4JFTA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor n-desmethyl-4-epi-(+)-codonopsinine
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
438
structure length
438
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords alpha-L-fucosidase
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 162
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jftA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jftA01
5AYIA 5HPOA 2VT0A 5ECUA 3FAXA 1V6XA 4H41A 4M80A 4CKQA 3AMCA 2VCCA 2B31A 2WHKA 1DTUA 2XN2A 3WUFA 4E8CA 5DF0A 3LPGA 2J8FA 5BXPA 2FE0A 5CPTA 3WNPA 3KLKA 3IK2A 2ZICA 5FIPA 1V3HA 2D0HA 1NWTA 2OSWA 3EJPA 2O9PA 1B1YA 2WMKA 4RE2A 1KWKA 4MJ2A 3MSGA 1KGXA 2YL6A 2X09A 3AIRA 2QLYA 5BWFA 2DSWA 1KQZA 5CG0A 3FY1A 3RJYA 2G41A 5IFTA 4PCSA 4P7RA 3WDPP 1CNVA 4AMXA 4CU8A 2XFYA 3WY3A 1BQCA 2DT1A 1GVIA 3AIBA 3VIOA 2GJXB 4V28A 3GXMA 3CZSA 2PC8A 2FH8A 1WDPA 2FGLA 5CXPA 4P8UA 1JDAA 1GOMA 2YDSA 1TUXA 1EGZA 4M1RA 3MS8A 2CYGA 5M03A 1HTYA 1B0IA 4AEEA 3U57A 3BUBA 1OGGA 1E9LA 2ZUVA 1GZJA 3VD9A 3TONA 3DYOA 2XM2A 3IANA 2QV4A 2PWGA 3EJQA 3AMKA 3GNPA 3W37A 4PN2A 5A6SA 3CGTA 2DSVA 1TVNA 3N04A 1WB0A 3K46A 1VEPA 1UD4A 3PZIA 2D0FA 5BXSA 2ZX8A 1MYRA 3W26A 2NT0A 3BH4A 4PTMA 3BVVA 5DT5A 3RILA 5A6BA 1XGZA 1GUVA 3ZOAA 4JHOA 1PIFA 1C7SA 4DUWA 3BLBA 2J7EA 2A3AA 4A3YA 1W32A 3VOCA 2BFGA 1IT0A 4KRTA 4D6FA 1V3LA 5CQ1A 3OIHA 2X2YA 3PZTA 4EK7A 4Z2GA 4ZEPA 1C91A 2CESA 2WW5A 4FNRA 1V0LA 2GJRA 4N42A 5M5DA 5HDRA 1J01A 2EPKX 3BAWA 4PMDA 1E71M 4KGLA 5E6YA 2ZUUA 2G8ZA 1D2KA 4MNMA 5GNXA 3L4YA 1B30A 3WNOA 1NP0A 3DX0A 2CBVA 1E6NA 4J3WA 3U7BA 1K9FA 3BLKA 5E70A 3KZSA 1E6QM 2VTFA 1BYBA 2VRQA 1BGAA 3N18A 3AS3A 4PUEA 1B3ZA 4W89A 5ABFB 5BRPA 3SCNA 5I5RA 2ZUMA 1V3KA 3FXYA 4F79A 3MV11 1KR1A 5A8OA 2BY3A 1CXLA 1LQ0A 5A8MA 1TCMA 2J7BA 1MFUA 4U33A 2EPOA 1LWJA 3MU7A 4V2XA 5JBFA 1H09A 4GQRA 5BYWA 2FGZA 1QBAA 4B3LA 1FP8A 3L4ZA 3OGSA 4U5KA 1QNPA 3UR7A 1QNRA 1CENA 4PYSA 1GORA 4PTXA 2W4XA 4FNPA 2OW7A 3QHOA 3QOKA 2XUCA 5KEZA 2Y24A 1QI5A 4UQCA 3WNMA 1ZBVA 1V6VA 3MUY1 3ZSTA 4J3XA 4XZWA 1OT1A 4LXFA 1UWQA 2XWEA 4KGJA 3N11A 3WQ5A 5A2CA 1UD3A 4DUXA 4FLQA 1D3CA 4IPNB 1ISYA 2OW6A 3OLDA 3N17A 1MXDA 1PZ3A 3BCDA 1AVAA 3KEHA 3DHUA 1CGWA 3AS2A 1W1PA 3CLWA 3GDBA 1VIWA 3MV01 4XZBA 2E3ZA 3OZOA 1W3HA 1E4LA 1LL4A 4RE3A 2VX6A 3AZRA 4C7GA 1VBUA 1A3HA 4PTVA 4AD3A 4W8AA 4PMRA 3D51A 1LG1A 2AMGA 2VZTA 3TA9A 2ZE0A 2CBUA 1PX3A 3VIMA 3VNZA 3AMDA 4JL1A 3QHMA 3GXDA 3BCFA 2VO5A 3ZT7A 1RD6A 5BRQA 1GHRA 2VQUA 3PTKA 1QHPA 1W2VA 3AZTA 1O7AA 4Z2IA 1UWSA 1TFVA 1GONA 1ZBWA 5CSYA 4WIWA 2F18A 3KL3A 2F8QA 4UFMA 1V0KA 4D6CA 3WQWA 1QWUA 3RM9A 3DC0A 2ZUNA 1XH0A 4AW7A 2VX5A 2VCBA 4TVCA 1KWGA 4D1JA 3GH4A 1QX1A 3ZMRA 3S2CA 4X0VA 3ALFA 4B3KA 4UQEA 1FH9A 1NH6A 3VNYA 2DSKA 4H2CA 3SURA 1V02E 3WD1A 4DWSB 2EACA 1XH1A 1G5AA 5E9AA 3LXBA 1XC6A 2AOSA 2BY0A 3PTMA 3KLLA 2VQTA 2WC3A 1TVPA 4GZJA 4YHGA 1JZ2A 4UZUA 2JF7A 3N13A 1SFSA 4UFLA 4LYPA 1R7AA 2WZHA 2XTKA 1EOKA 3CO4A 3WY2A 1JFHA 2BY1A 1FA2A 1NQ6A 1C7TA 2XPKA 3TTSA 1E15A 4EAMA 2WBKA 5JUVA 4AZHA 2W92A 2WK2A 3TOPA 1GW1A 2J74A 3AJ7A 1JAEA 1XYZA 2D73A 3DX2A 4PSPA 4S3KA 1HKMA 1Q6GA 4E8DA 4HZ8A 3EDDA 4RE4A 3AYSA 1TQUA 4GI8A 1UG6A 4QLLA 4CVWA 2CXGA 5I78A 4MNLA 5DMYA 1GNXA 2CIPA 2WMGA 4PRWA 3WQ8A 4W84A 1MQRA 1WKYA 1TA3A 3VIGA 1TE1A 4HZ7A 3CMGA 4ATWA 3AMGA 3HG5A 3VD4A 4PEEA 2Y8KA 2EEXA 4BQ4A 2A3CA 2X8RA 3AICA 1Q6DA 1NARA 4CU6A 1AMYA 4F9JA 4GI6A 4CCEA 2DT2A 2VRJA 1OGSA 3GNOA 3ARVA 2YL5A 1W3KA 3MUIA 2X0YA 1H0IA 2G3NA 3AHXA 1DWIM 1J0JA 2CKSA 1VFFA 4J28A 2XVGA 2BHYA 3AIUA 2XM1A 3GXIA 2F1AA 4UQAA 3CHEA 3GBDA 4AC1X 4FNQA 2CETA 2WZEA 4BCEA 3TP4A 3U5YA 2Z1KA 2A3EA 4V27A 2OSXA 3HMCA 1DWJM 1K9TA 4Z2HA 3CC1A 8A3HA 1E70M 5A69A 1G9HA 4W86A 2WHJA 2CERA 4LPCA 3ZJ8A 1EDGA 1CYGA 1V3JA 2F7RA 1C90A 2OWCA 1ZJAA 1W1YA 3H55A 1KCLA 1XYFA 3WH5A 3QOMA 5C70A 1HNYA 4J27A 7A3HA 1KGWA 2J7FA 2YL8A 3RM4A 2V38A 1QVBA 5BXRA 4Y7EA 2WCSA 1ZU8A 4D6GA 1W3LA 1OWQA 2VUYA 5IXEA 1VRXA 1UOKA 2D3LA 1HXKA 4UQDA 3ARXA 4RL3A 2J7HA 2O92A 1JZ3A 4JIEA 2QHAA 2C7FA 1BYAA 3BVUA 1E4MM 1QI3A 4UOJA 1KXVA 1G01A 3VM5A 3IAQA 2BVTA 2O9OA 4WLCA 3APGA 3MO4A 5C8BB 3S5YA 3UG3A 3UERA 2ZWYA 3VVGA 4GO9A 2OYLA 1EIBA 3WD0A 1WO2A 4YN5A 3BMVA 3B8SA 1L0PA 3II1A 3SUSA 4X9YA 2D24A 2PI6A 1VBRA 3VIJA 4P7QA 2PWEA 4UFHA 4GZIA 4Q22A 3VD5A 1PZ2A 4XUYA 4M81A 4KWUA 3DECA 2IXUA 3N1AA 1HKKA 2ZX7A 3IJ8A 5FD0A 1V6UA 3F5JA 4LYRA 1HWWA 3DX3A 2WCGA 1SYTA 4OUEA 1VF8A 4GQQA 1HJWA 3BUPA 4D71A 3NCOA 5M3WA 3A4WA 1UWIA 2Q8XA 5HBFA 4AD1A 3AMLA 4AWEA 4HA3A 1QNSA 4B9YA 4HA4A 3WQ6A 2D2OA 4HMEA 4BQ5A 4TVUA 4FF5A 2WLYA 1MW1A 2J7GA 1JL8A 3WF2A 2VX4A 1LWHA 3VDCA 4L4PA 3WEOA 3VGEA 3POCA 3K1DA 3FHAA 4GKLA 4GI9A 3WDIA 2PBGA 7CGTA 4N0RA 1EH9A 1LLOA 3AYRA 5IHRA 2YDQA 4FLOA 1HVXA 1K9EA 2ZUWA 7TAAA 2WSKA 1PEZA 3BXWA 1MW2A 1EO5A 2CKRA 2XFFA 2OYMA 3SEPA 3T08A 1ZB5A 3NSXA 3VUPA 3F5KA 1CGTA 2D0GA 1E56A 4FNSA 2YBTA 4M8UA 3QR3A 5A8NA 4C7FA 3CZ8A 2PWHA 4TOQA 3ARWA 3ZR6A 1M04A 1BVNP 3QHNA 2PWDA 1LL7A 2XG9A 2BVDA 3MI6A 2CPUA 3BSGA 3SUVA 4DO4A 2HISA 4OBRA 3MMDA 1PX4A 4BA0A 1UR1A 4PMNA 2XYLA 3W82A 4MNJA 1US3A 1UASA 1UR8A 4H04A 1GJUA 1UA3A 4HMDA 4NRRA 5D9PA 1WZLA 5EFDA 5A1AA 5FKYA 2C0HA 1ODZA 1C3FA 2JIWA 3T0DA 1E6PA 3W6LA 3GXNA 3RPMA 3HG4A 2JFEX 3ARRA 1UZ4A 4CD7A 2WYSA 1UR9A 3BAYA 1J12A 4AMWA 3WBEA 4QLJA 2WMFA 4XB3A 1XHGA 1CEOA 4NZJA 2J78A 1TQTA 3WL1A 2GK1B 4D1IA 1WP6A 1V3MA 3HG2A 1JDDA 3ZT6A 1J9YA 5IDIA 1HJSA 3ZQ9A 3VX0A 1QI4A 3CUHA 1KXQA 1FP9A 5LYRA 3VPLA 3WH7A 1JZ8A 3BVTA 1KB3A 3RDKA 4MB3A 5BCAA 4QP0A 2FHCA 2VC9A 1R85A 4CCDA 1X1NA 2UY2A 4P7LA 3CV5A 3WF0A 3GXTA 4TX6A 1ZJBA 4MAVA 3WNKA 4P8XA 3MMUA 1E40A 6CGTA 1CBGA 3PZQA 2UY5A 3W6MA 1GHSA 4JAWA 5I0DA 4C7DA 3TTQA 4AY1A 4WKAA 4QAWA 3OA5A 1W91A 1M53A 2F61A 1KCKA 4W8LA 3AIQA 2ZUTA 3KL5A 2XWDA 2QMJA 1O7DC 2VZOA 3WSUA 2V5CA 4ACYA 1VJZA 3ZJ7A 1LF1A 4HPHA 1QI0A 1ZBKA 2NT1A 1ISZA 3L4WA 4CN4A 5D9MA 5A2AA 4MB1A 3CZNA 3D4YA 3ZSSA 1HL8A 3WUBA 3OZPA 1RPKA 4WF7A 3CZKA 3WDQA 1GOOA 2E40A 4CD4A 4DO5A 5GQBA 1FFRA 2VX7A 1UWUA 3AHZA 3MANA 3OLGA 4JHZA 1UR0A 1LL6A 1JXJA 1C8YA 1Q6EA 2ZXDA 3EDEA 2FHBA 4AISA 1GOWA 1UH3A 4QLKA 1JYNA 4AZIA 5DT7A 2VI0A 5DO8A 3W38A 3BSHA 1LJYA 2DH3A 2WC7A 2WVVB 1O6IA 1UQYA 4MJ4A 2IUZA 2GDUA 3L4UA 1JF6A 5C71A 4CGTA 3VD3A 4W7UA 1E0WA 2XVKA 1E6ZA 2VOTA 3MUZ1 3AXHA 4R27A 1JZ7A 2UY4A 4UNIA 3O9NA 2GDVA 3ZT5A 4LQ1A 4A4AA 2Y8VA 4NZFA 4MNKA 4B15A 4BZYA 3NDYA 3WUGA 2X05A 2D22A 1IV8A 4W85A 5CLTA 4XV0A 4BF7A 2F7QA 4HMCA 1E5NA 2VZSA 3OG2A 1TMQA 2G4FA 1TQVA 4PMUA 3CTTA 3K4AA 4W7WA 4OOZA 1M01A 4U2ZA 3UCQA 1R75A 1BPLB 4X0NA 4EKJA 2UWFA 4KMQA 3SUUA 1JZ5A 3WFZA 5E0CA 1EXPA 2J7CA 5GPRA 4KH2A 5A8QA 5HXMA 4JFSA 3ZM8A 1X6NA 3EDKA 4MAZA 2WC4A 4PMVA 3W27A 2GJXA 1E4NA 4PTWA 3L2LA 3RM8A 4AD5A 4J3UA 3VMPA 3L4VA 3I3BA 4QCEA 3G6LA 3NJ3A 5ABHA 1H0GA 3ARTA 3WF3A 2A3HA 3ARUA 3CMJA 4B16A 1R34A 3AS0A 4W5ZA 3GBEA 4A3HA 2BHUA 2WANA 1YHTA 2VCAA 4U31A 3KWXA 5DFAA 1R47A 4UQBA 2IGTA 4NXSA 3VILA 2OYKA 1RH9A 3LX9A 4J7RA 1B2YA 4OBSA 3FW6A 3T2PA 4ZENA 4OOUA 3SCOA 2X2IA 1W9UA 1UH4A 1TA3B 2XGBA 5AYBA 1E1FA 1ZS2A 1NWRA 2JALA 2NW0A 4GINA 3GXFA 3MUAA 3PZMA 4JKLA 4BS0A 3T2QA 3S6TA 4U2YA 5A6BD 1EA9C 1JYXA 4H8VA 3CUGA 3WH9A 1XH2A 1WZKA 4JKMA 3K8MA 5A95A 2Y2WA 1CGVA 1J18A 1H1NA 2ZOXA 1DEDA 1HL9A 1QPKA 1S46A 4M24A 5HNNA 6A3HA 1WDSA 1H41A 3I3EA 3T0AA 3ECQA 2VNCA 3AHTA 5ABGA 4NF7A 2WZIA 4ACZB 2J62A 3SUTA 2YIHA 3L2MA 2BXZA 1IZKA 2W66A 3CZLA 1J0YA 3WKZA 2FYVA 4H8HA 1HJXA 4PBGA 4F66A 3HU7A 2D23A 1WAWA 4W5UA 1M7XA 1K9DA 3GH5A 3O2LA 5ABFA 3DDGA 1OBAA 1E0XA 1KGUA 1DWFM 1R86A 3W4RA 2V3DA 4Z2JA 4PMOA 6TAAA 5HPCA 1SZNA 1LG2A 3BGAA 4P8WA 4JCMA 1V0MA 4WKHA 4ZE4A 5IHSA 3PN8A 3AFBA 5ABEA 1HKJA 3ZJ6A 2X1IA 3GZAA 1BG9A 3OLEA 4P7OA 2JEQA 4PCTA 1XSIA 1OM0A 1C92A 4PMXA 3B9AA 1UD2A 3VKKA 2WB5A 1CIUA 2G3IA 1W3JA 3M07A 2JE8A 3SUWA 4CU7A 4HTYA 1BTCA 1XV8A 3WL0A 1VENA 4UTFA 1BLIA 1GOQA 1BYDA 2DH2A 2JF6A 4L4OA 4AD0A 3FAWA 1E1EA 4ML4A 1HT6A 1KFWA 3EYPA 3WELA 5BROA 1UR2A 3ARZA 3AHVA 2FH6A 1BVZA 5A3HA 2V5DA 1H2JA 2VRKA 3NDZA 1TZ7A 1SR0A 3FHQA 2YLAA 1U2YA 1EQCA 1CTNA 3AIEA 3WF4A 4PUDA 2F7PA 4PSRA 1E6XM 3T2OA 2YOCA 3A21A 4F9DA 3BUDA 4GZEA 3LRMA 4DWSC 3WDRA 3VGDA 3LPPA 1OCQA 2F2HA 1Z32X 2YBUA 2XVLA 2XJ7A 1CXKA 3H53A 1MXGA 3RIKA 2XIBA 2CNCA 3AISA 4H7VA 3SCTA 1JXKA 4FLRA 3PZ9A 3J7HA 2GVYA 2DPEA 2PWFA 1AQ0A 1JGIA 5FCZA 1H5VA 3VGBA 2YL9A 5EFFA 3IAPA 1NOWA 3MSDA 2WSPA 2DIJA 3FN9A 3CZJA 4QFUA 3LPOA 3LPFA 2EBNA 1EOMA 3VSUA 2Z1SA 1JNDA 4FK9A 1NOFA 3CUJA 1JI1A 5A6LA 2BV9A 3CHCA 2CBJA 1CLXA 4HU8A 4NSBA 2XSAA 1HP5A 2WPGA 2VL4A 3NSNA 4QCFA 5AY7A 2ZIDA 2EJ1A 1C8XA 2WWCA 4IPLA 1WZAA 1ISVA 1ISWA 1ZBCA 2DSZA 5EMYA 3NUKA 4HOXA 3KE0A 2DT0A 1JYVA 1RP8A 1J0ZA 4JFUA 2XFRA 4EANA 2DIEA 2XIIA 4AYGA 2A3BA 3TTOA 3ARQA 3ZO9A 2XSBA 3EBVA 2GJPA 5FL1A 1BFNA 1KXHA 2BXYA 5LA0A 3UG4A 2E8ZA 3VGHA 1UH2A 1R7OA 2G3JA 1JAKA 5LA1A 3VM7A 1WE5A 4AYSA 4FNTA 5FL0A 2VR4A 3AIVA 2J47A 4UOZA 2EXOA 3WD4A 3EJTA 1QNQA 1W9BM 3N9KA 3VINA 1SMDA 3AXIA 1VFMA 3ARYA 4HZ6A 2EADA 1J0HA 3NIYA 3EDFA 5JBDA 4UFIA 4CD8A 3THCA 3HG3A 3VMNA 4JZ5A 2DGAA 4CN6A 1EDQA 2O9RA 4TVDA 3BLPX 1TQWA 3OBAA 1FFQA 3NYDA 4D6JA 3LRLA 1HJUA 5I24A 1FHLA 1OSEA 2TAAA 3WD2A 1OIFA 2DEPA 4OZOA 2PB1A 4DM2A 3VSVA 5IFPA 1TQSA 1EHNA 3T0BA 4AZGA 1CXHA 1WDQA 4GO8A 4IM4A 1G0CA 4NI3A 3OLIA 5CPQA 4CVUA 1ITCA 3A5VA 3WH8A 1B3XA 4D6EA 1NWUA 2W63A 3U7VA 1AQMA 2J7DA 4NZCA 4P8VA 3G6MA 1Y7VA 3WBAA 1VAHA 4FNUA 2XN1A 1C93A 1XCXA 2EABA 3VIIA 5JBEA 2WVTA 3WQ4A 1MVYA 2CEQA 2WMIA 2WMHA 1I1WA 2E9BA 3CBWA 3VU2A 4P7NA 4ZXOA 3EDJA 3BAKA 3VIKA 4B9ZA 4CCCA 4J3VA 3EMQA 1OB0A 4IUGA 3O6AA 4DM1A 4M29A 1L8NA 2BHZA 4AZCA 4PMYA 4W87A 3A22A 3W29A 1JFXA 1HIZA 1HN1A 2X2HA 2WBGA 1KTCA 3OGRA 1T0OA 1V08A 1GCYA 2YDRA 1PIGA 3WD3A 5EBAA 2WHMA 5I6SA 3HJEA 3WF1A 1QBBA 3CH9A 5E1QA 5DEZA 4U3CA 5CJ5A 1I75A 2C8NA 4MADA 1CXFA 3WMBA 5HOSA 3OB8A 1VEMA 2IXVA 5AC4A 3K8LA 2X0HA 1HJQA 1MW3A 1V3IA 1D7FA 1N82A 3PZUA 3SCPA 4WSJA 4OGZA 2ZX5A 2RGLA 4MB5A 3VGGA 3CUIA 3SIMA 4DO6A 5JIWA 1QI2A 3BUQA 1VEOA 3VMOA 3CUFA 4CN1A 3UEQA 3ZJKA 4WKFA 1E55A 3AI0A 2XHYA 3BVXA 3WUEA 2WVUA 1E6SM 1UUQA 4YHEA 1KBKA 1H11A 4AIUA 4MPKA 2CCRA 2FHFA 4GPNA 3AROA 1V02A 2ZX9A 2XVPA 5A2BA 3SCQA 2GFTA 1J0KA 3LXAA 4LYQA 2ZXQA 1KQYA 2YKKA 2G3MA 2YJQA 4F8XA 1WZMA 4NX0A 1UR4A 2WHLA 3KL0A 3K8KA 5D8ZA 3UG5A 5D9NA 1ESWA 1IZJA 2E4TA 2JIEA 2VVNA 1MWOA 1OINA 1P6WA 1XSKA 1CLVA 4Z2KA 1UKQA 4UOQA 4PMQA 3BAXA 2JEPA 3D50A 4CD6A 5TD4A 5FOOA 1CZ1A 2WWDA 3W81A 1E73M 1V03A 1PS3A 5I23A 2DT3A 2E0PA 4WSKA 3GNRA 2X2JA 1C8QA 1JD9A 4JFVA 2W5FA 2W67A 3SCVA 4ZXLA 3A4XA 2NSXA 3IGUA 1E0VA 4HP5A 3WDHA 3U5UA 2WKGA 2GK1A 2BVYA 1U30A 3DDFA 2E9LA 2WMJA 1VB9A 1UYQA 4XX6A 1HKIA 3UR8A 3JUGA 1DHKA 2WM0A 2VVSA 1TR1A 1XD0A 3TTYA 3PZVA 1GQIA 3VGFA 8CGTA 1VJSA 1F4AA 2EPNA 3VIPA 4M56A 3BUIA 1JIBA 3WFLA 3TV8A 2EQDA 2WVSA 3WY4A 2ESCA 3SCSA 4AZ6A 1E72M 3D4ZA 1JYWA 4BQ2A 2WAGA 4AZ5A 2W61A 1MFVA 4UCFA 4Q7NA 5D8WA 3K4DA 2E8YA 3RCNA 4UZSA 2VJXA 4EE9A 1JG9A 1FHDA 1Q4NX 1ECEA 3SCUA 1FH7A 1JD7A 1JNEA 3BC9A 1UWRA 2OLHA 1GQKA 3VO0A 4AMCA 1R8LA 1FH8A 4YPJA 1EDTA 1B3WA 3EJUA 4E2OA 3THDA 1PAMA 1UWTA 1NWSA 1GPFA 3LXCA 4JKKA 3WIJA 1GJWA 4D6IA 1R33A 1UA7A 2CHOA 3POHA 1OGBA 1JZ4A 2QPSA 3WY1A 1TG7A 3IJ9A 1ZL1A 3N12A 1OD0A 1K6AA 3GXPA 1WPCA 1R46A 4JFTA 3CZGA 1B3YA 2W62A 4Z2LA 1B31A 1CGYA 4QDMA 3ZR5A 2YA2A 1I1XA 5GNYA 1CECA 3VIFA 2GSJA 1FOBA 3A4AA 1MQPA 1UKSA 5E0FA 1MQQA 5A6AA 2YA0A 1V0NA 3PBGA 1W9DM 2QMKA 1GOKA 1QWNA 3D52A 3DX1A 3RO8A 3SCRA 2PF0A 1EO7A 2WVVA 3QGVA 5I77A 2V3EA 3WNLA 2GUYA 4OIFA 1XCWA 1E6RA 3I3DA 3PTQA 2QPUA 3VDAA 2V3FA 3BAJA 1MW0A 3M7SA 2Y4SA 1W9VA 1HP4A 1G94A 1QW9A 1R87A 2CBIA 2RGMA 3A47A 3H54A 5CZKA 1J10A 3GH7A 3AIWA 2PBOA 3ARPA 4HU0A 5AC5A 3SCWA 5A94A 1BG4A 4M82A 5BXTA 1BYCA 1B90A 1OIMA 3NSMA 3ZIZA 4CD5A 1KBBA 3WH6A 1CGXA 2EPLX 2YFOA 1DWAM 1J0IA 1Q6FA 1W1TA 1BHGA 4AXNA 4FLSA 4J3TA 1GQLA 4E4PA 1WDRA 1OT2A 2UY3A 1WCGA 2EAEA 3VD7A 5GNZA 3WMCA 3PZNA 5CGMA 2CHNA 1QW8A 3AXXA 1F4HA 1H49A 5KZ6A 5E6ZA 3VSTA 3F4VA 2VZVA 2Y5EA 1UQZA 2D1ZA 2O9TA 3VDHA 1G1YA 4HPGA 2ZXBA 2F1BA 4TTUA 3AQUA 2YA1A 2WXDM 3LMYA 1AQHA 2WCAA 1HJVA 4CUCA 2EPMX 3VTRA 1V6WA 1W9PA 3AHYA 4W88A 3A3HA 5EB8A 3GTNA 5D9OA 3DX4A 1E5JA 1CDGA 3N15A 1BAGA 2VURA 3CPUA 4TTGA 2DSUA 1BSIA 3AOFA 1J11A 5M17A 4D72A 1GOIA 1E3ZA 2CITA 3W28A 3HN3A 3W24A 1X6LA 2XGIA 2D20A 1JDCA 3L4XA 3EJSA 2BY2A 4ATDA 4UQ9A 4U5IA 2WKLA 3WEZA 4MDPA 3S5ZA 3IJ7A 4ZE5A 1BF2A 1UZ1A 2OWXA 3T09A 1HXJA 3A6OA 2VZUA 4D6HA 4AZBA 2WLZA 4H8UA 5CLWA 1NP2A 2D3NA 3BVWA 4K68A 1US2A 2ZXAA 3DHPA 4TXEA 5A6JA 1UD5A 1B3VA 5LA2A 5A6KA 2EO7A 2XVNA 3B9DA 2WNWA 2J25A 3GM8A 4MB4A 1HF6A 4ACZA 2F7OA 3W25A 3L4TA 3M6DA 3CZEA 1PBGA 4TX8A 1GVYA 2YLLA 4DWSA 1QHOA 4LGXA 1SMAA 1DWGM 3ARSA 3AS1A 2J8GA 3F5LA 4KRUA 4J3SA 4U3AA 3MKKA 3PZOA 1QOXA 4W8BA 2FDMA 5JIPA 1A47A 3AZSA 5CSUA 4ATLA 2ZX6A 3RMEA 1UHVA 2J75A 4DUVA 1PJ9A 2OSYA 1QHZA 3BMWA 4AD2A 3CHFA 1ODUA 4TUFA 4AZ7A 1KR0A 1UD8A 1UD6A 1XRVA 1UKTA 1NOUA 2J79A 1M03A 2YFNA 1WNOA 4AIEA 4MDOA 4MTVA 2MANA 2J4GA 2AAAA 5A6MA 2BS9A 4JCLA 5CPSA 4AIOA 4UFJA 2DDXA 3PZGA 4NRSA 1BGGA 1PX8A 1HVQA 2WMIB 3MMWA 3D3AA 4AEFA 5I79A 4OJYA 4S3JA 1E4IA 4HA1A 3PHAA 1W9XA 2W91A 2J77A 1EQPA 4GXPA 1PPIA 1JZ6A 1W2PA 1DP0A 3RJXA 3WNNA 3WMSA 1XD1A 4W7VA 2OWWA 4AZCB 3LRKA 3OGVA 5E09A 1E43A 3WEMA 1QNOA 4GIAA 3B9EA 3VDBA 9CGTA 1VFUA 1H4PA 3FNDA 3EJRA 4URIA 1CXIA 3GYCA 3VIHA 4WJXA 3BAIA 3WQVA 1JI2A 3WDJA 3ALGA 1XSJA 4JFWA 4D6DA 4PMZA 5F7UA 1GQJA 1CWYA 3EMCA 2BNJA 4IISA 3HZ3A 4FMVA 1ITXA 3EMZA 3CHDA 3DYMA 1CXEA 1E3XA 3E1F1 3W0KA 3A24A 4ZFMA 4UFKA 4W93A 4LX4A 1V6YA 4AD4A 4HOZA 1UKOA 3DYPA 3UESA 2VR5A 1Q6CA 3UETA 1JF5A 2ZUSA 5CGTA 4UR9A 1B9ZA 2XN0A 4JL2A 4NXKA 1DWHM 1EHAA 3M46A 1W1VA 1CPUA 1UKPA 5D4YA 2ALWA 5A8PA 4WK9A 1HX0A 2E9MA 5I3DA 4BQ3A 1H3GA 2ZWZA 2VMFA 1NM9A 4OKDA 1YQ2A 3CIVA 1OD8A 2HVMA 4R5EA 2V3GA 4HOWA 5I2UA 3D5HA 1RP9A 3VX1A 2DQXA 1KXTA 3W53A 3A23A 1CGUA 3WN6A 4DWSD 3WENA 1VFOA 1ISXA 1KTBA 2QF8A 1U33A
chains in the Genus database with same CATH superfamily
4DLFA 5EBUA 5SWSA 2YEZB 1U58A 3L65A 4GUGA 4X9HA 3WUFA 3M0ZA 2ZQ0A 3UAFA 2D7OA 2FE0A 3V5HB 5CPTA 1OSZB 2PTXA 1NWTA 2CDEA 4FULA 1AYRA 1THFD 1D6EA 1RJPA 2AQQA 4KDVA 2G3XA 1PD0A 2ZXGA 2KZWA 4QDWA 3QO0B 4MWAA 3QH2A 1OAJA 5TAOA 1W1A1 4KJYB 2F54E 3EFFA 2P1YA 2P46B 5EY5A 3MA7B 1JFQH 4OD2B 1GEHA 1U95A 4IXXA 5HHXL 3PGFL 4Z78B 4H1LH 5F6IB 2PC8A 4IPPA 3PY9A 2R14A 2R9HC 3TROA 1OGGA 4S3DA 4G3YL 1IM9A 3I9AA 3Q6GL 1HCFX 3BIKB 3AMKA 2VDML 5EEUA 3W37A 1O95A 4R7VA 5DA0B 4K71B 3G9VA 1HZYA 4QKXB 1MYRA 5AZEH 3HNVH 3LYEA 3BVVA 3GMPB 1KT2B 2Z28A 1XF3B 3BLBA 3ITTA 2OL3A 4RDQG 5FECB 4BF5A 4JG1H 4NQCD 4A2MA 3EOBB 3O6ML 2NYYD 5IBLD 1TJGH 4M8QA 5JYMA 3KXQA 2IANE 4DJDD 2ZC1A 3RU8H 3DK2A 4MNGB 3N4FA 1QK0A 4HG4K 3QSRA 1LLWA 5SWSD 3TN0D 3L3DB 3SDDB 2X4NB 4Y4HD 4XN7A 3MV7B 5GGTA 3EJYC 5GRJL 4JFQB 3RN6A 1LE5A 1KPUA 3DOIA 4Z8FL 2ZUMA 2KPNA 3FXYA 5EMMA 2YAMA 1YPZA 3IFLH 4U33A 2XWBA 1H09A 4XPGL 2XKNA 5BOEA 8FABA 4L4JA 4I89A 2PETA 4MWAD 3N85H 2IWFA 4MA3B 4IK6A 4Y2DC 2OMXB 4NFBA 3ZHDA 4NI8A 4PWEA 4KGJA 3O6LH 3SFWA 1HYSC 2R1YA 3W2KA 3IRZA 4Y16A 4KY1H 2XZQL 1P7KA 1DZBA 3F7VA 3MV9B 1ZD6A 2DP3A 4YHNA 4RZKA 4JNXA 1BDYA 4OI9A 2EEFA 4IBVA 3V5DA 1ZANL 3GDBA 4NP4L 1IM9D 1S9XA 3KWSA 3OZOA 1N18A 4OQTL 4QAIA 2K4AA 2ZOKA 1DDHA 3KPMB 3DGCR 2APVA 2Q76B 4NHUA 2OFQA 3GINA 3MRKA 2QULA 1AW1A 1RIHH 3FU6A 1JCLA 2BW5A 4XIMA 5T5FH 5BRZB 2G9HA 3KL3A 1QWUA 2YAPA 4YTTA 1TRDA 4M03A 3B2VL 5HGDA 4BZ1L 3EF7A 2PW1B 1XC6A 4S3BA 3PS6A 1O1HA 1Z3GH 1XBRA 3R1ZA 4LYPA 4O02A 1NQ6A 3OHIA 4OCLC 2HX7A 1E15A 2Z4GA 2F38A 4E41E 2WK2A 1C9DA 2ERJC 4MXWH 3FLUA 5HY9B 3UJEA 4R96A 6PAZA 3L5LA 2P7TB 2CXGA 2XY1A 5B7YA 5F71A 5G2HA 1T22A 1CIDA 4HSHA 2WHVA 3GMRA 1F6KA 3F7LA 3INOA 2X8RA 2IPJA 3KWUA 4PIRF 4Y16D 2IQ9L 2QJDA 4P05A 1W3KA 3NJFA 4P9ML 1GL4B 1DWIM 2FQDA 1YYLL 5IW1A 3LB6D 4UQAA 4XVJL 1XF2B 5M2FX 1UMLA 4Q74A 2BLEA 2PF8A 4FQQB 3BZDA 4IK7A 5C86A 4HZLB 3CC1A 1KTRL 4X6DB 2AEIT 1C90A 2GVJA 1UB5B 4YC2B 3BUYB 2HQAA 1P1VA 4PUKA 1FVDB 2HTKD 3CT2A 4RAVA 4BI6A 1WTGT 1JK8A 5CAKA 4UQDA 1B57A 2P5EE 5HVGB 4EKXA 2XLLA 1QP1A 2BVTA 3APGA 5I3IA 4WHCA 5DJ2A 3GU9A 4F2BA 2OYLA 3B8SA 1YE4A 2YZ8A 1AR1B 4QYOB 4OKVA 3EWBX 1KFKA 3BKML 4M81A 3FQXA 3EA1A 4HK7A 1XLAA 3MP5A 4LLDB 4PRAA 1X7QB 3LHPH 4AM0A 1OYCA 2ZP0T 3WQ6A 2P3EA 3GO1L 1ZA6A 2IG2H 1XGYL 5F2IA 1VRSA 3L1GA 3SR7A 1IC7L 3POCA 1J6PA 1XF5B 2O6FA 4ZFZA 2ZUWA 1EO5A 4FL4B 4MJIE 1TTQA 2YBTA 3T0TA 3PWLB 2W0UA 4JEQA 1PS9A 5JQIB 2HRPL 3FSZA 3BAEL 1Z48A 3BSGA 1C1EH 2NUTA 3QIBA 4R3SA 4EUPG 2PR4L 2QCEA 3RU8X 4O28A 3T04D 1C3FA 1F8TH 3PWVB 3LNEA 4RNIA 3TCEA 1QRNA 2MTAA 4K73A 4LCIH 4MZIA 2KAUC 4FSAA 3SYAA 4B9KC 2EIZA 3NESA 4NZJA 4QS6A 1ME8A 2Y63A 1JDDA 1QTYT 1XAKA 4U1MB 5AW9B 2COQA 1OFAA 5C3IA 2PDWA 5BCAA 3OKLB 4DN3H 1D7DA 3SBWC 4LVFA 5H91A 1ZSXA 1M3IA 4XMPL 3CC5B 4NN7C 4BM7A 3WF0A 4HC1H 2E27H 2HJFB 1AZZC 3CYJA 2DPKA 3QZAA 3G1FA 3TZVA 4OIIL 2NXYD 4IOFD 4PD4K 2V5CA 4ACYA 2GW5A 3S35L 4CMMA 5I19H 3GDKA 4JY4B 4U3XA 1S78D 4IRSA 2E40A 4CD4A 5I76B 4I77L 3V6OC 3P4MA 5BVJB 4YS1A 1IFRA 4RNRB 1F4XL 2X1OA 1JYNA 4MSWA 1P2CB 3FF8A 4OLUH 2WC7A 1L6YA 4R84A 1TG8A 1Q6LA 1V54B 2OXNA 1R38A 4CGTA 1HILA 1TSRA 3QIBD 3UBXI 4PBWD 4AQAA 2E7BA 4OD1L 4LDOB 5T3XL 3NH7L 4B15A 4I5RA 4B5UA 1E4XL 3GEFA 15C8H 2XZCH 5F6IC 3LZRA 4BF7A 2G4FA 1WOAA 2E67A 2ZZUT 1U8CA 5FJRA 1UWXK 5E2VH 4D9LL 1RLWA 3BD3A 2O72A 2WNZA 3WFZA 3TT1L 3LTYA 5A8QA 5HXMA 1PD6A 1BJ1J 4K71C 4KO6A 4N2KA 2P26A 4RFEB 1FQ9C 3TXAA 3S5OA 5D7JB 4B16A 1K77A 1VF5C 4ZW8A 3UBXB 1TXKA 4GSDH 2BHUA 2QF7A 4M7KL 3HCVA 4NGHL 2GJ6A 4LP5A 4QDGA 3S2NA 2FJGB 2C3XA 3T2PA 5CJQH 3V2AR 4OOUA 3SCOA 1TA3B 2GBAA 3RX7A 5I18L 2V17H 4M62H 5CZXC 4IRSD 3N40F 4P59L 3CSTA 5T1JA 2EH7H 4N2EA 1IGMH 5KJ4A 3LSBA 3X3GH 4XMUA 1MZYA 5FDYA 3K13A 4MMYB 5HDOA 1J18A 1PE1A 4UDTB 4FP8H 4M24A 4WDWA 3PNRB 5SV4A 5FOBB 2WO5A 1N67A 2GIYA 2H0EA 4AVNA 1YYML 4XZLX 3FO0L 3FQTA 4F66A 4TMPA 2PCPB 1M7XA 4JAMB 4N85A 4XOCA 3WHXB 3IJLA 4N5EC 4MXQC 5DHVB 2Z1VA 1P5VA 4WKHA 2B3RA 1JNNH 2W95A 3C8NA 5D7LE 5LGYA 2ADGB 1F3DH 3HPLA 3BQUC 3LEYH 4PBDA 1GGBL 4MBOA 5GZOD 4PCTA 2FZNA 3QV7A 2WB5A 1FRGL 1OKEA 5K9CA 1UWXH 3KVKA 3NCYP 4AZ8B 2YMTA 3Q5OA 3QBTB 1OOWA 3EYPA 5JUEH 4N2AA 1GOXA 3IE9A 3ARGB 1BOGA 1CW2A 3QUML 4ONHA 5HBBA 1T1ZA 3MBEA 1MFCH 3KD4A 4MMZC 3NGJA 2GJ6D 4GZEA 1SYVB 3WDRA 4WI0A 5EBWB 3O15A 4KHTL 3NTYA 1IC5H 1SJHA 1ID2A 3GK0A 2Z3FA 5FEBA 5BOPA 4JRYB 2GVYA 2IV9A 2ICES 4LSSH 4KNTA 3SKNB 1TTRA 4UF7C 5FCZA 4N0CD 3O6FB 3UJTL 3IAPA 4OZHE 4NUQA 1SY6H 3PIQB 1W0VB 1EJ7L 5D7IF 1I8JA 2JVUA 3QG6A 1OC7A 1HWHB 4PJCF 1T1YA 4YDIH 5F7EH 3S96B 2KLSA 5H94B 3GUFA 4MG4A 3GYRA 4JHBA 5IESL 1ISWA 5IB4A 1ZBCA 2W3ZA 3HS0A 4LVAA 5GS0L 2OPCA 3CU1A 1UB6B 5LAPA 1E8XA 1TELA 2FRGP 3F4DA 1QFPA 2P5WE 1R7OA 1D5ZB 5EH1A 4FXFA 3AIVA 2HXUA 4L3CA 3QDGE 3KPPA 1CFNB 3B56A 4EUPA 1Q0XH 3NIYA 2LLGA 1BFTA 3UMTA 4KROC 3NZ8A 1UG9A 4X6CA 5FO8A 2ZG2A 4R9XA 1ONRA 3CQPA 1RI8A 4I18A 1HJUA 3ZPDA 1K6WA 5DCEA 2DEPA 5LDUA 4PRIA 2PB1A 2OKTA 1V7NL 3HBGA 4GO8A 2YQ3A 5CIPB 1A7OL 4D6EA 3I7QA 3JWDL 2CLZA 3CB3A 4JRXB 3T6XA 4GIYA 4NAEA 1YN7A 4FXGA 4Y9FA 2H8PA 2XN1A 1Q90A 3CUZA 5EOCH 1MVYA 5E6ID 4TS6A 1IC4H 3RTQD 1P6FA 3TO4D 3MRIB 1FPTL 4LB3A 3O6AA 3AW5A 4M29A 5FHBH 1N6UA 4ORZC 1DQVA 3A22A 2XFGB 1V08A 4MM1A 5DD0L 2Y7QB 3GFZA 1I75A 5B4MD 5DJYA 2CZEA 1T8XA 3EOAB 4EI5D 3UJIL 5AC4A 3NACH 4ENLA 3BPOB 4FG6D 3C8HA 4JFOA 2DDQH 3VGGA 3CH1B 2G37A 1KCZA 3R4IA 3GHEH 1OM3L 3AI0A 3GMMB 5DS1A 2OEJA 1UUQA 1A3ZA 4G8GB 4GXVH 3ZE0B 3VXUE 3TVMB 5TPWL 2CCRA 2FHFA 4XCYA 1BJ8A 4FC3E 3KGRA 5C0AE 3IN0A 4IP5A 4PPTA 2D2CC 1S3RA 3QULB 3KYMB 3ROOB 5G4HC 4PRID 1Y1DA 1QUNA 1AHMA 5DT1L 4PMQA 3V0UA 3E80A 1IC0A 3EH2A 4LAQH 3TO2A 2W67A 4Y19E 3IGUA 5K9OA 3PUEA 2J6VA 3WLHA 2WKGA 3KR3H 3JT0A 4XZUA 5E2TH 2C19A 5LXVA 2FATH 1QFWM 43C9A 1DHKA 2AFNA 4ZZKA 3DH7A 3NCFB 1F4AA 4XO3A 5IFHL 3GD1C 3GRBA 3TV8A 5HGBB 3HB3B 3N4EA 4YDJA 1A4LA 3S36H 3QVAA 5HDBF 1WUEA 4UDUA 1ADWA 1GIGL 4DZAA 1FH8A 1B3WA 4E2OA 3THDA 4K3DL 3RDJA 3U4EA 1R5YA 5IJKC 4OFDA 3WIJA 3P3TA 4JDEB 5SX5K 3MRLB 3MACL 1E27B 1AHKA 4FI6A 1DO6A 3E6HA 5D71H 3TH4T 2IH9A 1K6AA 1Y0LA 4ZBJA 3L48A 4DEPB 1XYMA 3G77A 1BQLL 3JTSB 3KJ4B 5SWZE 4L8SA 3ZR5A 4XBGB 3GYEA 4MRBA 4H83A 2G96A 4L29B 4WWOA 5C0BA 1UXMA 2JJVA 4APQD 4FQXA 3D52A 2WNNA 4FFYH 5D1XE 1P4LB 2E7DA 3BO8B 3UOAB 2QAPA 5I75C 3VXMA 3L1FA 1NFDB 5EF2A 2OP4L 3IM1A 2VW7A 2WWMC 1QW9A 3Q0HA 4NHCH 5AKTA 3LV3A 4BE5A 2CUAA 1U22A 3GH7A 4HWBA 2PDLA 1VYRA 3FJNA 3RKDC 2WNXA 5A94A 3IGXA 4M82A 4NX5A 1YN6B 1KBBA 5IFAH 3VOGA 1AHWA 4PRPB 1P48A 3WFDH 4F2TA 3QPZA 3MDUA 1NZRA 4MAYB 1LQSR 3AB0C 5ESAA 3VXSE 2VZVA 4B95C 5KMYA 1GYCA 4NASA 4GRMA 3V4PA 3V5CA 1B3JA 5DYFA 2F5AH 4K5OA 4L6OA 4YTRA 5FUOH 2G5BB 5T5NF 3GS7A 2YJLA 1OGAB 1CDGA 3QT2A 1CFQA 4LVGA 5FHAL 5LGHL 4DKDC 3MQIA 3VKBA 3NDYE 5EPDA 2IH3B 3EGDB 5IY5B 1T6WA 2VJ0A 4ATDA 2EDXA 2ENPA 3PBWA 2XKSA 4GY7A 2J43A 1S8DA 1OAXH 3CFBB 3ZJAA 1E2VA 1MH5B 5LA2A 4GP4B 4L4VB 5J6GB 4F58L 3TASA 4C57C 1XIWC 1TJMA 2YGNA 3VXRE 5KSVA 3U2JA 4O2EB 4V15A 1Q6RA 3GG0A 3BG9A 1JN6B 3GIPA 3KPSE 3ARDC 1ND0B 2ON3A 3M0KA 4MA1C 3KCJA 2OCZA 5D09A 1UHVA 4NWTH 1XLJA 2P49B 3GSWB 1G1CA 1KLFA 4OFPA 1XRVA 1ME7A 4L5ZA 1M03A 2YFNA 4QAMB 4HJGA 1Z89A 1KBGL 3D47A 2BINA 4LEOB 3VCLB 1A0EA 3APDA 3JR2A 2YUXA 1FC1A 4OJYA 1F61A 1F97A 2YQ2A 1SEBA 4ERIA 1A3QA 4G7EA 4GIAA 4W9JC 1Y1UA 3VCNA 2IFFH 1HEJC 5T26A 2I5YH 1Q9OA 3G3LA 4WJXA 3BTNA 1BVNT 1BXCA 5KBPA 3V7AG 2PGFA 5KTEH 2KQNA 4GAFB 4QHLB 5F93C 2VDQL 4BWWA 4ELDA 3SGKA 2EYTB 2XV2A 5TDOA 2GIMA 3DYMA 1ZUAX 5JHAA 2VDOB 4UT9A 1IAKB 3X14A 1PLBA 3NQIA 1BWLA 4XX1E 2HSIA 3DYPA 3SDAC 3VWKA 5FJUA 4NXKA 3IXTA 1IF2A 2QDGA 3L9CA 5A8PA 2E9MA 1D2PA 1NM9A 4MDRA 3DHMA 3UWWA 1T2QH 5EZLB 2EH8H 1WGVA 2HKAA 3VX1A 3S6DA 5FKPA 1VFOA 1RZKC 1OAYL 2QF8A 3NDZE 5D7IE 1JUFA 2ENYA 1T5WB 4PJCE 4K7PH 3VNIA 4M1DH 1A6WH 4KZEL 5EUOB 2NX9A 2KPWA 3Q6FA 4G8FB 2V37A 4YSCA 2IBZY 3IK2A 4FX5A 3Q48A 4GG8A 2W9MA 1V3HA 1TU2B 3EAUA 4WUUD 3SGDI 5IJBC 4BXVA 1NIFA 4LF3B 2X9ZA 3WQGA 1KQZA 4XNQA 4YLBA 2B4CL 5B1JA 1OVDA 5TQ2L 3VH8B 4F7EB 3F4CA 1W72H 2VDNL 4UU9A 4MJ6A 3SY5A 3KBJA 3H2CA 1CNVA 3IFPB 2J3SA 3V18A 4BFOA 3OPUA 3TA3A 1MCWW 2Z7ZA 2GJXB 5DZOA 1DFXA 2IH8A 3KYOA 3FDKA 2CDFB 3CZSA 2FGLA 3BN9D 3D39D 1XGPB 5I8KH 2X2UA 4CKVX 3CU7A 1YW1A 2FKPA 5GRZA 4ECLA 2XM2A 2FGBA 3O4LB 3RP1A 3SDOA 3KLAA 3ATBA 1MLBB 3B5GA 3JRKA 5IBUB 1TTBA 2FFIA 2MH4A 1OF2B 3FT4B 3NRPA 3DBPA 3VWKD 1UATA 4G7SB 3BD5A 4N2HA 3TIEB 3H9HA 4M4RA 4I4WA 1W15A 1KLUA 2NTSP 4PJEA 4YAQA 3EADA 3C86A 3CM4A 1OY3B 5J5EA 3QB7C 3UY7A 5J5DA 2GJRA 4RE0A 2PP0A 5LSMA 2ZZ2A 3KWVA 1AKPA 3WNOA 4QHPA 1RMFL 4J3WA 3S42A 2C1OB 2BERA 4BSVA 1J8KA 3R06A 4ADTA 3QKZA 2VRQA 3OR7B 3GI9L 4ZNEA 2B08A 1TCMA 4AV5A 2OTWA 3W1MA 1F4YH 4MVBD 4HKZB 1BD2A 3VC5A 3BESR 5LNWA 5T1LD 3K2KA 3CXDL 1QLRA 3LRSA 1K7XA 3DRQA 2QDHA 2VN7A 3QOKA 4A8IA 1PTZA 2ICCA 5KEZA 3RUGF 3FUDA 1JV5B 1KENL 2FFCA 3IGHX 3GFUA 3B0XA 4OVVA 5C9WA 4PE8A 3AXLA 1MAJA 2AJ3B 1CGWA 4PV8A 5M7QA 3AS2A 4KBPA 3QEZA 5D72L 1I3UA 1AGDA 1DQDL 4JQXC 4PTVA 4W9EC 3NQBA 32C2B 3H9SA 4WJ5B 2XZAL 4A22A 1MN4A 2GIXA 3IGAA 2NNXA 4IL0A 4QMEA 5CSYA 3WQWA 5LNRA 4I88A 3RM9A 1AXSA 4XVTH 1CF1A 3QUZC 2NXIA 2B7DT 1FBIL 2X7VA 1HTIA 4PN6A 3W7KA 2NDGA 5CZVH 3KJ4C 5EN2B 2EVFA 3A9IA 3LXBA 4XH2A 4YHMH 2WC3A 3DV6B 3SAZA 2WZPD 5C0IA 1ZS8A 4L23A 4MX7A 4ZSOB 5CU9A 3BCJA 2IMNA 5HDBE 2J74A 3CVBA 1BD2D 4WEVX 1UWYA 2IC2A 4LOCA 4RZ5A 1K3IA 3WS3B 3EDDA 3C0QA 3UWUA 5LXGH 5K1NA 5T1KB 2R7EB 5H35A 3GMLB 4Z7OB 5DI8B 5ERWB 1FZKA 1QK2A 4Y5YA 3GFXA 4JDYA 1MQRA 2NQ9A 3RVVC 2VEIA 3AMGA 3EPNA 1UQSB 3L9BA 4PJIB 3IJYA 3T4CA 3AYTA 2BNRB 1CICC 3OWEA 2DT2A 4H0GA 2V9TA 5KG9B 2FIQA 3FJLA 3TT3H 4JY9A 4WDXA 2CKSA 1RZGA 1WS7A 4TVPE 3W7RA 1VFLA 5KBLA 1GZ1A 3IETB 1XPYA 3C8FA 3U5YA 2E1WA 4G7RB 4J3OG 3MMTA 5JHBA 2FQEA 4JFYA 3P5ZA 5A69A 1G9HA 4NZUH 3H9SD 4ONOA 2YAOA 4LPCA 1EDGA 2DVUA 4FQJH 3EKZA 1ZJAA 2J1XA 1SLUA 2WKJA 3MWCA 2VDHA 4K7PX 2PU1A 4UWMA 2GSEA 1NDVA 4ODWA 4ZFOL 2QXWA 2Z7YA 2GGIA 5ICZB 4GQBA 2NNFA 1TV3A 3BPWA 4IJBA 1IFHL 3IAQA 4I9TA 3RL1A 1C16A 1IGJB 3UERA 3F7RA 1NEZG 2PP3A 3DRTB 4N24A 4K23H 1L0PA 3ZE1F 4A6YA 1T41A 3W1AA 3KDMA 4I1NB 2VD9A 3VD5A 4PCYA 3QSTA 3F5JA 2VQ1B 4QRSB 2ZPKL 2CKNA 4XNDA 3B0UX 3MLYH 4E8GA 3KVJA 3QQDB 4HA3A 1GYNA 5HJLA 4A39A 4F8TA 3B2UC 4POZC 2HH0L 3N9GL 1ES0A 3WLMA 2Y7NA 25C8L 2J1WA 3VFSA 4GI9A 3TW6A 5I6OA 5ENWB 3K2UH 1YQVH 4TQIA 2Z6JA 3IF1A 3TW9A 4JQIL 4PJGF 1ZB5A 2P8MB 3CN2A 2IOOA 1GSMA 2FO1A 4E3TA 3LNGA 5HYJD 2ZFAA 2ESVB 3BZFB 4PJDF 3IUIA 3IV3A 3SKMA 2BSSB 2HG5A 1KCUH 4JS7A 3Q65A 2E7LC 2IPKB 2JCCA 4H04A 1REIA 2FJSA 3HLAB 2UWEF 1IVLA 5FOJA 1XCQB 3W5MA 4WIQA 2WYSA 4JHWL 1G4TA 3NZ1A 3EHBB 5F0LB 3CCHA 2BMBA 1Z7AA 3OJDB 1GVFA 2B2XH 3L3KB 3L7FA 3UZYA 2YBGA 1TVHB 3EEGA 3P3SA 5CWSA 2BNQA 3OO2A 4HHWA 3Q9QA 1OAZL 4NQSA 3CV5A 1ZJBA 3LERA 1PTGA 1KBLA 6CGTA 3O6KL 3HNSL 4KTEH 3ES8A 1TWIA 1ZLDA 5FSEC 4F3FA 4JN1H 1RPUA 5T33H 2XWDA 3NBNA 1M4KA 3WSUA 4KEVA 1WT5C 1FFNB 2WXHA 1U8HA 2PYFB 4C56B 3F7PC 1F6LL 3MLTA 3Q4DA 4DO5A 4Z7VF 1RERA 1UT1A 3QDJB 2HBVA 2BO0A 5DJAB 3P0VL 1A7QH 2F53B 4LLYA 3T05A 4AISA 3KHOA 2OQLA 3EF4A 1IJ9A 1MHCB 3NURA 1WA1X 4GQ9H 1DBJL 2CAKA 3NWRA 4BKSC 1F6AA 2GFBA 3EZ8A 2XTJB 1SZFA 4ONVA 5C7ZA 3BOVA 4H20H 3CLMA 1CT8A 3K6IA 3PWJA 3CAKA 2A83B 1IL1B 4M8VA 4RZBA 3SN1A 3TLRA 3R1GL 3ZO0A 4V1DA 1TMQA 3F6LA 1TQVA 3GSOA 2WXRA 2VMJA 3CHOA 4KMQA 1I9IH 5CEWA 1P1ZB 4KH2A 1SGKA 1GMIA 3PF2A 3S5LB 5ISZE 1KCXA 3ZVHA 4UIMA 3RPIB 3L4VA 3GUWA 3R0MA 4KT2A 2IMRA 5CBBA 3WKQA 3FYPA 3WLLA 4MASA 5DFAA 3D46A 5I1IH 3CQHA 1X9UA 3R8RA 4RMVA 1WS8A 3FEQA 4PJ5D 3AT8A 3FQNA 5EWIL 1A1NB 5MHSD 3ILPB 3WFAA 4D3CL 3WLRA 1O5PA 3OV6A 5I6KA 1CLOL 3PZMA 4JKLA 3RY6A 1JYXA 4BRJA 3HIZA 3UJFA 1WZKA 3EPOA 2A2QT 1UENA 4C6FA 1E6JL 1HFUA 2XI9A 1VKFA 2FJHB 3CFKA 3ALXA 3ICJA 4JHUA 4WV1B 2NY1D 3QI9A 4AWJC 3I6GB 2D3VA 1TTUA 4L61A 3I6TA 4L8BA 1RZPA 4KZDL 4TNWF 4Y4KC 1TLKA 1M7IB 1KGUA 4IMCA 1ESOA 3HA0A 3E3QC 3MVTA 1B0GB 3QEUB 4PJHB 3P2VA 3PXHA 3ZDYF 5J89A 3ZJ6A 3L3JB 3VYPA 1EX1A 1ECQA 3FSVA 4DP8X 3SIZA 3U9UA 4MYAA 3CZFB 2IOMA 1LRTA 3ITLA 2BP8B 5IFJA 2VGLM 2XQBH 4R26L 3BO9A 1BTCA 4K9EL 1VENA 3C75A 4AD0A 5E2WH 3FAWA 1FWXA 2K6WA 3IDUA 1GHFH 1AP2A 3W3OA 4NDMB 2DI8A 4M1CC 3BHBB 5BMWA 1A1OB 1EFQA 2PXYA 1BVZA 2JQMA 1C29A 1FFPA 3RUGE 3MJ9A 4ZUWA 1U6AH 2YLAA 1WICA 5IW6B 2HJLB 4XIAA 2HJPA 3TBVB 1V6TA 1ZT7A 3A21A 3L3OC 1MZRA 1I2RA 1PYMA 3H4GA 4QCIB 4G9FA 3BI9X 2P28B 2EXYC 2XJ7A 1PZ5A 3U4KA 2B9AA 4H7VA 1NEZA 3SCTA 2J8UF 4UI2A 3O2DH 4XP6L 2NLIA 4QRRE 3PHQA 1H5VA 3VKDA 3PHSA 3RKPA 1T40A 2MKLC 3QNXB 5I0YA 4N0YH 3KPRD 8TIMA 5C2BH 5K3VA 3U7AA 2JTYA 1QEWB 3QI9D 4MKVA 2PLKA 3W9DB 5D2TA 4ELKB 3WSQL 1L3WA 1HP5A 5EO9A 1ID5I 3LTVA 1AOZA 4PI2A 1VFSA 1BEUA 2JJTA 2CZ5A 1XIBA 4C4KO 4IFRA 5DRNB 2JJWA 2GJNA 3Q1EA 4KPHL 4NRXB 3ARQA 5CGYD 3ILDA 5AB1A 5LA0A 3CWOX 3UO8B 3RRXA 1WBZB 2W59A 3QN3A 2EXOA 1U3ZA 3MRGA 2VXTH 4QHUB 4GWEA 2BOLA 3ZWSA 4KEUA 1E5CA 5A6TC 2C9RA 4O1DA 4ZA0A 1UMYA 5G4OA 6XIAA 1YXYA 1Z9OA 2Z4QA 1I8LC 2WZAA 1N2VA 1KFBA 5LQBL 3GUTB 1ZAGA 4PB0H 2VGGA 4NJJA 3L3GA 3G6AA 5ALCL 1CXHA 4BF9A 3T78A 4X5LA 4IM4A 2BSTB 5L7XH 5MEND 3QZLA 1K70A 2Y8UA 1OB1A 4Y4FC 4N8CL 1QSEB 2PNDA 1SVDA 1ZT4A 1C5BL 1EHLL 2PDNA 3U7WH 1DBMH 2NW2B 3ZUCA 4NQCA 4WI3A 2VE6B 4NZ8A 2XN9B 4WFED 4HKPA 3MBXL 4DJDA 5JDJA 1NU5A 3CV1A 4DPQA 1LO2L 2I9TA 4CCCA 4IUGA 3GRGA 2Z8WC 4GXWA 4DM1A 4QR6A 4XRCA 3TN0A 3KDOA 5E9NA 1BQKA 4Y4HA 3EX4A 5DK2B 3GHBL 1JPSL 3AREC 1A0CA 1KM4A 3T42A 3INUL 4C6NA 3CH9A 4DJEC 1IWBA 1WAPA 3ZE1E 2Q3ZA 2FJFB 5IVXA 3IVKB 1N12A 4LQFL 4U6HA 3JVFC 1XH3B 1I7ZB 4AX6A 4F1ZA 3SIMA 2QELA 3S97C 5DFVC 5KOMC 1MUJA 1HQRB 1BZ9A 2WN2A 2FZ3B 1MI5E 1II4E 4CSSA 5D70H 3FFCD 5F89A 4ZXBB 3VXGA 2VUKA 1KBKA 1BLNB 5HHOA 1ZGLM 1NA8A 1PNDA 3NVQA 3SDXF 3C60B 4G6KL 1ZLSH 3VWJD 5HMEA 5GHWL 3V5KA 4N2FA 4PJGE 4OJCA 1DBKL 3OKKB 2CUMA 3T55A 4HUCA 3SY1A 1N7ML 1VDGA 3V6BR 1E7UA 4PJDE 2I56A 4PCNA 3JW7A 3IWPA 1KTDA 3C2VA 1M9SA 2UWEE 3LVTA 1SO3A 2MOGA 2HFFA 4GUFA 3DIFA 1Y0EA 2C26A 1TR1A 3WTUA 1TJ0A 1VJSA 4PGCB 2KT6A 3NIGF 5F1KC 3PE9A 2YZ1A 4ZMLA 4HH9B 3S88L 1RZKH 2ESCA 4ZX4A 4OGYH 2X4RA 3D0AA 2XBTA 2YGQA 5DWUH 1OFBA 1JD7A 3JU2A 4Y8DC 5A16A 1QLFB 4GAGH 5ETUA 3A5FA 2ZCZA 2WZMA 4URKA 1VD6A 1OGBA 1NCNA 3GRWA 1IGFH 3ULUL 1JPGB 1B4KA 1SF5A 3IACA 2CR3A 4JPWH 1MCEA 3W39A 5CIPH 5CINH 4ZS6C 4PWHA 2X42A 5C09E 4GQ0A 4XAYA 5HHOD 2ITEA 1QWNA 3QJRB 3WQCA 3SCRA 4WNJA 3QGVA 1KM3A 3T0XA 1Q1JH 1XCWA 1S2TA 4Z7VE 3MXWH 5HGGS 3QCUH 5E9DE 1A6ZB 1NBCA 3GBMH 3QS3A 1VZIA 7ENLA 3UP1A 3A47A 2BDNH 2E7CA 2F58H 1JCXA 4MFEA 3MJGX 1CB2A 3FGCB 2W60B 2GUOA 1Q6FA 2H3XC 4LAJH 3SFKA 4FLSA 4XO7A 1WDRA 3CFIC 2VABB 1QPOA 1M1XB 5C0NC 4WXZA 2YLKA 3WK0A 3AXXA 4P2RA 4RMTA 4JTFA 5I16B 3M8OL 1YEGL 4HYVA 5DJ8A 1A50A 3VACA 3UZQA 5JHLA 2A21A 2Y3NA 1H6EA 1YCSA 1HJVA 3GM0A 3OVGA 4XVEA 3DETD 5TFSL 4FA8A 1MF2H 3OF6A 1KFEA 2UZXA 1PKQA 4LNCA 7REQB 4LOVA 2B16A 2DB8A 5EUKB 2HFTA 5EOQL 3S5ZA 4ZE5A 1VCVA 2R29H 2VZUA 1R3WA 1QNVA 4OR1A 5BUAA 3DX6B 5GSVB 3GI8L 1G7PB 1NCGA 2QCDA 2WNWA 1V27A 4ZSTA 4G7FA 2BZDA 1UEMA 2EDEA 4TX8A 1EO8H 1D6VL 4DWSA 4OZIE 4LLVB 3VC6A 4CILA 2Y6SD 1Q9LB 3QXAB 1I6NA 2FVMA 1GMEA 2BVQA 4AJ0A 2GZXA 2ZX6A 3QRGH 4JIHA 4QG8A 1QHZA 1SHXA 2HRGA 3WJZA 4WI9A 4BA8A 2WLLA 3MWAA 2V5MA 2MANA 1ZTXE 1H3TA 1S7UB 2C16A 4OIBA 4N9EA 3QQ3B 5DHMC 2XPGB 3LIZA 4S3JA 3G5XB 1XLLA 4PCKA 4L9LC 4WCJA 3WNNA 1AZVA 3KPOB 4ORMA 1T4KB 4P2RD 1M3JA 2JELH 1LP6A 4EXKA 2WUBH 1QU4A 3UT0A 4GRLB 1TPDA 4UTIA 1WWCA 4G11A 4XCNA 1I1RA 2EDBA 4L05A 2NX5B 4HLJA 4FJYA 1G0DA 4M7LH 2CK0H 3CSYA 3WDJA 3S3SA 5F7UA 5REQB 4HFWB 4WHBA 4CSTA 3G3MA 3IDGB 3FPXA 5KBKA 3OF6D 4XC3L 1FWTA 3QUYD 5FF2A 1N4XL 4PGDB 4CNOA 5ESQA 4GUHA 2HROA 3QPXH 3DVGB 4F2UA 5EFIA 1KN2H 4P4KD 2XN0A 4HB7A 2CM5A 4FA6A 3VKCA 1RAMA 4X8JB 3F3HA 1T80A 4I9WE 2DQHH 1RP9A 1CGUA 2CGZA 4DWSD 4OGAD 4QM1A 4YLQT 4NZ1A 4NQEE 1XDMA 5D9SB 5HPOA 4M00A 4JW3A 4FALA 3N1FC 4XD3A 4BFFA 4X6DF 4IRJA 1U2CA 5TGBB 2NUPA 2AK1H 4U1LA 1N8WA 1BIIB 3AITA 3GPEA 3ES6B 4JN8A 3WE1A 2O9PA 3W3BA 4G6AD 1KGXA 1ML0A 4IDJL 3OAZK 3UD6A 4U4BA 2EEAA 4P7RA 5CN2A 1EDHA 5HR7A 2ZCKL 4CU8A 1HXMB 1CQYA 4CRPA 5AHLA 5G1MA 4XNUL 2PTUA 3W57A 3FN3A 1B4JL 1T66C 1OC5A 2CLEA 1V5XA 3MNWB 2H9GB 1BWVA 4J1OA 3U6XS 1EGVA 4MTMA 4XN2A 3QHTC 3WNIA 3DYOA 4XR8C 2PEVA 3ATEA 1RZIB 1DCLA 4E0RA 1TVNA 3K46A 5C0QA 1VEPA 3NQ8A 2D0FA 5C3TA 1WLHA 4M61A 3RPKA 1C7SA 5KW9H 2A3AA 3C12A 3QIUD 1ITBB 4I3SH 1MELA 1IGCH 4HVBA 1XGRB 5CMAA 3PXLA 2B7PA 4G7VH 2EPKX 4ICNA 3IIZA 5B38B 4XCEB 5AW8B 4AGPA 5ADPL 1XI3A 4UNUA 1I3RA 3MJWA 4NJ9H 3CH8A 3L7EB 4IRJD 3KZSA 3VUSA 3HOJA 4JKPH 1LYQA 1EUTA 4Z3JA 2YMOA 5DY2A 5GZOA 1ZJHA 3MV11 1KR1A 3C60C 3L2IA 5EBGA 3MGOA 4LSRL 3L5XL 2A0LC 1UYWL 4L8DA 3U6XA 3SKJH 3B34A 2VDOH 2GQ3A 4YBLB 5CC3A 3OAZH 2XUCA 1Q94A 5A3ID 2XV6B 3USBA 4LXFA 4B50A 3A3WA 4IPNB 4K2UL 1DQMH 3WJJA 2CKBL 4X99B 4WNQA 4F0LA 3HI5H 4W9KC 5IJCC 3IN2A 1EEQA 3R5EA 4XVSH 2F74A 4F2MA 4DCQA 3SDDC 1I1AA 1H8NA 2H8XA 4FOJA 1ACYL 2ZE0A 4PJBA 2DJXA 3QHMA 4MJ5A 2WWOA 2OLDA 4KJQD 2C1GA 4E5XB 3VXQA 4FNLH 1O7AA 3TN6A 4XTDA 4UFMA 1V0KA 1XICA 1MFBH 2J88L 1VIZA 2KMWA 2Y22A 4LNYA 3HV9A 3CIWA 4H8NA 3IJSB 3UGRA 2BJMH 4YWGL 1I8UA 2SEBA 4WGWB 4XAFA 4M6OH 1QMLA 3VA6A 1KM1A 5B7FA 3O0FA 3GLCA 1JFHA 1NCWL 4KKAC 3QJHA 2ZSWB 2V7NB 4XAGA 4G9PA 1N8OE 2ZA2A 1E5AA 4IGBD 2G3ZA 4YLCA 3K72B 4MMXB 2RIKA 4GI8A 3ZRSA 2BIOA 2NCMA 2E9GA 1OAKL 3B3IB 4JTHA 3GZ3A 3V6OE 4HJTA 4BJLA 4HCRL 1HHKA 3SGDH 1WBJA 1IU1A 2Q01A 4PJAA 4RISL 4YHLL 1MNUH 3AICA 2DKMA 3UDWC 3VFOA 3JV4A 1Q6DA 2JMRA 3FQ2A 2X0YA 3BVNB 1EJWC 1W6TA 4LU0A 2WO3B 2QADB 1J93A 3CAVA 4J8RA 5KETA 2B14A 1FV1B 4A67A 3QYSA 1E1CA 2VDKL 3MLUH 2IKIA 2F6XA 4GPVA 3JV6A 2VUOA 1I1AD 2CJUL 4EZKA 5IBXC 3S1UA 1H9VA 1E51A 2PMZA 1HNYA 3RM4A 5IM7B 4M6VA 2WCSA 5E6IA 3RTQA 5AZ2H 2RDXA 4QRPB 3LBMA 3TO4A 3U9PL 3KJ6H 3BOFA 4S1RH 2HKFH 4PRDA 1ZVSB 1H7WA 3ZMEA 4JIEA 4ZUUA 2EDMA 4GKNA 4X7SL 4HCDA 5FA4A 5JQ6H 3V0JA 1H5BA 4C83A 2AEQL 4P5KB 5AHIA 1AR2A 4HHHA 3VVGA 5E99H 5EBLA 2D24A 3E7JA 3MR9A 2F7FA 2W6RA 4EI5A 4Z7IA 4XUYA 4DY1A 5EZOH 1FLRH 4MNGE 3H85A 1NDMB 2KYIA 4W9FC 3FXGA 3NPWA 4JY5H 2NZLA 4AG4H 3A4WA 4AWEA 1FWRA 4WO4D 4BFJA 3MV7E 2D2OA 3OYXA 4YX2L 5ACMA 3BICA 1EAOA 1F73A 4QHNB 2QS8A 4YC2C 4JY8A 4IBLT 4O16A 3AYRA 3S6CA 4Z3IA 3V4VB 1XIIA 2DKSA 2WXFA 2OYMA 2ICEA 5IMKA 4BZ1A 5TNVA 5I1CH 1WXJA 5K9XA 3VUPA 4FNSA 4GT7A 4FFZH 4UV7L 3BZ5A 3GSXB 4WUKH 4OU3A 5I8CB 2XG9A 3AFLA 3TBWA 5BUPA 1BSLA 2EEBA 1MSSA 5KVDL 1T21A 3CASA 1DLHA 4XGZB 4NRRA 1AR1C 1E6PA 3QJTB 4B9GA 5DRCA 4GRLC 4TM9A 4HLZG 1HKVA 2HMID 4EAEA 3X11A 1Q6OA 4QLWA 1QYGH 1GGCH 3ULUD 5E8PB 3QW3A 4XP5L 4UNKA 3NL5A 1V3MA 3MHUA 4EAYA 5TJWK 3IXAB 1FWSA 4UC5A 5FDWB 3BFOA 2BOFX 3W73A 5BRZE 5C9ZA 1TKWB 4XP4L 3PSVA 4QGTA 4FL4C 4UIKH 3KXFB 2VC9A 3JV5A 4Q58C 4DBDA 1RJLA 2G0WA 1LUCB 4PJ8B 3TJHC 5EF0A 1LD9A 4MZ8A 4LSTL 3WKMH 1XYLA 1I7RA 4LLAA 3CPGA 3F4NA 1N64L 2ZUTA 1P0DA 4X6BB 4N0UA 2VM8A 1REQB 1MWAL 4FXJA 3MMEB 1Y6MR 1LF1A 2X4QA 2QVTA 3FNKA 2ED8A 3EO0A 1I4FA 4APQA 2FNBA 4CN4A 3WUBA 1RPKA 4WF7A 1V05A 5AVXB 5GQBA 4YSPA 4ODVH 1GOWA 4ZMNA 1OALA 5DO8A 3L81A 1LJYA 4I0CC 5DDHB 3PB2A 2HUEA 2IUZA 5E00A 3VYOA 1JF6A 3RZCB 5JTWA 4OSUH 1QO5A 2V2XA 2DI9A 1P4BL 4W9TA 3ROLA 1IV8A 1DYZA 2BH0A 3UTQB 2NTFB 2VZSA 3JQOB 1YEEH 4O1EA 3PHOB 5KVFH 2GSIB 1KNOA 4X6DE 4ILSA 4WW2B 4JFXA 4WWNA 3LV6A 1CN4A 3MFGB 1NAKL 5EZIL 3F85A 1COBA 2AQVA 1DBBL 1QR1A 4PHZA 1H0GA 5HJGA 4YEEA 1R34A 4TNWK 3K30A 4W5ZA 3RFZA 1KIRA 1A3RH 1G9MC 1RU9L 1YUHA 4UNLA 1LROA 2Q7NA 4NXSA 2QFRA 1IWAA 3NCMA 3GMNB 1SF3A 5GRXG 2N1KA 2WXLA 2X2IA 4J12A 5AW4B 3UTTA 2JALA 3D87B 3E9UA 4XQ6A 2PTVA 3T2QA 3ZE0F 3ABGA 4PH6A 4XMWA 4Z1YA 3APNA 2EZ0C 2ITFA 3RWHA 2I60H 4TQEL 4HNVA 3MODH 1GS7A 3MJ7A 1H41A 1U8IB 3G0UA 1EL3A 5GS3A 4A38A 3S34H 1OWWA 1J0YA 1EVUA 4N1CA 4HN4A 1QQDB 3SDCB 3Q3GA 4KVNH 5D7JC 4YU1A 5HPCA 1LG2A 4M93B 3FFOA 4IEFA 3PUOA 3ANVA 3RBSA 2JEQA 1XSIA 1J8SA 3QARA 4YHZL 1ZK5A 2JE8A 3WFCL 3VA2C 2YCLB 3SE3A 3HM7A 1RZ8B 4JVPA 3DX9A 3I7SA 2CLLA 4XCCH 1BLIA 1JHLL 3WYRA 3QXVA 2WLNA 4TLTA 2C9QA 2GABA 5D96B 1DJIA 4XE5B 4ZUVA 3PAOA 1KIQB 3SBQA 1H2JA 3BRGC 3NRFA 5IQ7L 3PGCA 1CTNA 5GGRY 1YXDA 1O6TA 1OE2A 1HWGB 5HI5C 4Y5VA 2VFGA 1UIPA 2J27A 4JPGA 5TQLA 3WFBL 5M1TA 4Y7OC 1PG7L 2R39A 2FQIA 3AC0A 5FYJU 3UTTD 3DXAB 2R69L 3KCWA 3HG1B 3UJRA 3L7RA 2B1AH 3KOYA 2CO4A 4DQWA 1RBAA 3RX3A 3GF8A 1Q0EA 4AXWA 1NOWA 3FN9A 3LPOA 1I7TA 2Z1SA 4UMBA 1U8PA 4KVCH 5FKAB 5KWYC 4EIBA 2QCNA 1YYCA 5JOFB 2Q2LA 2WPGA 1NFDF 2VL4A 5EIIG 2IALB 3ARGC 1C8XA 2WWCA 4IPLA 1WUZA 5CFHA 3OPZL 3OWRA 4OCYH 3V6FB 4XE0A 4WUUA 3P7YA 1U8NA 1F5ZA 4JM4H 4ZUTA 4ZTYA 2E9IA 1J0ZA 3MC5A 4F7TB 3PBVA 4XPTL 1INQB 1KEML 5D1ZD 4FOUA 4JPIA 5KYXA 3AUWB 1F90L 4U05A 4LB8A 4PODA 1A3LH 1KFAH 5DJDA 4AF0A 1J0HA 1EUNA 4JCWA 3HGOA 3EDFA 3D39A 2CRIA 2Z0IA 1VGKB 3O6FC 4U10A 5JW5B 4RXFA 1GZQA 5G4NA 2V6HA 3I75A 4D6JA 1JGVH 4FA7B 5T3XD 1XBVA 3U36A 4XBKA 1IIHA 2MUCA 2H41A 5L2KB 1EK3A 4RA0C 5CU5A 4JIIX 2WY3B 1KJ2B 3SD5A 5LKNA 4S3FA 4HSAC 4NQDA 3FB5B 4D8ZA 3GDRA 2HTLD 2FLBT 1RUKH 4J5VA 3FO2B 3FT3B 2YPVL 2WMIA 4ZQOA 1GC1L 3Q13A 4MNQB 2WZ5A 4G6MH 1JZEA 4WU5A 3QUMA 3S36X 2VXSL 1J86A 2DLFH 2O5YL 2BFVH 4JFPA 4RGNB 3WMBA 5T3ZL 1Q7ZA 1RBOB 1NAML 5T1LA 3VI4B 3NYKA 2UXGA 4BFAA 2ARWA 4XHJC 4H0IA 5EIVA 2ZBTA 2WO4A 1EHXA 3B7SA 3TYFB 4I9XA 3V10A 4LCCA 1GAFL 3SJVA 2YD6A 3PNWA 2FD6H 2OZNA 4DNMA 3EWCA 1IZCA 1XF4A 1B0RA 4XBJA 1KELH 3N2BA 3SGEI 3URQA 3P77B 3CFEB 5F88B 1H8SA 2CE6A 4O9HL 4HGWB 3HMWL 3KLHD 1NKRA 2XFWA 2VVNA 2OZ4A 2WXJA 3R2GA 1EEZB 1IE7C 2LU3A 3DC8A 2AK4A 1YIXA 2C9UA 2X2JA 4NQDD 4AVHA 3B4UA 3MLRL 3BPOC 4DF0A 3SD2A 1KC5H 1QEXA 4G6JH 3LBCA 2F0CA 3HE6B 1RZFH 4JRYE 2EG6A 1JIBA 4X4YB 2VW4A 3ITCA 2XWTA 2X70A 3VXNB 4YPGB 1JYWA 3TVMC 2WZPA 4PEKA 5CSZB 4F7CB 5ILTL 3K4DA 3OKDA 4KK6C 4EE9A 1XQLA 3FT9A 2IJ0C 3U0TA 1XYBA 3GTFA 3V16A 5EUOF 1G4EA 1YECL 5HA7A 5KUMA 3FOLB 3AAZA 5ID1B 4Q6IB 3V4BA 1QHQA 1UA7A 2CHOA 3WD5L 3R10A 4GFTB 3G6JB 1UUOA 1KB5A 5DYOB 2NY4B 3GXPA 2W62A 2C7UA 1U93B 4LPWA 2OMBA 1RLBA 5GNYA 2M83A 3SJVD 2ICWB 2F5BL 1MCPH 2HP4A 2AKZA 4XNXH 4HA0A 1XINA 2IXQA 4OVXA 5JLZB 1XGTA 1ILUA 1UROA 4WW2C 1FGNH 4LSUL 1QVOA 3HB3C 1TV8A 1VH7A 1FWIC 5I1DA 1W9VA 1KKRA 1VADB 5GS0D 1VLIA 4C6DA 4CAGA 4ZTEA 1J1OH 2AK4D 3O0RH 2ETWA 3PG9A 3A3YB 2H32A 1UCBL 2ISVA 3QJQB 2IGFH 5AC5A 5F1NB 1IGSA 4NYYA 3FU5A 2JKSA 1B90A 4UQ3A 2WBWB 3CFDA 2DFAA 4DEPC 2Z24A 5EC2B 4JRXE 2GC4C 5K33A 5FYKU 2QQQA 5D2NB 2HRWA 4HPNA 2D1ZA 4MCNA 4YHPB 2PTWA 2ZXBA 4WI8A 1U3HB 1FNFA 5FW8A 2WXDM 3IKCB 2EPMX 3W1XA 1V6WA 3M64A 5ITBH 4S2BA 3GTNA 2O0TA 4E9QA 5IOBA 2DVXA 3AOFA 2FSDA 2I69A 3C3UA 2CRMA 3WG6A 3PDOB 3DOSA 3QC3A 2ZP8A 2YK1H 4HIJB 5TE7H 4HX1A 2GCYA 1AJZA 2Y23A 2WLZA 5EIIA 4FQLL 4K68A 5MEPB 3VXTA 3GLDA 1BYPA 3LEXA 5L4MA 5HYJA 4WAFA 3VOIA 2NLJB 3H42L 3NK4A 3ZE0E 1XTMA 3GSUA 4MAYC 1V5JA 4AQLA 4S1DD 1QHOA 2EILB 2FDBP 4Z08A 4LGPB 4RDYA 4GS7B 4J3SA 3QV8A 3IMBA 3LQZB 1A47A 2AQNA 3KS0H 4NN5B 4GK8A 1HSBA 3HR5B 3LAFA 4XAZA 1MAKA 5A6MA 2AAAA 2BS9A 2VN4A 4KJPD 2YW4A 3HZVA 3GHSA 3V5OA 1FAKT 3R7MA 3D3AA 1QFWH 4A6GA 1W9XA 4E9LA 1DVZA 2JB6A 3ZQXA 4UV4H 2QV5A 4XO9A 2XG4B 2AF2A 5PTDA 4HZMA 5CLZA 3S0PA 1IGYB 8XIAA 4KERA 1UWGH 2EYRA 3EJRA 4JFFE 4H00A 3W9EA 4BH8A 1Q38A 1QPNA 5F9DC 3B9KA 5CEZH 3EB2A 1THAA 5H8UA 2AXJA 4R7XA 3EMCA 1US0A 4CQ9A 3LOWA 1LK3H 1CGSH 1FWWA 2WMPA 4Z7OF 4TSBL 2RBLA 5IIEB 1T96A 1XXXA 4PJIF 3LG3A 5I3DA 3Q2WA 7PAZA 3BT2L 5DEFB 4DHLA 3LV5A 3L5AA 1RA0A 1EZWA 3H3PH 1IBDA 2FZ9A 3VFNB 3DV4B 3RWGB 2PCFA 2AI0L 1S9VB 2P0IA 3GC2A 3OKEA 3SE8L 3HUJB 4MNHA 5J1TC 1EAQA 2A7NA 2NY3D 3C08L 2NXGA 2ZJSL 4ODHH 1UM6H 1N0LA 2AZAA 3HE7D 4RDVA 4UTBA 2WNQA 5DEGA 4MGGA 4DGIH 3WIIL 3MJ6A 2WMKA 4H6RA 4AGQA 2RJGA 3U0HA 3N14A 3E5BA 2AABL 2NY6D 3N0AA 4IIEA 5AKVA 1PY0A 5AC6A 3TNNA 4FI4A 3QFGA 5HI4D 3RVUC 3MRMA 5EULV 4CNPA 4AMXA 4S38A 4PRPE 3GR4A 4Z1AA 3OHMB 1MEXH 2EDDA 3FL7A 4NQVB 3SDYH 5CG7A 3H2EA 2F1EA 3F7YB 1JDAA 2FDSA 1Z5YD 3QEQD 3B9KD 1W0WA 5FF6A 1B0IA 4RR4A 3JUYA 4PJ5A 2Z1PA 3KGTA 1TMHA 2YKLH 1HCYA 3APYA 3TIDB 3GNPA 2DSVA 2UXTA 1PKLA 3HBZA 1OGAE 3D2UB 2ZYHA 2WWKO 2HVJB 5BNKA 1GUVA 1NMAH 5DHXB 3AQXA 2ZTBA 3VVWA 1JXGA 4JJ5B 4XPFL 4GW1B 2ITDB 1ZLPA 5CQ1A 5F6HI 4ALAC 2DEYX 3ATFA 2FTPA 5BUGA 3QDHA 4FNRA 4UMSA 4KRZA 4P5MA 3HURA 3CV6A 5E6YA 4M1BA 1PZUB 3GHUA 3NA9H 5I8EA 3D09A 4L3EA 1KFLA 4YTQA 4LOFA 4TSCL 1MJJA 2VL5B 1P6AB 3QTGA 4DPRA 2E75C 3GJEA 5DZLA 2XQ0A 3EB3A 3ASWA 3HZMA 4ANXA 5MKGA 4LT9A 4C58B 4F8LA 5BQ7A 2JCWA 4AVJA 2DBLL 4JPKH 3VXPA 4OF0A 2HLAA 2H3DA 2YQGA 1YTEA 2Y1ZA 2A4AA 4H44C 4PTXA 1VLXA 2VLJE 4CC1A 2KS0A 2TMDA 3BJSA 3WLNA 1V6VA 5F7NC 3PLYA 1A5NC 1IE5A 1NSNL 1KIPA 3L3IA 3W11D 1WIUA 2VXQL 1P7BA 4HSQA 1CB4A 3U0PB 2BSCA 4AVFA 2F8OA 4JX5A 4WD0A 1JZDC 4PS8A 2ZSVB 4WHTA 5CSRA 4ZFGL 3U9IA 1OTSC 1JCVA 1YNLH 4QROA 1LG1A 3UL4A 4IQHA 1FL6A 2ZVIA 1JBJA 2GHZA 5FK9A 2NCEA 3MNZB 3AMDA 3RNDA 2VLKA 4HF5L 3M4HA 1PV8A 4XD5A 4GKTA 3W1NA 3EO9H 3FSUA 3KPRA 2APBA 2VX5A 1TV2A 2QUTA 3BXNA 4D1JA 1A6VL 2XYBA 5BZWB 3S2CA 3R0NA 4PY7A 2Y2YA 4FMKA 4HIHA 2WTPA 3R8BB 3N1QC 1VGAA 5CPOA 4L3ED 3UTZB 3PAZA 3T4AA 2PPEA 3I9GL 4NJGA 3UVAA 3G6DL 4EIUA 4Z5RB 2JH2A 4Y1AD 3B7RL 1S3KH 1FA2A 2ZTKA 5D2WA 3F03K 3R19A 2Y1VA 1WKFA 3WLWD 1CE1L 5EUOE 5C07B 3TAKA 3P62A 4OF7A 3IMSA 4XD4A 4X60A 4OJFL 3K6SA 4X2PA 4XNBA 4G56A 3BEVB 1Z3NA 3MA9L 2JKAA 3MCLL 3ARVA 1BKHA 3UBFA 4NT6B 1F11B 4EWND 1G9MH 4BE6A 2G0LA 5INDA 3S1GA 2XM1A 1DO5A 2PDYA 1BRLB 3D3VD 4ETYA 2OT0A 1ZXQA 5MENA 3DCPA 3STLB 5D2NC 2YC1B 3QUXD 1I9RL 2I9UA 1V3JA 4BK5A 1W1YA 2VLKD 5E94B 4Z7NB 1JK9B 5GGRA 1BQHA 2QT6A 4QO1A 5E7FA 1W3LA 3B3DA 5IXEA 3WLSA 3PL6B 1BBJA 2D31A 1JZ3A 5D93B 3S4TA 1Z9LA 1IKNA 3OAUH 4R4BA 3O9WB 5CO1A 1LOSA 1KD0A 4PBEA 2YGYA 2ZWYA 3CSFA 1EIBA 3OZYA 1QLEL 2A4CA 1HXYB 3UGUA 2A5HA 3WS6C 1RK5A 3OOQA 2ZX7A 5FD0A 5DFTA 2MRYA 3HAEB 3K6FA 4LUTB 4PJHF 5CJBA 1UWIA 4AD1A 4LRSA 3X1GA 1P6CA 2K3TA 3A4FA 4HMEA 1S7QA 4IJTA 1M7JA 2J7GA 3FFCA 1FZJB 2HPOA 2AVFA 1S2AA 1GKOA 5MERB 4RFOH 3W1QA 2PBGA 4FLOA 5D4JA 1U92A 1GEQA 2CKRA 3VWJA 3L9EA 3T08A 4FCHA 5EU6B 4X6EB 4CNNA 2A77L 5J13B 4OVUA 4FA3A 2HK1A 4KRPD 1U36A 3E3QE 1OX6A 3ZKMD 1ZHKA 4KQ3L 4XAWH 2FGWH 2HISA 1MCCA 3FHEA 1UR1A 3GSNB 1LZOA 2J4WL 2NQCA 3IJEB 4HMDA 3LPWA 3MRPB 2IDQA 5ACLA 3L1OH 3B7YA 5DHVH 1XIEA 3ARRA 1MREL 3P8IA 3OPSA 3MXVH 2BIPA 2FB4H 4EIVA 1JVOA 4U6VL 2VXVL 4LPTA 1X5IA 4CNTA 2G5RA 5IDIA 1QI4A 1K4CB 3K71B 3QIWD 1FP9A 4S23A 2DYPB 3P3UA 1TT6A 3CK0H 1P4IL 3UR5A 2O6DA 3H9ZA 3BKJL 2NNAB 1RJYA 3MUGA 3ANUA 5AB2A 5K4XA 3PZQA 4C7DA 2L7QA 4FQCL 1EFZA 2DICA 3T65B 1TJRA 1FDZA 3ZJ7A 2FL5A 4ZFOA 3FXIC 3SCMD 5A2AA 3ZSSA 1LO4L 1GOOA 1W2KT 1GY1A 5IKCA 4DH2A 2O6CA 6PTDA 2W9EL 4KXAA 4Z7OE 3N6QA 1X96A 3EHBC 2IW0A 1C12B 1FGVL 5IEHB 2FTWA 1YKWA 4AZIA 1ADQH 2OOFA 4AB4A 4AVIA 2BNRE 1LWRA 3FU8A 2ZOLB 4W9ZA 4XCFL 1QFWI 5C6TH 4S3GA 3O9NA 5D2LA 4JYDA 2OR9H 2A9MH 4A4AA 1A65A 2X05A 2E6YA 2G2PA 4P0DA 4HKXA 3COTA 4N86A 4PMUA 4LKXA 4YQXL 1G0YR 4OD3H 1S2UA 4N9CA 4XI5C