5KMYA

Crystal structure of tryptophan synthase subunit alpha from legionella pneumophila str. paris
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
262
Chain Sequence
AMNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDPMAEGPVIQRAMERALAHSIHCDDVLNMVRQFRKTDTETPVILMGYLNPIEQYGYDLFAQQAVEAGADGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNFINQHANGYLYYVSLALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGAALINEIIEAYEAKKDPLQASGALLSSMRQAIDNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Crystal structure of tryptophan synthase subunit alpha from Legionella pneumophila str. Paris
rcsb
source organism Legionella pneumophila (strain paris)
molecule tags Lyase
total genus 83
structure length 262
sequence length 269
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5kmyA00
1THFD 4Q4KA 2AAMA 3TE9A 4IWWA 5D05A 1Q6LA 4UFLA 2ZA3A 3FLUA 3PG8A 4X3ZA 2JBMA 1LRTA 4HPXA 1JR1A 3LTPA 5HUPA 3WJZA 1LBLA 3CB8A 3GXPA 4UIOA 3G1DA 2Y63A 3S5ZA 1MSSA 1R46A 1GEQA 3T4CA 2Y70A 4N9EA 5EA9A 2FDSA 4FIQA 4JTHA 4IQLA 4MY8A 1JUBA 1DV7A 3PBVA 3NQMA 4ONVA 3UQNA 5AHMA 5FF7A 4KWWA 3L65A 4NJKA 2GQ8A 4HN4A 2X1TA 1SO6A 4ZVJA 2ZZ4A 5D32A 3W73A 3MMTA 4GBUA 3O63A 3O6YX 4MUZA 2OJPA 5F4SA 3HG4A 1LLZA 1FWTA 1Z41A 1FBAA 4WOQA 3ABQA 3SW6A 3D0CA 3IGUA 3CWNA 4U28A 4MPQA 3P80A 5EPDA 1QNVA 1H63A 3GYEA 3TQVA 3PULA 4N9DA 5LNUA 3UXAA 4EIVA 1I45A 4Y9AA 3KX6A 1ONRA 1VYPX 1B4EA 2GVLA 2AGKA 3FYPA 4LU0A 2FPTA 4BF9A 3LHZA 1QPNA 1F6KA 3LCIA 3O1NA 4O11A 4MOZA 5J5DA 1VR6A 1TREA 4Z1BA 1X1ZA 5G2HA 2A7RA 1BEUA 1WOBA 3A23A 4EF9A 3M5XA 4LC6A 3QYQA 3B03A 1PS9A 1PCKA 1W1ZA 3B4UA 2UV8G 4XBSA 1HG3A 1JCMP 4OBTA 3NNTA 5SWUA 3W88A 4ZQRA 5D02A 5LNVA 3L9CA 3W84A 2YPIA 3QMTA 1KA9F 2PC4A 3BW4A 1TTJA 3W07A 3OVPA 4TU1A 1BWKA 1AMKA 4XKYB 3P8JA 2VFHA 1FWSA 1LOQA 4JTSA 2IQTA 2ZZ3A 4JGDA 5CSRA 1W3NA 4LNYA 2HS8A 5LNWA 5H2ZA 4O53A 4FNUA 3KVMA 3RLVA 4JTKA 3O05A 1F7BA 1G4EA 1FCVA 4HIBA 4WJEA 4NU7A 3HGOA 2DZPA 3T55A 1WBHA 3W7HA 2NX9A 3W1QA 3KRSA 3IGXA 2G96A 1SFLA 4IJBA 1R30A 1P0NA 1HO4A 3TAKA 5FEWA 5AYZA 1UJPA 2Z2UA 5DCEA 1DVJA 5DBTA 1LOLA 2QUVA 1QOQA 1KLZA 3BLIA 1O94A 4E2DA 4WUIA 3QSRA 1ADOA 3NQ2A 2YGYA 3TW6A 3QSTA 2GJLA 1ZAIA 3KAOA 3W7GA 1MEIA 5HR6A 1T96A 2RHGA 1Q3NA 4XZ9A 3N34A 1KW1A 2VEIA 3NO5A 1TMHA 3O07A 3HPXA 3WJYA 2E5DA 4A22A 1YXYA 5EL1A 1TPWA 3E49A 3W1NA 1TPEA 4HT3A 3PF3A 1Z42A 1EA0A 3L5MA 5K2ZA 4JYDA 3QQ0A 3S9YA 3RF9A 3TC7A 3EWWA 1YDNA 2HTMA 5ABTA 1WQ5A 2DZUA 1EWDA 4O1CA 1H61A 5DY2A 1AG1O 3S5OA 3UYCA 2DORA 2J88A 1A5SA 3MI6A 5C6MA 3DKJA 4Z1CA 1KFCA 3P5YA 1SZEA 3TU9A 4RLIA 3GR8A 3W7MA 4R7JA 3OEXA 4X22A 4NVTA 1PE1A 1W0MA 1NFBA 2E77A 3O16A 3NQ7A 2ALDA 1EP2A 2Q3RA 1V7YA 3R89A 3IGSA 2VFFA 1M6JA 3G3DA 1TRIA 3E96A 4JTLA 5GVJA 3W74A 3PR2A 3QMSA 3THAA 4NZFA 2G97A 4JICA 1TRDA 3LOTA 3TV8A 2B4GA 1O5KA 1RQBA 1TPB1 3TR2A 1AW1A 4O1DA 1YTEA 1VYRA 5F2LA 4JS3A 2A21A 4UC5A 2A6NA 3T78A 3W76A 5LHFA 4QAIA 1UUOA 4LS2A 3M5VA 1CW2A 2Y7EA 3ANYA 1FDJA 4NJHA 5EKYA 3IVSA 3NQGA 2QCHA 2Q8ZA 3NL2A 3H55A 1ME7A 3EB2A 4LY8A 5CPNA 4FNPA 2B7NA 4LC8A 4MZYA 1LP6A 1H7XA 3L67A 4C1KA 1I4NA 2WNNA 2FJKA 3QW4B 2VXNA 4O18A 1JCNA 1F74A 3C52A 4AF0B 4LOCA 2WPBA 3FKRA 4U4MA 4I7UA 1OJXA 3C56A 1VZWA 4OV9A 1GVOA 2WNQA 5K9CA 3O06A 2CLMA 3N9SA 1PHWA 3L66A 3INPA 3P5ZA 1I8JA 4YL2A 1JCYA 2Z6JA 3NQEA 3NQ8A 3GKFA 1QPQA 2X1SA 4AHQA 4NZJA 2YZRA 5J5RA 3R5EA 1T0OA 1G6CA 3LCGA 4UFIA 3STGA 4YCPA 1JUKA 4O4VA 3M7WA 1HL2A 3WK1A 3LLFA 1J2WA 4CCEA 2ZYFA 3MHUA 4MFEA 1Z48A 3W9ZA 3BO9A 1OFRA 3RNDA 4MYXA 3TJXA 3LRKA 2TMDA 2X1UA 1OHLA 3QZEA 3UZJA 1ME9A 3V75A 2X2GA 5C2XA 2VENA 1TCDA 3O8AA 2EPHA 1EUNA 1K03A 2V81A 2WNZA 3EX2A 5CGQA 3LCXA 3TXZA 3W7KA 3W6YA 3P62A 3W75A 5D04C 3U8GA 3W1UA 4JN6A 3QPZA 3G1AA 4DF2A 2FPYA 4LRTA 2TRSA 1O4UA 2DZSA 3HGRA 5K9DA 4OU1A 1W8SA 2W0UA 3S5NA 3TFXA 3NPUA 1LORA 2DZWA 3DFTA 1PV8A 1QPRA 4I7VA 2V0TA 1SO3A 1W5PA 2NXIA 1MXSA 3IVUA 1GYLA 5G2IA 4PH6A 3N2XA 3MJYA 3H54A 3HGSA 1YDVA 4M7SA 1IXQA 1LRNA 4JX4A 4S2CA 1H7PA 2C6QA 2YW4A 4WY0F 2QCDA 3HO8A 2V82A 3NOEA 2Y7GA 1J4EA 1P1XA 3BPWA 1M5WA 4N9BA 3U6WA 1TPDA 4PC8A 3W1PA 5FEXA 5G1TA 2ZRYA 3TSMA 4BR1A 5KSWA 3C8FA 4K8EA 5HNRA 4MLJA 1C9DA 4OQVA 2H6RA 4IGHA 4TMCA 4OE7A 1X6UA 2ZRUA 3W7DA 1H1YA 1WV2A 4NNCA 4M19A 4AHPA 4M7TA 3BARA 5CPOA 2NUYA 4QNEA 4LW7A 1OVDA 4EF8A 1JQVA 5CPLA 1VC4A 3CEUA 5HJLA 3N2MA 3W1AA 2GVJA 3L68A 2WOQA 3OVRA 1P5BA 3W7JA 2Z6IA 2ZTKA 5G5IA 4GRSA 2NWSA 3EX6A 1K8YA 3M9YA 3LHWA 3MBDA 5KINA 2QCCA 2TYSA 4MKNA 4UMBA 1FWRA 3LM7A 3HOJA 1H62A 1DJNA 1WYIA 2ZZ6A 3N14A 4HNUA 3BGJA 1DL3A 4QIUA 4LVAA 2JGYA 2QCMA 3NDOA 4K37A 1ALDA 4UTWC 2YYTA 3W3OA 3W86A 1YXCA 2KZHA 3VE7A 2E5BA 3F4WA 4P61A 4PL2A 1XCFA 3TX9A 1S5VA 5LGXA 3RMJA 1A5AA 1HTIA 3M47A 3KFTA 1FY6A 1L9WA 4UTJA 1IXNA 3G8EA 3Q37A 2I14A 1KM6A 4Y90A 2FPVA 2VEMA 4E2BA 5I3FA 1VS1A 1FXQA 5HR7A 3G0XA 3GKAA 1OF8A 5KTLA 3VKJA 4LV9A 3A24A 3EX1A 1R2SA 1XKYA 2J9XA 4I9AA 1CX9A 1PVNA 4UFKA 1EX5A 1JRCA 1KTCA 3GDKA 1I2QA 2AQWA 3M16A 3PAJA 5DBUA 1TPVA 4YMZA 4E38A 1GG0A 3CLMA 1XL9A 2J6XA 3GDRA 6TIMA 4L4LA 1DHPA 4RKAA 2ZRVA 2OT0A 3M41A 4BI7A 1G7VA 4MY1A 2VELA 3LBMA 3M5YA 5U4NA 3FYOA 3L0KA 1GOXA 3W23A 1EIXA 4OGZA 4DELA 3HB9A 2QR6A 2DJXA 4NJGA 1KM0A 4K36A 1W5NA 4AXKA 3HBLA 4EWND 2H3BA 4UMCA 5HQEA 1VH7A 5CZSA 3ZR4A 1IXPA 4FXSA 1SSGA 4RK8A 3EKLA 1RPXA 4QM1A 3Q2DA 3W7EA 4AMAA 3I68A 3EKZA 3W71A 3S42A 3A22A 3G24A 3LHYA 4O1AA 2CW6A 3HPSA 3C2RA 1RQHA 2QCLA 2R14A 4O57A 5F1VA 1N55A 1OYBA 3GXTA 1W37A 1SFJA 3LCWA 4K38A 3I65A 2CLIA 1GT8A 2O7QA 1KM5A 3UY8A 5BW6A 5F4XA 2A6LA 3G1FA 1WA3A 5FF3A 4HPJA 4R53A 4AH7A 3E12A 3R13A 5BMXA 3S1UA 4IXXA 4IMFA 3S6DA 4BWLA 3P7YA 4CQ8A 2E6FA 4UNLA 5D2VA 3ZS4A 1FUYA 2C1HA 3CWOX 4LVFA 4IMEA 1ZJIA 3G1SA 4ICNA 1KM1A 3C2VA 5D09A 2YCEA 1KFBA 3EXRA 1RQEA 2OT1A 4FNSA 1O95A 3C0JA 2CLHA 2QJIA 2A85A 4EOUA 1A50A 2RDTA 3BG3A 2E6AA 3G22A 3SSJA 3W2JA 5L6UA 5EMUA 2C0AA 4LRSA 2X30A 2QCGA 3PVFA 1ICPA 1Q6OA 2JKAA 2JGQA 1YPIA 4ORIA 1W54A 4CNNA 1DOSA 1NF0A 2Y7FA 5E1QA 3SECA 2EF9A 3LXAA 3MP5A 5FEZA 1IIHA 3GNNA 4UTTA 2CZEA 4GNJA 1G67A 1TQXA 4GJ1A 4K6AA 2V30A 3FS2A 3OVQA 2HS6A 1N8FA 1KM3A 1ZALA 5F2GA 4RZ6A 4LVGA 2C16A 2CLOA 2FQIA 4NX0A 4GC4A 4I7WA 2OZ0A 2O7SA 3R12A 5CZ0A 2CLKA 1SW3A 4WZHA 5IBXC 4XKYA 4WQ6A 3VFLA 3A21A 1SZGA 1G4SA 2OX1A 2RFGA 5CG7A 3O15A 3AO0A 5DCDA 1U5JA 4O52A 2I9EA 4O13A 1TTQA 4M6VA 4JX6A 1VRDA 3TNOA 2J9YA 3UD6A 2ZZ5A 3GDLA 2F7FA 4UFHA 5FI8A 3LV5A 3EEGA 5DXXA 3LERA 3HG5A 5F2IA 3NPVA 3UWVA 1S3HA 3UY7A 1ZENA 2P10A 4Q33A 2VFGA 2Z0IA 3LRLA 1TSIA 4Q32A 1UB3A 2WQPA 1NVMA 3BK0A 3GK0A 4NX5A 4X2RA 4UTMA 1D3HA 3CT7A 4KFNA 1EUAA 5CPMA 3ZWTA 3HIJA 3LCFA 3UWYA 2E68A 4FF7A 1XC4A 5I3HA 3Q94A 1ZY9A 1KTNA 4JTGA 3QH2A 1WBJA 2ZA1A 2A4AA 1XUZA 3TK7A 4JTUA 2BX7A 2J9ZA 2EKCA 4AVFA 4LUJA 3ABOA 4TMBA 3VCRA 4YWIA 1JUEA 2DJLA 3TA6A 4GUFA 3TDFA 3MHFA 4HNVA 5A8GA 2QKFA 3MUXA 3NZRA 1BWLA 1GYNA 1H50A 5HUOA 3C61A 3LHTA 4CQAA 1OFDA 4TX9A 1KFEA 1R47A 4UTLA 4G1KA 4IMGA 4P2VA 2YR1A 3QRHA 2H8XA 3IRDA 4JTEA 3MP4A 3LHVA 4CLMA 4UFMA 4ALDA 3KVJA 4N4PA 4O14A 1SPQA 1F05A 1FQ0A 3G1VA 1P4CA 5EBUA 3TROA 3NVTA 2R94A 4FNTA 1JCXA 5D38A 3G0SA 3HGJA 4FO4A 4JYFA 1LOSA 5TQLA 5BRBA 2CZDA 4K7VA 4H3DA 2R91A 1K8ZA 1KLYA 1L6WA 3W7LA 2ZQ0A 3W7RA 4A29A 5E0KA 1FCQA 1AL7A 2H3DA 2YDAA 1OFPA 3W1LA 1L6YA 4DO5A 5T26A 1QCWA 1WOAA 3PBWA 1SO5A 1MEWA 4CNOA 4JIPA 4ADSA 1W5MA 4S2BA 3NL6A 3MYOA 3LDVA 1FWWA 4O16A 1K8XA 5AYXA 1FDYA 1VPXA 2J24A 2C19A 1LTDA 3P60A 4OHQA 3W85A 3V1PA 1GTEA 4NNBA 2V2HA 4AF0A 4Y8FA 1A53A 4JDYA 2ISWA 1K02A 1K3UA 3W87A 1XBXA 4PL1A 3LLDA 4XTDA 4H6KA 2B0MA 3F4NA 4O1BA 2H90A 3L21A 1EP1A 6ALDA 1YYAA 1JRBA 4GXMA 1OFBA 1RV8A 2DZXA 2NZLA 2ZRZA 1ME8A 1KFKA 5G4WA 4QNWA 2QJGA 3SY5A 3FKKA 1O5XA 1PL9A 3DXIA 1B57A 1QR7A 4IXHA 4WXYA 2ISVA 3SR7A 5KZDA 4RXFA 3FA5A 3BW3A 3TSBA 1A5CA 5D37A 4DBEA 3DFPA 2PRHA 3LTSA 3GXNA 2F84A 3AJXA 4PTNA 2E6YA 5D03A 1QMLA 4LV4A 1PHQA 2Y62A 3QEZA 4M6QA 3DZ1A 3CQ0A 4MJZA 2YX0A 1GQNA 3L2IA 1PIIA 1K7FA 4Z0JA 4NQ1A 4N6FA 4J9JA 1CI1A 3B8DA 3WJWA 4M5PA 1EWEA 1T8XA 3MI2A 1QO2A 1OX5A 3ZFHA 3S0CA 1OG0A 3OHIA 2BWGA 2DP3A 2A2IA 3CU2A 3W1MA 3O6CA 4ADTA 3PUOA 1H60A 2Y89A 2X16A 4FB7A 3NGJA 3P61A 4Z1AA 3W70A 1F76A 3L0NA 2QAPA 4DBDA 2P0OA 1SU5A 4WD0A 5D30A 3GAYA 3CHVA 3NL5A 3WJSA 4JYEA 2NX1A 3P82A 4UCGA 4AWUA 1H51A 2BTMA 3W7NA 3M6YA 1ZAHA 3PB0A 1OYCA 3HF3A 2EGZA 4EVZA 4GUJA 1MZHA 5CZJA 2CLLA 4C1LA 3F03K 3IIOA 2C18A 4HNNA 4WX2A 1B4KA 3MHGA 3C2OA 4JTTA 4UTHA 1VLIA 3TAOA 4R33A 1PCWA 1WX0A 1RZMA 4Z1DA 3R2GA 5FEPA 3CPRA 3SFKA 1I2RA 3RK8A 4KFPA 4LS0A 3GX9A 4LTSA 1HFBA 4O0ZA 1Q6QA 1TYGA 5I3KA 3KXQA 1GG1A 3L5LA 5AB3A 1KFLA 5F2MA 1BTMA 4ZQPA 3A5VA 3NQAA 1OF6A 3EWUA 4M6PA 1S5TA 3QMRA 4UR8A 1U83A 1OX4B 2FIQA 1NSJA 3E0IA 4KWVA 2PRMA 1GVFA 4DF0A 1XFBA 2C13A 1EPXA 3EWBX 2GOUA 1O60A 4TO8A 4LWWA 3UWWA 1NF7A 1NAL1 3WK3A 4O10A 4NT0A 5I3JA 1LRQA 4LS1A 2G95A 1FCBA 3HG2A 2W6RA 3ATYA 3TJLA 4FHAA 1UCWA 4XTIA 2XN2A 2VFDA 3N3MA 1OFAA 3W1RA 4RZ5A 5D2TA 3VE9A 4GUIA 2V2DA 2C3ZA 4N4QA 2QCEA 3S1XA 3IIPA 3DFQA 1VQTA 1JCJA 3PSVA 3PUEA 3WK2A 3T7VA 4QISA 5D2WA 4TR9A 3BLEA 4GUHA 2I1OA 2PE4A 3SGUA 4DO4A 4JEQA 1TV5A 4ZZ9A 2Y85A 3G1HA 2EHHA 5KMYA 2HMCA 3ELFA 3W83A 3W7QA 2CZ5A 3C2EA 1YXDA 3KOFA 2NX3A 1SR9A 2GPTA 3P8IA 1W5OA 4MLRA 3NQFA 2CFFA 1I2PA 2Z1BA 3RFAA 3G3MA 3MP3A 4QJ1A 4AB4A 1G7UA 1LBMA 3DI0A 2QUTA 1UUMA 3SI9A 4DQWA 2YFOA 3SIZA 3LGEA 1RVGA 3NAVA 3PWAA 4JTFA 3O6DA 3ZWSA 1L2UA 1ZAJA 1H7RA 4UNKA 3GB6A 4DF1A 1ZFJA 3IIZA 2TSYA 3N19B 1WXJA 1F73A 3QJAA 3FOKA 1EEPA 2QAFA 3W7OA 4CNPA 2ZBTA 5L9FA 5HINA 2A5HA 3TH6A 1G4TA 5CSSA 3IEBA 4FX7A 5E93A 3DU0A 3ABSA 1TO3A 3B06A 1XUUA 2ZRWA 4FX8A 1G69A 3IIVA 4UTIA 5AHNA 4HNTA 4RCXA 4CCCA 4UTTC 3S1WA 3G8RA 3EWYA 1OK4A 3NR0A 1VHNA 2VKZG 2A1YA 4PA8A 4ZQOA 1QWGA 1GJPA 1F5ZA 1DORA 5CZTA 1UASA 3PC0A 2CU0A 2P1FA 4MY9A 4AHOA 4ML9A 5KITA 1RD5A 5IM51 3W2MA 3DFSA 1Z44A 2PCQA 3DHDA 1YLVA 1OK6A 3DBPA 3B0PA 2VC6A 2XFWA 5I3GA 2C14A 3HJZA 1AW2A 4IPJA 3R8RA 3C3NA 3ATZA 3KRUA 3W2LA 1XXXA 3B0VC 2E5CA 2HSAA 3LCLA 1VCGA 1K7EA 2ZCGA 3OA3A 5LNRA 1IXOA 4UTWA 3VI2A 2YSWA 3W7CA 1KV5A 5D33A 3T44A 3IIXA 2RKXA 5K4ZA 3W72A 1GWJA 3ABRA 1FWNA 3NM1A 4ZQCA 1JQXA 3LI1A 4CQ9A 1LDCA 3PBYA 4OV4A 1SO4A 4Z0SA 5LSMA 4E0CA 2G5WA 4D2JA 3NEVA 3JR2A 4N02A 3BG5A 3CIXA 1XBYA 2ZZ7A 5MHBA 4NNAA 1QO5A 4ZQNA 4IOTA 3THQA 3EWZA 5AC7A 2Y88A 1VHCA 2ZFAA 3E9AA 2FTPA 2VEPA 3DI1A 3TKFA 5BNKA 4HSOA 3UWQA 5G4EA 2A7PA 2RDUA 2QJHA 2B7PA 3STFA 5HWNA 3UWUA 3LCHA 1DJQA 4GUGA 4JTIA 3NM3A 2FB3A 3EXSA 3NG3A 5EYWA 3STCA 1QOPA 4LVBA 2ABAA 5AOUA 4FXRA 1P0KA 4OT7A 1ICQA 2VFIA 1DKWA 5BOOA 2BZNA 4IMDA 1F2JA 3CTLA 3GAKA 4JDBA 1TIMA 3BG9A 3GDMA 3SGZA 3CM4A 3JRKA 3NQVA 4K8HA 2NXHA 2Q8LA 2XN1A 2YXGA 2BXVA 3IVTA 1Q45A 4MYAA 4IMCA 1VCFA 1TTIA 3PB2A 1GPWA 3M0ZA 5AHEA 3M1ZA 3W7PA 4A21A 2WKJA 1ZNNA 2OMAA 4BI5A 2V8ZA 3LRMA 3S5YA 5TBOA 4GE8A 2B7OA 4PEKA 1ZHAA 3I6RA 1F6PA 3SJ3A 1OFOA 2ZRXA 5DXYA 1B9BA 4AWSA 1YDOA 3UWZA 1SUXA 2GUUA 2DZVA 1TB3A 4LUIA 5LKYA 3SZ8A 3G1YA 2V5LA 3DAQA 4JNMA 1H7OA 1S5WA 5FF2A 4AAJA 1TPC1 3QQ1A 3S1VA 3TCEA 2Q3OA 1GVSA 3VNDA 5LNSA 1RR2A 4RV8A 3B05A 3QC3A 1VYSX 2WJZA 2WSYA 1H5YA 3W7IA 1TPUA 1FX6A 1NEYA 4K7YA 2FB2A 1TPFA 3CIWA 1YPFA 1QAPA 1JCLA 5F4WA 2BLEA 1LZOA 2DU2A 5LHEA 4UTKA 3FEMA 3W2UA 3C2FA 4FNRA 5DELA 2NWRA 3K30A 4WY0A 2NUXA 3BLFA 5AFDA 1L6SA 4RJEA 3GZ3A 4MJMA 5AC8A 3KVLA 3BW2A 3UNDA 4KKXA 3LTYA 4WY0B 2ATMA 2CZFA 3C6CA 3PBUA 4QSHA 1TV8A 4A2SA 1AK5A 4N2YA 1W31A 2YFNA 4L4MA 5K4XA 2FLIA 1WAUA 1TJRA 1FCUA 2V9DA 1QFEA 1AW5A 3M44A 4WOZA 1OYAA 1TPH1 2RH9A 1JVNA 3TMQA 3RLUA 4JR5A 3LBCA 1K7XA 2PURA 3LB0A 2Y61A 4XUGA 4W9TA 3NYZA 1SW0A 2NLIA 1W5QA 3USBA 2GQAA 2ABBA 5IBXA 1XM3A 3UZ5A 3EX4A 1MO0A 4NJIA 4HHPA 2A0NA 4BI6A 2QDGA 1XBVA 3W1TA 4H4IA 4BK9A 2TPSA 3P81A 4DXVA 1AL8A 1HUVA 2RDWA 4TIMA 3TC6A 4A2RA 4O54A 5K3VA 3NQCA 4XWUA 3EWXA 3QW3A 4WXZA 4UTUA 1R2TA 2VOMA 2BSLA 4IX2A 3LXBA 5DCBA 4IUOA 1LYXA 3I7QA 4RR4A 5BMWA 3STEA 1MEHA 3P74A 2CLEA 3PS7A 2QDHA 3DFNA 3DHFA 3GIYA 2Y7DA 4MZ1A 3PM6A 2QCNA 4DPPA 2ZZ2A 1TJPA 1LROA 2ISSA 2EAWA 1VLWA 3L0GA 4XQ6A 3LV6A 4ZQMA 1QDSA 1GVQA 5A5WA 3M5ZA 5D2XA 4UXDA 1OFQA 1YTDA 2QEZA 4UR7A 4QQ3A 4MVAA 3MBFA 2FFCA 2W79A 7TIMA 1SZFA 2E6DA 3FJ6A 3GR7A 4JTJA 1KBIA 5G2WA 3WJXA 4AWTA 1OFEA 4FIRA 1HO1A 1D9EA 3RU6A 3GVGA 5FESA 5C55A 4GWEA 2B7QA 4A3UA 4RZ4A 1IIGA 5EY5A 4K39A 4FEZA 2QCFA 4AEOA 3E02A 5KZMA 2NXGA 3MO7A 2R8WA 2X1RA 4POCA 1T99A 1XDMA 4UMAA 4YXGA 1LCOA 4FX6M 3W2NA 4DPQA 3MW7A 2NV1A 1KM4A 5F1UA 3WK0A 3KRZA 4O15A 5AHIA 3MI3A 3A5FA 2WSRA 1LBFA 3TSDA 3BGGA 2V2CA 3I7SA 4FNQA 3BVJA 3TQKA 3LX9A 3NL3A 3OBKA 1V5XA 1BKSA 2GQ9A 4O50A 3M43A 3PY2A 4QITA 3OG3A 4MIMA 3TW7A 3YPIA 3TMLA 4O19A 3NQDA 4O28A 3KVKA 1SSDA 1JJKA 3P84A 5AC6A 2ZTJA 2VFEA 1XBZA 1B3OA 1I2NA 4PFMA 3TIMA 3W1XA 1VGAA 2XN0A 1DBTA 1N7KA 1W56A 3B04A 4DO6A 5KZEA 4O12A 3LXCA 1DQXA 3F1QA 3Q58A 2H8ZA 5H91A 3KHJA 4XBKA 3TQ0A 2NUWA 1J5TA 5TIMA 4O17A 3QM3A 3S8HA 3HQ1A 2VEKA 5AN7A 2C15A 3LHUA 1YADA 3H53A 3LI0A 1DQWA 1FXPA 4BFAA 1LLWA 5HULA 4NUWA 1I2OA 3U2OA 3HG3A 1XI3A 1SZNA 2LLEA 4YLWA 3T40A 4S1FA 2QF7A 2A7NA 1X8FA 1IGSA 3QF0A 3N9RA 2ZZ1A 1KV8A 3BV4A 3I7RA 5K9XA 1OX4A 5I3IA 1TQJA 4CCDA 2D73A 3A9IA 2CLFA 3NQ6A 1LM1A 1KM2A 2ATSA 1WDWA 3FFSA 2QCDB 5LGZA 3TFCA 5FF4A 1X1OA 1R2RA 1ICSA 5FF0A 1A5BA 3DFOA 3NPWA 1ML1A 1XDLA 1W3IA 2YW3A 1OABA 3G18A 2Y6ZA 4ADUA 1G4PA 1GTHA 1EB3A 1EP3A 8TIMA 1YTKA 4UUIA 3C4UA 1TV7A 4PODA 1ZCOA 1Q6RA 2WO5A 3DGRA 2DZTA 1H7NA 3NZ1A 1E51A 4IPIA 4Z08A 4Y96A 1X7FA 3QFEA 4HSNA 1H7WA 4PCFA 5D2YA 4R34A 4JIQA 5AHLA 1D3GA 5HWMA 2WSQA 4X9SA 4Y6GA 3MYPA 4ZMGA 5HMSA 1UBSA 2JKPA 3EX3A 4KFOA 4O0KA 3PSWA 1QPOA 3MWAA 5AYYA 4ORMA 3CEPA 4MZ8A 5U7SA 2ZDRA 3CC1A 4O8RA 3DENA 4OWGA 3JS3A 4N6EA 4BWLC 2NV2A 3GLCA 4JD4A 4ZL1A 4NJJA 5G1YA 3EXTA 1IF2A 1KTBA 1C8VA 3P67A 5CKSA 5LZLA 2V5BA 5K7JA 4LT9A 3DKLA 3W2KA 1TTPA 4JXCA 4JY8A 3HMJG 5DY3A 1FDZA 2PRLA 1VJIA 3NA8A 4JY9A 5C5YA 3OIXA 2CWNA 2GVGA 4LVDA 3NXFA 4GFSA 1W3TA 2ZA2A 4NXSA 4YCOA 3IV3A 3B0UX 1JULA 1SW7A 2WV8A 3TXVA 3HPZA 5AHFA 1GZGA 2QUUA 3G1XA 3PUDA 4HKPA 2E1DA 4NXKA 1KBJA 2JKEA 4IX0A 1VCVA 1C29A 3G0UA 1M7OA 5DLCA 2OCZA 4RX0A 3N73A 5HWJA 5C54A 4O4WA 4RXGA 2J27A 4JX5A 3GDTA 3PG9A 3UXDA 4B5NA 2E09A 2YYUA 2JK2A 3W22A 1OX6A 1SQ7A 4MFDA 3UPBA 3WFAA 3DH7A 4N9CA 3L5AA 4DEFA 5DN1A 1GVRA 1M7PA 3FJLA 3TUUA 1H1ZA 1Y0EA 3FIGA 1KFJA 3GNDA 2GJNA 3NPXA 3QPYA 4UFJA 3UPWA
chains in the Genus database with same CATH superfamily
3C2YA 1MUCA 4IWWA 3WLIA 4UFLA 3FLUA 3KTCA 1LRTA 4HPXA 5M5DA 3SCSA 2CBIA 4MWAE 3CNYA 1Q2RA 3LD5A 2I5QA 1RCQA 1F4HA 2FDSA 4FIQA 4IQLA 4MY8A 1GW9A 1J0HA 3R7MA 3EKGA 3NQMA 4ONVA 2P8CA 4A05A 4NJKA 1G5AA 3W6MA 1HQTA 1CNVA 4W4QA 2F38A 3GVWA 5D32A 3NDYA 3W73A 4J28A 2Z24A 3O6YX 4MUZA 1US0A 2D2HA 5F4SA 3HFTA 5E70A 3K46A 5FJIA 4Q7NA 1R9XA 3P80A 3VDCA 1QNVA 3TQVA 3PULA 5LNUA 1ZL1A 4AZBA 4JTCA 2L5HA 2BGQA 1I45A 2QV4A 2GVLA 3FYPA 4BF9A 4NZ5A 2CC0A 5LA1A 1F6KA 1VPQA 1ZLPA 5J5DA 1TREA 1X1ZA 4KESA 1JDAA 3GUWA 4EF9A 1HL9A 1VFMA 5I24A 1PS9A 3BAYA 2HISA 3B4UA 2UV8G 3OBAA 2CCRA 1JCMP 1OGGA 5D02A 4MB4A 5LNVA 3TLQA 3FXYA 1YBQB 2J6VA 2ICSA 3OZYA 4TU1A 3UZZA 5HAOA 3UVIA 1AMKA 4YTRA 4HNCA 4XKYB 1JDDA 1LOQA 3TJIA 1E9LA 2D2OA 2ANUA 4J3TA 2HS8A 3B0YA 5H2ZA 2VUYA 4R88A 3R8GA 3P14A 3M6DA 4JTKA 7TAAA 5HOSA 4WVXA 1ESWA 2DZPA 1WBHA 3ZLHA 2NX9A 3N18A 1JF6A 5A95A 3WBYA 5I07A 4LAOA 1MRAA 1WDPA 4QS6A 5AYZA 2Z2UA 4HMNA 1DVJA 4HJWA 1KLZA 2XHYA 4E2DA 4F0HA 2YGYA 2ZICA 5LIYX 3OB8A 3QSTA 3K4WA 1MEIA 2V3DA 2RHGA 1EJVC 1ENUA 4DJED 1KW1A 3NO5A 2R1KA 4OOUA 5T9BG 3QR1A 1YHTA 3IJIA 4OTKA 3WF3A 3O2LA 4DUXA 2XZ9A 2E5DA 2UZ9A 4DUVA 4QHRA 1U2YA 1TPWA 3W1NA 5CPSA 3ARVA 5A8PA 1J9YA 1NFGA 4YWSA 1YDNA 2HTMA 3E2SA 5ABTA 2DZUA 2UBPC 1GJUA 3UYCA 1XGEA 4IIGA 1A5MC 3AICA 1A5SA 3PNUA 3MI6A 3QLDA 3W6LA 1CB7B 3L2MA 2JEQA 3DKJA 4Z1CA 1JPIA 1XQKA 4B15A 3P5YA 1QNRA 1E6QM 3AFBA 3ARXA 3GTXA 4R7JA 1GYMA 3VIKA 4X22A 1PE1A 4WGXA 1NFBA 2Q3RA 3POCA 2PU1A 3CZLA 3R89A 2PF0A 3IGSA 2YJQA 4LGXA 1M1BA 1BYBA 4JTLA 4ZXOA 3QMSA 3THAA 4QBXA 2G97A 1TRDA 2GQ3A 2BY3A 4I6KA 1KCKA 2J7EA 4GH3A 2B4GA 5DMMA 3AXKA 4GK8A 1AW1A 1YTEA 1UG6A 2A6NA 1C8QA 4QAIA 3WLKX 4LS2A 3TTEA 2J7CA 3IVSA 1EO5A 2Q8ZA 4AZ5A 4FPSA 1UR1A 5EU9A 1V3KA 1OCNA 2PGFA 4C1KA 4O18A 1JCNA 3T07A 3VM7A 3PBMA 2ZUTA 1VZWA 2WNQA 2BOEX 4DJFC 2CLMA 5MKGB 1XV8A 4U3AA 1JCYA 3VGEA 3MMUA 3M7SA 2HXTA 2I16A 1MW2A 1EJXC 4CKQA 3R5EA 1T0OA 5CC6A 2OELA 1B2YA 1US2A 3STGA 5DRIA 4O4VA 1HL2A 3WK1A 4XK2A 5JUVA 1OFRA 2PDJA 3P2VA 5FAGA 2TMDA 4GI9A 4LAUA 5JBFA 3VCCA 1OT2A 3C0SA 5CBJA 1TCDA 4GOAA 1UD2A 5E9AA 2WYSA 1H09A 5LYRA 1K03A 4ASTA 2QXWA 5D04C 1JZ5A 1BRLB 2TRSA 5K9DA 4GZEA 1W8SA 1LORA 3WQ4A 3GFYA 1PV8A 1QPRA 4I7VA 4C7DA 4E8GA 1EL3A 4UTFA 1XRFA 1I1WA 1Z9AA 2D69A 2EEXA 1H11A 3FN9A 2ZC1A 3K2GA 2J4GA 4AFYA 5BU6A 3V18A 4KCWA 2ACSA 3H2NA 4HSHA 3V36A 2XGZA 5BCAA 1P1MA 2Y7GA 1ZSXA 1P1XA 3BPWA 4N9BA 3U6WA 4WKFA 1G01A 4EXBA 5G1TA 3TSMA 4BR1A 3CL7A 2ZXQA 3RO6A 3RR1A 3A4JA 3ZT5A 2DVXA 1NDVA 2ZRUA 1WV2A 1ADDA 2QHAA 4M19A 4M7TA 1TA3B 2NUYA 4QNEA 4GYJA 3V1HA 3CEUA 1XIBA 1POJA 1R3SA 3E74A 3OVRA 3W7JA 1B3XA 4H01A 2YCKX 2ZTKA 1PTDA 5HMDA 3SN4A 3VKAA 2E25A 4GRSA 3EX6A 3CB3A 2DVTA 1BVZA 1Z3NA 2QCCA 4QG6A 4UMBA 1R5YA 3WF4A 1DJNA 3N14A 4HNUA 4D1JA 2PTXA 4QIUA 2W63A 1E3ZA 3WO8A 4K37A 1BHGA 4UTWC 3W3OA 2KZHA 1QI0A 1HKMA 5FOOA 5CCZA 2FGLA 1XYCA 1HTIA 4NF7A 3CV6A 4HPGA 1IXNA 7CGTA 4LF1A 1OC6A 1KM6A 4UQEA 3TN6A 1BFNA 2WJEA 4M0XA 1JPMA 4A4AA 3RR4A 4FI4A 3G0XA 4GJIA 3IAQA 3OIHA 1P6WA 1HP5A 3EX1A 1UH4A 1R2SA 3STPA 4KCUA 3N15A 4XO7A 3SUVA 1CX9A 1PVNA 4UFKA 1EX5A 1JRCA 3GDKA 3U2CA 5DBUA 2ZOXA 1TPVA 2J6XA 2X1IA 1DHPA 3THDA 1QJWA 2OT0A 1LQ0A 3I6EA 2OQLA 3W26A 3M5YA 1GOXA 3W23A 4OGZA 3HB9A 3C0QA 1R3QA 2FZ9A 1KM0A 1RY8A 4K36A 1HJXA 1IZJA 2VX5A 3F5LA 1KQZA 2H3BA 5HQEA 1VH7A 5CZSA 3ZR4A 1IXPA 4FXSA 2DUZA 1SSGA 4RK8A 1YQ2A 3EKLA 4J3SA 3SEPA 1CXKA 3S42A 4J4KA 3LHYA 2C1GA 4O57A 2XVKA 4B92A 1N55A 4HZMA 1QASA 2BASA 4OECA 3I65A 2CLIA 4NRSA 4S3EA 3N4EA 4WK9A 2VO5A 1EEXA 2A6LA 4DN1A 1ZP4A 4HPJA 4IPPA 5CG0A 4QCEA 1RJPA 3E12A 1C3FA 2IXVA 5BMXA 4IMFA 3GU2A 3KBSA 3EOEA 3ZS4A 4KIRA 2C1HA 2WHJA 3CWOX 1ODUA 5A8QA 4ZE4A 5ABFA 1EOMA 2HDJA 4M1RA 2DDXA 3HA1A 3T6CA 4ROPA 5D09A 1US3A 2JE8A 4UCFA 3EXRA 3ENLA 1AD4A 2PDYA 1NM9A 4FNSA 1HW6A 4PUEA 1OM0A 4HPNA 3G22A 4INFA 3SSJA 3I4EA 5L6UA 3ZT7A 4M6UA 4B3LA 2JKAA 2OKTA 4IP7A 1W54A 5E1QA 2Y7FA 3SECA 3EMQA 3GNNA 2QVNA 3BJSA 1QXLA 4GJ1A 4AY1A 1CZ1A 3CL6A 2V30A 1YNYA 1N8FA 1KM3A 1TR1A 4Y2WA 1KKOA 1MQPA 2XDFA 4NX0A 1VFTA 1XIGA 1KO0A 3QGVA 4GC4A 3REQA 3POHA 2O7SA 4D8ZA 3DG6A 2CLKA 3GVVA 3WMBA 3VFLA 3H4GA 2WMGA 3O15A 3AO0A 4DVOA 1WPCA 1LL4A 3TNOA 4RW3A 2XZ7A 2A3HA 3GDLA 3EEGA 3ABZA 2NQLA 3GM8A 3T09A 3RGTA 3GTNA 3HG5A 4WR3A 4DAFA 3TOYA 3UWVA 4D6IA 3UY7A 4NI3A 4Q33A 4HPHA 1ITQA 1UB3A 2WQPA 4DBUA 1NVMA 2JALA 1K8CA 4X2RA 3LN3A 4UTMA 3DC8A 4KFNA 4GGHA 3VNJA 2FJUB 2QJJA 3UA4A 1IQ8A 3HIJA 1Z89A 1XSKA 4J2MA 3EWDA 1J93A 1XC4A 4C6CA 4CQBA 3Q94A 1R7AA 4MWAD 2E1WA 4JTGA 3QH2A 4PUJA 2Y8VA 2ZA1A 2A4AA 3DG7A 5XIMA 8XIAA 4TMBA 3VCRA 5GNXA 3SB0A 3URAA 3V0UA 2PGEA 4XD6A 2IPWA 4Q8MA 5A8GA 2QKFA 4AD0A 3NZRA 3PUGA 1FHVA 1V08A 3TWBA 3UJ2A 1V3MA 1OFDA 4PRWA 2W91A 4TX9A 1E55A 4JHZA 3URNA 1R47A 5C70A 4IMGA 1JDEA 2WWCA 2HJPA 5A6BD 4FOJA 4TV5A 1Q6EA 2W27A 1XJBA 2HNHA 3ARPA 4N4PA 4KCVA 1CXFA 4CN1A 3WEZA 1EH9A 2CKRA 4F0LA 4FNTA 2PDGA 1JCXA 2VI0A 3G0SA 4XV0A 1O5QA 3HV9A 1HP4A 5TQLA 2PDIA 4K7VA 4H3DA 2R91A 4A3HA 2A3LA 1K8ZA 3R4IA 1KLYA 3VNIA 4A29A 2BHUA 5E0KA 4Z2LA 4YU1A 3M0VA 4ADSA 7REQB 4P7NA 5REQB 2VUNA 3MYOA 4A3RA 4KRUA 5AYXA 4TTGA 1LTDA 4AZIA 3T8LA 3P60A 3W01A 3R79A 3W81A 4TVDA 2FYMA 2V2HA 1A53A 3PAOA 1MFVA 2IKHA 4IQJA 3W87A 4PL1A 3URQA 3B8UA 3GXMA 4LPCA 3R43A 2B0MA 3F4NA 4G56A 4QG8A 3UXLA 2PZNA 1YYAA 1JRBA 4DIAA 2NQJA 4GXMA 1HN1A 1ME8A 1KFKA 1RA5A 3RAOA 3SY5A 1QK2A 2WC4A 4HU4A 3GXDA 5KZDA 4HK6A 3FA5A 4DZIA 3TSBA 2Q09A 3EMCA 3GXNA 3AJXA 2FHCA 3SY1A 2BDQA 1QMLA 1F8MA 3QEZA 4XSLA 2WSPA 3Q4DA 2NVAA 3A6OA 3L2IA 1P0DA 3CQJA 3R6IA 4M5PA 1OZMA 3FAWA 1EWEA 1AVAA 5BRQA 1OG0A 1J18A 3OHMB 4EAMA 3W1MA 3O6CA 4ADTA 1H60A 1WE5A 4S3KA 1UKTA 3SCOA 5I77A 3A13A 4XAZA 1F76A 3L0NA 4I9MA 1JG9A 1NDZA 4WD0A 1SU5A 3CHVA 3NL5A 4GKLA 4JYEA 1EZ2A 2BTMA 4NYUA 1XD1A 1E9IA 4GUJA 3ZJ7A 1S2VA 4D72A 4GJJA 4JTTA 4FZIA 1PCWA 3WLSA 1RZMA 1UP0A 3CPRA 3SFKA 5I3DA 4PUMA 2BFGA 3GX9A 4O0ZA 3RO8A 1Q6QA 1TYGA 3VTRA 1KFLA 4NHVA 1BTMA 1FWDC 3NZQA 3ZJKA 3EWUA 4L4PA 1R3YA 2CPUA 2C7FA 4M6PA 4GYKA 4HA3A 4YYCA 1U83A 2PDUA 3E0IA 1GVFA 1NWSA 4PBFA 1U1JA 2C13A 1RUSA 5HQMA 1EXBA 4TO8A 4X0VA 6TAAA 1NAL1 3WK3A 1UWTA 3PWIA 4R85A 5I3JA 1M68A 2G95A 5A6KA 3N6JA 3QFWA 4JIRA 4PBEA 1UCWA 4XTIA 3DIPA 2VFDA 4R9OA 5FACA 3W1RA 1OGBA 4GO9A 3S1XA 1B0IA 1VQTA 1YW1A 1JCJA 2G3IA 1XHGA 3CASA 3EZ4A 3A4WA 1VIZA 5D2WA 3BLEA 1O1HA 1R38A 2PE4A 1TV5A 3G1HA 3ELFA 3W7QA 2CZ5A 3C2EA 3NVDA 1ZTVA 4IJRA 3KOFA 5G4HC 1SR9A 3P8IA 1W5OA 2CFFA 1KGXA 4M56A 4W7VA 2Z1BA 1G7UA 1XSIA 3DESA 3N3TA 2QUTA 8XIMA 1QK0A 1MI3A 2QVHA 4C90A 3B0XA 3NAVA 3ZWSA 1L2UA 4DF1A 1ZFJA 3WELA 2BG5A 2J7FA 4RNFA 2VR5A 4Q7IA 3TH6A 4XKMA 3RMEA 3M0JA 5EGRA 1K9EA 1XYAA 2DZBA 1H0GA 3IIVA 4HNLA 1GOQA 1GOKA 2E40A 3CAKA 1TWZA 2YL6A 3S1WA 3G8RA 1OWQA 1AQHA 1GJPA 1DORA 1UASA 2AKMA 3PC0A 2P1FA 1TKKA 1RD5A 4EE9A 3W2MA 3DFSA 1Z44A 3WH7A 1QI5A 1OK6A 3DBPA 2C14A 1ODZA 2OX4A 3ATZA 1J0ZA 4GQGA 2E5CA 2VC7A 3LCLA 4L1XA 4GO8A 1K7EA 1GKQA 5A2AA 4JNYA 1ZP3A 2YSWA 2XVPA 3T44A 3LA4A 3IIXA 2RKXA 3EA3A 4WSJA 1GWJA 1SR0A 2G3JA 1F3XA 1HT6A 3UJEA 3W02A 4CQ9A 1J01A 1LDCA 3E0VA 1L2QA 3GW3A 5LSMA 4LEFA 4E0CA 1DWAM 3BG5A 1AUSL 2IKJA 1VRXA 2HPIA 2WZMA 1V3HA 2VDGA 1XBYA 1XLDA 1JPDX 2YIHA 1QO5A 3XIMA 4ZQNA 4IOTA 5IDZA 3EWZA 3RITA 2ZFAA 3GC2A 3E9AA 3M0KA 3RG6A 1HJSA 1GZJA 3UWQA 3PP7A 5IHRA 5G4EA 4BQ3A 2B7PA 3ISIX 2HROA 2DSKA 4NKCA 5HWNA 3LCHA 3EXSA 3STCA 2R9RA 7XIMA 1QOPA 5XINA 1XC6A 4UOJA 3WQ6A 1P0KA 1IV8A 3DOPA 3VA8A 3QHMA 1NQ6A 3QV7A 3GAKA 4QR6A 3SRHA 3BG9A 3GDMA 4I5XA 3OJGA 1TV2A 1C8YA 4IGNA 1MUMA 1SJAA 5EMLA 1NFPA 3ZOAA 4U31A 5DT5A 1UWUA 2OMAA 1DPMA 3MUAA 3WUGA 4QLKA 3S5YA 3AMDA 2B7OA 4GVGA 1F6PA 3MKCA 1B9BA 4IFOA 4AWSA 3MA8A 5GJMA 3E1F1 1SUXA 1UMYA 5LKYA 3SZ8A 2E0PA 5I2UA 2Y4SA 1TELA 1UR8A 2XSBA 1DJHA 4Q7BA 1GJWA 5FF2A 1KQYA 1XX1A 1A4LA 2W3ZA 3S1VA 2OYLA 3CQHA 3VNDA 2Z7GA 4EXQA 3EA2A 2DSVA 3QN3A 4F2UA 3RCYA 3ITYA 5DMLA 4GVIA 1VYSX 2WJZA 3KZPA 3CK5A 3W7IA 1V03A 1TPFA 1QAPA 1J6OA 2DUAA 4XZHA 4F0KA 2IKGA 4O0QA 4UTKA 3VFCA 1V6XA 3VX1A 3QVQA 1GQIA 4FNRA 4XSMA 4MB5A 3AXXA 5AFDA 3GZ3A 4Q8QA 4KKXA 4WY0B 1LQAA 2CZFA 3C6CA 2QQ6A 1E72M 1FWAC 3BANA 4CNUA 4L4MA 1XR2A 4CD4A 2ZUSA 2GDQA 2O4QA 1XCXA 2V9DA 4CEUC 2P76A 1AW5A 2BOFX 2Y5JA 1IHIA 6PTDA 2QZRA 3LBCA 3FYYA 2PURA 1OC7A 2HRWA 4W9TA 4J35A 2VRKA 3N12A 5IBXA 4IP5A 4LCRA 3UZ5A 5BZAA 1I0DA 1HKIA 3MTWA 1XYBA 1PX8A 2P8BA 3G5EA 6A3HA 4BI6A 2QDGA 5HA7A 2PWEA 1H1NA 4ZTYA 3AHZA 1E43A 3MS8A 4H4IA 3ZXWA 3U57A 4BK9A 4X60A 4DXVA 1AL8A 2NSOA 4TIMA 3UGVA 4E2VA 4O54A 5K3VA 3NQCA 5AVNA 3KP0A 2GGJA 5ABGA 3WQFA 1PWMA 2BSLA 4IX2A 3H23A 3LXBA 3OO2A 4TTUA 2DW7A 1DIDA 1SMDA 2OYKA 1SYTA 2R6OA 3P74A 3PS7A 4MZ1A 5DANA 3DHFA 2ZZ2A 1LROA 1REQA 1Q6DA 4ZQMA 1QDSA 5A5WA 1VAHA 5D2XA 1XLCA 4H8HA 4NP7A 4UR7A 3U2EA 5CQ1A 4TV6A 4QQ3A 1XLHA 4HN8A 4D6FA 7TIMA 4RNIA 5HATA 5M1TA 3WH6A 1D8WA 3SSZA 3BQ5A 3F2DA 3L4VA 3FHAA 3B9EA 1VFSA 4BEUA 2VD9A 4AIEA 1MUWA 1D9EA 2WCSA 3MUY1 2C71A 2PBGA 4GWEA 5C55A 1Q13A 4L4OA 3RRAA 1GK8A 4X9YA 4K39A 2BP1A 1CGXA 1I1XA 4Q4MA 2YL8A 3P0XA 1J79A 4POCA 1T99A 1XG3A 4UMAA 4G9PA 3AS2A 2R24A 2WVVA 1KM4A 5AHIA 3VDAA 3MI3A 2P5NA 2WSRA 2D0HA 4FNQA 2C0HA 3BVJA 3AHVA 3OBKA 3WUEA 3B4YA 3EDKA 1P0BA 4QITA 3TMLA 3O0FA 1EJUC 4EKJA 1SSDA 4XO6A 3ZQ9A 1MYRA 2ZXBA 5AC6A 1Q65A 2VFEA 2EQDA 5AYIA 2C91A 1I2NA 2DFAA 1VGAA 2VTFA 2XN0A 3APYA 2PFHA 4W84A 1V6UA 1YRRA 1WKFA 4RV3A 4WF7A 4LYPA 4GI4A 4D6GA 2VNCA 3Q58A 3TQ0A 4FSAA 2NUWA 4O17A 4F66A 3QM3A 1NY1A 3HQ1A 2VEKA 1KRMA 3H53A 3LI0A 1FXPA 4BFAA 5HULA 5AC4A 4NUWA 1K77A 1UWQA 3AC0A 3VD5A 2XU2A 3TC3A 4YLWA 4S1FA 2A7NA 1IGSA 3N9RA 5K9XA 1DJWA 1EDTA 4PMYA 1TQJA 4IIDA 1UUQA 3NEHA 2D73A 1J5SA 3CZKA 3NQ6A 1FH7A 1P43A 4Q4PA 2DIEA 2V5JA 4GY1A 5FF0A 1A5BA 3DFOA 5I23A 4DXXA 3NPWA 1ML1A 2OYMA 1FP9A 4IP4A 1LL6A 3CTTA 4UUIA 1C90A 5HK4A 1TV7A 2P0IA 1ZCOA 4X61A 2WO5A 1GOWA 4ZR8A 3NZ1A 1X7FA 4HSNA 3APTA 3WD0A 5D2YA 3GS6A 4C7GA 1FH9A 4PMUA 4ERIA 3GHUA 5IHSA 5HWMA 5H8MA 3WNNA 4ZMGA 3MYPA 4Z42C 1HL8A 3MU7A 3LZ3A 3N6HA 3VDGA 4EPKA 1NU5A 5U7SA 2XGIA 3RPDA 4GX8A 4M8UA 2PLCA 4NAFA 4RL3A 4JCLA 1GORA 3VK5A 2NV2A 1A5KC 2CYGA 3VYLA 4JD4A 3TW9A 3PTDA 4P7OA 3T2PA 1M7XA 3DN5A 1PKYA 2QMJA 3EB4A 4XUYA 1Q6CA 5LZLA 3SADA 5K7JA 3UR2A 2GJPA 4WJXA 1TTPA 4JXCA 3HMJG 1K6AA 1E4LA 4ZO6A 3MSYA 2BV9A 3N11A 2WV8A 3WFZA 3HPZA 3PZTA 4Q4SA 3G1XA 2HZGA 2JKEA 3S2LA 4XAFA 1DIKA 1M7OA 3L23A 2OCZA 1UP3A 4C1NA 3CH0A 3QBUA 2B31A 5HWJA 3EDEA 5C54A 3AIEA 4PCSA 2J27A 4B5NA 1XLAA 2WMIA 2YYUA 1E6XM 1NJJA 3AYRA 1SQ7A 4MFDA 3FVMA 4DEFA 3KTXA 1B9ZA 4PRTA 2V5DA 4ZFMA 1AH0A 4F9DA 1RH9A 3T0TA 4U33A 3QPYA 3BJTA 3EA1A 1M04A 5BXPA 4B4FA 2F8QA 1WKDA 4L64A 4A8IA 2E7FA 2GSJA 4Q6XA 1Q6LA 3RPTA 3PG8A 3GTIA 3WLJA 3WLQA 4X3ZA 1KBLA 2JBMA 3TN3A 3WJZA 1TWIA 1GQJA 1TWDA 2QJNA 2PTYA 4AZ6A 1JD7A 3G1DA 2Y63A 4A3QA 1R46A 1GEQA 4TUFA 3T4CA 1JUBA 5AHMA 3VNKA 1OIFA 2YA0A 4KWWA 3L65A 3W82A 4HN4A 3P0WA 2V3GA 3TYBA 2EG8A 4LBSA 4MWAC 4AY8A 1F3EA 1U1HA 4CD6A 4ZVJA 3SY8A 3EPMA 4GNKB 1EGVA 3A64A 3GU1A 4GXPA 2NV9A 1Z41A 5ABFB 1IEWA 3V16A 2PI6A 3CAVA 3ABQA 4HMCA 4RW5A 1HVQA 3D0CA 1H41A 3CWNA 3ARRA 4AISA 1H63A 3NJ3A 3U0HA 3UXAA 3SIMA 4TVUA 3UEQA 2AGKA 4LU0A 1UWRA 3LCIA 2WMKA 4N0RA 4O11A 4UQDA 1MZRA 2PU0A 1VR6A 3VNMA 4Z1BA 2XYLA 3VD7A 1RA0A 3B9OA 1BEUA 2WVUA 1WUFA 3ES7A 3B03A 1PCKA 1HG3A 2E9BA 5AVHA 1I75A 3NNTA 5SWUA 1TMQA 4B2DA 2F6KA 4L6HA 1XWYA 1KA9F 3E0FA 3REQB 4RPPA 2GVYA 1CLKA 2XFRA 4Z17A 1M9HA 2BVDA 3B8VA 1FWSA 3ZVIA 3IJQA 2Y8KA 5CSRA 4KT2A 2ADAA 1W3NA 2CZVA 2A3CA 4DRSA 2OSWA 2Q6ZA 3SUTA 4LB4A 3RLVA 3W29A 1Q4WA 1G4EA 1FCVA 2EPMX 3WQGA 4Z1YA 2IPJA 3W1QA 2G96A 1P0NA 3HMCA 5FEWA 2ALRA 5DCEA 4P8WA 3CO4A 2BVWA 1ADOA 3QSRA 2GFTA 4KMQA 3TW6A 5LIWX 1B90A 2E28A 2GJLA 1UR0A 3W7GA 5HR6A 1U22A 4PUWA 3UU0A 3N34A 4QDWA 5FJJA 3OBEA 1X7IA 4JN7A 3VGGA 1AZ2A 1T8QA 4S3GA 3MKKA 4A22A 3ZJ6A 3E49A 3PF3A 4YVPA 2VX6A 3L5MA 1BQCA 3S9YA 3RF9A 1GCYA 2O9RA 1JZ7A 3EWWA 3HFYA 4PMRA 2QF8A 1KNWA 3LM3A 1EWDA 4O1CA 5DY2A 4JHMA 5JIPA 1A47A 1AH4A 3EOLA 3PANA 4F0SA 4EX4A 4ZOEA 5C6MA 3NO1A 5H8UA 1QW7A 4LCSA 4MNLA 1B1YA 4MNJA 1EPVA 4HMEA 4RLIA 3GR8A 9XIAA 4DB7A 4NVTA 3NSMA 3XINA 1RSCA 3O16A 2ALDA 4H83A 2D2JA 3UZXA 4IG2A 2IKIA 1LWHA 2G3NA 5HJYA 2VFFA 1V51A 4FLOA 3RIKA 2P3EA 4X0NA 3CWHA 3W74A 2W61A 4NZFA 2ZC8A 2YXOA 5F7UA 1VYRA 3W76A 3WEMA 1HIZA 5FJRA 4R3UA 3ANYA 1EZWA 2QCHA 4CQDA 3NL2A 1XIHA 3N4AA 3EB2A 4Q6JA 4AXNA 3L67A 4C6NA 4DJDA 3BSMA 3QW4B 3QY8A 4XISA 1FP8A 1F74A 2YLLA 3FKRA 4U4MA 4I7UA 1UPMB 1OJXA 3C56A 3VMOA 3GHSA 3UJRA 3W27A 4OV9A 1GVOA 3WQDA 4GI8A 3N9SA 3INPA 4IICA 4GKTA 4FAMA 3NQ8A 4PN2A 4HD5A 2X1SA 4AHQA 1IT0A 1E3XA 4XBJA 4NZJA 2YZRA 4LBRA 2X42A 1QPKA 4IIEA 3O9NA 3LLFA 4Z2HA 2HNEA 3GH4A 3LSBA 3OQEA 3LRKA 4AVNA 3VOJA 3LUTA 2BVYA 2X1UA 3UZJA 3MUZ1 3V75A 2ONEA 5C2XA 1ZCCA 3CAWA 2VENA 4RE0A 1XLFA 1EUNA 3BURA 3CMJA 2WNZA 3EX2A 2O9TA 3W6YA 4XAPA 4KERA 3W1UA 4HB7A 4JN6A 4QJ3B 2HPMA 3KOZA 3QPZA 3G1AA 4ZOBA 2FPYA 4LRTA 4HOXA 1O4UA 1H3GA 2DZSA 1CXIA 2VZVA 1JYWA 3NPUA 1X98A 2DZWA 3DFTA 1GEHA 2V0TA 1Q8JA 3UF9A 4OZOA 3WEOA 1MXSA 2WJFA 5A2BA 3MJYA 3HGSA 3TYDA 3R58A 1WDQA 4ML4A 1LRNA 1UZHA 4IHCA 3UZWA 1PX4A 1XYZA 2C6QA 4H2CA 3TLLA 2YW4A 4QE1A 4QEHA 4DI8A 4YIWA 4YS1A 3MC5A 3NOYA 3NOEA 2WMHA 4PC8A 1PEZA 4GMEA 3CQKA 2IS7A 1T5AA 3C8FA 5CJ5A 3FSTA 4MLJA 1C9DA 2H6RA 2PF8A 3S46A 3AZTA 4OE7A 1X6UA 3H21A 4JTQA 5CPOA 2ESCA 4LW7A 1JQVA 3C86A 3N2MA 3WQWA 3W1AA 4WJ8A 4AD4A 3KBVA 3T1GA 2NWSA 3D46A 3M9YA 3SJNA 3LHWA 4MKNA 3MVTA 3VIJA 3LM7A 4U3CA 3HOJA 4LY4A 3GG7A 4Q8PA 1WYIA 1MDLA 3BGJA 1IE7C 1DL3A 5ECVA 4JCMA 4AEEA 3WMLA 2A3BA 1H2JA 1P48A 3NDOA 4GIYA 1O5RA 4FOUA 1FVPA 3PJXA 4MTVA 4QG9A 3VKCA 3VABA 3KFTA 1FY6A 1L9WA 4UTJA 3G8EA 4NL1A 3Q37A 2I14A 2WC7A 3HQOA 3ZLGA 3H22A 2IMRA 1D7FA 1FXQA 1R3VA 2YDQA 3KW3A 4IPNB 3CYJA 3LMYA 3VKJA 4LV9A 3A24A 2WPGA 3KWSA 3NYDA 1W3LA 4AC1X 3V3WA 3NFUA 3GIQA 4U5IA 1KTCA 2AQWA 2D1ZA 4D6EA 2PODA 3KLLA 1GG0A 3CLMA 1RY0A 3B8WA 3SO7A 3GDRA 6TIMA 4WDTA 2ZRVA 3M41A 4LALA 2J77A 2VELA 3FW6A 3LBMA 5U4NA 3KUMA 4GIRA 2DJXA 2WZIA 2RJHA 1UWIA 5EMMA 1O6IA 1W5NA 3HBLA 3M0IA 3DYMA 4GI6A 3HU7A 6REQA 1W1A1 3VO0A 4QEEA 3DDMA 2INEA 1BF2A 4YTTA 3W71A 2CW6A 3SFWA 1RQHA 2R14A 2OEJA 1XQLA 2P3ZA 5F1VA 3E2QA 3M0XA 1W37A 4C6OA 4AWEA 4HK5A 4GBDA 1KM5A 3MUCA 3I3DA 3UY8A 5F4XA 3UR5A 2VJXA 3CT2A 3S4TA 5FF3A 1WA3A 5B7YA 2ACQA 3S1UA 3UXIA 1V77A 2Y0FA 2PDCA 2DT3A 4UNLA 4TX8A 3OLGA 5IXEA 4LVFA 1E71M 4PCNA 4ZODA 5E09A 3VINA 3T4WA 3TEVA 4ICNA 5JVLA 1N82A 2I5IA 1UQYA 5TAOA 5KZ6A 1YNQA 4HTBA 2OEMA 3H6OA 1A5LC 4OKDA 1O95A 2CLHA 4AC7C 3GXFA 2RDTA 3BG3A 2E6AA 4Q4QA 3BZJA 4JOMA 3W2JA 3U4FA 3BLDA 3PVFA 4H9TA 5M2FX 3K4DA 1DOSA 1UHVA 3R25A 4MJ2A 2CZEA 2F6XA 3M0YA 3LPFA 4GABA 2PDLA 3ZMRA 3FS2A 4ZO8A 1CECA 4C6MA 1XLEA 1E9YB 1XCWA 1ZALA 3BMVA 4R7OA 3VOHA 5F2GA 4XVEA 2VP8A 3V7PA 1DXIA 5AKQA 4I7WA 2I17A 3OTRA 3R12A 3K1GA 1A3WA 3H12A 4RNJA 4DWSA 3ZJ8A 4IPLA 5IBXC 1BLIA 4NG3A 4WQ6A 1SZGA 4P8VA 2OX1A 2RFGA 4O52A 2I9EA 4O13A 4M6VA 1VRDA 1IEVA 1KXTA 4UFHA 1W3HA 3LV5A 3OLIA 4PMVA 4A3YA 2W66A 4HCLA 1V3JA 3M64A 2FZMA 1CXEA 4AZCB 1UYQA 2WBKA 3LRLA 4Q32A 5CXPA 3GK0A 2XIQA 4NX5A 4NSBA 1FHUA 1AMYA 4D6DA 1JI2A 3OOQA 3CT7A 3ZWTA 1E6RA 3AOFA 3S2NA 2A3AA 3PZIA 4C6EA 2E68A 4FF7A 1OSEA 4B5XA 5I3HA 1EXPA 1VFHA 3LEPA 1JGIA 4QLLA 3FCPA 3TK7A 1I0BA 2EKCA 4AVFA 3LK6A 4LUJA 1DE6A 2BB0A 1E0VA 2CITA 4GUFA 2VC9A 4HNVA 3AUOA 4CD8A 4E8CA 3WD4A 1XIFA 1BWLA 1GYNA 1H50A 5CBBA 1JZ4A 3C61A 1ZJBA 2OLSA 1N8WA 3IARA 5J8LA 1KFEA 4LNCA 4I6VA 1LG1A 3IGHX 4P2VA 3CL8A 4PB5A 3VCNA 2DSWA 2QT3A 2YR1A 3IRDA 1XW8A 2Z29A 5BWAA 4H9ZA 2XGBA 1YNPA 4CLMA 1MW3A 4X63A 4ALDA 2RDXA 4O14A 2PAJA 2ZWYA 1R7OA 1UKPA 5CGMA 1E73M 5IRPA 1TVLA 3LBOA 5D38A 3UNTA 2JFEX 1YE4A 4RE2A 4H8UA 1Z69A 3S6TA 2ZQ0A 1M7JA 4QE5A 2UWFA 2YDAA 2H3DA 2WHLA 4BS0A 5CC3A 3CV1A 5E6ZA 4CU7A 3VUPA 4WLCA 2WHKA 5T26A 3RX4A 1WOAA 2FH8A 1MEWA 4CNOA 2OODA 1W5MA 4V33A 1K8XA 2J24A 4XD3A 3R0DA 2REQA 1CLVA 4QTGA 1GTEA 2Z00A 3AIBA 2GK1A 4AF0A 4Y8FA 1JAKA 1CB2A 1REQB 1XBXA 3LLDA 4H6KA 3OZMA 4HA0A 6ALDA 2AQVA 1OFBA 1RV8A 2DZXA 2NZLA 2ZRZA 4QNWA 2QJGA 2VR2A 3FKKA 1O5XA 8CGTA 1BD0A 2YA2A 2G3FA 3NWRA 1QR7A 3AALA 4IXHA 4LBUA 3CHCA 6ENLA 5RUBA 4Q8NA 3S83A 1O66A 4PRRA 1FRBA 3TN5A 1PHQA 2Y62A 3CJPA 3DZ1A 2AMXA 4RDVA 4YTQA 4JFVA 2WLYA 1GQNA 3EYPA 4N6FA 1V4YA 7ENLA 3B8DA 3WJWA 2WVVB 3N4FA 1R8LA 3MI2A 3ZFHA 3GW0A 2ZX7A 1Q4NX 2BWGA 4UNIA 2CIPA 1RVKA 2DP3A 4XD5A 4Q8VA 3M4HA 6XIAA 5B7ZA 2X16A 3DYPA 3P61A 3KCOA 4Z1AA 4CN4A 1J96A 3NO3A 4EPDC 2GVEA 3DFHA 4NI8A 4Z2GA 1CGUA 3ITCA 5D30A 2GGHA 2F2HA 4TQTA 3GAYA 3MQTA 3WJSA 3PFRA 1WDSA 2J62A 4AWUA 3ITVA 2Y5SA 2WKLA 3PB0A 1D7KA 3OW1A 4J5NA 2CLLA 4C1LA 1QRQA 4KCTA 1W9UA 4LEQA 4WX2A 4B9YA 1NWUA 1B4KA 1EGZA 3MHGA 3E2VA 3C2OA 4B5TA 4OUEA 4R33A 3AIWA 3VU2A 1J8VA 2QUNA 1HJQA 1KRCC 1FA2A 2Y5EA 1HJUA 1O1ZA 3VPLA 4EWJA 5AB3A 2YXXA 4LFYA 1UBPC 4ZFCA 2XSAA 3NQAA 4H2HA 4UR8A 2IUZA 1U30A 1UIPA 4IM4A 4JQ1A 4C6JA 2FVKA 2GSEA 3EWBX 1O60A 1XG4A 2VYOA 3AMGA 1NF7A 3CIVA 3BC9A 3UG8A 5DT7A 1FCBA 1V3LA 3VGHA 3TJLA 1V6TA 4CVWA 4FHAA 1EJSC 2IPGA 2XN2A 1CXHA 5CGTA 1KGWA 2BXZA 3LZ5A 3CMFA 3VE9A 3FXGA 3NSXA 2C3ZA 4N4QA 4DBSA 2QCEA 3IIPA 1C92A 1R9ZA 3WF2A 2VGFA 4GYFA 1FHLA 1EJWC 3JZEA 3RUBL 1GNXA 3V5FA 4JEQA 2EHHA 5D8ZA 2OWXA 2XIIA 1YXDA 2NX3A 1W1PA 5A2CA 1OB0A 4HQVA 2D20A 1I2PA 4NAFB 4AB4A 3BAXA 1UUMA 4DQWA 2YFOA 1W1VA 3LGEA 3MB9A 3GBEA 5TD4A 4JTFA 4PFHA 3O6DA 2VM8A 1BF6A 5T91A 1PZ0A 1UIOA 3A9BA 2TSYA 3QJAA 3FOKA 4MMWA 3W7OA 1K70A 4CNPA 5L9FA 2A5HA 4FX7A 3OZPA 4J3WA 2HE8A 3VC6A 1XP3A 3B06A 5I79A 4TX6A 5BXRA 4FX8A 4TOQA 5AHNA 1DJYA 2NLYA 1D2KA 3MSRA 4CCCA 5A6JA 4UTTC 5FKYA 1VHNA 2A1YA 1R86A 3BXWA 3RJXA 4C1NB 1F5ZA 3O3RA 5CZTA 1JFHA 2CU0A 5KITA 1JF5A 3I10A 2WMIB 3EWCA 1TX0A 3RLHA 2VC6A 2XFWA 1AW2A 4IPJA 3H2AA 3C3NA 2F6UA 3W2LA 4F48A 3VUSA 4MB1A 3WDPP 1FWJC 6CGTA 5LNRA 1Z32X 1IXOA 4D1IA 1Q7MA 5D33A 3ERPA 2DT2A 2AQOA 4DBWA 5K4ZA 3AIUA 5H8PA 4QXIA 4C6BA 2WBGA 2OWCA 4MADA 1FWNA 2OOGA 3KM8A 4ZQCA 1JQXA 4OUIA 5FL0A 3EOSA 3EAUA 4Z0SA 4D2JA 1NWTA 1R0MA 3NEVA 5HNUA 1TX2A 5T8GA 3V0SA 3WQPA 2BODX 1E0TA 1RP8A 3QYSA 3KBMA 4S39A 1VP5A 5BROA 1QBBA 2FTPA 1EJRC 5GQBA 2VMFA 3TKFA 5GNZA 7A3HA 4HSOA 1E4MM 2Y1HA 1GVYA 2RDUA 1TJ2A 3N04A 1SMAA 4W5ZA 4H1ZA 4F4RA 2EPLX 1PWLA 2G50A 5EYWA 3U4AA 1IWBA 3B40A 4B9ZA 4LVBA 4CQCA 5AOUA 4G6CA 1UROA 1ICQA 3JZUA 1MWOA 1QHPA 1BWVA 4IMDA 1GQKA 1PJ9A 1F2JA 1TIMA 3UJFA 3JRKA 3NQVA 2GDUA 4K8HA 2XN1A 2BXVA 4MYAA 3CZGA 1VCFA 1GPWA 3M0ZA 5AHEA 3NZPA 1K4HA 1Z6KA 1QT1A 2PMQA 1B54A 3NCOA 4BI5A 2V8ZA 4CNSA 3JVAA 3GE7A 4BY3A 3WD1A 2CWXA 1VFUA 4HOZA 1OFOA 5DXYA 3T0DA 5LIXX 2X09A 2DZVA 3GNRA 1O12A 5JH1A 3BAIA 4B16A 4JNMA 1H7OA 1S5WA 2KAUC 2FHBA 3TCEA 3RDKA 4EK7A 4G8TA 5LNSA 3MMWA 1UR4A 3QC3A 2VZUA 4IL2A 1JFXA 5JBDA 2WSYA 3BCFA 1NEYA 4K7YA 4W85A 4W88A 1JCLA 4PMJA 3VIPA 1LZOA 1HF6A 9RUBA 1MXGA 3PJUA 3GU9A 3WNPA 1UR2A 2DU2A 4JTAA 4XD4A 5LHEA 3KCJA 1W1TA 2WWDA 3W2UA 2Z27A 1NIUA 3VVGA 4F2TA 5DELA 2NWRA 3FY1A 4WY0A 3R8HA 2NUXA 1X96A 1PKMA 2QMKA 4RJEA 4MNMA 5AC8A 3KVLA 4QE4A 1KXVA 4CNTA 2ATMA 1PO9A 3PFMA 3C8NA 1VEPA 2ODOA 4GACA 4QSHA 4B90A 2PP0A 4A2SA 5A3HA 4OFCA 4N2YA 4RDYA 3MCMA 1EC8A 2W9MA 4ZB2A 2GZXA 3H7UA 2GUBA 3M44A 1JVNA 3TMQA 2GSHA 2X0HA 3RLUA 3LB0A 5FA5A 1XM3A 1PDZA 3PPCA 2HK1A 3F4DA 3RX2A 2W4XA 4L9ZA 2ZKMX 3WUBA 4C60A 1LT8A 3UR7A 4H8NA 1GKRA 1HJWA 1B3VA 3FNDA 1HUVA 2RDWA 3TC6A 2Z7KA 4PTXA 3URBA 4WXZA 1R2TA 4UOZA 2BGNE 2OB3A 4IUOA 5CSUA 3UCCA 3WF0A 5BMWA 4J3XA 2QDHA 3DFNA 3II1A 4IG2B 2TODA 4QQUA 1TJPA 1BXBA 2ISSA 4XQ6A 4BHYA 3M5ZA 4UXDA 5FJPA 2D24A 2QEZA 4Q8UA 2PCEA 9XIMA 2KX9A 3MBFA 2FFCA 2E8YA 4Q22A 1SZFA 5LA2A 2D3LA 3WJXA 1UH2A 4F79A 5HNNA 1XIDA 3Q45A 4FIRA 4MF4A 1ZBCA 3R10A 5FAJA 3ZIZA 2ZX6A 4XVDA 3PTKA 1UWSA 3KOWA 1PPIA 2XIOA 3U5UA 4RZ4A 2HV5A 1T7LA 1LL7A 4REQA 1IIGA 4BQ2A 4R9XA 1A0EA 4FEZA 4AEOA 3E02A 1ZPTA 4GCAA 3MO7A 4KEVA 3NZGA 5HXMA 5TF0A 1FHDA 1LCOA 4HHLA 1OIMA 4FX6M 5D8WA 3QTPA 3W2NA 3T05A 3WK0A 4O15A 2EG7A 2Q71A 3D6NA 4Y9MA 3A5FA 1LBFA 1UQZA 3WDJA 5HPOA 4WIWA 3NL3A 1V5XA 2O9PA 1BKSA 3WBAA 3OGVA 4UB9A 4W8BA 1QNOA 3MUIA 1U1UA 2V5KA 5C7VA 1R9YA 3P84A 1XBZA 1VFLA 1KWGA 3TIMA 1MNZA 4R27A 1N7KA 1W56A 4DO6A 2Q01A 3WNMA 5TNVA 1DQXA 2G41A 4Z2IA 2NW0A 1A5UA 1HVXA 5B80A 1UR3M 4QDPA 1J5TA 4C5YA 1K9TA 3S8HA 5AN7A 4AIUA 4QGCA 1I2OA 4LAKA 1TE1A 4ICMA 2LLEA 4AYGA 3T40A 4HYVA 3QF0A 4MJ4A 1KV8A 3I7RA 5I3IA 4GZIA 4DJFA 3K8KA 2OSXA 2QULA 1LM1A 1IEXA 1WDWA 2NQ5A 2GWGA 5FF4A 1NQKA 1R2RA 1XLMA 1GOIA 2C1IA 4H8VA 3G18A 1G4PA 2DT1A 8TIMA 2OR2A 3ITLA 4YNGA 1AH3A 1O7AA 1E51A 5H1WA 4Y96A 4PB4A 3QFEA 4Z2JA 3FDGA 4R34A 1A80A 4JIQA 2PC8A 2GWNA 4M82A 3COTA 1D3GA 4X9SA 5HMSA 5FJTA 4KFOA 4DYJA 2PWGA 4O0KA 3PSWA 4Y7EA 3CHDA 4ZOAA 1A3XA 4MZ8A 2ZDRA 5M3WA 4IUGA 4EP8C 2PUZA 3JS3A 2JF7A 1KD0A 2XVNA 3I3BA 3VZYA 1Q2SA 4JPGA 2JF6A 3LQGA 3CUFA 1IF2A 1KTBA 1DTNA 2RGMA 1TZZA 3P67A 5FCZA 2V68A 4WDUA 2XH7A 4KRZA 3PZGA 3W2KA 5JU6A 1K1DA 3LYEA 5DY3A 2PRLA 1VJIA 2GDVA 4AUBA 1EKOA 3SURA 5C5YA 3ID7A 4GNVA 1TVPA 3EMZA 4NXSA 1CTNA 3WH9A 4ES4A 4JBRA 1G0CA 4JAWA 4US5A 4HKPA 2E1DA 3DG3A 1KBJA 4YYFA 1VCVA 3G0UA 5DLCA 4US5D 4RX0A 3T2OA 4O4WA 4RXGA 3U5YA 3CUGA 3PG9A 8RUCA 3UXDA 1OEPA 2E09A 3E38A 3N29A 2JK2A 1QHOA 3W22A 1OX6A 2VZOA 3L5AA 5DN1A 4LAMA 3VX0A 2XWDA 3A3WA 1B3ZA 3FJLA 3TUUA 2Q02A 5PTDA 3F4CA 4DWSC 2GJNA 3NPXA 4H19A 1Y5XA 3UPWA 3VIMA 1THFD 1TV4A 4Q4KA 3H4WA 6REQB 3O0KA 2ZA3A 1VPYA 3SCVA 4F9JA 4FA3A 1JR1A 5HUPA 4AQLA 1R6WA 3GXPA 4UIOA 3RCNA 1ZZMA 3S5ZA 2EJ1A 4DUWA 3TQPA 5CLWA 3MDUA 1SVDA 3PWGA 3QHNA 1I60A 1GOOA 1DV7A 2IW0A 3A3XA 3PBVA 5FL1A 3UQNA 5FF7A 4ZBCA 1IR1A 2WKGA 2QV5A 2X1TA 4LXFA 4K1GA 2CLPA 2ZZ4A 3MMTA 2X0SA 4LUSA 3O63A 1FOBA 4OVXA 2D3NA 3HG4A 1FBAA 3SW6A 3ECQA 3IGUA 3FEQA 1Q6GA 2Z2AA 4U28A 4B5SA 3TVAA 4XX6A 5EPDA 3UYIA 1P6CA 3GYEA 4N9DA 1ZQ5A 2FZDA 3LNPA 4JQ2A 4EIVA 3WLPA 2GGGA 1ONRA 1VYPX 1B4EA 3LSCA 2FPTA 1QPNA 3G6MA 3QKEA 1FWCC 2PDNA 3VNYA 3O1NA 1X1NA 4MKVA 4MOZA 2Z26A 4GC3A 1IZKA 1Y5VA 1M65A 5G2HA 9CGTA 1WOBA 3A23A 3BCDA 4AD3A 3M5XA 4H7ZA 3BSHA 3E0WA 4B91A 4XBSA 2QUMA 4OBTA 3RYSA 3W88A 1FWGC 4ZQRA 2VVSA 3L9CA 4B5VA 2PC4A 3BW4A 3W07A 4IL0A 4DWSB 2QNEA 2ZE0A 1A5NC 3G6LA 1XIJA 1XYLA 3QZAA 4JTSA 5BXSA 4JGDA 3N17A 1I6NA 4V2XA 5LNWA 4O53A 4FNUA 2FHFA 3ZM8A 2DH3A 2BY1A 3UWEA 4HIBA 4NU7A 3W7HA 3T55A 1Z8AA 1PKNA 2OSYA 1XINA 3IGXA 3LPPA 1SFLA 4IJBA 1R30A 1HO4A 2DV0A 1XIMA 3TAKA 2ISDA 3GHTA 2J75A 1LOLA 3A47A 3CUZA 3BLIA 4Y9OA 4M51A 1M01A 4KEZA 3NQ2A 2HVOA 4D6JA 1ZAIA 3KAOA 3PPFA 3AHTA 3GIPA 4AZGA 1Q3NA 2FVMA 4ZO7A 3CLWA 4L9XA 2OQYA 2VEIA 1VIWA 1SJDA 5C71A 2NQ9A 1KCZA 1ITXA 3CV2A 3WFLA 2XIJA 3VGDA 3HPXA 5H6HA 3WDRA 2WHMA 1YXYA 1WP6A 3G1RA 1UD8A 1TPEA 1OQFA 4XIMA 4O1FA 1LJYA 4JYDA 3WLNA 3TC7A 4A35A 3MJMA 1V93A 4V1YA 1D8CA 1XSJA 1BTCA 2PWVA 1H61A 3KP1A 1AG1O 2EO7A 3QQWA 2VWTA 3HJEA 1R3RA 3WCZA 4IF2A 3L2LA 4LH8A 1BSIA 1KFCA 2OPJA 1UKOA 1SZEA 3TU9A 4E3VA 3W7MA 3OEXA 4Q4OA 1X97A 1FFRA 1PIGA 2DUXA 1W0MA 1BG9A 2BOGX 4US6A 1EP2A 1CGTA 2ZUMA 1V7YA 3GH7A 1M6JA 4GHRA 5JQ9A 3E96A 2AKZA 3DECA 3TN4A 5GVJA 3RLGA 3PR2A 4BQ4A 4JICA 3LOTA 3CZJA 4H6EA 3TV8A 1TPB1 4UZUA 5C9XA 3T78A 5F2LA 2A21A 5LHFA 3WLMA 4QJ4B 2OO0A 2OTDA 3L4TA 3M5VA 1CW2A 2Y7EA 5EKYA 1FDJA 4NJHA 4ZSTA 3H55A 4W5UA 1ME7A 4PUUA 3TP4A 5CPNA 3AIQA 3MCOA 3DC0A 4LC8A 1LP6A 2DSZA 2REQB 2WNNA 5CBIA 2VXNA 2QPSA 1GW1A 2GK1B 2WCGA 4AF0B 1CENA 2WPBA 4WDXA 4KF1A 1GKPA 3QC0A 2ZXDA 5K9CA 1VFOA 1PHWA 2E67A 2R82A 1PSCA 3GKFA 5FD0A 3VIFA 2OGJA 1R3TA 3RM9A 2CBVA 3LS9A 2W92A 3LG3A 2VURA 3CH9A 4NZ4A 3R94A 1JUKA 4JQAA 4DAIA 1J2WA 1JD9A 4CCEA 4BJHA 3TJ4A 3MHUA 1ONXA 1Z48A 4MFEA 2PD9A 1S2UA 3PZMA 4C7FA 4D6CA 3SQSA 3TJXA 4MYXA 2XM2A 4HZ6A 1C9WA 1M53A 4RDZA 3UCDA 3IAPA 3KHDA 1OHLA 3QZEA 1ME9A 5JH2A 4I8DA 2X2GA 3O8AA 3QKZA 2V81A 5CGQA 4GA8A 2Y8UA 3LCXA 4NZ3A 3TXZA 3P62A 4GIAA 4ZB0A 4DF2A 3H2CA 4WRHA 3N6QA 4OU1A 3OA5A 3S5NA 3L4YA 5E9XA 3VZXA 3VNLA 2VOTA 2NXIA 4XAGA 4EXAA 3IVUA 4G7FA 1GYLA 5DX7A 1KFWA 5G2IA 4HYRA 4PH6A 3N2XA 4U2ZA 3H54A 3WBEA 4J7RA 3CBWA 3QOMA 1MQRA 4M7SA 1IXQA 1H7PA 3MDWA 4PZVA 2V6AA 3BSGA 4W87A 1AFSA 2PDHA 3DERA 3MZ2A 3CPUA 1RBLA 1F3TA 2D23A 1QNPA 3GSMA 1BYAA 3DYOA 1TPDA 1QW9A 2XSXA 3F5JA 5FEXA 5KSWA 1UPPA 5I78A 1MXDA 1JL8A 1KBKA 4OQVA 3V5CA 4IGHA 4TMCA 1W9BM 3T2QA 1H1YA 1LT7A 2NT0A 3QR3A 4NZ1A 4URIA 4CEXC 3MKVA 3BARA 4EF8A 4AIBA 5CPLA 2XUCA 3LMZA 3T08A 2D0GA 2GVJA 3L68A 2WOQA 4MB3A 4HGXA 1P5BA 3UG4A 1ISZA 3DHUA 5DRCA 3PZUA 2XWEA 4PTDA 3MBDA 3BMXA 2TYSA 1SGJA 1FWRA 3RCMA 1H62A 5I09A 2ZZ6A 3W0KA 2VQUA 2JGYA 4WCJA 3EB3A 4WSHA 3KOXA 1PIFA 4C6KA 3W86A 1YXCA 2E5BA 3F4WA 4C65A 1M41A 4PL2A 5E6YA 1XCFA 3TX9A 1S5VA 5A8MA 1H0IA 1ZJHA 1Q85A 2WM1A 1A5AA 3M47A 1HXJA 2FPVA 4E2BA 3S47A 2XH2A 3CGTA 5I3FA 5IFTA 4BCEA 5EMJA 3D5HA 1SZRA 3PZ9A 4I9AA 1YE6A 3ARSA 3H4XA 3VKKA 5FIPA 3PAJA 4FP1A 4E38A 4LYQA 1JXJA 1X39A 1MDRA 2OFJA 2NQHA 1G7VA 4MY1A 1XDJA 2PDMA 4I5UA 4JZ5A 1JDFA 3L12A 3L0KA 3UVAA 4DELA 2QDDA 2QR6A 1W1IE 1BPLB 4NJGA 4GZ7A 1S46A 4EWND 1CDGA 3NSNA 4UMCA 2CBJA 4XG1A 1FH8A 3TA9A 2FZBA 3IACA 4QM1A 4AMAA 3MMDA 2WQDA 1PZ3A 4CU8A 3G24A 3GVQA 2WLZA 3HPSA 1JGMA 1W8GA 3VIOA 2QCLA 1QI3A 3KDOA 1SFJA 3QOKA 4DWDA 4K38A 4JL1A 3E5BA 3T81A 4CUCA 1E1CA 2O92A 4RE3A 4AH7A 4MKSA 1QVBA 4E3TA 3LPOA 4IXXA 3S6DA 1WDDA 3ARWA 2QYGA 4CQ8A 1X6NA 5DFAA 2J7BA 3RX3A 3CXOA 3TYEA 4IMEA 1GONA 3G1SA 3SRKA 2PWUA 3BOXA 1A3HA 1KM1A 4Q3MA 1JYVA 3C2VA 1L0PA 1KFBA 1S38A 3MV01 1XYFA 1RQEA 3AYTA 2VL4A 3OYXA 1KBBA 3C0JA 3GFXA 4LJ3A 2QJIA 4S3JA 3TCSA 2A85A 3IK4A 1N8IA 2G4JA 4PTVA 5EMUA 4G5DA 1WUEA 4B5WA 2X30A 1LUCA 4MAZA 5LXXA 1ICPA 1Q6OA 3H70A 2R1PA 1B31A 1NTHA 4ORIA 4CNNA 1NF0A 2EF9A 5FEZA 1IIHA 2XINA 2J8TA 1G67A 1FKWA 1TQXA 4K6AA 2HS6A 1TV3A 3T42A 3F5KA 4HBKA 4LVGA 2C16A 2V3EA 2CLOA 2YKKA 1E6NA 2OZ0A 4C6PA 5CZ0A 3RHGA 3UJSA 5E0CA 4WZHA 1W1B1 2F61A 4HA4A 5HANA 5CG7A 1UC5A 2J47A 1MW1A 5DCDA 3BUVA 1TTQA 4JX6A 2J9YA 4AYSA 1XKJA 3VC5A 4AZCA 4ZOCA 1Y5WA 3SGGA 3NQBA 1V7AA 1S3HA 1ZENA 2VFGA 1XLJA 2Z0IA 5I0DA 3BK0A 3W28A 2NT1A 2V63A 3CQIA 1XLKA 1C93A 3UXKA 3KWXA 5CPMA 4LYKA 4H04A 4L6OA 1SFSA 2AOSA 3K13A 3WG6A 1QI2A 2UY5A 4Q8OA 4S23A 2F9RA 4XZMX 4BF5A 1NOWA 1ZY9A 3PZQA 3TTSA 1WBJA 1DWHM 1DJZA 3PK7A 1W9PA 2IQDA 4JTUA 2BX7A 1TJ0A 1HKVA 4ATDA 3SRDA 4DJEA 5IFPA 2UY3A 2WMJA 3ABOA 4YWIA 2AL1A 1TWSA 3BQ6A 2EPOA 1JUEA 3EBVA 2VDIA 1LWJA 3EPOA 3TDFA 4KW2A 3MUXA 4AZ7A 1EYWA 3GNXA 3SUSA 3LHTA 1KB3A 4KH2A 4G1KA 4BEQA 4JN8A 2H8XA 4JTEA 1EBHA 1KC7A 3MP4A 3LHVA 2PZ0A 2PPGA 1EX1A 1F05A 1FQ0A 4D9PA 5T9CE 3G1VA 1EOKA 1P4CA 3B8TA 1QNQA 3TROA 2R94A 2RUSA 1F3WA 3CMGA 1OD0A 5CZKA 2OKOA 2NVDA 5A6AA 1DWJM 4JYFA 3H24A 8A3HA 2WJDA 2B81A 2FMOA 3WF1A 4W8AA 4CU6A 3VOGA 2VCBA 4D8LA 3W00A 1HNYA 2Z4GA 3W7RA 1FCQA 3SM0A 1AL7A 1OFPA 1BKHA 4XIAA 3S2JA 3UCQA 3OLDA 1SO5A 3WQCA 1EYEA 2HQAA 3S6OA 4NZCA 2HBXA 4GGBA 4P8XA 4S2BA 3LDVA 3B3DA 1FWWA 3MWCA 3NDZA 2UY4A 1BXNA 4Q4RA 2C19A 1W32A 4OHQA 1AZ1A 1F07A 5ECUA 1OGSA 4NNBA 1ZRQA 2CKSA 4JDYA