1K8ZA

Crystal structure of the tryptophan synthase beta-ser178pro mutant complexed with n-[1h-indol-3-yl-acetyl]glycine acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
268
structure length
257
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 98
structure length 257
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k8zA00
3F4WA 2EKCA 3W71A 2ISSA 4AHQA 3QFEA 4N6FA 5AC7A 3GAYA 3FOKA 4TR9A 1K3UA 4WY0F 1FCQA 1H1YA 5CPMA 5A8GA 1CX9A 3LCHA 5FF0A 1I8JA 1H7XA 1HL2A 3LHWA 2CW6A 2Y62A 3INPA 1TPWA 3UZ5A 4ADSA 1VRDA 4HN4A 3S5YA 4LC6A 2ISVA 3NQCA 5FF4A 2J88A 1I2OA 3QF0A 1GEQA 3EWYA 3S5NA 2AQWA 4ALDA 4XTIA 4MJMA 1B57A 2G96A 3W1XA 1P4CA 2QAPA 2ZTKA 3NGJA 4E2BA 1VR6A 1WBHA 3A23A 5D2YA 3LGEA 1W5OA 4LU0A 4FXSA 4PL2A 4GUHA 3MI2A 4NZJA 5F1VA 2Y61A 1XUZA 3PY2A 4GUFA 3EWBX 5C5YA 1Z48A 2YW3A 3PBYA 4IMEA 3FEMA 3NPXA 1P0NA 3QC3A 1TV8A 3W7KA 1F74A 1EEPA 3EWXA 1VPXA 1TV5A 3S0CA 2CLHA 3OVPA 5EYWA 2V2DA 3NA8A 4RZ4A 5KZDA 3ABQA 3VE7A 3TSBA 4A21A 4BFAA 3DU0A 3IVUA 3HB9A 3O05A 1G6CA 2H3BA 2PE4A 4I9AA 1E51A 3LRKA 3HQ1A 3IIOA 4N9BA 3B0VC 5HR6A 2CZFA 4NJHA 1JUKA 2PC4A 3DHFA 2E5CA 2X16A 2QCMA 5DY3A 5FI8A 1IIHA 2TMDA 3NYZA 3H54A 4N9DA 4GXMA 2BWGA 3TFCA 3PM6A 3NR0A 3W73A 3MMTA 5C2XA 3M5VA 3W6YA 2ZQ0A 4OHQA 4C1LA 5D05A 4LRSA 3L5AA 5AHEA 4WUIA 3W75A 3QH2A 4Z1CA 3W1UA 3O07A 3MYOA 3QMSA 4O17A 3TQVA 4DF0A 1R2TA 3HIJA 4O4WA 4UFMA 2WV8A 4UTLA 4CLMA 4K39A 3WJYA 3NM1A 2J24A 3OA3A 3DI1A 1DJNA 4NX0A 1Z44A 3MYPA 1FWSA 5G4EA 3DH7A 1QCWA 1GVRA 4JTJA 1YDVA 1W5QA 2ZZ2A 2BLEA 3W2KA 1TJPA 1PVNA 3WFAA 3FKRA 3JRKA 2J9YA 1CW2A 4M6QA 3EXRA 2J6XA 4EOUA 1OF6A 2Z6JA 1FXQA 1NF0A 3L68A 1DJQA 1RVGA 4NX5A 3TE9A 1T8XA 4GJ1A 4E0CA 1MEIA 2Y7GA 4NJIA 2FB2A 2Z6IA 4DF2A 4DBEA 3LHUA 3WJWA 4AHOA 2NXHA 4A22A 3BG9A 5LNWA 4P2VA 4POCA 3W1TA 1PV8A 5BRBA 4MUZA 3R13A 2VEPA 4AB4A 4U4MA 4Y9AA 2ZRXA 2Y70A 5KSWA 3NQGA 2E1DA 2NUXA 4MVAA 1R46A 1DQXA 5F4WA 2Q8ZA 2E6DA 2OT0A 2ZYFA 3M43A 5DCDA 3PUEA 4XBKA 5FEZA 1BEUA 1EIXA 1ZENA 5D03A 3TX9A 2BTMA 1BTMA 4XKYB 1LROA 4IGHA 4N2YA 1FUYA 3B0UX 3B03A 1KV8A 3GR7A 4O14A 1GVQA 3RFAA 1HUVA 3ATZA 3DFSA 1I4NA 4X2RA 4O1CA 4LC8A 3G3MA 1B4EA 2QCLA 3S9YA 2P10A 2YR1A 3R2GA 4RZ6A 3NL2A 1C9DA 2HSAA 4LT9A 3G1AA 2V81A 4N4QA 4BI7A 1M6JA 3CTLA 1TYGA 4IMFA 4YCPA 4NNBA 1K02A 2PRMA 1JJKA 3TK7A 2Y85A 3C2FA 1L2UA 1N55A 4YL2A 2ABAA 4JTGA 4RR4A 5H2ZA 4UFJA 3VE9A 4FO4A 4UTIA 1ZY9A 1XUUA 3HGSA 5E93A 4KWWA 3C0JA 2DZXA 3S1UA 1WBJA 3KVLA 2ALDA 2QDGA 1A50A 4JTUA 4RXGA 4OU1A 2XN0A 3B8DA 4O13A 4B5NA 1W5MA 2E68A 1EPXA 4UR8A 5DCBA 3TIMA 5TQLA 3N19B 1ICSA 3LBCA 3EX2A 3L0GA 1QPRA 2WNZA 3W2UA 3E02A 1EP1A 1IF2A 1H5YA 2JK2A 4UFHA 3T7VA 5AC6A 5HNRA 4UR7A 4PL1A 4ONVA 1W3TA 2NXIA 4QNEA 5AHMA 3W87A 3WJZA 2X2GA 1VQTA 1GT8A 3NQ7A 5FF2A 1YPFA 4H4IA 3F03K 4BK9A 4WZHA 3PBUA 1RZMA 2Y7DA 3W7GA 3EB2A 3W2MA 3TSMA 3UD6A 5HMSA 3C6CA 5BMXA 4S1FA 1SO3A 3L65A 1AG1O 3C2RA 1GVSA 3LX9A 5LHFA 2W79A 3IIVA 3B04A 3SGUA 5GVJA 4YXGA 1U5JA 1IXQA 5KZMA 4X22A 1GYLA 3EXSA 3P62A 4UNLA 3W7NA 4MY1A 1TTIA 1RD5A 1XM3A 2ZZ3A 2YSWA 4ZZ9A 3OBKA 4LNYA 4QQ3A 2BXVA 4Y8FA 1EX5A 3E0IA 4XZ9A 1RV8A 4MJZA 2DZTA 4LV4A 3HOJA 3ABOA 1PHQA 1TPDA 2JKEA 3W85A 3FKKA 1O94A 1B3OA 3STEA 1KM4A 3DFOA 4LS0A 1GVFA 3P80A 2AGKA 5DCEA 1VJIA 1WDWA 1YDNA 6TIMA 1YTEA 1KFEA 4R33A 3L5LA 3LCGA 3O63A 1NF7A 3MWAA 5ABTA 1F5ZA 1SZFA 4FX6M 4DF1A 2Z2UA 4PH6A 3TV8A 1MEWA 4Q33A 4JXCA 3JS3A 4AAJA 1DV7A 5F2IA 1TIMA 3GVGA 1GG0A 4FB7A 1AMKA 2YYUA 2AAMA 4M5PA 1UCWA 3I7RA 4NU7A 3GDLA 3MJYA 2GJNA 3A5VA 5AYZA 3BGJA 2RH9A 5LZLA 4FNPA 2E5DA 1QMLA 4E2DA 1R2RA 1KBIA 5D37A 3BLFA 3WJSA 5I3FA 1OVDA 3W7OA 1TPFA 3PULA 1K7EA 2Y7EA 1T99A 3G8RA 1YLVA 3LTSA 3LTYA 5AYYA 1XI3A 3TR2A 1GG1A 3HPXA 4GE8A 1JRCA 4MKNA 3LI1A 3TFXA 4O0ZA 1F05A 2Y63A 3G1FA 1S5VA 4ORIA 2X1SA 1L6SA 3NM3A 3W83A 1VZWA 5CPLA 1N7KA 1A5BA 2DP3A 3DKJA 1VGAA 4H3DA 3MP4A 4UTKA 4JIQA 3G8EA 1W37A 1WXJA 3LTPA 2A4AA 2YYTA 3P7YA 3A24A 4NQ1A 3QQ0A 3KRUA 5LSMA 2PCQA 3S8HA 1GVOA 4E38A 2RFGA 2H8XA 2TYSA 5F4SA 1JCNA 3FYPA 2JBMA 3CQ0A 5FEWA 5AFDA 1L6YA 2WO5A 1LOSA 1SW7A 1H7WA 2CLOA 5AHLA 5HWMA 4GWEA 4MOZA 4YCOA 5I3HA 1OFRA 3LCXA 4JICA 5U4NA 3STFA 3W2JA 1EP3A 1MXSA 1JCXA 3GAKA 2CZDA 4O1DA 1VLIA 3BVJA 2EAWA 2WJZA 1S5WA 4AHPA 3CWOX 2J27A 3W74A 1I2QA 3HO8A 3NQFA 3QSTA 2J9ZA 4JD4A 1NAL1 3NQ8A 2NX9A 5AB3A 1AK5A 3QSRA 4OGZA 3TC7A 1QPQA 1RQBA 4A3UA 4GBUA 3NZ1A 3HGOA 1PL9A 1OX4A 2XFWA 1ZAJA 3S6DA 2CLIA 1YDOA 2A0NA 3TAOA 4GFSA 5HUOA 1BWLA 4ZQCA 1G4PA 4IXXA 5HUPA 5FEXA 3BG3A 3HGRA 1SR9A 2GVGA 4JY8A 2QKFA 1H50A 2QCFA 1QDSA 1I2RA 2TPSA 2YGYA 1W5NA 1H7RA 2ZTJA 1KLYA 4LS1A 5FESA 1GPWA 3HMJG 1LBFA 1ZHAA 1VCGA 1Q45A 4ADTA 5F2GA 4NJGA 4O4VA 5HJLA 4RX0A 3STGA 4M7SA 4IQLA 3W9ZA 3QPZA 4IMCA 3N14A 1CI1A 3MI6A 4CCDA 3G18A 2HS8A 3FS2A 3PG9A 4JYFA 3RK8A 5D09A 3UNDA 3GDKA 4ZL1A 3QEZA 3L67A 2J9XA 1VYRA 4RCXA 1QNVA 3S42A 3HJZA 2E5BA 1GJPA 5C55A 3IIPA 3W76A 1A53A 4GNJA 3C56A 4O28A 3UZJA 1P1XA 1QFEA 1LDCA 4A29A 1FDZA 2OX1A 2QDHA 3UWYA 1TJRA 4Z1DA 2OZ0A 2RDTA 3EKZA 1ME8A 3MHFA 4AXKA 3CC1A 1G69A 3W70A 1SW3A 2X30A 1XBXA 2E6YA 4IX0A 4QAIA 1TMHA 3OVRA 5EBUA 4BI5A 2GQAA 3GX9A 4JEQA 4CQ9A 2FIQA 3MHGA 1FX6A 3VFLA 2FDSA 2YW4A 4JS3A 1D9EA 4FX8A 4HIBA 1WOAA 4N02A 1JRBA 2X1UA 1V7YA 1FCVA 2C13A 2QUUA 3P8JA 2VFIA 5DLCA 4LUIA 4CNPA 1EUNA 1DVJA 2FPTA 1KFCA 1Q6QA 5KINA 3NPUA 3CIWA 1H63A 2O7QA 3A21A 5L6UA 4DELA 3G1VA 6ALDA 2YZRA 2CZEA 1OX5A 1K8XA 3W07A 3PBWA 1XBZA 1WQ5A 2B4GA 3W7DA 1GTEA 4EF9A 2V5BA 4JTSA 4OE7A 1JCMP 4AH7A 5BOOA 1LRQA 4MFEA 4EVZA 4JTHA 3GZ3A 3NQMA 2Y89A 1HTIA 3WK0A 4ZMGA 3SGZA 1AW5A 4DXVA 3LHYA 3NL5A 1TTJA 3PSVA 3HPZA 4HSOA 1SZNA 1ZCOA 3THAA 1EB3A 4PEKA 4ZQMA 3W7IA 3ZR4A 3HPSA 3P60A 2FFCA 2HMCA 3L2IA 3C52A 1GQNA 1QO2A 4K37A 2BX7A 3PB0A 2EF9A 3T44A 2BSLA 3NQAA 5LNSA 1ICPA 1DBTA 2YCEA 4LOCA 4O50A 4TO8A 2NX1A 3W1RA 3DBPA 2A7PA 3RMJA 1OABA 2QCNA 5HQEA 3N2MA 3HG5A 4Z1AA 3P81A 2V9DA 4ICNA 4JIPA 4ZQPA 4RKAA 2QCDB 3EX1A 1SPQA 3UPBA 2YXGA 4BF9A 4UTHA 1LCOA 3W7CA 4AF0B 4JTTA 3GB6A 1UBSA 5K3VA 3I7QA 5CSRA 3UQNA 1MEHA 3LLFA 4UTJA 3M44A 3VKJA 5CG7A 2O7SA 4A2RA 4TMBA 3CIXA 4IUOA 3SFKA 2E09A 3QMTA 2V8ZA 2DZSA 3NOEA 3SJ3A 1HG3A 4O18A 4JYDA 1U83A 3QMRA 4CCEA 3F1QA 3S1VA 2VELA 4TU1A 1HFBA 1TPUA 1KFKA 3IVTA 2CFFA 3D0CA 1RR2A 1LOLA 4JY9A 2ZZ5A 3JR2A 1QPNA 3SW6A 1EUAA 2F7FA 1UB3A 4K8HA 1B4KA 1YTKA 1IGSA 2HTMA 5H91A 1OK6A 3EKLA 1K8ZA 1VS1A 5EY5A 1JVNA 2UV8G 3UWVA 2ATSA 1RQEA 1TRDA 1DORA 3CB8A 1UUMA 5AYXA 1VHNA 1M7PA 4L4LA 5EPDA 1EA0A 1JR1A 2Y88A 4HPJA 3IRDA 4AWUA 4UCGA 2XN1A 3W2LA 2IQTA 3KVJA 4WX2A 3WK3A 4HPXA 1XDLA 2H90A 3TJLA 1X1OA 3NDOA 1W5PA 3GXPA 2R14A 1KTBA 3Q37A 1Q3NA 1S5TA 3W7JA 3M5XA 5F4XA 4R7JA 2ZZ1A 2QCEA 5KITA 3CU2A 4K38A 1I2NA 2NXGA 4O0KA 4H6KA 1G67A 1F73A 3TQ0A 2ZRVA 3NQ2A 1S3HA 3QW4B 4NT0A 4UFIA 3GKAA 2FPVA 2XN2A 5MHBA 4K6AA 2C1HA 4LS2A 4K8EA 4K36A 4IXHA 2CWNA 2WSYA 4HNNA 3PG8A 3M5YA 1OFAA 4I7VA 1IXPA 1JUEA 4O15A 4WY0B 3THQA 3DFTA 4LVGA 4IOTA 3GXTA 4MFDA 4ZQOA 5TBOA 2WNQA 1PS9A 2BZNA 1TO3A 3FJ6A 3N9RA 2PRHA 5KMYA 3I68A 3LBMA 4O12A 3R8RA 4QJ1A 1ZALA 2V5LA 5G2IA 1TTQA 4JX6A 2QJIA 1DHPA 3UY7A 2VEKA 3DGRA 3E49A 3M9YA 3DENA 3PUDA 1D3GA 5CGQA 3ZWSA 3RLVA 1M5WA 2I1OA 4GUJA 5C6MA 5G2WA 4N6EA 1VCFA 1W31A 4PODA 4RK8A 1SZEA 1J4EA 4MPQA 3MBDA 2A6LA 2VEIA 3O6YX 5DBTA 5D04C 4NNCA 2EHHA 1KA9F 1HO1A 3KRZA 1Q6LA 3GKFA 5CPNA 3H53A 4DPQA 2QCGA 2A2IA 1K8YA 2R91A 4UFLA 3B0PA 3MUXA 1TCDA 5G1YA 4JTIA 4Y6GA 4Y90A 1T0OA 4TIMA 5J5DA 1O60A 5AC8A 3SY5A 4JTEA 4WXZA 3LERA 1UASA 2QEZA 4PTNA 5EA9A 3W7RA 1FBAA 1OFOA 3DAQA 3QQ1A 3M41A 3ZFHA 4I7UA 3NZRA 3LHZA 1XCFA 3BK0A 3LHTA 5F1UA 2VKZG 5BNKA 1WAUA 1H7OA 3USBA 4ZQNA 4UFKA 1QAPA 3IGUA 4Y96A 3NPVA 1YYAA 5G1TA 4X9SA 1X7FA 2NWSA 2NUWA 1NVMA 3T4CA 3G24A 2C15A 4NJJA 4JX5A 1J2WA 2P1FA 3NPWA 4PA8A 1LM1A 3O6CA 3LCFA 3BG5A 3GDTA 3BW4A 1L9WA 3AJXA 3BLEA 3I7SA 1PCKA 1XFBA 5LHEA 2ZRYA 3M0ZA 3TQKA 8TIMA 4FNRA 4KWVA 1KTCA 2X1RA 2DZUA 3NQDA 5F2LA 2V82A 5HWJA 1LRNA 3O16A 3W1QA 4BR1A 4FXRA 1NFBA 2WNNA 2V30A 4BWLC 3I6RA 2FTPA 3TW6A 3EWWA 2KZHA 4DQWA 4FEZA 3MBFA 3UWZA 3TU9A 3DZ1A 5EKYA 1TPB1 1UUOA 5CKSA 3PR2A 3S1XA 4QM1A 2F84A 1KM1A 4BWLA 3LCIA 4LVAA 2GJLA 4N4PA 1Z42A 1PCWA 1TPC1 4KKXA 4FIRA 4XTDA 1LLWA 3HBLA 2VC6A 2ZZ4A 3W2NA 1BWKA 2ZA3A 3IIXA 1IXOA 3NVTA 2ZA1A 4LTSA 3UPWA 5I3JA 3W7MA 4O8RA 1FWNA 2VFGA 4LV9A 5AHNA 4M19A 2C16A 2NUYA 2DZWA 3O6DA 1HO4A 1ADOA 2JGQA 2YX0A 4QNWA 1AW1A 1DL3A 1JUBA 5EMUA 4O53A 1TPVA 3VNDA 5DBUA 3TMQA 3L0NA 3SI9A 2JKPA 3BO9A 5EL1A 5CZSA 2QJHA 2CU0A 1JQVA 2ISWA 1K7FA 4UTTA 2QF7A 3VI2A 4R34A 1KM2A 2VEMA 4AWTA 3LXBA 3NQ6A 3P67A 2RKXA 1C29A 1QOQA 3FJLA 4XKYA 1R47A 1O5KA 1XBVA 4X3ZA 2WPBA 5HINA 3S5ZA 3M5ZA 4N9CA 2Q8LA 2C3ZA 4HNTA 5IM51 4MY9A 2B7PA 4EWND 2E77A 4Z1BA 5HWNA 4UTWA 3M7WA 4UMAA 3KX6A 1G4TA 3P8IA 4DBDA 4MY8A 3BGGA 5DXXA 1THFD 1K03A 2C18A 3C61A 3W7PA 5C54A 3EX6A 3L0KA 3UY8A 3KVKA 3HF3A 4AMAA 7TIMA 3U6WA 3MI3A 3W7HA 1FY6A 1KFJA 1DKWA 1G4SA 3RU6A 3T40A 4OV9A 5BW6A 2GOUA 2D73A 1KBJA 3BV4A 4O1BA 3TJXA 4Z0SA 3A5FA 1OHLA 4MIMA 1X8FA 5T26A 2PURA 2TRSA 4MZ8A 3G1YA 1VC4A 2LLEA 3S1WA 2E6FA 4EF8A 3Q58A 1VHCA 5K9DA 4FHAA 4LW7A 1B9BA 2H3DA 3NEVA 3LXAA 2GUUA 4IPIA 2W0UA 2C0AA 5FEPA 3YPIA 1O5XA 5G4WA 5AOUA 1F6KA 3STCA 5D2TA 3IGXA 2A85A 1FWTA 4AVFA 4JTFA 4RLIA 3W23A 4HNUA 1XDMA 1PIIA 2VOMA 4FNSA 2FQIA 1TREA 1SO6A 3NL3A 2V2CA 4HNVA 1H60A 1TRIA 1G7UA 4M6PA 4LWWA 3W72A 4QSHA 3N73A 2JKAA 1EP2A 2ATMA 5CSSA 2VFHA 1I45A 2OCZA 1KM6A 4YLWA 2RDWA 5LGZA 3ZS4A 3OEXA 4NXSA 3FA5A 4DPPA 1YTDA 5D32A 3HG4A 2QR6A 3KFTA 3UXAA 1GTHA 3TROA 2NWRA 4FNQA 1Y0EA 3SR7A 1FWRA 3T55A 2A21A 4MLJA 1V5XA 2ZDRA 3W7QA 4XBSA 5D2VA 4YWIA 4O1AA 2NV2A 2NX3A 1LBMA 3P82A 4FNUA 2PRLA 1DOSA 5G2HA 5FF7A 1AL7A 3W7LA 3LI0A 3W3OA 2W6RA 1Z41A 3O06A 4D2JA 4IJBA 3G1DA 3U8GA 2YPIA 4NVTA 1ZAHA 3W1AA 2A6NA 2B7OA 1YXCA 3C4UA 1WV2A 1LP6A 5DY2A 5FF3A 2Z0IA 1FCBA 3E96A 1SFLA 3B06A 5DN1A 3FFSA 3R12A 4NUWA 3ELFA 4ML9A 3LM7A 4O54A 1H1ZA 1GYNA 1FXPA 2GQ9A 1XL9A 3N34A 2YFOA 5I3GA 3QRHA 3BLIA 4Z08A 1EWDA 5D38A 1W56A 3BW3A 3L21A 4Q32A 2B7QA 3NL6A 4JDYA 5LNVA 3GDMA 2NV1A 5KTLA 4JR5A 3G1SA 3KXQA 3O8AA 1A5CA 1LTDA 3O1NA 5D2WA 4U28A 3HGJA 1LOQA 2DZVA 2CLFA 1LLZA 3UYCA 3LHVA 5D30A 3PF3A 2GVLA 2B7NA 3EXTA 1ZFJA 1O4UA 3W1PA 1KW1A 1KFLA 3MHUA 3NO5A 3PVFA 4JDBA 1LORA 4W9TA 1PHWA 2G97A 3TW7A 3G3DA 3G0UA 1ALDA 4M6VA 1X1ZA 4FX7A 3F4NA 5U7SA 2H6RA 3PB2A 3NQEA 3WK1A 2V0TA 3BW2A 4EIVA 4LVBA 1OFBA 3U2OA 1KM0A 4MYAA 3TAKA 1SFJA 2QJGA 2X1TA 3PWAA 3WJXA 3M1ZA 2E6AA 3TCEA 4NNAA 4XUGA 1H61A 4WOZA 3SZ8A 5K4XA 1X6UA 3K30A 1GWJA 1N8FA 2JGYA 3SECA 4JN6A 4DO4A 1W3NA 5D2XA 3VCRA 3E9AA 2YDAA 3N2XA 3G1HA 2FLIA 2ZFAA 4O52A 1JQXA 4FNTA 1LRTA 3LRLA 3W1NA 1OFPA 3KVMA 3UWUA 3BARA 3QPYA 4QIUA 3P5ZA 4KFNA 1MSSA 2P0OA 1TTPA 3W22A 2OT1A 3EWZA 3NQVA 4HHPA 3A22A 3P5YA 3L66A 3TKFA 2RHGA 2Z1BA 2YFNA 3IEBA 1YPIA 4UTMA 1G7VA 3W84A 3ATYA 1L6WA 1XBYA 1G4EA 1KLZA 3R89A 4WD0A 3EX4A 4PCFA 2VXNA 3Q94A 5LNRA 3FYOA 3G0XA 3DI0A 1TPEA 4O11A 2TSYA 3CEUA 3LLDA 1F6PA 5D02A 1LYXA 3CM4A 1QOPA 2CLMA 3I65A 3M47A 1FQ0A 1OG0A 3OIXA 3GDRA 2I9EA 3FLUA 3TMLA 3KAOA 4JYEA 5E0KA 1AW2A 1KFBA 1ME9A 4WJEA 3A9IA 1RQHA 4IMGA 3C3NA 3W86A 2CLLA 1OX4B 3IVSA 2QUTA 2VFDA 4OBTA 4OV4A 1F2JA 3AO0A 3EX3A 2ZRWA 2C19A 5KZEA 5AHIA 1C8VA 1TSIA 1XC4A 4UNKA 1F76A 3EEGA 4C1KA 5L9FA 4QITA 1I2PA 4UTUA 5IBXC 5K7JA 5K2ZA 1DQWA 3PSWA 3C2EA 5I3KA 2QCHA 1OX6A 1NSJA 3GR8A 4O19A 4AWSA 4WXYA 3LCWA 1ML1A 2Q3OA 5IBXA 3RF9A 3GNNA 3QM3A 1MO0A 1XXXA 1BKSA 1LZOA 2R8WA 3TC6A 3PBVA 5K4ZA 2WSQA 3KOFA 4RXFA 3LB0A 3TSDA 1OF8A 2GQ8A 3CLMA 3ABSA 3LOTA 1K7XA 1VYSX 1FWWA 2V2HA 2H8ZA 5CZJA 3TXZA 4QISA 3P84A 1JULA 1WX0A 2WOQA 1W54A 3ZWTA 4K7VA 5I3IA 3BPWA 3L9CA 4I7WA 4ADUA 2ZZ6A 5D33A 3G22A 2OMAA 1SSGA 1VCVA 4OQVA 1ME7A 2DJLA 3M6YA 3GYEA 4JX4A 1OYAA 3T78A 2DJXA 1Q6OA 1T96A 2DU2A 1RPXA 4MZ1A 1A5AA 5K9CA 3P61A 4M7TA 2G95A 2WSRA 2A5HA 3GLCA 1JCJA 1OFEA 3NG3A 4LRTA 4OWGA 2ABBA 3W1LA 1YXDA 2ZRZA 3O15A 4P61A 4GRSA 3FIGA 4RV8A 3L5MA 4UIOA 1QPOA 1QO5A 1R30A 2A7NA 1P5BA 5CPOA 5DELA 3KRSA 4O57A 2VFEA 4ZQRA 1A5SA 1ONRA 1VLWA 1YXYA 2C14A 3TXVA 2OJPA 4WOQA 4ZVJA 3GK0A 2WKJA 4FF7A 5TIMA 1KM3A 4GUIA 3ABRA 1JCYA 3MW7A 3OHIA 1Q6RA 3CT7A 4LY8A 5A5WA 3C2VA 3LV5A 2RDUA 1AL8A 1SU5A 3UXDA 1H7PA 5CZTA 2Y6ZA 1W8SA 4N9EA 1OYBA 1TPH1 1OFQA 2B0MA 3EWUA 1TQXA 3QJAA 3W88A 3ANYA 2ZRUA 4UXDA 4PC8A 5HULA 3N9SA 1WOBA 1VH7A 3QW3A 1R2SA 2HS6A 4JGDA 1FCUA 3C2OA 1XKYA 2CLKA 3IIZA 1IIGA 1ZJIA 2NLIA 3NNTA 5AHFA 1SUXA 1ZNNA 2ZA2A 4RZ5A 5HR7A 4HSNA 3V1PA 4IPJA 2C6QA 3MP3A 1J5TA 3B05A 5G5IA 2QCCA 4O10A 3CWNA 3PAJA 4R53A 4OT7A 1SQ7A 4XWUA 4L4MA 3RLUA 3G0SA 1FDJA 4UUIA 2QCDA 1SO4A 2VFFA 4BI6A 5F2MA 5SWUA 3PC0A 1OFDA 3B4UA 3P74A 4AF0A 4DO5A 2R94A 1SO5A 2Q3RA 3GXNA 4UC5A 1ZAIA 2WQPA 3PUOA 4HT3A 2FB3A 2CZ5A 4MLRA 1TQJA 4UMBA 3HG3A 2DZPA 4CCCA 1QWGA 1D3HA 3DFPA 4RJEA 1M7OA 3E12A 4LVFA 4NXKA 2FJKA 4DO6A 3LDVA 1JCLA 1QR7A 3LRMA 3MO7A 1VYPX 4CQ8A 4AEOA 5LKYA 4TMCA 4UTTC 4HKPA 1PE1A 2EGZA 4FIQA 4JNMA 1W1ZA 1YADA 4XQ6A 4Z0JA 3NAVA 3UWWA 1EWEA 2ZCGA 1OYCA 1O95A 1WYIA 2VENA 2NZLA 3QYQA 4WQ6A 5LNUA 4J9JA 3TH6A 2GVJA 1SW0A 3R5EA 4NJKA 2G5WA 1NEYA 3WK2A 3PS7A 1KM5A 1LBLA 4UTWC 2GPTA 3DXIA 3HG2A 1SZGA 1SSDA 4GUGA 3TA6A 3DFNA 3KHJA 5CZ0A 3TUUA 3W7EA 3H55A 4LUJA 3CHVA 3CPRA 3SIZA 3IGSA 3DKLA 4KFPA 5K9XA 4O16A 3N3MA 2QAFA 4UMCA 5BMWA 3W1MA 1IXNA 2ZZ7A 3QZEA 2ZBTA 5LGXA 1TB3A 4S2CA 4YMZA 4JTKA 4A2SA 1H51A 3NXFA 3LXCA 2Y7FA 3UWQA 3OG3A 3OVQA 1KV5A 2DORA 3S5OA 4PFMA 1TV7A 3DFQA 4GC4A 1W0MA 2A1YA 4JTLA 1GZGA 4CNOA 3CEPA 4IWWA 1FDYA 5E1QA 4IX2A 4ORMA 1H62A 4TX9A 5J5RA 4NZFA 2CLEA 3RNDA 1OK4A 3DHDA 4LVDA 1MZHA 4IMDA 3C8FA 4MYXA 1W3IA 3Q2DA 2EPHA 1F7BA 3LV6A 5DXYA 1ICQA 3M16A 5AN7A 3SSJA 4DEFA 2FPYA 2A7RA 3V75A 1UJPA 4Q4KA 3GIYA 2QUVA 1OJXA 4K7YA 3IV3A 4KFOA 1KTNA 4MZYA 3TDFA 3GNDA 4WY0A 3MP5A 4S2BA 3G1XA 1WA3A 4CQAA 3TNOA 2I14A 4CNNA 1P0KA 1H7NA 3LCLA 1GOXA 4G1KA
chains in the Genus database with same CATH superfamily
3QKEA 4O0QA 2ISSA 4UNIA 3QFEA 4N6FA 3GO2A 4ROQA 1A80A 4WDUA 4WGXA 2HXTA 1R3SA 2QV5A 1E5JA 2BG5A 3KBSA 1HL2A 3F4CA 1WXYA 3GG1A 1B31A 2HE8A 3PFRA 4LYKA 1TA3B 1E6RA 1XW8A 2ZTKA 3JZEA 3NGJA 4B5TA 4GVFA 3APTA 4QX4A 1QK0A 3GBEA 1IYXA 4A8RA 2WWCA 3LGEA 1W5OA 4LU0A 4KMQA 4FXSA 3VNJA 2O4MA 4NZJA 3AMLA 4ASTA 1XUZA 2REQB 3EWBX 1H41A 3PBYA 2GDQA 3NSXA 1UC4A 2D2JA 2BGQA 3EA2A 1F74A 4IJCA 2XU2A 1ZUAX 1VPXA 4JAWA 3VUSA 1ISVA 1LG2A 3NA8A 1US2A 4KCVA 3MANA 3TP4A 3TYDA 4JPGA 1UG6A 3ZXWA 3ANUA 4A21A 3PZGA 3D3FA 3IVUA 2H3BA 4I9AA 1E51A 3LRKA 3U2ZA 4KEUA 2PP3A 4Q7BA 4NJHA 5A2AA 4GK8A 1TV3A 1JUKA 2PC4A 1YX1A 1VF8A 3WF1A 1PEZA 1YPXA 1UP3A 3H54A 4PMNA 4AISA 3RLGA 4RE2A 3MMTA 2OZTA 4C6DA 3W6YA 2ZQ0A 4JTAA 2O4QA 4C1LA 3L5AA 1UZ4A 4WUIA 3W75A 3QH2A 4MAVA 3W1UA 1A5NC 3O07A 4DAFA 4O4WA 4UFMA 4UTLA 2P3ZA 3M4HA 1RP9A 3OA3A 3WLKX 4PMDA 5A6BD 2WMIA 4C6PA 1FWSA 4P8UA 4B92A 3GUGA 4JTJA 1W5QA 2ZZ2A 1PVNA 5IHRA 5EBAA 2J6XA 4V33A 1QBBA 2Z6JA 2VUNA 4MJ4A 1NF0A 2PC8A 1DJQA 1RVGA 1NP0A 4NX5A 1T8XA 3BXWA 1R5YA 4E0CA 3S1GA 2OGJA 2FB2A 4DF2A 2VR4A 4BQ5A 4H19A 1IQ8A 3URQA 4DLFA 4ATWA 3BG9A 3W1TA 7ODCA 3AU2A 2ZRXA 4Y9AA 5KSWA 3NQGA 2E1DA 1HQTA 1DQXA 5F4WA 1ZBCA 2E6DA 5ABFA 2OT0A 3M43A 1D2KA 1M65A 3JUGA 1E4LA 3ZM8A 4N2YA 4Z2LA 3GR7A 3BAXA 3O2LA 2GDVA 1ZGDA 3ATZA 1PYFA 5C9RA 1BWVA 2PU0A 4AG0A 4K8GA 1TZZA 2ZWZA 5ENLA 2YR1A 3BMVA 2QV4A 1MMFA 3R2GA 4X2PA 2GGGA 2WJFA 3G1AA 5FOOA 4S3DA 3C5QA 1V6TA 3S5SA 1M6JA 1BPLB 3TZNA 3DERA 2YZ5A 1XKJA 4JTGA 4RR4A 1S5MA 5H2ZA 3TC3A 3VCCA 2AL2A 1ZY9A 4AVNA 5E93A 1LUCA 3S1UA 3UG3A 1XIFA 3KVLA 2E9MA 2PCEA 5CZKA 1CTNA 4QGCA 3KOXA 1UPPA 1O1HA 1J01A 1NQKA 1UH4A 3LYEA 1OCNA 1VJZA 1ADSA 1EPXA 4UR8A 5DCBA 1LWIA 3F5JA 3GNOA 3TIMA 1GZ1A 3LBCA 4L9YA 3EX2A 2E9LA 2WNZA 2XSBA 1V6UA 2INZA 1A0CA 3E02A 2FHFA 1BG9A 3EOOA 1FH9A 1HJUA 3E0WA 1EH9A 3ZQ9A 3KTCA 3PZNA 5FJTA 1MW0A 1DXIA 1P1MA 2D0GA 3Q65A 1PO9A 3SADA 2HZGA 2YA2A 2X2GA 3QC0A 4PRRA 3SRHA 5A6BA 1ZCCA 4C6NA 4GINA 3KL0A 2EBNA 4F0HA 1H1NA 3EB2A 3VD4A 3UD6A 3PZOA 1SO3A 3CV1A 1AG1O 2A3AA 3DOPA 3C2RA 4GLEA 4EPEC 3LX9A 5B7ZA 4D9PA 2XVPA 4XD4A 3SGUA 1JI2A 1Q2RA 2Y8UA 2VCBA 4YXGA 4ZENA 5KZMA 2A3BA 3CAQA 3K1DA 4GYKA 1KBLA 4Y8FA 2BXVA 3FAWA 2R82A 1DXFA 1DJGA 1JFXA 4XZ9A 1TPDA 2JKEA 3THDA 5DT5A 1VFSA 1B3OA 3STEA 4PB4A 4AD4A 2AGKA 4WDTA 4XIMA 3G2GA 1VJIA 1WDWA 1YDNA 1XH2A 1J96A 1YTEA 1R87A 3N6QA 5ABTA 4LBSA 2WLYA 3PANA 4FX6M 1LLOA 1MEWA 4QLJA 4JXCA 3UJEA 2DQWA 3VOGA 3EWCA 1DV7A 4EAMA 4LCRA 4Z2KA 3C0QA 1AMKA 2O9RA 3ZLHA 3ZJ7A 2YLLA 4HHMA 3RN6A 1CLVA 3GDLA 2PWUA 1E1CB 3TTQA 4YYCA 4QP0A 1E4NA 2CHNA 5LZLA 2E5DA 4E2DA 1KBIA 1UWIA 3WJSA 5I3FA 3AICA 3K8MA 1K7EA 3H7VA 4Y9MA 4BHYA 3HPXA 1FWCC 3LI1A 4L4OA 1KBKA 3G1FA 3GYCA 3WSUA 1AH0A 1BF6A 3KZSA 4GX9A 1KR1A 2VVNA 4H3DA 2HISA 1EPVA 3G8EA 5CPSA 2WWDA 2ZXDA 2OO6A 4A3RA 3KRUA 3NEHA 3AHZA 1XLKA 4G9PA 3VDHA 4E38A 4TXEA 2TYSA 3CH0A 4S38A 2NLYA 5AFDA 3P2VA 4JIRA 1SW7A 4D6HA 2DUAA 4I5UA 5HWMA 2XIJA 4YIWA 5I3HA 1W3JA 1P6BA 1MXSA 3GAKA 3ITGA 2XHYA 4O1DA 3VD9A 3BLLA 9RUBA 2FGLA 4H2HA 3W74A 3HO8A 3U2CA 2PDPA 4YHGA 5E6YA 1BLIA 5AB3A 3MKCA 1TWZA 1NDZA 1NY1A 2PDJA 2P5NA 1QHOA 3K8KA 4XIAA 3AFBA 4D6JA 2OR2A 3GS6A 4LF2A 2A0NA 5HQMA 3I4KA 4HU3A 3TAOA 5HUOA 2PWGA 3UCQA 1QBAA 3MKVA 4WEVX 4ZQCA 5HUPA 4NILA 1RH9A 4BJHA 1BRLB 1Q6EA 3HGRA 1M03A 1ISZA 3WNLA 2QCFA 1QDSA 1I2RA 2OLHA 1E73M 1T41A 3L4TA 3LSBA 1XQKA 1KLYA 1W3KA 4NZ3A 1GPWA 3HMJG 1Q45A 3SN0A 1V51A 4O4VA 1PTGA 4J7RA 1VD6A 4RX0A 4UTFA 4XAZA 2PDYA 2IUZA 5CJNA 4PMJA 3WDPP 4IMCA 2QQ6A 3MI6A 3EGJA 3RK8A 4HD5A 3CMGA 4RDYA 1A0DA 5LIUX 1D3CA 4M6UA 2E5BA 4GFIA 3IIPA 2VTFA 4R9XA 3JW7A 2NV9A 2EPNA 4LAMA 4Q8NA 1QFEA 1LDCA 4DI8A 1DJHA 4BY3A 4K3ZA 3UWYA 2GWGA 2G3NA 4Z1DA 1MFUA 1CGTA 3WX7A 3IPWA 3CC1A 4CD7A 1SW3A 2X30A 2E6YA 4PR4A 1R86A 3KTSA 2G37A 4CQ9A 2D2GA 4OUEA 2FIQA 2PBOA 3VFLA 2ACUA 4B3LA 1HXJA 1NTHA 3QQWA 2P53A 4J3SA 2Q6ZA 4OKDA 4FX8A 1FKXA 1S2WA 1R3RA 2C13A 2QUUA 4CNPA 4IISA 1XLJA 5KINA 1UD2A 2Y0FA 1H63A 2ZIDA 5L6UA 1BYBA 5LYRA 2CZEA 1UJQA 3SY8A 1OX5A 1K8XA 2AMXA 1JIBA 4EF9A 4OE7A 1JCMP 4AH7A 4EVZA 4JTHA 3BCDA 3GZ3A 3WK0A 2CHRA 4LPCA 1KWKA 3LHYA 1TTJA 2XVLA 1SJAA 1RBLA 1SZNA 5JH1A 2R9RA 4KERA 3AXXA 3HPSA 3C0SA 3P60A 4PUWA 3L2IA 3C52A 1GQNA 1QO2A 4K37A 4Q8PA 2BSLA 1W9BM 1ITCA 1HL8A 4WIWA 2OFJA 2DT0A 1DWGM 3M0VA 3DC8A 4Z1AA 3ARQA 3P81A 3UR8A 4HZMA 1KXTA 4ICNA 7CGTA 1E0VA 4MB1A 1KCLA 3EX1A 3AWOA 3UPBA 2YXGA 4L5ZA 4H8NA 5FL0A 1LCOA 3RXZA 4LANA 3GNPA 3LN3A 1XSKA 1UBSA 3UXLA 5CSRA 2VEFA 4OIFA 1KXVA 1UQYA 1XIEA 5CG7A 2O7SA 1EQPA 4A2RA 4DBUA 4BQ4A 3OGRA 2WVSA 3PTQA 3SFKA 1P6WA 3TYCA 5FJPA 4CD6A 3VKDA 4AVOA 1WDRA 3P93A 3BLPX 1HG3A 2PDQA 4Z2GA 4Q3MA 4JYDA 4QJ4B 3QMRA 4WGHA 2VGGA 3SCWA 4WK9A 2VELA 3ALGA 4HHLA 2XFRA 2F2HA 3CYJA 4HMDA 2PD9A 2VJXA 4WKAA 5BXPA 3FVDA 2WC4A 3H4WA 4KCUA 2HK0A 1E0XA 5PTDA 1QPNA 3SW6A 1EUAA 2ZADA 4W8LA 2ZUUA 1Y5VA 5H91A 1VS1A 3A64A 1W6TA 4U2ZA 4HPHA 1LF1A 2VC7A 3EPOA 3FHQA 1HJVA 3V5OA 1UUMA 2XIQA 4L4LA 5AYXA 3AZRA 4A3YA 1JR1A 4YTSA 2Y88A 1TE6A 2XN1A 1GQLA 1DQUA 3MC5A 4Q7IA 2IQTA 2V5KA 4PUEA 4UWMA 3LEPA 3WK3A 2H90A 3BC9A 1X1OA 1W5PA 5IDZA 1YBQA 2DSUA 3W00A 3M5XA 2NSOA 1QXLA 5AECA 3HTWA 3TQ0A 4TV6A 4EKJA 2DZAA 4UFIA 3WCZA 2J79A 2RUSA 1JD7A 4DM1A 1Z89A 5DT7A 3LBOA 4MKSA 2ZVIA 1BQGA 4IXHA 3WH7A 2OKOA 3UWEA 4I7VA 1JUEA 2PSNA 1WKYA 1AUSL 4WY0B 2HCVA 4MFDA 5TBOA 3UXIA 3A6OA 3WBXA 3WDQA 3VD7A 1PS9A 3HJEA 2DZBA 1TO3A 3FJ6A 3N9RA 4DZIA 3HMCA 4YJ5A 3PWGA 3KOZA 1VPYA 3R8RA 1V4YA 5I2UA 4JX6A 2WZIA 2QJIA 3FSTA 3IJQA 3ABXA 3UY7A 3M9YA 3DENA 3VVGA 1LT7A 3HA1A 1ECQA 2I1OA 1B3XA 2Z1XA 1W31A 3UEQA 4FZIA 1Q6GA 1L0PA 2VEIA 3VNYA 5D04C 1CIUA 1KA9F 3II1A 5CPNA 2YBTA 1K8YA 4A8NA 3B0PA 3N4FA 3GNRA 3O9NA 2O9OA 2BP1A 4JTIA 4TIMA 1O60A 4O1FA 3VA8A 3SY5A 5C70A 1C92A 4G8TA 4PTNA 1FBAA 4J3WA 3GFZA 4O1EA 4I7UA 3GZAA 3WD1A 4C6QA 4E6MA 2YB1A 1HIZA 4P5UA 4D1JA 2ZICA 3NTYA 2GQ3A 2QXWA 1WAUA 3IJ8A 1OZMA 4UFKA 5IHSA 4S3KA 3WZ0E 5D4YA 3EOLA 3GC2A 1RA0A 1JAKA 1X7FA 1JXJA 2X40A 1NVMA 3M07A 3N18A 2C15A 3MUZ1 4S3AA 1VRXA 4JX5A 1M68A 3H26A 4Y9OA 4HNOA 2P1FA 1LM1A 3LCFA 3WUFA 3T0DA 3BW4A 3AJXA 1TZ9A 3OPSA 2PDLA 3TQKA 3BMWA 4CD5A 2CHOA 5TD4A 1A5UA 3CIVA 5F2LA 3THCA 2V82A 1GZJA 4UZSA 4BR1A 1IT8A 4KH2A 2WNNA 4BWLC 1DHKA 5E9AA 3OJGA 4FEZA 3UWZA 3CHCA 2X7VA 1TPB1 1UUOA 4M82A 1EF2A 4W87A 5HPOA 1KM1A 5E70A 3LCIA 2KAUC 4LVAA 3Q67A 1TPC1 4KKXA 3IAPA 3QN3A 4RDVA 1LLWA 2CEQA 4IZGA 2PDMA 2ZA1A 1QT1A 4O8RA 2VFGA 4LV9A 5AHNA 1FHVA 3FV9A 2DZWA 4JIEA 4JKLA 4CN4A 3T8LA 4MB5A 4HHHA 5KETA 1KWGA 2EXOA 3WN6A 3AIVA 3CGTA 3VNDA 3CNYA 5E9XA 3BO9A 4M0XA 3PWIA 1V02E 3A3WA 4RDWA 2QJHA 2CU0A 3VGFA 4ERGA 1EO5A 1P0EA 1KGWA 5BCAA 1EIBA 4JZ5A 4HGXA 1AJZA 3FJLA 4YNGA 3APYA 4CQBA 1UWQA 2R1NA 1XBVA 2WNWA 2WPBA 5HINA 3M5ZA 4HNTA 4EWND 3U2EA 1KO0A 1W32A 4UTWA 2I7GA 4AIUA 2I9UA 3VPLA 2VI0A 3H22A 3IJ6A 4MY8A 3BGGA 1G5AA 1K03A 2PI6A 1H5VA 5C54A 3EX6A 3KVKA 5J8LA 3MI3A 3W7HA 1FY6A 3R0KA 5CBIA 1ONXA 3WH9A 3RU6A 2IKGA 4OV9A 4GH3A 2GOUA 4O1BA 4PUUA 3RO6A 4Z0SA 1BXNA 1FWGC 4XUYA 1E9IA 4KETA 2PURA 2TRSA 4MZ8A 4XG1A 2J7FA 3GHSA 1VC4A 1W3HA 4DJEC 3Q58A 2GSEA 5K9DA 4FHAA 4LW7A 2H3DA 3NEVA 3PZMA 4YN5A 5XIAA 4UOJA 4IPIA 1IV8A 1F6KA 3STCA 4J3VA 2Q01A 2YB4A 5D2TA 1MRQA 2NQLA 3IJ7A 5CBBA 3EKGA 5CG0A 3CUIA 3NO1A 3QFWA 2GYIA 3MTWA 1XDMA 3T05A 5A69A 2V2CA 1DIDA 3KOWA 1I0BA 4WSHA 1TMLA 3W72A 4GKLA 4QSHA 4RE0A 2I5QA 1E70M 3H4GA 1GEHA 2RDWA 2NT1A 3ZS4A 4DPPA 3WENA 1E6SM 1GOMA 3EB3A 4Q4MA 4GXWA 2BY0A 4QQUA 2PAJA 4GYPC 2J13A 1C90A 2NWRA 1GORA 1MQRA 1Y0EA 3ALFA 1TX0A 3QR3A 3TN5A 3IV8A 2XSXA 3UVAA 3LZ3A 1XDJA 5C2CA 3GSMA 4O1AA 3MT1A 4ML4A 1CXHA 1TR9A 4QCFA 1LBMA 4FNUA 5G2HA 3ITLA 3SQLA 1OINA 1OIFA 4D2JA 2CERA 3BJSA 1JZ4A 1FTXA 2BS9A 2B7OA 1FWBC 1GKRA 1SFLA 2QGYA 4HYWA 1OSEA 3E0VA 3R12A 4NUWA 1YNPA 3ELFA 1PDZA 5CAKA 1MUCA 1YEYA 2GQ9A 4F0LA 5BOEA 5I3GA 1EWDA 4PSRA 4Q32A 2B7QA 1IT7A 1FVPA 4WR3A 4JR5A 1A5CA 1LTDA 3VMOA 3CT2A 5C7VA 5HK4A 3AHVA 3HGJA 2CLFA 1G9HA 1M9HA 2GVLA 2D3NA 2UY5A 3H24A 1F3TA 4M24A 4Q22A 5CC6A 3EXTA 1ZFJA 5CJMA 3MHUA 3NO5A 4F9DA 1PHWA 2G97A 3G3DA 3G0UA 3ICJA 5DQPA 3POHA 1V6XA 1HGYA 4FX7A 3WLQA 2GFTA 3F4NA 3UT0A 3CZGA 3NQEA 4IGMA 3U2OA 1OFBA 1H3GA 2V3GA 2FVLA 5EB8A 3TAKA 3AC0A 1B3WA 4GIRA 1NWTA 3PWAA 1VEMA 3M1ZA 3TCEA 5T9CE 4IPNB 3O0KA 4G1NA 2G0WA 3HQOA 5K4XA 1GWJA 2JGYA 3APGA 1P6CA 2Z1KA 1EKOA 5D2XA 5LXXA 2FLIA 2OQYA 3WEMA 4NZCA 1IWBA 3VDBA 1AA1B 3LRLA 1I75A 2Q09A 3BZGA 3OYZA 1EC8A 3IUDA 2Z29A 2DIEA 3E74A 4K68A 2GJRA 4FOJA 3GTFA 2P0OA 1X96A 3P5YA 3KBNA 2Z2BA 2Z1BA 3M46A 3ATYA 2OXNA 3DG3A 4AEEA 3SY1A 1Q6CA 4B3KA 2VXNA 1TJ0A 4BCEA 3FSUA 2EG6A 1O5QA 2VDGA 4BEQA 1F6PA 5D02A 3CM4A 3I65A 3GDRA 5I23A 4LCQA 1ZRQA 2D20A 2I9EA 2PF8A 2D1ZA 2J8GA 2CBIA 4LY4A 1KFBA 1ME9A 3N17A 1RQHA 4RNJA 5C71A 2YA0A 4GQBA 1F2JA 3AO0A 5I79A 3EX3A 2OKTA 1TSIA 1V77A 1RSCA 3N3TA 2PGRA 1XC4A 5I6SA 3HQNA 4QITA 4DUOA 1UW9A 5K7JA 3GQYA 1DQWA 3PPHA 1IGWA 1YE4A 1W1B1 1OX6A 3ONCA 4IM4A 4E5TA 4JFTA 4R9OA 4O19A 4HNCA 3LCWA 1UR1A 2CLPA 2Q3OA 3D3AA 5IBXA 2V6AA 3GNNA 4W8BA 2IKIA 2KX9A 3KOFA 3LB0A 1CNVA 2GQ8A 3CLMA 3LOTA 3EWDA 1VYSX 5E0FA 1Q63A 3TXZA 3A4AA 5BOFA 1C93A 1WX0A 2WOQA 2VGFA 3M6DA 3BPWA 3L9CA 4QDWA 5D33A 1SSGA 1VCVA 4OQVA 3GYEA 1OYAA 1RPXA 2DSVA 3LD5A 3EA3A 1WDDA 1KRBC 3ZT5A 2HPMA 3COTA 3GLCA 5A8MA 4LRTA 1DIEA 3RRAA 4IFRA 3CUHA 4GHRA 3VK5A 4QEHA 3WF4A 1IEXA 4AWEA 1QPOA 2QULA 1OZQA 2BB0A 4P7OA 3K5XA 2RJGA 5CPOA 2HNEA 4ZQRA 2JEQA 3UP8A 1A5SA 1VLWA 2C14A 1KQYA 3KBMA 3CAKA 4CQCA 2PGEA 1KM3A 4GUIA 3MW7A 1JCYA 4D71A 5D8WA 3BQ6A 3FGCA 3LV5A 2RDUA 1AL8A 5CZTA 2Y6ZA 3LZ5A 1OYBA 1TQXA 1ZL1A 3QJAA 4XD6A 4UXDA 4DZ5A 5HULA 4ZTXA 4EX4A 1Q7ZA 4A6GA 4KWUA 1AD4A 4QHRA 3M7SA 4DJED 4NL1A 3S47A 2XGIA 4GZIA 1IZJA 2GVYA 4QR6A 2C6QA 3S9IA 3A3XA 5G5IA 4AC7C 3V7PA 4R53A 2I17A 3RLUA 1FDJA 4P8WA 3VGHA 2VFFA 4QG6A 5SWUA 3AS0A 1OCBA 3P74A 2Q3RA 3T4WA 2G8ZA 3PUOA 6TAAA 1J12A 3AIQA 4UMBA 1PX3A 4CCCA 1QWGA 3LS9A 3VIGA 4NXKA 3LDVA 2ONEA 2PDKA 3LRMA 1VYPX 1ESWA 4AEOA 5IXEA 2XIMA 6REQA 1PE1A 1DJZA 1W1ZA 4XQ6A 3HURA 2Y24A 1EWEA 4LALA 1OYCA 2VENA 3QYQA 3TH6A 4DVOA 3OA5A 4NJKA 2G5WA 1NEYA 4XX6A 2GPTA 1SZGA 4GUGA 4GY1A 1POKA 3TUUA 2FTYA 2WLZA 3SIZA 3DKLA 3CQIA 4IIEA 1CPUA 1Q66A 2QAFA 3W1MA 5BMWA 4I8DA 5I0DA 1OEPA 3WD0A 5LGXA 2ZBTA 1TB3A 4S2CA 1NWUA 2BBFA 3NXFA 4MGGA 1C7SA 1CDGA 4UQBA 1V3IA 1DTNA 2DH3A 5CSUA 3XINA 1TV7A 2A1YA 4CNTA 1XF0A 1GZGA 1FP8A 3H2NA 1TJ2A 2ZX5A 3PPGA 4JHZA 3N11A 3WQPA 3BCFA 2VRQA 4J2PA 5J5RA 4NZFA 5DF0A 2FVMA 4QE1A 1MZHA 5TNVA 3SEPA 5EMJA 4GZ7A 2PP0A 3BZJA 3U5YA 1K9EA 4B90A 2FZDA 1E9LA 4N7QA 5AN7A 3SSJA 1B3VA 3V75A 2QUVA 1PBGA 1JCTA 4KFOA 4GI4A 1WA3A 2BGNE 3WBWA 3ZO9A 1TX2A 4ZB0A 2RGLA 2EKCA 2Y2WA 5A8QA 3VUPA 1PZ1A 5AC7A 1IWPA 3GAYA 3I3DA 2E67A 4IQEA 1RBAA 2EPMX 1K3UA 2DVTA 4WY0F 3AAMA 5CPMA 4KIEA 5A8GA 5FF0A 1I8JA 5FJOA 3LHWA 3INPA 1AODA 1TPWA 4HJWA 3F4DA 3UCCA 1VRDA 1XYLA 1R85A 2P88A 3CZEA 2DDXA 3S5YA 1J18A 4LC6A 2WMHA 5FF4A 2J88A 4B91A 1I2OA 4UOQA 1VBUA 3KUMA 3GVVA 3RCNA 1DEDA 1J93A 5A2BA 3W1XA 2QPUA 3W37A 5BXRA 1P4CA 2QAPA 1BVZA 4MWAA 4E2BA 3VCNA 3LU2A 4PSPA 4CCZA 2BVDA 2HXUA 1V3JA 3DFYA 4PL2A 4GUHA 4KWOA 3MI2A 1BHGA 2Y61A 2WM1A 3B40A 3PY2A 2DH2A 1WCGA 3KTXA 4GUFA 1HJQA 1Z48A 1P0BA 3FEMA 5HJYA 3PK7A 1RD6A 1ISXA 3QC3A 4HCLA 1LWHA 5AZ0A 3EWXA 3WLOA 1JXKA 1XGDA 2CLHA 3V4BA 4C5ZA 5T8GA 3SCVA 3T8QA 1ZJBA 5IOBA 3FDKA 5KZDA 1DYSA 3ES7A 4BFAA 3JZUA 3DU0A 3TONA 3HB9A 1UWSA 3P0XA 3UGVA 4AW7A 1SMAA 4GY7A 3B0VC 1B9ZA 1OCJA 2OG9A 7REQB 2INFA 2GL5A 2PWHA 2QCMA 5DY3A 4Z42C 1IIHA 2TMDA 1S2VA 1U30A 1B3ZA 3E2SA 2BWGA 3ZSSA 3NR0A 4IJRA 4OHQA 4LRSA 2DT2A 3FY1A 3MYOA 3CUJA 4LSBA 2ISFA 3FA4A 4CLMA 3M0JA 6XIMA 3DBNA 3FN9A 1DJNA 2ZUVA 1Z44A 3EBVA 5G4EA 1QCWA 1GVRA 1YDVA 1D7KA 3ITOA 3JRKA 2J9YA 4M6QA 3V36A 3NCOA 3KOYA 5CCZA 4YVVA 1VFOA 1V08A 3L68A 4C6IA 3KHDA 3CHEA 1VAHA 4GJ1A 4IG2A 1MEIA 2Y7GA 1WPCA 4IP5A 3LHUA 4AHOA 2NXHA 2VEPA 2QUNA 5CAHA 2FZNA 2NUXA 3CUZA 4E4UA 4MVAA 3OQ8A 4S3CA 4I8YA 5D03A 2HNHA 1QW8A 3OLGA 1VFUA 3AMCA 1FUYA 3B0UX 4DJFD 1RY0A 2UBPC 2V5JA 1AZ2A 3RFAA 4ECLA 1HUVA 3IK4A 3EB4A 4Y8EA 3N25A 1XHGA 2QCLA 1XLEA 2Q71A 1BYCA 4NZ1A 1N8IA 3VIPA 1WZAA 9XIAA 4RZ6A 3NL2A 2E7FA 3DN5A 1OM0A 2V81A 4N4QA 3CL6A 3CTLA 4Q4PA 1EJVC 4EXBA 5BROA 4LAUA 2PRMA 3TK7A 2ABAA 1XLIA 4TOQA 1U1JA 1XUUA 2W62A 2JE8A 2OSXA 1M3UA 2QT3A 3I3EA 1W1YA 3BTNA 2ESCA 3W25A 4JTUA 4RXGA 1IEIA 4O13A 3ARPA 5EU9A 2E68A 4B2DD 4PGLA 5TQLA 3VOIA 3CJPA 3GWQA 4ILSA 3L0GA 1AH4A 3UG5A 2FZ9A 4D6EA 1EP1A 2OSYA 1H5YA 1QHPA 4UFHA 4PB5A 3PNZA 5DRIA 2OYKA 3W4RA 5AC6A 3T0TA 3OYXA 1Z9AA 1UKPA 1RJRA 2J66A 4UR7A 4PL1A 5A6LA 2J7GA 2NXIA 3AIUA 1K6AA 4QNEA 3W87A 2P0IA 4X61A 2D2HA 1RUSA 1VQTA 1GT8A 1JZ5A 5FF2A 3QHOA 1CEOA 3F03K 4BK9A 4DLMA 1RZMA 4KGLA 2GLKA 3TSMA 3PN8A 2XWDA 4GO8A 3C6CA 2VCCA 3EA1A 3N1AA 1EDTA 2VURA 3L65A 4M81A 1QNQA 3TTOA 2ZOXA 2Q02A 1E43A 4ZFMA 5LHFA 2V5DA 3DG6A 3OZMA 4FLQA 4HOWA 3T07A 1GOQA 1T5AA 4UBPC 2FH8A 5GVJA 2BXYA 2G41A 3SRKA 4Q8TA 3W7NA 3ARSA 2A3LA 5DMLA 2ZZ3A 3CAWA 2Z00A 1EX5A 1LWJA 3E0IA 1FWDC 4MJZA 2DZTA 2PDXA 3HOJA 3W85A 2P76A 3FKKA 1IEQA 2BMBA 4YPJA 2DY3A 4LS0A 4UQAA 3DECA 5DCEA 2PU1A 2Z7GA 3PJTA 1FWIC 1PYMA 3LK6A 4A3HA 1V0MA 2DVUA 4NSBA 1KFEA 3LCGA 1JI1A 1JL8A 1GVIA 4PRTA 1NF7A 3CO4A 4DJFA 1IT0A 3DDMA 3LPOA 1F5ZA 1SZFA 2DIKA 3FYYA 4PH6A 3TV8A 2EEXA 1GK8A 1OC5A 4PZVA 4AAJA 1SYTA 1TIMA 1M1BA 4M5PA 3I7RA 4NU7A 3MJYA 8XIAA 4R85A 4DAIA 4GI6A 1S46A 1E6ZA 1VFLA 1OVDA 1TELA 2O0TA 3CZJA 3PULA 1T99A 3D46A 1YLVA 2DGAA 3K2GA 3LTSA 3GU1A 3LTYA 5CLTA 5AYYA 3TR2A 1XD1A 4GE8A 3T6CA 4MKNA 2F6UA 3V0TA 4O0ZA 1FWJC 2Y63A 4X60A 4ORIA 3BJFA 5CC3A 3ARRA 1V3MA 1N7KA 3N6JA 3RMEA 2BGSA 4GABA 1J0ZA 4UTKA 4JIQA 3SSZA 3LUTA 4H01A 2A4AA 3P7YA 4OFCA 2PA6A 1UHVA 2MANA 2RFGA 3NZQA 5C9UA 5F4SA 4H41A 3MDWA 3FA3A 5FEWA 2WO5A 3BGAA 1LOSA 3PBGA 1H7WA 5AHLA 2ZX7A 2J7CA 5CC5A 3S2LA 3B0XA 3WF2A 1UKQA 2PWEA 3IUIA 2NW0A 3LCXA 3W2JA 1R7OA 3ZT7A 1JCXA 1VLIA 3UR2A 2EAWA 1H2JA 4AHPA 1O6IA 2OWXA 2OGYA 1UR8A 2BNJA 2J9ZA 4JD4A 3GRIA 3E5BA 3DESA 1TG7A 5BWAA 1UZ1A 3UERA 5RUBA 2W92A 2XFWA 1JGIA 4RZBA 2X8RA 4C60A 4GFSA 3WQOA 4W5ZA 3AUOA 1BVWA 4V27A 5FEXA 2GVGA 3LSCA 3BOFA 1H7RA 4QTGA 2EO7A 2EJAA 1OT2A 5F7UA 1LBFA 4B5SA 3NO3A 1NM9A 4F8XA 1MYRA 3R0UA 1E6XM 2VNCA 5F2GA 1P43A 4H9ZA 5HJLA 1TFVA 3U7VA 5BU9A 4ZCWA 3GH4A 3W9ZA 3N14A 4CCDA 4EAYA 2HS8A 3FS2A 3CHFA 3QYSA 5D09A 2B31A 4ZL1A 3GDKA 3B8SA 3QEZA 4WHBA 3MSYA 1WZLA 1XISA 3S42A 2IQDA 2OQLA 4MTVA 4CN6A 3MB9A 3E0LA 4AD0A 3C56A 1XIDA 4MNJA 4JKKA 5FIPA 2OX1A 2PTXA 4HMNA 3D47A 1ME8A 4TVDA 4CNSA 1RJPA 2YL8A 4IX0A 4QAIA 1TMHA 3VTRA 5EBUA 4BI5A 4FAMA 4GXPA 1XPYA 3CPUA 3LM3A 4JEQA 3GUWA 1DJYA 3UZYA 4JNYA 1U33A 1TUFA 3V16A 4EANA 3MHGA 1FX6A 5H8MA 2YW4A 1S3TC 4HNLA 3B3DA 4QSFA 3ITCA 4HIBA 1H11A 1DTUA 4N02A 1W9UA 3VU2A 2NQHA 2FPTA 1GJUA 1IHIA 1KFCA 3NPUA 3CIWA 2CITA 3KL5A 2C7FA 3OODA 4DELA 3G1VA 1S2CA 6ALDA 1S2AA 4XAYA 1XBZA 1WQ5A 1I0DA 1UOZA 3FGCB 1KFWA 2ACQA 2B4GA 3W7DA 1B2YA 1XRTA 1GJWA 1YRRA 1GTEA 2V5BA 1VIWA 5BOOA 1XLLA 5T91A 2Y89A 3IGHX 1HP4A 3TYBA 1ITXA 1IWAA 4WKHA 3E2QA 1CXEA 3HPZA 1T7LA 5DMYA 2IPWA 3TLQA 1EB3A 4BF5A 2WPGA 1E4MM 1FWFC 1RALA 1Z6KA 2EF9A 5FJJA 5LNSA 1XINA 4XB3A 2J7EA 4LOCA 2CBVA 2O9PA 1SFSA 1KQZA 3MZ2A 3HG5A 4PMQA 4XZNX 4GKTA 2GOKA 4GIYA 2V9DA 3QV9A 1XICA 1XLMA 2X0YA 4YVPA 4ZQPA 3QGVA 2J74A 3QHMA 3WL0A 5C8BB 6CGTA 4DRSA 4REQA 1DIOA 3TYAA 5HMFA 1MEHA 3T08A 3LLFA 3M44A 3VKJA 1OGBA 4TMBA 1J6OA 3CIXA 1W3LA 2V8ZA 2DZSA 3ZT6A 1G0CA 2DIJA 6REQB 1U83A 1RCQA 1PDYA 4Z2JA 3K13A 1HFBA 1JF6A 1KFKA 1TWSA 1HVXA 3C8NA 1K1DA 1RR2A 4JY9A 1MDLA 3JR2A 4AX6A 5HANA 1EDQA 4Q4OA 1KGXA 3SUTA 1IGSA 1C91A 1OK6A 4CGTA 1K8ZA 1PIFA 2GK1A 1XCXA 3E38A 4G7EA 3UWVA 3TYUA 1V3LA 1TRDA 1ZZMA 1PTDA 3M0MA 3S4TA 4AD3A 2PLJA 2Z1WA 1IEVA 2Z26A 1A5LC 2XIIA 2W5FA 4NY2A 4DIAA 4H9XA 4E3VA 3TJLA 2XISA 3V35A 3V18A 1A4LA 3OVGA 3GXPA 1TUXA 2ZXAA 1K4GA 5F4XA 2ZZ1A 3KLLA 5KITA 3AIEA 4K38A 1I2NA 2NXGA 4HMEA 3FK4A 4H6KA 1G67A 3RGTA 3SUWA 1IE7C 1BRLA 2FPVA 5MHBA 4Q8VA 4GNVA 2QJNA 4X0NA 5CXPA 3AU6A 2Y4SA 5AC5A 3VNKA 2CWNA 3KBVA 3M5YA 1OFAA 2ZX8A 4WSJA 4NI3A 2XDFA 5DMNA 2G4JA 2YL6A 2P8BA 1F6YA 2QNEA 4IOTA 3GXTA 3GG0A 4I9JA 4JTRA 2OEMA 2CIPA 1XH1A 1XWYA 2WNQA 3BANA 4FR1A 2VDHA 1DXEA 5XIMA 3WH5A 2BVWA 1VP5A 3ABZA 3I6EA 5A94A 1PX8A 4HCDA 2V5LA 2CNCA 5G2IA 2GJPA 1TTQA 1QTWA 3DGRA 3T09A 1UUQA 3E49A 1F3XA 4DX3A 3ZWSA 2QJJA 3RLVA 4DJDD 1M5WA 1OGGA 5A6SA 1J0KA 2WVVB 4GVHA 5G2WA 4N6EA 2VRJA 1VCFA 2PS2A 4PODA 4EPKA 2Y1HA 1PB0A 3MBDA 2A6LA 3GC5A 4MWAB 3MMDA 2FFIA 1HO1A 2AKMA 3KRZA 4AUBA 3GKFA 1FOBA 1MI3A 3FNDA 2FVKA 3LGGA 4Y6GA 4Y90A 3TEVA 5CPQA 5AC8A 3GXDA 3LERA 2QEZA 3DAQA 1KBBA 2OLAA 1V0KA 3LHZA 1XCFA 4QEEA 3F4VA 2VKZG 1ZTVA 1H7OA 3USBA 2PDIA 2PD5A 4Y96A 3IGUA 4XZMX 2VZUA 4RPPA 3WBEA 1XIGA 3LQGA 3T4CA 2VZTA 3G24A 3NPWA 4LYPA 1HKIA 3O6CA 3QTGA 2FZ8A 3I7SA 3M0ZA 4JN7A 4C6OA 8TIMA 5GQBA 1TVPA 5AY7A 3VGGA 5HWJA 3O16A 3E0FA 1NFBA 4FPSA 4B5VA 3WUEA 1OY0A 3MJMA 3EWWA 1HF6A 4I5RA 4DQWA 2X0HA 3QY6A 1QU4A 3DZ1A 5CKSA 2HJPA 3PR2A 3S1XA 1KXQA 4QM1A 1GQKA 1YNYA 4BWLA 4N4PA 1YQ2A 2VWTA 1Z42A 4J28A 1PCWA 2Y8VA 3K4WA 1NOWA 1CLKA 4GBDA 8CGTA 3SUUA 4XV0A 4IICA 1JDEA 3HBLA 1YMYA 3NVTA 3ZVHA 3TJ4A 3W0KA 4OUIA 4GNKB 2C16A 1EYEA 1QNSA 3O6DA 3VABA 2OEKA 4QG8A 2YX0A 3STPA 4H9MA 1DL3A 1AH3A 1HKMA 5BU6A 4NF7A 3H2MA 5EMUA 1P0DA 4R88A 5DBUA 3L0NA 3SI9A 1T40A 5HA7A 5CZSA 1CYGA 2AL1A 3DFHA 1K7FA 2C1IA 1KM2A 3LXBA 3P67A 1RA5A 3HM7A 1ONWA 1R47A 4LH8A 1UKTA 4JCMA 3S5ZA 4F0SA 4WF7A 3GU9A 1XYFA 4DJDA 1Q4NX 3ITVA 4MY9A 2B7PA 2X05A 5HWNA 5AYBA 3H21A 4UMAA 3BLOA 3KDOA 4RW5A 4DBDA 4A35A 2AQVA 3TQPA 3MMWA 3WMBA 3VGEA 3L0KA 1SMDA 4AMAA 4XSMA 1DKWA 4UZUA 1LT8A 2D73A 3HZ3A 4KCTA 3VOHA 3BV4A 4GYJA 2YCKX 3UG8A 1OHLA 5ABEA 2WQDA 3B9AA 1O7AA 4W5UA 3WEOA 4DBSA 2FDMA 6PTDA 4M29A 3OG2A 5I09A 1TCMA 4AD2A 3DHPA 3V5CA 2C0AA 4Q6XA 1O5XA 5G4WA 3H2CA 5AOUA 3ZLFA 4C6KA 2EPOA 1R38A 2IPFA 3QV6A 3NDYA 2VMFA 4Q8OA 1RK6A 4L65A 1GCYA 2VOMA 3NL3A 1H60A 4PYSA 1TRIA 5DMMA 3TZFA 4PMOA 4MAZA 4M6PA 4ICMA 3T9PA 4MPKA 1QWKA 2JKAA 1EP2A 2ATMA 5CSSA 3XIMA 4AZHA 1I45A 1KM6A 3BJTA 1B5TA 2HWGA 3CWHA 2GWNA 2X2YA 4AIBA 2Z28A 1MW2A 1YTDA 3FHAA 3KFTA 4PMUA 4DUWA 3VC6A 4F3HA 5A6JA 5FJRA 2WM0A 2A21A 2OLSA 3W7QA 4YWIA 4GCXA 2D0HA 2IS7A 3PZVA 5HPCA 2Z27A 2NX3A 4JFSA 4ENLA 2PRLA 2OVLA 1DOSA 2PLMA 1WXZA 3FVMA 3AALA 5FF7A 1AL7A 3GG7A 2P3EA 3JU2A 4IJBA 1R0MA 1EJSC 4W86A 5EMYA 3U8GA 3IRSA 3BUVA 3W1AA 4XAGA 2ISDA 1YXCA 3UJFA 1LP6A 5FF3A 5EGRA 1KRAC 2YA1A 9XIMA 1UZHA 3UW6A 2V68A 4QDPA 3RPDA 2IW0A 1A5KC 4U3AA 2HQAA 1XLFA 3L21A 1WZMA 4HU4A 4R7WA 4JIIX 1CGXA 5KTLA 4DN1A 1WKFA 3O8AA 3WUGA 2OO0A 4FLOA 4JQ1A 3N13A 3GU2A 3URBA 3HV9A 2A3HA 1LLZA 3UYCA 4L1GA 4PUNA 1U1UA 4V2XA 1A3XA 1DWIM 3SIMA 3PVFA 1LORA 1UD8A 4W9TA 2WJEA 4ROPA 1FFRA 4HOXA 1HJSA 4M6VA 1X1ZA 1CGWA 1PKYA 4ZR8A 5EMMA 3KEHA 3PB2A 3BW2A 4QS6A 4LVBA 2GZXA 4TX8A 1KM0A 1SFJA 2QJGA 2D2OA 4H9UA 3VDAA 2E6AA 4XUGA 3PZIA 3SZ8A 2WK2A 3GTIA 2F8QA 3F2DA 2CWXA 3K30A 2TODA 3ME3A 3REQA 4JN6A 5T9BG 4DO4A 4IP4A 3VCRA 1U2YA 3G1HA 4HN8A 2ZFAA 4O52A 4ZXLA 1JQXA 4FNTA 1LRTA 1UH3A 4LYQA 1DJWA 3W1NA 2PP1A 3KVMA 1W1A1 3T1GA 3P5ZA 2AAAA 1NH6A 5HQLA 3AIRA 4PMYA 2D69A 3W22A 2OT1A 4GI8A 2X1IA 3A22A 3TOYA 5AZ1A 2RHGA 3DGBA 2UY2A 2YFNA 4P8VA 4ATLA 3IEBA 1YPIA 3QHNA 4MDPA 3QLDA 2MUCA 1M7JA 1UMYA 1KLZA 4WD0A 4PCFA 3TN3A 3Q94A 5LNRA 4MNKA 3S6OA 3S9ZA 3W6LA 2V38A 2PLKA 3DUGA 3LNMA 3T42A 4US5A 1OG0A 3OIXA 2DT3A 1OD0A 3GH5A 5D9NA 3KP0A 3FLUA 4CEXC 3NXLA 3KAOA 4JYEA 4WSKA 4HTBA 1NDYA 3A9IA 1MW1A 4LCSA 4IMGA 3CBWA 2CLLA 4FXFA 2QUTA 2VFDA 4NZ5A 5LXEA 4OV4A 4GACA 1KXHA 1S38A 2C19A 5KZEA 2HVOA 1C8VA 3EOEA 3GM8A 4UNKA 3EEGA 5L9FA 3OTRA 4AZBA 3R1ZA 2QCHA 3BSMA 1ELSA 1J8VA 3EDFA 2PDNA 1F8MA 3W81A 1ML1A 1Q8JA 3U7BA 1Z7AA 1DJIA 1BKSA 2WSQA 3SGGA 2OOGA 2XZ9A 3ITTA 3GE7A 1OF8A 1GOOA 4YTUA 4ZTYA 3SB0A 1K7XA 1JNEA 5AKQA 1VEOA 1E0TA 3ARZA 3N4AA 3P84A 1JNDA 3B4YA 3CHDA 1E1FA 4EACA 3WEZA 2OMAA 4E2OA 1ME7A 1UWAA 5C2GA 1Q6OA 3H6OA 4QJ5B 2YBVA 3PP7A 1A5AA 1C9WA 1S2UA 4M7TA 2G95A 2WSRA 2A5HA 3LLXA 3NG3A 1R7AA 2J78A 1VBJA 3MPGA 4ZA0A 4UIOA 4HPNA 1QO5A 2WHLA 3N6HA 1F4HA 2HVNA 2A7NA 1P5BA 3KRSA 1EZ2A 2VFEA 3UZWA 2F6KA 1B1YA 4PB3A 1YXYA 2Z7KA 4TVUA 3LG3A 1XCWA 3OHIA 1T6MA 3BCJA 4LY8A 5AVNA 3C2VA 1SU5A 2X42A 1H7PA 4J1OA 1W8SA 1UA7A 2IQ0A 3W88A 3ANYA 4JBRA 1I1XA 3QW3A 1R2SA 4JGDA 4HCHA 3AS1A 3C2OA 4CVUA 2YJQA 5JBEA 3QTPA 4I90A 1ZJIA 1XYBA 3NWRA 2IPJA 3KWXA 1ZNNA 4GO9A 4RZ5A 5HR7A 2FZMA 5HATA 4HVXA 2NSXA 3MP3A 4H8VA 2PWVA 5FSEC 2QCCA 5CJ5A 4NRRA 3BLDA 1J9YA 3PAJA 1J11A 2HROA 5CEWA 2IMRA 3O3RA 4XWUA 2W3ZA 5J04A 1Z69A 4LB4A 2QCDA 5F2MA 1E71M 3CQHA 1HZYA 4ERIA 3GXNA 4UC5A 5BYWA 3BMXA 1TQJA 3VKBA 4REQB 3PUGA 1M7OA 3E12A 2FJKA 4S23A 1QR7A 3MO7A 4KEMA 1TR1A 1JZ2A 4JNMA 2PLCA 4WJXA 3H7UA 1PPIA 1EXPA 3R25A 4Q8WA 3SCOA 3AHXA 4XD3A 4ZFCA 4F66A 4R7OA 4MB4A 2NZLA 4WQ6A 3TJIA 2CKSA 4J9JA 5TF0A 1SW0A 1LBLA 4UTWC 3HG2A 5FAGA 3W7EA 4H1ZA 1ZJHA 2Y5JA 4LUJA 3ZVIA 3IGSA 4KFPA 4IIGA 1OCQA 2GK1B 3N3MA 3MV11 4G7EB 2WXDM 4P7NA 1Y65A 2R1PA 1X39A 3ZMRA 4A2SA 1OD8A 1ZJAA 3CLWA 4C1NB 3ID7A 3UWQA 4H7ZA 3CUGA 3S5OA 3G6LA 4AD5A 1ZSXA 3PPCA 4JTLA 1XX1A 4RW3A 1FH8A 4OJYA 3TYZA 1O5RA 3WLRA 2YL5A 3WF3A 2VR2A 1J0IA 5EFDA 4ZOBA 3NSNA 1R9XA 3UVIA 4DNHA 3T0BA 3DHDA 3QVQA 1EA9C 3OHMB 3C8FA 3Q2DA 1BQCA 4KW2A 3T0CA 5DXYA 3S83A 4DEFA 2A7RA 3ARTA 4CD8A 2FTWA 3MSDA 4MZYA 3TDFA 4QG9A 3MP5A 2JIWA 4HBKA 2I14A 3LCLA 1H7NA 1EGZA 4B9YA 4FSAA 3ARVA 1U5HA 3W71A 5ABHA 2VP8A 3UZXA 3VOFA 1HKVA 4HQVA 3QR1A 3M0KA 4DM2A 2DW6A 3VIJA 4MNLA 1HKJA 1H1YA 3BH4A 1M53A 5HAOA 1CZ1A 2GGIA 4I3GA 2CW6A 3EDJA 3UZ5A 4HYVA 4L4PA 4L56A 2GUYA 1V0NA 3KCLA 5C7HA 2GDUA 4P7QA 4A05A 5XINA 2ISVA 3QF0A 3S5NA 2AQWA 2DPEA 4ALDA 4XTIA 1S5NA 1B57A 2G96A 1RCXB 4OECA 1HKKA 1UD3A 1XIHA 3NUKA 3FCPA 4GC3A 5D2YA 4WKFA 4Z2IA 4CKQA 2QW5A 3S2MA 4US6A 3NPXA 4JTDA 1P0NA 4LAKA 3WH8A 1TV8A 3PTMA 4DO7A 1AQHA 3W7KA 3WYZA 1TV5A 3S0CA 3T0AA 1X6LA 3QY8A 1EOMA 3OVPA 2VRKA 2V2DA 1GOWA 3ABQA 3VE7A 1UPMB 2WC3A 5IFTA 4WJ8A 3O05A 4JFUA 1PTAA 4XVDA 2PE4A 3N15A 3HQ1A 4N9BA 4C91A 1W1VA 2XH7A 3UESA 1TV4A 1FKWA 4CVWA 5JXQA 4N9DA 2YCLB 2J6VA 3TFCA 2E25A 1DWAM 4I9TA 4PCNA 5AHEA 4DZHA 2GJXA 3RITA 3TQVA 3QMSA 4DF0A 3HIJA 5MKGB 2WV8A 3TTYA 3NM1A 4PTXA 1RPKA 2OZ3A 1MUMA 3EMZA 5GNZA 3DH7A 3ZZ1A 3UGRA 3W2KA 4GIEA 3FKRA 5JMUA 1OWQA 1CW2A 4DXKA 3EXRA 4EOUA 4G2DA 1OF6A 4HMCA 4JNZA 5I77A 4BKNA 1WDPA 1FXQA 3QZ6A 3HQPA 1E9ZB 3WH6A 4B15A 2XVGA 3ZVHB 3RYSA 5I06A 5LIXX 3V1HA 4NJIA 4DBEA 4YS1A 2ALRA 1X38A 5LNWA 4P2VA 4POCA 1PV8A 5BRBA 4MUZA 4AB4A 4U4MA 2Y70A 4GQGA 2ICSA 4PMRA 1YDYA 3UJSA 4OBSA 5CBJA 4JQ3A 2F6XA 3PUEA 4XBKA 4J4KA 5FEZA 1UWTA 3TX9A 2BTMA 4AXNA 1N82A 2VC5A 4DWSA 4DBWA 3MMUA 1EXBA 3B8TA 4C6CA 1GVQA 1BGGA 4QBXA 3V0UA 2HVMA 3DFSA 4P8XA 5CGTA 3W29A 1I4NA 4X2RA 1EDGA 4O1CA 1B4EA 2P10A 2WZMA 1NOUA 3OZYA 2FGBA 4LT9A 3VIOA 3GFXA 4YCPA 4NNBA 1JJKA 3VIIA 1L2UA 2QPSA 1CGYA 4UFJA 4FO4A 4G5DA 2DEPA 4A4AA 1QI0A 3QY7A 4U2YA 3MU7A 4A8IA 1A50A 3I6TA 3SRFA 2XN0A 1NFGA 3S46A 4B5NA 2WVTA 4MKVA 1W5MA 5I07A 3N19B 3M0HA 5JUVA 3W2UA 1ONEA 3QOKA 3P0WA 1Q5MA 1ISYA 2XYLA 1IF2A 5A6AA 4Q8QA 3LPFA 3DG7A 3T7VA 3WMSA 3FJNA 1ZLPA 4JTQA 4ONVA 3CV7A 3SAZA 1W3TA 2QZRA 5AHMA 1WP6A 1KC7A 4W93A 3U0HA 1LJYA 4H4IA 2R1MA 3PBUA 3W28A 1JYNA 3VKKA 2Y7DA 3W7GA 3W2MA 2W27A 4XZHA 1BD0A 2WMGA 2ZVRA 4HB7A 1IEWA 1QNPA 1GVSA 1UR4A 3WD2A 4Y2WA 1XSJA 2W79A 3ZR6A 2CCRA 2C71A 3B04A 3FAXA 3WNPA 3CS2A 2X0SA 5JBDA 1U5JA 3KCJA 4E2VA 3GW3A 1GYLA 3P62A 1RD5A 3ZJ6A 2G4FA 1XM3A 2VWSA 2WBGA 2YSWA 4ZZ9A 2JFEX 4QQ3A 1QRQA 1UOKA 4G56A 4Z1YA 1XYCA 4H04A 4R27A 3TTEA 1XS2A 1O94A 1MFVA 2R1LA 3PPFA 3P80A 5GPRA 2W63A 7REQA 4C6MA 2BHYA 3O63A 2WMJA 3MWAA 3L4WA 4DF1A 7XIMA 5D9MA 1GVEA 2GVEA 3CB3A 3SFWA 3JS3A 4NHVA 3WNMA 5F2IA 2BVYA 3GVGA 1GG0A 4FB7A 2FHBA 2PUZA 2QYGA 2GJNA 3A5VA 5AYZA 1IZKA 2RH9A 1JPIA 4FNPA 2DUXA 1HGWA 5HMEA 5D37A 3NQBA 3W7OA 4IIFA 1CENA 1A0EA 2FZBA 1ZQ5A 4R5EA 4UCFA 1GG1A 4NRSA 1JRCA 2QMKA 2YXOA 3GXIA 3ERPA 3RJYA 1M01A 1S5VA 4AU0A 2X1SA 4AZGA 7ENLA 4IFOA 1GW9A 1VZWA 3REQB 3GDBA 3W83A 3I10A 3W02A 1A5BA 4JQ4A 4S39A 2DP3A 3DKJA 4GOAA 4GH1A 3MP4A 1R9ZA 1O66A 1WXJA 4NI8A 4NQ1A 3A24A 3QQ0A 3DIPA 2E0PA 3VGBA 1GVOA 2H8XA 1ECEA 4IQDA 3WF0A 3B8WA 3R10A 1GQJA 1VIZA 2JBMA 1L6YA 4LUTA 1QJWA 1WUEA 3EEZA 3WLIA 1ZS2A 4GWEA 4JICA 3STFA 5FAJA 2FH6A 2CZDA 2UY3A 2ZC1A 1E9YB 1PIGA 4RPQA 1S2TA 3VZYA 1S5WA 2X09A 3CWOX 2J27A 3F5KA 1I2QA 3NQFA 3QSTA 5C0QA 4E4FA 3R8GA 2NT0A 4XBJA 3NQ8A 2NX9A 3QSRA 1QPQA 1RQBA 4GVGA 2WHJA 3NZ1A 1EGVA 4GBUA 4AZCA 4YTTA 2WMKA 4E8DA 3HGOA 1JDCA 3I3BA 1ZAJA 3S6DA 1UKSA 1YDOA 1KGUA 4QXIA 1BWLA 1DPMA 5DX7A 5DFAA 4GYFA 3IK2A 5GNXA 4FMVA 3BG3A 1W8GA 4JY8A 2QKFA 4LAOA 5H8UA 4L80A 2TPSA 2YGYA 1W5NA 3AYRA 4GJIA 4LS1A 1U5VA 1MQPA 1ZHAA 1VCGA 4KWSA 4NJGA 5I5RA 4IQLA 3RU8X 3QPZA 1CI1A 2POZA 4BZYA 2AOSA 2Y5SA 1XIIA 2BHUA 1ZBWA 4JYFA 3UNDA 3CL7A 1HT6A 3L67A 1KRMA 1OBAA 1VYRA 2J9XA 1M41A 4RCXA 4WDWA 3HJZA 4MWAC 1A53A 1B0IA 3ITYA 3SO7A 1P1XA 2DFAA 3RILA 2QDHA 1XRVA 2OZ0A 2RDTA 5HNUA 4AQLA 4FLSA 2R24A 4AXKA 1QI2A 8XIMA 3CZ8A 1NU5A 4TX6A 4DNMA 3UCDA 3GX9A 4H2CA 3VDCA 1RVKA 4HA3A 1WNOA 2OSWA 2V69A 1JDDA 3PBMA 5HNNA 3WELA 1AJ0A 2QMJA 3VIKA 1J2BA 2XIBA 5E0CA 2XGBA 1JRBA 1CXKA 2X1UA 1FCVA 4KRZA 4ICCX 3P8JA 1DVJA 1X97A 1Q6QA 4F2UA 3CZLA 4IGSA 1NJJA 3S2NA 2O7QA 3AIWA 3QOMA 5M2FX 5I03A 1FHLA 2YZRA 1A3WA 3W07A 3L4YA 3PBWA 2CC0A 3HV8A 2BDQA 4JTCA 1NARA 3C3UA 4JTSA 1LRQA 3GXMA 2A3EA 4JOMA 3NQMA 1HTIA 3GHUA 1L8PA 3PSVA 1UR0A 1RLCL 2QVNA 2ZUNA 4KEZA 4PEKA 3WQEA 4ZQMA 1JF5A 1Q85A 3GVWA 3ZR4A 2HMCA 2GUBA 2PDBA 3IJDA 1ICPA 3IJLA 2YCEA 1AMYA 3P3BA 3S3GA 3GD6A 1BAGA 3W1RA 3DBPA 2A7PA 1OABA 1FHUA 3N2MA 3S2JA 3AQUA 1W9VA 5A3HA 2ZXQA 4NAFA 1C8YA 3SCUA 1RY8A 1UKOA 1PKMA 2QCDB 3QR0A 3QPEA 3W7CA 1EF3A 3OO2A 3TNBA 2WSPA 3I7QA 4UTJA 2O56A 4F2BA 1H09A 2E09A 3T2OA 1TWWA 4PMVA 1E0UA 3SJ3A 4KQNA 5G4HC 2POTA 4V1YA 2J4GA 3URAA 3WBAA 3F1QA 4D8ZA 3S1VA 4TU1A 1VEPA 2CFFA 3D0CA 4YTRA 1K9TA 1PXGA 4K8HA 4PE8A 3E1F1 1LL4A 1YTKA 2HTMA 1XYZA 3RCMA 1JVNA 4QLKA 2ATSA 1RQEA 2P8CA 2DSWA 3CB8A 1VHNA 1M7PA 5EPDA 1EA0A 1W17A 2HBXA 3IRDA 2PPGA 2D3LA 4QRNA 3MS8A 3GY1A 2Z25A 4HPXA 1XDLA 3TN4A 3CZKA 3NDOA 3A47A 3RRXA 2VGIA 2R14A 3Q37A 1EFZA 1L8NA 2VX7A 4KT2A 1Q3NA 1S5TA 4R7JA 2QCEA 2WMFA 3BAKA 3GTHA 4O0KA 3W24A 3CQKA 5M5DA 1LL7A 3FXYA 7TAAA 1FA2A 1OGSA 3NQ2A 1S3HA 3QW4B 4NT0A 1BG4A 3GKAA 2XN2A 2PZ0A 3VO0A 4QJ3B 2QIIA 4ZO8A 3RDKA 4K6AA 2E9BA 3LA4A 4LS2A 3D6NA 2WSYA 4HNNA 2VQUA 4Q4RA 3BAYA 3GHTA 3NJ3A 4MJ2A 3THQA 3DFTA 1GNXA 2B81A 2J7DA 4ZQOA 2PF0A 4S3EA 5FA5A 1XLAA 2I5IA 3IJIA 5GJNA 3SJNA 1T8QA 2YKKA 3ZYZA 2YLAA 1SGJA 2NVCA 2RAGA 5KMYA 1K9FA 3TN6A 1DHPA 3R43A 2VEKA 3W53A 3SCTA 3PUDA 4CU8A 3WLLA 5C9ZA 5CGQA 2O9TA 2BV9A 2XVNA 1MXGA 4RK8A 1J4EA 2ZWYA 3U57A 1TZ7A 1JD9A 4MPQA 5EMKA 1JYVA 3WQ5A 4CU7A 4PMZA 2VX6A 3UNTA 4Q6JA 3CUFA 1V7AA 3O6YX 2DW7A 1Q6LA