3LOTA

Crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
310
Chain Sequence
DDVVIVTCAITGAIHTPSMSPYLPVTPDQIVEEAVKAAEAGAGMVHIHARDPKDGRPTTDVEVFRYICREIKKQSDVVINVTTGGGGTLGIPVEERAKVVPALKPEIATFNMGSMNFAIHPLLKKYKEFKYDWEPEYLEMTRDIVFRNTFKDLEALSRIFKENDTKPELECYDIGQIYNTAFMFHEGYLEPPLRLQFIHGILGGIGTAVEDVLFMKQTADRLIGRENYTWSLVGAGRFQMPLGTLAVIMGGDVRVGLEDSLYIERGKLAKSNAEQVEKMVRIVKELGKRPATPDEVREILGLKGKERVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of PROTEIN OF UNKNOWN FUNCTION (NP_070038.1) from ARCHAEOGLOBUS FULGIDUS at 1.89 A resolution
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structure genomics, unknown function
total genus 107
structure length 310
sequence length 310
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05853 BKACE beta-keto acid cleavage enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lotA00
2BSLA 3C3NA 2C1HA 3PG8A 1YLVA 5LGZA 2LLEA 4NZJA 3W1TA 1EPXA 2P10A 4AEOA 1E51A 3UYCA 4DPQA 5D30A 1VC4A 4UMCA 2V82A 1SO5A 1GG1A 5KZEA 4UNLA 5K3VA 1ZALA 4M6PA 3TCEA 1QFEA 1KFEA 4O50A 3CHVA 2QJHA 1XL9A 1TPH1 1NVMA 4FX7A 2FTPA 2Y89A 1YTKA 3LXBA 3BLIA 2C15A 3FEMA 1SO3A 2V2DA 1VHNA 2BZNA 2HMCA 3S8HA 5FF7A 1G4TA 1B4KA 3S0CA 1BKSA 1LYXA 2Q3RA 3O6DA 3GLCA 4JTKA 5CKSA 2V9DA 3SY5A 2Y61A 1EP3A 3PUDA 4YL2A 3KHJA 4QITA 3VNDA 1Q6LA 1Q6QA 4JTHA 4MY1A 1VZWA 1K7XA 3L9CA 1H7NA 2XN0A 4RK8A 4UXDA 4DXVA 4FNUA 4HNTA 2BX7A 3N19B 2CLLA 3O15A 2JGQA 3P82A 3CWOX 3M9YA 3TH6A 4NNAA 3PSWA 3MBFA 3S1UA 1KBIA 3USBA 3T40A 2QKFA 4FNTA 5LNWA 1SZFA 1AW2A 3GDRA 4IJBA 4JTGA 2QF7A 3GDLA 4WQ6A 2YDAA 4NJGA 2ZTKA 5FEWA 4C1KA 6TIMA 1O95A 4O0KA 2ZFAA 3D0CA 3H54A 4LRSA 1Q3NA 1VPXA 2QCDA 2NX1A 4RZ6A 1IXOA 2Y70A 1SW0A 4BK9A 2WNNA 4LV4A 3INPA 3KRSA 3DKJA 2E6YA 1P4CA 1B9BA 3BG3A 2GJNA 5EY5A 1LRNA 1TTIA 3EWUA 1MXSA 3QM3A 4O4WA 1TPEA 2H90A 1OYBA 1EEPA 3ELFA 3LGEA 3N73A 1O4UA 3W7KA 3B0VC 5DBUA 3SI9A 4FB7A 3LRLA 4MPQA 1QOPA 4UTIA 3GZ3A 3LCIA 4R33A 5HWJA 3ZFHA 1F76A 4P61A 4N9EA 3DFTA 4BI7A 1LOQA 3GXPA 3HIJA 1QNVA 1XCFA 4IMGA 3VI2A 4O28A 1H5YA 2ABBA 4MJZA 3RF9A 3PUOA 1PCKA 5K7JA 1TIMA 4EOUA 3WJWA 3P61A 3OVPA 2DZVA 2ZRYA 3R2GA 4WUIA 5EMUA 2GJLA 3KVMA 4HIBA 3W1AA 3OIXA 4IXHA 2FB2A 3R13A 2G95A 3P5ZA 5LSMA 3E12A 5F2GA 5FESA 4K39A 3W2UA 3RLUA 1M7PA 1H50A 4O1BA 1NF0A 3S1WA 1VQTA 1GQNA 1ML1A 1QR7A 4Q32A 3EB2A 4IX2A 4YCPA 4JXCA 1NEYA 3W71A 5H2ZA 3NG3A 4I7VA 1KLZA 3YPIA 1OABA 4N2YA 2CWNA 2QCNA 3G1HA 2NUXA 1T0OA 1RZMA 1VCVA 2YX0A 3L0GA 3PAJA 5DY3A 4XKYB 4X9SA 2V30A 1XXXA 1DL3A 1GEQA 2QUVA 1TTQA 5D2TA 4G1KA 2DZWA 3NQ2A 2DU2A 5TIMA 1RD5A 1L6YA 1I4NA 3IRDA 1TREA 4FXSA 2J9YA 3KVKA 3W1UA 2FIQA 5D04C 2PE4A 1KA9F 3LCFA 1HTIA 4AAJA 1F6PA 3W73A 3MHFA 3SECA 4JDBA 5DCDA 1PHQA 3UPWA 4N02A 3VKJA 1JJKA 3EWYA 2JBMA 4ZZ9A 1VYRA 1EP2A 1I2PA 1X6UA 4MOZA 3TJLA 2Y7DA 3ZS4A 3NL3A 4BI6A 4RJEA 1F73A 3R89A 2UV8G 2B7PA 5I3IA 4O53A 3HQ1A 1W56A 4OWGA 4I7WA 2YSWA 3OA3A 1QWGA 3G8RA 1VYSX 1LOSA 1O60A 1L2UA 3FIGA 5EBUA 3LHUA 4O1CA 5LNVA 3NXFA 3E49A 4OU1A 2Y6ZA 2PC4A 3CB8A 1EA0A 4IGHA 1SU5A 2X1TA 4DO4A 1JQXA 3UD6A 3V75A 1KV5A 1DQWA 3EWWA 3SW6A 1KW1A 2R91A 2VEMA 3TSDA 1TPFA 2ZRUA 4UNKA 1GTEA 1TTJA 2ZDRA 3CTLA 4O8RA 2OT1A 1WBJA 2V8ZA 1FWWA 2VEPA 4JICA 3P80A 4JTFA 3UWVA 3A9IA 5LHFA 1TO3A 3WJYA 4EWND 5FEXA 1LM1A 5F4SA 1I2OA 2GUUA 3EX6A 2Z2UA 2CLHA 4PA8A 2TMDA 3QSTA 5HR6A 3GYEA 3LHYA 3I7SA 1ALDA 2WSRA 1H7WA 1FCQA 3P74A 4NJIA 1F05A 5G2WA 3FKKA 1G7VA 4BF9A 4LV9A 2PCQA 3NO5A 3KRZA 1QPNA 1DHPA 2CLIA 3O07A 1H7RA 3LM7A 2Y88A 2YFNA 4IMDA 5H91A 5LNUA 3STCA 5AC7A 3EXRA 4IMEA 4UFJA 2ZRZA 3W9ZA 2XN2A 4O14A 3FJLA 3W1MA 3L67A 1K02A 3NYZA 1PVNA 3CEPA 5FF3A 3HG3A 2NXHA 1RQHA 3LBMA 1UASA 5EYWA 4NNBA 3F4NA 4MY9A 3CC1A 1IXNA 4O1DA 5AHLA 2PURA 2ZRWA 3EKZA 1BEUA 1H62A 4OT7A 4AH7A 4UR8A 5CSRA 2VOMA 1MEIA 4LU0A 1LRQA 3UNDA 3WJSA 2ZZ6A 3DENA 1XBZA 4RXFA 3T55A 4ADTA 3ABQA 2JKEA 4O13A 4QNEA 4UTWA 4N6FA 4E0CA 4NX5A 2V81A 1ME9A 5EA9A 5K2ZA 1YPIA 4DELA 3MO7A 2V5BA 5T26A 5DCBA 3EXTA 1VLWA 1R47A 2QDHA 4EF9A 1JRBA 4GUIA 1ICPA 1W54A 3THAA 3FLUA 5KSWA 1JCJA 1VH7A 3LI1A 3O06A 1PV8A 1WAUA 5D05A 4ADSA 2W0UA 2WSQA 3LX9A 5G5IA 3DXIA 4YLWA 2J24A 2Y62A 1G4SA 2NUYA 1WX0A 2B4GA 2RHGA 3PB2A 5BRBA 1QCWA 3NPUA 3OBKA 1Q45A 1TQXA 5DCEA 5HR7A 1FWRA 3AO0A 5D02A 3L65A 1LP6A 3TV8A 4A3UA 1L9WA 2FPVA 1SZNA 4XBKA 3QW4B 2QCLA 3C2VA 1PCWA 4M7SA 4O52A 4K8HA 4GUJA 3QSRA 3KFTA 1A5CA 3MP5A 1ZHAA 3OEXA 2ATMA 2NX3A 1K7EA 3PBWA 2C13A 5AHEA 3S5NA 3UPBA 2ZTJA 3NAVA 1OX4A 4Z1DA 5F1UA 1BWKA 2YGYA 2V2CA 3MI3A 5LKYA 1YXCA 4RKAA 1ZENA 3CPRA 5G4WA 4JS3A 4ZVJA 1FXQA 3LTPA 5I3HA 5G2IA 3G1AA 2C19A 3A24A 4U4MA 1MEHA 4JTEA 1YXYA 4UFLA 3TR2A 3W1LA 4QNWA 2NXIA 1D9EA 4HNUA 1OVDA 2E77A 4Z1CA 1ZAJA 3HF3A 2QJIA 4MFDA 4MLJA 1OFPA 3LCGA 1OK6A 2H8ZA 2VFFA 1HFBA 4IPIA 3W7RA 2OJPA 4XWUA 1KM1A 2OCZA 1FY6A 5CSSA 1IIGA 1YTDA 1DORA 5DY2A 4KWVA 5K4XA 2QCGA 1A5AA 1OK4A 3S1XA 1FUYA 3WK1A 3B05A 3W7EA 3DFPA 4ONVA 5F4WA 3G1XA 3M5YA 3LCLA 3QPZA 3MWAA 1XM3A 3SSJA 2QCDB 3HGOA 2HSAA 2Y85A 3UWZA 1JR1A 2ABAA 3CLMA 3HG2A 3TE9A 3W7HA 5HULA 1GVRA 4YXGA 1N8FA 1GVSA 1JUBA 1XKYA 3C0JA 3MP4A 4O18A 4PL2A 1UJPA 1M7OA 4A21A 5K4ZA 3HO8A 4FNQA 4UTKA 1OX6A 4CLMA 5KZDA 2J6XA 4K7YA 3ABRA 4B5NA 3UQNA 2R14A 4PTNA 1XUUA 3IGXA 1OYAA 2FJKA 2OX1A 1W3TA 3W7OA 3DI1A 2YYUA 1DV7A 4QISA 1DVJA 3C2OA 1NF7A 1TPDA 4IQLA 4ZQMA 3QH2A 3R5EA 4LS1A 3HGJA 4GWEA 3LHWA 4N4QA 2DJLA 5CG7A 3IVUA 4MKNA 4IWWA 1OF6A 3QZEA 4JR5A 4LTSA 3BG5A 4UC5A 3W7DA 4WXYA 1B4EA 3LV5A 4GFSA 2CZEA 2B7OA 3VE7A 4O11A 3W2JA 3MYPA 1SR9A 3UWQA 3P8IA 4FNSA 5IM51 1EWEA 4JN6A 4Y90A 4Q33A 5F2LA 4GC4A 3G22A 2CLMA 1GWJA 1U5JA 3T4CA 1FDZA 4IX0A 2C16A 1IXQA 1CX9A 3S9YA 2R8WA 4FIQA 4LVFA 2Z0IA 4PL1A 1WQ5A 3QQ1A 5HINA 3NQ8A 3W86A 4RXGA 4UMBA 3PBYA 2VFGA 1OFRA 3IEBA 3TX9A 1OFBA 5KINA 5AYYA 1SUXA 1AK5A 2DZUA 4UTLA 4AMAA 1EB3A 3O16A 4K38A 1W31A 2H3BA 4AVFA 3CM4A 2A5HA 4M6QA 4FEZA 4H3DA 3W1RA 2XFWA 2AGKA 4GXMA 4HPJA 3NZRA 3MJYA 1HO1A 1WOBA 3GX9A 4MZ1A 2ZZ1A 3QRHA 1EIXA 1TQJA 1WXJA 3UY8A 1FCVA 5K9XA 1EUAA 5LGXA 3S42A 4KKXA 4EF8A 1YPFA 1T8XA 3G24A 1QMLA 1W1ZA 3O6YX 3DBPA 1ICSA 3QFEA 3EX1A 3M41A 1R2TA 5KMYA 3UWYA 1KLYA 3CT7A 3CEUA 3O8AA 2P0OA 1KM2A 4RX0A 4RR4A 1VS1A 2EF9A 3BLFA 1V7YA 3EEGA 3UZ5A 1QO2A 1R46A 3HBLA 4QIUA 3OG3A 1JCNA 4PFMA 3VCRA 4NU7A 3BV4A 3C61A 2BXVA 4J9JA 1OG0A 2NV2A 3NQFA 1X7FA 3IIVA 2GVJA 4PC8A 5IBXC 4FHAA 5K9DA 1EP1A 5EL1A 3NL2A 4Z1AA 4GBUA 1LDCA 2ZYFA 2Y7GA 3KXQA 1G7UA 4UFMA 4D2JA 1L6WA 1W5OA 1NSJA 3I7QA 2ZCGA 4CQAA 4GNJA 3NQ6A 5FEPA 5HMSA 1ZNNA 1SZEA 3G0SA 3VE9A 1HO4A 1LBFA 4OE7A 4DEFA 1TCDA 2E6AA 3N3MA 4RV8A 1A53A 4WX2A 3WK0A 3HG5A 3DH7A 4NVTA 2NZLA 3C6CA 5FF2A 3QMTA 4C1LA 3SGZA 3UXAA 3L5AA 3LHTA 5BMXA 5F1VA 3QC3A 3M16A 2FB3A 3W22A 4CNNA 4Z08A 1LCOA 1R30A 1XBYA 3IV3A 1R2SA 4NQ1A 1B57A 1ZY9A 4LVGA 3TUUA 1T99A 2TYSA 1AW1A 4R34A 3PULA 4UTHA 3S1VA 1OJXA 1OYCA 3CU2A 4LS2A 3LTSA 5I3JA 4CCDA 2ZZ5A 1PL9A 5DBTA 4AWTA 1YDOA 1GVOA 4QM1A 1O5KA 4MYAA 5CZJA 3ZWSA 3NL5A 4JTTA 2TRSA 1ONRA 1FXPA 1YTEA 3EX4A 1XBXA 2OZ0A 1GYLA 1KFJA 2DZTA 2H8XA 3NM1A 1OFDA 5AYXA 3C2EA 4Q4KA 1S5WA 3E0IA 3CWNA 3DFNA 3HPXA 5CPOA 3W7CA 1SQ7A 5CZSA 4JTUA 3TSMA 3M5ZA 2FQIA 4HNVA 3NQ7A 4IXXA 4RLIA 3L68A 4MJMA 1DBTA 4KFOA 2CLOA 1N7KA 2E68A 1W8SA 1QPOA 2Y63A 3IGUA 5E0KA 2ZZ4A 1HUVA 3W1NA 3TXVA 1SW3A 1JUEA 3P62A 4GUFA 1H61A 3LI0A 2QUTA 1TYGA 3LOTA 3GXTA 1Q6RA 1IXPA 1H1ZA 4LS0A 4EIVA 5A8GA 1Z48A 4O17A 1CI1A 5DXXA 3A5FA 4P2VA 5CPMA 3H55A 4RCXA 1GJPA 1WDWA 1FWSA 3RFAA 2WV8A 3C4UA 2YW3A 3MYOA 4GUHA 3P5YA 4FO4A 2ZQ0A 5BOOA 2G5WA 2I14A 1VJIA 5E93A 2OMAA 1TB3A 4ZQRA 2BLEA 4R7JA 1OFQA 4AF0A 1XBVA 2EPHA 4OHQA 2GQ8A 4AWUA 1OX4B 2F84A 3GDMA 2ALDA 2QDGA 4UUIA 1KBJA 2G96A 3NOEA 4RZ4A 4OBTA 1P1XA 3G3DA 4TMBA 1LTDA 6ALDA 5KITA 3SZ8A 3W2NA 5LNSA 3UWUA 2ZZ3A 3W2KA 1W5PA 1JCMP 5HWMA 4Y96A 1TV7A 1C29A 1JRCA 5KTLA 1JQVA 4TMCA 3PR2A 3MI6A 3PS7A 4CQ8A 2W6RA 1TJPA 2C3ZA 1KV8A 1UUOA 3DHFA 2NV1A 3DFSA 4AHQA 1LOLA 4MVAA 2Q8ZA 4JNMA 5D33A 3S5ZA 1AMKA 4S1FA 5D03A 2WPBA 3N9RA 3ZR4A 5HWNA 1YDVA 5AC6A 5U7SA 2A21A 3GDKA 4WD0A 3NQEA 3LB0A 4I9AA 1KM4A 2PRLA 2R94A 1SPQA 3JRKA 3CIXA 1LRTA 1TPB1 3GAYA 2FPYA 3R12A 4HHPA 4JTSA 3G1YA 3LXAA 1H60A 4LW7A 2GVLA 2ISSA 5F2MA 2X1UA 2VFHA 3Q37A 4AXKA 4JGDA 4GJ1A 2QEZA 4RZ5A 3LLFA 3P8JA 2JK2A 5D2XA 1P0NA 4LVBA 3TMLA 1KTCA 3JR2A 4NJKA 2RDTA 3GK0A 3NEVA 3L21A 3NQDA 1EX5A 4DO5A 3G3MA 2XN1A 4CCCA 2CFFA 4M5PA 1TPC1 3HOJA 4UMAA 1WA3A 1Z42A 4HSOA 2GPTA 1MSSA 3RMJA 4L4MA 1TSIA 3G1DA 3W7IA 4FX6M 3B04A 2VKZG 1W3IA 1PHWA 1FBAA 3L5MA 3P84A 2YZRA 4O16A 3DKLA 4DF0A 1M6JA 2QJGA 4M6VA 3GR7A 3M5VA 1KFCA 5F2IA 3TQVA 3N34A 1J5TA 4PCFA 2OT0A 2CZ5A 5C5YA 3BARA 1LZOA 2ISWA 4X22A 3M47A 1S5VA 3TDFA 3W7MA 3NDOA 4MY8A 1Y0EA 3C52A 1H7OA 3CQ0A 5L6UA 2CZFA 1FDJA 4S2BA 1K7FA 1KTBA 4IMCA 3UZJA 1IGSA 2QUUA 3FS2A 4M7TA 4OV9A 3W1XA 3TIMA 3B06A 2TSYA 3TC6A 4HT3A 5LHEA 3LCXA 2C0AA 5L9FA 4K36A 3I65A 4K8EA 1X8FA 2CU0A 1RPXA 2QAFA 3NR0A 4H4IA 3S6DA 4FXRA 4TX9A 5A5WA 3LRKA 3N9SA 4Z1BA 3ATYA 3F4WA 4ORIA 2Y7FA 4I7UA 4LVDA 1AG1O 1LBLA 3MHGA 3OVRA 5FI8A 3DGRA 1LROA 3THQA 3BGJA 2DP3A 2NWRA 4O1AA 2RDWA 4O4VA 3O6CA 1K03A 5D37A 3NQCA 2QCCA 4LRTA 3LTYA 1TMHA 1VLIA 1YXDA 3N2XA 4BR1A 5G4EA 5GVJA 2RH9A 3M43A 3C56A 1U83A 1CW2A 3M6YA 5FF4A 1JCLA 1I45A 4JYDA 2QR6A 2ZRVA 3P7YA 1M5WA 5AHFA 3HPSA 4LVAA 3LBCA 5AC8A 4WXZA 3W1QA 4DF2A 2AQWA 4ZMGA 2HTMA 4HKPA 3W85A 5CZ0A 3FFSA 1H51A 1PIIA 1Q6OA 4H6KA 3IIZA 3N2MA 1WYIA 3KX6A 3BW3A 1KFKA 5F4XA 3P67A 4QAIA 4NUWA 2RDUA 1XC4A 3QPYA 3TFXA 1WBHA 1TJRA 1ZFJA 3SIZA 3WJXA 5MHBA 1LLWA 4JX5A 2ISVA 3IIXA 4MUZA 4AB4A 2WOQA 4KFNA 1F74A 3G1VA 1ZJIA 1TV8A 2BTMA 1QAPA 3QEZA 4NX0A 4TU1A 3TW6A 4Y9AA 5D2WA 4JTIA 1VRDA 4QSHA 3W23A 5HUOA 3LCWA 2GVGA 1BTMA 3IIPA 4LUIA 3KVLA 2ZA1A 4MIMA 3H53A 3HPZA 2VELA 3SFKA 4BWLA 3TJXA 2B7QA 3IIOA 5IBXA 3STFA 1JCYA 4QQ3A 1A50A 3L5LA 4JDYA 3F1QA 3PC0A 4W9TA 4MLRA 3U8GA 4JY9A 4KWWA 4CQ9A 3UWWA 2WKJA 1W37A 1ICQA 3NM3A 1B3OA 3A22A 1RQEA 3R8RA 3W07A 4TO8A 1IF2A 3ATZA 1SO6A 3W2MA 3W7PA 2GQAA 4O0ZA 3WFAA 4Y6GA 2X16A 2ZZ2A 3W74A 4LWWA 3WK2A 5LNRA 1G4PA 3QYQA 1KM5A 4CNOA 2VEKA 3HMJG 3HG4A 3NZ1A 2YR1A 3G18A 2ZA2A 3BGGA 2W79A 3L0NA 3W87A 2YYTA 2JKPA 1FCUA 3GAKA 2FFCA 5C54A 3M7WA 4ZQNA 5BMWA 2A6LA 4A29A 3F03K 2DZXA 1QPRA 3EKLA 1J4EA 1XDMA 1Z41A 2P1FA 1TPVA 3B4UA 5CZTA 4CNPA 3LHVA 4NT0A 3O1NA 4E38A 3TAOA 5HUPA 1H1YA 3V1PA 2G97A 3GNDA 3GB6A 3W3OA 4FX8A 4WOZA 2GQ9A 1FDYA 3DZ1A 3E02A 1N55A 1TPUA 2VENA 2V5LA 3CIWA 2VEIA 7TIMA 4X3ZA 2O7QA 2PRHA 1WOAA 3U6WA 3QMRA 2NX9A 3ABOA 3NQGA 3C2RA 4BWLC 4LUJA 1I8JA 2EGZA 3TQ0A 2FPTA 3A23A 4NNCA 3BLEA 3DU0A 3G0XA 4AF0B 5EPDA 5HNRA 4KFPA 3NQAA 1K8ZA 3FA5A 1QOQA 1W5MA 4FIRA 2I9EA 1Z44A 3PG9A 2EAWA 4LT9A 2JKAA 3IVSA 1HG3A 4ZL1A 1TRIA 2IQTA 1VGAA 1O94A 4CCEA 2A7NA 5J5DA 3QF0A 3TW7A 2Z1BA 5HJLA 3VFLA 2Q3OA 3DI0A 5D32A 2DZPA 2NXGA 4JIQA 4UR7A 3C8FA 3TKFA 5G1YA 3L0KA 1XDLA 1GVFA 2CZDA 3QW3A 3BW2A 3T78A 2VC6A 4XBSA 4JIPA 4O19A 3BPWA 1QO5A 3W7QA 3HB9A 4AWSA 1DJQA 3B0UX 3LXCA 2H6RA 1TTPA 1UUMA 1OHLA 3KOFA 1QPQA 4O10A 4IOTA 3W72A 3W84A 1XFBA 4NZFA 3RLVA 2X1RA 2Z6JA 2QCFA 3RU6A 4LNYA 3W7NA 1ME8A 4NJJA 4DO6A 1DJNA 2QAPA 2QCMA 5AHNA 4UFKA 2X30A 4GRSA 3PVFA 3O63A 1J2WA 4S2CA 4Z0SA 3RK8A 1AL7A 1O5XA 3PBUA 5BNKA 3M44A 3LV6A 1QDSA 2AAMA 3MBDA 4POCA 3ABSA 1ZAIA 5KZMA 3LDVA 3NL6A 1F6KA 1ME7A 3L2IA 1S3HA 3G8EA 1TV5A 2VFDA 3P81A 4OQVA 4FF7A 4M19A 3JS3A 1ADOA 2H3DA 2E6DA 3TMQA 3SJ3A 4YMZA 3I6RA 2EKCA 2V0TA 4XQ6A 4WZHA 3FYPA 4OV4A 4LC8A 1UCWA 2O7SA 5D2YA 4A22A 3MHUA 3TU9A 4PODA 4XUGA 3W6YA 3LRMA 4ICNA 1I2NA 4ML9A 4ZQCA 5AN7A 1C8VA 1GVQA 1FX6A 3MW7A 2WNQA 1JVNA 2QCHA 2B0MA 3NNTA 4UCGA 1TPWA 3B03A 4DPPA 1ZCOA 1SFJA 1VCFA 3PF3A 2E5CA 3ZWTA 3BVJA 4WY0B 3E96A 2VFIA 1GG0A 3W2LA 4WY0F 5K9CA 2E1DA 4UTMA 3K30A 1KFLA 1X1OA 3TFCA 3QMSA 2RKXA 1TRDA 3DFOA 2V2HA 5FF0A 5AYZA 5I3KA 1VCGA 2NLIA 4DBDA 1GPWA 3NA8A 2A7PA 4LC6A 3TSBA 5LZLA 1GYNA 2J27A 1H7PA 1DKWA 1W5QA 3SR7A 1HL2A 1G69A 2C6QA 4MYXA 2DJXA 3BO9A 1K8XA 1VR6A 4L4LA 5G1TA 1A5SA 4UTTA 4ZQPA 3FKRA 4LY8A 2Z6IA 1G4EA 3NPXA 4DF1A 3A21A 3WK3A 1XI3A 4AHOA 1WV2A 3STGA 2QCEA 4K37A 1H63A 5AOUA 4HNNA 4WJEA 2CLKA 4UIOA 3ANYA 1OFEA 3GKAA 1GOXA 1OFOA 3TK7A 3PB0A 3AJXA 5AFDA 3GKFA 4O15A 3IGSA 3GDTA 4BFAA 4IMFA 3P60A 5D38A 1LORA 1I2QA 1PE1A 3HJZA 3G1FA 1R2RA 1F7BA 3LLDA 4WOQA 1MZHA 1W5NA 2YW4A 3PWAA 2YPIA 4JEQA 1V5XA 1P0KA 3QJAA 4JYFA 2WJZA 3GXNA 5CGQA 3STEA 1AL8A 5C6MA 1W3NA 2TPSA 4AHPA 1GT8A 1UBSA 3M1ZA 4HN4A 4MFEA 4BI5A 3B8DA 3W1PA 1GTHA 3NVTA 2C14A 2A4AA 3NPVA 5E1QA 2A7RA 4DQWA 8TIMA 3EWBX 1KM0A 2A6NA 5AHMA 5SWUA 3U2OA 2WO5A 3IVTA 3GIYA 1VYPX 2WQPA 4JTLA 1OFAA 3HGSA 1BWLA 2A2IA 1IIHA 4O57A 2X2GA 2A85A 4FNRA 4ADUA 2E6FA 3KAOA 4NJHA 1RQBA 1JUKA 1G67A 2ATSA 1SO4A 5EKYA 3FJ6A 4JX6A 5DLCA 5U4NA 1I2RA 4ORMA 1L6SA 4EVZA 5C2XA 3T44A 5I3GA 3T7VA 1JCXA 2FDSA 4O12A 2A1YA 4E2DA 2DORA 4OGZA 4LOCA 5AB3A 4O54A 1SFLA 3OVQA 1G6CA 1ZAHA 3MMTA 2E5DA 3EWZA 3PUEA 4XKYA 5I3FA 1KM6A 4QJ1A 1UB3A 4JTJA 3BK0A 1FCBA 1JULA 1RR2A 4UTTC 1FWTA 3HGRA 1GZGA 3A5VA 2JGYA 3L66A 4A2SA 3Q2DA 4TR9A 1S5TA 4Z0JA 3GR8A 4Y8FA 3FYOA 4WY0A 1P5BA 4N4PA 4YWIA 3LERA 2VFEA 2WNZA 3W83A 3TAKA 4JY8A 5DELA 3W7GA 3UXDA 2Q8LA 1SZGA 2EHHA 2BWGA 2I1OA 4GUGA 1X1ZA 2CW6A 2J9ZA 4U28A 3S5YA 4IPJA 3EX2A 5D2VA 1K8YA 5DXYA 2PRMA 4E2BA 1PS9A 2RFGA 1SW7A 4UTJA 4UFHA 4ALDA 4FNPA 1RVGA 4PH6A 3W75A 3GNNA 4K7VA 3W88A 3O05A 1LBMA 1KM3A 2KZHA 3TNOA 3W7JA 3TC7A 1AW5A 4NXSA 1MO0A 2C18A 3KRUA 3W76A 1RV8A 2DZSA 3EXSA 3RNDA 3M0ZA 1LLZA 4JD4A 4XTDA 1T96A 3OHIA 3W70A 5ABTA 2Y7EA 3PSVA 3QQ0A 5D09A 5HQEA 3TROA 3SGUA 3C2FA 2F7FA 4IUOA 2YFOA 4N9DA 1SSDA 4NXKA 3N14A 3NQMA 4N9CA 1K3UA 2E5BA 1OF8A 1XUZA 2VXNA 2ZBTA 3E9AA 1EUNA 4A2RA 4R53A 1THFD 3G0UA 3W7LA 3WJZA 5BW6A 5AHIA 3DAQA 2A0NA 3KVJA 4MZ8A 2NUWA 1OX5A 2X1SA 5DN1A 4YCOA 1SSGA 5C55A 4UTWC 1EWDA 3PM6A 1F2JA 5CPLA 2YXGA 3NGJA 2D73A 4K6AA 3MI2A 2CLEA 5TBOA 2ZZ7A 3EWXA 2ZRXA 3TXZA 2ZA3A 1A5BA 3MP3A 2J88A 4GE8A 3TA6A 3NPWA 3BG9A 3I68A 2CLFA 1FQ0A 3GVGA 3FOKA 4JYEA 1KTNA 3DFQA 1KFBA 3TQKA 3MUXA 4UTUA 1DOSA 1VHCA 3DHDA 3G1SA 3PY2A 3S5OA 2FLIA 4MZYA 1YDNA 1DQXA 4N9BA 1D3HA 5TQLA 3Q94A 3NQVA 3I7RA 4XTIA 2J9XA 1YADA 4UFIA 4HSNA 3Q58A 1MEWA 4JX4A 3LHZA 5CPNA 3EX3A 2E09A 4DBEA 1D3GA 2WSYA 4PEKA 1YYAA 5FEZA 1FWNA 2HS6A 4HPXA 4N6EA 4TIMA 1W0MA 4ZQOA 2B7NA 5G2HA 5J5RA 2HS8A 3M5XA 3LCHA 3B0PA 1NFBA 1F5ZA 1NAL1 3BW4A 2YCEA 3UY7A 1C9DA 4XZ9A 2GOUA 4X2RA 2NWSA 1H7XA 3PBVA
chains in the Genus database with same CATH superfamily
1WDPA 4C60A 3PG8A 1YLVA 3B9AA 2GJXB 2NQ5A 2ZX5A 2WAGA 3RCYA 1YNPA 1AJZA 3M0JA 3UYCA 3FK4A 5ABFA 1P0DA 2FVLA 3LZ3A 3B0XA 3EDDA 2VX5A 3CS2A 4UCFA 1KR1A 1MFVA 1ZALA 3DC8A 3KTXA 3ZR5A 4QE4A 4RPPA 1POKA 4AC1X 2ZXQA 3AICA 1XL9A 3VGHA 4YPJA 5EMJA 3VDGA 2FTPA 1SJCA 3BLIA 4C6QA 1SO3A 2Q02A 1B4KA 1LYXA 2O0TA 4GJJA 4BKNA 4JTKA 1HKMA 4MB5A 3OQ8A 2V9DA 3GTXA 3KCJA 1E3ZA 1UOKA 4YL2A 3WF3A 1ITQA 1Q6QA 2BXYA 4MY1A 3NSXA 3ARTA 1H7NA 4OTKA 4RK8A 2DUZA 4HNTA 3N19B 5BXPA 4H7ZA 2OODA 5EMYA 3EKGA 2BMBA 3V0TA 4FNTA 3AWOA 4JTGA 3H8AA 3GDLA 4OOZA 3VZYA 4HK6A 4UQ9A 1IWPA 2NVAA 1PTGA 4D6HA 3SUUA 1VPXA 2NX1A 1FWBC 4PMOA 2VUNA 1IXOA 4RZ6A 4GI6A 4FLSA 4GHRA 2E8ZA 4LV4A 3MB9A 3INPA 3VYLA 3KRSA 1JPHA 2E6YA 3GWQA 5FJOA 1P4CA 4XKMA 1R5YA 5TD4A 4BQ3A 3BMXA 6TAAA 3PNZA 1EEPA 3LGEA 4Y9OA 5DBUA 3SI9A 1B9ZA 2NT0A 1AUSL 3LCIA 5AKQA 3DFTA 4XAGA 4BI7A 4F9JA 1XH2A 3HIJA 1XCFA 2FTWA 4IMGA 4O28A 1H5YA 3RF9A 3S6OA 1TA3B 2XFFA 4CGTA 5DMLA 1TELA 1KWGA 3OVPA 2DZVA 2ZRYA 1Q6CA 3EEZA 4WUIA 5M03A 3PUGA 3MSYA 4JQ3A 1U1JA 3M0VA 5LSMA 2XH4A 5A6TC 4DWSA 3W2UA 3ITVA 4J3UA 3MQTA 4J3SA 3MANA 1GQNA 1E6XM 3WLRA 1NEYA 1ZLPA 3COTA 2HPMA 1S2VA 2D23A 5I09A 4N2YA 3DG6A 1JZ8A 2QCNA 3G1HA 1J9YA 1KWKA 2NUXA 3UJFA 3E0LA 3VD4A 3PAJA 3EOSA 5DY3A 4CKQA 3ORWA 4Z2IA 4FLQA 1GEQA 3T07A 3K4DA 3WH7A 2J9YA 3KVKA 1E5NA 3WMLA 5D04C 8CGTA 3KBSA 1E73M 3LCFA 3QGAC 3CUZA 3BWWA 2X0YA 1DHKA 2BV9A 4YYFA 3OZPA 5I24A 3VNKA 3SN0A 1VYRA 1I2PA 1TWDA 4PGLA 3CHCA 5D8WA 1L0PA 2FZMA 3ZS4A 2YLLA 4BI6A 4LCRA 2UV8G 4DIAA 4OWGA 2QDEA 4I7WA 2YSWA 1O60A 4JBRA 3TN6A 3FIGA 5EBUA 5BXSA 1I9CB 1LG2A 2CLPA 4OU1A 4ZE4A 2FZ8A 3VOIA 4B5XA 2DSVA 1CDGA 1EA0A 4AZCB 3WLQA 1E0TA 1H41A 3UD6A 4IL2A 5I02A 3PZGA 3S2JA 1QPKA 3TSDA 3UA3A 5BCAA 1TPFA 2ZRUA 4J2MA 4RNIA 4UNKA 3PPCA 4QDMA 2OT1A 1WBJA 3B4YA 4DJDA 1LL6A 3PP7A 4JICA 4R27A 3UWVA 3A9IA 4JHOA 4R9OA 4LUSA 1X96A 3UT0A 4CNSA 3WJYA 2BY2A 5F4SA 2GUUA 3EX6A 3H4WA 2Z2UA 1UWTA 3H12A 4F2UA 2QV4A 1DXIA 1O6IA 5HR6A 3WLTA 4PUMA 1G94A 3GYEA 2WSRA 1H7WA 4F3HA 1N2VA 3FKKA 1RH9A 2X09A 4DYKA 4HOZA 4DBWA 2CLIA 3LM7A 2YFNA 4IMDA 1ZGDA 5C8BB 4XO6A 1FTXA 3FJLA 3NQBA 1US2A 1UZDA 2VR5A 1K02A 4AZHA 3CEPA 1VJSA 5AZ0A 3HG3A 5I78A 3PZMA 4GIAA 4O1DA 5FKYA 3EBVA 2J47A 3RN6A 1QHZA 1XIGA 4FP1A 4CU8A 4BQ5A 4LU0A 3UNDA 3C86A 3DENA 1XBZA 3T55A 4XZIA 1SR0A 5C9XA 1XRSA 5LIKX 5DCBA 1T7LA 3RCMA 1W9UA 3BICA 5KSWA 2G41A 4Q8NA 1E6QM 3RM8A 1E9YB 3LI1A 2WC7A 3O06A 1WAUA 4ADSA 4WSJA 1WDSA 3DFYA 1ZPTA 4IH3A 3DXIA 2E0PA 2GSHA 4PUWA 2VR2A 5DMMA 3WO8A 1G4SA 1LWJA 1PZ0A 4DZAA 3VABA 3VIIA 3RCNA 5XIMA 2WK2A 5DCEA 1FWRA 4W85A 4R7WA 4TV5A 3L65A 4IZGA 5D02A 3TV8A 4MUPA 1QNQA 1G5AA 4I5RA 2FPVA 2NW0A 5DT7A 3C2VA 4GLEA 3L4ZA 3AIWA 5IFTA 1FHUA 3ERPA 3GFZA 1RY0A 1ZHAA 3U2ZA 3H7RA 4M0XA 1R3TA 3S5NA 3WQ6A 5CC6A 5IFPA 1P1MA 4PMDA 4GBDA 1YXCA 2REQB 4RKAA 3CPRA 3SCSA 2G4JA 1FXQA 1R8LA 4GG9A 4U4MA 1MQRA 1T8QA 4W7VA 2DT0A 2Y5EA 3QHNA 3W1LA 2DUXA 4QNWA 2VJXA 1D9EA 3NIYA 3WUGA 4MFDA 3EDJA 2SFPA 3R0KA 4MLJA 3D6NA 1OFPA 1XS2A 2VFFA 3QKEA 1KKOA 1YRRA 2AL1A 4XWUA 1LUCA 1FY6A 5CC7A 1NH6A 1VEPA 1EDTA 2JQXA 4YNGA 1QJWA 4Q7BA 2NQHA 4UB9A 3RJXA 2OEMA 4OOUA 3B05A 4MAZA 2MANA 3AS3A 4B92A 4GVIA 4LCQA 4MWAD 2QCDB 5EMMA 3JU2A 3VOGA 1UWAA 4JIRA 3UWZA 1JR1A 1IWAA 3TWAA 2I57A 2DGAA 3IJ7A 1JG9A 5HULA 4YXGA 1JUBA 3MP4A 1WXYA 2VC9A 4A21A 1BG9A 1OX6A 1L8PA 4GYJA 3U3HA 4PUJA 5KETA 2R14A 4RPQA 1E6ZA 2YYUA 3IACA 3Q65A 1V4YA 3NGFA 3V4BA 2E8YA 4ZQMA 5HANA 3HGJA 5EMLA 3RX3A 4N4QA 4J3WA 4JQ4A 5CG7A 4MKNA 1AD1A 4IWWA 5JVLA 4JR5A 2ZUVA 3V0UA 3A3HA 5I03A 1OCJA 1HJQA 3LV5A 2B7OA 1E4MM 3VE7A 2I5IA 3F2CA 3WD2A 3CQKA 3P8IA 2O9RA 5IM51 2PDIA 1MW3A 1ADDA 4XVEA 3G22A 4BCEA 1U5JA 3MY9A 1JAKA 2VEFA 3K1GA 4IX0A 2C16A 2XJ7A 1CX9A 3S9YA 3AYTA 2R8WA 4B4FA 4LVFA 3QR3A 2DVUA 3H2EA 3WNPA 5HINA 4WLCA 4X61A 3THDA 3EPMA 4GIEA 3W86A 1K9FA 4GY0A 4XV0A 3VM5A 1XISA 2GZXA 1LL4A 5A6SA 4KCVA 1BYCA 2MNRA 3EZ4A 1OC5A 4CD6A 3IJIA 3TLQA 4AMAA 2QMKA 2OB3A 2I17A 1XGEA 3E2RA 3WUBA 1YQ2A 1JDFA 3NZQA 3SRKA 4GXMA 2JIEA 2C7FA 3NZRA 3VKCA 3GX9A 1R6WA 5D8ZA 2ZZ1A 4I90A 3QRHA 1EIXA 2WLYA 2DIKA 2X1IA 3KRBA 2F6KA 3ZLHA 3ZT7A 3AS2A 3W81A 3AXMA 2VCBA 2POZA 4RE3A 2DPEA 4XD5A 4MKVA 3VIMA 4A3RA 4IFKA 3SSZA 4Z42C 3U9IA 1J8VA 2CWXA 2YBTA 2QULA 2P0OA 4KPLA 1VS1A 2EF9A 3GNOA 1V7YA 3EEGA 3TONA 1QO2A 4MWAC 4EPBC 4PFMA 3HZ3A 2BXVA 4PC8A 1LDCA 2Y7GA 3KXQA 2PTWA 1Z7AA 3RLHA 2OX4A 5A8OA 2ASHA 3I7QA 2ZCGA 3NQ6A 3GR4A 5HMSA 1EJVC 2AQVA 3VE9A 3KBNA 3PJXA 1JDCA 4OE7A 3H2MA 2E6AA 2I16A 4WX2A 1Q65A 5GPRA 5HQMA 1DJWA 2V5CA 3DYPA 4DM2A 3C6CA 3ALGA 1AQMA 2JEQA 4AY8A 3L5AA 1T6MA 1TR1A 3LHTA 1UP0A 2IKHA 3M16A 1EDGA 1EH9A 3UYIA 2HJPA 3W22A 3FYYA 1LCOA 1OZMA 4CU6A 4CVUA 1XIHA 1Q7QA 3V1HA 3T81A 1GONA 2POTA 1B57A 1T99A 2TYSA 1AW1A 1DWJM 3BLOA 2DT3A 1KRAC 1OJXA 1E4NA 1OYCA 1J79A 4Q8QA 4AWTA 2DH2A 4MYAA 4LSBA 4MJ4A 1ONRA 1XYZA 2W5FA 3EX4A 2I7GA 2EEXA 3HQNA 2ZUMA 4E6MA 2H8XA 2HV5A 1OFDA 5T9BG 2GL5A 1S5WA 4NL1A 3E0IA 3LM3A 3DFNA 3WQGA 4B16A 4C7DA 4L6HA 1SQ7A 4V28A 1M53A 1R7AA 3M5ZA 3QQWA 3NQ7A 1YNQA 4MADA 2W3ZA 4RLIA 3GC5A 4KIRA 4KFOA 4FI4A 2GVEA 2R24A 3ZT5A 1MXGA 2P88A 3W1NA 4V1XA 4MTVA 2V3EA 1JUEA 1TE1A 1H61A 3LI0A 1TYGA 3GXTA 3RO6A 4DBSA 3A47A 1Q2SA 3M0HA 1XX1A 2FGBA 4P2VA 2QQ6A 1WDWA 3ITXA 3C4UA 1ESWA 3MYOA 4GUHA 5C2GA 4ZTXA 1EYEA 2BASA 4QQUA 4YVVA 1OFQA 4E4PA 2EPHA 3S2LA 4HMDA 1QI2A 2CKSA 4TX8A 4UUIA 4S3EA 1JYNA 2W62A 3NOEA 4RZ4A 5HAOA 1P1XA 2Z1KA 3A4XA 3SCVA 3K1DA 3GVRA 2ON3A 3W0KA 3CB3A 4J3VA 5HWMA 3UG3A 2XINA 1W3JA 3FX4A 1WPCA 4OKDA 2NSXA 1MMFA 1UUOA 3W6MA 1WZMA 1GUVA 2Z1XA 1MXDA 3W53A 3RO8A 5AYIA 3WF0A 4U5IA 3ZR4A 5JH2A 3BSGA 4GZEA 3FGCA 1ELSA 2R94A 5ENLA 3N6HA 3JRKA 1LRTA 1TPB1 2FPYA 3R12A 4UQBA 4HHPA 4JTSA 4LY4A 3CASA 3RMEA 5AC5A 2GVLA 1XRVA 1E4LA 1K9TA 3P8JA 3BAIA 3ARXA 5D2XA 1P0NA 3L23A 4LVBA 3NEVA 3L4XA 3ONBA 1UROA 2OVLA 1J0KA 2BHYA 2XN1A 4CCCA 3TTOA 1TPC1 1FWIC 1J96A 2VZUA 4Z2HA 1UR2A 3AZTA 4P8UA 4DJED 4L4MA 4P7QA 3S47A 1TSIA 4FX6M 3WQCA 3KP0A 2PDJA 2VVSA 1W1VA 3L5MA 2Q01A 4DHGA 4Q8TA 1W1PA 3AMKA 1VP5A 2WHLA 2PDUA 3M5VA 3NDYA 2WCGA 3PZTA 2WZMA 4PMVA 4PCFA 2CZ5A 2EPNA 2A79A 5FL1A 2ISWA 2VGFA 1S5VA 1B2YA 1BLIA 1Y0EA 3C52A 1FWGC 1UR0A 3DIPA 1TV4A 3FNDA 2DUAA 3TJIA 1FWJC 1FDJA 1VFLA 2J8TA 1I1WA 4IMCA 4M7TA 4OV9A 3TIMA 1XCXA 1DPMA 3MZNA 2WHMA 3D47A 3EGJA 4HT3A 5LHEA 5L9FA 3VU2A 4K8EA 1RPXA 3UVAA 4FXRA 3LENA 2OLSA 4S3DA 3WDRA 2Y7FA 3VNZA 2WANA 3THQA 1DE6A 2DP3A 3M46A 4DRSA 1WZKA 3O6CA 4LXFA 1TMHA 2DIEA 4PYSA 4DZHA 3GUGA 4W93A 5GVJA 3FHAA 4X0NA 4HOWA 1CW2A 1NDYA 2WMIB 4ZOEA 5T8GA 5FF4A 1I45A 2YCKX 1FHDA 3MV11 2Y4SA 4ZOAA 2R1LA 2ZRVA 4BEQA 1W1TA 1JZ7A 1IEXA 3LBCA 4ZTYA 4DXXA 4ACZA 5CZ0A 1GPFA 1HL8A 1GOIA 1HVXA 1PIIA 3UZYA 4HA4A 3UGRA 3KX6A 5F4XA 1UQZA 4NYYA 1VKFA 3P67A 3LUTA 4CU7A 4NUWA 3QV7A 4QAIA 5CSYA 1A5MC 1TJRA 3ARYA 4NAEB 4GFIA 1LLWA 4XD4A 2EQDA 4JX5A 2ISVA 4HHMA 3IIXA 1XLMA 1ZP4A 3U7VA 1NDZA 2BTMA 4NRSA 3TW6A 3KL5A 5D2WA 1CXHA 3URNA 1ZP3A 3U0HA 1BTMA 1R9XA 4QSFA 5JU6A 5CEWA 4M80A 4Q8VA 4MWAA 2PDKA 5A95A 2VELA 3SFKA 4Q8WA 4QCFA 2B7QA 2RDXA 4ZO6A 3IIOA 1VBJA 1FP8A 1OT1A 3SCNA 1IEWA 1EJUC 4KWWA 4CQ9A 1P0EA 4IM4A 2EPLX 1B30A 1MDLA 1RQEA 1WDQA 2I56A 2Z7GA 3U4AA 1IF2A 1SO6A 3W2MA 2GQAA 3G6MA 5LXXA 4KWSA 2PF8A 5LNRA 1SVDA 3ISIX 2OQLA 2CCRA 2VEKA 3NZ1A 3RYSA 3BGGA 1RA5A 1KRMA 3M0IA 4H6RA 1FKWA 3VIPA 3H70A 1JPIA 1R0MA 3BJSA 5BMWA 2ZC1A 2A6LA 4AZ6A 3U5UA 4PB5A 2HEJA 2PTYA 3AHVA 3KHDA 4ZOCA 5CPQA 4WDWA 3LHVA 3WX7A 3ZJKA 4Z2GA 3O1NA 4KW2A 4E38A 3TAOA 1EPVA 2CEQA 2G97A 2PS2A 3GNDA 2O9TA 1ITUA 3PTMA 5IRPA 2BS9A 2GQ9A 1VBGA 1FDYA 1J0HA 3DZ1A 3R0UA 2GGIA 1TPUA 2BFGA 2IW0A 2R1MA 3RHGA 1YMYA 2XUCA 6XIAA 2XU2A 4MM1A 2O7QA 4H9UA 1WOAA 3U6WA 4OFCA 2C1GA 3ENLA 3QMRA 2NX9A 3ARSA 2DSWA 3EA2A 4JAWA 3NQGA 3QPEA 4LUJA 3TQ0A 2FPTA 3FV9A 4AF0B 3NQAA 1SJBA 3FA5A 1F8IA 1W5MA 1EFZA 3TYAA 1KNWA 3T08A 2E28A 1L8NA 1WP6A 3TCSA 1BXNA 1XSJA 1M7XA 2VQUA 2AMXA 2IQTA 3K4AA 2A7NA 4EX4A 5J5DA 1EOKA 5C9WA 1ONEA 5E70A 3ITGA 3K46A 3KTCA 2V5JA 4JIQA 2J7EA 1UZHA 2E67A 1TV3A 1WB0A 1XDLA 4H9MA 1GVFA 2WHKA 2BHUA 1E1EA 4JIPA 1JFHA 1QO5A 3BPWA 3W7QA 3HB9A 4AWSA 1XIJA 1WXZA 1GKPA 3KOFA 1QPQA 2DSKA 1M9HA 3I3BA 1XFBA 2DY3A 2Z6JA 3TWBA 4E2VA 3W7NA 1ME8A 2VQTA 4DO6A 5GJMA 5AHNA 1KBBA 2GQ3A 3PVFA 4Z0SA 1V7AA 1AL7A 1B54A 3RK8A 3WYZA 4S3AA 5JIWA 2XG9A 1S2CA 3MUIA 3PZOA 3VOCA 1CWYA 3E2VA 5KZMA 3LDVA 1GOWA 4ZB0A 3LEPA 3NL6A 5G4HC 2I5GA 3G8EA 4M19A 1ADOA 4OBSA 4M82A 3VGEA 3I6RA 3WD1A 2Z2BA 4LC8A 1HL9A 4G56A 2G3IA 4A22A 3KCLA 1S38A 1PIFA 1I2NA 4ML9A 9XIMA 1GVQA 3RM4A 3B8UA 1GHSA 1W9DM 3QBUA 2QCHA 4PTDA 5I77A 1TPWA 1AMYA 6ENLA 3VKDA 3B03A 4HK7A 4P7OA 1ZCOA 1SFJA 1V03A 1M03A 3PF3A 4QEHA 1VCFA 2V68A 1JXJA 3IAQA 4QE5A 3F7JA 3CUXA 5ABEA 4ACYA 1GG0A 3L12A 4PUUA 5HMEA 3ALFA 4WY0F 1EO5A 1NELA 2PLJA 5LA0A 1EC8A 1Q85A 5FF0A 5AYZA 2PP1A 2NLIA 4EPKA 5GNYA 4PCSA 4IT1A 1YBQA 3UU0A 2AL2B 1H7PA 4XSLA 4DBUA 2PLKA 1XQLA 2W67A 4GX9A 4MF4A 1S5MA 3PZQA 4L4LA 1W3LA 4ZENA 1CPUA 2J4GA 3FA3A 3QOKA 1WV2A 2QCEA 5AOUA 3QZAA 1H0GA 1Q4NX 2XVKA 3UJSA 1OFEA 3U57A 3CAQA 1OFOA 3TK7A 3PB0A 5AFDA 1CGUA 4G6CA 3GO2A 1TZZA 3IGSA 1ZJAA 5D38A 4A6GA 3H6OA 2V6AA 4JL1A 1KGXA 2JEPA 4PRWA 1MRQA 4AMCA 1I60A 2PB1A 5A6AA 1MZHA 1W6TA 3PWAA 1P0KA 3STEA 5C6MA 1L6GA 3IJDA 4AHPA 3CL8A 2GWGA 1F4AA 1KM0A 3DFHA 5AHMA 5JIPA 2WO5A 3IVTA 3CL6A 3GIYA 4LEFA 1AQFA 1GQKA 2WQPA 3E3HA 4JHMA 4WRHA 1IIHA 5BXRA 4RDZA 4WKFA 2J13A 3HJEA 3IARA 3RUBL 1JUKA 5CBBA 1SO4A 1FWAC 2PLCA 1HKIA 5DLCA 3MDUA 3VFCA 2FZ9A 1YNYA 3CIVA 1WAWA 3T7VA 3AYRA 1JCXA 1QT1A 2FDSA 1E43A 2OG9A 4LOCA 5AB3A 3AYSA 1SFLA 1F61A 1MUWA 2A3AA 1REQB 3K5XA 1G6CA 3MMTA 3WBAA 4AIBA 3PUEA 1Q6DA 4N42A 3QVQA 3T8QA 3O6AA 1UP2A 4UTTC 1FWTA 1GZGA 3VIJA 3A5VA 3IWPA 3WLKX 2HPIA 2QIWA 4TR9A 5E9AA 4F79A 1Q5MA 3FYOA 2R6OA 1P5BA 4DJEA 4YWIA 4H8VA 1WDDA 5FSDC 3TAKA 4JY8A 1E71M 1WZAA 1ZBKA 3W37A 1GW1A 2I1OA 3VDBA 2CW6A 4RNJA 4GQQA 1TVNA 4E4FA 1U30A 1GK8A 4JNYA 5ABFB 4HN8A 2XSAA 2XYLA 4UTJA 3W4RA 1W8GA 4BHYA 1W2PA 1X7IA 3WLHA 2JF6A 1RVGA 1QBBA 2FHBA 3CZEA 1K6WA 4K7VA 2YDSA 3O05A 1F8MA 3FDGA 4Q8OA 1MO0A 3GDBA 1Z8AA 4H9VA 2YA0A 3CT2A 2P8BA 1LLZA 4Q4OA 2YA2A 1UR9A 4MDPA 2EG8A 5HPOA 2ZVIA 3C2FA 3UJRA 1SSDA 3N14A 1O1HA 5C9RA 3NQMA 1FWDC 4IIBA 1B90A 1OF8A 2VXNA 2ZBTA 1MDRA 1Q7ZA 2Z1WA 3CPGA 1Q6EA 3WJZA 4XISA 4FMVA 3GZAA 3DDMA 4EPEC 1IV8A 3KVJA 3BLDA 3A12A 1XHGA 4YHGA 3WBEA 4YIWA 2C0HA 3CAWA 2Z00A 1EIBA 1F2JA 2HVNA 3MI2A 2X41A 1OINA 2ZZ7A 3NO3A 3TXZA 4GNKB 3TA6A 4EWJA 3NPWA 1EJWC 3N3TA 4RE4A 1FQ0A 2DDXA 3GVGA 1DJXA 3LS9A 4GKLA 1KFBA 4UTUA 1DOSA 3S5OA 2ISDA 5E0FA 1DQXA 1PPIA 3ZYZA 1D3HA 5A6KA 3I7RA 5HDRA 1C91A 1YADA 2O9OA 1RP9A 3PAOA 4UFIA 1W17A 3LHZA 8XIMA 3SO7A 4PMQA 1D3GA 2WSYA 1K70A 4ZO9A 4PEKA 3ECQA 3A4WA 4JTQA 3GHSA 4HPXA 5G2HA 4I9JA 1BAGA 3LLXA 2B81A 3M5XA 4KGJA 1SJDA 3AIVA 3UY7A 4DUVA 1HKVA 1IWBA 3B9NA 4XZ9A 2NWSA 3PBVA 1JZ5A 3C3NA 3AHZA 1UD3A 3AHYA 2LLEA 3AHTA 3GSMA 1EPXA 3U5YA 4AEOA 4DPQA 5D30A 1VC4A 4UMCA 2QV5A 4H8NA 2QXWA 1GG1A 4UNLA 2GGJA 5K3VA 1QATA 1XF0A 3R94A 1PEZA 1XP3A 3CHVA 2QJHA 3VO0A 4FX7A 1XSIA 2Y89A 3LXBA 3FEMA 2V5DA 1UR4A 3CMJA 1IR1A 2V2DA 2HMCA 3S8HA 4XD3A 2Q3RA 1CGWA 1U33A 3O6DA 2REQA 3ZZ1A 1LF1A 1OD8A 3URAA 4HA1A 5BZAA 1EP3A 1AD4A 3KLLA 3KHJA 1DJZA 1Q6LA 2PFHA 3KW3A 1K7XA 3L9CA 1V6TA 2XN0A 4UXDA 1F3TA 2VGIA 4FNUA 4DXVA 4F0RA 4C6DA 5GJPA 2WMHA 4C7GA 2JGQA 4AYSA 3R79A 2CHRA 2UZ9A 3M9YA 1V79A 4GXPA 3IANA 4JIIX 1VB9A 3MBFA 3USBA 3HFYA 3T40A 2C91A 5DT5A 2QF7A 3O3RA 1DIDA 1CXEA 3C5QA 4RE2A 4W7WA 3D0CA 5B80A 4LRSA 1JZ6A 1Q3NA 4PUNA 1XG4A 2QCDA 3M0XA 4DZIA 4PE8A 2XHYA 1SW0A 3FJ4A 1E70M 4BK9A 2WNNA 4LYRA 3EPNA 4YYCA 4XAPA 4UOZA 1TX0A 4LYQA 5BYWA 3BG3A 2XWEA 2UY3A 1ZJBA 2BVTA 1GJUA 3EWCA 1JXKA 1TPEA 4UQCA 3EB4A 4LUSB 3N73A 1B3XA 1CGXA 3LRLA 4AD2A 1V02A 4MNKA 1QOPA 3GZ3A 3VMOA 3ZFHA 2BGQA 4N9EA 1LOQA 5GNZA 1NWTA 3OP2A 1CB2A 4J28A 3VI2A 3WFLA 2PDQA 2Q8XA 3VIGA 1TIMA 1KCKA 5CH9A 4AFYA 3CV7A 4IG2B 1RBAA 2XFRA 1C92A 2FB2A 3R13A 2P8CA 4XZLX 3P5ZA 4ERGA 5FESA 4MKSA 2VX4A 3S1WA 4JCMA 5C7VA 2HDJA 1UKQA 4BQ2A 3B8VA 4JXCA 3W71A 2O9PA 1KLZA 3GW0A 4NI8A 5CAKA 2CWNA 1HX0A 4H9XA 2INEA 3KP1A 2V69A 1E4IA 4UQAA 4HP5A 1RZMA 1EC9A 1V51A 4XKYB 4X9SA 2V30A 1DL3A 4WEVX 1TTQA 5CPTA 1HVQA 2PEVA 3NQ2A 1K4GA 3L7RA 1I4NA 1TREA 5JMUA 3AALA 3VTRA 4B5SA 4URIA 2KAUC 4TVUA 2PE4A 3BTNA 1KA9F 5IHSA 3VC6A 1F6PA 1ZJHA 3LK6A 3IUIA 4JDBA 1HKWA 1JJKA 3PHAA 4MOZA 4Q6JA 5A1AA 2GJRA 2QS8A 5FJTA 1HJSA 2BVYA 4HNLA 4RJEA 1XYMA 1F73A 1E0UA 4O53A 4GO9A 3OA3A 4GOAA 3G8RA 2C8NA 1LOSA 1JFXA 4IGNA 3Q45A 1A3WA 1V0NA 4F8XA 1L2UA 1E0VA 4GYKA 5IXEA 3FAWA 3NXFA 3OO2A 4A8NA 4LALA 2Y6ZA 3TA9A 1JYXA 4IGHA 1SU5A 4PMNA 4C6LA 2ACUA 3SW6A 3JUGA 2P76A 2V63A 3VK5A 1AA1B 1GTEA 1TTJA 5FJIA 3HTWA 4K1GA 2VEPA 3O0KA 3P80A 2BOFX 4D6DA 1KR0A 3WEOA 1TO3A 2C1IA 2BVDA 5FEXA 4H7CA 4QCEA 1I2OA 2PA6A 3QSTA 1X98A 3WY1A 4KESA 3P74A 3I7SA 2Q09A 4NJIA 1F05A 9RUBA 4JN8A 2PCQA 1HJUA 1DHPA 3O07A 1H7RA 5LNUA 1A3XA 4V15A 3W9ZA 2QJNA 4K2SA 5A3HA 1QW8A 2IPWA 6PTDA 3NYZA 4AWEA 2HBVA 3PJTA 2NXHA 1V77A 1UASA 5EYWA 1V3LA 4MY9A 3CC1A 3KWSA 1IXNA 3TYUA 1QWKA 4OT7A 2Y8UA 2VOMA 3T05A 1LRQA 3WJSA 1VPQA 1DTUA 4I9TA 4ADTA 1BQCA 2JKEA 4QNEA 4N6FA 4ICCX 1ME9A 3ONCA 5K2ZA 4DELA 4XUYA 1IQ8A 2FVMA 5T26A 1M04A 2BOEX 5FJJA 3EMZA 3EXTA 1R47A 3KDOA 3NSMA 2VEGA 2XM1A 1JRBA 4GUIA 1ICPA 1W54A 2OZ3A 3FLUA 4GYPC 1JCJA 1VH7A 5E5CA 5D05A 4D8AA 2W0UA 3VOJA 3O7UA 4MG4A 3NURA 4Q22A 3WDHA 1WX0A 4W7UA 1NFGA 3P3BA 4X63A 2RHGA 1CNVA 5BRBA 3HMCA 4GKTA 1QCWA 2BY1A 1E15A 1JF6A 4NASA 2Y8KA 1Q45A 4HMNA 3UG8A 1JPKA 3T0CA 3MKVA 3GY1A 1L9WA 4A3UA 2PWVA 2ZADA 1PCWA 1B0IA 2DZAA 2PWEA 1US0A 4GUJA 4DVOA 1XLCA 1HP4A 4V1YA 3MC5A 4V27A 3E5BA 2ATMA 5LIXX 3PBWA 2C13A 5AHEA 2ZTJA 1DJIA 3NAVA 2J7CA 3N12A 3CGTA 1KBKA 2V2CA 3MI3A 4GQRA 5EFDA 3CXOA 2VMFA 3MO4A 1ZENA 4QJ4B 2I9UA 4M8UA 3G1AA 1XLLA 2C19A 3A24A 2VM8A 4KS0A 1MEHA 4JTEA 3MDWA 2W66A 2ZXBA 4ZR8A 2NXIA 2CITA 1ZAJA 2QJIA 4LUTB 2WBKA 5A6LA 1OK6A 2EO7A 4XO7A 3WDIA 4I5UA 2OJPA 2WM0A 4F0SA 4P7NA 4YHEA 1IIGA 1TKKA 3WQ4A 4C90A 4KWVA 3TEVA 1DJGA 2QCGA 3K8LA 2VCAA 2D22A 4A8RA 1CBGA 1A80A 3OZMA 3TN3A 3W7EA 2ZUTA 3G1XA 2Y24A 1BYDA 2Z2AA 3T2PA 2F6XA 3BGAA 1Q2RA 1J5SA 3HGOA 2WZEA 4B9YA 2WYSA 3G6LA 2HSAA 2Y85A 4C5ZA 4ECLA 3R7MA 3W7HA 4AXNA 4FPSA 1GVRA 1N8FA 1GVSA 1XKYA 4CQCA 4PL2A 3SRHA 1UJPA 5CJ5A 5K4ZA 3AIEA 3HO8A 2J6XA 2ACQA 2GUBA 4PTNA 3IGXA 2R1PA 3VVGA 3VDCA 1JD9A 1W3TA 2QLYA 3W7OA 1DV7A 5FAGA 2NLYA 1DVJA 3C2OA 1NF7A 2FMOA 4IUGA 4IQLA 1XLEA 4LS1A 3NTYA 3LHWA 2DJLA 4F2BA 3IVUA 3QZEA 4L9YA 3W7DA 2BGNE 5B7YA 4LH8A 1DIOA 4GFSA 2CZEA 1HKKA 4O11A 5PTDA 1EWEA 3JZEA 1KB3A 5EB8A 1TWSA 4IP5A 4KBXA 1C90A 3VM7A 2CLMA 2PODA 1WKEA 2Z4GA 3T4CA 3STPA 1IZJA 3SCWA 1TE6A 5JBFA 1NOUA 1UR3M 2BGSA 3CMGA 4PL1A 3NCOA 3N04A 1XYAA 1EYWA 1WQ5A 3OPSA 4JFUA 3WQPA 4XX6A 1BFNA 4LAMA 4RXGA 3O9NA 4M3PA 2E9MA 2VFGA 3GTIA 3O0FA 3IEBA 3TX9A 4LEQA 1SUXA 4U31A 2DZUA 2WC4A 2JF7A 4HJWA 1OZQA 4I9MA 1W31A 2H3BA 3PZNA 4AVFA 2A5HA 5ECUA 3H2AA 4H3DA 3W1RA 4DNMA 3PTKA 1OIFA 3WH6A 1HO1A 5CCZA 3N29A 1WXJA 1PO9A 4LGXA 4KWOA 2YDQA 3GU9A 4KKXA 2Y0FA 1YPFA 3M7SA 1T8XA 1W1ZA 3LZ5A 3MMDA 3IUHA 3DBPA 1BQGA 2WMIA 1HQTA 3UWYA 4AZ5A 1KLYA 3CT7A 4S3JA 1S1RA 1EXPA 3BLLA 4K8GA 4RX0A 3CZ8A 1IGWA 4RR4A 4W89A 3ZXWA 2W27A 3OG3A 1FWHC 4R3UA 4NU7A 3BV4A 5I3DA 2HE8A 4FHAA 1AZ2A 1EP1A 1VFOA 2ZYFA 3WNOA 4D1IA 3FSTA 1G7UA 4GQGA 2V67A 4D2JA 3DESA 3WLJA 3WSUA 1NSJA 4CQAA 2YZ5A 1ZNNA 1SZEA 3S5SA 3HU7A 4G7EA 3BH4A 1JD7A 1TCDA 4DEFA 3N3MA 4RV8A 4DN1A 3L4TA 3HG5A 4NVTA 3MCMA 3W27A 5FF2A 3AMLA 1UUQA 1JGMA 2J74A 2GSEA 5A6BD 3SGZA 3UXAA 4MAVA 1EOMA 3M64A 1NTHA 1UH3A 2FB3A 3H2OA 4Z08A 4QXIA 4HYRA 1R30A 3VUSA 3FGCB 3CYJA 1ZY9A 3AHXA 3PULA 2D69A 4PRTA 3CU2A 3VNYA 4RDVA 3TP4A 2ZZ5A 1PL9A 5CZJA 1O5KA 3ZWSA 2Y5JA 3NL5A 3DUGA 4JTTA 2TRSA 2JALA 2WCSA 5I79A 1PX8A 2OZ0A 3SADA 1GYLA 1KFJA 1PSCA 2J7HA 3DHUA 3CWNA 5CPOA 2IPJA 3R1ZA 2F38A 1R38A 4WCJA 1XYFA 2FVKA 4Q8MA 4AD3A 5CZSA 1NOWA 4HNVA 4JIEA 3QY7A 4GJIA 1DBTA 5CJNA 2CLOA 2VX6A 4KEZA 1N7KA 1QPOA 1C7TA 3UR8A 4K68A 4MGGA 4JTRA 1LQ2A 4HGXA 4EANA 3GG0A 1EHNA 5HJYA 1Q6RA 3MVIA 1H1NA 2A3LA 2QUNA 5A8GA 2YL8A 1Z48A 2YIHA 4O17A 1V93A 2X7WA 1UOZA 5DXXA 1EJXC 4O0QA 1UQYA 5TAOA 5BOOA 3ZSTA 2VRQA 1VJIA 1M7JA 4AYGA 3ANVA 4ZQRA 1WCGA 5I23A 2PU1A 1W32A 3R10A 4AF0A 4ASTA 2F2KA 2BNJA 1QW9A 4AD4A 4M24A 4OUEA 1A4MA 1C9WA 1KBJA 2XH7A 4LJ3A 3F4CA 5FSEC 1KO0A 2BVWA 4OBTA 4D6JA 3V5OA 4HVXA 3H26A 3W00A 3W2NA 3R0DA 3VDAA 1UMYA 1XYBA 1OT2A 1TWIA 2Y5SA 3NDZA 4BY3A 3ZQ9A 1JRCA 1JQVA 1S5NA 1CGYA 3PR2A 3PS7A 3KBWA 4B5UA 2C3ZA 2CETA 3WQEA 3UVIA 5DF0A 7PTDA 5D33A 4PCTA 3N9RA 4PRRA 1A5NC 3GDKA 4WD0A 4GVGA 4I9AA 3OLEA 3RLGA 1HP5A 4ACZB 4L4OA 7REQB 3LXAA 1SMDA 2ISSA 5F2MA 2X1UA 4AZGA 1TMQA 2QEZA 4A05A 3N4AA 2JK2A 5I07A 2YBUA 2D20A 3JR2A 2RDTA 1D8WA 4U33A 1UA3A 4FOJA 3NQDA 5C71A 1EX5A 3VA8A 4GZ7A 3G3MA 1R9ZA 4RUBA 4M5PA 1PWLA 1Y65A 1Z42A 4HSOA 2GPTA 1VIWA 4KGLA 2Z27A 1MSSA 2HVOA 3A64A 3G1DA 1BXCA 3GXDA 3GYCA 1PHWA 1V6VA 4C6CA 1T41A 3P84A 4O16A 3DKLA 1KXVA 2QJGA 5BU9A 1OY0A 4MWAB 2PWGA 1C8QA 4QP0A 3GXMA 1LZOA 2YKKA 5E6YA 3TN4A 3WF1A 4FK9A 5L6UA 5CPSA 2CZFA 1PXGA 3N2CA 1Z32X 3OZYA 1KTBA 4MHBA 4DNHA 1TCMA 2OEKA 1BD0A 4QRNA 2QUUA 1UPMB 3B06A 3AOFA 1I0DA 1UH2A 1V0KA 1X97A 3WH8A 2FYMA 1X8FA 2QAFA 2WJDA 2OFJA 4LUYA 4Z1BA 5DX7A 1EHAA 2IPGA 1F07A 1R3WA 4IL0A 3CZGA 1LBLA 4HOXA 1UKOA 2VC7A 3ANUA 3DGRA 3HN3A 1LROA 3AFBA 2NWRA 4O1AA 4ERIA 5CLWA 4US5A 2KX9A 2DIJA 1M68A 5D37A 3NQCA 4LRTA 1EBHA 3LTYA 1YXDA 3N2XA 3R6IA 4BR1A 5G4EA 2RH9A 3OYXA 3M43A 3KOXA 4H8HA 1PZ2A 3M6YA 4DLMA 4L1WA 3ZIZA 4B9ZA 1QHPA 3BSMA 2QR6A 1M5WA 4QEEA 5AHFA 3TVAA 1ZBWA 3NWRA 2NQ9A 3EOUA 4ZMGA 3ES7A 3ZOAA 4HQVA 1H51A 3IIZA 3A4AA 1WYIA 3BW3A 3GXFA 3IK2A 3PANA 1WBHA 3WDPP 4IPLA 3SIZA 1ZFJA 4FZIA 4F0KA 6REQB 5IHRA 4C91A 4JOMA 2D0FA 3N17A 1O7AA 1F74A 3BXWA 1TV8A 1QAPA 3QEZA 4L61A 4RDWA 1OCQA 3W23A 1XLBA 2GVGA 1W9VA 1CYGA 4LUIA 2QHAA 2ZA1A 4MIMA 3GNXA 3HPZA 1CEOA 4W4QA 3TJXA 4FOKA 4GQBA 1A50A 4PUKA 4AD1A 3PC0A 3ITLA 4W9TA 2W9MA 5HA7A 1ICQA 3A22A 3W07A 3WDQA 2O4MA 5E6ZA 3ATZA 4DLFA 1UZ1A 2WSKA 1PKYA 1JZ2A 1FH8A 3WK2A 1ZBVA 3SIMA 1KM5A 2B31A 1PJ9A 2ZA2A 2W79A 3L0NA 5A8PA 2YYTA 4NZCA 3BJTA 4ZQNA 3ZJ8A 4A29A 5EGRA 4LYPA 2DZXA 2J62A 1J4EA 4KMQA 1TPVA 3CK5A 1UZ4A 4NT0A 4AX6A 3C3UA 4D72A 1PTDA 5AZ1A 1H1YA 3PJUA 4GGHA 2HXUA 3UG5A 3SB0A 3S1GA 2OR2A 3N13A 4UOQA 3RRXA 3E02A 2VDGA 1US3A 3CTTA 4PZVA 2V5LA 3B0YA 3CIWA 1E40A 3N11A 2VEIA 7TIMA 4E8GA 2CERA 2PRHA 3OW1A 4D71A 2VWTA 1L2QA 5AVHA 1B5TA 4W88A 3GS6A 4BWLC 1I8JA 2EGZA 3DU0A 1FH7A 1YBQB 1QOQA 4FIRA 1Z44A 3I3DA 4HYVA 2EAWA 2XZ7A 2PDWA 1TRIA 4ZFCA 1VGAA 1O94A 4DI9A 1FWFC 2WZIA 2ACSA 2Z1BA 2DT2A 1ADSA 1WKYA 3DI0A 2DZPA 2HXTA 2NXGA 4AZ7A 1UIOA 3L0KA 4Q4MA 4B3KA 3PFRA 4E8DA 3BW2A 3ES8A 2VC6A 4MB4A 3WUFA 1JZ4A 4O19A 4PN2A 4M81A 4PBFA 4F48A 1DJQA 1B3YA 3E2QA 3B0UX 2H6RA 1UUMA 1OHLA 4QAWA 4EP8C 1R85A 4LB3A 4IOTA 3KOYA 4NZFA 4H7VA 3RLVA 1EQPA 2G3FA 3W6LA 1XJBA 3RU6A 5C70A 2QAPA 3S2NA 3TYEA 2VHLA 1JPDX 4S2CA 1QW7A 2HK0A 2X42A 1O5XA 3PBUA 1ISXA 2E25A 5BNKA 3M44A 1BTCA 1KC7A 3UR7A 3DERA 3ABSA 4D1JA 5A6BA 1ZAIA 5IOBA 4D6GA 1B3WA 3UG4A 2H3DA 1RD6A 1HJWA 2E6DA 1MW1A 1EKOA 2FJUB 3SJ3A 3Q67A 4YMZA 1CZ1A 1J0YA 1IE7C 2VVNA 2XSXA 2EKCA 2V0TA 3WCZA 2YXXA 3S9ZA 3SCOA 2XH2A 4NY2A 1N82A 4I8YA 4XUGA 4B2DD 1FX6A 2WNQA 1UH4A 1GCYA 1JVNA 2B0MA 3NNTA 1HJXA 1J0IA 1QNOA 3HPAA 1PX4A 1YDYA 3BVJA 3E96A 3BAXA 5K9CA 4H01A 1CXFA 3K30A 4CQDA 3TFCA 1YIXA 3UWEA 3DFOA 1EQCA 3WEMA 2D2OA 1VCGA 1A5LC 1AH0A 1MW0A 3AC0A 2A7PA 3NA8A 4DWDA 3LN3A 1D2KA 5LZLA 4DJFC 1DKWA 1S2WA 1E9ZB 1UD5A 3PK7A 2WJFA 4B5TA 3BO9A 1VR6A 5JBDA 2TAAA 3H21A 3EMCA 3MTWA 4HU0A 2Z6IA 3C0LA 3T6CA 3IAPA 1G4EA 2HQAA 4QLLA 1XI3A 3BAWA 4AHOA 4YTRA 4EXAA 3STGA 4K37A 3LMYA 2ZXDA 2CLKA 1XD1A 1U1UA 3ANYA 3AJXA 1AJ0A 1YX1A 2P50A 4MMWA 3B8WA 1MUMA 4CUCA 1LORA 1PE1A 3HJZA 4QX4A 1CLXA 3QGVA 5A2AA 4PMZA 4TOQA 5A94A 4DYJA 4O1EA 1F7BA 2IXUA 3BDKA 3I4EA 4WGXA 4WOQA 1SJAA 3TC3A 4P7RA 4JEQA 3U4FA 2WJZA 1UC4A 1WE5A 3EOLA 5GNXA 2PC8A 2F2HA 2WJEA 4HN4A 1CGVA 3XISA 3B8DA 3W1PA 4YJ5A 5C9ZA 3NPVA 5E1QA 2A7RA 4GINA 4DQWA 1JF5A 1SGJA 5DRIA 5JBEA 4IG2A 1V3JA 4E2OA 3LQLA 4JTLA 1BWLA 2A2IA 4U3CA 4IFOA 4PTMA 5LIUX 2X2GA 5MKGB 4ADUA 2P3EA 2WB5A 2ATSA 3FJ6A 1I2RA 5EU9A 2XPKA 4ORMA 4EVZA 2VT0A 1RA0A 4KETA 4E2DA 1NIUA 2EPOA 4LAUA 4O54A 1K77A 1E6SM 2YCJA 1ZAHA 4XKYA 3FVMA 2GUYA 4W84A 2WVVB 3WNLA 2OSYA 1UB3A 4Q7NA 4L4PA 4PFHA 3SCTA 1ZB5A 2JGYA 2VO5A 3GW3A 4GYFA 1E9LA 4IQDA 3Q2DA 1KGWA 4Z0JA 1C7SA 3GR8A 4Y8FA 4LCSA 2ESCA 4IMAA 2WZTA 3FXYA 1V6XA 2BG5A 3GNPA 4N4PA 2VFEA 2WNZA 3W83A 1P7TA 3W7GA 3E5PA 2BWGA 1TWZA 2ICSA 2H9AB 1LWHA 3EX2A 4X2PA 4E2BA 1SW7A 4FNPA 1J0ZA 3W75A 2CBJA 3XINA 1KM3A 2KZHA 4KRTA 4XG1A 4AC7C 7A3HA 2D2JA 1CXLA 1JPMA 3KRUA 2G3JA 3LD5A 5CAHA 3WQOA 3GRIA 3EXSA 3M0ZA 4D6IA 3KL0A 1T96A 3PSVA 3H7UA 3TROA 2ONEA 3C8NA 1DWFM 5CG0A 3MUAA 4PSPA 4N9CA 3N2TA 2IKJA 3KZPA 1XUZA 2X7VA 1VFHA 3E9AA 1EUNA 1O68A 3W7LA 5AHIA 2P0IA 3I10A 2WNWA 3DAQA 1X6NA 3SM0A 4QJ5B 3CHFA 1SSGA 4UTWC 4IQEA 4KRUA 1EWDA 1J18A 3PM6A 2YXGA 3NGJA 5FCZA 4K6AA 1EBGA 2CLEA 5CGTA 5TBOA 3VZZA 3EWXA 2ZRXA 1AQHA 2ZA3A 5XINA 3U2EA 4I3GA 4JTDA 1GQJA 5CQ1A 3H24A 3I68A 2CLFA 3MMUA 3LBOA 1ONWA 4PSRA 4JYEA 1ZZMA 2VCCA 3DFQA 2QGYA 1GGOA 3IJQA 2FLIA 4MZYA 1YDNA 4W87A 4MWAE 2PDHA 5TQLA 2FGZA 4E4UA 5TNVA 3EWDA 4HSNA 1XW8A 4IJCA 3WG6A 3PJWA 4KEUA 2A3EA 2CNCA 3ZLFA 3GG7A 1K4HA 2D24A 3OLDA 3N2OA 5FEZA 5GJNA 4N6EA 4ZQOA 2HS8A 3D3AA 3KEHA 4ENLA 3LCHA 2XIIA 1NFBA 2R9RA 3BW4A 2YCEA 1ODUA 1NJJA 2P5NA 1H7XA 3VMPA 2FHFA 2BSLA 2C1HA 3SCRA 2ZWYA 4KEVA 3SUTA 3VPLA 4E3VA 6XIMA 1F6YA 2OWWA 1SO5A 1A5UA 4ZSUA 3ZLGA 4D9PA 5KZEA 4PUDA 4M6PA 5KZ6A 3LSCA 4O50A 4IISA 3CQHA 8A3HA 1TPH1 1NVMA 4JQAA 4IP4A 4L65A 3AU6A 1QI3A 1VHNA 2EJ1A 3MUCA 4Q6XA 4HCLA 5FF7A 3S0CA 1BKSA 3GLCA 3KL3A 5CKSA 4NHVA 3H2NA 4H2HA 3SY5A 1NWRA 3L4UA 4QFUA 3C0QA 1GYMA 1PZ3A 1VZWA 3FW6A 4RL3A 4QDPA 4W5UA 3QR0A 3CNYA 4LUTA 2BX7A 3I6TA 1OB0A 1O5QA 3P82A 1Z89A 4C6PA 3TH6A 2PDNA 4J3XA 1JYVA 2A3HA 4Q4RA 1GOQA 1NP2A 4QR6A 3CL7A 2PMQA 2QKFA 4J40A 1XH0A 1W1B1 1AW2A 1CT5A 1U5VA 4WQ6A 4C5YA 4H8UA 2PTZA 2GGEA 1DTNA 6TIMA 4O0KA 2ZFAA 1QI5A 2WMFA 5JUVA 4YTSA 4H1ZA 3CV1A 1ISZA 4KF1A 8RUCA 2JFEX 2PGFA 2D0HA 2VZVA 3OGRA 5XIAA 2I5QA 3VKBA 3GU1A 3G2GA 2GJNA 5EY5A 4W8LA 1LRNA 1TTIA 3EWUA 1V6UA 3QM3A 4DWSD 2H90A 1AH4A 4S23A 3W7KA 4C6KA 4YS1A 3B0VC 2VWSA 4FB7A 3GVVA 2DW6A 4R33A 4AQLA 5DO8A 3GXPA 5BOFA 2ABBA 2QPSA 4MJZA 2ADAA 3PUOA 3R4IA 3AXXA 4H9TA 3EYPA 3P61A 3R2GA 5EMUA 2GJLA 3KVMA 2BY0A 3W1AA 4IXHA 1OM0A 2INZA 4ROPA 4M29A 5F2GA 2J7FA 4INFA 3CHDA 1H50A 4NAFA 4O1BA 4GISA 1EF3A 1QR7A 1P48A 3VNJA 3M0LA 1GZJA 3YPIA 1OABA 1J0JA 2V3FA 5H6HA 1UD4A 4ZE5A 4ZXOA 2ANUA 1T0OA 4A3QA 1W9PA 4GACA 1VCVA 3BSHA 2YJQA 1XXXA 2YCIX 2AOSA 3CUJA 5LA2A 3F5LA 1OG6A 1UR1A 2QUVA 5D2TA 3DYOA 2DZWA 4WIWA 5TIMA 1L6YA 3A9BA 4FXSA 1OSEA 2AAAA 3W1UA 5AC4A 4HZ8A 4WSKA 2FIQA 1FWCC 2FMNA 3K2GA 4G1NA 1VPYA 1F3WA 3MHFA 4O8AA 3W73A 3SECA 5DCDA 2JBMA 4UQEA 4K1WA 5ECVA 1EP2A 5FA5A 2Y7DA 3CZJA 4F0MA 5CC3A 4C1NA 4HB7A 1ODZA 4B2DA 2B7PA 3AQUA 5I3IA 7TAAA 3V5CA 3UEQA 2PF0A 1QWGA 1VYSX 1DP0A 2QMJA 1XCWA 3LHUA 3HV9A 2J66A 3UA4A 4PCNA 3CB8A 5CBIA 2X1TA 4OBRA 3V75A 3M6DA 1POJA 1KV5A 3EWWA 2GVYA 3S6TA 1LWIA 2X40A 4DWSC 2ZDRA 3CTLA 3GE7A 3IUDA 3WQ5A 3MUZ1 1FWWA 2VX7A 4JTFA 1FFRA 3H2CA 5LHFA 3ZMRA 2VYOA 2D0GA 4EWND 3A13A 2G50A 1S3TC 1UWIA 2XVNA 3OZOA 3BMVA 1EJ7L 1LM1A 1M41A 4GNVA 3SQLA 1LLOA 4CN1A 1PTAA 2CLHA 3PPGA 4F4RA 2TMDA 3TYZA 2EXOA 1DWIM 3LHYA 1ALDA 1FCQA 4HD5A 3WQVA 1J93A 1BKHA 1DJYA 4LV9A 4BF9A 1QPNA 1MVYA 5H91A 3ZR6A 1VD6A 2E4TA 4YU1A 2D1ZA 3CPUA 1GQLA 4H6QA 5CXPA 2XN2A 3W1MA 5M17A 3L67A 1IHIA 5FD0A 1VJZA 1IR2A 1PVNA 1OWQA 5FF3A 4GY7A 4J1OA 1RQHA 3LBMA 4NNBA 3F4NA 1XLHA 1PB0A 1DQUA 2EKGA 5AHLA 2PURA 2ZRWA 1H62A 3V16A 3JZUA 4AH7A 4X60A 4UR8A 3OODA 5CSRA 1YKWA 1UC5A 2ZZ6A 4QS5A 3CH0A 4RXFA 2OZ8A 3ABQA 3VD3A 4UTWA 3BQ6A 5EA9A 3AXIA 1YPIA 2V5BA 3L4WA 3MO7A 3OLIA 3RXZA 1VLWA 3TZFA 3T0BA 1PDYA 1GORA 5JXQA 4FOUA 3THAA 4UR9A 1A47A 1QI4A 2V5KA 1PV8A 2WSQA 3HM7A 3LX9A 3L2MA 4NI3A 1NOFA 2WC3A 4YLWA 3SFWA 3PTDA 4ZXLA 2B4GA 5IDIA 3PB2A 3OBKA 4S3CA 1TQXA 2FKPA 5HR7A 1NP0A 3GHTA 3AO0A 1LP6A 4IPNB 4GABA 1SZNA 4XBKA 3MJMA 2VR4A 1DWAM 3APTA 4M7SA 4O52A 4PBEA 2O4QA 3F4DA 3QSRA 3KFTA 1A5CA 3MP5A 4N7QA 1XG3A 3OEXA 5C7HA 2NX3A 2XIBA 3UCQA 9CGTA 4GMEA 1FP9A 1V08A 2UY2A 5H8UA 3V36A 4FSAA 2Z7KA 4FS9A 2CIPA 3THUA 2PDPA 3LTPA 5I3HA 1D3CA 2PDGA 4MB3A 4NP7A 1GOOA 5FJPA 1BSLA 1YXYA 1EO7A 4UFLA 3TR2A 2G3MA 3VIOA 4C6NA 3DECA 3B9DA 4ES4A 1OVDA 2E77A 3GG1A 3HF3A 2YL5A 1J01A 2Y1HA 2H8ZA 1HFBA 3WQDA 3WLOA 3W7RA 4OUIA 4AIEA 1KM1A 2OCZA 3THCA 5CSSA 5DY2A 1DORA 2OQYA 1CXKA 1WO2A 1K9EA 1A5AA 4A3YA 1OK4A 3GTHA 3WK1A 3DG3A 3POHA 5FIPA 5F4WA 3S2CA 3LCLA 7REQA 2IKIA 3QPZA 4DB7A 1XM3A 1JNDA 1XD0A 1A0CA 2J79A 1HGYA 2QPUA 2ABAA 3CLMA 3HG2A 5DQPA 3G1RA 5BRPA 4O18A 2ZIDA 1M7OA 4UTKA 4CLMA 2J8FA 5KZDA 3ABRA 3UQNA 4G7EB 3EMQA 2NV9A 1XUUA 2OX1A 4A4AA 1BRLB 2BHZA 1FWEC 2X2YA 3QH2A 3R5EA 4GWEA 1KFWA 1NY1A 1A4LA 3VZXA 5REQA 3VGGA 4WF7A 2OWCA 1QASA 2IMRA 3APGA 4CEUC 1OF6A 3BG5A 4HPNA 3EDKA 4WXYA 4AZIA 3PTQA 2MUCA 1B4EA 3W2JA 1SR9A 3UWQA 3U7BA 4N0RA 2PSNA 2D2GA 1DYSA 2RGMA 1QHOA 4JN6A 4Y90A 5D9NA 4Q33A 5F2LA 4GC4A 1U2YA 1GVIA 3LNPA 1GWJA 3SY1A 2Y2WA 1FDZA 1ISYA 1MWOA 1IXQA 1W9BM 5DMYA 1UPPA 2FZNA 4FIQA 4HPHA 2ZUUA 3BURA 3QQ1A 4Y9MA 2PD5A 3PBYA 3FJNA 1OFBA 5KINA 3J7HA 3WQWA 5AYYA 3CUIA 3P2VA 4QBXA 1AK5A 4UTLA 3BJFA 1W2VA 3P6LA 2V3GA 4K38A 2VNCA 1S39A 4E3TA 3UP8A 3W82A 4M6QA 4WDUA 4FEZA 1XRFA 2AGKA 4HPJA 1KCZA 4D6EA 4XSMA 4X9YA 1EX1A 4PB3A 5HK4A 3GNRA 1FCVA 5DANA 3DX5A 3T42A 3ARUA 4M6UA 1Z3NA 5FL0A 2QW5A 3O6YX 1OGGA 1ICSA 3QFEA 1R3YA 3B9EA 3M41A 3GC2A 3FY1A 2YBVA 1W9XA 4JFVA 1BG4A 1KM2A 2WVSA 3BLFA 4AVOA 4QIUA 5FJUA 3DYMA 4B5VA 2V3DA 1RCOB 3VCRA 2CYGA 3WLIA 2DQXA 2NV2A 1X7FA 3IIVA 2GVJA 5IBXC 5K9DA 3QLLA 2WMKA 3NL2A 5EL1A 2YL9A 4GBUA 4TUFA 3WD0A 4Z2JA 4FF5A 1S2AA 4JQ1A 3ABZA 3MV01 2QGHA 4UFMA 6REQA 2J6VA 4HHHA 3UJ2A 1W5OA 3M0YA 3JVAA 3V18A 5FEPA 4JQ2A 3EA3A 4XIAA 4CQBA 1JZ3A 2PTXA 4FXJA 3WK0A 1V02E 2GOKA 3DH7A 2NZLA 4AUBA 3T2OA 3SRFA 4PULA 3RR1A 4LF2A 1JGIA 1PKLA 4C1LA 3I4KA 1UIPA 5EFFA 4FALA 5F1VA 3UZWA 1VAHA 2YB4A 1XBYA 1OC7A 3SCUA 1KXTA 4NQ1A 4LVGA 4L1XA 2PI6A 1E0WA 3ARRA 4KEMA 1IT7A 3W28A 3AUJA 4QM1A 1YTEA 2DZTA 5JQ9A 3V0SA 3P93A 5T9CE 2TODA 1JDAA 3W7CA 3D5HA 3TSMA 4JTUA 4XB3A 2HISA 3AS1A 4GZIA 3VAVA 4IXXA 4CNUA 1DJHA 3L68A 4MJMA 5HNNA 1IZCA 4HSHA 2VZOA 4JFWA 4DX3A 1W8SA 3M4HA 3IGUA 5E0KA 2ZZ4A 1SW3A 4PMXA 4GUFA 4KT2A 2QUTA 4P8WA 3LOTA 2OKTA 2PZNA 3AROA 3BE7A 1H1ZA 2ZX6A 4LS0A 2EBNA 1R3QA 1CI1A 2J78A 3QXBA 2PDBA 3A5FA 1KGUA 2J7DA 1GJPA 2W91A 1FWSA 3CBWA 2WV8A 3W38A 2OELA 2Z25A 2G5WA 5F7UA 3FXGA 1M01A 3E0FA 1TJ1A 2X05A 2OMAA 1PYFA 4DAFA 1TB3A 1WUFA 1JIBA 3KTSA 4REQB 1XBVA