3U5UA

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
501
structure length
470
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Raucaffricine-O-beta-D-glucosidase
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
total genus 178
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u5uA00
2WAGA 1JL8A 3WUFA 2VJXA 4U2YA 5M3WA 4XV0A 3MO4A 3W53A 3NSNA 5IFPA 1C92A 4U31A 3WH5A 2UY2A 3RPMA 3PZIA 4D1JA 1WDQA 2W62A 3AIVA 2VMFA 3K1DA 5CQ1A 3VGFA 3AMCA 4Z2LA 3SEPA 1UUQA 3AXHA 3RO8A 3CLWA 4UFKA 2BHUA 3ZT6A 5A6BA 3UR8A 4D6HA 4JKKA 4HTYA 2E40A 4D1IA 3MSGA 1FP9A 2O9OA 2C7FA 3RM8A 3WMCA 3WNPA 1QI0A 2ZUMA 2J8FA 4BQ3A 1BLIA 3SCNA 2WWCA 1M01A 2CETA 2WVUA 2XHYA 3AHZA 1W3HA 3B9DA 4D6GA 3WY1A 2MANA 3W27A 2XVLA 2G3IA 2ZXBA 3VIMA 4FMVA 3W82A 1M03A 4JFWA 4NI3A 5HBFA 3RILA 2GJRA 1Z32X 2A3HA 3WDRA 1ISVA 1MW2A 3WQ4A 3GZAA 5BXTA 1QI2A 2WHLA 2JF7A 1CXLA 3W24A 4WSJA 3CZKA 2BXZA 4J3TA 3TONA 3HMCA 2CXGA 4W85A 3BAXA 2PI6A 5EFFA 3APGA 1XYFA 1HX0A 4PMNA 2G8ZA 3NJ3A 3W38A 4H8UA 1Q6FA 4D6JA 2V5DA 5E0CA 3T09A 2GFTA 4DM1A 1V3MA 3ZSTA 1TUXA 1KBBA 4PMYA 4CN6A 1QI3A 2UY4A 2W91A 3OLDA 3QR3A 4AD2A 4FLRA 4ZXLA 2YDSA 2XUCA 3VIOA 1Q6DA 2D20A 1JYXA 2VC9A 3MU7A 3VIJA 4TTGA 4HZ8A 1H4PA 4MB1A 2C0HA 2E4TA 1KXQA 3W6MA 1EHAA 3GNRA 2XGIA 4RE2A 1KB3A 4D6IA 2VX7A 3ZM8A 5E09A 2PBGA 3N15A 4GZEA 2E8ZA 4LGXA 3SCRA 9CGTA 1JZ2A 1QHPA 3WL0A 4Q22A 1AMYA 2V3EA 3QOKA 3BAWA 1ZJBA 2WW5A 3AXXA 2EBNA 4P7OA 1GOIA 4UTFA 4GI8A 1E3XA 3UG3A 4D6DA 1NWSA 1KWKA 2GK1A 3WDQA 1MFVA 3WUBA 2FH6A 1JG9A 2CYGA 4W5UA 1WDPA 1B0IA 1ODZA 2V5CA 3AYSA 2XJ7A 2OYLA 4CN1A 4P8VA 2VRQA 1UKTA 3WIJA 2X0HA 2CBIA 1E0WA 4YHEA 1GUVA 3GYCA 5CPQA 1VBUA 4ACZB 3CZLA 5I23A 4V2XA 3WMSA 4AC1X 2YA2A 1B3XA 4IM4A 5F7UA 4S3JA 1UD8A 1ESWA 1V3LA 3VOCA 3A47A 4J3VA 3EYPA 1JIBA 1MWOA 4X0VA 3GBEA 4FF5A 3AZSA 4M29A 4AXNA 4OUEA 3SCUA 4AD3A 3MUY1 4D6CA 3UCQA 4B15A 5BCAA 1DP0A 4B3LA 3BMVA 1GZJA 1EDQA 2CEQA 1MFUA 4ZFMA 1JYWA 3WF2A 3VDCA 2D0HA 4AD5A 1B9ZA 3N9KA 5D8WA 1E6RA 1MYRA 1JYNA 3CBWA 3FN9A 2XSAA 1FHLA 1V03A 2VCCA 4WLCA 1HJUA 2XWEA 1IZKA 1KQZA 2EPLX 4UZUA 5EMYA 5A69A 1I75A 3PTKA 1JZ6A 4MDPA 3L2MA 3AIBA 2GSJA 1VJSA 1EA9C 1ODUA 4Z2IA 7A3HA 3WEOA 2OWCA 2VT0A 5FKYA 4JL2A 2WLZA 4C7FA 2X2YA 3PZGA 1WB0A 1JAKA 1PZ3A 2DT0A 3CHEA 1AQHA 1UOKA 4CD6A 2CERA 1LL6A 4MTVA 2WBGA 4JFUA 2GDUA 1NP2A 3RIKA 3BAKA 1DWFM 2VR4A 5A3HA 1MXDA 3NDZA 5CLWA 3LPGA 4QLJA 1FHDA 1LLOA 3VGEA 3AS2A 1I1WA 1PIGA 1W9UA 3VIIA 2J7GA 4ACZA 1WP6A 5AY7A 2D0FA 4W8AA 6CGTA 2QPSA 3NCOA 4UR9A 3BSHA 1HJVA 2ZX7A 2DQXA 2JEQA 2ZXQA 1VIWA 2YLAA 2BVTA 1J9YA 1UKSA 3WQWA 5JIWA 5M17A 2D0GA 1UHVA 3T08A 2J75A 1QNOA 4UQ9A 1M7XA 2WC7A 2ZWYA 4BQ2A 1EOKA 1UWIA 4J3SA 5CSYA 1QHZA 3K8KA 3OLIA 5FL1A 1R7OA 1EOMA 2GJXB 1D2KA 1V3JA 3VM7A 5I78A 1B3WA 2NT0A 1UQYA 1V6XA 4LYQA 2ZX9A 1W9VA 3PTQA 1BVNP 5I2UA 2AAAA 1FOBA 1NH6A 1QW9A 1W3LA 1WNOA 4Y7EA 2WMIB 4BF7A 1LL7A 1LWJA 3L4TA 1JI1A 3FAXA 5D9NA 3OG2A 3PZMA 1W9XA 3WD4A 4L4PA 4NZCA 1NQ6A 2VL4A 1UQZA 3PZQA 3E1F1 4ATLA 1OGSA 5DFAA 2VCAA 2CBUA 1EDTA 3EMQA 3ZJKA 4M56A 2YLLA 2DH2A 4PSPA 3I3EA 3PZVA 2W4XA 3O9NA 3PZOA 5DMYA 4AZGA 1UR1A 3VIHA 4F79A 1IV8A 3L4XA 2D23A 1GJUA 1UA3A 1QNRA 4M80A 1CBGA 2OYKA 3WNOA 1WZKA 4JKLA 3AIUA 3N17A 4M24A 1CGWA 3T2OA 4P7LA 1XSIA 2BY3A 3FAWA 1DWJM 4AZ6A 1P6WA 1RP9A 4W86A 3I3BA 5ECUA 1DWIM 2FHBA 3VDHA 3AMGA 3FNDA 1ISWA 1GQKA 2X1IA 2VQUA 1X6LA 1UH3A 4C7GA 4IPNB 3K8MA 3RJYA 1UR0A 2J4GA 3ARVA 1WO2A 4CCCA 2ZUTA 5HXMA 1NM9A 1BFNA 1SMDA 2DSUA 2VVNA 3KL0A 3U5UA 4GINA 2YL5A 3NYDA 1H0IA 4J3XA 4WKFA 5DT5A 2J7EA 4M82A 4PMRA 1LJYA 4MAVA 1TFVA 3BAYA 1ITXA 4DWSA 2E8YA 3VO0A 1J12A 1V02E 4KGJA 2WMIA 4JFSA 3PZTA 3ARUA 1OM0A 3A4WA 1QHOA 3HJEA 2XGBA 1EXPA 3K8LA 1OT2A 3DHPA 5I3DA 4D6EA 3VMNA 1DWGM 4NF7A 3VIFA 5HPOA 3VNZA 1GQIA 1XCXA 5FOOA 5M03A 4UFIA 3OBAA 3NUKA 4EAMA 2WCGA 1E6NA 2WVSA 3WH7A 3NSMA 1WDRA 4AD0A 2VX6A 1W1YA 1VFOA 2W67A 1BG9A 2Y5EA 3BAIA 3WF3A 3WD3A 2AMGA 1HJWA 4Z2HA 3UETA 4MADA 4QCFA 5A8MA 3CO4A 3RJXA 4ZENA 4M1RA 1CENA 1U30A 3GM8A 3AHXA 1EGZA 1KXTA 3N11A 3AYRA 3PBGA 1E73M 1E4LA 4DWSC 1W9BM 1AQMA 3O2LA 1E0VA 4AW7A 2ZICA 4GPNA 1OIFA 3FY1A 2J8GA 3W4RA 1GOOA 3MV11 1LF1A 4NSBA 1WZLA 1KXHA 4LXFA 1GPFA 4PTVA 3DC0A 2EXOA 4E8CA 3MS8A 3VM5A 1J01A 4PMDA 1TMQA 4WKAA 1H11A 2PB1A 4UQEA 3SUTA 3ARZA 1Q4NX 3QHNA 4J28A 1E5JA 1HXJA 1B90A 5BXSA 2PWFA 1JXJA 3FXYA 3VILA 3WUGA 4TUFA 4QFUA 5CLTA 2AOSA 1H3GA 4MNLA 3HN3A 3M46A 4OZOA 3VD5A 1GCYA 5DT7A 4HMEA 2ZUWA 3WBEA 2ZX6A 3W29A 4W5ZA 4XUYA 4F9DA 1FH8A 5KEZA 5D9OA 1EQCA 5A8OA 3WFLA 5A2AA 3TTSA 4OOZA 1V0LA 4ZEPA 2WVVB 4QDMA 4JFVA 1BYBA 2XPKA 4AZBA 5I24A 4RE3A 3QHOA 1UR4A 1GVYA 1EDGA 1FH9A 4CD4A 1BYDA 2VO5A 2HISA 1WDSA 1K9EA 4BQ5A 3GBDA 4U5KA 2WMJA 4WIWA 4PMUA 4AEFA 3AHTA 3OGSA 3N04A 1XSKA 5GNXA 1MW0A 1KCLA 2DGAA 1UD5A 1QNSA 3OGRA 4X0NA 2VNCA 2FH8A 2FGZA 2VQTA 1OIMA 1LQ0A 4PMVA 1EIBA 1V6WA 3G6MA 1G5AA 2VZTA 1BTCA 5ABFB 1H0GA 3AFBA 2GK1B 1HL9A 3WNNA 1R85A 3SUWA 3AIQA 3AHYA 4F8XA 5A2CA 3D3AA 5A94A 5A6BD 4B3KA 3ZSSA 1OD0A 4R27A 1E0XA 5HNNA 4PCTA 4CU7A 2BFGA 3T0DA 1OSEA 4AD1A 1J10A 3WEZA 1CEOA 2XVKA 2YKKA 5CPTA 1UD6A 4AYSA 2OLHA 3AZRA 4CD8A 5A6JA 3AICA 2ESCA 2CKSA 1JD9A 2W63A 3WFZA 3BXWA 1B3ZA 1VENA 4OOUA 4F66A 1V08A 3CIVA 5I79A 3B9EA 2YL9A 4GXPA 1VFFA 3T0AA 1CDGA 3DYMA 2WZIA 4HA4A 2G3NA 5IHSA 2DT2A 2J25A 3VX0A 1ZBKA 1V0KA 6A3HA 3CHDA 1HVQA 3EDJA 2WCAA 4JKMA 1WCGA 2WVVA 1QOXA 1WZMA 2E9MA 3SIMA 3NIYA 2ZE0A 2YOCA 3W28A 3VDAA 3U7BA 2CBVA 1HT6A 3ZQ9A 1FH7A 2VRKA 2A3AA 3WDIA 1HJSA 3QHMA 2V3FA 5BYWA 5CG0A 2WLYA 1CLXA 5E6YA 4V28A 3ARPA 1VF8A 3RMEA 1RD6A 1GORA 3GXDA 1C8YA 4RE4A 1KXVA 4F9JA 3ARYA 1UWSA 5I0DA 3N18A 5TD4A 1PZ2A 2Y4SA 3GDBA 4W89A 5ABFA 4KWUA 3AIWA 3M07A 4P7NA 1VFUA 2DH3A 4M81A 3CZJA 2UWFA 1B31A 1U33A 3GH7A 3CPUA 4Z2GA 1ISYA 3AMDA 1JZ8A 5E9AA 2DDXA 4GIAA 2WANA 3OZOA 1H5VA 1E1EA 3VNYA 4H41A 2OSXA 3SCTA 3VGGA 5BXPA 3PZ9A 3K46A 2VZVA 4J3WA 1W9PA 2BNJA 1GHRA 1IT0A 2UY3A 1BSIA 1L0PA 1JNEA 4EK7A 1GOMA 3M6DA 3HU7A 2VUYA 1N82A 2GJPA 2BV9A 2CHNA 3SCVA 1MQQA 2VZOA 1G0CA 1TG7A 4OBSA 1PAMA 3PZNA 2GDVA 2QLYA 3UG5A 2O9RA 5ABGA 5BRQA 1SFSA 2PWDA 2WMKA 1C3FA 1DEDA 1E70M 2V38A 2ZX5A 1OT1A 2EJ1A 4L4OA 2Z1SA 4U3CA 2PF0A 1E1FA 3AROA 3K4DA 1C90A 2ZUSA 3DECA 1RH9A 3OA5A 2D3NA 4E4PA 3VPLA 1MW3A 1OBAA 4URIA 5E0FA 2VURA 2WZHA 1UKOA 2VVSA 1QW8A 1JZ3A 1SYTA 2PWHA 3POCA 1ZBWA 3LPOA 3CUJA 2XIBA 4BA0A 1OCQA 1MQRA 2CCRA 1TVPA 4W7WA 2CIPA 2OSYA 3BCDA 3F4VA 3CH9A 3EDDA 4PMQA 1D3CA 3A4AA 3OLEA 3DHUA 1HKJA 4MB4A 4H8HA 1UR9A 2O9TA 3WKZA 4V27A 4CKQA 2O92A 1KWGA 1OWQA 3ZR6A 1VEPA 1ITCA 3QOMA 1CIUA 4Z2JA 2G3JA 3WF1A 2ZIDA 1EO7A 5D9PA 1UH2A 2UY5A 4CD5A 2J78A 3MMDA 1OB0A 2J7FA 4P7RA 4W84A 3VTRA 1OGGA 1PEZA 4DUVA 2RGLA 4UNIA 2BXYA 4UQDA 1QBAA 2BVYA 2CHOA 3WL1A 1BAGA 3ARTA 2WPGA 4JHZA 1S46A 4AMCA 3OB8A 2XFFA 5FIPA 1YHTA 3ZJ6A 3MSDA 3FHAA 4CN4A 7CGTA 2WSKA 3W37A 1E40A 4KMQA 2CESA 1R8LA 1H2JA 1R7AA 2PBOA 1UKQA 1K9FA 2BY1A 3MKKA 3J7HA 4UFLA 4W7VA 1QBBA 1Q6EA 4U2ZA 3F5KA 2WMGA 4DWSB 3WSUA 4AIEA 4U33A 3ALFA 4JCLA 1LWHA 1DTUA 4PUEA 2OWWA 4HPGA 2J74A 2CPUA 1BF2A 1UR8A 1C93A 5BRPA 3W0KA 5A95A 1QNQA 3BLPX 4MPKA 2XM2A 1XYZA 4J27A 4Q7NA 5I6SA 1OD8A 1W32A 1YQ2A 3L4WA 3U5YA 4EANA 4XZWA 1KQYA 1CWYA 2XFRA 5JIPA 3JUGA 2XSBA 1W3JA 1FFRA 8A3HA 1VBRA 1GQLA 5AYIA 4AIOA 2YDQA 4JIEA 3ARWA 5GPRA 5I5RA 1B3VA 1SMAA 3AMLA 1PBGA 1PX8A 1ZBCA 2YA1A 2ZUNA 3ZR5A 1B1YA 3SCWA 4H7VA 5GNZA 5IFTA 4MJ4A 4WK9A 4CU8A 1XD0A 1Q6CA 4AZHA 1H41A 3WUEA 4AEEA 1WAWA 4GZIA 1UWTA 1HVXA 4B9YA 3VDBA 1BPLB 1LL4A 1DWAM 3TA9A 3CZGA 3L4YA 3L2LA 5JBFA 1VEOA 1HKKA 1QNPA 4B9ZA 5IDIA 3TOPA 3WEMA 2Y2WA 4GZJA 2Y8KA 3AOFA 2WWDA 5FL0A 1NWUA 2WCSA 1CGYA 2NSXA 2QF8A 5DEZA 1UYQA 3WQ6A 1UG6A 1E4NA 3VX1A 1US3A 3A4XA 1KR1A 2W61A 1W1TA 4J3UA 3G6LA 4YHGA 1JD7A 2DSVA 4PEEA 3GH4A 4B16A 1ISXA 1DWHM 2D3LA 3ZJ8A 5BXRA 2YA0A 4D72A 3PHAA 1ECEA 1VJZA 4HOZA 1BYAA 4WSKA 2XFYA 3IJ8A 4XX6A 2VX5A 1E55A 4E2OA 2ZXAA 3KL3A 3WNMA 1XH1A 1CZ1A 4JAWA 2J7HA 1BVZA 2WYSA 4PMXA 3ALGA 1K6AA 1KGWA 3THDA 4DUWA 2QHAA 1JFXA 4OIFA 3BCFA 4WKHA 3VVGA 2YL6A 1XSJA 1JYVA 4FLSA 4WJXA 1FFQA 3N13A 3LMYA 5IXEA 1J18A 3KZSA 2OYMA 1C91A 3N12A 2DEPA 5A8NA 3N1AA 3MANA 3ARSA 4DUXA 4HZ6A 3ARQA 2JIWA 3ZT7A 2D1ZA 4DWSD 4PSRA 4ZXOA 4UOQA 3VIPA 3GH5A 3IJ7A 3PZUA 2VRJA 2V3GA 2OSWA 1CGVA 3TP4A 3OGVA 4PTMA 3PTMA 4JZ5A 3NSXA 1BYCA 4AIUA 5HPCA 2DT3A 3SUVA 2WB5A 3KEHA 1E5NA 4OJYA 4MB5A 1HP5A 2ZUUA 1JGIA 6TAAA 2X0YA 3ZO9A 2CKRA 2VCBA 4UOJA 5C8BB 2WK2A 1B2YA 1ZJAA 1CXHA 1F4AA 2A3BA 3U7VA 3W25A 3IJ9A 3OZPA 3ECQA 3PN8A 1IZJA 1KFWA 3EDKA 4KRUA 5A6AA 1UD2A 3WH8A 1B30A 2XVNA 1GNXA 1BGAA 1UWQA 2J7BA 2A3CA 1I1XA 1TR1A 1ZS2A 4A3YA 2BY2A 5A6SA 4P7QA 2XIIA 3EDFA 4A4AA 1XGZA 1A3HA 1E72M 4AISA 1CXKA 1ZBVA 4D71A 1NWTA 2X8RA 1UD4A 4HA1A 5LYRA 3T0BA 2D22A 2YL8A 4ZE5A 2XG9A 1E6XM 1CECA 3OLGA 4LQ1A 1BHGA 2D2OA 4CGTA 2EEXA 2F2HA 4N0RA 1HP4A 5A6MA 2XVPA 4YPJA 2VI0A 1NOFA 4HMDA 1M53A 4H2CA 3L4ZA 1PJ9A 2XTKA 3CHCA 4ACYA 3WN6A 3SURA 1V3KA 4W8BA 1J0YA 1J0HA 1NOUA 1F4HA 5DO8A 1QVBA 3DYPA 2O9PA 4HOXA 1UKPA 4UCFA 3CZEA 3WQ5A 4PUDA 2XM1A 2D24A 3GXFA 1E4MM 4FLQA 5A1AA 1WE5A 3AIRA 3II1A 1NARA 2WMHA 5CGMA 1RPKA 5A6LA 3GNPA 4FLOA 4JHOA 4H04A 4UFHA 1WPCA 1HN1A 1CXFA 3VU2A 5HOSA 5AC5A 1VFMA 1G01A 5FD0A 1XD1A 3CTTA 5EFDA 4DM2A 2F61A 4K68A 4UQCA 4JFTA 2WKLA 1WZAA 3WD2A 3MUAA 2JE8A 5JUVA 3AQUA 4LPCA 3CUHA 4AZIA 3SCOA 3LPFA 2ZX8A 1XC6A 3RM4A 1ZB5A 2DT1A 1UWUA 4R5EA 1JAEA 2PC8A 1V3HA 1HKIA 1W3KA 3MV01 2J79A 5D9MA 3SUSA 5IHRA 1K9DA 1E6PA 5A2BA 3IK2A 1ZU8A 2E0PA 5M5DA 5I77A 2XYLA 3BLKA 1PIFA 4J7RA 2EPOA 2J7CA 4PRWA 3VD7A 5A8PA 1VB9A 4QAWA 2G3MA 1UH4A 2FHCA 4TVUA 1L8NA 4CVUA 1BQCA 3VMPA 2Q8XA 1CNVA 3AS3A 2DSKA 3UERA 4UQAA 2YBTA 1JZ5A 4UOZA 4HPHA 4PMOA 1V6YA 1CGTA 1W1VA 4NRRA 5LA2A 2W92A 2QV4A 1X6NA 1X1NA 3U57A 3WENA 3FHQA 3VINA 4WF7A 2Z1KA 4TXEA 4LYPA 1UZ1A 1EQPA 3POHA 3SUUA 3WD0A 5ABHA 3TTQA 2DIJA 1V6VA 4Z2KA 3D5HA 4GO8A 3A6OA 5HDRA 4HZ7A 3AXIA 3IAQA 1LG1A 2CITA 3CMJA 3QGVA 1E9LA 3KWXA 1E43A 2EO7A 3VD3A 4HOWA 1UR2A 2V3DA 2OWXA 1RP8A 4GI9A 1JDCA 1CGXA 2IXVA 2JEPA 2X05A 2J77A 2JALA 2A3EA 5JBDA 4CVWA 1G9HA 1HIZA 2WHKA 3EMZA 3RDKA 3A3HA 4LX4A 2QPUA 1WKYA 1D7FA 2FHFA 3EDEA 3SCQA 1GJWA 5GNYA 4IUGA 2Y8VA 1Y7VA 4HMCA 3WH6A 2WC3A 1TCMA 2WC4A 1H1NA 4AD4A 1TVNA 3GXIA 1JDAA 1Q6GA 1W1PA 4PCSA 3WF0A 4CD7A 3TTYA 1CXEA 3B9AA 1CXIA 3VGHA 3WQ8A 2Y24A 3WH9A 2W66A 3WDJA 1PPIA 1U2YA 4EKJA 1E15A 5KZ6A 2QMJA 3W26A 1GHSA 1JXKA 4HU0A 1XH0A 3WMBA 2WZEA 2GUYA 3WDPP 4PBGA 2WSPA 1VAHA 4PTXA 4CU6A 2QMKA 3MUIA 3TTOA 1W2PA 2B31A 3WNLA 1VRXA 3UG4A 1NWRA 1J11A 4JCMA 1KGUA 3BGAA 3NDYA 3VD4A 1PX3A 1FA2A 2WBKA 7TAAA 4P8XA 1UA7A 1HF6A 5CSUA 1R86A 5AC4A 1JDDA 4GQQA 2HVMA 1CYGA 4RL3A 4PTWA 1KGXA 3W6LA 5GQBA 2E3ZA 2BVDA 3B8SA 1XCWA 2WHMA 1KR0A 3MUZ1 3T2PA 2EPMX 1HJXA 1US2A 1XH2A 1MVYA 1V3IA 2WHJA 1CTNA 1J0JA 1NOWA 4P8UA 1GOWA 3CUIA 5EB8A 1K9TA 4KGLA 4LYRA 1W91A 2X09A 4KH2A 2WM0A 5CJ5A 2JIEA 2E9LA 1XRVA 4AY1A 3ZOAA 4TTUA 3WD1A 3UESA 4EE9A 1LG2A 1W9DM 5CXPA 1JNDA 2VR5A 1FP8A 1O7AA 1R87A 4AZCB 3ZT5A 5CGTA 1XHGA 2BHYA 1E6ZA 3DYOA 1J0IA 4ATDA 1OINA 1V02A 4UZSA 4MDOA 4AWEA 2CNCA 2PWGA 1VEMA 2FDMA 1BGGA 1AQ0A 4PYSA 2YJQA 3BMWA 2EPKX 2WKGA 1GVIA 3IAPA 1CPUA 1EH9A 1TA3B 3CUFA 5CPSA 1E56A 1M04A 1ISZA 4XZBA 4UFJA 1UD3A 3K4AA 4GQRA 1E71M 3BSGA 5FCZA 2F8QA 4HA3A 1GOKA 4U5IA 2ZOXA 3VKKA 2NW0A 4BZYA 2J7DA 2VOTA 4H8VA 1E6QM 1JF6A 4TVCA 3MMUA 4N42A 4XB3A 2J62A 2TAAA 3LPPA 3GXMA 4TX8A 1EHNA 1DHKA 3W81A 4AZ5A 5LA1A 4MNKA 4OKDA 2WVTA 1HKMA 2WXDM 1JZ7A 4GO9A 3VD9A 3CUGA 1AVAA 1E6SM 1H09A 4TVDA 4OBRA 3WDHA 4W7UA 4W88A 2DIEA 2VTFA 2VZUA 2YDRA 4CCDA 1QI5A 3WNKA 5C70A 3CGTA 4X9YA 3ZMRA 3AIEA 5A6KA 4MNJA 2XWDA 1W2VA 1C8XA 2RGMA 3BAJA 4TX6A 1C8QA 3AS1A 1KBKA 4ATWA 1JZ4A 4IPLA 4E8DA 3KL5A 2NT1A 1JF5A 4MAZA 2WMFA 3KE0A 4W87A 3EBVA 4W93A 5E6ZA 1MQPA 3FW6A 3SCSA 4M8UA 4U3AA 4GKLA 4AZCA 4YN5A 3L4UA 2BY0A 2W5FA 1EO5A 4A3HA 4GI6A 4MNMA 3S2CA 4JL1A 5D8ZA 4BS0A 1HNYA 4FK9A 4UFMA 4CUCA 3ZJ7A 2XVGA 4AZ7A 1BG4A 2BHZA 3UR7A 1TA3A 2DSZA 4P8WA 4C7DA 2DPEA 4QP0A 1E4IA 4S3KA 3GNOA 4ZE4A 1UZ4A 4IISA 1PX4A 2JF6A 3RCNA 4HU8A 1TZ7A 4QCEA 1H49A 4BQ4A 1CLVA 1C7SA 3VGDA 1QPKA 3AI0A 5AYBA 2BS9A 3THCA 2C8NA 1GOQA 2YIHA 3AMKA 4PN2A 1V6UA 3WF4A 3RM9A 3S6TA 1OGBA 1G1YA 2EPNA 4CCEA 2IUZA 4MJ2A 3VIGA 3CMGA 3L4VA 2GJXA 3MMWA 1GQJA 3GTNA 3WELA 3ARRA 3UEQA 1C7TA 5BWFA 2WNWA 1NP0A 5JBEA 1ZL1A 3AHVA 1KCKA 3ARXA 3F5LA 4BCEA 5BROA 2IXUA 4MB3A 2E9BA 1GONA 3AS0A 3CHFA 3VIKA 2YBUA 1A47A 1QI4A 5E70A 3SCPA 5LA0A 4ML4A 1JI2A 1JFHA 5A8QA 5DF0A 2CBJA 3F5JA 1G94A 5D4YA 2G41A 3OIHA 1B3YA 3EMCA 3ZIZA 4D6FA 1O6IA 2JFEX 2ZXDA 1UWRA 2FGLA 5ABEA 2PWEA 1GW1A 3I3DA 3AZTA 4QLLA 3O6AA 2ZUVA 1HL8A 1SR0A 1V0MA 2DSWA 1MW1A 1HJQA 2EQDA 3WBAA 3VGBA 3AJ7A 2VZSA 2VX4A 5C71A 3CZ8A 2GVYA 3BH4A 4KRTA 1J0ZA 1V0NA 3VUPA 3T2QA 1XV8A 5EBAA 4NRSA 2ZWZA 4TOQA 1J0KA 1CGUA 3VMOA 4PMZA 2J47A 4QLKA 4HP5A 3BC9A 1E3ZA 3AISA 2G4FA 3M7SA 4UQBA 5CZKA 3WQVA 1MXGA 4W8LA 8CGTA 1TE1A 3IANA
chains in the Genus database with same CATH superfamily
5A6TC 2WAGA 1K8CA 3WUFA 4QITA 5M3WA 1IEVA 4XD6A 3WK2A 5FF7A 3NSNA 4IG2B 3CPGA 1QR7A 3HIJA 2UY2A 3RPMA 4L9YA 1Q5MA 3EPNA 3ZWSA 4A8RA 3AIVA 2VMFA 3K1DA 3M64A 3AMCA 4Z2LA 3DX5A 4IJCA 3RO8A 1SZRA 2CLPA 2QDGA 4RPQA 1XIGA 1XYLA 3ZT6A 2XFWA 1P0BA 5A6BA 2E40A 3M5XA 4DO7A 3BOXA 3MSGA 1Q6LA 4Z0JA 4X9SA 2C7FA 2G96A 1W5OA 2HEJA 4M7SA 3H26A 2J8FA 4OVXA 2WWCA 1ZGDA 4RZ6A 1XDLA 2CETA 1LUCB 1J93A 4D6GA 4R9XA 3SBFA 4V1YA 2CZVA 2G3IA 2IQDA 3T44A 3H24A 2JBMA 4NI3A 3BICA 3THQA 5C2GA 2GPTA 3DGRA 3XIMA 4FNTA 2OLAA 3HTWA 4NAFA 2A3HA 4JYDA 4AQLA 1MUWA 3GZAA 2WPBA 1F3WA 1PHQA 3W24A 3SI9A 3DUGA 4PB5A 4H2HA 1LROA 4W85A 4QE4A 1KTNA 1OX6A 2PI6A 3EOUA 5EFFA 2GZXA 1XYFA 1HX0A 3QQWA 3O6DA 4Z0SA 3NPWA 4D6JA 5E0CA 3Q4DA 3WLNA 4NX0A 1FXPA 4LCSA 4NP7A 2TODA 1V3MA 3QV7A 3G3MA 1TUXA 1KBBA 1XKJA 3OLDA 4AD2A 4FLRA 4MHBA 6REQB 2YDSA 3KOXA 2D20A 2ZKMX 4O54A 2VC9A 5G4HC 1IEQA 4HZ8A 5HK4A 4YCOA 1KXQA 3W6MA 3GNRA 4WRHA 1DPMA 2INEA 2VX7A 5E09A 4Y8FA 2ZA2A 3EX1A 4C6LA 4QXIA 3MI3A 1J2BA 1PUDA 1P5BA 5EMMA 3DFQA 1JZ2A 3H6OA 1QHPA 3LHVA 2C13A 4HNNA 2EBNA 2WNZA 5HMEA 2YZRA 5DELA 3TW7A 3B3DA 1O5RA 2P3EA 4DBUA 1TCDA 2CYGA 1VH7A 3KBJA 4W5UA 1DJZA 1B0IA 1ODZA 1RCQA 3AYSA 5T91A 1M6JA 1O66A 3PG8A 3PNZA 1TQJA 3RMJA 5IBXA 1WYIA 4N02A 3TMLA 1W0MA 4WZHA 1VBUA 3CZLA 5IRPA 1EPVA 3NQ6A 4JTEA 4RZ4A 3BGJA 4AC1X 1BQGA 2XIJA 4R85A 3IVUA 2YA2A 2R1NA 4IM4A 4RJEA 4I7WA 5F7UA 1UD8A 1ESWA 3S1UA 1V3LA 4PUWA 3IGSA 4J3VA 4B91A 4YTQA 4WDWA 5DRIA 4AXNA 3SCUA 4AD3A 1UP2A 2QJMA 1VCGA 2QAFA 3KXQA 5KZMA 3W7LA 2R82A 2CEQA 3MJMA 3HPXA 4ILSA 3VDCA 3RNDA 3C61A 3CBWA 3MBFA 3LB0A 2VCCA 3U4FA 2PTWA 1KQZA 4JN8A 2WJFA 5C2XA 1R3SA 1KM5A 3NO3A 3VFCA 3DG6A 1GQNA 1EA9C 1BRLB 5K9DA 4MYAA 2VT0A 4NUWA 5CC3A 4IMAA 3DOPA 2WLZA 4C7FA 4RNFA 3DFYA 4GMEA 3NEVA 1PZ3A 4P61A 1QNVA 4CD6A 1X8CA 2I5QA 1TIWA 1P6CA 2WBGA 2ZRXA 4LWWA 5E9XA 2FZDA 3W85A 1N8FA 2CWXA 5A3HA 2V68A 3GS6A 3PUDA 3LPGA 4QLJA 4MF4A 4XBJA 4F2BA 3CWOX 1YPIA 2OMAA 3VGEA 1XQLA 3BLIA 4GVGA 1W9UA 4FHAA 2LLEA 4NX5A 1WP6A 4FSAA 4W8AA 2QDHA 1TJPA 1TZ9A 3NCOA 1BEUA 2QCFA 2DQXA 4BI5A 4JQ2A 3GD6A 2BVTA 3WQWA 2D0GA 1LLWA 1XYBA 4LVBA 5KITA 3QW4B 3OODA 1QNOA 3IJIA 3QTPA 1M7XA 1AL8A 2WC7A 3UPBA 1IEXA 4FIQA 3I65A 2A7PA 4J3SA 1QHZA 3K8KA 3GDLA 3OZYA 1R7OA 3VM7A 5H1WA 4IIDA 1VLWA 1TQXA 2NT0A 1V6XA 4DIAA 4MWAB 2ZX9A 2DU2A 3MHGA 4Y9MA 3RUBL 5I2UA 3QGKC 3RR1A 4AWUA 1FOBA 2PCQA 1QW9A 5H91A 1LL7A 2HE8A 3RX3A 4GWEA 4TMBA 3N14A 1UZDA 4L4PA 1R46A 3E1F1 5HJXA 3NQAA 4L1GA 3S2JA 2VCAA 1RJQA 5LXEA 3W7DA 3N2XA 2DH2A 3PZVA 4PCPA 3P5YA 1J5TA 3E6EA 4F79A 5DXXA 3LZ5A 3L4XA 3R79A 4US6A 4Q8TA 2D23A 4NZ4A 3N25A 2ACSA 4NZ5A 5HUPA 3P2VA 4AMAA 2CXEA 1J8VA 1EXBA 3N17A 1UC5A 2QJJA 3N29A 3G1AA 1EC8A 5C9UA 2L5HA 2PTDA 2F6XA 3PF3A 4QQ3A 2VEKA 3O1NA 1XS2A 2YFNA 3U48A 4P5UA 4WEVX 5ECUA 1DWIM 2FHBA 4W4QA 1GQKA 3PAJA 2VQUA 1R3WA 4ZCWA 3R0DA 3NOYA 4C7GA 3UY7A 1JPKA 1UR0A 1IEWA 3ABOA 3R10A 4LFYA 2V0TA 2ZUTA 5HXMA 2DSUA 3UU0A 3T0TA 2WKJA 1RY8A 4DN1A 2TRSA 1H0IA 3TQ0A 4PMRA 4IP5A 1K7EA 3DU0A 4JTKA 4DWSA 2E8YA 5BOEA 1J12A 1V02E 1XDMA 2XIOA 1AG1O 3K8LA 3S4TA 3RLVA 1OT2A 3DHPA 5I3DA 4AX7A 4HCDA 3VMNA 4NF7A 3BV7A 3HA1A 5HPOA 5M03A 1TVLA 3CYVA 4FIRA 3OBAA 4EPDC 3REQA 3NUKA 4EAMA 3WO8A 2ZYFA 4CCZA 3W2NA 2VX6A 2B0MA 5HWJA 1O68A 2AMGA 4ENLA 2ALRA 4HNLA 3UETA 4Z2HA 1UZHA 3JW7A 3CL8A 4QCFA 3CO4A 3NQMA 3PPHA 4QR6A 1P0DA 2V82A 3CU2A 1T96A 4M1RA 1KO0A 2PCEA 3N11A 2JK2A 4LF2A 1PE1A 3EWWA 1E4LA 1A4LA 3F4WA 3ZVHB 5K9CA 1AQMA 2FTWA 1A50A 3FY1A 3W4RA 1KXHA 4L6DA 1NTHA 2JGYA 3UVIA 3T8QA 1EJ7L 1Q3NA 4WX2A 1EBGA 3DDMA 2HSAA 1JXJA 1GVFA 2ZA3A 4GG9A 4TUFA 3JS3A 5EA9A 3CUZA 5DCEA 3ICJA 1S5NA 4MNLA 1TPH1 3GAKA 4BY3A 1OFDA 1UASA 2BZNA 7REQB 3LLDA 3S0CA 4KWVA 2ZUWA 3W29A 1FH8A 4AIBA 1EQCA 5A8OA 3WFLA 1PXGA 5AZ1A 5A2AA 3WZ0E 5AYYA 4KWSA 4JFVA 3WJZA 3EXSA 3QHOA 1GVYA 1EDGA 1OFEA 3S9IA 3W2MA 4Y9PA 3W83A 1S5WA 1LOSA 4LBUA 1A0CA 2HCVA 3FVMA 4MJMA 3RHGA 1UIOA 2FH8A 3GXPA 1FRBA 3G6MA 1G5AA 1DJQA 1YDVA 3DC8A 3QZAA 4MIMA 2PD9A 2E5DA 3AFBA 2GK1B 1XFCA 1A53A 4XQ6A 3SUWA 5A2CA 3D3AA 3GK0A 3UPMA 3I6EA 3ZSSA 3TN4A 1OD0A 3LK6A 4J2MA 3EB2A 1OSEA 4AD1A 4Q4QA 1R5YA 5CZTA 2YKKA 5CPTA 1ZAIA 2BSLA 3NZ1A 3L68A 1QCWA 3P8IA 3TXVA 3URAA 1Z6KA 1JD9A 4Q4RA 1XGDA 4YVXA 2EKCA 1AW1A 1VENA 3C52A 1V08A 1QATA 3CIVA 3WLQA 4GXPA 2GWGA 1CDGA 8RUCA 3PPGA 4DF2A 1E1CB 1WUEA 1Z7AA 4GKTA 5CAKA 3V1HA 3SY8A 1LRTA 4G7FA 3PC0A 3VX0A 4J1OA 2IS7A 5CBJA 5I3FA 2JKAA 3QQ1A 2WVVA 3WK3A 1QOXA 4NNCA 1WZMA 3HG2A 3NIYA 4LOCA 4IT1A 2ZE0A 2F6KA 4F0LA 3CIXA 2NXGA 3MY9A 4L6HA 1RA5A 2CBVA 4JEQA 2A4AA 4K6AA 5E1QA 2OQHA 2B7PA 3QHMA 5BYWA 4B90A 5I00A 2PU0A 4V28A 3V3WA 3RMEA 3E5BA 1C8YA 2C19A 3R8GA 5I0DA 1UWSA 2XISA 3N18A 4W89A 5ABFA 3O0FA 2P8CA 4P7NA 3QMRA 1VFUA 4M81A 4IGNA 2F84A 1FCUA 4IF2A 3BL3A 1S3HA 3GH7A 1ISYA 1W54A 3GVWA 4A8LA 5CSRA 3BE7A 1YRRA 1GK8A 1KKRA 3SCTA 3VGGA 3K46A 5LNRA 4J3WA 4S3DA 4S38A 3R4IA 3AYVA 4HJWA 2F6UA 4IP7A 3HURA 1L0PA 4Q4MA 2VUYA 1N82A 1KM4A 3TYDA 1NDYA 1L8PA 1GKQA 1Y8BA 4NAEB 1KLZA 3SCVA 1MQQA 2VZOA 4KFOA 4OBSA 3UNDA 2QLYA 2ZVRA 1TMLA 3UG5A 3FEMA 5A5WA 2OLSA 1E70M 1KC7A 2PF8A 1S2UA 2EJ1A 3TC7A 3ERPA 2QXWA 4U3CA 2OZTA 1E1FA 4JQ4A 2QJGA 3K4DA 2ZUSA 3V18A 4DJFD 1AZ2A 1P4CA 3C8FA 2D3NA 3OA5A 3B4UA 2VURA 5BMWA 2VEIA 2POZA 2VVSA 1LM1A 1QRQA 3POCA 2FB3A 5GVJA 1ZBWA 2OQLA 3LPOA 1UB3A 3W1UA 1MQRA 3GFZA 5T9CE 1M7JA 4XZ9A 1TVPA 4JTTA 4RNJA 1W5MA 3S9YA 2OSYA 4UUIA 3VOIA 4QNWA 3UGVA 1HKJA 3IRSA 2O9TA 1ECQA 3V5CA 4V27A 2O92A 1O1ZA 1KWGA 3QOMA 3QLDA 5CAHA 3ZVIA 2UY5A 4CD5A 3UNTA 2J78A 2W79A 2GVLA 4C6IA 1OB0A 2J7FA 4P7RA 1XUZA 4DUVA 1DTNA 3OHIA 3FA4A 3B0UX 3WL1A 1V51A 3IUHA 1BAGA 5C2CA 1S46A 4AMCA 3WQOA 3GU9A 3ZJ6A 3MSDA 2YBVA 3C2FA 4LS0A 1E40A 1ITUA 3I4EA 1EEPA 4HSOA 3LBOA 1QBBA 4LVGA 3BWWA 1K3UA 3SN0A 2YZ5A 4U33A 3P62A 1DTUA 4A3RA 2POTA 1XM3A 1DQUA 4ZB2A 1I8JA 2YXOA 2OT0A 1IXNA 2FJKA 2PZ0A 4BFAA 3DBPA 1XYZA 4Q7NA 4GX8A 4QG6A 3U5YA 3L5AA 4E2VA 4XZWA 2XFRA 2RDTA 5JIPA 1C9WA 1GVRA 3JUGA 8A3HA 3BJTA 1EGMA 2YDQA 3C3NA 3H53A 1WKDA 1B3VA 1N2VA 1ZHAA 5GNZA 3GO2A 1DJXA 1GYNA 5AVNA 4U28A 3DGBA 3UT0A 3HGOA 2NQHA 1HVXA 3NXLA 1BPLB 3TA9A 4F0RA 3L2LA 3A5FA 4FS9A 2P10A 3SO7A 2VD8A 3UZJA 2QCLA 5LIYX 2WWDA 1VZWA 2YB1A 4XAGA 4CLMA 2QF8A 3WQ6A 1X1OA 1XINA 4K36A 5TQLA 1HL2A 3PBYA 4HNUA 1T8XA 4B16A 1QDSA 4GE8A 3LOTA 5HNRA 1OG6A 5FA5A 4D72A 3TZFA 2VWSA 3ABZA 1UMLA 3KWSA 4HOZA 4HPXA 1BYAA 4JDYA 2QF7A 2V8ZA 4FOKA 3KVKA 4JAWA 2WYSA 2Z6IA 4PMXA 3ALGA 1ZZMA 2QHAA 1MO0A 3U0HA 4WKHA 1OFOA 3D3FA 4F2UA 4JTFA 2YL6A 3N13A 5IXEA 3KBWA 3BK0A 4S3EA 3KZSA 2NSOA 4QX4A 3UZZA 1ICQA 4L4LA 1KW1A 4DUXA 1WBJA 4MWAD 3H70A 1EUAA 1TTQA 2JIWA 4Y9AA 4PSRA 4JQ3A 5CJNA 4CNOA 4IFRA 3PZUA 2VRJA 3HJZA 4XZMX 3BQ5A 2QYGA 4JD4A 3TP4A 3IJDA 3NZPA 3DFTA 1S2AA 4EPKA 3HMJG 1JUKA 3GUGA 1F5ZA 3NFUA 4ZOAA 1ADSA 5EMJA 3IEBA 1E5NA 4JR5A 3Q65A 2X0YA 6TAAA 3ZO9A 2VCBA 1B2YA 4PTNA 1F4AA 2A3BA 2WZTA 3IJ9A 1TRDA 1R2RA 3PN8A 1HGYA 1KFWA 3T42A 4IH3A 2VDGA 3N9RA 4JTSA 1A3WA 2XVNA 1QO5A 1UWQA 4IX2A 1ZP3A 2A3CA 1I1XA 1ZS2A 4A3YA 1DE5A 2A79A 4DPQA 3TCEA 1XR2A 2XIIA 2X1RA 4RK8A 1E72M 3BARA 3IUIA 1ICPA 4ZE5A 3UBPC 2ZTKA 4JHMA 4B4FA 3QR0A 1NAL1 2D2OA 2QUTA 1HP4A 2C0AA 5A6MA 3N2TA 3JVAA 4YPJA 2VI0A 4HMDA 5F4WA 4GYFA 4IPJA 1M53A 4H2CA 3L4ZA 1LBMA 4Z42C 4W8BA 4LVAA 1NOUA 5DO8A 4TMCA 2OELA 5BZAA 5TF0A 4UCFA 3CZEA 1OZQA 2XM1A 2D24A 3VCNA 4XSLA 2R1LA 4XIAA 4MZ1A 2HTMA 4H04A 1G69A 5F1VA 5DRCA 3MUCA 5C9RA 3HQNA 1VFMA 3R6IA 3VI2A 5A8GA 3T81A 3CTTA 2CLFA 2F61A 4JFTA 1W17A 4G56A 1TJRA 3E74A 5HAOA 4LPCA 3TH6A 3LHWA 2H8XA 2I5IA 2H8ZA 3SCOA 3LRKA 4GYJA 1ONEA 2DT1A 4QG8A 3KBVA 2GOKA 3MV01 3SUSA 5I3IA 2Y62A 3GWQA 5A2BA 2PDIA 5CPNA 4IJBA 4U10A 4JTUA 5I77A 4HSHA 3MQTA 4DI8A 4JX4A 4ML9A 3G1DA 3QQ0A 2J7CA 2VENA 1VQTA 1VB9A 1L8NA 5G4WA 4CVUA 3VMPA 2PMQA 2Q8XA 1Q7MA 1CNVA 3AS3A 3TCSA 1J2WA 5I3JA 4MY9A 3KTCA 3G8EA 2DFAA 1SZEA 4E0CA 4EVZA 1PKNA 4HPHA 4PMOA 4QGCA 2HK1A 3OQ8A 1CGTA 5LA2A 4V1XA 3WLPA 2W92A 1X1NA 1OG0A 2Z7GA 3WENA 4WF7A 2Z1KA 5AYXA 3R94A 1QT1A 3EA3A 1EQPA 1RPXA 3TTQA 2B7NA 2R1PA 2J9XA 3MA8A 1KV5A 5HDRA 3SZ8A 2E5CA 2XGZA 1LG1A 1XLLA 3UFYA 3VD3A 3FXGA 3EX2A 1UR2A 2QCDA 4LALA 3QC0A 4DB7A 3OHMB 1Q65A 1JDCA 1L9WA 1CGXA 5EL1A 2NV2A 4JGDA 1G9HA 3W7HA 4LX4A 3LM7A 2QPUA 1WKYA 1LORA 1D7FA 2FHFA 1AODA 2H3BA 2O7QA 2Y8VA 3C5QA 4HMCA 5E93A 1TVNA 3GXIA 4IICA 1Q6GA 3TTYA 1GVSA 3B4YA 3T07A 5B7YA 1CXIA 4OU1A 3WQ8A 4EKJA 5KZ6A 2QMJA 4KWWA 1IQ8A 1FWNA 4XTIA 1YIXA 2F9RA 3EKLA 1R3QA 5H8PA 5MHBA 4XUGA 2YCKX 2GUYA 3P0WA 4PBGA 3IWPA 2WSPA 4ZQPA 3V4BA 4CU6A 3H4GA 4N9BA 1QFEA 1FCBA 1W2PA 5D02A 1VRXA 3UG4A 4DI9A 4CQAA 3OYXA 4JCMA 4GVHA 3NDYA 3H7RA 1EPXA 3MKCA 2NX9A 3O06A 3NQGA 4GQQA 2OT1A 4XAFA 2E3ZA 1EBHA 5C9ZA 3MMTA 5JVLA 3MC5A 1XCWA 4AF0B 1TKKA 3TYZA 1AH0A 1NOWA 1M9HA 4DJFC 2R1MA 3FGCA 1VFHA 3LERA 5HNUA 4CQBA 4GVIA 2UZ9A 2YCEA 2ZZ4A 4BEQA 3WD1A 2DUZA 3TSBA 1T5AA 3DI1A 4DAFA 1XBXA 2FPVA 1I9CB 2IQTA 3E5PA 5CXPA 4GISA 4FB7A 2FZNA 2QW5A 2TMDA 2VR5A 3N4FA 3AJXA 3ZT5A 1KKOA 3DYOA 1J0IA 4ATDA 2OVLA 4MDOA 5D33A 2QNEA 2PWGA 5JXQA 4Q32A 1W5QA 3WQEA 3SW6A 2NLIA 2YJQA 2WKGA 1VFSA 1GVIA 2HVNA 5CPSA 1M04A 3VNDA 1A0DA 1JUBA 2ISFA 1R3YA 1ZLPA 2F8QA 3ENLA 1M3UA 2YCLB 3EX4A 2XU2A 3ITOA 4BZYA 2J7DA 2VOTA 3E2SA 2C1IA 3GTHA 4IL2A 3MMUA 3WLSA 4C1LA 3BJSA 4XB3A 2TAAA 3LPPA 3NURA 4TX8A 3ZLGA 1DHKA 3VKAA 4AZ5A 4OKDA 5C6MA 1JZ7A 3VD9A 2X16A 2NQ5A 3B05A 4W7UA 3S2NA 3WNKA 4X9YA 1F8IA 4QTGA 3PPCA 3T9PA 1TPDA 1KBKA 1D8CA 4IPLA 1CB2A 3KL5A 1JF5A 2PDUA 1T8QA 1AUSL 4US5D 5CH9A 4Y9OA 3C0QA 2VFHA 4GUHA 4OBTA 1F6PA 2Y61A 2DY3A 4YN5A 3EB3A 4KIRA 4GI6A 1V7YA 4JL1A 3QM3A 4BS0A 2QGYA 1A0EA 3GTXA 4FK9A 5CEWA 3V0TA 1LT8A 1VBGA 2DJXA 5AB3A 3O15A 2QUMA 3UY8A 1BKHA 1NFPA 4QP0A 1E4IA 4HB7A 4S3KA 4LB3A 2Y1HA 4ZE4A 1POJA 3B03A 2JF6A 4HU8A 1ALDA 1XC4A 1TPFA 4H9MA 4Q4SA 3NM1A 1CLVA 3UP8A 1H50A 3AI0A 4GI4A 4G2DA 3HQPA 1GOQA 2EG7A 3A3XA 4ASTA 5G1TA 3WF4A 2OZ0A 1G1YA 2XN1A 4MJ2A 3FVDA 1Q6QA 2GJXA 2I17A 3KZPA 3DHFA 1JDFA 3UEQA 4RR4A 5FJIA 2QV5A 5BWFA 1E9YB 3F5LA 2VDIA 3FYOA 4AVFA 1US0A 4IIGA 4FF7A 1RR2A 2AL2B 1GONA 5XIMA 4V15A 4IFKB 2YW3A 1QI4A 5E70A 4ML4A 2D2JA 3DN5A 5DF0A 1KFKA 3V5OA 1YPFA 1HUVA 3F5JA 4Q8NA 5D4YA 2BLEA 2FZ8A 3LI1A 2Q3RA 3EWCA 4D6FA 2JFEX 2ZXDA 4PODA 4KCTA 3MZNA 1QMLA 1T41A 1SQ7A 3E02A 2ZUVA 3OEXA 1X97A 4AVNA 1MI3A 3Q45A 2PC4A 1V0MA 1MW1A 4J2PA 4K39A 1TE6A 2VX4A 1XLJA 3USZA 4WDXA 1FWJC 1YNPA 4KRTA 1J0ZA 1V0NA 3L65A 3HGRA 2ANUA 3T2QA 5EBAA 4XD4A 4DUOA 2ZC8A 4TOQA 3CM4A 4GNKB 3LHYA 4PMZA 2J47A 3BV4A 3AISA 3R7MA 5HMDA 1KFEA 5CZKA 1MXGA 3P8JA 4DVOA 2P0IA 4LT9A 3FYYA 2NQLA 2VJXA 3R5EA 1XIJA 4GYPA 3W53A 5AHMA 1XLFA 1QJWA 4TR9A 5HULA 1FDYA 4HSNA 3WH5A 1H1YA 4DNHA 1ZP4A 1MZHA 1WDQA 2ZC1A 2OJPA 4XIMA 3TMQA 4S3GA 1JEZA 1ME9A 2IKJA 1ZTVA 4A3UA 4LAOA 4MYXA 4D8ZA 3UR8A 4D6HA 5REQA 4JKKA 1CB7B 4MLRA 4NZ3A 2O4MA 2VHLA 1G67A 4XAZA 3K5XA 3H12A 3G0XA 3WMCA 1QI0A 1RSCA 2CLEA 4I5UA 1BLIA 3EKZA 3OTRA 2WNNA 1K6WA 3T78A 2WVUA 1W3HA 3AWOA 3SB0A 3BW3A 1FWGC 2MANA 4S3FA 3RFAA 3VE7A 2ZXBA 3MI2A 1WXJA 3VIMA 3W7OA 3W82A 2VGFA 4JTDA 2QVNA 3EXRA 3ZLFA 3UWVA 5CZSA 4NASA 4LJ3A 3WLTA 1ZNNA 3RILA 2GJRA 1FXQA 3LV6A 3P60A 3WDRA 1ISVA 1OEPA 5BXTA 3PBVA 5LNWA 4WSJA 3C0SA 3TJLA 3CZKA 3TONA 4B5UA 3ABQA 4GABA 2CXGA 3L0KA 3HM7A 3PSVA 4PUMA 3SRFA 4PMNA 1OC7A 4XKMA 2G8ZA 1OK6A 3DFNA 4GYKA 2UY4A 3W87A 3G5EA 3BZGA 2W91A 3E38A 4GY0A 3IIPA 2OOFA 4MMWA 1Q7QA 1KFBA 3AWNA 1F3EA 4H7CA 4L1XA 3MU7A 4TTGA 2E7FA 1IYXA 4MB1A 2C0HA 3UXIA 1EHAA 2XGIA 1U5HA 4REQB 3ZM8A 1Y65A 3FIGA 1WQ5A 3MHFA 4GZEA 4NU7A 1Y5VA 4PBEA 5G1MA 4QHRA 4H7ZA 4ADSA 9CGTA 3ZZ1A 2Q8ZA 5AOUA 3WL0A 2XH7A 1TR9A 4YTSA 1AMYA 4K2SA 3BAWA 1ZJBA 9XIMA 3STEA 2A0NA 4WXYA 1KRMA 1BWLA 1J5SA 4JEJA 1OX4B 1E3XA 1NIUA 3O0KA 1S2VA 1MFVA 1ADOA 2FH6A 1JG9A 3W7IA 4R33A 1AW5A 1WDPA 2V5CA 1OFRA 2Y8UA 2XJ7A 1OCBA 4LUIA 4CN1A 4P8VA 1UKTA 2X0HA 3FEQA 4YHEA 2HZGA 3V7PA 4O18A 4DJFA 1ZCOA 3S1XA 4S3JA 3EYPA 3AXMA 3HG3A 2GJNA 4X0VA 2A2IA 1FWBC 4XO6A 1TPC1 2GQ3A 3H21A 3NZGA 3B06A 4M29A 4WHBA 2AQVA 3IARA 3MUY1 4D6CA 5CBIA 2V30A 4XZLX 4B3LA 2ZDRA 3QVQA 3W71A 1EDQA 1MFUA 1F2JA 3WF2A 3W7EA 4AD5A 2FPTA 5D8WA 2PDCA 3QKEA 6REQA 1JYNA 3FN9A 2XSAA 1X96A 3KVJA 2XWEA 2ZA1A 3W72A 3APTA 5EMYA 2OZ8A 4BF5A 4DO5A 4DBEA 5A69A 3PTKA 3B8VA 3L2MA 1TIMA 3AIBA 3IIVA 2VFFA 4QDWA 3DHDA 3W22A 4Z2IA 7A3HA 2OWCA 3BG9A 3V5FA 5AC8A 2X2YA 3PZGA 1EC9A 1WB0A 1JAKA 3CHEA 1AQFA 3RN6A 1AQHA 4YCPA 3RLHA 3B97A 2KZHA 3D46A 4UTWC 5TIMA 4KETA 1TREA 4ZL1A 3A12A 2GDUA 2HXUA 4L56A 3TN5A 3NDZA 1VKFA 3RCMA 2X41A 2QKFA 1DJNA 1LLOA 2PWUA 1WXZA 1YXDA 4NJIA 3VZXA 5J5RA 4I8DA 2PDQA 2G37A 4Z1AA 3VIIA 1YTKA 3LA4A 6CGTA 1KM2A 4YTTA 2A85A 1B4KA 1S2TA 3BSHA 3K13A 3MCMA 2ZXQA 1EP1A 1UKSA 3E0FA 4K38A 5JIWA 3M5YA 4EF8A 2BGNE 3EPMA 2QEZA 4DELA 3R1ZA 5DMNA 2J75A 5MKGB 4GZ7A 4HQVA 1PTDA 4BQ2A 2ZWYA 1UWIA 4ZB0A 1VBJA 4C6NA 5CSYA 4I8YA 1B3WA 1YTEA 1XDJA 1FHUA 2JKPA 1TWIA 1W9VA 3FDGA 1BVNP 4DPPA 4H9UA 2AAAA 4KFPA 2RDWA 1FWSA 1NH6A 4X22A 4Y7EA 1BRLA 1V4YA 4RZ5A 1L6FA 4DF0A 3OG2A 3WD4A 4NZCA 1NQ6A 1F7BA 4ATLA 3SRKA 1MEWA 3OVGA 1OGSA 2REQB 5DFAA 4DJDD 2XN0A 4XO7A 2CBUA 3EMQA 3DKLA 1QO2A 3G8RA 3I3EA 3O9NA 4GK8A 1PCKA 3VIHA 1IV8A 1O4UA 2BTMA 2CLMA 3P7YA 4DAIA 4C6FA 4M5PA 2YXGA 4Y96A 3UYCA 2V67A 1NDWA 5FF4A 3WLJA 1SO6A 4M7TA 1GJUA 3VK5A 2OYKA 3WNOA 5I3KA 3AIUA 3B9OA 3R0KA 5T8GA 3LU2A 3QN3A 1CGWA 1RY0A 2NXHA 1YBQB 5D05A 2Q6ZA 4E6MA 1ADDA 3GDKA 2BY3A 2WV8A 5HMSA 4AZ6A 1RP9A 3BCJA 4BI7A 2J66A 1ISWA 4C1KA 1XPYA 4ZQRA 3AUOA 2QCMA 4IPNB 5FEPA 2J4GA 1WO2A 4CCCA 5D32A 4RNHA 4PEKA 5L6UA 5D38A 2YL5A 2O56A 4O13A 1PTAA 3M0VA 4WKFA 4MWAA 4M82A 5DT5A 3CUXA 3H2EA 1LJYA 2OU4A 4MAVA 3ABSA 3BAYA 1W1ZA 3M0ZA 1HQTA 3VO0A 1W1B1 1T6MA 2PP0A 1SO4A 3PZTA 5CPMA 1F73A 2CHRA 1DWGM 4RV8A 3VNZA 3L7RA 2QULA 1N8WA 1BXBA 3KS5A 4C60A 2WVSA 3NSMA 1MDRA 4LS1A 3RF9A 1W1YA 4GGHA 4KRZA 3TJIA 2W67A 3BAIA 4QJ1A 5FEWA 1HJWA 5A8MA 5CBBA 4WGXA 2E6AA 4Q8MA 1DXEA 3RJXA 4ZENA 5LNUA 1CENA 1YE6A 3GM8A 3AHXA 1RBOB 3V0UA 1IWAA 4PRTA 2Y89A 3NOEA 4AW7A 1OIFA 1J6PA 5U7SA 4NSBA 4LXFA 4PTVA 2EXOA 3N4EA 2A7RA 1OABA 3FSTA 1H11A 3BZJA 3BJFA 1GW9A 1SJBA 1SJAA 2FVLA 2PB1A 3RU8X 4H19A 3QHNA 4J28A 2FVKA 7XIMA 1B90A 5DANA 1O12A 5CLTA 3D47A 3VKBA 3QZEA 3QY8A 3KUMA 3M44A 3HN3A 3IIXA 1UMYA 2AL1A 4OZOA 3VD5A 3NGJA 1ME8A 2E68A 4A29A 3GXTA 5DT7A 4QJ4B 3WBEA 4B5XA 3GVQA 1UP3A 3K4WA 3NQ7A 1RJPA 1EJXC 1JQXA 2FYMA 1V0LA 3CEUA 4KF1A 4ERGA 3NQEA 1UR4A 2IKIA 5I3HA 4K1GA 1BYDA 2VO5A 4UMBA 1R2TA 1K9EA 4BQ5A 3GBDA 4WIWA 5DBUA 4PMUA 1RZMA 3B8TA 1L2UA 3OGSA 4WOZA 5FJUA 2X1TA 3N04A 1EFZA 4ZTXA 5GNXA 1MW0A 3K2GA 2DGAA 2ZRUA 1UD5A 1REQB 4GH3A 6ENLA 4WJ8A 2W0UA 1OIMA 2W3ZA 1LQ0A 4ZZ9A 3BOFA 3EOEA 4PMVA 1EIBA 1V6WA 4GH1A 3G77A 1BTCA 3RPTA 1HL9A 1R85A 1WUFA 2E09A 3GVGA 3AIQA 3OZMA 4F8XA 4Q8VA 1IT8A 4GNVA 2PDMA 4PCTA 1W31A 3L0NA 1TX0A 4HPNA 3T0DA 2Y0FA 3VUSA 1J10A 4EWND 3WEZA 4A8IA 3NL3A 2V5BA 5C9WA 3PAOA 2OLHA 3M6YA 1AD4A 4BKNA 3AICA 2AGKA 4XZIA 2YFOA 3LN3A 3GQYA 1B3ZA 3WQPA 4OOUA 4F66A 4GACA 2Z2AA 4B2DA 7ODCA 1RCOB 3T4CA 5I79A 3TLLA 1PL9A 3B9EA 4GNJA 2DJLA 7REQA 5CPLA 1GVEA 2WZIA 4HA4A 4K7YA 4FZIA 1XIMA 5LIWX 3CV2A 3HFYA 2PPGA 3ZR4A 2J25A 3GTIA 2HXTA 4R7OA 1HVQA 1OZMA 4JKMA 2YOCA 4QJ3B 3VDAA 1SW0A 1H5YA 3WK0A 4BWLA 1GG0A 3ZQ9A 2VRKA 3RGTA 4IIHA 4UTKA 5CG0A 2QJHA 2OX4A 1EWDA 2VOMA 4LC6A 5KSWA 3ARPA 4H4IA 5LGXA 1EX5A 2Z1BA 1GORA 1GOXA 4RE4A 1KXVA 2OPJA 4MZYA 5RUBA 2DP3A 3KCOA 4INFA 4RW5A 3GDBA 4PUNA 4GJJA 3EWUA 1H7WA 1SR9A 4KWUA 3AIWA 1BD0A 4TQTA 2I57A 3PSWA 1RQHA 4IQDA 2PDJA 1B31A 2UWFA 4E3VA 4FXSA 4LNCA 3CPUA 3VZZA 2GGIA 4GIAA 2FVMA 1E1EA 4KFNA 4I6KA 3C3UA 4KW2A 4N6EA 4H41A 4LW7A 4JQAA 3UXLA 2VZVA 1W9PA 1K77A 1IT0A 4O1DA 1Q7ZA 3DI0A 1EEXA 4UTWA 1GOMA 5MF5A 2OX1A 5AZ0A 4MG4A 2CW6A 2J88A 2BV9A 1PKLA 3VCRA 4AVOA 2PDBA 4YTUA 1G0CA 4LUYA 1PAMA 3PZNA 2GDVA 1S5TA 1E1CA 4X63A 3GKFA 4B4HA 4ORIA 3LBMA 2WMKA 1C3FA 3LTPA 4IWWA 4LEFA 2Z1SA 5ABTA 3DECA 2OZ3A 3M7WA 3UA3A 4DXKA 3VPLA 4Z1YA 5F2LA 1EJRC 5D2VA 4Z08A 3G1FA 3WQCA 4QSFA 1H63A 2WOQA 1JZ3A 1SYTA 1EYWA 1I2RA 3CTLA 4BA0A 3C8NA 3TN3A 1A80A 2Z4GA 4ZQMA 2CCRA 3RRXA 1KM3A 1R3RA 4CNTA 3G1VA 4IUOA 1R2SA 4Q8UA 2CIPA 2FQIA 4PMQA 3EDDA 1EL3A 2BOFX 3VNKA 3MHUA 1YMYA 4MB4A 4H8HA 1LRQA 4R7JA 4DJEC 4CKQA 2BDQA 5HR6A 4PR4A 1VEPA 4KT2A 3I4KA 1CIUA 1JULA 4UXDA 3WF1A 4L6OA 1SVDA 1EO7A 3N4AA 3UXKA 3VKCA 2NX1A 1RBAA 3MMDA 3NPVA 4H9YA 1PEZA 4UBPC 3OBEA 2BXYA 4DYEA 4HU4A 1B9BA 1D3HA 2C15A 4NZJA 2BVYA 2WPGA 4IXHA 4NAEA 1AMKA 3TROA 1PWMA 1F3XA 3OB8A 2XFFA 5FIPA 1YHTA 3FHAA 3VYLA 4CN4A 3NQ8A 4IMEA 7CGTA 2Z0IA 3T55A 3GG0A 2P50A 4US5A 4W7VA 1Q6EA 2WMGA 3STCA 3CT2A 4DWSB 4AIEA 3ALFA 1OYAA 1LWHA 4PUEA 2OWWA 1O5KA 3TW9A 1CW2A 2J74A 2CPUA 3GW3A 3SY5A 1UR8A 1C93A 5BRPA 1EIXA 1IGSA 4HK5A 3W0KA 5ENLA 2BASA 3MSYA 2JQXA 3LEPA 3STPA 4J27A 4UR7A 1OD8A 1QU4A 1W32A 3L4WA 1EJWC 1I2QA 1KQYA 1X7IA 3MPGA 3B0YA 4Q6JA 2XSBA 4EIVA 1FWHC 1YADA 3CWNA 5AYIA 2GLKA 3M47A 3ARWA 4F0MA 1SMAA 1T99A 1PBGA 2YA1A 3MYOA 1B1YA 4H7VA 1RLDA 3D6NA 5C7VA 4HU3A 1LTDA 1XD0A 1Q6CA 4AZHA 4H8NA 3WUEA 1WAWA 4GZIA 2P76A 4B9YA 3VDBA 1DWAM 4QISA 5JBFA 3K1GA 4AEOA 2RAGA 4IQJA 3HGSA 2QVHA 1VEOA 1HKKA 2PGWA 2MNRA 4MLJA 4B9ZA 4JTJA 2XH2A 3TOPA 4GZJA 3I6RA 2YPIA 2Y8KA 1YPXA 3LLFA 2X7WA 3LNPA 4CEXC 2FTPA 4C6KA 3B0PA 3C2YA 1UG6A 1E4NA 3NEHA 3VX1A 3A4XA 1KR1A 4J3UA 3G6LA 4YHGA 1JD7A 2DSVA 4KKXA 4O50A 3GDTA 5BXRA 2QR6A 1ECEA 1VJZA 2Z28A 3UPWA 4WSKA 2BWGA 3ANYA 4XZHA 4K7VA 2VX5A 1JCNA 3RG6A 1CZ1A 3KOFA 3BLDA 5HQEA 3GYEA 3SDOA 1Z69A 3THDA 4DUWA 1H60A 4YJ5A 3VVGA 3HQ1A 2Y5JA 3DENA 1XSJA 4I7UA 2I9UA 3AXKA 1X38A 5D37A 1JVNA 2PLJA 3N12A 2DEPA 5A8NA 3MANA 2GVGA 3EWXA 1FWIC 4PL1A 4IQEA 4RCXA 3W7PA 3CB3A 2D1ZA 4FALA 3HPFA 4X61A 3UWUA 1QAPA 3VIPA 3LCFA 3RLUA 4E3TA 4GOAA 2I9EA 4FX8A 4YWSA 5LHEA 2OSWA 1CGVA 1VS1A 2Q3OA 3P5ZA 4S3BA 4TIMA 1XYMA 1PS9A 3TJXA 4MOZA 2DT3A 3W1TA 1XLGA 3EB4A 1JCYA 4OJYA 4MB5A 1HP5A 3W7MA 3FK4A 4HGXA 3KRUA 2CKRA 3K30A 4Y2WA 2AMXA 5TAOA 1ZJAA 3GTFA 4FOUA 4UIOA 3N2BA 3OZPA 1S2WA 1IZJA 1XXXA 1TWDA 1YYAA 3UZWA 3WFAA 3G1SA 1UD2A 1B30A 4UWMA 1BGAA 2J7BA 4C6OA 4KERA 3QSRA 4NJHA 4P7QA 2WJDA 1QWKA 3EDFA 1V8EA 4A4AA 4H83A 1ZBVA 2WNQA 1UD4A 3T0BA 3KCJA 2YL8A 2XG9A 1E6XM 4ZGYA 1CECA 2Y7GA 1Q66A 1BHGA 4V33A 3MI6A 4NZFA 3NL2A 3PWIA 4IPIA 3H4XA 5LIUX 2C1HA 5LNSA 2RDXA 5DBTA 1IT7A 1I2OA 3P93A 1POKA 3TYEA 4MY8A 1V3KA 2IKGA 3BQ6A 2DZWA 2NVDA 3GB6A 4MUZA 2CLHA 3GXFA 1E4MM 1W8GA 4FLQA 1WE5A 1FDJA 5KMYA 3NL5A 4C65A 1FCQA 3GNPA 4LH8A 4UFHA 1WPCA 1EX1A 2P1FA 3VU2A 5HOSA 1G01A 5JMUA 3EKGA 4GC4A 1DXFA 1O95A 3MUAA 5LNVA 5JUVA 2BOGX 1VFTA 4AZIA 2ZX8A 1XC6A 3RAOA 3RM4A 1VGAA 3UWYA 3P82A 4EP8C 5D03A 3W88A 2PC8A 1ZUAX 3EXTA 1V3HA 2EGZA 4XBSA 1W3KA 3NQ2A 3LTSA 1K9DA 2V69A 1OHLA 3ITGA 1ZU8A 4PZVA 5M5DA 2XYLA 4YYCA 5JH1A 1GTEA 5B7ZA 1R6WA 5IM51 1PIFA 4J7RA 1Z41A 5FJJA 1TV7A 2HROA 4PRWA 3RU6A 4UTTC 4QAWA 3W7RA 2FHCA 1BTMA 3FJLA 5F2IA 1EJTC 2DSKA 4AX6A 3UERA 4NXKA 1HG3A 3ITCA 3MW7A 1OYCA 2ZFAA 1O5XA 5AHFA 3BLOA 3L67A 5KZDA 1V6YA 4HPJA 4DO4A 2TPSA 4GY1A 2JGQA 3U57A 3O6YX 3CHVA 4TXEA 3PJWA 4JYEA 4LYPA 1V7AA 1YNYA 3SUUA 3WD0A 3MO7A 1TPB1 3I68A 4NVTA 3A22A 1JPIA 3PNUA 4GO8A 1XRFA 4RLIA 3SN4A 2ZDSA 2VP8A 2CITA 4HK7A 1Y5XA 4RDVA 4HOWA 3N73A 2V3DA 2OWXA 4GI9A 1WV2A 5CZJA 2X05A 3LQGA 1NFGA 2A3EA 5JBDA 3H2FA 1PIIA 2WHKA 2A3LA 3EMZA 3H2MA 3LNMA 4AWSA 3S46A 5GNYA 3QEZA 1XGEA 1DQWA 2QDDA 4ZO6A 2WC3A 1TTIA 1I0BA 2WC4A 2NZLA 1JDAA 3LRLA 4LCRA 3H54A 1JDEA 1N8IA 2V2HA 2R8WA 3QJAA 3BSMA 3WH9A 2W66A 3WDJA 1PPIA 2PDPA 4UNKA 3ITVA 3N9SA 1FDZA 3WMBA 1HO4A 4PTXA 1JR1A 1WDWA 2QMKA 3UQNA 3MUIA 3TTOA 2DZTA 4LRTA 5GJNA 2B31A 2C3ZA 1NWRA 3V16A 1J11A 4RUBA 2C1GA 2B7OA 3BGAA 1G7UA 4HCLA 3GY1A 3VD4A 1KM0A 1M41A 2WBKA 4H6QA 4P8XA 4KEZA 3GRIA 2X1UA 1A5CA 1JDDA 1CYGA 1EP2A 4PTWA 1IXQA 5G5IA 5GQBA 3QFEA 2BVDA 4L65A 2WHMA 1KR0A 3MUZ1 4ZTYA 2EPMX 1HJXA 1RV8A 3NNTA 3O63A 1MVYA 3INPA 1QK2A 1JCXA 2VD9A 4FXJA 3FDKA 3LCXA 1W91A 1ZPTA 2NVCA 3GR4A 5U4NA 2PDNA 3U2EA 2FZ9A 3GC5A 2RDUA 3ZOAA 1S2CA 5FAJA 3TUUA 1KFCA 1RQEA 3E0LA 3GU1A 4EE9A 1LG2A 1W9DM 2XIMA 5EYWA 3T05A 2INFA 5T9BG 4PUUA 3LBCA 5CGTA 1XHGA 4HKPA 2BHYA 1E6ZA 3T40A 1VEMA 2FDMA 3VE9A 4GX9A 1BGGA 3OP2A 1AQ0A 1Q6RA 4JICA 4AAJA 2EPKX 4EOUA 5CJMA 5IOBA 3IAPA 1EH9A 1K1DA 3CUFA 1E56A 1ISZA 4UFJA 1XISA 1XICA 1M65A 2PTXA 5FCZA 1K8XA 3CNYA 1XIEA 4HA3A 2P3ZA 4U5IA 1DORA 3VKKA 4ZR8A 5FJPA 4Z1CA 2FZBA 2G95A 1E6QM 4TVCA 3GR7A 5HA7A 4DJDA 3CAWA 2E6FA 1A5MC 2UBPC 1HKMA 1KLYA 4KS0A 4DF1A 3CUGA 3W1QA 1AVAA 2ZQ0A 4TVDA 1HW6A 4OBRA 6XIAA 5T26A 1RJRA 4PFMA 5D2TA 2VTFA 2VZUA 1OQFA 3MBDA 3CGTA 3AIEA 4EPBC 4AF0A 3Q58A 3QF0A 3ES8A 1C8XA 2RGMA 4GBDA 1PZ1A 4UC5A 1JZ4A 1B54A 3GIYA 3P74A 4MAZA 3TFCA 2WMFA 3R11A 3HF3A 5I7GA 4W87A 3EA2A 3GFXA 3EBVA 3MDWA 2GJLA 3A13A 5AC7A 3A4JA 4W93A 1H51A 5E6ZA 1MQPA 5CGQA 4HJFA 3FW6A 2E5BA 4RW3A 4M8UA 4HYWA 4GKLA 1I4NA 3L4UA 2BY0A 4E2DA 1EO5A 5HR7A 2YW4A 5BMXA 1AJ2A 4UFMA 2CU0A 4CUCA 4RX0A 2R91A 3UR7A 3LV5A 4P8WA 1WAUA 4FAMA 3GNOA 5LXXA 1UZ4A 2C18A 5DLCA 1P7TB 4H9TA 2PFHA 1TZ7A 3B8UA 5HWNA 3AO0A 1X39A 5AYBA 1M7PA 4AY8A 4PGLA 2R14A 2YIHA 3W7CA 1VJIA 4PN2A 2O7SA 1OGBA 4CCEA 2IUZA 1ITQA 1XLAA 5K9XA 5G2IA 1GQJA 3FLUA 3L23A 1ZAJA 4ZSUA 2RFGA 1PV8A 4QEHA 1DJIA 3TNBA 3ARXA 4G7EB 1GYLA 3KFTA 3R2GA 1SPQA 4OV4A 3QV9A 4F4RA 1XL9A 3P80A 1JI2A 1JFHA 2QIWA 1NEYA 4LAKA 4Q33A 3HFTA 4TO8A 1H62A 3OVQA 1TPUA 3EMCA 4O4WA 3CYJA 1UWRA 1DKWA 2X7VA 1FWWA 5ABEA 8XIAA 4M19A 3ES7A 3AZTA 4QLLA 3OOQA 3O6AA 3HPZA 3VCCA 3CQKA 2ISDA 5EKYA 4M6UA 2DSWA 4YNGA 5EPDA 2ZRZA 3EOSA 4GIRA 3WBAA 1ZSXA 1M5WA 2DZPA 2VZSA 4LVDA 1LYXA 1A5BA 5C71A 3UJFA 1GWJA 3CZ8A 1G4EA 2ABBA 3BH4A 2HBXA 2I7GA 2H90A 2ZWZA 3LHZA 4L61A 1CGUA 3TV8A 3WJWA 3UVAA 3QW3A 4QLKA 4HP5A 3W7QA 2QDEA 1E3ZA 1VD6A 3W76A 2FB2A 1C8VA 1GVOA 1F6YA 3WQVA 1P1XA 4W8LA 1UUMA 5EMUA 2BP1A 3VABA 2J27A 3F4DA 3MO4A 4DZIA 3VNMA 2H9AB 4BJHA 4JY9A 3CV6A 3W2LA 5B80A 3KHDA 3PZIA 3S6DA 3F7JA 4D1JA 2W62A 2QZRA 4J3ZA 2FFIA 1PSCA 3SEPA 3AXHA 4IFKA 3CLWA 4DXVA 1RA0A 4GCXA 4D1IA 3A23A 3S8HA 4KQNA 2O9OA 1GYMA 2ODOA 4UTTA 3GE7A 3WNPA 3UJRA 3M0HA 3H2NA 2CLKA 1L6WA 3T8LA 3SCNA 1TTJA 4KBXA 3DESA 1QPRA 3AHZA 4X60A 1XBVA 4OFCA 2XVLA 5GJPA 2NV1A 3S5OA 3W00A 2YCJA 5DMMA 3ATZA 4RXFA 5HBFA 3H22A 2YSWA 3M5VA 1Z32X 4ONVA 3BMXA 4ZOEA 2JF7A 3OU8A 2OGJA 2CZEA 1K7XA 3BLLA 4YMZA 1FKWA 1ONRA 3T7VA 3BAXA 3S2LA 4IGSA 2DZXA 3APGA 1RK5A 3CV1A 2WQDA 1QPNA 1RCXB 3NJ3A 1Q6FA 1W37A 3T09A 3O05A 3OQEA 2QPXA 2BMBA 1IZCA 3ZSTA 4PMYA 4CN6A 1KBJA 2PU1A 5LSMA 4GC3A 3QR3A 3PY2A 2XUCA 5FEXA 4DZHA 1QK0A 3HV8A 3S9ZA 1H4PA 5JH2A 3GLCA 4WY0B 4TU1A 3M0JA 4D6IA 1W6TA 4DBSA 3NDOA 2Y6ZA 5FJRA 4ZQOA 4ZOBA 4Q22A 1MNSA 3TYCA 3QOKA 2B4GA 2WW5A 4QQUA 4JN6A 4P7OA 4GI8A 1VCFA 3GKAA 3O07A 1NWSA 4GVFA 4QNEA 1NVMA 3GX9A 1S39A 5HINA 1E0WA 4YVPA 1GUVA 3UJ2A 4ACZB 1R9XA 5I23A 4LUTB 2G50A 5D2XA 3EOOA 3GU2A 3OG3A 5EY5A 3GNNA 3PG9A 4RDYA 3A47A 3KX6A 3UG8A 1JIBA 3OW1A 2PLCA 1MWOA 1XCFA 3GBEA 4FF5A 3AZSA 3GHUA 4LSBA 3V36A 4FPSA 3UCQA 3B8DA 4B15A 5BCAA 5CC7A 3BMVA 1GZJA 4ZFMA 2E28A 2PEVA 5I3GA 2Y7DA 1JCMP 2E6DA 1B9ZA 3N9KA 5AC6A 3M0LA 1E6RA 2ZZ5A 4WDUA 3O8AA 3L5LA 1CCWB 1KFJA 5K3VA 1V03A 4WLCA 1HJUA 4W9TA 2PD5A 2EJAA 2PDGA 1I75A 2PRHA 5IBXC 4MDPA 1G6CA 1VJSA 3N6HA 4REQA 1BKSA 1ODUA 4HZMA 4FNPA 1P48A 1F61A 2PLMA 4DLMA 3DERA 5FKYA 4LUSA 3TZNA 3IVTA 1JPDX 2DT0A 3HV9A 4HT3A 2CERA 3ZWTA 1LL6A 4HA0A 1OX4A 3G3DA 4JFUA 5DQPA 2Z29A 1L6YA 3BAKA 3RIKA 4DWDA 5HMFA 4U4MA 3PP7A 1R9ZA 1FHDA 1YE4A 2R94A 3AS2A 1I1WA 1PIGA 4CQ9A 3WYZA 3JZUA 2J7GA 2D0FA 4NY2A 3M43A 4PCNA 1AJ0A 3F4CA 4HNVA 2QPSA 1MUCA 4UR9A 3LHUA 1HJVA 2ZX7A 3CEPA 1GVQA 1VC4A 2JEQA 1VIWA 2YLAA 1LBFA 1J9YA 3P67A 1XW8A 3PM6A 1X8FA 5M17A 5BW6A 3H8AA 4JY8A 3THUA 3W73A 3R8RA 4M6VA 4ALDA 3TWBA 5C9XA 1SJDA 1EOKA 4B5VA 3PJUA 1PVNA 5KETA 1O60A 2VC6A 1PO9A 1EOMA 2GJXB 1D2KA 1V3JA 1YDOA 5I78A 1BWKA 3G1RA 1UQYA 4UMCA 1GEQA 2WSQA 1TWWA 4GBUA 1EJSC 3KRBA 4LU0A 2Z27A 4S39A 3S5SA 3VZYA 4C1NB 1W3LA 3S6OA 2WMIB 4L9ZA 3NO1A 2BB0A 3S2MA 3ITTA 5EU9A 3FAXA 3GXNA 4G9PA 4AXKA 3LCGA 2VL4A 1IHIA 2HRWA 3CAKA 1UQZA 3PZQA 2GVEA 2ZRWA 3EZ4A 3L5MA 2ON3A 1A49A 4LAZA 4XBKA 1EDTA 3EEGA 3FKKA 4M56A 2YLLA 4PSPA 1BVWA 3MP3A 2W4XA 3PZOA 4I3GA 2G4JA 1DOSA 1UR1A 1A3XA 2ATSA 4HYRA 1NELA 4GFSA 1XQKA 2Q01A 1UA3A 1QNRA 4H3DA 4M80A 4X2RA 1WZKA 4A22A 4LBSA 3S83A 5DCBA 3GIQA 2H6RA 1YDNA 1XYAA 4JXCA 3A9IA 3SQSA 1IXOA 4QRNA 1KBLA 3FAWA 2E25A 1DWJM 4GA8A 1P6WA 1MNZA 3C0JA 3AMGA 3NA8A 1VR6A 4ES4A 2X1IA 2OB3A 2QUVA 5MKGA 1UH3A 1SO3A 2ZE3A 3ARVA 1WA3A 2QCEA 1TJ1A 3GDMA 3LS9A 3KTSA 5AVHA 1FKXA 1BFNA 2VVNA 4EXBA 3KL0A 2FMNA 3U5UA 1YEYA 2G97A 2HPIA 1VLIA 3NYDA 3FA5A 3P0XA 2OQYA 4J3XA 3LUTA 2J7EA 2P0OA 1TFVA 6XIMA 2PDFA 2HDJA 3URNA 4JFSA 3TYAA 4IZGA 5FSEC 1D7KA 1EB3A 1OM0A 4D9PA 3A4WA 3HJEA 4O17A 3USBA 1EXPA 3B8IA 2GQAA 5REQB 4D6EA 2REQA 5FOOA 2NUWA 1R38A 2WCGA 1E6NA 2W9MA 2PGFA 1WDRA 4AD0A 1OCNA 2G5WA 1BG9A 2Y5EA 4ZO9A 1VYRA 4N2YA 4Q8WA 3WD3A 1XIBA 4MADA 2P53A 3RCYA 1U30A 2RJGA 3AYRA 3PBGA 3DH7A 4C6MA 4S1FA 1E73M 4DWSC 2HE5A 1YBQA 1GKPA 1W9BM 4GLEA 3CPRA 3O2LA 1E0VA 4LF1A 4LANA 2ZICA 4GPNA 2J8GA 4WXZA 3MV11 1LF1A 2QGHA 3JR2A 3V1PA 3NAVA 4JS3A 1U5JA 3UYIA 4AG0A 5FF0A 1TMQA 4EPEC 4WCJA 2DW6A 2GVJA 4UQEA 1ZCCA 3ARZA 1Q4NX 2GSHA 3E2QA 2I16A 1E5JA 8TIMA 5BXSA 4PRRA 2DW7A 2AOSA 4ZBCA 4CQCA 2CLIA 1XIIA 3TW6A 3RPDA 3M46A 3MDUA 1ZENA 1LZOA 3LENA 2XZ7A 3G1HA 2ZX6A 4W5ZA 4XUYA 4F9DA 1KD0A 2C71A 3MCOA 3UA4A 3TC6A 2IPFA 1J79A 1BYBA 2XPKA 5I24A 1XP3A 4ZOCA 4K1WA 1FH9A 2E1WA 2FLIA 4H6KA 1WDSA 3UJSA 3ORWA 1SW3A 3W01A 3EWZA 2J24A 1KCLA 3SJ3A 2PDLA 3OGRA 3G1YA 2VNCA 4X0NA 2VQTA 4GUFA 1JRBA 3KOYA 3GNXA 1F9CA 1U1HA 2VZTA 1H0GA 3EPOA 2OEMA 3TIMA 3WNNA 2VEFA 3UR5A 1TUFA 5A94A 3H2OA 1RALA 4B3KA 4QBXA 4O1FA 1E0XA 4WQ6A 1E0TA 1MSSA 1A5NC 5AHNA 3SSJA 4CU7A 2BFGA 3NM3A 3DKJA 3TDFA 1P43A 1UJQA 4MGGA 5HWMA 2XVKA 3UZYA 4AYSA 1XRSA 1OX5A 4GUJA 3SY1A 4CD8A 5A6JA 3MT1A 3FCPA 3WFZA 1XLCA 4YXGA 4HNCA 1OCJA 1LBLA 3W7NA 4B5SA 4AFYA 5LIXX 2YL9A 4FR1A 4AY7A 1TJ0A 3C0LA 2G3NA 2D69A 5IHSA 2DT2A 2V63A 3VKJA 4GRSA 1ZBKA 2UV8G 4O0ZA 3CHDA 4ICNA 3EDJA 2WCAA 2ACQA 2IPJA 3VNJA 1W3NA 5CZ0A 2E9MA 3W28A 1ONXA 3S5YA 3U7BA 1O1HA 5G4EA 1FH7A 2A3AA 3B0VC 1CLXA 3V35A 1K02A 4CQ8A 4N4QA 3IS4A 4B2DD 2CWNA 3N3MA 1REQA 4A8NA 4F9JA 4OE7A 1CI1A 1WOAA 5TD4A 1PZ2A 4UTLA 4JTCA 4K8EA 4UCGA 2VFEA 3M07A 4ZA0A 2B81A 4JIRA 4A05A 4IOTA 1F76A 1QTWA 4A2RA 1SSGA 1WKEA 4AHOA 3AMDA 1JZ8A 5E9AA 2DDXA 3OZOA 4FOJA 2NLYA 4ZVJA 3VNYA 1NDZA 3UWEA 4Z1DA 4ICCX 2BNJA 3PBUA 3F2BA 1KM6A 1GHRA 1DVJA 3TA6A 1AH4A 1MDLA 2UY3A 4JQ1A 1BSIA 2BGSA 1A5OC 3S1VA 3M6DA 1IF2A 1XKYA 2VELA 3LDVA 4DRSA 3NTYA 1JQVA 4IHCA 4A3QA 2CLOA 3N3TA 1JRCA 3TU9A 5ABGA 3GZ3A 1DEDA 2V38A 3GG7A 2ZX5A 1H7PA 5AHEA 3BTNA 4D8AA 2QCNA 2Q71A 4WGHA 3UR2A 4FEZA 4ZSTA 3DIPA 3QGAC 3AROA 4H9VA 1RH9A 3CAQA 3FS2A 1OF8A 4HBKA 5FSDC 3TTEA 5E0FA 3URBA 1IEIA 2PDXA 2QUNA 1UKOA 1G4SA 5AKQA 4LV9A 1QW8A 5LGZA 4ROPA 3W2UA 4LAMA 4XD3A 4UTMA 3ME3A 3W7GA 3P3BA 3BCDA 3W7JA 3CH9A 3A4AA 3OBKA 3XINA 3L0GA 4DYJA 3DHUA 1UR9A 3WKZA 3KAOA 1OWQA 3HPAA 1ITCA 1K7FA 4Z2JA 2G3JA 1KM1A 3BLFA 2ZIDA 4HN4A 5CC6A 1UH2A 3U6WA 1P0EA 4M1BA 3VTRA 1OGGA 2V5JA 4UNIA 4O52A 1WXYA 5FACA 2FMOA 3LSCA 5L9FA 2CHOA 1DV7A 4IIFA 4ERIA 3F1QA 1R3TA 3ARTA 3SJNA 4JHZA 2DIKA 4QROA 3KOWA 1MMFA 2XH4A 3B40A 4GJ1A 3L66A 1VYSX 4H01A 2CESA 3LGEA 3KOZA 1H2JA 3AU2A 1UKQA 2BY1A 2IMRA 2PA6A 3J7HA 2OOGA 4UFLA 2V2CA 1XLEA 4U2ZA 3WSUA 3ZS4A 2DQWA 2TYSA 4HPGA 4TV5A 5AHLA 1Z44A 1BF2A 2FJUB 2NWRA 1QNQA 1UWAA 4GY7A 3NYZA 4MPKA 4ECLA 5I6SA 1YQ2A 3AALA 4R7WA 1CWYA 3IUDA 4ZQNA 3MVIA 1X1ZA 5BWAA 1FFRA 1VBRA 1GQLA 4MUPA 4AHPA 3QR1A 2VKZG 1UPMB 4IMCA 1ELSA 3FSUA 1GEHA 3AMLA 3S47A 1EC7A 2ZUNA 2E6YA 3SCWA 3R43A 4XKYB 2J6XA 4CU8A 3UGRA 4DY1A 3WJXA 2BG5A 2NXIA 4I90A 1Y0EA 3STFA