1XD0A

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase
publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xd0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xd0A01
4UTFA 1R47A 2GK1A 3K4AA 3G6MA 1C7SA 1BAGA 1TQUA 2PC8A 4D1JA 4MAZA 5FD0A 1C3FA 2FGZA 2F7PA 1GOWA 2WKLA 2FE0A 3HG3A 1FFQA 1JF6A 2WCSA 3W4RA 1TA3B 1H0GA 1H5VA 1WO2A 3AIWA 3UETA 1L8NA 2D73A 3WF4A 4KH2A 1UD6A 2J77A 3WFZA 9CGTA 5E6YA 4V28A 3N04A 3EJUA 2EPLX 1W1PA 4QP0A 4U3AA 5A8OA 1BGAA 4OOUA 3AMCA 3PZGA 3SCVA 3TTQA 2J7CA 3QR3A 3SIMA 3IAPA 4AIUA 4Z2KA 3ZR6A 1JD9A 5BXSA 4MPKA 2XYLA 1ZBKA 2F8QA 1YHTA 1TUXA 4K68A 4PN2A 1CENA 4MNJA 4ZXOA 2DSUA 2WBKA 1Q6FA 1JD7A 3BUDA 3AYSA 1HVXA 3VDHA 4CU7A 2F2HA 2VMFA 2VX6A 3AXIA 1R33A 4QFUA 3AS1A 1UR8A 3BUPA 3SUUA 2IUZA 3K8KA 2PWGA 1UR9A 1HKKA 3SCNA 3CHEA 4Z2LA 3AI0A 1NARA 5D8ZA 4HMCA 4U33A 2CYGA 3VU2A 4QAWA 4D71A 1HXJA 4XZWA 1PEZA 2VZVA 1OIMA 2WMFA 5A6SA 1E1FA 4M8UA 2BHZA 3GXIA 4UFLA 1JF5A 3WNMA 2CPUA 3NJ3A 4MJ4A 2XHYA 3FAXA 1E40A 1HJQA 5E70A 3VIKA 4JFSA 1LL4A 4BS0A 3N15A 1OSEA 1JDDA 4UQEA 2ZE0A 1MQRA 3ZJKA 2XTKA 1I1XA 3WY3A 1LWJA 3WQ4A 5I79A 3CC1A 4AYSA 1GQIA 1HJWA 3RJXA 2OSYA 4UZUA 4E2OA 3AROA 4AY1A 1R34A 2ZIDA 3GNRA 3S5ZA 1VRXA 4J7RA 5D9OA 3AQUA 2EPKX 5FKYA 2XWDA 4X9YA 3ZSSA 3ZT6A 5A8QA 1W2VA 2ZUNA 3CHCA 2VUYA 1QI3A 1F4HA 1UR0A 1JYXA 3VSTA 5A6KA 4UQAA 3D52A 3KL5A 3EJPA 4PSRA 3L4UA 2WYSA 4PCSA 2EACA 1J12A 2A3EA 2WWCA 3CMJA 6CGTA 3CZKA 1EQPA 4M80A 3CZGA 4J3UA 3SCOA 3BUBA 5F7UA 1H3GA 2V38A 1I75A 1WZKA 4B3LA 1X6NA 2Y5EA 1TQSA 1IT0A 1K9EA 2E3ZA 1ZJAA 2VC9A 3FN9A 3VNYA 3ZJ8A 2BXYA 1PAMA 3POHA 4TXEA 5I24A 3WQ8A 2Y24A 1EGZA 2BVDA 3LMYA 1B3VA 2ZX8A 2XM2A 3OGVA 1VEOA 1WDQA 4PSPA 3PZNA 4LGXA 4GQRA 3VGDA 3CUGA 2ZX9A 4JFUA 3A6OA 1NOFA 4HPHA 4GI9A 1VJZA 1XC6A 5D9PA 5EB8A 4AISA 1PS3A 1JAKA 3QHOA 1XSJA 1CDGA 3MS8A 1V3MA 1C8YA 1V6WA 5AYBA 3VGGA 3WF3A 1B2YA 1YQ2A 3WH7A 1V3IA 3ECQA 3NSMA 1WPCA 4W5ZA 3U7VA 1J0ZA 4PMUA 4ZFMA 2WZIA 2VOTA 2W92A 1O6IA 2E9LA 3ZSTA 1BVZA 1GVYA 2GDVA 4H8VA 3WQ5A 3KEHA 4H8UA 2BY0A 2X2JA 2G8ZA 3WNLA 3GBDA 2GK1B 1QBBA 3WMSA 1FP9A 3H53A 3OLIA 3SCRA 3BC9A 3FXYA 2WVTA 3AIEA 1RH9A 1HTYA 5JIPA 1QI5A 4GZJA 3LXCA 3RM9A 4D6HA 3BAJA 4MNLA 3D3AA 3W27A 3K8MA 4BQ3A 1ZBVA 3WQWA 1KXTA 4C7DA 2VX4A 3NSNA 1BYDA 2E9MA 3BSHA 3MUAA 1GHRA 4CN6A 4DWSC 5EBAA 2PF0A 1Q4NX 3GH5A 2CIPA 2D23A 3N18A 4CVUA 5EMYA 2WCAA 4W8LA 3WQVA 3BUQA 5D9MA 5ABHA 1KFWA 4E8DA 3NYDA 4UQDA 1NWTA 2RGLA 3DECA 5A69A 1TCMA 3BMVA 2JFEX 4IM4A 4AW7A 1GQLA 3CMGA 4AMCA 5CG0A 2O9TA 3GTNA 3L4WA 3EDJA 1E73M 4FLSA 1UD2A 1HJXA 1SYTA 2YDRA 4PMZA 3WBEA 1JZ7A 1EDGA 3GH4A 4V27A 5ABGA 1A47A 2QHAA 1BF2A 4KGLA 4TVCA 2D2OA 3GH7A 1SR0A 2DGAA 2XPKA 2J62A 4AYGA 3RILA 2YFOA 3VIHA 1C93A 4KGJA 2DSKA 1UWQA 3MV01 2HVMA 1SFSA 3EJTA 1NOUA 5I3DA 3WNOA 3W37A 5CLWA 3PZQA 3VDCA 4IUGA 5A2BA 3POCA 5A6LA 5AYIA 1AQ0A 2J7FA 1GQJA 3MI6A 5LA0A 4R27A 1SZNA 2ZXDA 3WH9A 2JIWA 1I1WA 4J3TA 1JZ6A 3M6DA 4XB3A 4EAMA 1JDAA 2WMHA 4OOZA 4WIWA 1E5NA 1CXKA 2Y2WA 2JE8A 2ZX7A 5JUVA 1HT6A 4H8HA 5A2AA 4OZOA 2XFFA 3VX0A 1N82A 3I3EA 1HJVA 4OGZA 2W67A 3ZT7A 3WL0A 1IZKA 4P7RA 2D0FA 5A8MA 1QHZA 4JKMA 3WENA 2X0YA 1CXHA 2YDQA 3EYPA 3OA5A 3AXXA 1B3ZA 3WQ6A 3ARSA 4MNMA 1J9YA 2CETA 3F5JA 3GDBA 5ABEA 1XCWA 4OBRA 3SCWA 4C7FA 3HZ3A 4JHZA 4W5UA 1G94A 1HL9A 2QPUA 1PZ3A 2WKGA 5E9AA 3ZR5A 1QOXA 3N11A 4TOQA 5HDRA 5EFFA 3FHAA 3W26A 1MFUA 5CPQA 3LPGA 3WMBA 1UWRA 2ZUMA 1KBKA 4PUDA 3THCA 2FH6A 4NXKA 2DT1A 5I2UA 1PPIA 2FHCA 4RE2A 2WNWA 5CQ1A 1FHLA 1HN1A 3EJRA 1OT1A 1T0OA 1DHKA 3W81A 1F4AA 4HA1A 3ARRA 1TR1A 4JKLA 1IZJA 1LQ0A 3W0KA 3BCDA 4UFIA 4P7OA 4MADA 4PBGA 3L4VA 1G01A 4AZHA 3WNNA 3PHAA 4N42A 2VQUA 2DH3A 3LRMA 1JNDA 3BAXA 2YJQA 4UFKA 2CERA 3VSUA 1UD4A 7TAAA 1TQVA 1MW2A 2GDUA 3WSUA 1VFOA 1V0LA 2WHLA 1JAEA 4N0RA 2YIHA 1DTUA 4BF7A 4FF5A 1UASA 4NZFA 1E15A 5AC5A 4W93A 2WMIA 5IDIA 3CBWA 5KEZA 2V3DA 1QW8A 3WF0A 3CV5A 2VTFA 2YBTA 3WELA 4Z2HA 5C71A 2OLHA 2EO7A 2XIIA 2EADA 4QLKA 2EPOA 4P7LA 2WWDA 5E6ZA 2WBGA 3AFBA 3QOMA 1HKJA 8CGTA 1KTBA 1QBAA 3IAQA 2CBJA 1BYBA 1J01A 1PX4A 2Z1SA 1OGBA 2PWFA 4NZCA 1TFVA 4WK9A 3WFLA 5TD4A 3EJSA 4E4PA 2BFGA 1LF1A 4UFJA 5JBFA 2G3MA 4AD2A 1LLOA 3AXHA 2BHUA 1WDRA 2WMJA 4M29A 3WH5A 1H09A 1US3A 2YL5A 1E71M 2DSWA 1FOBA 2OWXA 4HOXA 5BXTA 3W29A 3OZPA 1BHGA 2EXOA 3M46A 3VD3A 3WY1A 1XHGA 2F7OA 3MV11 5LA1A 3WD3A 2QPSA 1G9HA 2WHJA 4HTYA 3LXBA 2CKSA 3AJ7A 2CBUA 3H55A 2DQXA 4ACYA 1G0CA 5A94A 2VCCA 1V6VA 4EANA 2VT0A 3FAWA 5M17A 3WEZA 1D7FA 1HIZA 1JL8A 3EJQA 2C8NA 1JZ4A 4D6DA 2F1AA 2CBVA 1PBGA 2OYKA 1E0XA 2W4XA 1CPUA 2UY4A 2OWWA 1UUQA 2Q8XA 3GXMA 4M81A 3ARVA 1UD8A 4Q7NA 3VINA 1W91A 2D22A 2V3FA 2WB5A 3CUIA 1V0NA 1GOIA 4C7GA 3MSDA 4BQ5A 2F7QA 3T2OA 2XG9A 1W32A 1U2YA 3OB8A 2EABA 2GVYA 3AS2A 1QWNA 1UA3A 2XN2A 2QMJA 2OYMA 4JKKA 4B16A 2ZXQA 2VR5A 1VFFA 2ZUTA 1HVQA 4HZ7A 1TMQA 1V3JA 4GZEA 5BRPA 3BVXA 3RIKA 5FL1A 1GW1A 1MFVA 4W89A 4PTMA 5D4YA 4ZE4A 4HZ6A 3W6MA 5I6SA 1VFMA 2F18A 2VCAA 2W61A 3WH6A 1HKMA 1OD0A 2J78A 4URIA 1PX3A 4D6CA 3AHZA 3ZOAA 4DO5A 1QNQA 3GBEA 3AYRA 3RJYA 3K46A 4CUCA 1C92A 3T08A 1ECEA 2D24A 4CCCA 4D1IA 3EMZA 1C90A 5IHSA 3CZSA 1JZ8A 3SCQA 4R5EA 4XUYA 3RM8A 1UKOA 4TVDA 4CD6A 3SEPA 1R87A 3ZMRA 2ZX6A 2FHBA 1W9UA 1WDSA 4RE3A 1OINA 3AISA 1CYGA 3CGTA 1EO5A 2PBGA 3AZRA 3TTYA 3SUSA 2HISA 4F79A 3A24A 1UWTA 4FLQA 5DT7A 1TG7A 3TV8A 4OJYA 2OYLA 2IXVA 1E6SM 2W5FA 1E72M 1HP4A 1VBRA 3AIBA 4MB5A 1D2KA 1HX0A 4BZYA 5C70A 4F9JA 3AIUA 3H54A 3WF1A 1XYFA 2J7GA 5HPCA 1KXQA 1Q6GA 4J3XA 1UQZA 3WDQA 2ZX5A 3BVTA 3PZUA 1H4PA 4M1RA 1CGWA 3VD7A 3HG5A 4UNIA 1V03A 3KL0A 4H2CA 2VRKA 5BYWA 2JF7A 1CEOA 1PJ9A 3AMLA 1XSKA 2YLAA 4GZIA 3WD4A 1V3HA 3BVVA 4W86A 3N17A 3WBAA 4QDMA 2F7RA 3WD0A 3OLDA 2DT2A 3LRLA 3RDKA 1KWGA 1DWAM 5BRQA 5KZ6A 4XZBA 1E9LA 1VEMA 3AIRA 3IJ8A 3GXTA 3MANA 3W6LA 2IGTA 3FW6A 1UKPA 3A3HA 1E6XM 3LPFA 3PTMA 3BLKA 2VNCA 2WMIB 5D9NA 2UY3A 1VF8A 1B1YA 1LG1A 4WJXA 3EDKA 4L4PA 1ISWA 2NSXA 1W3LA 3WUFA 2UWFA 2X05A 3D4ZA 1UH2A 4YHEA 2GSJA 5CPSA 2XGBA 3HG4A 1BG4A 1VJSA 4PMRA 3D51A 4DWSB 2XVLA 4PTWA 1B90A 2E40A 2JEQA 1MW0A 1KR0A 4GINA 1W3JA 3OLGA 1B9ZA 3VD9A 2WLYA 4XV0A 5DT5A 2YKKA 1O7AA 4FNTA 3N12A 1OT2A 4WLCA 2VZTA 4UOQA 1M53A 4AZGA 2WZEA 2D3LA 2XFRA 1EQCA 5HOSA 1PIGA 1CGVA 4RL3A 1Q6EA 2ZUSA 5A2CA 3ARUA 2G4FA 4DUVA 4UCFA 3CHDA 1R7AA 3EMQA 2XN0A 3A22A 4FNSA 3WEOA 4CCEA 4UFHA 4TTGA 3A21A 4U5IA 3PZMA 4HP5A 1HJUA 1CTNA 3VIMA 4UOZA 3QHNA 5M03A 4HPGA 4LYPA 1MQPA 4M24A 4GI8A 4TX8A 3WNKA 4U3CA 4JAWA 3EDFA 1ZB5A 4Q22A 1BSIA 2DH2A 2DIEA 7CGTA 3KLLA 3ZJ6A 1GOKA 2W91A 2XFYA 2PBOA 4IISA 3PZOA 4X0NA 4V2XA 2J75A 3GXDA 4MDPA 4HMEA 1JNEA 1OIFA 2VX7A 1XD0A 3OGRA 4PMOA 3DX4A 4AMWA 2XJ7A 1GONA 1JFHA 2XN1A 3MSGA 1E4IA 4NSBA 1A3HA 2PB1A 3WUEA 3VOCA 1OGSA 1W1VA 3M7SA 1P6WA 1KCLA 3PZVA 3PBGA 2C7FA 1MW1A 1CGTA 1V3LA 3D5HA 4EK7A 1EIBA 1W3KA 3NDYA 4PMQA 4M82A 3GNOA 1EXPA 3DHPA 3NDZA 2BY3A 2UY2A 3T2PA 4WSJA 2XGIA 4UQBA 3B8SA 5I0DA 1CECA 1HJSA 4W84A 2A3HA 1WKYA 3B9EA 1JFXA 4W8AA 3WDHA 1SMDA 2WHMA 3F5KA 1BYAA 4TUFA 4ATLA 2EAEA 2WVVA 1JZ3A 3EDEA 3EBVA 4ATWA 1C91A 3N1AA 4AD1A 1ZS2A 3OG2A 3WUBA 3AICA 4A4AA 2TAAA 2V5CA 1XGZA 3JUGA 4F8XA 3VSVA 5FL0A 1R7OA 2DPEA 3DDFA 1UR1A 3VNZA 1GJWA 1UHVA 4JHOA 2WMKA 3APGA 4P8XA 5LA2A 1BG9A 3K1DA 2PI6A 3AIVA 5I77A 1KGWA 1UD5A 3UG3A 1V0KA 2J47A 4TX6A 4PTXA 2WW5A 3UR7A 2XVKA 1SMAA 1VAHA 3EMCA 4FNPA 1E6RA 4P7QA 3RPMA 2WK2A 3L4YA 4B15A 3NUKA 3FY1A 2VI0A 1GUVA 2WMGA 1B3XA 5ECUA 1R75A 5A6AA 3TONA 1UKSA 4YPJA 5M5DA 2J25A 4NXSA 3HN3A 1D3CA 3BVWA 3ARTA 1WZMA 3VM5A 2YA1A 4J28A 3IANA 3VDAA 2XVGA 2J4GA 3SCTA 1KR1A 3U5UA 1ITXA 2DIJA 3WN6A 1WP6A 2GJPA 5DFAA 2A3AA 3PN8A 1B30A 4HA4A 1EHNA 3LPPA 4CKQA 3S6TA 1JXJA 3MMUA 3UCQA 1Y7VA 4W85A 5JIWA 4L4OA 1BYCA 4KMQA 1MXGA 3VIJA 3AMDA 4S3KA 1V02A 4OUEA 3CZLA 5IXEA 3T0BA 2QMKA 1JI1A 1UYQA 1X1NA 1HWWA 2O92A 3WKZA 3K8LA 4KRUA 1V6UA 3O2LA 3DYOA 4MJ2A 1NWUA 3NCOA 1B0IA 4AZ6A 1NP0A 2O9PA 2VURA 1DP0A 5DEZA 1H1NA 1LWHA 3PTQA 1H2JA 4DUWA 3K4DA 4Z2IA 1J0YA 2VL4A 4CN1A 3CH9A 1C8QA 1RP9A 4IPLA 4GO8A 2AOSA 3J7HA 3ZO9A 2WC7A 1XYZA 1E70M 1TQTA 1EHAA 3AIQA 4ZE5A 4RE4A 5GQBA 3T2QA 3VIIA 2BVTA 1OM0A 4HMDA 3MUIA 4W7UA 1KGXA 4JL2A 1KXVA 3ARXA 2D3NA 3WEMA 5HXMA 1KCKA 5D8WA 1H0IA 4AD4A 1J18A 3ZIZA 1K6AA 5AC4A 1UKQA 3BAIA 3BGAA 3CZNA 2XM1A 4W8BA 4YHGA 2J8FA 4GIAA 5BXRA 3L4ZA 3UEQA 1UR2A 3WDPP 2J7EA 3MU7A 2J79A 4KWUA 1RPKA 1XV8A 1EOMA 2Y8KA 3GXFA 1NQ6A 1UQYA 2YFNA 2ZXAA 2EQDA 4H41A 3G6LA 4ZENA 3CPUA 1UWSA 1V02E 1UZ4A 2C0HA 4HOWA 4MDOA 1JYWA 2NW0A 4PMXA 4XX6A 3SUTA 3CHFA 1BFNA 1OGGA 2X2YA 3PZTA 4PCTA 3MMDA 1E5JA 5A8NA 1GCYA 2VVSA 1C8XA 3II1A 4H7VA 3D4YA 1KBBA 3AS0A 1AVAA 3VUPA 1WDPA 1XSIA 2E8ZA 2VCBA 2JIEA 3ARQA 3VIPA 4B3KA 4CU6A 4JFVA 2J7BA 2YBUA 2PWDA 4GXPA 2VQTA 1Q6DA 3IK2A 1NM9A 1UWIA 3I3DA 4LXFA 3VTRA 1C7TA 1O7DC 2JF6A 4FLRA 1GOMA 1Z32X 5E0CA 2OW7A 1EDQA 4ATDA 2QF8A 2WC3A 1MYRA 2WVUA 1LG2A 3LRKA 3WD1A 2JALA 3QOKA 1QHPA 1ODUA 5CXPA 5FOOA 1HXKA 1VBUA 1UWUA 2QV4A 2O9OA 3SURA 4QLJA 3TA9A 3VIGA 5A3HA 5GNXA 4PMVA 1CWYA 2WVVB 5A6BD 3ARPA 1VEPA 2O9RA 4JFTA 1QNRA 2X8RA 1GOQA 3TP4A 1U30A 3KZSA 3BLPX 1UZ1A 1VENA 2VVNA 1DWFM 1EH9A 3AS3A 3MO4A 4EE9A 2CHNA 1E4LA 2CXGA 2ZUVA 1KQYA 1JGIA 1M01A 1OD8A 4HU8A 3TTSA 1JYVA 4BQ4A 1W2PA 1M03A 1CXLA 4OIFA 3IJ7A 4DUXA 4B9YA 1NWRA 3BUIA 1W3HA 3WH8A 5DF0A 1JG9A 1QI2A 3O9NA 1LJYA 1E4MM 5ABFA 3DX2A 1HKIA 3WDIA 2EJ1A 1ISVA 1J10A 4MB1A 5IFPA 1ZU8A 1V6YA 2BNJA 4CVWA 4AZCA 3THDA 3VVGA 3BVUA 3A23A 3WF2A 2ZWZA 4F9DA 2J7HA 1PZ2A 4JFWA 2CEQA 1NWSA 1QI4A 1J0HA 1GQKA 1S46A 3IJ9A 1EOKA 2EPNA 4UFMA 1UR4A 4BQ2A 3VILA 4JCLA 2EPMX 4PUEA 4AWEA 5JBEA 4TTUA 1OWQA 2VX5A 3CTTA 3VKKA 3UERA 1PX8A 2DT3A 3L2LA 3WY2A 1U33A 1UH3A 4J27A 3DDGA 4GQQA 4D6IA 1BLIA 1QW9A 3SUVA 1XH1A 5HPOA 1XD1A 2VZOA 1ISZA 3VD4A 5E0FA 2BVYA 5CLTA 2XUCA 4D6FA 3BLBA 3MKKA 1QWUA 2XVPA 4YN5A 1UKTA 3KE0A 4W7VA 3CZ8A 2ZOXA 1W9VA 2XWEA 5FIPA 3W25A 4JL1A 3DHUA 1ISXA 4AD0A 1G1YA 4LYRA 2WSKA 1GPFA 4CD5A 2D0GA 1GJUA 3D50A 1W1TA 5GPRA 2EBNA 3EDDA 1ISYA 2B31A 3DX3A 1E55A 4OBSA 1BVNP 1E6NA 2J8GA 1ZJBA 3VMOA 2E0PA 1CZ1A 2D20A 3W28A 2ZUUA 4IPNB 3TOPA 4P7NA 1FH8A 1GOOA 2XVNA 3MUZ1 1J11A 1W9BM 1KQZA 3O6AA 4LYQA 1TZ7A 3ARWA 3BAWA 4FK9A 3U5YA 2CHOA 4HZ8A 1MXDA 3AMGA 3GXPA 3GM8A 3DX0A 5CSYA 3VX1A 3WUGA 1WB0A 4M56A 3CLWA 5A6MA 5I78A 3VMNA 1DWJM 1V3KA 1WE5A 2W63A 3UR8A 1UG6A 1US2A 1QHOA 2YA0A 4CD7A 4JZ5A 2A3BA 2AAAA 2WHKA 3HU7A 3BAYA 5I5RA 4U2ZA 3BMWA 4HA3A 4AD3A 2CCRA 4Z2JA 1DEDA 4UOJA 3A4AA 4ACZA 4PMDA 4UR9A 4DM2A 3ARZA 1B3WA 5A95A 4AXNA 1DWHM 3RM4A 4S3JA 4E8CA 4F66A 3W38A 3WNPA 1QNSA 3W82A 4EKJA 2ZWYA 3CZEA 3VGEA 1HL8A 1HNYA 5IFTA 4J3VA 3KWXA 1UOKA 3ZQ9A 4PYSA 3WL1A 3UESA 1KXHA 3AMKA 4LQ1A 1CGYA 2GJXA 3MUY1 1DWIM 2BS9A 3L2MA 2DEPA 3SUWA 5A6BA 2F1BA 4NRSA 1W9PA 4AZ7A 3FHQA 3DC0A 3L4TA 5BXPA 1E56A 1K9FA 3QHMA 2YA2A 2QLYA 5BROA 4DO6A 3A4XA 1CLVA 3KLKA 3ARYA 2Y4SA 1FP8A 2FDMA 3WIJA 3ZJ7A 3L4XA 5CJ5A 3T09A 1KGUA 1MW3A 2V3EA 2G3JA 1MQQA 4FMVA 5JBDA 1J0KA 1QPKA 3VO0A 2WLZA 4B9ZA 2VZSA 3ALGA 1JI2A 2YL6A 1HF6A 3RO8A 4LX4A 4NF7A 3AZSA 3DX1A 3F5LA 4AZ5A 2YLLA 1B3YA 1ZBCA 1WCGA 1QX1A 2DSZA 2BY1A 1E3XA 4DWSD 8A3HA 1UH4A 6TAAA 1WAWA 2VJXA 1E3ZA 3UG5A 5I23A 1XCXA 1GZJA 3DYPA 2E9BA 3RCNA 4ZEPA 3PTKA 4HU0A 3GYCA 4WSKA 3GZAA 1TVNA 3SCPA 3S2CA 1M04A 1E6PA 2WCGA 3N9KA 4P8UA 5A8PA 2PWEA 3GXNA 1E0VA 5A1AA 4Y7EA 1FH9A 3HJEA 4AD5A 5IHRA 1LL7A 1XH0A 1XRVA 5BWFA 5ABFB 4MB4A 4NRRA 4BCEA 4AZBA 4FNUA 3A5VA 4U2YA 4CGTA 1GORA 1R46A 3UG4A 5CPTA 6A3HA 3OZOA 1QI0A 4ZXLA 3FNDA 2YDSA 2X2HA 2FHFA 3OGSA 2WC4A 2G3NA 4AZCB 1ZL1A 2DDXA 4AC1X 2NT0A 3BXWA 4NX0A 4JCMA 3VGBA 1VIWA 5HNNA 1GNXA 3N13A 3W53A 3WDRA 2VO5A 4HOZA 1CGUA 4CD8A 3OIHA 2Y8VA 1GHSA 3NIYA 3VMPA 1JZ5A 3T0AA 4A3YA 5FCZA 4U31A 5EFDA 2IXUA 2RGMA 4QCFA 1LL6A 3VD5A 3F4VA 2YL9A 2WM0A 3VPLA 2DSVA 2GJRA 2FH8A 1WZLA 3VGHA 2WXDM 3MMWA 3W24A 1R86A 1EA9C 1CBGA 1TA3A 4WKHA 4LPCA 1GVIA 2OSWA 1CLXA 4Z2GA 2YOCA 3IGUA 3S5YA 1WNOA 5HBFA 1UA7A 4NZJA 1H41A 3SCUA 2D0HA 4AEEA 2ESCA 1BQCA 1K9TA 4FNQA 4CN4A 2CITA 1IV8A 1CIUA 4MNKA 2NT1A 2JEPA 4AMXA 2MANA 5CGMA 4AZIA 2CKRA 3ZT5A 1VB9A 1AMYA 1FH7A 1MVYA 2G3IA 4W87A 1FA2A 2X1IA 3WD2A 2ZICA 4CU8A 3BCFA 2CBIA 3AHVA 3GNPA 2WPGA 1E0WA 2EEXA 4H04A 1R85A 1MWOA 5CGTA 2W66A 4W7WA 2YL8A 1W9XA 3BH4A 2VR4A 3VM7A 4NI3A 1XH2A 2VZUA 3WMCA 1OBAA 1DWGM 2GFTA 2ZUWA 2FGLA 3RMEA 4DM1A 2WVSA 4AIEA 4PTVA 4MTVA 2OW6A 5A6JA 2XSBA 2CNCA 3AHTA 4GKLA 4X0VA 3LPOA 1CXEA 1G5AA 3CZJA 1E6QM 4D6JA 3M07A 4JIEA 2V5DA 3BAKA 2WAGA 1E4NA 2W62A 4D72A 1L0PA 1ESWA 1V6XA 4KRTA 3A47A 4DO4A 3U57A 1OB0A 4D6GA 1RP8A 2X2IA 3AHXA 4ACZB 1ODZA 4UQCA 1UD3A 1E6ZA 7A3HA 1PIFA 2OSXA 4GI6A 2X09A 3QGVA 2D1ZA 2BHYA 1JZ2A 1W1YA 1QNOA 3OLEA 4PMNA 1Q6CA 2VRQA 2Z1KA 3ALFA 1OCQA 1CNVA 4P8WA 2XSAA 3B9DA 1RD6A 1AQMA 3VIOA 3VIFA 1AQHA 1TQWA 2GJXB 4QCEA 3CUFA 4PMYA 3A4WA 3U7BA 5BCAA 5DO8A 2VRJA 2F61A 4D6EA 3T0DA 3ZM8A 2BV9A 1JIBA 1TE1A 1H49A 4GO9A 4ML4A 4WKFA 5DMYA 1QNPA 3PZIA 1BTCA 1W9DM 4WF7A 1VFUA 1NOWA 4PRWA 1V08A 1FFRA 4P8VA 5CSUA 5CZKA 3AHYA 1QVBA 1ZBWA 3WY4A 3HMCA 4CCDA 2FYVA 3SCSA 2E8YA 4DWSA 3AOFA 4AIOA 3LXAA 1X6LA 1KB3A 4OKDA 1KTCA 2J7DA 1R8LA 4GPNA 4A3HA 4AEFA 1NH6A 3CO4A 2ZXBA 2AMGA 3CUHA 4UQ9A 1WZAA 3B9AA 4U5KA 2WANA 1FHDA 4QLLA 5LYRA 2WSPA 1B31A 2A3CA 2UY5A 5GNZA 4WKAA 2WZHA 1TVPA 1E43A 2OWCA 2J74A 3AZTA 5C8BB 1E1EA 3I3BA 5AY7A 3VDBA 5E1QA 1JXKA 3LX9A 2GUYA 4PEEA 2BY2A 1EO7A 1M7XA 2XIBA 1K9DA 4MAVA 2X0HA 3E1F1 1JYNA 3DYMA 4TVUA 4CD4A 1CXIA 5GNYA 3HG2A 1ITCA 3BSGA 1J0IA 1CXFA 1BGGA 4BA0A 1NP2A 1HP5A 3OBAA 3TTOA 2E4TA 4W88A 5M3WA 3WDJA 3VGFA 2BXZA 3NSXA 4UZSA 2ALWA 1CGXA 4J3SA 3PZ9A 4J3WA 4FNRA 1V0MA 1JDCA 1H11A 3CUJA 1KWKA 1J0JA 2G41A 3KL3A 1EDTA 2V3GA 5E09A 2CESA 2PWHA 4MB3A 4FLOA 2DT0A 3CIVA 1BPLB
chains in the Genus database with same CATH superfamily
4D0CA 1G7PA 4KEVA 3U83A 5E8OB 4AIXA 3W7KA 4IJBA 3O3BB 2G5WA 4LSRH 1H0GA 5TQ2H 4QHUA 3NJFA 1T3FB 2VSCA 3EJUA 1T6MA 4OOUA 2FIRT 5AZEH 4GYBA 3MUHL 2OXGB 4MFDA 3QUZC 3WK0A 3PPFA 3C87A 2IFGA 3MRLA 1Q6FA 3W02A 3RWFB 1TWIA 2F2HA 3AXIA 3DUSA 4LBSA 4HZMA 3VWKC 1ACZA 4QPEA 4JE0A 1YN6A 4A68A 1E1CA 5CPLA 3UJEA 5D8ZA 2GPZA 4S3EA 3KTCA 4GMTH 2UYLA 4BI6A 1S7RB 3T6VA 3K6OA 1GGTA 1U8OA 3LHPH 1V5XA 5DJ8B 1W31A 3OBKA 3FAXA 4Z78B 5J06A 2BMBA 5EBWA 3FO9A 1LL4A 5DUPL 2ARJA 1BOYA 3LZFL 4Q7BA 1E28B 5SX4H 1IR1A 1YEIL 1WCBB 4RXFA 3BESR 3TO4B 1P53A 3FRUA 3ZKXC 5DK0B 4A3QA 3OSVA 3QJFB 1KENH 2G3FA 3MYOA 5MF5A 2H6OA 3AQUA 5FEPA 5D1QD 2MTAA 2VEKA 3RUGA 5D5ME 5AN7A 2BCKB 4MMYB 2VD8A 2HRGA 2Y7SA 1F4HA 4NLHA 2F7IA 3UZXA 5D1ZI 5L9DL 2PDYA 3QRHA 1N6VA 3CMJA 1NDMA 2F1EA 6ALDA 3HAEG 1ACXA 5J5EA 2ZKWA 5F7UA 4R3UA 3NZUA 4ZSTA 3GI8L 5I24A 2Y36L 4FG6D 2IV8A 2VFGA 3RPTA 3CUGA 3HG1A 1MCFA 3UP8A 4AISA 1ETJA 5DVNA 3ZFHA 1UM5L 5DCDA 5ENLA 1YQ2A 3NJHA 3KWWB 4PC8A 5JYLA 2ADIB 4IKJA 3HGSA 4IFKA 2W92A 4FEIA 2HA1A 3DXAD 3F7QA 2JGQA 4LWWA 3F7YA 4MNHB 3CL7A 4Z0XA 3MFFB 2CDFA 3WYZA 1T7VA 1X38A 3AIEA 4ENED 4JFED 3ZZ1A 1SSDA 1G1KA 5L6YH 1SEQL 3BAJA 1AI1H 1FWBC 1W5PA 4DGWC 3HFFA 5E2WH 1BYDA 1LVEA 3G5VB 2PF0A 5TF0A 5LGKA 3ISYA 6XIMA 3NCYS 1IBBA 4XP1L 4KZDL 3ZTEA 5K1NA 1VERA 3TYAA 3D2UD 5C3TA 1R24B 3FUNA 3IARA 4YVNA 4BFIA 3CFUA 1A7RH 3TH4T 1CE6A 3MJ8B 3WLLA 2VC5A 3NM1A 3HN5A 3L9RB 3TBBA 2E6FA 2C7UB 4GQBA 3B2XA 1VCFA 1D8WA 2TRHA 2OG9A 1WTLA 5CCZA 2QCEA 3W39B 5DZLA 2DSKA 1ZGDA 1I9RH 2DQFB 4OCNC 1NOUA 3PZQA 4NOBA 4NAFA 4X8GA 1GTNA 4QXTB 5HYJD 1F4YL 2NVAA 1A6TA 2VO8A 4MVBD 1XH3B 3X1BA 1AL8A 5IJCC 1EO8L 1BZ7B 3RA7H 1UADC 1PVNA 1OPOA 1A80A 2FWOA 3D9AH 3HB9A 2W67A 3B2MA 1I2OA 4WUIA 2D0FA 3VZYA 3QIBB 4FJ6A 1G69A 1YPZB 3U30C 4IOSA 1OADA 5LBVA 1KLYA 2NLJB 5JW4N 4OZFG 4GI4A 3K1KC 4LAQH 4U6YB 2F74B 2N1KA 1QTPA 1TPB1 2R27A 5EFFA 4YDLC 3NA4A 4JUSA 4PUDA 4NO0D 2DT1A 1NGWB 2YZ8A 1IFHH 4X5XA 1CFSA 3DVNB 3ZKMC 5ITBH 2VH5H 3EOEA 1TR1A 3TN0B 3T8VA 1HH6B 2X4OB 5C0BD 1RH8A 3CUXA 2DH3A 2Z35A 1TU2B 4ZVJA 2HWGA 3JSSA 4Z7WE 2DM4A 1IQDB 1WBJA 5K1VA 3MPGA 3BE1H 1A7BA 4AM0B 3I9AA 1KCXA 2P44B 2BSTB 1XR2A 1F4WL 1KCSH 2I5YH 1B6UA 5IG7B 2YBTA 1MVUB 4BFFA 5EBLA 2EO7A 2A9BA 4XVSL 3ZLHA 3FUHA 2WBWB 3T07A 3LQZB 4NNYA 4A1RA 2ENQA 4FX6M 3O2WH 3RQ3A 1QOKA 2Y7MA 5FUCC 1FZMB 3SGDI 2IAMA 2QIWA 3NVQA 1CT8B 3CMOH 5JBFA 4LHQB 2O61A 2FSDA 4C8XA 4DP1X 4E68A 4OTXL 4HOXA 4FEZA 2DLHA 4ZBJA 2Z7GA 2H0JA 4OIIH 5JXEC 3IFPB 1L7IL 2OO0A 1PW3A 5K9KB 1BQKA 1A6AA 4JM4H 5JVLA 3L1OL 3EXSA 5EMLA 4EANA 2P4AB 4AE1A 4XHQA 3E74A 5F7LB 2C8NA 2G75A 3K81A 2DN7A 2P3EA 1PBGA 2XQYA 3UAJC 5E8EA 1PB0A 5DD3H 3QMSA 4DKFL 1QYGL 7FABL 1F3JA 2W80C 4JKPH 4BHYA 3OB8A 1K4CB 2GVYA 3PF3A 2VC6A 3IJHB 3RU8L 1L6FA 1TTIA 4JY4B 3L13A 3CSPA 2Z31C 3X1GA 4AQAA 2Q2EB 3FFDB 1RUML 3GBEA 4OGAC 3W1UA 4OLUH 1AGBA 4D1IA 2M26A 2VDOL 2Y7DA 4CDGC 5E8PB 3ZE2B 3OGCB 4DPAX 1ZA6B 2X3BA 1R3KA 2GPTA 2FHBA 3B83A 1WDSA 1RZKL 5JORA 2KERA 3LUTA 1VSCA 3BKCH 5I18H 1Z7JA 3LKQA 3CHRA 2I9TA 4JX5A 4WWNA 3QUYC 4YZFF 4E9YA 4XAYA 4M6MH 3PB0A 5EZOL 5DD0L 3MC0A 4X6BB 1RMFL 4AMKL 2KT6A 3ICJA 4Y1AB 1FE8H 2NW3A 5AKVA 4N8VA 2VXVL 3PZUA 1H4PA 4A2FA 4LLAA 3HIZA 1A5NC 1YEHL 1QRKA 4DGVH 4FN0A 1J5OH 1PJ9A 4BFRA 4HBCL 2XZQL 4PLJD 4IKNA 1R9ZA 4AU0A 1OP5K 4XZBA 4PS4H 4OZIA 3C61A 2DJLA 2NY6C 3HRZC 4E4FA 4H8QA 4LVDA 1IVTA 4YBHA 2XBZA 1F3DH 4LLWA 2X05A 2YD6A 3AUWB 3EH5B 3PDGA 4PW4A 3HC4L 3NO1A 3GUTB 3MDUA 4BSVA 4GNVA 3FQRB 4S3CA 4LDCA 3NO3A 3R8GA 1K6QL 2CO1A 1HOCA 1Z69A 3QNZB 2DORA 1F6AB 1DQML 1FWFC 4YTTA 3ARUA 3GY1A 4DBDA 1MFAL 3BW4A 3ZE1E 4YDJA 3R11A 3SY0B 3HGOA 4PGCA 1EYEA 5JOEA 5D7EA 2EDHA 4HXBL 3KLLA 3KLSA 3B8YA 2XTJE 4AMWA 3GMNB 5L7XH 1KB5B 2G60L 5CAKA 3D39E 5IKCA 4XNXH 1QT1A 2E7DA 4X9GA 2Y1VA 2TSYA 1W1VA 1XR9B 1QSVA 2PYEB 3VXRB 5AOIA 1QRQA 1GT8A 4ZFGH 4LCWE 3S42A 1OP4A 2FIKA 2D7TL 5C0DB 2DS4A 3MUJA 4NQVB 4L1GA 4W8AA 1J1OL 4QRBA 3OG2A 1IXPA 4I13B 5FL0A 3VNZA 1UHVA 4UBPC 1CI1A 1NZRA 5IBTH 3L65A 2P8MA 3M17A 3EW3B 2CHWA 2R8SH 5CCKH 4E41E 5MERA 3GS7A 4X6DB 3RFZC 3KBPA 2WWMD 3MLRL 3FH7A 5HJBA 3B1UA 3B8IA 4JY6B 4R5XA 4WCJA 4A38A 4ERSH 4TQIA 3N42B 3FTGB 1UYWL 4JFDE 3M8OL 5HPMB 1GKOA 3NDZE 5D1QA 2YC1A 3SGEH 2Z27A 4XTIA 4F7KA 5J13B 4RMWA 1TJPA 1NWUA 2P5WD 3SD5A 3VXNA 4W81A 3EA2A 2BWDA 2ITDA 3NAAH 3H3PH 3DFNA 2QCNA 2QPEB 3MCKB 1EC8A 4P57A 3V5KA 1NFDE 1TMCB 3KBJA 4Q9RH 2ITCB 4MM1A 1IE7C 1YEJH 2NV2A 1U93A 3BLLA 5DT1L 4AD4A 2W5PA 3ZIZA 1WTGT 4YXHH 1IUZA 3GTIA 2I07B 3BAIA 3BGAA 3O3UN 1EC7A 2XM1A 1QTWA 1SM3L 5CD3A 4Y9EA 3C0LA 5C3IA 2IKIA 3VXUA 2QSVA 3ZZQA 1RPKA 3W70A 3DXAA 5HJ3A 2H5UA 4TUJB 5F1SA 1KPVB 3HBLA 3EO0A 2BX7A 1EEYB 3VOIA 3LLFA 2REQA 5PTDA 4HA0A 2CO7A 4JIQA 3UROR 3ET9F 4JFEA 2VVSA 4NY2A 2P5ED 4YR6A 5CBEA 1YEEL 3ITGA 1ZLDA 3NESA 3E8UH 1A14H 1WAAE 2YBUA 3FQXB 4NM8L 1R6VA 2Z00A 2VABA 3QXAB 4GNJA 3P61A 4LC8A 5D6DC 3HTLX 2YGPA 4N90E 8TIMA 4XNDA 2ITFA 2F53B 3I9PA 5I6XC 2ATKA 3RNKB 3BWSA 4NBZB 5FOOA 4FFZL 3GMQB 2O9OA 3QUYB 3T8XA 1ODAA 1RI8A 2EEBA 3FONA 4MJIA 4KEUA 5ABDE 5E23A 1VENA 4JPSA 2UVFA 1D2PA 1GZHA 3NEHA 4C1NA 1Q0EA 1AE6H 5HYJA 1UATA 1W8OA 3EAUA 4E5XG 3QQ3B 3SGJC 1PZ5B 2EDBA 3CWOX 4PBXA 3CTLA 3PBVA 4ZS6C 3NZSA 4RSYA 5DF0A 1JG9A 3NL6A 5G4MA 5I1CL 4ODWB 1XF5A 3GU2A 3DO7B 3FUFA 3HRZB 4K1GA 4K9JA 3BIAX 2EJ1A 3U4BL 1ISVA 3DFHA 1DJGA 1B0RB 4CVWA 5I8EA 4HIBA 4F9DA 2QJJA 4PWJA 4ABVA 1M7JA 3I6TA 4JRXE 1PLBA 5EC2B 4BQ2A 4KI5E 4F33B 2HSAA 4WO4D 1J8KA 1CBVH 2APSA 4ODXB 4DSYA 1VH7A 5CHNB 3MUGB 5EPMB 5FW7A 3QJSB 1QEWB 4FIQA 4PJ9B 1ISZA 1HC1A 4R5TA 3A5FA 4GIEA 2AJZA 3GYRA 4L8CA 4HJWA 2ZOXA 1GYVA 2XZAL 2DZWA 4AGNA 2L8AA 4J2QA 3RDTB 5C0BA 5FIPA 3W25A 4QNPE 1MCSA 2QGYA 4CD5A 3TZFA 3OB0H 4LARL 4TF4A 3H9YA 1A5AA 1IGIL 3O6AA 1IM3D 4F7TB 4ZFQA 5FYLH 3W22A 4QOKD 2D2GA 4NO5A 4ZTEA 2UXVA 4M56A 4Y2LA 4GRWF 1UJ3A 3QUMB 2ZZ2A 2VLKB 1WE5A 1R3JA 5FKPB 3KOWA 1H6EA 2W9EL 3HTWA 1RZ7H 2IXQB 5C9WA 3W7NA 1Q9KB 1BEYH 3HFMH 4KTDH 4CEXC 4AD3A 1LO3H 3D4GA 2V30A 1DWHM 4E8CA 1OIOA 2IWFA 4JPWL 4A6YB 1SVCP 3CSYA 3WNPA 3NN8A 1IGJB 4GXVL 3KLHD 3MQTA 5ADOH 2Y7GA 4UM8B 4IS6A 4LU5L 1M5WA 4HEPG 2BS9A 2AC0A 3SDXB 5C0AA 4H25A 2F1BA 5IBLC 4B92A 4FE9A 3FQYA 4C56A 3VXGA 4XCFL 4LSRL 3SJVD 4RFOH 3WIJA 2IEPA 2AGJH 2IDQA 3S8GB 3EXLA 4MG4A 1HGWA 4B9ZA 1DJSA 4CQ9A 4P5UA 2AL2B 3W11C 3S0PA 2A4ZA 5AZEL 3DX8A 4DWSD 2XH0A 2VERN 4Q4EA 2AW2A 3UG5A 1H6UA 3C6LA 5I23A 2ZOUA 4W6WB 4ZEPA 5DJDB 4POZC 2OX1A 3AB0C 3P73B 1RSFA 4J39A 2CCVA 5BWFA 2B08A 3AM8C 3LI1A 1MNNA 3A5VA 4U2YA 6A3HA 3OHXA 5IW1A 5INCB 2IPGA 1M7OA 3AU2A 3IACA 3QEQE 4Z42C 5J56B 3U2OA 2EG7A 3ARFD 3B4NA 2NZIA 5EN2A 5KYNA 5HNNA 3Q44A 3RPIB 3NQBA 2FX8H 3UBXG 1GPOL 2I25N 1ZV2A 1GKPA 3LQAL 2OJEB 2RGMA 4LSTL 1PLCA 4UU9A 3FUJA 2YL9A 3FDWA 1DBAL 3U9UA 4GEJA 3QVQA 3IIVA 2PDLA 3S5YA 2KDGA 3C6CA 3LKOA 4Q7IA 1SGJA 3PFUA 1NBYB 5HHXL 3UO8B 2B8OT 3AREB 3KYKL 1KENL 4GAGH 1FVPA 5I06A 2E77A 5HBBA 4I18C 3FQTB 1L9OA 3AQXA 4HNOA 2FZMA 5CP7B 5KYXB 1TO5A 1ME8A 2FX7H 4W7WA 4QS5A 4FX5A 2QR6A 4PRNA 1CURA 1W9XA 4AHQA 4TRPH 5IBXC 2B5IC 2ZUWA 4OCLC 4PJHF 5JPMB 1UIPA 4AIEA 1XXDC 3TKFA 3OC5A 3PL6A 4XPTL 4YSDA 5HQLA 3CZJA 1MRAA 5LNDA 1Z66A 1F1AA 3APTA 3UOAB 2HG0A 4D6GA 4BF9A 1E6ZA 1AZ2A 2I9EA 1JHLL 2X09A 4GO6B 4HSAC 2XH4A 1J96A 1X5KA 3V5DA 3OLEA 2VIRA 3O45A 1Z89A 4HS6A 4JFFB 4Q4RA 3BHBB 2WXFA 2BIIA 3TCLB 4QRPD 2NXZB 1OGPA 3WTXA 4PREB 2GDQA 1IXQA 5I6NA 4ML4A 3EOLA 3ITTA 3BDBA 6ENLA 3DVFA 1RULH 3CQ0A 3GZPA 4WTXA 1JEZA 2DQWA 4N4PA 1D5BB 3CH8A 4KVPA 3RGVC 1NH6A 4G7QB 2H4EA 3U36B 4JDZB 3RZWA 4GSUA 1XLLA 1JPFA 4BQBA 2UY5A 4GRLB 3C2AH 5TDOB 4MCYA 4KQ4H 1TVPA 4I2XE 5FYKD 1R5WB 5C3LD 1A7RL 3VRIA 4MXWH 4PVLA 3DTUB 4RFEA 5L9DH 1HQRA 3XIMA 4ZMPA 4O2CB 3RL1B 2BOLA 1I9RL 4W88A 1FWRA 2BXZA 3NIGE 3L5HA 3OPSA 5D2NA 3IE9A 2GUBA 1FV1A 5FF0A 1FNFA 3IMRA 3CUJA 2ENYA 1EDTA 3JS3A 4R7DA 2GBVA 3G6MA 3VA2C 3RPKA 3MT1A 3UAEA 5ANMB 1N67A 3D9AL 4QTHB 4PJXA 1YVLA 3MSYA 1TTGA 4V28A 4WFFE 3TQVA 4U3AA 1ZXKA 3O8AA 3QR3A 5DQJB 4OI9A 2DF3A 2WZ5A 2P5WA 4LAQL 1ZBKA 3B9OA 1X5MA 2GW5A 4JAMA 2BNQE 5JIKA 1IFHL 2IBBA 2VH5L 1QHQA 1XG3A 3PU7A 1SEQH 4Z7NB 4LRIC 4XKYA 2PWGA 4LYKA 4KJYB 4PRAB 3L0NA 1FFTB 1T1XB 5F93C 2PDPA 2VN6A 3FTXA 4KNSA 4KZDH 4ETQA 2PD5A 1P7QD 5I6KA 4DUOA 3LHTA 1KCSL 5CBAB 2I5YL 3BJLA 3OKDB 2X4NB 3S35X 4MJ4A 4NP4H 1Q6RA 3O2WL 1MCIA 4HJ1A 3T55A 3N4AA 3N15A 4Q4IA 4WKZB 1QATA 2RDWA 3A13A 1O5RA 1HHGB 4I5XA 2PZ0A 1GQIA 2P7TB 2GJNA 1F4YH 3OKYA 2P5EA 4NC1E 3AB0B 5MHBA 1DSFL 5CJQL 3KH4A 3MRNB 2AK1H 1EO8H 3C60B 2CO2A 2BNUA 5CPMA 4KJPC 1VGEH 4B3LA 1X6NA 4TQ8A 5FEBA 4NHUA 2BWIA 1K9EA 4LL4A 5C5YA 9RUBA 2EG8A 1PZCA 3QI9D 2Y24A 2FVKA 1IM9D 1B3VA 1MOEA 3K4ZA 5HGHA 1AKJD 2QJHA 3WJJC 4TX9A 1V7YA 1C12A 3X2QB 4JKPL 1UWAA 3TA3C 2RJMA 5K9QG 1XC6A 3NZGA 2VC2L 1N5AA 1PS3A 5IB5A 5CNHA 5HJDA 1C8YA 4G59C 4XMKH 1GYNA 1B2YA 4FXSA 1V3IA 1M6OB 3U2JA 1FWAC 4TMBA 2AITA 4PJ8A 3FK3A 1PYFA 1J8HB 4GJTB 4KH9A 2B9AA 3BWUC 1QTSA 4CDHA 3QNXB 1G7HA 2CBMA 5FLVA 1RJPA 4H4IA 1NFKA 4IJRA 1SJMA 3S2LA 4H88H 3QMRA 4S1FA 3WQWA 5I18L 1GHRA 5L4IA 4WO4A 2YRBA 5FGRA 4O8AA 3OKEA 5HGAB 4V2CB 2JKIS 3BUQA 1NSJA 4M6ML 5AWNL 5I75B 1SJXA 3LQLA 2CW6A 4P59L 3KVLA 4P2CG 4FLSA 4OTXH 3TASA 3N1PC 2P28B 5HHOE 4Y1SA 2KUTA 4YO0A 1THCA 4DGVL 2Z1PA 2NQDA 4GY1A 2Y70A 3L1OH 3VQ2C 3BKJH 3UTZB 1MH5B 4Z7UA 3SN4A 5A2JH 1IM3A 5XIAA 2YEQA 1AG1O 3FU7A 4XBJA 4PJAA 2BGQA 2BW4A 4QOKA 2PDJA 4O51A 4RRPM 5CSRA 1F3EA 1ZHBA 3EG9B 4DKFH 1QYGH 2NSQA 5BRZE 1T2QL 4HB7A 3CFNA 3RU8H 3HPZA 5IQMA 2WTOA 3UWUA 43CAB 1TT6A 1HXYA 1RHHA 1DUZA 4J3ZA 4W5UA 3FRPG 2F5BH 3S5SA 1HL9A 5H2ZA 1VBGA 4DYEA 4TOQA 5D02A 1SJBA 3W26A 2P3ZA 2VDOH 4U28A 2P49B 1GPWA 3GDLA 3UWVA 3PP3H 4GXFA 3W9DB 4CC4A 3PJNA 1I8MB 3WNNA 4O14A 3TQKA 3VOHA 4ABWA 2QULA 5F1KC 1MCCA 3BEVA 4FXLA 4PJDF 1MW2A 3JTTB 3SJVA 2AGTA 1UENA 3P4LA 1VFOA 4R7JA 1G4TA 4A3RA 1JUFA 1UASA 5GJNA 5L7XL 5E5UB 5DD0H 5KEZA 5H94B 4XNXL 3WELA 3RG6A 1RMFH 4AMKH 2XIIA 3S46A 3TZVC 1BGXH 2VXVH 2I7GA 4I4WB 1NC2B 4ZFGL 4E0RB 2WOBA 3NVDA 5FF2A 4QE1A 4MJMA 2FWSA 1LF1A 4A6GA 3U6XS 2X42A 4P3CL 1K85A 2XYBA 2AQRA 3H4FA 2AQVA 5EHFA 4IYKA 1F1DA 4KKBC 1P5VB 4XSLA 2IPWA 3H9ZA 1T21A 3RX2A 2XVBA 3OZPA 1R3QA 3VD3A 1XHGA 2QQNL 1P7TB 3ARFA 4L4MA 4RWYL 4DJED 5IBTL 3TWBA 3V75A 2R8SL 1AJ0A 3QORB 3P30L 4XMUA 1DCEA 1NEYA 4OCMC 1HGYA 5IJVA 2HKAA 4Q7NA 1WA0X 4PLOB 3VINA 1REQA 2ZQKA 4ERSL 2IC2A 5BW7C 2J8UA 1U2YA 3G1YA 3Q13A 3FQUB 4X8JB 1ZS8B 7PAZA 2OLDA 4ZE4A 3WQOA 2OAAA 1OD0A 5KSUB 4G7EB 3TYZA 5FYKH 1EP2A 3QFJE 4B0MM 5AL8A 4RLDA 1HG3A 5A2LH 2DM3A 3MHFA 4ZX4A 4X7FC 4GSQA 5IHSA 3CZSA 2OMAA 2GQHA 5FHAH 2NQ5A 4XUYA 7ENLA 1G9MC 1E5CA 2Z64C 3JT0A 4PGDB 5FK9B 2OLSA 1YLVA 1TMHA 1CYGA 3CGTA 1GCFA 1JCMP 4NRYB 3B7RL 2HG5A 2HMCA 2XTLA 5IMLB 5DANA 3SUSA 2PTXA 2D7TH 4YXHL 1E6SM 4DIAA 1VBRA 1OSYA 1C5DA 1A4BA 3QA3A 4QHKI 4F37K 5F89A 4MNQD 1S8DB 5LQBH 1JS4A 1XYFA 5HPCA 1ASPA 3JWNG 1EJ6A 4HUCA 4N0CD 5AVZB 3CWHA 3VD7A 1CGWA 2IADA 1DLFH 1D5MB 4QRPA 1Q2SA 2VRKA 4D8AA 3SFWA 5HHPB 5LXVA 3ES6A 4W86A 4QDMA 1FVCB 3C3NA 2KL6A 1K8IA 4PFEA 3E8UL 2AQNA 5DK3A 3ZLQC 5AENA 1W3LA 5D9SB 1JWSB 1UXSA 4J8RB 3DFTA 3D0AA 3D48R 1UYWH 1RSYA 2KQNA 4EAYA 3M8OH 1XLGA 3KS5A 3P2DA 1MW0A 5I1AB 1ALDA 3KPSB 2A9CA 1MIEH 4NOFA 1O7AA 1M53A 2HZGA 3PWAA 1OKEA 3R94A 4JR9L 5A6IA 4M9PA 5GGUB 1AE6L 1I8IB 4IJCA 4U5IA 4Q6IC 2YPKB 2DZXA 3DG3A 5C0NC 9XIAA 4GH7B 4LYPA 2BNRE 4OF5A 1J9CT 3UJJL 2RALA 5EU7C 4NO3B 4AV0A 3ILQC 4D3CH 1ZD6A 5IFJB 5I07A 3GE7A 5DT1H 1ZIAA 2DJMA 3VI4F 5ACZB 1NTHA 2ISVA 2FKPA 3UVIA 1ZCRA 2APXA 5L2JA 2OCZA 3QC3A 1U91A 3B43A 2B7PA 3OL2A 3KOXA 2R23B 4YH6A 1NGQH 1P6WA 2C7FA 3WUWB 2K70A 4AL8C 4LLDA 5DMKA 1MUJA 2BY3A 2VXQH 1JUBA 2YD1A 3E6FB 4XMLH 4ATLA 3IGXA 1JZ3A 3IDMA 1YEEH 4IHOB 9PCYA 1J9TA 1C91A 1GY2A 5ISZE 5T9CE 2TAAA 4NM8H 5AAWA 2EE9A 4E9VA 2DPEA 3UZQA 1P7QA 4IFRA 3LHVA 5ILTL 4IU2A 4TX6A 2XU9A 3UPMA 2HKFH 4MNGB 3VZXA 1QZ1A 3F1QA 2WMGA 3CG8A 2AEPH 4ODBD 1J8SA 1UWEL 3TONA 2F0CA 1HI6A 2YQ3A 1MCWW 1TENA 2C71A 5FFGA 2R1WB 3L3IB 2IPJA 3IMTA 2D2CC 3B0YA 3TZVB 5FFOA 4CKQA 1SJHA 1BEYL 5LIYX 2TRYA 3BP5A 4S3KA 5CJ8A 1V02A 5J5DA 3T0VA 4ACPA 1P9MC 5LWYH 1LO3L 4ZOCA 1L4IA 5DEFB 4FX7A 3ECVA 4GUQA 4F8OA 1F3DJ 3V6BR 2E6DA 1LWHA 4WJG3 3K4DA 4IMKC 3DX9B 1C8VA 4PCKA 1KV5A 4ELMA 4HYVA 5CZXC 2VN4A 2VXQA 3HR6A 1IM9A 1N26A 4AM0Q 1XDTT 3GM0A 2EP6A 1AKJA 2VE6A 5I30L 1AQKH 3USZA 2AGJL 4ZCWA 2XT1B 4HVXA 5BZWB 5BO0D 1LTXA 4W8BA 4KY1L 3L4ZA 2VN3A 4L9LB 3UEQA 4CQ8A 2Y63A 3AVEA 2YRPA 3FTUA 5HI3C 1U8IB 1NUFA 2G5BB 4C58B 4LARH 2EQDA 3GHSA 4R7XA 1Z1WA 4NJAL 1IGIH 4DK5A 3LBOA 3ARDB 1AR1C 1EXHA 5TQLA 1LBFA 5D1XD 2APTA 5HNTA 3BN3B 1WDPA 3GRGA 3DAQA 5C2GA 3EOBA 1E9YB 4QITA 5IB2B 5ID0A 4YPGA 4NQEE 1TZZA 1YEYA 2W9EH 4AW4A 3WIHL 3KYAA 2HLAA 1G7LB 2FZNA 2JALA 4MMXB 1G9NC 2EHHA 3QOKA 3V0VB 3P2TA 1GMIA 3U2SA 2YXFA 1OZQA 2CIKA 3ERPA 4L56A 3AWNA 4JPWH 5A6BD 4IL0A 4KQ0A 2X4UB 1U30A 4GXVH 3P77B 4GAGL 3V4VB 1TNMA 5KS9A 3FNKA 4LU5H 4PJCE 4KRZA 4JFPA 4M6UA 1HXMB 3SPVB 2BOBB 3WK1A 3P4OB 2NY3C 3HAEH 4Z9KB 1VKXB 2FX7L 5H1WA 3V0JA 3IPFA 1X8CA 1MQKH 2O4QA 2UV8G 2X9YA 4ZGYA 3L5XH 2KLSA 2FQGA 4XCFH 4ECNA 5DCBA 3VXOA 2Z91B 4TRPL 5I3IA 4GUPA 1KIUB 3D0LA 2FEJA 5DUBA 3MJYA 4I7WA 2E7CA 1J10A 1NICA 3U4KA 3QFWA 3T2LA 3LH2L 1PZDA 3C5ZC 2PDWA 3BT2L 3NIFE 3S47A 4X5WB 2CUAA 3G7TA 4OFKA 4PH8A 1U33A 3HJZA 4WK4B 4ZS7H 3VD4A 2VGIA 4B97A 2APFA 1V54B 3P62A 4YN5A 1MFBH 4WI8A 2Z1WA 3QDME 1NGZB 1SYVA 5GPRA 1JZFA 5B1BB 3DX3A 2QDVA 1GPOH 2FR4A 3VMOA 4L8DB 1IT7A 5GGSA 3LQAH 4GPVA 4F3FB 2NTSP 4LSTH 4TNGA 1DBAH 4QRUA 1RULL 3GT6A 4GSXA 3R12A 3I74A 2YUVA 4HS8H 3CLWA 4FQXD 5HHXH 4BHUA 1KV8A 2V5YA 4Q14A 3KHDA 1XLDA 3KYKH 2A6DA 1RJCA 2HJKA 3C2AL 3HAEA 4KQ4L 2BMKA 1UG6A 2YA0A 5IEKA 2B0MA 4P8QA 4M7JH 2IV9A 4AC7C 4MXWL 1WUFA 4DM2A 3QP3A 5KITA 3O6CA 2RHGA 1YDNA 4DJEA 3QW4B 3VNKA 3VFLA 1X5IA 5D70H 4XPTH 1S7QB 5H4YA 1IGWA 2P76A 4YNYA 2X6BA 3UYPA 4HFUH 4O8RA 4H3DA 4EI5B 3REVB 4AZ7A 3S6DA 1BQHG 3WO4B 4AJYV 1CLVA 2N7AA 5HJLA 1JHLH 1KGUA 1MQQA 3MGTB 3PQYE 5FYJU 4AYFB 4XO6A 4OZFH 3DV4A 3RO8A 4QBXA 5ESQA 3LHWA 4ZNEE 4ZW5A 2P10A 3G04B 2VJXA 4CKVX 3T3MF 1OX4A 1FXQA 3DEQA 1SJCA 2C1OA 2QVMA 3B5GA 5FECB 1E0VA 4LAUA 1Q0XL 3H4GA 1KPUB 5C0FA 5DS8B 1YBQA 2EDLA 1KLGB 1DL7H 2HRLA 5IVXE 3LGDA 4ZXLA 3OGSA 3IXTB 3RIAF 1V79A 2WOYA 3ULUD 3K30A 5DHDA 1QRND 3QPQD 4H9UA 4CD8A 2Y8VA 1NUGA 5FCZA 4MNQA 1AC6A 2V0TA 4LVHB 4QCFA 4KKAC 4NP4L 4BY3A 3E6EA 2XX0A 2FJFB 4EP8C 3RDJA 4GYKA 5LAPA 1K9TA 3MV8B 5L88L 4FI8A 4MNKA 5FI8A 3GIZH 2CGZA 4ORGA 1G0XA 3P0YH 2YBRB 5EU6D 2G3IA 4TUKH 2DJ4A 5T8IA 1AR1B 1F07A 1DEEB 1JJKA 2AK1L 3ATZA 1P6CA 3ZDXB 3MNDA 4OZFA 1MNSA 3Q45A 4JEJA 1VGEL 3WQDA 4N2KA 4PIRF 4PTVA 3IKCB 1OF2A 2CZNA 3X1EA 3WS6A 1K6WA 2YGQA 3DMMC 3BO8A 5I8CB 1UZ8A 1X4XA 4XXDA 2WW8A 3M07A 1DO5A 5FV1L 4NQXA 4J6RH 1XX1A 2Z1BA 3GJFK 4KRTA 4NN6C 1OB0A 1G67A 1PKMA 3FS2A 4KO9A 4XMKL 1T7WA 2EUWA 3S36X 3GSMA 4DFHA 1B4RA 2OTWA 2R4RL 1ZV9A 4TLTA 5I71C 2MPAH 1F9CA 2JKWA 2A7NA 3K0WA 4DF2A 3CB8A 2NY3B 2XWBA 2F61A 3GAYA 3T0DA 4RDVA 1ZDQA 5DMYA 3PHQA 4H88L 4YSUA 1SNRA 3FPXA 2OQYA 3ROLB 3U9WA 1QVBA 3H22A 5KVGE 1HILA 3UADA 2HQAA 1K3IA 1Z8AA 4PV9B 3RZCD 5I9QC 4XE0A 1XJBA 3F62A 2ZG1A 4L5FE 2IQ0A 2QJIA 5KUKA 5KZMA 1J6PA 2F9BT 4LNRA 3QUZB 2W65B 4YIQA 2QJMA 2F84A 1BFSA 4N87A 2J74A 2CJ3A 2RTTA 1OWWA 1DSFH 1V5JA 5CJQH 4JIHA 5GNYA 1P1VA 3IVKB 2ZVRA 5HDLA 2IWKA 3VWKB 1FWIC 5DZJA 4R2GD 1HNGA 3BKJL 3IGFA 1S2UA 3F5WA 3R0UA 3LNHA 5CWSB 1X9UA 2CXEA 4PI0A 2CESA 2Q86B 3GGWA 1ZT1A 4TU1A 4PLKC 1C7SA 2CHDA 3RHWK 4EZMA 4E8GA 2VC2H 2Q7NA 3UFYA 4OGQC 4AQ1A 3QPKA 1T5WA 1XHHA 4J2MA 3UGXA 2R6OA 4Z7QF 4W9JC 3PBYA 3ZKXB 1THAA 4QRRD 2A6KB 5EU5A 3WNIA 4KTYA 3PZGA 1U8QB 3FOMA 3SIMA 3FB5A 1I53A 1KA9F 4UIMA 1YNTB 4RVBA 5H35A 4ZJ9A 4LTSA 2F5BL 3EB3A 3BLFA 3ARBC 3ZRSA 2J1WA 4F2MA 2YK1L 4FQHA 3IJYA 5HJXA 3N3MA 3W1ZA 1H1YA 3RWJB 1U4FA 4BK8A 1BWMA 2X1XR 3NJKA 5D2WA 4GSRA 3WJLC 2VDNB 3FB6B 4JDEA 1P4LA 5AB9A 4D71A 3T1GA 5AWNH 1VGAA 5AYZA 4FXRA 4BKNA 2VZVA 4P59H 4I1PA 4PGLA 2VDHA 5DJYB 4ONHA 1BGXL 2AQPA 3CIAA 5C09D 4H0LC 2OCCB 2ZAHA 1PYMA 1WA2X 3ZJKA 1YCSA 3GMLB 4R9OA 5KANG 4PJ7F 3RJXA 4E2OA 4LB4A 3NPVA 3GNRA 5D1XA 4ZUSB 3JW7A 2VR2A 5I5IA 2ZKHH 4QO1A 1T2QH 2VN7A 2WBJD 4WGHA 4FR6A 1H3GA 3KPRE 2QF7A 3O63A 2IO5A 3RL2B 4F7EB 4HKJA 1DORA 5DU7A 3JV0A 4FQQB 1N59B 3IFOA 3M0ZA 3PZNA 1FVEB 1RQHA 4OGXL 4JFXB 1LK2B 1EZUA 3MW7A 5TK2A 4GJJA 3VGGA 3WF3A 4WU7A 1WF5A 1EUNA 3HO8A 1S7UB 1T66D 3NZ8A 4LLVA 3C2EA 3IMWA 2E5CA 1OTSC 5FYKL 3IGLA 2XN9D 5EFIB 1ZT7A 2FGWH 1Q94A 3BN9D 3HR5A 1NDYA 4H0IA 2FBRA 3CDYA 4ZPVB 3S1UA 3BC9A 5FHAL 4NSKA 3V0EA 4LOCA 3J8F7 1G9EA 2NNAA 1YO4A 5DC0A 3MJWA 3DG7A 4I9JA 3AADB 3KPLA 1O75A 1POJA 1U8NA 1E0UA 4HJTA 4L1DA 4FTVB 3BOVA 3U30B 3CHVA 3DOPA 3GH5A 4CNUA 4YTRA 4XXCA 3QY6A 2X9ZA 4K07A 4P3CH 5DC2A 1XGQA 3JTSB 2FEDD 4YSOA 4YDLB 5FYJE 2VDRH 2O9TA 5LQBL 4MUPA 2YDRA 4RBPK 4I8YA 1VLWA 2ZSWB 2QQNH 1UVQB 1MEHA 3DROA 3F7VB 4ZFCA 1DLFL 2JLLA 4A2GA 5EYWA 4RWYH 3I6LD 2DI9A 1SDDB 1UWQA 5DRCA 5IM7B 4LVAA 3WNOA 2IH3B 3P30H 2ZXGA 1PNCA 3ULVC 4IRJD 5CEYB 2JIWA 5EZIH 1TZ9A 4XB3A 3FT3B 4EAMA 1JDAA 4M7LT 4FQXA 5JUVA 2JJUA 5DJCA 1CYWA 4A67A 3UZWA 5A2AA 3APNA 1N82A 4I6VA 3QC6X 2QVKA 4CW1A 1UWFA 1DYSA 5ECJE 1Q45A 4FOMA 4F92B 1QLFB 3SPCA 5I9QB 4Z18A 2G9HB 1IBZA 3GDCA 2TMDA 1J5DA 5DQ9B 1MIEL 3D12B 3Q1EA 3GDBA 4QXVA 5EIIB 1DVQA 4X7SL 1FFPA 1JFQL 3CCHB 4DPRA 2ATMA 3F7RA 4NYLA 4M8QA 4JR5A 3V5HA 1U22A 3CZFA 3MJ7B 3CV2A 3WMBA 1DCLA 3U46A 1RAKA 3W81A 1F4AA 1EJXC 1HDMA 3ME0A 4NCC1 4P7OA 3ULUF 3M44A 2ZTKA 2X1QA 4D3CL 2Y5JA 1O66A 4C59B 1KTDA 3OTTA 3Q8CA 3B34A 2QIIA 3QQ9D 4BGDA 1J2WA 1CO1A 2ZDSA 4C6BA 5M94B 1TTRA 5IDZA 4UM9D 4M7LH 4UUIA 4W93A 3W0WB 2VTFA 2OLHA 5F6IC 4PH6A 3NCBB 1E5UI 1NGQL 1TVBA 2E9WA 5E6ZA 1G7VA 3B9KD 4Y9AA 1BYBA 1X39A 2Z31B 3X13A 3G1RA 1EF3A 2VXQL 3PF2A 2PLMA 3US0A 4IGBD 4RESB 3D34A 4K5MA 3RVUD 4XMLL 1RJLB 2PDQA 1R2TA 3RX8A 4UWQB 3W29A 1H8OA 2MNJB 4JG1H 2F7OA 5EUKA 3WD3A 1QK0A 5D5MF 2ZAIA 1DQTA 3FBQA 2AKRA 5KSAD 3OR7A 4Y5XA 4JQVC 3D2UA 5DRWB 1QRNA 3D2TA 1LOLA 1XFPA 2HH0H 1SR9A 5KBLA 1ZAHA 2HKFL 3QZWG 4C6JA 3AFLA 2AEPL 1MELA 1NCGA 3IYLW 3Q2VA 3EWYA 4NGHH 1UD8A 3CQJA 4E5XA 4DQOL 1V0NA 2QKIA 3KOFA 1E5AA 1YMMD 4JR9H 5LAXB 3TBWB 1MDLA 1YTDA 2QMJA 3SQOL 2VR5A 3GI9H 1HVQA 5EU6A 2XG4A 2HVJB 1IAKB 3EJJX 3FCUB 5LWYL 1S2AA 2GCYA 3UJJH 1KLUB 3BV4A 1SZRA 1CLOH 2WNQA 1S7SB 4Z6AT 4ZSOB 1QNQA 2NY6B 3AYRA 4K9EH 4UDTA 1I8JA 2GI7A 4TV3A 2EE2A 3RTQD 4WHTA 2HB0A 1A5KC 1S7XA 4OV6F 4QRSB 2F38A 1DANU 3E0LA 3VWJC 1AQKL 4NO0A 3D09A 4KCWA 3DSNB 1J8HE 2IXVA 4NQDD 2AAVA 1T22B 2ESVD 2UY6A 1RZ8A 2QQQA 3AIUA 4GRWH 2L3BA 2EEFA 5EUOE 3PBUA 3RR4A 4M1RA 2UWEB 3SOBH 2YRLA 3GYEA 5ILTH 1HKFA 3H7VA 3IUDA 2VDML 3OLDA 4KCVA 5E93A 1XR8A 2O6FA 1RK5A 1NPUA 5D4HA 5HYSA 4CQAA 5KZ6A 1ML0A 2DI8A 1UWEH 1E9LA 4GCAA 1VEMA 5F4XA 4ZQCA 2Z24A 3W6LA 3CLEL 1E6XM 1A1MB 2WMIB 2HJLB 2J71A 4HUMB 2QYGA 1VF8A 2F6UA 3BGMA 4HZ1A 3WUFA 1FNGA 3PR2A 1LGVA 4UDUB 1JXFA 3V9FA 3UZZA 1PEWA 4LAKA 3O6DA 9XIMA 1M1SA 1WCQA 4HCRH 4JX4A 4I0PD 3UCRA 4ZFZA 3SKOA 4IU3B 4HEPA 2VGLM 2VZTA 3T0EE 4K5NA 1WWCA 3TXVA 4MOZA 1IAIL 3B9NA 2WKOF 3RVTC 3UXKA 3V55A 4CCEA 4UFHA 4ZUTA 3PZMA 1CTNA 1ZPTA 4HPGA 5JQIB 2DQDH 1E6JL 2JMRA 4GI8A 4F2EA 3PWIA 4TX8A 3GQYA 1MQKL 2DPKA 3Q2WA 1R3WA 3GMPB 1KIPA 3L5XL 5I30H 2DH2A 2GJZB 3RFZB 2XFYA 4X0NA 1R3HA 3WAJA 1WIOA 4FZIA 2IGLA 1XQ4A 4GYFA 5E8NB 2X7WA 1HCFX 4OCRH 4Z7WF 4E42B 4KY1H 1V55B 1YC7A 4QRRA 1MEIA 3L48A 4LVEA 1TCRB 3VE9A 4KXBA 3URNA 4NAMA 5BMFH 1BMZA 4U4MA 5KBNC 4PVBA 3N41F 2QS8A 3ZBMA 4DOHE 4NJAH 1CECA 4XPHH 5DMJB 3TK7A 2X6CA 4ZS7L 2CM6A 4DP5X 3UBXA 2WHMA 3ALXA 1Z5YD 2NLYA 1MFBL 3IT8D 3QKEA 2HNHA 1V51A 3ALPA 2PWUA 2VWEE 2BZCA 1XIIA 4C65A 2UZYB 3B8UA 3CUPA 3IFNL 1M65A 2DIAA 3MZGB 5ES4B 3JUGA 3HQPA 2J24A 2OODA 1QVOA 1IKNA 4L4VE 3MJGX 4FHKA 5FUOH 1QSEB 3WIHH 5E03A 4EDXA 4M1CD 4JO1H 4LOEA 2QVIA 1BZEA 1YEKL 1A8JH 4H6RA 2NW2B 1X5XA 4LEXL 2UZPA 2ZTBA 5EEZA 3TEZA 4HS8L 3O9WC 6PAZA 5C09A 4BZ1L 1FVDA 1KD0A 3AU6A 3ISRA 2PPCA 4XVUC 5G5IA 4P4KC 4WUUB 5E94B 4ZQTA 4XNQB 4MZ1A 3MMUA 2G95A 5AZ0A 5C9JB 2DUXA 5C0CD 2NQLA 4M7JL 1K02A 4IBVA 3E49A 4YXLH 2R4SL 4NJGA 5I6PA 3VFUA 2EIZB 4MJ2A 2MHAB 2WBJA 1MI5E 1BWKA 2BVPB 4Y8AA 2YOAA 3IGSA 1L0XA 2LU5A 3LH2H 4YSCA 3OR6A 4CN1A 4R33A 1B4TA 1RP9A 3BT2H 5D70L 1UMLA 3T78A 3C9NA 1M1XA 5MENB 2FECI 4QG6A 5I6XB 4HFUL 4QQ3A 2HFEA 4DF1A 5GQBA 4KS0A 1OGAD 4NQCE 2A6LA 3WTVA 3V6OE 4TQPA 5U7SA 1DN0A 1AQDA 4LS0A 3Q5YA 1MWAL 1OT4A 1RIVL 2J8FA 4GIAA 4NUGH 3WIHA 2J7EA 3MU7A 5H8DA 2G5RA 1FJ1B 5I26A 5IHZA 1EOMA 3X17A 4LY4A 2XN9A 4U6VH 2YLHA 2C0HA 4KY2A 2X4SB 3CHFA 1XMWA 4NBXB 1PCXA 5FM5M 2DL2A 4ADIA 3L7RA 3R58A 4HCDA 2NVDA 4LHUG 4EIUA 4FYTA 1C8XA 2YLKA 4PJHA 1DL7L 3VUPA 4Y4HC 2XG5B 4XAZA 4B3KA 2J7BA 3JT2A 1ZVYA 5F1IB 4JGJA 4X50A 1T7LA 4W9IC 1S9YA 3GFYA 4HGKC 4F0RA 3EYOA 4WI0A 1YECH 1WLHA 2YCJA 1T1YB 4BEQA 4WU5A 5G1YA 2XKNA 2RQEA 2OMYA 5M1TA 5HR7A 3CLMA 2OMVA 5IB1B 4Y2NA 1SN2A 2QGEA 3N3TA 1QNRA 2X8RA 2GBTA 4YSTA 3OAZK 3P3TA 4ANUA 2VKZG 3GIZL 1IIIA 4FJYA 4EE9A 4UTHA 3P0YL 1RALA 4TUKL 3TTSA 4IRJA 2YAHA 3ULSB 2B2XL 1A2YB 1CXLA 5DEGB 4OIFA 3RRQA 2Y7LA 4KK9C 3K71A 3L3DA 4EPDC 1NWRA 4XAGA 5C9UA 4RETB 1L0QA 2I26N 1PD1A 1QI2A 2E9GA 2HPOA 5MKGA 3MNVB 3NJVA 4RQQB 3KDNA 3II2A 5SWSD 3SN6N 2LLGA 4P2QE 4RNFA 1B54A 3AYVA 4UMGA 2HBVA 1U3HD 4BFNA 3SPGA 1O7VA 2NXYC 3IJ9A 1UR4A 4LRTA 3AG4B 4HJ0C 1GKRA 4J6RL 3LQGA 4BR1A 3O06A 1DJYA 1HKWA 3OKKA 2OGJA 4LBRA 1Q0XH 4AC4A 3UAAA 2XUCA 3MCOA 3BGGA 5EC1A 3W57A 3STFA 1A4KA 3C8HA 1XYAA 5ID1A 2NY5L 4AQ8C 3TEUA 4ZMOA 2MPAL 4PTTB 3PUEA 1G1YA 1ZK5A 3QUXC 4B5NA 2UZXB 3WLWD 1HIML 5FDWA 1EQWA 5F21B 3VXME 3EYFB 5HYEA 4DRSA 3MV9E 1EBHA 2O1AA 1W9BM 1TZ7A 4ZMAT 3BAWA 4BKSC 1F3TA 1S7TB 3I4EA 3B9KA 3FYIB 1DO6A 2HTKD 5B1AB 3VX1A 1WB0A 3OP2A 5SX5H 2ZOTA 3ES7A 5L88H 4G83A 1DWJM 2O30A 3ILEA 2QW5A 3MNWB 1OE2A 4IGBA 3MRPA 1US2A 1P1ZA 5T3XE 4JZ5A 4NPKA 2GGJA 3DV6B 3BMWA 4GY7A 3G1FA 3CVIL 4YS4A 5J04A 4L1LA 4PMDA 2O6EA 5JOFA 5KSAA 3IM1A 4CL7A 1SJAA 2FJSA 4N4QA 4CMMB 1JNHA 3AMKA 4LLMA 2CLZB 3BIBX 1O60A 3MBWB 5FO2A 1W9PA 4E9QA 1P0SE 1XCTB 1TX2A 1VADB 1NFDF 3F4CA 3O9WB 1H0DA 1MW3A 2CBQA 5TDNA 1GS7A 2B0SH 1L2QA 2X4TB 2WLZA 3MXVL 2R4RH 4P4KB 3VXTA 4HALA 1T0NA 4CQBA 4I18B 8PAZA 4MWAE 2BH0A 1YE4A 1ZBCA 2XSKA 3GS6A 1SHXA 4GKTA 3IXAA 2FK9A 2H2SD 3N9KA 5A8PA 5L4JA 5D37A 2PWEA 3GXNA 1FCBA 4HK5A 3RTQA 4MB4A 4NRRA 3CFBA 2B5IB 1XZ0B 1R46A 3M5YA 5FESA 5HI5C 2A73B 2WC4A 4AZCB 4AC1X 3HOGA 1PYWB 4GMSH 1CD1A 2AJ3A 1VR6A 2G3XA 1XLHA 4NUQA 1WAAF 4YFLF 4NQDA 2BVOB 4RV3A 3N40P 2LLEA 1BZ9B 2ESVA 1LL6A 3VA6A 4LPCA 2JXMB 2CO6A 5SWZE 4G6AD 1U8CA 4TPRH 4WI7A 3PK7A 4S1RH 4ZMXA 1RQ5A 4GP5B 4OM1L 4GXUN 1VD6A 3GEWB 4L4LA 1I7UB 2ZKHL 4FYRA 3GNPA 2VKWA 1XBVA 1RXOB 3QDJB 3C2OA 1ORSB 1PVHA 3EF4A 1BMGA 1U8KA 5F71A 3RGVB 1G7MB 2Z8VC 1JUKA 4MMZC 1BX2B 2Y07L 4HSHA 2FPYA 2HK0A 2W3ZA 2YEVB 3MRJB 1JPMA 5E2VH 4C5ZA 4I0PA 1CXEA 1HTIA 1L8PA 1I3RB 3SAZA 4JIEA 4CBZA 2WAGA 3UC2A 3KRSA 2V8MA 2KPWA 1R5VA 1T6WA 2ZA1A 1U2CA 4KI5F 4ICCX 4PY8I 5DBUA 5LGHH 3O8XC 3W5NA 2YK1H 4IMLB 3BPCA 2BHYA 5B1JA 5MHSD 1S2EA 3ALFA 5JPNA 1LM1A 5IHWA 4Q8MA 2ZCHH 4PJGB 1H5BA 1TVLA 3KRZA 2FGWL 3H2FA 4HHLA 2ICWA 3A4WA 3QS3A 3U7BA 3U9PH 4YOKA 4D6EA 3BL3A 4U1KA 2QCDA 4MDIA 3Q0HA 4PRRA 3P60A 3N4EA 1KC5L 2G4GA 1OFDA 1Z5HA 4DWSA 1JPGB 1NINA 4GIYA 4NKDA 4LLYB 4OD1H 4NC0B 4HKPA 1IHIA 1S2CA 3KBMA 1TEYA 2ZC8A 4UQ9A 2IPKA 2H32H 2NXYB 2ZWSA 4Z3IA 2A3CA 4RCAA 4ZMNA 3EX4A 2Q76A 2VDRL 5C8BB 3JWNH 2J2ZB 3VDBA 4Q4QA 4LPWA 3TNNA 3EOAA 1H5YA 3URAA 1LP9B 2H9GA 1XIJA 3TTOA 1MDRA 1U8HA 3R4IA 2JTYA 5KVEE 4HS3A 3V8CA 1O5PA 1VCGA 4PJDA 3K7UA 1CGXA 2YMTA 1P6BA 2G2RA 4EVNA 3TWYA 1JTTA 1N2VA 3KL3A 5EZIL 4D9PA 1R47A 2GK1A 3FCSB 4OB5H 4JO3L 3FOKA 5EEYA 2GI0A 3RKDD 5DURB 3QZPA 4OV5A 2XV3A 4OGXH 3NSCA 4GISA 4LPYA 1WO2A 4LJ3A 2C9SA 4KKXA 5C0CA 4NKCA 3ULUL 4OAWA 1UJQA 2FLIA 1BGAA 3INUH 3B97A 3VXPB 5IM51 2E3VA 4Z2KA 4BE6A 2I9LA 1BVKA 1ND0A 4MLRA 3BZ4A 4IMCA 1LLWA 3O0KA 2EO9A 1LQBC 4KRPC 1GVEA 2IFFH 2BRQA 1C9DA 2XY1A 3H0TB 4RAUB 2VX6A 1JZEA 1KFJA 1K70A 1QPXA 2H32A 4I48A 1X4YA 3KEDA 1NJJA 2V7NB 3BLDA 3O07A 4XAKE 4S3AA 3U6XA 1YY8A 5EGRA 2MMXA 1JGEB 1Z42A 2WTPA 4XZWA 1VZWA 1E50A 4YYCA 2F19L 5I17A 4M7LL 3IVTA 1Q1JL 3TA3B 2GHWB 2EVFA 1G6RH 1SHWA 1VS1A 4G9FB 1TPUA 1EEZA 2OOFA 2FZ3A 3HI6L 1OSEA 4UQEA 1EGJH 5DYFA 2XTKA 4XCYA 4EIGB 3VH8B 3K72B 4XMZA 1M05A 1UXWB 3MX0A 3IDUA 4A37A 4M6VA 3WBYA 1OCRB 5BVJB 1W2VA 1UXMA 2ZUNA 4RNRB 4JG1L 5IUSA 3LS4H 2Y7OA 5K5YA 4KXDA 5H8PA 2D9CA 5E5LA 3WTYA 4EO5A 3CZGA 2NQJA 3DDMA 3IKKA 2HH0L 1VDGA 2IH8A 4HKZA 2K7PA 4R9XA 4NGHL 2BVDA 4YIWA 3GWJA 1S3HA 5JQ6L 3V2AR 4X7SH 1JFQH 1I31A 4JZOB 4RPPA 2QR0A 3FJ6A 2RH9A 2PTVA 3ZDXE 1N8FA 3GI9L 2P52A 5DXWA 1V3MA 2UXGA 2OB3A 3VOJA 2R7EB 2RJGA 4K8EA 5B7ZA 1MJ7L 4W5ZA 1YPZE 1CLOL 4K5LA 1F6FB 4H8VA 3DBPA 3OHIA 2F68X 1O4UA 1QW7A 3L3KA 2QQ6A 2ZCKH 4S3GA 4K9EL 4QEGA 1SVZA 4NFDA 4XCEA 4PRPB 5EU4B 1EGJA 3I2CH 3GR8A 1TJIL 1U3HA 5HHVH 1B0WA 3K8MA 1ZBVA 3MRQB 4C7DA 4MMZB 3SQRA 5EBAA 2XC8A 2CIPA 1M7DA 2Q6WA 2QUVA 4WDWA 2NYYC 2G96A 2HBXA 3QJVB 4UQDA 3GIQA 2R9HC 5CC3A 4O02H 4KWSA 2FL5A 1X9QA 2OEMA 3S4SG 1Q3NA 3SOBL 3F7LA 4KGLA 4YHPB 1IFGA 2OP4H 2OV0A 4H26B 3HG0A 2YFOA 4CMHC 3M1ZA 2ZQ0A 4MXQD 3VI4A 1U8JA 4XZUA 4UTWA 1ID2A 4AG0A 4KC3B 4IXHA 4M9OA 3FU9A 3NIGF 5AFAA 1I1WA 4JFYA 3BJTA 4AH2A 3M6DA 4DQOH 3TLRA 4JFQA 3GLCA 4O58L 3C5QA 4GOSA 4CVZB 4F7MB 4P2OD 1C9WA 3MXWH 3VX0A 4EXAA 5FOBA 3I3EA 4OGZA 3SQOH 1YPXA 3MA7B 3WLRA 1A21A 3SDCD 4G7FA 5KVDE 2GTWA 4M6AA 5F0JB 4CSPA 4HCRL 2DKMA 4KCTA 3KLAB 3WQ6A 3SCWA 2H8PB 2YMOA 2CNZA 1M9HA 3KVMA 3M9YA 4ACTA 1OF8A 4MY8A 1MFUA 2UV3A 4TUUA 4BWLC 5GGRA 5CQ1A 3QI9A 1GC1H 1OT1A 4NAJA 1KJ2L 2NUPA 3MR9A 5IROD 1B3OA 1A1NB 3NQAA 2DQDL 3BCDA 4UFIA 3HC0B 4PBGA 3Q5OA 2ASHA 1F56A 1MNZA 2IWEA 7REQA 4OCRL 3FBKA 4NZFA 5T1DL 4HKBA 3ZE2E 2K6YA 3WTTA 3N2BA 1ONRA 3N85H 1LOQA 2YAFA 3MO1A 1I8LC 1ZT4A 2WXOA 3GIVB 5BMFL 3AFBA 1HKJA 3IAQA 4DP2X 4GG9A 4JFOB 2CRYA 2PWFA 4XPHL 3PGFL 2VDMH 1EP3A 2GITB 2X4RA 4H5SB 4N28A 2V9UA 4X99A 2BHUA 4FKEA 5HI4C 4BV1A 4HH8A 4PVMA 1HKVA 4RDWA 5J7CC 1UB6B 2V9DA 2DSWA 4K37A 2IH1B 2Y5TA 4YEFA 3CLEH 5I1EL 2FJGB 3EWCA 4Y1AE 4GE8A 2PYFA 4KDTC 1JV5B 5FUOL 4QGTA 4PWIA 4ACYA 4JO1L 4HUKB 2VT0A 5ERWB 2YGVA 3KP1A 3CDFA 4X0KB 4F2UA 1MHCB 3S37H 1U5VA 2UY4A 2VLME 2PNDA 3PP4H 3HLAB 3QQXA 3VJ6A 1CICC 2VEFA 3I02A 1IAIH 3LA4A 2CDGB 1SJVA 5DWPA 3VCLB 2DY3A 3TPUA 1TWZA 1UMYA 2J5WA 4F8LA 2DZAA 3CO8A 5DJXA 2AQQA 4YXLL 1E6JH 3HPFA 3S8WA 1A4JB 2EIKB 1XL4A 4UI2A 3GMMA 2NY4D 4L4TB 3MRRA 1KO0A 3O1NA 4N8UA 4CADB 3LNIA 4ORIA 4Z1AA 1CQKA 2WSDA 1LYXA 2PEVA 5G5DA 4A8LA 3EWDA 1E5ZA 1QO2A 2G5UA 4F79A 4TKWA 4MAUH 1PHQA 4CSSA 4NUGL 4K3GA 3ZVHB 4XVOA 4HBQA 1QAPA 3IFNH 4Q6IB 4EZKA 3UTQA 5BOOA 4U6VL 2PYEE 3VXRE 1UZ6E 3HG5A 1XF2A 3BXNA 1XRTA 3BVVA 4XBKA 5J57B 4DAIA 1YEKH 4LKXA 2UXTA 4LEXH 4AT6A 1M9SA 4H01A 4HK3J 5GRUL 5L0QC 4A66A 4Y5YA 2ZZ1A 4BZ1H 1I9JH 2IGTA 4N8CL 3K6FA 4M5SA 3GSUA 3V0IA 2BBFA 2UY3A 2QSTA