5KMYA

Crystal structure of tryptophan synthase subunit alpha from legionella pneumophila str. paris
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
262
Chain Sequence
AMNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDPMAEGPVIQRAMERALAHSIHCDDVLNMVRQFRKTDTETPVILMGYLNPIEQYGYDLFAQQAVEAGADGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNFINQHANGYLYYVSLALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGAALINEIIEAYEAKKDPLQASGALLSSMRQAIDNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Crystal structure of tryptophan synthase subunit alpha from Legionella pneumophila str. Paris
rcsb
source organism Legionella pneumophila (strain paris)
molecule tags Lyase
total genus 83
structure length 262
sequence length 269
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5kmyA00
1F6KA 1ICQA 1H1ZA 4TX9A 3W85A 4ORIA 3TSMA 3AO0A 3VE7A 3GZ3A 1D9EA 2V30A 1M7OA 3M0ZA 4QNWA 5G4EA 5KZEA 3S5ZA 1G69A 2J9YA 3VNDA 3B0PA 1C9DA 2GVJA 3GXNA 2QCFA 3LTYA 3B8DA 5K3VA 4KFNA 3DFNA 2XN0A 4HSOA 3G3DA 3ZR4A 5CPOA 3EX4A 5KSWA 3P67A 1FXQA 4FX8A 3Q58A 5HINA 3WJZA 5DXXA 2ATSA 5AHFA 3GDKA 3S1VA 1MSSA 3G1DA 3TMQA 3N9RA 4FNQA 3S5NA 2A7NA 1IXOA 4X9SA 1TV5A 3F1QA 3NQAA 1ME8A 4M6PA 5AC8A 3ZWSA 1HTIA 3W2NA 1JCLA 3TK7A 4ALDA 1W5MA 4FXRA 1VZWA 3I68A 3W7HA 4MJZA 1FDZA 4I7UA 3LLFA 1KBIA 1KBJA 2YSWA 3IIZA 1ZJIA 3G1YA 1H61A 3LI1A 3L2IA 1Q6OA 3UWZA 4IUOA 5HWJA 1V7YA 1AW5A 1ME9A 1KM3A 3KVLA 3LHVA 3NM1A 1ME7A 1MO0A 5D04C 4LC8A 4O1CA 4RLIA 3FKKA 3EWUA 2G97A 4NXSA 1PHWA 5J5DA 3TFCA 4UXDA 4O18A 2ZRXA 1Q3NA 2D73A 3O16A 1RQBA 1RZMA 3U6WA 2YW4A 2OCZA 2Y63A 5F4XA 3G1SA 3S6DA 4ICNA 4E2DA 3JS3A 4UC5A 1JJKA 1VR6A 2CZDA 4JR5A 4WJEA 2CLEA 3B04A 1LBFA 1GT8A 1OFPA 3N14A 3R12A 1Q45A 2NZLA 2VKZG 1AK5A 2FQIA 3PSWA 4OT7A 1TQXA 5C5YA 1G7VA 3NPXA 3W2JA 4MOZA 5KZDA 1G4EA 3W7DA 5I3KA 4NX0A 3G1VA 1XUUA 3LERA 4Z1AA 2OT1A 4FX6M 4H6KA 3QZEA 1LOSA 3QSTA 1D3HA 3P80A 5BW6A 1I2QA 1ZENA 4XQ6A 3RF9A 4NVTA 3SW6A 5C2XA 1XI3A 2AQWA 3W9ZA 4PTNA 5LNSA 1IXNA 3P8JA 3ATZA 5U7SA 3RLUA 5DELA 3CIWA 3S1UA 1QR7A 5H91A 4LT9A 5T26A 4MZYA 3L66A 3LLDA 1CX9A 3QPYA 5CSSA 2EF9A 3NG3A 1SSDA 2ZFAA 2FLIA 3F03K 4ZZ9A 4JTKA 3P7YA 2QCCA 1ZAIA 4FNSA 4N6EA 1Q6LA 3LTSA 1VYPX 3C52A 1OFBA 1IIHA 1F2JA 3NQ2A 1K8ZA 1FXPA 4XWUA 3UZ5A 3G22A 1KTBA 5LHEA 1TYGA 4IOTA 4Q32A 5DXYA 1H51A 3IV3A 2ZBTA 3W7MA 3M6YA 3OEXA 4K8HA 5K7JA 4GRSA 3SR7A 1S5VA 3G0UA 1UASA 5DY3A 2QF7A 1W5NA 4I9AA 3W7CA 5EBUA 2PC4A 4JXCA 3R13A 2Y7FA 1GZGA 1W5PA 3MW7A 2E6AA 4IWWA 4RZ4A 3H54A 4P2VA 2Q3RA 1NF7A 4X3ZA 4J9JA 3BGGA 2Y7GA 3SI9A 3MBFA 2OZ0A 1AL8A 4CCEA 3GDLA 4Z1BA 4S1FA 3OVRA 2BTMA 4KFOA 3LI0A 3P60A 1JCXA 2R94A 3NQCA 3HGJA 5DBTA 1U83A 3SSJA 4N02A 4Y8FA 3T40A 4YMZA 1R2SA 1SFLA 2QUUA 2C14A 3GAKA 3KAOA 4UTWA 3W70A 3WJYA 4FEZA 6TIMA 2J9XA 3W7GA 1T96A 3W1NA 1R30A 2CLFA 1LROA 5LGXA 4NJIA 1XBYA 4JDYA 3GAYA 2J88A 5L6UA 1YXYA 4TO8A 4DF0A 1U5JA 2ZRVA 4UTUA 3W7JA 3OBKA 3TSBA 3W74A 5D30A 4EF9A 1O5XA 2OX1A 1BKSA 3IVUA 2TYSA 3LDVA 1OJXA 5C54A 2QCDB 1TPC1 4O17A 1X7FA 4NJKA 4WUIA 5FF7A 4QJ1A 4AF0B 1X6UA 2ZCGA 1OFDA 2TMDA 4IMFA 3L21A 4N2YA 4GC4A 1GTEA 3EB2A 3NDOA 1TPB1 2CLHA 3QM3A 1ZHAA 3PVFA 5D2XA 1VLIA 3THAA 2H3BA 1YDNA 2NUXA 2JKAA 4LU0A 4A2SA 4MLRA 3GDTA 1WA3A 5G1YA 1KM0A 4MY9A 2Q8LA 2VENA 2PCQA 3KVKA 2J6XA 3W1MA 4WZHA 4UTLA 3IIOA 2VFEA 3P62A 4JGDA 3C4UA 4K8EA 4S2BA 3B0VC 2VFDA 2QCHA 3NGJA 1OHLA 5BRBA 3RNDA 4O28A 4NNCA 5LKYA 1TTPA 3WK1A 2RDTA 1XBZA 3NR0A 4UR7A 2WKJA 1P0KA 4E0CA 3W22A 3WJSA 4GXMA 3H53A 2C16A 3LHUA 1DQXA 1KA9F 3P5ZA 3HJZA 5AC6A 1YPFA 4LW7A 4IQLA 3Q2DA 1W54A 3EXSA 3ATYA 4HNTA 2A21A 2YFOA 4O52A 3M41A 1IGSA 3NQ8A 2E77A 1IF2A 3SZ8A 5AHIA 4M19A 5KZMA 2NX1A 1EUNA 3DGRA 2YDAA 4PA8A 4AHPA 2XN1A 4Z0SA 5LNVA 2QJGA 3W7KA 1WBHA 3TE9A 3HPSA 3LCWA 1DJQA 4GUGA 1SQ7A 1C29A 1FQ0A 1TRDA 2HS8A 3O6CA 4MZ1A 1RVGA 3NO5A 1FDYA 4XBSA 4LS0A 1XUZA 5KINA 3KVJA 1MEHA 2Y62A 3SFKA 3UWUA 1W0MA 3TC6A 1DORA 5HR7A 2JKEA 3HQ1A 4ZQNA 4FXSA 1DL3A 3I6RA 4WY0F 2DZXA 3SIZA 4O14A 3VFLA 2P10A 3QEZA 1EP1A 3TW6A 4HT3A 1YDVA 5G5IA 1Z42A 2FPTA 3LCFA 5E0KA 3WK0A 4L4MA 3W1LA 1OVDA 1SW0A 1PV8A 1FWWA 1VCVA 3PG9A 4CNOA 1MEWA 1RPXA 1RV8A 1GG0A 1VHCA 3S5YA 4DF1A 2EGZA 1KM5A 2B7NA 3VE9A 5K4XA 1SZNA 1LTDA 4R53A 2A1YA 3D0CA 1OX5A 2ZZ4A 3N9SA 1THFD 4DBEA 3O6DA 4G1KA 4PC8A 1P4CA 4LVGA 3C6CA 4NUWA 1YTDA 3OHIA 3NXFA 1W56A 8TIMA 4O53A 2KZHA 2CLLA 5F2MA 1PCWA 1WV2A 2DJXA 2DP3A 3BO9A 4A22A 2RDWA 3FEMA 4UTMA 1HG3A 3QYQA 2Z0IA 3EX6A 4XUGA 3BLIA 4RZ6A 3V1PA 1J5TA 1S3HA 2ZA3A 3C2FA 1S5WA 3S5OA 4UFJA 5F1UA 5A5WA 1KM6A 3L0KA 2NV1A 1OYBA 5AYYA 4PL1A 4AWTA 3NL6A 1H7OA 4O57A 3U8GA 3IIXA 1Z41A 2P0OA 2CZFA 5KTLA 1QOQA 3E96A 1MEIA 3MO7A 5D05A 2NXIA 4GUIA 4UTJA 4O1AA 2G5WA 1TSIA 3C0JA 4OE7A 3TCEA 2A7RA 2O7QA 1OYAA 3WJXA 3EWWA 3SECA 4HN4A 1VH7A 3PBWA 4UFKA 2LLEA 2Y89A 2EHHA 3NPUA 4AH7A 5I3IA 4MY8A 1LRTA 3DU0A 1GWJA 3G8EA 4JN6A 2FDSA 3BLEA 3MP4A 2QAPA 4FHAA 4JTUA 2YCEA 4FF7A 4UFMA 2ISWA 1VPXA 4P61A 4TMBA 4W9TA 1OYCA 1UJPA 1K7FA 2RKXA 1GVFA 3E49A 5CZSA 2ZTJA 2E1DA 1D3GA 3UD6A 2CLIA 1GVOA 3PR2A 2V9DA 3QW4B 3W72A 3PAJA 4O4WA 3LRLA 4K37A 4BK9A 3OVQA 1I2OA 1JUKA 2NX9A 2I14A 1VYRA 2JKPA 1KFCA 3QJAA 2CZEA 3W7IA 3NNTA 3GKFA 3O06A 1OFAA 1OX4B 2YYTA 1LZOA 1XDMA 3IGUA 4RR4A 1R2TA 4DEFA 2WO5A 3G3MA 4M7SA 4KWVA 3FS2A 4O12A 1FWSA 2VFIA 4ZVJA 2ZTKA 2Z1BA 3A21A 3DFPA 2FIQA 4E38A 2J24A 4Y6GA 3PULA 2QKFA 2DZPA 5FF0A 1FY6A 3TU9A 3DENA 1KFJA 2WNNA 3L9CA 4EWND 4NXKA 4MYXA 1FCUA 1XBVA 3STFA 4LUIA 1O94A 4UUIA 4HKPA 1PVNA 3HG2A 1N7KA 5HWMA 4BR1A 1ZNNA 4GJ1A 1ONRA 1OFQA 5G1TA 3BVJA 4JD4A 3G1HA 4A29A 5IM51 3OG3A 3TXVA 3PB0A 5A8GA 3W84A 3E9AA 3EWYA 3TROA 3N34A 4QAIA 1AW2A 4NZFA 3UXAA 1EWDA 1ZFJA 3SGUA 4UTHA 4PODA 3NZ1A 5LGZA 5D2YA 1JQVA 5LNUA 2NWRA 3S0CA 1BWLA 2G95A 5J5RA 4LV9A 2HS6A 4RKAA 2ZZ2A 2EAWA 1FDJA 1L9WA 2Z2UA 2C15A 1AMKA 3EKLA 2FJKA 3W73A 2GJNA 4NQ1A 3USBA 5K4ZA 4AHOA 3R8RA 2H8XA 3LHTA 1VLWA 3NM3A 1BTMA 4MZ8A 3MP3A 5CZ0A 4RV8A 3MHUA 3TUUA 3GKAA 4IPIA 3G1XA 2B0MA 3C2VA 3DXIA 3W2UA 4UTWC 3CHVA 2VELA 3UWYA 5U4NA 5FEWA 1GPWA 1WXJA 4LVBA 1LBLA 4MYAA 3LOTA 5FI8A 1JRCA 1H50A 2C18A 3N2MA 1KFKA 1L6SA 1TPUA 1F05A 1SW7A 4GNJA 4O8RA 3NYZA 4XKYB 3NQGA 3PY2A 2QCNA 3STGA 3BG3A 5LSMA 3CTLA 3NQ7A 1QPQA 2B7PA 3HG3A 4MPQA 4UTTA 3DH7A 1LLZA 3UWQA 2HMCA 4JY9A 4B5NA 2QDHA 1TQJA 3MJYA 4UMAA 4O13A 3NZRA 5D33A 3LBCA 3BPWA 3P5YA 2A6LA 2V2HA 2GQAA 4CLMA 5HMSA 2CU0A 1H7PA 5DCEA 4Y90A 1KV8A 1KV5A 1LYXA 3TAOA 3ZFHA 2E6DA 2OJPA 2ZZ1A 3HPXA 4I7VA 3UQNA 3EWXA 3KX6A 4FO4A 5G2WA 1I2PA 3GR8A 1PHQA 2VOMA 4JTLA 4AWSA 3LM7A 3PS7A 3S42A 3O8AA 3MYOA 1EP2A 2GUUA 1KLZA 3BK0A 1TREA 4C1KA 3S9YA 2EPHA 3DFSA 1O60A 3N19B 2V81A 1EUAA 2OMAA 4N9CA 1HO4A 1K7EA 1K8YA 1TCDA 3DFQA 3W2KA 3THQA 1UUOA 4LOCA 3T4CA 2X30A 3ANYA 1DQWA 4JY8A 4BWLC 4AWUA 2I9EA 3W71A 3TQKA 1TPDA 2VC6A 3W1AA 2Y6ZA 1GYLA 3HB9A 3NPVA 2YYUA 2F7FA 5K9CA 1HFBA 3H55A 3W23A 4LNYA 1WOAA 3G1FA 4WQ6A 2BXVA 3I7RA 3E0IA 2PRMA 1OFEA 3HOJA 4TMCA 6ALDA 1EP3A 3BARA 3B4UA 2WJZA 3G1AA 3P84A 3M43A 1K3UA 1A53A 3A23A 1EPXA 5D37A 2NXGA 1CI1A 4AVFA 3GNNA 1LOLA 4FNUA 3WJWA 1KM2A 1O5KA 5TBOA 5ABTA 1SZGA 1UUMA 2J27A 3G24A 1VRDA 1R2RA 3FOKA 4I7WA 3B0UX 3PUEA 1NVMA 2WNZA 2V5BA 1HL2A 4CQ9A 5IBXA 3UY7A 3QPZA 2QJHA 5F4SA 4JIQA 4O1DA 4C1LA 3KRZA 4GUHA 4MVAA 3NQFA 3KRUA 1VCGA 3NL5A 3O07A 2RH9A 3M5XA 3QRHA 4XTIA 5AHNA 1T99A 2WV8A 4WY0B 1DOSA 1KLYA 1W8SA 4KWWA 3MHFA 4FNTA 3LRKA 1RR2A 5D03A 1NEYA 4QISA 1B57A 1JCYA 1MXSA 4QITA 2Y7EA 3NA8A 2TPSA 2ZA1A 3I7QA 4JX5A 1PS9A 2DJLA 3UWWA 4O1BA 4WXYA 4ADUA 1FCVA 1ZALA 4ZQMA 3QQ0A 1QDSA 4YXGA 1JVNA 2GOUA 2V0TA 2VFHA 1TMHA 3MMTA 3PC0A 2NV2A 2AAMA 2E09A 1TB3A 4HNNA 3UPWA 1XL9A 1O4UA 2AGKA 2ISSA 4X22A 2VFFA 3TX9A 4BI6A 1LP6A 1E51A 3PG8A 4YLWA 2QCEA 4O0KA 3PM6A 3R89A 1TRIA 3DHDA 3IRDA 1H7NA 4IX0A 4NT0A 5F2GA 2DZUA 2H8ZA 1FWNA 2DZSA 3NAVA 2HTMA 2QR6A 1GQNA 1IIGA 3OIXA 3LCLA 4IPJA 1FUYA 4MUZA 3O05A 4UMCA 5HWNA 5CZJA 4OV4A 3W76A 2V8ZA 2WNQA 5EL1A 4M7TA 3PSVA 3NQ6A 2E5BA 4LWWA 3MI2A 1DKWA 3CEPA 3T44A 4IMGA 4MIMA 5I3GA 1UCWA 5F4WA 3M5ZA 5LHFA 1ZY9A 1XC4A 2IQTA 2ZA2A 1AG1O 1LORA 1H1YA 3LX9A 3P74A 4JX4A 3PUDA 2W0UA 2CZ5A 1W3NA 4A2RA 2C0AA 3CLMA 1JUEA 5KITA 5FEPA 4ONVA 4JYDA 5DCBA 3HIJA 4UMBA 2ZZ7A 3NPWA 5CPLA 1FCBA 3LCGA 4AAJA 2BLEA 4AEOA 2CLKA 2ISVA 4WX2A 4HHPA 3PBYA 2QCDA 3P8IA 4JEQA 2QCLA 2YR1A 1KFBA 2A7PA 2FPYA 4MFDA 3T7VA 1QFEA 2A5HA 1BWKA 1H60A 1Y0EA 3FJ6A 1CW2A 2NXHA 3ZWTA 1JQXA 4H3DA 1NAL1 1SZEA 2WSYA 2E5DA 1W5QA 1JULA 2C1HA 1HO1A 3LXAA 4BI5A 4ZMGA 3V75A 5C55A 2A6NA 3LV5A 1QPRA 4ADTA 1N8FA 2J9ZA 1OF6A 4XTDA 3N73A 2RHGA 4GFSA 2C6QA 4M6QA 4DF2A 3IVTA 5AHMA 2ZRZA 3L0GA 4Q33A 1JUBA 1SO5A 5CG7A 3TNOA 3WK2A 1OFOA 3W86A 1KTNA 1JCNA 4NJGA 4XBKA 1EWEA 4GWEA 4DPPA 1OFRA 3KOFA 2QCMA 3WFAA 3TQVA 1M6JA 4AXKA 3U2OA 3I7SA 3HPZA 2YPIA 1SSGA 3CB8A 3LTPA 4YCPA 4IXHA 4AMAA 4O50A 4R34A 1XDLA 4EF8A 3CEUA 3BV4A 1W3TA 2R91A 4OBTA 4DBDA 4A21A 4L4LA 5DLCA 3QMSA 4AB4A 2O7SA 4DQWA 4NNAA 3HG4A 1OABA 5EPDA 3UXDA 2B4GA 3BW3A 4GE8A 1F7BA 5DN1A 3N2XA 2NUYA 2TRSA 4Z08A 1W5OA 3HF3A 3FJLA 2FB3A 2ZRYA 1WX0A 2I1OA 5TQLA 1VYSX 3LXCA 5F1VA 1SZFA 2BX7A 2NWSA 5D2TA 5D2VA 2VXNA 1B3OA 2PRHA 4FNRA 1LOQA 3P61A 3NQDA 2X1TA 4UIOA 5BNKA 3CIXA 3YPIA 5CPMA 2ABBA 4UTKA 4ZQOA 2DZVA 2F84A 3UWVA 3KXQA 2B7OA 4JIPA 1PL9A 4EOUA 1TPVA 3CC1A 2CWNA 4RX0A 4JTHA 4CQ8A 5F2IA 1K03A 1QNVA 3T55A 1TIMA 1NFBA 1O95A 3TXZA 4N9EA 2ZZ3A 4LS1A 5AYZA 5FEXA 1GVRA 4JTFA 4JICA 1XKYA 2W6RA 5K9DA 3JRKA 3R5EA 3IIVA 2ATMA 1MZHA 4U28A 4OU1A 1W31A 1VS1A 1T0OA 1ALDA 1TTJA 3P81A 1S5TA 4JX6A 4EIVA 1JCJA 3RU6A 4UTTC 1G67A 3T78A 1OF8A 3L5MA 3CT7A 2V2DA 1R46A 3PBUA 1WQ5A 3TV8A 3TW7A 1F6PA 1F5ZA 2Q8ZA 4ZQRA 3TDFA 1TO3A 2G96A 2Y88A 1F74A 3C3NA 3PWAA 3W1XA 3G18A 4RZ5A 2DZWA 3M7WA 5C6MA 3W07A 2FFCA 2VEKA 2P1FA 2ZZ6A 3QMTA 2QEZA 4FIRA 5HUOA 4TIMA 4PFMA 2V82A 1B4KA 3A24A 1TV7A 5CZTA 2X2GA 1J2WA 1KFEA 5I3HA 4KKXA 3GR7A 1YLVA 1GG1A 4UFIA 5EA9A 3OVPA 2WSRA 1H63A 1QPOA 3EXRA 5LNWA 3M16A 5HUPA 4ZL1A 3ABSA 3GX9A 4NX5A 3C8FA 4HPXA 3TH6A 3L68A 4HNUA 1P1XA 2PRLA 1B4EA 2VEPA 4K7VA 4O11A 3MYPA 5CKSA 2QAFA 4TU1A 1QPNA 5TIMA 4CCDA 1YPIA 3W2LA 1G6CA 1G4PA 4IMCA 2XFWA 3PBVA 4QQ3A 4M6VA 5L9FA 4RXFA 1JCMP 4IMEA 3LCXA 3RFAA 5K2ZA 3L67A 2VFGA 2BSLA 3QQ1A 1SUXA 1UBSA 4K7YA 3STEA 3HMJG 1WOBA 5G4WA 5D32A 1N55A 1IXQA 1DV7A 2ZYFA 1ADOA 3NL3A 3UPBA 5K9XA 3TKFA 2QUVA 1RD5A 3EXTA 3DZ1A 4GUJA 1OX4A 1VHNA 3EWZA 4HSNA 3GVGA 3HGRA 4QM1A 1W1ZA 2A2IA 4Y9AA 4JTIA 3IGXA 5IBXC 1TJPA 3W7QA 3W88A 1VJIA 4AHQA 3C2EA 3P82A 4LV4A 5BMWA 1EX5A 4RJEA 1JRBA 2WOQA 5LNRA 1V5XA 2WQPA 4RXGA 5AHLA 3Q94A 5AN7A 2GPTA 1TV8A 1L6WA 3DAQA 1TJRA 3B05A 4LY8A 1B9BA 4DELA 4JTJA 3Q37A 2RDUA 4QNEA 4O15A 1IXPA 2R14A 3QH2A 1ZAHA 3CPRA 2A4AA 2GVGA 2R8WA 3CM4A 3EEGA 3GXTA 3EWBX 4RK8A 3G0SA 3I65A 2YZRA 2WSQA 4JYFA 3O1NA 3DI0A 3LV6A 1GJPA 1SW3A 4UCGA 3MUXA 1SU5A 3DFOA 4LVFA 4MJMA 3TIMA 4DO4A 3IGSA 4ZQPA 1K02A 3DFTA 3DKLA 1YYAA 4HPJA 3LBMA 3TMLA 3W1TA 5FEZA 1EEPA 1YXCA 1TPEA 3GDMA 3LB0A 1G7UA 1WDWA 1GVSA 4X2RA 4FB7A 4OQVA 4D2JA 2A85A 1W3IA 4K38A 5H2ZA 4LVAA 2DORA 3RLVA 1YXDA 3E02A 2C19A 1L6YA 2ZDRA 5D38A 4E2BA 3IIPA 4XZ9A 5EKYA 1XXXA 3MWAA 4JYEA 4GBUA 5EMUA 1DHPA 2FPVA 3L65A 5D09A 4OGZA 1GYNA 1FCQA 3IEBA 4XKYA 5AYXA 3NL2A 1NF0A 3W1UA 3VI2A 1YTKA 4O16A 4R7JA 4O19A 5I3JA 3MP5A 1A5SA 1GOXA 2ZQ0A 1A5AA 4S2CA 1F76A 5EY5A 2ZRUA 3DI1A 5AFDA 1G4TA 4IGHA 4K6AA 5FF2A 2VEIA 3L5AA 2YFNA 3A5FA 1SO6A 5I3FA 4UNLA 3B03A 4LTSA 1X1ZA 3VCRA 5BMXA 1H7RA 1OX6A 1QCWA 1A5BA 3TSDA 1I2NA 1NSJA 2TSYA 1SO3A 3L0NA 1R47A 3QFEA 4EVZA 5HNRA 3ELFA 3IVSA 4H4IA 3C56A 1XM3A 2E68A 4O4VA 4A3UA 1Z48A 3O63A 4K36A 1DJNA 2CLOA 3SJ3A 5AHEA 3TR2A 2NUWA 1TPFA 3N3MA 1EA0A 3W7EA 1FWTA 2E6FA 3CWOX 1LM1A 1P0NA 3HBLA 4JTSA 5SWUA 1YADA 3S8HA 4IX2A 1VCFA 2JGQA 4UFHA 1PCKA 3BG9A 5DY2A 3GK0A 1SFJA 1W37A 5FESA 3FFSA 4O0ZA 1M7PA 2QCGA 2B7QA 5G2IA 1H7XA 3NQMA 4POCA 3DHFA 3O6YX 1XFBA 2V5LA 2QDGA 3KRSA 3DBPA 5BOOA 3FLUA 2Z6IA 2ZZ5A 5DCDA 4ORMA 2QUTA 2NLIA 3FYOA 4U4MA 3ZS4A 2Y70A 3QMRA 3OA3A 1QOPA 1QAPA 3GXPA 2W79A 2JK2A 1LDCA 3CQ0A 4YWIA 4CCCA 4BI7A 4DPQA 2QJIA 1KFLA 4YL2A 5AB3A 4JDBA 4NJHA 1VQTA 1XBXA 1LRQA 1UB3A 4QSHA 4UR8A 2GQ8A 1L2UA 2EKCA 4TR9A 2FB2A 3GLCA 4JTEA 2VEMA 4K39A 1WAUA 3UNDA 2UV8G 5HJLA 4ADSA 3GDRA 2V2CA 4LUJA 1G4SA 1FWRA 3M1ZA 3O15A 5CGQA 1J4EA 4FX7A 3TJXA 5FF4A 2RFGA 2ABAA 4WY0A 4MY1A 4ZQCA 1AL7A 3HO8A 3GB6A 1WYIA 1K8XA 4HNVA 3DKJA 1TTIA 2E5CA 2YW3A 5AOUA 3MI3A 5AC7A 1Q6QA 4OHQA 4O54A 4JS3A 3INPA 4FNPA 1FX6A 3W7LA 3B06A 4N9BA 3G0XA 3HGSA 1KM4A 4OV9A 3NEVA 1GEQA 1TTQA 5GVJA 1H7WA 4N9DA 1QO2A 4BF9A 4NU7A 3KVMA 4AF0A 1WBJA 1X1OA 3MHGA 3UY8A 3FIGA 3W7RA 4PEKA 5F2LA 2X1UA 3C61A 4OWGA 1I4NA 2A0NA 2DZTA 1RQHA 1KW1A 2ALDA 4DO5A 4NZJA 4FIQA 2PE4A 4BWLA 3W3OA 3FKRA 3JR2A 3R2GA 3F4NA 3W83A 4JTTA 4MLJA 4MFEA 4LS2A 3EX1A 3TC7A 3W1RA 4LRTA 1P5BA 4N4PA 3CWNA 3QF0A 2X1RA 1F73A 5E1QA 5LZLA 3RK8A 1LBMA 2WPBA 1ICSA 3GIYA 2X16A 3EX2A 3KFTA 1C8VA 4Z1DA 3CU2A 3W7NA 4Q4KA 4O10A 3AJXA 4WOZA 3FA5A 4UTIA 3HGOA 4DO6A 4JNMA 2PURA 1QWGA 1SR9A 2C13A 2X1SA 2YGYA 4UFLA 4MKNA 5MHBA 4WXZA 1EIXA 1ZAJA 4IJBA 4Z1CA 1HUVA 3W75A 4GUFA 4CNPA 3GYEA 1VGAA 3KHJA 1A5CA 3F4WA 3G8RA 2GJLA 2CFFA 1SPQA 3LHWA 5HULA 3TA6A 2H6RA 3M9YA 4UNKA 3MBDA 3A9IA 2YX0A 3GNDA 3M47A 4DXVA 3LHZA 5D2WA 1YTEA 3L5LA 2ZRWA 1TPWA 2BWGA 1DBTA 1FBAA 3K30A 1PE1A 4LC6A 3NQVA 3LHYA 3W1PA 1XCFA 3QW3A 5G2HA 3FYPA 3WK3A 1VC4A 2E6YA 3PB2A 3S1XA 1YDOA 1ZCOA 4NJJA 2XN2A 3W6YA 1OG0A 1QMLA 5CSRA 4YCOA 3NOEA 1I2RA 3BW2A 3ABRA 5CPNA 2H3DA 1QO5A 1AW1A 3ABOA 5D02A 1JR1A 1LCOA 1Z44A 5DBUA 2OT0A 2GVLA 3PUOA 1H5YA 1TPH1 4CQAA 5E93A 3SGZA 3HG5A 3LCIA 4Z0JA 3W1QA 4LRSA 3ABQA 3BGJA 3NVTA 1KM1A 1I45A 2HSAA 1BEUA 3EX3A 2NX3A 4PCFA 3UZJA 4QIUA 3RMJA 3W7OA 3LXBA 5EYWA 5KMYA 3C2OA 1RQEA 3PF3A 2YXGA 3TFXA 5HR6A 2Q3OA 5FF3A 2DU2A 2CLMA 4LVDA 3STCA 3E12A 4CNNA 1LRNA 1A50A 1OK6A 1KTCA 3SY5A 3C2RA 2H90A 4M5PA 1ICPA 4N6FA 3QC3A 4RCXA 2BZNA 2JGYA 2Y61A 1SO4A 3QSRA 3A5VA 4BFAA 1DVJA 3EKZA 3MI6A 1EB3A 3VKJA 3BG5A 3M44A 2GQ9A 4R33A 1LLWA 1K7XA 5HQEA 3W7PA 3TQ0A 1OK4A 3S1WA 3W87A 4PL2A 2Y85A 4WOQA 1Q6RA 3W2MA 4IMDA 3TAKA 7TIMA 1GTHA 1GVQA 1X8FA 1PIIA 3LRMA 3LGEA 4PH6A 2Z6JA 3M5VA 2FTPA 3UYCA 4HIBA 4WD0A 2C3ZA 3LCHA 4KFPA 1I8JA 4Y96A 3BLFA 2CW6A 3A22A 4N4QA 1T8XA 4JTGA 1ML1A 3NQEA 2JBMA 2Y7DA 3TJLA 4IXXA 1M5WA 4NNBA 1H62A 4ML9A 3BW4A 3M5YA
chains in the Genus database with same CATH superfamily
1UKSA 3UA3A 4AWEA 3UJSA 1F6KA 4C6DA 3KL5A 3S5ZA 3BANA 2PTWA 1C9DA 2QUNA 3LTYA 3B8DA 5K3VA 2CETA 3KW3A 3VGHA 3ZR4A 5FSEC 4CD4A 5FL1A 3EX4A 2VZVA 4HPHA 3PZGA 2R1NA 3Q58A 3R0UA 2EJ1A 4ROQA 1NQKA 3BOFA 3G1DA 5LIXX 3TMQA 4JTAA 4UTFA 3N9RA 3S5NA 7A3HA 5BU9A 5KEZA 2PEVA 1DXIA 3VD7A 4M6PA 3M0YA 1HTIA 5A2AA 2FYMA 1E9ZB 3KOXA 1VZWA 4NF7A 1REQB 5A8PA 4MJZA 4B9YA 4F2UA 4I7UA 3CUHA 4LEFA 2XVGA 5C0QA 1ZRQA 4IUOA 1DJYA 3ORWA 1AA1B 1AW5A 2YXXA 2QV5A 3LHVA 4J3XA 1W1B1 1MO0A 4LC8A 1W91A 2Q01A 6ENLA 4RLIA 3DG6A 5B7ZA 5A6LA 1CBGA 4RV3A 4JFTA 4O18A 2ZRXA 5F7UA 4XV0A 4BS0A 3UZZA 2F61A 3OLDA 4TTUA 4FOJA 3JS3A 4RNJA 4HBKA 2XVPA 4JR5A 2E8ZA 3ZJ6A 3V1HA 3UNTA 4QG8A 4WJEA 3FJNA 4WDWA 3B04A 1XGEA 3AXIA 4DBUA 1OFPA 3R12A 2NZLA 5FAJA 4OT7A 1TQXA 1JF5A 3U2CA 2YCJA 3NPXA 4MPKA 1G4EA 3T4WA 3CUFA 1XRFA 2OGYA 3LERA 3GXIA 2OT1A 2O4MA 3TNBA 5CCZA 4MB5A 3S9IA 3KWSA 4YTUA 5C2XA 1XI3A 3H7RA 2PS2A 1M68A 4PGLA 4BQ3A 4V33A 5LNSA 1CLXA 1OGGA 5DELA 1S2VA 1Z32X 1QW8A 3S1UA 3UG3A 4LT9A 4GKLA 4MZYA 3POCA 1OQFA 4JTQA 2E0PA 3QBUA 1CX9A 5CSSA 3NG3A 1FA2A 4QHRA 5GQBA 2YBVA 2FLIA 4ZZ9A 2QCCA 1NIUA 4FNSA 4CD7A 5A6TC 3KCOA 3ZIZA 1IIHA 3CBWA 1F2JA 4E4PA 3G22A 1KTBA 5HDRA 4R85A 1C8YA 1TWSA 1H51A 4M3PA 4A8NA 4QE1A 1R9ZA 3M6YA 4GNVA 5K7JA 3RX2A 4HK6A 4GRSA 2VDGA 3QKZA 1BKHA 1UASA 4B15A 1LF1A 2G3JA 2JEQA 2DZBA 3ARZA 3GQYA 4ZEPA 1W1VA 4C7GA 1UR2A 4GZEA 3ABXA 3ARWA 1R9XA 5LA1A 3MVIA 2HEJA 4PRTA 2I9UA 4B9ZA 2QXWA 1NF7A 2XGIA 1SJCA 4XBJA 1YIXA 5HQLA 3SI9A 1EFZA 1JDFA 2BP1A 3GDLA 4Z1BA 4S1FA 4GO9A 3P60A 1CGUA 1ZJHA 1U83A 4PCNA 3SSJA 4YMZA 3DGBA 3FY1A 2QUUA 2OLAA 3CZGA 3UG5A 5E9AA 3W7GA 4PUEA 3HU7A 1T96A 3M0XA 3W1NA 2CLFA 5KETA 1LROA 1VEOA 5DO8A 4ZGYA 1OCBA 3GG8A 4Q7NA 3GAYA 1UZHA 3E6EA 5AZ1A 2Z4GA 3W7JA 3GVQA 4CNTA 4GNKB 3SDOA 3LDVA 5C54A 1TPC1 4O17A 5FF7A 3WF1A 1X6UA 3S2MA 2PDQA 2FH8A 3FX4A 4NAEB 2QDDA 1T7LA 3AI0A 5BOEA 1UOZA 3OGVA 4Q8VA 5A6KA 3T2PA 3TR9A 1BRLB 4A3YA 3BJTA 1EOKA 1TPB1 3UJEA 1ZHAA 3PVFA 3SUTA 4FPSA 3C0QA 1FH9A 1R3RA 1VLIA 4AIUA 3KUMA 4B3KA 3R8GA 4Q4MA 3PNUA 1KM0A 4LUTA 2OWWA 5T8GA 1RXOB 2E8YA 2PCQA 2GGEA 3ITOA 3IIOA 2VFEA 3P62A 4GJIA 1WUEA 5HMFA 2D22A 4ML4A 3A9BA 3NGJA 5BRBA 1EZ2A 3LNPA 4LUSB 1Q66A 1KBLA 1BHGA 4G8TA 4HCLA 1MUWA 1D7KA 4RUBA 1K6AA 3ARQA 3GG1A 1P0KA 3WJSA 2PDXA 2C16A 2Y1HA 1AFSA 3VGEA 3VGFA 1DQXA 1KA9F 3JZUA 4C6FA 2OLSA 1W54A 3IJDA 1IGSA 3N3TA 3ITTA 5I02A 2Q02A 4Q8MA 2XN1A 4LXFA 5LNVA 2QJGA 3W7KA 1WBHA 4LANA 3OZPA 1C29A 4GJJA 5A95A 2QULA 4IF2A 1FDYA 4PB5A 4JEJA 3VIOA 1TG7A 3SFKA 1EJ7L 3IUDA 3TC6A 5HR7A 4ZQNA 3I6RA 4WY0F 1EP1A 3TW6A 4HT3A 4F0MA 3RPDA 2Z29A 5E0KA 3WK0A 4L4MA 3W1LA 4JHZA 3T0AA 1HKJA 1OVDA 4CNSA 1KBBA 4CNOA 3RYSA 5CSYA 1VBHA 4DF1A 3VO0A 2R24A 5D9NA 2EGZA 2AMXA 3ZR5A 3HPAA 2B7NA 3VE9A 1SZNA 2PDJA 1OX5A 4XKMA 4I9MA 1R7AA 3KBNA 3EWCA 1THFD 3EDJA 4PC8A 1XF0A 3OHIA 3VTRA 2EBNA 4JBRA 3H70A 4XZHA 1HVXA 3MQTA 3NXFA 1Y8BA 3WH5A 1I1XA 8TIMA 1HT6A 7ODCA 1RBOB 1PCWA 2R1LA 2Q09A 4A22A 2RDWA 4YVVA 4PTXA 2XINA 1EOMA 3SM0A 2DDXA 3QYQA 4Z2KA 4JIEA 1V3KA 3EX6A 1YW1A 1SJAA 1BAGA 4M1BA 4RZ6A 1J5TA 5HNTA 3TC3A 3P0XA 4PRWA 1TA3B 1PKLA 5A5WA 2ZWYA 4NRSA 1WNOA 1HIZA 5AYYA 4PL1A 1BGAA 4GO8A 4O57A 3IIXA 1Z41A 1I0BA 4J35A 2BOGX 3E96A 4GC3A 4PTDA 3ECQA 5D05A 2G3MA 3E2SA 4WVXA 3K1GA 1ISWA 3D46A 2YCLA 2A7RA 1DJHA 1AH3A 2LLEA 1CDGA 4C6CA 1HKIA 1GWJA 3CMGA 1J0HA 3CV7A 1UKQA 5JMUA 2ISWA 1V6WA 1UJPA 1K7FA 1GVFA 2BNJA 5CZSA 1UZ1A 2E1DA 1E4MM 2ZTJA 4J3WA 2CHOA 3T0DA 4A3RA 3PR2A 3W72A 3IJ6A 5DT5A 4E5TA 3B8VA 3OVQA 3VIFA 2I14A 1VYRA 1KFCA 3QJAA 1BYDA 3NNTA 1WDRA 1D3CA 1W9DM 1AODA 3IGUA 1UZDA 2YDSA 1R2TA 2WO5A 4LBSA 5T91A 2WZEA 4WF7A 1EDGA 3TLQA 1FWSA 5B80A 3Q67A 4US6A 3DFPA 4E38A 4PSRA 4JZ5A 4Y6GA 3PULA 2PWHA 4PMQA 1KFJA 2WNNA 3DECA 1KKOA 3L9CA 4GI9A 2BMBA 3STFA 3NZPA 4DJDC 4YYCA 3S46A 4LUIA 1XQKA 4HKPA 1JEZA 1C8QA 1ONRA 3PB0A 5A8GA 2PDKA 4MB4A 3T0CA 4GH1A 4Z2JA 4NZFA 2CKRA 1EO5A 1ZFJA 2ZX5A 2PLKA 4PODA 5JU6A 3STPA 5LGZA 5D2YA 4A8IA 2NWRA 3S0CA 4GLEA 1RAKA 2HS6A 2PDHA 4V28A 2YA1A 1UZ4A 2EAWA 1X96A 3CUJA 4GK8A 3EKLA 1AMKA 1E0VA 1E6NA 2FJKA 5M1TA 1OINA 2QGYA 3MP3A 4RV8A 3FW6A 4OOZA 3GKAA 3G1XA 5U4NA 4LAKA 3VCNA 1GPWA 4LVBA 3L4XA 1OGBA 1OG6A 3PJWA 1FWEC 1KRMA 4JTDA 3NYZA 2VZTA 1W9PA 1OC6A 1M9HA 3OOQA 4WSJA 4PCTA 4J3VA 1XYMA 2OYKA 3WSUA 1UA3A 1XDJA 3OP2A 3U5YA 3MJYA 4UMAA 4JNZA 3BPWA 4AG0A 1A49A 3BOLA 2J8TA 2V2HA 2UY4A 5HMSA 5EMLA 4AD4A 4M0XA 1AUSL 1KV5A 3ZFHA 2GGIA 5HPOA 1I2PA 3NCOA 2W5FA 3RCNA 4JTLA 1BYCA 2FVLA 3FSUA 1CB7B 3AU2A 1B2YA 5CC7A 1W1YA 2GUUA 3S83A 2HBVA 3S9YA 2HNHA 1E6PA 2EPHA 4XK2A 3GU9A 3QYSA 4GD0A 4IIGA 4CCZA 4H9ZA 2ZWZA 3SUWA 3TTQA 1K7EA 1V6TA 3NURA 1A3XA 1GKRA 1TCDA 3EAUA 5A8MA 3THQA 4LOCA 1MUCA 4GQ0A 3D6NA 3ANYA 3T81A 3PZVA 4AWUA 2I9EA 3GXMA 3W1AA 4N0RA 4IGNA 4OFCA 2P76A 3H55A 2PDGA 3W23A 5TF0A 1L0PA 3WBEA 3I6TA 4WQ6A 1T5AA 3E0IA 3BAIA 4MNLA 1E4NA 1XLAA 3KS5A 1OIFA 3B4UA 1UW9A 3BSGA 2X40A 3G1AA 4C6JA 4DO7A 3M43A 3UWEA 4Z1YA 1CI1A 1QK0A 3QV7A 1LOLA 4FNUA 4N7QA 1KM2A 1EJSC 1O5KA 2RJHA 4D6HA 2Y0FA 1IZJA 1VRDA 2C1IA 1OCNA 3MUZ1 4YN5A 4AZCA 4I7WA 3MTWA 1Q2SA 4GYJA 1B54A 2V5BA 2HROA 3W24A 3QPZA 4U3CA 5F4SA 4JIQA 4DLMA 4GUHA 3VYLA 5A6BD 3NL5A 2X7WA 3M5XA 5DT7A 1VBGA 2WQDA 2TODA 3D3FA 2WNWA 2WV8A 4WY0B 1PX8A 4KWWA 1W8SA 5AHNA 3L4TA 4QTGA 3MHFA 3DFHA 5D03A 4QISA 1JCYA 4Y2WA 5J04A 3WLQA 4H9XA 2TPSA 3ZT7A 3WNMA 5HMDA 3I7QA 4JX5A 1CIUA 4X0NA 4O1BA 1ZALA 4ZQMA 5EMKA 1RCOB 2XIIA 1CXFA 2ZIDA 3PC0A 3GSMA 1TB3A 2CXEA 3FXGA 1WE5A 1XL9A 1O4UA 1ZBKA 2EG6A 1V51A 4O0KA 1LWJA 4EPKA 1K8CA 4AZ7A 2ZUUA 4Q6XA 3DHDA 2CCRA 4NT0A 3KBMA 4IX0A 4FK9A 1FWNA 1J0JA 2DZSA 2IPJA 4ZB2A 1IIGA 2WWDA 4REQB 4IPJA 3SRDA 3O05A 3SUUA 1D2KA 4M7TA 4CVUA 1J93A 2E5BA 3HV8A 1YEYA 5F4WA 3MWCA 2ZA2A 1XC4A 1LORA 2F2KA 2DIJA 3G6LA 3RLHA 1ITXA 1VEMA 3BQ6A 4JCMA 2I17A 4ZXOA 4A2RA 1JUEA 2FGLA 5FJRA 4DJFC 5FEPA 4JYDA 4GQQA 2ZZ7A 3WBYA 1WDPA 4WX2A 1GHRA 2D0FA 3P8IA 1KFBA 5JVLA 3OG2A 4NAEA 2A5HA 3QV9A 3ZSSA 4S3AA 7CGTA 3FJ6A 1BRLA 1JQXA 1NAL1 1JULA 1W9VA 1X6NA 2OWXA 5C7VA 2A6NA 3XISA 1QPRA 5IHRA 3ZXWA 3N73A 2OZ8A 3FHQA 4M6QA 1EBGA 4Q33A 1JUBA 4KBXA 5CG7A 1GVYA 3VDAA 2PBGA 4LUSA 1NELA 1XGZA 4P7QA 5JH2A 4L6DA 1KTNA 4NJGA 4XBKA 3GC5A 3KOFA 1QI5A 1W3JA 2QCMA 3I3EA 4PMNA 4F79A 2YPIA 5A3HA 1U1HA 4GVGA 2WZTA 3RUBL 3S9ZA 3BV4A 3KBWA 1MQPA 2R91A 2DVXA 4LCRA 3WMSA 2JE8A 4L4LA 1C7SA 3N6HA 4RW3A 3WLKX 2XIJA 4JN7A 5EPDA 1TMQA 6TAAA 1PAMA 1J5SA 3FJLA 1WX0A 3AMGA 2NQHA 5C9UA 3IV8A 2I1OA 2C91A 4P8XA 4I9JA 5E09A 1VYSX 4KWUA 3KDOA 3LXCA 4A3QA 1SZFA 3AALA 3VD4A 5D2VA 3CV6A 4PULA 2SFPA 1GUVA 4FNRA 4U3AA 4MAZA 2X1TA 4UIOA 8A3HA 1F4HA 2WANA 3CIXA 4HK5A 2ACRA 5CPMA 2ABBA 4Z2IA 3IGHX 1K4HA 1FHLA 4UTKA 1XR2A 5A8QA 1TJ1A 1Z9AA 3IS4A 4JIPA 1PL9A 4EOUA 2E3ZA 2QUMA 3S2NA 1NWUA 4JTHA 3AHYA 3MUIA 1VJSA 3II1A 1ONWA 2F6KA 4IFKB 1K03A 1XLHA 4ZOCA 1FH7A 3D47A 1D8CA 1V6XA 2PWDA 1O95A 3VAVA 4ICCX 2ZZ3A 5AYZA 1GVRA 3RILA 3WYZA 4R27A 1XKYA 5HNNA 4H2CA 1W31A 1TTJA 3P81A 1CPUA 1BF6A 3MUY1 3GNRA 2BBFA 1UQZA 1NDZA 2AL2B 1OF8A 4RDZA 3BLOA 3ZLFA 3PBUA 1WQ5A 4JPGA 3FYYA 3EMQA 1KCXA 3MPGA 1YX1A 1UC5A 2WCGA 2XFRA 2Z28A 4ZQRA 2OO0A 4MSSA 3MJMA 3W1XA 4WIWA 4HU8A 1QUMA 4RZ5A 1TR1A 3QGAC 3PJUA 3GDBA 5ABGA 2BV9A 3VNKA 4YHGA 3UXKA 3QMTA 3WF2A 2GOKA 4S3KA 4GIEA 3A24A 3H2AA 4L9YA 3AMKA 1RALA 4YNGA 4W5ZA 1RPKA 4P7OA 4KKXA 1WZAA 1J6OA 4M80A 1YMYA 1ISZA 5EA9A 4FS9A 1L8PA 1QPOA 1B3ZA 4JQ3A 4ZL1A 3ABSA 1H11A 1QT1A 1EDQA 3AHXA 5GNZA 3VNYA 3DYPA 3LQGA 2VEPA 2R1KA 2XWDA 3HQNA 1WZLA 1TJ0A 1EO7A 1WKYA 3QHMA 2X0HA 1WZMA 8RUCA 1TR9A 3W2LA 3CV1A 1JPDX 1UJQA 4P7RA 3NSNA 1O66A 3UR2A 3WLNA 4M6VA 4RXFA 3WD2A 3L67A 3N25A 3NGFA 4LX4A 3S6TA 1GJUA 1SUXA 4HNCA 2I5IA 3HMJG 1WOBA 1XYCA 5G4WA 1RBAA 3UCCA 1MXGA 1N55A 1EZWA 3VM7A 2CC0A 3DC0A 4WK9A 3EXTA 4EKJA 2OODA 3LGDA 2WVSA 1PZ2A 1P6BA 3W7QA 1EDTA 3IK2A 3DIPA 3P82A 1C8XA 4RJEA 4H04A 2WOQA 3TA9A 2WQPA 3Q94A 5AN7A 3DAQA 1IR2A 3F5JA 1GQLA 1B9BA 2R14A 3QH2A 4EE9A 4QDMA 3GZAA 3EEGA 3GXTA 3EWBX 3DESA 2YZRA 1EC8A 2FZ9A 3RR1A 3WMCA 3M46A 3LV6A 2OFJA 2QHAA 5CBJA 3MUXA 2DEPA 1GKQA 1SU5A 1Q63A 2Y5EA 3DFOA 4LVFA 4DO4A 1IWBA 4F2TA 3TZNA 3DKLA 3LBMA 3TMLA 5JH1A 1EEPA 3LB0A 3QOKA 4ASTA 4MTVA 3VGBA 2VVSA 1US0A 3TJIA 1DJGA 4OQVA 4XD6A 3K13A 4JNYA 5H2ZA 1M65A 2FZMA 2ZE0A 3WD4A 1RJPA 1A4LA 4LYKA 1XIEA 2X7VA 5EBAA 2VX4A 3ICJA 5EMJA 1UQYA 1EH9A 1UKTA 3L65A 3H7VA 1CGYA 1XJBA 4P8VA 1H2JA 1GYNA 2W3ZA 5GNYA 3IEBA 1S1PA 1Y5XA 4UQ9A 4Z2HA 6XIMA 2XGZA 4O16A 4R7JA 4O19A 4HNLA 4HMNA 5CPQA 3MP5A 4D6FA 1A5AA 1F76A 5C2CA 1BD0A 2ZRUA 5AFDA 1IHIA 4IGHA 4K6AA 3L5AA 5M03A 8CGTA 6CGTA 3WEOA 1U33A 1CXLA 1SO6A 1XW8A 1EJTC 3CUGA 3A47A 4IIEA 1QCWA 2PU1A 2YOCA 1SFSA 2ZX8A 4ATWA 1HP5A 2Z1WA 1OT1A 1A5LC 3OZYA 2PZ0A 1RBLA 1R47A 4EVZA 2X2YA 3P14A 1MYRA 4O4VA 2EJAA 4K3ZA 4B5VA 2NQZA 5HPCA 2Z2AA 1TPFA 4Q3MA 3VZYA 1VP5A 5EGRA 1B3VA 3LZ5A 2E6FA 1QK2A 1LM1A 1P0NA 1K1DA 3ZO9A 1KCLA 3AYTA 3MCNA 4UFHA 1PCKA 5DY2A 1EPVA 3T8QA 4QXIA 1GONA 3VGGA 3DYOA 2O9RA 4KCVA 3T9PA 4A05A 2QDGA 3KRSA 3DBPA 3TP4A 4CEXC 3FLUA 4DZIA 5BOOA 5C9WA 4DVOA 1HF6A 4R7WA 2QJJA 1PX4A 2NLIA 3FYOA 2MUCA 3ZS4A 2Y70A 1QAPA 1C9WA 4G2DA 3A4JA 1X38A 4CCCA 1R85A 1EQCA 4BI7A 4DPQA 5AB3A 4NJHA 1NQ6A 1UB3A 2CNCA 1UD4A 1G94A 3NJ3A 2EKCA 1UMLA 4JTEA 1NY1A 4K39A 2V3GA 1LUCB 3EKGA 3VGDA 3GW0A 4UNIA 1G4SA 4UWMA 2OELA 1MW1A 1XLCA 2GJXB 3OYXA 1JPIA 2VX7A 3QC0A 4FX7A 5FF4A 3B9EA 2XWEA 4WY0A 2BY0A 4MY1A 3HO8A 4A35A 4C91A 4V15A 1K8XA 3QGVA 5ABEA 1VFUA 3DKJA 1Q6QA 2XH7A 2XU2A 1XC6A 1UR9A 1SYTA 3G0XA 1KM4A 1GEQA 2YB1A 4N9DA 1QO2A 4AF0A 1X1OA 5F2LA 1N8IA 3R11A 3QR0A 4ZOAA 4AIOA 3I6EA 3KTXA 1K9TA 3WQFA 3BCJA 1TV2A 4DO5A 1K4GA 5LIYX 1DTNA 3W3OA 5CGTA 3TTSA 1RLCL 3JR2A 4QG9A 1HL8A 4REQA 4QJ4B 4OUEA 3TC7A 2YL6A 4PB4A 3TYDA 4PMDA 4DJEC 1E71M 2XIBA 9RUBA 3EX2A 3KFTA 2QDEA 4Z1DA 2PCEA 3VCCA 4KEUA 4RDWA 8XIAA 3AJXA 2V3EA 5DEZA 3FA5A 3AJ7A 4NSBA 4KRUA 5AKQA 3CAQA 1BXNA 2HE8A 1QWGA 1SR9A 4QCFA 2DVTA 4UFLA 1EIXA 4NG3A 2JALA 1POJA 3CPUA 2YIHA 2FTWA 3AIWA 3F4WA 5HULA 3LHWA 4IHCA 3TA6A 2QMKA 2DQXA 3M47A 5DFAA 2DV0A 3GWQA 4HA0A 2OLHA 2VGGA 4DWDA 2WMJA 1FBAA 4U10A 3K30A 1PE1A 5C7HA 1QRQA 3NQVA 1XLJA 3QW3A 3EA3A 5G2HA 2DSUA 1VC4A 3PB2A 1W2PA 5A2CA 4QAWA 3W6YA 4Z2LA 3S1GA 2ZVRA 3PBGA 4ERAA 1JZ5A 3S3GA 1EHAA 3ABRA 3OGRA 3ZOAA 3M0JA 1AW1A 1JR1A 3WLLA 1E9LA 1Z44A 2GVLA 3PUOA 4GZ7A 1K6WA 4CQAA 3CHCA 3EDKA 1CWYA 1LL6A 4MKVA 2HSAA 2DT3A 2I57A 5KZ6A 5KMYA 3M0VA 3OODA 2DT0A 5HR6A 2AQVA 3STCA 1UH3A 4G7EB 4I6KA 3SY5A 4IFRA 4N6FA 4S3EA 2FFIA 1SO4A 2DH2A 4BFAA 3EKZA 3VKJA 4DZAA 2DT1A 3ZLHA 3M44A 4QSFA 4DJFA 1YNYA 4R33A 1AD1A 1FWHC 3RN6A 3GTHA 4PCSA 3TN3A 3W87A 3GH5A 2J4GA 4D6IA 1GVQA 1X8FA 3LRMA 3G6MA 1E73M 3N12A 2A3EA 2Z6JA 2FTPA 5BZAA 1PTDA 1KWKA 4J3ZA 2FVMA 3TVAA 6REQB 2CW6A 1RLDA 1T8XA 5HMEA 3RRXA 3EMZA 4I90A 3IJLA 3UF9A 4L1XA 2Y7DA 1A3HA 3WFLA 3PWAA 2UZ9A 5FKYA 1EXPA 1ICQA 2OOGA 4TX9A 2CHRA 3W85A 4F2BA 1IV8A 1XH2A 2V30A 2GJRA 5LA2A 2O0TA 3VNDA 3B0PA 3SGGA 1PWMA 2XH0A 3RPMA 3AHTA 2XN0A 1DE5A 4HSOA 4E8GA 2IPWA 4PUNA 2AL2A 1VPYA 1IE7C 4FX8A 4DUXA 3ZM8A 4MF4A 4LGXA 1OZQA 1QI2A 4PMXA 2PDBA 4C6PA 5DXXA 3VD3A 1SGJA 3AIBA 3GHUA 3GDKA 3VZXA 4NI8A 4FNQA 4YTQA 1EYEA 1XQLA 1L2QA 4X9SA 1TV5A 4DNHA 1ME8A 3FDGA 3ZWSA 1GZJA 3W2NA 3N4FA 1V3LA 1W5MA 2WJEA 3I68A 1N2VA 1BYBA 2V5KA 2X41A 2ZX6A 1B3XA 1FDZA 4H9MA 3AWNA 2ZUNA 1KBJA 1ZJIA 3BAYA 3LI1A 2WBGA 4UR9A 4H1ZA 4AEEA 4KGJA 4LB4A 5HJXA 3WUGA 4FALA 2DZAA 1YQ2A 1DWHM 3EWUA 2G97A 4DBWA 1PHWA 3A4AA 5J5DA 4GYFA 4ICMA 4UXDA 2D73A 3O16A 2PWVA 1JDDA 1RQBA 2DW6A 5IDIA 3U6WA 4DB7A 2Z00A 2YW4A 1D8WA 3FAXA 4ZO8A 5F4XA 3G1SA 3DCPA 1XD1A 4UC5A 1JJKA 1VR6A 2CZDA 3URBA 4AU0A 3L4YA 1LBFA 2QPXA 3N14A 4PUWA 2VKZG 1AK5A 4GH3A 2FQIA 3PSWA 5C5YA 3W2JA 1MI3A 5KZDA 2WLYA 5A6AA 5I3KA 1J0YA 4NIRA 2BXYA 3VDGA 4NX0A 3G1VA 4C6QA 3OJGA 1XICA 4FX6M 4TX6A 4H6KA 1LOSA 3QSTA 1D3HA 2QPUA 1I2QA 3RF9A 1UP3A 1E0TA 4NVTA 1HQTA 1IXNA 3R8HA 3ATZA 3H26A 1XIHA 4ZSUA 3RIKA 1Q8JA 3WLJA 4BA0A 1TX2A 5CBIA 5T26A 3L66A 1NFPA 3LLDA 4LNCA 3QPYA 3WDQA 4F0LA 5IXEA 4P7NA 3VILA 3P7YA 2ODOA 3LG3A 3EMCA 2P3EA 1VYPX 1OFBA 3HPFA 1PIFA 4HZ7A 1FXPA 2VZSA 4IOTA 4Q32A 5GJNA 3IV3A 4H7CA 2OQYA 3CZJA 3IARA 5GJMA 1E0XA 3G0UA 1DWFM 5EBUA 5AVHA 5CAHA 1VFMA 1GZGA 1W5PA 4IWWA 4RZ4A 3V4BA 1XG4A 4IJRA 4CU7A 2Q3RA 2XHYA 4X3ZA 2Y7GA 4J3SA 2WM0A 4D8LA 1V02E 2OZ0A 4Y9OA 3TTYA 1JZ6A 1GOIA 3RDKA 2BTMA 2R94A 3GTIA 2XM1A 4H8NA 5DBTA 1JDAA 3PZ9A 1R2SA 1RK5A 2A3CA 4UTWA 4C6MA 3KAOA 1S1RA 5ABFB 1S38A 3W70A 1ISYA 3WJYA 1CXEA 1J6PA 1IZKA 4NJIA 5JUVA 3UXLA 2J88A 3D3AA 3QZAA 4M56A 5L6UA 4S23A 4F4RA 2J13A 2VP8A 3TSBA 1BKSA 3IVUA 1FOBA 3B0XA 4C6EA 4H41A 3LD5A 4WUIA 4XSMA 2TMDA 4US5D 4WKFA 3BAXA 2OQLA 3L2LA 4N2YA 1IT7A 2POTA 2CLHA 3QM3A 3V5OA 5HAOA 3THAA 2NUXA 2DSZA 4MLRA 1WA3A 3MKVA 1PTAA 4IG2B 3SRFA 4F0HA 5D8ZA 2VENA 3DG7A 1ZBWA 5M5DA 3RNDA 2EQDA 2BGQA 3LMZA 5LKYA 1HL9A 2XIOA 3GFYA 2RDTA 4OKDA 4DLFA 3KRBA 4UR7A 2YCIX 2EXOA 3W22A 1SVDA 4GXMA 4DM2A 3BWWA 4Y9MA 3WUEA 3P5ZA 5AC6A 1Q8AA 3WD1A 1T41A 1NWTA 3C8NA 2A21A 3M41A 2WMHA 5KZMA 1LUCA 3HMCA 1EUNA 4AHPA 4CN1A 3FK4A 4AD1A 2OKOA 1A5MC 2GJXA 2W67A 1DJQA 1XLGA 4ZFCA 1FQ0A 2OXNA 4MZ1A 1IGWA 1MEHA 2JKEA 3E74A 3N2TA 4WSKA 3SIZA 4O14A 2P10A 3QEZA 2EPNA 1YDVA 4HOWA 3AUJA 1RP9A 4HOXA 3PG9A 1UWAA 1MEWA 4Y7EA 1RV8A 1VHCA 4CQCA 4S3JA 1P48A 2IPGA 2PI6A 1JZ2A 1LTDA 1UOKA 4R53A 3ZVHB 4C5YA 1PYFA 2ZUVA 2FVKA 4J28A 3N9SA 3W0KA 2VC9A 4DRSA 4L1WA 3SCPA 4AZHA 4R3UA 4O0QA 2FH6A 4YIWA 4HN8A 4E6MA 1R86A 1IWAA 1NARA 2GGGA 4LSBA 3GE7A 3BSHA 3PPHA 2DJXA 3GW3A 3TLLA 3ARUA 4DX3A 4S38A 5ECVA 4HTYA 4UTMA 4RE0A 1MFUA 3BLIA 2W9MA 4ERGA 5HATA 1QHPA 1S3HA 5HXMA 2VTFA 1S5WA 4RE2A 3GH4A 4UFJA 5F1UA 2DW7A 1GJWA 1D7FA 1E3XA 4DIAA 3NL6A 2R82A 3U8GA 1W2VA 2P0OA 5XIMA 4MWAD 1MEIA 4KERA 4GUIA 4WDXA 4I8DA 3QLLA 3TYBA 1OWQA 1P0DA 4TOQA 3VZZA 4AZ5A 1TSIA 3C0JA 3PP7A 2R9RA 3TCEA 2O7QA 1U2YA 3A6OA 4XZMX 1OYAA 3WJXA 1KRCC 3SECA 1VH7A 2ZX7A 2HVMA 3NPUA 5I3IA 3GC4A 4MY8A 1LRTA 4J7RA 4IQEA 1WDSA 4R7OA 3BLEA 2ADAA 5G1MA 3MS8A 1C93A 4FHAA 4JTUA 2YCEA 2PGWA 3DX5A 1VPXA 1Q65A 1M3UA 3EOLA 3LMYA 3VM5A 3UD6A 5AZ0A 2PDMA 4YU1A 1VENA 3PAJA 3KZSA 3OB8A 4GZJA 3RM8A 1I2OA 4G1NA 3V0TA 3ZR6A 2NX9A 2JKPA 4R9XA 4DJEA 2CZEA 4HPNA 3UFYA 3W7IA 1VD6A 1O5RA 1OFAA 1LZOA 1XDMA 4G7EA 1JL8A 4RR4A 3WLSA 4KWVA 4XZNX 1U1UA 2VFIA 1HXJA 2J24A 2DZPA 3ITGA 5FF0A 2Y5JA 3LENA 1FY6A 3DENA 3NXLA 2Y8VA 4PSPA 4F66A 1H0IA 3ARRA 3E5PA 3NOYA 3VKCA 4UUIA 1PVNA 1ZLPA 4BR1A 3I4KA 4GJ1A 4D1IA 5G1TA 3G1HA 1JXJA 5IM51 3RCMA 3OG3A 3BSMA 3TXVA 3W84A 4AC7C 3ZJ7A 6REQA 1GCYA 3TROA 3N34A 2ON3A 3IPWA 4DWSD 1EWDA 3SGUA 1AJZA 1FWDC 3GHRA 3VIIA 4TTGA 1KNWA 3PJTA 2IPFA 1CXIA 5J5RA 4J3TA 1GOMA 1FDJA 1XH1A 4B16A 2F9RA 1UUQA 2HVOA 1ZUAX 1BPLB 3PJXA 4ROPA 4OIFA 3NM3A 1BTMA 3DUGA 3MHUA 4W84A 3TUUA 4IPIA 4GINA 3AXMA 3RXZA 2YDRA 5BXPA 1WXJA 3LEPA 4MYAA 4Q8QA 5I6SA 5FI8A 1JRCA 2C18A 4EPBC 1F05A 4GNJA 4O8RA 4F9JA 1UR3M 3NQGA 5GNXA 1SMDA 2QCNA 4E8DA 3STGA 3BTNA 3EPMA 4IISA 2ACUA 2NLYA 2CLPA 4UTTA 2YL8A 2GZXA 3UWQA 3A4XA 1YE4A 2XZ9A 1TQJA 1OIMA 2OKTA 5D33A 1MNZA 4PBFA 3P5YA 2GQAA 1QNSA 1RP8A 1TVNA 3UR7A 2O4QA 2W62A 1KV8A 1NP2A 4H00A 2OJPA 2ZZ1A 4I7VA 4D6JA 4FO4A 3EDEA 3FSTA 4AXNA 1NU5A 3LM7A 4AY8A 3PS7A 3S42A 3MYOA 1EP2A 2PP3A 1A80A 1TREA 4C1KA 1SJBA 5EB8A 3N19B 2V81A 1CT5A 4KS0A 4ACZB 4L1GA 5CH9A 1HO4A 1K8YA 4PUUA 2ANUA 4NHVA 1R87A 3W2KA 3CWHA 3IK4A 4A8LA 4HP5A 1UUOA 3T4CA 4HOZA 1BSIA 4K1WA 3RCYA 2FGZA 3TQKA 1TPDA 4Q4PA 1X6LA 4LNYA 3GNXA 3O0KA 1QW7A 1XYLA 2GVYA 2PRMA 1OFEA 1EJUC 4TMCA 3WLIA 2HISA 2WJZA 2YLLA 5C2GA 1K3UA 2ZC1A 1EPXA 4US5A 1BYAA 3GNNA 4L61A 2XIQA 2BGNE 1EEXA 1UUMA 3WLTA 1LWHA 4EXBA 3B8SA 1FWAC 4QR6A 4AYSA 3U0HA 3VA8A 2WMFA 4CQ9A 2Y8UA 3VMNA 1TE6A 3H2OA 4S3DA 4C1LA 4HZ6A 2DUAA 3KRUA 4R88A 1VCGA 5JBEA 3DN5A 3O07A 2RH9A 3QRHA 4XTIA 1KLYA 1BLIA 2DUXA 4MB1A 1B57A 2GDVA 4Q7IA 1AVAA 4LUTB 2DY3A 2ZA1A 5FIPA 1PS9A 3UWWA 1OC5A 1PKYA 5DMYA 4ADUA 3LPGA 2NW0A 3QQ0A 4L65A 2VJXA 1QDSA 1RVKA 1JVNA 3ENLA 3K8MA 1R6WA 2GOUA 2V0TA 1XV8A 4HNNA 1GZ1A 1YPXA 2ISSA 4D6DA 1B1YA 4BI6A 4FR6A 3MZ2A 3B97A 4BZYA 2WBKA 5D9MA 3R89A 1TRIA 1XIIA 1E72M 1GOOA 4L9XA 5JBFA 1J2BA 2VOTA 1H7NA 5F2GA 2H8ZA 3V0UA 3PANA 2HTMA 4GQGA 2ISDA 3OIXA 4BCEA 3LCLA 1FUYA 4UMCA 5CZJA 3W76A 5EL1A 2VWSA 3MI2A 1F3TA 1DKWA 1H3GA 2V68A 3B9NA 1XLLA 1R9YA 4GYKA 5I3GA 1WKEA 5ABFA 5LHFA 5GPRA 5LIWX 1H1YA 4FXFA 5H8UA 3T0BA 4RPQA 3PUDA 3QZ6A 2W0UA 1TZ9A 2EPLX 4BF7A 3CLMA 4GY1A 5KITA 1RJQA 3PZMA 5DCBA 4K1GA 4UMBA 1XLFA 5CPLA 1I0DA 1E6XM 3ITCA 5JIWA 2CLKA 2ISVA 2C79A 1CEOA 4HHPA 2Z2BA 3CL8A 4WHBA 1FHUA 4HU0A 2CITA 2YR1A 2ZADA 4MFDA 3UJ2A 4DAFA 1BWKA 3I10A 1H60A 3TTEA 1YBQB 1H4PA 1CW2A 3BZGA 4IQJA 4C5ZA 4H3DA 1E0UA 3CUXA 4IZGA 1CZ1A 2HPMA 1QWKA 3LXAA 4I5XA 4LB3A 1UP0A 4DXKA 2RHGA 4GFSA 4QEHA 2ZRZA 3L0GA 3H4GA 4ATLA 3WK2A 4TVCA 3W86A 5B7YA 1QBAA 5CXPA 2WHKA 1OFRA 5CAKA 2RAGA 4AXKA 4MWAA 4XAPA 1HKKA 1SSGA 3BLPX 3GVVA 1AQ0A 2QNEA 3K1DA 1CNVA 3VX1A 4O50A 4R34A 2WWCA 4U2YA 1NOWA 1X8CA 3CEUA 4A3HA 2WHLA 2YBTA 1PZ3A 2FKPA 3HQPA 3UJRA 1DEDA 4J5NA 4AB4A 4DQWA 2BHUA 3ALFA 4WRHA 3N18A 1ECEA 1F7BA 4JQAA 1W5OA 5I3DA 5EFDA 4C7FA 4PMUA 2V67A 5F1VA 1KO0A 2CXGA 2VM8A 5D2TA 2VXNA 2PRHA 4ES4A 2O9OA 3A3WA 3C2YA 3CS2A 4B90A 1PKMA 3NYDA 2WW5A 5DMMA 1EJRC 3K8KA 4F0SA 3ZVHA 2HVNA 1QNVA 2AKMA 1XRVA 5FEXA 3MA8A 4DBSA 2WKLA 3JRKA 3IIVA 4JQ2A 1XFCA 3L4UA 2YXOA 5G4HC 3W4RA 3OLIA 2AAAA 5HBFA 1T0OA 1ALDA 3PHAA 4N42A 1A5KC 3U4AA 4Q8NA 2PTDA 1JCJA 4B3ZA 1G67A 1UKPA 2OYLA 1Y5VA 2PAJA 1V6YA 3CT7A 1V0LA 1KR0A 1R46A 3DC8A 4AFYA 2HQAA 2C0HA 4GI4A 1A47A 3VPLA 3TDFA 2B81A 1TO3A 2G96A 1XX1A 1SM9A 2FZBA 4DWSA 3WQDA 3CZEA 3P6LA 3M7WA 1EGMA 2VYOA 3T07A 4HA4A 3W07A 2FFCA 2VEKA 2P1FA 2OEMA 2QEZA 3KZPA 5HUOA 1R3SA 4C6KA 4X0VA 1B4KA 4W86A 1TV7A 1V7AA 2X2GA 1EQPA 5I3HA 3NFUA 3AROA 3CHFA 3CL6A 1UG6A 4UFIA 4D71A 1CENA 2WSRA 5LNWA 3M16A 5HUPA 2OSYA 4G5DA 4HTBA 4MGGA 3C8FA 4HPXA 4HNUA 4BF5A 1B4EA 3U7BA 5CKSA 4CCDA 3SQMA 1G6CA 4ZODA 1XPYA 4I3GA 4HJWA 1HJQA 5L9FA 4PFHA 1JCMP 5K2ZA 4TUFA 2IUZA 2VZOA 1UBSA 2R6OA 3AIRA 3STEA 3WEZA 2CBVA 4AEFA 1QPKA 3RO6A 1ADOA 3NL3A 4KCWA 4HA3A 2NSOA 2QUVA 2CBUA 1SFTA 3APTA 4GUJA 1VHNA 1V6UA 3CH0A 4FR1A 3GVGA 3HGRA 1W1ZA 2A2IA 1ZS2A 4GY7A 4MM1A 1TJPA 1DYSA 3NEHA 2OQHA 1AJ0A 1JRBA 9CGTA 3V3WA 2XVNA 3WLPA 1P0EA 1TV8A 4BQ4A 1QATA 1Q4WA 2VCBA 3N2OA 2VGBA 1TWZA 3WDPP 4JIHA 4JTJA 3F4DA 1Y65A 1ADSA 1IXPA 2O9PA 3GYCA 2W4XA 1OEPA 3GIQA 1MDRA 3L4VA 3V0SA 3CYJA 3WIJA 4U33A 4CUCA 3VOHA 4W7WA 4PMYA 1V93A 1KRAC 3VC5A 3REQA 7ENLA 4CQDA 3SN0A 3TYAA 1CYGA 3TIMA 3IGSA 1JI2A 4GFIA 4ZQPA 2GL5A 1YYAA 3BMXA 2ZDSA 3CAVA 5FEZA 1TPEA 3CQJA 1E56A 4JFVA 4MJ2A 4JOMA 4S39A 3WQCA 1KWGA 3WG6A 2PGEA 4UZUA 2ZKMX 3MSGA 3ME3A 2VHLA 2QJNA 1TIWA 3GFXA 2EEXA 2OGJA 3TEVA 3FCPA 2ZDRA 4XZ9A 5EKYA 1XXXA 4Q6JA 4IIBA 3MMDA 4I6VA 4AZ6A 2HK0A 4GBUA 3L23A 1DHPA 1EF2A 5D09A 3EOSA 4UQCA 5D9PA 4AZCB 3B8TA 4CD6A 3W1UA 2AKZA 3WBWA 3AXXA 5I3JA 2WXDM 3APGA 1A5SA 3COTA 2WCAA 1E0WA 1ZB5A 2VD9A 3DEQA 3DI1A 1G4TA 1XYZA 4HMEA 3PWIA 2FDMA 2YFNA 1PEZA 4EWJA 4UNLA 3B03A 1X1ZA 3VCRA 5BMXA 4HJFA 1JCTA 1A5BA 1MUMA 3SO7A 5I07A 3ONCA 1BGGA 3TSDA 1I2NA 1NSJA 2PF0A 2TSYA 4WCJA 5HNRA 4JHOA 3GRIA 1XM3A 2F6UA 4K36A 4XG1A 3MT1A 3ALGA 3CYVA 3TR2A 1DP0A 3W7EA 1DIKA 1XIGA 3SCRA 4MADA 3LS9A 2WHJA 3CWOX 4JTSA 5SWUA 4ACZA 1BXCA 1VCFA 2E40A 3WLMA 4W93A 3GK0A 1W37A 4XAYA 3TYZA 4OBSA 5A6MA 2XSXA 1M7PA 2QCGA 5LXEA 1HZYA 4NI3A 3DHFA 1VIZA 5BYWA 1XFBA 1NTHA 2ZZ5A 1FWGC 1MZRA 2XFFA 4QDPA 1KGUA 1UD5A 3E0LA 2WHMA 2JK2A 3CQ0A 4YL2A 1VQTA 3V5CA 1V79A 4QSHA 4UR8A 3H4WA 2GQ8A 1E70M 4UOJA 2VEMA 1E5JA 4B5UA 1WAUA 2UV8G 5HJLA 3ES8A 4ADSA 4JFSA 3R10A 2XGBA 1FWRA 3M1ZA 4PE8A 3GHSA 3O15A 4UQAA 3K46A 3SY1A 1W9BM 3DERA 1L6GA 3UZYA 3WQ4A 3IRSA 1J4EA 1GORA 1QI3A 3AS2A 1AL7A 3U57A 4F3HA 3O6AA 1WYIA 4C90A 2VL4A 3D5HA 3VDBA 1XSKA 4XAFA 3RRAA 3INPA 4FNPA 2VC5A 2J7BA 4BF9A 2E4TA 4NU7A 3I3BA 4HHLA 4PEKA 2X1UA 3C61A 3AFBA 1HW6A 2CESA 2A0NA 1RQHA 3SY8A 1TV4A 2Q71A 4NZJA 3RMEA 3UG4A 3SJNA 3FKRA 1H49A 2BVYA 3VOCA 3VC6A 3F4NA 4LS2A 4QJ5B 1AQHA 1JZ8A 4Z17A 3C3UA 1ZJAA 3GIPA 4NRRA 2VD8A 2X1RA 1OY0A 4F8XA 1RD6A 2CERA 2NT0A 1LBMA 2WPBA 1C8VA 3ZSTA 3TWAA 2OEJA 4Z2GA 1LL7A 1GW1A 2OSWA 5CG0A 2PDCA 1JD7A 3OIHA 4QX4A 3BURA 1TX0A 1Z69A 4UTIA 4JQ1A 4HPGA 2GWGA 2PDNA 3M0KA 1PKNA 2PURA 4RL3A 1KBKA 5MHBA 4MKNA 3T6CA 3HA1A 4IJBA 1DJZA 1WAWA 2XZ7A 3EOOA 3RAOA 1OC7A 3QOMA 4EANA 3G8RA 2DT2A 2GJLA 1DIDA 3F4VA 3I3DA 2H6RA 2FJUB 1YBQA 1R5YA 3A9IA 2YX0A 3HZ3A 4DXVA 3LHZA 2PGFA 3N13A 1XSIA 3L5LA 4GPNA 4GQBA 4C60A 1TPWA 1F8IA 1QTWA 4WGXA 3MSDA 4LC6A 2J74A 4OJYA 4Q8PA 3TYUA 3KP1A 3W1PA 3PZTA 3E5BA 4XUYA 3THCA 3FYPA 3AIEA 2G50A 4RDYA 4PUMA 1QMLA 4AY7A 4IUGA 1I2RA 4JTCA 5MF5A 3MSYA 2H3DA 3ABOA 4C6NA 2FGBA 5D02A 1QHOA 1O1HA 1JPHA 1AJ2A 1ZCCA 1Q6CA 4LRSA 3ABQA 3WENA 1EA9C 4PCFA 4QIUA 3W7OA 2XFYA 2OB3A 3AWOA 3S6OA 2YXGA 3LPOA 3TFXA 1V6VA 2Q3OA 2DU2A 3BQ5A 3CQKA 3E12A 1F6YA 1LRNA 4J1OA 4D9PA 1KTCA 3AYSA 3GNPA 4IPNB 3QC3A 2JGYA 2Y61A 1OCJA 3MV11 1Q7QA 1WXZA 5A6JA 3UJFA 1DVJA 4W5UA 1EB3A 1UPPA 4GBDA 2Y2WA 1R3QA 1I75A 5FCZA 4YWSA 1LLWA 4IL2A 3TQ0A 4YVXA 1TCMA 3AMCA 2Y85A 4IMDA 4DM1A 1GTHA 1PIIA 3LY0A 3GTXA 2D2GA 3S5SA 4HIBA 4Y96A 3BLFA 2WKGA 4NZ3A 2Z1KA 5AYIA 4JTGA 2YKKA 3B0YA 3TJLA 4IXXA 1M5WA 3GHTA 1H62A 5CBBA 2CZVA 3V35A 4D6EA 3BW4A 4KEZA 1UWRA 2G41A 3QVQA 1FVPA 2PDLA 3TSMA 1KB3A 3GZ3A 1D9EA 4LYQA 4TV5A 4AY1A 4YTRA 1M7OA 3SB0A 5KZEA 1G69A 2J77A 3CO4A 3U4FA 3GXNA 2QCFA 3W37A 1W1TA 2VO5A 4CU6A 4KFNA 3G3DA 3OQEA 3FEQA 2WPGA 5CPOA 4UCFA 4IQDA 1SR0A 3P67A 1FXQA 4HYVA 3RLGA 3R7MA 1ZSXA 1SZRA 2QW5A 5HINA 4ENLA 3WJZA 4YTTA 2ATSA 3S1VA 2PC8A 4H7VA 2DH3A 3F1QA 3NQAA 4KCTA 1RHCA 5AC8A 2WMIA 2E25A 5IOBA 4LQ1A 1S2UA 1O68A 4Q22A 3LPPA 3WH6A 1P6CA 3W7HA 2OYMA 4W85A 3MC5A 4ZENA 3LLFA 3BICA 2WZIA 3GTFA 3CUIA 4JFWA 1H61A 5I06A 3UWZA 5HWJA 1QI4A 3SADA 1V7YA 3KVLA 3O7UA 1F3WA 1H1NA 4CN6A 2C8NA 3PTMA 3VK5A 1ME7A 2RGMA 5D04C 4O1CA 2PUZA 2PP1A 3VNIA 3FKKA 3WQVA 3M0MA 3QTGA 1B0IA 2XH2A 1MRAA 2EKGA 4PMRA 1Q3NA 3KTCA 1RZMA 1VFHA 2OCZA 4JL1A 2Y63A 3NDZA 1XGDA 3S6DA 4ICNA 3WO8A 2CLEA 2D2JA 1E1EA 2CBIA 1F3XA 4O1EA 1FFRA 1G7VA 4LYRA 3W7DA 2W61A 4Z1AA 2BY2A 2OPJA 4DNMA 1HP4A 2WLZA 3ANUA 2VT0A 3WQ5A 3P80A 1ZENA 1EIBA 2VEGA 4UB9A 3SW6A 3MZNA 2AQWA 5D4YA 2PB1A 3B8UA 2GUBA 1ZL1A 4Y9NA 3QV8A 3P8JA 1EXBA 5I7GA 2QYGA 5U7SA 1TZ7A 2WVTA 3L2MA 1TUFA 1ISVA 5H91A 1XLMA 1ITUA 5AYBA 1AD4A 1MQQA 1SSDA 4MNMA 5T9BG 2BY1A 3F03K 1WCGA 1ZAIA 6PTDA 4YS1A 4ZO9A 4N6EA 1Q6LA 3LTSA 3C52A 2BFGA 3QQWA 4E3TA 3NQ2A 4LJ3A 1K8ZA 2WB5A 4XWUA 2HNEA 5DXYA 3MVTA 3ERPA 1E4IA 4X61A 4LY4A 5A6SA 3W38A 3T05A 3OEXA 4K8HA 4TXEA 4OOUA 2ZICA 2GUYA 4I9AA 3W7CA 3WNPA 2G4JA 4JXCA 3GVWA 3R13A 1F8MA 4FLOA 4QS6A 4IFOA 2E6AA 3H54A 1IEIA 3NZQA 3F2DA 4LUYA 3U7VA 1Q4NX 4AD5A 4P2VA 4ZBCA 4G7FA 4AVNA 4J9JA 3BGGA 4M29A 1YE6A 1AL8A 3VOIA 3RR4A 3SUSA 1TZZA 3OVRA 3LI0A 3BV7A 3H6OA 1J0IA 3HGJA 3R94A 1IEWA 4MHBA 3T40A 1XLBA 3PUGA 1QNQA 4E8CA 4IP4A 2C14A 4CD8A 2ZC8A 2VNCA 4FEZA 3PZOA 3CAKA 2Q8XA 1M01A 1R30A 2ACSA 4GISA 1XBYA 4XB3A 1UPMB 4JDYA 3CL7A 4TO8A 4UTUA 1J96A 1GHSA 3LLXA 3W74A 5D30A 4EF9A 1O5XA 2OX1A 5FACA 2IKHA 2TYSA 4FLQA 2Z26A 3E2VA 4H6EA 4QJ1A 1NDWA 4FI4A 3WQEA 4AF0B 2ZCGA 1OFDA 1XIMA 5DQPA 1BXBA 3N6JA 3L21A 4S3CA 3ITLA 1E6SM 3H2CA 4GC4A 2JQXA 3NDOA 3LGGA 3WH9A 1IT8A 3N4EA 1E6ZA 1OZMA 2H3BA 1YDNA 2JKAA 4LU0A 2DSWA 1JYVA 3GDTA 3M0IA 5G1YA 4MY9A 2Q8LA 2WZHA 2OX4A 4JGDA 4KF1A 3C4UA 2VR5A 4C1NB 1K70A 3CK5A 4S2BA 3VOGA 3UCDA 1JPMA 4UZSA 5REQB 1OHLA 4O28A 3F7JA 2UY3A 2YCKX 3WK1A 2PP0A 1HKMA 1M41A 3H53A 4XD4A 3QLDA 3HJZA 4HMDA 4UQDA 4LW7A 4IQLA 2WYSA 3EXSA 2Z27A 3ATYA 4HNTA 4B91A 4O52A 5ENLA 1IF2A 4PRRA 3SZ8A 2QVNA 2NX1A 4Z0SA 1LQ2A 2Z24A 3TE9A 2WSKA 3LCWA 4GUGA 2YLAA 2P53A 2VCAA 1TRDA 3O6CA 1RVGA 4XBSA 3ZMRA 3NTYA 4DYKA 1XUZA 5KINA 3KVJA 3UWUA 1O1ZA 3GVRA 4FXSA 2IS7A 3FHAA 2EG7A 5EMYA 3LCFA 1R3YA 3CZLA 2QIWA 1SW0A 1PV8A 1FWWA 1VCVA 3HFYA 1RPXA 3WLRA 3SCQA 2J7HA 3WCZA 1KM5A 2OOFA 4GZIA 5K4XA 4AMCA 3VNZA 4PTVA 4QDWA 4DBEA 3O6DA 3PTKA 1P4CA 4LVGA 3C6CA 1YTDA 3VKBA 4LAZA 2PTZA 3SCWA 4KMQA 1V08A 1W56A 1OM0A 1HX0A 4RNIA 2W66A 1XYAA 4HZ8A 5F2MA 3RITA 1DWIM 1G0CA 1KRBC 1WV2A 2DP3A 4ZR8A 1NH6A 1HG3A 3H12A 2Z25A 1JPKA 1J8VA 3K5XA 5BWAA 3QR3A 1KXVA 1TUXA 3MO4A 3V1PA 2ZA3A 1TELA 3V5FA 2BVDA 1H5VA 2VEFA 1KM6A 2NV1A 1OYBA 3OHMB 5FA5A 5KTLA 2VUNA 1QOQA 3DOPA 3VIMA 1R8LA 2J47A 3AZSA 3IWPA 4O1AA 2G5WA 3XIMA 4XIMA 3IJ8A 1HJUA 4IGMA 4UFKA 4QBXA 4AD2A 1KR1A 1RJRA 2Y89A 4Q8UA 3TTOA 1V0KA 3URNA 5C8BB 2CPUA 3CO8A 7PTDA 3DU0A 1EJVC 1S46A 1Q13A 2FDSA 1RA5A 3K4DA 3WLOA 2QAPA 1LG1A 2YL9A 4P61A 2RKXA 3CJPA 1GVOA 1PUDA 3QW4B 4EK7A 4W4QA 1TV3A 3LRLA 4K37A 3W81A 1VBJA 4CNUA 3FDKA 3CV2A 4YJ5A 3BJSA 4ZB5A 1KQZA 3GKFA 5JBDA 2YYTA 2XJ7A 3EA2A 1FWJC 4AIBA 4DEFA 5BXTA 2QGHA 4XIAA 3UGRA 4ZVJA 2ZTKA 3TYEA 1PDYA 3CB3A 1XISA 3A21A 2GDQA 4J2PA 2CBJA 4XZBA 3TU9A 4EWND 3AIVA 1VFTA 1XBVA 3HJEA 1O94A 1T40A 4AZGA 1VJZA 3GNOA 4KRZA 3W02A 2PWGA 4TX8A 4JD4A 4A29A 5BRQA 3PPCA 2V5DA 3E9AA 2X09A 2YBUA 1R0MA 3BUVA 4QAIA 1KCKA 4BEQA 3UXAA 3GS6A 3NZ1A 2GGJA 2NQ5A 4JKKA 1JQVA 1ZBVA 4PN2A 1DJWA 1NWRA 1BWLA 2QV4A 4LV9A 4H8UA 5I79A 5CC3A 2YDQA 1PTGA 2Z2UA 2C15A 3VIPA 1DWAM 1OCQA 2GSEA 4NQ1A 3R8RA 2BHYA 2H8XA 3LHTA 3UA4A 3E0VA 2HBXA 3AQUA 1BQGA 1U5VA 3LSCA 4FOUA 7XIMA 4FP1A 1P43A 3DXIA 2INZA 3W2UA 4W7UA 2JEPA 3CHVA 4UTWC 4FLRA 1LBLA 3LOTA 1W17A 4MDOA 5MKGB 1BVNP 1H50A 3DFYA 3U2EA 3W53A 3V7PA 4LEQA 1TPUA 1SW7A 1O5QA 4C6LA 4ZOEA 3L4WA 4XKYB 2WM1A 1QXLA 1F61A 1WXYA 2E1WA 2OWCA 3BG3A 3CTLA 3NQ7A 1XIFA 1QPQA 2ZXQA 3KEHA 3FV9A 2EPMX 3V16A 4WDUA 4KEVA 1LLZA 2AGTA 4E3VA 2HMCA 1V3MA 4JY9A 2E9MA 1XG3A 2VUYA 1XLKA 9XIMA 2W92A 2RUSA 2VWTA 3LBCA 2WZMA 2A6LA 2UY5A 1T8QA 1T6MA 4CLMA 5BU6A 2WVUA 2CU0A 1E6QM 1H7PA 3BH4A 2G37A 5DCEA 4Y90A 5CLWA 1C91A 3APYA 1LT7A 5E0FA 2OZTA 4ZO7A 1LYXA 3TAOA 2E6DA 4XX6A 3HPXA 1AMYA 3EWXA 3NZGA 5G2WA 1ZPTA 3GR8A 3EEZA 3QPEA 1YNPA 3A4WA 4R5EA 3BGAA 3UESA 4AWSA 3BAJA 1E1FA 3AS1A 3O8AA 3VIJA 3CT2A 1O12A 4Y8EA 1ZQ5A 3ARSA 4IIDA 1KGWA 1XPGA 3DFSA 1O60A 9XIAA 3OQ8A 3ES7A 2OMAA 4N9CA 5A6BA 2HV5A 1MW3A 1W3HA 3CZ8A 3KP0A 4EPDC 1DWGM 1DQWA 2UBPC 3O9NA 3W71A 3H7UA 2Y6ZA 3HB9A 3KOWA 2YYUA 2FZDA 5K9CA 1HFBA 3GO2A 3A3HA 1RY8A 3T2QA 3W29A 3AOFA 5I5RA 2J75A 4BHYA 4ZA0A 1PWLA 5FD0A 2J7EA 4ZSTA 3HOJA 2E28A 4PUDA 1R38A 4F0KA 1EP3A 1A53A 3A23A 1UKOA 4AVFA 2RGLA 1A0CA 2J27A 5IFPA 1VIWA 3G24A 3EYPA 3ZVIA 1P7TB 2F2HA 3B0UX 4OTKA 1NVMA 5I09A 1M53A 5IBXA 3UY7A 4H8HA 3FGCB 3AIUA 1GOQA 6XIAA 3KRZA 3NQFA 3H23A 1J0KA 1TVLA 2HK1A 4OBRA 1T99A 1BQCA 1DOSA 5DANA 4H9UA 1XH0A 4FNTA 2E9BA 1EGZA 4QITA 2Y7EA 3NA8A 5I00A 4GYPA 4KCUA 2DJLA 4HD5A 4MJ4A 4WXYA 5CGMA 4YXGA 1W9UA 3WMLA 3WH7A 4FAMA 1ISXA 1KGXA 2VFHA 1NJJA 3MMTA 2W27A 1E40A 2PTXA 2NV2A 2AAMA 1Q2RA 1H0GA 2FZNA 3UPWA 3UT0A 3TX9A 2PLCA 4NAFA 1E51A 3E2RA 3PM6A 3QKEA 4JKMA 3AICA 3IRDA 3WF0A 2DZUA 3NAVA