1XD0A

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xd0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xd0A01
1R46A 2XN1A 1JDCA 2VNCA 4HMDA 1G94A 1BG4A 3ARZA 3QOMA 4NI3A 2VJXA 5KEZA 2GJXB 1UD6A 1CTNA 2V3DA 3L4ZA 3DX0A 2BVDA 4C7FA 1NWTA 3WMSA 3QR3A 3VGDA 3CMJA 4AD0A 2CKRA 3ARQA 1GHSA 1US2A 4L4OA 3W6LA 3II1A 2XG9A 3PZQA 3WDIA 1WP6A 1K9TA 3BLPX 5HPOA 3GNRA 1VFOA 2VZUA 3OBAA 1CLVA 2EPLX 1R86A 4PMQA 4JFSA 3N17A 1CGXA 3A23A 2VQTA 3RM8A 2UWFA 1I1XA 6TAAA 4RE2A 2X2JA 1RH9A 4Z2KA 1KWGA 2J7FA 5CQ1A 4CN6A 2ZUMA 1E43A 3MS8A 4HTYA 2JF7A 3EDEA 4XZWA 5IHSA 3SCOA 3WUBA 4OIFA 3AICA 1Q4NX 1V08A 1CPUA 3T0AA 5LA1A 2XFYA 1DTUA 5ABGA 3TTQA 5E0FA 1HX0A 4U31A 1QOXA 2W66A 1KB3A 3AZTA 2J7EA 1XSJA 2WNWA 1DEDA 1B2YA 1E4IA 4AYSA 2QPUA 1H11A 1CIUA 1B30A 4NRRA 1KCLA 3AMKA 4UFJA 2YA1A 3MV11 2D23A 3AIQA 5CZKA 5CJ5A 4AC1X 4DUXA 2BV9A 2W62A 1E6XM 4PMZA 2WSPA 3OGVA 3BVWA 4UQCA 3HG2A 1MYRA 2XVNA 2A3BA 3U7VA 3IANA 4AZGA 1H0IA 2GDUA 4CCEA 1GORA 1E40A 4B15A 1UWRA 4V27A 1R7AA 4MJ2A 3VU2A 4ACZB 3QHOA 3GTNA 4AYGA 1L0PA 3VSUA 3BVTA 1SMAA 3T2PA 2F7RA 2V5CA 1EOMA 4UFMA 3L4VA 4AD4A 1KGUA 1V3KA 1VRXA 2NSXA 2WPGA 2PB1A 1JF6A 1E71M 4P7LA 1J0YA 2GJRA 3K4DA 3W27A 4GKLA 2WVTA 2VTFA 1OIMA 3A5VA 2BNJA 5F7UA 4KMQA 1SR0A 2BS9A 4HZ6A 4Q7NA 1VB9A 3AMGA 1ZBKA 3TTSA 1AQMA 4CD6A 3PBGA 1OSEA 4J3TA 2XGBA 2WLYA 3EDFA 1PJ9A 3D52A 2G8ZA 1V0LA 4GPNA 1IT0A 1AQ0A 1V3MA 3W28A 4BF7A 5EB8A 5FCZA 3WQWA 2VZSA 2DIJA 3GH5A 3RM4A 5M5DA 2WBGA 4LPCA 1UR1A 2DH3A 1V3JA 2J7GA 2Y8KA 3QHNA 3RCNA 1HTYA 4MDPA 3WELA 3CUFA 3VD7A 1CGWA 4UFHA 2Y8VA 1V3LA 3K8MA 3KLKA 1OBAA 2YL6A 3AS3A 3NDZA 3LPGA 1OD0A 1UR9A 5A6AA 4W5ZA 3UESA 2YL9A 4HOZA 5CLWA 3PTMA 1PAMA 4QLLA 1NARA 5TD4A 4UCFA 4GXPA 4N42A 4FF5A 1QI4A 1JL8A 2XVKA 1CGVA 4AEEA 4EKJA 1UKQA 3D4ZA 1NWRA 3CHEA 5I2UA 2VQUA 4JHOA 2CBJA 2X0YA 2XM1A 3WMCA 1MXGA 2X2YA 2VZTA 1UD4A 3BUQA 3ZT7A 1CYGA 3CZGA 4JFWA 3LPPA 1G1YA 2ZXDA 1XD0A 4M81A 3EBVA 2ZWZA 5A2BA 1QI5A 2WZHA 3VDHA 3ECQA 1OIFA 4JZ5A 4NRSA 2J75A 4RL3A 1XV8A 1CBGA 4M1RA 1GHRA 2PWDA 4NX0A 3FHQA 1KCKA 2DSUA 1RP8A 3S6TA 1H49A 1E55A 1PPIA 2VX6A 3VNYA 1TMQA 1M53A 2ZX6A 3VM7A 3GBDA 3AHTA 4AIEA 4J28A 1UD2A 3VO0A 3WD1A 2ZUTA 3SCSA 4HOWA 3N11A 1EOKA 1SZNA 1DWGM 2ZUVA 2BHZA 3WN6A 2G3NA 4MADA 3MKKA 3IJ8A 3WEOA 4A3YA 1XD1A 3PZGA 2WHMA 1OWQA 2DIEA 4NZCA 1ZBVA 1E15A 3A4XA 2PWEA 3CLWA 4PTXA 3AISA 5D9PA 2UY3A 5A8QA 3K8LA 3DX1A 3WUEA 3RMEA 1J10A 1TE1A 5AY7A 1E6PA 2DSZA 3AHVA 2CHNA 3AZRA 1OCQA 1VEPA 2OSWA 3LRMA 2ZX8A 4UFLA 1WB0A 4PSRA 3ARSA 4YPJA 1B90A 4W84A 4BQ4A 1HL9A 5HDRA 1WDQA 3M6DA 2YBTA 1Q6FA 1V0KA 1NWSA 4DO5A 2G4FA 5I23A 3IK2A 2D3LA 2FHCA 3WY3A 1VIWA 1W9DM 1JGIA 3WNLA 3N18A 1QBBA 4CKQA 1Q6DA 3G6MA 2J74A 1ZL1A 2CBUA 4PBGA 2JIEA 2ESCA 3LX9A 3BSHA 2VI0A 1NM9A 3SCQA 1FFQA 3BCDA 2OYMA 2GFTA 5CXPA 2W91A 4D1JA 3N04A 1NWUA 5A2CA 3T0DA 1ZBWA 4ATDA 2PI6A 4TX8A 4GIAA 4RE3A 1XC6A 3NCOA 1VFFA 2D3NA 1EO7A 5CG0A 1MVYA 4ACZA 2D20A 1DWHM 1EA9C 1E72M 2OWWA 3UCQA 1XRVA 1IZKA 1BLIA 3PZMA 3VSVA 4PTWA 1J11A 1CXEA 4DWSD 3BGAA 4B9YA 2XN0A 3VSTA 1UWIA 3FAXA 4PMYA 1A47A 4EANA 1E5JA 1LL6A 3L4TA 4CU8A 1E6QM 2VVNA 1OB0A 4D6JA 1UZ4A 3B9AA 3AROA 3ARUA 5LA0A 2AOSA 3D50A 1JZ2A 2XSAA 1U30A 1QNSA 2VRJA 1EIBA 2WM0A 2ZUUA 3ZT5A 4P8XA 2ZWYA 2ZXQA 1TCMA 3BLBA 2DSVA 3HZ3A 3MSDA 1VAHA 1Q6CA 1GOKA 2WMGA 1W1PA 3WDJA 3O2LA 4V28A 3ZOAA 2D2OA 1N82A 2CXGA 3CIVA 2F18A 2J7HA 3U7BA 1WDSA 3S2CA 1X6NA 1C8QA 2NW0A 1J0IA 2W63A 3JUGA 4QCEA 1HN1A 3SCVA 1HJUA 1PX3A 1ISZA 1DWIM 1SYTA 2FH8A 3K46A 4V2XA 3I3BA 2TAAA 1PZ3A 1R34A 2EEXA 3D3AA 2WC3A 3AHYA 3GNPA 1R8LA 3ARRA 1E5NA 2O9PA 1UASA 3PZOA 1J12A 2XJ7A 1CLXA 2D0HA 4P7NA 2CITA 3B8SA 1C91A 4P8VA 4P7OA 1XGZA 3RO8A 3BAXA 3FY1A 4B3LA 2QV4A 3LRKA 1Q6EA 4J7RA 4KRTA 5ABHA 2C8NA 1V3HA 4PEEA 1UWTA 4CD8A 4FNSA 1LL4A 4E2OA 1FP8A 3OA5A 5JBEA 2VX5A 4AZ5A 1E6ZA 2DEPA 2DT3A 1JDAA 1KR0A 3CZNA 4AZCB 2E40A 4MB3A 1WZLA 5DO8A 3VGBA 1ZB5A 3I3DA 4MNLA 3A4AA 2GK1B 1I1WA 5C71A 3WY2A 3WNPA 1A3HA 2OYLA 1QI2A 3W26A 4PMVA 3DYOA 4H41A 3LPOA 1O7DC 4U5IA 2WMHA 1NOFA 1D3CA 1G01A 3GXDA 4FLQA 1E73M 1E9LA 1B31A 4J3UA 4F9DA 2EADA 1JYXA 4AD2A 2Z1KA 3VDBA 3SCUA 1GOQA 3UG3A 2YIHA 3OGRA 3IAQA 3EJPA 3VGHA 5DT7A 3KL3A 4F79A 3AHZA 3VIFA 4UNIA 2YDRA 4JKKA 5JBFA 4GQRA 4QDMA 2J78A 4AMXA 4C7GA 3LXAA 4AISA 1KXHA 5DMYA 4CVWA 3B9EA 1WZMA 2FHFA 4CVUA 5BXPA 5ECUA 3WD2A 1WZAA 3GXIA 3WQ6A 1EDTA 2O9RA 2VX7A 4PMNA 1JF5A 2C0HA 3VPLA 3D4YA 1UKPA 2OWCA 3HMCA 4U3CA 2NT0A 4XZBA 4J3XA 3SUWA 1CXHA 3APGA 5D8WA 1TR1A 3RM9A 3WEMA 2EAEA 5A6LA 2YJQA 1NH6A 1UR8A 3MV01 3VIPA 1HKMA 3LPFA 2CIPA 1MW1A 2WMIB 3IGUA 5D9NA 1S46A 2WHJA 3BVXA 3TP4A 1MQRA 4UQBA 3EYPA 5CSYA 2WC4A 1VJSA 3ARTA 4Z2HA 4H7VA 3BAYA 4HA1A 1LWJA 1KGXA 1FH9A 4H8HA 3VNZA 3RIKA 3CO4A 1CXLA 5M3WA 1CDGA 3EJQA 4J3SA 5HBFA 1V6YA 3GBEA 3WD3A 4AIUA 3VIHA 2ZICA 1W3JA 4CU7A 2DDXA 3PN8A 5DFAA 3NJ3A 1LLOA 3VD4A 2DT2A 4OZOA 3OG2A 2EABA 1VFMA 4XV0A 1TQTA 1BTCA 2F8QA 4PN2A 4DUWA 1JFXA 4GO8A 2J77A 5ABFB 1W2PA 1O7AA 3K8KA 4QLKA 2F61A 1K6AA 1TA3B 2FE0A 1V0MA 1MFVA 5FD0A 3KZSA 4M56A 1BSIA 4EAMA 1TQWA 5CSUA 2V5DA 2VUYA 1C8YA 2D22A 5IFPA 1FHDA 2XIIA 2NT1A 4ATWA 4X9YA 1B3WA 1FH7A 3THCA 2PF0A 4W8BA 1UR4A 3W4RA 4MDOA 1TQVA 5A6MA 4GI6A 7CGTA 1LG2A 2CCRA 1PX4A 4MNMA 4OUEA 5I0DA 3AS1A 3CZ8A 1EHAA 4OGZA 4OBSA 4LXFA 4EK7A 3VGGA 4FLSA 3ZT6A 1C93A 2Z1SA 4ML4A 3UERA 1ITXA 1HIZA 4W86A 5A6BD 3IJ7A 2ZX5A 4CD7A 1BQCA 1TVPA 1ITCA 1HVQA 2VO5A 1DWFM 3WF2A 1GNXA 4Y7EA 2O9TA 4L4PA 1K9DA 1HXJA 1LF1A 4M82A 1CNVA 1UD3A 2J47A 3VIKA 3WD0A 2QLYA 3AZSA 3VDAA 2EPKX 3LRLA 1FFRA 3TA9A 1EO5A 1B1YA 2WSKA 5A6KA 3NSXA 1JZ7A 2EPOA 5IXEA 1E1FA 3LXCA 4AY1A 2VR4A 4FNQA 3RILA 5LA2A 3CC1A 1R87A 4JFVA 2A3CA 1JD9A 4K68A 3O6AA 2BHUA 3DX2A 5CPQA 1QHPA 5I24A 3UR7A 1V02E 2F7QA 3FNDA 1WNOA 1BYAA 2V3GA 3K4AA 2J8FA 1XH2A 4PCSA 4YHGA 3CV5A 5FL0A 2UY2A 2WMKA 1NP0A 1WE5A 1GQJA 1XHGA 3VX1A 3L4YA 2JFEX 2VURA 2J7DA 3T0BA 4UQEA 4JL1A 1QWUA 4ATLA 3ZJKA 1W91A 2EO7A 3BMVA 4A3HA 4IPNB 3AIVA 1LG1A 1QHOA 6CGTA 5E0CA 1HXKA 3IAPA 5AYIA 3WBAA 5DF0A 4TX6A 2HVMA 1ZU8A 2XIBA 4AXNA 4UQDA 4JCMA 3I3EA 3OGSA 1GVIA 3ZQ9A 5BWFA 1W3LA 4Z2LA 3TTOA 4MTVA 4FNPA 1OINA 4FLOA 1G0CA 4TUFA 1NOUA 1CENA 2J7BA 3CH9A 1MW0A 2GSJA 2D73A 4PTVA 8CGTA 2Y2WA 3AOFA 1E3XA 2E0PA 1ZBCA 4EE9A 3F5KA 1DWJM 2VL4A 1E3ZA 3M46A 2FGZA 2ZX9A 4IUGA 1X6LA 1B3ZA 1KXQA 1JZ5A 4BZYA 3CUHA 1R85A 5A69A 1KXVA 3WFZA 1BYDA 4TXEA 4JFTA 1UR2A 3MSGA 4UFIA 4QLJA 5D8ZA 4AZBA 4GO9A 3MUAA 4X0VA 3DDFA 5BCAA 4GZJA 2ZXAA 4J3WA 2WVSA 3SCRA 2ZXBA 3DYMA 2PBOA 4TTGA 2QF8A 4LQ1A 1MWOA 4X0NA 1M03A 1HL8A 1JDDA 2A3EA 4B16A 3NUKA 4E8DA 4D6IA 3EMCA 3A24A 2GJPA 3VTRA 2ZOXA 2CERA 4CGTA 4CCCA 3WD4A 3SCNA 2CKSA 1IV8A 3VGEA 5GPRA 4D72A 3VMNA 3QGVA 1C8XA 1C92A 4P8WA 3WMBA 3U57A 1OGGA 9CGTA 4KH2A 4DO6A 3H55A 1MXDA 3TONA 4CD5A 5AYBA 3GDBA 1EGZA 2WANA 4CCDA 2WZIA 4UOJA 5CPTA 1EH9A 5ABFA 3WH7A 2WMIA 5C8BB 4GZEA 4HA3A 1BGAA 2WLZA 3O9NA 2W92A 4PRWA 3WQ8A 2WW5A 2PC8A 1C7TA 1JZ6A 1V02A 3QOKA 4MAZA 2BY3A 2E9MA 3BUPA 2UY5A 2WXDM 1T0OA 3W25A 4A4AA 1UQZA 2IXVA 4D6DA 4MPKA 1W1YA 1TVNA 1U33A 1W9PA 4E4PA 1KBBA 2OYKA 1NP2A 1QW9A 1JNDA 3BLKA 2QHAA 1R7OA 1LL7A 3GXMA 5C70A 2XVLA 1W1TA 5BRPA 1BVZA 4UQAA 1M01A 3AIWA 3T09A 3ZJ8A 4AZCA 3UETA 4AD5A 1KBKA 3AYRA 4DWSC 3VUPA 2X05A 4FK9A 4JKMA 2J4GA 4BQ5A 4JHZA 3N9KA 3BVVA 3CZLA 1UKTA 3ZR6A 3CHCA 4PUEA 1UWQA 1V3IA 3WKZA 2WCGA 2JEPA 5M03A 2WCAA 1AVAA 2VC9A 1J0KA 1R33A 3SCWA 1CGTA 1GONA 3OB8A 4UOQA 1W2VA 2VZVA 4PMOA 4PUDA 1JIBA 3CZJA 4ZFMA 4BS0A 1ISXA 5EFFA 2Y4SA 2XYLA 1JAEA 3SUTA 3WIJA 2FYVA 3VVGA 3W38A 1CWYA 2W4XA 4NXSA 2YA2A 3EJRA 3A47A 2GDVA 1EQPA 1UR0A 4AIOA 1CECA 3SCTA 4HPHA 1HT6A 3FN9A 1R75A 4JKLA 2XN2A 1D7FA 2OLHA 1GJWA 2CESA 3VD9A 4P8UA 1HKIA 1HWWA 4KGJA 1W3HA 4F9JA 3IJ9A 1QVBA 3ARWA 5E6ZA 1QNOA 1KTBA 3VX0A 1ISYA 4D6EA 3A3HA 1QHZA 5JIPA 1P6WA 3CTTA 1HJVA 1QWNA 2XVPA 1RPKA 4TOQA 1KQYA 1TG7A 5CGMA 3L4XA 3T2QA 5BROA 1CXIA 1PIGA 2BXZA 3ZJ6A 1X1NA 2D0GA 4BA0A 1CZ1A 1SMDA 1GUVA 1BVNP 4PTMA 3CZEA 1H3GA 3BSGA 4S3KA 2XM2A 1FH8A 4AEFA 3RJXA 3OLDA 3VMPA 4R5EA 4W7WA 1GOWA 2C7FA 1BYCA 5FIPA 4HU8A 1BF2A 1W1VA 4W89A 1H0GA 1MQPA 3VGFA 3CMGA 4QP0A 1HJWA 4AMWA 5A6JA 1CXFA 1B9ZA 1HJXA 2ZUSA 3DHUA 3BUBA 5I5RA 3U5UA 2PWGA 1HF6A 4DO4A 5A8PA 1ISWA 4CN1A 4AD3A 1WPCA 1RD6A 4J27A 3GXFA 2QMJA 4U33A 2W67A 2RGMA 3AXXA 1XYZA 1O6IA 5BXSA 3VIJA 3VINA 1JYVA 4WK9A 3WUFA 2XHYA 5BXRA 7TAAA 1W9BM 3MANA 3GXPA 3WY4A 2OWXA 4D6HA 3N1AA 4OBRA 1BAGA 5A8MA 2BHYA 2VT0A 3GYCA 2CNCA 2WBKA 3WQ5A 2WCSA 4QAWA 2X09A 3WUGA 1PZ2A 3OLGA 2Q8XA 3CZKA 4FMVA 1E1EA 3PZNA 2XSBA 3CUIA 4RE4A 1ODUA 2EXOA 1JXKA 1H09A 4NSBA 4H04A 2Y5EA 1FOBA 2VCAA 3POCA 4HA4A 5I78A 1UKOA 1YQ2A 4KRUA 3HG5A 3AS2A 2WK2A 1OGSA 2F2HA 4W88A 1J9YA 4BQ3A 4P7RA 2DSKA 4UQ9A 4M24A 3U5YA 1LWHA 1FHLA 2VZOA 1WDRA 2YDQA 4GI9A 1E6RA 3AJ7A 1VF8A 4JCLA 3PZ9A 4QFUA 1UH2A 2AMGA 2WHLA 1E0WA 1B3YA 1EXPA 5BYWA 2A3HA 2XFRA 1C3FA 1V0NA 1UH4A 1BGGA 4FLRA 1ODZA 1E4LA 2BVTA 3ZSSA 2IXUA 4CUCA 1ECEA 4PYSA 2QMKA 3VMOA 4FNRA 1CEOA 1UQYA 2XVGA 1QX1A 5I3DA 2RGLA 3NSMA 2YOCA 1QNRA 2YL5A 4WF7A 1XSIA 1UA3A 1QPKA 1KQZA 1FA2A 3BC9A 1CXKA 2OSYA 4MB1A 2DGAA 1J0JA 1GPFA 3VIGA 3BH4A 4HPGA 3SCPA 2JALA 4DUVA 1GOOA 2YLAA 2WVVB 1DP0A 5A94A 1GQKA 5E9AA 3PTQA 4HOXA 4R27A 3SURA 5JUVA 3DHPA 3SUUA 3T2OA 2ZX7A 4W7VA 2VR5A 5GNYA 3VOCA 2YA0A 2XFFA 4URIA 4YN5A 1M04A 1W9XA 1ZS2A 2JEQA 4NXKA 4CN4A 1WCGA 3HN3A 5FKYA 3ARVA 1BG9A 3GNOA 4UZSA 5JIWA 4YHEA 3POHA 4H8UA 1PIFA 2QPSA 2WKGA 1E56A 3AHXA 4N0RA 2XWEA 5CGTA 2BY1A 1LJYA 3KE0A 1VENA 3W37A 4UR9A 2WVUA 4JL2A 2CYGA 4PMXA 1KTCA 2WKLA 1VEMA 3OIHA 3T08A 4PMDA 3G6LA 4ZEPA 1ZJBA 1KR1A 3AMLA 3ZSTA 1GCYA 2VOTA 3AMDA 4W7UA 5HXMA 2BY0A 4D6CA 2OW7A 1HKJA 1JZ4A 1E6SM 4LYRA 4LYPA 2WWCA 3VKKA 2W5FA 4NZFA 2V3EA 1UUQA 3WSUA 4JFUA 1UD5A 5CLTA 4AD1A 2G3MA 3WDQA 2WC7A 2CBIA 4ZXLA 2VCBA 3L2LA 1EHNA 1E0VA 4W85A 2J79A 3J7HA 4IPLA 4WJXA 1OM0A 4NF7A 2DT0A 1E70M 3GH7A 5A6SA 5FOOA 2X2IA 4HP5A 3DX3A 1GOIA 3BAKA 2HISA 1JYNA 5D4YA 1ZJAA 2FGLA 4MAVA 5BRQA 2EACA 2WWDA 4FNUA 4DWSA 1W9UA 1MQQA 4KWUA 1QNPA 2JE8A 2XGIA 2J62A 3GM8A 1GQLA 2O92A 3EDJA 2W61A 3RJYA 3VIIA 2GK1A 4GINA 2V38A 1OD8A 1JFHA 1Y7VA 4IM4A 2PWFA 1WKYA 1K9FA 4Z2GA 5A1AA 3KL0A 2JF6A 3N13A 3ZR5A 1F4HA 3FAWA 3AFBA 1VBUA 1WO2A 1WAWA 2YFOA 3ALFA 6A3HA 2ALWA 3VM5A 5BXTA 5D9OA 4KGLA 1HP5A 2F7OA 1BFNA 3K1DA 1QBAA 4D71A 1JZ3A 3W29A 1BPLB 3WL0A 2WB5A 1XYFA 4F8XA 3PZTA 2IUZA 3F5JA 2F7PA 1E4NA 4ACYA 3CGTA 4LYQA 2EPNA 1KGWA 2E8ZA 4Z2JA 3DDGA 5I79A 3KLLA 3KWXA 3ARPA 3HJEA 2PBGA 3WY1A 3DX4A 5A8OA 1JD7A 1WZKA 1V6UA 3EDDA 3MU7A 4E8CA 1PX8A 2VRKA 1H4PA 2GUYA 2Y24A 2JIWA 4H8VA 1Q6GA 4QCFA 3ARXA 1UZ1A 3NYDA 1UOKA 1W3KA 3ZM8A 1H5VA 3N15A 1HJSA 4GQQA 2A3AA 2E9LA 1VJZA 1BHGA 3TOPA 3AYSA 4OOZA 1GOMA 3HU7A 3CHDA 1OT1A 1UKSA 5HNNA 3BUDA 4M8UA 2DSWA 2G3JA 1XCXA 3WENA 2YFNA 3BUIA 1MW2A 4D6FA 1XH1A 4XUYA 3W53A 4WLCA 3UG5A 4HZ8A 1K9EA 4PCTA 2O9OA 4Z2IA 3EMZA 3A4WA 1GQIA 3GXNA 4UFKA 4OKDA 5JBDA 1I75A 5KZ6A 5E6YA 4TTUA 4FNTA 4ZENA 3BMWA 5AC4A 3RDKA 3H53A 4XX6A 3WNOA 4HU0A 2WAGA 3WBEA 3WH6A 5E1QA 1QI3A 3MUIA 4AWEA 1VEOA 5DT5A 4OOUA 2EPMX 4D6GA 3AI0A 5IFTA 2CHOA 3PTKA 3AIBA 4M29A 3EJTA 4HZ7A 2CPUA 3D51A 3FHAA 1JI2A 4D1IA 1UHVA 4PMUA 3CUJA 3BAJA 3WDHA 4AZIA 4U2YA 1OT2A 3B9DA 2G41A 1V6VA 3MUZ1 5A3HA 3W0KA 3F4VA 1EDGA 1EDQA 1KXTA 3CHFA 1HJQA 3DYPA 1QNQA 3A6OA 3PZVA 3THDA 2EJ1A 5IHRA 3PHAA 1MFUA 1BYBA 4IISA 3CBWA 3TV8A 3HG3A 3WF0A 3MUY1 3WNNA 2DH2A 3WH9A 5A95A 1HVXA 5LYRA 5HPCA 4UOZA 5GQBA 3W81A 3OLEA 1SFSA 1UWSA 1UH3A 2F1AA 2EBNA 1JNEA 2J25A 2BY2A 4UTFA 4WKFA 4TVUA 3UEQA 2D24A 4W8LA 3NDYA 1ISVA 2ZE0A 2J7CA 4DM2A 3KL5A 2E9BA 3SEPA 2YKKA 4LX4A 3AIRA 2BVYA 3GH4A 1KFWA 1J0ZA 1U2YA 4AZ7A 2MANA 3TTYA 5A8NA 3BAWA 3GXTA 2ZIDA 3QHMA 1RP9A 1J01A 3BAIA 2V3FA 3WFLA 5IDIA 5E09A 4W87A 1JZ8A 1UWUA 4XB3A 1UYQA 2DPEA 2DQXA 4J3VA 3A21A 3EDKA 1TZ7A 1F4AA 4MJ4A 3SIMA 4PSPA 3ZMRA 2J8GA 4WKHA 3NSNA 1OGBA 3PZIA 3GZAA 3CZSA 1GVYA 3AXHA 3BXWA 3SUVA 3KEHA 2E4TA 1TFVA 2WMFA 2YDSA 4S3JA 4WSKA 2XWDA 1QW8A 3CUGA 1XCWA 4UZUA 4AW7A 3RPMA 3ALGA 1C7SA 1US3A 2VRQA 3WF3A 2WVVA 1PS3A 4JIEA 2X0HA 2WYSA 5DEZA 1H41A 4B3KA 5EMYA 1GW1A 4AZHA 2BFGA 1VBRA 2GVYA 4U2ZA 2CETA 3AMCA 1DHKA 2D0FA 7A3HA 2VCCA 5AC5A 1E6NA 4Q22A 2FH6A 1L8NA 5CPSA 4ZXOA 1QI0A 3MMWA 3OZOA 3L4WA 2YBUA 4HMEA 4AMCA 3W24A 1CGUA 1WDPA 4WSJA 3WH8A 3HG4A 1PEZA 2E3ZA 4LGXA 2FHBA 3ARYA 2X1IA 3AS0A 1NQ6A 4TVCA 1KWKA 2VX4A 3N12A 3ZIZA 4PMRA 1M7XA 3OZPA 2E8YA 1V6XA 1UA7A 1AMYA 3WDRA 1HKKA 3VIOA 1TQUA 1LQ0A 1B3VA 1ESWA 3EJUA 1B3XA 4W93A 1E4MM 1AQHA 1XSKA 2UY4A 5M17A 3UR8A 3ZO9A 5FL1A 2B31A 3E1F1 4W5UA 2F1BA 3WQ4A 1J0HA 1VFUA 2DT1A 3VILA 1W32A 1NOWA 1PBGA 2EQDA 3VDCA 3DC0A 3AXIA 3FXYA 2YL8A 3F5LA 4OJYA 3L2MA 1G5AA 3EJSA 4C7DA 4DWSB 1DWAM 3WF4A 3PZUA 2BXYA 3WF1A 3FW6A 5EBAA 2CBVA 4WKAA 1FP9A 3L4UA 1GJUA 4ZE4A 3WH5A 4F66A 2IGTA 4NZJA 2WMJA 4BQ2A 3WQVA 2G3IA 4MNJA 2AAAA 1H1NA 1TUXA 4M80A 5A6BA 4B9ZA 4ZE5A 2ZUWA 5GNZA 1GZJA 4U5KA 5D9MA 1UG6A 3MI6A 1JI1A 1XH0A 4CU6A 8A3HA 3WDPP 1CGYA 2GJXA 3ZJ7A 3WNKA 3LXBA 1HNYA 1JG9A 4H2CA 1HP4A 3AIUA 3NIYA 3AIEA 3W82A 3H54A 3BVUA 3CPUA 2XUCA 2WZEA 5EFDA 1YHTA 5I6SA 2PWHA 3MMDA 1JYWA 3W6MA 3S5YA 1W9VA 2OW6A 3D5HA 5GNXA 4W8AA 4MB5A 2X8RA 4WIWA 1B0IA 5A2AA 3MMUA 3S5ZA 2CEQA 1V03A 2VVSA 4P7QA 3VIMA 3UG4A 2X2HA 2D1ZA 3A22A 1JXJA 1Z32X 1R47A 3M07A 2OSXA 4TVDA 5ABEA 2YLLA 3VD3A 1EQCA 1UD8A 5E70A 4MB4A 1V6WA 1J18A 3WNMA 3M7SA 1IZJA 3WEZA 3DECA 4AZ6A 2XPKA 4JAWA 2WHKA 3EMQA 1E0XA 1G9HA 2XTKA 1D2KA 3BCFA 2ZUNA 5I77A 4MNKA 3OLIA 1C90A 4BCEA 4DM1A 5HOSA 4HMCA 3VD5A 3AQUA 2VMFA 1MW3A 3LMYA 4U3AA 1TQSA 1TA3A 2FDMA 4GZIA 1JAKA 4GI8A 3SUSA 3WL1A 3MO4A 1H2JA 4CD4A
chains in the Genus database with same CATH superfamily
3C0LA 5GJTL 3WLMA 5TDOA 1KFKA 2XN1A 4ICXA 3B5TA 4JTLA 4PJGA 3OGOE 3TJHD 3TPUB 3FGCA 1G94A 1BG4A 1I3GH 2KUTA 5EUOE 2APBA 3GYRA 3MKCA 4UTBA 4NI3A 4JRXE 4OQTH 2PODA 4AVOA 1TREA 3GSOA 4PJIA 4X9FA 5E2WL 1OADA 2VEGA 5DWUL 1LLZA 4K5PA 5JHDE 5KEZA 3OYZA 4NO3A 4NASA 1RUAH 2EIKB 4G82A 1I1AC 4YYCA 3ZTJG 3TNNB 2GJXB 5IEHB 4MJIB 1XPGA 2LAGB 4CC4C 3PG8A 2A9NL 1NGXB 1F4WH 4DK3A 4M4PA 1LD9B 2WNNA 4ONGL 2CG9X 5CEYB 3N0PB 4O58L 4ECLA 5IF0B 1ES0B 2OFJA 4FF7A 2C1OB 3PGFL 4C7FA 2F54A 1L0YA 3QW4B 5KZDA 2VMJA 4YDMA 4E2VA 1NCGA 3CMJA 5J06A 3BEWB 5L2KA 4AEOA 1US2A 1AZUA 2OJPA 2NTFB 1G4PA 5ACZB 2R1MA 4L4OA 3KRZA 5DR5H 3O2VL 4HC1A 5BQ7A 4GXFA 4N0YL 5HJGA 1SF5A 5EWIH 4PJ7E 5MEPB 3TO4D 3X3GH 3ZE1E 3JW7A 4XNXH 3WXVH 2GBTA 2I5YL 2IDCA 1DBBL 2Y7DA 3ES8A 1BG1A 4XGZA 3FVDA 3KYMA 4HT3A 3BLPX 3INUL 1G4RA 4BSWB 3HHSB 4NQDA 3URNA 3GMOA 3WJYA 2O6CA 1ML1A 4D6FA 4TQEL 1CLVA 4JCWA 3UJSA 4CQAA 1CCZA 2C3XA 5FW8A 2BC4B 1R86A 4PMQA 1WT5C 4GRLD 2R24A 3NPSB 3TBYA 1VCBC 2H1PL 2HP4A 1SY6A 2X4PA 1CGXA 4JFSA 5T1KD 1M1XB 2AJXL 4NJAH 3RTQD 1ZPUA 1ZPTA 4LALA 5J5DA 3TBWA 3ELAT 1F2QA 4LAUA 3ENLA 1W3IA 3MBDA 2J20A 2X2JA 5I71B 2A3LA 1JWUA 4JIHA 1XF5B 3VFNB 1M7PA 1LO3H 2I69A 3BE1H 4GK8A 3ZL4H 5L7XH 4UMAA 3NYKA 4RMBA 2C9VA 3UZYA 4CN6A 3TW9A 1HHKA 3FUHA 1TCRA 4K7PL 4AWTA 3LEXA 5I6PA 2E3VA 3D2UA 4OCYL 4M7KL 4EQ3A 5I75B 3MS8A 4YUEH 4HTYA 2F74B 3EDEA 2AK1H 1DOSA 1YNQA 1WWBX 3QDMD 3B6SA 4N8VG 4PHXA 2GI0A 2YCEA 5B8CA 3CV6A 1NCAL 1A7BA 3WUBA 3FMGH 3N1PC 4O57A 1S5IH 2Z24A 2WQVA 2QHLA 2ACQA 2XFYA 2E7DA 2CHDA 2GI7A 3WBWA 3WJZA 4AF0B 1AJ7H 4L37B 3TF4A 4BF9A 5ABGA 5FUZL 4LLVA 1HX0A 4HXAH 4WJG3 4ZRGA 5GS0C 4U31A 1ONRA 1ZALA 2CC0A 2PDUA 2W66A 4L56A 1KB3A 2JJSA 1F90L 4LPXA 4PJEB 1MCWM 2PD9A 1KIRB 1FF5A 4Q0XL 1DQTA 1OAQL 4LUTB 4F1ZA 1N6UA 1UG9A 4PRHE 3GS6A 2YD5A 2QPUA 3C5SB 1B2WH 4LVEA 2NX1A 2B4CL 1MVUA 2G5UA 4NRYA 1A6TB 1B30A 5LHFA 1FL5B 2YD0A 3MRCB 4JPKH 5KAQG 2Q3RA 3HV8A 1RZFL 4GP5B 5D70L 5LSMA 5D7IA 1IBDA 3V0GA 4BFKA 5ILTH 2EVHA 1H19A 3SGJC 5E6SB 4XTDA 1EHLL 1KB9J 3PDGA 2YA1A 4UB0H 2Z7KA 3GDTA 3K2GA 3MV11 2V8ZA 1BZ9B 1FGVH 3VKBA 1GKQA 4DUXA 1OB1A 3RFZC 1S9VB 5DYOA 3EWDA 4QDPA 4PS8A 3VWJA 4AC2A 3MLWL 5IOPB 5HGBB 1YJDH 2JKXA 2AXFB 2Z8VC 5CZXD 4FG2A 3FB6B 4YNYA 5EBMB 1BIHA 4PY7B 1BFVH 4PM1A 1MYRA 3DIPA 2A3BA 4AUJA 5DK0B 3BPCA 4AZGA 1I4FB 4LHJB 1PZDA 4XN2A 3ZGIA 3UNDA 1I8LA 2PRMA 1FZOB 3UY8A 1XIIA 2YJLA 4OM0H 1GGIH 3OPZL 3WD5H 4BK4A 3UR2A 4B15A 3NMEA 2F54B 4V27A 2HJPA 2XTJC 2Y5QA 3GSWA 2G4JA 4GXMA 4K2UH 4MJ2A 3VU2A 1WA1X 4YHIB 5DXXA 3BKMH 4O10A 2WD0A 4CVXA 3EHBC 1FL3A 4Y8AA 1I2OA 3BVTA 2HFGH 3WKPA 3S96B 2VSKB 5IT2L 1PZ1A 2CLIA 4ICCX 2VXUH 1BRLA 2DQTH 3GJFH 2QUVA 4ESKA 5DRWA 3IMSA 2C14A 1RURL 2FYYA 2VH5L 4NNXA 3BVNA 3BJLA 3U6XS 1ML0A 4IOFC 1UWXH 2V2WB 3I9PA 1F3XA 3IJ6A 3VB9A 1BD2B 3GSWB 1EX0A 2MOGA 3BUTA 1R19A 1VRXA 2C3GA 3FYPA 4X0KA 4AMAA 2E6DA 2WPGA 5IVZB 2AXJA 3CWHA 3FKUS 1A3QA 4OVVA 1E71M 4P7LA 5DMNA 1S9WA 3TBWB 4F2EA 3L3JA 3THMH 1ZZMA 3MREB 4DZ8A 2APTA 1ZUAX 3E0IA 3W27A 4GRWF 3CWGA 2WVTA 4FOMA 2VTFA 2YN3A 3MUGB 3UACA 2HFEB 1LGVA 2A4EA 1KLFA 4G5AA 4HPYL 4ODTL 3DKJA 3IKKA 2V7HA 3FO0L 5CUSH 5IMKA 4HZ6A 4ZQOA 2EAWA 3E2QA 1KCRH 5D7JC 1VB9A 4XXDA 4YHKH 1VJIA 1ZBKA 4BKNA 4Q2ZA 4UQ2A 2R15A 4LP4A 1A0QL 2JV6A 3RA7L 1TZ9A 1RUKL 4FYQA 4LSUL 3PBGA 1L9MA 4KOBA 3AY4C 5F7FA 3STBA 5HD8C 1LVEA 3L9RB 1NCOA 5D1ZB 1ZLWH 1JQVA 3QQWA 5D2NC 2YHGA 2B20A 3EDFA 4NQED 1PJ9A 3D52A 1RUKH 3S4SB 4P46C 1J5OL 2G8ZA 4X2PA 4O51A 1GKRA 2C34A 1OHLA 1K8IB 4FQCL 3RFZB 1EZLA 1CDIA 4Z1AA 2WQRA 1AQ0A 4P04A 5GSVA 4NLHA 1TPVA 3IUDA 3S35H 3BOLA 3ET9F 3F58H 4XKYB 2HLAA 4N2AA 1ROWA 1JN6B 2UWEE 3WK0A 2ERJC 2AEQL 4RDBA 5E1AB 1QSZA 4JREC 1VPYA 1IM3D 5FLUA 2NXHA 1CQYA 5TE6H 3N42F 4BKLB 3GH5A 1GK8A 4XOAA 4HIBA 4HK0B 4YSQA 2WBGA 1JPEA 1LMKA 4IMKA 4Z77A 3RZCA 1S3HA 4OKVA 3HM7A 1UR1A 4P7NA 1C9DA 3BH9A 1EUUA 4Z3GA 3GRGA 3D3VE 1XF2A 4PJ8B 1BWVA 1PVHA 1CG9B 4N8PA 5DGRA 3QHNA 2A9BA 2YRZA 5HI5D 2Q7AA 3MJMA 5C9KA 4HYRA 2AQRA 2BHFA 4QI3A 4AL8H 4NRXB 2K9FB 2XXGA 4NUPA 3KLKA 1VR6A 2YL6A 1BQHG 4RZ6A 3FO9A 3CAVA 1NUGA 4Y16B 3AS3A 4MMWA 4UTTA 3LPGA 4X6EA 4B7IA 2OOFA 3BUYB 4HHAB 4H1LH 3OMAB 3PWNB 4BFFA 5F3BB 1EPXA 5A6AA 4C59B 1O9VA 4HOZA 4Y5XC 4R6UA 1I7RB 3H8AA 5I3JA 1FL6B 1TIMA 1NARA 2VDRH 1IF2A 5DLCA 4N42A 3V9EA 2YOAA 3EWCA 2Q02A 1MCSA 4LSSL 4M5PA 3BLLA 3A3XA 2DWDA 2VGLM 3EO9H 1J1PL 4OF7A 2YD4A 3REWB 4EKJA 5MEQB 2DVUA 3LUTA 3SY8A 3T40A 4AIXA 3E7JA 3WHXA 4TTDD 2NSQA 2VQUA 3MRRA 5KJ4A 2OMZB 1XIGA 3SADA 2A9AA 3P9LB 1MXGA 1FHNA 1N4XH 3BP6B 2O5YH 1URIA 4QLWA 4IPPA 3BUQA 1OM9A 4V1DA 4HCDA 5FO8A 4F7PB 4L9LA 3P4LA 3LHYA 3CZGA 3I6EA 1NGYB 4HIPA 1WBXB 2H26A 3LPPA 3TV3H 3IJHB 3B4UA 5CS7A 4ANKA 2CLEA 4ZT1A 3AU0A 2PTUA 4HWUA 5D1ZI 1TTBA 4HLEA 4KF1A 1YEIL 2X0UA 1R3WA 1M41A 4BQBA 1QI5A 5D5MF 4LCCB 1OW0C 2WINB 2OELA 5C08B 4JZ5A 3LZNA 5CBIA 3FOLB 3AG2B 3DV4B 3D25A 2PDKA 3ULVE 3NL2A 1XG4A 4WFGD 4RL3A 4KC3B 1XV8A 3K0WA 5FW6A 4JJ5A 1S2TA 5LIXX 4X4MA 5AYYA 4BWTA 2XKSA 4C6FA 2PWDA 3BLIA 1WBXA 4HUWB 4X5QA 4MKMA 4AVJA 6XIAA 2XXMB 5AB0A 4ACPA 3CFDA 4DQOH 4OUUB 3WJMB 1KCKA 4B41A 7REQB 5GJSL 1WRFA 4X50A 5FJPA 1H49A 5D03A 3U46B 3IGKA 3V18A 2CWRA 4PS4L 3RR1A 4CMMA 4R34A 4X5XA 3VRJB 3BVJA 3SKUD 1E55A 6FABH 1K8IA 1PPIA 1S7VA 4GXVH 4I88A 3RFZA 2OR9L 1N0LB 2CDFA 2NZIA 1UACH 4JDVA 4NQCA 5KVDL 3WFBL 2Z1PA 2X6VA 3F2BA 3CAKA 1RJCA 2XDHA 3IETA 3BPNC 3O0RL 4AIEA 2JJUA 1JF1B 3KBVA 2XJKA 4WW2F 5A3ID 1FBIL 2PYEA 1DWGM 3M44A 2BHZA 5E8PB 2HCVA 2ADFL 4INFA 3T6WA 2PMQA 3QMTA 2WP3T 1CLYL 3IJ8A 3WEOA 3HR5B 3ILQC 4A2HA 1H50A 1L2UA 4A3YA 2FWSA 5HYQB 5E0KA 3L45A 4WO4D 3D39A 3B37A 2QJNA 2V17L 4O9HL 1E15A 5T5NF 3N40P 3VYPA 1QEWA 3NSYA 2CGZA 4FNLL 1ELSA 1Q2RA 4A8RA 4ZW6A 2UY3A 2H3DA 3OC5A 4GYBA 4JOMA 4DAIA 3IU3B 3MXVH 1K5NA 4TQHA 3D39E 2XBTA 3GIZL 3K5SA 5G4OA 1EIXA 2ZA3A 3RMEA 1TE1A 3QNZA 3I74A 1J4EA 4PJEA 4CJ0A 1NDMA 1VEPA 2OSWA 3FCTA 1M1SA 4M7ZC 2Z91B 1ZIBA 5JR1L 3VG0L 4LBEB 5I00A 4MQSB 1N8OE 3S3CB 3IGSA 1GR7A 4JQ4A 1SY6H 1GIGL 4IGHA 5JHLA 3T1GA 1JNJA 3BI9X 4I0PB 4JO1L 2NW3A 4W84A 5HMFA 3O11A 1BXNA 3PUDA 1WDQA 3M6DA 4E3VA 3WTYA 5C9UA 4BKSC 1Q6FA 4JRXA 1V0KA 3G1FA 3UWYA 5LNRA 2YXXA 4XOBA 3G1HA 1KLZA 1F3RB 4IMCA 4Z7UA 2HRWA 1PCXA 1TB3A 3RUGF 4PGBA 3MODL 3E0VA 1MO0A 1YEEL 3LKNB 2HPMA 4ZOCA 3UJJH 5CJXA 5AZUA 1P6AB 1EJVC 1HYSD 1ONQB 4TKWA 3RWIA 4QHRA 3LS5H 5T1MB 3QQ9C 2X4SB 4EVZA 3MRDA 4IS6B 2VDKB 1XAKA 4AKOA 2AXFA 1P1ZA 2X7LA 5LB1A 5FCSH 3UWEA 1IQDB 1RZ7H 1JPGA 2CE6A 1FWJC 3AVEA 3BPCB 3KGRA 4HAFA 4EI6A 2VI0A 3LRGA 4OE7A 2BVEA 4W81A 1MLBA 4Y19E 4HKZB 2WQPA 5CEZL 2OL3H 4DHGA 1XXXA 1DE4B 1FFQA 4KHTL 2BWQA 5G4NA 2OYMA 4D1JA 1F42A 2PNDA 4FZ8H 4NFBA 4WI3A 5IB4B 5FI8A 2FIKA 4P4RA 3V52L 2JSFA 2HK0A 3A9BA 3S98A 5D1QB 3V0IA 4B4FA 4QAIA 3BIBX 2Q8BL 3ONCA 2VH5H 4OWGA 2VDNH 5FYJL 3REQB 1CICD 1JPGB 2GTZB 32C2B 1SPDA 3WGVB 2QAPA 2Q76A 2A7NA 3DDMA 1DVFB 4M8VA 1BV8A 5EN2B 3TXZA 4E2DA 5J89A 4R9HA 2P5ED 2X6BA 1JZDC 4P2QA 5DUMH 3SY0A 1XC6A 3VRIA 2QJIA 3QJTB 1FCBA 1OF2B 3S42A 3QZ6A 1EO7A 4HJUA 3H2EA 4KTYA 1YY9C 4P05A 3IMUA 4PGEA 1YKWA 4KHTH 4K2UL 4ACZA 2QCDB 4OV9A 1RJYB 4JHWH 5AKVA 5LBGA 4YHNB 4OSUL 1JCJA 1S4IA 2WXOA 3ZWSA 1VLWA 4Y5VB 4JZNB 1WIPA 3TSMA 4ROPA 4KWVA 1BLIA 3LH8A 1DQLL 2NDGA 1KM1A 2VGGA 3VSVA 4LVBA 3NQCA 3W2NA 4PEKA 1J11A 2X4TA 3SOBL 4DWSD 2EH8L 4G72B 3EAUA 4B9YA 5F0MB 4YDKL 1BWMA 4F15B 2ZZ1A 2O55A 3BKJH 1M3UA 2D7MA 5IM7B 2INZA 4W9GC 4QDWA 2PO6B 5CSZB 3U2CA 1KBGH 3PGCA 1LRTA 1LL6A 2A6NA 2H1LM 3IIZA 2VQ1B 3S4SA 1SMOA 2CNYA 5EOCH 3T8VA 1OB0A 2WXFA 1M3JA 2Y36H 4TLTA 4XWOD 2R0ZL 4L29A 1OVZA 1LORA 5BVPH 1OYCA 1IIHA 1RK5A 4JX4A 5LA0A 1GZQB 1ANUA 3CK0H 3D50A 4JPKL 1JZ2A 2BW5A 3KPNA 4W9ZA 2XSAA 4XP5H 4CC4A 5GS1B 1F4XH 1GYVA 1EEZB 4G1MB 2ZOTA 4CGUB 4DAGH 5SX5H 5IG7B 4DVBB 1F4YH 1K8DA 1AJ0A 5IB5A 1I8AA 1IRAY 4RGNC 1BIIA 1L9QA 4CBZA 2QVNA 1BFTA 1OTTD 3R25A 3WQOA 3ZKXC 4Q8QA 3AAZA 2ZXQA 2WKOF 2XX0A 3UYRL 4O1CA 3HC4L 4DNLA 2VQ1A 2PCFA 1AC6A 1TTCA 3GHRA 1XT5A 1VADA 4HJ0C 4P5MB 3MSDA 4RNIA 3GFUA 4I3GA 3U6RA 3UP1A 3PF3A 4JRXB 4DLFA 3I75B 1I4FA 5TDOB 1IKOP 1Q7QA 1FCUA 2DQGL 2AQNA 1RLDA 1MRDH 2CXGA 1NQKA 4GP4B 4H26A 4R0LB 5ADOL 3NQ7A 1FYHB 1T1ZA 3WNJA 2PMZA 5U7SA 1WDSA 2WXMA 4FHJA 1NCIA 1J6PA 4E9YA 1C8QA 2DI9A 5KBPA 3LDBB 4H9VA 5M95B 3SJNA 1ORQB 2DMHA 5HY9B 3SCVA 5H2ZA 5KVFH 1BBJB 1HJUA 4QKTA 3DX9B 4XNYH 4MJIA 4WHYH 3I3BA 3MUUA 1V51A 4OIIH 5C0BE 3CN0A 4AKPA 1F3DH 3IMTA 2EEXA 3D3AA 2WC3A 4XN5A 3O6FD 4UT9L 3AHYA 3ARRA 3BLFA 4YIQA 2OQJA 1UASA 3QFJD 3N2BA 5DRNA 2VXSL 4L0ZA 1P1MA 1DQUA 4EUPH 1X5MA 4DQOL 2CLZB 3L8QA 5GRYA 3IDXH 5CWSA 4P2YA 5SX5K 5B8CC 2OMWB 3AABA 4P8VA 3ULUH 4KW2A 3IUHA 3G5EA 3CXFA 3O9WA 1LT7A 1E42A 2EO9A 4UM9A 5E2VH 3RMJA 3RO8A 3BAXA 2E27L 3IKCB 5FO8B 3FY1A 4B3LA 5ABHA 4DP4X 2OXHB 2IOMA 4Z0XA 3VWKB 5J6GA 4O14A 3N2XA 3VI4F 2HQAA 1YO4A 2J8HA 3EFDL 2Y89A 1K4CB 4IIFA 1FP8A 3OA5A 2QPXA 1TZGL 4AJVA 2Q86A 1KRAC 3NCYP 3DVGA 2A99A 2ODHA 3ILPA 3L5WA 1JDAA 4CW1B 1TPEA 3VYLA 1BOGA 1E2VA 1P84J 2IOOA 3N2JA 4FR1A 3QEQD 4MDRA 4QQUA 3BOFA 1N8ZA 2IS7A 5SWSA 4LRIC 3ZYZA 1XYLA 2P5NA 3TO2B 3WKML 3WJJC 3IKCA 1NFGA 2WQ8A 1GGBH 3A4AA 5C3LD 1ADQA 3MYZA 1T1WB 3T4AB 1T96A 3GU9A 3WY2A 5AHEA 3WNPA 1A3HA 5JVLA 2A6KA 3AM8C 2UZYB 1QI2A 2VEMA 4WQOA 2XH7A 4PMVA 2XWTA 2C5DC 2R51A 3DYOA 5I1JH 4XIAA 1IAIL 3FQYA 1XI3A 2VR2A 3PWAA 4C90A 3RWJA 4ODXB 3O45A 4YC2B 3AFLA 5F0JB 3RXZA 4F33A 4ZFFA 1LRQA 1IEBB 4JLRB 5LNGA 1N8ZB 4X99B 1XGRA 1UXSB 2PC4A 3BE1L 1NOFA 1RERA 2XTJB 2BP0A 3K91A 1G01A 5HI3C 2Y5TB 3SBPA 1OLZA 5LGHL 3VFMA 2EADA 3A0OA 5KTEH 3WBDA 2Z1KA 4KPHH 1A6WH 3JWDL 4MD0A 1JPKA 4NM4H 2YIHA 3PP4H 3TO4A 3OGRA 4Y2NA 1ILSA 4IDJH 3S88H 4FFYA 3CASA 4XRCA 5E08L 3EADA 3JU2A 4PRPE 1EZ2A 3KL3A 5DT7A 3UABA 3HNSL 2MJWA 4NLAA 4XMKL 3WSQH 1PS9A 2OK0L 1CT8B 4U6XA 3AHZA 4HK6A 4Y9BA 4BFJA 5JBFA 3BV4A 3DGBA 1ZE3C 4L5FH 3F3HA 4OCSL 4GY0A 2J78A 3AWNA 1HINH 3RAOA 1ACCA 2ZYFA 2B3RA 4HNLA 4S0SD 4R5XA 2K45A 1U4EA 3M4HA 3VFUA 1FN4B 4H01A 4XPHH 6REQA 5KVFE 1H3XA 5FS5A 5DMLA 1IIKA 2DKUA 1G43A 4HJTA 4GXUM 1IT9H 1A14L 4A7GF 2WO4A 2PCPA 2B08A 3GXIA 3VGAB 2I32A 3VFVA 1JEZA 1EYEA 1E4JA 4M48L 3BG3A 3WQ6A 2JKSA 3D4YA 2QDEA 3P9LA 3U83A 2AERT 3H22A 4PE8A 1DXEA 2Y5JA 1J9CT 2ZUXA 5ES4B 4ES4A 5EZJA 2GGJA 2V0AA 2FGBA 3SW6A 4M8QA 2NY2B 5EOQL 3MNVB 3VRLF 4CNIA 4TSAH 4GUPA 3S5LA 3WS6A 1DL7L 3DI1A 1X38A 5E2WH 4N0UE 3APGA 4UDUB 5AVZB 2EAEA 4Z1YA 2R1KA 1G7QA 1NDGA 2CO3A 5IHBA 2OR9H 4AK1A 3LQAL 4TL5A 3W9DA 2NY5H 4IRJC 4UT6H 4ONVA 3SE9L 1MW1A 1ZANL 3PNRB 4DTGL 1BRLB 3FFCE 5T1MA 3VXRE 1XLFA 4NNAA 2XUWA 3MRDB 1S46A 4NZTL 3C0JA 2WHJA 4MKVA 1T5WA 4KI5E 3BVXA 5IROC 3BVNB 4Q8WA 1MPAL 4E42A 4G7RB 4NQDD 3HLKA 3KW7A 1A6ZB 3SD5A 2V68A 3DPBB 3WQGA 4F40A 5ABTA 3W3BA 5B22A 4C56A 1FWDC 1TO5A 2P52A 1DE4A 4HT1L 3WN5C 4QXIA 2B0MA 1I1RA 3J8F7 3TZVA 1HQ4B 1JXFA 4H8HA 3QO0A 2F54E 3QUZD 1PQZB 4XNUH 5IVXF 2Q6WA 1NGZA 3BL3A 4XX1E 3TMLA 3UNTA 2WNGA 5FEZA 4NO0A 1DJQA 3WUWG 4PJ6A 5IMKB 4QTHB 1A5LC 2ENYA 5HBFA 1B3JA 2QVHA 3RWHA 4UNLA 2EXYD 2W60A 1C5BL 2O61B 5CPMA 3REQA 3P0YL 5DQJB 4YR6B 2R0ZH 5I8EB 5ECVA 2ZICA 1L2QA 4UTKA 1EFXB 4LB4A 3S2NA 3PN8A 5CBJA 2NNFA 3PPGA 2HTKC 3NJ3A 2FX7L 4PU2A 3I10A 2WMPB 2RCSL 1JSYA 3U1SL 4NFDA 3W86A 3KZPA 4X9IA 3EYSL 4O12A 3GUFA 1RY8A 1VP5A 3N1MC 3WK1A 1ZE3H 2DT2A 2VDLB 4MFHA 5BWAA 4FA6A 5LHDA 1J8RA 3P4MA 1L9RA 3BEVB 3CQPA 4PWJA 4XE0A 3S97C 2O61A 3ULVD 2C0AA 3PPCA 4GA8A 3QJSB 3RHWK 3RNQB 4XO3A 3ALWA 1G7LB 2NXZC 4HWBA 5I30L 2ACSA 4P5UA 5EDXA 2HXUA 1WX0A 3NH7L 4LY8A 4GO8A 2P46B 1EQWA 3WKQA 1OKEA 3HMWL 3ABMB 2I85A 5D2NB 1M7OA 2YSTA 2F61A 2R39A 3PGCB 3FKKA 4HUMB 3IEAA 1V0MA 2OTWA 4FFWC 1XIMA 2CJSA 2BODX 1U8PB 4PBWD 4AM0B 3IARA 3EFFA 3HC0B 5F97E 1W1B1 4UFKA 1RZFH 1YCSA 5D2LE 1EZWA 1T7XA 3CDGA 4JDZA 5MKGB 1B2WL 2NY0D 4OAWA 3LHVA 2P0IA 4KJQC 2D22A 5L8JB 5DJ0B 4Q58C 3BSMA 1O60A 2ZAHA 5I3FA 4RFOL 2XIIA 1A6VH 3OHXB 3QWRA 4Y9EA 4ATWA 1FRGL 4KROD 5I3KA 3MBEC 2AQSA 4OLWH 5GGTA 5JOFB 3KPSB 4HIIA 4IS6A 3W4RA 3BD4A 4W9HC 4MDOA 3B0VC 2DWYA 4GI6A 3ATBA 5F1NA 7CGTA 4Q8UA 3M43A 4LLMB 4WK2B 4GUPB 4DN3H 5FGSA 4FQJH 4G6ML 1X9QA 4YDIH 3AS1A 5C0AA 4D0CB 1G9NL 1FNEB 3DXAE 2RR3A 4TXVB 3SDXF 5FJOA 2CW6A 3CMOL 4ERIA 3FEQA 4KTDH 2HVNA 5IW6A 3A12A 4M7TA 1F00I 3W1XA 2YLKA 1WZ1H 2AK1L 2Z1SA 2I25N 4CSSA 4JM2A 1RA0A 1HIZA 1TEGA 2WBJC 4NQCE 5J11C 2EICA 1CO1A 3EXRA 4W86A 4XN7A 5EU6D 3TW7A 3BP6A 3ZYOA 2PTWA 2JIXA 1B0WA 3VUSA 5A6BD 2A7RA 4DESA 2EDKA 2OMUB 3L3JB 5BNXD 3WIIL 2HTLC 4O19A 1YDPA 2K6WA 1RUPL 1Q9WA 2HRPH 4N8CL 1E5BA 2ZX5A 3VW3L 2XINA 1BD2E 1T03L 2C3VB 5I6XB 1WOBA 5RUBA 1NANI 1JTPA 2AJXH 4NJAL 4EDXA 3E0WA 1DBJL 2K4AA 4FXJA 5FF2A 4ZQKA 1HHIB 1CX9A 2VO5A 2R4SH 3PLYA 4L3CA 1E9QB 3PB0A 5F44A 1L6WA 1QPNA 3QPQD 3EB4A 2CALA 4L1XA 1YEKH 1LZOA 4Y7EA 1YADA 1K9DA 4G8GD 2NVCA 4GC3A 4L4PA 4S1SL 3VIKA 1UD3A 2G0WA 3AC0A 2Y88A 4YYFA 4N2IA 3B9KC 4J1OA 3NJIA 2ALRA 1I8IB 2B9BA 4NKDA 3T71A 5DCBA 4YVXA 1J9TA 1HOCA 1GXEA 3VDAA 3MRMB 3EWUA 2CR3A 3HUJE 3IVKB 3RBSA 2V5RA 1FHVA 3Q06A 1DXFA 2EPKX 3CNKA 2FMOA 3EG9A 1EL3A 5F1OB 4NO5A 3NGJA 3TNMB 3NSXA 5A6KA 2IMMA 4AMKL 4QRPD 4L3CB 3V0WL 4YC2C 4Y89A 3FN3A 5E00A 1HKVA 3LXCA 1R2SA 3ILDA 3D6NA 2XNAB 3QQ4B 1YEJH 4WNSA 4G7EB 2WNXA 2BIHA 5GSRA 1RJQA 1LDPH 3CC1A 4PV9A 3FJTA 3L5WB 3EYVB 5G4WA 1SHXA 1OGTA 4OKVB 3T0EE 4A63A 3O6AA 2W9MA 4P5KA 4MNHA 4B92A 1RSYA 2BHUA 2OMTA 5I19L 3IVKA 1ULVA 3NAVA 1CLOL 1GC1L 4X7CC 4H19A 2F58H 4XT1C 1O5RA 2NLYA 5CKAA 3FNDA 2BIQA 3P7YA 1A7PH 3NPXA 2V9QA 1A5KC 2ITEA 2XN9A 3URAA 3QQDA 5IR1A 3C08L 1BYAA 3C3UA 3QFJB 4GXVL 3SYCA 4PJAF 4F2ME 3D39B 4LBRA 4IBYA 4CDHA 5EMJA 4YHGA 5C8JA 1CURA 5E56A 1YEJL 2V2XB 2YPVA 3CV5A 5B1KA 1A14H 4F1SA 2XTLA 3LV6A 3V0WH 4IBQA 1RZGA 2KQNA 2AEIT 4YWIA 4KDTA 3MLUL 2J8TA 1WE5A 2WIMA 2B4CC 2YW3A 1OZUA 4JDTL 4TSCH 2HMIC 2QQLL 5TE4L 2JFEX 3IV3A 4N0UA 1XIBA 1DJZA 4JL1A 1OYAA 4KX8A 2VERA 1XINA 1QWUA 3GXUB 4MF4A 3SE8L 4YLBA 3EWBX 4XK2A 3DIFB 1KNOB 2WLIA 4IPNB 4AT6B 2LU5A 4XR8C 5F7BA 1ORQA 2WZMA 3C8NA 5FHBH 3WLQA 3EH5B 5LDSA 1ZRQA 3EF7A 4ZUTB 4WQ6A 3TFXA 1AACA 1QHOA 4OM1H 5DD0L 6CGTA 5AC6A 4FJZA 1FCCA 1YDNA 4MWAB 1F8MA 3LHPL 3O2WL 3L3DA 2HVKA 3O8XB 3IAPA 4ELMB 4DZBA 1SVZA 4HKJB 5K4XA 3ISYA 3ARBA 5LGHH 3VD0A 1IC5H 3ZDXF 4G3YL 1UR3M 4GG8B 4WI2A 4US5D 4JFPA 2IGFH 4M4RA 3STZA 1L9OA 3O05A 3N50A 1YQVL 2A74A 3OMNB 4RAUB 1TTJA 4NO2B 4AXNA 4JYFA 1ZLEA 3OGSA 5I1IH 1DQKA 2A6IA 4LSSH 4KKCC 1BD0A 1H51A 3VD1A 4X9HA 1G6RH 1W3LA 3EPNA 5AHFA 4ONFH 5BWFA 3BH8B 2E5DA 4Z2LA 3BYYA 3C9NA 3P73A 4ZBJA 1TV8A 4C58B 4QXTB 1YXCA 2ZZUT 1F6PA 1J5HA 5BOPA 1OINA 4WKXA 3VNLA 1G0CA 4XH2B 3QKEA 4PLJD 3PDOA 4J3OD 4PJ5A 2YD2A 5AKRA 4P4KD 3UCDA 1GQNA 5TPWL 3CO8A 5FKPA 2D73A 4IL2A 4R9XA 5IQ9A 1BOGB 1YECL 5T1LA 4P2VA 1E3XA 2EDHA 5EPMB 4GIOA 3MO7A 4JEQA 3H3KA 4F7KA 1CF1A 2GGEA 3HQPA 3UGRA 4ZS6D 2VRAA 2FEEL 2YEZA 1PB0A 1QO5A 3DSFL 4JVWA 1DQML 5I6OA 2FLRT 3VCLB 3VI3E 4PGEB 3MBFA 1Y65A 1R9XA 3L7EA 4KZCA 1QRND 2D31A 2Z31D 3L2NA 1V7ML 4YJZL 4ZQRA 4JFFB 5LBVA 3V2AR 4Y1TA 5FO7B 2AEQH 4O51B 3WFZA 1O6SA 4MRCA 4OQTA 2FO4B 4RNJA 1BYDA 2J8OA 3M7OA 4JFTA 4TXEA 4L8BA 1XXFC 2WXQA 4KO6A 5LAXB 2OQYA 4RZKA 4UFIA 2B7QA 4X0VA 3DDFA 3XIMA 2HAZA 1OG0A 3RUGE 2VKWA 1KJMA 2ARWA 2D2CC 4P5TB 1H6FA 4P4KA 4IGSA 1ZXKA 35C8H 2ICEA 3PL6D 4JY5H 3U9WA 3EOEA 5A6TC 2PBOA 4TTGA 1L0QA 3MBWB 1MWOA 2ZP8A 2JQAA 3QW9A 4LQ1A 2QF8A 5G1TA 2WMPA 3HTLX 2XTSA 3O4LA 1M03A 3C6SB 1XGTB 3EB3A 5FF6B 1HL8A 3Q65A 4NQVB 4B16A 1J2WA 5KZCB 2XIOA 5FO9B 3H9YA 3A24A 5AG8A 1MCDA 4FQ1L 3TN4A 3EPMA 4NJIA 4UMSA 3QY8A 5CGQA 4B6ZA 3SO7A 4CGTA 5B7ZA 3OM3B 3WD4A 1SZRA 4HGWB 3CFQA 3QUZA 3UQNA 1JK9B 2B77A 5DUML 4P2QD 4Y7OC 5BS0D 1LK2A 4K38A 4XTIA 4Q9BA 2UWEB 1S9YB 1U8JA 3IRCA 3D6GA 1ONQA 2BMKB 4UCGA 2J2ZB 3WMBA 2Y1ZA 3N2CA 5FKAA 3GMQA 5DMKA 5JYLA 2ZOOA 3B1UA 3H55A 1MXDA 2DQIH 2CR6A 4CD5A 2NYYD 5AYBA 3S3JA 4A2FA 2VC2B 4JTSA 3N3TA 2WANA 3MBEA 3PNWA 5GISL 3UMTA 2WZPD 3UPCA 4GVGA 5I7GA 1LEKB 5ITFA 3S88L 5SWZD 3WJJA 4CCDA 5C2XA 4XO8A 1JCNA 2HSAA 3QNZB 1RUQH 2OJ1A 1E4HA 1SDDB 5DVMA 3GEFA 1EH9A 1T5KA 3JYBA 1NIBA 4AJYV 5GS2H 1HO4A 1KB5L 1V93A 5ABFA 3WH7A 1RVGA 3TC7A 4PGJA 3OHXA 4GZEA 4HA3A 1WUEA 4L4VD 3UG8A 4OTXH 1NFAA 2PXYA 2W92A 3WQ8A 3ZTEA 1W8NA 1BEUA 1V7YA 4NOFA 1TXKA 3SPIA 4KPLA 4C60A 4U1SA 2EDLA 2E9MA 3BUPA 4WFFE 1QUNA 5F9AC 1LBLA 3W1AA 5DRNB 4GT0A 1KT2B 1L7TH 2VM9A 1UQZA 1WWCA 1ZGLB 1A7RH 2H2SC 3GMOB 4JEJA 1ZSXA 5C0GB 4FZIA 4FADA 5KTLA 3Q2WA 4MD5B 3T4YA 3DROA 1BZEA 1MVFA 2OMWA 1KBBA 1UATA 5DZVA 3EO1B 5GGUB 5C0CD 5HYSG 3EXLA 1QW9A 4PA8A 1HIML 3BLKA 4X7SH 1U8OB 3DBXA 4PODA 4GBXC 4LDLB 4I5BA 1P1XA 4E41A 3RWHB 1EMTH 2HMCA 3SDAB 4A04A 3UVAA 1M9SA 1K4CA 3L7EB 5TDNB 4DP1X 1KT2A 2RIKA 4HPOL 3AIWA 4HYWA 4LLUB 1GYUA 4Q0XH 4GKTA 2BIPA 5HYJB 4AZCA 4HCHA 4PUBH 4M51A 3VUPA 4XV0A 4AGMA 3KBNA 2ZUQC 3RIAK 3RG6A 2E27H 4M7LH 1HSBB 1MHCA 4ZMWA 3T4AA 1BZDA 3BICA 5XIMA 4K23L 1BXAA 3X13B 3HCVA 3N9KA 4Y2WA 1UKTA 1UM4H 3BD3A 1ME8A 4TVSa 1I9IL 3IS1X 3C8FA 1QEXA 4XBPB 3KHQA 2OEMA 4POUB 5H6HA 1UWQA 3FA4A 1ZHKA 1E7VA 2WUCL 2J66A 3TJXA 1Z42A 5ICYA 4ANWA 2RQEA 2VITA 3O4LB 4GAJL 4OV5A 4WUKL 1OTSC 1YNKH 1H5BA 4UDTA 1HQRB 3MFFA 3MNWA 4TRPL 4V11A 3T3ME 2WCAA 1Y8BA 3CSFA 2VC9A 2NX5B 2H6OA 4KRPD 4AQEB 1GONA 3GVGA 1GOXA 2EYSB 3SJVE 5D72L 4UOQA 2VXVL 2X9YA 2AGJH 1KJ2B 1W2VA 2ZQ0A 4WXZA 2H3XC 2NPLX 3TO4B 1I45A 5H2BB 3RP1A 4S39A 3P6LA 2Y4SA 4LVAA 4BS0A 4DNHA 3N6JA 2NY3C 2VSCA 3QI9B 3SUTA 4WFHD 5BXFB 5CZRA 5KW9H 3GTHA 1F2XK 5KVEL 6PAZA 3H7UA 5REQA 2LLGA 2ZD0A 3S1GA 4F8QA 3P5ZA 3VVGA 3MROB 5BRBA 1CWYA 5DUBB 1XQKA 3G5YB 3K6SB 2E77A 1SVCP 3WCZA 3EJRA 1A6UH 1A9EA 1IGFL 2XBDA 4PVBA 1YPIA 5KG9B 2BP1A 5ENLA 2WXGA 2LTQB 2EECA 4OCWL 5I1HH 2ZCHL 1UB6A 1U93A 1RUSA 4JO4L 3N4AA 3HGRA 4F91B 3N9SA 5AYZA 1IKFH 1GJWA 2HT2C 3NIDB 3Q3GB 4FQ2L 4DVBA 2X1TA 3MLPA 3LZ3A 2CUIA 2DWSA 3D69B 4YSSA 5B3NA 5JIQA 1WYIA 5C08E 3IDXL 1HWWA 4PGDB 4F9JA 1PLGH 1R3IL 3W71A 3TVMD 5KW9L 3CK0L 1VLIA 3HBLA 3IMWA 3NQ8A 5E6ZA 2G60L 2NY7H 4QEGA 5KG9A 2P88A 2FB3A 3SPCA 5JIPA 2DBJA 4KFOA 2OV0A 4PRIE 3I75A 3W02A 4PJ5D 4R26H 4Y4KD 2JGYA 4N8CH 15C8L 5KSUA 4AGPA 3C2VA 5DT1L 3L3IA 3GSVB 1LE5A 5CGMA 3L4XA 4O53A 2IAMB 3GFXA 4G8EA 3LKSA 4G5DA 3WLRA 5LCVL 3ZJ6A 3MLRH 3SJVD 2ZZ3A 1CZ1A 1F8TH 4HKXB 3I6TA 4FS9A 2A6IB 4X98B 3CUXA 3MNDA 4PJ7B 2DFAA 1ITQA 1GUVA 3CUPB 1Q8AA 2YBRA 5JH2A 4XE5B 5D7KE 4PJ8C 3HB3C 5EZOH 2FJFB 2YBVA 3EPOA 3BWUC 4S3KA 2EHHA 2VDPB 2VE6B 1FH8A 4US5A 4N0FB 4W68A 4AEFA 3CH0A 5HHXL 5JQIB 1FZMA 2GJ6B 4P2RB 3TBTB 1MFCH 1RVFL 1D2OA 5CZXC 2IDSA 3H12A 5DFVD 3VMPA 4NNBA 3FN0L 3NP4A 4BHUI 2LE9A 1T7WA 3QZPA 4TNWK 5I8OH 5SWSD 1FYTD 3TBVA 4HJEA 3LSCA 2C91A 1BYCA 4QG9A 4GKNB 2D7TH 2DIBA 1BF2A 3EFDH 3VXPB 1QFUH 1DVQA 4U1HB 5IHUH 4F3FB 4Y9PA 1SO3A 3S0CA 3CFCL 3V5DB 5JIIA 1ACZA 4O02L 4KU1A 5D4IA 3UJFA 4I7UA 1CXFA 4P46B 5FOJA 3I65A 2XH0A 2XKUA 1A1MB 3K4WA 3S3GA 2XG4B 2PWGA 2OMNA 3M0IA 2XZQH 3L3HB 4KY1H 4PWGA 3TBCA 2A4CA 2EF9A 2YCJA 3QV6A 3R0DA 3P0VL 5T3XL 2FBJH 4GWEA 5E5LA 4DNMA 3E9TA 5CD3B 3GHSA 4M6ML 5FK9B 2ZZ5A 4NJJA 5A8PA 3TT1L 3KWWA 1F6KA 3VE0B 3TX9A 3S4SG 3APCA 5I2IA 3HKZA 5IBTL 5E4AA 5FYKH 1F5ZA 3R58A 1RD6A 5BVJB 2XIJA 4Y9AA 4IQJA 4HK5A 1GYWA 4PV8B 3QXDA 5K1NA 3AXXA 4GIPD 1XYZA 3WXWH 3S9IA 1EDHA 2AJYL 2YGPA 4V15A 2NOYA 1OHZA 3M86A 2WZAA 5F7NC 4MAYB 5DMGC 2Z35A 4XHJD 7TAAA 1EJFA 3ZO0A 2GK0A 4RETB 1U8LA 4Y1AE 1XISA 4NBXB 4H3DA 4D6HA 4IMLA 3N1AA 4BZ2A 3AT8A 5GJTH 2VC5A 1BAGA 1HNGA 5T1DL 2OXNA 5JQ9A 2BHYA 5LBSA 2E6PA 1NGWA 5DJXB 3ARFB 3FU5A 3WQ5A 2HVKB 2W38A 3TXVA 2WCSA 1G4SA 3G24A 3SDXA 1LEGA 1T6BX 2CXKA 3NEOA 3LEVH 3GLDA 1E0UA 4JKPL 3A3YB 1KUMA 4GT7A 4X8JB 1H62A 4RDZA 3BT2L 4XBEH 3WUGA 4EACA 1RULH 1T1XA 2D7TL 3JUZA 3GPEA 1SXZA 3HV9A 2QGEA 1MWAH 3QQ3B 4ZTEA 1KFAH 3FQXA 1P9MC 1U3ZA 5AWNH 2Y5EA 3G5XB 1K02A 2A0NA 2ZE3A 4H04A 2AMXA 2Z8WC 4ONHA 3POCA 4K3JH 4NDMA 1P7QA 3RB7A 4EBQL 4NZ4A 2Y85A 3KNBA 4LPUA 5FKAB 5IGXL 2Q3ZA 1TV2A 3MR9B 4N2CA 1OC5A 5D71H 4F7PA 2P9RA 3S5NA 1P2CB 1X7SA 3FMGL 2UZPA 3LKQB 1JV2A 3TUUA 3IN0A 5T1DH 1DJNA 2NY5L 3C5JB 1OSPH 2AJ3B 3ITYA 4KRUA 1T21B 4NZUH 1ZKAA 3QJQB 4NIRA 4LP8A 2M26A 5AW9B 4X4XA 1BQUA 5AENA 2Z2BA 2Z0IA 3QZNA 1G0XA 1B88A 3NJGA 1UQSB 3O0RH 5B1JA 1O9ZA 4L8SA 5B3SB 1CCWB 1MFBL 1GVQA 3WXWL 3KNBB 1W15A 3N91A 1DIDA 1RQHA 2BX7A 4MZ3A 4WRHA 3PJNA 3U5YA 4M8QB 2I07B 2GEQA 2VZOA 1EEUA 1REIA 1BX2B 3L81A 3PAUA 2H3NB 5AVUB 4PJAE 2ZYHA 1BKSA 1DORA 3S1XA 3X11A 1D2PA 4PBEA 3AJ7A 4QRSA 3KEDA 3ARED 3O8XC 3X1FA 4JCLA 1LO4H 4DIAA 3BDYL 3J07A 4L4VA 4QFUA 1NDVA 4X4XB 3WTXA 4XUGA 4TVPL 1E0WA 2C4FT 4UB0L 2R82A 3LD8B 1CE6A 2VN7A 2A3HA 2VHLA 4S23A 2GVJA 1NIEA 5HA7A 4B95C 2BSTB 5EO9B 1HINL 5DZPA 1MAMH 4BE6A 2A1WL 3EJZD 1C3FA 3LZPA 2NMSA 1RIHH 4JQXA 4K7PX 1PZSA 4UV7H 5DQDH 4OCLC 1AD9A 4AF0A 3BP4B 2BVTA 3D39D 3QYMA 4RVBA 2XZCL 3ZSSA 3X11B 3BW2A 4TM9A 2DQ6A 4HYTB 3EOBB 4CUCA 1V5XA 1BLNB 4HYVA 4Y5YB 3CZUB 1ZS8A 4PB5A 5CIPA 5DZAA 1JGUH 4NERA 4PYSA 2ODOA 4PRDB 4FNRA 4RJEA 5CN2A 1TRIA 5TQLA 2XPYA 1ZNNA 1ICSA 5DDHA 5I3DA 1UGNA 4E41D 2YOCA 1IKNA 3RFRA 2P44B 4PJDE 5G55A 1ZAJA 1AJ7L 1NAMH 2A74C 3HOJA 3U0PB 1W16A 1VCAA 3S48A 3N25A 1DCEA 4MNQD 4ISVB 2CMRL 1MZZA 3TFBA 4NPYB 1K77A 4D8ZA 1ZT7B 2AJSL 3PWLA 1SM3H 4G8FB 4HEME 2FQIA 5CFAA 2PUZA 3R10A 4KV5F 2KL6A 4Y88A 5HI4C 3RDTA 3ITTA 2PPEA 3QNYB 5L9FA 4WUKH 1J0JA 1GPFA 4PULA 5F2GA 3TX4A 1L5GA 6FABL 3DFNA 3BH4A 2ZKXA 4A8LA 2HUEA 4HPGA 3RVWD 3FT4A 4GIYA 5E99H 1DP0A 1IL1A 2WVVB 2DTMH 3IGAA 2FJHB 3WFCH 4HOMA 3GMQB 5DMKB 1I0DA 3TSBA 2DU2A 1YYCA 3KCPB 3PTQA 5A94A 1RUML 2UY7A 4HOXA 1ET7A 4U6YA 3PJXA 5C0AE 4R27A 4K23H 3D48R 2BNQE 4O8RA 3D09A 2VDOL 2ZX7A 2QCLA 4W7VA 2VR5A 3GSQA 4PD4K 4K0OA 5GNYA 2MNJB 1WD8A 2DJ4A 4TQEH 4PJGB 2ALAA 1UMYA 3ZDYF 4FI7A 4KKQA 3QFDA 1W9XA 3DTXB 2AQQA 1AH3A 1C5CH 2JEQA 3U7YH 1U4FA 3ML8A 3OR6A 4Q56A 5KUMA 5IUCA 2MPAH 3F83A 1PMYA 3L3DB 3O8XA 4M5TA 4NXKA 4CN4A 3UZVA 3MQIA 4ELDA 5MF5A 5I1HL 1GY2A 4DLMA 4G5ZL 2W88A 4E9QA 3TU9A 1P7KA 1LNUB 1T2QH 1NKRA 3BGFB 3CSGA 3MRFB 5F6IC 2NQ9A 4R97B 4FX6M 1S5TA 1NF7A 3FQ2A 1V5JA 3G6JB 5EC2A 2R83A 2ENQA 4UTTC 3FFSA 3A6CL 4PUWA 1HKWA 2H8PB 3NQIA 2QGYA 5JMRA 4AGNA 3VFSA 5IFJA 3VXGA 1KTJA 5E1HB 2XWEA 1OAZL 2X87A 3SQSA 1OP5H 1LJYA 3DFSA 4KK5D 3S37H 2ZCZA 3PQYA 3W7QA 2WVUA 5TE7L 5TFSH 5EU6A 4APQD 2WKLA 2PTVA 3TZVC 4QRSB 3MRQA 3L65A 4MXVF 1PIIA 2MKWA 4NO5B 5GGRA 4XXDB 1FG2B 1R3TA 4EZMA 2EDJA 1LDPL 4MYWB 4UQ2B 4JNZA 2OOGA 1BGXL 1TZHB 2HJLB 5SWZE 3NO5A 1ZT4A 3T3PB 4RV8A 3HI6H 4XP9H 3H9HB 1E28B 4OZFG 4EJ1C 5LUMA 4KEVA 4ODTH 4YHPA 3W7LA 1DVUA 1OY3B 1P4LB 2E9GA 3GSRB 3MLXH 2I1OA 2W60B 3AXLB 3MJ9A 4U7MA 1XF5A 4HV8A 1BWWA 3ITGA 3SO3C 3VKKA 3UWVA 2NY5C 4YK4B 3FXIC 1IGTB 4EN3D 2Z1VA 3OQEA 4JG1H 4BH8A 3IU4L 4IIDA 4OZGA 4M1CC 4P06A 4UM9D 2DYPD 3OZKA 3P3UA 1UUQA 1N70A 4JFUA 3HJZA 1SLWA 3UIZA 3KM8A 4PJBF 1DEEA 1PG7L 3FUIA 3EUDA 2EEDA 2G3MA 5F9DC 1H7RA 3IS4A 2CO6B 3H70A 5FEWA 2HZHA 2WC7A 3WTVA 2A3TA 2VCBA 2J24A 1EHNA 2K6YA 1E0VA 3SQMA 2GFBB 3LY6A 4IPLA 4KWWA 1RIVH 4JFFD 2YXWA 4ILDA 3RBGA 5F8RC 1QJWA 1AZRA 3NA9L 1E70M 5A8GA 3BAEH 3II2A 2X2IA 1AGFA 2FEDD 3EH1A 4HP5A 4I77L 2Y36L 3A4JA 2FAUA 2O5YL 3X12B 4BCZA 2ETWA 4PJIF 3ZU8A 2DZUA 3CFEA 3LS9A 2NSMA 3E8UL 5D4YA 4EPKA 1XGYH 2GSGB 2YQ3A 4A7UA 2FGLA 4GD0A 5D2YA 1Q2SA 4ZSOE 3EXSA 4Y4HD 4NQEA 4S1DD 3GG8A 5DUBA 1F6YA 3BQUC 3NFUA 2W94A 5CD3A 5LNWA 2KLSA 3CFBA 4FMFA 5F2IA 1VZWA 3NIFF 5KBNC 3F7LA 3EEZA 1JUKA 2XV6B 4QCIB 1QR4A 1YY9D 4QGTA 3SYOA 1A4KA 1W72A 3QRGH 1I7RA 4HEPA 1C1EH 3RJYA 5EA0L 2ZOKA 3NQ2A 2OODA 3OVQA 1L9TA 3SBFA 5EIIG 5HPMA 5DCCA 3QY6A 1X5GA 1P0KA 2SODB 4YFLF 3TFKD 3B8TA 4XD5A 2W9DL 4Y2DA 1JFHA 1OD8A 4JM2C 4O13A 3HW7A 1AO7B 4KY1L 3LYEA 3O15A 3V55A 3GO1L 1Y7VA 1OFOA 4DGVH 3V5CA 3W2DL 5HANA 1E2WA 2NY4C 3SCMD 4XCFH 2TODA 3AU2A 3KL0A 4GXUN 3U4KA 1KTRL 3N13A 1V54B 3FAWA 2WLNA 4KUZH 5JLZA 3ULUD 2G5WA 3RF9A 2YEVB 3H1ZA 2H6PA 2GWNA 1CZ8L 1NMBL 3KOYA 2MNWA 3CLEH 3EX3A 2HCZX 1RLWA 4R5TA 1SNRA 3P4OB 3TH3T 4QXUH 2BZNA 1ASOA 3I7QA 3ZKQD 3MRIB 4G9DA 2EP6A 3W2MA 4Y9GA 4I13B 2HT4C 4DT2A 4I85A 4G56A 4WFHE 2E5BA 1M6UA 4LUYA 1F73A 1ICQA 3ABSA 1P7QB 3N9GL 3O9WB 4EI6B 1DDTA 2D7NA 1HL5A 1OTTC 1EPFA 5J8OA 1AW5A 3ARGB 1UJ3C 2OKOA 3KBPA 2Z8RA 1AI1H 1WTGT 1YMMB 1PD1A 2IF7A 3P9MA 1JRHI 4OJAA 2HG5A 1LDCA 3LOWA 1XZ0B 1F3WA 4PUNA 1FFNA 5CAYB 1U42A 4KQNA 2BVUA 3IIPA 2P26A 2F7PA 1MDTA 3D7PA 4EZLA 1EEQA 5IFAL 4BZ2H 1E4NA 2P49B 3V79C 1S7QB 3CGTA 2EPNA 1A0QH 3RA7H 4LYQA 1IM9B 2EUWA 4YOKA 4QXGL 4Z7IA 5I79A 3H4WA 4PFMA 3P1VA 2CKBB 3VABA 2OP4L 1A7QH 1SY6L 1WITA 1CF8H 1T6VN 1YEFH 1S7WB 3MRGA 1E9OB 3QWOB 3WY1A 4MGXA 4JO1H 4RGOH 1ZTXH 1MCRA 4UAOC 1JD7A 3NA9H 2IOIA 4GW5A 4ZXBB 4KV5E 2A6LA 1SN5A 4NAFA 2QPEB 2IKIA 4PRPD 1A4JA 1MKFA 2Y24A 2JIWA 2YCLB 3RRAA 3EWWA 1TU2A 2EXTA 3EYOA 3F8UB 1WA0X 4P3CL 3LKOA 5C07D 3ESMA 2IQAA 3ENEA 5TDPA 1NFIB 1UOKA 3GDKA 3GTFA 2CLVA 3NYDA 2LFGA 3Q5YA 3TT3H 3N06B 4FNLH 5JDJA 4P48A 1EWHA 3HC3L 4ZD3L 4U0QB 4L4JA 4NQVA 1PZBA 5T3XD 3RJQB 4IRZA 3RR4A 3PREA 3LEVL 3TOPA 4NYYA 3T1WA 3CVCA 1OM3L 4KWOA 3DI0A 1MCOL 1IILE 4HHGA 1RZKC 1UKSA 1XHHA 5C9XA 2Z7WA 3MV9B 2R9HC 1NGQL 3MOBL 5HNNA 1URZA 4M8UA 1QBLL 3UBFA 5C9JA 5MHSD 4TNGA 3QS3A 1UZ8B 4IOTA 2G3JA 5IWLA 5SWSE 1X4XA 5F1IA 4L8BB 4K8RL 5DWUH 5HDQH 1E3FA 1ZHBB 3OKMB 2YFNA 2Q7YB 3CM4A 2Y22A 4C6MA 1XO8A 1DZBA 5DJCB 1BFVL 3HBPA 3L1FA 1IIGA 3ALXA 4ZSOA 1QWKA 4HZ8A 4XAFA 3CQQA 3DERA 2XWZA 5J3HC 2OJZH 2O9OA 1CB2A 2GIMA 1NMCC 4OKDA 4O5LL 1R5IB 3DX6A 4GRLA 4JAMB 4W9IC 4OLXH 4FXSA 5D7JD 2YPLB 1AY1H 1IC4L 1P7TB 5KZ6A 1KV8A 4FNTA 3MC5A 1A3LL 1U2CA 3RZWA 3GMRA 1F3JB 3KZ8A 1UIOA 3RVTC 3QFWA 4CJ1A 2XZ9A 4RAVB 3RG1C 4XX6A 4NO3B 5K9DA 2WAGA 2VDKL 3WH6A 4J3OG 3FF8A 3MV7E 1T2XA 3MMEA 3C5JA 4P07A 4HC1L 5E1QA 3VWJC 3RGBA 1ITUA 4IBUA 5BO1L 3MUIA 1VEOA 1TJHH 2OR8A 5JIKA 3TJHC 5KWYC 3SDDA 5HY9A 4JY8A 1C9WA 2P47B 3E0GA 3HC2A 1NFBA 2CPUA 1WKFA 4AWSA 3V5KA 3D47A 2ZCKH 3EOAB 3C12A 4QTIH 5BZXA 2DKMA 3CUJA 4YAQB 3UZVB 4AK2A 3ROLB 2WWOA 5D1QA 3TYAA 3N0AA 1JP5A 1RLCL 4HH8A 2DKSA 1IC4H 5E99L 3WFCL 1PV8A 3D3VB 4HWBH 4BFIB 4C4BA 4XVEA 4AZIA 4XGZB 4HVXA 4O4WA 4NZ1A 4HKBA 4HKXA 2ADGB 4E9VA 2G41A 4JTAA 4Q32A 5A3HA 4MA8H 4OGXH 3S6CA 1XQ4A 3RU8H 2ZA2A 2O5XL 4DJEA 4F0LA 2YQ2A 3GR4A 2X4NB 3G8EA 3K3QA 1QNQA 1TLMA 2AEWA 3SQOL 4QX4A 3QXWA 3PZVA 3QS2A 4QE5A 4K5OA 2YW4A 3QK0A 3PHAA 1DUYA 1MFUA 4YHOH 4LVFA 2QVTA 1BVLB 3SCMB 5ITBL 3QJHA 2XQYG 4DEPB 4Q6YA 5H8PA 3T4YB 3H2AA 2PYFA 3FH8A 4EWJA 2P42B 5EU7C 5DMIH 4LS1A 2OLSA 3WNNA 2VGFA 4DJDC 3CX2A 3GSNH 5A95A 4EI0A 1WWAX 5HPCA 1A1OA 2FWOB 1OX4B 3EFOA 2VFIA 3ITXA 5JXEC 1SFSA 4LGPB 3OPSA 2CDEA 3DNKA 3SSZA 4DQWA 2UVEA 5ERWB 3TC3A 2LHAA 1KIUA 4LIQE 4UTFA 4ZK8A 3UPAA 1A3RL 2FJKA 4G83A 5REQB 4GAFB 4W8LA 5DLMH 4Q52A 1P84K 2ZZ2A 2J7CA 1W8EA 3QXDB 1A5CA 1KDJA 5K9QI 1X7IA 3UXDA 4L64A 2Y23A 4GUOA 3PJTA 1DQQB 3ML9A 3S35L 2VUOA 1DN2A 3TCLB 2AXGA 2EVJA 1HZLA 2QQNH 1U2YA 4MD0B 5CR8A 3GSQB 2MANA 5GGTL 1HE8A 5B21A 5EH1A 1NY1A 4PG2C 3GXTA 4YQXL 2QPFA 4GBXB 2GUBA 4MOZA 4LE8A 1BTMA 2RFXB 1WUZA 3V95A 3DFOA 4U1GB 1UADC 2BRRH 3BAIA 2E1DA 4V1XA 3T4WA