4JFTA

Crystal structure of a bacterial fucosidase with iminosugar inhibitor n-desmethyl-4-epi-(+)-codonopsinine
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
438
structure length
438
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-L-fucosidase
publication title alpha-L-fucosidase inhibition by pyrrolidine-ferrocene hybrids: rationalization of ligand-binding properties by structural studies.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase/hydrolase inhibitor
total genus 162
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4jftA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4jftA01
1R7OA 3WD2A 2YLAA 1J9YA 1JZ6A 2J74A 3ZT7A 3WBEA 4AW7A 4ZE4A 1GONA 1VIWA 2YA2A 2OSYA 5A6AA 3AYRA 4P7QA 2VCBA 1UKTA 1KXHA 1OINA 3AHVA 3VIGA 5I2UA 3DX3A 1IT0A 1V3MA 4LPCA 4AY1A 4PRWA 4W8BA 4AIEA 1DEDA 3PHAA 1CYGA 1XH0A 4GO9A 1J01A 1GOIA 1RH9A 1MYRA 3GNRA 1HP5A 3IGUA 1CENA 5IHRA 1UR1A 1V3KA 5DMYA 1HP4A 2X0YA 1QI5A 3L4UA 1CLXA 5CLTA 5DFAA 4OBSA 4WSKA 1PIFA 3JUGA 3SIMA 5BRPA 3EJRA 3SUSA 4W7UA 4JCMA 1Z32X 2OWWA 4JFUA 4Z2GA 5M03A 4MB4A 4ZXOA 1R87A 4EAMA 3S6TA 4PUEA 3DYPA 2CHOA 1TE1A 4AMXA 3SUUA 1C92A 1XGZA 1E0XA 2J7BA 2O9RA 1XV8A 3E1F1 3ARZA 1GNXA 5FD0A 4PMYA 2ZXBA 1M01A 1ESWA 1UZ1A 3RJXA 3TTYA 2D3LA 4HOXA 3WEMA 1TQWA 4V28A 1E6RA 3A4XA 3GDBA 1Q4NX 1ZBVA 3CGTA 4B9YA 2WM0A 1QBBA 1X6NA 2EO7A 3G6MA 4F79A 2WKGA 2X2YA 1DHKA 3L4WA 5DEZA 1GVYA 3AZRA 3AI0A 3SUTA 5A8OA 3A22A 2B31A 1SZNA 4JKMA 4CKQA 3AS3A 4L4OA 1CWYA 4MJ2A 2WVSA 2NT0A 3WUFA 3WBAA 2XWEA 2XG9A 3WDQA 2FE0A 1QNRA 1B1YA 4MADA 3VIKA 5I3DA 4ML4A 4AD2A 4TX6A 1E4IA 1UZ4A 2NT1A 5A2AA 3MUIA 4EKJA 4UCFA 1BPLB 3CUJA 2CKRA 3LRKA 5ABFB 2YDQA 1A47A 4FMVA 3EJTA 3GH7A 3MI6A 4HA1A 2X1IA 1B90A 1E3ZA 3LXBA 3LXAA 3ARTA 3WD3A 3N15A 2QPSA 2UWFA 4Q7NA 3A3HA 3WQVA 4GO8A 2XSAA 2Q8XA 4OZOA 5GNYA 1VRXA 3CO4A 4AYGA 6CGTA 2VZSA 5C70A 5BROA 4U31A 3MUZ1 3PTMA 3WDHA 2ZOXA 1NH6A 3U5UA 1OBAA 3GXFA 3BVTA 1PX4A 1V0NA 2D24A 2EADA 3K1DA 3TTQA 2F7QA 1ODZA 4Z2JA 3G6LA 1BGGA 1NOWA 4CN4A 1H0IA 5KZ6A 4X9YA 4JHOA 1HL9A 3VGEA 1V08A 1PZ2A 2XSBA 3KL0A 5A2CA 5D8ZA 5TD4A 3ZJKA 3BH4A 2W5FA 1VJSA 3EJSA 2D0FA 1ITCA 4AEFA 3BVVA 1CPUA 2PWDA 1W9VA 1WPCA 3WNMA 4UFJA 4KH2A 2V3GA 4U2YA 3N1AA 1CXHA 1QI0A 3EDKA 4OBRA 1WCGA 3OLGA 4W93A 3AICA 3IAPA 1J0ZA 4R5EA 2J75A 2OLHA 4OOZA 4DWSA 3L4VA 3TTOA 4W84A 4HA4A 2G41A 1SMDA 1D2KA 2VQUA 1OD8A 4QDMA 3T0DA 5JIWA 4CUCA 3WQ5A 1E56A 3EDDA 1GHSA 3HG3A 1GORA 1UD5A 4CD4A 4Z2IA 3N17A 4AMCA 1LJYA 1PEZA 2YKKA 4FNRA 4D6CA 3CZSA 2D22A 4GINA 4ACZB 2GFTA 1KWGA 1JG9A 6A3HA 3OZPA 1PS3A 5KEZA 2GJRA 1JDCA 4U33A 4LXFA 2PF0A 3THDA 4EE9A 1V03A 2EEXA 3HG4A 1CGWA 2G4FA 4DM2A 1VFFA 1W1TA 4URIA 2WHLA 3UEQA 2QMKA 3WKZA 2QLYA 3A4AA 2OYKA 3VGBA 3CZJA 2EABA 3LPOA 2X09A 2UY5A 4ZXLA 4CD6A 4GI8A 1VEOA 2FH6A 1V02A 2O92A 3BCFA 3VO0A 3WD0A 3OG2A 3WIJA 3SCSA 1JDDA 4ACYA 2QF8A 4HP5A 2YJQA 1PIGA 2XTKA 3POCA 2BXYA 3MUY1 1JZ3A 5CSYA 2WCGA 5HPCA 3AIBA 4BA0A 5IFPA 5CGMA 3WQWA 1JGIA 1UQYA 2O9TA 2CETA 1MWOA 3FNDA 3U7VA 3ARRA 1JD9A 1H49A 1M04A 4ZENA 5LYRA 2D2OA 4NRRA 5ABEA 3VGHA 1LL6A 2DT1A 4CU7A 4WKFA 1LF1A 1E6XM 2CBUA 3N9KA 3FY1A 3TOPA 2EACA 4BQ4A 1B0IA 3O6AA 3VX0A 3VM5A 3WMSA 1KTCA 5I79A 3GXNA 1N82A 2E3ZA 3OGSA 3PZUA 1DTUA 1E71M 5M5DA 3H54A 1JYNA 2YDRA 1NM9A 5EFDA 3IANA 2JF7A 4PMDA 1HJUA 1Y7VA 1HWWA 4AZCB 1RP8A 1R75A 3MANA 3WMBA 1XH1A 1FP9A 3ZOAA 1K9EA 1UASA 2VR4A 3SCRA 2VURA 4J3SA 4TTUA 1E55A 3F5JA 1MQRA 3WEOA 2GUYA 4CU8A 4JFTA 1OGSA 3WNPA 4HMDA 2W63A 4ZE5A 2E8ZA 3VKKA 2JFEX 5I0DA 3KLKA 4AZHA 3QHNA 3T2PA 3ZQ9A 4R27A 3WY3A 4TXEA 1GOOA 2CIPA 4JCLA 3CLWA 2WWDA 5BXRA 1WB0A 3GXTA 1QNSA 1KGUA 1TVPA 4XB3A 2BS9A 3B9AA 3RO8A 3BSHA 3UG4A 3EDJA 1EH9A 1E1FA 7TAAA 4JFVA 1WZAA 3BAYA 3WUEA 1VFMA 3CTTA 1E73M 2WBGA 2C8NA 3DX0A 3L4TA 3UESA 1HVXA 1E5JA 2ZUNA 3SCNA 3FAWA 2MANA 1C8XA 1TCMA 2WNWA 2DT3A 2WMHA 1O6IA 3DECA 1VFUA 1GUVA 5CPQA 4WIWA 2W61A 3WY4A 3D51A 2GJXA 1UR0A 1G5AA 4P8VA 4P8WA 2X2IA 3W24A 1BSIA 4UTFA 4MNKA 3BUIA 2D3NA 3PZIA 1TG7A 3MMWA 2VJXA 3WQ6A 2ESCA 1XCXA 3A23A 4BQ2A 2GK1B 3DHUA 2OWXA 4B16A 3BMVA 2FH8A 2W67A 1CTNA 3W0KA 1EDQA 2G8ZA 1E6ZA 4F66A 3WH9A 3CMGA 4F9JA 4HU0A 1ISVA 4FLOA 2FYVA 2W92A 3NCOA 5HNNA 1OGGA 3I3EA 1G94A 4JIEA 4X0VA 1D7FA 3CUIA 4M29A 3N13A 2YOCA 1E4NA 2XIBA 5DT7A 2VVNA 1L0PA 4Z2LA 4AZ6A 4H2CA 4PMQA 5HDRA 2F8QA 1V3IA 5D4YA 1QI2A 1BTCA 4W88A 1ZJAA 1HJQA 3NYDA 1WDSA 1GHRA 4KRTA 5CGTA 3N04A 1OSEA 4H7VA 3WD4A 1SR0A 3M7SA 4UZUA 1K9TA 4W8LA 1AQHA 1OGBA 4PTWA 2Y4SA 1MW1A 1J11A 3WDRA 2A3AA 2WC7A 2WVVB 3VSUA 4AZBA 4EK7A 3U57A 1QHPA 1BHGA 5IDIA 3I3DA 3OBAA 5A8MA 3NDZA 3WQ4A 3SCQA 4PMZA 2WLZA 5AC4A 1E6PA 3ARWA 3H53A 3WF1A 2XUCA 3W25A 3RPMA 1OIFA 3K8KA 4AMWA 1C7SA 3WDJA 3ARVA 3L2LA 5A95A 2WZIA 3M6DA 1BQCA 4QP0A 1QVBA 4CD5A 2AOSA 2DSVA 4UR9A 5D9NA 1W91A 1EQCA 3FXYA 4MTVA 3FHQA 1UWTA 2WSPA 1EOMA 5BYWA 2X05A 3K8LA 1C3FA 1KR1A 1X6LA 1O7AA 2AMGA 5JBFA 1JZ4A 3CHFA 2EBNA 1WDPA 2DIEA 1WDQA 2J8FA 4BS0A 3SCTA 3WFLA 3K4AA 2TAAA 2WB5A 2PWHA 4UFMA 3CZ8A 2PB1A 3IJ8A 5CXPA 1AVAA 1JI1A 4MJ4A 3VTRA 3VIMA 3MMDA 4NZFA 4J3XA 2V3FA 4WK9A 1VAHA 2WWCA 3W26A 2VC9A 1KCKA 3WH6A 4D6IA 1GZJA 4M8UA 2EXOA 1E4LA 4UQBA 1W2PA 4W5ZA 2IGTA 1UD6A 5HOSA 1LG1A 3HU7A 1E4MM 1CZ1A 1XYFA 4KGJA 8A3HA 3VGDA 4JKKA 5D9MA 3WSUA 7A3HA 5LA0A 1E6SM 3HG5A 2X0HA 3J7HA 4JZ5A 4B15A 4LQ1A 4U2ZA 2NW0A 4P8UA 1W32A 5IXEA 3CC1A 1TQTA 3H55A 3O2LA 1OB0A 1J0IA 1V6UA 2IUZA 3ARSA 5ABFA 3AXXA 1QX1A 2UY4A 4XX6A 4JFWA 3CUHA 4RL3A 2F7OA 4N0RA 3LX9A 3RILA 1BYCA 2YIHA 2NSXA 1E0VA 2WKLA 2W4XA 2ZICA 3DC0A 4E8CA 2O9PA 1BYAA 3APGA 1WO2A 1MQQA 3ZIZA 4AZGA 3HMCA 2YFOA 2EPOA 3VGFA 1X1NA 1EDTA 1WDRA 4GQRA 1MVYA 1MXDA 4KRUA 3LRMA 3L4XA 3ZJ6A 2XJ7A 4IISA 1W9XA 1CGUA 3BUPA 2BVTA 2DH2A 5BWFA 4UFKA 4CVWA 5HPOA 1CEOA 1F4HA 1NWRA 3B9DA 2WMIA 1SFSA 5CZKA 2UY2A 2DQXA 3CV5A 2XN0A 4EANA 4ATLA 3EMZA 2WZHA 5A3HA 4IUGA 3VUPA 3NJ3A 2WANA 5A6LA 2ZE0A 3SUVA 4PN2A 1LL4A 5A8PA 1S46A 1R85A 4P8XA 2A3EA 2V38A 1WAWA 3W28A 2VZVA 1LWHA 2OSWA 5CPSA 4DUVA 4GZIA 1B2YA 3OLEA 5C71A 1H5VA 4S3JA 1JF6A 4KGLA 4MPKA 4TUFA 4MB1A 3WNNA 4RE3A 4N42A 1B3VA 5A8QA 2RGMA 5E0CA 2W66A 4CCDA 1NWTA 1KWKA 1JNDA 1DWGM 1LWJA 2CYGA 5E9AA 3MS8A 4PSPA 4GQQA 1TQUA 1TA3B 4ACZA 3MV11 3AHTA 3W37A 2EPKX 1HKMA 1C7TA 5EMYA 4J27A 3D50A 2ALWA 5ABGA 1E3XA 3RJYA 5DF0A 3BLBA 4D6FA 4PMRA 5GNZA 1H41A 4M1RA 3NIYA 1V6YA 2BHZA 1DP0A 3AROA 4PTVA 2G3IA 3PZGA 4AXNA 4WSJA 4J3UA 3IJ7A 1V0KA 4ZFMA 2D73A 4PMXA 1SMAA 2WW5A 1GJUA 5ABHA 3B8SA 1I1WA 2XVLA 3AIVA 4PCSA 3WFZA 2GDUA 1C8QA 1XHGA 1ZBWA 1PJ9A 1E0WA 1HF6A 4JFSA 4DWSD 2VX7A 1OCQA 3LPPA 1JFHA 1UR9A 3AMDA 4FF5A 3LXCA 1I1XA 2W62A 4UQ9A 3AMGA 4P7NA 2V5DA 1UUQA 1JYVA 1KGWA 1JYWA 3PZQA 4FNSA 1JAKA 3AFBA 1W3JA 5LA1A 2PBOA 4HMCA 2F7PA 1ZL1A 2XM2A 1MXGA 5JBDA 2PC8A 4HZ8A 3MSDA 2XHYA 2FHBA 3CIVA 1R86A 2J7CA 2Z1SA 3ARPA 3WUGA 1EHNA 2JE8A 2ZWZA 3POHA 3GBDA 1WZLA 3SCOA 3K8MA 2DDXA 1OT2A 1QI3A 2WYSA 4HZ7A 2F2HA 4GZJA 5D8WA 3VSTA 5I6SA 5FCZA 3A6OA 1TQVA 5DO8A 5EBAA 3W29A 4AZCA 4UOJA 1QHZA 1FHDA 1JZ8A 4M81A 3II1A 4PBGA 4P7LA 2OW6A 5I77A 2XGIA 1M53A 4AD0A 3AQUA 2C7FA 3BCDA 5DT5A 3D3AA 3GXDA 4OUEA 3IJ9A 4E2OA 1NP2A 1PPIA 3AZTA 1UD8A 1GQKA 3AHZA 3AIUA 1CGVA 1FP8A 3T2QA 2YL9A 3BUBA 1OM0A 5A94A 1O7DC 2D20A 2DPEA 1UH4A 2J25A 3ZMRA 1I75A 1B3WA 2XPKA 3WDIA 2JALA 2D0GA 2DT0A 3CHEA 4FK9A 1U30A 4IPNB 4H8HA 4J3WA 3AS2A 3EJUA 2VUYA 4YHEA 3U5YA 4M24A 1HT6A 1JIBA 3WL1A 3GM8A 1XSJA 3AMLA 3CZGA 4AIUA 2DSKA 2XVPA 2X2HA 4TTGA 1R47A 4MDPA 2VX6A 4FLSA 1E6QM 1IZJA 2F18A 2CEQA 3ARUA 2ZUTA 3F5KA 4BF7A 2XFYA 3A24A 4CU6A 1H11A 1M7XA 4OKDA 1BGAA 3VIJA 4K68A 4PUDA 2DEPA 1QPKA 1ODUA 1KBBA 5A6BA 1US3A 2VNCA 1OWQA 3VD3A 3CH9A 4DUXA 2VX5A 1ZB5A 3DX2A 4PTXA 1WZMA 1V02E 4MAZA 4IPLA 1CGTA 2GK1A 1FH8A 2PBGA 4A4AA 4UNIA 1GW1A 3ALGA 1EQPA 3SCUA 2XIIA 1GOQA 1IZKA 4DWSB 4MNLA 1C93A 5E09A 4NF7A 4X0NA 2A3CA 1BYDA 2WVTA 1IV8A 3EJPA 1UWUA 2FGZA 2ZIDA 2J8GA 2ZX7A 3EMQA 4NZCA 3WN6A 1DWHM 1UWSA 1UH2A 2D0HA 3I3BA 3O9NA 4JAWA 5AC5A 3FN9A 3VVGA 3ZJ8A 3WNOA 3UG5A 3VDAA 1QNOA 4B3KA 2XFRA 1LQ0A 3KLLA 5E6ZA 2WHKA 3WF3A 3BLPX 1AQMA 2WVVA 4NSBA 4D71A 3VMOA 1VFOA 2J47A 3CHDA 2BHYA 1GVIA 2ZX9A 3UERA 4UFHA 5A69A 3DX1A 1QW8A 7CGTA 3KL3A 3L4ZA 1HX0A 4NXSA 4U5KA 4HA3A 3AISA 2YBTA 2X2JA 1C8YA 2HVMA 3GBEA 3GTNA 4U3AA 4MB3A 2CHNA 1DWJM 1US2A 2CERA 2WK2A 4CD8A 1JF5A 1E9LA 1BF2A 1MFUA 3SCPA 1NOFA 3W4RA 2XN2A 4AZ7A 2EAEA 2ZWYA 3ZT5A 3OLDA 2ZXQA 2BV9A 1H1NA 4UQEA 1LG2A 2VRJA 2FGLA 1VF8A 1HTYA 2Y2WA 2BFGA 3VMPA 3FAXA 1WZKA 2ZUWA 1TZ7A 3DYMA 2E40A 4YN5A 5EB8A 1WNOA 4XUYA 4Z2HA 3D52A 1ZBCA 1PAMA 3W81A 2VZOA 3VD9A 1KCLA 1QWUA 1E1EA 1CECA 3N12A 2CCRA 3DDGA 4HPGA 3T0BA 2VRKA 4W7VA 3W27A 1KFWA 3CPUA 1UWIA 3S2CA 3VU2A 1UKOA 2YL8A 4HZ6A 4MAVA 1NP0A 4HPHA 1UKQA 3BAIA 2HISA 1GQIA 5ECUA 3W38A 1GJWA 3AOFA 4KMQA 3GNOA 3PZOA 1Q6GA 4WLCA 1XC6A 1K9DA 2CXGA 1CIUA 2D1ZA 3GXPA 5CQ1A 4FNQA 3MO4A 3WF2A 2J77A 5I23A 2OSXA 2WC4A 1KQZA 3KEHA 2A3BA 4LYPA 1B3XA 3AXHA 3WMCA 1B31A 3VX1A 3MV01 1Q6DA 5A6MA 4GI6A 1H4PA 4B9ZA 1U2YA 3KE0A 4QLLA 1G1YA 3K46A 2Y5EA 1B30A 2DIJA 1UOKA 1KTBA 3ZT6A 4A3YA 4BZYA 1GQLA 1E70M 3EMCA 2PWFA 3ARXA 3VOCA 2WBKA 3VD7A 1UR8A 3VDBA 4QLJA 2FHFA 2Y8KA 3LRLA 2GDVA 2J79A 3RDKA 1G0CA 1MFVA 1QWNA 1CNVA 3AIRA 3ECQA 5I5RA 3UR8A 4F9DA 3EBVA 4UOZA 1OIMA 3W53A 3BAKA 3CUFA 1QNQA 1R8LA 1V3JA 2YBUA 1MQPA 2VO5A 3F5LA 5GPRA 1J0KA 2WMKA 2WCAA 3AHXA 1W1PA 1GCYA 1OT1A 5M3WA 1HNYA 5BCAA 2VL4A 3VSVA 3QHMA 3ZJ7A 3RM8A 3DDFA 3MU7A 3AZSA 2QV4A 4GKLA 3SURA 4M82A 1E15A 3UG3A 4C7GA 3PZ9A 3BXWA 3FW6A 2JEQA 2ZUMA 3KL5A 4LYQA 3AHYA 3S5ZA 2E0PA 2VRQA 3CMJA 2XVNA 4F8XA 5JIPA 4S3KA 4TVCA 3BVUA 2CESA 4JKLA 1W2VA 2E9LA 1VBUA 4W8AA 4NZJA 3W6MA 3A4WA 2WHMA 1QW9A 1FOBA 1VBRA 3PZMA 2DSZA 1BFNA 4W89A 2E9BA 1W9DM 4UFLA 4AD5A 2CBIA 1HXJA 1RD6A 2BNJA 5A8NA 3AMKA 2J62A 2ZUUA 2IXUA 2WHJA 1OD0A 3NSXA 3GZAA 1EO5A 3VILA 4GZEA 1W9PA 1J0HA 3AXIA 2VCAA 2DT2A 4C7DA 4JHZA 4AZ5A 2WZEA 3LMYA 2F1AA 4D6HA 1B9ZA 4LYRA 1TA3A 1C90A 3QR3A 3M07A 3WNLA 4BCEA 3GH5A 1UD4A 3D4YA 2BY3A 2YL5A 4WKHA 2A3HA 4BQ3A 1TFVA 2WAGA 1R46A 1AMYA 4D6DA 1PZ3A 4CGTA 3OZOA 1FA2A 5I24A 1A3HA 4FLQA 1E5NA 3QGVA 3PZVA 1AQ0A 3BVWA 1CGYA 5A1AA 3BSGA 4DUWA 2ZX8A 9CGTA 3WY1A 3SCVA 2XN1A 2WMFA 3PBGA 2F1BA 4HOWA 2YL6A 4UQDA 4AD1A 1K9FA 2E4TA 4UQCA 2DSUA 3PTQA 2F7RA 4TX8A 2JF6A 5HXMA 3D4ZA 1HJSA 4P7OA 3CHCA 3VMNA 5GNXA 1J18A 4J3VA 1GPFA 3UR7A 1U33A 1XCWA 2E9MA 3ZO9A 2J78A 3GXMA 3OGRA 3WL0A 3VGGA 4AYSA 2XGBA 4OOUA 1MW2A 1RPKA 3EDEA 1HIZA 1VEMA 3DHPA 2VVSA 3AIQA 3AMCA 2BHUA 4PSRA 1UR4A 4D72A 4D1IA 5CJ5A 1XD0A 1PX8A 3UETA 1Q6FA 3WH8A 3BUQA 2WC3A 1J0YA 2D23A 1ZBKA 2BY2A 2VT0A 3KZSA 1KXTA 3VD4A 6TAAA 3FHAA 1CXEA 4OIFA 2UY3A 1Q6CA 1ITXA 2QMJA 1HKIA 1HN1A 4P7RA 1V3LA 4M56A 1LLOA 4Z2KA 4RE4A 3VIIA 2CITA 5GQBA 3BGAA 4QFUA 4DM1A 1JNEA 4CCCA 5A6KA 2CBJA 4MNMA 1UG6A 2X8RA 1UYQA 2YLLA 4H41A 4DO6A 3WDPP 1M03A 2JEPA 3HG2A 3NSNA 4C7FA 2VZTA 1W9UA 1W9BM 1R33A 5IHSA 3IK2A 5A6JA 1JDAA 1QNPA 1CDGA 1UKPA 5D9OA 2VTFA 2J7GA 4WF7A 1XH2A 3GXIA 4W87A 2WSKA 4W85A 2GSJA 1ISYA 3NUKA 4PCTA 1NOUA 3M46A 5CPTA 3TP4A 3CZEA 4FNPA 1J12A 2PWGA 4OGZA 2V5CA 1GOKA 3AIEA 1UWRA 2IXVA 4W86A 5JUVA 3HZ3A 3QHOA 3VPLA 5F7UA 1UKSA 1TVNA 2XWDA 1W3HA 1B3YA 4UQAA 2J7EA 4XV0A 1V6VA 2VCCA 1JI2A 3BLKA 2VI0A 8CGTA 2FDMA 2QPUA 1VEPA 1UA7A 1CXKA 5HBFA 2WCSA 3S5YA 4M80A 1W1YA 3T08A 1KXQA 2WMIB 3UCQA 4PYSA 4W7WA 4A3HA 3NDYA 4CCEA 1JL8A 3VIOA 1JAEA 2J7DA 1ZJBA 1VJZA 1NQ6A 1B3ZA 2ZX5A 1HXKA 3A21A 1FHLA 3OIHA 3RM4A 2CPUA 1XYZA 5FL1A 4OJYA 1R34A 1CLVA 3GYCA 4AD4A 1DWAM 1K6AA 4WKAA 1UQZA 1JYXA 2CBVA 5AY7A 1F4AA 4U5IA 1V6XA 2VZUA 3PTKA 5LA2A 1EXPA 1QI4A 1BLIA 3MKKA 1J0JA 4GI9A 3D5HA 3CZKA 3VINA 3WY2A 4MB5A 1HJXA 3BAJA 2ZX6A 2EPLX 2OYLA 3W6LA 1KXVA 2J4GA 3SEPA 4PEEA 3OGVA 3DYOA 2ZUVA 3GNPA 1UHVA 2GVYA 1HJWA 4BQ5A 2XVKA 4UFIA 4AEEA 2OYMA 4HMEA 3TA9A 1VB9A 4AISA 2XYLA 3MUAA 4HU8A 3AJ7A 4CN6A 1P6WA 3VIPA 1QOXA 4UOQA 1YQ2A 1BG9A 2WXDM 1H0GA 2OWCA 1BVZA 1BYBA 4YHGA 3A47A 5E1QA 1ISWA 3AIWA 4GPNA 5I78A 3RIKA 1XSKA 2EPNA 5AYBA 5A6BD 2Y24A 2DSWA 2ZXAA 3VNZA 1PBGA 2BY0A 1RP9A 4JL1A 3BC9A 4GXPA 3VM7A 2O9OA 2WPGA 4MDOA 3GH4A 4AWEA 2GJPA 2YFNA 2VX4A 1CBGA 4D1JA 4H04A 3TTSA 3LPFA 1H2JA 4L4PA 2DH3A 5BXPA 2OW7A 5FKYA 3WH5A 5A6SA 1W3KA 4B3LA 4LX4A 3WENA 5CSUA 1L8NA 4J7RA 2WMJA 5BXTA 2WMGA 4E4PA 4W5UA 1JD7A 1KGXA 1UD2A 3N11A 4NRSA 1HKKA 5IFTA 1FFQA 1GOWA 3KWXA 3WEZA 3U7BA 5FOOA 1TUXA 2Z1KA 2EQDA 3ZSTA 2VMFA 4Q22A 2YA1A 2WLYA 3A5VA 3VD5A 3K4DA 3VDCA 1R7AA 4CN1A 2CNCA 1ECEA 1TQSA 1WE5A 4H8UA 3NSMA 3VDHA 1ISZA 2XFFA 3ZM8A 4QCEA 2BVYA 3PN8A 4GIAA 1NWUA 2ZXDA 4HTYA 4ZEPA 1H3GA 1VENA 1CXFA 1CXIA 4V27A 3AS0A 3TONA 4XZWA 3VIFA 4D6GA 3T09A 4PMVA 4D6EA 3T2OA 1TMQA 4ATWA 1G01A 2PI6A 1XRVA 3MMUA 1JXKA 1UA3A 1FFRA 4MNJA 2BXZA 1DWIM 5E0FA 1KBKA 1E6NA 3RM9A 3ZR5A 1W3LA 3ARYA 2EPMX 4AC1X 5E6YA 3VNYA 4WJXA 4PTMA 1EIBA 3DX4A 1C91A 1EGZA 2BVDA 4V2XA 3CUGA 5CG0A 3OA5A 1E72M 1PX3A 1FH7A 4J28A 3PZNA 4E8DA 1CXLA 1EDGA 4TVUA 4NI3A 4PMNA 2PWEA 1UH3A 4DWSC 2VR5A 3WH7A 4QAWA 2W91A 4H8VA 2VOTA 1E40A 2G3NA 3TV8A 5FIPA 1HVQA 3N18A 2AAAA 3WF0A 1T0OA 1V3HA 3L4YA 1JZ5A 3EJQA 5FL0A 1E43A 4LGXA 4FNUA 1LL7A 1V6WA 4HOZA 5M17A 1MW0A 1G9HA 1J10A 3WELA 2XVGA 1UD3A 2JIWA 4XZBA 1JFXA 4QCFA 3EDFA 1BVNP 1ISXA 4PMOA 4J3TA 3F4VA 4D6JA 4AD3A 1XD1A 1EOKA 1Q6EA 1JZ2A 1HKJA 4NXKA 1XSIA 3ALFA 5JBEA 2E8YA 1NARA 1WP6A 3BVXA 1KQYA 4TOQA 1MW3A 4CVUA 3HN3A 3OLIA 1HL8A 2YDSA 3ZR6A 2JIEA 4JL2A 2EJ1A 1KB3A 3PZTA 2RGLA 4UZSA 1EO7A 3BMWA 2J7HA 5AYIA 1HJVA 5E70A 3AS1A 2G3MA 4PMUA 3RMEA 2CKSA 3VIHA 4Y7EA 5EFFA 2F61A 3BAXA 3BUDA 4QLKA 3ARQA 5A2BA 3QOMA 2XM1A 5CLWA 3WF4A 3L2MA 4TVDA 1BG4A 1JZ7A 1KR0A 1DWFM 5BRQA 1W1VA 4YPJA 2J7FA 2ZUSA 1QBAA 1CGXA 3SCWA 1WKYA 2VQTA 3MSGA 5D9PA 1GOMA 3EYPA 1YHTA 2BY1A 4RE2A 3AYSA 4NX0A 2Y8VA 3OB8A 3SUWA 1H09A 3HJEA 2QHAA 4DO4A 2V3EA 3WQ8A 2V3DA 3QOKA 2YA0A 1UR2A 4FLRA 3ZSSA 2C0HA 2DGAA 4FNTA 3W82A 1BAGA 2FHCA 3RCNA 3CBWA 2GJXB 4ATDA 4DO5A 3LPGA 2G3JA 5BXSA 1EHAA 4IM4A 1UWQA 3WUBA 3WNKA 1D3CA 1QHOA 3BAWA 3IAQA 1ZU8A 4AZIA 5C8BB 1JXJA 4KWUA 1V0MA 3CZLA 4AIOA 1EA9C 3CZNA 2WVUA 3THCA 1TR1A 3WD1A 1SYTA 1FH9A 1GQJA 4CD7A 3B9EA 3T0AA 4U3CA 1ZS2A 1NWSA 1V0LA
chains in the Genus database with same CATH superfamily
4RNJA 4WY7H 5J3HD 1F41A 5JO5B 4QXWA 3D8MA 5BOFA 5HNTA 3FK3A 2A83A 5MERA 3OVQA 1DCEA 3QR1A 4N3UA 3MRMA 3BI9X 1YY9D 1NFDE 1IVLA 3FF8A 5HTSA 3B3BA 4JFFA 1B4JL 5HINA 3CFIC 1M3IA 4KPHH 5EU5B 4N2LA 4F5CE 4LL4A 5CD3A 4ZS7H 1D3GA 2QR0B 4XMLL 3EJRA 3EKLA 2FSEA 3BLDA 5HYJB 5E1GA 4JFUA 4YHLL 5C2CA 2GYIA 1ZHNA 4M4RB 4ODSH 4XPBL 2Q8BL 2I5YL 3SDAB 4X6DA 1FNAA 3KLAB 3ARZA 1JPSL 3FZUD 2OMUA 5FM5O 4RNHA 1F6LL 3ULUE 4L4VD 2FO4A 3W23A 3NN8B 3CGTA 3MVTA 1QBBA 2EO7A 2FB4L 4JB9L 1NCNA 4APXB 3D09A 5A8OA 3WXWH 4CL7A 3FTXA 1ZZMA 3INPA 2I1OA 4EDXA 1IQWL 3WUFA 3MJ9L 2PYFA 2GFBB 3AXKA 4DNLA 2YXXA 3GWQA 2WQAA 5I3DA 1KCSL 4TX6A 3C5ZB 3MUIA 1QBMH 3SGKA 4RSYA 1VDGA 1ZV9A 2V9UA 3DIVA 3BQUD 3DHDA 3RI5K 1MEXH 1A47A 3FHEA 4FMVA 2IMRA 1AKJB 2A21A 4GC4A 2VDIA 3OGCB 4Y7MA 1KZQA 1R3HB 4AFYA 4HAKA 1TPB1 1N0LB 1EHKB 3WSQH 1RZ7L 1H5BB 4UT9H 1HINL 3OX8A 5KAQG 3QRHA 1NWPA 5I3GA 4OJFL 1TTCA 1THCA 5B39A 2ZOXA 4JY5H 2XOTA 1M9HA 2B2XL 2EDXA 2BMKB 4PJBF 3ATYA 1TTPA 2CO2A 3T77A 1HL9A 4AEIL 4G8GA 5DN1A 3QZAA 3O6FB 1ZVSA 2DQDL 3CS2A 3MYOA 3WLRA 3NQBA 1CO1A 4G8EB 4JRYE 3UC0H 2ZSVB 2R0WH 3IRSA 3VXGA 3VXPA 1NKRA 5BZDB 5GJPA 4H9MA 4FXKC 1KV3A 3EX3A 3SKOA 5HHOB 3HUJE 2NQLA 5F1SA 2G5RA 3SDDD 4F0KA 2JCWA 3ZTJH 1U8CA 2E7FA 1W72B 1THAA 3Q2VA 5L9DL 3FYOA 1KXQE 5FHBH 1OKEA 4FNRA 4HFUH 2J73A 4K7PY 2YXGA 3HURA 4NQVB 1RAKA 1GAFH 3UZYA 4LNYA 4Z1AA 2GJRA 4KFPA 4G7YL 5CBIA 3G1RA 2PF0A 2ONEA 3NA4A 3HG4A 1X5MA 1Z0NA 2OQJA 3VUSA 5HSFA 4O14A 5BXFB 4ZYKB 1U8IB 1LWIA 4JRLA 3K0WA 3AY2A 2MCPH 3FRUA 1MRFL 2NY0D 3FO9B 1E2WA 1JDDA 3U0WH 3STBA 1OYBA 4FP8L 4L3AA 1EFXA 3MTRA 2PCFA 1E9PB 4ZNCD 5F7WC 1D5ZA 1JJKA 4FOJA 4QRTB 4XPGL 4N0YH 1VHCA 4QKXB 3S2NA 4CU7A 3TT1H 1E6XM 4I87A 4F24A 4XBGB 4MBOA 1U8OA 1ZT1B 3DFOA 4LAJH 3PZUA 2HH0H 4NQED 2GSMB 4XAKE 1KKOA 5J6GB 4FXGC 3FQUB 2QKFA 2DLTA 4HIXH 3QI9C 3W7OA 4S3GA 1XH1A 4EQ3A 4IKIA 1UASA 2AV1B 2FL5A 3B2UD 4WI0B 4Y4HA 4WI5A 4HMDA 4YNYA 1F58L 2V2XA 4JAMA 3QHNA 2HG5A 3KXQA 5IW6B 2QVNA 3G0SA 2ODHA 4XX1E 5DJAB 1QNSA 4MNQA 1FZJA 4ERAA 4EVZA 3RO8A 3CFTA 4OTXH 5C2BH 2G30A 1RVKA 3DX0A 5C0FB 4HIEB 1F9CA 3HC2A 3WJXA 1TCMA 3QCTL 4WI6A 1WK0A 2WMHA 1GY2A 1P0BA 1YG9A 4IJCA 4C59B 2HA1A 4B5VA 4R7DB 3QPKA 2AF2A 1V7ML 2R51A 3O0FA 1H61A 2WMPB 4AUJA 3A23A 4UTAH 3DHUA 1A5AA 2PF8A 2CR6A 5KW9L 4WCYL 3WH9A 3CMGA 4HIHA 5HGAB 4KKCD 5D38A 4MMYA 3MQTA 4GGHA 4B53A 1XIWC 5CZTA 1U9KA 4GUCA 1K5WA 3MBWA 4Q4PA 1MDAA 2IMMA 1OSEA 1MZZA 3ARFC 3NQEA 2AXFB 3EYUH 2WC7A 3BWSA 4JPVL 3BQ6A 4NERA 2PKDA 4MLSA 5K9DA 4ZTOH 3E3QE 4Y5XC 1Y65A 4IU2B 2DSVA 5BS0A 4GBXD 4CVXB 1M05A 1A6ZA 3UAEA 3VG0L 2B7PA 4LSTH 3ZIYA 1TWWA 2FMNA 1SEQH 4P23C 5FJOA 2C13A 3LB0A 4OCXL 3VXRA 3F62A 2QUMA 2V3FA 3KW8A 3WH6A 1PYWA 3DPBA 2ZUQB 4N0FA 4C47A 2K6WA 4IW4C 2P10A 4NNXB 3ITGA 3OHXB 1XYAA 4LCCC 4QO1A 4NM8H 1A6UL 2J44A 3NPSC 4AU0A 1ONQB 5GRJL 3CDGA 1GYMA 3ITXA 4B15A 2GVGA 3NMEA 4WVRA 3DX8A 3B2DC 5KJRH 1J0IA 1H3XA 4MX7A 2UY4A 4NO3A 2VDHA 3LS9A 3CUHA 4LU5H 3EB3A 3HCVA 2NSXA 4NNYB 4AZGA 3PFRA 2C3VA 3TBBA 2DBLL 1SNRA 1GZQB 3WL9B 2YXFA 2GGJA 5GJMA 3D3VE 4O5LL 1ZLUK 3S3JA 1UXMA 3CHOA 5HPOA 1HZHL 5C07D 3EOAA 4AQ1B 5ICZA 5D2VA 4R4BB 1AOHA 2JB5H 3CFQA 4JGJA 4XZIA 4BZ2A 4QR7A 2V2CA 4DEFA 5ITFA 4M93C 4JTGA 1ET5A 2GBVA 5LBSH 1HQTA 1PZ5A 1LE9B 4U28A 2OSWA 4C4KT 5KSVA 3AREB 5IQ7H 4N2CA 4M7KL 1A3XA 4S3JA 2H8PA 4PRNB 1MFEL 4L8DA 1B4JH 5DQJB 2FQDA 3DKJA 2MRYA 3H4HA 5GRZA 1CB7B 4JYEA 2I7OA 1WA0X 3O6YX 3RJDA 2MTPA 2CZEA 3CQQA 1LMKA 4XMLH 5DF0A 1PUDA 1A5SA 1OB1B 4N28A 1RUAL 2Y5JA 4JE0A 1I3VA 5F9WC 4L8CA 5L4IA 5BU6A 4YHLH 4XPBH 2Q8BH 1J5DA 3L2NA 5DHVB 5LNGA 4RISL 3SFWA 1JPSH 3C2EA 2HBVA 1OX6A 4JTDA 4NY2A 4KIEA 1PJ9A 5T26A 2WWOA 3X3GL 1OGTA 1WXZA 4RNIA 4PZVA 1JV5B 2ZADA 2FB4H 1NWOA 4FKHA 1OL0A 4LAOA 3VA2C 2ZCLL 5EC1B 2PBOA 1UZ6F 2LGNA 2R39A 2RH0A 2XIDA 1DBBL 2J7CA 4JFXB 4JNMA 3MJ9H 3GG7A 4NKQB 1Z5LA 4BK8A 3MNMA 1KCSH 3BDXA 3CHPA 1CICC 3Q6FB 4HPXA 4QTHA 4M81A 1HCYA 2OW6A 2ISFA 4AD0A 5SWUA 1GZHA 5BMXA 4GFIA 3HFFA 3HR6A 1RZ7H 5A94A 2FECL 3VWKD 3WZ0E 3WNIA 2Z7WA 3FOMA 3TC9A 4AHPA 4LMQE 2VISB 4YGAB 1VA9A 2ICWA 3U5YA 4C6JA 5E0QA 2JB6B 3WO8A 4AEIH 2X44D 4AIUA 5F3FA 3C60B 3B2XA 4LRNH 5DZAA 4O4WA 2DQDH 1ZSXA 1R24A 4XNZC 4BF7A 3QC5X 1JHKL 5DRZA 3KYOB 1B9BA 4N8VA 5LWYL 1ODUA 2VNCA 4PG9A 4PTXA 1PE1A 4TF4A 1CGTA 4KWWA 5EBMA 2FTYA 4OV9A 3V4PL 3NH7L 2FGZA 1GA2A 3C8DA 5L4JA 3LU2A 2J88L 3UJIL 3HRZC 5L8LB 1QNOA 5TBOA 4Q8OA 2OEKA 1MRFH 4Z3FA 1H7OA 4AWUA 2YZ8A 3IVTA 3IU3A 3QCUL 5EEVA 3FV9A 5L7XL 4FP8H 1PEWA 3FH8A 2X0WA 4L0PB 5G5IA 4KQNA 1F3EA 4XPGH 4JM2F 3HE6A 2Q8AL 5L0QC 1FGNH 4MD5A 2J8UF 1YC7A 2PC4A 1VLXA 4GG6B 4P2OC 4NWUH 3PAYA 1OCRB 3ZDXF 4YXGA 3NG3A 1XR8B 5KBPA 2O6FA 4QS5A 3O8XA 2W3ZA 5IFJB 1CECA 4G11A 5TH2A 5LAXB 3CPUA 1Z9PA 4WZHA 3BLOA 2CIKA 4GNJA 1TPH1 4IXXA 3WO4C 4F9PA 3ES8A 1F58H 4LY8A 1AQKL 4PR4A 1M71B 3DFQA 2WLIA 2J27A 5CQ1A 1H3UA 1I82A 3I6LD 4ZO6A 3QUKA 4XMXA 3H2NA 5GRYA 4LYPA 4LALA 2GQ3A 4XWGL 3WJZA 4QITA 2GSGA 4Y8DC 2O5ZL 4DKEL 3B8IA 4OLEA 4IQDA 2DW6A 3QIBD 1KEGL 1AHKA 1JPIA 4U1NA 3QCTH 4NQDA 5DJ2B 2ATPB 2O5NA 5D1ZA 1H7XA 1A5OC 1P0EA 4S2SB 4UMBA 3D4GA 3ECQA 4JZNA 3UR8A 4F9DA 2VXNA 1A0EA 4MSSA 4MYAA 3CD4A 3NACL 2PXYB 1JRHH 1MJUL 2E86A 3KTSA 2AJUH 1WEJH 2A85A 1V7MH 2YBUA 3LCHA 2WCAA 3L9EA 5KW9H 1Y1DA 4WCYH 2CLPA 3OPZL 4N2GA 2FB2A 5JDSA 3S83A 2E0PA 5DC9B 1XINA 1JRBA 2ZRWA 2E9LA 1OCNA 2KLTA 3PZMA 2BLFA 3SDXA 2E9BA 4AD5A 1DANU 4HUCA 1TJ2A 1OY0A 2PDWA 3B7SA 4JPVH 4M19A 3FQWA 2DLEA 4MFHA 2AQRA 4WUUA 4FXSA 3X13B 1DOSA 4FOKA 5LGYA 1JN6A 4N25A 2R7EA 4FLQA 4PW4A 4MAUL 5CEWA 5AL8A 1CGYA 4Q9QL 2QKIC 2XN1A 5GS0C 4UQDA 3VG0H 2AKRB 4P7OA 3TS8A 3QHTC 3MPCA 1VFLA 3FB7B 4OCXH 3FJLA 1WKDA 5D1XA 4PD4K 3IDMB 3R0NA 1N2VA 4N22A 4X8XA 3AMCA 1A6UH 4U7KA 1UZ8A 4OFQA 2LQRA 3KDPB 1ACYL 3WHE0 1OC6A 5GRJH 4BGLA 3QI9D 3PXLA 4XHJD 1P7KA 5ICYA 5F2IA 4NFDA 4WHTB 2JSFA 4EI5A 4Z2KA 1QFUH 3P74A 3IJEB 5FW6A 4N86A 3IVSA 4A68A 3WKYA 2P49B 4E9YA 3BH9A 4DO6A 4MHHI 5DHMC 3NSNA 5AKRA 1JOIA 1UJTA 5AFAA 2DBLH 3GXIA 1H7NA 1ISYA 2FNBA 4O5LH 3CHVA 4BWLC 1H8SA 1HZHH 1X5FA 1KT2A 3JV5A 3DA0A 3CU2A 4XNXH 4WY0A 2PN5A 2GDQA 5B1JA 1VEPA 4DN1A 1UA7A 1TMLA 2N0MA 5HHMD 4A6YL 2K6ZA 3D39B 2Q10A 4M7KH 1B3ZA 1J5CA 2Z93B 3VFTB 1R34A 3HI5L 1MFEH 2CG9X 3LBOA 5INCA 1DTNA 4J39A 3VK5A 4GI9A 2NUTA 3AXLB 2ZFAA 1JE6A 4DF9A 3VQMA 1XIWD 1IGTA 3BPWA 2ZX6A 5AZ2L 2OYLA 3W6LA 2GABA 1SXSA 1FG2B 2ICWJ 1RUAH 4BQ8A 2D03L 2JGYA 3MWCA 2R1YB 3ARFD 2INFA 3DFSA 4AEEA 1PCKA 1A8ZA 2OYMA 4P2RE 4ADTA 1EWDA 5FGBA 4NP9A 5I5JA 2FZ8A 4QDWA 3IDNA 5DHDA 1HZLA 1TZHA 1MWAB 3JWNC 1L6GA 2WXFA 1N7KA 1X4YA 2BY0A 3X3GH 1OK6A 2RHGA 2VDPL 4DW2L 1I7ZA 3QDGA 4DQWA 2CK0L 4HWBA 3BWUC 1A49A 2ZCLH 3PLYA 2VDMB 1D5XA 3GVRA 3VXQB 4HN4A 1W3KA 2D7TH 5EIIA 1DBBH 4P23D 4K5PA 1HKKA 2PZNA 3U1SL 4I7ZC 1SMOA 1BZEA 1ICTA 5GSVB 1U95B 4JY6B 4Q22A 3G22A 1XLGA 3P0VL 3RB5A 5HHXL 5DMNA 5IIEB 1Z42A 4MFDA 4RIRA 3Q67A 2OA9A 2XFFA 4EMZA 4GACA 3GUFA 4L4JA 4XZWA 1TETL 3IEBA 4Z3EA 3ATZA 4D6EA 4GVIA 1UW9A 4LRIA 1YEEL 3VKBA 4APQB 1HHHB 1QKZL 1MG3C 1EIBA 1QUNA 4AI7A 3LCXA 2HK0A 2JELL 3SBFA 3GHUA 2NLJA 3I50H 1E7VA 1H8LA 5LWYH 4MYWB 5C3TA 3ABXA 2GC4C 5I6OA 3DIFA 4PWGA 3FFCD 2R82A 3HMJG 4JFHD 4XP6L 1OGAB 1K5NA 3WLIA 2W0UA 4XMPL 1LROA 4I1NB 2ZZ2A 3TO4C 5FAAA 3V4PH 1UA6L 3NH7H 1BVNP 4V1DE 1R0AL 4J5VA 3RWEB 1J5TA 3LI0A 4OLXL 3EGDA 2J88H 2ZKXA 2R4RL 3V0UA 3UJIH 3SPGA 2IH9A 3STLA 4B90A 2E5BA 4PB5A 3I4EA 3PZTA 5HVHC 3TW7A 3RO6A 4C56D 5L6YL 3IDIB 4LLDB 4L8SB 4H88L 3QCUH 1LUCA 1CLYL 2F61A 5L7XH 2BVQA 1P6FA 5HGGS 1N8FA 4HDIB 3OW1A 1JRHI 4BE6A 5F4XA 1WDDA 1O1HA 4PL1A 4CNNA 4H8PA 2O55A 1YHTA 2Q8AH 5KSAB 1RUQL 2MUCA 1MCWW 1EX5A 1J79A 2JXMA 1Z69A 2Q3RA 4Q2ZA 1I7RB 3DUSB 2P47B 1XLMA 1DDHA 5D2YA 2Y1AA 2WZMA 4Z7VB 2WZPD 5BXSA 2GJ6A 2ACRA 5JMRA 1W56A 1MDLA 4LBEB 3GUGA 1EA9C 3D4CA 1L5GA 3CSTA 4YSCA 1AQKH 1CICD 1S9XA 4U3CA 2P3YA 3MBXH 2G75A 4Z3HA 4IIZA 2YLAA 1VIWA 3N34A 3N1QC 5DHXB 4XWGH 1AGCB 3APNA 4PTUA 4DKEH 2D7MA 4W8BA 2OQHA 2XQ0A 1S6NA 1LYXA 1KEGH 4PJ8B 1OWWA 3KPNA 4OIIL 5IHRA 2Z7KA 1UR1A 4G6FD 5E2JA 1NZRA 4US5D 2J21A 5DFAA 1GG0A 1XDJA 1PIFA 4PLNC 3NACH 1GGCL 5D37A 1MJUH 1YPZA 4KRZA 4MD0A 2LVEA 4A7GA 5GS1B 3GW0A 4X6CB 5IF0B 3OPZH 3VG9B 2DWEA 1PFOA 5B7MA 1FH5L 1S9VB 3TIDA 3H70A 1A6AA 4FTVA 5TTRA 2IS7A 3U0PB 4H1LH 2OL3B 3Q65A 3GRGA 4N8CL 1T1WA 1TITA 1SJDA 4KXBA 3K7UA 4YSQA 1MLBB 5GS2H 4PJFB 1AIZA 3GTFA 5KZEA 3OKKB 1RA5A 2XN9D 3ZUCA 2MNJB 2OMWA 1U3HC 3WHE1 4MJIA 5C0AB 3SE4A 3CUJA 3SQOH 4E36A 5CNHA 5F88A 2ZRYA 2RIKA 5CSSA 2Y06H 5C54A 1BMZA 4MAUH 2BNRD 1FCVA 1S8DB 3FA5A 2DMCA 4Q9QH 4FFYH 3STCA 3OG6B 4PJXA 3STPA 3CO4A 4LNRA 4DBEA 4X98A 3GU2A 4IBUA 1FC2D 1EBPA 1YYML 3VFRB 2EADA 2PETA 3O4LB 4X9YA 4KCWA 2W65B 3SY0B 3N9SA 4P2OD 4L2LA 2ITFA 2SFPA 3UZQB 3QORB 4C6BA 1ACYH 4LVHC 4UFJA 1EJUC 2PWDA 3WNMA 2DORA 1EUAA 1SO6A 3BEVA 3N1AA 3OLGA 4A2MA 2DWSA 5DCDA 1RJCA 1NL0L 1RZJH 2FLBT 2YKKA 3SSGA 5F7DB 3GU1A 5H4ZA 1F07A 3M0LA 1DVFA 3NSDA 4D9QD 4O13A 1CL7H 2XA3A 3N40P 1NCCL 5I1IL 2F54A 3U4FA 4RMUA 4AYFB 3WFHB 3NRFA 1QA9A 1HCFX 4GJJA 2JKNA 1WX0A 3WKZA 1FHVA 3LEXA 2OYKA 2BP0A 3BPOB 4W4OA 1V02A 3K72A 2VJ8A 4A6YH 1A5KC 1U8QA 2QF8A 5KAQF 4TVPE 2DQGL 3IFOA 4PTTA 1JGIA 1ECYA 4GPVA 3EYOA 3HI5H 4TSCL 5AC7A 1MKFA 1TF4A 4ZDHB 2IG2L 2VLJD 4HUVA 1N82A 4NJ9L 3MJ8A 5AZ2H 4IICA 5F1UA 3N9RA 4MD4A 2D03H 3NQCA 4GXVH 2DQTL 2TRHA 5T1LA 4CQAA 1BQKA 4WOZA 2YCLB 3NEOA 5E8NB 3O3AA 5TF0A 3W7EA 4G9FA 4PGJA 2BRQA 2YX0A 4M6OL 4ROPA 4XB3A 2VDPH 4DW2H 2CK0H 1DV7A 2Q5BA 2PTXA 4EUPA 5GS0D 1YDYA 4DHGA 3L4TA 4BH7B 5BOEA 5KVEL 2ZKWA 3MO1B 3D47A 1INDL 3RRAA 3DECA 2CR3A 1VFUA 4PY7A 3U1SH 1E27A 5GJTL 4P8VA 1B6DA 3LEVL 4P9HC 5HGBB 5KN5B 1SOSA 5HHXH 1P9MC 2BOEX 2FRGP 2A0NA 3FUIA 4PMJA 6REQB 3PP3H 2GWGA 43CAA 3F7VB 3LV3B 5EEZA 4BCXA 4KPLA 3PSVA 1ZXKA 3EWWA 5FF6A 1JCVA 5A7EA 3VH8B 5G1YA 2IKJA 1REQB 1TETH 4GNKB 4IMEA 2P50A 3TEZA 1EZVX 2YOCA 1E4NA 4BCZA 4CJ0A 4JVUA 4HLZH 1YEEH 5CEZE 1U36A 3MRCA 1SGKA 4ZQTA 3ZO0A 5CC6A 4HJJL 3APFA 1QKZH 3FOLA 4W8LA 5CILL 1E8WA 2ED6A 1J8SA 1SHXA 2JELH 1R3WA 1ZCRA 4LLYA 1QHPA 5DMIH 1IX2A 1M3JA 1EUUA 5JH1A 1SJEB 3EG9A 4J8RB 2J6EA 2YYTA 1ZVHA 3L3OB 4JS3A 1QVBA 5IW1B 4FG4A 4AVFA 2WO5A 2XJKA 2I9LB 3S5LA 3HGRA 4AG0A 3L17A 4PBFA 4XP6H 3I6RA 5IJVB 1VYPX 4L61A 3QIWC 5JBFA 5JPNC 1BAFL 4ORZC 5GZOA 2CBMA 2VDNB 1R0AH 5AN7A 4LU0A 3IGXA 3DVNA 1XLBA 2XV3A 3O16A 2R4RH 1E4LA 4LS0A 3R0MA 1OFAA 1U2CA 1CZ1A 3Q0HA 5L6YH 5D9MA 5FSDC 3O3DA 4QPEA 5HYQB 4H88H 3KPMB 4XI5C 4RGMC 4RV8A 1WAAF 4OBTA 4RBPK 1XSOA 3TN0D 5HDBF 4PJ6A 1PG7X 1IJNA 3DXAE 1FO0A 3GHTA 1M7JA 1RUQH 1E0VA 2Y63A 3QJZA 2WKLA 5KUKA 1XB3A 1YNTA 1BXVA 3TMLA 4Y9CA 6ALDA 3B05A 2MQGA 4A2GA 1I1AB 4IX0A 4MVAA 1SXBA 3ZJ6A 2XJ7A 2W9MA 3WSQL 5D93B 1CEOA 1V77A 1F4HA 2CLOA 4QEEA 4BHUI 3G6JF 1C9WA 1SFSA 4B2DA 4JY5L 1ZIAA 1GGUA 4ZO7A 4HYRA 1LT8A 3NJ3A 3G5VB 4LHUD 2ZWSA 3D18B 2XY2A 2AEOA 3IXAB 3W28A 5C0IA 5AALA 4Y4FA 1A3LL 1D2PA 1YDPA 3UXFA 4R34A 1Z3GL 4F0HA 1XIHA 3LCYA 1OX4B 1W15A 1GEHA 2RGMA 4OIIH 1XQLA 5EOCJ 5E9AA 1W0WA 4IOIA 4DVOA 4IIDA 1I8AA 1C7TA 5MEND 4QG6A 1IR2A 5IB1B 4GXFA 4UAOB 4GRMA 1GGCH 2Z1WA 3F85A 2E9JA 2ED9A 4MOZA 5HHQA 1GL4B 3H4XA 2DQFA 2AQQA 4IJ3C 1NCUA 1XZ0A 3REQB 3S88L 3A4JA 5K39B 1FH5H 1ES0A 5KBDA 4FF5A 5DRXB 3FDKA 1QOKA 1WBZA 3JVFC 4S1RL 2DYRB 3ZDYE 1KCVL 4FNSA 3TVMD 1JAKA 2VR6A 3M5VA 3U0WL 4J6IA 1RBAA 1W6TA 3TO4D 4Q9RL 4N8CH 2GT9B 2COQA 2YK1L 1ZLVK 4LEEA 1WZLA 1S7UA 4N0YL 3GMPA 5ES4B 3K8MA 1QI3A 1MHPL 1CL7I 5E0KA 4GZJA 3DTXA 1JNJA 2OCZA 1ZGLP 2JKXA 3LSOA 4LOFA 2VGBA 3K3QA 1KM0A 4HOMA 1Q90A 2DFAA 1GQKA 2QUVA 3U7AA 2YCJA 2QPXA 4UYQA 3BUBA 1LQ2A 1MHCB 4JVWA 2G5BB 1YYMH 4OZFH 5U4NA 1ZE3C 2ON3A 3OJGA 4Y2LA 1I2RA 3AMLA 5H91A 2ZYHA 1NM4A 5DEFA 4LKXB 3K2MC 3T0CA 4R3UA 1JVOA 2ABAA 4MWAC 3RUGE 4DX3A 4YSAA 3GKWH 3OBKA 5BVJA 4OTXL 5EUOA 32C2A 4F8TA 5C2BL 1G7LB 4MGGA 5F7MC 4OFYA 4YMZA 1V10A 4WI9A 4QRQA 1NL0H 4QY8B 1FH8A 2P7TA 5AOZA 4IMKA 3ZTDC 1M65A 1MOEA 2H3KA 4OCLC 2JF1A 2C9XA 4Q4EA 2DZEA 2IW0A 4UTAL 3EOBB 1P5BA 1RHCA 1NCCH 1SLUA 5I1IH 3ZLGA 3FN0L 3SQBB 1OOWA 4N1HB 2IFFL 3VCLA 2Z4QA 4BSWB 1V6TA 4AQAA 5IREA 2OMAA 3VC6A 4NJAL 4FEIA 4LJ3A 1XF0A 4QHUA 3CAQA 3VXNB 3FTYA 1B0WA 2DQGH 4ML9A 3GX9A 3C2SA 5L2KA 4LCUA 2ADGA 1G6RL 3ATDA 3BT0A 4ODWB 4AK2A 1W8NA 4TSCH 1RPQA 4LLQB 3EFDL 2ZXQA 4AQOA 2IG2H 1S3TC 4ANWA 4QISA 4Y0GA 4HS3B 1IIGA 2KI6A 3MX0B 3CQPA 3H2CA 2VZOA 4XPHH 3OR6B 4MDIB 5F9AC 1WOAA 1E1EA 2C9VA 1MN4A 3KD4A 1I8MB 2YL8A 5F96L 4BDVB 4HPHA 1CQYA 1OAJA 5GGSB 4S10A 5JORB 1U8MA 4NRZB 3UX9B 2YRZA 4S0HA 2J77A 3HLAA 4M6OH 5SV3A 5HYSG 5AW1B 1ZCOA 4R3SB 3BQ5A 1V7YA 4B9ZA 3KE0A 1B30A 1WCQA 3ALWA 1O9VA 2HV5A 4DT2A 3ZT6A 4I18C 3SJVA 3W9DA 1GQLA 2K70A 2Z4GA 5KVEH 4GQBA 1INDH 3Q9QA 2WAQA 2Q7NA 3RDKA 4NN5B 3B8VA 3B8DA 2A6IA 4HNLA 5GJTH 2OBGA 2X9XA 4UOZA 3LEVH 3QC6X 2J1WA 1D7DA 1NUDA 2VO5A 4GY4A 1YN6A 2XBZA 1Y5VA 5KVGL 4S1SL 5EV7A 3GHEL 3PZ9A 1IC7H 3VI3B 4KFNA 1JVNA 2C1IA 1LNUA 3CUPA 3BVUA 3L6FA 3I6EA 3M43A 4JFOA 1W2VA 1IQDB 1T5AA 5AVTB 4HJJH 1VBRA 3K81A 5CILH 3B6SB 5IQ7L 3NPWA 4NUMA 4WWKB 4Z7QE 3VXOA 1EERB 5KS9B 2VC2B 4Z77B 2X0UA 5LUMA 2WBJB 3BEWB 3QQ3A 1R3RA 4HU3A 2YBRB 4NN6C 4MNGB 4WW1B 3URAA 4X8CA 3ZE0F 3D34A 2UX7A 5D7JC 3ILEA 4JTFA 1E65A 4KX7A 4YR6A 4R5TA 5G1TA 2BW4A 3SCVA 2PGFA 2JH2A 2B16A 2BW5A 1BAFH 3FT1A 4Y8FA 1XIDA 4UQCA 4TX8A 3D4ZA 1KB9K 3AJXA 5E8PA 3ESMA 4L80A 1SXNA 1GPFA 1U33A 3S36H 4DAIA 4QMEA 3WL0A 5CSBA 5CO1A 2CDEA 1CLKA 4FF7A 3AIQA 1IXOA 2ID5A 1UR4A 3UETA 1EP3A 2PS2A 4YDVA 3KBHE 1P2CA 3BW9A 5KYNA 1G7IA 4P7RA 1A0QH 3RTQB 4REQA 3MCYA 1OCZB 5PAZA 3MRMB 4XBMA 3FBKA 5A7BA 3CEUA 5KOVC 4H41A 4P46D 3GDCA 5D2TA 1T7LA 4UF7C 4J2MA 5FKPA 3SY8A 1DEEB 4LGSB 3LKNA 1OABA 3CJJA 1AXTL 1FORH 2QGBA 1U8HA 2FSEB 4BK4A 3WHXA 3UBXI 3HFYA 4OGZA 4G71B 1ZT4A 2IXVA 1ZHNB 1OT4A 3FU9A 3VRLE 3FQRA 3SSJA 1M2VA 3QRFM 4G72B 4YVVA 5KYUA 2FDMA 1J8HE 2WCSA 4LLWB 2Y5TA 3G04A 2FO4B 5EMUA 3MA7A 5D1QE 1BPVA 4LRNL 3IIZA 1RCXB 1T4KB 1FHLA 1A3LH 1CLVA 1Z3GH 2NR6C 4G6KL 3EPMA 5K9JH 1V6XA 1AGEA 2WJ5A 4HGWA 3W01A 3FCBA 1QI4A 4QOKB 1YO4A 1J0JA 2IH8A 1N0XL 3VINA 3OYZA 4OVUA 5KYYA 4PI2A 3GNPA 4BQ5A 1TVHA 2G2PA 2XVKA 4DETA 2KPNA 5JXED 4TLSA 4UIOA 2OWCA 2K3TA 1BVZA 2VLKB 4E9SA 5I78A 3OX8B 2FNWA 2BSSB 3S88H 4GRLA 5T33H 3GDLA 3G5YA 1G43A 5CGQA 2YFNA 3EAUA 3KNBA 1Z6JT 2NXYB 4S1RH 4CMMA 2GQHA 1PZUB 1KCVH 3G1XA 5BXPA 3QIWD 1FP5A 4Q9RH 3BLFA 4P2QD 1ZVSB 1U93A 5LNVA 2YK1H 3WTUA 1T1XA 2H3XC 4XO7A 4LH8A 1MHPH 1FGNL 7ODCA 1SOKA 3VXPB 1TUXA 1QDSA 2DQEL 2X4PA 3SKOB 4AC2A 5ADPL 2CNCA 5D2WA 5M7QA 3DIPA 5TGBB 4NWUL 2IGLA 2WHVA 4DFHA 3EEGA 3GTIA 3G0UA 4EF8A 2X4TA 3FDGA 5JW5A 1JZJA 2EIMB 2XTJC 2TRSA 4GYFA 3GAKA 1A4MA 1FTXA 5F9DC 2ZUYA 3GJFK 4Z7NF 1TMQA 2DWTA 2YWYA 5KVMC 1ETJA 1J8KA 4Y19E 1AHWC 3JYBA 4WI4A 1DO5A 2NXZB 1WWWX 3KPSD 4R7JA 1MVFA 5TQ0L 2BVDA 1M57B 1TTRA 3RG6A 5CG0A 1G7MB 4W9DC 7REQB 1CXLA 4KV5E 3HC4L 3U48A 5JH2A 3LHUA 1BKSA 1UH3A 4DWSC 4PLKC 3CFBA 4PH8A 3VGAB 1E40A 1KPVB 4ODUA 1LMIA 1V6WA 4RPQA 2LV4A 1JRHL 1U8OB 4L3ED 2AJUL 1WEJL 5LCVA 4FQQA 1LO2H 1LM8V 1E28A 2VMCA 5JUEL 3MKVA 3EO0A 1HKJA 1EXBA 3WTYA 4FQHB 2XKNA 4UMGA 3FN0H 2ZP8A 4EIVA 2IFFH 2GY7B 5T3XE 4M1CC 1EJ8A 1MCOL 2WZAA 2IKIA 2OS7A 4YTUA 4KCTA 4NJAH 4FX8A 1UVQB 3W70A 4JAMB 4RW5A 5K5YA 3ISRA 2CKSA 2HG5B 4DGUA 1VHNA 3FCUB 1LILA 4GIPD 1G6RH 4IRSA 1I60A 1QBAA 4OZ4B 3KW3A 4I1PA 8FABB 1WKYA 3CFJA 4RE2A 1FFPB 2VO8A 2Y8VA 4H9YA 3EFDH 2P8LA 4GB9A 3SM0A 4LUJA 1UURA 2ENJA 4UTCA 3TPKA 1SJAA 5D55A 3I6SA 1URZA 1ASPA 1HEZA 4PUBL 5FO9A 4UAHA 3SJNA 3W7NA 1CUOA 1G7PB 4M9PA 1QVOA 4AZIA 1KTLA 4EJ1C 3KPPA 1QT1A 3R43A 5F96H 4HYTB 4QHKI 4FIQA 5DRIA 3OVUB 5EIVA 4HIHB 1ZKAA 5C0NC 1MUWA 4MMYB 4DYKA 1E6JL 1XGQA 3ZT7A 4ZE4A 4QYOB 2POTA 1OINA 3AHVA 3MBWB 1B4TA 2HTKD 3TBYA 3IIOA 3LAFA 1FAIL 1OF8A 5T5NG 2PFHA 1QFUL 1IO4C 5B38B 3SGDH 2ADJB 5CD5C 1HJCA 1T5WA 3TT3L 4HCFA 5CLTA 2VJ0A 3WYZA 2YSSA 2DKSA 2VSKB 4B97A 2OWWA 2LT9A 4AV0A 3S6TA 3DWTA 1C92A 2A3TA 5CH9A 4EVNA 1XV8A 4M7JH 4MWAD 4PS7A 5KVGH 4F7TA 4S1SH 3LBMA 3E3QC 1CDUA 3GHEH 4XPTL 1OE2A 2Z35A 1UG9A 3A4XA 1KYFA 2GUOA 3W7LA 4XNXL 1D9KA 1B2WH 2H6PA 1PYWB 3DPBB 4N0FB 1G1CA 3SUTA 1G4MA 5J6SA 1QMUA 1BF5A 1CWYA 2AMXA 2Z34A 2AQ3A 3MRQA 1FC1A 4MADA 5JHDE 4ZTYA 2MSPA 1Z9MA 2AZAA 3WLWC 3IGSA 2QR6A 4MX7B 1YRRA 2OT0A 3R0KA 1P1XA 3V6ZA 3HCVB 2EH7H 2DDQH 2R69L 3ONBA 3A3HA 3WKQA 4G8TA 4F7MB 3VXME 2OO0A 1T83A 4OZOA 4Q6IB 1VKXB 4ZMYA 4TMPA 2WJ7A 3NVDA 4ZMZA 4ZZFA 3GXFA 1QFWM 5C0BD 2IADB 4Z2JA 3G6LA 1XB8A 4KK6D 5KZ6A 2PDLA 2GI0A 5JU6A 3VGEA 5A2CA 3R8GA 4ELMF 1R17A 3EJSA 2P5WA 5ITFB 4B5SA 4KH2A 3S5OA 3QUZD 4HU4A 3RL1A 2CRYA 4QRRA 3SO7A 3XIMA 2RFXA 4JDVA 2CK2A 4IOFC 5KSVB 2J8TA 2PTYA 2D7TL 4OOZA 2H8PB 1PZBA 3F58L 1OD8A 1GIGL 4FA6A 5KANG 1KMGA 4WNQB 3WK2A 1RIVL 3MQIA 5TDNA 3TXAA 3A4EA 4BZ1L 5KEZA 1AXTH 3P5ZA 1JDCA 4ACTA 1XYLA 1H9DA 3TX4A 1V03A 3CNKA 1R5VA 3VXSA 4L8CB 2REQB 2OQLA 4MJJA 4YS1A 3M8OL 3GFZA 3KRUA 2QMKA 1EJOL 3VGBA 4R96A 3VWJA 4L9XA 3VO0A 3US1A 4M7TA 2YPLD 1OGTB 5ALCL 3EWDA 1Z66A 3LN3A 3L1OL 3QT2A 1EPVA 3UC2A 5EU7C 1M04A 1HHIB 1KIPA 3I50L 1MG2C 2HE5A 4G6KH 2PUZA 2GJZA 4H19A 1DVQA 2QF7A 2X10A 3ILPA 1I0DA 1N0XH 4Y1AB 3H54A 2XWXA 2C9AA 3X11A 1MH5B 5JOFA 1HJUA 4OLWL 1TSHA 5LKYA 4DZHA 5BW6A 4HSAC 2FIRT 2IANB 3CPRA 1DLHB 3V5OA 1TIUA 2HG0A 3O0KA 4KKBC 2HN7B 3CLWA 3BISA 3IJHA 5BUPA 4OF8A 5D7JD 4O57A 5MHSE 1M56B 3B9AA 2KT6A 1L2QA 3UG4A 1NAL1 4GSRA 3EGXB 5DXXA 1HVXA 3GR7A 2J8OA 2LFEA 4JLRA 1XIFA 3N40F 5CPQA 5DRZB 3KYNA 2HUHA 3WFBH 2DQEH 4JX0A 5ADPH 3HE7A 1A0CA 1IXQA 4HZMA 1OW0C 3S4SA 1IARB 4Z7UA 3PZIA 1TJGL 2QCFA 2FH8A 3B8YA 4TQHA 5EBMB 5E1HB 4F66A 4JQIA 4JY9A 1J48A 1HUVA 5FC9A 4AL8L 2WJFA 3KBMA 1FHNA 1U41A 5DZVA 3C87A 3MBXL 4TLUA 5DBTA 2GVEA 4PTWA 5EO1A 5TQ0H 3O0RL 5LBGA 5DLML 4Q6YA 3E9TA 1W8OA 3IU3B 3NDZA 3HZVA 5CCHE 1QFPA 1E6PA 2FMOA 3HC4H 4P06A 1JJUA 3OEXA 1JGMA 3K8KA 3LEPA 1XLEA 3ARVA 3L2LA 3FPXA 3UDWC 4XD6A 4G1EB 4E9WA 3OSKA 3HE6B 3LQAL 2J57A 4JBRA 4KRLB 2K78A 2V7HB 1BRLA 2X05A 1N59A 3M7FB 4MD5B 3UTTD 2FKPA 2J7LA 5I2IA 5C0CA 2WB5A 1DKWA 3C2RA 3HV8A 1POJA 3B8TA 1JI1A 3RNKA 5JUEH 3PGDB 5FYKD 1BZDA 2AEQL 1VAHA 1AGFA 5TH2B 3W26A 1GYVA 2NR6D 2XU9A 2XZZA 1BQRA 1I9CB 1F3JA 1V5XA 4CBPA 1H51A 4MUZA 1A0DA 1MCOH 5EU3A 2R1NA 4O10A 1E4MM 1YY8A 1EXUA 3SGDI 2BSCA 7A3HA 4NUJB 2QPFA 1E6SM 4I6KA 4J1OA 3IJIA 5JZ7C 3ZS4A 4H9ZA 3LKOB 4P8UA 2GSGB 3P9MA 5ABFA 5IR1A 4PJ9C 3N1FC 2OMYA 1KPUB 1QNZL 4E8CA 3DC0A 4U1NB 4A38A 2IBZY 2ZOKA 4NQDB 3SQOL 4I77H 3HMCA 2DZXA 4PUBH 1WDRA 2Y06L 2P5EB 4JZNB 1JGLH 1TQXA 1FYTB 1Q1PA 2ICSA 3Q43A 4FFYL 1N6QL 1QFOA 3MOBL 1SHMA 2PDIA 4XVOA 3QM3A 3SE8L 2JK5B 2DQXA 2KC0A 2UWEF 3SRKA 4GVGA 4YK4B 4QRPE 4TN9A 5JDSB 5D5MF 4ILDA 1QSED 4JPGA 1E6JH 3AU2A 4DOHE 1USQA 5E93A 3PDOB 5I26A 3G24A 3EOUA 2OJEA 1UM4H 4ENEC 1RPXA 1Q0XL 2POZA 1HS6A 2XTJD 3SD5A 1FAIH 5ANMB 1KF9B 4HCGA 4K07A 2WXKA 4CCDA 2XBTA 3TT3H 4HT1L 1RZJL 5EMYA 1H5YA 3TF4A 1U5HA 1L0QA 4KNUA 3CT2A 1XGRA 1QEWA 5MEOA 5HJGA 2K8QA 1CL7L 4Y2WA 4NI8A 1U8LB 1LO5A 4K94C 2G4JA 4FZEL 4M7ZB 4XPTH 5FEXA 4IBYA 1HOCA 5CWSA 4JFSA 4DWSD 3PU7A 1H3WM 1JFHA 1PNCA 1Q94A 4Z7WF 3E2HC 3NPXA 5D1XB 2ZXWB 1JYWA 2BINA 1NANH 4XMVA 1GKRA 2JKPA 1UZ8B 4YGVA 2GGHA 4FADA 4XZ4A 4P61A 4YZFE 2Z1SA 4LF1A 3WN5A 4JEGB 4JPIA 1AD1A 1U3NA 5AW2B 5ICYB 2E6PA 3RFZC 4H44C 4EI5B 4M1CD 4IEFA 3H3KA 4P7LA 2ARWA 1SDDB 4AH2A 4XAKD 2C7FA 2D31B 4A7TA 2R69H 2WLMA 1GZPB 3CPLA 1IJ9A 3N44F 2OL3L 3L5HA 4GXVL 1DBML 4A67A 1E51A 4OV6F 4PJBA 2J25A 4OZGB 4J3WA 4R85A 1T5XA 3D0LB 3DERA 3QNXB 1KT2B 3Q8AA 5HPMA 2EDJA 1JDFA 1S2TA 4HZLB 1D6EA 4UIMB 2DLHA 1H7RA 5GGRY 4O16A 2M26A 4UTTC 1F11A 4AF0A 4Z1PA 3VFSA 3E6FA 1KKRA 1DZBA 3FC8A 4PRPE 3PRZA 3F58H 4NO0B 3IARA 4XOBA 2FVKA 1GIGH 1PDKB 2AGTA 3QH2A 2NV1A 1RIVH 3F7RA 1L9OA 2NUTB 4GUIA 3WGVB 1JP5A 4QQUA 4BZ1H 1KFCA 4KZEL 1MJJA 3EMQA 1UGKA 4P5TC 3CBRA 2IV8A 1GQNA 5CC3A 3EBGA 5CUSL 4DPBX 5EBGA 3M8OH 1B5TA 2BNQE 1EJOH 3M5ZA 3IDNB 2GEEA 3KLLA 1S38A 4XOAA 4HBQA 5DFWH 3TESA 1AQMA 1FAKT 1I1YB 4QXIA 2IQDA 5CBBA 3DRTB 3FU0A 2V30A 1WDAA 4HA3A 5ALCH 1QTWA 2HT2C 4PJCF 2HLEB 3GTNA 3L1OH 3L67A 2Q09A 3QDGB 4PGEA 5DMIL 2ZQKA 1JF5A 1REIA 2XN2A 5RUBA 3BD4A 2ZXEB 1WBHA 4GH7B 3W1TA 3E8VA 3GQYA 2XISA 3NBNA 1WZKA 4DZIA 1KUMA 3SDCC 4YN5A 1WNOA 3CVCA 4OLWH 5IB4A 3JWNG 2ALRA 3KBJA 3NZUA 2CCRA 2FQEA 2IJ0C 12E8L 4Y5YA 4RIRB 4Y9GA 1I8IA 3T8MA 2AQVA 3HHSA 2GYSA 1GQIA 3W38A 4LCQA 3T8QA 3IE9A 3PZOA 4HJGA 2DRUA 1BWLA 5LDUA 2ZKYA 1HFUA 3WIHA 3LVTA 3S8HA 3WLWD 1SM9A 3DGRA 1VACB 1B3XA 1NFAA 3P4MB 4ZSTA 1QFWH 2IO5A 1H4PA 4LHUG 4JRWA 3HQPA 5DHYA 2C4FT 4RGNC 4BZYA 4NNBA 2YSTA 1A7QL 3TVAA 2A4AA 2AKMA 3DFHA 4KT2A 4Y5VB 4EBQL 3LRLA 3Q2WA 3TUUA 3DUGA 4OCNC 3DIFB 3I9AA 1TJGH 3EX1A 2QFRA 5F7KC 1K5NB 3KPOA 3BRFA 2VDMH 3NO3A 4ADGA 4JRXE 4IOFD 2H9AA 2VRQA 4LB4A 2PPAA 4EIBA 4O0QA 3C56A 4AL8H 1JWMB 4PGCA 4JR5A 3EGDB 4EO5A 3HMXL 1THFD 3STLB 1M9SA 4P5KA 1IAOA 2ZUUA 2IXUA 3NSXA 5TPWL 3O0RH 2YOAA 2I07A 5DLMH 1RZKC 4HVXA 2NUPA 3LMYA 3ZX1A 4YWGL 3M07A 1D7BA 4WKHA 4AJVA 5L2JB 1Z1WA 4AYEC 2VN6A 3UFIA 4MY9A 3MV8E 3OJDA 3B97A 3LQAH 3MBEC 5GRVL 3MV9E 1E5NA 3CV2A 4XCNB 3BSGA 3W07A 1KGJA 2JXMB 4DLMA 4HOWA 1B0GB 2H32B 4ZOCA 4Q2ZB 2CIIA 5D30A 2HFTA 1DDHB 1S9WB 4MHBA 3VKAA 1EJXC 2K7PA 3I6GA 3BUTA 3U9UA 1ZRUA 2AEQH 1Q9WA 2GJ6B 4O02A 3GI9L 4XXCA 4AENB 3LZOA 1IGJA 1L5GB 2WSYA 1XD0A 1WQVT 3WH8A 4ERIA 3KZSA 1S9XB 4UTMA 2OCJA 3MUHL 3VD4A 4YYCA 2VDNL 3TYEA 3WEXA 3T8XA 1ORSB 4I9XA 3C8FA 4A7VA 5A6TC 3TQ0A 4D94A 2F74A 4MNMA 3LH9A 4TKWA 3WDPP 2EEFA 1QNZH 1W9BM 4CSZA 1R33A 4I7UA 3IK2A 4KKBD 4K9JA 5ECGA 5IMLB 1QSFE 5IY5B 1N6QH 3PWLA 2ZCZA 4MJ6B 3CZEA 3MOBH 1GOKA 4MD0B 4YAQA 5ETUA 1NANI 3SE8H 1X5JA 4UQAA 3ARDA 3QWRA 4BUHA 5ISZE 4WTZG 1LLWA 3D25A 3PIQA 1O95A 2APTA 4M1BA 1FZKB 5T1JA 3DSFH 1LOQA 3W73A 4A3HA 1NEUA 1RSCA 1WC7A 2Z64C 1HSAA 1WIUA 3QTPA 2A38A 1TEFA 5ADOL 1XYZA 4H83A 1PG7L 3GKWL 1Q0XH 2VIRA 3CUZA 5SWZA 1K6AA 5AY7A 2QQ6A 1F4AA 3BIKA 4U5IA 3RBSA 1HH6B 5IVXB 2VDKB 4LHJB 3W1MA 1L0YA 2E7MA 3WY2A 2XGZA 4HT1H 2EPLX 1PSKH 4JO2L 3GDMA 1SN0A 4KTYA 3FLUA 3ARBA 4X3ZA 5EFIA 1A4JB 2DZAA 1AH3A 2ZWLT 4IQJA 4PRAB 1WQ5A 4P57B 1CI5A 1RZPA 4DP9X 4PJXB 4FZEH 3Q05A 4LNRB 5D2LB 5AYBA 4X98B 2OULB 4JZOA 2HKAA 3GLZA 4NHUA 1T40A 5EOTB 4NPYB 3LNPA 3TW9A 1BWMA 2FEDC 4PCNA 1Q13A 5A6SA 5KYXA 1GYCA 3BEVB 3JSSA 3N11A 3D2UD 3L1EA 4X5PA 4HLJA 1NEPA 3KYMA 4B5WA 2EDNA 2EQDA 2VLMD 4YC2B 4MDRA 1AZUA 5TIMA 3K4DA 1R7AA 1W3IA 1TQSA 3PUDA 2W95A 4IHBA 1R2TA 5E5RB 3QAZB 4XPHL 5FOBA 3NSJA 3LZFH 2OL3H 3S1GA 3RGTA 1DBMH 2XXFA 5JZ7D 1RJZB 1TJHH 5CJXC 3NIDF 3S8GB 5FM8A 2EPHA 4PJ9D 5AVZB 3ARYA 1YC8A 3TU6A 3MYJB 3LEXB 5DD6B 4PTMA 2BP0B 3KVLA 2H90A 3OA5A 3IJYA 3O2WL 3K72B 3E2RA 1U8QB 3ARGC 1TJXA 3KM1A 4H0IA 1LO3H 5C3LD 4Q89A 2QGCA 5SWSB 4JTAA 5I17A 1V3HA 3VNKA 1LL7A 1GYUA 4XZBA 1JFXA 5TNVA 4XNQB 3U7YL 3MJ8B 3BICA 3TXZA 2ZJSL 4PY8I 4X4MA 4MCMA 4B9CA 4KZEH 4IH3A 4P5SA 1MCJA 4DESA 1QFWI 2ABBA 1IC7L 1KQYA 5CUSH 3MUGA 3ZR6A 4MMXA 1Y8BA 3KDNA 2KZBA 2Z4TA 4QXVA 4G9FB 1M42A 3RMEA 2X4QA 4FRWA 3QUML 3K6OA 5FYJD 1N9PA 3L2MA 4FFWC 4QHLA 4X99A 4LSVL 2J8UA 1PKQA 2EAWA 1A2YB 4DJEC 3K30A 4XRCA 1KIQB 5K1JA 1RJYB 3N5AA 4OB5L 2ZXGA 4LASL 4NUQA 4HCRL 4N2EA 1NKOA 2NY3C 2C0HA 5K9KB 1E27B 2LLEA 2BNUA 5LZLA 1IBGL 4AGPA 3N6QA 2BVUA 5CF3A 1BJ1H 2CW6A 3WNKA 12E8H 1VCGA 5FB8A 43CAB 4AY7A 3CZLA 3D48R 4UU9A 4XZUA 5FDWB 1TIWA 1SLVA 3LK6A 3WJJA 3DMMC 3S36L 3IIXA 3AM8C 2X1XR 4RETB 1FFNA 1WFJA 2JKEA 3OMAB 5I1KH 3N91A 3FOLB 4LCWA 1TJ0A 3HN5A 4C6IA 5D6DA 1A0QL 1GOIA 1TPWA 1MYRA 3DGBA 4XVDA 1YE4A 1OAQL 1A7QH 1CDYA 3H22A 2YEZB 1AO7A 4C6KA 1QI5A 4EBQH 5L4MA 4BWTA 3STGA 5DS8B 5IQLA 1NUNB 3QEQB 4W7UA 2ZOLB 4ZSOB 4U4IA 2J7BA 3LSBA 1B4EA 2X7VA 1FORL 5DZ9A 3E1F1 3P77A 3P2DA 5DQPA 2HRGA 4PV9A 1M01A 1UZ1A 3TTYA 4HOXA 3W83A 1E6RA 3PHQA 4NZ1A 5F72S 4RAUB 1DHKA 5F8RC 3HMXH 1IGSA 2Q6WA 3AZRA 4C65A 3A22A 1YIXA 2B31A 3W0WD 3CV1A 4AZ8A 5TPWH 2PYEE 2H3BA 4Q6KA 2C15A 1ZAIA 5CN1A 4YWGH 4P5TD 3HZYA 5K9JL 1BPLB 3FT3B 1B90A 3PQYD 1TJ1A 2G97A 3OXSA 1P1ZA 1QOQA 3WQVA 5IK3B 4DI8A 5T5NF 1YNTB 5I8KL 2HT2D 5F1NA 1BLNA 4P2RD 5D7IF 2VC2L 5C7HA 5EO0B 3ZY7A 3I6TA 5ELIA 4XP5H 3DLQR 3GI9H 4HJEA 1BGGA 2NW3A 1A4AA 1H0DA 2Z8VC 3Q8BA 5T33L 2E7LA 2W5FA 4JHWL 4Y2DC 3SDCD 1ITCA 1QO3A 5F1IA 3NCMA 5AUMA 5CEXA 4LPWA 3FB8A 3T0VA 3NIFB 1U3ZA 3L08A 4L5FH 5C0IB 3BFWA 1DXFA 2VDNH 4G83A 3E0LA 3TEYA 3UADA 2VENA 1YDPB 3LM7A 2G41A 4HSCX 3FCTA 4QDMA 4PB3A 5DEJA 4ZAKB 4JFDD 5C6PB 1UD5A 4UM8A 1W0WB 4IOIB 1HEHC 2D22A 4NSKA 5E2TH 1A9BA 4YHOL 5KZCD 3IV3A 3G5EA 4GRMB 3OMZA 4PP2B 3H4FA 2G4FA 4RGND 1HILA 1XDTT 1JCKA 4PVMA 2QLYA 2DQFB 3W9EA 4PTNA 2LVCA 1ZHKA 4GI8A 2Z31A 2VCOA 4OE7A 3WBDA 1ES0B 4G7VL 4ACYA 2XFXB 2IQTA 2WCGA 1G84A 5E6RB 3QDJB 1WBZB 5JIIA 5ADOH 2CETA 3ME0A 4JYFA 1PG7H 3PL6C 1H49A 3ID7A 1UMLA 1RA0A 4QLWA 1L7IL 1UXSA 1GYNA 2HMCA 3PJXA 1IM9A 4G1MA 4DEPB 4JO2H 1IGFH 4HXAL 3AY4A 4V1DD 1PKOA 1LO2L 1G7JA 2XZ9A 1W5NA 4LAMA 3CPGA 1CDCA 1NDTA 2JCCE 5I1DA 4ZE5A 3EPOA 1K8DB 4DEWA 1L9RA 2A1YA 4TXEA 3W1AA 5C09B 3FS9A 1F6YA 2I5QA 3T6ZA 3MBED 1W72L 2BS9A 2B0SL 4KXCA 4Y9BA 4V15A 1RJLA 1BA9A 1AJ7H 3NJIA 2GSEA 5DEFB 4JFEA 3ESOA 1W0VB 4M51A 1I4FA 5EUOB 3P84A 4ECLA 3GG0A 4M3JA 1VBHA 2BGSA 5BJTA 1Q0YH 1YEKL 1RPUA 5E9DD 2OMZB 3MOAH 2Z1PA 4KTDL 4ZMXA 1YZZA 1WUEA 2GZXA 3MMWA 2OWXA 3R0UA 2P7TB 5G4HC 4TV3A 2C9SA 1E6ZA 4OV5A 1R5YA 2BJML 4X0VA 1D7FA 3CUIA 3FUJA 2NPLX 5EB9A 1KCUL 1B6UA 1ZS8A 5BOJA 2A6DB 3IJDA 2NY2C 2JJTC 5BOPA 3VCLB 3E9AA 1U3HD 3BYYA 5E24E 5K3VA 1SR0A 2Z4QB 4AQAB 4OZHF 4K71B 4HKJB 2X4NA 4HHGA 3O2WH 1NBYB 5EU4A 2HB0A 1RY7B 4LUIA 1OE1A 2MJWA 4P4KA 5C08D 4BI6A 5JW4M 1C7SA 4NS0A 2X2UA 3M6DA 1WS7A 2YUVA 5AFDA 5FAGA 3VFLA 1J5IA 2WSPA 3QC0A 3SZ8A 4JPWL 4R2GC 2AMGA 4PJ5A 5U7SA 2TSBA 2I9TB 9XIMA 2NY1B 3U7YH 2R29L 1TWIA 1AE6L 2ZJSH 3BJTA 1PY0A 1WBXB 4M7JL 3AUOA 2WKJA 4KJPC 1GH7A 1LT7A 1JGVL 3QDMA 3INOA 3ZMNA 3KZ8A 1B2WL 1KTDA 3WSUA 1U8MB 1XFBA 4F2EA 4PJ7F 3QUMH 3HLAB 5I73B 2AK4E 3L13A 4LSVH 2QSCL 1X38A 4K5LA 2F7OA 3D0CA 4OB5H 3SJVB 3C4UA 4EPBC 1BFOB 1DQDL 2DZSA 4LASH 3CXFA 1UJ3C 3APGA 4HCRH 1AQFA 3ITOA 4R6UA 3T1GA 4HEME 5D9SB 5JA9A 2EH7L 2A6IB 1IBGH 1YLBB 1QLRA 2DDQL 1EIXA 1FVEB 3LMJL 4QNPF 4BH8B 2DYPA 1YN6B 5KJ4A 5ENLA 5FOJA 5LHDA 1A7OL 3W7HA 3SKUD 5HJBA 2XN0A 3SKJH 3ASNB 5LNWA 3Q3GB 4Y4KB 1LL4A 3IWPA 3K2UH 4UTWC 1RK7A 3IXTB 3O41B 2VZVA 2QT3A 1NA8A 5ICUA 5FUCE 1WWAX 2PTTA 1Q8AA 4HJUA 3OYXA 2Q3ZA 1IAMA 3GWJA 4N42A 2GHWB 4C83A 2QVIA 1OAQH 3VXOB 5IUCA 3IPFA 2A83B 5MERB 2MMXA 3SY1A 3U2IA 3LLXA 3ZXWA 1P5UC 1LZOA 4JFFB 4NZ8A 3QS3A 2A9BA 3E6HA 2IPJA 2ADFH 4CMHC 3KHQA 1IEWA 1V6YA 1BOGA 4G8FA 3BP6A 4J3UA 1O6SA 4NN7C 2QSTA 5CD3B 4ZBCA 4YR6B 2BIPA 2WW5A 4HAFA 3HFTA 3ARGD 4ES8A 3PFUA 1A1OA 4NZ3A 2FJSA 5E8PB 2VFHA 1BREA 5LGKA 2HCVA 3NZPA 4X6DB 4XZLX 2OMUB 1D5BA 3V8CA 2Y7GA 5JDJA 3KOFA 4YDKL 4HMCA 2V5BA 1IAIM 1N8ZA 1O5RA 2XHYA 4KHTH 3GBDA 4YDVB 2HSAA 1DHPA 4J8QA 5IGXL 2MOGA 4REQB 3ULUC 3IRPX 3PP3K 3VSTA 3GTXA 4EDXB 4AZCA 3VFOA 3LKRA 5FAJA 2PYFB 1FHDA 3KOWA 5EDXA 4U6HA <