1FCQA

Crystal structure (monoclinic) of bee venom hyaluronidase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
321
structure length
314
Chain Sequence
EFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hyaluronidase, a major allergen of bee venom.
pubmed doi rcsb
source organism Apis mellifera
molecule tags Hydrolase
molecule keywords HYALURONOGLUCOSAMINIDASE
total genus 128
structure length 314
sequence length 321
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01630 Glyco_hydro_56 Hyaluronidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1fcqA00
3O06A 3W1LA 4TX9A 4NXSA 4X2RA 4POCA 5G4WA 3M6YA 2DZWA 4JIPA 3EX3A 1GZGA 5CZSA 1TIMA 4YXGA 3QSRA 4WD0A 1GVSA 1CW2A 3LBMA 1HTIA 1I2PA 1FWRA 1AW5A 1LLWA 2NWRA 6ALDA 1XBVA 1LOLA 1H7OA 5LNSA 3LCGA 1OFRA 1XCFA 3O07A 3NQ7A 4AHPA 1TPB1 2HS6A 2V2CA 4O13A 1P0NA 1WOBA 3DI0A 4OWGA 3HGSA 4JTLA 5DCDA 3UYCA 1GG0A 1RQBA 4GC4A 4FNPA 2YXGA 3HPXA 3BG9A 4Y90A 1QCWA 4MJMA 3OVRA 4NX5A 4CCDA 1WV2A 3L66A 1OVDA 3UPBA 3MHGA 1YDNA 1ZJIA 2Y85A 5K7JA 4AWUA 1A50A 1V5XA 5EL1A 5KZEA 1ZALA 4ICNA 2DORA 4FXRA 4FF7A 2DZXA 1F6PA 1BTMA 3GXTA 1SO6A 4MY8A 2GJLA 2V5LA 2HSAA 2FB2A 2YR1A 1TB3A 4MZ8A 1EWEA 3S1WA 4MYXA 3SR7A 2BSLA 1RPXA 1ZCOA 4JX4A 2B7OA 2DZUA 2WOQA 3W7PA 2PRHA 4CQ9A 1JQXA 5CZJA 5DELA 5LNWA 5EA9A 3LRMA 4UFIA 2WSYA 1O95A 5A8GA 4DF1A 3ABOA 5HR6A 1TREA 2C3ZA 3P62A 5D05A 3RLVA 3KOFA 3MI6A 4QSHA 3NOEA 3KAOA 1N55A 2A2IA 4QISA 2ZFAA 2CU0A 4UNLA 3S1VA 3EXSA 1FUYA 4JR5A 3SSJA 3Q94A 1GYLA 3PBUA 2GVGA 4PTNA 1IF2A 1ICSA 4MY1A 3STFA 1MEHA 2C13A 5U4NA 2JKAA 3OEXA 3TA6A 5DN1A 1SO5A 3EWZA 3OG3A 3W1TA 4WXZA 1S5VA 1YTDA 4E38A 5KINA 3UY7A 3P80A 4ORIA 5D04C 4CNOA 2JKEA 2ZCGA 3EKZA 3MUXA 1YDOA 3HG4A 1LLZA 1N8FA 5I3GA 3QQ1A 1C9DA 1WXJA 4HNUA 3L0NA 2ZA3A 5BMWA 3ATZA 3IGUA 1X1OA 3G8EA 2PC4A 4BFAA 1PHWA 1A5AA 1MEWA 3CC1A 4K7YA 3DI1A 1M7OA 1G67A 3M1ZA 3P81A 4AVFA 3HOJA 3FS2A 3QM3A 4DEFA 4PL2A 1K03A 5K9DA 3GZ3A 4N9DA 4O52A 4BI5A 1KTNA 1FX6A 1OK6A 2FPTA 4DO4A 4HHPA 4N4QA 4PA8A 2R91A 1GTEA 4Z0JA 3W2JA 4ZQCA 3T7VA 5EKYA 4MFDA 1JRBA 4FNSA 1VLIA 1OJXA 1LBLA 4HSNA 3N2MA 2FDSA 3CQ0A 3ELFA 3RMJA 1TCDA 4JICA 3G0XA 4HNVA 3LLDA 3NZ1A 5AYYA 3NL3A 5FF3A 5HUOA 3LTSA 4UTWA 3FEMA 2WNNA 3DFTA 4LVBA 1KFBA 2VFFA 1OYBA 1LYXA 1XUZA 1SZFA 3EWUA 2BWGA 2QCHA 1ME9A 5HWNA 1PS9A 4LV4A 4UTTC 3EB2A 1J2WA 4WY0A 2B7QA 2QF7A 3EEGA 4JIQA 2H8ZA 3P60A 3G1YA 3W7KA 3JRKA 4M7TA 2ZRYA 4HKPA 3NQ2A 2QJGA 3N3MA 3LM7A 3NM3A 4JS3A 3QF0A 3W74A 4Q33A 1DHPA 3LDVA 1EIXA 3DFQA 3R12A 3ATYA 3FJ6A 2YW4A 2QCMA 1VYRA 1SO3A 1YXDA 4LOCA 3QPZA 3VKJA 3TMQA 4NNCA 1XBZA 5G5IA 3B03A 3NQEA 1ZAIA 5HQEA 4GUFA 2NLIA 1Z42A 2VENA 3A23A 3IIXA 2QUUA 4K8HA 1FXQA 3WJSA 2FLIA 1Q6LA 4MZYA 2TYSA 3FOKA 1OFOA 1JCLA 3NXFA 1QO5A 3STCA 5LHFA 3S1XA 4GBUA 3SJ3A 5CSSA 4L4LA 3TW7A 2LLEA 5F2MA 5CPMA 1JUEA 3KX6A 5I3HA 3DBPA 1L6YA 3USBA 2V82A 2EPHA 1ICQA 3NG3A 5SWUA 1W3NA 4AMAA 3G0UA 1XL9A 3CLMA 5J5DA 4Y6GA 1OYCA 3HO8A 3QFEA 5D33A 4UTJA 4YCPA 1IXQA 1JR1A 1SZGA 4K36A 3SECA 3TFXA 1KM5A 2OT0A 2RKXA 4A2SA 4CNPA 2RDTA 4LRSA 5FF4A 1WYIA 1K7XA 3DFPA 3EWYA 4OV9A 4FNUA 4RXFA 4FX8A 3CWNA 3NA8A 1MEIA 4W9TA 2E77A 1W3TA 4AHQA 4ADSA 3N19B 3DHDA 5D2TA 4UFLA 3FJLA 3STGA 3SGUA 1OX4B 2UV8G 2OCZA 2YFOA 1K8YA 3CEPA 4Z1BA 1AMKA 1WX0A 4IMFA 4AXKA 3G24A 1IGSA 3L5AA 2A5HA 4RZ4A 3L2IA 2RHGA 1EUAA 4Z1AA 4Y8FA 6TIMA 3NQAA 1PE1A 1VRDA 4LVFA 2WNQA 4M7SA 2W0UA 1O60A 4RJEA 1IIGA 1LTDA 3PB2A 1OF6A 4GUGA 3TCEA 2CLIA 2F7FA 2DP3A 3EX2A 2P0OA 4OV4A 1W5OA 4FNTA 1SW0A 2J6XA 2NUYA 2QCEA 1B9BA 4NZJA 1KBIA 4Q4KA 3HG5A 4BWLC 4WY0B 3LHTA 1EP2A 3TJLA 4EWND 1KLYA 2ZBTA 3QMSA 5G2HA 3IGSA 3EX4A 2GQ9A 4E0CA 3UNDA 5C5YA 4AEOA 3B04A 1JQVA 1T96A 3DGRA 4AAJA 3NQ6A 4FHAA 5EY5A 3PUOA 3B8DA 3TSDA 2CZDA 3LV6A 4HN4A 1SZEA 3UWVA 3WJXA 5ABTA 1OX5A 3M0ZA 4Z0SA 3QC3A 2E09A 1OYAA 4A29A 3KVMA 5HWJA 1UCWA 3GDKA 4JY9A 1Y0EA 1W8SA 3JR2A 4O15A 3QYQA 3G1HA 3C4UA 4M6PA 4JYDA 5G4EA 3KVKA 3N73A 3EXRA 3WK3A 2G96A 1HG3A 5HWMA 3NEVA 3TC7A 4HNTA 4RV8A 1N7KA 2X1SA 4CQAA 1W56A 2V0TA 4N9CA 4XWUA 2AQWA 3QMRA 3QRHA 4LT9A 5G2IA 5I3KA 3U8GA 3O15A 4O1BA 5BRBA 2ZZ1A 4C1KA 3BPWA 3GIYA 2J9YA 1GTHA 1LROA 1KBJA 3M5VA 3IIVA 4NJKA 4KWWA 4I7VA 3TV8A 2E5CA 1F6KA 3LCXA 1FXPA 3DU0A 4PCFA 3P67A 1VCFA 4HT3A 4OBTA 4IQLA 1GPWA 2PE4A 1LRTA 4I9AA 4ZQNA 4RX0A 1ME7A 3VE9A 4RKAA 3DXIA 4N4PA 4UFHA 3GYEA 3MO7A 3NZRA 3FKKA 3L0GA 2YX0A 3W7GA 5D2XA 1DL3A 4J9JA 1VGAA 1XKYA 1R2SA 3BLFA 4XKYB 1XC4A 1TPDA 3T55A 2QUVA 4PODA 3EWXA 3G3DA 1P4CA 4O1DA 2IQTA 4O19A 3W1AA 2C16A 5K4XA 4U4MA 1TPH1 4N9BA 4O53A 4UTKA 1TQXA 3A5VA 3PULA 5C55A 2A6LA 3OVPA 1KFLA 1KLZA 5AYZA 1QOQA 3GDRA 4EF8A 4E2DA 1IXNA 4O0KA 2QUTA 3E12A 4BK9A 2W6RA 4DQWA 3UWWA 5A5WA 2I1OA 2WO5A 5HMSA 1VYSX 4IPJA 3I7QA 4XKYA 3MW7A 5F2GA 2ZZ3A 4LS1A 3SIZA 1DORA 3K30A 3TAOA 3TROA 1WBHA 1EEPA 2A6NA 2VKZG 4O10A 3L5LA 4EOUA 4HNNA 2VFDA 1OHLA 2X30A 3W7HA 4D2JA 1H7PA 4XZ9A 4P61A 4JNMA 1A5SA 3S9YA 5F2LA 2XN0A 4A22A 3LRKA 1K3UA 3GKAA 4XBKA 3G1DA 3N14A 1EX5A 1Q6QA 3W7JA 2ZZ2A 1OF8A 1ONRA 1DV7A 3SZ8A 1AL7A 3W3OA 1WDWA 2YW3A 3TAKA 2GJNA 3W1XA 1TSIA 3SGZA 3JS3A 1H7XA 5FI8A 4JTJA 3O63A 1KW1A 4ONVA 4HPJA 3O6DA 1ADOA 4N02A 3BW3A 1GEQA 5HINA 3BG3A 4H3DA 2RH9A 3WJZA 4FIRA 1FCUA 1LOQA 3LX9A 3NQ8A 5DBTA 4O16A 2X2GA 4NNAA 4OU1A 2NUXA 4MZ1A 3IIOA 4GUHA 1SU5A 1JCXA 5T26A 5FF2A 1QNVA 3P84A 2DU2A 1WAUA 3ABRA 4MJZA 2X1TA 5CG7A 1QMLA 3H54A 1DQWA 2VFIA 3RNDA 5CZ0A 1EUNA 4K6AA 1I2RA 3W7RA 4I7WA 2YFNA 3PUEA 1FBAA 4DELA 3LI0A 4A3UA 1GVQA 3O8AA 3QEZA 4UTWC 3PSWA 2ZA2A 3LXCA 3DFSA 3TR2A 5IBXC 3LHWA 1SO4A 3BGJA 3M43A 8TIMA 2VEKA 3KHJA 4A21A 2DJXA 4BWLA 3LTYA 3IV3A 3QMTA 4IJBA 4AWTA 4PEKA 1H62A 2ZZ5A 4UMBA 2V30A 3L67A 1TPVA 2A1YA 1GWJA 1PV8A 3MP4A 4OQVA 3TQKA 5U7SA 3W7QA 1KTCA 3W2KA 4FX6M 2RFGA 1QO2A 1H1YA 2V81A 3EX6A 4O1AA 4O14A 5BOOA 4PC8A 5G1YA 3Q58A 3TH6A 1C29A 3ZFHA 1DJQA 1YTKA 2FIQA 1QFEA 2TPSA 1K8XA 1SR9A 5FESA 2E5BA 1VH7A 3OIXA 1NFBA 4NT0A 3I6RA 3ANYA 1JCMP 3NAVA 3M5XA 3N9SA 2A7PA 1TTJA 4Y96A 2FFCA 1G7UA 1L6WA 2VFEA 1JCJA 4MLJA 2EAWA 2H3DA 3NPXA 2Y7GA 1Z41A 4NJIA 3BVJA 5FEWA 3I65A 1ML1A 2YYTA 2VOMA 3R2GA 2YYUA 1BKSA 3GLCA 2GQAA 1VCGA 3LBCA 3CTLA 1H51A 3S42A 1H61A 2WSRA 2GVLA 3KVJA 3I7RA 1I4NA 4AF0A 5F4WA 1JCYA 2VFGA 4M19A 2JK2A 3BO9A 5LZLA 4LUIA 3FA5A 3W86A 5DY3A 1W0MA 1D9EA 3NO5A 4KFNA 1H50A 3NVTA 1XDLA 1TPWA 4ORMA 3P61A 3S6DA 3HJZA 4WUIA 3NR0A 1R2TA 3TFCA 3V75A 1Z44A 2G97A 3VCRA 2QAPA 3CEUA 4UTIA 1DBTA 2ZA1A 3MP5A 4FNRA 1Z48A 5F4SA 2C1HA 4QNEA 3BGGA 4K8EA 1JRCA 3MHUA 4YLWA 3T44A 2Q8ZA 5LGZA 4GUJA 1ALDA 3IIPA 2FJKA 2R14A 1SZNA 1X8FA 2AGKA 1U83A 4CLMA 3TW6A 1UJPA 3LI1A 4QAIA 1O94A 4MYAA 4WOQA 1AW1A 1KFCA 2EHHA 3S5ZA 5DXYA 4Q32A 3TIMA 3KRZA 4BI7A 3NDOA 4WXYA 4GRSA 3TKFA 1FCQA 3FKRA 2ISWA 3IVTA 5DXXA 4Z08A 1R46A 4KFPA 3IGXA 3P74A 3HIJA 1S3HA 4XUGA 3ZWSA 4JTTA 3PBWA 2ZRXA 2ZZ6A 4H4IA 3UXDA 4O0ZA 1YADA 2CZFA 2H8XA 2J88A 5I3IA 5CSRA 5E0KA 3UWZA 3W76A 5K3VA 5E93A 4HPXA 1F73A 2CWNA 3PS7A 1W5MA 2WKJA 3A21A 4RR4A 4DO6A 3B06A 1OFAA 3C56A 3FLUA 5BW6A 2QCDB 5IBXA 2A7RA 5D37A 3GDMA 5K9XA 2BX7A 3HMJG 3PVFA 1YLVA 2OMAA 5FEZA 3KVLA 4JTEA 5BMXA 1Q6OA 3NPWA 5KTLA 3KRSA 1ZENA 2WV8A 1LRNA 1F74A 2CFFA 3UXAA 4NNBA 4N6EA 3U6WA 3E0IA 2J9XA 4ALDA 4XTDA 2CLOA 1AG1O 1TV7A 2YCEA 3LCFA 1RR2A 1YXYA 5LNRA 2J27A 3CWOX 4AWSA 4ZQRA 1TRDA 1XXXA 3MP3A 3NPVA 1FWWA 4Y9AA 3W2LA 1P5BA 1GYNA 1L9WA 1SSDA 1XBXA 1HFBA 4N2YA 4OT7A 1M5WA 3MBFA 4JYFA 4GXMA 3R5EA 1UBSA 2A4AA 3M44A 2EF9A 1TV5A 1R2RA 3GDLA 4LW7A 3TSBA 1A53A 3NQVA 3C52A 2Y89A 3DFOA 1GT8A 1NF7A 1TTQA 4IOTA 5FF0A 2R94A 4O11A 3VI2A 3PAJA 2NUWA 4M6QA 5D09A 2C14A 1I45A 3PBYA 1K7EA 4JTKA 3THQA 3G18A 2GQ8A 3TNOA 1SFJA 3W84A 4PH6A 1XBYA 4FB7A 3TE9A 1IXOA 2O7QA 3UWUA 4AH7A 1AK5A 4DF2A 4DPQA 4UFJA 3O16A 3C2EA 2J9ZA 2Z6JA 4M5PA 4LNYA 2WNZA 4UNKA 3GXPA 1I8JA 3G1AA 4EF9A 1GJPA 1F2JA 4DXVA 1G4PA 3W1RA 1P0KA 3MJYA 2PCQA 3CIWA 1OFQA 2VELA 2NV2A 4TR9A 5F2IA 1QPQA 1VYPX 2Z2UA 1KFKA 2W79A 2VC6A 3NM1A 3FFSA 4NJHA 1OX4A 4O57A 4S2BA 4NQ1A 4R34A 4MPQA 1LDCA 3OBKA 5TQLA 3PSVA 2ZTKA 3A9IA 3W72A 3LXAA 1QOPA 2CLFA 4WJEA 3P7YA 1OFDA 2PRMA 4XTIA 3L0KA 5DY2A 1MZHA 3PR2A 3C2FA 4IMEA 1VZWA 5CPOA 4IX0A 2E6FA 2Y62A 3SFKA 1XDMA 3TMLA 1WBJA 5HNRA 1BWKA 4C1LA 4IX2A 3W7NA 3V1PA 1UUMA 1HL2A 1XI3A 1I2NA 3DKLA 5H2ZA 3C2OA 3LLFA 1ME8A 5D2WA 3WK2A 3G22A 1Q45A 1TTIA 2V8ZA 4ZL1A 3EX1A 3GDTA 3R89A 1M6JA 2WPBA 2F84A 2ZRWA 3LCIA 5F1UA 3W1UA 2ABBA 1JVNA 1H63A 4CCCA 2BTMA 3SW6A 3TK7A 3F4NA 4RCXA 2DZSA 4MKNA 3W23A 4O1CA 3BW2A 4GJ1A 1H7NA 4QNWA 1ZAHA 2TSYA 1J4EA 1RVGA 2DZTA 2V9DA 1MO0A 1WOAA 3QW3A 3M9YA 1D3GA 1VJIA 3RF9A 5CKSA 3DKJA 3R13A 3PUDA 5FF7A 3BW4A 3HG2A 2HS8A 3D0CA 1THFD 3UWQA 3STEA 3W75A 4E2BA 1LORA 1QPOA 1FDZA 1W1ZA 1R47A 2C15A 3EKLA 3MBDA 1G4SA 3KRUA 3DFNA 2C6QA 1PIIA 4S2CA 3W2MA 4LS2A 5DCEA 2GVJA 2ZRUA 5C54A 1EA0A 1X6UA 2ZRZA 3S0CA 3HBLA 1SW3A 1O5KA 5AOUA 5AHFA 2GUUA 1L6SA 1F05A 1XM3A 1YPFA 2NWSA 3MHFA 2Q3RA 1QWGA 2A85A 4JDYA 1KTBA 1TMHA 3PF3A 4DBEA 1MXSA 3INPA 7TIMA 1YPIA 5KITA 2Y6ZA 4ZMGA 2ZQ0A 2ISVA 1KA9F 2ATMA 1TYGA 3A22A 2ISSA 1VQTA 2YSWA 3E9AA 1HO4A 4JX5A 3RFAA 3HGJA 1EPXA 3LV5A 3T4CA 3NL6A 3TX9A 3M41A 4NXKA 3HG3A 2Y7EA 2JBMA 4X3ZA 4WX2A 3HGRA 5EYWA 2B0MA 1F7BA 4CCEA 3VNDA 3SY5A 4IXHA 3F1QA 2CLLA 4ZQOA 5HJLA 2Y70A 3NPUA 4G1KA 2ABAA 2E5DA 2A7NA 1OX6A 5G1TA 3TSMA 5TIMA 1KM1A 3LHZA 3P5YA 1NAL1 1G4EA 1EWDA 1PL9A 1FQ0A 3FYOA 3F03K 1KFJA 3W7CA 2A0NA 1I2OA 1NVMA 4RZ5A 5HUPA 1ZAJA 2I14A 3C3NA 1GG1A 4KKXA 4K37A 3CT7A 4RZ6A 3Q2DA 3T40A 5GVJA 4UXDA 3RK8A 1L2UA 1I2QA 1SW7A 2FPVA 3M7WA 4TIMA 4IXXA 1WQ5A 4O4VA 3W22A 4JGDA 1TQJA 4LY8A 4N9EA 3G8RA 3AJXA 4FXSA 1ZY9A 1W5QA 3PC0A 1T0OA 2V2DA 3L21A 3N34A 4R7JA 2H6RA 4TMCA 4ZQPA 4AHOA 2E1DA 5EPDA 1W5NA 1FDJA 3I7SA 1G4TA 3FYPA 2E6AA 4MVAA 4LVDA 2QCDA 3QSTA 4FEZA 3IEBA 1IIHA 3LERA 3W2UA 1ICPA 4XQ6A 5MHBA 3GNDA 1FWTA 2QJHA 1LP6A 1HO1A 5LGXA 3W70A 4TU1A 3P8IA 2O7SA 4FX7A 1FCVA 4UCGA 4BI6A 2DJLA 1VR6A 4O4WA 3MI2A 4NJJA 4UUIA 5F1VA 4PFMA 1KM0A 3HB9A 3YPIA 1ZNNA 2BZNA 3IIZA 3GR7A 1W31A 3B4UA 5KSWA 5CPNA 2JGYA 3B0PA 2R8WA 4OE7A 5K4ZA 3LCHA 3DHFA 1UUOA 2ZDRA 3GB6A 5CPLA 3LCWA 5DBUA 4KFOA 2QDHA 3C61A 1IXPA 3BARA 3C0JA 5KZMA 3A24A 1VCVA 1H5YA 4R33A 5LKYA 3HQ1A 3W7OA 3TQ0A 3C2VA 1XUUA 3BK0A 3W1NA 4UMCA 2YGYA 3P82A 2P10A 3F4WA 1X7FA 1VHCA 3LHYA 3L5MA 3G3MA 4UTTA 4QQ3A 1G6CA 2V2HA 5K2ZA 2NX9A 1NEYA 4LV9A 3S8HA 3DZ1A 4O54A 4YWIA 4MY9A 1LRQA 4GE8A 3MYPA 4K39A 1BWLA 3B05A 3EWWA 3TC6A 2H90A 2FQIA 3W1MA 1TV8A 1UASA 3LHUA 2C0AA 3U2OA 5D03A 3LRLA 1TPFA 4FNQA 3C8FA 3QW4B 1OG0A 2QCNA 2CLMA 4JDBA 2OT1A 5D2VA 3W1QA 3UY8A 4AF0B 4S1FA 1RZMA 3HPZA 5F4XA 1LBMA 1W3IA 5FEPA 2I9EA 4RXGA 4RK8A 4X22A 3E49A 3W85A 1B3OA 1RV8A 3N9RA 3UZJA 2ZRVA 1OFEA 4IMDA 2GPTA 4JD4A 4Z1CA 1TO3A 1TPC1 3AO0A 4DPPA 4BR1A 1EP3A 3N2XA 1H60A 3PY2A 2NXIA 3W7LA 4UFMA 2WSQA 4MOZA 1KM4A 3DENA 4GWEA 3NYZA 3KXQA 1W5PA 5AHLA 4JXCA 4NUWA 4H6KA 4A2RA 3GAKA 4UTUA 3IVUA 4XBSA 4YMZA 3WK0A 3I68A 3M5ZA 2OZ0A 2Z0IA 3G1XA 2RDUA 2XFWA 3W7IA 1DQXA 3HF3A 2Z1BA 1W37A 5AHIA 3VFLA 3LB0A 5KMYA 4IMGA 5I3FA 3NQGA 3WK1A 2X1UA 4L4MA 3FIGA 4O17A 1QR7A 3W7EA 3MWAA 4O18A 1Q3NA 5G2WA 4K7VA 3ZR4A 1K8ZA 5LSMA 4OGZA 1M7PA 3NL5A 4O28A 2V5BA 5D2YA 4CQ8A 3NL2A 2GOUA 1G69A 1F5ZA 2QCLA 5CZTA 3GR8A 2VEIA 4LWWA 5CGQA 3PWAA 3QQ0A 2QR6A 1G7VA 3W71A 1PCWA 4LTSA 3TU9A 3OA3A 3G1SA 1DVJA 4LS0A 1CX9A 4EVZA 1T8XA 3CPRA 1LCOA 2Y63A 3S5YA 2VXNA 2ZZ4A 4JEQA 3L9CA 4O50A 4ZQMA 1GVFA 4JTGA 1FY6A 4HIBA 4DF0A 2CLKA 3BLIA 3C2RA 3G1VA 3O05A 4O12A 2Q8LA 4PL1A 4MUZA 1FCBA 3B0VC 3THAA 2G5WA 2B7PA 2VEMA 1JCNA 3UQNA 1DKWA 3P5ZA 1VC4A 1KM2A 2RDWA 3LCLA 3TUUA 4QIUA 3S1UA 3OVQA 2TMDA 2NX1A 3C6CA 1QPNA 3ZS4A 4UTHA 1TJRA 3MI3A 2OX1A 3QPYA 3P8JA 1KV8A 1YTEA 3G0SA 1VPXA 1B57A 3E96A 5AFDA 5AHNA 4WY0F 4NVTA 2AAMA 1YXCA 1RD5A 4DBDA 3GKFA 3OHIA 1ZHAA 2FTPA 1W54A 1YDVA 3BLEA 1H7WA 1TPEA 1PCKA 1TTPA 5AN7A 2E6YA 2J24A 4JTFA 1A5CA 1KM6A 2X16A 1JULA 2XN2A 3ZWTA 5FEXA 4U28A 2NV1A 4LU0A 3W9ZA 5AB3A 3MYOA 3EXTA 1RQEA 2C18A 1EP1A 4IUOA 5AC6A 3KFTA 2YPIA 3Q37A 4AB4A 2Z6IA 2Y61A 5AHMA 4GNJA 4IWWA 2NXGA 3NQMA 3EWBX 1XFBA 2FB3A 2VEPA 2D73A 1K02A 1D3HA 2QDGA 3CB8A 1GVRA 1YYAA 5EBUA 2CLHA 4EIVA 3CHVA 3M16A 3S5NA 4UMAA 4MLRA 4JTSA 3LHVA 3UD6A 1MSSA 1EB3A 1FWNA 2E6DA 2Y88A 5HULA 2CLEA 1F76A 1T99A 1AL8A 3UWYA 2XN1A 3ABQA 2JGQA 2Y7FA 2QJIA 4Z1DA 2G95A 5AC8A 1VS1A 4HSOA 3PB0A 5DCBA 4FIQA 2ZZ7A 4IMCA 1TJPA 4LVAA 4UR7A 1KM3A 3W87A 3G1FA 1GVOA 3TXZA 2QEZA 1QDSA 1HUVA 3CU2A 3W73A 2WJZA 5IM51 3S5OA 3GVGA 4ADTA 2QAFA 1PHQA 1X1ZA 3W6YA 5I3JA 2B7NA 5EMUA 3BV4A 4QITA 1JUKA 4CNNA 2HMCA 1UB3A 5C6MA 3TDFA 3PG8A 2WQPA 5K9CA 3TJXA 4LVGA 4TMBA 2E68A 2TRSA 2DZVA 1LOSA 3NGJA 2PURA 3W07A 1VHNA 2OJPA 1OFPA 3HPSA 3WJYA 3UPWA 1OFBA 4X9SA 4QM1A 4UIOA 3W2NA 1DJNA 3NQFA 3O6CA 1H7RA 4BF9A 4YCOA 5LHEA 4KWVA 2B4GA 4UC5A 1WA3A 3SI9A 1P1XA 5HR7A 3NQDA 4LC8A 1SQ7A 3QH2A 4JY8A 3W7DA 3IRDA 1ZFJA 3A5FA 3DAQA 1BEUA 5J5RA 1DOSA 2NX3A 1SSGA 4JN6A 4WOZA 3GAYA 4MIMA 2CZ5A 5TBOA 3LTPA 3R8RA 1OABA 5L9FA 5D38A 4R53A 1PVNA 5D32A 3TQVA 1H1ZA 4M6VA 1QPRA 4WQ6A 1KV5A 1R30A 3E02A 3H53A 4NX0A 1KFEA 4P2VA 4TO8A 1S5TA 4GFSA 2A21A 1SPQA 3WJWA 3GK0A 3M47A 3ABSA 3LXBA 2EKCA 3H55A 1GQNA 1SFLA 3WFAA 5H91A 3QZEA 5L6UA 1J5TA 4JTHA 2ALDA 4NJGA 1TPUA 1B4EA 4I7UA 5AYXA 3PBVA 1NF0A 4O8RA 1C8VA 3T78A 2JKPA 3RU6A 2QCCA 1QAPA 2NXHA 4QJ1A 3TXVA 4ML9A 3IVSA 4JTIA 4YL2A 1K7FA 4LUJA 1FDYA 1FWSA 1AW2A 2NZLA 5KZDA 1V7YA 3GNNA 2CW6A 3LGEA 2YZRA 5AC7A 4MFEA 2ZYFA 4LRTA 5LNVA 5AHEA 3QJAA 4ZZ9A 4JTUA 1SUXA 3W83A 5BNKA 1OK4A 2CZEA 3HGOA 1LZOA 3LOTA 3DH7A 1Q6RA 2ZTJA 5C2XA 1S5WA 4UR8A 1JJKA 3L65A 1NSJA 4NZFA 4B5NA 4IPIA 4UTMA 1O5XA 4UTLA 1U5JA 4GUIA 1O4UA 2H3BA 3GXNA 2YDAA 4WZHA 3PM6A 3BG5A 1GOXA 2VFHA 4NU7A 1TRIA 4RLIA 3L68A 1VLWA 2X1RA 3O6YX 2QKFA 1RQHA 3RLUA 2HTMA 3B0UX 1LBFA 3CIXA 5D02A 3O1NA 3VE7A 4FO4A 3M5YA 2BLEA 5E1QA 4N6FA 3MMTA 2DZPA 4DO5A 3UZ5A 4JX6A 5D30A 3W7MA 4ADUA 4JYEA 2P1FA 1E51A 1LM1A 5LNUA 2Y7DA 4IGHA 3NNTA 2QCGA 3W88A 4OHQA 4LC6A 2BXVA 2C19A 3NQCA 4K38A 2EGZA 4ZVJA 2KZHA 2PRLA 2FPYA 2Q3OA 3CM4A 5DLCA 1A5BA 1B4KA 2ATSA 2QCFA 1CI1A 4UFKA 3W1PA 1JUBA 3PG9A 3GX9A
chains in the Genus database with same CATH superfamily
1DE6A 5C2GA 2YZ5A 4NXSA 1BPLB 3S9IA 4YXGA 1GVSA 3N4AA 3ZR6A 1LOLA 4DB7A 2HK1A 3ZQ9A 4XSLA 3SY8A 2ZXDA 3DI0A 2GVYA 3H2CA 4JTLA 2B81A 2VX6A 2WKGA 5I5RA 3CAKA 4QROA 2OLHA 2PGFA 1ZBCA 2AKZA 2YXGA 4GYJA 3HPXA 3BG9A 4CN6A 5MKGA 2PDCA 3KCOA 3L66A 4LALA 3AIRA 4NASA 1WZAA 4AWUA 1UR3M 1A50A 3PWIA 5EL1A 3LPOA 4J3ZA 2DORA 4WIWA 4DX3A 3RX2A 2C91A 1PSCA 4CGTA 3GXTA 1SO6A 2OX4A 4FZIA 4IFOA 1LWJA 3M0KA 4B3ZA 4MZ8A 5D9PA 1EWEA 2X09A 4MYXA 3PJUA 4D8LA 4JX4A 1FH7A 1GVEA 4HMDA 3GU1A 1UR8A 4CQ9A 4IFRA 3T0AA 7REQA 5DELA 3S5SA 1OGBA 2GSHA 4G9PA 4L1GA 4DVOA 4AFYA 3ABOA 3EZ4A 4DYJA 5D05A 2PF8A 1WXYA 3MI6A 3NOEA 5REQA 4QISA 4WF7A 4DUWA 3SSJA 3A64A 3BOLA 2XISA 2C71A 1ICSA 5DF0A 2BGNE 2VC7A 2FZDA 3VVGA 1UD6A 1XIGA 3HV8A 4ORIA 4CNOA 1S2VA 3AS2A 4LFYA 3DG7A 1RJQA 3EA3A 1AQFA 1WXJA 3WF0A 4HNUA 2GOKA 3CUIA 3L0NA 2ZA3A 4CU6A 1X1OA 3G8EA 2PC4A 3TTEA 4BFAA 1PHWA 2XPKA 1JD9A 1A5AA 3CC1A 4GY7A 4DN1A 4IIEA 1H5VA 5MF5A 3UU0A 1H1NA 3FS2A 4DEFA 1MYRA 1I75A 5K9DA 4N9DA 4EAMA 2X1IA 4MWAE 1NDZA 1OK6A 1PIFA 2WM1A 2FPTA 4GG9A 4N4QA 4GFIA 4PA8A 3T0DA 2WQDA 1EGZA 4Z0JA 1A0DA 1OJXA 1M41A 2QDEA 1LBLA 3LK6A 4J27A 2FDSA 3AIEA 3R0DA 3RMJA 1OB0A 3G0XA 4JICA 3UVIA 2JF7A 4EPKA 3MA8A 3LTSA 3V1HA 1EYWA 3FEMA 2CPUA 8RUCA 4KT2A 3DFTA 1KFBA 3V18A 2GDVA 2W3ZA 1LYXA 1V08A 1PS9A 2WMKA 1F4HA 1R3YA 4WY0A 2QF7A 4JIQA 2G8ZA 2H8ZA 4Q6JA 1E4IA 3VIJA 2W92A 3WF4A 2OOGA 2QJGA 3LM7A 3H12A 4JS3A 4P8VA 2XZ9A 3HURA 2I5GA 5FCZA 3W53A 3DFQA 2QCMA 1YXDA 4QS6A 4GQBA 2BOEX 3I6TA 4NNCA 3D6NA 3FEQA 4Q8NA 5G5IA 1V3MA 1WE5A 1ZAIA 3QV9A 1X39A 4EXBA 2VENA 3IIXA 2QUUA 2WNWA 4H8HA 2XUCA 1Q6LA 4PMRA 2BXZA 2IXUA 3WEZA 2YB4A 3WH9A 3S1XA 3GXMA 5CPMA 1JUEA 2ANUA 3BOXA 3V7PA 3KX6A 3W29A 1VD6A 1L6YA 5FJTA 5SWUA 4AMAA 3G0UA 5FD0A 1ISXA 3K8LA 3VD3A 4K36A 1JR1A 5J04A 3SECA 4UQBA 1DP0A 4LUTB 1BG9A 4S3GA 4E3TA 3RUBL 4LRSA 3SCOA 2PDUA 4LUYA 1R85A 1V02E 2E77A 4XIAA 1E40A 3PPCA 2QV5A 1JZ7A 3L4ZA 2OCZA 4Z1BA 1K8YA 1L8NA 4ATDA 3B97A 1WX0A 1K70A 5B7YA 4RZ4A 1EUAA 1TELA 4Z1AA 2REQB 1PE1A 1IGWA 1K9TA 2E0PA 1O60A 1I6NA 1IIGA 3K8MA 4RJEA 3OG2A 4MM1A 4IGMA 2P0OA 1REQB 3RM8A 1SW0A 3RJXA 2QCEA 1WDQA 1CECA 3BQ5A 2PBGA 2J25A 1EJWC 4CN1A 4MNLA 3VD7A 3PFMA 2FTYA 4AW7A 4LQ1A 3TJLA 1EP2A 2DSZA 4RE3A 1J93A 3QMSA 2J47A 1HN1A 1GZ1A 3UFYA 4OFCA 4E0CA 3UNDA 1AZ1A 4AEOA 4H8NA 4JQ2A 1QBBA 5I78A 1O5RA 3DGRA 3NQ6A 4FHAA 5FJUA 3VU2A 5EY5A 4KCUA 3B8DA 2CLPA 1OBAA 3GNOA 1N2VA 1SZEA 3UWVA 3WJXA 3M0ZA 4PUEA 1XIEA 4OBSA 3KVMA 3TN6A 3KBJA 2QYGA 3JR2A 4OUIA 4O15A 1DTUA 2UBPC 1CGVA 3WQEA 4XO6A 5LA1A 4M6PA 3KVKA 3WK3A 1JDEA 4GC3A 3NDZA 4HNTA 4RV8A 1N7KA 3AJ7A 3BAKA 1SFTA 3QXBA 4GCXA 4S3BA 2F2HA 2UY3A 5FJPA 4GZEA 4C1KA 3WMBA 2ADAA 3GIYA 2R1NA 3M5VA 4PN2A 5DQPA 1JXJA 4KRUA 5A8MA 4BA0A 3DU0A 1Q6FA 3VOJA 3TTQA 3IJ8A 4I9AA 2PGEA 3UVAA 1HJXA 1VKFA 1BG4A 3VE9A 1VEOA 3DXIA 1BQGA 3FKKA 2YX0A 1TWSA 1DL3A 2BY2A 1VGAA 3CL6A 5LYRA 4DJDA 1JZ6A 1TPDA 3EWXA 1ISVA 1RCXB 2IQTA 4O19A 2X2YA 4U4MA 3BH4A 4N9BA 2Q02A 1TQXA 3VKDA 3OVPA 1KLZA 5AYZA 3GDRA 3OZYA 3T2QA 4E2DA 1JYVA 5IDIA 5FA5A 5GNYA 3WUBA 2YCKX 3E12A 2YLLA 5I0DA 2EPKX 5A5WA 5HMSA 4EXQA 2BBFA 4QLJA 2XGBA 3WNKA 4FAMA 3K30A 3MCNA 4EK7A 5CSUA 1KO0A 3LNMA 1PB0A 1AUSL 1F07A 1K1DA 3TROA 2BASA 1NARA 4O10A 1ESWA 3L5LA 4EOUA 3DYOA 2VFDA 4PMOA 4KQNA 4DI9A 5I09A 3TJIA 4HU0A 4UCFA 1QPKA 1KXQA 4XBKA 2J62A 3EDJA 2AMGA 3G1DA 4PCNA 3GXDA 1OF8A 1V0KA 1DV7A 5GJMA 3W3OA 3TAKA 3W1XA 1S5NA 1TSIA 2WXDM 1OZMA 3BW3A 1XINA 2DSUA 4CD5A 3U2EA 3ALFA 1CCWB 2XIMA 4H3DA 4HCHA 2EKGA 3AI0A 3COTA 1O6IA 2PTXA 3AYVA 2XM1A 1KXHA 4B5WA 1CYGA 1Z32X 4YWSA 4QHRA 3WUFA 5CG7A 3R4IA 4RV3A 4MJ2A 3WYZA 2VFIA 2WHJA 2DV0A 5CZ0A 1QVBA 1UBPC 4FLSA 4H41A 1YQ2A 1GOIA 1FBAA 2ZUMA 3I3DA 3O8AA 1M7JA 1Q85A 3PSWA 4L65A 2XVPA 3LXCA 1E0VA 5IBXC 1WKEA 2X41A 4H8UA 3SB0A 4TVDA 1GEHA 3T0CA 4ERAA 2VEKA 4BWLA 4L1XA 4GJJA 1H62A 1VF8A 2WC4A 4UMBA 1DXFA 5T9CE 4LY4A 2AKMA 3L67A 4FOUA 3MP4A 2HZGA 4OQVA 3TQKA 3WQ6A 3ERPA 4CVWA 3CAVA 1NWUA 1QO2A 1OGGA 4KBXA 5EMMA 1X8CA 3EA1A 4PC8A 5G1YA 4L7ZA 3TH6A 2IKJA 1WDDA 3ITCA 4CD6A 1JPDX 5G1MA 1XW8A 2TPSA 1K8XA 1IYXA 4B3LA 2E5BA 1TJ1A 3OIXA 2V3FA 1NFBA 2O4QA 3V5FA 3I6RA 3ANYA 4IIFA 1JCMP 3N9SA 3DESA 4HD5A 4MG4A 3T05A 4FLRA 2FFCA 3GNRA 1EGMA 2EAWA 3NPXA 5CGTA 2Y7GA 1LWHA 2PD9A 5IFTA 3A47A 2XIJA 1ML1A 1W17A 2VOMA 3R2GA 2NVDA 1VBRA 3CTLA 1H51A 3V35A 4PMDA 3VIFA 3KBWA 1NOUA 1EXBA 4AF0A 1EO7A 1JCYA 4M19A 3BO9A 5LZLA 5XIAA 2WVSA 1V0LA 5DY3A 5E0CA 1W0MA 3NO5A 5CC5A 1XDLA 3URAA 4C7DA 4HK5A 3ZVIA 4JN7A 4WUIA 4GKTA 5CEWA 3OQ8A 2OEKA 1DXIA 4M51A 3E38A 4O1FA 1DBTA 1LQAA 4H19A 2DDXA 1UH4A 3N1AA 3FSTA 1JRCA 4BJHA 2O55A 5LGZA 1ALDA 2Q71A 2MUCA 4Q4OA 4CLMA 1GQKA 2GLKA 1AW1A 4WOQA 4HP5A 4WXYA 1EC9A 4PULA 5PTDA 3DIPA 5DXXA 5HJYA 4Z08A 1R46A 1RBAA 3SUWA 2D2OA 1BFNA 2QPXA 1XICA 2ODOA 1Z7AA 2ZRXA 2ZZ6A 3UXDA 3AZTA 5E9XA 4CNSA 3CL8A 1KBKA 1R3VA 2YDQA 3LPGA 3NZGA 1F4AA 5HMFA 2YDRA 3AXIA 3K13A 2CWNA 3GIPA 4DO6A 2BP1A 2QCDB 2XFYA 5IBXA 3QOMA 5D37A 5K9XA 5DT5A 3TEVA 4R9OA 3HMJG 2FGLA 3PVFA 1KKRA 3LSBA 5J8LA 4QQUA 3H23A 2H9AB 1ZENA 1PAMA 4C5YA 2VT0A 1W9PA 2QQ6A 3LENA 3E0IA 5HJXA 2F38A 4ALDA 4DBUA 4JIHA 4XTDA 2YCEA 3HA1A 5LNRA 1EJXC 2J27A 3CWOX 1J0YA 1RHCA 2OWWA 4AWSA 1TRDA 1JDDA 1FWWA 4FSAA 4Y9AA 2DIEA 3PJWA 3W2LA 5I00A 1FHVA 1JZ4A 4OT7A 4N2YA 1PZ2A 1C93A 4JYFA 3CUJA 1UD5A 4PE8A 5A8OA 3FGCA 3R5EA 4NIRA 2A4AA 3M44A 3DGBA 3NYDA 1R2RA 3GDLA 4WK9A 2ZUUA 3TSBA 2WAGA 4PB4A 1HJSA 1R9XA 1ECQA 3PZVA 1GT8A 3DC8A 1NF7A 4FPSA 2BMBA 4NAFA 1P7TB 3PBYA 4V28A 1K7EA 1X6LA 4GI8A 3W84A 4PH6A 3CZJA 4FB7A 1IXOA 1VFLA 2O7QA 1K8CA 4DF2A 2J7FA 4LUSA 1U1HA 3O16A 4AVOA 1MZRA 3SJNA 1FP9A 2VCBA 5LXEA 1CXKA 2J9ZA 5BYWA 5FIPA 4UNKA 5I3DA 2OYMA 4EF9A 1F2JA 3BCDA 1Z8AA 1YIXA 2PCQA 4ZO8A 1OFQA 1MI3A 2VELA 2Z29A 4TR9A 3MANA 4HU4A 4Q7NA 4NJHA 1OX4A 2PODA 4R34A 4CD8A 3PJTA 3PSVA 3AYSA 4HOZA 5EMLA 3LXAA 4GYPC 1NY1A 3RLHA 5KETA 2GZXA 2RGLA 3C2FA 4XZMX 1V3JA 3EOEA 3IS4A 1EFZA 3RM4A 2GJXA 4CD4A 5ABGA 4UB9A 2Y62A 3ECQA 4U33A 3QGVA 3SFKA 3TMLA 3ZLFA 3KS5A 4C1LA 3SBFA 4CUCA 2XGZA 1I2NA 4Y9PA 2L5HA 3BMXA 3LLFA 1ME8A 2P88A 5D2WA 3G22A 4J4KA 1TTIA 1I9CB 3EX1A 2F84A 2ZRWA 1KXVA 3EOUA 3VILA 3DYMA 2ISFA 1CNVA 2XFRA 2A3HA 1ITXA 2BTMA 4X2PA 2DZSA 1E4MM 4LBRA 4QNWA 3U57A 2DZTA 2V9DA 4LYPA 1WOAA 4JTRA 3RF9A 5CKSA 1OD0A 3R13A 5FF7A 2WZEA 3E6EA 4OIFA 3D0CA 2PDGA 3UWQA 4ATLA 1KNWA 3F2CA 3S1GA 3MBDA 1XIHA 1JPKA 2Z24A 2ACQA 3BJTA 2F8QA 2C6QA 4DUXA 5JIWA 2VRQA 3W2MA 2ZRUA 2CBUA 1MQQA 3SO7A 2WCGA 2F61A 1O5KA 3CH0A 1F05A 2CXGA 4INFA 5LIUX 5DT7A 2GQ3A 4XAYA 3PF3A 1V6WA 3BLLA 3AWOA 4EX4A 7ODCA 4MB3A 7TIMA 2NV9A 1W1IE 2ZQ0A 1KA9F 2VZVA 3RN6A 2WMFA 4WDUA 1UQYA 3E9AA 2R6OA 3L4WA 3RFAA 5A3HA 4N7QA 3VKBA 3NL6A 4NXKA 3TWAA 1TIWA 1PKLA 3BJFA 3R43A 1PPIA 1OD8A 1XPGA 5EYWA 4MJ4A 4QG6A 5BROA 4WCJA 1AQ0A 4IXHA 3F1QA 3B9EA 1F3TA 2RAGA 1H3GA 2E5DA 2A7NA 4HZ6A 1UR2A 1XIJA 5G1TA 4J2PA 4OKDA 1M04A 1Y65A 3P5YA 1B0IA 1NAL1 2JIEA 1G4EA 1PL9A 3V16A 3F03K 1KFJA 4KRTA 3FCPA 3K8KA 2A0NA 1I2OA 4F3HA 4RZ5A 4PMYA 3TYCA 2UY4A 4J3SA 3G6MA 4UZSA 3REQA 4K37A 3CT7A 3K2GA 5AYIA 3BL3A 3MUCA 3FJNA 2FZ9A 4D1IA 3RK8A 1O7AA 1XQKA 3FJ4A 3UR5A 1I2QA 3M7WA 1WQ5A 5C9XA 2QIIA 1TQJA 3CK5A 4LY8A 1S1PA 4N9EA 1BD0A 3NZPA 4W8BA 2V2DA 5B7ZA 4AC7C 2I5QA 1CXLA 4AHOA 3WH6A 2BGQA 2E1DA 4HU3A 1IE7C 1XYBA 1FWAC 4PBGA 4MVAA 2E4TA 3ITTA 1FH9A 1XLLA 2V38A 1DEDA 4DWSD 3P93A 3V0SA 3LERA 4DAIA 3W2UA 5HPOA 2PWEA 4H9VA 4Z2LA 2JF6A 2PWDA 1UKQA 2QDDA 3P8IA 1YKWA 5A94A 1FCVA 4Z2GA 2DJLA 5HNTA 3BWWA 1E9IA 5F1VA 4QE4A 4PFMA 1KM0A 1TV2A 4AD0A 3B4UA 5KSWA 4PYSA 3IJ7A 5CPNA 5C9ZA 3B0PA 2R8WA 1J5SA 4YTUA 4DJDC 4Q8TA 1Q6DA 3VGDA 3B8VA 5DBUA 3LCWA 3NEHA 3BARA 2WMGA 2WMIB 3HQ1A 3W7OA 1XUUA 3WNOA 2P0IA 3QR0A 3TW9A 3BK0A 4L4OA 2QUMA 2BG5A 3VO0A 2D22A 3G3MA 2Z7GA 3U5YA 3GFZA 4J5NA 1NEYA 3CT2A 3S8HA 3T6CA 3MYPA 5T8GA 3E0LA 3NGFA 2YB1A 3W1MA 2FQIA 1UASA 3SGGA 3U2OA 4FNQA 1CZ1A 3BAXA 1TVLA 3PZOA 2ZUTA 3FSUA 1FFRA 1YNQA 3GD6A 4IIBA 1T5AA 2OZ3A 1DYSA 3POHA 3HPZA 1LBMA 4W4QA 1DPMA 4HA0A 4RK8A 3BLOA 3GS6A 3MCOA 3UZJA 2IKHA 3SFWA 4JD4A 4Z1CA 1TO3A 1EP3A 4KRZA 3SQLA 3PY2A 1A5NC 3DENA 3KXQA 1IZJA 1CXEA 2VI0A 1CPUA 5AHLA 1OT1A 2W67A 4H6KA 4LBSA 4KGLA 3WCZA 3GAKA 3WLOA 3IVUA 4XBSA 4YMZA 1IHIA 1C9WA 3NSNA 3G1XA 3ZVHA 2RDUA 3W7IA 4C5ZA 1W37A 1TKKA 3PZTA 4JQ3A 3OP2A 4IMGA 4KPLA 1IZCA 3GE7A 2ZXQA 1VEPA 1JZ3A 2WJFA 3DG6A 1FVPA 6XIAA 4B5VA 2XZ7A 3BV7A 1EOKA 1ZLPA 4E6MA 4K7VA 4GY1A 1M01A 3VZZA 5AZ0A 5HNUA 5D2YA 4Z17A 2I56A 4CQ8A 1GOMA 1G69A 4NRRA 2QCLA 5CZTA 3GR8A 1M9HA 3PWAA 1G7VA 3W71A 4S38A 3UZXA 3SY1A 3LMYA 1UD4A 1OGSA 2Y63A 1GVFA 4H9ZA 4HIBA 1VRXA 3TC3A 3BQ6A 1XRVA 3F4CA 4GVIA 3B0VC 1O66A 2G5WA 3UJRA 2PB1A 4U31A 2RDWA 4D6GA 3P3BA 3QC0A 2R1KA 4J1OA 3U4FA 4A3HA 1TJRA 4XAPA 3P8JA 1XYMA 3K4AA 3G0SA 3UGRA 3MUY1 4ACZB 1R0MA 5AFDA 1QNPA 3WG6A 2AAMA 1WP6A 3EDDA 4GCAA 4GOAA 4LAZA 3GKFA 3PFRA 3FW6A 2FTPA 4GISA 3GHRA 1W54A 1XYLA 1YDVA 4I5RA 2VGGA 1TPEA 2ACRA 1PCKA 3VDBA 4JTFA 1UUQA 1GKPA 3XISA 3GH4A 3W9ZA 5AB3A 4IPPA 4TTUA 3MYOA 5I24A 3WDIA 2C18A 4LEFA 2DW6A 2Z1SA 4DWSB 4KERA 2HQAA 2Y61A 2J6VA 4GNJA 3EWBX 2VEPA 2QDGA 3OLEA 4ZB5A 1XYCA 3N17A 4MLRA 1D3CA 1G5AA 4AYGA 5HULA 3BLPX 1WNOA 3CTTA 1C92A 3VXGA 3C5QA 1B90A 2HE5A 1B3XA 1R7AA 2CBJA 3TOPA 1V0NA 4F8XA 4Z1DA 2G95A 5AC8A 2V5KA 4C6PA 5DCBA 4LVAA 1U33A 1IV8A 3W87A 3G1FA 1KC7A 1GVOA 3TXZA 3U5UA 3ALGA 3CU2A 1US2A 3M0YA 3SN0A 3H6OA 1J2BA 2VCCA 1C8XA 2QAFA 1PHQA 3FY1A 5I3JA 3AXXA 1JUKA 3SRFA 3KDOA 2OG9A 1PX8A 3BLKA 4KETA 1PDZA 2FVLA 3FGCB 3HPSA 3UPWA 4C6DA 3H26A 2OPJA 4UIOA 3W2NA 1DJNA 3NQFA 2QLYA 3T9PA 1H7RA 5DEZA 4HZMA 1GHSA 4PMVA 3TYUA 4GZJA 3AROA 4UC5A 3VKAA 5HR7A 1XLEA 3E0WA 3ARRA 3GG1A 3W7DA 3IRDA 2G3IA 1JGMA 3DAQA 4YHEA 5EBAA 3VOGA 4JHMA 4F0RA 3D46A 5TBOA 1XIBA 4I3GA 3QTPA 4FOKA 5L9FA 4JL2A 2BODX 3TQVA 3N13A 1UOKA 6A3HA 3URQA 9XIMA 5C0QA 3IACA 3T1GA 2JFEX 5CH9A 5T91A 4TO8A 1TZZA 3WD3A 3WJWA 3FYYA 3LXBA 3H55A 1GQNA 1SFLA 3QYSA 1HGWA 1UH3A 4JTHA 5HPCA 4I7UA 5AYXA 3ONCA 1C8VA 2WVTA 2JKPA 3RU6A 4QJ1A 3TXVA 2VUYA 4YVPA 1JYNA 3GW3A 3IVSA 4K68A 1UWTA 4YL2A 5JXQA 3N4FA 1V7YA 2Y5SA 4RPPA 5LNVA 3QJAA 3MUIA 4ZZ9A 1YBQB 1SUXA 3W83A 4U3CA 2INEA 2CZEA 3NXLA 4D6FA 3HGOA 1VJZA 3OGSA 4F48A 3LOTA 3FVMA 4UR8A 1JJKA 2W66A 1NSJA 4NZFA 3WQCA 1WB0A 1U5JA 1O4UA 3GXNA 2BVDA 4Q8UA 4JFUA 4NU7A 1TRIA 4W87A 2OYKA 2D23A 3L68A 4UQCA 3TN3A 4DI8A 2QV4A 1LBFA 3QZ6A 3WQ8A 1O1HA 1PIGA 1W32A 1HT6A 1X38A 5CBJA 3A9BA 3ITYA 4GQQA 5E1QA 5H8UA 4Y9NA 3AUJA 3MMTA 2GK1B 5B80A 2UWFA 3ZT5A 4JYEA 3HPFA 4XBJA 2Y7DA 3NNTA 3EMZA 3W88A 1W2VA 4OHQA 3VDCA 1MDLA 1NOFA 3NQCA 4PUUA 2GJPA 1J0IA 3C2YA 2FPYA 2Q3OA 3N2CA 2NQJA 2GGHA 1PTGA 5XINA 1A5BA 1CI1A 1GJUA 5CC3A 1BSIA 3W1LA 4TX9A 1OSEA 1B30A 1VFHA 3OLGA 3EX3A 5CZSA 4ECLA 1MNSA 4WD0A 1CW2A 2GVEA 2GJRA 2WCSA 3W01A 4YHGA 1AW5A 1LLWA 2NWRA 3GWQA 3TA9A 3JZEA 5LNSA 1P6WA 3AU2A 4AHPA 3NQ7A 4PUWA 2HS6A 3DFYA 4ZXOA 4O13A 4HYVA 4J28A 1WOBA 4OWGA 4E8GA 1LG1A 1TG7A 2Z1VA 1PTDA 5DCDA 3S47A 5C7VA 1F3XA 1DWHM 1OC5A 4NSBA 5CLTA 3WBAA 5LIWX 5FL1A 2B31A 3N18A 1YEYA 2J8TA 4DZHA 3VD9A 1R9ZA 3MHGA 3VTRA 4TX6A 2OB3A 3VZXA 2XVGA 2BHYA 3PNUA 1V5XA 4IP7A 1XWYA 1S39A 3BTNA 3LN3A 4PCSA 5A69A 2PWUA 4MWAD 1XRFA 4MY8A 3GVRA 3UF9A 2HSAA 1E55A 4A3RA 2W27A 2EG8A 4DLMA 5D9MA 2VZUA 4S3JA 4S3AA 4GD0A 1FWCC 5CGMA 3W7PA 1B3VA 1JQXA 2BS9A 4QE5A 4EP8C 4PTDA 5EA9A 3LRMA 3MCMA 3E2QA 5A8GA 4RNHA 4DF1A 1HKVA 3N3TA 4PRWA 1RJPA 4Z42C 2C3ZA 3P62A 3RLVA 3KOFA 4CN4A 2NQLA 1N55A 2A2IA 2Z7KA 3PZUA 1RK6A 2ZFAA 1E6QM 2CU0A 4F0SA 4JR5A 3PNZA 4V1XA 1ZBWA 2HK0A 4R7OA 3LM3A 1ISWA 4PTNA 2YBTA 1MEHA 2C13A 4AEEA 3EWZA 5A6SA 1DJIA 4WXZA 1YTDA 3R8GA 3UY7A 3P80A 5D04C 3QPEA 3EDFA 3MUXA 4JFVA 4DWSA 1S2AA 1K6WA 1LLZA 3CV2A 5JBFA 3QQ1A 1C9DA 1S2UA 5JBEA 1TWWA 3VNYA 4IIDA 3DI1A 2OKTA 1G67A 4V2XA 4JFSA 3OPSA 3W82A 3WQ4A 4NYYA 1KTNA 1TE6A 1FX6A 2ZC8A 4JEJA 3LYEA 4HHPA 4XVDA 3UP8A 4ZQCA 3T7VA 5EKYA 1JRBA 1VLIA 1XF0A 3NFUA 1YNPA 3N2MA 5ABFA 4QEEA 1AQHA 1TCDA 1SMDA 3ZJKA 3NZ1A 1UIOA 5FF3A 5HUOA 3AHTA 4UTWA 1Q7ZA 4MF4A 4LVBA 3ANUA 2VMFA 3S2MA 4LXFA 3OA5A 1XUZA 3B0YA 1LL6A 2BWGA 1EJRC 1ME9A 5HWNA 4LV4A 2IPFA 4UTTC 3EB2A 3D3FA 2YA1A 4IT1A 4U10A 3WDPP 5DMNA 4DJFD 3W7KA 3TYAA 1MW1A 3NQ2A 3P14A 4HKPA 4KS0A 2AMXA 3APYA 5EMJA 4PUDA 3W74A 4Q33A 4UOZA 1DHPA 2G50A 2VHLA 3R12A 3ATYA 3CMFA 4B5XA 1GKRA 4B2DA 1TUFA 1SO3A 4KEZA 4R9XA 3ES8A 3WQDA 1KFWA 1TWDA 3N15A 4HCLA 4LOCA 5AVHA 3B03A 4J40A 4GUFA 7PTDA 1POKA 4UQDA 4Q8MA 5FAGA 1Z42A 3A23A 1EQPA 4CQCA 4HMNA 2Z4GA 3WJSA 1V6XA 4FK9A 2QHAA 3GBDA 4LBUA 1J6OA 4CU8A 5DX7A 1QRQA 4V33A 1JCLA 3USZA 1QO5A 9CGTA 3SJ3A 4L4LA 1HXJA 3TW7A 4GA8A 4J3XA 4L56A 2PWFA 4J2MA 5I3HA 2WHLA 4IZGA 3ANVA 4GIEA 4HOWA 1RBOB 4GK8A 1W3NA 3CASA 3I4KA 1PJ9A 2UY2A 3HO8A 4F9JA 4I9MA 1KM5A 2OT0A 2RKXA 4M82A 4A2SA 2C1GA 2QT3A 4A3YA 2J7GA 5FF4A 4AY1A 3A13A 5HDRA 1CGXA 3EWYA 4OV9A 4GVHA 4FX8A 3KLKA 3CWNA 4M29A 4W9TA 1MXGA 2QF8A 3MSDA 4AHQA 3ZLGA 5D2TA 3FJLA 1HKJA 4Q6XA 1I1WA 3SGUA 4HA3A 3CEPA 1IGSA 3GFXA 3ICJA 2PPGA 3SCSA 2VQTA 1VRDA 4CQDA 4U3AA 1V6UA 2HNEA 4LVFA 2WNQA 3PBMA 4L9YA 4M7SA 1P48A 2W0UA 3PB2A 1OF6A 2O9TA 5JUVA 4ROQA 4J35A 2DP3A 2A3AA 3IJQA 4WJXA 1B9BA 2VDHA 4L6HA 4DO7A 1FH8A 1KBIA 3KS6A 1EZWA 5F7UA 3OYXA 4TVCA 4XZBA 4NI8A 3AOFA 3WEOA 1JQVA 2CERA 2PTDA 2CZDA 4Y9OA 5E70A 5ABTA 3EMCA 4ZSUA 3QC3A 3ME3A 5HWJA 4KGJA 3PP7A 2YA0A 4J3UA 5DMYA 4JCMA 3DOPA 3G1HA 3QY6A 4AIEA 3MMDA 1Z9AA 4JYDA 4D6IA 3VGFA 1HG3A 2HRWA 3KBVA 3NEVA 2PDWA 4ZTXA 1W56A 2V0TA 3AAMA 4C6QA 3VYLA 3U8GA 3ZIZA 4O1BA 2ZZ1A 4D8ZA 3SQMA 1GTHA 3T08A 1LROA 1H49A 1ZU8A 5AVNA 3EGJA 3R6IA 4NJKA 4KWWA 3STPA 4F9DA 3IJIA 3WQ5A 4IL2A 3TV8A 1DWGM 3GZAA 3KOZA 1LRTA 3T09A 4ZQNA 1Q4NX 1ITCA 1KR0A 4H6RA 4N4PA 1JL8A 4DNHA 3L0GA 3U2CA 1XIMA 1MWOA 2W63A 6XIMA 2OLAA 1EDTA 3VNIA 3T55A 1RK5A 3ZXWA 3TYDA 3G3DA 3FA4A 3Q65A 2ZKMX 2DSVA 2ICSA 3AIUA 4UTKA 1QOQA 2V5CA 2X05A 4LB4A 2G4JA 1KBLA 3FVDA 3EPNA 4FALA 4DQWA 1PUDA 4XUYA 4W5UA 2WO5A 4V27A 4IPJA 3I7QA 4XKYA 3IV8A 2VUNA 2FZBA 3MW7A 3THDA 1W1YA 2DT0A 4GPNA 4LS1A 1W91A 2AL2A 1WBHA 2VKZG 4Z2IA 1AQMA 4D2JA 1QHOA 4WGXA 4XZ9A 3ES7A 3QBUA 2XN0A 3LRKA 3GKAA 4AZCB 1DJYA 5A6AA 3CIVA 2BGSA 2C8NA 3SRKA 3L2MA 1P43A 2OQYA 3W7JA 4QG8A 3BMWA 3VZYA 1ONRA 2V3DA 1WDWA 2ZOXA 4MSSA 3SGZA 1H7XA 5FI8A 4Q7IA 2ZX7A 2R9RA 4HPJA 3O6DA 1ADOA 3CHFA 4N02A 1JGIA 1GEQA 1EJSC 3EDEA 4GNKB 2KX9A 5HINA 4PMQA 1TA3B 2VJXA 1LOQA 5DBTA 3VDAA 4O16A 4DJEA 3KCJA 4MZ1A 1D7FA 4J7RA 1JCXA 2YOCA 2IXVA 3CV1A 1WAUA 1J8VA 6CGTA 2X1TA 1CLVA 3APGA 3RGTA 1QMLA 2NQ5A 1EUNA 3WLRA 2NW0A 4I7WA 4MNKA 2V68A 3LI0A 4A3UA 2HVMA 1GVQA 3LHWA 1XIFA 5JMUA 3B9OA 5JIPA 1SO4A 1ZBKA 8TIMA 1BVZA 4GI9A 1GONA 1PYMA 3S4TA 1E5JA 3K5XA 2DJXA 1DIOA 3LTYA 4Z2JA 4IJBA 2ZX8A 3FDKA 3HZ3A 1RCQA 2I9UA 4B16A 2ZZ5A 1QUMA 2EEXA 5CXPA 3MKCA 4EANA 1N8WA 3NQBA 1GWJA 5EU9A 1IT0A 1YHTA 4JZ5A 1KTCA 4RDVA 2A3LA 2VO5A 1SZRA 4IGNA 4FX6M 4HA1A 3EX6A 4O14A 1F8IA 4HA4A 1XH0A 4HZ7A 4WKAA 1YTKA 1QFEA 2D20A 2RJHA 3NSMA 1SR9A 4ZTYA 1KRCC 1YPXA 4ATWA 4WVXA 4XSMA 4P7QA 1Y5XA 4K2SA 1XYAA 3NAVA 3M5XA 1BGAA 4A8NA 2BVWA 1TUXA 4GBDA 1L6WA 1JCJA 4MLJA 2VDIA 5HK4A 5HA7A 5C8BB 1KB3A 1QI0A 4NJIA 1GOOA 3BVJA 2OSWA 5FEWA 2DT1A 1L2QA 4H9TA 4GYPA 2PA6A 1UWAA 3ID7A 3LBCA 5HQMA 1J96A 1MUWA 3QHMA 2YBUA 1W1PA 5F4WA 4URIA 1R6WA 2GUYA 2VFGA 2JK2A 3MWCA 1DWJM 4AZIA 1GOQA 4LUIA 1IZKA 3W86A 1E9ZB 3CQKA 4KFNA 1H50A 1TPWA 3F5JA 4ORMA 3P61A 1XLKA 3KWXA 2VX4A 4Y9MA 1MUCA 1EA9C 3CHEA 1R2TA 3NR0A 3SCRA 1GCYA 5BRPA 4FOJA 4ROPA 3TFCA 3I3EA 1Z44A 2Z1XA 3VCRA 4FI4A 3PWGA 1SFSA 2QS8A 1UD3A 1Z48A 5F4SA 4QNEA 4NY2A 1J01A 4K8EA 4W8LA 5ECVA 1GHRA 1MMFA 4GUJA 4DJED 1X8FA 1JYWA 3CQJA 3LI1A 4QAIA 1O94A 4R7WA 4IG2B 2EHHA 3S5ZA 3ARSA 1F6YA 4ERIA 2J8GA 4GRSA 1FCQA 3FKRA 1QW7A 2AQOA 2OR2A 2YKKA 3ZSTA 2HJPA 1HIZA 1VFSA 4QXIA 1DTNA 4JTTA 4H4IA 3QHOA 3CUXA 2VEFA 1KCXA 3RHGA 2J88A 1UC4A 3H7VA 5K3VA 4NKCA 3KOYA 2Z00A 6ENLA 4HPXA 1W6TA 1W5MA 4PMXA 3A21A 3B06A 1UMLA 3KOXA 1OFAA 8XIAA 3FLUA 1JNEA 4HHHA 3AWNA 4QJ4B 3GDMA 4IQDA 4WDTA 1R87A 4ACYA 3KVLA 4JTEA 2XINA 3NPWA 4H6QA 1B9ZA 1JPMA 1LRNA 2WV8A 1C7SA 1Y8BA 3ORWA 1MQPA 3DERA 3J7HA 4N6EA 3U6WA 4DRSA 2CLOA 1TV7A 3VOFA 1RR2A 4I9TA 3NPVA 3UXIA 4KWSA 4JTQA 4GIYA 1BAGA 4I5XA 1L9WA 2V69A 1HFBA 3UETA 4AISA 4E2VA 5I77A 2VVNA 1UBSA 1VENA 2EF9A 1TV5A 4C6EA 4LW7A 3NQVA 4HBKA 2E8YA 2Y89A 3DFOA 1TTQA 4IOTA 5CSYA 5FF0A 2R94A 3GHTA 2ASHA 4AX6A 3QQWA 2X8RA 3HU7A 2C14A 5D09A 1WO2A 1VIZA 3C3UA 3IANA 4GIAA 4JTKA 3OO2A 4G7FA 1G01A 3MKKA 4IGSA 3MB9A 1R3TA 3UWUA 4AH7A 3VA8A 3CV6A 4UFJA 1UW9A 3B8UA 4TUFA 2PBOA 3ITOA 3GXPA 2ZXBA 1I8JA 4DXVA 1UZHA 3W1RA 1P0KA 2JE8A 4QDMA 4B5TA 2JQXA 4IFKB 3IUDA 3NM1A 1GW9A 1A5MC 4S2BA 3CZKA 2HVNA 2E9BA 1Q65A 4MPQA 3UT0A 4RNIA 4DBSA 3RO8A 2ZTKA 3A9IA 4ZOCA 3W72A 1E5NA 1US3A 2D0HA 3MO4A 2CLFA 1OADA 4LYKA 1QNOA 4WJEA 3P7YA 3S9ZA 4YU1A 5DY2A 2FH6A 4M56A 1OC7A 4IMEA 3WO8A 1U1JA 5FOOA 5CPOA 2P3ZA 4IX0A 2E6FA 3PBGA 1AH4A 5I7GA 3W7NA 4G56A 3WBYA 1XI3A 4R85A 3PAOA 4NAEA 3W25A 3WLIA 1FOBA 2V8ZA 4ZL1A 3VMOA 3EWCA 3GDTA 1B3WA 1M6JA 3LCIA 2BY3A 5F1UA 3W1UA 4QS5A 2ABBA 3GTFA 4ML4A 5TD4A 3SW6A 3W23A 3FN9A 2RDXA 1H7NA 3DC0A 1J4EA 1RVGA 2J4GA 5JQ9A 1CGYA 1MO0A 3UXLA 5LA2A 3R58A 1XLFA 1IWPA 2HS8A 4ZB0A 3Q67A 1E1FA 1THFD 4S23A 3STEA 3W75A 4E2BA 1LORA 4ZO7A 1R47A 4E4FA 3EKLA 1VEMA 3KRUA 5A95A 3UG4A 1CLKA 4XD3A 1PIIA 1R3QA 1KCKA 2DZBA 4S2CA 2GVJA 2PC8A 5GPRA 1X6UA 4PCTA 3HBLA 1SW3A 1I60A 5AHFA 5BU9A 2GUUA 2NWSA 3MHFA 3M07A 2Q3RA 4ENLA 1QWGA 2A85A 4X63A 4IP5A 1VFMA 2Y24A 3POCA 4JBRA 2QJMA 3INPA 1YPIA 5CCZA 3U7BA 5KITA 2Y6ZA 4IUGA 1ZP4A 4C6LA 2ATMA 1TR9A 1TYGA 4LAMA 3FA3A 4C6OA 4C7GA 4Q7BA 1FKXA 3CQIA 4DLFA 3K4DA 3HGJA 4AYSA 4X3ZA 3VD4A 1J0KA 1HVXA 3HTWA 1XD1A 5EMKA 3VNDA 1Q8JA 1WUEA 1MW0A 4ZQOA 1Q6EA 2WMIA 2FH8A 4G1KA 3ARWA 1QJWA 3TSMA 5TIMA 2VD9A 5FJOA 5CAKA 1EWDA 1LUCA 2O9OA 3E1F1 3DEQA 3C3NA 3XINA 1EHNA 1GG1A 1UZ4A 1S3TC 3IJ9A 1E43A 1I0DA 4RZ6A 7ENLA 4QR6A 1FKWA 3SUUA 4L6OA 1SW7A 3Q45A 4IXXA 2QPSA 2OVLA 3G8RA 3UCDA 2J7DA 4FXSA 3E0FA 1ZY9A 4US5A 3MVTA 1XCWA 1PXGA 4R7JA 2PP1A 2WVUA 2H6RA 3Q4DA 1EDGA 4ZQPA 1R5YA 3AISA 5HMEA 1FDJA 2G4FA 1NU5A 4BEUA 2E6AA 3GIQA 3QN3A 3IEBA 1MNZA 1ICPA 3S6TA 1HJWA 3GNDA 3UR8A 3WLLA 4FX7A 3CBWA 4UCGA 4BI6A 3C8NA 4OUEA 3MS8A 4S3EA 4O4WA 4F0KA 1DWFM 4GI4A 4NJJA 2VTFA 5I6SA 1CGUA 4JIEA 2RUSA 4H9MA 1NDWA 7A3HA 1JI1A 3GR7A 1JAEA 3QV7A 4MAZA 4TV6A 3E3HA 1XFCA 5C71A 3WFZA 2NQHA 2QVNA 4YPJA 3VKCA 2C7FA 1HL9A 2QDHA 1O68A 1IXPA 1CENA 3A24A 5LKYA 3C2VA 1XLJA 3ZLHA 1LL7A 1FWFC 2YGYA 1NFGA 3U9IA 5I79A 1X7FA 1XLCA 2E9LA 1OCBA 2O4MA 3IJLA 3CLWA 5A8PA 1G6CA 2FZMA 4Q4RA 2V2HA 3DZ1A 4YWIA 5KZ6A 4W93A 3PTDA 1BWLA 4IISA 3B05A 3VC5A 1JDCA 5BWAA 4K1GA 3LHUA 2C0AA 2OU4A 4HQVA 2VZTA 3L4TA 1TPFA 2D69A 3QW4B 2C0HA 3MV01 2OT1A 3RYSA 3W1QA 3UY8A 5F4XA 3JZUA 4KESA 1W3IA 5FEPA 4RXGA 4PUNA 2Z1WA 3ONBA 3W85A 3AHXA 4IMDA 2GPTA 3OZPA 4BR1A 2WVVA 4QGCA 1H60A 3AXHA 3PHAA 3W7LA 5CPTA 3EWDA 4MOZA 1E1EA 1KM4A 3FAWA 1PKNA 1GGOA 2PDPA 1RJRA 1QI5A 4PR4A 3BCJA 2REQA 1E4LA 4YYCA 1BLIA 4AZGA 3GR4A 2O9PA 3AQUA 2OZ0A 2Z0IA 4AX7A 1DQXA 3HF3A 1JI2A 2QZRA 2FGZA 2IW0A 3GG0A 5KMYA 4WKHA 3MSGA 5EGRA 1ELSA 4XV0A 4H7ZA 1M7XA 2ZUVA 1V0MA 3I4EA 3WUGA 1EZ2A 3GW0A 3NL5A 3NL2A 1NJJA 4G1NA 1UROA 3KL3A 1F5ZA 1XP3A 4YS1A 2QR6A 1PCWA 3ARVA 4I5UA 1GK8A 2IUZA 2Y5JA 4Y8EA 3VIIA 4EVZA 3RX3A 4IPNB 3WQVA 1LCOA 1TX2A 2VXNA 2ZZ4A 3L9CA 4O50A 4DJEC 2CLKA 1W9BM 4ILSA 4LH8A 4QX4A 2Q8LA 4PL1A 1E9YB 1FCBA 7TAAA 1JD7A 1AMYA 3THAA 1JCNA 2E25A 3UQNA 5JH2A 3VDHA 1VC4A 4GQRA 1KM2A 4S3FA 1EJTC 4QIUA 3OVQA 2NX1A 4MPKA 1QPNA 3IWPA 3H8AA 1O12A 3HM7A 5AC4A 1UPPA 1W3HA 4QEHA 2OX1A 4GVGA 1DJGA 4S3DA 2G3NA 1YTEA 4DZIA 3SADA 4GI6A 3E96A 5AHNA 9XIAA 1WDSA 4UOQA 1YXCA 4DBDA 4W7UA 4DY1A 3OODA 2WYSA 4S3CA 2E40A 1H7WA 5AN7A 2VGIA 1QW9A 4NYUA 1ZJHA 1KM6A 2XN2A 5FEXA 4U28A 1QW8A 2NV1A 1Q5MA 3UERA 3EXTA 1T6MA 2CETA 2EO7A 3CV7A 3ARUA 3SCUA 4GINA 4F0MA 5AC6A 3MMUA 3CMGA 4AB4A 3NQMA 1PWMA 2FB3A 1K02A 1GVRA 1YYAA 1D2KA 5EBUA 3GC4A 1Z69A 4NZ4A 4JTAA 3CHVA 4ZXLA 4BQ2A 4CNUA 1VPYA 3S83A 4LB3A 4D72A 1MSSA 1EB3A 5AKQA 1V02A 1T99A 3UWYA 4WEVX 5A6LA 1FP8A 2F2KA 4WDXA 3C86A 1VS1A 4K3ZA 1ADSA 4I6VA 3GBEA 4UR7A 4XX6A 4GQGA 3VKKA 4H00A 2DT2A 3F5LA 3KL5A 2QEZA 3UPMA 5IXEA 4IQJA 4PZVA 2OELA 3W73A 1KWKA 2X7WA 1PX4A 1AZ2A 5EMUA 3BV4A 3QGKC 4CNNA 2VWSA 2HMCA 1UB3A 5C6MA 3TDFA 4GX9A 1FWHC 4NRSA 4LVGA 1P1MA 3ITXA 2E68A 1LOSA 3W07A 3VX1A 2OJPA 2I57A 3B4YA 3WL1A 4X9SA 2RGMA 4XIMA 2VC5A 4LF2A 3TJ4A 3CNYA 3LZ3A 1WA3A 3AMCA 1SQ7A 1UQZA 2FVKA 3PTQA 3B8SA 1BEUA 3ABXA 3AHZA 2PZ0A 1DOSA 2NX3A 4WOZA 2V6AA 2CZ5A 1KCLA 1YX1A 3BAIA 5BCAA 2PP0A 2Y2WA 3H53A 3QKZA 3VNMA 1XLGA 1KFEA 1S5TA 4GFSA 3GVQA 2A21A 1UKPA 1JCTA 1FFQA 1SPQA 2WANA 3GK0A 4ZBCA 3ABSA 1UC5A 1E1CB 5L6UA 3UZYA 4MKVA 1XSJA 3VM5A 4NJGA 2CCRA 1B4EA 3WSUA 3SEPA 4O0QA 1NF0A 3IUIA 3KM8A 4O8RA 2HWGA 1QAPA 4E8CA 2PDMA 4ML9A 3CB3A 4JTIA 1UWSA 5DFAA 3WBEA 3NURA 1FWSA 2XHYA 3N6QA 1ZCCA 1J10A 1SGJA 4IJCA 5KZDA 3LGEA 3OLIA 4GZ7A 3WLMA 4D6DA 5AC7A 4MFEA 1Q7QA 3E74A 3WLKX 2CC0A 3RCYA 3IK4A 4JTUA 1BVNP 4QLKA 2Q8XA 4A05A 3E5BA 1W9DM 1LZOA 2OEMA 3DH7A 1Q6RA 2ZTJA 3E2SA 3L65A 2GK1A 4IPIA 1FTXA 4UTMA 2D2JA 1O5XA 2WW5A 4U2ZA 2YCLA 3OB8A 3ITGA 2Z27A 4JTDA 4AG0A 3PM6A 2VFHA 4RLIA 1H0GA 4W88A 2X1RA 2VZOA 1RQHA 3SIMA 2HTMA 1B54A 4XB3A 1UR4A 4N6FA 1K4GA 4TV5A 4CEUC 2OO6A 4M6UA 3W7MA 4ADUA 3RITA 3WD1A 3MV11 5HQLA 1MVYA 4ZO9A 2QJJA 2BXVA 3PZNA 4Q4QA 2WVVB 3WD0A 1Q63A 2W62A 4MNJA 4D6JA 1XLAA 1B4KA 2ATSA 4JPGA 2QCFA 3TWBA 5LXXA 3W1PA 3UR7A 3PG9A 3ZZ1A 1MRAA 2E1WA 3O06A 1TJ2A 3WLTA 4POCA 3M6YA 4JIPA 1KKOA 1J0HA 1G1YA 1GZGA 1GVIA 1TJ0A 4C90A 3QSRA 2D2GA 5D8ZA 1QASA 1N82A 2HE8A 3W26A 1HNYA 2Y5EA 2A79A 1JDFA 5A6BD 4Z2KA 1SJBA 1XBVA 3ENLA 4PUMA 2PGWA 3LCGA 1OFRA 1XCFA 1BTCA 4JKLA 3ARXA 3GC5A 4EE9A 4N42A 1AH0A 1RALA 1CEOA 3HGSA 4GABA 1GG0A 1RQBA 2QULA 4GC4A 3SRDA 4H83A 4JFTA 4MJMA 3OVRA 2OXNA 4NX5A 1MW2A 1KCZA 4H2HA 4CCDA 1GQJA 4XZHA 2ZVIA 2FFIA 4TXEA 3WLQA 1ZJIA 2Y85A 5K7JA 2DUZA 3F4DA 1OG6A 5LIXX 2E9MA 2AQVA 4FF7A 3AHVA 2AOSA 3T2OA 4LAUA 2V5LA 4GY0A 4I90A 2YR1A 1TB3A 1H2JA 1QT1A 1PDYA 3UWEA 1J9YA 4AUBA 2BSLA 1RPXA 1ZCOA 3PPHA 2B7OA 2DZUA 3UA3A 3CAWA 3RPTA 2PRHA 3TZNA 1EJVC 3TTSA 4L64A 2E67A 3GFYA 4H9XA 2WSYA 6REQA 5HR6A 1TREA 2C1IA 1BQCA 2I17A 4REQA 4NAFB 3QFWA 3KBSA 3UJ2A 3W02A 4MWAA 1HX0A 1GUVA 2YIHA 3Q94A 3PBUA 2GVGA 1IF2A 4MY1A 3STFA 1CT5A 4XD5A 1AJ0A 5H8MA 1D7KA 2JKAA 4FP1A 3TA6A 1R9YA 3DECA 1SO5A 2P8BA 3OG3A 4S39A 4H7VA 1RSCA 3AXMA 5KINA 2OKOA 2ZCGA 3SRHA 3EKZA 4OZOA 4OOUA 3HG4A 1N8FA 5I3GA 4RNFA 1EPVA 2WC3A 2HDJA 2XIQA 2GDUA 1RVKA 5BMWA 3ATZA 5FACA 4M24A 1TVNA 4C6BA 1MEWA 3E0VA 1M7OA 2ZDSA 4G8TA 2G37A 3P81A 5TAOA 4PL2A 1K03A 1FWDC 3NVDA 5IDZA 4BI5A 3SM0A 2XSAA 3BZGA 4DO4A 3W2JA 3OHMB 2FVMA 4MFDA 1XSIA 3T81A 3M7SA 3HPAA 4FNSA 3MQTA 3H2EA 1JPHA 2TODA 4GYFA 4WLCA 2XGIA 3D47A 4HNVA 3LLDA 4D1JA 5AYYA 1OQFA 4QG9A 2PS2A 2IPGA 5M2FX 2O56A 3PK7A 4OOZA 3EMQA 4IPLA 2VFFA 4LPCA 2ZUNA 3MC5A 1OYBA 4C6MA 4F2BA 3EWUA 4D71A 3GU2A 4PBEA 3W27A 4ES4A 3GH7A 5HAOA 2B7QA 4W7WA 2HNHA 1A3WA 3OOQA 4KEMA 2OSYA 2EQDA 2CKSA 2ZRYA 1JFHA 3CO8A 3VM7A 4UZUA 2QMJA 4PSRA 4IQEA 3L4UA 1WUFA 1EIXA 5CZKA 1PZ1A 2YW4A 1VYRA 3E2VA 2HXUA 1PKYA 3QPZA 2YL9A 1ADDA 4FXFA 5BXTA 1V03A 2OZTA 5HQEA 1WDRA 2NLIA 3N6HA 4K8HA 4NF7A 3SDOA 1KGWA 1W9VA 3MY9A 1J12A 3UGVA 2FLIA 4IIHA 3B3DA 2TYSA 3FOKA 3LBOA 3QLDA 3NXFA 3GTNA 2RJGA 4J3TA 5LHFA 1CTNA 2PCEA 4GBUA 3EOOA 2GWGA 2LLEA 4Q8WA 5FSEC 4CCZA 4PUKA 1M03A 1A3HA 1C7TA 3DBPA 3URBA 3USBA 2V82A 2WPGA 4UQAA 2ZX6A 4AXNA 5J5DA 2Z26A 3QZAA 3TFXA 1ZGDA 1F3EA 4CNPA 1TV3A 5A6JA 3L12A 4YYFA 1KRAC 3WMLA 4UNIA 4GO8A 3NA8A 1MEIA 1UH2A 1HKKA 2XH2A 3BXWA 4CQBA 3I10A 1CWYA 1W3TA 4U5IA 2VWTA 3N19B 1HP4A 2HISA 4UFLA 3STGA 1EO5A 1TVPA 1UA7A 4GQ0A 4F0LA 1AMKA 4V15A 3I3BA 3WEMA 2OWXA 4IMFA 3G24A 3L5AA 4HSHA 2A5HA 4IFKA 3BSGA 1EH9A 4AZ5A 3L2IA 3B9NA 2RHGA 1E71M 3NQAA 2XYLA 4BS0A 5CJ5A 4MWAC 2YL8A 4M1BA 4NZ5A 3U7VA 1LTDA 2Q01A 4GUGA 3TCEA 3GC2A 2CLIA 2F7FA 4OV4A 4FNTA 2X0YA 2J6XA 3B0XA 1KRMA 4YIWA 4JKKA 4XD4A 2GSEA 3P2VA 4Q4KA 3S2CA 3KDNA 3EEZA 4WY0B 5IRPA 4EWND 3PTMA 2ZBTA 1VBHA 3N9KA 4OJYA 3EX4A 3RAOA 3SCTA 3QV8A 2W5FA 3B04A 3A4XA 1F3WA 1T96A 4AAJA 1PKMA 1QWKA 3PUOA 4FA3A 4D8AA 4RL3A 1E1CA 3TSDA 3LV6A 4HN4A 3VIPA 3OBAA 4Z0SA 3RLGA 3V5CA 1OYAA 4D9PA 4OVXA 3CHCA 3VNKA 4A29A 5BU6A 1UCWA 3GDKA 3MJMA 4JY9A 1Y0EA 3WLSA 1W8SA 3VMNA 3SURA 3ARPA 3F2DA 1V79A 2G3JA 2GGIA 3C4UA 4ZR8A 3WD2A 5G4EA 3N73A 2PU1A 3EXRA 2Z2BA 4X61A 4Y2WA 4MMWA 3CPGA 1HKIA 3HFYA 5HWMA 4AD1A 1NFPA 4CQAA 3L4VA 4N9CA 2AQWA 4AQLA 5I3KA 3O15A 3VD5A 5BRBA 3OIHA 3VK5A 2DFAA 3BURA 3T0TA 2J9YA 5FJJA 1KBJA 3U48A 1M68A 4C6JA 2E5CA 1F6KA 2QXWA 1E0TA 3LCXA 4PCFA 2PDNA 1Z89A 2PWVA 4H1ZA 3WQGA 3ZO9A 3P67A 1VCFA 5A1AA 3VNLA 1E56A 4UTFA 2WCAA 3UYIA 1UD2A 3CH9A 4RKAA 2PAJA 3H22A 3GYEA 3MO7A 3NZRA 4UOJA 5D2XA 1W8GA 2HVOA 1EX1A 3VIHA 1R2SA 3BLFA 1V4YA 3TN4A 4XKYB 4PODA 3OQEA 1IWAA 4O1DA 3UJFA 4GH3A 4LCSA 1FWBC 2WWDA 4C6FA 1TPH1 4O53A 2YJQA 1HP5A 5C55A 2A6LA 1KFLA 3AIQA 2OGYA 1P0BA 2OSXA 1BYAA 2QUTA 2O92A 2W6RA 1Q4WA 1WKYA 1W3JA 2X40A 1UZDA 3GXFA 1HJVA 1IEQA 3M0LA 1DORA 4E3VA 2DIKA 1WZKA 5HNNA 1JZ8A 1IEIA 3EBVA 1OHLA 2X30A 3W7HA 4AD4A 3NTYA 2BVTA 1H7PA 3D3AA 3HQNA 3S9YA 4EPDC 1ONWA 1Q66A 1MQRA 4V1YA 2DUXA 4MGGA 5MKGB 2ZZ2A 1OY0A 4EPBC 1OZQA 2I7GA 2YW3A 1HGYA 4GIRA 3THCA 3EOSA 3O63A 1HJUA 4ONVA 4DM1A 3ZSSA 3GUGA 3RRAA 3KL0A 1XD0A 2PMQA 1H0IA 3WF3A 4AC1X 4F2TA 1WKFA 3BG3A 3OW1A 3R8HA 1R3RA 4C91A 2POTA 2X2GA 4NNAA 4OU1A 1FHDA 2ZC1A 3IIOA 1GYMA 1SU5A 1ZBVA 3RR1A 3P84A 4JN8A 3ABRA 1T40A 2NSOA 4HZ8A 4UQEA 4LAOA 1LLOA 4HPNA 1ZPTA 2J77A 1DQWA 3RNDA 4F2UA 4K6AA 1I2RA 3W7RA 2G3FA 3PUEA 1A5LC 5E9AA 3M0IA 3TONA 1FRBA 1W1TA 2POZA 5RUBA 1V77A 1MFVA 3M43A 4H04A 3LGDA 2WKLA 1BYDA 3IV3A 1US0A 1QTWA 3N6JA 3SCNA 3BDKA 4P7LA 3SQSA 2VOTA 2A1YA 4BQ3A 3W7QA 2JEPA 3DFHA 1QK0A 1DE5A 3EAUA 3WENA 1H1YA 4O1AA 3T0BA 1Q2SA 4GJIA 1U2YA 5HBFA 1C29A 1XISA 4YN5A 2PZNA 3SUTA 3KZSA 5FESA 2YBVA 3N11A 1VH7A 3ZJ6A 2VURA 1QATA 1XH2A 3KOWA 1L8PA 4GNVA 3RRXA 1NQKA 4DJFC 4ZODA 1TTJA 4Y96A 2YCJA 1G7UA 4M1RA 3ITLA 3OVGA 3UG5A 4XZWA 2CHOA 2H3DA 1PWLA 2J74A 1ODUA 3H2FA 4LYRA 2CKRA 3PZMA 4PUJA 3I65A 4IF2A 4P7OA 1A0EA 4YTRA 3W28A 3A4AA 4DXXA 5EMYA 3GLCA 4B15A 4PMUA 4L5ZA 1VCGA 4BF7A 1BXNA 4YTTA 3QY8A 4L1WA 3S42A 1IEVA 3KCLA 3MMWA 4PSPA 3HJEA 1ECEA 1H61A 2QVHA 3RPDA 2XSBA 2GVLA 3I7RA 1I4NA 4L9ZA 3MSYA 1CBGA 1ITQA 4GGBA 3L4YA 3BSMA 3PZ9A 3WQWA 3FA5A 3WLPA 3AS0A 3RO6A 2DW7A 1D9EA 3O3RA 1L6GA 1Z6KA 3M64A 2A3EA 3TTOA 1T8QA 1SR0A 2G97A 4KMQA 5A6KA 5KEZA 4HOXA 2ZA1A 4PFHA 1DJHA 2C1HA 3W4RA 3BGGA 2NQ9A 1JAKA 3VGEA 4K1WA 3MHUA 3QKEA 4YLWA 2P53A 2YLAA 3IIPA 3GSMA 1E3ZA 3B8WA 3M4HA 1U83A 3TW6A 3MUZ1 2G41A 2H9AA 5AZ1A 4NHVA 5CG0A 2AL1A 5DXYA 4Q32A 3TIMA 2P8CA 4BI7A 3NDOA 1SM9A 1W9XA 1LG2A 3IVTA 3WY1A 2E28A 3VINA 1U5VA 4US6A 4KFPA 3IGXA 1R8LA 2P3EA