5KMYA

Crystal structure of tryptophan synthase subunit alpha from legionella pneumophila str. paris
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
262
Chain Sequence
AMNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDPMAEGPVIQRAMERALAHSIHCDDVLNMVRQFRKTDTETPVILMGYLNPIEQYGYDLFAQQAVEAGADGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNFINQHANGYLYYVSLALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGAALINEIIEAYEAKKDPLQASGALLSSMRQAIDNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tryptophan synthase subunit alpha from Legionella pneumophila str. Paris
rcsb
source organism Legionella pneumophila (strain paris)
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 83
structure length 262
sequence length 269
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5kmyA00
1AW1A 5BOOA 3C0JA 1XI3A 4JICA 1TO3A 2AGKA 1NVMA 1K8XA 5AC6A 1QMLA 2B4GA 4Z08A 3HPZA 3MO7A 3L2IA 4NU7A 3DH7A 5CZSA 4U28A 4GE8A 4O18A 1DQXA 1OHLA 3W2LA 2E5DA 4AWTA 5D2TA 1OFDA 3MP5A 1G7UA 1S5VA 3FIGA 3TV8A 4AVFA 4LVAA 3GDLA 1GG1A 4NXKA 1NFBA 2A0NA 1B9BA 4ZQRA 4XWUA 1G7VA 1VLIA 5AC8A 4YL2A 3S0CA 3M5VA 4RJEA 1TV8A 1G4EA 3CQ0A 4K38A 4PA8A 3P84A 3QYQA 4UNLA 4HSOA 4HNVA 3EEGA 4UFLA 3LI0A 1XCFA 1NEYA 1ZAIA 2J9XA 2A6NA 2JKAA 1I2RA 3LBMA 1SO3A 4TU1A 5D2VA 2QCDA 1EP1A 2CZEA 4OT7A 4UIOA 3B0PA 3W1TA 4CNOA 1YDVA 2ZYFA 2VC6A 3O63A 4JTJA 1FCQA 4JN6A 1TIMA 2O7QA 3W76A 4RKAA 2RDWA 3ATYA 3THQA 3PULA 3QF0A 4A2RA 2DP3A 3M41A 3UWZA 3DFTA 5G1TA 2DZSA 1GG0A 2Y63A 4MPQA 4X22A 1LYXA 3M44A 3SR7A 3BG5A 4O1DA 2Z2UA 1XUUA 1KM6A 3PR2A 1SO4A 5LHEA 2B7NA 4HSNA 5G2IA 3GNDA 3RNDA 3TX9A 4PODA 5F2IA 1KTCA 1QOQA 1L6WA 5DY2A 3TIMA 5HR7A 3MYOA 4J9JA 3TSDA 1M6JA 3KVMA 4TO8A 3T4CA 1DVJA 3B03A 2C19A 2CZFA 5E1QA 2YR1A 1ZAHA 4BWLC 4MLJA 1K03A 3T78A 3GAYA 4WOQA 1W5QA 5T26A 1H7NA 4Z1DA 3QMSA 3LDVA 3M6YA 3FA5A 1W31A 4CQ8A 4LW7A 3IVTA 3NL5A 1VPXA 1SW7A 3W1MA 1F76A 5D2YA 4ICNA 1F6KA 1KFJA 4NQ1A 5DBTA 3TW7A 1KM3A 3DHFA 3QZEA 5F2MA 1TPEA 4GRSA 4NX5A 1LP6A 3UY7A 5KZMA 1NF0A 1V7YA 2QCCA 3SSJA 1KTBA 2A7PA 3BGJA 3QPZA 1W37A 3S5ZA 3CPRA 4RLIA 1G6CA 4QISA 3C52A 2OCZA 5J5RA 3EKZA 4PL1A 1TJRA 4IUOA 2E6AA 2Z1BA 2Q3OA 4Z1CA 3HG5A 1W56A 3GDTA 3GXPA 3NR0A 1XFBA 1BEUA 1CW2A 2VEKA 4RZ5A 4OQVA 1HG3A 5F2GA 2QKFA 2ISVA 3W3OA 1BWKA 2A85A 3W2MA 5EYWA 3ATZA 1KLZA 1VGAA 2C6QA 2O7SA 2V5LA 4ZZ9A 3DFPA 4JTHA 2NX9A 5AYYA 3SW6A 4Y9AA 4JGDA 3CEPA 2X1UA 3HMJG 5AYXA 3C6CA 2X1TA 1OABA 1A5AA 2RHGA 4R34A 2WOQA 5TQLA 3HPXA 1KV8A 1ICQA 1IXQA 1X8FA 3M43A 2PC4A 1XBZA 3PY2A 4M5PA 1W5OA 6ALDA 3UD6A 1LBMA 1M5WA 4UTHA 3KVLA 3PBYA 4UTKA 1EWDA 3WJWA 1QCWA 3QSTA 3NQDA 4O0KA 4CCDA 4A29A 3OVPA 3BLIA 4JTGA 2BSLA 3MBFA 3P5YA 5G5IA 1HUVA 5HINA 3GKFA 3QQ1A 1JCNA 2J9ZA 2E1DA 4NXSA 4DBEA 2VFHA 3PF3A 1AW5A 3ZS4A 4Z1AA 5DELA 3W2UA 1VCVA 4N4QA 4OHQA 2X30A 3O1NA 2CLHA 1X1ZA 2ZFAA 3EXSA 3W23A 1I4NA 4NZFA 4XZ9A 4O0ZA 3WJSA 1TQJA 1B4KA 4IXHA 1FCVA 1EA0A 3QJAA 3W70A 4WUIA 2QJHA 4IPJA 4K7VA 3LBCA 4DO5A 1WOAA 2VXNA 1HO4A 3G1FA 3IIPA 3NAVA 1TPH1 4MYAA 3UWUA 1SQ7A 2YPIA 3A21A 3LXBA 4FHAA 3THAA 1EX5A 1S5WA 3PUDA 4IMDA 3GR8A 1FUYA 4Q33A 2PE4A 5LNVA 3ZR4A 4DELA 3LX9A 2Z6JA 4BWLA 5HWNA 4O53A 1R2SA 2BX7A 3W7RA 3TC6A 2R14A 3C3NA 5G4EA 1HTIA 1V5XA 4YWIA 4Y90A 3AO0A 1I45A 2R8WA 3WJXA 1RQBA 2PRMA 5F1VA 3PVFA 4GJ1A 3U6WA 4I7VA 3UZ5A 1ME8A 4Z0JA 2GVGA 4L4LA 3DGRA 3FEMA 1JUBA 4I7UA 3VI2A 4H6KA 3LRMA 5BMXA 1Q6OA 3OEXA 2B7PA 5I3HA 1M7PA 3STFA 3UZJA 3I7QA 2QDHA 1TJPA 2Y89A 3A22A 4X2RA 3NVTA 4GFSA 4RZ6A 3EWYA 2VFGA 4HNUA 1RD5A 3UPWA 4JYDA 1OFBA 5AHNA 2TMDA 3M47A 3LM7A 2QCEA 3HG4A 3OG3A 4FX8A 1EUAA 1Q3NA 3B05A 4MIMA 4N6FA 4O17A 5I3GA 4LT9A 1OG0A 3GR7A 4M7SA 4AXKA 3W7PA 1GQNA 3TKFA 2VOMA 2ZZ5A 1SR9A 1YDOA 3EX1A 3LXCA 2A6LA 3W83A 2W0UA 4JD4A 3P62A 4UTTC 5BW6A 1XXXA 3LLDA 4N6EA 5C2XA 1OK6A 4EF9A 3MI6A 4POCA 3TW6A 4LRSA 3PC0A 4JTFA 1KLYA 3GAKA 3I68A 3N2XA 2P1FA 2FQIA 2NXIA 1N55A 3WJZA 1FQ0A 4JTUA 4LS0A 3BARA 4FEZA 5ABTA 1OX6A 3PG9A 1DV7A 2Y70A 4UFIA 3SY5A 1RV8A 5TIMA 3W73A 1L6SA 3F4WA 4QAIA 1CX9A 4QM1A 4K39A 4IMEA 4FNTA 3B04A 4AMAA 1SUXA 1VHCA 2H8XA 3OIXA 3BV4A 1VC4A 1TPC1 3W7EA 2PCQA 3C2VA 1RVGA 3MHUA 2JKPA 3PBWA 2YZRA 1FWSA 2V30A 1W0MA 1DHPA 3VE9A 1L2UA 1R47A 2DZTA 1LLWA 4PC8A 3BO9A 3BVJA 1W3IA 4LWWA 4Y96A 3L66A 1PL9A 1UASA 4BI5A 3E9AA 1XBYA 3IGXA 1T96A 2E6DA 4IMCA 1GTEA 3PB2A 2YXGA 3PS7A 3CLMA 4LVDA 1H1YA 3O6DA 3TH6A 1GVRA 3NG3A 2I1OA 2FIQA 3U8GA 4JX6A 5FF7A 4QQ3A 1QWGA 1TMHA 3W7HA 1H7WA 3C56A 1MEIA 3FJ6A 4M6VA 2HSAA 4BF9A 3RF9A 4ZQPA 4JS3A 3DFSA 2PURA 3O16A 1MZHA 1WX0A 5IBXA 3PBVA 4UUIA 4UTWA 1HFBA 3TU9A 3SECA 2CZ5A 3BW3A 5CPMA 3I65A 4AWSA 1SPQA 1ME9A 1QOPA 3QM3A 3INPA 2W79A 2IQTA 4LVGA 1FCBA 2JGYA 4R7JA 3W88A 3S1WA 5FESA 1PS9A 1F2JA 3GIYA 1I2NA 3ABQA 3DZ1A 3W1UA 3GDRA 5L9FA 2DZUA 1QNVA 3QH2A 4HT3A 4BI6A 4JXCA 3HGOA 4OBTA 2VENA 2YDAA 4IJBA 1UB3A 3I7RA 1GYLA 4O16A 5LHFA 3L0KA 4A22A 4UXDA 1X6UA 3PAJA 2A7NA 4XTIA 1KFBA 4GC4A 3DXIA 3P80A 4N4PA 5KZDA 1B3OA 3FYOA 3GB6A 3OVQA 1GJPA 5AC7A 2CLMA 3P74A 1ZNNA 2ZRZA 4I9AA 3A9IA 1RQHA 3LCLA 3W1AA 4UTJA 3BK0A 3LRLA 4YMZA 1LDCA 1P1XA 1I8JA 4BK9A 2NZLA 3RLUA 3N3MA 3RMJA 4GWEA 4RXGA 5EMUA 3L68A 4FIQA 3LERA 1R30A 1TTPA 2TRSA 3CEUA 4O1BA 4MVAA 5AOUA 3EKLA 4O15A 1TPUA 1WOBA 3KOFA 4UTWC 1O94A 2NX3A 2G96A 2ZBTA 1ZCOA 1QR7A 1OYCA 4GUHA 4KWWA 2Q3RA 1B4EA 3MBDA 2V82A 3FYPA 3NQAA 3NL2A 1W5PA 3DFOA 2E6FA 3U2OA 1VJIA 1WYIA 3DU0A 3G1DA 4LVFA 5CG7A 1TTQA 3EX2A 1Y0EA 5FF4A 5LGZA 4NNCA 4U4MA 3W7CA 3F4NA 5EL1A 4GBUA 3QC3A 2DZWA 1LBFA 3P8JA 3DENA 1FX6A 1LRTA 2ZZ2A 4DPPA 3WK3A 4O50A 3PB0A 1KA9F 2V5BA 2JBMA 3S5NA 3W85A 1A53A 3SFKA 3SGUA 3V75A 1PCWA 2NV2A 2HTMA 2XN1A 3VKJA 5LNSA 4MZYA 1LOSA 5A5WA 1U83A 2P10A 3RLVA 1ICSA 3UXDA 4NUWA 5K4ZA 3W72A 3IGSA 4ZMGA 2FPVA 3NQ2A 5DXXA 4LNYA 4MUZA 3TAKA 2CLLA 3LCXA 2QJGA 1TV5A 4FXRA 3L21A 4GUGA 1RZMA 1G4PA 4GXMA 5LNUA 1SO6A 3TCEA 3WFAA 4M6QA 4BR1A 3TROA 1IF2A 3LHUA 5F1UA 4QNWA 4HNTA 3CIXA 4FNRA 3W1NA 2Y61A 4E2DA 3DFNA 4NX0A 3M0ZA 3NNTA 1OJXA 3BLEA 1H60A 3NGJA 1F73A 3NPWA 1XL9A 1KBIA 2GQ9A 3M5ZA 4HIBA 4LTSA 3HGRA 3GLCA 2A5HA 3NPVA 1WA3A 2C1HA 4WX2A 4GUIA 3W1RA 2ZA3A 4UTIA 3IIVA 1OYAA 1YDNA 1DOSA 3JR2A 3LHWA 1OFPA 3CU2A 1P5BA 4K6AA 4X3ZA 2ZA2A 4JYFA 4ML9A 2DJXA 2QAFA 3SGZA 5D2XA 3YPIA 5HUOA 3LB0A 3IIZA 3P67A 4IX0A 3F03K 3NO5A 3EX4A 2EKCA 4O11A 3TC7A 1W54A 1EPXA 3CB8A 4NZJA 4AWUA 4DEFA 4O4VA 4UCGA 1EWEA 4JIQA 3TSMA 1GWJA 5FF2A 1C8VA 2VKZG 1R46A 1EP2A 4ALDA 1JQVA 1YPIA 2GOUA 1A5CA 3C8FA 4IMGA 2ZTKA 2EHHA 1NSJA 3DHDA 4UMBA 1H7XA 3CC1A 5HULA 2YX0A 3CWOX 4DQWA 5E93A 2X16A 4UTLA 4LS1A 4TMBA 3TMQA 3KVJA 2QAPA 3QQ0A 5CPNA 2WSRA 4WD0A 3M1ZA 4RCXA 1TPB1 1VQTA 4RX0A 2GPTA 3EWUA 4AHPA 3HF3A 4PH6A 4W9TA 2QCNA 5D04C 1OK4A 3TK7A 1GYNA 2AQWA 2QCMA 1RPXA 5FI8A 1B57A 3HQ1A 3LHZA 1EIXA 3NQGA 4H4IA 1JCJA 4O54A 2Y85A 3NQCA 5D02A 5U7SA 4FX6M 4P61A 1LZOA 3C2FA 1F6PA 3P60A 3MMTA 4K37A 1LOQA 3E0IA 1FWTA 1KM4A 4OU1A 3NPUA 2YW3A 2ATMA 3HGSA 1MXSA 1I2OA 1W3TA 2VFDA 1W8SA 2R91A 4FO4A 4AF0A 2QDGA 4BI7A 1THFD 2GQAA 5HNRA 3P81A 4R33A 4WY0B 5CZJA 2G5WA 4IWWA 1SZNA 4LY8A 4JYEA 5AHMA 3EWWA 2J24A 3ELFA 3S9YA 4ADUA 2ALDA 5AB3A 3A23A 3HOJA 1N8FA 2Y62A 2AAMA 3QMTA 3W2KA 5L6UA 3MP4A 3LV5A 5HWMA 4FNPA 4JIPA 3PM6A 1ALDA 4QIUA 3TUUA 1H61A 1JCLA 1IIGA 4O14A 2YSWA 4O4WA 3IV3A 1MO0A 1UBSA 1H62A 1SU5A 3C2EA 3UWWA 1O95A 1H50A 5FF3A 2FJKA 4HHPA 4UNKA 2C0AA 2WPBA 4CQ9A 3HJZA 2GUUA 4FXSA 1SSGA 3EX3A 1O5KA 2YYTA 5G2WA 3M9YA 1EP3A 3S1VA 1R2TA 5FEPA 3W84A 3UYCA 3IIXA 3TE9A 2EF9A 3GVGA 1QO2A 1FDJA 4FNUA 4RXFA 1ZJIA 4TR9A 2A7RA 1P0KA 2B0MA 3G1YA 5LNWA 1LBLA 2ZZ4A 1GTHA 3W7DA 2OT0A 1YXCA 4JR5A 4MLRA 2DORA 2EAWA 3N9SA 5IM51 3S42A 1OF8A 3HG3A 1IXNA 2NLIA 1EB3A 3PBUA 4XTDA 4JDYA 3FKKA 1P4CA 1QPNA 1C9DA 1QPOA 5AN7A 5I3IA 2FB2A 1MSSA 3GK0A 4WQ6A 2Y88A 3KRSA 1YTDA 1QPRA 3KRZA 1OF6A 1KV5A 4WXYA 1W5NA 2B7QA 3G1XA 2EPHA 2CLOA 4JY9A 2Q8ZA 3UNDA 4EOUA 1KFLA 2G95A 2YFNA 3EXTA 4JX5A 2PRLA 3LV6A 3PG8A 3VCRA 1FBAA 2FPYA 4MJZA 3M7WA 1Q45A 4N02A 5BRBA 1RR2A 4CNNA 1CI1A 4UFKA 3LHVA 4X9SA 4PEKA 1QO5A 2QJIA 3IGUA 1J4EA 3UQNA 1O5XA 3EXRA 1AL7A 3W7IA 3KFTA 5G4WA 1DQWA 1TTJA 4CQAA 1WBJA 3IVUA 1ME7A 3LHTA 4IGHA 4K8HA 4DO4A 1X7FA 3O05A 3MHGA 4D2JA 1AW2A 4OV9A 2WKJA 1Q6RA 4KFPA 3W07A 4K7YA 3STEA 2A2IA 4MKNA 4NJJA 4EIVA 4YXGA 1HO1A 1ONRA 4DF1A 2Y6ZA 2Z6IA 3HGJA 4WZHA 3HG2A 2BZNA 3QSRA 2Z0IA 1VCFA 1FDYA 1OFRA 1HL2A 2OX1A 1ML1A 4GNJA 1NAL1 4CCEA 4G1KA 1PV8A 1VHNA 2ZRVA 2QR6A 1NF7A 4JEQA 2RH9A 4A2SA 1KFKA 4LOCA 4DPQA 4N9EA 1KW1A 2E68A 5SWUA 3W9ZA 5MHBA 1TSIA 2ABAA 4O12A 4WY0F 3EB2A 1SZGA 3W7MA 2GQ8A 1GVOA 5K2ZA 1K8YA 1WDWA 5AYZA 3NZ1A 2R94A 3IVSA 7TIMA 4MY9A 5F2LA 3B0UX 3KAOA 4WOZA 3NQFA 5D05A 1XDLA 2J6XA 4MYXA 4MFDA 2C3ZA 2DJLA 5K9XA 4DBDA 3NQMA 4UTUA 1GVQA 4AF0B 2X1SA 3QW3A 4JNMA 2G97A 2ZQ0A 1VRDA 4CLMA 4UTTA 4MOZA 3G1HA 3NM1A 1BWLA 2QF7A 4Q4KA 5C5YA 4LVBA 4PCFA 3BPWA 2Q8LA 1Z42A 3ZWSA 4KFOA 4HPXA 1JUKA 4IX2A 1KM2A 2E5CA 1SZEA 4C1LA 4TX9A 5EPDA 3DI0A 2I14A 1PVNA 1UUMA 2FB3A 2VEIA 2ZZ1A 4ZQOA 1FY6A 5DXYA 2V2DA 1XUZA 3CWNA 4YCOA 4WXZA 4QNEA 3GX9A 2LLEA 1SFLA 2A1YA 3UPBA 1TPDA 1VS1A 3G24A 1UJPA 3TQKA 1ICPA 2Y7DA 2FFCA 1KFEA 3W87A 3KHJA 3NQEA 3L5MA 3USBA 4HN4A 3NQVA 3RU6A 1AMKA 2H3DA 2V81A 4BFAA 3MHFA 3WK2A 3B0VC 4XBKA 3ZFHA 1H7RA 3C61A 4DF0A 4JTSA 2H90A 5D09A 4E38A 3NA8A 1SZFA 1ZENA 2JGQA 3W1PA 3LTSA 1KM0A 4O1CA 3DI1A 1H51A 3BG9A 1AK5A 2RFGA 2E5BA 3W6YA 3G3MA 2JKEA 4B5NA 2VEMA 3NQ7A 3S1UA 4S2CA 5DLCA 1UCWA 1E51A 1LROA 2DU2A 2W6RA 3ABSA 3GDKA 3KX6A 5F4SA 5LNRA 3Q58A 3UWYA 3R5EA 1IXOA 4OV4A 2GVJA 4DO6A 3VE7A 6TIMA 1G4TA 2BLEA 4FB7A 1D3HA 4N2YA 4L4MA 1K7FA 3T7VA 8TIMA 3TA6A 3CM4A 1L9WA 2CU0A 3RK8A 3PUOA 5F4XA 2YYUA 3R13A 2D73A 1JCXA 3NQ8A 3G22A 3RFAA 4MZ1A 3EX6A 5DN1A 2TSYA 2UV8G 3QPYA 1OVDA 4K8EA 2WV8A 3JRKA 3T55A 3WK0A 2TYSA 1S5TA 3I6RA 5H91A 3WK1A 1O4UA 2ABBA 2NXGA 2A4AA 4CNPA 5I3KA 3NXFA 1J5TA 1H1ZA 3LLFA 4Y8FA 5DBUA 4KFNA 2WSYA 1DJQA 5CGQA 1LRQA 1GT8A 1VCGA 3LTPA 3TNOA 3TAOA 3G3DA 1VH7A 2B7OA 3K30A 3N34A 4QJ1A 4HKPA 4UR8A 2QEZA 3PSWA 1KTNA 4P2VA 3LTYA 3GYEA 5K4XA 5C55A 1JCMP 1OFOA 1OYBA 3DAQA 1SSDA 1FWRA 2ZZ7A 1VYSX 4ADTA 4LV4A 2NXHA 3S8HA 2C14A 4O10A 5H2ZA 1GOXA 1AG1O 2A21A 3R89A 3O06A 1X1OA 1JRBA 3MI2A 4RZ4A 1K7XA 3VFLA 1Z48A 5KZEA 2V2CA 3BW4A 4M6PA 5AFDA 4ZVJA 5HUPA 3HBLA 4GUJA 1OX5A 3CIWA 1WQ5A 3FJLA 3N9RA 4O52A 4C1KA 3GZ3A 1LCOA 3GKAA 3R2GA 1YLVA 4ORMA 4RV8A 4WY0A 2XN0A 5HQEA 3CTLA 4WJEA 2BTMA 4O13A 1WBHA 2QCLA 3QW4B 1K8ZA 3TMLA 4MY1A 3LCFA 1DBTA 1TREA 2XFWA 1ZHAA 5EY5A 4JX4A 3G0XA 1D3GA 2V2HA 5CSRA 1TPFA 5CPOA 5DY3A 4JTTA 2OMAA 2ZTJA 3LRKA 2RDTA 1MEHA 4M19A 1C29A 3MYPA 2QUUA 3QRHA 4NT0A 4TMCA 4LRTA 5HJLA 2J88A 2TPSA 1DORA 2YW4A 2CLEA 3LCWA 4ZQMA 1PHQA 3VNDA 1I2QA 3Q94A 3NM3A 1VR6A 3G18A 3G1SA 4IOTA 4NJHA 5HR6A 3O6CA 5D30A 3C2OA 2CZDA 1DKWA 3QFEA 1JJKA 4PL2A 2YFOA 1TV7A 5DCDA 2X1RA 1T8XA 4TIMA 1KM1A 3CHVA 4RR4A 3LCHA 2QUTA 4LC6A 5A8GA 3W71A 3FLUA 2HS8A 1FXQA 1FXPA 4UFJA 3FFSA 3TDFA 1VYRA 4OE7A 3KVKA 5HMSA 2C16A 3B06A 1BTMA 1SFJA 3E49A 3ZWTA 2KZHA 3DFQA 1XBVA 4O1AA 1IXPA 2NUWA 3W7QA 3P7YA 2VELA 3O6YX 3MJYA 4QSHA 4HNNA 1JVNA 2X2GA 1JULA 1VYPX 3W74A 3L0NA 2V8ZA 5DCEA 1YPFA 1LLZA 1OX4A 1XKYA 2RKXA 2DZXA 3PSVA 4FNQA 5D32A 1XM3A 5TBOA 5BNKA 4YCPA 3HIJA 2WQPA 3MUXA 1L6YA 4XBSA 3BLFA 1YXDA 4ZQCA 4OWGA 1VZWA 3TSBA 1ZFJA 2XN2A 1GZGA 2ATSA 2NWRA 2H6RA 3G0SA 3EWXA 1F7BA 4S1FA 4AH7A 4KWVA 3T40A 2H3BA 4N9CA 1YYAA 3L67A 3BG3A 3M5YA 4JTLA 4O28A 1OFAA 4LV9A 5LKYA 2ZA1A 1RQEA 2BWGA 5CPLA 4DF2A 1ZALA 2QCDB 2RDUA 2DZPA 1O60A 4JTKA 1GVSA 2VFEA 3Q37A 5C6MA 2JK2A 3G8RA 1DJNA 4LU0A 3MP3A 4AHOA 3M5XA 3NPXA 3HB9A 1H7OA 1OFQA 4LC8A 4XQ6A 1TTIA 3ABRA 4N9BA 3LHYA 1Q6QA 5G2HA 5K9DA 3TXZA 3A5FA 3LGEA 1UUOA 2FPTA 4IPIA 1JCYA 2VFFA 2FTPA 4Z1BA 4FX7A 2HS6A 2V0TA 5EA9A 3NQ6A 4K36A 4MJMA 1IIHA 1LOLA 4PTNA 1XC4A 1TQXA 3NEVA 3TR2A 3LCGA 1TB3A 4CCCA 1G69A 5CZTA 1A5BA 5HWJA 2Y7FA 2QCHA 3F1QA 3S6DA 3W75A 3DKJA 5U4NA 4Y6GA 5KTLA 1TPVA 5KINA 3NYZA 5K7JA 2OT1A 4EVZA 3IIOA 1ADOA 1XBXA 5KMYA 3NDOA 2P0OA 4MY8A 3OHIA 4O57A 4A3UA 5D03A 3TFCA 3W7NA 1TRIA 2NUXA 2NX1A 4NNAA 3G1VA 2QCGA 1WV2A 1FWNA 4I7WA 4ORIA 1FDZA 3SZ8A 5K9CA 1LM1A 3L5LA 3UY8A 2C15A 3NOEA 3C2RA 1PCKA 1XDMA 1R2RA 2DZVA 4NJGA 2ZRXA 5FF0A 5K3VA 1W3NA 2OJPA 4E0CA 1SW3A 1DL3A 2Y7EA 3O8AA 3JS3A 1F05A 5AHFA 3TQ0A 3EWBX 3HO8A 3W7GA 1MEWA 1PHWA 1EEPA 1KM5A 1TCDA 4LS2A 3B4UA 4R53A 2VFIA 5I3JA 1OX4B 3R12A 2J27A 1ZY9A 3LOTA 3C4UA 3SIZA 1Z41A 2WO5A 5GVJA 3QEZA 3W7KA 4S2BA 5FEXA 1QAPA 4M7TA 5E0KA 3BW2A 1SO5A 1QFEA 2I9EA 2QUVA 3W2JA 3LXAA 1YTKA 3OVRA 3TFXA 1JR1A 3STGA 2BXVA 1T99A 3OBKA 3W86A 5KSWA 4UMCA 1LRNA 5D37A 1G4SA 4IMFA 4O19A 3W7LA 5CSSA 5I3FA 1H63A 2GJNA 3N19B 1KBJA 4E2BA 2E77A 4FF7A 3TQVA 3T44A 4UR7A 3R8RA 1S3HA 4AEOA 2CLFA 4MZ8A 4O8RA 1M7OA 4GUFA 4RK8A 1W1ZA 3L5AA 4NJKA 3P8IA 1FWWA 3H55A 4XKYA 5CZ0A 2CLKA 3STCA 2WNZA 3SI9A 3L65A 3HPSA 3KRUA 4ZL1A 1PIIA 3E12A 3O15A 3S1XA 3W1QA 3KXQA 5FEZA 3W7OA 2ZRUA 5BMWA 2ZDRA 2ZZ3A 3E02A 3GDMA 4XKYB 2CW6A 2OZ0A 4ADSA 3S5OA 4QITA 3LCIA 4H3DA 5EBUA 5EKYA 4LUIA 4UTMA 4JDBA 2ISWA 2ZZ6A 3D0CA 1H5YA 3MI3A 1VLWA 4MFEA 4XUGA 3NL6A 2E09A 1LTDA 3PWAA 4ONVA 3UXAA 3W2NA 3TXVA 3CT7A 2YCEA 4FNSA 2ZRYA 3WJYA 1YXYA 4UMAA 2ZRWA 2EGZA 4A21A 3S5YA 2C13A 2J9YA 3ABOA 1IGSA 1SW0A 3H54A 3MW7A 3GXTA 1A50A 2E6YA 4EF8A 2Y7GA 5D33A 2WNQA 3N73A 3N14A 1WAUA 3BGGA 3TJXA 3EWZA 3G8EA 1U5JA 1EUNA 1QPQA 5DCBA 3FS2A 2WNNA 1OFEA 3FKRA 4IXXA 1GEQA 1ZAJA 3FOKA 1H7PA 1FCUA 3A24A 1GVFA 4JY8A 1WXJA 1TPWA 3IRDA 1JRCA 2H8ZA 2FLIA 3H53A 5AHLA 4Q32A 1K3UA 4UFHA 2NV1A 3L0GA 3P82A 2NWSA 3W1XA 2ZCGA 3O07A 1YADA 1TYGA 1TRDA 2CWNA 2VEPA 3W22A 4LUJA 2QCFA 5D38A 2GJLA 5J5DA 2C18A 4UC5A 1D9EA 3W1LA 4AHQA 5D2WA 1F74A 4OGZA 5KITA 2FDSA 5CKSA 2PRHA 2GVLA 5LZLA 3P61A 3NZRA 3MWAA 2F84A 4YLWA 1JQXA 3GNNA 3AJXA 4AB4A 1P0NA 1YTEA 1LORA 1N7KA 3PUEA 4HPJA 2V9DA 4UFMA 3W7JA 1K7EA 4KKXA 4DXVA 3G0UA 2ISSA 5LGXA 5FEWA 3M16A 1BKSA 2CLIA 5LSMA 4IQLA 3UWVA 5IBXC 1KFCA 4PFMA 4Z0SA 3L9CA 4JTEA 4JTIA 3LI1A 1JUEA 1Q6LA 3Q2DA 3NL3A 2CFFA 1I2PA 2WJZA 3UWQA 2F7FA 2WSQA 3DBPA 3P5ZA 1F5ZA 1PE1A 2NUYA 3DKLA 3G1AA 1T0OA 3E96A 3N2MA 1W5MA 1A5SA 4ZQNA 2YGYA 4NNBA 3QMRA 4AAJA 4EWND 1Z44A 3B8DA 1J2WA 4FIRA 1QDSA 4NJIA 1G67A 5AHEA 1AL8A 5G1YA 3GXNA 1K02A 3V1PA 4NVTA 3OA3A 4N9DA 2HMCA 3SJ3A 5AHIA 3I7SA 3IEBA 5F4WA 5C54A 3A5VA 1GPWA 3ANYA 3TJLA
chains in the Genus database with same CATH superfamily
3A9BA 1PBGA 5BOOA 1BYBA 2Z4GA 4X0NA 4G7EA 3W82A 3MA8A 7REQB 5BXRA 1KWKA 4S3EA 1HT6A 2IMRA 1XYAA 5A94A 3LSBA 5CZSA 3GBDA 3AS2A 3GBEA 4AMCA 4DJDD 1S5VA 3FIGA 3TV8A 4F2UA 3VMNA 1GG1A 3KZPA 4NXKA 3MMUA 1IZCA 2A0NA 2W61A 4XWUA 3LD5A 3C2YA 1VLIA 2Q6ZA 5AC8A 4E4PA 1E6SM 5DFAA 3KTCA 3M5VA 4RJEA 1G4EA 3MDUA 2XVNA 3CQ0A 3ZO9A 4PA8A 3P84A 3K4DA 1Q6EA 4UNLA 3V0TA 4JHZA 4UFLA 3A6OA 2J9XA 5CC7A 3R8HA 2ISFA 4TU1A 1RXOB 3CZGA 4UIOA 3B0PA 4CNOA 3VMOA 1JZ4A 1TIMA 2O7QA 1XSIA 3ATYA 3ONCA 4A2RA 2DP3A 4ZOCA 4JQ3A 3FV9A 4Y9MA 5JMUA 1CLXA 5F7UA 1UWRA 4Z2GA 2DZSA 4BEQA 1EQPA 1IEIA 3SR7A 4JL1A 2WZEA 2I57A 4LBUA 1F3EA 4WGXA 2GYIA 2B7NA 3GNDA 1GQIA 1VPQA 3BUVA 5HR7A 3MYOA 1Q7MA 3TSDA 5A6KA 1IEQA 3T4CA 1LQAA 2X0YA 3B03A 4AZIA 3REQB 1K03A 3T78A 4WOQA 3QKZA 4KERA 1TVNA 4Z1DA 4HP5A 5HATA 4DBSA 1TWZA 1S1PA 3IVTA 3NL5A 1R3YA 4JIEA 5D2YA 2VR2A 4ICNA 4NQ1A 5G4HC 4DJFC 2AQVA 4H9ZA 3UY7A 1NF0A 1R38A 4HZMA 2HNHA 1EF3A 1V7YA 1BKHA 3SSJA 3BCJA 3L7RA 3LMYA 1V93A 3AMDA 2XYLA 3NTYA 3F5LA 1W37A 1AZ2A 3CPRA 3S5ZA 1S5NA 2IXUA 3N4FA 1CYGA 1P48A 2X0SA 3IJIA 3SIMA 3EKZA 2VEFA 3SCWA 1TJRA 4MWAA 5E09A 2O4QA 1BEUA 1ZP3A 2DVXA 4H8HA 6A3HA 1IT8A 5EMYA 4OQVA 3OZOA 4JPGA 1R86A 2JEPA 2W4XA 1HG3A 3F4CA 1BWKA 3QY6A 5CBBA 1KLZA 2XIIA 2JF6A 4AZHA 5CH9A 1XH0A 2VX4A 4B3ZA 3DFPA 2NX9A 1XYCA 1PKMA 1PX3A 1KQYA 4W7VA 3CEPA 3SUUA 3W38A 5AYXA 1JI2A 1SYTA 3BAWA 1A5AA 2RHGA 2VM8A 1MQRA 3VIPA 5TQLA 5CPQA 1KV8A 4KEZA 4JFVA 3WH9A 1EL3A 1KRMA 4Q8TA 4GYKA 3RRXA 3ZIZA 4M5PA 3ALFA 6ALDA 1BSLA 4AWEA 2E9LA 3PWIA 3KVLA 3PBYA 4IIDA 2VX6A 3EMCA 1QCWA 1V0MA 3NQDA 4JTGA 4DYKA 2BSLA 3AJ7A 1R9YA 4QLKA 5HINA 4A4AA 3QV6A 5GPRA 1AH0A 1PTDA 2CYGA 4O8AA 5DELA 2VCBA 3KUMA 1J10A 2CLHA 4GQQA 5HANA 3EXSA 4NZFA 1NWTA 3R58A 4AD5A 4LAKA 3SB0A 3N6JA 2W92A 4LQ1A 1FP8A 1WKYA 3W70A 4WUIA 4IPJA 3G77A 2RDXA 3U3HA 1HO4A 3QY7A 4B2DA 3A21A 1EX5A 1S5WA 1B30A 1FUYA 3GU1A 4GX8A 3VAVA 5CEWA 2CXGA 2PD5A 1BTCA 4U5KA 3CB3A 1S2AA 4F66A 4BWLA 3B8TA 3WNNA 5AZ1A 4O53A 4YTRA 2PMQA 5G4EA 3T2PA 4AZ5A 3BCDA 4DBWA 4D6EA 3UXIA 2OU4A 4DXKA 3BZGA 1E40A 5F1VA 4GJ1A 3U6WA 4I7VA 4TTUA 3GFZA 1MZRA 1R5YA 3WQWA 3UJ2A 3DGRA 3FEMA 1QI4A 2QNEA 3I6TA 4LUTA 3KM8A 2B7PA 3KOZA 3A3XA 4V28A 3UZJA 2Y89A 3W0KA 1JAEA 2W67A 3EWYA 2R1MA 1O1HA 3WH5A 2GSEA 4GO8A 2PTYA 3M47A 2QCEA 3HG4A 4H6EA 2R6OA 3GHTA 4FX8A 4DWSB 4O17A 3TR9A 3KDNA 4G56A 4REQA 1SR9A 4M81A 1XPGA 2BG5A 1PAMA 3W83A 3P62A 1XXXA 2CC0A 3LLDA 5HAOA 4P8XA 1VFLA 4EF9A 3AIEA 1ZB5A 4QSFA 2CHOA 4POCA 5ABFB 2OXNA 3TW6A 1WDDA 5IHRA 4KT2A 3HJEA 2OLSA 3AZRA 3N2XA 3WJZA 1FQ0A 2WM0A 2ZC8A 4LS0A 1DV7A 2V3DA 5LXEA 3F4WA 4QAIA 1CX9A 4IL2A 3HU7A 4JN8A 3HFTA 2MNRA 4MHBA 4AMAA 3R11A 1LL7A 4DYEA 4EXBA 3ALGA 3PAOA 1TPC1 3W7EA 1RVGA 2JKPA 4NAFA 1DHPA 1L2UA 1R47A 2QV4A 2DZTA 4R5EA 5BOFA 1P1MA 4S23A 1YEYA 4Y96A 3KS6A 3NEHA 3W81A 3GVQA 2C71A 1UWQA 2OZTA 4C6KA 1RCXB 2OG9A 5CAKA 1GJUA 2YXGA 3PS7A 4LVDA 4Q7NA 2JE8A 1ZZMA 3NG3A 3WYZA 5FF7A 1NQKA 1IZKA 3FEQA 2C0HA 3FJ6A 3HZ3A 4XBJA 4ERAA 3RF9A 3GDBA 1F4AA 3FY1A 3L4VA 1R9XA 3DFSA 2PURA 5C9UA 3PBVA 3AMKA 3RJYA 3BW3A 5CPMA 4TV6A 1V3HA 3I65A 2OEMA 1S2UA 1V6UA 4IIBA 4A05A 4CD5A 1LF1A 4LVGA 1S46A 3W88A 3M07A 4ZEPA 1F2JA 5I06A 4GVGA 2OGYA 3W1UA 3GDRA 5XIAA 3A3WA 1U1HA 3QH2A 4HT3A 1TV4A 4BI6A 4H6QA 4JXCA 3TZNA 4OBTA 3S9ZA 2G37A 3TQPA 4KRZA 3UJEA 3CO4A 5LHFA 3L0KA 4O0QA 1X6UA 4IISA 4JAWA 4HA3A 2XU2A 4GC4A 4Z2KA 5KZDA 7REQA 5TAOA 1D2KA 3FYOA 3P74A 1HF6A 1Q8JA 4A8NA 1UG6A 4UTJA 3LRLA 3K13A 1KCKA 1WDQA 2HJPA 2YJQA 3HM7A 3RMJA 1TG7A 4URIA 4X0VA 3KE0A 3UG8A 5A69A 1XGEA 4S39A 5AOUA 3LA4A 3EKLA 2FTYA 2PGRA 1WOBA 1O94A 3ZSSA 2G96A 4BF5A 2ZBTA 4NRSA 3FVDA 3R25A 3WEZA 4KWWA 5MKGB 3AXKA 2YBUA 2WMGA 3FYPA 3S2MA 3ARPA 1FH7A 2E6FA 1WZKA 3T42A 3OU8A 2D0GA 3DU0A 2PBOA 1TTQA 5LGZA 4NNCA 3QFWA 7ODCA 3SRDA 5EL1A 3P8JA 1XKJA 5DX7A 1KA9F 3GXDA 3KWSA 2Z29A 3AQUA 5A6BA 3WLTA 5BYWA 3MSRA 4YTSA 3KBMA 4QROA 3VKJA 5LNSA 4S3FA 1LOSA 1UZ4A 4WCJA 3CIVA 1Q6GA 1ICSA 4PMZA 2XFYA 3REQA 4DWSC 4IH3A 5CBJA 3E6EA 2WCAA 3N4AA 1ECEA 4V1XA 5EGRA 3SRKA 2QJGA 4AEEA 2D0FA 2XTKA 1V0KA 2NSOA 9XIAA 5LNUA 3T1GA 3TCEA 5BOEA 3VKCA 4G5DA 4DJED 1OM0A 3HQPA 4M6QA 4BR1A 3KL5A 3CIXA 4FNRA 4E2DA 4NX0A 4N42A 5FAGA 2WANA 2GFTA 5LA2A 2OZ8A 4XD5A 3BLEA 1J8VA 4H7ZA 1OINA 1I0BA 3NGJA 3NPWA 5ABEA 3TYDA 1X6LA 1RK6A 3GLCA 3NPVA 1EJVC 3W1RA 1OGBA 3EDKA 1V79A 3O7UA 1YDNA 2ASHA 2WBGA 3LHWA 4YVVA 3ZLGA 4X3ZA 4JYFA 4M56A 2QAFA 4ZE5A 3UZWA 4RE3A 5FJOA 1E5NA 3CQJA 5HUOA 4DWDA 4IX0A 2XSAA 1KRBC 4V27A 3TC7A 1CB2A 2KAUC 3S1GA 4NZJA 4AWUA 4N7QA 3P6LA 3T0DA 3TSMA 1GWJA 3UYIA 4FALA 4CEUC 1MRAA 1HKKA 1K1DA 1A5CA 3C8FA 4KIEA 3LU2A 4IMGA 1NSJA 2YX0A 2YBVA 3K46A 4DQWA 2X16A 2R24A 3LEPA 3KBWA 4K2SA 2QAPA 4R27A 1VFFA 4AHPA 4HTBA 1OK4A 4L6HA 3TK7A 2QCMA 3RMEA 1RPXA 2A3AA 5FI8A 1EIXA 3NQGA 3PTKA 4CNUA 4XZLX 4O54A 5GNYA 3ARRA 5D02A 2NT1A 3U5YA 4H8VA 3V36A 2C8NA 4P61A 4C90A 4U31A 1KM4A 3NPUA 2ATMA 1I2OA 4Q8WA 4XAPA 2VFDA 4TX6A 3VKKA 4FO4A 4AF0A 4OVXA 1UKPA 5HNRA 1I9CB 4R33A 2CBJA 4DJDA 1JGMA 1GGOA 4IWWA 4RPQA 1SZNA 1PEZA 1RAKA 1VFMA 3FN9A 3WLQA 5AB3A 3HOJA 4KIRA 3QMTA 3W2KA 2WSKA 5HWMA 1FHUA 5AKQA 2G8ZA 1ALDA 4P8UA 3TUUA 1RA5A 1UOZA 3MUY1 2PF0A 1W1PA 2RAGA 5I07A 3RDKA 3MB9A 1PIFA 4OIFA 1E6ZA 1S2TA 1WDPA 3IV3A 4FOKA 5B80A 2A3LA 1Q2RA 1O95A 1H50A 3UR8A 1XLFA 2FJKA 2FFIA 3W25A 4IF2A 2OWCA 3AALA 4W5UA 1KGWA 3HJZA 2GUUA 1XC6A 3EX3A 3UR7A 3BURA 2QPUA 1TELA 4YTUA 5A8OA 3UYCA 3NXLA 3TE9A 2EF9A 2IUZA 5FD0A 5A6JA 1QO2A 4RXFA 4FNUA 2VWTA 3GXFA 4M1BA 4EPEC 4CQDA 2OT0A 1YXCA 1UD5A 2EAWA 4IUGA 3BXWA 5IM51 1OF8A 1IXNA 2NLIA 1EB3A 2HBXA 4MM1A 3H2CA 3FKKA 4PUNA 3SEPA 2X05A 3BWWA 2BVDA 4PSPA 4WQ6A 4LAUA 1CGUA 3QZAA 2WZTA 1K9EA 3KRZA 1OF6A 2PSNA 3QR0A 4WXYA 4WVXA 1QRQA 4PCSA 1KFLA 2G95A 2QVHA 4JX5A 3BOFA 2PRLA 7ENLA 4Z2IA 2WHLA 3OYXA 3PG8A 2FPYA 4Z2HA 1PKYA 1KBKA 4YJ5A 1XFCA 1RR2A 2OSWA 4H9XA 1CI1A 4UFKA 3UG4A 1E71M 3LHVA 3TW9A 4YYFA 1UJQA 2I9UA 3KOXA 1J4EA 3WMBA 1O5XA 2GK1A 4J3UA 3MCMA 1M65A 1V6WA 1EPVA 4MAVA 1EXPA 3CHCA 4CD6A 1WBJA 4FLOA 4X9YA 3LHTA 4IGHA 3S83A 4NYUA 1X7FA 2WKJA 1CGVA 1Q6RA 2XSXA 1IZJA 2E9MA 2DT3A 4UOJA 2Z26A 4EIVA 1T6MA 2FVKA 4WZHA 3HG2A 4JNYA 3B0YA 4UZUA 4E5TA 1XIJA 2OX1A 1J96A 4CCEA 4IFRA 3Q4DA 4DN1A 2HXUA 3IAPA 3VCNA 1NF7A 1N8WA 3KOYA 1S5MA 3TWBA 2OVLA 1KFKA 4I6KA 4R3UA 3AZSA 5ABGA 3WENA 2E68A 3WN6A 4E2VA 1V6VA 5MKGA 3RCYA 5DMYA 1TSIA 1R85A 4WY0F 2YLAA 3W02A 1SZGA 2G50A 4F0MA 2GQ8A 1GVOA 1FFRA 5A6SA 1CLVA 4P5UA 2INZA 2R94A 3BLOA 1E1CA 2J66A 4WOZA 3NQFA 1E0WA 1XDLA 1UH2A 1GORA 3M0LA 3O0FA 3WH8A 2W66A 1G01A 1UP3A 2EG7A 3UCQA 4AF0B 3QW3A 3IJ6A 3A4XA 3URAA 5C5YA 1BWLA 2QF7A 2BY3A 2HXTA 4HPXA 2WJFA 3CV2A 1SZEA 4XUYA 2ESCA 1Y5XA 3MMWA 3LK6A 3CUFA 3H12A 2XZ9A 2J7FA 2VEIA 5KEZA 1FY6A 5DXYA 2V2DA 3RLGA 4AIEA 3OGVA 4C7FA 2LLEA 3K8MA 3ZR5A 4BCEA 5HBFA 3UPBA 5T91A 3B8UA 3WLSA 4HNLA 1TVPA 1IE7C 1UJPA 1ICPA 3CL6A 3K4AA 3QOKA 3VX1A 3I4EA 2XH0A 2DZAA 3UXKA 3EOSA 3NQEA 1ONEA 1AMKA 3ZLHA 1ZTVA 2DSUA 3JUGA 3N15A 3WK2A 1QI5A 3C61A 4DF0A 2X7WA 3NA8A 1SZFA 5C8BB 1ZENA 4Q7IA 3LTSA 4GI9A 4GIAA 4HHLA 4LFYA 3THUA 3WLPA 2BOEX 1E1CB 3BG9A 2E5BA 1C3FA 2BS9A 3MWCA 1XYFA 4B5NA 5C2GA 3TVAA 4S2CA 2WWCA 4HMDA 1YW1A 2DU2A 5E6YA 3XIMA 3PHAA 5C0QA 3Q58A 3MSGA 3PNZA 2OQLA 4OV4A 1B5TA 2PGEA 4KEUA 3VX0A 3VE7A 1DHKA 1FWEC 4LEFA 2ZC1A 3H2AA 1K7FA 3WEOA 3TA6A 2Z7KA 1OY0A 3OODA 1L9WA 3RK8A 4CEXC 5F4XA 2XDFA 1KQZA 3R13A 2UY2A 4MZ1A 5DN1A 2EO7A 3QPYA 4K8EA 3JRKA 3L4ZA 3SN0A 2TYSA 3L2LA 3I6RA 1SJDA 2G0WA 3DHPA 1O4UA 2GUYA 4H2HA 3CUGA 3PUGA 2GUBA 5I3KA 4BQ4A 1P7TA 4NY2A 3LLFA 3TYBA 1GT8A 4WKAA 3S6OA 1UD8A 4C1NB 3R94A 2BVYA 3G3DA 2B7OA 4UR8A 3DESA 3PSWA 1KTNA 4P2VA 2OX4A 1P7TB 3H7VA 3CZKA 2VDIA 5C55A 4OECA 1IWAA 1VENA 4ADTA 4LV4A 1RJPA 4E6MA 3S8HA 4P7RA 1ITUA 3WLJA 3MI2A 3BJTA 5KZEA 3WQGA 2E67A 3BW4A 4IIEA 5C7VA 4ZVJA 3WCZA 2VQTA 4FA3A 2NW0A 3KP1A 3GXMA 1FRBA 3FJLA 3N9RA 3GZ3A 4RV8A 3VGFA 3LBOA 4WJEA 3AS1A 2R1NA 3E2RA 3OHMB 4YVPA 2QCLA 3QW4B 1VFSA 1DBTA 4XG1A 1OGSA 1TPFA 4OUEA 4KEMA 2OMAA 2PAJA 5GJNA 3WQ4A 1MEHA 3WUFA 4Z17A 3N17A 3GH4A 4J35A 4TMCA 4LRTA 4QDPA 5HJLA 2TPSA 1DORA 3CGTA 6ENLA 4LALA 3LCWA 4ZQMA 4JCLA 1PHQA 3TTEA 1I2QA 4AY7A 2ZE3A 4X63A 4L64A 3UNTA 4IOTA 2XM1A 5HR6A 3O6CA 5D30A 3VD5A 2J8FA 1JYNA 1JJKA 1HZYA 1NDWA 2YFOA 4HMEA 1T8XA 2X1RA 1K9FA 4TIMA 4BEUA 4PUUA 3ZR6A 3FNDA 3V1HA 1EJTC 5A8GA 4QLJA 3W71A 3GNOA 4XAFA 3FLUA 2HS8A 1FXPA 4MJ4A 3WD4A 1VYRA 1ZJHA 2BY2A 1Q6DA 1CXLA 3SCNA 5EMMA 1SFJA 3ZWTA 3DFQA 4M6UA 5T8GA 4KPLA 3MJYA 4Q4OA 1NTHA 1FKWA 1JULA 3W74A 5DCEA 5BNKA 1OC7A 1TZZA 2F9RA 2PLKA 4JFSA 3MUXA 3BOLA 5DT5A 2ICSA 1R7AA 3RPDA 4ZQCA 1TV2A 1MXDA 1VZWA 2QMJA 1EYWA 2XN2A 1GZGA 2ATSA 3EWXA 1F7BA 2FZ8A 2WMIB 4KWVA 1C91A 2H3BA 1YYAA 3M5YA 5EBAA 4G8TA 3KL3A 3PZIA 1VKFA 3AS0A 1GVSA 2JK2A 3VIFA 1DJNA 4LU0A 2ZE0A 3MP3A 1J79A 3NPXA 2OELA 2Z25A 1SMAA 3AMGA 3QKEA 1GKRA 2FPTA 2ANUA 3EDEA 1BRLA 2FTPA 3HA1A 3WDHA 3U2ZA 1IR1A 3NQ6A 1Z9AA 4JIRA 4PTNA 4GZ7A 1HJXA 1Q65A 4GY1A 4L9XA 4H2CA 3TR2A 3LCGA 4CCCA 1RSCA 1A80A 3QY8A 3W75A 3VDBA 3K8KA 4Y6GA 1TPVA 3NYZA 1GNXA 4PYSA 3E2SA 2QIIA 4IL0A 3CV1A 2C91A 3FXYA 4PULA 3W7NA 1ZLPA 3N11A 3SQSA 1Z6KA 4NNAA 1UD2A 2VI0A 1FWNA 2E1WA 4I7WA 5HQLA 1FDZA 2DQWA 4GYPA 2ON3A 8CGTA 3VGEA 1PO9A 1PB0A 3U4FA 4S3GA 3VNYA 1NFPA 2PDYA 1KXVA 4ERIA 4F0KA 2J13A 4CNTA 1NH6A 3O8AA 4DY1A 5AHFA 3TQ0A 2JALA 1U5VA 3O0KA 2PP0A 2QMKA 4LS2A 2GGJA 4R53A 3IARA 3KTXA 4W8AA 1CNVA 1ZY9A 4DJEA 5M5DA 3LOTA 1MXGA 3OJGA 1B3XA 3SIZA 2WO5A 3OZPA 4S2BA 1V3IA 5FEXA 1UWIA 4DAFA 3BLLA 5E0KA 4BZYA 4HZ6A 3A4JA 3VNZA 1QFEA 1V6YA 2I9EA 5M17A 2PGWA 1UWSA 3OVRA 1YNYA 3VDAA 1JZ7A 4U2YA 4OOUA 4EAMA 2WPGA 2Z1XA 3V18A 1GOWA 3N19B 1EF2A 1YX1A 2E77A 4B15A 4UR7A 4JOMA 4GX9A 2ZWYA 2CLFA 5A8NA 2VCCA 4MZ8A 4RK8A 2FVLA 3MUZ1 2OSXA 1E4LA 4HMCA 4NJKA 2VYOA 2OOGA 2FJUB 3FDGA 3RHGA 3E0LA 4ZA0A 4ZFCA 2VZTA 3HPSA 3G6MA 3KRUA 4PTVA 3S1XA 1F3WA 1TR1A 3KXQA 4RW5A 3W7OA 4S3DA 1UMLA 2QLYA 3EDFA 1SJBA 2VZVA 3GDMA 3S5OA 4C6EA 5EKYA 5EBUA 4MF4A 4UTMA 1H5YA 2ONEA 1Z32X 1LTDA 3VIJA 2FTWA 3W2NA 4X2PA 1CXIA 1GQLA 2DVUA 3W4RA 2GDUA 3QV9A 3CT7A 2YCEA 4ZE4A 2ZRYA 3QZ6A 3ZT7A 5GJPA 3AAMA 4A21A 4B5VA 1GKQA 2AQOA 1CXHA 4LAZA 4IP7A 4GFIA 3GYCA 1UROA 4LY4A 1DJHA 2GJRA 4KS0A 4FLQA 1NM9A 2QYGA 4EF8A 3LNMA 5D33A 2WNQA 3N14A 1WAUA 3WNMA 3F4DA 4W89A 1U5JA 2DT1A 4GLEA 3PBGA 4DB7A 1FCUA 4JY8A 1UMYA 1JF5A 3RPMA 4DJFD 2V67A 4PB5A 5I6SA 4NILA 1CDGA 1UZHA 4PMJA 5AHLA 4Q32A 6XIAA 2NV1A 1E1EA 3K1GA 1YADA 1TRDA 3WLLA 2CWNA 2VEPA 3W22A 4B9YA 4LUJA 2X7VA 2C18A 1QHOA 3OLIA 2WCSA 3ZJKA 3N1AA 3ECQA 1K6WA 3SFWA 2GVLA 4GY7A 2REQA 2QV5A 4U2ZA 2F84A 4IP5A 5FACA 3GNNA 2ZUMA 1PZ3A 4UFMA 1FWIC 3W7JA 5GJMA 4DXVA 5FJIA 3W29A 4JQ4A 1RY8A 4I5RA 4J3ZA 4IQLA 5IBXC 3OYZA 4P7OA 4S3JA 1KFCA 4PFMA 4R85A 4Z0SA 4JTIA 1I2PA 3UERA 1K4HA 5IOBA 3CHDA 4PN2A 3DBPA 3P5ZA 1F5ZA 3E96A 4TQTA 4MDOA 2WMJA 4GXPA 2QVNA 3F2BA 3QMRA 2EPOA 4AAJA 4EWND 3B8DA 1TJ2A 1QDSA 4YU1A 1MQPA 3OLEA 1E0VA 5CLTA 4N9DA 1A5MC 2WMIA 1KRAC 3I4KA 3N18A 1WZAA 1V3LA 1L6GA 3FHQA 3OW1A 2WWDA 3A5VA 1GPWA 2E09A 1LWIA 1AW1A 2VT0A 2OR2A 4AZCA 1XI3A 2YA2A 1HN1A 2VUYA 3WQFA 1TO3A 2AGKA 5HDRA 2Z1KA 1K8XA 1W2PA 3HPZA 3PFRA 5E0FA 3B9OA 3L2IA 2DH2A 3D3FA 1LQ0A 2R1KA 3RCNA 4U28A 4GE8A 3T07A 1LT8A 3W2LA 1BD0A 5D2TA 3MP5A 1SJCA 3OGRA 1QPKA 2PWDA 3GDLA 3AISA 3SQLA 1BPLB 3CAVA 4XAYA 5E0CA 1NFBA 3DC8A 4GNKB 3WUBA 4F0RA 4QCEA 3WX7A 4FS9A 2PTWA 1VBJA 1X1NA 1U1JA 1PKLA 4W84A 3S0CA 3VCCA 1TV8A 4JTAA 3QYQA 1KR0A 3EEGA 1XCFA 1NEYA 1ZAIA 3VOCA 3IANA 1UR0A 1SO3A 5D2VA 4BF7A 1DXIA 1YDVA 2ZYFA 2VC6A 3O63A 3W76A 1ZL1A 4KBXA 4U5IA 1FWDC 3HV8A 1FWFC 3UWZA 3I6EA 5G1TA 2I16A 2DT0A 3MJMA 3R0DA 4NAEA 3SN1A 2Z2UA 1XUUA 1Y5VA 1KM6A 2VC9A 1WKFA 3LQLA 1HJQA 5G2IA 3RNDA 3W6LA 1A0EA 3DG3A 1M6JA 1XHGA 1S2CA 4TO8A 1DVJA 4HA1A 3KTSA 1B0IA 5B7ZA 2KX9A 2HBVA 2O56A 4BWLC 4YIWA 4MLJA 1DWAM 3GAYA 4YS1A 2OODA 2CZVA 4FP1A 4WRHA 5T26A 3QMSA 3QYSA 3C0LA 4Q8OA 1PZ0A 1VPXA 1F76A 3ANUA 3W6MA 2VR5A 3KL0A 3H26A 1F6KA 5DBTA 4XD4A 1QT1A 2BMBA 1I1WA 1LP6A 5KZMA 3V0SA 2PDBA 1EC8A 1FFQA 4Q8NA 2A7PA 2WZHA 4NHVA 2XWDA 1G6CA 3WF0A 3C52A 3RX3A 3SUWA 1O5RA 2XVPA 4HJFA 2E6AA 1NU5A 1J93A 1B9ZA 3HG5A 1W56A 3GDTA 1DWHM 1HGWA 3ZJ8A 1CW2A 3SCVA 4Q6XA 2YL6A 3GW0A 5A95A 3PJTA 3CT2A 5F2GA 5I79A 2J4GA 1US3A 2C6QA 3VXGA 2V5LA 1Q13A 4QX4A 1UKOA 2WZMA 1QTWA 1T41A 3S6TA 4NYYA 3WH7A 3MVIA 5HJXA 4JGDA 3BAJA 3CPGA 2PLJA 3C6CA 1XYLA 4C5YA 1YPXA 2WOQA 1ICQA 1UWUA 1J0IA 1O6IA 1UYQA 1X8FA 5LA0A 4ZO8A 3UD6A 3MQTA 3GUWA 2P88A 1M7JA 4B90A 1Q8AA 3C8NA 4EX4A 5HNUA 3L4YA 1O68A 2ACQA 3BLIA 3OVPA 3QOMA 2YXOA 4CGTA 3P5YA 2V5DA 1B1YA 4FK9A 2E1DA 3EOUA 4NXSA 4DBEA 4DO7A 2ZIDA 4AVOA 3DIPA 4Z1AA 4G1NA 1KKOA 1RY0A 1VCVA 1MVYA 3UG5A 2X30A 4IZGA 4I9TA 3EYPA 3O1NA 2HE8A 3VUPA 4K3ZA 3W00A 3W23A 2DT2A 2IKHA 3AWNA 2E8YA 2F6UA 4ZFMA 4IXHA 3H7UA 1FCVA 4CUCA 2GVYA 3WMSA 4ILSA 5E6ZA 1QW7A 3LBCA 2VXNA 1TPH1 1W6TA 1PZ2A 5T9CE 2YPIA 4OTKA 4FHAA 3THAA 4IMDA 4W7WA 2BHYA 4A8LA 3LQGA 1A5KC 3LX9A 4FF5A 1KD0A 2DV0A 3GO2A 1BF2A 1XP3A 2VZUA 3EDJA 5TF0A 3C3NA 4MWAB 1HTIA 1V5XA 4YWIA 4Y90A 3AO0A 4HU4A 4HYWA 1I45A 2ZVRA 3WJXA 1RQBA 2PRMA 2VD8A 2YL8A 4Q4RA 4Y8EA 3UZ5A 1ME8A 3WY1A 3KEHA 2XGZA 3WF1A 4I7UA 4H6KA 4AX6A 3DUGA 1M7PA 3STFA 3I7QA 1TJPA 2YCLA 3DHUA 4RZ6A 2VFGA 4HNUA 3UPWA 4W86A 1FHLA 3L12A 3DECA 2WC4A 4U3AA 2CIPA 3OG3A 3B05A 4MIMA 3UGRA 1VBGA 5E9XA 3VNKA 3A3HA 1NP0A 3TKFA 2D2JA 1YDOA 3EX1A 4KWUA 2X1IA 3LXCA 2W0UA 5BW6A 1GOOA 1PYMA 1XICA 1OK6A 2XSBA 3MI6A 4GKTA 4LRSA 2XGBA 1OSEA 2UY3A 6XIMA 1A5UA 3GAKA 3B40A 2FQIA 1Q85A 2P5NA 3BARA 4PTXA 1S2WA 1OX6A 3PG9A 4OUIA 4JIHA 1V6TA 3XINA 5TIMA 3W73A 2G3JA 2QULA 1QNSA 4K39A 4IMEA 4FNTA 2I5GA 1ZBKA 2NQZA 1UWTA 1VHCA 2H8XA 3GQYA 4F0HA 3BV4A 1AQHA 1G5AA 1VC4A 2PU1A 5G1MA 8XIMA 2AKZA 4MG4A 1VAHA 3WQPA 2PCQA 5JBEA 3TOYA 2YLLA 3AIBA 1XCWA 4NZ1A 3VM5A 4KRTA 3VIIA 1IGWA 4CVUA 3MV01 3SRHA 3RIKA 4PC8A 4L1XA 4M8UA 3AFBA 2PA6A 3MCOA 3LG3A 3NQBA 4LWWA 1HW6A 3L66A 3M7SA 1PL9A 2EQDA 3GVWA 4F0LA 4Q8MA 4DX3A 1Q7QA 1UASA 3GVVA 3THDA 1BG9A 3G6LA 5CXPA 3CK5A 4IMCA 1GTEA 3PB2A 1ZU8A 3CLMA 3DN5A 2X0HA 3LS9A 1E0UA 3FHAA 4H01A 2FIQA 4F0SA 2V69A 3H70A 4QQ3A 4H9UA 2HSAA 2P76A 3UWEA 4AYGA 5HXMA 1L2QA 1HJWA 1LJYA 2Z00A 2GLKA 1ESWA 3O6AA 3OIHA 1HFBA 3TU9A 3RX2A 1GQJA 4Q3MA 1ME9A 3VOJA 4LUSB 2W79A 2JGYA 2H9AA 3ZYZA 5FESA 3PJUA 1WDRA 3RR4A 1FHVA 3GG0A 1HX0A 1VF8A 4MB4A 2VGGA 2CWXA 3N2OA 3WD3A 3HGOA 1W32A 1UR3M 1DIEA 3H2OA 4DRSA 5D8ZA 1GYLA 4O16A 1KGXA 3RXZA 3VFCA 4A22A 2OB3A 2OFJA 3SQMA 3PAJA 2XVGA 3HQNA 2PFHA 3HV9A 4LXFA 4E8GA 1R3RA 1KFBA 3SY1A 3DXIA 3BMVA 1FHDA 3P80A 3NIYA 1S39A 2QZRA 4QAWA 3SADA 3GB6A 1GJPA 3PP7A 1ZNNA 2ZRZA 2WC7A 4I9AA 3LCLA 3W1AA 4XO6A 3MDWA 1I8JA 5A6LA 3CQHA 2XIQA 2XVKA 1A3XA 3N3MA 5EMUA 4GWEA 1R30A 1O5QA 3ITGA 3CEUA 4MVAA 3FVMA 1XIBA 1JPKA 4IHCA 1TPUA 2NQ9A 3E3HA 4GD0A 3MBDA 2V82A 2OO6A 3NQAA 1J6PA 4C6NA 3Q67A 3AYSA 1ISVA 2WK2A 4U4MA 4ZXLA 1H2JA 3W7CA 3F4NA 2FYMA 4GBUA 2DGAA 4LCSA 2DSWA 3OLGA 1FX6A 4DPPA 3WK3A 3PB0A 3S5NA 2JBMA 4E8CA 4UOQA 3W85A 1A53A 4CKQA 4GCAA 3SGUA 3PANA 3PJXA 2NV2A 2Y4SA 2IQ0A 5A5WA 3RYSA 3TNBA 1KWGA 4LF2A 3W72A 1UP2A 4ZMGA 3NQ2A 2YL5A 4DUVA 4I90A 3TAKA 3H4WA 2BGSA 3LCXA 1TV5A 1V4YA 2VTFA 1RZMA 3WFAA 4ZOEA 5F1UA 4C6BA 2Y61A 2TODA 2IQDA 2FGLA 3NNTA 5JUVA 3AU2A 1H60A 1E9IA 5JH2A 2GSHA 1KBIA 1QJWA 5JBFA 2NQHA 1PPIA 1WA3A 4Z1YA 3B8IA 1ZSXA 3NYDA 1U33A 1OYAA 4Q8QA 2A3CA 4ECLA 3MPGA 4N0RA 3Q45A 2ZOXA 1P5BA 2ZA2A 3MU7A 4ML9A 4YYCA 2VR4A 3ZJ7A 3VNJA 3LB0A 3IIZA 3F03K 3NO5A 4LUYA 2EKCA 3QGKC 4PUMA 4GVHA 4MDPA 2J74A 4DEFA 3SCPA 1JDCA 1EWEA 2NV9A 3OB8A 3PZVA 3PZTA 5J8LA 1IEXA 1C8VA 2PDCA 2VHLA 3FGCB 3I3EA 4PUEA 3VINA 4XZMX 1UIOA 4P7NA 2J25A 3UJFA 3WLNA 5HPCA 5E93A 2WC3A 3QQ0A 3VC6A 2WSRA 2W91A 1TPB1 1ZRQA 3V4BA 3MY9A 1FWBC 2PWUA 3EWUA 4PBEA 3HF3A 4PH6A 5D04C 4D6HA 1GYNA 4LPCA 4INFA 3PZQA 1B57A 1QWKA 1JCJA 5BRQA 2Y85A 4QEEA 3TWAA 1L8NA 3VIMA 5C2CA 3TLLA 4EWJA 1BSIA 4FX6M 2HK0A 1S1RA 3IUHA 3MZ2A 2R82A 1MI3A 1F6PA 1DTUA 3MMTA 4K37A 1LOQA 3OVGA 4OU1A 1RP9A 2Y0FA 2WVUA 4IGSA 2AOSA 3CPUA 5LIKX 4BI7A 3C5QA 3CJPA 5T9BG 3P81A 4WY0B 4DM1A 4U33A 4LY8A 2CKSA 4JYEA 5GNXA 2OGJA 1E72M 2Z27A 3ICJA 2PDIA 4RDVA 1WZLA 3S9YA 4MPKA 5AYIA 3A23A 3FGCA 2AAMA 2XHYA 5L6UA 1RD6A 2UY4A 4QGCA 4FNPA 4LYRA 2PLMA 3PM6A 1H61A 3WBEA 4BA0A 2IKJA 2C79A 3E1F1 3T0CA 3T6CA 1V3KA 1H62A 1SU5A 3UWWA 1LLOA 5FF3A 4XB3A 2J7HA 4ACZB 4BHYA 5E70A 2WPBA 4CQ9A 1XLEA 5DQPA 4R9XA 4FXSA 4WDWA 5AY7A 2ZXBA 1SSGA 1BRLB 1XSKA 3CUZA 1XIGA 4KGJA 5G2WA 1C8YA 3T0BA 3WMCA 5JH1A 3R0UA 1MW1A 4TR9A 1ZJIA 1OT2A 2A7RA 2F61A 3G1YA 1V3JA 4FMVA 3S2NA 1PZ1A 4MLRA 3N9SA 3T08A 5FL0A 3HG3A 5D4YA 2ZX7A 4JDYA 2OWXA 3HPFA 1D8WA 2VD9A 1Z89A 2FB2A 1VFUA 2XH2A 3GK0A 3TLQA 1QPRA 2XINA 3JW7A 2J62A 3G1XA 1G0CA 1OEPA 2EPHA 2CLOA 2WNWA 4CQCA 4J3SA 3MUIA 3RCMA 4D8LA 1BF6A 3ZT6A 4OKDA 3VCRA 3AROA 1NDVA 1XX1A 4MJZA 1Q45A 5BRBA 1EX1A 3O2LA 4CNNA 3V7PA 1AD1A 1J6OA 2EG8A 3S3GA 3PZUA 4J3VA 5CC5A 1F8IA 2FGZA 3UQNA 1AL7A 3W7IA 1V08A 2REQB 4RDWA 4DUWA 3DG7A 2PDNA 1JNDA 1TTJA 1J11A 1ME7A 3VZZA 4DO4A 3MHGA 2HZGA 4D2JA 4KFPA 2DSVA 4YXGA 4DF1A 4GGBA 3HGJA 5CZKA 9CGTA 1FDYA 1OFRA 3LMZA 2BODX 4C5ZA 4GACA 4ZO9A 4LAOA 4KESA 4F40A 4Q4QA 2BXYA 3AXIA 1RCQA 4LOCA 3ZSTA 1F4HA 4DPQA 3GM8A 3S9IA 4FR1A 3W27A 4GK8A 1QI3A 3W9ZA 1LG2A 4F79A 4O12A 4YTTA 4H6RA 4AZBA 3TYCA 3UZYA 3UA3A 3AXHA 1WDWA 1WP6A 5AYZA 3NZ1A 3P0WA 5F2LA 4RNIA 4GI4A 3KWXA 3K1DA 3K4WA 5D05A 2NT0A 1C92A 4J40A 1E43A 1F07A 1MFUA 3NQMA 3B4YA 2YDQA 5DRCA 3OOQA 2X1SA 4JNMA 2ZQ0A 1L8PA 3WDPP 1VRDA 3RUBL 3NM1A 4Q4KA 4LVBA 4PCFA 3BPWA 1IHIA 1JUKA 4IX2A 2E5CA 4TX9A 1QVBA 1NWUA 2I14A 1QW9A 4XK2A 1Z69A 2ZZ1A 2WHMA 4ZQOA 1E6PA 2HE5A 4YCOA 4WXZA 3KOWA 4WKHA 1J2BA 1R3VA 2P8BA 2GQ3A 2Y7DA 3M0KA 2FFCA 3KBNA 1OGGA 3PPCA 2CNCA 4UQBA 4HN4A 5CJMA 4LCQA 4BFAA 4AXNA 3MHFA 4WDUA 1H7RA 3ZFHA 4WLCA 4CN1A 4E38A 3SCQA 5CGTA 3W1PA 3GS6A 1H51A 3QR1A 2JKEA 3WSUA 2PB1A 2VEMA 5FSDC 2X42A 3FCPA 1E51A 4IG2B 6CGTA 1LROA 1GKPA 1JYXA 1DXEA 1TX2A 3MZNA 4JL2A 1KFWA 6TIMA 1FKXA 1G4TA 3N3TA 3EPMA 4ML4A 5A8PA 3PPFA 3T7VA 3MMDA 1JGIA 3N04A 2CU0A 3PUOA 4X61A 2YYUA 2E28A 3SCOA 3EX6A 1DE5A 3AHZA 4F9JA 4WSJA 3FK4A 2WV8A 3WL0A 4XX6A 3WK0A 1Q4NX 3WK1A 2NXGA 2A4AA 4CNPA 2VRKA 3NXFA 3IAQA 2V3FA 1E6RA 4PBGA 4PBFA 4KFNA 3RO8A 5CGQA 1LRQA 1V3MA 4FAMA 3TAOA 4W7UA 5C71A 4GKLA 4XSLA 2ODOA 4W87A 4M0XA 4QJ1A 4HCDA 3M0MA 3BJFA 1SGJA 3LTYA 2PDGA 3GYEA 3CUIA 1XGDA 4YHGA 3AXMA 4GMEA 4Q4SA 3MT1A 1YMYA 2C14A 4O10A 5H2ZA 2A21A 3CQIA 3O06A 1X1OA 1Z48A 4ICMA 1TV3A 2ZWZA 5HUPA 4GUJA 2I17A 3R6IA 4C1KA 4O52A 4IIGA 1BGGA 1LCOA 3R2GA 5HQEA 3SM0A 1VB9A 2BTMA 3SN4A 1OZMA 1OT1A 3TMLA 4MY1A 2PWEA 3LCFA 3ME3A 4JFUA 1YDYA 4L65A 2POTA 2V2HA 5CSRA 8A3HA 5CPOA 5DY3A 3VDHA 5ECVA 4M19A 4TV5A 7XIMA 2G3IA 2VX7A 2FGBA 3MYPA 2X2YA 3QRHA 2PDLA 3PPHA 2J88A 1ZGDA 3UU0A 2YW4A 2CLEA 1EGZA 3D5HA 3V5CA 4UWMA 3VK5A 1DKWA 4OBRA 5HMDA 1Q7ZA 1FA2A 4PL2A 4NI3A 1TV7A 5DCDA 5J04A 1J0ZA 5H8PA 3R43A 1ODZA 2QUTA 1DXFA 3FFSA 3TDFA 4A8RA 4HA0A 3KVKA 5HMSA 3B06A 2RGMA 1BTMA 1DJXA 4ERGA 5D9OA 3F2DA 2V68A 3E49A 3H7RA 3TTOA 2CESA 3NOYA 3EB3A 3KCLA 3P7YA 4IM4A 4HNNA 1JVNA 1US0A 4AU0A 4J28A 4KWSA 1YPFA 3R10A 1XKYA 1E9LA 1JDFA 1EJUC 2WQPA 3FYYA 1UIPA 1WZMA 2PEVA 1QBBA 1CXEA 1ZFJA 6REQA 5HJYA 2H6RA 4U10A 4NAFB 2JIEA 4KF1A 4AH7A 4PRRA 3T40A 4LBSA 3H22A 1HXJA 4B5WA 3L67A 2O0TA 3BMXA 4HA4A 1OFAA 1RQEA 1W8GA 2EPMX 2RDUA 3OBEA 1VFOA 1O60A 4NKCA 4MNLA 3CYVA 3Q37A 5C6MA 3UA4A 4F3HA 2XIBA 3M5XA 3N6HA 4EE9A 3ABRA 4N9BA 3LHYA 2YCLB 1VFHA 1UUOA 3CO8A 4IPIA 3CAKA 1OBAA 3GSMA 4Z1BA 2CCRA 2HS6A 2V0TA 2Z28A 3HFYA 3BLPX 4IPNB 4DWSD 1IIHA 1LOLA 3BE7A 1XC4A 2BOFX 3NEVA 1G69A 5HWJA 2Y7FA 2QCHA 4I3GA 3EOEA 3TZFA 3ZVHA 2DVTA 3IJ9A 5U4NA 1I75A 5A6BD 4B91A 2CERA 4WDXA 2ZX5A 3M0JA 5D9PA 5JQ9A 3K8LA 5I0DA 2NX1A 2NUXA 3UETA 3L4WA 1WV2A 5K9CA 3L5LA 2C15A 4H9MA 1XDMA 3AHYA 1XQLA 4DAIA 2OEJA 4GH3A 4AIOA 2ZRXA 2NSXA 3WUEA 1ISWA 1G9HA 1F05A 3VNLA 3EWBX 3IJLA 3L4UA 5BXTA 3CQKA 3CMJA 4G6CA 2Z7GA 1MNSA 2WCGA 5I3JA 5FIPA 3C4UA 3L23A 3QEZA 4RDYA 1X8CA 4FLRA 1QAPA 4Y9NA 2MUCA 3OZMA 1QNQA 3J7HA 1R7OA 1RJRA 4PGLA 1JR1A 4ZTYA 3W86A 4CN6A 3ARTA 1FH8A 1G4SA 4O19A 2EG6A 3M0YA 1BLIA 1UR4A 5I3FA 2NQ5A 2PTDA 3OP2A 3ONBA 3T44A 3R8RA 1YE4A 4HHMA 4AEOA 4O8RA 1M7OA 3RM9A 3IWPA 2J79A 1JCTA 3TTSA 2XFFA 1K8CA 2WNZA 3SI9A 1E15A 2ZUTA 5CAHA 3UJRA 3D47A 3E12A 2G3MA 3NSNA 1K6AA 3ARQA 1R3TA 2ZZ3A 3MKKA 4ACZA 3P14A 4ADSA 3QGVA 4QITA 3LCIA 1UWAA 4H3DA 4LUIA 4JDBA 4WSHA 2ISWA 4XUGA 4MFEA 2YCJA 3POHA 4HGXA 1KO0A 3ZZ1A 4KCUA 2O9PA 2BBFA 3WJYA 3B8VA 1YXYA 4I9JA 3S5YA 2C13A 2EKGA 5I78A 4I8DA 3SY8A 1V03A 3AIQA 2EPLX 4TX8A 2RGLA 3H54A 1EZWA 4QG9A 3T2OA 4B5UA 7CGTA 3GUGA 3RLHA 3MC5A 5AYBA 1GVEA 1WUFA 1LWHA 1EUNA 3RR1A 2RJHA 2XH7A 4LNCA 4IXXA 5JBDA 3FOKA 2NVDA 2VRQA 1H7PA 3A24A 1E5JA 2OO0A 3N9KA 1JRCA 1VIWA 5EFFA 3CS2A 1EC9A 2PGFA 3W1XA 3ZQ9A 2ZCGA 1E6NA 3K2GA 3M0XA 4P7LA 2E7FA 4LSBA 3WNOA 3W1LA 4AHQA 5D2WA 4ZR8A 1W91A 4NZ5A 2Y8UA 3GG8A 5LZLA 2O55A 3NZRA 2FZ9A 1XV8A 4QE5A 1ZPTA 4YLWA 2DW7A 4MSSA 2GJPA 2PWHA 3AJXA 5CJNA 4FOUA 1YTEA 1LORA 3PUEA 3ZVHB 4PMYA 1UR2A 5ENLA 3G0UA 3BMWA 2ISSA 5LGXA 2ZXAA 3WNPA 3UWVA 1RA0A 1EGMA 3L9CA 4JTEA 3Q2DA 1AMYA 3NL3A 1AUSL 4UZSA 4WJ8A 4R88A 3CMGA 1PE1A 3NURA 4Q22A 1HJSA 2O4MA 3DKLA 5A3HA 3H2FA 2WB5A 5LA1A 1J9YA 4J2PA 4NNBA 1XQKA 3EOLA 4D1JA 3QQWA 2Y8VA 1Z44A 5IDZA 4MB5A 1QHZA 4FIRA 1BXNA 1G67A 3BQ5A 4GQRA 1GOMA 3UVIA 3V1PA 1Y65A 3B0XA 4GI6A 2FMOA 4XZNX 3NDZA 4BKNA 3WF4A 2YKKA 4IT1A 1I6NA 1NVMA 3TA9A 2WMFA 1QNRA 4Z08A 1M41A 3DH7A 4O18A 4XZBA 1HKIA 4DIAA 2CITA 2E5DA 2PBGA 4DNMA 4D6GA 1OFDA 3TN4A 1ZS2A 3WELA 4LVAA 2G3FA 2GGHA 4S3CA 4BJHA 2BGQA 2OEKA 1TA3B 4YL2A 4ZO7A 1PUDA 4K38A 4GHRA 2Y24A 3GG7A 3S46A 1S38A 3CAWA 4RV3A 3LBMA 1EP1A 2CZEA 1TA3A 3W1TA 3U7BA 4WKFA 1FCQA 1XH2A 3THQA 3LZ5A 2F6XA 4ZB0A 3M41A 1QBAA 5C9WA 4DBUA 3DFTA 5A1AA 3KRBA 1GG0A 3KCJA 1BXCA 4DZAA 2I7GA 2Y63A 4ZCWA 1LYXA 3QPEA 3M44A 3BG5A 4O1DA 1B2YA 3NUKA 3G5EA 4RE4A 4TXEA 3PR2A 3GTHA 1SO4A 1E9ZB 1Z7AA 5LHEA 4L61A 4HSNA 1W1B1 4XVDA 3QHNA 5F2IA 1KTCA 3F4VA 1L6WA 1SFTA 3OQ8A 3PTMA 4MAZA 3ARVA 2C19A 4UR9A 2YR1A 1ZAHA 1XRSA 5C9XA 3VA8A 1H7NA 3LDVA 4S3KA 3FA5A 1W31A 4LW7A 1PIGA 4DI8A 1QK2A 5CSYA 3W1MA 3NCOA 5KETA 1KFJA 3WLIA 4LYKA 3TW7A 3R0KA 4A3QA 3DHFA 1PX8A 3HMCA 4NX5A 2ZADA 1DQUA 3CNYA 1IEWA 3LENA 1Q5MA 3PTQA 4J1OA 1KTBA 3LPGA 2GJXA 3QPZA 2FZBA 4RLIA 4QISA 3ERPA 2OCZA 3BH4A 3T0TA 4PL1A 1V7AA 3FAXA 4CU8A 1W1VA 2Z1BA 1F8MA 2QPSA 4R7OA 3IK4A 3GXPA 1OWQA 1BXBA 4J3WA 4RZ5A 2PP3A 3E0FA 4LGXA 4PUJA 2YOCA 3N2TA 3KW3A 4ZSTA 1XCXA 1MW2A 2A85A 3W2MA 3ATZA 1VGAA 2O7SA 4CQBA 2HDJA 3BCFA 2OSYA 2O9RA 3GC4A 4JTHA 5A8MA 3VIHA 1XLBA 4AD4A 3ITCA 1EDTA 2X1UA 3AXXA 3VPLA 3WBYA 1OABA 2D69A 4R34A 1XSJA 1HKMA 4C6DA 4Y7EA 3HPXA 3ES7A 3GH7A 3CHFA 2V5JA 1IXQA 1XBZA 2IPFA 2GVEA 1M5WA 1O12A 5FOOA 4UTKA 3C0SA 3R8GA 4C6FA 4O0KA 4IFKA 3RPTA 4CCDA 3ITOA 3CL7A 3GKFA 4G7EB 1TJ0A 4LX4A 1JCNA 1BYCA 1Z8AA 2J9ZA 2VFHA 3NGFA 1YQ2A 3BC9A 3U2CA 5A2BA 1AW5A 1KBBA 3KBVA 3ZS4A 4XO7A 2BY1A 4OHQA 3L2MA 1ONWA 3BLDA 1WO2A 1X1ZA 3U5UA 1I4NA 1J0HA 4XZ9A 4O0ZA 1TQJA 1EA0A 3U4AA 3GTIA 3BICA 1UA3A 2QJHA 4L4PA 4KGLA 2D3NA 3IIPA 1XRTA 3NAVA 3UWUA 1SQ7A 3OA5A 1BYDA 3GR8A 4M1RA 3RITA 3WH6A 2PE4A 3ZR4A 3ZMRA 2J7DA 1JZ5A 5HWNA 1R2SA 2BX7A 3QR3A 4AQLA 4LB3A 2JEQA 3W7RA 2RUSA 3TC6A 2R14A 2EEXA 3T05A 4JKMA 4GVFA 3B3DA 3EBVA 4GQ0A 3PVFA 1WUEA 5D9MA 4Z0JA 3N25A 4GZEA 1KXHA 5CC6A 1TR9A 2I56A 5FL1A 1EO5A 1JUBA 3LRMA 3O9NA 5BMXA 3OEXA 4NZ3A 2PTZA 5BWFA 3W24A 4DYJA 2QDHA 3RRAA 3NVTA 1MMFA 4GFSA 2EJ1A 3EMZA 1RD5A 4L80A 2WMKA 1RK5A 4JYDA 2TMDA 5AVHA 4DM2A 4ROPA 3NWRA 4QG8A 4LJ3A 2QT3A 1JPDX 4N6FA 3AYRA 2UY5A 3STPA 4WGHA 4LT9A 2PDUA 1C8QA 3GR7A 5LXXA 4EXAA 4M7SA 2QJJA 4AXKA 3W7PA 4R7WA 1G94A 2ZZ5A 1JDAA 3ES8A 4JD4A 4QTGA 1U5HA 2CBVA 4BQ3A 3A12A 2HV5A 1GOIA 3FDKA 4M29A 4C6LA 3PC0A 4M82A 1TVLA 2P1FA 1H11A 1EJRC 1N55A 4JTUA 4FEZA 3UFYA 5H6HA 4UQDA 5ABTA 4UFIA 2HPIA 3SY5A 1L6SA 2V5CA 1KRCC 4B3LA 4QM1A 1JL8A 4LYQA 1Z3NA 3C0QA 1AVAA 4HYRA 1K9DA 1K4GA 4C6PA 2PDQA 4ATWA 1TWSA 4EANA 3AC0A 4QQUA 3QHOA 2DW6A 3MHUA 3PBWA 2YZRA 1FWSA 3DERA 3VE9A 4KQNA 3V16A 1SZRA 3T0AA 1XLGA 2D23A 1LLWA 4WF7A 3BO9A 1W3IA 1TUXA 3FSTA 4MJ2A 2PS2A 1V6XA 3JVAA 3BV7A 1UKSA 3EPNA 5I09A 4BI5A 3E9AA 1XBYA 3N2BA 3UZZA 2E6DA 1TWWA 4PMUA 2VGBA 1H1YA 3KZSA 3R7MA 3TH6A 2G4FA 2I1OA 1WXYA 3EZ4A 1QWGA 1TMHA 3CASA 3C56A 3GIQA 1MEIA 4BF9A 2IKGA 4ZQPA 3E0VA 1GOKA 3O16A 1MZHA 4MB3A 2P3ZA 2XVLA 3MSDA 1W1TA 3ITXA 4QXIA 2CZ5A 4AWSA 1SPQA 7A3HA 1EXBA 4AIUA 1OZQA 4KRUA 3INPA 4AZGA 1V0LA 4ACYA 3S1WA 1E55A 1PS9A 3UJSA 1I2NA 1PYFA 5L9FA 4I5XA 5FSEC 3AYTA 1E70M 1VFTA 2YCKX 4QE4A 2OOFA 2YDAA 4IJBA 3I7RA 2GOKA 3BAXA 1XIHA 3F7JA 1LT7A 1DJYA 3M4HA 4UXDA 1MUMA 1YHTA 1BVNP 1ZQ5A 2A7NA 4XTIA 3COTA 4N4PA 1WKEA 1B3OA 4GO9A 2WJDA 3OVQA 5AC7A 1RQHA 3KS5A 3BK0A 3IUIA 1LDCA 1P1XA 2NZLA 3RLUA 4J4KA 4GXWA 3L68A 3U7VA 4J2MA 2Z1WA 1TTPA 5JU6A 1SJAA 4MNMA 1F3TA 4UTWC 4P8VA 2VNCA 2NX3A 1EJSC 1TMQA 1HVQA 3SSZA 2PDHA 1U2YA 3WO8A 5A6MA 1QR7A 1OYCA 4GUHA 1IYXA 2Q3RA 1HKJA 4GIRA 3MCNA 1QASA 1W5PA 3DFOA 1G1YA 1VJIA 1WYIA 4JQAA 3G1DA 4LVFA 3EX2A 1Y0EA 5FF4A 3VOFA 3EOOA 2HCVA 3IUDA 4GCXA 4PTMA 2DZWA 5FA5A 1LBFA 3DENA 2ZZ2A 1LRTA 3NO1A 4O50A 2V5BA 3SFKA 1J0JA 3MUCA 3V75A 1PCWA 1EO7A 2XN1A 2Y8KA 2WBKA 1U83A 3M0HA 2P10A 2DIEA 3WFLA 3WDQA 3RLVA 3UXDA 4NUWA 2AAAA 5K4ZA 3BSGA 4L4OA 1LL6A 2FPVA 2PLCA 3JZEA 3QXBA 1H09A 4NL1A 4MUZA 4CNSA 1ADSA 1JPIA 1A3HA 4HD5A 3L21A 4CD8A 4GUGA 3AIWA 2OKTA 2Q71A 4ROQA 4HOWA 4AG0A 3LHUA 4QNWA 5H8MA 3P93A 3WQOA 1ITQA 4PMVA 3CTTA 1F73A 2PZ0A 3MKCA 3AI0A 1B3ZA 1XL9A 3FXGA 3M5ZA 4HIBA 3HGRA 2A5HA 2C1HA 3RN6A 3NSMA 3BSHA 4JTDA 4WX2A 1XG3A 4GUIA 4Q7BA 1XDJA 1EDGA 3CZLA 4B5TA 4L7ZA 4E3VA 3R79A 1JDDA 3BSMA 1XIEA 3H2EA 3AIUA 1KCXA 3T8LA 2F6KA 2BV9A 3EX4A 3KLLA 1EPXA 3CB8A 4B3KA 4O4VA 3BL3A 4QJ4B 1NJJA 4JIQA 1UC5A 1ECQA 1GCYA 5FF2A 1ZJBA 2VQUA 1R46A 1EP2A 1JQVA 4QRNA 1YPIA 4PMQA 2XWEA 1OD8A 1MUCA 2ZTKA 4H9YA 3CH9A 1UA7A 1XR2A 5HULA 1W3KA 2I5QA 3QGAC 4OFCA 4UTLA 4LS1A 4TMBA 5M1TA 4GJIA 4YN5A 2WLZA 4XVEA 4RCXA 1VQTA 4C6IA 3S5SA 4W9TA 2PDPA 3UG3A 2QCNA 3RM8A 1TE6A 3NFUA 2AQWA 4JTRA 4XD6A 4HCHA 1JZ8A 4PCTA 3LHZA 1JZ6A 1HKWA 5DMLA 1OC5A 2D1ZA 1X7IA 4RUBA 4PTWA 4IGMA 4DHGA 1QHPA 3NQCA 1HJVA 3GW3A 3VIGA 1QNPA 5FJRA 1LZOA 4Q8VA 3JZUA 4W8LA 1B3YA 1FWTA 1SFSA 1H0IA 2O9TA 3HGSA 4YVXA 4JFWA 1W8SA 2QDGA 3TN3A 3WQVA 1VJZA 3GH5A 2CPUA 5CZJA 2VUNA 2G5WA 1EQCA 4MUPA 1RALA 2A79A 5AHMA 1QI2A 1UZ1A 2J24A 3NZPA 1VD6A 4EACA 1K9TA 2ALDA 1P43A 2BHUA 1Q66A 4DNHA 3MP4A 4J3TA 1EBGA 5CBIA 4JIPA 4C6QA 1JCLA 1IIGA 4GA8A 3ZOAA 1W9PA 1W3JA 5CQ1A 3UEQA 4FR6A 4O4WA 3TOPA 1MO0A 1Q6FA 3B8WA 1EKOA 2E40A 2FZDA 2ALRA 4UNKA 3ORWA 4G7FA 2DDXA 2XG9A 1V51A 5EFDA 1O5KA 2YYTA 3M9YA 3PZMA 2XIMA 1AD4A 3PJWA 3SUVA 3S1VA 5FEPA 3W84A 3IJDA 3IIXA 3O3RA 5CG0A 3RJXA 1PDYA 4L56A 4YPJA 2B0MA 2PDWA 4MADA 2DORA