1FCQA

Crystal structure (monoclinic) of bee venom hyaluronidase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
321
structure length
314
Chain Sequence
EFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HYALURONOGLUCOSAMINIDASE
publication title Crystal structure of hyaluronidase, a major allergen of bee venom.
pubmed doi rcsb
source organism Apis mellifera
total genus 128
structure length 314
sequence length 321
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01630 Glyco_hydro_56 Hyaluronidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1fcqA00
2VC6A 3L5LA 3M16A 1KFLA 1KM0A 1LTDA 3M41A 4K39A 1C8VA 3BG3A 2E5BA 2CU0A 1FUYA 3USBA 3LV5A 4CQ8A 1LRQA 5I3GA 3MI6A 1X1ZA 3TIMA 4C1KA 3GNDA 4OHQA 2WNQA 1H7XA 3T78A 2V0TA 5C5YA 3W7NA 1KTCA 5DBTA 1GOXA 1RVGA 1FX6A 2OCZA 1X8FA 2J6XA 3TJLA 3LHZA 4CQAA 1HO1A 1KLZA 1FXPA 1OFAA 5DLCA 4ORIA 4JR5A 1Q6RA 1W37A 3GR8A 3TR2A 4NVTA 1S3HA 1W1ZA 1NSJA 4JIQA 1W56A 1JQVA 3DKLA 3MYPA 6TIMA 4XBSA 2QF7A 4HIBA 4AHQA 4D2JA 1TSIA 1WAUA 5HR7A 3SFKA 4PCFA 1H7OA 2ZZ5A 4O53A 1LLWA 4TIMA 4LVGA 4KFPA 3OVQA 4U28A 5FF2A 1GWJA 2V8ZA 3TV8A 2J24A 4O16A 2Y7GA 1YLVA 3DFTA 3EWZA 1GVRA 1KV8A 4AF0B 1MXSA 2RH9A 3WK2A 2V82A 3C0JA 2ZZ7A 1SZGA 4GC4A 4XUGA 4Z1CA 2G5WA 4LVFA 3ZFHA 5ABTA 2B7PA 3DFSA 1P0KA 1UCWA 4O52A 4LU0A 1NAL1 5FF4A 2ZTJA 3CLMA 1GVFA 3W2MA 3LCXA 1TPVA 2A4AA 3RMJA 2NUWA 2E6YA 5K9XA 2DP3A 3JS3A 2W6RA 1LOSA 5F4SA 3W76A 3FYPA 4O18A 2FB3A 2R94A 4IGHA 1DQWA 1M7OA 1KM5A 5D2VA 3L0NA 4MYAA 4XTIA 4MY1A 4PEKA 4JYDA 3ZWTA 1TPDA 3C2FA 5HMSA 1DBTA 1FXQA 1SR9A 2NUYA 4XWUA 4QJ1A 3FKRA 1NVMA 4RZ5A 1JUKA 5LHEA 1Z42A 3HBLA 1VCVA 1G4TA 4UUIA 3O63A 2QCCA 1QPOA 3TAKA 5EKYA 3NO5A 3TA6A 3N2MA 4LS2A 3L5MA 4RJEA 2OT1A 3L65A 3PG8A 2PCQA 5EL1A 4K6AA 3O1NA 5FEWA 2TSYA 2CLIA 1I45A 4IPJA 5CG7A 4UTHA 5D05A 3BLEA 3GB6A 2ZZ2A 4DO6A 2BLEA 1TTIA 2CLMA 3PBWA 4EIVA 1LBLA 3STEA 4CQ9A 2GOUA 3LTPA 1VPXA 1VS1A 1LDCA 1QNVA 1ML1A 5D38A 4FXRA 2ISWA 1XBZA 3B4UA 4NX5A 3UWVA 4LW7A 1LROA 3CWOX 3LCGA 2WKJA 3DH7A 4E2DA 2EGZA 3TK7A 2QJHA 1VC4A 5EPDA 1R47A 4YLWA 5F2IA 2G97A 1G4EA 3LCHA 1CW2A 1TPFA 1ONRA 3CIWA 3TNOA 1H1ZA 5DXXA 1BEUA 4JXCA 2CLLA 3P60A 2H3DA 1FDYA 3W7LA 1W54A 2FDSA 2HS8A 4FNRA 1SSGA 1FWNA 1H7NA 2A85A 3R8RA 2YDAA 5CGQA 3W1RA 1TRDA 1WBJA 3C4UA 3GVGA 4JTHA 3UWYA 4FIRA 4UFHA 3N73A 3NQDA 3SJ3A 1ZENA 1B3OA 4PL1A 3CEPA 1FWWA 5BMWA 5U7SA 2Y6ZA 1YXCA 3W7EA 3HO8A 3W22A 1P4CA 3M6YA 5HQEA 3G3DA 1R2SA 4HNNA 3W1UA 3KRSA 3F4WA 4FX6M 1OFOA 4WUIA 4UMAA 2CLHA 1TV5A 4UIOA 2DZXA 1SO5A 1QFEA 5D04C 2PC4A 3TXZA 3EXTA 1JRCA 5AYYA 2CZFA 3DENA 1I2PA 4Q32A 5KTLA 3RFAA 3VE9A 3TFCA 4QM1A 4MFEA 4DPPA 4Z1AA 3CT7A 4C1LA 2I14A 1WOBA 3CIXA 2DZSA 3BLIA 2CZEA 4FNQA 1EWEA 1Q45A 2C0AA 2WOQA 4O12A 5E1QA 1A5SA 2XN2A 4UNLA 4WJEA 3IIZA 3M5VA 4RCXA 3VNDA 5C6MA 4DELA 4P2VA 2RHGA 3WK0A 3NVTA 4OU1A 4PC8A 3Q2DA 5D32A 1FQ0A 1K02A 1XM3A 4UTLA 5D2XA 4Y6GA 3PVFA 3ZR4A 4ZMGA 4R33A 5H91A 3P67A 2JKPA 4BI6A 3G0UA 3GYEA 3OVPA 4MZYA 1AG1O 3THQA 5F2GA 3LRKA 3N9RA 3I7SA 3L66A 1JCJA 3UQNA 3DZ1A 2PRMA 3WK3A 5LNWA 2CFFA 3NR0A 1K3UA 5LZLA 1ZAHA 1T99A 1W5NA 3PR2A 3GR7A 1YDVA 4AWTA 2XN0A 4JIPA 2QCHA 5AFDA 1LCOA 2CLKA 4LV4A 2YXGA 3FA5A 3HOJA 2X1SA 2C14A 2C18A 4UFKA 3IIXA 2R8WA 4I7VA 3NQ7A 2V2HA 4BWLA 2BZNA 4WXYA 4HNVA 4UTIA 2NZLA 3NPWA 1SZFA 3O06A 3LRMA 3LCLA 3R89A 1EB3A 4OGZA 2NUXA 2QCGA 4I7WA 2DZTA 3VE7A 3G1HA 5AC6A 4Q4KA 4M5PA 3LCFA 3KVLA 3MYOA 1JUEA 3THAA 3EXRA 3FJLA 3QC3A 3SGUA 1VR6A 4DO4A 2B7OA 1H60A 4EOUA 2DU2A 1S5VA 2EPHA 3RU6A 1H7WA 3BGJA 4WY0B 3N3MA 1JR1A 4JX5A 4NXKA 1YDOA 3MBDA 4JICA 4GBUA 2V2DA 3R2GA 1WYIA 3PS7A 2FQIA 2Q8LA 4FIQA 3GDTA 1HG3A 3W86A 1MEHA 1HTIA 4JX6A 4LV9A 4BWLC 1ICSA 1I2OA 5F1VA 3QSTA 4A3UA 3YPIA 2F84A 1GTEA 3WK1A 1W5PA 1ZALA 2X30A 3FYOA 1RV8A 1I2RA 3C2VA 2VFGA 2WSRA 4DBEA 4JTJA 5LHFA 3LB0A 1XDLA 2Y85A 3TC7A 3G24A 1QO5A 1W5MA 4ZQRA 4N4PA 1N8FA 3V75A 3NYZA 3W2LA 3L2IA 3G18A 1R30A 3W71A 1SFLA 2ZCGA 2R91A 5BRBA 4KWWA 3T4CA 2VXNA 2V2CA 1I2NA 4QIUA 3MW7A 3N2XA 5MHBA 3W7MA 2WJZA 4MY9A 5U4NA 1NF0A 1QCWA 5AC8A 2QCLA 2ISVA 1TV8A 2OJPA 1W3TA 1W0MA 3LERA 3FKKA 3OHIA 3UNDA 3QEZA 1MO0A 3TW7A 2Z6IA 3TXVA 4GUHA 3G1XA 3TSMA 1YTEA 3GXNA 4JX4A 3EX6A 4Y96A 5I3JA 2ZYFA 3S0CA 3PY2A 3W73A 3SW6A 4LY8A 3NL5A 4X2RA 3UZJA 1A5CA 3UWUA 2I9EA 4AWUA 2A6NA 3LXCA 1AMKA 1KM2A 3HG2A 1AK5A 3HPZA 3L67A 4HNUA 5DY2A 1QPRA 3DU0A 4GJ1A 2YSWA 3TUUA 3GDMA 1VLIA 3RF9A 4AAJA 1EA0A 2HTMA 3I7RA 4UFIA 1EEPA 1ZNNA 2EF9A 3BLFA 1RR2A 1W5OA 1SPQA 4XQ6A 5AHEA 4RXFA 3C2OA 3IGSA 1ME7A 2A1YA 3ATYA 3G8RA 5FF0A 4Y9AA 3C61A 5KMYA 2NV2A 2A7PA 4GUJA 2YFOA 1ME8A 1QMLA 5KSWA 3UZ5A 3KOFA 2A5HA 4WQ6A 3MWAA 5I3KA 1YTKA 2IQTA 4IXXA 3T44A 1OFDA 3ELFA 3DFPA 1A5BA 1I2QA 1QOQA 1DHPA 2CZDA 1X1OA 4ZZ9A 3N14A 1TMHA 1YPIA 4IX2A 1KFEA 4ALDA 4JYEA 1LYXA 5LNUA 4X22A 1PHWA 1WA3A 1YDNA 4ONVA 1VZWA 2BXVA 3P81A 1ZFJA 3LBMA 4EWND 1L6SA 4NJGA 1GVQA 1QPQA 3TFXA 5F1UA 4JD4A 1Y0EA 1FWTA 4ORMA 2CLOA 1GT8A 1VYSX 1R2TA 1PL9A 4ADSA 1GZGA 1H63A 1SW3A 3BVJA 3P74A 4LRSA 1Q6OA 5AYXA 1WXJA 3W7IA 1W5QA 4MJZA 4TR9A 3CEUA 5CZ0A 3G0SA 1LRTA 4GUIA 4KFOA 3PBVA 1F05A 1WOAA 2QEZA 2ZRZA 1UJPA 3LX9A 1ICPA 1KM1A 3LDVA 4BK9A 3FOKA 3W70A 5HWNA 4YL2A 3E02A 4MYXA 5LGZA 3NL2A 5G1YA 3TC6A 3TCEA 1TPH1 1WQ5A 4AHOA 3GDLA 2VFFA 3RNDA 1W8SA 2V81A 1YYAA 4UTWA 3N19B 3HG4A 3T7VA 3K30A 1SW0A 2WQPA 4MKNA 4LS0A 2OMAA 4TX9A 5AHNA 1CI1A 5KZDA 2VEPA 4O4WA 4UTTA 1GEQA 2EHHA 3I6RA 4JDBA 4YXGA 2VEIA 3NZRA 4BI7A 5K3VA 4AHPA 1OFQA 1X7FA 2Z1BA 1OX5A 5AB3A 4O14A 3W1XA 4QQ3A 4GUFA 3OVRA 3GKFA 4MFDA 1TIMA 3TW6A 4FX8A 2Q3OA 3DGRA 2G96A 3QJAA 1KFCA 2Y7EA 2FPYA 1G4PA 5J5RA 1W3NA 3RLVA 2WPBA 1XDMA 3ZS4A 3FFSA 4JTGA 3GZ3A 3EXSA 3EEGA 1N55A 1VHCA 4UTWC 4Z0SA 3UXAA 4CLMA 3PF3A 3JRKA 3W2NA 1ZAJA 1DVJA 1F7BA 5LKYA 1SSDA 1KM4A 1Z41A 3E9AA 3U2OA 3LM7A 3B0UX 3EX3A 4UTTC 3S42A 2E5CA 3M43A 3NQMA 1EWDA 1AL8A 6ALDA 3O16A 4AF0A 2GQ9A 1G4SA 4A2SA 3SGZA 1P0NA 3G1AA 4LNYA 3EWXA 4CCCA 4E38A 3LHVA 1EP3A 2VFIA 3P7YA 1XFBA 4R34A 3UXDA 4NXSA 4K7YA 1CX9A 4RX0A 5DXYA 3P5YA 4AMAA 1P5BA 1DKWA 5TIMA 3TQ0A 4Y90A 3DFNA 1IXOA 1GVOA 2B7NA 1O95A 5BW6A 1PV8A 1MEIA 3CHVA 1QOPA 4JNMA 4A22A 1AW2A 1RPXA 2GPTA 2J9YA 3ZWSA 3H55A 4HSOA 5C54A 4IMEA 3PULA 1EUAA 3GXTA 2C3ZA 3GK0A 2E09A 4IMGA 4TMCA 1JCLA 1RZMA 3JR2A 4H3DA 3M1ZA 5G5IA 4RXGA 3BW3A 3M5YA 4Z1DA 4HT3A 2ISSA 3G1VA 4K37A 4ZVJA 5LNRA 1W3IA 3QW3A 4MLRA 3A9IA 3A5VA 1BWLA 4NUWA 1ICQA 1YADA 4O1BA 1LBMA 1S5TA 2YX0A 3NZ1A 3STFA 4O50A 4A21A 1BWKA 1H61A 3ANYA 3MBFA 2X1TA 3KHJA 5D30A 1G7UA 4MZ8A 1TB3A 3UWQA 3C52A 4JDYA 1H62A 1IF2A 2FB2A 2H8ZA 3KX6A 2NX3A 1OFRA 2WV8A 1T96A 1VYRA 2ATMA 2JKAA 3TX9A 1TRIA 1QR7A 2JKEA 4DF2A 2TMDA 3HGRA 3W85A 1Z48A 2PE4A 2FLIA 5HJLA 4LC8A 1G69A 3QPYA 1A53A 1KFBA 5J5DA 4JTSA 3C56A 1VRDA 5K9DA 3PBUA 3BK0A 3A24A 3SR7A 1JQXA 3DHDA 1V7YA 1F2JA 3OEXA 1O60A 3W07A 3I65A 2YYTA 3U6WA 1MEWA 4DF1A 5E93A 4DEFA 1TJRA 1A5AA 4HSNA 2Y7FA 3CC1A 4B5NA 3VI2A 1XBXA 4NNBA 3MI2A 2YFNA 1EX5A 4FF7A 2NX9A 3TQKA 2FPVA 3ABQA 3LHWA 3OG3A 3MI3A 5DCDA 3W83A 3INPA 4IMDA 3S1XA 4MIMA 3STGA 2ALDA 3E0IA 4KKXA 1XUZA 4IXHA 4FNUA 3GDKA 3LCWA 3S5YA 1NFBA 1JVNA 3P62A 4OQVA 3UWWA 4IUOA 3UD6A 4N02A 1G67A 4WZHA 2A7NA 4N6FA 1ADOA 4AH7A 4WOQA 3PAJA 1M6JA 4LTSA 4UFLA 4EF9A 1WBHA 3LHYA 4O0ZA 3HGOA 1WX0A 2J27A 4IMFA 1KTNA 4A2RA 4IQLA 3BG9A 1ZAIA 5FEPA 1KV5A 4DF0A 1IXQA 3H54A 1LOQA 3NQAA 3C2EA 3QPZA 4LWWA 2QCFA 3NG3A 4UTKA 1F76A 3B03A 3UPBA 1JJKA 2A21A 3HQ1A 2DORA 1VJIA 2VFHA 3KVJA 1KBJA 4OBTA 2P0OA 3R5EA 3EX2A 3GDRA 5D2TA 1EP2A 3EB2A 4NU7A 4QITA 3MHGA 3GAKA 5D2YA 1YPFA 3NQCA 1OK6A 5BOOA 3OIXA 4NT0A 2E68A 4O1CA 3NM3A 3A22A 1LLZA 4GRSA 1M7PA 5A8GA 3WFAA 1F6KA 3DFQA 4S1FA 1RQEA 5HWJA 2VOMA 4IJBA 3PB0A 3EX4A 1GPWA 2AGKA 1K8YA 2QAFA 5BMXA 4FNTA 1KLYA 3IIOA 4IMCA 2CLEA 3I68A 4I7UA 1K8XA 1TJPA 3UY7A 4N6EA 4BI5A 1R2RA 2E1DA 2VEMA 3GIYA 1M5WA 2WNZA 3QFEA 2QDHA 1PS9A 3TMQA 1F74A 4YCPA 4FHAA 4N2YA 1D3GA 3ABSA 3W84A 3DAQA 1XXXA 4MVAA 3TU9A 5D03A 4UMBA 4XKYB 1TO3A 2W0UA 4K8HA 1O4UA 1IXPA 1J4EA 3BV4A 3MJYA 1WDWA 1SZEA 3TH6A 5TQLA 4JTEA 3S9YA 4GFSA 1K03A 5KZEA 4DXVA 3L21A 3G1FA 3PC0A 1OVDA 2ZRUA 4E2BA 3QMTA 3NQGA 1MZHA 3P5ZA 3IGXA 4NZJA 1QO2A 2QAPA 2VELA 2NV1A 4QNWA 2WSYA 4WY0A 3TE9A 2XN1A 2HSAA 3BARA 2GVJA 2V30A 4P61A 4N9CA 4GE8A 1C9DA 2V5LA 2YW4A 2H3BA 2V5BA 1UBSA 1YXDA 1N7KA 1ALDA 3A5FA 1DV7A 4CNNA 1AL7A 1B57A 2C1HA 1AW5A 2FFCA 3LHUA 3LRLA 2ZA3A 2C13A 2A2IA 3S5OA 2ZQ0A 1VQTA 4H4IA 4K36A 4NJKA 1OX4B 1OG0A 1H51A 4L4MA 3LLDA 2DZPA 4YWIA 1VHNA 3RLUA 3W2UA 2Y61A 1HO4A 5AHMA 4JTFA 3UWZA 1TCDA 2A6LA 1LORA 4ICNA 1OX4A 2W79A 4O54A 3HG5A 3MO7A 3OA3A 4FB7A 3PG9A 4RK8A 3W74A 4XTDA 4ZL1A 3BO9A 1L6YA 5SWUA 3LOTA 1VCFA 5CSSA 2E6FA 2P1FA 1XBVA 1OHLA 5L6UA 3W1PA 2F7FA 5H2ZA 3GAYA 4GUGA 4AB4A 1T8XA 4UTJA 3HF3A 3W7HA 4HNTA 2QCDB 4FX7A 3NPXA 5AYZA 3NL6A 1FDZA 5IM51 3S5NA 4WX2A 4RZ6A 3B0PA 3W7DA 5LNSA 3PSWA 4UCGA 3W75A 2DJLA 2EKCA 3S6DA 3EKLA 5EBUA 1OJXA 5IBXA 4NNCA 1UASA 2VKZG 5AC7A 5C55A 2GJLA 2YCEA 1VYPX 5DN1A 1EUNA 3HIJA 5DCBA 2RKXA 4X3ZA 3C3NA 3SZ8A 2Y62A 4QAIA 4OE7A 5L9FA 4ZQNA 3NQEA 1TV7A 2X1UA 2BWGA 3C2RA 4JY8A 4H6KA 3LXBA 3IEBA 2NWRA 3QZEA 5G1TA 5G4WA 1FY6A 4TMBA 2GVLA 2RDTA 3W7QA 4WD0A 2CLFA 5I3IA 3GLCA 5CKSA 2J88A 3H53A 3GX9A 2RDUA 4JEQA 5BNKA 1HUVA 4POCA 1PCKA 3R13A 1KA9F 4KWVA 5CSRA 2WNNA 3E96A 3QYQA 1I8JA 3DKJA 1IIHA 2C15A 2H90A 2QUTA 4O1DA 2FTPA 2JGQA 1JCNA 5IBXC 2QCNA 3NQ6A 3PB2A 3NQ8A 1IIGA 1ZY9A 3NDOA 1Z44A 5C2XA 5I3HA 1FWSA 1UUOA 4JTLA 4RR4A 3N9SA 5KZMA 5HR6A 3W7OA 3LXAA 3W72A 1KM3A 1K7FA 1JULA 2CWNA 5DY3A 2VENA 3TDFA 3PUEA 1HL2A 2Y70A 2ZZ1A 3B8DA 2HMCA 2DZUA 5CZTA 3FS2A 5CZSA 4LRTA 4LVAA 4O57A 3FJ6A 4X9SA 2NX1A 2D73A 3IIVA 3LTSA 4UR7A 4G1KA 1PCWA 4GXMA 3TQVA 3W1NA 2RDWA 3CU2A 2KZHA 4TU1A 2C6QA 2YYUA 3CPRA 8TIMA 4MLJA 4PTNA 3TROA 4NX0A 1F6PA 4OV4A 1LBFA 2AAMA 4NJJA 5LSMA 2DJXA 1ZJIA 3NQ2A 3QRHA 4QISA 3P8JA 2RFGA 4K38A 3W7CA 5HINA 4M6PA 3TSBA 3BG5A 3F1QA 3MHFA 4L4LA 4NZFA 1TQJA 5LGXA 1U83A 3FIGA 3LCIA 1SO4A 2VFEA 3TAOA 3HPSA 3IGUA 3F4NA 3F03K 2NXHA 1SU5A 5FF7A 4FNPA 5FEZA 3LBCA 5D2WA 1EP1A 3IVSA 3NEVA 3O15A 3QSRA 3L9CA 1GYNA 2QUVA 5D02A 1D9EA 4KFNA 3MHUA 5F4XA 1XI3A 4DPQA 2QJIA 2J9ZA 5HUPA 4JY9A 3WJWA 1OFBA 3HGSA 4MUZA 4A29A 3QF0A 4JTIA 2QJGA 3IIPA 5G4EA 1DJNA 1IXNA 2TRSA 3W7RA 3L5AA 4CCEA 4NQ1A 5DBUA 2B0MA 4AXKA 1EPXA 2YW3A 3CTLA 4O8RA 1FCVA 1H50A 2E5DA 4RLIA 5EMUA 3NXFA 3ATZA 3CB8A 1H7RA 5D09A 4PL2A 3W1LA 1OFEA 4AWSA 3W3OA 4MPQA 2QR6A 2BX7A 2QDGA 1A50A 1LM1A 1PHQA 2ZDRA 5G2WA 2ZZ4A 2OT0A 4S2BA 3W1TA 3G1YA 2JGYA 5KINA 3BPWA 4PODA 4J9JA 3W7GA 1DJQA 3QH2A 3RK8A 1XL9A 4WXZA 4LOCA 1PIIA 1KFKA 2YZRA 4HKPA 3M9YA 1SZNA 1OF8A 5TBOA 5AN7A 3VCRA 3DBPA 1TYGA 1BKSA 2NXIA 5K9CA 1FCQA 1K7XA 1JCMP 4QSHA 3LI1A 4XBKA 2Y89A 3FLUA 4Z08A 2VEKA 2WSQA 2GUUA 1TPWA 3P82A 1H5YA 4JTKA 1I4NA 2NXGA 3AJXA 4UFJA 3M5ZA 1V5XA 4MOZA 1T0OA 1TTPA 4M7SA 2ZRXA 4UXDA 1H1YA 3PWAA 2DZVA 3KVKA 3GNNA 5D37A 5KITA 4K8EA 4HHPA 1OF6A 3KRZA 3P84A 4BFAA 1SQ7A 3Q58A 4RZ4A 1P1XA 1QWGA 3M7WA 3MP3A 1XCFA 2OX1A 3IV3A 2YR1A 2JBMA 2PRLA 3SY5A 4O10A 3O8AA 1F73A 2FJKA 2ZRYA 4TO8A 4PFMA 1AW1A 2QCEA 5D33A 1QDSA 2ABBA 2ZRVA 1OYBA 3V1PA 4XZ9A 3EWWA 3W1MA 1VCGA 5K2ZA 1VLWA 2Y7DA 1SW7A 4WY0F 1B9BA 1YTDA 4FXSA 4YMZA 1TTJA 1FCBA 2TYSA 3M44A 5F4WA 3W7KA 4M6QA 4UNKA 3P61A 5F2LA 5F2MA 5HNRA 2O7SA 1B4KA 3BW4A 3B05A 3G1SA 1KFJA 1GYLA 4O28A 3EWYA 1OK4A 4EF8A 2Z2UA 1NEYA 4LS1A 4HPXA 3QMSA 4MJMA 4ZQOA 4NJHA 3N34A 1GJPA 2ABAA 3GXPA 1TQXA 1W31A 4N4QA 3TKFA 2AQWA 4Y8FA 3NNTA 4IPIA 5AOUA 2PRHA 3W7JA 1IGSA 3NOEA 2DZWA 4JTTA 5I3FA 3NA8A 2QKFA 3ABOA 4UTMA 4JYFA 4GWEA 1O94A 2C19A 2B4GA 3UPWA 3UYCA 2QUUA 3FEMA 2E6DA 4ZQCA 3W2KA 1S5WA 2H6RA 4LVBA 3O07A 2CZ5A 1SO3A 1EIXA 4O19A 2B7QA 4DO5A 4M6VA 3S1VA 2X16A 3W6YA 2YPIA 2WO5A 4ZQPA 4YCOA 1DL3A 5T26A 2FIQA 3R12A 1TPEA 1L9WA 5EY5A 1GVSA 3QMRA 1VGAA 2P10A 3WJSA 4RV8A 3EX1A 3QM3A 3MP4A 3LV6A 3STCA 3SI9A 3W23A 4EVZA 4MZ1A 3SSJA 3PBYA 5G2IA 4Q33A 1B4EA 1FWRA 3C6CA 4R7JA 4Z0JA 3NAVA 3G0XA 3CM4A 3PSVA 3VFLA 3S1WA 3S8HA 2ZZ6A 3A21A 4O11A 1GQNA 1LZOA 3C8FA 1DQXA 3IVTA 4UTUA 3LHTA 5LNVA 5EA9A 4FNSA 1K8ZA 1QAPA 1Q6QA 1QPNA 3E12A 3NPVA 1O5XA 1TREA 4M19A 3W9ZA 5DELA 4AVFA 5GVJA 4CNPA 1Q3NA 3W87A 1NF7A 5K7JA 1E51A 3B06A 3GKAA 3HG3A 4K7VA 1LRNA 3QQ1A 1DORA 4LVDA 4Z1BA 3B0VC 1WV2A 1H7PA 4O0KA 4JTUA 3DI0A 5G2HA 1Q6LA 4HN4A 1SO6A 1ME9A 4LUJA 4XKYA 5HUOA 1SFJA 4O4VA 3MP5A 4ML9A 5FF3A 3A23A 3NQFA 4FEZA 5CZJA 4AEOA 2ZZ3A 3Q94A 5AHIA 4JGDA 4M7TA 3O6CA 4NJIA 1XUUA 4QNEA 1MSSA 3KFTA 2OZ0A 2E77A 5EYWA 3S5ZA 3EKZA 3KAOA 3HPXA 2EAWA 3M5XA 1JRBA 4BF9A 5FI8A 2G95A 3Q37A 1LP6A 4MY8A 1BTMA 4N9DA 4UC5A 2XFWA 3NGJA 5CPMA 2H8XA 3T55A 1X6UA 2ATSA 2Y88A 1R46A 2BSLA 4UFMA 4DBDA 1L6WA 3T40A 2NLIA 5HULA 2Z6JA 5DCEA 5CPOA 3TMLA 3G8EA 2NWSA 1O5KA 4IX0A 2Q3RA 4I9AA 1L2UA 1GG1A 3B04A 2ZBTA 5AHFA 1PE1A 3IRDA 3W2JA 3WJZA 3WJYA 2V9DA 2R14A 1KBIA 3OBKA 2C16A 2HS6A 1RD5A 5FESA 2PURA 1UUMA 3DHFA 2YGYA 3P80A 4WOZA 3S1UA 1F5ZA 1THFD 1XKYA 1K7EA 3NPUA 3LI0A 3PM6A 1XC4A 4OWGA 2O7QA 4O15A 4UMCA 3IVUA 1KM6A 7TIMA 5FEXA 2GQAA 2X1RA 3L68A 1OX6A 1RQBA 1FDJA 1J5TA 4LUIA 3CQ0A 4UR8A 4JS3A 3KXQA 1OABA 2I1OA 3U8GA 4CCDA 5CPLA 2ZFAA 3M47A 2UV8G 2Y63A 1SUXA 2GQ8A 4CNOA 4O1AA 2ZA1A 5CPNA 3UY8A 2GJNA 1ZCOA 2E6AA 3HMJG 5K4ZA 2LLEA 3MUXA 1XBYA 3QQ0A 1D3HA 2CW6A 4O17A 2QCMA 3M0ZA 2A0NA 2JK2A 2VFDA 4N9BA 4IOTA 2QCDA 1G6CA 3W1QA 5E0KA 3G3MA 3NQVA 5HWMA 4OT7A 2GVGA 1JUBA 1TPB1 1GG0A 3LLFA 4IWWA 3LTYA 2X2GA 3HGJA 1HFBA 3TJXA 2ZA2A 4ADUA 3W1AA 1FCUA 1OFPA 3BGGA 3E49A 3HJZA 1KW1A 3NM1A 3G1DA 1C29A 4OV9A 2TPSA 1PVNA 3EWBX 3KVMA 1UB3A 3LGEA 4LC6A 4S2CA 1TTQA 3DI1A 3BW2A 3SECA 3WJXA 3KRUA 3EWUA 2J9XA 1RQHA 4ADTA 1ZHAA 1YXYA 3TSDA 1OYAA 2BTMA 3DXIA 2ZTKA 2Q8ZA 2FPTA 4RKAA 3I7QA 4DQWA 4PH6A 1TPC1 4PA8A 1JCYA 5K4XA 1JCXA 5A5WA 3SIZA 3AO0A 3CWNA 3P8IA 4BR1A 4E0CA 3PUDA 3D0CA 3O6DA 2A7RA 3NL3A 3L0KA 3PUOA 4W9TA 3QW4B 3ABRA 4FO4A 1GTHA 3O6YX 3DFOA 3G22A 3VKJA 4GNJA 4HPJA 1VH7A 2ZRWA 4JN6A 1TPUA 4R53A 1OYCA 1LOLA 3W88A 2Z0IA 4N9EA 1FBAA 3O05A 1DOSA 1J2WA 4O13A 3MMTA 3L0GA 4LT9A 5AHLA 3W7PA 4NNAA 1U5JA 1KTBA 4ZQMA 3HB9A 4U4MA 1G7VA
chains in the Genus database with same CATH superfamily
2D24A 2CBJA 3C3UA 3QGVA 3U2EA 1WB0A 3BG3A 3WF3A 4L9YA 1FUYA 3AXKA 4CQ8A 3T0TA 2WNQA 2EQDA 3T78A 3TEVA 1FWHC 4XZNX 2ON3A 3UCCA 5A6TC 1UMYA 2Q8XA 4LAKA 4X0VA 5REQA 3NXLA 1KLZA 4LUSB 1CB7B 4ORIA 4JR5A 4CKQA 4W7UA 3NDYA 1Q6RA 1W37A 3GR8A 1VFLA 3FN9A 2OZTA 4R5EA 4UNIA 2XIIA 1FWGC 3KOWA 4URIA 4XBSA 3N17A 1GEHA 1UJQA 4IUGA 4MNKA 3IK2A 1XG4A 1E9IA 5TNVA 1H7OA 2BOEX 4AUBA 4CD8A 4KFPA 3DESA 3PPGA 1US2A 4PMNA 1E9LA 4O16A 2Y7GA 3AICA 3DFTA 1EZ2A 1KV8A 4AF0B 1MXSA 3WD3A 3E3HA 3U4FA 4TV5A 4MKVA 4XUGA 2PDPA 1EO7A 4O52A 5FF4A 5KEZA 1GVFA 5DQPA 2Q09A 2JFEX 3C86A 3LCXA 4IIFA 3BAKA 1Q5MA 1IEXA 5C0QA 1A0EA 3FDKA 4GIRA 4RV3A 4IFKB 1LOSA 2VC5A 4D71A 3BMWA 3DC0A 4YTRA 3GFXA 1M7OA 1KM5A 4HTBA 4BS0A 4XTIA 4MY1A 3QN3A 1TPDA 3FSUA 1DBTA 1FXQA 3IJ7A 4XWUA 1NARA 4QJ1A 2ESCA 3MZ2A 1JUKA 5AYIA 4GIYA 4UTFA 5LHEA 3MDWA 1KRMA 5A6KA 4XV0A 3WFLA 5A6MA 1M1BA 1W3KA 3QYSA 1OINA 2V38A 2UY4A 2VNCA 4LS2A 4RJEA 3GYCA 5TF0A 4K6AA 5I02A 5HJXA 3UJSA 1W3HA 5D05A 1QI3A 3RU8X 4R9OA 3T0BA 3MSDA 2BLEA 2CLMA 3S2LA 3STEA 4CQ9A 2XSBA 2Z26A 1NY1A 1ML1A 5CSUA 5FSEC 3ZT5A 3NSMA 1LROA 4E2DA 3KEHA 5EPDA 2CC0A 1PIGA 1FHDA 4AU0A 3MV11 4J3VA 1HKKA 3HV9A 3EA2A 4JXCA 4BY3A 2FDSA 3B8SA 4CVWA 3KS5A 1SSGA 2RGLA 4B4HA 2C71A 3DG7A 4ICCX 3UA4A 3N73A 1FOBA 1ZP3A 1TJ2A 1ZENA 1TA3A 3O2LA 1SFTA 3HO8A 5CGTA 3HPFA 4MB1A 3W1UA 3F4WA 1R5YA 5IDZA 5D04C 3EXTA 4KEZA 4GCXA 2YIHA 3WZ0E 3WEOA 3TFCA 3AROA 4LCRA 1F07A 1IZKA 1WOBA 2QNEA 8CGTA 3DFYA 4S3DA 3K5XA 3V5OA 4F8XA 2GJXA 5GPRA 4UNLA 4WJEA 5FJPA 4PUUA 1P7TA 4DUVA 2PTYA 4AC1X 4CQCA 4P2VA 4DELA 5CBIA 5CC3A 1PB0A 2R1MA 2Y8UA 4AIEA 2XSXA 3ERPA 3KWSA 4QTGA 1MUWA 3PVFA 3ZR4A 3Q45A 2MNRA 3W25A 3CQJA 1R7AA 4S38A 4BI6A 3G0UA 1XLMA 1X6NA 1PPIA 3THQA 5F2GA 2I9UA 2AL2B 3MS8A 1JCJA 3CAWA 1TR1A 4JQAA 4AEFA 2CFFA 4GY1A 3VUSA 4G5DA 1T99A 3VILA 6REQB 2CHRA 3PR2A 3IJQA 3GR7A 2XN0A 4WGXA 4ES4A 4RE4A 2Z27A 1E56A 3VZXA 4E8DA 1TZ9A 4U5KA 3FA5A 1HL8A 2X1SA 3U57A 3KL0A 2Y8KA 4UFKA 3M0VA 3TYAA 2R8WA 1GCYA 3ME3A 4H7VA 3CZEA 4O8AA 3AU6A 3UPMA 1EDQA 4DHGA 3U7VA 3THAA 2G3JA 3EXRA 3IGHX 3UWEA 2QDEA 3QC3A 4WK9A 1P43A 3SGUA 1VR6A 2E9MA 1DWGM 1W9BM 2EPHA 1H7WA 1U1UA 4TV6A 4ZB2A 5DFAA 3N3MA 1JR1A 2DQXA 3VNKA 4FPSA 5ECVA 1HG3A 1TUFA 2EXOA 1UA3A 2YL8A 3ZSSA 3MVIA 4LV9A 2I7GA 1ICSA 3WMSA 3OGRA 3YPIA 2WC3A 1ZALA 3AALA 1I2RA 4P7LA 4JTJA 3LB0A 1PTDA 2V5CA 4S3BA 2Y85A 3DG6A 1QO5A 4ZQRA 2JQXA 3N13A 3VFCA 1SGJA 2ZUUA 3R79A 2ZCGA 1V93A 1AH4A 5BRBA 4XK2A 2OEJA 3BJSA 3N2XA 5MHBA 3W7MA 3NWRA 3TWBA 1S2CA 4AW7A 3LERA 2P50A 1SMDA 1RCQA 4MUPA 6XIAA 3AZTA 2Z6IA 4GUHA 3G1XA 3TSMA 1K8CA 4ILSA 4AZ7A 1YTEA 1UKPA 4JAWA 4Y96A 1H09A 1T6MA 1V6XA 2X7VA 2EG7A 1UZ1A 3SW6A 3U2CA 2WWDA 1E73M 1A80A 3AHZA 3GUWA 4DJDD 5B7ZA 5KZ6A 2A6NA 3LXCA 1H0GA 1AMKA 3AWOA 3DIPA 3HPZA 1H11A 1XSJA 1GZ1A 2CHOA 4GJ1A 2YSWA 3RF9A 4AAJA 1MRAA 5DT7A 4Q22A 3AMDA 4B5WA 4WDTA 3CV1A 4QROA 4RXFA 3C2OA 2PDCA 3S6TA 1VFOA 3AHXA 4Y9AA 1DJWA 4GUJA 4US5D 1Z69A 4AIUA 2AQVA 1ME8A 1OC7A 5KSWA 4NILA 3UZ5A 4Q8NA 3MWAA 5I3KA 1XLDA 1DIEA 2IQTA 1OFDA 5TD4A 1Q85A 4LGXA 2CZDA 1X1OA 3CHEA 1YPIA 1C8QA 2NQJA 1B5TA 4ALDA 1K9DA 4JYEA 1J0KA 5LNUA 3N25A 4JZ5A 1VZWA 1ZFJA 3LBMA 1L6SA 4AVOA 1Y0EA 1GOQA 1JI2A 1VYSX 1R2TA 4ADSA 4LRSA 1Q6DA 1WXJA 2XH4A 4QBXA 1W5QA 1KBLA 3AHYA 5CZ0A 4GUIA 3TYUA 4JNYA 1SJAA 4RDYA 1R3TA 2PDKA 2I5GA 3RJXA 2JE8A 1JXKA 5HPCA 2ICSA 5HWNA 1QRQA 3E02A 4MYXA 1UIPA 4Y9MA 1FH8A 1ZL1A 5DANA 1TPH1 5B7YA 4ZO8A 2VFFA 1KCLA 4PUNA 4UTWA 3BL3A 3R11A 1OD0A 1PSCA 3WD1A 3CQIA 2WQPA 4MKNA 4TX9A 1XIGA 4MJ4A 1WZMA 3GTHA 4UTTA 1A5UA 3IPWA 1SJCA 2VEIA 4H00A 4HVXA 4M29A 1OFQA 1X7FA 2B31A 4O14A 3W1XA 4JTQA 1R9XA 3OVRA 3NZPA 5T9CE 3TW6A 1EKOA 4FX8A 4XAZA 2WHLA 4XZMX 3WCZA 5IHRA 1W3NA 1XDMA 3EEGA 1IWPA 4UTWC 2R9RA 2DT1A 4YYCA 3PF3A 3T1GA 2WZHA 2WKLA 1UH3A 1W2PA 3W2NA 1ZAJA 4DNMA 1DVJA 4F66A 2XVGA 2PMQA 1SSDA 2WMKA 3U2OA 1PUDA 3B0UX 4HJWA 4UTTC 4INFA 3VDAA 1E71M 4IIDA 4HJFA 3SCWA 3O16A 4AF0A 1D7FA 3EOLA 3UNTA 1L6FA 2FVMA 1CXLA 2G8ZA 2ZIDA 2HK1A 2PD9A 3MKVA 4A8IA 4DRSA 3ARVA 3PBGA 4H8UA 2XIOA 1EP3A 3VINA 3P7YA 5GJPA 3LG3A 2QJNA 4K7YA 4W84A 1CX9A 3P5YA 3EOUA 4H8NA 2QPUA 1IXOA 1GVOA 1WZLA 2B7NA 4J40A 2QUMA 3EDJA 3H7UA 4HNCA 1V3MA 1UWIA 5HNNA 2VQTA 2VYOA 4QX4A 4XD3A 1EUAA 3GXTA 5H8PA 5DMYA 3GK0A 3L7RA 3N11A 3U0HA 2ISSA 1UQYA 3QW3A 5RUBA 1KCZA 1J6PA 4QG9A 3VGHA 1JZ2A 4KWUA 1XPYA 2QGHA 1BWKA 1IZJA 5GJMA 3POCA 4JDYA 4LALA 4XAPA 3MVTA 2WV8A 1T96A 3TX9A 2JKAA 2OEMA 3WQVA 2BASA 4MSSA 4NRRA 4C90A 1V6WA 1JYNA 2EPLX 1Q7MA 2FLIA 4LC8A 1G69A 4O0QA 4YJ5A 3QPYA 4ZOEA 3TJIA 3C56A 3ARWA 1V4YA 5K9DA 3JZEA 3PBUA 2FFIA 3BK0A 1JQXA 4YNGA 3W07A 3QV9A 4PULA 3AIUA 2ZUSA 2BFGA 3I65A 3U6WA 5JH1A 3HQPA 3UBPC 3FA3A 1JFHA 4AYSA 1VENA 4HSNA 4QE1A 2D2GA 4I6KA 3VTRA 3VI2A 5BU6A 2NX9A 1HVQA 2PWDA 3OG3A 5DCDA 1YE4A 3W83A 3INPA 3S1XA 4ZOAA 1NWSA 1NDWA 3L12A 2H9AB 1GKQA 5EFFA 1NFBA 3QY7A 3B4YA 4PMUA 1IQ8A 4OQVA 4PSRA 1G67A 4WZHA 1ADOA 4V27A 4LTSA 2E3ZA 3EZ4A 1WX0A 1XLHA 2J27A 2J7HA 2P8CA 3W24A 2PTDA 1KV5A 3BAXA 4V33A 4DF0A 5ABHA 1LOQA 3C2EA 2VTFA 4W7WA 3AS2A 4C6JA 4NZ5A 3WUEA 2Q71A 2DFAA 4PSPA 1OGSA 4MM1A 2PLKA 3LK6A 5JBDA 2VFHA 4GCAA 3EX2A 5CXPA 2PLJA 3RITA 4NU7A 3ARXA 6XIMA 1OK6A 2PDYA 4O1CA 3UJFA 1MW3A 3WNOA 3PTQA 3A22A 4GRSA 1M7PA 3F5JA 1WE5A 1UIOA 1M01A 3DFQA 1JD7A 1W9UA 4IJBA 3PB0A 1K8YA 4PRWA 2YBTA 2AL2A 5BMXA 1OT1A 4FNTA 4QAWA 4IMCA 2CLEA 3I68A 4I7UA 3RCYA 2AKZA 4N6EA 1FHVA 3MKCA 1UWUA 1PS9A 4YCPA 5BU9A 5A8PA 1DWIM 1OIMA 3ITVA 1TO3A 2W0UA 4K8HA 2PD5A 4E3VA 3AYVA 1SZEA 3TH6A 1F4AA 5E09A 4JTEA 1K03A 4DXVA 3V3WA 1I0BA 4KERA 3FJNA 1HT6A 3FNDA 4GZJA 3QMTA 1AQHA 3F5LA 3ABZA 5CCZA 2NV1A 2XN1A 2GVJA 1XLAA 1QHOA 4P61A 3FHAA 5HNUA 4PCSA 3WQ5A 4GE8A 2GZXA 2YW4A 3PUGA 1NJJA 3WQ4A 2XYLA 4QJ5B 1DV7A 1JF6A 1AL7A 1DJHA 5FJUA 2FFCA 5JU6A 2DEPA 4ZE5A 4ZXOA 2A2IA 3LGDA 3QOKA 2ZQ0A 2ZWYA 4GYFA 3GVWA 2VD9A 3VDHA 2QF8A 1XH1A 1OX4B 2XH2A 5EMLA 2OGYA 2DZPA 3QHNA 4FR6A 4YWIA 3W2UA 1HO4A 1CGVA 2NQZA 2V63A 5AHMA 1PAMA 5I0DA 3BJTA 1I1WA 4TX6A 5BWFA 5MKGB 4A05A 5HBFA 2I5QA 3HG5A 1SMAA 2XJ7A 1FFQA 1WCGA 3BO9A 4W86A 1QASA 2FZMA 1BYCA 5IDIA 4JFSA 5LYRA 3U9IA 1XYBA 1B0IA 1LQAA 2OGJA 3W7HA 2QGYA 3WQWA 3PPHA 3NPXA 2F9RA 1KQZA 5AYZA 5CG0A 2D22A 4HU0A 4WX2A 3S5NA 4RZ6A 3W4RA 3B0PA 3L4VA 3W7DA 4UCGA 3H4WA 3W75A 4LEFA 2BVWA 1G0CA 4UOQA 1E72M 3LNMA 3ZZ1A 4NNCA 1VBHA 3GW3A 1UASA 2VKZG 3GUGA 4D6DA 4CD5A 1XRTA 1FP9A 2GJLA 2OEKA 4L9ZA 5DCBA 2RKXA 4X3ZA 2FZBA 3APGA 3C3NA 1UR9A 4I5UA 4GJJA 3V5CA 3WIJA 3C2RA 4GQBA 4H6KA 5G4WA 2V6AA 2HE8A 4TMBA 2RDTA 3W7QA 3OOQA 4WD0A 4GH3A 3L4UA 4IP7A 3R0DA 1T5AA 4GZ7A 1BQGA 5BNKA 2CBUA 1TWDA 4POCA 1PCKA 4HBKA 1KA9F 4KWVA 3RX3A 1HQTA 3DOPA 3GC4A 2BDQA 1CWYA 4CEUC 1ZPTA 2QCNA 3ITTA 1ZY9A 4WDUA 3NDOA 4TVCA 1XLKA 2V3DA 1R3QA 4HHLA 5DX7A 4AYGA 4J1OA 5DY3A 2XVPA 1O66A 2AMXA 1HL2A 2ZZ1A 2HMCA 3RR4A 2QV4A 3EA1A 4LRTA 2C91A 3ALFA 3VM5A 3VD3A 1GOOA 3BANA 5BYWA 2D73A 4LJ3A 3E0LA 1W1PA 3IIVA 3VKBA 3S2CA 4G1KA 4JN8A 1Q8AA 4JQ1A 3EEZA 3TQVA 1MNSA 5ABGA 3CU2A 1ITCA 2KZHA 4LH8A 4L4PA 1PWMA 4PTNA 4WJ8A 2AL1A 2Y5JA 4NX0A 4HCLA 5JUVA 4OV4A 2WWCA 4QE5A 3NQ2A 4GBDA 3P8JA 3CPUA 1K6AA 3O6AA 4K38A 1EO5A 3TSBA 5JBFA 1Q6GA 4S39A 2E28A 3GXMA 3MHFA 4L4LA 4NZFA 1TQJA 5BRQA 1YPXA 1U83A 1SO4A 4L6DA 3WQOA 1SU5A 5D9MA 2ZXDA 5FF7A 4FNPA 4WRHA 5D2WA 4GGBA 1WAWA 3O15A 4C6EA 2QUVA 3ZMRA 4W93A 3HQOA 1V02E 3L4WA 4KFNA 3MHUA 5F4XA 3OQEA 2OU4A 2FZNA 3PZQA 4DWSA 2QT3A 3AIRA 4YPJA 3ZLFA 1BYBA 1NTHA 3IS4A 1CZ1A 5J04A 1RLCL 4H8HA 3LMYA 2WMFA 5DBUA 1E6RA 3QR0A 3AXHA 3VC6A 1ZS2A 2FH8A 4F2TA 4PL2A 1P0EA 3KCOA 1BHGA 3H2CA 3W3OA 3O3RA 3AIEA 1DEDA 4XIAA 3ES7A 4MPQA 2QR6A 4XZHA 1A50A 4L56A 2ZDRA 4A4AA 3EDDA 4KBXA 5DMNA 1PWLA 3EOSA 1IT0A 5A2CA 4DWSC 3RK8A 1XL9A 4TTUA 5HATA 2YZRA 4QGCA 1OF8A 1QNQA 3PZTA 3VCRA 3GW0A 4WKFA 4ZTXA 1IEQA 1B1YA 3D47A 2VJXA 4IHCA 1JCMP 4P8XA 1V6VA 1NWRA 2CPUA 2Y89A 4GA8A 3NOYA 2GUUA 3WEMA 4DZAA 1H5YA 1E3XA 2OWCA 4M82A 3IANA 3QC0A 1V5XA 1T0OA 2OYMA 3PP7A 4M7SA 1H1YA 4NAFA 5D37A 4GH1A 2HVOA 4HHPA 1JCTA 3P84A 1AMYA 2DIKA 1WNOA 4RZ4A 1F6YA 1P1XA 3M7WA 3MP3A 4RDVA 1SYTA 3F2BA 3IV3A 3P6LA 1U1JA 2PRLA 3MDUA 1XHGA 2I57A 1O12A 2QS8A 5D33A 2QCEA 3T2QA 1QUMA 1OYBA 3RHGA 3W1MA 1ISXA 1DXEA 1KRAC 2WB5A 1VCGA 4ZCWA 5K2ZA 3MZNA 4KS0A 1B9BA 1TTJA 2TYSA 3MUIA 4HQVA 4EXAA 4M6QA 1DPMA 2CXEA 1X6LA 1UOZA 2O7SA 1B4KA 4TOQA 2NW0A 3G1SA 3OYZA 4O28A 4F40A 2NQ5A 2OXNA 1NEYA 3V0SA 4HPXA 4HYVA 2X8RA 4ICMA 4P8UA 3GNXA 3N34A 1GJPA 3GXPA 1QNSA 4N7QA 1TQXA 4HOXA 4DBWA 3TKFA 1D8WA 2AQWA 3W7JA 2E8YA 1IGSA 2JIEA 3N04A 2QKFA 1ZZMA 4J3ZA 4JYFA 3ZSTA 4IFOA 4MPKA 1O94A 2C19A 3UYCA 1BF2A 2QUUA 9RUBA 1BAGA 1XD0A 3PZ9A 4YIWA 5C8BB 4Q8VA 1EXPA 1E0VA 1EIXA 3CPGA 3ARTA 3AIVA 2ZXQA 1TE6A 2VO5A 4DO5A 3R1ZA 1JL8A 5M5DA 1CGTA 4UQAA 1DL3A 1UKOA 1CXKA 3R12A 3XIMA 1GVSA 2IW0A 3EX1A 4Q7NA 3EDEA 4Q8QA 3STCA 3UZZA 3APTA 2IPFA 4H2HA 4EVZA 4MZ1A 3PBYA 3RDKA 4FLOA 4Q33A 1B4EA 4LF1A 3VFLA 3G0XA 3CM4A 4ATDA 5CJMA 1E0UA 4MB5A 1LZOA 4GJIA 2RJGA 4AQLA 3IVTA 1K8ZA 1JPMA 2VP8A 4KGLA 1TREA 4LPCA 4YVVA 2VUNA 5GVJA 3LQGA 3R8GA 2V68A 4W89A 1NF7A 5K7JA 1E51A 3B06A 3BMVA 3QQ1A 1DORA 3QR1A 4Z1BA 3B0VC 5HQLA 1K9TA 3DI0A 1Q6LA 1V03A 3TYCA 3ZVHB 2VX6A 3T0AA 3E0WA 1AUSL 2YDQA 3A23A 4H1ZA 5E6YA 3Q94A 4M7TA 1XUUA 1RPKA 3AFBA 1MSSA 3KAOA 1JI1A 3R4IA 3M5XA 2ACUA 4BF9A 2G95A 3U48A 5CPSA 4IG2B 2RAGA 4UC5A 3UGVA 1FTXA 2H8XA 2PZNA 1X6UA 2XPKA 4C5YA 3UR7A 3LA4A 3WD4A 5AZ1A 2OPJA 1CNVA 3QTPA 2OFJA 1O5KA 2VM8A 1AQMA 2F6XA 4IX0A 1E0TA 3CV7A 1GG1A 3AYTA 1Z7AA 2IXUA 1EC8A 3W2JA 2C79A 4LFYA 1KBIA 3OBKA 3AISA 1VJZA 1KNWA 2PURA 2YCIX 4ZEPA 1U5VA 1QT1A 3BZJA 4C60A 2PEVA 1FP8A 4R85A 5BROA 4HK5A 3S1UA 1F5ZA 4F0HA 3AAMA 1DWJM 1QNOA 1KM6A 2PPGA 5MKGA 3WUBA 2X1RA 3FYYA 2HNHA 2GVEA 3GO2A 4UR8A 4JS3A 3KXQA 2OTDA 4L1GA 2GQ8A 2WW5A 4X60A 3UY8A 1RH9A 2E6AA 1UUQA 2PC8A 1CGYA 3TYZA 2LLEA 1NWTA 5H8MA 4PTWA 3OYXA 3NVDA 3WNNA 2A0NA 1ADSA 2C7FA 2AAAA 5HWMA 1ELSA 4FSAA 4OT7A 3CYVA 4Q4MA 2FMNA 2O9TA 2XDFA 1TPB1 1GG0A 4PCPA 1HFBA 2ZA2A 4IT1A 4ADUA 4RZBA 4JIHA 1FCUA 3HJZA 4DJEA 3DYMA 2TPSA 3PJWA 3EWBX 1UB3A 1AVAA 3GXFA 3LGEA 3DN5A 2DV0A 2J62A 3BW2A 3EWUA 1MI3A 1U5HA 2VZUA 3ARRA 4S3JA 1YXYA 3OIHA 1X38A 5HPOA 4AMCA 3DXIA 3I7QA 2OQLA 4HPNA 3P8IA 1KD0A 1DJYA 1P48A 3D0CA 3O6DA 3VD7A 1QW7A 3QW4B 4MAZA 4RW5A 8XIMA 3C0QA 3NDZA 1DWAM 5ECUA 4DJED 4OKDA 2DVUA 3G22A 3VKJA 2DH2A 3B8VA 3WD2A 1CGWA 1FFRA 2ZRWA 3MWCA 1JPKA 1OYCA 4DJEC 1LOLA 1Q6FA 4CNUA 2ZUWA 1GQLA 3MMTA 3RX2A 4GI6A 2A3BA 3W7PA 7REQB 2G3NA 1KTBA 3AOFA 4FP1A 4ZQMA 3GVVA 4H6QA 4U4MA 2EBNA 3FK4A 1KFLA 3VAVA 3CUIA 1LTDA 3ZJKA 1ITQA 4K39A 4DAFA 4LY4A 4EPKA 4UZSA 1FWFC 3LV5A 5I3GA 1LRQA 3T07A 1X1ZA 1XG3A 1NOFA 4A8LA 4MNMA 1O6IA 1GOXA 2OCZA 3PWIA 1KCXA 3NJ3A 3TJLA 4PMQA 3V7PA 1HO1A 1FXPA 3RUBL 4DM1A 5JH2A 4MTVA 1WXZA 3TR2A 1W1ZA 4JIQA 1IEWA 1VBRA 3DKLA 2WZEA 2PDJA 4HIBA 1ONEA 4AHQA 4D2JA 1F61A 3QR3A 1WAUA 4DM2A 3MSYA 3MUZ1 1D2KA 4PCFA 3W6LA 4TIMA 1V0NA 3OVQA 3DFHA 3HJEA 4U28A 1EF2A 1SJBA 5FF2A 2QIWA 3TV8A 3EWZA 1GVRA 1VBGA 1GONA 3WK2A 1KWGA 1OSEA 3C0JA 4CNSA 1Q2RA 2WMIA 4GC4A 2XIJA 4Z1CA 2G5WA 1NQKA 2B7PA 1P0KA 3N2CA 4Q8PA 4LU0A 3MSGA 1NAL1 1R86A 3CLMA 3ENLA 1XGEA 1OQFA 2NUWA 2OKOA 2C8NA 4E4FA 5F4SA 3W76A 3Q65A 3FYPA 4C6QA 4B5TA 3RM9A 4R7WA 1QVBA 1TVNA 3GG0A 3L0NA 5ABEA 4MYAA 3WSUA 3ZWTA 1XQKA 3WLHA 2BGQA 3CL8A 2NUYA 2W63A 3IARA 3FKRA 1NVMA 4MWAE 4IIBA 1VCVA 1G4TA 1RK6A 3O63A 2FHCA 1JXJA 3TAKA 4EXQA 1QK0A 3NO5A 3L5MA 1QPKA 3ONCA 5LIXX 3L65A 4U3AA 5FEWA 3VDGA 1I45A 4RUBA 3CZJA 2ZZ2A 1U2YA 1FKWA 1TTIA 2EKGA 3PBWA 3LTPA 3SBFA 2WZTA 4GY7A 5D38A 3DYPA 4FXRA 4PTDA 3B4UA 3UWVA 7ODCA 1CBGA 3CWOX 1UD4A 4J28A 1RD6A 3LCGA 1DXIA 4HTYA 4ZSTA 2R1NA 3ITCA 3UVIA 1VC4A 2GGEA 4O1EA 2G97A 1G4EA 3ARUA 1FWJC 4XD4A 2UZ9A 3LCHA 1PDZA 1TPFA 5DXXA 1BEUA 2POZA 4P7RA 1FDYA 1B30A 1UPPA 6CGTA 1SFSA 1H7NA 4YN5A 3BSMA 2YDAA 3W1RA 1UOKA 1R3WA 1MUCA 3UWYA 4JTHA 3AIBA 2D69A 4FIRA 4UFHA 3M0KA 3BAIA 1E70M 1MMFA 1B3OA 2O55A 4HCHA 3B40A 2E8ZA 2X7WA 1IHIA 3GRIA 5U7SA 1VEPA 3M6YA 1R2SA 5BXPA 3KRSA 4FX6M 2VDGA 1PZ1A 4UMAA 4WUIA 2CLHA 2QUNA 3K2GA 1XIMA 1SO5A 3EPNA 4V28A 1QFEA 3TXZA 2PC4A 2X0HA 3BQ6A 3KCJA 2CZFA 2EO7A 1W17A 1I2PA 4Q32A 5KTLA 2WBKA 2OVLA 4U31A 4GHRA 3ZOAA 2F61A 4MFEA 4Q8TA 2I14A 4KRUA 2DZSA 4FNQA 2C0AA 3C5QA 3R58A 4RDWA 2GGGA 4F0SA 3M5VA 2NQ9A 4RCXA 5BZAA 3VNLA 3BWWA 1MQRA 2RHGA 3EOOA 3R10A 3NVTA 1I9CB 1QI2A 1UKSA 1XLJA 3UXKA 3AXMA 5D2XA 4Y6GA 4R33A 2VEFA 3W28A 3GYEA 4AEEA 3B8IA 3N18A 3LRKA 1F8MA 1EQCA 3I7SA 3L66A 2PTZA 3KDOA 1DTUA 2J7DA 5LNWA 3NR0A 2F38A 4NHVA 5LZLA 2Z1VA 3I4EA 4ZBCA 3BCFA 5AVHA 2UY3A 4AZ5A 3HOJA 2C14A 5I5RA 2V2HA 4DN1A 4L64A 2BZNA 4WSJA 3NPWA 3MMWA 1SZFA 4QG8A 3LRMA 4JKKA 4OGZA 2R24A 3TZFA 1XCXA 5BCAA 2ACRA 3N3TA 4DI9A 3VE7A 2FZ8A 4Q4KA 5AC5A 4M5PA 3BSGA 5JXQA 4CD4A 3MYOA 4WCJA 5EFDA 1Q7ZA 4FXFA 1JPDX 3COTA 4YTUA 4HMCA 3UESA 1H60A 1KBKA 3SUUA 1MRQA 1HIZA 4QFUA 4J7RA 3F5KA 3CUHA 2BOFX 4E3TA 4DI8A 3OLEA 3MBDA 2J4GA 6ENLA 4GBUA 1OCNA 3R2GA 1WYIA 1PJ9A 3DYOA 1EGMA 3GDTA 4HA1A 3H23A 2WAGA 4EPBC 3W0KA 1HKJA 3ARPA 2R1PA 4JX6A 1HP5A 1ZUAX 3FJ4A 1TZ7A 4F0MA 4IICA 3VZYA 1UP3A 3QSTA 4A3UA 4D9PA 1RJRA 2F84A 3K4DA 3WK1A 2KAUC 2BMBA 2X30A 4S3GA 1RV8A 2WSRA 4DBEA 5LHFA 1XDLA 3V35A 4LF2A 3OLDA 3TC7A 2J7BA 4N4PA 1N8FA 1HL9A 3W2LA 3NYZA 3B9NA 3CMGA 4YTTA 3KBWA 2UBPC 3MW7A 1P6CA 2DVXA 3TTQA 1N8WA 1NF0A 3W6MA 4PCTA 2OJPA 1W0MA 1DJXA 3FKKA 1R3RA 2WKGA 1TE1A 3GC5A 3UNDA 3QEZA 3TW7A 1ZQ5A 4QHRA 2QV5A 2REQA 2W9MA 2Y24A 4JX4A 5I3JA 2ZYFA 4LY8A 3NL5A 4X2RA 3MCOA 3VIJA 3EMCA 3EPMA 4WF7A 4HPGA 5CC7A 1QTWA 4HNUA 3QTGA 3BMXA 2NSXA 2YKKA 2BHYA 1NM9A 3DERA 3I7RA 4UFIA 1EEPA 3KM8A 3IJ8A 2EF9A 1RR2A 3HFTA 5BRPA 4U33A 1PTAA 4PBGA 3EB4A 3TYEA 3WBYA 1UP0A 1SPQA 2D2JA 2E67A 1AJ0A 3IGSA 1B3WA 1ME7A 2PI6A 4NZ4A 1DIKA 4HZMA 4G7EA 4DZHA 5KMYA 4D6CA 1W6TA 1CPUA 3VM7A 1JYWA 2YDRA 1S38A 3HFYA 3NTYA 1M68A 1QMLA 3GTNA 4NI3A 1CIUA 3S5SA 2Q6ZA 3KOFA 1CCWB 1MQQA 4WQ6A 1YTKA 1W9VA 4MDOA 2D2OA 3ELFA 2CERA 3AI0A 3VIFA 1I2QA 2ZKMX 3N14A 1TMHA 4IX2A 2F2HA 1TWIA 2CHNA 1YDNA 3P81A 1GVEA 4NJGA 1GVQA 1QPQA 3E0VA 4AD1A 4JD4A 3GXDA 1BRLB 3E1F1 4ORMA 4CQDA 2XZ9A 1SW3A 2CKRA 3P74A 3SCUA 1Q6OA 5AYXA 3W7IA 2BY2A 4ATLA 1LRTA 4KFOA 1QWKA 1CXEA 3VIMA 2CIPA 4I8DA 2ZRZA 4ZB5A 7TAAA 3K8LA 3K13A 1EJRC 4I6VA 3WDRA 3GBDA 3LDVA 2YA0A 3FOKA 1XGZA 4YL2A 3NL2A 4JFVA 2QLYA 1S2TA 3QV7A 5G1YA 3TC6A 2OR2A 4PTMA 1WQ5A 4AHOA 3W00A 4L1XA 1HGWA 1YYAA 2VGGA 2XTKA 1LLOA 3ARYA 1XYLA 4OOUA 3ZJ7A 1BG4A 1EX1A 1UP2A 1CI1A 1A5OC 2Z1SA 3VIPA 3EWCA 4JDBA 3I6RA 1VJSA 4Z2KA 1J79A 3M0LA 4WR3A 1KFWA 2RUSA 2D1ZA 4BI7A 4US6A 4AHPA 5A1AA 4ZSUA 2Z1BA 1OX5A 1QI5A 3GH4A 3V16A 4GUFA 3GKFA 3VIOA 4UB9A 3LY0A 4MFDA 2VRJA 4DNHA 3WBAA 2D20A 1TIMA 5I2UA 3CAVA 4Y8EA 3LD5A 4HNLA 2VOTA 2WM0A 1IV8A 2O9OA 2O56A 1TWSA 2G96A 1KFCA 1M03A 2Y7EA 2WHKA 3EYPA 3CH0A 1B90A 1JZ3A 1JD9A 4JTGA 5FIPA 1ZBKA 1X39A 3A4JA 4ACZB 3E5PA 3UXAA 3KUMA 4GOAA 2GGJA 4Y2WA 5LKYA 2ZUNA 2C1GA 3E9AA 1PZ2A 3EX3A 3O0FA 3M43A 5LIKX 3SCNA 4D6JA 3IK4A 2QMJA 2GQ9A 3WO8A 4A2SA 5I78A 1J18A 3PHAA 3SGZA 3G1AA 3T6CA 1UR2A 1K6WA 2DUZA 5C7VA 1HN1A 1NOWA 3LHVA 1E6NA 2VFIA 4R34A 3UXDA 4QDMA 4RX0A 2HBXA 5DXYA 1H5VA 4M80A 4GI4A 1V79A 1P5BA 1DKWA 5TIMA 3RN6A 3DFNA 1IT8A 4ZE4A 3ZLGA 2ADAA 3CHVA 4JNMA 1KGWA 2WLYA 1RPXA 1UR3M 3ZWSA 3H55A 2PWFA 3ZJ8A 3H70A 1HGYA 4B92A 4IMGA 1JDDA 1RZMA 3JR2A 1JZ7A 5G5IA 3T09A 3BW3A 2PA6A 1UD2A 4C6DA 5LNRA 1W3IA 1Q66A 3EAUA 5EMMA 3W82A 3A9IA 4GABA 5EU9A 3CV2A 3EB3A 4W5ZA 3A5VA 1EC9A 4H19A 5D9PA 3ISIX 4A21A 1YBQB 1E9YB 3VCCA 4DUOA 2JF6A 5D30A 4MZ8A 3UWQA 1TB3A 4KIEA 4BQ3A 1H62A 2H8ZA 3KX6A 2NX3A 3NO3A 4XZWA 3BSHA 2ATMA 3M7SA 3DX5A 3AMLA 5FAGA 2ZXAA 4MWAB 1Z48A 5HJLA 3JW7A 3WLSA 1KFBA 1J0YA 1J01A 1VRDA 1E1CB 2WZIA 1EJSC 3T8QA 3A24A 3SR7A 3G2GA 3KW3A 3RJYA 1KXHA 4H6EA 1A5AA 1D7KA 1XGDA 2OO0A 4B5NA 3VX1A 4AY7A 3S6OA 3ICJA 5LXXA 1EX5A 5CAKA 3L2LA 3UA3A 5A8QA 2J7FA 3LHWA 1XYCA 4OIFA 4MIMA 3STGA 1WDDA 3UF9A 3E0IA 2AKMA 1XUZA 4IXHA 4FNUA 4PB3A 3GDKA 3S5YA 1KGXA 4R88A 1LL6A 4M8UA 1UW9A 2QPXA 4MB4A 5FJRA 1JIBA 3P62A 4CN1A 2RDXA 4IUOA 3UD6A 2A7NA 2L5HA 4AH7A 1QBAA 3PAJA 1M6JA 8RUCA 2P5NA 4J2MA 2O9RA 1R6WA 4EF9A 1WBHA 3LENA 1XDJA 4MG4A 4IMFA 1KTNA 3URNA 2WMGA 4IQLA 3OQ8A 1MW2A 5FEPA 3VIGA 3VGDA 2QCFA 4UTKA 1JJKA 2A21A 5CQ1A 1VJIA 2VRQA 3ARZA 1R9YA 1B54A 1KBJA 5GQBA 5BXRA 4C6NA 3GDRA 1E6PA 5D2TA 3RCMA 4FLRA 4PUWA 4AX6A 1YPFA 3NQCA 1K4GA 5BXTA 2JIWA 2X1IA 5BOOA 1S5NA 4NY2A 1RCOB 1F6KA 3CHFA 4P8WA 2E4TA 2WC4A 2AGKA 5J8LA 1HJVA 2FH6A 3IIOA 1K8XA 4BI5A 1R2RA 2E1DA 3VXGA 1M5WA 5A95A 1EDTA 1F74A 1UMLA 1H41A 4FHAA 2X05A 2A3LA 1Y5XA 4N2YA 2V3EA 3ABSA 3W84A 3LPOA 1EPVA 3GTIA 4MVAA 1GJWA 2INZA 4X61A 1O4UA 4EXBA 5E0CA 1WDWA 3KP1A 4DIAA 3G6MA 3KOYA 4GFSA 5I6SA 1P0BA 2XH0A 4JHMA 4LUYA 3H26A 3OPSA 1PKMA 2Y8VA 4L61A 4E2BA 7ENLA 2P3EA 4XO6A 1XFCA 1MZHA 4ZO9A 2ZX5A 3P5ZA 3IGXA 4NZJA 5AKQA 4ZOCA 1QO2A 2VELA 2XVNA 3TVAA 1GJUA 4S3CA 1HP4A 2HSAA 1XLEA 3SCOA 5LIYX 2V30A 1WKFA 4E2VA 3L4TA 4XVEA 4L1WA 5FJIA 1TVLA 1W3JA 1EJ7L 2OKTA 2V5BA 4V1YA 1N7KA 3A5FA 5DRCA 3E2SA 4IL0A 4I5XA 4CNNA 3ARQA 2CBIA 4QP0A 4UQEA 4YVPA 3CAKA 3ZJ6A 4LEQA 1V3JA 3ID7A 1VQTA 4B91A 3WLKX 1UQZA 4H4IA 1XYAA 3VIIA 4FR1A 3WFZA 4BQ2A 1C3FA 2GVYA 1VHNA 4IL2A 1FWCC 2HISA 2Y61A 2FYMA 5G1MA 4JTFA 4CCZA 3UWZA 4PMXA 1TCDA 2BHUA 4BEUA 3D3FA 2PDBA 1UC5A 4O54A 3AMKA 4PMZA 2OSXA 3PG9A 1O5RA 4K68A 5C9WA 1RALA 2ANUA 3S9ZA 4WSKA 1ZBWA 2OZ8A 2WMHA 3WMLA 2F8QA 2P1FA 1XBVA 3L23A 3KWXA 3OW1A 3W1PA 1MQPA 2IPWA 5DEZA 2BOGX 2OZ3A 2I17A 4AB4A 1PBGA 1T8XA 3FVDA 3HF3A 3MSRA 2QCDB 1JDEA 3WKZA 1HJWA 1W8GA 3LQLA 5EB8A 2PB1A 4L80A 1A3WA 2PGFA 2EJ1A 1MFVA 2EKCA 2HWGA 4F48A 3N6JA 2F6KA 1OJXA 4KCUA 3MUY1 1IWAA 3U7BA 5AC7A 5C55A 2WHJA 5DN1A 1EUNA 1W1A1 1PX3A 3HIJA 4P7OA 2W62A 3W01A 2XHYA 2G3MA 1LF1A 5L9FA 3STPA 3NQEA 3L4YA 1TV7A 2R1KA 4RW3A 2X42A 3LXBA 4I9TA 2EG8A 3QZEA 3JU2A 1FY6A 4RDZA 3LPGA 4H8VA 3BZGA 3MPGA 4GY0A 3GLCA 5CKSA 3GX9A 1JDCA 3RCNA 2J8GA 4XZBA 3ZLHA 4C7DA 2BB0A 3A12A 4M24A 2BNJA 2PDUA 4YHEA 4ZB0A 5CSRA 4L65A 3NQBA 3QYQA 1XSIA 4E8CA 1IIHA 1JNEA 3PZOA 4JTAA 2H90A 2QUTA 3BC9A 3WLIA 1JCNA 3CUGA 3NQ6A 1IIGA 4O1FA 5I3HA 4JTLA 3N9SA 5HR6A 5T9BG 1A4LA 5DMLA 1KM3A 1K7FA 2CWNA 4WDXA 1V6YA 1PYFA 1PEZA 3PUEA 2Y70A 3B9EA 2QULA 4EPDC 3ABXA 2XGBA 3NGFA 5CZTA 2A3AA 3EDKA 1E6XM 2OO6A 4O57A 1TV2A 1PZ3A 1EEXA 3LTSA 1RP9A 3FDGA 3W1NA 2RDWA 2PBGA 4TU1A 3GG7A 2YYUA 3GD6A 4JQ2A 3TROA 1FHLA 4QJ3B 1F6PA 1RY0A 1LBFA 1Q7QA 5LSMA 5XIAA 3TNBA 2DJXA 1ZJIA 1YE6A 3VOFA 3KOZA 4MB3A 1H49A 4PB5A 1A5NC 3GQYA 3PTDA 2GLKA 4OVXA 3F1QA 4X2PA 3UP8A 2ZVIA 1UZDA 3FIGA 3SUTA 3M4HA 3HPSA 3IGUA 4XIMA 3TTSA 3VIHA 3W37A 1U1HA 4QLJA 3PN8A 1TG7A 3VNZA 3NEVA 1FH9A 2DT0A 1GYNA 3TLQA 3BCJA 3M64A 5D02A 2XISA 3S1GA 3CIVA 4GKLA 5A6BD 2J6VA 2QJIA 2J9ZA 2PUZA 1R3VA 4M1RA 2Q01A 4QCEA 3FEQA 3HGSA 4A29A 4H7CA 1JZ6A 4JTIA 1L6GA 5FACA 1XICA 2QJGA 3IAPA 1DJNA 5EMKA 4CCEA 2E1WA 1ZRQA 3CMFA 3SQSA 1TWZA 1V08A 4XBJA 3URAA 2YW3A 1FCVA 3CQHA 5E6ZA 2E5DA 3TLLA 3NXFA 3ATZA 1ITXA 2WM1A 1OFEA 4AWSA 4J3WA 3HM7A 2QDGA 1EOKA 3CS2A 2OT0A 4FAMA 2J75A 3D6NA 3DHPA 4W4QA 1R0MA 4JKLA 2PDMA 3G1YA 1YRRA 3DC8A 1EOMA 2Z00A 5KINA 3BPWA 4NL1A 1RHCA 3W7GA 1DJQA 2XFFA 4W8AA 3SUVA 2WMJA 3M9YA 1SZNA 3UERA 1AJZA 5TBOA 4P7QA 4HOZA 3AWNA 3OJGA 1BKSA 1LT8A 1YBQA 5K9CA 2DVTA 4I90A 4IJRA 4QSHA 3LI1A 3GIQA 4XBKA 4AD2A 3J7HA 1PKNA 4XUYA 4DUWA 1TPWA 4GK8A 3OZOA 3S2JA 1I4NA 2WCGA 2NXGA 1ECQA 3C8NA 3AUOA 4JQ3A 1GVYA 1A5KC 2BY1A 3GH7A 4NG3A 1XIDA 1TTPA 1KXTA 5H1WA 4UXDA 3IUHA 3UR8A 1OF6A 3KRZA 3WBEA 1RSCA 4BFAA 1SQ7A 3GTFA 3IJ6A 3Q58A 1T7LA 1DTNA 2G37A 2YR1A 3SY5A 4J3TA 4O10A 3HA1A 2ZRYA 4TO8A 4HHMA 4PFMA 1GPFA 2HXTA 1NDZA 4GNVA 5H6HA 3UG8A 2CCRA 4XZ9A 3EWWA 3K8MA 3TZNA 3II1A 4WY0F 2FVLA 1FCBA 1XYFA 3IUDA 3WL0A 3BW4A 3CB3A 1GYLA 1V7AA 4MWAD 1NP2A 3QMSA 1TV3A 1JFXA 2IPGA 5T91A 1AH3A 3WDPP 3KTCA 4DVOA 3NNTA 5AOUA 1B31A 1TV4A 1G01A 3NOEA 3ABOA 1G94A 1BSIA 3B9AA 4GWEA 4GYJA 1R3SA 3TONA 3VNYA 1D8CA 2E9LA 1V3LA 3V18A 5HMEA 1TJ0A 1NIUA 2WZMA 3W2KA 3DDMA 2ODOA 2X0YA 3O07A 1SO3A 4HA3A 2FVKA 1BYAA 3AC0A 4C91A 3S1VA 2Z24A 1QI4A 2BVTA 3MUAA 1XX1A 2ACQA 1QATA 2F2KA 4KCVA 4K1GA 5TAOA 2D3NA 4QDWA 1VGAA 5CPTA 3ITOA 3QM3A 4D6IA 4L6HA 2HCVA 3MP4A 3LV6A 3SUSA 3W53A 3SSJA 1HJSA 4R7JA 3S1WA 3PSVA 1UWAA 2OYKA 1LQ0A 1GQNA 1UR4A 1DQXA 4LAMA 4FNSA 1QAPA 3NPVA 4M19A 4XO7A 4PBFA 1XLLA 2ZDSA 2VCBA 1E4NA 3OVGA 1G1YA 1Q3NA 2OX4A 5FD0A 1F8IA 3W87A 4BEQA 1ISZA 3GH5A 3KBVA 4K7VA 3IUIA 3MTWA 4LVDA 2YCJA 1WV2A 1WXYA 2J7CA 4ACYA 4LUJA 2PDQA 3PBMA 3MP5A 4H01A 4CNTA 3NQFA 4ZFMA 4AEOA 4PUEA 1N82A 3UEQA 5LA2A 2OELA 3VOCA 1MFUA 3KFTA 3HPXA 4Z2JA 2EAWA 1JRBA 3WLNA 3CO4A 1YNYA 3Q37A 4P5UA 4C6OA 1LP6A 4N9DA 3A64A 4GMEA 4FOUA 5CPMA 3T55A 4WSHA 1UD8A 4BZYA 4DX3A 2ATSA 2Y88A 1A0CA 1V3IA 2BSLA 1Q63A 5HNTA 4UFMA 2FZDA 3QV6A 3FHQA 2Q02A 3CUJA 2Z6JA 1UROA 4M3PA 3KE0A 3RILA 4A8RA 3NYDA 1CLVA 4I9AA 1L2UA 2NT0A 2BXYA 3C2YA 4J3SA 3N2TA 1EGZA 1ZU8A 3GY1A 2R14A 4PN2A 3MU7A 2C16A 4HGXA 1RD5A 1K77A 2X40A 4DJDA 3DHFA 2XUCA 3K1DA 3AYRA 3B9OA 1H4PA 4QDPA 2IMRA 4KETA 5ABFB 4A6GA 1K7EA 4GZEA 2O7QA 4BQ5A 3IVUA 1IR2A 1BPLB 3VDCA 5FEXA 2DPEA 5HDRA 1OX6A 1FDJA 1J5TA 4LUIA 3R7MA 4US5A 1OABA 4C6LA 2DDXA 5CPLA 2UV8G 3VKCA 1R85A 3I3DA 2GJNA 4NSBA 3BLOA 4XZIA 2VC9A 1UWRA 3WH6A 3MUXA 3W02A 1OZQA 1D3HA 2CW6A 4O17A 4DJDC 3OGSA 2ZXBA 1AQFA 2VFDA 4N9BA 4IOTA 2QCDA 3W1QA 5E0KA 4BA0A 4GKTA 3UZXA 5CAHA 4IWWA 3W1AA 3BGGA 3M0JA 4Y9NA 4OV9A 3UVAA 1U22A 5EGRA 3PANA 4GVGA 3ZVIA 1FWEC 2W92A 4S2CA 3NSXA 3PFRA 3WJXA 2J9XA 1RQHA 4L5ZA 4IGSA 1XLGA 2Q8ZA 4DQWA 1VFSA 4PA8A 1JCYA 5K4XA 1JCXA 1C92A 1OG6A 3SIZA 3AO0A 1IGWA 3VGGA 4KGJA 3PUDA 3UGRA 3SGGA 1B2YA 4AWEA 1RJPA 3ZT7A 4TVUA 5M03A 3DFOA 2PU0A 3B8TA 4HPJA 3GG8A 1VH7A 4Q8WA 2HBVA 1NU5A 2VR2A 5BOEA 2WHMA 1KRCC 3W88A 4X63A 3N6HA 4N9EA 4AX7A 3O05A 1DOSA 4LT9A 4UQ9A 1UYQA 5I07A 1PZ0A 3HB9A 1G7VA 2VC6A 4LSBA 3UFYA 4C1NA 2GGHA 1REQB 2GK1B 2E5BA 2CU0A 1KO0A 2W3ZA 1B9ZA 1J0JA 3USBA 2GWNA 4AFYA 3LN3A 3GNDA 4OHQA 1H7XA 1K4HA 3CXOA 1KTCA 5DBTA 1RVGA 1WP6A 3UG3A 2J47A 1UC4A 2J7GA 1ODUA 3LHZA 4CQAA 4RNFA 5DLCA 1Z32X 1JZ4A 1NFGA 4NVTA 1S3HA 3UZYA 1A0DA 1JQVA 1XV8A 3MYPA 6TIMA 3QQWA 2QF7A 1TSIA 3MUCA 1KXQA 4FOKA 4LUSA 3SFKA 2Y2WA 1I75A 2ZZ5A 4O53A 1LLWA 3N2BA 1EXBA 1GWJA 3MT1A 4RNJA 3S46A 2RH9A 3SSZA 2V82A 3P2VA 4IIHA 4LVFA 3ZFHA 3AHVA 3DFSA 5FKYA 1UCWA 3S3GA 2V3GA 3QXBA 2ZTJA 3S47A 4KEVA 1LJYA 3RMJA 2E6YA 4Q4SA 2DP3A 3JS3A 2W6RA 1ZGDA 4PEEA 1A49A 3ALGA 2BVYA 3NIYA 4PMJA 3PNUA 3CT2A 2R94A 1VAHA 3CUFA 4IGHA 4KEUA 1CYGA 5I24A 4JL1A 2J66A 4HOWA 4JYDA 3TOPA 2NSOA 4IFKA 1KGUA 5HMSA 4M81A 1UZ4A 3GDBA 3SO7A 5CBBA 4RZ5A 1Z42A 1VPQA 4KW2A 4UUIA 1YX1A 1P6WA 3A3WA 5EKYA 1BVNP 3TA6A 3QGAC 3N2MA 4ZODA 1JPHA 2OT1A 3WNKA 3PG8A 2PCQA 5JMUA 1LQ2A 3O1NA 3V1HA 5CG7A 3IJDA 3BLEA 1A47A 3GB6A 4DO6A 1Z8AA 2PDGA 4Z2LA 3OTRA 5CH9A 1VPXA 4QXIA 1E6ZA 1VS1A 4GQGA 4TTGA 1YIXA 4YS1A 1S2AA 4LW7A 1FWBC 1LWIA 2WKJA 1CEOA 3DH7A 2O4QA 3KLKA 1R47A 4YLWA 5F2IA 1Q6CA 2TODA 3N2OA 1CW2A 3GXIA 1ONRA 3CIWA 3TNOA 3P60A 2H3DA 3SCVA 4EK7A 4B5SA 2DT2A 1W54A 2HS8A 4HD5A 3IRSA 1JF5A 4DYJA 2Z7KA 4ZOBA 2A85A 3LPPA 5E9AA 5CGQA 3MJMA 4LAUA 1KBBA 1WBJA 1WUEA 1SJDA 1IT7A 2ZE0A 1T8QA 1X97A 3VKKA 3NQDA 1TFVA 2HVNA 3SJ3A 3HURA 3VCNA 4PL1A 1FH7A 2VC7A 1FWWA 3KBJA 1MXDA 5BMWA 2Y6ZA 3Q67A 3W22A 1P4CA 4JNZA 3G3DA 4HNNA 3FX4A 4LCQA 3KL3A 3FA4A 4UQBA 4UIOA 2YL9A 3EWDA 2DZXA 2CKSA 1KR0A 2GFTA 2GJXB 3WELA 3DENA 3RFAA 3VE9A 4OJYA 3SRHA 1TJ1A 4GXPA 5A8NA 4DPPA 3AIWA 2OOFA 4Z1AA 4AVNA 3CT7A 4C1LA 3VMOA 5C2CA 4H2CA 3VK5A 3CIXA 2CZEA 4J5NA 2F6UA 5E1QA 2PCEA 2XN2A 3SN0A 4X0NA 3VNDA 5C6MA 1BWVA 3DCPA 1BTCA 3SY1A 2P76A 3ITYA 4PC8A 4JN7A 1HX0A 4ERGA 1FQ0A 1K02A 1KB3A 1G5AA 4ZMGA 2W67A 2GDVA 3BAWA 2HRWA 2VGIA 4GD0A 7PTDA 3OVPA 4MZYA 1Q65A 2GDQA 3N9RA 1YHTA 3UQNA 3DZ1A 4HPHA 3WK3A 1VFFA 1K3UA 4KEMA 3E0FA 3BUVA 1ZAHA 4F3HA 3CBWA 2QQ6A 1K1DA 3VX0A 2NVCA 4JFTA 1W5NA 3VOIA 1J2BA 1YDVA 2DT3A 4AWTA 4JIPA 1J96A 1LCOA 2CLKA 4DJFA 4JIEA 2YXGA 3ZIZA 1Z9AA 1R3YA 3APYA 4DUXA 2C18A 4HN8A 3RG6A 6REQA 1U30A 4BWLA 4LX4A 4Z17A 3A13A 2NZLA 4U3CA 3VUPA 2WJFA 3C0LA 3EDFA 4NKCA 1VFMA 3F4DA 1BGAA 1S2UA 2QCGA 3V4BA 4I7WA 4B5VA 3BDKA 4ECLA 1JYVA 1A5LC 1JUEA 3FJLA 3RLHA 1BXCA 1NELA 4NYYA 1GORA 4WJXA 2B7OA 2Z2BA 4EOUA 2DU2A 3KS6A 1XLCA 1S5VA 4GPNA 3LNPA 2FMOA 4IP4A 3UW6A 4WY0B 4JX5A 4DJFD 2ZUVA 1YDOA 4YTQA 1BXNA 2GOKA 2V2DA 3PS7A 3V0UA 5ENLA 4DJFC 1MUMA 1ZSXA 1MEHA 1FA2A 3MMUA 1HTIA 4BWLC 1UZHA 5H8UA 1HXJA 1I2OA 5F1VA 2FKPA 2VURA 1W5PA 1YEYA 2HEJA 3SCPA 3C2VA 2VFGA 4GIEA 4PCNA 5DF0A 2PTWA 3G24A 1W5MA 1O7AA 4TVDA 3V75A 1RVKA 3F2DA 2XM1A 1R30A 1FWAC 3WYZA 1SFLA 1XLBA 4HYRA 3B0XA 3S83A 1JGIA 2OODA 1HJUA 3E2VA 4KWWA 2VXNA 4QIUA 2WJZA 4MY9A 1C90A 4E4PA 1WDQA 2QCLA 2ISVA 3VD5A 1TV8A 3WL1A 1HKMA 3OHIA 2GJPA 4J2PA 1AD4A 2Y5EA 3NSNA 4F4RA 3GZAA 3TXVA 3SN1A 4AIBA 4AZIA 5ABFA 2WSPA 3GXNA 3U5YA 3S0CA 2MUCA 3MV01 1HW6A 3W73A 4IH3A 1B3VA 1RBOB 3AYSA 1OGGA 2OSYA 5C2GA 4AWUA 7XIMA 4KWSA 1KM2A 1AK5A 2OOGA 1XLIA 3DU0A 4WLCA 1W1B1 1JDFA 1ZNNA 3VMPA 1MZRA 1W5OA 3U2ZA 1TIWA 4XQ6A 5AHEA 3OHMB 4RL3A 4MMWA 3ATYA 4LB3A 1T40A 3G8RA 3JVAA 3FCPA 4I9MA 5FF0A 1VIWA 1RLDA 3C61A 3OBEA 5JIWA 2NV2A 3JZUA 4IFRA 3T08A 3WQEA 1ZCCA 2YFOA 1LG1A 5I00A 3IJIA 2O92A 4AZCB 1SM9A 2A5HA 3H4GA 1CLXA 1K9EA 1UR0A 2GJRA 4IXXA 4MAVA 2HXUA 3GC2A 3OG2A 4Z2IA 5C7HA 4ZZ9A 4GACA 2YBVA 2HPIA 1KFEA 3SRKA 4DO7A 4NYUA 1HVXA 1PHWA 1WA3A 3CL6A 4ONVA 2UWFA 5DMMA 2DIJA 2QZRA 3TFXA 3BLDA 2VR5A 1FWTA 2CLOA 2AOSA 4B2DA 4HA4A 1GZGA 1H63A 1JDAA 9XIMA 2O4MA 3CEUA 2GUYA 3K4WA 5HMFA 3PBVA 3D3AA 3SJNA 1WOAA 4F0LA 2QEZA 3VPLA 2ZWZA 3GTXA 2Y1HA 3M0YA 1Q4NX 1UJPA 2P3ZA 2PWEA 1KM1A 4BK9A 2GL5A 5FOOA 5LGZA 3FGCB 3P14A 3N9KA 3WF0A 2V5KA 3RNDA 1GOWA 3N19B 1KKOA 1SW0A 1A4MA 3MANA 4LS0A 2OMAA 1RBLA 5KZDA 2VEPA 4B2DD 1YW1A 4O4WA 3RXZA 4Y9PA 1AJ2A 4YXGA 3OZMA 1REQA 3NZRA 2GK1A 3A3XA 2EPKX 5K3VA 3ECQA 4ATWA 4LBSA 3FVMA 1IR1A 3GNPA 2GWGA 1LG2A 5T8GA 2ASHA 1XIIA 2Q3OA 1NDYA 2PGRA 4H6RA 1NP0A 3GFYA 3CL7A 4GX8A 4L6OA 2PS2A 4HZ6A 1K70A 2IKGA 3H21A 3P93A 2FPYA 1G4PA 5J5RA 3O7UA 2ZVRA 3GZ3A 1VF8A 3EXSA 3R94A 1VHCA 4Z0SA 5HOSA 4CLMA 3JRKA 1W9PA 3KP0A 1KM4A 1Z41A 4V2XA 3LM7A 2E5CA 4GG9A 3WDIA 3AXXA 3NQMA 1EWDA 1AL8A 3RYSA 2VRKA 4ASTA 1G4SA 1N2VA 1UH2A 4C6CA 1U33A 4N0RA 1P0NA 2ZX9A 3ZYZA 3CV6A 2DQWA 1CXIA 2WCSA 1XFBA 3GM8A 3QPEA 2D3LA 4NXSA 2NQHA 1C7TA 3QY8A 3TYDA 4AMAA 4FZIA 3U4AA 5M2FX 4CGTA 1O95A 4A22A 2IPJA 2J9YA 3H2EA 4IMEA 4OUIA 4TMCA 1JCLA 4H3DA 3TR9A 4RXGA 4Z1DA 4K37A 3G1VA 4JQ4A 3A3HA 2R1LA 2EG6A 5JQ9A 1BWLA 1E15A 4NUWA 5HMDA 3S4TA 4O1BA 3NZ1A 1S5TA 3STFA 4PUDA 4O50A 1V0LA 3MBFA 3NFUA 3KHJA 1ISVA 4JTCA 1G7UA 3NZGA 1AODA 4HMDA 1IF2A 3H22A 5BOFA 3WH7A 1OBAA 3URBA 1TRIA 2W61A 5PTDA 2JKEA 2W5FA 3WNPA 1SZRA 2TAAA 4DF2A 4R7OA 3WQPA 2WPGA 5IOBA 3HGRA 3W85A 2PE4A 3D5HA 4EP8C 4UQCA 1EHAA 4TUFA 5J5DA 4JTSA 1V51A 4DYKA 3EMZA 4HK6A<