4P61A 1DXIA 1HO1A 3FGCA 2ZYFA 3W1AA 2VFGA 4V1YA 4DWSC 3WNOA 4MTVA 3CJPA 3SCNA 1ZU8A 2V3EA 1XSIA 2VZTA 2R14A 2E40A 2WPBA 3FJLA 3TP4A 2BWGA 5DEZA 4F2TA 3PUOA 1HKIA 1MQPA 4U2YA 1OHLA 2WMFA 3BGGA 3O63A 3PNZA 4GZEA 4F66A 2Y8KA 1T8XA 1EP1A 1OEPA 2R8WA 5HUOA 3B8TA 2WHMA 4RNFA 1SMDA 3R94A 1JDDA 1FWHC 4C6QA 1HG3A 1R30A 2E4TA 2PF8A 1D3CA 4ZO6A 5GVJA 1ADDA 2E8YA 3APYA 3LBMA 4ZOCA 2OXNA 5A8OA 4YIWA 3ABRA 4AH7A 4E4FA 1GZJA 4PTWA 2HRWA 3KS5A 5DRCA 4ATLA 2D0FA 2PFHA 5J04A 1TIWA 1OK4A 3W1TA 1GOIA 2O4QA 2Z1SA 2B31A 1GVRA 2PDIA 3OJGA 2E9MA 5IBXA 3VGFA 1CGVA 4JYDA 1EC7A 1UZHA 1KQZA 4IIHA 4BJHA 5E09A 2PDUA 4H3DA 1B3XA 3AI0A 2VX4A 1J5TA 4MYXA 4L64A 2YSWA 3SGUA 5C54A 3FXYA 3F4NA 1XRVA 1P6BA 3XISA 2VRQA 4GUIA 1J0YA 5AYBA 4UQEA 2B7NA 4HA1A 5AYXA 3NOEA 3LXBA 5D8ZA 3O7UA 1NDWA 1L6FA 3D6NA 5BW6A 1XYBA 4GI8A 1ONEA 4MJMA 4P8UA 2A3CA 4DZIA 1LRNA 3SCOA 1A5NC 2WMIA 3WFLA 2XN1A 5FJUA 3TXZA 1HL8A 3W2NA 3VGDA 2Z1KA 3C2OA 2HVNA 3VX0A 2BVDA 3MCOA 3KZPA 4MY9A 3W2LA 1CIUA 5IXEA 4PZVA 4DAFA 4H6EA 1UH4A 3GTXA 3S9IA 4DLMA 1HW6A 2BMBA 1XBXA 4H2CA 2AOSA 3ARTA 2VEGA 3EX4A 7ODCA 3VNMA 1OFDA 4LUYA 2C3ZA 2QULA 4GX9A 2J27A 1XYCA 1HTIA 2CLKA 2OEJA 1Z32X 4YTTA 1LLOA 1FHVA 2G3NA 3FY1A 3EEGA 3HU7A 5G1YA 4Z2IA 1OG6A 4DJED 3PTDA 2HISA 3QV8A 4KRZA 3AU2A 4OOUA 4HNUA 3U7BA 4ORIA 5CXPA 2VCCA 4I9TA 1P6WA 2G4JA 4XD5A 4GYPA 4QBXA 3V1PA 4HSNA 3TTOA 1BYCA 4OOZA 3GAKA 3HG5A 3T2OA 1TV2A 3G2GA 1XF0A 1CGXA 1YPFA 3HQPA 3O15A 4WR3A 2FVMA 3BW4A 3VOIA 3S5ZA 3UR2A 3SFWA 2XM1A 1E4LA 4K1WA 4PMZA 2EPNA 4LTSA 3UESA 2Z26A 2HVOA 1Q85A 1XLKA 1TMHA 1KRCC 4LBRA 3LZ5A 4PH6A 4REQB 1TE6A 2XSAA 2QCCA 3AMGA 4DLFA 4MIMA 3MPGA 2ACUA 3GBEA 3UPBA 3KS6A 1JZ5A 2PDJA 4X9SA 4JN6A 1ME7A 4CU6A 3NOYA 1RQBA 2OCZA 1LQAA 1E1CB 3UG8A 1SJDA 3RMEA 3GYEA 1J0JA 2MNRA 1KM1A 5E9AA 1OK6A 3FN9A 2DZUA 3WJSA 4FNRA 4OV4A 5FF0A 3PJTA 4HZMA 2YJQA 1US0A 2BV9A 5LYRA 3FNDA 5DT5A 2NX9A 1WCGA 1H5YA 3EAUA 3ITOA 3BWWA 1HXJA 3LNPA 4IGHA 2W92A 2ATMA 4QLLA 1O1ZA 1IZCA 4JCMA 3LSCA 3PWGA 4ZB5A 4YHEA 5FSDC 3B8IA 2OGYA 1QPQA 3B8UA 2J9YA 3LPGA 5D2YA 2PDFA 3H55A 1XS2A 2Y4SA 4XAYA 1BG4A 3KZSA 3C61A 4W93A 3BOXA 1JZ3A 1C9WA 2QIIA 3CS2A 1OIFA 1E3XA 1RBLA 4XVDA 4JIIX 4GCAA 4ONVA 3ANYA 1TREA 5EMMA 3ZLGA 4GUJA 1H1YA 2PDKA 1Z89A 2J75A 3WNMA 3UR5A 3V0UA 3RCYA 1J0IA 3IIOA 4XIAA 4IMCA 5AVNA 2KAUC 1VKFA 1Q45A 4RE4A 4DXKA 2V5CA 1W9PA 1H09A 3STFA 2PDQA 4RZ4A 2WYSA 4QE4A 3T6CA 1E15A 4PUUA 3WLKX 3LI1A 3LPOA 3AHZA 1TV7A 1X6UA 3C0LA 4TU1A 4B3LA 2OOFA 2NQ5A 2J77A 3NPXA 2GVEA 1QBBA 4MB1A 1KNWA 4LVFA 2WMJA 5DMMA 4KFOA 5BXRA 1GOOA 3WQOA 4I7WA 2EKGA 4US5A 4DWDA 3FIGA 4AAJA 1A53A 1E0WA 4H04A 2F38A 3ARZA 4UQ9A 3WMSA 1LWJA 4XK2A 2VEKA 2H9AA 2ODOA 1EUAA 3PUDA 4EPEC 3I68A 1B31A 4LV4A 4J3UA 4Z42C 1JDFA 1JCXA 2DPEA 5HMFA 4AY1A 5K4XA 1EA9C 4CU8A 2W67A 4OQVA 3T9PA 4FNQA 3WEOA 3W6LA 1Z69A 3LHZA 5HNRA 2OX4A 1PHQA 2ZUWA 2XGBA 3S6DA 1KW1A 3N2CA 3N11A 1UMYA 2OEKA 2Y7GA 3E9AA 3HQOA 5C7HA 5FF3A 4WX2A 3VZZA 3RAOA 3AXKA 1KO0A 3Q37A 1O5KA 4KCTA 2FZMA 2DW7A 3AIUA 4GI9A 5TBOA 4HNNA 4GKTA 2XU2A 1JI2A 1XLEA 4XTIA 2XVLA 4QDMA 1F6KA 4ZZ9A 2P76A 1WX0A 1AVAA 2FMNA 4IIEA 4NZ4A 2XH0A 4HT3A 3N25A 2VR2A 3EEZA 1UW9A 1Q6EA 1TZ9A 5JIWA 1W3NA 3TJ4A 4AIUA 1ZALA 3QR0A 3B04A 2Z1VA 3VNZA 4WKHA 4F3HA 1WV2A 2OSYA 1AH4A 3SRDA 1PDZA 4ZOEA 4JDYA 1W3HA 3HQ1A 4A2RA 3TEVA 1A3WA 4Q8NA 4C91A 3T4CA 4YNGA 1E0XA 3VGEA 5BYWA 1UWQA 2WMKA 4ICCX 1MEIA 4IQDA 2VUYA 4K7YA 4LYRA 4ADUA 1HP4A 2VFFA 1MYRA 1NELA 3C8NA 4O0KA 4M6QA 3STCA 1XISA 1BRLA 1W9XA 3OPSA 1K70A 3RCNA 3WDQA 2I16A 2A3AA 4E5TA 5A8PA 1V51A 1UP0A 3VGHA 4I9AA 5GNZA 3B8WA 4MMWA 4JQ1A 4PTDA 4IP7A 3VD3A 2JGQA 3UJEA 4O1EA 5F2MA 3D47A 2XIMA 1UKQA 3OHMB 5D2TA 5I3HA 4EK7A 4FXJA 1VBGA 1OYBA 2OYKA 2ZFAA 1WZAA 4JS3A 3CZGA 4IPLA 3BZGA 4NXSA 1OJXA 1G01A 4CVWA 2V9DA 1UUMA 2Q71A 1FVPA 3S1GA 3W7PA 1E43A 3TZNA 3W24A 1CENA 3ELFA 3UFYA 3K13A 1V3KA 3CQ0A 4KPLA 2ALRA 4J3XA 4P7OA 1DBTA 1ECEA 1EJ7L 1FWDC 4HU8A 2XH7A 4GC4A 5HANA 2EPKX 1RALA 2H6RA 2QIWA 2ZQ0A 3SY8A 1ISXA 1KA9F 2A6NA 4Z17A 1JPKA 1ZP3A 3F5JA 4ASTA 3WF2A 1VLIA 4CN4A 1J96A 3P82A 3AU6A 3VX1A 3MCNA 4GMEA 2QR6A 3RPMA 1UOZA 2CXEA 1XRSA 3PS7A 3WBEA 2WSPA 1LDCA 4BWLA 3S2CA 2CHNA 4PMOA 3TJIA 2QJMA 1O5RA 1ZAHA 1TV4A 2TMDA 3W7KA 1CXKA 2WZHA 3BV7A 3GG7A 1N8FA 2BX7A 1BYBA 3AJXA 3LQLA 2TYSA 1S1PA 2GDVA 1UQYA 3EWXA 2Z2AA 2PTXA 4JHZA 3WCZA 2PC4A 2WBKA 4IH3A 1M7OA 1N2VA 5H91A 2XZ9A 4A2SA 2B0MA 1W32A 1OCQA 1E6RA 4HNLA 3PZNA 3W22A 1BTMA 1MXSA 3P0XA 1JL8A 3GXMA 1H63A 2ACRA 4PUWA 1TV5A 3I3DA 3N14A 1Z48A 2GVJA 3QLDA 4MB5A 2IQ0A 4DJFC 3B97A 4UB9A 3W2KA 2OWWA 4RDYA 3WBYA 3BLFA 1YTEA 4Y7EA 3T08A 5KETA 4F0LA 4ZFMA 3SJ3A 4EAMA 1ITUA 3L4UA 2CNCA 1S5NA 5CG7A 2V3DA 2GJNA 2NT0A 2W62A 3ZT7A 1DIOA 2WQDA 3VDHA 4V1XA 1QOQA 5HUPA 3FA4A 4B3KA 3TJXA 2XIIA 2I9UA 3E0IA 4GUFA 3CH9A 3EOLA 5D2WA 3DFHA 5FAGA 5CJNA 3NO1A 5LHEA 1C8YA 1JGMA 1Y8BA 2MUCA 3BMVA 4A3RA 4D9PA 3LA4A 3AUJA 1X1ZA 4Z1YA 2Z1WA 3NSMA 1CWYA 1GJWA 3TLQA 1W17A 4A3YA 2QS8A 3A5FA 3WK2A 3EBVA 3OO2A 1QFEA 3PZIA 4JIRA 2IKJA 3IJQA 3WQ4A 1FHDA 3TDFA 3NQ7A 3CAVA 3DU0A 1JPDX 3AXHA 3STGA 3VUPA 5T91A 3QJAA 1UA3A 4RDZA 5TQLA 1W5OA 1JYVA 1G0CA 3DGRA 3GE7A 3QYSA 4AEEA 1QJWA 3DHDA 1YRRA 3B0PA 5BXSA 2O7QA 4IUOA 4AF0A 5LNWA 4O17A 5AHIA 4DEFA 1F74A 4B5TA 5J5RA 2H3DA 5C8BB 2L5HA 3MSRA 5LNSA 2E0PA 2F6XA 4XKYB 1YXDA 4DNHA 3EOEA 1PTDA 3CMFA 3W7IA 4JTLA 1K7FA 3WQEA 1NWRA 4J27A 3B8VA 6REQB 1OT2A 2Q3OA 1LG1A 1A0DA 3CNYA 4WGXA 4IMEA 4O13A 5REQA 5I0DA 3QV7A 5LIUX 4LCQA 3SW6A 3R79A 1KRMA 4OBSA 4M6VA 4C1LA 3MHUA 4A35A 1RV8A 4RZ6A 3GIQA 1ECQA 4UTKA 2QV5A 3FVMA 4LX4A 2ZZ4A 3WLMA 3KRBA 1AD4A 1NOWA 1QBAA 3EWWA 4LAZA 3PVFA 3RJXA 4DRSA 1YBQB 3D46A 1OX6A 4WIWA 1H3GA 4UTHA 1EWDA 5M17A 1Q6FA 1BSIA 4ZBCA 3KBMA 3NZGA 3I6TA 3KW3A 5JQ9A 2FFIA 1GQNA 2E6DA 4AY8A 1ZBKA 4WD0A 3CUZA 1P0BA 3T44A 4QJ4B 3N34A 5ECUA 3VKBA 3BDKA 4D1JA 2X41A 3P67A 1LUCB 4WJ8A 3LHWA 4ORMA 3SY5A 4WDXA 1SR9A 1QPNA 3QXBA 2ISVA 4BI5A 8A3HA 4PR4A 4X60A 3GX9A 3W76A 4I9JA 2BOGX 3I10A 4JTGA 5AHMA 3VGBA 3AHYA 4L5ZA 3PB0A 1FH8A 4GH1A 5A6LA 4Y6GA 1WUFA 3U2ZA 3U6WA 1SW0A 3TIMA 4XZLX 3LRKA 3F5KA 4PUNA 5DMLA 2C14A 1L8PA 5AC7A 1S2UA 2HCVA 3H8AA 2PU1A 3C2FA 3CXOA 2ZA3A 2NSXA 2OPJA 2HK0A 4HHPA 1WDQA 3R8GA 3DFOA 1ZBCA 3V0TA 2OZ3A 1R87A 3T2PA 3RM9A 3M0HA 4AD0A 1GCYA