1K8ZA

Crystal structure of the tryptophan synthase beta-ser178pro mutant complexed with n-[1h-indol-3-yl-acetyl]glycine acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
268
structure length
257
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 98
structure length 257
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k8zA00
3EX1A 1K3UA 3P60A 1BTMA 3GDKA 1FX6A 1F6PA 1VRDA 3RK8A 4FIRA 2JKEA 1GVQA 4Y9AA 3T78A 3SECA 1IXNA 2E6DA 1UB3A 4JTFA 5HUPA 3UQNA 3NDOA 3DAQA 1R46A 3UNDA 3KHJA 4XUGA 6ALDA 4YMZA 3MJYA 3NEVA 2TPSA 3TC7A 3MBFA 3G1XA 2PRHA 3EXTA 1DQXA 1OFBA 3M44A 2ZBTA 3FFSA 5KINA 3S5ZA 1W5NA 2Q8LA 3C4UA 3KVMA 3GDLA 3DFQA 1GYLA 3S6DA 4O8RA 3UD6A 3EWXA 1SQ7A 1Z44A 4O1DA 4NJGA 3ABOA 1H7WA 3AJXA 4TO8A 3M43A 1YLVA 2ZZ7A 4ZQCA 1TQXA 4CNNA 3W71A 5K4XA 1S3HA 3F03K 4UTWC 5LNSA 1PHQA 1IXQA 3PR2A 4HNTA 5K9DA 4QJ1A 1GG1A 1VCVA 2CLFA 3FYPA 3Q94A 4FNPA 2QUUA 2QCLA 5F4WA 1MXSA 3TFCA 1YXYA 1LOQA 2DJXA 5AC7A 3N2XA 2J9XA 5FF4A 1TJPA 1KM3A 2FTPA 4LWWA 4WXZA 4OE7A 2A85A 3FEMA 1H7PA 2BTMA 2DZVA 1EPXA 3LHYA 2W79A 3NPWA 1TJRA 4FNSA 1FWSA 1OHLA 4O10A 1QO2A 1GG0A 2VOMA 4FNRA 1AG1O 3L5LA 1TRIA 2V2HA 3NQGA 4K39A 3S1WA 4CCEA 2WSYA 3LXCA 1O5KA 5LKYA 4XZ9A 1EP3A 3O6CA 3WK3A 3LXAA 1P5BA 2DJLA 4HPXA 3B06A 1KM0A 1W3NA 4O0KA 3CLMA 1S5TA 3TJLA 2ATSA 2ZRXA 4RJEA 4JEQA 2FQIA 1TO3A 1F2JA 1LLWA 2XN0A 3H54A 3NL5A 4H3DA 1JCMP 4Z1DA 2DU2A 4NNBA 4U28A 1KV5A 3HOJA 3LHUA 4O18A 4AH7A 2A0NA 5K2ZA 3IVSA 1TV8A 3LTPA 3CU2A 3HO8A 1SZFA 2YDAA 2WJZA 1FDYA 3TC6A 5FF0A 3LV6A 3MO7A 3W7PA 2WNNA 5K9XA 1FCQA 5I3KA 3UXAA 4FX7A 4JYDA 2VFGA 1WDWA 3W7NA 3FKRA 1H50A 4P61A 3W1LA 3RF9A 3ZFHA 1I45A 1JUKA 4AWUA 2OX1A 3C8FA 1AMKA 3LDVA 3MI3A 8TIMA 3EEGA 1OG0A 3A9IA 4DQWA 1FY6A 4WJEA 4XQ6A 5G2IA 4ADTA 3T55A 1HFBA 4N6EA 4GUIA 4O17A 4H4IA 1MSSA 2YW4A 1H61A 2R91A 4IJBA 3E49A 3KX6A 2I14A 3W1RA 5AFDA 2NX1A 3G0XA 1SUXA 1TPDA 3T4CA 4AXKA 4LC6A 2J6XA 2VFHA 2YYTA 4JYFA 3U2OA 2CU0A 4JDBA 5G1YA 2O7SA 1P0NA 1WA3A 3PWAA 1OX6A 3L0NA 3HIJA 3R12A 4DF2A 1ZAIA 2P0OA 3TNOA 1RZMA 4WX2A 2NLIA 3RLUA 5BRBA 4TMCA 4I7WA 3I7SA 3P5ZA 4MY8A 1W5QA 1DVJA 1SZNA 1QPOA 4JY9A 2VKZG 2TSYA 1K02A 1YADA 3C3NA 3NNTA 4OQVA 1DOSA 5CSRA 4WQ6A 3C2OA 3S5OA 3CEUA 4A2RA 2C1HA 4LU0A 5C5YA 4M7SA 2QCEA 1GTHA 1OK6A 1SO3A 4RCXA 1RQBA 3STFA 2GQ8A 4BWLA 3PSVA 3LCGA 3WJXA 5DCBA 1GTEA 4MJMA 3N34A 4KFOA 5D37A 4R33A 1GPWA 1A5CA 3W86A 1TPFA 1LRNA 1W8SA 3W1AA 3TW7A 5KSWA 3ZS4A 4JD4A 2V2DA 4Y96A 1OFOA 1R2TA 1N7KA 5A8GA 4UFIA 4A21A 4AHOA 4C1LA 1WX0A 3GAYA 4MJZA 1Q45A 1FCUA 3W1XA 3MYPA 5HQEA 4O52A 1O4UA 1OYAA 5D04C 3EXRA 2E6YA 2WV8A 1ZAJA 1D9EA 3EWYA 3TA6A 3PG8A 4JTIA 4BI6A 1M5WA 3CTLA 4XBSA 3R89A 4NZJA 2ISSA 2CLLA 3W75A 4QQ3A 1DJQA 4OGZA 5FESA 4AF0B 4O12A 4UTWA 1MEIA 1XUUA 2EHHA 4O54A 1KBJA 3M5VA 5CKSA 4DO4A 1G4SA 3PS7A 4UFLA 3RU6A 1YDVA 3MHFA 1VJIA 2WNZA 1KTNA 3KOFA 4O16A 4HN4A 2DZWA 3CPRA 3F4NA 1CW2A 3H55A 4X2RA 2YYUA 1SO5A 4LOCA 1JCYA 1W1ZA 1Q3NA 2ZRVA 2JKPA 4MLRA 5HUOA 3STGA 4M7TA 3PBVA 3L68A 2ALDA 3P84A 2RDUA 1VH7A 5LNVA 1KBIA 3EB2A 4WXYA 1ME8A 1TTPA 1RQHA 1MO0A 3IGUA 3SFKA 3NM3A 5KZMA 3W1NA 3C2VA 2NUYA 3OIXA 2JGQA 2NUWA 5FF3A 1M6JA 2NXGA 4DF0A 1PCWA 1K8ZA 5D30A 4PH6A 2CLEA 3C52A 4L4MA 4NXKA 3F4WA 1TIMA 3C2FA 1NF0A 3EX6A 1KV8A 4ZZ9A 1KM4A 2PCQA 2WSQA 3DHFA 4YL2A 5AN7A 4N02A 3M1ZA 1ZAHA 1I2OA 5G2WA 2QJHA 4Q4KA 3EX2A 2BZNA 3UWZA 4JR5A 2ZRUA 1ZJIA 3YPIA 4BI7A 1QMLA 4GFSA 1YYAA 3G24A 4UTUA 2C19A 3W9ZA 3G1FA 4I9AA 1J4EA 1A5SA 3TFXA 1TPWA 2GVGA 4QISA 3TR2A 3LOTA 3IEBA 2W0UA 1T8XA 1G69A 3W23A 1KFBA 2VXNA 3QPZA 2F7FA 3S42A 3INPA 3UY8A 4JTLA 4DEFA 1IF2A 2B0MA 1LM1A 1QOPA 1JVNA 4X22A 4IXHA 1JCNA 3SY5A 3NGJA 2UV8G 4HPJA 5G5IA 1KM1A 1N55A 3BV4A 4WD0A 3N19B 1IXOA 5CPNA 5AHEA 3QJAA 1RV8A 2CLHA 4NNAA 2RDWA 5U7SA 2V9DA 4JTUA 2VEIA 3UYCA 4JIQA 3SR7A 4GE8A 4N4PA 2V0TA 1QCWA 1CX9A 1VLIA 3N3MA 4FIQA 4Y6GA 3VNDA 5KZEA 4JN6A 5BMXA 1NEYA 4JGDA 1K7FA 2FB3A 3TXZA 2Y85A 2C14A 2FDSA 1YXDA 2X1RA 3O05A 1DL3A 3DFTA 5CPOA 1GOXA 2GJNA 5D32A 1TPUA 2QCCA 5FEPA 1SW0A 1NFBA 3B05A 3OHIA 2NV1A 3N2MA 1H1ZA 1LROA 4DPQA 1R30A 3UPBA 4MIMA 4HHPA 4UNKA 2ZZ3A 1FWRA 3VI2A 3W07A 2ZZ1A 1AL7A 2RHGA 5I3GA 3E9AA 3BO9A 5CPLA 4MPQA 1V7YA 2V5LA 3P61A 1ML1A 5D33A 3L21A 1I4NA 4ONVA 2H6RA 1ZFJA 2Z1BA 1N8FA 2VFDA 1G6CA 4RXFA 1TCDA 3W85A 1YDOA 4CQAA 4KFPA 4OT7A 1AW2A 1RR2A 3M6YA 4E0CA 3LCFA 3ZWTA 5AHMA 4PA8A 3S1VA 4OBTA 3UWYA 4CCDA 3USBA 5D03A 4MY1A 3OEXA 4K38A 4MVAA 4ZL1A 4JTKA 1JCJA 1XDLA 1BKSA 3G1AA 5SWUA 1NSJA 2A4AA 3E96A 1FDZA 3G1DA 5E1QA 3R2GA 4GWEA 3FYOA 4K7YA 1HTIA 4K8EA 1A5BA 2NXHA 2Z0IA 5D2TA 2ZZ6A 3N73A 2RH9A 2E5DA 4EF8A 3LHZA 1H7NA 3S5NA 1OK4A 5D09A 1IIGA 3STEA 1Q6OA 1ZY9A 3LCIA 4MYXA 3VFLA 3BLEA 2CZDA 1QNVA 3OG3A 3STCA 2GJLA 2ABBA 1SZEA 1EA0A 1Z41A 2QCDA 4IGHA 4CLMA 5C6MA 1PL9A 4NT0A 1FXPA 4BK9A 1BWKA 1LBMA 4AWTA 1LYXA 1TV5A 2H3DA 3LGEA 4O4VA 3PUDA 5EBUA 4DELA 5J5DA 4MZ8A 5K7JA 4YCPA 4FB7A 1F7BA 5F2LA 1G4PA 2NX9A 3DXIA 3BW2A 1Q6RA 4AF0A 4KFNA 4N4QA 1W3TA 4DPPA 5EPDA 3NR0A 1FWNA 2Y6ZA 3G0UA 6TIMA 1JUEA 1LDCA 3PB2A 4YWIA 4EIVA 1VQTA 2YR1A 4FO4A 5I3IA 2YFNA 1PV8A 4QITA 3O63A 3QW4B 3W7JA 4ZQNA 3LX9A 1GVOA 4WZHA 3TJXA 4R53A 1SO4A 3LHTA 2QR6A 3TQVA 1JCLA 3QSRA 3LCLA 1DHPA 2FPYA 1W5MA 3L0GA 4M6PA 1VLWA 4S1FA 1O95A 3GR8A 3LI1A 2OJPA 3G3MA 5GVJA 4UTTA 1G4TA 3M9YA 2ZA3A 4ZQMA 1YTDA 2CLKA 1IIHA 2DZTA 3KRUA 4LVAA 3PF3A 4AWSA 3CM4A 2J9YA 1KFEA 3QC3A 3GLCA 3MW7A 4K36A 3QSTA 1ME7A 1ZENA 2QCGA 4ICNA 1KFKA 5DXXA 3RLVA 1WOAA 3FJLA 3IVTA 3QZEA 2GQAA 3O6DA 1SU5A 2FJKA 5CGQA 3TKFA 3BG3A 3LM7A 4OV9A 4BFAA 3TSMA 2B7PA 5HR7A 3N9SA 4MLJA 3W2NA 3N14A 2YCEA 1YXCA 1JULA 4ADUA 2C16A 4PCFA 3ELFA 1XDMA 2E68A 2Y7FA 1XBYA 5BNKA 3BARA 4IMCA 3GNDA 3C6CA 4WY0A 3A24A 3GXNA 3PB0A 4OV4A 2CW6A 2ZRZA 3C61A 1QWGA 3IIVA 3JR2A 2ATMA 4MFDA 3S0CA 1F6KA 1ZHAA 3L5MA 4UMBA 1VR6A 3B0PA 5KZDA 3TXVA 2B4GA 4UMCA 1BWLA 3PULA 1VPXA 2QF7A 1EIXA 3MP3A 4ZMGA 2QKFA 2G95A 4GUJA 3W2LA 4G1KA 4DO5A 5L6UA 1C8VA 1G7VA 1EWEA 4JTGA 3DH7A 3HPXA 4NJHA 2QAFA 4WUIA 1A50A 2VFFA 3LLDA 3W73A 2HTMA 4XWUA 3LHVA 1VCGA 1VHCA 4MYAA 1O94A 1C29A 5BW6A 1OABA 5K4ZA 1LBFA 1KLYA 2WNQA 4LVDA 3IIZA 3W1PA 3NPXA 1W3IA 3TQ0A 3G1SA 1SSGA 4LUIA 1LP6A 2Y61A 4LNYA 2PC4A 1W37A 4JX4A 2JBMA 4Z1AA 1WYIA 3ABRA 4GNJA 5C55A 7TIMA 1W5PA 3HJZA 1H60A 2CLIA 3IRDA 3PAJA 1KFLA 1M7OA 2VEPA 3QF0A 3ATZA 3O1NA 4A2SA 3I68A 3EKZA 3M5ZA 3LBMA 1ICPA 1SFJA 3BLIA 4Q33A 1RVGA 1F74A 4UTHA 3NPUA 1XKYA 4WY0F 3NQFA 1XC4A 3DU0A 4YLWA 2AQWA 3Q37A 2JK2A 1TPVA 3BW4A 3MI6A 1JJKA 4HNVA 2Z6JA 4UR7A 1O5XA 4ZQPA 4ORIA 4E2BA 3TSBA 4PTNA 3QEZA 3BGGA 3LCXA 1TREA 3O6YX 3G1VA 4JTEA 3W84A 1KM6A 4O1CA 1ZCOA 3V75A 5T26A 5HMSA 3FA5A 3R8RA 3FIGA 4BF9A 5AHFA 1THFD 1FXQA 4AHPA 3LTSA 4IQLA 5HWJA 2YFOA 2YPIA 1TRDA 5MHBA 2FIQA 3CIWA 1KLZA 1LTDA 4UFJA 3CT7A 4MY9A 3GZ3A 3DHDA 2Y89A 2J24A 1GT8A 2YSWA 4MFEA 1FQ0A 3TK7A 1A5AA 4JX5A 2XFWA 1ALDA 3MBDA 4KKXA 2VENA 2WQPA 2TRSA 4NU7A 4CCCA 1XM3A 5J5RA 1VZWA 3QM3A 3PY2A 3S1UA 1WV2A 5D05A 4GXMA 4NUWA 1UJPA 2OMAA 3MHGA 4ORMA 3DGRA 4PODA 2A7PA 2IQTA 4M6QA 4LUJA 4O1AA 4UIOA 2QCDB 1Z48A 5AC8A 3HPSA 3DKJA 3NOEA 3E0IA 4JYEA 1GJPA 4NX0A 5DBUA 1YPFA 1TYGA 4BR1A 3M0ZA 4NJKA 3HGRA 2C3ZA 2NWSA 2Y88A 3QYQA 4WOQA 3LXBA 3UWVA 3GX9A 4J9JA 1R47A 1HG3A 1LOSA 4R34A 2NZLA 4N2YA 5EA9A 1S5WA 5ABTA 1WBHA 2ABAA 1C9DA 3W2MA 1OFAA 2HS6A 3W76A 4UTMA 2JGYA 1WAUA 2HS8A 4UFHA 3NVTA 4NVTA 1HO1A 3T40A 1OF6A 3DKLA 4NJIA 3I7RA 5H91A 3U6WA 4EVZA 4LVGA 3C2EA 4HT3A 4FNUA 3HGSA 4M6VA 3A21A 3SZ8A 3KRZA 1H5YA 3TAOA 3CQ0A 3SW6A 1VC4A 5DY3A 4DBEA 1E51A 3EX3A 3OVRA 2KZHA 1UASA 1TV7A 2EPHA 3PBYA 3ABSA 1XBZA 2GUUA 5BOOA 3NA8A 1PHWA 1EX5A 5KITA 2V5BA 5CPMA 4IX2A 3W2KA 3W7GA 1K8XA 1PE1A 1DBTA 1LBLA 1MZHA 3L0KA 4O50A 2C6QA 3Q2DA 4RV8A 3DFNA 5A5WA 3JS3A 4PL2A 4UXDA 3TMQA 2G5WA 3W70A 2BWGA 3TE9A 1ICSA 3UWQA 4O28A 3W72A 3TIMA 2A6LA 3NQEA 5TQLA 1OX5A 1XFBA 3WK1A 3NL6A 3WK2A 4WY0B 3CC1A 3I7QA 3HBLA 3R5EA 3M47A 2G96A 1O60A 4IMDA 4EWND 1B3OA 4O13A 1ZNNA 3CWOX 3LRKA 3ZWSA 4UTIA 3TMLA 3W1TA 5DELA 1VYRA 1QR7A 4JY8A 3HMJG 2GVLA 3B4UA 1JR1A 2P1FA 3S9YA 3GVGA 3D0CA 3KXQA 1JQXA 4LVFA 1K7EA 2B7QA 3V1PA 3GAKA 4LV4A 3NL3A 2Y62A 1KM2A 5KTLA 2B7OA 4LW7A 4S2BA 2WO5A 4UC5A 4LS1A 2I9EA 3IGSA 1OFRA 2WSRA 4JIPA 3DI0A 3UZ5A 3NQCA 2V30A 3HG3A 3KVLA 4A3UA 3BK0A 5CZJA 2Y7DA 3L67A 1QFEA 5LSMA 5LHEA 1QPRA 3QH2A 3DBPA 2J9ZA 4PL1A 1SPQA 2AAMA 2J27A 2GVJA 5LGXA 4GUFA 2NWRA 2R8WA 5LGZA 2CZ5A 3QQ1A 1D3GA 2DZPA 1JQVA 2QCFA 3P8IA 2V8ZA 4W9TA 1HL2A 5FI8A 4LS2A 4RX0A 4N9DA 3NQAA 3PBWA 2VEMA 4LT9A 1LCOA 4LS0A 1Y0EA 1L6SA 2PE4A 2BX7A 3ATYA 4LVBA 1W5OA 2ZZ4A 2CZEA 3W7KA 4YXGA 3BLFA 2V82A 3GDTA 4IPJA 1H7XA 4Z0SA 3SIZA 1YPIA 3SJ3A 1OFPA 3TDFA 3W7OA 1L2UA 1CI1A 4N9EA 4RZ4A 3PUEA 3NG3A 1EWDA 1TTIA 2FLIA 3E02A 4QM1A 1XCFA 1XL9A 3QMRA 1EP2A 1VHNA 2OT0A 2VFIA 4GRSA 2VEKA 2ZYFA 3P5YA 3HGOA 3L65A 4XBKA 5DBTA 5FF2A 3THAA 4S2CA 3P82A 2DORA 1OFEA 2EKCA 1AW5A 5IBXC 1TPC1 3B0VC 2I1OA 1KTCA 4FNQA 4XKYA 2ZTJA 3M5YA 1WOBA 2A1YA 3NPVA 3W87A 5DY2A 5FF7A 4LTSA 4MKNA 4GBUA 3HG5A 3B03A 2X16A 3U8GA 1RQEA 1DORA 2Q3OA 4POCA 1UUOA 1SZGA 4FX6M 3EKLA 1FDJA 2O7QA 2D73A 1VYPX 3A5VA 1XXXA 4NXSA 3MUXA 1TTQA 2ZA2A 3IIPA 4NQ1A 4IXXA 4OWGA 3F1QA 4OU1A 5HJLA 4UTJA 1TMHA 1XBXA 2R14A 3T44A 4TR9A 4O14A 3B8DA 5AHIA 1JRBA 3W7QA 5C54A 2ZA1A 1BEUA 1JUBA 2Z6IA 2G97A 1H51A 4UMAA 4BWLC 2R94A 2C0AA 2VFEA 2YZRA 2XN1A 3W83A 1K8YA 3LLFA 2ZCGA 4UCGA 5HULA 3A23A 4FEZA 3BW3A 2BSLA 1R2RA 4JTTA 1ADOA 5F1VA 3VE9A 3CEPA 5D02A 4K7VA 3TUUA 2E77A 3UZJA 1B57A 1VCFA 1W56A 3P74A 2HMCA 1G7UA 1I2PA 4HSNA 1FWWA 3P81A 5FEWA 4X3ZA 3SI9A 3GKFA 5KMYA 2YW3A 3T7VA 2OT1A 3VE7A 5AYZA 2J88A 3WFAA 3SSJA 1OVDA 3UPWA 5AYXA 3K30A 2H8XA 5DLCA 3LBCA 4A29A 1FCBA 4M5PA 1R2SA 4DF1A 3SGZA 1GVRA 1YDNA 5K9CA 3DI1A 2H90A 1MEHA 2DZSA 1WQ5A 3RFAA 1FCVA 3PM6A 4O11A 3UY7A 2PURA 4EF9A 1EEPA 1PS9A 1Q6QA 3NQ7A 3EXSA 4ALDA 3L9CA 3R13A 3E12A 3MMTA 1DV7A 1TPH1 2ZZ2A 1XBVA 4R7JA 4UFKA 1P0KA 5DCEA 3HG4A 3O16A 4HNUA 2V2CA 1LRQA 4ML9A 2V81A 3UXDA 4QNWA 3W7MA 1B9BA 3FJ6A 1U83A 4I7VA 4DBDA 4PFMA 2A2IA 4TMBA 4QAIA 3BG5A 5HWNA 2CLOA 4N9CA 3W7DA 1X8FA 3OA3A 3W7LA 3OVQA 1GVSA 1SR9A 2Q8ZA 2WKJA 5TBOA 2Y63A 4KWVA 3NQ6A 2E09A 4QIUA 5H2ZA 4L4LA 3QPYA 3MI2A 3FOKA 3EWWA 2OCZA 2DZXA 2FFCA 3TH6A 4Z1BA 2Y7EA 1GWJA 1T99A 2X1SA 4MOZA 3Q58A 5HWMA 1QDSA 4IX0A 1SO6A 3G8EA 4RK8A 1KA9F 3C2RA 1OFQA 2X1TA 5CSSA 4AEOA 3BVJA 5LNUA 2EGZA 4FF7A 4MUZA 1DQWA 3LERA 5L9FA 5F2IA 5G1TA 3GXTA 3C0JA 2QUVA 4JICA 5HNRA 3CIXA 2H3BA 3W7HA 1TQJA 1FBAA 3UWUA 2PRMA 3ABQA 3W1UA 4NZFA 3S1XA 3WJYA 2AGKA 2NX3A 4HIBA 3TV8A 3W22A 1YTKA 2NUXA 2C13A 3FKKA 3EWUA 1LORA 1QAPA 3HG2A 1VGAA 5LNWA 1RPXA 2RKXA 4LY8A 4Y90A 1NVMA 3GKAA 4Y8FA 4RXGA 1T0OA 2A21A 4LRTA 5AHLA 5D2YA 1FWTA 3QRHA 1EUNA 1L6YA 2F84A 2XN2A 3G0SA 1B4EA 1TSIA 3LI0A 3TROA 5D2WA 3W7EA 3MP4A 1L9WA 3O8AA 2E6FA 2FPVA 4N9BA 5CZTA 2WOQA 4O1BA 3LRLA 2QDHA 4RLIA 2CZFA 5IBXA 2DZUA 4AAJA 3EX4A 3DFOA 4YCOA 4NX5A 1A53A 3BGJA 3W2JA 3LTYA 4FXRA 1DJNA 1JCXA 4QNEA 4HSOA 2OZ0A 3S5YA 1NF7A 3IVUA 2QAPA 5E93A 1F05A 4Z1CA 3B0UX 3BG9A 2A7NA 1T96A 1OX4A 1OJXA 5E0KA 3TAKA 1I2QA 3PSWA 3IIOA 1JRCA 1U5JA 4CNPA 4FHAA 3M16A 1EUAA 3LCHA 3PG9A 4HKPA 4XKYB 3NQ8A 3P7YA 1J2WA 4O19A 5U4NA 4UUIA 4TIMA 2NXIA 3MWAA 2QJIA 1QO5A 4NJJA 3WK0A 3W6YA 3S8HA 5FEXA 3QFEA 3W3OA 3DFPA 1UCWA 2E6AA 3M41A 2A6NA 1AK5A 2FPTA 4LRSA 4XTIA 4EOUA 1FUYA 3NL2A 1F73A 1H62A 5F4XA 3HB9A 3G18A 5AB3A 5K3VA 4JX6A 1Z42A 1H63A 2CLMA 2ISWA 2GPTA 5AHNA 2C18A 3W7IA 2EF9A 1H7OA 4IMGA 3QMSA 4LV9A 1P4CA 5G4WA 2ZFAA 1UBSA 4O4WA 1OYBA 2B7NA 1XI3A 1YTEA 3MYOA 3A22A 4WOZA 3DFSA 2ISVA 2X2GA 5I3HA 5DXYA 3CB8A 3P80A 3W1QA 4FX8A 1RD5A 2QCHA 1PIIA 5CZ0A 1XUZA 1W31A 2YX0A 2ZZ5A 3NO5A 1GZGA 3NYZA 5AYYA 1AW1A 3LB0A 3TW6A 1WBJA 4K37A 1TPEA 1B4KA 4E2DA 2A5HA 3BPWA 3GNNA 5BMWA 4C1KA 5F4SA 1LZOA 3KFTA 4O15A 3W1MA 5I3FA 1I2NA 4MZYA 4LC8A 3HGJA 3L5AA 3FS2A 4RKAA 3O07A 1HO4A 2PRLA 3W7CA 3WJZA 5I3JA 5CG7A 4UTKA 2E5CA 3KRSA 4UTLA 2E1DA 1X1ZA 3KAOA 2WPBA 3CHVA 1W0MA 5AC6A 3G3DA 3PC0A 2ZQ0A 4O0ZA 3NQVA 3RMJA 1X6UA 3GR7A 4FXSA 3CWNA 1PCKA 1LOLA 3TX9A 3LRMA 3IV3A 2QUTA 4O53A 1TTJA 3O06A 3VCRA 1ZALA 1EB3A 1WXJA 4X9SA 1P1XA 5IM51 3HPZA 3P67A 4IWWA 2E5BA 4JDYA 3EWZA 1GYNA 2EAWA 2Q3RA 3HF3A 4MZ1A 1LLZA 3P8JA 1K7XA 2VELA 4PC8A 4B5NA 3W2UA 3NZ1A 4A22A 3QW3A 1H7RA 3KVKA 2GOUA 3DZ1A 3GXPA 1F5ZA 4UTTC 5F2MA 3ZR4A 4CNOA 4TU1A 2VC6A 3O15A 4ADSA 1HUVA 1GQNA 1KW1A 2Y7GA 5EL1A 4Q32A 1X1OA 2BXVA 1ONRA 5F1UA 1ICQA 4IPIA 3TCEA 2BLEA 1OF8A 1OFDA 4N6FA 5TIMA 1F76A 1H1YA 3MHUA 4M19A 1MEWA 5LZLA 3PBUA 2DP3A 1KFCA 3GDMA 3THQA 3HQ1A 4OHQA 3VKJA 2JKAA 5EKYA 5DN1A 5EYWA 2TYSA 3NQ2A 2Z2UA 3QMTA 2QEZA 5DCDA 3LV5A 1AL8A 4UNLA 3W74A 4D2JA 1SSDA 3TU9A 4KWWA 4Z0JA 4UR8A 3NM1A 1EP1A 1X7FA 1SFLA 2ZRYA 4JTJA 2Y70A 5LHFA 2YXGA 1S5VA 2ZRWA 3L66A 3TQKA 3NQMA 2TMDA 3GIYA 1PVNA 3GK0A 4NNCA 5EMUA 3AO0A 2P10A 2CWNA 3IGXA 4O57A 4AVFA 1OYCA 1SW3A 5AOUA 1ME9A 3LHWA 3SGUA 4GUGA 2RDTA 4K8HA 3KVJA 4FNTA 3NAVA 1QPNA 3G1YA 4U4MA 3A5FA 3PVFA 1GEQA 1NAL1 1QOQA 4RZ6A 1I2RA 1IGSA 3GDRA 4IUOA 1DKWA 3JRKA 5D38A 1J5TA 4E38A 4JTHA 3UWWA 3B04A 1IXPA 2YGYA 5C2XA 3NZRA 3W88A 5HINA 4ZQRA 3G1HA 3IIXA 1W54A 1TPB1 4QSHA 2HSAA 2X1UA 3PUOA 2NV2A 4IOTA 4I7UA 3N9RA 4XTDA 3I65A 3W7RA 4K6AA 4ZQOA 3GB6A 3C56A 4GC4A 2QJGA 1G4EA 1D3HA 4JXCA 3OBKA 4GJ1A 2GQ9A 3I6RA 1VYSX 4CQ9A 3G8RA 3WJWA 1OX4B 3OVPA 5HR6A 1UUMA 5D2VA 1K03A 3LCWA 1VS1A 4HNNA 4TX9A 2QDGA 3QQ0A 3MP5A 4RZ5A 3WJSA 4JS3A 2CFFA 3DENA 2FB2A 3P62A 2C15A 5F2GA 1M7PA 5G4EA 3EWBX 4AHQA 1L6WA 5EY5A 3RNDA 3NQDA 4IMFA 3L2IA 2QCMA 1KFJA 3G22A 2X30A 4DXVA 1GVFA 4CQ8A 2W6RA 1G67A 1SW7A 4GUHA 2ZTKA 1KTBA 4PEKA 4UFMA 5CZSA 3H53A 4AMAA 5G2HA 4DO6A 1TB3A 2ZDRA 1QPQA 4BI5A 1KM5A 4P2VA 3TSDA 4ZVJA 4Z08A 1I8JA 1LRTA 3NXFA 5D2XA 4RR4A 2QCNA 3M7WA 3ANYA 3M5XA 5LNRA 3GYEA 3FLUA 1V5XA 5FEZA 4H6KA 4JTSA 2LLEA 2A7RA 2RFGA 4JNMA 2H8ZA 4AB4A 1Q6LA 4IMEA
chains in the Genus database with same CATH superfamily
4OBRA 1U30A 1IXNA 5F7UA 5HUPA 3TYUA 3UNDA 3IGHX 3WSUA 2HJPA 1O5QA 2WCGA 3GHRA 1DQXA 2WKLA 1FHDA 3TTEA 3BZGA 5C7HA 3GDLA 1MZRA 2Z27A 3S6DA 3BH4A 2BOFX 4O1DA 4NJGA 2CERA 3UCCA 3L4ZA 1H7WA 1BVWA 4TO8A 2ZZ7A 4HJFA 2OG9A 3M0VA 4PFHA 1S3HA 3F03K 4UTWC 4LCQA 4ZB0A 3K2GA 3AIVA 4HNTA 1VCVA 2CLFA 3FYPA 4LF2A 3S9ZA 2WANA 3MDWA 5CGTA 1H5VA 3TFCA 1YXYA 1LOQA 4GFIA 1WPCA 2YL8A 1TJPA 1KM3A 2FTPA 3H2OA 3WQCA 3FGCA 1H7PA 1XP3A 3Q4DA 3DFYA 4GJJA 2W79A 1FWSA 4BF5A 1KWKA 1GG0A 5AY7A 2EG7A 3AAMA 3N11A 2PI6A 1TRIA 1MFUA 4CCEA 2WSYA 4KESA 4AIOA 1CTNA 3WK3A 3LSCA 4IPLA 4PMVA 1W1VA 3B06A 1K8CA 2VX5A 2D0HA 3PBMA 3TZNA 5BWAA 4MTVA 5GJPA 4RJEA 2FQIA 1Z69A 4HNOA 3H54A 1UZ4A 3AMLA 1LJYA 2DU2A 2PLMA 3WL0A 3VFCA 4S3GA 3KDNA 3VIGA 4M1BA 4ZE5A 2A0NA 2OSWA 1TZ7A 3SCVA 3CU2A 3GIQA 2GSJA 2DGAA 2YBTA 3UG4A 7XIMA 5E09A 4RDVA 2PFHA 5I3KA 3W26A 2YKKA 3VD7A 2RUSA 3TJIA 2H9AB 1XRFA 3PZMA 3WMSA 2JIEA 2OWWA 3H23A 4JFUA 2WHJA 1OG0A 3VM7A 1P0BA 4XQ6A 5J8LA 1BSIA 5G2IA 4ADTA 3T55A 2IMRA 4FI4A 4O17A 1XIGA 1A3XA 4JTCA 1K9EA 2CEQA 4KERA 1DTUA 1H61A 1RY8A 4DY1A 5ABFB 1BXBA 4N7QA 5HQLA 2QGHA 2VFHA 3U2OA 3T0DA 2CU0A 3ZOAA 1EGZA 1BGGA 1CENA 2O7SA 3MKVA 4RW5A 5M5DA 1ZAIA 1QJWA 4ICCX 4HCLA 4IQDA 3UU0A 2WM1A 3RLUA 3TVAA 3QQWA 4HZ8A 3HV8A 3ABZA 1H3GA 4I7WA 3RLHA 1TJ1A 2XWEA 4PUMA 3ITCA 1F3EA 5JBEA 1FWCC 3AFBA 3RG6A 1SZNA 2QJJA 2FGBA 4JY9A 1YADA 3C3NA 1GJUA 3NNTA 5H8UA 3C2OA 4PSPA 1XSJA 2ZWZA 4LEQA 5BXTA 3TTSA 5LIKX 3QFWA 1OK6A 1SO3A 3STFA 1U5HA 2C8NA 3LCGA 3WJXA 4HU4A 2EBNA 3RCNA 4Q4QA 1FHLA 4BQ4A 4C6FA 2AGTA 3TW7A 4B9YA 3FNDA 4Y9MA 4D8ZA 1ELSA 3FSTA 4OKDA 4Q4OA 2OSXA 3GUWA 4Y96A 1JGMA 4UFIA 4AHOA 1WX0A 1V0KA 1Q45A 2EO7A 5E9AA 1QBBA 3UR7A 1RK6A 3A9BA 2WV8A 4M81A 1D9EA 3EWYA 3TA6A 3CQJA 1U2YA 3BSMA 1M5WA 4XBSA 3R89A 2VP8A 4QQ3A 2OB3A 5FESA 2WVVA 1CGTA 5CKSA 3PS7A 4UFLA 3F4DA 3RU6A 2DUAA 3CJPA 1HIZA 4PZVA 3NZPA 3NGFA 3BQ6A 4UQBA 3OLIA 5IOBA 5KETA 3UCQA 2PDUA 3AYVA 1KTNA 2HWGA 3AOFA 1ECQA 2IKJA 4O16A 2DZWA 3F4NA 3SN4A 3KDOA 4AXNA 5D9OA 4X2RA 3WMLA 1LT7A 5HUOA 1DP0A 3SEPA 3PBVA 2ALDA 4F2UA 2RDUA 5LNVA 4ZENA 1KBIA 3MVTA 3CMFA 1MYRA 4D6FA 1MO0A 5KZMA 3W1NA 4A05A 2CC0A 1WUEA 3KS5A 4DF0A 2GWGA 5D30A 4PH6A 3C52A 4L4MA 4JHMA 1FKXA 3K1GA 1QNRA 3VUSA 4YL2A 1XFCA 4C65A 3WLOA 4N02A 7ODCA 1Y65A 1OCJA 2BZNA 1VF8A 2X1IA 4C6EA 4W86A 1ZJIA 4JTRA 1GVIA 3WQFA 3B9EA 1VIZA 4XD6A 4G56A 1YYAA 4UTUA 2C19A 3UJRA 1HW6A 1A5SA 2GVGA 3MMWA 4QISA 1UUQA 3REQB 3TR2A 3IEBA 4NAEA 5CC3A 1WKDA 5FCZA 4K2SA 4P8WA 3QPZA 2F7FA 3CAVA 4JTLA 1R9XA 4DEFA 4GI9A 2B0MA 4QG6A 1W3JA 3W82A 2XFFA 1QOPA 4Q8QA 4X22A 1BHGA 4IXHA 1JCNA 5MKGB 3F2BA 2YOCA 3NGJA 4Y8EA 5G5IA 3BMWA 1N55A 4I5UA 3S2NA 1IXOA 1QTWA 4RDYA 5AHEA 4X0NA 4F0HA 3RCYA 2PDQA 2Z29A 2ZUTA 3BURA 1SZRA 4W7WA 1GQIA 4J27A 3N04A 3SR7A 2ZXBA 4GE8A 4PTMA 1QCWA 1B3YA 1VLIA 1P0EA 2XZ9A 5FOOA 4EXBA 4HPHA 3RM4A 5BMXA 3T0BA 2I7GA 2VZTA 2X1RA 1E55A 1ZUAX 5CPOA 1MNSA 2GJNA 3S2CA 3B05A 4GI8A 3LENA 3N2MA 1H1ZA 4J3VA 4DPQA 1GORA 3G5EA 1QK0A 2OWXA 2ZDSA 4W87A 3UPBA 1HX0A 3PZQA 4C6JA 4IG2B 1E0VA 1QI0A 1V3HA 3RUBL 3FSUA 1LF1A 3BO9A 3ECQA 1V7YA 2V5LA 2CCRA 4ACZB 5IFPA 2VQTA 1I4NA 3TN6A 1HNYA 1ZFJA 1XLLA 1C92A 3GH5A 3ARQA 4ZB2A 3M6YA 2GJRA 3UXIA 1HJSA 3LGDA 4PA8A 4OBTA 4CCDA 1DE6A 3LNPA 4B5SA 2SFPA 3VIIA 4MVAA 1XDLA 3W6MA 5E1QA 4GKLA 1FDZA 4J3SA 2Y8VA 1W8GA 3PBGA 1VJZA 2JEPA 1EXPA 1WUFA 2PDFA 2HZGA 4P7QA 2IQ0A 2FKPA 4L5ZA 4KBXA 1JDDA 4ZR8A 3PNUA 1KQZA 1VBUA 6REQB 4MYXA 3VFLA 3BLEA 1R5YA 2F6KA 4IM4A 3LZ5A 1GQJA 4HA3A 1PYMA 2BBFA 3OG2A 4IFRA 2ABBA 4XZBA 1V3IA 2D22A 4CLMA 4LBUA 1FXPA 3WQOA 4BK9A 4S39A 1KC7A 1ZSXA 2DVTA 2PD9A 3PUDA 4K8GA 4DELA 5K7JA 5F2LA 2NX9A 3DXIA 3BW2A 4KFNA 4F2TA 4N4QA 1L6FA 3NR0A 1IWAA 4PUWA 1JDFA 1HXJA 3RO6A 6TIMA 1JUEA 2ADAA 3EA1A 3IJIA 1VFTA 5DEZA 5LA1A 1A0DA 4K68A 1GVYA 2IW0A 4PR4A 1UD6A 3TJXA 1EF3A 1R3RA 1R0MA 1PAMA 2FPYA 3MT1A 3L0GA 3WEZA 3DBNA 3G3MA 3S47A 1G4TA 2QPUA 3M9YA 1JEZA 1IIHA 1XCXA 3PZ9A 3HV9A 1F4HA 4HA1A 4JOMA 3H7RA 2QPSA 2PGFA 3MW7A 4K36A 3UP8A 1KFKA 3RLVA 1WOAA 3M0IA 3IVTA 3QZEA 2GQAA 3U5UA 3GVVA 3VIKA 4FF5A 4M82A 2YB4A 3C3UA 3LM7A 4OV9A 4XSLA 4AYGA 3BJTA 3UFYA 4MLJA 1HP5A 1WAWA 4WSKA 1JULA 4PCFA 2XSAA 1CGWA 5CAKA 2E68A 2Y7FA 4R7WA 1XBYA 3H26A 3O3RA 5BNKA 3C0QA 2WXDM 4H83A 4KCVA 4WY0A 3A24A 3PB0A 4I6KA 3WYZA 7REQB 2ZRZA 3IIVA 3JR2A 4PMDA 4JIIX 1FWIC 1F6KA 2GJXB 3L5MA 1VR6A 3BOXA 1P43A 2WC4A 1QK2A 3T08A 1TA3A 4KH2A 4ZMGA 1MUMA 4XIAA 1W32A 1DJHA 2D24A 4W8LA 5L6UA 1C8VA 3WF1A 1XRTA 1AUSL 1J96A 3H4XA 4B15A 4NJHA 4WUIA 1A50A 5M3WA 2HTMA 4XWUA 4S3FA 3LHVA 4HU0A 4MYAA 4C5ZA 3K46A 1OABA 5BW6A 5A8OA 1O1ZA 3BCJA 3IIZA 4G9PA 1H0IA 4O8AA 3ZMRA 4W84A 2ONEA 4QROA 2PUZA 4PMYA 1UJQA 3ZO9A 1SSGA 4IP4A 4OBSA 1W37A 4FSAA 4E8GA 1EJ7L 4JX4A 4Z1AA 2VRJA 1KR1A 1WYIA 3A64A 3ABRA 1UH3A 1W5PA 3IRDA 1R9ZA 2EEXA 3PAJA 3QF0A 4UCFA 3T2OA 3H4WA 3ATZA 1B54A 3EKZA 1R3SA 1ICPA 1TX0A 1OG6A 4I6VA 1J11A 5BU6A 4WY0F 4AUBA 1XC4A 2PMQA 3VAVA 5HPCA 4YTSA 1TPVA 4L4PA 1JJKA 4HNVA 4GVIA 2FVLA 4PTNA 1UD2A 1PTAA 2C1GA 4O1CA 3ALGA 3F2CA 4C7FA 1RA0A 5T26A 1EH9A 4HK6A 3WF0A 4AHPA 5HATA 3LTSA 3ZT5A 2YFOA 2QPXA 3CUFA 3CT7A 1KBBA 2Y89A 2J24A 4MFEA 1R38A 3E1F1 1QW7A 1EHNA 3SBFA 4AW7A 2WQPA 5J5RA 1KQYA 3QM3A 1IWPA 4AZ5A 2VGFA 2V3EA 4GY0A 4EAYA 4Q8MA 3S2MA 3KBVA 3OZOA 2VNCA 1A0EA 4EANA 1X6NA 4LUJA 5AC8A 1V93A 3HPSA 3NOEA 4NX0A 3R0UA 3QR3A 3VD4A 1W1TA 3NDYA 1YPFA 1TYGA 3M0ZA 4GZJA 3QC0A 2UZ9A 5CLTA 2CBIA 4LH8A 1KRAC 1IT0A 2Y8UA 1JXJA 2X7WA 4R34A 2FVKA 2QV4A 1C9DA 1J6PA 1OFAA 2HS6A 2CPUA 2DSUA 2YDSA 4C6DA 4UTMA 1J0ZA 5CGMA 3AROA 1EQPA 2JIWA 1U1UA 1ZBCA 3PZVA 4XAYA 4EVZA 4DJDA 3BAJA 3AHTA 4FNUA 1CXIA 2P3ZA 3HGSA 3VNIA 1B3VA 4QJ3B 2BY3A 2J74A 3L4UA 3S2LA 3AZRA 5EMKA 3PJTA 2A3HA 8XIAA 2GWNA 4IJCA 5M03A 1GKQA 1XBZA 3GTIA 3NA8A 5KITA 1XH0A 5GJMA 1VFFA 2RAGA 3I6EA 4PMRA 1ONEA 1E1EA 4AEFA 3L0KA 3II1A 4RV8A 5A5WA 2PWEA 3TQPA 1W3HA 1JZ7A 2IKGA 2OU4A 3W70A 3KZSA 3TE9A 1ICSA 3WDPP 4PUKA 3UG5A 4JTAA 1YE4A 3TIMA 3NQEA 5TQLA 1FH8A 3I7QA 2ZX6A 3R5EA 3WF2A 2G96A 3KCOA 4ZSUA 3LS9A 1Z9AA 3H2CA 4EWND 4O13A 2XJ7A 3CWOX 3ZWSA 3TMLA 1T40A 3B8VA 3UZXA 5CXPA 5BXSA 1RJRA 4XAGA 5HPOA 2YBVA 1XGZA 1JQXA 1W91A 3M0LA 3WH6A 3MZ2A 1X98A 4DJDD 4LFYA 4X60A 4LV4A 3A47A 1KM2A 2B7OA 2OR2A 4LW7A 2WO5A 1XLKA 2I9EA 3IGSA 1OFRA 2WSRA 3DI0A 3UZ5A 3BZJA 1J6OA 1V79A 3NQCA 2V30A 3HG3A 1QNOA 4A3UA 2PZ0A 2Y7DA 2WC7A 3L67A 4Q8WA 3KLKA 3LLXA 4HTBA 2O9TA 3IK2A 3AJ7A 4GX9A 3A4AA 2XGIA 2CIPA 1NDVA 4PE8A 1JYNA 4UB9A 1E1CB 4R88A 1TG7A 3ARRA 4DAFA 1D3CA 3QHMA 4W9TA 4HNCA 4GYKA 3SQMA 2JF7A 1DWGM 2D2JA 3WLIA 1UR0A 2VEMA 4B3KA 2WNWA 4NHVA 4BZYA 2IUZA 3WUBA 2PLCA 2ON3A 3SCTA 3SAZA 1V6VA 1Y7VA 2ZZ4A 1HN1A 3BLFA 1R3VA 3WNPA 4IPJA 3AMKA 3SIZA 1NOWA 1YPIA 3SJ3A 1OFPA 2WCSA 4YVVA 3W7OA 2EPLX 2UWFA 1EWDA 1RP8A 1QU4A 4QM1A 3GFYA 3S1GA 4GLEA 4FMVA 1RALA 4D6CA 2I57A 1VIWA 2OT0A 3MUZ1 4GRSA 4PUNA 2PD5A 1AVAA 2VVSA 2WLYA 1S2VA 2GDUA 3P82A 4V2XA 1OFEA 2EKCA 3CO4A 1TPC1 5AVHA 3B0VC 3V5FA 2I1OA 4H2CA 1E0WA 3M5YA 2A1YA 1YRRA 3TC3A 1FWFC 3B03A 2X16A 2Q3OA 1DORA 4POCA 4EACA 1JCTA 1UUOA 5C9UA 4FX6M 4XD3A 1VYPX 1UA3A 4NXSA 2ZA2A 1GVEA 4G6CA 1B90A 4GQGA 1XBXA 3GE7A 4NILA 3B8DA 5CC6A 4C6QA 4V28A 3E0WA 1JRBA 3MKCA 5AYIA 1F8MA 3PP7A 4ZO9A 1F6YA 1GGOA 4BWLC 4E3VA 2C0AA 3JZEA 3GO2A 3W83A 1K8YA 4UCGA 3A23A 3QBUA 3BW3A 4JN8A 2XG9A 2BSLA 2OZ8A 4AQLA 3VE9A 3BAXA 5D02A 1V6TA 3QN3A 1B57A 4HYWA 3NCOA 1G7UA 1I2PA 4HSNA 4RNJA 1AZ2A 1DIOA 4PTVA 2YW3A 5KMYA 1GOKA 2PEVA 1O5RA 5AYZA 3VZYA 3WFAA 3OO2A 4PMXA 2PDXA 4B4FA 4C6CA 3BLLA 1UKTA 4DYKA 5AYXA 1E3XA 4CU6A 5DLCA 1FCBA 2PP1A 4LUTB 1R2SA 1EA9C 3SGZA 1GVRA 3FVMA 1JAEA 1YDNA 1BSLA 5K9CA 3IJ8A 2H90A 1MEHA 2DZSA 1WQ5A 4NF7A 1JZ2A 4O11A 1UBPC 3E74A 1EEPA 3AMGA 1DJZA 4I8YA 4QDPA 3M0KA 3W53A 3E12A 4HMNA 4NSBA 4UFKA 2FHCA 2W92A 3HG4A 4ML9A 5I6SA 1FHVA 1QNSA 3EMZA 3AQUA 3FJ6A 1NFPA 4I7VA 1G0CA 4PFMA 4QAIA 1KGXA 5HMFA 2BGSA 2CLOA 3OYXA 1XYMA 3OVQA 2Q8ZA 1OCNA 3C8NA 3ZJ6A 3THDA 3PK7A 1AJ2A 3NQ6A 4Z2HA 2J62A 5H2ZA 4L4LA 3SUUA 4GO9A 4HK5A 2OCZA 2FFCA 1YKWA 3TH6A 4UQEA 1Q6FA 2QYGA 4B5UA 4CU7A 2Y7EA 1TWDA 1I60A 4XKMA 3UXLA 3Q58A 3BMVA 1ZLPA 2WM0A 4IX0A 4LYPA 5CQ1A 1SO6A 3UA4A 3G8EA 3C2RA 3EPMA 4AYSA 2X1TA 2J8TA 2D0GA 3BLPX 5BU9A 2F8QA 1K4GA 5L9FA 4ES4A 2W67A 4D6IA 4YVXA 3MCMA 4J5NA 3EOEA 2HVOA 2PRMA 2FDMA 4NZFA 3WJYA 3LGGA 2WMJA 4U10A 1DHKA 4AVOA 1YTKA 1EO7A 2D3LA 1R3QA 3QY8A 4A3RA 3BV7A 3GQYA 1LWJA 3GVWA 5LNWA 1RPXA 3TEVA 2HK0A 1D8WA 1LWHA 4LY8A 1NVMA 4Y8FA 2A21A 3QRHA 2EJ1A 3IUDA 5EBAA 2F84A 2XN2A 1QBAA 4C6BA 4QS5A 1KCKA 5XIAA 3M46A 2D2OA 4XB3A 4IFKA 1L9WA 3PAOA 4N9BA 3EDJA 4RE2A 5CZTA 2QDHA 1EKOA 1U33A 4M29A 5EMYA 3ZLGA 2YCJA 3BE7A 3EX4A 1XLFA 2I17A 1GOOA 5CSYA 3BGJA 3W2JA 1A0CA 1DJNA 2V69A 3PTQA 4QNEA 5E9XA 4HSOA 4PTXA 2AAAA 3VKAA 3MTWA 2QAPA 1F8IA 1E5NA 1C7TA 3TAKA 4ZCWA 1JYWA 1EUAA 3LCHA 3PG9A 4XKYB 4D1IA 1U5VA 1Q65A 1US3A 4UUIA 4GGHA 2R6OA 1QI5A 1AQMA 4NJJA 2XU2A 4ZOBA 4MJ2A 1PZ3A 4PCSA 4CN6A 4MWAA 3DFPA 1UCWA 2E6AA 3M41A 2A6NA 1MQQA 3KHDA 2FPTA 4LRSA 4KS0A 3VNMA 1FUYA 3TW9A 3HB9A 3G18A 3DG7A 4DWSC 1XF0A 5K3VA 4JX6A 5DMNA 2HRWA 2P0IA 2YA0A 2W66A 4F3HA 2C18A 3W7IA 1H7OA 2YLLA 3N2CA 3IUIA 1UBSA 2Y1HA 3V18A 3KL3A 1FWBC 3A22A 4Q7IA 3BOLA 3VDCA 1D7FA 3USZA 2PWVA 2X2GA 3SO7A 3AI0A 5DXYA 3P80A 4BHYA 4C6NA 3E0VA 4HZMA 3GYCA 2VEGA 2J7EA 2VUYA 1OCQA 1TUXA 2FGLA 5I02A 3B8IA 2VEFA 4XVEA 3ZM8A 1TPEA 3RU8X 1E40A 2HPMA 2A5HA 2Q09A 4C1KA 2ZUMA 5F4SA 1LZOA 4B5WA 1ENUA 3KFTA 2INEA 1I2NA 1NOFA 2ESCA 3GM8A 3UR2A 3RITA 3N4AA 4ZFCA 1TWZA 2NQ9A 4RKAA 3O07A 1HO4A 2PRLA 3WJZA 4I90A 4A3YA 3BDKA 5CG7A 4UTKA 1EC9A 3QGKC 4C6LA 1ZP4A 3GR7A 4GI6A 1LOLA 2FFIA 4OVXA 3FGCB 3MUIA 4MWAD 2QUTA 2F61A 2YLAA 1ZALA 3GHSA 1EB3A 2PB1A 5IM51 4GINA 4DN1A 4DLMA 4QBXA 3K8LA 3P67A 2ZE0A 1JFHA 4IWWA 2UY5A 4IF2A 3KBMA 3HF3A 3V5CA 1VRXA 3CHFA 2VELA 3NIYA 3GDBA 2PDHA 3KVKA 4LYRA 3DZ1A 4UTTC 2DIKA 4U2ZA 3V16A 1XQLA 1KCLA 2CKRA 4QFUA 5A2BA 1EDGA 4QG8A 2R82A 7CGTA 3T8QA 1ONRA 5AKQA 1NWSA 4GI4A 3VKCA 5GPRA 7TAAA 4HU3A 5TAOA 4JQ1A 4UNIA 3CAWA 3KRBA 1UR8A 1VD6A 3URNA 4Z2IA 2DT0A 2Z2UA 2OVLA 3FCPA 3QMTA 5DCDA 1AL8A 3UNTA 2WCAA 4GZEA 3TU9A 4KWWA 4PRRA 4W5UA 1X7FA 1SFLA 3QY6A 5FSDC 1DXEA 4GBDA 4AZBA 1F07A 2D0FA 5EMJA 1K9DA 1PVNA 3GK0A 2P10A 4O57A 5IDZA 2H9AA 1ME9A 3PWGA 1E6ZA 3GVQA 3LHWA 4LAMA 4YHGA 3ZJ8A 1ZCCA 2PGRA 1QPNA 1JXKA 2EJAA 4U4MA 3RRXA 3NOYA 4FP1A 4XZHA 1BYAA 1IGSA 1J5TA 4RNFA 2QJMA 2Z00A 2YGYA 3WFLA 3H2FA 3E3HA 2BOGX 4GIAA 4ZQRA 1GOQA 5A69A 5FAGA 5ABFA 4QSHA 2X1UA 1QOXA 5B7YA 1OZQA 4IOTA 3I65A 4GCXA 3C56A 3UJSA 4YJ5A 3OBKA 2GQ9A 5CEWA 2E8YA 3EMQA 2OYLA 1ZJAA 1KWGA 3OVPA 3EWCA 1JDCA 3P0XA 5D2VA 4DJFC 1W9DM 1VS1A 3IUHA 4TX9A 2QDGA 4FALA 2BVWA 4U3CA 1RJPA 3DENA 2FB2A 3ZIZA 3P62A 4MDPA 5CG0A 9RUBA 3PTDA 1M7XA 1M7PA 2GGHA 3VUPA 3KWSA 2R1KA 1R7OA 3L2IA 4KEUA 4DAIA 2AKMA 4OIFA 1W9BM 4ZOAA 3R1ZA 2VX7A 4CQ8A 2G37A 1SW7A 1RP9A 1KTBA 4AMAA 2XH7A 3DYOA 5G2HA 1IZJA 2BVTA 2W63A 4E5TA 4J35A 4B92A 3TSDA 3U2ZA 4ZVJA 2ACUA 3EOOA 5D2XA 1E0UA 3E5BA 5RUBA 1W2PA 2AMGA 4NZ5A 3CZJA 4CN4A 2PTWA 3FLUA 1V5XA 4F4RA 4XZLX 3GG0A 2MUCA 1PX3A 1VFSA 3UCDA 1V6XA 2J66A 3P60A 2BHYA 2GUYA 4FIRA 1A5MC 2J75A 2JKEA 1A3WA 3T78A 3SECA 1UB3A 5D4YA 1UPMB 2WLZA 2W3ZA 3PUGA 4H6EA 1SVDA 4XUGA 3TLLA 1E4MM 3MBFA 2J7CA 1YEYA 1UMLA 1TR1A 3S5ZA 5CJNA 1W5NA 1JPDX 2W4XA 3C4UA 4JL2A 2BASA 4J3XA 3VZXA 4O8RA 3UD6A 1Z44A 4DX3A 1E70M 3ENLA 3OQEA 1XKJA 2NT0A 2Z25A 1YLVA 1PKYA 1O66A 1QI2A 3W71A 1EDQA 2RJHA 3PR2A 5JQ9A 1GG1A 2WMHA 4IPNB 2QUUA 2QCLA 1YBQA 1TZZA 2P8BA 1BXNA 5AC7A 1R87A 2J9XA 5FF4A 1Q6GA 4XAZA 3TLQA 4LWWA 2YDQA 4OE7A 2A85A 4HGXA 3E0LA 1KCZA 3LHYA 3CH0A 1R3YA 2INFA 1QO2A 2DV0A 1HGWA 3SN1A 1NFGA 3L5LA 5FA5A 2V2HA 3RX3A 4QCFA 4Q6JA 3LXCA 3MSGA 5LKYA 1V0LA 4UR9A 4XZ9A 3O6CA 4D6DA 3SY1A 4CQCA 2DJLA 1W3NA 4O0KA 2D1ZA 4EPKA 3TYCA 2ATSA 4MGGA 4EP8C 1GZJA 5EMMA 3H6OA 4J4KA 2P50A 1F61A 2XN0A 1JCMP 4ROQA 4Z1DA 4KIEA 2XWDA 3LHUA 4L9XA 3I3BA 3QGVA 4O18A 3REQA 5ABHA 5C7VA 5K2ZA 3IVSA 3V1HA 3HO8A 3LQGA 5FF0A 3EA3A 3KBSA 3MO7A 4Q3MA 3R4IA 3KL0A 5MKGA 4FX7A 4JYDA 2VFGA 4LBRA 5TD4A 4YHEA 5FIPA 1H50A 1NELA 1P48A 4WDWA 1VEOA 3SN0A 3ES8A 2OX1A 3C8FA 3ZVIA 4XZNX 1ITXA 1E71M 3W00A 1Y5XA 1NJJA 1UR3M 3EEGA 1MW2A 1YW1A 3A9IA 4DQWA 9XIAA 2GVEA 4GUIA 4TVUA 4DUWA 4IJBA 3MMDA 3FHAA 2PSNA 3G0XA 4O1EA 1V4YA 1TPDA 4AXKA 1XPGA 3FW6A 2DW6A 1ESWA 4D6EA 4JDBA 3U2CA 1UKOA 1NQKA 1WA3A 3L0NA 3PJWA 4DF2A 1Q8JA 4IG2A 4H9XA 4HPNA 4LUSB 3AIUA 4DVOA 4TMCA 4XVDA 1DIKA 3RILA 2ZX7A 4KW2A 1QRQA 4ACZA 1W5QA 1DVJA 1GYMA 2TSYA 1K02A 2OEJA 1DWFM 3CEUA 4A2RA 2XM2A 4LU0A 4CVUA 5C5YA 1SM9A 3NFUA 2QCEA 4QG9A 2KAUC 2RGMA 3GU1A 3WIJA 1RQBA 3AXIA 3CUIA 4BWLA 4X0VA 3DIPA 3IAPA 1DYSA 3SCRA 1GTEA 1OC6A 3N34A 5D37A 4R33A 1J2BA 4TOQA 1CCWB 1U1HA 5JMUA 1TPFA 1AD1A 1YX1A 3J7HA 3W1AA 1LQ2A 2IXVA 3WBAA 1CECA 3ZS4A 3DX5A 4JD4A 2V2DA 5A8GA 4QLJA 1J0YA 3SADA 4A21A 4C1LA 5ABGA 6REQA 3W1XA 3CL6A 5M2FX 4DYEA 5JH2A 1O4UA 1OYAA 4NI8A 4H9VA 1V3MA 2DIJA 3ARWA 1ZAJA 3BSHA 3MO4A 4FLQA 1MQPA 4NZJA 3W75A 3MY9A 3OGRA 4O12A 2FH8A 1MEIA 4PMOA 1KBJA 4JFVA 1W1YA 2VRKA 4Q6XA 2BV9A 3VOJA 2FTYA 3LN3A 2WNZA 3CGTA 4GVGA 2PP3A 4HN4A 3CPRA 3EBVA 1OB0A 1BVNP 1OGBA 3STPA 4LOCA 1Q3NA 4NZ1A 4MLRA 4M7TA 1T6MA 1VH7A 3MSDA 3CMJA 3OLDA 1RQHA 3LSBA 3OZYA 1UWRA 2XGZA 3VCCA 4BCEA 1QWKA 4LX4A 1JIBA 3OIXA 2NUWA 4HTYA 2J8FA 2NXGA 1VENA 2CLEA 4NXKA 1UQYA 3UVAA 1GEHA 1VKFA 1TIMA 3BAYA 4ZZ9A 1KV8A 4OOUA 2PAJA 2PCQA 1TFVA 3S83A 2VCBA 2WJEA 2QV5A 4Q4KA 1XG3A 3UJFA 1V08A 4BQ2A 1NH6A 1E15A 4EE9A 3YPIA 5M17A 4BI7A 2QDDA 7ENLA 2VJXA 3AALA 6TAAA 3G24A 4MUPA 4Y9NA 2DT1A 3G1FA 4NZ3A 3TFXA 1P0DA 3BLKA 1TPWA 7REQA 3R43A 5LIUX 1R86A 3LOTA 1K4HA 1T8XA 4JQ4A 3W23A 2REQA 3R0DA 2GJXA 3INPA 3UY8A 3SUTA 3SUWA 4XK2A 5HMDA 3POCA 1LM1A 2C71A 3O0KA 4FR6A 1V8EA 3SY5A 1H2JA 2Z2AA 2XISA 2UV8G 4HPJA 1KM1A 3BV4A 4WD0A 1RV8A 4MKSA 3R7MA 5U7SA 2V9DA 4N4PA 2V0TA 3QVQA 2J7HA 2W9MA 4CKQA 1CX9A 4Y6GA 3VNDA 2ZICA 2WZMA 4JN6A 4H7ZA 3N1AA 5GNYA 1K7FA 3BMXA 4F0LA 2BGQA 1S2TA 3O05A 1IR2A 4WKHA 1DL3A 1ZJBA 3DFTA 5A6SA 2AL1A 1GOXA 1JFXA 2VYOA 4NKCA 5AC5A 3OHIA 3GTXA 2ICSA 2NV1A 4HHPA 3RX4A 4P7OA 2ZZ3A 1FWRA 3VI2A 3W07A 2DY3A 3HMCA 3TN5A 1CLVA 3DCPA 3EMCA 1TVNA 3L21A 2YJQA 3P0WA 3R8HA 3JZUA 2OQLA 4CD6A 2ANUA 5A6AA 2Z1BA 3GTHA 3VDBA 1UP2A 2OYMA 2DQXA 3LPGA 1YDOA 4OT7A 1RR2A 2OGYA 4QEHA 3TYAA 3LCFA 4HMCA 5AHMA 1NWTA 3L2MA 5D03A 3LPOA 4ZL1A 4JTKA 1JCJA 4DM2A 3BICA 5SWUA 3E96A 1JDEA 2VDGA 3WD3A 1IR1A 4GWEA 2GQ3A 3FYOA 4M3PA 1HTIA 5JH1A 1A5BA 2NXHA 5BOFA 1OC5A 5D2TA 1XS2A 4TVCA 3TOPA 2RH9A 5CPTA 1QW8A 3TP4A 3LHZA 5H6HA 2XH4A 3S5NA 1OK4A 5D09A 1HP4A 1C8XA 1HJVA 1ZY9A 4CD7A 1XSKA 1O1HA 2HK1A 4K1WA 4ASTA 1SZEA 4RDWA 4MB4A 3NJ3A 1EA0A 1HL9A 4IGHA 3OHMB 4NT0A 4W88A 4QJ5B 5FD0A 3BANA 3P3BA 1TV5A 2H3DA 5I00A 3BGAA 4O4VA 3OODA 2YA2A 1BF2A 4MZ8A 4YCPA 1EYEA 4MB3A 4AF0A 1BGAA 1Y8BA 2CHRA 1ZTVA 3ICJA 4K3ZA 2Y6ZA 1E43A 3KTSA 1KCXA 1LDCA 3WF3A 3SRKA 2J6VA 1VQTA 2YR1A 4JKKA 3WNKA 4FO4A 2YFNA 1GOIA 4QITA 5DANA 4ZQNA 3WQ8A 3U9IA 4WZHA 2OEMA 1X7IA 2QR6A 1DEDA 1WZAA 1UP0A 1OINA 3QSRA 4FS9A 3LCLA 4QE5A 1DXIA 3T81A 5DF0A 1GOMA 1O95A 1W1IE 2OJPA 4LY4A 2QUMA 2FMOA 5GVJA 4UTTA 1YTDA 2DZTA 1WO2A 3KRUA 4ACYA 1W1B1 2DDXA 2J9YA 3WBYA 1KFEA 3QC3A 3GLCA 1UR4A 3QSTA 5CH9A 2NT1A 1ZENA 2AKZA 2HBVA 5AC4A 1SU5A 1UZDA 5D9MA 4L64A 5G4HC 3CQKA 3CUGA 1UKSA 3TSMA 4FXJA 2B7PA 3B9OA 3M64A 1YXCA 3ARUA 1OGGA 3HA1A 4AX6A 3ELFA 3KM8A 1V3KA 4IMCA 3FJ4A 4KCWA 4OV4A 1QWGA 3DUGA 3WNLA 2GJPA 4H2HA 4UMBA 4REQB 1FWJC 4MB5A 2QIWA 1GPFA 2B4GA 1I9CB 1F3XA 3GNPA 3PPFA 3PULA 1VPXA 2QF7A 4HA0A 3S3GA 2Y5SA 4GUJA 4JTDA 4G1KA 3H4GA 4R27A 5BWFA 1B30A 1EWEA 4JTGA 1ISZA 3WX7A 3S6OA 3U7BA 2PF0A 3LLDA 4E8CA 2PTXA 3DDMA 4Z42C 4GABA 2WNQA 1XLAA 3NPXA 1W3IA 3GRIA 3TNBA 1TMLA 1Q6EA 3G1SA 3CLWA 4L9ZA 4XIMA 1LP6A 1RLDA 1S1PA 4GX8A 2R1MA 3SCUA 2PC4A 4RW3A 3ERPA 4NZ4A 1E1CA 3O9NA 4DJFA 2CLIA 1EXBA 1RBLA 2BHZA 3O1NA 3BAWA 4BQ3A 4H9TA 3I68A 4MNKA 3MS8A 4HYRA 1SFJA 1IEIA 4UTHA 3NQFA 3DU0A 4YLWA 4AY1A 1UOZA 1V77A 1A5OC 5LIYX 2JK2A 1DIDA 1EJRC 1O5XA 4ZQPA 4ORIA 3DGBA 2DSZA 1M7JA 3LCXA 5T9BG 2NQJA 2EKGA 1Z32X 3NO1A 3W84A 4PEEA 1PTDA 2X40A 3L2LA 1SYTA 3RAOA 3WELA 4OFCA 3R8RA 3FIGA 4BF9A 3A4WA 5AHFA 4WKFA 4DNMA 2NVCA 3K4DA 2FIQA 1LTDA 3W0KA 3AIEA 1JF5A 4L4OA 4KGLA 4NASA 4H8VA 4CCCA 2OLSA 2PP0A 4A35A 3WQVA 3S1UA 5D05A 4NUWA 1UJPA 4ZE4A 3WNMA 1XLCA 4PMUA 2CKSA 4PODA 2IQTA 5HQMA 1XYZA 4UIOA 2QCDB 5JU6A 4JYEA 4DJFD 2DZBA 1BXCA 1ISWA 1C9WA 2XPKA 4BR1A 3V36A 3HGRA 1RA5A 2NWSA 4J9JA 1K6AA 1OCBA 1S39A 1KR0A 1HG3A 4H8HA 8RUCA 3GG8A 2XVGA 2NZLA 1Z6KA 3I10A 2X0HA 1WBHA 2IQDA 2HS8A 3EOUA 3QKZA 5EMLA 2Q01A 4NVTA 1HO1A 4FLOA 3BWWA 3SQLA 2W91A 3A21A 5FACA 2PZNA 3HQPA 1PYFA 3KRZA 5CPQA 4B3LA 3L4YA 5CSUA 3VMOA 3EX3A 3JW7A 3DG3A 1GQKA 4L1XA 5FJUA 3OVRA 2KZHA 3WL1A 4DBWA 4E3TA 1TV7A 5FJOA 3PBYA 3H8AA 1EFZA 3ABSA 4PRTA 2V5DA 4RDZA 5CPMA 3VMPA 4H7VA 2ZVIA 1K8XA 1PE1A 1DBTA 1LBLA 1MZHA 4O50A 2C6QA 3OOQA 1XLJA 3DFNA 4IP7A 3GBDA 4PL2A 4UXDA 4IIBA 3O7UA 2XVNA 3QKEA 3P2VA 1W9VA 2FZBA 4EXQA 1K9FA 4YTQA 2A6LA 4D71A 2VGGA 2YXOA 1XFBA 3WK1A 2ZXDA 3NL6A 4D1JA 3CC1A 1H0GA 5BYWA 1XYAA 2AQVA 2OSYA 2ISFA 4Q8TA 4CU8A 1O60A 2BOEX 2WPGA 2O4MA 2CHNA 4JAWA 3G2GA 3FHQA 4JY8A 1QI4A 3B4UA 1RLCL 1GW9A 3S9YA 4ZO8A 1UROA 3D0CA 3KXQA 4WDTA 1PBGA 3ITGA 3OGSA 4TV6A 4S2BA 4IIHA 4UC5A 5KZ6A 4LS1A 1T41A 3UPMA 4ZTYA 3LZ3A 1BYCA 3THCA 3BK0A 1Q2RA 5CZJA 5A6TC 3H7VA 4V33A 5LHEA 1QPRA 1VB9A 3QH2A 5I03A 2EQDA 3BQ5A 4FOUA 4PL1A 2J27A 2AAMA 1UHVA 2GVJA 2OZTA 4GUFA 2NWRA 2R8WA 5LGZA 2CZ5A 3U7VA 3WFZA 2Y0FA 1NTHA 4JHZA 4CEXC 3P8IA 3ARXA 4WJXA 4IHCA 1HL2A 5FI8A 1CBGA 3PBWA 4ERIA 1Y0EA 4JFSA 3FDKA 1JGIA 1FRBA 1G5AA 5E5CA 3H24A 3QYSA 2CZEA 4YXGA 2V82A 1WDRA 3GDTA 2PWDA 2XSBA 4Z0SA 4MAZA 4G7FA 5E6ZA 3ZZ1A 1XRVA 1L2UA 1L8PA 3LY0A 4N9EA 2O9OA 3T2QA 3NG3A 3CL8A 1RUSA 2UBPC 2FLIA 3V0TA 1XL9A 4MADA 4FOKA 2G3MA 2WYSA 3QMRA 1VHNA 2VFIA 1HJXA 3WUFA 1M65A 1LG1A 3L65A 8A3HA 5DBTA 4GNVA 5FF2A 2DORA 5IBXC 4ILSA 1UIPA 3KUMA 4TQTA 4XKYA 3ZR6A 4ATDA 1TCMA 2D69A 5FL1A 1B3ZA 4BY3A 1FWEC 3FN9A 4UOJA 3EKLA 1FDJA 2D73A 3A5VA 1XXXA 3IIPA 3URBA 4NQ1A 3UYIA 3SSZA 4TR9A 4H8UA 1JYXA 2I5IA 1RBAA 5AHIA 1VEPA 3W7QA 5IDIA 2OX4A 4LB4A 2QDEA 1DQUA 1XICA 2ZA1A 1BEUA 1GUVA 3ORWA 4UMAA 2IXUA 4M8UA 4U5KA 2VFEA 3RN6A 4O1FA 1XIMA 3RGTA 4EK7A 2ZCGA 1XLHA 1FOBA 1N82A 3NSNA 1R2RA 2CZVA 4JTTA 1ADOA 5F1VA 3T9PA 1TELA 1TV3A 3TUUA 3R8GA 2E77A 3PZIA 4WEVX 1VCFA 3N15A 3P81A 5FEWA 3TONA 3SI9A 3K8MA 3TYBA 4HOXA 1LL7A 3T7VA 1XH2A 5T91A 2OT1A 3GD6A 1JI2A 3VE7A 3DYMA 1PDZA 2V3DA 3SSJA 3N17A 1OVDA 1BQCA 2DIEA 3M0XA 3UPWA 2OKOA 3K30A 4GH3A 4E2OA 3M0MA 3LBCA 4XD4A 4WGHA 3QTGA 4L9YA 5EFDA 4IISA 1ITUA 1SFSA 1FWHC 4CNUA 3BXWA 3XISA 1RH9A 3DI1A 4H9YA 3UY7A 5A8QA 1MW0A 1J0JA 1PS9A 3M0YA 5HAOA 4ALDA 5EB8A 3A13A 1MRQA 1L0PA 1TPH1 2CNCA 1XBVA 2ZZ2A 4R7JA 1JI1A 3IJ9A 4HN8A 1FA2A 3O16A 2V2CA 3ITVA 1ZQ5A 3UXDA 5A6LA 4DBDA 3BG5A 4N9CA 3KP0A 1JPKA 1GVSA 3CMGA 3WBWA 3KOXA 2Y63A 2POTA 4TX8A 4WCJA 4QIUA 4INFA 3FVDA 3QPYA 3TYEA 4ZEPA 3FOKA 5CLWA 2NQ5A 1V6YA 3AXKA 4H9MA 3OB8A 1S38A 1QDSA 4WLCA 4RK8A 2A3CA 4PULA 1OFQA 4AIUA 3ZSSA 4PB3A 3BVJA 3QOKA 4XO7A 4A8NA 4C1NB 3DC0A 1K70A 5LNUA 2EGZA 3DN5A 3EWDA 3LEPA 3OLGA 1MNZA 3T0CA 1UYQA 3DESA 2E9BA 2QUVA 3W7HA 4HNLA 3KWXA 1H09A 4AZHA 3OVGA 1FBAA 4IUGA 2Z1XA 2VZOA 1QVBA 1W2VA 3TV8A 4CNSA 3W22A 2C13A 4JPGA 3FKKA 3EWUA 1Q7QA 5IXEA 3HG2A 4YIWA 1VGAA 2RDXA 4MG4A 1UWQA 4Y90A 1F4AA 3WQEA 1TMQA 4LRTA 4Z2LA 3KCJA 1FWTA 2ISDA 4LANA 1GQLA 1BYDA 4J28A 1L6YA 1R85A 4S3EA 3AZSA 3G0SA 3CS2A 1EQCA 3TROA 4DYJA 3U4FA 3UZZA 1VJSA 2E6FA 3GS6A 2FPVA 3LRLA 1PX8A 1WZMA 5BXPA 2V3FA 3L4WA 4V15A 2DZUA 4AAJA 3DFOA 2FVMA 2BB0A 3OP2A 4URIA 1J01A 3LTYA 2HNHA 2FH6A 1WE5A 4V27A 4LAUA 4DIAA 2E25A 4UBPC 4KRUA 1V7AA 1NF7A 3WLSA 4HK7A 4Z1YA 2A7NA 2CESA 3WDQA 3AHYA 3GUGA 2GDVA 5REQB 3VNKA 1JPMA 3ZVHB 4G5DA 4JKLA 3NQ8A 4KRTA 3W6LA 2OYKA 2ASHA 4TIMA 3HQOA 1JL8A 2ZIDA 4PGLA 4Y9PA 1BG9A 4GCAA 2WSPA 3W6YA 1OT2A 2XH2A 1Q4NX 3P6LA 1PTGA 5DQPA 1AK5A 2QXWA 4C6IA 4EOUA 3THUA 3VTRA 3TTOA 3QV6A 3FXGA 4GZIA 1H62A 5AB3A 1Z42A 2ISWA 5AHNA 5FJPA 3TCSA 4MHBA 3BL3A 2B81A 4LV9A 1ITQA 2ZFAA 1UPPA 4M1RA 4O4WA 1O7AA 5C9WA 1NDYA 1YTEA 1J9YA 1PDYA 3MYOA 3ITYA 1W9UA 4QLLA 3CB8A 4GISA 1OSEA 2QCHA 2HCVA 4DJEA 2UY2A 2FHFA 5I09A 4WDUA 1W31A 1WXZA 4H00A 4GIYA 3RPTA 2ACQA 1LWIA 1DPMA 3QXBA 4JIEA 3SRHA 5CBIA 3TW6A 4RNIA 5A8PA 4GVFA 1I1WA 4V1YA 1CXHA 4JQAA 4O15A 4EPEC 5I3FA 4MZYA 1W3LA 3HGJA 1XIEA 1XLEA 4R3UA 2WZIA 3OQ8A 3UGRA 1NP2A 3VGEA 1IHIA 2YCIX 4L6DA 2E5CA 1YBQB 2PTYA 3KBJA 2NSOA 3RMJA 4FXSA 3IK4A 3H2NA 1NU5A 3K5XA 2PDIA 4KGJA 2CWXA 2OKTA 1SJDA 3IV3A 1C90A 3SGGA 4IMAA 3MJMA 1GZ1A 1P1XA 2BY0A 4XBJA 2G4FA 4Q7BA 2PDKA 3EWZA 4KWOA 1GYNA 4DUOA 4MZ1A 3P8JA 1K7XA 2YL5A 4PC8A 3NZQA 1FVPA 2WBKA 3W2UA 4B5NA 1H7RA 4H6RA 5F2MA 1F5ZA 2BFGA 4DWDA 4CNOA 2Z7GA 1RSCA 2VC6A 3O15A 1GQNA 2Y7GA 1X1OA 2VMFA 4DJED 2HXUA 2VDHA 3ID7A 2GUBA 4ZO7A 2PWHA 1MEWA 3PBUA 4KEVA 4GIEA 4OHQA 1HF6A 1C8QA 5EKYA 5DN1A 5EYWA 3OGVA 1TV4A 3W74A 4LJ3A 1ZZMA 2R1PA 3Q65A 1E0XA 2L5HA 4ZGYA 1I0BA 4H8NA 1MW1A 1BD0A 2YXGA 5BXRA 3L66A 2BVYA 3KEHA 4AVFA 5CC5A 4IGMA 1SW3A 3LK6A 1QHZA 3SGUA 4K8HA 1ZU8A 4FNTA 3NUKA 2YDRA 2JQXA 2QJNA 5A6MA 3A5FA 3PVFA 1QOQA 1I2RA 4IUOA 5LYRA 4E38A 1DKWA 4H04A 2IKHA 1IXPA 5GNZA 5C2XA 3CZGA 2EXOA 3W88A 1DE5A 3G1HA 1ZS2A 2GL5A 4DI9A 4M56A 5PTDA 1S5MA 1A4LA 4I7UA 1CB7B 4LQ1A 3W7RA 4S38A 1PXGA 4PBGA 4GJ1A 1JAKA 4IGSA 4J2MA 2XDFA 3KE0A 3G8RA 3WJWA 1OX4B 1YDYA 4D8LA 5BROA 4LUSA 5HR6A 1UUMA 2PA6A 4WSHA 1PKNA 3EGJA 3MP5A 3PHAA 4JS3A 1M41A 1QPKA 3U57A 3EWBX 1FWAC 1L6WA 3WQPA 2VZUA 2X30A 1XCWA 3E2VA 1NOUA 1XLGA 5GNXA 4UFMA 3UT0A 4Q7NA 1TB3A 4W85A 4BI5A 3WN6A 1RY0A 5I78A 4Z08A 3NXFA 4CD4A 3JVAA 4RR4A 1FHUA 2QCNA 1RBOB 3M7WA 3AUOA 3M5XA 3NSXA 3QHOA 3UESA 6XIAA 4H6KA 4JTSA 3GHTA 2LLEA 4JNMA 4YNGA 1HKWA 5ABEA 2H8ZA 4IIEA 4AB4A 2XFRA 1Q6LA 4IMEA 1VFLA 1E9IA 1BTMA 1FX6A 5XIMA 3CUXA 1AQ0A 3CUZA 4MAVA 1EPVA 4LCRA 2YIHA 3RR1A 2BY1A 3UQNA 3DAQA 4Q8PA 4KQNA 2ZXQA 6ALDA 3MJYA 3NEVA 3TC7A 3M44A 1OFBA 2ZBTA 4B16A 3KVMA 3DOPA 4FR1A 3DFQA 2FZDA 1GYLA 2QGYA 4B90A 3EWXA 1SQ7A 4J40A 5I06A 3AJXA 2NSXA 4ZQCA 5I0DA 1CGXA 4DNHA 1TQXA 2QUNA 3B0XA 3UZYA 5DFAA 5HNNA 1IXQA 5K9DA 4HB7A 4QJ1A 3UEQA 4FNPA 4LGXA 3V0SA 1MXSA 4P5UA 2F9RA 2VVNA 3EOLA 4L1WA 4NRRA 2VCAA 2BTMA 5LIXX 6PTDA 3NPWA 1EZWA 1TJRA 2ZKMX 1OHLA 1QNPA 1RD6A 4O10A 3PFRA 4IL0A 4FNRA 3ANVA 1AG1O 3NQGA 3VNLA 4K39A 4JN7A 3MCOA 1EP3A 1BAGA 1E72M 3QLDA 1GHSA 2FGZA 4GKTA 3LPFA 3MV01 1C8YA 2X0SA 3TJLA 2ZRXA 4JEQA 4M51A 3WLKX 3NL5A 1XC6A 2REQB 2E9MA 2D2HA 1KV5A 4NNBA 2WMKA 5AVNA 1XD1A 3G6LA 4R7OA 3W81A 1TV8A 3AXXA 3LTPA 2F2KA 2EPMX 1J12A 2WJZA 3UETA 3LV6A 3W7PA 2WNNA 5K9XA 1FCQA 1TVPA 1P1MA 3UXAA 1WDWA 5A3HA 3W7NA 4P61A 3W1LA 3RR4A 3RF9A 3ZFHA 3D5HA 1JUKA 4UOZA 4TTGA 1BQGA 1AMKA 2Y2WA 3MI3A 1OZMA 2EG6A 2PDWA 2C91A 1HFBA 4QE4A 4N6EA 2OOGA 4H4IA 2HVNA 2YW4A 3UG8A 4C90A 2BVDA 2JALA 3E49A 2I14A 3W1RA 5AFDA 2NX1A 1SUXA 1Y5WA 3T4CA 1UH4A 1EGVA 2DVXA 4JYFA 2WVSA 2VHLA 5G1YA 1P0NA 3PWAA 1OX6A 3TA9A 4B91A 3GFXA 4ML4A 3U4AA 4D72A 2NLIA 5BRBA 2HPIA 3LNMA 4UQ9A 2G3JA 2O9RA 3I7SA 3VPLA 1Q66A 3AWOA 3VOGA 3B8WA 4DWSB 4Q8UA 1FFQA 1MQRA 2G3IA 1REQB 3CBWA 4H1ZA 1DOSA 3EA2A 5CSRA 4WQ6A 3VDAA 2C1HA 3S9IA 4M7SA 1NM9A 5JBFA 2GQ8A 5DCBA 4MJMA 3MKKA 4F9DA 1WDDA 1GPWA 1A5CA 3W86A 1S2WA 1B0IA 4A6GA 1W8SA 2WC3A 4JIRA 1RCXB 2ZADA 1VBJA 2E4TA 2CITA 2QT3A 4BKNA 2PPGA 3OLEA 5HJXA 1R2TA 4FLSA 2DH2A 4PYSA 4DB7A 3WNOA 3CT2A 2DVUA 3CNYA 1ZBWA 4MJZA 4Q22A 3MYPA 4GIRA 5HQEA 2NQHA 2XVKA 2BNJA 5D9NA 3EXRA 2E6YA 3QY7A 1S2UA 4PMNA 4JTIA 3ALFA 4ZO6A 4G8TA 2ISSA 3OU8A 2CLLA 4Z2GA 1RK5A 1DJQA 1L8NA 2XIIA 4AF0B 2GFTA 2YZ5A 4UTWA 1XUUA 2EHHA 4O54A 1G4SA 4LBSA 1MWOA 1PZ0A 5DMLA 1CGVA 5D8ZA 1US2A 3MHFA 4DHGA 1Y5VA 4PUEA 4CUCA 1B5TA 1VFUA 1CW2A 3A4XA 1XV8A 1IEQA 3H55A 3T07A 1SO5A 3IJ6A 1JCYA 4XZIA 2WVTA 3L68A 4A8RA 2AOSA 1XGDA 3RXZA 3CXOA 3VGDA 4WXYA 2AMXA 3SFKA 5A8MA 2GGJA 2JGQA 4Q8OA 1FH7A 1RHCA 1PCWA 1K8ZA 5E70A 3R94A 3EX6A 1KM4A 2WSQA 3DHFA 1XGEA 2Z1KA 3M1ZA 1I2OA 5G2WA 2QJHA 2DQWA 4M0XA 1B9ZA 4KEMA 3UWZA 4JR5A 4XAPA 2X05A 2ZRUA 2Q02A 3HURA 3NVDA 3RO8A 2QQ6A 3WLTA 1YE6A 1QASA 4GFSA 1I75A 4PBFA 3W9ZA 4H9UA 3M7SA 1J4EA 1S1RA 4LYKA 3WMCA 3QV9A 1SFTA 3SQSA 2W0UA 2YA1A 2INZA 1G69A 4LPCA 3ZLFA 1OM0A 1KFBA 3GTNA 2F6UA 3LUTA 2ZXAA 2PDCA 5I77A 4REQA 1IF2A 5E0FA 1KFWA 2XM1A 3WD0A 4JHOA 1JVNA 2WWCA 4Y2WA 1VPQA 3O6AA 1NIUA 4G7EB 2PDBA 1IZCA 2V67A 3N19B 3Q67A 2DUZA 2PLKA 5CPNA 3QJAA 2AL2A 3GW3A 3OA5A 4HD5A 4V1XA 4DZ5A 4WF7A 1OQFA 2XIQA 3GY1A 5EU9A 4NNAA 2RDWA 4JTUA 4WHBA 2VEIA 3VGGA 1FTXA 2OEKA 4JGDA 3T42A 4OJYA 3ZT7A 2Y85A 1YXDA 3CAKA 4DLFA 3B4YA 1YNYA 4AD3A 3AU2A 5D32A 3W27A 2RGLA 1NFBA 5I7GA 1LROA 1WP6A 1R30A 9CGTA 4MIMA 1S2CA 3FXYA 2ZZ1A 4B5XA 3E9AA 3CV1A 3P61A 5D33A 2Z26A 4IFOA 4ONVA 2H6RA 1H1NA 3F7JA 4WJ8A 2VFDA 3MA8A 1G6CA 1TCDA 3W85A 4ZFMA 1WDQA 4CQAA 4KFPA 1RAKA 3QV7A 4E0CA 6A3HA 3ZWTA 2VGIA 3S1VA 1E6XM 2Y5JA 1C93A 3MWCA 4MY1A 3QHNA 4IH3A 1MMFA 5BRPA 4FAMA 3UA3A 1EF2A 4J1OA 1BKSA 4YTUA 1JZ4A 1NSJA 2A4AA 3KCLA 3R2GA 1DWIM 1P7TB 3UERA 2HISA 4K8EA 1V0NA 2V68A 3N73A 2VD8A 2E5DA 4EF8A 3VM5A 4MB1A 5HNUA 4J3WA 1H7NA 2VX4A 1HKVA 2BODX 1IIGA 3F5LA 3STEA 2DZAA 1Q6OA 3RYSA 3LCIA 2WMIB 3DHPA 2CZDA 4YS1A 1ZL1A 2YL9A 3OG3A 4FOJA 4DUXA 3BC9A 3VGBA 3W4RA 2GJLA 4EPBC 1EOKA 2QCDA 4Q4SA 5C6MA 3RX2A 4KF1A 1XDJA 4YN5A 3V0UA 1BWKA 3LGEA 1IQ8A 5EBUA 3LPPA 4FB7A 3MPGA 2JE8A 1W6TA 4QP0A 4P8XA 3TTYA 5EPDA 4D8AA 1FWNA 1UZ1A 1PZ1A 3H12A 2OPJA 2W5FA 4HA4A 1PV8A 3B8SA 3DEQA 1GVOA 1SMAA 3RM8A 4AY7A 4D6GA 1SO4A 3LHTA 4BF7A 1PO9A 2WZEA 1JCLA 1W17A 1W5MA 3LI1A 2ZA3A 3FAWA 3TYDA 4AWSA 4DJDC 3TR9A 1BRLA 4L56A 3EB4A 1JPHA 4QSFA 1ME7A 4FA3A 4ICNA 4E4PA 4XZWA 2GSHA 2WK2A 1W9XA 2FJKA 3BG3A 3CHCA 3WQ6A 4QEEA 5HR7A 4GQ0A 3W2NA 4OOZA 5FL0A 4GNKB 1WXYA 2YCEA 3AU6A 2D23A 4BEQA 3BARA 2Z24A 1JF6A 2WJDA 2PCEA 2WZHA 3GXNA 3HTWA 3WH5A 2VR4A 3C61A 5C0QA 2FTWA 5M1TA 3M07A 3SIMA 3S2JA 4E6MA 3R6IA 1ZHAA 2P88A 4QR6A 3B0PA 1O12A 3TXVA 2V5KA 3L4TA 4UMCA 4RE3A 1JNEA 5CJ5A 1ZB5A 2CETA 1EIXA 3MP3A 3T4WA 3AICA 4ZSTA 4DO5A 4QHRA 1UH2A 3CUJA 3TZFA 1CT5A 1BWVA 4NL1A 3HPXA 3UF9A 2QAFA 3W73A 3DFHA 1KXVA 1VCGA 1VHCA 1O94A 1C29A 3WEMA 5K4ZA 4X63A 1KLYA 4QX4A 3QOMA 4LVDA 1OADA 3W1PA 1KBKA 2J77A 4R85A 2Y61A 4LNYA 2J4GA 3UR8A 3LD5A 3HQNA 3HJZA 2JF6A 3EZ4A 1MRAA 3N2OA 3IRSA 1M7OA 2VEPA 3UZWA 4Q4MA 4PB4A 4A2SA 3M5ZA 4AD4A 3LBMA 4XISA 3QZAA 3GU2A 1PSCA 3BLIA 2OQYA 3RRAA 4YTRA 3Q45A 4GHRA 3JUGA 3Q37A 3T09A 3WQGA 3CZ8A 3MI6A 4YU1A 2Z6JA 4UR7A 1CXKA 2IPJA 2D3NA 2EPOA 3LM3A 4J3UA 3BGGA 1A5NC 4R9XA 1X6LA 1BPLB 1TR9A 4JTEA 2VZSA 1KM6A 1O68A 1K9TA 2OO6A 4PUDA 3B8TA 4I3GA 5I79A 3V75A 5HMSA 1UC4A 4UZUA 2D2GA 1QW9A 3HFYA 4AIEA 3TYZA 1VPYA 3WDRA 1THFD 1FXQA 4IQLA 5HWJA 4JEJA 1M1BA 3RJXA 1NY1A 4LYQA 3WCZA 3TTQA 1KLZA 4UFJA 5HANA