1XD0A

Acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase
publication title Acarbose Rearrangement Mechanism Implied by the Kinetic and Structural Analysis of Human Pancreatic alpha-Amylase in Complex with Analogues and Their Elongated Counterparts
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xd0A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xd0A01
1MW0A 3GXIA 2XSBA 4FMVA 1E3XA 2J78A 1X6NA 3UR7A 4ZE5A 1HKJA 1G5AA 1UWUA 3SUUA 4IISA 5FD0A 2CKRA 4UZUA 3LPPA 4PTVA 2WZIA 2GK1A 2E8YA 1BVZA 3SEPA 2XN2A 5FCZA 1GZJA 5A6BA 3N17A 4OBSA 1HVXA 4ACZA 2VRKA 1WNOA 2XVKA 3PZOA 4J3WA 3G6MA 3AXIA 1C90A 2A3CA 1XCWA 1WDSA 5A8NA 4ZFMA 3W6LA 2CERA 3LRMA 2YLLA 3A6OA 3N9KA 2DT3A 1GQLA 1US3A 4TTUA 4MNLA 2XGIA 4P7QA 5IHSA 1J12A 4A4AA 1XC6A 3BLPX 3KLLA 3BGAA 1CGUA 4YN5A 1B31A 4AISA 4EK7A 1NOFA 1V6WA 3VINA 3K4DA 2OWXA 2XN0A 3VPLA 1HKKA 4UOQA 4RE2A 2HVMA 1KFWA 1W9PA 4OZOA 4MB4A 2CPUA 1V3KA 1XV8A 3G6LA 4NXSA 2WVSA 3S5ZA 4PMYA 4WSKA 1M53A 3CPUA 2BY0A 4ZXOA 4JFSA 3BUBA 1BG4A 4D6JA 4PUEA 2JIEA 3HN3A 2ZE0A 3OIHA 1PZ2A 2Z1KA 2VURA 2QMKA 3BVTA 4WK9A 3ARXA 1B3XA 5JIWA 3VO0A 1QI2A 1JZ2A 1DHKA 3TONA 2WVVB 1CXKA 4Z2KA 1CWYA 2E0PA 3ZJ8A 1XGZA 3ARVA 4D6GA 2DT2A 2XYLA 4CU7A 3GNPA 4UQBA 3CZSA 2J7GA 1X6LA 4AMXA 3U7VA 1JNEA 4RL3A 3K8MA 2CNCA 4XZWA 1BG9A 2V3DA 4FF5A 5JBDA 2OWWA 1KQYA 4A3HA 1CYGA 3VILA 3HG3A 3S6TA 3VDBA 2V3GA 3BUPA 3N15A 3RPMA 3VGBA 1L8NA 2F1BA 1ZBKA 4ZE4A 3QR3A 3AIWA 3CZLA 1JXJA 1XSJA 4PMDA 1A47A 1OT1A 3EYPA 3D51A 2X2YA 3WMBA 4HOWA 1G1YA 1UD3A 1ZBCA 1AQ0A 2F61A 1WB0A 2J7FA 1E6RA 3B9AA 3WQ6A 4W5ZA 1MXGA 1N82A 3FAXA 2WC4A 1AMYA 4UQ9A 4CN1A 2BVYA 1B1YA 2VR4A 4W7UA 4PRWA 1SFSA 3GH5A 3M46A 2A3BA 1TQWA 1JYNA 3BVVA 3CZKA 1UZ1A 1B90A 4S3KA 2X05A 1WZLA 2G3MA 3WBEA 4AZGA 2YL6A 1WKYA 1HL8A 2J74A 3EMQA 4UQCA 4PMVA 2J75A 2XIBA 3DX3A 4UOZA 4MAVA 4DO4A 4UOJA 2D3LA 4FLSA 1PIFA 1OD0A 2YFNA 3VDHA 2BNJA 3N1AA 2IGTA 2YA0A 1E4NA 3K8KA 1X1NA 5I23A 3GH7A 5EFFA 2VR5A 3AMDA 3BAJA 1NQ6A 1OWQA 4PYSA 4LXFA 1MW3A 4UQAA 3ARTA 2E8ZA 1GUVA 1CBGA 2G3NA 3AMKA 2VUYA 2BY2A 3OA5A 1OGGA 2XJ7A 1TE1A 2XFRA 1EGZA 1V0MA 4Q22A 1E6PA 4W7VA 5FL0A 4LYQA 1JYWA 4BF7A 4JFUA 2GFTA 1EQCA 3AS1A 3T0BA 3EJRA 5A8PA 1KB3A 5HPCA 1XH2A 5JIPA 5CPSA 4H04A 2EPOA 1LQ0A 3E1F1 1KBKA 4EE9A 5A6MA 2TAAA 2G41A 4W8BA 3NSNA 4GZIA 4J7RA 5DEZA 3HJEA 4P8WA 3TOPA 3T0DA 1JZ6A 3WN6A 2F7QA 3AQUA 1CLVA 3CO4A 2DT0A 4RE3A 4B9YA 3AICA 5GNXA 2XVLA 4PSPA 3T09A 3OZOA 3WEOA 1P6WA 1KWGA 2A3HA 2V3FA 3TV8A 4HA1A 2DSWA 4P7OA 1BAGA 4FLRA 1D2KA 2D1ZA 1V3IA 1CPUA 1GOIA 1V0LA 2EXOA 5BYWA 4CVUA 3AXHA 1JZ7A 4R5EA 3IGUA 2VCAA 4AIEA 2BHYA 3VGEA 7A3HA 1VRXA 5D9MA 1K9DA 4IPLA 1BQCA 1XSIA 4FNUA 1QWUA 2DIEA 4KWUA 1V6YA 2YLAA 1GNXA 1HJSA 1JZ4A 2BHUA 3BLKA 4DO5A 2E9LA 1B3VA 3VGFA 3WDHA 4URIA 1R33A 1E6XM 3H55A 2Y5EA 1UKPA 3PBGA 3DDFA 1E9LA 4W84A 4HA3A 3I3BA 2D0FA 2WWCA 4E8CA 3F4VA 3GDBA 3ZSSA 4AD0A 1DWIM 1UHVA 2EAEA 1Z32X 4C7GA 1JAEA 4MB5A 1CXEA 1NWSA 3A23A 5AY7A 5A8QA 5I0DA 3OLGA 3L4XA 2XIIA 1JD7A 4XX6A 2BV9A 2OSYA 1E70M 2PWFA 5E6ZA 7TAAA 1E1FA 4AWEA 4AZBA 1CGTA 1UD5A 2VX7A 3ALGA 4MNKA 5I78A 1MXDA 1ITCA 3EJTA 3LPOA 2ZX8A 1EDQA 4W87A 1TA3B 4OJYA 1R46A 1W9UA 1VJZA 2QF8A 3W53A 4JZ5A 3DX2A 1H5VA 3AIRA 3CUHA 3TTOA 4PN2A 3BAYA 2ZXQA 4KRUA 2F7PA 3S2CA 1RP8A 4HZ7A 2CETA 4JKMA 1OB0A 3APGA 3EDJA 4B16A 4WLCA 4MNMA 2X8RA 3VIIA 3SCNA 3AYRA 3WIJA 3NDYA 3OLIA 1E6ZA 1GONA 4UFLA 1UH2A 1VFUA 1NARA 1GOKA 4ATWA 2F18A 1US2A 3DX0A 5FL1A 2WSKA 4M80A 2VVSA 2WCSA 3SURA 4XZBA 1GHSA 1PX8A 3SCQA 1EO5A 4AEFA 4CCEA 4IPNB 1EXPA 4AIOA 4HTYA 5IFPA 3A4WA 2VX6A 3WUBA 3SCWA 4UFHA 2GDVA 4ZEPA 3AZRA 1JFXA 3FY1A 1ISVA 2X2JA 2OSWA 3LXCA 5GQBA 4MB1A 4TTGA 2EPMX 4ATLA 4NSBA 4DWSC 1FA2A 3VIJA 1ISXA 3PHAA 3D4ZA 2A3EA 3WEZA 2YDRA 3RM9A 1B0IA 1H2JA 2DH2A 2WBKA 2ZXAA 3MU7A 5JUVA 2PF0A 3ZT5A 3AI0A 1T0OA 2D2OA 3TP4A 2VRQA 4MTVA 3MV11 3HU7A 2BVTA 1UZ4A 3CUFA 5DF0A 4W8LA 1GVYA 1LLOA 4C7DA 1ODZA 3PN8A 1Y7VA 4BQ4A 1W9BM 1LJYA 2X1IA 2ZUWA 3CLWA 4CUCA 6A3HA 3NCOA 2W4XA 4PUDA 2X0YA 3WNPA 5C71A 3EJSA 4X9YA 3NDZA 3BC9A 3CMGA 2VJXA 3SCPA 1QNOA 3PTKA 1WZAA 2RGLA 4CD8A 4L4OA 3LPGA 3VD3A 3WEMA 3BUDA 2DT1A 3ARQA 5GPRA 3WDPP 1NWTA 1UWTA 3ARPA 2G4FA 4UTFA 1KCKA 1WDPA 4GQRA 5BXPA 3AHVA 1PAMA 3PZIA 4HA4A 5I5RA 3K4AA 1PIGA 2ALWA 4P8UA 1H1NA 3RM8A 1LL6A 1B3ZA 3J7HA 1DWJM 2JE8A 1LG2A 3EJPA 4CD5A 2ZIDA 4QLKA 1W91A 3FHAA 3WDJA 3W29A 1ITXA 2YL5A 4PCSA 4M24A 1EH9A 5BXTA 4J3TA 2XVPA 1FH8A 5E0CA 4CD6A 3HG4A 5A6LA 1K9EA 3TTQA 5HBFA 3FXYA 4CGTA 2J8GA 3ARZA 3L4UA 1OGSA 2NT1A 5EFDA 5D9OA 1CXLA 3WNOA 4PMUA 3UESA 3WF3A 4UFJA 4X0VA 3WY3A 4U2ZA 4BZYA 6CGTA 2VT0A 5ABFB 2VZSA 4LYRA 4J3XA 3AHXA 3EDFA 2J7HA 2JFEX 3BAKA 2O9RA 5CPTA 4K68A 4Z2HA 1SMAA 5CQ1A 1UR1A 1UWSA 2PC8A 3F5JA 4BS0A 1JL8A 2O92A 1E71M 3ZQ9A 4MB3A 5A1AA 3DYMA 2XM1A 3CUJA 2V5CA 4GQQA 1C8YA 4H41A 4DWSD 1UR8A 1OIMA 2FE0A 2PBOA 2VZVA 2GVYA 3BSGA 2YFOA 4OOZA 3ZT6A 2XG9A 3CHEA 2QMJA 4ZENA 4D6HA 1E4MM 3GBDA 3LX9A 3KL0A 4M29A 3VNZA 2WMFA 5AYBA 1ODUA 3MKKA 2WHKA 2JF7A 1J0KA 4KRTA 1WZMA 2V5DA 5HXMA 2WSPA 1DWHM 4D6CA 1XD1A 2WZEA 1TA3A 4MNJA 1UWIA 4JAWA 2ZX6A 2WBGA 2VMFA 2QHAA 1QW8A 2WHLA 2WAGA 3OBAA 3IANA 4N42A 2Y8KA 1VB9A 1K9FA 4KGJA 1WPCA 2D73A 5JBEA 1ISWA 3NIYA 2EO7A 1BSIA 4QDMA 3SUVA 3AHYA 1VEPA 4AZ7A 1VEOA 1W32A 1E5JA 3WFLA 2YIHA 5A8OA 4UQDA 5I24A 4B3KA 1O7AA 3VIHA 2G3JA 1E73M 2V3EA 5A6SA 1JAKA 2CYGA 4DWSB 1AQHA 3DHPA 3CBWA 4L4PA 3VIKA 3WUGA 1HXJA 5A2BA 2E9BA 5E6YA 4NRRA 1HJVA 3O9NA 1Q4NX 1I75A 4PSRA 2WCAA 1C8XA 2WPGA 4AMCA 1C7TA 5LA1A 2WHJA 3B9DA 1E1EA 1E72M 2GJRA 2F7OA 4CN4A 1ZB5A 3VIPA 3SUWA 3VVGA 4W89A 2YDQA 3ZJ7A 2O9PA 2J4GA 3THCA 5DT7A 1UQZA 3AIUA 1QPKA 1CXHA 4M8UA 3BCFA 1J0JA 3ZJ6A 4LGXA 3CHDA 4DM1A 4H2CA 1UH3A 2CBJA 3WH9A 1UQYA 4U3CA 3ARWA 3GBEA 4BCEA 1W9VA 1OGBA 3PZVA 1NM9A 1ZL1A 4J28A 1JF6A 1WP6A 3ARYA 1JNDA 4MDOA 3VIMA 1OCQA 2BY1A 1H49A 3GXNA 1ECEA 3U5YA 5TD4A 1BF2A 3T08A 1R8LA 1JYVA 2BXYA 1FP9A 2J7DA 4XB3A 5CG0A 3WF4A 3CIVA 2NW0A 1TCMA 4AEEA 4U31A 1CGYA 4CU8A 1DP0A 1QVBA 4WKAA 1UUQA 1JD9A 1CXIA 3D50A 4BQ5A 3DDGA 1Q6EA 1ZJAA 1TQVA 4PBGA 3WH5A 2ZX9A 3MSDA 3AISA 4GKLA 1E0XA 4TVCA 1VIWA 4HOXA 2DQXA 1JIBA 3SCOA 1NH6A 1EDGA 3B9EA 2ZXDA 3CZEA 1E6QM 2JF6A 1GCYA 4P7NA 1R7OA 4RE4A 4U3AA 1E6NA 3CHFA 2WLZA 1E3ZA 3M7SA 1R47A 1D3CA 1D7FA 5FOOA 3DX1A 2YDSA 1C93A 4GO9A 1FP8A 3SCRA 4TVDA 3ZSTA 5DO8A 4HU8A 1TZ7A 2WKLA 3KWXA 5ECUA 2EPKX 3K1DA 3ARSA 1I1WA 3LPFA 3L2LA 1I1XA 1VFFA 2ZX7A 3OGRA 5CXPA 4DUWA 1KGWA 2W67A 4P8VA 3LRKA 3ZM8A 4WKHA 2YBUA 3AMLA 1BYDA 3W82A 2DSVA 3VU2A 2XVNA 1WZKA 2DH3A 2EADA 1TUXA 4HPGA 4AZIA 3WQ5A 5A69A 1XYFA 1TG7A 3QHOA 4NZCA 1H3GA 3WUEA 3PZQA 1OSEA 1B2YA 5ABFA 1IV8A 3W37A 1UR0A 1YQ2A 3JUGA 1BGGA 1UG6A 3N18A 5JBFA 5I3DA 1MYRA 3VGHA 1BYBA 3LMYA 5A3HA 1QHPA 3WL0A 3WNKA 1J10A 2FH8A 1E56A 4NI3A 1NP0A 4OUEA 3WDQA 4AC1X 1LWHA 2V38A 3AIEA 1BYAA 3GXFA 5BXRA 4F79A 2E4TA 2WWDA 3KL5A 2YA2A 1XCXA 5BXSA 4HZ6A 3AS3A 3I3EA 4B15A 2WMHA 2DGAA 3ECQA 3LRLA 3NSMA 2CXGA 3KE0A 1M04A 4YHGA 3WFZA 3HZ3A 3L4ZA 1C8QA 3MUAA 2WMKA 4MPKA 2O9OA 1E0WA 3TA9A 4AD3A 3N04A 4J3UA 1K9TA 3FHQA 4ATDA 4LPCA 1UD2A 3TTSA 1E40A 3WQ8A 4EANA 2DIJA 3BXWA 3VGGA 1FFQA 3WELA 2BXZA 2WC3A 1B30A 1BLIA 3CZNA 1UASA 3A24A 1F4AA 4UCFA 3ARUA 3A22A 4GZEA 3II1A 1PJ9A 3KL3A 2DSKA 1M7XA 2EACA 1KXHA 3WNNA 1HL9A 2ZICA 4OGZA 3PZ9A 4W7WA 4CU6A 5AC5A 2Y24A 4GI8A 4H8UA 4E4PA 2OW6A 2VNCA 3IJ7A 3UCQA 1GORA 4U2YA 3WD0A 3WKZA 4R27A 4AIUA 3D5HA 3WD2A 4DWSA 1GVIA 2PWDA 4YHEA 3VGDA 3RJYA 1PBGA 4GIAA 4W85A 3D3AA 4AZCB 4QAWA 3QGVA 3WY1A 1PX3A 2VCBA 1HX0A 1RP9A 4JL2A 1BYCA 2YOCA 1QNSA 4H8VA 4PTMA 3A5VA 2BY3A 1GQKA 4PCTA 2YBTA 5E09A 3SCTA 4IUGA 1SZNA 3WENA 1C7SA 1YHTA 1W1TA 2X2HA 3CHCA 2W5FA 1W3LA 4W93A 1JI1A 1EHNA 3VSVA 2XSAA 2WVVA 2ZWZA 2OYLA 1J01A 4ACZB 5M17A 1R85A 3WMSA 3SUSA 1QI3A 1QNRA 2FHCA 1GOWA 3SCSA 1BHGA 4TX6A 4JFVA 4JCMA 1ESWA 3WY4A 5I77A 4HZ8A 1H09A 4S3JA 3SIMA 3HG2A 1E55A 3MMUA 1UOKA 3RO8A 4CN6A 4ML4A 1V08A 2ESCA 2IUZA 3GNRA 5BROA 3WY2A 2FGZA 4DM2A 3F5LA 3HMCA 4PTXA 3BMVA 1JGIA 1KGUA 1UH4A 1UKQA 4AW7A 2PWGA 1TMQA 5KEZA 1MQPA 3N13A 1CTNA 4C7FA 3AZSA 3PTMA 1W1PA 1TQSA 4QFUA 1JI2A 1GOOA 3O2LA 4PMNA 1JFHA 1MW2A 1XYZA 3OB8A 3CMJA 1B9ZA 5D9PA 3RILA 1CXFA 3L4VA 3QHMA 3BAIA 4KH2A 1TVPA 4OBRA 3CUIA 1U2YA 2GJXB 4D1IA 2WM0A 4UZSA 2ZWYA 3VNYA 3GYCA 2UY2A 2XN1A 1G9HA 5AYIA 1KXVA 3AXXA 1VFOA 2UY3A 3WQVA 3GXMA 5HDRA 3N12A 3IK2A 1FHDA 3WF0A 3AIQA 3BUIA 3AOFA 4OOUA 2F1AA 2Q8XA 1MQRA 4YPJA 3EMZA 2JEQA 3U7BA 3GNOA 1VJSA 2GUYA 3MUZ1 2BS9A 3BLBA 2YL8A 2VVNA 2PI6A 2VL4A 1VBUA 3A4XA 2VOTA 3ZIZA 2CBUA 4KGLA 3WF1A 3VD5A 4NF7A 1QNPA 1KGXA 3WBAA 4LYPA 1W1YA 1FHLA 1ISZA 1FH7A 2RGMA 5I79A 3RMEA 1VAHA 1Q6GA 2OSXA 2WZHA 1QX1A 3W38A 3POCA 4B9ZA 3GM8A 1E0VA 4P7RA 2XFFA 1ZS2A 1H0IA 4PMQA 3VX1A 3MUIA 2PWEA 3WSUA 4DUVA 1ZU8A 4TVUA 2BFGA 3M6DA 2W63A 1HWWA 2BVDA 3SCUA 3O6AA 1PPIA 5EBAA 5D8ZA 2ZUUA 1U30A 3IAPA 3ZOAA 3CZGA 1KQZA 2W92A 3EDDA 3ZJKA 1VENA 3VMNA 1MWOA 2XWEA 4Y7EA 4NZFA 1GJUA 4NRSA 1W1VA 1VF8A 2MANA 1W9XA 4AZ5A 1V3JA 4W88A 3DECA 1KXTA 5CSYA 5GNZA 4TXEA 2J7EA 5HNNA 5DT5A 1H41A 2FYVA 3CC1A 1GQJA 4FNPA 1R75A 1GJWA 1J0YA 4E8DA 4Z2LA 4FNRA 3T0AA 3GXPA 5CLWA 3NUKA 4FNSA 4FLQA 5E0FA 3M07A 2IXVA 4E2OA 3THDA 4DO6A 2GSJA 1UR2A 1KCLA 4WIWA 4CCCA 1BVNP 4EAMA 1KTBA 4AD5A 4N0RA 3UG4A 3MMWA 1WDQA 2CITA 2ZUTA 5D8WA 3MI6A 2XWDA 3VIOA 1JZ3A 2XTKA 1EHAA 2E40A 5EMYA 1JYXA 2DSZA 4AYGA 4UFMA 1CENA 2WMGA 2WMIB 5HOSA 2XUCA 1HP5A 4P7LA 4KMQA 3IJ8A 4PMRA 3A21A 1HKMA 2ZXBA 3EJQA 1L0PA 2C8NA 3U57A 4AZCA 2D3NA 1VEMA 2VZOA 2CHNA 4D72A 2AAAA 4GI9A 1LG1A 3WL1A 3L4YA 1OINA 4MJ2A 4F8XA 2VZTA 4M82A 4WKFA 2FH6A 3D52A 5LYRA 1J9YA 2XPKA 3WDIA 5FKYA 1J0ZA 1BGAA 1UWQA 3GTNA 3VSUA 4LQ1A 3TTYA 1UKOA 3QOMA 1M01A 2VX4A 2IXUA 1V3MA 2WNWA 2YKKA 1UYQA 1JG9A 1CIUA 1HP4A 3VDAA 4X0NA 1KBBA 2YA1A 1LWJA 3S5YA 1PX4A 3PZMA 4AXNA 2WMJA 4WSJA 2WYSA 3PZUA 1NP2A 5DFAA 4AYSA 1F4HA 5A2CA 4V27A 1R86A 1E4IA 2EPLX 1RD6A 3VSTA 1QW9A 3AROA 5A6JA 2YL9A 3BVWA 3CZ8A 1O6IA 3CZJA 4WF7A 3WD4A 3BVXA 1Q6DA 4MJ4A 1GQIA 4JL1A 1UD4A 1E15A 1KWKA 3DX4A 1CDGA 3AIVA 3PZTA 1OIFA 2Z1SA 2VI0A 4D1JA 4UNIA 1V0KA 4DUXA 3VMOA 5BCAA 3NSXA 2GJXA 3ZR6A 1J0HA 3VX0A 5AC4A 8A3HA 3MV01 1EQPA 2G3IA 4GO8A 1NWRA 5M5DA 3L2MA 1WDRA 1HJUA 4TX8A 2C7FA 2W61A 4EKJA 4MADA 3BH4A 1B3WA 3W27A 2EABA 3OLEA 3W26A 1BFNA 2WK2A 4Z2IA 1HJQA 3KLKA 5CPQA 3MO4A 5CLTA 1C3FA 2CCRA 4H7VA 4UR9A 1EO7A 3VMPA 2BHZA 1NOUA 1QNQA 1C91A 2GDUA 3T2QA 4U5KA 5FIPA 1E6SM 2ZUMA 3BVUA 3U5UA 3T2OA 3AFBA 4OKDA 4P8XA 3HG5A 4CD7A 3L4WA 1UD6A 2G8ZA 2VC9A 3GXDA 4F9JA 5LA2A 3QHNA 4GZJA 1JDAA 1CLXA 5E1QA 1C92A 2DEPA 2QPUA 2CESA 2EPNA 4AZ6A 2GJPA 2PWHA 1XD0A 1W3JA 4AZHA 4HP5A 3IJ9A 1QI4A 1QI5A 1PZ3A 2W62A 1Q6FA 5A6KA 3QOKA 3UEQA 3ALFA 1GW1A 1OD8A 1HXKA 2E9MA 4FK9A 2J77A 1FH9A 4TOQA 3BAWA 1UWRA 2F8QA 1ZBVA 3AS2A 2DSUA 1TQUA 2CHOA 1CGVA 3LXBA 3DC0A 3W4RA 4A3YA 4HMEA 1SR0A 2XGBA 2QPSA 2E3ZA 4M56A 1RH9A 1KXQA 3VD7A 1XHGA 2CKSA 3ZO9A 1HNYA 4HMCA 3UERA 4HOZA 3EBVA 3RDKA 4GI6A 5CSUA 4Z2JA 2WW5A 1MVYA 3W81A 5M3WA 2UWFA 2WKGA 4J27A 2F2HA 4OIFA 1V0NA 3WNMA 5A95A 1MFVA 3EMCA 3VIGA 5IXEA 1UKSA 4M1RA 1FOBA 1JF5A 1GOQA 3WH8A 2WCGA 5F7UA 1HN1A 3VUPA 3OG2A 4FNTA 1E4LA 1CGWA 1EIBA 9CGTA 1LL7A 2AOSA 2C0HA 2QLYA 4UQEA 1J18A 1K6AA 1W9DM 3VM5A 1WCGA 2W91A 2D23A 2WB5A 1TQTA 4GPNA 3NJ3A 3PZNA 1EDTA 3WD1A 1V3HA 1PS3A 8CGTA 3AHZA 3CH9A 4CKQA 2D24A 5D9NA 1HJXA 5BWFA 3BCDA 1E5NA 4HMDA 2WMIA 4HPHA 2X2IA 2XM2A 3EDKA 5HPOA 1JDCA 1WO2A 2EQDA 2J47A 2JALA 1TVNA 3UG5A 5LA0A 1HF6A 2EEXA 3GZAA 3OLDA 2D20A 2J25A 1W3HA 1FFRA 4MAZA 3VOCA 4F66A 2PB1A 1NOWA 1HJWA 3RM4A 5IDIA 1V02A 2CIPA 2JEPA 1JZ8A 3K46A 5A6BD 5A6AA 3FAWA 5CGMA 1OM0A 2HISA 4D6EA 3MANA 3PZGA 1UKTA 2A3AA 2XFYA 3UR8A 3W0KA 2OLHA 1ZJBA 4JHOA 4ZXLA 5A94A 3OGVA 3WQ4A 5I2UA 5E70A 4QLJA 2ZUVA 2NSXA 4JCLA 5C70A 4QP0A 2OYKA 1OT2A 3MS8A 3WH6A 5EB8A 1IT0A 3VIFA 2QV4A 2FHBA 4JIEA 3A3HA 2ZUSA 2VRJA 4JKKA 2Y2WA 3KEHA 3DYOA 5IHRA 4PMXA 2CBIA 5E9AA 1NWUA 1A3HA 1DWAM 3VD4A 4GXPA 3AZTA 3BMWA 2WXDM 4PMZA 3RJXA 2VQTA 3DYPA 1ZBWA 2O9TA 3ZT7A 3KZSA 2GK1B 3WD3A 2WVTA 1M03A 4HU0A 4M81A 5ABEA 4JFTA 2FGLA 3GXTA 2CEQA 1HVQA 3ZR5A 1V6UA 4AD2A 3VKKA 4QCEA 3UETA 1UA7A 2DDXA 5C8BB 4PMOA 2OWCA 3BAXA 4W8AA 4FLOA 2ZUNA 5D4YA 1H11A 2F7RA 4W5UA 2VCCA 1U33A 3OZPA 4D6FA 4V2XA 1DWFM 1VBRA 1MFUA 3CGTA 1XRVA 3EJUA 1AQMA 1MQQA 2CBVA 4F9DA 4LX4A 1JXKA 4WJXA 4MDPA 4W86A 5M03A 3A47A 4AD4A 1O7DC 3WH7A 2W66A 5GNYA 3VM7A 5BRPA 1GHRA 1GOMA 3VDCA 2EJ1A 1TR1A 3BUQA 1AVAA 3ZMRA 2Y4SA 1J0IA 1G94A 4XV0A 2D22A 4Q7NA 5KZ6A 1XSKA 4V28A 3N11A 3GH4A 2OYMA 4UFKA 1PEZA 5CJ5A 2VO5A 3MMDA 1V6XA 4AY1A 1CEOA 5DMYA 5CZKA 1CECA 3AYSA 4D6DA 2WC7A 3AIBA 2PBGA 2Y8VA 1JZ5A 3BSHA 3POHA 2WANA 1W2VA 1UR4A 3W28A 2UY5A 3SUTA 4FNQA 1EOKA 1QHOA 3FW6A 5BRQA 1QBAA 4H8HA 2X0HA 3IAQA 4JHZA 1QWNA 2XHYA 3I3DA 1HTYA 3B8SA 5ABGA 3D4YA 4J3VA 1OBAA 1UD8A 3FNDA 3WF2A 2WVUA 1TFVA 2ZX5A 4U5IA 1Q6CA 4BQ3A 6TAAA 3CUGA 1DTUA 3DHUA 3SCVA 4IM4A 4ACYA 2J79A 1W2PA 1LF1A 4Z2GA 1H4PA 2FDMA 1QOXA 2UY4A 3T2PA 3AJ7A 3WMCA 2EBNA 1S46A 3PTQA 1V3LA 1BPLB 3AHTA 1WE5A 3CTTA 2FHFA 1UR9A 3W6MA 2VZUA 2J8FA 4CCDA 4GINA 2WLYA 2YJQA 3MSGA 3RCNA 1R7AA 4PEEA 4JFWA 1CNVA 1V03A 4CD4A 3NYDA 2VTFA 1V6VA 3AMCA 1H0GA 3W25A 3AS0A 1B3YA 1DWGM 1EOMA 1HIZA 2X09A 1EA9C 2J7BA 4AD1A 3A4AA 1XH1A 4CVWA 3W24A 1DEDA 1HT6A 4B3LA 1MW1A 1XH0A 1G01A 3WDRA 5A8MA 3L4TA 1QHZA 3MUY1 2OW7A 4NXKA 1IZKA 4PTWA 1ISYA 3WNLA 2DPEA 3F5KA 1KR0A 1RPKA 1QBBA 4QCFA 3K8LA 1KTCA 3H53A 4D71A 4JKLA 1SYTA 1UA3A 4BA0A 4D6IA 3CV5A 5IFTA 2J62A 4TUFA 2B31A 2J7CA 3VTRA 4U33A 3WUFA 7CGTA 2ZOXA 3AMGA 3RIKA 5CGTA 1VFMA 3EDEA 4AMWA 1IZJA 1E43A 1CGXA 5ABHA 1W3KA 2D0GA 4QLLA 5I6SA 3WQWA 1G0CA 4J3SA 1BTCA 2VQUA 2JIWA 3H54A 1LL4A 4NZJA 1WAWA 3ARRA 1KR1A 2NT0A 2VX5A 4UFIA 4NX0A 1R34A 1R87A 1V02E 3UG3A 2XVGA 2AMGA 3OGSA 3VD9A 3FN9A 4BQ2A 1QI0A 1HKIA 2WHMA 1JDDA 1J11A 1CZ1A 3LXAA 5A2AA 1GPFA 1SMDA 4XUYA 2D0HA
chains in the Genus database with same CATH superfamily
1MW0A 2FWOB 3QJHA 2I5IA 1AZRA 2E77A 1EZVY 1FIEA 1BQRA 4IISA 2YBVA 3HW7A 4FB7A 2CKRA 4UZUA 2XZAH 5DELA 1QPRA 4R7WA 1FL5B 2PO6B 4IXHA 4MF4A 3NQAA 1U8OB 2DW7A 3AC0A 3VA6A 4UI2A 5IMOA 4G82A 5IREA 4OKVA 3A4EA 5JW4Q 4A4AA 1VFAA 2ZRVA 1B31A 2NV9A 1XIGA 2YAOA 4MKNA 3BKYH 1THFD 5AOIA 1KFWA 2HZGA 1WBYA 1KLFA 1UWYA 4NXSA 4UOW0 2NQLA 2BY0A 5IQ9B 3S1XA 3J2PA 3GMLB 3BSZA 2G9KA 3V79C 3VC6A 4MZIA 3VWKC 3C8KB 4WW1B 4P2OD 3AZUA 2J88A 3S5OA 4R5TA 3NDYE 3GMMB 3KS0J 5D1XE 1P7TB 5IVXA 5EZIH 1SBSH 2Y7SA 3RFZA 1YY8B 2VQ1B 1LDPL 1AD1A 3K8MA 4ANXA 2WJEA 3CUZA 5C0AE 3HF3A 3B97A 4QIRA 5CF3A 5CJXC 3LRSB 3CXHK 1EYEA 3S35L 4RZCA 3AXMA 1I85A 4A67A 3W83A 3MOAL 3RWGB 5EEZA 3I74A 2J7FA 1CD9B 3D47A 4ZMAT 4YDZA 5HWNA 3US0A 4E5XA 4RISH 1TZHA 3WGUB 1HJCA 2BBFA 5IF0A 4X4YB 2DIAA 2DOCA 3IPEA 4K5NA 5AVTB 4IDJH 4XPFL 1QCWA 1TEGA 2X05A 3DJ9A 3UZQB 1DL3A 4JBSA 1TVBA 2J74A 1SLUA 5EIVA 1OKEA 3FFSA 3ZHKA 4PMVA 2J75A 2VLRA 4FZEL 1TELA 2FZNA 2WOQA 1O94A 2YFNA 1LZOA 4GAJH 1WKEA 3O45B 3GH7A 3DRQB 4J8RA 3IFPA 3KVKA 2WKOF 3KOZA 1AL7A 3FU3A 3FL7A 5FB8A 3B4UA 3BZJA 1YDPB 2Q2LA 2NSOA 2OMUA 4BF7A 3GSNA 4TQEH 1HKWA 5CD3B 5EEUA 4H04A 3GIPA 1KBKA 1CR9L 3K6SA 2A6LA 1LM8V 3CFEA 2JKTM 1URZA 2NY2C 1JZ6A 1I3GL 4QQ3A 4PRAB 2JJSC 4ELMA 1RZFH 3MDWA 3SKMA 2XVLA 3U0WL 3MLYL 4LLMB 3MWAA 4GH7B 4P7OA 1IM9B 3Q6GH 2EVGA 1GOIA 2PTTA 3GVGA 5BYWA 3FRUB 3KYKH 5CBBA 2EDMA 4JTCA 4LB4A 4QITA 4L1TA 2BOLA 3JV6A 4GY1A 3BLKA 1LO4H 1X5JA 4PJHA 4I9AA 4B9PA 1U5JA 4MXWH 1C5CL 3QKEA 2FFCA 5DCCA 3TC6A 2WWCA 3F4VA 1JN6B 4G8EA 2X4UA 3LKSA 3IMBA 2C4XA 5CEZL 4C4KT 5HYEA 3B8UA 3M0VA 3IF1B 5AY7A 3SQOH 3SKUD 1CGSH 1KT2A 4GG9A 4YL4A 3FBKA 1E1FA 1QK2A 1KEGH 1F07A 4F7TB 3D0VB 3F12A 1MXDA 3BT0A 4L4VB 4XOBA 3LPOA 2Y25A 1EDQA 4OQTL 4JO3L 4C6KA 3QYMA 1LBMA 4X5PA 3QC5X 4QXVA 2BS71 3DEQA 1KRMA 1VZWA 1T80A 3NJMA 5IG7B 1SM3H 1I6NA 4HKBB 1SMOA 1VFUA 3ZHDA 1LHZA 5JHDD 4OZIF 4N1HB 1QEWA 5EO9B 1JVOA 2VVSA 4CCEA 2VR3A 1SDDB 4UM9D 4Q6JA 1XTLA 5BS0E 3CDYA 3P5ZA 5LWYL 3A12A 1V79A 1KMGA 1CT8A 3WL9B 1BZ8A 3HLAA 3D0LA 4UTIA 5GQBA 2CHWA 3C0JA 3E6HA 4Z7NE 4DWSC 3GI9H 3WEXA 3QGKC 3MO7A 4HT1L 3TZVB 1RUQH 5JUVA 2PF0A 4DRSA 3KYAA 3UZVB 2ZXWB 1OCBA 4XZ9A 3MV11 3HU7A 2X4OA 4P5KB 4K3EH 3GR8A 1S8DB 3TDFA 1B3IA 4KVPA 3B37A 4X9FA 5GGTL 1JHTB 2UZXA 2JIXB 3BW9A 4K9EH 3CO8A 4I4WB 4JFQA 3MDUA 3FDGA 1MAJA 3PGFH 3KBNA 3MXVH 3O6FD 5IR1A 2HN7B 5I28A 2KZBA 1KCZA 4L4OA 3HPLA 4NWUH 2QSCL 1YO4A 3ETBJ 2DT1A 4YCOA 3AB0C 3U9UA 1YADA 1UCBH 3EX2A 5G4NA 4S11A 2JLLA 1TX2A 3PZIA 3QFJD 2JV6A 4XZNX 2QCHA 1NCIA 5I8KH 1P84J 2JE8A 3TPUB 1FZKA 4ZMYA 3S98A 4QE4A 2O55A 4WFHE 4DQOH 3R43A 1YEFL 1IAIH 5BXTA 4J3TA 4G6FB 5DMMA 1KM5A 4N6QA 3KJ4C 1USQA 5E8PA 3OYZA 1IE7C 2B5IB 1E9OA 2E47A 2BX7A 2EDYA 3ME0B 1MCNA 1PZSA 2YOAA 3KPRE 3GGWA 2H5UA 2VZSA 5EZOH 5C07A 1X3DA 3SDDA 4F33B 4C91A 2HH0L 3ARBC 2ATKA 1UJQA 3F64A 3LD8C 1J88A 3CHPA 8XIMA 4OFYA 3UGXA 2P8MA 1FZJB 1JZEA 1RJYB 1WA0X 2WHVA 2V7NB 1FNEB 1SQ2N 1CLKA 4DWDA 1CN4A 1DWHM 5EOCH 3T3MB 1UWIA 2H32H 1LCOA 3AWFA 3OEXA 1OZMA 4QRSB 4JANB 2I27N 5E6IB 4FABH 3U6XS 1AHKA 1ZT7B 3PL6D 1E5JA 5IMKB 1EEYB 3BISA 5I1KL 1XS2A 4XMUA 4KH9A 1P43A 3IRSA 1E73M 4J12A 2XTJE 2QCGA 3ATZA 2X9XA 1I75A 3IDIB 3IWVA 3L5AA 3CYJA 1PSCA 2OOGA 4RX4D 4ZQRA 3PWIA 4MFHA 4YIWA 2Q8BL 5D2YA 1FWFC 2IANE 2F8OA 3H2WA 2K1MA 3TR9A 5DRCA 3ARYA 5D1QB 3WE6A 4WZ9A 4XZIA 5JMUA 4WNSA 4PFMA 2R2CA 4KO6A 2DZVA 4IFRA 5IBUG 4AEEA 3MOBL 2GOKA 3TQ0A 5AOKA 1EJOH 3T0EB 1CXIA 3NH7L 4MA3B 2J9YA 2P80D 3O7UA 4X4ME 1C08B 1XIWC 1JIBA 4O15A 3F5WA 2NQDA 5SX5K 3MCKA 5ABZA 3J8F7 3G3LA 2BXVA 4WDTA 3NQKA 1ONQA 3IRDA 3T1FA 1UC4A 3D3VD 2AJZA 1BD2E 4Q8BA 3KWXA 1I1WA 3G5YB 3RLVA 3LS4H 3IGKA 1U8NB 5C7XH 2W67A 1X5ZA 1PD1A 5EIQA 3OKMB 1UCTA 4L6OA 3ZE0E 4O2CA 1DZ0A 1ZANH 3QHZL 3WQ5A 4XUGA 2Y6SC 2EDJA 4NZCA 2EIDA 3RU8L 4NIRA 1Q6LA 5I18L 5JPNB 1JFQH 5T91A 3LHAA 5LCVH 2PRMA 4QE1A 1S5VA 4Y2DD 1T4KA 4H6EA 3SDYH 4MQTB 4DVOA 1LLZA 1I0BA 3HZVA 1A7RL 2QJHA 2WTPA 2PLCA 2EDOA 3DIFA 1XCXA 2BP5M 1NQBA 4ZUUA 2XWJA 3HPFA 5IVZB 1P53A 3L4ZA 1PKQA 1IIHA 2CJSA 3QDJB 4ZFQA 2CGRL 3W7GA 5D2TA 5I0WA 3HI6L 3KPOB 3QEHA 2RQEA 5CM1A 1KGJA 4WU5A 4YHML 1Z41A 3TX9A 3PY9A 2PFHA 3X3GL 3ITTA 4GS7B 1P6BA 1B30A 2XZQL 4UCFA 1KJMA 2J7LA 1PJ9A 2TRSA 2CKBA 1AACA 1KXHA 3UJTL 1E2WA 4GI8A 2NNCA 3PSWA 4GIAA 5AYUL 1MQKH 4PTMA 4KRLB 4HJTA 4D9RE 5JPMB 1WITA 1M6OA 1E2VA 3RVXD 4XMVA 4JG9A 2UZIL 3FQRA 5C09A 4Y16B 1F6YA 2MQ0A 1IQWL 2JBMA 3HG2A 5GSVB 1IJ9A 3L3JB 4Z1CA 1ME7A 4QX4A 2F5AH 3FQTA 3NJKA 1KC5L 1RK1A 2EE9A 1G6VK 2X3CA 4M00A 4BE5A 1TVPA 3JWOH 4U6YA 1NDYA 3PIQA 3VNYA 2DDQH 5AYIA 1BBJA 2TRYA 3BDYL 4CEXC 2EG8A 1OGTB 4WX2A 1Q85A 4UBPC 1HCYA 4P3CL 4TVPH 1MG2C 2R2EB 1ZWIB 4PTTB 2F1AA 3CFCH 2L7UA 4ZPVA 1RZ7L 3O4LD 4AC4A 3MUZ1 3NSFA 3IVTA 5AAWA 4P2CG 4HLJA 1OV8A 3ME3A 4BK4A 4JDEA 1BYPA 4NRXB 2ZKHH 2ODOA 1R4XA 3W38A 1H8OA 4AVNA 5A6TC 3GM8A 1FFOA 2NSQA 3INPA 3QJVB 2X1TA 2D7TH 2WZ6A 1JGEB 4HHWA 1QLRA 4DJEA 3PWGA 4O2EA 2Y2TA 3DROA 3ZTCC 2BVDA 3WJJC 3NPSB 3QXDA 5DRXA 3IJSB 2NZ9D 4Q8WA 2BP0A 2W92A 4DP4X 4NO3B 3V35A 1J1XL 4NRSA 3QBTB 2OTWB 2XWXA 5FYKH 4LCYB 4AZ8A 1KIQB 4M8RA 5DJ8B 1R75A 5B7ZA 3RWEA 2PDFA 4E8DA 4YXKH 3E80A 3QUYC 1BXCA 4L9DA 5EF1A 4FCAA 5T33H 5JXEA 4OSUH 3LG3A 2EYSA 1EHAA 4KDTA 5KJRL 2VLME 1ASQA 3S4SA 5HOSA 4PRNA 5AKQA 4PB9L 1NCNA 1F7BA 4XP1H 4PMRA 1DFXA 2BS8A 2YRLA 4BUQA 2VLLB 5T3ZD 1TE6A 3U57A 4WO4B 4PJEA 1A25A 2O30A 4BSWB 4M82A 3QC3A 2BC4A 3TGXA 3P3SA 1XR9A 4KPLA 3BN3B 4TR9A 4DOHE 5H37H 1XR2A 1UYQA 1I1AD 2CZFA 4S1DC 3DZ1A 2A83A 1SW7A 3PZUA 1NP2A 4XBSA 3ZE2F 1MFCL 3LM7A 1GPOL 3IIVA 5KZCB 2DW6A 5D7IE 4PR5A 4WF7A 1GY1A 1AYRA 2XSKA 3BVXA 4YTUA 4APQB 4BHYA 4KTDH 1AL8A 1Q6DA 2J8UF 3UG8A 4Z3TA 3FA4A 4DPAX 1KJVA 1BEXA 4KVCL 3FFOA 4UNIA 3CL7A 1NFIB 2NXHA 4KPHL 4EDXA 4EPDC 3MV01 4ZYKB 4PHZA 5CSZB 3NL2A 3HFFA 3CN2A 1HQRB 1BZ9B 3PE9A 4JO1H 1ZGLA 3IMRA 3MO4A 1C3FA 4K5LA 4EXKA 3KHJA 2BHZA 3V75A 4OTXH 3HN5A 2HJFA 3B5GA 4LSUH 2C1OA 1E6OH 2A77L 1SPDA 1L3WA 3TO4A 4LPVA 3SCMD 5D1ZC 4Q8PA 3FF7A 5AD0B 3PJNA 1FXQA 3TOYA 3EX1A 3KWWA 3EH4B 4K9JA 4QTGA 1W3JA 2B8OT 2X2UA 3LSBA 1ED3A 3F7YB 1J8HD 3VNJA 3T55A 3U4KA 3V7MA 1IBGL 4L1SA 3JTSB 3AS2A 4POCA 4LRIC 2AI0L 4MJ6A 2PUQT 1N0XH 1X6UA 1ZLSH 2BOBA 2ICCA 4HOZA 5AUMA 3S3SA 4Z2JA 3Q5OA 1VRDA 2UWFA 1Y5VA 4AVJA 5SWSB 3LHWA 5I1GL 1FOBA 4L6HA 1GOQA 2AZUA 4G6AC 1FC1A 2OMYB 4YGAB 2I07A 1ZTXE 1HGYA 3HNTL 3PZNA 4F8LA 4CKQA 1QA9B 5IQMA 4Z1AA 4HPHA 1YUHA 3H2FA 3FT0A 5DYFA 5LA0A 3H3BC 4ADGA 3EJZD 2UWEB 3MRLB 3LYEA 2WV3A 4PODA 5A6BD 4D6EA 1L9NA 2A3AA 2XFYA 2GPZA 4DQWA 1J9QA 3U9PL 1HU8A 3DHDA 5DK2B 1NIFA 4KQ0A 1OT2A 1SY6A 3QQ1A 5HHOE 5LZLA 1T04B 1ZP3A 4KK8C 5IHRA 5FUOL 3HB9A 4Z7WE 3LOWA 2J6EH 3FS2A 4MMZA 2J4WH 2HLEB 2PYEE 5E8EB 4O58L 4HU0A 2CLRB 4JFTA 4A2SA 3AG1B 2EC9U 3ZR5A 5DMKB 4QCEA 4JPIA 2HFEA 4WTXA 4FLOA 4Z0BL 1SBSL 4DNHA 1TJHL 5SWUA 3NCWA 3BT2H 1ACYH 1NIUA 4HWZA 1AQMA 4RMUA 1F86A 1D3HA 1INQB 4N9GB 4LF1A 5IBLC 1Y18B 3GNML 3PUCA 1TR1A 1OE3A 2QIIA 3COTA 1XLJA 4EQ2A 3PAYA 3BOLA 1PZ5B 3BXNA 1ZAJA 3DTXA 4EVZA 4MVBC 4RISL 3MMDA 2YB1A 3CUXA 3CHQA 5HGAA 2QVHA 1CD1B 3REVB 4H5SB 4GYJA 3AVEA 3MNMA 4A7VA 5EU9A 3UJEA 2WP3O 3Q67A 4M8VA 2FZBA 3VH8A 5CJ8A 5AZUA 1SSDA 3UTOA 1RJZB 3IVSA 3RCYA 3FNDA 2BM3A 4HU2A 5SWZE 1SLXA 2AQQA 4FQLL 3DPBB 3O11B 4Z77B 1LDPH 1WK0A 4HUVB 1QOXA 1I2QA 2UY4A 5M2FX 5C0BB 5FEZA 4YX2L 3S35H 1QWHA 4CCDA 3VXUB 2F54E 4YNGA 3MOAH 5ERWA 4FXRA 5IMMB 5IBUB 5E23A 3S2AA 4O02B 3AS0A 1NCCL 1EA9C 4MNHB 4X7DC 5KYWB 1JUFB 3BO8B 2CGYA 3PLYA 4N6FA 5HVHB 3AAMA 2AEQH 3WK0A 3C8HA 3W22A 4PE8A 2PDXA 3OPSA 5G2WA 3L5XL 4TUFA 2J8OA 4FZEH 3KPTA 2MCAA 2XACC 4GY4A 4IOIA 2R9RA 3PBVA 2V2HA 2WWMC 3STZA 4UFIA 1XF1A 5MP6L 1FV1B 5AYZA 3E0GA 1XLLA 1RUML 3ETSA 1PCWA 1Y6KR 3SQOL 4WCYH 4AVOA 3LNMA 5C0EB 1UWUA 1KEGL 2CIKA 4MLIA 1CR9H 4AQEA 1PDZA 2DN7A 3GRGA 1OWWA 5KS9F 4OH2A 1ZHLB 4P23B 2FIRT 2WZ5A 1I3GH 3PHOA 5FF0A 4J3WA 4GVGA 3AXIA 5EEWA 3U0WH 4K7PL 4WY7H 1OADA 5E9NA 2H2PD 3CVHA 4YDJA 3OO2A 4LS2A 4O8RA 4CMMA 2DT3A 2VL5A 1I7RB 4OZIE 1OF2B 1MNUL 4KV5F 2W79A 1A49A 4OCYL 3GJEA 1FZOA 3ULVC 2J20A 5JIIA 2FNBA 3K4DA 1C5CH 5BQ7A 4OD2A 3U4BL 4JFSA 3V18A 2QHLA 4GBXB 3KXFD 2QCCA 3W6YA 2ZE0A 3AY4A 1XYAA 1ND0A 4WK9A 4XK2A 5KITA 3VO0A 2A79A 3ZJAA 1GGBL 1U8LA 3KPLB 2DQ6A 3TEVA 2GI0A 4PLKC 1T2JA 4HPXA 1Q94A 2ZYFA 5E56A 3U4EA 3KYNA 2A5HA 3I7QA 4OQTH 1Z6JT 3O2DA 4JO3H 3QWOB 2P5WA 4P46D 1BG9A 3BCJA 5DUJA 3M16A 2VYRE 4GSQA 4HNUA 3L1FA 3HG3A 3RUGF 4K9EL 3EA1A 1T41A 4O9HL 1WISA 3VGBA 2HSIA 1SFDA 2IPWA 4FL4B 2GHZA 4NWUL 5G4MA 2IDUA 3FT3B 3WKPA 4W5ZA 1LE9A 4H83A 3SW6A 2VH5L 3S3CB 4L4TB 1U58B 2HXTA 1XLHA 5EU7C 4A6YA 1W72B 4FXGC 1DCLA 5IT2H 3EGDB 1AGDB 5LWYH 3QUXD 4PWKA 2G3MA 2BVPB 3SB0A 4QS6A 4H9MA 4DQOL 2ZF8A 5JMRA 3IUHA 3OXSA 3M7OA 1UFUA 4HT1H 1J8RA 1KA9F 1X7TA 1V54B 1G9NL 5BJTB 4DVBA 5DC4B 4UQAA 3PNUA 2E8ZA 4I0PB 1CBGA 4P2YA 3AMKA 2QQNL 5GGTH 4LLYB 4F3FB 2I57A 3T6WA 4WKXA 3W1RA 3OJDB 4JFUA 2X38A 2VABA 3OMAB 3PV6A 1XH2A 2QSCH 1XPYA 4E6MA 3HB3C 4PLNC 3B6SA 5JXQA 1WC7A 2R6OA 4NDMB 3CO4A 1HZYA 5GNXA 3NCJL 1O12A 4K07A 5E99L 4ZJ9A 4NI6A 2BMKB 5L2KA 3THUA 3RVTC 2A3HA 3FZUD 4HA1A 2DZTA 1YEFH 4DO7A 4XTDA 4R7NB 3DX8A 2VCAA 4E5TA 2ILLA 2BHYA 5I71B 1VRXA 1K9DA 4IPLA 4YN3A 3HMXL 1DHPA 2YLAA 3FTYA 4I5BA 1IGYA 3VGFA 1E9LA 2PXYD 4X6BB 5E4OA 1W1ZA 5D71L 2HH0H 4UZGA 4GRSA 1ZLEA 5A8QA 2BV9A 4AZBA 2NUYA 5LBSA 4WV1B 4XCNB 5EG6C 1AFVL 2X87A 5DVPA 1VHPA 3UF9A 3W0WD 3DUGA 1AANA 3BAYA 2HFFB 1FPTL 3QQDA 5KBPA 4Z78B 1MJ8H 2IPUK 3BFOA 3VXME 2BERA 4HLEA 1X7QA 2X8RA 3VIIA 1OM9A 1EJOL 3WIJA 4N9BA 4PRIA 1KEML 1EUAA 4HWNA 3ILQD 1H5BC 2RALA 5I1KH 4JX5A 1LOSA 3CFKA 5EU3A 5HVGB 1ZS8B 4HNTA 3ORJA 4NQDD 5ECJE 3VKDA 3BLEA 5HGHB 3R06B 3L67A 1R30A 4HU4A 1QLEB 3I50L 4DGUA 2AAMA 3RM9A 4A1RA 2DH2A 2Q8BH 3ZT5A 3MCNA 4QJ3B 5C7XL 3GNXA 2JNZA 1ADOA 3B8YA 3PPGA 4DCQA 1CWVA 4YHLH 4CUCA 3NCOA 5E9DB 1E0OB 5JH2A 2VXVL 3RWIA 1WFNA 1F5WA 2B2XL 3LH2L 3MOBH 1PNDA 1N8WA 1QZNA 2NY5L 3H2QA 5IEHB 1VHCA 3EOSA 4DP9X 2J27A 1WAAA 3QCTH 2XFWA 4DXKA 3OAYK 1IJNA 1Q8JA 3S8FB 1B3ZA 3GVWA 2ZIDA 1J5CA 4QSFA 5ADOH 4PCSA 1LEKA 1FNGA 5TDPA 2XVPA 5HI5D 1FH8A 2ZSVB 4RDQG 2VE6A 1QYGL 3KTXA 1SDAB 2VDQB 2OSLB 1RLDA 3RHWF 1XYLA 3L4UA 1ZA6B 4PY7A 2JTYA 4XBGB 4PW9A 4B9FA 2P0IA 4IGHA 1Q38A 3DDMA 5CPTA 3QHZH 1KCWA 2FBJL 4KFOA 5I18H 1MRCH 4K8EA 1W1IE 3PWJB 1M1XB 2XM1A 1TJMA 4DJDC 1LWIA 4XAGA 3IMWA 2DJXA 2DORA 3KOYA 2QHRL 1M68A 1MQKL 3G1YA 4OLZL 2BB0A 5PCYA 4HD9A 4TYUA 1A7RH 1H0DA 2CRMA 2OJPA 1A2YA 5CIPH 5AAMC 2JF1A 3B9KA 1QAWA 5F89B 4NQCE 4POZD 1DEEB 2CGRH 3SUVA 1IWPA 4YHMH 3PWLB 2PW2B 4RAHA 1IC1A 5EEYA 1B4RA 1ORSA 1U95A 2XZQH 5E5LA 4IBYA 3WUGA 1MVFA 4NRRA 3IUDA 4PJ9D 2Q3RA 2GHWB 3UJTH 4U6VH 2DDQL 1E72M 3HI5H 4CN4A 4HIXL 1E2ZA 3QO0B 5JORA 3TVMA 2O9PA 1YJDC 5K9KB 4N0CC 2XV3A 5AYUH 2GQ8A 4UQ3B 4YHNA 4DEUA 1KBIA 2ZWLT 4K55A 3X12A 1WV2A 3LGGA 2JK2A 4I48B 4GUJA 2WAQA 4NZTL 3S2LA 5GS0C 1PGRB 3QNZA 2H9GA 5FJUA 1ZEAL 2UZIH 2YSSA 4J28A 1T40A 5HHVL 5IHUH 4A3QA 3ILEA 4G42A 5MI0C 1R8LA 4KXAA 1JPGA 1NLBL 5B38B 1TKKA 4TUUA 4QUOA 1IQWH 1B4TA 2I9UA 4WK2B 5LHEA 2KYIA 3NGBC 4TLUA 4BQ5A 1OTUD 1N7KA 4F2UA 1KC5H 3EF7A 1J1OH 4FFTA 3EAKA 3TH4T 2DWEA 1E6QM 4UT6A 1MCJA 2WLZA 1R47A 3DX1A 4Y5VC 3BDYH 1MY5A 5FK9B 1YA5A 5FYKL 3SCRA 5AQ0A 5EZLA 4NNXA 3JVFC 1VPXA 4YXKL 1I2PA 4LLVA 5AZ0A 1RZ7H 4L8BB 4HXBL 4ZQCA 2PEVA 5FYJD 5LGYA 4NN6C 3MRCB 4NCC1 3EKLA 4XP1L 3PQYD 1ZLWH 3WNKA 2K7PA 4EIUA 1BQGA 4K73A 2WWDA 4DESA 1BX2A 2X6CA 4Z7VB 1WBXA 2WBJA 1HK6A 3NSMA 3K2MC 5I6OA 1WEJL 5HGDB 3ZE2E 3H42H 2WMKA 5DRIA 2EDEA 1GTHA 1G7MB 5D7JA 2PODA 4ONOA 3TTSA 1DVFD 3QRGL 4ABWA 2J8UE 1PQZB 4KO7A 1BLIA 1NSJA 1F4AA 3EZJB 2OI9C 3SQSA 2YC1A 4ORZC 3WNNA 3I02B 4CU6A 4H8UA 5KJRH 2VIRA 1GORA 5EULV 2PWDA 3GX9A 1PBGA 1CLCA 3CC5A 3IIXA 4PB9H 1HX0A 1RP9A 4N0FB 4H8VA 2PDLA 2IKJA 4BSJA 2F15A 4R7DB 4WGKA 4B0MM 1NGPL 1RZQA 3L3GA 1XCTA 2ZWZA 4KDWA 5ECGA 2DWDB 1R85A 4LLDB 2WZPD 1L9OA 4F15C 1ESWA 3WY4A 1MCWM 1H09A 3WLMA 3EKZA 4IIFA 1E6OL 5EU6E 4PJ5D 5F7KC 1LT7A 3VXRB 3STGA 1L6ZA 4C7FA 1JERA 1MFCH 1TQSA 1GPOH 4KK9D 4XZ4A 3H56A 4NYLA 2UYLB 2P45B 1NBYB 3LKRA 3FFCD 1NGWA 2CUAA 2E46A 1R0MA 3OQ3B 2A73A 5D7IF 3SGDI 4MS6A 4ZAKB 1RPQA 4PCPA 3IK2A 2XPZA 4XRCA 3KVJA 2IAMB 3BQUD 5H2BB 3QDGB 2W9EL 1A7BA 2EKSB 1KJ2B 4P4KA 4UTBA 3K6FA 5AYQA 2PI6A 1L9MA 4NBZB 1KGIA 1WBHA 3F85A 3ZIMA 4K8RC 1TTJA 1KJ3L 4AQAB 3LERA 2A77H 1Q6GA 1PDKA 2QJMA 4JJ5A 4YCPA 3BPCB 3DFOA 3ETBF 4Z8FH 3VX1A 3AREB 3US1A 4ZSOA 5C7HA 4QM1A 1LQ2A 3LSOA 2QELA 4S3EA 2AABL 2PP7A 3APMA 5D8ZA 1A65A 4RA3A 2Q3ZA 4N22A 3ZOAA 1SO6A 3I2CL 1KQZA 1IBGH 1XFPA 5I03A 3DUUA 3NA9H 3UDWC 4LOCA 1XQKA 4TXEA 2AI0H 5ICZA 3FSAA 5ENLA 4LMQE 3QKZA 1NFPA 4H4IA 3AM8C 1FO0H 2GGHA 3QXBA 2M1KA 3I10A 3QPXH 4C8XA 4N0RA 2VR9A 3VIOA 4FQHA 2QGYA 2PCPA 4GG6F 1TWDA 2YYTA 2ADGB 3Q06A 5I66A 1QTWA 1P7QD 3KPSD 1S6NA 2Z93B 3BWZA 3T1WA 4LKXB 2BWGA 2XUCA 4ODWB 4N90E 3HNTH 1F3JB 1R5IA 2Z8VC 2P42B 5EORL 3EWZA 4JG5A 3ULVF 2X6UA 5D2NA 3V0GA 2VRAA 1QHQA 3U30C 3MRKB 3MPCA 3WL1A 4QYOA 4MJ2A 4BFIB 1GW0A 3I6KA 5FECA 1K8ZA 2XPKA 3TFKD 4F9LA 1SN0A 4X7TB 2CFFA 5FO8B 2VX4A 1UWFA 2NY1D 3BT2L 4HAKA 3MZ2A 2KLRA 5TNVA 5D7KE 1ACYL 2XXCB 1VLIA 3X1NA 3VAEA 4ERAA 4RZ6A 3DFHA 3V2AR 1W16A 2NQ5A 1ZT4A 2DYPB 1KFGA 1X44A 3U9PH 3MNZA 3KFTA 4F2TA 3QI9C 3DMMC 1UUSA 4Y4FD 4HZAA 3G1SA 4FG0A 2X41A 3C60C 3KX6A 2QQLL 2VEIA 3CXHJ 1GA2A 5FUOH 1T0NA 2GJ6E 2BOFX 1B4JL 2NY0C 2ZRZA 3T07A 5KWYC 4EUPA 2XJLA 1CICC 3AUVA 4IL0A 2ICWA 4GNVA 4XKYB 1EQPA 4FGMA 4DW2L 4Z7WF 1INEL 1GYUA 2W61A 3WJSA 4O58H 3DU0A 2FDBP 2VSDA 2BNRD 2JB6A 5K1NA 2VDKB 2Y72A 2ADFL 4IQDA 4HHMA 3V7AG 3GJFA 5DQDH 5KSBB 4Z0BH 3WIFA 1Q5MA 1TJHH 2HX7A 5ANMB 2F6XA 1Y0EA 1RXOB 3G6DL 3OKNA 3AFBA 4OKDA 2EDNA 4B3EA 2J5LC 1JDAA 4IQLA 1C92A 2ZYIA 1G7JB 4C6BA 1OCOB 2G50A 4O11A 3ZDZE 4LVDA 1U3HA 3GNMH 4KKQA 1XAKA 4KBXA 1IUZA 5D7LE 4AJYV 2HX8A 4Y4HC 1FH9A 4W6YB 2JFCA 1UWRA 4JQ2A 3TN5A 2BRRL 1IQDB 4GUGA 4A3YA 3PANA 3CDGA 1G6RL 2P9RA 1A6TA 3T8XB 1DE4A 2AEQL 1M71B 2CDEA 1A66A 1W0YT 5LG1A 5GISL 1WBZA 4K8GA 5AW3B 2IH3B 1YNLL 5EUOE 3LQAL 1RA5A 1XF3B 2X7VA 3VFRB 4JZOB 1S7TB 2Y69B 1UZHA 4TULL 1KTLA 4XN9A 3IU3A 4AJ0A 1CLOH 1TUPA 4FNTA 3W39A 1I1RA 4RDZA 4FQLH 3MSYA 1UZ6F 3SE3C 4CVXB 3MQIA 1DSWA 3MBED 4BFBD 2IH1A 3TBYA 4FAMA 4Q58C 2D23A 1EAQA 4YX2H 3EJYD 4MJ5B 3FSUA 2GK0A 4WCYL 1TF4A 5KS9E 5HPOA 1O66A 3NQ8A 1TX0A 4FXKA 2AL1A 1UWEL 2EEXA 2EDFA 1MG3C 1CIDA 1QASA 1NCCH 2Y6ZA 3ZHNA 1FFRA 4X9GA 2B7QA 2R1WA 3KVQA 2CIPA 4Y96A 1XICA 1IGSA 3WTVA 4WY7L 3T0XA 3IE9A 3CZFA 3WFDL 4G80A 3QS3A 4KV5E 3UR8A 5B7MA 2VGGA 1JZGA 4FADA 3V6OE 2P8CA 3L5XH 1IWBA 4YVVA 1IM3D 2NZIA 2YUZA 3RDTD 5F1NA 4HWEH 1RCYA 3KEHA 4HUUB 3S3BB 4C56E 3EYOA 4D0CA 2GZXA 1IARB 5MP6H 1DQML 3UWUA 3FF8A 1RUMH 4HPOH 4DXVA 3ARDA 5C55A 2WVTA 1C12A 5F3HA 5BOFA 4KX7A 2QVMA 3APDA 1BF5A 3HUJA 1C9WA 4XCCH 4Q8NA 3UETA 2W0PA 2AK1L 4DK5A 4OZGA 5IMOB 1EANA 1U33A 3DI0A 3OZPA 4OKVB 4PGEA 5JQ6L 3RUGE 3QMRA 5C0JA 1Z9OA 4RMSA 4L4LA 4ZVJA 4K7PH 1MVUA 2X1PA 3M86A 2PO6C 1ONRA 1NKGA 5M03A 3BP4B 2BGNE 1WGVA 4JQAA 4WWKA 1MNUH 1WBYB 1KLFB 4XNMA 3VNKA 1AVAA 4OCYH 2BSBA 4WI4A 1SHXA 2I5GA 2LLEA 4YSUA 3T8MA 3PG9A 1HWHB 3G8EA 5B7FA 3U4BH 4M43L 5G4WA 3S0PA 4IKLA 5IT2L 4ZA0A 1JPMA 4G9FD 3M5XA 4QNEA 1WDDA 4F7MA 5IVXB 3QC0A 2J24A 3RFZB 1L9WA 1GGBH 4Z95H 4JHZA 2PD5A 4G7RB 5G2IA 2N1KA 1JZIA 2HPOA 3KRBA 4QO1A 4MSSA 1S3TC 2YD0A 1W2PA 3W85A 1S46A 4O9HH 5D55A 3BPLB 2OG9A 2UZ9A 3UYCA 2HT2C 4E5XB 3P4LA 1TZHB 5IF0B 3RGTA 4L18A 5A2JH 5I02A 3TAOA 3NOYA 1NOLA 2KPWA 3QP3A 2B3RA 5AW2B 2X09A 3H9SE 1KZQA 1TVBB 2VH5H 4CVWA 5KBLA 1GKQA 1H1ZA 5EMMA 2OW7A 3GS6A 4PTWA 5I0ZA 5EBWB 1SO4A 3GSWB 3S4SG 4JKLA 2HBVA 4J8RB 3IFPB 1ACXA 2PDCA 3NJIA 3EDEA 5FB8B 1G9NH 4AMWA 1IZJA 4F80A 1LM1A 2C9AA 5JDJA 5F88A 1IC0A 1ZHBA 2OMUB 2XV6B 1FKXA 4GCXA 3GSNB 1KGCD 3M5VA 3AXLA 5AW0B 3K6DA 1V02E 2VR7A 3SRFA 2QQNH 3K6SB 5C0FA 1PSKL 3CFEB 4FMVA 3MV8E 3NGFA 1RUAL 2HVKA 3DV4B 4LF3A 4WUKL 1XRSA 4WXYA 5G1TA 4ELMB 3SKMB 3MRHA 2JGQA 1KIUA 2P8LB 3N17A 1AHWC 1SFHA 2PTTB 5H8UA 3NCJH 5E99H 1T5WA 1VC4A 3DGBA 1MJ8L 3E1ZA 4HHPA 2X40A 3EO0A 3SJNA 1ML1A 4PJHB 3EYQD 4F2FA 4NRZA 1NINA 3GDRA 3HMXH 4G8EB 2X4UB 3LKSB 1RVGA 3DN5A 3EH3B 4S3BA 3D18A 1KT2B 3TSMA 1EKOA 3BUBA 2V5YA 3URQA 5D71H 1PW3A 2GAZB 3F12B 3V55A 4TUKL 4V2BA 3VWJB 1V5JA 2E09A 5FA3A 1Z6KA 5HULA 4QHMA 4GH1A 1XGRA 3CN1A 1KF9B 3MKGA 4TQHA 4JN7A 4CU7A 1AFVH 3NOEA 1HCVA 5F7AA 1TV3A 2APXA 1JNEA 1XCQA 4JFHE 2CNCA 3KVPA 4JX4A 5JBDA 2AQ2A 4YHLL 1FPTH 3BWUC 1S2CA 2IWKA 2FLBT 5HNRA 3HG0A 1QEWB 4ZE4A 1BOGA 4ZNEA 4QDPA 4LIQE 4OBTA 4HOWA 4QRUA 1UD3A 4MAYA 2OX4A 1KEMH 2G2NA 3LDBB 4IRJB 1CT8B 4D8PA 3HLAB 3D0LB 3QCTL 4W7UA 3E6HB 4CMHB 4Y2NA 3WEXB 1SFSA 3DG3A 3BVVA 3FU8A 4GXMA 4AEIL 4DP7X 5ADOL 3QZLA 4MQXD 35C8L 2X4OB 3I50H 1ZV5A 3HRZB 3N1AA 2IGTA 2GSMB 1Y8BA 3BW9B 1C9SA 4JFQB 3TJLA 4X9HA 3DIDA 2RGSA 1E4KC 3TZVC 5IR1B 3ESVF 5I8CA 3HPLB 4DJMA 5ISZD 2YGPA 4I3SL 3O3DA 3GO1H 2VO8A 1MRCL 2VXVH 3KLHD 3U9UB 1F2JA 4LBAA 2B2XH 1HNFA 3LH2H 4CNPA 1N0LA 2NY5H 4LV4A 1OTTD 4Z3GA 1D5MA 4U4BA 4XMTA 1P9MC 1FZKB 3NSNA 2Q7YA 1JCKA 4W9ZA 4YDVA 1MY7A 5JIQA 1TVLA 2DZSA 3MNWA 3UTSA 3K91A 3T09A 3FKUS 4JMXA 5E8PB 4UDTB 3TV8A 2FEDD 1ZA3B 3ARFD 1E9OB 1OG0A 3C8DA 5CZXC 5D04C 4WWOA 4LCWE 3SQLA 4NQEA 2ODHA 3GGWB 4X7FC 1NWOA 3CWGA 2ZUYA 3F2DA 4PWJA 1QYGH 5C07B 2Q7AA 3CAFA 3SDDB 4FNUA 2P28B 3ZS4A 3AGVA 4AY0A 1B3VA 3PBGA 4K7FA 2ATKB 3NBNA 4W6WB 2AJXH 2B5IC 1DWIM 2FBJH 2P8MB 4U6VL 1IT7A 3HI5L 1U8HA 5I0DA 1W3TA 2XIDA 3L4XA 4XX6A 3T2LA 4DZBA 4RDVA 2QHRH 4YYFA 4OLZH 4ZO8A 2R29L 2P5EE 1H7XA 4OJYA 5IP4A 4AIBA 4JQVC 1NCDH 3T3PF 5EMJA 1T1ZA 2E59A 5IHUL 3S2CA 1JUEA 1RP8A 2N59A 5F96H 5E7BA 1H60A 3GSUA 4B16A 1GK8A 3W7MA 4KO5A 2A2QT 1Q7QA 3AYRA 4BGDA 2ADIA 3T7VA 3VH8G 2AQRA 1J1OL 3OTTA 4F7PA 2DVUA 1GHSA 3SCQA 5E6IC 1TZOA 3GSOA 4AHPA 2X7WA 4GAYB 5I6MA 4PJ8A 3QYSA 2FCBA 2X6AA 2CBOA 3IJYB 2X2JA 2KQMA 4G5ZL 4MB1A 4HIXH 5JZ7D 3VIJA 4ATTA 2D7NA 1B0GA 3MLSL 4K4KA 1XIEA 4NZTH 3QIBD 3N29A 4TX9A 1J9SA 4AGPA 2X3BA 1ZEAH 2KHAA 4C7DA 4G6CA 5HHVH 1X9LA 3VJ6A 1NLBH 1EFXD 5MHSE 4UQ2A 1TU2A 1WZAA 5HTSA 1K7EA 1D6EA 4H25A 5D1QC 3TN0C 5F7FA 1YXDA 3ZKXB 3F5WB 3MCKB 4YHZH 1GWJA 1VFSA 1KENL 1ONQB 2IG2L 5BUGA 1PIGA 1OYAA 4YSDA 3T0EC 2AJZB 3BG5A 4UTTA 5IMLA 5F72S 3WQFA 1XGUA 2Q3XA 1GZHC 3H42L 4O2CB 3HG4A 1K9EA 5HBFA 4IDLA 3L3DB 1VERA 3BANA 3L0NA 4U2ZA 4LYRA 1A64A 3O9WA 4HXBH 2MCG1 3CU2A 5FGCE 3HS9A 5M1TA 5K9QG 1UR1A 1T4KB 3DYMA 3HZVB 3IWPA 4J2XA 2IWEA 4KI5D 5TDOA 3QNXA 4JIQA 3RL2A 2DU2A 2QAFA 3DIFB 5JPNC 3HURA 1E4MM 3QT2A 1RLWA 4FTVA 4ZUUB 2XWJB 1JPHA 1TTBA 1HHJA 1PKQB 3V6BR 4Y0GA 5HXMA 3MRJA 3JZYA 3PPFA 3QEHB 4F0LA 2JSFA 4WU5B 1WEJH 2V8LA 5AVXB 2VMDA 4O16A 4KGJA 3B3DA 4A35A 4TXVB 1KJMB 3FJ4A 3AHYA 1XYMA 2CKBB 1DVQA 2J73A 3QRGH 1AKPA 3F03K 3ZXAC 1AO7D 2G95A 4YWIA 3O9NA 4DAFA 1FWNA 3IIZA 5AB3A 4GS7C 3EGSA 1M6OB 1J2WA 2RH9A 3L4CA 3GMPA 2DYSB 5ACMA 5DT7A 4NI8A 5AFDA 3FQRB 5C09B 2PDYA 2R8SH 3DFPA 2OEJA 3ATBA 5ID0A 1NGPH 3KR3L 3C3NA 4A21A 1WP6A 3VIMA 1H49A 1DYSA 4EACA 1JVLA 5C0CA 5F3FA 5JPMC 3QEQE 3HIZA 3FQTB 1JZDC 1RK1B 4Y16C 4I9WE 5HD8D 1XLCA 2VWEC 4Z8FL 2HT4D 5TQ0L 2VC7A 3RPTA 2R69A 4PBGA 1H9VA 4H8PA 3W75A 1IEIA 3TV3L 3PIQB 1MCFA 1BBJB 5GRVK 3TA4D 2W07A 1F1DA 1NH6A 5AVQB 3FTXA 1SJDA 3DJSA 3Q2DA 4DKEL 3M7SA 3NA9L 4XNAA 1F3DJ 4M5TA 5GJMA 4ZPVB 1K3UA 1LEIA 1YDYA 1WWWX 2EPKX 4LEXH 1M1BA 4A38A 5I3GA 1CCWB 4DUWA 2WQAA 2W9EH 4JDEB 1FO0L 3AU0A 2NX5A 1GY2A 1OFRA 2JKPA 2DSVA 4GG6E 3QPXL 3SO7A 4DZHA 2C1IA 1FFOB 1TREA 1N2RA 1QLRB 1KJ3H 1YQ2A 4NJHA 3QXDB 3FFDA 5DRXB 3ULVE 4WK4B 5DC0A 3V0IA 2BP0B 3VYNA 1ICTA 2AK4D 1JRHH 2JCCA 3UTTD 5BXRA 2AABH 1XT5A 3C0SA 4AZ8B 5I17A 3I2CH 1MHPL 4LPYA 1EUTA 1JF1A 3RWEB 1MZYA 4MXQD 4MMXA 2I69A 4CC0A 3NPSC 3MRDA 2EDHA 3DVGA 4EZMA 2N7BA 1ZIBA 1M05A 1XHHA 4EANA 5AVRB 2EYSB 3EO9L 2WUCL 5CCGE 5F4XA 5L2JA 3S4SB 4PRNB 2Y24A 4LUSA 1V7MH 4LGPB 4U6XA 3GQYA 3RVUC 4YHEA 3FT2A 1TJ2A 4L05A 4PJEB 3IV3A 3WY1A 4ORIA 2EIZA 4RSVA 2BC4B 4EMZA 1XDJA 5EORH 4ZK8A 1W1TA 1UUNA 1A50A 4H8WH 1XR9B 2WVVA 5EU7E 1S7SA 2FATL 4ACZB 5M17A 2A83B 5DQDL 3LNPA 2FECI 1H50A 4WO4C 1HKFA 3HBZA 5EFIA 4I6VA 2J56A 4AQ8A 1P5VB 3T4CA 3WUWA 4AQOA 4J4PD 4GFTB 2C6QA 2YCJA 1IGTA 1KJVB 4M4RA 4L29A 3WKNA 2ZONA 3P30L 2IH9A 3WIHL 2V2WA 4IPPA 2QQLH 4EDXB 1MI5A 3DI3B 1B4JH 3R58A 5FOJA 2C9QA 3N9RA 1ZGLB 3N12A 2Y23A 4X42A 4APQC 4AMAA 3KZ8A 4DW2H 4YQXH 4LAUA 1INEH 4V1DA 2Y7DA 3SPGA 2HJFB 2D3VA 3LHYA 2BS9A 1AXTH 2R4SH 5T3ZL 3TO4B 2GFBA 5C08B 2ADFH 3VD5A 1UZ6E 3EO1A 1QNPA 4JNYA 1CLOL 5CSGA 1KELL 5DS1A 3KWWB 1NC2A 2IQDA 2GUUA 3PUEA 3G6DH 2UZYA 3LCHA 4P7RA 1ED3B 3NCFB 1BWLA 3BYTA 1ZU8A 3CTLA 4F37F 2E1WA 4MJ6B 2ZUUA 2VW7A 3W76A 1F00I 4RCXA 3ZDZF 4Z0XA 2YQBA 5AUMB 2BRRH 2A4ZA 2YAMA 1F6LL 1KXTA 1WUNT 3EZ4A 1I9RH 4HUCA 2FYVA 2QFPA 1G6RH 3RA7L 5GS3A 2X1WL 1EJ7L 4KCTA 3VD2A 5GISH 5DZLA 4AYFA 1WTGT 1YNLH 1M7OA 3LQAH 4DO6A 2ZOWA 4W9FC 4Y5XA 3TBVA 4CCCA 4HFWB 2I07B 3RE0A 3JWNH 4TULH 3UG4A 5D1ZI 3CIAA 5EUOF 4FQCL 1REIA 4HWEL 2F38A 4X6CA 3GUTA 2DSZA 4AYGA 1BIIA 4FG2A 3D85D 1OF0A 1YUHB 4P7LA 1UR3M 1PTGA 4HVXA 3IJDA 2DZAA 4ZMNA 4HPOL 4P2QD 7ODCA 2NW2B 3P80A 1VEMA 2AAAA 3I65A 3GUFA 2L8AA 1GC1H 4XCCL 1A0CA 5IB2A 2B4CH 4NHVA 1UWEH 4YL2A 3QOMA 2IVFC 1CDBA 3KHDA 1JG9A 3TYGL 3B7RL 2HWZH 5BXFA 2GIMA 3W1XA 4A04A 3WFDH 1NC4A 4UWQB 1F4HA 4MNGA 3EOTL 3L1OH 4ZW7A 3VSTA 1W3NA 4J39A 4PG2A 1UWAA 1HAUA 1MUCA 3WD4A 3H7LA 3K5RA 4MMZB 1ACZA 1UM4L 3EPMA 2NYZA 2YXXA 1KWKA 3W1AA 4LCRA 3BWUF 3UA3A 3IVKA 5SV4A 2VDRL 1DQMH 4JPIB 2ACQA 2HFEB 3SQBA 1IR2A 4YH6A 4GOSA 4PYGA 4Z95L 1NBZA 2QCFA 4U1KA 5SWQB 3L16A 4UR9A 1EO7A 4NQQA 2AK1H 4HWZB 1C91A 5JQ6H 3KCWA 3NWRA 5FEPA 4FULA 5DVMA 4Z18A 3VKCA 2Z28A 2CM5A 3BXNB 5T3XE 1QFWI 3DTXB 4OD3L 1VHNA 1BJMA 5TF1L 3ZL2A 3LLFA 2FSEA 4QJ4B 3GFUA 5HGAB 1OFBA 4FA3A 4KRPB 4M6QA 1HNGA 2PCEA 3DIPA 5D4HA 2Y7EA 1OC5A 3SOTA 4MCMA 3VH8B 4M43H 3MWCA 5F1UA 1FYTD 4G7FA 1TTUA 1QG3A 3BEWA 3W81A 3NO5A 3GR7A 5T5FL 3UP8A 2E6YA 3PABA 2AS5M 4UQIM 4PGLA 3VIGA 1HGWA 3TS8A 3WH8A 3BGJA 1UP2A 2PE4A 3F3HA 2QPFA 1K6AA 1F8TL 4PULA 4UYQA 5TE4L 5ERWB 1EDTA 4J3ZA 4MLRA 2HG0A 3SDAA 1PXGA 2R1PA 3AITA 1JDCA 3ISRA 1ELSA 4KKCC 2GIXA 3RVVC 1KB5L 4AG4L 3IETA 1HAWA 1YEKL 3FU0A 2WJ7A 4PB4A 2Z7KA 4F0KA 3MANA 2FPYA 2ZA2A 2R15A 4IOIB 4RGNE 5A7BA 5DFWH 3T81A 2QV2A 2HKHL 5HVHC 1IILE 3MS8A 2ACSA 2FHBA 3A3HA 4XAPA 5E6RB 5CAHA 2EDTA 4Y1TA 4ZFOA 3BMWA 4F0HA 4JPQA 2CIKB 3CWOX 4TTDC 1PSKH 5KN5A 3T3MF 1RUAH 4WUKH 4WJKB 1HVQA 5J3HD 3NZQA 2BW4A 3PHOB 1OTSD 4GNKB 2VAJA 5CN2A 3CVHB 4W5UA 5FDYA 4YDJB 4JQIL 2AFNA 3OX8A 4XOAA 1QFWM 2VL5B 4V33A 4FC3E 3CGTA 2QTEA 3L7FB 3GJEB 1FZOB 4EI5A 1RZKC 2XPGA 1Z1WA 1JXKA 2WD0A 1X96A 4P23C 5F9DC 3WH7A 3DERA 2W66A 3X1EA 1GHRA 4RNRA 1DV7A 3O2VL 5E94A 2OTDA 3BUQA 3BGMA 5BQ7B 4OD2B 4JKWA 2Q6WA 1X5MA 4JFFA 1FH2A 1UEMA 1A3WA 3S2JA 1A3RL 3BW2A 43C9A 2Z7GA 1U8LB 3LHTA 2PBGA 1Q94B 2BVOA 1U8IA 4FNQA 4TUKH 1JPFA 2XTSA 3U4EB 4EWND 3KYNB 3DOSA 2EO1A 4N0UE 3DFTA 3A6CL 2P5WB 1M41A 1NEZA 4MJHA 4GBXC 5BZAA 1TFVA 4UCGA 3HR5A 3MXWL 5EN3A 4Q3MA 4Z2GA 2FDMA 3DOHA 3CPLB 4P04A 3GO1L 2P24A 1O75A 3GC5A 1LE9B 1A5MC 3VKBA 1E5BA 4MJID 4OJFL 4A6YB 3D39E 1TQCB 1IC5L 3W25A 4F2ME 1SJHA 3KEDA 4FL4C 2ESVA 1A4JA 3OXSB 5A8MA 1TZZA 4JFEA 1KR0A 5ABTA 2DLGA 4AEIH 3K8LA 3KD4A 4DVBB 1UW9A 35C8H 4UNTA 2P26A 4A3RA 2N4IA 5DQPA 4XBEL 3BWAA 6ALDA 2XDHA 1FCUA 2JK5A 2A21A 2NQHA 3SIZA 3CFNA 3LY0A 2VABB 4ZOBA 3TBSA 2BMBA 4YAQA 2AJXL 3PV6B 1LRTA 4K3HA 3FCSA 4I3SH 5A2AA 1XL9A 4UUIA 3WLNA 2H26A 1BECA 4I0PC 3B6SB 2J78A 5KUKA 1WC7B 2QKFA 5FD0A 3LPPA 3TXAA 3T3PE 5L2KB 1QU4A 1Z0MA 5LJYH 4IOTA 3CUPA 1NCDL 2M2DA 3TASA 4J40A 3G6MA 3DX8B 4W4NA 3P9LA 3H2NA 4FEIA 3N9KA 2XH2A 5F96L 3FRPA 4XTRC 4EUPG 3SFKA 4ZMVA 1OSYA 4I5BB 1IGYB 1F02I 2OELA 4DH2A 1OAQH 1E8ZA 4JFDE 3W87A 3VPLA 3FU5A 1RERA 5D1XD 3N2TA 5GZND 2B9AA 5I71C 2H2SD 3D9AL 2ZG2A 1BG4A 4GBUA 3R8QA 1TMLA 5C0AD 3OIHA 4HS6A 5T1KA 5AB1A 1LQSR 4ZMPA 2YPLD 2FUQA 5JHBA 2JKNA 3QQDB 2R29H 6TIMA 1MCIA 1DKWA 2GJZA 3S3JA 2Z1PA 3NM1A 5E5RB 4FHJA 2BASA 5K33A 4P57A 4R7OA 3N50A 2A4AA 4WV1C 4PRIB 2C9XA 3W57A 1QRNE 2V17L 3CEUA 2C7UA 5FUZL 1OT1A 3CFKB 5EU3B 5KINA 1WB0A 4PJDA 4YHZL 5D2LF 3TURA 4RMVA 2ZTBA 1QR1A 4PRWA 3T4AB 2H4EA 4O4VA 3HBGA 3TT1H 4O5LL 1WKYA 2AERT 4C59B 2EXWC 4G5ZH 2GITA 4PH6A 2CLKA 1BF6A 5FFOA 4M03A 5FYJU 3TU6A 1OD0A 3QIUA 4DCQB 2BNJA 3MLSH 3S8WA 2F0CA 1SJMA 5I23A 4KNSA 1PU0A 3RWIB 2QEJA 4TSBL 3R8BB 3MFFA 1S9VA 3VA8A 4KCWA 4ZFFA 2C4FT 1HOEA 3T0BA 1A1NB 4NJKA 2W95A 5CPSA 5C9ZA 4JICA 5DEZA 4EI0A 5JTWA 1KENH 4IMKA 1TZIA 1E4XI 2IG2H 2J3SA 3T0DA 3LV6A 4H19A 4GGHA 3R5EA 1LEKB 1FNGB 4C6FA 1AS6A 3S47A 2RJHA 2VE6B 1BZOA 2ZOUA 4KERA 2VMJA 1T1XA 4PY7B 1EJSC 1Z9AA 1P2CA 5IBXA 4ZT1A 5KETA 4TKWA 3LQLA 2Z4QA 4NNPL 3H55A 2VISB 4A7GF 1DZBA 1O9WA 3KCPA 4I5RA 3LMZA 1T1WA 3V0JA 3ZSSA 3E3HA 1Z32X 1JAEA 1R6VA 2ZUQB 2C19A 1UZ8A 4HF5L 4AHQA 1A2YB 4H0HB 4H20L 4XHJD 4RNHA 1L2UA 2R8SL 2CXEA 2C15A 4E8GA 3B9KB 1W9UA 1EJRC 1VJZA 5LGXA 3MP5A 3PPCA 1D5BA 4L3ED 3ROLA 5BS0D 5F70A 5ETUA 3K2KA 5E08H 1XGPA 4KY1L 2VERA 2PURA 1ZE3C 1ORSB 3UGEA 3ZRFC 1RPXA 1S2EA 1NARA 4ATWA 4Y19E 4JNXA 4YVNA 4G8GE 1O7VA 2X10A 3MU3A 5T1MA 5JORB 5JH1A 3TVMB 3SJVA 1FE8L 4YHNB 1DYZA 1HINH 4MNQE 2I9EA 3APYA 3X12B 2PTUA 1Y1DA 1D5IH 4P5TD 5CPMA 3CQQA 1HG3A 3QNZB 3QCUH 2H9GB 2YDRA 5HDOA 4LEXL 3P4NA 2YSSB 4NOBA 4C54A 5IY5B 4MTVA 2FL5A 4G42B 4FZIA 1CS6A 5DA4A 2O4QA 5DK0A 5H8PA 3FS9A 3KR3H 1FWEC 4P2RA 3FMGL 4O4YH 3MUJA 3G22A 2F74A 2W4XA 1CTMA 4INFA 4YU1A 3VCNA 4PGBA 3B03A 4WFHD 5KSAD 2DWEB 5IJVA 4RBPH 4RSYA 4TLKA 5BNKA 5TQ0H 3TV3H 1JRHL 2OR7A 4J1UA 3NIFB 2QSVA 3RNKA 3K4AA 4PG9B 1U2HA 4GRWB 5GVJA 3RM8A 1MCLA 5EZLB 4UB9A 4BXVA 4NNXB 3FB8A 3TZFA 3RRQA 4DKEH 3WJZA 1DQVA 5LO7A 3FHAA 2WTOA 4LLVB 2V2TA 2XU2A 4BWWA 3HC3H 2ATSA 4OVUA 4QRQA 4OFKA 4PWGA 4MMYA 3E12A 1P6FA 1WVZA 1QAPA 1U91B 3WF3A 1Z7JA 2JJWA 4BZYA 4KROB 1DUZA 3AHXA 3SM0A 3B0UX 3BAKA 4Z2HA 1DBAL 2DEWX 2NQCA 1WA1X 3F5JA 3Q2VA 2PC8A 4FOJA 4BS0A 2OOFA 2FBRA 1V7ML 4O0QA 2FZ3A 3GSMA 1GG1A 4MB3A 1EERB 1CU4L 1UT1A 1TJGL 3ESNA 2A6NA 1NICA 5HBBA 2GVYA 5CWSA 3QORA 2XG9A 1BX2B 1IT8A 5IJKC 1WBXB 4Z0SA 2WBJB 5INDA 4H8WL 1R19A 2AQVA 5BW6A 3D8MA 2CDFA 3LMJL 1ZY9A 1WJ3A 2EECA 1MHPH 2XTJD 4LVEA 3RI5K 3S37X 5D7JB 5BMXA 2I9TB 2QHAA 1QW8A 3BP7A 4IG2A 3NJNA 5JBEA 2VW6A 4JRXB 2YC1B 3WIAA 1LD9A 3ZL4L 1K3ZA 3WFLA 3NP3A 3EO9H 2WUCH 2VIRB 2XN9A 3VFPA 4I7UA 5A2BA 3CC5B 4FCHA 4ZD3L 3W7JA 2GJRA 3ALPA 2PRHA 3HGJA 2J1YA 2N56A 3L3GB 2H0FA 1HH9A 1XCTB 5C7VA 4NQXA 5IDZA 4YQXL 4AL8H 3CHDA 4H2CA 2H8XA 3TN4A 3GBEA 1AXTL 2R4SL 5L6YL 2Y1VA 3HCVA 3QG6A 2L5HA 2FATH 5IBTL 1ETZA 4PJAF 1UWGL 1EF2A 3MJWA 4S0HA 1K4GA 4XB3A 4J2QA 3KOXA 4U31A 2QUTA 4XN5A 3H2PA 4XVSL 4NYLB 3GG0A 2EDQA 2DMHA 3NVTA 3LKRB 1OD7A 1BD2D 1Z89A 1NGWB 1O4UA 2Z2AA 2A73B 4NFCA 5K5YA 4NN7B 3L3KB 7TIMA 3WQDA 3P30H 3WIHH 4XRCB 3QJRB 1J4EA 3H9YA 2OS7A 1I9RL 4P4KB 2UXGA 5C92A 1E9PB 5D6DC 1RD5A 3JUZA 2Y1YA 4ZAKC 3MN8A 5C1MB 3VU2A 4BBWA 5T3ZH 4A2HA 2IAMC 4Y89A 1PDKB