3U5UA

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
501
structure length
470
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Raucaffricine-O-beta-D-glucosidase
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 178
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u5uA00
4D6IA 1NWRA 3SCRA 5LA1A 4HZ6A 4MNLA 2JIWA 3VUPA 3T09A 1FP9A 4D6HA 1R86A 3ECQA 3PTQA 4HOZA 4EANA 2ZWYA 1OIFA 3MV11 4JHZA 4E8CA 3SUUA 1PPIA 1QW9A 1E6PA 2BVDA 4M80A 2YL8A 1E56A 5JBFA 3EYPA 3GTNA 3K4DA 5CLTA 4HA4A 2V3GA 4AZ5A 1LQ0A 1MW2A 3CIVA 4E8DA 1DWIM 1WKYA 3M7SA 1K9DA 1PX4A 1E6RA 1V6WA 4H8UA 1GOQA 2XSAA 2W62A 2WAGA 2BV9A 2XUCA 3N13A 4KMQA 3DECA 3AMKA 4M82A 4W93A 2V5DA 3MMDA 1VIWA 1YHTA 2F8QA 3BLKA 4ATLA 2DIEA 1AQMA 2C8NA 2J7BA 4W5ZA 4YN5A 5BXRA 4AD1A 1ISXA 1LL4A 3CLWA 1TZ7A 5ECUA 2G3MA 2CKRA 1J9YA 3ARSA 2A3CA 2XHYA 5KEZA 2J25A 2OYKA 1QHOA 2UY5A 3MANA 4J28A 1XSIA 3PZIA 5FL1A 4K68A 1QI4A 4OZOA 1OD8A 5E0FA 3N04A 5DF0A 3CO4A 1H1NA 1C7TA 3UG3A 1PJ9A 5A6SA 4GI6A 3UCQA 2VX7A 4QP0A 5A6LA 1JZ6A 2DSVA 1MQRA 2VX5A 3RCNA 1FHDA 2CERA 2OLHA 3O6AA 1QNPA 3WQ5A 5BROA 4MDOA 2XIBA 3WD3A 3GBEA 5IFTA 1MWOA 4B3LA 3UG4A 2BY2A 2CBVA 4AISA 4DUXA 5FOOA 3POCA 1KQYA 5KZ6A 1GQKA 4TXEA 5E6YA 1MQQA 3WD1A 3WDPP 3CZJA 3RO8A 2D0FA 3FNDA 4D6EA 5DT5A 1D2KA 4ATWA 2E40A 3OLEA 4TTUA 2O9OA 2VT0A 3A47A 2XYLA 8CGTA 2WMGA 2CIPA 2W61A 3WY1A 1WZLA 4UTFA 1E71M 2BVYA 2XG9A 1KXHA 1ZBCA 3GNRA 5JIPA 1MW0A 4JKMA 4P8XA 4CD8A 1DEDA 3M6DA 4MJ4A 3HJEA 3T0DA 1UR4A 4ZXLA 2Y2WA 1ITXA 4JAWA 1G5AA 1OD0A 3S6TA 4W88A 4CU7A 1IZJA 3W6LA 3ARZA 2WVVB 3MSDA 4GXPA 3WNPA 3WMBA 4W5UA 4J3TA 2Y4SA 1UUQA 2X05A 3IAPA 1GQIA 4W84A 2O9RA 2DT3A 1GOMA 5I79A 4MJ2A 1PX8A 3W38A 1TR1A 2DSZA 4FK9A 4GZIA 5HOSA 2YL6A 3ZJ8A 5AC4A 1NOFA 2J8FA 1HF6A 3THDA 3SCQA 4X9YA 2J75A 1VRXA 3A6OA 3OZPA 4H8HA 1TFVA 3UG5A 1KGUA 1XD1A 5DFAA 1PZ3A 1R8LA 3CMGA 1ECEA 1R7AA 2Z1SA 3D5HA 2E4TA 5A2BA 3NDZA 1NQ6A 1EOMA 1R7OA 1E6SM 1M53A 3VGEA 2PWGA 2IXVA 1CENA 2PWEA 4LYQA 5HBFA 2FHCA 2YBUA 3SUVA 2J78A 2ZX8A 2Z1KA 2ZXDA 1XSJA 5JIWA 2O92A 1TVNA 3GNPA 4J3VA 3W25A 3WNOA 4CKQA 4YHEA 4UQCA 1CLXA 3JUGA 3T2QA 4MAVA 5GQBA 4DWSA 3RPMA 1GUVA 3GXIA 2J74A 1OWQA 3VGGA 1KWGA 4LYRA 2V5CA 5BXPA 1I1WA 2CPUA 3VDAA 5CSYA 4PMUA 2QPSA 4AZCA 1JAKA 1W32A 1HP5A 3TA9A 3AYRA 3K4AA 3VO0A 3VD9A 1JIBA 1UWIA 3U5YA 2FH6A 1WZMA 3ZR6A 1CPUA 3AHYA 1DWGM 3SCTA 3N12A 2VO5A 1EHNA 3TTYA 2EQDA 1JDDA 3W4RA 5ABHA 1B3YA 1HJSA 2NSXA 1PZ2A 2WMJA 4PCSA 3CUHA 3U7VA 3AS0A 4AIUA 3AI0A 3K8MA 3CMJA 1CEOA 1JL8A 3WNNA 5CG0A 4P8VA 4XB3A 4HU8A 1J01A 2W4XA 5HNNA 3BCDA 3CHDA 5HXMA 2E9BA 1QHPA 3LMYA 2XM2A 3NYDA 4NRSA 2CCRA 2DH2A 4GI9A 2GJPA 5A8OA 2WNWA 2YA0A 3VILA 2PB1A 3I3DA 3AICA 1Q6EA 2VTFA 4QLJA 1EDQA 3RDKA 3RIKA 4UQEA 5IHSA 1ZU8A 3MUIA 1H09A 3GBDA 1XYZA 1CXFA 3VU2A 2E3ZA 5A6JA 2WVVA 5FKYA 1UH2A 3RM9A 3AMDA 1SR0A 1JI1A 3ARRA 3IK2A 5IDIA 4U2ZA 5A6BA 1SFSA 1BVNP 4M56A 2OSYA 2NT1A 2WYSA 1VENA 1UWTA 4CD6A 1P6WA 3WL0A 5GPRA 1S46A 5D9MA 1K9TA 1DWFM 3FAXA 4LYPA 5F7UA 2WHLA 1RD6A 7TAAA 2WBGA 3AIRA 3WQVA 1MYRA 1MXGA 1J0KA 1DTUA 4F9JA 4WKHA 4BS0A 4JCMA 3OGVA 2PWHA 1VJSA 1X1NA 1W1VA 3CHFA 3WH8A 4HZ8A 1F4AA 3TTQA 3A3HA 2YIHA 4GIAA 2PWDA 3WH5A 4PUEA 3VMOA 2E8ZA 4D1IA 1W1YA 3MS8A 1VBUA 2BHYA 1ZS2A 1BG4A 4GZJA 5EB8A 4PSPA 1EH9A 3VM5A 1CXIA 2YLLA 4CD5A 1Q6GA 3GZAA 1KBKA 3CH9A 4D6JA 4AXNA 3KL0A 2X1IA 1JNEA 1JYXA 1NH6A 1G0CA 4UQ9A 4CU6A 3VTRA 1CWYA 3L2MA 5CQ1A 2AMGA 1W9PA 3LPGA 3KL3A 3WBAA 2AAAA 2BY0A 2YOCA 2BNJA 1J0HA 5A6AA 4PMZA 1TA3B 4H8VA 4V2XA 2DT2A 2VZSA 1UWSA 1QHZA 1Q6FA 2XVKA 1W3HA 1E15A 3VX1A 1BF2A 4OBRA 1E72M 3L4XA 4HA3A 4DWSD 1E4MM 4MNMA 1J18A 4U2YA 3WENA 1GONA 4WK9A 3SEPA 1LL7A 2DQXA 1M7XA 5I0DA 4NI3A 4B3KA 4AZGA 1MFVA 1UHVA 3K46A 1WDPA 3PZVA 4JL1A 1E3XA 1GOIA 4OOUA 4W7VA 2CYGA 1GHSA 3ARPA 1H41A 2VI0A 1EO5A 2XJ7A 5A8QA 1BLIA 5ABFB 1W3LA 2X8RA 4DUVA 4KGJA 1BPLB 1JFHA 1GPFA 1C7SA 3U5UA 2ZICA 4U3AA 1ZBKA 3APGA 1WNOA 3VMPA 3N1AA 1XCXA 2CITA 3PTMA 3W29A 3W26A 1KXTA 2XFYA 2YBTA 1MXDA 3VD5A 4MTVA 4Z2JA 1HKJA 2YLAA 2BY3A 3ZJ6A 1B90A 4P8WA 4WKFA 1HKKA 1XH2A 3WEOA 3EDDA 3AS2A 4UFKA 4OIFA 1B1YA 1XHGA 3WD0A 2VC9A 1V6YA 5A6BD 1OGBA 2X09A 2PC8A 3U7BA 2DSUA 1E70M 2EJ1A 4PSRA 2D20A 4HOXA 1OINA 4UFIA 1ODUA 1LF1A 3U57A 1E55A 4ACYA 1WP6A 3M07A 2ZX5A 4E2OA 2WANA 3WKZA 5I23A 4AZ6A 4Z2LA 4Z2KA 1FH7A 4W7WA 2QHAA 2VVSA 1BHGA 3L4WA 2DDXA 5C8BB 1R85A 2ZUMA 3AFBA 1BGAA 1XSKA 1TMQA 2CETA 4ZEPA 4J3WA 3EDJA 2E8YA 1E0XA 1ESWA 3TP4A 3CGTA 4UOQA 1ISYA 3HN3A 2FDMA 3VKKA 1NWSA 3WNKA 1UA7A 3N18A 2E9MA 1TA3A 3RMEA 1V3MA 1IT0A 3OGRA 5E0CA 3WQ8A 3QHNA 3ZT5A 2VRQA 1H3GA 2WXDM 3CZGA 1EDGA 1J12A 1VEPA 2J8GA 3AIBA 4LPCA 1GOOA 3GXDA 2C0HA 1LL6A 1EIBA 1UQYA 3AMCA 2BVTA 2D24A 3GH7A 4TVUA 3T2OA 3WH7A 1JXKA 2WK2A 2YDSA 5D8ZA 2J62A 1UWUA 4WSJA 1GOWA 3TONA 4NRRA 4WJXA 1JZ7A 4AMCA 1XYFA 3MSGA 1EXPA 5FCZA 3IJ8A 2WM0A 1G9HA 1ZBVA 2PWFA 1FOBA 4HMDA 4GINA 3VVGA 1B3ZA 4PTXA 3F5LA 1GHRA 1B3XA 3FHQA 5ABFA 4B9ZA 3NSNA 2ZWZA 3B8SA 4CVUA 2TAAA 2RGMA 2EPKX 1RH9A 4M24A 1B31A 1CGVA 3J7HA 1SYTA 3ZO9A 2OSXA 1K9FA 2W5FA 3KEHA 3SCSA 2PBOA 2V3FA 2VCAA 2GK1A 3VGDA 3PZTA 1Y7VA 5FD0A 2J4GA 3AZTA 4D1JA 4W7UA 4H7VA 3CPUA 4V27A 3UR8A 3OB8A 2WSPA 4TVCA 3L2LA 1MFUA 2EO7A 2A3HA 2G4FA 4PTWA 1JF6A 1LJYA 2EPMX 1J0YA 3UR7A 3ARVA 2VX4A 1PIGA 4W8AA 1B9ZA 1VFOA 1ZB5A 3DYPA 3WUFA 3AHTA 3ZR5A 5A8PA 2WWCA 3NIYA 2D1ZA 2VCBA 7A3HA 4EAMA 1NM9A 2G8ZA 1HVQA 5CLWA 1KBBA 1UD4A 2DSKA 4FLRA 1UR1A 4JKLA 3GH4A 4W87A 2GJRA 1C3FA 1FHLA 2F61A 4BCEA 4AZBA 1QW8A 1E4NA 2OWCA 3ARXA 2G3NA 1ZL1A 4DM1A 1E6XM 2XVLA 3QHOA 3EMCA 3T0AA 1E6ZA 4PEEA 4C7FA 2W66A 1W1PA 2WKGA 4JKKA 2WHKA 1DWJM 2EPLX 1F4HA 3CUFA 1QI2A 4MB1A 4AZ7A 5JBEA 4NF7A 5HPCA 3BSHA 2XWEA 4GI8A 2BS9A 3UEQA 5E09A 3SUTA 4ZE5A 2VZUA 2Y5EA 3CZEA 2DH3A 2CBUA 4IUGA 4MADA 2XFFA 3TTSA 1CBGA 5E6ZA 4CU8A 1E0VA 2J7DA 2XTKA 1CECA 2WC7A 1XRVA 1DWHM 4Z2HA 1AMYA 4KRUA 3AXHA 2FHBA 3PZMA 1VFMA 5IXEA 4FF5A 1I1XA 1JAEA 3AISA 3VPLA 2G3JA 2QMKA 2MANA 2RGLA 4P7NA 5DT7A 2IUZA 5D9OA 1XD0A 4W8BA 3W27A 4BQ4A 4A4AA 2ESCA 1JXJA 3ZMRA 5CPTA 4PMNA 2ZUTA 1QBBA 3WUBA 5A8MA 5CGTA 2VURA 3D3AA 4TTGA 1B30A 1JGIA 3CZLA 4Y7EA 2UWFA 1UZ4A 1TG7A 5I77A 4J3XA 4JFWA 1ITCA 3BMWA 4CN1A 3NDYA 3MKKA 2QLYA 1JYNA 2WKLA 4QFUA 4KGLA 4L4OA 4A3YA 4XUYA 1D3CA 4QCFA 4JFSA 3MUAA 1KB3A 4CCCA 3A4XA 1OBAA 1U2YA 1CGXA 3FN9A 1W9VA 1BYDA 1JDAA 3POHA 3NSXA 3VD3A 1GVIA 1H5VA 1V02E 2V38A 1E1FA 2VQTA 1GQLA 4PUDA 5CGMA 2FH8A 4XZWA 2BHUA 4AW7A 4H2CA 1UYQA 3TTOA 2UY4A 4HTYA 1VEOA 1HNYA 2X2YA 1GVYA 3SCUA 3W82A 4HZ7A 2VQUA 3AYSA 3WFLA 2W92A 2WMKA 4A3HA 4D6FA 4S3JA 3ZOAA 1V6VA 2EPNA 2DPEA 4E4PA 5E70A 2ZXAA 3W0KA 3BAKA 2J7GA 3FY1A 3OG2A 1V03A 3MU7A 3N11A 1UZ1A 1X6LA 5AY7A 1M03A 5CPQA 3WMSA 1V08A 2NT0A 3MMUA 3AXIA 2YA1A 3ARQA 3WUEA 1UR2A 3VIPA 4F9DA 1TCMA 3MV01 2OWXA 4PN2A 4F8XA 1PEZA 4U5IA 2ZX9A 4AD4A 1C8QA 2WZIA 3WH9A 5M03A 4UQAA 2WMIB 3GM8A 4F66A 3BGAA 4UFJA 3LPOA 5JBDA 1HJUA 5M5DA 1E3ZA 1QNOA 1BVZA 1TE1A 3KE0A 1VAHA 3L4YA 1NWTA 3PZGA 4C7GA 4QAWA 3B9DA 2HISA 3CUIA 1WDQA 4UQBA 1E9LA 1ZJAA 4GO9A 5A6KA 4PYSA 5EFFA 2J77A 2O9TA 1JZ2A 5FL0A 1E4IA 2O9PA 7CGTA 5FIPA 4LXFA 5AC5A 4JFVA 2VUYA 2BXYA 3NCOA 1QNQA 3M46A 2G41A 4NZCA 4PMVA 4R5EA 4AC1X 1WCGA 1NP0A 3RM4A 4CD7A 4PMQA 2YL5A 5I3DA 1L0PA 2QF8A 3AOFA 4TVDA 1B2YA 3WF1A 1CDGA 1VFFA 5A69A 1E73M 3SURA 1KXVA 1QVBA 3PZOA 4UFMA 1OIMA 1UKOA 1HKMA 5LA0A 3VGBA 1V3IA 1V3JA 2GVYA 5CJ5A 1J10A 2VRKA 1CGWA 2OYMA 1O6IA 1V3LA 2JEQA 2WHMA 5ABGA 3OLDA 3F5KA 3GDBA 3WUGA 1JD7A 4AD5A 2XVPA 4TX6A 2WCGA 2W67A 1Q4NX 4H41A 2VMFA 6CGTA 1NOWA 3AZSA 1JYVA 3ARYA 2ZX6A 5A3HA 2JALA 3B9AA 1WDSA 1BG9A 3AIEA 1J0JA 3FXYA 2PI6A 3L4TA 1VF8A 1EQCA 2CXGA 2GFTA 4WLCA 2EEXA 3F5JA 3RJYA 5I5RA 2WC4A 6TAAA 1GJUA 3WDHA 5A95A 3LPFA 4PMYA 2W91A 2J47A 2GUYA 4M81A 4AWEA 1DP0A 1H49A 2HVMA 1VEMA 5BXTA 3BLPX 4AZHA 3VX0A 1UKQA 1CXLA 3VM7A 3AS3A 4TX8A 2VR5A 3AMGA 4W86A 1GW1A 3IJ9A 4J7RA 4PTVA 4CUCA 1EGZA 3UESA 3AHZA 5BXSA 2NW0A 1BSIA 2J7FA 5CZKA 1B3VA 1CXEA 4L4PA 5DMYA 2WSKA 1E6NA 1HL9A 1LLOA 1UR9A 2JIEA 3ARTA 1XH1A 4R27A 2FGZA 1CGUA 1UKSA 1KXQA 1K9EA 2CBJA 3WQ6A 1UWQA 1XCWA 4XZBA 3WDJA 3PZNA 1FFRA 3WF4A 3OLGA 3WFZA 1W9BM 4AZIA 3NJ3A 2WMHA 3CTTA 1KGWA 1GNXA 1FFQA 2PF0A 3IAQA 5A1AA 1H11A 1X6NA 5BYWA 1CYGA 3O2LA 4HPHA 4W8LA 2VRJA 3II1A 4S3KA 2QPUA 4MAZA 3W24A 3CUJA 3AQUA 4ACZB 3SCNA 1J0IA 8A3HA 5I24A 3NUKA 1QBAA 2ZUWA 2JFEX 2FGLA 4IPNB 3ZT6A 3ZT7A 1CGYA 4CN4A 4N42A 2ZUNA 3RJXA 3WD2A 1KR0A 1XC6A 3OZOA 1SMAA 2VR4A 1MQPA 2WHJA 3SCPA 4BQ5A 3ZSTA 5D8WA 2J7EA 3DHUA 4MPKA 4D6GA 2J7HA 3VIFA 4QCEA 4CVWA 3EDEA 3WQWA 5I2UA 1MW3A 5EBAA 2VZOA 4UZSA 2CHNA 1V0MA 4AIOA 2WZHA 1VBRA 3PZ9A 2VVNA 4HMEA 2ZXBA 5BRPA 2D3NA 1RP9A 1JI2A 1IZKA 4PMXA 4AEEA 3WL1A 1GOKA 1WDRA 3BC9A 1UA3A 4MB4A 3WEZA 3A4AA 4JL2A 4OOZA 3WN6A 1JZ8A 4KWUA 3DYOA 1W9UA 1AQ0A 1CXKA 2A3BA 1UQZA 3HMCA 3ALFA 1UD2A 4HOWA 4AEFA 4B15A 4Z2IA 2YKKA 3THCA 1WAWA 5AYBA 1J0ZA 2D3LA 1HL8A 1GJWA 4CCDA 1OCQA 3ARUA 4HU0A 1K6AA 2WW5A 1UKTA 5BRQA 4H04A 1C8XA 2DGAA 1WO2A 4GQQA 4BF7A 1DHKA 5A94A 4AD3A 3AIVA 1XH0A 2WLZA 1OM0A 3BH4A 3A4WA 1HX0A 2OYLA 1GCYA 1EDTA 1CXHA 1WPCA 4M8UA 5I78A 1Q6DA 2YL9A 4Q22A 2C7FA 3QOKA 3WNMA 1HJQA 1DWAM 1TUXA 1EO7A 4C7DA 4ZE4A 4ZFMA 3IANA 3WQ4A 3CHCA 1JD9A 1QI0A 3VIJA 3ZJKA 3GNOA 3O9NA 1O7AA 3WDIA 2FHFA 2AOSA 3EMQA 4P7RA 1E5NA 2F2HA 3VDBA 1CTNA 4OBSA 3WDRA 4PTMA 1EA9C 6A3HA 1C93A 2W63A 1M04A 2EXOA 5D9PA 2BY1A 3DHPA 4U5KA 2ZX7A 4W89A 1UD5A 2G3IA 2ZUUA 1UD6A 2UY2A 3AROA 3WF2A 1G1YA 3RM8A 4DWSB 4YHGA 5C71A 4FLQA 1JZ3A 2D0GA 4DUWA 4ACZA 1HXJA 4EKJA 4ZXOA 3K1DA 2YJQA 4PMOA 4AZCB 4X0VA 1V6UA 3W28A 3AIUA 1V0NA 5A8NA 1MVYA 1OGGA 2YA2A 1NWUA 5DEZA 1W9XA 1NOUA 3N17A 1W1TA 1YQ2A 2EBNA 3WD4A 3SUWA 5AYIA 1KR1A 1US2A 4BA0A 4M1RA 3EDKA 4MNJA 3OA5A 5DO8A 4HA1A 3SCVA 1B0IA 1EQPA 2WLYA 4Z2GA 3WH6A 1H4PA 4B9YA 3WF0A 5TD4A 2V3EA 2QV4A 3T08A 2Y8VA 2VNCA 2X0YA 1G01A 4QLKA 3ARWA 3MMWA 2V3DA 4P7QA 5CPSA 4TOQA 4J27A 3VDCA 1ISWA 1HKIA 3VIHA 5BWFA 2WCAA 2ZOXA 2OSWA 1OSEA 4AIEA 3WIJA 1VB9A 2WC3A 3TOPA 1E1EA 2E9LA 2CHOA 4EK7A 4M29A 1U33A 4UZUA 3PN8A 2GSJA 2WWDA 1E40A 3CUGA 1J11A 1JF5A 1QNRA 3BXWA 1E6QM 1UH3A 1VFUA 4BQ3A 1JYWA 4FLSA 4KRTA 5EFDA 5E9AA 1N82A 1PAMA 1W3KA 1TVPA 4CD4A 3AXXA 1OGSA 4WSKA 2WBKA 2UY3A 3CHEA 2Q8XA 3PHAA 3ZJ7A 5ABEA 2WVUA 2VZVA 4GPNA 2CESA 1OT2A 3CBWA 3BAYA 3W81A 1ISVA 2Y8KA 3F4VA 4U3CA 2OWWA 1UKPA 2XGIA 3WMCA 4URIA 1GZJA 2IXUA 4HPGA 1FH8A 3K8KA 2CKSA 3VGHA 1HN1A 4JFTA 5CXPA 2DT0A 1W3JA 3BAXA 2J7CA 4LX4A 2GJXB 1ZJBA 3QOMA 3MUZ1 4ZENA 1Q6CA 4HP5A 1A3HA 1ZBWA 4J3UA 2YDQA 1CNVA 3OIHA 1RPKA 3VGFA 4GKLA 1LG2A 4JFUA 4AD2A 1E0WA 3I3BA 4GO8A 4MNKA 1CZ1A 2XWDA 1JZ5A 3VIMA 3IJ7A 3K8LA 3QR3A 4QDMA 4BZYA 2GDVA 1PBGA 1UD8A 1JNDA 4UOJA 1C90A 1KFWA 1BYCA 2J79A 4D6CA 2VL4A 4J3SA 4UOZA 1WZAA 4JIEA 2WCSA 3WF3A 3AHXA 1QI3A 4MB5A 4V28A 1BFNA 1KCKA 2XIIA 1D7FA 1BGGA 1UR8A 4AD0A 2XVNA 2X0HA 1R87A 3B9EA 3AIQA 3VIGA 3FAWA 3GXMA 4F79A 3VIIA 1W2PA 5D9NA 3NSMA 4LGXA 4JHOA 2D22A 1OB0A 1FH9A 4PMRA 4AYSA 2XPKA 2D0HA 1LG1A 1WE5A 2GDUA 2JF7A 1OT1A 1QPKA 3S2CA 4JCLA 1U30A 4PBGA 4XV0A 2CBIA 4OUEA 1ISZA 9CGTA 3UETA 1Z32X 4FMVA 5HPOA 1C92A 3PBGA 4P8UA 3VD4A 3PZQA 2ZUSA 4LQ1A 4RL3A 2DIJA 1KGXA 1KWKA 3WNLA 3G6LA 2WPGA 4GQRA 3EMZA 4DM2A 1W2VA 5I6SA 3BMVA 3T0BA 1MW1A 1E43A 5GNXA 4U33A 3L4ZA 1H2JA 1H0GA 4UQDA 1V02A 2ZUVA 2YDRA 3KWXA 3MUY1 3LPPA 4XX6A 3OGSA 3KL5A 3VMNA 4TUFA 2JF6A 2ZIDA 3VOCA 5IFPA 1E4LA 4X0NA 1BYBA 3UERA 3BAWA 3HU7A 1ODZA 3G6MA 1AQHA 3PTKA 2A3AA 3SUSA 4MDPA 5A6MA 3AHVA 1VJZA 2WZEA 3VDHA 3SCOA 3SIMA 1QNSA 1FA2A 3ZSSA 2DSWA 1AVAA 3FW6A 1XGZA 2WVTA 3GH5A 1WB0A 1EHAA 4UNIA 3WBEA 3OLIA 3E1F1 2EPOA 2XM1A 1KQZA 3I3EA 1V3KA 3BSGA 4RE3A 5LYRA 1NP2A 1HT6A 4W85A 1EOKA 1HP4A 3AS1A 4U31A 3ZIZA 4QLLA 4P7OA 2GJXA 2VOTA 3AJ7A 5CSUA 3DYMA 1WZKA 5M17A 4OJYA 3VINA 4CCEA 1B3WA 5GNYA 1PIFA 5D4YA 2QMJA 4CGTA 4DWSC 1BYAA 1LWHA 3KZSA 3CZKA 3EBVA 3FHAA 4D72A 1UH4A 2JE8A 4PRWA 5HDRA 4OKDA 3WDQA 4UR9A 3RILA 1HIZA 3WELA 1C91A 3ZM8A 4IM4A 1US3A 5C70A 3W53A 3MO4A 1HJXA 1W9DM 3QGVA 5GNZA 1L8NA 4NSBA 2VJXA 3BAIA 4PMDA 1UWRA 2Y24A 1UD3A 2E0PA 3W37A 1GORA 3GXFA 3QHMA 5LA2A 3VIOA 2DEPA 1HJWA 1W91A 1IV8A 3VNZA 2CNCA 3T2PA 4D6DA 4JZ5A 4UFHA 1JZ4A 1XV8A 1UG6A 3L4UA 2DT1A 2JEPA 1C8YA 3CZ8A 4GZEA 2VX6A 4WIWA 1V0LA 4CN6A 1A47A 4ATDA 2WMIA 2BHZA 1BQCA 3EDFA 3VIKA 1H0IA 2CEQA 4WKAA 3L4VA 1M01A 4D71A 2ZXQA 5IHRA 4BQ2A 3BCFA 4FLOA 2D23A 3VD7A 1LWJA 4P7LA 3WEMA 4EE9A 4IISA 5M3WA 1HVXA 3W6MA 2BFGA 5EMYA 1SMDA 1KCLA 2XSBA 3PZUA 4RE4A 3ALGA 4HMCA 1G94A 4Q7NA 2GK1B 2B31A 3OBAA 4UFLA 1BTCA 1QI5A 1CGTA 3SCWA 2ZE0A 3GYCA 4YPJA 2WB5A 5BCAA 3WSUA 2XVGA 1NARA 5A2CA 4ML4A 1PX3A 1I75A 2PBGA 4AY1A 4PCTA 3AZRA 3AIWA 2D2OA 1V6XA 3AMLA 3VNYA 3BAJA 2WMFA 2A3EA 2VCCA 2VZTA 2BXZA 1UOKA 1QOXA 1HJVA 4KH2A 4WF7A 1V3HA 1FP8A 2XGBA 3N15A 1BAGA 4N0RA 3ZQ9A 4RE2A 4B16A 1JG9A 1GQJA 4IPLA 1CLVA 5JUVA 1JDCA 1UR0A 2WVSA 2XFRA 3DC0A 1E5JA 1RP8A 3N9KA 1CIUA 4MB3A 4UCFA 1JFXA 1V0KA 5A2AA
chains in the Genus database with same CATH superfamily
3LBMA 1MMFA 3VUPA 4AC7C 1I0DA 2QJGA 3VAVA 1R86A 3PTQA 2GZXA 4EANA 4NNAA 1Z8AA 2PZ0A 2XN1A 3M0XA 1ONXA 2ZWYA 4MWAE 3U2EA 1US0A 2C19A 3SUUA 2JKAA 3I6RA 3A12A 3K5XA 1XRTA 4ZQOA 3W71A 1E56A 5JBFA 4H6RA 4JTSA 1GYLA 1QATA 1WOBA 2IQ0A 3VDGA 3KHDA 1K9DA 3TNBA 2J8TA 1PX4A 1RCQA 1Q3NA 3DH7A 3QQWA 2BV9A 3ZVHB 1LRNA 1DJNA 1Y0EA 1IE7C 1BQGA 4KFOA 2DIEA 2X2GA 1YDOA 2XN0A 2OOGA 3TTEA 3NQ6A 1KRBC 2PLMA 3CQKA 2VDHA 2BBFA 2A3CA 2XHYA 4D8LA 1BSLA 1BXNA 2BWGA 2J25A 2J9YA 2OYKA 3PZIA 1S1RA 4DRSA 4NVTA 3USZA 2ZRZA 4XAYA 3N04A 2EAWA 1SFTA 4NI8A 1E9IA 3UCQA 1KM5A 1XLDA 1F7BA 5A6LA 1DJYA 2DSVA 4QX4A 4TV5A 3W88A 1EJTC 3RCNA 1FHDA 2REQB 4I9TA 1ITUA 1FQ0A 1UOZA 5BROA 3G1RA 3DG7A 4Z17A 5F2GA 2OOFA 1H5YA 3NQCA 2BY2A 2CBVA 4S2CA 3PJUA 4DIAA 5TIMA 1KQYA 1GQKA 5E6YA 3CZJA 3P67A 2Q3RA 1TWZA 2A2IA 5CAKA 5KZMA 1D2KA 4PGLA 3W7IA 2VFHA 4ADTA 1ME8A 4YTTA 2XYLA 5DCBA 8CGTA 2PP0A 3GNRA 4O4VA 1XIMA 2NLIA 5JIPA 4P8XA 3WG6A 1FCVA 4ZSTA 2DP3A 1DEDA 3GDTA 2ACQA 1TIWA 3HJEA 4GK8A 3BGJA 3CAKA 1XLBA 3T0DA 4IQLA 3KM8A 2DW7A 3STGA 4LBUA 1OD0A 2GVGA 3S6TA 3PJWA 3WX7A 2Y1HA 3UWYA 3N2CA 3ARZA 5DY3A 3MSDA 3LB0A 2E7FA 4GVFA 2O9RA 1SVDA 3F4CA 1TUFA 4R88A 3SQMA 1TYGA 1L6GA 1FY6A 1OX4A 4GZIA 4RXFA 3SO7A 1J6OA 3ZJ8A 5HOSA 3PBMA 1HF6A 3THDA 3SCQA 3W2UA 4X9YA 2J75A 5G2IA 3TVAA 3LK6A 3A6OA 3OZPA 5G2WA 1TFVA 3NQFA 2HCVA 4YXGA 1R8LA 1M5WA 4B91A 3DC8A 3L23A 2E4TA 4HHPA 4NP7A 4C5YA 2FTWA 2YBUA 3LLFA 2ZX8A 4X2PA 3CQ0A 3K30A 1UASA 1QR7A 5AZ0A 2CLFA 1X6UA 2O92A 3T0TA 1O94A 4C5ZA 4HD5A 3GNPA 3W2LA 1KBLA 4YHEA 1Q6RA 3JUGA 1IWAA 5GQBA 4DWSA 4YWSA 3IVUA 1YRRA 4DBSA 2F7FA 3VGGA 1KWGA 2HK0A 4LYRA 3VKCA 4GFIA 5BXPA 3KOFA 4PH6A 1JAKA 4L65A 4N9CA 4WOZA 3VO0A 4LNCA 4I6KA 3XISA 2AL2B 1ZJIA 5B7YA 3SB0A 4I5UA 1XQLA 2PDKA 3GKAA 2MNRA 4R3UA 1PTGA 3C0JA 5ABHA 3C0LA 3C5QA 3USBA 1F73A 1SJAA 4AIUA 1GT8A 3K8MA 3O16A 3WNNA 4Z1DA 2GSEA 2ABAA 2BMBA 5F4SA 4MG4A 4H9XA 2WZTA 4IIFA 2FQIA 5HNNA 2QIWA 5HXMA 1QHPA 2CCRA 2DH2A 2GJPA 3EB3A 5D2WA 5M1TA 3FJ6A 3W7LA 4AX7A 4Q4KA 4ZOEA 2ZADA 4H1ZA 1KM2A 5A6JA 2SFPA 1HUVA 3RM9A 3AMDA 5T9CE 3WQOA 2G3FA 2QDDA 5A6BA 3E6EA 1BVNP 3H24A 1VENA 5HWJA 3WL0A 5GPRA 1GEHA 2BSLA 3CL8A 1W37A 3FAXA 4LYPA 4MJMA 3HJZA 7TAAA 3RMJA 1MXGA 1J0KA 3AXKA 4GY0A 1Q65A 1DTUA 3FJLA 1DOSA 4FHAA 4Y96A 2DZPA 4DYJA 4G7EB 3A3HA 4RCXA 4GIAA 3WH5A 3VMOA 1MRAA 2RDXA 3QSTA 1NTHA 1RV8A 1ZS2A 1BG4A 1JRBA 2YB1A 5EB8A 3VM5A 4OE7A 1LUCA 3UY7A 3ANVA 2OU4A 4CD5A 1Q6GA 5GJPA 4GNKB 4PTDA 3L2IA 1XC4A 3CPRA 1IXOA 4DPPA 1Q7ZA 4A21A 2X1IA 1JNEA 4UQ9A 3LTYA 5DXYA 4LTSA 4JTRA 5G4EA 1TTJA 1NF7A 3KL3A 3M44A 3G1FA 2YOCA 4B5NA 1ZNNA 4ZB5A 2NX9A 3UJSA 2X30A 3G1AA 1YNYA 1VPYA 4H8VA 4IPPA 5AHLA 4LVAA 2YDAA 1LRQA 2NQHA 4PCFA 1IXQA 2XVKA 3NURA 3VX1A 3CIXA 1E72M 1IR1A 3L4XA 4HA3A 4FA3A 2OZ8A 2PDFA 3R4IA 3KVJA 1W17A 3KBNA 4YTRA 4O54A 4HNLA 3RPDA 3WLMA 3O6YX 1RVGA 5A5WA 4NI3A 4B3KA 4YMZA 4LCSA 1FHUA 4JL1A 2O55A 3RRXA 1GOIA 3H7VA 4N9EA 1AD4A 2CYGA 1GHSA 3WLIA 1H41A 4QNWA 3GLCA 4Q7IA 4Q6XA 3U5UA 1NELA 2ZICA 4US5A 3DFQA 1WNOA 5EKYA 2XINA 1XCXA 3PTMA 4KCTA 3W26A 1KXTA 4NYYA 2NUYA 3VD5A 4G2DA 1S5VA 1NVMA 4IXXA 2YLAA 1B90A 3NQDA 1UJQA 1OABA 3RLGA 3WEOA 4Y90A 4ERIA 4POCA 3P62A 3EEZA 3B0PA 4OIFA 1XHGA 3WD0A 4A2SA 3UYCA 2GVEA 3V18A 1P0DA 1S2VA 4XUGA 2R1PA 4NIRA 3U7BA 2INFA 2DSUA 4LUSB 3S8HA 2XIMA 1OINA 1ODUA 1LF1A 4ACYA 1ADDA 1XIHA 3SDOA 1NFPA 3S42A 3MI2A 2VVSA 3AWOA 5C8BB 4GJJA 1BGAA 4F0HA 1TMQA 1RY0A 3QQ1A 1A5OC 4J3WA 4ZEPA 4GX9A 5K9DA 3M1ZA 4IPIA 4MYXA 2UZ9A 2FDMA 4L1XA 3GIYA 1NWSA 1FUYA 2AQOA 4C1NA 1TA3A 3OGRA 2G37A 1RSCA 4RR4A 1P7TB 1H3GA 2WXDM 3CZGA 1VEPA 3DFYA 3S46A 2FFIA 2ZYFA 3E74A 3UWUA 1OQFA 2CU0A 1JJKA 2BGNE 4N6FA 4ZOCA 1T0OA 3WH7A 1JXKA 5D8ZA 1OFDA 2J62A 2VEPA 3C56A 1XYFA 3MSGA 3TAKA 1EXPA 4FXSA 1D8CA 4HMDA 2HNHA 3KP0A 3VVGA 8RUCA 4JIHA 3GHUA 4M7SA 4UBPC 1B3XA 1SM9A 4PCPA 2ZWZA 4CVUA 1RH9A 1B31A 1CGVA 1K9FA 4A2RA 4S3CA 3BGGA 5AYXA 2PBOA 2V3FA 3FYOA 3AO0A 3PZTA 1Z6KA 3PPCA 5FD0A 4V27A 3WJSA 1LDCA 4JOMA 3T7VA 1MO0A 4TVCA 2A3HA 4C6IA 3QY7A 2EPMX 1UC4A 3ARVA 4IP5A 5FF7A 2DU2A 4W8AA 5LIKX 4NZ3A 1Q7MA 1UD4A 4FLRA 1UR1A 2IKGA 2WSYA 1S5TA 5HR6A 3MWAA 1C3FA 1WKDA 3REQA 4IQEA 4C6MA 3Q67A 2G3NA 1OHLA 1V6TA 4EVZA 4I5RA 3DOPA 3VOJA 2DZVA 3QF0A 2WHKA 4JN7A 2EPLX 1F4HA 3CU2A 4S2BA 3CUFA 4AZ7A 2DIKA 2G96A 4GI8A 4UTWC 2PGFA 4WRHA 3M0IA 1AG1O 1D3HA 1SZGA 3O1NA 1T99A 4IUGA 3DFPA 1CBGA 3RGTA 1C9WA 2HJPA 3PG8A 3THAA 2IQTA 5IRPA 1XRVA 4C91A 4QR6A 3BURA 3S1GA 5CPNA 1VFMA 4FF5A 4JIPA 2V67A 3WLOA 3HV9A 1OG0A 1EYWA 3R5EA 2IKJA 1A5LC 1XD0A 3W27A 4BQ4A 4A4AA 3A24A 5CPTA 3UNDA 5AYZA 4CNTA 1B30A 2HBXA 2RKXA 3W70A 1DJGA 3RUBL 1TPB1 4FOKA 3C3UA 3A9IA 5FF2A 3PAJA 3UR2A 1KA9F 1IGSA 4JFWA 5JXQA 3NDYA 2WKLA 3Q4DA 4KGLA 3MUAA 4I3GA 2R14A 1KB3A 3UPWA 2VEIA 4YLWA 3IGUA 4DBWA 1W9VA 1QK0A 3U0HA 4F0RA 3POHA 3NSXA 1H5VA 1P6CA 4RK8A 2G97A 1CB2A 3T55A 4PUDA 3ITVA 1WBJA 5D30A 1UYQA 2WQPA 2POTA 1SQ7A 1TTIA 1Q6OA 4AVOA 2GOUA 4PC8A 3LN3A 3NWRA 5D2XA 2A4AA 4ZO8A 4S3JA 1PKYA 3SM0A 3T0CA 1V6VA 1RK6A 2PP1A 3S47A 3VNJA 4NHVA 3DKLA 4E4PA 4IMCA 1AH4A 5C9RA 1TB3A 2C18A 4B4FA 1OADA 1VJIA 3MQTA 3MZNA 5I3IA 3F4WA 5CPQA 4IZGA 1E0UA 1K8XA 3O15A 3O7UA 2TODA 1TCMA 4QDPA 3I6TA 4U5IA 3WH9A 1I2NA 2YCJA 4ZZ9A 1SU5A 3PB2A 4F66A 1FDYA 4JNYA 1FRBA 3LPOA 5JBDA 1LT7A 3G0SA 3GD6A 1HJUA 3QM3A 4CNPA 4XZIA 3IRDA 1TE1A 3KE0A 4DBEA 3S6OA 1NWTA 4C7GA 3I68A 1K8ZA 1FKWA 2YFNA 1X96A 5FJIA 2IW0A 4GH1A 3TQVA 1JPMA 4AF0B 1ZJAA 4GO9A 2X1SA 3OVRA 3PPGA 5EFFA 2J77A 3N2XA 3GVGA 2O9PA 3AXMA 3CB3A 2E5DA 4YTQA 5AC5A 3IIXA 3IWPA 3DFSA 1S3TC 3KDOA 4EF9A 3UZYA 3NCOA 3M46A 3ATYA 4AC1X 4GISA 4Q4RA 2Q09A 4MYAA 3HG5A 1L0PA 5I3DA 3TLLA 1B2YA 3ELFA 1CDGA 5A69A 3S6DA 1TV3A 3SURA 1RA5A 1AL7A 4UFMA 4DJED 1UKOA 4GOAA 4GUHA 4IGNA 2YFOA 3GU1A 3VCNA 2Z1BA 1J10A 1MZHA 3DKJA 2VRKA 2FPYA 2GDQA 2WHMA 3URNA 1OY0A 3DFOA 2BASA 4GKTA 4NX5A 3HGOA 2HVOA 4AD5A 3E2RA 1B5TA 5AHEA 1MZRA 4BY3A 1H51A 2OT1A 4DNMA 1Q4NX 2VMFA 1NOWA 4IL2A 1BG9A 3AIEA 1MUWA 3FXYA 4KEMA 3D0CA 4B2DA 1H1ZA 2CXGA 4WLCA 2EEXA 2WC4A 3DFHA 6TAAA 5A95A 3LPFA 1Z89A 2E28A 5HUOA 1RD5A 1EJXC 3M47A 4AWEA 1YE4A 3BLPX 1K7FA 3TSBA 4AZHA 1UKQA 3AS3A 2V5LA 1XPYA 2VR5A 2Z2UA 1PIIA 3LHVA 4PTVA 4AXKA 1XLKA 3G1SA 4EIVA 4GGBA 2Z2BA 2W0UA 5DMYA 1UR9A 2PDXA 3B06A 4R27A 3N9RA 4QE4A 1LQ2A 2FGZA 2GQ9A 3E02A 3ZR4A 1TJ0A 4RDVA 3OO2A 3W1LA 3TA6A 1KC7A 4XKYA 1YXDA 3WF4A 3OLGA 2AL1A 3RR4A 4A3RA 2DFAA 2WMHA 3CTTA 5F1VA 3NQ8A 2PF0A 4IJRA 1PSCA 3TN3A 3II1A 3KDNA 3THUA 3W24A 1W5QA 3AQUA 5J04A 2QJJA 1KM0A 8A3HA 3GAYA 5I24A 3GAKA 3NGJA 2H8ZA 3GB6A 3ZT6A 3ZT7A 4EPEC 3MHUA 4XSLA 4Y9PA 3SQLA 3TYBA 4FNRA 1YPXA 3BZJA 1V93A 4AG0A 3S5YA 2VEGA 3OZOA 3ORWA 2A5HA 2P3EA 1ADOA 2DZWA 1L2QA 1T5AA 5CPLA 2TMDA 3WK1A 2J7HA 3VIFA 2V81A 3KOZA 3I4EA 4QCEA 3UQNA 4UTJA 1CCWB 4QS6A 2VZOA 1POKA 3B8VA 1EB3A 4AIOA 4DVOA 2WZHA 1VBRA 3PG9A 3PZ9A 2VVNA 4HMEA 2P5NA 2ZXBA 2WQDA 2Q02A 4PMXA 3CHVA 4IFOA 1O5KA 4G6CA 3SECA 3BC9A 3WL1A 3R25A 4REQA 4MB4A 4A22A 2R24A 3W86A 4GC3A 3UWEA 1I4NA 2A3BA 3HMCA 4IX2A 3UD6A 4LUYA 3QFEA 4B15A 4O1BA 3ID7A 5AYBA 4HHLA 4CCDA 3NO3A 2ZZ2A 4TV6A 3LV6A 3HQPA 1OX4B 4BF7A 1OM0A 3A4WA 1RLCL 1HX0A 4K37A 2Q8LA 4IUOA 1Q6DA 1MI3A 5CSRA 2C7FA 4BWLA 4CQCA 1HJQA 2O7SA 1JUBA 1ZENA 3E49A 4ZFMA 3IANA 3KBJA 5TF0A 2Z00A 5D32A 3WDIA 1YYAA 5CZ0A 1UBPC 3QC0A 2CZVA 2F38A 2EKGA 4JYDA 4E2DA 2EJAA 1A5BA 3PB0A 1CTNA 5IM51 3WDRA 1EA9C 3IUDA 3KS6A 1X1ZA 1M04A 4WY0A 3D6NA 2ACSA 5ECVA 3R12A 3DHPA 2VR2A 2G3IA 3LGEA 1GOXA 4DWSB 1G1YA 2RUSA 4YHGA 3MC5A 2VFEA 4JPGA 3FYYA 2D69A 2D0GA 1R2SA 4DUWA 4JTFA 2HWGA 4ZXOA 3S5SA 1V6UA 3P7YA 4RPPA 3AIUA 1A5CA 3M43A 3HGJA 5C6MA 3UZXA 1OGGA 4WUIA 3VKAA 3CEPA 3N17A 3GXNA 5D2TA 7REQA 1ITQA 1VS1A 3WD4A 4LUJA 5AYIA 1US2A 3EDKA 2P10A 4Q8TA 5DO8A 4LNYA 2WLYA 4UTHA 4LUTB 3WF0A 1H1YA 3H7UA 1IZCA 4I8YA 3IS4A 3TFCA 3I7QA 2IPFA 3L65A 1N2VA 3MMWA 4GGHA 2V3DA 3TLQA 4IP4A 5T8GA 4J27A 3CJPA 3VIHA 3VZYA 2WCAA 3FGCB 4AIEA 2WC3A 5RUBA 1RBLA 2CHOA 1Z3NA 2BVWA 1U33A 4DXXA 5IBXC 3BXWA 2CZ5A 4LF1A 2LLEA 1UH3A 4FLSA 3N6QA 5E9AA 4U10A 1PAMA 3GC4A 2BOFX 3AXXA 3R58A 3NZPA 3PHAA 3ZJ7A 5F1UA 3DI1A 2WVUA 4GPNA 1WXZA 5D09A 1I9CB 2Y8KA 1R3QA 5TBOA 4U3CA 3NPWA 3OBKA 2IXUA 1FH8A 3GC5A 3GR8A 2CKSA 3RX3A 1HN1A 5CXPA 5I03A 2DT0A 3F7JA 4MY8A 4Z0JA 1X8CA 4LX4A 2GJXB 3DERA 2E6YA 1ZJBA 5KINA 1XIGA 1Q6CA 3D47A 4HP5A 2NUXA 1H7PA 1ZBWA 4J3UA 2X40A 2YDQA 5BNKA 3TJXA 4I7WA 1RPXA 1B4EA 4PR4A 4Q8QA 4ZA0A 4YCOA 4WZHA 4GKLA 3EPOA 4K7VA 3I3BA 3V4BA 3VIMA 4J4KA 4QDMA 1C90A 1KFWA 2FZNA 3ONBA 4CNUA 2VL4A 3DENA 3SJ3A 4JTUA 4G8TA 4V28A 2A21A 1KCKA 1DYSA 4GYPA 2AKZA 2XVNA 2X0HA 4ZOAA 3GR4A 3AIQA 3VIGA 5G5IA 2YCIX 4TR9A 4L6HA 2XDFA 3NSMA 5CBJA 1Y5XA 1XLGA 1ZZMA 2PLCA 1OB0A 4NY2A 2DVTA 4AYSA 2XPKA 6PTDA 1F5ZA 2GDUA 3F4NA 3TSMA 4PBGA 1ELSA 2CBIA 3LNPA 1ISZA 3UETA 2OODA 1PL9A 3V5FA 1XLFA 2YXGA 2ZUSA 2QIIA 1EUAA 1VCFA 2WPGA 3EMZA 4DM2A 5LNUA 1XYBA 3T0BA 3CV6A 3KBWA 1G4PA 1QPOA 4U33A 2QJIA 1H2JA 2ZUVA 1TJ2A 5BZAA 1A3XA 2ZVRA 4NJIA 3KWXA 4K8GA 3KL5A 1K7XA 5XIMA 2XIOA 1SGJA 3QV6A 1IHIA 3LU2A 1BYBA 1WDDA 3UERA 3VCCA 1ODZA 1HG3A 3G6MA 3AWNA 3NZ1A 1TJPA 2A3AA 1FCUA 3A21A 4IF2A 1VJZA 5FESA 3SCOA 3SIMA 3W83A 1XIDA 4HK7A 3ZSSA 1XS2A 4MPQA 4WDWA 4IMEA 4UNIA 3WBEA 1KV8A 3GG0A 3NZRA 1TR9A 3PSWA 2XH7A 1NP2A 2DZBA 1SO4A 4U31A 3NQVA 4WVXA 3BCJA 4FNPA 2VOTA 3E5BA 4XBSA 3AJ7A 1H7RA 4DI8A 3FVMA 5M17A 4RE0A 6XIAA 3CH0A 5D4YA 1XBVA 4CGTA 3G1YA 5H1WA 2OX4A 3FKKA 4JTHA 1J5TA 2YGYA 4Q3MA 4HSOA 1LYXA 1HIZA 2PDIA 3GE7A 4IX0A 2J9XA 5C54A 3NQAA 1W9DM 3HV8A 1GYNA 1YXCA 2PDGA 1HL2A 2NQJA 2GSHA 4NAEB 3PC0A 2PGWA 1QT1A 5T9BG 3GYEA 3QHMA 1HJWA 1W91A 1IV8A 3VNZA 2CNCA 4D6DA 3DESA 3RPTA 4UXDA 1UG6A 1XIEA 4I7UA 3MO7A 3W1NA 3L4UA 3TCEA 1M7PA 1C8YA 5DY2A 4WD0A 3TR2A 2VX6A 4HPNA 1VPQA 4WIWA 1M6JA 1V0LA 3QKZA 1A47A 4TU1A 4XIAA 2WMIA 1H0IA 3CQJA 3NEVA 4WKAA 2D2GA 4NZ4A 3S2MA 1XLAA 2Q3OA 4D71A 3V5CA 4BQ2A 3BJFA 1H7NA 3U9IA 1LWJA 2CZDA 4M5PA 3W6MA 2XSBA 3GC2A 3ZXWA 1G94A 2PTWA 4IP7A 2E09A 5H8MA 3M0HA 1F05A 1YMYA 1BTCA 2WB5A 5CC6A 5BCAA 2XVGA 5HMSA 4ML4A 3NXLA 3VZXA 5LKYA 4QTGA 2FYMA 4CQBA 3M16A 3AMLA 3VNYA 3BAJA 9XIMA 2DVUA 3BE7A 1U22A 2BXZA 1A4MA 1QOXA 1PCWA 4LCRA 1PTDA 1HJVA 1U5VA 3B3DA 2XGBA 3QPYA 3ZQ9A 2RJGA 4N2YA 3QR1A 1EC8A 5JUVA 1N8WA 3DC0A 1AW1A 1CIUA 4MB3A 3REQB 4UCFA 1OCNA 3NL6A 3SCRA 4JY8A 4UTTC 3VFCA 4S3AA 4HOZA 2QCLA 4AIBA 1TPUA 4CQ9A 1BWVA 4JHZA 2OMAA 4HCDA 5DBTA 2BVDA 4M80A 1WV2A 2PPGA 4RNHA 2JGYA 1TMHA 3LENA 3UJEA 1VKFA 4ZFCA 1YPFA 3GTNA 5CLTA 4HA4A 1JUKA 1LQ0A 1OK4A 4IL0A 4XTDA 3EWYA 5IBXA 3LX9A 1XXXA 1V6WA 1GOQA 3UPMA 1OCBA 1YPIA 2FFCA 3RLUA 4JX6A 3AMKA 3VYLA 2V5DA 4H7CA 4RKAA 3BLKA 4JHMA 1L6YA 4W5ZA 4AD1A 1ISXA 3GHSA 4WY0F 3CLWA 2NSOA 4LY4A 5ECUA 3NR0A 2G3MA 3MT1A 3L12A 1KLZA 1XUZA 1J9YA 3ARSA 5KEZA 3LA4A 1ZP4A 2GGEA 2V2HA 1TVLA 2XISA 5FL1A 4RW5A 1MDRA 1TO3A 3ITTA 1VCVA 1VLWA 4A3QA 1OD8A 5DF0A 3H2MA 3CO4A 3W7GA 3QY8A 3W7CA 3UG3A 1C7TA 4XISA 1K7EA 2VX7A 2VX5A 2YR1A 1TRIA 4KCUA 4H9VA 3BLOA 1XRFA 3ANUA 1GQNA 1VC4A 3WD3A 4GE8A 4F2TA 4X22A 1EC7A 1QWGA 3E0IA 4HNUA 3UG4A 4DJDD 2POZA 2PAJA 5U7SA 3PSVA 3TC3A 1MQQA 3WD1A 3WDPP 3WQDA 3FNDA 3VNDA 4D6EA 3EKGA 4B90A 4ATWA 1RJRA 3OLEA 2FKPA 3PWIA 2DZTA 4JNZA 1FX6A 1RUSA 2WMGA 3WY1A 3UCDA 2NXHA 1WZLA 1E71M 1KXHA 1ZBCA 4AHQA 2PD9A 4UWMA 2VFGA 3U8GA 4GNJA 3P93A 4MJ4A 4JD4A 4XD6A 1IWPA 4J40A 5EMJA 3UXKA 1KFLA 3JU2A 2PS2A 1G7VA 1UR4A 1F6KA 3NGFA 3KOYA 3LTSA 4CU7A 1IZJA 1KFJA 1JQXA 2IMRA 2GGHA 4GXPA 3W1TA 3I7RA 2PRHA 3WMBA 4W5UA 4J3TA 3DBNA 2FZ8A 3LYEA 4C6JA 1UUQA 2ISFA 2QT3A 2DT3A 4MJ2A 3CV2A 1TR1A 1PZ1A 1NOFA 3BZGA 1LOSA 4Y6GA 3ZVHA 5HR7A 1C9DA 1VRXA 2NWRA 1KV5A 1V7YA 4XQ6A 5I3JA 1PZ3A 3CMGA 2V82A 1O1HA 3UGRA 3QPZA 1H7OA 1R7AA 2Z1SA 4Z0SA 3LM7A 5A2BA 3IVSA 2HROA 1EOMA 3QC3A 5D2VA 1W31A 1BEUA 2X1TA 1CENA 2PWEA 2GVJA 3EXRA 1LP6A 4IH3A 4LYQA 4AH7A 4G56A 2FHCA 1TWDA 2J78A 1F8MA 1XSJA 2DY3A 4AWUA 2QW5A 4CKQA 3GG8A 3G3DA 3BOLA 3DIPA 2J74A 2REQA 2CWNA 2PDUA 2VDGA 2VUNA 1QPNA 2V5CA 1I1WA 1HKVA 3VDAA 4GIYA 4PMUA 1Q8JA 3QV9A 4DHGA 3AYRA 3K4AA 3W2MA 1VCGA 2CFFA 1UWIA 2PD5A 3U5YA 1P0EA 2FH6A 1WZMA 4KFPA 2WKJA 4EXQA 3ZR6A 3SCTA 4JQ4A 2INEA 1G6CA 2VO5A 2RDTA 3TTYA 4FSAA 3VOGA 2J9ZA 2NSXA 1HJSA 2YYUA 4KWWA 1PZ2A 2R1MA 3LY0A 2FVMA 3CUHA 1PVNA 3GZ3A 3AS0A 1AK5A 4IHCA 3W2JA 4OT7A 1U1JA 1X7IA 5CG0A 4P8VA 4XB3A 4F48A 4HU8A 1W5OA 1ZALA 5TAOA 5A8OA 1A4LA 4GI9A 3VILA 1YNQA 3LZ3A 2BGSA 5HA7A 1P0BA 4H2HA 4QLJA 3RDKA 4EPDC 3RIKA 2Z28A 3ZLHA 1LZOA 1H09A 1CXFA 1ICPA 5FKYA 3SZ8A 3E2QA 3ARRA 3PF3A 3IK2A 4U2ZA 1SFSA 3QV8A 4M56A 1UP0A 2NT1A 2WYSA 1YBQB 3STEA 4CD6A 1P6WA 3OW1A 4J5NA 4O15A 3R8RA 3T05A 4D9PA 5D9MA 4WHBA 4S3EA 3LCIA 1OEPA 4IQDA 3AIRA 2GPTA 4XBJA 3MUXA 4K1WA 4F9JA 4WKHA 4ZSUA 3CHFA 1W1VA 4M6UA 1KRCC 3WH8A 4CEUC 2PDPA 2PDQA 2W6RA 3E2SA 1A53A 5KMYA 4ZO7A 1W5MA 2E8ZA 4P5UA 3H22A 1EF2A 4QIUA 4MZYA 1P5BA 3P84A 3HF3A 3SW6A 1XINA 3KLKA 1GKPA 4GZJA 4PSPA 1B3OA 1TPVA 1CXIA 2YLLA 4O53A 1KFEA 3O63A 1SZFA 1OYAA 4DAIA 1KBKA 4UTTA 3NPUA 4S23A 4KEUA 2ATSA 3TN4A 3RK8A 3HQNA 5CQ1A 3NL2A 2AMGA 3ZWTA 1VZWA 2AAAA 2BY0A 3H54A 3RLVA 3VNLA 3VNIA 4PMZA 1FWIC 2ZTKA 2VD8A 4V2XA 4WSHA 1JPHA 2AL2A 1JUEA 2VZSA 4MZ1A 1UWSA 1Q6FA 1W3HA 3N9SA 1BF2A 4UNLA 4OBRA 3W2KA 4MM1A 1XIIA 3KHJA 1NIUA 5EYWA 4DWSD 4MNMA 3CEUA 1UBSA 2QF7A 1L6WA 1M7XA 1UZHA 5I0DA 1TJRA 2O4QA 4O8AA 4WJ8A 4ENLA 1FWHC 4W7VA 2GL5A 1EGVA 1FWFC 5AECA 2XGZA 3TC7A 5A8QA 1BLIA 2PDHA 5ABFB 4KGJA 4K3ZA 2I5QA 1N7KA 1C7SA 5EPDA 3STPA 1JDEA 4ALDA 3APGA 5GJNA 3E9AA 2CITA 1Z69A 3C8FA 2XFYA 1G4EA 1Y65A 1YKWA 2QKFA 3P6LA 4IPJA 1W1B1 1MXSA 6ALDA 4YYCA 4Z08A 2BY3A 1IEWA 5K9CA 4IFRA 3ZJ6A 3Q58A 4JTTA 4P8WA 4L1WA 3WLHA 1F61A 2CXEA 3W02A 4KERA 3T42A 3FIGA 1XH2A 3EDDA 4MWAB 3W72A 3G5EA 2YW3A 4JR5A 2P50A 3S3GA 4EXAA 3OP2A 3W1XA 4QRNA 5BMXA 4G7EA 2NQ5A 5A6BD 2FB3A 1OGBA 1L2UA 1SO6A 2PC8A 5JU6A 5HUPA 5JQ9A 3UJRA 1T6MA 2QUTA 3PPFA 2PU0A 1W3IA 3GIQA 3CL7A 4Z2KA 1FWEC 1BHGA 3R11A 3AFBA 4ZQPA 2ZVIA 4HJFA 3V0TA 3WLLA 3TP4A 1P48A 4IXHA 1PE1A 1ISYA 3HN3A 3TAOA 1MNZA 3WNKA 1UA7A 4Q4MA 2XIJA 2E9MA 1V3MA 1OC7A 5E0CA 2GYIA 1EDGA 2KAUC 4LPCA 3EWBX 4CQ8A 1FCBA 2C0HA 4GLEA 3GW3A 4YCPA 1M7OA 4WCJA 4UTUA 3DUGA 1XFCA 1QJWA 3WJYA 3DU0A 9XIAA 2BG5A 3B40A 2GGIA 1LCOA 4WSJA 2V2CA 1GOWA 2PCQA 1PHWA 3TONA 3ZS4A 2PTYA 3ONCA 1Y8BA 4LVFA 5K3VA 5CKSA 1NJJA 4ZQNA 1G9HA 1FOBA 4BK9A 2OKTA 4Y8FA 1B3ZA 3F5LA 1DQUA 1LOQA 3NVDA 3MA8A 2V9DA 4RNJA 3EX4A 3FHQA 3NSNA 5AKQA 1TX0A 3H2AA 1WYIA 1U83A 2HK1A 4M24A 2ONEA 3W7JA 4MKSA 1SYTA 2IPGA 2OSXA 3FEQA 3SCSA 2W5FA 2FJUB 3P80A 4NASA 2GK1A 5KITA 1Y7VA 4Z1YA 2XZ9A 3NOYA 2J4GA 3AZTA 3CPUA 3UR8A 4LW7A 2WSPA 2OFJA 1KM4A 1MFUA 2EO7A 4QEEA 3KTSA 5LNRA 1JF6A 1IWBA 3UR7A 4L4MA 1XKJA 3NQ2A 1ZB5A 2YXOA 1GVRA 4O50A 3KW3A 4US5D 1JCNA 5A8PA 2WWCA 2VCBA 4HA0A 3LCWA 4EAMA 2JGQA 1NM9A 1DHPA 4JEQA 1HVQA 2DSKA 3NFUA 4ECLA 1FHLA 2F61A 4AZBA 1E4NA 1RBAA 1E6XM 1YTKA 3EMCA 3C61A 1E6ZA 4C7FA 1UUOA 3B05A 5LNVA 5H91A 1NDVA 4JKKA 1VBHA 4MB1A 2FB2A 5CGQA 1AW5A 1DTNA 5HPCA 3IJQA 4LAKA 2XWEA 5TNVA 5I3GA 4HBKA 4ZE5A 2I16A 1YTEA 3M5VA 1KKRA 2CBUA 5FSEC 4DWDA 4X63A 1NFBA 3TMLA 5E6ZA 4AQLA 1R3SA 1P7TA 4JQAA 2V5BA 4QGCA 1CECA 2WC7A 3M5ZA 4KQNA 4Z2HA 2H9AB 1UMLA 2OPJA 4HN4A 2G0WA 2FHBA 4DBUA 2V0TA 5IXEA 3O06A 3H12A 1I1XA 4MIMA 3AISA 4M6QA 4AY8A 4ORMA 2QMKA 2MANA 4YL2A 4UCGA 4J9JA 3PUEA 4PL2A 3UWWA 1PYFA 2ESCA 1JXJA 4KWVA 3ZMRA 4RZBA 1YXYA 3WUBA 3S5ZA 3UWVA 5A8MA 5CGTA 2VURA 3CZLA 4Y7EA 3NDOA 1TIMA 3OEXA 4B5TA 2VENA 1UZ4A 1TG7A 4IICA 3BMWA 4F40A 4KT2A 1XIJA 3MKKA 2QLYA 3N29A 4A3YA 1D3CA 4QCFA 4JFSA 1ONRA 4NU7A 4DYKA 5CCZA 3P0XA 5C55A 3A5FA 4CCCA 4US6A 4HCHA 3FN9A 4HYWA 2NVDA 1JDAA 5HULA 3VD3A 1GVIA 2NQ9A 3H4WA 4HNNA 1IEQA 2ACRA 2V38A 4KWSA 4HYRA 3UCCA 1QK2A 1KRAC 5CGMA 1JCJA 4H2CA 2O4MA 2XH4A 5D37A 3RO6A 1QRQA 1HNYA 1GVYA 3MUCA 4NX0A 2W92A 4QJ5B 3KRZA 5AC7A 2WMKA 3KAOA 2QDGA 3ZOAA 1QO5A 4HVXA 2DQWA 4OQVA 3NG3A 1RJQA 1S39A 2P88A 2BODX 5E70A 2ZXAA 3BAKA 2J7GA 4OWGA 3S2JA 3H53A 1V03A 1IR2A 1UZ1A 1W54A 4LVBA 5AY7A 4MZ8A 1XW8A 4LWWA 5C9ZA 1V08A 4Y9MA 3CAWA 1CX9A 4E5TA 3AXIA 2YA1A 1KTNA 3WUEA 4XIMA 4J2MA 4XVDA 3LZ5A 4O52A 4JYEA 3MV01 5J5RA 3CTLA 1JCXA 2WZIA 3HGRA 3CB8A 2WMIB 1D7KA 5HMDA 3SSJA 1QPQA 4FOJA 2Z24A 1XDMA 1QNOA 3EX6A 2W79A 1VAHA 4QAWA 4Q8OA 1F3WA 4B5VA 3CUIA 2V2DA 3L0GA 1WDQA 5HAOA 3PBVA 1SR9A 1E9LA 1F76A 5CSSA 4PODA 1OF6A 3DX5A 1ZCCA 4K8HA 3PBYA 4JTCA 3B9OA 4H3DA 1R2RA 1S2TA 3E2VA 4F0KA 2QAFA 2Y7DA 3SRKA 4JQ1A 4JFVA 4F2BA 5CBBA 5HMEA 3GDLA 5C9UA 3WJZA 4GACA 2HBVA 2G41A 4IQJA 4QEHA 1WCGA 1DIKA 1H62A 1DL3A 3OVQA 4AB4A 1EEPA 4JQ2A 1VFFA 4FR6A 1XG4A 1E73M 3TYUA 3LLXA 4JX5A 3PZOA 1OIMA 3SN1A 5LA0A 3VGBA 1V3IA 1ICSA 3INPA 4C65A 1R3WA 2OYMA 3IIZA 3G0UA 4GYJA 2OEJA 1RVKA 4GBUA 1JD7A 4Q4PA 3WUGA 3LMZA 1DJWA 4RZ4A 3LCGA 5DCEA 4L7ZA 3ARYA 5A3HA 5LZLA 1Q2RA 2ZRUA 3IEBA 4LS1A 3FFSA 3UZZA 1V79A 3B8DA 1DJZA 2ZRYA 1W3TA 3L4TA 3TE9A 4WGHA 2QJNA 4HU4A 4EXBA 4M3PA 3JVAA 2OXNA 4MSSA 3DHFA 1PYMA 1LTDA 2ZDRA 1TCDA 2HVMA 5BXTA 2A7RA 1O5QA 3R94A 1VYPX 3OVGA 1OX6A 3WJXA 2AGKA 3V1PA 4IOTA 3AHZA 1RY8A 2BLEA 3KRSA 1B3VA 4PL1A 3TW6A 4G5DA 3MKVA 1JCYA 9RUBA 4Y9NA 5K7JA 3WQ6A 1UWQA 4XZBA 3D3FA 2OGYA 3TN6A 1YX1A 4AF0A 3B03A 3WFZA 1W9BM 2QCEA 5GJMA 1UROA 1FFQA 1QUMA 2Z6JA 3IAQA 1Y5VA 3ZWSA 1H11A 1X6NA 5BYWA 3O2LA 1MNSA 2VRJA 2QPUA 4WJEA 3SCNA 3NUKA 1B54A 2E1DA 1OFOA 3WBYA 3O6CA 1S5MA 4IPNB 3S2NA 4GUGA 2ZUNA 4WDUA 4FNSA 3DN5A 3RCMA 2VR4A 4PUWA 4BQ5A 4TO8A 3ZSTA 5D8WA 1TX2A 3DHUA 4MPKA 1S5WA 1X97A 1S2AA 4BI6A 2PP3A 3BV7A 4OV9A 3HTWA 4L1GA 4CVWA 3WBXA 3FA3A 1KKOA 1MW3A 4HQVA 2PE4A 5EBAA 4LYKA 3STFA 2PLKA 3UFYA 3P14A 4UZSA 4KS0A 3KBSA 3CK5A 2OLSA 1FHVA 4PUNA 5KSWA 1E0TA 4XKMA 1EEXA 2CZFA 1JI2A 4AEEA 1IXNA 4FIRA 4GQBA 3I7SA 3B9NA 3A4AA 4JL2A 3W1PA 4AY7A 3U2OA 4OOZA 1K77A 3BPWA 3DYOA 1G7UA 2V69A 1HO1A 2HTMA 4AEFA 5FJPA 1WAWA 1J0ZA 2D3LA 2P0IA 1R9ZA 3ARUA 1K6AA 2PSNA 4MKVA 4DZIA 1UKTA 2F84A 4H04A 2A0NA 1WO2A 1LM1A 2EF9A 4IIGA 4AD3A 3BH4A 2Y8UA 2Z1WA 4GUJA 1IXPA 4IMDA 1CXHA 4AFYA 4Q22A 3WNMA 3W1AA 2V6AA 2YCLB 1DWAM 1S1PA 4C7DA 3WQ4A 1JD9A 1J8VA 3CO8A 4B2DD 1M65A 3VIJA 1NY1A 4L6OA 3NNTA 2YBVA 4YJ5A 4PZVA 5LIYX 3EMQA 2AMXA 5FF4A 3OPSA 4FALA 3OJGA 1E5NA 6A3HA 5D9PA 2BY1A 2X7VA 3HPSA 3M0KA 4DQWA 5ENLA 4D2JA 2ZX7A 1XGDA 2ZUUA 4FXFA 3RM8A 2GJLA 4K2SA 1L8PA 4IMFA 1UC5A 2WJDA 1X39A 2DUAA 3UF9A 4X0VA 1C8VA 5A8NA 3OYZA 1C29A 3M7WA 1NWUA 1W1TA 1XGEA 1W6TA 1YQ2A 2EBNA 4PE8A 3QLDA 4DZHA 4QAIA 1KR1A 4BA0A 3S83A 2ANUA 4ICMA 2CWXA 1TWSA 4DJFC 3SCVA 1B0IA 1J6PA 1DIDA 1KO0A 3W84A 3WH6A 1H4PA 4X9SA 3PPHA 2V3EA 3WMLA 4F0SA 2Y8VA 2VNCA 2X0YA 1G01A 3DFNA 3H2OA 1EGMA 1DJXA 4P7QA 5HINA 4TOQA 3W1QA 3B04A 2OSWA 3WIJA 1DE6A 3QKEA 3TOPA 4XD4A 4OVXA 3TYEA 3RITA 4M29A 4Q32A 3R10A 4LVGA 2H90A 1J11A 1QNRA 1L6SA 1VFUA 3RX2A 3MBDA 2XIQA 3CT2A 4KRTA 5EFDA 1N82A 2V5KA 1W3KA 2R1LA 3BLDA 4H6KA 3RFAA 4M7TA 1QTWA 1T40A 2QCMA 5ABEA 2CESA 1OT2A 2Q8ZA 1X7FA 3S1VA 1FWRA 2YCKX 2VGGA 3KCOA 2XGIA 5C7HA 4URIA 1GZJA 2ZDSA 4NJKA 3M0LA 3BICA 3NO1A 3VGHA 1H50A 1AODA 1W5PA 2I57A 4HIBA 3TJLA 1F6YA 1FBAA 4BI7A 2WJZA 2OZ0A 1JEZA 1KNWA 5I02A 3P0WA 3V1HA 3KXQA 2OZTA 3UNTA 1GWJA 2INZA 1V7AA 4HMNA 4CLMA 5CH9A 5IDZA 5CBIA 1XRSA 5CG7A 1RPKA 3ABZA 1O95A 4GHRA 4AD2A 1E0WA 3AYTA 4MNKA 3BJSA 3IJ7A 3ABRA 2P0OA 3LHTA 1BYCA 4IIBA 5HANA 1DBTA 5C2XA 1P4CA 2B0MA 7TIMA 2R82A 4J3SA 4UOZA 3QMTA 1WA3A 2E67A 1UCWA 4JIEA 1DPMA 3WF3A 4IFKA 3W7KA 1BFNA 2G95A 4DZAA 1BGGA 2ZRXA 5G4WA 4AD0A 1OJXA 1R87A 2V30A 1A0DA 2NX1A 1GGOA 4H9UA 3GXMA 1RCOB 4M0XA 4CNNA 2PRLA 4LGXA 3WQCA 2VC6A 1KBJA 3M41A 4E2VA 4FX6M 4LUTA 3G8RA 4PMRA 1REQB 2A1YA 2YYTA 5LNWA 2JF7A 1VHNA 1XUUA 4LU0A 4JCLA 4C6PA 1QASA 4ZO9A 4XV0A 2J24A 5JMUA 9CGTA 1U1HA 1Z32X 4FMVA 5HPOA 2Z2AA 1C92A 1YDNA 3FGCA 3GTFA 3PZQA 3W7DA 3VD4A 4HB7A 1ZGDA 3MKCA 1ICQA 2DIJA 4IGHA 2IS7A 1W1ZA 4UIOA 3QSRA 5I6SA 3BMVA 5GNXA 2QVHA 4U4MA 3G1HA 5K2ZA 1V02A 1K4HA 4RPQA 4C1LA 1Q4WA 4TUFA 3PBUA 2ZIDA 5IFPA 1E4LA 4LB4A 4DNHA 3BAWA 3RNDA 2W3ZA 2HZGA 4H19A 4QE1A 4N6EA 3EWDA 2WZEA 3G1VA 2HPIA 2ICSA 1QNSA 4AWSA 4DPQA 1CW2A 3GH5A 3WO8A 3I3EA 1SFJA 5HJYA 5LYRA 4LBRA 4FIQA 3EKLA 4DYEA 3AS1A 3U4FA 3ZIZA 4QLLA 2GJXA 3O0FA 1KW1A 5CSUA 2D2HA 1WKEA 3DYMA 4GH3A 1WZKA 4KESA 2FZ9A 1PIFA 1AH0A 2QMJA 1S38A 3CIWA 3L5MA 1H7XA 4F3HA 1UH4A 3VOFA 2OO0A 6TIMA 4ZB0A 4XD5A 7ODCA 3TZFA 1US3A 1LQAA 3MTWA 1XP3A 2ZKMX 2VKZG 5FJTA 3H55A 3BJTA 3SIZA 4NZJA 2VJXA 4Q8NA 1UWRA 2DORA 1TWWA 1Q6LA 2Y24A 5AN7A 3W37A 1PKNA 3GXFA 2FLIA 5LA2A 1FWGC 3VFLA 1XV8A 3L7RA 4B92A 4R7OA 4Y8EA 1G67A 3VE9A 4L5ZA 3C4UA 4BHYA 1TREA 2GQ3A 3BG5A 1YTDA 2Z27A 4NZ1A 2BHZA 1M01A 2ZXQA 2D23A 3H7RA 4QISA 4EE9A 4EAYA 1HVXA 5LXXA 3OHMB 2GWGA 1TZ9A 3MVIA 1TPDA 2HVNA 1YDVA 3PZUA 3QYSA 1QOQA 4JICA 2TSYA 2GK1B 2B31A 3SCWA 3THQA 3E5PA 3GYCA 4YPJA 3GNNA 3QW4B 3L5LA 4JS3A 5A2CA 4FR1A 1I75A 2PBGA 1AW2A 4LAOA 1V6XA 2G4JA 2ON3A 3DEQA 5AHMA 2VCCA 1RA0A 1GVOA 4QG9A 4C6BA 4LSBA 1FP8A 2F6UA 2FPVA 2CW6A 2R9RA 2Y89A 2QQ6A 1EFZA 2WV8A 3BUVA 1K70A 1IIHA 3GVQA 1RP8A 3N9KA 3O0KA 5A2AA 4DJFA 4D6IA 5LA1A 1FP9A 4D6HA 1THFD 1Z42A 3MSRA 4HNOA 4LS2A 4L56A 3AU6A 2A7PA 4H01A 3T40A 3MV11 4CEXC 2X16A 4O19A 5DMNA 1PPIA 4ZGYA 2Z6IA 1NDYA 1NDWA 2A3LA 2YL8A 3UG8A 3EYPA 1QNVA 3K4DA 3CM4A 4ADSA 1M68A 4AZ5A 1DIEA 1RJPA 4NAFB 4E8DA 2HS8A 4NAEA 3BARA 2CLLA 5L6UA 1E6RA 4H8UA 2XSAA 4YVVA 2W62A 3MHFA 2WAGA 3EZ4A 2XUCA 3FYPA 4XO7A 3DECA 3PJXA 4W93A 3MMDA 5DMMA 4ATLA 2J7BA 5BXRA 2FDSA 1PDZA 4JTQA 4K7YA 4L80A 2CKRA 4ML9A 3SFWA 1GVSA 3CWHA 5B7ZA 1QHOA 4J28A 1XSIA 4I7VA 1GK8A 1OF8A 5AFDA 1NF0A 4NJJA 4OZOA 1AFSA 4N9BA 5CJMA 2OQHA 4X60A 1H1NA 3AAMA 3IACA 3K4WA 3W07A 2GVLA 4GYFA 3RF9A 1M1BA 3SGGA 4H7ZA 4QP0A 4JTDA 1JZ6A 1MQRA 3TNOA 4DLMA 3AJXA 2CERA 2OLHA 4YNGA 3SGUA 3KP1A 1EP2A 3O6AA 3WQ5A 4H00A 2XIBA 3N14A 3OU8A 2OR2A 4PBEA 3R13A 3QLLA 2VYOA 2PDBA 5IFTA 4JDBA 4E2BA 1MWOA 1TV8A 2CLIA 2HE5A 1MRQA 4B3LA 5LHEA 1KTBA 5FOOA 1J2BA 3RXZA 4TXEA 3R43A 3RO8A 2D0FA 2GLKA 4GC4A 2NV2A 1I6NA 1A5AA 3OOQA 2O9OA 4IGSA 3A47A 3QN3A 4MLRA 4TQTA 2CIPA 2W61A 4UTFA 2XG9A 3IGHX 5I09A 1JCLA 1TQJA 4JKMA 4GXWA 2D73A 4CD8A 3W6YA 1ZUAX 4ZXLA 4S3FA 3CAQA 4W9TA 3TU9A 1ITXA 4JAWA 1G5AA 1PHQA 4W88A 3W6LA 2WVVB 3C2RA 3TQPA 2QCCA 3QY6A 3WNPA 1T7LA 2J6XA 1DJHA 1YE6A 4QROA 5HMFA 4QM1A 3UU0A 1K4GA 1GQIA 3IAPA 4XAGA 2XN2A 3W38A 3OHIA 2HEJA 2DSZA 3TXVA 5KETA 5H8UA 1TV5A 3CNYA 4MOZA 5AC4A 3QRHA 4QBXA 5EMLA 2J8FA 3IV8A 2Y70A 1P0KA 5FAGA 1SFLA 3W74A 1A80A 1UB3A 4RXGA 3W23A 3PTDA 3VKJA 4O4WA 2CLEA 1KGUA 1ZAIA 5AOUA 2C1GA 1ECEA 1TQXA 3D5HA 3VUSA 5JH2A 1F3TA 4L61A 1R7OA 1E6SM 1M53A 2PWGA 5KZDA 3M0JA 3ITGA 1QOPA 4BI5A 5HNTA 5HBFA 1VFSA 4A8IA 4EX4A 3ABOA 3QXBA 2ZXDA 4KCVA 4YU1A 4CQDA 2RFGA 3W25A 1FWAC 1D8WA 3OA3A 4WEVX 3WNOA 3KX6A 1PUDA 1W1IE 4MAVA 4A35A 2QPXA 3RPMA 3EB2A 2IQDA 3E38A 1ZQ5A 1Q66A 3IUHA 1R9XA 3NZGA 5FJRA 2CPUA 5DN1A 5AC6A 4MWAC 1W32A 1HP5A 5BWAA 3O3RA 1PTAA 3V3WA 3TA9A 3B8IA 4LB3A 5EBUA 4MUZA 3VD9A 3V7PA 1JIBA 1LWIA 1MSSA 1CPUA 3AHYA 2CLHA 1F2JA 3HPAA 5I7GA 4EOUA 3HGSA 2DZXA 1LOLA 3EA1A 3ZZ1A 2EQDA 3W4RA 3SN0A 4IIEA 1GVEA 5I3HA 2WMJA 3MYOA 1SSGA 3TQKA 4DEFA 3CXOA 3U7VA 4UTIA 5AZ1A 3AI0A 1QCWA 3CMJA 3OQEA 3C86A 1I2PA 2PODA 3QGAC 1J01A 1PWLA 1PDYA 3KCLA 1MUCA 1H60A 2XM2A 4YTSA 2YA0A 4H9ZA 5D05A 1Q6EA 4N4PA 3PUOA 1WQ5A 2ACUA 2FMNA 3U3HA 1ZU8A 3MUIA 3RRAA 4FPSA 1QW7A 1B9BA 1FWBC 3IJLA 3GIPA 4LRTA 3AUOA 2NZLA 5DXXA 4Z42C 2PDCA 1UWTA 1XX1A 5AHNA 1D3GA 3SI9A 1S46A 3URQA 5KZEA 1MYRA 4BEUA 3EOUA 2OG9A 5LXEA 3ITLA 2PU1A 4JCMA 4BS0A 2PWHA 5E5CA 4PFMA 5FI8A 1VJSA 1X1OA 3B0XA 1VLIA 1RQEA 2WPBA 2Z0IA 3ZYZA 1ONEA 3QZEA 3JZEA 4C6LA 3NL5A 2OB3A 5I07A 4X61A 2YIHA 1W8GA 4GCXA 1RCXB 3MS8A 1VBUA 2BHYA 2PZNA 3G1DA 1EH9A 3APYA 1P1MA 5CPMA 3FSUA 1NU5A 2Y6ZA 2Z25A 5EA9A 4KBXA 1FCQA 4GQ0A 2GQAA 1JDFA 3FS2A 4D6JA 4HTBA 3V16A 2YZ5A 3LNMA 4ZR8A 1G0CA 3VTRA 4KEVA 3TROA 8XIAA 2Y85A 5DCDA 3L2MA 3GHTA 3B8TA 1BD0A 3ZLGA 3L68A 4MHBA 1WOAA 3WBAA 3VK5A 3LHWA 1R30A 4I5XA 3GTIA 5A6AA 3GWQA 2I1OA 5H6HA 2V63A 2DT2A 3W1MA 1RK5A 3H2FA 3FEMA 3MYPA 5F2IA 3R8HA 1ONWA 3NVTA 1PWMA 3P74A 5T91A 1CLKA 1E4MM 1J18A 3WENA 1WBHA 3KWSA 3LI0A 1GONA 4WK9A 3SEPA 1LL7A 3CUXA 3EAUA 3U6WA 3RU6A 2ZZ6A 2X41A 1MFVA 1UHVA 1EL3A 4AZGA 3K46A 1WDPA 4XG1A 3PZVA 4FEZA 4QG8A 3GKFA 2E25A 5LSMA 4MGGA 2QJHA 1E3XA 1XYMA 4OOUA 3QGKC 1R3RA 3IV3A 2E68A 3N34A 2I14A 2XJ7A 1W3LA 3GFZA 2HMCA 1BPLB 1TELA 1JFHA 4GCAA 1XI3A 3DI0A 3U4AA 3LTPA 4MY9A 1T8QA 1ZBKA 4A8NA 3VMPA 2QCDA 3N1AA 3LM3A 1VIZA 3W29A 4XD3A 4XSMA 1YBQA 4MTVA 4Z2JA 2E77A 4JQ3A 1NFGA 3DDMA 1HKJA 1R9YA 1EX1A 1OK6A 1UP2A 4A6GA 4ILSA 4Q8PA 2Y7FA 2Y62A 3BL3A 3GDMA 4WKFA 3WK3A 4O1DA 1HKKA 3AS2A 3EX2A 4UFKA 3QH2A 3FDGA 3FDKA 4BFAA 2EKCA 2VGFA 2R91A 2X09A 1E70M 2EJ1A 2D20A 2L5HA 3JW7A 4UFIA 3H4XA 3DBPA 1E55A 1S2UA 2FZMA 2E6DA 4LV9A 1GZGA 3G0XA 5I23A 3MMTA 1TPFA 4Z2LA 1FH7A 1K8YA 1SZNA 1TV7A 2DDXA 1R85A 3UZ5A 2CC0A 3E3HA 2O56A 1ESWA 2R1NA 4YVPA 3QYQA 4UOQA 1M41A 5E1QA 2FZBA 3CV7A 3QBUA 3C8NA 1ZLPA 4UTWA 3N18A 1PZ0A 1KD0A 3RMEA 3S1UA 1IT0A 3W87A 4GRSA 3G77A 1OFAA 3QHNA 4K8EA 1B57A 4Y9OA 2J8GA 2PGRA 3RHGA 3WZ0E 3CQIA 4NG3A 3FSTA 3O8AA 3GXDA 1LL6A 2OELA 1EIBA 3AMCA 3L5AA 4L9YA 2BVTA 2D24A 3GH7A 4TVUA 3T2OA 4DI9A 4L9XA 5F2MA 2WK2A 3ABXA 1DJIA 1EP3A 2NLYA 4XZHA 1JZ7A 5K4ZA 5FCZA 2OVLA 3VOIA 3IJ8A 2WM0A 1ZBVA 2VGBA 1TWIA 1K8CA 3TV8A 1R0MA 2HPMA 4UMCA 4PTXA 1GHRA 1DORA 1IYXA 5ABFA 1GZ1A 3B8SA 2TAAA 4V15A 2UV8G 2QYGA 4GI4A 2EPKX 3GSMA 1R3TA 5AHFA 8TIMA 1KBIA 1DVJA 1XKYA 4W7UA 3OIXA 3PANA 4MKNA 3OB8A 4DO7A 5F4XA 4HYVA 3L2LA 2FMOA 4JIIX 1J96A 3IJ6A 2G4FA 3I10A 3M6YA 1J0YA 3EXSA 4C6EA 2Z1XA 1E9ZB 4MWAA 3TFXA 1B9ZA 4GA8A 4AX6A 1TRDA 3AHTA 2D1ZA 7A3HA 4V33A 4HK6A 4FOUA 1SW7A 3HIJA 1JGMA 4EPKA 4GG9A 4IFKB 4JKLA 4W87A 1E9YB 2GJRA 2BDQA 1F3EA 4BCEA 1HGWA 1QW8A 3BW3A 2OWCA 3ARXA 3CPGA 4DM1A 2DZSA 4HHHA 3ME3A 2WKGA 3LD5A 1GJPA 2JK2A 3TKFA 5G2HA 5JBEA 3BSHA 4NT0A 5E09A 3SUTA 2C1HA 2VZUA 2Y5EA 3UJ2A 1ZPTA 3CZEA 3TWBA 2XSXA 4JIRA 2DH3A 7PTDA 4MADA 2XFFA 2FZDA 2JKEA 3R8GA 3C2YA 3N2MA 3TJ4A 5AC8A 1DWHM 1PS9A 1ML1A 3H2EA 3VKDA 1AMYA 4KRUA 3AXHA 5CZSA 2C0AA 3BMXA 1KCZA 1GTEA 1FXQA 3VPLA 3LBCA 2G3JA 5REQB 2QGYA 2UBPC 4P7NA 5DT7A 2IUZA 5HATA 3UP8A 1VGAA 2B4GA 2HS6A 2ZUTA 3KVMA 1QBBA 3SQSA 4TTGA 4QITA 1XIFA 1JGIA 3V5OA 4N7QA 4R53A 2OO6A 1W56A 4PBFA 1R6WA 3EEGA 4J3XA 3KBMA 1ITCA 3UR5A 3WFAA 5BRBA 3QQ0A 4CN1A 1JYNA 4XUYA 4S38A 4S3GA 4PCNA 4L4LA 3KVKA 4HU3A 1AUSL 3OTRA 3VKBA 1CGXA 3P8JA 3OZMA 1GW9A 4NZ5A 2VQTA 5FA5A 2BHUA 4LEQA 1VFTA 3TTOA 4QS5A 4AWTA 4HTYA 1VEOA 2YPIA 5XINA 1FDZA 2X2YA 3SCUA 5MKGB 4C6CA 3AYSA 3WFLA 1OFBA 2PA6A 3G2GA 3RR1A 5J8LA 4FB7A 4LY8A 4A3HA 3CV1A 5HQLA 4LJ3A 4YTUA 2DPEA 3W0KA 3KRUA 1X6LA 3WMSA 2NT0A 3QVQA 1BWKA 3TQ0A 2CZEA 3ARQA 1UR2A 3VIPA 1RXOB 3H23A 2Y5SA 3JS3A 2OWXA 3W9ZA 1V4YA 2QUUA 4F8XA 1C8QA 3SAZA 4Q4SA 4O1FA 1A5SA 3NM3A 4Q4QA 4QJ3B 3LRLA 4LF2A 1E3ZA 2H9AA 5HWMA 1BVZA 4NJHA 4BF5A 3FOKA 1VH7A 5H2ZA 3B9DA 1XYLA 2HISA 3S9YA 3FCPA 4UQBA 5AYYA 2YZRA 2RH9A 3GQYA 2O9TA 3XINA 3ABSA 1JPKA 1E4IA 4PUJA 1VFHA 7CGTA 4GVGA 5FIPA 1GKQA 1F6PA 1AMKA 1WAUA 2VUYA 1EWEA 4PRRA 2BXYA 3MHGA 3UGVA 3N73A 1V8EA 1QNQA 5E9XA 2QVNA 4PMVA 3EWXA 2AAMA 3URBA 3KFTA 5CZTA 1GVQA 3RM4A 4CD7A 4PMQA 2YL5A 3TC6A 2QF8A 4OECA 3BV4A 4P61A 4TVDA 5TQLA 3WF1A 2QCHA 1RQBA 5SWUA 2W27A 4K6AA 1KXVA 1KM3A 1QVBA 5G1MA 3HFTA 1HKMA 2QCFA 4GIRA 1VHCA 4GJIA 1HQTA 2J13A 4OU1A 1D9EA 2BB0A 1LLWA 5CJ5A 3IRSA 1UW9A 4OHQA 1CGWA 3EGJA 3W22A 2G5WA 1V3LA 2JEQA 1T96A 4DBDA 3OLDA 3F5KA 3GDBA 4BEQA 1R47A 4TX6A 4IIDA 2WCGA 3F2BA 2W67A 6CGTA 1JYVA 1OFEA 1PKLA 1DXEA 1AD1A 2ZX6A 2JALA 3B9AA 1WDSA 2PDWA 2PI6A 3PR2A 4OTKA 3M5XA 1XR2A 3F5JA 1FWNA 1DV7A 3RJYA 2GOKA 4LV4A 4LH8A 4O16A 2QDHA 1SJBA 3Q2DA 1GKRA 5A6TC 2GUYA 3A3XA 3UYIA 4GWEA 2Y63A 1DP0A 1VEMA 4QQUA 3VX0A 4TX8A 4W86A 4NYUA 1GW1A