4JFTA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor n-desmethyl-4-epi-(+)-codonopsinine
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-L-fucosidase
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
total genus 162
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jftA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jftA01
3A3HA 4J3WA 4Q22A 4PMQA 3D52A 4B15A 2ZUMA 3VNZA 2X2HA 5AY7A 3AOFA 3SUWA 2WPGA 1VB9A 3LRKA 1MFUA 2E8ZA 2QHAA 2G3JA 1LJYA 2NW0A 5HDRA 1Y7VA 2WVUA 1OIFA 1PIGA 2ZUWA 3ZMRA 1HKJA 2CPUA 4F79A 4YHEA 4J3VA 4CN4A 4MDPA 2OWXA 3VGEA 4OBSA 1BG9A 2WBKA 3W37A 2YL8A 1UD3A 3MKKA 1E72M 3WL0A 1W9VA 4UTFA 1FH8A 4E2OA 1W1TA 4K68A 1UH4A 1PPIA 3T08A 2VZVA 2FGLA 1HP5A 1WE5A 5DMYA 1CXFA 4W8LA 2WCSA 4D6JA 4W5UA 4PMYA 3A22A 1QVBA 5AC5A 1CTNA 1VEPA 2QPUA 3EBVA 3WDJA 3VNYA 5A6LA 3A47A 4DO6A 3UR8A 3M6DA 4AEEA 2D1ZA 1F4AA 1UKQA 4NZFA 1D2KA 4UFKA 3OGVA 1BF2A 2XHYA 4AZHA 5E6ZA 5DFAA 2VVNA 3I3BA 1KFWA 4DWSC 4XZBA 3WY1A 2VQTA 5M3WA 4BZYA 1JXKA 2J79A 2WCAA 1OINA 2O9OA 1IV8A 3WH9A 1UD2A 3NDZA 4M81A 1EDGA 5I0DA 1BQCA 3KE0A 1J12A 4CKQA 4M24A 1CXHA 2Y4SA 2EPNA 4GI8A 1C8XA 4MTVA 1O7DC 1UZ4A 3W25A 4DO5A 4NX0A 4FNRA 4ACZB 5JBFA 1MW3A 2J7BA 4M29A 4RL3A 1B2YA 1H49A 3PTKA 4PTMA 3ZSSA 2EADA 2CKSA 4QLKA 2Y5EA 1PBGA 3CZSA 1QHZA 3BUQA 2XUCA 3AIRA 3ZT5A 3WNKA 2G41A 1E9LA 1HKMA 1FP9A 3W26A 3HG2A 4FLOA 2XG9A 4OZOA 1VJSA 2O9PA 4BQ5A 3U5UA 4EK7A 3AISA 1ZL1A 1ISYA 1QPKA 1TVNA 4KRTA 4M1RA 3G6MA 1GOMA 2QPSA 3ZT7A 4M80A 1Q6GA 4AYGA 1NOWA 2EBNA 4S3JA 5D9MA 1C90A 1WKYA 4TVUA 1W1VA 3LPFA 2DQXA 4WKHA 1PX4A 4JFUA 5CJ5A 1BYDA 3CO4A 1Q6CA 3VMPA 1XYFA 3WBEA 1MFVA 2BY0A 1CXKA 1US3A 7A3HA 2EO7A 4HU0A 2J62A 1CECA 1TQVA 3SCPA 3CUIA 4HMCA 4MJ4A 2JEQA 1TA3B 1LQ0A 4CCDA 3AMDA 3VGDA 2YA0A 2BXZA 1B30A 2YBTA 3WF1A 1QWUA 1V3MA 3DX0A 4UOQA 1B3VA 1HJWA 4RE4A 4LPCA 4JKKA 3WSUA 3THCA 3W4RA 4A4AA 5ABFA 3PZUA 2VMFA 5A1AA 2XTKA 5C8BB 5I5RA 3S6TA 1HJUA 2XVLA 2F7QA 3OLEA 1J10A 5IFTA 4OOUA 2XN1A 1CIUA 1QW9A 3LXBA 4J3TA 4JHOA 1V02E 1KQYA 4UOJA 3AIBA 3VIFA 4GQQA 1QNPA 3BVTA 2E0PA 4HOWA 2ZUVA 2J25A 4JFVA 5A8PA 4HMEA 1QBBA 1R7OA 3EMCA 4DUWA 3WH6A 1P6WA 2Z1SA 3H55A 2YDSA 1VRXA 4E8DA 2Y2WA 1V08A 1KB3A 3L4YA 2WMIA 2W62A 4HZ7A 1W32A 4P8VA 3WEZA 4ZEPA 1V3IA 1CYGA 2AAAA 2VRKA 1H4PA 3MUAA 1NP2A 1UD4A 3D4YA 1TQTA 2J75A 3BVXA 2WZEA 1JZ5A 1NM9A 1OT2A 1IT0A 4NRSA 3UG5A 2J8FA 2FH6A 2XSAA 2XFYA 2XM1A 3S5ZA 4UQ9A 5A2AA 1R87A 2Y8VA 4V27A 5BXPA 3ARUA 5D8WA 1NP0A 4KH2A 1JZ2A 1V6XA 5I2UA 5I3DA 4U5IA 3NSNA 1UWRA 1WDSA 3W27A 1HL8A 3LPGA 4E8CA 1UWUA 3U7BA 3CMJA 3PN8A 2E9LA 4PTVA 1YQ2A 5BWFA 4N0RA 4JFWA 3WEOA 2D73A 4R5EA 3WD3A 3WNOA 2XWEA 4CCCA 1E5NA 2BXYA 1SMDA 1LL7A 2YL6A 4AMWA 1CGXA 4H41A 1LWJA 2BVYA 1VFUA 1UWSA 4AC1X 2A3AA 4OGZA 2QMJA 1R7AA 2GSJA 4PMUA 1H1NA 1WAWA 1E6ZA 1HF6A 2WCGA 3VDAA 1UZ1A 1FOBA 1ZU8A 1V03A 2GJXB 3WQ8A 2YDRA 4HMDA 2BY1A 1OSEA 3VGFA 2CBUA 3BAWA 2WLZA 1RPKA 2BFGA 2JF7A 3T0DA 4HU8A 1CGVA 3AS1A 4TX8A 5LA1A 1KCLA 2AMGA 4N42A 2WANA 5AC4A 1GHSA 1SR0A 2WVSA 1B0IA 4XV0A 3OLDA 1JG9A 1UD5A 4P7QA 1BVNP 4PEEA 5EMYA 4MNKA 1JL8A 3S5YA 3SUUA 4C7DA 3EJQA 1E4IA 4W5ZA 3CUFA 3NIYA 2J7CA 1R33A 3VIMA 4NXKA 2V3EA 5DT7A 3CZ8A 3WUBA 2WAGA 1GPFA 5HOSA 3AROA 4F9JA 1ISZA 1UOKA 2BHZA 3SUSA 4JKMA 4CVUA 2WB5A 3VIPA 2BY2A 3UG4A 1EO5A 1HKIA 3KZSA 4AZGA 3A21A 1XSKA 4U5KA 2GK1A 3J7HA 4B9ZA 3CHDA 1FH7A 2YDQA 1X6NA 3BAYA 4FNPA 1ITCA 3JUGA 5JUVA 3MS8A 2GDVA 3PZQA 4BQ2A 4QLLA 4AD4A 3BC9A 1XV8A 2XIBA 3POCA 4ZXLA 3SEPA 4DO4A 1TQWA 4PRWA 1ISVA 4H7VA 1C3FA 1JDAA 1HJVA 1K9EA 4PBGA 2W92A 1SZNA 4PMOA 3F5KA 2VQUA 3H54A 2OSWA 2DDXA 5CXPA 5BRQA 1N82A 2VCBA 1C8QA 3VMNA 3AXXA 2A3BA 3ARPA 3W82A 1H0IA 1GQIA 3LMYA 4TTUA 1BTCA 2EXOA 1K6AA 2CBIA 1QBAA 4Z2JA 4GI6A 2XGIA 1E71M 1VFMA 1LG2A 1KBBA 2PI6A 1HTYA 2WHLA 3O9NA 4Z2HA 1E6NA 1D3CA 1OM0A 2X0HA 4MB4A 2F7PA 3CHFA 1J01A 5ABHA 5A69A 1PAMA 3W24A 3HU7A 3IJ7A 2GJPA 1TUXA 3BSGA 4WJXA 2D0FA 1JYVA 4FK9A 3VKKA 2VVSA 1ECEA 4KGLA 1CLVA 1GORA 3EYPA 4BF7A 5CG0A 4A3HA 4NZCA 5CLWA 1FHLA 3M7SA 4CD7A 1CBGA 1B9ZA 2A3CA 5LYRA 3WQ6A 3WQ4A 3VIKA 1L0PA 3ZO9A 3CTTA 3PZIA 2F1BA 4B3KA 4UFIA 1J11A 1WZLA 3AYSA 1R75A 2YLLA 1EGZA 1XCWA 3K4DA 5M03A 2VNCA 1B3XA 4UQBA 2IUZA 1JNEA 1KGXA 2CEQA 5DF0A 3AHXA 3D4ZA 4DM2A 5FOOA 5CSYA 1A47A 2IXVA 3B9EA 3TP4A 3BVWA 3UEQA 5A8OA 5KEZA 3L4ZA 5DT5A 4CUCA 1JAKA 4UZUA 1XGZA 1VFOA 4GPNA 5A6JA 2W67A 4P8XA 2BVTA 4LX4A 2A3EA 1BLIA 3N04A 5HPOA 4CD8A 1GONA 3VIJA 1JNDA 4PMXA 3CZKA 3BVUA 3L4TA 3N11A 3VILA 1V3KA 4WLCA 3PZVA 4WF7A 3VSUA 1Q6DA 4JFTA 3WNPA 2PC8A 1R34A 1ZBKA 3BGAA 3A5VA 3BUPA 1HIZA 1E4LA 3A4WA 4F9DA 3AXHA 4JIEA 1UKPA 3EJUA 4P7LA 1U33A 5JBEA 1G94A 2NT0A 3WY4A 4OKDA 2WBGA 4LYRA 2DGAA 4IM4A 3VSTA 2XFFA 1CENA 2BS9A 2ZXQA 3ARVA 4BQ3A 2JF6A 3VGBA 3BCDA 1JZ4A 3VD5A 1M53A 2VZUA 4HPGA 3AJ7A 4PTWA 3WH5A 1GVIA 5CGTA 5BRPA 1US2A 4RE2A 2C8NA 1C93A 1R86A 1E4NA 4DUXA 3PZMA 2ZWYA 4PTXA 1G1YA 1C92A 3IANA 3RO8A 2VR4A 1RP8A 3WN6A 3GXFA 3DDGA 3WY3A 1V02A 3KLKA 1J9YA 4ZENA 3IJ9A 3APGA 1DWHM 7TAAA 5D9OA 2WSKA 6A3HA 4QFUA 3LXCA 3AS3A 1CPUA 1FHDA 3T2OA 3KLLA 1I1XA 2VT0A 4AWEA 4CD5A 2CESA 2DSZA 2WHKA 2YBUA 2GUYA 3GXTA 3AIQA 2PBOA 2WVVA 1UHVA 3AZRA 1UR0A 3HG3A 1E43A 5I23A 2TAAA 3NJ3A 2VX7A 1W2VA 2FH8A 2X8RA 1UR1A 3BAXA 3WEMA 1W1YA 3SIMA 3N17A 1CXLA 2DSUA 1CGWA 1TQSA 1UA7A 1EXPA 1WP6A 1SYTA 2DSKA 4Y7EA 5E09A 3GH4A 1E40A 1B3ZA 1UKSA 5A6BA 4HTYA 4CGTA 1JIBA 3RILA 1OB0A 3WDRA 3FW6A 1QOXA 3WMBA 1WDQA 1V6VA 1KR0A 4LXFA 2DSWA 1XD1A 3TOPA 1OBAA 2ALWA 2VJXA 1NWRA 1JZ6A 2WMIB 3AMLA 3CGTA 4WK9A 2VOTA 1V6YA 2VUYA 3BUBA 3CH9A 3RM4A 2FE0A 1DP0A 3WQWA 3ARWA 4IPNB 2G3IA 4KRUA 3DX2A 2WMGA 2CERA 2X1IA 1KBKA 4HZ6A 3MV11 1NOFA 3AYRA 1GOOA 3CZGA 3LPPA 4TX6A 1B1YA 1W9DM 1PZ3A 3WUGA 1XHGA 4UOZA 1NWSA 2ZX6A 2GJRA 1GQLA 4QP0A 4Z2KA 1QNQA 2XGBA 1DWGM 3WBAA 4HA4A 1SFSA 2VC9A 4TOQA 4PMDA 5IXEA 3BAJA 1R8LA 3T0AA 4BA0A 1OIMA 5EFFA 3K8MA 1E56A 5I6SA 2OSXA 3HG5A 3F5LA 2OW6A 1HN1A 1JYNA 4AZIA 2YIHA 1W3JA 5A6MA 1XYZA 1GOIA 3WFZA 2EPMX 1H3GA 3AQUA 3T2PA 3W29A 3WUEA 3BLBA 2FHCA 3ARSA 3SUVA 1QI0A 3H53A 3CHCA 1OGGA 4UR9A 4HP5A 2F61A 3OG2A 5CGMA 3PZGA 1JZ7A 4AYSA 2CXGA 1AMYA 3BMVA 1GHRA 1UUQA 1VBUA 1DHKA 9CGTA 5CZKA 1JAEA 1JF5A 4HOZA 2DT1A 3B9DA 2WC7A 1MVYA 2J7HA 3AHTA 1HKKA 1V6UA 2JIWA 4ATWA 3ZOAA 3WD2A 4IPLA 3CUJA 1A3HA 1ESWA 1JI2A 1CGTA 1VBRA 4TVCA 2NT1A 2W4XA 4PMZA 3D3AA 3ZJ7A 3RJXA 2QLYA 4WKAA 3EJSA 1HWWA 3BSHA 4AW7A 1E73M 1GUVA 1Q4NX 1TZ7A 4DUVA 3BH4A 1R46A 2W66A 5JBDA 4TXEA 3A24A 4FLSA 4U31A 4ATDA 2Z1KA 1V0NA 3AZTA 4MB5A 1EHAA 1C7TA 4PUDA 3SCSA 3QOKA 1QNSA 2WSPA 1UWQA 3WNLA 5LA0A 3BLKA 3GNOA 2GFTA 3RCNA 1G0CA 2MANA 2RGMA 4XUYA 1KXHA 4D6HA 3A4XA 1JYWA 3AIVA 5E70A 2DIEA 3W0KA 2E8YA 2EPOA 4PUEA 5ECUA 4R27A 2CETA 3ZM8A 2F18A 5E1QA 2VX5A 2WZIA 3K46A 4KGJA 4PCSA 5HNNA 1EO7A 1KTBA 3N12A 1LG1A 3RM9A 4CU7A 5JIPA 1TE1A 4FNQA 4ACZA 1MQPA 4MNLA 2DT2A 5I78A 3AHZA 1OCQA 2HVMA 2PWDA 4W8BA 5CSUA 1JF6A 3OLIA 4KMQA 2V38A 2XJ7A 5A6SA 4FNSA 1EIBA 1NOUA 1EH9A 3GXMA 3TV8A 3WL1A 3VIOA 2D2OA 3IAQA 3K8KA 3K8LA 4U33A 2J4GA 1MWOA 1XCXA 4QLJA 1UKTA 4AZ7A 3SCQA 3LX9A 4BQ4A 1RH9A 3VIGA 1JFHA 2O9TA 3MMUA 3ALFA 4URIA 3DC0A 1OD0A 3PBGA 1AVAA 4GO9A 3W53A 1UWIA 3AMCA 2FGZA 2XM2A 3PTQA 5ABEA 1V3HA 1UR8A 4D1JA 4EANA 1LL4A 2VR5A 1CLXA 5A8MA 4AD1A 1LL6A 3ARYA 3SCUA 3WD0A 2XSBA 4J3XA 2ZICA 3AIEA 1UD6A 1CZ1A 1V0LA 1E0VA 4AZCB 3VO0A 1CNVA 1IZJA 1SMAA 2DPEA 2X2YA 1PEZA 3OA5A 2W63A 3W6LA 1EDTA 1TA3A 1H41A 2J47A 1WO2A 5GPRA 3PZTA 4NF7A 4AD2A 4B16A 3CC1A 4JKLA 4DWSD 5TD4A 2FHBA 1X6LA 3N18A 2Q8XA 1EQCA 3MMWA 1VFFA 4W88A 3CZJA 1HL9A 3LRLA 1LWHA 4Z2IA 1ZB5A 4EAMA 2EABA 1C7SA 4AZ5A 4AMCA 1AQHA 1ZJAA 4PSRA 4LYQA 1GOKA 2EAEA 2WVTA 1LLOA 4UQEA 3VIIA 4C7FA 3DX1A 4W7UA 1NWUA 3ZJKA 3HJEA 1E6PA 3WH8A 4MDOA 4OJYA 2E40A 3EDDA 1M04A 2IGTA 3CMGA 3U5YA 1G01A 3ZR6A 3NYDA 3EDKA 2J7EA 3VIHA 2WW5A 4IISA 4DM1A 5IHRA 4AIEA 2OYMA 3WFLA 2WMHA 1EHNA 4UQDA 5IFPA 2G3MA 1VF8A 1HX0A 1K9DA 3IGUA 3K4AA 5BXTA 1B3WA 3MANA 4PMRA 4CN1A 3FAXA 3GDBA 1R47A 3VDHA 2WWDA 4OIFA 5A6BD 2E9MA 1E6RA 1X1NA 5CQ1A 1H0GA 1G5AA 1J0HA 1XD0A 4J27A 3AS2A 3II1A 3OGSA 4AISA 4D6IA 4W84A 2YL5A 3AFBA 1DWIM 1GJUA 2J74A 3FN9A 2J8GA 4U2YA 3VVGA 4UNIA 2JIEA 1WB0A 2ZUNA 4LYPA 1JD9A 1W9XA 1EOMA 3F5JA 4TVDA 1B90A 4PMVA 3T2QA 3GBEA 3WNNA 1HXKA 1OT1A 3EMZA 2CBVA 1B3YA 3MMDA 4H8UA 2VX6A 4YPJA 4A3YA 2PB1A 1JYXA 2OYLA 3AHYA 4MB1A 3UG3A 1C8YA 8CGTA 2D20A 4UFMA 3GNRA 3LPOA 3TTOA 1XC6A 1E4MM 4NI3A 2FDMA 1OGSA 1EOKA 2JALA 2GJXA 1KWKA 2WMJA 1MW2A 3ARXA 4S3KA 3VUPA 3VGGA 5A6KA 4L4OA 4J3UA 2WYSA 2XFRA 4NZJA 1JDDA 4JL1A 2J7DA 2ZIDA 1WNOA 1MW0A 2WKLA 4MB3A 3CUGA 1W9PA 2J7FA 3D51A 3NSMA 5EBAA 3CBWA 4FLRA 4UFHA 5A94A 2V5CA 1OWQA 2F8QA 2CNCA 3N9KA 4GZEA 3UERA 1QHOA 4AXNA 3NUKA 2ZXAA 2BNJA 1BG4A 4PN2A 4HA1A 4JAWA 3TA9A 3HN3A 3EJPA 1W9BM 1FA2A 1HJXA 3OGRA 2PF0A 2Y8KA 1E55A 3W38A 1WZKA 3DECA 3MSGA 2V3GA 3VINA 4FNUA 2UY4A 4EKJA 3WF3A 1Z32X 4FNTA 5AYBA 3DX3A 3KL5A 1W3LA 2YFOA 4HA3A 2JE8A 2W5FA 4WSJA 3DYOA 3F4VA 4UQCA 1BGGA 1E6QM 4U2ZA 1BYBA 4UCFA 2D22A 2VX4A 3CZLA 3CZNA 1PX8A 1J0JA 1M03A 3BLPX 5E6YA 2X2IA 2E9BA 3AS0A 4BS0A 1D7FA 1M01A 3QHMA 1H2JA 1XSIA 2ZWZA 1E1FA 1H09A 3UCQA 1BYAA 3I3EA 3RJYA 5C71A 5FL1A 2OYKA 4UFJA 3MO4A 4MPKA 1F4HA 1J0KA 2VURA 1HVQA 3SCTA 3N13A 4XX6A 3OB8A 2ZX5A 4PSPA 3ECQA 3BAKA 1KCKA 2E4TA 3SCVA 3ZJ6A 5BYWA 1W1PA 1AQ0A 5A6AA 4D6EA 2YLAA 3GM8A 2B31A 3THDA 4X0VA 2J7GA 1ZBCA 3DYPA 3OIHA 4CCEA 3T09A 1LF1A 2D3LA 2VRJA 1WDPA 5GQBA 4CU6A 4H8HA 5A8NA 4JCMA 4DWSA 4C7GA 1CXIA 1QI3A 4XZWA 1E15A 3VPLA 3BUIA 3T0BA 3POHA 3AHVA 2D23A 4GZJA 1Q6FA 2XYLA 4GIAA 4V28A 2WK2A 1E70M 1OD8A 3VX0A 3DHPA 5FCZA 1E1EA 2RGLA 2F7RA 1V3JA 4X9YA 2XN2A 3W6MA 4U3AA 4AZ6A 2YA1A 2ZUSA 4P7OA 2XN0A 4HPHA 2CBJA 1AQMA 4Q7NA 2JEPA 3EJRA 4B9YA 3DYMA 4MADA 1DWFM 3WH7A 3GH7A 3QR3A 3AMKA 5I79A 5ABGA 5ABFB 5GNXA 3WNMA 2OW7A 3BAIA 4J28A 3MSDA 3WENA 5DEZA 2W91A 1KR1A 3WF2A 1XH1A 1XSJA 4PCTA 3MU7A 1UR4A 3QOMA 4AD5A 1GCYA 3PTMA 2BVDA 3GYCA 3VX1A 3AZSA 1V6WA 4KWUA 5A3HA 4W87A 2D0HA 3PZOA 1MW1A 2XVKA 1ODZA 4CN6A 1VIWA 2XPKA 1QI2A 1W9UA 2PWGA 4J7RA 1V0KA 2F7OA 2E3ZA 4W8AA 2CKRA 3VD9A 4P8WA 1MYRA 3N1AA 2UWFA 4ZXOA 4WKFA 1PS3A 1JFXA 1JZ3A 1E6XM 4P7RA 5C70A 1QI5A 3WD4A 4MAVA 2BV9A 4GINA 3EJTA 1UASA 1MXGA 1ZBWA 3ZJ8A 4H04A 2OWWA 3CLWA 1KXTA 3UESA 1G9HA 4H8VA 2EPKX 1ZS2A 3IK2A 1E3ZA 5JIWA 3PHAA 2J78A 2GVYA 3OBAA 3WQ5A 4PMNA 5HPCA 2WWCA 2G8ZA 3IJ8A 1TVPA 2UY5A 3FY1A 1WZAA 1KTCA 3AIWA 4FLQA 4CD4A 1I75A 3DX4A 1CGUA 5A95A 1JI1A 4UFLA 3BUDA 3GBDA 3L2MA 4JL2A 4AY1A 2BY3A 1KXVA 1DTUA 1CXEA 3AXIA 3GTNA 2Y24A 1GJWA 1BYCA 3LXAA 4NRRA 3U57A 4WSKA 4AIOA 4AIUA 3KL0A 5FL0A 2UY2A 1QNOA 4GXPA 3VMOA 1WDRA 2HISA 1DWAM 4FF5A 1GNXA 1HXJA 1JZ8A 1W3HA 4M8UA 2ZX7A 3CHEA 3B8SA 4P8UA 4CU8A 3A23A 2YJQA 2DH3A 2WC3A 2BHUA 2CYGA 4W85A 2FYVA 3QHNA 1TQUA 2XWDA 1KGUA 1HT6A 2QF8A 3M46A 2YKKA 3EDEA 4OUEA 3AMGA 6TAAA 3BXWA 1E5JA 4LGXA 5CLTA 2X2JA 2WMFA 5F7UA 4GKLA 3WY2A 1GQJA 2D24A 5IHSA 3WKZA 3FHAA 2D0GA 4EE9A 1E0XA 5M5DA 3WD1A 2X0YA 1UD8A 3FHQA 4ZE4A 3ARQA 3WDHA 3CV5A 4YN5A 4GI9A 1QWNA 2X05A 3LRMA 4TTGA 3TTSA 1E6SM 3VGHA 3PZ9A 4XB3A 3A4AA 5IDIA 1UWTA 3SUTA 3G6LA 3OZPA 1YHTA 1U2YA 3N15A 1J18A 2X09A 3B9AA 5CPSA 2GK1B 3MUZ1 2WM0A 4ACYA 3WUFA 3RM8A 3OZOA 2ESCA 1TFVA 4AZBA 5LA2A 1W2PA 1V3LA 3RDKA 1E0WA 1S46A 2EQDA 1FFQA 3AICA 2WZHA 1BHGA 2VRQA 2DIJA 2CIPA 3SCRA 2ZUTA 2CHOA 1CDGA 3VD7A 3SCNA 3WIJA 1XH0A 1BSIA 4D6GA 3O6AA 1GOQA 3L4WA 1J0YA 1K9TA 3W81A 3MUIA 4D6FA 1CEOA 1EDQA 2XVGA 2YOCA 1QI4A 3FNDA 2EACA 5FD0A 5CPTA 3U7VA 2J77A 2ZX9A 2VCCA 1UQYA 4W89A 3VM5A 1DWJM 3WDQA 3VSVA 2OWCA 1BAGA 3KEHA 3L4XA 3VD3A 5I77A 4NSBA 5D8ZA 2ZOXA 2XVNA 2ZUUA 1FP8A 1H5VA 1QW8A 5KZ6A 4D71A 1HJQA 2V3DA 5AYIA 3GXDA 1HJSA 2F1AA 3OLGA 2WXDM 3CUHA 4PYSA 3VDBA 3RMEA 2EEXA 4IUGA 3L4UA 1JXJA 2GDUA 3WF4A 4AD0A 2WC4A 3L4VA 1TCMA 4QCEA 3I3DA 1KWGA 4JFSA 1JGIA 1QHPA 5I24A 4B3LA 2ZX8A 3WF0A 5A2BA 1PJ9A 1FH9A 4Z2GA 1CGYA 3RPMA 1WPCA 4J3SA 2WHMA 4MJ2A 3NDYA 1MXDA 2DT0A 4QAWA 1HP4A 4OBRA 3QHOA 3MUY1 5GNYA 2O92A 3RIKA 1EA9C 1VEMA 3ZSTA 1GZJA 1JDCA 4UZSA 5FIPA 1KGWA 3HG4A 1BGAA 5BXRA 2C0HA 2W61A 1PIFA 1MQRA 3TTQA 1UR9A 2PWEA 3BMWA 3ZT6A 1U30A 1B31A 3D50A 3HZ3A 3WDPP 4F8XA 4OOZA 2QMKA 1ZJBA 3W28A 1VAHA 1E3XA 1KQZA 5A2CA 4HOXA 1GOWA 2NSXA 1OGBA 3KL3A 3DDFA 4U3CA 3UR7A 2CITA 2JFEX 3BVVA 4W93A 2FHFA 3ZQ9A 3HMCA 2ZXBA 2WNWA 1W91A 3VTRA 3CPUA 2ZXDA 2IXUA 1QNRA 3WDIA 1QX1A 2YL9A 5EFDA 1PX3A 2EJ1A 3K1DA 2VL4A 2G4FA 3WMSA 2PWFA 5E0FA 4JCLA 5E9AA 1UA3A 2VZTA 2YFNA 4GZIA 5CPQA 4AMXA 3S2CA 5E0CA 3ZIZA 1KXQA 3GZAA 1VENA 1UQZA 3MV01 2V5DA 2DEPA 3SCOA 2PBGA 1EQPA 2VCAA 1W3KA 3QGVA 5A8QA 2VZSA 3CZEA 1BFNA 3GH5A 5DO8A 2ZE0A 4CVWA 2AOSA 3AIUA 3L2LA 4W86A 4M56A 1UYQA 1UG6A 3FAWA 2BHYA 5HXMA 3D5HA 4D72A 2CCRA 5EB8A 2PWHA 4MNMA 2XIIA 3WELA 1GVYA 3ARRA 2WLYA 2UY3A 4DWSB 2QV4A 1ITXA 4NXSA 2VZOA 4QCFA 3SCWA 1TR1A 3NCOA 2WKGA 4D6DA 4FMVA 2WMKA 1UH3A 3GXPA 4YHGA 5D4YA 5M17A 4HZ8A 4L4PA 1DEDA 4P7NA 1TMQA 1FFRA 2VTFA 1I1WA 4AD3A 4AZCA 3E1F1 3NSXA 5BXSA 4GO8A 4TUFA 1MQQA 1GQKA 3A6OA 5FKYA 2VI0A 3UETA 1O6IA 1BPLB 2WVVB 3EDFA 5D9NA 1CWYA 3WQVA 1J0ZA 1GW1A 2G3NA 7CGTA 1T0OA 3PZNA 1ZBVA 3EMQA 3ARZA 1HNYA 3TTYA 1WZMA 4F66A 1TG7A 1C91A 4CD6A 4MNJA 1RD6A 3SURA 2D3NA 2OSYA 1J0IA 1XH2A 4X0NA 5BCAA 1HVXA 4ZFMA 3BCFA 3IAPA 2V3FA 3AI0A 1O7AA 4JZ5A 3VDCA 4MAZA 1BVZA 6CGTA 5BROA 4W7WA 5HBFA 1K9FA 1H11A 2DSVA 1NQ6A 1R85A 2DT3A 3ZR5A 2EPLX 1VEOA 2VO5A 4D6CA 2CHNA 3M07A 4Z2LA 3TONA 2OLHA 1ODUA 4ATLA 1NWTA 1NH6A 3VD4A 1M7XA 1Q6EA 1RP9A 3O2LA 3GXNA 4V2XA 4RE3A 3EDJA 4M82A 1JD7A 4GQRA 3VU2A 3GXIA 2O9RA 5D9PA 4AEFA 4BCEA 1NARA 4W7VA 4ZE5A 4LQ1A 5GNZA 4E4PA 3GNPA 4UQAA 1PZ2A 4ML4A 3ARTA 3KWXA 3WMCA 1UKOA 1VJZA 1WCGA 1IZKA 2WHJA 4QDMA 4H2CA 3VOCA 3DHUA 2F2HA 4D1IA 1UH2A 3CIVA 2YA2A 1UR2A 2DH2A 3MI6A 1V0MA 1XRVA 1ISXA 8A3HA 4JHZA 2XVPA 1ISWA 4WIWA 3FXYA 3ALGA 1L8NA 2A3HA 3VM7A 2C7FA
chains in the Genus database with same CATH superfamily
1G4TA 1Q72H 2AQVA 3KYOA 1QYGL 5IQ7L 4MA7L 2VENA 3TJ4A 3VCLB 3QRHA 3NN8A 4NU7A 1BXVA 2A73B 4K38A 5IB1B 5IW1A 3ZMNA 5B1KA 1AXTL 3TU6A 1V7NL 4PVBA 1KELH 5HHOA 1F18A 2TYSA 5LGYA 2ID5A 5ELIA 4E2OA 1G6VK 2MMXA 1E6JL 1MWAB 3IGHX 1RZ7H 1IR1A 1J8HB 5CIPH 1Q3NA 3PWJB 2C0AA 3VFCA 4MJIA 2WWMC 5TE7L 4YQXH 4Y16C 3IFNH 4TM9A 5DJAA 3QNYA 3NQ8A 5HJDA 4YDVA 3FOMB 4KNSA 5EZIL 3WE6B 4WKXA 1LO0H 2OKMA 1JGLH 3W88A 1IEQA 3ISRA 2KLRA 1CFQB 1C8XA 3W25A 3MRLB 3RIFF 2Y06L 1KM3A 3BHBB 2W07B 3ZSSA 2CKSA 5KZDA 1AG6A 2XUCA 3PJLA 1L9RA 3RGVB 2DLFH 3BZJA 4YSQA 1CF8L 4YBQD 4Q8WA 2Y7QB 5CS7A 5SX5K 1YUKB 1TTAA 4M62H 1TUFA 1OARH 3ZE1B 1TV8A 3UJJL 4OI9A 3HG1A 5JW3L 1PX4A 1FG2B 2WLJA 2FEEI 3O4OC 3FXGA 3VKJA 1I85A 1FIEA 2TRSA 3M86A 1UUOA 2V69A 2ZCZA 1TQVA 1AXSB 2JCCE 3J27A 2GI0A 3UG8A 5CP3A 4CCDA 4M8VA 5CM1A 4GMTL 2GK2A 2BXZA 1YJDL 1I3RA 1Y07A 3KPLA 1KA9F 4LPCA 2E74C 2XQBL 2XTKA 4KRPB 4GEJA 5IHUH 4KXZI 5E2JA 4YVUA 4J3TA 4BKSC 3ALWA 3AGWA 4M4RB 3UR5A 5DCBA 1MJJB 1KLGA 1EP2A 5I6KA 4NZTL 3RFRA 3HRZA 1YCSA 2F68X 5DU7A 3GSNH 4FULA 3QVQA 5C9JA 3O6DA 3F2LA 4PJDE 1JV5B 5I3DA 1AIZA 2XSXA 1KBVA 4OE7A 3CMJA 3N1FC 2XICA 2IKGA 3T4WA 5G1MA 2YAPA 2Z35B 4AGPA 2WBJD 4QXGL 4AIXA 3EKGA 3LV6A 1F45A 5DCCA 5HD8C 4AMWA 5B38G 5DRNA 5AN7A 2QMJA 1R7AA 1F5ZA 1LK2B 1H3PL 2R1WA 1UZ1A 3OYZA 4FA8A 4GUIA 2A77L 5T1MA 2GFBA 4AYMC 1ZAJA 4M19A 1DKWA 3GSWB 1NBYA 3TCEA 5BUGA 1YNLL 4ZUTA 1H62A 2XA8H 3WKYA 4ZX6A 1RFDH 3TH2T 1OOWA 4MCZA 2W88A 1BVNP 1G7HA 1F05A 3SPVB 4DXKA 2BPBA 4OQTL 1PKQE 2BDQA 3DFTA 3NIYA 3RNQA 5IFHH 5KG9A 4WWNA 3TBYB 2VR3A 5E1GA 1EJUC 4YVPA 2FFIA 5E56A 1ZS8B 4AE0A 3S0CA 1A7NL 1EO5A 4TKWA 4GH1A 4PEKA 1I8MB 4HV8B 4B9ZA 4MVAA 3L7FB 3LN4A 4XNBA 1OE3A 3S3SA 4WSGA 3HN8A 3KZ8A 2PDBA 3JWDC 5BOFA 1WD8A 4ZXLA 1B9KA 5SV3A 3EJYC 4TUJB 4DO4A 5ID1B 2FRGP 4MD4A 1JDAA 3UWUA 1JUKA 4O2EB 1QU4A 3DFNA 4U3SA 2BWIA 4DEUA 5K9QI 4HT3A 2OQJB 2L7EA 4CC1A 3P93A 1NAMA 1WS7A 5IVXB 1BTCA 1UB6B 2OO0A 1VFMA 4UTLA 4R8WL 4L2YA 1OYAA 1I8KA 5JHLA 4UIMA 4YXKL 3M0LA 2WZAA 1KENL 3S35H 1DIDA 3L95A 3N41F 1WHPA 4L29B 1FXQA 2ZNWA 4A29A 1R2TA 4YBQC 3IUHA 3IJIA 5I19H 4LAKA 4G8EA 1W1A1 3II2A 3W7GA 1A1MB 5AD0A 5EEVA 3N4AA 4J35A 2B1HL 4E41A 4JN2B 4BQ6A 3VXNB 4KIEA 5KEZA 1OZMA 4UZUA 3PM6A 1U8MB 1AJ7H 2NCEA 4NP4H 2PCFB 5EGRA 4XT1C 1AJZA 4XBGB 3LCFA 1Z5LB 3VIJA 3N11A 1OAXL 3V0JA 5CPNA 4WF7A 3UZ5A 2JB5L 1JNLL 2LLLA 4H8NA 1IARB 4U1NB 2GC7C 1U8IB 2NT0A 4XNYH 4OKDA 3EYUL 1AY1H 3DX9A 5DK0A 4LEOA 4KUZH 2DWTA 3PREA 1WITA 3U2SA 4CNPA 1M53A 2K3HA 2RCSH 2X4TB 1GVIA 2GWNA 2AL2A 2X4RA 3QDJE 5JHDE 5IOBA 3EYOA 4DHLA 1IE4A 1H7NA 3F7YA 5EH1A 1IGSA 3DA0A 2TSYA 1RZ8B 2J73A 1DWHM 1J05A 7TAAA 1TE6A 4U1MB 2LOEA 4QFUA 5AAPA 3EWYA 3OSKA 1L5GA 4Z3JA 4U6HB 3ARBB 4PRTA 4H6KA 2WBJC 4QRRA 4QI3A 4X5RA 4HIJB 1BXAA 1IT9H 3AZRA 4P0DA 1UR0A 3HG3A 2VLKB 2W27A 1UR1A 43C9A 4O54A 4ZMYA 2BVQB 2AQWA 5A6BA 2MQ3A 2ZP0T 3FW6A 4XZUB 1QOXA 3WMBA 3BWAB 4LXFA 4RFNC 4C55A 2VJXA 5GJSH 3FT1A 2ZZ5A 2QJDA 2AJYH 2FO4B 3Q05A 3RM4A 4IPNB 1REIA 4QRUA 4JG0H 3CJJA 3CZGA 3VYLA 4NB7A 1NWSA 2XWRA 2KI6A 4H7ZA 3PV7A 5KN5B 4HKZA 1EPXA 1TIWA 4H40A 1VADA 4R2GB 3NA9H 2WO4A 1W3JA 4HNOA 1DVXA 4DP9X 1GOIA 4JO4H 5E8DL 4YU1A 4P23A 3WK2A 3ARSA 2F61A 3FNKA 1ALDA 2DZXA 1G5GA 4NC1E 4YSUA 1WKDA 5F9AC 1V6UA 2Z7KA 5T1MB 2GFBB 2DL9A 5TFSH 4HJUA 4XNUH 3DMMA 2CUHA 2GSIA 2ZXGA 3HGOA 5I1GH 4FR6A 2V17L 3T4YA 1V55B 2QTEA 3BSHA 3C2OA 5FA3B 2YLKA 3ARDB 3QIBB 5IMKA 1JWUB 1G7HB 1VKXA 3QHFL 2EPHA 3GINA 1JGDA 1EBAA 2WNQA 3B5GA 2OLSA 2OR9L 4W9DC 2VC2H 5HGDB 3TYCA 2YD7A 2R4SL 4YDLC 2DTMH 3FQUB 3JVGC 3ME0B 1UCTA 5F3HA 4JFPA 3ZM8A 5SWSA 4QDPA 2IADA 3BVDB 1U8LB 4NRXA 2F53A 3FT2B 1G9EA 3ZR4A 3V9CA 4V2CB 2AHIA 1U5VA 4EF3A 1JF6A 4LEQA 1HEZA 3V0TA 3RZWA 2D2OA 4ZOBA 4R0LC 2XN9E 4U1IB 3GTFA 4X6FB 3QDME 1JFHA 2O9TA 1KB9K 2J6EH 1QXLA 4KZDL 2A1YA 2IANA 2X1TA 4PBEA 1AO7D 4EANA 5JXEA 4XCYB 1I8KB 5H35A 1BSLA 4UIMB 1R3HA 2R69L 2K9UA 1KTKE 1EDTA 2E56A 5EG6C 2DJSA 4NKOA 3CC1A 3SDAD 1QTSA 1KJ2L 2Y6SD 3TN0D 5TTRA 5CEXA 3TJLA 4W88A 1VZIA 1S7VB 4P4RA 2YGVA 3VFNA 1MREH 4GMSH 5FA5A 4AMCA 3CQPA 4F15C 1C5BH 2E5CA 2NW3A 2P46B 2YAQA 3GBMH 1LQAA 3IUDA 3ZZQA 5T5FL 4HAKA 4NUJA 4UQEA 5BU6A 3CFMA 3FQNB 2Z29A 4OJYA 1U8NA 4IISA 5IHRA 3UY7A 1OFAA 3JT0A 5IFPA 2VD9A 3DV4A 3X1GA 4ABWA 4AQAA 1MN4A 2E47A 2AJVH 5HJ3B 4MCNA 1R9FA 4H8QA 2F8XC 2E9MA 3MRNA 1IEBB 1DJQA 4XP6L 2Y70A 3R5EA 2IQ0A 1HQ4A 3IM1A 2DYPD 5B38A 1VBJA 1EHXA 3HE6A 1LMKA 3MSPA 3W2UA 1IEVA 2QCMA 1B4JL 5EBWA 1JK8A 1EFXD 3FU5A 1OT1A 1YW1A 1UM5L 2LU3A 1XLLA 5EU6D 1RL1A 5AZEL 3GNRA 4NI3A 4B5VA 4OUUA 2XFRA 2GUUA 3NXFA 2ZIDA 3G77A 1KEGH 4LLMB 5H2BA 1F1AA 1H3TA 2OI9B 3LIZH 2K8MA 3L08A 5DTFA 1AGEA 4Y4FD 3ZTCC 2OMVB 3HBGA 4RMTA 2CGYA 1QD0A 2VDLL 2WV8A 5KOVC 2R29H 1ZVNA 3IFLH 3RX8A 5E5LA 1I2OA 1NL0H 4WTWA 1C9DA 3SQMA 1OOAA 2WLHA 4EKJA 4LSUL 3DX3A 2B08A 4JN6A 4K71B 1YDYA 1BGGA 4U2ZA 2D22A 5E6IA 3CZLA 4AUYA 1ZCRA 3KXFB 3OGCB 2DLIA 1SR9A 4ZDHB 5CWSA 3WLBA 3SCTA 1OE2A 4XP4H 4C65A 5F0PB 3BAKA 1XBZA 2FGWH 1Z7JA 4G6KL 3GJFA 1FE8L 5IBLD 4DGWC 1NC2A 5EO9A 1WQVT 3S6CA 4QD2E 4G3YL 1PKMA 4PJGB 4DELA 3R8QA 4JJOA 3GRGA 1MO0A 2Y25A 2CLZB 1N8WA 4W1TA 4R3SA 3T0WA 1VPXA 3I9PA 2ZKXA 4BK9A 4JGUA 4X9YA 4JTAA 3RVUC 3CVIL 1DBKL 3U30C 2WZ6A 3GZOA 5D6CB 2OZTA 3WNMA 4XVSH 1UJPA 2G5WA 1EBHA 3WENA 1T20B 4L61A 1KR1A 4G7SB 1PMYA 1MCSA 4Y19E 4G6AD 4OFVA 4FQQA 4OZFG 1BZ7A 2PCPA 3X1FA 3MYOA 3BPLC 3NPSB 1CLOL 1SUHA 2BVOB 3P60A 4GY1A 5HWNA 4DJDD 5IHZB 3SDAC 3TN0C 2Y6SC 2R8SL 1FWSA 4NQTA 2PR4H 1ZPUA 4F7EA 2IH3A 3DVFA 4JTLA 4MAVA 4NQ1A 3P82A 3CASA 1H19A 4V1YA 3NWRA 3T71A 5L2KB 3CLWA 2PDJA 1KXTA 4FFTA 4H1ZA 1NCWL 5I0YA 1M7DB 1GVEA 3PDGA 3PQYB 4PGZA 3W7HA 2G8ZA 3AIWA 5A95A 3S42A 4KEUA 4ODTH 3L2MA 3UTPD 2VFHA 2IANB 2APBA 3GTNA 5D6DA 1YEEH 2WYZA 4BI6A 3U57A 3IFPA 3NQ2A 3HS0B 4GNKB 1W72A 3IDJB 1QSED 3S7GA 1URIA 3DRTA 5I8KH 4KWOA 3ZHDA 2BHUA 5IMLB 4QHKI 2FYVA 1IIHA 1PSCA 3CV2A 5C07D 2YUZA 4ZMXA 3M46A 4DP7X 3FUNA 4OFYD 2X2JA 4KXDA 6PAZA 1T7WA 1EZVX 3UZQB 2GK0B 3FHAA 4PI0A 1OAJA 1B0RA 4XO4A 2R2HB 3C12A 2I85A 1QWNA 2XC8A 5GRZA 1E6SM 2BOGX 4HW6A 4XB3A 2ZONA 3C61A 1P4IL 1J8VA 1IYXA 4U1LA 3NOEA 2IPGA 1LK3L 2BDNL 4R88A 5L88H 3CX5K 4Y4FC 2E68A 3SY1A 3TF4A 4NAQA 2D7OA 2F5BH 2ZG1A 1A6TA 3BL3A 5EWIH 3CG8A 4P2QE 2HRHA 4P46D 4GXVL 3NQDA 4P3DB 2ESVE 5C0BB 4GVFA 4IX2A 2BINA 1U8CA 2CLFA 2CLVB 4H9XA 3K74B 1AE6H 2PPCA 3CAFA 2GWGA 5BOPA 1V79A 5I06A 1EJ6A 4QRFA 5EB9A 2XVNA 4KO6A 1HJSA 3OKDA 5F1VA 4ABUA 4LB4A 1JXJA 1EYEA 4K15A 1BXXA 4AD0A 4JJ5B 4E42A 1UWXK 5JORA 5FECA 1KIRB 5A2BA 5IBLC 2PP7A 4IPJA 4M6OL 3MBEA 4YIQA 4HJGA 4NKQB 1XG4A 3SGKA 1FQ0A 1FWAC 1BJ8A 4K7YA 3E5BA 2FQDA 3TO2B 5DSCA 3SYAA 3JZ7A 2IDTA 1PIFA 3L5MA 1MQRA 3N6QA 5F1NB 1GIGH 5CAKA 2RHEA 4WK0B 4HOXA 3SW6A 4OJDH 3W39A 4YEFA 2XFWA 5IW3A 2CD0A 5E6IB 3L16A 1AGFB 3I7SA 4FTDA 2EDWA 3FT4A 1ESOA 1SJDA 3SKMA 4G6AC 1K03A 5CWSB 2CXEA 4TQEH 1Q1JL 1DYSA 4FABH 2H41A 4MZRA 3C60B 3GJFB 5A7BA 4IJBA 3DH7A 4FS0A 2HT4D 5IGXL 2AOSA 2Z3FA 3AU0A 3URAA 2BHYA 3BWSA 4IBTA 4JFDB 4B5EA 4DJDC 3UXDA 4M6NH 1YN6B 3ZTNH 1ITXA 4JB9L 2QPXA 3RUGE 4FMVA 1TWZA 1SOSA 1A1NA 1S39A 1TWIA 1FDLH 2R7EB 5AVQB 4L4VE 1AC0A 3PAZA 4AQEA 1R6WA 3VQLA 2BFVL 4LB8A 3CWNA 3ZYJA 3NJNA 1AQDA 5EZOL 4YXHH 1E4WL 1OAQH 1Z41A 3K71B 3MO1A 5AW6B 3MJWA 4E38A 1U4FA 4OZ4A 1TG7A 3OQRA 4CD6A 1IKNC 2H32H 4C57C 3G1SA 3HGSA 1S2AA 2PCPB 2HNEA 5EORL 2BIMA 3QUMH 4G6MH 4AGLA 5KSAD 4QJ3B 3IDXH 3S34H 3VXME 3NCYS 4PRRA 3M0YA 3NBNA 1RJYB 2E28A 1LEKA 4KCWA 3QQ3A 4F7KA 4KDWA 5I30L 2IGFH 4X7SL 2W1NA 4C6CA 2E09A 3MJGX 3US9A 4GIPD 5CD3B 4ZXBC 1NGYA 2QFPA 5E2UH 5AOIA 5ECJE 4IBYA 1KN2L 3ULVL 4AVHA 2EE9A 4Z7NE 2QQKH 1I2QA 2X1OA 1NDMA 3BH9A 1ZA6A 1EA0A 4XOBA 4F58H 2Q8BH 5F4WA 4KRNA 4LSRL 1E9YB 3GSRB 2HS6A 4TMBA 4PY8J 3QEZA 3DBPA 3FFSA 1LJYA 3TEYA 3SE8L 2A3TA 2IG2H 4P46C 2P8PA 3SKNA 1OD7A 2O72A 4M5PA 1N4XL 2WBKA 4PRAB 1F7BA 3C6EA 4ZMQA 2RFXA 1TDQA 3CPRA 4MWFA 4EUPH 4BWLA 2DZPA 4ZYKB 1OF6A 3A22A 1QVBA 5E08L 1AODA 2P3EA 1Z0NA 1UW9A 5A6LA 5E0KA 2P5PA 1OFPA 2D1ZA 3SR7A 2XHYA 1JPEA 3MACH 3EH2A 5BUAA 2Y62A 2OX4A 5T1DH 1IRAY 1QVOA 3NIFE 1G7QA 3LHVA 4OV4A 3WYZA 3NQIA 4NX0A 5KVDL 4ACZB 2VWSA 5PAZA 4QO1A 1A4CA 1A6TB 2KZBA 4E6MA 1QHZA 1E9LA 1UMLA 2WGXA 1MEXL 4YHNB 1ZANH 1EJWC 5G5IA 4LSSH 2N3JA 4M1RA 3G6MA 1GOMA 5IEKB 4QYAA 2XZAH 1KJVA 2D7MA 3GS4A 3IF1A 4UB9A 5CCHE 4HA0A 4WDIB 3A9IA 2MCPH 4AB4A 4QHLA 1YBQA 1K2DB 3NZ8A 1SRDA 1XZWA 4NWTH 1XYFA 3WFCH 2I69A 3TWAA 4FX6M 4RV8A 3MOQA 1RJZA 2PDYA 2E4FA 1NLBL 3N3TA 1GZQB 1JK9B 1FN4B 4KAQH 2YMXL 1IGCL 3BW2A 5K39B 2HT4C 3SPIA 2AKMA 3L1OH 1XL9A 3VCRA 3DX0A 2KS0A 4OZFA 4A68A 3S5NA 3SDCD 4H1LB 2E67A 2P5ED 5D7IB 4NNXA 1BVOA 2VLRE 3BKCL 3APFA 3FK3A 2ZSVB 5ESVB 4JFEA 2PLCA 3LXBA 4OLVL 1KQYA 4X7EC 3BVTA 5DSCB 4JFVA 2ROXA 3EXTA 1D5RA 4E8DA 4ZEPA 3T5WA 1B6DA 4G1EA 4IRSA 2YRZA 3W39B 3L9BA 1A5AA 1X9RA 4Y9MA 3M7FB 4AENB 1AA1B 3HURA 1JMXA 3G3DA 1UWGL 1I8JA 4NYLB 2I7SA 1XIDA 4V27A 4B4FA 1JZ2A 2QSCL 4LRSA 1CL7H 4JDEB 4HIQA 1TJIL 4OJFL 2DP3A 2PCQA 5KSAC 3HI5L 4JFWA 3WEOA 2D73A 2CZDA 3AU1A 2CCWA 4CCCA 3FLUA 3WHXA 1MCOH 4WW1A 2EXSA 1X5AA 2JK5A 1WAWA 1PQZA 4FQHA 1FWCC 4LVNC 3MX0B 4O02B 2G9KA 1HCYA 4IU2A 2FX7L 4MWAA 3SDYL 1FWEC 5HYIA 4WV1C 5HDQL 4TV3A 5DD6A 3MHGA 4IZGA 4MUZA 3UJFA 4PBVC 4Z7QF 1A2YA 2QGDA 2V7NA 3BOVA 3STLA 3ELQA 4XTDA 4Y5VA 3C8NA 4XCFH 5C09A 3ZL4H 3ML8A 1EEYB 1DJZA 4X6DF 3UZYA 2MJWA 1E4XL 4ZO9A 1IR2A 4ZW7A 1P4BL 1R33A 1SPQA 4S2SA 2V3EA 5I9QC 3AG4B 4Q9BA 1UYWH 5DHVB 1ET8A 1ISZA 2R0ZH 4JKMA 2FLMA 4DEFA 3PLYA 3APYA 4YLWA 2YPLA 5DVOA 2GK1A 5DJ2B 3TH4T 4KPLA 4R4FH 3A3XA 3MS8A 4QLLA 3POCA 3TA3D 2DQCH 1YEFL 4AXWB 1ZEAL 2QKFA 1MMFA 4OZHB 2GBTA 4PMOA 2F8OA 1DQQA 1MJ8L 4Y9OA 1PVHA 1FGVH 2NY3B 3VMNA 4NJHA 3W82A 1RU9H 1Q65A 4FOUA 2EXOA 3QFJE 2YGYA 3OZ9L 4H6EA 5LNSA 2QBWA 3DX6A 1KC5L 4HKXA 4L1GA 5AYXA 4GG6B 2BCKB 4LEEA 2B4CH 4S11A 4JGMA 4B9IA 3UIZA 4BF7A 3WXVL 4ZUVA 4NZCA 4XPGH 2XBTA 3IXTB 3MJMA 2DMBA 5EU5B 1BFVH 3WQ4A 3VIKA 1L0PA 2RFXB 2GT9B 4ERAA 1XMWA 3IDUA 1J6PA 4RISH 3WBXA 1T03H 4Q89A 2QZQA 3V0VA 1N5YL 3VI4E 4ODSL 3UGXA 2ADIB 1P4CA 4AYEC 3T8MA 3F58L 1R0AH 3HM7A 4RBPH 2AV7A 2VN5A 3FCBA 5CCKH 5C2BH 3SDCC 5FHAH 4ZW3A 4KETA 3CDFA 1Q6DA 3H4WA 1LQ2A 3QIWB 3QXBA 2RMNA 4WK2B 1JPSL 3JU2A 3NPWA 1PVNA 1VH7A 4R4BA 3X3FL 3Q9QA 2AK4D 2P48B 3HB3B 2A9NH 1DBJL 3MHFA 2PXYB 2J8UF 3VXOA 4UQ2B 5A8GA 4Z7OF 1YMMB 5CGTA 1EHLL 3AQYA 3MRMB 2DY2A 4MD5B 1QTYT 3A67L 3GI8L 3NZ8B 1G1YA 1E9OB 5IOPB 4LQFH 3RPBA 3O45B 3WBDA 2DQHH 3E38A 2CDGB 4ZENA 3BAEH 4R84A 4Z77B 4NPKA 1RK1A 3S96B 3K4ZA 3AAZB 5J1SC 1HUVA 3MV9B 5E5UB 4MD0A 4JANB 2NNRA 1CR9L 3PGFH 2GL5A 5DK3A 3VXRE 5AHLA 3RWHB 4BCYA 1I0DA 1TFPA 3WGUB 3GK8H 2N56A 2UWEF 3DGDA 1R2RA 4ZFZA 4XX1E 5CN2A 4KCTA 3MT1A 1S7XB 2GJ6A 1CBVH 1IIKA 1JZ6A 3FO9B 5D1QE 4HEPG 3ARWA 3CSYA 4DKAA 2FWUA 3GLAA 1AANA 3T3ME 3OBKA 3PF3A 3CFDA 3LPPA 4QNPF 5CJQL 3BV4A 3NRPA 4GW5B 4EBQH 2BNRA 3GRWL 4PHXA 2IPTL 3BAJA 3V6FA 3W22A 4OT1H 5I5JA 5I6SA 1EC8A 4NJKA 1NKRA 1P5BA 2JB6B 2WXIA 3AU1B 4UTHA 4HVXA 5D04C 3W29A 3BLBA 2X89D 1Q0EA 4UBDD 4G8TA 1U22A 5CGMA 2ZOOA 4WW1B 1F3JA 2VKXA 1H3XA 3TA3C 3BZGA 3VCLA 1WFOA 3VABA 1AZZC 4JNXA 2BZDA 3VNJA 2A73A 4HWBL 5IB1A 4XBEL 1MCDA 4HU3A 4FFYH 1QRND 2V7NB 2HTKC 3STLB 5B39B 5CHNB 4DUVA 3WLOA 4XO3A 2LGNA 3HFYA 5H37H 1J8HA 2COVD 1TVBA 4GB9A 3PWJA 1V0NA 2CO3A 2V5YA 2AFNA 3HA1A 3A4DA 1RH8A 4S2SB 3GNOA 4X2RA 4TQIA 3NVDA 4PLNC 3BXNB 3FOMA 3WE6A 2V9DA 3JTSA 3Q5YA 3IIPA 1CFQA 3D30A 4OAWB 5E2WL 1MPAL 3TJEH 3KWVA 1CGSH 2Q09A 3BHBA 2W07A 1IBGL 2P8MB 3RGVA 1F73A 4JEJA 4RRPM 3VVVA 4S1FA 4ES9A 3JV0A 4AZ7A 2Y7QA 5EA0H 3V7PA 2D03L 1EJSC 5AG9A 3HZVB 1AI1H 3AMCA 2XWJA 1FG2A 4K7PL 4HC1H 1OP5H 3HI1B 4HG4J 1PU0A 1QR7A 1UP2A 2GTZB 1AXSA 1IZJA 4MZ8A 3SIKA 1JN6B 3J07A 3EA3A 4MGXA 1EQCA 3B0UX 1UBSA 2JJUA 4QHPA 2PWVA 4C91A 2B0SL 4GNVA 1HZHH 1TG8A 3KBMA 4K3DL 4D8PB 3W57A 5IMOB 3G5ZB 2F6KA 4PSRA 4H7CA 1TTFA 3V0VB 5K1JA 3H9SB 1OWWA 4E2DA 3WUWB 3K2MC 4BZ1H 1NWUA 5TE4H 5ERWB 5C6MA 3EBIA 3HJEA 4M4RA 1MJJA 3FKRA 4HNNA 3B8IA 3TF7C 1K9DA 1JS4A 5IV2A 4A7VA 1B3WA 3MANA 4JIIX 4PMRA 2BS71 2WB1A 2NWSA 2FNWA 3CNKA 2JKAA 1BVNT 3DWTA 4R4BB 2YL5A 1JV5A 3I6LD 5CAYB 1FXPA 4LVDA 4LASH 3SGZA 3MV7D 3MVTA 5DQDL 2CRMA 2OJ1A 2Z35A 1O9ZA 3CMOH 4JTSA 3MRJB 3LS5H 4O28A 4RX4A 3CPGA 3VXTB 1SF3A 1KCVH 1N59B 1UXWB 1HXKA 3D0LB 2Y0FA 4P4KB 4NHVA 2X9WA 2QQ6A 2CGRL 4DF2A 1IVLA 1LK2A 1R19A 2HX9A 2REQB 4S23A 2JALA 2XETA 4PJBE 4L5FE 2ZF8A 2VL5B 3GSWA 4NZJA 5E8OB 3IFOB 1V27A 4HNCA 1UROA 2WUBL 5AVYB 1J79A 1N68A 3M0XA 5AHNA 1RJCA 3PG2A 1HK6A 3ILPB 1KPRB 4UBDC 5DWUH 1DBBL 3M1BB 2Z34A 3SPVA 1E55A 1FH5H 2R1YB 4KUCD 2OU4A 4HKBB 1H8NA 3EGSB 5EF3A 1S9YB 4A6YH 1BMGA 3TBYA 4HOMA 4UCFA 2VX4A 4LP8A 3TT3L 2EEAA 3U36B 1ZS8A 3RFZB 4WHCA 4HKPA 1BYAA 1KPUB 1I8MA 4HV8A 3CQFA 1HVQA 1IC7L 3L7FA 5FO7B 3CFDB 3IS4A 4TUJA 1W1PA 5ID1A 2DQIL 2YLAA 1R5IB 3F7KA 5T3XE 1X5HA 3V6FB 3L3OB 2DD8H 3ARFC 4O2EA 2FB4H 4PRHD 3C2VA 5GQBA 4CU6A 2OQJA 2EUXA 1A9BB 3P3YA 4J39A 3Q58A 3WS6A 5IVXA 4OUOA 1UB6A 3IU4H 1WOAA 4GO6B 3RPIB 3NQKA 4D7PA 2D23A 4GIAA 4CNTA 3P0VH 4FP1A 5ABDE 2F9RA 2LFGA 4K8RL 5HYQB 2XY2A 3ATAA 2IWKA 4L29A 1YEKL 3AMKA 1IX2A 2FAUA 2FKPA 5L9FA 4KUCF 5C0ND 4LHQB 5DEZA 1H7RA 5CMAB 1PCSA 4JNMA 1ZDQA 5FYJH 3C75A 4XN5A 2XFXB 1IGMH 1A1MA 3BZEB 1TVBB 4NFDA 3D87B 5KTLA 3EJYD 4JN2A 3VXNA 2XPKA 1X38A 3FCTB 4FAMA 4W8AA 1U8MA 1SSGA 4CMHC 2PCFA 1MYRA 3GKWL 4V11A 4XBGA 5JIMA 1Z5LA 1SLXA 4TULH 3UZEA 3JTSB 3ABMB 1MXGA 3BIAX 3WFDH 1CZ8H 4N68A 4U1NA 1T5WB 4L8BB 2X6MA 5JIWA 1U8IA 4U0RC 4UMCA 4G8GE 4XPHH 1H0DB 3VXPA 1KTCA 4ONFL 3STZB 1HKVA 4Y4HB 3GJFK 3HNSH 5DT1L 3NIDE 4YZFF 5IVZB 2X4TA 4Q8VA 3FA5A 2EDQA 1J1OL 1W80A 2XTJB 2ITFA 4X5XB 2XWJB 2LLEA 3Q45A 2HISA 1RZ8A 1FAIL 4TSBH 5JOFB 2FPTA 2X1XR 5FYKE 1RD5A 4U1MA 4P8UA 4NN6C 1E2WA 3U1SL 2DQTL 1TQUA 4FFZH 1QFWL 2Z31B 4I0PD 4U6HA 3ARBA 4L1DA 1M9WA 3H2MA 3N4FA 2QF8A 1KBPA 4HIJA 1YMHB 5F7UA 2VLKA 3H26A 2D24A 3ME3A 1T7LA 2X0YA 4QG8A 3L3KB 3WDHA 2BVQA 4HEPA 4TTGA 1WICA 4XZUA 4BFRA 5HHOE 4JRXD 2EDNA 3WSQL 4IFOA 3BWAA 3XINA 4DUOA 1I1AD 2PURA 2ZJSH 3ZVVA 5CC5A 2FO4A 3MUZ1 5IV2B 4MJIE 3AB0C 4DESA 3UTSB 2E7LA 1PEWA 1XXXA 5KN5A 3BMXA 3WIJA 1GT8A 4D6GA 1XFCA 2C18A 4CC4C 3F05A 4RSYA 3MV8B 3EOTH 4PCYA 5CBIA 3JBG7 3L65A 4CSTA 1VQTA 4CSZA 1A14L 5J8OA 3H2CA 1NANI 1XCFA 3VDBA 3VVWA 1NLDL 1JGVH 5IB4B 5EEWA 1A25A 3G8RA 1WXYA 1I7ZA 2KMWA 3GYEA 1PZBA 1OG6A 1UM4L 2P4AB 4Q6YA 3HG1E 4K07A 5LG1A 1KN4L 1IEIA 3AUVA 2C1PB 4M1DL 2Z9TA 5FA3A 3QIBA 3ARDA 5DA0B 4ROPA 1L6ZA 2PLKA 5J5EA 3S6OA 5FKAB 1JWUA 1GVFA 5IDZA 3MPCA 1ZJBA 3QV7A 5HGDA 2HJLB 2BRRL 3FQUA 3TEVA 3ME0A 4JFZL 3RUBL 4F27A 3UX9B 1MFEH 1W91A 3MZ2A 2X7WA 4F9PC 5C0NC 5CKSA 4DSYA 1U8LA 3FT2A 3N6JA 2OJZH 4OCXL 4MSWB 2PBGA 4ZPVB 3ZO0A 5DO8A 5TQ0L 4CKVX 2QKSA 1G6RL 2DF3A 3Q9PA 5EBUA 4U1IA 5IM51 4X6FA 4JO8A 3C2AL 1OAUH 3WO8A 2QV4A 4LPXA 4RMWA 1TR1A 4D6DA 5TAOA 2IOIA 5CPMA 1PV8A 2DAVA 2AEWA 1Z3NA 4FP8H 5M17A 4XCYA 2HLAB 4MVBC 4LIQL 4DJEA 1LEIB 1C08B 4HBKA 1GQKA 3PNZA 1XGYH 1ZWIB 2PDQA 4FX8A 4BCZA 5HJLA 3CK5A 1CICB 4HQQH 1S7VA 2VSMB 4DHGA 1K85A 3F4CA 3TV3L 3NL5A 3NACH 1URLA 5KVFL 1S3TC 3TTYA 4F66A 4WUUB 4YL2A 3J8F7 2N4IA 2V67A 3BJ91 4ZFMA 2WSDA 3NABH 4G6JH 3S98A 1BVZA 3FQNA 3MJ9H 1NQ6A 4ZNEA 3RP1A 3QZOA 4MQTB 4I0PC 5C0DB 5HJ3A 4PUWA 3MLYL 2ABBA 2ED6A 1NWPA 5C0AB 3WKNA 1IEBA 5FYJU 2FMOA 3SB0A 4UQAA 1AS8A 3KWXA 2AXWA 2JJTA 3ATYA 4TOYL 2KBGA 2ADYA 3VOCA 4ANXA 3VXPB 3VI3F 1SLUA 5H8UA 4OLZL 3NCJH 1I1AC 1UEYA 4LPVA 2DM3A 3NO1A 4BFFA 2NY5H 1NBZB 4DPCX 4F57L 1NUDA 3A3HA 3KCOA 3PWLB 4Q22A 2AXFB 3F2BA 3L1GA 4WK4B 2QELA 4UWMA 3I4KA 4NY2A 4FOJA 4L9ZA 1KFJA 5JH2A 4IKLA 4J3VA 4QDWA 4LLMA 3FU3A 1BG9A 3HMWL 1E4KC 4H2HA 1E72M 4EACA 4FXKB 2B5IB 3BSMA 2YX0A 2OMVA 1HWHB 1UWEH 1D5IH 1CXFA 4Q6IB 4RDQG 4NM4H 1MIMH 1CTNA 3EBVA 3H70A 1H51A 5ABAA 3GBLA 4RNFA 5BW7A 1F4AA 3TYGH 1SQ7A 1INEH 1BF2A 1GGIL 4QLRA 1K3UA 3QPYA 2WCAA 1C29A 1WX0A 1T1XB 3KXFA 3OGCA 1MI5D 1BQCA 1CXHA 1GPWA 1VYPX 4JYFA 4MTVA 4ZDHA 4WI6A 5GSRB 4E41E 1DVFB 4BFNA 4U7KA 5F7WC 2Y5EA 3F4NA 3W1TA 1P0NA 4KKAC 1LVEA 4LRNH 4JY8A 4PR4A 4JTKA 1KM4A 1TF4A 1UGNA 2GGEA 1SN5A 4RRPG 2FPVA 1ISYA 3DZ1A 1EWHA 5KOMC 4YDNA 2DZSA 4TVUA 4PJGA 1T0PB 4MNQB 1WLHA 4JFUA 4CC0A 5F2MA 1OCRB 4WDXA 5D5MB 1MFVA 2XH7A 4LBUA 2CLZA 3QXVA 5J12B 2J62A 3DN5A 1DL7H 3L1FA 1LQ0A 4NN7B 5L4IA 2NX5D 1I7ZB 2ZOTA 2ICWI 4UOQA 4WTQA 5EPMB 5D6CA 4YHYC 4A4AA 1LDPH 5I5RA 3QNXB 2D9QB 1HJUA 1T20A 1KEML 1CIUA 4LW7A 3WLMA 1TU2B 1NDVA 1CQYA 1QNPA 3JV5A 4Q52A 4H1LG 5DDHB 2ZBTA 3RY6C 2GIXA 3NG5A 2GSHA 3T05A 4IGMA 3KBEA 1Y1UA 1AL7A 1F58L 1NICA 2QADD 4QRRE 2B39A 1T5XB 1MG3C 2BVOA 1YEGL 1D3GA 1SPDA 1PTGA 4NG3A 5IHZA 3HNTH 2E7FA 2ORBL 3O6FD 1XHHA 1T1YB 1IT0A 4D7BA 2XFYA 3N40F 5L2KA 1QK2A 3ARUA 5D8WA 1SY6H 3TAKA 4F0HA 1HL8A 1NDWA 1M7DA 3MHUA 3PQYA 3RVUD 2CU0A 4N0RA 2MNUA 2IPKB 3NQCA 1L6YA 4X4MA 3OW1A 1IFHL 2BVYA 5HNTA 4UTBA 5DR5H 2Q3AA 3FO0L 3VTTA 3WIHL 5H2ZA 3HS0A 25C8L 4JOMA 3GO1H 4HKJB 3IDJA 2GITB 3QYNA 1JCJA 3RPKA 1KCLA 3V0DA 5IMLA 3VFGL 4PUMA 5KYNA 3GI9L 4X8CA 1T83C 4UR7A 3UZQA 2GK0A 1I45A 3IJDA 3S3PA 4PJAB 3BO9A 3T8QA 2PPEA 4LCCB 2R2HA 3VUSA 2I9EA 1OG0A 3DIFB 1MFMA 2IJ0C 1P7BA 3RGHA 3M5XA 2APTA 5A2IH 4JHWL 1LXMA 3NAAH 3B97A 4BYHA 3N43B 2OX5B 3FF7A 4P2OB 1GPOL 5D93B 1UIOA 2NOYA 4M5YH 3BAYA 3FFCB 4DAGL 2ZNXA 1BCIA 3HCVB 2IKJA 1AHWB 1XV8A 2XIBA 3CFCL 3JWDL 2A7BA 3QYMA 1SDAB 2ZUXA 4PBGA 4P3DA 5C0BA 1XKYA 6REQB 3LS4H 4WCYL 4LVAA 5SWSE 1A7OH 2CLVA 4TVSa 4O58H 2F53E 1KNWA 1KIUB 1L9PA 1R3KB 1FL6A 3O9NA 2VFEA 1U8PA 5JA9A 2CLIA 2R0LL 4NAJA 3ZGIA 3ZDYB 3KP0A 5DMNA 1TJRA 4JJ5A 3MODL 3B05A 1XIEA 2CKNA 1KIRA 3G3LA 3BPOB 1CBGA 3DG6A 3KS5A 3X3GH 1M7IB 3ZO9A 3PZIA 1FRGH 5EF0A 3O2DA 3O16A 5LBSL 3BFWA 1KGXA 1T7ZA 3TO2A 3FSZA 2BNQD 5C0QA 5F1NA 3Q2CA 2IFFH 4CUCA 2XZQL 2JH2A 4KZCA 1J87A 4PUNA 3PAVA 4KT2A 2P3YA 2CRZA 1MEHA 1OFQA 1AGFA 1V3KA 4KFNA 2HKFL 4OM0H 4U1GB 1S38A 3O15A 4LB3A 3GMPB 2K45A 1YPZF 5B7EA 3SY5A 3VW3H 2DGAA 3C60A 2QADC 3TQKA 3T8XB 3VGBA 2NMSA 2V2WB 2VZUA 4JFDA 2R91A 4AT6B 3SIZA 4HS3B 3PY9A 1JPIA 1YY9D 1YN6A 3O6FC 2H8PA 4HS6B 1NDYA 1L3NA 1ZP3A 4TIMA 1F86A 4KO9A 3QZLA 1HSAB 3OMIB 3WN6A 4MMYB 2R7EA 2ARJA 3KLKA 1T6MA 4HJFA 5AAMC 1M05B 4N5ED 4WEBL 3I9GL 3KFTA 1QFEA 1UB3A 2YBUA 4DI8A 4FD0A 3K71A 5SV4A 5KMYA 1W2VA 4LC8A 3WJZA 3N17A 4JHBA 5JHMA 2Y63A 1KZYA 3NL6A 5KSVB 4CGTA 1BIIB 2NXIA 2WKOF 3KJ6L 2AC0A 1GYVA 4LEXH 3L5WA 1RJYA 4MJ6A 2A9MH 2BZ7A 5DD0L 3Q01A 3GUTA 4QYOB 2PKDA 5CD3A 4Z2KA 5JPNC 1C1EH 1R3WA 3WKML 2EF9A 3DSFL 4MUPA 1TX2A 4MKSA 2J24A 3FB8B 2EH7L 4LK4A 1FKWA 2EPMX 3WEBA 4IMDA 1OGGA 2RQ8A 5L8LB 3CHQA 3GSRA 1SO5A 4C5YA 2WC7A 2J7HA 3EFOB 3GLCA 4JGNA 3WD2A 2HRPH 1ZFJA 1SJEB 1K72A 3FQ2A 3UA4A 3OX8B 5GHWH 1XX1A 1MCHA 2INZA 4PRAA 3NFPB 4Z7WF 4ELMF 4YTRA 2BVWA 1A6WL 1JTTA 2NUXA 1PLBA 4ZXBD 3MGOB 2YZ8A 4ZYKA 4NP7A 4EIBA 1QNSA 3PF2A 3NRQA 1AKJD 4HH8A 5TF1H 1UWQA 1AMKA 5B39G 2W0FB 1JCMP 1FCVA 2RGMA 3S35X 4Y9AA 4XUYA 1PFOA 4UT7L 4XAZA 1DBAL 2XKNB 1OE1A 2EIZB 4B5TA 1VFLA 2OGJA 4URTB 1L9SA 4ZUUB 4L9LC 4RRPA 4ACZA 3CFUA 5CCZA 5CIPB 2DT2A 3DI0A 1OCQA 2HVMA 4A63A 1DJHA 4I6VA 4ALDA 5AZUA 3K6IA 1ZVYA 4YHNA 1AD0B 1Q6RA 4NDMB 1OKEA 3WKQA 2JIXD 3N14A 4BQ4A 5IEKA 3O4LD 2EG7A 5FGSA 4RWYL 4URIA 3RA7H 4UXDA 4WDIA 4GO9A 3GG8A 4H25B 4N2DA 3PTQA 5GGQL 1K2DA 1NCIA 1V3HA 5DRWB 4OKVB 5TK4A 2VRAA 3FTWA 5J5RA 1FL6B 5EL1A 4AD1A 1LL6A 2YD8A 1U8PB 2XTLA 1GZQA 1JK9A 1FN4A 1M1SA 4AXKA 3UF9A 3TR2A 4IWWA 2O4MA 3MTXA 5K39A 4KKNA 4S0HA 4JN1H 4H1LA 1VFFA 3E49A 3NGBB 5D7IA 3SJVD 4QDGA 1KV3A 5GS1C 3TBTB 1YY9C 2ZSVA 4MS8D 5ESVA 2BX5A 4G8AC 5LXXA 5JQ6H 3US0A 3V0IA 5BZDB 3CVHH 4XE5B 4N5EC 2WMHA 4M93C 2C9RA 1CS6A 3LNHA 2FZBA 4JTJA 3WUWG 1KCZA 4IW4C 3NQGA 2J55A 1R3QA 2Z92B 3MLXL 1KGIA 3QPXH 5EO1B 3ILDA 4AENA 1JVNA 1E6RA 3LZ3A 1XD0A 4NYLA 3BDKA 2G3FA 5F93C 4HPOH 4GRLD 1LL1A 3ZE2E 5DZAA 1SFDA 4QEEA 4JDEA 4X83A 1OK4A 2DW5A 1W9XA 5HMFA 3G0UA 3QJSB 1B3YA 4Y9GA 4HNUA 2A4AA 3UU0A 2PB1A 4U10A 4P9ML 1QPPA 3GSNB 2H8PB 2F74A 4MB1A 5IBUB 2IF7A 1ACXA 3QG7H 3MX0A 1BD2D 1I60A 4O02A 1KWKA 1XTLA 1NUGA 3ARXA 5FJJA 4JUSA 3ELFA 4KHXH 4IIDA 3HB9A 5CEZD 2ARJB 2TSAA 1WNOA 1O4UA 3A4EA 2O5YL 3N5AA 1W5MA 5I16B 3GNMH 2V2DA 2AV1B 4LEFA 4G7YL 1QHOA 2Y7FA 4IP4A 4YBLC 1F74A 4PL2A 3UPCA 1YQVH 2K4AA 1HJXA 1EEYA 4YK4C 3QEQA 2VFIA 2V3GA 1TCDA 1N0XH 4PJFB 2NV1A 5JHAA 4WSJA 5DHVA 3F4VA 4UQCA 2XXMB 2ZCHH 1XYAA 4YDIL 3L5WB 1V93A 4UMAA 4PVMA 4MJ6B 2B7QA 4A2RA 1EPVA 1EZVY 1X9UA 4ZI8A 3KTXA 5DJ2A 2CE6A 5D2YA 3GUTB 1Q2RA 3DTDA 3OB8A 1LP6A 2QULA 4JQIL 4AWUA 3G1XA 4Y2DB 1U91B 1EWEA 3TZVB 3W70A 1YE6A 1MZRA 4AXWA 4YHOH 3CPLB 4OZHA 3B2VH 1XL4A 1ZBCA 3HUJB 5I6PA 3T09A 5HYSB 4QTIL 4AX6A 3QCVH 3BSZL 4QT5B 1QO5A 4BK5C 3FTUA 4JKWA 1IGTB 3AHVA 1MUMA 4FQIL 1GVSA 5LNWA 4RA3A 2ENSA 3H9HB 4XAGA 1E1EA 3ZJAA 2N7BA 4GG6A 1KT2A 2BCKA 1SVCP 2BC4B 1IM9B 1FYHB 1DWFM 3WH7A 1D7BA 2AABH 1QA9B 2K0RA 1T40A 3L68A 1AZBA 5F1KC 5FLVA 3IXTA 1H60A 3EO9H 5DHXB 6FABH 4J28A 4B2DD 1WUEA 5EU5A 1T80A 2QHRH 2GT9A 2CDFA 4OLYH 4A2GA 5CILL 3TEXA 3GYCA 4KWUA 3B9NA 2IQDA 4DBSA 2ADIA 3UCDA 4CN6A 1WK0A 1YRKA 4FHAA 4IQDA 3KOFA 2AQSA 1D2PA 4J7RA 5GRVK 1DJIA 3VD9A 4KVNH 2ZE3A 1QI5A 3U7WL 2OL3L 5IT2H 1IAOA 1XGDA 3QIWA 4MS8C 4Z3TA 3UESA 3CT2A 4OV6F 2EPKX 4FYTA 4YSCA 3IK2A 4HPYL 2DQEH 4ELDA 1IJ9A 2NY1D 2YS4A 1SSDA 2PS2A 1SVDA 4PS7A 4OIAA 2O0TA 3OPSA 3TYEA 3U9PH 3OHXB 2VGBA 2PXYA 4UQ2A 1YMMA 4EI0A 2QKIC 3MRMA 4MD5A 3OC5A 4ZMLA 1QYGH 2HB0A 5IQ7H 2BSTB 1BYCA 1A66A 4MA7H 1E9OA 5IOPA 2GG1A 2EVHA 3O45A 1MFDH 4N2LA 1F8TL 3QCUL 2X1PA 2CDGA 3NEOA 4Z77A 3TDFA 4GRLC 3B8SA 3S96A 3AAZA 3MRFB 1GHFL 1QTWA 1V7NH 3MV9A 5F7FA 5I6LA 4D8OA 2WOYA 4JANA 5E2VH 5DJ8B 2EIJB 1E6JH 4OUEA 4NZDA 2V0TA 5CLTA 3LDBB 1OL0A 3RWHA 2WY3B 3H3BC 4EWJA 1E0XA 3BT2L 1UD8A 3VNIA 1PUDA 5TE7H 2FNBA 4F7TB 3QDGD 2P0IA 5HGBB 4JFFD 4ZW5A 4PS4L 2V2XB 4EE2A 3HMXL 5EZIH 1S7XA 3OZPA 4NNCA 3FO9A 1LOQA 2G0KA 1HH6B 4FTVD 4IGNA 4X4YB 3LKOB 2ESCA 1TFVA 4Y90A 1R5YA 2Y06H 1V3LA 3RVWD 3LNIA 3RDKA 1P0SE 2VRQA 3ELAT 3LJ3A 3O3UN 5D70L 4GW5A 1YLBB 4JTIA 3SCRA 2WWOA 3B5TA 4TL5A 3SCNA 4D9QE 4ZFOB 1CF8H 1K9TA 3C6SB 4PW4A 4EVNB 3VU1A 4A8NA 2JB6A 2X1WL 3UJJH 2VCCA 4LUSB 4GP4B 4ZQMA 5JW3H 1VBHA 4NUWA 3D39D 1S3KL 3RMEA 3T4CA 2F74B 4KWSA 1KFGA 3R89A 1SJCA 3GG0A 3S8FB 2VXVL 4LCQA 4XAWL 3V0FA 2OP4L 5F7NC 1YJDH 4R7VA 1RMFL 5LCVH 1HEHC 2XQBH 1MDTA 1T22B 1TREA 3F83A 3MSRA 3AO0A 3IN2A 1FWNA 5B39A 5CHNA 1GGBL 3SFKA 1GZJA 3W1RA 5K4ZA 5ALBH 1BGAA 4D9RD 3QJRB 3IIOA 3QEQB 2A3LA 3R13A 3ISIX 1EVTC 4YVXA 1NGZB 1VAHA 1TZ9A 4NZTH 1VIZA 2P80A 3SGJA 5F9OL 3BXNA 1QNRA 4JFEE 4I9TA 1QX1A 1MG2C 2EJ1A 3MRPB 2VC5A 4XZ4A 2VC6A 2VZTA 1QWHA 2YFNA 4OAWA 3NQMA 5DJYB 2OXGB 4YFDB 3K5SA 1JXDA 3N2BA 2P8MA 4P05A 4UQIM 1VPOH 3H7UA 3CZEA 4GMEA 4CVWA 2VC2B 3KYKL 3D3VE 4QXGH 3E2HB 3VFUB 2V9UA 4PBWD 4X7TB 1EXGA 4NXSA 2HTKD 3HZVA 4M1GH 3GR8A 1H3PH 2VH5L 4X61A 3T0VA 3HI1A 5HHMB 3LCLA 2VTFA 4TL4A 2GTZA 2NY1C 3LQMA 4ABVA 1KT2B 3MCNA 4ISVA 2QJHA 1JN6A 4IJ3C 2WVVB 3PZNA 1NDTA 2QSTA 2HMID 2CDFB 4OQTH 2WOQA 4MWAE 4D8PA 1H7OA 5IMOA 3G5ZA 3F5WB 2OSYA 1G1CA 2MTPA 3H9SA 3WUWA 1VFAB 3QXUA 3HPAA 5ERWA 1S5TA 3DXAD 4WXZA 4BH8B 1A7NH 5C09E 2OLHA 2P76A 5L8KB 4G7FA 1IAOB 5H94B 3TCSA 5CAHA 1NARA 1RPQA 3X13B 3NIGF 5I7GA 3EOLA 4DN3L 5I26A 1GZHA 1BM3H 2FIRT 2YPLE 1WUNT 1S5HB 3ILEA 1V0MA 2PP3A 4QRBA 1ISXA 4N02A 3MRJA 8A3HA 5I1IL 3VXTA 3NZUA 3BQVA 1N59A 1UXWA 3CTLA 2V2TA 1QWGA 3D0LA 4P4KA 4KKRA 4R8WH 2E5BA 1AGBB 4YXKH 4MBOA 3RVWC 1C8VA 3LRKA 4ZFQA 2REQA 2E8ZA 4DJMA 4Y5YB 1A50A 2VL5A 2PF8A 1ID2A 1FFOA 5E8OA 3IFOA 1D7DA 1TKWB 1HKJA 4F79A 2VKZG 3SDOA 3EFDL 4NQQA 4GBDA 5K93A 2QIWA 2WSRA 1C8PA 2OODA 3FUJA 3O9WB 2NY0B 3ILPA 1KPRA 4W5UA 2ZWKA 3M1BA 2F54B 2HCVA 1X4XA 2B1HH 2N1KA 2R1YA 5I1DB 4HKBA 3EGSA 1FO0L 3EA2A 1S9YA 4LLWB 1UKQA 1KFWA 4NPJA 5GRUL 3FQ4A 5E51A 3N34A 3U36A 4IMKC 2CZVA 3RFZA 5XIMA 2JB5H 4X2UA 1KY7A 1A7RL 1JNLH 4ORIA 5L2JB 1KPUA 4J6IA 2G5UA 1H49A 2C9UA 1RK5A 1WXZA 5FO7A 3ECWA 4PTMA 2ZP9A 3EYUH 3G18A 3TYAA 1R5IA 3VXUA 3EXSA 3VZYA 1TVNA 4KRTA 3L3OA 1NBQA 4AYDC 4GT0A 1WKYA 1MAKA 1A9BA 2NSOA 1FNLA 4F0MA 1ITQA 3RPIA 3CO4A 2MUCA 1L6GA 3TWYA 4HU0A 3N44B 1EL3A 1X9QA 4FFWD 3ETBJ 3TO4B 4MJ4A 3G6JF 4R7NB 5HYQA 3QQ4A 3QY7A 1G0XA 4O4YL 3BVNB 3D18A 1EUAA 3VXSB 2YBTA 4AYFB 2AQPA 2VN7A 4IMGA 3VH8B 3L3GB 3S6TA 3E3QC 1Q9OA 2H3DA 1Q7MA 5CMAA 2PRHA 1VA9A 4IOSD 3VIFA 2XFXA 2Q8ZA 4JO3L 3BZEA 4RNHA 2FUTA 2J25A 4I90A 1R7OA 1DQJB 3IIVA 1J9CT 1AW1A 3H55A 2LT9A 3CAKA 3VCCA 2PDFA 3FCTA 3EOSA 1OGPA 2W62A 4P8VA 3ARFD 4TMCA 1DORA 3GMQB 4N90E 4YFEA 2NNXA 3CU7A 3SGDI 2HMIC 2ZRYA 3C5ZB 3B9OA 1TWWA 4YH6A 2D8KA 3QISA 1T5WA 3W0WD 4L8BA 3HHMA 5JR1L 2GJ6E 4N2BA 1I8IB 4XSMA 1QCWA 1QQDB 1XAKA 5KVGE 3WD3A 4Q74A 1H0DA 5L0QB 3EOBB 3STZA 1I9IL 4LS2A 4Y4HA 3EHBD 5E8DH 1E28B 1FDJA 2D7TL 1VFUA 5IVZA 3R2GA 4WI2A 1A4MA 3EIFA 4LUTA 4HWEL 1OFRA 3EOUA 2BNRE 1YN7A 4X5XA 1FOBA 1WRFA 1RVFL 2I25N 4FG4A 1AZ2A 3C6CA 5D2NE 3E1ZA 4EF9A 3VQ1C 1DDHB 3EGJA 2DZVA 2Z1WA 5JOFA 1CGVA 2K4WA 3RB7A 4ISVB 1GHSA 1SR0A 2Z31A 4C1LA 3PWNB 2C9SA 5RUBA 3KM2A 5D7HA 1PD6A 5F71A 1YMHA 3QHFH 2R51A 4ZMZA 5F2FA 2HFTA 3LCYA 3KVKA 3L3KA 2H6OA 4OVXA 4LH8A 3W1QA 1ZHKB 2R4SH 2WAGA 3DESA 3HGJA 5FJPA 2BHZA 3PL6B 2DOCA 3T0ED 5CZJA 1E1CB 2JJWA 3G5YB 1J8HE 2YBGA 5E9DB 3W7QA 3OVQA 3L5XL 3UTSA 3NQVA 3SEPA 3LNEA 4PM1A 3K6FA 2DUZA 2M1KA 3B3DA 1QLEB 2VDOL 1YDPB 2YEVB 4GE8A 4AGNA 4KZDH 5G1TA 3MV8A 1XF3A 1FWRA 1N64L 5F70A 2DJUA 2E9JA 4NYYA 4QRPD 2V2TB 2N01B 1T89A 4JG1L 3ZE0B 1D3CA 2PTTB 5K69A 2QVTA 4HWUA 2ATAA 1FRBA 5I6MA 5A69A 3S36L 2FX8L 2Z6IA 1DQTA 1SHMA 5IB4A 3HLAA 3RAOA 4W4QA 3QGAC 4KVCL 1ECEA 1CLVA 2XRAL 1FFOB 5AWNL 4DVRL 3TL5A 3QZNA 3ZE1E 4P2RB 4U6VL 4OZGB 1UOLA 1QR4A 2AQ2A 4C6QA 2C1PA 5JIDA 4YDJB 3HBLA 5HYEA 2E1DA 1I8LA 4MLIA 3UBXB 5T5FH 2WXHA 4DM2A 1RIHH 5FKAA 3B9EA 1W3NA 2RAGA 2A38A 4FFWC 3IPWA 4B9KC 4GPNA 3UXIA 2HJLA 3QCTH 4WY7L 2A3EA 3LKPB 4GHRA 5CJOL 1I1RA 3VWJB 2ITCB 4H83A 4UTUA 1L9WA 4XP6H 5MEOB 3ITYA 4A55A 1R9ZA 5ACZB 3M5ZA 4Q4OA 2BJML 2NZ9C 4MSWA 4AU0A 2OTDA 3PANA 4JE0A 4ZPVA 3LTSA 3LEYL 2ZXQA 1S2UA 4RZCA 2NV2A 3VXUB 4D9LL 2ENQA 2B20A 3U1PA 3WJLA 5DZJA 3AJ7A 5BRPA 3QR0A 1UM5H 2C8NA 2VLJB 4LFHG 3IWUA 4OTKA 1C92A 1ET5A 3LYEA 3BKJH 3A6CL 4IP7A 3S37L 2EC8A 5DRXB 4Z3FA 2HLAA 4HSHA 2ATMA 4RR4A 1LEIA 1C08A 3QQ4B 1T7YA 4V1DB 2DZWA 3NPZB 3D18B 3G5XB 3DOSB 1ZWIA 1IC5L 1ZT4B 3EHBC 1A4LA 1MCNA 1CICA 4M5ZH 1VD6A 2TAAA 1BAWA 4JPIB 3WFBL 1Q9OB 4YSEA 2VWTA 1FBAA 4P5TC 3RF9A 1CXLA 2OB3A 4QE1A 1CGWA 4WUUA 2OTWB 4JMXA 3TKFA 2P42B 4LSUH 1NCUA 2X88A 1LDSA 1LOSA 3P62A 3IPBA 4Z3EA 3Q2WA 4R97B 5A40E 4X6CF 3THML 2VMCA 3E0IA 4XZIA 3GHSA 5C0DA 2CERA 2VM8A 2X1IA 2ICEC 2YEQA 2HYMA 1GJPA 5C0AA 1DSYA 1O95A 4G6KH 2X4OA 1KFAH 1BP3B 4XP5L 3RX9A 2H32B 3MJ6A 1FE8H 4MVBD 1R8LA 2R4RL 5HJYA 1X8FA 3QUMB 5EDSA 1JYNA 5A6MA 2VQ1B 4G3YH 1MUCA 4Q7BA 2E6FA 3T0EC 1S7UA 4A2MA 3ML9A 3SUVA 1NDGB 4CMMA 4UR9A 4Z1PA 1BAFH 1JZ7A 3VK5A 5B7MA 4LUTB 3H8AA 1TCRB 1NBZA 3KCPB 4MHBA 1YN7B