4JFTA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor n-desmethyl-4-epi-(+)-codonopsinine
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-L-fucosidase
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
total genus 162
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jftA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jftA01
4UR9A 3VSVA 3EDDA 1NOUA 5BCAA 5DMYA 4P8XA 1BTCA 1X6NA 5A6MA 2OSWA 3DDFA 4MJ2A 4QP0A 1T0OA 2WVVA 2DGAA 1MW1A 3VGFA 1QOXA 2XVPA 4HMEA 4U33A 1E0XA 2GJXB 5D8WA 4J28A 4JFWA 8A3HA 4OJYA 1QNQA 2EEXA 1EXPA 3BLPX 2CEQA 3ALFA 4MNLA 2OLHA 1E6XM 1AQ0A 3T08A 3VMNA 3WL1A 1U2YA 2YIHA 1UD6A 1JYXA 2OWXA 1XSIA 3OLGA 3CZSA 4PSPA 5LA1A 1ISWA 2WCAA 5D9NA 1JZ6A 1HVQA 1W91A 2XG9A 1E5NA 3VD9A 1DEDA 5CPQA 4GI9A 1HL8A 1Q6DA 1V0NA 2D24A 4PTMA 3THDA 1ISXA 5ABFB 2J7CA 3TP4A 3ZJ8A 3OGRA 2WNWA 1MQQA 4P7LA 4JFTA 1XCXA 1NM9A 2F7OA 3WNKA 2XN2A 1F4HA 1X1NA 4W88A 4TVDA 3BAXA 2VI0A 2ZWZA 1V6XA 3VGGA 2XIIA 2FHCA 4JFUA 4AYSA 3GDBA 3L4WA 1H11A 1E1EA 3WD3A 4AC1X 1NWUA 4V27A 4CVUA 2EXOA 4UQBA 3L2MA 2YOCA 2D2OA 2V3FA 4UFKA 4LXFA 2VZOA 4GIAA 2F7QA 1L8NA 3FNDA 5EFDA 1EGZA 4EKJA 2WVUA 1WP6A 1GONA 4FLOA 2UY3A 4DUXA 1RP8A 2YDRA 1QI2A 1FA2A 1CIUA 1QHZA 5HDRA 1Q6CA 3ARRA 2WHJA 4LQ1A 1WDRA 3MKKA 4B9ZA 2FE0A 4TVUA 1SMAA 1JZ5A 4WK9A 3OLEA 5IFTA 2D3NA 1PPIA 4AISA 3LPOA 1JYVA 1TE1A 2DT0A 1UR8A 4F9DA 4D6DA 4D6IA 1HVXA 3CZKA 4AIOA 1J01A 3U5YA 3KWXA 1CGYA 1OB0A 1NWSA 3W25A 1A3HA 1M53A 3L4UA 3ZJ7A 3CUFA 3OGVA 4CCCA 1UYQA 3SUTA 1KBKA 1XV8A 1TA3A 3TV8A 1JXJA 2BY2A 2D3LA 2YA0A 2O9PA 3ZOAA 4PN2A 2WPGA 2O9RA 3UERA 2PWDA 1G1YA 1XYFA 3WF1A 3H54A 5A8PA 1XHGA 4PMVA 1G94A 1E6PA 1ITCA 4ZXOA 1GOQA 3UG3A 4J7RA 3F5KA 4MJ4A 1TVPA 5IXEA 3G6MA 4PCSA 3LRLA 4CD7A 1KFWA 4H04A 3E1F1 3BAIA 2PWFA 4P7NA 1KCLA 4QAWA 4C7GA 1B1YA 2EAEA 3EJRA 3VGBA 1CLXA 4HMCA 3N12A 4KWUA 3CBWA 2WB5A 3AS2A 1BHGA 2VQTA 2UWFA 3HG2A 3MMDA 1JDCA 4PMNA 2BHZA 3PZTA 3VD3A 1JAEA 4OOUA 1BYBA 5ABHA 4NXSA 3ALGA 4WKFA 2X05A 1E1FA 3WUEA 1OGBA 1BSIA 4CKQA 5A95A 1MQPA 4ACZB 2QHAA 1JG9A 4MNMA 4AD5A 1FHLA 1CXHA 4IISA 1W9PA 2EPNA 4GKLA 2YFOA 1CECA 5HOSA 3BUIA 4UQDA 4UQAA 3AIEA 3BVWA 4JZ5A 2XTKA 4FK9A 1GNXA 3WENA 1UZ1A 3CZJA 4OZOA 4NZFA 5I6SA 3AICA 2CPUA 1W3JA 2PI6A 1WZMA 1DWFM 4BQ3A 3SCSA 2MANA 3B9EA 3WFLA 3ZT5A 3H55A 3ARYA 3TTOA 2VX6A 3DHPA 2ZX7A 4CCDA 3VMOA 1E4MM 5DFAA 2DH2A 2WBKA 2BNJA 1XH1A 1V02A 1VFMA 1VBUA 3BVVA 3AIVA 5GQBA 4M1RA 5I78A 7CGTA 3QR3A 2WMHA 1TUXA 2OW7A 1VBRA 1KR0A 4CCEA 4Z2IA 2XUCA 4B9YA 2G8ZA 3AYRA 1BAGA 4HOXA 3WUGA 5A2AA 2EPLX 4AZGA 5CLWA 4W8LA 1UKTA 2WWDA 5A6LA 1V3LA 1RD6A 4JKMA 1E4LA 3IANA 4KH2A 4J3SA 1WDPA 3IJ7A 3DX3A 3AMCA 5BXTA 5I3DA 3CMJA 2CCRA 4K68A 1CDGA 1KXTA 1GORA 3HU7A 1VIWA 1B3VA 4AZCA 4B3KA 5EFFA 3PZ9A 4Y7EA 3BC9A 2F1BA 3EJSA 1I1WA 5EMYA 4AZBA 4XB3A 2PWGA 2FHBA 3KL5A 4CD5A 3MUZ1 1JNDA 2YA1A 4MB5A 1EDTA 2F7PA 1HF6A 3DC0A 4EAMA 3N9KA 2X0HA 4V2XA 4NZJA 4HZ6A 4HA4A 1CEOA 3AS3A 4E8DA 2ZWYA 1QNPA 1DWGM 1Y7VA 1R7OA 1XCWA 4Q7NA 2VL4A 4GO9A 1U30A 2J7HA 2E9MA 2XJ7A 2G3MA 5E0FA 1FFRA 1WZLA 2FH6A 4JCMA 3ZSSA 2CNCA 3A22A 3CHCA 1V6YA 2WLZA 4NZCA 2X2HA 1V6UA 3HG3A 2OYMA 5LA0A 5CXPA 1Q6GA 3A4WA 3THCA 3VDBA 1O7DC 4PMZA 3W28A 1UZ4A 2A3AA 2XM1A 2QPUA 1RP9A 1FH7A 3W37A 1GVYA 2NSXA 2WMJA 3JUGA 3GM8A 4IM4A 1XGZA 1ZB5A 3PZMA 2YL6A 4B3LA 4E4PA 4GQRA 3QOMA 4TXEA 4E8CA 1VAHA 4AZIA 4MB4A 1UQZA 4YHGA 1E4IA 5A6KA 5JUVA 1IZKA 2YKKA 3AISA 3AXXA 2CHOA 1V08A 1QVBA 1JAKA 3EJPA 1V0KA 1CTNA 5E0CA 4R5EA 4IUGA 4PSRA 3PZOA 1EQPA 4HOZA 2CIPA 4BF7A 3WELA 1BPLB 4HZ7A 2EABA 1EH9A 1BVNP 3SCNA 5I77A 2Y4SA 1HXJA 2J47A 2IXVA 1UWIA 3VX1A 3AI0A 3MV11 1KR1A 1B3ZA 1C3FA 3M46A 3G6LA 3A21A 1KQZA 2IXUA 1J18A 3VIMA 5CJ5A 2CERA 2IGTA 3VILA 2Y8KA 1JZ4A 3LPGA 3K1DA 1R87A 5A69A 3U7VA 1QX1A 3WQVA 3VNZA 2V5DA 4D6FA 2D0HA 2X8RA 3NDZA 3WY1A 1PZ3A 1JFXA 4WKHA 4D6GA 1R33A 1OGGA 1W9XA 1VB9A 2WANA 3AHXA 3F5JA 4KGLA 3HG5A 3VX0A 2X2YA 3RMEA 4HZ8A 1OWQA 1C8QA 1CZ1A 1KGWA 2XWEA 3FY1A 3SUUA 4U31A 4AYGA 1KXHA 2AMGA 1M03A 1V0MA 3ARSA 5JBDA 3DX2A 3WBEA 4DUWA 3SUVA 4W8AA 5BXPA 3BUQA 4A3HA 3DYPA 1H0GA 2VR4A 4FLRA 3N18A 1GQJA 4LYPA 1MW0A 5CPSA 1G01A 5IHSA 5AC5A 1VJSA 3W38A 3WQWA 1QPKA 4MDPA 1O7AA 5A6JA 3SUWA 3W26A 4W7VA 2WVTA 1R34A 4NI3A 1ODUA 5JIWA 3L2LA 1E55A 2CBJA 4JHOA 2WHMA 2X0YA 4UFHA 4HU8A 1E0WA 4S3JA 3VIFA 1V3IA 3OZPA 1ZBCA 4AMCA 4B15A 1VF8A 1J0KA 1X6LA 4W5ZA 1SFSA 3A4XA 5A6SA 2BY3A 3CHEA 1WZAA 1GZJA 3WMSA 2VT0A 4BQ4A 3WKZA 5LA2A 3BLBA 4AIUA 1VEOA 3K4DA 2WVVB 3CGTA 4PEEA 1ZU8A 2XM2A 1VRXA 3SCVA 2ZXAA 3TOPA 4JL1A 1BQCA 3ARQA 1UG6A 2VZSA 4RE4A 3ZR5A 3MANA 4MNKA 1JFHA 2BVTA 2BVYA 1K9TA 1CXEA 3D4ZA 3W81A 1QI5A 2F2HA 5GNYA 2W91A 2XIBA 2F61A 2QV4A 5AYBA 5EB8A 2YLLA 2EJ1A 1N82A 4MAVA 4A3YA 2VURA 1KB3A 2ZX8A 1J0ZA 2XFRA 4URIA 1OCQA 1VENA 4D6CA 3VIKA 3WD1A 4E2OA 3WDPP 2WXDM 5E6YA 1GOOA 2XSBA 4M29A 4IPNB 2X09A 3S5ZA 4AMWA 1NWTA 4NF7A 3MU7A 2ZUWA 3O6AA 3BH4A 1H41A 5EBAA 1XH2A 1J0HA 3KLLA 3WD4A 1CGUA 4OKDA 2VX7A 4KGJA 4OIFA 2EBNA 3DHUA 4M56A 1HJUA 1FHDA 3CIVA 5I0DA 2EADA 4ATDA 2Y2WA 2E0PA 3KEHA 5C8BB 4UTFA 1I1XA 5IDIA 1WKYA 1DWAM 1C8YA 3SURA 3WN6A 3IJ8A 4CN1A 4WIWA 3MUY1 1J12A 3MSDA 3W4RA 4B16A 1UH2A 1QNOA 3KL0A 3N15A 1KTCA 1BYDA 2VZVA 3VVGA 1JF6A 3EJTA 4OBSA 2J7EA 4XZBA 4PMRA 3CH9A 3RPMA 3N1AA 1OBAA 3CZGA 1BYCA 1E56A 4JKKA 3SCPA 2YBTA 2DSVA 3L4YA 4MTVA 3BGAA 3A47A 3AIUA 1W3HA 1V6WA 2GJXA 1CLVA 3N17A 3OGSA 1NOWA 2V38A 2WHKA 3L4VA 1LLOA 2WWCA 4LGXA 3OA5A 3WH7A 2ZX5A 4UFJA 1I75A 1KCKA 3MMWA 1HJWA 2DPEA 3PTQA 4PTXA 1NQ6A 3WDHA 2FHFA 3ZM8A 1PAMA 2ZXDA 4LX4A 2ZICA 1EIBA 4DWSA 2ZUVA 2E9BA 2XVNA 1WE5A 3WQ5A 3M7SA 1QHOA 2ALWA 1XYZA 3O2LA 4XX6A 4UZSA 1E6RA 3OIHA 5A2CA 4Z2GA 4UQEA 1KXVA 1O6IA 4YHEA 3WD2A 1DTUA 4OUEA 1ISZA 5HXMA 1OD8A 2PB1A 3WH8A 1NOFA 5FCZA 4NSBA 3AIQA 1BFNA 3PZVA 3IJ9A 4UCFA 1OT2A 4HP5A 2A3HA 2OYKA 1GHSA 1OIMA 3ZO9A 1UR1A 3H53A 3ZR6A 1LL6A 1JZ3A 3QHNA 1XRVA 1UKOA 1B9ZA 3GBEA 1CYGA 2WC3A 3GZAA 3D52A 4DWSD 2DT1A 1US3A 4OBRA 3ARZA 3VUPA 1QW9A 1B3YA 2OW6A 5E70A 3PZUA 1EDQA 4P8UA 1GOMA 1E70M 2JEPA 4AZ6A 3DECA 2OSYA 3FW6A 4XZWA 1EOKA 4QLJA 4U5KA 3BVXA 1C8XA 2JALA 4F66A 4BCEA 3T0DA 3EMCA 1UD3A 1J0JA 4U2ZA 2XYLA 4W5UA 4UZUA 1C7TA 1UA3A 1CXFA 2XWDA 4W7UA 4GPNA 2XVGA 5C71A 4DM1A 3AHZA 3VPLA 3WDJA 2GFTA 3EDFA 3I3DA 3WUFA 2ZXQA 1U33A 3TONA 3MUAA 2GK1A 2ZX9A 2GUYA 3AMLA 1H09A 3VM7A 5AYIA 5A6AA 2BHYA 2WKLA 2FDMA 4BA0A 5DT5A 3VIHA 3WQ8A 3BUPA 4J3VA 3OB8A 3W0KA 4UFIA 3GH7A 3OG2A 5A3HA 4U5IA 5AC4A 5FOOA 2A3BA 1QI3A 2Z1SA 5A8NA 2VVNA 2WMIA 3BAJA 2NT1A 1BVZA 1Q6FA 3AZTA 2Q8XA 5KZ6A 3M07A 2ZIDA 1H3GA 3EJUA 1JZ7A 4D71A 2VO5A 2FYVA 3IAPA 4Z2KA 4BQ2A 1LWJA 3RO8A 3UCQA 4CD4A 3WNPA 4AD3A 4DO5A 3VSUA 2ESCA 2J7DA 2YA2A 3F4VA 4CVWA 5F7UA 1J0YA 3AS1A 1OD0A 1WZKA 1GVIA 2B31A 3GNPA 3OZOA 2VCAA 2WMFA 2AAAA 3WNMA 4M80A 1JIBA 1CPUA 1V02E 1H0IA 1W3LA 1J0IA 1ESWA 1HJXA 1UOKA 5E6ZA 3WH9A 2VZTA 2OWCA 4BQ5A 1QWNA 1XSJA 1RH9A 1KGUA 1FOBA 2WM0A 4AZCB 4ZXLA 2W92A 3RILA 2DIJA 3PTKA 3F5LA 3GYCA 3K8LA 2CYGA 1ISVA 5A8MA 4MAZA 5BWFA 4JHZA 5A1AA 3VO0A 1JZ8A 1XH0A 2WMKA 1BYAA 3AMGA 4W8BA 3ARXA 1GHRA 2W63A 3GH5A 4WKAA 1UWTA 3SCOA 2VNCA 1ZBVA 4FF5A 3PZQA 1ZJBA 3DYMA 3MS8A 3CUHA 1MW2A 2HVMA 3IGUA 3VGEA 3LPPA 1UWRA 2XVKA 2D23A 2C7FA 2JEQA 3CO4A 3ZQ9A 4JKLA 2FH8A 2F1AA 1UWQA 2FGZA 4AIEA 4QDMA 1WNOA 3ZJKA 1QBAA 5I79A 4Z2JA 3S2CA 2UY2A 4AD4A 3GH4A 3UEQA 1IV8A 4HMDA 4W89A 1KXQA 2V3EA 1ITXA 2E3ZA 2XPKA 2XSAA 4LYRA 4AXNA 4D6JA 1UR0A 1KGXA 4PTWA 3VDCA 2VZUA 4DWSC 2O92A 2XGIA 5ECUA 3VU2A 4HA3A 2WLYA 1E6QM 4PMQA 1JNEA 4OGZA 3LX9A 2J25A 2PC8A 1JDAA 4J3UA 5CSYA 2PBOA 1CGWA 3W6MA 2Z1KA 2Y8VA 1E73M 2IUZA 4D6HA 4HU0A 3CZEA 3WFZA 4F79A 2J74A 3W6LA 3VGDA 1W9VA 2GVYA 3ECQA 3WBAA 3U7BA 1G5AA 5GPRA 2DQXA 1SZNA 3NYDA 4AEEA 2YJQA 1ZBKA 4AW7A 1GQKA 1IZJA 1DWJM 3CZLA 1E6NA 4J3WA 1VEPA 2W62A 2W4XA 2VQUA 4NXKA 4AY1A 5DEZA 4J3TA 1HNYA 3WEMA 1ZJAA 3UG5A 4F8XA 1W9UA 2PWEA 1B2YA 3N13A 3W29A 4H2CA 4UQ9A 5TD4A 1LQ0A 6A3HA 1HP5A 3CTTA 1WO2A 1UD4A 2XN0A 3MUIA 3EJQA 4BZYA 2WBGA 1QW8A 1UD8A 3KE0A 4X0NA 3WUBA 3GTNA 4PMDA 4FNRA 3RIKA 1W1PA 1W9DM 4WJXA 2BFGA 4F9JA 2ZXBA 4TX6A 1ZL1A 4U3AA 5A6BA 3WF0A 1GUVA 2PBGA 3APGA 3PZGA 5A8OA 4TUFA 2G4FA 5DO8A 2XVLA 2DSKA 3AFBA 1JDDA 4JIEA 3WH6A 4EANA 3BUBA 3SUSA 4TOQA 5I5RA 2YDQA 5HPOA 3WL0A 1JD9A 2WCGA 5BYWA 3MV01 1B90A 2E40A 1TQVA 4ZENA 5D8ZA 2JF7A 1GJWA 4GXPA 3ARWA 4PUEA 3AQUA 1CGXA 1EQCA 4WLCA 3RM4A 5A6BD 5CSUA 2QF8A 1E9LA 1R75A 5C70A 3VM5A 3NUKA 4UNIA 1DWHM 4GZJA 1ECEA 2VR5A 3AXHA 1HTYA 2D0FA 1PX3A 3CUJA 3SIMA 1TQSA 1TR1A 3T2OA 1VFUA 3ZT7A 5I24A 2EO7A 4ZE4A 3VOCA 3CZ8A 4ZEPA 2CESA 1GCYA 2ZX6A 5FKYA 1TVNA 2G3IA 4M82A 4MADA 1E72M 1AVAA 4UFLA 1US2A 1JD7A 1CGVA 1LL4A 4TVCA 3BUDA 3ZJ6A 2DSWA 4IPLA 1C93A 1JZ2A 3RCNA 3AZSA 3SCTA 3I3EA 1CXKA 1ZBWA 1DWIM 2HISA 3MO4A 2VMFA 2QMKA 5HNNA 2WC7A 1TG7A 3CUGA 1V03A 4QCEA 1B30A 3EDJA 5FD0A 1QBBA 3VD7A 1UA7A 3AS0A 3KLKA 1LF1A 1C7SA 2AOSA 3AMDA 4OOZA 1S46A 4JL2A 3GXMA 4FMVA 3AMKA 4AZHA 1RPKA 3PN8A 2ZUTA 1K9EA 2CITA 3W27A 1E3XA 4W87A 1WCGA 4EK7A 2XHYA 3WNLA 2E4TA 2EPKX 2X2IA 1LG2A 4CU7A 3AHTA 2CETA 1WB0A 3LRKA 3WQ4A 4KRUA 4MPKA 4NX0A 1HT6A 1LWHA 3W24A 1LL7A 1CNVA 2XN1A 3WSUA 3AZRA 3EMZA 4KRTA 7TAAA 1KWGA 3S5YA 3A24A 3WY2A 1TFVA 3UESA 4TTGA 1H5VA 3W82A 2JIEA 3VSTA 1CBGA 2WC4A 2J62A 1HJVA 2W61A 2OSXA 2WZIA 3SEPA 4UOQA 5M17A 6CGTA 1E71M 1GOWA 2E9LA 3PZNA 1W2VA 4S3KA 1PBGA 4WF7A 3K8MA 5CPTA 2BY1A 1B3WA 1J11A 3A23A 2G3JA 3S6TA 1OGSA 3CMGA 5DT7A 5FL1A 1JYWA 3TTQA 3N11A 2DH3A 3LRMA 1EDGA 3CLWA 4FLSA 5KEZA 3EYPA 1UR2A 4TTUA 3HJEA 3O9NA 4CN6A 4M81A 3MI6A 2BXYA 1HP4A 2QPSA 1WPCA 1WDQA 3RDKA 3NSNA 3GXPA 1FFQA 1L0PA 1R47A 3CHDA 4DWSB 1EHNA 3BAKA 2J4GA 3K4AA 3ARPA 2C8NA 1UR4A 1CGTA 3EDKA 5CGMA 2NT0A 1FH9A 2V3DA 2VRJA 5A94A 3T0AA 4C7FA 2ZUSA 4UQCA 1H2JA 4GZIA 3BAWA 4FNPA 1HL9A 3PBGA 3NSMA 1HKIA 3CUIA 3WNOA 4CD8A 1R85A 3WNNA 3HG4A 4XV0A 4CD6A 1TA3B 3M6DA 1B31A 2ZUMA 3TTYA 2V5CA 1NWRA 1MYRA 3IAQA 3VIOA 2VCBA 3ZT6A 2J75A 1F4AA 2E8ZA 4U3CA 2EPOA 1W3KA 3LPFA 1EA9C 2YFNA 4L4PA 4H8VA 3VDHA 1PX8A 4JFVA 2VOTA 2WSPA 1QI0A 4V28A 1V0LA 3AOFA 1UKPA 2F7RA 1NARA 4U2YA 4PCTA 3AROA 4BS0A 2GK1B 2G41A 4M8UA 2D20A 2Y5EA 5ABFA 7A3HA 1ODZA 3FAWA 3KZSA 1VFFA 2BS9A 5M03A 3BXWA 2J7BA 3UR7A 2WZHA 3RM8A 5JBEA 3WD0A 3K8KA 3FXYA 3RJXA 3AJ7A 4P8WA 1HIZA 3BLKA 1W1TA 3I3BA 1JYNA 4QFUA 3ZIZA 4PMXA 1UD2A 1AQMA 1KQYA 4JCLA 4AWEA 5I2UA 1KTBA 4MB1A 4WSJA 2JIWA 1XD1A 4L4OA 1W1VA 4PMUA 2VRQA 1QNRA 2G3NA 2WMIB 3PZIA 1UD5A 4LPCA 1P6WA 1PIGA 1HKMA 1E3ZA 3LXAA 4GI6A 1PIFA 3BVTA 1C90A 5A2BA 4NRSA 3QHMA 3GXFA 1NP2A 4CU8A 1XSKA 2ZE0A 4HPHA 2D1ZA 1DP0A 2WW5A 4PBGA 1G0CA 5CQ1A 3NIYA 2DDXA 2BY0A 3EBVA 1NP0A 1V3JA 4D6EA 2NW0A 5JBFA 3A4AA 3AIWA 2A3CA 5DF0A 1VFOA 2YL8A 5BXRA 3VIJA 2VJXA 1MVYA 2JF6A 3UETA 4AZ5A 1H49A 2GJPA 3WIJA 4RE3A 2WYSA 3QGVA 1D3CA 1OIFA 1V6VA 4FLQA 3SCRA 3WDIA 4GO8A 4PMYA 1WAWA 3K46A 1XC6A 3BCFA 2J7GA 1QWUA 1OM0A 2PWHA 4TX8A 5E09A 4CUCA 3FAXA 4DUVA 6TAAA 1AQHA 2J79A 2W67A 3B8SA 4AD1A 4J27A 3U5UA 5HBFA 3B9AA 1JI1A 1BG4A 3OLIA 4PMOA 2RGMA 3GXTA 4HA1A 3UR8A 1HN1A 3UG4A 1QI4A 1V3HA 1UH3A 1UR9A 3DDGA 4P8VA 4D1JA 5ABGA 4AD0A 4N0RA 3WF2A 2FGLA 4DM2A 4PTVA 1OT1A 2D73A 3BMVA 1W2PA 2RGLA 3BSGA 4PRWA 4RE2A 4GINA 1E4NA 1SR0A 1MXDA 2J7FA 1B3XA 3RJYA 1PX4A 3T09A 4JFSA 2GSJA 1UWUA 2D22A 3ARTA 4GQQA 4ZE5A 4X9YA 1UASA 2VUYA 2CBIA 1EOMA 1W32A 1Z32X 3LXCA 3WMBA 2ZUUA 3AIRA 3FHAA 4MDOA 2W66A 1B0IA 2PF0A 3W53A 3L4TA 4Z2LA 3WQ6A 2YBUA 3SCWA 3LXBA 2GDVA 3AHYA 4ACZA 1UWSA 4H41A 2JFEX 3BMWA 2WK2A 3TA9A 5CLTA 1E43A 2EQDA 3GXIA 1UH4A 1TMQA 1CWYA 1FH8A 3SCQA 1UUQA 1G9HA 1BF2A 1GPFA 3L4XA 2DT3A 3WF3A 4DO6A 2DT2A 4ATLA 5CGTA 1GQLA 4ZFMA 1BG9A 5IFPA 3VKKA 4H7VA 1TCMA 3PTMA 2WMGA 2BHUA 1M01A 1E15A 2J8FA 2V3GA 5A8QA 4D1IA 4JAWA 4EE9A 2DIEA 1H4PA 3CV5A 2EACA 2WCSA 4RL3A 3T2QA 3VMPA 1UKSA 4UOZA 5BXSA 1E0VA 5D9MA 2QLYA 4N42A 1UQYA 2DSZA 2CBUA 2VCCA 3SCUA 2CBVA 3QHOA 2C0HA 2O9OA 5LYRA 3T0BA 3VD4A 4W85A 5E9AA 1CENA 1PS3A 3A5VA 1JL8A 5BRQA 1W9BM 1YHTA 4QLLA 3POCA 3WH5A 1JXKA 5D9PA 4R27A 2VRKA 2E8YA 1D2KA 2F8QA 3N04A 3QOKA 3CHFA 1BGAA 4HOWA 4P7OA 5CZKA 1VJZA 3VINA 1PEZA 1MFVA 4W84A 2ZOXA 4FNQA 3T2PA 4KMQA 1K9DA 4NRRA 1UHVA 1SMDA 4ML4A 2J8GA 3VIPA 1E6SM 1HJSA 1MW3A 1J9YA 1BGGA 4PYSA 1BLIA 1ZS2A 1K6AA 1D7FA 3ZMRA 1W1YA 4P7RA 3DX0A 1CXLA 2VX4A 3GXDA 3D51A 2YL9A 4PUDA 3AXIA 3WMCA 3BAYA 2F18A 1NH6A 3A3HA 1Q4NX 1C92A 3WEOA 3KL3A 3GBDA 1MFUA 3D50A 1E40A 2EPMX 3BCDA 4H8UA 5D9OA 5BROA 2O9TA 1LJYA 2Y24A 1MXGA 3ARVA 5M3WA 1Q6EA 3WDRA 3VDAA 1A47A 4Z2HA 3ARUA 4GI8A 3AYSA 4HTYA 4J3XA 4AMXA 4YPJA 3GXNA 4AEFA 2D0GA 1HKKA 1M04A 2ZUNA 1PZ2A 4UOJA 1V3KA 1FP8A 3WY3A 2VVSA 2DEPA 1AMYA 3IK2A 2X1IA 1XD0A 2UY4A 2DSUA 2VTFA 1GJUA 3HMCA 3D3AA 3VD5A 1J10A 1MWOA 2JE8A 3OLDA 1TZ7A 8CGTA 3TTSA 1HJQA 2WVSA 4LYQA 2XFFA 2A3EA 2WAGA 3NDYA 3WF4A 4W86A 1HWWA 3CPUA 1EHAA 3WDQA 2YDSA 4M24A 2J77A 2CKRA 4Q22A 4XUYA 2YL5A 5BRPA 3BVUA 1H1NA 4CGTA 3GNRA 2CKSA 4D72A 5IHRA 3EDEA 3HZ3A 3NJ3A 4AD2A 4CN4A 2VX5A 4WSKA 4GZEA 4MB3A 4C7DA 1R86A 1E5JA 4H8HA 4W7WA 2GJRA 1GQIA 2XGBA 5I23A 4A4AA 4MNJA 4ATWA 1JI2A 5M5DA 4DO4A 3A6OA 5HPCA 3VIGA 2BXZA 1WDSA 3WEZA 1SYTA 1R7AA 3DX1A 1IT0A 1EO5A 1TQWA 3RM9A 3CZNA 1CXIA 2WKGA 3NCOA 4YN5A 5GNZA 1JGIA 5CG0A 4FNTA 3II1A 1LG1A 1KWKA 3HN3A 2VC9A 4FNSA 9CGTA 4HPGA 3VNYA 2CXGA 4P7QA 2WHLA 1QNSA 1GW1A 1TQUA 3VTRA 3MSGA 5E1QA 3DX4A 2UY5A 3L4ZA 1OINA 5GNXA 1R46A 2BV9A 2YLAA 3B9DA 3LMYA 3ZSTA 1EO7A 1JF5A 2CHNA 2BVDA 2J78A 3NSXA 1GOIA 1K9FA 4AZ7A 4W93A 1HXKA 4QCFA 4X0VA 2WSKA 4CU6A 1HX0A 3U57A 3WY4A 1DHKA 1UKQA 2W5FA 1V3MA 4FNUA 3D4YA 3AHVA 3OBAA 3VGHA 2X2JA 1ISYA 3GNOA 3FN9A 2TAAA 2GDUA 3BSHA 1M7XA 3J7HA 2WZEA 1R8LA 3DYOA 1MQRA 1TQTA 3CC1A 1HKJA 3D5HA 3POHA 2XFYA 5AY7A 4ACYA 3FHQA 5D4YA 2OYLA 3AIBA 5ABEA 1C91A 1FP9A 5FL0A 3VIIA 1PJ9A 4QLKA 1QHPA 1KBBA 3MMUA 1E6ZA 2QMJA 2OWWA 3PHAA 4UFMA 5JIPA 1OSEA 5FIPA 1GOKA 1YQ2A 3EMQA 1VEMA
chains in the Genus database with same CATH superfamily
4X7SH 3IF1A 3G1DA 2R1WB 1FV1B 4Z1DA 5AOLA 4QP0A 4B2DA 4WFHD 2XVPA 4U33A 2GJXB 5D8WA 3O3EA 1LT8A 2VN3A 2EEXA 1VBGA 4RISH 1ZQ5A 3ESOA 1SJEA 1OCWL 5T5NF 3O16A 4AGNA 1KMGA 1G4EA 4LCWD 1F58H 2IJ0C 2HX9A 1XF5B 2HVJA 1U2YA 3N2TA 4XAKE 5I16B 3SQBA 5BPPA 2VC5A 3DKHA 4AM0Q 3CZSA 4J4PC 1YEKH 3CYJA 3HNVH 4QAIA 4Y9OA 5ES4B 3TWAA 1HL8A 1JZDC 3Q8EA 3HOJA 1UQSA 3MZTA 4JFZH 5EYWA 4J1UB 3G6DH 2CA4A 5HSFA 2F7OA 1AP2B 4R7NB 1AGFB 4ZSOB 1ACCA 3H3KA 5LIWX 1E1EA 3GW3A 4MKTA 1GZHC 2CIIB 4UFKA 3GLDA 1ZUAX 5CC5A 2D69A 4RGNC 1RK7A 4IJBA 1YJDH 1S2WA 1OP3K 4N9DA 1FA2A 3OM3B 3IPWA 5C1MB 12E8H 3QNZB 3VFCA 1UUNA 3CAQA 4RWYL 4Y5YB 2R0ZL 4F8PA 5KG9A 3U5YA 2Y6SD 2WBJC 1YXDA 4LCUA 3O9WA 3DENA 5DX7A 2EEAA 1XV8A 3J27A 4PREB 5H35A 2X3BA 4D94A 2X2UA 1XEUA 2ZOKA 2IS7A 2NXYC 4FTVD 3IM1A 3LBOA 1NEUA 4YR6B 3UERA 2HFEA 2E5EA 1I1AA 3UG3A 4KKAC 1W1ZA 4MJ4A 4OCYH 4FR1A 1W15A 3IJYB 3RX5A 5IXEA 1P4BL 3G6MA 2WLLB 3FA5A 1S5IH 1AGBB 2W9DL 4A3UA 3BRFA 3ITOA 3M64A 4YLWA 4ZRGA 3WTXA 2Q6WA 3WBWA 4KK5C 4U6XB 2L5HA 4UBDC 4DELA 1TPVA 3UT0A 5EBWB 5CJXC 5I18L 2FWLB 1KKRA 1F41A 1PYMA 1KPRB 1UWGL 1KLYA 3NIFE 4RE0A 1LRNA 3D6GA 3RX2A 3GMNB 4M48L 5F3FA 2X12A 1LDPL 4TNFA 3CV1A 2VDOL 2W07A 1A6WH 1Z9LA 3ULVF 3B9EA 2YD4A 1F8TL 1R0MA 2HQAA 2QEJA 3Q37A 3CZFA 3P73A 2VFFA 3ITCA 3LQMA 1HOCA 1FFPB 3KGRA 2NY3C 1A14H 1WC7A 2XTJB 4AY0A 3KLHC 1W6WA 4CCEA 5L7XL 4KEZA 3NJIA 2XFWA 2NX5A 4NN6B 5EPDA 3IFPA 3N34A 1OYAA 1H61A 3DV4A 4KKPA 4UU9A 3RVTD 1E0TA 4KH2A 2ZSVA 2F2KA 3QDME 3CMJA 3WHE0 5D70L 1F00I 3OWRA 1BQSA 2X1XR 5KJ4A 2VKXA 4UNLA 3ZKMD 5EMYA 2FJFA 2OVLA 2GTZA 1YNKL 3QNXA 1LE9B 4Z7WE 3DC0A 4EAMA 1X39A 4HZ6A 4JIPA 5E6RB 5IV2A 4L4TB 1RZPA 5EN3A 4GRWH 1GC1C 4HBCH 1A9BB 2FH6A 3SE3C 4ZUVA 4LEXH 3W28A 5A7BA 3KWWB 4Y4HD 1RP9A 1PLAA 4EDXB 4PJGB 4BJHA 3JUGA 4B97A 3PZMA 4E4PA 3GHSA 4UMCA 5LGHH 4QLWA 2PTVA 2W9MA 2ZUYA 4NWTL 2WN3A 2YKKA 5FW7A 3LEXA 4EMZA 3LHPL 2VDGA 1SY6L 1US0A 5LBSH 3B1TA 4IUGA 1MLBB 5JH1A 1FORH 3MLWH 3MACL 3LHTA 4UTBL 1IO4C 1PZDA 1T2JA 2ADFH 5E0QA 3QQ0A 5I77A 3PAJA 4FFVD 5DEFA 5KYYB 2R1PA 3MV11 3A67L 2PPAA 2OCFD 1Z3GH 4JO3H 1W1A1 3MHGA 1JZ4A 1ZPLA 3LRSA 3WXVH 5A43C 4XZIA 3MRNA 3U7VA 3U25A 3FQ2A 2R2HB 3VXMB 4WKHA 3NXLA 5FA5A 1YMMD 1OWQA 5I66A 2WZAA 5MKGB 3BZEB 5AW6B 2H8PB 2CO6A 4LSRL 7PCYA 4JFQA 3ROLB 2NNRA 1MW0A 3GRBA 2DJUA 1NFIB 3LV5A 1O7SA 1PEWA 4W7VA 4GW5B 3MNMA 1VZWA 3GBNL 2MFNA 3BP7B 4NX5A 1AODA 4MJ5B 3LTPA 2BLEA 2XISA 2P5EB 1M42A 1VF8A 3C6SA 1SFTA 3EFDL 3MV9D 3P0VH 4M8QA 3Q8FA 4LU5H 4ZYKB 5FCUL 2IV9A 3BGGA 3ARGD 4GSXA 1OLZA 1BQCA 2YKLH 2A4EA 4WW1A 3QQ3A 4ZA0A 4QRTB 5LXEA 3KAAA 1AGCA 3ILPA 2QKIB 4Y9CA 3QK0A 4E9YA 1N82A 1S78D 3MRFB 4JFFD 1V8HA 3KOWA 4QG8A 2ZX8A 3E80A 5AZUA 4GH7B 2Z31B 5FEPA 1W5OA 1I85A 2OEMA 4AVFA 1QTWA 3AAZA 1R5IB 3RIAF 5I8EB 3W2JA 1IBHA 2E7DA 4LSSH 5XIMA 5BO0D 3OD3A 3O6KL 3UJFA 1XSOA 3FTYA 4PV8A 2P5ED 4P2OD 3LS5H 5AD0A 1MUJA 4OM1L 3F58L 4GUGA 4FKEA 2E0PA 3T4AB 1X5YA 4HQVA 5CM1A 4WIWA 2MNUA 3P62A 1JZIA 4P57B 1E8YA 1NF7A 1EERB 4WNQB 3BKYL 5LN4A 4RZCB 4M1CC 3UIZA 1WOBA 3NCJH 3SCPA 2O7QA 2YBRA 1MI5D 5GGVY 3AIUA 4G6CA 1AACA 3F84A 5T1LD 3WBDA 2GJXA 2WGXA 4S2CA 3UC0H 4Z1CA 5MERB 2E77A 1RFDH 4ZQMA 3DVGB 2V7HA 4YHML 3LPWA 2XQYG 4QDPA 2ITDB 2DVXA 1NMAH 4HUCA 1N68A 2NY6B 1EXUA 5GSVA 2Y85A 3UR2A 3KR3H 5KZCB 3WQ5A 3RIFF 2WB7A 5A2LH 4YE4L 5CU5A 2YUWA 5BMWA 4E0CA 4BEQA 2EIZB 1N8ZA 2QJJA 2OYKA 1IBZA 1WUEA 3ZR6A 3OF6D 2GAZB 4NFBA 1GJPA 4JKNA 1PZUB 4K5LA 1WTLA 1KLGA 1QW9A 2QVIA 2FAUA 2QQNL 4QRPB 1A0QL 1PSKL 1OX6A 1KYAA 3LGGA 3LKRA 4G83A 5HWJA 7FABL 4LHUG 2YPLB 4O1BA 4GPNA 3SIZA 1T2XA 3I3DA 4NS0A 3AMLA 3UAJA 3P0YL 3VM7A 5D4JA 2HVKB 1MCFA 3MLPA 2JKLA 2W0FB 4FI6A 1A5UA 4Y5YA 2HXUA 5FAAA 4FZ8L 3W2LA 4EF3A 1N0LB 2WMIA 1E8WA 4PREA 2YXGA 3M07A 2ROXA 2IFGA 4OSUL 3WNPA 3RB5A 1PDKA 4BK5A 3WAJA 4KJWC 2J21A 3MOBL 2WLLA 3K74B 1JPFA 2QQLH 1EIXA 1AGBA 4A35A 5I76A 3BARA 3HMWL 2Y88A 2AZUA 1FAKT 2DWEB 2ZRXA 1Z5HA 2JK2A 1KYDA 3OJVC 3NJVA 1BZ9B 5EC2A 3JWDC 3F5LA 3RYMA 1ISVA 1P7KA 3SBRA 1T40A 3FU3A 2NX5E 4PJFF 4W8BA 2W9EH 3K6FA 1GHRA 1MDAA 2GPZA 3ZE0E 3L3OB 2VNCA 3PZQA 4M93B 3GMNA 5LHDA 3UPCA 1ZSXA 2Y36L 3ZQ9A 3W9DA 3MNWB 3GNMH 4GRWB 3TPKA 3TO4D 4ZBCA 4BH8B 1VHCA 4IRZH 5CUSH 4XD4A 2WW8A 1UG9A 2FEEI 5HHXH 5DLML 1YN7A 2C3ZA 2G9HB 1E90A 2H0FA 5T1MB 5IREA 2BS8A 2X89A 1CMOA 4LASL 1EEXA 3CMOH 1JNEA 2C4XA 2P8PB 5JW4Q 5DC9B 1NCCH 5E8PA 5CSYA 3T3PB 5FFGA 4XBSA 4I88A 3RHWK 1PKQB 1L6SA 1XLCA 4RRPM 5I6LA 3WLRA 1A9EA 4HWZA 4AEEA 1UCBL 3UW6A 3SE6A 1ADSA 4CQ8A 2OK0H 2WQDA 3DO7B 4YXLL 1E6NA 2E76C 4JO2L 1VEPA 4GAYA 2JJVA 1TVBA 2BMBA 1NAKL 2HLFD 1K7EA 4GG8A 2A6KA 3SFKA 4OLZL 3RI5K 3HS0C 2CR0A 2Z7GA 3CPLA 4WI9A 3MJGX 4B41A 2XQYA 1H5BC 4V11A 4I8DA 5DS8A 4Q8WA 1A9BA 4UZGA 1A22B 2UWEA 3PWVB 2OI9C 3LVEA 4ERSH 4K23L 3ZUCA 4Q4SA 5KINA 4HA0A 1JQXA 1SJBA 3QJFB 4MQXD 2BP8B 4P46C 1B90A 2VIRA 5FDWA 3GKAA 1XKYA 2KBGA 5GS0C 2ILLA 2G97A 4Z7QE 2ZRYA 1EAQA 3SOBL 5I3IA 1LTDA 4GZJA 2E74C 2ZXCA 3B03A 3BLDA 1LP9F 3LGDA 3BJFA 1MHHA 4ZOEA 3VOCA 2ZWKA 3VFGH 3QIBB 2ZX6A 4UFLA 4NHCH 3D34A 3HQOA 1LL4A 1TFPA 2ODIA 4GWEA 1TG7A 3CUGA 3PUGA 2YD7A 3GZOA 3QMTA 1G7PA 3UZEC 3LXUX 4U6VL 5MKGA 2E3VA 3OMIB 3BZEA 1ZPUA 5IDZA 4ZMZA 3RY6A 5LQBL 4A8LA 4J3BA 2GIYA 4M7KL 4PJCF 1I9EA 5IK3B 2V17L 2X2IA 4P2QA 3CFBB 3AHTA 2CETA 3VXNA 1K6QL 3KRZA 2X0UA 5IHLB 4KBXA 3BD5A 3RVWD 2YGNA 1KWGA 3WY2A 3JT2A 3CQJA 1OCWH 1EKOA 1X5JA 4X5QA 2DZXA 4E6MA 6CGTA 3IXTA 1VJIA 1C16B 4WF7A 3S6TA 1JYWA 4X7EC 5A2FA 2HT4C 1QFWL 4B50A 3BD3A 4G43B 4JEGB 3H23A 1XGYH 1E51A 5KYUA 1EJXC 1TNNA 5E5UB 1TPXB 2Z31A 3MRJA 5CZJA 3BYYA 4C7FA 5FHAL 3DKJA 3GUGA 2JQZA 5I8EA 3QT2A 4BGLA 4B5TA 4JGMA 3Q3GA 3ZX1A 3QDGB 1HKIA 3WNOA 4PRDB 4DVRL 3HZYB 3WNNA 3H7LA 1AR1C 4I7VA 1TA3B 4S1FA 2Z28A 4GQ9L 5I0VA 1QEXA 3MREA 3MO1B 3W1MA 2HRWA 1GSMA 4XN4A 1MFNA 3FONB 2CDGB 4RWYH 1HHGB 2QT3A 1N8OE 4BS0A 2G41A 3GLAA 1JUKA 2D20A 3UMTA 3U2SB 5EKYA 4F7CB 1BEYL 3BXWA 3PV6B 4CILA 1MCKA 1PD0A 5I1IL 4RW5A 3DX8B 3LCXA 4PMXA 2AXJA 2O26U 1G4TA 2WAQA 3PDOB 1H3VA 1D5MA 1P4BH 1P6WA 35C8L 1RMFH 1T99A 3I9IA 5A2BA 2O55A 1EJWC 2NLJB 1NP2A 2W9DH 3T8QA 3NL3A 4JZNB 3HR5B 1I0DA 5CQ1A 4GXUN 1O6SA 1BD2B 4R7OA 3EHBB 4HISA 1TU2A 4DZAA 4X7CC 5I18H 1JUFB 1H49A 5I1DB 3GTXA 4Y4FB 1UWGH 3G1HA 3MCOA 1IWBA 4KK6D 2QUNA 4LBRA 3P2VA 3MLSL 1AQHA 1LDPH 4O14A 1IC7L 2AZAA 3X1GA 1AD1A 3E9UA 3ANYA 2P3YA 2BH0A 5ABGA 1X96A 3N2BA 4N0RA 4UT7L 3SN4A 4YSQA 4U6YA 3TC9A 3CVHL 1E4NA 1MFAL 2HVNA 3I7QA 4GO6B 1MXDA 4AJWA 2QJMA 4LNCA 3C5QA 2WXLA 4GFXA 4JFSA 3PPGA 3EOAA 4RDWA 4GUIA 1XX9C 2E47A 2CBTA 2VENA 2XCMC 2NNCA 5D33A 5L7XH 2VGIA 3P93A 1B0IA 1Y07A 2ZD0A 4L3CA 3LXBA 1P7HL 1QPRA 3GMMB 1SVCP 1VLXA 5K1NA 3YPIA 4K37A 3GK8L 1T1YA 1TMQA 2PUQT 5DEGA 4NKMB 4G80A 5D7SL 1CDHA 1QUMA 5CGTA 5CSGA 2FZ8A 2EKGA 1ID2A 3UWVA 2C9XA 1O75A 2BHUA 4D7BA 4AG4H 4JY5H 2B1OA 4PGBA 3C6LB 1QR1A 4GNVA 2HSIA 3NP3A 4LOVA 3VC5A 3EOUA 5G2WA 4U4IA 2O9OA 4BSWB 1DQUA 5LYRA 1VZGA 2AJ3B 4JFYA 3BSZA 4RMUA 4Q9RL 4WGVB 3L3OA 3SE9H 1IEWA 2IH3A 4C1NB 1QWHA 3RWHA 1OCCB 4LS2A 3PPHA 1E6SM 3LLDA 3FC8A 3L3IB 3BPOB 3ZE1B 3LHPH 1SY6H 4AV0A 2YEQA 5EU6B 3LQGA 5HYFA 3NQDA 4B9IA 4Q32A 2G60L 3MACH 5D7JC 4IHCA 2Y70A 1V7YA 1RHFA 2M1KA 5E2UH 2FQFA 4K1GA 3A67H 3V7MA 3VDAA 3MCYA 2OZ8A 5E9XA 4GQPH 3RDTD 2AVGA 3ECWA 2UWEE 2PDWA 1AD0B 5LBSA 3NAVA 1FP8A 3WY3A 3RWEA 2AMXA 1QZNA 2B0SL 5HWMA 3SE4A 1AXTL 3N25A 4PYHA 4UDTA 4KCTA 3HNSL 5CEYB 4HG4K 4OGAD 2H41A 4OQTL 3K4WA 3UABA 3GHUA 2VX5A 4WJKB 1VFHA 4CNUA 4B95C 4BEIA 3IJSB 2VXNA 4LOUD 4DO4A 5HPCA 2NUPB 3UXIA 1S2TA 1SXBA 2ZYSA 3AU0A 3GBNH 1EJTC 2HFFB 4XAFA 5JR1H 4LDCA 3W56A 3PWVA 3EFDH 4BSJA 1ZLWK 1U8JA 4GJTB 5CIPA 3ET9F 1Z89A 2OMWB 2BOFX 3QJFA 5D1ZD 4D2JA 1R46A 4UQ2B 2BSDA 4LJ3A 2BP8A 1PYWB 1XWVA 1MCLA 4WI0A 5C7XH 2ACRA 1KCUL 2O56A 4ALDA 1RZFL 2VLME 1DHKA 2EH8L 3HR6A 4ZW6A 1XW8A 3DGBA 4P2QE 2IAMB 2ZF8A 3DYOA 2ZYHA 4TNWK 3AXKA 4M7SA 4JVUA 1S2CA 3FHEA 2JNZA 3UZQA 2J3SA 4GZ7A 3HZMA 3BE1L 3QDAA 4MG4A 4C60A 4Q74A 5HY9A 3OKDA 2OWWA 2Y1HA 2X10A 2QHRL 2DJMA 4KI1A 5KYWB 4PJDA 1G4RA 3UWQA 1NOUA 1AJ7L 3FSZA 4PRBA 4UILH 1O6VA 4OM1H 4GC4A 3F58H 1YG9A 4YSRA 3QZEA 5F96L 2V37A 3JVAA 4MCZB 3QY7A 3SKNB 1JCMP 3FRPG 3D69A 3PP4L 3BKYH 1MJUL 3L1OH 1N18A 4QHNB 4CC1A 2YIHA 4U1HA 3IVTA 3KHDA 4F9PC 5E4EB 3X11B 2GITA 1U6AL 2J88A 2E5DA 3L3HB 5KBLA 4PU2A 3L5AA 3ZKQD 4QHPA 4GYBA 4PCKA 3JV5A 3CC5B 4J6IA 3OR7A 3I6EA 1X1NA 1IIGA 4H25B 1AKJB 3ECVA 4OCRL 1T7ZA 1XG4A 4CVUA 2XBTA 2D2OA 5DR5L 3CEPA 4YE4H 2DW6A 4OCXL 1ETZB 4NO2B 5K4ZA 3CWHA 1GY1A 3DX5A 2OMAA 3MKKA 5JPNA 3ZZLA 2J9ZA 5LVEA 2NQ5A 25C8L 1ZGLM 4FI8A 4GUQA 2QQNH 3KCPB 1A0QH 3AQYA 4PI0A 1PSKH 5TE6L 4D6IA 1J01A 2Z65C 1NWSA 3MKCA 1O7DE 2R9HD 4ZFOL 7FABH 2YR1A 5EV7A 2YZRA 1OTTD 1W56A 3M88A 4AENB 1TA3A 4LL9A 4ESKA 1IJNA 3QI9C 4PN2A 3P0YH 3MO1A 2HK1A 3C8NA 4GUOA 3LYRA 3NIFB 1K4CB 3OKMA 4BQ8A 3FONA 2CDGA 3M86A 1KFWA 4FCAA 5BUGA 2P3EA 3KUMA 4R90L 4FZ8H 5E6IA 5FECB 1YEFL 3NG5A 3K2KA 5D2VA 5LAPA 3MYOA 3AS2A 4PLOB 2YCIX 4Z3TA 5T1KA 4LV9A 1HIMH 4OOUA 3TTEA 4OSUH 4XSMA 1S7QA 4H40A 4PFHA 1WAPA 1MQPA 4F1ZA 4MNMA 1F4XL 4AL8L 3IRPX 1FHLA 4R97C 4KQ4L 3W75A 4HS6A 3BUIA 2FSDA 4HJTA 1X6UA 3HMWH 1S7TB 3PNZA 3WENA 4HD9A 3BCJA 4NZFA 4OJDH 1S8DB 1RCQA 2PI6A 3VWKD 5DWUL 4Z78A 4R5TA 1JJUA 1LD9B 5B3JE 4L05A 2VX6A 2DQCH 4L5FL 2B7PA 4CNTA 4Y4FA 4WDXA 4CC4C 2VISA 2OTPA 3WJLC 3S37L 3QDMB 2ZBTA 4I9MA 1DSFL 1G7LA 2B16A 2P80A 4X5WA 5C6TL 3H70A 2VEPA 4B9YA 3SY0A 2Y36H 3KS0J 2JXMB 2Q86B 2JLPA 1VD6A 3LQZA 2XWBA 4Z7WB 1MNZA 2V5BA 3U2ZA 3GHEL 1YNQA 3F83A 5DLMH 4XIMA 5AL8A 5HI5D 4LASH 4Q7BA 2GOKA 4C4KO 2DBJA 3R58A 5GJNA 4JYFA 5IBTL 1INQB 3H12A 1WEJH 3NQ7A 2F7PA 4M6OL 2XDHA 2WYHA 4DETA 1R7OA 4N8VB 4OAWB 3BSZL 2AC0A 3BICA 1UCBH 1F97A 1A0EA 1YZZA 4F15C 2ICWI 4YXLH 4JO2H 4XNZC 5FYKL 5EC1A 3FZUC 3IWVA 4PMZA 1TMHA 3NA9H 3KXFA 3TJLA 1A5FL 4ELKA 1EXGA 3DSNA 1SSGA 4OLZH 1U8PB 3DFHA 4PGLA 3K2UL 3QUYD 4YTQA 3NIGF 4TXEA 1VAHA 3GIYA 1UQZA 1L9RA 1R9YA 1RH8A 4IMGA 3KGTA 2X6CA 4PGZA 1IIHA 4AQOA 2QIIA 3MLYL 2VXSL 3MAWA 4RAVA 3RAOA 3RTQC 4HZ7A 3D87B 4Q33A 3G1FA 4U0QB 5HGHB 4WZHA 2MTAA 1RERA 3Q6FB 1KIPB 3JV6B 4JG5A 4XR8C 2CERA 1MFDL 5DHYA 3LPGA 3QIWA 3G5YA 4R4ND 4BHUI 5B22A 1R87A 3TO2B 3WQVA 2VLJA 2X8RA 5IB1B 1VB9A 3VX0A 4X9BA 2D7OA 2B39A 3F4NA 4AYGA 3VFNA 4TLKA 4MX7B 1EYEA 5GJTL 3BUQA 1J93A 1DVQA 1AD0A 3BZ4B 2WBWB 1Z9NA 4QTHA 5GRVK 32C2A 4L9XA 5IVXB 3DMMC 4N2HA 4QPEA 5JOFA 1TYRA 4YQXL 2CBJA 4GVGA 4MHHI 5K9DA 5CEYA 2R2EB 4U6VH 3BZFA 5E2VH 1X6LA 5B7EA 1YNPA 3IF1B 4O4VA 3EXSA 5LQBH 3WMSA 3QQ1A 3WKZA 4HZLA 5T26A 1OFAA 1HE7A 1DPMA 4M7KH 3Q8CA 4A7UA 1OX5A 2V17H 3GDTA 3O3EB 1V05A 3IJSA 1SHXA 1J5OL 4WVXA 1SJEB 3DFPA 2DQEL 4YC2B 4WTZG 2HVJB 4PJDE 3SQBB 4OFPA 4WY0F 4D6CA 2XKNA 3N2XA 2OMWA 4PGCA 4X22A 5C9RA 1WOAA 3J8F7 3ZL1A 1GOOA 2QGDA 2JSFA 4LUJA 5TAOA 1YYML 1RZKC 5IM7A 1KLUA 1QFWH 1H41A 1ZLVK 3E2SA 2YSSA 3EUDA 3GC4A 4F92B 2Y7SA 3EOBA 3R18A 5BQDA 1EMTL 4GQZA 3EGSA 5G2HA 2P9RA 4X8CA 1J6OA 4O58L 2J88L 2HS6A 1YC7A 4DVRH 1NDVA 2J1KA 3CFIC 2Z1PA 2M2DA 1BGXL 1M9SA 1REQA 4IS6A 3FTGA 4B6ZA 1VFTA 4NC0B 5KG9B 1NOWA 5CZXD 4AVHA 2O5ZL 4LWWA 3H2MA 4LCUB 3D85A 3O9WB 1ITUA 4K8EA 4LGXA 3SKNA 1XBRA 4AU0A 5H35B 2XZAH 2ZOKB 3R12A 5HMFA 4YHYB 4JFOA 3U7AA 2HFEB 4LAJH 1I1AB 5B1JC 3NPVA 4UTKA 1BEYH 4FFYA 3X11A 3SGUA 1RQBA 3M7SA 2DQHL 2AJXH 4BY3A 4NUWA 3TYGL 4E0RA 3QPXL 4GABA 4LGSB 1NOFA 4AUJA 5FCZA 1OO2A 1ZJIA 3S4TA 3F2CA 35C8H 1HE8A 2RAMA 2Q6WB 4AV5A 3I6TA 2F74B 4YTUA 1INEL 1VRSA 3VUPA 5HYQB 4P8UA 2P48B 4EPDC 4D3CL 2FQDA 4WRLA 4I8YA 3THUA 4F66A 1MAJA 2WYZA 1AFSA 3CIAA 1VESA 2P1YA 4A04A 3O9WD 3S9DB 3C5SA 4DM1A 3MRMB 1ETZA 4NO2A 2E7FA 1U33A 2EEBA 2W07B 3KLSA 3C2OA 2IAND 1P7QD 4GSQA 1CT8A 3MLSH 1I1AD 3B43A 3CZFB 3VIHA 3P73B 5E93A 1HOCB 3KH4A 2WNGA 1IC7H 3HE7A 1BQKA 1E4XI 4MAYA 3PWGA 4PG9A 5E23A 4UT7H 4JHUA 5GRUL 3AUOA 1MFAH 4YBLB 1H3GA 5FC9A 1T8XA 2NX5B 5A3IC 3IFPB 4MA1B 3JVGA 3MCNA 3DXAA 3DV4B 1RY0A 2PGRA 4Y5VC 4UU9B 4MVAA 2J9YA 4WDUA 1J0IA 4MA8L 2QVFB 1TV7A 3E5PA 2ZSVB 4KI5C 1UOKA 4BQ5A 4XK2A 4IBUA 3GK8H 3PGFL 2CYGA 2FJFB 2MRYA 5D7SH 2GTZB 3QNXB 4HNNA 4P23C 4MMWA 3S1VA 5IV2B 1RZIA 3ULSA 4L9LC 4WJ5A 1S7TA 3JBG7 4POCA 3S3SA 3RAJL 4EIUA 4WOZA 4ZUVB 3UJEA 2FH8A 1M1BA 4KJYA 3HVNA 4W89A 1AZCA 2XSAA 4N2DA 1MZHA 3F7KA 2JKPA 4L6DA 3RHGA 2VZUA 4Q9RH 3VFOA 4NNPL 5LG1A 3BVDB 3LEXB 4DPRA 3HC0A 4Y6GA 5IB4A 3ML9A 4Y8DC 3FUEA 1K8CA 1P0BA 2Y8VA 4ORGA 4H7ZA 3KXFE 4AY8A 5DEFB 4Z77A 2GVYA 1WISA 2ZG1A 1QK0A 2G60H 4UTMA 2C91A 3SODB 5K69A 2WWMD 4KRZA 1ILSA 3NIDB 4P2RA 3LRSB 2MTPA 1NANH 4MLSA 3MNDA 3MRNB 3E5BA 2R23A 1TWIA 4JHBA 3KYMA 3WEMA 3BWUC 2PWEA 1SY6A 4UQ9A 1N67A 1UZ6F 1FCVA 4PW9A 3QPQC 2BHFA 5I66B 4L1DA 5CILL 3U6XA 2Y5QA 2VB5A 4Q6XA 3N29A 2B0SH 3LHYA 4UTBA 2CO6B 3SPVA 5TQLA 4JFQB 1X4YA 3H6JA 3BLLA 3GTNA 3HNSH 5CZ0A 3ZE1E 5IFAH 3QUXD 4OQTH 2XQBL 2VLJE 1H50A 1ZSHA 2RFGA 1S4IA 3MUHL 4IIQA 2YD0A 3H4WA 3DI2B 1IC1A 5K9XA 5AOIA 3AGWA 3C6SB 4LSQH 4APQC 2BWDA 4M8QB 4HUVA 4GXPA 1OJXA 2PDMA 4FPSA 1BDYA 4HCIA 1NICA 1F61A 3WYRA 1HQ4A 3LYEA 4WW1B 1XGDA 3QQ3B 4ZXBC 1TQSA 2BNRA 1B2WL 5I17A 4O50A 4ZE4A 3CZ8A 1CUOA 1AGCB 3ILPB 2WJEA 2CESA 2VW6A 1KCUH 4W4OA 1RZFH 3BEWA 2CLLA 1NEZG 2QMKA 4XSLA 1V03A 2GDQA 1H7XA 3AAZB 2RQEA 1SJCA 4UMBA 5RUBA 3WTVA 3NR0A 1O1ZA 3PWPA 4CNOA 5JNYA 2YR3A 3SCMC 2HMID 1XMWA 5AD0B 1NIUA 4OT7A 1MUJB 2QHRH 5IVXA 2AQNA 5F96H 2OMTA 2R9RA 3A3XA 1EJRC 3EGXA 1ZXQA 3KBHE 2YAFA 2J62A 2YBRB 2WZIA 1GH7A 4UOQA 4LKXA 1PG7L 2ZJSL 1W2VA 3VGAC 1U6AH 3BRDA 5KSAC 2HX8A 2V7HB 3H9HB 3MBEA 1F11A 1NFPA 1HP4A 4JN6A 1L0PA 2B2XL 1EXUB 2KKQA 5GSVB 2J8TA 2I7OA 1MHPL 1I2QA 1UB5B 4OCRH 1N8ZB 4S11A 3AJXA 4UNKA 3L2NA 5DR5H 3ARFC 5F1VA 2WZTA 2AK4D 2BWGA 2BNQD 4MLIA 2ZT9C 4OCXH 1ASPA 3M6DA 1KLGB 3F6JA 1TX2A 1IEHA 4NQQA 2BZ7A 1NLBL 3LKRB 4FR6A 25C8H 3ZT6A 4FULA 2F58L 2YFNA 2PWUA 4XODA 1OWRM 1UJQA 4PMFA 5TE6H 3H2QA 4FFYL 3GLCA 4YDKL 2P47B 2FZ9A 3GDKA 3AROA 7A3HA 1ODZA 1GC1L 2X70A 4QHRA 1GTHA 4NIYE 4GUFA 3BLKA 3GS7A 3MI2A 3WMLA 5I2UA 3W1TA 2JIWA 3RPKA 2E56A 2WMIB 2EICA 2AQRA 2ADIA 4FS9A 5G5IA 5CKGA 1V5JA 3KLAA 4Y2DA 4R90H 1MCWM 3LTVA 5I0XA 3MR9A 1PDKB 3V6BR 1T04A 4JX0A 3OG6B 1FL5A 1VFOA 1ZP3A 1JPFB 3BD4A 4HJIA 2FBRA 2VMDA 4OUUA 4Z3IA 5I76B 3S2LA 4AL8H 1O12A 4EXBA 2F74A 3ABZA 4KQ4H 1DFXA 1WA0X 3S6OA 5EC2B 3UAJD 5HYQA 2J79A 1XIEA 1CLOL 1P7KB 2R1MA 3EPMA 5DWUH 1YIXA 4KW2A 4L5FH 3DXAE 3LZQA 2RGLA 2VC2H 4YS4A 3MRMA 3C2YA 4F37K 3S37H 3WJJC 3PFRA 1MEIA 3W9DB 4U1MA 4HLJA 1NEZA 4HCHA 2BP0A 4FALA 2VWEC 5C6TH 3AIRA 2OMZB 2CBOA 1YN7B 4IBZA 1HS6A 4OKVA 3LUTA 3GHEH 4EN3A 2EZ0C 2ERJC 2YUVA 2ADYA 3GXIA 5E8PB 4NYLA 1UUQA 2J8UF 4WO4C 1NOAA 2DT3A 5C55A 4HSAC 3WK1A 1BG9A 3QPKA 4I0CC 1KFAL 2VAAA 3WFEL 1A9EB 3DO3A 4HWZB 5LXGH 4GAGL 4OIIL 1YUHA 5DJ2A 5IBTH 3WJZA 1O95A 2FCBA 3VNLA 3PWUB 1E0VA 3PAZA 1UQYA 4M6OH 4DBSA 1ZIAA 4GAYB 1KJ3L 1TVBB 3BSZH 5AHLA 4WW2F 4W85A 4GG8B 5TDNA 1CENA 2A6KB 3OJMB 1TV8A 3CPLB 4DAGH 5AZ2L 2E9GA 1S3TC 1D6VH 4IZGA 2KYIA 2EDXA 2XTJD 5DS8B 4KXZH 4P2RE 3WN5B 4PW3A 2UWEB 1MW3A 5EIQA 4C1KA 3ZHFA 3MLYH 4ANXA 4X7TA 3WXWH 4UB0L 2G3ZA 1O9VA 3CB3A 3I6RA 2VX4A 2YL9A 3DETD 4WJ8A 4JPIA 3RX4A 1EFXA 3B2VL 4NZ8A 4FHJA 5E4OA 2HKHL 2WSDA 4FP1A 5CGQA 1N2VA 2VIRB 5FDWB 1QT1A 5DT1L 2V69A 4RKAA 4G5DA 3IU4L 2X87A 3G9VA 3FJ6A 2DY2A 3G1VA 2K3HA 5INCA 2AJZA 1MFDH 1PZ2A 4LHUB 1VERA 1CB2A 4X99A 1IE5A 5E51A 2VEIA 3VD5A 3NFSL 1Q6QA 1MHHB 5LNSA 4L4TD 2WVSA 3W5MA 3O81A 3B8TA 1TCDA 5ID0A 1CT5A 4JM2C 4DKEL 1H1NA 4XRCB 5GJTH 4BV1A 2GJRA 2IPKA 1Z5LA 1G7PB 3CHXA 2Z4TA 2BNRE 2YD2A 1Z0MA 4YQXH 5E8EB 5CIPH 5HYSG 2QVTA 4P2QB 2DQ6A 1KRMA 1AK5A 4ZCWA 2JMRA 4ZMWA 3A4FA 3VXNB 1FG9C 2WZPD 5FA4B 1TQUA 3LEYL 1S38A 2OZ0A 4Y96A 3WLBA 3CFKA 4UT9L 5C9UA 5FAJA 1J5OH 3DFQA 5B4MC 4K8HA 1HINL 4X6BA 3PWPE 3BKMH 2PFHA 2DQEH 5HHQA 2MPAL 2ZKWA 1A7PL 4CCZA 3ZO0A 4DEFA 4GKSA 5AW7B 3IXTB 3ULUC 5IVXE 3SOTA 3VXMD 1MDRA 1QACA 4Z18A 1FQ0A 3AIBA 2C19A 1FP9A 3M43A 1DQJA 5F7NC 5KYUB 3V9CA 2C1IA 4HKXA 1YYMH 1CLKA 1K02A 4UR9A 3RX7A 1S1RA 4MWAA 3GAKA 5C6PB 3G6JF 3MRJB 4P2QD 3FF8A 1L6ZA 1DVTA 2WUCH 1G7QA 2PETA 1XDJA 4LL4A 3IVUA 1EMTH 3WKQA 3ATZA 3BLPX 3Q3GB 1AH1A 2VDIA 1B4RA 4IRSA 2GQ9A 5HA7A 4O58H 1FWIC 4FFTA 3LOWA 2J88H 1JPDX 3MREB 3JWDL 3OLGA 2G5BA 3VFLA 5D9NA 3IGHX 4D9QE 1FUNA 1GOGA 1Q6DA 2O5ZH 4ILSA 1S5HA 4ZFCA 5AC7A 3V4UL 3CFCL 5HANA 4DERA 1Q3NA 1WZ1H 3WNKA 2NQZA 2EIJB 3GFZA 1CICA 1H11A 2Z31D 1X1OA 3JV0A 4X8JA 2EXOA 5AOMA 1D5MB 4NB7A 4YDVA 1GTFA 3DBXA 3TYGH 3QPXH 3H9HA 1EGZA 4UXDA 4JRYB 2OQJA 4GACA 2GT9A 2ENYA 2K6WA 2NLIA 3ARDB 4XC3L 1Q6CA 1O6SB 2DZAA 1JZ5A 1INEH 1NCJA 3G5EA 1RLDA 1TU2B 1TE1A 1UB5A 4N2KA 4D3CH 2MMXA 1CGYA 1A3HA 4XNBA 3ZE0F 1BD0A 3O4OB 4IKNA 1DN0A 4O0ZA 1FZMA 3FQTA 2O7SA 1NDGA 3UBPC 5E8NA 3E38A 4FQLL 1V7NL 4IPIA 4U6YB 2G75A 3OZ9H 1Q85A 1TVHA 2A4CA 4G59C 2CLRA 2FYMA 3GO1L 3EOAB 2VC2B 5GRUH 1P1XA 4PCNA 2DYSB 4I3SH 4MTMA 3PZTA 3RWCA 2NY6D 3IV8A 3AW5A 4QRQA 5KZCD 3SKMA 4NQXA 1TZOA 4L3CB 1UCWA 1WBZA 3W7GA 2YEVB 2A77L 1T6WA 3W1QA 2XSKA 1T1YB 4MA8H 5DEGB 5AAPA 3NPXA 3CVHA 4G80B 5GS0L 1TXKA 3OKYA 4QRPD 2APWA 4JTFA 3PGFH 2PE4A 4J5VA 3ARYA 4AGMA 4L0YA 4PH8A 4EP8C 1QAPA 1DZ0A 1FJ1A 2E9JA 3UMNA 2YPLD 4LUIA 1YC8A 4MM1A 3ATDA 3UJRA 4PGBB 2IEPA 2ISSA 5BOOA 3Q45A 1QR1B 3ZWTA 1IILE 5DY2A 3EJZC 1GIGL 1GS7A 4WZ9A 2IWGA 3SYPA 3NOIA 1DVFC 3RAJH 3NN8B 3J07A 4JFYB 4F2TA 4W8LA 1XZWA 1V3LA 2IH3B 4M8RA 4IBWA 4A05A 3RWHB 3RGHA 2K4WA 2DM2A 3PG9A 2C18A 1E7VA 3D06A 1D5XA 1OE1A 5LGXA 5T8IA 1PW3A 2V2WB 3BC9A 2OMZA 1KGCE 3FQRA 4Z7QF 4N0UA 4JTDA 3CHVA 1FHUA 5T33H 4N9BA 3SIKA 5ACZA 4NPYA 4E5TA 2G3MA 4NZCA 2OYMA 3R1GH 1NCBL 4ZD3L 3KNBA 3RWEB 2DLEA 3IPBA 2JKEA 4DBUA 4KJQC 1DJWA 5EOCL 4UDTB 2GVGA 4DJMA 2AXGA 3PWUA 5CILH 2PGWA 2W0LA 3AXXA 1N19A 3EJPA 1FWRA 3WBYA 5F7HA 3UYIA 1A6VL 3TYZA 4OVUA 3VFRB 2EABA 1Z8AA 2DTSA 2DM4A 1BEXA 4HVBA 1BVNT 3NIDE 4E9LA 3WN5A 4WUKL 1JV2A 1U8JB 5CIPB 1QX1A 3QPYA 2PO6C 3C86A 3FK4A 4D6GA 4OQTA 1OFDA 3OAZH 5EBLA 4KGLA 1DLFL 3THMH 2Z7WA 1ZDQA 1C8QA 4RRPG 4WI0B 3HE6C 4H0HB 3FY1A 5L4JA 2V5SA 3B06A 2ZDSA 1B2WH 3B7YA 4G8EA 4K7PY 4WJG3 3F7QA 5BXPA 4K3JL 1A64A 4ZS6C 3DRQA 1H0GA 3K2IA 2RQ8A 4LHUA 3G3LA 4N4PA 2YQ2A 3GNNA 4U7SA 3A0OA 1H62A 1IU1A 4M4RA 1FNHA 3UZQB 3HZMB 5C0ND 1AGEA 3L2LA 5HY9B 1GYVA 3OKDB 3CNKA 3SO3B 1V3IA 3R79A 2HTKC 4PJDB 5K9QI 1TELA 4LDEB 1UWXH 4XRCA 2BVUA 3FT4A 4PRBB 5KBNC 2XM2A 2ZXAA 4ZMOA 2A7PA 4FRWA 3REVA 2VZSA 4MNKA 5EN2A 1AZ1A 4KK9C 2QCFA 4MJMA 1M3JA 1QU4A 2EVHA 2HK0A 3D69B 5E8EA 2RDUA 3R1ZA 1XYLA 5GZND 1G0YR 3QG7L 4U1HB 4H8PA 1LNUA 5FA4A 4CKVX 2GITB 2VGBA 1ECZA 5CGYC 5FYKU 3GBML 1H1ZA 4JQ1A 5I5MA 2YMXL 3QIBD 4JTTA 3ZVHA 4WCJA 3OR7B 1KT2A 3GGWA 3E7JA 4HWEL 4KGJA 1UACL 3ABKB 2B2XH 2C9UA 3IE4A 3PWNA 1MHPH 3S6DA 2KERA 3I50L 5C8BB 2RJMA 3GTVA 4JYDA 4XAZA 5KBPA 1EUAA 5AW0B 2CCVA 3KL0A 4NJJA 1FHVA 1GS6X 3SBWC 1UOZA 1OBAA 5JPNB 1U21A 3RPTA 3N3MA 3VNIA 4LT9A 3IDYC 5BZDB 2PMQA 2GWGA 2F58H 3TC6A 1F2JA 4M61A 4LIQL 2WWKO 2CLKA 4RLDA 4FFYH 4XXCC 1O60A 4JK0D 1ZAIA 4R3SA 2ZZ5A 2NVDA 2EXWD 3W2DL 3LS4L 5BO1L 2XWXA 3OKMB 5HULA 4Z2GA 3OAUL 4OUEA 5ABTA 3TFKC 5D1XC 5HXMA 3WH8A 2R0ZH 2FECI 3IMSA 5E6IB 4DF0A 1GCFA 3SDDA 5BRBA 4C65A 3QUKA 4ZFOA 5H4ZA 5T1KB 3RP1A 1JR1A 3VQ1C 1S7SA 3E12A 3GBLA 3B9KC 3NQVA 4S1RL 1C8XA 1S7QB 2YW3A 5KVGL 3LQLA 3SJ3A 4FXFA 4U2ZA 3M0IA 5BS0A 4ZODA 4JQAA 4JRYA 4HS6B 3ME0A 3QDGD 3RY5A 5CF3A 1S7XA 3ARDA 3NZUA 2A0LC 3MJWA 4L1GA 4Z78B 2FDMA 2R0KL 3VOHA 3BUYA 1V8EA 4K3GA 2VSCA 2VISB 3TH4T 1RBOB 4Q14A 3ELQA 4P07A 4AZUA 4M48H 5E6ID 1G7LB 2Q3ZA 5REQA 2VDOH 4X5WB 4Q4RA 1UW9A 1UENA 3RO8A 1OAXL 3UCQA 5T1KD 1OWWA 3SY0B 2PGFA 1F8TH 3LQZB 3FU8A 2XWBB 5HBBA 1FWXA 3ZZQA 4IQDA 3I75A 2GJNA 2BCKB 4KKQA 1EF2A 3ALXA 1GR7A 1BD2D 2I9UA 1RL1A 3EHBD 2Q1EA 3O8XC 5T9CE 3L5IA 4S0SD 2CK0L 3UWUA 1D8CA 1FYHB 1ZBVA 1KFAH 4Y4FD 4PJGF 3WFEH 1EZLA 4EE2A 3FCGA 4GAGH 4FFWC 4OIIH 5DJZA 1G0XA 2FNWA 2C7FA 1S2AA 5D70H 4A67A 1RUQL 2PTXA 5EC1B 5IFJA 2P80D 2OODA 2IDQA 1UWQA 1PD1A 5CD5C 1EB3A 2HE8A 4DI8A 3KXFB 2UY2A 2X1PA 4M6AA 4XVJL 3G24A 4ELKB 3DSNB 1CX9A 1YNKH 1JZGA 1RCXB 3IDUA 1KGXA 4N0UE 3N2MA 3V0WL 5FUOL 3KEDA 2L3BA 1NC2A 1U8OB 2DICA 1YAIA 3L08A 4LL1A 1SDDA 4HA3A 4RFNB 4XTRD 4J3UA 4RAVB 3NN8A 3D0LA 1OK0A 4NP9A 3M5XA 1WLHA 4BFOA 1L6XA 3G08A 4PH6A 4HLZG 3B2VH 3SY1A 5JA8B 4QBXA 4PR5A 2HKHH 2WZ5A 4NWTH 2FLRT 3WQEA 5DHYB 3C2SA 3SQOL 3QIWB 3G5YB 1OIOA 3IU4H 3HA0A 5CAYB 2V2WA 2VLJB 4F27A 3S0CA 3RZCA 4TUKL 3EYSL 3WLWC 4UTBH 1CI3M 2XN0A 4Q4OA 4XN5A 3N6HA 2WLHA 3NFSH 3VFNB 1FDLL 2HRLA 4RJEA 4RA3A 3C6LD 5F1SA 3TH3T 1W0WA 1DIOA 2JJUA 1IT8A 5LHEA 1DEEA 4DKEH 4QTHB 32C2B 1HAWA 2YC1B 4DHGA 4K4KA 3QXTA 5JOFB 5DO8A 1BVOA 4RDVA 1YDPA 4QRUA 1IRAY 3BZFB 4H8NA 1JD9A 1IARB 5I1EL 1VS1A 3SGJC 4LSRH 1GJWA 4HZLB 3AQUA 3QIWD 3GZKA 3JUZA 5EU6D 1TMCB 2VLJD 4NN5C 3VFRA 1J5CA 2EINB 4DHLA 1WWAX 3LEYH 1KBJA 2EO7A 4A38A 3GX9A 1WBXA 2HG5A 1E4WL 1HINH 5EY5A 4M43L 2PPFA 3EAUA 2JIXB 1LK3L 5FCUH 1ZBWA 4GYPC 4OE7A 2XKNB 4PGCB 1B30A 1KO0A 3OZLA 2VYRE 4X9FA 1S46A 5I1LB 3B8YA 5IM7B 1SUJA 1KLUB 3K91A 3PPCA 2CITA 4Z3EA 2YSSB 1FDZA 4MLRA 2E4TA 4QXTB 2NY3B 3EOBB 4L9DA 3C09B 3LNPA 2Y3NA 3OC8A 4F1SA 4NZ3A 3LRKA 4MXWL 4DP1X 1FDJA 3OOQA 2VDRL 5CBJA 2WXQA 3EGSB 4BSVA 3EJJX 4AXWA 1YHPA 3GRWL 3NZQA 5IZ7A 3O6KH 3W00A 4DESA 1HJVA 3CVDA 2PSNA 4EVZA 3IGFA 2VC7A 1REQB 4IS6B 3FTGB 1LT7A 1PBGA 3PTDA 5C2BL 2YN3A 4N8CL 3D85B 4INFA 3W1LA 4Z3FA 3DX7A 3EX6A 1IR2A 2WXNA 4O1AA 3U0TA 1WUNT 1MF2L 2BXYA 1WPCA 5DMNA 4JFOB 5I6OA 1SXSA 3EOSA 4WHYH 3V4UH 3UYOD 3CFCH 3I7RA 5AHEA 3GVWA 1DBBL 6PAZA 2IAMD 3V75A 5CJOL 1AQFA 5CGMA 4E0RB 3LB0A 4K15A 1AGDA 2BZDA 2PNDA 5K93A 2GJ6A 2EDYA 2A85A 1RY7B 3CUIA 4YHMH 3L17A 4IJRA 1K3UA 1I1YA 2QFPA 3V0EA 4XAKD 4X42A 4H8WL 4XC3H 1FNSL 4DJED 3KCLA 1GW0A 3C5SB 2ESVA 2QAPA 3DXIA 5F6IC 2VEKA 1CT8B 2X0VA 4N22A 4L3EA 3K8KA 4R7WA 3L3JA 2ICEA 5BZDA 2Y23A 3ERXA 1KEGL 3HE7B 3TVAA 2NWRA 4MAYB 6PTDA 4FQLH 4L4OA 1OFOA 1W1VA 4PG9B 1V7NH 4AGLA 5BS0E 1JPMA 4X5PA 1P9MC 4JRYE 3B5TA 4CU8A 4DP4X 2WW5A 4L64A 2R51A 3GO1H 3TMQA 1K03A 3QSTA 3O4LB 1AKJD 1ZA6A 2VDOB 2QADC 3DXAB 4NILA 2VJXA 3R0NA 3RDJA 1WAWA 3GMPA 3BCFA 3MSPA 3TVMC 5DO2C 3PAOA 4DUVA 3KDMA 4JQXC 4JKWA 2NVAA 5MEPA 4FYTA 4LSUL 2NYYD 2D3VA 5GS0H 1QI4A 1E5AA 1X44A 3CFDA 4GRWF 3MOBH 2QW5A 1PZAA 4Y16C 1BWVA 1RZIB 4Y9NA 1WVZA 3RPIA 3ULSB 3IJ6A 4WJ5B 4L5FE 3ZIYA 2F6XA 1VYSX 1GIGH 1UWUA 4KJYB 3T3PF 4AYEC 1KOAA 2LU4A 4LHQB 2EDWA 5CO1A 2XG4B 4QISA 4NGHL 3VFOB 2W6RA 3M5YA 2VW7A 3CVIL 1RQEA 4RSVA 2GPTA 5HATA 3HC0B 3C5ZA 5IB4B 4WWKC 4FG4A 3RA7L 1P4IL 2CLEA 4ORGB 4ATLA 4LT7A 5I1JL 2OLSA 3PTMA 4Z77B 4DUOA 1I8LA 2DIEA 2BCKA 4E9WA 3LH8A 4P2RB 1KFEA 1U0QA 2CBUA 1NCWL 3OJGA 2C0HA 2XFGB 2R23B 2XHNA 1NDMA 3KYMB 4LPXA 1SU5A 2QGHA 3A5VA 1JL8A 1Q1PA 5D5MA 3EKCA 1NCBH 1Q4WA 3T8VA 4ZD3H 2AAVA 1AOHA 4KOBA 3FRPA 5KVFL 4X4YA 5FYKE 4EUPG 3SPVB 1MFVA 5DMJB 2A9DA 3BIKA 4FG6C 3QDMD 4N85A 4OV9A 3L65A 4M9OA 3CHQA 2RHGA 2HPMA 1NAKH 5J8OA 4HUWA 4P7RA 1PBYA 4MJ6A 4LAOA 4IIQB 4EPBC 3COTA 1A6VH 1KTLA 4JHAL 2CGRL 1U8OA 3GF8A 5HJXA 4O17A 4J4PA 2ZZ4A 1QMLA 4XGZB 4HUVB 3AYSA 3HUJA 1HKKA 4WUKH 4HUNB 2YBVA 3FS2A 3BJLA 3LHWA 1RIHL 4K23H 3CSTA 1IM9A 2QR6A 4GMTL 5F7KC 4KY2A 1HQ4B 1XD0A 2DUZA 2BNRB 1OCOB 5I17B 2JE8A 1KFBA 1XRTA 1H8LA 4AFYA 3SGZA 4G1EA 4PAZA 3NDYA 4LQFL 1YEJL 1EX1A 4YK4C 3DZ1A 1GZHA 3IJQA 1U9KA 1BXXA 3SKJL 3NJ3A 1L9MA 4CN4A 3BEWB 4K3JH 4WSKA 2FJUB 2A6IA 4MNJA 3SOBH 3SZ6A 1NCNA 5FA3A 3B6SA 1AJ2A 4QHLA 3PWPB 5GNZA 3AG3B 5EF0A 5JNYB 4PI2A 3OAWA 4EDWL 2WBJA 3F1QA 2ALAA 2YC1A 3QSRA 1S9VA 3VKCA 1QNSA 3CSGA 3IRZA 5E1QA 4C6NA 5JMRA 1T6VN 5F9JA 2OMTB 1EO7A 3EGXB 3TYDA 2BNRD 2CHNA 2EXSA 1DJNA 4ZMLA 4W93A 2AV1A 4QCFA 1A3LL 4CU6A 4KVCL 3VXPA 4HIHA 4LKXB 4F40A 1ZGLA 4PUNA 3QG7H 3BSHA 3C75A 1LYXA 1K6QH 4PWFA 2ZXWB 4JHWL 5D4YA 1PJ9A 3MBEB 3GBMH 1F11B 2CHRA 2Q76A 1JWSA 3FV9A 5CJXA 3T0EC 4PJEA 4UFMA 1XLJA 2YMXH 2PDGA 1B9BA 1L4IA 2JIXA 1MQKL 1RUPL 3NGJA 3DDFA 5I75B 2DZBA 1QOXA 1SOKA 4MA3A 1VGEL 1LQAA 4PMEA 5D05A 1ZSDA 2R39A 4G6AC 4O28A 5I1LA 4LPUA 3MSRA 4QXTA 3GVRA 2J8OA 2XBDA 3O3BA 3SQRA 4B2DD 4PRAA 3KS0H 1QFEA 5J56B 1ISWA 5FHAH 4ECLA 4NN7B 2GJ6E 2YD5A 1LLWA 4Q52A 1JMXA 5CR8A 3MBED 3EPOA 3QEGL 4L4VB 5CAHA 4LIQH 2TSBA 2X70B 2QCDA 3L1FA 2TPSA 2B7QA 4TVDA 4GQ9H 1XMEB 5TIMA 3LSCA 3VNDA 3VFSA 3W2DH 4LOEA 3LS4H 5BO1H 3TN0C 5HDQL 4D9QD 2ADIB 4FQ2L 5LIXX 5BRZB 3KLAB 3OVQA 5IHZA 1JPEA 4Y2DB 2EDFA 2ESVE 4YDMA 4FMFA 2OEKA 4V2BA 3VA8A 1RVKA 2FE0A 5IG7B 3MR9B 1SMAA 4MYWB 3BSMA 4WK9A 4HIPA 3RVVD 1RUAL 1YMHA 4L3EE 2D3NA 1T04B 5I1IH 2DWTA 1FL5B 2P42B 1T2QL 3TV3L 2V68A 4OUUB 3SE3A 3S88L 4S1RH 1A3ZA 4MKVA 4IFKA 5ADPL 3SQSA 2K7PA 4NG3A 2BY2A 3N40P 1U1HA 2D3LA 2VR3A 5FACA 2R14A 2KUTA 3STEA 1FWJC 4P46B 4ZOBA 1QASA 4NOBA 4LZKA 2R0KH 1DE5A 2DBLL 2G9KA 4M7TA 2G0KA 4M1DL 4MOZA 3UR5A 4MQ7A 1CQKA 4U1MB 1NEZB 1TPWA 3FCPA 3QJXA 2BP0B 3ZHNA 2YB4A 5KJ7E 4WKFA 1XPYA 1L9SA 3WUEA 2XT1B 4JFEA 3L13A 4OKVB 4P0DA 4EN3B 1GXEA 3CVHH 2K1MA 3VUAA 5HOSA 1J5SA 4WWOA 5DGRA 3VABA 3RGBA 2XTKA 4NYLB 2ADJA 3O4LA 4PE8A 4V15A 3SADA 3G8RA 3H55A 4WHBA 2VAAB 4AYDC 3SSZA 5DFAA 3U2JA 1YUHB 5DJ2B 1H1YA 1XH1A 4YVXA 1CTMA 1MCPL 5GQBA 2JKTM 3HG1A 3VG9B 4C6MA 1L5GA 5TDNB 4IP4A 3FLUA 5ESVA 2CRYA 1CD0A 1RUQH 3AYRA 4Z95L 3ZE1F 4AZGA 3T2NL 5GHWL 4XVJH 3U30C 2V5MA 3E8UL 1SBBA 4WTZA 4E8GA 4EN3D 2W0UA 5FUOH 2APSA 2BODX 3IAGC 4JZJC 4OLXL 2DFAA 3HU7A 3NEHA 3BPLC 4X7TB 5DA4A 5J1SC 4HULB 1XGPA 2NX5D 4IHBA 1OVDA 5D5ME 4JPIB 1EFXB 4I13B 2WWNA 4TQHA 5CLZA 1XLEA 4CD5A 1SJVA 3B0UX 2XG4A 3WIFA 1HF6A 3NPSB 3STGA 3UZWA 4XAYA 4JIRA 5INCB 2AJZB 4OVVA 3ZSSA 1TT6A 3HFFA 3B04A 2QEZA 2BOGX 4X99B 2RH9A 2NTFA 4TUKH 1KGCD 4R7VA 4LB4A 2OOGA 3VUSA 3OHXC 2ZOLB 1IVTA 5ID0B 3P3UA 2QV5A 3FSUA 1FDLH 1CTNA 3Q2DA 3HUJE 1OVZA 1XGEA 4C54A 2IPKB 1Z5LB 1ZLDA 4KO6A 1QRNA 2D7QA 3FCTB 2IXVA 2VR2A 1HI6A 4ORIA 5DC2A 1AXTH 5LDSA 2DQTL 3UCDA 1SLWA 2NXIA 3NDYE 2XY1A 4JUSA 1KBGL 3S36X 4ISVB 5I1EH 4RGNE 1S3KL 2V5DA 3MHZA 3TASA 4JG9A 3WLBB 3CFKB 3LDBC 1WRFA 1WF5A 3GYEA 1T1XB 2XWEA 4X6BB 1PTAA 3PWLA 4XGZA 4DKDC 2BC4A 3DX2A 5HHME 5HHQB 1AQKL 3DI0A 2EUXA 1CD9B 3W2UA 4UMAA 4GKSB 3DYPA 3WQFA 1E4WH 2PU0A 5TGBA 4IK7A 4M43H 4AQZA 1O6TA 3VXRA 3Q8BA 1LK3H 1QPKA 2FWUA 3TNOA 2PGEA 1U5HA 1FXPA 1DQJB 4JHOA 2X0YA 3IARA 1E0WA 7REQA 4N2MA 3KVDD 4HKXB 3W7KA 4UT9A 4MWAB 1X4XA 2EH8H 3DHFA 4CDGC 4S1QL 1G7QB 4OCSL 3RU8L 3L7EA 2OSLA 3ARQA 3ZVIA 4WR3A 4MXWH 3ZLQC 2HDJA 2VDRH 4EO5A 1JFHA 1GOXA 3BE1H 4IRSB 3KMDA 4PJEE 1J7VR 3GRWH 2IC2A 1HSAA 1AJ7H 1KB3A 2G5BB 2A83A 2X44D 2VQ1A 3H2EA 4N02A 3V6FA 1NM4A 4WDWA 4G7SB 4UMGA 1S5HB 2XSBA 4D2NA 3HJ0A 3PP4H 5B1AB 3PNRB 1O7VA 3U9WA 2IDFA 1MJUH 1T7WA 1CICB 1ZIBA 3OVUB 4LVOC 4QGTA 2FEEL 2OA9A 3ZR4A 4X8JB 3EYVA 4ATDA 1DBBH 3UNTA 5CJOH 3ZIMA 4YDVB 3DBXB 1WKYA 1UXSA 3QF0A 2OQJB 2GT9B 1DQWA 1XEDA 1TNMA 2TSAA 3U2EA 4I9WE 4XBJA 4JTSA 1ECQA 4H8WH 2BM3A 1R3KA 2VN5A 1FNSH 3E2HB 3SY6A 3NIFF 2BWQA 3L4VA 1MVUA 3GS4A 1SF3A 3RVUD 3WH7A 2ZX5A 1I75A 2QCHA 1DN0B 3GMQA 1FZMB 3FQTB 4R33A 5JORA 1VGKA 1NDGB 5I9QC