1XD0A

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase
publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xd0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xd0A01
3TP4A 3CBWA 1HJXA 2CBIA 2VZTA 1D3CA 1GQLA 2JE8A 3MSDA 4MDPA 2FDMA 3AHVA 5GNXA 3BMVA 3TA9A 1QHPA 2F18A 3SEPA 1EO5A 1TE1A 2E9LA 4WLCA 1HIZA 1TVPA 1JNEA 4CD6A 1OBAA 3BAXA 4OKDA 1BYBA 3W29A 3CO4A 1LL6A 1Q6FA 1UWIA 2DT2A 4BF7A 2VZSA 3I3BA 4HPGA 1JIBA 5A6MA 5LYRA 4L4PA 3NSNA 4GZEA 5CZKA 3ZQ9A 2YKKA 3WH7A 2WLZA 4N0RA 3VIHA 4KWUA 3THCA 4JZ5A 2J7HA 2BY2A 1W9UA 2J62A 3CZ8A 1XD1A 3WMBA 4JFSA 1HVXA 2XWEA 3K8KA 4BS0A 4UQDA 4UR9A 1C7TA 3VD3A 4UZSA 2Y8KA 3OLEA 5D9NA 1BYAA 1JDDA 1Q6GA 3L4TA 3UCQA 4B16A 1UKPA 2DT1A 2VX6A 1E6SM 3NDZA 3BVTA 2WWCA 3WEZA 2FE0A 4TX8A 4CU6A 1ZBVA 1EH9A 5LA0A 4YN5A 4AIUA 1FH9A 3OZOA 2QV4A 2QMKA 4J3WA 2GJRA 4NI3A 3DYPA 3AMDA 4CCCA 2D3LA 3NYDA 1SYTA 4DUWA 3VVGA 1DWAM 3A4AA 4OGZA 1GJUA 3N1AA 3VMOA 3SCTA 1Y7VA 1UWTA 4AYGA 1HX0A 3TTSA 2J74A 4ML4A 1HVQA 2JFEX 2MANA 2XYLA 4PYSA 1UD6A 1GOKA 2VO5A 1WCGA 1GOOA 1HWWA 2VX7A 1UR2A 1TQSA 2QLYA 2NSXA 1U2YA 4CUCA 4XX6A 5EFDA 4FK9A 3RM8A 4YPJA 3AHYA 2YA1A 3TONA 1E70M 2EQDA 2GUYA 1VEPA 3W53A 2WCAA 3CMGA 1WZMA 5A6SA 1K9FA 3D4YA 1J9YA 3UR8A 1WDSA 5CGMA 2DT0A 1H49A 4JKKA 2ZXBA 2XSAA 2WHJA 3WY2A 1LL7A 2WMKA 4ATDA 5M03A 2WM0A 1BPLB 3L4VA 1E15A 1ODZA 1WZAA 3CZEA 3EYPA 4E2OA 1W3KA 4U5IA 1LQ0A 4F9DA 3W6MA 4H8VA 3VGFA 3GNOA 1V3JA 3BVVA 3AFBA 2IUZA 4ZXOA 3WFLA 3CZNA 3MUY1 4NZFA 3VMPA 1KQYA 3AHXA 5JBDA 4AISA 4OIFA 3CIVA 1MYRA 4M29A 2E0PA 3W4RA 4XZBA 1C8XA 1W2VA 5EB8A 1N82A 4W89A 4QLLA 3DX0A 2NT0A 1UD8A 2ZUVA 2XG9A 3WQ5A 1O7DC 3WMCA 4UOZA 1R33A 3BAIA 2BFGA 5BXRA 2VTFA 3VGBA 4W93A 2W5FA 4LYQA 3WDPP 1V6VA 1BHGA 1JG9A 3CZLA 3W81A 5C8BB 4MB5A 3ARRA 3CUGA 1PZ3A 3EMCA 2WXDM 4H04A 5I23A 1CNVA 2J8FA 4HTYA 1K9EA 4MB3A 5HBFA 3WH6A 1DWFM 4ZEPA 1J0ZA 2PF0A 3LRKA 4PTVA 3T09A 3UG3A 1O7AA 3OZPA 1CGWA 1AQHA 4BZYA 3EJRA 4NZCA 5JBFA 3MUIA 4TVDA 1EHNA 3RM4A 3AS1A 1NWUA 2A3HA 2HVMA 2GK1A 4F66A 3VGHA 1VFFA 2WLYA 1E5JA 1NP0A 5IDIA 1WDQA 1F4AA 2WMFA 3QGVA 2NT1A 1JYWA 3SUWA 2XVNA 2JEPA 1V03A 3DC0A 3A4WA 2D2OA 1V6WA 3AYRA 1UA7A 4WKFA 2V3GA 3N04A 4P8WA 4W8AA 2XVKA 3VIPA 1KXQA 1S46A 4W88A 2ZXDA 3DHUA 2A3AA 2XGIA 1JD7A 3IJ9A 4LX4A 1E1EA 1HP5A 3BH4A 3QOMA 1HKIA 4AW7A 4TTUA 4LYRA 3WMSA 2EPKX 2BS9A 5CSUA 1B2YA 3VM7A 4PMDA 5CXPA 4NXKA 1R8LA 1NOWA 3T2OA 3KLLA 2WSKA 5A3HA 2RGLA 3AS0A 1JD9A 4B3LA 1GVIA 1M53A 3D4ZA 4XZWA 1GOWA 1GHSA 3BUBA 2OSXA 2WNWA 1QHOA 3DHPA 2C7FA 2PWEA 2CBJA 4AZ6A 3EDEA 1G01A 1PZ2A 1BYDA 2W91A 4J3TA 5I77A 2X1IA 3M46A 2G41A 4DWSD 1LWHA 2VC9A 3EMZA 4XUYA 4MADA 2F7OA 2WB5A 3EBVA 1JI2A 5I5RA 2W63A 3DDFA 1X6LA 2UY2A 4XB3A 4PTWA 4WIWA 3VIJA 4OOUA 3EJUA 4TUFA 1V3HA 1UKTA 3PZGA 5IFTA 1EDGA 1CGYA 3VDAA 1XYFA 3K4AA 3AHZA 2ZUMA 2ZXAA 4AWEA 4CKQA 3EDJA 3VSTA 2E4TA 5DF0A 1KFWA 2X05A 4L4OA 4MDOA 1TCMA 1R7OA 4OOZA 1KTCA 4AD5A 1KWGA 2WMIA 3SUVA 4WSKA 4PSPA 3VX0A 1T0OA 3CC1A 3SCNA 4HOWA 1W3JA 1QNPA 4P8VA 3SUSA 1XRVA 1CGTA 4OUEA 1NQ6A 1BGAA 1Q6CA 2E3ZA 1JXKA 2D0FA 4M8UA 1UQZA 1MFVA 4H8UA 3OIHA 2YA0A 4UQ9A 2UY5A 2BHZA 2XVLA 3VIGA 3VIKA 2DPEA 4PMUA 2EEXA 1MW2A 3ZJKA 5FCZA 3FY1A 1ECEA 3PZVA 3WDQA 1XH1A 1OGSA 5D4YA 2WCSA 1E4IA 1DHKA 2DSKA 7TAAA 1TQUA 1KB3A 1R75A 2DSZA 3AMCA 1SZNA 4Y7EA 1EA9C 2WZEA 1JZ4A 1LJYA 2YOCA 1YHTA 2E40A 2VNCA 2XPKA 4U3AA 2IGTA 3UERA 1WP6A 1J10A 1UR0A 4P7RA 4K68A 1H0GA 3APGA 1QI5A 1GW1A 2GSJA 1OCQA 2WMJA 3NCOA 1W9XA 4TVCA 3EDDA 3WL0A 4KH2A 5M3WA 1GUVA 8A3HA 1UKQA 2XFRA 3GDBA 5A2BA 3KL0A 3WKZA 1BVNP 2VVNA 1ZBKA 5E70A 3MMDA 5A8NA 4HP5A 3S6TA 3AZRA 2YJQA 5A6BD 2CKRA 2WYSA 2WK2A 3AXHA 3F5JA 1BQCA 2YL9A 5CQ1A 3WF1A 1RPKA 3L2LA 2BXYA 1I75A 4W8LA 2O9OA 1UH3A 5ABFA 1J01A 3VX1A 4J7RA 3U57A 4GO9A 2ZXQA 2V38A 1TQTA 3BUDA 2BHYA 1AVAA 3UR7A 7A3HA 1JXJA 3AXIA 3KLKA 3FNDA 4ZE5A 1ZJAA 4H8HA 4D6HA 2CITA 2JEQA 3QOKA 1CGXA 3VD7A 2O9PA 1FA2A 4DO5A 3DYMA 3W25A 2X2HA 3TTQA 4UOJA 1NARA 2Y4SA 1OINA 2BXZA 4UQAA 1A3HA 3WEOA 1UZ1A 3CH9A 4J3VA 1SFSA 2ZX6A 3WNKA 3POCA 1VB9A 3T08A 3WIJA 5I6SA 3MUZ1 1B3ZA 1NP2A 1QI4A 1W9BM 4JFWA 3GXDA 4J3SA 2XIBA 4ATWA 1W9PA 3MUAA 3EMQA 3QR3A 1R86A 2OSYA 1BTCA 4M81A 2ZIDA 1GHRA 4FNPA 2YLLA 4R5EA 3QHMA 4A4AA 1ESWA 2WC7A 3N12A 1H2JA 1H3GA 3CHEA 1MFUA 4D6FA 2YFOA 2WAGA 2FYVA 3EJPA 1ITXA 3OGRA 3N17A 1BGGA 3CHDA 1UKOA 3ZOAA 5HXMA 2ZWZA 1UH4A 3WBEA 3WH9A 1WDPA 3CPUA 3AISA 3HMCA 1E71M 2YL6A 4CN1A 1CIUA 1EHAA 1TFVA 2V5DA 5JIWA 4J27A 3AIVA 2DIJA 4KRUA 3LMYA 3QHNA 1VJZA 4LYPA 3CZKA 1HNYA 1GPFA 2EACA 4PBGA 1B9ZA 1PAMA 1SMDA 2F1AA 5E6YA 1WKYA 1TQVA 1B3XA 3O6AA 1BVZA 1IZKA 4PTXA 3QHOA 4WJXA 4UFHA 2OWXA 3SCQA 2O92A 3VDBA 4FMVA 3GH4A 1JF5A 4HU8A 1NWRA 1GONA 4IUGA 1US2A 1JZ2A 4B9YA 2OWCA 4HA3A 1F4HA 1E3XA 4PMZA 4CD7A 4AIOA 2BVDA 2X09A 4PMVA 4BQ4A 2UY3A 3NSMA 3LRLA 4Q7NA 1PIFA 2G3NA 1B3WA 5DEZA 1V08A 4HZ6A 3KL3A 4QCEA 4UQCA 1GOIA 2QF8A 3PTQA 2FGLA 1EOKA 1O6IA 3SURA 4FNTA 4PMQA 2D22A 1OT2A 1R34A 2WMIB 1IT0A 4P7QA 1FP9A 1QW8A 4C7GA 2CXGA 4UCFA 2Y5EA 2E8YA 1HP4A 5BWFA 1QI0A 1RP8A 4WKHA 1HJSA 2BY1A 2XSBA 3AIUA 1GJWA 3MKKA 1HN1A 1MW3A 1E55A 3W38A 2J7DA 5E09A 3WF4A 5CPTA 1JZ6A 3O2LA 2PWGA 1TG7A 3THDA 1HKKA 3GBDA 4HU0A 2YL8A 3WUFA 3D50A 2ZUSA 3VTRA 3WQ6A 3AYSA 5A8OA 4UFLA 1QNRA 2PBGA 2HISA 1PIGA 1P6WA 1KGXA 4AC1X 3VNZA 3GZAA 1Q4NX 3WDIA 1R87A 4W7WA 1EOMA 1MXDA 4HZ7A 2WWDA 2EJ1A 5LA1A 3PN8A 1X6NA 2QPUA 3PHAA 4M82A 5D8WA 1C8QA 1Z32X 4C7DA 3CTTA 3KL5A 1WNOA 1EQCA 4TXEA 4UFJA 2X2IA 1JFXA 1J11A 4X9YA 1CPUA 3EJTA 2FHCA 3WFZA 1E43A 2YBUA 3VUPA 3DX1A 1GVYA 2J4GA 3PBGA 2D24A 3ARWA 2Z1KA 3WF2A 4U3CA 4ACYA 3AI0A 4UQBA 5AYBA 3N13A 3W6LA 4FLSA 1IZJA 2VX4A 1VFOA 4BQ3A 4FLRA 1JAKA 1VEMA 4OBRA 2V3FA 1FOBA 1R47A 5D9PA 4E8DA 2J7BA 2G4FA 1OGBA 1K6AA 1NH6A 5ABFB 2VR5A 3BAWA 1UWUA 2J7FA 1OD0A 3CUFA 5FIPA 3GXIA 3BVUA 3CHCA 2ZE0A 1UKSA 1OB0A 1V3LA 3FN9A 3RPMA 1CENA 3AHTA 1GOMA 3EJSA 4P7OA 6TAAA 2DSWA 4CVUA 1XGZA 4A3YA 2V3DA 1EDQA 3BXWA 4V2XA 1E0WA 4NRRA 1V02E 2XVPA 2CHNA 3ARVA 2J77A 1MQRA 1X1NA 4Z2HA 1HL9A 1JZ3A 3A21A 3UG4A 1CLXA 5AYIA 2WHLA 3HU7A 5CGTA 4D6JA 2CHOA 5E0CA 2ZX7A 2DGAA 3SIMA 3T2QA 4AMWA 3OLGA 1KBBA 1B31A 4J3XA 6A3HA 3LRMA 2FHBA 3GTNA 1VEOA 3LXBA 1NOFA 2OYKA 1UA3A 2CNCA 4FNSA 3GNPA 3WF0A 3BAYA 1E6XM 4W7VA 2EAEA 3WQVA 1UWQA 1AQ0A 1CXKA 3ZJ7A 3A4XA 1B3VA 4J28A 3AMLA 2ALWA 4AZGA 2OW6A 3HG3A 4D72A 1HF6A 4PMRA 3BSHA 3WELA 2D0HA 2XM1A 3F5LA 2FHFA 3OLIA 1E6NA 1PS3A 2XFYA 1J0IA 4PCTA 4BQ5A 1LG1A 1CWYA 2EABA 4ZE4A 1FHLA 2E9MA 5A8QA 2DH3A 1DTUA 2PB1A 3WEMA 4GZJA 4PMYA 1JGIA 3WNOA 3POHA 4AD1A 3A22A 5CLTA 5CSYA 4W5ZA 5CG0A 3N18A 3L4WA 1TR1A 3WUEA 3VSUA 1U30A 3AS3A 2CBUA 2WW5A 2DSUA 2CEQA 1QWNA 2F7PA 1AMYA 2YBTA 4JAWA 4GPNA 5CPQA 1R46A 1E4MM 1UQYA 5IXEA 3VM5A 1G0CA 2DDXA 2VVSA 1H41A 3WD3A 1EXPA 4AD2A 5BRQA 3HZ3A 4AYSA 3VD4A 2BY3A 1GNXA 5FOOA 4D1JA 4RE3A 3ZM8A 1JYXA 2JIEA 1XC6A 1UR8A 4FLQA 1E3ZA 1G5AA 4AMCA 1UD4A 3G6MA 1CDGA 1E40A 1PJ9A 1CXLA 1E73M 4ZENA 2VQTA 1C90A 3ECQA 3IJ7A 4UOQA 1XD0A 4D1IA 3MO4A 5AC4A 1D7FA 2G3MA 1YQ2A 2TAAA 3VD5A 1LLOA 2XFFA 2X8RA 2VZUA 4AZ5A 1JAEA 2XHYA 4PUDA 4AZCB 1JZ7A 1LL4A 4IPNB 1E0XA 3WQ8A 4CU8A 2WVTA 2W92A 1KBKA 1QNQA 3NSXA 1W1YA 3AMKA 1OIMA 1KTBA 3NJ3A 3RO8A 1DEDA 5A2AA 5ABHA 2EPMX 3N15A 5KZ6A 1NWTA 4PMOA 1B90A 1HXKA 1HKJA 2F7RA 1W1TA 3LPFA 2F7QA 1MQPA 4M80A 4EE9A 1NWSA 2DEPA 4W86A 2W66A 3BUIA 5E0FA 1QWUA 1OIFA 5HOSA 1DWHM 3WNMA 4MTVA 3SCWA 5JUVA 5F7UA 4MB1A 1J0HA 3CZGA 1H1NA 1PX8A 4P8XA 3BAKA 1ZB5A 1GQKA 4HA1A 4JFTA 3EDFA 1M01A 4AD0A 3B9EA 1VAHA 2VI0A 5A8MA 4JKMA 4HMEA 4Z2LA 2OYLA 1UH2A 4UNIA 3W27A 3VU2A 4WKAA 4CN4A 5EBAA 2J78A 1J0YA 3WQ4A 3RIKA 3KEHA 4AZ7A 2ZUNA 4U2YA 1CXEA 2J47A 1UG6A 4RL3A 2D23A 1K9TA 5BCAA 1CTNA 2EPOA 2X0YA 1KR1A 2ZOXA 5FD0A 4D6CA 1JYNA 2VR4A 1EQPA 5A6BA 4TTGA 5I78A 1VENA 3VGDA 4H7VA 4BCEA 4A3HA 3A5VA 1HJWA 4C7FA 2WKGA 3ALFA 1NM9A 3TV8A 3ARXA 3IJ8A 3PZNA 5GPRA 2VCCA 4DUVA 4XV0A 5M17A 3RDKA 2JF7A 3B9DA 2F61A 6CGTA 3EJQA 2G8ZA 1BFNA 5IHSA 2DIEA 3H55A 4PMXA 3OBAA 3RMEA 2VRJA 3WD1A 4CD8A 1E56A 3LPGA 1HT6A 1KXHA 1R7AA 1ITCA 1UR4A 4PMNA 1E6RA 3MV11 4S3JA 4W85A 1JYVA 4FNUA 4RE2A 3U5YA 3MSGA 3BMWA 4PUEA 4B9ZA 4Z2JA 1UD3A 1UYQA 4MNMA 4LQ1A 1W1VA 2EXOA 2C0HA 4H2CA 4GQRA 3ARTA 1GCYA 3DX4A 2IXUA 3FAXA 1WE5A 3ARSA 1CZ1A 4PEEA 4U31A 4GI9A 4EKJA 4NX0A 2WSPA 1QBAA 2XIIA 1ODUA 3AQUA 1WDRA 1XHGA 3BUPA 1OWQA 2Q8XA 2NW0A 4F79A 3ARZA 3GYCA 4M24A 4Z2KA 1CGVA 1ZJBA 4GI8A 7CGTA 5DO8A 1HJVA 3UESA 4FNRA 1E6QM 1QHZA 2FH6A 1UUQA 5A95A 3ZR5A 2Y24A 1ZBCA 1BYCA 5FKYA 2DH2A 1V0MA 4JFUA 4Q22A 4R27A 3L4XA 2J7EA 3WY1A 2ZUTA 3D5HA 2CETA 1TA3A 3U7BA 2WVVB 2VRQA 4DWSB 1VBRA 2ESCA 1IV8A 5ECUA 4OJYA 4DUXA 3VSVA 1CXIA 2BVTA 4OZOA 3ARQA 3VILA 3AZSA 1KGUA 4YHGA 1UR1A 2CCRA 1JNDA 4NRSA 3WQWA 4GIAA 2WMGA 3WY4A 4KRTA 3CHFA 2VURA 2YDQA 3L4YA 2O9RA 4TX6A 4N42A 3PZMA 4JKLA 5I79A 1B1YA 1HJQA 1E4LA 4QP0A 1WB0A 2WHKA 1BAGA 5M5DA 1UWRA 3UEQA 5I24A 1BG9A 1UWSA 3DYOA 5I2UA 1Q6DA 4NZJA 3W28A 4ZXLA 3AXXA 2EO7A 1OT1A 1UHVA 1WPCA 3VO0A 3WY3A 1E9LA 1L8NA 2EPLX 4MNJA 4QCFA 1TZ7A 1H4PA 2WVUA 3WD2A 5A6AA 4UFIA 4GQQA 4WF7A 4GKLA 4URIA 1C3FA 1CBGA 1CYGA 2VRKA 1B3YA 3ALGA 4AEEA 3BUQA 3AZTA 5I0DA 2XN0A 2F1BA 2YA2A 4PSRA 1J0KA 4MB4A 1H5VA 3ZSTA 1V6XA 2WMHA 4FF5A 1TMQA 4QFUA 2DSVA 2VZVA 3BC9A 3FW6A 1V0LA 2XJ7A 2BY0A 3A6OA 3PTKA 3GH7A 3ZT5A 5TD4A 3AIWA 4JFVA 5HPCA 3BGAA 1FFRA 2UWFA 4MNLA 2GJPA 2WANA 4Z2IA 2EBNA 3II1A 2A3BA 3M7SA 1OSEA 4X0NA 5A69A 1LG2A 2VZOA 5DT7A 1ISWA 4FNQA 2D73A 5A2CA 4NSBA 3SCSA 3HG2A 2AMGA 3MMWA 2GDVA 2XTKA 3K46A 3M6DA 4IM4A 3WNNA 3ZT6A 2A3CA 2ZUWA 3BLKA 4TOQA 3L4ZA 3PZOA 1ISVA 2X0HA 4AZCA 4F9JA 3VIMA 4UFKA 4GINA 4D6EA 3A47A 2WC3A 4LGXA 2XUCA 1E6ZA 2BVYA 1BF2A 4W8BA 5JIPA 1G1YA 1LF1A 3WN6A 3VD9A 5BXPA 4PCSA 5JBEA 1C92A 4RE4A 3K8LA 1UOKA 1VRXA 1V3MA 1LWJA 2ZX5A 3CZJA 3LXAA 4GZIA 1W2PA 3WENA 3FXYA 3WUBA 1QPKA 4X0VA 2V3EA 4FLOA 3VKKA 1KXTA 3RJXA 2VQUA 1KCKA 2OSWA 3GXFA 2CPUA 1VJSA 4AY1A 3LPPA 3AS2A 5DFAA 5E6ZA 1E0VA 2BV9A 4MPKA 3GXMA 2O9TA 5GNYA 3ZJ8A 3F4VA 4KGJA 2CKSA 3U5UA 1J12A 4GI6A 2CIPA 4HA4A 3FAWA 3H54A 4DM2A 1UZ4A 1GOQA 1JDAA 2YIHA 1I1XA 2V5CA 1W3HA 2CBVA 3PTMA 3CLWA 2YDSA 4AD3A 2IXVA 5D9MA 1ZBWA 3M07A 1AQMA 1W32A 2CERA 1JDCA 4W5UA 3FHQA 3O9NA 4ACZB 3T0BA 1UD5A 2EADA 5BRPA 3A3HA 3RCNA 1XCWA 3L2MA 2GJXB 2CESA 2PWDA 5C71A 1V02A 4IISA 1K9DA 1SR0A 3NDYA 3UG5A 3DX3A 3AMGA 3AOFA 2YL5A 4NF7A 4W87A 2E9BA 1M03A 4ATLA 1MQQA 4V28A 1FFQA 3KE0A 4EK7A 4AMXA 4DO6A 5HPOA 1TA3B 1XH2A 2JALA 4GXPA 2WCGA 3PZUA 2J7GA 2VT0A 1DWIM 4AZIA 1V6UA 4DO4A 2OLHA 1XV8A 1ISZA 2JIWA 2J7CA 3HJEA 2VJXA 4NXSA 3IAQA 2ZWYA 1CEOA 2YDRA 4JCLA 1C91A 1H11A 3BAJA 3OGVA 3W26A 3IANA 1OD8A 1CXFA 3I3EA 2D1ZA 3BCFA 2E8ZA 2VCBA 3ARPA 3SCVA 4MJ2A 3D3AA 3TTYA 3OA5A 4P7NA 1KQZA 4D6GA 1I1WA 2VL4A 2G3JA 1OM0A 3VGGA 4OBSA 1MVYA 4J3UA 1HXJA 2CYGA 1H09A 3SCOA 4M56A 1V6YA 3N11A 5CLWA 4TVUA 2PC8A 4DWSC 2X2YA 4HZ8A 1RD6A 1G9HA 4YHEA 2YFNA 4M1RA 4PRWA 4U5KA 2J25A 3SCPA 3OGSA 3ZJ6A 4MAZA 2VCAA 2Y2WA 3GH5A 4PN2A 3MANA 3N9KA 4CGTA 1GORA 4HOXA 2A3EA 1VBUA 3AROA 3WSUA 1KWKA 2QMJA 3VDCA 5BROA 4UZUA 1KGWA 5GQBA 3RJYA 4B3KA 1XH0A 2C8NA 3WUGA 4HMDA 1HTYA 3WDJA 1JL8A 3MS8A 2WVVA 2D0GA 3TOPA 5A6KA 4DWSA 2XGBA 5LA2A 3BCDA 3GXTA 1US3A 2AAAA 1RP9A 3MU7A 2OWWA 1QNSA 1QOXA 5DMYA 3VIIA 4D6DA 4LXFA 4BQ2A 2AOSA 3VDHA 1MWOA 4E4PA 4UTFA 1BSIA 3CMJA 1CECA 3J7HA 2Z1SA 3RILA 2WZIA 4U2ZA 3GXNA 1A47A 4H41A 1JI1A 1V3KA 5D9OA 3W0KA 1UASA 2BHUA 5CJ5A 3ZSSA 3RM9A 2D3NA 3VIOA 3BLBA 4JCMA 2WPGA 3GM8A 1XSIA 1DWGM 1GQJA 5E9AA 1U33A 3S5ZA 4AZHA 3ARYA 1C93A 5HDRA 1MW0A 2VOTA 1VFMA 5GNZA 3G6LA 3LXCA 5I3DA 1QVBA 4UFMA 1D2KA 4QAWA 3BVXA 4UQEA 1KR0A 4AZBA 4JL1A 3VPLA 1B0IA 4D71A 2ZUUA 1W3LA 5IFPA 1H0IA 1QW9A 2ZX9A 1ISYA 1GQIA 1FH8A 3GXPA 4P8UA 2G3IA 3PZIA 1W9DM 3BLPX 3SUTA 1PX3A 1MW1A 3DX2A 4MAVA 3WF3A 3CUHA 1L0PA 2WVSA 5A1AA 1J0JA 1DP0A 2EPNA 3WDRA 1HKMA 1BG4A 3K4DA 2PWFA 1JF6A 4JL2A 4D6IA 2QPSA 2WZHA 1VFUA 1C7SA 1NOUA 1E1FA 1SMAA 3SCUA 2GDUA 5D8ZA 2W4XA 3VOCA 4LPCA 3CV5A 3ZO9A 3AIEA 3WH5A 1W1PA 3AICA 1HL8A 3E1F1 1ISXA 1PEZA 1TUXA 1TQWA 1C8YA 5BXTA 3T0AA 3SUUA 4CD4A 2X2JA 4QLKA 3TTOA 3DDGA 1WZLA 4HPHA 3JUGA 3HN3A 3AIRA 2OYMA 3OB8A 3VINA 3H53A 4GO8A 1V0NA 4PTMA 2BNJA 2WBGA 3BVWA 3PZ9A 1CGUA 5AY7A 2D20A 3ZR6A 2DT3A 3FHAA 4CU7A 3D51A 1KXVA 3VMNA 3IK2A 1BLIA 1V3IA 3CZSA 1B30A 2XVGA 3B9AA 1EGZA 5EFFA 1KCLA 1PBGA 3SCRA 3CUJA 1FP8A 2FGZA 3F5KA 3T2PA 3WD4A 1MXGA 5AC5A 4QLJA 4EANA 2ZX8A 1FH7A 2JF6A 1G94A 4ZFMA 5ABEA 4HOZA 5A6LA 5FL0A 1ZS2A 2WHMA 4Z2GA 2PI6A 3PZQA 5C70A 3KWXA 3LPOA 1JFHA 2VUYA 5A8PA 4CD5A 1QBBA 3WBAA 3VIFA 2UY4A 1QI3A 4BA0A 3WNPA 4IPLA 3OG2A 8CGTA 1JZ5A 2PBOA 4AD4A 3HG4A 3ZMRA 1EDTA 1QNOA 1Q6EA 5ABGA 5CPSA 3WD0A 3ZIZA 4AIEA 3KZSA 5BXSA 4DM1A 4JHOA 4ACZA 3T0DA 2W62A 2YLAA 3K8MA 2WC4A 1GZJA 1CXHA 3W24A 2VX5A 1XYZA 1EO7A 3L4UA 1FHDA 2GJXA 4JHZA 4WK9A 3U7VA 2GVYA 1DWJM 2QHAA 4MNKA 4KGLA 2GK1B 3IAPA 3ZT7A 1ZL1A 2J75A 3D52A 3DECA 2GFTA 1JZ8A 1PPIA 3IGUA 4CCEA 2PWHA 4JIEA 5A6JA 3OLDA 4CCDA 1TVNA 2F2HA 3EDKA 1W9VA 1WAWA 2FH8A 4CVWA 1E6PA 4CN6A 2RGMA 2DQXA 5EMYA 4WSJA 4AEFA 4W84A 3VGEA 4AXNA 5FL1A 2OW7A 1ZU8A 1XCXA 3AJ7A 5BYWA 3AIBA 3LX9A 1XSJA 4V27A 2W67A 2J79A 1XSKA 2XN2A 4EAMA 1VF8A 3WL1A 4U33A 1E5NA 3WDHA 3MMUA 1V0KA 3A23A 1UD2A 1RH9A 3BSGA 3NIYA 3AIQA 2Y8VA 1R85A 2XN1A 2WBKA 3CGTA 4S3KA 3VNYA 1CLVA 1EIBA 3S5YA 1WO2A 2WKLA 2ZICA 3W82A 4F8XA 5KEZA 3GBEA 2F8QA 1M7XA 3MI6A 4HMCA 3A24A 5DT5A 1QX1A 2W61A 4QDMA 2VMFA 1E4NA 3NUKA 1QI2A 3CUIA 3B8SA 1M04A 2XM2A 1VIWA 4MJ4A 3W37A 4P7LA 2J8GA 4B15A 1W91A 3HG5A 5A94A 3K1DA 1OGGA 3I3DA 1J18A 5IHRA 3S2CA 1PX4A 3MV01 3GNRA 5E1QA 3WNLA 3WH8A 4E8CA 3UETA 3PZTA 5HNNA 4KMQA 1HJUA 1WZKA 4W7UA 9CGTA 1E72M 3ARUA 2B31A 2XWDA 1UR9A
chains in the Genus database with same CATH superfamily
1TQCC 3CBWA 3A6CH 5AD0A 4F33B 2JE8A 3W1PA 4F2FA 3WK1A 5LAXB 3SEPA 2WNGA 1EO5A 4N2DA 4XD6A 2CO4A 2OFJA 4GA8A 3TOYA 3DENA 1QWHA 4ZS6C 2R1WA 2AJUH 4WUUA 4JANA 1U8NB 3MAWA 5JHDE 1FA4A 4DFIA 2ISSA 5C0GA 5DJAB 3OKEA 1I1FA 4KWUA 3CSYB 4AJ0A 2VKXA 1XD1A 3WMBA 4A2SA 5FSDC 4IIBA 4DEFA 2GGIA 3BWZA 3VNMA 3WMQA 3FFDA 4C6MA 1JDDA 5AB2A 4RISH 3R0DA 4NN7B 5L2KE 5DC0A 5C9JB 1PWMA 4N87A 1EH9A 4JDEB 1TUPA 4YN5A 3FOLB 4OZIE 1QNZL 5ELIA 3GUTB 3BLOA 5HAOA 1NLBH 2QMKA 2IADA 3PY2A 4YUEL 3T0CA 2LE9A 1KB5A 1A5AA 2YRBA 3QG7H 4PJ8B 3ARGD 3VMOA 2G9HB 3V0JA 4HUKB 1GOOA 1UR2A 3DX7B 4AQEB 2QPFA 4XX6A 1OAZH 4YPJA 1D9KB 2A0NA 5I1DB 1Y18A 2Q20A 4PJ5B 2Z6JA 1OQFA 2OEKA 3C2VA 5IEHA 3RNKA 3BZDA 3L3KB 4IZGA 1TETH 1BPLB 3RG6A 1Q6OA 1I7ZB 3OP2A 1QEWB 3FRUB 5I82A 1WKDA 2VITA 4F9DA 4IX2A 4MNGB 4UUIA 4I8DA 2B1AH 4B0MM 2X4RA 1KQYA 3H22A 3APYA 4ENLA 3R10A 4JPWH 4H0LC 1X97A 3QEQD 2ZC8A 4W89A 3BWUF 1ACYL 2DKMA 5EBMA 2FMNA 3LHWA 4FI7A 3BLLA 2KLSA 3KCWA 4IMLA 4GK8A 1I0BA 3ETTA 3W81A 5H37H 1F86A 3GR4A 3ARRA 3CUGA 3UCCA 2QHLA 5I23A 3Q13A 5GXBB 3FDGA 4LLVB 4UWQB 1DWFM 1QSEB 4QYAA 4G80A 3W9EB 4KI5F 4G9FE 1GYMA 3RPIB 3VGHA 4HCHA 1KOAA 2GT9B 5C6WH 4PV9B 5FKPA 4HCDA 3MJ7B 5FJPA 5GGSY 3NFUA 2XVKA 4G7VH 1BEUA 3E9UA 3IN2A 5I73B 1K3UA 2AQRA 3GJEB 2VEIA 5J13C 1EUUA 5BZDB 1G43A 4GIPD 2BS9A 4PLKD 5I8OH 4JRWA 5DDHB 3FSTA 3H7BA 3V5OA 1EGJH 5CWSB 3QUXC 5JIDA 1GOWA 3FC8A 2PYEA 2PWEA 3EDEA 2W91A 3WIIL 1BZEA 1TPC1 3HTWA 5I77A 4Q6IA 2V9DA 1UJPA 2P0IA 3MV8D 1U95A 2NV2A 5K9QI 3DTDA 1PD0A 2VSDA 4KDVA 4LEEA 4YHPB 3ROLA 3EYUL 3QUXA 4WJKB 4LHUA 3EAKA 3JZ7A 2W9DH 1RU9L 5IQ7L 4AWEA 1MCDA 3L3GA 4QOKA 1DQXA 4KKCC 2Q8BL 1KWGA 2HAZA 3HGOA 3WLRA 5HGBB 3CC1A 3N34A 2GYSA 4FTVD 1QNPA 4I9JA 4P23B 5LXGH 4IGBD 3FO9B 3PNWB 2O6FA 4JM0A 3L3IA 1B4LA 3FY1A 5BRZB 1SJAA 2EXWC 4O1FA 4HJ0D 3EX1A 4IBLT 1NCDH 1ZA3A 3KGRA 4LAOA 3KOXA 3D5OF 3SDDC 4KHTL 5IHZA 3DO4A 4PJHF 2ZZ2A 2TODA 1IGIL 1LQAA 4LY8A 2AHIA 4QT5B 1CGSH 1LL1A 5D7IF 2RBLA 4J3OD 4N9OB 4G42B 5TDPA 5ECJE 2WUCH 3S6TA 2YJQA 4FZIA 5A6BD 3OAWA 1BQCA 3SDDA 1GW9A 2YLKA 4GUPA 3VACA 3MRFB 5F9OH 2VQ1B 3N1MC 2E6PA 4GO9A 1H19A 3QXDB 4FR1A 1UP3A 3UY8A 1FSKB 3P40A 2R2HA 1JXJA 7A3HA 1PKQB 3KPMB 2W07A 3KLAB 2RHEA 4DGWC 1ZJAA 2VEGA 5LG1A 1I9JL 5EZLB 4HCRL 4FQ1L 5SWZE 4NC2B 4JPVH 5KZCD 4DYJA 5AZ2H 2OSLA 5D7JC 2TSYA 4LAQL 5CBAB 2IPJA 4A2GA 4ZYKA 2PD9A 3POCA 3ARBD 1T83C 3P0WA 3LH2H 4C6JA 4JTTA 2VN5A 8XIMA 1HESA 4X80L 3GNNA 2QCDA 2QJIA 3N12A 3MGOA 4XIAA 1MFUA 3SPCA 4U1IA 2ZTJA 4NAQA 1WWCA 1RUQH 5D7JA 5L8KB 3TWAA 4Q6YA 3E5PA 4NNYA 3FS9A 3AIVA 2PD5A 2G3XA 4R7OA 5KS9A 1VSCA 2WNNA 1OANA 2G37A 1PAMA 4GFXA 5DA0B 3KCJA 4LIQL 3G0UA 2WO5A 5KITA 1AY1L 1RZIA 1E4XH 2XG4A 3MCLH 4KX9A 3TSDA 4F2EA 1G84A 4TNWF 3S2MA 1NWRA 3ZN6A 4XPTH 4B9YA 4F15C 3QBUA 3X12A 5KTLA 4AIOA 1OYAA 5LNSA 1L7TL 2P8MB 5DJYA 1FVPA 1P0KA 1P7QB 4HZ6A 2FEEL 4YX2H 3KBNA 1M3JA 1O6IA 1IBZA 2X4NB 3WJXA 1FP9A 1NC2B 2VABB 3AB0C 3LHTA 1TYRA 4WFHD 4AHPA 1HN1A 2DORA 4F7EB 4L9LB 4CDGC 1EP2A 3RRQA 1VFBB 3FYIB 2ZD0A 3WUFA 5F88A 5A8OA 1QNRA 5DR5H 3SYQA 2HZGA 2GIXA 1X5FA 1NAMH 2ZWKA 1MXDA 2XZCH 1NFKA 4NHCH 2NUPA 4GP5B 4MQSB 4O5LL 4OT1H 4Y1AB 5T8GA 3QSTA 5MKGB 1BWVA 1JFXA 4DGVL 4PB0L 3KPSA 2J20A 3CV6A 4OLWH 5AW7B 1SO3A 3ITOA 2J4GA 1TPEA 4EQ3A 5AYBA 2N56A 4ERSL 2ISWA 4M5ZL 2IAMD 5GGUA 5K9DA 1DLFH 4J6RH 2DMHA 1NMBH 2YPKA 1K6AA 5C08A 4RUBA 4BEIA 3BAWA 1RMFL 4N5UA 3N6YA 2XKNB 3GXIA 4YL2A 3T3PE 2BH0A 3GI8H 1JWMA 1V3LA 4WOZA 2YAPA 4WU5B 1PKLA 4MMZB 5IVZA 3R7QA 4NRRA 1VCVA 3LTSA 1U92B 1UZDA 1QPNA 4G6JH 4Z2HA 2A99A 1T6MA 1XYLA 2MJWA 1PY0A 1UPPA 1U8MB 3HU7A 2PLTA 5CGTA 3GMRB 4QHMB 2DGAA 1QFUH 3URBA 1OGAB 2VELA 2BIQA 2DL9A 3BYYA 3G1DA 3H9SB 4WJ8A 1CXKA 4YZFE 5EU3A 2P5WE 2Z31B 4ALAL 1S7RB 1S9VA 3GMNB 3OSVA 3NZPA 4JGUA 1P6AB 4AVNA 3D08A 2B1OA 5IFHH 3V0UA 4U1GB 4MXQD 1EF2A 3RBSA 2AANA 5IQNA 1GYCA 3N29A 1G4TA 3LPWA 4UTAH 3TT3L 3K0WA 1CWYA 5L88H 4RLDA 2XC8A 3LHPL 4IRSB 2DZXA 3AXLB 1A6PA 5CBJA 1G6RH 2IMRA 4IS6A 3L4WA 1TR1A 2LFEA 4BI6A 2CBUA 5FYKL 2CQVA 3C0QA 4DEWA 4HJSA 2VVSA 5AQ0A 4J4KA 4HHAB 4OJCA 4AYSA 1OK6A 4QAMB 3MHUA 4X7FC 4Q32A 2PTDA 3RB5A 2PCYA 4BFIB 1S1PA 1K6QH 4G1MA 1ETZB 2XYCA 1JCVA 1KLGB 2TAAA 1B0RB 2QKIB 2R29H 1X96A 2BOBA 3C8HA 4YHLH 5FGBC 5ANME 3G1XA 3E7JA 3FJ4A 2COVD 4MAYB 5DJCB 3QXWA 4EAYA 3L5MA 3AFLA 4OD2A 4Y4FD 3FO2A 3TH2T 4PW4A 2FLBT 3ET9F 2DLEA 1A0QL 3F01A 5JUVA 5CAHA 2NY3D 1QRND 3MCKA 5FGBA 1IQDB 5ICYB 4DBDA 2IWGA 1HI6A 3PHOB 4Q4MA 4H4IA 2R2EA 1HDMA 4X42A 3D05A 5ISZD 2ZC1A 4LVDA 4GVHA 1JPKA 3JW7A 1FCQA 1H0DA 3EFDL 3N2TA 5FF4A 3JV4B 3EPMA 1YYLL 4GKNB 1FNHA 3ILPA 4PJDE 4RL3A 2FAUA 3BV7A 1MCEA 4HK3J 4D6CA 4EXKA 1OTTD 4G8FA 4I5BA 3VGDA 2WXQA 1JNJA 4ZFFB 3GG1A 4XBEL 2ICEC 4Z9KB 1SJCA 4AYFA 4N0YH 5FYJH 3EJQA 1VPOH 1BFNA 1JDEA 3I6GA 1MJUL 3CQ0A 5CZVH 5I3GA 5CZXD 1X5MA 3ZL4L 1UR4A 1ZAJA 2I9TB 3DX5A 4S3JA 3MUGB 3Q5OA 1YC8A 5F1NA 2XIMA 3CD4A 3JVFC 5KYUA 2VP8A 2ICEA 1RJZA 3X14A 3W5NA 4LVHB 3LY6A 2VDLH 4GI9A 4EKJA 2YX0A 3FKUS 1L0QA 3KHQA 5FO8A 4JTIA 3BUPA 1QMLA 3QZPA 5AKRA 1K8CA 3HC3L 5D7KE 3UTTA 1RR2A 3KVJA 2G50A 4RDBA 5D37A 1R3IL 1L6YA 3TIMA 1TJIH 1D9KD 2CKBB 2NXYB 4PJ5D 3U6RA 2E77A 1L9PA 5DURB 4L18A 1HG3A 4XCNA 3OKNB 3GHEH 2I9LA 3GPSA 3E3HA 2YDQA 1RV6X 5F8QC 3GRIA 1WB0A 4I3RH 3VABA 2PDPA 4HCRA 3MLYH 5AYUH 4TF4A 4JNXA 4JY5L 4YSQA 4RZBA 5KVGE 4JTCA 3NCYS 1L8NA 5CIPH 1IEBB 1UROA 4UFIA 2Z7YA 2JJTC 4HCLA 2X6UA 2C4FT 3SDXA 3MOBH 1SY6L 5GRVL 2WMHA 1I3GH 4W9EC 1QSED 1BAWA 4QRTA 3H7VA 2A6JA 4ODUA 4RW5A 2YQGA 2RFGA 3W7HA 4UTTC 2JJTA 4CNPA 3V4PH 4P5SA 3OC5A 2AMGA 4OZGB 3CC5B 2GCYB 4ZS7L 2HVKB 5E00B 2PDWA 3D2TA 4PODA 2VISA 2FATL 3BAEL 2YZ8A 2GTZA 3MA7B 4PJIA 4NKDB 3VKJA 4KXAA 3II3A 4UTTA 4J9JA 3OKKA 5BXPA 3P73A 5I17B 2K70A 2WQRA 4NN6B 4O0QA 1USZA 2ODOA 3GG7A 3NIDE 2CPUA 4I8YA 1CK0L 4IDLA 1ZUAX 3ZHFA 4OY9A 5DFAA 2OI9B 2K0RA 3PU7A 3PREA 4CNSA 1E8XA 5A16A 4JG0L 5BW6A 2QVMA 1IGJA 3MJMA 4U1HA 8TIMA 3PYCA 3O3BB 3BGMB 1EZUA 3S83A 4KEUA 4QGCA 5DMIH 3MRDB 4F20A 4KPHH 1HHGB 5A2JH 4YVXA 4YSTA 2FIQA 2FT8A 3L0NA 3RCNA 1QMUA 5SX5K 2W95A 1YCSA 4YMPA 1NDZA 1A1MA 1CG9B 3FONA 4HQQL 4HPJA 4LPTA 1B3IA 4P23D 4L8BB 4XOCA 1HKVA 4DO4A 4OM1H 4YNYB 3AYTA 3MODH 3U83A 5BRZD 3BCFA 5TDNB 3LGEA 4WNQA 3QUYC 4GQPH 1P5BA 3MXWH 2BDNL 5IHBA 4L8SC 3VGGA 4DKEH 1XX1A 4AY0A 1T4KB 4AMAA 3UL4A 4ALAC 3PFMA 4NQVB 4IHBA 3QUYA 3KS0H 1EV2E 2H9GB 1DBMH 3TBBA 1P48A 4DQAA 5F7KC 5BROA 4L8SA 5AW4B 1XH0A 1U8JA 3QBTB 1R3YA 2WVVA 4EDWH 2XGBA 1KELL 1ADOA 4ONHA 1E5YA 3N19B 4Q4SA 1KLUA 3THAA 2X0UA 1I4NA 1NUNB 4U2ZA 3VWKB 3I65A 1UASA 3HUJB 1MCWW 5HVFB 3K81A 2LQRA 4QTHB 1EJOH 3WXWL 3IUHA 3NIGF 1S5NA 3L7EA 3I9GL 1PZ1A 4B5EA 1BMZA 1Z7JA 2F8OA 5K9XA 1RURH 4O8RA 4PS7A 3LIZL 4BWWA 4D71A 2D69A 2CR3A 3GXPA 3MNWA 3W3BA 4Z7OE 1UFUA 2V6HA 3AAZA 1ZE3H 1TQBC 1R4XA 4UTIA 2CR0A 2EPNA 3K4DA 2K7PA 4XP6L 4MFEA 4N2KA 2PEVA 2JTDA 4D9LL 3SCUA 4LLDA 2N4IA 4PGBA 3AIEA 2ZOUA 4HVBA 1P7QD 1TELA 4NSKB 1ISXA 3N43F 4CNIA 4MA8L 4ODTH 1XT5A 3EG9B 4CD4A 1MUMA 3OKLB 1FRBA 5T5FL 5HJ3A 1MUCA 1NC2D 1KBGH 2QIIA 4KROC 2APFA 3HR5A 4IGHA 3E2HB 5AY7A 4YBLC 3BRGC 2WZ5A 1WXZA 1MCPL 3R7RA 4MVBC 5TE4L 1SJHA 4DKDC 5HYJB 3GJFK 3W88A 1BZQK 2A6KB 3OB0H 1LOSA 3OXSA 1EPXA 3U2ZA 3RRAA 1N9PA 4CSZA 3DROA 1YEDA 1G7IA 4PRNA 3ZMRA 3QDGE 4FQXB 4Y1AD 4LT7A 4F24A 1N10A 1BFVL 4JPSA 4PJ9B 1XGYL 4ACZA 4JLRB 5KSBB 1RJLA 2WC4A 1GZJA 1K7FA 5B22A 2CO3A 4LCQA 1BZ7A 4D8PA 1E4KC 3W39A 2Q02A 3E0FA 2VIRB 4UM9B 3KGTA 2X9XA 1O9WA 4MIMA 5HHXH 1XIDA 1Y07A 3V95A 1F4YH 4DHLA 2PURA 2CM5A 4XNQB 3VG9C 4TXVB 5FL1A 1NDTA 1DQIA 3PG9A 1MFEH 1E4KA 5KAQF 4KXCA 2W67A 2J79A 3WDHA 5CEWA 4LL4A 2F74A 4TIMA 2XN1A 1EIBA 4R7VA 2WZPD 1K8IB 1I9RL 3TKFA 4XWGH 1XF0A 1QTSA 5IB5B 4XTRC 3N73A 3WL9A 1OGAD 1EFXB 2WBJB 1OP4A 3H9SD 2BSSA 5IK3B 4LEBA 4ICMA 1YEFL 3WNLA 2Z31D 5KZEA 2VGBA 4N5ED 5EBWA 4J6IA 1ZV2A 1D3CA 1I7RA 5KVGH 4MDPA 2ZWNA 1F3DH 5F7YC 2DOCA 2E9LA 5IBLC 1BYBA 3CO4A 3SPJA 3SY0B 4GMTH 4IRSD 3O6LH 4GKSA 3S0PA 4GG9A 2PUQT 1IB5A 1DZ0A 2R8SH 5ICZA 2YKKA 3M5XA 3VIHA 1H9DA 3W73A 1CE1H 4WKXA 2X2GA 5CU9A 3SI9A 3FMGL 3OV6A 4FXKB 1ZANH 3TBYA 1C1EL 5EGRA 5LDSA 3BLDA 1P4BH 4YZWA 5FX3A 4FX5A 2F53B 3H1ZA 2DMCA 5JQ6H 3KLHD 1T8QA 3XINA 1IBFA 3AWNA 2D3LA 2PTVA 3DURB 3QORB 1OE3A 3AG4B 1ORQB 4Z7QE 1URIA 2FPTA 1M6JA 2ERJC 3LZNA 1MRDL 2A6LA 5KN5B 4ERAA 2CGYA 2XZZA 1RERA 1OD7A 5F71A 2VX7A 2I60L 4MAYD 1D9EA 3VTMA 4HWNA 1OSYA 1PDYA 1Y5VA 2DVTA 3AHYA 2GUYA 4OB5H 3VC5A 3K4ZA 3W53A 4Z7WE 3IFNL 5I1LB 5ECVA 1G9MC 1DQLL 4WCYL 5C0CE 1JTTA 2WHJA 5SWQA 2PDYA 2AEOA 2VW7A 3I75B 5DYFA 4F1ZA 5FI8A 4AJVA 5EZIH 3IFOA 4E9SA 4M29A 1YDYA 2AF2A 3B2XA 4BH8B 1EEPA 2XFXA 4PMEA 2E3VA 2IBZX 5KZDA 3ES6A 4G70B 4LYQA 1Z1WA 3KYOB 4F5CA 4PFHA 4N90E 2DQ6A 2I25N 4OLZL 5BNXD 2EIZA 4WO0A 4PRPE 1II4E 2R1XB 5HYSG 4LK4A 3GUWA 1CVRA 5FO2A 4C6FA 3CUPA 1EHNA 5E2UH 4BZ1H 5MHSE 1FHVA 5K9OA 2BNRE 2GDQA 3STFA 4X6EB 1JYWA 4M43H 1FDLH 3KUMA 1GGBL 1D6EA 3M17A 3NGBC 4CC4C 3WTYA 4L6HA 4EOWH 3NZ8B 4HS8L 1JD7A 4PJXE 2YCKX 4UIKH 1AD1A 3RXZA 2CSPA 4JHAL 3NZRA 2ARJA 1W72B 2JKJA 3NMEA 4XI5C 5C0ND 1JDFA 1TSRA 2RGLA 3L67A 2GPTA 4CC4A 3O05A 3WO4C 3UJJL 2CBJA 2NXYD 1ZCCA 4J3TA 1N3NA 3ABRA 1E6JL 4KC3B 2QULA 3MLUH 1MLBB 3B06A 1JCNA 1X6LA 3SRFA 3T4AC 3HPXA 2XU9A 2OQYA 3I74A 4R3UA 3VXUE 4CQ8A 2C4XA 2WO3B 4PVNA 5ABDE 4N6QA 4XZMX 1G0YR 4QHKJ 1RK7A 4MDOA 2NVAA 4Y96A 4XP1L 3VKBA 1U22A 3AXMA 3CQIA 3T4AA 3LV5A 4C83B 2G4EA 3DV6A 4M1DL 2Q10A 1RULH 1Q6CA 2E3ZA 2HVBA 4I2XA 4DGUA 2GAZB 4H8UA 1OFQA 1T03H 1XR8B 3WSQL 1X5ZA 3LIZA 4ADUA 2L7JA 2DPEA 1TCRB 2CJUL 3G77A 1A5BA 1RHFA 1UB3A 1XQKA 2DSKA 1LLAA 2NLJA 3PBYA 3AMCA 4Y7EA 4OQTL 1YHTA 3RWDA 4S1QL 4PRIA 3O6MH 2E7CA 1W9XA 2Y6ZA 1LP9A 1H3UA 2BPBA 1G4MA 1A9BB 2IMNA 1QLEH 4OZFB 5TF0A 4JFFA 5IOKA 1PAZA 5EOQL 5CQ1A 4GH1A 1XLDA 1JGLH 1DEEB 3HNVH 2Y8UA 2PCPA 3F7LA 5F4SA 5T5FA 1PVNA 1KB9K 3UP1A 3NCMA 3ZTDC 5H6HA 3V5CA 3ALWA 5HDQL 1GY2A 1DE5A 3QOKA 4N8CL 3TW6A 3ITLA 4M4PA 4FEZA 5A5WA 2B20A 4RCXA 2YPLA 2WKOF 2IQ9H 3EFFA 1CTMA 3GZOA 5FESA 1GW6A 3X1FA 4NP9A 1QFHA 3GXDA 4XVDA 1W9PA 2WJ7A 1B88A 4HSAC 3EYFB 3V3WA 1ERNA 2GIMA 4D6FA 2ZTBA 5AOIA 2B5IC 12E8H 4WTQA 1H15A 1N7ML 4HJJL 3KBJA 2EINB 3ZOAA 4F7KA 1SO6A 3DX6A 2O4MA 2NR6C 1ULVA 3HE7B 1R2SA 3KP0A 4NQXB 4G9DA 2X6BA 2QGYA 2DDQL 3G5VA 3XISA 4W9FC 3INUL 4QY8A 2V5JA 4D7BA 5F7NC 5H4ZA 4KTDL 4ZOCA 1QTWA 3MUHL 4UFHA 3PFQA 1AE6H 1K77A 1WC7B 2AGJH 2OWCA 4JY4A 3FUKA 3UAJC 4PMZA 3EB4A 2NR6A 4HB7A 4KO5A 2J8UB 3QJOA 1J93A 2QFPA 3FT2B 2R4RH 4JO2H 4KFNA 1P2CB 4LUTA 2BOLA 1ZLUH 1NBVH 1DVFB 1GJWA 4WGXA 3UAJA 4Y90A 5HR6A 4PJAA 1KGIA 3MJ8A 3S6CA 2DZBA 4HAKA 4OJEH 4KERA 2Z1WA 3RZCB 1WICA 4CVZB 3BOLA 3EO1B 1R87A 2CDFB 3THUA 4LSQL 1ZHLB 1JPDX 4M82A 3KTCA 4YHIB 3VWKD 1MAML 3HG1E 1ZCOA 1XB6A 2AEQL 5I1CL 1OE2A 5F3FA 3ARWA 3UZJA 4UQBA 5GRZA 4FLSA 5HVHB 4BQ3A 3H24A 2J7BA 1GXEA 4Q8MA 4BZ2L 3PWVA 1YPZA 5FIPA 1ZLVH 1OB0A 1OK0A 2H2SD 3CLFL 4V2XA 4F7MA 2A6IA 3BT2L 2FD6H 1GTFA 5IVXE 1IBGH 3BZJA 1WEJL 4XISA 4IKNA 1A3LL 5HYSA 4WHYG 4BGDA 4HOMA 4NQDE 1NDGB 3GXUB 3OLGA 3VKAA 4DSYA 3W7JA 3NPWA 3GNPA 1Q9OB 4PS8A 4PJBB 4LOUC 2CFFA 3E8UH 1UWQA 3ITYA 4Z3JA 4MZ2A 1D5ZB 2CD0A 3FFSA 4HUMB 2Y1HA 1WG3A 3K2GA 5FW8A 3NAVA 3CL8A 4NPYA 3G6JA 4B2DD 1J0IA 3MV7E 5HYJD 5KSVA 2HKFH 3NYZA 2YOAA 3IFPB 4H00A 3ZDXF 1RUSA 5BZWA 2AL2B 1TTAA 4UNUA 4L7ZA 1ACZA 5EU9A 3N18A 5BQDA 1BEYL 4FQXD 3WUEA 2VR2A 2X1XR 3N1GC 4DZAA 2YJLA 5EC2A 4UAOB 4PJ9D 1EC7A 3TLRA 1THFD 4OKVA 2DSUA 1Q5MA 5C9ZA 1N2RA 2V2TB 4LU0A 5FO9B 1E4MM 1G0CA 1PLBA 4JFHD 4LBAA 3VFOA 3LMJL 3ELFA 4J2MA 3SKOB 3CU7A 4UM9D 1OFDA 1GVEA 3EO0B 2ZSVB 1ZPTA 2DQEL 3DH7A 5JQIB 2DEWX 1CL7H 1D7FA 5GRWA 3T42A 4XNZB 4R3SA 3BP4B 3P2BA 4F0LA 5GZNC 2WUBH 3F2DA 3H2OA 2Y07L 3QI9C 2XYBA 2XTJC 4FNLH 1I7TB 2Q8AH 2Z91B 1DIDA 1F3EA 2J6EH 4AEIL 3HJ0A 3GHUA 2G5RA 2OX4A 5DVLA 3RNQB 2X41A 1Q94A 5GZNA 1ZB5A 4NRYB 3MYJA 4HA1A 4LCWE 1EFXD 2WBJD 4OD3H 3QI9A 3SE4C 1VAHA 2BG5A 3G5ZB 2DTML 5KSUB 1C12B 4H6KA 4F3HA 1BX2B 1REIA 2V8MA 2O55A 3MRBA 4AZ8A 3RIKA 5E4EB 4JG1H 1TT6A 1AKJB 2I07A 2XPYA 4PS3A 1F1GA 3MJ9L 2RD0A 1E9QA 4OUIA 2A77L 1M6OA 5HTSA 3U82B 4WDXA 4M1CD 2X0YA 2CLZA 2NTSP 3HGJA 3GQFA 3SE4A 3D25B 4DAGH 3DETD 5I78A 3VZYA 1PL3A 4HKBA 3NACL 3ONCA 3O0RH 5AW6B 4DUVA 2Y06H 5IV2B 3PGCA 3LM3A 3SOBH 2YUZA 2ZUQB 3NQ6A 4CD8A 1JN6B 4TU1A 2A4CA 4W9JC 1JCTA 2HT4D 3RGVC 3NXLA 3IJDA 3BLEA 4HHHA 3MP5A 1GH7A 4QCIA 4M5TA 2P46B 2WLMA 1LORA 4GQRA 2MKLC 5C8JA 2KZBA 2F53D 2CUIA 5F96L 3DXAE 4Z0XB 4U31A 5K59E 1JCMP 2WSPA 3JU2A 3UTZA 2JKEA 3KYKH 4OQTA 3OKDB 3QORD 4BI5A 3L3DA 1WDRA 1ZJHA 1OM3L 4N0FB 3RGVA 1B0GB 2OXGB 1OLLA 2BOFX 3BW9A 1J1XH 2AQ1A 2QSTA 4QRQB 1YEKH 4NJ9L 2AV7B 1BYCA 2DH2A 1XTMA 3G5XA 3U48A 3H2PA 15C8H 1DE6A 1JUFB 4FERA 3RG1C 1EWEA 3PXHA 4KK9D 5IGXH 3DO7A 1H3PH 2AXGB 2ATMA 3AZSA 3SQLA 1EAOA 4EVNB 4XX1G 1CVSC 4WI0B 4IOFD 5AW3B 2GQ3A 1P6CA 4RGMB 1MCJA 2QF7A 4TTDD 1UJTA 3KTXA 4INFA 4HJGB 4GX8A 3QP3A 5F7DB 4JVPA 1RZFH 2V9TA 3UEQA 1RUAH 5DZAA 4IGMA 4PHXA 1U91B 4X5XA 1QNVA 3AXXA 3MNDA 4Z7VF 2WV8A 2LU7A 4PGCA 3D30A 4JN8A 2EDHA 5IMKB 3GDKA 3ALGA 3MV9A 1IGTA 5BUAA 5I0DA 1IM3B 4YHYC 4XGZB 1XF3B 4OE7A 3H4XA 2GFBA 1AH4A 1TVBB 3NA9H 4K3EL 2NW2A 3KOYA 3TBSB 5J1AB 3BXNB 1WKFA 4PGDB 3Q7JA 2DIKA 5GSRB 1JHLH 4K7FB 5FO7A 5ALBL 3D39E 1DLHA 1EZVX 5IKCA 1A7OL 1T66D 3K71A 1L9WA 4C91A 1SXZA 4MWAE 1ROCA 4TNEA 4WD0A 2X1PA 4BFKA 1WUZA 4X5WB 1GOXA 1JXFA 1AKPA 3A47A 2PABA 5IBTH 2NVCA 1AQKL 2PDKA 2CLKA 2EEDA 4RE4A 5B3JE 4H8WL 1V3MA 2K9FB 3THMH 1CB2A 4L5ZA 2J27A 3VKKA 4KNTA 1VJSA 3AS2A 3HQOA 5CP7B 1DUZB 3W7NA 2Q5BA 1DCLA 4GBDA 3REWA 4IFOA 4HA4A 3H54A 1FWTA 4YIQB 2VDNL 3EF7A 2ICWI 1NCBL 1HH9B 3H3PL 4CC1A 3B8IA 4LSVH 1M7IB 7FABL 2Z7ZA 2CWRA 4GXVL 4JMXA 3PK7A 3QWRD 4A66A 5C71A 1AW1A 1SR0A 1L0YA 4APXA 1MPAL 1MQQA 4ASTA 3VNDA 2VN4A 2JCCA 3QJQB 7PCYA 2DWXA 1VBGA 4A7UA 2LT9A 4PLNC 1CURA 4P61A 4BZ2A 1KM4A 2VYOA 2J7CA 4JRXA 3S8GB 4JTHA 4DLFA 1E9OB 3FPYA 2A73A 5HDOA 3W26A 5AL8A 3A3YB 4S3FA 2C13A 3DVGA 4X9HA 2ODHA 2VCBA 1JHTA 4BHYA 2CZEA 3ATZA 1FFNB 5IQ9B 5I1KH 4WW2F 1HXJA 1L2UA 3C5ZB 5HI3C 3VXME 4NO0B 2IGFH 1L9OA 3CH1B 1Z3RA 2I85A 4CGTA 1KLZA 4JIPA 2IG2L 1HU8A 43CAA 3H42L 3PRZA 4X22A 1EVTC 4Z7NB 5L7XL 2I69A 5BOPA 2XA8H 1J1OH 4HMDA 3TFBA 4HZLA 1JL8A 3F7YB 5BU9A 3SSGA 3DPBA 3ZDYF 3EBIA 2XWCA 2VDKB 1QOXA 3IE9A 1TWZA 3PWNB 3IIVA 3Q37A 1XGTB 5IQOA 4H41A 2VXTL 2XXMB 5EUKB 5CJ5A 2GG1A 1QFWH 4EBQH 3HCVA 1TWDA 3TIEB 4D0BA 4DOHE 1Q9KB 5IIEB 3O41A 5DZOA 4XHJC 5E9AA 1NBYB 4XVSH 2X4UA 1RQEA 3LKOB 1NLDL 1IC4L 1A9EA 1EXHA 2IPWA 5FAJA 1KRCC 1BZ9A 5I76B 3S4TA 4TQ8A 1OLZA 3QQ3A 2F6KA 1NGPH 4UIMB 3HE7D 3W83A 3V5KB 5D2WA 3U2EA 1W9DM 1TTQA 3OIXA 5ESVA 1ZHBB 2ED8A 5DC4B 5HY9A 1YNTA 2F6AA 1V10A 4L6DA 5L4MA 2IWEA 1ITUA 4I9WE 4KJPC 4LLQB 4WNJA 3DFTA 4BK4A 3S88L 4HNLA 4ENZA 3N1PC 1DJIA 5EU4A 2Z7GA 3QRLA 4HWEL 1C8YA 3SUUA 1VHCA 4Y16C 3AACA 3MRPA 1AAJA 3DDGA 4KWVA 5FYJE 4YVUA 3OHMB 2AZAA 4F93B 2WXMA 1OSZA 3UDWC 2BNUA 4MXVE 5I15H 3AGWA 4U1JA 1EQWA 1DVFD 2DD8L 3FHAA 5CJOL 1OYBA 1BLIA 3CZSA 3O11B 2L0DA 3RUGF 3IVKB 1PBGA 2BVPB 3QZBA 5IMMB 3RZCD 2G60H 4Y16A 1F11B 3FYPA 3OZMA 4XMKL 3IETA 4Z2GA 3W7EA 1NDWA 4PMJA 5C70A 5ID1B 5HPMB 4DCQB 1EDTA 3HQ1A 3MJ9A 3N25A 2ZUXA 2V17L 3HOGA 4S0TD 1LMKA 3T0DA 1T89C 2ZP8A 5TF1L 2R24A 1WLHA 3KAOA 1EHKB 3C08H 1GA2A 1EJSC 1FWGC 4WQ6A 3D3VA 3W7OA 4MLRA 2BDQA 1JTPA 3IGUA 5B8CB 2EDFA 5IRPA 3E0GA 4XE5B 3L21A 1AACA 1JCXA 2DUZA 4ZFOA 4G8GE 3GKWH 3N2MA 2DZSA 3FQTB 1T89A 1U3HB 3AJ7A 2HRPL 3K2UH 3W84A 1MJ7H 1OQXA 3P2TA 4FG0A 1E5NA 2AJ3A 2EVJA 2H9AA 3AIQA 1U3NA 5K9KA 5JW4R 2VXQL 4S1RL 2J55A 3TZFA 5C7ZA 1W80A 1GZPA 1T83A 2BW4A 1E4NA 1U4FA 1GPOH 5FCUL 2JKSA 2HLAB 4B15A 4JN1L 4QTFA 2E5EA 2TRSA 4GIOA 3ME0A 3EWBX 5B1CA 4AYID 3GNRA 5C9UA 4E8CA 2VLJB 4YHMH 1WZKA 3VRJA 2X4SB 2B31A 1EAPB 2EYSA 2VLME 1VDGA 5LBVA 4FG6D 3U4BL 2FDMA 2HVJB 5FDYA 2C1PA 3NJKA 3FTGA 3BKCL 1EJ6A 2X4QA 5T33H 4BJHA 3FU0A 4AM0A 4WJ5B 1I8UA 5T3XD 5KBMA 1AO7B 4RDVA 4YSRA 5AB3A 2VFFA 4XP5H 1ES0B 3QO1B 5C07B 3TCEA 3GRWL 4FX8A 4X98B 1U4EA 2E5BA 5T1DH 1I8LC 3B03A 3HPAA 3HHSB 1YXCA 3U2CA 4N9BA 3D48R 1KJVA 1FL5B 5D4QA 3RVXD 4RPQA 4QF1B 5J3HD 2GWGA 3OU8A 1Q8JA 2FSEA 3LTYA 1EO8H 3AT9A 4NUGL 4BFJA 4KS0A 4TX8A 4X7TB 1ZBVA 1FCGA 3NJIA 4DGYL 2QV4A 5GJNA 1I8LA 3DYPA 5IBUB 2PLCA 3EYVB 4XCYB 2OQJA 3WQCA 3NCWA 2DP3A 5KINA 4H8WC 1Y7VA 1HX0A 4NENA 3TTSA 3Q5YA 4Q8TA 2VO5A 4WWKB 1ZAHA 2IH1A 4Y2WA 3TBTB 1FHUA 3HFML 3B3IB 5DFVC 2IANE 3PNRB 1J9YA 5GGSA 5AYQA 1OK4A 3N42B 4HJ1A 4OLEA 4P2VA 3DSFH 4L5FH 2XSAA 3DN5A 5H2BB 1YEGL 1LL7A 3VE0B 1A3QA 1UUSA 1E15A 4TSBH 1QWGA 2DUXA 2YXXA 3GK0A 4AX3A 3AFBA 3V6FA 3NIFB 2ADAA 4I48A 5E94A 1MYRA 3QS3A 4JTRA 1AKJD 4POZC 1MDAA 2VLKE 1K72A 5E4AA 3I10A 2YQBA 4XNYH 3RX2A 3CZLA 1S78D 3IYLW 4ZMPA 3HRZC 3WCZA 4X7CC 3QPQD 3KBEA 2O5XL 2J8FA 3I2CL 4ZEPA 2HQAA 2O72A 4JM2B 4XH2B 4I0PC 3CN4A 4GG6A 5DRWA 2BNQB 3NFNA 1W17A 3SYCA 3ZLGA 1SOKA 5F44A 4RV8A 1NP0A 3QUMB 4JRYB 4N2LA 3VXOB 5EG6C 3HRZA 2OKTA 4RMWA 3MCYA 2D2OA 1V6WA 2H2PC 3X3FH 4WKFA 4GRLB 1KM3A 3T77A 1YLVA 1IM9B 4I0PA 4W88A 2VLLB 3SQBA 4GRMA 1HILA 2BVOA 4Z3HA 4KQNA 1HL2A 1YMHA 3GDRA 3QOMA 5FEBA 3W7CA 2RH9A 3JVAA 5DYOB 4TV3A 4GLRH 2XXFA 1NOWA 3M41A 3H85A 1EZSA 2DQIL 3HMXL 2B59B 2WSKA 4F3FB 3Q6FA 4P2RB 2NY2B 3K5RA 1U41A 3WG6A 1QHOA 3MFFB 4XVTH 3QUHA 2C7FA 2NY4B 4NLHA 3BQVA 2VM8A 3QULB 3GX9A 4NUPA 1T40A 4XUYA 2Z7WA 2J24A 3IDMB 4KY1L 4GQBA 1AGFA 1FPTH 2UY2A 4PJCB 5LBSL 3ZKXC 4QG6A 3FU7B 2E7HA 2H41A 3N2JA 4P2QB 3DFSA 2EIEA 4PRHB 1DJSA 4LNCA 3AHZA 4PRAA 2CZ5A 5D5MB 4U6YB 4XRCA 4PQXA 1Y8BA 1CL7I 2DFAA 2ISVA 3LNPA 4W4OC 2H3BA 1XXDC 4XPFH 1T22A 1Z48A 3R4RA 3AWFA 4D0CA 2X6CA 4OCSL 2FZ3B 4D2JA 1IM3D 1BGAA 4DN4L 1DJXA 5IEKA 4MD5A 4M8UA 3MNZB 3EOTL 3FT1A 1UB5A 4R34A 3RBGA 4NO3A 2EEXA 3VA6A 4MXWL 3BKMH 3D8MA 3NPSB 5CPNA 3X3GL 2YCEA 3BPLC 4HBCH 4UT9L 1I9IL 2R7EB 1AZUA 2V2XB 3BEVB 4A6YH 2XPKA 1OTUC 5CNHA 3PDDA 3RWFB 2NNCA 3APGA 4O2FA 1LLZA 3QFJE 4F9LC 3RX7A 4UMCA 3FCPA 2XCMC 4MY8A 4UU9A 1IL1A 3EUUA 1KIPA 4HP5A 2IGLA 3CFKB 4Y9PA 3SGEH 4KXDA 3AXHA 5F3HB 4Q6KA 2Y6SC 2AV1A 2R0ZH 4APQB 4DZBB 3QCVH 1RA0A 1RK0B 4O8AA 1S7SA 3MROB 4RWYH 4LDOB 2FUTA 4LRNH 4F9LA 4R7DB 4DJFD 4QTGA 1TRIA 3UBXI 3WTTA 4U1KB 5AUMB 4GAGH 3W25A 3DRTA 4PJ8D 1UM6L 1DQMH 3FQ1A 4WSHA 4C59B 2Y4SA 5TDOA 4UQAA 1RXOB 4ABUA 4W6YB 3KW7A 2A9ML 1IR2A 1F8TH 1XC4A 3EMQA 1I4FB 3SOTA 1NFGA 4WW1B 4BKNA 2OJ1A 4A4AA 1MEXH 4QIRA 3OVPA 3PV7A 2WAGA 4MD0B 2EVGA 4LC8A 3JR2A 3VXSA 5HXMA 5C0AE 2DV0A 3C87A 4DPBX 3RR4A 4KK8C 4BWTA 1MWAH 5BRBA 2V5TA 3H8NA 2A83B 1RJYB 4NAFA 1XYBA 4Q0XH 3PS6A 1YEEH 5C0FA 1S5WA 3CK0L 3TASA 1FVEB 3CXHJ 5E6YA 1S4IA 3EGDB 3TR2A 3MMEB 4FQJL 1Z5LA 3WZ0E 1MRCH 5G55A 4M7LL 1HQRA 2O92A 4Z0SA 2J8OA 3NJVA 3W0WA 5L2JB 1W15A 2Y36H 2QDEA 2R1PA 2GC7C 4YS1A 2G3NA 1MNUL 3KL3A 3NFPA 1Z41A 4D9RE 5BS0A 3TF4A 1GAFH 3C5ZD 4PMQA 1OT2A 1X7IA 1M68A 4NO0D 3GS6A 3MZNA 4YQXH 2BTMA 2BIPA 4IRZL 4M6NH 3HJZA 2NQDA 3OKYA 3TEVA 4DELA 3MKKA 1GYUA 2PWGA 3KPOB 2V7NA 1H7RA 4URKA 3UZEC 4ZZFA 1UZ6F 3VI4F 1PCWA 2VUKA 1A6AB 2ZJSL 3GC5A 4DK5A 1TZHB 4OI7A 5HHQA 1EOMA 1HFBA 1ECYA 5HWNA 3I6KB 3BW2A 2AJXL 2FGWH 2Z2UA 4LCRA 2FB4L 2QSCH 2X30A 1DVYA 1KIRA 3BEWA 4R33A 4XWOD 3UZEA 2X2IA 1JUKA 4K39A 4H9TA 3VRIA 2CJ3A 3FKRA 4IRJB 4ABWA 4WVRA 4U3CA 5HNUA 3IK4A 2HRWA 2CLEA 1VFOA 3GRWA 2V3FA 2WZ0A 4KDWA 1E90A 4KKAC 2HX8A 2YXVA 4FPSA 1BZDA 5ABFB 5I1AB 4G71B 4I89A 4ZO6A 1UGKA 4YGVA 2G95A 4U6HA 1NFIA 2PW1A 1Q1PA 4ZPVA 4QS6A 4BV1A 1CENA 4CL7A 6ALDA 3L3JB 2YYUA 4KCUA 1M71A 2EC9U 5E9DA 2BRQA 1FZMA 2V3DA 3UTQB 2Y0SA 1V02E 4XKMA 3Q8AA 1FAIH 3I50L 5DQJA 2BZNA 5J6GB 2O93L 2HMIC 1TZ9A 1EHXA 2CHOA 3FCSA 3CZUB 3PUDA 3T81A 3ULUE 2PO6B 2FHBA 2CNCA 4FNSA 2EAEA 4X6FA 3LEYL 2NTFB 1U93A 3WU1A 3RDTC 1DVQA 4XN4A 5CZSA 4C55A 4Y19E 4QRPB 3TZVB 4Y5VC 3TVMC 3BWUC 5F1OB 4GKTA 3TBVA 3FQNB 4XNDA 4AGLA 3CSPA 4DP2X 2FHFA 3C60B 3MYZA 4E5XB 2FBJH 1S5IH 3BPOC 1N8IA 1ZHKA 3RDTA 2PB1A 3QNZA 4P5RA 4Y5VA 3MUCA 2X12A 2J12B 1NMCC 1UXLA 5FUOH 4GFTB 3KHJA 4KI5C 3IDJB 4Q4EA 3RX3A 4YDLB 3OL2A 3L66A 3GRGA 5D72H 1UC6A 1O66A 4GPNA 4EI6A 2LU4A 3WOVA 5IQMA 1UQYA 4FOUA 2XXCB 5LNVA 1I8JA 2W0FA 4D1JA 1VACB 4R26L 4WAFA 1XC6A 4OSUL 1A3XA 4ZVJA 3ZYJA 1MHHB 3DOIA 2WTRB 4ZENA 3ECQA 4IPJA 1EC8A 4D9QD 4NWUL 2UXFA 3W7IA 3BJLA 1U3HD 1AP2B 4JHBA 4C90A 2OTUA 2ZZUT 5KUMA 4XNBA 3LZ5A 1CQKA 4HW6A 3RO8A 4KJYA 4Z1BA 5A6TC 4HJUA 4PMOA 4K1GA 1HXKA 3AM8C 3P82A 5DD5H 1BZOA 4LT9A 4Y9BA 1CD1B 4RAUB 2V8LA 3FIGA 1QFWI 2QR0A 5E0FA 1QWUA 2FTPA 1MCHA 3CZGA 3DUHA 5MERA 4NKMA 3NJJA 2RB8A 3MRRA 3TA3C 4IIEA 1JV2B 3B2UD 2UXGA 3VXGA 3AM8A 3VU2A 4WKAA 1LT8A 2VLJD 5TPWL 3PC0A 4XPAL 4ORGB 3FQRB 2OQHA 3M9YA 3CCHB 5DRZA 5LBSA 3F7KA 1R3SA 1QO3A 4FHKA 5BCAA 2YUWA 2W80C 5PCYA 4AUJA 1V4YA 4Z1AA 1OP3H 3STLB 1IGML 3TA3A 2AGKA 4RDQF 5HUOA 1T2QH 3BFWA 4AG4L 1U6AL 2WKGA 5IMLA 1AO7D 4OFPA 3OC8A 2CU9A 5C07D 4OI8A 4GH3A 6CGTA 4ZQCA 2GKIA 5BV7H 3DHFA 4P3DB 2ATKA 1JRHH 4U4MA 2NNRA 4UQ3A 3DAQA 2BVQA 3WFBH 4GABA 5GGQH 3QMRA 1MREH 4P4KC 1JK9B 1HEJC 3H2MA 1GCYA 3BW4A 1S7QA 3OO2A 3PLYA 4OF6A 4XB8A 4M93C 4PEEA 4DJEC 1C5DA 4UT9A 5AB1A 3AQUA 4LSPL 4PJHA 4Q52A 1ID5I 4QRUA 3O4LB 3ARZA 1JCJA 4P4KA 1BYOA 4Z2KA 3OHXB 4WWKD 4JE0A 5D7IA 2A6DB 2FH6A 4XMTA 1RAMA 5BJTA 3W56A 4ZUTB 3RAJL 1UP2A 3ZZSA 1VESA 1TA3A 2JGYA 1CW2A 3M1BA 1D2OA 1W6LA 1KGUA 1ZFJA 3TO2A 1UR1A 2OZ0A 1WTGT 3UG8A 3K5XA 3TMLA 2DRUA 2QHRH 3H2AA 2GVEA 3JTSB 1H8NA 3V8OA 4MMXB 4KRPB 3KPNA 4RGNC 2ZTKA 2QJNA 3DYOA 3VRLF 3CFEB 3QEGH 1UHVA 3VO0A 2A4EA 1E9LA 2J6XA 4HGWB 1RCYA 5JMRA 2WB1A 3S48A 4S0HA 1H5VA 2EKSB 4XOAA 4FF5A 4BFEA 4AUYA 4IL0A 2VZVA 4P07A 1XUZA 3P2VA 1YMMA 4JM2D 4KZDL 1AXTH 1KN2L 1EEXA 5CZ0A 4PC8A 2BNQD 5I0YA 4QXGH 4Z2IA 1OAUH 1H7XA 1NF0A 3W6YA 2H4EA 3II1A 3RP1A 2B2XL 1HNGA 2D2HA 1EDYA 4JRYD 2Y63A 1ZK5A 2CLFA 3HZKB 1AGBA 2GDVA 1E4XI 4DKFH 4KWSA 3L4ZA 4GRLD 5IREA 3UZQA 1TJMA 1IM9D 2C3ZA 4GINA 1FORH 2W0PA 5TAOA 3ZYOA 1J8HA 3QJFA 1SY6A 3U9IA 1QR7A 5C7VA 4QRRE 1KJ2B 1SYSA 2MNJB 2CLRB 4P2RD 1KXTA 2NY2D 4YHNA 4IRZA 3LQZB 2VDPB 4NM8L 3P3YA 3PJSB 3NVQA 2NY4D 3A0OA 4U6XA 5JOFA 2B14A 5GNYA 3KPLA 1J12A 4NN5B 3KPRE 1F45A 1ZRUA 2JCWA 5I71B 2C1HA 1SHXA 1VS1A 1A4AA 1BBDL 4CSSA 3SJVB 3C2SA 5E4OA 5H8UA 3EOYG 4P2QD 4MDRA 4PRHD 3RVUD 1US0A 3OR7A 4RZ6A 4K3DH 4WTZA 1L6GA 3OKMA 3LHVA 2A85A 2E9BA 3CAWA 2ON3A 4RNRA 4O13A 1FWBC 4A05A 3GU2A 3WS3B 1E8ZA 2EPHA 4E42B 2J7GA 1OAKH 4NKIL 1P5UC 3OAYH 3ULSB 3QY8A 4EUPG 3T2LA 3MBFA 2EKJA 3ZFHA 3SJNA 1OD8A 5BZXA 4QR6A 4WJEA 4OZ4B 4O28A 2BX5A 3OAZH 4KRNA 4UT7H 1S2CA 5J1SC 2Y7QB 3ULUH 5A43C 4UUJB 3E6HB 1RZJL 2X2YA 4XO3A 3QIBB 4OU3A 4NFCA 3W2DL 1QR1A 3DI1A 4N3TA 1R19A 3ZS4A 4S3DA 3WQFA 1A5LC 7REQB 1BAFL 3AADB 4APQD 1MRAA 2WIMA 4M9PA 4B3KA 5KJRL 1J05A 2NOYA 5D55A 5JXAH 1MFMA 3T0EC 1XGPB 1IQ8A 3MS8A 1PLGH 2V9QA 1NCAL 1DBAH 5D2LE 4ZDHA 1QPRA 3GSVA 3VIIA 5I1JL 3QSRA 1MWOA 4YC2B 3S1WA 1LRNA 2CKNA 2BHUA 4NL1A 1VGKB 4U7SA 3VIOA 3S6OA 4YXHH 1VGAA 4GS7C 1VJIA 1CLZH 1K85A 4M4RA 4AENA 1D2PA 5JO5B 5I3DA 2HTKC 1INEL 4ORZC 2YLHA 4JL1A 5DURD 3DTXA 1N7KA 1TR7A 3B8UA 5DELA 1Y5XA 4YWGH 4M5YL 4GLRI 4IG2B 1W0VA 1FC2D 3CUHA 2X87A 1QBML 2FWOA 2AJVH 2BVEA 2KQNA 1QLFA 4JL2A 1DJWA 1NCUA 3A9BA 3OA3A 5AW8B 1XIWC 1NGYA 1G0XA 4G7FA 4ZO7A 2VDQB 1B2WH 1EVUA 4MBOA 1E42A 2YD3A 4NY2A 1PEZA 5I6XB 5E7BA 2WINA 3QZWB 2WWMD 3RRXA 3W1XA 3FZUD 4FOKA 3INPA 3QIWC 4HPHA 2UV3A 4NPJA 2BCKA 1TEYA 5DUML 2P3ZA 2G5BA 3PZ9A 1XIWA 2DI9A 3DBSA 3NNTA 4YTQA 1L9TA 2QGDA 1AR1C 1O5XA 2EDLA 2G30A 3QYMA 5EFFA 3CHQA 4AGNA 5JOPD 3H2FA 2DEXX 3FB6B 2JTYA 2HNEA 1G94A 1DORA 3QIWA 4O1BA 3F03K 3UZVB 3OZ9H 3LPOA 5JU6A 1XCTB 4F7CA 3NAAL 3WBAA 4BA0A 4X6CB 2JB6B 4O02L 1JZ5A 1FQ0A 4PBEA 4IMKC 4AD4A 2J1ZA 2JIXB 1IAIH 4GAFB 3PDGA 3ULVD 1Q6EA 5CPSA 5IG7A 3WD0A 3ZIZA 3VZZA 1MJJA 2D7OA 4DVOA 1P7TB 5EORL 4IRJD 3TNNB 1IEVA 3D47A 5DRXA 1EO7A 5EUOB 4OM0L 3WD5H 3VQ1C 4P2OC 3GC4A 4P5MA 3X17A 3SGEI 3STZB 3HAEH 2Q7YB 1NGXB 1I8MA 1HXYB 4ANWA 1A6WL 3LAFA 1XGEA 4EWJA 4NRXA 4Q6JA 1N64H 5SWUA 3IWUA 4P2OA 4U33A 3MMUA 1RUKH 3NIYA 3ZE0B 4ONFH 3WFDH 2Q6WB 1AMXA 1WO2A 4JQ4A 2DQWA 2NYYD 1RSFA 4WGWB 1J96A 1S3RA 2MQ3A 5DRNA 2ZCHL 2G3ZA 2XM2A 1FYTB 9XIAA 1VIWA 5DJDA 3VFGH 2PO6D 3VNLA 3PHQA 3HG5A 2Q8ZA 2OMYA 5BNKA 4LTSA 1LTDA 3S2CA 1PX4A 4LQFH 1IE4A 3O4OB 3S97C 4QRPD 3TZVD 2PLKA 3UETA 1RJQA 4W7UA 3MLVL 3OJDB 3U36A 2VDOH 1UYWH 1FGVL 1WE5A 1XGUA 1O0VA 3P61A 5FA5A 3C60D 3AHVA 4TVPL 1VADB 1KFEA 1BXUA 2YAQA 1UWXK 4H2AA 1YRKA 1FV1B 1YEIH 2W5PA 5EMLA 1NBCA 4TL4A 2WJDA 2HT3C 1JGUH 3EOBA 5KAQG 2ACRA 2FO8A 4FYQA 4JZ5A 1UA6L 2NX5E 4Z77B 2J62A 2F54B 1XG4A 4N0CC 1X5KA 4DYKA 3SN6N 1U8OB 5EU6A 3OLEA 5DHVA 2YBRA 3OJMB 1UKPA 5G4WA 4XC1L 5F9AC 2K4AA 2IDFA 2X0WA 4E3VA 4GKZA 4ZB2A 1IEAA 4UMSA 3WEZA 4ZODA 4D8OA 4HCFA 4M6VA 3J27A 2JXMA 1WBZA 4P46B 4NI3A 4V1XA 3CL7A 2YR3A 4OGZA 1NDMB 4QGYA 3N1AA 4FQCH 5AVRB 4AYGA 4ML4A 3ITGA 1GOKA 3S9ZA 4PJFF 2ZCKL 4YPGA 2KHAA 2ZNWA 3GVRA 5BVJB 1FF5A 1R0AH 3HOJA 2KUTA 3WHXA 4X4XB 1RZ8B 1E9IA 4KJWD 5A6SA 1AFVH 1E27B 4EUPA 1H49A 2PP7A 4LSSL 4KK5C 4H40A 2ZXBA 3KVKA 3WUWB 3RLVA 5JYLA 3GKZA 3IDIA 4GRWF 3WAKA 1OWWA 4POCA 5IZ7A 3TJ4A 3QKZA 2DLGA 4NILA 3MRJB 1SFTA 2AKRB 3CZNA 4JO3H 2YBGA 3GHBL 5I8EA 1XDMA 1GGUA 4HKZA 3O6FC 5EO1A 1I3UA 2BFGA 4DUOA 4M7JH 4IBQA 3SDCB 1BFOA 4JD4A 3QQ9C 3Q6GL 3G8RA 2VXUL 1S5HB 5AW2B 2B1HH 5IJVB 2R1KA 1KBPA 4QE5A 2BSCA 4MB3A 3Q4DA 3TU6A 2DY2A 4S1DC 2GITB 2C3VB 3O6FA 3HE6B 2Z29A 2A9NL 2C19A 1NWUA 2QUTA 1T0MB 4LCIH 1E5JA 3PPCA 1E1CA 2C9UA 1CD0A 1AOZA 4P9MH 1RZJC 1ADDA 2APTA 1XCFA 4XBGB 3QRGL 1S46A 4BHUI 2ZXDA 2XGIA 1E5BA 2MNUA 2Z28A 1NAMB 4IFKB 3KWVA 4AE0A 4RGOH 3O4LD 4FD0A 4E9WA 4OJDH 1IF2A 2VXVL 1ND0B 3R43A 5JHDB 2VDMB 2OMZB 3G6DH 2NY5H 2INZA 1JD9A 2OCCB 1GVIA 1J8VA 1GHSA 3BUBA 1PSKL 1SVBA 5CCKL 5IVOA 5CINH 1UXSB 3LERA 2N3JA 3RFAA 3B83A 4EXPX 2X6VA 4X6DF 5L2KB 2XN9A 1MEIA 5IOPB 4EXAA 1QRKA 4OAWA 4OZIB 4H8NA 3EWYA 3QZNA 4ZB0A 4PJGF 2ZUMA 4KRPD 1BW8A 5F6IC 1F3RB 2Q2LA 2ZRVA 3QCUL 5HHOE 1F73A 3FB7A 4AGQA 4WEEA 1ZLSH 4QDGA 3IJYB 2EDKA 3ANVA 1DBTA 2WMIA 4PREA 1MEHA 3VX0A 1C9SA 5CBEA 3SUSA 1XEUA 5EZOL 5FA4B 3K2IA 3AUWB 4BFAA 3FL7A 2F1EA 3VIGA 3EFOB 1B57A 3AWOA 1PZAA 3AXKA 7TIMA 3HFTA 4HNNA 1UT1A 4PJEF 2NV9A 1BWMA 2GK0A 1NGWB 2WZEA 3GFUA 2E40A 4B41A 1BQUA 1MJ8L 4ZUSB 4E9LA 3P4OB 1ZHAA 2PXYC 4HIEA 5LWYH 3U4EB 1XO8A 5I6MA 4PBDA 1UWYA 4XCCL 4E6MA 5G1MA 3GBMH 4A2EA 1VIZA 3GDBA 3KYAA 1W54A 4K73A 5E70A 1UOVA 5E2TH 3P77B 3LKNB 5F72S 2ZSWA 5KWYC 3B9KC 3JWDH 2PXYA 1J01A 3I85A 4K5PA 1TQTA 2R1YB 4G43B 2CMRH 4G9FB 5EC1B 3T6WA 5C0JA 2EICA 4C47A 5DHEA 1D8WA 2P24A 2BXZA 3B9KA 1WFOA 3WEOA 4POUB 1K3IA 3WNKA 3P3BA 4LSBA 3SJVD 1LUCB 1QDSA 1QI4A 1EXGA 2ID5A 4L80A 5GJTH 4O02A 3T71A 1K8XA 3ARFC 4NFDA 1P6BA 3AREB 3OGRA 1L9QA 3H3BC 3UJTL 4GSRA 2ZWZA 1OY3B 4LAUA 3S37L 3TYUA 5C0BA 1KCBA 4BXSV 3CZKA 2GJNA 3OMNB 1A1OB 2EACA 4JKNA 1M2VB 3JVGC 5GGRY 6XIAA 5B1AB 1SFLA 3L0KA 3MRIB 1W1B1 3P9WB 4PTXA 2G2NA 3ARFA 1S3KH 1JF5A 1U8CB 3LEVL 1IGCL 4LEXL 2CC0A 2BVDA 4BQ4A 3FXIC 4GW5A 4LBUA 4QXWA 1GS6X 3JVGA 1W8EA 3WFEH 2VEFA 4E0RA 2V2WA