3U5UA

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
501
structure length
470
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
molecule keywords Raucaffricine-O-beta-D-glucosidase
total genus 178
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u5uA00
2B31A 4JCLA 1TFVA 1UWQA 2HVMA 5JBEA 2UWFA 8CGTA 4E8CA 2VCBA 4W8LA 1ISWA 1GHSA 5DF0A 1QNQA 1GQJA 4J3UA 3PZMA 1WZKA 1MQQA 3AI0A 4FLOA 2BHUA 4RE4A 5D4YA 3NSNA 1E4MM 3EDJA 4CVWA 3CUIA 4PBGA 5BRPA 2W92A 4HZ6A 2ZWYA 5LA0A 2QLYA 4UFIA 3AYRA 3BC9A 4PMZA 5FD0A 1WCGA 1CXLA 1R7OA 2WKLA 3BH4A 1ZS2A 3LPPA 3POHA 1K9FA 3M7SA 4U33A 3ZSSA 1GORA 1UZ1A 4MB4A 4MJ2A 4M8UA 5CQ1A 2VX7A 5HOSA 2XGBA 2WVTA 4YHGA 4LYPA 2BY0A 1UWUA 5A2BA 3PTMA 3PZTA 3GM8A 2XSAA 2QPSA 1CGYA 5DT7A 1MW2A 2DT3A 4KH2A 1EA9C 4PUEA 2OYLA 4MNMA 3VO0A 1MFUA 2BVTA 3S2CA 2FGZA 1LJYA 3MU7A 3U5UA 1GPFA 4P8XA 4ATLA 1E6XM 1OGBA 2XWDA 4TVDA 1V0LA 4H04A 1J10A 1QHPA 2DSZA 2ZICA 1CXHA 3WDPP 2WXDM 3T2QA 1DWHM 1LQ0A 1ZJBA 5DFAA 1E55A 1L8NA 2PWGA 1HT6A 1VRXA 1Q6GA 3ZR6A 1VFFA 1XYFA 1OGGA 2WPGA 4AXNA 1TE1A 1KQZA 1UD2A 4AY1A 3I3DA 1OBAA 4IPNB 1E6ZA 5CXPA 1CXKA 2D2OA 3U7VA 1XYZA 2VT0A 3NSXA 3O2LA 1RH9A 5A6JA 3A3HA 5CGMA 1E6PA 2YOCA 4NI3A 4ZXOA 3VX1A 1HL9A 3DHUA 3WH6A 3WNNA 2DT2A 4AD2A 2X2YA 3TTYA 1BAGA 4EANA 1DEDA 3MUIA 4CCCA 2BXZA 1MFVA 3WL0A 3LMYA 4U5KA 4TTUA 2WZIA 3CIVA 4PTWA 4PN2A 2PI6A 3AIEA 1K9TA 4RE3A 2NT1A 4W5ZA 4CN4A 1JYVA 1JNEA 2YL5A 3BSHA 1FH8A 1HKJA 2J74A 3KE0A 4KRTA 5BWFA 2YA0A 5E0CA 2BNJA 1GNXA 3POCA 1KCKA 1V6UA 3L2MA 3A4WA 2ZX6A 3GXIA 2JEQA 1PJ9A 2JIWA 3GNRA 1HKMA 3RPMA 1BG4A 3W81A 3SCNA 2BY1A 1E5NA 3WIJA 2X0YA 4V28A 3B9DA 2VMFA 3B9AA 1HIZA 2J78A 1JDAA 2XFYA 4FK9A 4CD7A 4H8HA 5CGTA 5A94A 3T0BA 4K68A 4D6JA 3ARZA 2JE8A 4W85A 2XM1A 3U7BA 3MKKA 1H11A 4A3YA 1NOFA 3N18A 1XV8A 4CU6A 2RGLA 3WDQA 5C8BB 1LLOA 1QI0A 4OUEA 3WH9A 3K8LA 4XZWA 3SURA 1KXTA 3BXWA 4ZFMA 5C71A 1I75A 3GNOA 4U5IA 1I1XA 1CEOA 1NWTA 2ZXDA 3WD1A 1VBRA 1EH9A 3N9KA 2VCAA 3GH4A 1UQYA 1JF5A 1X6NA 2XFRA 4UQDA 4UOZA 4D72A 1BYBA 1WZLA 2YL6A 4F79A 4XUYA 3A47A 3WF3A 1O6IA 2E3ZA 3UR7A 1GVYA 3UEQA 4WIWA 1GOWA 1D7FA 3VM5A 4GKLA 4CD6A 1UA3A 3BGAA 4HA1A 5CZKA 4Z2KA 4B9ZA 3WD4A 2GJXA 1LWHA 1U33A 3CTTA 1KXQA 3VGDA 4HP5A 2C0HA 5CLWA 1J01A 3L2LA 4WSJA 2F2HA 3F5LA 1JYNA 4DM2A 5ABHA 1C90A 4Z2JA 1C8QA 4J7RA 3WDJA 1ZBKA 5I78A 4M29A 1TZ7A 3WUBA 2GK1A 3WD3A 1C93A 2BFGA 1KXVA 5CG0A 4JZ5A 2XVGA 4JL1A 1K6AA 2CERA 4AD4A 2A3CA 1WB0A 2WVVB 1CIUA 4LGXA 4UQCA 7A3HA 2VR4A 2TAAA 3QOMA 1B31A 2D0HA 3FN9A 4QFUA 3ZT5A 2VZSA 4J3VA 1KGXA 3SIMA 3ZMRA 1UD6A 2QHAA 3OBAA 4AIOA 3VIGA 3EDKA 3VIPA 1XCXA 1UHVA 1LL6A 3ZM8A 3WF0A 3WNPA 5BROA 5IFPA 1EDTA 1ISXA 1OWQA 5JIWA 1VAHA 3QOKA 2Y24A 2J7EA 2G41A 2JFEX 2WCSA 1UD5A 1JZ6A 1B3XA 3VGGA 3HMCA 4J28A 3VDBA 1OT1A 1Q6EA 3ARUA 1FOBA 2V3EA 4W89A 1QVBA 4LYQA 1ODZA 3GH5A 4QCFA 1E6QM 3PZGA 1JFHA 2VNCA 2WC4A 4AZ7A 3VIJA 2VVSA 4UOQA 1WKYA 3FY1A 2PWFA 3GBEA 3IJ7A 3PZ9A 3TTQA 3BMWA 2ZXQA 3W82A 2FHFA 4PMYA 5BXTA 1CGVA 3T09A 1GW1A 1WZAA 1H0IA 1E4IA 3DYOA 1V0NA 4QDMA 4MAZA 4GZJA 2ZUSA 1CXFA 2XIIA 4X0NA 1EO5A 1P6WA 1TMQA 2WK2A 3CMGA 3EMZA 3MANA 3EYPA 2WYSA 2DGAA 3G6LA 1CXIA 2ZUVA 4KGLA 4AW7A 5IHSA 2DSUA 1ZB5A 2AMGA 3FW6A 3W24A 1HL8A 1DWGM 2C8NA 3OB8A 4NF7A 4NRRA 2Q8XA 3OGSA 5LA1A 3W53A 1V3IA 3BLPX 5F7UA 2CBJA 4PMNA 1F4AA 2WMIB 2VC9A 1UOKA 5GNXA 1NWSA 2PB1A 4UOJA 2D3NA 1V03A 2CEQA 2EPNA 3II1A 1SR0A 1JXKA 3OGVA 2YDQA 1V6VA 3U57A 1WZMA 4OBSA 1OIMA 1UH2A 3RM8A 3UETA 1JD7A 1JL8A 3AQUA 2CBIA 5D9NA 1ISZA 2E9BA 4JKMA 4DUVA 1E6RA 2XUCA 1GQLA 1W9BM 5CPTA 4MB5A 3NDZA 4U2ZA 5CSYA 1BTCA 1HF6A 1EIBA 1PAMA 5I2UA 1KR0A 1J0KA 4ZXLA 1JYXA 4TX6A 3CMJA 3ARSA 2E4TA 4PRWA 4B15A 1UZ4A 2V3DA 1NH6A 3WN6A 2Y2WA 1DHKA 1W1PA 3AMDA 3MMWA 2X8RA 3VIOA 3WNOA 1CLXA 4OOZA 1GCYA 3WF4A 2WB5A 4W8BA 5I24A 4UFHA 4PMVA 4MDOA 3FAWA 1VBUA 1BFNA 3HN3A 1U2YA 4AISA 1EQPA 2XWEA 2DIJA 3IK2A 3K46A 2CHOA 3TP4A 3W25A 4JHOA 5HXMA 4N0RA 3VMOA 5A8OA 2YBTA 1H41A 2EXOA 4F8XA 3S6TA 2WVUA 3WNMA 9CGTA 4AWEA 3ALFA 1AQ0A 1HP4A 1V08A 1HXJA 1BHGA 3PN8A 2VTFA 3CHEA 3SCWA 4AZBA 4AD3A 1QI3A 4J3SA 5A6KA 4UQAA 1MVYA 5FOOA 4W88A 2GJPA 1OD8A 2QMKA 3MSGA 1WDSA 2YJQA 5FL0A 1VFMA 3APGA 2C7FA 1PZ2A 2J79A 3WENA 1HN1A 1UR2A 3O9NA 1W1VA 4PUDA 4AD5A 1E3XA 4U3CA 1JXJA 1J9YA 2J25A 2W63A 4C7GA 4AEFA 2WMGA 4AMCA 4R5EA 1Q6CA 4XV0A 4W7WA 4PMRA 3TA9A 3SCRA 5D8ZA 3AHZA 4GQQA 3QHMA 3SEPA 4LYRA 1QBAA 1QNRA 5A8QA 4GO9A 4C7FA 3PZQA 2W62A 4MNKA 4ACZA 1PX8A 1QNPA 1S46A 3AIUA 1W2PA 1B3WA 2WBGA 4PCSA 1X6LA 3K4AA 4P7OA 4D6EA 1QNSA 4J27A 1B90A 4UFMA 3EMQA 1V0MA 1UQZA 4F9DA 3F5KA 2XHYA 5LYRA 4EKJA 5HDRA 4DWSA 2V3FA 2OWCA 3CHCA 3WY1A 1CZ1A 1CTNA 1UUQA 2HISA 1RPKA 3AFBA 4KWUA 3IJ9A 1HJUA 4W84A 2WHJA 4E2OA 1HP5A 1NWUA 2JF6A 2E9LA 1LG2A 1ISYA 3K8KA 3WUFA 3TTSA 1J11A 1J0JA 3W38A 4J3XA 1R87A 2OSWA 1TUXA 5AYIA 3OZOA 3QR3A 3WQVA 3NUKA 2WW5A 3VDHA 2WM0A 3AZTA 3RILA 2DEPA 1KFWA 3ZO9A 1DWFM 1DWJM 5ABEA 2VX6A 2OSXA 1CENA 2J4GA 3EMCA 5I3DA 1M04A 2E40A 2XG9A 2V38A 5A3HA 1OSEA 4M82A 1IZKA 3DC0A 1DWAM 2VQUA 3GXDA 3BAJA 3OIHA 1V3HA 4H7VA 4PMDA 1HVQA 2IUZA 3ZJ8A 5HPOA 1HNYA 4D6HA 1V6YA 3F4VA 1K9DA 4CN6A 4TVCA 1BVNP 1CDGA 3WDHA 1UA7A 2E8ZA 3VIHA 4Z2GA 4AZ6A 4A4AA 3RJYA 4KRUA 3NSMA 3VILA 1JGIA 2CBUA 1J0ZA 5TD4A 1E1FA 4MPKA 3MS8A 3SUTA 4GPNA 5A6MA 2D24A 2J7DA 4BZYA 4AC1X 4MNLA 1GZJA 1US3A 2XJ7A 4JFWA 2Y4SA 3NDYA 3W6MA 4E8DA 4HMDA 4W7UA 1JI1A 3WMSA 3DYPA 3KEHA 2V3GA 3VD5A 4UQBA 1SFSA 1R7AA 3SUSA 4D6CA 3MSDA 3VGBA 1QW9A 2OWWA 4M80A 2EPOA 2O9PA 3AZSA 4WKAA 2VJXA 2JEPA 4MAVA 1M03A 2OLHA 2WMJA 2ZIDA 2VRQA 4FLSA 4WLCA 5CPQA 4GXPA 2ZUMA 1UR1A 1EHNA 4Q22A 4MDPA 1O7AA 2ZUWA 1B3YA 2CPUA 1B3VA 1HJSA 1WAWA 1NQ6A 4JFVA 1E73M 1KWKA 1LL7A 2WZEA 3VINA 1W3LA 1EQCA 4P8WA 4CN1A 1NP0A 4GQRA 2CKSA 2G3JA 4V27A 3W29A 3MMDA 4AZIA 3PZNA 4S3KA 4X9YA 4IUGA 6A3HA 1YQ2A 2XSBA 2WC7A 3AHYA 2X1IA 1TVNA 3SUWA 1JZ8A 5KZ6A 4LX4A 1CBGA 4PCTA 3PZOA 4ZENA 1DTUA 4YPJA 1HJXA 1FP9A 4TXEA 3WUGA 5LA2A 2FH8A 2GDUA 4JCMA 3ARQA 1IT0A 2E8YA 3AIQA 4PTVA 1LL4A 3WUEA 4TTGA 2ZWZA 4NRSA 2CHNA 4UFLA 1JZ4A 1E0XA 3WFLA 2YLAA 2J75A 1E0VA 3VM7A 2OWXA 4P7RA 1ZJAA 4L4PA 3AHXA 2DSVA 1VFUA 1WO2A 4ZE5A 3CZEA 4JFSA 2CKRA 1UWTA 1QW8A 2E9MA 3WH5A 3N1AA 3WDRA 4CCDA 4JAWA 1Q6FA 5GPRA 3WEOA 3WNLA 4P7LA 4UNIA 2YL8A 2YBUA 4GO8A 5E70A 1TA3A 3WNKA 3OGRA 2ZX8A 2Y8KA 3OZPA 1AVAA 1QNOA 1ZU8A 2FH6A 1E43A 3RO8A 3AS3A 4MB3A 2VRKA 1BYAA 4MB1A 1GUVA 1C92A 4RE2A 1H4PA 4UFKA 4P7NA 2FHBA 5EB8A 4FLQA 3NIYA 5A8MA 1E9LA 1V3LA 3CZLA 3LPFA 2J77A 1UKTA 4KMQA 6TAAA 1AQHA 2YDSA 1E4LA 1RP8A 4ATWA 1TCMA 2MANA 3CUJA 2BVYA 3PBGA 4M81A 1WPCA 2CBVA 2Z1KA 5E0FA 4JKKA 1TVPA 2WSPA 2WSKA 5ECUA 5GNZA 2XTKA 3AS1A 4WSKA 2DSWA 2DT1A 2WVVA 2V5CA 4HMCA 5A6BD 2BY3A 2FGLA 1TG7A 1EOMA 3L4XA 2VO5A 2WLZA 1XSIA 1L0PA 2BV9A 4U31A 3OLEA 4W87A 1V3JA 1VEPA 5AC5A 3BSGA 3RCNA 1DP0A 3AJ7A 1NM9A 3GXMA 1E3ZA 2JALA 5D9OA 3ZOAA 3ARRA 2WBKA 4TVUA 4QLJA 3QHOA 1QHZA 3ECQA 2WC3A 4GI6A 4D6IA 1W91A 1FH7A 1JZ5A 2BHZA 2EO7A 4V2XA 4ZE4A 4D6FA 3KWXA 2J7BA 1QI5A 1KCLA 1PIGA 2CYGA 4WKHA 2IXVA 2UY3A 4HZ8A 2J62A 6CGTA 1PX3A 2NT0A 1G0CA 5GNYA 1CGTA 4CUCA 3L4TA 4TOQA 3VD4A 4AEEA 3SCTA 5AY7A 4QLLA 3QHNA 4OBRA 4GIAA 3VDAA 3PZVA 1UKPA 3CGTA 4GI8A 3J7HA 2VVNA 7CGTA 3WQ8A 5I6SA 2WHKA 1GOKA 5BCAA 3ZT7A 3ZJ6A 4QAWA 1WNOA 4J3WA 3WL1A 3FAXA 1WDQA 3L4YA 2VRJA 2VZTA 3WMCA 3AS0A 1ZBCA 4QLKA 3VGHA 3MMUA 3MUY1 2WHMA 3EDDA 1ZBVA 2PWHA 1V02E 3VD9A 2YDRA 3VMNA 3PTQA 3N12A 2GJXB 3D5HA 1G5AA 3AOFA 1IV8A 2D23A 4LXFA 2GJRA 4UQEA 4W7VA 3AS2A 2PBOA 3VIKA 4DUXA 3ARYA 2DH3A 2W61A 2WANA 4J3TA 3KZSA 1UR4A 3BAIA 3WELA 4AD1A 1HVXA 4MTVA 1PEZA 2UY4A 5HNNA 3AXIA 4CD4A 2CIPA 1XD1A 2DQXA 3VMPA 3CPUA 4TX8A 2FHCA 5CJ5A 1C7TA 2J8FA 5D9PA 3UG5A 4CVUA 2PWEA 3CBWA 2DT0A 1WE5A 4AYSA 4EAMA 3PHAA 1V3KA 5A8PA 5E09A 4JKLA 3WF2A 1F4HA 1UWIA 2PC8A 2J8GA 3ARWA 2GUYA 3N17A 1C3FA 2G3IA 1UD3A 1E40A 3LPOA 3VDCA 1C7SA 5CPSA 5BXPA 2WCAA 4P8VA 2XYLA 3CH9A 1HKIA 1VENA 2WNWA 1HJQA 1ITXA 4H2CA 1KWGA 3L4UA 2BXYA 3AIBA 4HU8A 2XVPA 2D3LA 1MWOA 2GSJA 3GH7A 1CECA 1UR9A 3AYSA 3UG3A 4B3KA 1ISVA 2VCCA 3QGVA 2X09A 2X0HA 2D0FA 4HMEA 4Z2HA 2NSXA 1JDDA 5CSUA 1LWJA 3ZQ9A 5FL1A 4MADA 2YKKA 1R85A 1Y7VA 1JNDA 3TOPA 1XC6A 2WMHA 1NOWA 1M7XA 2CCRA 3FHAA 3BAKA 1E5JA 2OYMA 3BCFA 1UD4A 1GJUA 2F61A 3VOCA 1ODUA 3ARVA 3WQ4A 3VKKA 3HU7A 4LQ1A 3TONA 3SUUA 3N13A 5EFFA 4UCFA 2XPKA 1LG1A 3L4VA 3ZT6A 1XHGA 1QI4A 3VD7A 3NJ3A 4AIUA 2J7GA 1NP2A 5DMYA 4DM1A 5A95A 1EHAA 1GOQA 5A1AA 1SMAA 3RJXA 3WD2A 4H8UA 2YL9A 4S3JA 4HOZA 5E9AA 3SCUA 4GZIA 1OD0A 1PIFA 3VX0A 4URIA 1BYCA 3WD0A 2CNCA 1VIWA 3RIKA 2J47A 5I79A 2D0GA 2XGIA 1GHRA 1E6SM 2WZHA 2O92A 3AZRA 4PMXA 1TA3B 5M5DA 1EGZA 1E70M 2QF8A 5A6BA 1JF6A 4B3LA 1VJZA 2G3MA 3W0KA 1VJSA 1U30A 2DH2A 4ATDA 3K8MA 1W9VA 4W5UA 1XCWA 3K1DA 1AQMA 5DEZA 4QCEA 7TAAA 2WMKA 4W8AA 5D9MA 1CXEA 1GVIA 5E6YA 3T0DA 2WMFA 3SCOA 3AMKA 1EDGA 1E1EA 4H41A 4Z2IA 1LF1A 1N82A 1FHLA 5CLTA 4XB3A 1W1YA 1FP8A 4PMUA 4BQ3A 1XSKA 3W6LA 2EPKX 3CZGA 2FDMA 2W91A 2IXUA 2XVKA 5JBFA 1XH2A 4OJYA 1BGGA 2WVSA 3W26A 3T08A 4CD8A 4QP0A 3GXFA 3VIIA 4RL3A 2XVLA 3A4XA 3UG4A 5ABGA 4GINA 1GJWA 3WSUA 3IANA 1GONA 4X0VA 1E72M 3FHQA 5KEZA 2WWDA 1CGXA 3CUGA 3JUGA 2BVDA 1FFQA 1BF2A 1EXPA 5A2CA 3WF1A 3WFZA 4CGTA 3WQ5A 1JFXA 4HOWA 1D2KA 4M24A 3BAWA 3B9EA 4CCEA 4C7DA 1UKQA 5ABFB 1W9XA 3L4ZA 3VTRA 3OA5A 4BQ4A 3CLWA 2VX4A 3FNDA 2PWDA 1H3GA 2W5FA 3VIFA 3M46A 3WH7A 2QMJA 2ZUUA 4UFJA 3BMVA 2E0PA 1C8XA 3MO4A 3WQ6A 3AISA 4L4OA 2BY2A 1OGSA 3AMLA 3WDIA 2VUYA 2O9RA 3AHTA 1BQCA 1V6XA 2ZXBA 3VNZA 1KBKA 4BQ2A 1R8LA 4E4PA 5I0DA 4WF7A 3SCPA 4AZCB 3DYMA 3DHPA 1CWYA 2WMIA 4UTFA 1H2JA 3EBVA 1TR1A 2EJ1A 2WCGA 1WP6A 5DO8A 4YN5A 5IFTA 4OIFA 4YHEA 2J7FA 1JAEA 1W3HA 4IPLA 3SCSA 1H1NA 3OG2A 1CPUA 1GQIA 1XGZA 3WBAA 2J7HA 3THDA 1CLVA 1OIFA 1OT2A 3WMBA 2W4XA 2X05A 1UYQA 4AZ5A 3AIWA 1ECEA 2YA2A 5A6AA 4JHZA 1KBBA 1V3MA 2G3NA 2YA1A 3AHVA 5IXEA 4AZCA 3VD3A 5AC4A 1OCQA 3WQWA 2XIBA 1KB3A 4DWSC 2F8QA 1W1TA 3G6MA 1FA2A 3K4DA 4H8VA 1VEMA 3RDKA 1B1YA 2G8ZA 4BF7A 1E15A 3I3EA 3BLKA 1ZBWA 1H5VA 4CD5A 5DT5A 3VPLA 2GK1B 1M53A 1B30A 2PBGA 3VIMA 2VL4A 2GDVA 2G4FA 3WKZA 4TUFA 1ESWA 1UG6A 4Y7EA 1H09A 1MXGA 4AZHA 3PZIA 4D1JA 1M01A 1B3ZA 5D8WA 4PMOA 1QBBA 2XVNA 1WDPA 4F66A 1C8YA 2Y8VA 2O9TA 4IM4A 2J7CA 4U3AA 1FHDA 3AMGA 3AROA 3E1F1 4PYSA 4EK7A 3WBEA 1JI2A 4FMVA 4JFTA 5EMYA 1G94A 3OLIA 2CXGA 1BPLB 1SMDA 1HJVA 3A4AA 1NOUA 5A6SA 2VR5A 4W86A 4ACZB 3D3AA 3EDFA 3CZ8A 3BAYA 4BS0A 1CYGA 1RP9A 5IHRA 3RM4A 2YLLA 3CO4A 3TTOA 2AAAA 4PTMA 4D6GA 3HJEA 3KL0A 4HPHA 4Z2LA 1CNVA 2DIEA 1UKSA 3L4WA 2WAGA 5A8NA 2VI0A 3LPGA 1VB9A 5M17A 3F5JA 4OZOA 3GZAA 4W93A 5AYBA 5JBDA 1OINA 1Z32X 2A3BA 1GOMA 2D22A 1JAKA 4D6DA 5BYWA 1JZ2A 3UERA 1MQPA 1BYDA 4UR9A 4AD0A 1US2A 4UZSA 4OKDA 1Q6DA 1A47A 1J0HA 4Q7NA 1JIBA 3BCDA 2ZUNA 1A3HA 5A69A 2V5DA 3RMEA 4PMQA 8A3HA 4P8UA 2A3HA 4R27A 2A3EA 3SUVA 2DPEA 1NWRA 1XRVA 4HA3A 3FXYA 1MW3A 3EDEA 2WLYA 1JYWA 4IISA 2OYKA 1UH3A 3VGEA 4WJXA 3T2OA 4JFUA 3CHFA 2ZX9A 3A6OA 2GFTA 1UR0A 3BAXA 1GOIA 3AIVA 1QOXA 1G1YA 3CZKA 5M3WA 1J12A 3N04A 2ZX5A 4CKQA 1BSIA 1W2VA 1JZ3A 3U5YA 1VF8A 1W9PA 3ARPA 2QV4A 3SCVA 4ZEPA 4WKFA 1E71M 2EPMX 2D20A 2ZUTA 5HBFA 1YHTA 3MUAA 1J0IA 1E0WA 2W66A 1QHOA 5A6LA 4D1IA 5FIPA 1SYTA 3O6AA 1DWIM 3AXXA 4F9JA 4PSPA 1EO7A 4CU8A 3WEMA 2ESCA 1W9UA 3MV01 2XM2A 4AIEA 2VOTA 1KQYA 1J18A 1E6NA 1B0IA 1W9DM 2NW0A 1R86A 2VZVA 1KGUA 1HJWA 2EEXA 5EBAA 4U2YA 4BCEA 1MXDA 2VZOA 1EDQA 4FF5A 1JG9A 1BG9A 2O9OA 4FLRA 1JD9A 4DWSB 1MQRA 1D3CA 1XSJA 1ITCA 4M1RA 2JIEA 2VQTA 1KGWA 1QI2A 4UZUA 5A2AA 3ARXA 1JDCA 1BLIA 2VX5A 4DUWA 1J0YA 3VU2A 1XH0A 3MUZ1 4DWSD 4GZEA 4HTYA 1MW0A 1C91A 5C70A 1HX0A 1UH4A 2EBNA 1IZJA 5JUVA 5I77A 1OB0A 4HOXA 2WHLA 4JIEA 4MNJA 3AMCA 2XFFA 3IJ8A 1PZ3A 5EFDA 3CUFA 1EOKA 3AICA 1XD0A 4B16A 3GYCA 3ARTA 3MV11 4OOUA 1MYRA 1KR1A 1PBGA 3I3BA 3VNYA 3B8SA 2YIHA 3DECA 3KL5A 4HA4A 1GQKA 1VEOA 2Y5EA 4ML4A 5BXSA 4KGJA 3KL3A 1OM0A 4N42A 2UY2A 3UCQA 1K9EA 4NZCA 3CZJA 1NARA 5I23A 1XH1A 2UY5A 2BHYA 4WK9A 2DSKA 4BA0A 2CESA 1X1NA 5FKYA 1Q4NX 4UQ9A 2D1ZA 5BRQA 2CETA 1FH9A 1VFOA 2AOSA 1B9ZA 2EPLX 4MJ4A 3GNPA 1E56A 5ABFA 2WKGA 4M56A 3ZIZA 2BS9A 4XX6A 3W37A 3ZJ7A 2ZXAA 3UR8A 1UKOA 3VGFA 5BXRA 3GDBA 4LPCA 3W4RA 2PF0A 1B2YA 2ZOXA 1UWSA 2JF7A 2ZE0A 2EQDA 4HU0A 4AZGA 5E6ZA 1CGUA 5HPCA 4ACYA 1W3JA 1UD8A 2OSYA 5M03A 1V0KA 1ZL1A 3IAPA 5IDIA 1RD6A 3IAQA 1BVZA 2GVYA 3ZSTA 2VZUA 3PTKA 3SCQA 3OLDA 1G01A 1QPKA 1GOOA 2CITA 4BQ5A 1MW1A 1G9HA 3GBDA 4JL2A 5GQBA 3VVGA 3PZUA 3VUPA 3CHDA 3ALGA 4NSBA 2Z1SA 1WDRA 1H0GA 3M07A 1W32A 3M6DA 1FFRA 1CGWA 3T2PA 3AXHA 1PPIA 1UR8A 4GI9A 5I5RA 4PEEA 2A3AA 2ZX7A 1E4NA 1V02A 2RGMA 4P7QA 2WWCA 3THCA 3ZR5A 2QPUA 3T0AA 3W28A 3CUHA 4EE9A 1PX4A 2W67A 1HKKA 3AIRA 4B9YA 1BGAA 2DDXA 4PSRA 1UWRA 4CU7A 4HZ7A 5JIPA 3RM9A 3WH8A 4D71A 1KXHA 2VURA 3W27A 1V6WA 3GTNA 1I1WA 3N15A 5FCZA 3UESA 3N11A 3ZJKA 1JZ7A 1AMYA 1W3KA 4PTXA 1H49A 4XZBA 3OLGA 4A3HA 3WEZA 4HPGA 3NCOA 3NYDA
chains in the Genus database with same CATH superfamily
2FZ8A 1K4HA 3NPWA 1TFVA 1GEQA 1UWQA 2HVMA 1OF8A 3W70A 4E5TA 4DBUA 1JPHA 2VCBA 2HVNA 1ISWA 3HB9A 1MO0A 4DYJA 1GQJA 3T0TA 3DFSA 1WZKA 4WDXA 1KCXA 3AI0A 1PL9A 2Z27A 1Q3NA 4FLOA 3LM3A 4RE4A 4N4QA 4NYYA 3EDJA 3CUIA 3EX3A 5BRPA 5T26A 3EOSA 2QLYA 2WPBA 1S38A 3VABA 1ONEA 3O16A 4G7EB 1GJPA 5I3KA 1R7OA 3S1GA 1UZHA 1ZS2A 1UUOA 1OYAA 2OKTA 3POHA 3DU0A 5D2TA 3KTXA 2TSYA 4U33A 4S1FA 4Q32A 3GIYA 1WBJA 5CQ1A 1DBTA 2V63A 2XGBA 4Q7BA 3S0CA 4YHGA 1EKOA 3VDGA 3R6IA 4X60A 1F07A 4RR4A 4C6OA 1FWAC 1EA9C 4K7VA 4PUEA 4FF7A 3GAYA 4MNMA 2BVTA 1AK5A 1EL3A 3IUIA 1VP5A 4ATLA 3VZXA 4QSFA 1LCOA 1K03A 1XYBA 1XYMA 1T8XA 1TMHA 4AG0A 1CXHA 4GKTA 3WDPP 4FS9A 3T2QA 1DWHM 1V5XA 1UP0A 3OW1A 1VRXA 2GGHA 1M5WA 3NYZA 1F76A 1PYMA 1TE1A 3HPXA 2QVHA 4KF1A 1SJBA 2IW0A 1A5MC 6TIMA 1CXKA 4HCHA 2VT0A 5AKQA 1BXNA 4CQAA 5A6JA 1E6PA 2YOCA 3FXGA 1M1BA 1N8IA 2J27A 2R91A 4FP1A 3WH6A 4JQ2A 1J93A 2Q71A 4ZVJA 2HPMA 3NZQA 2ISVA 4HYVA 4A05A 4HD5A 4MPQA 5JVLA 3MUIA 3WL0A 1TVLA 2PDKA 1OFPA 5D2XA 3CIVA 2NQHA 3CH0A 4LJ3A 4CN4A 4W5ZA 1JUBA 4PUMA 2YL5A 3BSHA 4R7WA 1TPWA 1FH8A 1PB0A 1UMYA 1F8IA 3KE0A 2O55A 3D0CA 5E0CA 1TV2A 1S5NA 3KRSA 4H2HA 1YNPA 4QG9A 3SY5A 1KCKA 5CPOA 3TSMA 4O11A 3GXIA 1F8MA 5KITA 3GNRA 4QTGA 2PDWA 3DFNA 3E74A 3KBJA 4IJBA 3DXIA 4QS6A 1E5NA 1SQ7A 2R24A 1H50A 2X0YA 3N4EA 2VMFA 3JRKA 5KMYA 2J78A 2XFYA 4IJCA 4H8HA 2IPJA 3T0BA 4K68A 3NPXA 3B8VA 4A3YA 1TV5A 4OUEA 3EWDA 1IWBA 3WH9A 3M41A 3W1UA 1T0OA 1KXTA 4ZFMA 3CAKA 1XIFA 3E3HA 1NWTA 3HFTA 1IEXA 1EH9A 3OODA 4KT2A 3GH4A 4MJMA 3PP7A 4UQDA 3B0XA 1K3UA 5EY5A 1SZGA 3WG6A 4I9MA 4EPEC 1AH3A 2E3ZA 3K1GA 3S5NA 1GVYA 3KAOA 2H6RA 4GKLA 4ZQRA 3VOHA 1NDWA 1GG1A 1HZYA 3CTTA 4HP5A 3B9NA 3P62A 1JYNA 3GVGA 3NQDA 5E1QA 4BI5A 1ZBKA 5I78A 4M29A 4Y9MA 4C1KA 1KM5A 2TRSA 1AW1A 4S3BA 3OYXA 4I6KA 4Z42C 4DZIA 3TX9A 4M1BA 4JZ5A 2INEA 2TMDA 4C6MA 5B7ZA 1WB0A 2PLMA 1VIZA 4LGXA 3ANUA 2WSQA 3THUA 1VLWA 2TAAA 3FCPA 3PJWA 4LOCA 2HTMA 2VZSA 2YB4A 3IACA 1TZ9A 2FYMA 3R0DA 1KGXA 3SIMA 2QHAA 5CG7A 4AIOA 3HOJA 3TQ0A 3UZ5A 1XCXA 3QPEA 2HRWA 1F7BA 2QUMA 3UPWA 3FKKA 2A0NA 2GSEA 3E0FA 5J04A 1ISXA 5DRIA 3ABXA 4GVGA 4OV9A 2Y24A 5CAKA 3PAOA 1EWDA 2G41A 2JFEX 1I0DA 3W2LA 3C56A 1JZ6A 1KKOA 3TW9A 1AQFA 3LBMA 2R82A 3IJDA 4G7EA 4IMAA 4D8AA 2V3EA 4LYQA 3GH5A 4NL1A 4L4MA 1E6QM 1DVJA 3OZYA 3OHIA 1OFQA 4FA3A 2WC4A 3CEPA 1SZEA 5CH9A 2PWFA 4WUIA 3PZ9A 5LGZA 2QR6A 2WJEA 2ZXQA 2IS7A 2R8WA 5BXTA 5EKYA 1WZAA 4UTMA 1E4IA 2FZ9A 5C7VA 5K7JA 3GXTA 2VFGA 3CV2A 2E5DA 3BV4A 3DFOA 4UR8A 3CMGA 4DJEA 1VFTA 3BICA 1MRQA 2A85A 2QQ6A 4JNMA 3FDKA 3FW6A 1EJUC 3NVTA 1DWGM 2EG7A 5LGXA 1AL8A 2PTZA 4TV5A 3PSWA 4PMNA 3E0VA 3LLDA 2VC9A 1UOKA 2NXGA 5GNXA 2X1RA 5EBUA 4UOJA 5FSDC 2EPNA 4IMGA 1SR0A 1EZ2A 3BJSA 4HCDA 4K37A 4NUWA 2WJDA 4AF0A 3LCWA 2PMQA 3BUVA 2HWGA 2WSRA 3HGSA 2PDFA 2A1YA 3SN1A 1JD7A 5C55A 2DZUA 2CBIA 2FVMA 1AODA 4Q8OA 2ADAA 2E9BA 4DUVA 1GQLA 2HK0A 3RG6A 4MB5A 4O16A 4U2ZA 3MQTA 1EIBA 4EF9A 1JYXA 3QW3A 3ARSA 2E4TA 4I7WA 5CCZA 3SY8A 5I3IA 2HXUA 5H6HA 1NH6A 2BGQA 2NUYA 4HYWA 1DHKA 3AMDA 3ABOA 4EWJA 3VIOA 4JTAA 1CLXA 5A8GA 4LUTB 3WF4A 4W8BA 5BOOA 1XBXA 3PBWA 2O0TA 1VBUA 2YYTA 1Q63A 5C54A 1BFNA 3HN3A 2OODA 1JGMA 1U2YA 3GDTA 2NXIA 1KFBA 3NM3A 1EQPA 3M0XA 4B4FA 2C18A 1YMYA 2QCGA 3UXLA 2CW6A 5CPLA 3F4DA 1O94A 1BQGA 4C6QA 3B9OA 1HO4A 5F2IA 5A8OA 1VCFA 4JTIA 9CGTA 4AWEA 1EX5A 4GYPA 3ALFA 1HP4A 1YDOA 1K02A 3I4KA 1V08A 4LUYA 4PCNA 2PODA 3SCWA 1JQVA 3G77A 3QV8A 3QC3A 5FOOA 5C9WA 3MTWA 5D33A 3HGOA 2PU0A 2YJQA 4F0KA 3APGA 3ITVA 1B3OA 2J79A 4ZODA 1UR2A 1W1VA 3PG8A 1E3XA 3VXGA 4U3CA 4A22A 1O68A 4HNCA 4AMCA 3CAQA 4YL2A 4W7WA 3QSRA 1T6MA 2G5WA 3IV3A 3LHYA 4LYRA 2QIIA 3M1ZA 1AD4A 3TMQA 3EB2A 4Y9OA 5LNUA 3NXLA 3K30A 4MNKA 4ACZA 1E1CA 3WQDA 3B0YA 1X6LA 3K4AA 4P7OA 4UCGA 1QNSA 1B90A 4H6RA 3WQOA 1SO4A 2XHYA 1XL9A 4NZ1A 5LYRA 2BP1A 4EKJA 1LBLA 4HHLA 1VHNA 3WQPA 2CZVA 3GKAA 1TX2A 1VFHA 1HJUA 5FF3A 5DRCA 1LLZA 1LROA 1NWUA 4NNCA 3MT1A 1ISYA 3K8KA 3TTSA 1J11A 3W38A 1TUXA 5AYIA 3OZOA 2QEZA 3WQVA 2I5QA 4A3UA 2WW5A 5FACA 3AZTA 3HPSA 4GIEA 1Q2RA 3GR8A 2OEKA 1KFWA 1DWJM 4L56A 3LGGA 5ABEA 3AAMA 3SFWA 5ENLA 4ZQOA 3HTWA 1TWSA 4JN8A 3TYEA 2V38A 5A3HA 2Y7EA 1OSEA 3RXZA 3DC0A 2HBVA 3GXDA 3OIHA 3QXBA 1MMFA 2JKPA 4GFIA 3BWWA 2I14A 5C5YA 1K9DA 2ZC1A 4DAFA 4TVCA 1O5QA 4PTDA 3WDHA 2YZ5A 5HANA 3RJYA 2DZXA 4ILSA 1VQTA 3UG8A 4KRUA 4UBPC 1R3VA 5TBOA 5DCDA 3V7PA 3T7VA 5TD4A 1MEIA 4FOKA 3GTIA 5A6MA 4O14A 2VC7A 3U3HA 3E9AA 3C2EA 4GA8A 1EGMA 2J7DA 4AC1X 3ITGA 4MNLA 4PRRA 1SZFA 1US3A 2Y88A 2EAWA 3NDYA 1ZLPA 5BMXA 2HVOA 3KEHA 1SW7A 3VD5A 4DZ5A 4UQBA 1R7AA 4D6CA 3KOXA 3W1AA 2OWWA 4M80A 2EPOA 4QNWA 3IIXA 4LV9A 3G3MA 1RBOB 4MAVA 1M03A 3E0LA 2WMJA 4TV6A 1ZJHA 4WLCA 2ZUMA 3MI2A 1EHNA 2V2HA 3UW6A 4B2DA 3AO0A 1B3YA 1RBLA 1B3VA 2CPUA 5LIXX 5D04C 4ADSA 2AQOA 1W3LA 1TV3A 4P8WA 4CN1A 3S8HA 1EC9A 4PBFA 4KEUA 2FLIA 2YFNA 1IXNA 3IEBA 2G3JA 3S4TA 2PU1A 4ZSUA 3W29A 1ZCCA 4AZIA 4S3KA 4X9YA 6A3HA 4LRTA 3LDVA 2XSBA 3AHYA 4Z17A 4OHQA 1TVNA 1DJQA 1BWLA 1Q85A 4LX4A 3PZOA 1DTUA 4JIHA 2FGBA 4KPLA 4YPJA 4JX6A 5LA2A 5H8PA 2FH8A 3FA5A 4HA0A 4PTVA 1LL4A 4TTGA 1NTHA 3N73A 2O56A 2GYIA 3W87A 3WFLA 2J75A 1EBGA 4CNPA 1JCLA 2OWXA 4DF2A 2DSVA 4IG2B 2RKXA 4K7YA 1UWTA 3DFYA 5CC3A 4JTKA 2BGSA 2HMCA 3ZLGA 4LCSA 4CCDA 4LB4A 4CCZA 2TPSA 4NX5A 5DMNA 2EG6A 4JAWA 4AWTA 4X63A 5GPRA 3W23A 3WNLA 4P7LA 4UNIA 4YYCA 1YBQB 1TB3A 1I2QA 4N4PA 1E43A 4Z08A 1T96A 1YNQA 4X9SA 4B5NA 1BYAA 1XUUA 1TTIA 3KTSA 4RE2A 5LIKX 2D69A 1W5NA 3A23A 1V4YA 3EWCA 2YDSA 3R25A 3NL6A 1Y5VA 3BG5A 1TCMA 3W7MA 3CUJA 2BVYA 4JEJA 2RAGA 3UWEA 4YXGA 3KCLA 1TVPA 3DHFA 4DJFA 4IMCA 1LRQA 5ECUA 2QJHA 5GNZA 3TUUA 2HEJA 4WSKA 3KM8A 2V5CA 3TWBA 5A6BD 1U1HA 2FGLA 2NQZA 5C2GA 2Z7KA 2WLZA 5LHEA 3T4CA 2O4QA 3OLEA 4W87A 2KAUC 2XIOA 3GXMA 3D46A 4RE0A 4EP8C 1S5WA 3O63A 3N25A 1JPMA 3D6NA 1P0KA 2WBKA 4TVUA 4HNNA 4LF2A 2X40A 1CCWB 4E2BA 1FH7A 3CT2A 3TZNA 1JZ5A 4ZE4A 2R9RA 3W76A 1MI3A 3CO8A 4G8TA 4PR4A 2OB3A 3VKBA 4GJ1A 3K2GA 1NAL1 3LXBA 4YVPA 3N19B 4JX5A 3TJLA 1W1IE 3R8GA 4KCTA 3WK2A 5TQLA 3CWOX 4CUCA 3CAWA 4IFKB 4JEQA 2C79A 4TOQA 3VD4A 2DUXA 1CB2A 5AY7A 4YTQA 2CU0A 4GIAA 3URQA 3J7HA 3QYQA 3UY8A 2VVNA 3AUOA 4J35A 5I6SA 4E3TA 5FEXA 3QTPA 3QH2A 3HIJA 2QJNA 4RUBA 4DO7A 3ZWTA 2RJHA 3DFTA 4JY8A 3WL1A 3ABZA 3FAXA 3TQPA 1WDQA 3O06A 3L4YA 2VZTA 3RLVA 5DBUA 1ZBCA 4GJJA 3CNYA 1K7FA 4F0RA 4F0HA 5EL1A 3VMNA 2MNRA 3D5HA 1XGEA 3KFTA 4W7VA 3BZJA 3VIKA 4O1EA 5HNTA 2I57A 4J3TA 4LUSA 3PY2A 4AD1A 4L6OA 4MTVA 3CTLA 3UZYA 3TXVA 3F7JA 3I7SA 2UY4A 3UP8A 2I1OA 3IRSA 4CD4A 3PFRA 1XD1A 1IEWA 4TX8A 2FHCA 1WXZA 1Y5WA 4I5RA 3HJZA 2DT0A 4H9TA 4EAMA 3R4IA 2ACSA 3KBMA 4JKLA 2PC8A 2J8GA 3ARWA 3PR2A 3UQNA 1TTQA 1RLCL 3IGHX 1RCXB 2JQXA 2Z1WA 2O7QA 1C7SA 1HKIA 1EA0A 4V33A 3H4GA 3L4UA 1XDLA 3GH7A 3HF3A 3AYSA 5BW6A 2GQ9A 4IIDA 4HMEA 3ERPA 2NSXA 5FL1A 3EXSA 2FB3A 3N6JA 4PCPA 1MSSA 1XC6A 2CCRA 3BCFA 4DJDC 2CLKA 4YS1A 2F61A 2LLEA 5FSEC 2GGGA 3WQ4A 3R11A 1YRRA 3HU7A 4LQ1A 5T9BG 2XPKA 1LG1A 5HJXA 4Q8QA 3VD7A 1NP2A 5DBTA 3DHDA 1YE4A 3UCCA 2DV0A 4Q4SA 4FR6A 2QCCA 4S3JA 3USBA 1RZMA 4LC6A 5E9AA 3T40A 4GZIA 2YXOA 2YW4A 4KWSA 3UGVA 3Q67A 3B0PA 1QPOA 4UMCA 2Z2AA 1GPWA 3AZRA 4PMXA 3T55A 4MG4A 1EGZA 5A6BA 3TJIA 7TIMA 4PH6A 4JDYA 1U30A 4UMAA 2DH2A 2VWSA 1W9VA 4MY9A 5CSRA 4QM1A 2V5BA 1AQMA 7TAAA 5BU6A 2ABBA 1CXEA 2CLHA 4RZBA 4GABA 4NY2A 4BI7A 3L67A 1ADDA 3GR4A 3P84A 4YVXA 1YPIA 2GVEA 1X6UA 4O0KA 3M0VA 2XSXA 1JR1A 3UZWA 3MCMA 4R34A 1W1YA 4FX8A 1FP8A 1EYWA 2Z1BA 3UPMA 2EPKX 2WV8A 2W91A 3VAVA 1ICQA 1XH2A 4OJYA 3W7IA 1BGGA 2WVSA 3WO8A 4CD8A 6REQB 2ACUA 3LBOA 3LLXA 5DLCA 2XVLA 3A4XA 1PHQA 1YYAA 1UROA 2OZ0A 3BOLA 4H9ZA 3BOFA 4AF0B 5E93A 1DIKA 2QCDB 1CGXA 9XIMA 4BI6A 4HN8A 3KTCA 1YNYA 2JGQA 2OOFA 3QQ0A 1PV8A 4KEZA 3WFZA 1MDRA 1JFXA 3NQVA 1FVPA 3BAWA 3B9EA 4GE8A 3PJUA 2TYSA 4C7DA 3KCJA 1KA9F 2ICSA 4JNYA 1W9XA 2CHRA 3L4ZA 3VTRA 3OA5A 3CK5A 3VZYA 4XBJA 4R3UA 3BLOA 5CBJA 3VIFA 3PVFA 4ERIA 3OQEA 4QDWA 3M46A 4CQCA 1J79A 2E0PA 3WQ6A 1ZAJA 4L4OA 2BZNA 1RLDA 2E6AA 2WSYA 3HGRA 3KLKA 3AMLA 3WLOA 4V15A 3GYEA 1V6TA 1MUMA 4YWIA 1Q6LA 4EVZA 2DP3A 2YSWA 4E4PA 4QJ4B 4WF7A 4AZCB 3DHPA 2WCGA 2EJ1A 3M0JA 3M7WA 3WQCA 4AVFA 4YHEA 1K1DA 2J7FA 3G1FA 4D8LA 3B8WA 3OO2A 1QXLA 2PRMA 1DJYA 1OT2A 5FJPA 3JZUA 2NXHA 5ABTA 2X05A 1UYQA 2YA2A 1Q65A 2I56A 3MP4A 1V3MA 4BY3A 2YA1A 3K5XA 1TTPA 2ALDA 5CZSA 2VP8A 3VD3A 5AC4A 4HVXA 1OCQA 1KB3A 2PEVA 4ADUA 2BSLA 3P8IA 4JTDA 3MCNA 1FCVA 1U22A 3UT0A 1X97A 2DJXA 1VC4A 1SJDA 1BKHA 3BLKA 3QF0A 1EGVA 3KP0A 4L1GA 3GC2A 3SFKA 2GK1B 1B30A 1FWSA 1KM2A 1W0MA 3NQGA 1FXQA 1MXGA 1B3ZA 5D8WA 4PMOA 2XVNA 3PFMA 2AGTA 2Y8VA 3ATZA 3RU8X 4S2CA 4M5PA 4U3AA 3AROA 3E1F1 2B0MA 3RK8A 1JI2A 3G1XA 1TPDA 5G2IA 3KP1A 3N29A 1HJVA 2VR5A 1S2CA 3EDFA 3CZ8A 5H1WA 3L9CA 3CO4A 3TTOA 4QXIA 4PTMA 3HJEA 3GVQA 1AJ2A 3S5YA 3LTSA 3KL0A 4Z2LA 3S47A 2H9AB 3N14A 4FALA 3O6DA 5A8NA 4B5WA 4WGXA 1VB9A 3S1XA 1TWIA 1XIBA 4HK7A 2WKJA 3DENA 3EKLA 4C91A 3FYOA 1Z32X 3E0IA 3KOFA 4QJ3B 1JAKA 4EXAA 1OVDA 4D6DA 3FA3A 1RK6A 4UR9A 3PG9A 3IJLA 2YXGA 3HV8A 1IXOA 1A47A 2XFWA 1JIBA 4B2DD 1R9YA 2ZUNA 2R14A 3P6LA 1OFBA 3WMLA 2ZADA 3VNKA 1GGOA 2A3EA 3SUVA 2DPEA 3CUZA 4GQ0A 2NVAA 4DLMA 3FXYA 3EDEA 2B81A 1WKEA 4IISA 1FHUA 3CQIA 1VZWA 3T2OA 1N2VA 3LCXA 3CHFA 2QS8A 3A6OA 3VC5A 1XRSA 4G1NA 1M68A 5E0KA 5M3WA 1J12A 4GYKA 2ZX5A 3Q2DA 3QLDA 1NF0A 1JZ3A 5K2ZA 1Z41A 4IF2A 2EPMX 5HBFA 4GVHA 4I90A 1F61A 1E0WA 3QFWA 3DKLA 3ICJA 1QHOA 2C16A 4OT7A 3SRFA 4D1IA 3O6AA 2Y63A 4EWND 1D3GA 4KS0A 1XKYA 3E2SA 4GRSA 1QW7A 1NQKA 4M3PA 2Q02A 4Q6JA 8RUCA 2HNHA 1R86A 4DO5A 3QBUA 4E8GA 2OO6A 2R1PA 3NO5A 4H19A 3L5AA 5HULA 3MUCA 4EPBC 4NAFB 3VFLA 4FLRA 1JD9A 1MQRA 4L65A 3RFAA 2AL1A 3VKCA 1ITCA 2RDTA 3C2RA 3R0KA 2NLIA 3WBWA 4JOMA 1XXXA 1PS9A 3B8TA 1J0YA 3CAVA 3SRHA 5B80A 1C91A 1PKYA 1S2WA 5E5CA 4JIQA 1UH4A 1IIHA 4O0ZA 3WLQA 5I77A 3Q94A 1RK5A 3VI2A 4JIEA 3QJAA 4MNJA 5G5IA 2X16A 5EFDA 3KOWA 4NP7A 2VEGA 4B16A 2DZSA 3ARTA 1X1ZA 1R2RA 1OX6A 3AC0A 3B8SA 2YIHA 3SR7A 4A6GA 3RPTA 3BDKA 4IFRA 4PULA 1B9BA 1R3RA 4ZOCA 3W7HA 2I16A 1K9EA 4NZCA 4E38A 1XH1A 4WK9A 2UY5A 5FF2A 3CYJA 4MUPA 3SADA 4JTHA 3SGUA 3L0KA 4JQ3A 1Q4WA 3F4WA 2C91A 4LUIA 3TN6A 3MHGA 2CETA 1VFOA 2AOSA 1B57A 1E56A 2NLYA 4XWUA 4D9PA 4Q7IA 7REQB 3T07A 2YCLB 3ZJ7A 3V35A 3UR8A 1UKOA 2QJIA 3W73A 1QPNA 4ORIA 4AY7A 3O15A 4NAEB 1GW9A 1KKRA 2E6YA 4AZGA 2EG8A 2EQDA 1W3JA 5HMDA 2OSYA 5M03A 1ZL1A 4ZB5A 5IDIA 1RD6A 5HR6A 3OJGA 3CU2A 3A12A 4UTTC 4MY1A 1YEYA 1G01A 3LHWA 1GOOA 2AKMA 3GS6A 4IP7A 2CITA 3W86A 2E7FA 4IGNA 3CV6A 4JL2A 3W1PA 1YTEA 1FWGC 4XAPA 4LB3A 4ZFCA 3L5MA 2PDIA 4NSBA 2VGGA 2Z1SA 4XZMX 3NQAA 2PDPA 1ADSA 3M6DA 3S6DA 1H7XA 3GY1A 1FFRA 7PTDA 4GI9A 3WJSA 3HZ3A 3UJFA 3CLMA 3BURA 3GWQA 5HNUA 2A3AA 4P7QA 3THCA 1A0EA 3T0AA 3CUHA 3VE9A 2V82A 3MPGA 3V5CA 1HKKA 3AIRA 1UC5A 2DDXA 3H7RA 3OOQA 1PUDA 1K8YA 4HZ7A 3P80A 4NI8A 3LQLA 3RM9A 2VURA 3GTNA 5HJYA 2CLFA 5FCZA 4Y9PA 3R0UA 1R30A 4GH1A 3KVJA 1XX1A 4JTUA 4PTXA 1DQWA 4XZBA 2ZTKA 2NV9A 3WLSA 1M9HA 4GQGA 2YX0A 5HWMA 3V0UA 3NYDA 4DNMA 1FQ0A 3KVKA 4EIVA 3BW3A 2UWFA 3R89A 4ZQMA 5K4XA 2OFJA 1J5SA 5AHEA 3UWVA 1C29A 4J3UA 1JCTA 5F1VA 2QCHA 1MQQA 1DQUA 1E4MM 3GHUA 4CVWA 4HZ6A 3PC0A 4O4VA 4C90A 4UFIA 2G4JA 1P0BA 1VYRA 1WCGA 2XH4A 3R94A 3UXIA 3L0GA 3BH4A 3LPPA 3DOPA 5C6MA 1K9FA 1ADOA 1UZ1A 3BLEA 3EKGA 5HOSA 3UR2A 1VKFA 5A2BA 3ZLFA 3PTMA 3GM8A 2QPSA 1QWKA 4KH2A 1M7OA 3LY0A 3VO0A 1MFUA 2OLSA 3U5UA 2E67A 2BB0A 1GKQA 3W1XA 1E6XM 4MFDA 4LCQA 3W71A 2E6DA 1J10A 4TQTA 1X96A 3THQA 4MWAE 4TMBA 2ZICA 3CASA 4GC3A 2WXDM 3MC5A 1QPRA 3MDUA 1LQ0A 1ZJBA 1T8QA 2PWGA 1XPGA 4RNJA 5CZ0A 3EB3A 2PDHA 1XW8A 4F40A 1OBAA 1J6PA 2QZRA 4IPNB 4HZMA 2CXEA 3PF3A 4DVOA 1G69A 2D2OA 4NVTA 1RBAA 1W5MA 4QIUA 1VRDA 7ODCA 1TWDA 4ZXOA 2A6NA 2NQLA 4POCA 3DHUA 2DT2A 3QY8A 2FVKA 3I4EA 3YPIA 1BAGA 1HW6A 1QRQA 1S2TA 2C13A 3CS2A 3LMYA 4OBTA 3S2JA 3BJTA 2WZIA 4LBRA 5JH1A 1FWWA 2GOUA 3NNTA 5TF0A 1K9TA 5E9XA 2NT1A 3AJXA 3QC0A 4D8ZA 2PDUA 4MLRA 3DI1A 2DVXA 1NF7A 2J74A 5JXQA 5BWFA 2YA0A 1GNXA 4LVDA 4WOZA 3V16A 4XSLA 4JTSA 1A5SA 2JIWA 3LXAA 3LMZA 4L6HA 4ZO6A 4LH8A 5HA7A 3RPMA 3W81A 2XIMA 3MYOA 3WIJA 4V28A 4ERGA 1Z9AA 1A5LC 4IP4A 3EWBX 1XYAA 4C6PA 4C6CA 2ZCGA 4R7OA 1HIZA 2PCEA 2W3ZA 5CBIA 1NFBA 5A94A 1WUEA 3ARZA 4KEVA 3WLNA 2Y89A 4W85A 4IIEA 4QRNA 2YCEA 2PURA 3MKKA 1H11A 4G1KA 2RGLA 1V8EA 2C1IA 1QI0A 3JU2A 1W5OA 4HJWA 5CJNA 3SURA 2XN1A 1I1XA 1CEOA 1UR3M 4Z0JA 3WD1A 5CC5A 2YB1A 2BWGA 3N9KA 2VCAA 4K3ZA 4K39A 5FF4A 1JF5A 2Z7GA 4OGZA 4UOZA 4D72A 4C6LA 1NIUA 1WZLA 1FWEC 3WZ0E 3ISIX 3BTNA 2YL6A 1PCWA 2OQYA 3TWAA 3HBLA 3A47A 1O6IA 3GTFA 1XJBA 4A2SA 4OVXA 4C60A 4RCXA 1GOWA 1D7FA 4CD6A 4B3ZA 1ZZMA 3WD4A 1XGDA 2C0HA 4LS2A 1IT8A 1J01A 3F5LA 3FSUA 1MEWA 4DM2A 1C90A 4J7RA 3WDJA 2P76A 1TZ7A 1WUFA 3VFCA 4L5ZA 3UJEA 2P5NA 1K6AA 2CERA 4ML9A 1ZTVA 4JYEA 3EEGA 4NT0A 2WVVB 3T0CA 1CIUA 2Z25A 3CIXA 7A3HA 2VR4A 3QOMA 3NA8A 1B31A 3S5OA 2OEJA 1Y8BA 4QROA 4J3VA 3ZMRA 1FHVA 5FAGA 3QQ1A 3VIGA 4M6VA 1TRIA 4AMAA 3QY7A 1FCBA 1UBSA 4LAMA 1VPQA 3C2YA 3IIVA 4QS5A 3M0ZA 2YFOA 1DJIA 2GUBA 4R53A 3PANA 2WCSA 2FVLA 1AUSL 2Z6JA 1UD5A 4JTQA 1B3XA 3U0HA 3EWXA 4NJJA 2PTWA 1GWJA 4J28A 1U5JA 1DHPA 3ARUA 5K3VA 4DQWA 4Q4QA 1LORA 8XIMA 4QCFA 4LS0A 2YYUA 4JN6A 2VNCA 4AZ7A 3UCDA 3VIJA 1XLCA 2XH7A 1OX4B 2ALRA 3TTQA 3W82A 5ECVA 1QFEA 3GE7A 1VS1A 1MNSA 3DYOA 4RW5A 4QDMA 5DELA 4MFEA 4K8GA 3TC6A 5AHIA 4H9YA 1P6WA 5AYYA 3VNDA 3EMZA 3EYPA 1CXIA 3GUWA 6XIMA 1QDSA 7XIMA 3FGCB 3UR5A 4HB7A 3UWYA 2C8NA 1HG3A 3OB8A 3P74A 4NF7A 2Q8XA 1WXYA 4NRRA 5AN7A 5C2XA 1ZP3A 3WQGA 5LA1A 3BLPX 5F7UA 2AL2B 1F4AA 3TMLA 2WMIB 3VZZA 4H83A 1NWSA 4KIRA 3DX5A 1V03A 3II1A 1A5CA 2V30A 1QCWA 4DF0A 2JBMA 1V6VA 3C2OA 3U57A 3LNMA 2F6KA 3LU2A 4G56A 1LT7A 4L1XA 3W1RA 1JL8A 3AQUA 4UTHA 3O6YX 2ZKMX 3OG3A 1E6RA 4AWSA 3L0NA 4BKNA 4QBXA 1OK6A 4AWUA 1BTCA 1XLFA 1PAMA 1KR0A 2QUTA 4ZXLA 3RAOA 4TX6A 3CMJA 4C5ZA 2QIWA 1JUKA 5REQA 5H91A 3WN6A 3EA2A 3MMWA 1W8SA 1XISA 2X8RA 3WNOA 1BVWA 2DQWA 2W27A 2WB5A 2XH0A 3LSBA 1IXQA 1REQB 3FAWA 4JXCA 1OX4A 4L80A 4FOUA 2V5LA 1IR1A 2XINA 1W6TA 4LFYA 3AYVA 2CHOA 3TP4A 4O19A 4JDBA 4ZO9A 3W25A 3RUBL 2BDQA 3NQ8A 3WFAA 1Q2SA 3FLUA 1NJJA 1RV8A 7ENLA 4ROQA 4XKYB 3P67A 2OT0A 3EA3A 3VMOA 4CQDA 2A21A 1XR2A 2L5HA 3B3DA 2YBTA 1KTNA 1PTAA 3GU2A 3LCGA 4F8XA 2WVUA 3LHVA 4XO6A 3OA3A 1AQ0A 1YE6A 2HJPA 4DNHA 1G4EA 3PN8A 1GVOA 3W2MA 3ANYA 4AZBA 4QISA 4UQAA 1MVYA 2PF8A 4W88A 2GJPA 5FEPA 4JQAA 2QMKA 3Q65A 2JK2A 3LTYA 3CYVA 4ECLA 3W1TA 3E38A 3LOTA 3O9NA 1JXJA 4QJ5B 1EJVC 3EA1A 4GHRA 4AEFA 3E96A 2WMGA 1XBYA 1V77A 4XV0A 3PSVA 3P2VA 3RX2A 3DESA 2J13A 5C7HA 5D8ZA 3AHZA 4FB7A 1EXBA 3PZQA 4L1WA 1NELA 1R38A 3GSMA 4KWOA 1W2PA 4PCSA 4QSHA 4S3FA 3UNTA 2FTWA 4OU1A 2PWUA 1TX0A 2G3FA 1KBIA 4MZ8A 3PB0A 1EYEA 1QK0A 3HFYA 3QYSA 2F7FA 4FZIA 2OWCA 3CHCA 3WY1A 3W00A 1UUQA 4Z1BA 3IJ9A 4FI4A 5BNKA 5I3JA 1HP5A 1S5MA 1VYPX 1FWFC 3GW0A 1G4PA 1LZOA 4MKSA 3NZRA 3VNLA 4J3XA 1R87A 2OSWA 2DVTA 4EXQA 3JW7A 4JGDA 3S5SA 3G1SA 1DV7A 3NUKA 1ZALA 3VDHA 5FEZA 3RRAA 3L5LA 3MKVA 3RILA 2DEPA 2PPGA 4JYFA 4WDUA 1YLVA 3SM0A 5SWUA 1CENA 2J4GA 3EMCA 4N7QA 1M04A 1FKXA 4UTWA 4O18A 4RPPA 2GQ8A 3WCZA 5BU9A 4M82A 3B4YA 2A4AA 4HNLA 3TROA 4YJ5A 4DXXA 2IUZA 3O6CA 1HNYA 2XZ9A 1WKFA 2PZNA 5IDZA 1V6YA 4CN6A 1E9YB 2J8TA 1K8XA 1CDGA 4YTTA 3N9RA 1UA7A 2D73A 4J2MA 1Z44A 4MSSA 2J6XA 2V9DA 3NEVA 1Q66A 3F4CA 2CBUA 4IGMA 3MKCA 4GNKB 2OG9A 2PDGA 4DJDD 4MPKA 3MS8A 4HQVA 4GPNA 1S3HA 1KFEA 4KETA 1F6KA 4ZOBA 3KBWA 1Y0EA 1QATA 4JFWA 3W6MA 4HMDA 4U28A 3FX4A 1XS2A 4H7CA 2CLMA 3QV6A 1PSCA 4XD5A 1MUWA 4L4LA 1KW1A 1PKNA 3SUSA 1FX6A 4IJRA 3MMTA 1RPXA 3AZSA 2E09A 4EPKA 2OLHA 4FLSA 2ONEA 1OADA 5HWJA 1IGWA 4GXPA 4EACA 1UR1A 2GGJA 4Q22A 5GVJA 1EJSC 3GC4A 4N9EA 2ZUWA 1EUAA 1W8GA 1NQ6A 1H1YA 5XINA 1E73M 5EMKA 2WNQA 1EQCA 3B8IA 3WLTA 3EWZA 4RDZA 3DH7A 5DMMA 3DN5A 1EJRC 4GQRA 2OZ8A 4JN7A 3H21A 1EZWA 2ZZ5A 2HZGA 3MMDA 2I5IA 3PZNA 1U5HA 1YQ2A 2W9MA 2ISWA 5LSMA 2W0UA 1JZ8A 2PGEA 4PCTA 4ZB2A 4ZENA 1HJXA 1FP9A 4TXEA 4AUBA 1XLAA 3UF9A 4JCMA 3ARQA 3SDOA 1ONWA 1FWDC 3ZFHA 1D8WA 3UYCA 4UTJA 3M5ZA 3LK6A 2VEMA 4LAUA 3UY7A 1TREA 2QDGA 3HPZA 1VD6A 3VM7A 2Q09A 3VOGA 1ZJAA 3AHXA 4K38A 3QRHA 3L23A 2V5JA 1DQXA 2CC0A 1FWCC 1QOQA 1JCYA 5DMLA 3NWRA 2PD5A 3WDRA 3W74A 3JZEA 3TN5A 2I17A 3H2FA 4Q33A 4LBUA 1W31A 5HR7A 3M16A 1TZZA 4RX0A 3G1DA 5E70A 5F2GA 2BLEA 5EU9A 1TPVA 2QKFA 1R2SA 1QNOA 1ZU8A 2FH6A 3RO8A 3AS3A 4MB3A 4PA8A 2VRKA 1C92A 1NVMA 2CLPA 4O52A 1PXGA 3E0WA 4FLQA 2DW7A 2ACQA 3NIYA 2PCQA 3IIZA 4Z1YA 4NYUA 1ZY9A 1V3LA 3UGRA 3LPFA 5L6UA 6TAAA 1AQHA 1E4LA 2J88A 4ATWA 5TAOA 1JDEA 4LANA 1WPCA 2CBVA 2DZAA 4LVFA 5CZJA 1I0BA 1LUCA 2XTKA 1I2PA 5CC6A 3IWPA 2ODOA 2DT1A 4HMCA 2C14A 4Z0SA 4IPPA 2WOQA 3GVRA 1TG7A 1RHCA 2VO5A 3A4JA 1L0PA 4AH7A 1V3JA 1VEPA 2A7RA 3BSGA 3RCNA 2F38A 3AJ7A 5G1TA 2QAFA 2VEFA 2JALA 1AJZA 1WA3A 3N2CA 1LYXA 3UJ2A 3R8RA 4UB9A 1DJXA 1R46A 2WC3A 3VOIA 1DE6A 5CPMA 1UIOA 2B7QA 2Y7GA 4F2UA 4D6FA 3KWXA 1XLDA 4IX2A 1QI5A 4AVOA 3PK7A 3SI9A 5FJRA 4WJEA 4WKHA 5AYXA 4HZ8A 2J62A 6CGTA 1ONRA 3NZPA 4GQBA 4KCUA 1G0CA 2P0IA 3L4TA 1A5OC 4AEEA 4GH3A 4QLLA 4E2DA 3QHNA 2B7NA 1P1XA 2OQLA 4IHCA 7CGTA 3WQ8A 2ZRYA 4FX6M 2BOFX 2VGIA 4L9XA 4WHBA 5BMWA 2ZZ7A 4QAWA 3NR0A 3MJMA 1LLWA 4P2VA 1OZQA 3ITLA 2VRJA 2GZXA 3B40A 2P53A 3AS0A 4PUKA 1XLEA 1F3XA 4OQVA 3MUY1 2WHMA 3EDDA 1TJPA 1GVSA 2PWHA 4AVNA 1V02E 2YDRA 3VE7A 3N12A 4Q8PA 2GJXB 1G5AA 5T8GA 1O1HA 4WD0A 2GJRA 4UQEA 3LBCA 4DUXA 2W61A 4IP5A 1UR4A 2YXXA 2A3LA 3BAIA 3WELA 5I3HA 4ASTA 2NUXA 1OF6A 2PDQA 5HNNA 3C8FA 3DC8A 4C6DA 2CIPA 4RDYA 1GYNA 3CPUA 3W75A 1XLBA 5CJ5A 3ZZ1A 5D9PA 2HQAA 4RXGA 1IE7C 2PWEA 4O1DA 3RCMA 2GGIA 2VYOA 4NNBA 3UWZA 2E1DA 3EB4A 2CLEA 1US0A 2BTMA 3DIPA 4X2PA 3MO7A 2GUYA 4IFKA 1C3FA 1DJHA 4RXFA 4JD4A 2G3IA 1E40A 3URNA 3H4WA 3PNZA 4P8VA 2XYLA 1VENA 2WNWA 4H2CA 2BXYA 1ALDA 2XVPA 2GSJA 3EOLA 2IKHA 3C61A 4B3KA 3B8DA 1TSIA 1OEPA 2D0FA 3FYPA 5C9XA 2C3ZA 3M5XA 4RDVA 2YKKA 1R85A 3GHSA 1L8PA 1Y7VA 2NWSA 3UPBA 1NOWA 4IMFA 2ZRXA 3BAKA 2HE8A 1UD4A 3VOCA 5LIWX 3ARVA 2P3ZA 2NX9A 4UCFA 4EPDC 3PBUA 3GKFA 3XINA 1XC4A 8XIAA 3FJ6A 5A95A 1PYFA 1UPMB 3WD2A 4H8UA 1TWWA 2YL9A 4KBXA 3NVDA 4XZIA 3C0JA 4URIA 3LSCA 3SZ8A 1FWHC 3VKJA 2O92A 4JTLA 3LNPA 1A5NC 1Q7ZA 1TA3B 5LNVA 1V93A 3T81A 1QNVA 1E70M 3DFHA 2R1NA 3GDKA 1Q7QA 2G3MA 1XIHA 2Y61A 4O57A 2ZZ2A 4ATDA 2YGYA 4NXSA 2VGBA 5DEZA 1KFLA 4QCEA 2F9RA 1YPFA 1GVIA 1FCQA 5HMFA 1KM4A 3QMSA 3T0DA 3KRZA 1XDJA 3O05A 3LZ5A 4KQNA 1FHLA 2OZTA 2A7PA 4H1ZA 3RCYA 2HXTA 5CPNA 1EF2A 4PMUA 4BQ3A 4C6JA 3W6LA 3GG1A 4PGLA 3GD6A 3PUOA 4ZGYA 5JBFA 1FTXA 2BOGX 1E0UA 3EOOA 1UUMA 5A5WA 1LUCB 3LUTA 4LUSB 3T08A 5CKSA 3DERA 4IGHA 3SQLA 4I8DA 3VIIA 3UG4A 1XICA 4GIYA 1G67A 5CGQA 5ABGA 4XZNX 4FXSA 5G2HA 4XG1A 3M44A 1E72M 5KEZA 3JUGA 4QHRA 2GWNA 4AB4A 1EXPA 4AFYA 4CGTA 2NV2A 3WQ5A 1IYXA 4S3AA 4HOWA 4M6UA 1I45A 4HU3A 4CCEA 4QEEA 1TV4A 1Q13A 2VX4A 3FNDA 4GVFA 3AU6A 1H3GA 1OYBA 2W5FA 4RV8A 2DZBA 3R10A 4UFJA 2PDLA 4UMBA 1EIXA 3MO4A 3ATYA 3B97A 3BO9A 2BY2A 1OGSA 3CL7A 3EPOA 4GXWA 2QF7A 3PPFA 1KRBC 3IUDA 3NFUA 1V6XA 4LSBA 3Q37A 3C3NA 4XZ9A 3CL8A 3TU9A 4ICMA 2QDEA 2BGNE 5I0DA 4LUJA 1H2JA 3EBVA 1R3SA 1WP6A 4NAEA 3M43A 1MZRA 4DRSA 4YN5A 3TC7A 3S2MA 2PGRA 4C1NB 4ZQPA 2VEIA 3LV5A 3OG2A 1GQIA 3E2QA 3BL3A 3WBAA 2OO0A 2OT1A 1OFAA 2J7HA 1CLVA 4Q8TA 3CPRA 3P7YA 2V6AA 3WMBA 4S3DA 5B7YA 4H6QA 4GLEA 3FEMA 5TNVA 2G3NA 3P82A 4FR1A 5IXEA 1UP2A 3H7VA 2XIBA 4IL2A 2F8QA 4H6KA 1TKKA 4DZAA 3W07A 1FA2A 2Q3OA 3M5VA 1XCFA 3RDKA 1B1YA 2G8ZA 1E15A 4IMDA 3PPHA 4CD5A 5I06A 2P3EA 3GG8A 4ZCWA 3S9IA 3VIMA 3WQEA 4A21A 5DQPA 2G4FA 1F3WA 3G2GA 1UG6A 3B04A 4AZHA 3IK4A 3BSMA 5LZLA 2P10A 2GDQA 1QBBA 3PUGA 3UZXA 2QXWA 3QGKC 5F4XA 3G1AA 2W79A 3H2CA 1RJQA 3KHJA 1FHDA 3AMGA 4PYSA 1JULA 4IG2A 4EK7A 3NQ7A 2J9XA 4L61A 2OEMA 4GK8A 3BJFA 3G8RA 1G94A 3OLIA 1TPB1 3H2NA 4QQ3A 4W86A 4ACZB 1PO9A 3HG5A 4BS0A 3CMFA 5I3FA 1A4LA 2AAAA 4X61A 4XKMA 1E0TA 3LRKA 4UTWC 2WAGA 5AHFA 3QLLA 3RO6A 4XD6A 5DXXA 4EF8A 1L6WA 3LPGA 4RZ5A 4GYJA 3UWUA 3NL5A 5M17A 3F5JA 4V1XA 3GZAA 5AYBA 3DBNA 3FOKA 4JQ1A 3T9PA 2A3BA 1WOAA 4O8AA 1JZ2A 1BYDA 3GG7A 4ALDA 1QJWA 3IIOA 1Q6DA 2QYGA 3Q45A 4X3ZA 3TNBA 2V5DA 1UB3A 3M47A 4KWVA 4P8UA 4R27A 3W2UA 4DBWA 1NWRA 4C6IA 4QDPA 1RA0A 2DZWA 1JPDX 1X38A 4B5TA 4E6MA 1TPH1 2WLYA 5M1TA 1IEVA 3N6QA 1RY8A 5AHLA 2OLAA 1UH3A 3VGEA 4US5A 4WJXA 1P1MA 4JFUA 1REQA 2PDBA 4JIPA 4UWMA 1UR0A 4L64A 4FXFA 1GOIA 3A9BA 3CZKA 1YPXA 4M7TA 2QCMA 3NGJA 5D2YA 3EX4A 1JCNA 5CZTA 4QE4A 5D09A 4CKQA 1W2VA 2HS8A 2RDXA 2BMBA 5CBBA 3MP3A 1Z48A 4WKFA 1E71M 2D20A 2ZUTA 1NDVA 1J0IA 1DXIA 3WLRA 1L9WA 4K1GA 5MHBA 1SVDA 2KX9A 5A6LA 1Z89A 1DWIM 1H63A 1K7EA 3GTHA 2Y85A 4PSPA 3TVAA 3G24A 2X1UA 3WEMA 3W02A 2ESCA 3MV01 2PTDA 2VOMA 1J18A 3JR2A 2VM8A 2NW0A 3Q58A 1P48A 4WR3A 2EKCA 1XLIA 5EBAA 4BCEA 5C9UA 2VZOA 4JTJA 4FOJA 4Q4MA 1BG9A 4DWSB 1D3CA 5LIYX 4M1RA 2JIEA 6PTDA 1JCXA 4F2TA 4UNLA 1F2JA 3F2CA 1X39A 1QO5A 1SZNA 3A13A 1QI2A 2RDWA 3VCCA 2Z2BA 3LRLA 3VU2A 3ANVA 3NDOA 3MUZ1 5D03A 5C70A 1V79A 4IQEA 3KXQA 1IZJA 1GYLA 1ZAIA 4HOXA 3WJXA 2QCNA 5T91A 2XFFA 4YIWA 4IXXA 4WXYA 4IICA 2RH9A 1XD0A 4AYGA 3GHRA 1XYCA 3H6OA 1SO6A 3VNYA 3R2GA 5KSWA 2Z00A 3DECA 3KL5A 1GQKA 1UOZA 2Y5EA 5F2LA 1XM3A 5BXSA 4V1YA 4C6EA 3TA6A 4KGJA 4O4WA 2E1WA 4WRHA 3UCQA 3SGZA 3CZJA 5I23A 2V2CA 1LBFA 3CQ0A 3BCJA 2CESA 5LXXA 1TPEA 3EOUA 5EMLA 5BRBA 3QZ6A 2I7GA 1ZPTA 3W7RA 3W7PA 4NG3A 3BARA 3V0SA 4MJ4A 5ABFA 4RDWA 2WZTA 4XX6A 1KTBA 5T9CE 1XIEA 2ZXAA 1K70A 4U4MA 2VEKA 5BXRA 1PCKA 3LHTA 2PF0A 1N8WA 1B2YA 1UWSA 5HAOA 4ZO8A 5E6ZA 4C6KA 5U4NA 3LI1A 3UXDA 4O53A 4S3EA 1EC7A 1DE5A 4Y90A 1WBHA 1F9CA 3SCQA 2AMXA 3W22A 5DY3A 1QPKA 1TYGA 4LNCA 1PZ1A 1IEIA 3KS6A 4BQ5A 5MKGA 1IT7A 5AOUA 3GBDA 1BWVA 4MYXA 1D3HA 3VVGA 1I8JA 1WYIA 4PFMA 1OABA 4Q4RA 4DPQA 3T2PA 3AXHA 4H4IA 1PPIA 4HSOA 5I5RA 4L7ZA 3KVLA 5CAHA 1OFDA 4WEVX 4PUWA 4WSHA 2ZX7A 1E4NA 2Y6ZA 2Z0IA 2OX4A 3VOFA 2WWCA 1Q5MA 3W28A 3VNMA 3PBVA 5EYWA 4EE9A 1BGAA 4PSRA 5JIPA 3WH8A 3RRXA 1KXHA 4D71A 4G2DA 3W27A 1GVFA 1KRMA 1V6WA 1EWEA 2ACRA 3N15A 1XLHA 1Q6QA 1XIJA 3UESA 3OYZA 2ON3A 1JZ7A 1AMYA 4IOTA 1K6WA 3TLLA 3BZGA 3UZZA 4HPGA 3NCOA 3GRIA 3ZXWA 4ZMGA 1HKVA 2B31A 4JCLA 3TXZA 1R5YA 3HPAA 2FIQA 5JBEA 5K9DA 1XG3A 8CGTA 4IXHA 4E8CA 3GQYA 1YXYA 4E0CA 1GHSA 1QNQA 2CLLA 1WX0A 4INFA 3OP2A 4DLFA 4I3GA 3PZMA 3RHGA 2BHUA 4NNAA 4A8RA 3NSNA 4CNOA 4N6EA 2ZWYA 4GG9A 1KCZA 4Q8VA 3STFA 5F2MA 1DPMA 3SRKA 2WKLA 1XLJA 1DXEA 3M7SA 2YR1A 4I7UA 3ZSSA 1GORA 3FDGA 4MB4A 5AYZA 4M8UA 3OQ8A 2VX7A 3QM3A 2WVTA 5J5RA 1D7KA 4LYPA 4DO4A 5FESA 3EAUA 4I9AA 2XSAA 5EMJA 3FVMA 2DT3A 4PRTA 2OYLA 3UXKA 3RX4A 4W4QA 2FGZA 1LJYA 1CX9A 2B7PA 3S2CA 5HQLA 3MU7A 4RJEA 4P8XA 4TVDA 4H04A 1QHPA 3JS3A 2FTYA 5IM51 3W7JA 1Q45A 3FYYA 1XLKA 4MWAD 2ZE3A 4GUFA 2IPWA 1OG0A 3WLLA 3B8UA 1KFKA 1RALA 1Q6GA 3ZR6A 1VFFA 3W6YA 1XYFA 1XBZA 3TH6A 1OGGA 4AXNA 1KQZA 1UD2A 4AY1A 3FJ4A 5CXPA 1WOBA 1SFJA 2PC4A 1YW1A 3U7VA 3QY6A 4F3HA 4UC5A 3NSXA 3VX1A 5G4EA 1HL9A 3HPFA 1YTDA 1QO2A 2VDGA 4AD2A 3QKZA 3TTYA 3W7OA 1DEDA 2QDHA 3V5FA 2VFDA 4X22A 3DDMA 4CCCA 4J2PA 1MFVA 4TTUA 1BF6A 3A9IA 3G1VA 3QZAA 4BWLA 4PN2A 2PI6A 2EKGA 3AIEA 4JTFA 4UR7A 1JNEA 2P0OA 2Y62A 3WX7A 2Y0FA 2IKJA 4A8IA 1LDCA 1R3TA 3NZ1A 2C1GA 1V6UA 3NL2A 4MZYA 5M2FX 2OXNA 1X8FA 4J9JA 2ZX6A 5K9CA 3BQ6A 4E3VA 1GT8A 1HKMA 2GSHA 1BG4A 4GMEA 3SCNA 4PODA 2QGYA 2ATMA 4DX3A 3B9DA 3WLPA 3B9AA 1JDAA 2REQB 4XKYA 4CD7A 5CGTA 5MF5A 4D6JA 2HROA 3AXKA 1NOFA 3FFSA 3N18A 1XV8A 4XD4A 4CU6A 5HUOA 3QVQA 2EGZA 3KS5A 3A5VA 2A2IA 1ELSA 1LLOA 1G6CA 2VENA 4XZWA 2XN0A 2NX3A 2VDIA 2VEPA 4JX4A 4U5IA 2ZXDA 4IQDA 2QCFA 4DWDA 4H9UA 3RF9A 4F79A 3REQB 1L6YA 1PWMA 4J5NA 2Z24A 1F74A 3UEQA 4WIWA 2C19A 1UA3A 3DCPA 3F03K 3BGAA 4HA1A 5CZKA 4Z2KA 1GVEA 1P6BA 1U33A 1WQ5A 2FPYA 1KXQA 2FPVA 5CLWA 4WSJA 2F2HA 3B4UA 3CQHA 4M0XA 3DGBA 3ITYA 3MSYA 4GJIA 2ZRUA 1KXVA 1KM0A 4JL1A 4G9PA 2DJLA 4I6VA 5CC7A 1QMLA 4YCOA 4UQCA 3KDOA 4J1OA 3FN9A 3CIWA 3ZT5A 1W3TA 1PDZA 3WLKX 4HPJA 3M0YA 5BOFA 3EDKA 1EB3A 3ZM8A 3HA1A 3WF0A 3R43A 2PDJA 5BROA 5IFPA 1EDTA 3R5EA 3PPCA 3O07A 3PWIA 1OWQA 3T78A 5JIWA 1A80A 1DJNA 4NZ4A 5FI8A 5EA9A 3ZVHA 2J7EA 3W7QA 1LRTA 3FJLA 1K8ZA 1XINA 3HMCA 1FWJC 3S46A 2VELA 1T99A 5LHFA 3QTGA 1XLGA 4DI8A 1FOBA 3A5FA 4W89A 1QVBA 1AA1B 1JFHA 3ABQA 1GYMA 3I65A 1XKJA 2X7VA 2VVSA 3FY1A 3GBEA 3IJ7A 4QE5A 2E77A 3SRDA 2FHFA 1B4KA 1CGVA 4NASA 3O8AA 1GW1A 1V7YA 1XQKA 1W3IA 1H0IA 2PZ0A 1N55A 4MAZA 4GZJA 3TDFA 4DYEA 4ZOAA 4X0NA 1EO5A 5FJUA 3ME3A 2WK2A 3R13A 3MANA 1Q8JA 3T42A 2WYSA 3BE7A 3G6LA 3MWCA 4KGLA 1QK2A 2PP1A 4AW7A 1TV7A 5IHSA 4XVEA 4B4HA 1ZB5A 2AMGA 3W24A 5GJPA 2J24A 1HL8A 5KINA 1SGJA 3QN3A 2QT3A 1V3IA 4XISA 3BVJA 2G37A 1X7IA 2PB1A 3ITCA 4Y96A 2PWVA 1AMKA 2CEQA 3HV9A 3L7RA 3SQSA 3NQ2A 2YDQA 4UTIA 2FZDA 1FDYA 4TR9A 1WZMA 1IZCA 4OBSA 1OIMA 3LXCA 1UH2A 3RM8A 4WY0A 1OFOA 4O10A 2NVDA 3WYZA 5D9NA 4LEFA 4HIBA 3GHTA 2F6UA 4JKMA 3F2DA 3PM6A 5CPTA 1FUYA 3NDZA 4JTTA 3XIMA 4NZFA 3OPSA 1F3TA 5AFDA 2AGKA 4JIIX 1BXBA 4XO7A 3P3BA 3COTA 4P5UA 1PHWA 4KCWA 2V3DA 2DU2A 4JPGA 2Y2WA 1W1PA 1OJXA 3EKZA 3WLIA 3W3OA 1I2NA 4WCJA 3S2LA 2ISFA 4QX4A 1GCYA 2YDAA 4PMVA 1K77A 3GFXA 4MDOA 1EX1A 2QNEA 3E5PA 1FCUA 1LQ2A 4XBSA 1TJ2A 4NKCA 5HWNA 2DIJA 3SIZA 4JHOA 1LWIA 4FIQA 3N2MA 2AL2A 4UNKA 2BODX 1H41A 1TJ1A 2XIJA 2FMNA 1V51A 1HXJA 1BHGA 3IV8A 5JH2A 2VTFA 3DAQA 3UFYA 1KFJA 2BASA 1EJ7L 3H8AA 5A6KA 2PA6A 1OD8A 3I10A 5FA5A 1VCVA 1NDZA 2ZVRA 1D9EA 1Z7AA 1FY6A 3W2KA 2FQIA 4HNVA 3WENA 1HN1A 4XK2A 4AD5A 3DUGA 1K7XA 2X0SA 1H7OA 3G0XA 4P61A 2KZHA 4R5EA 4Z1DA 3DGRA 3TA9A 3SCRA 3UWQA 4W9TA 2A7NA 2HS6A 4GQQA 4E4FA 3SEPA 5A8QA 4IIHA 1MUCA 4C7FA 4Y8FA 2W62A 1UJPA 2FJKA 1QNPA 1S46A 3AIUA 1CT5A 1B3WA 1E1CB 3TYUA 3NO3A 3V75A 4J27A 3WK3A 4UFMA 3EMQA 5AC7A 1UQZA 2P1FA 4F9DA 4BF9A 1ONXA 3F5KA 3BGJA 4C65A 2FZNA 3TW7A 2Q8ZA 1CZ1A 4NJHA 3OHMB 1RPKA 3AFBA 1OCNA 1Q7MA 4KWUA 4W84A 3TJ4A 4PZVA 4S3GA 1FWTA 4R9OA 2E9LA 4UUIA 3WUFA 2ZYFA 1W37A 1G4SA 4DBSA 4O1AA 1S1RA 1S2AA 3VCRA 3A22A 2WM0A 1TV8A 3R79A 2V0TA 3O3RA 4N9CA 4HPNA 1DWFM 2HE5A 4FNUA 1DOSA 3NL3A 5I3DA 4XAYA 4FNSA 4EOUA 3RNDA 1IZKA 3KWSA 1DWAM 2VQUA 2G96A 1IHIA 1V3HA 4PMDA 5C0QA 4KFPA 1HVQA 4X2RA 3ZJ8A 5HPOA 1OC5A 3DFQA 3NAVA 3F4VA 4XAZA 5LKYA 3UD6A 4IIFA 1BSLA 1ZAHA 1BVNP 3VIHA 4Z2GA 3QPYA 4A4AA 4RNIA 5XIAA 3PBMA 3NSMA 3QV7A 1AW5A 1J0ZA 4JQ4A 3N6HA 4H8NA 2NUWA 1POKA 3I7RA 2ISDA 3GO2A 3NZGA 3RLUA 3BW4A 4M6PA 5G1MA 3A64A 3T44A 1KLZA 1A3XA 2Y4SA 3NQCA 2V69A 4E8DA 2CZ5A 4W7UA 1JI1A 3WMSA 3U4FA 4MJZA 2ZC8A 1H60A 4KIEA 3TCSA 3VGBA 1EPVA 1AH0A 5AZ0A 2O9PA 4GY7A 2VJXA 2JEPA 2PTYA 2ZIDA 2VRQA 5CPQA 2X2GA 4GIRA 3BMXA 3LYEA 1R47A 4MOZA 3MCOA 1ITQA 3FK4A 2J66A 1HJSA 1WAWA 4LF1A 1KWKA 1B4EA 4LVGA 2WZEA 3C2VA 4YTRA 1NY1A 2ANUA 5H8UA 3P81A 1NP0A 2VFIA 1TQXA 3TE9A 1DXFA 3VA8A 2C71A 2ZRZA 1DIDA 4MY8A 4GY0A 1Q6OA 4V27A 3T1GA 2MUCA 2CZFA 3W7NA 3ZLHA 1L2UA 1JQXA 2WC7A 1RQHA 2CFFA 2X1IA 3SUWA 2PS2A 1F3EA 5KZ6A 4J4KA 4MWAA 1R3YA 5HMEA 1PWLA 1DL3A 4QGCA 4A3RA 1JPIA 1IT0A 3WUEA 5DANA 2ZWZA 4NRSA 1HO1A 4UFLA 3CT7A 1JZ4A 1E0XA 3TFCA 2QVNA 4H9MA 4P7RA 1IWPA 3MW7A 4LVBA 4WVXA 3CZEA 4JFSA 3NQMA 5U7SA 2AAMA 1QPQA 1NFPA 1Q6FA 2OTDA 3DZ1A 2YL8A 2YBUA 3TK7A 2IKIA 3LQGA 1E51A 1TA3A 1XFCA 1P7TA 2NSOA 4ZR8A 1OHLA 2ZX8A 3KOZA 4UTLA 3C8NA 3S3GA 3UYIA 5RUBA 4MB1A 3THAA 2QUVA 4DY1A 1H1ZA 4IMEA 1H4PA 4UFKA 2FHBA 2QUUA 4P7NA 4QR6A 4I7VA 1QOPA 1C9DA 1E9LA 3CZLA 4KCVA 2XIQA 2J77A 4NZ5A 4KMQA 3QSTA 1RP8A 2MANA 3PBGA 4M81A 3MDWA 5E0FA 1W5PA 4RKAA 2Z1KA 5I00A 2WSPA 5I03A 1XF0A 3AS1A 1WXJA 3B06A 5G4WA 2DSWA 3CWHA 2WVVA 1SPQA 2Q8LA 3LV6A 2Z1VA 5LNRA 4MZ1A 2UV8G 1EOMA 4U31A 1XSIA 2BV9A 5AC5A 3URBA 1J8VA 1DP0A 2F84A 1NM9A 4LNYA 3QR0A 1H61A 1YIXA 1KV8A 1L2QA 1X7FA 3PB2A 2F6XA 4M51A 4NILA 2GL5A 1TE6A 4QLJA 3QHOA 1QHZA 1TCDA 3B0UX 4D6IA 4IT1A 3WLHA 4GYFA 4L6DA 2EO7A 1RD5A 1ZP4A 3N9SA 1UIPA 4V2XA 1OX5A 2J7BA