3U5UA

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
501
structure length
470
Chain Sequence
b'DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Raucaffricine-O-beta-D-glucosidase
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 178
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u5uA00
4EE9A 3NSMA 3CHDA 1DHKA 3EDDA 4WSJA 4H8UA 3VD3A 3FNDA 4M56A 1P6WA 3OG2A 1OD0A 1J9YA 3T2PA 4JZ5A 1B3XA 5I3DA 4M29A 2PF0A 3MUIA 3AYRA 3VDHA 4M8UA 3IANA 3GM8A 1UWUA 3ARYA 1V3KA 2XIIA 5HPOA 4UFHA 4H41A 1CNVA 3WNNA 2O9PA 1JNEA 1KCLA 3LMYA 1JZ3A 2VR5A 1DWGM 1QVBA 1LG2A 3CZGA 3ALFA 1KBKA 1HVXA 1HJQA 4PTMA 1E4LA 5A6BD 2X05A 2J62A 3WL0A 3CZKA 1UD3A 4V27A 2E9MA 3FAXA 3I3EA 1MW1A 3T0BA 1V0KA 1Q6FA 2ZX8A 1WNOA 1US3A 1QHPA 2QV4A 2V3FA 3OZPA 3ECQA 1TVNA 4YHGA 1OSEA 1TA3A 1YHTA 2Z1KA 4HMCA 2GJRA 1C8QA 1MFVA 5BXPA 5BXTA 4AZIA 1OIMA 3A4WA 2X1IA 3N1AA 3WH8A 1E1EA 2JIEA 3EDFA 4CU8A 1HN1A 1QI2A 2DT0A 3IK2A 2XWEA 4JFVA 1XD1A 1HX0A 1E5NA 1NQ6A 2G3MA 3AIRA 4CU6A 1V02E 1KFWA 3RMEA 4JKKA 3SCTA 3SIMA 3I3BA 1HVQA 1B3ZA 1QHOA 1EGZA 3RM4A 1E43A 3VIGA 2EPKX 4X0VA 3AS3A 3IAQA 1E6ZA 4AD1A 2QPUA 2X0HA 1YQ2A 1X1NA 4D6EA 2W67A 1ISXA 1LLOA 2VI0A 4HA3A 4LYQA 1BG9A 4AWEA 2Q8XA 4W8LA 2J7HA 3NYDA 2DIJA 1B3VA 4BS0A 4NSBA 2ESCA 1EH9A 2BY0A 4KMQA 1H3GA 1PX3A 4UQCA 3BH4A 3AHZA 1ISYA 5BXSA 3WMSA 1MYRA 3RJYA 1PPIA 2CKRA 1BAGA 1HNYA 3OZOA 3GNRA 1JYWA 4AD4A 7CGTA 3K8KA 3TOPA 5I79A 3WFLA 4MJ2A 4IM4A 3L4VA 2O92A 2PWEA 4NRRA 1TE1A 2YA2A 4PBGA 2UY5A 6A3HA 4TVDA 3AHXA 4FLOA 3ZSTA 2G41A 2WHMA 4QDMA 3NIYA 5C8BB 3MV01 3BAWA 3HJEA 1Q4NX 2X0YA 1SMDA 2BY3A 3VKKA 4CN1A 5IDIA 3EBVA 1JD9A 2V5DA 1DP0A 4CGTA 3UEQA 3VIJA 1ITXA 1LWHA 3BAIA 2YBUA 4E2OA 1CXFA 5I5RA 1QW8A 1I1WA 3NSNA 4CD8A 1SMAA 3AIBA 1ZBCA 4JHOA 2YIHA 1MQPA 1UKSA 1IZJA 3DHUA 4IUGA 1G5AA 2YL6A 1PX4A 4D1IA 1EQCA 1J01A 4EAMA 1LL7A 2G3IA 1HL9A 3BAXA 3CH9A 3TTSA 3WEZA 1MFUA 3GH5A 3U5UA 4HOXA 4JFTA 1HJSA 3CHEA 4JFSA 1TZ7A 2WMHA 1WDSA 4UNIA 4YPJA 2XJ7A 1DWAM 4B9ZA 2VQUA 2QLYA 2ZICA 4QP0A 4F66A 3M46A 4TUFA 3WNOA 4W5UA 1R86A 3VINA 3NDYA 5DEZA 2IUZA 2HISA 4BQ3A 4M1RA 3W29A 4LQ1A 2ZUNA 1HL8A 1JYVA 4M80A 1LQ0A 1PEZA 2WVSA 1EDGA 2XUCA 4HTYA 4AD3A 2WMIA 1O7AA 5EFDA 2VRQA 3QOMA 5CQ1A 3VU2A 2WB5A 4HU0A 1VFOA 3VM7A 4EKJA 3WF2A 3MUY1 1NWUA 2D22A 1CGVA 1QNQA 5F7UA 4P7LA 4JCLA 1ODUA 3WH7A 3GXFA 4RE2A 3GYCA 2WWDA 2DDXA 4P7QA 3WENA 1PZ3A 1CWYA 1XH1A 3VD5A 2VNCA 4QCFA 5A6SA 2WC7A 3FW6A 1UR2A 4ATDA 3AI0A 3L2LA 1H4PA 2EBNA 3MKKA 5DT5A 3PZVA 5IXEA 5I78A 2DSKA 4CD7A 4UZSA 5FL0A 1C90A 1J12A 5I24A 3ZJ6A 1JYNA 1KGWA 4BQ2A 4DWSA 1FHDA 4GINA 2ZXAA 3UESA 3B8SA 2QMKA 4UZUA 3G6MA 2BXYA 4AZCA 3BC9A 1HKMA 3N11A 3KE0A 1ISZA 1WE5A 3POCA 4CVWA 1CIUA 1U30A 1A47A 1V6YA 4UOQA 2WCAA 1WDQA 2VZTA 1W32A 3K8LA 2FGLA 3THDA 3AMDA 2DSZA 1ECEA 1JAEA 1B30A 3CIVA 5JIPA 3TTOA 1UR9A 4W8AA 2OSWA 3RJXA 4OOZA 1XCXA 2EXOA 4XZWA 3VTRA 1XRVA 3WF4A 3U57A 4A3HA 3OA5A 3WNPA 1CTNA 2ZXBA 4UTFA 3DYOA 2F8QA 2XFFA 1H0GA 4HZ6A 2E3ZA 4AD5A 3W26A 3ARUA 2D20A 2V3DA 3WIJA 3AIEA 5EMYA 1R87A 2WCGA 2VOTA 5FCZA 1V3IA 4GI8A 4U5KA 5EFFA 2DH3A 2YL9A 3CLWA 4KGLA 3ZR6A 4TVUA 5C71A 2ZX7A 1HJWA 3VGFA 1JZ6A 4HU8A 2JF6A 2WSPA 1HXJA 3VD4A 2WZHA 1UD5A 1C91A 1KXQA 1MW0A 1KXVA 2CHOA 3PN8A 1GOMA 1W2VA 3D3AA 1ZJAA 1UWRA 2YLAA 3BSHA 4GI9A 4OOUA 3ARVA 1B0IA 2JEPA 1EQPA 2W61A 8CGTA 5JBEA 5DFAA 1CDGA 3WSUA 1OGGA 3OGSA 2XM1A 3SUWA 2WKLA 4PEEA 2XWDA 4UFIA 3CHCA 2ZOXA 4AIUA 3VX1A 3VX0A 1UD2A 1KGXA 1GQJA 4W88A 1K9FA 4TX8A 5AC4A 4AZ7A 1OM0A 4HA4A 2VUYA 2NSXA 3ZOAA 4WIWA 2JFEX 4X9YA 1B3YA 1GOIA 5ABHA 5BXRA 4OIFA 1UH3A 3N12A 3U7BA 2VVNA 1JDDA 1E6PA 1J0ZA 2W92A 1VB9A 3CGTA 2EQDA 5BROA 4W87A 1EIBA 1W9DM 2CYGA 5HNNA 4AY1A 1UKPA 5A6KA 3F5LA 4UQ9A 3OBAA 2CNCA 9CGTA 5E0CA 1ZBWA 1WZMA 7TAAA 3SCSA 3SEPA 3AHTA 5D9MA 3WDPP 3ZJ8A 1JDAA 2OYKA 3GXIA 2DT3A 1PBGA 1H2JA 2J7BA 2PBGA 3AIWA 3EMQA 4S3KA 4UFLA 1VBRA 3I3DA 1QHZA 1LWJA 3F4VA 2A3AA 2CHNA 1XYFA 3W6LA 3L4ZA 1D3CA 1UOKA 4JKLA 3W38A 1KGUA 1R85A 4UFJA 2OWWA 2VCAA 3WEOA 3W24A 2WW5A 1MQRA 1ZBKA 4FK9A 3SCNA 1HKJA 2ZX6A 2VRJA 3ARQA 2DQXA 3VUPA 3BLKA 1GHRA 2DT1A 1OGBA 1OINA 2D0GA 4CCDA 1C7TA 3CUIA 1H11A 4RL3A 1JF6A 1BSIA 4U3CA 1FOBA 3IAPA 2J7GA 2GSJA 5A8NA 2XPKA 3T08A 1CGUA 2W62A 2WVVA 2GJXA 1R7OA 1E6XM 2J4GA 2VZUA 5BCAA 3AMCA 1V6VA 4AZHA 4W86A 3CUJA 2PWDA 1NOUA 4W8BA 3OLEA 4P7NA 1E0XA 1OWQA 2OWXA 2UY2A 4TXEA 3AZRA 1GQIA 1JFHA 2WZEA 2YOCA 1D7FA 1VENA 1UKTA 1DWJM 5A94A 2GDVA 3UG5A 1E71M 2VX7A 3WMCA 2Y8VA 4RE3A 4UQBA 1NWRA 4PCSA 3ZJKA 2WXDM 4PYSA 1WZLA 5M5DA 3MUZ1 5FOOA 1XSIA 2G4FA 1VIWA 2VURA 3VGHA 5E9AA 2WM0A 4PN2A 3AHYA 2WHJA 1QNPA 2C0HA 1M7XA 1WZKA 2JE8A 1GOQA 1B1YA 1UD8A 1HJVA 4XB3A 4WSKA 3EMCA 1ISVA 2VT0A 4D6GA 1EDQA 1GZJA 4KH2A 1O6IA 2WPGA 3AOFA 2UWFA 4MDPA 2CBJA 1HP5A 2YDSA 4GXPA 2CETA 1CYGA 1NP2A 1Q6GA 3ARTA 5A6MA 2BS9A 3SUVA 4MB5A 5A2CA 1UQZA 1VF8A 2VX4A 4LYPA 5BRQA 4D6HA 4AYSA 2F2HA 2XGIA 5A8MA 2CBIA 2PB1A 3ZT6A 2BXZA 4ZEPA 2VZVA 1KR0A 5GNYA 3K46A 3VD9A 1DTUA 3ARWA 3PZOA 1QNOA 3SCVA 3WDQA 1K6AA 3TONA 3VIFA 2X8RA 1HKIA 1LF1A 1H49A 5HXMA 1V02A 1W9VA 3DC0A 4NRSA 3VDAA 3WQ5A 1MXDA 1ODZA 2ZWZA 4QAWA 1UWTA 2VJXA 2ZUMA 2D23A 3PZGA 2EPMX 1B9ZA 4HOZA 2E40A 3SCPA 4TX6A 4JHZA 2BY1A 2BHUA 1JFXA 4A3YA 4AIEA 3NUKA 2VVSA 1XYZA 3FHQA 3OIHA 1KQYA 4PMVA 2BY2A 4ACYA 2J78A 3G6LA 4BA0A 4JL1A 1FP9A 4U5IA 2GJPA 3KWXA 2V3EA 2NT0A 3O2LA 2XVPA 3W25A 3L4UA 4C7GA 3VO0A 4TTGA 2FDMA 3SCWA 4ATWA 4PUEA 3GH7A 1V3JA 2DSWA 3WUFA 4HPHA 3MUAA 4OZOA 1OT1A 1E15A 1OD8A 3HMCA 5A6AA 3WQVA 2XGBA 3K4AA 1IZKA 4AXNA 1UR1A 1ITCA 2G3NA 1EOMA 4W7VA 4JFUA 1JF5A 2YBTA 3AJ7A 2WC4A 3PTKA 2BFGA 2Y24A 2ZX5A 2CCRA 2D3LA 3A4AA 4RE4A 4E8CA 1EHNA 5BWFA 4UFMA 1ISWA 4HMEA 1JDCA 1GORA 1G94A 2WCSA 3BLPX 1A3HA 3L4XA 1CPUA 1BYCA 1CXLA 2DIEA 3ARSA 2AAAA 1QNRA 7A3HA 4PMYA 1W3JA 3SUSA 3VILA 4J3SA 1HJXA 3PZ9A 1WDPA 1E6QM 4AZCB 1E72M 2FHCA 2OLHA 4N42A 1CXHA 5A1AA 5E0FA 4PMNA 5I0DA 1E56A 3QGVA 4PMDA 4B15A 4V2XA 4NI3A 4PMZA 2FH6A 1FFQA 4CD4A 2W63A 3W53A 1HJUA 5GNZA 2W4XA 5CPQA 1V0NA 2CPUA 1UYQA 1B2YA 4S3JA 3WUGA 5DF0A 4ZXLA 1JD7A 2VCBA 1CGXA 4GO9A 3VNZA 1FA2A 1W91A 4MNMA 1G9HA 3DYPA 2DSUA 4CN6A 2J25A 4P7OA 1HP4A 1KXTA 1FP8A 3U5YA 3ZJ7A 1QNSA 5AYIA 4LXFA 4MB4A 2YA0A 3QHNA 2MANA 1DEDA 4JCMA 4OKDA 2WKGA 1WKYA 1BVZA 3PZUA 2WZIA 1CGWA 3BCDA 6TAAA 2CITA 1B31A 1H1NA 2CBUA 2V5CA 3FY1A 3WNLA 2XSAA 2ZWYA 3NSXA 3GH4A 1TR1A 3MS8A 1EOKA 3ZMRA 2VMFA 3AIUA 1GONA 2XG9A 4Q7NA 3L4TA 2Y4SA 3II1A 3LPFA 3J7HA 2PI6A 4D6DA 5ABFA 1UKQA 1W2PA 3N15A 1OT2A 3WNMA 2XM2A 5CZKA 1RH9A 1JIBA 4WKHA 1CLXA 4J3TA 4JIEA 3AXXA 1QBBA 1C8YA 3M07A 4WKFA 1JZ7A 4UQDA 4WLCA 2WMGA 1CGTA 1BYBA 2UY4A 5CGMA 4ML4A 1WCGA 3WDJA 1V3LA 2FGZA 3AMKA 4FLSA 1K9TA 2A3HA 4DUVA 1C8XA 3RDKA 4OJYA 3W6MA 2XIBA 3WD4A 2VZOA 4BZYA 2VX6A 5A3HA 4DWSD 1GCYA 4BF7A 1UKOA 4PCTA 1KB3A 2ZUUA 1WAWA 2YA1A 4W89A 5KZ6A 1NWTA 2CEQA 2BVYA 1KCKA 3WUBA 2QHAA 1CXEA 4XZBA 4AW7A 3W0KA 3AZTA 1Q6CA 1VAHA 3JUGA 3WD0A 1QI5A 2QPSA 1GOKA 4FF5A 4M24A 3VD7A 3EDJA 1HF6A 2PBOA 4Z2GA 4ACZB 1GHSA 3VGEA 3UG4A 1V0LA 4NF7A 3VMNA 4DM2A 3AZSA 4PMXA 4YN5A 5A2AA 3AQUA 2PC8A 1ZJBA 4UOJA 1F4AA 1K9DA 2GK1B 5IHRA 4D6CA 5A8PA 4Y7EA 2VX5A 4FLQA 2Y2WA 1GW1A 3N17A 3E1F1 3FXYA 2E0PA 2J75A 3AXIA 4MB3A 2OYLA 1E0WA 2ZIDA 1KBBA 2EPLX 1VFMA 1V03A 1PZ2A 1BLIA 3PTQA 4QLKA 1PJ9A 1VJSA 2AMGA 3D5HA 3HU7A 1JI1A 3SCOA 1BYDA 4GO8A 3VIIA 4QLJA 3WEMA 1EO7A 2YKKA 1QBAA 1M53A 5BYWA 1EA9C 1E5JA 3POHA 3OGRA 4F9DA 4HZ7A 1UWSA 3VIHA 1JAKA 2YL5A 2BV9A 3ZR5A 1GVIA 5I77A 3BCFA 3EMZA 3GDBA 1F4HA 3CZEA 2J7FA 2BVTA 2WMFA 2XVLA 1VEPA 1GQKA 3RILA 1OBAA 3MANA 4HPGA 4XV0A 2FH8A 2IXVA 3NCOA 1G0CA 4UCFA 5FD0A 1E3XA 1KQZA 3WKZA 4DUWA 4UQAA 1E70M 1H5VA 5HOSA 2O9RA 3KEHA 4AIOA 1PIFA 1XH2A 1M03A 2WK2A 3WY1A 1UQYA 1HT6A 1UUQA 3PBGA 3WDRA 1G01A 1UA7A 1FHLA 3AIVA 1BVNP 5BRPA 1BF2A 4P8WA 3LPPA 5A6JA 5IFPA 3UR7A 1TUXA 1WO2A 2XTKA 1OB0A 5AYBA 2XHYA 3DHPA 2RGLA 2A3EA 3DECA 3VVGA 3CTTA 4AZBA 1I1XA 2ZUVA 1W3HA 1R7AA 2D3NA 4MPKA 1J0IA 2Z1SA 3GTNA 3RM9A 5GQBA 3VMOA 1J18A 3CZ8A 3TTQA 4H04A 1J0YA 2C8NA 5C70A 3MMUA 4ZENA 2NT1A 1KWGA 5TD4A 2VC9A 1TA3B 3FN9A 1WPCA 5HPCA 1Q6DA 1CXIA 4F9JA 5JUVA 4AD0A 1FH9A 3MU7A 3T2QA 3AIQA 3WF0A 2G3JA 3ARZA 1V3HA 4GQRA 1UZ4A 1IV8A 1JG9A 4CCEA 3VOCA 4KWUA 2FHFA 1MW2A 2BHYA 4P8UA 5E09A 3F5JA 2QMJA 4HZ8A 1W1TA 3EDEA 3RIKA 5KEZA 1MXGA 1RD6A 3KL5A 4CCCA 3GZAA 4PMRA 2WHKA 2J7CA 4PRWA 3WL1A 2J74A 3KL0A 5D9OA 4WF7A 3WDIA 4UFKA 3ZSSA 3IJ9A 3IJ7A 1E4NA 2CIPA 1NH6A 3CMJA 2J7DA 3KZSA 5M3WA 5CPTA 1W1YA 3PHAA 2D2OA 3O9NA 3GXDA 2ZE0A 2PWHA 3THCA 1C3FA 4OBSA 4AEEA 4PMOA 4ZE4A 1PX8A 1DWHM 2W5FA 4AD2A 4GI6A 1PAMA 3WNKA 3BMVA 1W3LA 1GPFA 5ABEA 2CKSA 4B3KA 1MVYA 4BQ5A 1G1YA 3A6OA 3QHMA 3SCQA 4CD6A 5JIWA 1JL8A 1NOFA 2V3GA 1Y7VA 1E6RA 3A4XA 1NOWA 2BVDA 4J3WA 4B9YA 3OLGA 1UR0A 4JAWA 1UWQA 4CUCA 4QFUA 5FL1A 4PTVA 2ZXQA 2GVYA 4ZXOA 2QF8A 4MB1A 3EYPA 3SCRA 4D71A 5A6BA 3K4DA 2XFYA 4D6JA 4J3XA 5IHSA 3S2CA 3W37A 3OLDA 3DYMA 1E0VA 1NWSA 1VBUA 3WQ6A 1CEOA 1V6XA 1VEOA 5E70A 1BGGA 3VIPA 5A2BA 3CBWA 4P8VA 1S46A 2VL4A 1N82A 1C7SA 1E4IA 1CGYA 2ZX9A 4J3UA 3ZT7A 3AS0A 4CU7A 3T0DA 4DWSC 1KWKA 4C7DA 1CECA 1WDRA 4KGJA 5CGTA 1CENA 2XYLA 1WZAA 2Y8KA 1EO5A 1J0HA 3WUEA 4UOZA 1BYAA 3LPGA 2O9TA 3N18A 3CPUA 4MJ4A 1RP9A 4GZIA 4BCEA 1E9LA 1VJZA 3MMWA 3WQ8A 3APGA 3CUFA 2VQTA 1X6LA 2GDUA 2VO5A 3MSGA 4PTXA 1W9XA 6CGTA 4MNJA 5CLTA 3WFZA 5DO8A 4U33A 3IJ8A 3AICA 3RPMA 1M01A 2XSBA 1CXKA 1H41A 3K8MA 1E1FA 4PSPA 4J7RA 3T0AA 1GOOA 2DGAA 3RO8A 1J0KA 1UH2A 1CLVA 5EBAA 1GQLA 3AISA 4AEFA 1XC6A 4MAVA 1OIFA 1Z32X 1UR4A 2W91A 1TG7A 2E9BA 3N04A 3W27A 3LPOA 1NP0A 2GUYA 2CXGA 1KXHA 1VEMA 5I23A 5A6LA 4D6FA 2WMIB 4EANA 4P8XA 5GNXA 1L8NA 2D0HA 4OBRA 4PMUA 1J0JA 4W84A 1PIGA 4MTVA 2DEPA 4L4PA 4H8VA 1QI3A 3GXMA 3KL3A 3VM5A 1SYTA 1XHGA 1GUVA 1DWFM 2HVMA 2XVKA 1GJUA 4Z2JA 2JEQA 1LG1A 4JL2A 3OB8A 1HKKA 3MO4A 3N9KA 3VIOA 3CZJA 2UY3A 3UCQA 1FH8A 2IXUA 4Z2IA 3CUGA 4B16A 5I2UA 5ABFB 1L0PA 3WD3A 4TTUA 3MSDA 4Z2KA 1ZL1A 3OGVA 4V28A 5A95A 1MQQA 3EDKA 2NW0A 2VR4A 1JI2A 2YDRA 3AMGA 3UERA 4LYRA 4GPNA 5D9NA 5EB8A 1AQMA 4DWSB 1W3KA 1NARA 2WC3A 3S6TA 3ZM8A 4W5ZA 2BNJA 2PWGA 2J77A 2PWFA 1UHVA 2ZUTA 1UZ1A 3T2OA 4U2YA 3ZQ9A 4D72A 3L4YA 5LA2A 3T09A 1NM9A 2D0FA 4EK7A 3NDZA 4HA1A 4X0NA 1EXPA 1QW9A 3WH5A 1QI4A 2WVUA 5M17A 2E9LA 3BAYA 3M6DA 4ZFMA 3WD1A 1AVAA 1WP6A 3CO4A 4AZ5A 1LL6A 1TFVA 3BXWA 5HDRA 2OWCA 1JZ4A 3CZLA 4JFWA 1XCWA 2VCCA 4J28A 3ALGA 3VDCA 4MNKA 1GOWA 3WBAA 3ZO9A 3ZT5A 1BPLB 3WMBA 4D6IA 5HBFA 1TCMA 3MMDA 1X6NA 1JZ5A 4MNLA 3ARRA 3WBEA 2VZSA 3SURA 3BGAA 4AISA 3AXHA 5A8QA 4P7RA 2DPEA 4IISA 1SFSA 3ARPA 1XV8A 2XVGA 4R27A 1JXJA 3HN3A 3QHOA 1FFRA 1W9UA 4AZGA 3U7VA 3WQ4A 4TVCA 2WMKA 3WD2A 5A8OA 1UD4A 3FHAA 3GBEA 5I6SA 2D24A 3AFBA 1E55A 2J7EA 4QCEA 2AOSA 1V0MA 1ESWA 4DM1A 1ZB5A 3PZMA 4IPLA 2J47A 2WANA 3GNOA 2VTFA 1JYXA 1V08A 2WMJA 3GBDA 4H8HA 4JKMA 3WQWA 5E6ZA 2DT2A 1H09A 3CUHA 4WK9A 4AZ6A 3QR3A 4GQQA 1JXKA 3PZIA 2J79A 4WKAA 4W7UA 4XUYA 5D8WA 2GFTA 1AMYA 5M03A 1JGIA 2DH2A 1ZBVA 1MWOA 2YL8A 3WF3A 4M81A 4U2ZA 5DMYA 1UA3A 2WAGA 1U33A 2E8YA 1OGSA 5LA0A 4TOQA 4J27A 1KR1A 3W82A 2OSYA 1E6SM 3VMPA 1XSKA 3AROA 4R5EA 2ZUSA 4CN4A 1DWIM 2X09A 3BSGA 1UG6A 4BQ4A 4LX4A 4AMCA 3WF1A 3L4WA 2EJ1A 4MDOA 3UETA 1QI0A 1E4MM 5A69A 2YDQA 1LL4A 1U2YA 2EEXA 4W93A 1RP8A 3A3HA 5ECUA 4URIA 2BHZA 2WHLA 3VPLA 3VDBA 1BG4A 3SCUA 3WN6A 3O6AA 2WLYA 1H0IA 3PZNA 5CSYA 1GJWA 1Q6EA 1BFNA 2RGMA 1TMQA 1ZS2A 4HMDA 3AS2A 2ZUWA 4WJXA 4K68A 3L2MA 2W66A 2CERA 2CESA 1JZ8A 3AHVA 4CVUA 3K1DA 3BAJA 3VGDA 2XVNA 1VFUA 3MV11 4E8DA 2WNWA 3TA9A 2JF7A 3BMWA 2ZXDA 4W7WA 5AC5A 2E8ZA 2XFRA 1QPKA 2E4TA 1E3ZA 3VIMA 4ATLA 1XH0A 1B90A 4UQEA 4YHEA 2J8FA 4IPNB 3CHFA 3VIKA 5CG0A 4W85A 3N13A 3VNYA 1CZ1A 2OSXA 3UR8A 4C7FA 2A3CA 2WVVB 1R8LA 2GJXB 2G8ZA 4F79A 3WELA 1TVPA 4DUXA 1UH4A 3PZTA 2F61A 4QLLA 3SUUA 2J8GA 1WB0A 1V6WA 5CJ5A 1E6NA 1W9PA 3PTMA 4UR9A 5DT7A 3FAWA 3ZIZA 4D1JA 1CBGA 3M7SA 1E40A 5D9PA 2C7FA 1J11A 1UD6A 1FH7A 4GZEA 1B3WA 3ARXA 4U31A 4Q22A 2Y5EA 5E6YA 1M04A 1ZU8A 1K9EA 2EO7A 4FMVA 1MW3A 4M82A 1EHAA 5IFTA 5JBDA 3SUTA 1GVYA 3PZQA 4KRUA 2WBKA 3A47A 1BGAA 4ZE5A 1QOXA 1D2KA 2OYMA 1US2A 4GKLA 5D4YA 3GNPA 3WDHA 3QOKA 2VRKA 3AS1A 3VGBA 4LPCA 5ABGA 1XD0A 1RPKA 1SR0A 5LA1A 2B31A 1UWIA 3NJ3A 4PSRA 5GPRA 1VRXA 5CXPA 2WLZA 2A3BA 2FHBA 1V6UA 4OUEA 4LGXA 3VGGA 1AQ0A 1HIZA 1W9BM 3B9DA 1BHGA 4MADA 4FLRA 3W81A 3TTYA 5D8ZA 1XSJA 4GIAA 4L4OA 4H7VA 3W4RA 5JBFA 5FKYA 1C93A 1AQHA 4KRTA 3WH6A 4B3LA 1V3MA 1GNXA 4ACZA 3B9AA 4MAZA 4Z2HA 1BQCA 4F8XA 3RM8A 2YJQA 3UG3A 4E4PA 2O9OA 2X2YA 3WH9A 3CMGA 2V38A 5LYRA 2EPOA 4CKQA 5CLWA 5CPSA 1E73M 1J10A 4AC1X 4Z2LA 2TAAA 1JNDA 4XX6A 2GK1A 3BAKA 4PMQA 2DSVA 1W1VA 1OCQA 4NZCA 2WWCA 2WSKA 4CD5A 4U3AA 1IT0A 1BTCA 4J3VA 2YLLA 5CSUA 4HP5A 3F5KA 2D1ZA 2EPNA 4PUDA 3B9EA 3AYSA 3OLIA 2WYSA 1XGZA 1JZ2A 1I75A 8A3HA 1W1PA 1C92A 4PTWA 2WBGA 1LJYA 3W28A 1VFFA 5FIPA 3TP4A 2JALA 1EDTA 2WVTA 4HOWA 3RCNA 3AMLA 5AY7A 1UR8A 4A4AA 4H2CA 2CBVA 4N0RA 4GZJA 2JIWA
chains in the Genus database with same CATH superfamily
3CHDA 4OV4A 3BURA 4QJ1A 4DXKA 3C5QA 1EYWA 4L6OA 1O1ZA 3HA1A 1LM1A 4A3RA 1U5HA 1Y5WA 3OG2A 1OD0A 1RLCL 3O07A 3LA4A 1SQ7A 3R11A 2QIWA 1B3XA 2ACQA 3F2CA 3GR7A 3O6CA 1S5TA 2YXXA 1SU5A 4JIIX 4O17A 4HHMA 2CZDA 3GM8A 3ARYA 3ITVA 5DMLA 2OT0A 5G4WA 1E51A 3NR0A 4RK8A 4UFHA 5DCBA 1FHUA 3QW4B 4M7TA 1CNVA 2JKPA 5CZTA 1XINA 4E6MA 1JZ3A 2NXIA 1LG2A 2PDUA 4XAZA 1MEIA 1UMYA 4IIFA 1O5KA 1F6YA 2HV5A 1OX6A 3OVRA 2J62A 1KTBA 5DRCA 4IP7A 4JPGA 4V27A 5L6UA 3FAXA 4K37A 1V0KA 2ZX8A 3SW6A 3WQPA 2V3FA 2E6AA 3D3FA 3UQNA 1NFBA 3NGJA 1OFQA 3UZ5A 2OEKA 1ZPTA 1AG1O 4AZIA 2Y6ZA 5HMDA 3URBA 2PURA 1KTCA 3A4WA 2Z1WA 2HVNA 2X1IA 2JIEA 1UBPC 1AK5A 5AC8A 2Z4GA 4ZSUA 3DFSA 3UNTA 1EJRC 1QI2A 2DT0A 3N34A 3S42A 3CL6A 2PS2A 1EB3A 2PD5A 3LI0A 3ES7A 2E5DA 4LB3A 2VWTA 1YDNA 1E5NA 4JKKA 3SCTA 3DGBA 1QHOA 1PHWA 1EGZA 3VIGA 1AZ2A 4PUUA 4LVDA 3AS3A 4AD1A 3HQOA 3H53A 4MZ8A 3WO8A 1YQ2A 5FF4A 1PKLA 1ISXA 1LLOA 2VI0A 5SWUA 4XSLA 4AWEA 2C19A 1OFAA 1FDJA 1J8VA 4W8LA 2J7HA 1WUFA 1U83A 2F6KA 4BS0A 3NQVA 4IQEA 1UC4A 3THUA 1LT8A 3WX7A 2C13A 1U5JA 1PX3A 3BH4A 1ISYA 5BXSA 3RJYA 3ZLFA 1PPIA 1WXZA 1HNYA 4DY1A 2G3FA 2P8BA 3B9NA 5I79A 1DQUA 4X9SA 2TODA 3L4VA 2PWEA 3UPBA 1TE1A 4GXWA 4PBGA 1T8XA 3NZGA 3AHXA 4V1YA 3UZYA 2QIIA 3TQPA 5LKYA 1GVRA 2G41A 4G56A 5LHFA 1SMDA 3CQ0A 4IJCA 4CGTA 3UEQA 3DZ1A 4FXFA 4L4LA 4XBSA 3V7PA 1LWHA 4R9XA 5I5RA 1QW8A 1REQB 3B4YA 4JICA 3S47A 1K3UA 5AECA 4C91A 1MQPA 1EP2A 4KEVA 4DYEA 1R2TA 3QQ1A 2C14A 4DJEA 3FLUA 2Y85A 3UZJA 4IPPA 3TXZA 1TPVA 4KF1A 2FGBA 4S3DA 2IKHA 4UMAA 4JFSA 4YPJA 2OGYA 4GFIA 3UJ2A 1EWDA 3REQB 4QP0A 1Q2RA 3M46A 4HD5A 3WNOA 1LOLA 3W7QA 3VINA 3NDYA 5DEZA 2IPWA 4B92A 1NDWA 4LUIA 1JYVA 1PEZA 1T96A 2E67A 2XUCA 3W7DA 1A3XA 3H4GA 4HU0A 2P5NA 4AH7A 3MUY1 3NWRA 3W7RA 3QGKC 4JCLA 1LUCB 4HHLA 4P7QA 1KV8A 1F3WA 4EOUA 3S3GA 4JTLA 3S1UA 1H4PA 2EBNA 5DT5A 1LDCA 4NX0A 3PZVA 5I78A 2DSKA 3MYPA 4CD7A 3IIOA 5LGZA 3NPWA 1J12A 1OFRA 4E0CA 5I24A 1ICSA 3NZ1A 1KM0A 3EWCA 4B91A 4BQ2A 1K4HA 4DWSA 1M7OA 1UP0A 2ZXAA 3UESA 1TPWA 1YNPA 1SVDA 1TJ1A 1SW3A 3MYOA 1HKMA 3N11A 4RPPA 2GYIA 3ZYZA 2HNHA 4LEFA 3THDA 1ECEA 3E38A 1JAEA 3VOIA 3TTOA 2OSWA 3Q2DA 3BJTA 5LGXA 2OFJA 1H5YA 1XRVA 1YKWA 3N2TA 2OX1A 4A3HA 3WNPA 5G4EA 2ZXBA 4MF4A 5E9XA 5T91A 4Z1BA 2DZTA 2F8QA 2QEZA 2W0UA 3OQ8A 3C0LA 3F4DA 3B8WA 3PWGA 5T9BG 4EPDC 4GVFA 4O16A 4IWWA 2WCGA 4RZBA 3LMZA 4KFNA 5F2IA 5EFFA 3C3UA 2VDGA 4KGLA 4EPKA 4LYKA 2JF6A 2XN0A 5DX7A 2WSPA 4JQ4A 3K4WA 1KXQA 1KXVA 4XD3A 1W2VA 1TPEA 3P5ZA 1JDEA 3O05A 3Q37A 1ZJAA 2J13A 1UWRA 3BE7A 3A23A 2Y5SA 3CXOA 1Q45A 3HO8A 1TJ0A 2JEPA 4PCFA 3NQMA 1R9YA 1G4EA 5DFAA 1OGGA 1J4EA 2Q8LA 1H62A 3NL2A 3SUWA 3KRBA 4PEEA 4K8EA 3PFRA 4BI6A 3WBWA 3STEA 1A49A 5TIMA 3VX0A 2ZFAA 4K36A 4Q4KA 5AC4A 3PJXA 4C5YA 1XYCA 2VUYA 2I9EA 3C56A 2NSXA 5I3KA 3ZOAA 3SSZA 1WBJA 1RA0A 5AC7A 1N8FA 3E2RA 3GNDA 1DXEA 3PBYA 3U7BA 2FZNA 2GSHA 2VVNA 1JDDA 2NUYA 1VB9A 2EQDA 5BROA 3B0YA 5BU6A 9RUBA 1EIBA 4HVXA 3VFLA 1EEPA 4JDYA 3F5LA 3UNDA 4MWAD 1ZBWA 4JTKA 4E2VA 2QCHA 4NUWA 4TU1A 3TYAA 3AHTA 5D9MA 3ZJ8A 4FB7A 2OZ3A 2OYKA 3GXIA 3M6YA 1PBGA 3EMQA 3S46A 4S3KA 2I9UA 3LTYA 1LWJA 3F4VA 1XYFA 3WLRA 1R3YA 3L4ZA 2E77A 4GH1A 1KGUA 1KCXA 2PZNA 1MUMA 3SQSA 3TR9A 2VEIA 4JXCA 2OWWA 3W24A 4MKVA 4IFKA 3PSVA 2Y7FA 3T8LA 1OGBA 5EMKA 1C7TA 2AKMA 4HK5A 2V5LA 4HK6A 4WVXA 3F2DA 2GSJA 4RDZA 4O14A 3TDFA 3M0XA 3VCRA 2YR1A 3GHSA 2WVVA 2YCLA 3O6YX 2QCLA 2PCQA 3LEPA 4N9EA 1V6VA 3LNPA 4WDXA 5EBUA 1TPUA 4AIBA 3OLEA 4L56A 3EOLA 1L6FA 4ZO9A 1D7FA 4AVNA 4FXRA 3BICA 1M7JA 3GC4A 2GDVA 4YMZA 3WMCA 3HGRA 4XD6A 3GG1A 3S5NA 4RE3A 1JCMP 3STGA 4PYSA 5M5DA 3PS7A 4O18A 4CNSA 1IGSA 5E9AA 3C0SA 2WM0A 3IV3A 4F0RA 4NZ4A 1QNPA 2C0HA 1XC4A 3MO7A 4IQLA 2NWSA 4WSKA 2W9MA 5T8GA 3EMCA 1A5SA 4H8NA 1PXGA 1ISVA 2VT0A 3FYPA 3W1TA 1EDQA 3D46A 4J4KA 1P5BA 1HW6A 4KH2A 3CL7A 4NIRA 3MP3A 2A3LA 1H7NA 2RKXA 4YVXA 2JBMA 3G2GA 5PTDA 1GYNA 2Y8UA 4GXPA 5J8LA 4CQCA 2JGQA 3NQ8A 1OVDA 2YCIX 5A6MA 3SUVA 1A5MC 1VF8A 3WLMA 3WZ0E 1W56A 2PB1A 5C2GA 4FXSA 1DJGA 3E2SA 2AKZA 1V77A 1MRAA 4K6AA 3GDKA 4A2SA 4IZGA 3U6WA 5GNYA 2ZDRA 1XIMA 3PZOA 3HPFA 3LS9A 3CT2A 3SCVA 1K6AA 2ZKMX 4RKAA 2A21A 4FOJA 1R3TA 3LZ3A 3TONA 1OABA 2X8RA 2NQJA 1CCWB 1LORA 2A4AA 3CASA 4O12A 5HXMA 2BOFX 4MVAA 4YCOA 5BU9A 4CCZA 2WJZA 2P3EA 3WQ5A 2CLEA 1MXDA 1G4TA 1PYFA 2IPFA 1YMYA 3G22A 3UWZA 4KERA 3XISA 3FKKA 4N2YA 3LCFA 4ADSA 1JFXA 4DJDC 4TMCA 1D9EA 1KQYA 2BY2A 3W1AA 4Q4SA 1PKYA 2QZRA 2R82A 1DJXA 4IGHA 1KBIA 4QJ4B 3WMLA 3L4UA 4C7GA 3WQCA 1PB0A 2PTXA 4GWEA 4YCPA 1Y0EA 4ATWA 1V3JA 3ZVHA 1O94A 3PAJA 4HPHA 3MUAA 5EPDA 3GB6A 3W7CA 1DIOA 1E15A 3N2MA 3V35A 5A6AA 3WQVA 1Y5VA 2V68A 3BJFA 4E38A 3M0ZA 3V4BA 1N2VA 2QUNA 3TC3A 2Z7KA 4A29A 1O66A 2Q02A 4LF1A 2BFGA 1JVNA 4X3ZA 4DQWA 2PE4A 4LVGA 4HMEA 3KCLA 3BLPX 1BYCA 3TFXA 1TZ9A 2DIEA 4WXYA 7A3HA 2FVKA 4PMYA 1DJQA 3G8EA 1HJXA 2GL5A 1WDPA 1E6QM 3A64A 4LV9A 3EX4A 1E72M 3NEVA 4N42A 1Q3NA 5B80A 1O68A 5E0FA 5CBBA 1XBXA 2C0AA 4LC6A 4NI3A 1RLDA 2FH6A 4WSHA 4PFHA 4CD4A 1V0NA 3UJSA 1DHPA 1OC6A 3CUZA 3BARA 3S8HA 3NURA 1YXCA 3QV6A 1EX1A 4S3JA 5G4HC 3WUGA 4DJED 1W54A 3V18A 3RR1A 1CGXA 4XSMA 1FA2A 4HN4A 1G9HA 5F4XA 2ON3A 4WEVX 1PZ0A 2DSUA 2BGSA 3FOKA 3R6IA 4FP1A 4HCLA 3ZJ7A 3QJAA 1QNSA 3UA4A 2YA0A 4GRSA 2VXNA 3QHNA 2MANA 4JCMA 1QDSA 3PG8A 4XD5A 5G1YA 1YDYA 4OKDA 3MB9A 1R2SA 2Y7EA 1BVZA 1JPKA 2V8ZA 3OU8A 2VEPA 4R7JA 2RDUA 1B31A 1H1NA 3FY1A 1LQAA 1NVMA 3TMQA 2I7GA 4JD4A 1EOKA 3AIUA 3W70A 3S1XA 4B4HA 4MJMA 1JDFA 3II1A 3JU2A 1DIEA 2PI6A 4D6DA 5ABFA 3N15A 3PJTA 2CFFA 3WNMA 2WPBA 3GX9A 1RVKA 4WKHA 1HG3A 3ZLHA 4UMCA 1CLXA 4J3TA 2HS8A 1F74A 5I07A 5CG7A 3RU6A 3N3MA 4XQ6A 3M07A 3TJLA 2I1OA 4WKFA 1JZ7A 4YWIA 2WMGA 4RW3A 3UJRA 1BYBA 2A85A 4ML4A 2FGZA 3D47A 5AOUA 3AMKA 4FLSA 3RNDA 3VZZA 1K6WA 4K1WA 5LIUX 1C8XA 1D3GA 1TIWA 1EJXC 2GGGA 3BCJA 2XIBA 3HG5A 1IXQA 2VZOA 5EL1A 4BZYA 4DWSD 4ZOBA 1MZHA 4AVFA 2VELA 5M1TA 1ADSA 1FRBA 4WXZA 1K7FA 1IWPA 3HOJA 5KZ6A 2CEQA 2HK1A 1IXOA 1KCKA 5LNWA 1EWEA 4K38A 3AZTA 3KS6A 4PB4A 3WD0A 4XTIA 1AJ2A 1NDYA 3BL3A 2PBOA 2ZZ5A 3SRFA 7ODCA 2PP0A 3VGEA 2Y61A 4GUFA 2Z7GA 3SN4A 2A6LA 4O8AA 4NF7A 3VMNA 4GK8A 4F48A 4PMXA 3H2CA 1XF0A 2BXVA 1IQ8A 1K9DA 1V8EA 1OADA 1TO3A 1Q8JA 5DQPA 2GK1B 3BUVA 5A8PA 4IFOA 2VX5A 1GGOA 3R2GA 1H50A 2OQYA 1E0WA 2PTDA 4DIAA 3PTQA 2O7SA 3THAA 1PJ9A 1VJSA 4NAFB 2FTWA 3AWNA 1F8MA 3SCOA 4GO8A 4GVIA 2Y5JA 1QBAA 5BYWA 3NVTA 1LUCA 1GK8A 3TYBA 4HNCA 3S9ZA 3TW7A 4AHPA 2Z2BA 3BQ5A 3F03K 4L5ZA 4JY9A 2PWVA 4DBEA 1F4HA 2A1YA 2GUUA 5C2XA 3PK7A 2O4MA 2GWGA 2WOQA 3QFEA 1T40A 1R3RA 3KLLA 1OBAA 4HNVA 4GBDA 2IXVA 2W79A 1OCNA 4B5XA 5H8PA 3L66A 1G0CA 3TKFA 4YTRA 4ML9A 1WA3A 5LSMA 3KEHA 4AIOA 1XUUA 3SR7A 5CBIA 2BG5A 3GG0A 4RXGA 3CUXA 1UQYA 1UUQA 2QCFA 4GG9A 1UA7A 1FHLA 3LV6A 4US6A 1WV2A 3AIVA 5LIXX 4NZ3A 4P8WA 1W1ZA 1GOXA 4KCWA 3UWVA 3UR7A 2FTPA 1I45A 3QFWA 1OB0A 4MWAE 1XLHA 2A3EA 3N2BA 5EA9A 4YYCA 3DECA 3VVGA 2G37A 3C0QA 3KM8A 4AZBA 4QTGA 1KC7A 4MPKA 3NQ7A 1YPIA 2Z1SA 1EJTC 2OVLA 2PDNA 1LQ2A 5GQBA 5D09A 1J18A 3CZ8A 2P3ZA 4ZFCA 4ZENA 1H61A 3NQCA 5TD4A 1Z44A 3W1QA 3DG7A 4C6BA 4FNRA 5HPCA 4AF0A 2GJLA 4F9JA 4C6OA 2XZ9A 2ATMA 1PCKA 2G3JA 1Z48A 4GQRA 3B97A 1JG9A 3VCNA 3EXRA 2QDGA 1HUVA 1XGDA 4AHOA 3GW3A 3EDEA 5KEZA 2Q71A 1M41A 3U9IA 2J7CA 4BFAA 4KWVA 4PRWA 2J74A 3KL0A 4IPIA 2FYMA 4JEQA 1FXPA 1G6CA 3CV1A 4XZNX 6ENLA 3VC5A 3ZSSA 5AHEA 1KRMA 3SRDA 1E4NA 2DJXA 2CIPA 4MYAA 3A22A 1S5WA 2QCDB 5M3WA 2D2OA 3QKEA 3BWWA 3O9NA 3N4EA 4JQ3A 1C3FA 4OBSA 3P3BA 4R85A 1W1IE 1Z89A 1PAMA 3PPHA 3GIYA 5ABEA 2CKSA 5CPNA 4B3KA 1DJNA 3T42A 1QK0A 3LG3A 4IIEA 1PCWA 3NZPA 3SCQA 3QMSA 4ERIA 2H3BA 5JIWA 2QPXA 1JL8A 1E6RA 1NU5A 1NOWA 3L65A 4J3WA 4B9YA 2ZA1A 1L6GA 1WYIA 1VQTA 4XZLX 3IIPA 3W7LA 1SFTA 5A6BA 1AH3A 2YFNA 4D6JA 4Q8QA 4J3XA 1BQGA 5IHSA 3LLXA 3W37A 2BASA 2CLIA 4XWUA 3LB0A 2VL4A 1JPHA 1FQ0A 1C7SA 4BR1A 1E4IA 5FEWA 3AU2A 1GVQA 1V79A 2PDKA 3TEVA 2YSWA 3UD6A 2ZC8A 3F4CA 4NG3A 5CGTA 2Y8KA 2INEA 3UJEA 3VDGA 3LPGA 1DYSA 3GDLA 1P7TB 1E9LA 1ZTVA 2NVDA 1ZQ5A 3T4CA 1F5ZA 1MDRA 3R13A 4Y96A 3O3RA 1VHCA 1EUNA 1PE1A 3EOSA 1KM4A 5DO8A 3N29A 3AICA 1F07A 2BWGA 3B05A 1H41A 3K8MA 3QRHA 5J5RA 3T0AA 3O7UA 5EBAA 1GKQA 3AISA 5LIKX 4AEFA 4MAVA 5REQB 1Z32X 3B3DA 1UR4A 2W91A 1RK5A 3EKGA 3IRSA 2WQPA 2E9BA 3VE7A 2Q09A 3B8DA 1RCQA 1NP0A 4KCUA 4IJBA 4Z1CA 1CT5A 2WMIB 2D0HA 4ZB0A 2AQWA 3H70A 4W84A 4MTVA 2DEPA 2QJNA 3IJIA 4UTWC 2DY3A 2ZZ7A 3IJQA 4DNHA 3VM5A 5AYXA 1SYTA 3LK6A 4PFMA 1XLAA 3PJUA 4XZMX 3KTSA 3CK5A 5K7JA 1FHVA 3FK4A 2ACRA 3N9KA 3VIOA 4Q4RA 3CZJA 1I2NA 1M9HA 3CUGA 2XISA 4J1OA 5I2UA 1UR3M 1YBQA 4RE0A 2C1IA 2XZ7A 3L5AA 1ZL1A 2CWNA 2QCNA 2OOFA 1MQQA 2O0TA 1H60A 3STPA 3S0CA 4LYRA 3ITLA 5EB8A 4JNYA 1NARA 3S1VA 1PTDA 2BVWA 2Z27A 3S6TA 1OX4B 4W5ZA 3UY7A 2HCVA 7PTDA 1POJA 2ZUTA 1UHVA 3CEUA 3OVQA 1UZ1A 4LBUA 3T2OA 3CC1A 2GUBA 3PPGA 5LA2A 3H22A 1NM9A 4EK7A 1D8CA 1JR1A 1R3SA 2CLMA 4Z17A 5C9ZA 5HMSA 4X0NA 1KW1A 4PBFA 3DKLA 4HJFA 1M3UA 4IUOA 3P60A 4DHGA 4IPJA 2FVLA 1WP6A 4O1AA 1LL6A 1JZ4A 4GFSA 2FJUB 2VCCA 4PRRA 3GU2A 4IMAA 3TTEA 3WMBA 4D6IA 3PANA 1I9CB 5D02A 1JZ5A 4OBTA 4O19A 5C9XA 3SGGA 2VZSA 3PPCA 3ELFA 4FOKA 1UROA 2GGEA 1W3IA 1VPQA 4WHBA 1CB7B 4P7RA 3O8AA 2XVGA 4PR4A 3PWIA 4R27A 1XQLA 3RYSA 4AZGA 1KD0A 1WUEA 3WQ4A 3P84A 2J9ZA 5A8OA 1EKOA 1UD4A 3ITOA 1YPFA 5HR6A 4O54A 4Q6XA 3W7PA 8XIMA 1NDVA 3GDMA 3KRSA 3TN4A 4IPLA 4C5ZA 2WANA 5EY5A 3GNOA 3RGTA 1Q4WA 4IQDA 3GG7A 4Q7BA 4FOUA 2KZHA 1UW9A 4FNSA 1DVJA 4M6PA 5E6ZA 1XDLA 4FIQA 1F8IA 3WG6A 1WDWA 3LGEA 2Y7GA 2YL8A 4ADUA 4MZ1A 4AAJA 4L64A 1ZRQA 5DMYA 2YGYA 4DJFC 1UA3A 4EF9A 2E8YA 2REQB 2XSXA 4B2DA 5LA0A 5HJLA 4FSAA 3W7JA 2BSLA 1GYMA 1WXJA 4YWSA 3N2OA 4LALA 1XIDA 3W82A 2OSYA 5K9CA 2EKCA 3AROA 3TOYA 2X09A 1GVEA 1UG6A 3SN1A 6REQB 3G0UA 1QI0A 5A69A 3VNJA 2EEXA 4R7OA 1RP8A 3TQVA 1AH4A 2HJPA 3HQ1A 1BEUA 3HB9A 3GZ3A 3GSMA 4DJDA 1GW9A 4HSOA 4LEQA 2WLYA 1UMLA 5CSYA 1GJWA 1BFNA 4R3UA 3H4WA 3AS2A 2YYTA 2W66A 4MFEA 2DVUA 3AHVA 3V3WA 2H9AB 3BAJA 3K1DA 3W72A 2B7QA 3GRIA 2OT1A 3EX6A 2ZXDA 2YXOA 2XFRA 1E9ZB 1FXQA 1E3ZA 3VIMA 3DCPA 6PTDA 3INPA 1TTQA 1JQVA 4IPNB 4REQB 5CG0A 3N13A 1XKJA 2A3CA 1QPQA 2F2KA 4H6KA 4GH3A 3KS5A 4JN7A 4C6JA 4DO5A 3LHVA 4GYPC 2J27A 3UXIA 1U22A 2V69A 1SFLA 3PTMA 3BANA 4RNIA 3FAWA 3CO8A 4D1JA 1E40A 1UD6A 4NASA 4I9MA 4HU3A 1XLLA 3LX9A 3ARXA 2JGYA 3E96A 4Q22A 4H6EA 5E6YA 3MSRA 4IL2A 3USZA 3OHMB 1A80A 3LN3A 5JBDA 2YZ5A 3T07A 3WK3A 2Z2UA 3NZRA 3L67A 1D2KA 2OYMA 1A4LA 3U2OA 2QCCA 5D4YA 3GNPA 3WDHA 4V15A 4GMEA 4LPCA 4QJ5B 2J24A 2FKPA 3RX3A 1OX5A 3GTXA 4C6QA 1TWZA 2A3BA 2YDAA 4X63A 1QUMA 2OTDA 3EEZA 2OLAA 4O11A 4UNLA 5D8ZA 4JN6A 4GIAA 4L4OA 4MJZA 4MY1A 3W4RA 3T81A 4KRTA 1V3MA 4IX0A 3TZFA 4PCPA 5FF0A 4Z2HA 4F8XA 3RM8A 2YJQA 3RAOA 2X2YA 1RY8A 2RH9A 5CPSA 4Z2LA 3M0VA 4GXMA 3FJ4A 2GK1A 1GG0A 1RQBA 3CWHA 4NZCA 1R38A 2VC5A 4JBRA 2YLLA 5D2VA 3DC8A 2HS6A 3F5KA 3LRLA 4L6HA 1DV7A 1Z69A 3WQEA 3OBKA 1I75A 4RLIA 4DF0A 4IT1A 3W28A 5HJYA 5FIPA 2WVTA 4ORMA 4HOWA 5C0QA 3AMLA 4H2CA 2CBVA 1S2CA 4N0RA 4GZJA 3NSMA 3MTWA 3DEQA 3EDDA 4WSJA 4DUOA 4GI4A 3CAKA 2JK2A 2C16A 3IVSA 4ORIA 3BG3A 3VD3A 1F3EA 1P6WA 1X8CA 3RCYA 3MDWA 4M19A 2R91A 3ANUA 3RLHA 1J9YA 3BLDA 1OHLA 3UYCA 1W5PA 2QYGA 3G1AA 4XAFA 4M29A 4EF8A 2VC6A 3BPWA 3DU0A 4I8DA 4FNTA 3IANA 2J66A 3L23A 1V3KA 3F7JA 1OK4A 1FBAA 2HPMA 4GC3A 2NZLA 1N7KA 4NXKA 1KNWA 5KZMA 2ACSA 1JNEA 4FZIA 4ICNA 4DZAA 2VR5A 1JPDX 5BMWA 5CC3A 1Z3NA 4QR6A 3T55A 1E0TA 2YZRA 1HVXA 1HJQA 2NV2A 4GC4A 1E4LA 1MDLA 5A6BD 5DMNA 2A7RA 1MNSA 5CEWA 3CZKA 1UD3A 3HURA 2E9MA 3T0BA 1P6CA 1Q6FA 4GD0A 3OZPA 1TVNA 1QO5A 3GVVA 4KCVA 1N8IA 5HNRA 1BSLA 2GJRA 4ZBCA 5BXTA 1XI3A 4BWLC 2ISVA 3N1AA 4WGXA 4RZ6A 4CU8A 1HN1A 3VKAA 4XKYB 3HFTA 3W2KA 3ANYA 3LGDA 3U0HA 4JX6A 3A9IA 1KFWA 1XICA 1HVQA 2I57A 3W1LA 1PTAA 1TJPA 2CW6A 5CGQA 5IBXA 4EXAA 4X0VA 3IAQA 2VHLA 2X30A 4D6EA 2QCDA 2V5JA 5RUBA 1TZZA 1XLKA 1RVGA 2Q8XA 1VFSA 3R94A 4A8RA 4I7VA 2OEJA 1B3VA 5L9FA 1FWSA 2BY0A 5G5IA 2WNQA 3FEMA 1E0UA 3G8RA 1WX0A 1H3GA 5G2HA 2D73A 4KBXA 2X42A 4Z1AA 4PBEA 3WMSA 1MYRA 3CJPA 4J35A 3ZS4A 1KKRA 2TSYA 3GS6A 1MSSA 1RHCA 1JYWA 4AD4A 3WFLA 4IM4A 3T9PA 3HGOA 3GKAA 2O92A 2YA2A 5E0KA 6A3HA 1C9WA 3QY8A 3TMLA 4FLOA 1XDJA 3M5VA 5BRBA 8TIMA 4A21A 3W88A 4RUBA 2X1RA 1T6MA 1YXYA 3MV01 3HJEA 4XAGA 1Q4NX 3BG9A 3K5XA 3VKKA 4JHMA 3O6DA 1G7VA 1TWSA 5HQEA 3EKZA 5K9DA 1HL2A 3WLJA 4UIOA 3QW3A 4AXKA 4NQ1A 1PYMA 1ZNNA 2V5DA 1DP0A 1ITXA 1YE6A 3EWUA 5T9CE 3W1NA 1XXXA 1VP5A 4G7FA 2YBUA 2DQWA 1TV7A 1SMAA 2JQXA 3H7VA 3AIBA 3ISIX 3OG3A 1UKSA 1IZJA 3DHUA 1S39A 4PB3A 2IQ0A 1EQCA 1J01A 4EAMA 2GVLA 2G3IA 1HL9A 4GYKA 4R7WA 1FWAC 2NLYA 3S83A 3CH9A 3G24A 3TTSA 3WEZA 4MOZA 2WJEA 1H7WA 4Z08A 4XBKA 3IVTA 1HJSA 4JFTA 4Q8OA 1IT7A 3CHEA 1XLEA 3EOUA 2WMHA 4UNIA 4YTTA 4B9ZA 3B0UX 4KEMA 2QLYA 2ZICA 4UMBA 1A5UA 4TUFA 3MWAA 1P1XA 1TPDA 3N6QA 2GWNA 3G1SA 3W29A 4LQ1A 1AJZA 1UPPA 3ZVIA 3TU9A 3FJ6A 4HTYA 4AD3A 1VCVA 2WMIA 3AO0A 2ZRZA 3FXGA 4DXXA 5EFDA 2VRQA 3VU2A 3DXIA 1G4PA 3VM7A 2QR6A 3WF2A 2D22A 4EXBA 3WH7A 1ODUA 2L5HA 3ABOA 2PLJA 4CNUA 3GYCA 1PZ3A 1XH1A 4NZJA 1BF6A 5A6SA 3FW6A 1XG4A 3VNLA 4FX7A 3ZXWA 3IJDA 3WLQA 3RUBL 1IE7C 4XAPA 1KLYA 1C90A 2RDWA 3S5SA 1OQFA 2C1HA 1JYNA 3OIXA 4GUGA 3DG3A 4GINA 4L4MA 5AN7A 3B8SA 1OX4A 2J88A 4UZUA 2BXYA 4AZCA 3BC9A 3ES8A 1WE5A 4CVWA 1CIUA 1A47A 4UOQA 2WCAA 4I9TA 2VZTA 2PDBA 2PU1A 4MWAB 1W32A 3I4EA 3MA8A 4DLMA 2FGLA 3AMDA 3P81A 1A50A 1OFOA 3VNDA 5JIPA 1UR9A 3AYVA 4WUIA 4H6RA 4NHVA 2D2GA 3LY0A 4XZWA 4DPPA 3P82A 5EKYA 2XFFA 1H0GA 3RCMA 3MHGA 2I5IA 3TZNA 3A5VA 3W26A 3ARUA 2V3DA 2ALDA 1BVWA 2PWUA 4PTNA 2A6NA 2YL9A 1MRQA 4L7ZA 4NJKA 4A6GA 1ZFJA 2ZX7A 3VGFA 2J9XA 2VGGA 5GJMA 3AUOA 3C61A 1Q13A 3QPZA 1HXJA 3O06A 3VD4A 1UD5A 4JTSA 3WYZA 2CHOA 2FIQA 3FX4A 1A4MA 2BODX 4HK7A 6XIMA 1TTIA 1HQTA 2YLAA 4GI9A 4OOUA 2PUZA 3UU0A 3HQNA 8CGTA 4ZO7A 1CDGA 2RJHA 3HV8A 3OGSA 3ABZA 1YX1A 2XWDA 3CHCA 2EKGA 1KGXA 3UW6A 3W73A 4UTMA 2G0WA 1K9FA 1T0OA 3IVUA 3BSMA 3V1HA 2Z1XA 4X9YA 4IMCA 3QR1A 1B3YA 3DOPA 1GOIA 1TIMA 1TPH1 1XLJA 3U48A 5BXRA 4ZSTA 1UH3A 2A79A 3EZ4A 3M1ZA 3V5FA 1J0ZA 2HEJA 2ZYFA 4HSHA 2CYGA 2Y88A 5A6KA 4UTJA 4UQ9A 3LHZA 3OBAA 3QKZA 5E0CA 3R8HA 2PP3A 7TAAA 3SEPA 2R9RA 4JEJA 3WDPP 3VFCA 2DT3A 4PGLA 5CPMA 2WJDA 1QHZA 1UJPA 3EXSA 1XIEA 2A3AA 2CHNA 1ML1A 3UY8A 3W6LA 5FF3A 4JKLA 3ITCA 3W7OA 1YADA 4UC5A 1OFEA 4QITA 5B7YA 1R85A 1XDMA 3BGJA 3PULA 1O12A 3GO2A 1KM3A 2WW5A 1MQRA 1AD1A 1ZBKA 2H9AA 4R88A 1TQXA 3I10A 2AMXA 2PRHA 3VUPA 3BLKA 2MNRA 4K7VA 5EMMA 1PWLA 3MMTA 3CUIA 4A8NA 1XLCA 4LUSB 1H11A 1LTDA 1BSIA 1C9DA 3IAPA 4REQA 4M0XA 3T4WA 2FZDA 3NTYA 2FJKA 5HQMA 4D8AA 1LRNA 1E6XM 1TPFA 3ABXA 4UTUA 2VFHA 5I02A 5BCAA 1EYEA 3BG5A 2PWDA 1NOUA 5C6MA 1I4NA 3IGSA 2X1SA 2Q01A 4IIGA 4RNHA 2UY2A 1ZUAX 4TXEA 1GQIA 4LSBA 1VENA 4TQTA 1UKTA 1DJWA 4E3VA 4ECLA 2PGWA 2XH2A 3UWWA 2Y8VA 3SECA 4DZIA 3W2LA 3ZJKA 1AJ0A 2WXDM 3BW4A 2WJFA 5DN1A 2G4FA 5FOOA 3B8IA 1HGYA 4LTSA 2PDYA 3ABRA 3W71A 1R6WA 4OUIA 1WZKA 1GOQA 4XTDA 3SN0A 2CLPA 4L9ZA 1HJVA 2VGBA 4WY0A 3HPXA 3M0IA 4X2RA 3P0WA 1GZJA 4PMJA 3WJZA 4H3DA 1EXBA 4NX5A 3MI2A 3AOFA 2UWFA 3PG9A 5U7SA 2CETA 1CYGA 1Q6GA 5HUOA 2VX4A 1FCVA 4D6HA 2F2HA 2XGIA 5A8MA 3VC6A 2PGRA 4D8LA 4HCDA 2BXZA 4KIRA 4GCXA 1KR0A 2GSEA 3E02A 1EFZA 3N73A 5KMYA 1DTUA 3RLVA 2V2HA 3EWYA 4G1KA 3NVDA 5LNUA 4GLEA 4DWDA 3ZR4A 5CBJA 1H1ZA 2FFCA 3VIFA 1SPQA 1HKIA 3MWCA 3CEPA 3W23A 1RZMA 5HQLA 1V02A 4JTTA 1QT1A 1RJPA 3NQEA 4GYPA 4QAWA 2GDQA 2RUSA 2D23A 2QUVA 3PZGA 2EPMX 3P80A 3EEGA 3VOJA 1VKFA 3B03A 8XIAA 2BY1A 1Z6KA 3FA4A 1BKSA 3N19B 4A3YA 1OF6A 3TYUA 4GNKB 3NUKA 2FB3A 1C29A 4ACYA 5HNUA 2J78A 1K77A 1YNYA 3G6LA 4BA0A 1NJJA 3E12A 4A22A 4NZ1A 3RX2A 4L1XA 4AWUA 3PBVA 3W25A 2V5KA 3R10A 4IX2A 3VO0A 4TTGA 1JCNA 2FDMA 1W37A 3M44A 2Z2AA 1NIUA 3L12A 3VXGA 3Q94A 3LHTA 3FV9A 1DL3A 4GABA 3E9AA 4RPQA 1I6NA 3HMCA 1A0EA 2PDGA 4Q7IA 4KWWA 1XLBA 1UJQA 1UR1A 1ITCA 4H00A 1U5VA 1FWTA 2BP1A 4W7VA 1JF5A 4RDWA 3PTKA 4ZO8A 3R7MA 2Y24A 2ZX5A 2CCRA 3A4AA 4E8CA 4YL2A 4IOTA 3VABA 1GORA 1G94A 1A5CA 7ENLA 1OCBA 4LAKA 4O10A 3UPWA 2PD9A 4IMFA 4QX4A 2AAAA 2HBVA 3KHJA 2XN1A 1ICQA 3PZ9A 4ZQCA 1RXOB 4IIBA 2ZBTA 5A1AA 1S3HA 1DPMA 4C6CA 2F84A 1R2RA 2TRSA 3O15A 4LUJA 4PMZA 2D2JA 4POCA 1FFQA 3W53A 3H7UA 2W4XA 1PL9A 2PCEA 3DG6A 4XKYA 4DZ5A 3QF0A 4F3HA 1UYQA 1KLZA 8RUCA 3EWZA 5DF0A 1FDZA 4NP7A 4GO9A 3VNZA 3TWAA 4R34A 3BLEA 3FS2A 1L8PA 2I5GA 3SSJA 5BNKA 2CZFA 5KZDA 3DFQA 2C79A 4MB4A 3RPTA 4Y9PA 3LD5A 5C2CA 5F2MA 3V5OA 5FJJA 4KIEA 3GIQA 2WZIA 3BCDA 6TAAA 2CITA 2CBUA 2W6RA 1KBJA 2XSAA 4HNNA 4W4QA 1TR1A 4QDPA 4ZQNA 3W2NA 1A5AA 3L4TA 3LPFA 3J7HA 3S4TA 1OT2A 4PC8A 4J3ZA 4MLJA 4H9VA 4H1ZA 3R8RA 1RH9A 3B8UA 3HG4A 4JIEA 4IJRA 1QBBA 4G1NA 1C8YA 4J9JA 3W1XA 4L9XA 5D2YA 3W1MA 4DO6A 3R5EA 1POKA 1TWDA 3PPFA 2HWGA 3W84A 4WY0F 3G77A 2PFHA 2GQ9A 1H7XA 1H63A 4GQ0A 3W6MA 3KOZA 1P1MA 4BWLA 3RK8A 3DH7A 3WD4A 3QVQA 1J79A 3EA1A 1V5XA 5I3FA 2X16A 2EHHA 4KFOA 1GCYA 3W6YA 4BF7A 1UKOA 1WAWA 1NWTA 2QDDA 4CQ8A 2B7NA 2JKEA 4UWMA 3D0CA 2VKZG 3TJXA 1GOKA 4M24A 1NY1A 3VD7A 4ACZB 1GHSA 4WGHA 3S1WA 3TYZA 1GG1A 2BMBA 1V0LA 3UGRA 1YDOA 2DV0A 1GVFA 1XLIA 4K8GA 4RDVA 3VCCA 4D6CA 2ZTJA 4I5RA 1GW1A 3AXMA 3FXYA 4B4FA 2E0PA 3AXIA 4CNPA 5H91A 2EPLX 1PZ2A 5U4NA 3HU7A 2OO0A 2QDHA 4MM1A 4RDYA 2QVHA 1K8ZA 3SJ3A 3PUEA 3PUGA 4TR9A 2WNNA 4ZODA 2PA6A 3BLFA 1XQKA 1EA9C 4HZ7A 2ZADA 1UWSA 2RDTA 5GVJA 4HT3A 2YL5A 2KX9A 3OBEA 4LVBA 2J7FA 4XVEA 2BVTA 4DI9A 2WMFA 2XVLA 1VEPA 1P0EA 1IZCA 4K8HA 3NEHA 4NJIA 4XV0A 3R0KA 3TYCA 4NAEA 1Z41A 3R43A 3WKZA 2C18A 2NXHA 1E70M 2O9RA 4XG1A 1PIFA 5JMUA 3WY1A 2IMRA 1EJUC 5BRPA 4EACA 5A6JA 5IFPA 5JH2A 3B0XA 2WZMA 4UBPC 3TV8A 1KFLA 5LNSA 4YU1A 3P61A 4ZQPA 4P2VA 3CTTA 3JR2A 3LRKA 2ZUVA 1W3HA 1ONXA 4GYJA 2VEGA 3RM9A 5E5CA 1GVOA 2NQZA 4H04A 4Z0SA 1Q5MA 1TA3B 4WZHA 4EPBC 1CXIA 1FH9A 3MJMA 1KM2A 1SM9A 3T2QA 5TF0A 3SQLA 4N6EA 1UZ4A 1QPRA 1P6BA 5F4WA 2FHFA 4H19A 4P8UA 2OU4A 2TPSA 2E09A 1KCZA 4LV4A 3GLCA 2QMJA 3O0FA 4HZ8A 1W1TA 4I8YA 2OG9A 1RD6A 3C8FA 3W3OA 2V0TA 3KBNA 5EGRA 3HGJA 1XIIA 2EG7A 3A5FA 2WSRA 4ADTA 2VDIA 5FJPA 3WDIA 4E3TA 1F9CA 1AD4A 4H9YA 3C0JA 1AH0A 3CMJA 2J7DA 4QSFA 4MKSA 1TV8A 1Y8BA 1GYLA 3PM6A 3PHAA 2QAFA 4HPXA 4H7CA 2GOKA 3GXDA 2LLEA 3OZMA 1VZWA 3EX1A 2IQDA 4WOQA 3WJSA 1L2UA 2P53A 4AD2A 3RLGA 1GPFA 2C6QA 4F0KA 1TJ2A 2CXEA 3HIJA 4S1FA 3B8TA 1ECQA 1WAUA 2YXGA 3KBVA 5LNRA 4CD6A 4J5NA 5BW6A 2V3GA 3A4XA 2FDSA 5I3JA 1X1OA 2BVDA 3ZVHB 3CMFA 2ZXQA 1PDYA 2GVYA 3MQTA 2QF8A 4MB1A 4S3GA 5DY2A 1LBLA 3S2CA 1XBZA 1VBUA 2Z6JA 4HN8A 1CEOA 1YTEA 4QNEA 3VIPA 4P8VA 1S1PA 3HPAA 4JYDA 1N82A 1CGYA 5AHIA 3A12A 5TQLA 1EBGA 3GKFA 5G2WA 4NU7A 3NQAA 3FDKA 4C7DA 3S9YA 1CENA 1WZAA 1EO5A 2NUXA 3WUEA 1VR6A 1BYAA 4FR1A 4RV8A 3CPUA 4MJ4A 1RP9A 4GZIA 3PTDA 1VJZA 4LUSA 3KWSA 4I9AA 1XCFA 2HXUA 4PTXA 1BD0A 6CGTA 1NF0A 3LCIA 5CLTA 3IJ8A 2FZ9A 2XSBA 1E1FA 1GQLA 1XC6A 1LLWA 1GQNA 4KRZA 1KO0A 3CQIA 1JGMA 3B06A 4B90A 3N04A 4DYJA 5FAJA 2CXGA 1VIZA 4H7ZA 1SZEA 4EANA 3USBA 1XP3A 4OBRA 4XZIA 4FIRA 1RCOB 3DFPA 3GXMA 1KM1A 3KL3A 3WBXA 2V63A 1XHGA 2R1MA 5CZJA 3W76A 2HVMA 2PU0A 4OV9A 1SSGA 2JEQA 4C6EA 1O5RA 3OB8A 4IGMA 3MO4A 3LQLA 3UCQA 1FH8A 4G8TA 4B16A 3PF3A 3UT0A 5ABFB 1YTKA 3WD3A 3MSDA 5H8MA 3LHYA 2GVEA 3EWWA 4F2UA 5A95A 3EAUA 2DZSA 4E2DA 1RQHA 1JI2A 2FZMA 3AMGA 4R53A 3T7VA 2QGYA 2F7FA 3CPRA 4S3FA 4R33A 4HCHA 1IIHA 4DF1A 3ITYA 5BOFA 2J77A 3OYZA 4U2YA 2QJGA 2Q6ZA 3T09A 2D0FA 1W0MA 1UASA 3G0XA 4XO6A 4HA1A 1QW9A 2YYUA 5A5WA 3WLPA 2P50A 3GUWA 3WH5A 2WVUA 5M17A 3WQFA 1VJIA 2EF9A 2E9LA 3WD1A 5DLCA 4AZ5A 3S2LA 4GE8A 3BXWA 2OWCA 3U2EA 1QWGA 4JFWA 1XCWA 3ALGA 4MNKA 3QLLA 1GOWA 3ZT5A 3FIGA 1PS9A 2NQ9A 2H3DA 1TCMA 5E93A 3KRUA 1KRCC 3G18A 1EZ2A 2B7PA 3VYLA 3O0KA 4FALA 3SURA 3AXHA 2YCJA 1SFSA 2VEFA 3ARPA 2XIOA 1EL3A 2PZ0A 3HN3A 3IGHX 5FJRA 4V33A 3W02A 4N02A 2PDLA 3NPUA 2Z25A 4GNJA 3FHAA 1VYRA 3B8VA 2AOSA 3H2MA 3IIVA 2Z0IA 2P10A 1NQKA 1Y5XA 2VTFA 2WMJA 2HBXA 3NFUA 2DT2A 3T8QA 2CWXA 2WSQA 2DZPA 5AHNA 5IOBA 3GVWA 3PZIA 3P74A 1CW2A 2J79A 1P43A 4XUYA 5D8WA 1JCYA 3LLDA 3M0LA 3R58A 2WSYA 3I6RA 3WF3A 4M81A 2FZBA 4ILSA 3QTGA 1JCJA 3JZEA 4LVFA 3UF9A 4UR7A 1E6SM 5DXYA 1TCDA 1XSKA 4R5EA 3ZWTA 1RSCA 1VC4A 2XINA 3VKJA 4Q8VA 1XPYA 4BQ4A 1RY0A 1FY6A 1W5QA 4J2MA 4KWOA 4HKPA 3WLHA 3A3HA 1XX1A 4URIA 1K7XA 4CQAA 4JIHA 2DZVA 3CT7A 4MIMA 2WO5A 3WN6A 1EIXA 3TYDA 2RGMA 2DUXA 1ZS2A 1F6KA 4JTIA 5D03A 2QJMA 4K39A 4K68A 5G2IA 1WBHA 2CERA 4FPSA 2YW3A 4LRSA 3W86A 3MV11 2C71A 5XIAA 4E8DA 1TV5A 2WNWA 1ME9A 3BMWA 3TA9A 5AC5A 1UZDA 3HQPA 4AF0B 3E74A 3V0UA 4LUTA 3SJNA 1B90A 4UQEA 2J8FA 3TN5A 2DVTA 3MUXA 3CHFA 3M5XA 1CZ1A 2GJXB 3B04A 4JTDA 3WELA 4C6MA 4M6UA 3ERPA 3PZTA 4QLLA 3SUUA 2J8GA 4LC8A 1WB0A 1V6WA 1ADOA 3KXQA 5C9WA 2WZTA 2X1TA 5D9PA 5ENLA 4A2RA 4K2SA 2VC7A 2Y5EA 4F2TA 1XKYA 3BZGA 1J93A 2EO7A 3P8JA 3H55A 4M82A 4I6VA 5IFTA 1GVYA 3G1RA 4KRUA 3A47A 4ZE5A 5HR7A 1K8YA 1EJVC 1US2A 4DB7A 1YE4A 2D2HA 3W2UA 2VRKA 3C2OA 5ABGA 1W3TA 5KTLA 1ZHAA 5C9UA 2FB2A 4PSRA 3FFSA 2FHBA 3STCA 1V6UA 4D8ZA 3VGGA 3DBPA 3B9OA 1BHGA 3WLOA 1OG6A 3CQKA 3QZAA 4PUJA 9XIAA 4H7VA 5CC7A 2OLSA 1AQHA 4UB9A 4B3LA 1DJIA 2VD9A 1GNXA 4ACZA 1MO0A 3B9AA 1Q7QA 4MAZA 1SO5A 4BEQA 2CZ5A 2RJGA 4LBSA 4E4PA 3WH9A 3CMGA 4MFDA 4JYFA 2EPOA 2GPTA 4CKQA 5CLWA 5K4XA 4AWTA 3PFMA 1J10A 3NO5A 3TQ0A 5AYZA 1M5WA 4O52A 4XX6A 2DSVA 3E6EA 1W1VA 1OCQA 3CAWA 3QPEA 2WSKA 4CD5A 1BTCA 2EGZA 1O60A 4J3VA 3HMJG 4IL0A 1MI3A 1I2QA 3BZJA 4PUDA 4S2BA 3B9EA 3QR0A 5AYYA 2E5CA 1XGZA 4ZB5A 1OFDA 3HBLA 3E2QA 1C92A 1LJYA 1VFFA 2JALA 1EDTA 4LJ3A 1UR8A 4MLRA 5BMXA 1Q6OA 4DEFA 3M0JA 5C55A 1Z42A 2ISDA 3RFAA 3T1GA 4EE9A 3I65A 1IEVA 3W00A 4NZ5A 1NDZA 1ZALA 1XRFA 4M56A 2DUAA 2ZCGA 3V0SA 1VFLA 3T2PA 4OVXA 1BWVA 3PR2A 4GUIA 5I3DA 3AYRA 4JX4A 3E0IA 1EEXA 3LI1A 3VDHA 1SO4A 1VGAA 1K70A 3GR4A 1SZRA 2C15A 4HJWA 4L61A 3M47A 4OE7A 2W27A 3R0DA 5HPOA 1YBQB 2O9PA 2ZTKA 1KCLA 1RJQA 1DWGM 3CZGA 3ALFA 4GUJA 1XIGA 5K3VA 3Q65A 1FWFC 1KM6A 5LXXA 3I3EA 4LS1A 1VCGA 1YPXA 4DI8A 1QHPA 3W74A 2QV4A 1OSEA 1OZMA 1TA3A 2O56A 3GFYA 2PMQA 2Z1KA 1C8QA 1MFVA 2XIQA 3IACA 1O5QA 2Y0FA 3MBFA 1P0BA 1YYAA 2C91A 1E1EA 3GVGA 4LCRA 3B4UA 5FACA 1R30A 1KTNA 1MEHA 2R1NA 4AHQA 3IK2A 1TV2A 5EMUA 2XWEA 1FWHC 3QYQA 5HAOA 4N9DA 1XD1A 5BOEA 5FA5A 4NJJA 4G5DA 1HX0A 1NQ6A 2G3MA 4Z42C 1V02E 2DUZA 3RMEA 6XIAA 1TPB1 1I2OA 5A8GA 3RM4A 1QR7A 4S3EA 4AQLA 5E1QA 2EPKX 1E6ZA 3RR4A 2QPUA 2QCGA 4QS6A 1X1NA 1MXSA 2W67A 3MW7A 3ZFHA 1OC7A 1H7RA 3LXAA 1BG9A 5AZ1A 5D2TA 3SGUA 4WD0A 3NYDA 3GAYA 1S5NA 4NSBA 4C60A 4KMQA 4DAIA 4Q4QA 2E28A 2E5BA 2PODA 4PZVA 5FSEC 3OHIA 2CKRA 1BAGA 4GIYA 3OZOA 3LCWA 3TOPA 4MJ2A 4U28A 2YB1A 4NRRA 3ABQA 4UR8A 5CJNA 2EJAA 3E0LA 3GHRA 1TV4A 1FX6A 2A5HA 3ZSTA 4IXHA 4C6DA 1IEXA 3MPGA 1ZENA 2WHMA 2PDQA 4R9OA 1DJYA 3BAWA 3TSDA 1V93A 2BY3A 2PPGA 5HUPA 1LLZA 5F2GA 5IDIA 3NO3A 4HHPA 1JD9A 2IKGA 3A24A 3VIJA 2VOMA 1PKNA 5DCEA 1LBMA 5HMFA 3BAIA 4N9CA 2QJHA 4E5TA 2QKFA 1CXFA 1QATA 4S38A 1ELSA 4CD8A 3M4HA 2QGHA 3FYYA 5FJUA 4Y6GA 4ZOEA 4IUGA 4PUKA 3RF9A 4D1IA 4AY7A 3OW1A 3H7RA 4QROA 2QUMA 2G97A 3U5UA 4HOXA 3ITGA 1T8QA 4ONVA 1TZ7A 1WDSA 3TYEA 3OEXA 3HG2A 4F66A 4JQ2A 4MY9A 2NLIA 2IUZA 3GU1A 2HISA 1VYPX 2ZUNA 1HL8A 3QY6A 4M80A 4JTQA 1EDGA 1PV8A 3PP7A 4QEHA 1O7AA 1OK6A 4IMDA 4XVDA 4O0ZA 1VFOA 2TMDA 4LAMA 2OQLA 4EKJA 4AFYA 4PODA 4BKNA 3BTNA 3GDRA 3T44A 1QNQA 4P7LA 4BF9A 3GXFA 4XZ9A 4H4IA 4NI8A 4O8RA 1G67A 1XW8A 2DDXA 3WENA 4HTBA 1ONWA 3VD5A 2VP8A 2WC7A 4G2DA 5MF5A 3AI0A 3H2AA 6TIMA 4JTAA 4GA8A 1KFCA 3E0VA 3LQGA 1K03A 1K8CA 3CLMA 5FL0A 4MY8A 4O0QA 5DMMA 3W83A 1FHDA 1RUSA 3ZWSA 1W3NA 2QMKA 6ALDA 3KBJA 3G6MA 1GTEA 4INFA 1ISZA 4CNNA 3POCA 3KBWA 3T6CA 1ZZMA 3EX2A 1V6YA 2ZA3A 1WDQA 1YNQA 5JQ9A 3TWBA 3ID7A 3W7MA 3G1VA 2DSZA 1HGWA 1GZ1A 1KM5A 3MKVA 1LBFA 1B30A 4XO7A 3T78A 5FESA 4QE1A 4W8AA 1B5TA 2OPJA 4N7QA 2G95A 2EXOA 2R24A 3VTRA 3WF4A 3U57A 4DRSA 3OA5A 4UTFA 2HROA 3DYOA 4HZ6A 3GU9A 2E3ZA 4OFCA 2PEVA 4GZ7A 1F3XA 3WIJA 4HMNA 3AIEA 5EMYA 3L0KA 2OMAA 1R87A 2VOTA 5FCZA 1V3IA 3MCNA 3NL3A 1QCWA 2NV9A 4JYEA 1TJRA 1DIDA 1HJWA 4GOAA 1EC8A 4HU8A 2WZHA 1MW0A 5C7VA 1GOMA 1UCWA 2PC4A 1G69A 3D3AA 3ARVA 2AL1A 2G50A 5JBEA 3PBMA 4LNCA 1FWWA 4C1NA 2IQTA 2Z1VA 4AMAA 4C6PA 4WDWA 2WKLA 4XISA 3UR5A 4RNJA 3H24A 3HF3A 3KP0A 3QEZA 1GQJA 1TKKA 1J2WA 5M2FX 5K4ZA 1WKFA 4AZ7A 3DHFA 4GIRA 4FNUA 3PNZA 4WIWA 1S2WA 1S2UA 2JFEX 1KFEA 1VPXA 5ABHA 2Z00A 5AVHA 4XD4A 2R1LA 3LERA 2FMOA 1E6PA 2E25A 4W87A 1W9DM 5HNNA 2Y62A 3GTHA 2Z29A 3KUMA 3W1UA 9CGTA 1EGMA 4JTUA 4PUNA 4XUGA 1WZMA 3SCSA 5B7ZA 2V2CA 4AB4A 3LM3A 5HATA 4O15A 4IIHA 4XK2A 1H2JA 3AIWA 2GVJA 3LZ5A 2P8CA 1DOSA 1XLGA 5JXQA 1D3CA 1K4GA 1UOKA 1SUXA 3W38A 1FWIC 3UFYA 3IRDA 3UVIA 1AW5A 4UFJA 1XUZA 2E1DA 3OVGA 4JQAA 3WEOA 5DCDA 3SCNA 1HKJA 2QCEA 2VRJA 3ARQA 1AL7A 2CLOA 2DQXA 3DFOA 1GHRA 2DT1A 3NG3A 2D0GA 3AU6A 4CCDA 3NM3A 3A13A 4RL3A 1JF6A 3RN6A 5DRIA 1FOBA 4IF2A 2J7GA 4MKNA 3I68A 2HZGA 5A8NA 3T08A 2W62A 2H6RA 3EWBX 2GJXA 1W5OA 4TX9A 1R7OA 3VZYA 3EXTA 2J4GA 3A9BA 2VZUA 4AZHA 4W86A 3CUJA 4RJEA 4P7NA 3ABSA 4H9MA 3AZRA 2NSOA 4QG8A 3LBMA 2YOCA 3GW0A 1FCUA 4YLWA 4LF2A 4KCTA 1YLVA 3DKJA 3VOFA 5EYWA 3UG5A 4JN8A 3CYVA 3G1XA 5I7GA 1WZLA 3I7QA 1XSIA 1SGJA 4HSNA 3W7NA 3TLQA 4UCGA 7REQA 4J40A 4PN2A 2WHJA 5AZ0A 1O1HA 1V7AA 3LSCA 3P5YA 1M7XA 3P93A 4H9XA 5T26A 1A53A 2VD8A 3WQOA 4FF7A 3W2JA 3AALA 3VUSA 1TELA 3R1ZA 2FVMA 5JH1A 4YIWA 4D6GA 4PH6A 3G3DA 3LCXA 3U2CA 1O6IA 3XIMA 1GT8A 1XPGA 4MDPA 4BK9A 1HP5A 2YDSA 1MUWA 3NAVA 3ARTA 1VLWA 3N4AA 4EAYA 1UQZA 5K2ZA 2X41A 4LYPA 3KOFA 3ZLGA 4AYSA 3DGRA 3IV8A 1FWDC 3WCZA 4ALDA 3ZT6A 1JULA 4S3AA 1OG0A 3AAMA 1WDDA 3KAOA 3K46A 1NF7A 2R6OA 3ARWA 5I09A 1X6UA 4WCJA 4JR5A 4PL1A 1QNOA 3WDQA 3GXNA 4Y9OA 4IFRA 1ZY9A 1JUKA 1GEHA 3I7SA 1FDYA 1IWBA 1H49A 3TLLA 1G4SA 3N2CA 1W9VA 2BDQA 3BK0A 4NRSA 3N3TA 3VDAA 4M1BA 2IKJA 4ZVJA 1JUEA 1UWTA 2VJXA 2ZUMA 3L5MA 2Y63A 1VYSX 4HOZA 3SCPA 4TX6A 3KZPA 1H7OA 4JHZA 3LV5A 4L65A 3F1QA 2BHUA 3CQJA 4AIEA 2B4GA 3JW7A 2QQ6A 5D33A 1XYZA 3FHQA 1Z7AA 4ZL1A 3E0WA 3NXLA 3UBPC 1FP9A 5I00A 4U5IA 2GJPA 3KWXA 4IXXA 1OYCA 2NT0A 4M3PA 3N2XA 5LIWX 3O2LA 2XVPA 2X1UA 3CS2A 3FA5A 4LAOA 4I5XA 1JCXA 3APYA 4QIUA 1IEIA 4JOMA 1I0BA 3SCWA 4EWND 3GH7A 2DSWA 3PWAA 3WUFA 4OZOA 4X2PA 5XINA 1I60A 1OD8A 4Q4MA 2X40A 3W75A 3IJLA 2XGBA 3WQGA 3K4AA 4KWSA 5FF7A 1IZKA 4AXNA 3WLKX 3H4XA 4JTEA 3LU2A 4MSSA 4JFUA 3U4FA 2OEMA 5AKQA 2A7NA 2D3LA 4JGDA 3TFCA 1L9WA 1PVNA 2WCSA 5C7HA 3M41A 1CPUA 2DVXA 1NFPA 3W01A 2H8ZA 3ARSA 1QNRA 5TAOA 4F2BA 1W3JA 4O1FA 3SUSA 3VILA 4J3SA 3BV4A 4AZCB 2OLHA 2FHCA 3QGAC 5ECVA 2ALRA 2G96A 4FX8A 3TX9A 1PDZA 2ZZ1A 1ZP3A 1V7YA 1E56A 3ONCA 5AC6A 2YX0A 3C86A 1CX9A 2W63A 1B4KA 5GNZA 3FSUA 2OKTA 1MMFA 5CPQA 3U4AA 3WLIA 2CPUA 4QE5A 4PEKA 1S2VA 1JD7A 2VCBA 3WJYA 2VYOA 2ZVIA 3C2VA 3SB0A 4JTCA 3MDUA 1TX0A 1KV5A 3DYPA 3UXLA 1NTHA 3BOFA 4CN6A 2J25A 1XL9A 3U5YA 2G5WA 4LXFA 1IT8A 4LY8A 1HKVA 1HKWA 5JVLA 2HRWA 1PSCA 4QG6A 2V5CA 4JX5A 2O7QA 3WNLA 2ZWYA 3NSXA 2HTMA 3EOOA 3GH4A 3IEBA 4QSHA 1GONA 2PLMA 1M65A 2XG9A 3ITTA 2EG8A 4LT9A 3W7HA 3OPSA 2Y89A 1UKQA 3N25A 1W2PA 4A8LA 2V5BA 4LRTA 3DAQA 3LTPA 4JNZA 2XM2A 5CZKA 4C6LA 3TJ4A 1QAPA 3P7YA 1W5NA 4WLCA 4D9PA 2AGTA 1CGTA 2UY4A 3WDJA 4QRNA 1TMHA 3SIZA 4ERGA 1K9TA 1DTNA 4DUVA 3ITXA 4XKMA 1YRRA 3LDVA 1XS2A 2NVCA 2OELA 3Q45A 2DIKA 2VENA 2PTWA 4Y8EA 1ZJHA 4NZFA 1KB3A 1OCJA 1XISA 3IJ6A 4IG2A 5AHFA 2ZUUA 2YA1A 2F6UA 1X8FA 4GX9A 3WUBA 1TWWA 4AW7A 3CQHA 3KW3A 2ZRYA 2OR2A 3JUGA 4JNMA 4AX6A 4FF5A 3A4JA 3EDJA 3AWOA 1HF6A 3MKCA 1A5OC 2CC0A 3C2RA 1AL8A 4EWJA 1OY0A 4FNQA 4H83A 4EX4A 4L1GA 4YN5A 5A2AA 1ZJBA 4UOJA 1F4AA 3EPOA 1RA5A 5J04A 2VFEA 5IHRA 1PZ1A 3SBFA 2VFGA 4HHHA 2PDFA 2GZXA 2Y2WA 3N17A 1HO4A 3OA3A 5BZAA 4MB3A 1FCQA 2NVAA 1KBBA 4AVOA 4CEXC 1VFMA 1V03A 2VDHA 1AW1A 1T5AA 4QLKA 1SR9A 1FKWA 3D5HA 3GQYA 3KX6A 1JI1A 2V9DA 1BYDA 3VIIA 4QLJA 4OT7A 3WEMA 1XYMA 2YKKA 2PRLA 3DI1A 1M53A 2CLHA 2W3ZA 3OYXA 3UXAA