1K8ZA

Crystal structure of the tryptophan synthase beta-ser178pro mutant complexed with n-[1h-indol-3-yl-acetyl]glycine acid
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
268
structure length
257
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 98
structure length 257
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k8zA00
1TRIA 3PBVA 4M7SA 1NVMA 3LHUA 3FJLA 4LVAA 2DZPA 4IPJA 3QW4B 1H61A 3L65A 4PL1A 2QCHA 3CLMA 3EXSA 4C1LA 3W1UA 5C2XA 4NUWA 1LYXA 1CX9A 5A8GA 1Z41A 1H63A 3Q37A 2CZ5A 3G1VA 2XN2A 1KFLA 2ZA3A 2OT1A 3B0UX 2YFNA 1JCNA 2ABBA 4QITA 1BWKA 1EX5A 1TCDA 1YTDA 2DZVA 3W6YA 2OZ0A 2E09A 3IEBA 3W1TA 1KFEA 4ADUA 4UFIA 4MFEA 4LC8A 2Z6IA 5BMXA 3BW2A 3RMJA 5G1YA 1HO1A 5LNUA 4N6EA 4FNUA 3W07A 2GJNA 1T99A 5AC6A 5LNVA 4ADTA 2TRSA 2TMDA 4IMDA 3TW7A 1KTNA 4JX5A 4Z1BA 3TFXA 4FIQA 3PF3A 1JCMP 1GYNA 3FKRA 1YYAA 4K36A 4N02A 1VC4A 1IXPA 2TYSA 1VH7A 4LWWA 1XBYA 2NLIA 1GZGA 4O19A 4MJMA 1H7XA 5FEWA 1AW2A 3W7KA 1O95A 2VFGA 3S5NA 4O54A 1C9DA 3USBA 1HO4A 4GBUA 1TTPA 4N6FA 2V82A 4UNLA 1O5KA 1ICQA 3TX9A 4WXZA 3GB6A 1KA9F 3HIJA 2E6AA 4XKYB 5KSWA 5DCBA 4Z0JA 5LHEA 5HNRA 3KVLA 5T26A 3NL5A 1L2UA 4X2RA 4UIOA 3LCHA 5HULA 3BPWA 4JYDA 3GDMA 1R2RA 5CPMA 1LTDA 5DY3A 3VI2A 1O5XA 4LW7A 4UFKA 4WUIA 3BG5A 3OA3A 3PUOA 1ADOA 3MBDA 2DJLA 5LSMA 5D03A 2R91A 4IMCA 3HB9A 3KVMA 4DBDA 2ZRUA 4FNRA 3SIZA 2QCCA 5E0KA 5I3GA 2VOMA 3NL6A 2XN0A 5G4EA 1TIMA 3LOTA 3UYCA 3GNNA 3NQCA 3ZWSA 3N9SA 4YWIA 3OVQA 2OCZA 3CM4A 3RK8A 4P2VA 3M9YA 5LGXA 4K6AA 2X2GA 2NX9A 1H1ZA 3LGEA 3NQAA 2QUUA 3CEUA 1Q6RA 1KM1A 2RDUA 3GDLA 3H53A 2Y89A 3HBLA 5KMYA 4O0KA 3L5LA 3N2XA 2BWGA 1W8SA 3MYOA 4K39A 4BFAA 3PG8A 1FDYA 2QDGA 1R46A 3T4CA 4DO6A 1ZJIA 3OHIA 1WYIA 5LHFA 4LUIA 3F03K 3VE7A 4ALDA 5CSRA 4AMAA 3W1PA 6ALDA 1T8XA 1F6KA 2VELA 1QR7A 1MEIA 3DAQA 3MP4A 1SUXA 3ZR4A 2ALDA 4O0ZA 4QJ1A 4LS1A 4UTUA 4FX6M 1SU5A 3S6DA 5F2LA 1GT8A 2FDSA 4JEQA 2YFOA 3OBKA 4QSHA 3W2UA 4AVFA 4FHAA 2V5LA 4A2SA 4HSNA 1JR1A 4JTSA 2W0UA 1RR2A 1ZNNA 2F7FA 1U5JA 3S1XA 2Z1BA 1L9WA 1UJPA 2CLEA 1K7FA 3MI2A 5K4ZA 5KINA 2CLFA 1I2OA 5F2MA 3R2GA 2G5WA 4AH7A 4IMEA 3FYOA 4XKYA 3TH6A 1DBTA 1ONRA 1Z42A 1G69A 4I7WA 1EUNA 3B4UA 3V1PA 5FESA 2V8ZA 5AYYA 2E77A 4O1AA 4ORMA 4UTTA 3NPWA 1VLIA 4WQ6A 1G7VA 1KLZA 4O4VA 1FCUA 5SWUA 1A5CA 1OX6A 3IGSA 3QQ0A 4QISA 4HPXA 2VENA 3P84A 3LCWA 4O57A 4H6KA 5D2YA 3BG3A 3LRKA 4OHQA 4ADSA 1LDCA 3C3NA 3W2JA 4MOZA 1H1YA 2YYTA 1XDMA 4GXMA 4Y90A 3I65A 1TMHA 4JX6A 1MSSA 2HS8A 3RF9A 3W7IA 3PWAA 1IIGA 1G6CA 5BNKA 2ZRVA 3LTSA 1AL7A 1EUAA 1MEWA 1GVSA 3SY5A 3CU2A 3FEMA 1QWGA 2ABAA 4JYEA 1XC4A 5F1VA 3WK0A 2BXVA 2ZZ7A 4AHPA 1TB3A 4AF0B 4ICNA 2NX1A 2CWNA 3UXAA 3UWQA 1ICPA 1QPNA 3HG4A 3WJSA 3JR2A 1JRBA 1YDVA 3G0UA 4MY9A 4P61A 3TUUA 5HMSA 3PR2A 3QM3A 3ABRA 5K7JA 1XKYA 4CLMA 1I2PA 2D73A 5AHMA 1UBSA 3LCIA 4O14A 3IIOA 2AGKA 1XI3A 5D32A 4MIMA 4NZFA 4PODA 1VJIA 2WNZA 3Q94A 1A5SA 3LXCA 3W74A 3TW6A 1F5ZA 1F7BA 4Y9AA 3RLVA 2YGYA 1WOAA 3W87A 1HTIA 1I2NA 3BW4A 3W1LA 2A21A 1FWSA 3WK1A 3T7VA 4XZ9A 1X6UA 1A50A 1DORA 4YCOA 3LTYA 4IJBA 1MZHA 2C13A 1EB3A 3SJ3A 4LOCA 2E5DA 3TC7A 1DVJA 4ZL1A 4JTLA 3NQ7A 4UTHA 4GFSA 1F05A 5J5DA 3CB8A 4UTIA 1SZNA 5K2ZA 5I3IA 1DOSA 3N34A 1I2RA 4AEOA 1QPRA 2ZZ2A 3TV8A 4LTSA 4JDYA 5E1QA 4FX7A 3ZFHA 5CZSA 2YXGA 5MHBA 3S5YA 1NF0A 3E0IA 1TYGA 3G8RA 3EX2A 1AL8A 3W1XA 4CCEA 1XDLA 2GOUA 2XFWA 3TMQA 2EKCA 3TR2A 5D38A 2LLEA 1XFBA 3V75A 1JRCA 4AHOA 3ABQA 3VCRA 3LB0A 3LRMA 3W2KA 3HG2A 4Q33A 4DPPA 3QPYA 5LNWA 2A0NA 3EKZA 4YLWA 1LRTA 4K38A 4N4PA 5D2XA 2NUYA 3R5EA 4LUJA 4FNSA 1I4NA 5I3KA 5AC7A 3KVKA 1FY6A 4KFOA 1PS9A 3TXZA 5DCEA 3NL3A 5U4NA 3W22A 2PE4A 5I3JA 1R2TA 4R53A 4U4MA 2NXGA 2X1RA 3E12A 3M47A 3R8RA 4AXKA 4OWGA 2JK2A 4JDBA 3NEVA 1VYPX 3W75A 3TCEA 4RXGA 3DFPA 4X3ZA 1OJXA 3GR8A 3HJZA 3PULA 3JS3A 1LCOA 4AF0A 1M7PA 5HWJA 3HGSA 5AHIA 3G1HA 3TSDA 1N55A 3D0CA 1VHCA 1GVRA 1XBZA 5EL1A 5FF3A 3SR7A 2V5BA 1L6SA 1JUKA 3B05A 3A22A 1VHNA 1OYAA 2J6XA 4EF9A 5D37A 3HGRA 3DI0A 2Y63A 2C0AA 2TPSA 2ZZ1A 1ALDA 3DU0A 1F76A 2ZCGA 4KWWA 2PURA 5IBXA 3W71A 4M6PA 4UTWC 2QJIA 4IMFA 4PL2A 4FF7A 4S1FA 5DY2A 1YTKA 4GUJA 2GVGA 3LXBA 4Y96A 1ZAIA 5CZTA 5FF4A 4O53A 2QEZA 3S1VA 4LU0A 4Y6GA 4BI5A 2BX7A 2QJGA 4K8EA 1OVDA 4NU7A 2ZA1A 4LRSA 3NR0A 3GYEA 1EEPA 1TTIA 2GQ8A 2CLIA 1UASA 4MKNA 1BEUA 2VFFA 2WO5A 2J9ZA 3NNTA 5DLCA 4E0CA 1EWEA 4JXCA 4JTKA 5I3FA 2H3DA 2ATSA 3INPA 3KVJA 4IXXA 3N9RA 1TPVA 3LHYA 3EWXA 1B4KA 2FB2A 4NT0A 4NQ1A 1TJRA 2R94A 4WZHA 3C4UA 1D9EA 5HQEA 3P8JA 4UTMA 3STEA 2J9YA 1RQHA 3QZEA 1SO4A 4FIRA 2VXNA 2Y7GA 3LI1A 1I2QA 3TROA 4TO8A 2C3ZA 2X1SA 4HT3A 4MJZA 3CHVA 4O28A 3VKJA 3NQEA 5AYZA 3LV6A 5D2WA 1SFLA 3EX4A 5LZLA 3G18A 1N7KA 3KRZA 3WFAA 1Y0EA 5BW6A 1ZY9A 3SW6A 3WJYA 2E6DA 3NPVA 3W73A 1GVQA 2YZRA 3OVPA 3UWZA 1FBAA 4UFHA 6TIMA 1OF8A 2J88A 2H3BA 1D3GA 2V2DA 1W5QA 1JVNA 4QNEA 1JUBA 4G1KA 3KHJA 2J9XA 3UQNA 3PB2A 4U28A 3LCLA 4N9EA 1FCQA 4O10A 4GUGA 3K30A 3W7MA 4POCA 2E1DA 4JICA 5HWNA 3LM7A 4MFDA 2H90A 5EY5A 3WJZA 1I8JA 1KBIA 2NUWA 3VNDA 1FCBA 2XN1A 1OK4A 5AN7A 3M43A 4LVGA 2J24A 1CW2A 4HNUA 4LRTA 1BWLA 2Z2UA 4K7VA 3S1WA 3LLFA 4YL2A 3C0JA 1PVNA 3G0XA 3ABOA 4GE8A 3TQVA 3QSTA 3TNOA 3P82A 3U8GA 3BLIA 3B06A 3TFCA 4EWND 3HMJG 4O16A 4WX2A 4ZQOA 3WK2A 3GLCA 3W2LA 4YXGA 2Y70A 4UR8A 4AWSA 1K7EA 3NG3A 5EKYA 3NO5A 4OE7A 2H8ZA 4RK8A 2A1YA 3CC1A 2A7NA 5D02A 1LLZA 4M6VA 1NAL1 1SSGA 2GJLA 3B04A 1T96A 3P62A 4I7UA 3KXQA 5G5IA 3EWYA 1Q6QA 3EWZA 3A24A 3P5ZA 2C1HA 4KFNA 2VEIA 3PVFA 3PSWA 4AWUA 5AB3A 1LLWA 4PEKA 4Z08A 3TAKA 2A7PA 5K4XA 4PC8A 1WAUA 2CZFA 3FS2A 1G4TA 2ZRZA 1ZAHA 4CQ8A 4N9CA 1SW3A 1S5WA 4Y8FA 1K8ZA 3M41A 5DXXA 4JTGA 2QCMA 3S1UA 2WSRA 1GTEA 4NJJA 1LROA 4N4QA 1MXSA 2X30A 1TPH1 2JGYA 4HSOA 3TJLA 3UPBA 3C52A 1EP3A 3BO9A 3S5OA 2FB3A 1B3OA 1KV5A 3BLEA 1ZALA 1WXJA 1LZOA 1ME8A 1TV8A 4AWTA 4IXHA 3QSRA 1TPUA 4IX0A 3HPZA 3LHVA 1M6JA 3TAOA 2R14A 3U6WA 2QAPA 5C54A 4CQAA 1JUEA 4QAIA 2Q8LA 2NXIA 3EEGA 1HUVA 1DL3A 1SFJA 3L5MA 4X9SA 1YXYA 4K8HA 3WJWA 2QCFA 4NVTA 4DBEA 5AC8A 3HGJA 3CIWA 5KITA 3NQ6A 1VLWA 5F4XA 1PV8A 2HMCA 4NJGA 3M5ZA 3PSVA 1YDNA 4MY8A 3PG9A 2H6RA 5IM51 3SZ8A 4O1CA 1KBJA 3QYQA 4RLIA 2FTPA 4MVAA 2V81A 4NJIA 4WD0A 3UXDA 3HF3A 1OFAA 4WY0B 4M7TA 3U2OA 3MYPA 1GYLA 3NAVA 2W79A 1K8XA 2FJKA 4O8RA 3GXNA 4S2BA 1GQNA 4RCXA 3LHTA 1SQ7A 4LY8A 4GJ1A 1PHWA 4DQWA 3G3MA 3LHWA 1F74A 2BZNA 4UNKA 3LBCA 1ZFJA 3S5ZA 2V2CA 2YW3A 3RFAA 1OYBA 1W5NA 1NF7A 1AW1A 4BI7A 1P1XA 1DQWA 4PH6A 2CLMA 4MPQA 1VRDA 3Q58A 5F2IA 1XXXA 3DI1A 3N3MA 4JY9A 4LS2A 4JIQA 5KZEA 3R89A 4B5NA 3MP3A 1KTCA 2VFEA 2Y85A 4UTWA 4LVDA 3L0KA 3TQ0A 1KM2A 1SZGA 1GVFA 1J4EA 2QCLA 1TPEA 3L9CA 4O1DA 1OX5A 5KTLA 4DF0A 1Z48A 1GG0A 1H7NA 3CWNA 1PCKA 2CLLA 2FIQA 4MLJA 4H4IA 4CCDA 1BKSA 3DHFA 2E5CA 2Z0IA 3L0NA 4I7VA 2QCDB 1IGSA 2NV2A 5CGQA 3W1RA 4TMCA 2PCQA 1IF2A 5AHNA 4UTKA 1XCFA 3VE9A 2C19A 1O94A 4WOQA 3T55A 5GVJA 3MW7A 5D04C 1OABA 4M5PA 4IMGA 1LP6A 3MWAA 4MZYA 4L4MA 3BV4A 1HL2A 2YW4A 3UNDA 3M5XA 5HWMA 4K7YA 3DGRA 3R12A 1ML1A 4K37A 5BRBA 1ZCOA 4EVZA 3GDTA 3NOEA 2P1FA 4RZ5A 1KFKA 2QR6A 3W7JA 2EGZA 2VEKA 2QCNA 3C6CA 4JTUA 5TQLA 4DELA 4FEZA 5D05A 4IUOA 1K7XA 3HPSA 4WY0A 1TRDA 1RZMA 1RPXA 2Y7EA 4FXSA 1PIIA 2H8XA 1OFRA 3M6YA 2HSAA 4AAJA 3QF0A 2ZZ6A 4MZ1A 1YXDA 4OV4A 4IGHA 1TREA 2OT0A 3W7EA 4XBKA 4L4LA 4KKXA 2DU2A 3F4WA 1KW1A 4XBSA 1W1ZA 1W5PA 4LVFA 1EP1A 2DORA 1EP2A 2V30A 2WSYA 3LCFA 1HFBA 1H51A 5TIMA 2FLIA 3W7OA 2YYUA 5CZ0A 1D3HA 1SZEA 2UV8G 4UCGA 1WX0A 3NM1A 3W7NA 3A23A 3E96A 3GZ3A 4UMCA 2Y88A 3EX3A 4JTJA 4E2BA 2RFGA 4M6QA 3PBWA 2DP3A 1Z44A 1WOBA 3M44A 1KM0A 3MHGA 3IRDA 1KFJA 2A4AA 1VCFA 1AK5A 2ISSA 3I7RA 3QH2A 3JRKA 3UY7A 3W1AA 1OFDA 3KAOA 3L68A 5HUPA 2EHHA 1PL9A 4NXKA 3O6DA 5DCDA 5C5YA 2ISWA 4NX0A 1K02A 3QQ1A 1ZENA 1XUUA 3GKFA 4BF9A 4DF2A 2QCDA 4HNNA 2EPHA 4Z1AA 2NWRA 1FXPA 2RHGA 3ZS4A 5LNRA 2QF7A 2A85A 4A2RA 1HG3A 2DZWA 5FF7A 1WQ5A 1RVGA 3GK0A 1Q45A 3QW3A 4GC4A 2C14A 5K3VA 4X22A 2FPVA 1GG1A 1B9BA 1GVOA 2Q3RA 3W9ZA 2HS6A 3H55A 3G1YA 5EBUA 2OJPA 2Q3OA 3A5FA 3WK3A 4TMBA 3PB0A 1L6YA 3NM3A 4CNPA 4E2DA 2NX3A 3FA5A 3GAKA 3NPXA 5CPOA 1DKWA 3GR7A 4DEFA 3IIZA 5FEZA 2YDAA 3G1SA 3UPWA 1GJPA 3BW3A 5FF0A 1SZFA 4YMZA 3G22A 3GXPA 3TMLA 3F4NA 3NYZA 2NV1A 4BI6A 5C6MA 4H3DA 1RQEA 3G24A 3Q2DA 4O15A 4OU1A 1FXQA 1TPDA 4TX9A 4GWEA 2ZZ4A 1IXNA 2CU0A 3GXTA 3HPXA 3EB2A 1V7YA 3THAA 2R8WA 4KFPA 3UWUA 3DZ1A 4RKAA 1VR6A 5AOUA 3LI0A 1YLVA 2RH9A 2WQPA 3A5VA 1P4CA 3QMSA 3W76A 4DO5A 4O52A 2CZDA 1K3UA 3KRSA 4R34A 1O60A 2RDWA 3NQMA 1H60A 5FF2A 1F6PA 3DBPA 3S8HA 1OF6A 2QCEA 3M16A 4RXFA 2VFHA 4I9AA 2JKAA 4TR9A 3W7DA 3C2EA 4JR5A 4JTEA 4DPQA 3UZJA 3EXTA 1C29A 5ABTA 1VZWA 1ME9A 1LBMA 4UMAA 4N9BA 3S0CA 3T78A 2V0TA 3MI3A 3DH7A 3LCXA 3CT7A 3W1QA 1FX6A 1UB3A 1VYRA 1UUMA 2E6FA 4UFLA 3O05A 2ZRWA 4FB7A 3HG3A 3FFSA 4AB4A 3DFOA 4LNYA 1W31A 1QO2A 1V5XA 2PRLA 4NX5A 3M7WA 4IQLA 5H2ZA 2BSLA 2Z6JA 4XWUA 4UTTC 4Z1CA 3TXVA 2PRHA 2E6YA 3DFTA 3NL2A 3W7HA 4RZ6A 3LTPA 2ZRXA 5LNSA 2B7NA 2ZTJA 3F1QA 1QOQA 5EA9A 2JBMA 3I7SA 4GUHA 4DXVA 4JN6A 2VFDA 3C2RA 2NUXA 4WOZA 3OVRA 1FDZA 1MO0A 3O16A 5EMUA 2NWSA 4O4WA 4FNTA 3DKJA 4JGDA 1P0KA 1IIHA 4JYFA 4IX2A 3C56A 3ZWTA 2YPIA 2ZZ3A 3QFEA 1TTJA 3MMTA 2B7PA 4UTLA 2GVJA 1S3HA 3N14A 4JTTA 3W86A 1H7WA 1KM4A 2E5BA 1NFBA 2QAFA 4JS3A 4FX8A 4MUZA 2VFIA 3W88A 4JY8A 1IXQA 1ZHAA 2G96A 5D09A 4Z0SA 3QC3A 4LC6A 5DBUA 1A5BA 1P0NA 2Y7DA 1FWNA 4FXRA 2O7QA 3LX9A 5AHFA 2GQ9A 5DBTA 2G97A 3NQDA 1SW7A 3ANYA 3O63A 4XTIA 1YPFA 4BK9A 3STCA 1TQJA 1OYCA 4O50A 2I14A 4EF8A 3CQ0A 3UZ5A 3CTLA 3DFQA 2YR1A 1W5OA 1TPC1 3LHZA 3C2VA 3TK7A 1FWWA 5TBOA 5CG7A 2Y7FA 4IPIA 5HJLA 1DV7A 1RV8A 1X8FA 1LBLA 1JQXA 3MHFA 4O12A 1LRQA 5DN1A 4QM1A 4YCPA 3BVJA 3MBFA 2DZUA 2JGQA 1IXOA 3FJ6A 3PAJA 2GQAA 1W5MA 3QEZA 1QDSA 2B7QA 1M7OA 3G1DA 4LVBA 5H91A 3W1NA 3G8EA 1X1ZA 4QQ3A 2CFFA 1OFEA 1VS1A 4ML9A 5D30A 2CLOA 3T40A 2FPTA 4RZ4A 1OFOA 2F84A 2JKEA 2DJXA 3DFSA 2QKFA 3NQ2A 3NGJA 3G0SA 1KFCA 4W9TA 3W23A 4UFMA 1OG0A 3N19B 3P74A 3NQVA 3BGJA 1FCVA 2CLHA 3PY2A 3CWOX 2PRMA 4A29A 1X7FA 5CZJA 3BK0A 1B4EA 1M5WA 5L6UA 3GX9A 3IGUA 1QNVA 5EPDA 3O06A 3LLDA 2ZTKA 3C61A 3MHUA 4R7JA 3P8IA 1ZAJA 1RD5A 3TSBA 1TV5A 2CLKA 4NXSA 1TPFA 3CPRA 4AHQA 2WJZA 1TJPA 4EIVA 3HGOA 3NZ1A 3L21A 1XBXA 2C6QA 3G1XA 4NNBA 1LM1A 5E93A 5AFDA 3C2OA 5K9CA 2IQTA 5CPNA 5K9DA 1JCJA 3SI9A 3UWVA 1EIXA 1S5VA 3TE9A 1WA3A 2WPBA 1SR9A 1VCVA 3IGXA 4FO4A 4C1KA 3L66A 1GPWA 5J5RA 3STFA 2WNQA 3FLUA 2FFCA 2RKXA 3I6RA 1E51A 3IIXA 3I7QA 1YADA 5IBXC 4RV8A 4O18A 3P5YA 1GOXA 2OX1A 2GVLA 3A21A 4PFMA 3DKLA 3B8DA 4CNNA 4RX0A 3C8FA 1K03A 1SO5A 2PC4A 2QUTA 3O6YX 5G2IA 2NXHA 3TA6A 1FDJA 3SGZA 4NNCA 3PUDA 2B7OA 3UY8A 1TO3A 1G4EA 2DZXA 3E9AA 1TV7A 3P7YA 3S9YA 1EWDA 3SFKA 4N2YA 3L2IA 3TIMA 1R30A 1KV8A 3O8AA 1LBFA 4LT9A 3FKKA 3N2MA 1ME7A 1H5YA 1H7RA 1TTQA 5AHLA 3GNDA 1SPQA 3QRHA 5G2WA 1I45A 1QFEA 4IWWA 4O1BA 5F4WA 3FOKA 3DFNA 5FEPA 1Q3NA 3M5VA 1QAPA 4E38A 1C8VA 2QUVA 3TDFA 4HHPA 1FUYA 3MI6A 3QMTA 4JNMA 4MYXA 1W0MA 2YSWA 3MUXA 3KX6A 8TIMA 2V9DA 4O13A 3W3OA 4JTHA 3KRUA 4HIBA 3AO0A 1AG1O 1G67A 2Q8ZA 3IVSA 3E49A 4R33A 1G4PA 3UWYA 1NSJA 3TSMA 2OMAA 1KM5A 1XUZA 5LKYA 3NQFA 2A7RA 2FPYA 1R47A 1L6WA 1SO6A 1DJNA 5C55A 2C18A 3HOJA 4IOTA 4GNJA 4BWLC 4O11A 5D2VA 4PA8A 7TIMA 4MLRA 3EKLA 3P61A 1T0OA 1VGAA 3SECA 3G3DA 5I3HA 2GPTA 4Q4KA 3UWWA 3IIVA 1KLYA 1YPIA 3PUEA 2ATMA 3CIXA 4UR7A 2B0MA 5G2HA 3RNDA 3NXFA 3W7RA 4HN4A 3HG5A 3VFLA 1DHPA 4JD4A 1WDWA 3PM6A 3L5AA 2ISVA 1TSIA 1A5AA 3L67A 3UD6A 4OQVA 4ZVJA 3TU9A 5HR6A 3IIPA 1KTBA 3W7GA 4PTNA 4TIMA 4XUGA 4NNAA 1EA0A 3EWUA 3QMRA 1A53A 2EF9A 3W2NA 3DXIA 4XTDA 4CCCA 5U7SA 5CKSA 4CNOA 2ZRYA 1JJKA 3CEPA 3LDVA 4JX4A 1SSDA 3TQKA 3NZRA 4RR4A 1R2SA 3STGA 5F1UA 4ZZ9A 3NDOA 4PCFA 3LBMA 3EWBX 3LCGA 4OV9A 3IVUA 3SSJA 3MJYA 3O1NA 1UUOA 1OX4B 1NEYA 3W1MA 3NA8A 2VKZG 3LRLA 4CQ9A 3WJXA 3EWWA 3B0PA 4JTIA 4XQ6A 4A21A 3B0VC 2WOQA 2DZSA 1GWJA 2DZTA 2WV8A 2YCEA 4GUIA 1VPXA 1TQXA 3EX6A 3TKFA 2W6RA 3P81A 3W84A 3G1FA 1N8FA 3N73A 2HTMA 2VC6A 3TJXA 3QJAA 2AAMA 2I9EA 2BTMA 2P10A 1OFBA 1ICSA 4UFJA 2RDTA 5KZDA 3L0GA 2VEPA 3FYPA 5FEXA 2GUUA 2V2HA 3RU6A 5KZMA 3IV3A 1QO5A 3RLUA 2A5HA 1VCGA 1JULA 5DXYA 4JIPA 4ZQRA 3M0ZA 1LORA 2QCGA 1XM3A 4Q32A 2BLEA 3P67A 1Q6LA 2WSQA 4NJKA 3OG3A 1YDOA 1FWTA 2ZZ5A 4TU1A 2E68A 2X16A 1RQBA 2C16A 3R13A 3W83A 4ORIA 2ZDRA 1AMKA 3NVTA 1QCWA 1XL9A 3M5YA 4ZQMA 5A5WA 1SO3A 4HNVA 1P5BA 2AQWA 4MYAA 2Y6ZA 1LRNA 1YTEA 2QJHA 3DENA 4JTFA 3GDRA 1W3TA 4MY1A 2J27A 3I68A 1WV2A 4ZMGA 5HR7A 4ONVA 1YXCA 3PC0A 4LV9A 3LERA 1VYSX 4ZQCA 1UCWA 5BOOA 3W7CA 5AHEA 3BARA 5F4SA 1B57A 3H54A 3O15A 3O6CA 3PS7A 1PE1A 1H7PA 3ATZA 5L9FA 3M1ZA 3GVGA 1Q6OA 4S2CA 3NPUA 4GUFA 2A2IA 1OX4A 2G95A 1GTHA 3TC6A 4BR1A 1G7UA 1H7OA 1QOPA 1X1OA 1BTMA 2WNNA 2X1UA 4UTJA 4O17A 2KZHA 5D2TA 1K8YA 3W2MA 3PBYA 5F2GA 1JCXA 3QPZA 3W72A 2WKJA 2YX0A 3GKAA 3S42A 3ABSA 1H50A 4KWVA 5HINA 1KM3A 4A22A 3B03A 4UC5A 3YPIA 1W3IA 1KM6A 4OBTA 2FQIA 1PCWA 1OFPA 3MP5A 3SGUA 2ZFAA 4OGZA 4ZQPA 1FQ0A 2ZA2A 5FI8A 5AYXA 1KFBA 1WBHA 1VQTA 4GRSA 5K9XA 4HPJA 1QMLA 4NJHA 2CZEA 2EAWA 3BLFA 3IVTA 1LOQA 5EYWA 4LS0A 1SW0A 4FNPA 3W7QA 4LV4A 3LV5A 4RJEA 4Z1DA 3AJXA 5D33A 5LGZA 3FIGA 4M19A 3ATYA 2ZYFA 1J5TA 2C15A 1DJQA 3MO7A 2X1TA 3HO8A 3W70A 4UMBA 3DHDA 4QIUA 3GDKA 1F2JA 1FWRA 4J9JA 2VEMA 4QNWA 5CPLA 3A9IA 5G4WA 4HNTA 4HKPA 3OEXA 1H62A 2CW6A 3P60A 3EX1A 1MEHA 3W85A 1JQVA 1F73A 4UUIA 1QPQA 1GEQA 3P80A 3KFTA 1O4UA 3GAYA 1TPB1 1G4SA 1THFD 3ELFA 4A3UA 4EOUA 1JCYA 1U83A 1OHLA 3BGGA 2ZQ0A 3HQ1A 2Y61A 4NZJA 1W3NA 1W37A 3OIXA 3W7LA 4UXDA 2A6LA 3O07A 4DO4A 1AW5A 3BG9A 4WY0F 1LOLA 1J2WA 1OFQA 5G1TA 4WJEA 3PBUA 2O7SA 5CSSA 1LOSA 1OK6A 3NQ8A 4OT7A 2NZLA 3T44A 4BWLA 1DQXA 2A6NA 2I1OA 3W7PA 1S5TA 2Y62A 1TPWA 1QPOA 5BMWA 4ZQNA 3LXAA 1W54A 2P0OA 3E02A 3G1AA 2ZBTA 4DF1A 1W56A 4FNQA 1EPXA 4WXYA 5DELA 4N9DA 3KOFA 4MZ8A 2JKPA 2QDHA 2B4GA 3GIYA 1PHQA 1JCLA 1XBVA 3THQA 1CI1A 4D2JA 3C2FA 3NQGA 1WBJA 3EXRA 5HUOA 2TSYA
chains in the Genus database with same CATH superfamily
3EDEA 4AD0A 1LJYA 1UP2A 3EXSA 2PWGA 3E0VA 5C2XA 4NUWA 1CX9A 5A8GA 3NVDA 1H63A 1ZB5A 1U22A 3TYZA 3W28A 4H9UA 4QITA 1REQA 2DVUA 3C5QA 1HL8A 2OZ0A 4J2PA 3AMCA 3LQLA 2XGIA 4A3QA 1KFEA 1E1CB 4F2TA 2Z6IA 1EDQA 3O3RA 3RMJA 4N6EA 4URIA 1M7XA 1AJ0A 4FNUA 5AC6A 1T99A 5LNVA 2TRSA 2TMDA 4IMDA 1KTNA 5CXPA 4Z1BA 4KF1A 2BVTA 5EFFA 1GYNA 3P0XA 4GKTA 1XGEA 2INEA 4N02A 3WELA 1QI3A 1JAEA 1EZ2A 2TYSA 3VKCA 1Q2RA 1VH7A 4HCHA 4PZVA 3UNTA 3QY8A 3UR2A 1M41A 2JE8A 2WC7A 5J8LA 4O54A 3P3BA 4GBUA 1TTPA 2QULA 4N6FA 3SCPA 3M0KA 3VD4A 2DT0A 1O5KA 3MDWA 1XRVA 1D8CA 3HIJA 5HNRA 3NL5A 4UIOA 3LCHA 4JZ5A 4JYDA 5GNXA 4ZA0A 1R2RA 3FY1A 1LTDA 3VNIA 3NTYA 1VFHA 4LW7A 4ZB5A 1GEHA 2A3CA 3PUOA 1ADOA 4MJ4A 2R91A 2OEMA 3HB9A 3KVMA 1O12A 5E0KA 5I3GA 2HVNA 3NL6A 5D9NA 2E8YA 2XIOA 4YWIA 3OVQA 3RK8A 4W4QA 2NSOA 5LGXA 1UWAA 3S2NA 3KP1A 1WZKA 4W93A 3AMLA 3NQAA 3IK4A 3CEUA 1Q6RA 3S3GA 4CVWA 3H53A 1JAKA 3R6IA 4JQ3A 4IISA 2PWEA 4O0KA 1B90A 1WDSA 3CBWA 3PK7A 4PB3A 1EQCA 4K39A 3AYRA 3T4CA 1AH0A 4DO6A 3OHIA 4ILSA 3NGFA 3VE7A 1E1CA 1LG2A 3EPMA 1V8EA 3PAOA 1TVLA 3MWCA 3NO1A 2VELA 2NVAA 2VUYA 1OGBA 3GTIA 1SUXA 2ALDA 3S6DA 4NZ1A 1CWYA 1PWMA 4FR6A 4LF1A 1K1DA 2XH4A 2FDSA 1EA9C 1UW9A 5BWAA 4ZFMA 1TCMA 2V5LA 2FH8A 4L6HA 4A2SA 3T9PA 4GG9A 4WSJA 3U2ZA 2VZSA 4HHLA 3CXOA 4QSFA 2F7FA 3GTHA 2Z1BA 4S3AA 1NY1A 3MSRA 5K4ZA 1VPYA 4AH7A 2Z1KA 1HVQA 1VEPA 3TH6A 2DFAA 1KB3A 3PZ9A 1Z42A 1G69A 4PR4A 1EUNA 1XYFA 3B4UA 1UH3A 1YE6A 1FP8A 4IFKA 3ARWA 4O1AA 3AIUA 3BLDA 5EMLA 2YXXA 1UG6A 4ORMA 4UTTA 3NPWA 4OUIA 3L7RA 4WQ6A 3SO7A 2PDXA 3WLNA 1OX6A 4QISA 3WF2A 2INFA 4F79A 2FTWA 3LCWA 1QWKA 4H6KA 5D2YA 3BG3A 4JFWA 2PZ0A 3C3NA 4LUSB 5LIUX 3WH6A 3KTCA 2V63A 3GWQA 2PDKA 1MSSA 3W7IA 3WN6A 4W86A 3PWAA 1X98A 4A8NA 2EEXA 2OVLA 2ZRVA 3SY5A 3DBNA 1CTNA 3N4EA 4JYEA 5C70A 5TD4A 5F1VA 2BHYA 1TB3A 4AF0B 4ICNA 2CWNA 1K4GA 3AXKA 3HG4A 3LZ5A 3WJSA 4M8UA 4MY9A 3ABRA 3MDUA 1XD0A 3IIOA 4Q6XA 3O7UA 4PODA 1VJIA 3SCWA 1A5SA 1GOWA 3L12A 1PAMA 3CWHA 1F7BA 1UHVA 2EBNA 3RN6A 1XSJA 5D8WA 4UNIA 3PN8A 3W1LA 1FWSA 3T7VA 4XZ9A 1A50A 3LTYA 5A6SA 1MZHA 1UA3A 3TYBA 1PZ1A 1DVJA 4UTHA 2DZBA 1F05A 4LCRA 3CB8A 4NYYA 5I3IA 1DOSA 4AEOA 1HL9A 4BQ3A 1UR4A 3D3AA 5CZSA 2VCCA 4ATLA 5MHBA 5AC5A 2XWEA 1TYGA 1BSLA 4CCEA 2LLEA 4DY1A 5XIAA 1IQ8A 3VC6A 3VNLA 4QTGA 3QPYA 3EKZA 3ZVIA 1JDCA 1S2UA 3S2LA 4LUSA 5I3KA 2YL8A 3MUY1 1JPDX 5AC7A 4KFOA 1BLIA 2PE4A 5CLTA 5I3JA 4R53A 4U4MA 2NXGA 3JZEA 3E12A 3VNYA 3KDNA 1VYPX 3CUJA 3R0DA 3W75A 4L64A 3E74A 1R85A 3HJZA 3JS3A 3W82A 1GOKA 1LCOA 4AF0A 3HQPA 1FH7A 1OCNA 3CGTA 1VHCA 2V69A 3UJRA 1IR2A 2XINA 3B05A 1VHNA 3ZT7A 4WDUA 1OYAA 3WLJA 3MQTA 4EF9A 4RL3A 2ZZ1A 1VJZA 4EXAA 1SJCA 1D8WA 3IJ8A 4KWWA 2IPGA 1CXKA 3WIJA 3F2DA 4UTWC 1OIMA 4PL2A 4FF7A 4S1FA 4N42A 3CUXA 3MS8A 2GVGA 4Y96A 2GGIA 5FF4A 4HA0A 4BI5A 1O66A 2QJGA 4NU7A 2BFGA 2ZA1A 1EEPA 3FJNA 3DYMA 2CLIA 1UASA 4TVDA 1XPGA 1YEYA 2VP8A 4DZIA 2J9ZA 3NNTA 4E0CA 2VC7A 1YMYA 2RJGA 1PJ9A 2ATSA 3INPA 3CZEA 4IXXA 1TPVA 3EWXA 1BAGA 3QTGA 4NQ1A 1BYCA 3VXGA 3CUGA 4WSHA 1BGGA 1RQHA 2Y7GA 2C3ZA 2X1SA 1X7IA 1XRSA 3CHVA 1BXNA 3PNUA 4ACZB 5AYZA 5MF5A 5D2WA 5G1MA 1QI0A 3BL3A 1J6PA 3DYOA 3HV8A 1UD4A 4JQAA 1PIGA 1SFSA 3SW6A 2E6DA 2PI6A 3NPVA 1ZBCA 2AKMA 4DBUA 4HYVA 4DUXA 1O1HA 5CGMA 3MUAA 4JIIX 1HVXA 1JUBA 4DI9A 4B92A 4O10A 1UKSA 1B0IA 3BQ5A 3LM7A 1RP9A 3RU8X 5EY5A 1CCWB 3WJZA 4C6LA 2WCGA 1C8YA 4W7UA 1FWCC 5AN7A 1B31A 3N29A 1BWLA 2Z2UA 2RGMA 5M2FX 3OVGA 5A95A 3G0XA 1TV4A 4GE8A 4GVHA 3B0XA 4G5DA 3TNOA 4FOJA 3TFCA 3HMJG 2W66A 2P88A 1XP3A 5C0QA 4JN7A 4DUWA 3VOCA 4H6EA 4UR8A 4RE2A 3PANA 4AWSA 1FHDA 1HN1A 3NEHA 3FNDA 4L9XA 5EKYA 5REQB 3PBGA 1XF0A 1XLKA 2BY3A 3DFYA 3T8QA 1IZCA 4RK8A 3WLKX 3UWEA 3CC1A 2GVEA 4M6VA 1SSGA 3TN4A 3P62A 3PZTA 3KXQA 4GFIA 1POKA 3EWYA 1Q6QA 1NQ6A 2VOTA 1A3WA 3WQCA 1RHCA 4KGJA 3CAKA 1XLJA 2DVTA 3PSWA 3OQEA 1RUSA 5JUVA 4JFTA 3A4AA 2CLPA 4KRTA 2A7PA 4ACZA 3RPDA 2A79A 3FS2A 2ZRZA 2IPJA 2GL5A 1EOKA 3E5BA 3CZ8A 1E0UA 1GNXA 1GVYA 5DXXA 1DEDA 1O7AA 2QCMA 3S1UA 1GTEA 1LROA 2XVLA 4L1GA 4EWJA 4LUTB 4ZTYA 3EOUA 3TJLA 1HKJA 1PTDA 3WDJA 3BO9A 3S5OA 3P93A 3GC5A 3K5XA 3ZVHA 4UQAA 5JH2A 2BDQA 3AJ7A 1ZALA 3M0HA 1WXJA 1TV8A 4AWTA 1JDDA 4BJHA 1TPUA 2R14A 2QAPA 1JUEA 3LNPA 4QAIA 2Q8LA 4HU4A 2NXIA 4XO6A 1XGZA 4K3ZA 1TR9A 1RCQA 3WQ8A 3V16A 3EEGA 1SFJA 4B4HA 4K8HA 4CQCA 5KEZA 3WQVA 4OUEA 4GNVA 1VPQA 3HGJA 4KQNA 4IIFA 2DSVA 4K8GA 1PV8A 1HJUA 4NJGA 3VGEA 3ANVA 2WJFA 3T07A 2OU4A 2H6RA 3SZ8A 3MMWA 2ZADA 3GHRA 4RLIA 4MVAA 1MQPA 3HMCA 5REQA 3KZPA 5A8PA 4WY0B 4M7TA 3NAVA 1K8XA 3C3UA 1ZJAA 2VX4A 1R3RA 2O4MA 4S2BA 3KZSA 3VM7A 3WZ0E 3WQ6A 4DQWA 1F74A 4UNKA 1ZFJA 2V2CA 1TWSA 2YW3A 4IF2A 1OYBA 4AIEA 2ANUA 3U0HA 5HMDA 3GE7A 4EAYA 3N2TA 3F2CA 1PX3A 3BXWA 3KTSA 3E2QA 1M04A 3Q58A 5F2IA 4CNTA 1BXBA 3KOWA 4XX6A 2D3LA 4B5NA 1ZBWA 2VFEA 2EG6A 3ZOAA 2WKGA 4GJJA 4LVDA 3TYUA 4LUTA 5B7ZA 2HPIA 1O6IA 4DF0A 1QK0A 1GG0A 1H7NA 5A6TC 1PCKA 1BKSA 3DHFA 5LIYX 1OT2A 3L0NA 1XIGA 2PCQA 1BFNA 1RA0A 5AHNA 3VE9A 2C19A 1O94A 2NQZA 1CNVA 4WOQA 1W32A 3OZMA 1V4YA 3VKKA 2J78A 3BAIA 5D04C 2JIWA 4DJDA 1CB7B 4M5PA 4IMGA 4DYKA 1LP6A 3MWAA 4HU8A 5JBEA 3UNDA 3GG1A 1ZQ5A 5HWMA 1BYAA 5I03A 1CXIA 4C6JA 4K37A 3SY1A 3KBSA 3GC2A 1Q63A 3B9NA 1A47A 3KBJA 4DLFA 1XLLA 1O68A 3N6JA 3DDMA 4AZHA 1TX0A 2QCNA 4B4FA 3U5UA 3C6CA 5TQLA 3ONCA 4DELA 4PMYA 2W92A 4MPKA 1EFZA 4WY0A 3GXMA 1DJYA 2VZVA 4D1IA 1PIIA 2VD9A 1OFRA 2NQLA 1KCXA 1C90A 6ENLA 1EO5A 3B3DA 3QF0A 2ZZ6A 4MZ1A 1YXDA 4EAMA 4IGHA 3UBPC 4KKXA 2E67A 1E55A 3RLHA 3AMDA 1KW1A 2JF7A 1P6WA 4LH8A 1EP2A 5TIMA 4CVUA 2I5IA 1YPXA 1SZEA 4A3RA 3NM1A 2Y8VA 3E96A 3GZ3A 4UMCA 3VIMA 2Y88A 4H9VA 3S9IA 3R1ZA 1WAWA 4ZE5A 1Z44A 1KM0A 3MHGA 1AK5A 2ISSA 4Y7EA 5DFAA 5BRQA 3QH2A 3UY7A 1DE5A 1ZP3A 1OFDA 3L4ZA 5HUPA 5DCDA 4NX0A 4H6RA 1DWFM 4Y9OA 1XLCA 2EPHA 4Z1AA 4F0HA 2PTXA 1FFQA 2GJPA 5HXMA 4WGXA 2HK0A 1H3GA 4MAZA 3FAXA 1V77A 3WNLA 3WDHA 3K4WA 2FPVA 4MHBA 3SUTA 3W9ZA 3H2FA 4P8XA 3NDZA 2UY4A 3A12A 4TMBA 2QGHA 3OTRA 3SRHA 3NM3A 5EMYA 3BZJA 4E2DA 3NPXA 4ZB0A 5CPOA 4DEFA 3IIZA 2Y0FA 1XIJA 5BZAA 1TJ2A 2CZVA 3RO8A 1BPLB 4YMZA 3TMLA 3GXPA 3VMNA 1UQYA 5I7GA 3VD3A 5C6MA 4H3DA 4QHRA 3WEMA 2BODX 4GNKB 3EB2A 4YHEA 5A6BD 4KFPA 3UWUA 4RKAA 1XCWA 3CS2A 4AVOA 1GONA 4AX6A 1JZ5A 2BGQA 4DJFA 1IE7C 4LALA 3KRSA 1KQYA 1H60A 3DBPA 1NWUA 3S8HA 4PTWA 4RXFA 2VFHA 4NRSA 1J11A 2ZX6A 1A5UA 3QQWA 5HA7A 4EPDC 4V1YA 3CUZA 1QHOA 1HP5A 4Y9PA 5ABTA 1KCZA 1MWOA 2D2HA 5BROA 1T41A 4C6OA 4N9BA 4BEQA 4NI8A 4RPPA 3MI3A 3DH7A 3LZ3A 2P8BA 3THDA 3CUHA 1FX6A 1UUMA 2E6FA 1CXHA 1W31A 1DXEA 2XZ7A 4IQLA 4ML4A 1UWRA 1V79A 4MKVA 3NL2A 2B7NA 2ZTJA 3WF3A 3TN5A 1MDRA 3V5FA 3ARYA 1KRBC 4QLKA 4XZHA 4QRNA 2NUXA 3BOLA 4MTVA 3KS5A 4FNTA 3DKJA 2EXOA 1NOFA 4JYFA 2ZWYA 3A4XA 1D2KA 2YPIA 4F2BA 3CV1A 2Z4GA 3QFEA 2DVXA 4UTLA 2C1IA 4G2DA 2CHNA 5AVHA 4BHYA 3T05A 4XZIA 4JTTA 3W86A 3TLQA 2HPMA 3W88A 3UXIA 2VX5A 2G96A 3V0UA 4D71A 4UQ9A 3W29A 4HU3A 4LC6A 1P0NA 2Y7DA 3VGFA 1MW3A 3FGCB 4FXRA 3LX9A 1AD1A 2G97A 1OQFA 4C90A 3LNMA 1JYWA 1X6NA 8A3HA 3STCA 1HKIA 1ONEA 3CAQA 4O50A 1BF6A 3BJSA 4GCAA 2GLKA 1EXBA 1W5OA 4IMAA 2GJRA 1FA2A 2R9RA 2J74A 4KCUA 2Y7FA 3QV6A 4ZSTA 1KFWA 5HJLA 3KOXA 4DWDA 5HNNA 5DN1A 3MSGA 3RYSA 4G7EB 3PUGA 3PAJA 2I17A 2VVNA 3LSCA 4UR9A 2KAUC 4LVBA 3W1NA 5H8UA 5IDIA 1E3XA 1OT1A 2CLOA 1UQZA 5D30A 4KCVA 1UD2A 1MXGA 4XV0A 4YTQA 4C6IA 2DJXA 3DFSA 1PB0A 4HOZA 4KH2A 3NGJA 4W9TA 2R1MA 4UFMA 4U2ZA 1EJSC 4AC1X 1X7FA 4QAWA 4FI4A 3IGUA 5EPDA 3QLDA 2AKZA 3TSBA 1E0VA 2OX4A 4U2YA 2UWFA 4LUYA 4NXSA 4DHGA 3P2VA 1DPMA 2HBVA 3HGOA 3LGGA 3NZ1A 2PD5A 2AGTA 4KEZA 5I23A 3IAPA 2C6QA 4NNBA 4J5NA 4Z17A 4C6MA 5K9CA 3OU8A 2FVKA 4FLOA 1JCJA 1S5VA 3TE9A 5DRCA 4S3JA 2WZHA 5XINA 3L2MA 1GPWA 1XIFA 4P7NA 3STFA 4QGCA 3FLUA 2RKXA 1J01A 2FKPA 2VM8A 3ZYZA 2YBTA 3P5YA 2GVLA 4PUEA 4PBGA 3UVIA 2J77A 2B81A 3OZOA 1Z89A 4RX0A 4US5D 3C8FA 4M24A 5J04A 1K03A 2PC4A 2NXHA 1DTNA 3ARQA 3SUWA 3VDHA 4YVPA 2B7OA 1WCGA 3UY8A 4ROQA 3E9AA 3P7YA 3H2AA 3PBMA 1S3TC 3VGHA 3NSXA 3GXIA 1E70M 1ITUA 3WF4A 2REQB 3EOLA 3FKKA 4G7EA 2E4TA 4KRUA 3GNDA 3PZMA 3B8IA 1QFEA 4L4OA 1A5KC 3DFNA 4B5SA 1WKFA 3QC0A 2PDJA 3TDFA 5D9PA 3PJXA 2BBFA 4MYXA 2YSWA 2XVNA 3FCPA 1NFPA 2V9DA 3B9AA 1BYBA 2UY2A 3KRUA 2PDLA 4QCFA 2Q8ZA 3E49A 4R33A 1VFOA 1NSJA 2J7EA 1IEQA 1NIUA 5LKYA 1J10A 1R47A 1L6WA 1E1EA 5C55A 4FPSA 3K2GA 3HOJA 4IOTA 4O11A 1WDDA 2BOFX 7TIMA 3OA5A 3SRFA 3EKLA 2PB1A 2HVOA 3SECA 5I3HA 3IIVA 1ZBKA 1JGMA 3PUEA 3CIXA 2OLAA 2ZXBA 2B0MA 5G2HA 1T40A 2VTFA 2D23A 3NXFA 2PCEA 2XH2A 3W7RA 3E0LA 1DHPA 4JD4A 3PM6A 2YCLB 2X40A 1N82A 1A5AA 3CHDA 4YU1A 5JQ9A 4HJFA 3UFYA 3UR5A 3AHYA 4HNOA 1KTBA 2BVDA 1NP2A 3N18A 4XIMA 2GGEA 2EF9A 1E3ZA 2ACUA 4WRHA 5CKSA 3CEPA 3LDVA 4JX4A 3TQKA 3NZRA 2QMKA 3VMPA 4ZZ9A 3NDOA 4CU8A 2OSYA 2PWUA 4S3GA 4CUCA 3AS2A 3IVUA 4ROPA 3GXDA 2REQA 4RV3A 3W1MA 1NEYA 1HF6A 2QHAA 4P8WA 2X0YA 4ZSUA 2GSHA 3WJXA 1EDTA 2GDQA 4MNLA 4JTIA 4FF5A 1OD8A 4A21A 3NWRA 1R0MA 4GUIA 4DZ5A 1TQXA 4S3CA 5HATA 1ITXA 3W6LA 2OSXA 3W84A 4A6GA 1Y65A 3AICA 2HTMA 2VC6A 2YL5A 3WLMA 4W5ZA 2C71A 1GUVA 1FRBA 4PSRA 3FYPA 2GUUA 3WDPP 4PTMA 2A5HA 1V6XA 2OQHA 3WMBA 5IHRA 5FOOA 2ZXQA 3LLXA 1YBQB 4DWSB 1LORA 1XM3A 2BLEA 1GZ1A 2WSQA 3BMXA 2OSWA 1FWTA 1UD8A 1UR0A 3BDKA 4BY3A 3VYLA 3SRDA 3GUGA 1XH2A 1RQBA 2C16A 1KQZA 2YCLA 2ZDRA 5CQ1A 2DSZA 4IGNA 9RUBA 1RALA 2AQWA 3CHFA 3GR4A 2Y6ZA 2GYIA 1LL6A 1FOBA 3QVQA 1VENA 4JTFA 1W3TA 3APTA 2J27A 3I68A 3N3TA 2OLSA 1YXCA 3PC0A 3LERA 4F40A 4GI8A 2I7GA 2CHOA 1IV8A 3RLGA 1B57A 2PDHA 3HPFA 3O6CA 3M1ZA 2F61A 3L4VA 1MRAA 1Q6OA 4L6OA 4S2CA 1H41A 5FCZA 3NPUA 5FAGA 3BH4A 3UESA 4GUFA 1WE5A 3SQMA 2BY0A 1H7OA 1QOPA 4AXNA 4CD4A 2WNNA 2ON3A 2X1UA 1JFHA 3Q45A 3OGVA 5D2TA 1K8YA 3KOZA 4W88A 3W2MA 5F2GA 3EMQA 2PDCA 3UGVA 2UY5A 3QPZA 2YA2A 4KWVA 4JOMA 4KGLA 4JKMA 1JNDA 3B03A 4UC5A 3H8AA 1OFPA 3TTYA 1AQHA 4R85A 1MQRA 2O56A 2ZA2A 1PUDA 4GRSA 3V7PA 1QMLA 1I0DA 4LCSA 2CZEA 1XYBA 1WO2A 5H6HA 4X61A 5EYWA 2QPXA 3PNZA 1YBQA 2TODA 1QOXA 4RJEA 6REQB 5I09A 3UF9A 1XSIA 3FIGA 4LAMA 3XINA 4QROA 2ZYFA 5EU9A 1J5TA 3MT1A 1DJQA 3MO7A 3CO4A 4HU0A 3AIVA 3HO8A 1ISVA 4QIUA 1F2JA 2VEMA 2X05A 1EJ7L 5CPLA 5G4WA 1AJZA 3IRSA 5CAHA 2CW6A 2J7CA 3P60A 4UQBA 3V3WA 1MEHA 3UEQA 1F73A 1GQIA 4EP8C 3GDBA 2WWCA 3O2LA 1CLKA 4HGXA 4DIAA 3NFUA 1UUQA 2A3BA 1O4UA 3GAYA 1Y5WA 2F8QA 3SY8A 4B5XA 1HJSA 2ZE3A 4EOUA 1ZSXA 1JCYA 1S2TA 1UKPA 1VEOA 3T08A 2W91A 1YHTA 2G3NA 3OZYA 3OIXA 1KXVA 1KBBA 2E1WA 3PZNA 1PX4A 1L0PA 3DC0A 1C8QA 3PBUA 4JQ2A 1J0IA 3SCRA 1W1TA 3NQ8A 4MG4A 2NZLA 5A94A 3R11A 4FP1A 3GHTA 2A6NA 3W7PA 1JD9A 1NWRA 2Y62A 4U3CA 4EXBA 1FHUA 1PYFA 2EPNA 1V0KA 4DF1A 4XAYA 4FNQA 1JEZA 2B4GA 3GIYA 3H2EA 3OLEA 1Y5XA 3OYZA 3THQA 5ABFB 3M6DA 1IWAA 4W8BA 2WJEA 3W37A 3PFMA 2PGFA 2WSPA 4L7ZA 4CEXC 1C9WA 1IWPA 3LHUA 3QGVA 4LVAA 2DZPA 3ARXA 4IPJA 6REQA 4DYJA 3L65A 3R25A 2EJ1A 2W67A 1H49A 2OZTA 4D6DA 3WY1A 2XN2A 1Q66A 2ZA3A 2QDEA 3B0UX 2YFNA 1EC7A 1BWKA 1CGTA 1YTDA 4WKAA 4OECA 3W6YA 1PKNA 3IEBA 4HCLA 2CCRA 4ADUA 4UFIA 1BHGA 1DJWA 3TTSA 5BMXA 4ZBCA 5LNUA 4F9DA 2GJNA 3CH0A 5HQLA 3USZA 1W9BM 4DJFD 4J27A 2VEFA 4FIQA 4C6QA 5D9OA 4DO7A 3SM0A 4K36A 3HM7A 3KHDA 1VC4A 3RJXA 1IXPA 1RP8A 3K8KA 1VBGA 2NLIA 3VIKA 4FS9A 4MJMA 1H7XA 3EDFA 5ECVA 1AW2A 5ECUA 4WK9A 2P0IA 2FH6A 2VFGA 1VB9A 3QHOA 4XD6A 1HO4A 3URQA 5FKYA 2MANA 1MW1A 4A8IA 5H8PA 4WXZA 3LENA 3BMVA 4C91A 3VD7A 4JTRA 3UJEA 1OG6A 1L2UA 5JMUA 5HULA 2XH7A 3BPWA 5CPMA 2G3JA 5D9MA 1DJXA 3D5HA 4UFKA 1GW1A 5BXRA 2WCSA 1UR9A 3GIQA 2WMIA 4JAWA 3UW6A 5ABFA 4IMCA 4DBDA 2ZRUA 1DWJM 2GGGA 4DJED 3ZWSA 3SB0A 3C2YA 2OCZA 3RAOA 2VC9A 4P2VA 3CHEA 2X2GA 1PSCA 3OB8A 2J62A 4B5UA 4J3WA 5DQPA 3CZKA 3FK4A 3H7VA 2Y89A 4KMQA 2ALRA 1MFVA 3VU2A 4PUWA 1BQGA 1X8CA 1S39A 3MYOA 3CNYA 3PG8A 2Y5EA 1I75A 1FDYA 1R3YA 1S1RA 1E6RA 5LHFA 4KWOA 2CESA 3F03K 2NQ9A 5C9UA 4V28A 1YQ2A 4HN8A 1X1NA 4QJ1A 1VFSA 2E9MA 4LS1A 2DQWA 3LYEA 1VKFA 4L1XA 1WXYA 2Y5SA 3LK6A 3OBKA 1UYQA 4FHAA 4D8LA 3GFYA 1HJVA 1P43A 2QPUA 1TIWA 1JDEA 3JVAA 4HSNA 1IWBA 2WHJA 2O4QA 1RR2A 2V3FA 4RNIA 3S1XA 1UROA 2YB1A 1UJPA 3C0SA 4US6A 1GJWA 1K7FA 3EOEA 5F2MA 3R2GA 1I9CB 2PD9A 1J0JA 5I3DA 3GVVA 1DBTA 3GHUA 3WBAA 4JPGA 2PF8A 2DUAA 1JI1A 4IIEA 4YJ5A 1VLIA 2SFPA 1G7VA 1QASA 2E40A 3NUKA 3QQ0A 4HPXA 3VVGA 3P84A 3AIRA 4Z2HA 1NARA 3LRKA 4OHQA 4ADSA 4DAIA 4MOZA 3CJPA 3FXGA 4GHRA 4GI4A 2YYTA 4M1BA 3SDOA 1XDMA 4GXMA 4PRWA 3DYPA 3CZLA 3WUBA 9CGTA 1TMHA 1I1XA 3SN1A 3UT0A 2HS8A 1KRCC 4GMEA 5BNKA 2OLHA 3LTSA 4ERAA 3CYVA 3VINA 4B3KA 1XC4A 1OZMA 2ZZ7A 3UXAA 2VRJA 3VILA 3EDKA 1BF2A 5E9AA 1XLFA 3G0UA 4P61A 2VO5A 4MMWA 3U7VA 4CLMA 3HN3A 3VDCA 5AHMA 4O14A 3LCIA 5CSUA 4B2DA 1XI3A 4MIMA 4NZFA 2WNZA 3S4TA 4QJ5B 3MV11 1EYWA 5DMLA 4C6CA 3TW6A 1RJQA 3RLVA 3W87A 1HTIA 1OWQA 4QEEA 3BW4A 2P3EA 3TTOA 1PPIA 3APGA 3WK1A 3NO3A 4LYPA 3CL6A 1MW0A 4LOCA 5CJ5A 5JXQA 2E5DA 4PMZA 3UJ2A 4FR1A 4LJ3A 4TV6A 4CKQA 3D46A 3CV6A 1VBJA 1NDZA 4E8CA 2DUZA 3B8UA 3APYA 4GIRA 1WKEA 3N34A 1I2RA 3H26A 4IL2A 1QPRA 1R7OA 4R27A 1AVAA 2ZZ2A 3DGBA 3TV8A 4LTSA 1Z3NA 4FX7A 3KWSA 4O1FA 2XM1A 1NF0A 3E0IA 3GO2A 4RE0A 3EX2A 1AL8A 3G8RA 3W1XA 1TMLA 2XFWA 4E2OA 2EKCA 3II1A 4AHOA 3ABQA 1GOQA 2R1NA 5LNWA 3IPWA 4YLWA 5CC5A 4UZSA 4N4PA 2NUYA 3R5EA 2IKIA 3WBYA 3KLKA 3A13A 3FAWA 4H8NA 2DUXA 4OWGA 4ZO9A 3UP8A 3DFPA 4X3ZA 4F9JA 1BG9A 1X96A 4XZNX 3PULA 4PN2A 2HNEA 1M7PA 1P0BA 1U1UA 3HGSA 5HWJA 3TC3A 3G1HA 3CLWA 1E73M 3D0CA 5FJJA 4FAMA 2XUCA 1XBZA 5FF3A 4R5EA 4QG6A 3SR7A 3ITYA 1RXOB 1UKTA 2V5BA 3EDJA 1TA3B 4R7OA 1UJQA 1L6SA 3A22A 4LEFA 5ABHA 4KETA 4Q8OA 2J6XA 1W9DM 3DI0A 3HGRA 2Y63A 5CC7A 2C0AA 3CQIA 4WR3A 1E9IA 3A9BA 1TZZA 1ZGDA 5IBXA 3CYJA 2QJIA 2QVNA 2PGEA 4IMFA 2ONEA 3L4XA 5DY2A 2C0HA 3TOPA 2Z7KA 3LXBA 4QP0A 4O53A 3PWIA 3S1VA 4LU0A 4IHCA 3AAMA 1HIZA 3WH7A 1WUFA 3OODA 1TTIA 4KBXA 4ENLA 4MKNA 2WO5A 3AIQA 3NZGA 3WLIA 5I3FA 8RUCA 1W9VA 2BGNE 1R38A 1TJRA 1JF5A 4GYFA 4H00A 4WZHA 4LANA 5HQEA 3BSMA 3STEA 2J9YA 2VXNA 1R8LA 3TROA 3LSBA 4HT3A 4ASTA 3R79A 2Q02A 2CIPA 1NH6A 2DT3A 1RCXB 2DSWA 3VKJA 3DG3A 3LV6A 4UOZA 1SFLA 1WUEA 3LU2A 1UH4A 5A3HA 3FYYA 5A8QA 5DMNA 6TIMA 1OF8A 1D3GA 1W5QA 3WG6A 1JVNA 2UBPC 4G1KA 3KHJA 3U5YA 1HW6A 2J9XA 2PDFA 3TTQA 4U28A 4N9EA 3W7MA 4GUGA 3K30A 4POCA 3N4FA 3PPFA 1XIDA 3THCA 4JICA 3U48A 4JNYA 3CZJA 3WLLA 1KBIA 2NUWA 5AZ0A 1V51A 2XN1A 3UG5A 1JXKA 2X0HA 4QDPA 3M43A 4LVGA 2J24A 1CW2A 3UPMA 1ECEA 2VGBA 5GJPA 3S1WA 3LLFA 5BWFA 2YDQA 3BCFA 3AHVA 3TQVA 3QSTA 4JFVA 5FJIA 3U8GA 2AL1A 3EMZA 4A3YA 1XLBA 4O16A 5HMFA 2W9MA 3ZT6A 3PZIA 3BLPX 4MB4A 1NFGA 4GGHA 3BLLA 3MKVA 1K7EA 1J6OA 3NG3A 4ZR8A 2GOKA 2HISA 1PX8A 2ZX5A 4OIFA 4D8ZA 1V0LA 4HOWA 1DIOA 4C6EA 3ITXA 2C79A 2A7NA 5D02A 3OZPA 1LLZA 3B04A 5PTDA 4J35A 2CBUA 3UXLA 4GC3A 4GZJA 1GOOA 5G5IA 5DT7A 3EWZA 4Q8NA 4OVXA 3GBEA 3P5ZA 2C1HA 4PUJA 4J4KA 4XD5A 4AWUA 3BQ6A 1LLWA 4PEKA 3TAKA 5HNTA 1MDLA 1WAUA 2CZFA 2C1GA 1ZAHA 3LM3A 4QBXA 4N9CA 4Y8FA 1K8ZA 3M41A 4B3LA 2ZKMX 4JTGA 3H2NA 3AISA 4HHHA 1IT7A 4NJJA 3R8GA 4N4QA 5GNZA 1M03A 1MXSA 5HDRA 1TPH1 1Z32X 3CL7A 5FJRA 3C52A 4H9ZA 4DJFC 1Q6DA 3URNA 3AXMA 4DWSD 1ADSA 3WQ5A 1B3OA 2RDXA 1AH4A 1LZOA 4M80A 3F4DA 3WFLA 3WCZA 3HPZA 1V3JA 5C54A 1A3HA 4CQAA 1DE6A 1JZ7A 1E6SM 3GU1A 4HPNA 1DL3A 3L5MA 1YXYA 3SSZA 2QJNA 2WM1A 2QQ6A 3CT2A 3CIWA 5KITA 3NQ6A 2XSAA 3N12A 2HMCA 4C5ZA 4AZGA 2NVCA 1U1JA 3PG9A 3IAQA 3VOJA 4GYJA 3QYQA 1XRFA 2D69A 4RDZA 3W24A 3BWWA 5CBIA 3MC5A 4DX3A 3ME3A 2BS9A 4WD0A 3UXDA 3IWPA 3MYPA 1SJAA 1K9FA 4GIEA 2XSBA 4NZ4A 3MU7A 5I79A 4DJEC 1SQ7A 3VO0A 2IXVA 1PHWA 2BZNA 2WC4A 3LBCA 3RFAA 4HMNA 3U3HA 3GBDA 2PDIA 1AW1A 3KOYA 4BI7A 1P1XA 1DQWA 1YX1A 4MPQA 1E4NA 1YRRA 4AZ7A 4LS2A 5KZEA 3MP3A 3FSTA 3PJTA 2Y85A 1TFVA 1XQKA 1VBRA 3A64A 1YIXA 3TQ0A 1KM2A 3RUBL 1GVFA 4OTKA 4G56A 1J4EA 2QCLA 1OX5A 5DMMA 5DX7A 4DXXA 3IV8A 5GJNA 4ATDA 4I7VA 2BXYA 2J7HA 5CGQA 3W1RA 4F0RA 4TMCA 4UTKA 1XHGA 5HAOA 4XK2A 4IPLA 1KBLA 1H0GA 3KM8A 3LPOA 3UU0A 4M82A 2QNEA 9XIAA 1OABA 2VHLA 4IP5A 3A4WA 2GGJA 3GD6A 3G77A 1E9YB 1FVPA 5HK4A 2FGZA 4LYKA 1LT7A 5BRBA 4EVZA 1UMLA 4YTRA 1SR0A 3IUIA 4MDOA 1ITCA 3NOEA 3H4GA 2P1FA 3W0KA 1KFKA 2L5HA 1PO9A 2V68A 3W7JA 2EGZA 2P3ZA 5AY7A 3BOFA 2OKTA 3NSMA 4IUOA 5CG0A 3HPSA 1TRDA 1RZMA 1RPXA 3EEZA 5CJMA 2JFEX 3M6YA 3KCOA 5HJXA 3E1F1 3QBUA 1KXHA 2Y5JA 4G7FA 4JN8A 1EX1A 4FSAA 3W7EA 2GZXA 4B90A 3QKEA 1RK5A 4J3UA 5BOFA 1TMQA 4G1NA 2PDQA 1W1ZA 2DORA 3E2RA 3LCFA 1HFBA 1OB0A 2QDDA 1ZU8A 1XYCA 2FLIA 4DM2A 2NT1A 4HJWA 2YYUA 1D3HA 3M0IA 3P14A 9XIMA 3A23A 3JW7A 1CLVA 1T7LA 1OADA 3AHZA 2EPMX 3SADA 3VNZA 4JTJA 4M6QA 3PBWA 2DP3A 4IIGA 2A4AA 1KFJA 3I7RA 2PTWA 3FN9A 2D20A 5FSEC 3WF1A 4NXKA 3O6DA 1A0EA 3F7JA 3RPMA 5C5YA 2ISWA 3DERA 3QQ1A 3U57A 3ZLGA 1ZENA 1F07A 5JIPA 5ABEA 4BF9A 2PP0A 3MKCA 1FXPA 5TF0A 3A3HA 3G5EA 3KE0A 5LNRA 4A2RA 5FF7A 1JDFA 3WQDA 1KWGA 3QW3A 4GC4A 4MWAD 2PLCA 4MSSA 1GVOA 2Q3RA 1E9ZB 2X2YA 3MY9A 2OJPA 2ICSA 3WK3A 4D6EA 4GISA 2NX3A 1IZKA 1E72M 4LAOA 2VRQA 3M7SA 1F8MA 4Q4PA 4D6HA 3HA1A 2XSXA 2YDAA 3PZVA 5CC6A 2ACSA 3HPAA 3RPTA 1H5VA 3E0WA 4I8YA 3U9IA 3R8HA 1SMAA 3LA4A 4TX9A 2AOSA 1K6AA 5F7UA 4PUDA 1V7YA 2R8WA 1JZ6A 2YBUA 3BZGA 3DZ1A 5AOUA 2RH9A 3B8WA 3ZLHA 4DVOA 1P4CA 4H8HA 3W76A 4DO5A 4O52A 2CZDA 3GQYA 3RRAA 3NQMA 2DIKA 3AS1A 4B9ZA 3C86A 2HE5A 3R43A 1JGIA 4TR9A 1G94A 3W7DA 4UWMA 4OFCA 3UZJA 1GW9A 1C29A 4RE3A 3VOIA 3UCQA 2DSUA 5EMMA 4M56A 1P48A 4AEFA 3AFBA 3CT7A 3W1QA 1UB3A 1VYRA 3AMGA 4Z2IA 3ZIZA 4UFLA 3O05A 2ZRWA 4FB7A 3V0SA 3HG3A 3FFSA 1XGDA 1OC5A 1AZ2A 2WZEA 1QO2A 4GI6A 4NX5A 4GACA 5JVLA 1JYNA 2Z6JA 4Z1CA 3TXVA 2PRHA 1R3VA 5G4HC 3GSMA 3MO4A 1P0EA 4JL1A 2D2JA 2FGBA 1W2PA 1R7AA 2DIEA 1QOQA 1A4MA 1IR1A 1SZRA 1U5VA 4GUHA 4S23A 1YNYA 3A47A 4DXVA 2VFDA 1IGWA 1OY0A 3UR8A 4TOQA 3CZGA 1FDZA 4F4RA 5EMUA 1GORA 4O4WA 4NZ3A 1W9XA 1PIFA 3R0UA 3MZNA 4B15A 4E3VA 3TYEA 3JU2A 3NDYA 1TVPA 3MMTA 1LUCB 4UZUA 5AKQA 5C71A 1IT0A 4LSBA 1VBUA 2GVJA 3N14A 3ISIX 5T8GA 1H7WA 4PEEA 1K9TA 3WLTA 2QW5A 2VFIA 3RG6A 1ZHAA 1XR2A 3FHAA 3T09A 3SJNA 3P6LA 4Z0SA 1NQKA 3GU9A 4L9ZA 3XISA 2WZTA 1YDYA 1OSEA 1FWNA 6XIAA 2O7QA 1HGWA 5AHFA 5DBTA 3NQDA 2GSJA 4XTIA 2RGLA 4W8AA 2H9AA 1TQJA 2J7DA 2I14A 4YYFA 3TJIA 2VDGA 2HXTA 3CQ0A 3UZ5A 4AEEA 3FHQA 3CTLA 1EL3A 3LHZA 4Q4OA 1A0DA 3C2VA 3NSNA 5CG7A 2ZX9A 1XG3A 1X8FA 1JQXA 3QKZA 1LRQA 1XKJA 4QM1A 4YCPA 3BVJA 3MA8A 1FP9A 2DZUA 4MDPA 2VGIA 5E5CA 1D7KA 1QDSA 2JALA 4QQ3A 4YTSA 4ML9A 1ZPTA 3CQKA 1J79A 2AMXA 2FPTA 1LWHA 1ISZA 5A2BA 1K9DA 3NQVA 3AI0A 2Q01A 5EBAA 3PY2A 3CWOX 4ES4A 4MNKA 2X42A 4FK9A 1U1HA 4A29A 4GVIA 4C6NA 1OGSA 4J28A 1TZ9A 3BK0A 4AIBA 3BSHA 1YNQA 2BV9A 2UY3A 2WHKA 3GX9A 3S2JA 2VWTA 1Y8BA 3O06A 3LLDA 3MHUA 1RD5A 1LUCA 2CLKA 1QBBA 1TPFA 3CPRA 4AHQA 1LQ2A 3VDBA 4PMXA 1IEVA 4U33A 4EIVA 1EF3A 3W27A 1XBXA 4H7CA 3DN5A 1LM1A 3QOKA 5E93A 4K2SA 1EIXA 1BGAA 4NSBA 4IP4A 4MB5A 1SR9A 3CPUA 4MF4A 3IGXA 2YB4A 2DDXA 5J5RA 1KCLA 1XC6A 3I6RA 1E51A 3IIXA 4IFKB 2O9TA 4PULA 1YADA 4RV8A 1GOXA 3V36A 4G9PA 4DWSC 3R7MA 5H1WA 2QUTA 3CMGA 2ZUNA 3TA6A 3EYPA 3PUDA 2Z28A 1AQMA 1LL4A 4XD3A 1EOMA 4N2YA 3IJIA 1GKQA 3L2IA 4AIOA 4D6GA 1UP0A 4GQGA 2Z26A 1LBFA 1Y7VA 1UR1A 1H7RA 1OBAA 3QOMA 5AHLA 1SPQA 3B8VA 2OYMA 2IPFA 1EGMA 1Q3NA 4E38A 1C8VA 2FMNA 4HHPA 5GNYA 3MI6A 1W0MA 4L56A 4GZ7A 5BRPA 3MUXA 1UKQA 4O13A 3A3XA 2W4XA 1RJPA 1W3KA 3WQFA 1SMDA 3AO0A 4P7LA 3N13A 4FZIA 2J66A 3IVSA 4GX9A 1US0A 1QNPA 3TSMA 1KM5A 5BYWA 2WBKA 3B9OA 4P7OA 2A7RA 7CGTA 3THUA 3F5KA 2C18A 1Q65A 5D2VA 4PA8A 4MLRA 2O9RA 3P61A 1T0OA 1VGAA 3G3DA 4LX4A 3NXLA 1KLYA 2ATMA 3T8LA 2AAAA 4AY8A 4WIWA 3IS4A 1UR8A 3G6MA 2QLYA 2MNRA 3EWDA 3NYDA 3L67A 2WNWA 3J7HA 3UD6A 1E9LA 5HR6A 3IIPA 3URAA 2NQ5A 3W7GA 4GABA 1OCJA 4TX6A 1UPPA 1SM9A 3IJ6A 1WDQA 1R5YA 1W1IE 4AW7A 1BKHA 1K6WA 1EA0A 4X9YA 4L80A 1AQ0A 5TAOA 2C91A 2NW0A 3QMRA 1A53A 1UR2A 3DXIA 1ISXA 4CCCA 2B31A 3VOHA 3UXKA 4KT2A 1P1MA 1ODZA 4NP7A 3NJ3A 1SSDA 4I5UA 5FL0A 2Z1XA 4IPNB 1R2SA 4QS6A 1OC6A 3STGA 2E8ZA 1VP5A 2Z1WA 4NHVA 5M17A 3VIPA 2J7GA 1E1FA 3NZPA 2BOGX 3SSJA 1HKWA 4PFHA 2XHYA 3D47A 2VKZG 4HPHA 4CQ9A 1V08A 3EWWA 2WMFA 3LN3A 3QY6A 3B0VC 3ARUA 2VWSA 4KEUA 2OWCA 2WV8A 2YCEA 2INZA 1Q7MA 3MTWA 2QUMA 1KGXA 1XYLA 3EX6A 1TE1A 3RM9A 1O1ZA 2W6RA 2PFHA 4OJYA 3G1FA 4YIWA 3TJXA 4LBRA 2Y8KA 3QJAA 1VEMA 1ICSA 1OFBA 1LF1A 2RDTA 1DWIM 5FEXA 4PSPA 3RU6A 3H4WA 3IV3A 1S2AA 4YTTA 1QUMA 3TYAA 1ONXA 4E5TA 3T0AA 3TONA 4HK5A 2E9BA 4ZQRA 3M0ZA 2QCGA 2F2HA 1CLXA 2J47A 1M68A 1PEZA 3MVTA 4H1ZA 5B7YA 2QJJA 2O9OA 4TU1A 3WD4A 4B9YA 1JNEA 1JG9A 1GVIA 2RAGA 1XL9A 3M5YA 4ATWA 4ZQMA 4Q7NA 5A5WA 3AZTA 4HNVA 3VOFA 1LL7A 3PP7A 4WJXA 4GINA 1X38A 4PB4A 5DRIA 1WV2A 3R94A 4A3HA 2IS7A 4ZMGA 5HR7A 3RGTA 4ZQCA 1VYSX 4GZEA 5BOOA 3BARA 5F4SA 1EDGA 4M0XA 5RUBA 2W61A 3H54A 4DN1A 1QXLA 3FJ4A 5A8MA 4LYRA 4MWAC 4C6FA 4MNMA 3H24A 3KP0A 5M1TA 2A2IA 2G95A 3TC6A 4H9YA 4H7ZA 1L8PA 1XFCA 4XG1A 1NU5A 5BU6A 2ACRA 5BXTA 4AZ5A 2PWFA 7ODCA 4H83A 3KCJA 2WKJA 2YX0A 2Z2AA 2DQXA 3GKAA 2A3LA 3ABSA 3MCMA 3YPIA 4LEQA 2O92A 4OBTA 3ARTA 3B9EA 1E5JA 4OGZA 4LPCA 1X97A 4WGHA 1WBHA 2WK2A 4JIHA 3MMUA 1VFUA 4HPJA 1JPKA 2QV5A 1U5HA 2EAWA 1SGJA 2VQUA 3BJTA 1V7AA 4WKFA 2NQJA 3BICA 1R3WA 3LMYA 3SCSA 2PODA 4PCPA 1V6YA 3UJSA 2HRWA 2BXZA 2PBOA 4XSLA 4TXEA 4XAZA 4J9JA 4W8LA 5A2CA 4QNWA 1EF2A 1XLEA 3GUWA 4HNTA 3TWAA 2E3ZA 3EX1A 1RPKA 3M0MA 2EG8A 1TX2A 5KZ6A 2HVMA 3HZ3A 1JPHA 2VMFA 3U7BA 3KFTA 1XD1A 2WAGA 4DZAA 4J3SA 4IL0A 2VR2A 1G4SA 1THFD 3DHUA 3ELFA 4A3UA 1UIOA 3BGGA 3PPHA 1RA5A 3E2SA 4LGXA 1ZTVA 4NZJA 1W3NA 4CNUA 1GCYA 4WJ8A 4OBRA 2A6LA 3O07A 4DO4A 1AW5A 3BG9A 4WY0F 4WJEA 3OGRA 1DQUA 3PJUA 1OK6A 5T9CE 3T44A 4BWLA 4NL1A 1C91A 1W2VA 4M3PA 3K13A 3ZVHB 4IG2B 1T5AA 1TPWA 3V5CA 1QPOA 2BVYA 4ZQNA 3LXAA 3SCNA 1W54A 1XYAA 3G1AA 4J3TA 2HQAA 1EPXA 1K8CA 3GNPA 4MZ8A 2QDHA 3VIIA 4Q4MA 1MQQA 1XBVA 4UQEA 4NZ5A 2ZUUA 2DV0A 2J7BA 3VIFA 3WENA 3S83A 5HQMA 1NELA 2TSYA 1TRIA 4M7SA 2V5DA 1CZ1A 3FJLA 1GK8A 3QW4B 1H61A 2QCHA 3CLMA 2IW0A 4YWSA 3W1UA 1LYXA 1Z41A 2CZ5A 3G1VA 1F3WA 5C9WA 2ASHA 4D6FA 2IPWA 3ARZA 4Q7BA 1JCNA 4NAEB 2XWDA 3FA4A 2ABBA 1TCDA 4GKLA 2OR2A 4JHOA 3M4HA 3CAVA 3RXZA 3WSUA 2NLYA 4MFEA 4LC8A 4HZ8A 3GH5A 2X7WA 2YDSA 3W07A 1B5TA 4IQJA 4ICMA 4E3TA 4JX5A 2XGZA 1YKWA 3PF3A 1JFXA 1S5MA 3FKRA 1EYEA 2PU0A 4LWWA 1XBYA 4NZCA 3CO8A 1R3QA 1AH3A 2C7FA 2PDGA 3S5NA 1C9DA 3VNMA 1QHZA 3T2QA 2V82A 1A5OC 1V93A 2VZUA 6CGTA 3TX9A 2E6AA 4XKYB 4IG2A 5DCBA 2GDUA 4U3AA 3KVLA 4F48A 5ENLA 2KX9A 1J12A 5I07A 3N04A 1FWFC 1GQJA 1W1A1 1EXPA 5DY3A 2NV9A 3VI2A 4HZMA 4J3ZA 2XIBA 4WUIA 2PP3A 3R0KA 2DJLA 1PZ0A 1RJRA 4BQ4A 1UOZA 4ZO7A 4FNRA 2QCCA 2V3EA 3UYCA 3GNNA 3VIOA 3N9SA 3MUCA 3CM4A 3M9YA 3GG7A 4PE8A 3IJ9A 4K6AA 5BXSA 5A8OA 3W26A 4Q8VA 4DXKA 2QUUA 3TJ4A 4Z2GA 2RDUA 3GDLA 2YCKX 1SJBA 4FXFA 5KMYA 4S3DA 2BWGA 3T42A 3VIJA 4NAEA 3S9ZA 1J9YA 4FXJA 1XRTA 1WZLA 2O0TA 1AMYA 4BFAA 1F8IA 2EQDA 1R46A 1PYMA 1ZJIA 1HXJA 4AZCB 1B3XA 3POHA 4H8VA 4ALDA 3AUOA 5CSRA 3PJWA 4H8UA 3F4CA 1T8XA 1J93A 2FFIA 1MEIA 3MP4A 4XZBA 2YOCA 3I4EA 3M0LA 1KBKA 2YFOA 4QSHA 3W2UA 4AVFA 1PDZA 4AYGA 1JR1A 4JTSA 1DHKA 4XISA 2VX7A 1U5JA 4A35A 2VCBA 3E3HA 4PCNA 2CLEA 3MI2A 5KINA 2DEPA 3AZSA 2GDVA 3ALGA 2VD8A 5B80A 4MUPA 4LAKA 4XKYA 4OBSA 1AJ2A 1ONRA 4I7WA 3GYCA 3V1PA 4Q7IA 5AYYA 2E77A 1E6PA 4O4VA 1H2JA 1RBOB 4RUBA 5SWUA 1W9PA 1A5CA 4ZOCA 4IPPA 1H4PA 1G0CA 4I6VA 1Q2SA 1LDCA 1LQAA 1H1YA 2JIEA 4LBSA 3T6CA 4Y90A 4GCXA 3R10A 4GPNA 1C93A 1UWQA 1IIGA 3ZLFA 1G6CA 2Y8UA 3N17A 3WMCA 3CU2A 3FEMA 4Y8EA 3PPGA 4LNCA 1QWGA 2ABAA 3GXFA 1O5RA 3WK0A 4AHPA 2NX1A 4MB3A 3EZ4A 1TWZA 3UWQA 1ICPA 1QPNA 1QK2A 3HV9A 3JR2A 1LLOA 4PMQA 4AZCA 4HHMA 3DG7A 3SUUA 3VKAA 4NYUA 3TUUA 3PR2A 3QM3A 5K7JA 4IQEA 1I2PA 3MSDA 4C6DA 2AGKA 5C7HA 1X39A 5D32A 4AZ6A 3Q94A 1XIBA 3LXCA 3O0KA 4XAGA 1F5ZA 2YGYA 1WOAA 3SAZA 4C60A 3T4WA 1ADDA 2P50A 3LS9A 1JF6A 5FIPA 2ODOA 3LG3A 1MYRA 5AC4A 1DORA 4YCOA 4IJBA 4PYSA 4BQ5A 4HZ6A 2F38A 1EB3A 2ACQA 3SJ3A 3H70A 3UG4A 3TC7A 4ZL1A 4JTLA 4GFSA 2ZUVA 5DANA 3STPA 1SZNA 2E28A 3VIHA 5BU9A 4EK7A 1SVDA 4BQ2A 5E1QA 2VGFA 1U33A 3ZMRA 3N6QA 4MM1A 3VOGA 1QI5A 5D38A 1XFBA 4PUUA 3VCRA 3KUMA 3LRMA 3HG2A 3K1DA 4Q33A 3W2KA 4DPPA 5TNVA 2BASA 1LRTA 3G6LA 4K38A 3VKDA 2F6XA 3KDOA 4LUJA 3SN0A 3KVKA 3EBVA 1PS9A 3T0TA 4TUFA 4JCLA 4Q4SA 5DCEA 3NL3A 4GYKA 3W22A 4EPBC 3WD3A 6XIMA 1XIEA 3REQB 4L1WA 2X1RA 4GY1A 3M47A 4E6MA 4AXKA 2JK2A 4PMRA 3NEVA 4GYPC 3ZM8A 2R1KA 3H12A 3GR8A 3T0DA 1KO0A 4QCEA 5AHIA 3L4WA 1N55A 1CDGA 4QJ3B 1GVRA 1EO7A 3C0QA 2V5CA 3VCCA 2EJAA 3GG8A 1V3LA 3GVWA 3AOFA 4ZXLA 1ALDA 2TPSA 3OBEA 4AFYA 4GIYA 3MUIA 1F76A 3WH9A 2PURA 3W71A 4M6PA 1CPUA 1FWJC 4GA8A 4MJ2A 5CPQA 5CZTA 3OIHA 3EGJA 2I57A 3EOOA 4Y6GA 3KCLA 1S5NA 2BX7A 3QYSA 4L5ZA 1W1YA 3QV8A 3AC0A 4K8EA 4DNHA 4J2MA 4LRSA 1B2YA 3NR0A 3GYEA 4Z2KA 2GQ8A 1MUWA 2I5QA 4XKMA 3S2CA 2QIWA 4JTKA 1ZRQA 2H3DA 2OGYA 3N9RA 2IKGA 1F9CA 2R94A 4FA3A 8XIAA 5EFDA 3FDKA 1FHVA 3P8JA 4DBSA 4C7DA 2G4JA 1UOKA 4FMVA 1GQLA 4TO8A 5T91A 1J8VA 4HSHA 1EHNA 4F0LA 4O28A 4S38A 5JU6A 5BOEA 3EX4A 3REQA 1EHAA 3DESA 1N7KA 1Y0EA 5BW6A 1ZY9A 2QPSA 5I02A 2ZE0A 4X63A 3W73A 3TTEA 3RX3A 3AIEA 3QR0A 3UWZA 1FBAA 1EZWA 2J88A 2H3BA 1BYDA 3BCJA 3F2BA 1PXGA 4KW2A 3SRKA 3PB2A 3K46A 1AFSA 4MFDA 4GO9A 4QG9A 1TR1A 3V5OA 1I8JA 3SGGA 3VNDA 1FCBA 5AECA 1JPIA 4J7RA 3WD2A 3RITA 2G50A 4PBFA 4XUYA 4LRTA 1FKWA 4K7VA 7PTDA 1UP3A 4E8GA 3RM4A 4V1XA 2ZVRA 3BC9A 1GVEA 3C0JA 3ABOA 3EPNA 4IJRA 5DF0A 4F0SA 4XAFA 3BLIA 3B06A 1XS2A 4ZQOA 1JZ8A 1ODUA 3WK2A 3GLCA 1UWSA 3QHNA 2PTDA 4L6DA 4QX4A 3OLGA 2A1YA 1DJIA 3FA3A 3RRXA 4XVDA 2WXDM 2DIJA 1NAL1 2GJLA 2PA6A 1T96A 1ISWA 3TA9A 3ITGA 1FWHC 2HJPA 2PSNA 3AYTA 3C0LA 2P53A 3GIPA 3TZFA 3PVFA 1VFFA 5AB3A 4QE1A 4Z08A 4W5UA 4PC8A 5C2CA 2F6KA 3E2VA 3XIMA 3CQJA 4CQ8A 1CGWA 3Q4DA 5LIXX 1S5WA 3ID7A 4PMJA 3RHGA 3WUFA 1ITQA 3R4IA 2WSRA 4JIEA 5AZ1A 5ABGA 2X30A 1MNSA 2JGYA 2VUNA 3UVAA 3LQGA 1EP3A 3DC8A 4DYEA 1KV5A 3BLEA 3IJDA 3GW0A 4TV5A 2DW6A 2X0SA 1ME8A 4KESA 4C65A 4IX0A 3TAOA 2FZMA 3U6WA 3BSGA 2CITA 4W7WA 1OZQA 4XZWA 4R9OA 2XISA 1EH9A 4X9SA 2GQ3A 3WJWA 5CLWA 2QCFA 5LIKX 4Z1YA 4IQDA 5AC8A 1EEXA 2XYLA 2JF6A 1VLWA 5F4XA 1V03A 1JDAA 3M5ZA 3PSVA 4DZHA 4MY8A 1RCOB 5IM51 4O1CA 1ZCCA 2ZICA 2OFJA 3ITOA 2OWWA 1HQTA 2A3HA 2V81A 2QT3A 2XVKA 3I6TA 1OFAA 4QLLA 3GG0A 1UZDA 1K9EA 1GYLA 1GQNA 4RCXA 1V6VA 4LY8A 4ERGA 1LWJA 1RD6A 3G3MA 5C9XA 3AMKA 2OO6A 3S5ZA 1I0BA 3U4FA 5FL1A 1R9XA 4GXPA 3B8TA 2XDFA 2PLJA 4WEVX 1QRQA 2F2KA 1Z6KA 1S2CA 4IIDA 1VRDA 3DI1A 3WNNA 3N3MA 1M7JA 4JY9A 4HQVA 2OKOA 1Q7ZA 4QLJA 5A6BA 1AODA 3R89A 1M65A 4RDWA 1W3HA 4X60A 2NVDA 1VFTA 3TW9A 3FVDA 2J25A 1SZGA 2VGGA 4HK6A 5KTLA 4OOUA 2WMKA 2O55A 3CWNA 2CLLA 2FIQA 1WKDA 4MLJA 4H4IA 3RO6A 1M1BA 3W4RA 4CCDA 4I3GA 2E5CA 2QGYA 1E0WA 2GJXB 4INFA 3ECQA 4QDWA 1Q7QA 1ZP4A 3T55A 2W5FA 5GVJA 1RBAA 3MW7A 3FXYA 3HFTA 3EA3A 1V0NA 2WVUA 4GY0A 3BV4A 4MADA 2NT0A 2YW4A 2DZAA 5LYRA 3DGRA 3R12A 3SCTA 3E38A 4D9PA 3GFXA 1ML1A 2PTYA 4EPEC 4RW3A 1ZCOA 2BOEX 3IJ7A 4K1GA 1B3ZA 1FHLA 3LEPA 4K1WA 4LAZA 1QTWA 2YBVA 4RZ5A 5I2UA 2O9PA 1V02E 4AU0A 2QR6A 1MUCA 4W89A 3DFHA 1W1VA