4JFTA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor n-desmethyl-4-epi-(+)-codonopsinine
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
total genus 162
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jftA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jftA01
3CZLA 3AZSA 2WWCA 1QNQA 4UQEA 4CCCA 4D1JA 1VEOA 4XB3A 1CDGA 2YDQA 4MPKA 1H49A 2BHYA 4PUEA 1PAMA 4KGLA 5CQ1A 1BSIA 1B3XA 2QF8A 5A8PA 4HZ8A 4URIA 3WNOA 4OGZA 1O7AA 1VBRA 2DH3A 4JL2A 4EANA 3EJRA 4P7NA 2DSWA 1QNRA 4J3UA 1VB9A 5CPQA 5GNYA 2WWDA 3THCA 3BMVA 2ZX7A 4MB5A 1D3CA 4X0VA 2VL4A 2D0GA 1E4MM 4W85A 3DHPA 2EPOA 3NSXA 1VENA 2JEQA 1YQ2A 3ARRA 4CD7A 3W27A 1I1WA 3WUGA 2XVGA 3L4YA 1W3LA 5ABFA 4W7UA 3AFBA 5I0DA 4M8UA 1V0KA 1QHPA 3ARYA 1UH4A 1HL8A 5I6SA 1TUXA 5EB8A 3WSUA 4IPLA 3PTKA 2BXZA 4AD3A 3CUJA 3GBDA 3D3AA 2O9PA 4NZFA 4S3JA 1B9ZA 2G4FA 1UWQA 1UZ1A 2F2HA 4CD4A 1LJYA 4H8VA 1UWTA 3VX0A 2CBVA 2F7QA 4WSJA 1PIGA 2EADA 4LYQA 4D71A 5DFAA 1JG9A 1RP9A 1QWUA 1KCKA 4FK9A 1MW3A 1UD4A 3VGEA 1CZ1A 1R34A 1UASA 1UQZA 4H04A 1E72M 1OBAA 3WKZA 4WF7A 3AIUA 3CIVA 1V3IA 5CJ5A 3SCNA 4KGJA 1TQTA 2X2JA 1DEDA 3GZAA 4FLQA 3QGVA 4QAWA 2GJPA 3S5ZA 4J3TA 3RMEA 1GOWA 3WQWA 3NYDA 3WFZA 4JFWA 2GK1A 2J8GA 4P8WA 3WD2A 1QOXA 1XD1A 5EMYA 2CHNA 2PWHA 3AZTA 5AC4A 3WH5A 5HNNA 2O92A 3WQ8A 2AOSA 3SCOA 1VFOA 3DYMA 1DHKA 3S5YA 4GI9A 1E0WA 4MTVA 3K4AA 2J62A 3BVUA 3LRMA 3HG5A 3O6AA 1CEOA 3D5HA 1UOKA 2XUCA 4CN4A 1GHSA 3A47A 4AW7A 1XH0A 2WBKA 2BY3A 2YA0A 4ATDA 1JAEA 1H1NA 2CYGA 2WCSA 1MYRA 1W1VA 1E1EA 2V3EA 3VDBA 3W82A 3RCNA 3ALFA 4CCEA 4PMDA 3IJ8A 2D23A 4MB1A 2D0FA 1EOKA 2O9OA 3NDYA 2D1ZA 4GPNA 1QW8A 3LPFA 3VD3A 3CZKA 1EGZA 2DT2A 1OT1A 4ML4A 4HZ7A 3CZSA 1E15A 1JFXA 5A69A 5I5RA 5BRQA 3G6LA 2V38A 2WC7A 3WDIA 1XSJA 2W67A 4TVUA 1WB0A 2JE8A 3DC0A 2EBNA 3MKKA 3W29A 2WVUA 1MFUA 4OBRA 4JZ5A 3PN8A 2FYVA 4QDMA 4AD2A 4AZ6A 3F4VA 2CKSA 3ZJKA 1G01A 4W8LA 3AIWA 1UKPA 1EXPA 2V5CA 3WENA 1V3HA 3SCQA 1R86A 4MDOA 2ZX5A 2NT0A 2J77A 1WPCA 1J0KA 1BVZA 4FNPA 5E70A 2DDXA 2YBUA 3PZVA 2F1AA 3GXDA 1RPKA 2YFNA 3B9DA 5EFDA 1JNDA 1G94A 4AD4A 1GORA 1MW0A 1V6XA 1EIBA 3WQ5A 1FHLA 4QLKA 1TE1A 1B3ZA 1ODUA 4PTVA 2NT1A 4WIWA 4QLJA 4ZXOA 2WYSA 5DF0A 3VIJA 2ZUUA 3AXIA 1WDQA 1SR0A 1TVPA 3HN3A 3VPLA 3VGGA 1XYZA 1IV8A 1TQWA 2GK1B 1NWTA 4KRTA 3EDEA 3UETA 1HJUA 2Q8XA 5D8WA 2FHFA 4U31A 2JF6A 2EJ1A 3GXPA 1UR1A 1ZBCA 2D22A 2DSUA 4ZENA 1GZJA 3CV5A 2ZUWA 3UG4A 3VO0A 2X0YA 1XYFA 3VSTA 1KGUA 2WMJA 3BUQA 2DGAA 2E0PA 1AMYA 5KEZA 4OIFA 1ITCA 3SCPA 1NWRA 4PN2A 1KXHA 2WZEA 4J3XA 4DM2A 2ZXQA 1G0CA 4Z2KA 1ZBVA 3KE0A 1QBAA 2WMIA 4GQRA 3N15A 2DSVA 3A4XA 2XM1A 2E8YA 1FH7A 3BGAA 2XVKA 3M7SA 4W87A 1J0HA 4D6IA 2WHLA 4HA4A 1H3GA 3N04A 2D24A 3VGDA 1E1FA 4WKHA 1B0IA 1ZU8A 4Q22A 4RE4A 3ARXA 3CUHA 3VVGA 1JZ7A 4P8XA 3S6TA 1QI3A 2WHKA 1V3LA 4A4AA 3VDAA 1VAHA 3U5UA 1W1TA 1B3VA 2XN2A 5A6MA 2XVNA 4HMCA 4AD0A 1BHGA 2VOTA 2BVTA 4GQQA 3FN9A 4L4OA 2WMIB 3AS0A 2FH6A 2CHOA 1UA7A 1V3MA 3UERA 1HWWA 3PHAA 3DX4A 5GNZA 3WUFA 4LYRA 3ZT6A 1KGXA 3N11A 2YL5A 4W84A 1KWGA 1V0LA 3WY4A 4ACZB 1BPLB 3AIEA 3BAXA 2D73A 3OGRA 1CXEA 3AIBA 3WY2A 1UR4A 4GXPA 1GJWA 3F5KA 3VIOA 5JBEA 1EQPA 1WO2A 3AHZA 1EO5A 2QMKA 1H41A 7A3HA 5JIWA 1QX1A 1EH9A 3KLKA 4AEEA 4F79A 2RGLA 4NXKA 4R5EA 5M17A 3TTSA 1NP0A 2DSKA 3VNYA 3QOKA 4D6FA 4BA0A 3CBWA 4BQ2A 2PC8A 1UR9A 4PMNA 3VINA 1GOMA 1OCQA 1SMDA 2OWXA 4AYSA 4U2ZA 2XWDA 4AZGA 3VX1A 4TTGA 3WD1A 1CBGA 1V3JA 1F4AA 3BAIA 3CUGA 1HKIA 2YLLA 5IFTA 3CZGA 1HTYA 5AYIA 4UNIA 1ZJAA 5IFPA 4R27A 5D9OA 5CLWA 2UY3A 2A3CA 3OZOA 1CPUA 4K68A 4JKLA 3WMCA 3D4YA 1W91A 1W32A 5AY7A 4HU8A 4W7VA 1UZ4A 2E40A 2EACA 3AHXA 2J7BA 1MFVA 3W28A 2F8QA 1PX3A 4MAZA 1YHTA 5A6KA 3VDCA 4B3LA 2OWWA 2X05A 1Z32X 1U33A 1HN1A 2QV4A 4FNUA 1GNXA 1TVNA 4M56A 3HU7A 3KZSA 1GQIA 3EMZA 1Q6GA 1C8YA 2Y24A 3OGSA 5I2UA 2UY2A 4UFJA 4H2CA 3L2LA 4FNRA 9CGTA 4U3AA 1C93A 4AZIA 1HVXA 5AYBA 3BLPX 3B8SA 1R46A 3VUPA 3AJ7A 2FDMA 4ACYA 1KB3A 1E0VA 4BQ5A 1NOUA 3K8MA 3VMOA 2YDRA 1CIUA 2CXGA 3DHUA 3O2LA 1JYVA 4HPHA 2FGZA 5CGTA 2J7HA 3FAXA 3ARZA 3LX9A 2J7DA 2JIEA 2J7EA 2JIWA 3WH6A 3SCRA 5JUVA 2E4TA 5CG0A 4FNSA 1D2KA 4GINA 3AOFA 1PZ3A 1VJZA 4J7RA 3CUFA 1UYQA 1J0IA 4ZEPA 2ZXDA 4ZXLA 1E3ZA 1MW2A 1LLOA 1KWKA 1OM0A 3A21A 1GHRA 2X09A 1HJWA 3MUZ1 1MWOA 2GFTA 3WNPA 3SCWA 4PBGA 2YL6A 5A8MA 3VU2A 1E56A 1LG1A 2WMHA 3RM8A 5LYRA 3L4WA 4GIAA 3D52A 1K9DA 3AMCA 2X2HA 5CZKA 3BVXA 3FY1A 3WD4A 2OSXA 3BC9A 1BLIA 3WEMA 1TQUA 2WK2A 1E55A 1SYTA 3PZ9A 5A94A 4HA3A 2ZX6A 1HKJA 3GNOA 2WSKA 1QNOA 3GH7A 2NW0A 2FHBA 3PZTA 1RH9A 4AZBA 3A23A 3VM7A 4JHOA 4UOJA 3ARVA 4DWSC 3WNMA 1R7AA 1W1PA 3CHDA 1JZ4A 3WY1A 3SUVA 3WMBA 4PMOA 3A4AA 1K9TA 1GPFA 1L8NA 4EAMA 4AISA 4D6JA 2WMFA 3GBEA 4J3WA 2VC9A 1CXFA 3GXNA 4DUWA 5BCAA 4M81A 1MQPA 3I3DA 3AIVA 2GJXA 3W53A 1MVYA 1IZKA 2IXUA 3SUSA 4PSPA 1CGUA 4C7GA 1VFMA 2ZE0A 3WD0A 5ABEA 3NCOA 1FFRA 4GI8A 1WP6A 3WBEA 1W1YA 2Y8VA 3APGA 2J78A 3SUTA 3BLBA 1OGBA 2EQDA 1KR0A 2OLHA 1X1NA 4JFUA 5GQBA 1E0XA 1V0MA 5CSYA 4JKKA 2XFYA 4AZ7A 1JFHA 3BAYA 1B2YA 1JNEA 4DWSA 3BVTA 1GQJA 2DT0A 2FE0A 3VD5A 4X0NA 1HJQA 2UY4A 1Q4NX 2VZSA 3WQ4A 1JYWA 3AS1A 3KWXA 2PI6A 3KL5A 3AHTA 1UH2A 5FKYA 1EA9C 5BXRA 4NI3A 4FF5A 3QOMA 2W62A 2VR4A 3SCUA 4HU0A 3AROA 2J7GA 2E3ZA 1QW9A 1XHGA 2WC4A 1BF2A 2WAGA 1BVNP 2XFRA 1ISZA 4UOZA 2XSAA 3KEHA 4CVWA 2QLYA 3BAKA 2VCBA 4DO5A 3ARTA 2G41A 1KTBA 4HZ6A 3D4ZA 3UG3A 4PMUA 1TR1A 2A3HA 5C71A 1UD5A 3CLWA 3WN6A 3GNRA 4DO6A 5A3HA 3EBVA 1X6LA 3PZNA 4CN1A 1LG2A 1TCMA 4GKLA 3AI0A 3POHA 3OLIA 4HMEA 2BVYA 4BCEA 2Z1KA 1JL8A 1V6YA 3A5VA 2E9LA 3WUEA 4AZCB 3WQVA 3AISA 4XUYA 3UR8A 4AIEA 4D6CA 5EFFA 1BYDA 4Z2GA 2WKGA 3N18A 1FH8A 1V0NA 4E4PA 4BQ4A 4XV0A 3WDQA 1HXJA 2XTKA 5A6BD 5BRPA 3U7VA 1GONA 2YJQA 5KZ6A 1ZL1A 1CGVA 2D3NA 2XSBA 4MB4A 3RDKA 4UFLA 5A6AA 1RD6A 2QMJA 2VNCA 3WF2A 2DH2A 3FXYA 1UUQA 2EPKX 2FHCA 4W5UA 2DIEA 2BY2A 4CU7A 1DWHM 4ZFMA 4M29A 1KQZA 4W5ZA 3K8LA 1HL9A 3VD9A 1DWFM 2C8NA 2J75A 1NQ6A 1B3WA 2WCAA 1QI0A 3WF4A 5DEZA 4Z2HA 4JAWA 1ISWA 3BXWA 1J11A 1LQ0A 4MNLA 3VGBA 2XYLA 1EDQA 1JXKA 1W3KA 3LXCA 2BY1A 2O9TA 1JYNA 4NX0A 1IZJA 2V3GA 3VGHA 2WM0A 4JFSA 1JZ3A 2G3IA 3EDFA 4LQ1A 4M82A 2WHJA 2CPUA 2XG9A 2IGTA 4UZSA 3KL0A 1MQRA 2W91A 3WL0A 2X2IA 3WF3A 3IGUA 2YA2A 2VRQA 1JD7A 4J27A 3ZMRA 4NZJA 1UA3A 1UHVA 1D7FA 1K9EA 4UFHA 4YHGA 1H2JA 1E71M 5D9MA 3VOCA 3WNLA 1WCGA 2D2OA 3GYCA 1E4IA 2QHAA 1VBUA 4YPJA 1LWHA 4NRSA 1PX8A 1NOFA 1CYGA 1OGSA 3OLDA 3MV01 1KR1A 1KBKA 1BQCA 1M53A 3FHAA 2WMKA 4CCDA 2GUYA 2QPSA 2OW7A 1HKMA 2E9MA 1PIFA 1JIBA 3TA9A 1OIMA 3WELA 4NSBA 1EQCA 3BUIA 2YLAA 2WVVB 4KMQA 2WCGA 4A3YA 2YL9A 1UKOA 3AQUA 3CZNA 4UQDA 1SZNA 2WXDM 2VMFA 4PMVA 2XIBA 4QLLA 3AHVA 1CGXA 2Z1SA 4UTFA 3AXHA 1NM9A 3MMWA 3CC1A 1HVQA 1UD6A 1WZLA 4EK7A 1U30A 3ZR6A 1O7DC 1J12A 3VM5A 4XZWA 1T0OA 3VSVA 4MDPA 4FLOA 1GCYA 2WW5A 3MU7A 3T0AA 3BUDA 4E2OA 4U5IA 2EABA 2WZHA 1XSIA 1F4HA 3CO4A 3W24A 3WDHA 2VZTA 3A4WA 4UCFA 1V02E 1E6SM 1HKKA 3L4ZA 1E6QM 3F5JA 3W25A 1CXLA 3B9AA 3RM4A 3AZRA 1B3YA 1KFWA 3T2PA 3ECQA 1J0ZA 4BQ3A 3WY3A 3G6MA 1OSEA 4UFMA 5BXTA 5I23A 4H8HA 4FLRA 1UKQA 4OKDA 1DWGM 4LX4A 4JCMA 3LPPA 5A2AA 4D72A 3CTTA 2VX5A 1MXDA 5DT7A 3K46A 3SEPA 4CUCA 6TAAA 3FAWA 1GOQA 1CXKA 4DO4A 4TXEA 1FHDA 2EPMX 4WLCA 3DX3A 3ARWA 2Y4SA 1JI2A 1JZ2A 3LRKA 1J9YA 3CHCA 4PMQA 3RM9A 1KTCA 4OUEA 3WD3A 4IM4A 4DUVA 4OZOA 4P7LA 8A3HA 4S3KA 3ZSTA 1DWJM 4NXSA 3W6LA 1QI4A 1G9HA 3MSGA 3M46A 2CITA 4J3VA 5GPRA 3O9NA 4E8CA 3W81A 1UR0A 4MJ4A 1JGIA 4OOUA 3OLEA 1QI2A 3NUKA 3IAPA 3K8KA 1OIFA 3MI6A 2XWEA 4UQAA 1EDTA 4MNJA 2VURA 3ALGA 4OOZA 1B30A 1EHNA 2YOCA 3AICA 1OGGA 3K1DA 2WLYA 2DPEA 1E43A 3VIGA 2X0HA 1JDCA 8CGTA 3PZGA 3WMSA 4EE9A 2VQTA 3HJEA 1PEZA 4TVDA 5A8QA 1H0GA 2BVDA 3AYRA 3N9KA 3H55A 1FP9A 3BAWA 4JCLA 4JFTA 4M1RA 4F66A 1CWYA 1FA2A 3AIQA 3DECA 2V5DA 3TTOA 4IISA 1ESWA 4F9DA 4U3CA 2X1IA 1ISVA 5A8OA 4AY1A 4U5KA 1HX0A 2BS9A 2WANA 3GXIA 2TAAA 1HXKA 3ZSSA 1NARA 1GQKA 1A3HA 3UR7A 2V3DA 3IK2A 1J0JA 2ZUNA 4AXNA 3EJSA 2WMGA 4Q7NA 2OSWA 2GJRA 2IXVA 4QCFA 3FHQA 4F9JA 1I1XA 2GDUA 3LMYA 3H54A 1E6RA 4DWSB 4Y7EA 2WLZA 2J7FA 1E6NA 2F7RA 3VIPA 4GZIA 1BYBA 2W4XA 2VVSA 4KRUA 2AMGA 4UFIA 1ZJBA 3FW6A 2CBIA 4HOXA 2BHUA 4GZJA 3WDRA 2CEQA 1JI1A 1SFSA 5E0FA 1W3HA 1W9DM 4D6EA 3T0BA 4J3SA 5FCZA 5E9AA 3BAJA 3AXXA 2OYKA 4HOWA 1E70M 1KQYA 1UG6A 1VFFA 4WK9A 1H5VA 3A6OA 1QPKA 1DWAM 1DWIM 3WF1A 5CPTA 3ZM8A 1JDDA 2B31A 4AZ5A 3UCQA 3FNDA 5TD4A 4B15A 2ZWYA 3OGVA 3CUIA 1Q6DA 4TX8A 1G1YA 1JDAA 1VFUA 2ZUMA 1E4LA 4A3HA 4UQ9A 2WPGA 1PPIA 1QHOA 1ZBWA 3M07A 2PB1A 4CVUA 3U5YA 2AAAA 4W8AA 5ABFB 3TV8A 2J74A 1ZS2A 3DDFA 3RIKA 2XVPA 1ZB5A 3N12A 1GVYA 1KXQA 2J47A 3RILA 2WKLA 2CCRA 1VIWA 2J4GA 4Z2LA 5I24A 1HIZA 3TONA 1CGTA 1TMQA 2OYMA 2DT3A 2XFFA 1G5AA 4MNKA 2G3MA 5DT5A 1NH6A 3EDJA 3GDBA 5AC5A 2GDVA 1TQVA 4UOQA 3H53A 1GOKA 5LA1A 3CPUA 4PTWA 4AWEA 3QHOA 5E09A 5A6LA 1E3XA 2JALA 4P7RA 4PCTA 3A3HA 2VI0A 1R8LA 5BXPA 2OW6A 3KLLA 3N13A 2DIJA 2HVMA 5GNXA 1R75A 2C0HA 2XGBA 4RL3A 4HA1A 4ZE4A 3MUY1 4PEEA 1K6AA 3TTQA 3VILA 3WH9A 1OWQA 3VSUA 3VIKA 4AC1X 2WNWA 1EOMA 5A2BA 3IAQA 6A3HA 2BNJA 5FD0A 1UD2A 1AQMA 3UEQA 3EDDA 1QI5A 3WEOA 3CMJA 3GTNA 4AEFA 4MJ2A 4AZCA 5A95A 3MUAA 3OBAA 2YIHA 1BAGA 1H4PA 3QR3A 3WQ6A 2VX6A 1E6XM 3GXTA 2BV9A 3GH4A 5JBFA 4AD1A 4PSRA 5FL1A 1WDPA 3MANA 5FL0A 5IHSA 4AMWA 5A2CA 3QHNA 1CXIA 4FMVA 3BUBA 2ZX9A 3N1AA 1NWSA 3LPGA 2WHMA 2Y5EA 4HP5A 3CZJA 4PMXA 5BXSA 2J25A 2G8ZA 2ZX8A 1J10A 2VZVA 1X6NA 3AS3A 4YN5A 2ZUTA 3PZOA 1FH9A 4AMCA 4AZHA 1Q6CA 4N0RA 3HG3A 2W63A 2CESA 5I79A 1L0PA 2DSZA 4JL1A 2XJ7A 3PTQA 1VEMA 2WZIA 2A3AA 5D8ZA 5M03A 3VIHA 3EJTA 4UFKA 1JZ8A 3L4VA 3BVVA 3VDHA 4BS0A 4UQCA 4L4PA 4LGXA 4OBSA 4HPGA 4PTMA 1US2A 3D50A 4H41A 4JFVA 2CKRA 1E6ZA 3DDGA 4AIUA 1ZBKA 3EDKA 1QWNA 3VD7A 3WF0A 1KGWA 1UKSA 4DM1A 4W7WA 1C92A 2E8ZA 1XH1A 1H11A 2XPKA 3HZ3A 2CERA 1WNOA 1J01A 2ZOXA 4B9YA 1W9UA 2F7OA 2RGMA 1MQQA 4Z2JA 2ZXAA 3L2MA 1OD8A 3I3BA 1S46A 4KWUA 1CLVA 1JF6A 1HJSA 3J7HA 1BGGA 1GOIA 3EJQA 1LF1A 3F5LA 2BFGA 4NF7A 1VF8A 2XN0A 3L4UA 1UR2A 1TZ7A 4W93A 1B1YA 3AYSA 2DQXA 2ZUSA 3MMUA 1VEPA 1KXTA 1W9VA 4MNMA 1XV8A 1R33A 1GVIA 2J79A 2WC3A 3ZOAA 1UQYA 1BFNA 2PBOA 2W5FA 3AS2A 3PZIA 4CU8A 1WZKA 2CETA 1XSKA 2WSPA 1US3A 1DTUA 3VD4A 3HG2A 3POCA 1W9BM 4HMDA 3HG4A 2EPNA 5A6JA 4AMXA 3LRLA 2D3LA 1CXHA 4PUDA 4BZYA 1OB0A 3CH9A 3PZUA 1R47A 1TQSA 3SCSA 1XGZA 1UWRA 1XD0A 4GZEA 4H7VA 4B3KA 1R87A 3WDPP 2VRKA 1PJ9A 3BCFA 1TFVA 1PZ2A 3WH7A 7CGTA 3ARSA 1DP0A 1JXJA 5HOSA 2VTFA 6CGTA 2ZUVA 1PBGA 1E5NA 2XGIA 1WE5A 1R85A 3MV11 5IXEA 3W37A 2EXOA 1BYAA 1ISYA 1WZMA 5E6YA 1E6PA 2BXYA 1UKTA 2ZIDA 1VRXA 1ISXA 1M01A 2Y8KA 4DUXA 3MUIA 5E1QA 4PCSA 4CD6A 3ZR5A 2HISA 2YFOA 1HNYA 2F1BA 4FLSA 3BLKA 5C70A 3EJUA 4PMRA 3NSNA 3E1F1 1CNVA 3GXFA 1UD3A 1C7SA 2VX7A 4X9YA 2CIPA 5I78A 5D9NA 2YA1A 2G3NA 3WH8A 4ACZA 1WAWA 4LPCA 5EBAA 1QNSA 4HTYA 2F61A 4GO9A 4WJXA 1GQLA 5A1AA 2XVLA 4U2YA 2FH8A 2WVSA 3PTMA 4TVCA 2IUZA 2DT1A 2OSYA 1JF5A 3UG5A 3NDZA 1UWSA 3WEZA 3PZQA 3VMPA 3U57A 4P7QA 1UH3A 2VR5A 2VCAA 1U2YA 3BH4A 3LXAA 5JBDA 2QPUA 3KL3A 1BTCA 2XM2A 3THDA 5LA2A 1AQHA 4CN6A 1V08A 4ATLA 5F7UA 2C7FA 3MMDA 4M24A 1V6WA 3HMCA 4P7OA 2X8RA 3ZO9A 2ZWZA 1GJUA 4M80A 1FOBA 3ZJ7A 2VZOA 4PRWA 2YDSA 3L4XA 5HBFA 3AMGA 4RE3A 2VJXA 1WZAA 1KXVA 4C7DA 1JYXA 2V3FA 4QCEA 3WNKA 2PBGA 2EPLX 4W88A 5DO8A 5CXPA 2VT0A 1QHZA 3WDJA 2FGLA 2MANA 4J28A 3LPOA 5BWFA 1CLXA 3A22A 5ECUA 3GH5A 4MADA 3CZEA 4N42A 1C3FA 3EMCA 4U33A 5M3WA 3MSDA 1WDSA 3AMKA 4AIOA 4XX6A 4JKMA 3NJ3A 4CD8A 1V03A 4P8UA 3MS8A 3BUPA 2EEXA 5CSUA 5CPSA 3OB8A 4QP0A 3WFLA 2PWGA 5LA0A 4GI6A 2W66A 1AVAA 3GXMA 4OJYA 4UQBA 1BYCA 5BROA 4PMZA 4MAVA 3ZJ6A 1OINA 4ZE5A 2ZICA 1HP5A 4W8BA 2JEPA 4AD5A 3ARPA 3IJ7A 1UWIA 2ESCA 3W26A 3CHFA 5HPOA 2XHYA 2UY5A 4AYGA 1PX4A 4GO8A 2EAEA 4NRRA 1OD0A 2O9RA 4QFUA 1H09A 4CGTA 5CGMA 4W89A 4TUFA 1Y7VA 3TOPA 1R7OA 4CU6A 2UWFA 1LL7A 5HPCA 2D0HA 1UR8A 1ODZA 1QVBA 4DWSD 2PWFA 1CECA 3N17A 4WKFA 3AMLA 5A8NA 2YKKA 2F18A 2A3EA 4Z2IA 1O6IA 3T2OA 5FIPA 3SCVA 5M5DA 1C8XA 1JAKA 3VMNA 1M04A 1UD8A 3RJYA 4D1IA 1W9PA 3VIMA 4TX6A 3BMWA 2NSXA 1QBBA 1UWUA 4CKQA 2XN1A 3I3EA 2BHZA 4V2XA 2WVTA 1C91A 3DX1A 1XCWA 1ITXA 3WNNA 2W61A 5DMYA 5E0CA 3WUBA 3DX0A 1LWJA 5CLTA 4LYPA 5I77A 3T0DA 2WVVA 2OYLA 2BY0A 4WSKA 1J0YA 4E8DA 1AQ0A 2W92A 1HF6A 1B31A 4D6GA 3T2QA 4WKAA 5FOOA 2CNCA 3ZJ8A 4D6DA 4UZUA 1P6WA 5HDRA 7TAAA 3TTYA 1W9XA 3A24A 3D51A 1FFQA 3ARUA 3VIIA 1OT2A 3RPMA 1KBBA 1V6UA 3CZ8A 2J7CA 2JF7A 2PF0A 1GW1A 1Q6EA 1SMAA 3EMQA 4JHZA 3M6DA 2CBJA 1LL6A 1CENA 1FP8A 4B16A 3U7BA 2VUYA 2GSJA 3T08A 3OZPA 2VVNA 1E40A 1MXGA 1BG9A 4IPNB 1WKYA 4V28A 3EJPA 3PZMA 4KH2A 4V27A 5A6SA 3NIYA 3BSGA 1MW1A 3S2CA 1Q6FA 1EDGA 1J18A 3PBGA 3WBAA 1JD9A 3BVWA 2Y2WA 2OWCA 1QNPA 4PYSA 1I75A 5ABGA 3W4RA 4F8XA 3QHMA 3JUGA 2DEPA 3OG2A 4HOZA 3IJ9A 3VIFA 5C8BB 1HT6A 3II1A 1B90A 1GOOA 3RJXA 1XH2A 3ZT7A 1HP4A 2ALWA 3B9EA 3K4DA 4CD5A 4FNQA 1TG7A 2VZUA 1GUVA 4NZCA 2XIIA 3SUUA 3VGFA 1BGAA 2PWEA 1NOWA 4TOQA 4PTXA 3UESA 3WL1A 1VJSA 2YL8A 3TP4A 3W0KA 3RO8A 3ARQA 1XRVA 1N82A 3SUWA 3CGTA 1W2VA 3SCTA 4B9ZA 1W2PA 1KCLA 2VX4A 1IT0A 1CGYA 5HXMA 1TA3B 3NSMA 3BCDA 4BF7A 3VTRA 3SURA 1A47A 1C7TA 1HJXA 4JIEA 3GM8A 5D9PA 1M03A 1EO7A 2G3JA 1XC6A 1BG4A 1E9LA 3AIRA 4XZBA 4LXFA 4RE2A 3VKKA 5JIPA 3EYPA 1E5JA 3VNZA 3W38A 2PWDA 1RP8A 1JZ5A 5A6BA 2VQUA 3LXBA 3SIMA 3DYOA 2CBUA 3DX2A 3AMDA 3GNPA 4PMYA 4P8VA 1V02A 5D4YA 5E6ZA 4TTUA 1TA3A 1ECEA 1CGWA 1V3KA 1WDRA 5BYWA 3OLGA 4FNTA 2EO7A 1LL4A 3ZQ9A 1H0IA 1C90A 4W86A 2X2YA 3AHYA 4H8UA 2VCCA 3BSHA 3ZT5A 2WBGA 2E9BA 2YBTA 2VO5A 1EHAA 3IANA 1C8QA 1K9FA 1CTNA 3OIHA 3DYPA 3W6MA 2F7PA 2A3BA 5ABHA 1V6VA 1W3JA 3OA5A 2D20A 1XCXA 1E4NA 2ZXBA 4YHEA 2VRJA 4IUGA 1NP2A 2J8FA 2JFEX 3L4TA 5IDIA 1JZ6A 2GVYA 1NWUA 1PS3A 4D6HA 4EKJA 2WB5A 4UR9A 3CMGA 3MO4A 5IHRA 3ZIZA 4ATWA 1E73M 3WIJA 4C7FA 1HJVA 5I3DA 4MB3A 1M7XA 2GJXB 3T09A 3CHEA
chains in the Genus database with same CATH superfamily
4MD0A 4KK6D 3AZSA 5FX3A 2R1LA 3MRIA 4P4KD 3KPRE 3BP6B 4LMQE 1EAJA 1BFOA 3H9YA 2RHEA 5I0YA 1ZD6A 5L2KE 1WBXB 4JDZA 1TZZA 4DN4L 3MRPB 3VG0H 1MDRA 2YDQA 1F8MA 1CU4L 1ORSA 2BNRD 1LP9E 1V7ML 2AQ1A 3WTVA 1OF8A 2BHYA 5C9UA 3UD6A 4BBWA 1FE8L 3LEVL 2PXYA 4J4PA 1DIEA 2H9GA 1ZTXE 4GVFA 4JIRA 1S2WA 1XJBA 3MRHA 5KSUA 1B3XA 4PREA 1LRTA 4MCZA 1VYPX 4DQWA 5IHBA 5A8PA 4KFZC 1P7QA 1U3JA 3DX8B 2X1OA 3WK0A 2DH3A 3D9AH 3BHBA 4UV4H 2ED6A 2E47A 2FL5B 5CHNB 4JL2A 2GVGA 2HWZL 5E94B 3EO9L 1Q85A 2R91A 3VQLA 4J3UA 3HUJA 4PJ5D 2YPIA 5IM7A 1GKPA 1TTQA 4JQVC 4MD4B 4WRLA 1IGSA 4P9HL 5CPQA 3G18A 2JELL 2WWDA 3VFWA 4U6YB 3BMVA 5LBSL 4A3QA 4AMKL 3NCYP 4JHWL 4MB5A 3H9HB 4I6VA 1JRBA 4WO4D 1D7CA 5G1YA 1J7VR 1U93B 2FB4H 2NY5C 3BD3A 2PPEA 5J1AA 2IMRA 4PGLA 2JKWA 4OD2B 1AG1O 4K5PA 1XH3B 2R27A 3EOTL 3DHPA 4G72B 4TRPH 3RIAK 1ML1A 2DN7A 4PJHB 2EJAA 2WZ0A 4ZZ9A 2EPOA 1VENA 2JEQA 3W87A 3ARRA 2WGXA 2DMHA 3AQYA 3T3ME 4NZUH 4DEWA 4CD7A 1R19A 4N9OB 2VEFA 4JFXA 3E3QE 5EZJA 1CT8A 1OL0A 2IFGA 3OR6A 3O3DA 5CCHE 1QWGA 4IBQA 1FWXA 4PRAA 4JGJA 1P5UC 4ZX5A 3MJ9A 3P30L 4B60A 5I0DA 5K9QI 3AWGA 5IHZB 3NTCH 1PKLA 2OOFA 3LTYA 3V5FA 4FA3A 4KFMA 3IS4A 1QHPA 1ACYH 4P3DA 1C8PA 4H9TA 1OP3K 5TFSL 4O58H 1R0AL 4MFDA 5I6SA 5FJIA 1ZVYA 3N41B 4FQXB 1MAML 4DWHA 2J88A 2BXZA 4YSQA 1F02I 2Y07H 3P4NA 3GNNA 4AD3A 1K3IA 3QB7C 1ONXA 2WD0A 4LCSA 3UGVA 3W1RA 4IP7A 3TXVA 3D0LB 5EZOH 5E94A 4N0YH 4NB7A 4ZFGH 3ESMA 3OVRA 4Z0JA 4G8GB 2G4FA 3HV9A 4HWBL 2NZ1A 5DJZA 3UBXA 1UWQA 3SQBA 1KOAA 5F4SA 1FYHB 5D1ZC 2XY2A 4NERA 4YDZA 4H8VA 4ZSOB 4AFYA 1QNZL 2CO4A 3VX0A 2CBVA 4HJGA 4KQ3H 4MNHA 5DLMH 1C12B 1T4WA 1H15A 3RVXC 4LYQA 4Y4KD 1TF4A 1F45A 5DVOA 1DJWA 3KBJA 1TWDA 4N2MA 4FQLL 4OGXH 1JMXA 5HVGB 1JPFA 3SDAC 4PS8A 4FK9A 1UD4A 2C3GA 1IMHC 2YD3A 1R34A 4KKAC 3KRUA 2V5YA 4H04A 4H9MA 1KT2A 2Z9TA 4R9OA 4WF7A 3TNOA 3S9YA 4QX4A 2OXHB 2ZNXA 1YNYA 3RDTA 4IXHA 4ROPA 2P8MB 2J1KA 1KKRA 5K1NA 4CW1A 4G8IB 1S7TA 3MQIA 5I5IA 3STGA 4NFCA 1DEDA 4P46C 2GG1A 4X4MA 5TDPB 5E6ID 4QAWA 4HG4K 1P48A 4J3TA 4WCYL 4FCAA 3RMEA 1M2OA 3WQWA 1BAFH 3UO8B 4N0CD 1I0DA 3BH9B 2GK1A 4AWSA 2J8GA 4P8WA 1QOXA 4LEOA 2JGQA 1PQZB 4H7CA 1F0LA 2W0LA 3FCSB 4PD4J 1MNZA 4MLJA 3F12A 4BQ6A 3UFIA 1SXSA 1TREA 4Z42C 5AC4A 4PUKA 3EOAA 5BV7H 4N8PA 3R12A 3M17B 2VZ1A 1K3UA 3SCOA 4HXBH 3NRFA 3U4EB 1TOXA 3S5YA 4GI9A 3WLBB 1E0WA 3GR7A 2QUNA 3G04A 2GQAA 5HP5A 2J62A 4GMEA 5KOMC 5H6HA 4K2SA 4QHNA 3HGOA 1JGEA 1K8DA 5F1NB 1SFDA 3QIWC 4U6TA 1KEGH 1CEOA 4E0RB 1V4YA 2O6PA 4HLEA 3CLFH 4AX3A 2Q02A 1AR2A 5FYKE 4DAFA 1W0YT 2FZ3A 4LLQA 3A47A 3RY6A 1RZJL 1QFUH 2WLHA 3UP6A 3IGSA 3D87B 4KEZA 4ATDA 4J6RL 3N43B 2EYRB 2H45A 2WOYA 3L5JA 3O4OB 2XQYG 1NFBA 4M7TA 3TQPA 1NCNA 4Q2ZB 5AVZB 1PKMA 2DQGH 3HA0A 2LVEA 3W86A 5I1IH 4PMDA 8TIMA 4IGBB 2QQNH 3KPSB 5FGRA 3VXSE 1PUDA 2D23A 1NU5A 4PB9L 4AQZA 5AYUH 4IGSA 2ZWNA 3HLKA 2JLPA 5GSRA 3O2DA 4M7ZB 2F54A 3QEQE 4PYHA 5EO9B 2O9OA 3GW3A 3OEXA 5FEWA 1ETA1 1JGVH 1T66C 2ZP0T 4GPNA 5AYYA 5DYOA 4NQCA 4BEUA 4O0ZA 3GO1H 2NV1A 3CZKA 4K1GA 4KZEH 1DVZA 2DT2A 1W72L 4ZAKD 4ML4A 1Q2SA 2O56A 3CZSA 4MZRA 2OMTB 4F33A 1E15A 5E00B 1JFXA 5CO1A 3PIQB 4Y4KB 2EH7L 2XG4B 4BWUA 3TN3A 3TEUA 1WISA 1RAKA 2AQWA 2WC7A 2W67A 3BIKB 4QE4A 1N8ZB 1SXZA 4CRPA 4F27A 2JE8A 5C0AA 4CNPA 1JMZA 4QBXA 2B9AA 2VR2A 5D5MF 3WJLA 4Y16C 3WHE1 1TRIA 3W29A 4DTGL 2WVUA 5EUOA 3RWFA 4UIMA 3T65B 1Q7QA 4KRPB 2NW2A 2EXYD 3U8GA 1YY9D 4ACPA 5AVWB 4A3UA 5G4MA 4FHKA 2VWTA 3N1MC 4V1DB 4AZ6A 4M00A 5JR1H 4Q4RA 4F5CA 4ABWA 3H9SD 4ODVL 4JICA 4X6BB 3DETC 4H8WH 5BOZG 4DBEA 5LGHH 4H25A 2LLLA 5H8PA 3QQ4B 1V3HA 2V5CA 3BVJA 3SCQA 3VWJB 3CQ0A 4DJDA 1R86A 2OTWB 3RPKA 5HGBA 4B7IA 2KAUC 4MDOA 3CFIC 5KSVA 2ZX5A 1KLGA 1QOQA 2J77A 4H00A 1D5BA 1HINL 4TUJB 1AG6A 5DQPA 5JPNC 5K33A 4MDIA 3BIAX 2XZQH 5DFTA 7PAZA 2LGNA 2I24N 5AOJA 4ZS6C 1YTDA 3NFNB 4GMSL 2BOLA 3AW5A 1LGVA 1Z7JA 3IU4L 3LVEA 1K3ZA 3LDBB 1BJ8A 3N40F 4KQ4L 4W70A 5DK3A 4YXKL 2WYHA 1ME9A 3GKAA 4GY1A 2F84A 4GAAA 4LC8A 3WMPA 1G94A 5I8EA 4U3HA 5ACZB 1X5GA 1EIBA 4X5XA 3P73B 3TJHC 3WQ5A 4QLKA 2DJUA 4ZMTA 4CNIB 2D7PA 3GF8A 3L3KB 3LN4A 4I48A 5J89A 3OSKA 4XVUD 1FYTA 2XN9E 4TO8A 2NT1A 4KTYA 1ICPA 4WIWA 5LLIC 5CH9A 3RWCB 5XINA 3ITTA 2PC4A 1MJUH 2KZWA 1SR0A 2EIBA 2DEXX 2KERA 3NTCL 5GS1C 4YSAA 4PRPB 1B57A 3I6GA 3IDNA 4YR6A 4M1GH 3D46A 5FJUA 1AQDA 1GG0A 5B7YA 1DBAH 3EDEA 3DHFA 1KIPA 2Q8XA 2B3RA 4I85A 4LSRH 3T0WA 4R4BA 3VKBA 4F2MB 4LF2A 4NJIA 1EA0A 4DI8A 4OZGB 2JF6A 2YCLA 3HTLX 6PCYA 2EJ1A 1ZBCA 2D22A 3LN5A 1KTLB 5KN5A 2XH2A 1RR2A 4FI4A 2F9BT 1AW5A 1HYSD 2ASHA 4MY9A 4M7LL 3RR4A 3VXMB 4ABUA 3BQ6A 1QTWA 2OMBA 1ADWA 2CLMA 3N14A 2A3LA 1GRWA 3QUKA 2DGAA 3CN2A 4H26A 4L5FL 4EMZA 1J5OH 1KCVH 3RWHB 1X8CA 2RMNA 2VAAA 1IBGL 4FG6C 4QOKD 1XYCA 4HIIB 3HZVB 4PW9A 3V95A 5TQ0H 3X3FL 2MCG1 4EUPA 4CNIA 4UBDD 5J7CC 3MPCA 5GZNA 1EBPA 2F74B 4J3XA 1U8HA 4OJAA 3KXFE 3W5MA 4RZ6A 3DMMB 2EZ0C 3GNXA 4OZHB 2QPEB 5SV3A 2EE9A 4L4VD 4NAMA 3TN0A 4JFEB 5D5ME 3W7QA 1DSFL 2UXFA 4IH3A 1P9MC 2QVHA 4HCRL 3HGRA 1B9KA 4RMUA 4XNUH 3KE0A 1Q6QA 2NY3D 2WMIA 4PLNC 1XIWB 3WLPA 4AV4A 1D5MB 1ITUA 5DX7A 1N9PA 5CEZH 2BOCB 3KPNA 1NC4D 4PRHA 5D7LA 4BKTC 1FH7A 3AUOA 4PC8A 3RVVD 1JPMA 3A4FA 1AXIB 2P8PA 3V5KA 3REQB 1KJVA 3NPZB 2CKBA 5T1LA 5T3XE 4P3WA 2DYRB 2ROYA 2V17H 5DHDA 2XETA 3MRDA 4R7NA 1JUBA 4HA4A 5EG6C 4YDMA 3WLWC 4YTRA 4N68A 3QHZH 1S9XB 4ZUUA 4HNCA 1AHWB 2H6RA 3GDRA 3M0LA 4TUUA 2QT6A 4PJHF 1ZU8A 3L9RA 2BVWA 4XPHH 1NCCL 5DJCB 3EWZA 4RE4A 4K8RC 4KRLB 1FHUA 4PUNA 2DQEL 2ZP8A 4XD5A 5D1QD 3L95A 4GIOA 2OB3A 3NIDB 4OFQA 1YPZE 5B22A 1JZ7A 1W3IA 3MB9A 5KITA 2Q8BH 1V3LA 3NDZE 4TPRH 3I75A 4A4AA 4Y16B 4XR8C 3VI4B 4NSKB 1DVXA 1HQ4A 5FKPB 1I9EA 1PG7W 3MV7A 4Y1AB 1THFD 3L7RA 1DBJH 5D6DC 3W75A 5AWNH 4KZ0A 2BRRH 3TA6A 4OLVL 3X3GL 3F6IA 1W1TA 5MHBA 5A6MA 2XVNA 4AD0A 3GHPA 1K7EA 4U1HB 4FJ6A 1ZHAA 2BVTA 2EDOA 3C6LA 4PZVA 1YMHB 3M88A 3BXNB 2WMIB 3UERA 4MNGA 1J8VA 2GGJA 1RUPH 5IEHA 2UUDH 5J8OA 1QR7A 3OG4B 3QIBB 2FT7A 5F2GA 5JTWA 2R1WA 2CLIA 5FA5A 1T89C 2FX8H 2Z31C 2CU0A 4ERAA 3NO5A 1OC5A 2X4PA 1V0LA 3ENEA 2PN5A 1W72A 4ANUA 2ZRZA 5HHVH 3GTTA 5ETUA 3WY4A 3ZE2B 1QO5A 4JTQA 1EP3A 2EVIA 1RZGB 2D73A 1NVMA 4X6CA 2IG2H 3FONB 3LDBC 3WUWB 2GSIB 4GD0A 4AL8C 5C0AE 2VN6A 3WY2A 3NSFA 3AIBA 1UR4A 4JTEA 1UCWA 4IGNA 2EDYA 1TIMA 5T1DH 5C7HA 5IQLA 3VIOA 3QP3A 3NNTA 1QLEH 5ICXB 2NXYD 4XPFL 5T33L 5EEZA 3E0VA 2YB1A 3SECA 4HBCH 3ZL2A 2OPJA 3AHZA 3K2KA 4R90H 4LDOB 3VXUE 4KKXA 5EIIB 4UMCA 3UABA 4C6MA 1G6RL 1XZWA 3S5LG 4FXLA 3RX5A 1H41A 3C8DA 4N28A 4CNSA 3T3PB 4ZFFA 3B04A 3WLNA 1X3DA 3Q8BA 4KTDH 1EH9A 4XBEH 2WCPA 1A3LL 3JV0A 2VXTL 2IH3B 5HHMD 1ADQL 2DJSA 4IIZA 2W07A 3QEQB 4NXKA 3WFBH 4LSUL 3NOIA 2R9HC 3X2QB 1K03A 1ORQB 3KOZA 5AC6A 2LTQC 4MWAE 3S1VA 5IEHB 2B7PA 1KTJA 1V7NL 2ZKHH 3VNYA 3QMRA 1R2RA 5FV1L 2OQLA 4S3GA 4NQSA 4BA0A 3M0MA 5JOPD 2CA4A 4Z7UB 2PC8A 5DELA 3FVMA 1QASA 2O5YL 3TH2T 1X1ZA 1EXHA 2Q6WA 4BV1A 3BJTA 1EERB 2OWXA 2M2DA 3ABGA 3CSYB 3LCYA 2X53A 2XWDA 2VXNA 1Z1WA 5KS9A 1S8DA 1UP3A 2A4CA 4AZGA 3PDDA 1MCHA 3VX1A 1BBDL 1BV8A 1EPXA 2R8WA 1CICC 3HMJG 4R3SA 3ZKQD 1R5VB 4C6PA 4N1CA 2F2KA 2GVLA 2VM3A 3GMNB 2ZKMX 3DNKA 4JM2A 2GIMA 2PCFB 2VDKB 4JZJB 4YAQA 1TPWA 1NEZA 2YLLA 4TS6A 4W6XB 4APQB 4Q3MA 3D48R 5ICXA 3C60D 3RWEA 5DXXA 1ZJAA 3QR0A 3LKRA 3BT2H 5CN1A 1O1ZA 1URIA 4R27A 5IFPA 1NCUA 5D9OA 2W79A 3ZMEA 2A3CA 3MLXL 3PQYA 4FQCH 1CPUA 1GYMA 1J8HE 1F90L 4K68A 4LRSA 4Q7BA 3C3UA 1CWVA 3PY2A 3NQ8A 3D4YA 4JQVA 2WQWA 4NGHL 3LZOA 4G6FD 4A35A 4PE8A 5AW3B 2OODA 4S2SA 1BFTA 5AVXB 1AO7B 2EACA 2G0LA 5I1IL 1XDLA 2J7BA 2OA9A 2NWRA 5KSBA 3NK3A 1FXQA 5C55A 2XDHA 5BZWB 3THAA 1MFVA 4PB9H 3GHEH 2NR6C 2VEMA 3W28A 4Z5RA 2AMUA 1T5WB 4MAZA 4ZODA 3BWSA 4HFUH 1YHTA 2F8QA 3VFPB 1M7DB 2WXJA 3VDCA 3TFKC 2OWWA 1Y6MR 4GFIA 3MU3A 1E9OB 2WYTA 1U33A 4ONGL 3KPOA 4O2CB 1YY9C 5DHEA 1GNXA 3AXLB 4PCPA 1Q9KA 1TVNA 3GBNL 1BZ7A 4MMZB 4WW1B 5E0QA 5T1KD 2P0OA 2G96A 1XRSA 5ACMA 1W72H 1NUNB 5I1DA 4D0CB 4GXUN 1GQIA 1JFQH 2GGHA 1S8DB 3CXOA 2Y24A 1D6EA 3OGSA 1PLAA 3DXAD 1EL3A 3F12B 2Y7GA 5I2UA 2VDPH 2PGWA 3P5ZA 4FFTA 4UFJA 3V16A 5LUMA 4LOCA 3L2LA 2C5DC 3QCVH 4ZO9A 4DAGH 4LW7A 4PHZA 5C08A 3D39B 1XLGA 3RNKA 5FKPA 1IGIH 3MV7B 1RULL 9CGTA 1C93A 1LUCB 4AZIA 5KANG 2D4DA 1TJ0A 3B8SA 1R46A 4MZIA 5JZ7C 5AW1B 2X6VA 3LCIA 4XE5B 4HKZA 4WGKA 4S11A 1NGQH 1E8ZA 1CT5A 2CDEA 4JTLA 1QA9A 4QEGA 4FTDA 1DN0B 3QIBD 4HCRA 3AJ7A 5FF0A 2DWSA 5J13B 1ZS8B 4HIQA 1OPGH 2AQSA 4TVPD 1SSGA 2ATMA 2DV6A 2GVJA 5DJAA 5ECJE 4M6NL 5EOCL 5IQ9B 1KM6A 2Y1YA 2DUZA 4BQ5A 1OCNA 3S96A 4LPYA 3K8MA 3BD5A 4JFZH 1XR8A 4JFED 2BP5M 1XLIA 5GVJA 5EU7E 5IB2B 3U9IA 1CIUA 3DHUA 4NUGL 4FQQA 1IQWL 1A21A 1OK0A 5HJXA 3I6KA 1C08A 2GITA 2X6CA 5CGTA 1MDLA 4Z3GA 1MUCA 2OEMA 4ERIA 2LLNA 4NZUL 1G4SA 5JPMB 4UNKA 3ARZA 3C61A 3TJIA 2BDNH 5DT1L 4HWEH 4X9HA 4XN7A 3SPIA 2JIEA 3DURA 4UWQB 1H6UA 3W11D 3WH6A 1WFOA 4EWND 2E4TA 3HAEG 3HE6B 4OCXL 2BSEA 4EXBA 2K78A 3JWNE 3PNRB 3L5WB 4XVSL 5DZNA 1VHCA 2QDHA 4ILSA 4C6LA 4LNRB 4GINA 3AOFA 3QI9A 4ISVA 1G7HA 3RCMA 3RNKB 4Z1DA 4CMMA 1KPUB 4L0PB 4YHML 4M6OL 1VJZA 2PLMA 3IETA 1KCSL 1MAMH 1UJPA 3STLB 2Q8BL 3NIFF 1UYQA 3PBYA 2HMCA 4Z23A 3VZZA 2V7HB 4AYFA 1PLGH 4XSLA 5EOCJ 1A9EA 3IMSA 5EZOL 1W37A 3ANUA 3N6HA 1Y1DA 4PJIE 3QUMH 1CI5A 2DMCA 3N40P 4MNGE 4HH9A 4WWID 1AGCB 4ONFL 4OKVA 5E6SB 5EORL 5F72S 2GLKA 2OSLB 3DFYA 1H7RA 1ZLUH 3W5NA 3ULVH 3DESA 2NZIA 2ZOWA 1MW2A 4FKEA 3MBEA 4KPLA 1Y07A 3WIFA 4UF7C 1OM0A 5CAYB 3STZA 2RJMA 3FPYA 1XUZA 2OJZL 1QG3A 1KBLA 1MWOA 3QXWA 3P02A 2GFTA 1Q8MA 2NUTA 3TBWA 2YL6A 3VU2A 2WMHA 4QPEA 4X6CE 4NNCA 2R1YA 4YDLC 5LYRA 2C1HA 2W80C 3W1UA 3H7BB 4Z0XB 4R97B 2W5FA 2Y36L 2X2HA 1A2YA 4LEBA 4M7LH 4BFKA 4E2VA 3FQTA 3MSRA 3P11H 2PSNA 1JXFA 5DY3A 5JIMA 3KS5A 1U2CA 3TZFA 5EWIL 2VSKB 3VQ2C 1L9TA 4FXRA 4GH7B 1BZ9B 3VI4E 2ATAA 4BHUA 4O5LL 1DDTA 1VKXB 5FW8A 2B7QA 3DJZA 5BUPA 1ND0B 1VCVA 1CYXA 4DJEA 2J6EH 4H1LH 2ZX6A 3GZKA 4U0RB 1B4EA 3WFHA 4MWFB 1MUJA 3PZTA 1X5AA 1OAZH 1OGTA 3DVFA 3UPRA 2Q2EB 1RH9A 2JCCB 3IN2A 1PY4A 2R2HA 4UOJA 3BJSA 4JHOA 4XPGH 2CO3A 1NCJA 3I2CH 4NO0A 1NIFA 1R7AA 4YHKH 2F53B 4TSAL 2H4EA 1W1PA 4Y2WA 4PJIB 4HEPG 5DD6B 1Z3NA 5IHZA 2CBTA 3WY1A 4IKIA 4MVBD 1CQYA 4GW1B 2KDYA 4HJIA 3HQNA 3WMBA 5E9NA 3CFQA 2E7MA 4A8LA 3GVGA 3CUPB 3MRLB 2VDOB 1P1VA 3U2ZA 4KJQC 1P5VB 4JM2C 2FPYA 4EAMA 3HI5H 4FYRA 4Z3TA 3ICJA 1DCEA 2FX7H 4KUCD 3X13A 2LW3A 3JYCA 1UT1A 2Z7UA 3ECBB 1TPXC 2FJSA 1MEHA 1MJJB 1BIHA 2BZCA 3MCKB 4DUWA 1BCIA 3E96A 5I17A 4P5RA 4M81A 1DQTA 3IJIA 3R8RA 2FLBT 5C08B 2EIEA 4LV9A 5HWMA 1CMOA 2BVPA 2GJXA 4YBQD 5CIPH 5DVLA 2C18A 2A6LA 2FYMA 5DHVB 2IXUA 4ZG1A 1PHQA 4PSPA 4MFEA 3SUSA 4ANWA 3H0TA 4YHNA 1W8GA 4B53A 1KYOJ 5D7IE 3UPRB 5DANA 3MV9D 4LSPH 5ABEA 2H3NB 2QQQA 3L8QA 2FJUB 2WSDA 4JTJA 1N26A 1W0WA 1WP6A 4GI8A 3SKUD 4QXIA 1MFAL 5DJYB 1ZEAL 3W3OA 1KLUB 4TYUA 4B6ZA 3GUTB 3LKSA 3D0AA 4KKAD 5EEVA 2P5EE 4AYID 1L6GA 2V8ZA 1YEKH 5ID0A 2HRPH 4KK8C 3ZE1B 2D2HA 5TDPA 1RHFA 2P26A 3UIYA 4JREB 2GITB 4XP6H 4XWGH 1RZIB 3IARA 2VDLH 1FPTL 2P1FA 3E74A 2EQDA 4PJAB 4F8PA 1BM3L 3DUUA 3BV7A 4Z7AA 5EF2A 1V0MA 4QTHB 3UJIL 4EDWH 5CSYA 1P4LA 4CQCA 2XFYA 1ZHLB 1U5JA 2W9EL 1A3WA 3QDGB 2OXGB 4KRMB 4DWSA 2IGFL 1UB5B 4O51A 4X6CF 5HI3C 3EBAA 5DZ9A 2CZFA 1E5AA 1U42A 2GK0A 1WYJA 2OELA 4PJ7E 2HN7B 3QJVB 4KKLD 3GAYA 2UY4A 5KVGE 4AUBA 3ZLQC 3WQ4A 3QUMA 5DUBA 1J8HB 1F73A 2V7HA 4I88A 3SOTA 3UJ2A 1OTUC 5F1NA 4YU1A 2Y61A 4P23B 2H1LM 1EA9C 4LUTB 4WFEE 1ZSXA 4RZBA 2FNBA 4MYWB 1W0WB 3KCJA 5KZDA 5HJYA 2O9RA 3NEXA 1IU1A 5C7VA 4M1DL 1KLUA 3AROA 3IRZA 1OP5H 4IMKA 2W9DH 5DFVC 3GUTA 1IBDA 3FTUA 3SQOH 3G8RA 2Z7GA 3NO3A 4GXFA 1XHGA 4R5XA 1N5AA 2VWEE 2EIZB 1Z9PA 3O11B 5GJNA 1XF1A 2QUMA 2UZ9A 3SGJA 1BZDA 1ISZA 1IC0A 4KQ0A 4G9FD 4JG0H 2XSAA 4WI3A 3EZ4A 1NEUA 4QS6A 3R1GH 3UT0A 4OJCA 4IRJB 3IIZA 1RZ8A 1PKQB 2BH0A 2C0AA 2XIQA 3MRCB 3TYCA 2G41A 4P99A 3S2JA 3KVLA 1O6SA 3FQUB 3BZJA 2DKSA 5DK2A 4UQ3B 2BHFA 1JVKA 5FO7A 1GOXA 1SLUA 3WN6A 4LEXH 3W1ZA 5K39A 3BPLC 5INCA 1UB5A 5HYFA 3GNRA 4G5DA 1CQKA 4Q6JA 5DCBA 1DLHB 1E8YA 5FSDC 3OLIA 3PJUA 4C5ZA 1OCOB 1ZSHA 3FONA 4B9GA 5IJVB 5MEOA 1JL8A 3RWHA 1V6YA 2EG7A 3LGGA 3SRKA 3WUEA 4AZCB 2FLRT 4JN2B 5KTEL 2AQRA 2NY5L 1FAIH 3MGAA 1XWYA 4C65A 2MEJB 4LSRL 3QXAA 3VU1A 5FO8A 5BU6A 3ASOB 2FZ8A 5C5YA 4QT5A 5J0BA 1ADSA 3UR8A 3UWWA 4Z2GA 2YGNA 3SD5A 1OGAD 4B7LA 5LGYA 1V0NA 2CUHA 3L3HB 4FKHA 4Z18A 5FHAL 4EJ1C 1IL1A 1GONA 5HWNA 5KZ6A 1UCBL 2ABBA 2WKJA 3UU0A 5IJBC 1SUJA 1U21A 4MB4A 2ADGA 2XSBA 3KR3H 3GU2A 4XAFA 2NXHA 4LGSB 4UFLA 5EBUA 1GPOH 2WTPA 6PTDA 2XV3A 3ZFHA 4P59L 1JPHA 1WX0A 2BXVA 3WF2A 3EX3A 4WI7A 43C9A 4NKIL 5D1QE 4OUIA 3E8UH 4K8EA 4R2GC 1JGMA 4HAFA 3J2PA 2FHCA 1D5BB 3HNTL 4YHZL 1US0A 1DWHM 1YXDA 4ZFMA 1CK0H 3U25A 2DY3A 2G50A 3KH3A 5AW8B 2NRDA 1HL9A 2WUBL 4X0KB 2QXWA 4Y9BA 1I3RA 3GS6A 1HHGB 2C8NA 2J75A 3RRXA 2BVQA 1SU5A 1UM4H 1URLA 5F7BA 4Z2HA 5H1WA 3TJPA 3DRTB 2FZ3B 3VAEA 1LQ0A 1L6SA 2IH1B 3T8QA 2OX5A 4GUPB 1NEZB 4HUXB 2A83B 5BOOA 3W7RA 4CC4C 2C1OB 3LZFH 4ZUSA 4O1BA 3EH4B 3TO4C 2KUTA 5IB1B 2QCGA 1FHGA 1JXKA 1RK0A 3WFEH 4HK6A 2YCEA 5A2FA 5EOCH 4YYCA 2ZAGA 1IFRA 1ZVHA 3KXFD 5B38A 5F9WB 2DZWA 2GJ6E 4LHQB 4CNTA 4XPHL 1GAFL 1JPGA 4EXKA 1YE4A 2X7LA 3GS4A 4ZO7A 4NIRA 3VGHA 2EE3A 2Z24A 4FQIL 2WM0A 1KIPB 4P5UA 3AY2A 1IC4L 2UXTA 4PRHE 5J11C 4ZQNA 3RY6C 2IAMD 2WHJA 1RLBA 1HIMH 3DENA 4KRPC 3KS6A 1M6OA 3GSWA 5MP6H 4JUTA 3QV8A 5B1CA 2GOKA 2PPGA 3D69A 3DVNB 4RQQA 4UZSA 2A9DA 1NCWH 4P4RA 5TDNB 1MQRA 1BQLL 3WL0A 5A2KH 2WSYA 5E4AA 4ABQA 3F85A 1SPQA 2PDQA 5MKGA 5I15H 1RQBA 5JXQA 3UYRL 1JD7A 4AV5A 1U36A 1MREL 5CUSH 5AHEA 4HX1B 3GKZA 1EJWC 2DQHH 3LQAC 1L9PA 4JE4B 4DGIH 5EMMA 1D7FA 3FS9A 5D6CB 1WBYB 1QTPA 1E4XI 1A4BA 2CALA 2X1PA 2VC7A 1AP2A 4YHGA 5HGHA 3HJZA 1JJKA 4FG6D 3HHMA 4KY2A 4GCAA 3PAYA 2D9CA 3JSSA 4ZFFB 1JUKA 2V8MA 1R5WA 3MLWH 3O8XB 1WCGA 3GYCA 1T5XA 1HWHB 1V54B 4EKXA 5HJGA 2FO4A 2R7EA 3MRNA 3MLUL 1LWHA 4R8WL 4IGBC 2XZZA 5IMMA 2J21A 4EI5A 1E3FA 1IGYA 3EPMA 4QE1A 3RVWC 3VWJA 3E2HC 1IM9D 5E51A 2IMMA 4BR1A 3WS3A 4W9GC 4AWJC 2QGBA 1KR1A 1DFBL 2FVLA 2DYSB 1UA6L 4X9FA 2YXMA 2WMKA 4U7MA 3G1FA 2BFVH 4ZW5A 1C29A 4PL2A 1E7UA 4GK8A 1XLMA 5H8DA 3DFQA 1QJWA 4W9IC 6FABH 5I8OL 3BUIA 1CF1A 5IK3B 4YEFA 4S1DC 4R7VA 3P3SA 3JXAA 2H41A 5T5FL 4A3YA 1HE8A 2QBWA 1B54A 3OA3A 2YBVA 4ETQB 5DBTA 3CMOL 1JZFA 1W5MA 1P4IH 2VDQB 1U8LB 4UQDA 1AE6H 2HE5A 3NGJA 1ZRQA 1RSFA 3CBJB 4WJXA 2QKIA 1HCZA 3GT6A 3BYYA 2K1MA 2XIBA 4ODTH 3UTTE 1TV7A 2Z65C 3IRPX 3REVB 3ZKSD 1IWPA 3AHVA 2KI6A 4H9ZA 4YHKL 1WKEA 3GLAA 1ED3B 1I1AA 3GIZH 4NZTH 4WWOA 4F7MA 2BLEA 5DO2C 2EUVA 3QSTA 2X6BA 4KRNA 2YWZA 1NM9A 3AXHA 5FUZL 5H35B 2ABAA 2V82A 2CH8A 4Z78A 5KZCD 5L2JA 1EEXA 4H5SA 4QTGA 3QQ9C 5A5WA 3FU5A 3JS3A 4QQ3A 2DQFB 3T55A 1J12A 1MH5A 3HCVA 3LKOA 3VM5A 2C71A 4XZWA 3HI5L 1T0OA 4N2DA 1NGZB 4MDPA 3SUWA 4MWAA 2BP0A 3S4TA 2J3SA 4FLOA 4X6DE 1GCYA 3ZRFC 3DKJA 3MU7A 3G5YA 3P8JA 4LFHG 5K7JA 4XBKA 1DVSA 1RJCA 1MSPA 3MRGB 4ZW6A 2EABA 2VXQH 3QQ3B 3H7RA 4BK5C 4QJ3B 2VLLB 1F4HA 1AODA 3BV4A 5TQ2H 2JJVA 4M3JA 5HHOE 3CO4A 3IRDA 4KFPA 4RGNE 5F1SA 4AVOA 1R3WA 3F5JA 1E5YA 2FZMA 3BQVA 5B7ZA 3D6NA 3RVTD 3FO1A 2PDFA 4J2PA 5IROD 5K9CA 3RM4A 3GVRA 2XG5B 4PTTB 3S5LB 3A64A 3G1SA 2LHAA 3T1FA 3QJFB 4GIRA 1NAKH 4MS8D 2E1WA 1LO0H 2W38A 1N59B 3ESVF 4I2XB 3OQ8A 4YL2A 1UYWL 2ATKB 2YCJA 3U6WA 3HPSA 4ETYA 5FJOA 1KBIA 4BQ3A 3EOEA 2XWCA 1N8WA 4TLKA 4H8HA 2X7LB 2OFQA 1A5MC 2EUXA 2PDUA 1EVUA 1VGKA 2NLJA 4A04A 3TEZA 4OKDA 4TNWF 2V5BA 4JCMA 2VDLL 1ZY9A 3ZZSA 2EG6A 1RK1B 2AEPH 4K73A 2MQ3A 2VL5B 4HN4A 3KXFB 5F4XA 1KLFB 2XBTA 4IGHA 5HDBF 3D8MA 1WAEA 3JT0A 3V5CA 5MF5A 3U7YH 1D5XA 1T6WA 1ACCA 1OABA 4QRPB 4HJUA 2W94A 3K30A 2X9ZA 3IM1A 5IM7B 5KVFL 3E8UL 3TU9A 1PO9A 4LLUB 3FRUA 5I3HA 5C7XH 1EJ8A 1F6LL 4RZ5A 5B3JF 1I4FB 4YHZH 4QWWC 3WNJA 2RD0A 1IC5H 3CVDA 2EPMX 3DX3A 1IGML 1P0NA 3ARWA 3DHMA 2PLJA 1M3UA 4N4QA 1U93A 4QXUL 3JV4B 4TOYL 5C0GA 4X4YB 1ZCCA 3LRKA 1J9YA 5DRCA 1U41A 4LQFH 2FWLB 3LHAA 4P2RB 4A7UA 2XG5A 2UZPA 1AZ1A 3R0DA 4H1ZA 4ZDHA 4MG4A 4PMQA 2QCHA 2ZD0A 5AKTA 2CO7A 2DQCL 4XZ4A 5DUMH 1N5YL 1BKHA 8A3HA 2DQUL 3NPSB 2FGWL 5CD5C 4KETA 3CHSA 2WXLA 4S3KA 3F5WB 1DE4B 2C19A 1DWJM 4KXBA 4ELMA 4YSUA 3B7TA 5EF1A 1G9HA 3MRMB 2Y70A 4C1NB 2EGZA 3ROOB 5DJ2A 3WJMA 5L4FA 5EB9A 3VE0B 4RFEA 3KBPA 2HEJA 1E0TA 2OX4A 3BLDA 4OLWL 2DDQL 5GPRA 3O9NA 4REQB 1HSBA 1JF1A 2H3XC 5F4WA 1KGCE 2QJNA 1E9OA 1V7NH 4MJ4A 4NZDA 1IKFH 4D7BA 3H21A 3NUKA 3LKQA 3KPSA 4CMHC 1KCSH 4ZQMA 3JVFC 2CO6B 5I74B 3QN3A 3I7RA 5IROA 2IPFA 4PJAA 1UXSA 2YMXL 1CU4H 4O50A 1B30A 2LQRA 2A6NA 3V0FA 3VFVB 2YOCA 3UDWA 2VR7A 4ELKB 4J3BA 4HYTB 3AICA 3SBQA 3BKYH 1C12A 1HILA 3CHPA 1OGGA 4GEIA 2F6XA 3UYCA 2H8PA 4OGAD 4AEHH 1QLFB 4X8CA 1AI1L 5KTEH 1BEYL 3JV6B 3EGJA 1T8QA 3CV1A 4NO3B 4O4VA 2X0HA 4QJ1A 1FZMA 4N26A 4DP5X 2N4IA 3GS0A 4PJEF 2H3DA 4XNMA 3BIKA 2H5UA 4PJGA 4BFIA 1NFPA 4NZRH 1T2XA 2JELH 2GJ6B 1CD1B 4X6EA 5JIKA 4OU1A 4FQCL 2A77L 5E99H 4QQUA 3S2LA 4IF2A 3K5SA 4PJIA 5DD6A 1SZRA 2FZNA 3RWFB 4BQBA 1NGYA 3ATFA 2BTMA 3APTA 3W7JA 2COQA 4PB0H 3VE0A 4OUOA 4JFHD 1E2VA 1HXYB 3FN0H 2HX8A 3HBZA 3MLUH 3QIBC 4APQC 1D5ZA 3H55A 4YLWA 3GHEL 4DYJA 7ODCA 5HBBA 1A53A 1U8KB 3T81A 3PWUA 5HUPA 3TYZA 3I84A 2XVBA 3OZLA 3P0GB 4YL4A 2UYLB 5GGVY 2IPKA 3L5IA 1ZV5A 5E9DE 3EXSA 2G5UA 4LAMA 5ESAA 1QSFB 2G5WA 2CKBH 2XIDA 3QVQA 1ESWA 4IBLT 4JPVH 5C6TH 1OX5A 1TPFA 1T1ZB 3TZVA 2X1IA 4U6VL 1YEIL 1A5OC 2A4EA 1CF8L 2ZPKH 2A74C 2YK1H 1WHOA 4PJCE 3GMOB 4YLBA 4QD2E 4ZAKC 2EDEA 2A9NH 4AGLA 3ETBJ 5CJOL 5C0FB 1GZQB 1N70A 3SGEH 5BOPA 1OK8A 1P4IL 3DTXB 2HKHL 3FTWA 4KDWA 5IJVA 4GVGA 1SJEB 4GQ9H 1BXVA 1OP9A 3GXIA 4XHJC 3UAJA 2WZAA 4JN8A 3MP5A 4L9XA 1ILSA 1C16B 1L7TL 3ULUE 4YC2C 1XEDA 1NARA 4IYKA 4GACA 4HKPA 5LO7A 1NQKA 1JXDA 3G3DA 1P6AB 1QFWI 2ITEA 2V3DA 2Y6SD 4I1RA 3VI3A 1HHHA 5IB3A 2ZUNA 3N3MA 5D2LA 4DCQA 3K6IA 3E5BA 1JHTA 4TX9A 3OJDB 1QK0A 1G7JB 5EFIB 3LA4A 2Y85A 3T9WA 2OMVB 3QZMA 5IBUB 3PWAA 4KCVA 1Q0EA 1I3UA 3MACL 1FVEA 2J88L 4U0RC 4L8BA 4QDGA 1E6OH 5DC4B 5J06A 3FHQA 1D6EB 1BOGB 4JK0D 1YUHB 1DUYB 2FEJA 4RGMC 1I1XA 4DW2L 5DT1H 4JFFB 2XLLA 1E6RA 1T21A 4ZT1A 3DO7A 3I6LE 5B7FA 2DW7A 4GHRA 4MNQB 4PGCA 1BYBA 3QCUH 2JJTA 2D2GA 2VVSA 2HN7A 3CLMA 2IBZX 3FO9A 3TC9A 5C07A 2HT2C 4UFIA 5F21B 1J5HA 3CEUA 4A2RA 4K3HA 3C87A 4Z7WB 2QVKA 3DK2A 4M6OH 3OF6D 3HZMB 3GMMB 3MOQA 3WTYA 1VLIA 4GZJA 2BVQB 3EJZD 5JDSA 2WXKA 4JKNA 3V0DA 1Q7ZA 3AO0A 3WG6A 4Z3HA 4F48A 2WHVA 2W3ZA 1FBAA 3BAJA 5JHAA 2D2CC 4KMTL 4PJEE 3K2UH 3S96B 1SM3H 1CI1A 1REQB 2A73A 2Z91B 4GQZA 4XVOA 4YFDB 3T2LA 1UG6A 1VFFA 4WK9A 1VZIA 2LLEA 1JPSH 5CHNA 4FI6A 4M1BA 4HZLB 3ABQA 1X5YA 1RJYB 3WHXA 2CEQA 3NPWA 3HUJB 3V6ZB 3USZA 4U10A 4YE4L 5KBMA 4DXKA 1NFAA 4OM1H 5D1ZD 2BFVL 5J9PA 4ZB0A 1FHNA 3MZ2A 4X7DC 3DJTA 1U8PB 4MJIE 5B39G 1XAKA 4YTSA 5E7FA 5EU3A 3KP1A 2VMDA 1FFNA 3IJDA 2WBJD 3UQNA 1G1YA 1JDAA 4JFFE 1LHZA 1LNUB 4HS6A 1EJTC 4PRPD 4LLYA 4POZD 4YUEH 3F00A 1E4LA 3PWPB 2Z1XA 4QDWA 4A3HA 3P14A 1AE6L 3D7PA 4YOKA 1PPIA 4IBYA 1E4KC 2B2XL 3KHQA 5CZXD 5FM5M 3RUGF 5I8KH 3BZGA 5DZVA 3H0TB 1N67A 2FNWA 1PZDA 4NYLB 4B5UA 4K5MA 1EX1A 1WXJA 2PUZA 3RIKA 4NLAA 2UVFA 4ELME 3DI1A 1QO3A 1TZIB 4KRPD 4KVNH 5LGXA 1MRDH 2R51A 4I9WD 3V7PA 1HKLH 1R3TA 4CC1A 3LV5A 5D6DA 2DIKA 4X80L 5E6IC 5F89B 1OARH 4UBDC 1AMKA 2FJFA 2QR0B 2RR3A 2WQVA 1RIVL 2FYYB 1EEPA 4IJBA 2TYSA 1OF2B 1AC6A 3LQAL 5D33A 3MGTA 3MC0A 3HPXA 3ULUF 2VSDA 4LL9A 3BK0A 35C8L 2PUQT 1CW2A 4I18A 3AUJA 3T6VA 3BO9A 4KXCA 5IESL 1I1YB 1TMQA 4G7YH 3EOYG 4BFFA 3BG5A 3QQWA 2OYMA 2MCPH 3OTRA 4BWWA 1E9IA 1A7BA 2HKFH 3MREA 4NAEA 1G9NC 4QTHA 3MHUA 4TV5A 3LIZA 1HKVA 4KJYA 3TH6A 3RFZC 5GZOA 3II3A 2H47C 1RIUL 5AC5A 4IRSC 5C86A 5FYJE 4Y4KA 4ZS7H 3O41B 1W56A 3VXGA 1I7TA 1J05B 3CPUA 1J6OA 5DU7A 1LE9A 3HOGA 2VLJE 4NYUA 4PTWA 2AKZA 4YZWA 4AVKA 5A6LA 4M9PA 4OSUH 1OSZB 5D93B 3CFEB 1X5IA 3LHVA 4PCTA 3P81A 2VI0A 1HINH 4Y2OA 4PJBA 4ZPVB 3MP4A 4G8IA 1DQQB 1XGYH 5GZNC 3H42H 2E5CA 1X7QA 3FT1A 3EB3A 2WJDA 1B3JA 3DX9B 1R75A 3DERA 3H70A 3T3PE 3FA3A 3NXLA 3QEUA 1EV2E 4HA1A 3L7FB 5KANI 5E5RB 2RALA 2DM3A 3DFTA 3IACA 3QFGA 1SFLA 4N86A 4IBZA 4M93B 2WUBH 3N41F 4U1IB 5CKGA 3SJVD 4F3FB 5JXED 4PB0L 3RGVC 2HWGA 4YNGA 2G97A 2B4GA 1QFPA 1I1YA 4KHTH 4O2FA 1K2DA 1H63A 4G7EA 4I0PC 3WH9A 3RPIB 1O7SA 3I4KA 2AFNA 1JWMA 1OWQA 2JH2A 3MRDB 1YE6A 5C7XL 2VDIA 5JIQA 3N06B 1NCBH 4XZNX 5A8GA 3VIKA 2D7NA 3U46B 4H6KA 3IJQA 4UUIA 6A3HA 2YC1A 1GC1L 1PZ1A 2BNJA 4M0XA 1UD2A 3G04B 2VGGA 3GG0A 1AQMA 4HUWB 4WK4B 5FHBL 1RZJC 3UO1H 3ZKXB 1YYCA 4CKVX 3QTPA 4JY8A 3T77B 5LBVA 2ATPB 1QRNB 4N8VA 5ESQB 5EZIL 4U1SA 4GW4B 1CF8H 4G80A 2APBA 3GTNA 4PCYA 4KO6A 1XDJA 4YGVB 1NJJA 4KI5D 3QMTA 3T44A 4PEKA 4PRDA 5SWSB 4XZUA 2VGIA 1BAGA 3WO3B 5T1MB 3QG6A 3W2MA 3MLRL 3TW9A 3TVMC 1AH1A 3FQXA 4N8UA 4L8SC 3DEQA 2QJDA 3IMUA 4YZFE 1E6XM 3VI3F 1PFCA 3HS9A 2VELA 2ZKYA 1WZ1H 4DPRA 2BV9A 4NX5A 4FAMA 4U3SA 4ELMF 1XF4B 3SQOL 1RY7B 1TJGH 4PSRA 1PDKA 3V4VL 4MKMA 3MUUA 1IEXA 3HV8A 4ZMNA 5IQ7H 1VYSX 1KFCA 1NOLA 4K94H 4BE5A 3UTZA 4AIZA 4Z7QF 1UBSA 4OIAA 5A2CA 3TBSA 3QHNA 1N8IA 2JKSA 5TIMA 3X3FH 1CXIA 3BUBA 2GJ6D 4WGWB 4JIHA 4I5BB 2VDQH 3UAJD 3IV3A 3ATAA 5CWSB 5C2CA 5EEUA 3PQYD 1KO0A 2CR3A 2FFCA 2ED7A 5ISZB 2H6PB 3CZJA 4YTUA 4KKCC 2GBTA 3RPTA 4LNCA 5AVYB 2EF9A 4US6A 5H2ZA 5BXSA 2G8ZA 1NC2A 2YBRB 2OR9H 1J10A 2FX9L 3AS3A 1XIHA 4YN5A 2ZUTA 4AENA 2OR2A 1FH9A 1PMYA 4TQ8A 1M9SA 3GNPA 4YFLF 4K7FA 5HHNA 4GIYA 4YXHH 1I9RH 2WWKO 3MV7E 2FQIA 5I79A 2PTTA 2DSZA 1AQKL 2FB3A 1A4MA 4HW6A 2HH0L 4LSSH 3VXSD 3SGEI 3H4FA 1WDWA 3C60C 3O6LH 3MRIB 2WZIA 4LVOB 4DZIA 1HNGA 1N5AB 3F83A 5KYNA 3UVAA 1W6WA 4UFKA 3PU7A 2YAEA 3QQNA 3CVBA 4ZFQA 1JZ8A 3B6SB 4LCYB 2F6UA 4FQ1L 3LY6A 1QOPA 4JREC 2QAPA 4BS0A 1Y0LB 4HPGA 4UI2A 2XV2A 4L5ZA 2C9AA 1US2A 1UR3M 2C16A 4Q33A 5JH2A 2OTWA 5HGBB 3KLSA 4H41A 5J6HA 3LHWA 2Y1AA 5FLUA 1ZT1B 3SRHA 4R53A 4NKDA 1E6ZA 3NJJA 4TUJA 4J4KA 3ARGC 3EDKA 4NJJA 3TN4A 3WF0A 1KGWA 5EOTA 1UKSA 4PJHE 1EK3A 5KYYA 2P5ED 2A1YA 5EZPA 4MNQE 4KK5C 3ZDZB 1H11A 5I0XA 1K6WA 2KH2B 2CERA 2C3VB 2C9QA 1LE5B 3LCXA 3YPIA 4MYPA 4M62H 1J01A 2ZPKL 1B0RA 1E2ZA 2ZXGA 1DEEA 2WQSA 1TQJA 1MQQA 3HPAA 1F61A 5G5DA 4DZBB 3NVTA 4Z2JA 5IFHH 4GG6E 2XXCB 3JW7A 4MY1A 3RVUC 2YD5A 1OD8A 3S0PA 3FO2A 2FATH 1HJSA 4UAOB 3KWSA 1SDYA 1H3TA 1AACA 3L23A 1JGUH 4B41A 5MEQB 4M4RA 3R25A 4HISA 43CAA 2YUZA 3FA5A 3NIGE 1JPST 1MCCA 4UT9A 3LZFL 4Q9QL 1PSCA 4P06A 3MBDA 1FWJC 4Q4QA 1INDL 1DUZA 3TN5A 3DRQB 1N6QL 3CSFA 2IAND 2XN0A 3L4UA 3QCTH 3S98A 1E67A 1UR2A 2XXGA 3TASA 5B1BB 2FVMA 4HNNA 1PG7L 4MCNA 4ZRGA 2DL2A 3LQAH 3ARGA 4X8XA 3CHVA 4F2ME 3DI0A 3FFCE 3A4DA 4K3GA 5IMLA 1GS7A 1KXTA 3TO2B 1OFEA 3ZXAC 4WHDA 5GRXG 3QNXB 4NNXA 2FTWA 1BZ7B 1TETH 1VACA 2D31B 3LZPA 4MMZA 2GTWA 4OT1H 3O3EA 3IGAB 1U1UA 2PBOA 3PZIA 2Z1BA 1NBZB 1RZKH 2WSPA 3MMEB 4NT6A 4OH2A 1DOSA 1NIUA 2APVA 4DEUA 1BBJA 3VD4A 5ANMB 3BN3B 4U1LB 2AKMA 3CTLA 4Q8UA 5ENWB 3SJVB 4XN4A 4BCYA 4HSCX 4Y5XA 1CD0A 4PG9B 2D69A 5JMRA 4AM0Q 5FYLL 1V93A 5EZLB 4Y1TA 3EXTA 4R3UA 5A6JA 2IH1A 4OLXH 4YJ5A 3LRLA 2D3LA 4GAGL 1GGBL 5F71A 5ICZA 4PUDA 3BCJA 3VJ6A 4C6BA 1NFIB 5IEKB 3QZBA 3Q2CA 4GRLC 1VFLA 4GVHA 2HFEA 1AY1H 2ZCZA 3I50H 1ZQ5A 2RGSA 4NJAL 1G7IA 3CH9A 1NGXB 1SZEA 4AYBA 3H2QA 1C1EL 4JNXA 1ZWIB 4M8QB 1XD0A 2R69H 2BIQA 1G0DA 3URNA 2I60H 4KFOA 1AD0A 3B8VA 3TAKA 3WDPP 1A3RH 1PJ9A 3DA0A 3DIFA 3G7TA 4XNZC 5CCZA 2OMYB 5CP7A 3MPGA 1ADQA 3VI3B 1AFVH 2EKSA 2IDFA 3ARSA 3JWDH 3CXFA 1BVWA 1ICTA 1TVLA 2CLHA 1JXJA 2DICA 1VFBA 3GLDA 1FRGL 5ILTL 1TWSA 2XGIA 4O15A 2ICES 4F92B 3U0PB 3PK7A 4A6YH 3IJEB 3D2UA 3H8NA 2EXOA 1JJUA 2K9UA 5HYJB 1KN2L 3S88H 5D30A 1DQML 2YBRA 5E6YA 2GI7A 2YPLB 1K8IB 3WO4B 2PEVA 2XGZA 3FCSA 3DOSA 3TFKD 4JYEA 5HDOA 1Q72L 3LZRA 3X12B 3NBNA 1ETB1 1UQSA 2ZIDA 1BG1A 2CG9X 2FIKB 3CZFA 3REWA 4K9EH 1ISXA 1OXYA 1QACA 5FHBH 3O8AA 4NSKA 4KT2A 3GSVA 1I7UA 1FVCA 1KEMH 3Q8FA 1O5XA 4LEQA 5JH1A 1CG9A 3N0PB 3MUIA 5EZIH 4XO6A 4KVNL 1CD9B 3CLEH 4N2HA 5CGYD 5E1QA 2DJLA 2AERT 4LLMB 4P9MH 3IK4A 3EF4A 3NJVA 4HUUB 4BFRA 5AKVA 1CB4A 2CPCA 4R96B 2HS8A 2QJHA 3PJLA 4H13C 4MXQD 4AXWA 4GSXA 4US5D 1L6PA 5EBMB 2ZAIA 2V5LA 3TNBA 3GTXA 4CNOA 1EZSA 3HC3H 4IS6A 2OSLA 3V36A 3BUTA 4HFWB 3DUGA 2F1EA 2H2PC 4HLJA 3SGGA 3VW3L 3PE9A 3GW0A 4GBXA 1T1YA 4AQAB 5MENA 1W3NA 1C7SA 2VX7A 1PY0A 2CBPA 2P10A 4X9YA 2VYOA 1BJMA 4D9PA 5I78A 2DLTA 4N22A 4FEIA 4HQQH 1KLFA 1A4JA 4GRWE 2YA1A 3P4NB 3U7AA 2ZTBA 4XODA 2V2WB 1SBBA 5BW7A 5DRZA 5ETUB 3A4JA 4MUPA 1NGQL 5FGBC 2CAKA 2DMKA 3D2UB 4LCCB 3TK7A 1GKQA 3IUDA 4JM2D 1U6AL 3WUWA 1GQLA 3FQ1A 5IK3A 3SDDC 3SQBB 3KBSA 3IDMB 1YNPA 5TH2A 3H85A 2E59A 5IG7A 2NZ9D 5IHWA 2E9IA 1KCXA 1MFBL 4LS2A 3HW7A 5DN1A 1ET8A 1N3NB 1UOLA 2CUMA 4ORIA 4E9RA 2RDUA 4D8ZA 2QIIA 2IUZA 4JFZL 4HN8A 4WWNA 3Q43A 1KIRB 3UG5A 1JF5A 2BC4B 4UM9D 2OMNA 2JXMA 2UZYA 3EFOB 3OKEB 4HHWA 4Q6IA 3LCLA 4YVVA 4DJFC 4RAUB 3QUXB 3T8MA 1M68A 4KQNA 3W2LA 1JSYA 3WK1A 5CCKL 2VCAA 3EB4A 3BKJL 3VRIB 2EDQA 4RW3A 5F7YC 3KWVA 4RNRB 1QFWH 3RNDA 3ESPA 3LXAA 5D05A 5E5CA 5GZOC 4XQ6A 3O6LL 4RX4A 3EXLA 2CRYA 3AG2B 3PRZA 1IC7L 1BTCA 1FKWA 3PWJB 1ASOA 2APSA 5BVPL 2AAVA 3PB0A 3G5YB 2RQ8A 3LIZH 1AQHA 3IJYA 4CN6A 3BHBB 1OF6A 1XISA 3VOHA 1NICA 3UWZA 3O3EB 1GZPA 3ZHLA 4M43H 2BLFA 3CSYA 1V08A 1JXGA 4XXWA 2A9BA 2GJLA 4P5TC 2C7FA 3CJPA 4M24A 3QDJD 5ANMA 1IXQA 3HMCA 2X8RA 3NPUA 3ONBA 4DKEL 1MOEA 3LRSA 2OGYA 5CBAB 4ZCWA 1HQTA 3NCMA 5E2VL 3FCTB 3UO1L 2FZBA 2V0TA 4NZ1A 4M80A 2XZ7A 4YSPA 1HCYA 2VZOA 2L3BA 2UWEA 3LHPL 1WAUA 5EBLB 3MJ6A 3FJ6A 3T4AA 5HBFA 3UTOA 2VJXA 3VFSA 4KI1A 2PW2A 1WZAA 1KXVA 4F5CE 3PGFH 4PJIF 4NEHB 1WA0X 4YWGH 3WLQA 2P42B 4MHHG 2H3NA 3VRLF 3DG6A 3C2YA 2KC0A 2ENYA 3QRGL 2EPLX 4AWTA 4L37A 2EIMB 5FCUH 2VQ1B 3VFNB 1JPKA 1RK5A 4N6QA 4DK3A 3WKQA 1GZGA 4W88A 5EWIH 5GRVL 3ZDYB 3NQEA 2XYCA 2Z34A 4Z5RB 3URQA 3WDJA 9PCYA 3KXFA 1NLBL 2OU4A 4J28A 3NFUA 3S35L 4PYGA 2C34A 2PPFA 2J6EL 1CLXA 4EPKA 4M1CC 3A22A 2BVEA 3PAVA 4PPTA 3FT2A 4QTIL 4BKLA 4ZXBB 3NQAA 2CU9A 4KXZI 5G4NA 4MADA 2HZHA 2VDGA 3BKML 3LZNA 2NUPB 4LWWA 1GGCL 1C3FA 5DMIL 3I2CL 5HYSB 2J73A 2H26A 3Q9QA 5M3WA 2DWTA 2XCMC 5FF6A 1WSST 1OYCA 3QHFH 4WSGA 4F9PC 5D2TA 3K6FA 1MG2C 3I9GL 4NCC1 1JRHI 2DY2A 2OLAA 3NJ3A 1CZ8L 5CP3H 4P8UA 4XBGB 5J12C 2W60B 2EEXA 4NFBA 1D3HA 5CPSA 1MLBA 5EBLA 1IAIH 4GPVA 4I13B 4YXHL 4WCYH 5LIKX 1P69B 5FF2A 4GI6A 2A6DA 4ANKA 5E4OA 1AVAA 2JIXB 1BYCA 3LXUX 2ATPA 3NFPB 4N8VB 1RZQA 1CC3A 1WA1X 3B5TA 4NM4L 4XIMA 3ZJ6A 2R56H 4LBEB 4BSVA 2DJMA 2ZICA 2P45B 2J1ZA 2R2HB 3CWGA 3D3VA 4G1MA 5FF3A 2XA8L 3W02A 3CFJB 1H6FA 2F53A 4W8BA 3DETD 4IJ3B 1FZOB 3V9EA 1XR8B 2VC2L 3ARPA 4PJEA 4DVBA 3HO8A 5IB5B 3RVWD 1EJSC 1DBBH 4LGRB 1HO4A 1RQHA 3I02A 3SBFA 1RV6X 3N55A 4K23H 1HNFA 2AGJL 5HPOA 1ZA3B 2XHYA 3CHFA 2EDWA 4DI9A 2UY5A 5FOBA 1PX4A 5B1AB 4P0DA 4LCCC 4LL1A 2W0FA 3VQ1C 3SFKA 2VDRH 1LEKA 3LCFA 3SOBL 2X4UA 1KCRH 1DVFD 2PF6A 2EAEA 2ESVE 4GO8A 4PRHB 5E1GA 1K7FA 3ABMB 3MYZA 2HG0A 1NGPL 3MXWH 4YH6A 4N20A 4Z95H 3AU1A 4Z1PA 5C3IA 1IT8A 4LJ3A 3WYZA 3PGDA 1F7BA 4CGTA 1GJIA 1WJ3A 2BIHA 5K39B 4UDTB 5CGMA 2HRPL 3S88L 4ZMXA 1Y7VA 3FYEB 3U7WH 3FF8A 5T8GA 4QKXB 2UZYB