1FCQA

Crystal structure (monoclinic) of bee venom hyaluronidase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
321
structure length
314
Chain Sequence
b'EFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYALURONOGLUCOSAMINIDASE
publication title Crystal structure of hyaluronidase, a major allergen of bee venom.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Hydrolase
total genus 128
structure length 314
sequence length 321
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01630 Glyco_hydro_56 Hyaluronidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1fcqA00
4MUZA 3M43A 2DORA 2F7FA 2E5BA 4LNYA 3W1RA 1LLZA 3U8GA 1JCXA 5HQEA 2CLOA 5CPNA 2ZRZA 4RK8A 1I8JA 3R2GA 5DXYA 4AHPA 2BSLA 3B03A 5J5RA 3WK3A 3B8DA 1RPXA 4UFKA 3DKLA 3TDFA 5K9CA 1BWKA 2Y6ZA 1GOXA 2P0OA 5T26A 3LGEA 4O15A 4ADUA 1TTJA 1OJXA 2Y89A 1XBXA 4MJMA 1MZHA 2NX9A 3T7VA 3LBMA 3NO5A 3SJ3A 4FF7A 5K4XA 3W1NA 2R8WA 3P82A 2V82A 1U83A 1VZWA 4K6AA 4NZJA 1TREA 4MZYA 4DO5A 3DFSA 3PBWA 1X7FA 1N55A 3G0UA 2EAWA 1YDNA 3R13A 2QDHA 2R91A 3H53A 1K7XA 1KM2A 1O60A 2CU0A 3KVJA 3TQVA 1RV8A 2PRMA 3HGSA 4JTJA 2ZRXA 3IIOA 3C4UA 4FHAA 4OWGA 5H91A 4GUHA 3WJWA 4UTHA 1GWJA 5TIMA 1SZGA 1TPUA 3NAVA 3F1QA 3SIZA 5CPLA 1TV5A 5AC8A 3TQ0A 2ZZ2A 4S2BA 3THQA 1NAL1 5E1QA 2OCZA 1JUBA 3MYOA 1B3OA 1M7OA 3U2OA 3UD6A 1ML1A 1EIXA 5D2TA 1VYPX 1HG3A 1S3HA 3UZ5A 4LC6A 1R47A 4KWWA 1SSDA 4K8HA 4BK9A 3M1ZA 4O19A 4Y8FA 1BTMA 3G18A 4EVZA 4A22A 2V2DA 1SR9A 2BTMA 2O7QA 3ATYA 4HIBA 1F73A 3BGJA 2KZHA 4IMDA 2BWGA 4R33A 3UWUA 2A0NA 3E02A 1OFRA 3F4NA 4N9DA 2NV2A 3RK8A 3W7NA 4O13A 4N02A 3GXNA 3HG2A 4OQVA 5G2WA 4JN6A 3BG5A 3PVFA 2C0AA 2E5DA 4LVFA 5D2VA 1SSGA 5G4WA 4JS3A 4CNNA 4LOCA 1W5PA 3P80A 3CTLA 2E1DA 1JCJA 4LW7A 3TC7A 1O5KA 3M0ZA 2J9ZA 4JYDA 1OK4A 1QR7A 5K9DA 2GQ8A 5LNVA 3GLCA 5FF2A 1O5XA 1W37A 3LCHA 4DBDA 4Z1BA 4Z1CA 4LTSA 4NXKA 2Y7FA 4DQWA 4NJJA 3VKJA 1R30A 3SECA 3GKAA 4UXDA 3L0GA 5FF3A 3SZ8A 1YPIA 3C52A 3O06A 2YW4A 4RLIA 4IX0A 3TIMA 4QITA 2GUUA 3PR2A 1GVQA 1E51A 4DPQA 1AW5A 4KFNA 2VEIA 4NJGA 4YCOA 3STEA 3ABQA 1H7PA 1UASA 3LCIA 4XKYB 2Y85A 3L67A 3DFQA 1YYAA 3CQ0A 2G5WA 3KRUA 3JR2A 4HHPA 1OX4A 4MLJA 3GNDA 4GUFA 1GYNA 3I65A 1XDLA 3W7CA 1PHWA 3I68A 1W5OA 4NX0A 3DI0A 1DOSA 3W88A 3TAOA 5HINA 5LKYA 4U4MA 1SFLA 1K8ZA 1P0KA 4NX5A 1O94A 3L66A 3P5ZA 2IQTA 3R8RA 5DBUA 3V1PA 2ISSA 1U5JA 4UTTC 1EPXA 1SO3A 1FCUA 4LWWA 4R7JA 3GYEA 1TPDA 1WV2A 1SZNA 4EF8A 3NPXA 5CGQA 3TW7A 4TIMA 4IMCA 2NXHA 2X1UA 3DBPA 2JKPA 1LRQA 1X1ZA 4JTHA 2YYTA 5LHFA 2XFWA 5G2HA 4NJKA 4YXGA 4Z0SA 1QO2A 4N6EA 4JX4A 3CB8A 1ZCOA 3BLFA 2C6QA 2E6FA 1K7FA 1S5WA 3HG3A 4JIPA 2TRSA 3HO8A 3QMTA 1SO6A 3B06A 3LBCA 4XTDA 3RMJA 2HS6A 1PL9A 1KM0A 4XQ6A 3NR0A 1UUMA 2X1SA 4QM1A 1D3GA 2B7PA 1EWDA 4O1AA 4NQ1A 5LNWA 2FQIA 4KFPA 2ZZ1A 2ZRVA 4JGDA 5D05A 1M5WA 1PVNA 3HPZA 3NXFA 3EKLA 1LDCA 5HR7A 1EB3A 3W83A 4GJ1A 5HUPA 3W7OA 4P2VA 5D02A 3PSVA 1K02A 3S42A 1GG1A 3W2NA 4FO4A 3LV5A 3W7JA 3BLEA 1W5QA 3AJXA 4LS2A 2DZUA 3W73A 3NDOA 3NL5A 3PC0A 2Y61A 3PBUA 6ALDA 3G1FA 4UMCA 3CWNA 1TPVA 1KFEA 3R89A 1OF6A 2A6NA 1LRTA 3PB0A 3L0NA 3PUEA 2RKXA 2E68A 2VENA 4CCCA 5BOOA 2GPTA 4QQ3A 5D09A 2A6LA 1G7UA 3ANYA 1FXPA 1JUEA 2GOUA 3TNOA 3W2JA 3W7GA 4ZMGA 5AHMA 3W7IA 4WZHA 1P0NA 3MO7A 1OYAA 1A5SA 1QPNA 3N2XA 3O16A 1L6YA 3VCRA 4UMAA 3JS3A 3W7KA 4MZ8A 1VH7A 3QMSA 5EA9A 5I3HA 3ZWTA 4CNOA 3N14A 5LNUA 4TMBA 2V9DA 1UUOA 1W5NA 3IIPA 3GDRA 5A5WA 3W71A 4K7VA 3BV4A 3I7QA 2R94A 4O16A 3TV8A 4JDBA 3TJLA 3LRMA 4EF9A 2OX1A 2YDAA 4ONVA 3IGSA 3TROA 3RNDA 1F6KA 1NF7A 1RR2A 1XBYA 3QH2A 4K39A 3W7DA 4UUIA 3A23A 1K03A 4Y6GA 3TFCA 4NNCA 2E6DA 1RQHA 2Z1BA 1OABA 3L65A 3RFAA 2QUTA 3LRLA 1CX9A 1QFEA 3VI2A 3LCXA 4M19A 1KLYA 2WOQA 5G1TA 4AF0B 1TQXA 2C14A 3W7QA 2NX3A 3GDTA 4YMZA 3BO9A 3MBDA 1Q45A 1PIIA 1R46A 1ZJIA 3EWUA 4DF0A 1KFBA 1R2SA 5IBXA 2A1YA 1YPFA 1KV8A 2E77A 1GT8A 3W1LA 2CZ5A 1IF2A 3T55A 2Y62A 2HMCA 3UZJA 1ICSA 4HKPA 1GVSA 1K8XA 4Z0JA 2R14A 1NVMA 2NX1A 1VCFA 4RCXA 1QDSA 4UTMA 4WXYA 2JBMA 1B4KA 3KHJA 3E49A 2PE4A 4OV9A 4KKXA 3S5NA 1BEUA 3PULA 3WK0A 3MHFA 4M6QA 3LX9A 1GYLA 5HNRA 4WQ6A 3W2UA 3NQ7A 3P7YA 3K30A 1V5XA 4DO6A 3T40A 3Q37A 2X1TA 1FQ0A 2ZQ0A 3DFTA 3IGXA 1LOQA 4BF9A 3INPA 2OJPA 3MW7A 2YPIA 1K8YA 2YYUA 3TSDA 3NPVA 5CZJA 3PB2A 1ADOA 2J24A 4LV9A 3VFLA 3HB9A 4A3UA 1W3IA 3TAKA 4AH7A 2YGYA 3KVLA 2ZRWA 1KA9F 2A7RA 3A22A 4X3ZA 5AHLA 2QDGA 4JTLA 4WXZA 4O53A 3L21A 4BWLC 3KVKA 4WY0A 5C2XA 1MO0A 1PCWA 1THFD 2CLLA 3N34A 3OVRA 4X22A 5KTLA 1KFJA 1KV5A 3CC1A 4ADTA 4AMAA 3S1UA 1L6WA 3W1XA 2XN2A 1LROA 5AHNA 1WOBA 1KTNA 3LRKA 5AYYA 1EX5A 4HSNA 4M7TA 2C1HA 3N73A 3LXAA 6TIMA 1J5TA 3EWXA 4IOTA 4UTIA 1TIMA 3TUUA 1SW0A 1WA3A 1K7EA 1ZAHA 4CQ9A 4A2SA 4FB7A 3QSTA 4LVDA 4LVAA 3T78A 2VFGA 3NQ2A 3SY5A 5FEPA 2OT1A 1H5YA 1OF8A 3W2LA 1KM4A 3NVTA 2CZEA 4EIVA 4O17A 4Y9AA 4JICA 1GQNA 5FF4A 1KM3A 2ZDRA 4AWSA 2PURA 2YXGA 4WY0F 1VCGA 4JTSA 3M41A 3RU6A 1PE1A 4O8RA 1VR6A 3QM3A 5G2IA 3BG3A 5I3JA 1OK6A 4LV4A 4XBSA 4K8EA 3S0CA 2BX7A 2A21A 2QCEA 4O57A 2JGQA 5AN7A 2QCLA 1XBZA 4IX2A 2QJIA 4EWND 2VEPA 3EX3A 2I14A 1KFKA 2JKAA 3PSWA 5BW6A 2XN1A 4JTEA 3MHUA 3QC3A 1DVJA 3OBKA 3CIXA 2J88A 4M6PA 1H1YA 2B4GA 4O1CA 2NV1A 2Z0IA 5D32A 4A29A 5CZ0A 3HGJA 8TIMA 5KSWA 3O05A 4O18A 1VYSX 2G96A 1SUXA 3L68A 4P61A 4CCEA 4OGZA 3QW3A 3W2MA 4I9AA 2A7PA 4PODA 3DENA 1TB3A 1WDWA 2VEMA 2H3DA 1QMLA 1EWEA 4QISA 1OFAA 1YADA 3RF9A 1F7BA 1G4PA 1TPC1 3FA5A 1KTBA 3S1XA 4ICNA 4JNMA 4MJZA 4K37A 3EXSA 1AK5A 3S1WA 4LVBA 2ZRYA 1TYGA 1IXPA 3B04A 3MP4A 1EP1A 4POCA 3C61A 4QNWA 3W6YA 1ZAJA 3M5YA 2DJLA 2DP3A 3ATZA 3NQAA 3UY7A 1KLZA 1G6CA 1TPH1 4MYAA 4IMGA 1FWSA 1GZGA 4TU1A 1MSSA 1TPEA 2WNNA 3MJYA 4MFEA 4JYEA 2YZRA 4LRSA 2HS8A 2V2HA 1EP2A 2RFGA 4C1KA 4JIQA 4UR7A 3S5YA 2H6RA 3DHFA 3VE9A 5F4WA 4JYFA 2ABBA 3E9AA 3EX1A 5D30A 2HTMA 4N9BA 5AYXA 1OX4B 4I7VA 3B05A 4H4IA 3GR7A 3MP5A 3M5XA 3O8AA 3HMJG 2UV8G 3CPRA 2FPYA 4IWWA 3WFAA 3YPIA 5K2ZA 3ZR4A 3KFTA 3LM7A 4MFDA 3BVJA 5HUOA 4PEKA 1A5CA 5AOUA 3NL2A 3W72A 4AVFA 1XI3A 4WUIA 4AWTA 3F03K 3S5OA 1LOLA 1PCKA 4ZQMA 5D2XA 1GTHA 3BW3A 4N6FA 3TSBA 5CSRA 2Z6JA 2ZTJA 5LGXA 4JD4A 1Z48A 3USBA 5BMWA 2QCNA 4QAIA 3TKFA 5C54A 5F1VA 4YLWA 5CKSA 2ZA3A 2CLMA 2Q8ZA 3KVMA 3GZ3A 2TYSA 3SSJA 1LM1A 1VYRA 3TMQA 5KMYA 3MYPA 2PCQA 3EX4A 4BFAA 1VLWA 3O63A 3TK7A 5C5YA 2EF9A 4NNAA 1RD5A 4KWVA 3EXTA 4XTIA 3BW2A 4DF2A 1OFDA 2FFCA 3W1PA 3HBLA 1NEYA 4UNLA 4WOQA 1RQBA 1H7WA 2YCEA 3P67A 1XDMA 5AFDA 4MY8A 2ZYFA 4JR5A 4O11A 1FDZA 5U4NA 5CG7A 3FKRA 2TPSA 1J2WA 3P81A 3ABRA 4JTGA 1L2UA 4LY8A 3QQ0A 4LT9A 4MVAA 3S6DA 1JJKA 3O6CA 5F1UA 4FNUA 3UPWA 4MLRA 3FKKA 2E09A 3M9YA 3C6CA 1G4SA 2WQPA 5D38A 1I2PA 2BXVA 4J9JA 3OVPA 3G24A 4ZL1A 4A21A 2QAPA 3NA8A 4TMCA 1W5MA 2VC6A 1XM3A 3ABSA 3W70A 2QKFA 4FX8A 4ORMA 2GQAA 5HWJA 4Q32A 4GNJA 3W7RA 1H60A 5LSMA 3IRDA 5FEZA 3GX9A 3IIXA 4BI6A 2WSRA 4RKAA 1XKYA 3I6RA 1DL3A 1FBAA 3G1AA 3S9YA 3UWVA 5D2YA 5D37A 1FDYA 2QUVA 2GVGA 1W54A 4N4PA 5G4EA 3EX6A 4JX5A 1TMHA 4IUOA 1TRDA 4UCGA 4LS1A 1A5BA 3L5LA 1OFEA 3PAJA 3TX9A 2ATMA 1LRNA 1F2JA 1CI1A 3JRKA 4HSOA 3GR8A 2FIQA 1OFOA 2BZNA 5I3FA 2X30A 5K9XA 5U7SA 3F4WA 3FEMA 4PA8A 5FEWA 4CCDA 1F6PA 2A2IA 3WJZA 2EKCA 3PUDA 3UXAA 2FJKA 1AL7A 3DXIA 2Y88A 3A21A 3SFKA 4WJEA 4JTIA 1JCLA 1JQVA 3TH6A 3A24A 3SGZA 4UTJA 4JDYA 1HO1A 1O95A 3FLUA 3N19B 2ZRUA 4MZ1A 3C56A 5FEXA 1V7YA 5HULA 4QIUA 4Z08A 1JVNA 3NM3A 2V81A 3KRSA 4UTWA 5KZEA 4L4MA 4UIOA 5A8GA 1XFBA 2B7QA 3NQMA 3G0SA 1WOAA 2CZDA 1LORA 4O54A 1YTEA 3BG9A 4M5PA 1LYXA 3TFXA 5L9FA 3GDLA 2FDSA 2J27A 1G4EA 2P1FA 1L9WA 4MY1A 3TJXA 3P60A 1X1OA 1AG1O 3OIXA 1NF0A 2PRHA 1VLIA 2ABAA 3B4UA 3VNDA 5AC7A 3G0XA 4A2RA 1IXNA 2ATSA 3DH7A 1AMKA 1OYCA 5G5IA 4O12A 1OFPA 4M7SA 2ZFAA 4BR1A 3BK0A 3TR2A 1RZMA 1W0MA 1ME9A 4DXVA 1SZFA 3P61A 4AAJA 2CLKA 2WKJA 3NQ8A 5BMXA 3G1VA 2J9YA 1VCVA 1XUUA 5AHIA 5LNRA 2CW6A 1FDJA 4KFOA 4GUGA 4AEOA 3NQ6A 1Q6RA 3P74A 2E6YA 1I2RA 3P8JA 2DU2A 3W9ZA 4FXSA 1OX5A 1HL2A 3W7EA 1O4UA 1QWGA 3RLVA 2Z2UA 4W9TA 4UNKA 4PL1A 2RDWA 3MWAA 2YFOA 4PC8A 2ZCGA 1WXJA 4IXHA 1TJRA 4LS0A 3NQDA 1Z44A 2G97A 3SW6A 1ME8A 1QAPA 1TTIA 1W3TA 3E12A 5HJLA 2RHGA 1UB3A 2D73A 3W74A 3QSRA 2QR6A 5F2LA 4GXMA 4OU1A 4NT0A 2F84A 1X6UA 1MXSA 2C19A 1TPB1 5AC6A 3IGUA 1YTDA 3UPBA 5F4SA 2A5HA 4FX6M 3VE7A 2WPBA 3NZ1A 3GB6A 2Y7DA 3DFOA 3NNTA 1GJPA 1H61A 2W0UA 1R2TA 2V8ZA 5D2WA 4MYXA 2QCDA 4ZQRA 4RZ6A 1WQ5A 2TSYA 4MOZA 2C18A 2JGYA 1T96A 2ZZ6A 3S1VA 2XN0A 3W3OA 3M44A 4GFSA 4WY0B 3W1QA 3CEPA 3W2KA 1S5TA 1W1ZA 4IPJA 1ZFJA 3GDKA 2VKZG 3SGUA 1KM6A 4CQAA 4Z1AA 1YXYA 4JX6A 1MEIA 1QO5A 2VFEA 2DZPA 1A5AA 3PS7A 4UTLA 2QCFA 4NNBA 4UFJA 2WSQA 1C29A 1VJIA 2AAMA 4RX0A 2Q8LA 3LLFA 4JTTA 1DORA 1W3NA 2YSWA 2W6RA 4HPJA 3FJ6A 4EOUA 5DCEA 2C15A 4MIMA 1VGAA 3QRHA 3G1YA 3TA6A 3DZ1A 1ZNNA 1EUAA 2JK2A 4WD0A 1LBMA 1Q3NA 2Y70A 3EWBX 3W7HA 3EXRA 5FI8A 4R34A 4TX9A 5TQLA 5G1YA 4JY9A 1W31A 4L4LA 1KW1A 1FUYA 2QEZA 2Z6IA 3NQGA 3R12A 1W8SA 1JULA 1H50A 4NUWA 3MBFA 5KITA 4IXXA 1LLWA 2E6AA 5D04C 3EWYA 1WBHA 1IIGA 1DJNA 3H54A 3QZEA 1H62A 1QPOA 3THAA 3STCA 5K4ZA 3MI6A 3DHDA 3DFNA 3WJSA 4JTUA 2ISVA 4RZ4A 1FCQA 4UFHA 1FXQA 3EX2A 4GRSA 3UWWA 2TMDA 3FIGA 1N8FA 1F5ZA 2RH9A 2Y7EA 1UJPA 3W1MA 3I7RA 1M7PA 2NLIA 3OVQA 3LLDA 5ABTA 3LI1A 4DO4A 3IIVA 1JUKA 2X2GA 4AWUA 2QJHA 3W87A 3Q94A 1FY6A 1KBJA 2A4AA 5H2ZA 1SO5A 3B0VC 1H7OA 3LCLA 4I7WA 2ZA2A 4FXRA 3G1HA 5CSSA 1PHQA 4OV4A 1PV8A 3PG9A 3DKJA 3FS2A 2WJZA 1ME7A 3UXDA 5E93A 3CM4A 4FX7A 5D33A 1HO4A 1TRIA 5CPOA 3PY2A 1JQXA 3C0JA 3OEXA 4PH6A 5DLCA 3O1NA 5AYZA 1NFBA 3NQVA 4UMBA 1G69A 2ZBTA 2V5BA 3WK2A 4O1BA 3TW6A 3U6WA 4O1DA 4YL2A 1RVGA 1YDOA 4NJHA 3W86A 4E2DA 3W84A 3S8HA 1NSJA 3HJZA 5EKYA 2RDUA 1SQ7A 2ZZ7A 5EPDA 1SU5A 3W23A 4RZ5A 5L6UA 1LZOA 2NWRA 3IVUA 5K7JA 1I4NA 3A5VA 4AHQA 1MEWA 3QMRA 3WK1A 4NZFA 2Y7GA 4HNUA 3TMLA 2ZA1A 1KFCA 3LCGA 4GUJA 1HUVA 4O0ZA 3TU9A 2X1RA 1Q6LA 3IIZA 1H7NA 1YTKA 5TBOA 5DBTA 5C55A 3PUOA 3LV6A 3HQ1A 4JEQA 3TQKA 4FIRA 3HG5A 1DV7A 4O28A 1D3HA 2ZTKA 3LTPA 4FNTA 2NXIA 2VFHA 4FIQA 3UYCA 4H3DA 1TV8A 4UTTA 2V2CA 4ML9A 3EEGA 3TXVA 3I7SA 3P5YA 1GG0A 1ICPA 2QF7A 3MMTA 1W56A 4OHQA 3HGOA 1VHNA 4LC8A 2Q3OA 3NL3A 4O4WA 1EEPA 4U28A 3ZFHA 4DEFA 5IM51 1WYIA 2NXGA 4H6KA 3C2EA 3MI3A 2I1OA 3PF3A 3KXQA 2QUUA 2B7OA 3A9IA 5DCBA 2A85A 3QPYA 4Z1DA 4O10A 4AHOA 5AHEA 2VEKA 4OT7A 1SW7A 4GUIA 1QOQA 4K36A 1LOSA 3E96A 1IIHA 4HNNA 3HPXA 1ICQA 4UTUA 3N9SA 1G7VA 5FESA 1SW3A 1TV7A 3W7MA 3UWZA 5IBXC 1VS1A 3B0UX 4N9EA 5EMUA 4WX2A 1JCMP 3O6YX 2DZSA 2YW3A 3TSMA 1T8XA 2C13A 4NVTA 3HGRA 2YX0A 4N2YA 5I3IA 4FNRA 4K7YA 5HWMA 1T99A 3C2FA 3SR7A 5BNKA 3NPUA 4DPPA 1TSIA 4O4VA 3M6YA 4BI7A 1IXOA 2WV8A 1OFBA 3KX6A 2EGZA 5DY2A 3BARA 5DY3A 5CZTA 2Y63A 3IV3A 3GNNA 5SWUA 4XUGA 1KTCA 1WBJA 1B9BA 1G4TA 2ZZ5A 4X9SA 5KZDA 1TQJA 4IMEA 2JKEA 3W85A 1PS9A 1IXQA 1XL9A 3IEBA 3A5FA 1JR1A 1Q6QA 4IMFA 5KINA 3LHYA 1JRCA 5DN1A 2H8ZA 2PRLA 3G1SA 1GVRA 3GXPA 4S1FA 3CEUA 2H8XA 5AB3A 4E38A 5HMSA 1RQEA 4HT3A 1VQTA 2VXNA 2FPTA 1ZENA 4YCPA 1X8FA 3LCFA 2A7NA 2BLEA 2HSAA 2E5CA 2FLIA 2Q3RA 3N9RA 1AL8A 1HFBA 3GXTA 7TIMA 4N9CA 4I7UA 1AW2A 1TO3A 4GWEA 4ZQNA 3ZS4A 1F74A 1ZHAA 2CZFA 3QQ1A 1I2OA 3KOFA 3NQFA 1BWLA 4UFMA 1LTDA 3W1AA 4X2RA 1KM1A 3STFA 3LHVA 3NGJA 3EWZA 2VELA 3FJLA 4XBKA 3CHVA 1VHCA 3QJAA 1GVFA 2C3ZA 3H55A 3Q2DA 2ISWA 2J6XA 4BI5A 2AGKA 3HOJA 5J5DA 2VOMA 2I9EA 3W7PA 2PC4A 4ADSA 3UWQA 2CLFA 2VFIA 3QW4B 3T44A 1F05A 4S2CA 2G95A 1G67A 1YXDA 1F76A 3P8IA 1T0OA 4AB4A 1R2RA 4K38A 1SZEA 3G8RA 3L5AA 4JTKA 2OMAA 3L5MA 5F2MA 5I3KA 2FTPA 3LI0A 4FNQA 5F2GA 2P10A 5LZLA 1DQWA 3UNDA 4JY8A 1TPWA 3LXCA 4FNSA 2CFFA 4ZVJA 4Q33A 4HNVA 2VFDA 3G3MA 4OBTA 1C8VA 2J9XA 5DELA 4NU7A 3CWOX 3CT7A 2GQ9A 4UC5A 1OYBA 3ELFA 1A50A 4ZQOA 4ALDA 3LCWA 4E0CA 3NM1A 3G22A 4FEZA 2QJGA 1JRBA 1I2NA 5GVJA 4IGHA 1K3UA 1VC4A 1XC4A 4G1KA 3NEVA 3OG3A 1M6JA 2FPVA 1OVDA 4Y90A 3NL6A 5I3GA 3PBYA 4LUIA 3IVTA 2ALDA 3M5ZA 3LTYA 5EYWA 4O0KA 4N4QA 1OHLA 1AW1A 2H90A 3DU0A 4BWLA 3LB0A 5F4XA 4Q4KA 3STGA 3Q58A 3HPSA 3M47A 1B4EA 2NWSA 3W1TA 4LVGA 1QNVA 3EB2A 2QCDB 4RR4A 2GVJA 1SO4A 3PWAA 5DCDA 3NQCA 3LHTA 2VFFA 3NOEA 1H1ZA 3LERA 3C8FA 5LNSA 4XKYA 3S5ZA 3HG4A 3N3MA 3W75A 2CLHA 3FOKA 3C2VA 3CU2A 3ZWSA 4TO8A 4GE8A 3PG8A 1EA0A 3MP3A 1DBTA 4DF1A 3O6DA 1FWNA 1FCVA 4OE7A 1I45A 1OFQA 4XWUA 2WSYA 5E0KA 1CW2A 4RJEA 4GC4A 1FCBA 5CPMA 3P84A 5MHBA 1SFJA 3D0CA 3W76A 4JXCA 3RLUA 1YLVA 4UR8A 3UWYA 4ZZ9A 3MI2A 3C2OA 4HPXA 3WJYA 3G1DA 4RXFA 2NUXA 4RXGA 1D9EA 3TE9A 4ORIA 1YDVA 1JCYA 1H63A 1FX6A 1DHPA 3TC6A 1XBVA 5CZSA 2FB2A 3R5EA 4QSHA 4LUJA 2YR1A 1BKSA 3BGGA 2CWNA 3SI9A 4LU0A 2X16A 1MEHA 2V30A 1DQXA 3LTSA 3N2MA 2WO5A 2WNZA 4ZQCA 2CLIA 1UBSA 2O7SA 4YWIA 3QPZA 1IGSA 4O50A 1Z41A 2OZ0A 3QEZA 3EWWA 4D2JA 1QCWA 5DXXA 3QF0A 1UCWA 3WJXA 3LHUA 2GVLA 3FYPA 4IPIA 2B0MA 4DBEA 1KBIA 5D03A 1YXCA 4Y96A 1JCNA 1ONRA 3GIYA 3MHGA 4TR9A 2NUWA 1GPWA 1WAUA 3MUXA 1FWTA 1H51A 3KAOA 3C2RA 3NQEA 4CQ8A 4DELA 2DZXA 1DJQA 2QCCA 3GK0A 1LCOA 4CLMA 4UTKA 3O07A 3BPWA 3LDVA 1P5BA 1P1XA 4ZQPA 1EP3A 4MPQA 3HF3A 1TTQA 1EUNA 1Z42A 1P4CA 4M6VA 1N7KA 3CIWA 3UY8A 4UFIA 3B0PA 5FF0A 4AXKA 3UQNA 1Y0EA 3G1XA 4PCFA 1LP6A 5BRBA 1ZY9A 4C1LA 2NUYA 4PFMA 5HWNA 2FB3A 3DAQA 1OX6A 1H7RA 3OA3A 5F2IA 3NYZA 3EKZA 1TTPA 3P62A 5EBUA 1DKWA 3G3DA 2QCMA 1S5VA 1XCFA 3L9CA 3LHWA 2AQWA 3DI1A 3L0KA 2WNQA 2GJLA 3PM6A 2DZWA 4O14A 4IQLA 3GAYA 3C3NA 4E2BA 3PBVA 4RV8A 4CNPA 2QCGA 1QPRA 3QFEA 2NZLA 1B57A 4MY9A 3FYOA 3V75A 5C6MA 3OHIA 5HR6A 1GEQA 2DJXA 3G8EA 2QCHA 4B5NA 4LRTA 1SPQA 4UTWC 4QJ1A 3NPWA 3CLMA 3M7WA 3E0IA 1H7XA 3GAKA 1GVOA 2V0TA 3NG3A 3NZRA 1XUZA 1L6SA 2LLEA 4UFLA 3W07A 1C9DA 3T4CA 2H3BA 1ALDA 4NXSA 3KRZA 1ZAIA 3DGRA 4AF0A 2OT0A 5LHEA 2V5LA 3LXBA 2CLEA 4PTNA 1KM5A 1QOPA 4R53A 3QYQA 1J4EA 3LOTA 1TPFA 3BW4A 4HNTA 1LBLA 4JTFA 3W7LA 2DZTA 3AO0A 3O15A 1Q6OA 1TCDA 3W22A 1TJPA 3BLIA 1WX0A 3M5VA 3IVSA 5FF7A 1I2QA 4MKNA 1FWWA 1LBFA 2EHHA 3M16A 2W79A 4FNPA 1QPQA 4IJBA 3TCEA 4NJIA 2YFNA 2RDTA 3DFPA 3GVGA 2B7NA 1ZALA 1KFLA 5LGZA 2QAFA 2ZZ4A 2GJNA 4PL2A 1XXXA 5EL1A 4QNEA 3W1UA 4XZ9A 1A53A 4O52A 2EPHA 3ABOA 5KZMA 3GDMA 3L2IA 2C16A 1VRDA 5K3VA 3TXZA 2DZVA 2ZZ3A 1OG0A 4HN4A 1HTIA 1VPXA 3LHZA 4GBUA 5EY5A 3GKFA 1GTEA 1FWRA 3FFSA 3HIJA 5AHFA 4WOZA
chains in the Genus database with same CATH superfamily
2ZX6A 1QT1A 2E5BA 4B3ZA 3W1RA 5HQEA 2CLOA 3VVGA 4A3QA 1UQYA 2ZRZA 4RK8A 1OT2A 3WY1A 5J5RA 3PN8A 4UFKA 4M1BA 1XLGA 4P7RA 6TAAA 2HVMA 1XBXA 3QR1A 2P88A 3AYVA 3MT1A 4CEXC 3T7VA 2CKSA 2EG7A 2DSUA 5A8MA 1K6WA 3W1NA 3MVIA 2G37A 1IEQA 4MZYA 4BEUA 1TR9A 3DFSA 2I5IA 1N55A 3OZOA 4IZGA 2EAWA 2DV0A 5FSEC 1K7XA 1O60A 2CU0A 3ZLFA 5JBDA 1GOWA 2PRMA 2FTWA 3K8KA 4YN5A 3G6MA 4FHAA 3WJWA 4GUHA 4UTHA 3ENLA 1ISXA 1SZGA 4C1NB 3AOFA 3F1QA 5HJXA 3SIZA 5CPLA 3VC6A 3TQ0A 3EA1A 1Q85A 4QG8A 3T07A 3THQA 2ZUWA 5EMJA 1M7OA 3U2OA 1ML1A 3EDFA 4LC6A 1H2JA 1AJZA 4LJ3A 4BK9A 4YVVA 3CYVA 1E15A 1SR9A 3R1ZA 4KWSA 2VVNA 4QFUA 4IMDA 4UQEA 2WAGA 4GCXA 3E02A 3WDPP 3B8IA 3VU2A 3W24A 3F4NA 1JI2A 1ZBWA 3QYSA 4A3RA 4A4AA 4N02A 1UKSA 1Z32X 5G2WA 1R9ZA 2C0AA 1SSGA 4QE4A 4CNNA 2PD5A 1XLAA 1DWFM 4MWAD 1QW8A 2EEXA 1UR1A 3GLCA 3TYZA 1W37A 1RCQA 3BAIA 3R10A 4TVDA 1A47A 5C2CA 2HJPA 4Z1BA 3VPLA 3VKJA 2D2HA 3WH5A 3GKAA 4UXDA 3C52A 1BKHA 3O06A 1BRLB 3TIMA 2GUUA 1GVQA 4S3FA 4DPQA 4F0RA 3WLKX 4NJGA 1MRQA 2J62A 1E6ZA 3CV1A 2ZX5A 1UR2A 3L4YA 3KTCA 1WP6A 1XIHA 1Q6FA 1IQ8A 4AZCA 2ZE0A 3GNDA 4AY8A 4GUFA 2WHMA 3DG3A 1V93A 2PDQA 1XDLA 1PHWA 3DI0A 1QHOA 1MUWA 1DOSA 1Z89A 4O8AA 4ZO8A 3ITOA 1D2KA 3NYDA 4U4MA 5HINA 3QGAC 4F66A 3U7BA 4NX5A 3I3BA 5HPCA 3RX3A 1EZ2A 2RGMA 2R1PA 2NSXA 1TELA 3H23A 2ZKMX 4XAGA 3MC5A 3EAUA 5A8QA 4EF8A 4DO7A 4W5ZA 4IMCA 3QKEA 3REQB 1X1ZA 4JCMA 1FWIC 5CBIA 2O56A 3CB8A 3BLFA 1ESWA 1O1HA 4P8XA 4JIPA 5I02A 2NQHA 4E4UA 3QY6A 3T8LA 1DTUA 4QQUA 3LBCA 1DJXA 1IGWA 1E1CB 1W9XA 4KCTA 1PL9A 2VCCA 1Q6EA 3GU1A 3NR0A 1MW1A 3ZSSA 2B7PA 1E3XA 2P3ZA 3WENA 2ZRVA 3GNRA 3LA4A 4NKCA 4PUDA 1M5WA 1LDCA 2CBIA 1E1FA 4I6KA 4P2VA 1GGOA 3PSVA 3W2NA 1BYDA 1QNQA 1YDYA 3GHTA 4H7ZA 4HNCA 4FSAA 4M29A 4PTWA 1L8PA 1TWIA 2Y61A 4I8DA 4UOZA 6ALDA 1F8IA 4XZHA 4UMCA 3CWNA 1GOMA 2D2JA 1TPVA 2X41A 1W1PA 5G4HC 1UWAA 2GJRA 1LRTA 3EPMA 1A4MA 4JFUA 1R86A 3PB0A 2VENA 4CCCA 4INFA 1PUDA 3O2LA 4V33A 3DYMA 4BCEA 1G7UA 1EH9A 4PSRA 2PDXA 3GSMA 3MTWA 1XH0A 3W7GA 2VRJA 4ZMGA 3CTTA 5AHMA 3N2XA 1A5SA 4KMQA 1TV3A 4UMAA 3JS3A 3W7KA 1VH7A 4XIMA 2YBUA 2WMGA 3N14A 5LNUA 1NQ6A 1UUOA 1W5NA 2W3ZA 1FWCC 4Q6XA 2BP1A 3I7QA 3TJLA 1UD4A 4XD3A 1TZ9A 3TZNA 1IEXA 1XIDA 1F6KA 1RR2A 4K39A 3IARA 4JTQA 5FIPA 4H9XA 3JUGA 1HP5A 1JNEA 1EGVA 3L12A 3SFWA 2QUTA 1R9XA 1CX9A 5G1TA 4AF0B 1TQXA 3GDTA 2BVDA 3MBDA 4MG4A 1ISYA 1AFSA 4GZJA 1R46A 4B92A 4OTKA 3PPHA 1R2SA 1JZ6A 1GT8A 2GFTA 1IF2A 1O68A 2Y62A 4D72A 2HWGA 1ICSA 5FJIA 2XWEA 4DXXA 2J25A 2R14A 1NVMA 2NX1A 4C90A 1B4KA 3T0BA 4GBDA 4KKXA 3S5NA 1OC6A 3UJRA 2OODA 3WK0A 3MHFA 1O5RA 3LX9A 3HQNA 4WQ6A 3NQ7A 3N18A 3K30A 3ITXA 3ZT6A 1HVXA 1EGMA 2WW5A 3T40A 3IGXA 4BF9A 3VOGA 2X40A 2YPIA 3TSDA 2YYUA 2J24A 1W3IA 3UZXA 1DE5A 1ADSA 1H4PA 3KVLA 1CNVA 3A22A 1PZ2A 4LFYA 3CAVA 3XISA 4WXZA 3L21A 4BWLC 3N29A 4DYEA 3OVRA 1JAKA 2V5JA 4GIEA 4QDPA 3SUUA 3V4BA 3APYA 3AZTA 1L6FA 1JF5A 1L6WA 7ENLA 3LRKA 5AYYA 2C1HA 1ZRQA 2PDFA 1XG3A 1J5TA 1UWTA 2PDHA 3AWOA 1XLKA 1WA3A 3MMWA 3GVVA 1ZAHA 3RRXA 4A2SA 3QSTA 2HBVA 1E1EA 1VFTA 3ZYZA 2OT1A 4B16A 1RPKA 1OF8A 6A3HA 2PU1A 2X7VA 1EC7A 4F2TA 4EIVA 3OZPA 4DNHA 5XINA 4OBSA 2X0HA 4C6MA 3A9BA 3KOYA 1CLXA 4AWSA 2YXGA 4WY0F 1PE1A 3GO2A 1VR6A 4ROPA 1KWGA 5I3JA 3EDEA 4JFTA 2A21A 2JGQA 3LUTA 3KE0A 3EOEA 1GOKA 4IX2A 3GXIA 1XLJA 2QJIA 2BS9A 2Z7GA 3PSWA 2XN1A 2P53A 4JTEA 4PCPA 1H1YA 2B4GA 3VKKA 4HYRA 5M2FX 5D32A 8TIMA 4E4FA 3L68A 3W2MA 3BTNA 1WDSA 1LQAA 2A7PA 3TYDA 5C2GA 2H3DA 1EWEA 1OFAA 3RF9A 4A6GA 1TPC1 3FGCA 1KTBA 3BLPX 4ICNA 4K37A 1AK5A 4LVBA 1TYGA 3MP4A 4G9PA 3TJIA 4QNWA 6XIAA 2ACSA 3W6YA 1OSEA 3R7MA 1MRAA 1RA0A 1TE1A 3PZTA 1B3YA 1ZAJA 4XZBA 2YJQA 1XPYA 1KLZA 4XUYA 1G6CA 3UXLA 1HVQA 4LH8A 1TPEA 4JKLA 4PMDA 4MFEA 4JYEA 2HS8A 1EP2A 4UR7A 2VCAA 5F4WA 4CD8A 5KETA 3L2MA 3E9AA 3OBEA 3R94A 3CH9A 5D30A 5FJRA 3MSYA 4LQ1A 4HZ6A 4I7VA 3SAZA 1G01A 1RHCA 2C71A 2UV8G 3AXKA 3PBMA 3W53A 2PU0A 3BVJA 4L1XA 2OYLA 3W6MA 3AHVA 3LPOA 1A5CA 3THDA 3NCOA 4WUIA 1R3SA 1GTHA 3BW3A 4N6FA 1BD0A 4A35A 2V63A 3USBA 5BMWA 1OCQA 1CB7B 3VGEA 3S6OA 4QAIA 4YLWA 2ZA3A 4V15A 2PLCA 2Q8ZA 3GZ3A 1M3UA 5FKYA 4XO6A 1ZBVA 1LWHA 1J96A 5KMYA 3MYPA 2BGSA 2G3NA 3ITCA 5C5YA 4B90A 4XKMA 3VIPA 4KWVA 3F7JA 1RSCA 3BW2A 1HKJA 4U3AA 1VEMA 1AQFA 4PMVA 1HKMA 4UNLA 1RQBA 3WQFA 1JZ8A 1XDMA 1S38A 2ZYFA 4JR5A 4O11A 4XAZA 3WNKA 2PF0A 1QJWA 5CG7A 1J2WA 4ZTYA 3NZPA 3LQLA 3T09A 1A3XA 1MI3A 3HMCA 1TJ2A 4R7OA 4LT9A 2AKZA 1UC5A 4AD1A 3UPWA 1DYSA 3M46A 5I24A 1XFCA 2QAPA 3CUXA 5D9NA 3FNDA 4C6OA 4RDZA 2VC6A 3USZA 3W70A 2QKFA 4ZODA 3WBWA 4GNJA 3ZLHA 4F0HA 3VDAA 3C0QA 2ACQA 3IJIA 5FEZA 5HOSA 1BVNP 4BI6A 2WSRA 3BSMA 3BOLA 3I6RA 1SJAA 2Z1KA 3S9YA 1ZBCA 3UG8A 1JPDX 1ZP4A 3WLOA 3VIGA 4UCGA 1TRDA 1QOXA 1OFEA 3PAJA 1LRNA 2VRQA 3JRKA 4HSOA 3RG6A 2Z00A 4C6LA 4AY1A 1CIUA 1BSIA 4XK2A 3EMZA 2OGYA 3F4WA 1EO7A 5FEWA 2PDBA 2A2IA 3TNBA 2EKCA 3PUDA 3UXAA 3U2EA 4G56A 1EDTA 3DXIA 2Y88A 4JTIA 2G8ZA 4JDYA 1VBJA 2ZRUA 2CC0A 5HULA 4MGGA 3KRSA 3GTIA 4WRHA 4L4MA 4UIOA 5CC5A 2B7QA 1P6BA 4JKMA 2CZDA 4O54A 1YTEA 1K9EA 4PYSA 3ABXA 5CQ1A 5A6MA 1XRFA 3GDLA 4JIHA 2J27A 1L9WA 1D8WA 5CG0A 5ECUA 1PO9A 3TJXA 5LXEA 1IV8A 1VLIA 2PDJA 3B4UA 5AC7A 2WNWA 3E5PA 2ATSA 3MDWA 3GG0A 4FMVA 4YTTA 4O12A 4K8GA 1UIPA 4LYPA 4RUBA 3TZFA 1D7KA 3FYYA 4CD4A 1KBKA 5DT7A 1W0MA 7ODCA 3SN1A 4DXVA 2HISA 5AZ0A 1KB3A 4MAVA 4AAJA 2CLKA 5BMXA 4GIRA 2FGLA 2J9YA 5LNRA 1AA1B 1WDRA 1I2RA 4IG2A 1XLDA 4Q3MA 1KRMA 4FR6A 3QLLA 4UNKA 4PL1A 2RDWA 1A3WA 2ZCGA 1WXJA 3NQDA 1Z44A 3T08A 1QAPA 1W3TA 1FTXA 2D73A 5DF0A 3W74A 4Z1YA 5F2LA 2E9BA 4GXMA 4WJ8A 2EPMX 4HB7A 1MXSA 3H22A 3NEHA 3VOHA 3EWCA 3R58A 4RNFA 5F4SA 2GOKA 4FX6M 4REQA 4Q4PA 2WPBA 3NZ1A 1CT5A 1RA5A 3ZZ1A 3NNTA 1A3HA 1R2TA 1XRVA 2JEQA 4MYXA 4ZSUA 2QCDA 5DFAA 1V0NA 1HW6A 3UGVA 3UCQA 1FKWA 1T96A 3S1VA 1EJSC 2BHYA 1YQ2A 3W3OA 3M44A 2VR5A 5AY7A 1W3LA 3TA9A 3W1QA 3P2VA 1W1ZA 3UEQA 3S2MA 4B9ZA 2VKZG 1NFPA 4HCLA 4CQAA 1OBAA 1J8VA 1YXYA 1MEIA 4Q4MA 4LYQA 3PS7A 1DPMA 4AIOA 3E3HA 4G2DA 5HQLA 2WSQA 1VJIA 1QVBA 1XYFA 2Q8LA 3LLFA 4JTTA 1W3NA 3C3UA 1QBAA 1JIBA 4EOUA 1XX1A 2DW7A 3V5OA 3DZ1A 2YLAA 1EUAA 4WD0A 1Q3NA 2Y70A 1KCKA 3HZ3A 4TX9A 4R7WA 1SFTA 3LU2A 4JY9A 4LX4A 5G1YA 2I5QA 4G7FA 1AUSL 1W2PA 3W38A 1PIFA 3MBFA 4CKQA 1M9HA 1UMLA 4IXXA 3UT0A 2E6AA 1AD4A 1PTAA 1WBHA 2NQ9A 4DM1A 4W87A 1WB0A 4LCRA 1ECQA 3A13A 3CASA 1J93A 4U5IA 2WVVA 4UFHA 5I78A 4GZEA 1R9YA 2DH3A 4GRSA 4MB4A 3H2NA 3WL0A 2FGBA 4R5EA 4DBUA 2FZ9A 3L7RA 3K2GA 3LI1A 4DO4A 1JUKA 4AWUA 4X0NA 5FJPA 3QN3A 2P0IA 3TOYA 4OIFA 2ZA2A 1RK5A 3XIMA 1HGWA 3URQA 1RJRA 1AZ2A 1WXYA 4OV4A 3PG9A 2DZAA 3TC3A 3MSDA 1TWSA 2Z1SA 3POHA 1V6XA 2Y5SA 4FX7A 2OTDA 5A6AA 3C0JA 3FGCB 3FSTA 3AIEA 3O1NA 5AYZA 3QXBA 4C6NA 1WDPA 1M41A 2QMKA 4UMBA 2ZBTA 2V5BA 3CPGA 1YDOA 4MDPA 4E2DA 3S8HA 4H9UA 1F4AA 3LBOA 3IVUA 3RUBL 1I4NA 3A5VA 4LAKA 3WK1A 2Y7GA 1MXGA 3WF2A 1XGZA 1QNOA 3UGRA 1HUVA 3IIZA 1J0IA 2TODA 1YTKA 2WVUA 5C55A 3LV6A 3HQ1A 4RE4A 3WQOA 4RDVA 3TQKA 4CNSA 4UCFA 2BOEX 5DMMA 3HM7A 3T0DA 3GDBA 5PTDA 3SCVA 3LTPA 2F9RA 2NXIA 4FIQA 3MKVA 4H3DA 2V2CA 3CK5A 4PTMA 2PDNA 2P8BA 3I7SA 2V5CA 3MMTA 3MU7A 3WH6A 3CPUA 4QJ3B 3HPAA 4AEFA 1Z9AA 4GACA 1UKOA 2NXGA 3HTWA 3BCJA 2XINA 3A9IA 4JNYA 4BHYA 2OKOA 4QCEA 3VD4A 2PZNA 3JVAA 3IANA 4Z1DA 2IKIA 3KUMA 3CWHA 4OKDA 2GLKA 2G4JA 3HPXA 2ANUA 3M6DA 1JZ3A 1TVPA 4KEVA 4TTUA 1SW3A 1TV7A 1KNWA 2PGEA 4Z2IA 2TAAA 3PTQA 4WX2A 5EMUA 2V69A 2ZXDA 1HL9A 2DZSA 5EB8A 3ZT7A 2A3EA 4AZ7A 2J79A 1KXQA 4K7YA 5CC7A 4LALA 4JTAA 1AODA 4JQ4A 4GIAA 5BNKA 1KRAC 4XBJA 1NU5A 1HGYA 3FN9A 1FHUA 1J6OA 3SCNA 2EGZA 3WF0A 5DY2A 1NH6A 2PP0A 1VBGA 2Q6ZA 3AMKA 1B9BA 1TJ0A 1G4TA 1UD8A 2BOGX 3N4FA 3E1F1 3F5JA 6CGTA 5HQMA 1IR2A 4HK7A 2PLJA 3A4JA 1JR1A 1BQGA 1GEHA 1JRCA 3OYZA 1UR8A 4M51A 1YX1A 5DN1A 3BZJA 4ZE5A 4GNKB 1GVRA 4L9ZA 4S1FA 2O0TA 1C92A 2XIJA 3URAA 1VQTA 2VXNA 4YCPA 1X8FA 2A7NA 2E5CA 3CHDA 1KXVA 2Q3RA 1SFSA 5TAOA 1HFBA 4D6FA 3TYAA 4I7UA 1TO3A 3VABA 3V7PA 3F4VA 1I2OA 3C8NA 3WN6A 3KOFA 3NQFA 3CAKA 1BWLA 1LTDA 4X2RA 1SR0A 3TOPA 3FDKA 4CEUC 4XBKA 1UH4A 3GG7A 2XWDA 3KOWA 3F2DA 3RITA 3CQJA 2AGKA 4NL1A 3IJ9A 5FCZA 3B0YA 4GO9A 4GVGA 5FJJA 4G5DA 1TMLA 3LNMA 3IJ8A 2I9EA 3W7PA 3ARXA 3UG4A 2VP8A 3T44A 2PDYA 4S2CA 1TG7A 2J6VA 1CLKA 4KWUA 2QF8A 4Q7BA 4J2PA 1SMDA 1H1NA 4AB4A 4K38A 3L5AA 3WFLA 4JTDA 3KS5A 3WQVA 5F2GA 1DQWA 3UNDA 4RNIA 3C2YA 3D6NA 2VFDA 4GQ0A 4XSLA 1C8VA 2PBGA 1EC8A 4QEHA 4NU7A 3CWOX 4FS9A 2Y2WA 2QPSA 3M7SA 1OYBA 1A50A 1OADA 3NTYA 3LCWA 5LYRA 1RALA 4MNMA 5FAJA 1JRBA 3QVQA 1ELSA 4AZGA 1VC4A 1XC4A 3DC8A 3DESA 4G1KA 2ZUNA 1AD1A 3E0VA 3OG3A 1A80A 2GZXA 2FPVA 2QHAA 4DAFA 5C9XA 4Q4SA 1W17A 3PBYA 4LUIA 3A4XA 3VIIA 4WKHA 1R3TA 5EYWA 4AZBA 4TV6A 3R43A 4YTQA 5CJ5A 2V68A 4REQB 3CO4A 3P3BA 3LB0A 2OYKA 4Q4KA 4U31A 3VNZA 3STGA 3HPSA 1PBGA 1R85A 4PRRA 3EB4A 2NWSA 3W1TA 2QCDB 1FWFC 4ZB5A 2GVJA 1H49A 3LHTA 1Q8AA 5LNSA 3DERA 4XKYA 3N2TA 3HG4A 3TQPA 3ZVIA 1XIGA 4GCAA 3LMZA 4B15A 2CLHA 4FOUA 9CGTA 2JF7A 3CLWA 3R11A 5EBAA 8A3HA 1E5NA 2ADAA 1NQKA 1UH3A 1PZ0A 4DF1A 4QDMA 1GQLA 1ITUA 4OE7A 3HFTA 2J7BA 4R9OA 5T9BG 5E6YA 3UPMA 3BE7A 2VEFA 4GH1A 4PUWA 3RN6A 4MAZA 1CW2A 4RJEA 4E8GA 2CKRA 4GC4A 5MHBA 3P84A 4MWAC 3D0CA 3MUZ1 4PCNA 3RLUA 2FZ8A 4FLQA 4HPXA 4RXGA 3TE9A 3SCRA 4J7RA 1JCYA 4D6GA 9RUBA 3DG6A 2HV5A 1XBVA 3W4RA 5CZSA 4QSHA 3R5EA 4Y9MA 1QK2A 1V0MA 1PYMA 3BGGA 3AXMA 1FWEC 3SI9A 2X16A 3W26A 2PLMA 1PX3A 3EZ4A 1FH7A 1QNSA 2CLIA 1UR9A 4L1WA 8XIAA 5C8BB 2O7SA 1TV2A 2D22A 4K68A 2WVVB 3QPZA 2E8ZA 1ECEA 3EWWA 3VX1A 3ABZA 3R8GA 3ARPA 3QF0A 1RBAA 3WJXA 2POTA 4GG9A 1DQUA 3LHUA 1A4LA 2AL2B 1YXCA 2W4XA 2VNCA 3MHGA 2NUWA 1VD6A 4YNGA 3SCOA 2A3LA 2VO5A 3T2PA 3NQEA 2YA0A 1DJQA 3S6TA 3V0SA 1TWDA 3IJLA 4IFOA 1KXTA 4NZ1A 1EP3A 3HF3A 4JKKA 2GGHA 4M6VA 3LG3A 4UFIA 3B0PA 5FF0A 4AXKA 3UQNA 4PCFA 3VDGA 1ZY9A 2WZHA 5C0QA 1S2TA 4PFMA 3AWNA 5HWNA 3ORWA 1OX6A 3OA3A 5F2IA 4ES4A 4S3GA 4B5UA 1XDJA 4BQ4A 2WLZA 1FWJC 2HK1A 1EQCA 2QCMA 1XCFA 5FAGA 2WMIB 3T1GA 3U57A 2AQWA 2V3FA 2WNQA 2GJLA 4Q22A 4O1EA 3ZMRA 3IACA 3ZQ9A 5TF0A 5I77A 2DZWA 7REQA 2F6KA 4CNTA 1SMAA 3PBVA 1UPPA 1V6VA 4UOJA 2QCGA 3BLKA 3QFEA 1JPIA 3VIFA 4BY3A 3FYOA 3V75A 4I6VA 5C6MA 3OHIA 2OG9A 1EL3A 4HTYA 3CZGA 2JE8A 3CLMA 1A5NC 3M7WA 4XAYA 4CUCA 1H7XA 3GAKA 4TOQA 1KKOA 4TX8A 3RM4A 3PUGA 4TXEA 3KRZA 2HQAA 4XVDA 4Y9OA 1GVIA 3DGRA 2OT0A 1H09A 1PX4A 2PLKA 3SGGA 4K2SA 1QOPA 2W91A 3U5UA 1ZCCA 1LBLA 3W7LA 3AO0A 3O15A 2VD9A 3W22A 3BLIA 1WX0A 2Y8UA 3M5VA 4Y9PA 1XYZA 5FF7A 1FWWA 1LBFA 2EHHA 3M16A 1J0HA 4IJBA 3MO4A 3KDOA 3ARQA 2FZMA 5BRQA 4H2HA 3TTSA 2B7NA 1KFLA 2GJNA 4PL2A 4Z2JA 1XXXA 1B31A 3SUTA 4ATDA 5EL1A 1NOUA 4QNEA 3W1UA 1A53A 1ODZA 1U1HA 3TJ4A 4B3LA 1VRDA 1RVKA 2OGJA 4EXBA 2W62A 1VPXA 3DYPA 1MMFA 5EY5A 4UQDA 5E9AA 3GKFA 4MDOA 3HIJA 3EDJA 5AHFA 4US5A 5ABGA 4MUZA 3M43A 3N12A 3VKDA 4LNYA 4JQ1A 1QUMA 2GSHA 2CERA 1O66A 3R2GA 2FTYA 4UOQA 4EPEC 3B03A 2ZC8A 4GJJA 3EYPA 3WK3A 2VRKA 3DKLA 3EA2A 5K9CA 4ZA0A 3G77A 1GOXA 2P0OA 5T26A 1GQKA 3LGEA 4O15A 3UG3A 1QI4A 4ADUA 5GQBA 2HE5A 4KF1A 1OJXA 5M17A 4QLKA 3DN5A 3M0VA 4Z2KA 4HZMA 2WVTA 3SJ3A 1UD6A 4FF7A 4C7FA 4QS5A 4GC3A 3SY1A 4UZUA 3M0YA 3MMUA 4GVIA 2J4GA 5I06A 5K4XA 2D1ZA 2QDEA 3NWRA 4PZVA 1XSJA 1VZWA 2BVWA 3QKZA 5I5RA 4DO5A 1DWHM 3PBWA 1LG1A 2QPUA 2PODA 3IV8A 1YDNA 5AECA 1TUXA 4H8NA 3H53A 4U2YA 1DWJM 5GNZA 1RV8A 2V67A 3WH7A 3RU8X 2ZRXA 3IIOA 3H7RA 4GZ7A 1GWJA 1CGXA 3NAVA 4ICMA 4S3JA 3PFMA 2PCEA 5AC8A 1XLMA 3F2CA 3CUFA 4CQDA 4S2BA 4LAUA 3T9PA 1WKDA 4DJFA 5E1QA 2PPGA 4HD5A 4P8VA 3QV8A 1U33A 4ICCX 4ACYA 3UD6A 1VYPX 1HG3A 3GRIA 2ZX8A 3PTMA 4ZBCA 3V36A 2JF6A 1G1YA 3VNJA 2XSBA 3NXLA 3GW0A 4HYWA 2HVOA 1VJZA 4A22A 2V2DA 2BTMA 3ATYA 1EO5A 1F73A 1ZP3A 2KZHA 3GFXA 1NTHA 2WQDA 1M53A 1OFRA 5AZ1A 1CGUA 3LK6A 3B9OA 4O13A 1F8MA 1G0CA 4OQVA 3BG5A 2GJPA 3MWCA 4FF5A 1TJ1A 5G4WA 4JS3A 4LAZA 4LOCA 4NAFA 1WUFA 1E4IA 2HXUA 1FP8A 2PTYA 4HMNA 3M0ZA 3N6QA 4JYDA 5DQPA 5LNVA 1CGWA 3SDOA 4FZIA 4AD3A 2WZIA 4J3TA 5CH9A 2BG5A 5BXPA 3JW7A 4DQWA 3E38A 4C6DA 4LUYA 3P14A 3V1HA 4GVFA 3L0GA 2PEVA 2Y5EA 5DEZA 3N04A 2E40A 5DRCA 3WNPA 1EHAA 4AYGA 4KFNA 4HOZA 4LCSA 3AJ7A 1GOQA 2J13A 4J5NA 3LCIA 4J1OA 2DDXA 4XKYB 4GX9A 3L67A 3DFQA 9XIAA 1XQKA 2X09A 3UNTA 3S5SA 1YYAA 2QIIA 3OU8A 4HPGA 3KRUA 4HHPA 3UESA 3WEMA 3TYEA 5MF5A 2YBVA 1GYNA 3I65A 1C93A 4H2CA 1G5AA 3T6CA 3TAOA 5CBBA 5LKYA 1SFLA 5FA5A 3H12A 3VX0A 4GYPC 3WO8A 1O94A 3P5ZA 2HZGA 3R8RA 1TMQA 1MW3A 3GVWA 4HCDA 3DIPA 1EPXA 3K1DA 3PTKA 1HJVA 4E4PA 3OB8A 4LWWA 4LXFA 4R7JA 3GYEA 1J79A 1JZ5A 2GVYA 3NPXA 3TW7A 1Q66A 2NXHA 2X1UA 4C5ZA 3DBPA 2JKPA 3HV8A 1LRQA 2YYTA 1V3HA 4YXGA 1A0EA 1QO2A 4QX4A 2XU2A 1V79A 1K7FA 3WH8A 3ISIX 1XIBA 4IFKB 3QMTA 1SO6A 2PBOA 1V4YA 3RMJA 3UW6A 3WL1A 2PGWA 1CXEA 5FJOA 4XQ6A 4B2DA 2X1SA 4L6OA 2YL9A 1D3GA 3N25A 1Y65A 2WM0A 1EWDA 1EXBA 3IAQA 2V5KA 1TUFA 5XIMA 4EK7A 1E4MM 2CHNA 1PVNA 4IIBA 2VTFA 3NXFA 1FKXA 1NOWA 4GJ1A 5HUPA 3HQPA 1RAKA 3CAQA 5D02A 3W7JA 3BAJA 3G2GA 3NDOA 3NL5A 3PBUA 2OQLA 3ME3A 2XG9A 5JBEA 3UCDA 2PWGA 3R89A 1F61A 3GZAA 4ACZA 3N4EA 3L0NA 2CESA 4XVEA 4QQ3A 2D0GA 2HPMA 5D09A 1PZ1A 3ANYA 2VR4A 1FXPA 1GHRA 1JUEA 2GOUA 1G94A 2R6OA 1XWYA 4GKLA 1I0BA 3KWSA 5A2BA 1IT0A 5I23A 3QMSA 3E0WA 5I3HA 3ZWTA 1NM9A 1ZPTA 4JL2A 2EPLX 7PTDA 5BWAA 1BPLB 4KS0A 2POZA 1ENUA 3RM9A 3IIPA 2WANA 3GDRA 5A5WA 3W71A 2QJJA 3BV4A 3TV8A 3WLPA 3BZGA 1C9WA 3W82A 3ZR5A 4ONVA 4CD6A 3HN3A 3MCNA 3TROA 1XCXA 1GKRA 1V0LA 1XBYA 3QH2A 3A23A 1OZMA 3VGDA 1N8WA 4KW2A 4FOKA 5DMLA 2GSJA 3W29A 1ODUA 2E6DA 3VIKA 1OD8A 3RFAA 3LRLA 1QFEA 1K70A 3GC5A 3LCXA 3FA3A 1BYAA 1J18A 3VNYA 2NX3A 3DX5A 4ATLA 4YMZA 5M03A 1Q45A 3EWUA 4DF0A 1EJTC 1KFBA 4ILSA 2A1YA 4C6IA 4HKPA 1X6LA 1FH8A 3QTGA 1VCFA 4RCXA 5I79A 1QDSA 2VJXA 1DWIM 4PMQA 2JBMA 2ZWYA 2JALA 4B9YA 3WLNA 2OWXA 2VHLA 2YXXA 1BEUA 1EFZA 3IWPA 1K4HA 4M24A 2PDPA 1GYLA 3S83A 2ZUVA 4NRRA 1XD0A 3P7YA 1V5XA 1FQ0A 3ZJ6A 3DFTA 1K8CA 3COTA 3MW7A 3WBYA 1UWSA 3CIVA 1WKEA 3NPVA 1ADOA 1WUEA 2QS8A 3HB9A 5A8OA 4A3UA 3TAKA 4M3PA 4AH7A 5HMFA 1T8QA 2YGYA 2WVSA 2ZRWA 1MDRA 2VX4A 3BAXA 4X3ZA 2E9LA 4O53A 3T2QA 3RCYA 4WY0A 3WLHA 1PCWA 3ONBA 4FP1A 4AZHA 3MKCA 1PJ9A 1KV5A 3URBA 2GDQA 2VZOA 5CSYA 3S1UA 2XN2A 5AHNA 1KTNA 4M7TA 3GUWA 3N73A 4W8LA 1F6YA 4L9XA 2PAJA 4AWEA 1UQZA 3OGSA 4UTIA 1TIMA 1F3WA 4LAOA 4AFYA 2EPNA 1MNSA 4LVDA 1XGDA 3KOXA 2V38A 2YXOA 3SY5A 3AQUA 4PUEA 4CN6A 5FEPA 1H5YA 2QV5A 5E0FA 1QK0A 3W0KA 3ARZA 1GONA 1GQNA 3LD5A 2WMJA 1JGMA 5FF4A 1OC7A 4D6CA 2ZDRA 2CYGA 1VCGA 3RU6A 5D9PA 5G2IA 3CUIA 1R3QA 3BG3A 5I6SA 3SBFA 3ZLGA 4I5XA 4JTRA 4FA3A 4P8WA 3GW3A 3PTDA 3VIMA 2WCSA 4L61A 2XYLA 4IGMA 1KBBA 2JKAA 4GISA 1UZDA 3F4CA 5BW6A 4W5UA 4DHGA 1DWAM 4KT2A 3OBKA 1JG9A 4J3ZA 3B3DA 4O1CA 4A29A 5CZ0A 2G3FA 3KBMA 1E43A 1PAMA 3HGJA 1DIEA 1UJQA 3NDYA 2J75A 2IQ0A 3C0LA 4CU6A 3ZJ8A 2VUNA 3K5XA 3A4WA 4NAFB 1UR0A 1M65A 1WDWA 2NQ5A 1VAHA 4QISA 1YADA 3K4WA 5JVLA 3TLQA 2WJFA 2PDKA 3S1XA 3FSUA 1P7TA 1QI3A 4KEZA 1US0A 3HURA 1EP1A 4POCA 3C61A 3CHEA 1KCXA 1TVLA 1RY8A 2VM8A 1EJRC 2R1LA 4WDUA 3MZ2A 1JI1A 2DJLA 1EJUC 3ATZA 3NQAA 1C90A 5KEZA 4MYAA 4WDXA 3FXGA 1I1WA 2QGHA 3B8VA 2V6AA 9XIMA 2X1IA 4QROA 3KBWA 3LYEA 3MJYA 1GHSA 1LLOA 2G3JA 2YZRA 4LRSA 2V2HA 1F3EA 3VD5A 3S5YA 3VCNA 3VE9A 1B3VA 4N0RA 4JYFA 1R0MA 4BF7A 4N9BA 5LA0A 3GR7A 2OEKA 3MP5A 4NAEA 2E7FA 3T8QA 3HMJG 4IWWA 1B3XA 3CPRA 2VGBA 3QV9A 2PTZA 4ATWA 1K9TA 2QT3A 5EGRA 3K13A 2HRWA 4AWTA 3GH4A 3W28A 3S5OA 1JDDA 1XCWA 1PCKA 2OLHA 3GTXA 4W7VA 3LZ5A 3TTYA 4GFIA 1E5JA 5CSRA 4JD4A 1VIWA 3TKFA 5F1VA 3K8LA 4BQ2A 4IUGA 1OT1A 3T81A 2DY3A 4J28A 1LM1A 1VYRA 4Q8QA 4DAIA 2YA2A 2B31A 2PCQA 4DVOA 1VLWA 3TK7A 3CBWA 4QBXA 1RD5A 3EXTA 3MUCA 2PD9A 4XTIA 1OIMA 4IGSA 2FFCA 3DUGA 2YCEA 3L4TA 5AFDA 1XRTA 4H9YA 3U3HA 1BVWA 1GZJA 2VZSA 3M0KA 3ERPA 3KDNA 2NQLA 4JTGA 4LY8A 3CGTA 4PCSA 3RGTA 1T5AA 3O6CA 5F1UA 4FNUA 3TVAA 3FKKA 3M9YA 1I2PA 2BXVA 4A21A 3VM5A 3NA8A 1WAWA 4P5UA 4U33A 2CIPA 2GQAA 3W7RA 3GX9A 3IIXA 4YTRA 2XH4A 3PNZA 5ABEA 1S2VA 2J7CA 4GYFA 2PWFA 1QTWA 3UWVA 3BGAA 5D2YA 1FDYA 4G7EA 4N4PA 3EX6A 4JX5A 1U1UA 1TE6A 4LS1A 4BEQA 3TX9A 2HVNA 4ACZB 2IS7A 3WLQA 4JZ5A 2FIQA 1OFOA 3S2JA 4GH3A 4PB5A 4H00A 2Q02A 4IT1A 3BICA 1J6PA 5U7SA 2J78A 1Q13A 1W8GA 2J8GA 2OOFA 3K46A 3VIJA 3V3WA 3W81A 3MUAA 1AL7A 3PJTA 4PRTA 3SFKA 1JQVA 1V03A 1XJBA 4XX6A 3RLGA 4UTJA 4DZ5A 2IPGA 4PTXA 3FLUA 1XSKA 3UCCA 3GD6A 5BOFA 4DI8A 1YE4A 1V7YA 5FEXA 4QIUA 4J2MA 1JVNA 5M3WA 1VFHA 2V81A 3B9DA 4UTWA 4TVUA 4E8DA 1Z6KA 1XFBA 1I60A 4LY4A 2OLSA 2WWDA 1LORA 1VPQA 4NYUA 3BG9A 1LYXA 3U4AA 1G4EA 3D46A 2P1FA 1DIKA 1AG1O 1B3WA 3PPGA 3BUVA 1NF0A 4IMAA 5GNYA 5I7GA 2PRHA 2ABAA 4AU0A 3CZEA 3R0KA 3VNDA 3PZNA 2X0YA 1IXNA 1AMKA 5C7HA 3M0HA 1OYCA 2G0WA 3EMQA 4D6DA 3GU9A 2O55A 3BK0A 3TR2A 1RZMA 1ME9A 1VF8A 3AC0A 3IGHX 3KL0A 3NQ8A 4Q8UA 1XP3A 3T4WA 2CW6A 1FDJA 4KFOA 4GUGA 3LY0A 3P8JA 4LSBA 1AH4A 1XC6A 3WFZA 4DLMA 3MWAA 4KH2A 1IEVA 4GOAA 4IXHA 4LS0A 3WD3A 4M6UA 5M5DA 1NFGA 4RW3A 3GH7A 3QSRA 3GVQA 4NT0A 3CQHA 3VNKA 2FJUB 5C9RA 2O9OA 1Z69A 2C19A 1PKYA 1Q63A 4WEVX 4KESA 1GNXA 1YTDA 3M4HA 3UPBA 3VE7A 3BWWA 4U10A 1R38A 4GX8A 3LPGA 1RD6A 2A3HA 3ZSTA 3ZR6A 3DFOA 4JQAA 1GJPA 3AXXA 1PX8A 5D2WA 4J4KA 1XPGA 2TSYA 2PTWA 2IW0A 1UR3M 3BCDA 4WY0B 4IIDA 1S5TA 2VD8A 3N17A 3GDKA 3SGUA 1KM6A 2PSNA 3IJDA 4JX6A 3GE7A 1XICA 3UWEA 3H6OA 4UTLA 3BOXA 4IH3A 4RX0A 1CENA 3MZNA 4S3EA 2YSWA 4C91A 4HPJA 2QW5A 3FJ6A 3G1YA 3VGBA 1JYNA 1OB0A 5GJNA 4BJHA 3AS0A 1IYXA 3GNOA 5CJNA 1Y5XA 2D3NA 1W31A 3ARRA 3I4KA 4KIEA 3AMGA 1FUYA 4W8BA 1GQIA 2VCBA 1XD1A 1LT8A 1W8SA 1XLBA 4HVXA 3E2RA 2Z2BA 4RL3A 1V02A 2OO6A 2PDMA 5D04C 4GXWA 1IIGA 3QZEA 4PUUA 3ITGA 3THAA 3M0XA 1PDYA 3STCA 3WMLA 3UXKA 4S3DA 3DFNA 4JTUA 1Q2RA 2ISVA 4RE2A 3B40A 1FCQA 3CHFA 1FXQA 3FIGA 1N8FA 4JQ2A 1DXIA 1HX0A 3ZT5A 1DIDA 1M7PA 3LLDA 1YNQA 3N3TA 3IUHA 4DBSA 2QJHA 3OZMA 2PDIA 3LEPA 2A4AA 4C6KA 1SO5A 4I7WA 1US3A 2PA6A 4D71A 4L80A 3G1HA 4W4QA 5CSSA 3U9IA 1PHQA 3FS2A 1CBGA 4Q4QA 4JIIX 2PDLA 3KBSA 3H24A 1ME7A 4HZ8A 3UXDA 2Q71A 3CM4A 5EFFA 3LM3A 2PDWA 3UETA 2OSWA 3PY2A 2VQTA 3TYCA 1VKFA 3PANA 4E8CA 1G69A 3AMLA 3WK2A 2AMGA 2PWUA 4O1BA 3TW6A 1SJDA 1NSJA 2ZZ7A 4NASA 1J11A 2BDQA 3OW1A 1VBUA 1YNPA 2XSAA 5L6UA 1T41A 4RW5A 4EPDC 1AH0A 3VMPA 4NZFA 2E25A 4C60A 4GI4A 2ZA1A 1KFCA 3LCGA 2DT3A 2ODOA 3AHTA 1M01A 1EQPA 4O0ZA 3UVAA 1ITCA 3RR4A 5DBTA 2GGEA 4JEQA 4FIRA 4KRZA 4NAEB 3H2OA 1DV7A 1CGTA 1UZHA 1UWRA 1E56A 1T7LA 1F4HA 4UTTA 1MFVA 4ML9A 3DFYA 3LPPA 3KP0A 1W56A 4OHQA 5CPSA 3HGOA 4LC8A 3PNUA 4O4WA 4U28A 3ZFHA 1PDZA 1WYIA 4CU7A 3MI3A 1AQMA 1JFHA 1WCGA 3KXQA 4US5D 1R6WA 2PFHA 4B91A 3L4XA 4FR1A 5ABHA 4X61A 3PP7A 3DEQA 2FZDA 4AHOA 4OT7A 3EEZA 1VIZA 3IK2A 4GUIA 4YHGA 1QOQA 1LOSA 2FH8A 1WXZA 7A3HA 1IIHA 4B5XA 1ONEA 5HA7A 4HNNA 2EXOA 2FGZA 4HJFA 3IJ7A 2ZIDA 1J9YA 1VS1A 5AKQA 4QXIA 2ASHA 4HSHA 2BB0A 3VFCA 3A3WA 1EC9A 4DWSA 1AVAA 1ZB5A 5BZAA 3SN0A 2RJHA 1T8XA 4HZ7A 3CV6A 1V3LA 4NVTA 2YX0A 4N2YA 2PWVA 4C7GA 5I3IA 3VD7A 1YHTA 1J01A 1QBBA 3A3XA 1WZLA 1PKLA 2J47A 1T99A 3PAOA 5IFTA 5A6LA 2IKHA 3SR7A 4GA8A 3OGRA 3NGFA 3NPUA 4WDTA 1B2YA 2YB4A 3QV6A 1HJQA 4RZBA 4C7DA 3QFWA 3GNXA 3M6YA 2JEPA 4UQAA 4A05A 3IV3A 3UR5A 3M64A 3WDRA 1UWQA 2RDXA 4G7EB 5MKGA 4JCLA 7TAAA 5KZDA 1TQJA 4IMEA 3N2OA 1MQPA 1Q4NX 1XQLA 1PS9A 2WXDM 3E0LA 2V5DA 3A5FA 1CGVA 4DJFD 3EPOA 4IMFA 4GY7A 5KINA 3LHYA 1ZJAA 4NILA 2WZEA 5EFDA 3CMJA 5AB3A 4NP7A 1KR0A 3EGJA 1J2BA 2NVDA 2BLEA 1GYMA 2HSAA 2E4TA 2IPWA 4W93A 1C7SA 3N9RA 1P0EA 4GWEA 4ZQNA 1YPXA 3KBJA 1TR1A 2CZFA 4NI8A 3QQ1A 4C6CA 1EF2A 1GOOA 1HKIA 3LHVA 1CXKA 5E0CA 5FL0A 1DTNA 3FJLA 1RP8A 1NELA 4G8TA 3N15A 1GVFA 4BI5A 3HOJA 5D8WA 2OWWA 2WBKA 1DJGA 3CV2A 1Q7QA 4ADSA 2VFIA 4D6IA 3QW4B 5BWFA 3POCA 1BXNA 3VUPA 5GNXA 2G95A 2RJGA 4DXKA 1NDYA 4D8ZA 4GI8A 2OKTA 4TV5A 2YIHA 2OMAA 4LUSA 5F2MA 2R24A 2P10A 5LZLA 4MM1A 5J8LA 1TPWA 3BAWA 3LXCA 4ZVJA 4Q33A 3QHNA 4HNVA 4OBTA 3TN3A 4XIAA 2J9XA 1Q6DA 3F5LA 4DUVA 4XSMA 2GQ9A 2DSWA 3RDKA 2WYSA 4E0CA 4FEZA 3HFYA 4FAMA 1RJQA 4IPPA 3CJPA 4IQDA 1JYXA 3N13A 4LEQA 2IKJA 2FVLA 4IQEA 3IVTA 2ALDA 4V1YA 3M5ZA 3SRHA 2EKGA 1HKWA 3BMVA 1PTGA 1HIZA 3SJNA 3ES8A 4N4QA 3WEZA 4EPBC 4S23A 4X9YA 3DU0A 5BU6A 5F4XA 1V3JA 1V6YA 2A3CA 3WMSA 1KWKA 1QWKA 4LVGA 1Q6CA 2XDFA 3NQCA 2VFFA 3VNLA 3ZO9A 3S46A 3N3MA 4DJDA 3ONCA 3KW3A 3NDZA 3C2VA 3VNIA 2QPXA 1RJPA 1GJWA 4BA0A 4TO8A 4GE8A 4MJ2A 1IWPA 4CVUA 1FWNA 1FCVA 1EDQA 3V0UA 4LF1A 4BQ5A 5BXTA 5CPMA 4B2DD 4D6EA 3VGFA 3AIWA 1LWIA 3VINA 1YLVA 3AUJA 4UR9A 3VOJA 4HP5A 3MI2A 2NUXA 2WC7A 2ONEA 1H63A 4NY2A 1DHPA 2W27A 4HK6A 1PTDA 2YR1A 1BKSA 3PWIA 4CN4A 3BL3A 4UQCA 4LPCA 3WD1A 2V30A 2FMNA 3GNPA 1DQXA 2PTDA 4H7CA 4R9XA 2WNZA 1DXFA 1VBHA 4MKVA 1O5QA 4O50A 1WKYA 1FWBC 2WM1A 2D0FA 4W7UA 3AYSA 2CWXA 1UCWA 3P0XA 1DP0A 2D24A 2B0MA 4DBEA 1TZZA 4PMOA 1SYTA 1PWLA 1D8CA 4TR9A 1WAUA 4DJED 1FWTA 3KAOA 3C2RA 4CQ8A 4HK5A 2EG6A 4ZOBA 4MADA 1RUSA 3I4EA 4M8UA 1H0IA 1LCOA 4GXPA 2OYMA 4HN8A 3O07A 2PWDA 3RPTA 3LDVA 2BBFA 4Q8VA 3RJYA 1CLVA 1Z42A 3GBDA 1BF2A 3CIWA 4JEJA 5DRIA 1B1YA 4CCZA 4FPSA 2IKGA 2NUYA 1QXLA 1XYBA 5BXRA 2F6XA 3DAQA 3S3GA 2V3EA 4WVXA 1B30A 3NYZA 3EKZA 2CITA 1TTPA 3P62A 4PFHA 1DKWA 5I07A 1S2WA 3WQDA 5JH1A 3LMYA 1GCYA 1RBOB 4GYKA 4IQLA 3AS1A 1UP3A 3CZLA 3PJUA 1V3MA 4CNPA 4MTVA 1QPRA 5H1WA 2UY2A 4L56A 4PCTA 4EPKA 3IK4A 2DJXA 2NQJA 4J3VA 2VGIA 1SPQA 3WQ6A 2ON3A 1ZTVA 4ZFCA 4RNJA 3SCWA 4AD0A 1C9DA 1OM0A 2H3BA 1IE7C 1ALDA 3BJSA 3VD9A 2WCAA 2AL1A 2R9RA 4R53A 3QYQA 3LOTA 2CBVA 2DZTA 4DB7A 1OC5A 2PB1A 3IVSA 3WQ8A 2FHFA 4EAYA 2W79A 4FNPA 3WG6A 4RDYA 4IM4A 3TCEA 2YFNA 3DFPA 5AYIA 3UZWA 1BGGA 1FA2A 2VC7A 4DWSB 1VFUA 2YL5A 4XZ9A 1HJSA 1EYWA 5KZMA 3L2IA 1C8QA 1W2VA 3B8SA 3TXZA 2R82A 2PMQA 1HTIA 2QUNA 1V02E 4J3UA 3ZVHA 4AW7A 1VB9A 1GTEA 3OLIA 4WOZA 2DORA 2XUCA 2F7FA 1HJUA 4FXJA 3U8GA 3UA3A 1HL8A 4ZO7A 4AHPA 4HMDA 4DZHA 3TLLA 5BRPA 5MKGB 1RPXA 1KCLA 4DUOA 1BWKA 4F9JA 4E2OA 1TTJA 3UJFA 1PB0A 4C6EA 2Y89A 4MJMA 2D0HA 1B90A 3EOLA 3GC4A 2PS2A 3LBMA 3NO5A 4EANA 3EOSA 3P82A 4Q8WA 1JZ4A 1XIMA 2VDIA 2XTKA 2V3DA 3V16A 1X7FA 2MUCA 3G0UA 3R13A 2QDHA 2R91A 3KVJA 1KM2A 1TX2A 2I5GA 4Z2HA 3HGSA 4JTJA 4OWGA 5H91A 3SCTA 2DFAA 5TIMA 4L65A 3ZOAA 1MUCA 3MCOA 3AIBA 1RXOB 2E67A 1YBQA 4DNMA 2C1GA 3RILA 3H4GA 4B5VA 1GOIA 1NAL1 4L5ZA 2RGLA 2OCZA 1JUBA 1B3OA 1U5HA 4AD4A 3ITTA 1EA9C 1R47A 2QIWA 1M68A 3M1ZA 4O19A 4AZCB 1BTMA 2FZNA 2GUBA 4EVZA 4LAMA 4JFVA 3SQLA 3SSZA 4HIBA 3BGJA 3VM7A 1K9DA 1I0DA 4R33A 3RYSA 3NOYA 4OJYA 2J7GA 3W37A 4DWDA 4IPNB 1BLIA 3W01A 3KHDA 4GABA 3BOFA 3GXNA 3HG2A 1NDZA 4YTSA 3PVFA 3B4YA 2E5DA 4LVFA 2Z4GA 1L2QA 1W5PA 2DW6A 3P80A 4AX6A 1JCJA 1O5KA 2J9ZA 2P76A 2XIOA 1OK4A 1UR4A 2OX4A 1QR7A 5K9DA 2GQ8A 5FF2A 3BCFA 3LCHA 3RX4A 4TVCA 5HBFA 4DBDA 3QY8A 4Z1CA 5A6KA 4LTSA 2Y7FA 1ONWA 4NJJA 1XH2A 3SECA 3SZ8A 3U2CA 2PF8A 1A0CA 4RLIA 3VGGA 4IX0A 4QITA 4HHMA 4H9TA 4AC7C 4E3VA 4JIEA 2VEIA 3IAPA 1H7PA 4CN1A 2YOCA 2Y85A 1JXJA 2CEQA 1K9FA 1XG4A 4WKAA 4S39A 3CQ0A 5EMKA 1S46A 4S38A 5EMYA 5CLWA 1E9LA 3O6AA 4GIYA 1E9YB 5IXEA 2FZBA 1UROA 3WQ4A 3I68A 1W5OA 4G1NA 1UC4A 3W88A 4UTFA 3GHRA 4M1RA 3UFYA 1GPFA 2J66A 5E9XA 4L6DA 2WLYA 3L66A 4LCQA 3V1PA 2ISSA 1U5JA 3F2BA 2QGYA 3WLTA 1SO3A 2ISDA 4AISA 3MY9A 2HEJA 1NP2A 3U7VA 1DJHA 4ZB2A 2DQWA 2JQXA 1NARA 1W1IE 1QHZA 3A12A 2CLPA 2CCRA 4LUTA 4W85A 2XFWA 3CYJA 4NJKA 2VL4A 3VD3A 4Z0SA 2BXYA 4YPJA 2EO7A 3SCPA 1EOKA 3VC5A 4MB5A 4JX4A 2BGQA 3OA5A 5JIPA 1S5WA 3MDUA 3HG3A 4WDWA 1BRLA 3B06A 3H2AA 2HS6A 3D5HA 4CD7A 3W27A 1KM0A 3MVTA 1EDGA 1P6CA 2I17A 5XIAA 3KCOA 1N8IA 5GJPA 1OIFA 1REQA 4O1AA 3PPCA 5LNWA 2ZZ1A 1R3YA 4JGDA 1TKKA 4GZIA 2ZC1A 5CEWA 3EKLA 1EB3A 1XS2A 4JHZA 5HK4A 3W7OA 2OR2A 1K02A 3S42A 4FO4A 3LV5A 2C79A 2X2YA 3BLEA 4LS2A 2DZUA 2HCVA 2CNCA 4HNOA 3DDMA 2UZ9A 4PMUA 1YE6A 4CVWA 3QR3A 5JU6A 3V18A 2ZWZA 1JDEA 3S47A 5IFPA 5CSUA 1OF6A 1EXPA 4QAWA 4FOJA 5G1MA 5A6BA 1AMYA 5FD0A 4DY1A 1SM9A 4QLLA 3WQPA 2RKXA 2E68A 4KWOA 4YVPA 3TONA 4PMXA 3K1GA 3TNOA 5ECVA 1IZJA 1P0NA 2Q01A 1J10A 3MO7A 3O16A 1XRSA 1L6YA 3VCRA 1R3RA 3H4WA 4HU8A 2WJEA 3Q45A 5EA9A 1CCWB 3NZGA 4TMBA 1CXFA 2HBXA 1MDLA 2V9DA 3FK4A 2XSXA 3WELA 3KRBA 5I3DA 3H4XA 2R94A 3GXFA 4O16A 4JDBA 2W67A 4EF9A 1S5MA 2YDAA 2ZUTA 3IGSA 4ZTXA 1EF3A 5LIWX 4ZENA 3W7DA 4UUIA 6ENLA 1AJ2A 4Y6GA 3TFCA 4NNCA 1YIXA 1Z7AA 4IL2A 3AISA 4TX6A 2Z1BA 3L65A 5LIYX 2GDVA 3VI2A 1S1PA 2WOQA 5C71A 1QASA 3W7QA 3BO9A 3DFHA 3KOZA 1T6MA 4QEEA 4ERIA 1ZJIA 3VKAA 1AH3A 1UZ4A 5BCAA 5IBXA 1ITXA 2E77A 1KV8A 3W1LA 2CZ5A 1S2AA 2HMCA 2XH7A 3N11A 1K8XA 1GVSA 4I90A 3NZQA 3DBNA 3D3AA 4C6FA 3KHJA 3MANA 3E49A 4AUBA 3SO7A 3PULA 5CPTA 4FLRA 1R3WA 1GVYA 1LT7A 1Q65A 5HNRA 3W2UA 4ZR8A 3HJEA 1VPYA 1M04A 4DO6A 2X1TA 2ZQ0A 3ZVHB 2VQUA 1KRCC 1ZQ5A 3INPA 2OJPA 1K8YA 4QJ4B 3I10A 2XVGA 4D6JA 4QHRA 5CZJA 3PB2A 4V27A 1ZBKA 3VFLA 2YBTA 4PN2A 4UBPC 4KGJA 4PBEA 2A7RA 3H7UA 5AHLA 2QDGA 3TN5A 4DN1A 3VTRA 3KVKA 5C2XA 3LENA 1XR2A 4C6PA 4PEEA 3N34A 5KTLA 3CC1A 4ADTA 1NWRA 3AMCA 4IHCA 3W1XA 1UBPC 1JNDA 1EX5A 2C91A 4M0XA 3WCZA 3SCUA 4RPPA 2C1IA 4JQ3A 3EWXA 1PIGA 3TUUA 4AIBA 4HHLA 5DT5A 5AVHA 1K7EA 1LQ2A 4FB7A 4LVAA 5A2AA 1SJBA 4Z17A 2VFGA 2Z27A 4KQNA 3KTXA 4MHBA 1KM4A 3NVTA 1BHGA 4O17A 4JICA 1CB2A 4YU1A 2Q8XA 2YKKA 1KM3A 1YBQB 4Z2LA 5LA1A 3HV9A 1YEYA 3CUZA 2DH2A 2PURA 3C86A 1A5MC 1Q7MA 4JTSA 4H9VA 3QM3A 5CGMA 2Y1HA 1OK6A 4XBSA 4K8EA 4JN7A 5AN7A 2QCLA 5FACA 3VIHA 3AHZA 1XBZA 1DEDA 1LQ0A 2QYGA 3WNNA 4EWND 3EX3A 4OUEA 2I14A 1KFKA 2ZXBA 3GBEA 1PZ3A 5DMNA 4XD6A 3VNMA 4DIAA 1A5KC 3QC3A 1H0GA 3SQSA 1V77A 1IEWA 3CIXA 2J88A 4M6PA 1E0WA 1E6XM 3QQWA 3UU0A 4QS6A 2Z0IA 3LSBA 1OCNA 4KBXA 4QE5A 3B0XA 5FSDC 3W25A 5KSWA 3O05A 4E2VA 5I09A 5E5CA 2G96A 1SUXA 4P61A 4CCEA 4OGZA 3QW3A 4I9AA 2O4QA 3AXIA 3DENA 2VEMA 1QMLA 3VKBA 3ANVA 3FAWA 2QULA 4R85A 1VFFA 1G4PA 3FA5A 4GD0A 4JNMA 3EXSA 4JFSA 5A69A 2ZRYA 3B04A 1IXPA 2NV9A 2YCIX 4ZEPA 3BANA 3M0IA 1TWZA 4FI4A 2YCLA 3KWXA 3PZUA 1U30A 3GR4A 2WSKA 3UY7A 2X7WA 3K4AA 3ZM8A 1EJ7L 4TU1A 1MSSA 4HBKA 3M0MA 6REQA 2FH6A 1K77A 3OVGA 4C1KA 4JIQA 3AFBA 1QI0A 3AU2A 3EX1A 2HTMA 5AYXA 3EWDA 1VFMA 3B05A 4ZXLA 1V3KA 3O8AA 3WFAA 3QGKC 3ZR4A 1MWOA 5HUOA 4PEKA 1V51A 3R25A 5AOUA 3FEQA 3CS2A 1EBGA 2DSZA 3W72A 4AVFA 3NSNA 4DWSD 5GPRA 4ZQMA 4D9PA 1O6IA 3TSBA 1L0PA 2ZTJA 4HMCA 1OCJA 1WE5A 1BG9A 4Q4RA 5CKSA 1NWTA 3KVMA 2TYSA 1W9PA 3SSJA 4I8YA 2XH0A 3RX2A 1CXHA 5CZKA 5CCZA 3EX4A 4BFAA 4LUTB 2EF9A 4NNAA 4A8RA 3ARWA 1LL6A 3ARSA 4R3UA 4DF2A 1XF0A 2P50A 1NEYA 1H7WA 3VA8A 4MY8A 1FDZA 5U4NA 2TPSA 4GQQA 4PBFA 2XFFA 3P81A 5EU9A 1L2UA 4GKTA 4XZWA 4MVAA 3S6DA 4BQ3A 4F2UA 3FHQA 4D1JA 1BFNA 3P93A 4MLRA 4TQTA 4H7VA 4E5TA 1REQB 2WQPA 3OLEA 2ZDSA 5D38A 4J9JA 3OVPA 1W5MA 2DVTA 1ZL1A 4JAWA 3CZKA 3TYBA 1OY0A 3ABSA 3RMEA 4ZGYA 3VK5A 1AQHA 4ORMA 5HWJA 3TP4A 5IRPA 4XD5A 3DOPA 3S4TA 3RLHA 4AVNA 2GUYA 1XKYA 3GM8A 3G1AA 2GGIA 4IISA 5D37A 3N1AA 2VGGA 5G4EA 1W91A 2YL6A 2BASA 4IUOA 3SUSA 1A5BA 3L5LA 1Z8AA 2ATMA 3FJ4A 3MUIA 3QTPA 1F2JA 5I3FA 2BZNA 4IG2B 5A3HA 2BGNE 4HMEA 5CBJA 4LNCA 1WDQA 2WWCA 3BH4A 4PA8A 4CCDA 3WJZA 2KX9A 4GQRA 5T8GA 4NI3A 1PYFA 3MUY1 4AQLA