3U5UA

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
501
structure length
470
Chain Sequence
DATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
molecule keywords Raucaffricine-O-beta-D-glucosidase
total genus 178
structure length 470
sequence length 501
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u5uA00
3WSUA 1GVIA 1ZBKA 1EIBA 4J27A 1WZKA 1QVBA 1NWSA 1GQJA 2D23A 3ARTA 2ZXBA 2BVDA 1W9DM 3THDA 3D3AA 1E40A 5F7UA 2ZUVA 3BXWA 4CVWA 1LL7A 3BLKA 3NJ3A 3WDRA 1CGUA 5A6LA 4GO9A 2GFTA 4V28A 2E8YA 2YLAA 1BG4A 2DPEA 2DSKA 3OBAA 1RD6A 1EQCA 1LLOA 1JYXA 3RIKA 4H8UA 4YN5A 4TX8A 5FL0A 2ZX9A 2VOTA 2VX6A 4CD7A 1XD1A 5AC5A 4Z2IA 4AW7A 1E72M 3W6MA 4PMVA 2J78A 4JKLA 2EXOA 2Y2WA 5ECUA 4MB4A 1KQZA 4BF7A 4WKFA 3AMKA 2X1IA 3SUTA 1X1NA 3W24A 4R5EA 4M8UA 2D24A 1FA2A 4AISA 3N12A 1JZ7A 2VVNA 4K68A 2ZXAA 2GJXB 1GJWA 3EMCA 3TONA 1V6VA 3ARYA 2D1ZA 2XVPA 4EKJA 2F2HA 4MB3A 1NH6A 1QOXA 4UFJA 5EFDA 1CGTA 4AEEA 1K9DA 3CZEA 1OBAA 3OA5A 4KRTA 4Q22A 4WJXA 4H8VA 4ACZA 1VFUA 4IPLA 1B1YA 3BAXA 1VB9A 4UQDA 1CLXA 1KBBA 3WNMA 4AD3A 2J7CA 3BAKA 3N15A 3WF1A 4JL1A 2DSWA 4WK9A 1IZKA 4MJ2A 2VQTA 2WHMA 1CWYA 4HMCA 3VIPA 3GDBA 2EQDA 2VVSA 3HMCA 4F9JA 3WF2A 4CKQA 1EQPA 1VENA 2OSYA 2GK1A 1M7XA 4UFIA 2BVYA 4GZEA 1E0WA 5JBEA 2DSUA 4TOQA 1YHTA 2O9OA 3AIQA 4AC1X 5BCAA 1CBGA 3ZT6A 1B3ZA 3DHPA 3WBEA 3CZGA 1EO5A 1PIGA 4LPCA 1E15A 1NWUA 2OYMA 4PTMA 1VFMA 2D0GA 1CNVA 2YLLA 5EB8A 3QGVA 3PZOA 1L0PA 4M81A 4XB3A 3BH4A 3WF4A 3ZJKA 4JFWA 3SUUA 2VCAA 1V02A 1NWTA 4KWUA 3ARZA 5E9AA 1GOMA 1IV8A 1KWKA 1JI2A 1VBUA 2WANA 3KZSA 4BQ4A 2DSZA 1UG6A 4PMOA 5LYRA 3L4XA 5A6KA 2VI0A 1OIFA 1C8YA 2FDMA 2Y24A 2D2OA 3SCPA 1XYFA 1FFRA 2BY1A 2DT1A 1HKMA 2J77A 1KXQA 2NW0A 2GDVA 1JGIA 1VIWA 1UD3A 4RE3A 1PZ2A 2XGBA 3S6TA 3FAXA 3TTQA 2PB1A 3ZQ9A 4PMNA 4YHEA 3ZO9A 1W3LA 3F4VA 1GONA 1K9TA 1WDRA 5A2BA 4YHGA 3BAYA 4DUWA 3VIKA 4UOJA 2VURA 1XSIA 3AXXA 1G01A 3JUGA 4JFVA 1UHVA 1CXLA 5D9NA 1JNDA 1ZU8A 2BFGA 2YA0A 3OGRA 1J12A 4U2YA 3WNKA 1XH1A 2DSVA 2BHYA 1HJQA 1TR1A 2J8GA 3WH6A 3MUAA 3UESA 2CCRA 4PSRA 4CU7A 1MFUA 1RP9A 1DWAM 1E0VA 2YL8A 5C8BB 2J74A 1XGZA 2WYSA 3FN9A 2J75A 2ZUMA 4HZ7A 5LA2A 2QF8A 4KRUA 3ECQA 3W29A 4HZ6A 1E5JA 1JF6A 1I75A 2EPLX 1JDCA 2CXGA 5GNYA 3WD2A 5CGMA 3WH7A 4DWSD 1WP6A 2XPKA 1S46A 1UR8A 1UUQA 3AI0A 4FK9A 1TVNA 2CNCA 2E8ZA 1VF8A 4LXFA 1P6WA 3QR3A 2BXYA 2D3LA 1AQMA 5JUVA 4F9DA 3GH7A 1J0JA 1UR4A 4Z2KA 3AIVA 4UR9A 4R27A 4Z2HA 4KH2A 4DM1A 3MMWA 2FHBA 4FLQA 4D6JA 4GINA 1W1TA 3EDEA 4AEFA 2UWFA 2XWEA 2JFEX 1XHGA 1OCQA 4BQ5A 4ML4A 4NRSA 3NDYA 1E70M 3MV11 2D22A 2OSWA 5IHRA 1BHGA 1QBBA 4X0NA 5IHSA 4WSJA 3U5YA 3GH5A 1W3JA 3AZRA 1H3GA 1KQYA 1PIFA 5FD0A 3W0KA 3GXIA 3QHOA 4PCTA 1UA7A 1WAWA 1JZ6A 2RGLA 1U30A 3FW6A 5A6JA 3W27A 3O2LA 2XJ7A 4N0RA 4GPNA 1E55A 1AVAA 5CJ5A 1FP8A 3MUIA 3VGFA 5KEZA 4QP0A 1TCMA 2WZIA 1UKOA 4E4PA 3L4ZA 1NARA 2WXDM 3AQUA 1EDQA 1GNXA 4CVUA 5FIPA 4D6HA 3AHTA 4NRRA 3GH4A 3WQ6A 3RPMA 3U5UA 4UQCA 4UFKA 3VTRA 3VGEA 3M46A 3VIHA 4XV0A 1UD8A 1GORA 4MB5A 5DF0A 3AHXA 3OZPA 3VIGA 4CU6A 4HP5A 4M80A 1BAGA 2DDXA 1XH2A 3IJ7A 2X0HA 5BXSA 3L4YA 2JE8A 2XIIA 1NWRA 1MW3A 1OGSA 3NSNA 4J3WA 1FFQA 2VRJA 5A94A 1BGGA 2EPOA 4M56A 3VOCA 3WELA 3K8MA 1CGVA 2BV9A 4GXPA 2WZEA 4ZXOA 1J0ZA 2WSKA 4PN2A 1HKJA 2FH6A 1XC6A 3SEPA 1E43A 3IAPA 1NM9A 2WC3A 4D6GA 1PBGA 2VX5A 1R87A 2XTKA 3WD1A 2J8FA 1CXKA 2IUZA 2DIJA 4PMYA 1N82A 1US3A 5A8NA 5A1AA 3NCOA 4ATLA 2CETA 5HPCA 2QLYA 5A6BA 1TFVA 1PJ9A 3T2QA 1E6NA 3BAIA 4LX4A 2CEQA 2DQXA 1V0MA 3CUGA 1J18A 2WVVA 1BYDA 3I3EA 3OLDA 2GJRA 1I1WA 2FH8A 2OWWA 1B0IA 3RM9A 1G1YA 3MUY1 3PHAA 3RM4A 2CBJA 1SYTA 3WD3A 1UR1A 1BYCA 2V5CA 4D6IA 4PMXA 4Q7NA 3EMQA 2WMJA 3A6OA 1V3IA 3ZJ8A 3RO8A 5I3DA 1H0IA 5IDIA 4GKLA 3HN3A 3K1DA 3AYRA 1DEDA 2E40A 3ARRA 1H11A 3CPUA 2XFFA 1ITCA 2W92A 5HNNA 4AZ5A 1VFFA 3TA9A 1QNQA 2AMGA 2OLHA 1TZ7A 1JAKA 5CSYA 1QHOA 1CECA 2WM0A 2EPMX 4GIAA 2VT0A 1CXIA 3F5JA 4PRWA 3ZMRA 1JYNA 1R86A 3AMGA 3K4AA 1EHAA 5GPRA 3OIHA 1MQRA 2JALA 1ISXA 4Y7EA 5A3HA 4MNMA 5GNZA 4AIOA 5E70A 3VGDA 1HT6A 4EE9A 4A3YA 5CPSA 2VJXA 1E4MM 1QNSA 4CD6A 4HTYA 1WDSA 2VUYA 1WNOA 3UR7A 1CZ1A 2E9LA 5KZ6A 1OT2A 3ALGA 4IUGA 5A6BD 2GK1B 2YBTA 1XH0A 2DT2A 2VRKA 5AYIA 1UWSA 1OT1A 1PX4A 1HXJA 3N04A 2VRQA 3WDPP 5HDRA 2W91A 3WFLA 2VZOA 3I3BA 4WSKA 3T0BA 1X6NA 4AIEA 1UD2A 2FGLA 5AY7A 5I2UA 4KGLA 2XHYA 1JZ3A 4CD5A 4RE2A 3W6LA 3NSXA 2V3DA 5BRQA 3CUHA 5CXPA 2VZVA 1DHKA 1HVQA 4JFUA 2X09A 1HJSA 2CKRA 3UG3A 1MXGA 2EPKX 3G6MA 2WMKA 4OKDA 3K8LA 2BNJA 3W81A 3VD5A 4M1RA 2AOSA 1RH9A 8A3HA 2EEXA 1U33A 1DTUA 5EFFA 1UKQA 2G3MA 3WIJA 3POHA 3VIMA 3KE0A 3MSGA 1IT0A 4URIA 1WZAA 3SUWA 4JIEA 1VEPA 2VX4A 1WKYA 1JI1A 5M5DA 1Q6FA 4TTGA 5M03A 2VZUA 1UR2A 2XVNA 1GZJA 5A2CA 2WPGA 4BA0A 1H1NA 1LF1A 3KWXA 1W9BM 3ALFA 4UQEA 1TE1A 5A95A 3ARPA 1VEOA 1E3XA 3N11A 2CESA 5A8PA 4HOZA 1W3HA 2O92A 7TAAA 4LYQA 3SCQA 1ISYA 4CN4A 1UD4A 3VGBA 1I1XA 3ZJ6A 4D6CA 3BAJA 2OYLA 1W9UA 2PWFA 4BS0A 4W8AA 1JNEA 2YL9A 4PYSA 1U2YA 1R7AA 4UOZA 3VGGA 3PZVA 1WCGA 3ZIZA 1GHRA 4XX6A 3CO4A 3SUVA 3RMEA 3PZMA 5FL1A 3AIRA 2W62A 5I24A 6CGTA 2J7GA 1HL9A 1C8XA 4AMCA 3MMUA 1GPFA 2XFYA 4QLKA 2WVVB 4CCCA 1FH8A 1BQCA 1W1VA 2JF7A 1ESWA 3ARQA 1JXJA 3BLPX 4AZHA 3GNOA 1UR9A 2FHCA 3IJ8A 3K46A 1MW0A 1MYRA 3CGTA 1KXHA 2WCAA 3TTYA 1K9EA 3SCWA 2E4TA 2UY5A 3EDJA 1E4IA 1UH4A 4P8XA 5LA0A 1R7OA 3WQ8A 2VZTA 3BSHA 1ISWA 1NQ6A 3UCQA 2Z1KA 4D1IA 4FLOA 2VMFA 3PTQA 1V0KA 2GUYA 3TTSA 1WZMA 3CUFA 5E0FA 4D71A 4E8DA 2BY2A 2EJ1A 2WVSA 1Q6DA 1LG2A 3FAWA 1HKIA 3WNLA 5IXEA 4WF7A 1CGWA 4W89A 2CBIA 2GVYA 3T08A 4PMRA 2XYLA 3L4TA 1E1FA 2XSBA 7CGTA 2ZXDA 2GSJA 3AICA 2QMJA 1B90A 4ACYA 3WQWA 3CMJA 4B16A 4JKKA 5D9PA 4UNIA 4B15A 4BZYA 4CCEA 4DM2A 3CHCA 1ODUA 4DWSB 4W88A 2JIWA 3VX1A 4S3KA 3WDHA 2YDRA 1Q6GA 1JDDA 3AISA 1V0NA 2E9MA 4UCFA 2A3HA 1KBKA 4C7FA 2HISA 3WL1A 1LQ0A 3VD3A 3QOKA 4HZ8A 2D0HA 1DWJM 1HJWA 4GZJA 2DH3A 3NUKA 3AS0A 4AD4A 4GO8A 3I3DA 3MV01 3U7VA 4DUVA 3W28A 1OB0A 2ZWYA 4IM4A 3VDAA 5IFTA 4V2XA 1FH7A 4F66A 6TAAA 2J4GA 4IISA 5FKYA 3CHDA 3VKKA 5BWFA 2C8NA 5D8WA 1W1YA 3WQVA 4UQAA 2VX7A 3VILA 1XRVA 3ZR6A 1TA3B 1WDPA 3DYOA 4OZOA 1US2A 4D72A 2ZX7A 1UD5A 1UR0A 3GNPA 4AYSA 2WBGA 4X0VA 2OSXA 5D9MA 2CPUA 3U7BA 2G3JA 3CZJA 1WB0A 1KB3A 4F79A 5ABFB 3THCA 4LGXA 4PMUA 1E6RA 2HVMA 1KR0A 3TTOA 2E9BA 5C71A 3W82A 4M29A 1GQKA 2WBKA 2J7FA 4UFLA 4U2ZA 3KL0A 1NP2A 3O9NA 3N9KA 1XV8A 2PC8A 3BSGA 4W86A 1UKPA 2O9TA 5I79A 5DT7A 3VDHA 9CGTA 2VC9A 2Y8VA 4AZGA 4J3VA 1BGAA 2NT1A 2WWDA 2WHKA 3VD7A 4C7DA 1AQHA 3WD4A 4HPGA 1JL8A 3RJYA 2WC7A 2WC4A 3BAWA 3APGA 3A47A 5FCZA 2CBVA 2ZWZA 1PX3A 2JEPA 1EXPA 1GHSA 2WLYA 3L4UA 3OG2A 2XWDA 1E73M 4ATWA 1UA3A 1WDQA 1LL6A 3OZOA 4B3KA 5CG0A 1W32A 1EGZA 2CERA 2VR4A 4MJ4A 2V3FA 5M17A 1Q6EA 3GXMA 3CZKA 5BROA 1MFVA 2G4FA 2IXVA 2ZUTA 4P7OA 1UWIA 3PTKA 1L8NA 1ZBWA 1R8LA 5ABGA 1H09A 2YDSA 1QNOA 5HOSA 4AZCB 1KXTA 1V3LA 2YJQA 5E6ZA 5I78A 1XSJA 3B9EA 3O6AA 3W37A 1W9VA 4LYPA 2V3GA 3M07A 3AS3A 3W4RA 4W5ZA 3CMGA 5JIWA 4J3XA 2G3IA 1D7FA 5M3WA 2VCCA 4AIUA 3MSDA 1K9FA 1GOKA 3B9DA 1B3YA 2WKLA 5AC4A 1D3CA 1QBAA 2WW5A 3WY1A 2DT3A 1QI3A 2BY3A 4MTVA 4P8WA 3QHNA 4JL2A 4UFMA 3PTMA 3RM8A 3WMCA 2VQUA 3PZGA 4MPKA 3W26A 3WNOA 3DYMA 2D0FA 1QNPA 2TAAA 1J11A 1JDAA 2YA2A 1E6PA 2WMGA 1MVYA 2Q8XA 4OOUA 4RE4A 2OYKA 1KFWA 1TA3A 2W63A 2CHOA 1LWHA 3AHZA 1VEMA 3VINA 1V3KA 4AD0A 3PBGA 1HNYA 3ARXA 1UH3A 1DWHM 4DUXA 4BQ3A 4AZ6A 1W1PA 3RILA 1CYGA 1V3JA 3PZ9A 3AS2A 1QPKA 5CLTA 2CHNA 1C93A 4EANA 2VNCA 1UWQA 3T09A 3ZT7A 4ACZB 4HOWA 3PZTA 2J7DA 4J3TA 2J62A 4PMZA 1J0IA 3GZAA 4U5IA 5E6YA 3POCA 1IZJA 3SCSA 3BCFA 2WVUA 1J0KA 4QDMA 2JEQA 4OIFA 3VPLA 4QAWA 1BPLB 3TP4A 2WHLA 3SCNA 1ECEA 3OLEA 2QV4A 1QI5A 4JFSA 2CITA 2QMKA 2WWCA 2WVTA 1JD9A 1AQ0A 3WD0A 3BMVA 4UQBA 2EPNA 3VM7A 1EHNA 2WKGA 1W3KA 1CENA 5D4YA 3WH5A 3MS8A 1BYBA 2ZUNA 4CN6A 5CPTA 5JIPA 3FXYA 3OB8A 2ZE0A 1M01A 4RL3A 1ISVA 1HP5A 3WDIA 1EO7A 1NOFA 2ZUUA 1B30A 4AD1A 5IFPA 3CLWA 4XZWA 3VDCA 3HJEA 4UFHA 2E3ZA 1KXVA 1J0YA 1UWUA 5A6MA 2PWHA 1HKKA 1GW1A 2A3AA 3W53A 3A4WA 4H8HA 2WMHA 2J7BA 2WCGA 3AZTA 4GQQA 4HU8A 1HJUA 4E2OA 1UWTA 3AHYA 1CLVA 5DT5A 2Y8KA 1WZLA 3CBWA 3II1A 1E5NA 1TG7A 2V3EA 3EBVA 7A3HA 2JIEA 3UG4A 1B3WA 1LL4A 2E0PA 3VMOA 3OLGA 1H41A 2J47A 1GVYA 3T0DA 4FF5A 1B2YA 5TD4A 4Z2LA 3VO0A 5BXRA 3WKZA 4XZBA 5E09A 4P7LA 2FHFA 1V6XA 1JZ4A 1JYWA 4P7RA 1ZL1A 3WF3A 1XD0A 4UTFA 3GBEA 1V0LA 2O9RA 2VCBA 1ZB5A 1JG9A 4H2CA 1C7SA 5GQBA 1DWGM 5ABEA 4DWSC 3K8KA 4AD5A 1GJUA 2F8QA 2PWDA 3E1F1 3VNYA 1QNRA 1DWFM 2OWCA 2ZXQA 2XVKA 3CZLA 5CLWA 1BVNP 3AMCA 1GUVA 2ZUSA 1ZJBA 1AMYA 1HJVA 4J28A 4UZSA 2XM2A 1KGUA 5ABFA 1XSKA 1UOKA 1OSEA 2CBUA 1E4LA 5I5RA 5HPOA 1CPUA 3VIJA 3WNPA 3A3HA 1OGBA 4C7GA 4PTXA 2ZX5A 2YA1A 3VIFA 3AZSA 4N42A 4TUFA 2YIHA 3VIOA 3FHAA 3WUFA 4U5KA 3WNNA 2WK2A 3WFZA 2ZX6A 2YKKA 4AZCA 1PPIA 3MUZ1 4EAMA 1V08A 1GOOA 3GTNA 3VNZA 3LPPA 3BMWA 3SUSA 3IAQA 4HMDA 4P8VA 2IXUA 4UOQA 1UD6A 1SMDA 3MO4A 3QHMA 4Z2GA 1E0XA 4FLRA 4W87A 3L4VA 1J10A 4AD2A 3M6DA 2W66A 4PMDA 1XCXA 4ZE4A 1UKSA 4TVDA 1FP9A 1D2KA 3AJ7A 2WMIA 1BYAA 3WEZA 2WCSA 2C0HA 4M24A 4JCMA 4AY1A 2ESCA 3GXDA 2YL5A 4H04A 4PMQA 1V6WA 5BXTA 3GBDA 4HOXA 4QFUA 1HJXA 3AMDA 2WZHA 1FOBA 4PCSA 1CIUA 5CGTA 1SR0A 1E6ZA 3WDQA 1UZ1A 2J7EA 2AAAA 2X2YA 1UYQA 3VVGA 1VFOA 1CTNA 4J7RA 1JAEA 2B31A 1G94A 4M82A 1RP8A 2VR5A 2G8ZA 1EOKA 3MU7A 5EBAA 1UQYA 2A3CA 4P8UA 1TMQA 4JAWA 2J79A 2WAGA 1G9HA 1M04A 4ATDA 3CIVA 4ZXLA 4HPHA 1O6IA 3WL0A 1MQQA 3WQ4A 1QI4A 1GOIA 4JZ5A 4KMQA 4UZUA 4MNJA 1QHZA 1H4PA 5CZKA 2XUCA 1NP0A 4J3SA 3IK2A 4W84A 3PN8A 3WF0A 3VGHA 1EDTA 6A3HA 1W9XA 2ZX8A 3AMLA 1XYZA 3GYCA 4MAVA 2BS9A 3TOPA 2BHUA 4JHOA 3B9AA 1ZJAA 2PWGA 1LWJA 1JFXA 1G0CA 3VD9A 4MDOA 3PZQA 1JF5A 1DP0A 3VDBA 1A3HA 4U33A 3U57A 1X6LA 4U3AA 3IJ9A 3GM8A 1OGGA 3SCVA 5BXPA 4PUEA 3ZR5A 3F5KA 1E9LA 1CDGA 4TVUA 3AFBA 3KL5A 4W85A 4S3JA 1QHPA 5CQ1A 3A4AA 4HMEA 1UKTA 1E1EA 4L4OA 3WH9A 1JZ2A 4AZBA 2PF0A 3AROA 3ARSA 3M7SA 1FHLA 1VAHA 4D6DA 2CIPA 3CUIA 1QW8A 3HU7A 4MADA 1VJZA 4E8CA 2XGIA 3RCNA 4OOZA 2WLZA 3K4DA 2X05A 5A8MA 4W7UA 1G5AA 2Y4SA 3VMPA 2WNWA 2ZICA 1ODZA 3ZT5A 2GJPA 1EH9A 1FHDA 2XVGA 3LMYA 3NIYA 2W67A 4PEEA 2NSXA 2WSPA 2BXZA 2XM1A 2DIEA 3AHVA 1F4AA 2CYGA 2QHAA 3FHQA 5A8QA 1GOWA 3VM5A 1UQZA 1F4HA 1PEZA 4GQRA 1V02E 1HIZA 3D5HA 1KCKA 1MW1A 4OUEA 2ZOXA 1GQIA 4OJYA 4IPNB 2PWEA 1KGXA 1BLIA 1B31A 4QLLA 2VZSA 4PBGA 4J3UA 1E4NA 2DH2A 4W7WA 2EO7A 2ZIDA 1EOMA 4BQ2A 2RGMA 3RJXA 1MWOA 3N1AA 3FY1A 4CUCA 3KL3A 4U3CA 1HX0A 2OWXA 4CCDA 4L4PA 5GNXA 4BCEA 4WKHA 3ARUA 2XIBA 3UETA 2BVTA 3ZJ7A 1V6UA 5JBFA 1OD0A 1WO2A 2UY3A 3VX0A 3SCOA 4X9YA 5CPQA 1HL8A 4UQ9A 3AIEA 2PBGA 4B9ZA 3BCDA 1HP4A 2X0YA 3OLIA 3IANA 5D8ZA 3ARWA 3L4WA 3WBAA 3W25A 2O9PA 1M03A 1KWGA 2EBNA 1K6AA 3MKKA 4D6EA 1M53A 4OBSA 2J25A 1O7AA 2YDQA 1OINA 3WUEA 2XSAA 3CUJA 1JZ8A 2WHJA 3LPOA 3AIWA 3B8SA 1KGWA 1WE5A 2QPSA 4GI9A 4B9YA 3BC9A 4ZFMA 2V5DA 5BYWA 3EDDA 1UH2A 1BFNA 2UY2A 1JD7A 2VTFA 1C90A 4MNLA 1C8QA 1J01A 4JFTA 4CU8A 4CD8A 3ZM8A 3FNDA 2ZUWA 3WQ5A 5D9OA 4TVCA 4PTWA 5A6SA 2UY4A 5I23A 1MXDA 3NDZA 2PBOA 4HA1A 3MANA 1ITXA 4D6FA 1JZ5A 3VMNA 4V27A 1E56A 2WMIB 2D3NA 3PZNA 1GCYA 4QCFA 2F61A 1RPKA 4MNKA 1YQ2A 1H49A 3DC0A 4CN1A 1E3ZA 2BHZA 4QCEA 3DECA 3LPGA 2PI6A 3AOFA 5DEZA 4JCLA 1UWRA 4W5UA 3GNRA 1BSIA 1Y7VA 3F5LA 1LJYA 1OM0A 1C92A 4WKAA 5I6SA 1PZ3A 1E6QM 1R85A 1CXFA 2YBUA 3GXFA 4WLCA 3ZSTA 2VL4A 3AS1A 4JKMA 4JHZA 5E0CA 5HBFA 4P7QA 2XFRA 2BY0A 3UG5A 1BF2A 3ARVA 1BVZA 2DEPA 1KCLA 4PSPA 2GDUA 4U31A 2JF6A 3PZUA 3BGAA 4NI3A 3VIIA 3L2LA 1QI0A 4LYRA 4B3LA 1HVXA 5DMYA 4QLJA 3UEQA 1PX8A 1ZBCA 4EK7A 4CD4A 3WENA 4FMVA 1CGYA 4TX6A 1ZS2A 3NYDA 1JFHA 1E6XM 1MQPA 2C7FA 3CZ8A 3EYPA 3SCTA 2X8RA 1C91A 3AIBA 4ZEPA 3UR8A 3ZOAA 1CGXA 2GJXA 3WDJA 4D1JA 2XVLA 1CEOA 3DYPA 1B3XA 2W4XA 1OD8A 3CHEA 3AXHA 3NSMA 5EMYA 5ABHA 3VD4A 1TUXA 4NZCA 2YOCA 4HA3A 3OGSA 4PUDA 4AZIA 1VBRA 1FH9A 1GQLA 1H2JA 1QW9A 1B9ZA 3WMSA 4HU0A 3T0AA 1EA9C 5DFAA 1OIMA 4OBRA 5A6AA 1H0GA 3CHFA 3VUPA 3WUGA 3QOMA 3N18A 1W2PA 1GOQA 3EDKA 1Z32X 5BRPA 3MMDA 1EDGA 3SCUA 1W91A 5DO8A 3WEOA 5A2AA 4F8XA 2NT0A 1CXHA 1BG9A 4MAZA 4ZE5A 3OGVA 3PZIA 4GI6A 2MANA 5I0DA 1W9PA 3T2OA 3W38A 1KR1A 3CTTA 1XCWA 5A8OA 4Z2JA 4NF7A 2G41A 4GI8A 4AWEA 2A3BA 1MW2A 4ZENA 4P7NA 1C7TA 1HN1A 2D20A 3EMZA 4TTUA 3WN6A 5CSUA 2Y5EA 3WEMA 5C70A 2DT0A 1VJSA 1LG1A 4W93A 4HA4A 4GZIA 4A4AA 1VRXA 3CH9A 2A3EA 1E6SM 1PAMA 2J7HA 2DGAA 2VO5A 2Z1SA 1JXKA 3WMBA 1ISZA 4DWSA 5A69A 1H5VA 3SCRA 4H7VA 2W61A 5FOOA 4PTVA 4MDPA 1Q6CA 3SURA 2CKSA 3T2PA 3AIUA 4H41A 1OWQA 1NOWA 2V38A 4TXEA 4W7VA 5JBDA 3S2CA 1E71M 2YL6A 3AXIA 1V3MA 3RDKA 1B3VA 8CGTA 1TVPA 2FGZA 1V3HA 4XUYA 2WB5A 3J7HA 1CXEA 4KGJA 3LPFA 4CGTA 3AYSA 3N13A 3N17A 3WUBA 1QI2A 1ZBVA 1V6YA 1JIBA 4AZ7A 3UERA 2G3NA 4FLSA 1Q4NX 5HXMA 5LA1A 1UZ4A 1WPCA 1SMAA 1JYVA 4AXNA 3SIMA 2QPUA 3KEHA 1J0HA 1HF6A 3A4XA 4W8LA 4YPJA 3VU2A 1C3FA 2WMFA 1W2VA 4MB1A 5I77A 3EDFA 4LQ1A 1SFSA 3DHUA 2XG9A 5AYBA 3L2MA 1V03A 4WIWA 1DWIM 4W8BA 3WH8A 3ZSSA 4NSBA 1J9YA 1NOUA 3G6LA 4A3HA 1A47A 2W5FA 1BTCA
chains in the Genus database with same CATH superfamily
1GVIA 1IT8A 1GQJA 2BVDA 3BG5A 2DUAA 2ZUVA 4CVWA 3NJ3A 1CGUA 3NPXA 4GO9A 2HXTA 2VD9A 2E8YA 2H3DA 2H3BA 2YLAA 3P2VA 5HJXA 3OBAA 1LLOA 1OADA 2ACUA 1GQNA 1JYXA 3NEVA 5FL0A 2ZX9A 2ZC8A 1M7PA 5F2MA 1IEXA 2WQDA 4AW7A 3QC3A 1YNQA 2CW6A 1UPMB 1JRBA 4QDWA 5ECUA 3TMQA 2NWRA 1Q45A 4BF7A 5HNTA 3LM3A 2QJIA 4WKFA 3QKEA 2D24A 1FA2A 3N12A 4MWAB 3PP7A 3EMCA 3F4WA 3OVGA 3PB0A 2YFNA 3A9BA 1ZP4A 4DJFC 4MB3A 4Q8VA 1QOXA 2YCEA 5XIMA 1TO3A 3EWZA 6PTDA 4AEEA 3W1LA 3EWCA 4H8VA 1WXZA 2ISFA 1VFUA 3T0TA 4IPLA 2A1YA 4JQ4A 2BG5A 4NZJA 4RNJA 4KRZA 1KBBA 2FLIA 3GW0A 3P81A 3VKJA 2VC7A 1UP3A 2FZ9A 3CB3A 1SM9A 3CLMA 2BVWA 3TH6A 3VIPA 4G7EA 4CQAA 1OC7A 1FQ0A 2OOGA 1RVKA 2VP8A 3WF2A 2ICSA 1NSJA 1QAPA 1Z9AA 2E1WA 4UFIA 4EXQA 3S46A 1SO6A 1AJ2A 2BVYA 1B57A 5JBEA 2DSUA 5REQB 2WJDA 2HTMA 2O9OA 1W3TA 3RMJA 3AIQA 4DF1A 1TJ1A 2OXNA 3ZT6A 4PCPA 3T7VA 2QDEA 2EG8A 4LPCA 1E15A 1KCXA 4PTMA 1WBJA 1VFMA 1SZFA 1UC5A 1J6OA 3QR1A 5EB8A 3QGVA 3PM6A 1L0PA 3SSJA 3ZJKA 1V02A 1NWTA 1U1UA 3ARZA 1LT8A 4GUHA 5CC3A 3S2MA 5C2GA 1N8FA 3UZJA 4DZAA 1VBUA 4BQ4A 3A4JA 4GY0A 4G8TA 1J96A 4FNUA 4O4VA 3PTDA 1LRTA 3L4XA 3L5AA 3MCMA 3UWZA 2VI0A 3N14A 4V1XA 1K8XA 2BX7A 3G3DA 3IACA 4ALDA 2DT1A 4HCDA 1RLCL 4C6LA 2NW0A 3IPWA 1UD3A 2XGBA 2VGFA 3R0KA 3S6TA 2PB1A 3TWBA 3ZQ9A 2J13A 2EPHA 4CQ9A 4PMNA 4YHEA 3F4VA 1SJCA 5FF0A 2F6UA 1ZUAX 3G1YA 3BAYA 9XIAA 3GIYA 3O0FA 4IMEA 5FF4A 2XH4A 2QUUA 2DIKA 3AXXA 4JFVA 3BV7A 3MZNA 3USBA 1OX6A 1UHVA 1PZ1A 4ZFCA 1CXLA 5D9NA 1ZU8A 2BFGA 2YA0A 5XINA 4BWLC 4O57A 4GJJA 1J12A 3WNKA 4UTHA 3DHFA 1XH1A 4EF8A 2BHYA 3PPHA 1GJPA 4HSOA 1TR1A 1XS2A 4JTEA 4XBJA 3CQ0A 3UR2A 1OY0A 3OJGA 4PSRA 2VFDA 4O1CA 3DI1A 2I56A 3LZ3A 2YL8A 1RQBA 4Q32A 3KDOA 2OTDA 2NXGA 1KFBA 2WNZA 4C6CA 3ECQA 3W29A 1JF6A 1NDWA 3B8VA 5GNYA 2DUZA 4QG8A 2BB0A 1WP6A 1S46A 1UW9A 3IGSA 3AI0A 4XZMX 3G0XA 1KM6A 3JR2A 3SO7A 4LALA 3QBUA 3ANYA 3FA3A 3QR3A 4Z0JA 2BXYA 4I9MA 4F9DA 2IMRA 1J0JA 3AIVA 4UR9A 4Z2HA 1K02A 1L2UA 4DM1A 2TMDA 3WLIA 1A0EA 4IPJA 3S2LA 3STPA 1MUMA 4BQ5A 2EKGA 3HPFA 4LF2A 1E70M 1E0TA 2HNEA 2D22A 3LMZA 1BHGA 1P0DA 4HK7A 4CQBA 1YBQA 1EJ7L 2NUWA 1PIFA 3W0KA 4PCTA 3QHOA 1FCBA 1UA7A 4NXKA 1T96A 4IGHA 2HV5A 2YCLB 1A5LC 3O2LA 2XJ7A 3PBUA 2HEJA 4MY9A 1FP8A 1EZWA 3C0QA 4LF1A 4QP0A 4HCLA 3GDKA 5IOBA 4HD5A 3EWWA 3L4ZA 4LVBA 3NFUA 1GNXA 3PR2A 2BGQA 4D6HA 3A13A 2BMBA 4YTTA 2D2HA 3QQ0A 3GH4A 4KPLA 3RPMA 3U5UA 4UQCA 1HTIA 3FA5A 3VTRA 3M46A 1UD8A 3AHXA 4H00A 3W1PA 3L4YA 1NWRA 1FFQA 3CIXA 3GVRA 1BGGA 2PCEA 3U2OA 3G8RA 4TX9A 3KS5A 1TV8A 1XRTA 2HDJA 4ZQCA 3WELA 4JTKA 4YJ5A 1KLYA 3AXKA 3QW4B 1UP2A 2VDHA 4QQ3A 2WZEA 1NFBA 1J0ZA 1BRLA 2W9MA 1HKJA 1XC6A 1E43A 3IAPA 1NM9A 1PBGA 4GKTA 1R87A 4D9PA 2XTKA 3BDKA 1BQGA 2PRLA 3WD1A 4JGDA 4U28A 3W7QA 5I3IA 1CX9A 1S3TC 4J5NA 1PJ9A 1Z89A 1M41A 1TQJA 4FPSA 2CEQA 4NX5A 1R3WA 2DQXA 3NQEA 3EWDA 2BOFX 6XIMA 1BYDA 1PV8A 2GJRA 2ZZ6A 2J66A 1DJWA 5BZAA 3VOHA 1DL3A 1G1YA 3PHAA 3RM4A 1SYTA 1FDYA 3BCJA 2PE4A 3VZYA 4HN4A 1DJQA 1AH0A 1NFPA 5F2GA 1ITQA 4IQDA 3ARRA 4K2SA 1ITCA 4UIOA 2CWXA 5HNNA 3C2OA 4DPQA 1TZ7A 2QYGA 5FF7A 4Q8MA 1XPGA 2VT0A 1CXIA 4FOKA 1P4CA 3HZ3A 2PDWA 1S2UA 3OIHA 1MQRA 3GG8A 5A3HA 3PFMA 4GOAA 4R9OA 4EE9A 4A3YA 3UCCA 3ZVHA 4H9TA 4R85A 3FYYA 2VUYA 4RE0A 4CNOA 1CZ1A 2QPXA 1OT2A 1B5TA 3GW3A 2GK1B 1W1IE 4JNYA 2VRKA 5AYIA 4IIGA 1OT1A 1PX4A 2OQHA 1HXJA 1TV3A 2Z25A 5HK4A 2WQPA 3ATYA 3WDPP 2E77A 3VNMA 2W91A 2B7PA 4F0MA 3QGKC 3T0BA 4KKXA 5AY7A 1AK5A 1W17A 3GB6A 2QJNA 3NSXA 2CXEA 3ABZA 3CUHA 4YCPA 3GU1A 3DFSA 4JFUA 4JTSA 3G6MA 1A0DA 1JDFA 1CCWB 4HT3A 4WXYA 4QXIA 3TE9A 8A3HA 1RH9A 1VKFA 1XYBA 1DTUA 1VIZA 5EFFA 3KBWA 3L21A 2BSLA 3LGEA 3WIJA 3H26A 5B7ZA 2VEIA 5T26A 1PKMA 4DO6A 2YB4A 1THFD 1VFSA 4C6OA 1MNSA 3U48A 2WZTA 4GH1A 2FB3A 1VEPA 4NKCA 1JI1A 5I03A 3VABA 4BEQA 4LUJA 4B5XA 1ICPA 1JPKA 1SGJA 4IP4A 3HGSA 2F6XA 3UP8A 5DCDA 1VEOA 1E3XA 3N11A 3T40A 4AHQA 3H54A 4ILSA 1SZRA 1EGMA 3GR4A 2OZ8A 4LYQA 4CN4A 3DFQA 4IMGA 3TK7A 1I1XA 4WEVX 2C1GA 1KM3A 5PTDA 1W5NA 1W1ZA 3P8JA 3B9NA 2OYLA 1W9UA 4BS0A 1JNEA 2YL9A 2ZZ1A 3L12A 2QUNA 1MZHA 2ZZ7A 1GHRA 5H2ZA 4D8AA 1X1OA 3LNPA 1QATA 3F7JA 5HATA 4ERGA 3P93A 6REQA 1EYWA 3VKBA 4QLKA 2WVVB 4A8IA 4HZMA 1BQCA 4ZB2A 1C9DA 3BQ5A 1ESWA 2RDUA 3U8GA 3GNOA 1UR9A 3K46A 3PS7A 3NAVA 1KXHA 2WCAA 1DHPA 2UY5A 1Z41A 4TR9A 2QS8A 3R2GA 4MPQA 3WLPA 3UJEA 2OELA 1ISWA 1NQ6A 4FLOA 1G4EA 3PTQA 1YDYA 3S83A 3BUVA 7ENLA 1QPOA 1WZMA 1AL7A 1VHNA 2ZBTA 4TU1A 3FAWA 5LNSA 3ISIX 4WF7A 3UJRA 4PMRA 2XYLA 1E1FA 4AVFA 3WLSA 3NPUA 3R4IA 1QWGA 3WQWA 4IMCA 3LI1A 1OFDA 5D9PA 4B15A 4UNIA 4BZYA 1S1PA 1ODUA 3KOZA 4W88A 4XD4A 2I9EA 3LDVA 4BF9A 3WDHA 4DQWA 3QY6A 3VKAA 3FA4A 3CASA 3M9YA 2CLHA 3KX6A 1QJWA 4S38A 2E9MA 2NV2A 1YPIA 2PC4A 2D0HA 2Z7GA 1P0BA 1Z8AA 4O15A 3IRSA 2WSYA 1A53A 4DUVA 1OB0A 2DZTA 4MFDA 1IGSA 3VDAA 5IFTA 1XG3A 2YZRA 2Y8UA 1MEWA 5KZMA 4JICA 4IISA 2PP1A 1W37A 2YCIX 5FJUA 3C0LA 1W1YA 2NXHA 4UQAA 2CC0A 2QJMA 4LBSA 4YIWA 1TA3B 4UTWC 2I14A 3KCOA 2X42A 3W7JA 1DV7A 1UD5A 1UR0A 2ZX7A 4PUJA 1Q8AA 2CPUA 1O68A 1KB3A 3LCLA 4Q3MA 3THCA 3F4NA 1IIHA 3D47A 1P7TA 3K5XA 4FR6A 1TIWA 4L56A 1XCFA 3ID7A 2ANUA 1DJZA 3N9KA 3CUZA 3B40A 1AW5A 4GYFA 1XFCA 1UKPA 2O9TA 3D46A 3U4FA 5AKQA 1IIGA 3TJIA 9CGTA 2Y8VA 4M7SA 4M6QA 2WWDA 3WD4A 3A3XA 1PWMA 3KCLA 4GGHA 4I7WA 4HPGA 1E9YB 3NZPA 1QT1A 1V79A 4LC6A 4A6GA 4JPGA 3RJYA 1G4SA 2WC4A 3O8AA 2PEVA 5K9XA 3THAA 4XZIA 4LRTA 1CW2A 1KM2A 3L4UA 8XIMA 4X61A 3PJWA 1K77A 5EMLA 1WDQA 2PDPA 1W8SA 3ANUA 2XIMA 3CMFA 3USZA 1VGAA 2CERA 2VR4A 2V3FA 1Q6EA 3LQGA 3BW3A 5BROA 1MFVA 2IXVA 3CQIA 4NAFB 4REQB 3URBA 2YDSA 4E5TA 3LXCA 2PRHA 1GTEA 2OODA 1TIMA 1V3LA 4Q7IA 2YJQA 5FJPA 4ZMGA 5ENLA 3AS3A 3W4RA 2PDNA 5JIWA 2ZADA 4J3XA 3T05A 2F9RA 2VCCA 4AIUA 2O4MA 3MSDA 5LNRA 1H5YA 2DORA 4JIHA 4K8GA 2D69A 5AC4A 3W1NA 1RA5A 2DT3A 1QI3A 4O14A 4P8WA 4JL2A 1P1XA 4MPKA 1IXPA 3G3MA 3UGVA 1E6PA 2WMGA 3NQAA 3FGCB 4RE4A 4OOUA 1XGDA 2I17A 2GVEA 1KFWA 3VFCA 3D6NA 2W63A 2HMCA 4Q8TA 4GHRA 4AD0A 2PRMA 2BXVA 4K36A 2QJJA 4BQ3A 1PTGA 3M5YA 3IIZA 2A3LA 3CEUA 3N3MA 4X3ZA 5I00A 1QPKA 2CHNA 1QU4A 2VNCA 3T09A 3ZT7A 1WBHA 4ACZB 2J7DA 2J62A 3ICJA 1J0IA 4GVFA 3GZAA 3UW6A 5E6YA 2YBVA 1RJRA 6XIAA 2F38A 2WVUA 3MJYA 3HO8A 1J0KA 1ME8A 3TVAA 1BPLB 3ITTA 4LCSA 1XLKA 2WHLA 1E1CA 3KBJA 3UNTA 1B9BA 2FKPA 2QV4A 4JX6A 5DMNA 1POKA 2CITA 3MHGA 1JD9A 3P62A 2EPNA 1ZGDA 5BMWA 1EHNA 1EP2A 1TPVA 2WKGA 4JXCA 5LNUA 1W3KA 1C29A 1ZCOA 5D4YA 1FRBA 4NYYA 2QZRA 5C6MA 1ALDA 3W87A 5I09A 5K7JA 2A7NA 3NGJA 3S1GA 3CAKA 4XO6A 2PZNA 4NIRA 5IFPA 3CLWA 1NDYA 3R94A 4FXSA 4KCUA 1MDRA 3KVLA 1OFEA 3EX2A 4AH7A 5FEXA 1Y5WA 2PWHA 1HKKA 3EKGA 3DEQA 4PODA 3W53A 4GH3A 3VUSA 4CEUC 3E0WA 3GC5A 3B0VC 2GVGA 3PJXA 4AFYA 4QTGA 1YNYA 3UZZA 4L5ZA 1AD1A 3II1A 1TG7A 3B0XA 3W6YA 1RAKA 7A3HA 2JIEA 3UG4A 3VMOA 2R1LA 3UQNA 1I2PA 4LAKA 4FF5A 3UT0A 5TD4A 4Z2LA 2ZRWA 3VNKA 3UWEA 3M0JA 1ZRQA 3QPEA 4OWGA 4GVGA 1JZ4A 3H12A 4HPNA 4FSAA 1V0LA 2O9RA 3GVWA 3TDFA 1L6YA 2YFOA 1C7SA 3OP2A 3MBFA 3SN4A 5I07A 5I06A 3EOUA 2F8QA 2PWDA 3E1F1 4ORMA 3VNYA 2KX9A 3QVQA 1DWFM 2ZXQA 2NQLA 2XVKA 1XFBA 4AF0A 4H7ZA 5AC8A 4J28A 1IXQA 4UZSA 1ZLPA 5C9RA 5ABFA 4XZHA 4RXGA 1OSEA 2CBUA 3S5ZA 1LBLA 1E4LA 4GYPA 3R0UA 2VGIA 1ZFJA 4G9PA 2CZ5A 3WNPA 3LI0A 2Q3RA 4AVNA 1HZYA 4RPQA 3WG6A 4FIQA 4N42A 1GKRA 2CZFA 3GG1A 3VIOA 4U5KA 1LOQA 1YNPA 1JCYA 5AFDA 3MUZ1 1AZ2A 3P7YA 3CL6A 1F7BA 3VNZA 1R3VA 2FIQA 4UTMA 1EJUC 2FPVA 4P8VA 1KTBA 1OABA 3PUGA 4C5ZA 2V5LA 4D8LA 1YYAA 1JVNA 5EGRA 5DLCA 3OBKA 4RDYA 5FACA 5AHFA 1J10A 3H2OA 1BSLA 1XCXA 2KAUC 1UKSA 1PDZA 2WMIA 1BYAA 2AQOA 2Y5SA 4FX6M 3GIQA 2QEZA 2C0HA 3W2MA 2C1HA 2ESCA 4A2SA 4MFEA 5FSEC 3R0DA 3GBDA 1HJXA 2WZHA 1CIUA 2REQB 4LRSA 1E6ZA 3WDQA 2AAAA 1WXJA 2X2YA 1UYQA 1VFOA 2B31A 3K1GA 4PRRA 1RP8A 2G8ZA 3MSYA 1Z44A 5AVHA 1TMQA 3HGJA 4JN8A 2J79A 1IWPA 4ATDA 4HPHA 1UPPA 4WGXA 3WQ4A 4HTBA 1YXCA 4MNJA 1A5OC 3V0TA 5LGXA 2XUCA 3IK2A 4HU4A 3PN8A 3VOIA 3TYEA 3VGHA 4S3CA 2BHUA 3O1NA 4JHOA 3B9AA 4OGZA 3ITCA 4B92A 2PWGA 1TJPA 4MDOA 2W3ZA 3W7OA 3PZQA 1SJBA 4HMNA 2QV5A 2RKXA 2ZVRA 4GISA 4FAMA 2Z28A 2V63A 3QSRA 4PR4A 3TJXA 5HJLA 4C1NA 3YPIA 4MUPA 4MGGA 3B0PA 5DX7A 3LY0A 5JU6A 4PUEA 4BF5A 3GUGA 4MWAD 3TA6A 2VEPA 3LLDA 1LRQA 2EAWA 2Y61A 2V5BA 4K1GA 4F0SA 7PTDA 1UKTA 1E1EA 4KCTA 4L4OA 1EF2A 3WH9A 4ICCX 1GVFA 2OQYA 5LHFA 2PF0A 1KLZA 3FV9A 3I65A 3WQDA 1VAHA 1M6JA 3W02A 3HQNA 4GFSA 3HMJG 2X7VA 2WLZA 2REQA 3K4DA 4PZVA 4XBSA 1HL2A 2ZICA 4A8LA 2Q8LA 1ADOA 4Y9OA 4FOUA 4L9YA 2W67A 1YTDA 4PEEA 1E51A 1ZY9A 3TCSA 2WSPA 4LB3A 1DJHA 1JUKA 3MUXA 5A8QA 3SN0A 3IJ6A 2G97A 3ORWA 3GAYA 4KT2A 2JQXA 1KCKA 4IX2A 1GQIA 4L7ZA 4LAOA 1EUNA 1TREA 4MJZA 3FX4A 4GIEA 3L7RA 3W7IA 2EO7A 4RNIA 2YPIA 1OYCA 3N1AA 4A22A 2OZ3A 4CUCA 3W1AA 1ADDA 4BCEA 2XIBA 3UETA 3JZUA 4Q8OA 2AKZA 1PB0A 5JBFA 2UY3A 1DXFA 2VUNA 3N3TA 4X9YA 4N02A 3BMXA 3SQLA 4C6QA 3GKFA 4UR7A 1HP4A 2X0YA 4XKMA 2CLIA 1KTCA 1I2NA 2EHHA 5MF5A 3WBAA 1M03A 2EBNA 4A3UA 1M53A 1TSIA 1GOXA 1O7AA 3LCWA 1PTDA 2HNHA 2WHJA 1AUSL 1LYXA 3AIWA 4F3HA 5EMUA 3FDGA 4GI9A 4B9YA 5JH1A 4ZFMA 3KWSA 2OGYA 5TNVA 1BFNA 3FS2A 3QQ1A 2VTFA 1C90A 1AODA 3SECA 4WRHA 4JFTA 2EG6A 4CD8A 2A79A 2RFGA 3EX4A 3EAUA 5F1VA 3GD6A 2ZUWA 3WQ5A 1IXOA 3W7GA 1FUYA 3QZEA 3STGA 2PBOA 4D6FA 1ITXA 1JZ5A 4YWIA 2FPYA 3TXVA 1OQFA 2WMIB 1FHVA 3NZRA 2B7QA 4MNKA 2AKMA 3OU8A 1ZP3A 4DXXA 3S2NA 3BOLA 4RR4A 4PTNA 4B3ZA 1YX1A 3V7PA 4ZTXA 5DEZA 2FDSA 3NO1A 1M68A 4JYEA 4JCLA 2JKPA 2V2HA 4WDWA 3C8NA 5I3KA 5I6SA 2BDQA 3KW3A 1XG4A 4IQJA 1TTQA 3PFRA 3V36A 4ZZ9A 5LIYX 3JU2A 9XIMA 4HPJA 4HU3A 1XKJA 2J6VA 4DNMA 3W76A 1H61A 2R82A 1REQB 3MY9A 2BY0A 3UG5A 1EJSC 5AZ0A 1BVZA 2DEPA 3GC2A 3GDMA 3VIIA 4GVHA 4AWUA 1QI0A 4LYRA 4B3LA 1R3RA 1HVXA 3FVDA 1YDOA 3E2VA 4WR3A 3APYA 1AW1A 4X60A 4ONVA 1MQPA 5TAOA 1CGXA 2GJXA 3DERA 3GTFA 4YNGA 4GACA 1UIOA 3LNMA 3AXHA 3F1QA 1AJZA 1BKSA 5EMYA 3WFAA 2QCDB 3LGGA 4PUDA 1QDSA 1EX1A 2HE5A 1H2JA 3NOYA 5LHEA 4MYAA 3E6EA 1P43A 1EA9C 5DFAA 1OIMA 4OBRA 5A6AA 2NVDA 1TPWA 3E2QA 1GOQA 1XIMA 3T4CA 4I8YA 3MMDA 1EDGA 4ZB5A 3SCUA 4AX7A 5DO8A 4K8HA 1CXHA 4ZE5A 1S2TA 3W75A 3VCRA 2GOKA 1W9PA 4PBFA 4R88A 4H6RA 8XIAA 3CTTA 3NVTA 4KEVA 3C4UA 5ECVA 5A8OA 2DZBA 3O3RA 3P0WA 2A3BA 4ZENA 1VZWA 3DBNA 5FSDC 2YSWA 3EMZA 4HKPA 1AMKA 2I9UA 4HSHA 5A8GA 4A4AA 2OZTA 4Z0SA 4P5UA 3R79A 2DGAA 1ISZA 4IICA 5A69A 2AGKA 4MDPA 5LIUX 1Q6CA 2P0IA 3SURA 3CTLA 4IP7A 3FKKA 3W7MA 4TXEA 3APTA 4W7VA 3Q58A 5F2LA 5JBDA 1H7NA 2YL6A 4NNAA 3RDKA 4MVAA 1RQHA 1LT7A 4UNKA 2WB5A 3J7HA 2CU0A 1RCOB 3B04A 1R38A 3WUBA 1QI2A 4H8NA 1V6YA 2YB1A 5EMJA 1EX5A 2QCGA 4PUNA 4FNSA 4N9CA 1FWTA 4AXNA 3SIMA 3V5OA 3A4XA 4K8EA 4ADUA 1EEPA 3VU2A 4XTIA 1C3FA 3L67A 4JQAA 4IMAA 3DI0A 1DJIA 4G2DA 3GDRA 4HJWA 1M5WA 4RZ6A 2PMQA 5CC5A 1FTXA 3WH8A 2Y5JA 2G3FA 1W5PA 3G6LA 3M0HA 1A47A 2YXXA 3TN3A 2W5FA 3UR8A 3DENA 1EIBA 4J27A 1NWSA 2D23A 3ARTA 2ISVA 4HJFA 2RUSA 5CPLA 4JTRA 1W9DM 4YTQA 5HWJA 3D3AA 1E40A 1OK6A 3OVPA 3FEQA 3AJXA 3EKLA 4V28A 5K9DA 1H7OA 1FWDC 2DPEA 2V30A 2DSKA 3T9PA 1NDZA 1RD6A 1JCMP 5HMDA 3LYEA 4IIEA 4YN5A 1J2WA 4GJIA 1FKXA 3KOFA 4TX8A 2JKEA 1U1HA 3M4HA 3G2GA 1P48A 2EXOA 3LCHA 3QQWA 2Y2WA 3TYAA 3W24A 3JVAA 3SB0A 3P14A 3EEGA 2C1IA 2VVNA 2I5GA 3M0ZA 3DESA 2GJXB 1GJWA 2Y89A 4IJBA 1G6CA 1TZZA 2DV0A 3TONA 3MP5A 1F6YA 2YDAA 3S1VA 2XVPA 1P0EA 4AY8A 5DANA 3NQBA 1W56A 1NH6A 4UFJA 1GVOA 5EFDA 2FMNA 4LS2A 3OA5A 4WJXA 1FWWA 1OX4A 5M1TA 1NIUA 5G2HA 1R9ZA 4C6DA 5HQMA 3P5YA 1B1YA 1VS1A 3BAXA 3ITOA 5CKSA 1VB9A 1CLXA 3O06A 1R9XA 4PCNA 3MHUA 3N15A 4JN6A 1YADA 3B8UA 3BL3A 4Z42C 4QM1A 3IVSA 4MJ2A 5HNRA 4S23A 4UB9A 1HW6A 3TNBA 2RDXA 2Y62A 3VC5A 2VVSA 1HO1A 3W70A 3QYSA 4WJEA 3LRKA 1EQPA 3UYIA 3P80A 2ZCGA 4KIRA 4Y9MA 2B0MA 3AU6A 1E0WA 1CI1A 4JDYA 1FXQA 4AC1X 5BCAA 1MZRA 4E3TA 4IZGA 4NJIA 1XBVA 3M7WA 3WBEA 4Y8EA 1PIGA 3U2ZA 1NWUA 3CWHA 1KKRA 2CLKA 2AQVA 1UZHA 2WZMA 3BG3A 4ENLA 2OQLA 2E1DA 1EB3A 1A5CA 4C6PA 2ATSA 3BH4A 4YTRA 3TQPA 1ZJHA 2ACQA 2NV1A 1IV8A 3RLUA 4IGNA 2ATMA 2WANA 3KZSA 4JTQA 1UG6A 4PMOA 5LYRA 2Y24A 1VCVA 3N34A 4DZIA 3MCOA 2BY1A 1A80A 3LXBA 2J77A 1KXQA 1OFBA 3L23A 4QHRA 4I9TA 3SFWA 1RY0A 1S2AA 2PTZA 2PDMA 3SI9A 4YHGA 2Q3OA 3N9RA 3UXDA 1YPFA 3OGRA 4A8NA 3GXPA 3HGRA 4AX6A 4HCHA 2PAJA 2J27A 2J8GA 3WH6A 5AN7A 4WJ8A 4NI8A 3UESA 1H7XA 5CC7A 3S5YA 1MFUA 4A8RA 5C8BB 5FEZA 3KBNA 3N4FA 1XYLA 1S5MA 1R3QA 1DORA 4KRUA 1E5JA 3O16A 2EPLX 1JDCA 5CGMA 3WD2A 3WH7A 4Y9AA 4DWSD 3W01A 4LVDA 1EGVA 4FK9A 5A6TC 1TVNA 3GR7A 3CB8A 4A2RA 4ZO8A 4Y6GA 3I10A 3H4GA 3NQFA 4LXFA 3C52A 4JQ3A 2D3LA 4DWDA 5JUVA 1EJWC 4NZ3A 1UR4A 3GVVA 3HG3A 5FAJA 4R27A 5HMEA 4KH2A 4FLQA 3VE9A 4HHHA 4S39A 2DQWA 2UWFA 3TQVA 4ES4A 1OCQA 2B7OA 1LOSA 4ML4A 5BW6A 3NDYA 1SSDA 5IHRA 5HR6A 2XH0A 5A5WA 3U5YA 4O11A 1GW9A 3U4AA 1TELA 3AZRA 1H3GA 4YTSA 3CL7A 5FD0A 3GXIA 3TYUA 3O0KA 2XIQA 3WQPA 3QSTA 3D0CA 3UVIA 3W27A 2XFWA 4JOMA 1KNWA 4N0RA 4GPNA 1AVAA 4PMJA 5CJ5A 3VGFA 1YMYA 3G1HA 2WZIA 4WCJA 3ONBA 1N8WA 1NARA 2WXDM 3AQUA 1GZ1A 1X1ZA 3BGJA 3GK0A 5FIPA 1NAL1 3AHTA 3OBEA 3LTPA 4S3FA 2GGGA 3B4UA 2WV8A 3VGEA 4XV0A 4MB5A 5DF0A 4QBXA 1WDDA 1KM1A 4CU6A 4HP5A 1PS9A 3KCJA 1XH2A 3IJ7A 5BXSA 4MY8A 2FVMA 2HRWA 1N55A 4A29A 2IPGA 2VFEA 2W0UA 2E5BA 2EPOA 4M56A 5CSSA 4O1DA 1UB3A 5DRCA 1F9CA 3P8IA 4HNOA 4ZXOA 4Q33A 3SSZA 1US0A 3CT2A 4PN2A 2FH6A 4BHYA 1EC9A 3VAVA 3NM3A 4RXFA 1CXKA 1VYRA 5FESA 4PMYA 4S3AA 5A1AA 1RA0A 6ALDA 3S9ZA 3GDTA 1D3HA 1TRIA 1SO3A 2V67A 3KVKA 1TCDA 1TV7A 3T2QA 3BAIA 2EJAA 4G1NA 1V0MA 3CUGA 1Z42A 1TJ2A 3OEXA 1NELA 2FH8A 2OO0A 3RM9A 3MUY1 1TMLA 2CBJA 1FX6A 2FZNA 1BYCA 2V5CA 4HQVA 4KWWA 3TN5A 4E4UA 3JZEA 4Q4RA 3EMQA 2WMJA 1V3IA 1Z7AA 1VC4A 3DUGA 4DB7A 4E4FA 4KWVA 3WLOA 2WKJA 1KRAC 4HHMA 2DVUA 3A22A 2VEFA 1GG0A 2AMGA 2OVLA 2NQHA 3SAZA 1OVDA 1QHOA 2HS6A 1CECA 1LUCB 2GGEA 4LUSB 2EPMX 1Y5XA 3ZMRA 1R86A 3AMGA 4M3PA 4LU0A 4W9TA 2DFAA 4DIAA 5H8UA 3QGAC 3V3WA 4Y7EA 4X9SA 4MNMA 4JBRA 4I90A 3VGDA 3NYZA 4GC4A 1EL3A 2VC5A 4O54A 1E4MM 1QNSA 4CD6A 1PZ0A 3WCZA 3QF0A 2Z0IA 1XLMA 5KETA 2E6YA 3UR7A 5AYXA 3MTWA 2WPBA 4WY0B 3IJDA 2ZQ0A 3ALGA 4IUGA 3EOLA 5A6BD 1K8CA 5AHNA 1KKOA 3TLQA 1XH0A 4GRSA 4Z08A 4O8RA 3I6EA 2IQDA 4DJEC 3IVUA 4L1GA 3BK0A 1DQXA 3I3BA 4NT0A 2QW5A 4O17A 5I2UA 4KGLA 3NR0A 2XHYA 1JZ3A 4CD5A 2V3DA 1QNVA 1FWGC 3BGGA 1KFCA 2NVAA 5CXPA 1RVGA 1OFOA 4BK9A 1F5ZA 4GUIA 3PNZA 1DHKA 1HVQA 2X09A 1HJSA 2CKRA 3UG3A 1V5XA 1F05A 4FI4A 3HGOA 2WMKA 4GNJA 3W81A 4ZVJA 3SFKA 3QZ6A 4GYKA 4LJ3A 1ITUA 4M1RA 3VD5A 2JKAA 4NY2A 3N9SA 1SW3A 3VDGA 5F4WA 4XAYA 2V81A 3MZ2A 1MNZA 3MSGA 1H60A 1IT0A 3A3WA 4KESA 5G2WA 4L64A 3WO8A 4H9XA 4DXKA 5M03A 2A5HA 2VZUA 4AAJA 3GNXA 3SN1A 1GZJA 2PGFA 4RNHA 5A2CA 3PPGA 4DO4A 4BA0A 5JH2A 1XLEA 4IXHA 4UQEA 5A95A 4E2BA 5D2TA 3GVQA 1R46A 3LCFA 2O92A 2HVOA 1NF7A 4HBKA 1KW1A 4N9BA 3HJZA 1UD4A 3TUUA 4MUZA 4LUYA 3C3NA 1PKLA 2PLMA 4W8AA 3W23A 5HULA 3UXKA 4DPPA 4TMBA 1I4NA 1R7AA 2QUTA 2DY3A 3CQHA 2PZ0A 1WCGA 3NZGA 3NO3A 4RPPA 3ES7A 3PZMA 4MZYA 5I24A 6CGTA 4AMCA 2RDWA 1RK5A 1XUZA 4QIUA 2XFYA 1WV2A 2PDXA 1FH8A 1X6UA 2JF7A 3ARQA 1JXJA 3BLPX 2HPIA 4DJFD 4O50A 5CPNA 1MYRA 4LNCA 1G69A 3TTYA 3FFSA 2E4TA 4C1LA 1FWEC 1E4IA 1K3UA 1AA1B 1R7OA 1QXLA 2FYMA 2VZTA 3UCQA 2Z1KA 2VMFA 3NVDA 1V0KA 2GUYA 5CJMA 1WUFA 5T9BG 4E8DA 1KM5A 2BY2A 3N2CA 3TROA 4L4MA 1A4MA 1VCGA 3WNLA 3IJQA 2J9YA 1P0NA 1CGWA 2VEGA 2GVYA 3T08A 3VOFA 3H23A 2GSJA 2QMJA 1B90A 3NL3A 1R9YA 2XIOA 5G4EA 4C1NB 4NX0A 3CHCA 1PUDA 5CSRA 5KZEA 2JIWA 3SDOA 3S1WA 2E25A 1ONWA 4O1BA 3VX1A 3TEVA 4S3KA 2GWGA 7ODCA 5TBOA 1AG1O 3SRHA 3NQCA 4IJRA 4S3DA 1BD0A 4C1KA 3AISA 4UCFA 2A3HA 1KBKA 3WL1A 1RZMA 3PULA 1PYMA 3T0CA 5J5RA 1OCJA 4HZ8A 4GZJA 1HJWA 2DH3A 3NUKA 3AS0A 4GE8A 4G7FA 4V1YA 3V1HA 4AD4A 4GO8A 3I3DA 4R3UA 4GQBA 2PP0A 3NQ8A 1FY6A 4MYXA 2J4GA 1RBAA 5FKYA 1EA0A 3B8IA 3E96A 3VILA 4IGMA 3PK7A 3ZR6A 3B05A 4MY1A 3DYOA 4M0XA 1UR3M 3G5EA 1US2A 3GNPA 2WBGA 4MLJA 1MEHA 5C54A 5TF0A 1WB0A 4F79A 1E6RA 1KR0A 3MWAA 4CLMA 2YYTA 3TTOA 4C91A 5C71A 3DCPA 3W82A 4M29A 1GQKA 1BWKA 2WBKA 1TX0A 1F74A 2ISSA 3A23A 1NVMA 1WOBA 1YXDA 1XV8A 4W86A 4CNPA 2ACSA 4J3VA 3BJSA 1BGAA 3F4CA 4F48A 3KP1A 4B4HA 4A3QA 1GWJA 2XZ7A 3G0UA 1S3HA 3Q45A 1FCQA 4EACA 3LBMA 2P3ZA 3HG4A 4LB4A 4NNCA 3APGA 4PGLA 5T8GA 3A47A 3LUTA 5FCZA 1REQA 2ZWZA 1NEYA 2JEPA 3PJUA 1GYLA 3RX2A 1GHSA 2WLYA 4X22A 4US5D 3C8FA 3E9AA 5TIMA 1K1DA 4IMFA 4NZFA 3SRKA 2FZDA 5CG0A 2C19A 1EGZA 1F3WA 3GTXA 1BRLB 1UWIA 2OO6A 1R8LA 2P8BA 1H1YA 4F2UA 1I0DA 1ELSA 1KXTA 4DLFA 1PKNA 4GCXA 5CJNA 3MVTA 2PDJA 1DJXA 4LYPA 1T41A 3M07A 3HG2A 3F2CA 1UROA 2G3IA 1D7FA 2GL5A 3VK5A 5CZSA 1K9FA 3NQ2A 3WQCA 3ZLGA 4D8ZA 3G77A 3V18A 1D3CA 1JULA 2WW5A 5HMFA 4GXMA 3QHNA 2XH2A 2FMOA 3RM8A 2VQUA 1I2OA 4K37A 4YWSA 3DYMA 3E49A 1OYAA 3VNDA 1IHIA 2ZE3A 3T8QA 1XICA 2GVLA 1JDAA 4EPEC 3LCXA 4FP1A 2QF7A 1MVYA 4REQA 2PTXA 4C5YA 3T78A 3IIPA 4GNVA 1LWHA 4YCOA 2V5JA 3AHZA 3VINA 1V3KA 4JN7A 2X16A 3XINA 1SR9A 3KDNA 1HNYA 1NQKA 4DUXA 3UXIA 3QKZA 1RBOB 2PDGA 1TJRA 3LZ5A 2TRSA 1UWQA 5JMUA 4HOWA 2OG9A 2GLKA 3PZTA 4PMZA 1KFJA 1V6TA 3POCA 1GEQA 1FWBC 3WLHA 2VYOA 4QDMA 4GC3A 4MG4A 2JEQA 3MDUA 1LLZA 3SCNA 3RLGA 1VFLA 4Y8FA 1ECEA 1P1MA 4JFSA 2ZRXA 2WVTA 3U2CA 2PD5A 4V33A 1SU5A 4E3VA 4JEQA 2HQAA 3ABOA 3MS8A 4QJ4B 4RX0A 1DYSA 5CPTA 3NXLA 5KZDA 1WDWA 2POTA 1XLDA 5RUBA 4RL3A 4HIBA 5G1TA 5K4XA 1NOFA 3UZWA 2CWNA 3W7NA 1B30A 4AD1A 4XZWA 4WQ6A 4JQ1A 3EEZA 2J8TA 4TMCA 2PDUA 4JD4A 3TQKA 4AWSA 3NQGA 2A3AA 3NL2A 5DRIA 2V69A 1PYFA 1RY8A 4CQCA 1IF2A 1HJUA 3EA3A 1VP5A 3AHYA 4ICNA 3GFXA 2QKFA 1MI3A 2Y8KA 4JDBA 3CBWA 3EBVA 3DHDA 3H2FA 3ZZ1A 2NX1A 2POZA 1GVYA 4Q8QA 3T0DA 5K4ZA 2HXUA 3GU9A 4YMZA 4PBEA 3TC3A 5BXRA 3WKZA 1W1B1 5E09A 1H7PA 4PC8A 1V6XA 2F2KA 3GC4A 1JYWA 1JCNA 4P7RA 1ZL1A 3BARA 3TJLA 4UTFA 1GTHA 1JUBA 2TPSA 4GABA 1ZB5A 4H1ZA 3RNDA 1JCLA 1PE1A 3IV8A 2I7GA 1GT8A 4GD0A 3KOYA 4FALA 4AUBA 3A5FA 2ZRZA 1GJUA 1UMLA 4G6CA 3DG6A 3FXGA 1QNRA 2OWCA 3LHZA 1RJQA 5CLWA 3AMCA 1ZJBA 1AMYA 1HJVA 1H1ZA 1UASA 1A3WA 4GA8A 3CEPA 3SW6A 1RSCA 3MPGA 1BWLA 3V5CA 2QJHA 1A50A 1KM4A 3G18A 4C6KA 5HPOA 3OYZA 1CPUA 3B8WA 3VIJA 3A3HA 6REQB 4O8AA 4OE7A 1Q85A 5C7HA 1RJPA 4TUFA 1K03A 4BKNA 1F73A 1XIBA 3WNNA 2P5NA 1I6NA 2YKKA 8TIMA 2QVHA 4A21A 1TE6A 3VNJA 4ZOEA 3SUSA 2BZNA 3W7DA 1R2TA 1K7FA 3GHSA 2EKCA 2QUMA 2C15A 3R89A 1RR2A 1UD6A 3HA1A 3IS4A 4Z2GA 4US5A 3I68A 3UG8A 2ALDA 2VEKA 4H6KA 4LEQA 5J5DA 2VC6A 4KETA 2HK0A 4N4QA 1FP9A 3AJ7A 1FBAA 3WMLA 2P1FA 3WEZA 2WCSA 4JCMA 3GXDA 2YL5A 1IEQA 1XLIA 3GNDA 4PMQA 1V6WA 3EB2A 4O0ZA 2WO5A 1XDLA 2C79A 3AMDA 1YDVA 4PCSA 5CGTA 3OPSA 3SADA 4L1XA 3HV9A 3LENA 1R3TA 1QWKA 4MM1A 1I60A 2FB2A 1UZ1A 1UBPC 1J93A 3VVGA 1A5NC 1XPYA 1EKOA 1YPXA 1VLWA 1G94A 3FJNA 2FTWA 4F0LA 1IGWA 2A3CA 4P8UA 1AQFA 3CIVA 2PDHA 4ZXLA 1O6IA 1MQQA 1QI4A 3G8EA 4JZ5A 4UZUA 1J79A 1QHZA 1H4PA 4RV3A 2W27A 1DQWA 3ZR4A 1NP0A 4J3SA 3DGRA 4A05A 1SUXA 3LRLA 4I7UA 2P3EA 3UNDA 3V5FA 1R3YA 4GYJA 3P84A 1XYZA 3IIOA 4MAVA 4LWWA 3TOPA 2GQ3A 4FNTA 3QY7A 1QK0A 4NAFA 4ADSA 1DP0A 1FWAC 5H1WA 3IGUA 1EXBA 1X6LA 2O7QA 3SCVA 1OGGA 3IUIA 1FDJA 2HROA 3R43A 1RALA 4JNZA 3KL5A 4W85A 4S3JA 3V75A 3CV6A 3OO2A 4QE5A 3UZ5A 3H55A 4HMEA 3LA4A 2V5KA 2GSHA 3E3HA 3M5XA 1HGYA 1JZ2A 5AHLA 4AZBA 1BTMA 3ARSA 3LHYA 1FHLA 3W7LA 4D6DA 3CUIA 3HU7A 2GPTA 1VJZA 4S3BA 4Z17A 1XL9A 3H21A 5A8MA 1G5AA 2Y4SA 3IJIA 2WNWA 4LBRA 1FVPA 2GJPA 4QJ1A 1EH9A 5LIKX 1FHDA 4XAPA 3FIGA 1FXPA 2XVGA 2VFHA 3N4AA 3TJ4A 3RR1A 3GTHA 3IK4A 1PCKA 2BXZA 3QJAA 4UTUA 3AHVA 2CYGA 3FHQA 4H4IA 1UWAA 2ZVIA 4XIMA 4DJDC 1QOQA 4AU0A 2OT1A 4JTDA 4WZHA 1PEZA 5DQPA 2QT3A 1XP3A 2RDTA 5CAKA 3VI2A 4OUEA 4OJYA 5HNUA 1XIFA 2PWEA 3WQOA 4HYRA 4S3EA 1X38A 3BVJA 3S42A 1AW2A 3HF3A 2Q02A 3TYDA 3RHGA 3N2MA 1HKVA 3EZ4A 3L66A 4BQ2A 2RGMA 3RJXA 3FY1A 3KL3A 1XIIA 3JS3A 1IQ8A 3O7UA 4K7YA 5KSWA 4H19A 3N2TA 3ZJ7A 5D2WA 1DIOA 2VEMA 3VX0A 5CPQA 1HL8A 4UQ9A 4N7QA 2PBGA 5LGZA 5FJTA 3BCDA 5DY3A 1ICQA 2W79A 3IANA 4LFYA 4QGCA 3W25A 2O9PA 2E28A 3EWYA 3PANA 5DCEA 2J25A 3NQVA 4IFRA 3MJMA 1JZ8A 4JTIA 1VRDA 1TWZA 1LZOA 2AQWA 1T99A 4MSSA 2OKOA 3LRMA 2VWSA 3EDDA 2UY2A 5HQLA 2VGGA 3Q67A 1C8QA 4XO7A 1WXYA 1VYPX 3ABQA 3ZM8A 4UTTA 2OMAA 4AEOA 5D9OA 1O4UA 5A6SA 5I23A 1MXDA 3BOFA 1VBGA 5U7SA 2CZDA 4I3GA 2D3NA 1G4TA 4S2CA 3M6YA 3VCCA 3M16A 2F61A 1RPKA 3DC0A 4CN1A 1E3ZA 3ERPA 3V0SA 4QCEA 4AG0A 2TSYA 2JGYA 3IGHX 1VJIA 3P6LA 3GNRA 1Y7VA 2QCFA 3F5LA 3N73A 1LJYA 4WKAA 4H01A 1TWSA 3MC5A 3UWQA 1KO0A 1QPRA 3P61A 3DG3A 3O6CA 2VL4A 3AS1A 1X96A 4JKMA 4JHZA 5E0CA 2Z2BA 1AH3A 5AYZA 1EP1A 2XFRA 2KZHA 1QTWA 4UMCA 2GUUA 2FZMA 1WKEA 4U31A 2QAFA 3H70A 3E0LA 1K6WA 1BXCA 2O0TA 4QLJA 1PX8A 4H3DA 1RV8A 1FCVA 3ZVIA 4EX4A 4FMVA 2RJHA 1CGYA 3LLFA 1U5JA 3NYDA 2RH9A 1E6XM 3B03A 1R0MA 3EYPA 3SCTA 3VCNA 3ITLA 3LTSA 1C91A 3AIBA 2MNRA 3S1UA 2O4QA 2XVLA 3UZYA 3IGXA 2IS7A 3DYPA 1B3XA 3I6RA 3CHEA 2E09A 3I7SA 4UC5A 3MYPA 3NSMA 3INPA 2GUBA 3MKVA 3VD4A 2FZBA 2C13A 2Y0FA 2YOCA 3PSWA 4LEFA 4UCGA 2WSQA 1F8MA 1U5HA 4UTLA 1MRAA 3LCIA 3WUGA 1ONXA 3QOMA 4PTDA 1A5BA 1ECQA 3N18A 1X97A 5BRPA 2DZSA 3M0MA 4MLRA 5A2AA 4F8XA 3QW3A 1BG9A 3HB9A 4R53A 3TC7A 1J8VA 4EIVA 2BWGA 3DZ1A 1H7WA 2QIWA 2V2DA 3W00A 4GI8A 1XYCA 1XQLA 1MW2A 4KIEA 3WJYA 5CAHA 4P7NA 1C7TA 1D3GA 1HN1A 1ZJIA 2D20A 5CSUA 4IHCA 2Y5EA 3WEMA 4TO8A 1LG1A 4W93A 5H6HA 3CH9A 1E6SM 3R58A 4GBDA 5C5YA 1PAMA 2J7HA 3WQGA 3WMBA 2W61A 3W7CA 4PTVA 3FKRA 4GUGA 4FO4A 3DC8A 3AIUA 2OZ0A 2OX1A 1NOWA 3WJXA 3M5VA 2NXIA 1B3VA 3C5QA 4KGJA 3BZGA 3LPFA 3AYSA 3N13A 1CLKA 1LTDA 3HOJA 1LM1A 4QX4A 4FLSA 4FNPA 1ME9A 3PWIA 3KBMA 1ME7A 1SMAA 3GLCA 4I5UA 4ZQRA 4FEZA 3DFTA 1T8XA 4ZGYA 4AF0B 1QOPA 3WX7A 4W8LA 2R1MA 3PPCA 4LVFA 1N8IA 2WMFA 4U4MA 4P2VA 4LQ1A 4IFKA 4O52A 1Q2SA 4WHBA 1J5SA 3DHUA 5AYBA 1V03A 5F4XA 3WLNA 3OYXA 3NXFA 3IIXA 3N2BA 4IJCA 3EB4A 3U3HA 1KTNA 4A3HA 1ZPTA 1DXEA 1BTCA 3WF1A 1WZKA 1QVBA 4LVGA 3TOYA 3THDA 3PBWA 3C2YA 2VELA 3WLRA 1QRQA 1X8CA 3BXWA 5BMXA 5FJJA 4ZOBA 1XYAA 5DCBA 3PB2A 4HSNA 2GFTA 3T42A 4WY0A 1BG4A 2QGYA 4LV4A 4S3GA 3W3OA 7TIMA 4KQNA 5AECA 2FFCA 3VOJA 2VOTA 5FF3A 1XD1A 3GS6A 5K2ZA 5AC5A 2I16A 1E72M 3R11A 3RXZA 1SO5A 5DXXA 3GXTA 2X7WA 2FJUB 5BNKA 5EL1A 2X1IA 3SUTA 1MO0A 1D9EA 4R5EA 1TX2A 2Z4GA 4AISA 4ADTA 1JZ7A 4Q8WA 2ZXAA 4DBSA 3ABSA 1QO5A 1DIDA 1YXYA 1V6VA 4KWSA 4EKJA 3WLKX 2Y7EA 4JY9A 4OQVA 1XLJA 1NU5A 1CGTA 4YS1A 4CNTA 4GUFA 3CZEA 4Q22A 3GG0A 4KBXA 4KRTA 3TKFA 1N7KA 4UQDA 3B3DA 5D37A 3WNMA 2NUXA 2J7CA 1OHLA 2ZRYA 2PLKA 4JL1A 2DSWA 1SQ7A 2ADAA 1IZKA 4DRSA 2VQTA 1CWYA 3U9IA 2ZA1A 4HMCA 1PDYA 1XBYA 3GDBA 2EQDA 3HFYA 4F9JA 3BANA 4ZB0A 4XAGA 1VENA 2OSYA 1KFLA 3Q2DA 4RKAA 3NZQA 4GZEA 3EXTA 1YHTA 2Z2AA 5IDZA 2A0NA 1CBGA 1P7TB 4HPXA 1JPHA 1Z48A 3CZGA 1EO5A 1IEWA 3GE7A 2A7PA 4QEEA 2WSRA 2D0GA 3BE7A 2YLLA 3H7VA 2H6RA 3PZOA 4M81A 3WF4A 2GJLA 4JFWA 3QYQA 3TSDA 3SUUA 4QAIA 2VCAA 1GEHA 4DJDA 2MUCA 2SFPA 5E9AA 1S5TA 1KWKA 4O1FA 1V93A 2DSZA 3LN3A 5I3GA 4HNTA 2PLCA 3HPXA 1C8YA 2FDMA 4GX9A 4FXFA 2D2OA 4DF2A 1XYFA 1FFRA 3W1UA 5HUOA 4DELA 2GDVA 2NZLA 4QE4A 5FA5A 1VIWA 1PZ2A 4R33A 4QR6A 2AL2A 3TYBA 1LRNA 1KCZA 4ZR8A 3PUOA 1GONA 3GWQA 2R1NA 1WDRA 5A2BA 5G4HC 4DUWA 3W74A 2VURA 1XSIA 1VPXA 1G01A 3O63A 3N6QA 1ZTVA 4U2YA 5FF2A 2DSVA 2NQZA 2PD9A 3N29A 1HJQA 3MUAA 3S47A 1Q6RA 3R8HA 1KRBC 2YXGA 4CU7A 3S8HA 4K6AA 2YZ5A 4F2TA 1RP9A 1E0VA 3WK3A 2J74A 4KEZA 4B2DD 1XGZA 1R30A 2IQ0A 1TTPA 1W5QA 3MB9A 1ZAHA 3WLJA 2ZUMA 4I9JA 4GIRA 3W1TA 2QF8A 4HZ6A 3WZ0E 5LXEA 1I75A 4L9ZA 3UYCA 5CZJA 2XPKA 1UUQA 2CNCA 2QQ6A 5HQEA 4G1KA 2E8ZA 1EP3A 3MVIA 3WJWA 1G4PA 1P6WA 4B5SA 2DZWA 4RZ5A 3R5EA 4B91A 4LYKA 2A6LA 2QVNA 4OTKA 1W54A 4C65A 4XWUA 1S2CA 1SVDA 3NDOA 4PUUA 2FHBA 4D6JA 4H2HA 1YE4A 3B4YA 3EDEA 5CPMA 4AEFA 4EXBA 2XWEA 3LHUA 4PH6A 1GPWA 1XF0A 3GSMA 1TPB1 3LV6A 1VCFA 4KEMA 4NRSA 1FHUA 1RPXA 1JCTA 3M0XA 1XDJA 1QBBA 5IHSA 3I4KA 2V6AA 5ABTA 4HHPA 3GH5A 5IBXC 1PCWA 3ABXA 3AXMA 2E6FA 3R7MA 2CHRA 1T8QA 1WAWA 2XISA 4RCXA 5K9CA 3S9IA 4R9XA 2RGLA 1U30A 3FW6A 3WK0A 1YDNA 1KD0A 3C2FA 2QR6A 1EIXA 1E55A 5KEZA 1TCMA 4MOZA 3TQ0A 4E4PA 4H9MA 1EDQA 1TWWA 2GQ9A 4JYFA 4CVUA 1CB2A 5D33A 3N19B 4NRRA 3WQ6A 5BOOA 1FWNA 4UFKA 3VIHA 4OU1A 1GORA 3VIGA 3OZPA 4WDUA 3ENLA 4US6A 2X0HA 1RD5A 1Q7QA 3CUXA 1TTIA 3WBYA 1K4HA 1MEIA 2DUXA 2NUYA 4M5PA 2X40A 3K8MA 1CGVA 1TZ9A 1MRQA 4IG2B 3I7RA 3QEZA 3W07A 1O95A 4POCA 1M7OA 3LX9A 3SEPA 1S5NA 2WC3A 4TIMA 3C3UA 1EWEA 2J8FA 3W2UA 3DGBA 3ZS4A 3TCEA 3UCDA 3R8GA 2DIJA 2NWSA 1N82A 4XD5A 1US3A 5A8NA 4D2JA 3NCOA 4H9VA 3HURA 2CETA 3QR0A 2B4GA 5A6BA 2XN2A 3BPWA 3G24A 1E6NA 4LX4A 3BJTA 4U10A 4BEUA 1IR1A 4IFOA 1KBLA 4NG3A 2WVVA 3P0XA 5BOEA 3PBVA 3AUJA 4TV6A 3DOPA 2CLOA 3O05A 3OLDA 3TIMA 4N9EA 1I1WA 2OWWA 1B0IA 2VKZG 4I6VA 2XZ9A 4F40A 1H51A 4XZ9A 2VM8A 3W2LA 1MXSA 3WD3A 3U2EA 2Z1BA 1R2SA 1YEYA 3KOWA 4Q7NA 3M1ZA 3ZJ8A 4GKLA 3KTXA 2J24A 1TWDA 3AYRA 3L65A 1DEDA 2GYIA 2IKHA 1H11A 2W92A 4AZ5A 1VFFA 3CK5A 3AYTA 1JAKA 4L6OA 2A4AA 2P50A 5MKGB 3EKZA 5CSYA 2GVJA 4EF9A 2WM0A 3R8RA 4GIAA 3KUMA 3F5JA 4PRWA 3K4AA 2I5IA 1EHAA 1XLHA 5AOUA 1L6FA 1ZENA 1W8GA 4UR8A 3SY5A 3OIXA 5CPSA 1X8FA 2VJXA 2PFHA 4HTYA 2PDLA 1LDCA 3F2DA 4QROA 3CAWA 3UGRA 3VKCA 3EOEA 4CCZA 3IWPA 3TNOA 1LBMA 3M0VA 2YBTA 1OYBA 2DT2A 2E6AA 1MDLA 3RITA 3N04A 4YVPA 1F07A 5HDRA 2DW7A 4JNMA 3WFLA 3LG3A 3E02A 1UZDA 3KRUA 2VZOA 4WSKA 4UMAA 1X6NA 1UD2A 2FGLA 2G4JA 1RBLA 1U83A 4RE2A 1Q13A 1DIEA 3T6CA 3G1VA 3OODA 3NGFA 4XUGA 1P6CA 1EJRC 1MXGA 2EPKX 3WLLA 4JQ2A 4IL0A 5KINA 3BZJA 4OKDA 2AOSA 2EEXA 1U33A 5BU9A 2G3MA 1O66A 3W1MA 1A4LA 3P5ZA 3KE0A 4WVXA 4L9XA 3FLUA 1WZAA 4O1EA 3SUWA 1R3SA 4ZQOA 3RUBL 3GVGA 4JTUA 3W83A 3W2NA 1EZ2A 1Q5MA 1P6BA 1HKWA 5FAGA 2XVNA 4WSHA 4X63A 3JRKA 1H1NA 1LF1A 2E7FA 2QNEA 4UBPC 3ALFA 2P88A 4I5RA 1KM0A 1UJQA 2GQ8A 2CESA 4HOZA 7TAAA 2Z2UA 3NPVA 3NZ1A 2F84A 3ZJ6A 4D6CA 3BAJA 1GVSA 4GQ0A 4RDWA 2E5DA 1G67A 1U2YA 1IWBA 1RQEA 2G96A 4UOZA 4NZ4A 3Q4DA 3EX6A 3ZIZA 3ITVA 4XX6A 4EWND 3SUVA 4O16A 4UTTC 3ITXA 3GR8A 2FPTA 2J7GA 3UWVA 1C8XA 2NSOA 5DBUA 4B90A 3REQB 5EY5A 2ZZ3A 3L0GA 4CCCA 2NQ5A 2HZGA 2BOEX 3BURA 4LH8A 5DY2A 3WLMA 3IJ8A 1L6WA 1MW0A 4AY7A 1Q6OA 4EAYA 2G0WA 1UH4A 4P8XA 2CLMA 4CNSA 3URNA 3BSHA 1QUMA 3MCNA 4D1IA 4H7CA 3H24A 1RLDA 2F6KA 1OEPA 5E0FA 4XSMA 1E9ZB 4D71A 2EJ1A 2IPJA 3RG6A 2WVSA 6ENLA 3TFCA 1HKIA 4PRTA 2HSAA 1OZMA 4IX0A 2ZDSA 2CBIA 3L4TA 2XSBA 4GQGA 3MDWA 1PHWA 3FVMA 3CMJA 3MT1A 4B16A 1AZ1A 4JKKA 2R1PA 4CCEA 4DM2A 2XIJA 2Q01A 1LP6A 3AC0A 4N6FA 1HGWA 3W7PA 4Z1AA 3CO8A 4J2MA 5D04C 4BR1A 3S0CA 4LBUA 2INZA 1IEVA 3VD3A 3MSRA 1B4KA 4C6MA 1GKQA 3FEMA 3TFXA 3MV01 4YYFA 3U7VA 2OT0A 3HBLA 4DLMA 3W7EA 4V2XA 2FGBA 1FH7A 2HPMA 4F66A 6TAAA 2BASA 2C8NA 5D8WA 4Z1DA 3WQVA 5C55A 1OFPA 1OCBA 2IKJA 4L6HA 1J4EA 3E2SA 4LUIA 4D72A 4AYSA 1DPMA 5DN1A 5D9MA 2G37A 4ZOAA 3GXNA 3ZXWA 3ZLFA 1XLBA 3CZJA 3UPBA 2FTPA 5JXQA 1Q2RA 5ABFB 2QCMA 3WK2A 2D2JA 4HA0A 1YKWA 2E9BA 2QGHA 2R9RA 3VZZA 5D38A 2J7FA 4U2ZA 3EPMA 4DNHA 1A5AA 4JTJA 3BSGA 4K38A 5I79A 4FHAA 2O7SA 1DQUA 2VC9A 4AZGA 3KHJA 2WHKA 1L8PA 1AQHA 3REQA 5FJOA 1JL8A 4WX2A 2PDKA 4MKNA 4AC7C 3TW7A 2WC7A 2PSNA 3A64A 3G1FA 3BAWA 2BOGX 4FNQA 1P0KA 3L5LA 1PX3A 4I9AA 4XD3A 1IWAA 3OG2A 3C2RA 2R14A 2XWDA 1E73M 1LL6A 3OZOA 2OGJA 4B3KA 3M0IA 3QV8A 4MJ4A 5M17A 3GXMA 5HUPA 2EF9A 3ATZA 1WKFA 2G4FA 2ZUTA 2Y7GA 3EGJA 3PTKA 1ZBWA 2PGRA 4JTHA 4NJJA 1LLWA 3RN6A 5ABGA 1H09A 4B5TA 3TTEA 4TV5A 5HOSA 3ONCA 4AZCB 4CNUA 4YXGA 5C2XA 5E6ZA 5I78A 1LROA 1XSJA 2ZA3A 3W37A 5DMLA 2V3GA 3B0UX 3NA8A 4RLIA 2GOUA 5M3WA 2RAGA 5CGQA 4WDXA 1PTAA 1GOKA 5LXXA 1GVRA 1VBJA 1QBAA 3TN6A 3VA8A 3AAMA 2ZA2A 1NFGA 3RX3A 2BY3A 2R8WA 4UFMA 1XBZA 3LOTA 3PTMA 3WMCA 3UY7A 3CT7A 5GJNA 3W26A 3WNOA 4JTGA 4M1BA 2D0FA 1QNPA 3MW7A 2TAAA 3M44A 1J11A 2Q8XA 2OYKA 3LD5A 4GLEA 1TA3A 4F4RA 4DI8A 2CHOA 3EA2A 5CPOA 3UWUA 1VEMA 5B80A 1ZAJA 3PBGA 3ARXA 2Y85A 4EOUA 3OHMB 1DWHM 1XW8A 2BODX 3W85A 1D8WA 4AZ6A 3RILA 2X1SA 2PWVA 3PZ9A 3AS2A 2PP3A 2QCHA 3DU0A 4IT1A 5CLTA 4EANA 4KW2A 1V8EA 3CYJA 4XVEA 5KITA 3SJ3A 2JK2A 1W6TA 4QS6A 4C6EA 3NEHA 3GNNA