1XD0A

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xd0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xd0A01
1BGAA 4JKMA 1V3MA 3PZIA 3VILA 2X1IA 1JZ4A 5GPRA 3CO4A 4N42A 2FE0A 5IHRA 1SYTA 3HG3A 2CBIA 2DT2A 1ZBVA 2DSVA 4IPLA 2JIWA 2YDRA 4AW7A 3CZNA 3VSUA 1QBBA 5M5DA 2YL8A 1R7OA 1UWTA 1B30A 3AMDA 3VINA 3GBEA 1UR9A 1E43A 3W28A 3W81A 5I2UA 1QHPA 1XH2A 4U33A 3B8SA 3MUZ1 3POCA 5DO8A 5A2AA 3B9DA 1UZ1A 2E4TA 4HOWA 5D8ZA 4OUEA 5A95A 1JDDA 2ZUNA 1XYFA 2YBUA 2YFOA 4F66A 2CESA 3MKKA 3NIYA 4PTWA 3CZJA 1CEOA 3WF4A 2WZIA 3WH5A 3T0AA 1V6UA 3PN8A 3WUBA 4JAWA 4W84A 1Q6FA 2BNJA 1HJVA 1QW9A 5A6BA 3G6MA 1PZ2A 1Q6CA 1DWJM 2XSAA 4P7LA 3RM9A 3A5VA 3WNPA 1W1YA 4U3AA 1AQMA 2WVSA 2ZXQA 2X2HA 2YJQA 2EPNA 4DO4A 4L4PA 5D8WA 4GPNA 1OT1A 1E9LA 3WEZA 1OSEA 3IK2A 2GDVA 3ARUA 3VKKA 3N18A 2E9BA 3BLKA 1BQCA 2WZEA 1QOXA 5C8BB 4TUFA 1AQ0A 2DT0A 5FKYA 3BH4A 3W4RA 3AS3A 5LA0A 1KGWA 4MB3A 3T09A 1E3XA 3ZOAA 5AYIA 2OW6A 1GW1A 4U2ZA 1J11A 5CSUA 1WKYA 2VCAA 2JEPA 1DWAM 2WMIB 2ZX5A 4GXPA 7CGTA 1H3GA 3H53A 1E6PA 3LXBA 4W7VA 1TMQA 5E0FA 1NM9A 3HU7A 3WF0A 3PTKA 3RM8A 1KBBA 3BUBA 2E8ZA 1JAEA 4C7FA 3DHPA 1HX0A 1UKPA 5DFAA 2VZOA 4FNSA 3BAKA 1UWUA 1UZ4A 2OWCA 2ALWA 3O2LA 2OW7A 4ATWA 2AOSA 1K9EA 3ZT6A 1LWJA 4NX0A 4PTVA 4DWSA 1CXIA 2DSKA 3VPLA 3PZGA 1H09A 2YA0A 5C71A 3IJ8A 3A47A 3HG2A 2VR4A 4ZEPA 1CLVA 4X9YA 1CGUA 3IAQA 4S3KA 3FNDA 3OLGA 3BVWA 5D4YA 1GQJA 1V6VA 5JBEA 2Y4SA 2WVTA 2BVYA 1E0WA 1J0YA 4MB5A 2XVGA 1PX4A 2A3EA 5D9PA 3ARVA 1BVNP 1HNYA 2BFGA 5GNYA 3WH8A 2F7OA 1E5NA 4W7WA 4WK9A 4C7DA 2WMFA 3D5HA 4Q22A 1ZB5A 4OBSA 5KZ6A 2DPEA 5CZKA 4BF7A 3SUSA 2VZSA 4UQDA 3J7HA 3WUGA 5IHSA 4QP0A 4YHEA 4HU0A 4JL2A 1JD9A 4HA3A 1E72M 4KMQA 4E4PA 1J18A 4GZJA 2EADA 3GH5A 3SUTA 3EYPA 4CCDA 1ODZA 2GJXB 1JXKA 4E8CA 3CMGA 5HOSA 4NXSA 3MSGA 2YDQA 1XV8A 2CCRA 2W67A 3QHNA 1BLIA 1ESWA 3VX1A 2Y24A 1TVNA 4GI9A 1HVQA 4D6JA 4CCEA 1VB9A 4GO9A 5E09A 3W29A 1OBAA 1FFQA 5E6YA 2WC4A 1E6QM 1GORA 3QHMA 3WD0A 4AIUA 1BG4A 2G3NA 2WHMA 3I3DA 2CNCA 3EJTA 1MQRA 3AYRA 4CD5A 4D6EA 1MW1A 3MMUA 3EJPA 1NP0A 4PMRA 1UASA 2WMJA 1H2JA 4OBRA 3II1A 1PBGA 3VNYA 1WDRA 2ESCA 2FGZA 1QX1A 3AIEA 1W3LA 1UHVA 5D9MA 3LXAA 2DSZA 2V3EA 5HPOA 3ZR5A 1YQ2A 3NJ3A 4CN4A 4MJ2A 1JIBA 1CXHA 2YA1A 4J3SA 4TVUA 4AY1A 3B9EA 3VIIA 1QHZA 4A3YA 3M6DA 3M46A 2D24A 2VUYA 2D20A 1UD5A 1F4HA 3SEPA 3CZSA 1I75A 4ZXLA 1JDAA 1O7DC 4U5IA 2IGTA 2BHYA 1O7AA 3CIVA 2XHYA 2BVDA 3FHQA 1TE1A 2F2HA 1OD8A 1E6XM 3CUGA 1S46A 2WANA 1SMDA 1LL6A 5M3WA 3WIJA 1V3LA 1WP6A 4Z2IA 1UKOA 2PBGA 4QDMA 1BPLB 5A6LA 1R46A 4MADA 1EHAA 2VQTA 3VSTA 1GJWA 4MJ4A 1E40A 5F7UA 3IJ7A 5A8OA 3A22A 4W8AA 6CGTA 3LPGA 1TR1A 4OOUA 2WSPA 2EPLX 5GNZA 3NSMA 2E0PA 1KQZA 3KL0A 2WAGA 1HWWA 2C8NA 4GO8A 3A4AA 3VUPA 1KWKA 4Z2HA 4MNKA 1V0KA 4AZGA 3K1DA 2GK1B 1KXHA 3SCOA 3U5YA 1FOBA 3DX3A 4W89A 2F18A 1QI0A 1WCGA 3MUAA 3T0DA 3THDA 2X05A 2PWHA 3UR7A 2HISA 3VTRA 1PZ3A 3T2OA 5CGTA 5I23A 2EXOA 3AZRA 4RE2A 3VOCA 1JGIA 1EQCA 3E1F1 4YPJA 2JALA 5FOOA 2DSWA 4CN6A 1JFXA 2EPKX 4JFVA 4J27A 3AHTA 2ZUTA 4JCLA 3ALFA 3MU7A 3WEMA 1UA7A 4HMEA 4PCTA 4H8UA 2QPSA 1CXKA 3UG4A 1GOMA 3BC9A 3TOPA 4V28A 3WDPP 5A6KA 1GQLA 3QHOA 3FXYA 3HG4A 1KWGA 3ZJKA 1SR0A 4PBGA 2A3HA 1M04A 1UA3A 3MI6A 1WDSA 2VRJA 3WNKA 4UFIA 1QPKA 4FNUA 3BSHA 4PMNA 2YOCA 3LXCA 1JD7A 1W3JA 3K4DA 5DF0A 3EDJA 1UUQA 1GUVA 4AYGA 1QNSA 1L8NA 4WSKA 3SCSA 4LYRA 4DUWA 1H1NA 3WBEA 2G3MA 3VGDA 5JUVA 1GNXA 1W2VA 1XC6A 1FH7A 1E1FA 2DT1A 1JF6A 3BXWA 8CGTA 1W3HA 3L4YA 1B90A 2J8FA 4NI3A 1HJXA 2W91A 3WEOA 3QOKA 4PMOA 3W24A 1WAWA 5EFFA 1B31A 1EO7A 1E4IA 2CERA 3D4ZA 3F5KA 3S6TA 4ZE4A 3TTOA 1CENA 3UEQA 2VRKA 1YHTA 1UG6A 3MMWA 1UR4A 4N0RA 2F1AA 3GXTA 4FLQA 4W86A 4X0VA 2HVMA 5FIPA 3LPOA 2EO7A 2YL6A 3DECA 2D0FA 1ITXA 1QI4A 2GUYA 1QHOA 2XWEA 4HPHA 3OG2A 1VFFA 3W82A 4PTXA 2WSKA 2XFRA 1ITCA 3W26A 2JF7A 1B3WA 2DDXA 3WDJA 4JFWA 3A3HA 2NW0A 1HJSA 1CGYA 3WUFA 2E8YA 1MQPA 3O9NA 2UY3A 3VDHA 1K9FA 1VRXA 1TFVA 1B3VA 2WB5A 4AZ6A 3PZVA 1V6WA 3NDZA 2WVVB 2J7FA 1W9BM 3WF1A 1VF8A 2WVUA 1LG2A 1X1NA 2EACA 5FD0A 4WSJA 2YL9A 1JF5A 2F61A 3BSGA 4ZENA 3WL1A 1P6WA 5ABHA 3WMBA 3LPFA 1DP0A 1GQIA 2ZXBA 3OLIA 5CPSA 3APGA 3KL5A 2F8QA 1ZBWA 3I3BA 2WPGA 1CIUA 2XIIA 7A3HA 1V6XA 3GH7A 2UY2A 4WIWA 2F7PA 1BSIA 4AMXA 2YL5A 3VD9A 4IM4A 2J7CA 2FHBA 4YN5A 3UERA 1HT6A 2V3GA 4JFUA 2WKGA 1R87A 2VVNA 3L4WA 1W9XA 4CCCA 2TAAA 1W3KA 3IJ9A 1E55A 3VM5A 4ZE5A 4HOZA 1JXJA 3AMLA 4W7UA 2ZX9A 3IGUA 1MVYA 1PEZA 1BTCA 5JBFA 1B3XA 1HKIA 4ML4A 2VQUA 5AC5A 3FW6A 2Y8VA 1MW2A 2XGIA 2D22A 2J62A 1JI1A 3FAWA 2VO5A 1XYZA 3CHFA 1UD6A 3SCTA 3ZR6A 2DSUA 1VFUA 2DQXA 1HP5A 1LG1A 4FK9A 3VM7A 3CUIA 4WKAA 1UQYA 2F1BA 4WF7A 3CUHA 1JZ3A 3UR8A 1MW3A 3WH6A 3L4VA 1T0OA 2GVYA 4UZSA 1NWSA 1J01A 1MXGA 2J7BA 3AIVA 1PJ9A 3CUFA 4AIOA 2CKRA 4BS0A 2D23A 1KR0A 3WH9A 4M8UA 2Y8KA 2WCGA 4D6HA 4MNJA 3VMOA 4W85A 1CXFA 2W61A 3VNZA 3WNLA 3BUDA 5A8NA 3OGRA 4TOQA 3WY2A 2WHJA 3D4YA 2EEXA 2YBTA 2V5CA 3MUIA 3U5UA 1DWGM 3SCPA 1HKJA 3M07A 3VD5A 3HZ3A 3W6LA 1HVXA 3ZJ7A 1CTNA 2JFEX 1ZJBA 1G0CA 3ZM8A 1JZ6A 4QLJA 2FDMA 4RL3A 1PAMA 1W1PA 5EBAA 3AMKA 1U2YA 3WBAA 2CBVA 4KH2A 4IUGA 3AS0A 1EQPA 1UOKA 2DH3A 3T08A 1UD3A 1KTBA 1V6YA 4B9YA 2CYGA 1B9ZA 3U7VA 3BCFA 3VIKA 5BWFA 4P7OA 3WH7A 3AYSA 1HJQA 3PHAA 4DWSB 4BCEA 3WMSA 5BXRA 1Y7VA 3VDBA 1BAGA 1H11A 5FL0A 4P8XA 3T0BA 1VEMA 1AQHA 1O6IA 1EDGA 4HU8A 1XGZA 1EA9C 1UR1A 1GONA 5IDIA 3VO0A 3WUEA 4M80A 5I24A 1OT2A 4P8WA 4AZHA 4A4AA 3WF3A 1EDQA 1G01A 1AVAA 4HA4A 1OGSA 1UWRA 3N17A 1WZLA 3DYMA 1DHKA 4AXNA 1GHSA 4AISA 3D52A 2ZUWA 1WNOA 1U30A 3GBDA 4TVCA 1TVPA 2ZE0A 3AIQA 5I79A 1NQ6A 2VOTA 1UR0A 4TVDA 3ARYA 1OM0A 1G9HA 5C70A 2MANA 3VSVA 2PWFA 1E0XA 2VT0A 1TQUA 2ZUVA 2D1ZA 4PUDA 1NWTA 4PMVA 1D3CA 2YA2A 3BMWA 4PSRA 4AZCA 2E3ZA 2EBNA 2QLYA 1B3ZA 3PTQA 1GCYA 8A3HA 3GNOA 5BRPA 4XUYA 5ECUA 3RM4A 9CGTA 1JI2A 3ZT5A 2J47A 1BYCA 1UH3A 1GVIA 4W8LA 5A8PA 5CPQA 2ZX6A 3WL0A 5ABFA 1TA3A 3MUY1 1G5AA 5KEZA 2J7DA 5A8MA 4J3UA 5A6JA 1F4AA 2O9PA 3ARWA 1UD8A 1GOIA 3AQUA 4LYPA 5CLWA 3DX2A 2E9MA 1SZNA 5AY7A 1E6ZA 3GXFA 1ECEA 1IV8A 2VTFA 2CKSA 5DT5A 4UQCA 3GXNA 5BCAA 1K9TA 1KXVA 4GINA 3ARRA 3MO4A 4KGJA 1V3HA 4GI8A 3EMQA 2ZXDA 2OSWA 4DWSC 3CZGA 1J0IA 1E15A 4JL1A 2V38A 3K46A 4OZOA 3GXPA 1KXTA 3AIWA 3VDCA 4BQ3A 1FP8A 2B31A 3WD1A 3RIKA 3CHCA 2ZX7A 3EDEA 1R34A 4PMUA 5E9AA 3OGVA 3OZPA 4U5KA 3FN9A 4MTVA 1HIZA 4EE9A 2Z1KA 5A6SA 3DC0A 1HL8A 4B16A 3AOFA 1OWQA 1UR2A 3KLKA 2WMIA 4UOJA 2XGBA 3SCWA 3NCOA 4FLSA 1J12A 4W88A 4CD6A 3VGHA 3LRKA 1E1EA 4CU7A 4XB3A 2BVTA 4XZWA 3AMCA 1VJSA 5GNXA 3VIGA 4QLKA 2G3JA 3ZSTA 3TONA 1R85A 2XVLA 4LXFA 1BHGA 2VCCA 3EBVA 4D6IA 1GJUA 3BVTA 4CD8A 4JFSA 1B3YA 2W4XA 4R5EA 3UESA 4CGTA 4J3VA 5DMYA 1QBAA 4M56A 1VENA 1U33A 2ZICA 4R27A 4UQ9A 3W53A 3ZIZA 5JIWA 3TTYA 4Z2LA 4LGXA 5A3HA 2JE8A 1XD0A 3W38A 1Z32X 1V3IA 2VX6A 3PZTA 2VZUA 2X09A 3HMCA 1RP8A 4W93A 1J0HA 2EPOA 2WC3A 1E0VA 3AROA 4W5ZA 1R7AA 4AZ5A 5A69A 1R33A 2O9TA 4FNPA 3D3AA 3CTTA 4NRSA 3ZQ9A 3WQWA 4X0NA 5EB8A 5A2BA 1DTUA 1US3A 3VIJA 1E71M 2FH6A 3EJQA 3ARTA 4P8VA 3T2QA 5M03A 3S5YA 3AICA 3TV8A 2QF8A 3LRMA 2VL4A 5CG0A 2A3BA 2PF0A 1EOMA 1NP2A 4JHZA 2AMGA 2VZVA 3NUKA 1CXLA 3UCQA 1BGGA 2VCBA 3WN6A 2VX4A 4NRRA 3BAIA 3PZMA 2VURA 2WXDM 4ACYA 2QV4A 4KWUA 5DT7A 3SCNA 2ZUSA 1JZ5A 2XM1A 3GXDA 3WQVA 1J0KA 5BYWA 3MV11 3MV01 1CNVA 1TQWA 3OA5A 2VC9A 1I1XA 3WMCA 2PWGA 3VGGA 2XFFA 3ARXA 2CXGA 4KRTA 5I78A 1VBRA 2A3CA 4F8XA 4EKJA 4UTFA 2DEPA 4NXKA 5D9OA 4F9JA 5BXSA 4UOZA 3DX4A 3WY1A 4J7RA 2JF6A 2W5FA 1BFNA 4FLRA 1E73M 5AYBA 3EDDA 3ZT7A 2XG9A 3AMGA 4U2YA 1W9DM 1QW8A 4UQEA 3EDFA 6TAAA 1TUXA 1JYNA 1KXQA 2JIEA 3AJ7A 4GIAA 1UD2A 2YIHA 1D2KA 4KGLA 3GM8A 3OB8A 4S3JA 2WK2A 3T2PA 2C0HA 3EMZA 4HA1A 1C8QA 2JEQA 3N9KA 3EMCA 4M1RA 3RMEA 1BYBA 2NT1A 3VGBA 4TTUA 2D0GA 3U57A 3RDKA 2QMJA 1VEOA 3HG5A 1V03A 4CU8A 3RJYA 1LQ0A 3VD7A 3AXHA 1C91A 1XHGA 3AISA 3LPPA 2WLZA 3DHUA 2W66A 3CZLA 3UETA 3MMDA 1E56A 3TTSA 2J78A 2J79A 1EHNA 4AD5A 4CUCA 1JZ2A 1V08A 1HN1A 1R86A 2WHKA 1XRVA 2VVSA 1JZ8A 2J7GA 4UZUA 2ZOXA 1WO2A 3HJEA 1FH8A 4AZ7A 1QNOA 2XN0A 5A6BD 3B9AA 4QCFA 4UFMA 4XV0A 3W27A 2F7RA 2XWDA 1OGBA 3A23A 4CN1A 1G94A 1C93A 2GK1A 3A4WA 4B3KA 1KCLA 2VZTA 2CBJA 2OYMA 1NOUA 2WLYA 4LX4A 3A21A 3DX0A 3BLBA 2Y5EA 5HDRA 1B2YA 1OCQA 4BQ2A 2V3DA 3KZSA 5IFTA 5LA2A 3BGAA 1TQSA 3LRLA 4P7NA 4UFKA 2VI0A 4PRWA 1M7XA 1TA3B 3FAXA 2WWDA 4D6DA 4FNTA 2GSJA 3AXXA 2DH2A 3KLLA 5GQBA 1BYAA 1MW0A 4JKLA 4PUEA 1JDCA 1PIFA 5JIPA 2WMKA 2BXYA 3VMNA 2OSYA 1VBUA 2QHAA 2DIJA 2O92A 4NF7A 4K68A 4ZXOA 1IT0A 2XTKA 4P7QA 3PZ9A 1V0LA 1QNPA 2CPUA 2VRQA 1KQYA 2XN2A 4PTMA 3OLDA 1W9PA 1EDTA 1EIBA 1GOOA 3K4AA 3KE0A 4OOZA 2W92A 1E4NA 1G1YA 1W1VA 4PYSA 1AMYA 5AC4A 2WVVA 1FHLA 4D71A 4MNMA 1ZBKA 2GFTA 4BQ4A 4ACZA 4UR9A 5ABEA 3S5ZA 5I3DA 4PMDA 1R8LA 3I3EA 2CHNA 4M29A 1C8YA 2BHZA 4HZ7A 4CVWA 4DUVA 1JFHA 1NWUA 4H41A 1ZS2A 2J74A 3SCUA 3GXIA 1WZAA 3WFLA 5LYRA 1E4MM 2DT3A 4MB4A 2J25A 4V27A 4DO5A 1BG9A 3U7BA 2AAAA 1JL8A 3POHA 1I1WA 1HXJA 4NSBA 4D6CA 1XSKA 3EJSA 1C7TA 5HPCA 2EPMX 4OGZA 2Z1SA 4J3TA 1DWHM 3VMPA 3VGEA 1W2PA 3GYCA 4ACZB 1UH4A 2X8RA 4J3XA 5IFPA 2QPUA 3SUVA 2XJ7A 1VJZA 3MSDA 4ATLA 1EXPA 3ZO9A 4Z2JA 1VFOA 4EAMA 2BY1A 1OIMA 3VIOA 3WY4A 5CJ5A 2XUCA 3VGFA 3OZOA 3GNRA 1R47A 2ZXAA 2OYKA 3WQ6A 2CHOA 2DGAA 2D3NA 1EOKA 3WD3A 1JZ7A 2GJPA 1CECA 1JNDA 3RCNA 1CPUA 2WNWA 4PMXA 1OB0A 1KBKA 2XVPA 3WKZA 3LX9A 3BMVA 4QLLA 2CITA 4AZCB 3FHAA 1XSIA 4OJYA 1FA2A 5I5RA 1MYRA 3ARSA 3BUQA 2OSXA 2J7EA 3SCVA 3KL3A 3BUPA 3WD2A 1C7SA 2O9RA 5A8QA 3VIFA 5CPTA 4QAWA 3LMYA 3W0KA 1LL7A 3CZEA 3AIRA 3IANA 1HF6A 7TAAA 1E3ZA 3G6LA 1J0ZA 1IZKA 5E0CA 1Q6DA 1Q6EA 3OGSA 1ISXA 1WDPA 1JNEA 2IUZA 1HP4A 3OLEA 2WBGA 2WMGA 1RPKA 3BLPX 4LQ1A 1GVYA 5CGMA 2GJRA 4HMCA 4LPCA 4JIEA 5E70A 2EJ1A 1UKQA 1Q6GA 4HZ6A 5BXPA 1N82A 1UWSA 5A6MA 3D51A 4AIEA 2YFNA 3CHEA 4UNIA 1OINA 3VDAA 2YLAA 4H04A 2RGMA 2DIEA 3SCQA 3GTNA 3H55A 1JYWA 2XVKA 1MFUA 4C7GA 1X6NA 3GNPA 3VIHA 2CETA 4B15A 2VNCA 3CPUA 1R75A 3AHXA 2D73A 4MAZA 1WPCA 2VX5A 3WENA 1XD1A 2UWFA 3PZOA 2WCSA 1GPFA 1H41A 1E6RA 2VR5A 4W87A 5HBFA 1LWHA 1RD6A 1J10A 1QNRA 3EDKA 1WZKA 1LJYA 2CIPA 3F4VA 6A3HA 5I77A 1QWUA 3O6AA 3NDYA 3AS1A 1KGXA 3BCDA 4M82A 3PBGA 2V5DA 1NARA 4PMZA 2BHUA 1KR1A 2WC7A 4MNLA 4QFUA 4UFLA 1EO5A 2ZX8A 2W63A 3BVXA 2D0HA 3DX1A 5A1AA 5JBDA 1QI5A 5CSYA 1E6SM 3ZMRA 4W8BA 3W25A 2Q8XA 1UYQA 4B3LA 1MWOA 1FFRA 1CZ1A 1K9DA 4RE4A 3L4TA 5BROA 4M81A 1UQZA 1QWNA 2NSXA 4Q7NA 4D6GA 3WQ4A 1EH9A 3GH4A 4URIA 1B0IA 1NH6A 5E1QA 2FGLA 3AXIA 3NSNA 3SURA 1WE5A 2ZWYA 1GZJA 2ZWZA 1JG9A 3CGTA 3CV5A 4HZ8A 4DWSD 2WZHA 4MPKA 1OGGA 3CLWA 1MQQA 1FP9A 1M03A 3AIBA 3MANA 5D9NA 4BA0A 2PC8A 4AYSA 2PWEA 3DDFA 1XH0A 2YKKA 1HJUA 3IAPA 4U31A 1NWRA 4P8UA 3AS2A 3WDIA 1C8XA 3EJUA 4PN2A 1ODUA 1H49A 1HJWA 4P7RA 3VVGA 2NT0A 1M53A 3AI0A 5CLTA 1A47A 1W1TA 3L4ZA 4D6FA 3VD3A 4HMDA 3VIPA 2FYVA 3SUUA 1ISZA 2C7FA 4UQBA 2G4FA 5EFDA 1ZBCA 2J77A 4H8HA 1A3HA 1JAKA 2XFYA 1UWIA 5FCZA 4GKLA 4TXEA 1TQVA 3WDQA 3AZSA 3WNOA 4KRUA 4GQQA 1FHDA 1VIWA 4A3HA 1KGUA 3EJRA 4MB1A 4OKDA 1GOQA 2CEQA 4D1IA 2BY0A 1KFWA 3CUJA 1CXEA 1UKTA 2OLHA 3N04A 1H0IA 3DDGA 3GXMA 5CXPA 3WDRA 2BXZA 4CKQA 1OIFA 3ZSSA 4MDPA 4FLOA 4HPGA 3KWXA 1WB0A 4HTYA 1CGVA 3TTQA 3ARQA 2GJXA 3PZQA 1W9UA 1WDQA 4AWEA 4DUXA 2WYSA 1W91A 2BY2A 5I6SA 5IXEA 2WKLA 1HTYA 1H5VA 4RE3A 4DM2A 1CDGA 4XX6A 3TA9A 4IPNB 1UWQA 4JKKA 2BY3A 4NZCA 2WCAA 4UQAA 4EK7A 1WZMA 4OIFA 5E6ZA 5I0DA 4DM1A 2FH8A 3WNNA 1ISWA 3ZJ8A 1ZL1A 2WHLA 2E40A 1TQTA 2XPKA 3CMJA 2XSBA 3DYPA 2E9LA 5HXMA 1XH1A 2XM2A 4UFHA 4TTGA 2VX7A 1QI2A 4AD1A 5BXTA 2J8GA 2D3LA 3AHVA 5DEZA 4L4OA 4BQ5A 2PWDA 4F79A 4J28A 3GDBA 2IXVA 3WQ5A 3BVVA 1MFVA 1ZU8A 1V02A 2BS9A 3CZKA 3VX0A 3N12A 1VFMA 1GOWA 1XCWA 2OYLA 4B9ZA 4PMYA 3F5LA 4CU6A 3L2LA 4JFTA 1V0NA 1JYXA 1VAHA 2J75A 2Y2WA 4JCMA 3K8MA 2BV9A 3WDHA 1X6LA 4JZ5A 4GI6A 1HKKA 1V0MA 3WSUA 2IXUA 3WFZA 3CBWA 3NSXA 3SCRA 3RPMA 2WMHA 4JHOA 3RJXA 4AD3A 3AFBA 4BZYA 1UH2A 3M7SA 1KB3A 2ZUMA 1CBGA 1RP9A 5A2CA 4F9DA 1FH9A 5ABFB 4ZFMA 3N1AA 3S2CA 3GZAA 4V2XA 4E2OA 3BUIA 3N11A 1V3JA 2EQDA 1E6NA 3CC1A 3MS8A 2G3IA 4AMWA 2PBOA 4GZEA 3WQ8A 2PB1A 4AEFA 3AHYA 1DWIM 1E5JA 4GZIA 1PIGA 4XZBA 3L4XA 4MDOA 1CGTA 2GDUA 3ECQA 4NZJA 2YLLA 4AZBA 2FHFA 4ATDA 1PS3A 1BF2A 4D1JA 2J4GA 4MAVA 1CLXA 3PZUA 3L4UA 1GHRA 1RH9A 4QCEA 4CVUA 4WKHA 3CZ8A 3OIHA 1D7FA 5BRQA 4TX8A 1V3KA 1LLOA 3A6OA 1BYDA 1LF1A 1J0JA 4UCFA 1GOKA 2XN1A 3PZNA 3QOMA 2X2IA 3HN3A 4D72A 2G8ZA 3WF2A 2WWCA 1HXKA 3JUGA 2YDSA 1PPIA 3THCA 2VJXA 2WW5A 3QGVA 1UKSA 4PEEA 1KCKA 2XVNA 1H0GA 4WKFA 4CD4A 3ALGA 2QMKA 1SFSA 1L0PA 4AD0A 2EAEA 4Z2KA 1PX3A 3BAWA 4AD4A 1TCMA 3A24A 1CGWA 4Z2GA 2OWXA 2EABA 3NYDA 4AMCA 1MXDA 4FMVA 5M17A 1BVZA 4FF5A 1UD4A 4U3CA 3CH9A 4UOQA 3H54A 1HL9A 3WNMA 1C92A 1QNQA 4PCSA 3ARZA 3L2MA 1Q4NX 1IZJA 3CHDA 2O9OA 2WBKA 1H4PA 2CBUA 3BVUA 1DWFM 4AC1X 2OWWA 1CGXA 2ZUUA 1K6AA 3WY3A 1C90A 3VIMA 2W62A 3BAXA 1SMAA 1E70M 5A94A 4PMQA 3N13A 2A3AA 4IISA 1XSJA 3BAYA 3VU2A 2FHCA 1UR8A 4W5UA 1M01A 1B1YA 1CYGA 1KTCA 2F7QA 1LL4A 3DYOA 4AZIA 3D50A 3OBAA 3WD4A 1PX8A 1JYVA 3RO8A 1DEDA 3N15A 1QI3A 2X0HA 3ZJ6A 4EANA 3UG5A 4H8VA 3K8LA 1ISYA 1TZ7A 4PSPA 4J3WA 3VD4A 4YHGA 4AEEA 1ISVA 1J9YA 2XYLA 4WLCA 5CQ1A 4M24A 1HKMA 1NOWA 3RILA 2V3FA 1TG7A 5LA1A 3AHZA 1CWYA 1QVBA 3FY1A 3TP4A 4AD2A 2X2YA 3PTMA 5FL1A 4UFJA 4NZFA 3A4XA 1OD0A 5EMYA 3W6MA 1XCXA 1W32A 2X2JA 3K8KA 5TD4A 3SUWA 2G41A 1W9VA 2ZIDA 3F5JA 4H7VA 2D2OA 5ABGA 4LYQA 1ZJAA 3BAJA 3WELA 3W37A 1C3FA 2X0YA 4DO6A 1E4LA 4TX6A 1US2A 1GQKA 2WM0A 4H2CA 2VMFA 5A6AA 3KEHA 4CD7A 2PI6A 1V02E 4E8DA 1VEPA 1EGZA 3SIMA 2UY5A 3AIUA 4FNQA 3UG3A 4HOXA 4Y7EA 5HNNA 1NOFA 4GQRA 2J7HA 4WJXA 2UY4A 3AZTA 4HP5A 2RGLA 2XIBA 3ARPA 4FNRA 3QR3A
chains in the Genus database with same CATH superfamily
2WYHA 3JV4A 2G75B 4QXUL 2AQWA 2VDKH 1OTUC 3GO2A 4JKMA 2VL5A 4BSJA 3GMQA 4PJGE 4PJBB 4DH2A 5AD0B 1U93B 1T99A 3G04A 2OTDA 1NFGA 1ZPLA 2YLKA 3UF9A 1G7MB 4KQ4H 4ZB5A 1MEXH 3O2WH 5CSZA 5GPRA 3MLWH 1TU2B 4XBGB 4OCYL 1KLGB 2DT2A 4UQ2B 5FR3A 1ZBVA 2I57A 4IPLA 2YDRA 4Q9QL 4PV9A 1GZ1A 2YB1A 3CZNA 1HUVA 5IG7B 1T5WA 4MA8H 3DAQA 5IMLA 2CLEA 2YL8A 1R7OA 3S2MA 3O6KL 2EDKA 3HA0A 3MBEA 5EC2A 4UNVA 3K71A 2HE8A 1QDSA 3EH2A 4ZI8A 3F7VB 4Z0SA 1FI8C 4MZIA 5CUSH 2NUTA 1LE9A 3RJOA 1UR9A 1S5IH 1VHPA 2UV3A 3NMEA 1OWRM 3M9YA 3W28A 3W81A 1T6WA 4UT6L 5CCKL 5REQA 2NQCA 4EI5C 2PODA 1M1XA 3V6OC 3VXSA 3C2FA 5E2JA 2WD0A 4WKZB 3KW7A 3MUZ1 4ZQRA 4LAQL 5DO8A 4D0DB 3B9DA 3FZUC 2E4TA 3L3IA 4I3GA 5PAZA 1KMGA 1BRLB 5J13B 2ZA2A 4OUEA 5I03A 3ZXWA 3N19B 4RR4A 5F1OB 3BIKA 1G9NL 1RJLA 3EF7A 3LG3A 3GW0A 5F88A 1ACXA 3O3EB 3CCHA 4HIIB 1TRIA 2YBUA 1QWHA 2EDHA 4PU2A 4GY0A 2X6BA 4JFDB 3PUEA 1RJZA 1DQUA 1ZLUH 1ZJIA 1JUBA 1KZYA 3PJLA 4TM9A 3ARBD 3QG6A 3S48A 1ITUA 2Y7FA 3INOA 3FIGA 3F84A 1BQGA 4GKZB 3WUBA 4FP8H 2A1WL 8FABA 1R3VA 3VNJA 3QNYA 4XZHA 1OHQA 2DQIL 3LKRA 4NNYA 3QTPA 4PJ7A 1BFOA 5C09E 5G2IA 5A6BA 2BVQA 4G8GB 3CPGA 3O3BA 3GSRA 3TSDA 4P7LA 3HE7D 3C09C 4I7VA 3ZU8A 3Q5YA 1E1CA 4WZ9A 4O1EA 1TQCB 1AQMA 2MKWA 5ILTH 2VO8A 2WVSA 2ZXQA 4KVCL 3ZE1E 3HE7A 1PKQB 2X2HA 1GCFA 3X11A 2FGBA 2DOCA 2D3JA 4M61B 1EJVC 1Z9NA 2EPNA 2AAMA 4TQTA 4QRNA 3TEVA 5EC1A 1SBBA 5DLCA 4CQCA 3CDYA 1NBCA 4JGJA 5IF0A 1K5WA 2JSFA 2NY4C 5HDQL 1OSEA 2NY6D 1FFPB 3EOTH 3IK2A 4XBMA 1KZQA 2E9BA 1C8PA 2P76A 3I7QA 4NWTH 3PGFL 3ABZA 1JZHA 3BWSA 3Q5OA 1QOXA 1AQ0A 1DBBL 3QPKA 1QEWA 2A21A 2VR6A 3KXFA 1K3IA 5LN8A 3G24A 1IXOA 4FYTA 5H8UA 4QT5B 1T7XA 2J12B 3PHQA 2PGEA 5GS2H 2VC2B 1YTDA 5FECB 4MBRA 2ZA3A 3M43A 5DD5L 2VXTL 1TIUA 2W9EH 4FJYA 1T4KB 2DQCL 3RTQB 4MMWA 4OHQA 2VM9A 5D02A 1P7KA 3JWDH 3ZL2A 4M48L 4YR6A 1G69A 2FDSA 3KCPA 5JQ6H 1C5DA 1U92A 2FQIA 3TYGL 2OW6A 2ZXWB 2FZBA 2R0KH 4Y9MA 1J11A 1MFCL 3UIYA 5CSUA 1WKYA 3NN8A 3X13A 2EUXA 1Q63A 5BZXA 5TE7L 2JEPA 2FQEA 2BCKB 4JPIB 5GGRB 2KC0A 3SDXF 3BRDA 2WMIB 3NL6A 5HJBA 3UZZA 1EFXD 1FH5L 3W7IA 3UCRA 1JGEB 2Z8RA 2ZX5A 3W2JA 4PJHF 2XWBA 1H3GA 3PPEA 5FGBA 1E6PA 3B06A 4JW3A 1IYXA 3I02B 4L4TB 1Q7ZA 1AFVH 5C2UB 1UJQA 1JOIA 3QDMA 1T40A 4YSAA 3HU7A 2OMYA 4DGIH 3E2SA 5IB2B 5F0JB 4YHOL 3WLSA 2J43A 3FSZA 1GVSA 1QTWA 4WJ5A 1FF5A 1E4WL 3PPCA 2JQXA 4OLVL 5I0ZA 4F7EB 4KRMB 3WOVA 3E2VA 2ZOOA 3DFHA 4UM9B 5CMAB 4D94A 3HVDA 3PIQA 3HGJA 1TJRA 2VEMA 4H0GA 1I0DA 1ZOXA 3NZQA 1T2XA 4B5ZA 4Y4FC 3QEUB 3QPYA 3EOSA 1SOSA 1J1PH 3O4OC 5D2VA 2VMDA 3WKYA 1DVFB 1M42A 3ULUF 4L3EB 4N6FA 4HN8A 3GNNA 5JUEH 4D9LL 2CRIA 2LLGA 1BAFL 2DQUL 3VB9A 3LQZA 4WHTB 3VTMA 1CD9B 2OFJA 5JXQA 2JTYA 1Z5LB 1B0GA 4L3FA 1OF2A 5ISZE 1QBML 4JUSA 2WSDA 1FSKB 1T22B 2XYBA 2QQKL 1SHSA 3QSRA 4C6BA 1YYAA 4WW1A 3VFLA 2MTPA 3PWPA 3L3KB 4YZFE 1THCA 4PUBH 4FF7A 3U9UB 3HNSH 4F5CE 1BVWA 3LV5A 4RSVA 3FA4A 1FVCA 2B9AA 1H50A 1PCWA 3NTCL 4QOKE 2CGYA 2YA0A 5EO1B 1H09A 3QW3A 4XN9A 4K7VA 3A47A 3L5WA 1FZKA 2VR4A 3HG2A 4I0KA 1ZLVK 3S3DB 1OAKL 1PKLA 2IKJA 1CGUA 3S37L 2QPXA 3IAQA 3MKVA 2VKZG 4HHPA 4Y9PA 3OLGA 3BVWA 4Z18A 3VC5A 1TF4A 2XKUA 5D4YA 5HJDA 2VFDA 4AYID 1SW0A 1NQKA 3QV8A 3WFEL 1FXQA 4M03A 3S36L 3T6ZA 2BVYA 4Z95L 2PDWA 3AQZA 2Z92B 4HIJA 1G9MC 1OCJA 3NABH 3QUYC 4JRYA 4MB5A 2YXWA 1PX4A 4FZIA 2WQAA 1WFJA 4NNYB 1R5WB 4NO0A 2A3EA 1IEAB 3ARVA 3O6ML 3IPWA 3O6DA 2OBGA 4P2VA 3QEHB 2VR9A 1O7SA 3SBPA 3V4BA 2BFGA 2H26A 2WWMC 2F7OA 1ZTVA 1E5NA 4W7WA 4Y9NA 5DUML 3WH8A 1BIIB 3FQ1A 2J6XA 1CT8B 2AJVH 4X8JB 4YLWA 4ODSL 5C0IB 5E6UB 3T3PB 1PKQA 3D3FA 5AYUL 3M7OA 4WV1C 3HOGA 1TV4A 3DX5A 3NCYS 3BGGA 4QP0A 5IHSA 3QKEA 4L8CA 3VFUB 2CDGA 4Y5VA 3PCYA 2Z26A 3GG1A 4PFEA 1AGDB 2BH0A 3ANYA 4AXWB 2EADA 4GW1A 4I0PC 4PLJD 3EYPA 3GH5A 3NJNA 3WJWA 3SPGA 4E8CA 3UZEC 5TGBA 3X14B 3MSGA 2HWGA 5K9QG 3MRRA 1XV8A 1A4KA 4XVSL 2DWEB 5K59E 2KUTA 3UCDA 1O6TA 4U1SA 1XR8A 2RH9A 4PV8A 3CUPB 1BQRA 5I6OA 1RK5A 4GI9A 1TVNA 4TVPE 2Q7YA 4YPGA 1E9PB 5AB3A 4YGAB 4GO9A 12E8H 1JGVL 2NNRA 1PSKH 2C3HA 3K13A 1FFQA 2XU9A 1GVRA 5JOPE 3TIDB 4R7OA 1DVXA 4UTTA 3QHMA 4PJDF 4AIUA 4A05A 4H0HB 4LWWA 3NJXA 3DGCR 4KK9D 3B7YA 1G7VA 2HCVA 3VKBA 1P0KA 4H1ZA 2YUWA 1MQRA 4CEXC 4KX7A 3VXUB 1S7WB 1MKFA 3F7YB 3GMRA 4BK5C 5HI3C 3ZTNL 3EWCA 3VZZA 2VC2L 5H2ZA 5KS9B 1F8TL 4XZIA 5GHWL 5KANG 3MMUA 4FA6A 1MFDL 1DFBL 3WS6C 4KXZI 4BZ2A 5EEXA 5GSVB 1T8XA 3F5WA 2Q9OA 4TO8A 4DETA 1ZVSB 4UZGA 3R4IA 3WXWL 2P3EA 2CHWA 4UTWA 2FJFB 1D5XA 4ANUA 1W3LA 4W9LC 5D9MA 1FAIH 3MRQB 4WU5B 4XAKE 2IXQA 1XH3A 4AYFA 2Y5TB 4PGDA 4H20L 3LXAA 4Z1PA 3W0WD 2OELA 4NASA 4FP8L 5G4HC 5HPOA 4M6OH 2W1NA 5HQEA 3ZR5A 2QEJA 3I50H 3NJ3A 1BXXA 5E5MA 2P3YA 3WE1A 4F9LA 1CXHA 1RLCL 1AXIB 2ALAA 5I3IA 5EIIG 3AB0C 3FCGA 4TVUA 1P4IL 4FQ2H 4IFKB 1P9MA 3ML9A 3TF7C 2NY5H 4OGXL 5EIIB 3RVWC 5ITBL 3NGJA 3OVPA 3VIIA 5I3GA 3ZE2E 5MENA 2UYLB 4M6VA 1TREA 3QUHA 5C0DA 1FVEA 2CMRL 4IMLB 3ZE2F 2WWNA 3SEPA 1EAOA 1I75A 5LAXB 3FB6B 1J8HE 4ZXLA 4QTHB 4CVZA 1SXBA 4GFIA 1O0VA 1JDAA 5E6IB 1THFD 4PE8A 3S4SB 3MLVH 4JFQA 2VLJD 3NSYA 3P77B 4QHLA 5GS0D 3HNSL 3NJKA 4NQCE 4OIIH 3GMPB 1BA9A 2WO5A 4OZFG 3HS0B 2LLLA 3FHQA 5DYOA 5HJ3B 1G7IB 4NYLA 2Y63A 3WJLA 3V6OA 1TE1A 2VDNL 4UT9L 1OD8A 2ADGA 4TV3A 1E6XM 1A14L 1X44A 5KG9B 3PB2A 2FZDA 2FKPA 4ZT1A 4ORMA 3ML8A 3C5ZA 3L5WB 1XGPB 4Z2IA 2WQPA 2QR0B 1BPLB 3UTTD 2NW2B 5A6LA 2DQDL 4PJ5A 2TRYA 4LSSH 5HDBE 4QS5A 4C6DA 1EHAA 3VG9C 4DYEA 1NC4A 3B04A 2CA4A 4YSOA 4ZMVA 4XOCA 2WXIA 5EF1A 2B3IA 4F9DA 1WBHA 3GGWA 4E0RA 5FHAH 3NABL 1VFBA 4X0KA 1TETL 3WIHH 5F7UA 4NO0B 2IQAA 2HJKA 3TIEB 4MKNA 4KY2A 1PIIA 4G80A 1PZ1A 2BLEA 1EERB 5DZ9A 4JICA 4OVUA 2FB4L 3P3UA 6CGTA 5LXVA 3LPGA 4OOUA 2WSPA 2EPLX 2CKBA 4MFEA 5CM1A 4O1FA 1PWMA 3NSMA 4Z0JA 3BOFA 1JFQH 2MNRA 3DKJA 2IDSA 4LL9A 3L5HA 3KRBA 2F74A 3W2DH 3C87A 1LP6A 2VW7A 5F1IB 4U28A 4X50A 5IOBA 4UM9D 4NO3A 4Z78B 1KWKA 4I3RH 3CXHK 1RUPH 2E68A 2OZ0A 4YDJB 4D9PA 5LGHH 1QPXA 1KIPA 2VDQL 4Q33A 2GK1B 1YNPA 3OAZK 3TEZA 3SCOA 4HISA 5I8KH 1RUAH 5EORL 4ESKA 3WHE0 2R0WL 1UA6H 1SY6L 4FDWA 1NBYB 5A2LH 1H7PA 3FT4A 1MCRA 4HPNA 2I07B 1XINA 3GO1H 2BIMA 3ZKXB 1TPUA 3KNBB 1YEGL 5DK3A 5INCB 4ZMZA 5IHWA 2ODOA 2IPKB 1P9MC 4NQXA 2BPBA 1FZMB 4Z0BH 2BSLA 2DQWA 1KG0B 3THQA 3VWKB 3UR7A 5CAKA 5EN3A 5I3HA 4L8DB 5DZLA 4Y4HB 3WS3A 5J04A 3EGSA 5CGTA 2HRHA 3ITLA 1SEQL 1JK9B 3IM1A 3LD8C 4YXKL 4BQ9A 3AZRA 1S7VB 2GG1A 3GS7A 3MA7A 5F1VA 3SJVA 3OHXA 4CC0A 2C79A 2F7IA 4GNJA 2EIBA 4KEZA 4LHJB 2IC2A 2GC7C 1JF1A 2JALA 7TIMA 2XIJA 5FX3A 5CIPH 1VGKB 5FOOA 5E00B 5MERA 1WAAF 4P46B 4CN6A 2O6DA 3L0KA 3GMRB 2EPKX 3QJZA 3OZ9H 5B1JC 2WLKA 4M7JH 1XP3A 1OZUA 1XR2A 3KPRB 4JPSA 5DN1A 3MU7A 4XPTH 4FL4C 3QFEA 1TPVA 2H9AA 2WO2B 3GIZH 2Y70A 2P48B 3KBVA 1AHWB 3ME3A 3F58H 2ZSVB 2FJFA 1UB5B 4FFYL 4HMEA 4NP7A 4PCTA 1YNYA 1CXKA 3SPIA 3UG4A 3HG1A 1GOMA 3GZ3A 2Y23A 1DN2A 3IWUA 2J44A 3TOPA 4ETQA 1YBQA 3UCCA 3WDPP 2Z31D 4JGMA 4BUGA 4KIRA 4XZ9A 2GCYB 5CGYD 1OTSC 3D85D 5T5NF 1QRNB 4AV5A 3GSWA 5BMFH 3HG4A 1M7IB 1KWGA 2UVFA 1CB7B 2A6LA 3LGGA 3STLA 1SR0A 1UW9A 4TVPH 3UZQB 2E9WA 3RIAK 4FQCL 1DJNA 1M04A 3D05A 3PWPD 1VKXA 4Y1TA 3MCMA 5HWJA 4MXQD 1WDSA 2VRJA 1BFSA 4HJ0C 3LQGA 1BD2A 4AC2A 4UFIA 4JN7A 3IBOA 4FNUA 4U1NB 5AW8B 4HQQH 2QUNA 4RSYA 3OAYH 1VESA 2UYLA 2W0FA 2Y7LA 3N9SA 4DF9A 3N4AA 3BQUC 3S5LB 5BS0D 1ZSXA 3DHFA 1SOXA 5DDHA 5KSBF 1MRDH 3BQUD 4K5LA 2F6XA 4X5QA 5CAYB 1UUQA 3QIBB 1GUVA 4E0CA 4QHMB 5FA4B 1FWCC 3RAJL 4Q4IA 5K9JH 2XIDA 5BUPA 4LYRA 4DUWA 3GEWB 3K81A 4JHAL 1H1NA 4Z1YA 3LJ3A 4YVVA 4FQLL 1H3XA 1PYMA 2X6CA 2WCPA 3WFHB 5HYQA 3MUUA 4N0UB 4Y1AD 3OG3A 2P7TB 1MSSA 2RJMA 4ZPTA 3RWJB 3A4EA 3LKNB 4AYMC 4X9SA 2DRUA 4FTVB 1K6QL 5BUAA 1W3HA 3MC0A 2YCJA 3QYQA 2J8UB 1H60A 3DSNA 3VKAA 3E1ZA 1IBDA 3HHSA 1H0DB 3MLVL 5HTSA 4X6FB 4PBEA 1NSNH 4YCPA 2DQ6A 4L9ZA 5JH2A 3CIAA 3EWXA 4ODVH 3HR5A 3S96B 3FTGB 2SEBA 3OU8A 2VXQH 2OXHB 3QRGH 3M0LA 5TE4H 4WFFD 4KF1A 3D4ZA 5I19H 5T5FH 1HYSD 3F5KA 3S6TA 1OW0A 2CXKA 1OCWH 4ZE4A 1CFBA 1NDGA 1EDHA 2XOTA 4IS6B 2B77A 4L8BA 2MOGA 5IBUB 3CX5K 3U7AA 1CENA 1RCQA 2AK1H 2FMNA 4OBTA 4DK3A 2XZAL 1VHNA 4V2CB 2VWSA 1RPQA 4B2DD 4X0VA 2WP3T 3BEWA 2HVMA 2P3ZA 1TITA 4MNQB 5L2KD 4HPYL 5C07D 1GWJA 3SGEI 4KTDH 4W9DC 2Z9TA 2YL6A 3P8JA 5BOFA 4EJ1C 4X8XA 3N5AA 4CBZA 1CURA 5ERWA 4YHZH 1D3GA 2NYYC 3MLRH 1N6VA 2Z91A 3BVNA 3O4LB 1IGWA 4A35A 3Q0HA 1YHPA 2BZCA 3T6VA 3ES8A 3KZPA 4PUJA 4WI3A 3LXUX 4UTBL 5EV7A 1WZ1H 5K93A 3A3YB 3V0HA 2CO7A 4Y19A 4K7PX 4PTXA 4AX3A 1MCPH 4Z7OE 3QPZA 4RZBA 1ZE3C 3T4WA 3DGBA 2CLHA 1FA4A 4JYEA 3MZGB 3O45B 5DJ6B 2PWVA 3LCHA 2P5EE 2NW0A 1VCBC 4WNQB 4EUPA 2WWKO 3WUFA 4TQIA 3O9NA 3TJLA 4DAIA 4EXKA 2NXYD 2E8YA 1EP2A 2YGNA 1N2RB 2DUXA 3H7BA 3VXSE 3RGTA 1XBVA 1NCAH 1WA0X 4NQTA 3QV6A 2BGQA 4Z76A 4LQFH 4NZ1A 4M7JL 4RIRA 3V79C 1IQDB 3K6OA 5B8CA 1B3VA 1EVUA 1TFVA 2WB5A 4HJUA 3LNPA 4AZ6A 2OI9C 3B97A 3PZVA 1V6WA 1FNAA 1U8NB 3LU2A 3ZHDA 3G04B 4PRPE 3WLBA 1X5XA 3FXGA 4KNTA 5ESQA 1FGNH 1RK6A 3EWUA 3RX4A 4M1DH 5F6HI 1XZWA 1ECYA 2B4CH 2ROYA 1PTAA 3QXBA 5CO1A 5F4SA 5AYYA 1KBVA 3SQMA 2XQYG 3IBEA 3QWNA 4MASA 2B1AL 4LCWE 1A5MC 1MDRA 1IVLA 3JV6A 1I82A 4NLAA 2KLTA 3WD5H 4WSJA 4Y2NA 3FQUA 4FKHA 2UZ9A 2DEWX 1TWZA 4QOKD 1IGTA 1DE4A 3FQNB 1P6WA 1ZQ5A 1FLTX 5I0YA 5D7HA 2ITDB 1XGUA 4PJ7F 1DP0A 1Q9OA 2VDKB 1HKWA 3FONA 5FYJL 4LOEA 2EGZA 3COTA 1MFEH 1QAWA 2R39A 1JXGA 3MRCB 3ERPA 4N0FA 2ZOLB 3LZPA 3MKGA 4GEJA 3QUZC 1KYAA 3F7KA 1A22B 3OLIA 5D1XA 1FH5H 5REQB 1NGZA 4JG9A 2FZ3A 1IT7A 3APGA 4JX0A 3QVQA 5K9DA 4UTBA 2R23A 3L1FA 3WE6B 2WNQA 7A3HA 4P2CG 1XBRA 3PABA 2E27L 2UY2A 3N41F 1O5DT 4AWSA 1LLWA 4UAHA 5K33A 1J6OA 1NAL1 4GS7C 4O8AA 2YL5A 4P23D 5IGXH 3H1ZA 3QEGL 4I9JA 4P3DA 2EDFA 3TW9A 2APXA 3VE7A 2E7HA 4UTAL 3NCCB 4W9JC 1ZK9A 4AEHL 1PS9A 2WKGA 1V7AA 1VP5A 3C0LA 3IETA 4KFOA 2PDIA 2WINA 4P5UA 1W3KA 3MSYA 3EO9H 4OAWA 3QZ6A 3NQEA 3WO8A 2VOMA 3N44B 2K78A 1JXJA 3AMLA 2F2KA 3W1QA 3GUTB 2EVGA 4WENB 1MVUA 2X6MA 2HFEB 1AIFA 4I89A 4ZJ9A 4Y7OC 2CO6A 4XMTA 3AU6A 3D09A 1DCEA 2VQ4A 4L1HA 4H8NA 1MCLA 5JHDB 3KYAA 4X6CF 4UB0L 3O3BB 1AMKA 5AC5A 2FZ9A 1SXAA 4N0YH 2FEEL 3AVEA 2XGIA 2BVPA 1JI1A 3FAWA 3U7YH 4R83A 4C47A 4GIEA 2BOCA 4Q6YA 2VO5A 2FFCA 4K71C 3OO2A 1RMFL 5C6PB 2P8CA 3B40A 1UD6A 1W6LA 2W0UA 3ARDD 3C5SA 1OC6A 1P0EA 1WWAX 5J7CC 2QDGA 1BYPA 4TQ8A 4K94L 4FK9A 1KYUA 6TIMA 4JTEA 4DAFA 2DV6A 3F7VA 1RK0A 1DVTA 4A37A 1P0NA 1A3RL 5DJ8B 1WDWA 3LIUA 2OQLA 4JFYA 2EDTA 1MW3A 1ZWIA 2ARJQ 3FQXA 4JNZA 3L48A 3WH6A 4K7PL 2W95A 2ANUA 1NDGB 4LVOC 3WJZA 4MAUL 3K5XA 4K38A 1Q6LA 2YGPA 3FU6A 2UX6A 3R1GH 3QXWA 1PZDA 1MXGA 3ZYJA 4PRAA 2GK2A 4WWKD 5EU4A 4LLMA 2NYKA 1ALDA 1MCOL 2CKRA 2D23A 2PD5A 3TYAA 3V35A 3WH9A 1OL0A 1G0XA 3D34A 2AXFB 4KTDL 4ZS7L 4Z3GA 2V30A 4DQOH 4HIIA 4NZ8A 1LDPH 2FIKA 3QO1A 4UTAA 4UMCA 3ULVF 3UVIA 2FQGA 3WLHA 2TSAA 1W72A 2FBJH 3O9WC 1CXFA 1DIKA 2B15A 4FQCH 5I8OH 3VNZA 1N70A 3LCXA 3T77A 3BUDA 2OZ4H 3TCSA 1TT6A 4KTYA 3CN3A 1YDYA 2WNNA 5A8NA 1P6FA 2XQBL 5GGSY 3URBA 1ONQB 3WY2A 2WHJA 3D4YA 2EEXA 3MO7A 2ZUXA 3O45A 5DJ6A 3DBSA 4OQTH 2YBTA 3FYOA 3SN1A 2V5CA 3VOIA 5A6TC 3U5UA 4FULA 4JS7A 1FFNB 3FJ4A 1K7XA 1YEFL 3TC6A 4PTTA 4Y1AB 4DXKA 3ZXAC 1FJ1A 5MEPA 3W1NA 3IIZA 1SVDA 3SDYH 2XWBB 4DW2L 3MJ9L 3LZNA 3OJ2C 3C12A 3IJYA 4LSRH 3USZA 4LLUB 3M07A 4AJVA 3IFPA 2Y1YA 3EXJA 2Z25A 1BWKA 3MRPB 3O16A 3R89A 3EXLA 3QE5A 1GTEA 3TA6A 3MLSL 3BZDA 4P2RA 5DHYB 5T9CE 3BJTA 3VI2A 1E8ZA 2RQ8A 3CZUB 1JZ6A 4QLJA 5ALCH 1ZS8B 3L5XH 3SKMA 4DOHB 1Q13A 4YHML 3AMKA 2AXGB 2DWTA 3NPXA 3NVTA 3P5ZA 4JNMA 2P9RA 4NC0B 5F7YC 4PJDE 5HHNB 2WQ8A 1U21A 3STGA 4XAKD 2YGYA 4XTDA 2ZXGA 4PJAE 3EJJX 2ZCKL 3D1MC 4JPQA 4NM4L 4H25A 5KOMC 3W0WE 1RZQA 4J35A 2BRRH 3PU7A 3B0XA 3EJYD 3L1GA 1AGCB 3S4TA 2BVUA 1S7RB 3UO1H 1BFVL 3AXLA 4LZKA 3HUJA 4S1QH 3T71A 3UVAA 5EZJA 1JPFA 1OAZL 3IRSA 3APYA 1WGOA 3LQLA 3QJAA 2P8MB 2OU4A 3EHBB 4KHTH 3F4DA 2FX9L 1OAUL 4QCIA 1YN6A 3WH7A 3QI9A 3KPLA 4FI8A 5I66A 1JNHA 1Z9PA 2O6PA 3PHAA 5TH2B 3TIMA 4BCEA 3TYZA 1GRWA 2BWDA 4O2FA 3SDDC 5I1AA 1T03L 4GYFA 5IUCA 3QDJA 1NTDA 5AG9A 1V77A 2O6FA 4NJHA 1K7EA 4Y16A 4P8XA 3QUXD 4ADJA 1VEMA 1AQHA 1MCBA 1GGTA 1ZAIA 4JE4B 3GC4A 3LV6A 1X9UA 4ANXA 2P50A 4M1BA 3JXAA 3NQKA 1KLFB 1NF7A 2VISA 3E6EA 2WYZA 2OZ4L 2HXAA 4EAEA 1E50A 1DSFL 3RVWD 4ALAL 2J2ZB 4EPDC 5I24A 3ZVVA 3U2JA 2Q09A 1D8CA 3HA1A 2ZOKB 4HUWB 2H8PB 3THML 2FB4H 3UGUA 4BGDA 2Q3RA 4UTHA 3WFEH 1Y65A 1FYTD 4L37B 3SQBB 2EVFA 4CC1A 4NWTL 2Y6ZA 3AREB 2PCFB 2Y85A 4OT1H 1AVAA 2I16A 5KN5B 5D04C 2EC9U 3ECWA 3FTVA 4LKCA 1D7KA 4GVIA 3EOTL 1UWRA 1FWWA 5CKGA 3HFMH 2DLHA 1GHSA 3TA3B 3DSFL 1EUAA 3KOFA 3NACH 3O41B 2YGVA 2NY7H 3HB3C 1Y1UA 1WNOA 3OKMB 5HGBB 3LZLA 4R4FL 3SYCA 4FXJA 3W1PA 4KJWD 4M7KH 4ORIA 4L8SA 2Y6TE 2DI8A 3UACA 1L5GA 1DLHB 2OEKA 5GIRB 4EXQA 1SHWA 2ZE0A 2FWSA 1NQ6A 3N0AA 3ZWTA 4ALAC 3TEWA 4LARL 2PDNA 2DM2A 3PP3H 4R26H 2AXFA 2Q7YB 4XPBH 2VDPB 3FOLB 3C6EA 2B0MA 2FVMA 1UR0A 3BG5A 3OEXA 4Y16C 4K3EL 3DMMD 4POZC 5SV3A 4NAEA 1DANT 1VCAA 4KZEH 3ARYA 1TYJA 3NCJL 1G9HA 1OM0A 4RGNE 4HZ1A 3T8VA 3RLGA 2D7OA 2NY3C 1F4XH 2PWFA 1RJYB 2YRPA 1CE1H 4H8WH 4RW5A 4HQQL 4X4YB 2NQHA 2X40A 4UTTC 3SN4A 2XH0A 3DWTA 5TDNA 3O2DA 3IMWA 4BHUI 4PUDA 3SDCB 2GQ3A 3OKLB 1B5TA 1D3CA 3F4CA 1U36A 1IC7L 3KTSA 3IACA 4PMVA 3BMWA 3BIBX 4FI6A 5LB1A 3CL8A 3F2LA 1TUPA 2XPGA 2ZF8A 2ZNWA 2EYRB 2QLYA 4HX1B 4PRNA 2XN9D 1GCYA 4S11A 3VFGL 2KYIA 3PV7A 1B3ZA 3IGAB 4ONHA 8A3HA 5GGTL 4ZFFA 1RLBA 2H3KA 5AVWB 3SB0A 4CDGC 1M2VB 5ECUA 3MRBB 1IR2A 1HSAA 4AVHA 2IXQB 4AYFB 3IUHA 3RHWK 1MQ8A 5GHWH 2X38A 3CT7A 4QS6A 3ZT5A 5I76A 5ENLA 5CCGE 2J47A 1GK8A 4CNSA 3OKNA 1O12A 3FCTA 3W1UA 4LF1A 5DFVD 3NZUA 5F8QC 3FUKA 3GT6A 3EFOA 4PJ7E 5CBJA 5AENA 1QFUH 1F0LA 1RLDA 4XUGA 5CPQA 3RVTD 3HE6B 4LFHG 1E6OL 3K2KA 3DK2A 3BJ91 3CQKA 3FSUA 2J7DA 2BSTA 2WIIB 4NZ3A 1EC9A 1XX1A 3R2GA 4J3UA 5C0AB 3GBNL 1F4AA 2WAHA 5IB3B 3ARWA 3H26A 3CUPA 3GFZA 4DGWC 1BFVH 1LWRA 2H6PA 5HHQB 4LYPA 2H6UA 4JR9L 5IY5B 3VGAB 2BNQB 1XYMA 2CLLA 3WNIA 5AY7A 5C0BD 7FABH 1E6ZA 3UY7A 3WHXB 4E5XA 4XE0A 1MLBB 4X2UA 4P5MA 4D8LA 3LD5A 3TV3H 1NLDH 5AVUB 3ZL4H 4YFDB 5BCAA 4PFHA 3VXQB 3OC5A 2CW6A 1E65A 1EQWA 2HKHL 3GK8H 4KGJA 4PRIE 3SO5A 4ZQKB 1TTFA 2X6UA 1B4RA 3IWPA 4B9PA 3DFQA 4DWSC 5H2BA 2NSOA 3SY6A 5M1TA 3G6AA 4LSVL 4TNVK 1KBJA 3NAVA 3ATAA 4Y16B 4XN4A 1A7PH 2ISFA 4JL1A 2R2CA 3K46A 3DGGB 5DBUA 1KBGH 2RQEA 1OTSD 2HA1A 1V8HA 3GJEB 3GXPA 4Q8PA 1LOSA 3AIWA 5GISL 3SJVD 4MKVA 5HYIA 2HX9A 5ADOH 4P3CH 4G1KA 5D7JC 4HSAC 1SJVA 3GMQB 4PJBA 3IJQA 4GVFA 4PRRA 5DRZB 4Y8AA 1XF3A 4XMXA 3HI6H 5FK9B 4XR8C 1CU4H 4PY7B 2LTQC 2N1KA 1URZA 3FU7A 1CFVL 4ONFH 4YMPA 3LH2L 1LO3L 3LKQB 4XBGA 1ITQA 1FWHC 1T96A 3H7RA 3GHBH 4IUOA 3LS4H 4DN3L 3A3XA 1GL4B 3L7FB 5LNRA 1VZWA 2QCGA 4PUUA 4XBKA 5CCHE 3OC8A 1NC2B 4MTVA 4WU7A 2WYTA 1U6AH 4YIQA 3M5VA 4LFYA 4MYXA 2V33A 4OUIA 4PR5B 1XQLA 2GVJA 4FFWD 1TO5A 4L3AA 1OK8A 1WIOA 3KPOB 4MBOA 3OKDA 2M1KA 3JTSA 4EWJA 5F1NA 3KXQA 5E6IA 2J88A 1QVOA 2AKZA 2WSRA 2XINA 1BDYA 1IM9B 4ZQCA 3GC2A 1UR2A 2UXGA 3KLKA 5AW3B 4UOJA 2IAND 2CCLA 4WO4C 2JKSA 2XGBA 2BIHA 1YKWA 4EX4A 4WO4D 4NUJA 4FLSA 2Q20A 3GB7B 5EU7E 1CLKA 2KS0A 3GG0A 1HS6A 1IT9L 3ZE2B 1MUWA 2YUVA 3TN4A 3NYKA 3P9LA 5INDB 1XISA 3WEXA 3HUJE 2HQAA 3REVB 1JGDB 3CXDH 4Y2DD 3PSWA 5AYUH 2DZSA 1PZ0A 3LHAA 1JBJA 3P62A 4JRYE 3EYQC 1LXMA 3VIGA 1RZGA 1NGWB 2PYEE 1YECL 4RCAA 2G3JA 3T40A 3BUYB 1HH6B 4QWWC 3TONA 3ZSTA 1R85A 4JDEB 4F7PA 1HWGB 4LXFA 1IWBA 3BOXA 4B91A 3EH3B 4I6VA 1QLRB 2I25N 3L3HA 1OP5K 2PTTB 2OP4L 1XFPA 4XNZB 2ZZ7A 1GJUA 5ACZA 2YD5A 4NC1C 1DOSA 4GYBA 4L23A 1JQXA 4KITB 4QOKA 1B3YA 2EJAA 4G3YH 2W4XA 2H9AB 1KCVL 5DU7A 1PSCA 1MCWW 1QBAA 3FQWB 2NTFB 3GSXB 4IEFA 4Z08A 1WH0A 2MQCA 2VXSH 3PWPE 2ZICA 3SR7A 5EUOF 3INUH 3MCYA 3ZGHA 4EVNA 4P5SA 3CHQA 4OD3H 5F3FA 3G08B 3BGMB 4M61A 3CAKA 2JE8A 3GTFA 6ENLA 3N3EA 1V3IA 4XRCA 3WIIL 1B54A 4J8QA 1TELA 1KIPB 1S3KH 3D18B 1P0BA 4N2IA 2VZUA 4BFNA 1ZHKB 2QCLA 1JP5A 4WUUA 1A1NA 5CPMA 5I16B 3S83A 5J6HA 2VC2H 1A25A 4KZ0A 4XAWH 4Q8MA 1RP8A 1Q6RA 1H7RA 2GQ8A 4DBSA 5CD3A 1Q9LB 3SY0B 5KYXB 5F7WC 1XGQB 1X4ZA 4DVBB 1I9RL 1NL0L 4HKBA 2EDEA 2CKBL 3N34A 3KXFB 4NRSA 2V2XA 2AXJA 4HIPA 4QX4A 3M5YA 4W9IC 3C08L 4NSKB 4Q7DA 5BXFA 5FECA 3NM3A 5EB8A 3VIJA 5ICZB 5DQDH 4CQDA 3KUMA 4Y5YA 4BSWA 4QHUA 1A53A 3L3DA 2XWJA 4OCSL 3T2QA 1E8WA 1DUZB 1ND0B 2HYMA 3HC3H 3S5YA 2Z0IA 4QO1A 4GY7A 3GINA 3VRJB 5CC5A 3GHTA 1AZRA 2HBVA 4Z7VB 3MHUA 1GZGA 3TV8A 2E7CA 1DVFC 5ITBH 3MA9H 4OFQA 4O02H 1UVQB 5KBPA 5BVPL 4H9YA 5EBGA 3WLOA 4IG2B 4Q6IC 3NPVA 4JLRA 5CBBA 5TIMA 4G82A 5D7EA 1OQXA 2X1QA 3NUKA 2WLJA 2Y6SC 3UCQA 1SEBA 1UP0A 5JW5A 4JDYA 5CP7B 5D1ZD 4P4RB 1XCQA 3N85L 3C09B 4OJAA 4OLYH 1BQKA 1AQDA 5F7LB 3BZEB 1KBIA 2X2GA 1OADA 2X7LA 5DT7A 2ZUSA 2SEBB 4KDVA 1IGFL 3BYTA 3QARA 5CSBA 5C0BA 1J86A 1EZWA 4K3JH 2IF7A 2OXGB 2ROXA 2W9DH 4AVKA 5LGHL 1KEGL 5FWRA 4JS3A 2P43B 5DHXB 1CNVA 3I4EA 3KOXA 4GI4A 2BOLA 5BWAA 1H3WM 5EPDA 3FCBA 4NJIA 1V7NL 3E8UH 4U1NA 1HHHB 2XFFA 4G1NA 2C3GA 2Z7GA 2APWA 4F8XA 1URLA 3U25A 1PZ5A 4O5LH 3K5RA 3QQ9C 3GIVB 4FZEL 1FWSA 2DEPA 5IT2H 4GCXA 1YXDA 2QFRA 1L6SA 1JK8A 3T42A 5ADOL 5U4NA 5BXSA 3DX4A 1QLEB 2Z65C 4RFNB 3WFDH 4MQXC 3KZ8A 2AK1L 2BB0A 4JR5A 4DBDA 4PJCF 5BRZD 3O63A 1AIZA 2CO7B 2FZMA 5AYBA 2R2EB 2FJGA 1N8FA 1TJGH 1ADWA 3CMOL 2ARJA 2MCPL 4NT0A 3TMLA 4NIKB 3ZT7A 1BKHA 4R9XA 2XZQL 5J5RA 5FJUA 4A7SA 3DURB 3EDFA 2YPLA 3AQDA 1UZ6F 3BGFC 5CINH 3GLCA 1X3DA 4JIPA 4RETB 3BZ5A 4KHTL 6TAAA 1CLZL 1JYNA 1FO0H 1FY6A 1OZMA 1T5XA 2XIMA 4OECA 5G55A 3VNDA 4Z2LA 4YJ5A 2YIHA 2DM7A 4OLUH 4UV7L 1D2KA 4XHJC 3C3UA 1DQMH 5D38A 4RIRB 3GNML 1JE6A 4JM2B 3DOPA 3V75A 1RZ8A 2PW1A 4OZIF 2CPCA 5SX5K 1YIXA 3LLDA 4JDEA 5F44A 4F7PB 3KS5A 5IEKA 4GG6E 4MHHG 4LCWB 3FTGA 4Z7VE 4DJED 5IMKB 1SLXA 3Q65A 2B2XH 3PFUA 2VLJB 4EOUA 3QQNA 2XICA 3KH3A 1KGJA 3GSVB 5B1AB 4C60A 5L8JB 1T1ZA 3QXUA 5A16B 3GSXA 2C9XA 5SWZD 1CT8A 2X12A 3NG3A 3U57A 2IPTH 2QMJA 2UWEB 4X5WA 3LMJH 4Y4KB 4DI9A 4CU8A 5BRZE 2AQOA 4JIRA 4FQJH 1MY7A 1EXUB 1LQ0A 2IBBA 1E8YA 1E4KC 1PCXA 1AR2A 1XHGA 1RK1B 1BXAA 1YEEL 3Q7JA 1M68A 5I6XC 1A3WA 3LPPA 1RJPA 4DGUA 3UAJC 1ET7A 4WI2A 1HEJC 3RY6A 3MOAL 1A2YA 1JNNH 1YW1A 1JMXA 2JCCA 1HHIA 1IIHA 3GSMA 1E56A 4TUUA 1KY7A 4QTGA 4GW4A 4AQAB 3E6HB 3BWUC 4GVGA 4JX6A 2GQAA 4RFEB 1SGJA 5A5WA 3T78A 1QTSA 3B2UD 5FAAA 1O5RA 4JB9L 4PJFA 1HIML 4IW4C 4XPTL 1IM9D 3RVTC 1S78D 1JZ2A 2PTDA 4Q4OA 3ATFA 1U8CB 1R86A 5I6LA 2AV7B 2HVBA 4UZUA 3FYYA 1SM9A 2PRHA 3BN3B 2CJSA 5T8GA 3K91A 1AJZA 1NDYA 4YC2B 4DEWA 5LAPA 3X3GH 1EHXA 1HJBC 3CSYB 2O5YH 2YHGA 5JLZB 1U4FA 1CYXA 4MWFA 5DVLA 3R79A 4GAYB 4AVFA 2QCNA 3CDZA 4PGBA 3FCUB 1XGDA 3UPBA 2XWDA 1OGBA 1CVRA 2CO6B 3MLWL 2A6KB 3MYJA 3KAAA 1S7SB 3QVAA 2ZCLH 1KD0A 1NFBA 2CLKA 3SGDI 2H6RA 3RX5A 2C71A 3NCJH 1UVQA 2XFGB 4CN1A 1F2XK 1L2QA 4NZRH 2BVPB 1EJXC 4Z7QE 1LP9F 2EUWA 5T3ZD 2B3RA 4JVWA 1FWXA 4NNBA 3R8GA 1W3IA 1CLZH 4HUVB 4GUHA 4KDTA 2VZTA 3U36B 2CBJA 1K4DB 1PFCA 5ENWB 1MDTA 4D0CB 4F1SA 1NOUA 1TQBB 4BQ8A 4ASTA 4PH8A 3WCYA 3MP5A 3FXYA 3VWKD 2Y5EA 3E3HA 3H8AA 3FONB 2X4SA 4LDLB 4N3UA 3V95A 2PO6D 2CJUL 1KW1A 3KZSA 5DURB 3B8IA 5U7SA 1YNKL 4GIPD 3FTZA 3T3MF 4K55A 3H2OA 2R2HB 4H88H 2M26A 2A73A 3GRGA 3GS4A 4RMBA 2CM5A 5AB9A 5A6IA 4Q8UA 5SWQB 1M9HA 1NKOA 3LRLA 3M4HA 3IF1A 1WUZA 4OD1L 4B9GA 3DKHA 1M7XA 5HGHB 1U8LB 1WVZA 4R84A 4U1HB 1TA3B 2WWDA 4D6DA 3JV4B 3IFOB 5K69A 5DD5H 3QEQB 2WINB 4B9IA 3H7VA 1I1CA 3GJFK 5E2WL 3KW3A 4P2YA 3GMPA 3PAYA 4JKLA 2WKJA 3D0CA 5LNSA 4OCRL 2ARJB 2DQDH 2F68X 2FO4B 4ZPVB 2QAPA 3PQYE 4YVPA 4DERA 3QYMA 3VMNA 2Q5BA 5ABZA 1VBUA 1HQ4A 1OE2A 1DR9A 3A4FA 5FHAL 3K0YA 3A67L 3U2SA 3UTZB 2J8UE 1KJ2H 5F7KC 4EN3B 1VPXA 2XU2A 1OD9A 2ZUQC 4P7QA 1IBZA 1AG6A 2BP8A 4LOVA 4U1MB 1YY9C 2A9NH 2GABA 2OQHA 2OVLA 3W75A 5I5JA 3LPWA 2GEEA 2NUTB 4NKIL 5IBXC 4HS3A 3VW3L 1DSYA 1KQYA 1QNPA 3R11A 5KVDH 3NM1A 2O26U 3ESOA 2AGJH 2QQKH 4JFED 1NQBA 4NJ9L 3IDMA 4ZNEE 3ZX1A 5BQ7B 4QHNA 1ECQA 3TVMD 2C4FT 2IQAB 1EO8L 4R9HA 3TIEA 2ZOWA 4CMMB 1UEYA 4IHOA 3ULVL 1HYSC 4W6XB 3KE0A 1TJHH 5CFHA 3OKOA 4B2DA 3IIVA 5IHZA 1ZT1B 4PMEA 3RWDA 4Z77B 3N2XA 4C6JA 4DAGL 4KETA 1B57A 4J12A 4J8RB 3V52L 1W6TA 4NKOA 3MVSA 2R29L 4FABL 1N6QH 3ENLA 3DTXA 3MSPA 4GBXC 1GGUA 1TPWA 2F38A 2ZG2A 4KI5F 5TQ2L 5CBIA 4QRUB 1JPFB 1KT2A 3G5XB 4PM1A 3B8TA 3SDAC 3NQ7A 3I3EA 1R3LA 2H32A 3TO4C 5DQ9A 4CVWA 2QCMA 1U1UA 4HZ7A 2BVWA 4B53A 4NUGH 1YEHH 4H41A 5D96B 4FXFA 4XSLA 1E1CB 1TZHB 4ZZKA 4GUCA 3FFCE 5IB5B 5D2NA 3UTPE 4JTIA 2JF1A 5LYRA 4YSQA 5AZEH 4A6YL 1INEL 5GVJA 3X17A 3D25A 2ABBA 2XH2A 3PG2A 2J25A 2PN5A 1FIEA 1DJIA 4L4VB 5DA0B 3B8VA 4V27A 4HIXL 3VH8G 2FBOJ 3OHXB 4D6CA 1AGFB 2WIMA 1RURH 3POHA 4FS0A 5DJDA 1I1WA 4WDUA 3IJYB 2QFPA 3GIZL 1TWSA 2FCBA 3IIPA 2QW5A 1ZNNA 1Q1JH 5L2KB 3SGKC 2O5XH 2VDRL 3TT1L 1EBAA 3QZNA 4OGZA 5K1VA 3O9WD 4JNXA 5HI5D 1GYLA 1S3HA 2RDXA 1M65A 4IKJA 2EZ0D 1W2PA 4ACZB 1UH4A 3QUKA 3CSBA 2R1KA 4H83A 2QPUA 5DFTA 3M44A 4PY8J 1RIVH 3U6RB 2P47B 3AREA 2DZXA 2OMBA 4CQAA 2ZDRA 3MSDA 1BJMA 5I1DA 4QDPA 4K7PH 1EXPA 3GQYA 3UYIA 3VFTB 2XZCH 3ULUH 3R0DA 3B3BA 4Z0BL 1A5AA 4X2PA 4GQGA 3UAFA 4WZHA 4AAJA 4Q8VA 3AUVA 1S7RA 2QUMA 4XVUC 2PPCA 1I1AA 4A8IA 5F8RC 5TJWK 4QLWA 3RA7L 3QIUD 3TO2A 2R69H 3CJJA 5E95B 5KSBB 3U0WH 3V7PA 2Z31A 5CJ5A 2VM8A 4ENZA 2P8MA 1UQSB 1L6GA 2R9RA 5DRIA 1CF8H 3Q8FA 1Z0MA 2Q8AH 3NIDB 3P9WB 2OR8A 5FYKU 5D2YA 1KY6A 3TBWA 4JQAA 1WFOA 3OR7B 2H3XC 2D3NA 4GMSL 1LT8A 3GAYA 3GVWA 1OWWA 1JGEA 3C5ZD 2QBWA 1MEIA 3QXDB 5CPOA 2A2QT 3WD3A 3R18A 5HANA 4HCRH 4PAZA 3RHGA 3TFKD 3GI8L 2E6YA 2QQLL 3GVRA 1SVCP 3RCNA 1ERNA 1CFNB 4NQ1A 4EACA 3LSOB 1OB0A 1VZHA 1KBKA 4RH4A 5CC7A 4KHXL 4PIRF 2FEDC 4FTDA 3LD8B 3ET9F 4N2CA 2XVPA 3QZMA 2K8QA 4OCRH 4OZGA 1TJ1A 1OLLA 5FW6A 4KKLD 2IANA 4DJEA 2L7JA 5AAPA 3ZYZA 4F2FA 3MBDA 3OBKA 2VLLB 4F2MB 1FRGL 1KCRL 3GWJA 3QDGB 3FHAA 5DGRA 1CI1A 2XPGB 3D69B 2I14A 2WJZA 1IE4A 3TYCA 1AY1H 4MXWH 1MYRA 4J9JA 4JQ2A 3SCVA 5F7DA 2WXFA 1CW2A 4BV1A 3LYRA 1C7SA 3UJRA 3WD2A 3MCNA 5TQ0L 1GPOH 1Z3RA 3BT0A 4YXLL 1Z3GH 3EYUL 1FG9C 2OO0A 4Q52A 3LMYA 5I15H 1K8ZA 2AFNA 3BOLA 3LAFA 3M88A 5BOZG 1WKEA 2VZ3A 4QHNB 1VD6A 3IANA 3S6CA 1HF6A 3RYSA 3FB7A 3IRCA 1E3ZA 4PJ8C 1UZ8A 4LDEB 3UO1L 1J0ZA 4N2HA 5BO0D 7TAAA 5IWLA 1FQ9C 3O41A 3TW7A 4GXMA 4R90L 3M0YA 3E3QE 3V0DA 4JBSA 1JNEA 2E7LC 3OLEA 1WDPA 2WMGA 4S0SD 3DN5A 2PF6A 4HGXA 1RPKA 4LQ1A 4QRRB 5J12B 1DLHA 1ZD6A 4BQCA 5JW4M 1ZLVH 2YD9A 1TR7A 2GHZA 3GIYA 3FSTA 4HMCA 4L0YA 4X60A 3KRUA 2A6JB 3WYRA 2DIBA 4FQLH 3U46A 1XG3A 2EJ1A 5EDXA 3V6FB 4HZ6A 5HHPA 1NAKL 2OQJA 4YDIL 3DESA 1UWSA 2NY2C 1G4PA 3EAKA 1WEJL 2XTLA 5IRPA 5C0GB 3O4LA 2LQRA 4N8CL 4QAIA 4X42A 1OV8A 2OZ3A 4H04A 3MCKB 3EW3B 4DBUA 2HK0A 3VXQA 3ARDB 4I9AA 4HJJH 2OMVB 3GBML 1JWMA 1HG3A 4LQFL 4JTSA 1H9DA 2AK4B 5KYYA 3BKJH 1MZHA 1X6NA 2VEIA 2DWXA 2JK5B 2VNCA 3HMXL 4KNSA 2W81C 4KPLA 3ETBJ 1FLRH 3K1GA 3FZUD 3AHXA 2D73A 3OVQA 4XAWL 1T0MB 2AVGA 3GDKA 4NWUH 1TJGL 2MCPH 3CMOH 4WTXA 3VFUA 3K6SA 1ML1A 4WTWA 5C09B 3JWNE 5IFHH 4XC3H 2QULA 2ICES 3KTXA 3DHMA 4IKKA 1GPFA 1IGCL 2Q7AA 3PR2A 4PMJA 2H45A 1OZTG 1KXVC 5IJKC 4J3ZA 5HBFA 1RD6A 3S46A 1J10A 5IEHA 3EDKA 3WLWC 1KO0A 1UPPA 2NZLA 2DWEA 2Z00A 3UBGA 1RSYA 2A6DB 1FWRA 3W74A 3L16A 2FD6H 1QWUA 3L08A 4NHCL 2FEJA 1F3EA 3O6AA 4NQDA 3ZLHA 1YY8A 3V4VH 5IFAL 2AQ3A 2J66A 2UZXB 4M82A 5GJMA 2CDEA 4RDQG 2YW4A 4LARH 1N68A 4RK8A 5FJPA 4A38A 2PPEA 3SQRA 4DLMA 3BW9B 3D6GA 4ZAKC 5GGTA 1K8YA 2ADAA 3EFDH 1QYGL 3S37X 3OXSB 2A74C 3TN0D 3TE9A 4MNLA 5C0AE 3VA6A 2QLVB 4QFUA 4UFLA 3D48R 1HHGA 4I4WA 3KM2A 2WO3B 4Z6AT 5CR1A 3IRZA 1P7TB 1EZLA 5JYLA 1AI1L 3INPA 2V17L 4HNVA 5JBDA 4R90H 4NUJB 3DJTA 3WJYA 3F5WB 1XLJA 2V0TA 3NO3A 3D3VB 4J5NA 2RCSH 1WV7T 2V7NB 4PJBF 1QI5A 5E4EC 4XAFA 5F1KC 1BWVA 1J8HD 5CU9A 4R7LA 3US1A 3FT1A 2XZCL 4OQTA 2CGRH 3MWCA 1MVFA 4JE0A 4XZ4A 3OYXA 1PDKB 1FFRA 2D7PA 2IQTA 4HC1H 1BQHA 2B7OA 2OX4A 5KVEL 1OVDA 2SFPA 3PF3A 3PNUA 3N43B 4FMFA 2YD7A 4OZFH 4QF1B 3RDTD 3SZ6A 3DC8A 1DUYA 3T0EC 3O81A 3KVPA 4MXWL 5HJGA 1MAKA 2FBRA 2WMPB 5JA8B 5J1SC 1O5QA 3ULVE 1HI6A 1UQZA 1QBLL 2V67A 3WQ4A 1N12A 2DJMA 4L2YA 3P4OB 1ONEA 2NYZA 4MMYA 4IH3A 4NVTA 3EO1B 4PWJA 3GH4A 1G9NH 3TJPA 3VI3A 5IIEB 4PA8A 3FU7B 3P14A 2L04A 3L54A 4LSBA 1F11B 1D5IL 3HS9A 4UDTB 4XP9H 3KOWA 2ZWZA 4LMQE 1JG9A 3CGTA 4BM7A 3FB5B 2B59B 3CV5A 4P07A 1HWHB 4A2LA 4DGVL 1W0WB 1N5AB 4JYFA 3NH7L 4QSFA 5DMNA 4Q58C 1RALA 3W86A 4JQXA 4IKLA 5EO9B 1A02N 4DELA 4MQXD 3CLWA 4Q89A 1T66C 5BZWB 2VLKB 5IJVB 4TMBA 1KGYE 4EP8C 2CDGB 1HOCB 3IFNL 3KLDA 3L9BA 4Y5VB 5E1HB 1FP9A 1FNSH 3NVDA 1M03A 1DLFL 2COQA 3MU3A 4HS8L 5E8DH 4G42A 4B50A 3HB3D 1VIZA 2B0SL 2WXMA 2KZKA 3K6FA 1ZWIB 3FQXB 5SWZE 4B3ZA 2G2RB 5KINA 4HAGA 2IGFL 1P7BA 4INFA 3TVMC 3UPWA 2O61B 3NA9H 4B9FA 1EJ7L 2V2DA 4XZMX 3DDFA 3FCSA 1XH0A 2YKKA 1HJUA 5AC6A 1MNUL 4D9LH 5G4WA 1WT5A 2ZOTA 4N26A 4JQXC 4U31A 2OL3L 3HAEA 3CVDA 4OM0L 4XHJD 3H23A 3FUMA 3AS2A 1HW6A 1IBGL 5B39B 4ZB0A 2NX5A 2Z27A 1KYOJ 4UIMB 2Z4QB 2HXTA 1HJWA 3CYJA 2EXYC 1HKFA 4MYPA 1VFBB 4N8CH 1ET5A 3AGWA 4X0KB 4D9QE 1M53A 1V7YA 3B5GA 3B9KC 4YAQB 5DC0A 2HROA 1H5BC 1VACB 4OI7A 4L3CB 3IDUA 5FLVA 1XUZA 3TJEH 4JN2A 1RPUA 1M6UA 2XT1B 4YDNA 1JWMB 4O14A 3EX4A 3MLXH 5CEZD 3BWWA 4FTVE 4Z3FA 1LE5A 3FGCB 4OUOA 4H5SA 4M8RA 1ISZA 5HA7A 3N2JA 2FTPA 2BRQA 2YAPA 5SX4I 5IHLB 2G4FA 4DWHA 4FX7A 1Z5YD 2GPTA 4H8HA 1HZKA 1JAKA 1I45A 3C8DA 5FUCC 5EG6C 4UTBH 4X63A 1PNCA 4QISA 5EEYA 3RNDA 2LU3A 4A1RA 2WZTA 5FCZA 4GKLA 4TXEA 4MWAD 1GQNA 3S6DA 1QJWA 4N6QA 3OZMA 4L05A 4W70A 2VM3A 2NW3A 4KRUA 3TAKA 3NFNB 3CBRA 4DPRA 5FV1L 1AY1L 3G5ZB 3QM3A 1TX2A 4PRBB 4KERA 5C08B 2Y25A 1KGUA 4Z3HA 3IXAB 3TVMA 2HUHA 5K3VA 5DHVH 1GZQB 1OAUH 3SKOB 5AWNH 3KYMA 3ZPDA 2RHEA 2OTWA 4D1IA 3IMVA 1I7ZA 4S0HA 2HH0H 3H9YA 3OVUB 1KFGA 3GVVA 3ZJAA 3RUBL 4EF9A 2F58H 3HN5A 1GZPB 2VABA 2OT1A 2XN9B 2R29H 1DBBH 5KITA 2CE6A 1KFKA 4M1DL 1EUUA 3EH4B 4QHLB 1N8ZA 2Y61A 3WDRA 3V4VA 4XMUA 2RJHA 3GW3A 4QHUB 4GABA 1U95A 4XISA 3L3DB 3NXFA 4RDZA 1OY3B 2LU4A 3H9SA 4PGZA 1OK4A 2WN3A 1R5IA 3VI3F 3KPRA 3S4SG 3ZSSA 3WJMB 3GVGA 3HMWL 2LFEA 2NNAA 3MCG1 4RZCA 1I2PA 1HHJB 1I1FA 3JWNH 1I7TB 4MDPA 2YPLB 1KTLA 4IDLA 5HHVL 4HC1L 1CGVA 5B7YA 1I9JL 3ARQA 5DT1L 3VAEA 1NDVA 4LS0A 2EC9T 3MLSH 1WDQA 3BEVA 4DUXA 2AS5M 3FDKA 4AWEA 2WYSA 1UB6B 4YHKH 1YPXA 1C5CL 2BY2A 1KRBC 2P0OA 2NNCA 3QDJD 1QNZL 2OV0A 2SODB 4KI1A 4RGNC 3UYPB 4TOYH 3C2VA 5C0EB 1BECA 3N55A 3ZUNC 1CLOL 3F4NA 1H5VA 1ID2A 3BICA 4PJCB 5L7XH 4XX6A 2O30A 2C15A 3NPWA 2TMDA 4J40A 1QNIA 4P4RA 4IGBC 3UZQA 1RHHA 2BY3A 4ZMTA 4MYWB 1MAMH 3IS0X 5D7JD 3V9FA 3FN0H 5F9JA 4BQBA 4OIFA 4HHGA 1F07A 2A7PA 3T0TA 3W2NA 2NPLX 3ARGB 3GSNB 4MDJB 3ULSB 1XQ4A 3QGAC 5IIEA 1ISWA 1G7JB 2A1WH 5CEZH 6ALDA 4Y9BA 5JQHC 2P28B 3ZJ8A 1I3RA 1ZL1A 2WHLA 5AVHA 1WTLA 3QQXA 3FB5A 4KO6A 4FN0A 3VXRD 4LB4A 1T83C 2UWEA 3HAEG 1SXZA 5F9OL 3X1EA 1LBFA 2VWTA 4HH9B 3K1KC 1X5LA 4UFHA 4IBWA 4DVRL 4Z78A 1MCCA 2EC8A 4PVMA 2ISVA 4E41A 3QQ4B 3TQVA 3OB0H 1ZVYA 4FERA 4Q8OA 2UY7B 2D3LA 4M3JA 3WBWA 4C4KO 4EZMA 3PXHA 4Q9CA 3AHVA 2R7EA 5DEZA 1XVSA 3VH8A 4EDXB 5CCKH 1JRCA 3GK0A 3F83A 3T0CA 3O0KA 2L3BA 3CN2A 4BQ5A 2OB3A 1X4XA 4JDZA 2D7QA 2C1OB 3SBWC 4F79A 4F2BA 4C4BA 1JXFA 2EDXA