4JFTA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor n-desmethyl-4-epi-(+)-codonopsinine
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
total genus 162
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jftA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jftA01
3EDJA 2BHUA 3FN9A 1LF1A 4W5UA 1GOIA 4LXFA 2DT3A 2FGLA 4PMNA 2O9OA 1LL6A 4AD2A 4JFSA 1ZS2A 3BCDA 2X2JA 1HP4A 3VGDA 3GBDA 2DSZA 4UQBA 1UKPA 2PWDA 3B8SA 1N82A 4UFLA 1WB0A 3TTOA 4RE2A 4EK7A 5I5RA 2Z1SA 1J0YA 1UD8A 3GNPA 1KGWA 4BQ2A 1T0OA 1ISZA 1WCGA 2GSJA 2WAGA 3FHQA 3AYRA 1K9TA 1M04A 3AOFA 4CN4A 3S5ZA 4M56A 1OD0A 1CDGA 2X2YA 1OGBA 4M8UA 3WENA 1E15A 1WZLA 4U5KA 1C8YA 1K9FA 2WVVB 2D0FA 2J7DA 1O7AA 4AD0A 5BXRA 1I1XA 3GH7A 1E6NA 3D50A 3W25A 2YDQA 4MNLA 3CZGA 1J0ZA 1JFXA 5HXMA 1JYNA 1JZ6A 1BYBA 4U3CA 1B3ZA 1M03A 2WK2A 3DHUA 3KLLA 2JIWA 3EJSA 5ABFB 1VFFA 1PBGA 1KBBA 5E0CA 2V5DA 3CMJA 3RDKA 4PMZA 4A4AA 2WHKA 2YFOA 2W62A 4M80A 2OYLA 2OLHA 4AMXA 3AIWA 1GVYA 1D2KA 3VMOA 3AISA 4XV0A 5DFAA 4GI8A 2J7BA 1AMYA 2J77A 2Y8KA 1XHGA 5CXPA 3OB8A 3WNPA 4LPCA 1B3YA 5DT5A 4W8BA 3BLPX 2D23A 5M5DA 5A6BA 1G94A 3BAYA 3KLKA 3WBAA 1YQ2A 2W63A 4CD6A 3SUUA 4X0NA 4CVUA 4D6JA 5A8MA 1KXVA 1SMAA 4U5IA 5A95A 2D3LA 2VCBA 4TTGA 2D2OA 4HA4A 2V5CA 4U2ZA 2ALWA 5JUVA 1ZB5A 3SCPA 2VX7A 2XHYA 3RILA 3EJRA 4B3LA 2WC7A 3L4UA 2WVSA 3BAXA 2QLYA 2J47A 1XGZA 3OA5A 1YHTA 3O9NA 1UR8A 3CHEA 3VSUA 3AMKA 1GW1A 2OSXA 4HA3A 1W9UA 1JAKA 4QCFA 3VIFA 3LXCA 1FP8A 1GQLA 3ALFA 2J7CA 1UZ1A 3BGAA 2OW7A 3VIHA 7CGTA 1V3HA 1JNEA 1JFHA 4DO5A 3S6TA 1WZMA 3VD7A 1R33A 5EFDA 1QI5A 3ZJKA 1WAWA 4J3UA 1UWIA 4OOUA 3WH7A 4M24A 4DWSB 5LA0A 2J79A 1PIFA 4UFIA 2XGIA 2IXUA 1C7SA 1GOOA 1Y7VA 1ZBCA 2D24A 4ZE4A 1KTCA 2QMKA 5HNNA 5CLTA 5DF0A 3WQVA 1JI1A 3H53A 3MV01 5A6BD 1R75A 1GUVA 5HBFA 5BROA 1NP2A 3POHA 1NH6A 3D3AA 3QR3A 2X05A 4NZJA 5A8PA 3UG4A 3OGVA 2EPMX 1CGYA 2WHLA 4JL1A 3PBGA 4WKAA 3ARUA 1U33A 4EKJA 1OM0A 1IZJA 3KL3A 2CCRA 3W26A 4NSBA 2NSXA 5BRPA 4M81A 4WLCA 4AMCA 5ABEA 4HZ6A 5GNYA 1EO5A 3EJQA 2DPEA 1QX1A 2CXGA 3BMWA 2G3IA 2X09A 4AD3A 3D51A 3CH9A 3A6OA 4AZ6A 1QW9A 4FLRA 3QHMA 2YA1A 3LPGA 3GBEA 2E0PA 3HZ3A 5BRQA 4AZCA 2VO5A 3VPLA 1XYZA 1JG9A 3DYPA 1UKTA 3H55A 4NZFA 5D9PA 3T08A 1DWHM 2YL8A 1MXGA 3KEHA 1XCWA 1ODUA 1C8XA 2G41A 1DWJM 3ARYA 4AMWA 2ZUNA 3ZOAA 3AIBA 1ISWA 4Z2IA 4YHEA 2WVTA 2DT0A 3UR7A 2EAEA 2F18A 4WSJA 4ATLA 4Z2JA 1M53A 1P6WA 1Q6CA 1MFUA 2EABA 1W9DM 1GOKA 1E6ZA 2QPUA 3D52A 3M6DA 4TVDA 3WDHA 3WNOA 5EFFA 2WKGA 2V3DA 1V0MA 3AHVA 4MJ4A 4OUEA 1FFRA 1VEPA 1RP9A 3N18A 2WVUA 1UOKA 4JFWA 3WBEA 1HVQA 2J75A 5EMYA 1V03A 3ZT7A 3CHFA 3WEOA 1CLVA 4AZ7A 5FL0A 4W5ZA 3WD2A 1NP0A 4AYGA 2XYLA 4MB4A 4QLJA 1QVBA 3ZSSA 4L4OA 4PUEA 2OWXA 4HOWA 1H11A 1IT0A 1TA3B 3VM5A 2YOCA 3B9AA 1NOWA 3W0KA 4CD5A 1WDPA 2ZXQA 1CGUA 4BQ5A 1US3A 1DHKA 1R7OA 3OGRA 3M07A 1OIFA 5BCAA 3WNMA 1EOMA 3BLKA 1GNXA 3SCWA 4MNMA 2NW0A 3VD3A 4F8XA 3VIGA 3CZJA 4FK9A 4U33A 1KCKA 1Q4NX 2WM0A 3MO4A 3WKZA 4W8LA 1MWOA 3D5HA 4DM2A 4L4PA 2PWEA 1DP0A 2WMFA 2DSKA 1TQSA 4PMQA 2YL6A 1HXKA 4A3YA 1QNQA 1CGWA 5EB8A 2YA0A 1E0VA 5AY7A 5A69A 4XZBA 2CIPA 2VZOA 3WN6A 4CGTA 1HJQA 2QF8A 4Z2LA 2X1IA 3DYMA 1KCLA 1MW3A 1ZL1A 1TUXA 3LXAA 4MAVA 3GM8A 2WZEA 1W3HA 4B15A 2VOTA 4CD8A 3U57A 2GK1B 1RH9A 2EBNA 3UETA 3VIJA 1H49A 4H2CA 3N9KA 4JAWA 5BWFA 1K9EA 3T0DA 3BVTA 1CBGA 1BTCA 2J62A 4D6EA 2IUZA 2J7FA 3WD3A 2VQUA 1PPIA 5ABFA 2HISA 1BSIA 2JF6A 4GIAA 2FH8A 4HA1A 3BUQA 3N15A 1DWAM 1EHNA 4HU8A 1XD0A 1TQWA 1IV8A 4OBRA 4P7NA 4AD4A 1W2PA 1NWRA 3AJ7A 1G9HA 2G3JA 4C7GA 3T09A 1R7AA 2WSKA 1EGZA 2D20A 1HKMA 4W86A 3MSGA 1UKQA 3ECQA 4CN6A 2VURA 5DEZA 4UOZA 1VENA 3U5YA 3AZRA 3GYCA 3RM4A 5I2UA 2OYKA 1TQVA 3QOMA 3WH8A 4MADA 3SUSA 1KXHA 3ARPA 3CGTA 3BCFA 2UY5A 4GO8A 2J7GA 3W6LA 4GINA 1V6WA 2FHBA 4DM1A 2QMJA 4OBSA 3NIYA 3FY1A 2CETA 5A2BA 4W8AA 3AIEA 1KR1A 1MYRA 3U5UA 2WHJA 4XUYA 3WQ4A 3JUGA 2XM2A 5KZ6A 4PTVA 1Z32X 1RD6A 1KWKA 1OT1A 2E8ZA 5E6ZA 7A3HA 3GXMA 5C70A 4DUXA 4D6CA 3CIVA 1UR4A 1UZ4A 4D6DA 1E71M 1EDQA 3BVWA 4FF5A 3LPOA 1W1VA 3DC0A 2PBOA 3PHAA 3APGA 3GTNA 2VX6A 1PJ9A 3SCNA 1BYDA 5D4YA 4CKQA 4B16A 1GQKA 1VFMA 3WY4A 4UR9A 5A6KA 1JF5A 3VOCA 4DO4A 1OBAA 3THDA 3CHCA 3IAQA 2O9TA 1JF6A 4KRUA 1H0IA 4PBGA 5F7UA 1JGIA 1E6QM 2WBGA 1E3ZA 1E4LA 4IPLA 4ATDA 1E1EA 3W28A 2VZVA 2ZXAA 4BQ3A 5JIPA 1WDSA 3ZJ7A 1BG9A 3EJUA 1WE5A 1NWSA 3TA9A 1XH2A 4FMVA 5A8NA 1JZ5A 1VAHA 3S2CA 3IGUA 4X0VA 1LG2A 4ATWA 3UG5A 2JFEX 4HU0A 1I75A 4J7RA 3WL1A 4UQCA 4W85A 1W9BM 1NOFA 1QBAA 4H04A 1GJWA 1HT6A 1G1YA 1G5AA 2ZWZA 2HVMA 2WMGA 4W87A 2E9LA 2EPLX 1LWJA 5I6SA 4HMCA 1CXKA 4PMXA 3F5KA 3OG2A 2D3NA 1QW8A 3SURA 4NX0A 3SCOA 1AQHA 4CD7A 2WZHA 2VJXA 2VUYA 3M7SA 5CPQA 5AYBA 3ZT6A 4UTFA 3VIMA 2NT0A 3ALGA 3VSVA 2AMGA 3MSDA 1E43A 3VUPA 4AZGA 4PCSA 4KMQA 3MI6A 4HZ8A 1UWUA 1QI0A 3ZSTA 4CCDA 4PMOA 2VVSA 5E09A 1NWTA 3O2LA 4LYRA 4IPNB 4P8WA 2E9MA 4J3WA 4QLKA 3J7HA 5IDIA 2BVDA 4J3XA 1G01A 3WEZA 2WC4A 2VZSA 3VM7A 2D0HA 1M01A 1HWWA 1HKJA 2AAAA 4LGXA 4W84A 4PCTA 4UQ9A 4QFUA 3VIKA 4HMDA 4D1JA 3A22A 3PTKA 3GXFA 1W91A 3UR8A 3IJ8A 4FNRA 1PX3A 1R85A 1J0IA 9CGTA 4CD4A 5CSUA 3OZOA 4PSPA 2WCAA 5GQBA 2FH6A 1OSEA 2PWGA 3W38A 4NXKA 1B9ZA 2FYVA 2PWFA 1E0WA 1E6RA 1BQCA 2J8GA 4XZWA 1JDCA 2WPGA 1VBUA 3ARWA 2E8YA 3EJTA 3IAPA 3VGHA 3K8MA 3BVUA 1E4NA 2UWFA 2OW6A 2CNCA 3VDAA 4PMVA 4TUFA 3FAXA 1VBRA 1R87A 3VU2A 2UY2A 1UWQA 4PMYA 2A3AA 1TFVA 4PMUA 1CGTA 4FNPA 3K4DA 4ACZA 5LYRA 3SCRA 1W9PA 5E9AA 1MW1A 5ECUA 1SFSA 5CJ5A 2CEQA 2ZX9A 2CBVA 2XFFA 2EADA 3M46A 1PEZA 3DX4A 2VZUA 1JDAA 1OWQA 1OT2A 3PZ9A 3RPMA 1KB3A 4IUGA 2GJXB 1EOKA 3AICA 3F5LA 4IISA 2E9BA 1E5NA 4M1RA 3D4YA 1J9YA 1UH3A 1E0XA 4RE3A 3AS1A 3KL0A 4JZ5A 1VF8A 2F7PA 3L4ZA 1HXJA 5FL1A 1BLIA 1J12A 1GJUA 4F9DA 5CLWA 1UASA 3L4YA 3CV5A 2WBKA 2XIIA 2DT2A 3O6AA 2BV9A 2WSPA 4CUCA 1PZ2A 2CITA 4JKLA 2G3NA 3VDBA 2GVYA 2XFRA 1B1YA 4CVWA 1UG6A 1ZU8A 4HPHA 1VFUA 3MS8A 3VTRA 3BVVA 3VGBA 3WEMA 1HJSA 4ZFMA 3AMDA 3W29A 1W1TA 3GDBA 1PX8A 1XYFA 2JE8A 1JD7A 1BF2A 2PF0A 1LLOA 3EDDA 4WSKA 4KH2A 1CENA 5D8ZA 3WDIA 3SIMA 4MB3A 1UQZA 3FHAA 4GZEA 1VJSA 1CGVA 4UQAA 3SEPA 3IJ7A 3OLGA 4YN5A 2VT0A 2DSUA 3A24A 4PMRA 1F4AA 4PN2A 3A21A 2DT1A 2G8ZA 2XVGA 4DWSC 5A6MA 1JD9A 3WMSA 1Q6DA 1H2JA 1WNOA 3NJ3A 3IANA 3AHYA 4QDMA 4AWEA 4AXNA 3GNOA 2PWHA 4AY1A 4TVCA 1E72M 3VD5A 1GCYA 4ZXOA 1MQRA 1ZJAA 3D4ZA 5CPTA 2BY1A 4XB3A 1EQPA 5C8BB 1O6IA 4AEFA 1OIMA 2WCGA 2BY2A 2XJ7A 3AZSA 4Q7NA 1J18A 2F7RA 2CHNA 3BH4A 3WF0A 1EH9A 3EBVA 2EJ1A 2MANA 1HL8A 4HOXA 3LPPA 1H5VA 1JZ8A 3PN8A 6CGTA 1BFNA 1HIZA 1NM9A 2PC8A 4FLQA 2VC9A 4EE9A 3CUFA 4AZ5A 5I78A 2W67A 1JZ3A 4N42A 4E4PA 3DX0A 4H7VA 3MKKA 1E5JA 1KGUA 4WIWA 3BUBA 1QWUA 3KL5A 3A3HA 1GOQA 2EPNA 2VX4A 2ZUWA 1VJZA 2OSWA 4UFHA 4PRWA 1MQPA 1WDRA 1HJXA 2VR4A 5HPCA 1V0NA 2Q8XA 1JI2A 1XD1A 2CERA 2O92A 2WANA 3GZAA 4CCEA 4M82A 3WUEA 4PTMA 1ZBWA 1J11A 2A3EA 3A4WA 4UQDA 3MUY1 2YDRA 1B0IA 2A3HA 3WQWA 1ECEA 1OINA 4W7WA 3BVXA 4UOJA 2NT1A 3KE0A 2WLZA 3FXYA 2X8RA 3GXDA 1OGGA 2F61A 1H1NA 1JZ2A 1QHOA 1PX4A 4W93A 1TZ7A 4TXEA 1V3KA 1MW0A 1TG7A 3CUGA 3PZGA 3CLWA 2XN1A 4DO6A 1WKYA 4FNQA 4Z2HA 2BFGA 4UOQA 3WMCA 1FHLA 4P7QA 2D1ZA 5I24A 1C90A 1U2YA 2VR5A 2YIHA 1UR9A 3N13A 3T2PA 1GPFA 2ZOXA 4NI3A 2Y2WA 2GDUA 4UFMA 1W1YA 1C93A 2J78A 3TOPA 3WQ5A 1V0KA 1PS3A 4HZ7A 4X9YA 1EDGA 3SCUA 3EDKA 1UUQA 4U31A 5CPSA 1EXPA 4AZIA 3SUVA 1U30A 2WWDA 1E6SM 1V02A 2YDSA 4BA0A 1AVAA 3WELA 3BUPA 2WLYA 2V38A 3N12A 3W81A 2OYMA 2WHMA 1I1WA 3VKKA 3VX0A 2CHOA 4W88A 6A3HA 3PTQA 2XWEA 1B30A 1B2YA 3QGVA 3WFZA 1V0LA 3PZNA 3AHZA 1QNOA 4D71A 5I3DA 2J8FA 2EXOA 3VNZA 3ZIZA 1CPUA 5A1AA 1JIBA 1GONA 3T0AA 4GI9A 5KEZA 3VILA 2ZWYA 4J3TA 4Q22A 4J3VA 1FH7A 1OCQA 3AI0A 1GQJA 1WZKA 8CGTA 2VMFA 2X0HA 3WF2A 3WD1A 3CUIA 4WK9A 3BUIA 2D0GA 1W2VA 2ZUSA 4F66A 2VRJA 1R47A 3OBAA 2J25A 4B3KA 4MNKA 1E40A 4DWSA 3VMNA 1UWTA 3TONA 1XSKA 3POCA 2ZICA 3S5YA 2RGMA 1UR1A 4BCEA 3BAWA 1CXEA 2VTFA 1CYGA 2YFNA 1WO2A 4FLOA 1V6YA 2OWWA 3GNRA 2ZX8A 2ESCA 4V28A 2CKSA 4BF7A 1HNYA 2CPUA 4NRSA 1LWHA 4GI6A 1JXJA 3ZM8A 3OLDA 1KGXA 2VCCA 3UERA 1M7XA 3W82A 3DDFA 3KWXA 3LRMA 1E56A 2WMIB 3DECA 1TR1A 3WDQA 2G4FA 1H41A 1UA7A 1QI4A 1VB9A 4D6GA 1XH1A 4JL2A 3CBWA 4D1IA 5GNXA 3OGSA 1E6PA 2JF7A 4D72A 1UA3A 5IHSA 3G6LA 3LRLA 3A47A 4GPNA 2XTKA 1V3IA 2W92A 1B3WA 4URIA 5A6LA 3A4XA 2X2HA 1V3LA 3W37A 1EHAA 4DUWA 1WDQA 3TTYA 1W1PA 1H4PA 2WVVA 3L2MA 2X2IA 3K8LA 3VINA 2OSYA 3WUFA 1CEOA 3WQ6A 5M03A 3THCA 3CC1A 2WMHA 5A8OA 3SCQA 3VO0A 1W9VA 3HMCA 1B3XA 3VGGA 1DEDA 3SUWA 3MUAA 1XCXA 3K1DA 4MTVA 3I3EA 1DWFM 4DWSD 2XG9A 2QPSA 2DQXA 3RCNA 4UCFA 2BHZA 3DHPA 3WNNA 1JYVA 2W4XA 4P8UA 4S3JA 5ABGA 4V27A 5CG0A 3RMEA 4TX6A 3VNYA 1TQTA 2W61A 2WW5A 4WJXA 2Y24A 1E55A 1L8NA 1MW2A 1AQMA 2ZUMA 3EYPA 3K46A 2WCSA 1SR0A 3N11A 5IXEA 3CZKA 3E1F1 3OLIA 1R86A 4AD5A 1Q6GA 1HJUA 1DWIM 1O7DC 3T0BA 1BVNP 2WXDM 2VL4A 1LQ0A 4OGZA 3MMUA 1CXIA 4LYPA 4KGLA 1GZJA 4W7UA 2UY4A 4U3AA 3CTTA 3ZJ8A 3LX9A 4YHGA 1HP5A 2CKRA 3ZJ6A 2ZE0A 4PMDA 2DSWA 5AC4A 1GOWA 3EDEA 3WDJA 1S46A 2J4GA 4Z2GA 1QNPA 1TE1A 7TAAA 3ZO9A 3DDGA 5CGTA 4E2OA 1CECA 1KXQA 2FHFA 3EJPA 3BMVA 2BXZA 3QHOA 4AZBA 1QNRA 3OIHA 4W89A 5E1QA 2WC3A 5M17A 2VNCA 1KQYA 1BGAA 2XN0A 5C71A 3AXXA 4NRRA 5JBDA 2JALA 1V02E 4GZIA 3A5VA 4MDOA 4WKHA 5E70A 3WY2A 2WYSA 2OWCA 3WF1A 1VRXA 1JYWA 1H09A 1QHPA 4AEEA 3ARXA 3UCQA 3ARRA 2WMJA 3VDCA 5AC5A 4PTWA 2WB5A 4C7DA 2WKLA 2Y8VA 5BXPA 1D3CA 1E70M 3BAKA 1PZ3A 3WUGA 4H8VA 3BUDA 3BSGA 2BS9A 1JAEA 1K9DA 3AIRA 1UD5A 2GFTA 1LG1A 1KWGA 4AISA 4R5EA 3WL0A 1C7TA 3PZTA 1FH9A 2YL5A 4P7LA 4A3HA 4D6HA 2ZUTA 3I3DA 4E8CA 1Q6FA 2VI0A 1A3HA 3RJYA 3WH6A 1KTBA 3ARQA 4JIEA 4HMEA 5CZKA 2RGLA 1V3JA 2EQDA 1UD4A 4ZEPA 1NQ6A 2YLLA 3CPUA 3DYOA 4NF7A 2XUCA 2ZX7A 3N17A 5D8WA 3W4RA 2PI6A 4GQQA 3AHTA 3WNLA 2GUYA 1ISVA 2F2HA 1GVIA 3ZQ9A 2BVTA 3PZMA 3UEQA 1CTNA 3W53A 2DEPA 3AZTA 2YJQA 5CQ1A 3AIVA 1NWUA 1B90A 1D7FA 2XVNA 3HN3A 3WIJA 5E6YA 5GPRA 3AMGA 3PZIA 3T2OA 1H3GA 1UR2A 2VCAA 4QLLA 2DDXA 3KZSA 1VFOA 1DTUA 5HPOA 3VIOA 2XWDA 3GXPA 1MQQA 5I77A 2E3ZA 1E3XA 5D9NA 2DIEA 2ZIDA 2O9PA 4YPJA 2F8QA 4TVUA 3TV8A 2D73A 3NYDA 1HL9A 3LPFA 5FD0A 4Z2KA 5LA1A 1XH0A 4JHZA 4UFJA 3RM9A 4JFTA 5D9MA 1BHGA 4QAWA 5JBEA 2XM1A 2FE0A 4GQRA 4OJYA 2JEPA 3BLBA 4OIFA 4QP0A 2F1AA 5GNZA 3I3BA 4GXPA 3CZNA 5FOOA 1WP6A 5FIPA 1J01A 1V6XA 4ZE5A 1E1FA 2PB1A 1CXHA 2VZTA 3BXWA 1CIUA 4KGJA 1G0CA 1QI2A 1CXLA 1UD3A 3QHNA 4UQEA 3NSXA 2EPKX 1LJYA 5DT7A 4EAMA 2Y4SA 3G6MA 1KBKA 1V3MA 2BY0A 4IM4A 4K68A 4MJ2A 4JFVA 3CMGA 4PSRA 1UQYA 3AIUA 4CCCA 3VDHA 1EO7A 4P7RA 1BYAA 4P7OA 3AS2A 4UZUA 3QOKA 2VRKA 4UFKA 1J0JA 1QI3A 2XVLA 5A2CA 3TTQA 1ISXA 3DX1A 1ESWA 1W32A 2DH2A 2BHYA 2YBUA 2FDMA 4AZCB 3ZR6A 1V6VA 5A94A 4LX4A 1RPKA 1QWNA 4FNUA 3CO4A 1KFWA 3WY3A 2DGAA 2C7FA 1UHVA 2XSBA 2YL9A 2ZUUA 1ZBKA 5EBAA 3DX3A 3VIIA 4H8UA 1C3FA 4MNJA 4AD1A 1TQUA 1UR0A 1GOMA 3L4WA 3PZVA 1HJWA 3MANA 4AIEA 3PZUA 2VX5A 2EACA 3WH9A 5JIWA 2YLAA 4AYSA 5HDRA 2W66A 3AYSA 3NDYA 1TA3A 1XSIA 3WUBA 1XSJA 4FNSA 5HOSA 4KWUA 3FNDA 1GHSA 2J74A 4R27A 3N1AA 2WNWA 4PTXA 5FKYA 4LYQA 1JL8A 2GK1A 4C7FA 4J3SA 2ZUVA 1Q6EA 1BYCA 1SYTA 4EANA 4MAZA 4GZJA 5BXTA 3ZMRA 4TTUA 2VRQA 3GXIA 1V08A 4XX6A 3MUZ1 3AMLA 1QPKA 2BNJA 1MFVA 2EPOA 4FLSA 1CLXA 3AFBA 1ISYA 4F79A 2BXYA 3CUJA 1LL7A 1E73M 2YKKA 3WD4A 2W5FA 2F7OA 5D9OA 2GJXA 2V3EA 3WNKA 3BAJA 1QBBA 4Y7EA 1QHZA 1XRVA 5I79A 5M3WA 3NSMA 2XVKA 3LRKA 1UKSA 1F4HA 3HG2A 4MB1A 1W3KA 5CSYA 1JZ4A 3GXTA 1L0PA 3WF4A 1QNSA 1C91A 4TX8A 4ZXLA 3VIPA 3NDZA 3B9EA 4RL3A 3WMBA 4F9JA 4MDPA 4B9ZA 3B9DA 4ML4A 3IK2A 4M29A 3AXIA 4CN1A 4PEEA 5JBFA 1HN1A 3SCVA 4CU8A 2EEXA 3MMWA 4JFUA 4ACZB 2E4TA 4U2YA 1W3JA 1TMQA 1US2A 4JKMA 4W7VA 1FHDA 4V2XA 5A6SA 2IGTA 2XVPA 1HX0A 1WZAA 3WQ8A 1UKOA 2O9RA 1UD2A 1MXDA 3A23A 3EMQA 2Y5EA 3AQUA 1EDTA 4S3KA 4MPKA 3CHDA 1V6UA 4J27A 3AMCA 1MVYA 1HKIA 3VX1A 1BGGA 1PAMA 3ARTA 3VSTA 4ACYA 1HVXA 3VD9A 2V3GA 1JNDA 3GH5A 3RM8A 3NSNA 1B31A 3ZR5A 3L4TA 4WF7A 4HPGA 3WDPP 5TD4A 4H8HA 1HF6A 2J7EA 4H41A 1PIGA 1B3VA 1CXFA 1J0HA 1BAGA 4P8XA 2Z1KA 1JDDA 3L4XA 2GDVA 3AHXA 1UYQA 3TTSA 2D22A 5IHRA 2XFYA 3F5JA 1EA9C 1HKKA 2VVNA 2F1BA 4GKLA 3WY1A 4AIOA 4JCMA 2DSVA 3ARVA 3VMPA 3UESA 3CZSA 4AC1X 4J28A 1ZJBA 1FA2A 2X0YA 4BQ4A 4KRTA 1R46A 3K8KA 3GH4A 3LXBA 2VQTA 4PUDA 1ODZA 1R8LA 5A8QA 3U7VA 3FW6A 3WSUA 1VEMA 1E6XM 3OZPA 3ARSA 3CUHA 4B9YA 3SCSA 1OGSA 2CBIA 4BZYA 2YA2A 3U7BA 4D6IA 2CESA 1CNVA 3AIQA 1GHRA 1BPLB 1KR0A 2DIJA 1E9LA 1E4IA 4PYSA 5A3HA 5ABHA 1FP9A 3HG4A 3TP4A 3H54A 1RP8A 2YBTA 1A47A 2XPKA 1X6NA 1UH2A 5I23A 1J0KA 5A6JA 2GJPA 1OB0A 4ZENA 2WMKA 2WZIA 1XC6A 4CU6A 2XGBA 2JEQA 3ARZA 2A3BA 3VD4A 3VVGA 2DH3A 3BAIA 1ITXA 3RJXA 3HG3A 2B31A 1C8QA 1H0GA 3VGFA 4BS0A 3A4AA 4AW7A 1AQ0A 4P8VA 1SMDA 1W9XA 4LQ1A 2CBUA 3PZOA 1J10A 3UG3A 4RE4A 2F7QA 2QV4A 3EDFA 1X6LA 6TAAA 2ZXDA 3HG5A 3II1A 3L4VA 3F4VA 3MUIA 1UWSA 5IFTA 3N04A 1FOBA 2ZX5A 3EMCA 3L2LA 4HTYA 1IZKA 1KXTA 2PBGA 3GXNA 2J7HA 3MU7A 3HJEA 3EMZA 1BG4A 4JHOA 1R34A 1JZ7A 3FAWA 4NZCA 3WH5A 1WPCA 1JYXA 2E40A 3PZQA 4JCLA 2QHAA 5DO8A 2AOSA 2WWCA 3BC9A 4OKDA 1UH4A 3WFLA 2V3FA 1CZ1A 3OLEA 4D6FA 1OD8A 2XIBA 3IJ9A 2IXVA 3AXHA 5AYIA 2BVYA 2C8NA 3W6MA 5BXSA 1E4MM 2FHCA 3VGEA 1NARA 1XV8A 1TVPA 1DWGM 1NOUA 1JXKA 3LMYA 5A6AA 4GO9A 1FH8A 3ZT5A 4AZHA 2ZXBA 3MV11 2XSAA 3NCOA 3RIKA 2GJRA 1ITCA 1SZNA 3NUKA 3CZLA 3BSHA 1X1NA 2UY3A 3AROA 5BYWA 4MB5A 1CWYA 2FGZA 2EO7A 5FCZA 4NXSA 4UZSA 1HJVA 5DMYA 1EIBA 2CYGA 3W24A 4UNIA 3CZ8A 4E8DA 5I0DA 1QOXA 4N0RA 5E0FA 4HOZA 4OOZA 2ZX6A 1VEOA 1GQIA 1K6AA 3PTMA 1GORA 2TAAA 2G3MA 1TVNA 3AS0A 3K4AA 3HU7A 1LL4A 3MMDA 3W27A 3WF3A 3T2QA 3SCTA 4OZOA 1FFQA 1UD6A 1HTYA 3SUTA 3CZEA 5A2AA 4FNTA 3AS3A 2A3CA 5CGMA 4TOQA 2JIEA 5LA2A 5IFPA 1W3LA 1BVZA 3DX2A 1ZBVA 2WMIA 2BY3A 1KQZA 4WKFA 3RO8A 3WD0A 2W91A 2C0HA 1VIWA 4HP5A 4JKKA 4AIUA 4QCEA 2XN2A 3WDRA 1CGXA 4DUVA 1EQCA 2CBJA 1TCMA 1UWRA 4CU7A 1C92A 8A3HA
chains in the Genus database with same CATH superfamily
2ASHA 3RWDB 1CO1A 1XIWD 2H3NA 1LF1A 3MA7B 3GDMA 4W5UA 5CINH 3BT0A 4HS3A 2FGLA 2WBWB 2QR6A 3BLOA 2LR4A 3NIFF 1UXMA 4JRXD 1LL6A 4YN3A 4JFSA 4C65A 2UVEA 4LAKA 2VDKB 4KY1H 1VHNA 3T0EE 1E51A 1E4KA 4QY8A 4B96A 3VGDA 3NZUA 4K7FA 1YTDA 4FNLH 5JPMA 1VZGA 3GBDA 3H6AA 4GP4B 1UKPA 5C0CA 2OMXA 4DEFA 4ZB0A 5SWZE 2X0SA 1EWDA 4RFOH 4CNPA 3B2VL 4M3KB 3RP1A 4PV9A 2WZAA 1Z3GL 5BNXD 3PTDA 4H26B 4CC1A 1Y8BA 2WZTA 3UZWA 3FQUA 4GPVA 1NUDA 3P73A 5EBMA 1LQ2A 3MWCA 3DERA 3MZTA 5F3BB 1FL5B 4WO4D 2A6LA 4GS7B 3QM3A 2C9AA 4UYQA 4AIXA 4RE2A 1UD8A 5KN5B 1GKPA 3TMLA 1X38A 3X3GL 2DZBA 2E47A 2LTQB 3EFFB 4A7UA 3NOYA 4BQ2A 1X7SA 2PYFB 4HUNB 3O3DA 1RUML 5C0AE 2ACSA 1MAML 2X89D 3MLYL 2P52A 1MDTA 3JWNC 4PGCB 3I6GA 1O4UA 3SGEI 1M04A 2AJ3A 1KG0B 1K03A 3FFCE 4LCUB 3TC7A 3MXVH 3JWDC 1EEUA 4PBDA 4UNVA 3DFTA 5D96B 1FDLH 3NACL 2C9RA 3WMPA 1JV2B 1S78C 3CEUA 3ID7A 1JQXA 4U1HA 4K38A 4DPQA 1XGEA 3V6OE 3FRPG 1V27A 1I8JA 2W9DL 4GAJL 4WWNA 2AANA 4OCRH 1CDGA 1H8OA 3STZB 4CNOA 4KK9C 3BZDA 4WCJA 2PF6A 2FPTA 1JEZA 3LKQB 4X5XB 1E15A 1VR6A 3VFVB 3N4FA 4E36A 1C8YA 4UBPC 1I2PA 2V5KA 5KW9L 5JW4M 3ABXA 2RQ8A 3PDOB 4I4WB 2FB2A 1GTNA 5CZVH 2HFEB 3QUYC 2PUQT 2KX9A 3L95B 4XBJA 1I1XA 1E6NA 2G4EA 3TZFA 4Z42C 3NP3A 5F0JB 4B2DD 3CZGA 3Q9PA 2FQGA 3QZNA 1FHVA 3LQAC 3LV3A 5JO5B 3GLCA 3O0KA 1KMGA 3B3BA 3MV9D 3OTRA 2AQOA 3EOLA 1IBZA 1Y18B 2OL3A 3QJFB 3PV6A 1BYBA 4IMKC 4U3CA 4MKNA 2EVHA 1KM6A 2Z00A 4WFGE 3E1ZA 4G1MB 4QKXB 1OM9A 1I7RB 2R0WH 3DHUA 5TPWH 3BJTA 3FJTA 3RL1A 2V9QA 5BPPA 1KJ2B 4GKSB 3BTNA 3DG7A 3ICJA 5DJZB 1E2WA 4J1OA 4HIHA 3VOGA 1YEWA 1YDPA 1G1KA 5E0CA 4QDPA 5EGRA 1U4EA 3UADA 2X6VA 5HHME 4F15C 3W01A 4RFEB 3I65A 1MHCB 2QJDA 4I0PC 4BZ2A 4LGSB 2IBZX 4DTGL 2W62A 3WH5A 2OYLA 4M1CC 4XX1E 5AW9B 4AMXA 4Z2LA 1KOAA 1GVYA 3CVDA 4LQFH 4OLVH 4Z9KB 3AISA 1MFCH 3B0UX 1YEFL 4CNUA 4R8WH 1OCZB 4LCYA 4ERGA 2XX0A 2J7BA 1AMYA 1WUNT 1YNKL 2O5XL 4A63A 1BWMA 4GMSL 5FJTA 3MRNB 1I8AA 4KKAC 4K1WA 3OU8A 3W76A 1Y1DA 4LPCA 4KX9A 1FE8L 1LO4H 5ALCL 4JMNA 3E02A 4W8BA 2A9AA 1NC2B 3BLPX 5DJ8A 1XGRB 3HZMB 3Q13A 5I6PA 5JOPD 2H2SD 5FFLA 3B3IA 2PDGA 3EWBX 4GKTA 1G94A 3BAYA 3STFA 1FRBA 1U91A 2PABA 4C5ZA 4B5VA 4MM1A 5FF7A 2BWQA 2IAMB 3M45A 3BLLA 3DGGA 3FXGA 1IFGA 5BO1L 2NWSA 1BD2A 4ODBD 2CHDA 1JZJA 2L3BA 3A67H 2PCXA 4X0KA 4D6JA 4AQLA 1TRIA 5A8MA 1TEFA 3MMEA 2E7DA 3BISA 4MMYB 1ADOA 1TETL 2YPLE 3VI4A 3QNZB 4DZ5A 1FE8H 1S8DB 2DQIH 4H5SB 2NPLX 3RE0A 1UP0A 4N2YA 1F0LA 1OW0A 2D2OA 4GG6E 4DI8A 5EO1B 3QJTB 2V5CA 4XBEH 4P5SA 4MA3B 2NY1C 1F1GA 2A6IA 3REVA 1XQKA 2K9FB 2OZ4L 3QZOA 3SCPA 3SJVB 1NAMH 1XR9B 2BZDA 3BZ4B 2ZOLA 3RILA 4UT6A 1FCUA 1WZ1L 1Q5MA 5HJLA 4DSYA 3CPRA 2XKSA 1F4YH 1KENL 3C5JA 3BAXA 2FJGB 4OFYD 3OA5A 1MFMA 4Q6IB 3WXVH 3VYLA 5BMFH 2AJ3B 5JW4N 4ZFGL 3W88A 5DRZB 5C09E 4Y89A 1NIDA 3DX7B 1OZQA 3U30B 4IMCA 1GW1A 4O51A 1K8DA 2R6OA 4GQBA 1PCSA 2WKOA 3WBDA 1AS8A 4BINA 4IX2A 4JFEA 5JOPE 1OEPA 3W1AA 4NC1E 2PCPB 4P2RD 1SOXA 4XAWL 2F53A 2YD7A 3EXRA 3LXCA 3TH2T 3UBXA 1FP8A 1J5OL 4O1AA 2E75C 2C26A 4Q6JA 3VG9B 2KERA 2NY4C 1ZUAX 1UZ1A 5CKAA 4GQZA 2Y1YA 1H3WM 1DVFD 5DHVB 4WO4B 2E28A 3CIXA 3U2ZA 1IEAB 3HBLA 3NQGA 1HH9B 3BPLB 3SYPA 4F33A 1V3HA 5CPOA 5D1ZI 1JFHA 4WGVB 3VACA 1G7IB 4DO5A 3PY9A 1WZMA 1SBBA 5AAWC 5EFDA 2PW2A 1QI5A 3GVRA 3V4PA 1QSFB 3JWDH 4NHCL 1T6BX 3WE6A 2YAFA 5IGXH 1UWIA 3RBSA 2OL3B 1CG9A 4NQSA 5IW6B 4IHOB 3S34L 3W86A 4NUJB 4JHBA 5C5YA 4UT7H 3T77A 1PIFA 5CF3A 4Z76A 4UFIA 1BBJA 1NOLA 5A3IC 2IXUA 1C7SA 1Y0LB 3JYBA 2FTYA 3OGCB 1C5DA 1KTCA 2C1OB 1XFCA 3H2CA 3GUFA 1UP3A 3PPGA 4R7DA 1OZUA 2WWKO 3H53A 4L4VB 4ZTOH 4GLEA 3CAFA 2A85A 2FLMA 5IVOA 1ZLVH 1QMLA 5HP5A 1R75A 1Z5YD 4B2DA 1IQWH 4G70B 4L9ZA 4LP5A 5EORH 1OAQH 1MCDA 4JJ5A 4OSUH 3VCLA 4DP5X 2VL5A 3ZRCC 4D8ZA 4LESA 2IANB 2WW8A 2Z8RA 5GGVL 4ZO6A 4GY4A 4JZOA 4YDLC 1OFAA 3MBDA 3UG4A 4IFKB 3L2IA 5I0WA 1MQ8A 3NCYP 5TFSH 3HB9A 3QC0A 2W9EL 4A2DA 5MERB 5FSDC 3GQYA 1IEQA 5CMAB 1QT1A 2VEIA 4JL1A 2WHLA 2ZZUT 4ROQA 3ARUA 4G6AC 2Q7YA 1U33A 2D3VA 3GTHA 3HBZA 3IFLH 1OY3B 1EZUA 3TQVA 4KZEL 1L2UA 4R7VA 3PGDA 3KWWA 6REQB 1N64H 2VRAA 4M61B 1F45A 5EOTA 1ASOA 3H6OA 1HXMB 4DVBA 2MPAH 1KACB 3W26A 3IRZA 4D0CA 2WQRA 3PNWA 4Z0XA 1N55A 1NBVL 3RY4A 1G7MA 2CUHA 3EJZD 1GXEA 4AM0Q 4DAIA 5GS1B 3OVGA 4KK8D 5AZ2L 1CFTA 5BRZB 4ICMA 3PAYA 4YEFA 1JDFA 1A02N 4PRRA 2CXGA 3BMWA 3UMNA 4CCZA 1XUZA 3BG9A 2YAHA 4I3RL 4JPWL 3CVHL 1XXXA 3EWUA 5DVPA 4OV4A 3A6OA 2O7SA 3V0TA 4AZ6A 4FLRA 4JBSA 1S7QA 3HZ3A 3C56A 3TIEA 3BPOB 1O5XA 4N6RA 4AZCA 1XF4B 3K2MC 4H13C 1UKTA 5FF6B 1LQSR 1BJ8A 2X0UA 4NZFA 3WKPA 3FCPA 4GQGA 5DWUH 4QNEA 1DWHM 3L48A 2ZP9A 1DLFH 5SWSE 3VE0B 1AR2A 3QWRA 4QT5B 1NU5A 3KCWA 1UZHA 4AMWA 1MEWA 3DI1A 1ZTXL 3M0XA 4MMXA 2IBZY 3FGCA 2BZCA 3AIBA 2GQAA 4P4KC 3FSTA 3KGTA 1ISWA 3VGAB 3HS0B 1K2DB 2A6DB 1GW9A 3D39D 5D2LB 1QG3A 2P88A 2EYTB 4PTUB 4JZJC 3EADA 4LZKA 1RD5A 3LIZA 3NZ1A 4I85A 4MD5B 2DEWX 3SFKA 4L1TA 1AACA 3QUMB 3NMEA 1LP6A 4K4KA 3AREA 1KBLA 3KWSA 1KIRB 3QH2A 3TVMC 3MKGA 1FN4B 1T4WA 3D52A 3EW3B 4JG9A 3RFZB 3WNOA 4XPBH 5EFFA 4P3CH 1CQYA 3QUYD 2WKGA 1BWVA 3K2UH 4WW2B 4ZFFB 2X6BA 3IRPX 1YEJL 4MD0A 1VEPA 3R0NA 1IRAY 3Q8CA 2EG7A 1NOAA 3KRUA 4N4QA 1GKQA 3WKML 4ABVA 4Y2OB 2WVUA 1YDPB 1UOKA 2GY5A 3D87B 1DQWA 3L3KA 2BHFA 1YPXA 2NLIA 2PWVA 4UIOA 5F6IC 3W0WE 2J75A 4MSWB 5EMYA 4UDUB 4GI4A 3IJHB 1Q63A 2AABH 2X30A 3CHFA 1ZLWK 2ITCB 4KO9A 3UJJH 3VI4F 3WEOA 4YSEA 1SU5A 3HC3L 2AL1A 2FMNA 1LDPL 1M65A 2G9HB 3LKRA 4D0DB 1UGNA 1CE6A 5DFWH 4Y0GA 5F1NA 5BRZD 2NNAA 5GGQH 3N3MA 1AD9B 2BSTB 3L16A 3I9AA 3FRUA 3QDGD 3CUZA 4LEFA 1QVBA 4W70A 2DFAA 4MMWA 4P2QE 4F7PB 4F8TA 3BJFA 4B5EA 4PJDE 3EGJA 4NDMA 2B1HL 1H11A 4FO4A 1IT0A 1S9WA 4PJAE 4F8OA 4PFMA 2YOCA 3MHFA 2FDBP 1VYRA 4NOBA 3CIWA 1V5JA 2A9NL 4X99B 3VQMA 5B8CC 1HCVA 1JTTA 5CJQL 4DKEL 2XC8A 1AGBB 1K4DB 1T66D 3PGDB 2VGFA 4O11A 4BQ5A 1W72A 5A2LH 3PAJA 4YXLH 3LXUX 1NMAH 5ADOH 4FX8A 5BCAA 2GY7B 3PQYE 5HDWA 3BLKA 4F2MB 2QJJA 3SCWA 3DO3A 4XGZA 4MNMA 4P2VA 4M7LH 3QUMA 4D2JA 4Z1AA 2D7TH 3C5SA 4EZMA 1F2JA 3NZQA 1OB1A 3U6XS 1C16A 1RA0A 3RRAA 1W31A 4UR8A 4EZKA 1QO3A 1DBTA 3DUSA 3IUDA 1FG2A 3WKZA 1WFTA 5GZOA 1QFWI 5JNYB 1UTDA 4R9XA 3FO2B 5H4ZA 4UIMA 1R5YA 3LLDA 1OAXH 2DJXA 1XQ4A 4DW2H 1G7VA 2E5DA 1YEDA 3EAKA 5KZCB 4L4PA 3UNDA 3W7EA 3O2DH 1AP2B 1M7DA 4A6YH 3FH5A 2GYIA 2ZVRA 3HNVH 1PZAA 4LANA 2X4TB 1EEYA 1US0A 3QI9A 4Y2OA 4A3YA 1YZZA 4MJID 1QNQA 4JY8A 2YA0A 2IANE 2E27L 2XZCL 5J8OA 3OVUB 3W5NA 2QUUA 4LUYA 3FB5A 5GZNC 2DL9A 3T1WA 5FW8A 1K8YA 1H15A 2V2HA 3GG7A 2QPFA 5IR1A 4GSUA 1P5UA 2BP0B 2Z8WC 4BZ1L 5FB8B 1JRCA 1TSIA 5K9CA 1U95A 2APBA 2EDRA 1RQ5A 3U9IA 2HT2C 3W2UA 3CHRA 4RGNE 3WN6A 5E5UB 4OV9A 3GU9A 4MHHI 2CM5A 5E2VL 2QF8A 3W6YA 2X1IA 4P2RB 4HLJA 2JTYA 3DYMA 2VENA 4AJYV 2XTJD 5JYLA 1KCLA 1MW3A 3PABB 5J6GB 1ZL1A 3NAVA 3N34A 4GQ9H 1RIHL 2WPBA 3GM8A 1UYWL 2K4AA 2HK1A 2WZEA 4A6YL 1W3HA 3GNNA 4H1LA 5AW7B 5HGAB 3L6FB 2VOTA 1A9BB 1FZKA 3CSPA 4G5AA 4NPJA 4UWQB 2PTYA 5I1JL 3OAUH 3MUHL 4G11A 1MCCA 4OT1H 2BTMA 1JCVA 4LHJB 3S6OA 1J1PH 2EBNA 1LGVA 3M0IA 4EXPX 1HGYA 2E9IA 1FCCA 1H49A 1F5WA 1XMWA 4EI5D 3PJLA 2GK2A 4H2CA 3IJDA 3QKZA 4F0KA 1AKJD 5BWFA 3X11A 3T0DA 3CEPA 4RZCA 4AG4L 3VAEA 5EOQH 3HG0A 4M6QA 4WUIA 2CO3A 4BR1A 3LCGA 4MA7H 3VOFA 4MMZB 2VFIA 4PJ5A 4Y90A 3CFBB 4ZTEA 4PWKA 1NF0A 5CJQH 5EO9A 5AZUA 4DKEH 5E4EC 2HISA 2OEMA 1HU8A 1MCOH 1U8NB 1SLUA 3P30H 3TJEL 4AENA 1S5WA 2DVXA 4JREC 2AZAA 5FGBA 4YR6A 2IKJA 4TUJA 3U8GA 2FH8A 4HA1A 5EH1A 4K8RH 3N15A 4PH6A 3B7SA 1PW3A 3VI3F 1DWAM 4BFAA 1ET5A 2YR1A 4NOFA 5C8JB 1BZ9B 4HU8A 5B39A 1XD0A 2OLSA 2BNUA 1JTOA 1IV8A 4IBSA 1JHLL 2YD4A 5EOTB 5FGSA 3RAJL 1OE2A 2R94A 4Q33A 2P5ED 5E6IB 2YMOA 1SEQH 2BMKA 1IIGA 3W39A 1F3XA 3FX4A 2BP0A 1G9HA 1S9VA 2X1OA 1PDYA 1PY9A 2BIMA 2BNQE 3GEFA 1IKNA 3SPVB 1KFKA 3UA3A 3UYIA 2JI1A 3VXRB 5KJRH 3QXUA 5K59F 3AWOA 4ZMQA 3EJZC 3MSGA 4NU7A 4B3ZA 4CN6A 1JK8B 3I6EA 3A4FA 4R7NA 3MSYA 4M51A 4LLYA 3VUAA 3QO0A 2XFWA 1J9CT 2IALA 3LEYH 4OU3A 2HLAB 1QNIA 3KPMA 4NM8H 3RX5A 3AZRA 3SQMA 4MD0B 4Y8FA 4FF7A 1XXDC 2IPKB 3NJIA 1N6VA 2Q09A 3QOMA 5BVPH 3OBKA 4MFDA 3PUUA 4Z7QF 3ELQA 3GSNL 3UJEA 1KCRL 2ESVD 4PUBH 3IMWA 4U1KA 3M7WA 3SUSA 1EL3A 1E27B 3ZVHA 3CGTA 3ULVD 2R29H 5ADPH 5A6TC 2ZUQB 4KK5C 4UDUA 1XS2A 4GO8A 5FUOL 1H7PA 4GXFA 4MXVF 4H88H 4CNIB 3W6LA 1X5LA 3UXKA 2CBTA 3CU7A 1K2DA 2A6DA 1F4XH 3FQ1A 4PW9A 5CEZH 1XDLA 3NCJL 5DQJA 2FHBA 3G6AB 2AXWA 4YUEL 4W4QA 3LS5H 3J27A 3HS8A 1K8XA 3LBMA 3DRQB 4OY9A 1MF2L 2E6QA 1P5UB 2AAMA 2DVTA 3FY1A 4ZB5A 4F80A 2YD5A 5F7YC 4XH2A 2Z4TA 4O17A 4DN1A 3RLVA 2Y88A 1KR1A 5BZDB 1XGUB 1OCBA 3EKGA 4BFRA 4BK4A 3JUGA 3MYPA 3R2GA 4PTVA 2B9BA 3QR1A 3IV8A 1M7IA 1FPTL 5C6TH 1RD6A 3V6ZA 3O45B 3C6SB 2CLZA 4Z1BA 3VWJC 1O12A 1OT1A 2FLIA 2WSDA 4Y2DC 2ITFA 3IEAA 3PGFL 4U1MB 5JORA 3P14A 1E6OH 3EHBB 3S4SG 3FFDA 5GS1C 3LLXA 3GXMA 4BZ1H 5C70A 1ULVA 5I17A 4DUXA 3F6IA 1JVNA 4ENEC 4D6CA 3RGBA 1UR4A 4C54A 3NJVA 2QADC 5I1CH 3WLOA 2A99A 3B37A 4XMKH 3S5LG 1UFUA 5CEXB 1BRLA 1V55B 1E71M 3QW3A 2EXWD 2H26A 2OQHA 4FF5A 1HC1A 1KF9B 2AJVH 1W1VA 1BZQK 4LVEA 3DC0A 1Q0XL 1ZLSL 5CSBA 1T20B 1IXQA 1UC5A 4PP1D 3RHWF 3CWOX 4TOYL 3PHAA 5DT1L 3MUJA 4PP2B 3GTNA 3U4KA 4CL7A 1RHHA 2VX6A 1UWEH 1S7TB 3TBSA 1BYDA 2EG8A 4I5UA 2R56L 4JTDA 1QRQA 4GHRA 5D4YA 4CKQA 4MLRA 3C52A 1GS6X 1HKLL 1TQCC 3NSYA 1E9OB 4QTGA 4RGNB 1VFMA 2G96A 1HXYA 1AG0A 2CBMA 2F53E 3QJHA 4G7VL 3U4BL 4HQVA 3QI9B 2A4CA 2Q6WA 3T44A 1EEXA 2B2XH 1LDSA 3QK0A 1KD0A 4HWZA 4C6CA 2PDQA 4JFFE 4JTGA 4LSUH 2X4QB 1Z9AA 3T0CA 4HPOH 5D30A 1JGIA 3FQXA 5JHDA 2WBGA 1H8LA 3CUXA 3R0UA 5DRCA 2AQQA 2VDLB 3HS0A 3WFCL 4FQXD 3EX4A 4LBRA 3MCOA 5F1KC 5LBGA 1RMFL 4BDVA 2DQGL 1KIQB 2DIAA 3RBGA 3QLDA 3DJRA 4ADTA 1XJBA 5AFDA 5EORL 4PWJA 1GH7A 4DZ8B 4TVSa 2F53D 4BQ3A 1IKFH 1MG3C 3VCNA 4AC7C 1BG9A 4JFED 4WK0B 5T33L 2ZXWB 3MA7A 4Y4HC 4G1KA 4C1NB 2DLHA 1SJVA 3WD5H 4FABH 5A8NA 2B1HH 4PLKC 1JCYA 3V4PB 3IGUA 1O1ZA 4AFYA 1J6OA 1TV2A 4PJ7F 3O8XB 3W9DA 4IHOA 4O9HL 3MROA 4H8WC 1U8JB 1JVKA 1UT2A 5I1EL 1TZGH 3N6QA 3OXSA 4ODWA 4XPAL 4XCEA 4W9HC 3QV6A 3IGLA 3WLBB 3WL1A 4WI5A 4G9PA 3BZ5A 1KB9K 1P7BA 4RMWA 3FT4A 3LTVA 2ZAGA 2XRAL 1NOFA 2HSAA 4LCSA 1AXTL 1TQBC 4FFYH 1TJGH 4G43B 4JHMA 1UT9A 4IW4C 1G1YA 2ZWZA 4FKEA 4KJWC 3ZZ1A 1T0NB 2E9LA 2FYMA 4JFXB 4I5BB 3GIPA 5LDSA 3D0VB 5I6SA 2W60B 4Z7UB 4ZZFA 4MUZA 4J6RH 3KM8A 3K72A 4BXSV 2EZ0D 4NGHL 2P1YA 1O6SB 3B4NA 3OG2A 1AA1B 3TDFA 1T80A 3NFSH 3ALPA 3PB0A 3TH4T 2H8PA 1REQA 4NX0A 3SURA 1NJ9A 2ZVIA 4WJ5B 1MH5A 4N0CC 5FA3B 4AQZA 1W80A 2QSCL 3E74A 3QSRA 4MAYB 3PR2A 5FUCC 4LYKA 3AW5A 4CD7A 1P5VA 1CD1A 3HFYA 5AYBA 2Q6WB 1THFD 3WIAA 4UTFA 3L3DA 3ALGA 2AMGA 4WUUB 1VCBC 4W9FC 5E6RB 5F7BA 3VUPA 3MLUL 3W0WB 4QHNB 5IB1A 1U8CB 2EYSA 4ZW8A 3F2LA 5IVXB 2F84A 2OQYA 1UBSA 3SKNB 3O3BA 3QEQA 1EJXC 3TF4A 4G6JH 1UWUA 3CJJA 4R7XA 5CIPH 3DNKA 3SDYH 2VDMB 3O2LA 3ARGC 3PSVA 3QQ0A 1N4XL 1FO0H 2E9MA 4YDJB 3M41A 1IGCL 3J7HA 1WA3A 4M0XA 3RO6A 3D2UD 4N2CA 4DERA 4AY8A 3FB7A 4QG9A 1G01A 3VKAA 1BREA 2VZSA 3WO4B 5C86A 1TCRB 2D0HA 5GGTA 3W1PA 2OMUB 5ICXB 4BH7A 4KDTA 3VG0H 1WITA 3DZ1A 1SJBA 3T3MF 4W84A 1G9MC 3CBKB 3FQNB 4YZFE 3X14A 1KPVA 1TKKA 5EMKA 1JRHH 1TR9A 4UQ9A 1NUNB 3KBPA 5TGBB 2VEKA 3RXZA 2C1PB 2YJLA 4K2UH 1PYWB 5FHAH 3LQZB 3KVMA 4LVDA 3V7AE 3CH1B 5E08L 2KZ1B 4L3CA 2NZ9D 4PB9H 1LO4L 2XH2A 4NYLA 3DJ9A 3S1XA 1RCQA 4D1JA 4G43A 1KO0A 3KYKH 3UZVB 4F15B 2DY2A 4CD4A 5C0CE 2VFFA 3VXMB 1SHWA 3OZOA 5GGRY 3X3FH 3T0EA 2NMSA 4PN6A 5D03A 5SX5H 3TU9A 2PP7A 2A7RA 1B9ZA 1Y65A 1L9NA 5I1AA 4HUKB 3PHOA 4TTDD 5I2IA 2Y7NA 2J8GA 1QTWA 1BLNB 4DTGH 1LK2A 3DX8A 4JTIA 1I2OA 1JDCA 2WPGA 4UXDA 1PTDA 2C91A 4Y9AA 3ARWA 3QUZB 4R2GC 3EJTA 3VC6A 4FIRA 2ZYFA 3T9PA 5DYOB 2NXHA 5LIXX 3BVUA 4MX7A 3E6HA 5TPWL 1YUHB 5LZLA 4U1MA 3RA7H 2IPKA 4M7ZB 4LASL 2CNCA 3K30A 2BSSA 3VDAA 5AAPA 1LUCB 4H7CA 1M6OA 4TUFA 4AVHA 1VBRA 2X89A 4PCKA 3JVAA 4RH4A 1YNPA 2GJ6B 3F2DA 2OR7A 4ZUWB 3FT4B 4X6FB 3PP4H 4ZSOB 3GBNL 5AW4B 2FX7L 4O02H 3MCLH 3I74A 3TC3A 3W9EB 3K4DA 4FNPA 1B4LA 4JKNA 4EI5B 1CFNB 4OLUL 2BX5A 2VLRB 1BVKB 3LHTA 3TCSA 1HAWA 2YCLA 3QXAA 4LNRA 4DN4H 2WUBH 2ZWKA 2XKNB 3SDAB 3MJ9L 3T0XA 5CJ5A 4QY8B 4ENED 5IB5B 4OU1A 3C2VA 4YHZH 2W0KA 5EC1A 3U0PA 3F7QA 2GZXA 2F5AL 2CBVA 2HVNA 1AGFB 1ZV9A 2XFFA 3O3EA 4OZ4B 5LNVA 1KCUL 2JJTA 5FYLE 4CADB 3UZ5A 4M4RB 4N1CA 4MXWL 3PZ9A 5HGHA 2GSIB 4Z18A 4OZIA 3PWGA 2EDEA 1NFIA 5HGGS 3MRKB 3IUHA 3MCLL 4DJDA 4KU1A 4MLIA 1RQEA 2OX5B 5HI4D 5LQBL 2R69A 3UC0L 1RJLB 3EO1B 5I30H 1F3JA 2OMTA 3D4YA 3NQMA 1UH3A 3QIUC 5CC5A 1D5IH 4W9KC 5D7IE 4M6NH 3AS1A 3C8DA 4P46B 4FAAB 1Q72L 1POKA 1Z48A 4AUYA 5I8EA 3HLAA 3OSKA 1PSCA 3WFCH 2YAQA 1F8TH 2MCG1 3VWJB 4NT6A 1OF8A 2V69A 3O6ML 3LBCA 2Q01A 2A38A 2CUMA 3JV4B 5TH2B 2B8OT 4KUCF 3QC3A 1JGLL 1GJUA 1P1VA 5D70L 5CLWA 1W0WA 3L4YA 4MCNA 3U4BH 3I6LD 2DBLL 2CO7B 2DT2A 5BW6A 1ZNNA 4CUCA 2NY5H 4O8AA 4GK8A 3P74A 5AHLA 5HDQL 3IIOA 1IC1A 4FTVD 3VDBA 4U10A 3GSRB 3W7QA 5E00B 2J44A 3SSGA 4OTKA 4HJWA 2CKNA 5EN2A 4A55A 4PTNA 4M5TA 5AC7A 4MXWH 2HFEA 4A2MA 1MI3A 2HTKC 5IESL 4LL9A 2CWRA 2B3RA 2E3VA 2XICA 4B6ZA 3GR7A 4GXVL 1DN0A 3NFNA 2PPCA 5J11C 2W65A 1SFJA 3RDTA 3APDA 1CDUA 3BGFC 4LBEB 1QBML 4K8HA 2OM5A 1DE6A 2XV0A 3TLRA 4HPXA 4OFCA 1M56B 1EEZA 3MS8A 2UWEF 2CGZA 4YYFA 3ZR4A 4HKBA 1NCAH 1Z3RA 2AV1B 4RV8A 1LILA 3G6JA 1ZRQA 3T78A 3JTSA 5G2NA 2V4LA 1FL6A 1A8ZA 2PTUA 1YG9A 5F9WB 1H7RA 5CHNB 3GW3A 1PX8A 1XYFA 3F7VB 2OYPA 3CNKA 5L2JB 1CD0A 1BF2A 1FCVA 4E9TA 1T5AA 3SPGA 3S35X 1INEH 2ZG3A 2B1OA 4L1BA 4WK2B 1CLOL 1YRKA 4G6KH 4K3JL 4KJYA 4YO0A 1EGVA 4GLRI 1ZXKA 4PJGA 5TE6L 2ACUA 3V3WA 3RLSA 3SIMA 2Z91B 1QDSA 3GVWA 4L6DA 2BS71 4PBVC 1UQZA 1FCGA 1IBDA 2Z34A 1YW1A 3T3PE 4HIQA 3V5KA 3FFDB 4PGZA 2CXEA 4GZEA 3NIDF 1HFUA 4PGDA 1CGVA 1D5BB 4OJCA 1WRFA 1M57B 3IJ7A 3NPSB 4UQAA 1ACZA 3WX7A 1MRQA 5CCHE 1Q94A 4AQOA 5CEZL 2AGTA 5KBPA 3DPBA 4OQTA 1D5XA 1F4AA 1FWBC 3ZKXC 3S2NA 3ABZA 2DT1A 1Q9OA 2G8ZA 1R5VA 3MV7B 2REQB 5HDOA 4W9ZA 4Y96A 5J1SC 1JSYA 4UTTC 3ARFD 1ZHNB 2B77A 3GGWA 3P1VA 2GFBB 3QDMD 5LGJB 3ULVC 3TA6A 3HAEG 3SYCA 4GUHA 1NUGA 4AWTA 3ZDZE 4AWEA 3B0YA 4FKKA 1ZTMA 1N7MH 3U7YL 5B7FA 4MZYA 2PW1B 2MQ3A 4AQAA 1GGBL 1NFDE 3PPEA 2KI6A 1BQKA 2EKSB 1R1CA 1Y5XA 1ZJAA 4NO0D 3VQLA 5CZVL 1ZVYA 4M1BA 1LK3H 2BY1A 4Y1TA 3TN0D 1EQPA 1X7IA 5CPTA 3GWJA 1OIMA 3PBUA 8XIMA 2BY2A 4Q7NA 3SPIA 1VDGA 4JO2L 5FDWB 2CHNA 4DWDA 4DJEC 3ZU8A 1ZIBA 2FCBA 2WQWA 3QA3B 3VXNA 2J8HA 3EBVA 3PS7A 1NM4A 5HI5C 1BBDL 5LCVA 4I18B 4N6QA 2OU4A 1TV5A 1HL8A 4O9HH 2VN6A 3ZZQA 1NDVA 3U6WA 3LPPA 3HUJA 4XPHL 1NGZA 1M7IB 3WFDH 5IIEB 3KWVA 1H5VA 1A49A 1MNZA 3BP4B 3QQ3A 3SODB 3LMJH 4HIJA 6CGTA 3FA5A 5CZJA 2DKSA 3S48A 5CCKH 3B1UA 3RIFF 2GL5A 1VJIA 2R23B 4FQ1L 5EN3A 2PC8A 4QOKE 1K6QH 4M3PA 3KPOA 4C6QA 1OG6A 5GGVY 2OXHB 4JZJA 3K6NA 4EAYA 1K7EA 1K6WA 2R7EB 1XIMA 4AZ5A 1AFSA 5IBLD 1VCGA 3E6EA 4JO3H 2OQLA 3MO1A 4H7VA 2QHRH 4WIWA 5I8CB 3BUBA 3RR4A 1QWUA 4ORGB 1OPOA 1TPH1 3QISA 2Z4GA 4AGLA 1L9MA 1FIGL 2R51A 4OF7A 1BYOA 4RDQF 5D7EA 4YXKH 3KGUA 3UXDA 4L4TA 3G3DA 5HHOB 3B40A 3BD3A 2VR4A 3KOFA 1V0NA 2Q8XA 5HPCA 3A5FA 1XD1A 3EYFB 2K3TA 2CERA 4FLHA 5B1CA 4N86A 4JMXA 4BIKA 2WTRB 2WANA 3KLSA 4FQLL 5JIIA 3PFRA 4KEMA 1MSSA 4M9PA 4NRZB 1EANA 3D69B 3GBLA 2N0MA 4P0DA 5J56B 2JKSA 4F0LA 2DKUA 3BH8B 4U1GB 5D4JA 3EWWA 3EGDA 3U9UA 4F2UA 1B0IA 4XCNA 5I73C 3AG3B 2Y6TE 3F4WA 3GRIA 4G7RB 4W7WA 4U7KA 2OMVB 3QUXB 2IQAB 3QRGL 1KA9F 4KFNA 5E1IA 3H2PA 3TBBA 3AYTA 4O1BA 1E28A 5EPDA 1GZQA 3MI2A 4NQCE 1JZ2A 1QHOA 1PXGA 1FFOA 5I73B 1PKQA 3O6FD 4W93A 1TZ7A 4QNWA 5ABZA 3PWAA 1A3RL 1MVUA 4RA0C 3PM6A 3SIZA 3PZGA 1KY7A 4UTBH 4XXCC 4XRCA 1KEML 3V4VA 3QYMA 4DO6A 3DXAE 1T04A 1I1RA 4FNQA 4K9EC 4BQ9A 3HHMA 2Z24A 3S8FB 2NX1A 2Z9TA 2FB4L 3SDCB 2AK4B 4ZMZA 5IMMB 5F7FA 1UM5L 4HEME 1BQGA 3DUSB 3WTWA 1INQB 1SFDA 2BDNH 3MLWL 4M5ZH 1U5VA 3W87A 2V8ZA 1UR3M 1U2YA 3WLSA 3QUXC 2P53A 1LT8A 3UTZB 2Z7UA 3VXUA 4PUUA 1NLDL 1XB3A 1PYFA 1NCOA 1DUYB 2OS7A 4GWEA 4Z0JA 1R38A 3BO8B 3GMRB 4L9DA 2FSEB 1YDVA 2K6YA 3T07A 3TH6A 4IOFC 4WFFE 4JFOA 4U6YB 3DVNB 4MAUH 5EKYA 3ZMEA 3NQ7A 3V5OA 2N0KA 4HS6B 5CSZB 1T5WB 1KFAH 4APXB 4GVHA 4OTXL 1XGYL 1N7KA 2AI0H 4PHXA 4AGQA 4R97C 4YXLL 1D3GA 2WSRA 2BLEA 4X9YA 4MWAA 3HHSA 2BP8B 3EDKA 3MBWA 3NCEB 4ZI8A 3LZOA 3ETBF 4FYRA 5DRXB 5E9DA 3AABA 3BARA 5CPSA 4EUPA 5K9OB 4LS1A 3H7BB 3QRLA 4YS4A 3MRDB 4NM8L 3ARBA 3IDGB 4LEXL 2QDHA 2CDEA 3GMPA 3TEXA 2IV8A 1MCPH 4FFTA 4MFHA 4BA0A 3AB0B 4LPXA 1EVUA 4N22A 1YVLA 5DJ0A 2XV3A 2XFGB 4S11A 2NQZA 4C6LA 4ES9A 2E5EA 5CBAA 1WXJA 3N12A 2RCSL 2XA3A 1TLKA 3NQFA 1H5BB 3W81A 3NPZB 1XDJA 5C9JA 5HINA 5LIYX 1BVNT 1UM4L 3BLDA 5CEYA 2DQDH 3P61A 4UTJA 3VKKA 1FNEA 4Q4OA 3VX0A 5IY5B 2R2HA 3QDGB 1O7DE 3NBNA 2PDPA 2R0ZL 3O9WC 2PC4A 5HMEA 3I75B 1F13A 4F33B 2NTFA 3WJZA 3P4MA 2AABL 3QGVA 2ZCKL 5CN3A 1V0LA 5BV7C 4G5DA 3G8EA 3IDIB 1QNOA 1A5MC 3FO2A 1ZLDA 1G4SA 3I02B 3I7RA 3DBXA 3PUOA 5K9QG 4YPGA 3LEPA 1M5WA 5DCEA 1SJMA 3MX0B 2RACA 2UZYB 3NCWA 1GONA 1OL0A 3Q2VA 3OHXC 4L4VA 1M3JA 4WWOA 3OKNA 2ZWYA 3CFCL 4U0RB 1OCQA 1R3LA 3T3ME 2GBAA 4Z6AT 3LK6A 2CDGA 1LOSA 2H6OA 5DC4B 2EGZA 1PQZA 3Q6GL 1X96A 5EUOE 5IBXA 2X0HA 4XAKD 5DJ2A 4LLMB 2DL2A 4PJAB 1O7SA 4TLKA 2PGRA 4DJFA 2ESVE 4G8FA 2VM9A 3NH7H 3WKNA 5DWPA 4PTDA 5JMUA 1N12A 3G6JF 4PODA 2AMXA 3PFQA 2Q20A 3C3NA 3GW0A 3I10A 3T7VA 1ORSB 2D0GA 2VZ3A 1SXBA 2I5YL 3UTTA 4CQDA 3DRQA 1XSOA 2XQBL 3VFUB 5K69A 3OMIB 3EFDL 5ITFA 2NLJB 3PULA 4W9JC 5GSVB 4LDLB 1JYNA 3TGXA 1HH9A 4EN3D 1SVZA 2V68A 1TLMA 5FCUH 5JXAH 3HPXA 4G56A 3IAGC 1P7TA 2G95A 3N06B 3F7VA 2V5SA 4B3KA 2NQJA 5A2JH 1UM5H 4PULA 1J9SA 4L7ZA 4OLXH 5DMKA 3ULVH 2MRYA 3Q6FA 5C08A 2A2IA 3VMNA 3NPSC 3BP7A 3W73A 2J1WA 2FFIA 2X1WL 2ZICA 3C09B 5F72S 2TMDA 2RGMA 2H1XA 2O72A 3OV6A 4ORZC 4P5MB 4F3FA 1JPKA 1XLHA 1DVFC 1N0XH 2Z6IA 4BCEA 1REIA 1CXEA 3BAWA 4YHOH 2D7MA 1YJDL 4FLOA 1EZSA 4I0KA 4LRSA 4QRQB 3QGKC 2WWMD 1SHSA 2OWWA 1ZT1A 2XN9D 3R0DA 3THMH 1E6JL 4EPSA 2D2CC 4N8VB 4AL8H 3QULA 1IO4C 4LVHB 2CKSA 1CLZH 3QH3A 1HNYA 4O57A 4BF7A 2ICCA 3I4EA 1TVLA 1JXJA 2A73A 2QQNH 3PJXA 4K5MA 2XN9A 3MKVA 5JXEC 2ZZ7A 3MNWA 3UERA 2W79A 4NAQA 4WJKB 3WTSA 2PTZA 5FF3A 4JQ3A 4TN9A 1P4BH 5I6OA 2PCYA 3B2UC 1FNGB 3CXFA 3KWXA 4IMKA 2AC0A 2WMIB 4I7UA 5IB4B 2UWEB 3ZXWA 1NL0H 2Y07H 4GFXA 1ONQA 4HGMA 4P2OC 5HD8D 4MY8A 3RHGA 1EV2E 1D5MB 1QLFA 4MAUL 4M8RA 4UI2A 1YN7B 1SO6A 1OCCB 2DLFL 1S9WB 3EKCA 4HJ0C 4JL2A 3EPNA 1DSWA 2OB3A 3GMMA 4KY2A 4QGTA 2VUNA 4YSOA 7ODCA 2NUPA 4C56D 4L1GA 3N0AA 5AC8A 1OHQA 3AM8A 3G6LA 1PSKL 3TFCA 2JQAA 3A47A 3LBOA 5KYXB 1GYLA 4RXGA 3NQAA 1MY5A 3KH4A 3ETBJ 4ODTL 3F2CA 2ZJSL 1C8PA 1D7DA 4NQDB 3WK0A 2DY3A 2CNYA 3F00A 2PEVA 4NQTA 1V3LA 3UWEA 1YBQB 4DUWA 2QGCA 3QAZB 4Z7VF 2A9NH 4NKQB 2IMNA 3IWUA 3K8LA 3W3BA 4DWHA 2OSYA 4KPHL 2E25A 1MCRA 1IJNA 3BL3A 3QO0B 5M03A 1XBYA 3CC1A 3QYQA 3XISA 1EDHA 2L7EA 5A8OA 2GKIA 1ZP3A 1OAYL 2DWEA 4L4VD 5HTSA 3VO0A 1ONEA 4XP4H 2AVFA 3CFIC 4XPHH 2GITB 3TIDB 3RFAA 2D2HA 2YHGA 1L5GA 2HT3C 1TPB1 3VRLF 2QAPA 3MLPA 2EECA 3GRBA 2ZOOA 5DO2C 4PJBE 1CLCA 3MFGB 3I3EA 3DSNA 3CV1A 4GNJA 1DVUA 3SGKC 5CD5C 1QRKA 3K2GA 3NO5A 4D6GA 4JDTH 1ZZMA 1FLRL 2IOMA 2BIQA 3QFJE 5CFHA 4R34A 3VNJA 5BS0E 3I9IA 4IOSA 5GGUB 2NCEA 3KVLA 2WWKT 5DD3L 1IE7C 2IGLA 4NN7C 4MNQE 5CZ0A 1RA5A 5JPMC 4G59C 4S3JA 4Q8VA 5CNHA 4GQPH 4V27A 2DJSA 3PBYA 3RMEA 5CG0A 2WXKA 1JNJA 4X7EC 2ICWI 1CCWB 1JGVH 3SQSA 1U8NA 1ZJHA 1R3JA 3LHWA 3OVQA 4O2EA 2ODOA 4WJXA 1X44A 3U1SH 3JVGC 3V8CA 1SEBB 1A4BA 1MW2A 2WO2B 1E55A 2GOUA 4KJYB 3GKWH 4BCYA 1KM0A 2PLKA 4J1UB 3VIIA 3S96A 2XETA 5LNWA 3DMMA 5IXEA 2WXQA 4DPCX 3D1MC 4MIMA 3C2AL 3QR2A 5AW3B 3NL2A 3QSTA 3TYEA 4AKQA 2BSEA 1SJXA 4QRSB 4ZQNA 4IRZL 1HJUA 4MWFB 1HI6B 4PJHA 3RPKA 2ALRA 2PCPA 1E9IA 2ED7A 4AHPA 1BVNP 1CGSH 1QRNE 2VL4A 2WLJA 1JPFB 4PJIE 4W68A 1MI5B 1VQTA 4P5TB 1TEGA 3ITVA 4MMYA 1GZJA 4W7UA 3R10A 2WB7A 2DWDA 5T9CE 3NL6A 3SJVD 2FZBA 4PUWA 1PCXA 3M5XA 1A7RH 1PTZA 4FJZA 1TRDA 3RMJA 1YEGL 3ZJ8A 4PD4K 3BH9A 3G1YA 3KDNA 3L66A 3Q01A 3KWUA 1O1HA 4YHGA 2PFHA 4P2QB 4XN1A 1HP5A 2CKRA 2FJFB 1NIEA 2ZE0A 2WBJD 3MCKA 4JTLA 7FABL 4JN7A 3ZJ6A 2GLKA 1F97A 5AC4A 1GOWA 4PLJD 1NTDA 1S46A 1FUYA 1JK9A 1NCDH 3NSCA 5AVSB 1ZAIA 2J4GA 4HBCL 2OCZA 3I7QA 4MUPA 3H3KA 2P8BA 4Z2GA 3NG5A 4NO5A 5E8PA 4HJUA 1TE1A 4H2AA 3ULUD 3QUZD 4OUIA 5JQ9A 5CGTA 3PPSA 3VH8G 1CECA 2FHFA 4NB7A 4X7DC 2HG5B 4N1HB 2QCLA 1U2CA 2BXZA 2HAZA 3TZVA 4QSHA 2BOCA 1DJSA 4PYHA 1N4XH 3OIHA 5C09D 3VFVA 1A7NL 1U8CA 2EYSB 3E8UL 5E1QA 4AYID 2HVJA 4W9GC 3T0WA 4EN3B 1B30A 4E9XA 3D3VD 3K2UL 1BWKA 2HMCA 3APYA 5GIRA 1CDCA 3USZA 3SDXA 1KQYA 1RUPL 4IGBD 2OR8A 4XVDA 2XN0A 3UXAA 5C71A 4X4YB 1B54A 3AXXA 4LALA 5JBDA 2OMYB 1FYTE 4JG1L 3DX8B 1ID5I 3ZTCC 1QFEA 1T6MA 1V02E 5HWMA 3TCLB 4FOKA 3C6LD 5E8DH 4JTQA 2OWCA 3WF1A 3P9LA 4P23A 3GKWL 1JYWA 1GVEA 4F27A 3WHXA 1QHPA 1AD4A 4PI2A 1Q7QA 4PWHA 3RWFB 3DVGA 3MRGA 3ARXA 3H12A 4A21A 3MXWH 3ARRA 2IDQA 2A74B 2AJUH 1A22B 3EG9B 4JFFA 4MNQA 5GGVH 5HYQA 4LEQA 2WC3A 5AC5A 1MJ8L 3S2MA 4JANA 5DK2A 2WKLA 1RZPA 1FKWA 2FPVA 2Y0FA 3APTA 2WOYA 5C92A 4TSCH 3S3DB 3BAKA 3KHJA 3RWGA 5LGHH 1JVOA 4C4KT 2ZUYA 2JKWA 5ISZB 4UU9A 4JQVC 3S98A 5FECB 5I8KL 4H8VA 6ALDA 2J8UB 4JPKH 4DESA 1NDMB 4LCWB 2GJNA 2NR6A 1F3RB 2BS9A 2IBBA 4YBLB 3TL5A 3QFJD 3RL1B 5C7XL 1XBRA 3AIRA 3DFPA 1MH5B 3MCKB 3FFCA 5FA3A 4QXIA 1ZLPA 1MI5E 4CDHA 1NC2A 5I1EH 3B8DA 4Q8NA 3UXFA 1E5CA 1PV8A 3NGBC 4WCYH 4A66A 1P53A 1C7TA 3CU1A 4N2GA 4HIIB 4UM9A 5B39B 2AS5M 5IESH 4IG2A 3H4FA 3WJJC 3S5OA 2VDMH 2YL5A 4E8CA 2GSIA 5CIPB 3I3DA 4MNHA 1TWSA 3ASNB 4X9GA 3Q2LA 2ED6A 1TX2A 4C6OA 1QLRA 3RJYA 3QEQB 3RWDA 2JI2A 1QVOA 4BDVB 2FDSA 3GC5A 3M0YA 5TDNB 1BQRA 4L65A 2X7WA 2XINA 2GI7A 3VFTB 4JIEA 3EH5B 4F9PA 1CZ8H 1MJ8H 2EQDA 4JY4A 3KPNA 3GSWB 2KUTA 4LL1A 5EA0H 1NQ6A 1QU4A 3H85A 3R12A 3UYCA 2INFA 3AITA 3CPUA 1DBBL 2H2PD 4K5PA 3FYEB 5F3HA 3TN0A 2J8OA 2W9EH 2VWSA 4XZLX 3DYOA 2VE6B 3HC4H 1EZVY 1R3YA 1F3DJ 2FNBA 5F1IA 3D0LB 1Z0MA 2VH5H 3QQXA 1HL2A 1OADA 1NIBA 2EUZA 2ATSA 1NICA 4CJ0A 1BD2B 2JSFA 1OAQL 1OGAE 2NUTA 4OLZH 3WGVB 2PCEA 1O7VA 3UEQA 3U0PB 3W53A 2ICWB 2DEPA 2Q7AA 2YJQA 3G1DA 3AIVA 1M71B 2VM4A 5CLZA 5IB2A 1E5YA 1OOWA 1D7FA 3O6LL 3WIJA 4MYXA 4WDIB 4N8VA 1A0QH 3H9SA 5GPRA 4Z5RA 1MCWW 3FKKA 1WBYA 2VDML 4WD0A 4JGMA 5J12B 5JHDB 3AMGA 3PZIA 1GZPB 2R14A 3T2OA 2VCAA 2IG2H 2QGBA 4B9JA 4PB9L 3NGJA 4Y4KA 2AJYL 2G2PA 2ZOLB 5D7JC 2AQ2A 1P4IH 4PS8A 1LEIB 1Q65A 3HTWA 4U4MA 4G80B 5I3GA 2VDLL 4P46A 2Y1VA 4DN4L 1PO9A 5E1AB 1AJ7H 2ZIDA 2F15A 5FFGA 3GUWA 4JM2A 1H0DB 5KBKA 3FDGA 4U1HB 3DFOA 3EZ8A 1HL9A 2X1XR 1MCKA 5IFHH 2XWBA 4NQDE 1HWGB 3IE9A 5DYOA 3MRPB 4JGNA 4ZCWA 5CJ8A 3FU5A 5E8EA 4ZSUA 1DXIA 1S7RA 4XO3A 2PRLA 3TR2A 3RM9A 4JFTA 4KFMA 5D9MA 1J48A 1JV5A 2FE0A 4JDVA 3U7WH 1BF8A 5GS1A 1EC9A 3NQDA 2CKBA 4OJYA 2K7QA 3C5XA 3P73B 4N9DA 1QMUA 1H7NA 3MC0A 4L3EE 4OIFA 5D71L 3PUGA 5HVWA 4QP0A 3WN5A 4XE5B 1MFCL 3OSVA 1XTMA 4QRTA 2AHIA 1QAPA 2FZ9A 3FOLB 4GXPA 3PWUA 4XN7A 5E8DL 3ETSA 5DI8B 3IMBA 3EX1A 3O05A 5HNUA 2PLJA 5HANA 4F57L 1KENH 4G8TA 3TN4A 4EZLA 1LM8V 1SF5A 1DQUA 4PJ5E 3GC4A 3MRMB 5F96H 5T1KA 3THUA 4LPTA 2QJGA 2EXYD 5IVZA 2HROA 2K7PA 3SE8H 5KSUA 1RUPH 2IADB 4JM2C 5BOZG 5E2JA 5BZDA 2C34A 4Z3TA 1IR2A 4YDZA 2YBVA 3CSTA 2B59A 3NIFB 4ODUB 4GG9A 4RAUA 1UD3A 4OZFH 4LAMA 4UQEA 2VLKD 1LJYA 1Z0NA 2CK0L 2EZ0C 2Y4SA 2E7CA 4NAEA 2YYUA 4QRPB 1PS9A 3FSUA 1KBKA 5K9DA 4K68A 5GHWH 2FZMA 4MJ2A 3WXWH 4FXKB 1RJLA 3EO1A 4CDGC 4K2UL 5FHAL 1MCWM 4OH2A 5DD3H 4FR1A 5C9KA 1J5TA 4KK6C 4HS8L 1KZYA 5F2FA 1NIUA 4ZS6C 4CCCA 4JHAL 4TVPD 3VDHA 4P7RA 1JRHL 2HJLA 2IS7A 4P7OA 4S2BA 2ZRXA 4CRPA 4XPTH 4X42A 4FN0A 3S83A 1AIFA 1QI3A 3ULUC 3EYVA 4K7PH 2EVGA 4MRCA 2NQHA 4FP8L 2MNUA 5GRWA 2FBOJ 2QGDA 4FXLA 3DX1A 4K55A 4X7FC 5E1AA 3VXOB 1ESWA 4DJDD 1YIXA 1G7IA 5CBBA 2HKHH 5HYEA 2Y3NA 2OMBA 4GMSH 5DCDA 2ESVB 1RPKA 4FNUA 2QJHA 4B3LA 2PDJA 3FUIA 4MWAC 2H45A 2YGPA 2BNRD 5AYXA 2YRPA 2HKFH 3UTSA 2ZKYA 3JR2A 4B5ZA 1QASA 2EDXA 4RMQA 1ILSA 2ATKA 1ZSHA 2ZUUA 4PCPA 3C6LC 3TO4C 1ZBKA 4Z7WB 3GAYA 3NQEA 3BD5A 2BERA 4ACPA 2JVUA 5DLCA 5EBAA 4EXQA 3L2NA 4F1SA 4L1XA 2UUDK 2XQ0A 3H70A 2WSYA 4IU3A 1Q3NA 1H6UA 3QNXB 5LBSL 3VXRD 3BE7A 4NJGA 3MRNA 4Y19E 2C9QA 3RTQB 2BOFX 4RX0A 3RB5A 4JN1L 3L4WA 4MD5A 2HVBA 1K4CB 4LLWB 4U0RC 4XVJH 4IBVA 1LVEA 4FFVC 1B9KA 3Q5OA 5DO2D 1TITA 1XF3A 4JKPH 3F58H 4A37A 4NGHH 1TPEA 4X6EA 2VX5A 2GHZA 1XEUA 2EACA 3WH9A 5JIWA 3BEWB 1BMZA 1FZOA 4AYSA 3G0SA 1MCFA 4M5ZL 4O14A 1V7NH 1XSIA 1XF0A 1TWIA 1NCUA 2CLVB 4FFYL 1K77A 5D2NB 5HOSA 3HI6L 3IU3A 3QE5A 3S96B 3BIKB 3TYGL 3GIQA 4LV9A 2BSRA 4BZ1A 4EI0A 3OGOE 3R8QA 1GHSA 2E5BA 1YMMA 5DUPL 1TX0A 4CSSA 2KH2B 4QHLB 4M62L 2GBTA 3KCPB 4DGVL 1Q7ZA 4KUZL 3D46A 2BMKB 1LRQA 1RZJL 3PV7A 3RVWC 2IDCA 5I30L 3VXUE 1ONXA 2D69A 2FVMA 4PTXA 4YXGA 1RPXA 4OD1H 5I26A 2J8UF 1BYCA 5H91A 2BRQA 4EANA 4MAZA 2WD0A 4HK6A 3FTVA 1X8FA 3PGFH 3GDCA 3TA4D 4G9DA 1CBVL 5K1VA 3MYOA 4NQCD 2EYRA 2AJXH 4UB9A 3W7DA 4DZAA 5AYTA 2CM6A 5EHFA 5BOPA 3OF6A 5IFJA 2BNJA 1I4FA 1OAUL 3PNRB 3PWPA 1LZOA 1MFVA 1IM3B 2C4XA 3MLXH 4TUUA 2YW3A 5H37G 1DANU 5LBSA 3P3SA 1F9CA 3QY6A 2NVDA 1G7PB 3AFBA 4AK1A 5AVVB 4XXCA 3WEXB 3ZE2F 2HV5A 1DXEA 2ISFA 3HS9A 3BJLA 3IFNL 3HURA 1BYNA 5CUSL 5JXAL 2EJAA 4AXWB 4MXQC 4K8EA 4F79A 3EKLA 2XJKA 5KAQG 2OKMA 1LL7A 1QHQA 3L1OL 4M48L 5KG9A 2W5FA 3QFWA 2A6KB 2F7OA 1ES0B 2I9UA 2VABB 1SJHB 2EE3A 2GJXA 3AU0A 2V3EA 4Y7EA 3BAJA 1SMOA 1PKYA 3QIWA 3EO0B 5GVJA 1SJEB 4EIUA 3MN8A 1G6CA 3KYAA 2XVKA 1X5YA 4LSRL 3TX9A 1UKSA 1ME7A 5J9PB 2R56H 5LAXA 3BKJH 5G2HA 3JT0A 1S9VB 2IWEA 2Y6SD 4F37K 2X16A 4C6KA 2ZA2A 1SEBA 4LPWA 2H3KA 1L3NA 3GXTA 4X2RA 1T1XB 1PEWA 5CC3A 4NCC2 3WF4A 3HUJE 1JNNL 1NKRA 4FD0A 1QNSA 4PFHA 1GMEA 1XR2A 1T04B 2CO4A 2ZOTA 3SHSA 2YK1H 3VIPA 3CHXA 4X7SL 3THML 1BIIA 3WMBA 5HULA 1NBZB 2HVKA 3G77A 4O4VA 4LDCA 2C19A 4F9JA 3B9DA 4Q4SA 4M29A 3AXIA 1IL1B 1UT1A 4QRRD 3UDWA 5JQ6L 4MJZA 5I07A 1P43A 2QADB 3SCVA 2X4NA 4DXXA 4US5D 5AVQB 1F7BA 3N5AA 1TV8A 2FTPA 3UPMA 2MWCA 4PJHE 1UENA 4FHKA 4A3RA 3O4LD 2H41A 4JFUA 4M7KL 4ALDA 1JHTB 2E4TA 1FVEB 4M6PA 1TMQA 4L23A 4RZCB 4NQXB 2O6EA 1PWLA 2BIOA 2GYSA 43C9A 4Q74A 4AIZA 4BEIA 2Y7FA 1FHDA 4OUOA 3S35H 1YYLH 1XPYA 4HUXB 4QTHB 4EDXB 4LWWA 2OSLA 3TN5A 1TIMA 2W0UA 2HKAA 1I9EA 2B59B 1MCPL 4GRLD 4LOCA 2XQBH 3E0LA 4H0IA 2W27A 3KS5A 3MBFA 5L2KD 3APNA 4JM4H 1YEHL 2O30A 1K3UA 5K1JA 3AQUA 1FNSH 4E9WA 4ZW6A 4JOMA 4S3KA 4WZHA 3WLNA 1SN5A 4DJEA 5DDHA 2NY3B 4BKTC 3CHDA 3K91A 5C8JA 4IU2B 2J2ZA 1Z9MA 2C3ZA 5FYJH 2R29L 3J07A 5ADPL 1VPXA 1HNFA 5IDZA 5TE4L 1MVYA 3T65A 1E4XI 4MQ7B 4QRSA 3VX1A 1QK0A 3H7LA 3TEYA 2GTZA 2YB1A 4OGAC 3OBEA 1W72B 3PHQA 2IPFA 2HUEA 3ARTA 3VD9A 4ACYA 4LCWD 1VC4A 5ENWB 4IP4A 3GH5A 4ZW3A 3PBMA 3OKEB 1FWFC 4XNBA 2WV3A 3VFUA 4P4KD 5JUEH 1A4KA 4HCRA 3OX8B 4IBQA 4ZOEA 5CC6A 3OHXB 3SCMB 5FYKE 1BXUA 4ZFFA 1FAIL 5EYWA 3N43F 3IJQA 1LLAA 3S3PA 2GJZB 4AMKH 4DEPB 1B3VA 2RH9A 1J0HA 3GGWB 2Z1KA 1AL8A 2O7QA 1YN6A 4B3VA 2XPGA 4L8DB 3Q45A 4I18C 4BE5A 1AP2A 4FYQA 3UTZA 1TREA 1UYQA 4H01A 5CJNA 3ISIX 4FXGB 2WJEA 1NCJA 5F7AA 3NYZA 5IREA 5I6XC 3N2CA 3ZMNA 2RFXA 3IGAA 2VLJB 4B4FA 2EDKA 2NY2C 5IKCA 3JUYA 3WAKA 4C6NA 4FXKA