5KMYA

Crystal structure of tryptophan synthase subunit alpha from legionella pneumophila str. paris
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
269
structure length
262
Chain Sequence
AMNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDPMAEGPVIQRAMERALAHSIHCDDVLNMVRQFRKTDTETPVILMGYLNPIEQYGYDLFAQQAVEAGADGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNFINQHANGYLYYVSLALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGAALINEIIEAYEAKKDPLQASGALLSSMRQAIDNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
publication title Crystal structure of tryptophan synthase subunit alpha from Legionella pneumophila str. Paris
rcsb
source organism Legionella pneumophila (strain paris)
total genus 83
structure length 262
sequence length 269
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5kmyA00
2WV8A 4O19A 2CFFA 3QQ1A 1THFD 3N19B 5D2WA 2ZA2A 4N6EA 1KW1A 3NQDA 3RU6A 4A2RA 1GVOA 4ADSA 1MEWA 6TIMA 1QR7A 3P5YA 3PBWA 4Y90A 5BMWA 1NEYA 2V8ZA 3QFEA 4NXSA 1GOXA 2YW3A 4OE7A 1H7RA 4FNPA 3Q94A 1S3HA 1SZGA 3FLUA 4DBEA 1SZEA 1MXSA 5ABTA 3NOEA 4BFAA 2VEIA 4N9BA 4HHPA 2WSQA 3NEVA 3NL6A 2QCEA 1O60A 3GDRA 3IIXA 3LRLA 4GUGA 4RXFA 2PC4A 2CLOA 4WX2A 1V5XA 1IXNA 2QCNA 2O7SA 1K7XA 1KFJA 2FPVA 4C1LA 5LKYA 2ATMA 4UMBA 2B4GA 1K8ZA 3Q2DA 1XCFA 1EEPA 1LCOA 5F4XA 4ZQOA 3NL2A 1H61A 1W3TA 4PL1A 3W83A 1VS1A 1LDCA 3RLUA 4UTKA 2HS6A 3PF3A 1TV5A 2NX3A 1L9WA 4G1KA 4EVZA 1EP3A 4DEFA 1OX4A 3KX6A 3S1XA 2CWNA 4DO5A 3QMSA 4Q32A 2R14A 1YDNA 3W1NA 5E1QA 3TQVA 3P82A 5D04C 2CZFA 1RR2A 4KKXA 3GIYA 3NQAA 3M47A 3LOTA 1F6PA 2YZRA 2Z6JA 4FXRA 4JTTA 5U7SA 3KOFA 1VLIA 1KBJA 4BWLC 4CCEA 4CNNA 4JR5A 4P2VA 3M44A 5C6MA 1FWSA 1YADA 3PC0A 1AMKA 3QSTA 1D3GA 1YDVA 4M6VA 1JJKA 3UZ5A 3LCLA 3W7JA 4ZL1A 1JCXA 3L5LA 3HO8A 3L9CA 3CIXA 5I3IA 4XBSA 1J4EA 2QDGA 3C56A 4XWUA 3TAKA 5D02A 3DFSA 1LM1A 3FKKA 2Z2UA 5FESA 5FEXA 4LW7A 2ZRVA 2ALDA 3G0UA 3TSMA 1R2SA 3NPWA 3G1DA 3EEGA 4ZQRA 3F1QA 3EWBX 4UNLA 5AN7A 3UWWA 1Z48A 4RK8A 1X6UA 3W1MA 3MP3A 3S8HA 3TAOA 3QC3A 1SR9A 1GVSA 1UBSA 1F6KA 1H7XA 5EPDA 4N4QA 1FWWA 3C61A 2C15A 4O14A 1WV2A 4N02A 4YXGA 1TTPA 3THAA 1FY6A 1H51A 3DXIA 1B4KA 4NJGA 1DOSA 5D37A 5EYWA 3TV8A 1W1ZA 3LBCA 3LRMA 1OX4B 5IM51 1JRCA 4ADTA 2DZSA 4LNYA 2RDTA 2V5BA 5KITA 4MIMA 2Q3OA 4HSOA 1SU5A 1GVRA 4LV4A 3G0XA 1JRBA 2B0MA 4NT0A 4XZ9A 1IF2A 5H91A 2A7RA 4PL2A 3DBPA 3N2MA 1XDLA 1H50A 3LLFA 3DAQA 2QCGA 4EF8A 1ME7A 3NQFA 4KWWA 4CLMA 3O16A 3SSJA 2R91A 1DV7A 1W5NA 1M6JA 3WJWA 2VC6A 4R33A 2ZBTA 4ORMA 5FEWA 4TR9A 3T40A 5AOUA 4FX7A 1FCVA 4NQ1A 1VZWA 3IGSA 2GOUA 2NZLA 2PRMA 2A7PA 1OFPA 5LNSA 2J88A 1KBIA 3L66A 1O5KA 4O1BA 5LGZA 2H6RA 4IMGA 1H7PA 1TRDA 4ZQMA 3M5VA 1CW2A 2WKJA 3C2VA 4TMCA 5F2LA 2X2GA 3EX1A 2AQWA 1JCJA 4AAJA 2G95A 4TO8A 1L6YA 4NUWA 3SR7A 1GWJA 1H7OA 5C2XA 3TJLA 4O1DA 4DXVA 2Y89A 4UXDA 3W1TA 1DVJA 3C2FA 3PULA 2Q8LA 2E5CA 3V75A 1LOSA 3HF3A 1KM4A 3W1XA 3Q58A 2RDWA 2E6AA 1KTBA 1LBMA 1MSSA 2J9ZA 2C13A 1GQNA 3U6WA 1X8FA 3SY5A 2V9DA 4MZYA 1GG1A 4UFMA 3CT7A 4HNNA 4JEQA 3PG8A 1TREA 2VFFA 4ZQNA 1FX6A 5I3GA 2V30A 3ANYA 1KLZA 4GUHA 3HPXA 1EX5A 3HGRA 3L0NA 1W5PA 4M19A 4L4MA 3W6YA 3PUEA 2QJIA 3NQMA 3W84A 4Z1DA 2YYTA 1JCLA 4JYEA 1JCMP 4Y9AA 3SI9A 3HGSA 3UZJA 4MFDA 4UTTA 5FF0A 2E6YA 3KRZA 3HG5A 1ZFJA 3NL5A 3M43A 3W7QA 3BARA 5AHEA 3W7KA 4K36A 1PV8A 4JX4A 1TSIA 3S5YA 2CLLA 5TIMA 2VEPA 1LBLA 5AC8A 4X3ZA 3EWXA 1D3HA 1ALDA 1SW7A 1K8XA 1QOQA 3S5NA 1PCKA 1LZOA 3FEMA 2P0OA 2E09A 1RZMA 3HPSA 1KFKA 1SO6A 2ZZ7A 2NX1A 4O54A 5KZEA 3VNDA 1TO3A 2NV1A 1NVMA 4PODA 2X30A 1O95A 1OABA 3LTSA 4NZFA 5DCEA 1I45A 3BVJA 4R53A 1YLVA 3DENA 3MHFA 4X22A 4ZVJA 4ADUA 4C1KA 4JX5A 4MPQA 5KZMA 1P0KA 3NQ8A 3MI3A 5DCBA 4OQVA 1H63A 2UV8G 3ABQA 5BW6A 3O63A 2ZZ3A 5HR7A 3EXRA 3BW2A 3NQCA 1JQXA 2TPSA 3OEXA 1F73A 3ATZA 3IRDA 1SFJA 5G2WA 4Y6GA 3D0CA 1TQXA 2B7NA 3L67A 3BPWA 1B3OA 2NLIA 1Q6RA 1B4EA 4ICNA 3S1WA 1EA0A 4DO6A 1R2TA 4JXCA 2G5WA 4B5NA 4O0ZA 1X1ZA 1GPWA 5FF4A 3MP5A 1SFLA 1TPC1 2FFCA 1UUOA 3W7OA 2Q8ZA 2VFDA 1HO1A 5HWMA 2C16A 2DZPA 3M5ZA 4HPJA 1IGSA 2QF7A 1AW5A 3TSBA 4X2RA 1WBJA 2BZNA 5DCDA 1H1ZA 3WFAA 4HT3A 1VJIA 1QFEA 1EP1A 2E5DA 1Z42A 4R34A 5T26A 4I9AA 3VE9A 2ZZ4A 3ZS4A 4UIOA 4QITA 4ML9A 3A23A 1KM3A 1WA3A 3SZ8A 4IXHA 1VGAA 3MW7A 3EWZA 4HIBA 4NNAA 1FDZA 4MFEA 2WO5A 1OHLA 3M41A 2H90A 1XBXA 1X7FA 4DPPA 1F74A 2V2DA 1YPIA 3L0GA 2VOMA 3I68A 1XL9A 3KRUA 3QQ0A 4LC6A 3WJXA 1TPWA 3I6RA 1UCWA 1JUEA 3CQ0A 3JS3A 3BGJA 1LLWA 5F1VA 4Q4KA 5G2HA 4O57A 4W9TA 3GNNA 3O05A 4LV9A 4QNWA 4O1CA 2EHHA 1LORA 1ML1A 5LNVA 4QM1A 3BLEA 4HNTA 2J27A 4H4IA 4JTKA 1N55A 3C3NA 5AHFA 4ZMGA 3LM7A 3MP4A 3W1AA 1KV5A 1XBYA 5K3VA 1LOLA 1FDYA 2GQ9A 4GUFA 1L6SA 2ISWA 4OV9A 4CCDA 4JY8A 3TX9A 5DXYA 2E68A 4UTMA 3UXAA 4TMBA 4LT9A 1U5JA 1WX0A 4MJZA 4UTHA 5F2MA 1VYSX 2A85A 3KVLA 1VCVA 2A5HA 1ZHAA 4IUOA 2CLKA 1AW2A 3UY7A 5TBOA 3IGUA 3LDVA 4PCFA 3TROA 1XXXA 4CNPA 4JTGA 4JYFA 4K38A 3TE9A 1QPNA 2Y7GA 1R30A 3C52A 3YPIA 3LX9A 4I7UA 2Z0IA 3OG3A 1VRDA 2WSRA 2XN0A 3E49A 5LNWA 1IXPA 2Y7EA 4KWVA 2I14A 3UYCA 3BLIA 4BI5A 3TJXA 5DY2A 1HUVA 2JKAA 3DFTA 1NF7A 3G1SA 3G1HA 3UPBA 3JR2A 1SZNA 2R8WA 1OFBA 4JTJA 3FJLA 3O6YX 1M5WA 2W6RA 2EAWA 2E77A 3PBVA 3UPWA 3O15A 2RHGA 3NVTA 2GQAA 1OK4A 2QCHA 2FPYA 4QSHA 1HG3A 4CQ9A 3P80A 3LHTA 3QMTA 4FNUA 1FCBA 4NZJA 1XC4A 3FA5A 3IGXA 2C18A 5CZSA 5IBXA 4CNOA 4JTSA 1A50A 4RZ6A 3W1QA 5AHMA 4WOZA 1QWGA 2Y63A 4JTFA 2QUTA 2ZTJA 3HB9A 1OVDA 3M5XA 1PCWA 3F03K 4AMAA 4UFLA 3ATYA 2Y88A 3EWUA 1YXYA 4A29A 5EL1A 3DHDA 4LTSA 5CPNA 3TCEA 1XUUA 1Y0EA 3I7SA 1F5ZA 2YCEA 2Q3RA 1R47A 3PSVA 2C6QA 4PH6A 1UJPA 4N4PA 3G0SA 3LXCA 4IPIA 1BKSA 1QNVA 1OFAA 3PG9A 4RKAA 2VXNA 3LV6A 3RF9A 3P8JA 4JICA 3PVFA 2Y70A 4ZQCA 4JX6A 2JKPA 4N9CA 4A21A 2FIQA 3V1PA 1W3NA 4JGDA 2CU0A 4K7YA 1N8FA 5BRBA 3NG3A 2VFHA 4CQAA 4PA8A 1G4SA 1MO0A 1GG0A 2CZ5A 3W7PA 4K37A 3N73A 2DP3A 1GJPA 2A6LA 4AXKA 3STCA 2QEZA 1RV8A 3LCFA 2ZYFA 3EX3A 3LTPA 3Q37A 4UTIA 2ZZ1A 3NGJA 3GYEA 1TMHA 4NNCA 5HWJA 4LS1A 3OBKA 3HQ1A 4XTDA 2ZRXA 2DZWA 5FI8A 2HTMA 1QO2A 4MUZA 4IXXA 4XQ6A 4MZ1A 2VENA 3NQVA 1PL9A 3EX6A 4QQ3A 1AK5A 5BMXA 1A5CA 1S5VA 1OYAA 2Y7FA 3SJ3A 3JRKA 5U4NA 3IIVA 3LCHA 1GZGA 4AEOA 4A2SA 4H3DA 1DORA 3STEA 2EPHA 2ABAA 2PCQA 3CB8A 3TR2A 3VFLA 2OT1A 3BO9A 3UY8A 3R2GA 3HMJG 4NX5A 3TNOA 1JQVA 4OGZA 1LOQA 4LOCA 1ICPA 3L5AA 5DN1A 3ZWTA 1T99A 4E0CA 3TFCA 4QIUA 3NO5A 3W7IA 1G67A 3TU9A 5G5IA 4GFSA 4LUIA 3MUXA 3P74A 3H55A 3IVSA 3MI2A 2ZZ2A 2V81A 2YX0A 2C1HA 1SZFA 1SW0A 2V2HA 1SUXA 3TC6A 4MY9A 3B05A 4GUJA 1KFCA 2X16A 4JDYA 4O53A 1PHWA 4S1FA 4NXKA 3FIGA 4IMEA 2BX7A 4DF1A 4BR1A 2OMAA 2WPBA 2E5BA 3W1RA 3PWAA 3LLDA 4GJ1A 2GPTA 3AO0A 4AHQA 4JN6A 5CPOA 3CC1A 3C4UA 3QM3A 3GDLA 3T78A 1SSGA 4OBTA 1C8VA 2CLIA 3S0CA 4IX0A 5D2VA 3TK7A 3W07A 3N9RA 1QPOA 1U83A 2B7OA 3KFTA 3LHVA 1W54A 5TQLA 4DF0A 4RV8A 2I1OA 3CPRA 1DJQA 2C0AA 1WBHA 5DBUA 3G18A 1C9DA 5CZ0A 1O94A 4A3UA 1KFLA 3RLVA 1WOBA 2NWRA 4XTIA 5I3JA 4GC4A 1P5BA 4JIQA 3W1LA 1GYNA 4O12A 1VQTA 2V0TA 1KM5A 1QOPA 8TIMA 4QISA 4AHOA 1DJNA 1WAUA 4FX8A 3VKJA 4UTLA 1GTEA 1TTQA 4EIVA 4BI6A 3DFOA 3AJXA 4Z1BA 4HKPA 2V82A 4UTWC 3E0IA 4AWTA 3INPA 3DGRA 3NXFA 1JUKA 1M7PA 3GXTA 3G3MA 3LTYA 1AL7A 3ELFA 3NM1A 4POCA 1KM6A 4HSNA 1VYPX 5G1TA 1EPXA 3LRKA 1EUAA 4GUIA 1KV8A 1XFBA 3MI6A 1HFBA 4KFPA 4MLJA 3GNDA 5CSSA 4OHQA 3GAYA 3TQKA 2OJPA 3QEZA 1SW3A 4DF2A 3S5ZA 3TA6A 3O8AA 3G1AA 1K7FA 1XUZA 3SECA 1XBZA 3BW4A 5D03A 3LCWA 5SWUA 2DJLA 1Z44A 3W2UA 3L0KA 3TKFA 1Q6OA 1QDSA 1H60A 3LHYA 4MLRA 4MOZA 2ZRUA 3B8DA 5G1YA 3W1PA 5KSWA 1OX5A 4P61A 4O8RA 3RNDA 3G8RA 4UUIA 4YCPA 3GXPA 5LGXA 4QNEA 2CZDA 1QPQA 3O06A 1LLZA 3HG4A 2FJKA 3ZFHA 2WQPA 3WJSA 3WK3A 1AW1A 2TYSA 3BK0A 4WQ6A 4KFNA 1VHNA 4QJ1A 2A1YA 2Y62A 3GVGA 3SW6A 4WUIA 5AC7A 5LNUA 3W22A 3W88A 5LNRA 2ABBA 1J2WA 4IWWA 4LVDA 5AHNA 3NYZA 2ZRWA 5KMYA 1PVNA 2VEKA 4O18A 5HQEA 2Z1BA 3DKLA 2PE4A 3T55A 1OJXA 4JYDA 2AAMA 2CLMA 3GZ3A 2GJLA 4LY8A 3P67A 1GTHA 6ALDA 1MZHA 1BEUA 2VFEA 2BTMA 1QAPA 3FFSA 2Y61A 4E2DA 1O5XA 3DFPA 2I9EA 4M7TA 4HN4A 2QUUA 1OF6A 4KFOA 2A7NA 3P8IA 1SO4A 5AYXA 1KFBA 3F4WA 3KAOA 1Q6LA 5CPLA 1TPVA 3TQ0A 4IX2A 2RFGA 2EGZA 2QCFA 3TSDA 3DI1A 2HSAA 3M7WA 1XBVA 2PURA 3G22A 4TX9A 1TPDA 2G97A 4Z1AA 3NPVA 4HNUA 1H62A 5L6UA 1G69A 3PAJA 3U8GA 5DLCA 2XN2A 2YDAA 4JD4A 3HIJA 2HMCA 3TUUA 2VFIA 3HBLA 4EOUA 3NQ7A 5D2XA 4M5PA 4AF0A 3F4NA 3IVTA 4YL2A 2HS8A 4A22A 1ME9A 3ABSA 1HTIA 1OFOA 1B57A 1DL3A 3KVMA 1F05A 2A21A 2PRHA 3C8FA 2BLEA 4O50A 3NQ2A 2QCLA 5D09A 4K8HA 3MBFA 3T7VA 1FWNA 4YMZA 1XDMA 3IV3A 2NUXA 3R5EA 3N2XA 3MMTA 3DI0A 4MY1A 4LC8A 2GQ8A 3W70A 3LV5A 1DHPA 3W7GA 3L5MA 4JY9A 3USBA 5K7JA 3E96A 1GVQA 4IMCA 2QDHA 4U28A 4RR4A 3QZEA 2QJHA 4WY0B 3QW4B 3S6DA 1PE1A 4JTEA 1ZAHA 4YLWA 2X1UA 2ZCGA 4JS3A 3W2KA 3A5VA 1KFEA 1S5TA 3SGUA 1LTDA 5H2ZA 3OIXA 3W2JA 1JR1A 3MYOA 4ZZ9A 1OG0A 3W7CA 3NQ6A 3A9IA 3C0JA 3FYOA 3S5OA 3LCXA 3T4CA 2E6DA 3MHUA 3SIZA 1G7VA 4TIMA 3NZRA 4RCXA 2OZ0A 4BWLA 3W3OA 4RJEA 1EWEA 4JIPA 4LUJA 4UMAA 3FKRA 3LXAA 3GKFA 1S5WA 3QRHA 5F4WA 4UC5A 2TSYA 4NVTA 3O6DA 4XUGA 1P4CA 2WSYA 4UFKA 3VE7A 4AF0B 5GVJA 4EF9A 3DFQA 4M6PA 1E51A 1SQ7A 1NFBA 2NX9A 3S42A 3W2MA 2WJZA 3BGGA 1Z41A 1WOAA 1EP2A 1OFDA 1RQEA 1UUMA 2DZUA 3N3MA 1VHCA 1TRIA 2WNQA 4CQ8A 3P7YA 3WK0A 2GVJA 2NXHA 2P1FA 3EWWA 2CZEA 1Q45A 1FQ0A 5AYZA 2QAPA 4WD0A 2ZZ5A 3HOJA 3KVKA 3TW6A 2VFGA 4MVAA 2ATSA 2QCDB 1LRNA 2X1TA 1ME8A 1FCUA 4Z08A 3W73A 5C54A 4GWEA 5HWNA 1WDWA 1N7KA 2YYUA 4I7WA 3W7LA 1NF0A 5KTLA 3O6CA 2VELA 2OX1A 3TMLA 5CZJA 1W37A 4GNJA 4AVFA 3G1VA 5FEPA 3EX2A 3EXSA 2YFNA 3UQNA 2F84A 1ICQA 2RKXA 4OU1A 4O52A 3IIPA 4IGHA 4O4WA 4XKYB 1K7EA 1DQWA 4UTJA 3QW3A 1G4PA 1L6WA 5K9XA 1MEIA 2VKZG 4UTTC 2JBMA 3P60A 1RD5A 3BG5A 1FWTA 1IXOA 2EF9A 3PY2A 4K7VA 1WYIA 3MHGA 4NU7A 5F1UA 3W1UA 1JCNA 3UWQA 1OF8A 5BNKA 3W85A 3GDMA 3RFAA 1OFQA 1F76A 4FNRA 3TXVA 4O17A 5LHEA 2Y6ZA 4IOTA 2NXIA 1RPXA 4OV4A 4FB7A 5D30A 3VI2A 4MZ8A 4FXSA 1RQHA 1F2JA 1TQJA 4Z0JA 5AHIA 3GR7A 4WXYA 2Y85A 2JKEA 4LU0A 1YXDA 2V5LA 4WOQA 5E0KA 5HULA 2P10A 3QPZA 2H8ZA 3FJ6A 2YPIA 3TDFA 1EWDA 1W0MA 3DKJA 3N34A 1TJRA 5F2GA 4FIRA 5LZLA 2YFOA 2ZRYA 1SSDA 3EB2A 4AB4A 1KLYA 1OFRA 3ZWSA 3E02A 4O15A 3W75A 4O16A 3H54A 1D9EA 1FXQA 3PB0A 2E6FA 2ZA1A 1XM3A 5CSRA 2H3BA 1TPUA 2YSWA 2C19A 3W23A 4JDBA 3N14A 3RMJA 4Z1CA 5I3FA 5I3HA 2F7FA 2BXVA 4AWUA 4ORIA 3WJZA 3R12A 1G7UA 3CWOX 4XBKA 4DBDA 3KVJA 3W72A 2CLEA 3BG9A 3N9SA 3PBYA 2EKCA 1K8YA 5FF7A 1IXQA 1ZALA 2XFWA 3UXDA 4ZQPA 2WNNA 3C2RA 5D05A 4O11A 3P5ZA 3W7NA 4IJBA 5F2IA 3UD6A 4MYXA 1TJPA 3PS7A 1I2RA 3L2IA 5CKSA 4Y8FA 3W7MA 2QCCA 1UB3A 5K4XA 1TPB1 1P0NA 3IVUA 4I7VA 3L68A 3M1ZA 5HJLA 3GKAA 3GDKA 2A6NA 1VYRA 5G4WA 3NDOA 5D2YA 1W5OA 1AG1O 2DZXA 4MJMA 5LHFA 4FX6M 4IQLA 4M7SA 1I2QA 1DBTA 4LVFA 2WNZA 1ZNNA 4LVGA 3CEPA 3PBUA 4RZ5A 1TV7A 1WXJA 4FF7A 2NUWA 1I2PA 3P81A 3U2OA 5G2IA 2BSLA 1VCGA 4YWIA 1QO5A 3LI1A 2V2CA 1HL2A 1OFEA 5KZDA 1OX6A 3SGZA 3C2OA 3E9AA 3MJYA 3WK1A 2JK2A 3DHFA 1LROA 3GXNA 4NJHA 3W71A 3OVPA 4GE8A 2YR1A 3O07A 5A8GA 2QCMA 4Q33A 3S9YA 3P61A 4PEKA 1TTIA 4FEZA 3NR0A 3LCIA 1QPRA 1P1XA 3EXTA 1Q6QA 4UR7A 1KM1A 5KINA 2QUVA 4N6FA 2JGQA 2KZHA 3B0VC 3I65A 1V7YA 3MO7A 1G4EA 2A4AA 3W9ZA 3TMQA 2C3ZA 4JTIA 1FXPA 3R8RA 3DZ1A 2O7QA 5G4EA 5CPMA 2R94A 4UFJA 3I7RA 1TYGA 1X1OA 1I2OA 1I8JA 3LXBA 2ZDRA 3PUDA 2J24A 1H7WA 1YTDA 3NPUA 5EA9A 1R2RA 4E2BA 2NWSA 3TIMA 1OYCA 4GXMA 5EY5A 5BOOA 1IIHA 5K2ZA 1QCWA 1ZAIA 1DQXA 4O13A 3DH7A 3HG2A 3TXZA 1KA9F 2FPTA 2ZQ0A 1SO5A 5K9DA 3M16A 1LBFA 2BWGA 4LWWA 2W0UA 1ZJIA 4NX0A 4CCCA 5D2TA 2D73A 4Z0SA 3A22A 5HNRA 4K8EA 4R7JA 3FYPA 5EMUA 5DBTA 3M0ZA 3B0PA 1H1YA 3UWYA 1PS9A 5FEZA 3NA8A 3TC7A 3W7HA 1W31A 3QH2A 2QJGA 2W79A 3W7EA 3NAVA 4DELA 5I3KA 1NAL1 5HUPA 5FF2A 2ISVA 3OVQA 3M6YA 1LRQA 1EIXA 4HNVA 1GT8A 4WXZA 3LB0A 1A53A 2YXGA 1YTEA 3EKLA 1Q3NA 3OHIA 2JGYA 2X1RA 1RQBA 3QMRA 5D38A 3CU2A 1XI3A 1YDOA 3E12A 1KM0A 3LGEA 1NSJA 5A5WA 5IBXC 2G96A 4UNKA 1W3IA 4NJJA 2H8XA 3DFNA 3MBDA 3IIOA 5HUOA 3WK2A 4QAIA 3CHVA 1UASA 2FQIA 3GAKA 1R46A 4LS2A 4J9JA 3W7DA 3W87A 3TH6A 3UWZA 5C5YA 4ONVA 1J5TA 1BWLA 5F4SA 5LSMA 2Z6IA 3W86A 1KTCA 1K03A 4BI7A 4H6KA 4NJKA 1KTNA 1TV8A 1G6CA 3B04A 4K39A 3ABRA 3C6CA 2B7PA 3HGOA 3G1FA 2LLEA 1C29A 3QYQA 3T44A 1A5AA 3EWYA 3M5YA 1K3UA 3IEBA 3CTLA 2DU2A 2RDUA 3TFXA 2J6XA 2DZVA 3G3DA 1T8XA 1XKYA 5HMSA 2OCZA 1ONRA 1W56A 4UFIA 1LP6A 1W8SA 5DY3A 5EKYA 3B0UX 5D33A 4WY0A 1YYAA 4MY8A 2ZA3A 1YXCA 3G1YA 5CZTA 3NNTA 3L21A 4N9DA 2QAFA 4FHAA 5AFDA 3GLCA 5HINA 1TIMA 3G24A 2IQTA 3FOKA 2QKFA 4JTHA 4FNSA 3NPXA 1WQ5A 3BG3A 3W2LA 4AH7A 1KM2A 2YW4A 2FDSA 3GB6A 4PC8A 1O4UA 4LVBA 1DKWA 5EBUA 2YGYA 7TIMA 3KRSA 4FNTA 1PIIA 1SO3A 1TTJA 4JNMA 1H5YA 1MEHA 1VR6A 4X9SA 1QMLA 3RK8A 4YCOA 2A0NA 3HJZA 4DO4A 3ZR4A 2J9YA 3S1UA 2GVGA 3ABOA 3STFA 3L65A 1VCFA 3NM3A 3B03A 3DU0A 5E93A 3LHUA 1CX9A 1EB3A 4RLIA 3PUOA 5AB3A 4EWND 3O1NA 3WJYA 1T96A 1JCYA 3W74A 3W76A 1I4NA 2FB2A 2TRSA 4AHPA 4MYAA 3FS2A 1G4TA 1B9BA 2QCDA 5AC6A 3R89A 4OT7A 3GR8A 1ZAJA 3K30A 4FNQA 3HPZA 4RXGA 3A24A 3STGA 1FCQA 2ISSA 4PTNA 3BV4A 4U4MA 3B06A 2FLIA 1EUNA 1IIGA 3VCRA 3B4UA 4L4LA 1CI1A 2NV2A 2QR6A 3LBMA 3A5FA 4GBUA 4RZ4A 2NUYA 3W2NA 4M6QA 1RVGA 5K4ZA 3S1VA 5C55A 4XKYA 1F7BA 4D2JA 4E38A 3MWAA 2GUUA 3P62A 4WY0F 2GVLA 1FUYA 1HO4A 4S2CA 1H7NA 2OT0A 3H53A 5L9FA 1ICSA 2DJXA 2WOQA 3C2EA 3LHZA 1TCDA 4BK9A 4UR8A 4RX0A 1OK6A 4LS0A 1K02A 3QF0A 2CLFA 4FO4A 1ZCOA 3R13A 1TB3A 2RH9A 3P84A 4NNBA 3QPYA 3GDTA 4O28A 3OVRA 3NZ1A 1W5MA 2FB3A 2B7QA 1VLWA 2ZFAA 3CLMA 5K9CA 4UCGA 1TPH1 1YPFA 5CG7A 2X1SA 3BW3A 3THQA 2CW6A 3SFKA 4IMFA 2FTPA 4UFHA 3NQGA 3CM4A 1A5SA 2DORA 3CEUA 1I2NA 4AWSA 4UMCA 5DXXA 1GYLA 4IPJA 4LVAA 3LCGA 1FBAA 1JULA 1AL8A 4N2YA 2DZTA 4WZHA 2Y7DA 1ZENA 1JVNA 3QJAA 4BF9A 2H3DA 1FDJA 1GVFA 3G1XA 4O10A 1BTMA 1PHQA 4WJEA 3PR2A 1L2UA 5J5DA 1M7OA 2CLHA 4N9EA 1YTKA 4GRSA 3KXQA 5J5RA 3EKZA 2E1DA 4K6AA 3UWUA 2J9XA 4MKNA 3UWVA 2ZRZA 2GJNA 5D32A 3MYPA 4NJIA 3GK0A 3LHWA 4DQWA 5AHLA 4ALDA 2ZTKA 4PFMA 2PRLA 3G8EA 3LI0A 2TMDA 3CWNA 1VPXA 3CIWA 5DELA 4OWGA 4JTLA 3BLFA 4FIQA 3OA3A 4LRSA 3QSRA 4O4VA 4O0KA 1ADOA 3NQEA 2C14A 4O1AA 4HPXA 1OYBA 1VH7A 4UTUA 3PM6A 4TU1A 4UTWA 2XN1A 1ZY9A 3LERA 3NL3A 5CGQA 2NXGA 4IMDA 2A2IA 1JUBA 1GEQA 1TPFA 3PB2A 1LRTA 1W5QA 2AGKA 3PSWA 3W7RA 3GX9A 3UNDA 1LYXA 3KHJA 5AYYA 1T0OA 2ZZ6A 2VEMA 3A21A 3HGJA 3M9YA 4JTUA 4DPQA 1SPQA 4S2BA 5MHBA 1A5BA 1VC4A 5HR6A 4Y96A 1TPEA 3EX4A 1BWKA 5FF3A 1FWRA 3TW7A 3HG3A 3I7QA 3IIZA 4LRTA
chains in the Genus database with same CATH superfamily
3QQ1A 4PTXA 2QGYA 1UR4A 1CGYA 2ZA2A 4W8AA 4A2RA 2ACQA 3ONCA 4ADSA 6TIMA 1QR7A 2H9AB 3P5YA 4G56A 5BMWA 2V8ZA 3QFEA 2QVNA 2YW3A 4OE7A 3Q94A 1SZGA 5JH1A 4DBEA 3NO3A 4NF7A 4QLJA 4AX7A 1W2VA 2I57A 2ZIDA 3TYBA 1MNZA 3G77A 4GZ7A 1K77A 2XHYA 3NEVA 3NL6A 4DUOA 3GDRA 2BOGX 4EP8C 1W3HA 1EJVC 3PJUA 3CHFA 4Q7IA 2WZIA 4XAGA 1E9ZB 2C7FA 1K7XA 1Q7MA 4FR1A 2CBJA 5LKYA 4UMBA 4OOZA 3UA4A 2J78A 3UZYA 3VOJA 2ZUMA 3BAXA 1VKFA 1EEPA 1LCOA 3IJ6A 2QPUA 3KRBA 1LDCA 1IYXA 4AYGA 1FA2A 2WSKA 4UTKA 1K70A 1VFOA 2ACSA 1RJQA 3QYSA 1TV5A 2Y5SA 3UXLA 1QU4A 3ARYA 4JFVA 3RCNA 3S1XA 3R4IA 1CGXA 4DO5A 3QMSA 4WLCA 2WBGA 4GG9A 2YCIX 3ORWA 3NWRA 2A79A 1RR2A 3U4FA 1TA3B 1XGZA 4BQ5A 1OY0A 3NQAA 4J4KA 1F6PA 2PTYA 3D5HA 5BRQA 4CN4A 3IPWA 3ZQ9A 5U7SA 1NFGA 3CHEA 1KBJA 4BWLC 1GVEA 4JR5A 4P2VA 3WH9A 3W26A 3SRDA 3KLLA 3WLRA 3GO2A 4M6VA 1DXIA 4HYWA 2J7DA 3LCLA 4XZLX 4ZL1A 1EC8A 3EEZA 1E0UA 2WBKA 3M07A 3HO8A 4M56A 2QDGA 1W8GA 3KZSA 3C56A 5HDRA 4FSAA 3GH7A 3FKKA 4LANA 4JFWA 3UU0A 2Z2UA 5FEXA 5DX7A 4LW7A 2ZRVA 3QHNA 4GY1A 4ZQRA 1YX1A 3AXMA 4FXJA 3WDPP 4RK8A 6PTDA 4HPNA 5FJJA 3W1MA 1JZ8A 3C61A 3VDCA 1WV2A 4N02A 3XISA 1TTPA 3EPMA 2WHKA 5D37A 1UKPA 1SZRA 2Q3OA 4LV4A 1Q13A 1JRBA 2B0MA 4EPEC 2NQ5A 3WF1A 3BXWA 5H91A 4PL2A 3N2MA 1XDLA 1MYRA 4XG1A 1H50A 3UF9A 3DAQA 2EG7A 3R0DA 4A4AA 1UIOA 3WH8A 3O16A 1XCWA 4CQDA 3WJWA 2OG9A 2PP1A 4ORMA 1AD1A 1CENA 3AOFA 1BHGA 5AOUA 2VC9A 1FH8A 1VZWA 4HNCA 4XZWA 2Z7KA 1S1PA 3DC0A 1FFQA 1GOWA 1S2AA 3UG4A 4Y8EA 4ZSTA 3WUGA 4ES4A 3RM4A 4BCEA 3MDUA 1CW2A 4C6LA 2DDXA 4LY4A 4TMCA 2AQWA 1QNRA 2O55A 3TTQA 1GWJA 2P53A 3S9ZA 4R88A 2Z27A 3C5QA 2B81A 1PKMA 3PULA 3V0TA 3HF3A 1KM4A 3W1XA 3Q58A 4E8CA 1C91A 1ZL1A 1UG6A 3AMCA 1GUVA 4E3VA 4G1NA 4JEQA 1A0DA 4PMXA 1RJRA 2VFFA 3UJFA 5ABHA 1GHRA 1KLZA 4HA4A 4B4HA 2OWCA 4ZB0A 1E4NA 2VURA 1EH9A 4C7GA 3HG5A 4Q4SA 2XIJA 3W7QA 4JPGA 2JF6A 5AHEA 3W7KA 3FCPA 4MB1A 5TIMA 4A3QA 1GQIA 3QHOA 1XX1A 4G7FA 1SW7A 3AIVA 3KP1A 1LZOA 1E0XA 5A6KA 4PCSA 2P0OA 1RZMA 3DX5A 2ZZ7A 3QY6A 2D2HA 2FH6A 2WC4A 3ME3A 4Q3MA 3VNDA 4PODA 7REQB 1IEVA 3FDGA 1O95A 3R25A 5DCEA 4YHEA 2YA1A 1YLVA 3DENA 3MHFA 4X22A 1DE6A 3SUUA 1TFVA 1ZJBA 1EL3A 5DCBA 4GVIA 3TLLA 1KWKA 5BW6A 2BODX 5XINA 1NWSA 3BAIA 4D6JA 1EO7A 2TPSA 2XIMA 3DBNA 1M01A 5G2WA 4BA0A 4FOKA 1B3OA 1Q6RA 3P93A 4ICNA 4HTBA 3HFYA 3E5PA 3S1WA 4CU7A 1V6WA 4O0ZA 4MB4A 2ZUVA 1QI2A 3PHAA 1SFLA 4E8GA 3M0JA 2FFCA 1D3CA 2OYLA 3LMZA 2FDMA 3CO8A 3XIMA 1HO1A 2OO0A 4IP4A 2VZVA 3UGRA 4M81A 4F0MA 1AW5A 1WBJA 2VZOA 5DCDA 4NZCA 4WVXA 3ZJKA 1QFEA 1EP1A 2IW0A 5HNNA 4R34A 2HCVA 4WKFA 4ZODA 4UIOA 1OT1A 3PFMA 4ML9A 4RE0A 4DM2A 1KM3A 4A8RA 4EX4A 3TZFA 1ZSXA 2WO5A 2H90A 3UVIA 1X7FA 5T9BG 4MJ2A 2A3BA 2VOMA 3QQ0A 1DWJM 1UCWA 3LSCA 4ZEPA 3CQ0A 5F1VA 1OCNA 4Q4KA 5CH9A 4B9YA 4NSBA 1AUSL 3GNNA 3GUGA 2EHHA 1ML1A 3VIGA 3BLEA 1BKHA 2J27A 4H4IA 5KETA 4RW3A 2UY3A 1R9YA 2HVMA 1L8NA 4NI8A 3UJSA 3W1AA 4F9JA 3UXIA 1UYQA 4GUFA 4EE9A 3CWHA 2OWWA 3FW6A 2NVAA 2E68A 4UTMA 4TVDA 3S6TA 1UMLA 1VYSX 5CXPA 3DG3A 1VCVA 3OYXA 2IPGA 2JE8A 1MQQA 4MADA 3AUOA 4CNPA 4JTGA 4ZOEA 4G9PA 1NOUA 4PGLA 1I1WA 3AQUA 1KQZA 3B9EA 3A3XA 1H49A 3OGSA 4TX6A 2Y7EA 2R1LA 1AFSA 3WBYA 3TJXA 1QNQA 3GH4A 3HPAA 1F3XA 5FKYA 3H12A 2XZ9A 3G1HA 3M0HA 3MVIA 5HPCA 3JR2A 2R8WA 4F2TA 1ISXA 5HJXA 3N9KA 1E56A 3ZLGA 4C1NA 1SJBA 2E77A 3UPWA 2RHGA 3NVTA 3SUTA 1OK4A 3CL7A 3BLPX 1HNYA 2R1MA 3QMTA 3WQPA 2P5NA 1IHIA 3XINA 2NQLA 4JFUA 4UOZA 2PLKA 5IBXA 2CHRA 4JTSA 1A50A 2Z1VA 1QVBA 1E9LA 4D71A 4PMOA 3VILA 1O12A 1PCWA 3F03K 4DZAA 5JMUA 5AYIA 3DHDA 1V51A 3MVTA 4KWOA 2VCCA 2YCEA 1XLGA 2I5QA 2PF0A 2C79A 3L4ZA 2C6QA 3G0SA 1QNVA 5G4HC 3CZEA 2JFEX 4UQDA 1JG9A 4GQRA 1VF8A 4JICA 5I09A 4ZQCA 4N9CA 4UZUA 2YXOA 2QIWA 3K5XA 4DJFA 3PZIA 1N8FA 3W02A 3VKCA 3ISIX 2HBVA 5BCAA 4WGXA 4CQAA 1G4SA 1GG0A 1HJVA 2CZ5A 3JUGA 3IAQA 1GJPA 3VNIA 2QEZA 3ZXWA 3EX3A 1ZJAA 3Q37A 2OYKA 5DO8A 3NGJA 3EOEA 5BRPA 3OBKA 1XLMA 4IIBA 4W84A 3AIQA 1E6XM 1QO2A 4DX3A 4IXXA 2D2JA 1R3WA 1A5UA 4B5VA 3EX6A 3SRFA 1JZ4A 3LCHA 4IM4A 3BAJA 3STEA 5CAHA 1B0IA 2PCQA 4XBJA 3HMJG 1UC5A 3A13A 1ICPA 1QXLA 2INEA 4DY1A 5LIWX 3TFCA 1XPGA 1WB0A 2WHJA 4GFSA 3H55A 3C8NA 3IVSA 1L6FA 3MV01 2J79A 4U5IA 4Q4RA 3ITLA 4MY9A 1EA9C 4GUJA 3L4UA 2X16A 3AXXA 2OQHA 2PA6A 4NXKA 2BX7A 1H2JA 2CLPA 4GY0A 3LM3A 3W1RA 3LLDA 3LEPA 8XIAA 1AJZA 5CPOA 1CXIA 1W1IE 3QM3A 1XD0A 3GDLA 3TZNA 4KIRA 4OBTA 3S0CA 3A64A 4HOWA 2YCLA 4TV6A 2PDFA 2VDGA 4KESA 3LHVA 5TQLA 4DF0A 2VGBA 4RV8A 2I1OA 1AQ0A 4MAVA 4QS5A 3UG8A 2QXWA 3CPRA 1YQ2A 1ZUAX 1Z89A 3PJXA 4YIWA 3H21A 1WOBA 4WIWA 4XTIA 3OODA 3GTNA 3WDRA 2XSXA 5JQ9A 4P8WA 2QS8A 4O12A 2GLKA 2QIIA 2YBUA 1KM5A 4Q8QA 4GOAA 2Z25A 2Z00A 4AHOA 2W27A 4LCQA 3KBNA 4E3TA 3GYCA 3FXYA 1QUMA 4EIVA 3E0IA 3NXFA 1M7PA 4WDXA 3G3MA 3NM1A 1AL7A 3WF4A 3URBA 1NELA 1KM6A 1UD2A 4X9YA 1VYPX 4O1EA 3MY9A 4C60A 2E67A 3PZTA 4PSPA 1PJ9A 1XFBA 1E0WA 4MLJA 4GMEA 2A3CA 3GAYA 4QCFA 1FKXA 3H7UA 3QEZA 4Q8TA 3RHGA 3OGRA 3S5ZA 3BJFA 1K8CA 3TYZA 3TCSA 4HCLA 3O8AA 3VCNA 2BP1A 3NDYA 2D3LA 3LCWA 2X41A 4QGCA 1Z44A 3L0KA 5CEWA 1H60A 4HPGA 4QE4A 3FN9A 2PGEA 1R8LA 3L7RA 2GOKA 1EDQA 1XIDA 5C2GA 2WPGA 4L4PA 4S23A 4US6A 5DMYA 3E5BA 1AW1A 2TYSA 3MZ2A 3BAWA 4PCTA 2Z24A 2G3NA 4PRWA 3U48A 2Y62A 4WUIA 4DJDD 1MWOA 1NWTA 5LNRA 1S2TA 2ABBA 1K9FA 4IWWA 3QLDA 4S3BA 3AMLA 1PVNA 3WLMA 4CVUA 3CHDA 2PE4A 1Z7AA 4FI4A 4GINA 4JYDA 4IIEA 2CLMA 1W9UA 3P67A 1MZHA 1BEUA 3CV7A 3RR4A 3VKKA 2DT3A 1O5XA 3DFPA 2I9EA 2XG9A 4M7TA 4HN4A 1OF6A 5C70A 3WBEA 3KDNA 3P8IA 3F4WA 2HPIA 1G01A 2RFGA 2EGZA 2QCFA 1UD6A 4GKLA 2ZDSA 3DI1A 3CH9A 3M7WA 3K46A 3P14A 3VC6A 1OADA 4LAKA 1WP6A 3SGGA 4HNUA 1Q6CA 5L6UA 4LUTA 4LAUA 3PAJA 4XISA 1VENA 2PLCA 3KL0A 5DLCA 3TUUA 1XDJA 3H2MA 4EOUA 3NQ7A 3FJNA 4AF0A 3IVTA 3N15A 1HJSA 4MKVA 4YL2A 3CQIA 1VPYA 5BXTA 4A22A 2QJJA 1UWUA 1XYBA 1HTIA 1A5OC 2W4XA 3AUJA 3OTRA 2A3HA 2Y8UA 1D7KA 1RBAA 4J28A 1IR2A 1P0EA 1GONA 2A21A 2VTFA 2BLEA 4XZNX 1JZ7A 2QCLA 3AIEA 4K8HA 5I6SA 3T7VA 3DHPA 1JI2A 1V93A 3P0WA 3IV3A 3R0UA 4EAMA 2HQAA 5A95A 4PBGA 1KRBC 4HMEA 1UHVA 2QDHA 4H7VA 3SCVA 1C90A 5G1MA 4GQQA 4AEFA 3S6DA 1LQAA 1ZAHA 2X1UA 3A5VA 1KFEA 1UPMB 1YKWA 2XU2A 1V0LA 1JR1A 1NM9A 2ZUNA 1NQ6A 2OSWA 2O92A 1KWGA 1M9HA 4TVUA 1HJQA 1YRRA 2E6DA 1KXVA 1G7VA 3TWBA 4TIMA 1V08A 1XQLA 3W3OA 1DJIA 1WAWA 1HJXA 4UMAA 3GKFA 3GVRA 3PN8A 2TSYA 4UFKA 2DUXA 3VE7A 2G4JA 3ITXA 5GVJA 2DQWA 3WQGA 1NFBA 4WJXA 2NX9A 4HZ6A 4LB3A 2WJZA 1OCJA 5AZ1A 1WOAA 4X0NA 3QOMA 4LBUA 3N3MA 4LUSB 1TRIA 4A3HA 1OD0A 5D9NA 3TOPA 1F4HA 3EWWA 2CZEA 1WDPA 1Q45A 5AYZA 4WD0A 5EMKA 3KVKA 3OBAA 3EB3A 4DB7A 1E6ZA 3W73A 4IP5A 1JZ3A 2YYUA 3W7LA 5IRPA 3TMLA 1QBBA 4JKMA 4PULA 5I24A 3PZUA 2IXVA 1W9VA 2W9MA 3EXSA 4LCRA 4ROPA 1SR0A 1VAHA 1YMYA 1TJ1A 4O52A 4O4WA 1PB0A 2E1WA 4XKYB 3TTEA 1DQWA 1EC9A 4M6UA 4UTJA 2MANA 4FLRA 3V18A 1NOWA 1G4PA 1MEIA 2QNEA 4UTTC 4B2DD 5GQBA 1LT8A 2WLYA 1K9DA 1FWTA 1FWBC 3C86A 4XSLA 1JGIA 3W1UA 5HQLA 3UWQA 4OECA 5CSUA 3W85A 3RFAA 1H4PA 4ZB2A 4O17A 2Y6ZA 3T9PA 4IOTA 1RPXA 1W17A 1YNPA 4MZ8A 3RPDA 4DHGA 3WQVA 3CAVA 5M3WA 3AROA 1TQJA 4Z0JA 5AHIA 3RUBL 1CYGA 4WXYA 2Y85A 5E0KA 1YXDA 4ASTA 2P10A 2H8ZA 5M2FX 1PTAA 4F0LA 3FJ6A 1W0MA 4BQ3A 2O0TA 3RILA 3URNA 3VO0A 4AB4A 2Y5JA 1XIMA 3ITYA 1KLYA 1S38A 4HOXA 1UZHA 3RAOA 4CGTA 1ZRQA 1OQFA 4H9ZA 1XM3A 2NSXA 4WDTA 5CSRA 4DRSA 5BYWA 1TPUA 2C19A 3QKEA 4KT2A 1VEPA 3RMJA 3BLDA 5I3FA 3ITGA 3M64A 3U4AA 3ARQA 1FFRA 3PZMA 4DWSC 3H26A 3PZ9A 3R12A 3V5CA 4HHMA 4DBDA 1B90A 4HK5A 3UESA 1K8YA 3P6LA 2WQDA 2XFWA 2BB0A 1P7TB 4KETA 3P5ZA 3AALA 4LEQA 3CQKA 5F2IA 1NARA 3UD6A 4MYXA 4JTAA 1I2RA 2KAUC 4HZ8A 1R38A 5FOOA 3IVUA 1EOKA 1R3YA 3AS2A 4I7VA 3L68A 1D8CA 1ITCA 2DT0A 2WSPA 4CUCA 1ZGDA 1DJGA 1VYRA 4AD0A 1E5JA 3ZSSA 3W6LA 1DWFM 2OKTA 4MJMA 3VABA 3T8LA 4AZBA 2FGLA 4FX6M 4MAZA 2HNHA 3CUXA 4M7SA 1I2QA 1W3JA 1NP0A 4MWAC 3VTRA 1B30A 4YNGA 1ZNNA 4LVGA 3CEPA 2OSXA 4REQB 4RZ5A 1VFTA 1W1TA 3MT1A 4Q8PA 3FK4A 2BVTA 5JBFA 1BYCA 4MM1A 4JTQA 1M41A 1VCGA 4JOMA 4YWIA 1QO5A 3LI1A 1V4YA 2V2CA 1HL2A 2AMXA 1OFEA 4M51A 5KZDA 3AU6A 2WVVA 1OX6A 3SGZA 5AECA 4U3CA 1KGUA 1LROA 4NJHA 1WKYA 3AXHA 3ZJ7A 1AJ2A 1CPUA 3S9YA 2QUMA 3TN4A 3GNOA 3LCIA 1QPRA 3T42A 1FKWA 2EPMX 3B0VC 1V7YA 4YTQA 1FHVA 3T2QA 1XIIA 3MO7A 1G4EA 2A4AA 5A8NA 2VO5A 4C6BA 1LL7A 4JTIA 1PX3A 2G3IA 3PBGA 1TYGA 1EPVA 1FWGC 1I8JA 1SJAA 2J24A 1H7WA 2XVLA 4DXXA 1R2RA 4E2BA 1RA5A 1RVKA 2HE8A 3WFLA 4GXMA 5EY5A 3K8KA 3GY1A 1CZ1A 1ZAIA 3HG2A 3WNOA 3AS3A 1EXBA 1KC7A 3DFHA 1UJQA 1RA0A 2FPTA 5TAOA 1CGUA 5K9DA 5DRIA 3LG3A 1TCMA 5CG0A 4CCCA 1W91A 4B90A 2CESA 4LNCA 4KCTA 5HNRA 4R7JA 2O9TA 4CD5A 4DAFA 3UWYA 3W7HA 1W31A 3QH2A 2PTDA 3NAVA 5I3KA 3RRXA 2PD9A 1EGMA 1OC5A 2XJ7A 1LRQA 1GT8A 1A53A 1GHSA 2YXGA 3BOLA 3LPGA 3MSYA 2JF7A 4IZGA 3W37A 2FH8A 2JGYA 2X1RA 5D38A 1YDOA 3BJSA 3E12A 1KM0A 3LGEA 2CKSA 2G96A 4UNKA 4NJJA 2PWHA 4AY8A 2H8XA 3DFNA 1RD6A 3MBDA 3WK2A 4NIRA 2FGBA 3BC9A 4HNOA 4LS2A 2DSKA 4P7RA 3K4DA 3TH6A 3UWZA 5C5YA 3PTQA 3TYAA 3DUGA 4BF5A 1GPFA 1XISA 5I79A 5LSMA 1E40A 1BVWA 4C5ZA 4BI7A 1UH2A 1TV8A 1G6CA 3B04A 1XLLA 2X7VA 3UT0A 4INFA 3VGGA 2FZMA 4NAEB 1A5AA 4MHBA 3E6EA 1YNQA 1XKYA 5HMSA 2OCZA 1LF1A 4CEUC 2D24A 3VDGA 4ROQA 1XRVA 1PIGA 4DJEA 3VOIA 1YXCA 3G1YA 2EXOA 1F3WA 4QP0A 3H2EA 1KKOA 3NNTA 3L21A 4N9DA 1GKPA 1V02E 2VUNA 4IMAA 1ISZA 5AFDA 2X8RA 3GLCA 4CEXC 2YDRA 1IWAA 2QKFA 3CYVA 4JTHA 3VIJA 3NPXA 3GTXA 2J8TA 3HQNA 1WQ5A 3LK6A 1TE6A 3WF0A 2YW4A 3GB6A 1O4UA 1A3HA 2YGYA 3T4WA 3SCNA 3SQMA 1TUFA 1J01A 1C8YA 2ZWZA 1RP9A 3Q65A 4MNLA 3RK8A 2V6AA 4JL2A 3U2EA 3CTTA 3SURA 4DO4A 3ZR4A 4D6IA 3L65A 3VNMA 5I02A 4QCEA 3NM3A 3B03A 1XLCA 3WUEA 4UWMA 4Z2GA 4RLIA 3M46A 4LFYA 1KRCC 5AB3A 3AYRA 1U5VA 1UR1A 5TF0A 1PKNA 1T96A 4P8VA 3W74A 1R3SA 4HJFA 2BY1A 3WLQA 3DYPA 3I6TA 4O0QA 1B9BA 3LD5A 5AC6A 2BNJA 1H1NA 4E8DA 3F4DA 4S3KA 4DXKA 4H41A 3OB8A 3ZLHA 2FTWA 1O1ZA 1VFHA 2ISSA 2BASA 4PTNA 4IGNA 4B5UA 1VFFA 4K1WA 3UZXA 4L4LA 1CI1A 1IR1A 1H41A 3LBMA 5A1AA 3AYTA 4RZ4A 1OEPA 1PZ0A 1C8QA 4H7ZA 3W2NA 4BEUA 4YTSA 4P8UA 3UETA 4C7FA 4RDVA 3ARZA 3S1VA 3BWWA 2ACUA 5DT7A 4PMUA 2GUUA 3LPOA 3IS4A 4HTYA 3N2TA 1H7NA 2OT0A 4GYPA 2CYGA 2VP8A 4AX6A 1LUCA 2NLYA 1EBGA 5D8WA 2GGGA 2R1NA 5BXSA 2CLFA 2D0GA 2IQDA 3WQ4A 1WXYA 2RH9A 1V02A 1XYMA 1R85A 4I9JA 2PDUA 3GDTA 3B8VA 4GLEA 4ZENA 4H2HA 4UCGA 3BW3A 1XRSA 3AYSA 5BROA 2CW6A 3THQA 1XLHA 4IMFA 2PP0A 2WZMA 2BOEX 1RCQA 2FHBA 4DWSB 1I2NA 4BZYA 4WK9A 1VIWA 2GUYA 4IPJA 6REQB 2EG8A 3VKAA 1FBAA 1KCZA 1PTGA 4WZHA 1KNWA 4EACA 2I16A 4W5ZA 1I6NA 1VBRA 1XYLA 3QJAA 4HA1A 1GVFA 3E2RA 3MB9A 4MNJA 4CNSA 1PHQA 1JAKA 4WJEA 1L2UA 5J5DA 4GRSA 3KXQA 4L6OA 4QJ3B 3QXBA 5J5RA 4ZO9A 3MYPA 4LCSA 2FJUB 5LA2A 3LHWA 2I5IA 4JHMA 2E8ZA 3V1HA 4OWGA 4JTLA 4K1GA 1HL8A 4FIQA 4LRSA 4O4VA 3RG6A 3I3DA 4GGBA 4HPXA 4HCHA 4TU1A 4UTWA 1GOQA 2XN1A 4IH3A 4MNMA 3NSXA 1UWQA 5CGQA 1F07A 2E8YA 4IMDA 3UWEA 1JUBA 3W7RA 1V6YA 4PMYA 3KOWA 5AYYA 2VEMA 3LBOA 1B2YA 1A5BA 1VC4A 4LUYA 1JD7A 3CH0A 3R6IA 3IIZA 5LA1A 2WV8A 5I77A 4ZTXA 2CFFA 3WDHA 1THFD 3B0YA 3N6HA 2ISDA 3N19B 5D2WA 1KW1A 4HU0A 1XLEA 1R0MA 2R24A 3PBWA 4W7WA 3C0SA 4NXSA 3WQOA 1C8XA 4DJDA 3NQBA 4FNPA 1CGVA 1MXSA 1DJXA 3ARUA 1P0DA 5GJPA 3NOEA 1KXHA 4HHPA 4A6GA 1F6YA 2WSQA 4D6DA 4AC7C 1BXCA 4RXFA 3VZZA 2CLOA 1W3KA 3BICA 4WX2A 3G1RA 2QCNA 1IXNA 2O7SA 3EMCA 1KFJA 3M0MA 1LWHA 2B4GA 1EYEA 1WKDA 1A3WA 3W83A 3POHA 2AL2A 4LF2A 4GVFA 1CGWA 1ZZMA 2HS6A 2D1ZA 1BAGA 4CD4A 1L9WA 4G1KA 1EP3A 4DEFA 1OX4A 3KX6A 2V69A 3GIQA 2XUCA 4R9XA 5E5CA 3QTPA 5D04C 2CZFA 2D3NA 3M47A 3VKBA 4H6EA 4JTTA 4DYKA 5IHSA 3KOFA 4R7WA 3OQEA 1BPLB 4HQVA 4RDYA 3GC5A 2HPMA 4D8LA 3AHVA 1YADA 3UBPC 1S3TC 1YHTA 2IMRA 1D3GA 4GYKA 4UQBA 3E2VA 1OC7A 1NDWA 3LY0A 2DFAA 3QOKA 1RP8A 3L5LA 3MKCA 3H2NA 4G6CA 1QTWA 4NASA 4CNUA 3DFSA 1LM1A 4ZFMA 2EPLX 1TR1A 5FESA 2ALDA 1R2SA 2BXZA 3T09A 1OGGA 1XF0A 4S3JA 4DYJA 1OZMA 3VMNA 1UMYA 3UP8A 3TAOA 3B8TA 3R0KA 1UBSA 1DP0A 1HKIA 2CXGA 4N4QA 1FWWA 2C15A 1EOMA 4GCXA 3THAA 1J12A 4K68A 1FY6A 2HVNA 3BTNA 4JNYA 3PZVA 1DOSA 5EYWA 4JFSA 4JIIX 3GVWA 3M4HA 1TMQA 1SU5A 1GVRA 4WKHA 4XZ9A 3T6CA 2ALRA 3DBPA 3KBVA 1BVNP 2PDQA 4Q22A 4MSSA 3I3EA 3PZOA 1O7AA 4R85A 4LX4A 1M6JA 2VC6A 2ZBTA 4FZIA 3B40A 5CCZA 2Z1KA 1FCVA 2GOUA 3CMFA 1UKOA 1KQYA 4ZO7A 4QLLA 1CXKA 2J88A 4ATDA 3L66A 1O5KA 4W7VA 2YA2A 4O1BA 5LGZA 2QPXA 2H6RA 3IJIA 3KS5A 1KGWA 1Y5XA 1JPDX 1I75A 5F2LA 2UWFA 2G95A 4TO8A 4D1JA 1H7OA 4DXVA 2Y89A 3BOXA 2WLZA 5IHRA 1C3FA 1OB0A 1KTBA 1LBMA 1MSSA 1GW9A 2PGFA 2J9ZA 3KHDA 2C13A 4JL1A 3Q4DA 3U6WA 4JHZA 1X8FA 3SY5A 1W1PA 2VJXA 3M0IA 2P88A 2PWVA 3TP4A 1N82A 4ZQNA 1CXHA 1JDAA 3KL5A 3GR4A 2V30A 3ANYA 3L0NA 2XDFA 1KFWA 2BY0A 1IGWA 2VHLA 3SIMA 1EXPA 3PUEA 3LA4A 2QJIA 1CDGA 2YYTA 2KX9A 4F79A 3H2FA 4B5WA 5MKGA 4V1YA 4MFDA 1V77A 5FF0A 2E6YA 2D2GA 3WNPA 3BARA 4H8UA 3UFYA 1FHUA 1TSIA 3S5YA 2CLLA 1Q85A 1RAKA 4J3WA 3ZIZA 1LBLA 1PIFA 2XIIA 3RPMA 3RR1A 1ALDA 4PE8A 2FZBA 1K8XA 2WC7A 2OX4A 2CHOA 3FEMA 1JPIA 1S2UA 2V5DA 1SO6A 1ZBCA 1X96A 1DWIM 4AXNA 1LQ2A 1XD1A 1TO3A 2O4QA 1E71M 1NVMA 2OLAA 3S2NA 4Q7NA 3BVJA 4XZIA 1OINA 3AIUA 3CUZA 4ADUA 4C1KA 5FSEC 7A3HA 1OZQA 2GQ3A 2VZSA 3MI3A 4Y9NA 5C7HA 4H9TA 3ARWA 5A2CA 2FMOA 3UXKA 3FDKA 4XB3A 3BW2A 3NQCA 3D3FA 3GTHA 1QI4A 5JBEA 1C92A 1SFJA 3IRDA 4HBKA 2B7NA 3L67A 2VVNA 3T2OA 2QUNA 1HKJA 4JXCA 1AZ1A 2O9RA 4B5NA 1X1ZA 4US5D 2OTDA 4AZCA 4FMVA 1TPC1 3W7OA 3ERPA 2Q8ZA 3BZGA 2C16A 4C7DA 3JU2A 3H4XA 3M5ZA 3WD0A 3WMSA 3TSBA 1CGTA 2QV4A 1H1ZA 4J3SA 3WFAA 4HT3A 3WLTA 4H9UA 3GTIA 4Y7EA 2Z28A 5C9UA 4I9AA 1K9EA 3KTXA 2VVSA 3ZS4A 1Q65A 3GIPA 4QITA 3NEHA 3A23A 1J9YA 5DMLA 3SZ8A 1VGAA 1MW0A 1H3GA 3ZYZA 1FDZA 1KR0A 4HP5A 3HZ3A 1XBXA 1F74A 3CUIA 4Q6XA 2ISFA 3I68A 2RUSA 1W9PA 4S3DA 1POKA 3A3WA 3QR0A 1AD4A 1JUEA 2OLSA 3V4BA 1BWVA 3JS3A 1LLWA 4I3GA 1PZ3A 4GKTA 3LUTA 4LV9A 4O1CA 2INFA 4IFOA 5LXEA 1LORA 2J77A 4HNTA 1MQRA 3F2DA 5AHFA 4ZMGA 4Z17A 3MP4A 4C6CA 4A3YA 2W66A 3BOFA 1XBYA 2GQ9A 1HZYA 2Q09A 2GWGA 4MPKA 4OV9A 3ONBA 3TX9A 3UXAA 1Y5WA 4D1IA 1PDYA 4N0RA 1HGWA 1JDDA 4DO7A 4UTHA 2A85A 3QLLA 5TD4A 5LIUX 4IUOA 2CLKA 5TBOA 1BG9A 3Q67A 1MFUA 4Y9PA 1ODZA 2VZUA 4RNFA 3ALFA 4XD3A 4JYFA 3C52A 3DECA 4I7UA 3P3BA 1VRDA 1AQFA 1ITQA 3EDKA 3E49A 1L8PA 4F0KA 4BI5A 3TYUA 2HE5A 2PAJA 5DY2A 4W89A 3L23A 1BF2A 2JKAA 2BOFX 2WCGA 3DFTA 8CGTA 3OYZA 1R7OA 3FHAA 4NZ3A 1TV3A 1A4LA 1SZNA 1GVIA 1OD8A 2W6RA 1SVDA 3OLIA 3PZGA 3AWOA 5FSDC 4KEZA 1HG3A 2IPWA 3P80A 1FCBA 1WDRA 3FA5A 5FCZA 1IEXA 1PWLA 1O1HA 2WVSA 4C6KA 2JEQA 4A35A 4CNOA 5T8GA 2ZX7A 3VIIA 5AHMA 4WOZA 2Y63A 4JTFA 2WZHA 3V0SA 2ZTJA 3ATYA 4DM1A 2XH4A 2BBFA 4ATWA 1IE7C 1XPYA 5CPNA 2OEJA 1ADDA 1XUUA 2E7FA 2PFHA 4DYEA 2Q3RA 1XGDA 4MKSA 3U7BA 4N4PA 4H6QA 4IPIA 3G2GA 1OFAA 3FXGA 4RKAA 2VXNA 3O0KA 4DUXA 3P8JA 1P48A 3SCOA 2Y70A 3KZPA 1W3NA 1KCLA 1MO0A 3W7PA 3N73A 4PMVA 1ZBVA 2JALA 3LCFA 4UTIA 4C1NB 1IZCA 3GYEA 4NNCA 1ELSA 2J7GA 3HQ1A 4XTDA 2ZRXA 2DZWA 3ZT5A 2HTMA 3KTSA 2VC5A 1J0IA 1KD0A 3PWIA 4C5YA 1KR1A 1GKRA 1OYAA 2Y7FA 2FVMA 1TX2A 2EPNA 3CUHA 1H0GA 2ABAA 2PDMA 3TR2A 3VFLA 2OT1A 2BS9A 5JU6A 2G8ZA 2GSJA 1JQVA 4IFKB 1LOQA 4LOCA 3WQDA 1VJZA 3ZWTA 1T99A 3S9IA 1TZ7A 1QJWA 3PJTA 4QIUA 2ZVIA 1ITXA 1J0KA 3ZLFA 3W7IA 2D69A 5G5IA 4LUIA 1R3RA 3MUXA 9XIAA 3LENA 3AWNA 2QVHA 2C1HA 4HYVA 3RU8X 2V2HA 1SUXA 4ZE4A 3H2AA 4G8TA 3LNMA 2HWGA 4F3HA 4AWEA 1JGMA 1PHWA 3GC4A 4IMEA 3PPCA 4DF1A 4BR1A 2WPBA 2E5BA 4JIEA 2Z29A 3PWAA 4GJ1A 2A3AA 2GPTA 4N7QA 1LG2A 4JN6A 4LJ3A 1GOIA 3E0VA 2CLIA 2FZDA 1T40A 4EANA 5IDIA 4HN8A 3RJXA 3DYMA 1YE4A 4PN2A 5D9MA 3D46A 1DJQA 1WBHA 5DBUA 3G18A 3T08A 4A3UA 4IPLA 1ZTVA 5I3JA 1ZPTA 3BLOA 3W1LA 4PUWA 4W85A 1VQTA 5CQ1A 3Q45A 4UTFA 4UNIA 1DJNA 1WAUA 3KWSA 1EJTC 2OFJA 1DIKA 4BQ2A 5HOSA 3ID7A 4HKPA 4AWTA 1WDQA 4TOQA 3ARTA 2OGJA 3GXTA 3ELFA 3VVGA 3ZVIA 1L2QA 4B3LA 1TVNA 5G1TA 4S3EA 1P6CA 1EPXA 1RCXB 2QT3A 2RJHA 4PCPA 1EUAA 4GUIA 1KV8A 2BG5A 4KFPA 2V5JA 5CSSA 3TQKA 1GJUA 2PTZA 4CN1A 4AU0A 3SECA 1HVQA 1LL6A 2FYMA 5D03A 5SWUA 1MXGA 3OW1A 2DJLA 2E25A 1BQGA 1UWRA 4ZOCA 1DYSA 4YYCA 1Q6OA 1QDSA 1B3WA 3RCYA 2DH2A 5KSWA 3U5YA 2NQZA 1E73M 3GTFA 2VYOA 1JFHA 1JCTA 2YCLB 1QPQA 4CD7A 3TC3A 4NZ1A 3ZFHA 1MW3A 3AZTA 3WJSA 3WK3A 4PTWA 4LAMA 4H01A 1VHNA 4PBEA 1XP3A 2A1YA 4KF1A 5AC7A 1JXKA 1W3LA 3W22A 4C6QA 3WNLA 2D0HA 4LVDA 4XZMX 5KMYA 4XSMA 2VEKA 2VRQA 3EWDA 4GIYA 1P43A 3A3HA 4P7OA 3DKLA 3CYJA 4CNTA 4U2ZA 4AIEA 2GJLA 4LY8A 1BTCA 1QAPA 1UR8A 2R1KA 2Y61A 3BCFA 2WANA 4E2DA 4DJFD 1EEXA 4KFOA 5AYXA 1MXDA 3KAOA 1IV8A 1TPVA 5RUBA 4KERA 4IX2A 4WSJA 4HK6A 2YCKX 2PURA 3G22A 1TPDA 2QDEA 1G69A 1NY1A 2VWSA 4JQAA 4NAFA 3U8GA 2P50A 1Q2RA 1PO9A 3BDKA 3HIJA 2HMCA 4L1WA 1YBQA 4HK7A 5CBJA 5BZAA 1V3MA 1MDRA 5CGTA 5M1TA 4LB4A 3T0TA 1N8WA 3AAMA 2PZNA 1ME9A 5BOEA 4V33A 3ABSA 3WDQA 3D3AA 1OFOA 2VT0A 4M29A 1DL3A 1UQYA 1F05A 4D6GA 5HMFA 1K4GA 3C8FA 3NQ2A 4UBPC 1X7IA 3EOSA 3FA3A 3SCWA 1TJ0A 1GCYA 4YMZA 3E1F1 3SO7A 3R5EA 3N2XA 3DI0A 4LC8A 3W70A 3LV5A 1AMYA 1UUQA 4RR4A 4WY0B 3DFYA 3WF2A 1IWBA 2ZVRA 4C6MA 4JS3A 3SGUA 1LTDA 3OIXA 1W1B1 4UB9A 1J18A 4Q8VA 3VCCA 2VI0A 3W7CA 4E4FA 1E4IA 3S5OA 2FFIA 1A4MA 3SIZA 2OZ0A 4BWLA 5FJIA 1U30A 4MJ4A 4AZHA 4LUJA 4IF2A 5F4WA 1IEWA 3O2LA 4UC5A 3KL3A 4NVTA 2QZRA 1P4CA 1JYVA 4AF0B 3N4EA 1HN1A 1SQ7A 2W92A 3WDJA 3W2MA 4Q8MA 1KXTA 2ASHA 1UUMA 2DZUA 1UA3A 4IHCA 4GI9A 3P7YA 3SUVA 1OWQA 3L4TA 1O66A 2NXHA 2P1FA 4GABA 4B9ZA 4JTRA 2ZZ5A 3QPEA 4MVAA 3UW6A 2ATSA 2QCDB 2VEGA 3R7MA 3SCSA 3J7HA 1DWGM 1XJBA 3ZZ1A 2RAGA 3PPGA 5C54A 5AYBA 4ACYA 2VELA 4H8VA 4CD6A 5I2UA 3K4AA 4KGLA 4GNJA 2AOSA 1V79A 1BSLA 5FEPA 3EX2A 3TJ4A 2F84A 1ICQA 4OFCA 3NGFA 3ABZA 4IGHA 2V67A 4LYPA 3KP0A 2J62A 1NQKA 1L6WA 1G5AA 2VKZG 2XH2A 1A5LC 3BG5A 2PWDA 8RUCA 2EF9A 3OZYA 3WENA 3IUDA 5IXEA 1E70M 1OF8A 3NJ3A 5BNKA 1RLCL 3THUA 2BY2A 3FV9A 1AJ0A 3GDMA 1Y5VA 2GSHA 1Q7QA 3TXVA 3K1DA 1XYFA 5LIXX 2DGAA 2V5CA 5D30A 3VI2A 6XIMA 4W93A 3STPA 4U3AA 1YW1A 5HULA 5JIPA 5GNXA 3W6MA 1FVPA 1AH4A 3MUZ1 5HBFA 2YPIA 3TDFA 3SCPA 3DKJA 1UPPA 4WGHA 5F2GA 2DVXA 3EB2A 1IT0A 3H7RA 5AC5A 1NOFA 1SFTA 2Z1SA 1OFRA 3ZWSA 3H54A 3PB0A 1GQKA 2YSWA 4QEHA 2UY4A 3WQ8A 4Z1CA 4IGMA 4GPNA 1V8EA 4AWUA 3AIBA 4ORIA 3WJZA 1G7UA 3S46A 4XBKA 2CLEA 3BG9A 3PBYA 2C91A 2EKCA 1IXQA 1ZALA 3AU2A 5FA5A 1F61A 1E6PA 1P6WA 4JQ3A 4O11A 3E2QA 4L9XA 3W7NA 5A94A 3VZYA 2Y1HA 1TJPA 1XIFA 2YKKA 3L2IA 3O7UA 3OVGA 4Y8FA 4DBSA 3VU2A 1E1EA 2PSNA 3DC8A 3M1ZA 4ZA0A 3GKAA 5G4WA 1XYZA 4WDWA 1AG1O 2DZXA 5C7VA 2GJXA 2FHFA 2V3GA 1HGYA 2YDQA 4I5XA 2Y8VA 1QHOA 2PDNA 4PTDA 1J93A 3D6NA 2IKGA 1WXJA 3MWCA 1G0CA 4UQAA 4PTMA 5IDZA 5DF0A 3U2OA 3R1ZA 4MWAD 3RYSA 4RV3A 2XYLA 4EWJA 5A8PA 2WM1A 4BQ4A 3UG3A 4C6PA 3C2OA 1S5MA 3H2CA 2WWCA 4US5A 2JK2A 3DHFA 3ARXA 1IEIA 3CAQA 2HXUA 2J8FA 2YR1A 3GHSA 4JQ1A 4PMNA 4P7QA 3MCMA 3NR0A 1P1XA 3CUJA 3RO6A 3NYDA 4GH1A 1AODA 2I56A 1EF3A 4XIAA 2V63A 1EGZA 4GIRA 2WMHA 3ITCA 3TMQA 3M0LA 5HPOA 1PDZA 1FXPA 3R8RA 3DZ1A 2O7QA 5G4EA 1CNVA 2R94A 3QQWA 2PC8A 3LU2A 1TKKA 2GDQA 4DVOA 4LSBA 2UY2A 2PGRA 2CBUA 1JD9A 5EFFA 5BOOA 1QCWA 5A6SA 3TOYA 2WWDA 1LBFA 2V3DA 4TQTA 2QYGA 2W0UA 1ZJIA 4NX0A 3SY8A 4Z0SA 2VRJA 3A22A 4YTUA 3BSGA 4K8EA 2IS7A 4IIDA 4I6VA 1H1YA 4UQ9A 4R3UA 3NA8A 2WVVB 2QJGA 3GBDA 4NZ4A 3W7EA 4KGJA 3RX3A 1X98A 3GU2A 5FF2A 2ISVA 2PDGA 1QI5A 4PRTA 3LB0A 1VPQA 4D6CA 3EKLA 5CSYA 1Q3NA 3ZJ8A 3CU2A 1XI3A 1XLFA 4W5UA 1NSJA 5A5WA 3MSRA 1W3IA 2XIBA 4GYFA 1OM0A 3MKVA 1XYAA 1WZKA 4EXBA 4C65A 1BGAA 3WELA 4GJIA 3ZJ6A 2FQIA 3GAKA 1R46A 1FWIC 2Q01A 4ML4A 3W87A 1TV2A 4ONVA 2QLYA 4XO7A 1J5TA 4LGXA 4JIRA 3CV1A 1KTCA 1BVZA 4IPPA 1KTNA 1H0IA 5CPQA 4AZ7A 4AIUA 3G1FA 4GO9A 3KM8A 3EWYA 3VGFA 3QY7A 2DSWA 2YLLA 3IEBA 3CTLA 2DU2A 2RDUA 2GUBA 4NL1A 1M68A 4QJ5B 1ONRA 2XSAA 3E74A 4UFIA 5EKYA 3B0UX 3A4XA 4MY8A 1MZRA 3ITTA 3THCA 3NZPA 1RK5A 3CZLA 3EKGA 5CZTA 3FSTA 1GVYA 1CXFA 1FHDA 2QAFA 3VNLA 2XGBA 3G24A 2IQTA 3GNRA 1S5NA 2IPJA 4LVBA 5EBUA 2CIPA 3CXOA 4C6EA 1PIIA 1TTJA 1H5YA 1VR6A 1W1YA 3MO4A 2E0PA 3DOPA 2PF8A 5A6BA 4MB5A 3CV6A 2VL4A 4AISA 2J9YA 4QFUA 3NFUA 3STFA 3B9NA 4GXWA 1VCFA 4ZR8A 1ZCCA 3KEHA 2P76A 3DU0A 4W87A 3SN1A 1CX9A 2IUZA 3HQPA 4CCZA 4EWND 3O1NA 5BWAA 4ICMA 5GNZA 4L5ZA 4G7EB 5H8PA 3T0AA 3FS2A 4ZE5A 2VDHA 2C0HA 3SUWA 3LLXA 2YOCA 1KCKA 1GGOA 1HP4A 1A3XA 1ZP3A 1ZAJA 3K30A 4LXFA 3HPZA 3MSDA 1PBGA 1HX0A 4RXGA 3CZJA 3EOUA 4B5XA 3MMUA 3QTGA 4JN7A 3GDBA 2J47A 4QX4A 1EUNA 3VCRA 4D8AA 2QMKA 1XWYA 1MFVA 2QR6A 2FTYA 4IT1A 1U33A 4MUPA 2G4FA 3A5FA 3V0UA 4Z1YA 4GBUA 2NUYA 4QEEA 1XH1A 6XIAA 4BEQA 1V6TA 1RVGA 5C55A 4IPNB 2PZ0A 4XKYA 4E38A 4D2JA 1QW9A 3P62A 4WY0F 3VOCA 1FUYA 4KIEA 3CO4A 1VB9A 2DJXA 3LHZA 3FGCB 4AG0A 4UR8A 4RX0A 4CVWA 4LS0A 1MW1A 5ENLA 1MRAA 2CCRA 3W38A 1YIXA 4HGXA 3K13A 1UWTA 4QDWA 3BAYA 1CLKA 4MNKA 4NNBA 1PX4A 3UZZA 4GD0A 4EKJA 3NZ1A 1W5MA 2FB3A 5C0QA 2B7QA 1RH9A 3JVAA 3E2SA 5K9CA 3NOYA 3SFKA 4AD1A 1C7TA 2FTPA 4HB7A 1YPXA 3CJPA 1A5SA 4WF7A 2O4MA 3SQLA 4JCMA 4UMCA 1F3TA 3F5LA 2POTA 1J2BA 1V6UA 4LVAA 3POCA 3GRIA 1AL8A 3WBWA 3H7VA 4J40A 1J96A 1VIZA 3EOLA 3M7SA 3QGVA 1JVNA 3VDAA 2H3DA 3WLLA 3UCDA 2IPFA 3AYVA 2CLHA 4ZOBA 4QROA 2YLAA 3THDA 4G5DA 5M17A 3VM7A 3OZPA 2GJNA 1VFUA 2BHUA 5D32A 4PB5A 4NJIA 3KDOA 3SCTA 2VX7A 1US0A 3CL6A 1M53A 3GK0A 3IARA 4BY3A 4DQWA 5AHLA 2PRLA 3ZO9A 4I9MA 3BL3A 3CIWA 1B54A 1P7TA 3GS6A 3WL1A 3OA3A 3GU1A 1Z3NA 4B5SA 3SDOA 1Z9AA 1OYBA 2PUZA 4HU3A 4UTUA 1LUCB 1QNOA 3JZEA 5CPSA 3LERA 5CJNA 3NL3A 4AD3A 2A2IA 4PFHA 3PB2A 3NTYA 3CV2A 1LRTA 2V3EA 3AISA 4GX8A 2ZZ6A 5ECUA 4JTUA 1SPQA 2HBXA 3F2BA 4LH8A 4XZBA 3TN6A 4Y96A 4AIBA 3TW7A 1HF6A 3GXFA 2ZX6A 2TODA 4DJED 5JVLA 4REQA 1ONXA 1J11A 4J2PA 3WCZA 3GG0A 1TR9A 2ZICA 3NQDA 3C0QA 3CIVA 1GVOA 1UQZA 2BVYA 1DE5A 2OR2A 3R8HA 4Y90A 1NEYA 4XAPA 1OCBA 2G37A 4CQBA 3WMLA 1C7SA 3F5KA 4WCJA 4CU6A 5DMNA 2XFFA 3MUCA 5ABTA 3F7JA 3ECQA 4PMDA 4N9BA 3GH5A 3MPGA 1VD6A 5CBBA 2QCEA 3IIXA 3LRLA 4GUGA 2WCSA 1E6QM 3QGAC 1V5XA 5FJTA 2FPVA 4C1LA 2ATMA 5C9RA 1K8ZA 2ICSA 3Q2DA 1XCFA 5F4XA 4ZQOA 5E6ZA 2ZE0A 3NL2A 3B97A 1W3TA 2HJPA 1VS1A 4AY7A 3VA8A 3RIKA 4Q8OA 5BXRA 3PF3A 2DUAA 2OVLA 1AQHA 3REQB 4EVZA 2IXUA 1E4MM 2CZVA 3FEQA 4DNHA 3W1NA 2BGQA 3LQLA 3EAUA 5E1QA 2A3LA 2OOFA 1E1CA 4KKXA 3I6EA 3I4EA 1H11A 3GIYA 1SMAA 2YZRA 4FXRA 3M0YA 1VLIA 3TYEA 4CCEA 1GQJA 2YL9A 4NILA 3IJ9A 2DW7A 1XQKA 3C3UA 3R43A 5M5DA 3PC0A 4S38A 4DZIA 1AMKA 1YDVA 4A8IA 2NQ9A 2QQ6A 3WLJA 2AQOA 1JEZA 3IUHA 3AHXA 5I3IA 1K4HA 4XBSA 2REQB 2ZXAA 4S3FA 3BE7A 4XWUA 2CC0A 5D02A 3PPFA 4H9MA 3WH6A 3TWAA 3LQGA 4ZFCA 3SFWA 4FLSA 1V03A 3FYYA 3G0UA 3W28A 3NPWA 3EEGA 4UNLA 2RGLA 5AN7A 3UWWA 5LYRA 3N2BA 3GFXA 3S8HA 3QC3A 1SR9A 3QZAA 1GVSA 2X7WA 1H7XA 2AL2B 4O14A 4W86A 5ECVA 4YXGA 4NKCA 4ZO8A 1H51A 3AHYA 4NJGA 1XYCA 3LGDA 4V2XA 1W1ZA 1OX4B 1JRCA 2OZ3A 4ADTA 4H04A 2RDTA 4MIMA 4HSOA 3G0XA 3ANUA 3LNPA 1WKFA 1IF2A 2XINA 4H9YA 1DXEA 1GORA 4F4RA 3IGHX 3LLFA 2V5KA 1PYFA 3KWXA 1ME7A 3WN6A 4V28A 3KOYA 4E6MA 4KWWA 4NP7A 4PUDA 2R91A 1DV7A 1W5NA 5A6MA 4R33A 5FEWA 4TR9A 3T40A 2CERA 3IGSA 2NZLA 3UVAA 2PRMA 2PLJA 4IQDA 4AZIA 2YL5A 5LNSA 3U2CA 5A3HA 3B3DA 4L4OA 1KBIA 2MNRA 2R6OA 4M82A 4H8HA 1CEOA 1H7PA 3M5VA 2WKJA 2ESCA 5ABFA 3BH4A 1JFXA 1L6YA 1AZ2A 4OJYA 5C2XA 3TJLA 4UXDA 2I9UA 1WZLA 1DVJA 2E5CA 1CIUA 2RDWA 2E6AA 4OZOA 1XINA 3B8IA 3FA4A 4IIFA 3WF3A 3UCQA 3TN5A 3CNYA 4MZYA 3WSUA 1GG1A 3L2MA 3CT7A 4HNNA 3OHMB 4I6KA 2YBVA 2UY5A 3PG8A 2UBPC 1X6LA 1FX6A 2EQDA 2YB4A 5I3GA 3EDEA 4LBRA 4S3GA 3MS8A 2VEFA 3HPXA 5H8UA 3N4AA 1EX5A 3HGRA 4M19A 3WLKX 4MWAE 3W6YA 4Y9MA 4IQJA 3W84A 2BFGA 4Z1DA 4YTRA 3H2OA 3ZOAA 3BMWA 1QNPA 1JCLA 4Y9AA 2J13A 3HGSA 3HMCA 3UZJA 3BCDA 4UTTA 4FPSA 3M43A 4K36A 3C0LA 2OQLA 2WCAA 2WJDA 5C71A 4X3ZA 3B9DA 3EWXA 1D3HA 4BF7A 4YVVA 4HZ7A 1QOQA 3S5NA 1PCKA 3JZUA 4QRNA 1TE1A 1RJPA 2PDHA 3HPSA 1KFKA 1OCQA 1LWIA 4H2CA 3EA2A 3RM9A 4O54A 1WDSA 4ZSUA 7XIMA 2TAAA 2X30A 3LTSA 1E6SM 4R53A 2O56A 2CBIA 2HK0A 4ZVJA 3V5FA 3A12A 4AW7A 4JX5A 2AQVA 5KZMA 1P0KA 1Q6FA 1DWAM 1E1FA 2XH7A 1H63A 2UV8G 3ABQA 1CWYA 2OLHA 1TV4A 3PANA 2HXTA 2ZZ3A 2YDSA 1OIFA 3PAOA 1XLIA 3OZMA 3AZSA 1JQXA 4Z2JA 1OGBA 3L4YA 4DWSA 3ATZA 3KBSA 4Y6GA 3BPWA 2NLIA 3IJLA 3TLQA 1EC7A 1EA0A 2G50A 6REQA 1R2TA 1TELA 1MUWA 4AYSA 2G5WA 4WR3A 4XVEA 2WVUA 3MP5A 1LG1A 1I0BA 1TVLA 5MKGB 2QV5A 1VEOA 2I17A 1UUOA 3OLGA 4MDPA 3B8UA 4DNMA 1V0KA 3WDIA 4HPJA 1IGSA 2WVTA 4X2RA 4J3UA 3KCOA 1VJIA 3MANA 4XAYA 2PBGA 1Z42A 1WDDA 1ZJHA 2W91A 8A3HA 2E9BA 3VE9A 4XX6A 4GQGA 1IZJA 5AY7A 4MWAA 2IQ0A 2QW5A 2F2KA 4IXHA 5HATA 4NNAA 4XK2A 4MFEA 3KUMA 3MZNA 1KCXA 4PR4A 4RDZA 4RNJA 4KQNA 6TAAA 4XD4A 1QBAA 2R1PA 1XL9A 1SJCA 2QPSA 3WJXA 1KGXA 1ZU8A 3BGJA 1W1VA 4W9TA 2D22A 2NQJA 3FY1A 5LNVA 5REQB 4JTKA 4I8YA 1N55A 2D23A 5EGRA 4LYKA 3LM7A 4FK9A 5K3VA 1P0BA 3BGAA 3TA9A 1X8CA 4AZCB 1A0CA 1L6SA 1J5SA 1M3UA 2ISWA 2ON3A 3LZ5A 4CCDA 1BG4A 4JY8A 3V16A 1NDVA 1WX0A 3H4WA 2GFTA 2AL1A 3QKZA 3KVLA 2A5HA 1AW2A 1NDYA 1ZBKA 3I3BA 4GACA 1ZBWA 3LDVA 3TROA 4K38A 5DRCA 2DVUA 3TE9A 1QPNA 2PDBA 2DIEA 2Y7GA 3YPIA 3LX9A 1Y7VA 3OG3A 1O68A 2XN0A 1XLJA 1A0EA 4B4FA 4KWVA 2I14A 3UYCA 3BLIA 1EYWA 1A5KC 3UR7A 1NF7A 3G1SA 3UPBA 1UW9A 2J7BA 4NZ5A 3WLPA 1OFBA 3FJLA 3O6YX 4PUKA 1Z69A 2X40A 1J8VA 2QGHA 3W29A 2ZX8A 2GQAA 4HVXA 4JBRA 2FPYA 4QSHA 4HPHA 4CQ9A 3EB4A 3LHTA 3TTSA 3VNJA 4FNUA 4NZJA 1KO0A 1TIWA 1UP2A 1XC4A 4ILSA 4TTGA 5CZSA 4R5EA 5DANA 4RZ6A 3W1QA 1V7AA 1QWGA 2PDJA 2QUTA 2SFPA 3AIRA 3WLSA 1REQB 4UFLA 3EWUA 3W82A 2OYMA 1EJRC 4ECLA 1XG3A 1PXGA 4A29A 5B7ZA 5EL1A 2PWUA 4XD6A 3B9AA 3TCEA 1Y0EA 2DPEA 1S2CA 2V68A 4DUWA 3PSVA 4Q8WA 1XS2A 2PMQA 2AGTA 4PH6A 3S47A 3LXCA 1B1YA 3LV6A 4TV5A 3RM8A 3VGHA 1ESWA 2WHLA 2GK1A 4AFYA 1A47A 4JX6A 2JKPA 4A21A 4WRHA 4JQ4A 2PU0A 3UJ2A 1HP5A 4JGDA 4K7YA 5BRBA 2Z2AA 3NG3A 2VFHA 1T8QA 3UPMA 4B92A 3VC5A 4K37A 4Y9OA 2W67A 1R3VA 1UKSA 1RV8A 5I00A 2VWTA 2PWFA 2ZYFA 4NYYA 5GNYA 3S1GA 2ZZ1A 4YTTA 4LS1A 3T0DA 4IG2A 4DIAA 4RZBA 1TWIA 3V7PA 3BANA 1NJJA 4MUZA 1UBPC 4RE3A 4XQ6A 1DQUA 3HTWA 4MZ1A 4GVHA 4XAFA 2VENA 1J6OA 4QQ3A 1AK5A 5BMXA 1A5CA 1S5VA 2PCEA 4DLMA 4IJRA 1O5RA 3JRKA 3KBMA 3IIVA 5U4NA 4AEOA 1WO2A 4JTDA 4A2SA 4H3DA 3O3RA 4DZHA 2EPHA 3CB8A 3BO9A 3WMCA 6ENLA 4NX5A 4OGZA 3ZR5A 5CPTA 3L5AA 5DN1A 3GFYA 2GJRA 3L12A 4UQEA 3H8AA 4QG8A 3RX2A 3A9BA 1FP9A 1G67A 4NY2A 3PZNA 2HDJA 2ZZ2A 2V81A 3H24A 2YX0A 1SZFA 1SW0A 3TN3A 1C9WA 1EJ7L 2OEMA 3TC6A 3VIPA 4H9VA 3WD4A 3CQJA 4YVPA 1Q6GA 1KFCA 1OIMA 4K8GA 1XH0A 4O53A 4YN5A 1TX0A 3KTCA 4S39A 5A8MA 3RGTA 1TVPA 3AO0A 2CEQA 3C4UA 4I8DA 4G2DA 5D2VA 3TK7A 3W07A 1BSIA 3ICJA 3N9RA 1QPOA 1RHCA 2F6XA 1RK6A 4KPLA 3KFTA 1W54A 5I78A 4ZCWA 1XKJA 2FMNA 2Y8KA 3HM7A 1C9DA 5CZ0A 1K1DA 3RLVA 2NWRA 1Y65A 2XGIA 2YB1A 2NVDA 1P5BA 5DEZA 1SMDA 3PNZA 3H22A 1QOPA 4QISA 1E6NA 4LAOA 3VKJA 4UTLA 1TTQA 2VRKA 4BI6A 3AJXA 4Z1BA 4HA0A 3WEMA 5H1WA 3UEQA 2GDUA 3LTYA 2FZ8A 4POCA 4QE1A 4HSNA 5A8QA 4OKDA 2WXDM 5HNUA 5KEZA 4AUBA 3HA1A 4DZ5A 1T7LA 2P8CA 1ONWA 3WQEA 2DZAA 4M80A 3S3GA 1X39A 5HK4A 2OJPA 1SW3A 4DF2A 1R3QA 4L9YA 3TA6A 4L1XA 1K7FA 2QJMA 4PRRA 2CXEA 5AKQA 2EPKX 3UYIA 3DERA 3W2UA 3CAWA 3TKFA 1B3YA 1AH3A 3LHYA 4MOZA 2ZRUA 2Z26A 2PI6A 1OX5A 3H6OA 3EMZA 4P61A 4O8RA