5KMYA

Crystal structure of tryptophan synthase subunit alpha from legionella pneumophila str. paris
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
262
Chain Sequence
AMNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDPMAEGPVIQRAMERALAHSIHCDDVLNMVRQFRKTDTETPVILMGYLNPIEQYGYDLFAQQAVEAGADGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNFINQHANGYLYYVSLALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGAALINEIIEAYEAKKDPLQASGALLSSMRQAIDNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tryptophan synthase subunit alpha from Legionella pneumophila str. Paris
rcsb
source organism Legionella pneumophila (strain paris)
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 83
structure length 262
sequence length 269
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5kmyA00
3NAVA 3LOTA 1EEPA 1BKSA 5G2IA 3W1XA 1LLZA 3WK2A 1DHPA 4CLMA 1F5ZA 2A6LA 1P4CA 3GVGA 2QCDA 5MHBA 5AYXA 3MHUA 4JYEA 5K2ZA 3HG2A 2DP3A 3QW4B 5CSSA 3N2XA 4M6QA 5D32A 3S5NA 4LC8A 1A53A 4O4WA 1GYLA 1F05A 4NT0A 4FNUA 4OE7A 4PL2A 1TV8A 4UNKA 5K3VA 1W31A 3LLFA 3W2KA 4LVGA 4AXKA 3UPWA 2ZZ5A 1YPIA 3TXVA 5KZDA 4JXCA 1Z48A 3M43A 4MUZA 3GB6A 5F2MA 1ICPA 4OT7A 1THFD 2ZA1A 3HG4A 3PG8A 3NPXA 2P0OA 2NX9A 3HF3A 4UUIA 1R2SA 2VEKA 3L5LA 1FQ0A 3LRMA 5AOUA 3PY2A 3U8GA 3OHIA 4C1KA 4I9AA 4N6FA 4H3DA 1EX5A 3CTLA 4K37A 3DBPA 1XL9A 1QPRA 2I9EA 2ZBTA 4BR1A 4IJBA 3LCLA 1SW3A 4UFMA 3A21A 3LI1A 1TJPA 4R53A 5I3KA 4AHOA 4GUFA 3P67A 1VCVA 3TC7A 2O7QA 3E9AA 5L6UA 1FWSA 1CI1A 3W7MA 1D3HA 4JTHA 1D9EA 3C2FA 1SPQA 4MLRA 4O50A 3S42A 3W73A 3HPZA 1UCWA 4K39A 3T40A 3OBKA 5AHFA 5D2YA 3LCXA 4IMEA 3W7IA 1T96A 3UNDA 1XDLA 3W23A 2FJKA 2Y7EA 1Q6OA 1VHNA 4N2YA 2E1DA 1YXDA 2QCMA 5I3JA 3M6YA 1W37A 4ZL1A 3Q2DA 1FWTA 2O7SA 4Z1AA 3IIXA 5FEZA 4PFMA 3UWUA 5AHMA 3NQ6A 1OYCA 4Z1DA 1TPB1 4TR9A 3TFXA 1R47A 3QMTA 4LS0A 4MZ8A 1GPWA 3IVUA 2V2DA 1DL3A 4IPIA 3GNNA 1TMHA 1XBYA 3B03A 1H7WA 1XBZA 1RVGA 4EWND 4XBSA 3USBA 4DBEA 3R89A 1ZFJA 3C8FA 3W7GA 1H7NA 5ABTA 3Q58A 3NDOA 1J5TA 5AHEA 4E38A 1QOPA 3NO5A 2HTMA 4N9CA 2Y85A 3LBMA 3QFEA 2QDHA 2X16A 1VLWA 3T55A 3SGZA 5LHEA 1HO1A 2C16A 3GK0A 3I6RA 3B8DA 4IOTA 1C9DA 1KTBA 2QAPA 1OFAA 3C3NA 1HO4A 3GDLA 4IXHA 4O53A 1PHWA 5HMSA 3CM4A 3W71A 4DXVA 3LV6A 2ZZ4A 1F73A 2FPVA 4NVTA 3W72A 3NQCA 2J6XA 2WO5A 3A22A 5G5IA 8TIMA 1MEHA 3E96A 2YR1A 1M7OA 5K9CA 3KAOA 1QPQA 4TMBA 5CG7A 1VGAA 3WJSA 4PEKA 1RPXA 4OWGA 1F6KA 1DKWA 1KM3A 4NZJA 3G24A 2CZEA 1G69A 2GVJA 2GJLA 2CLFA 2X30A 3NPVA 3WK3A 1PS9A 4P61A 4M5PA 5C55A 4QNWA 3STGA 2Y88A 3LCHA 1SFLA 4O28A 3W2LA 1OYBA 1VCFA 2R14A 3P8IA 2VFHA 4UTMA 1E51A 3TUUA 2JK2A 2EAWA 3FYOA 3W1RA 3GXPA 2F7FA 4AMAA 4B5NA 1G4PA 3UXAA 3BPWA 1HFBA 3LX9A 3LTYA 4FXSA 5KZEA 4NXKA 3SI9A 3TJXA 2ZA3A 3L2IA 2V5BA 1VLIA 4DF1A 4UTUA 4NJKA 1ZALA 3T4CA 3GNDA 2Z2UA 1U5JA 2I14A 3BG3A 3STCA 4CNOA 2TSYA 4R33A 3ABSA 3EWUA 4GUIA 2YSWA 3PF3A 4LUJA 1QR7A 2VFGA 2Y6ZA 2ZYFA 1R2TA 3C56A 4JY9A 2VFIA 1XCFA 3VCRA 4AWTA 2ZTJA 3LHZA 4S2BA 4LVDA 5DY3A 3UWZA 1EPXA 1VCGA 3W1NA 2ZA2A 3W2UA 3PM6A 4FNQA 3UQNA 2QDGA 3Q94A 4WOZA 2X1SA 3LGEA 5HUOA 4W9TA 4HNUA 3R2GA 2Y61A 3QEZA 1EP1A 3WJYA 4MY8A 2J9ZA 3VFLA 3FEMA 4FIRA 1WBHA 3WK0A 5F2IA 4CNNA 1FWNA 1WAUA 2V30A 2QR6A 2CZDA 4AWSA 2JGYA 5BW6A 3UWWA 2Z1BA 4NX0A 2YW3A 4LS2A 4WUIA 2OJPA 3PS7A 5DCEA 3TSDA 4LTSA 1OFDA 4U4MA 4WQ6A 5TBOA 3TAOA 3VE7A 5IBXC 4RLIA 2WJZA 3WK1A 1B4KA 3LLDA 4NJHA 3LCWA 4TX9A 2F84A 2CLKA 2A1YA 3P7YA 2Z6IA 3F4WA 2EF9A 3IEBA 4LWWA 3W83A 1H63A 4ALDA 4C1LA 5CKSA 2HS8A 1YDVA 3D0CA 2EPHA 1ME9A 3CWNA 4I7UA 3THAA 4O4VA 4HT3A 4WY0F 1BTMA 2YCEA 2CWNA 4AVFA 1I2OA 3EX3A 2QF7A 2NV1A 2UV8G 1MO0A 3NL2A 5F2GA 5D30A 3DFQA 3W1MA 1GVOA 3A5FA 4OU1A 4EF9A 1RZMA 5GVJA 4R7JA 4WOQA 2WSRA 4OGZA 5DLCA 1NSJA 1AL8A 1TJRA 3DFSA 2CLOA 2QUVA 5TIMA 3QF0A 3ABRA 3O07A 3N14A 4JY8A 4P2VA 5G2HA 1P0KA 4FX7A 1H50A 4WXYA 2ISVA 3O1NA 4GFSA 1OFBA 3DHFA 1C29A 1GQNA 3C6CA 4O52A 4UTWA 3G1XA 4NJJA 1RQBA 3QSTA 3P82A 5D33A 3IIPA 1EP3A 1FXPA 3UWQA 1DOSA 1F74A 4O10A 3TV8A 1QO2A 3VNDA 4CQ9A 1TQJA 3P84A 4HNTA 3PUEA 3ELFA 3PB2A 4QISA 2B7PA 2FB2A 3KVLA 1KM0A 1H60A 1W3TA 4HSOA 4DO6A 4JTIA 1JUBA 3EWYA 1A5SA 3SJ3A 1DJNA 3INPA 4Y9AA 3LXAA 2WNQA 3TAKA 1ME7A 4JD4A 5D2TA 1R46A 1YDNA 2GUUA 4M19A 1T8XA 1WDWA 4N6EA 1ALDA 1BEUA 3W75A 1NVMA 5EYWA 1Z44A 2AQWA 2DORA 2A0NA 2JKPA 1SO4A 3M9YA 1OX4A 1MEWA 5EL1A 1TTQA 2WKJA 5LNVA 4BI7A 4K8HA 4H6KA 2W6RA 1TQXA 4MZ1A 7TIMA 2KZHA 1AG1O 4LV9A 1XUZA 2G95A 2W79A 1IXOA 3L5AA 2X1RA 2FPYA 1LROA 1RD5A 3M0ZA 1IGSA 2GQAA 1M6JA 3L0GA 1AW2A 3IVSA 2TRSA 5FF3A 4FX8A 4JTGA 2QUTA 5AHLA 1TV5A 3RLVA 1UUMA 3L65A 4AF0B 3W7NA 1F76A 1XM3A 3W9ZA 4IX2A 2Q8ZA 1N7KA 2ZZ6A 1L2UA 1Z42A 3DFPA 3PBVA 1K8XA 1L9WA 3HO8A 3NZRA 2WOQA 1OG0A 4MJMA 1H51A 3G1FA 1GZGA 1DORA 5D09A 3L21A 3A24A 4XKYB 5LGXA 4ORMA 2YFNA 1TIMA 1YXCA 1K8YA 3PSVA 1YADA 2NWSA 4YMZA 2QCGA 5U7SA 3FA5A 3I65A 2AGKA 1SW7A 3DENA 3MUXA 4POCA 4I7WA 4BWLA 3MP3A 4JX6A 5KZMA 1VQTA 3G1HA 1TPFA 1OF8A 3ZFHA 3W1QA 3BLIA 1ZHAA 5SWUA 3O16A 1T0OA 4ZQRA 3DH7A 3U2OA 1O4UA 4MYXA 3NG3A 1I4NA 1PCWA 1W1ZA 3S1XA 1B57A 1ME8A 4IUOA 3KXQA 1AK5A 1MEIA 1FCVA 4NU7A 4Z0SA 1XFBA 1B4EA 5AHIA 1LDCA 5G4EA 3B0UX 1BWKA 3G1SA 2DZUA 3CLMA 2ALDA 3PBWA 3W1PA 4AHQA 5FF0A 3I68A 3NR0A 1O95A 2BTMA 3DGRA 1WV2A 4O15A 1SU5A 1SQ7A 1TB3A 1UJPA 4QM1A 1GTHA 3BK0A 4HN4A 4Q33A 3M5YA 3G1AA 5K9XA 4XBKA 1LOSA 4N9DA 2PRMA 1O5KA 4EOUA 2H8ZA 1Q3NA 3C2EA 3R5EA 5I3HA 1LRNA 2ZRVA 3GX9A 2JKEA 1G4EA 5AFDA 3GAKA 3R8RA 4MKNA 3DI0A 4UMAA 2ZZ2A 2B7OA 3BW4A 3VKJA 1VS1A 1OVDA 1KM6A 4TIMA 4IGHA 4FB7A 2ISSA 5E93A 2G96A 1IF2A 5F4WA 2G5WA 4YXGA 2NUWA 1I2NA 5DY2A 3M47A 1ZAJA 1OK4A 1P0NA 1JUKA 4JTLA 1P1XA 3Q37A 1EWEA 3GXTA 5LNRA 3MYOA 4WD0A 1W5NA 1O60A 3C61A 4KKXA 5HWMA 1GTEA 1OHLA 4O1CA 5C5YA 2X1TA 4N4PA 5EY5A 4JIQA 2B0MA 1OFRA 2V8ZA 1LP6A 3IIOA 3NQEA 1SSDA 3S8HA 1FDJA 4BK9A 3W88A 5CPNA 5I3IA 3B4UA 5CZ0A 4O1AA 3UD6A 5D38A 2DZTA 2D73A 1EIXA 4ADUA 3BARA 2P10A 4IMCA 1GG0A 3N34A 3DHDA 4O13A 5D2WA 1JCXA 1W3NA 1LYXA 3DKJA 4ZVJA 3PUOA 2ZQ0A 5KSWA 1WX0A 2E5BA 2RH9A 5L9FA 4Z08A 3SSJA 2V5LA 4N9BA 3CWOX 3KRZA 4NJIA 4Z0JA 1OK6A 3EKLA 4YWIA 2NUYA 4MYAA 1PVNA 1WOAA 3F03K 2A21A 3P74A 4MIMA 3MMTA 4L4LA 2WPBA 5U4NA 3V1PA 2DJXA 5A8GA 2A6NA 3DFTA 4M6VA 4X22A 5CZSA 3QYQA 3TNOA 3IIZA 3CIXA 3M44A 4IMFA 3QQ0A 2WSQA 1FXQA 1QNVA 2R91A 3MW7A 2RFGA 1GOXA 1H5YA 3FFSA 1KFBA 3SY5A 1SR9A 2CLMA 4X3ZA 3ATYA 1JCNA 3DKLA 3N3MA 4MVAA 1LORA 5HQEA 3LTPA 4QQ3A 3NM1A 1OFOA 1KLZA 1S5VA 3QZEA 4M7SA 2TPSA 3H53A 1ZJIA 3HPSA 2AAMA 2NWRA 1VYPX 2NXGA 5AC6A 4XTDA 4CCEA 1OX4B 5IM51 1KTCA 4YL2A 4LV4A 4UC5A 3FJLA 1TTJA 1TPDA 3O06A 3W3OA 2J24A 3ABOA 3CQ0A 4HPXA 4WX2A 3C2RA 1W56A 2PURA 4DPPA 3B04A 2YX0A 1B9BA 3PULA 4IMGA 2TYSA 4U28A 2ZCGA 4K36A 1RR2A 3O6CA 3O6DA 1MSSA 1KLYA 4PA8A 3NQFA 4QSHA 3F4NA 3NXFA 2A7NA 3TMQA 4RR4A 2E6DA 3SR7A 2HMCA 5H91A 4IPJA 3W7JA 1QAPA 2QCDB 4JTEA 2PE4A 1IIHA 4OHQA 2FDSA 4RKAA 1JUEA 4LY8A 2JKAA 4ZMGA 5BRBA 5H2ZA 2ISWA 3KOFA 4UFKA 2QCFA 1W5QA 1TTPA 2DZWA 3EWZA 3PR2A 5AYZA 5KINA 1QOQA 1G4TA 4UMCA 3CHVA 3EWXA 3TW6A 3NPUA 4FNTA 2OCZA 3PUDA 3NA8A 3NZ1A 2QKFA 3R13A 2E5CA 3W84A 1WQ5A 1YXYA 2GQ9A 2E5DA 2R94A 3M5ZA 3NGJA 2OZ0A 3EWWA 2QJHA 1FCBA 4JDYA 1UASA 4E2BA 3KRUA 1ZY9A 1GJPA 4YCOA 1AW1A 4JYFA 4K38A 3IRDA 3TR2A 3QMRA 3JS3A 3THQA 3MBDA 2XN1A 3C0JA 4GXMA 2ABAA 3CT7A 3GKFA 4NXSA 2C6QA 1GVQA 2NV2A 5AB3A 1O94A 3MO7A 1SZNA 4CQ8A 4NX5A 2EKCA 2H3BA 3RNDA 4OQVA 3B06A 1W5PA 1KV5A 4LUIA 1H62A 2RHGA 1KM4A 3GDRA 4GE8A 4GJ1A 1SO6A 2RDTA 1OFPA 4UCGA 1R2RA 2CW6A 1C8VA 4A3UA 1EWDA 5KITA 2Y63A 1K7FA 3SFKA 5BMXA 1H7XA 1GYNA 1LZOA 4MZYA 4JX5A 4DPQA 4QITA 4IWWA 3MBFA 3W7KA 4LOCA 5G2WA 3PBUA 4QJ1A 4UFLA 2E68A 1TO3A 2WNZA 2YFOA 2QJGA 4UFJA 1JJKA 1YTEA 5DXXA 1CW2A 4FX6M 2ZRYA 2YDAA 5D04C 4J9JA 5AC8A 1TSIA 4ZZ9A 1FY6A 4M6PA 5FEPA 3MWAA 1ICSA 4UTTC 5G1YA 2DZSA 3CPRA 4BWLC 1QPOA 3TROA 3FJ6A 4BI5A 4XUGA 1J4EA 3O15A 2GOUA 4OV9A 5J5RA 4FNPA 4UFIA 1Q6RA 3RFAA 4UXDA 4LVFA 1M7PA 4PCFA 1SO3A 2OT0A 2VFFA 3L67A 4ADSA 3LHUA 1DQWA 3W7QA 4NNAA 3HG3A 1P5BA 2NZLA 3NL6A 3P5ZA 2CLIA 1BWLA 3O8AA 1LTDA 1K7XA 2QCEA 1TPWA 4JTJA 3IVTA 3LTSA 1SZFA 1T99A 1TCDA 4MFEA 4NNCA 3A9IA 4EVZA 3LCFA 4GBUA 4JGDA 4PH6A 4N02A 1KFKA 1AMKA 1PCKA 2B7NA 1JCJA 5C54A 1YPFA 4TMCA 2J9YA 3W7OA 1FUYA 1DQXA 4GUGA 4KWVA 4G1KA 1GEQA 4BF9A 3LB0A 3TQVA 1G7VA 3TX9A 3NNTA 1LM1A 1L6SA 3BV4A 2V0TA 4AWUA 3PG9A 2Z6JA 1KTNA 5K9DA 2C15A 3NQMA 4CCDA 3STEA 2QCCA 6TIMA 5HWJA 2A7PA 3QW3A 3EX6A 1H1YA 2ZZ7A 1SO5A 3L5MA 3DZ1A 4WY0A 1HL2A 3K30A 4GWEA 2WV8A 3O05A 3R12A 2C19A 3E02A 1SUXA 2B4GA 3CEUA 3DFNA 3P62A 5K4XA 3KVJA 5F2LA 3NQDA 3RF9A 1LBLA 1DV7A 4MLJA 1WXJA 3KRSA 4NJGA 4O57A 1ONRA 5FESA 4Y8FA 2Y7GA 3DXIA 3I7RA 4KFNA 4KFOA 3PB0A 4UTWC 3KVKA 1J2WA 1K02A 2ABBA 2QEZA 1KV8A 3W76A 3UXDA 2ZRXA 1JQVA 3WJXA 2PC4A 1G4SA 4UNLA 4X2RA 3HJZA 1VPXA 1CX9A 3LRKA 3M41A 4RXGA 1X1OA 5DXYA 4HSNA 3TMLA 4L4MA 5AYYA 3HMJG 1QFEA 5DELA 5LKYA 5D2XA 4GC4A 1K03A 3LHWA 3PBYA 4JTKA 2GJNA 4X9SA 3W86A 4YLWA 5HR6A 3N19B 4Q4KA 3MI3A 1KBIA 3NEVA 4Q32A 1JCYA 4UFHA 3LDVA 3KFTA 4HPJA 1OFEA 3B05A 3NPWA 2A7RA 2PRHA 1W54A 2JGQA 3W7DA 5K4ZA 1QO5A 1VHCA 1PIIA 2ATSA 2I1OA 4NZFA 2TMDA 3QM3A 3RU6A 3E49A 3S1WA 1YYAA 3TJLA 3W70A 1LOQA 3YPIA 3E12A 1FBAA 4XTIA 3TU9A 1Q6LA 3LXBA 5D02A 5AC7A 1VYRA 2E6AA 2QAFA 4O12A 5EA9A 2BXVA 3P61A 1JRCA 3P81A 1OF6A 5EBUA 4RCXA 3S9YA 3S5OA 1XBXA 2DU2A 4DELA 2C3ZA 3UWVA 1G67A 2FQIA 1OYAA 1N55A 3HQ1A 1OJXA 4BFAA 1X7FA 1TREA 2Q8LA 2BWGA 3IIVA 1ZNNA 5A5WA 3TW7A 4PC8A 4ZQMA 4QIUA 1XBVA 2QJIA 1KA9F 1FDYA 2CFFA 4O8RA 2FB3A 3ABQA 5E1QA 5HINA 2NLIA 1JVNA 3WJWA 1OFQA 1GVFA 1S5TA 2ZDRA 2VFEA 1D3GA 4O1BA 5AHNA 3TKFA 3MHGA 3BG9A 5D2VA 2XFWA 3G0UA 2Y7FA 1KFLA 3EXTA 1LOLA 2CU0A 3GR7A 5FF7A 4EF8A 1UB3A 3LV5A 2OMAA 1NAL1 3S5YA 4AEOA 4JNMA 3I7SA 3S0CA 3HPXA 4ORIA 5DBTA 4FF7A 3L66A 2Y89A 3NOEA 2JBMA 5CPOA 1XC4A 5FEWA 5EPDA 1H7PA 2VENA 1K7EA 3PSWA 3P5YA 3P60A 1Q45A 4KFPA 3NQGA 4PODA 1JCLA 1KFJA 2C0AA 2GVGA 3G1DA 5EKYA 3LI0A 1ZAHA 3PVFA 4UTLA 5E0KA 3SIZA 3QH2A 2DZPA 4MY1A 3WJZA 4DQWA 3JR2A 3TH6A 4UTJA 4JN6A 3G18A 1AL7A 3L0NA 2LLEA 4ML9A 3UWYA 1N8FA 3W22A 4A29A 4ZQOA 2P1FA 1EUAA 3UZ5A 1WBJA 4QAIA 3CIWA 1TPVA 1LRTA 4S1FA 1SFJA 3NQ7A 4LT9A 4OBTA 3PC0A 4WY0B 1LBFA 2H6RA 3W7PA 2E6YA 2R8WA 3IV3A 3GDTA 2CZFA 2PRLA 2NX3A 3QMSA 4GUJA 2VFDA 2B7QA 4LNYA 1GT8A 3W2NA 3OIXA 4HIBA 3LHYA 4YCPA 1IIGA 1GVRA 3TQ0A 4LC6A 1X6UA 3TE9A 3S6DA 2VEMA 4Y96A 3LERA 2A85A 3BW3A 2BZNA 2YXGA 2V9DA 5T26A 3UPBA 4FEZA 3IGSA 3L0KA 1TV7A 4WXZA 4DF0A 3LHTA 5I3FA 3U6WA 4M7TA 4LVAA 3CU2A 5CZTA 4A2SA 4JTFA 2NX1A 2CZ5A 4A2RA 3MP5A 5LGZA 1LLWA 3L9CA 1KM2A 1QPNA 1I2RA 4Y6GA 1W0MA 3W6YA 2ZZ1A 3OEXA 3UY8A 4UR7A 5CPLA 3IGUA 5FI8A 3T7VA 2FLIA 2FPTA 4DBDA 3DI1A 2C13A 2A5HA 4HNNA 3AJXA 4ICNA 1I2QA 1K8ZA 4Z1CA 2ZZ3A 2Z0IA 1JCMP 1DJQA 1EUNA 3G0XA 3GZ3A 3LRLA 3RK8A 4DO5A 1G7UA 1KFEA 3V75A 1KM1A 3GDMA 1H7OA 3G1VA 5DBUA 2VEIA 5LNWA 3S1VA 3QC3A 4JDBA 1W3IA 3B0PA 5KMYA 3A5VA 4O54A 3P80A 3LM7A 4O17A 2H90A 1Y0EA 4XWUA 3T44A 3PAJA 3W1TA 1XDMA 4O18A 4O11A 1ICQA 4LRSA 3MJYA 1YDOA 1ZAIA 1VRDA 3W7EA 3QSRA 3PWAA 3TQKA 4ZQNA 3NQ8A 4PTNA 5CPMA 5BOOA 4LW7A 3HG5A 1XKYA 3M16A 3TCEA 1RQHA 1OABA 6ALDA 4CQAA 3AO0A 3DFOA 3IGXA 1GWJA 2E6FA 4FIQA 1GG1A 1UUOA 1IXQA 4RK8A 4DO4A 1MZHA 1H7RA 4O16A 4K6AA 1DBTA 1ADOA 1ZENA 3KVMA 5LZLA 3DAQA 4XQ6A 5LNSA 3C2OA 1W8SA 1HUVA 2Q3RA 5FF2A 2NXIA 5LNUA 3QRHA 2PCQA 5HUPA 1WYIA 3G3MA 2Y70A 3N9SA 5FF4A 1NF7A 2CLLA 3I7QA 4JEQA 1EB3A 3FKRA 1X8FA 3EB2A 2EGZA 3EX4A 4ADTA 1H1ZA 2QCLA 3EXSA 3ZWSA 3C2VA 1SZGA 5G4WA 1SZEA 1A5BA 2V2CA 3N2MA 5IBXA 3NVTA 1V7YA 4CNPA 1PE1A 3MYPA 3NQ2A 4GRSA 1I45A 1S3HA 2V82A 2XN0A 3G3DA 4NUWA 3EWBX 1OX5A 5K7JA 4O1DA 3NL5A 4DEFA 2J9XA 3LCIA 3MHFA 4FO4A 2X2GA 2DZVA 4O0KA 1A50A 4CCCA 3O6YX 3UYCA 3VI2A 3TFCA 4I7VA 3SZ8A 1V5XA 4MY9A 4K7YA 1TPEA 3WFAA 3FIGA 1ZCOA 4Y90A 1YTKA 3VE9A 5CSRA 1F6PA 2VOMA 3TSBA 4LRTA 5FEXA 2H8XA 5HNRA 3TXZA 3GXNA 1KFCA 1Z41A 3BG5A 4UIOA 4AB4A 3GIYA 2WNNA 2WSYA 2IQTA 1A5CA 2J88A 1G6CA 5BNKA 2V2HA 1WA3A 4MJZA 2YPIA 3W1UA 4K8EA 4FNRA 1SW0A 4JS3A 1IXPA 3ZWTA 3UZJA 2H3DA 2VXNA 1TRIA 1VR6A 3DU0A 2RDWA 3W1LA 2FTPA 1NEYA 3W7HA 5I3GA 4WZHA 3M5XA 3LXCA 3BLEA 2V81A 3QQ1A 3G8RA 1JULA 4LU0A 3LBCA 4RZ5A 4UTKA 2OT1A 4HHPA 2ZFAA 3LHVA 4A22A 2ATMA 1VZWA 5C6MA 4RXFA 1S5WA 2NXHA 1FX6A 4MPQA 3HOJA 2E09A 1HTIA 3T78A 4EIVA 3EKZA 1XUUA 3M1ZA 3GKAA 1FWRA 2Y62A 5D37A 3B0VC 4UTTA 3STFA 4UTHA 4NNBA 4R34A 3M5VA 1JR1A 5LSMA 2VKZG 3EX2A 3G22A 3HBLA 1IXNA 2YYTA 5J5DA 1OX6A 3H54A 4UMBA 1QWGA 1O5XA 4BI6A 4AAJA 3W87A 3OA3A 5BMWA 1Q6QA 5HJLA 4O0ZA 3HGOA 3OVQA 1VJIA 2X1UA 5CZJA 5HWNA 2QUUA 3C52A 1A5AA 1TPH1 2GVLA 1TTIA 3A23A 3C4UA 2Q3OA 4HNVA 3H55A 3HGSA 2BLEA 2YW4A 3SW6A 3TA6A 5EMUA 3NM3A 4O19A 3SECA 4WJEA 3F1QA 3CB8A 4JTSA 2HS6A 1FCUA 5DCDA 4DF2A 3UY7A 1RV8A 2VEPA 3EX1A 3GLCA 2NUXA 5C2XA 1FCQA 2GPTA 2VELA 4MFDA 3W2JA 3W07A 4TU1A 3TSMA 4S2CA 2GQ8A 1F7BA 3LCGA 2ZRZA 1W5OA 4O14A 2CLEA 4AH7A 5F1UA 4UR8A 3TIMA 3OVRA 1TPC1 4JTUA 4N9EA 4PL1A 2YYUA 3GAYA 3MP4A 4FXRA 2J27A 1JQXA 2DJLA 4JIPA 5HR7A 2XN2A 1VC4A 3SGUA 3ATZA 5F4SA 1UBSA 3OG3A 4ZQPA 5AN7A 3BW2A 3BGGA 2CLHA 4ONVA 3MI6A 3ZR4A 1VYSX 1TRDA 4E0CA 1SSGA 1B3OA 4FHAA 4XZ9A 4AF0A 4GNJA 1GVSA 3MI2A 3W7CA 1LCOA 1YTDA 1VH7A 3QPZA 1QDSA 4RV8A 3RMJA 3FYPA 3HB9A 3NQVA 3W7RA 2C18A 1QCWA 1XXXA 1NFBA 3W1AA 5CGQA 2QCHA 3FLUA 4RJEA 3HGRA 1W5MA 4LS1A 1QMLA 2ZRUA 4JR5A 3W85A 4MOZA 3GYEA 3KHJA 1FWWA 5DCBA 3E0IA 2G97A 3KX6A 3TC6A 2C14A 3ANYA 2DZXA 1WOBA 4IQLA 4JX4A 3JRKA 1DVJA 3HIJA 4RZ6A 3L68A 4K7VA 2OX1A 1NF0A 3G0SA 4RZ4A 5F4XA 1H61A 1M5WA 3FOKA 2C1HA 5F1VA 3ZS4A 1I2PA 4RX0A 4UTIA 4QNEA 5HULA 2RDUA 1JRBA 3NYZA 3BGJA 1KM5A 3NL3A 1PL9A 1ML1A 2YZRA 1EA0A 1X1ZA 2VC6A 3G8EA 3RLUA 3O63A 4E2DA 1KW1A 1TPUA 3QJAA 5D05A 3QPYA 3CC1A 4ZQCA 4IXXA 3M7WA 3TK7A 4OV4A 5TQLA 1K3UA 1EP2A 5DN1A 1R30A 3CEPA 4A21A 4JYDA 4IX0A 2FFCA 4H4IA 1F2JA 2BX7A 4TO8A 1TYGA 1XI3A 2ZTKA 3FKKA 3W2MA 4KWWA 3TDFA 3N9RA 1RQEA 2HSAA 4GUHA 3NQAA 4JICA 2EHHA 1LBMA 2FIQA 5D03A 1U83A 1FDZA 2A2IA 4Z1BA 2ZRWA 1L6YA 2Y7DA 1KBJA 3S1UA 4AHPA 4XKYA 2A4AA 4HKPA 5G1TA 1PV8A 1LRQA 3GR8A 2E77A 3P8JA 3W74A 1HG3A 1I8JA 1YLVA 3HGJA 3BO9A 4N4QA 5KTLA 4JTTA 4D2JA 3GDKA 2RKXA 4NQ1A 1L6WA 3FS2A 2BSLA 4FNSA 3W7LA 2WQPA 5LHFA 3N73A 4LVBA 2YGYA 3S5ZA 1AW5A 1PHQA 3EEGA 2W0UA 3OVPA 2QCNA 1MXSA 3EXRA 3G1YA 4IMDA 3BVJA 3BLFA
chains in the Genus database with same CATH superfamily
3L2LA 1HJVA 4FP1A 5G2IA 1OC5A 4HP5A 1LLZA 2FGBA 3M0MA 1O7AA 2A6LA 2Z1VA 3HA1A 4XVDA 4JYEA 5K2ZA 3HG2A 4I3GA 4DO7A 4JKKA 3QW4B 1HJQA 2D0HA 3WSUA 1XPGA 1UJQA 3OQ8A 3VKBA 5AECA 2WMIB 3CV6A 4UNKA 5K3VA 1UWQA 4P8XA 2ZZ5A 4J3ZA 3TXVA 5KZDA 4KGJA 2ACSA 4N7QA 5LA0A 5F2MA 4QDMA 4OT7A 4NAEA 2AAAA 4NI8A 1C8QA 2GSHA 3GTIA 3CGTA 2ZWYA 5HJXA 3B97A 1HKKA 2FH8A 4NSBA 3WLNA 1EX5A 3GUWA 3DBPA 3WX7A 1HZYA 1QPRA 1XPYA 2WVVA 4Z2LA 4CN1A 3TN3A 2YOCA 2QYGA 2V3FA 3TVAA 1NP0A 5HBFA 3E1F1 4S3BA 5FSEC 1W17A 5CG0A 4Q8UA 3W7MA 2G8ZA 3S3GA 4MLRA 4O50A 3A47A 1TE6A 3GG7A 3WBWA 3UXIA 1NFPA 3OBKA 5AHFA 4D6HA 3N2BA 3IWPA 1VF8A 4CD7A 1PKLA 3W7IA 3UXKA 3EDKA 3QHOA 4ZEPA 1OGSA 2Y7EA 4NL1A 3H8AA 4N2YA 3GNRA 2E1DA 4LYKA 4Q6JA 3M6YA 1WNOA 1FWJC 1WXYA 3UWUA 1TPB1 1TELA 3R43A 3VCNA 5HA7A 3QMTA 4MZ8A 3AMLA 3IVUA 5JXQA 4AVNA 1DJXA 4C7DA 1NQKA 3MUIA 1JFHA 1TMHA 3TN5A 3VDHA 1XBYA 1H7WA 1F9CA 1XBZA 3C0LA 3P0WA 4ILSA 4DBEA 5CPTA 2R24A 5A6BD 1W1B1 1J5TA 1QI0A 2OSWA 4IP4A 1V8EA 4HTBA 4S3KA 5CPSA 1A5LC 3OVGA 1HO1A 2C16A 2D2OA 3GK0A 3AHVA 3KTSA 4JNZA 2PP1A 1ZBKA 1C9DA 2MNRA 5E6YA 2R1NA 3QBUA 3RX3A 2OB3A 4O53A 3WD2A 4JCLA 5AYBA 3W71A 5FCZA 4EPBC 1ZBVA 4NVTA 3SCRA 1ECEA 3VMOA 2J6XA 1YDYA 4LQ1A 2DT3A 5HPOA 3GUGA 4AIOA 3AS0A 5HANA 4M1RA 1YIXA 5K9CA 2WZHA 5TAOA 1VFTA 1QPQA 4AUBA 2F2KA 3WJSA 1RPXA 4OWGA 3M0JA 4NZJA 4DZAA 2CZEA 1EXPA 1G69A 2IPWA 2CLFA 4HOXA 1HJWA 3WK3A 3R4IA 4U2YA 5C55A 3STGA 2Y88A 4JKLA 1VCFA 2DW7A 2R14A 2J25A 5DRCA 1E51A 4DLMA 1JCTA 2P0IA 1FOBA 3FYOA 1FKXA 1DEDA 3LX9A 4FXSA 4LYRA 1QVBA 4TX8A 4HYVA 3SI9A 4EX4A 4CNSA 1CXIA 4NJKA 4PSPA 3HN3A 3U57A 2VQUA 1O66A 1U5JA 3R0KA 3FK4A 3NURA 4FLSA 4QR6A 1QR7A 3JZEA 2ZYFA 4JY9A 2VFIA 1QTWA 4DUVA 4HZMA 5DY3A 1VCGA 2XTKA 2ZA2A 3W2UA 4W7VA 2QDGA 3EWCA 5HUOA 3TJ4A 3SCSA 3CPGA 1EP1A 2J9ZA 3VFLA 1PIGA 3AZTA 1WBHA 5F2IA 1Z8AA 4PBEA 1YNQA 2QR6A 2XUCA 4WJ8A 5BW6A 1IR1A 2PWVA 3GIQA 4WUIA 3E0VA 5TBOA 4RLIA 2WCSA 2OLHA 1B4KA 3LCWA 2WHLA 2ZE0A 2PTWA 2ZC1A 1J18A 2F84A 3SCVA 3P7YA 5FSDC 3W83A 5A6TC 2DPEA 5I5RA 1S2TA 1YDVA 3D0CA 5XIMA 1IT0A 3CWNA 4I7UA 6XIMA 1YPXA 1BTMA 1JDAA 3DCPA 3SN0A 2CWNA 1E1FA 3EX3A 2QF7A 2NV1A 2I57A 2ZUTA 4B5TA 1A5UA 3W25A 3PAOA 5F2GA 2GZXA 4GH3A 4IPNB 2F6XA 3AZRA 3T05A 2C1GA 4EF9A 2G50A 1RZMA 4R7JA 2YL8A 3VO0A 3WCZA 4OGZA 5BWFA 4D8LA 3DFSA 1KCXA 4CKQA 2CLOA 2G3IA 4YWSA 3CZJA 3N14A 4AY8A 4JY8A 5G2HA 2WKLA 2PB1A 4DZIA 4CUCA 2ISVA 3QXBA 4FLQA 2XIQA 3VU2A 5I09A 3G1XA 2PF8A 1WDSA 4NJJA 5H8MA 3P82A 4C6CA 1F74A 3EZ4A 5ECVA 1QO2A 2Y4SA 3P84A 1OY0A 3VFCA 4PR4A 5LIKX 4QISA 2B7PA 1VFSA 3KVLA 1KM0A 4HSOA 4H6EA 3VD5A 1JUBA 3I3EA 3WFLA 4X61A 3MSYA 3SJ3A 3KRBA 1DJNA 3CL7A 2WNQA 2W9MA 5D2TA 5DT5A 3P93A 3EOLA 1T8XA 1EC7A 4N6EA 7TAAA 3W75A 1NVMA 2VURA 4XB3A 4ERGA 2IXVA 3GYCA 3ALFA 2XFRA 4D6GA 3RDKA 2A0NA 5DANA 2YKKA 4GYJA 1D8WA 3AYSA 1CLXA 4K8HA 3HMCA 4H6KA 4MZ1A 7TIMA 1JZ3A 4LV9A 3F7JA 4C6EA 3BZGA 4GG9A 2W79A 4W86A 3L5AA 2FPYA 4QBXA 3AISA 4GABA 3U2CA 1M6JA 1AW2A 3IVSA 5FAJA 2R6OA 4FX8A 3UR2A 3VABA 4E4PA 4B3KA 3RLVA 1YNPA 1REQB 1XM3A 3B4YA 1N7KA 3N04A 2ZZ6A 3V4BA 1L2UA 1XD1A 4X60A 1X98A 5XINA 1L9WA 2WOQA 1OG0A 5C9ZA 4RE4A 2OZTA 1GZGA 1BGAA 2GOKA 1S1RA 5C70A 4JQAA 3L21A 3ZR5A 4XKYB 4W93A 4DBUA 1TIMA 2QZRA 4LUTA 1K8YA 1HT6A 2OO6A 4JHMA 2NWSA 2EG6A 4YMZA 2QCGA 3CQHA 1ONWA 3I65A 3DENA 3B8TA 4JX6A 2PTDA 5KZMA 1VQTA 4IJRA 2XU2A 1TPFA 1OF8A 4E4FA 1XR2A 4PUDA 3U2EA 3U2OA 1O4UA 3NG3A 1Q65A 1QNPA 1TZZA 1HF6A 1AK5A 3ZMRA 4QJ4B 3WLSA 1B4EA 5AHIA 1B3XA 4ZE5A 2DZUA 2GSEA 3GRIA 5C8BB 1S1PA 3I68A 3MANA 3NR0A 5IXEA 3GDBA 1O95A 3NDYA 3BQ6A 3USZA 3Q65A 1A5KC 5A8PA 3BJTA 1K4HA 4K68A 2VNCA 1UQYA 3AIQA 4HN4A 4Q33A 3WD1A 2BV9A 3EGJA 4A3QA 4EOUA 2HJPA 2XPKA 1A47A 5I3HA 3PANA 3GX9A 1Q6FA 3UXLA 1G4EA 2HV5A 3GAKA 2FKPA 5CXPA 3AIRA 4HYRA 3ANUA 3BW4A 4RV3A 1F8IA 1L8PA 3VKJA 1VS1A 3APYA 2CBJA 3F2CA 4G9PA 1ISXA 3H7UA 1AQHA 3CHDA 2AQVA 3I6TA 2Z27A 4FXFA 2G96A 1IF2A 3Q4DA 3QZ6A 1BF6A 3MTWA 4Q4PA 4ZO6A 3SRKA 3O0FA 3M47A 4ASTA 4QG8A 1ZAJA 1OK4A 3BCFA 1P0NA 4OTKA 1VJSA 2YL9A 1P1XA 2PDMA 2PF0A 2XH0A 3GXTA 1J6OA 4QRNA 1Z89A 3MYOA 4YVPA 2PODA 4KKXA 2AL2A 1OHLA 2GGGA 2VCBA 1UBPC 5IOBA 3DGBA 3AIVA 2X1TA 2V69A 4N4PA 5EY5A 4MF4A 2V8ZA 4QROA 3CQKA 1BYBA 1DJZA 2BP1A 4DAIA 5I3IA 1EKOA 3WLHA 5D38A 4GINA 1UWTA 1OZQA 4J28A 1IWBA 2P10A 4IMCA 2NQJA 1GG0A 2REQA 3N34A 5D2WA 2XVKA 4PUUA 1W3NA 2PBOA 3THUA 2QJJA 1WX0A 5D9PA 8A3HA 2H9AB 4NJIA 1CENA 5EMKA 4YWIA 3HQPA 1PVNA 3G1RA 3BUVA 1WOAA 4UTFA 3MMTA 5U4NA 2DJXA 5A8GA 5CZSA 3NSXA 4M6VA 3VUPA 3QYQA 4GKLA 3FVMA 1IWAA 2Q09A 2EBNA 3H2MA 3QQ0A 4AY7A 2D2GA 2BNJA 2Y8UA 4H9UA 1FXQA 1QASA 4WSJA 1GOXA 4KEVA 3VUSA 4MNLA 4QHRA 1US2A 3DKLA 1R3WA 1C8YA 3B0XA 3KBMA 3NM1A 3URAA 1KLZA 3MUY1 2VGBA 3H53A 3ZVIA 5A69A 1V6XA 2AAMA 1ZP3A 2PS2A 3GU1A 4XTDA 4H9VA 1MYRA 1Y8BA 4XAGA 4JQ3A 2J24A 2VI0A 4NRSA 3KBJA 4WX2A 1W56A 2PURA 1AVAA 4DPPA 2YX0A 1B9BA 4IP5A 1JDEA 4IMGA 2OODA 2WANA 3CUZA 1CXFA 2ZCGA 1T41A 3O6CA 1S2CA 2ON3A 1L8NA 1KLYA 3PPHA 3F4NA 3WNKA 2A7NA 2ZUMA 3SR7A 2ZIDA 1L0PA 3KZSA 2QCDB 2YXOA 4YVXA 1IIHA 1JUEA 1XIHA 2JKAA 5H2ZA 2TODA 4UFKA 4L7ZA 1GOIA 2DZWA 5AYZA 4BQ5A 4LYQA 1UD5A 1FH7A 2VTFA 3TONA 2I9UA 3A3XA 3IGHX 3TW6A 1QBAA 1MWOA 4Z2KA 3MQTA 2X8RA 3W84A 1PPIA 2GQ9A 3T0AA 1J96A 1KR1A 2R94A 3M5ZA 3EWWA 4JHZA 3T4WA 4P7NA 5B7YA 2DIJA 2V5JA 1FWEC 3BL3A 1ZY9A 2PDUA 1HKIA 1GJPA 1XLHA 1RCOB 3TYUA 3WUFA 4GZ7A 3JS3A 3CT7A 3S2CA 4Y9PA 3N29A 4CVWA 3VOIA 4ZFCA 1DXIA 2H3BA 4C1NA 1FWHC 1W5PA 2C79A 4LUIA 3WD3A 4GE8A 4GJ1A 2R1PA 1OFPA 3RCYA 2Z25A 4UCGA 1TWSA 3LGGA 3U2ZA 3PZMA 2P76A 1K7FA 2WZMA 4ES4A 4PMNA 3R11A 1GYNA 5A94A 4JX5A 2PGWA 3NSNA 4CVUA 3WKZA 4LOCA 5G2WA 3PBUA 4QJ1A 3P6LA 3ZO9A 6REQB 3MCMA 2QJGA 1QK0A 1G01A 1YTEA 5AZ1A 1EJTC 2P3EA 5D04C 4HHLA 1RBOB 5AC8A 1A3HA 4GGHA 4GBDA 1LG2A 3DYOA 3PK7A 4GCAA 3UJEA 3AOFA 4H8HA 5FEPA 3W01A 2IMRA 4UTTC 3CPRA 3TROA 4OV9A 4ZFMA 2OGJA 4HK5A 4J4KA 3QTPA 2JALA 3GD6A 4UXDA 1BSIA 1P43A 1VIWA 4TVUA 1DWGM 1MDLA 4LVFA 2J75A 1FWGC 3VMNA 2IKJA 2VFFA 3LHUA 3HG3A 2REQB 2BODX 2NZLA 4EKJA 3NO3A 1EQPA 1CEOA 3O8AA 1IEXA 1K7XA 2ZC8A 1TPWA 3PZTA 4XD4A 5M03A 4WKHA 1ELSA 4MFEA 1E1CA 3BAJA 3UU0A 1KCKA 3VD4A 3LCFA 8RUCA 1KFKA 3UBPC 4F0SA 2QF8A 1AMKA 4GIAA 2WVVB 2B7NA 1JCJA 4P5UA 5C54A 4M56A 3W7OA 3S2MA 4N0RA 1DQXA 1NU5A 4KWVA 3UCDA 1GEQA 4BF9A 1G7VA 3GH7A 3NNTA 1NWSA 3N4FA 2V0TA 4AWUA 3PG9A 2Z6JA 4MNMA 5C9WA 3WQ6A 3VC6A 4CCDA 4IL0A 1RJRA 3QW3A 1H1YA 3DZ1A 1MNSA 3VD9A 3PNZA 4B4HA 1X6LA 5CQ1A 3S2JA 1B5TA 5F2LA 1V79A 4MLJA 2D69A 1ONRA 4KFNA 3ALGA 4KFOA 1W3KA 1I9CB 1QXLA 1K02A 2ABBA 3W76A 1KV8A 1UWRA 4TOQA 1V08A 1OCQA 2ZRXA 3BLDA 2JFEX 3WJXA 5C2CA 2WC7A 3MU7A 3VOJA 3W4RA 3MV01 1J0JA 2G0WA 1M9HA 1JYVA 4HD5A 1A4LA 1BG4A 4JTKA 2PZ0A 4RE3A 1KBIA 3ITYA 2R1KA 4BJHA 2Y8VA 1J0HA 4IG2A 4GVGA 3KFTA 3E0LA 3OLDA 4HPJA 4JQ1A 2A7RA 2JGQA 4AZIA 1VHCA 1PIIA 2I1OA 1K9TA 2TMDA 3QM3A 4F2TA 2E0PA 1LOQA 4GOAA 1FBAA 3TU9A 1Q6LA 2VZUA 3OG2A 3L4VA 5D02A 4DJDA 2E6AA 4O12A 2GJXA 3BMVA 3MVIA 1O1HA 3OQEA 3S6OA 7A3HA 2DEPA 3S9YA 2C91A 1XBXA 4ZXLA 1QBBA 2DU2A 2ZUUA 1G67A 2FQIA 3R94A 1N55A 3WEMA 2OPJA 4DX3A 4BFAA 3UA4A 2Q8LA 3TW7A 1EC9A 4EXAA 4L9XA 1W3JA 3VM7A 1Q2SA 4DXKA 2PCEA 2FB3A 3ABQA 3UESA 1R5YA 3T1GA 2WLZA 4H9XA 5HINA 2XSAA 1OFQA 3GXDA 4W8AA 3N6HA 2ZDRA 1I6NA 3KW3A 3TKFA 4ZCWA 3MHGA 2ICSA 3FDGA 4PUWA 2J62A 2XFWA 1RY0A 3ENLA 4BQ2A 1LOLA 4Q8PA 4KWOA 2D23A 5CC5A 3BOLA 1GUVA 2CITA 2ZXDA 4JNMA 3HPXA 1BRLA 4WK9A 5IFPA 4F2UA 1T8QA 2JBMA 2X2YA 4AX6A 4TXEA 2HISA 3NIYA 1H7PA 2VENA 1K7EA 1ADDA 1Q45A 3NQGA 5EKYA 2C0AA 1UH3A 4NY2A 1ZAHA 3VIIA 3IUIA 4MWAC 5E0KA 2GJRA 3SIZA 1V6TA 3SUTA 4MY1A 3FJNA 1VENA 4M8UA 2RJGA 4ML9A 4C60A 4BEQA 4A29A 2HRWA 1EUAA 4QAIA 4S3AA 4S1FA 3T09A 4AC1X 4OBTA 3PC0A 3AXXA 1LBFA 3W7PA 4MG4A 3IV3A 2CZFA 2B7QA 4LNYA 3L12A 1GT8A 4PCPA 1MNZA 4YYCA 4MAZA 3LHYA 3BJSA 2FZNA 1EO5A 3S6DA 3BW3A 2YXGA 5EFFA 3V16A 1ESWA 5D8WA 4FEZA 3VOCA 3VX0A 3BURA 4DF0A 5FJTA 2EPOA 3LHTA 4DLFA 4J35A 9CGTA 2PWFA 3H24A 1HKWA 3CU2A 4A2SA 1R3QA 3GG0A 4JTFA 2YDQA 4A2RA 4MJ2A 2GGIA 1I2RA 1W0MA 4LEFA 4UR7A 5CPLA 5HMEA 3BMXA 1E0WA 3T7VA 2QW5A 3CPUA 1DJWA 4KEZA 4C6QA 1I2QA 5TF0A 4QEHA 4Q8WA 3CMJA 1EUNA 3EEZA 4D6DA 3GZ3A 3JUGA 3PNUA 1G7UA 3HV9A 1OD0A 1ZJBA 5A8MA 1JD7A 3G1VA 3QC3A 4JDBA 2WZTA 3B0PA 4O54A 3P80A 2WMGA 5EU9A 3VVGA 4A8NA 1K4GA 3S83A 5BCAA 5A6SA 4GHRA 4B5XA 4C91A 3PAJA 1XDMA 1XLCA 4O18A 4O11A 4I9TA 1NWRA 3PWAA 3DYPA 3TQKA 5BOOA 5CPMA 1XKYA 3ZSTA 1TVNA 1RQHA 6ALDA 1EH9A 3U3HA 3H12A 2E6FA 2EPLX 5LXXA 3TJIA 1Y65A 4O16A 2DQXA 1DBTA 4U10A 2CHRA 1W8SA 1HUVA 1UP0A 5LNUA 3QRHA 2PCQA 4LUSA 1E5NA 3H26A 2HE8A 3G3MA 1MW2A 3G77A 2Y70A 4FS9A 5FF4A 2J8TA 1NF7A 3FEQA 3FKRA 4IF2A 1X8FA 3WBYA 5DQPA 1V3IA 2V2CA 2XGIA 1V7YA 3VM5A 3THDA 1EIBA 4XD6A 5DFAA 2E4TA 4GIEA 1S3HA 2XN0A 1GQKA 1W1PA 3WLKX 4KESA 2ZUWA 1JPKA 4ICCX 4DEFA 3R25A 3LCIA 3MHFA 4FO4A 4CCCA 4LBRA 3UYCA 1IGWA 1JZ7A 4Z42C 1V5XA 4MY9A 4ZXOA 4K7YA 2PDKA 4UR9A 1LWIA 2EXOA 2DSKA 4Y90A 3WFZA 2VOMA 1NP2A 3RPTA 1Q66A 5M3WA 5HNRA 3TXZA 2HZGA 2VZVA 4CEUC 3WMLA 3BWWA 4ZGYA 4IMAA 2EG7A 3LMYA 3ZLHA 1Y7VA 1SW0A 3K1DA 4JS3A 1IXPA 4RE0A 3VX1A 1NH6A 3UZJA 4RNFA 2VXNA 2EJ1A 3W1LA 2FZ8A 3W7HA 3PFMA 4YTQA 1UKSA 3WNPA 1JULA 3CS2A 2ATMA 2OZ8A 3H2NA 1UD3A 1S5WA 3L23A 2E09A 3VGFA 4XX6A 3T78A 4EIVA 3M1ZA 3B0VC 3AQUA 3H4GA 1JR1A 2X41A 2VKZG 1PB0A 1IEQA 1QWGA 1O5XA 1Z69A 4AAJA 1BVNP 3OA3A 3GWQA 5BMWA 4Q7BA 3TN6A 1HP5A 4WSKA 4L6OA 4W84A 4HNOA 3OVQA 4M80A 5HWNA 1TWIA 1UH4A 3S2NA 2GVLA 1TTIA 4D9PA 2HBXA 1P7TA 2Q3OA 5LIUX 4S3FA 1KQYA 3R0UA 2B81A 3NCOA 3OZYA 3TA6A 3SCTA 3GW3A 4O19A 4CU8A 1UD4A 4JTSA 4DF2A 3CUXA 1GCYA 2QMJA 3GHTA 4F4RA 1ISZA 1V02E 4HTYA 5HJYA 3SN4A 1F7BA 2ZRZA 3LCGA 1XW8A 2DH3A 4AH7A 4DY1A 1C90A 2DSWA 3L7RA 3GVWA 3SQMA 4Y2WA 5I03A 1WDPA 4AZGA 3LYEA 5EBAA 3K8KA 4X0NA 1CWYA 2DJLA 2NW0A 4XKMA 4JTAA 3ZJ8A 1VC4A 2L5HA 2F61A 3SGUA 3N4AA 3ATZA 2QVHA 4HVXA 4ZQPA 4FR1A 2NQZA 3BGGA 2CLHA 3RRXA 1W9PA 3WD0A 1KBBA 1TRDA 4C6DA 4E0CA 1MMFA 4FHAA 4XZ9A 3QGKC 4GNJA 4J2PA 2IPJA 1B54A 1J0IA 3MI2A 5EFDA 3W7CA 1F4HA 3QPZA 2NSXA 3FYPA 4RL3A 1DXEA 1RH9A 3VOGA 3FW6A 1XXXA 4IFKA 3W1AA 4IH3A 4B2DD 3CL6A 2EPNA 1XLLA 4RJEA 3HGRA 2PUZA 4XAYA 1SM9A 1XRVA 2OGYA 4DJFC 1QMLA 3KWSA 4N42A 1Q5MA 3AUOA 5DCBA 3KHJA 3KX6A 4YS1A 3TC6A 3ANYA 1GKRA 4TTUA 2ADAA 3B8IA 3G0SA 3C86A 2PTYA 1MXDA 1H61A 1M5WA 3LNMA 3OA5A 1E40A 1RBAA 4QNEA 2RDUA 4AD0A 3NYZA 3BGJA 3NL3A 2CNCA 1PL9A 6A3HA 1EX1A 4C5YA 4C5ZA 2YZRA 5FL1A 3RLUA 5D05A 1TPUA 4UQBA 5J8LA 4ZQCA 4ICMA 3R79A 3TK7A 3M7WA 3WQ4A 4C6KA 1DJIA 4AYSA 5E0FA 4IQDA 1K3UA 1BHGA 3CK5A 3WUEA 1IEVA 2CKRA 1TYGA 4YVVA 1EYWA 3FKKA 4NAEB 3N9RA 3E2QA 1YX1A 1RQEA 3BAWA 3WNOA 4KH2A 4GUHA 3NQAA 2EHHA 1HKVA 3WUGA 5A6JA 5D03A 4Z1BA 1DJYA 5ABGA 1L6YA 1T6MA 5D8ZA 5G1TA 2PDLA 1LRQA 1JNEA 1CTNA 3IK2A 2X1IA 2GLKA 1YLVA 2JF6A 3F4VA 3MSRA 3LG3A 3S47A 3WBEA 4L1GA 1U33A 3U5YA 4D2JA 2ZX9A 1L6WA 2BSLA 5LHFA 1AW5A 1PHQA 2W0UA 1SGJA 3EXRA 3G1YA 4IFOA 5BXPA 3F2BA 3WLJA 4IIGA 1P6BA 1H09A 4YIWA 3NAVA 3LOTA 3UG8A 1EEPA 2FVMA 4YTUA 3LPFA 4AYGA 2QMKA 3M0VA 3CBWA 3W1XA 3WK2A 3MCOA 3WO8A 5MHBA 5AYXA 3ARTA 1OM0A 1X96A 2DP3A 1XLFA 4Q8MA 3N2XA 2OKOA 4RZBA 1UKOA 4HU0A 1FHVA 1UW9A 1A53A 1SJCA 4U5KA 1F05A 1E3XA 1VD6A 4GI8A 4KIEA 2NT1A 4FNUA 4L5ZA 2VMFA 2JEPA 1XLBA 3ARUA 4PL2A 3A13A 3N2OA 3N2TA 2ZXQA 4H9ZA 4AXKA 3UVIA 4PMOA 4FALA 1KKOA 4RPPA 4H7ZA 2H9AA 1THFD 3HG4A 3U4AA 2I5QA 3A4AA 2E67A 1R2SA 3LRMA 3U8GA 3PY2A 3OHIA 4C1KA 5DMNA 4NIRA 3C0QA 4K37A 5GNZA 5DX7A 4XO7A 3WF2A 1XL9A 2I9EA 5GJNA 2HNHA 2ZBTA 1MVYA 3W24A 2I56A 4IJBA 2XM1A 4UFMA 3IUHA 5I3KA 4AHOA 1Z9AA 1E1CB 3W26A 3P67A 4B9YA 1VCVA 4MB1A 3IS4A 4FLRA 3BAIA 4J27A 4K3ZA 5CC7A 4PUKA 2E8ZA 3C2FA 2XVLA 1X8CA 3B9OA 3NGFA 3S42A 1BYDA 3W73A 3CZ8A 3V18A 4K39A 5D2YA 1XDLA 2KAUC 1J11A 2YZ5A 1Q6OA 1UG6A 5CCZA 1LUCB 1Q6GA 5I3JA 5JH2A 2DW6A 4AMCA 4Z1AA 2FMOA 1EOMA 3NQ6A 4Z1DA 1JZ2A 3EDJA 1GHRA 1R47A 4LS0A 4R85A 1Q6EA 3EYPA 4C6NA 4GYKA 4MPKA 4DBSA 4KEUA 3B03A 3WELA 4AIEA 3USBA 4MHBA 3ZYZA 5ABTA 3Q58A 3NDOA 4B2DA 1GOKA 3PZ9A 2WHJA 4GO9A 2IS7A 2YCLA 4WVXA 4DWSA 1XV8A 2BGQA 3I6RA 3RPDA 3TTYA 4E2OA 3C3NA 3AAMA 4IXHA 1RA5A 3GTHA 2J7BA 3EMQA 2PGRA 1UC5A 3LV6A 2ZZ4A 1F73A 3W72A 1XIDA 1H3GA 3A22A 5G5IA 4H83A 3FN9A 3VIPA 2WC3A 3CNYA 8TIMA 4AW7A 1M7OA 4B91A 3CYVA 5CG7A 1JPDX 1VGAA 1S2VA 1O6IA 1R87A 4NASA 4NZ5A 3G24A 1J9YA 3NPVA 1PS9A 4P61A 4YTRA 3LCHA 3W2LA 3UFYA 3GW0A 2VFHA 4UTMA 1XJBA 4PRWA 4AMAA 2F7FA 3M0YA 5KZEA 1HFBA 1V0LA 4NXKA 4MADA 3TJXA 2ZA3A 3L2IA 2V5BA 5CPQA 4M0XA 4M29A 1JG9A 3STCA 3WNLA 4LUYA 2TSYA 4R33A 3EWUA 1GONA 4GUIA 4NILA 1Y5XA 5BOEA 2V3DA 2G3FA 2Y6ZA 4TUFA 1R2TA 3C56A 2YB1A 4MGGA 3DHPA 3LHZA 5FJUA 1K9FA 3UWZA 3EOSA 3WEOA 1Q8AA 4IJCA 3UW6A 1E0XA 3R7MA 3UERA 4FNQA 2X1SA 3LGEA 4J3WA 3WJYA 3OIHA 2CXGA 4FIRA 3PBMA 4JIIX 4CNNA 1FWNA 2V30A 4FSAA 4F9DA 2OEKA 1V93A 4AWSA 4P7OA 2I5GA 1XLDA 3VGGA 4LS2A 3KP1A 3D6NA 4E8CA 3PS7A 4PCTA 3LA4A 4U4MA 3VE7A 4OJYA 2WJZA 3R8GA 2QIWA 4DIAA 1KGXA 4HPNA 1WXZA 3O7UA 4IP7A 4NJHA 5H6HA 3SUWA 5A2BA 4TX9A 2CLKA 2Z6IA 3F4WA 1H63A 4ALDA 2AKMA 4C1LA 3DEQA 2C0HA 4A3YA 3L4WA 2EPHA 1ME9A 3WG6A 2BOGX 4UZSA 3WLLA 1MW1A 2VVSA 4HT3A 1D7KA 3SSZA 2JEQA 2UV8G 1MO0A 2D22A 5JVLA 2WNWA 1HNYA 4XG1A 2V5DA 3TTQA 3RX4A 4GXPA 4J7RA 4LEQA 3A5FA 4OU1A 3EDFA 4ACZB 1UKQA 5FJIA 3W28A 1TIWA 4PMZA 4BY3A 4LB4A 5FJOA 4NAFB 4ZTYA 2QUVA 3QF0A 1QOXA 3PN8A 3CZKA 1P0KA 2OKTA 4ZOEA 2D2HA 3SY1A 3VNIA 4JTQA 3C2YA 2DY3A 5D9MA 1HP4A 4GFSA 4KRTA 5JBFA 2WMKA 4ERAA 2DFAA 1PO9A 1GQNA 2J8FA 5FKYA 4O52A 4F48A 1CGYA 1RQBA 3QSTA 5D33A 2NQ9A 4ROPA 4O10A 5I06A 2BOEX 2X05A 1J5SA 1C8XA 4C90A 2PLMA 2PP0A 1PTGA 2E1WA 3PB2A 1W3TA 1XC6A 3IUDA 3S6TA 2R1MA 3NFUA 4Y9AA 1KXVA 3ID7A 4WDXA 1YHTA 4H8UA 2D3NA 4C65A 3GXMA 1S3TC 2XDFA 3XINA 1EF2A 4RUBA 1PIFA 3SCWA 1ALDA 3N15A 3ZR6A 4MUPA 1Z44A 1XIJA 3UEQA 2AQWA 2DORA 4GQBA 1SO4A 3M9YA 1OX4A 1PTAA 5EL1A 1TTQA 4PMXA 1GNXA 4IPPA 3NQBA 3W6MA 3DUGA 2W6RA 1AG1O 3EB3A 1XUZA 3KL5A 3WL0A 3OYXA 1Q4WA 3EB4A 4Q8NA 2EKGA 4CQCA 2X1RA 3MPGA 4PRTA 1K6WA 5LIXX 1H1NA 4GI9A 5FF3A 1DJGA 5A3HA 1RXOB 2QUTA 1TV5A 1UUMA 3L65A 1A0EA 3SGGA 4AF0B 1F76A 3W9ZA 3RUBL 1Q7ZA 3K46A 3PBVA 3T8LA 1ZGDA 3G1FA 3ORWA 5JBEA 5LGXA 1YXCA 3PSVA 1F4AA 2OEJA 3II1A 4GQGA 3UETA 1CLVA 4QJ5B 1VEPA 3EAUA 5U7SA 3FA5A 2AL2B 2BVYA 1F3TA 1SW7A 2IPGA 5JMUA 3NZPA 1XLAA 4Q8TA 3G1HA 3OZOA 3BLIA 1ZHAA 5SWUA 1T0OA 3FSTA 1W1ZA 1A3XA 4IUOA 4QE1A 4DHGA 5HQMA 2C1IA 4CD4A 4NU7A 3E6EA 3ZVHB 3VIJA 5G4EA 3B0UX 2V5KA 1BWKA 3G1SA 4DJEC 3PBWA 4G2DA 3TQPA 5CBJA 4AWEA 2BTMA 4XK2A 2O4QA 5CC3A 1XD0A 1SU5A 2AQOA 3UF9A 4QM1A 3GFZA 4DM2A 5F7UA 2ZWZA 3BK0A 3R1ZA 3M5YA 2GWGA 5K9XA 3IJ8A 3ZT5A 4I8YA 5B7ZA 2H8ZA 1Q3NA 3C2EA 4NYUA 3R5EA 1KRMA 3KDOA 3AYTA 4JFVA 2JKEA 4ZENA 1RLCL 4LH8A 3R8RA 4S3DA 4PUMA 2ZZ2A 2RGMA 2XH4A 3O2LA 1ZUAX 2PFHA 1KM6A 4TIMA 3G6LA 4CU7A 4FB7A 3FX4A 2ISSA 3VKCA 4ZSTA 1I2NA 3KBVA 2DIEA 1JUKA 3MDUA 3Q37A 4YU1A 1E9IA 5LNRA 3R8HA 1M68A 4WD0A 4AD1A 1W5NA 1UP3A 1O60A 2Q01A 4W4QA 5HWMA 5EMLA 2OWWA 4O1CA 1AH3A 4JIQA 1EOKA 2B0MA 1OFRA 3H23A 4PBFA 1CDGA 3NQEA 3LS9A 4Q4OA 1SSDA 1FDJA 5CPNA 4O1AA 3UD6A 4HU8A 4ADUA 1SVDA 2PU1A 1JCXA 1W1TA 1XLJA 3BLPX 3DKJA 2CZVA 3PUOA 3T2QA 5KSWA 4YTSA 4AD5A 1UR3M 1QATA 2WM0A 1VFOA 5EMJA 3VNMA 2X0HA 4D6JA 4IUGA 2XZ7A 3EKLA 3OGVA 4PYSA 3F03K 1IQ8A 3UG4A 3P74A 4CD6A 3Q67A 4L4LA 3V1PA 3OBEA 1E6RA 3O6AA 4X22A 4QDWA 1QWKA 4WDTA 3TNOA 3CIXA 4H7CA 1Q8JA 2WSQA 4R27A 2Y5EA 2Z2AA 4QG9A 5CC6A 1S39A 3C0SA 3KM8A 1US0A 3K8LA 1H5YA 1PEZA 1KFBA 2O9RA 3URBA 1VKFA 3ARQA 1LORA 5HQEA 1EZ2A 3SAZA 3GTXA 1OFOA 3N13A 3QZEA 3LD5A 4PMUA 3T8QA 2MANA 1ZJIA 3HPSA 5D9NA 5M17A 3VIOA 1VYPX 3H2EA 4ZB5A 4WGXA 3ZQ9A 3VDCA 1OX4B 4HNCA 4H41A 4UC5A 3RM4A 3ZLFA 3K8MA 3ABOA 3M0IA 4S3EA 3GHUA 2TYSA 2TAAA 3WQOA 3M0XA 4QCFA 4XVEA 1R86A 4DRSA 1MSSA 3RYSA 4XD5A 3J7HA 4Z2GA 3NQFA 4ERIA 4JTEA 1GQLA 1OC6A 2FDSA 2O4MA 4OHQA 4RKAA 1KCLA 2POZA 3KOFA 1JL8A 3WLOA 3LZ3A 2BMBA 3EWZA 3DIPA 3MVTA 1GJWA 3N3TA 4PTDA 1T40A 3SN1A 4UWMA 2Z4GA 1IZKA 1G4TA 1Z3NA 3CHVA 3DN5A 3NPUA 4FNTA 4CQBA 2OCZA 3NA8A 2ZICA 2E5CA 4WKAA 1IYXA 2E5DA 3R58A 3UZYA 1JEZA 2BASA 1ZL1A 2QJHA 2WVUA 5HQLA 3MUAA 3VD7A 1XYAA 1B3WA 4JZ5A 4NXSA 2W4XA 3RIKA 4IIDA 1GVQA 2NV2A 5ECUA 1O94A 4BHYA 1LF1A 3B9NA 1SZNA 4CQ8A 1W1A1 2EKCA 9XIMA 1KV5A 1H62A 2RHGA 2HDJA 1KM4A 3MSGA 3GDRA 1R2RA 2IKIA 4W7WA 2CW6A 5E6ZA 3GZAA 4XZLX 5KITA 4J3UA 4UOJA 2ASHA 3WL1A 4PCSA 4IIBA 2Q02A 1EYEA 1EEXA 3C3UA 4UFLA 1XCWA 4MB5A 2YFOA 2DUXA 4HJWA 1W32A 5DXXA 1QI5A 2CETA 3WH6A 3FGCB 2F6UA 4GPNA 2FYMA 5BZAA 2WLYA 3ARVA 1JNDA 1LWHA 3D5HA 3MWAA 3QV8A 2Z28A 4GX9A 1UD2A 5G1YA 2DZSA 3P14A 3HURA 4F3HA 1J4EA 2C71A 3O15A 3W53A 3ANVA 3WMSA 4AFYA 4I5RA 1VPQA 3V0UA 2V63A 2F38A 1IEWA 2GQ3A 4C6LA 3B9AA 4PCFA 3CUIA 1SO3A 1SMAA 4GZJA 4ADSA 1JDDA 1XLMA 2ZE3A 1P5BA 3E0WA 3NL6A 3P5ZA 2CLIA 4AG0A 1LTDA 1EJVC 4JTJA 2DSVA 2FZMA 1TCDA 1N8IA 3RJXA 4GZEA 5AYIA 5BXSA 2WW5A 3VZZA 3AC0A 3KTCA 4YJ5A 1PCKA 1ZZMA 1GW9A 4YPJA 1AJZA 2J9YA 4R7OA 2PGFA 1PDYA 3LB0A 3TX9A 2V38A 2ZX8A 3VNJA 3WLRA 1DIDA 2A3EA 2VO5A 4HMNA 1R0MA 7CGTA 4REQB 1L6SA 3DOPA 2ZDSA 1BVWA 1KTNA 2VC5A 1EJ7L 1R85A 2C15A 1BQCA 4HU3A 4H2CA 6TIMA 2A7PA 2ZZ7A 3AYVA 2HXTA 3NUKA 1HL2A 3K30A 2GK1B 3U48A 1A3WA 1SYTA 1SUXA 2WHMA 3GVVA 1DTNA 2EO7A 3AMKA 4ACYA 3O3RA 1IT8A 1O12A 3RF9A 3LPGA 1LBLA 2UY2A 3GNXA 3O9NA 3H7VA 3V1HA 4O57A 3DXIA 3I7RA 1YKWA 3PB0A 2W3ZA 1PWLA 3QKZA 2QEZA 2Z1XA 3UXDA 2Q8XA 4DUXA 1JQVA 1ZQ5A 3UR5A 2BY1A 4BF5A 3HJZA 1CX9A 4RXGA 2Z7GA 2ZOXA 5AYYA 3HMJG 1QFEA 2NT0A 2PDGA 3AXIA 3PBYA 4X9SA 2V6AA 4GX8A 4YLWA 2QQ6A 3RILA 3N19B 3H22A 4Q4KA 4DWSB 4Q32A 1QHZA 4ZO9A 3MMUA 1OFEA 1AQFA 3BMWA 3W7DA 2FGLA 2ATSA 3WLIA 3NZQA 3GHRA 4LGXA 1YYAA 3W70A 3YPIA 3E12A 5CBIA 4XTIA 3FA3A 2XGBA 3CASA 3EMZA 3EDDA 3TZNA 3DDMA 1JRCA 4Z2IA 3WQ5A 3KBNA 2GGJA 4FA3A 3S5OA 1OQFA 4P7LA 2HROA 3I10A 1NDVA 2E9MA 4DELA 1E6QM 2C3ZA 1HKJA 1OJXA 2JIWA 3GU2A 4L56A 4ZO7A 1JF6A 3IIVA 3GG1A 3T0CA 5A5WA 2PDIA 4QIUA 5AY7A 1XBVA 2PWDA 1ITXA 1FDYA 5TD4A 2CFFA 1BTCA 4O8RA 3WIJA 1PZ0A 3QLLA 1DTUA 4ZO8A 5A6LA 1RY8A 4ATWA 2YCIX 2NLIA 1JVNA 2XIOA 3UZZA 1Y5VA 1XYZA 1R3VA 1D8CA 5AHNA 1JZ5A 3PUGA 3PZUA 1PXGA 3BG9A 5D2VA 3ONCA 3G0UA 2Y7FA 2QPXA 3W6LA 1W8GA 4XAZA 3W82A 4GISA 3LV5A 6CGTA 4DJED 4AEOA 4NZ1A 1WKFA 1EDTA 1QW8A 3PPCA 3NOEA 3SO7A 4HOZA 2QULA 5CPOA 1WDRA 1XC4A 1EGZA 5FACA 1AZ2A 1LQ0A 1XP3A 3LGDA 1KFJA 2GVGA 1O1ZA 3OW1A 4TX6A 4UTLA 2YCJA 1UPMB 2VRJA 3A64A 4DQWA 3JR2A 1K70A 4R9XA 4UOQA 3TH6A 4DWDA 2P3ZA 3G18A 1C3FA 3CZGA 4HU4A 2LLEA 3W22A 2BHZA 3FSUA 3N12A 3UZ5A 1WBJA 3K4AA 3CIWA 2VZTA 4DJDD 4GFIA 2WBKA 3NQ7A 4KCWA 3WQ8A 5FOOA 4XAFA 2H6RA 4BEUA 4Y9MA 4A3RA 1VEMA 2NX3A 3QMSA 2DSZA 3W2NA 3OIXA 4HIBA 1OT1A 1XSJA 5CEWA 3GU9A 3XISA 3N9KA 3ZOAA 4J1OA 4Y96A 4O8AA 1KNWA 2BZNA 3POHA 4GD0A 4GY0A 2V9DA 4HPGA 5HMDA 1LUCA 3IGSA 3L0KA 1TV7A 2IW0A 2PSNA 2WCGA 2DVXA 2PDCA 3S5SA 5CZTA 2NX1A 2CZ5A 3BZJA 3MP5A 3DERA 5LGZA 4EPEC 1QPNA 4DJFD 1V77A 3UY8A 1ADSA 2R1LA 2CXEA 1E4NA 4DBDA 3O0KA 3LN3A 5BRQA 3AJXA 2Z0IA 1ITUA 1KD0A 3P0XA 1O5QA 2OG9A 1H7OA 4HHMA 5LNWA 3S1VA 1XG3A 1UOKA 1JAEA 1XLKA 1CXHA 3A5VA 4JKMA 3ES7A 4W7UA 2OQYA 3QQWA 2PTZA 3LUTA 3T44A 3W1TA 3ARZA 1ICQA 4UQEA 4XZIA 1VFUA 1EZWA 3W7EA 1ECQA 3NQ8A 4PTNA 4XZNX 2EPKX 5A6KA 4F9JA 1OABA 2HXUA 1KR0A 1K9EA 1U1JA 2VL4A 1WZMA 2XVGA 4CQDA 1FRBA 4FIQA 4DYJA 1UUOA 1IXQA 2E25A 1A80A 4D1JA 1ZENA 3KVMA 5LZLA 3DAQA 3C2OA 2Q3RA 2NXIA 5HUPA 3G5EA 4J3SA 4DNMA 2F6KA 3D3FA 4KS0A 3I7QA 1W9XA 3EB2A 1KXQA 4ADTA 3EX4A 3VDBA 1H1ZA 4IGMA 4U5IA 3C2VA 1SZGA 1QRQA 1J6PA 1A5BA 2NVCA 3N2MA 3V35A 2F2HA 3NVTA 5AZ0A 1I0BA 3B8UA 1PE1A 4AXNA 3MYPA 1RCQA 2V82A 3DX5A 4QS5A 1ZLPA 5K7JA 1UQZA 3NL5A 4JBRA 2DDXA 3RXZA 2J9XA 1TWDA 1A50A 3NO1A 5BXRA 3O6YX 3VI2A 2VDHA 4NF7A 4AD2A 3SZ8A 1PDZA 2KX9A 5A2CA 3WFAA 3BE7A 3AWNA 3EWDA 4DZHA 3VE9A 4XISA 3LSCA 4M1BA 3PTDA 3GXNA 4AB4A 3GIYA 3LPOA 3FV9A 1HJSA 2VC7A 1G6CA 4F0KA 3VAVA 2QPUA 2YPIA 4GVIA 4K8EA 4YTTA 4FNRA 3ZWTA 4ZTXA 1VR6A 3DESA 2RDWA 3VIHA 1NEYA 3ITGA 3VOHA 2XZ9A 2V68A 1C7SA 3LBCA 4A4AA 2ZFAA 3SY8A 1VZWA 4DUWA 4RXFA 2DVUA 3RM8A 2NXHA 1HN1A 1FWRA 2Y62A 1EQCA 3QGAC 2VDIA 3STFA 4Z2HA 4HHHA 3GY1A 2Q6ZA 3EX2A 1XH1A 1IXNA 3CUJA 4MAVA 1NFGA 4BI6A 3SCOA 5J04A 4LUTB 1E6NA 5CAKA 3M0LA 3HFTA 3T2PA 4OUIA 3UJ2A 3HGOA 1VJIA 2WSKA 3CV1A 3VA8A 4QEEA 5CJNA 2FH6A 3A23A 1CB7B 3AMDA 4C6MA 2Z24A 2XH7A 4XV0A 3HGSA 1EPVA 2BLEA 2WSPA 3PJXA 3F1QA 1JPIA 5CLWA 2UY4A 2VEPA 4GGBA 3GNPA 5C2XA 5JIPA 2CESA 1R3RA 3W2JA 1JXJA 3UJRA 3HQOA 2GQ8A 4MWAD 3QVQA 3GC2A 4JTCA 1GGOA 5GPRA 1VFMA 3CH9A 4O14A 2XIIA 1XRTA 1ZJHA 3SRFA 5F1UA 3ZSSA 1TPC1 4WGHA 4N9EA 1CGXA 2OQLA 4PL1A 2YYUA 3WQPA 3UP8A 4UBPC 4J40A 5HR7A 2GDQA 2ODOA 3NEHA 5F4SA 3W00A 1BG9A 1RJPA 2BVWA 4AY1A 2HE5A 5I07A 1KCZA 4H7VA 1B3OA 5DRIA 1LT8A 4AD3A 4DYEA 2XVPA 1LCOA 3RMJA 4NYYA 1I60A 1PKNA 2PDXA 5CGQA 2I5IA 5A6BA 1B30A 4XIAA 5CJ5A 2G4FA 1C93A 2ZRUA 3HZ3A 2P5NA 2AKZA 3IK4A 5HK4A 3B9DA 1K77A 3KDNA 4MOZA 3GYEA 1FWWA 2OR2A 2C14A 5C9RA 3EOUA 4RZ6A 4K7VA 1Q13A 1NF0A 4GIYA 4RZ4A 3FXYA 1J10A 4FXJA 2C1HA 3ZS4A 3OZPA 1I1WA 5HULA 1JRBA 1ISYA 1V6VA 1KM5A 3N6QA 5E09A 3NSMA 1XHGA 1M65A 3E3HA 1ONXA 1G9HA 1EA0A 4K1WA 2PLJA 3G8EA 3QJAA 2QS8A 3QPYA 4KCTA 2PZNA 3I4EA 3VGEA 1H0IA 3WN6A 1PYMA 2BBFA 2VM8A 3CAVA 5DN1A 3F4DA 5EMYA 4JYDA 3MKVA 2F9RA 4IX0A 4H4IA 3STPA 4HYWA 2BX7A 1UP2A 2ZTKA 2PDQA 1V3LA 4D6CA 3WDHA 4JICA 2VC9A 1LBMA 3QV9A 1U83A 1FDZA 2GDVA 2A2IA 2ZRWA 4I5UA 1KBKA 3S1UA 2A4AA 4IG2B 1EHNA 3GR8A 2ESCA 2E77A 4PSRA 3S9ZA 3QY8A 4AD4A 3W74A 1I8JA 1E3ZA 4C6BA 2Y8KA 4N4QA 3BO9A 1FWFC 3F5JA 1NTHA 2C8NA 3K5XA 4FNSA 3N73A 4LVBA 3UA3A 1K1DA 1MUCA 4IMDA 3BLFA 3AS2A 4GJIA 5A8QA 3K4DA 3OB8A 4L9YA 3T42A 4A6GA 1XINA 1F5ZA 3GVGA 2QCDA 2FDMA 3MHUA 4Q22A 4PUNA 5CSSA 4M6QA 3S5NA 4KQNA 3ARWA 3GXIA 1GYLA 4NT0A 5HXMA 4AZCA 4OE7A 4WDWA 2VZOA 4D72A 1VFHA 2CERA 3HTWA 3IJIA 1XCXA 3M46A 1CYGA 3LLFA 1E1EA 1UR0A 4LBSA 4LVGA 3UPWA 4KRUA 1YPIA 4DB7A 4JXCA 1E56A 1HKMA 1GOQA 3BAKA 3V0TA 4DYKA 1ICPA 3PG8A 3NPXA 2NX9A 4JOMA 3HF3A 4UUIA 2WVTA 5JUVA 4Z17A 5AOUA 3NJ3A 3VNZA 4H3DA 4JN7A 2QT3A 1IHIA 2OYLA 4BR1A 1DWIM 2QGHA 3H21A 4H01A 2JF7A 4RDVA 3LI1A 3V5FA 4V33A 3BLLA 5L6UA 1FWSA 1R3YA 5EB8A 1EF3A 1CI1A 2VUNA 1P7TB 2IPFA 1UKPA 3KCOA 1TMQA 4EPKA 3A12A 3HPZA 4R7WA 1VP5A 1UCWA 3GFYA 3T40A 3I6EA 3LCXA 4IMEA 1T96A 3UNDA 3W23A 2D20A 2FJKA 4P7QA 3GHSA 4QE5A 2W63A 2RJHA 4PUEA 1HJXA 3ES8A 1K8CA 2O9TA 2PPGA 3B3DA 1DP0A 4YYFA 3IIXA 1TVPA 4PFMA 3AU2A 3TFXA 3AWOA 4DUOA 1GPWA 2V2DA 4UOZA 4IPIA 3N4EA 4MKSA 1GOMA 4HA4A 1CGWA 4TVCA 3LEPA 1RVGA 4EWND 1BLIA 3TCSA 3QV7A 1ZFJA 3C8FA 3PZVA 1TJ2A 3LPPA 3ZT6A 4W8BA 2VT0A 5AHEA 1QOPA 3NO5A 2HTMA 3TYAA 4N9CA 2Y85A 3LBMA 1DWHM 3QFEA 4JQ4A 4JCMA 2X16A 3T55A 3CAKA 3IANA 5LHEA 1IE7C 4H9YA 3B8DA 3S1GA 4CNUA 4IT1A 1DE5A 4IOTA 1QU4A 2QAPA 1JDCA 2OO0A 2HNEA 1OFAA 1IT7A 4I6VA 4HCDA 1HO4A 3M6DA 5GJMA 3UJSA 1PHWA 3DG6A 5HMSA 3CM4A 3GM8A 4FPSA 4DXVA 2OWXA 1I0DA 4NHVA 3QLDA 1JD9A 5HNTA 5I77A 1J93A 1BAGA 1MEHA 3E96A 3LSBA 3TN4A 2BOFX 3NVDA 2YR1A 2R82A 4TMBA 2ACRA 3DYMA 2V3EA 1E9YB 4PEKA 4DI9A 1F6KA 1DKWA 2YCLB 5LA2A 1KM3A 1CXEA 3RX2A 1XICA 1PYFA 3RCNA 2W62A 2GGEA 4XIMA 5HMFA 5I00A 4LJ3A 4MWAA 1PZ2A 2JK2A 4MMWA 3LMZA 3ZLGA 1T7LA 3W1RA 3GXPA 1H2JA 3LTYA 3QGVA 2YDRA 3WYZA 3W38A 4GYPA 4S38A 4DF1A 3N11A 5JH1A 3V5OA 4PTWA 3BG3A 2I14A 3R0DA 4F8XA 3ABSA 4LUJA 4GQRA 4HPHA 1KGUA 3E74A 2NQ5A 4J3TA 1N2VA 4S2BA 4LVDA 2YA2A 1EPXA 1FFQA 3OPSA 4AEFA 3F2DA 3TWAA 4WIWA 1JXKA 3PM6A 5DO8A 4WLCA 4WOZA 1JDFA 1IWPA 4HNUA 1AH4A 3R2GA 3E0FA 2Y61A 3TOPA 4MY8A 3WQGA 4PMYA 1M41A 2ZXBA 3WK0A 1ZP4A 1WAUA 1XYFA 2CZDA 2PP3A 4PULA 3UWWA 2Z1BA 4NX0A 3MWCA 1MQPA 1YBQA 2J7GA 5DCEA 4LTSA 1TCMA 1OFDA 1L2QA 3TAOA 4PE8A 2ZX7A 3WNMA 3WK1A 3LLDA 4NG3A 4L1WA 4ZSUA 2GJXB 4AQLA 2A1YA 1MQQA 2WBGA 4JIHA 2EF9A 3IEBA 4LWWA 3N2CA 3RGTA 1SFSA 3FHQA 2NQHA 2GWNA 5CKSA 2HS8A 4BZYA 1MI3A 4L80A 5FJPA 1NELA 3KTXA 4WY0F 2YCEA 4MNJA 1C7TA 3ARRA 5D4YA 3U4FA 1S2WA 5H8UA 2IXUA 4PTVA 2NSOA 2CYGA 2O0TA 2ZX6A 3UG5A 4WOQA 2WSRA 1EJXC 3AHYA 4W89A 1AL8A 4G8TA 2BY0A 3ABRA 4DWSD 3O07A 2QDEA 4P2VA 1FHLA 3K4WA 4PUJA 2E3ZA 3AUJA 4F66A 2YLAA 1FWAC 4HMCA 3O1NA 4OECA 1WZLA 1KRCC 2PA6A 3VZYA 2D3LA 3C6CA 3GSMA 1UD6A 1W3HA 3UWQA 4FOKA 3XIMA 3VNDA 1QHPA 1VJZA 3TLLA 3PUEA 4F0HA 3ELFA 1JI1A 2FB2A 2Y24A 3U7VA 3EA3A 3BANA 2A3AA 3EWYA 1A5SA 2BXZA 3APGA 3FVDA 4XUYA 3IJQA 3TAKA 1ME7A 4JD4A 1R46A 1D3CA 4LUSB 2Z29A 1ZPTA 2GUUA 4URIA 1JGMA 4M19A 1WDWA 2VR2A 1UPPA 2XH2A 4UNIA 2JKPA 2DT1A 2O56A 1DXFA 2WKGA 4V27A 2OYKA 2OU4A 4B3ZA 5FA5A 4DWSC 4D8AA 2CHOA 1TQXA 3H2CA 4HB7A 4OUEA 2G95A 3ITTA 4FMVA 1RK5A 3CUHA 4PBGA 4S3CA 4CNTA 3M0ZA 2E28A 3L0GA 2TRSA 2ZADA 4JN8A 1ZRQA 1V6YA 4QSFA 3DG3A 2ANUA 4JTGA 5AHLA 1W91A 1H0GA 4L9ZA 1P48A 3WLTA 2Q8ZA 1CXLA 5MKGB 1B90A 2YIHA 1K8XA 3HO8A 3NZRA 1H51A 4TV6A 2QJMA 1DORA 5D09A 2WXDM 3MUZ1 1IZCA 1HW6A 3A24A 4ORMA 1TJ0A 1AMYA 3PJWA 1CGUA 5DEZA 2AGKA 4FI4A 3F5LA 3U5UA 4BWLA 4HOWA 2XJ7A 3ZFHA 3W1QA 3ICJA 1BGGA 3O16A 4ZQRA 4HN8A 1I4NA 3WLPA 1GYMA 1UR2A 1XSIA 2I16A 2VWTA 4CGTA 3ZZ1A 3KXQA 1MEIA 1AUSL 2RUSA 3CL8A 4AX7A 1LDCA 4RPQA 4AZHA 2IKHA 3CLMA 4Q8VA 3W1PA 4AHQA 1YE4A 2NVAA 5FF0A 2VX5A 1IZJA 5HAOA 1Y5WA 4O15A 4YN5A 1SQ7A 1TB3A 1GTHA 1PKYA 3LU2A 3VNKA 3T0TA 3G1AA 5AVHA 2ZUVA 1W6TA 4N9DA 4IGNA 4JNYA 4HBKA 1LRNA 2ZRVA 4QQUA 5I79A 4C1NB 2POTA 1V0NA 3GC5A 4B5VA 4MKNA 3DI0A 1O5RA 2B7OA 1TX2A 2VX6A 1ODZA 1GZJA 4GQQA 1TWWA 2WMHA 1W9UA 2O92A 3CO4A 1OSEA 3RR4A 5E93A 1BF2A 5F4WA 4YXGA 5E0CA 2NUWA 6ENLA 5HNUA 1DWJM 4PB3A 3AICA 4JTLA 3SRDA 2GDUA 3BCJA 5DMYA 4FOJA 3GG8A 4TQTA 3C61A 1AQ0A 3PTQA 3AS3A 1TX0A 1GTEA 3DG7A 4GI4A 3SSJA 5KEZA 4A35A 3C8NA 4L1XA 4AEEA 3S8HA 3RLGA 3IJ9A 4ZOBA 3W88A 1F3EA 1SFTA 1N8WA 1V4YA 3VINA 2DZTA 2D73A 1EIXA 3BARA 3SADA 1ZU8A 1XDJA 4GYPC 1V0MA 4MJ4A 2E8YA 2EPMX 2ZQ0A 2VD9A 2E7FA 1GVYA 2WJEA 2AMGA 2DV0A 3CIVA 2ALRA 2V5LA 2GYIA 4N9BA 3CWOX 3CUFA 1OB0A 4ZB2A 4Z0JA 3R6IA 2A21A 2YLLA 4ZB0A 2G3NA 4MIMA 3IPWA 2WPBA 3DFTA 1NOFA 3MKKA 2MUCA 1A5NC 3SQLA 4GVFA 1XYCA 5FIPA 5CSUA 2ZXAA 3SEPA 1PZ3A 1QNVA 3ITOA 3MW7A 4I9MA 2ZKMX 4R9OA 1Z32X 1SR9A 4X3ZA 4PTXA 4R3UA 1UWAA 5E70A 3NTYA 4KERA 1TR9A 4EPDC 6PTDA 3KP0A 3BH4A 4Y7EA 4KW2A 1RUSA 5AC6A 5BU6A 3N17A 2WYSA 5IM51 1X39A 4O1EA 3QV6A 1TTJA 3AZSA 4G7FA 1TPDA 1VPYA 4HPXA 3C2RA 1REQA 1CLKA 3PTKA 4U28A 2Z2BA 3VXGA 4K36A 2PDBA 2BHUA 3O6DA 3QR1A 3CHCA 3IJ7A 4PA8A 4XD3A 4QSHA 1EBHA 4FK9A 5C71A 1XGZA 3TMQA 4RR4A 2HMCA 5H91A 4IPJA 1QAPA 5IRPA 4Z1YA 1JIBA 3ZT7A 3DFYA 4Q4QA 1V03A 1QNSA 4LAKA 2VX7A 1BKHA 2R9RA 3H4WA 1CPUA 4MB3A 3VGBA 3PR2A 4D6FA 3FCPA 1Z7AA 1V0KA 9XIAA 4B3LA 3MT1A 1C91A 4GACA 3BC9A 4Y9OA 1J0YA 1PTDA 3H7RA 1TR1A 3NGJA 4KRZA 1ZB5A 2W67A 3TYBA 4JDYA 3WLQA 4E2BA 2ZVRA 2J79A 3MUCA 4HCHA 1A0CA 3IRDA 3QMRA 2XN1A 4GXMA 3GKFA 2A79A 2C6QA 1UOZA 2YCKX 2V3GA 5AB3A 2Y5JA 8XIAA 2FJUB 3T07A 3RO8A 1J79A 3MO7A 4NX5A 1YQ2A 1SJBA 3B06A 3LK6A 3QOKA 1AD1A 2UZ9A 1UROA 4UCFA 5A8NA 2HPIA 2CBUA