1FCQA

Crystal structure (monoclinic) of bee venom hyaluronidase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
321
structure length
314
Chain Sequence
EFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYALURONOGLUCOSAMINIDASE
publication title Crystal structure of hyaluronidase, a major allergen of bee venom.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Hydrolase
total genus 128
structure length 314
sequence length 321
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01630 Glyco_hydro_56 Hyaluronidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1fcqA00
3B04A 2CLIA 4YMZA 1HTIA 3FEMA 2X2GA 2H90A 4O53A 3DHDA 2OX1A 1XBYA 1HUVA 4UFKA 3OEXA 2E09A 2PRHA 4RKAA 2Y7FA 2VFIA 1T8XA 5CGQA 1NVMA 1H7PA 4H3DA 2E6YA 2WOQA 3TNOA 4JX4A 2YYTA 1SO3A 3G1SA 3QQ1A 3N9SA 4CQ8A 4FNTA 4O54A 2RHGA 4LWWA 1W5MA 2NV2A 1QO2A 1WAUA 4LV4A 5ABTA 3M43A 4YCOA 3TV8A 1O60A 3FKKA 1WYIA 4AEOA 3MJYA 3NPVA 1PHQA 2C16A 3OG3A 2JK2A 2CU0A 3L65A 5G1TA 3EWZA 1AG1O 4Z1BA 4BI6A 3NPWA 4K37A 5G4EA 2DZUA 3NQFA 3E12A 3SECA 4UTWA 4HSOA 3TXVA 4AAJA 1PCKA 2YDAA 3CQ0A 1PVNA 3P80A 2C18A 4J9JA 2F84A 4C1LA 2FFCA 3HF3A 1RQBA 4FNRA 3S0CA 4LTSA 1VGAA 4JTGA 1GOXA 1C29A 1OFBA 4QQ3A 3Q37A 1OFAA 5KZEA 2E68A 2HTMA 1THFD 5AHIA 1O5XA 1Q6RA 3LCLA 5K2ZA 2CFFA 1D9EA 4HHPA 3KVJA 3O6CA 4K8HA 2GUUA 1QAPA 3PUOA 4MIMA 1PL9A 3M5ZA 6TIMA 2A7RA 4A22A 3S5ZA 5CPLA 4PC8A 3P5YA 1H7WA 3W2JA 5I3IA 3W84A 5LGXA 4A2RA 2ZZ4A 3OHIA 1XCFA 1SFJA 1OX4A 4UTLA 2VEMA 4QJ1A 1LRTA 1AK5A 3STCA 3NEVA 4IUOA 1V5XA 3S42A 1RVGA 4GJ1A 2B7PA 3KXQA 1XXXA 2Z2UA 5TBOA 4HSNA 2Y89A 5LKYA 4KFPA 5F1VA 2P10A 4RK8A 3U6WA 2CLOA 3W7HA 5AYYA 4IMEA 3GNDA 3B03A 4UFLA 3LDVA 3TJXA 3HBLA 1SZNA 5HWMA 1XL9A 3NPXA 4BFAA 4N4PA 4HNNA 2JKAA 4N2YA 3RLUA 1W3IA 5IBXA 1QDSA 3BG5A 4TU1A 2ISWA 1TJRA 1MEWA 3HJZA 5F2MA 1RQEA 1H50A 1SSDA 2X30A 2G96A 3S6DA 2RDUA 5EY5A 2DORA 2QCCA 5HUPA 4A3UA 4JTKA 3TQVA 4HT3A 2HS6A 4ICNA 4WQ6A 3HIJA 3EXRA 3NZRA 1A5CA 2GJLA 4OU1A 2JBMA 4JTTA 3EX3A 1VCFA 3PG9A 1AW5A 1G67A 3GR7A 3GYEA 3TDFA 1QNVA 2BZNA 3LBCA 3QC3A 5D04C 3UXDA 5LNUA 3EEGA 2WNQA 2CLHA 1NFBA 1FUYA 3I7RA 1VR6A 5LNSA 3NR0A 2V81A 2HMCA 5DBTA 1DJNA 4ZVJA 1LZOA 3LGEA 4EF9A 3E0IA 4IMFA 3SGUA 5LHFA 3G8EA 5K9DA 1Z41A 3SI9A 4AXKA 3P84A 2FDSA 2CLMA 5AHEA 4ML9A 1QO5A 1UJPA 2ABAA 3QM3A 3EX1A 3H54A 3GIYA 4UFHA 3LRLA 1ZFJA 1F7BA 4UIOA 4FB7A 2WV8A 5G4WA 4LUIA 1PIIA 5E0KA 3A24A 4O14A 3B4UA 4O0ZA 3W87A 4WOZA 1ZAJA 3TXZA 1KFKA 5G2IA 1K02A 3I68A 4AHOA 3QFEA 1GVFA 1TQXA 4R7JA 5AHMA 4FXSA 4ONVA 2GQ9A 3W7OA 1KFCA 2R14A 3G1FA 3R12A 4E0CA 5D2YA 1FCBA 4QSHA 4MJMA 1DVJA 2PCQA 3R2GA 1JCLA 4UTTC 4HIBA 2VELA 4AF0A 3ABRA 2W6RA 1OX4B 3LTYA 2NLIA 2QCDA 3LCXA 2C14A 3DFPA 3M41A 1KFBA 3YPIA 5H2ZA 2BX7A 3ABOA 5K7JA 3LLDA 1XFBA 1KBJA 1FWNA 3C4UA 3W2UA 1M6JA 4O4VA 3W1LA 2EHHA 4N9BA 3V75A 4UFJA 3L68A 2BLEA 4Q4KA 5D02A 2I14A 3MI2A 4Q33A 4O10A 3NVTA 4IPIA 4AWTA 1FQ0A 2RFGA 5K9XA 4JDYA 1A50A 5AB3A 4TX9A 1QPQA 4ORIA 4TO8A 4O16A 4MFDA 3NL2A 1IXOA 1D3HA 3ABQA 5DELA 3IGUA 3W7EA 3G0UA 1S5VA 4O52A 3O16A 2TYSA 1UUMA 5CPMA 7TIMA 1OYBA 4NQ1A 1K03A 1VLIA 3QRHA 4MLRA 3ZR4A 1SU5A 3USBA 2J9YA 1I2NA 4FX7A 3M5XA 5EMUA 4I9AA 1EPXA 3C6CA 5DN1A 2QCLA 3CT7A 1KM1A 1ZAHA 3DFQA 3TSBA 1LBLA 3LCFA 3LXBA 3DH7A 5HJLA 2CLFA 4K38A 2ISSA 4PODA 1B4EA 4O1DA 1UCWA 1UUOA 1ZENA 3S5NA 1YTEA 4ZQOA 1NF7A 1DL3A 3RU6A 4IX2A 2ZZ7A 3EWYA 3LI0A 3TQKA 4JTIA 5C2XA 2EF9A 2Y7EA 4PEKA 3CHVA 3FJ6A 1XBXA 3BPWA 2C13A 3W1XA 5KZMA 4XBSA 1SW7A 4O0KA 1OF8A 3W1RA 4JTFA 3PG8A 1BEUA 1KTCA 3LCIA 4UFIA 1S5WA 1F05A 1ICSA 3W7QA 2NX3A 4PTNA 2VC6A 3HPXA 4QNEA 1ONRA 3W83A 3N19B 3C2RA 2J9XA 1U5JA 4CNOA 5K4ZA 4LC8A 4XBKA 4A29A 3I7SA 3S8HA 2E1DA 2CW6A 3BLEA 4WY0A 1MO0A 1YPFA 2AGKA 3RK8A 4O18A 2A21A 4CCCA 2ZZ2A 2B7NA 4AF0B 3DFSA 3E02A 4L4MA 2YX0A 3MO7A 1EA0A 4YCPA 2X16A 2OJPA 4O8RA 3LX9A 1VJIA 1GWJA 5EYWA 5CSSA 4QAIA 2PURA 5DCDA 4X22A 1FCUA 1EX5A 4E38A 1KV5A 3CU2A 1EP3A 4GNJA 3NQ6A 1W37A 2Y61A 1TV5A 5AC8A 3NQ2A 3QJAA 4IXHA 1M7PA 1TPVA 3UD6A 4UNKA 3N2XA 3IIXA 1J5TA 3QMRA 5LHEA 5LNRA 3TIMA 4FEZA 1I2OA 1TCDA 1KLZA 4M5PA 3WK1A 4JDBA 3NQAA 4GWEA 1TPH1 3G18A 4HNVA 1L2UA 2A6NA 4IMDA 4IXXA 4MFEA 1FWSA 1K8ZA 4LNYA 1GPWA 1FCVA 3E9AA 3KAOA 5AFDA 3GXTA 4AVFA 2VFFA 1XBZA 1JR1A 4LY8A 3NM1A 2VKZG 3KRUA 3P8JA 3CEUA 2FTPA 2HS8A 2ZA2A 3C2VA 3A22A 2CLKA 2I1OA 3HQ1A 4PFMA 1I2QA 4P61A 3DKLA 3C61A 4IJBA 1FXQA 4BK9A 4M7TA 1QOPA 3LTPA 2ZZ6A 5CPOA 2G5WA 2IQTA 3UPWA 4LV9A 3QSTA 2GJNA 3IGSA 4OV9A 2VEIA 1MEHA 3I7QA 1H51A 1WBJA 1WV2A 4DF2A 1W56A 5KMYA 3NDOA 2V2CA 1OFOA 1LRQA 3LERA 3LXCA 4N4QA 1UASA 4LUJA 3CWOX 2ZBTA 2GVLA 3KFTA 4M7SA 3SZ8A 4NXKA 4MKNA 3O15A 1YTKA 2QDGA 1YPIA 4MOZA 3GVGA 4JX6A 2Q8ZA 1V7YA 1EP1A 3RLVA 3BK0A 3G1XA 3WJXA 3W74A 2C1HA 4YL2A 3W7NA 1X7FA 3G3DA 3QH2A 4JY9A 4UTTA 3PSWA 4D2JA 1SUXA 1JJKA 4N9DA 4Z1AA 4GE8A 4A2SA 4WY0B 4I7WA 1R2RA 1NSJA 6ALDA 1KM4A 4LU0A 1IXPA 1T96A 3C8FA 4DBDA 4LOCA 5KTLA 3SIZA 3CM4A 3W71A 1JCJA 1YDOA 3N73A 3HPZA 4EOUA 1WA3A 3A5VA 2FLIA 4KFOA 2QCFA 4NXSA 1TQJA 3NQDA 3A23A 3R8RA 3GDTA 1IIHA 4Z1DA 3HOJA 5J5RA 1VRDA 2V30A 5FESA 2CZ5A 1F5ZA 2ALDA 3GK0A 4DF0A 2QUUA 3WJZA 2KZHA 5HWNA 3NPUA 4M6PA 1F6PA 1Y0EA 1JVNA 3UY8A 3M7WA 3TJLA 3EWXA 5K4XA 1TRDA 3T4CA 1QWGA 5AHFA 3HG3A 3S5OA 1T0OA 4AWUA 2A7NA 4RLIA 2JKEA 4N6EA 1WXJA 2ISVA 1OX6A 2Y7DA 1EUAA 1R46A 3P5ZA 3BW4A 3U8GA 3G3MA 1GZGA 3C3NA 3B8DA 1VHNA 1W5PA 3C0JA 2VFGA 4UXDA 1J4EA 3IVTA 1FBAA 3S5YA 1XC4A 1CI1A 1JCNA 1OFDA 1OFPA 2ZDRA 1KFLA 3L5MA 3W2MA 4MYXA 3NQMA 5I3GA 3N14A 4R34A 5FEPA 2NXGA 2P1FA 4Q32A 1FDYA 1KM5A 2TPSA 2I9EA 5C54A 3M16A 3VFLA 4JTSA 5EBUA 1TIMA 2QEZA 2XN0A 3MP5A 4K6AA 1H5YA 1LRNA 4O1CA 1B9BA 2DZVA 5FI8A 3FIGA 4UR8A 1YTDA 3W72A 3DENA 4UMAA 4S2BA 4XTDA 4NNAA 1TTJA 1F2JA 4B5NA 1W8SA 1K8YA 1P4CA 4N02A 1N55A 2YYUA 4ZQRA 4DO6A 2RDWA 1SSGA 2FB2A 3FJLA 4HPXA 5C5YA 2YFOA 3BGJA 3PSVA 3DXIA 2FPYA 2QF7A 4FXRA 5CZJA 3FYOA 2J6XA 3PVFA 2WQPA 2DU2A 3UNDA 4WZHA 2ZZ3A 2QAFA 2C3ZA 3W1NA 1LCOA 2BWGA 3RF9A 1VPXA 5AOUA 1GG0A 3R13A 2C6QA 3TMQA 1H7NA 4NT0A 3L66A 4I7VA 5TIMA 4AB4A 1H7XA 2XFWA 4IOTA 1ADOA 4PCFA 3HG2A 3W7RA 3GDMA 2V5LA 3G1DA 4NJKA 3ATZA 1PCWA 1OJXA 4XTIA 1K7FA 5DLCA 1M7OA 1QFEA 4LW7A 4DELA 4PA8A 2QDHA 1DHPA 1RD5A 3W6YA 3JR2A 4UNLA 3UWQA 3G24A 1SZFA 1XUZA 5BMWA 5HULA 4O4WA 5H91A 5F4WA 1I4NA 3V1PA 3L2IA 3S1VA 3OA3A 2Q3OA 1WOBA 1X1OA 2RH9A 4K7VA 3P61A 3GDKA 2Z1BA 3ZFHA 1TPDA 4E2BA 1YYAA 1KM2A 4RZ4A 2X1SA 2YXGA 4JIPA 2R8WA 1TPC1 4OBTA 1TV8A 3KHJA 2FQIA 3I65A 3TE9A 3WK0A 1P0KA 2PE4A 3NL6A 3C52A 3NQGA 3W7MA 3DBPA 3LHTA 4N9CA 3QSRA 3WK3A 2OZ0A 2NX9A 3W7LA 1X8FA 2LLEA 3BW3A 1GVSA 3BLIA 1K7XA 3EX6A 3W86A 3UPBA 4LVGA 5CKSA 4WD0A 3M5YA 1FDJA 3OVPA 4CCEA 4WOQA 3GNNA 4AH7A 5C55A 4Z08A 4FNPA 5EA9A 1SZEA 1W5QA 5F2LA 4M19A 3O07A 5K9CA 1G4SA 3P60A 3W7JA 4UTKA 2PRLA 4JTUA 3G8RA 3RNDA 4WJEA 3LV5A 1TPFA 1IXQA 1OABA 2H8ZA 2QCMA 3UQNA 1OHLA 1F74A 1VCVA 5DY2A 1JRCA 4S1FA 1LBFA 2Y63A 4ADUA 4AMAA 1W1ZA 5KZDA 1H63A 4ADSA 2GVGA 2ABBA 2NXIA 3TKFA 1KM0A 1ZJIA 3IVSA 3ZWTA 2DZTA 3CB8A 5AHNA 1NF0A 1E51A 1SR9A 4MZ1A 4ZQMA 3AJXA 2CWNA 3QPZA 1I2PA 4H4IA 4ADTA 2Z6JA 3B06A 3W1MA 2A0NA 4AHPA 3WFAA 1VH7A 2J27A 4IQLA 4JXCA 3NQEA 3GB6A 1O5KA 3K30A 1L9WA 4O50A 2JGQA 3S1XA 1SQ7A 3WJSA 2ZRZA 1VCGA 2V8ZA 1F76A 1FXPA 2J9ZA 3S1WA 2QUTA 3OVRA 2NWRA 1MSSA 3GKAA 3P67A 1HFBA 2ZTKA 3P62A 1TSIA 4CNPA 4NNBA 2A1YA 5D03A 3LB0A 4JICA 4RV8A 5HNRA 1G4TA 1EUNA 2H8XA 3RMJA 3L0GA 5A8GA 2WO5A 2B7QA 1MZHA 1ZY9A 3C56A 3EX4A 4UMBA 4X2RA 2VXNA 2Q8LA 5J5DA 3PC0A 2R91A 1ZCOA 3CC1A 5EL1A 2A5HA 4JY8A 3EKLA 3VKJA 4Z0SA 2EKCA 4LRSA 3EWUA 1GG1A 1R2TA 3NYZA 4N6FA 5F2IA 3ABSA 3W1TA 1AL7A 1EIXA 3EB2A 2OT0A 3LHWA 4O12A 1TREA 2B7OA 3DZ1A 3SR7A 4JYEA 1VZWA 3E96A 2WSYA 1TRIA 1DKWA 1YDVA 3LHYA 1TPUA 4RZ6A 1XM3A 3NM3A 1LBMA 4PL2A 4K8EA 1TV7A 3OIXA 1W5OA 5HUOA 3BO9A 4HPJA 4YWIA 1SPQA 1IIGA 4NUWA 1K3UA 3TX9A 1Q45A 4HN4A 3M0ZA 3N3MA 5D2VA 3LM7A 4OV4A 4IX0A 4ALDA 2H6RA 5HR6A 1LORA 3W7IA 1A5BA 2X1UA 3DI1A 1KTBA 2V2DA 2A2IA 3IV3A 2ZA3A 3TK7A 2QCDB 1GTEA 3SY5A 5BW6A 1C8VA 3NOEA 4GRSA 4DPQA 1L6YA 1F73A 1OF6A 1SO6A 2UV8G 4FO4A 5D32A 3KRSA 3G0XA 3R5EA 3NNTA 1ME9A 3ANYA 2C19A 3IIOA 4Z0JA 1O4UA 3NQ7A 3FYPA 1KW1A 4XZ9A 1EWDA 2WNZA 1U83A 1UBSA 5CZTA 3VNDA 4O11A 3TMLA 5D38A 1HO1A 5G2HA 4BI7A 3HO8A 5I3FA 3W76A 2FB3A 4TMCA 2A6LA 4YLWA 1H7OA 2E5BA 1B57A 1TTQA 1CW2A 1H1ZA 3PWAA 1J2WA 3B0VC 1LDCA 5BOOA 3L5AA 3L21A 1Z42A 3STEA 1FCQA 1ML1A 4L4LA 4UTHA 3QW4B 5HINA 4M6QA 1D3GA 2AQWA 1GT8A 3I6RA 5DXXA 3PAJA 4CNNA 4TMBA 3F4NA 3PR2A 2C15A 3KVMA 4NJGA 2ZCGA 1QPOA 1JQVA 2YFNA 1OYAA 4XKYA 2GVJA 3S1UA 1KFEA 5HMSA 5EKYA 1KM3A 3EX2A 1IGSA 3TFCA 1JUBA 3PF3A 3QYQA 4GBUA 1YXCA 1N8FA 4GUJA 5IM51 2V82A 2VEKA 5CG7A 3ZS4A 4XUGA 1JCMP 1I8JA 2WSQA 3W23A 1M5WA 4FNUA 3M47A 5FF0A 1GYNA 1HG3A 4DPPA 3EXSA 3PBYA 2E6FA 2V2HA 2ZQ0A 4CCDA 3HG5A 4U4MA 3QMTA 2FPTA 2A4AA 3LRMA 5FEXA 3B05A 3LTSA 2ATSA 2GOUA 1SO5A 4UR7A 4BF9A 2FIQA 1X1ZA 3FKRA 1Q6QA 3PY2A 3W1QA 2X1RA 1JUKA 1YLVA 3LLFA 1KA9F 1RV8A 5G1YA 4GFSA 2VENA 2NXHA 3RFAA 1DQXA 1XI3A 1LOLA 1W5NA 2ZZ5A 4O28A 1JRBA 1XDMA 2P0OA 3KX6A 1WBHA 4Z1CA 2WJZA 4JX5A 2J88A 5I3KA 1FX6A 1NAL1 2ZYFA 4LRTA 2ZRXA 1CX9A 4RJEA 2O7QA 2DZSA 1LOQA 2QCNA 3NQCA 3W2KA 2E77A 2JKPA 3DFTA 5EPDA 2Y85A 3PUDA 3UWZA 4UTUA 4MVAA 3LCHA 3M9YA 2QJIA 4FF7A 5FF2A 3N2MA 3GR8A 1OG0A 1OK4A 3UWVA 1ALDA 3UYCA 2YSWA 2ZRUA 4FX8A 1T99A 2J24A 1QPNA 2ZRYA 3T40A 2CZFA 4BWLC 3PBUA 3G1YA 3TC7A 1A5SA 5F2GA 3O6DA 1WQ5A 3DFNA 2G97A 1KFJA 2V9DA 4FNQA 1ZNNA 3NA8A 3GLCA 2G95A 2GQ8A 2Y6ZA 4NVTA 4LT9A 3LCGA 3NGJA 3GAKA 2QCEA 5C6MA 1DQWA 3D0CA 1WOAA 2Z0IA 1GQNA 4UCGA 5LNVA 3EWBX 2QUVA 1OK6A 4PH6A 2DP3A 5MHBA 1RPXA 4U28A 4XWUA 1FWWA 1I2RA 3DKJA 3C2FA 4K36A 3TAKA 4CQ9A 4XKYB 3TH6A 1GJPA 2XN1A 3DHFA 2WNNA 1ICQA 1FWRA 3M6YA 4RXGA 3W3OA 3TW6A 1G7VA 4RCXA 2D73A 3W7CA 1VLWA 3HGJA 1G7UA 3TAOA 1KM6A 3H55A 2PRMA 5D37A 3MW7A 5L6UA 1TTIA 1QPRA 3T44A 3O05A 5FEWA 3TC6A 3W88A 1H7RA 3HMJG 4BI5A 1TPB1 1MXSA 4NX5A 3TR2A 5DXYA 5LGZA 5D05A 4TIMA 3MP4A 3BVJA 5D2WA 3NL5A 3SFKA 3GXPA 1G69A 2ZFAA 1B4KA 3AO0A 5DCEA 5E93A 3PBWA 1K7EA 1TPEA 1JCXA 1XDLA 2GPTA 3QPYA 5KINA 1XKYA 3MHUA 3MHGA 4DO5A 1ME7A 1GVQA 5F4SA 2TSYA 2TMDA 1BWLA 2PC4A 4PL1A 3C2OA 3L0NA 3TSDA 2H3DA 3KOFA 3PUEA 3FFSA 2C0AA 3JS3A 3FLUA 4A21A 3BLFA 3UZJA 3TUUA 2ZTJA 5U7SA 3O6YX 1KTNA 3P81A 2FPVA 3MYOA 4O15A 3LRKA 3QMSA 1SW3A 3M44A 2Y7GA 4OGZA 5AC6A 4JTHA 4MUZA 3MWAA 5GVJA 3CPRA 2NV1A 3WJWA 4AHQA 4QIUA 3Q94A 1RR2A 2BSLA 5AN7A 3U2OA 3DI0A 3KRZA 1IXNA 1RQHA 2CLLA 2VFHA 4WX2A 3P82A 3G1HA 3IVUA 4ZL1A 1OX5A 3G1AA 4FNSA 4NZFA 3QZEA 2B0MA 2H3BA 4NJHA 4UMCA 1LOSA 1S5TA 1TJPA 3LHVA 1EWEA 5AHLA 3C2EA 4DQWA 3LHUA 3PB0A 4Y6GA 4UTMA 1DOSA 2ZRWA 4X3ZA 4O17A 4LS2A 1QCWA 2YR1A 1LLWA 4HKPA 3LOTA 4JN6A 4JTEA 3SJ3A 4NU7A 1OFQA 2W79A 3CIXA 3BG3A 3HB9A 4GUFA 2NX1A 3S9YA 4Y90A 3BW2A 3TQ0A 4EWND 3G0SA 3CLMA 5D33A 2VFEA 1BTMA 2R94A 2YZRA 5AYZA 3W7DA 1GVRA 3A21A 2E5DA 1DV7A 4XQ6A 1RZMA 3F4WA 4LVBA 3STFA 1YADA 1TO3A 1W54A 3TROA 3W2LA 1EP2A 2NUWA 2HSAA 4QM1A 2TRSA 3LV6A 4RR4A 5HWJA 4X9SA 3W2NA 1QOQA 4OQVA 2AAMA 3MYPA 1R30A 4K7YA 3F1QA 4GC4A 4DXVA 5CPNA 5BMXA 4Y8FA 5AC7A 3INPA 4GUIA 5F1UA 3W85A 4MYAA 3NQVA 5LSMA 4MY1A 5TQLA 5SWUA 4GUGA 3FOKA 4LC6A 2E6AA 1AW1A 5DCBA 3T78A 1OVDA 1G4PA 3CWNA 4JGDA 5I3HA 4R53A 5D2XA 1OYCA 1TMHA 3B0UX 3ATYA 5LNWA 1R2SA 3EWWA 2QAPA 1Z44A 1SW0A 3VCRA 1W31A 3M1ZA 1SZGA 3DAQA 3MBFA 1WX0A 2EGZA 1W3NA 1QMLA 1LROA 1P5BA 1Q6OA 4JR5A 2E6DA 3LXAA 5U4NA 3UWYA 1OFRA 4IGHA 4JTLA 4OWGA 3UXAA 3A5FA 4O1AA 1GTHA 3P8IA 1PS9A 4O1BA 4BWLA 2V5BA 3JRKA 4OT7A 3W1PA 4NJIA 2DJLA 4RZ5A 4MY9A 4JYFA 4EVZA 1PHWA 3ZWSA 1ZAIA 3KVKA 4ZQNA 1VHCA 2Y62A 2VEPA 1R47A 3UY7A 4DEFA 3IRDA 4Y9AA 3PULA 5G5IA 1Z48A 4G1KA 1EB3A 2EAWA 1TTPA 3W7KA 2YGYA 3G22A 5K3VA 4KWWA 3L5LA 4O19A 5D09A 4ZQCA 1KBIA 3F03K 4IMCA 3QEZA 4WY0F 1LM1A 2YW4A 1NEYA 1VS1A 2ZZ1A 3MUXA 2QJGA 3PBVA 1B3OA 4DF1A 4P2VA 3KVLA 1AL8A 1H62A 1OFEA 1MEIA 3GDLA 4Y96A 4FHAA 4W9TA 3VE9A 3QW3A 1P1XA 2B4GA 2WSRA 2RDTA 1DORA 4JNMA 3DFOA 1A5AA 3FA5A 4IPJA 3T7VA 2QJHA 4ZZ9A 4O13A 3A9IA 5E1QA 2V0TA 5HQEA 1W3TA 1ME8A 3BGGA 4UTWC 1H1YA 4NNCA 2QCHA 4ZMGA 1SO4A 3VI2A 5CZSA 5FF3A 3UWUA 4LVAA 3GKFA 3NO5A 3TW7A 1LYXA 3IIZA 3GZ3A 3BV4A 1UB3A 5BNKA 2VOMA 5I3JA 2OCZA 1JQXA 2Y70A 3HPSA 3DU0A 2VFDA 3HGSA 2DZXA 4FIQA 4MJZA 4MZYA 5DBUA 3GX9A 4EIVA 1A53A 3NQ8A 1AMKA 3BARA 4LS1A 2DZWA 1L6WA 2A85A 4QISA 3ELFA 3MI6A 2YW3A 3Q2DA 1AW2A 1VYSX 2NUYA 2GQAA 4NX0A 4MY8A 1O95A 4QNWA 1JCYA 2F7FA 5F4XA 4IMGA 3UWWA 2E5CA 3HG4A 1H60A 3TCEA 1LTDA 1IF2A 1Q3NA 8TIMA 4LVFA 4OE7A 3GDRA 2FJKA 1TPWA 5AYXA 4RXFA 5CSRA 4JYDA 2XN2A 3NXFA 3P74A 5CZ0A 1GVOA 4FIRA 2O7SA 1QR7A 4EF8A 3OVQA 1H61A 1C9DA 4JIQA 2DZPA 3GXNA 2Z6IA 3IIPA 1JUEA 4WXYA 3W22A 3WK2A 4POCA 2NWSA 2ATMA 1K8XA 4LS0A 3LHZA 1EEPA 3G1VA 3STGA 5FF4A 4UUIA 1GYLA 3SW6A 4MZ8A 5IBXC 4LVDA 4UTJA 4FX6M 3PM6A 1LLZA 3P7YA 4YXGA 3QF0A 3O8AA 2ZA1A 3IEBA 3IGXA 3E49A 3O1NA 4S2CA 4I7UA 1ZALA 5A5WA 3MP3A 3THAA 4UFMA 4HNTA 3L0KA 1FWTA 4JTJA 3M5VA 2OT1A 3LBMA 4ZQPA 2W0UA 4HNUA 2CZDA 1G6CA 1KV8A 4JD4A 3GAYA 3W7GA 2NZLA 1TYGA 3O63A 5KITA 1YDNA 3EKZA 1S3HA 3W07A 1TB3A 1KLYA 4JS3A 2JGYA 4KKXA 3W73A 3PB2A 4OHQA 1L6SA 1ZHAA 1PE1A 4CLMA 4GUHA 5G2WA 1WDWA 3MMTA 4MPQA 5FEZA 4DBEA 1X6UA 3MI3A 3T55A 3MHFA 3W7PA 2ZRVA 4GXMA 3WJYA 4NJJA 4NZJA 5DY3A 1HL2A 3CEPA 3N34A 1O94A 1XUUA 2Q3RA 1VYPX 3VE7A 3THQA 5KSWA 3FS2A 1VC4A 1VYRA 4E2DA 2QCGA 3IIVA 3W1UA 1XBVA 3L9CA 3TFXA 4UC5A 1P0NA 3DGRA 4UTIA 3W1AA 1F6KA 2QKFA 3MBDA 5BRBA 4KFNA 4C1KA 3QQ0A 1VQTA 4DO4A 3LI1A 4KWVA 3N9RA 4JEQA 3SSJA 2WKJA 1G4EA 4R33A 3W9ZA 4RX0A 2WPBA 1N7KA 1SFLA 3B0PA 5FF7A 1GEQA 3NL3A 3OBKA 2YPIA 3TSMA 3CTLA 4WUIA 1BKSA 2DJXA 1HO4A 3O06A 4BR1A 1YXDA 3NG3A 4K39A 3TA6A 3R89A 3W70A 2A7PA 3SGZA 2YCEA 1FDZA 1JULA 1YXYA 4AWSA 1I45A 2QR6A 5D2TA 4H6KA 4QITA 3HGOA 3UZ5A 3W75A 5D30A 1Q6LA 1PV8A 2BXVA 5HR7A 4N9EA 1W0MA 1DJQA 4ORMA 3TU9A 4WXZA 1FY6A 3LCWA 3H53A 2NUXA 1LP6A 3L67A 5T26A 2BTMA 4O57A 5L9FA 5LZLA 3CIWA 4IWWA 4CQAA 1DBTA 2RKXA 2X1TA 4M6VA 4MLJA 2Y88A 1ICPA 3EXTA 3Q58A 3HGRA 2CZEA 2OMAA 3BG9A 3NZ1A 2CLEA 1BWKA 3NAVA 2EPHA 3PS7A 4TR9A
chains in the Genus database with same CATH superfamily
3FEMA 2JF6A 2IS7A 2X2GA 3TN6A 2EG7A 4BZYA 1V6XA 3T8LA 4QDPA 4GQ0A 4US6A 1CT5A 4ZO6A 4I3GA 2YYTA 3M7SA 1SO3A 5A2AA 3QQ1A 3WF1A 4CQ8A 3T0AA 4FNTA 2DDXA 7TAAA 2OSYA 2E7FA 3KBJA 4LV4A 2DSUA 3TV8A 1IEWA 3MJYA 2CU0A 4Z1BA 2QGHA 4GD0A 4K37A 3E12A 2NVDA 1E3ZA 1LQ2A 2PGEA 4Q4PA 4J9JA 2F84A 4LTSA 1GOXA 2PWEA 1C29A 1OFBA 1YBQA 1J0HA 2FVLA 2PDFA 4S39A 5MKGB 1PIGA 1Q6RA 2CITA 2BOGX 4DLMA 3LCLA 5K2ZA 1E6SM 2CFFA 1B3WA 3ZJKA 4MNLA 1R87A 4DJDA 1QBAA 4MIMA 4Y7EA 4PC8A 1ZGDA 5I3IA 3W84A 4A2RA 1JEZA 3A64A 2ZZ4A 4IIFA 1OX4A 1JGIA 1H3GA 2HEJA 3S42A 1MMFA 1XXXA 4Y2WA 3KTCA 3PZ9A 4Q4RA 4RK8A 3GFYA 3U6WA 4OBSA 3BJFA 2PTWA 2EBNA 1GOQA 3Q45A 5HWMA 1OCBA 3NPXA 4BFAA 2NLYA 1PZ3A 4HVXA 2WVTA 2PGFA 2GJPA 4TVCA 1EHNA 3HJZA 5F2MA 3LD5A 1JYWA 3N18A 4YTUA 2G96A 3ANVA 1AZ2A 4XD6A 4HOXA 1VPQA 2X41A 3VMNA 3TN4A 1KFWA 1HZYA 3TQVA 1Z7AA 3EBVA 4HT3A 4GA8A 4GCXA 2OELA 2HS6A 4WQ6A 3AS1A 3WZ0E 2P8BA 2XINA 4LANA 1XINA 4JTTA 4I6KA 1VCFA 3E2QA 1S1RA 2GGEA 2ZUTA 3GR7A 3H2AA 1QNVA 1HF6A 3LPPA 1BQCA 3QC3A 3EMCA 2WNQA 2OEMA 1NFBA 3NURA 2QNEA 2VUYA 3VUPA 2GGHA 2HMCA 2QT3A 3C5QA 1ZJHA 4ZVJA 3E0IA 1VFTA 3G8EA 2ZX5A 4WF7A 4YNGA 3R6IA 3IJDA 4AIEA 3P84A 4LYPA 4MHBA 1XIDA 4UBPC 3H54A 4UFHA 3LRLA 4UIOA 3TN5A 2WV8A 4EWJA 2A79A 3A24A 3L2LA 4JKLA 4JKMA 4S3FA 2XSBA 2HJPA 2XH4A 4QE4A 4Z2KA 1KFCA 1CGWA 2R14A 3G1FA 3R12A 4QG6A 5D2YA 4DYJA 1FCBA 3WBYA 2ACQA 2O0TA 5CQ1A 3ABRA 2VC9A 1JDAA 2GZXA 1DHKA 3N6JA 4NZCA 3LCXA 2C14A 1JXKA 3AICA 2BX7A 3ABOA 4L61A 5K7JA 5FIPA 3B9EA 1XFBA 3C4UA 3GS6A 1XRVA 4AIBA 3WF3A 3W25A 4Q33A 1EGMA 3VKDA 4O10A 3NVTA 1GHSA 4AWTA 1DTNA 4LAMA 1UKPA 4HB7A 2VX5A 1QPQA 4ORIA 3GNPA 4O16A 4MFDA 1EJ7L 3T0DA 3NL2A 1IXOA 1D3HA 2BGNE 3BUVA 5KETA 3RUBL 1S5VA 3O16A 2ZE3A 2TYSA 1GOMA 5IFPA 7TIMA 3NQBA 1OYBA 1K03A 4LB3A 1ONXA 3QRHA 2W27A 4AZCA 4W8AA 3RX2A 2J9YA 3C6CA 4HA0A 1ZAHA 2JALA 1Z89A 2G3MA 3FJNA 4QE1A 4QG8A 4J3XA 4Q8OA 1HX0A 2A3AA 5LIUX 5A1AA 2ZVRA 4V1YA 2PI6A 4ZFMA 2ISSA 1B4EA 3TCSA 3EPMA 1A5NC 1UUOA 3ZO9A 1DL3A 3UXLA 4IX2A 1FWEC 4JTIA 4HTBA 2QV5A 3NVDA 2OYKA 1XBXA 1XYMA 1WDDA 5KZMA 4UQBA 4O0KA 4JTFA 3LCIA 4UFIA 3RGTA 2E67A 1R7OA 2DVXA 1L8PA 1FKWA 1HNYA 2NX3A 3HTWA 2G4FA 3GC2A 3W83A 4NL1A 1W91A 3L4YA 4YTSA 1FWAC 4LC8A 2QDEA 2E1DA 1WCGA 1MO0A 1E1FA 1JI1A 4BF7A 4IG2A 2A21A 5D9MA 5GJMA 4PB4A 2PF0A 4YCPA 2VTFA 2X16A 2GUYA 4GG9A 4U5IA 3LUTA 1VJIA 4B5UA 3MSYA 3WN6A 2F9RA 3RX4A 1B2YA 4LAZA 4E38A 4IGSA 4E2VA 2PD5A 4GGHA 2X09A 1DWJM 4IXHA 1KGUA 2J7FA 4EANA 4GNVA 2DZAA 4UNKA 3RR1A 3IIXA 2PLMA 5CJNA 1K9TA 4H9YA 1Z32X 4BQ4A 4C5YA 1KCLA 3WQGA 5HJXA 1TVPA 4ZOCA 1F8MA 1KLZA 2ACRA 4M5PA 3KTXA 4HU0A 4H9UA 4IMDA 3CQJA 3NDYA 1V02E 4MFEA 4P7OA 1KBLA 1GPWA 2XSXA 1BQGA 3ZVIA 3E9AA 1TE6A 4AVFA 1WAWA 1XBZA 1JR1A 3VABA 2VKZG 2XH2A 3CEUA 2FTPA 4V33A 2HS8A 3IK2A 2GWNA 1ZB5A 2CLKA 3HQ1A 4HNCA 4PFMA 3CGTA 1MRAA 3DKLA 2I16A 4BK9A 1EIBA 1MW0A 5B80A 5CPOA 2G5WA 1R3QA 2IQTA 3OZPA 4C6DA 2GJNA 4C6EA 3WQ5A 4OV9A 3RX3A 2XGBA 1H51A 3DG3A 2BP1A 1WBJA 4R7WA 4D8LA 1W56A 3MCNA 4GKLA 4H00A 2V2CA 1OFOA 4GXWA 1UASA 4IP4A 1A0EA 1SJAA 4M7SA 1VBUA 3CUIA 3OBEA 1YTKA 2A3LA 3RU8X 4JX6A 2Q8ZA 2W4XA 1QT1A 4AYGA 3G1XA 1H0GA 4X61A 5FA5A 4L6HA 3HPFA 4F0LA 4JY9A 2WVVA 4GGBA 3PSWA 3UJSA 4J4KA 4XZMX 4Z1AA 4A2SA 6ALDA 1R2RA 1NSJA 4B5WA 1PX8A 4LU0A 1KM4A 2HRWA 2NW0A 1T96A 4IZGA 3C8FA 3KEHA 4LOCA 3W71A 3TEVA 5A8PA 4G6CA 5FSEC 3QGAC 3LPOA 1W6TA 2WMIB 3N73A 5IRPA 3HPZA 3A5VA 3QV6A 1HKWA 4K1WA 2ZADA 1PKMA 3B40A 3H2FA 5DMMA 3UESA 5J5RA 1HJQA 2CZ5A 5I3DA 2ALDA 3WQVA 3GK0A 4DF0A 2QUUA 1BRLB 2IKJA 3NPUA 5M03A 4M6PA 1F6PA 1Y0EA 1XW8A 1JVNA 3UY8A 5BOFA 1A4LA 5M17A 1QWGA 2A3BA 5AHFA 2FZNA 3P0XA 3HG3A 4Q4QA 4LUYA 3AUOA 3PUGA 4AWUA 5HQLA 2A7NA 3W82A 4RLIA 3EOEA 2JKEA 2OO0A 4N6EA 1E5NA 3C86A 2ISVA 4CVWA 2CHOA 2P8CA 4CN6A 5E6YA 4RDVA 4B3ZA 3BL3A 3B8DA 1DQUA 1EOMA 1KCZA 4AMCA 3S5YA 3IUHA 1OFDA 2ZDRA 1KFLA 4JQ3A 4WR3A 4LUSB 3WMBA 3NQMA 3N14A 5C54A 3VFLA 4JTSA 2QEZA 4LF1A 4CGTA 4Q6XA 3MP5A 4K6AA 1LRNA 3FIGA 4X0NA 3SJNA 3AWNA 1TX0A 3DENA 5CJMA 3M0YA 1TIWA 3BLOA 4V2XA 4XTDA 4JIIX 1GOIA 1LWHA 4B5NA 1W8SA 4PEEA 1P4CA 2W92A 4ICMA 5C9WA 2RDWA 4IFRA 3S46A 1ZS2A 4PCPA 4YJ5A 2YFOA 3PSVA 1LL7A 2FPYA 3VD7A 5CZJA 3PVFA 2WQPA 4B92A 1MW1A 3W1NA 2DV0A 3APTA 3VNZA 3TTQA 2C6QA 5A8MA 1KCXA 4LBSA 2NQ5A 3FX4A 5TIMA 4AB4A 2BVTA 3UW6A 2XFWA 1ADOA 3GDMA 2V5LA 5A69A 5BXPA 4AZ7A 2FH6A 1PCWA 5IOBA 3A9BA 5DLCA 1QFEA 3WNLA 4DELA 1RD5A 1CGVA 3VILA 2PDXA 2CHRA 1N8IA 3G24A 1SZFA 4PZVA 5H91A 1XIEA 3L2IA 2YCJA 5A8OA 1WOBA 3REQB 2RH9A 3GHRA 1AFSA 2HNHA 1C92A 3DG7A 2DT2A 3BJTA 1YYAA 3CASA 1KRBC 2QHAA 1Q6CA 3KHJA 4JFWA 1NU5A 2GFTA 3T42A 1O68A 1P0KA 2PE4A 3BH4A 2Z2AA 3W7MA 1TVLA 2G41A 3W7LA 3C3UA 2LLEA 3W86A 2V5JA 1M7XA 4GKTA 4CCEA 1VFHA 2FJUB 3OJGA 4Z08A 1V3HA 4CU7A 3T2PA 1PX3A 4NYYA 3T0TA 3ZR6A 2WHJA 4JBRA 5F2LA 3W7JA 1V8EA 1UR2A 4EAYA 2XG9A 3LV5A 1J0IA 1F74A 5DY2A 1JRCA 4S1FA 4LAOA 1REQA 3M0IA 1MXDA 2Z25A 4AMAA 3A12A 4OFCA 2GVGA 3A4WA 3EB4A 3TKFA 1P48A 2IKGA 1S2UA 5FJIA 3VIKA 5I23A 4BCEA 1SR9A 5I5RA 4BQ2A 3V0UA 1XDJA 2WQDA 1SMDA 1XSKA 4H4IA 5CC3A 2ZWZA 4PBGA 3W1MA 3UG5A 5AECA 3UJEA 2QVHA 5ECUA 2J27A 4CNTA 2RAGA 2Z7GA 3GB6A 2UWFA 2C8NA 3S2NA 1L9WA 4O50A 4KRZA 2VL4A 2BODX 5LA0A 4M81A 2ZRZA 1GONA 2V8ZA 1CXHA 2J9ZA 4I8YA 2QUTA 3OVRA 1FH8A 4GO9A 4JZ5A 4O0QA 1R3TA 4NNBA 3T6CA 4DNHA 1JIBA 4JICA 1MNZA 5C2CA 7PTDA 1EUNA 2E4TA 2D2HA 2WO5A 4J28A 1J0YA 5G1MA 2Q8LA 5J5DA 3PC0A 4DXKA 3IJ8A 1ZCOA 3CS2A 1V6VA 3CC1A 4DJEA 4YS1A 1XLBA 3EKLA 3VKJA 1IWPA 4NHVA 2EKCA 3WUGA 3VIFA 4N6FA 3W1TA 3ABSA 2HZGA 5CC5A 3N13A 4YTTA 2BV9A 2PWHA 3SR7A 4PTXA 3E96A 5H8MA 2WSYA 1TRIA 3CL6A 1BSLA 1IR2A 3HFTA 1DKWA 1A80A 4WEVX 1HKKA 3NM3A 3MMWA 4PL2A 3ARRA 2QLYA 4JQ2A 3RO8A 1AD4A 4U31A 4NUWA 5XINA 4R5EA 3N3MA 4OV4A 1QI3A 2PDPA 2YCLB 4HYRA 3PJXA 4ZSUA 4JIRA 2FGZA 5HR6A 1LORA 1JDFA 4ZODA 4J1OA 3HM7A 1EA9C 3AROA 2QCDB 3NOEA 4JFSA 4DWSC 1L6YA 5KEZA 3E2SA 5BROA 1F73A 1SO6A 3G0XA 3MSDA 3E0LA 3H2MA 3NQ7A 1KW1A 1EWDA 4H9VA 3GG1A 3LK6A 3WLSA 1NELA 2YZ5A 4ZOBA 1RLDA 3VNDA 5CZTA 1UYQA 2DQWA 2XVGA 3HO8A 5A8QA 3F2BA 1B57A 1OT1A 1TTQA 2EPLX 1HKIA 4DB7A 3HMCA 4Q8UA 3L21A 3STEA 4UTHA 3BSHA 3QW4B 1JDEA 5HINA 4D6CA 1R9XA 1D3GA 2AQWA 1GT8A 3UYIA 3WL0A 2DQXA 3PAJA 4A3QA 1OCJA 3PR2A 4HPHA 1QK2A 3W38A 1XIGA 4HD5A 6ENLA 3T8QA 1V6YA 4XKYA 3S1UA 5EKYA 4PSRA 1KBBA 4AZIA 4UNIA 4AD3A 2FTYA 2YJQA 4CU8A 4AY7A 1F61A 4XUGA 1JCMP 1I8JA 3M47A 2E9LA 3QVQA 3PBYA 2V2HA 4HJWA 2WWDA 3RRXA 1J6OA 4UR9A 4QDWA 1KWGA 4U4MA 1AZ1A 4WCJA 3ARXA 2Z27A 4US5A 6REQB 2VZUA 4W7WA 1Q6QA 1BPLB 4F9DA 4DJED 3QGVA 4NY2A 2VGBA 2VENA 2NXHA 1XI3A 4A3HA 1NOUA 3AYSA 1LOLA 4ZOAA 3HU7A 4MNJA 1JRBA 1XDMA 1RBOB 1EXBA 1XLFA 4Z1CA 1VAHA 2J88A 1RAKA 4MWAB 2ZRXA 4CVUA 3AIWA 2O9RA 1EC9A 1TJ1A 3CJPA 3NQCA 4J3WA 3EDKA 1PKLA 1KWKA 2E77A 5LXEA 1ZP3A 4URIA 4XX6A 3M9YA 3BLPX 1XH0A 1L2QA 3BMXA 3BWWA 1OK4A 2GWGA 4FX8A 2WANA 1ADSA 3E5PA 1T99A 2CZFA 3LMZA 3VGEA 3KZSA 4W7VA 2YOCA 3O6DA 4WSKA 2WXDM 2GUBA 4FNQA 1ZNNA 3NA8A 3GLCA 4XK2A 2GQ8A 2Y6ZA 3U0HA 4EK7A 1CDGA 3NGJA 4L64A 1VF8A 5C6MA 4L9XA 3D0CA 2HISA 1GQNA 3NO3A 2BG5A 5LNVA 3F5LA 1DE6A 3QTPA 4FF5A 4WKFA 1RPXA 4XWUA 1EJXC 4KIRA 5BU6A 1E1EA 1WUFA 3TAKA 3TH6A 3U5UA 4Q8PA 1E6RA 1UD4A 2PLCA 4GPNA 2XPKA 5DRIA 1G7VA 1TFVA 1B30A 3N29A 2D73A 3H55A 4HHLA 4RDYA 1PO9A 1BTCA 1QPRA 3T44A 2NQLA 3QKEA 3C2YA 2Z26A 4NX5A 3TR2A 4AQLA 3PTKA 4LAKA 3JW7A 1RHCA 4PUWA 3H7VA 3F4DA 5D2WA 1V77A 3NL5A 3SFKA 1G69A 4C6MA 2GSJA 1JCXA 3ECQA 1KXQA 4IL0A 4NRRA 1XDLA 4PMXA 4G7EA 2WM0A 3QPYA 3RO6A 3MHUA 3B8SA 3GTXA 1DJWA 3MHGA 3AU2A 4M0XA 4JCMA 5I06A 1Q7QA 3VKCA 2INFA 3QZAA 4HNOA 3SQLA 2DT1A 1ECEA 3KOFA 2Z28A 3H7UA 1Q66A 2P3EA 1QJWA 1A0CA 3JS3A 4FAMA 4D72A 3TUUA 5LA1A 4RNJA 3GW3A 4JFUA 2C91A 3MYOA 4ACZA 1Y7VA 1BF2A 4L6DA 3QMSA 2Y7GA 1EJVC 1XSJA 1OEPA 3WJWA 3VZZA 3Q94A 1GQJA 4M51A 1QNQA 1FHVA 5AN7A 4PTWA 3ZXWA 4Z1YA 1OX5A 2CPUA 3D3FA 3UEQA 3OIHA 3HQOA 2OG9A 2QPUA 2B0MA 1GQKA 4NJHA 1BKHA 2FGBA 1LOSA 3LHVA 2YXXA 4C7GA 1EWEA 5DX7A 4WK9A 5AHLA 1EO5A 3C2EA 4HPGA 2O9PA 3W00A 1U1HA 2D2GA 3U2ZA 4YTQA 1DEDA 3PB0A 3GU1A 2FVKA 4LS2A 1TA3A 2YR1A 4GI8A 1Q5MA 4CQBA 5EU9A 3N2CA 2ACSA 1CXKA 4XAGA 3U3HA 4JOMA 3BG3A 2P53A 3U4AA 3AHZA 4NZ5A 2VQTA 2YZRA 3W7DA 4XQ6A 3DYOA 4MNMA 3F4WA 3STFA 1S5MA 8A3HA 1YADA 3TROA 1W1A1 3W2LA 1UKQA 2NUWA 2HSAA 1XQKA 3RJXA 3W2NA 3MYPA 3BZGA 1OT2A 1R30A 1BAGA 3F1QA 1M03A 5CPNA 4UTFA 5AC7A 5DMYA 3INPA 5F1UA 4D6IA 5LSMA 5TQLA 1WNOA 2CYGA 3L4TA 4D1IA 1D2KA 2F61A 3T78A 1T7LA 4R85A 1IR1A 3CWNA 3GC5A 1J2BA 3S2LA 4JGDA 1UMYA 4PGLA 1OYCA 4WDUA 2XGIA 4MDOA 3CXOA 1Q2RA 1EOKA 2ANUA 2ACUA 3PBMA 1W31A 4YYFA 3DAQA 1NM9A 3MBFA 4MKVA 1DJYA 2EGZA 3DGBA 4JR5A 4A05A 3AMLA 3LXAA 4IGHA 4MKSA 1K4GA 1IT0A 4XKMA 3AZSA 3A5FA 4O1AA 4BJHA 1PS9A 1ZL1A 5BU9A 2OOFA 4RZ5A 4EVZA 1QK0A 1TR9A 3KWXA 4ZQNA 1VHCA 1W1YA 3FA4A 2XM1A 1UKTA 4ATDA 2NQJA 2VM8A 3UY7A 4Y9AA 2BVWA 2OQLA 3F5JA 1EB3A 2EAWA 2BBFA 1DIEA 3L5LA 1KBIA 2YW4A 3CAQA 1Q6DA 1RSCA 4DF1A 3RRAA 5CBJA 1E72M 1E0XA 4W9TA 2WSRA 2WC3A 1DORA 3QHOA 2QJHA 3NSNA 1TCMA 2CERA 3C8NA 3ABZA 1H1YA 1M9HA 4ZMGA 1WDQA 2ZUUA 1C7TA 1KB3A 3UWUA 3NO5A 3SFWA 3TW7A 3VC5A 3GZ3A 4J7RA 3BV4A 2BY0A 2W66A 2VOMA 1UPMB 2Y70A 3IGHX 4YHGA 4GVIA 4MZYA 3WLKX 4EIVA 1A53A 1G9HA 3VNJA 3WH8A 5FAJA 1HJVA 4Q8VA 1L6WA 2WC7A 4DY1A 2YW3A 1VYSX 2NUYA 4I6VA 4UOJA 4MY8A 1O95A 1JCYA 3FDGA 1JGMA 3RM4A 5GQBA 3UWWA 4GYPC 3HG4A 1H60A 1Q3NA 8TIMA 1JFHA 3GDRA 4ZTXA 4RXFA 5C9UA 1CEOA 4MG4A 1ISWA 2XN2A 1XP3A 3N25A 1G1YA 1E6QM 3NXFA 3P74A 4B15A 1W1VA 3BQ5A 4DI8A 3KP0A 4EF8A 3R0KA 1C9DA 1E6ZA 1UR1A 4WRHA 4I90A 3WK2A 4POCA 3AS2A 2ATMA 3WQDA 1O7AA 4A8RA 3TC3A 4UUIA 2VRKA 1GYLA 3SW6A 1RBLA 1P7TB 3QQWA 4FX6M 3PM6A 3WD4A 3WD2A 3CZ8A 4YXGA 2YL5A 1XYBA 3IEBA 4S2CA 1ZALA 5A5WA 1CXEA 2VR4A 3L0KA 4KRTA 1IT8A 2W0UA 2AAAA 4B90A 3VMOA 3NEHA 4QHRA 3BTNA 3GAYA 4Z17A 2NZLA 3W07A 1KLYA 1NOFA 4CQCA 4OHQA 1ZHAA 1PE1A 3OZOA 4GUHA 1RXOB 4HBKA 1MYRA 5FEZA 3O2LA 2ZC8A 3SUWA 3T81A 1S2VA 1A49A 2OZTA 3T55A 3NUKA 8XIMA 3IAQA 2W5FA 4NJJA 3GVQA 2WB5A 3CPUA 4IIGA 5M1TA 1XUUA 1H5VA 1VYPX 1VC4A 3VCCA 4HCLA 1GPFA 2QCGA 2VNCA 4AZBA 4DZHA 1HP5A 5HATA 1XJBA 1SFTA 1P0NA 1W9XA 4EP8C 4IFKA 2DUZA 4UTIA 3VA8A 1F6KA 1UD5A 2R9RA 4KCWA 3A6OA 1FP8A 1RCQA 1L0PA 2QIIA 3TP4A 4KWVA 2PDIA 1EGZA 7REQA 3W9ZA 2WMFA 4F8XA 5HANA 3SBFA 4RV3A 1CNVA 1IZJA 1I75A 1R3YA 4U33A 2VD8A 3EDDA 1HO4A 3O06A 3N3TA 4M56A 3TA6A 3VC6A 2A7PA 3VOCA 5IDZA 2W9MA 4XAFA 3G1RA 1Z8AA 4GYKA 4ZO8A 3W75A 1UBPC 2GQ3A 2BXVA 2Z1SA 3BAXA 3AU6A 1EJSC 1CCWB 3AMKA 1KXVA 1FY6A 3QFWA 5T26A 2V3FA 4QCEA 1TR1A 1DBTA 4M6VA 4MLJA 1ICPA 1GOOA 4LF2A 3BG9A 1UKSA 2EPHA 1FFQA 2CLIA 3IPWA 4GQQA 1HTIA 1K1DA 4O53A 3KE0A 3BOXA 2PEVA 4J5NA 4UFKA 4RKAA 2PRHA 4D8AA 2Y7FA 3ITCA 3SURA 4H3DA 2ZOXA 5E5CA 4UB9A 2E6YA 2WOQA 3TNOA 4JX4A 3EOOA 4HZMA 4F9JA 3PPHA 2FZDA 1X6LA 1HJWA 1UPPA 4LWWA 4O54A 2NV2A 1QO2A 1V3IA 3K4AA 3KS6A 3HV8A 1EYEA 2PDCA 4M1BA 5ABTA 1YNQA 3M43A 4AEOA 3AXHA 4HU4A 4XAPA 2Z7KA 2V5KA 3OG3A 3V35A 5BWAA 3KZPA 3VOIA 3ZSTA 4GOAA 2OEJA 2ZWYA 4IIDA 4QEEA 3UPMA 3K46A 2C18A 4C6NA 2FFCA 3HF3A 1QBBA 5E70A 3Q37A 1HJSA 2WZEA 1J9YA 2E68A 1K70A 5AHIA 4PUKA 3VOGA 1DP0A 3MJMA 1D9EA 3R0UA 3RG6A 2V63A 1YRRA 4K8HA 5A94A 2GUUA 3NO1A 2AQOA 4GQBA 4PCTA 1PL9A 3M5ZA 3P5YA 3UJRA 1XHGA 1WXYA 1ISXA 2IQ0A 1PAMA 4DWSA 1C8YA 2PBGA 3STCA 5FSDC 3NEVA 1DIDA 1V5XA 3GD6A 4ILSA 2Y89A 4IISA 1D7KA 1WDPA 5F1VA 3MKKA 2X7WA 2CLOA 4FXJA 4UQCA 4C6KA 3NDZA 2EPKX 3GUWA 2OSXA 4KBXA 4C1NB 4DHGA 3KOYA 3WNNA 3RLUA 2CWXA 2J78A 4CD7A 2VJXA 3BG5A 1TJRA 3VOHA 1BD0A 1H50A 3ITOA 2B81A 2FYMA 1OC7A 2HXUA 9CGTA 5HUPA 4YYCA 4EPBC 2D22A 5A6BD 1YNPA 3EXRA 2YBVA 1A5CA 4IJRA 4AISA 5C2GA 3OLEA 4OU1A 2JBMA 1DJXA 4LXFA 4IJCA 1UWIA 3K5XA 1OG6A 1EPVA 1QASA 3GYEA 4IQDA 5T9CE 3LBCA 1PTDA 3TW9A 1RK6A 2PSNA 1FUYA 1E15A 4MUPA 1Q8AA 5FD0A 3SGGA 4GABA 1XPYA 4JKKA 3GVWA 3QV8A 4AXKA 1SJBA 1ZU8A 3I4KA 4ML9A 1QO5A 1J0KA 3PTMA 3UCQA 1F7BA 1YBQB 3UR5A 3PZUA 1POJA 4TVDA 3CO8A 1ONEA 3H70A 4LUIA 3B9AA 4O14A 4J3UA 3B4UA 1ENUA 3W87A 2OQHA 1XYCA 3UNTA 1K02A 3LENA 3QFEA 4R7JA 4ONVA 4E0CA 4M8UA 3OGRA 1JCLA 4UTTC 4F0HA 1V6UA 2E0PA 5CZKA 4QAWA 2W6RA 4PB3A 1OX4B 1W3KA 3LTYA 2NLIA 3L4XA 2QCDA 3DFPA 4G7FA 1KFBA 1FWGC 4JHZA 3LLDA 3QOMA 1KBJA 3U7VA 3LPFA 4Q8TA 1M6JA 4B2DD 3MI2A 3A3HA 3GVRA 2AMXA 2PU1A 1GCYA 3U9IA 1A50A 5AB3A 2WCAA 3E0VA 4JEJA 3IGUA 1E0VA 3ZR5A 3ITYA 3G0UA 4QX4A 1VJZA 1JNDA 3N6QA 1HKJA 4ZFCA 3M0LA 1K6AA 1WZLA 5C70A 1I2NA 3M5XA 5DN1A 2QCLA 1C90A 3CT7A 2BFGA 4EPKA 1KM1A 4U2YA 2D20A 3LCFA 4KERA 3DH7A 1GJUA 3BICA 3UG4A 3HV9A 4HMEA 1WKDA 4K38A 4P8XA 3TZFA 1UCWA 1UUQA 1YTEA 4ZQOA 2V6AA 4TX6A 1LF1A 1XWYA 2ZZ7A 3TQKA 3LQLA 4B5SA 2Y7EA 2WSKA 1M1BA 3TN3A 3FJ6A 4YVVA 1J11A 4R9OA 3AIEA 5JBFA 1SW7A 4IIHA 4FLOA 3CMJA 3W7QA 3ONCA 4QNEA 3ES8A 3N19B 2PC8A 3C2RA 3HQPA 4IGNA 4AD5A 1CLKA 4XBKA 3I7SA 4XZWA 5FOOA 4DZ5A 3BLEA 4WY0A 3TJ4A 3BZJA 3N2TA 3GW0A 4J3ZA 3RK8A 3DC8A 3DFSA 4L4MA 1M01A 3OTRA 4QR6A 4H9XA 1EA0A 4C6OA 3CYJA 3B8VA 1CLXA 5EYWA 1MW2A 3NSXA 3SRHA 5DCDA 1DWFM 3TLLA 4AW7A 3UVIA 1W8GA 4HSHA 3CU2A 3WLIA 4ASTA 2Y61A 1W37A 4U3CA 1JXJA 4RW5A 5AC8A 3NQ2A 3AUJA 1M7PA 3MTWA 2CXEA 1XLJA 1S39A 3H2OA 4QQUA 3WLMA 3NYDA 1PEZA 1MNSA 3QMRA 2J13A 4B4FA 3ZVHA 2PODA 3WK1A 2ADAA 1KD0A 2XUCA 5EFFA 3G18A 4HNVA 5CSUA 9XIAA 2VVNA 1L2UA 5A6AA 4OUEA 3CQIA 4C5ZA 4AFYA 1FWSA 3CZGA 1A5OC 3SRDA 3KCJA 4AZCB 4Q4OA 1OGBA 3MVTA 4GVHA 4KEMA 1GW9A 3NM1A 2J7BA 3S6TA 3KRUA 2J62A 4IICA 2J77A 3A22A 4HMCA 2I1OA 3B3DA 1ZJBA 4IL2A 1QOPA 3OU8A 2ZZ6A 2OFJA 1EHAA 1C8QA 2TAAA 2VEIA 1O12A 3QLLA 4WJXA 4DF2A 1TVNA 3BLKA 2CIPA 4YTRA 1M04A 1CECA 3LERA 4N4QA 3CWOX 3L7RA 1XR2A 5HMFA 2BB0A 4E6MA 1YPIA 1OCNA 1E4NA 1V6TA 1GHRA 4LY4A 2GVEA 3VIHA 2AL1A 3W74A 2C1HA 1A47A 3W7NA 4LAUA 3OG2A 3QH2A 3AIBA 3DOPA 4L80A 2ZXAA 1QOXA 4ZB0A 2CBUA 3VOJA 3U7BA 1W9PA 4KT2A 2Z24A 1Q6GA 4IG2B 2DSKA 4DBDA 3HN3A 4XVDA 3SIZA 3SCQA 3EWDA 3I6TA 1JCJA 4S3BA 2QCFA 4AD2A 4NXSA 5DRCA 3K4DA 3A23A 1MQQA 3W27A 5JUVA 5CEWA 4L56A 3WQ6A 4Z1DA 4EXBA 1VRDA 5FESA 1NARA 4P7RA 2HCVA 1P0DA 3WJZA 2KZHA 3DHPA 1H41A 4LEFA 4ZCWA 2EPMX 4HHMA 3S1GA 3MUY1 4PMDA 4AZ6A 3URQA 1T0OA 1TV3A 1TE1A 1EUAA 3VFCA 3BW4A 3H4WA 1CYGA 1W5PA 2VFGA 4UXDA 4GNKB 1GW1A 3WLQA 1FBAA 2ZXBA 1CI1A 1S1PA 3MV11 4ZA0A 1JCNA 4J35A 4QLJA 3L5MA 3W2MA 2WM1A 3TYEA 2V3GA 2ZUMA 4MYXA 4ZENA 1RBAA 2GDVA 5FEPA 2NXGA 3KL3A 2P1FA 1FDYA 4Y9NA 1S2TA 4GX9A 1TIMA 3FJ4A 5GNXA 1AMYA 3H7RA 4AIUA 2PU0A 3F4VA 3TYBA 3D5HA 2VQUA 3RM9A 3DX5A 3PBGA 4S2BA 2CBIA 2J74A 3E3HA 3RMEA 1BWVA 4G8TA 4NNAA 3O6AA 3WQOA 1K8YA 3AMDA 4WIWA 5GNZA 3OZYA 4IQEA 3U48A 4MWAC 3GHSA 2QGYA 4Q22A 3FJLA 4HPXA 5C5YA 3SAZA 2P50A 2GJXA 4G2DA 3IUDA 4FXRA 3UNDA 4WZHA 2WVVB 4XSLA 3DCPA 2ZZ3A 4GH1A 2C3ZA 1LCOA 3KBMA 1VPXA 1QW9A 5I78A 3NTYA 3MDWA 3TMQA 5CCZA 1FP9A 3PZQA 4WHBA 4OECA 7ODCA 1LUCA 4IOTA 1NDVA 3G1DA 4NJKA 2YLLA 2VR5A 4HPNA 1S46A 2QJMA 1T5AA 1K6WA 2FH8A 1M7OA 5IXEA 1B3ZA 2QV4A 3FVMA 2ZE0A 4PA8A 3RJYA 2QDHA 3BGAA 3RXZA 1GORA 1EDGA 1FVPA 4IP5A 3UWQA 1J6PA 1XUZA 2O56A 4HP5A 3B8UA 1GKPA 3TYAA 3SY1A 1Y65A 3OA3A 2VCCA 3VIIA 2XIQA 2Q3OA 2XZ9A 4H01A 3P61A 1ITQA 3GDKA 4GYJA 3SCTA 1KM2A 2J8TA 4RZ4A 3SCOA 3LN3A 4QFUA 2YXGA 5DANA 4OBRA 2FQIA 3CUHA 1PXGA 4KGLA 4W5UA 2GDUA 3C52A 3NQGA 2NX9A 1I6NA 4C6PA 4RDWA 1E70M 4QXIA 4PTDA 1XRFA 3T9PA 1K7XA 5CAKA 3VOFA 4C91A 4F2TA 2WMKA 5EMMA 5CC7A 4P8VA 3VIOA 4ZB2A 2VURA 1FDJA 2E28A 3OVPA 4DJFA 4XO7A 4AH7A 1S2WA 4BEUA 2WKGA 2E1WA 2AGTA 1UR9A 1W5QA 4M19A 3O07A 1V03A 1G4SA 3STPA 2REQA 3G8RA 5EGRA 3WQEA 4BKNA 4E8CA 1NY1A 5FJPA 1OHLA 4DBWA 3T0CA 1WO2A 1JPIA 4TV5A 3B0YA 5HNNA 1QXLA 1H63A 4KCUA 1KRMA 1JDCA 3QGKC 1R0MA 3CB8A 5AHNA 3DERA 4TV6A 3IJ6A 4S3JA 2CWNA 2UZ9A 1KGWA 1I2PA 1J01A 1NP2A 5LYRA 3W01A 2PLJA 2A0NA 4K2SA 4IQLA 4JXCA 4WSHA 3S1XA 2FTWA 4Y9OA 4S3KA 4FLRA 3SY8A 4KEZA 1F76A 1FXPA 1GZ1A 4YU1A 3ARPA 3CMFA 1MSSA 4AZGA 1X1NA 3P67A 1OWQA 3WD1A 4CNPA 1CPUA 4XB3A 4GX8A 2DVTA 2J47A 1G4TA 3RMJA 3KOZA 4NILA 5A8GA 1ZBVA 5T91A 4DXXA 1ZY9A 3C56A 1L6FA 3BAJA 4UMBA 4X2RA 4X9YA 2VXNA 4JTRA 2R91A 1AUSL 5EL1A 2A5HA 1HN1A 3WLOA 3EWUA 4AVNA 2ZX9A 3KS5A 1AL7A 3CV2A 2OT0A 3R58A 1RY8A 3LHWA 1TREA 2B7OA 4KGJA 3M0HA 4JYEA 1RD6A 3LHYA 1YDVA 3T4WA 5AVHA 4MNKA 3VIMA 1G5AA 4RZ6A 1T6MA 2RJHA 2CCRA 4MJ4A 4HZ8A 3NSMA 3WMCA 2WSPA 3MT1A 5E0CA 3BANA 3M6DA 5CBIA 2VD9A 1F3EA 1NIUA 4ECLA 3RCMA 2DVUA 5TAOA 2V2DA 3IV3A 4XZNX 3VNKA 4DJFD 5M2FX 2ZA3A 4C6LA 1R5YA 1REQB 2G8ZA 4DPQA 4HJFA 4HCHA 3GH4A 4QROA 1UW9A 1ME9A 3ANYA 3IIOA 5CGTA 1XLKA 4XZ9A 3E6EA 3UU0A 4H8HA 1KO0A 1JZ2A 2WNZA 1FOBA 1FH9A 3TMLA 5D38A 1HO1A 1UA7A 5G2HA 4BI7A 2FB3A 4TMCA 2E5BA 3GYCA 1CW2A 4HOZA 3B0VC 1GEHA 2VT0A 5BOOA 3L5AA 3H21A 1Z42A 4L4LA 3K2GA 3Q67A 2F6KA 4W8BA 2AKZA 1SGJA 5REQA 1M65A 1KCKA 5LIKX 4E4UA 1FHDA 3R43A 1FHLA 4NJGA 2ZCGA 1D7FA 4H7VA 3BSMA 2YFNA 2PGWA 1OYAA 4AVOA 5HMSA 2R1NA 1SMAA 2PTXA 4I9TA 4GCAA 5JIPA 5JQ9A 2D3LA 1OCQA 3QYQA 1YXCA 3ZLHA 4EPEC 1DXEA 5IM51 2V82A 3ZS4A 2Q6ZA 5CG7A 1BHGA 3W23A 2YB4A 5FF0A 4DPPA 2XIOA 4GFIA 5G4HC 2GOKA 2E6FA 8CGTA 1DTUA 2Z00A 2ZQ0A 4CCDA 3GXFA 2NQZA 3BOLA 3TVAA 2FPTA 5A2CA 4GBDA 1TV2A 3FDKA 3LTSA 2GOUA 3VVGA 1SO5A 1XC6A 3UBPC 1US3A 1EKOA 2X42A 4RE2A 2FKPA 1BGGA 3FKRA 3UR7A 2BHYA 1Y5XA 3GNOA 2O9OA 3LLFA 3IUIA 4ZEPA 2YBTA 5ECVA 4DAFA 1DQXA 1U22A 2QPSA 3WD0A 3B8TA 1WUEA 2P0OA 3QY7A 1WBHA 4GZEA 4H7ZA 1QWKA 1IHIA 4LRTA 1CX9A 3QY6A 4O8AA 2DZSA 3BLDA 3ZLFA 2PFHA 4GI4A 4S3CA 4XV0A 1W9BM 3AYRA 2BMBA 2JKPA 1TWWA 5EPDA 3PUDA 3AXXA 1NWUA 1EL3A 2QJIA 3EPNA 1UIPA 1EYWA 3N2MA 1OG0A 1AODA 4MB5A 4LEQA 3UWVA 1ALDA 5AC4A 1PTGA 1Q4NX 3WENA 3W24A 4E2OA 1TELA 1QI4A 1VIZA 3JVAA 2WJEA 2ZRYA 2NT0A 4BWLC 3G1YA 5E9AA 1BVZA 5F2GA 2W63A 3T05A 1A3WA 4CU6A 3BAKA 1UWAA 1OSEA 2QUVA 4PH6A 3UJ2A 4U28A 4DZAA 4GO8A 1FWWA 1I2RA 3DIPA 3T2QA 3C2FA 2WHMA 1BYDA 3WF0A 4AG0A 4XKYB 1GJPA 3DHFA 1FWRA 3M6YA 3W3OA 1U1UA 1GKQA 1Q85A 2IPFA 1NQKA 4B16A 2VYOA 5I79A 7A3HA 3TAOA 3MSGA 2MNRA 3N6HA 3ZLGA 4C6IA 2OOGA 2Y8KA 4PRRA 2X05A 3D3AA 3O05A 1KKRA 1B3VA 1ZPTA 3HMJG 3GY1A 4KRUA 3S5SA 1TPB1 3PTQA 1MXSA 5DXYA 5CLTA 2J25A 1ESWA 1ZZMA 3ME3A 5C8BB 2ZFAA 3AO0A 1B4KA 1US2A 1W3HA 2CEQA 2QJNA 2DH2A 2UBPC 3PNZA 3QV7A 4RZBA 3ONBA 5KINA 2VZOA 1ME7A 5F4SA 2Q8XA 4AC1X 1XCXA 4U5KA 2PC4A 3L0NA 2P76A 3PUEA 1X98A 3BAYA 2VX7A 3N4AA 4A21A 3BLFA 5HJYA 1VFFA 2ZTJA 5U7SA 2FPVA 1V3LA 3LRKA 2NVCA 3M44A 1F6YA 1E3XA 2NVAA 5GVJA 4JN8A 4F79A 1BYCA 1GVYA 4JPGA 4NI3A 1CGUA 4A8NA 1CGYA 3U2OA 3DI0A 1IXNA 4D71A 2CLLA 4M3PA 4WX2A 3KUMA 4Q7NA 3G1HA 4ZL1A 3BE7A 3RR4A 4NZFA 3ITVA 3AYTA 2ZIDA 1E71M 4OZOA 1TWDA 2OGJA 1ZLPA 1X38A 4PTVA 1RALA 2I56A 1OQFA 4BHYA 3LHUA 1EGVA 4JN7A 1DOSA 3HPAA 3VM5A 4O17A 2TODA 1QCWA 1LLWA 3LOTA 3SJ3A 3QR3A 1J93A 3CIXA 3E38A 3B9OA 2CHNA 4HGXA 3PZGA 3WLJA 4FR6A 1BTMA 5H6HA 3L4VA 4HU3A 3A21A 1DV7A 5ABHA 4FA3A 5D4YA 2MANA 3N15A 1IE7C 2XWDA 1XKJA 4QM1A 2PTDA 4MPKA 4RR4A 5HWJA 1QOQA 1Y5VA 3WDQA 1QI0A 2P3ZA 1C7SA 4Y8FA 3GR4A 4GUIA 1CXIA 3W85A 4MYAA 3NQVA 3AMCA 2E6AA 2JEPA 5DCBA 4C6CA 2WYSA 3TTYA 4AY1A 4G7EB 3F4CA 4DZIA 4PBFA 2GSEA 4K1GA 5I3HA 4WDWA 4F40A 1TMHA 1HQTA 1B0IA 5LNWA 3EAUA 2QAPA 2J7HA 3VCRA 1BXCA 1SZGA 5I2UA 1W3NA 1UMLA 1O1HA 5D9NA 1JCTA 3VD9A 5U4NA 5AZ1A 4DJDD 4ACZB 3H26A 4FXFA 4MF4A 2EKGA 4HMNA 3T09A 3P8IA 3BURA 4OT7A 1JZ4A 4M6UA 4QDMA 3RPTA 3WLRA 1PHWA 3RIKA 2HXTA 1ZAIA 3SCPA 3UZYA 5PTDA 3KVKA 1M68A 2Y62A 1A4MA 3N12A 4MTVA 2Q02A 1PTAA 3W6MA 1OY0A 1Z48A 1XD0A 1VFOA 4R3UA 5CPQA 2ESCA 1OADA 2HE8A 4LUTA 4KWWA 1V51A 5D09A 3F03K 1F8IA 4IQJA 1PBGA 1A5LC 3Q65A 3MUXA 2IQDA 3P6LA 2QJGA 3PBVA 1TA3B 1CXLA 1BVWA 3KVLA 1AL8A 1H62A 3EDFA 4RPQA 1OFEA 1MEIA 3EYPA 5C9XA 1P1XA 2B4GA 3P3BA 4JNMA 3DFOA 1A5AA 3LU2A 4J3SA 3T7VA 3NOYA 1XIJA 3A9IA 3BXWA 5E1QA 1UZ1A 2V0TA 1W3TA 1OD0A 1SO4A 1UWTA 1B3XA 1O66A 5CZSA 3VPLA 3GKFA 3QKZA 3R4IA 3VDBA 1AQMA 1FWIC 1TZ9A 4JTDA 1J96A 1UB3A 4QS5A 3SCWA 5CC6A 4EXQA 3SQMA 1A0DA 3HPSA 3DU0A 2X8RA 3GFXA 3IJLA 5DBUA 3BAIA 3NQ8A 2E40A 5HK4A 3LZ5A 4JFVA 2J7EA 3UJFA 4UQAA 3OO2A 1P6BA 2A85A 3P0WA 3ELFA 1BLIA 2XZ7A 1AH3A 1K9DA 3K8LA 3NXLA 3OODA 3ICJA 4JTAA 3VIJA 5F4XA 3LNMA 3VDGA 1MVYA 1TPWA 3OA5A 5AYXA 2OB3A 4JYDA 5FJRA 4W87A 5CZ0A 3LYEA 5AVNA 1VFMA 2HV5A 3AI0A 6XIAA 1QR7A 1ODUA 4F0MA 3K8KA 3GXNA 2Z6IA 4AY8A 1XICA 3ARSA 1UC5A 4AD0A 1WDSA 1K8XA 1EEPA 2BVYA 3UFYA 5FF4A 3IWPA 4UTJA 4HA4A 1LLZA 3CB3A 3L12A 3O8AA 1GK8A 2ZA1A 4EXAA 1EDQA 5D9PA 2VZVA 2P5NA 3L23A 3MP3A 1DJHA 1UD8A 1Q2SA 5AY7A 4JTJA 2VZSA 4GJJA 3M5VA 3LBMA 1TMLA 4ZQPA 4E4PA 4YIWA 1G6CA 5H8PA 1UR3M 2Z4GA 4C6BA 4GIRA 4KKXA 4BQ3A 2PZ0A 3W73A 2R1MA 3PB2A 4P8UA 3MO4A 2D1ZA 1AD1A 4CLMA 4QLKA 3WF2A 1Q65A 3MHFA 5DY3A 4G1NA 4PYSA 3F7JA 3KTSA 2Q3RA 3KBSA 3VE7A 5KSWA 1RLCL 3FS2A 3WQWA 3EMZA 1WKYA 3IIVA 1XBVA 3L9CA 4QLLA 3TFXA 1R3VA 2HE5A 1Y5WA 3V0TA 1V93A 3A4AA 2VX4A 1DWAM 4RE4A 3W1AA 2XTKA 3CQKA 3OLIA 3P93A 4BF5A 1VQTA 1KXTA 1C93A 4IH3A 4JEQA 1G4EA 3CL7A 4R33A 1UD2A 1IZCA 4IPPA 4K8GA 5FF7A 4IUGA 3OBKA 4I8DA 3TSMA 4WUIA 1BKSA 2DJXA 1YXDA 1ISZA 1NFGA 3W70A 2X7VA 2YCEA 1V3KA 3WDHA 4AWSA 1O6IA 1T41A 5CBBA 1HP4A 3LQGA 2DSZA 1Q6LA 1GJWA 5HR7A 1W0MA 2OODA 1RPKA 2Z29A 4A8IA 3TU9A 1IEXA 1W3LA 5EMLA 4O57A 5L9FA 4OUIA 3O9NA 2D2JA 4ZO7A 2Y88A 2CZEA 1JAKA 1YPXA 2CLEA 1JD9A 2CBVA 1BWKA 3NAVA 2ISDA 4Q8QA 3SEPA 3B04A 4NSBA 4XD3A 4YMZA 2C0HA 2H90A 4PMVA 1L8NA 1XBYA 1HUVA 3EA1A 1C3FA 2E09A 5EB8A 1JAEA 3PFMA 4R9XA 4PMYA 1T8XA 3MUIA 5CGQA 2ZUNA 4G5DA 1NVMA 1H7PA 3AHYA 3RITA 1UZ4A 3E2RA 4FPSA 4HYWA 3G1SA 3N9SA 1ZJAA 2RHGA 3R79A 3PNUA 4W4QA 3ZQ9A 1W9UA 1WYIA 5JBEA 1HIZA 2C16A 3VTRA 3IAPA 4KS0A 1AG1O 4BI6A 1H11A 1TWIA 3DUGA 3NPWA 3B9DA 5G4EA 2DZUA 3SECA 4IPLA 4UTWA 3MU7A 4QSFA 4HSOA 4L9ZA 3TXVA 4AAJA 3CQ0A 3C0QA 3P80A 4B91A 4FNRA 1D8WA 4JTGA 3RPMA 5KZEA 5DT5A 1UD6A 2W67A 1THFD 1O5XA 1A5UA 4IFKB 5A95A 3FSTA 4FLSA 3SM0A 2AKMA 1XS2A 1R3RA 3O6CA 3V18A 1AQHA 4AEFA 1QAPA 2EQDA 3AS3A 7REQB 2Y8VA 5FJUA 2A7RA 3BMWA 3S5ZA 4RL3A 4L65A 1H7WA 3W2JA 4B5TA 1W2PA 2R82A 1XCFA 3CZJA 4UTLA 5H1WA 1AK5A 4G56A 1E9LA 1LQAA 4IUOA 3EOSA 4GI9A 1DJIA 4ES4A 1RVGA 3KXQA 5TBOA 2P10A 2V67A 2ZICA 1R9ZA 3P14A 3W7HA 3AOFA 3GNDA 2QULA 4UFLA 3LDVA 3TJXA 4R7OA 2RGLA 4ML4A 4HNNA 3CUFA 2JKAA 2BGQA 2OWXA 3DECA 4N2YA 3SSZA 2P0IA 4L4OA 5IBXA 1QNRA 4TU1A 2ISWA 2ZC1A 1MEWA 4ENLA 2Z1XA 1SSDA 3LBOA 2X30A 4BQ5A 1MUWA 1JFXA 3WLPA 4A3UA 3ARYA 3WDJA 4JTKA 1TV4A 1A3HA 4JL2A 3H4GA 3HIJA 2XIJA 2ZDSA 3VGFA 3PJWA 3PK7A 2HWGA 1AA1B 1E40A 1FRBA 3W53A 5D04C 5A8NA 3UXDA 5LNUA 2NQHA 3B8IA 3WD3A 2CLHA 4MMWA 2Q09A 3I7RA 1VR6A 4JFTA 2RUSA 2V81A 4EF9A 4O1FA 5LHFA 4IMFA 4KW2A 3SGUA 2EJ1A 2POZA 3GXIA 4GJIA 2FDSA 2R6OA 1HVXA 3QM3A 2V68A 3EX1A 2VDHA 1HT6A 2VCAA 4UZUA 4FB7A 3EWCA 5FJOA 5G4WA 1PB0A 5E0KA 4DO7A 2ZUVA 4UOQA 5I77A 2OLHA 4O0ZA 3TXZA 4NZ1A 1QUMA 1KFKA 5G2IA 3SO7A 3MC5A 2QUNA 1NOWA 1QNSA 3W7OA 4GZ7A 3UZWA 1E9YB 2PCQA 3R2GA 2VELA 4AF0A 4A6GA 3KM8A 4DWSB 3WELA 4A8LA 4FALA 1S2AA 2FDMA 5E9XA 3IK4A 3M41A 5H2ZA 3YPIA 3VNMA 3JU2A 1EBGA 1FWNA 3W1LA 1SVDA 3WFZA 4UFJA 2XIMA 5D02A 2I14A 1SJCA 2PP1A 1FQ0A 2RFGA 1EDTA 4BEQA 4TX9A 4Z2HA 5BOEA 1KRCC 2BVDA 5T9BG 5DELA 1JZ5A 3ES7A 3WBWA 2X0HA 2PDUA 3MMUA 2INZA 1S3TC 5CPMA 2QJJA 2HDJA 3R1ZA 1A3XA 1QATA 4QCFA 3ZR4A 4QRNA 2X2YA 1UWQA 3URBA 4I9AA 1EPXA 3SN1A 4QS6A 4DAIA 3COTA 3GTNA 2QDDA 1VBHA 2DW7A 3SCVA 1OB0A 4GQGA 1LBLA 2WJFA 2DUXA 2WNWA 1UQYA 1GGOA 2W91A 1EC7A 3R8GA 1EEXA 1MQPA 3I3BA 3GU2A 2D23A 3ORWA 3CK5A 2PWUA 1HKVA 4RUBA 3CZEA 3LI0A 2YCKX 3WNMA 3ZIZA 5C2XA 3LMYA 2EF9A 4PEKA 5I7GA 3CHVA 3PN8A 3BPWA 3WEOA 3CUGA 2C13A 1T8QA 4QP0A 4TVUA 3V3WA 4XBSA 5BXSA 3W1RA 1BEUA 4PUJA 2Y5EA 2IKHA 2X1IA 6XIMA 1ICSA 1KQZA 3WNPA 1U5HA 3UGVA 2BY3A 3MS8A 1F9CA 2J9XA 4GI6A 4CNOA 3HA1A 5K4ZA 1NWRA 2FVMA 4Q6JA 3S8HA 1PKNA 2CW6A 4F66A 2IXVA 2HNEA 3OP2A 1W17A 2V38A 2AGKA 4CCCA 4S3GA 2ZZ2A 4N7QA 4ICCX 2YX0A 3E74A 1JZ3A 4XZBA 4AEEA 2OJPA 2BOEX 4O8RA 3LX9A 1GWJA 1SM9A 5FJTA 4QAIA 2FZ9A 2PURA 2I5GA 3VKAA 1FCUA 3I10A 4NASA 1EP3A 1K9FA 4QJ5B 4JQAA 3EGJA 4GNJA 3NQ6A 4ROPA 2ZX8A 5LIYX 3GXMA 1IWAA 1TUXA 1J5TA 1E73M 3QHNA 3JZUA 5LHEA 4FEZA 5C7HA 1I2OA 2VHLA 1TCDA 1RH9A 2WCGA 3NQAA 2C79A 2A6NA 4IXXA 1K8ZA 4LNYA 3VINA 3QLDA 3NZPA 3HURA 2V5DA 3KAOA 5AFDA 2E3ZA 4D6JA 3MB9A 4KWSA 2A3CA 3CV1A 1HGWA 3P8JA 3FV9A 5TF0A 2VOTA 1EFZA 3C2VA 4GQRA 2JF7A 1I2QA 4P61A 4CNSA 1FXQA 4M7TA 3LTPA 3UPWA 3TONA 4LV9A 3IGSA 4JNYA 3ITLA 1B3YA 2IUZA 1GVEA 3GHTA 5KMYA 4I9JA 2OZ3A 3NDOA 2WPGA 3VDCA 1PWMA 1LRQA 3VGGA 4EKJA 4LUJA 2DPEA 2ZBTA 4LSBA 2GVLA 3KFTA 5FJJA 2H9AA 4JHMA 3SZ8A 4NXKA 3XIMA 2HQAA 3GVGA 5GPRA 2YLAA 4LCRA 4ZTYA 3RLVA 1MUCA 3OYZA 3ITGA 5JU6A 4W86A 1NH6A 4XAZA 3S9ZA 3WJXA 3PFRA 4YL2A 1S5NA 4U2ZA 1X7FA 2NT1A 3G3DA 4D2JA 1SUXA 1JJKA 1H1NA 3CAWA 4N9DA 4GE8A 4NRSA 4I7WA 4WY0B 7ENLA 4KCTA 1PX4A 9XIMA 5JVLA 3CM4A 3WQ4A 3V0SA 4L7ZA 1YDOA 4NKCA 3GH5A 3R10A 1WA3A 1BYBA 2FLIA 1KR0A 1TQJA 3V5FA 1MFVA 3GDTA 2OKTA 3RAOA 3KLKA 5I6SA 1M41A 1KC7A 3A4XA 1E43A 1VRXA 5HWNA 1EJUC 1UOKA 5CH9A 4KETA 3VGBA 4UZSA 1Q6FA 3TJLA 3EWXA 1TRDA 1MW3A 3V5CA 1RCXB 1XISA 2DIJA 3S5OA 3ZVHB 3KBWA 4J40A 1IWBA 4TX8A 1WXJA 3BAWA 2Y7DA 1CENA 1CIUA 4J27A 1BGAA 3G3MA 1GZGA 4QBXA 3C3NA 1VHNA 3AALA 1UR8A 1XLMA 1XC4A 2Y4SA 3PZOA 1UP0A 1OFPA 1W1IE 4DJEC 4KCVA 3WYZA 4ZBCA 5FL1A 3KRBA 3FHAA 2BASA 5B7YA 4E3TA 4ACYA 2AL2A 5EBUA 3AXMA 4H9ZA 2XN0A 3AQUA 4Q8NA 3W4RA 1H5YA 2DZVA 3K1DA 1P0BA 3SN4A 4UR8A 1YTDA 4XD5A 4UMAA 4ERAA 2DT3A 3GUGA 2D2OA 1PSCA 5AZ0A 4N02A 1N55A 1IEQA 2YYUA 4ZQRA 1DXFA 1POKA 3ARVA 2W3ZA 2FB2A 2PLKA 1U5VA 3DXIA 2YBUA 2QF7A 4DUVA 2FHFA 4US5D 3FYOA 2J6XA 5HPCA 1CGXA 1XX1A 5I07A 1E55A 5F7UA 3NWRA 2QAFA 1WZMA 4MM1A 2DT0A 4XSMA 2BWGA 5IDIA 3UA4A 3RF9A 3EA3A 1FWCC 1GG0A 3R13A 2WZTA 3CUZA 3N4EA 3L66A 2DW6A 3FN9A 1KR1A 3I6EA 3HG2A 3ZT5A 2QYGA 3HQNA 1S38A 2OSWA 1CB7B 1OJXA 1QHPA 4XIMA 4J3TA 3ID7A 4LW7A 3TYZA 4WLCA 4LX4A 4J3VA 3I3DA 4KIEA 4AWEA 3W6YA 3JR2A 4KEUA 4F48A 1WKEA 3RPDA 5HULA 3SUUA 1AJZA 1XPGA 3H8AA 1RP9A 3S1VA 4RE0A 3BQ6A 1PZ2A 1X1OA 4TOQA 2FFIA 4K7VA 2Z1BA 1J0ZA 3ZFHA 4E2BA 2X1SA 4JIPA 2R8WA 3VIPA 4E5TA 2R1PA 1HL8A 3I65A 2YDRA 3TE9A 1MDRA 4H83A 2E25A 3SDOA 2VO5A 3LHTA 5HPOA 2ZUWA 3CHDA 4N9CA 1FWDC 3WX7A 4B5XA 1X8FA 3BW3A 1GVSA 5C7VA 3AXIA 4C90A 2DZBA 3UPBA 1TG7A 1DWGM 5CKSA 2EJAA 4WD0A 1PYMA 3M5YA 1P6WA 5C0QA 3GNNA 5C55A 1EF3A 2D3NA 4FNPA 3S9IA 5EA9A 3A47A 1NJJA 5K9CA 4HA1A 1TZ7A 2PRLA 4HN8A 1ZSXA 2UY4A 4H41A 3RNDA 2F38A 3CL8A 2G3FA 1TPFA 4JHOA 3APYA 4KMQA 1XIBA 4PUDA 2GJXB 1LBFA 1W1ZA 5KZDA 4HZ6A 1CTNA 2VZTA 5CJ5A 2NXIA 2ABBA 3WIJA 1EO7A 5BCAA 1RJRA 4LYRA 3GC4A 2I5IA 3CMGA 3ZWTA 1E0UA 3EDJA 1Q63A 1VBGA 3I4EA 1NF0A 1G01A 4MZ1A 3TWBA 2OO6A 3AJXA 3QPZA 3GFZA 3AAMA 2Z6JA 1K9EA 3ARWA 4WDXA 4CEXC 1LQ0A 4ZE4A 3B06A 1LUCB 2XVLA 4AHPA 5HQMA 3FA3A 3M0KA 1VH7A 1BG9A 3NQEA 3CT2A 1J5SA 5FL0A 1O5KA 3K30A 4CD8A 1BSIA 2ON3A 3AHTA 2PAJA 1SQ7A 2XFFA 3WJSA 2J6VA 1JPHA 1VCGA 3E2VA 5ABFA 5CAHA 1N8WA 1OM0A 2OPJA 1XF0A 2NWRA 1TSIA 4M29A 2AOSA 2A1YA 5D03A 4RV8A 5HNRA 1TJ2A