4JFTA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor n-desmethyl-4-epi-(+)-codonopsinine
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
total genus 162
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jftA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jftA01
2PBOA 2YDRA 4CD5A 3SCSA 3MV01 3CZGA 4AW7A 5I24A 1Q6EA 3WNLA 3VM7A 3SUSA 3MUIA 3BUIA 1H09A 2V3EA 5FL0A 4GI8A 3RJXA 4LXFA 2GUYA 3BLBA 2AOSA 2BXYA 1QI2A 3UETA 2F1BA 2BY1A 3HJEA 2BY3A 4WIWA 2E9MA 3PZGA 1E71M 2WBGA 4FNTA 2WXDM 1JZ8A 3THCA 3WDHA 2BVYA 4QCEA 1VFFA 4JCLA 4MAVA 4P7LA 3SCTA 3UERA 4CCEA 3DDFA 4H41A 3MI6A 1JNDA 5LA0A 3B9DA 2PF0A 9CGTA 5FD0A 2EPKX 1X6LA 3WH8A 2W91A 1OD8A 4CU7A 2CBVA 3W25A 3IANA 1OGGA 3AXIA 4WSJA 1AQMA 1NP0A 2JEPA 4KWUA 4MNJA 3U5YA 5DT5A 1MXGA 1KCLA 2CHNA 4P7QA 4N42A 3CHDA 2PWDA 2X0YA 3PTQA 4DWSC 3F4VA 5ECUA 3PZMA 3PZOA 3SUUA 3J7HA 3WBEA 2GVYA 4FLSA 1CYGA 2WC7A 1ITXA 3VGFA 2VC9A 4UQ9A 2J8FA 1GJUA 2YBTA 1W3JA 4UNIA 5BROA 2NW0A 1TR1A 4UOJA 2BHYA 3WDJA 1CTNA 3WNKA 3MUZ1 1OD0A 3AMKA 2VRJA 3BVWA 2J79A 3BSHA 4H8UA 1GOWA 1HIZA 1AMYA 3WD0A 4OBSA 4M8UA 1B3XA 2ZX5A 1QX1A 3VGHA 3AICA 2ZUMA 1MFUA 3DYPA 4FNPA 4RL3A 4Z2HA 3RDKA 4H2CA 2Z1SA 2CESA 4ATWA 1BVNP 2QMKA 3BAIA 3KL3A 2FGZA 2XHYA 1E40A 3QHOA 3VD7A 1HX0A 2WVUA 2CERA 5DEZA 1LQ0A 5A2CA 1GOKA 1FHLA 3WNNA 1E6SM 5GNYA 2DQXA 1W32A 4JCMA 4D6FA 4W85A 4KGLA 4PMDA 3SCQA 2CPUA 1C7TA 1UWQA 4AZ5A 3ZJ7A 4PTWA 3W4RA 3O6AA 5I2UA 1PS3A 1ZU8A 3D50A 2JIEA 4HA4A 5ABFA 1JZ7A 1J10A 2XGIA 1QWNA 4H04A 1LG2A 1UR8A 2QV4A 1C90A 3ZJ8A 3BVVA 1R87A 4CVUA 1UR0A 4PUDA 1G0CA 1TQTA 1GQIA 4F9DA 3A6OA 2XGBA 3ARUA 3PN8A 3H53A 1GQKA 5C8BB 4H7VA 1NWTA 4PMNA 3VDHA 2WVSA 2VI0A 4D6JA 3VIKA 3WDPP 4AIOA 3DYOA 3WY4A 3WEOA 3ECQA 1XV8A 2YL9A 1UH4A 1B3VA 3SUTA 1J11A 2VJXA 4OUEA 4ZENA 4NX0A 3ZO9A 2J25A 3T0AA 1PX8A 1LL6A 3SUWA 2D3LA 4ACYA 1OT1A 4JL2A 1WDQA 2YFOA 3WH7A 1E6PA 1TMQA 2EADA 3PZNA 5A94A 1UQYA 3DHPA 5CLWA 2WAGA 1CGTA 1B1YA 2F61A 1J0ZA 4TTUA 1G01A 4JAWA 3AMLA 3GBDA 2OSYA 2O9OA 4HA1A 4P7RA 3GZAA 4RE4A 4QDMA 1EDQA 1EQPA 3WD3A 3WD1A 4FNRA 3NSMA 4FLQA 2G41A 3I3DA 2DH2A 2J77A 5IDIA 3G6LA 1KFWA 1XH0A 3NSXA 1KWKA 5EFDA 3HMCA 2EXOA 4UQDA 1CPUA 1W2VA 4S3KA 4PMYA 1WNOA 3BMWA 1QNSA 3OLDA 1GJWA 4AD5A 3IJ9A 4AD0A 2CIPA 3FAXA 5CSUA 1JXKA 1YHTA 3DX2A 4GXPA 1WAWA 1FA2A 3LMYA 4OZOA 2BNJA 1HJQA 4LQ1A 3DX1A 2ZX6A 2MANA 3A22A 1QI4A 1PX4A 1OGBA 5KZ6A 1JI1A 1EA9C 1KXVA 3KE0A 4J3VA 3VO0A 3VIPA 5A8QA 2ZOXA 4YN5A 1HXJA 1PIFA 5D4YA 4GKLA 1QPKA 4PMUA 5EMYA 3GXMA 1B3YA 3UG5A 5A6BD 1ODZA 3WH6A 5A2BA 3VGDA 1TFVA 3GXNA 1AVAA 4UQBA 4HP5A 3AHVA 1UKQA 1XYFA 4HZ7A 3TTYA 1R75A 2VUYA 4UFKA 3WL0A 4D6CA 2VCCA 3TTOA 2BVDA 1I1XA 2G3NA 4AZGA 2WHMA 3PZUA 2ZXDA 3W38A 4V2XA 3WQ8A 4LYQA 1J01A 2WVVA 3WY1A 4DM2A 2BHZA 4D1IA 2V3FA 1J0IA 5I3DA 5D9OA 1FP9A 3AS0A 1R8LA 1ZBCA 2BHUA 1IV8A 3VMNA 3WNOA 1UZ1A 1V08A 3WEZA 2WMIA 3MSGA 2E8ZA 1GPFA 3ZIZA 2Y4SA 3GXPA 2FHFA 1UH2A 2E9LA 2EPMX 3KZSA 4NZFA 5E9AA 2VCBA 4EAMA 3OZPA 3RCNA 3VIGA 1R46A 3HU7A 2VR5A 4OKDA 4YPJA 4DUXA 2F18A 1KTBA 3F5JA 5A2AA 1DWHM 4DO6A 2XN0A 2RGMA 2QLYA 3AQUA 2VVSA 1WPCA 2E9BA 3AJ7A 1OM0A 3F5KA 3VINA 3WQ5A 1ECEA 1AQ0A 3H54A 1TVPA 2DSVA 1KWGA 1I75A 1L8NA 1BPLB 2XN2A 3SCVA 2X2JA 2X2HA 1EOMA 1OBAA 3POCA 1U33A 4CN6A 2ZX7A 2J7DA 1SFSA 4AWEA 3A4WA 1WCGA 4UQEA 1D3CA 3VIOA 3NYDA 1E5JA 1Z32X 4RE3A 2FHCA 2WZIA 3EMQA 4CD6A 3WMSA 3M07A 1KXQA 3T09A 1E4NA 3CZEA 4AZCB 2BXZA 4D6IA 3WENA 1BYAA 4GIAA 1C91A 4H8HA 2ZUSA 5I77A 3EJUA 3AMDA 1HN1A 1ZB5A 3TA9A 1GUVA 2HVMA 4KGJA 4Z2KA 1V3IA 4F79A 2GSJA 3WDIA 3IJ8A 4JFVA 4X0VA 3PZ9A 4TX6A 3WMCA 1CGVA 2XM1A 1EO7A 1UKPA 1BGGA 2YFNA 3ZOAA 2JE8A 4J7RA 3S2CA 1UR2A 1GVIA 3WY2A 1M04A 1WDPA 1ISZA 1HXKA 1UWSA 4PN2A 3WF3A 3QHNA 2AMGA 1JFHA 5D9PA 3NDYA 2WMKA 1YQ2A 2OLHA 1CXIA 1EO5A 4U2YA 5I78A 2WMJA 2E3ZA 5CG0A 4BZYA 2QPSA 4B3LA 3BAXA 1EHAA 4U31A 4DO4A 1XCWA 1CECA 3LX9A 4W93A 1E1FA 3WQVA 1JDDA 3AYSA 4MJ2A 1JYVA 3WELA 4JKKA 3CV5A 1Q6FA 5BCAA 3ZJ6A 3T2OA 4AC1X 3AHXA 3VSUA 2C8NA 1O7AA 2ZX9A 2CEQA 1GHSA 1TCMA 3GDBA 4IPNB 2DPEA 3LRMA 5DO8A 2GJPA 3K46A 2VMFA 3MU7A 2PBGA 4YHEA 4N0RA 5FKYA 1VFUA 4AYSA 2CXGA 8CGTA 5IXEA 1GHRA 3AS1A 5GNZA 3AXHA 3SIMA 5JBEA 3WFZA 1KGXA 1ISVA 2QHAA 2XPKA 1KGUA 1B90A 2WCSA 1KBKA 3DX0A 4UFHA 2WSKA 2CKSA 4Q22A 3K1DA 1X1NA 1QOXA 3H55A 5A95A 4J3WA 1W3HA 2JEQA 4P8XA 2W62A 3RJYA 4B15A 5CXPA 1EDTA 4UZSA 1UD6A 3W82A 3VDCA 4A3YA 1BF2A 4MDOA 4DUVA 3W24A 3TOPA 1J0JA 1ZL1A 4MAZA 5DMYA 5A8NA 1WZLA 3VMOA 1TQWA 3ARWA 4P7NA 4YHGA 4HOXA 4FF5A 4PBGA 2FH8A 3A5VA 2CETA 5ABGA 1FOBA 2V38A 4GI9A 3FW6A 3U7VA 1FFRA 3PTMA 1E1EA 3SCRA 3AZSA 3BC9A 3SUVA 1KR0A 3AS3A 3BLKA 4CN1A 2WM0A 1E73M 4Y7EA 2XM2A 1W1TA 1IZJA 4S3JA 4J28A 3GXFA 2WCAA 1R7AA 4GI6A 4E4PA 2WNWA 5M17A 4A4AA 3AIBA 3FNDA 1VF8A 1OB0A 4ZE4A 2Y5EA 4TX8A 3A47A 3BVUA 3WBAA 3K8LA 2XN1A 3D51A 4GZEA 1HKMA 2D24A 2PWFA 1KBBA 4CKQA 3A4AA 1XD0A 5TD4A 4AZHA 1C92A 3RM9A 1PJ9A 2X2YA 3AIEA 4TOQA 3WD2A 3SEPA 1BG4A 4FLOA 5A6SA 4HMCA 4P7OA 3MS8A 5IFPA 4NZJA 1OT2A 1PPIA 2JF7A 3N1AA 4ZE5A 1CXLA 2O9PA 3B9AA 5CLTA 2DSZA 5DFAA 2WMGA 5HOSA 6CGTA 1MW2A 2J7EA 1XH1A 1UD3A 3W0KA 5M3WA 4WKHA 3B8SA 4JKMA 1U2YA 3IK2A 2VZUA 2PI6A 1QI0A 1JDCA 4A3HA 1W9DM 3CIVA 4Z2JA 5A3HA 4KRUA 1UWRA 3CZNA 4F66A 3W28A 1CGYA 2WKGA 1PZ3A 3OLEA 4R27A 2X05A 5BXSA 2VTFA 1XD1A 2VZTA 1UWIA 3MO4A 5A6BA 1UD4A 2VVNA 2CKRA 2VX5A 2GDUA 4HOZA 5I79A 1ESWA 1E55A 2OWCA 2VOTA 1K9FA 3S5ZA 5I0DA 1QI5A 1W1PA 1PAMA 1M01A 5LA2A 1E6QM 1CBGA 4JFWA 4AXNA 2A3HA 4QFUA 3D4YA 3QGVA 2W66A 4TVUA 1CWYA 3ARTA 2D0HA 4ATDA 5JIWA 4XX6A 3VSVA 1V6XA 3D52A 5D9NA 5EB8A 3CPUA 1GORA 1VBRA 5BWFA 1W3LA 4OJYA 1CXFA 3W29A 3VGBA 1IT0A 2VZSA 1QVBA 4EKJA 2YBUA 3EJSA 1FP8A 4GPNA 4E8DA 5CPSA 3AIUA 1TUXA 3MUAA 4QAWA 1ISWA 1KR1A 2EEXA 3AOFA 3NDZA 4M81A 5EBAA 1NH6A 2XVGA 3UCQA 4MPKA 4TVDA 4PSRA 1VBUA 3CUJA 3G6MA 1KXHA 4HU8A 1KB3A 1E43A 1DTUA 1KCKA 2JFEX 3GXTA 3ARXA 3MV11 4U5IA 1HL8A 3SURA 3PZVA 1ODUA 4KMQA 3MKKA 4UR9A 4BQ5A 3POHA 4W84A 3EDDA 4CVWA 2UY4A 1E56A 1WE5A 1OINA 4FK9A 1NARA 1MQPA 2W92A 3VOCA 2V5CA 2WZHA 5F7UA 4W8AA 2FDMA 2J62A 3RO8A 4B3KA 2OW6A 2D23A 4U5KA 3LXBA 4UZUA 3VDAA 5CSYA 4MJ4A 2O9RA 1G5AA 5CJ5A 1D2KA 4W86A 1EHNA 1DWJM 3VTRA 1SZNA 3LXAA 5C71A 2D1ZA 3OA5A 3EDJA 5CGMA 2DSWA 4HMDA 3BAKA 1B2YA 4AMXA 2WMFA 3AIQA 4LYRA 1GZJA 4BQ3A 3VSTA 1H11A 2OWWA 1CIUA 3AHYA 1QHPA 1EDGA 3FHQA 1ZBWA 1GQLA 4MB5A 2G3MA 3A24A 1C93A 3FXYA 4AD1A 2UY2A 1N82A 1JFXA 3UG4A 4OIFA 4C7GA 3DYMA 2FE0A 4PMOA 1MW0A 1JDAA 2J47A 1G9HA 2WKLA 3UEQA 3ARSA 1FH7A 1OCQA 3VNZA 1WKYA 2Y8VA 3BVTA 4L4PA 2WLYA 3W81A 3ARPA 3OB8A 4IISA 2QMJA 4AZ7A 1V6WA 2ZIDA 2JIWA 3CZJA 5GNXA 3L4UA 4JHOA 2IXUA 2XUCA 2DT1A 1C8YA 2J7HA 1XGZA 4UQAA 4NRRA 1F4AA 4JFUA 1OGSA 3WMBA 2NSXA 5LA1A 1JZ6A 1W9UA 2YDQA 4W7WA 1K9DA 3U7BA 1G1YA 1W9XA 5CZKA 3BAWA 4MB1A 3ARRA 1E6RA 3TONA 2YL6A 3NUKA 5I5RA 1CENA 2EABA 4JFSA 1KQZA 1V0NA 2DDXA 3BXWA 1JF6A 4W8LA 4M29A 1TZ7A 1J0YA 1BG9A 2A3CA 3AISA 1E6ZA 4BS0A 3KWXA 2VO5A 1SR0A 1VIWA 2BVTA 4EK7A 3BAJA 1CGUA 2D0FA 3L2LA 3GNPA 4M1RA 4UFLA 1QNQA 1BFNA 2DSUA 4NSBA 2DEPA 4UOQA 4D72A 2Y8KA 1Q6DA 3CLWA 1JZ2A 3LPOA 4QLKA 5FIPA 4AMCA 1M03A 2D22A 4LPCA 1LG1A 2CHOA 4CCDA 2DGAA 4K68A 4BF7A 1ISXA 3DX3A 2CBJA 5BYWA 5JBDA 5EFFA 1M53A 4MB4A 2PB1A 2J4GA 1E4IA 1GVYA 4KRTA 4XZBA 3MSDA 2WMIB 3OGSA 2O9TA 3QOKA 1OIMA 1KGWA 1V02A 1UUQA 2EPNA 4IM4A 2PC8A 3SCWA 3ZR6A 2VURA 4AEEA 2QPUA 1ISYA 1QBBA 3PTKA 1OWQA 4XV0A 2X09A 1UD8A 2ZICA 1B3ZA 1U30A 3VX1A 1CXEA 1VB9A 1J18A 2CNCA 4JL1A 3ALFA 3GNOA 2VQTA 3VUPA 1GCYA 1S46A 3CUIA 3DC0A 1G94A 5A6MA 4AD3A 1SMAA 2ZX8A 3BGAA 1PBGA 2ZXAA 3EYPA 3N9KA 5FL1A 1KTCA 1V3MA 3PZTA 4AIUA 3S5YA 2GJRA 2F1AA 1SMDA 4WKAA 5A69A 4W5UA 4AIEA 2YL5A 4HOWA 4OBRA 1HKIA 2VRKA 2YLLA 3APGA 1UKOA 3RM8A 3K4AA 3ALGA 1HT6A 3WF4A 1US2A 2X1IA 2WHLA 4E2OA 1H0GA 4ZXLA 2WANA 2WHKA 1BSIA 1JL8A 5D9MA 1QW9A 4HA3A 3OLGA 2ZUWA 1AQHA 2E40A 4DUWA 4Q7NA 1E4MM 4PCSA 4NF7A 2EBNA 4D6EA 1TQUA 4J3SA 3EBVA 2V3GA 3E1F1 5ABHA 2XFYA 5AC5A 2XVLA 1V03A 1Q6CA 3VU2A 5DF0A 5A1AA 4W89A 1GQJA 5IHRA 2UY5A 4U2ZA 5D8ZA 3N17A 4QP0A 1BLIA 4WJXA 2QF8A 3T08A 3VKKA 2VZVA 2GDVA 5JBFA 5AYBA 1WB0A 4GQQA 1E70M 3UG3A 2V5DA 2XFFA 2ZXQA 4UFIA 4GINA 2WMHA 4M80A 4WLCA 1XRVA 2CBUA 3SCNA 8A3HA 4LX4A 4PMQA 1E15A 4HZ8A 1ZS2A 3VNYA 1H4PA 3A4XA 1BYDA 2YA2A 3VMPA 1M7XA 4U3AA 4XB3A 2XJ7A 1CLXA 3FY1A 1LJYA 3M46A 1UA3A 1GNXA 2XVNA 4FNUA 4UQCA 1BTCA 4UOZA 4D6HA 3PZIA 3ZR5A 4CN4A 2YJQA 2ZUVA 3IGUA 1TA3B 1RPKA 2F7RA 3L4VA 1GOMA 4PMZA 2OSXA 2VNCA 2VCAA 3GH4A 3FHAA 1VRXA 2WHJA 3SCUA 2J8GA 3QHMA 1RP9A 3KL5A 5BXTA 3UR8A 5A6AA 1FFQA 3AIVA 3HZ3A 3CHEA 1JAEA 2YDSA 3QR3A 3N04A 4ML4A 3GH7A 4WF7A 2X0HA 3CUGA 5A8OA 2EPOA 1LLOA 1WZKA 1E6XM 4AEFA 1E5NA 1JI2A 4B9ZA 6A3HA 1A3HA 4D1JA 4MNKA 3WUGA 4Z2GA 4JIEA 1E6NA 1J0KA 2GK1A 1CGWA 1HF6A 2DIJA 2VRQA 3N12A 3I3BA 3IAQA 1JD9A 3OIHA 4R5EA 1EH9A 1W2PA 1R7OA 3OZOA 4IPLA 3BLPX 2AAAA 4FLRA 1TQVA 2EJ1A 1CLVA 3CMJA 1QHOA 1BVZA 4BQ2A 3VD9A 1QBAA 1EGZA 4PRWA 1NWSA 1IZKA 3WH9A 1UR4A 2EQDA 4W7UA 1PX3A 2C0HA 2G8ZA 2XTKA 1WP6A 3VIFA 3WD4A 2OYMA 5C70A 2O92A 3WUEA 1UKSA 3CUHA 4ACZA 4CUCA 3VILA 3ZSTA 2BY2A 1HWWA 1V3JA 2VX7A 5FOOA 3TTSA 4AD2A 2XIBA 1FHDA 2Y2WA 3OG2A 3WQWA 2E4TA 2WW5A 4J3TA 3BSGA 3EDEA 1E0WA 3AMGA 3ARVA 1VEOA 3HG2A 4GQRA 1UKTA 3AMCA 1J12A 3CH9A 2J7CA 5HNNA 4UCFA 1ZBVA 4NRSA 4CCCA 1NM9A 1FH9A 4CU8A 2ZWYA 1Q4NX 3TV8A 1MW3A 1UOKA 4M56A 4OGZA 4JHZA 4WKFA 1H1NA 2ZUTA 2WYSA 1QW8A 1H5VA 1QNPA 1WZMA 4HMEA 3CGTA 3WFLA 1NOWA 4C7FA 1H0IA 1ZBKA 3N13A 3PZQA 1EIBA 1GONA 3OGRA 4CU6A 3L2MA 2OYKA 2OWXA 1CNVA 1XSKA 2X2IA 3LXCA 5HBFA 3RMEA 1JG9A 2WCGA 3W26A 1B31A 4MNMA 2IGTA 6TAAA 1JAKA 1KQYA 3DX4A 4J3UA 1NQ6A 3LPGA 3KLKA 3VX0A 1BAGA 1W9PA 1LF1A 5BXRA 4PUEA 4CGTA 3WL1A 2HISA 4WK9A 2W5FA 4AZIA 4NXSA 4W88A 3MMUA 3VGGA 3W53A 3BCDA 3CMGA 1JD7A 3ZT6A 1K9TA 4J3XA 1H41A 1PEZA 3GNRA 1XHGA 4MDPA 3VIIA 1UWTA 3ZQ9A 1DWFM 1D7FA 4XUYA 1WZAA 3WDQA 3UR7A 3ZM8A 1E0VA 3WEMA 2DIEA 5ABEA 4FMVA 5HXMA 1TA3A 2FH6A 3A23A 5GQBA 3EJPA 4TTGA 1CXKA 1ITCA 1HL9A 4W87A 5M03A 3A3HA 1XC6A 1V6YA 1L0PA 5I23A 4PCTA 3WNMA 2WB5A 5CGTA 4HU0A 4UFJA 1WO2A 3VIJA 1UYQA 3BAYA 4EANA 3JUGA 4GZJA 1DEDA 4PSPA 1CZ1A 3M6DA 3KEHA 2WLZA 3ZT7A 1ZJAA 4BCEA 3K8KA 1HP5A 1JZ5A 1SYTA 2GJXA 1NP2A 2F2HA 1V0MA 4HPGA 2V3DA 3EJTA 4MB3A 3LRLA 4JFTA 1C8XA 3EJQA 1NWUA 1XCXA 2J7BA 4XZWA 1JXJA 2VT0A 5CPTA 1B30A 1XSJA 3WSUA 2WC3A 3D3AA 4QCFA 4ZEPA 1HVQA 3FAWA 1HJUA 2F7PA 3K8MA 1V6UA 4ZFMA 2PWHA 3RILA 1LL4A 2BS9A 3DDGA 4LGXA 2YIHA 2Q8XA 3F5LA 1UH3A 3L4ZA 1W9VA 1XH2A 3WN6A 3IJ7A 2J7GA 3AXXA 4DWSA 2G4FA 1JF5A 1V02E 3CZKA 1QWUA 1QHZA 3WUFA 1VJSA 5FCZA 3MMDA 4Z2IA 4H8VA 2YLAA 3PBGA 3AFBA 2Y24A 3T2QA 1HTYA 2J78A 2NT0A 2YA0A 2UWFA 2JALA 2J74A 4M82A 1WDSA 1JGIA 3W27A 3GBEA 5BRPA 1E3ZA 4RE2A 4TUFA 1OIFA 3EJRA 3EDFA 3ZT5A 2ZXBA 2A3BA 3BUDA 4U33A 7A3HA 3WUBA 4DO5A 1TQSA 2C7FA 1LWHA 3NSNA 2J75A 4PMVA 1V3LA 2WZEA 4W5ZA 3CC1A 3TP4A 1CXHA 3B9EA 1NWRA 4TXEA 1BHGA 5IHSA 3CBWA 3ARZA 4PTMA 2G3IA 1UD2A 4AYGA 1W91A 1W1VA 3L4TA 1XYZA 4DM1A 3GXIA 1R47A 5ABFB 3RM4A 1BYCA 2WC4A 3ZSSA 5HDRA 5A8MA 1MW1A 5KEZA 5I6SA 1R33A 1E9LA 5E70A 1R86A 3ARYA 3CHFA 5A8PA 1VAHA 5BXPA 1V3KA 3K4DA 1HJVA 4CD4A 1V0KA 1GOOA 1OSEA 3W37A 2WVTA 2YKKA 4L4OA 1Y7VA 3GM8A 3RIKA 4W7VA 3FN9A 1P6WA 1WDRA 2B31A 4IUGA 4F9JA 3HG3A 1MWOA 1HVXA 3AHZA 3L4XA 3AS2A 1UR9A 1X6NA 3L4WA 1E4LA 3WIJA 3VIHA 4W8BA 2YL8A 4F8XA 3BH4A 4PYSA 3VVGA 2OSWA 3MMWA 3VGEA 4JKLA 2G3JA 2E0PA 1QI3A 2J7FA 3AHTA 4PMXA 2ZE0A 1HJWA 5E0FA 1HKJA 3CO4A 2EO7A 2ZUNA 5LYRA 4PTXA 3VM5A 1VEPA 1MVYA 1H3GA 3WNPA 1CEOA 3L4YA 1QNRA 2XIIA 5AYIA 2BFGA 5E6YA 3QOMA 1VFMA 4FNQA 4ZXOA 3LRKA 1DWAM 2YOCA 5IFTA 2F7QA 1H2JA 2W4XA 1JYXA 3AZRA 2GJXB 5AC4A 1DWIM 1PZ2A 1VENA 4AISA 3KLLA 2ALWA 2XSAA 1W9BM 2EPLX 1EOKA 2XSBA 5AY7A 5M5DA 1MFVA 3WF0A 4QLJA 3O9NA 2CITA 4BQ4A 1HNYA 4E8CA 2W63A 1QNOA 2FYVA 2OYLA 3TTQA 1K6AA 1R34A 2XYLA 1RH9A 2VL4A 3KL0A 4D71A 2TAAA 4B16A 1UASA 1HKKA 1DHKA 1V0LA 3BUPA 3HG5A 5A6LA 7CGTA 1US3A 4V27A 1KXTA 4DWSB 3LPFA 4UTFA 3NCOA 3U5UA 1H49A 1UWUA 3UESA 2FHBA 3AZTA 1JZ4A 5D8WA 2IUZA 2VZOA 3SCOA 2XWEA 2VR4A 4AZBA 1MQQA 2XFRA 1C3FA 4CD7A 4DWSD 1HJSA 3CZSA 4MNLA 1V6VA 2BY0A 3CZLA 3O2LA 3HG4A 2CYGA 3EMZA 4KH2A 2BV9A 3WF1A 3GH5A 3W6MA 1UG6A 3OGVA 3OLIA 3CUFA 1GOIA 2XG9A 4HPHA 1CDGA 3BMVA 3GTNA 3II1A 3AI0A 3T0DA 2WVVB 1UHVA 3VPLA 2D2OA 5BRQA 3CZ8A 1I1WA 3BVXA 1GW1A 3ZMRA 1B0IA 3WDRA 1W1YA 4GZIA 3BUBA 2WSPA 2X8RA 1FH8A 2ESCA 2DSKA 1A47A 4J27A 3N11A 4UFMA 3CHCA 1J9YA 1NOFA 3HN3A 3AIWA 3WY3A 4PMRA 1PIGA 1DWGM 4OOUA 1UA7A 2WPGA 2XWDA 3ZJKA 3VD5A 2NT1A 3EMCA 2D3NA 5GPRA 2E8YA 5A6JA 4X0NA 3WQ4A 2D0GA 3WH5A 4U3CA 1V3HA 3LPPA 1JYWA 1C7SA 2F8QA 1ZJBA 2WBKA 4MTVA 1F4HA 5CQ1A 4AZ6A 2YA1A 1EXPA 3SCPA 4PEEA 3MUY1 3NJ3A 2GK1B 1T0OA 1E0XA 1HJXA 4C7DA 4TVCA 3D5HA 4B9YA 2W61A 2WWCA 2UY3A 3A21A 3N15A 3U57A 4BA0A 1MYRA 1TVNA 2DT2A 5E0CA 1O7DC 4NZCA 3BUQA 1E3XA 2EACA 1UR1A 1BGAA 4AZCA 7TAAA 1JNEA 1TG7A 5E09A 4OOZA 4EE9A 3THDA 3BCFA 2A3AA 3T0BA 1LWJA 2XVKA 3W6LA 5E1QA 2CBIA 3WF2A 1LL7A 4AD4A 1JYNA 2RGLA 2ZUUA 2CCRA 1GOQA 3GYCA 3EDKA 2Z1KA 1O6IA 1MQRA 1TE1A 2OW7A 5HPCA 4ACZB 4M24A 1BYBA 4HTYA 2WWDA 3IAPA 1JIBA 3WQ6A 3CTTA 1R85A 2D20A 5A6KA 5JUVA 1VEMA 1JZ3A 4D6DA 3WKZA 3S6TA 2DH3A 1RP8A 1VFOA 4LYPA 1K9EA 2A3EA 5E6ZA 1J0HA 1XSIA 1CGXA 3OBAA 3PHAA 1W3KA 2W67A 3N18A 3DHUA 4AMWA 2VX4A 1RD6A 4QLLA 3D4ZA 5JIPA 3VD3A 4CD8A 2VX6A 3VDBA 2IXVA 3M7SA 4MADA 1HP4A 2DT3A 3GXDA 4PTVA 3MANA 2PWGA 2ZWZA 2VQUA 5HPOA 4AY1A 4FNSA 4V28A 3AYRA 3ARQA 2JF6A 4JZ5A 1UQZA 3I3EA 4P8VA 4D6GA 4ATLA 3AIRA 4WSKA 4URIA 2FGLA 4NI3A 1VJZA 4NXKA 2PWEA 1C8QA 3NIYA 1EQCA 1UD5A 4HZ6A 3VIMA 4GO8A 1BQCA 2D73A 3AROA 1E72M 3T2PA 4P8UA 2GFTA 1NOUA 1B3WA 2F7OA 3DECA 1Q6GA 2XVPA 1UZ4A 2WK2A 4Z2LA 2DT0A 5DT7A 4X9YA 4P8WA 2EAEA 1MXDA 4GO9A 1DP0A 3RPMA 5CPQA 1B9ZA 3VD4A
chains in the Genus database with same CATH superfamily
3H2MA 2Y2YA 5AYQA 4HJTA 2PBOA 4CD5A 4DN1A 1JZJA 2PW2B 3CZGA 1WTGT 3N3EA 3KLSA 1W17A 3VNLA 4PR5B 1X9LA 3K1GA 3SBFA 2FWOB 5JORA 2ZWLT 4KEZA 4ABQA 1QNIA 2B0SH 2V3EA 1X1ZA 5F7EL 2BNQE 3GSNB 4OI9A 1L8PA 1AIFB 1JGVL 3HE7D 4GI8A 4OZFA 3QXBA 4WZ9A 5ITFA 4FX8A 3RJXA 5DA0B 3LHTA 2VL5A 4PJDF 3GMMB 2BXYA 2JB5L 2CUHA 3H7UA 1AQDB 5DXWA 4KTDL 3T8VA 4DPCX 1DFBL 7XIMA 5DK0A 4GKTA 3NAAL 5AZ2H 5J12C 2BY3A 2FWLB 5FCUL 4LANA 5I1JH 3UAFA 4GUPA 2I9LB 1H1YA 1FSKB 3CFEB 4GY4A 2VEPA 1HG3A 5FSEC 1E71M 3OGOE 4RBPK 3HMXA 3KRSA 1UQSB 1OL0A 2MPAL 3SYCA 3HC0B 3WDHA 5HVGB 2CJUH 2EIZA 4JCLA 4XKYA 3MV8E 3QXDA 1DBBH 3GC4A 2FJSA 2DMCA 1F9CA 1XKYA 1KELL 3GLAA 4IRZH 5CNHA 3RIAK 3S3CB 5CFHA 2NXYD 5FKPB 5CCKL 4GISA 4JRFA 2UUDK 2DL2A 3MI6A 4J2XA 3BP4A 4E36A 4F7PA 5HATA 3B9DA 3PWLB 2PF0A 5EC2B 5C0JB 2ZRVA 5HYQB 1JSYA 2QFRA 3BTNA 3DOSA 5E2VH 1NSNL 3MACH 1OD8A 2F6KA 4ZXBD 3WK0A 2JXMA 1EBPA 1OO2A 2XKUA 4NJAL 4U6YB 5AG8A 1GZGA 4N9OB 1NGZB 2YXWA 5F7DB 3CXDL 3V6OA 3FB8A 3OF6D 2FB3A 4WSJA 1T5KA 5LHEA 1AR2A 2IQAB 3JV5A 2Y69B 1XLJA 3U5YA 1QD0A 3LNFA 5A2IH 3VFPA 5DT5A 4ZPTB 1TE6A 4F2TA 2CHNA 2DL9A 5EU3A 4G7EB 3UJJL 3WKML 4XODA 2W9EL 4P4KA 4XE5B 3CHDA 3EG9A 2VXSL 4JDTL 2X0YA 2WLKA 4NAJA 3F4VA 3KBJA 4BYHA 3MKCA 2CZEA 3FQUB 4Q0XH 5I74B 1PKOA 3PZMA 3OAZK 5DVLA 4IFKB 2DICA 3UD6A 3FOLA 2Y1VA 4P2QA 4RW3A 3J7HA 3DXAD 2XWRA 4PCFA 2OULB 2WJDA 1WFOA 2C18A 5F9DC 4DQAA 2HXUA 5H91A 1TU2B 3B9VA 4QO1B 3QORB 2Y22A 2X4NA 4LCWB 2AVFA 3B6SA 5IB4B 1TQBC 4J12A 4RUBA 5LIWX 3B4UA 2ICWJ 2YUZA 1BECA 3V4UL 4AQOA 2YBTA 4JPSA 5BVJB 3BOLA 4EXBA 4QHMB 4YJZL 1TR1A 1IQDB 1F6AB 2AVGA 4UOJA 2OL3L 4Z7QE 3QEGL 1MHHA 4HEME 3GD6A 3K2MC 5FF7A 4LQFL 1BZ9A 1TWIA 1RZFH 3H56A 4U6XA 4R7DA 3SB3A 1NCWH 2X4RA 3N1QC 1I60A 3CB8A 3TCSA 3HC2A 4DAGL 2F7FA 2HTLD 3CLFL 4XXDA 5D1QD 5D96B 3D0LA 2YAHA 2FBRA 3AREA 3BSHA 1H3XA 2XH7A 2ZDRA 4XNUH 3V8OA 1HIZA 1N5AA 5IHUH 3WO4C 3B0VC 2EG7A 2VDKL 4PP1D 2M8XA 3WS3A 5HHQB 1NL0L 4IPPA 1KBPA 4PGDA 1QLEH 1D9KD 4ZMTA 5I30L 1B3XA 3C60A 1PFOA 3O4LA 5BZXA 2QXWA 5IW6B 2AXFA 5K9QG 4NKMA 3MJ6A 2ZUMA 2VELA 1J05A 4JFFE 1QFPA 1F5ZA 2QR6A 2FCBA 2VWEC 1G0DA 4G2AA 3QRFM 4MA1C 2VGBA 4ONHB 4H01A 4MFEA 4TV5A 1PHWA 2D7TL 4K3JH 5BMWA 4JFEB 1ESOA 2HSIA 3MUUA 4PRHE 1P4LB 3C8HA 5DCCA 5B3JF 3HZMB 1ROWA 2NQHA 2ACUA 2Z1SA 4XO7A 4U1KB 5G2NA 4YTRA 4AJYV 1RUQL 2XHYA 2W79A 2EDYA 3LJ3A 4UBDD 1BQUA 3N19B 4NQ1A 2TSBA 3KVDD 1HX0A 2GK0A 3N44B 2PPGA 4KTEL 5BV7L 3ICJA 1EQWA 4E5XA 1T6WA 1FHLA 3QUGA 3SOBH 5GSVA 5GNYA 4H1LB 1BWKA 1ZLWK 3A9BA 1W32A 5JIMA 1PKQA 2IBZY 1AD0A 4R2GC 3TVMA 4N90D 5KJRH 2VDOH 1DQWA 2YKLL 1NFDE 4LBRA 3S1VA 1BFOB 4KGLA 4AXWB 3W9ZA 5K39A 5FGCB 4HVBA 2DPKA 1N6UA 3LKQB 3TIDA 1CS6A 3IJSB 4XQ6A 5KBLA 5ESAB 3K6SA 2DWDA 2PYEB 3I75A 2VUKA 4Q4EA 2GZXA 3CHVA 1UWQA 2HDJA 4XNZC 2FVMA 4UCGA 4IHOA 3BEVB 5CKAA 4N9GB 1NU5A 4PTWA 3RU8H 4GCAA 1PYWB 5HHXH 1T4KA 4XN8A 1OAQL 4ZSTA 3QQNA 3CCHB 3QIWA 2O5YL 4DGYH 1HK6A 4YLBA 3D50A 1YLBB 5C7XL 5IQMA 1JZ7A 2DVXA 4HA4A 1J10A 2BSRB 4URTB 1QWNA 1NKRA 3VXRB 5HD8C 3BG5A 1C90A 5T91A 3TLQA 4BBWA 4LCQA 4ELDA 4FIQA 3ZJ8A 1HSAA 3BPCB 5H4YA 3HNVL 1HILA 4CVUA 2OSLB 5FECA 4PUDA 2C9QA 2V63A 1F2QA 4HNOA 4LRNH 4RZ6A 1MCEA 4KC3B 4QLRA 1GQIA 4FD0A 1IF2A 1PTGA 2EDNA 2Z28A 3PN8A 4MNQE 2Z0UA 3UPRA 2A6KB 4HC1H 4IU2B 1O60A 4GYJA 3QKEA 2OR7A 3EEGA 2BOCA 5SWQB 4QDPA 4PJHF 1JGLH 3ZE0F 3PM6A 1OP5K 4ENED 5EOCJ 2VI0A 5G4HC 5D1XB 4D6JA 1H61A 1NAML 4OUIA 5LNWA 3WY4A 1ACXA 5D1QC 1QUNB 3E38A 3O6LL 3U1QA 1EJVC 4OCSL 4QMEA 2YL9A 4I5XA 4D9QE 2BSSA 3L3JB 4NPKA 2OX4A 1DQIA 2Z7YA 5FYLH 3P81A 3C5ZA 4JO2H 4YZFF 1CDYA 1TZAA 2GAZB 2VM4A 3O15A 4OUEA 5JO5B 4IDJH 3UBFA 5CEZH 5EPMB 1J8KA 1SN2A 3S9YA 4WOQA 4XOEA 1OM3L 1BBJB 5EBWB 5DWPA 5TH2A 2ONEA 6REQA 3HN8A 3WL9B 4YK4B 1CZ8H 2FT6A 3NCYP 4RISL 3JZUA 1EZSA 2VN4A 5EO1A 5C6TH 3TAOA 3NRFA 4WI9A 5LNGA 3BW3A 3UZJA 2FFIA 1IC7H 4JY6A 2BOEX 2BJMH 1FYTD 4RBPH 1UXMA 3DHPA 4WW1B 2G5RA 3ILPA 3PCYA 3PGCA 4M7TA 2A7RA 4IRSC 2BMKB 4P5TD 4JE0A 1B6DA 4I87A 4Y9GA 4YFLF 1UR3M 2J73A 1GYCA 3BCJA 4MCZA 4Y4FA 3KJ4C 5E24E 4JAWA 4QXUH 3GBDA 3E7JA 4ANXA 3V0JA 5I3HA 2GUBA 2JI1A 2OSYA 4C6LA 1JFQL 2DV0A 3FQYA 4P7RA 2I1OA 5FB8A 2G75A 5DVOA 4ADIA 3QZOA 4BGLA 1ZXKA 5KSWA 1EQPA 3WJZA 3WD1A 1KFEA 4KFOA 4LZKA 5KYUB 1TPVA 4FLQA 2CDEB 1AAJA 3HGSA 2HJKB 1KJ2B 1XF3B 5AVZB 5KAQG 2YSSB 1RAMA 2ATKA 1OZTG 2PRLA 4OFPA 1QRNE 4OLYH 1WAAA 4OH2A 4MWAC 3OKOA 3D39A 5DU7A 5I82A 1ZT4A 1X1OA 3WLRA 3HE6D 2X3AA 4Y2DA 5C09A 1ZT7B 2QJMA 3N42F 1E9OA 2J9XA 1HAUA 3HMCA 4Z7UE 3EX3A 2JIXA 1KJ3L 2IAMA 1T80A 4XZUA 5CZRA 4FEZA 3MLPA 4N8PA 3V52H 4ENLA 4ZSOA 4S3KA 1FVCB 3QIBD 3ES6B 1U3HB 3HPLA 3PJSA 1IGWA 3OBKA 2ISWA 4NN7B 3UAJA 3SPGA 1QNSA 1K4DB 1I85A 2BIIA 3NRPA 1XAKA 1ELSA 3FPXA 3IJ9A 4UB0L 1BWMA 5CZJA 5D2YA 1FH5H 2NLIA 3FAXA 1JXKA 1OAJA 4ICCX 3MX0B 3DX2A 4XT1C 4GOAA 4QRRE 4PJBA 3W1PA 2RQEA 4L1LA 1V7NH 3MZ2A 3L45A 5CINL 3QUML 1NMAH 3ULUC 3E6HA 4DFHA 3ZY7A 3U30C 1RHHB 5JUEH 3SECA 5DC0A 5AAWC 3N44F 1AR1C 5TDNB 3PJUA 1XHHA 2BNJA 1XT5A 4XC3H 2X16A 3HI5L 2ZX6A 1QVOA 2VEMA 4FXTA 1YMMD 3MRPA 1PX4A 2QADD 5TQ0H 4YNYA 2YB1A 2OQJA 4A1RA 3PNWA 4O2FB 2VD9A 1D5RA 1XDMA 1JI1A 1GMIA 5EZOH 5HGAB 3ZYJA 4Y9MA 2VMCA 2BP8B 3UGUA 5EZPA 4NC1C 5KN5A 3WCYA 3SY0B 1ENUA 4WY0A 3CLMA 1ZLVK 4IQLA 1RIVH 5DURB 4MA8L 1HXJA 1PD1A 2XN9E 2JMRA 1E9IA 2BWQA 4Y1SA 3X3FH 2B39A 4JPGA 4BEIA 4HBQA 4C56D 2V6AA 1K85A 2Z6IA 3PUDA 3HFMH 4K71B 3UG5A 3VK5A 2YPVL 3WH6A 3E80A 5A2BA 3GXNA 1S4IA 4G9FB 3VCRA 3PHQA 2EKGA 3HPXA 4FALA 4PJ7E 3KLAA 4GW4B 1RHFA 1UM6H 4UC5A 1XYFA 3MVIA 3LH9A 4HZ7A 3TTYA 1G9ML 1NGWA 3U7WL 3ZJAA 5CSGA 5DBUA 5MENE 3LB0A 2O5XL 2GSGA 3BJFA 3V9EA 2W59A 1IGTA 1BQGA 5AW8B 3D46A 3VJ6A 3NOIA 4U4BA 2ZCZA 4I77L 4UT9H 1CYXA 2V67A 2FATL 2H7WA 3TTOA 1YNKH 1WAEA 2HBXA 2W38A 4HIHA 1WKDA 4HZ1A 2ADIB 2ID5A 1I1XA 1PUDA 4NM4H 3UZVB 3PZUA 4ZUSB 1O9VA 3PAJA 3GFYA 3W38A 1N59B 4LDEB 1KFCA 3I85A 3Q05A 3ABGA 4HVXA 2AJ3A 4DGUA 2GEQA 4EBQH 3KPLB 1PSKL 4HAKA 5E2WL 1PY0A 4NUPA 2WVVA 25C8L 1L6GA 4HWBH 3SKOA 2AEQL 3ILQD 4HJGB 2OTUA 5IFJB 1XP3A 5B7YA 5I3DA 3V4VH 5D9OA 1S6NA 3AS0A 3WLBB 1OZQA 3FULA 1BXUA 4YR6B 4DF0A 5DTFB 1BVKA 3PS6A 4DHLA 4JQ1A 5E51A 3VMNA 1QWKA 3L3OC 5JPNA 1V08A 3WAJA 3EYVA 2WMIA 4ZB2A 3MSGA 3ZIZA 3MT1A 4G5AA 5CCHE 4B3KA 2FHFA 4NAEA 3FTVA 1X5LA 3MNVA 4H5SB 1NC2B 4JFFB 5F7AA 2DWYA 5HI3C 2PKDA 5CU9A 1SHWA 4DTGH 2R6OA 1U41A 3DUGA 6ENLA 3IRDA 1SJEB 2CCLA 1IEXA 3GW0A 4HUKB 2XRAL 1DXIA 2O5ZH 1HQRA 1U8MB 3FB7A 3ZU8A 4AK2A 1A02N 1B4KA 4HUXB 5CSZA 2VCBA 1TJGL 1CD1A 4H3DA 4TL5A 1F3RB 2IBGA 2VR5A 4IIQA 2E9GA 4LMQE 4OFDA 3MY9A 2V8ZA 5DQPA 3TZNA 4OKDA 12E8H 3E2QA 3ME3A 1GZ1A 3C08H 5JHDA 1Z9PA 2C91A 3MJ9H 3A3XA 2F18A 1L0YA 3CVHA 4BE5A 2QPXA 3VQ2C 4NP4H 5I7GA 4JICA 3F5JA 3BIAX 5LZLA 2Y7NA 4RFOL 5HDBE 4M1DH 2OTPA 1A0QH 1JK8A 2WTPA 4WTZG 4X5WA 5DD1L 3OP2A 2OMYA 5CBJA 2QLYA 2H6OA 5I8OH 2ZONA 3BT0A 1Y6NR 2CJSA 2QQQA 5DHVB 5C07A 3SE9H 2VVSA 3AJ7A 5FF6A 3NDOA 1JCXA 4UNLA 1MJ8H 1G7IB 1HXMA 3M1CA 2FEEI 1SZFA 1T40A 1B9KA 4WO4D 5IY5B 1B57A 2QCGA 2OX5A 1IAIM 2GUOB 4YEEA 3QPKA 3DFPA 4L1TA 4K2UH 4MKMA 3VOHA 5K33A 2X2JA 1JHKH 2I24N 4P2VA 3UPBA 2XTJC 3G1VA 3F65A 3M7FB 3ILQC 4D0BA 4HUVA 1L9QA 1WCGA 3W53A 3GTIA 1NBVL 2BOLA 4D0DA 4JY8A 4TXVB 5JIDA 5CC5A 5CILH 1YEHH 1QSZA 4AMKH 3SIKA 4LP8A 3DFHA 3DIFA 3WYZA 2D2CC 3CC5A 5FDWB 2OXNA 1TQCB 4XO8A 5E8OB 5I2IA 1PCSA 4CD6A 3EF4A 3K5RA 3WMSA 1KXQA 1T04B 4PS7A 2CLPA 1I3RA 4YDIH 5KVGH 1T7VA 2DWTA 3GMLB 4PRIE 1VDGA 3RVVD 1E4NA 4D0CB 4Q7DA 5C9JB 2C1GA 1S2WA 4IP5A 2F19L 3INUH 3SDYL 2ABBA 1SUJA 4JM4H 3N2BA 5LXEA 3EIFA 5F21B 5KBDA 3GNDA 1FUYA 3BIKA 4N2MA 1IWBA 2XX0A 3MRDB 4H8HA 3O45A 4XNAA 4UQ2B 1EO8L 4H9UA 4XD6A 3STZA 1T96A 3UYIA 1GUVA 1EEXA 2HVMA 4TUKH 2BNRE 4NGHH 3H9YA 3WDIA 1UWEH 2GSJA 4LMQI 3FA5A 1ZKAA 2IIJA 1TSRA 2WGXA 4PL1A 2YARA 2HZHA 4M48H 4M61A 1L9WA 1CDCA 3Q2WA 5D6DC 4O17A 5AOUA 3L81A 3P3SA 1BMGA 5LCVA 3ZOAA 2WJZA 3WUWB 3P9MB 4J7RA 1VKXA 5E2TL 5D7JD 3WZ0E 5AC7A 5FJUA 2AK4D 2W07A 3VXOA 3OU8A 1T0PB 1T5AA 2J4WH 5D71H 3FIGA 3D2UD 5CP3H 5E9XA 4LCUA 1JGUH 1WDPA 2GVEA 1CLCA 1CLYL 2WMPA 3AWEA 3FONA 2GJ6A 3OMZA 4NQVB 5IMKB 1U3NA 1C08A 5CBAA 1MNZA 3FTGB 5GGTA 1VBHA 3NEOA 1MZYA 3N5AA 4Y2OB 5D9PA 1WIUA 5B21A 1Q90A 1FVDA 2HLFD 3O6CA 2X1OA 3NK4A 4FP8H 1JRBA 2Z31B 2WMJA 4NO3B 3SRHA 4X42A 4P2OC 4PRID 4YXKL 1XS2A 3VYLA 1PVNA 3BAXA 1EHAA 4U31A 3IVKB 4AM0B 1B6UA 4TMBA 4DLFA 1BAFL 2IBZX 2X9XA 3AG1B 3LX9A 2OPCA 4P57B 4E9VA 3REQB 3T6ZA 1U8HA 2GJ6E 1PDYA 3BEWA 3WQVA 1ETZA 1MRFL 4RGMC 1JDDA 3BDBA 2YLKA 2QUNA 2Y5TA 2WHVA 5LIKX 1JPFA 1LDPH 5I8CB 3S2NA 1Z9SB 5D4QA 2PC4A 3T2OA 2AQ3A 2WINB 2JCCE 5IQ9B 2YCLA 1AQKL 5A16B 5H8UA 4JFPA 1QNZH 1WA1X 2N3JA 3F00A 3ME0B 1A7PL 3NQEA 2INFA 4B5WA 1TCMA 5I17A 1OANA 4XAWL 3N40P 2ITEA 2E68A 1A9BB 2GJPA 2G0LA 5SWZB 5DC2A 1KC7A 1C5CH 4S1DD 3MU7A 1QPPA 3OZ9L 2WZ6A 4LE8A 1A9EA 1TLMA 3C5JA 4OCYH 4DWDA 2FK9A 2AANA 2L5HA 1VFUA 1ZHNA 1UPMB 3OD3A 4Z7QB 4AYSA 1J9CT 2CXGA 4YDKH 1UVQA 2HG5A 5CN1A 5J6HB 1SM9A 1Q8MA 2HMIC 3S48A 2DTSA 2BIMA 5IQ7L 1WFNA 2A9NL 3UBGA 3TF4A 1GHRA 3NXLA 2XG4A 3RUBL 4KPLA 5JBEA 5JHDD 1HHHB 1AO7B 2M1KA 3MRKA 4M19A 5A43C 1TEGA 2VCOA 5JXEA 4DP4X 4MOZA 2EH8L 3HHSB 1LE5A 2HAZA 3UO1L 2XBZA 4F2MB 2V81A 4CCZA 3LDVA 3MACL 1FYTE 4LCYB 2O6CA 4FI4A 1HZHH 1PF3A 4MCNA 4N7QA 2V82A 2QVKA 2J12B 5EDSA 3MKGA 4V15A 1DANT 1K5NB 5C5YA 3K1DA 4AY0A 5D7LB 4HZLB 1KFLA 4FOJA 3QRGL 3VQ1C 1NDGA 1UM4H 3H0TA 1A2YB 3B9NA 1I8KB 3WU1A 4ZXLA 4NX5A 2SFPA 4DF2A 5D2TA 2AK4A 1FVEA 2VXSH 3ZTJH 3TEZA 2QCHA 2W62A 1LO4H 3MMTA 2I60H 5C08D 5T3ZH 2V5BA 3LZQA 3SE3A 3GB7B 2VDPB 4UZSA 4OHQA 4WJ8A 1UT2A 1UP2A 3LN5A 4WUUD 3B0PA 2FWOA 3AQYA 1MRCH 4NQEA 1F6LL 1OAYL 5C07E 2WLNA 3TEVA 3QP3A 3WKQA 1QR1B 1HSBA 4GOSA 3ZDXB 4ODSL 4UTKA 4TULL 2C9RA 3LD8B 4QTIH 2J1YA 2Q3ZA 3PV6B 1CD0A 3TYGH 3DJ9A 4AQZA 4Z7VE 2OJZH 3UXLA 3O7UA 3WK2A 1VYRA 2VKWA 1WZLA 3CNYA 3E2VA 3SDAB 4HUMB 4N02A 3ARWA 3D5OF 4YHGA 2QGCA 2Z7ZA 4MX7B 4NO0B 2C7UA 4G8FA 3VDGA 1OC6A 3NEVA 3CZFB 5D02A 2I9LA 4X6CE 4GGBA 4MXWL 3U7VA 3FW6A 1GVSA 1WT5C 3PTMA 2JKJA 3QIUB 5HDBF 3RWFA 3WFHB 4UZGA 3WKPA 2ACQA 2R1NA 1N7KA 4XIAA 3L6FA 4OD3H 3WXVL 1I0DA 3DEQA 5G4WA 5T33L 5FV2A 2EIZB 3BLKA 3FSOA 1D7KA 3D1MC 4PYGA 4NQDD 4MYPA 5DHXB 1EK3A 2QJDA 4JVWA 2DQDL 3D2UB 3MZGB 5T1KD 1A7RH 2WM0A 1WICA 2HPOA 4PJ9D 5G55A 1A7QL 4KZ0A 1MFNA 2FO8A 2HT3C 1W1TA 4S3JA 1GYLA 4IJ3C 3PF2A 1ZGLM 4LLVA 2WCAA 2NXZB 4NQDB 4E4PA 3QUYD 3NURA 3ARFD 3OZKA 4GSXA 5FFOA 3Q7JA 5C0JA 1ZVSB 5LN4A 4OCWH 4H1LG 3W7JA 4N3UA 5ILTL 5ENLA 4KKCD 1Z6JT 3QJXA 3QJHB 1TTIA 1RMFH 4FYSA 3RK8A 2IDSA 4MAYD 1C5DB 2QJGA 1OGTB 3ESMA 5T5NF 2QCDA 3K13A 3TQ0A 3WBAA 2WIIA 2AHIA 4PVBA 4PJXF 2XN1A 1HHIB 2OI9B 1HKMA 2WO3B 4NNXB 4MHHG 1M7PA 5AUMA 2VXVL 1T8QA 5I73C 1Y0EA 5D2LA 4CKQA 1KIUB 4RFEB 4O0KA 5IBXA 4JZJB 4QY8A 2WQWA 2E77A 4KETA 1HNGA 3GSXA 3F58H 2QQLL 1WAAF 3ABLB 1IGCH 3ESUF 2AEIT 3RM9A 1KLFB 3PBYA 5ETUA 3VXMB 3R79A 1HH9B 3DRTB 1T21A 2VLJD 1EXBA 1R24A 1NGPH 1WSST 4XPBL 2W9MA 3MJ9A 3B6SB 4GMSH 4UV7L 5FGBC 1ZLWH 3SEPA 5J12B 2A6LA 5I06A 1S7RB 2MNRA 3WFBL 2NYZA 2ENYA 3ABZA 3GRWL 3FB5A 2VD8A 5C0AE 2EPHA 4AYMC 4PJXA 1RUPL 43CAB 3IETA 3TN0B 3V0UA 3G8EA 3ESNA 4HGWA 4REQB 1W8EA 4MPQA 5AC8A 2BH0A 4AUYA 4J2QA 1SU5A 3EO9L 1MUJB 3IAGC 2HNEA 1A3LH 1FFPA 5CLTA 4U6XB 3W7RA 3I74A 1J8HD 2NNAB 6TIMA 2QVTA 4CEUC 3KH4A 1TQCC 1GYUA 3VI3F 5HOSA 6CGTA 2A74B 3P93A 3FZUD 5I1GL 2N4IA 1EBAA 1UD3A 1R3IL 4HG4K 4PLNC 5AB9A 3AREB 4KXBA 4W9HC 4WFFD 1U2YA 5DRXB 3V5HA 1DYSA 3AT8A 3IK2A 1K4GA 5I16B 4PJ8C 1QI0A 3GMQA 3RVVC 1EP1A 3F64A 1A8ZA 4WI5A 3WS3B 3LTPA 2PPEA 3MNWA 2XTJB 2P88A 1TJPA 1FX6A 1OQFA 3H2EA 3Q37A 3CZNA 1A4KB 3FU7A 3O4LB 3S42A 1U8LB 1FNLA 1CT8A 3GSNH 4QRTA 5E23A 1DYZA 4BF9A 1TTUA 3W28A 2NY0B 2WKGA 4NKMB 1PZ3A 1Z5LA 3OLEA 4FXJA 1TX0A 5AOKA 2X05A 1OTUD 1RUSA 2MHAB 3RUGF 1B0WA 4R9HA 4ONHA 3WLNA 5EKYA 2Y6TE 3TNNB 2O4MA 1XD1A 4JLRA 1UWIA 2H41A 1UD4A 4N2GA 1RSFA 3VXSB 3BT2H 4N5ED 5C0CD 3P4MB 3TQKA 4TQ8A 3W11C 5I79A 4HAGA 1OCNA 1OFRA 2VXUH 3BFQG 3OC5A 3KHOA 4C90A 2HPMA 4NJ9L 4WO4C 2YRPA 2ISSA 5INCB 3T3ME 1K9FA 4DZ8B 5I0DA 4A2SA 1G7MB 5JW4Q 3T8QA 3BI9X 2Z4QA 1AZ1A 3EWZA 1I1AB 3UP6A 1PAMA 4DXVA 1DXEA 5CEZL 2Q09A 5LA2A 2VLRD 2ATPA 3W9DA 1TZZA 3K0YA 3TYEA 1CBGA 3TSDA 3UP8A 2IGFL 2JJWA 4GC3A 5EU6B 1T1WB 1B4JL 1KDIA 3G5XA 1QJWA 1BFOA 1QSED 2I5YL 2CKNA 1LBLA 1H7PA 3GZQA 4Z76A 3TIDB 3LSOA 3WJMB 2Z24A 2BVOA 1QRNA 1UA6L 3SZ6A 1VCVA 3I75B 3QV6A 5F70A 4AW4A 4AFYA 2XG5A 3MP4A 3HC4L 1DLHB 3LS9A 2JTYA 3KWSA 4N9GA 4ZMVA 5JIWA 2XX1A 3VAEA 3WKNA 4MRBA 2B2XL 1MH5B 1RHCA 3CCHA 3QIWB 2OFQA 2FL5B 2WQSA 4GLRH 1N68A 2NXGA 4DOHB 3NVTA 5G4EA 2FGWL 2G4GA 3NGJA 4EPEC 5I73B 3QY7A 4C6CA 5L8JB 1A6ZB 1MZZA 2HTMA 2P1FA 3ITGA 4BI6A 1T1XB 2VGGA 2HTLC 2VGFA 5JMUA 4ELKA 2NLYA 2X1TA 3CNKA 1HILB 1NDTA 1CXFA 1SYSB 1JGMA 4MJMA 4XWGH 1IT0A 1W6TA 2UUDH 2D4DA 4HS3A 5IW1B 2P8MA 1T89C 4EKJA 4HU2A 2I9TB 3CV7A 4IG2B 5BPPA 3BPNB 1JOIA 2ENQA 4GPNA 4E8DA 3RA7L 1DN0A 1U9KA 2Z92A 1E0TA 3FQ4A 4JO5A 2K6ZA 2MOGA 3RHWF 5I8KH 6ALDA 4WFHD 5AWNL 2OMVA 4E42B 4B3ZA 4JB9L 1NH6A 3IF1B 5KVDE 5IVXB 3H9SB 4PSRA 1VBUA 4LNVA 2J24A 5HVHC 3BOFA 4GVIA 1E43A 3MV11 3GTFA 1I8JA 5FACA 3T81A 3SURA 4WUKL 3PZVA 3MOBH 3MKKA 1BBDH 4NUQA 4U1LA 4BQ5A 3POHA 4JGUA 2YPKB 2V5TA 1YJDH 3H2WA 4WGXA 3HS0A 6PAZA 4CVWA 3EHBC 3RJOA 1QUNA 2WZAA 1LO0H 1U95A 1H3WM 2R1XA 1JPTL 3NA9H 3PABA 4JPVL 3VTMA 1N6QL 3KPSB 1OINA 3NG5A 3RU8X 4FK9A 2FZ3B 4XUGA 5A5WA 4WJ5A 3QUYA 4A3QA 2LLNA 4AVHA 5L4IA 3VI2A 4F7MB 2DQJL 3LCYA 5DJ6B 3RUGA 3ZL2A 1A5AA 1AHWC 3O8XD 3E5PA 2IBBA 1NCBH 3W7OA 1Z5YD 4XH2B 1A4JB 4IICA 4FI7A 5IESH 2FDMA 3EO0A 3KOWA 2E9WA 3M43A 3LXBA 4UZUA 4PB3A 1MREL 2NLJA 2R1WA 3O07A 2VN7A 5FA5A 1QYGL 2HH0L 1OOWA 3O3DB 4RXGA 2WXGA 3P54A 4TQHA 4QJ4B 1J9RA 4K7PX 1BQSA 2WXNA 1EHNA 2I56A 3W1QA 4AY8A 2QVIA 5DMJB 1URIA 1ZA3B 2FB4L 2YAPA 1EJTC 3B8IA 4F0HA 3C9NA 1HKLH 3T5WA 4B5TA 2VQ4A 5DFVD 4FJZA 2QLVB 2H2SC 2CR6A 5FFLA 5L8LB 2XWBB 3APFA 4H7CA 3FUDA 2CO4A 4L3EA 4M7ZC 3AIQA 2AXJA 2JKLA 4V1DB 4MKVA 5DUML 1GZJA 3UCRA 1O75A 1NEZG 1H11A 1NEPA 1OF8A 2F74B 2HLEB 3EYQC 4LSQH 2R29A 1MCWM 4L4TA 1EDGA 1KJ2A 1XF3A 1ONQB 1M05A 1U8OB 2ZE3A 4AEIH 3OR7A 1SSGA 1AO7D 3QQ9C 1LBFA 5TBOA 3S6CA 2IQ9L 3P69A 4MB5A 4WVRA 2YEZA 4YDVB 4DN4H 1D5ZA 2N7SA 2LABA 3ML9A 3GKZA 3P40A 3WIIH 5XIMA 1ZT7A 3OKMA 4NFDA 1F76A 3W2JA 1SYVA 4Y2LA 4FA8A 5KS9E 4C7GA 3Q5OA 5A3IC 15C8H 1TZIB 3QCTL 5IJKC 2CLHA 1IM9B 1CR9H 3BQ5A 3WG6A 3DIDA 1HH6B 4Z1PA 4DIXA 1FVCA 2J47A 3VNDA 1UWXK 3KLHD 3CVHH 3KJ6H 4K3EL 4Q3MA 4ERIA 3WBYA 4OKVA 1RXOB 4ODVH 3CL6A 4Z3HA 1FH7A 4OFYA 4O4WA 4QHKI 2J5WA 2WUBH 3FSUA 2OZ4A 5IMMA 1WKYA 4YPGB 2Y8VA 3GDTA 1PSKH 3QJUB 2F6UA 1UATA 2UZPA 5BZWB 3O3UN 4JJ5B 3T2NH 1D8WA 3DDMA 2ZOWA 3HE6C 4K3DH 1UUOA 4GXUN 5E6SB 1JCYA 1V6WA 5KSBF 2ZUQB 1QMLA 2G2RA 2XXMB 4YWIA 3OV6A 3CZJA 4BQ6A 3M0MA 4PWJA 2FIQA 5KJ7E 1IKNA 4B91A 2YDAA 1HI6A 1KV5A 3WJSA 4IGMA 4HWEL 3O4LE 1QVOB 2XV0A 4ZW7A 1XGZA 5CU5A 2F68X 3RIFK 4DPQA 4P2YA 1F4AA 4YNYB 4EZJA 1FIEA 1RZGA 2I7SA 3QFDB 4YCOA 2OMXB 1XLLA 1Z7AA 3W7LA 2AQPA 3AW5A 5H37A 2YDQA 5XIAA 3DETC 2DV6A 1MF2H 3U7BA 4FG0A 5GSRA 4EDWH 1G1YA 4HT1L 1ML0A 3NIGB 2P24A 3MODH 3N9GH 3P11L 4Y0GA 3IJYB 1A6TB 1FFOA 3TNMB 3JQOB 4IJRA 2WLMA 2OCZA 3MRGA 5JHLA 1BKSA 1QASA 1IEAA 4LEFA 3ARFB 3ARRA 4X4MA 3NUKA 3TONA 1CENA 3S9ZA 2FX8H 5GRXG 4WHYG 1V0NA 3UQNA 1OFDA 2VLJB 1OC7A 2IKHA 5HYJE 4M29A 3OHXC 3HRZC 4J3OG 1TZ7A 1ZFJA 5FLUA 3D3FA 3KXQA 5AVWB 1LK2A 2HJFA 3U9PL 5J13B 4ALDA 4CCDA 1EWDA 2GKIA 4L3AA 4WUUE 5ESQA 1FDLH 5C0BD 5CJXA 3NOEA 3NIGE 4DETA 3KWXA 2VXQH 2GIMA 3FQNB 4IMLA 4GQZA 5C0BA 2VO5A 5CR8A 2BLEA 3QNYB 3WLKX 2BVTA 1FDJA 2J6XA 1CGUA 4UFLA 1TPXB 2NY1B 2FIKA 2XY2A 4IOSD 1QNQA 3ASWA 3S36X 2AJZA 4HXBL 3VCLA 1SOQA 3UZVA 2P46B 2RGSA 4PJFF 4Z7NE 4DI9A 1CFNA 2L7EA 2MRYA 3EYOA 1JULA 1N59A 3TH2T 2Y8KA 4W9GC 4Z1CA 1IXOA 4Z3JA 2I7OA 2NX5E 3KPLA 4JY4A 4N6QA 1XF5A 5REQA 5FIPA 2VDPL 2ALAA 2YQBA 1WFJA 4WW2B 1OVZA 1TTBA 4LL1A 3UJTH 3GZKA 1EJUC 1KW1A 1PQZB 1OP3H 1A3QA 3CS2A 3WQEA 4M1CC 5KOVC 1MI5E 1RU9L 2ICWI 4K68A 4S38A 4BF7A 1ISXA 3U0TA 4BR1A 5EOCL 3DX3A 5E8DL 2IPWA 2CBJA 4QAIA 2OTWB 2NXIA 4WNJA 1E1CB 1SFLA 1N10A 2JBMA 2X2GA 3I9IA 5EFFA 1W3NA 5JBDA 1M71A 4MB4A 3PVFA 1VLXA 1OP3K 3VOFA 3WEAA 1E4IA 4ODUB 3Q2LA 4JM4L 2LGNA 2WMIB 3M4HA 3QOKA 4GMTL 5U4NA 1FYTA 5I0VA 4G8IA 3OYXA 2Q76B 4IM4A 2P3ZA 4DZBB 2PC8A 3SCWA 5FYJL 1AHWB 3MV8A 4JM2D 2BSTA 4KRPB 4X7SH 2ZQ0A 1QBBA 3EXJA 1OWQA 2NVAA 3CXHJ 5IM7B 2XWCA 4NJKA 2DQTH 3RVXC 1GGTA 3B7RL 2ITCB 4HK3J 3A5FA 3C6LA 1TJIL 5DVKA 1VB9A 3FQXB 1H19A 3JTSB 4P5SA 1ZWIA 4U6HA 1AH3A 1PZ0A 1VCGA 1CD1B 3DAQA 2QHLA 3MV7A 2CNCA 3RTLA 4ZFCA 2JFCA 1ADWA 2IFFL 3N1PC 5EU6D 2J6EA 3G7TA 5JHDB 3VUPA 4H6RA 4LKCA 1J9TA 2GJZB 3FS9A 1NKOA 1SDDA 2G5WA 4D9PA 4DP6X 4LS0A 5A6MA 1PTAA 5LG6A 4AD3A 2OMYB 4J5VA 3WEBA 5E9DD 2X6CA 4HHWA 2XXFA 1SMAA 2ZX8A 4XRCB 5F9OL 4Z7QF 5AZUA 3KBPA 5EN3A 1PBGA 4E9XA 3VZYA 5EF0A 1MXSA 1WISA 3FKKA 3EA2A 2X6BA 4GBXC 4KFZC 1DL3A 4M51A 4Z95L 2GJRA 3J27A 3OF6A 2F53A 1YKWA 1YYLH 3FMGH 4GS7B 4AV0A 3DIPA 4HCGA 1H3PL 3W2MA 3VFUB 4K94H 1UMLA 2IV9A 2HJLA 2VWEE 4OBRA 4P5KB 4X50A 4L0ZA 1EANA 3KVJA 2Q01A 1FDYA 4PJ8B 1HCVA 4FDWA 5IP4A 2YLLA 2VENA 4OLZL 4HFWB 3GMPA 4M3HA 1K8YA 5F7NC 5GZND 3HC3H 3DI2B 1QLRA 3RWCA 2HP4A 2Q8AL 4YHZL 5E8OA 5I2IB 4R53A 4HLEA 1WTLA 2HS6A 4F24A 3EEZA 3NWRA 2YZ1A 3UJSA 3ZMNA 1H1ZA 4YSDA 3WF4A 1OF6A 1I3RB 1WZ1H 5C6MA 3IPFA 3AGVA 4XE0A 4JN6A 5CFAA 3PHSA 2Z31D 4AVNA 2WXLA 3O6KH 4KK9D 2OKTA 3L68A 3L9CA 5A40E 4QNEA 1QW9A 3ZHFA 5IV2A 5FUOH 2R14A 4JTSA 1J1PL 1UM5H 2D7QA 5D9SB 3ZBMA 5KS9B 1RCQA 1AC0A 1TCRB 3DUUB 4W9ZA 5C0RH 5E8EA 1CBVL 1E4MM 3STZB 4B0MM 2B1HH 1M5WA 2WXRA 3HM7A 4D6EA 3NMEA 1HINH 5LIUX 1A64A 3T07A 2EC9U 4L5FL 2X42A 4JRXA 3EA3A 2Y6SC 2XVLA 1R3SA 1V03A 3OO2A 4EJ1C 1HL2A 1M2VB 3VTAA 3OZYA 1X4XA 2VERN 2R0KH 3TX4A 3VU2A 1VCFA 4QBXA 3SCRA 3F8UB 5CBEA 3TV3L 3KX6A 1GQJA 3WLQA 2LQRA 3MXVH 4P2RB 4LCUB 2UY5A 4UQ3B 1WAUA 4Z42C 4M3JA 4YUEL 1J5OL 2ZSVA 4QP0A 3CFBA 5CJQL 5D8ZA 4RGNC 4ELME 2EUXA 2JB5H 4OF5A 3L7EA 3T08A 2VXNA 2VZVA 3SQLA 3VKKA 4O2CB 1RALA 1W31A 4JFZL 4JYFA 4L37B 4LOFA 3EO1B 3EOAA 2R9HD 2AKMA 2GTWA 1ZSDA 5ANME 4LB8A 2G60L 2ZXQA 3WS6C 5LGJB 4JE4B 1XCFA 2IPKB 3BJLA 2XFFA 1N18A 4IIQC 1U5VA 2HX8A 3M16A 2WMHA 4UFIA 3WMLA 1AL8A 4WLCA 2LAAA 3STLA 3OEXA 4N68A 3QUHA 1LO2L 2PTXA 4DO7A 1F3TA 4J40A 4XAKD 3G22A 1MVFA 3HE7B 3RNQA 3WE6B 3KBMA 4G6JL 1D7CA 2BWGA 2XVBA 1ZS2A 2FR4A 3BGGA 2DDQL 3AQDA 1BYDA 4Q6XA 1GIGL 4LOEA 3TH3T 1U8NB 4U3AA 1MCSA 4D94A 3HI6L 3Q8FA 2BSED 2XJ7A 2D31B 4RXFA 3TZFA 3DPBB 3GYEA 4O50A 3NR0A 4FA7B 3N1GC 4FNUA 5F44A 4HJEA 1AFVL 5F89B 3ME0A 1YA5A 2PDMA 3EH2A 4APQD 4XNQA 3U4AA 1BTCA 5IBLD 1XDJA 3HNSH 1VFLA 4D6HA 3OGCA 1XUUA 1W54A 1A9BA 3ZR5A 3MAWA 4IRSD 1TO5A 4PH8A 5IEKB 2YJQA 4XMPH 3P84A 1OXYA 1G6RA 3IGUA 4PW4A 5DZVA 1TJMA 5L2KD 1W0MA 4DNHA 3T1FB 2GABA 2B1AH 3LM7A 3L4VA 1URLA 4FMFA 2HVNA 1QAWA 1A6VH 1EEZB 2VNCA 4X5PA 3AY4A 1F6YA 5J6HA 1W1IE 2NWSA 3AB0B 2NQZA 2DQDH 3IUDA 3ETTA 3FHAA 3H42L 4B3VA 1VRXA 1XGQA 4HT3A 2XG4B 4YSSA 1FWNA 1OQXA 1IJNA 1A8JH 4WOZA 3GC3A 2BFVH 1XWVA 4ANVA 3BXNB 4NYYA 1RJCA 3BMXA 3LGEA 3DGGB 4RVBA 1FV1B 2ESVB 2BHFA 3HZ3A 3ROOB 2IALA 2PYEE 1X9UA 4ORGA 1D9EA 3WG7B 3ANVA 4BF5A 4BFNA 4IIBA 4BELD 4WF7A 2X0HA 3B9KB 1K5NA 2E6FA 3D18B 4GXMA 1NLBH 4UTJA 3EUDA 2EPOA 5A8OA 4YAQA 1GZQA 5TK2A 3FUEA 4ODBD 4YQXH 4X9SA 1I8KA 1LLAA 3RLGA 5IB5A 1E5NA 3LKNB 4C57C 3S4SG 1YTDA 4NSKA 4LF2A 3NIFB 1RZJH 1BGXL 4B9ZA 2XPGB 3G6AA 4NAQA 1M4KA 5TF1H 4MNKA 4OM1H 1FZKB 4GKSA 3O8AA 4FQXD 4LSSH 4FFYL 4U7KA 3UZQA 4ANWA 3P82A 4H88H 4JIEA 2WOYA 1U42A 1S5IH 4ZFOL 4B9IA 1EKOA 1I4NA 2P7TB 1DVUA 1XZWA 3VFRB 2GK1A 3T3MF 1Q0XH 3GO1H 3PHOB 2DIJA 5I07A 2CKBL 4JMXA 5D2NE 3I3BA 1BA9A 3FEQA 3N12A 4NO5A 5HNUA 2Y85A 3OIHA 3DX6A 3HOGA 1QRQA 3CFJB 4S10A 2N0MA 1D6EA 4EI5A 3NA4A 3L7RA 2NNCA 1HUVA 1TWZA 4XBGB 3SDAA 1X8FA 4YE4L 5I6XC 2AK1H 3OHIA 4NWUH 1EX0A 4O1AA 4GAAA 3V0VB 3OZOA 5EA9A 3O81A 4R7LA 1X5MA 3BWWA 3WCZA 3NJVA 5DT1L 1QK2A 2WP3O 1JTOA 2O72A 4EVNA 4JAMB 1LEKB 4JG1L 1HDMA 4PJ7A 3HMWH 2COVD 3S34H 3SSGA 3ZTEA 3L6FB 4FTVD 4WI2A 2EJ1A 4B7IA 4M3PA 4GAGH 2F8OA 3UZEC 3AFLA 4I7ZC 2X4QA 1OAKL 3S2LA 4BQ2A 2J6EH 1TNMA 4YVXA 2IV8A 3GSQA 4Q4MA 1I3GH 3MDUA 1TZ8A 5IJVB 4TRPL 4XCNB 3WH9A 4C6NA 1PZ1A 1BSLA 3UVAA 1RVKA 3BW9B 2VDRL 4MAYA 2OMNA 2IKGA 4YTUA 4LLVB 3NPUA 1T6BX 4GAFB 1VH7A 2NY6D 3KPMA 4YSCA 2G8ZA 3WH8A 1CK0H 2C9VA 4QRRD 2YUXA 3QEZA 4I6KA 3KPSD 3W39B 1SMOA 3SE6A 4EQ2A 3US1A 3WD4A 1BVLB 3MVSA 2I07B 3K91A 4DP7X 3JWDH 3DGDA 3WUEA 1YEJH 2ZRXA 4X63A 2VMEA 2E7DA 4F57L 4F0RA 3GIZL 3C3UA 1F4WL 2BY2A 2H0PA 2YUWA 2J44A 3C8DA 3FFCB 5I1EL 2VX7A 2R1YA 2Q0ZX 1KIUA 4L1WA 1BEYL 4EN3D 4AD2A 1ZAGA 3TW7A 2XIBA 2IPTH 1ADQL 4JDVA 4JZJA 4XP5L 1X4YA 3RPIB 3X1FA 1BQHB 2A6IB 4PJIE 4PWIA 4YLQT 4PTDA 4BSWA 1MN4A 1NFAA 5DZOA 2ADAA 1QFWM 3CHQA 3NTCL 3OMNB 3V0GA 3GW3A 4IMAA 4AG0A 1N64H 1YBQB 3BSGA 1OLZA 5DK3A 4MNQD 4PJIA 3LTSA 3HPZA 1GVRA 1SFTA 1T21B 2I5YH 1DBKH 3EJYC 4E9WA 1OLLA 4NB7A 3AMGA 5CG7A 1VEOA 2NY7H 2R83A 4G9FD 1J5OH 1MQKH 4BEUA 1S7RA 4PJ5E 2A77H 4GQRA 4TL4A 1F3EA 4DNMA 3HUJB 1CICA 3WIFB 2J6VA 2V17H 2O5NA 4Q89A 1ICSA 4Y4HB 4GSRA 4JNYA 3HZKB 5FOBB 1S8DA 2J7CA 4OFCA 1REIA 5HNNA 4DBEA 1I9RL 1U6AH 3ZFHA 4O02H 4CCCA 2V2HA 1RULL 5DQDH 1KELH 4IRZL 1MFEL 5FUZL 4CU8A 5AOLA 2VFDA 1Q4NX 3QC3A 1FAKT 1OCCB 1E6JL 3FUFA 2JI3A 4GUCA 4JHZA 3QZWA 4FQQB 4JXCA 4WKFA 1KENH 3OB0H 4XXCA 2D2GA 3K7UA 3TO4B 1E2ZA 4HS6B 1H5VA 3GR8A 4NNAA 1WZMA 1ONXA 1QSEB 3M0XA 1SW7A 1FNGA 1S7TB 1KLUA 4N2IA 5GGQL 4EMZA 1NOWA 3WFLA 4C7FA 3NCJH 5KYYB 4MMXB 2CMRH 5G1YA 4KDTA 3W00A 4BZ1H 5KZCD 2XLLA 1ILSA 2OMBA 3B9KD 3L3GA 1UB5B 5GGRB 3PG2A 5T1DH 4BKLA 1XG4A 1KDJA 3OGRA 4QRTB 3B5HA 1A4AA 4Q2ZA 4RISH 4DKEL 2H3NB 5E08L 3GBLA 1MI3A 1YDYA 2HE8A 2PCFA 2LOEA 2OWXA 5E4IA 3VYPA 4A37A 3GDLA 4DKAA 2MHAA 1AXSA 2A5UA 1U4FA 3FA4A 1F00I 2WCGA 3RPBA 5F88B 3P62A 1B31A 3E96A 4MNMA 2IGTA 4HN4A 3VXSA 1KQYA 4E4UA 2PCPB 1YJDL 3DX4A 4J3UA 5ICZA 3BG9A 3GQYA 1XR9B 4K2SA 1JPTH 3CHSA 5AAMC 1F8IA 1LF1A 4QXGL 3MJWA 1OTTC 5JPMC 3LZ5A 4KI5E 5D8JL 4NHCH 1G7MA 1A5SA 1WKFA 4OIBA 1P0KA 2FEDC 5DDHB 1T2QH 1ZXQA 3THAA 3WNIA 1GWJA 4IRJC 3VACA 1ZIBA 1AACA 3VFCA 2ATPB 4WK9A 1D9KA 4MASA 4AZIA 3MRBA 3FO9B 1BPVA 3CX5K 5DJXA 2ZKXA 2O6PA 4LHUA 3VGGA 3DROB 4NRZB 4UT7L 5IKCB 1TQJA 2PDXA 4J35A 4J3XA 4NAFB 4E5TA 2ADFH 3QDJD 3EF7A 5CIPA 1URZA 3RR4A 3APNA 2FX7L 2VQ1A 4I4WA 1SUHA 2P47B 4KUZH 4BWUA 4FAAB 3QJZA 3KXFE 3U2SA 1L9TA 3HAEH 4R8WH 3PDOB 4N2LA 1IEWA 2P3EA 1DJYA 3EH4B 4JO4H 1A4LA 5I1LA 2C79A 3EBHA 1C9SA 3T44A 2J9ZA 1T03H 4F4RA 4EPKA 3GHRA 5DJDA 1AKJD 3NJIA 3ETBF 4PGZA 4NENB 3CV1A 2X9WA 4AYDC 1SFHA 1HL5A 4F2EA 3IV3A 1WZAA 3WDQA 4KXZI 2Q8ZA 4ZTYA 3WFCH 3ZM8A 5LQBL 3WEMA 2DIEA 1E0VA 2OR9H 4KY1L 5KBMA 1UXSA 3LKOA 1P69B 2LW3A 4RDVA 3W0WA 5KANG 4GO6B 3UX9B 2Z7WA 2V9UA 4Z5RB 2ZTBA 3EGDB 3SM0A 3IXTA 1A3ZA 1AOHA 2Y7OA 3WIHL 5CJNA 4MA1B 3EJPA 3PNRB 2CZDA 4RGNE 1NLDH 2CC0A 1R3HA 3C8KA 2MPVA 1DEEB 1TXKA 3FCBA 3OPUA 1HL9A 1RPQA 4P8QA 4R97B 1CLOL 5ALCH 5E1AB 5T3XL 2O0TA 3DETD 5DUBB 1KTDB 2CG9X 2VDNL 1U2CA 5F2FA 3DKLA 4PLKC 3VFVB 4NN7C 1S3RA 3ULSB 2V2TA 4NZTH 4UFJA 2ZZ4A 3DV6B 4QX4A 1WCBB 1YN7B 5C3TA 2JQAA 4BK9A 5FUCE 3VIJA 1KPUA 3BAYA 1RA5A 3JUGA 5EU4B 5D96C 1FYHB 4AL8C 3DU0A 3RLVA 3U7AA 1WK0A 1QP1A 1O5PA 2EC9T 1R5WB 4I18B 3W7NA 1Y0LB 3PABB 1ZJAA 4F5CA 3W74A 2GYSA 5F2IA 4S3EA 1UZ6F 4WV1A 4QS5A 1HP5A 3P0XA 4X6EB 4PREA 3TN4A 3PP3K 3QUYB 2HUEA 1KFGA 1NP2A 3EOBB 4HPGA 4EKXA 4BK5A 4NZ4A 4JFTA 3PIQA 1C8XA 1JPIA 3EJQA 1CI5A 2C19A 1WUNT 1A4JA 2AZUA 4XZWA 5I03A 4KCVA 4XO4A 5CPTA 5IRPA 3FYEB 3L3OB 4OQTH 1B30A 4X0KB 3IVUA 2AXGB 3MCLH 3G04B 2Z26A 5J7CC 3C5SA 3Q9PA 4JTIA 1RLCL 5AZ1A 2WSYA 3GBML 4MWFA 5E6IA 1V6UA 3TT3L 5LB1A 2PWHA 1FL5B 2R51A 1IM3D 5GS0H 2J21A 4FR6A 5HHPB 3UADA 3AU1B 3S3GA 4AKQA 3E74A 3SE3C 4NO0D 4F48A 3VXGA 3AVEA 3C9NB 5EIIG 3AWNA 3DDGA 1JPEA 2YIHA 4OIIH 2Q8XA 1ONRA 4A2MA 1K7XA 4X2PA 3L4ZA 3QCVH 4OUUB 4Y8AA 4MMYA 1IEQA 3GMNB 1A1MB 4A2HA 3GS4A 5HHVL 3WN6A 1MRQA 1DBTA 2JSFA 3IJ7A 4MCMA 1M7OA 2XHNA 1AGDB 1T4WA 1PNDA 3HS9A 1JF5A 3CZKA 5CGQA 3LKRB 3VFTB 2ZOUA 4KZDL 3WUFA 4L9DA 2EZ0C 5E8PB 3S37H 3OR7B 3UYRL 2YAMA 3FCTA 2BWDA 4RA3A 3ZDWA 1YN6A 2R0WH 2Z1WA 1H8OA 1FWGC 1U3HC 3EKGA 4L23A 1D5ZB 2EINB 2Y24A 5D1QB 5KSUA 3T2QA 4ZMAT 4PBEA 3EHBB 4IIZA 1UJQA 1SYVB 2EKSA 3QFGA 4G72B 3DZ1A 4GQGA 1RK0A 5IOKA 2YA0A 2C4FT 4UAOC 5D2NB 2VDQL 5EUOB 1AOZA 5D7LD 2QPFA 3M0VA 2ERJB 1NGXB 1S7UA 2WP3T 4M8VA 4PJCA 3MLUH 4XPAH 4JS3A 2ZG3A 4JO3H 4ONVA 1ZS8B 3TWCH 3B3IA 3V4PA 4X8CA 4X7TA 4ZUWB 5JOPD 1OHLA 3I6EA 2J13A 4IOTA 3W27A 5IMMB 4RA0C 2DYSB 5EORH 3RWEA 3ZK0A 3IFNL 4IJBA 2B59A 3L5AA 2IPGA 4RE2A 2DQUH 1NCIA 1T89A 3BE1L 3T6QC 4TUFA 3P4LA 3QZ6A 5CEXB 1UOLA 4R97C 4WR3A 32C2A 3G5VB 3MO1B 2PCQA 3I6KA 3K6DA 2ZXBA 5EIIB 2A3BA 1AD4A 3O1NA 4WEBL 4DERA 2V8LA 1M6UA 1Q7ZA 4BI7A 2AEWA 5GS1B 3RGVD 3HGRA 4LAMA 5HP5A 4WUUA 2J75A 3D2TA 1KA9F 4RMRA 3SDOA 1IGJB 1RK5A 3IDYC 1JCKA 4O53A 4EF8A 4N1EA 1HXYB 2TRYA 2H6PB 4GXVL 3CV6A 2OMXA 2WYIA 1SW3A 2DJSA 2IXQA 4PRAA 5CMAA 2WWNA 2X7VA 2IMMA 4FFTA 4R84A 4WFEE 2R1KA 3GSOB 4OCNC 4WW2C 4CC1A 3EGXB 1VFAA 4TUUA 2AJSH 2QHRH 4N8VB 2WZPD 3REWA 2JJTC 1A6TA 1FFOB 4OJAA 3UG8A 1KB5H 2PZNA 1DVZA 3JV6B 4G3YL 4PTMA 2FEJA 2PXYB 2KBGA 4AYGA 1I4FA 1XX9C 4JRWA 4KERA 1IEAB 2GPTA 1G9NL 3GVVA 3DX5A 1LMKA 1XYZA 4DM1A 4HHGA 4G9DB 1R47A 4FFVC 2FQFA 4JHWH 4UTAA 2TODA 3RM4A 4UTLA 3QXWA 2FBJH 2O55A 3WS6A 5HDRA 1X5YA 5F6IB 5TF0A 1BFSA 5D70H 2HJFB 5DRZB 4YO0A 1X5XA 2LU5A 1AH1A 3TIEB 4P9HL 1E9LA 4A2DA 4MGGA 2NY3B 2ALDA 3FQNA 5C0BB 4ZTOH 1FN4B 1R86A 1XGPA 1LT7A 1G7JB 3IGHX 3D3VB 3CHFA 5JQ6L 5DR5L 5HVWA 2BNRD 3O8XA 4CD4A 2AJZB 5AOIA 4I1PA 1AS7A 1OSEA 3O3BA 3W37A 1A14L 4FNLH 1RH8A 1ERNA 2WVTA 3VA6A 1Z9LA 3G5ZA 3DURB 4LEXH 3PK7A 4I7UA 5F3FA 2QKIC 1CG9B 1IXNA 2Z0IA 1ITUA 3GNMH 4W7VA 2B31A 1A5MC 3D3VD 5IHLB 1RURH 4R90H 5CD3B 4F9JA 4LW7A 1NCGA 1JBJA 3MGTB 4ZFOB 4HIEA 4L6OA 4CQAA 3HG3A 4M48L 5ANMB 4BFFA 2P0IA 3TBYB 3MCMA 2FX9H 3S2AA 2Q71A 4GIEA 1O5XA 4LFHG 2Z9TA 5AD0B 4LLQB 2GQAA 1KG0B 5A7EA 3AS2A 1R3TA 5B7ZA 1X6NA 3GVRA 3KVKA 4LHQB 1E4LA 1WDWA 1RIVL 4NWTH 4F79A 4LSRL 4ZMXA 4OGAD 1SNRA 1MFAH 1EHLH 1R4XA 2Y7QA 5B1JC 4K8GA 3WTTA 1E4JA 3C6SB 4LSDA 3MI3A 1HFBA 3RHWK 4BK4A 3RZCD 2Y6ZA 4PYSA 3LQZB 4KXAA 3VVGA 2UYLA 2E7HA 4HH9A 1KXVC 3V0WH 3V2AR 1SM3H 2OSWA 5CAKA 3C6EA 3QM3A 5IVZA 5IMLA 2Y88A 1CIDA 4EXQA 1YNTF 3D25B 2V5KA 2BGQA 2PYED 2OLSA 2G3JA 2PR4H 4BE6A 2PD5A 2ITCA 2GBVA 3RE0A 2BASA 3QO1B 5HVFB 3FQXA 3JTSA 1F4YL 1TJHL 2O5XH 4WEUD 4ERSH 2QDHA 1M65A 3L3IA 1UPPA 3NIDE 4RETB 1GYAA 4LSPL 3NZHL 1EJ8A 3AHTA 5HD8D 4PHZA 5FGBA 5E0FA 4NIYE 1GTHA 4W9TA 1U4EA 4HUWA 4WJKB 3OWRA 1SDDB 1RK6A 2ZUNA 4JZOA 4PTXA 2YN3A 4LLYA 3ZQWA 3BRDA 3WNPA 1CEOA 2VFHA 2ANUA 2O4QA 4XRCA 5ECJE 5CJQH 4L8BB 3U4FA 1T1YA 2BFGA 1CL7L 3GYRA 4WHTB 1QFWL 3BZ5A 2EUVA 2YCEA 1S9VA 5DJ2B 5FF0A 3P0GB 1SVDA 3UDWC 2JJSC 2WTOA 2NY6C 4ZFFB 1LTDA