1XD0A

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase
publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xd0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xd0A01
4MNMA 2DGAA 5FCZA 3CZJA 2ZUNA 2D23A 3GNRA 4AZ5A 5DMYA 3VIFA 3CZNA 4GI6A 5BWFA 1DHKA 3BAJA 5ECUA 4PMXA 5CJ5A 4JIEA 4OOUA 3T0AA 2OW7A 1J9YA 3NYDA 4P7NA 4U5KA 1Z32X 2F61A 3ARTA 2QLYA 2V38A 4CD4A 3W24A 3KL3A 1OB0A 3O6AA 2CETA 3GXMA 3EMZA 1PX8A 1UWRA 1LWJA 2A3HA 2W67A 3OLGA 3CLWA 5AC4A 1K6AA 3AISA 1QX1A 2BS9A 2WB5A 3AMDA 1MFUA 2O9PA 4H41A 5ABGA 3WQ4A 1OWQA 4W89A 5TD4A 3N9KA 3AI0A 2G3MA 1HP5A 2W91A 1E71M 3TA9A 3PTMA 1GJUA 1JYXA 3CUHA 3MS8A 4UFJA 3TOPA 3T2QA 1GUVA 4JKMA 5DO8A 4TOQA 1TR1A 2JEPA 1TCMA 2XTKA 5I2UA 1V6WA 3IJ7A 3WFLA 5FKYA 1W9VA 2YL6A 1FA2A 3SCSA 4TUFA 2W66A 2VTFA 1CNVA 3RM9A 5GNZA 4FNTA 3DX0A 1J0JA 3UCQA 1HVQA 3WH5A 1WDQA 4CCDA 4ACZB 5JUVA 1JF5A 4FNPA 2PBGA 4UOZA 1R47A 1KB3A 3WEOA 5FL1A 1V3MA 2VURA 3IJ9A 3WNNA 4R5EA 4R27A 3AMGA 4W7UA 4AWEA 2FHBA 3ZOAA 3U7VA 3BGAA 2J77A 4GXPA 4KGJA 1OGBA 1JXKA 2W4XA 2ZUWA 4IPNB 5BRQA 3BAKA 1E6XM 3VMNA 3TONA 3BC9A 2XGIA 2X0YA 4OOZA 3EJUA 3PZOA 2DSKA 3VDCA 1HXKA 1W1PA 1JFHA 3AXIA 1B31A 4AZIA 2AAAA 5A6AA 2VVSA 1HP4A 3EMCA 1TA3B 3D5HA 3A5VA 3ARXA 4D71A 3GBDA 3AFBA 3L4TA 1E6ZA 5IXEA 1UKPA 2EPKX 4U3AA 4S3KA 4WKHA 3CV5A 2BHUA 3AYSA 1F4HA 5IDIA 4BQ5A 2GDUA 4UQ9A 2GJXA 2X2HA 2CNCA 1KQZA 3BCFA 4AXNA 4MB3A 3RILA 2V3DA 2EBNA 1PJ9A 2WBKA 2XSAA 4FLQA 4J3VA 3N13A 4YHEA 4FNRA 1CTNA 3L4XA 2OYMA 1K9EA 1SMAA 1K9TA 2YBUA 1BYCA 3UG5A 4UFLA 1WPCA 4F9DA 1UWIA 3SIMA 1E4LA 3ZQ9A 1ISZA 4NSBA 2YJQA 1J0YA 4EAMA 3MSGA 2E9MA 1GQKA 1QI2A 3VGFA 2D1ZA 3DYPA 3PZQA 1E1EA 1E3ZA 1ZJBA 4TX8A 4PMRA 1DWIM 1UWTA 1KXVA 3AJ7A 4J3SA 2XWEA 3TTYA 3M6DA 3TTQA 5A8MA 4D6CA 4U31A 2EADA 1CGVA 2VX7A 3MV01 5EMYA 2QHAA 3AQUA 2D0FA 1H1NA 1H2JA 3BVXA 5D9PA 4JHZA 4U2YA 1UA3A 2ZUVA 4PMZA 4XUYA 2PF0A 2BXZA 1QHZA 2JF6A 1VEMA 2ZUMA 3G6LA 3W82A 2X1IA 4OBRA 1XC6A 5C71A 1TUXA 3BXWA 1TG7A 3N15A 2J7GA 4PMQA 2D3NA 3ARQA 5A95A 2Z1KA 1FH9A 4HMCA 3MKKA 4B9ZA 2VO5A 4LQ1A 5D8WA 1OGGA 3WDQA 2ZXBA 1CGTA 2D73A 2YLLA 3RMEA 3POHA 3AIWA 2IGTA 3GH4A 2J62A 3CZKA 3VVGA 2AMGA 2XHYA 1JYWA 4AD5A 4HP5A 1OGSA 4CU7A 3ECQA 3N04A 3DC0A 1E43A 3AICA 4AIEA 2DDXA 3WUBA 2YIHA 1GOWA 4W5ZA 1JAKA 4D6IA 4UR9A 3U5UA 3CUFA 5I24A 2W63A 5KZ6A 4HMDA 4BA0A 3ZR6A 5BXPA 5EB8A 1J12A 4B3LA 1KBBA 4UOJA 5A2BA 3KL0A 1B3YA 2BVYA 4XB3A 4AW7A 3NDZA 2J7EA 1MQPA 1BTCA 1QHPA 3EDJA 1HX0A 2C8NA 4U33A 4M8UA 2CERA 1W9UA 3N12A 4PBGA 2BY2A 4ZXLA 2E8ZA 3QOKA 1C8XA 3N18A 4WF7A 2J8GA 3WD3A 4PMDA 1H3GA 3B9AA 4XX6A 1UR9A 4M24A 2F7RA 3B8SA 1VF8A 1EO7A 8CGTA 1HL8A 1TZ7A 1Q6FA 3PTKA 4QLJA 1WP6A 4QFUA 1UHVA 4C7FA 3OLIA 3UR7A 1EDTA 4QAWA 1NWRA 3WUGA 4QLLA 4NZCA 1P6WA 3KLLA 5EFFA 4OGZA 1E55A 3WKZA 1AMYA 2VJXA 1JYNA 2EO7A 1V3IA 3ARZA 4MNKA 1DWFM 3VNYA 4PTVA 1R8LA 4WLCA 1NOFA 3W38A 1W3LA 1V3KA 5AYIA 1IZJA 1R46A 5A8OA 1WNOA 1LG1A 3TP4A 1UD8A 2GK1A 3AIBA 4GI8A 1RP8A 3DDFA 1UH4A 3L4WA 2XVLA 2OYKA 3A6OA 4AZCB 4DUWA 1ISXA 5IFPA 5EFDA 3EJRA 1QNQA 2D22A 2PWHA 1JG9A 1HJSA 1C7TA 2DSZA 5C70A 4MADA 3EJQA 1LG2A 2NW0A 4KMQA 4KGLA 3WDIA 1KWKA 1LLOA 2A3CA 1CZ1A 1VIWA 4MJ2A 3GXTA 3CH9A 1V3LA 2DSUA 1QI0A 4UNIA 2GFTA 3VIHA 4AD0A 1EA9C 1AQ0A 4TVDA 4Z2HA 1L8NA 3VMPA 3I3EA 1SMDA 2X2JA 1HKKA 3OA5A 4AMXA 2UWFA 5A1AA 4IPLA 2D2OA 4Y7EA 3WF1A 3PN8A 1XCXA 3BSGA 1V0LA 1J0KA 1C93A 2PWGA 1WDRA 4WKAA 1V3JA 3OGRA 3OGVA 3VDBA 4CD8A 2W62A 1JDCA 3VO0A 2CKRA 3THCA 3EDKA 1BGGA 2V3FA 3T2OA 4JCMA 4AYSA 3RPMA 4ACZA 1NWUA 1RD6A 3S6TA 1XRVA 3ALGA 5LA1A 3K4DA 1KCLA 1UUQA 2D24A 3CZLA 4UOQA 3ZJ8A 3WBEA 1W3JA 3ARPA 1TQVA 3WQWA 1GONA 3WH8A 3VIKA 1JZ5A 3AMKA 3CBWA 2ZX9A 2VNCA 2CBIA 3GXFA 1KXQA 2IUZA 3ZM8A 1XHGA 1W9PA 3A4WA 5CPQA 1MVYA 1DWGM 3WQ8A 3U5YA 3KEHA 3PHAA 5A69A 3AMCA 4WKFA 3ZT5A 3BLBA 1NQ6A 3D50A 2XUCA 2BY0A 3EJPA 4PSPA 2EQDA 4LYPA 4AEFA 4M56A 3U57A 1TA3A 3B9DA 1GNXA 3CPUA 2D0HA 4CD5A 1YHTA 2X8RA 4HA3A 2PWFA 1UKSA 3QHNA 1UKTA 5C8BB 1CXFA 2Y4SA 1WZMA 4GINA 5I79A 3W27A 3SUUA 2BHYA 4C7GA 4UQDA 1E6SM 2XG9A 4LYQA 3CZEA 4ZENA 4BS0A 1VFMA 1FFRA 1C92A 1E4IA 5I3DA 1E4NA 3SCPA 2QMJA 3S2CA 1VFFA 5E09A 4PMVA 1XYZA 1I75A 2EJ1A 1HL9A 3NSXA 3F5KA 1L0PA 3T09A 1JDAA 2ZUUA 1EOMA 1R85A 2Z1SA 4ZEPA 1PPIA 3AZRA 1VBUA 3MO4A 1TVPA 2ZX8A 3AZTA 2VRQA 3QHOA 4JFUA 4HOWA 3T0DA 4CN6A 4BZYA 1E6NA 2DIJA 4P8VA 3APGA 1M01A 4W5UA 3DYOA 2QV4A 5AYBA 1JZ8A 2C7FA 1BLIA 1E56A 4WIWA 4F9JA 3BCDA 1D3CA 3CTTA 2YL9A 2YA0A 5BYWA 1TFVA 1CXLA 1E73M 3RO8A 3ZMRA 3EDFA 4W7VA 4FLRA 4Q7NA 2EPNA 2A3AA 2WKGA 4M80A 4EE9A 3AOFA 2WAGA 3T2PA 1WZKA 4KH2A 3W0KA 2XIIA 4HZ8A 4W87A 2VT0A 4IISA 4K68A 1FH8A 1GOQA 2Y24A 1HKJA 5ABFA 5HOSA 2VRJA 1JZ4A 4AEEA 3NSNA 4FMVA 2CHOA 1Q6DA 4CU8A 4OUEA 3D51A 3ARWA 3WELA 3HZ3A 3K8KA 5E0FA 3NJ3A 2FHFA 5F7UA 3WDJA 2F8QA 1LL7A 2VI0A 3N17A 4P8WA 2CITA 1HXJA 4W93A 1KQYA 3KZSA 4XZWA 2XVNA 4CN4A 1M53A 3W28A 1BAGA 1W9XA 1ZBKA 5KEZA 3L4VA 2BVDA 2B31A 4GZJA 3DX3A 5CLWA 1XSJA 1VJZA 4M81A 2J7BA 3OZPA 3FNDA 5E1QA 4DM2A 1US2A 5LYRA 2WVVB 1JD9A 3NDYA 1CLXA 3EDDA 4PMOA 3ALFA 2EACA 3TTOA 1KR0A 1QNOA 2BV9A 2WNWA 2XN1A 4OJYA 4GI9A 2ZICA 1BQCA 4RE2A 1UZ4A 2DEPA 1KGXA 5CSUA 2J74A 1M7XA 5D4YA 4D1JA 2VQTA 1E72M 3AS0A 1KBKA 3WSUA 3WNKA 1CGYA 4CUCA 3N1AA 1MXDA 5FD0A 4JZ5A 3W4RA 1H4PA 2WMFA 2XFRA 2ZXQA 1PX3A 1B9ZA 1HNYA 3WY1A 1EDQA 3ZIZA 3DX4A 5I77A 3G6MA 4YHGA 4DO5A 3GXPA 4MAZA 1HJVA 3VGDA 4CN1A 4YPJA 1E6RA 2G3NA 4HA4A 5E6ZA 4AC1X 6A3HA 3TTSA 2XFYA 2WWCA 4D1IA 1Q4NX 4QP0A 3SEPA 4AIUA 2OW6A 2CCRA 3O9NA 4JHOA 2FDMA 1WE5A 3AHTA 2F7PA 4FF5A 1OM0A 3RM8A 3VIOA 1J0IA 2YDRA 1WZLA 1WB0A 3KE0A 2UY5A 3CUJA 3SCUA 3VSTA 1DEDA 3MANA 1JNDA 1QWUA 1KGWA 2OWCA 4D6EA 4FK9A 3QGVA 3CHEA 3MSDA 1C8YA 2F18A 3AHZA 4C7DA 3GH7A 4CVUA 1UD5A 3WY3A 2RGMA 2E4TA 3SCWA 3FW6A 2X2YA 2CIPA 1TQTA 3LRMA 1MYRA 2VMFA 4AZCA 3HN3A 1VBRA 3M46A 3HG4A 4LPCA 2XGBA 1U2YA 1DTUA 5CGMA 3HG3A 2WMJA 1NOUA 1JNEA 1W32A 1B3XA 4BQ3A 1CXHA 1B3ZA 2WHJA 1OSEA 3IGUA 4H2CA 1PAMA 2WMIB 4TTUA 1GCYA 3ZJ6A 2CKSA 3UG4A 4EKJA 4HA1A 4GZEA 3OG2A 3AS1A 4PUDA 4H04A 1VFOA 3AHYA 4MNJA 4NI3A 4PTMA 1GHRA 1E5JA 5M5DA 7TAAA 1HJWA 2WHLA 2EPLX 3LPGA 2E9BA 4GQRA 1NP2A 4GZIA 3UR8A 1BVNP 1W2PA 3DECA 2O9TA 1WDPA 2WMKA 3M07A 4M82A 1MQQA 4PCTA 1CGUA 3KWXA 3CMJA 4W86A 1LJYA 1B3WA 1FH7A 4H8UA 1E3XA 3ZSTA 1EO5A 2PWEA 1K9DA 4HTYA 2BY3A 1C91A 1ZBWA 4EANA 1EXPA 2FH6A 4L4PA 4MAVA 2OSXA 1CYGA 1GVYA 5A6KA 1KXTA 2EAEA 1GORA 4BF7A 2BXYA 1I1XA 4N42A 4PSRA 3SUSA 5JBFA 3BVVA 5BXSA 4JCLA 3II1A 2E40A 5CZKA 3VINA 3K1DA 3B9EA 1QVBA 1X6NA 2A3EA 1MW3A 1TVNA 2YFNA 2ZUTA 1JZ7A 2WC4A 2ZX7A 1G0CA 5IHRA 1PIGA 5CXPA 3AROA 2JEQA 1UWSA 3BMVA 4PTXA 3GXIA 4GO8A 3K46A 4W88A 2WM0A 2WC3A 5BCAA 4RE3A 2XYLA 1ITXA 4OZOA 4RE4A 1PZ2A 4PMYA 1JI2A 3BLKA 4E2OA 4AZBA 1YQ2A 2J7CA 4HPGA 3VIMA 1DWHM 2A3BA 3AYRA 1UD6A 2VUYA 4FNQA 3ZR5A 3CIVA 1XH2A 1QNRA 2VL4A 1Q6GA 3D52A 3FAXA 1PBGA 3L4YA 1PS3A 1M03A 2DPEA 4AY1A 2WSPA 1V3HA 2XM1A 4URIA 1O7DC 4AZHA 3SCRA 5D9MA 3VPLA 1EH9A 1XCWA 3ZJKA 1GOMA 3IJ8A 5GPRA 1CGXA 1V02E 3ZJ7A 4PUEA 3MV11 1DWJM 4HZ7A 1UQZA 4LYRA 1V0MA 2YLAA 2QMKA 1JDDA 4OKDA 2ESCA 1TQUA 1KXHA 4CKQA 1UD4A 4Q22A 4J3UA 5IHSA 2YDQA 3T0BA 3W37A 2O92A 1EQPA 1ZBVA 4MB4A 5BROA 3AMLA 2CBUA 3RIKA 1OBAA 3AIVA 4S3JA 1JYVA 1J10A 1V6VA 2GJXB 4DUVA 2WKLA 3SCTA 3WBAA 3L2MA 3CHFA 1D2KA 4BQ4A 1V6YA 4GO9A 3N11A 2PWDA 4P7RA 1E0WA 1H41A 1ISYA 4JL2A 2O9RA 3AS3A 3IANA 1E0VA 3MMDA 1FFQA 2DT1A 4WSJA 2GUYA 5A6MA 1JAEA 4PEEA 4LGXA 1BF2A 3GNOA 1E0XA 1G01A 1E9LA 3WY4A 2JFEX 1HN1A 2WZHA 4UFIA 1VJSA 3WD1A 4AMCA 1CEOA 1W9DM 1F4AA 8A3HA 1V02A 5A8NA 4BQ2A 4IUGA 1SYTA 2XFFA 3GXDA 3HG5A 3WEMA 3OBAA 3RJXA 3WH9A 4HOXA 3EMQA 1VENA 1J0HA 2WZIA 1QI3A 1VEOA 3W25A 1VAHA 2WCGA 1B1YA 3ZT6A 1NOWA 3A24A 3WH6A 4GQQA 2FE0A 1A47A 4NXSA 5A6BA 3LXAA 3DHUA 4NRSA 4AD3A 1TQSA 3CGTA 3VMOA 1H5VA 4UQCA 1OINA 1B3VA 1HKIA 5E9AA 2FGZA 3W81A 2OLHA 2E3ZA 2BFGA 2WVVA 5D9NA 4Z2IA 4CD6A 3NSMA 5HPOA 4P7LA 3FHQA 3ZO9A 2VZTA 1GW1A 5M3WA 3WNMA 2EXOA 3MU7A 3I3BA 3BAWA 4A3YA 3I3DA 2Y2WA 3A4AA 4QCFA 2QF8A 2GVYA 2WSKA 3VD4A 1XYFA 1E4MM 5A6BD 3BAYA 4GKLA 3A22A 2JIWA 1WDSA 5CQ1A 1GQLA 4AMWA 1WO2A 1E5NA 4AZGA 4MJ4A 4TVUA 1ODUA 2WMGA 2HVMA 4D6GA 1QPKA 2QPSA 2W61A 3NUKA 1B2YA 3WEZA 2ZXDA 3K8MA 4JL1A 3ARRA 1FHDA 3F5JA 1HT6A 2J7DA 3WNPA 1BPLB 1CLVA 1BGAA 6CGTA 4IM4A 2F1BA 3MI6A 1XGZA 1OIMA 1QI5A 1V08A 4CCCA 4J3XA 2JF7A 3QHMA 4UFHA 3FHAA 3IAPA 3W6MA 2X2IA 1TE1A 3AIEA 2X0HA 1V03A 4V28A 4E8DA 4CU6A 2XN2A 1XSIA 2YKKA 4TVCA 4MPKA 3MUY1 1C7SA 2WCSA 5HBFA 1QHOA 1EGZA 1GHSA 4ATWA 2HISA 4QLKA 4OBSA 4JFTA 4HU0A 3RCNA 3VTRA 4CVWA 1RH9A 4WK9A 3AXHA 2YBTA 3CUIA 2WXDM 1GOIA 4JFSA 2WC7A 7A3HA 5JBDA 2CPUA 5HXMA 2XVPA 1GQIA 2VR4A 1CECA 3PZTA 1RPKA 1CPUA 1H0IA 3W29A 3ARUA 2EPMX 4BCEA 3GDBA 1XD0A 2AOSA 4U2ZA 3CUGA 2ZX6A 4DWSC 4HPHA 1QNSA 3OLDA 2IXVA 1ZJAA 4JFVA 1EQCA 4W7WA 1JFXA 4Z2JA 3WF2A 1RP9A 4ZE5A 4UTFA 4QDMA 3DX1A 4AD2A 3CZSA 3RM4A 1H49A 1JI1A 1EIBA 3GXNA 1HVXA 3FXYA 4E4PA 3OLEA 3TV8A 1UQYA 3O2LA 5A3HA 1HTYA 1ISWA 2WZEA 1HKMA 4MTVA 4W84A 3PBGA 1UH2A 5E0CA 3DX2A 1GOKA 1UKOA 2V3GA 2D20A 2FGLA 2GK1B 3JUGA 5I5RA 3BUBA 1HF6A 3CHDA 1R33A 3LPOA 1O7AA 1QWNA 5A6SA 3FY1A 1UASA 4A4AA 4J3WA 1QNPA 2WVTA 3EJSA 1QW8A 4AYGA 1ODZA 1UZ1A 4X0VA 2WK2A 3AXXA 1OIFA 3GYCA 1ZS2A 1JXJA 1X1NA 4V27A 2CYGA 3D3AA 5DT5A 1CXEA 3WN6A 1E15A 1V6XA 4DUXA 4F79A 2ZWZA 2WHMA 3RJYA 1MXGA 2E8YA 1VFUA 4PN2A 1ZB5A 1ITCA 4A3HA 4UQAA 4DWSB 4QCEA 3LPPA 1OT2A 1C8QA 1JIBA 1ZBCA 4H8VA 4HU8A 1GVIA 1MW0A 2OYLA 3NCOA 1X6LA 3VIPA 5DFAA 2UY3A 5A6JA 4D6HA 1XSKA 1UA7A 2XPKA 4X9YA 2J25A 5M17A 3IAQA 4WJXA 1U30A 4M29A 2ZX5A 3ZSSA 5JBEA 1S46A 1WZAA 4UZSA 5CLTA 2UY4A 3GTNA 1B90A 1KGUA 2W92A 3BH4A 1E6PA 2NT0A 1FHLA 1CXKA 1UR2A 1I1WA 3POCA 1LF1A 3D4ZA 2ZOXA 3WNOA 1JL8A 3VGGA 4TXEA 4U5IA 1MW2A 3PZIA 3VGHA 2RGLA 3VSUA 1OT1A 2Y8KA 1BYDA 2J75A 2ZE0A 9CGTA 1UR8A 5M03A 3A21A 3VX0A 3GNPA 5CSYA 3AIRA 3LX9A 3WF3A 2GSJA 2YL5A 3MUAA 5ABEA 2WVSA 3DDGA 5CGTA 1Q6CA 2JE8A 3S5ZA 5I23A 2VR5A 2G41A 1VEPA 3KL5A 2BHZA 1ZL1A 3KLKA 3OGSA 2CEQA 2YOCA 2W5FA 1UH3A 5E70A 3ARSA 3VDAA 3WH7A 1UYQA 3PZ9A 5AC5A 1UR0A 1E40A 4NX0A 2FYVA 5FOOA 2GJRA 3WUFA 2DH3A 4DO4A 1MWOA 3HJEA 2PB1A 1R7OA 4RL3A 4XZBA 3SUVA 3BUQA 4MDOA 3RDKA 3GBEA 1W1VA 4FLSA 2VX6A 1QW9A 2EPOA 4AD4A 3HU7A 2CBJA 5D9OA 2WW5A 5IFTA 2F1AA 2VCAA 3LRKA 2XWDA 3LPFA 3IK2A 3T08A 1TMQA 2DT2A 3UG3A 3WNLA 3F4VA 2C0HA 4XV0A 3BVUA 1FP8A 2WLZA 2OWWA 1JD7A 1W1YA 1CDGA 2G3JA 4ZFMA 4AISA 2VCCA 5D8ZA 5I6SA 4KRTA 2NT1A 7CGTA 5I0DA 4B15A 4FNSA 1CGWA 1ESWA 3PTQA 1G5AA 4JFWA 2BNJA 2WANA 4ML4A 3MUIA 1QBAA 2VOTA 1A3HA 1XH1A 1EHAA 4P8XA 3U7BA 2WVUA 2YL8A 1XV8A 3QR3A 4UQBA 3VD7A 3W6LA 3UERA 1H11A 1V0NA 3VD3A 4Z2GA 3WUEA 1B0IA 4P7OA 5A94A 4KWUA 1HIZA 2G4FA 4EK7A 3FN9A 3E1F1 4P7QA 4LX4A 4MB1A 3WL1A 3SCNA 3VM7A 1W1TA 1UWQA 4UFKA 3WMBA 1W9BM 2V3EA 3VD9A 2VX5A 1SZNA 4ATDA 3GM8A 2WBGA 1Q6EA 3W26A 3WENA 3FAWA 1LQ0A 1J0ZA 2TAAA 3L2LA 2WLYA 4CCEA 1GJWA 1W2VA 4ATLA 2WMHA 1XH0A 3NIYA 2VZOA 2G8ZA 5GNYA 3VGBA 4ACYA 2J7FA 4NRRA 1GQJA 1W3KA 5ABFB 1JF6A 2ZWYA 3WDRA 3UETA 3QOMA 4AIOA 3PZVA 5BXTA 4Z2LA 4W8BA 2WCAA 1H09A 3BUDA 3BLPX 2ZIDA 5JIPA 3AHVA 1NM9A 3H54A 1KTCA 4TTGA 2VC9A 1V0KA 5HDRA 3VU2A 1UG6A 4AZ6A 1R7AA 1GOOA 4PMUA 2VQUA 1SFSA 3AIQA 3J7HA 3SCQA 1Y7VA 3CZGA 3BAIA 4PCSA 3WF4A 2QPUA 1ECEA 4H7VA 4PYSA 4B3KA 2FH8A 3VKKA 2IXUA 3VGEA 2V5CA 5LA2A 4CD7A 1ZU8A 4W85A 1KFWA 1EOKA 4KRUA 1MW1A 1HJUA 3S5YA 3WMCA 4HZ6A 2ZXAA 3MMWA 2J7HA 4AZ7A 4DO6A 3PZGA 1W91A 2VZVA 2WWDA 3H55A 3WF0A 3K4AA 1CENA 2EABA 3ARVA 1E70M 1FP9A 3THDA 4AD1A 4DM1A 3CZ8A 1QI4A 1R75A 3PZMA 4CGTA 1IV8A 5EBAA 4W8AA 5CPSA 4NZJA 4UFMA 1XD1A 1LL6A 2V5DA 1QOXA 2JALA 1PIFA 2EEXA 4UCFA 2DH2A 1MFVA 2CHNA 2F7QA 1CWYA 2OWXA 1UOKA 3AS2A 3BMWA 1LL4A 3VD5A 5A2CA 2O9OA 1QBBA 2Y5EA 1C3FA 4F66A 3K8LA 2PBOA 1KR1A 5A8PA 2CBVA 2XN0A 4L4OA 5CPTA 1VRXA 1K9FA 5ABHA 2F2HA 1BVZA 2J79A 2PC8A 4JAWA 2DIEA 5A8QA 5A6LA 2YA1A 2UY2A 4GPNA 1J11A 4N0RA 3SUWA 2ZUSA 3A3HA 3EYPA 3M7SA 1LWHA 3A23A 4MB5A 3AIUA 4J7RA 2XVKA 3D4YA 2E0PA 1VB9A 2D3LA 1JZ6A 1KCKA 3LXCA 3CO4A 3H53A 4U3CA 1W3HA 5HNNA 1BYAA 2CESA 3LMYA 4PTWA 3A47A 4NXKA 3VILA 3VUPA 3WD2A 5FL0A 4LXFA 5BRPA 4J28A 5BXRA 1G94A 1R86A 2OSWA 4GIAA 1NARA 2YA2A 1EHNA 3UESA 5CG0A 3BUPA 2XJ7A 1JZ3A 1V6UA 1D7FA 1T0OA 1OCQA 1MQRA 3LXBA 4E8CA 2X09A 1GZJA 1N82A 1G9HA 4V2XA 3AZSA 3SUTA 5JIWA 3EJTA 1KTBA 4J3TA 5GQBA 2E9LA 4PRWA 5FIPA 1BG4A 6TAAA 3L4UA 2WHKA 4FNUA 2DQXA 4DWSA 1US3A 4D6FA 3WL0A 2DT3A 1CXIA 4NZFA 3OZOA 4NF7A 4TX6A 2WYSA 1H0GA 1UKQA 3CC1A 4D72A 2VZUA 1DP0A 4B16A 3BVWA 1B30A 1OD0A 1PZ3A 1UD3A 1GPFA 3LRLA 2VX4A 3MMUA 2DT0A 5AY7A 1NP0A 3MUZ1 1C90A 4F8XA 2YFOA 4MNLA 4ZE4A 2D0GA 2PI6A 1G1YA 2WPGA 1OD8A 5DT7A 1SR0A 4JKKA 4M1RA 1DWAM 3EDEA 4DWSD 1E1FA 4J27A 3WDPP 2BY1A 4D6JA 4OIFA 1PX4A 3HMCA 2VRKA 3WIJA 4PMNA 1UD2A 4MDPA 3DHPA 4H8HA 1CIUA 2YDSA 2J4GA 4HOZA 5A2AA 1BFNA 4P8UA 3WY2A 3WQ5A 2F7OA 1WKYA 1J01A 1BSIA 3VNZA 3VOCA 2J8FA 1CBGA 4B9YA 1NWTA 2ALWA 5GNXA 1R34A 2BVTA 3HG2A 2CXGA 1WAWA 2JIEA 2GDVA 2Y8VA 2VCBA 1JZ2A 1AQHA 2XIBA 4HMEA 1UR4A 1HWWA 2GJPA 1UWUA 3BUIA 3SURA 4X0NA 4WSKA 1E6QM 3OIHA 1FOBA 4W8LA 3SCOA 3BVTA 4Z2KA 2MANA 1WCGA 3VSVA 1AQMA 3WFZA 1HJXA 3L4ZA 1R87A 4ZXOA 3WMSA 1PEZA 5DEZA 1AVAA 3OB8A 5HPCA 1J18A 3ZT7A 3VIGA 1IZKA 2OSYA 2XVGA 3UEQA 1BYBA 3DYMA 3BSHA 3PZUA 1O6IA 3VIJA 3GH5A 1IT0A 3A4XA 4UZUA 1NWSA 3F5LA 4D6DA 4FLOA 4JKLA 2VVNA 3VDHA 3WD4A 1JGIA 1NH6A 3AHXA 3BAXA 2XM2A 1U33A 3SCVA 3VM5A 2XSBA 3WQ6A 3WQVA 3WD0A 5LA0A 1UR1A 1KWGA 2DSWA 3WDHA 3PZNA 2Q8XA 1EDGA 2WMIA 3EBVA 2FHCA 2NSXA 2DSVA 1M04A 2G3IA 3CMGA 3CHCA 1BG9A 3VX1A 5I78A 1ISVA 5DF0A 1TQWA 1BHGA 3VIIA 2J78A 5E6YA 4UQEA 2J47A 4YN5A 1HJQA 3GZAA 2X05A 3W53A 3ARYA 2VZSA
chains in the Genus database with same CATH superfamily
4M02A 4OFIA 2DGAA 3QULB 3F01A 4HV8A 5IB1A 1RJLA 4L56A 4JPKL 2COQA 4HJTA 5AVTB 1IGFH 3MYPA 2AEQL 3NYDA 1IAIL 2A9NH 4JANB 2Y0FA 3D12B 3V0HA 3WLMA 2OXHB 2CLFA 4N9DA 3L1OL 3D3VE 4PVMA 1CU4L 2DBJA 2BOFX 1UXLA 1LWJA 5C0FB 4MYWB 5DVOA 1BFOA 5DLMH 1FHNA 3HLAA 2DM2A 3UZQA 1A5FL 3PNZA 3PTMA 3RIAK 4KKPA 2AK1H 3TOPA 1A25A 5IBTL 1GUVA 5DO8A 2P0OA 3W2LA 2JEPA 3CIWA 1V6WA 2BIIA 2G9HA 3IJ7A 4P9ML 4QQUA 2PD5A 1BDYA 2I1OA 3RWIA 1CJYA 4Y4KA 2A4EA 4XGZA 2XLLA 3QDAA 2JCCB 4DUOA 4F92B 5HGAB 1U92B 1WDQA 4ACZB 5JUVA 2IAMC 1KB3A 2CRZA 3NQBA 3U7VA 3D6NA 2J77A 1KEGH 5IBLC 5T5FA 4RMSA 4ETYA 1WLHA 5T1LB 2YXXA 3KBMA 4OF8A 1S7VA 3GAYA 5GRUL 1M7UA 1G4EA 4G9FB 1OD9A 4IBUA 1RZKL 4AZIA 1HP4A 4D3CL 3D5HA 3A5VA 5B7MA 1UKPA 2DQDH 1ZKAA 1Z3GL 4QHLA 3PQYB 2X12A 2R9HD 3TBWA 2Z7KA 2V17L 5TK2A 4EDXB 2FSDA 3NQDA 4JW3A 3P2DA 5I75B 4V1YA 2QKSA 4AJYV 2TMDA 3TCLB 1VKXB 3D0VA 4U1NB 2FZ3A 1GZ1A 3SCMB 4S1RL 2X6AA 3TWYA 4BWUA 1F3WA 4NQVB 4YXGA 5C7ZA 5D2NB 4WW1B 4HQVA 4QRPD 3VFLA 1S3RA 3CEUA 3VWJA 1BWLA 1BCIA 4LSVH 3CFQA 3ZHDA 4HIHA 1T89A 2NY2C 3BLIA 3ZHKA 3KPSE 4ZMZA 1NBCA 3GDLA 2EADA 3SOTA 2HXAA 2Z34A 5HYEA 5AOIA 2QHAA 4Z7UF 4XMXA 2WZ0A 5L7XL 3V4PA 1IXPA 3W7NA 2IS7A 3QBTB 5FFOA 4XT1C 2Y61A 5LJYH 5BRZA 4FKHA 2ORBL 5EOCH 3WI9A 3ARQA 3UJEA 3TC7A 4AOFA 3WLTA 1POKA 1T1WA 2WTRA 4W9GC 5EN2B 5I76A 3WO4B 4P0DA 1C16B 4X6EB 4TSAL 3RBSA 1JYWA 4IEFB 3VFGL 4Y1AB 4DIAA 1DJQA 3G5WA 1XLCA 1E5AA 1YPZF 3N0PB 3O6ML 4UR9A 4FJZA 3QIUB 1KBBA 1R3JA 3VZXA 5TQ0H 5F88B 2WZAA 3OKOB 2C8NA 5HMSA 4IUOA 3UG8A 1C5CH 4BELD 3L3DB 1ROCA 2FEEL 5I8OH 4ENEC 1SZFA 4X80L 1PD0A 2F84A 3R25A 2F7RA 3QSRA 4A7GF 4X7SH 1NFDE 4IRJB 4NZCA 3GM0A 2L5HA 1GEHA 4PW3A 2DQTL 4GUHA 1WYIA 3P77A 4G1KA 3TP4A 1ACCA 4J2XA 4AZCB 4HT3A 1ISXA 4P2OA 3EYOA 3O11A 5F72S 3UIYA 1C7TA 4PH8A 5T3XD 3FU9A 4XMPL 1IR1A 4BFJA 4LVHC 2BS71 1BQHG 4YSPA 4GG6B 3F7VA 1XG4A 3DBXB 2BP3A 3QIWC 5IIEA 3JV4A 1G7PA 1T1YA 4I3SL 1A3QA 4UIMA 5C2BL 1GJPA 3MWAA 3PWLB 3ZE1B 4XO8A 2VDNL 3KBNA 3T2OA 3HB3D 1AO7A 1DXEA 3WD5H 3MY9A 1KCLA 2B0MA 5JW4M 2F9RA 1F8TH 1FCGA 3RPDA 2V68A 2IBBA 2X4PA 1B88A 2ZX9A 5HQLA 5D1QA 3HI6H 1F73A 2AAVA 2FLRT 4JM2B 5CEZH 3LA4A 1K7XA 4KIEA 2MCG1 1AQ8A 4UM8B 4NO0B 1XAKA 3LN4A 2ZYRA 2E7MA 5HY9A 2P47B 1G7IB 3ECBB 4DI8A 4XHJC 5LIUX 3CPUA 1YEEL 2X8RA 3C5JA 3CDYA 4LLMB 3OWEA 1XF5B 3FLUA 2XBTA 1AD0B 2XBDA 1UM5H 3HHMA 3NCEB 1EP1A 2C34A 2QJGA 3U8GA 2NWRA 4LYQA 3CZEA 3V4PL 3MAWA 4FGMA 1BM3H 3ERXA 4PMEA 3V0SA 2I25N 1VFFA 5KOMC 2WJ7A 4WHCA 3RKDD 4B7LA 4X5QA 1ZWIA 1WDWA 4Y4HA 5INCA 1ZY9A 2ZP8A 4KJQD 4O50A 1IKOP 1JWMA 3RF9A 2ZQ0A 2D7TH 4M7ZC 2CR0A 3W7EA 1LD9A 1KBWA 2BOCA 2ETWA 2V2WA 3GKAA 4K5MA 1Q0EA 3TR2A 2WWMC 2DPKA 5TDOA 1J88A 4U4BA 3QJHA 5ESAB 2BP5M 5IMKB 4GSDH 4HNVA 3QFJB 4GW4A 1JZ4A 1E0TA 3ROLB 1TEYA 2Y89A 4FQHB 2I9TB 4MD4B 1VFBA 3Q4DA 4FQLH 4G80B 1VSCA 1D5XA 1AGBB 2WUCL 3HZVB 1UWYA 3TUUA 4QRRA 2XJKA 3CVHH 2R2BA 4PRBA 5EO0A 1F5WA 2PCYA 4LF2A 5CSRA 1XSJA 3UH8A 4NCC1 4ZMTA 1N19A 3BLDA 4PRTA 2HLAA 1TOXA 3RO6A 3OB0K 2L7EA 4N6QA 5E2VH 1KFGA 2R83A 4CRPA 4F37K 1QFUH 5BO1H 5FA4B 1IEWA 1A5UA 3PULA 3VXTA 2RMNA 3VD1A 1HNYA 3CSGA 1L3WA 1V27A 1A6AB 2X30A 4P57A 4MS8D 4NL1A 4CN1A 5JOPE 5D5MF 1E6RA 4FR1A 3VXSA 4D1IA 4AIUA 2P5EB 3RIFK 2B77A 3QZWB 3JZUA 1ID2A 2CZ5A 2YDRA 5FF0A 3EZ8A 1JNDA 1QWUA 3WHE1 3I50L 4C7DA 4PLKD 1FZMB 3AWOA 5AAMA 3V5FA 4PS8A 4MX7A 1WS8A 3AJXA 4AEHH 5F6IB 1YJDC 4B2DD 1LLZA 5J56B 1OYBA 5HYSG 1CLZH 3NXFA 1B3XA 1I85A 4LQFH 5HYJD 2WWKT 3UG4A 4ZPTB 5D2WA 5LBVA 4PUDA 1RJYB 4MNJA 3LEXA 4U1JA 2VDGA 5M5DA 2JCCF 2GT9A 3GHTA 4POZD 3UR8A 4ZMAT 2GUOB 3S88L 3P4OA 4WW2A 1CGUA 4Z7WE 4HCGA 1V7NH 5JHDE 1FH7A 1FWDC 4PRIA 3AXMA 5EH1A 5CPLA 2OCZA 4GO6B 1JFQH 3ZGIA 1EBGA 3FL7A 4AENA 4WUUD 4N20A 5CIPH 5XIMA 3PABA 2R9HC 4GUOA 4JQVA 2VISB 3K1DA 3QO1B 3OGOE 1XT5A 2ADIA 1BLNB 2NXGA 2W5PA 5CXPA 4M7LL 4GUPB 5DS8A 4S10A 2X1RA 4NOBA 3R0KA 1ICPA 1AGEA 5IT2L 1ITXA 4YL4A 5J3HD 7FABH 4FOKA 5F2GA 5GIRA 4PMYA 1MCWW 3C5ZD 3MT1A 3CH0A 1INDH 4E2OA 4F1ZA 2V67A 3L7RA 4YE4L 4ZX6A 5FECA 3D47A 4QHNB 4WSHA 5GZOD 2NNAB 3CX5J 3TF4A 2ZKMX 1BEYL 5CZJA 2FZBA 1D5MB 3GSXA 4ZRGA 1E4WH 3FCTB 1M03A 4AEIL 4AY1A 2HE8A 1R9ZA 5I18L 4GBXA 5FF7A 4FI4A 4WV1C 5IEKA 1JPSH 1BVWA 3IU3A 3O2WL 3IEBA 4DPPA 3G9AB 4JDZA 2QZQA 3RL1B 5KS9B 3NFUA 3U4FA 4IHOA 4TQPA 4FRWA 3L2MA 2AZUA 1D2KA 3W1AA 4NZUL 1K2DA 1F6YA 1DQML 2DJLA 1RZKH 3PHSA 4DK3A 4UV7L 3QUXA 4HUWB 1SEQH 2Z6IA 4XZHA 1XEDA 4GSXA 1F4AA 4I90A 4GEIA 1MCQA 2XFFA 3ISWA 5HJDA 1D8WA 3MV9D 5DX7A 3WXVL 4XPTH 3LXAA 4FEIA 5SV3A 5DJXA 1M05A 2EPHA 3IDMA 2K9FB 2BHFA 1AGCA 4HCFA 2EDWA 3LYRA 3ZO0A 2EXTA 4PJ7A 5LWYL 1XIMA 3AAZA 3D0AA 1ET7A 5F3HA 3MU7A 4NKMA 1PZDA 4WQ6A 2BJML 4IIEA 1XM3A 1NGPH 3OKKB 4DJDA 2EIZB 1WAAA 5EUKB 5F7HA 3TK7A 4JRWA 2EKSA 2JIWA 4OM0H 5J1TC 5F21B 1MNSA 3EEGA 2IO5A 5I5JA 4I6KA 3S5LB 3I9GH 4OE7A 3PF3A 5DVMA 4ZUVB 1YYLH 2BSBA 3MLTB 3IRPX 4J3XA 2IBGA 4DESA 3LEVH 5F71A 1B4RA 4KFPA 3TO4A 3DROB 2ALRA 4LBEB 2YSTA 2K9UA 1E2VA 2N4IA 3WL9A 1MNZA 3DXAE 5K9QG 5K5YA 1MRCL 3S8HA 2YPLB 2G0KA 2FEJA 5FJPA 5FYKU 3FB8B 3VJ6B 3KM2A 4HWZB 3DI1A 3VFPB 2YAHA 4U2ZA 3QUHA 3P4MA 3LMZA 3CUGA 2NMSA 4DWSC 2R1YA 3N2OA 4AVIA 4Y9AA 1EQCA 1A3LH 3N1QC 2I5QA 4Y6GA 4ES4A 3EOYG 3CHRA 2XN9B 1W6WA 2ZZ7A 5E2UL 2YQ2A 3ZE1F 2B16A 4KI5F 3T2NL 1NVMA 3FUJA 5BMXA 3WJJA 1L8PA 3UYOD 4FQQB 4KY1L 4P2QE 2CLZA 3SZ8A 2GHZA 2ISVA 4JM2F 3Q94A 4KCWA 1HOCB 3EYQD 2W27A 4NUJA 3C2AH 1OE3A 2OFJA 25C8L 4P3CL 1R2RA 4AVNA 1HDMB 4MTMA 1S2EA 3AM8C 2DVXA 5HI3D 2AGKA 4UTKA 3O2DL 4LEOA 3WFDL 4JO4L 1RZPA 1S9KC 2CZNA 3RKDC 1ED3A 4AYEC 4ODHH 3DV6B 2R69H 2IAAC 1CBVL 4EE2A 4M5ZH 2XZ7A 2HROA 3TCTA 3FUFA 1WX0A 3D4ZA 3V0GA 5GHWL 4PJ9D 1RURL 2Z93B 4JPWL 3UU0A 2GGJA 2RGLA 2R91A 5ANMA 4QRPE 5DEFA 3UTQA 4DVRH 3A21A 4NEHB 2GSJA 4GRMA 1NCDL 3W1PA 4GXUN 3LQAC 2A7RA 4R0LA 1AYRA 2VR5A 4TVPL 3RTQB 1WAPA 2OZ4A 3H2WA 1XIWD 3L5IA 2PD9A 5HNUA 2PGRA 2PB1A 3B8WA 2X9WA 5F9WB 1IKNC 1QW9A 5L9DH 2RQEA 2V5BA 5D6DC 1W8OA 3WHE0 2X89A 3CQKA 2NY4D 3LM3A 1IVTA 4X4YB 4D0CA 3KBSA 1FP8A 3O3DA 2OWWA 2CDGB 3MTXA 1YNTB 4KRTA 1YEEH 1XLJA 1FI8C 2GSGB 5TPWL 3BH8A 2WANA 4P05A 3PR2A 1SW3A 1IR2A 1A3HA 4JDEB 1HZYA 1UCTA 2WLIB 3T6ZA 4GCAA 4O02A 3GRIA 3ABQA 1AQFA 1MAMH 5JORA 1MNNA 4JZNB 3FCSB 4LSSL 2G4FA 3E1F1 2FJHB 4MS8C 3TVMA 2W9EH 3KJ4C 1SZNA 2APFA 3QUYB 3HS0C 3VA6A 3QTPA 5BZWA 4XNZB 3VGBA 1OAXH 1UWGH 1OTTD 2JIXD 4XO6A 1QD0A 3W2DL 3H4HA 4IIQC 4KVCH 4L2LA 3RAJL 3X3FL 2OT0A 5J12B 1NM9A 4MY9A 2XHNA 1TEGA 2FVKA 4P4KD 1V0KA 3ZUCA 3T71A 4NNXA 5C0BB 3F85A 3KOZA 4PJDB 2PGWA 3QI9D 2WJFA 4PYSA 2VKZG 2V5CA 5LA2A 3FSUA 3SB3A 2KH2B 4ORGA 4BUGA 4W85A 1SDDA 3B8UA 3GW3A 3SSJA 3OJ2C 2HT4D 2WV8A 1TENA 1U8PA 1U93A 1JVOA 4X4XB 1D9KB 5DUMH 5LGHL 3MCKB 2WQ8A 3RZCD 3GY1A 4O57A 2PTZA 3HBLA 3RUBL 3WFHA 2D7OA 2XSKA 2XFXA 2MTAA 1BAWA 3R4IA 4WTWA 3KW3A 3LDBC 4UCFA 1QNVA 1WA3A 4IWWA 2W07B 4KK6D 1PDZA 2W9MA 3VD5A 2O9OA 1C12A 4OLZL 1WXJA 2RFXA 4M5YL 4QXGH 5HPMB 4DH2A 3FSOA 4YL9A 2AL2A 3GEFA 3BV7A 1LWIA 4GS7B 8FABA 1LE5A 2VMCA 5E8OB 1T2JA 2W0UA 2WKJA 2YA1A 2JVUA 4X6DA 1J11A 4ALAL 1OW0A 3CD4A 4XMWA 5D1ZD 3ZLGA 1CW2A 1KCKA 4Z0XA 2HBXA 4NRYA 3ITGA 5J3HC 3A47A 1GPOL 3C5ZC 3L7FB 2F54A 5CC5A 3I50H 3MRRA 3AZSA 2FPTA 4RBPK 1KTBA 2CGYA 1L3NA 3WK2A 2ZAHA 4LAJH 4ANKA 1JCMP 4PJ5E 1YEIL 2OZ4L 1Q0YH 5DD3H 3CC1A 3SJVE 4C6DA 3ZXAC 3BVWA 4C4BA 3BN3B 2XA3A 5T9BG 4YR6A 1YAIA 3HLKA 2R29A 2GI0A 4E41E 4R7OA 3N50A 4NO3B 4B5WA 3UWWA 5EO9B 3BUTA 1BQRA 3WIJA 3SN4A 4GHRA 2BM3A 1YN6A 3DHPA 2JTYA 3BL3A 3WQ5A 3LYEA 3TGXA 4IOIB 3VNZA 4HLEA 2BVTA 2VDOH 3VFMB 4WI6A 3GBNH 5D37A 1X7IA 5I03A 1VPYA 4N1CA 2WINB 2LVCA 4NY2A 1W5NA 1BXXA 3ZL1A 3I6SA 4WKXA 4IIBA 1TETH 4Z2KA 1WCGA 4LLUA 2B5IC 1J5CA 4Q89A 4Y4FA 3OB8A 3TU9A 2XVGA 4PGZA 3SSGA 3FPYA 1RBOB 1NCWL 4S38A 1D2PA 1R30A 3V9EA 4B5XA 4GD0A 4L4TE 3AHXA 3BAXA 5I1JH 6PTDA 1I7RB 4PP2B 5CEZD 1K7EA 2P7TB 1QBMH 3SRDA 2AXHA 3AYTA 4O2CB 4YE4H 2FHCA 4ENLA 3HZMA 2VJ8A 2VDRH 3WAJA 1WTLA 2X05A 3NQIA 2VC2H 1JVNA 2FSEB 4H88H 1UZHA 3C9NB 3GNRA 5EU3B 5A40E 4AEIH 3EO9L 2DEXX 4JRYA 4NFCA 1XX9C 5GZNA 3DGGB 2PCEA 1ZDQA 2AEIT 4PREB 2OS7A 3MLYL 3U83A 1I1CA 5I1AB 1YJDH 2Z4GA 5D71L 1A0EA 3LNGA 2A3HA 1WWWX 4JAMB 5ABZA 1Q1PA 4W89A 3NIDE 2P4AB 4QKXB 1GHFL 1MEXL 1P69B 2IOMA 4MAYD 5DLCA 1FP5A 1H6TA 4YU1A 1MI5E 5FIEA 5TQ2L 3PAOA 3BE1H 5C92A 2JB5L 1LM1A 3PY9A 3CAWA 1UA6H 2DYSB 3O2VL 1EHXA 3ZVVA 3RX4A 1NMCC 2JQAA 2YRPA 1RBLA 4WFFE 3SDDD 4PD4J 1B2WH 4FZ8H 3L3OA 3V0DA 2W66A 4ZO9A 3P5ZA 1UZ6E 4TOYH 4QY8B 3B4YA 4XX1G 3QJFA 5ERWA 2P43B 3FO2A 3ULUL 4E9TA 4R5EA 4W7UA 2FHBA 3ZOAA 3BKYL 2K6WA 3BGAA 3F5WB 4MJIB 1JXKA 5F96L 1H8SA 2ITCB 3S34L 1XBRA 3JS3A 3RB5A 3VMNA 4XPFL 3VOJA 3D3VD 2WSQA 2R8SH 2LOEA 5CC7A 3QJSB 1BYPA 1N18A 3AXIA 2EIJB 1NCAL 1KBGL 3KRZA 3V0VB 3ME0B 4K7VA 4PBFA 4WKHA 1LRNA 4ZUWB 3QN3A 4R7VA 5GGVH 2GQ8A 2EDNA 1PIIA 3N06B 4MB3A 3FB6A 1ZVSA 4C6IA 5B1BB 4F27A 4J3VA 4LVDA 3UAAA 4CSPA 2BNRB 1BYCA 2XV6B 4G1NA 5FI8A 3LNDA 5A5WA 1MVFA 3DJZA 3PWUA 2F58L 3OPUA 3S8FB 5C0EB 5D93C 2VGLM 4PJ9C 3VGFA 3ES7A 2DQHL 1QA9B 1MCOH 35C8H 3CAFA 4AGQA 4Q6JA 4TX8A 5LNWA 2DQJH 4ZW8A 5KG9A 5XINA 3RK8A 2WXMA 1C08B 3HF3A 1NANI 3Q5TA 3MCMA 3U9IA 3VKBA 2A1YA 4DQOL 3BP7B 3PAVA 2BXZA 1XIWC 4MDJB 1QABA 4U05A 3NCMA 1WUFA 3PBUA 1T66D 2XXGA 3GJEA 5KETA 1E5BA 4RDWA 1WWCA 1W5OA 1AP2A 3QORB 4XBSA 1IBGH 2H1XA 3CLMA 2W0LA 1QOPA 3RLVA 3GI8H 1DBBL 1DJNA 1GOFA 3T0EA 3GH4A 2OMXB 4K5NA 4HP5A 4M61B 3KXFE 1JF1B 1E43A 3E0LA 2DDXA 4Y5VC 3H6AA 4OB5L 1GZHC 1S8DA 3OAZK 4XP6L 3O9WD 5F8QC 4JFQB 2OXGB 1J12A 1YNTF 2DW6A 1GYCA 2YYUA 4LCQA 5HHNB 4QGYA 2X4UA 3KPSD 4QHMB 1T21B 5DCEA 3FQ1A 3GSNL 4GRLA 5LN4A 3R06B 1DCEA 3B9AA 2OBGA 4OKVA 3S46A 2EH8L 5T3XH 3NAAH 1OTTC 3OLIA 1K6QL 3SY0A 3M0VA 4PRPA 3OG4B 5BUGA 1WK0A 3HBZA 1JYNA 3W22A 3IJSA 4GE8A 1MAJA 2YQ3A 4HX1B 4L3EA 1IZJA 4IRSD 5D7SL 1T7VA 2H8PA 1PAZA 4Y2NA 1LP9B 1FDLH 5EFDA 3QI9C 4RRPG 1Z9LA 4JNZA 2QEZA 5AYUL 4F0HA 2VUOA 3PGFL 4ZI8A 1GMIA 3QEQA 3RI5K 3F12A 4APQA 4C57C 1NDWA 2NR6A 2O4MA 1UT9A 2HT4C 5HHVL 1GZPB 4PJDF 2EZ0D 2LGNA 2GSMB 5I1LA 4HIQA 1MCIA 1NLBH 2UZXB 3WLBA 5IHUL 3VIHA 4RSVA 2BX5A 4PV8A 1O95A 1EANA 4AMXA 4CC4C 3W1UA 3LRSA 5A1AA 1L9PA 2FD6L 5EU6A 2NX1A 1XCXA 3BSGA 1FWEC 4FI7A 1V0LA 2TSBA 4FCAA 4EN3B 4R26L 3UCRA 1V3JA 5TPWH 4Y90A 2BOBB 1G1KA 2CO4A 1EL3A 5D7JA 1K8DA 3HRZA 1IAKB 1ECYA 5GS1A 3OXRA 1CI5A 5CNHA 4ZQKB 5LQBL 1Q0XH 3FDGA 3BFQG 1TJIH 1YC8A 2AQ1A 1EFXA 4M6VA 4OZIE 5FWQA 5AW9B 5D1ZC 1JZ5A 4LPVA 2H3XC 1EGVA 2IFFH 1MHHA 1KIRB 1QFWL 5E2WH 5DMKB 1HFBA 4NU7A 1OEPA 1L6XA 3GC2A 3ET9F 3EJPA 3W2DH 4GNKB 4LYPA 4AEFA 4HLZG 4XD6A 3C2YA 1VPQA 2X7LB 1J5OL 2MCPL 1V7MH 3U9UB 4UQDA 4F2MB 2YPKB 3ZDXE 4OV9A 4RRPA 3WJMA 2F5BH 3U6XA 4H8WL 3BEWB 4BHUA 2PR9A 3G04B 5E09A 4QT5A 3BSZA 3PWNA 4M8RA 3LQAH 1HHIA 4LHUA 2YSSB 4CGUB 2LTQC 2J9XA 1RK6A 3TAKA 2DB8A 3U82B 1U21A 1BEUA 3E02A 4UC5A 4M93C 1AY1L 2ICES 5GRWA 2C7FA 2F74B 3ZKQD 4TVSa 5BYWA 3ZMRA 4DN1A 4M6QA 2Q7NA 4S3GA 2ZSVB 4TUKH 5DMJB 4FO4A 4Y2LA 1GYUA 5LVEA 1JGLL 3M86A 3AT9A 5C7VA 3O41A 4L4VE 4JY4A 2FHFA 5E08H 2XQBL 2CITA 1QHQA 4JO5A 4ZSOE 3OR7B 4TQ8A 3QNXA 3B2XA 1XZ0B 3MRJA 2HJKA 4YUEL 2P8PB 4NJAL 3T44A 1VJZA 4CDHA 1YNKL 3FNDA 1FBIH 4NQDA 5J13C 2XN1A 1MCBA 3ES8A 5IKCB 1U91B 3RL2A 1XLBA 1WWBX 4XBEL 1EMTL 2ZG2A 4L29B 2C9SA 2NY6B 3Q2NA 1AE6H 4OV5B 4YJZL 3L3KB 1S7QB 3G6MA 1MAKA 4MAZA 3UC2A 4OIAA 3KPTA 2NY2D 2VYOA 1W1IE 2P48B 2YGNA 3FULA 1VADA 4FA3A 4AIBA 3O9NA 1CFTA 4LL9A 1EF2A 2V2TB 4FF5A 5KBKA 2OMAA 2I7SA 3FF7A 4MAYC 1E9OA 1WB0A 3KE0A 2P52A 5MEPA 2OWCA 4KX7A 3B1UA 4Y2OB 3MSDA 5E93A 3EOAA 1R3QA 1NQBA 2FIRT 1QWKA 3FW6A 2CIPA 4AQ8C 5H91A 4EAEA 4BIKA 2EYSA 3PNRB 4JX6A 4CQDA 1HI6A 4L6HA 4YHIA 4RV3A 1WUZA 3TFKD 3IXAA 4NQEB 3HHRB 4OCXL 4AEOA 5IHHA 2PCFA 1GC1C 2WZMA 2AK4B 3INUL 2XG5A 1VFHA 1NP2A 1DIDA 3GDRA 5AZUA 2O5XH 4PG9A 5JOPD 5G2WA 4W86A 1A5AA 4AM0A 1F41A 3SKOA 1KPRA 2WSDA 1E3XA 4MM1A 1HL2A 3V36A 3TCSA 4RMTA 4ENED 1GA2A 4ZNCD 2W65A 4OZFA 4CVZB 2F0CA 4JPIB 3M1BB 3CSYA 3EO9H 1ME8A 1NCIA 5DJAB 3CUXA 3BOLA 4UTAA 1ZLSH 1TV4A 4NWUH 1D5ZA 2YRLA 2A3EA 4A35A 1NCBL 3BSZL 1G0CA 4LO9A 1P7KB 3K6DA 2WWKO 3GIVA 4Q74A 3REWB 4XHQA 3RY4A 5FO2A 4W88A 4UTHA 4R7JA 5D1XA 2XYLA 1BZOA 1PZ2A 3KYOB 3OJGA 2DQIL 3CFJA 3H24A 3OODA 5LZLA 3BPLB 3O3EA 5EEZA 3EYSL 1Y18A 1Y0LA 3DU0A 3S9ZA 4TV6A 3K5SA 1AG6A 2FZ9A 2JKRM 4B0MB 4YE0A 3L4YA 4RDVA 2JF1A 3B2PA 4KNUA 3O16A 3KZ8A 2X28A 2IF7A 4YDJB 4WDIB 1XR9B 2X4TA 2EVIA 2XV0A 2Y5QA 1DWJM 3R8BB 2GTZA 1TQUA 3EOOA 3HC4H 1J1XH 1SO5A 3UA3A 1XYCA 4YS4A 2W9DL 4QS5A 3RDTA 3ZXWA 1KM3A 4YSOA 4R9OA 6XIMA 4IQEA 4C90A 4P7RA 1W31A 2O9RA 5CEXB 1BZ9B 3PIQB 5HHMB 3N6YA 1XIGA 2MOQA 4PEEA 3O9WC 2VDKL 2XWTA 1U8IA 1DQIA 1D3HA 5FOBA 4XNMB 2CWNA 4JTLA 1TQJA 5F9AC 1LQSR 1RSCA 4HS3A 4URTB 4TPRH 1SFDA 3JUYA 1HYRC 1E4HA 1X9LA 2FE0A 4ODBD 4UINL 3FTZA 3J8F7 1VZHA 3VFWB 1XRSA 3U7YH 3W85A 5K9CA 1AKJB 2WZ5A 2VHLA 4P8QA 1I2RA 1A7QH 3L1EA 3QARA 3SPHA 1LYQA 2P53A 5B3JE 1HZLA 4XAZA 3W2NA 1H5BB 4XMVA 4IRSC 1I1FA 2ZWKA 2E67A 4IJBA 3V0JA 4LLYB 4LCYA 3OG6B 4GRWE 5KMYA 2HK1A 2FWOA 4L8CB 2OTDA 4S3CA 2BIQA 5HVHC 4HAGA 1MCNA 3BUYA 3LHYA 1FHDA 2N1TE 1PDKA 1RVFH 1LP9F 4F33B 3PPFA 4EUPH 1HAUA 1HHHA 3AIEA 1X44A 6PCYA 5IUCA 3TA4D 1BZ7B 1C7SA 4NYLA 4OIIH 3OKDA 4ATWA 5EYWA 1JCLA 2CRIA 3FH7A 3JV6A 4XP6H 4RUBA 1H0IA 2GCYB 3G6JB 3FU7A 4UTAL 4XO4A 1SJEB 4OVUA 4LP4A 4MQSB 4XG1A 2CKBA 3TW9A 5T1MB 3UFIA 3SQOL 5H2BB 3IMTA 3TV8A 4XMZA 5KVMC 1FCCA 4W84A 2G4EA 3L68A 3HUJE 2D20A 1B0RB 5BOPA 4N85A 4QBXA 1ZCOA 4Y4HD 1E0OB 4XCCL 5C0CE 5SWSB 3VU1A 4FXSA 4LLWA 3DUUB 4IP7A 2QQKL 4CADB 4GAGL 2O5YL 2ZOKA 1AA1B 4X0VA 3UPWA 4UB0L 5E51A 2P8LB 4BQ8A 1ECZA 4DTGH 3LHUA 5KBDA 3R8RA 3NQGA 1AZZC 2AQVA 3FO0L 3CH1A 3DXAD 3KBFA 5DYOA 4EBQH 3FYEB 3FS2A 5D7IA 1NSNH 3W5MA 2D03L 3VIPA 3GQYA 4XCFL 4Y2DA 5M17A 4WJXA 5G4HC 4LU0A 2AVFA 4K55A 2UY4A 1R5VA 1OQFA 5EIIG 3EA1A 5LXXA 3ZL4L 1I1WA 5AWNL 5F0JB 4YAQA 4D7PA 1V54B 2FD6H 3BH9B 3PZIA 3Q6GH 5LXEA 4GSRA 4ETQA 4S1SL 3SDOA 5E4OA 4KV5F 5CSYA 5CCGE 2HSAA 2CO6B 3QPYA 2NNRA 2R8WA 3NJGA 4P2QD 5EDSA 2YL5A 2Z31B 5FDWA 3MUAA 3RCMA 4OLYL 1LT7A 3EWWA 3NH7L 2CLEA 3HQOA 3DBNA 3LM7A 1KZQA 3RVXC 4OTXL 5AC5A 5FOOA 3MRCB 3SE4A 2GJRA 3OKNB 3SYQA 3REVA 4KETA 3GBEA 3MJ8B 3VXSD 4X63A 1LILA 1N8ZA 1CLYL 4OU3A 3UJTL 2YEZB 3SBFA 3V9CA 3L65A 1YX1A 3LVEA 3TNMA 5C0IA 3L21A 1NDGB 3HMWL 2TRSA 3EFOB 2I5YH 5C0RL 5FCUL 4ML4A 3CU2A 4E8GA 4R6UA 2A9BA 3TF7C 1NUNB 5LHEA 5IQ9A 4RAVA 2YL8A 4RA0C 1Z9AA 3L5XH 1UZ8A 1W0VA 1V0NA 3KDNA 3OVUB 5TE6H 5I1DB 2R94A 4A8RA 1NJJA 3M4HA 3NTYA 1YNYA 4P7QA 2DN7A 3CFDB 3SCNA 4KJPD 4XVTH 1F3JB 1H60A 3VWKB 1W9BM 3SQBA 1CGSL 1ZHLA 4ZO8A 2YXWA 1TTJA 4GIRA 1NIAA 4KHXH 1U8QB 3UEZA 3IJYA 3QJQB 3NIYA 2XC8A 2R6OA 3K30A 2O30A 1VESA 4UT6H 4WCJA 3FJNA 2VH5H 3UXFA 2PDWA 4LMQI 5DCCA 3Q2VA 3C86A 4PGEB 4PRID 3JYBA 1U3NA 2AERT 3KP0A 4XI5D 1J8HA 2OMYB 4AZ6A 1E9YB 4LEXL 3WTYA 1DUZB 4AXWB 2J8UB 1UJ3A 1K70A 2B1OA 3FOLA 3VFUB 1QRNA 1FX6A 3TFKC 1R3KA 1H3UA 4RMBA 4ZTPH 3LPWA 2ZXAA 2XQBH 2B39A 5FK9A 4TLUA 2J7HA 4AZ7A 2JCWA 3KM1A 4AD1A 4F0RA 1FIEA 2QCNA 4C1NA 5D38A 2W80C 2V5DA 2AABH 3QHFH 3RR1A 3PHOA 1PJWA 2BERA 2H32H 1QBBA 5A8PA 4JKNA 5KYUA 1NCTA 3CFKB 1ZTMA 2X9YA 2B7OA 4L7ZA 4QNPE 3G6DH 4JFFB 4N6EA 4M43L 1A7OH 1CLCA 3BLOA 2BNQA 2ONEA 3SUWA 2ZUSA 1HH6B 4PS4L 1RK0B 1YEGL 2D3VA 1JK9B 3T6WA 5DA4A 3T81A 4GAYB 3UJJL 2GY7B 1AL7A 1XLIA 3LMYA 1E51A 3GG7A 3H9SE 4PB3A 4GQ9L 4GIAA 3F2CA 1W8NA 2ZUYA 3S2NA 2VE6A 5T5FL 4FA7B 3QDGA 1L6PA 5DRCA 2CE6A 1MIML 3WGUB 4AQZA 3SKNB 3QUXD 5TBOA 3N1MC 2IADA 1GT8A 3WKQA 4ADJA 4D2JA 1DQDL 2EYTB 3CCHA 5FHAL 1MZHA 2PDCA 1GPFA 3UGUA 3N29A 2ZOTA 2PI6A 4WK2B 4JKKA 1M71A 2WN3A 4DWSD 1DQQB 4B3VA 5IHWA 4Z7VE 5BZXA 4RW5A 2VRKA 3V5HB 3UWQA 4I9JA 4NZ3A 2ZNWA 4GIEA 3SDAA 2ALWA 1FNEA 1JZ2A 1W1A1 5BNKA 4EJ1C 2FTWA 2UWEB 1HHJA 1RU9L 1E42A 1PQZA 2X7WA 3SURA 4ODWB 4W8LA 4HKBA 2XZZA 3TU6A 1AVAA 1RUAL 4L37B 3ZT7A 3UEQA 3MQTA 3DYMA 3MREB 1I8IB 2HVBA 4K5OA 3GWJA 1HILB 3S9IA 4PJ5D 2R1KA 3AXLB 4N8PA 3ZZSA 1FUYA 3SJVD 1ZAHA 2A5HA 3WD0A 3RHWK 1SVBA 1EDGA 2C19A 4OZGB 4E41D 1BHGA 4MCZA 3HPJA 4JFDA 1OL0A 5KYWA 1BQHA 5FCZA 3Q6FB 5HWMA 3VIFA 1H3XA 2JKXA 3W7MA 1A6VL 1I7UB 4GUFA 1BQLH 2RJGA 1TJGL 5IRPA 4MKSA 3HV8A 4CD4A 3OTRA 2O61A 2H26B 2X3CA 2HAZA 4HKJB 4CNIA 3W7LA 5D1QC 2V8ZA 1MFUA 3WQ4A 3Q06A 4PWHA 5DQ9B 1J5TA 3HB3B 2OMZA 4NIKB 3KNBB 4H9ZA 1VCVA 3SYAA 2O72A 1GC1H 4L4TD 3TL5A 4NAEB 4P46B 1H61A 5K9OA 2QYGA 5JA8B 2V6AA 4GJJA 1RIVL 3MPGA 4ZQOA 5D33A 3UCQA 4KZEH 3R18A 3RX7A 4M5TA 4NKOA 4K9JA 1V93A 4PB9H 3SRFA 4Y9NA 5C07B 3WTVA 3G6JF 2FYYB 4NGHL 3N6JA 1FKWA 2HPMA 1FNSH 2KLRA 4Y4HC 1NMAL 1P7HL 3CV2A 4IPNB 3OR6B 4L1SA 5D72H 5LG6A 1YLVA 3BC9A 1G7LA 1P1XA 3CLFH 1QKZH 1HXKA 1GG1A 1U8KB 5AQ0A 5BWAA 1A6WH 3IDJB 1AJ0A 5JR1H 5LAPA 5HANA 3K2GA 3MOAH 1DN0B 4DXXA 1MI5D 2BHUA 2BOLA 3AYSA 4BQ5A 1E6OL 2A6DB 1JHLH 2GDUA 4W9LC 3V18A 3O6FA 3R0UA 4YC2B 4WFFD 4CNTA 4PHZA 1L2UA 1A8ZA 5HDQL 4FNRA 1CD1A 1SMAA 1HE8A 2WP3T 4E9VA 2YBUA 1X3DA 4TRPH 2X89D 5BRZE 1TYEB 3CAKA 5AZEH 2A4ZA 3JTBA 5FGSA 3U4BH 3FK4A 1J8HE 3MX0A 2YWZA 1K4CA 1HZHL 2E77A 4HEMA 1RD5A 2VKXA 1X5ZA 3MB9A 1JRHH 4REQA 1TIMA 5IZ7A 5GSVA 4RNHA 1H2JA 4Q2ZA 2QEJA 2JI1A 2ZUVA 2EE9A 4F7EA 4HNTA 3BP5A 1R3HA 2Y5JA 5DZLA 3TVMD 1OF2B 5C3LD 4IDLA 3WK1A 4IMLB 4PMQA 4GK8A 1UP2A 4JPKH 5CLYA 2ICCA 3IIVA 3UVIA 3VE0A 3ZDYE 2AEQH 2YLLA 1IAIH 3NJKA 2VABA 4GLEA 2W95A 1BBJA 5G4NA 1ZA6A 3L1OH 1NDTA 3CMOL 1CU4H 2HZHA 2UY7A 2WQXA 2AVGA 4ESKA 2VDHA 1EVTC 5AAMC 1A4BA 5AFDA 1IAIM 2GQAA 1TREA 5IB4A 4NN6C 1A2YA 2ZTJA 3BGJA 2DAVA 2FRGP 1A5FH 5DC0A 2Y63A 4H6QA 3NL5A 3QP3A 3X13A 1KW1A 1A6ZA 5IBTH 2HN7A 4U1IA 4KJPC 2BY2A 2GDQA 4P9MH 3ZTJG 3QGKC 4HETA 4EI6B 3NQ8A 3UROR 1H3GA 2APBA 3WTTA 1W8SA 2VLRA 1T41A 2Y7GA 1U8HA 5HYSA 3T0TA 1N7ML 1TZ7A 1WP6A 3UR7A 4WHTA 2CRMA 1E0UA 1X5FA 4WW2C 1A4JB 3XINA 1O6SA 5MEOB 2CO2A 5HYJB 4S1SH 3CU1A 5AYIA 4F1SA 4XI5C 5JW5B 1ICQA 2ICWI 4HUMB 4EI0A 2QUTA 4Z0JA 3ARDA 3NH7H 5GRUH 2OLAA 1U4EA 3KXFD 2HVJB 4EDWL 1SJDA 4BJHA 4JX4A 4TNGA 4H2HA 3TJEL 3N3EA 2FMNA 4D3CH 1YXCA 1AO7E 3WEXA 4NHCL 1YHPA 1LLOA 3IIXA 6REQA 4XCYB 3GFXA 1X5YA 4JFXB 3ULUD 5KOVC 1NGZA 1V3LA 1Z3GH 2DZAA 2BSEA 3MRPB 3QQWA 2QJIA 3G0UA 2V17H 1MFNA 3UTSA 1L8NA 2MNJB 2ZF9A 5D1QE 5A16A 1KLUA 3BW9A 2ZZUT 1SJHB 5F7LB 4F7PB 4R84A 2BRRL 4XIAA 3HEIB 2HX9A 4S1RH 3TMLA 3ILPA 2KZBA 3CHSA 4X5WA 3QUKA 4XD4A 3THUA 5HDBE 1E90A 3WLLA 3IB4A 3QQ3A 2H9AA 1QPRA 1I2QA 4ZAKB 5JHAA 4IQDA 5JZ7D 5L7XH 2ZXGA 3AMCA 5J6HB 5MERA 5JO5A 3T8QA 3U4KA 2JI2A 5HYQA 1YHTA 2PWFA 2ORBH 4LOFA 4L3FA 4DVOA 1UKTA 1A7PL 3QUXC 2IALA 5F89A 1H8OA 5IV2B 3A3WA 4XBGA 1P0DA 4TSAH 4Y4FD 3VFGH 3K2UL 4GG6F 4DK5A 5BNXD 4YMPA 3O6MH 4QQ3A 4LCRA 1R85A 5JIKA 4HUUB 4WIQA 2Z1SA 3S8WA 2DWYA 1TVPA 4KXCA 1ORSB 3ULVF 4JFUA 3F58L 4QRRE 4ODUB 3MV9B 3KUMA 3EGSB 1E56A 4UDTB 2IPWA 3R79A 3MBED 1SNRA 4LSPL 2QLVB 2WMPA 4X80H 1AZBA 3UTTB 4DJDC 5C0DA 4JB9L 4CQ9A 3G1SA 4MCYA 1L0XA 1ONQA 4K3DL 3FTSA 4JRYD 1TIUA 3S1VA 4IX2A 1OP3H 5GZND 2IQ0A 4FMVA 3DHFA 4O58L 2ARWA 5KSVA 2UWEF 1Q6DA 2DQTH 3HZ3A 1EX1A 2VI0A 2ZYSA 2CBMA 2CLHA 4QRAA 2I9LB 3PFMA 3TJXA 3TO4C 3OVRA 3ZLHA 1AZVA 3VXSE 2R23B 3UTZB 5D96B 4B5SA 2WVVB 3EUDA 1CFSB 4NJGA 3TTOA 4XMPH 4O4WA 5G2NA 2HWGA 3ZKXB 2BODX 4JG5A 1AC0A 3E9UA 3BK0A 5D4YA 1DFXA 1S1RA 1H4PA 1PX3A 1QLRA 1ASOA 4XWGL 2X6VA 3CXOA 4I3SH 3K2KA 5C2BH 3TTSA 4Z77A 2XFYA 4QP0A 2OW6A 1MIEL 2VDNH 1S9VA 3WJJC 4UTTC 4L4VD 1F02I 1M5WA 4D6EA 4K3ZA 3FA3A 3GH7A 2IW0A 4MZIA 2AXFB 2DLHA 1A1OB 1WA2X 4X0KB 4PRIE 5FW6A 2AQTA 4H7ZA 1A5CA 2XGBA 1EP2A 2ZWNA 1DTUA 5CGMA 3B2DC 1PSCA 2Y36L 1JNEA 3TA3B 1W32A 2WHVA 2WHJA 1DDTA 4ANVA 4ES8A 3L66A 2IANA 3FPXA 4G1EB 4HHMA 4BFIA 1GRWA 1QOQA 1EC9A 1DUYA 5IM7A 2NW2A 2DL2A 4G72B 3GD6A 4ALAC 1HCYA 3D18B 2EPLX 2OLSA 3NL2A 4FABL 3V4PH 3NZQA 1MG2C 4ML9A 4MCMA 4M82A 1UACL 4HHHA 1MH5A 2EG8A 1GGBL 2PWEA 1K9DA 3P62A 1WD9A 4S1DD 1SDYA 3N85L 4MAVA 5E95B 5A6KA 2DUZA 3QV8A 2EAEA 3SDXB 4R0LC 2E56A 3FUDA 5IW1A 2OZ8A 2ZUTA 2IKGA 4Z3FA 4I1RA 4JKWA 1PCSA 4LGPB 3BMVA 4TUJA 4RE3A 4NDMB 7ENLA 2GSIB 2YC1A 5I3HA 2YD8A 4QUOA 4H4IA 3GPSA 4C6MA 2WUCH 1ZFJA 4QAIA 2CUMA 1HCFX 2NY4B 3PWJA 2WBJA 1OAUL 4HJJL 4JY5L 4M0XA 1Y1UA 4P23A 3P5YA 4QNWA 1JDDA 3TVMC 4TVPE 2WTOA 4YDVB 4E6MA 1QSEB 5IHSA 1OP9A 5C54A 3URNA 3Q48A 4FQXA 5IJVA 3PAYA 4HS8L 3QK0A 4QOKB 1VBHA 2UUDK 2GJXB 4B3EA 1YY8B 2X4RA 5CJBA 2Q7YB 4WHBA 2PWDA 1Y65A 4OZHA 4PRPD 4ZFZA 3K71B 1EERB 1Q9LB 4Y16A 4PJ7E 1IJ9A 4JPGA 1DSYA 2DRUA 5F9JA 1VPXA 1H3PL 4O11A 3GMQA 3O8XD 4ZMGA 3BJLA 4BQ2A 1Q2RA 1WAAE 3GD1C 3FTWA 3HG5A 4EACA 4BFOA 3FQYA 1B57A 2X2GA 1RK5A 2EEAA 2J1ZA 1HGYA 1J0HA 1VAHA 4OLUL 5BXFB 4LT9A 5REQA 2QCFA 1NC2D 3P9MA 3CG8A 2FAUA 4ZUSB 3KVQA 4UB9A 4P4KB 1CVSC 4XNQA 3AFLA 2XX1A 1N7KA 2F68X 4KJYA 4RA3A 4HOMA 5T1KB 3MHFA 4MBOA 3F7YA 4AC2A 1UYWL 1WC7A 3WNMA 4NSKB 4J5VA 1E5CA 3BZ4A 3AUJA 3DFYA 2WLLB 5LNVA 1TPFA 1IGIL 3S88H 4X6FB 3OC5A 3RZCB 2PDXA 1LL1A 5KS9F 1QPKA 5E1AA 1DV7A 1PG7X 3ULUC 1OW0C 2G5BB 1EYEA 3QHMA 3KBHE 4O02L 3LCWA 2PPEA 3CMFA 2E7LA 1FIGL 3MI3A 3KWUA 2HISA 4NNAA 3AXHA 1YMHA 4M7LH 3WEBA 2POTA 2UZ9A 1E4JA 4JR5A 5IT2H 3Q7JA 4O0ZA 4LDOB 4IPJA 3V8CA 3L3JB 1JPST 3S4SB 3DX1A 3FT4B 3K13A 5DD1L 3V5DA 1BEYH 1HKMA 4MTVA 5B7FA 2V3GA 4BCXA 4U3XA 1SJXA 2PPAA 5I18H 3MROA 2L8AA 3DTXA 3VXOB 5JZ7C 4LLDB 4GFIA 5I00A 2WQPA 3O2WH 3LV3A 2WKOA 1F2QA 3WJYA 1UZ1A 2PP8A 5CILL 4HG4K 3A9BA 4V27A 1PNDA 3LQZA 2NNXA 3L6FB 4EI5B 1U36A 3JRKA 5E7FA 2HXUA 5KZDA 5ANME 3D33A 3NL3A 3L13A 2IC2A 3QHTC 1OHZA 2G5UA 1TQBC 1IYXA 1COBA 6XIAA 3MCYA 4NZUH 2QSTA 1DQMH 4Y4FC 1C8QA 2EUXA 2DMKA 3F03K 5DGQA 4XN1A 3PAZA 4UV7H 1GS7A 2J25A 2M1KA 4DGWC 4D8OA 4PI2A 2DORA 3VKDA 4GW5B 4I8YA 1UMYA 1D6EB 2ZTKA 3DIPA 1E6PA 1IWPA 1FHLA 3QZ6A 3K5RA 2DWEA 4HJEA 4S11A 3WXVH 1GVOA 2QPDB 2VFFA 4QISA 2Y7QB 3REQA 2GPZA 5BS0B 3KOFA 3MBEC 4JR9L 5JHBA 5C0CD 3S3PA 2ZE0A 3O3UN 3G18A 4WHYH 4MDIB 3DTUB 3WF3A 5GGRA 4OV4A 1DL7L 5JXEA 2YXFA 2G41A 3QQXA 2BHZA 5LWYH 5GZNC 3WH7A 4XC3L 2IEPA 1CO1A 3PPGA 4NX0A 2BJMH 4L8DB 1V5XA 1XQ4A 4QEEA 4N6RB 3EGJA 1LVEA 4J3OD 1F11A 2E59A 1CTMA 4FAAB 1KCBA 5IFTA 3TLQA 2I56A 4BWLA 1DJYA 2O5NA 1FA4A 5CMAB 4DJMA 3ZWSA 4C4UA 4HHGA 3GSRB 2CLPA 1LDPL 4A7TA 2ACUA 3F84A 2R29L 1ZT1A 4LOVA 3O15A 4JFWA 2Z7ZA 3ETTA 4JM0A 3L3OC 1JCJA 1S3HA 4JFEA 2XFGB 1XLGA 3VD3A 1M9WA 1F74A 3O6KL 3KVLA 1W3TA 4NNBA 1GGCL 1MRCH 5GJSL 2Q86A 4HIPA 1OF0A 3WL1A 3VM7A 1MOEA 5ID1A 4R7NA 2Y2TA 1EFZA 5DHXB 3VD9A 3CDGA 1W1B1 3SDDB 3L0GA 3C2FA 3MJ6A 3QQDA 3F58H 5IHBA 5GNYA 4BZ1A 4AIOA 5E2UH 1IQWL 3NCFB 1BD2A 4O17A 3CZFB 3T2NH 3OL2A 3G3LA 4QTHA 4ZUUA 3EOEA 2KX9A 5G4OA 1P48A 3O6CA 3VU2A 1R7AA 4H9UA 2H0PA 2VQUA 2LAAA 3VDGA 4KY1H 4PPTA 4YZFE 1EJOL 5TAOA 3CVHB 1ZT4B 5H8PA 3CU7A 3H7BA 3V7MA 3CPLB 3OF6A 2E46A 2WQDA 4X6DE 25C8H 5J57B 1JZFA 5EF1A 3ULUE 4WX2A 4P3CH 1D9EA 4A29A 2V7NA 3R8HA 2YWYA 1JHTB 3PZMA 1SOSA 1S2WA 4W8AA 3O2DH 3DJSA 3WFDH 4JO4H 3FUHA 2F54E 4QLWA 1RZ7L 4S1DC 3OD3A 2J7LA 5M94B 4G7FA 1H8NA 2VKWA 5ADPL 1I8MB 5FYKL 1CBVH 2PC4A 2P1YA 3JTTA 3CVBA 5H8DA 9XIAA 1AXSA 1NCGA 4MNGB 1X8CA 1AZRA 2CBVA 5GHWH 5A2JH 3G8EA 4J1UB 1RURH 4JPWH 1VRXA 5JDSA 5D6CB 4H8WC 1K4GA 2H5UA 5A8QA 1FV1B 3EAKA 4BF5A 1TJ0A 1NCDH 5B8CA 3N4EA 4YIQA 1WIOA 2XDFA 5CGYD 3CH8A 4TVPH 4DN4L 1HSBB 1NM4A 4ZMVA 4WTQA 3AGWA 3T0EC 4XP4L 1C5DA 2VMEA 3BKJL 3GSOA 1D5BA 4IGBB 4IJCA 1K77A 1V55B 1EJ7L 3EJTA 3E2HB 5D04C 1G7HA 2B59B 2ZOLA 5E6RB 1G0DA 1KM1A 4Q4MA 1HOEA 3FSVA 5L2KA 3FFCB 1XR2A 2CD0A 4J8RB 1KD0A 2LLEA 1OD0A 1NP0A 2IPTL 2D0GA 1T20A 1MHEB 3WG7B 1RUPL 2OQLA 3LERA 1OFRA 5FF2A 5G4EA 4H0HB 4LSSH 5CIPB 1NWOA 5A2AA 2OX4A 1A66A 1FE8L 1J01A 2FGBA 5IQ7L 1Q4WA 4DVBB 1OFQA 3RWHB 3KPSB 1F61A 4DZ8A 2DYPA 4FSAA 1UR4A 3H2NA 2R2EA 3H9SD 4AX3A 1UUNA 3O8XC 4WSKA 2AF2A 1TX0A 1CDIA 4M48L 2MCAA 4X3ZA 4JRYE 3STEA 3RAJH 3X3FH 2QJJA 3NEHA 3VIJA 3KPNA 1Q6QA 3PJSA 3A4XA 1T1XA 1P4IL 1THFD 1PY0A 5FJTA 2QGYA 2GAZA 4BHYA 2O6FA 1N0XL 1MZRA 3WQVA 3P0GB 5LA0A 5GISL 4BZ1L 4I0PA 2OMTB 4TUOB 5FYKE 4MZRA 3OQRA 4F40A 1RUML 1QO2A 4Y9PA 1WDAA 3FT2A 2P80A 2FQEA 2HXTA 4OU1A 1CQYA 5LGHH 4MNMA 3RU8X 1A02N 4Z5RA 4D8ZA 3V4UL 2IQAA 1DHKA 5D7JC 1BXCA 5CJ5A 8XIMA 5GS1C 2ATPB 4ICWA 3HNVL 3HFYA 3EW3B 1BVLA 3TIDB 2EDYA 5D32A 4JGDA 3HKZA 3RLSA 1MMFA 5CH9A 1F13A 3HBQA 2IMNA 2QKIA 4OLZH 2INZA 5ABGA 4XCEB 1NFDB 1TZ8A 3QY8A 4M5YH 2B08A 4I13B 3ULSA 1QUPA 3U4EA 1A5KC 3RVXD 1WSST 3VFRA 2W91A 3G5VA 4U6TA 3CUHA 5HDWA 4ALAH 5CP7A 4M6PA 3Q8BA 1PUDA 5DR5L 1QK2A 1W54A 2XTKA 3DUGA 3FTGB 3U30C 5F8RC 4E4UA 2YL6A 1GPOH 1U8OA 5CHNA 5DJ6A 4HK7A 3LCHA 4G7VL 4FNPA 2ODOA 3DC8A 1R1CA 1B0GB 3NSDA 3V3WA 5GGVY 4Y4KD 5TDPB 1SW7A 2Q71A 3H2QA 1EWHA 1YEIH 2XGIA 2OZ4H 5EU4B 2W9LA 4PLNC 4R9XA 3CN1A 4U7KA 5ADOL 3TPUA 3MJ7B 3RX5A 3UYPB 3SFKA 1QTWA 2XZAL 5ICYB 5E9DA 2AJZA 3DI0A 5IDZA 3JYCA 3KPLB 5HGDB 3M1CA 3SPVA 5KJ4A 4RIRA 5KSBA 1SYVA 4YVVA 1CF1A 2IAMB 4R85A 2VR6A 3L9RA 5MKGB 3H8AA 3NMEA 3TNOA 3N6HA 3JT2A 2VEIA 4M7LT 2FLIA 2J21A 3PG9A 2J5LC 3QH3A 3A13A 4HJGA 4AZ8A 1E4LA 3ABLB 3Q8FA 1CT8A 2R1LA 2OOGA 2AC0A 1J0YA 3L17A 4NOFA 3T8VA 1NCWH 2X16A 1E3ZA 4PP1D 1IEQA 2XH4A 5AHNA 3GKWL 3MRMA 3T0EE 2WO3B 3O05A 1Q65A 1PDYA 2IV9A 2HJLB 5AVQB 2HRWA 4HS6B 2Z7YA 5EB9A 3IFPB 2CU9A 1ZMYA 4A7SA 3VWJD 1QHZA 4UAOC 5I8CA 1VCGA 3R12A 1K85A 4J3OC 4N90E 2DDQL 3T1GA 1IM3B 2G97A 3MKKA 3Q05A 4HMNA 2VQ1B 5D4HA 2WP3O 2RQ8A 3N9RA 2G0LA 2VDML 3P3UA 3SGGA 4Y5YA 3MLYH 2F5AL 2PTDA 4QE5A 5D71H 4LKCB 3Q9PA 5BRZD 4ZOEA 1EHLL 4FI6A 4PRPE 1UMLA 4M7SA 1TCRA 3M5XA 3QCTL 1J8HD 2CLRB 1GHFH 1MEXH 3ZR6A 4L3EE 4UOJA 4Z7AA 4N9BA 1WFUA 4NP9A 2BVYA 5TQ2H 2KZKA 3STLA 1S5VA 1MQPA 2X70B 2JB5H 2IPFA 3O2VH 2X6BA 1RZ8B 3RDJA 4PVBA 3DPBB 3QEQE 1FYTA 2VRAA 3KHOA 3JBG7 4NT0A 3PJUA 1BYNA 1X7SA 3HZYB 2YGOA 4X5XA 5DTFB 3M5ZA 4JTJA 3AWGA 2DZEA 3KLLA 4PTTA 3ULUH 1ZPLA 3BKYH 1V3IA 3M88A 5F96H 2IXQA 2F8OA 2Y72A 5EU6E 4OY9A 3S34H 1FWAC 2R0ZL 4XPFH 2Z0IA 3EJRA 3OZ9L 1QNQA 4F91B 1YE4A 2W6RA 4QHKJ 3BGFC 4ZMYA 5IWLA 1NCAH 2DSZA 3LY0A 1KBGH 1Q94A 2DI9A 1TQCC 2M83A 4HLJA 3UNTA 2NY5L 1OARL 5G2IA 3MNVA 1ETA1 1ZHKA 2JLLA 4P2OD 5D1XC 3VFVB 1AQ0A 4MJZA 3S48A 2OFQA 4QRTB 5DANA 3X14A 1IT7A 4HIEB 3EXJA 5I17A 3PN8A 5C09B 1NFGA 4HUCA 4K07A 5T1DL 3GU9A 1OX4B 3HQ1A 3LNPA 3QDGD 3VDBA 3OGRA 3OGVA 3ZVHB 4MG4A 2F58H 3IUDA 3K6SA 1A7NL 4DZBA 3S6TA 3PUDA 2DQHH 1TWSA 1NGYA 2G5RA 2D24A 2VAJA 3ARPA 5GJSH 3HI1B 4AK1A 2JTDA 4N0CD 3C2SA 1OCNA 3O0RL 4BA8A 4LVHB 3ZLQC 5CGYC 5CPQA 3RDTC 4DQOH 1AO7D 4Z7WB 1JDEA 5ID0A 5JHDB 2BK8A 2C3HA 4FOJA 3QIWB 5LKYA 3J2PA 3GU1A 4G7EB 1G7JB 3B9DA 2HKAA 3SDAD 9PCYA 4O5LL 2Y4SA 2DI8A 5D1QD 4ZK8A 3D85A 2BHYA 1E6SM 1QUNB 1XH3B 1DBBH 3B7RL 1VFMA 4JGUA 3EOBA 3GZQA 4K0OA 4OB5H 4F48A 4IHCA 1PPIA 5ISZA 2EIMB 4Q8QA 1AQDB 1JNHA 1SXSA 4YSRA 1EEYB 2NNFA 4NWTL 2VN5A 4UQ3B 5FKPA 3U25A 4U1LA 4XC1L 1AR2A 5AYBA 1OGAA 1YEWA 3X2QB 4OLWL 2XKUA 2YL9A 5L8KB 3GSNH 2XWCA 1R3IL 4FFVC 4LIQL 4FLRA 3H4WA 3MDUA 1BOGA 4HWBA 1R3LB 2O56A 4NQDE 3TO2B 1LOSA 3MGTB 2EH8H 2XIJA 4IISA 4HC1A 1K6QH 2GSHA 4OM1L 3KRSA 5KSUB 4CMHC 4JTHA 2DQCL 4LCCA 4J2PA 4ERGA 5D7SH 1LUCA 5HGHA