3LOTA

Crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
310
Chain Sequence
DDVVIVTCAITGAIHTPSMSPYLPVTPDQIVEEAVKAAEAGAGMVHIHARDPKDGRPTTDVEVFRYICREIKKQSDVVINVTTGGGGTLGIPVEERAKVVPALKPEIATFNMGSMNFAIHPLLKKYKEFKYDWEPEYLEMTRDIVFRNTFKDLEALSRIFKENDTKPELECYDIGQIYNTAFMFHEGYLEPPLRLQFIHGILGGIGTAVEDVLFMKQTADRLIGRENYTWSLVGAGRFQMPLGTLAVIMGGDVRVGLEDSLYIERGKLAKSNAEQVEKMVRIVKELGKRPATPDEVREILGLKGKERVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structure genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal structure of PROTEIN OF UNKNOWN FUNCTION (NP_070038.1) from ARCHAEOGLOBUS FULGIDUS at 1.89 A resolution
rcsb
source organism Archaeoglobus fulgidus
total genus 107
structure length 310
sequence length 310
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05853 BKACE beta-keto acid cleavage enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lotA00
3DFOA 3W2LA 3LV5A 2YW4A 5DXXA 2QJGA 1OFRA 3HB9A 4I7VA 3BV4A 2ABBA 4UFIA 3I7RA 3TQKA 2QJIA 5C6MA 5HR6A 1JQXA 1ZCOA 1EIXA 3BGJA 3BO9A 5AHFA 1JQVA 4O1CA 4CQ9A 5BMXA 5FESA 3GDRA 1TSIA 4MOZA 1FDJA 1LORA 3ABQA 4U4MA 1H5YA 3NR0A 2R91A 1TTIA 2NXGA 2KZHA 5AN7A 1F74A 1KFCA 1L9WA 5HWMA 5CPLA 3HBLA 4R7JA 1WV2A 3DFSA 3W2UA 1H7XA 3P8JA 1XBXA 3IIXA 3UYCA 1EUNA 2Y89A 4Y90A 4K6AA 4FB7A 3R12A 1KTBA 3IGXA 3MO7A 2H6RA 4O52A 3W1MA 5D05A 5LSMA 1Z41A 1WQ5A 2GOUA 5D09A 4A2RA 5CSRA 1Q6RA 3TW6A 3W7NA 1VCFA 2BWGA 1I4NA 2W79A 3C3NA 4FHAA 3Q94A 1DKWA 1WX0A 1FY6A 4O18A 5F2IA 2XN0A 4RKAA 1WBJA 3P74A 2OZ0A 4H4IA 2TPSA 3LCFA 5J5DA 2ZZ2A 1JCXA 3TH6A 1X1ZA 3L0NA 3H55A 2PC4A 2CZEA 5D32A 3NL5A 2BZNA 1O95A 2H90A 3L21A 4OQVA 2A0NA 4GXMA 3MWAA 3KOFA 3PUEA 1K7XA 1OFOA 1UBSA 3W1RA 4N4QA 2Y85A 4ML9A 3O63A 3W88A 3NQAA 5DY3A 2CLIA 4EWND 4LV4A 1A5BA 1V5XA 3O8AA 3W86A 2ZDRA 3LBMA 1GVFA 3Q2DA 1B3OA 4NUWA 2A2IA 4QQ3A 4NXKA 4UCGA 1G69A 4NZJA 3LCHA 3MBDA 3TFXA 4Z1DA 3DFQA 1A50A 4CCEA 1S5TA 4NNBA 6TIMA 3O6CA 3WJZA 2WNQA 3NNTA 3B0VC 4PL2A 1A53A 1W5PA 1K7EA 3A23A 1JCJA 8TIMA 3W1NA 2ISSA 3PBUA 4BWLC 1F5ZA 1R2TA 3I68A 1GOXA 2J6XA 3NPXA 4UXDA 2WSYA 3WJSA 3UWYA 3ZWTA 1HFBA 1O5KA 3ABRA 2GPTA 3C52A 1VZWA 3W1LA 4IPIA 5CG7A 3RLVA 1UCWA 3EB2A 3SI9A 3R2GA 4JD4A 1OFQA 4NNAA 3THQA 3FYPA 2D73A 1TPWA 1JCYA 6ALDA 2UV8G 3UD6A 4WUIA 5EBUA 3SY5A 2NXHA 3MMTA 3E12A 4Z08A 3SR7A 5G4WA 4KWWA 1QOPA 2Y63A 3PBWA 5U7SA 2O7SA 4NZFA 1YTDA 3G8EA 4UTIA 3T7VA 1W31A 3W7HA 4Y6GA 5DXYA 1YYAA 1HG3A 3BG9A 4UC5A 3GLCA 5DELA 2FLIA 3KVKA 1EP1A 3W7PA 4O1DA 2DZWA 2NUXA 3TXVA 1VH7A 4XTDA 4N9CA 2EHHA 3TA6A 1H60A 5D2WA 1XBVA 3ZWSA 3HGOA 4H6KA 5KSWA 3MHGA 3FOKA 1EX5A 1RPXA 4IXHA 1TYGA 1FDYA 2R8WA 5HNRA 1S5VA 4PC8A 1KM6A 4IX0A 1K8YA 4IJBA 1N7KA 4Y9AA 5L9FA 1O94A 3CT7A 2AAMA 2C0AA 2YDAA 2FTPA 3QMRA 1O5XA 5DCEA 1NF7A 2XFWA 3O07A 4BR1A 1D3HA 1JCMP 3P61A 4BWLA 2TMDA 2BLEA 1FXPA 4O8RA 3E9AA 3L65A 3BGGA 3CWOX 4MYXA 7TIMA 1P0NA 2G95A 2WKJA 4NJHA 3QF0A 4MJMA 1VPXA 1MEIA 1R46A 1S5WA 3MI6A 1FBAA 4RCXA 3W71A 1JRBA 2VFEA 5AC7A 4MUZA 4JTUA 1UASA 2E5BA 3DGRA 3P8IA 3UZJA 3T55A 4HSNA 4E0CA 1IGSA 5I3KA 1W5OA 2CZDA 2V2HA 1IF2A 1WYIA 4BI6A 1J4EA 4E2DA 4G1KA 5CZ0A 1TQXA 3GVGA 3W07A 4GFSA 3UQNA 1K8XA 3NQVA 1TO3A 4LV9A 1QNVA 3BK0A 4B5NA 3NQDA 3OBKA 4JTFA 4AWSA 3JS3A 5LKYA 4Y96A 5HWNA 3LCLA 4P2VA 1XFBA 3HO8A 2AQWA 2P10A 4XTIA 1FWTA 1H7WA 5BW6A 3OIXA 3QPYA 1SU5A 4L4MA 2J27A 1Z48A 5C54A 1OFPA 3DXIA 3BPWA 3MJYA 1TPEA 3MP3A 1EA0A 1QFEA 4FEZA 4ADTA 5I3GA 4O12A 4BI5A 2JK2A 1VCVA 3IRDA 1IIGA 4ONVA 5D2YA 2PCQA 5D30A 1LROA 1L6YA 2G5WA 4AF0A 1VHNA 2TSYA 3HGJA 3M44A 3LGEA 4YL2A 1LRNA 1OJXA 4O57A 3P81A 1L6SA 3W76A 2FPTA 3C2EA 1XM3A 3NQ8A 1LP6A 4M6VA 1GVRA 3CTLA 5LNRA 2ZA3A 4YCOA 3UNDA 3JRKA 4FXSA 4AAJA 2LLEA 3BG5A 4XBSA 3P67A 3I65A 3M5VA 5CZTA 1M5WA 5HINA 2V5BA 4MZ1A 1PS9A 3N2MA 1I2NA 4JNMA 2E6DA 1VCGA 1THFD 4DF0A 5C55A 1ME7A 3EX2A 2CWNA 1QCWA 3S42A 3TE9A 2IQTA 4M7SA 3GX9A 3QFEA 5HQEA 3W7OA 1TV7A 2DJXA 2ISVA 4LOCA 3G18A 4LS2A 2NUWA 2DZXA 3ATYA 3OA3A 4H3DA 2V9DA 3EWXA 4ALDA 4IWWA 2CLKA 3RFAA 1MZHA 5FEXA 5D03A 1OX5A 3PBVA 2WV8A 1F7BA 3WK3A 1VYPX 2V81A 1B9BA 3TAOA 3S5ZA 1VC4A 1TPDA 1JUKA 1MEWA 4N2YA 1XC4A 1FUYA 3NDOA 1FCVA 2NUYA 1W56A 1T0OA 3EX1A 4FNPA 3C0JA 1OHLA 5I3FA 3VCRA 1KFBA 4FNUA 2TYSA 1CX9A 2ALDA 3LHWA 4WXZA 3B04A 3VNDA 1GZGA 4XBKA 2V2DA 4OT7A 3N9RA 3INPA 4LVDA 3R5EA 4UR7A 4XKYA 3U6WA 4NT0A 3O06A 4OBTA 5K7JA 5AHEA 1OVDA 4KFNA 2HSAA 4WY0A 2HS6A 2QCDB 2B7OA 4NJKA 4P61A 3CEPA 2BXVA 1YPIA 5G5IA 1OYAA 3MI2A 3TMLA 5F4SA 3YPIA 5K4ZA 2YPIA 1LBLA 1ADOA 3W22A 1LYXA 2X1TA 4Z1AA 3IIVA 3W7CA 2QCGA 4UMCA 4GRSA 1PVNA 4IMEA 4TR9A 1KFEA 3STEA 1FWNA 3DZ1A 3LXBA 3QQ0A 3LB0A 1RVGA 2WOQA 3BW2A 3HG4A 1KBIA 1ZJIA 3QMSA 2ZRXA 1D3GA 1ICSA 4S1FA 1FWWA 1SZGA 4POCA 3W73A 3B05A 2ZZ5A 3MBFA 4Y8FA 3TNOA 3NEVA 5LZLA 5AFDA 4PFMA 1KM3A 4XQ6A 2Y61A 1GVSA 2EGZA 4HHPA 4NX0A 5G2HA 3GIYA 4LT9A 4QNWA 3F4NA 3W1TA 1G4TA 2C3ZA 4O19A 4N4PA 2A7PA 5BOOA 2C6QA 3LI1A 1W0MA 3I6RA 4RR4A 1SO4A 4UTLA 4N9DA 2V2CA 3STFA 3UY7A 2X30A 3LTYA 1H7OA 5FEWA 1B4EA 4AVFA 1LRQA 3S5NA 2VELA 3M16A 1F2JA 3EXTA 3FEMA 2I14A 5AHNA 1PIIA 1VR6A 1IIHA 3NQ6A 4UTHA 4MZ8A 4IX2A 3NPUA 3LM7A 1A5CA 3IVSA 3W84A 1C9DA 2Y7FA 4BK9A 2NZLA 4ZQPA 5KZDA 5EKYA 4UTTC 5DY2A 1DL3A 4CLMA 1NSJA 5FEPA 3RMJA 4AB4A 3QMTA 3W3OA 4O10A 3W83A 1G6CA 3TJLA 3UPBA 4LRTA 4ZVJA 3NPVA 4CCCA 3TSMA 5EYWA 3C2RA 1K03A 1O60A 1T96A 1H7NA 3PG9A 3O6YX 4UFLA 1AL8A 3W1AA 5G2WA 4RZ4A 2Q3RA 3F1QA 3S1UA 4JTKA 1YADA 3IGSA 3EKZA 2E6YA 1F6PA 3DH7A 3KAOA 3W72A 1TPVA 3O05A 3O1NA 4O0KA 2ZZ7A 3B03A 3MYOA 4I9AA 4QNEA 1KM0A 2X2GA 3NOEA 2GJLA 3FIGA 1W3IA 5HUOA 3NGJA 3FKRA 5DLCA 3QC3A 3IIZA 2ISWA 4HPJA 3H54A 3K30A 1H61A 1UJPA 2B4GA 5F2GA 3M5YA 4RV8A 3TX9A 1WDWA 4UUIA 4O17A 1GWJA 4JS3A 3W7EA 4ADUA 1T99A 2WSQA 3M5ZA 4MKNA 2RHGA 4DO5A 1JRCA 4I7UA 4HSOA 4TMCA 1N8FA 4JYEA 4PA8A 2Q8ZA 3QSTA 3P84A 2ZQ0A 4O4WA 3W1PA 1C8VA 3AO0A 5F1VA 5CPOA 2QEZA 1TCDA 1G4PA 5AHMA 1OFBA 3HIJA 3WK0A 2OCZA 4JDYA 4NNCA 3CPRA 2EF9A 2Y7GA 1TJRA 4Q4KA 3S5YA 4EIVA 1AW1A 4QISA 2R94A 1JCNA 1W37A 3DENA 3S9YA 2PRLA 3G1YA 4FNQA 1U5JA 1EUAA 4K7YA 1G7UA 4I7WA 3PWAA 1GT8A 4LVAA 1KBJA 4DF1A 4U28A 1QMLA 4PCFA 1PCKA 4YLWA 4WOQA 4JYDA 4UTTA 2ZTJA 2Y7DA 4ZQOA 1W5MA 3B8DA 3PS7A 4ORMA 3V75A 1GTHA 2GQ9A 4WXYA 5EMUA 1DQXA 1UUOA 4JY8A 4LC8A 4RZ5A 3TW7A 3G1DA 5AYZA 3NZRA 5LHEA 1A5AA 3LHVA 2H8ZA 3W1XA 1HO1A 3NAVA 2J9XA 2H3BA 4YCPA 1PE1A 3QZEA 1OX4B 3IVTA 3NXFA 1RQEA 1OK6A 2J24A 1XI3A 1H7RA 2FQIA 1F76A 4QAIA 1FQ0A 4LVGA 2OJPA 4JX5A 1M7PA 3NQCA 3M9YA 4NU7A 4O11A 3M43A 4Z1CA 3W85A 2BSLA 2Z1BA 4GWEA 4XWUA 1ZFJA 3R8RA 1I2OA 3WFAA 4LS0A 3GKAA 1XUUA 1XDMA 2O7QA 3PM6A 4AH7A 3LCGA 3EX3A 4R33A 2WPBA 3HF3A 4KWVA 3BW4A 1ME9A 3WJYA 5AB3A 4MFDA 4KKXA 5D2XA 2OT0A 3LLFA 2CLLA 3TIMA 4LTSA 3P82A 3TC6A 2RDWA 2DZTA 3OVQA 3THAA 4EVZA 5H2ZA 3HMJG 4KFOA 3SSJA 4Z1BA 3UXAA 3M0ZA 1RV8A 3IGUA 3E96A 2YXGA 5G1YA 5LNWA 4QSHA 4YXGA 1DVJA 3GAYA 1SUXA 1Q45A 1QO2A 1EEPA 4BF9A 1YPFA 1GVQA 4PEKA 3F03K 3RNDA 5F4XA 2WJZA 4UTKA 5KZMA 5AHIA 3TMQA 1W5NA 2NXIA 5E0KA 3EKLA 1AK5A 3NG3A 3W2JA 4XZ9A 3N73A 3T78A 3QRHA 2ZRYA 1W3TA 5L6UA 1AW2A 4LRSA 4OHQA 1F73A 1ZAHA 5CPNA 1H1ZA 1YTKA 2F7FA 3A24A 1GPWA 3A5VA 3LRLA 3HPZA 5EA9A 2GJNA 4ZMGA 3W7QA 3GZ3A 2F84A 3DFTA 1TTJA 1LLZA 3EX6A 3QYQA 4JGDA 4JN6A 1P4CA 3G3DA 4IMGA 3ABSA 3PSWA 4LS1A 4JXCA 4UR8A 2CLFA 3EWWA 2EAWA 1KFKA 3TUUA 3DHDA 5D04C 3EWZA 3N34A 5FF4A 1TRIA 1PHWA 2ATSA 1QPRA 1OABA 4GUFA 5DCBA 5EL1A 5G2IA 3ATZA 1H51A 4DXVA 3PG8A 4MPQA 4WQ6A 1Y0EA 3RLUA 1SPQA 2C14A 1FWRA 5LNSA 4AHOA 5K9DA 4A21A 3P60A 1W5QA 1FCUA 1R30A 4O15A 2B7PA 2YFNA 4DPQA 1W54A 3LRMA 3QM3A 3PUDA 4LU0A 1KA9F 3Q37A 4M19A 3KRUA 3W7JA 4EF9A 1UB3A 3TV8A 1Z42A 5D37A 5CZSA 3TK7A 3VI2A 4FNSA 3OVPA 1KV5A 2W0UA 3IV3A 1QAPA 1LZOA 5KMYA 1QDSA 1TV5A 3NO5A 4TX9A 5SWUA 3MHUA 4WY0F 4AEOA 3T4CA 1I2RA 4IQLA 3C8FA 3I7QA 3WJWA 2FFCA 3UWUA 3N3MA 4JIPA 1QPQA 3L0GA 3O16A 1KM4A 1QPOA 2NX1A 3HJZA 3L0KA 3DFNA 1DHPA 5U4NA 1KM5A 3G22A 2V0TA 4RZ6A 1Q3NA 4EF8A 2FPVA 1CW2A 2ZCGA 1PCWA 5A8GA 2Z6JA 3KXQA 2YR1A 3BG3A 2VEKA 1FCBA 4TO8A 3W7GA 1EP2A 1AG1O 4X2RA 3WK1A 3LERA 5HR7A 3G3MA 2Y6ZA 4YWIA 1QOQA 3E0IA 3IIOA 2FIQA 3C2OA 3W74A 2VXNA 5F4WA 1BEUA 4FNRA 1YXYA 2A4AA 4FXRA 1SSGA 4QITA 2QF7A 4FX7A 3KVJA 3NM1A 1I2QA 3E02A 2QCMA 5G1TA 4OE7A 1WXJA 2FDSA 4GC4A 4JTTA 1X1OA 1LDCA 3EWUA 3U2OA 5DBTA 2E68A 3DI1A 1EB3A 1TREA 1I45A 1I2PA 5EPDA 2FJKA 5AC8A 2BX7A 3DKJA 3FA5A 4UMAA 4MZYA 3VE9A 3HQ1A 1OFAA 1VYSX 2W6RA 4HT3A 2X1RA 1PL9A 3S5OA 2NV1A 2J9ZA 2VKZG 1G67A 4JTJA 4WX2A 3W2MA 4AXKA 3B06A 4PODA 2YFOA 5C2XA 3DU0A 1EPXA 3N2XA 3W7MA 2AGKA 3KFTA 4X3ZA 3CU2A 3I7SA 2PE4A 3WJXA 3MW7A 4E2BA 3P5ZA 3TDFA 5ABTA 4O1AA 2GVJA 3S8HA 1TPB1 3G0SA 3PULA 3BLIA 1YXCA 5KITA 4MY1A 3L2IA 3GXPA 1SZNA 4JEQA 3M41A 2VFFA 2X1UA 5LNUA 4GUGA 1XKYA 4IGHA 5LGZA 1C29A 3TSBA 3CHVA 4OV9A 5AYYA 5AHLA 1R2SA 3W23A 4JTSA 1W1ZA 4LWWA 3S1VA 1F6KA 2CLOA 1K02A 1JUBA 4LVBA 5IBXC 1DJNA 1SW0A 4DBEA 1ALDA 2BTMA 2Z0IA 3UWQA 5FF2A 1NEYA 4FNTA 1J2WA 1YXDA 5EY5A 2RDTA 5F2LA 4AWTA 1VYRA 4K38A 3SW6A 4DO6A 5FF3A 3LHUA 3LCWA 1MO0A 3LOTA 3HGSA 3NA8A 2GUUA 2Z6IA 4ZQNA 1YDVA 2VFHA 4JX6A 1WAUA 2NWSA 3W87A 3LXCA 2FPYA 2QKFA 4UFKA 4ADSA 3NL2A 2YSWA 3RU6A 3BVJA 3ZFHA 1LTDA 1RD5A 2ATMA 3RF9A 1ICPA 3TCEA 1GVOA 3TROA 1FCQA 4FX6M 1H7PA 3W7RA 1PV8A 4ICNA 1VRDA 3EWYA 2ZZ6A 3B4UA 3CWNA 3CC1A 4JTHA 4QJ1A 1NVMA 3W6YA 1KTNA 3LDVA 3W2KA 3W75A 3NQ7A 5MHBA 3FYOA 1EP3A 2H3DA 3TKFA 2RKXA 3GDMA 3M6YA 1BWKA 3HG3A 1HTIA 1DORA 2QDGA 3OG3A 5K3VA 4NJGA 3CLMA 3S1XA 1KLZA 1LLWA 3A21A 3OEXA 2QCHA 1WBHA 3HG2A 2TRSA 1FXQA 4PTNA 3DAQA 3BW3A 5K9XA 5FI8A 1ZALA 2R14A 1KLYA 4N9BA 2V8ZA 3B0PA 3IVUA 4YMZA 3G1VA 1OK4A 4UNLA 4NQ1A 5TQLA 1Z44A 2VC6A 5T26A 1D9EA 1GYLA 4O28A 1KW1A 3QH2A 3CM4A 4M5PA 4LW7A 1DQWA 2ZZ4A 5CKSA 3PC0A 2J88A 1SFLA 3C2VA 3W70A 5D33A 1RR2A 2I1OA 2RH9A 4HNTA 1TTQA 5IBXA 3UXDA 2A21A 1O4UA 2YX0A 4DQWA 3QEZA 4S2BA 4DF2A 1QWGA 1XBZA 4DPPA 2A5HA 4HIBA 1ZAIA 2HS8A 4FIQA 1ONRA 3TR2A 1X6UA 2WNZA 2RDUA 2E6AA 1FX6A 1VHCA 1DOSA 1WA3A 2QJHA 1ZAJA 2I9EA 2A7NA 4MY9A 3NL3A 1TRDA 2YYTA 2P1FA 4O0ZA 4O14A 2PRHA 1KTCA 4IMFA 5DN1A 4D2JA 2C13A 3A22A 4XUGA 3OHIA 4GJ1A 4GNJA 1NAL1 1GJPA 4HN4A 3VFLA 3S6DA 3HPSA 4R53A 3PAJA 3V1PA 1VGAA 3P7YA 3SGZA 4ZQCA 4A3UA 2CLEA 5TBOA 3P5YA 1V7YA 3LI0A 3TC7A 3G1AA 2ZRWA 3USBA 4C1KA 1SO6A 4JTEA 5G4EA 1TPUA 1MSSA 1QO5A 3NZ1A 3LXAA 1LOLA 2DZVA 4NXSA 3DI0A 4E38A 3W2NA 1JR1A 4CQ8A 3W1QA 2GVGA 4LC6A 3NQMA 1X7FA 1YLVA 3L67A 4JTLA 4W9TA 3SIZA 1RZMA 4IMDA 1W3NA 5KTLA 1OYBA 2CU0A 3PBYA 4M7TA 3HPXA 2Y62A 2A6NA 4JDBA 1AL7A 4WJEA 2JKEA 3L66A 3UZ5A 3NQ2A 4LUIA 1WOAA 3TJXA 2E6FA 4WZHA 3HOJA 3FJ6A 3FJLA 4GUJA 5AOUA 1H1YA 2JGQA 1IXPA 4MY8A 4HNUA 2QCDA 3NQEA 3GNNA 1HL2A 2OT1A 3KVMA 4N6FA 3FS2A 3CIWA 2VEIA 1FWSA 2YW3A 3KX6A 3QSRA 4ZQMA 1PHQA 2C1HA 1OFDA 1KFJA 1TMHA 1TQJA 2QUVA 3F4WA 4AF0B 4WD0A 4N6EA 5HWJA 1P5BA 1K8ZA 5F1UA 3IIPA 2QCLA 3R89A 3SFKA 3IEBA 1TB3A 4UFMA 1BKSA 3ABOA 4RX0A 2CFFA 3G1HA 1SO5A 2NWRA 2XN1A 1KM1A 2QCNA 4UMBA 1Q6QA 1ZHAA 5CZJA 4UTWC 1YDNA 3A5FA 3FKKA 3LHTA 5E1QA 1IXQA 2E77A 3LCXA 2B0MA 5KINA 1BWLA 1G4SA 3A9IA 2VFGA 2A1YA 1JULA 4PL1A 4DEFA 1VS1A 5BNKA 3SGUA 2GQAA 3L5MA 2A7RA 5IM51 3FLUA 4RXGA 4AHPA 3SECA 3C61A 3M7WA 4HNVA 1ZY9A 3DBPA 2C19A 4NVTA 3R13A 2QUTA 1ML1A 1P1XA 1NFBA 2NV2A 3NQFA 4NJJA 2CLMA 3O6DA 2ABAA 3N14A 5FEZA 1TPFA 4ZL1A 1KFLA 4PH6A 4WOZA 1GG1A 3MI3A 3BLEA 3CEUA 2VFIA 4JTGA 3QW4B 2QUUA 3QPZA 4K37A 4MIMA 1VJIA 3SJ3A 2GVLA 1E51A 3DKLA 2WQPA 3TU9A 1JJKA 4UFJA 3T40A 3PF3A 2ZZ3A 3TAKA 4O16A 2NX3A 5HUPA 1SZFA 1TV8A 2A85A 4N9EA 4O13A 1J5TA 2VFDA 3G24A 5TIMA 3ELFA 3QQ1A 5BRBA 3C56A 1L2UA 4O4VA 5DCDA 4A29A 2V82A 3NYZA 3PVFA 2NX9A 3P62A 2WNNA 1VLWA 4O1BA 3LTSA 4ORIA 1Q6LA 1XUZA 2RFGA 1LOSA 3NQGA 1XCFA 2VEMA 3G8RA 1BTMA 2HMCA 4BFAA 4R34A 5FF7A 1XBYA 4DO4A 1P0KA 5H91A 1K3UA 3MHFA 3UWZA 3GR7A 4XKYB 2ZZ1A 2E5CA 4CCDA 4IXXA 4WY0B 3NPWA 3TSDA 2E09A 1GYNA 3GDLA 3LV6A 4DELA 3QW3A 2C16A 4GE8A 1LBMA 2ZRZA 1QR7A 4UTWA 3GDTA 4AMAA 4K8HA 3TXZA 3PUOA 2B7QA 3C6CA 3LCIA 4RJEA 5I3HA 1X8FA 4A2SA 2EKCA 3G1FA 5D2VA 4HPXA 4UTJA 2VENA 2YZRA 1AW5A 2C18A 2Q3OA 3TQVA 3W7LA 3G1SA 4FO4A 5BMWA 3G0UA 3UWVA 5A5WA 3GXNA 5F2MA 3ZR4A 1G4EA 3C2FA 2ZBTA 4MYAA 5AYXA 3TFCA 5K9CA 4HNNA 3Q58A 4UNKA 3CIXA 4MJZA 4FF7A 1S3HA 1G7VA 2XN2A 4JICA 4QIUA 1IXOA 5LGXA 4M6QA 1UUMA 2EPHA 3N19B 4LNYA 1SW7A 3W7IA 4AHQA 3GR8A 4FIRA 1NF0A 3W9ZA 2ZRVA 1GQNA 3P80A 5K4XA 3KHJA 3GK0A 5FF0A 4HKPA 3GB6A 3GAKA 1HO4A 3L68A 4AWUA 3B0UX 1A5SA 4CNNA 1AMKA 3RK8A 1M6JA 3L9CA 4RLIA 2Y70A 1LBFA 5I3JA 3N9SA 4IPJA 1DJQA 1H62A 1TPC1 4FX8A 3PY2A 4DBDA 3HG5A 1LRTA 2VEPA 4A22A 3LTPA 5DBUA 2G97A 3W1UA 2G96A 5GVJA 2PRMA 3M1ZA 3MP5A 1OX4A 3STGA 2PURA 1QPNA 5CPMA 4MLRA 1JCLA 3JR2A 3G1XA 4K36A 3UPWA 3LX9A 3MYPA 3S0CA 2E1DA 2OX1A 2YCEA 5D38A 4OU1A 4K7VA 3M47A 2VOMA 1ZENA 1CI1A 2ZRUA 2Q8LA 3GYEA 3T44A 4JIQA 1T8XA 1JVNA 3LBCA 1XDLA 1OF8A 3LLDA 3NM3A 2DORA 1N55A 4Q33A 1RQHA 2P0OA 1GEQA 3KRZA 5C5YA 3QJAA 1B4KA 3ANYA 2HTMA 2C15A 4MVAA 4OGZA 3C4UA 4LVFA 4GUHA 4X9SA 3ZS4A 4ZZ9A 4CNPA 4J9JA 2V5LA 1SZEA 5LNVA 2DZSA 3GKFA 1H63A 2ZA2A 4CQAA 5I3IA 1TIMA 3CB8A 3W7KA 2B7NA 3DFPA 1OG0A 3LRKA 3LHYA 1R2RA 2OMAA 5D2TA 1HUVA 1SSDA 3FFSA 2WSRA 3MUXA 1GG0A 4O53A 4LUJA 2V30A 1ICQA 1YTEA 4O54A 4BI7A 5AC6A 1H50A 2ZFAA 1EWDA 2CZFA 4S2CA 1OF6A 3GXTA 3UWWA 4UTMA 5J5RA 4IMCA 1DBTA 4NJIA 4ZQRA 3BARA 4JX4A 3AJXA 4UTUA 5HJLA 4UFHA 3S1WA 5CSSA 3BLFA 1ME8A 3STCA 1KM2A 1WOBA 2JKPA 3NVTA 1MXSA 2ZYFA 2CZ5A 2YGYA 4LY8A 3VE7A 3H53A 4M6PA 3EX4A 4OWGA 2Y88A 5HMSA 4OV4A 4RXFA 4TIMA 1I8JA 2E5DA 1ZNNA 3W7DA 1TTPA 1LOQA 1SO3A 3UY8A 1Q6OA 2FB3A 2QDHA 1JUEA 2ZTKA 5LHFA 3PB2A 1IXNA 2CW6A 3KVLA 1YDOA 3EXRA 2QR6A 4IUOA 4KFPA 1R47A 2QCFA 4JTIA 2QCCA 2H8XA 3LHZA 4Z0SA 1OX6A 3VKJA 1SR9A 2JKAA 1OFEA 2JGYA 2DZPA 4N02A 3HGRA 4CNOA 3PR2A 2DZUA 4K39A 1B57A 5KZEA 2J9YA 4X22A 1OYCA 3EEGA 4O50A 4K8EA 1K7FA 1L6WA 1DV7A 2NLIA 3G0XA 3MP4A 3KRSA 1SFJA 2JBMA 1VLIA 1RQBA 5D02A 1M7OA 1SQ7A 2QAFA 4GUIA 3DHFA 1U83A 3EWBX 1EWEA 3TQ0A 2DP3A 5E93A 1LM1A 3GNDA 5K2ZA 3WK2A 3L5LA 2ZA1A 2DU2A 2YYUA 1GTEA 3GDKA 1LCOA 1TJPA 4JY9A 2QAPA 1FDZA 3EXSA 1TPH1 2A6LA 3L5AA 4GBUA 1XL9A 4RK8A 1XXXA 4TU1A 2QCEA 4NX5A 2GQ8A 4MFEA 4C1LA 4TMBA 5HULA 4QM1A 2CLHA 2FB2A 1W8SA 1SW3A 2WO5A 3M5XA 2DJLA 4JYFA 2Z2UA 1MEHA 3D0CA 1VQTA 3NL6A 2X1SA 1KV8A 4EOUA 3PSVA 4Z0JA 4MLJA 3O15A 2Y7EA 5CGQA 3CQ0A 4IOTA 3PB0A 3OVRA 4JR5A 3E49A 4L4LA 3U8GA 4UIOA 1F05A 2X16A 4Q32A 3SZ8A
chains in the Genus database with same CATH superfamily
2X0YA 3DFOA 4IIGA 2YW4A 3M07A 5DXXA 1UKSA 4O8AA 3V35A 4GI4A 4I7VA 3TYBA 2ABBA 2QJIA 3WEMA 3W53A 3BO9A 1JZ6A 4O1CA 6REQB 4XZMX 2GWNA 2VT0A 1V3IA 3F5JA 2REQA 3UZWA 5C9ZA 4R7JA 3SUTA 3W2UA 1K8CA 4Y90A 4K6AA 2BG5A 3R12A 3IGXA 2H6RA 4GKLA 3K1GA 1FVPA 5D05A 5HDRA 4W8BA 1B9ZA 1Q6RA 3W7NA 3MPGA 3OLDA 1LUCB 3HM7A 2DT0A 3B9AA 3C3NA 4FHAA 2V67A 1DKWA 1WX0A 1WXZA 1L0PA 1KCKA 2FHCA 4W7UA 5TNVA 3N17A 4YVPA 3BOLA 2DDXA 3P74A 4OUIA 2OZ0A 1QHOA 4H4IA 5GJPA 4HU4A 4Q6JA 3UETA 5DF0A 1NWUA 4TVCA 3HMCA 5A6MA 5BRQA 2CZEA 3NL5A 2CLPA 2BZNA 3JZEA 1O95A 2A0NA 4GXMA 3MWAA 4JFUA 3W1RA 2YL8A 2Y85A 3O63A 2QVNA 1V08A 2CLIA 2JFEX 4LV4A 4ATLA 3KE0A 3W86A 3JW7A 2ZDRA 2FTWA 4NUWA 2I17A 4NZJA 1SGJA 4GYFA 3SUUA 3MBDA 4HYRA 4Y7EA 2V5DA 4Z1DA 1S5TA 4NNBA 1XF0A 1AJ0A 3WJZA 4Q7IA 2WQDA 3A23A 1ESWA 4BY3A 2Z29A 3WJSA 2P3EA 4PULA 4E5TA 2PI6A 2BOGX 1Z8AA 1OT1A 4IG2A 4IPIA 3WLJA 4GHRA 3QV9A 4EAMA 1H09A 3UA4A 2VUYA 3ABZA 1UR1A 2O9PA 2UV8G 2HXUA 4WUIA 1POJA 3SY5A 1RLDA 5FA5A 3MMTA 1QWKA 4Z08A 4KWWA 2Y63A 1X7IA 5I77A 2C1GA 4NZFA 1FH9A 3KBJA 1ZBVA 3LYEA 3KZPA 2L5HA 4C6BA 3GUWA 5DXYA 4IGMA 5JBFA 2WVTA 3GLCA 3QV7A 3DESA 1EP1A 3W7PA 2DZWA 4QHRA 4KPLA 2NUXA 2EHHA 3TA6A 5D2WA 1OGGA 3FK4A 2EEXA 4XZWA 2PTZA 3FGCB 3HGOA 5KSWA 3MHGA 2WHKA 2C1IA 3WL0A 4M82A 5LIWX 2AGTA 4KETA 3AUJA 4I8YA 1UWQA 3E0VA 1S5VA 4QP0A 5D9OA 4NAEB 3B0XA 4IX0A 5HQLA 4PMYA 2WZMA 1Q63A 2O56A 1SJCA 4JL1A 1RP9A 4C60A 3IARA 2FTPA 2HNHA 2WC3A 3G1RA 3O07A 3P61A 2HROA 2ZWYA 2PDIA 2NW0A 4O8RA 2GSJA 3M0JA 4AIBA 4MYXA 4DNHA 1E0VA 4NJHA 4XX6A 3QF0A 1NDZA 1PX3A 1MEIA 1S5WA 3CL6A 5FJIA 2VFEA 5AC7A 2VGGA 2W63A 1ONEA 4JTUA 4WHBA 2E5BA 3URNA 3TYAA 3DGRA 4FLOA 3T55A 1BWVA 4GABA 5I3KA 4NRSA 4G1KA 5CZ0A 2PLMA 1R3QA 3UQNA 5DMLA 1KC7A 2XM1A 4HSHA 3BK0A 3NQDA 3B97A 4JTFA 3U4FA 4AD0A 1XFBA 3VGGA 3LQLA 4ROPA 4MWAC 1SU5A 4C91A 2VR2A 4MAVA 1Z48A 5T8GA 5C54A 7PTDA 1HJSA 3BPWA 4GI9A 1ITUA 3OZPA 5FAJA 4O12A 2NLYA 4QLKA 1XYLA 1VCVA 3LEPA 1CZ1A 5D2YA 3S9IA 5D30A 2OOFA 1M53A 2G5WA 3MS8A 4ZEPA 3ZXWA 3V18A 2TSYA 4CD6A 1O1ZA 4I5XA 3BAWA 2FPTA 3C2EA 4XIMA 1XM3A 1QRQA 5LNRA 5EFDA 3SCOA 2OWWA 4C6OA 3PBMA 1EJUC 3GVRA 1E6RA 4AAJA 5CC3A 4I3GA 4FLQA 4XBSA 4C6LA 3M5VA 1CTNA 5CZTA 3AZRA 3BCFA 4H00A 1PS9A 3N2MA 3CV1A 1XGDA 3OZYA 2QIIA 2CWNA 1QCWA 5A95A 1Q13A 3QFEA 3W7OA 3VNZA 1TV7A 2ISVA 3F4VA 1UP0A 2VRJA 4LS2A 1MW1A 1I9CB 3WLIA 5C9UA 2VEGA 4YTQA 3ATYA 1CCWB 3EDJA 4B90A 4RE0A 5DQPA 2CLKA 1MZHA 1JGMA 4V27A 4D6IA 3I6EA 5E70A 1F7BA 5BOEA 1VYPX 2FZNA 3TAOA 2CXEA 3TLQA 1MEWA 4N2YA 4NI3A 4MWAA 1FUYA 1WUEA 1TELA 1L6FA 2NUYA 1W56A 2CHRA 1M68A 1E1CB 1T0OA 3EX1A 4FNPA 2GGIA 1OHLA 2V5CA 1FH7A 2VMFA 2ALDA 1QOXA 3VNDA 4E2VA 3V36A 3KEHA 2IPFA 3INPA 4LVDA 3R5EA 1C8XA 4UR7A 2PA6A 4XKYA 3U2ZA 3HPFA 4OBTA 4L1XA 2HS6A 4PRWA 2BXVA 1T6MA 3E5BA 4H01A 4IQDA 2VURA 1OYAA 3MI2A 1ADOA 1LYXA 2X1TA 2QCGA 3PJXA 4IMEA 1KFEA 1FWNA 2QMJA 1RBAA 1UQYA 2JIWA 1D3GA 2OTDA 5I00A 4AX6A 3B05A 3EA1A 4Y8FA 3NEHA 5AFDA 5CXPA 1ZB5A 1PKNA 1CBGA 4XQ6A 2Y61A 2EGZA 4HHPA 3CYJA 4QNWA 2J79A 1RJPA 2GOKA 2YCIX 4N4PA 1W0MA 3I6RA 1SO4A 1OC7A 4N9DA 4GPNA 3O2LA 1Q5MA 4U2ZA 1IHIA 2HK0A 4AVFA 1EKOA 2IKHA 3QR0A 1F2JA 3EXTA 3UESA 2VX4A 2DH2A 3P3BA 3VIMA 1VKFA 1WKEA 3MCMA 1OSEA 4HA4A 1VFMA 1IIHA 2NT1A 4CGTA 4H9VA 3H2EA 3WMLA 4IHCA 1BFNA 5I24A 3FEQA 1ZJHA 5FSDC 3W3OA 4O10A 4AXNA 3AHVA 3W83A 1G6CA 1TX2A 4ZVJA 1P6WA 1R9YA 1K03A 1O60A 1T96A 3T42A 1H7NA 1EHAA 5G2WA 4HGXA 1L6GA 4UZSA 2Q3RA 3F1QA 1YADA 3EKZA 1TPVA 1OQFA 2NT0A 4LAUA 1W2VA 2VQUA 2XGZA 1G5AA 3WQWA 4I9AA 2YBUA 3ES8A 4ZO7A 1FHDA 1MFVA 2VGBA 3Q67A 3WD2A 1KCXA 3FKRA 3HQPA 3QC3A 3IIZA 4HPJA 3H54A 3K30A 1H61A 2PDGA 4IFKA 3TX9A 1IR2A 1V3HA 3MDWA 4UUIA 3W7EA 1GWJA 4HK7A 3WH5A 3WF4A 3CUIA 3N1AA 3M5ZA 1GVEA 4HSOA 4IP5A 1EYEA 4QJ4B 3QSTA 1XIEA 4CEUC 3LZ3A 3BMVA 1C8VA 4ZO8A 2YA2A 3GM8A 2PF8A 4US6A 3WK0A 1PIGA 1JD7A 3EB4A 4EPKA 4HJWA 3BJFA 3EEZA 3WNLA 4L9XA 4HPHA 1AW1A 4PEEA 3BL3A 4AZIA 1BGGA 1JCNA 1FWFC 3N4AA 3G1YA 4MWAD 4FNQA 2G37A 1NP2A 3VGHA 1KBJA 3BAYA 1QMLA 1PCKA 4WOQA 3IJ6A 4JYDA 2ZTJA 4NASA 2Y7DA 4RPQA 4KEZA 3PS7A 3MJMA 3AS0A 2X42A 1JF5A 1A5AA 1HO1A 2BGQA 3OW1A 2J9XA 2OEJA 4JL2A 3QZEA 1OX4B 3NXFA 3WH9A 4J2PA 1H7RA 1TIWA 4QAIA 1M7PA 3OLIA 2WBGA 4ZXLA 3W85A 2Z1BA 2ZWZA 3AALA 2BOEX 4XWUA 4A3QA 4EKJA 4C1NB 3R8RA 1MXDA 2XSAA 3PM6A 4UOJA 3RR1A 3BQ5A 3EX3A 1DJWA 1WDDA 4Z2IA 1TE6A 3BW4A 3N4EA 1PDYA 3N12A 5B7YA 3VOGA 2V63A 3V16A 2OT0A 4Y9NA 1HIZA 3GFYA 4LTSA 2RDWA 3HMJG 4E2OA 1VBJA 1YDYA 1A5LC 3DUGA 1RV8A 5E0FA 2VI0A 4OZOA 4XZLX 5LNWA 3B9NA 1DVJA 3R79A 1SUXA 1Q45A 1EEPA 4WR3A 2J13A 2OX4A 4GK8A 3SN0A 3VKAA 5C70A 4GI8A 1I0BA 1AK5A 3W2JA 3D47A 4OJYA 3BDKA 3GS6A 1UD8A 4LCSA 1W3TA 3QTGA 4E4UA 1NQKA 2J66A 4PTVA 1TVNA 5CPNA 1H1ZA 1YTKA 1WDQA 3VIIA 2WVUA 1GPWA 1T5AA 3BLPX 3AUOA 3CZJA 1QU4A 2GJNA 1CNVA 4AEFA 3DFTA 4DYEA 1PX4A 3A13A 4QX4A 1UZ1A 4Q3MA 1E4NA 1BYAA 4IMGA 4FK9A 3ABSA 1UOKA 1X96A 4H19A 2BB0A 2EAWA 4D8AA 1C90A 2F8QA 5D04C 1J5SA 1E6PA 3N34A 2VJXA 1EBGA 2FTYA 4DUWA 1ZBWA 2ATSA 3M64A 1OABA 3L4XA 3OLGA 3ATZA 2QZRA 5E09A 1H51A 3PG8A 4MPQA 3PPFA 3B9EA 3TTOA 3RLUA 2V38A 1SPQA 1OIMA 2C14A 5LNSA 4AHOA 4LBRA 1W5QA 1WB0A 5DX7A 1NM9A 1T40A 3LSCA 4JKLA 1GOKA 2YFNA 2OZ8A 3WEZA 3TOYA 1IZKA 3TR9A 4M19A 3KRUA 1Z42A 5CZSA 3VIFA 4FNSA 1GOMA 2W0UA 4DO7A 3O7UA 1LUCA 1W8GA 4PTMA 3AWNA 1ONXA 5D9NA 4XO7A 3GR4A 4A35A 2WCAA 3AJ7A 1W9XA 4IQLA 2VZVA 5EMYA 3L0GA 1IEWA 5CBJA 1QPOA 2F6UA 4GY1A 3OZMA 3DHPA 5U4NA 2VX7A 3G22A 3P0XA 4QCFA 4KBXA 2UY2A 2DZBA 1DEDA 3G77A 1O1HA 3WLLA 2INZA 2YR1A 3CAWA 1FCBA 4TO8A 4HA0A 2PWFA 1CXEA 4X2RA 3IJ8A 3LERA 2PDHA 4ZFCA 4HOWA 3QR1A 2TODA 1L8NA 4YWIA 4MNMA 3ZQ9A 3E0IA 1V3LA 1KKOA 5ABEA 2A4AA 3GXIA 4MDOA 2YCKX 2D1ZA 3GHTA 3DX5A 5H1WA 5HJXA 5CSYA 3MUZ1 4HZ8A 4M1RA 4JTTA 3K4WA 1LDCA 1D7KA 4D6HA 3EWUA 2WZIA 2E68A 3RITA 1EB3A 1OY0A 5FD0A 1V3MA 1I2PA 4IISA 2OODA 2WB5A 2FJKA 3HZ3A 3CT2A 5HA7A 3TN6A 1GJWA 4J3SA 4W88A 3HQ1A 1AD4A 1PL9A 3ZIZA 2J9ZA 4WX2A 4AXKA 3GG8A 1UH3A 3WD0A 1MRAA 4IF2A 4GY7A 2WK2A 1JXKA 1EPXA 3DU0A 2AGKA 4X3ZA 1U33A 1JPHA 4PTWA 1EOKA 4LEQA 3WO8A 3QKEA 3R0UA 1AA1B 3NUKA 2QPUA 3H4GA 3FAXA 5PTDA 3CS2A 3WMBA 4QQUA 2X1UA 3A4XA 4GG9A 5LNUA 1XKYA 5A1AA 5LGZA 3HV8A 2OQYA 1R3SA 1XGEA 1EF3A 4OV9A 5AYYA 5AHLA 1IE7C 2XZ9A 3W23A 3S6OA 3BV7A 4JTSA 4KF1A 1K02A 1JUBA 2E1WA 4LVBA 4MKVA 3LU2A 5IBXC 5BXRA 1RLCL 3UWQA 1ITCA 5FF2A 3LY0A 4NAEA 3AS2A 3K1DA 2RDTA 3F5LA 2HRWA 1VYRA 4K38A 3SW6A 3WX7A 4HNCA 4TV6A 2RAGA 3HGSA 3NA8A 2Z6IA 1CWYA 2XFFA 5ABHA 3NL2A 5I07A 2WZTA 1RD5A 2ATMA 4F9DA 2ADAA 3R8GA 3TROA 1JYVA 3NURA 3VDCA 1H7PA 1EGVA 3B4UA 4M6UA 3VCNA 1J0JA 2G50A 4JTHA 3M0KA 4QJ1A 4Z2LA 3W6YA 1D3CA 2PDNA 3AYSA 3I3EA 3PZOA 4JQ3A 4TV5A 5TF0A 3QY7A 3NQ7A 4HYVA 3FYOA 1EP3A 4C6PA 1GVIA 4M24A 3TKFA 2F61A 3FXGA 1ZSXA 4HK5A 3W37A 3CZKA 3M6YA 1BWKA 3HG3A 1GQJA 3NFUA 1DORA 2V3GA 2QDGA 3WDHA 3EDDA 3KL3A 4NJGA 3TTQA 2H9AB 3S1XA 4ZTXA 1EJVC 1BTCA 3OEXA 2QCHA 4FF5A 4GQBA 1WBHA 1UOZA 2XGBA 1FXQA 2WAGA 1IEQA 3BW3A 2QPXA 1YW1A 2R14A 3L4ZA 4YMZA 3GHUA 1HL8A 2EG8A 3WBYA 4UNLA 3W02A 4NQ1A 3VABA 1U30A 2XVLA 1ZJBA 1X6NA 3B40A 1EXBA 1MI3A 1UP2A 2Q71A 3DBNA 1DJGA 4M5PA 4L6DA 4P7NA 3C8NA 3N2CA 5CKSA 2J88A 3WNNA 5D33A 2VDIA 4A6GA 4NRRA 1GGOA 2RH9A 1PX8A 4HNTA 5IBXA 2A21A 2R24A 3QEZA 2X1IA 4DF2A 4LYPA 1QWGA 4DPPA 4HIBA 1ZAIA 1FTXA 3GBDA 3UXKA 1RP8A 1X6UA 1R5YA 3DYPA 2WNZA 4X0NA 1G01A 1W1B1 3WKZA 2CNCA 4DUOA 5MKGB 1FX6A 4AG0A 4M81A 3R7MA 3V1HA 4LNCA 3IUIA 2QJHA 1PZ2A 1RAKA 3FDGA 4A8LA 3URQA 1H4PA 1R9ZA 1TRDA 4DUXA 4MMWA 3VGEA 4EK7A 4PBFA 4LYKA 2HE5A 1MXGA 3OHIA 3LLXA 4FS9A 5TAOA 1GJPA 3S6DA 3ITVA 3BANA 3PAJA 1VGAA 3MUCA 4ZQCA 2CLEA 1XH1A 3LI0A 4HMNA 5CLWA 3TC7A 3G1AA 4WGXA 1V6WA 3OLEA 2R82A 3RM9A 1WZLA 2W66A 4PMRA 1OM0A 3PZ9A 3WDIA 3AIBA 4IQEA 2HV5A 2OQHA 1YLVA 1DWGM 6ENLA 4W9TA 3SIZA 1RZMA 1W3NA 1OYBA 1E1CA 2CU0A 3RMEA 1EJSC 1HJWA 3PBYA 3MMWA 3VDAA 2VCAA 4QS6A 4H83A 3SRFA 4JDBA 4WJEA 5AYIA 2JKEA 4JTDA 3TJXA 3V3WA 1X1NA 2JGQA 3RPTA 1IXPA 1A49A 3FY1A 3NQEA 3CAVA 4DYKA 4QJ5B 3S2NA 2OT1A 3DFHA 2VEIA 3BURA 2GDQA 2YW3A 4ZQMA 3FNDA 4MPKA 2PB1A 1TMHA 2QUVA 4Q8QA 4WD0A 5HWJA 1M7JA 3SFKA 3FVDA 4L80A 3CAKA 4NAFB 4UFMA 4RX0A 3SN1A 3M7SA 3PWGA 5I09A 3W6MA 5I79A 4DWSD 3AS3A 2E77A 2A1YA 3L5MA 2R9RA 4GGHA 3RX2A 3R94A 3FLUA 4RXGA 4AHPA 1A0CA 3A47A 4QG9A 5FJOA 2NSXA 4LBUA 3M7WA 3APGA 3DBPA 2QUTA 2CLMA 1VFFA 5TD4A 1KFLA 5REQB 4WOZA 1XLBA 4NP7A 3MI3A 3BLEA 4GCXA 3QW4B 4XD4A 4AY1A 2KAUC 2GVLA 1E1EA 3TU9A 2G3MA 3PF3A 2ZZ3A 2PDCA 2NX3A 1SZFA 4N9EA 2PEVA 2VFDA 3G24A 2PTXA 4GJIA 4E6MA 2BHUA 3QQ1A 5A69A 3C56A 2V5KA 2NX9A 4J2MA 2PWDA 5C0QA 3GVQA 5J04A 2RFGA 3IPWA 2YA0A 1Q85A 5M1TA 1LOSA 3NQGA 1XLCA 1XCFA 1KNWA 1QBBA 1AFSA 1Q2SA 1C7TA 3P14A 1TFVA 4BFAA 2HBVA 4UWMA 4JHMA 4R34A 5FJPA 4DO4A 1P0KA 1P48A 3GR7A 3WLOA 3L7RA 5JU6A 4CCDA 1QI0A 3R4IA 2R1LA 4MF4A 3GDLA 3OG2A 2ZC1A 3LV6A 3GDTA 4AMAA 4K8HA 3TXZA 1L2QA 3UNTA 4J7RA 1KCLA 3LCIA 4H7ZA 4CN6A 1HKIA 4X60A 1V03A 1XSIA 3VNIA 2W27A 3ZMRA 1U1HA 2Q3OA 4MADA 1VFOA 3G1SA 5BMWA 2G0WA 1VENA 3C2FA 4ZE4A 1WDRA 3TVAA 3F5KA 3WLNA 1BGAA 3Q58A 4R5EA 2DY3A 1DYSA 3ALGA 1S3HA 1WCGA 3SCNA 4QIUA 1IXOA 1GEHA 4JQ2A 5LGXA 2J78A 2RGMA 1UBPC 1SW7A 4AHQA 5BWAA 4XUYA 1NF0A 4AZCA 3SDOA 2ZRVA 4OFCA 5A2BA 2J7CA 1EPVA 3CV2A 4HKPA 2WCGA 5HMDA 2XISA 2CERA 3S6TA 1M6JA 3L9CA 3SUWA 1ITQA 5CBBA 4AEEA 2OU4A 5DMMA 1DJQA 2Z1SA 3QTPA 3PTMA 4Y9MA 3CHFA 3HG5A 4PB4A 3HA1A 1LL4A 2G96A 2PRMA 2E8YA 2NV9A 2DUXA 2OXNA 1OX4A 3STGA 2FZ8A 2PURA 3GW3A 1QPNA 1A4LA 3G1XA 3JR2A 4K36A 2QF8A 3OOQA 2O0TA 3MVTA 4K7VA 3BC9A 2VOMA 1QW7A 4B5XA 2ZVIA 2ZRUA 4C1NA 4JFVA 1JVNA 1XDLA 4CU8A 1ZPTA 4RNJA 1FWJC 2P0OA 1AJZA 3T07A 3KRZA 1ZRQA 4REQB 4LCQA 4W7VA 2HTMA 4MVAA 2Y5EA 3UR5A 4OGZA 3U2EA 2WJFA 4X9SA 3VZXA 4E4FA 4J9JA 3WD1A 3LNMA 1UR3M 2QLYA 1SZEA 2DZSA 1D8WA 5HPOA 4DBUA 3GNOA 2B7NA 3DFPA 4A8IA 2Z27A 1MMFA 3S1GA 3O6AA 5D2TA 4J3VA 3ARVA 1UIPA 4HQVA 1JPDX 4LUJA 2RJHA 3UVIA 1YTEA 2EPKX 3KRBA 4YWSA 4Q7BA 3W27A 3UWWA 1DBTA 3JZUA 3ZYZA 4UFHA 5CSSA 4LEFA 5XIMA 3DGBA 4Z2KA 1YPXA 1OCQA 2YGYA 3E5PA 3CUFA 1Q6CA 1YKWA 3H53A 1DXFA 2J6VA 5HMSA 4OV4A 3LM3A 3I4KA 3LSBA 1I8JA 3EPNA 4LAOA 4L1WA 1TWIA 3SQSA 4K1GA 3NOYA 1JUEA 3FJ4A 2CW6A 3AMKA 4XZHA 3VD7A 4DY1A 4J5NA 1KXTA 1J01A 1R47A 1JPIA 3N6JA 1GUVA 2A3HA 2QDEA 3VKJA 4LUTA 3CZLA 4IL0A 2DZPA 2VVSA 4KS0A 4CNOA 3PR2A 2TAAA 1A4MA 4QDMA 1BYDA 3EEGA 2ZUMA 1K7FA 2X8RA 2BFGA 3MO4A 2NLIA 1YEYA 3MUAA 2JBMA 3A3HA 1RQBA 1MRQA 3L4TA 5D02A 3DERA 1M7OA 4B91A 3M0LA 2XVPA 5E93A 4R7OA 4LBSA 3KM8A 3ARUA 1XW8A 1E6XM 1HKWA 2YYUA 1EZ2A 1GTEA 2QAPA 2A6LA 3L5AA 4RK8A 2PZNA 3VKKA 1OG6A 1QJWA 4TX6A 2C91A 1W8SA 1MEHA 3NL6A 1IT7A 4TTGA 1KV8A 4EOUA 2OZTA 4MLJA 2D2HA 4F48A 5CGQA 3CQ0A 4IOTA 3PB0A 1HJQA 3CB3A 4L4LA 1F05A 2X16A 2AQVA 2XGIA 4D6EA 1EO5A 4W84A 1VFTA 2HJPA 2QJGA 1OFRA 3QZAA 4FSAA 5M2FX 4BCEA 3I7RA 3TQKA 2VOTA 1ZCOA 3R0DA 3CPUA 3BGJA 1AH4A 3NYDA 3WQVA 3CUXA 1KBLA 3EPMA 3T2OA 2PP0A 4CQ9A 2JEPA 3GDRA 1TSIA 3W82A 4MOZA 3ABQA 1YIXA 4PGLA 4JTAA 4GNKB 3UJ2A 2NXGA 3ZM8A 2XIOA 3P8JA 5I23A 3CMFA 1HT6A 2Y89A 4G1NA 4C6DA 1E4LA 1CXKA 3SEPA 3W1MA 4H2CA 2J4GA 1JDFA 2GOUA 4A2RA 1XP3A 3ZVIA 3M0HA 1O7AA 4CEXC 2BWGA 3EGJA 4R27A 2W79A 1B31A 1E55A 1Z9AA 2OYMA 4O18A 3JU2A 3VOFA 2V69A 4RKAA 2J7FA 1OC5A 4PMNA 3TH6A 1E71M 1X1ZA 1JAKA 3L0NA 3SUSA 2Q01A 1RD6A 2GGJA 3L21A 3KOFA 2OG9A 1K7XA 1OFOA 4ML9A 5I78A 1I1XA 1UUQA 3NQAA 3OYZA 4GO9A 2VD9A 1EJWC 2BNJA 4A8NA 5AECA 3GNXA 1V5XA 2PODA 4IJRA 3UJEA 2PTDA 1XFCA 1H11A 1GVFA 3Q2DA 2A2IA 4OIFA 4QQ3A 1WE5A 3KS5A 4C6MA 3ARPA 3IGHX 2HK1A 3DFQA 1A50A 3E0WA 1CPUA 3PZVA 1W5PA 4HK6A 4CD4A 8TIMA 3W1NA 2PUZA 4IJCA 1Y5WA 3I68A 1GOXA 2IKGA 2J6XA 4MB5A 2VM8A 3UWYA 1RBLA 3ABRA 1W17A 3WQPA 1VZWA 3W1LA 3R43A 3R2GA 2PPGA 1LJYA 1F4AA 2P50A 2H9AA 3LS9A 3VM7A 1PKYA 3GC5A 3E12A 1U1JA 5M17A 1LT8A 3SR7A 5GNXA 3U4AA 5G4WA 4QAWA 2O7SA 3M46A 1NDYA 1YTDA 5DRCA 1ZJAA 4W87A 4UTIA 1R3YA 1KXHA 3T7VA 1W31A 4Y6GA 1E70M 4QEEA 4UQAA 4W5ZA 1QHPA 3KVKA 4HZ6A 1GHSA 1ZP4A 3WMSA 4GZIA 3CHEA 2E8ZA 1Q6GA 3HQOA 4XK2A 3IAQA 3UR2A 4H6KA 1GW1A 3EMCA 3UZXA 1FWAC 2FHBA 2YDRA 4E8DA 3FVMA 5MKGA 2DUZA 5HNRA 1QW8A 4ZR8A 4XAZA 4LAZA 3DYMA 1KM6A 1K8YA 3UCQA 1OD0A 4IJBA 4Y9AA 1I60A 3VC5A 2AAMA 2OEMA 1O5XA 1NF7A 2XFWA 3W6LA 4BEQA 2YDQA 4J3ZA 4BR1A 1D3HA 1JCMP 1FXPA 4JIEA 5AYBA 2OZ3A 3THUA 3BGGA 4QXIA 1HN1A 3EB3A 2PWGA 1P0NA 1XPGA 4MHBA 1VPXA 1TUFA 2IKJA 1DWJM 1WZMA 1UASA 1QI5A 4UB9A 3LPPA 3P8IA 4QTGA 4J3WA 1PUDA 4RW5A 4JTCA 4E0CA 2VNCA 1POKA 1F6YA 3GUGA 2AL2B 2VZTA 1J4EA 3GVGA 1J9YA 3W07A 3NQVA 3F2CA 3LMYA 1TO3A 4LV9A 1QNVA 1XIFA 3WCZA 2ZXQA 3EMQA 3VUSA 3JS3A 7ENLA 2W61A 4Y96A 5HWNA 3LCLA 3FYYA 3HO8A 1Z89A 2GWGA 1FWTA 2YBTA 4NZ3A 5BW6A 5I6SA 4B5VA 4B2DA 4E3VA 1XLHA 5M03A 3MCOA 3V0SA 3OQEA 1OFPA 3DXIA 4E8GA 3MP3A 1EA0A 1QFEA 4FEZA 5EU9A 4ADTA 4BI5A 1O12A 3BAXA 4FLSA 4ONVA 2GGHA 2A3LA 1E3XA 3HGJA 3M44A 5AVNA 5JVLA 4JN8A 3QOKA 1OJXA 3WFZA 1QT1A 4D8LA 4MNKA 2E28A 4NAFA 3W76A 3N2TA 1K1DA 3NQ8A 4P7LA 2ZA3A 2DIJA 1CENA 2OGYA 2PBOA 4YCOA 4ATDA 1HKVA 1VBHA 4EPBC 4FXSA 2LLEA 4L9YA 2VWSA 5HINA 5H8PA 4HJFA 1OZQA 1I2NA 1UR9A 1THFD 5B7ZA 3GC4A 4K3ZA 2INFA 1UD2A 5CEWA 1EJ7L 1XKJA 1K9FA 3KUMA 1FFRA 1W91A 5ABGA 2DJXA 5REQA 2O4QA 4ATWA 1RH9A 3AIEA 4AYGA 4H3DA 5GJNA 5D9PA 4OBSA 1GVYA 2WV8A 3IAPA 1O68A 4Y9PA 3WK3A 2CWXA 2CKRA 3W29A 3FX4A 1FWIC 1EHNA 1C8QA 3PNUA 2Y0FA 4AZHA 1UKQA 1FCVA 3G6MA 4F4RA 5G4HC 3C0JA 1IV8A 4DXKA 4FNUA 4U5KA 3R11A 3CTTA 1AVAA 2ZUWA 4WXZA 4LXFA 4H9XA 1S1RA 3H21A 3WNPA 1B0IA 2OOGA 2V2DA 4OT7A 3N9RA 4KWOA 3GD6A 4WSJA 4NT0A 3AAMA 1CGTA 5AHEA 1OVDA 2HSAA 4PE8A 2QCDB 2ESCA 3EDKA 4P61A 4KEUA 1YPIA 4DJFC 5F4SA 3YPIA 3CQJA 1H0IA 1LBLA 3W22A 1JPMA 3IIVA 4W89A 4BEUA 1HKJA 2C0HA 3STEA 3LXBA 1XJBA 3J7HA 1DHKA 1RVGA 3PK7A 1Q4NX 3BW2A 1ZJIA 3WNOA 3QMSA 4HZ7A 3GC2A 1QNPA 2A3AA 4POCA 4QR6A 1E9IA 2PDMA 4YU1A 1KM3A 4FZIA 2DQXA 1W3JA 3ARRA 3AMGA 1GVSA 3CL7A 4NX0A 1XV8A 4GQRA 2VDGA 3LPOA 3IACA 3MA8A 3DC0A 3CASA 1HXJA 2PWHA 4UTLA 2V2CA 3UY7A 1US3A 3LTYA 1J18A 3ZJ7A 2HISA 3D3AA 5A8QA 1VR6A 4KIRA 1W9UA 1JDEA 4MZ8A 1Q8AA 3NCOA 1VBRA 3ZVHB 3IVSA 3W84A 1EA9C 2Y7FA 4B2DD 1GZ1A 2DT2A 2XH7A 2HWGA 4HA1A 2DIEA 2YIHA 5KZDA 5EKYA 3QFWA 2V3DA 5DY2A 4CLMA 1NSJA 5FEPA 4AB4A 3COTA 2OB3A 3PJTA 3TJLA 3UPBA 1Q2RA 3NPVA 4F8XA 3TSMA 1NU5A 1PTGA 5EYWA 4WRHA 2FZ9A 4ZB0A 4V33A 2DT1A 3PG9A 3O6YX 1RJQA 5E9XA 4GVFA 5CAHA 4DJFA 3AWOA 3S1UA 2OLSA 2F9RA 3IGSA 1F6PA 3DH7A 1PYFA 1UWSA 4IM4A 3MYOA 4QNEA 1UPPA 3GU2A 1NOUA 3NOEA 4NZ1A 4REQA 2GJLA 2DH3A 1JDCA 3VU2A 3NGJA 5DLCA 2HPMA 5E6ZA 3BJTA 3GSMA 1S2VA 2B4GA 4QBXA 2YL6A 4MB1A 3TONA 4O17A 4JS3A 1OEPA 5HMFA 2VX6A 4NYUA 3RN6A 1JRCA 2XFYA 4GIEA 4PBEA 3QOMA 1MVYA 2P53A 3P84A 2XIMA 1Q6FA 3KBMA 3AO0A 5F1VA 1ZP3A 3AXKA 1S46A 2Y8VA 2OCZA 1M1BA 1T7LA 1U5HA 2G8ZA 2HCVA 2Y7GA 1XH2A 2VZSA 4Q4KA 3POCA 4FOJA 4WKAA 3S5YA 4EIVA 3V0UA 5C9RA 1UYQA 1E0UA 1J0IA 3DENA 1JXJA 1W6TA 4Q6XA 3S9YA 4HHHA 4TTUA 3T0TA 1EUAA 1GW9A 1XGZA 3PWAA 4LVAA 4DF1A 2DZAA 4U28A 4IUGA 4YLWA 1TJ0A 4Q4OA 1YHTA 3PTKA 1W5MA 1R6WA 1VEOA 3UZZA 5BU9A 1B3YA 1UUOA 2AL1A 3TW7A 1RK6A 2BVTA 3NZRA 3W1XA 4HN8A 3H8AA 1NTHA 5BXTA 3PPHA 4S3DA 4EXQA 2NQZA 1GQKA 2VUNA 1W2PA 3ZO9A 2OEKA 1XI3A 1GZJA 1NOWA 2FKPA 1FQ0A 2NVAA 2OJPA 3WBAA 1F3XA 3M9YA 3HN3A 4RDVA 1QNOA 4Z1CA 4Q8PA 4WSHA 3BUVA 3OODA 3OA5A 2GSEA 3WFAA 4LS0A 4F0MA 4PRTA 4AH7A 2WPBA 4B3KA 4QG8A 3RPMA 4KWVA 3QGKC 5AB3A 4MFDA 1CXIA 5D2XA 4ERAA 2OSYA 3TC6A 2ZX8A 3THAA 1RJRA 1BG4A 3UXAA 1VD6A 3IGUA 1A47A 4U5IA 1BF2A 3GAYA 4TQTA 3HFTA 5GNZA 6A3HA 1QO2A 4BF9A 2OO0A 4PEKA 3F03K 3WD4A 4I90A 3EKLA 3IRSA 3NG3A 4XZ9A 3N73A 2HXTA 4AVOA 5HJYA 1GJUA 1UWIA 3QRHA 4K1WA 3S46A 4Q8UA 1F73A 1ZAHA 3ABXA 3RLHA 2F7FA 3A24A 3NSXA 1RY8A 5CQ1A 2MNRA 2O55A 3LRLA 4RDWA 4ZMGA 5LIYX 1P4CA 4CU6A 4PUNA 3WBEA 1C8YA 2NQLA 3PSWA 3MQTA 1UD5A 4UR8A 2CLFA 5BWFA 1KFKA 4GY0A 3DHDA 2Z7KA 3EWZA 4B5UA 1EF2A 4GUFA 5DCBA 1WDSA 6XIAA 1FKWA 3E6EA 1L8PA 3GHRA 3AXIA 1CXHA 4MUPA 3UG8A 2IKIA 4OUEA 2B7PA 2BDQA 4H04A 4PFHA 2PGWA 4LU0A 3SCQA 4ZO9A 3L4WA 3Q37A 3PANA 5HOSA 1UB3A 1CT5A 3KTSA 3TV8A 3H2AA 3B4YA 2PFHA 1XLKA 2GUYA 3UJFA 3VI2A 2DV0A 5KMYA 2CHOA 4Y2WA 1Q8JA 3NO5A 3M6DA 4JEJA 3MHUA 4WY0F 4AEOA 3T4CA 2O9OA 1I2RA 3NQBA 2X41A 1Z32X 3S47A 2ZDSA 2PDXA 5A2AA 3UWUA 4FALA 1QPQA 3MUIA 2CKSA 3E1F1 1JIBA 8RUCA 1M3UA 4CVUA 3D6NA 3RXZA 1V51A 3MB9A 1J93A 1IQ8A 4W93A 4UZUA 5JUVA 2NQJA 3TCSA 1A3WA 4DRSA 3FJNA 2Z6JA 3BG3A 3S2MA 3GTNA 4C5ZA 3W7GA 1EP2A 3BAKA 4B4HA 2CC0A 5HR7A 4O0QA 4CD8A 3W24A 2Y6ZA 1KRMA 1YMYA 3H4WA 1V0LA 2WMIB 2FIQA 2VXNA 5F4WA 2I16A 4QITA 1QVBA 2QF7A 4S38A 4EP8C 3E02A 2QCMA 5G1TA 4OE7A 1MW2A 3IK2A 2VD8A 2WPGA 5DBTA 3DI1A 3E0FA 3ARSA 1TREA 2GFTA 4DLMA 1I45A 2YJQA 3MDUA 3RM8A 7A3HA 3NZGA 1V79A 3DKJA 3FA5A 4UMAA 4MZYA 3VE9A 4JQ1A 4K2SA 3PBGA 1Z3NA 1R3TA 2W6RA 1AQMA 4HT3A 1XYCA 3S5OA 1F8MA 3B06A 4HOXA 3O3RA 5C2XA 4P8WA 1JYXA 1GQIA 3KFTA 1JAEA 3PAOA 3UBPC 1GK8A 3P5ZA 1YX1A 3B8VA 4ZXOA 4O1AA 3I4EA 1TPB1 4LANA 3PULA 4V15A 4ZBCA 4ACYA 3IJIA 1BF6A 2IPJA 4DM1A 3EOLA 5KITA 2DPEA 3GXPA 2WNWA 5HATA 4CNUA 3M41A 2VFFA 4PMOA 4IGHA 1DE6A 3NTYA 3N18A 2WJEA 3TSBA 7ODCA 4CCZA 1V6VA 4LWWA 4PZVA 4K68A 1VFUA 4NY2A 3H12A 4IMAA 1E15A 2BTMA 4WGHA 2XSXA 1ISWA 1PZ1A 1V6YA 1W1PA 1J2WA 5F2LA 2YLLA 2PMQA 3LHUA 3LCWA 4QDPA 1MO0A 3GG1A 4ZQNA 3AXHA 2ANUA 3KBVA 4J35A 3U5UA 2X40A 4IL2A 3LXCA 3W87A 2FPYA 4UFKA 4LYRA 5CGMA 4ADSA 2YSWA 3H23A 3VA8A 4XISA 3WF2A 2F2HA 4KESA 5JMUA 1GVOA 3EWYA 2ZZ6A 3V7PA 4EWJA 1S5MA 3PZMA 4Z17A 3CH0A 5AC5A 3ALFA 3W75A 3FA4A 2OYKA 5EFFA 4JFSA 2AL2A 3LG3A 3A3XA 1HTIA 3DOPA 5K3VA 3MWCA 4IP7A 1KLZA 1LLWA 4GQ0A 3WQGA 5FI8A 4N9BA 2WVVA 2V8ZA 4HA3A 3IVUA 1LWIA 3GXFA 2Y8KA 3G1VA 2W9MA 2XFRA 2Q8XA 5TQLA 1EL3A 3UA3A 4H9MA 4O28A 1KW1A 3KWXA 3CMGA 3QH2A 2WSPA 3A12A 2A3CA 1ELSA 2OSWA 1LT7A 4JIRA 2WMKA 4WDXA 3LPGA 3PC0A 3W70A 1RR2A 2XIJA 3UXDA 3E2SA 1O4UA 2UY5A 3GTIA 1H0GA 4DQWA 1OCJA 1XBZA 3E74A 4ICCX 4L4OA 2A5HA 1XRFA 2HS8A 4XSMA 4C6FA 4H8HA 3KCLA 4P8VA 4Q4MA 4TX8A 2XIIA 3KOYA 4HCDA 3BH4A 3SIMA 5FJJA 1NDWA 3RJXA 2FVKA 3VMNA 3OGSA 3UWEA 3WQOA 2IPGA 4GYPC 3PZQA 2PU1A 1XYMA 1LQ2A 1WNOA 2YYTA 4B5SA 3VO0A 2BY3A 1NOFA 4H2HA 2NVDA 4D2JA 2VYOA 1XD0A 3GYCA 3WLMA 3RLGA 3KP1A 1PB0A 2POTA 4PCTA 3HPSA 4EACA 3DIPA 4A3UA 3VD9A 1GPFA 5TBOA 1IEVA 1V7YA 2QW5A 3P5YA 4CD5A 4EPEC 4C1KA 4JTEA 3K4AA 3IJDA 1CGWA 5C8BB 5G4EA 2BMBA 3R58A 1CEOA 3WN6A 1LOLA 3DI0A 3UG3A 1Y8BA 2E9BA 5H8UA 1AD1A 1IGWA 3NQMA 3CV7A 4XVEA 3VILA 5A8NA 4H6EA 4BQ4A 4MJ2A 3ZT7A 1XCXA 3HPXA 3B8SA 3CIVA 2A6NA 1XWYA 4I9MA 3WIJA 3AC0A 1AL7A 1QW9A 4CKQA 3UZ5A 2CIPA 4F0HA 1UC5A 5HANA 1JYWA 2QCDA 4FMVA 3CO8A 3GNNA 1W9BM 1HL2A 3KVMA 4N6FA 3FS2A 3CIWA 3IJLA 4WDUA 1FWSA 3KX6A 5EB8A 3NVDA 1TQJA 1V4YA 2GJXB 2WC4A 5CPTA 2OWXA 1K8ZA 4GYPA 1LG2A 3ABOA 2Z26A 1M65A 3LGDA 3G1HA 3SAZA 2B31A 5GPRA 4XSLA 3ZLHA 3ITOA 3LHTA 3VIKA 4Q8VA 5CC6A 3GIQA 1FWEC 1BWLA 3A9IA 3OB8A 1JULA 2WMHA 1VS1A 4H9YA 2QPSA 4CNSA 3SGUA 1BVWA 3CHCA 2A7RA 4M0XA 5IM51 7TAAA 2PS2A 3RR4A 2PTYA 4XZNX 4ZODA 3PZUA 4HOZA 4WKHA 1HW6A 2UY4A 1JI1A 1ML1A 1NFBA 2ZXAA 4UQDA 4QSFA 2DW7A 2ASHA 3VGBA 1NWSA 4JTGA 3WNMA 1KBBA 3KDOA 3IANA 1AJ2A 2QUUA 2QGHA 3QPZA 4PRRA 4LAMA 1J0YA 4MIMA 3DKLA 1O6IA 2WQPA 5G1MA 1R85A 4GJJA 6XIMA 4O16A 3TNBA 3ZVHA 2BGNE 1TV8A 2A85A 1VF8A 1C7SA 5TIMA 4KWUA 3ELFA 4XIAA 1TZ7A 1L2UA 3KLKA 4GQGA 1D2KA 2A3EA 4Z2JA 2V82A 1EJRC 3PVFA 3PTDA 3ZJKA 3OTRA 1I0DA 4O1BA 1BSIA 4ORIA 1AQFA 4N42A 2BVWA 1PYMA 3MC5A 3PPGA 1HNYA 4GZ7A 2VEMA 1TVLA 2FH6A 4KEVA 3KWSA 3G8RA 1BTMA 2ON3A 4UTFA 1EO7A 4ZCWA 2HMCA 5FF7A 2GL5A 1XBYA 3NWRA 3MHFA 4PSRA 3VIHA 3OBEA 2ZZ1A 1XG3A 2QT3A 4IXXA 4WY0B 3NPWA 2V68A 1GYNA 3WF0A 4H9TA 2QJJA 1LBMA 4G7FA 1K4GA 4QLJA 5A8OA 3PUOA 2DIKA 3KLLA 5I3HA 1UC4A 1X8FA 2CCRA 3G1FA 3SM0A 1AW5A 2CEQA 3V5OA 1AMYA 1B90A 2Y8UA 2P8BA 3W7LA 3AHXA 3G0UA 3MSGA 3UWVA 3GXNA 5F2MA 3ZR4A 1G4EA 1NQ6A 5AYXA 1R9XA 2WWCA 4HMEA 3D5HA 5K9CA 2PLKA 4UNKA 2ISFA 2GVEA 2QJNA 4FF7A 3XISA 2VO5A 1YBQB 3WLTA 1K6WA 2VCCA 1XRVA 4M6QA 3HV9A 4G8TA 1UUMA 2D69A 3VXGA 4H8VA 1IZCA 4LNYA 5C71A 3THCA 4FIRA 2DVUA 3CPGA 3W9ZA 2OPJA 3P80A 3GK0A 5FF0A 3GB6A 2NSOA 4IPPA 3GAKA 3L68A 2GDVA 3MV11 4BA0A 4GH3A 1AMKA 2RDXA 5GNYA 1GKQA 5BOFA 1D8CA 3SCRA 4XKMA 1XHGA 3MU7A 1QNQA 1LWJA 4I6KA 4FX8A 3RO8A 1LRTA 4A22A 3H2CA 2WBKA 5F7UA 3DFYA 2G97A 3WDJA 3BE7A 5GVJA 3M1ZA 1RBOB 4ZOAA 3LD5A 1CLVA 3CUGA 2FVMA 4MLRA 1JCLA 4WEVX 3S0CA 1ZS2A 2E1DA 2OX1A 2YCEA 5D38A 3M47A 4H9ZA 3AQUA 4LF2A 3USZA 3GYEA 3LLDA 3NM3A 5M5DA 4YPJA 2QNEA 4Q33A 2VZUA 1EC9A 1CIUA 1GEQA 3CHDA 3QJAA 4HTBA 2AAAA 2X2YA 4QEHA 4LVFA 3GG0A 4OOZA 5A6SA 4CNPA 4PYSA 5LNVA 2ZA2A 4CQAA 5LA0A 1FHVA 5I3IA 3WH8A 3ME3A 3XINA 1HUVA 3FFSA 2WSRA 5B80A 3MUXA 3WF3A 1GG0A 3DHUA 3W38A 3UEQA 1ICQA 2J62A 1BQCA 3POHA 4IFOA 3AYTA 4O54A 4BI7A 4RDYA 2ZFAA 1EWDA 2FMOA 2CZFA 1QI3A 4S2CA 1OF6A 2V5JA 2G3FA 2EJ1A 4UTMA 1BHGA 4NJIA 3QGAC 1G0CA 3V4BA 1S3TC 3ANVA 1XLLA 3WNKA 1HGWA 3QYSA 4QROA 3V5CA 1KM2A 3CBWA 4LY8A 1QASA 3EX4A 2G3NA 1S2AA 4RXFA 3RHGA 3WUFA 4TIMA 1XLAA 1TUXA 2E5DA 2CBVA 3W7DA 4PB5A 3UY8A 1B54A 2FB3A 2QDHA 3M0VA 3GWQA 1V77A 1IXNA 4QGCA 3E2QA 3EA3A 4JIHA 3EXRA 1O5QA 4IUOA 4KFPA 5DT5A 2QCFA 3M0XA 3LHZA 3B9DA 3Q4DA 1SR9A 4DAFA 5CJ5A 4N02A 5IDZA 2BGSA 4U10A 3TW9A 3N6HA 4X22A 1BKHA 3LZ5A 3E38A 4LB3A 1DV7A 3KRSA 1NFGA 4OTKA 2GJRA 2G3IA 4PB3A 3DHFA 5LXEA 3EWBX 1D7FA 1TJ2A 1EWEA 3SURA 1J6OA 4DHGA 5JH2A 3T9PA 5DEZA 3WK2A 3IJ7A 3L5LA 3PWIA 2ZA1A 1DWIM 3DG6A 2YXXA 4BS0A 3DG3A 2P5NA 1MDLA 4UR9A 1LCOA 4IPLA 1FDZA 3EXSA 1TPH1 3RIKA 1UR8A 5ECUA 2QCEA 3QV8A 4ACZB 1XYZA 2XHYA 2GQ8A 2PDKA 2Z28A 2CLHA 1SW3A 1ADSA 3M5XA 4JYFA 1PTDA 4FOUA 1MQRA 1ISZA 2X1SA 1KO0A 3PSVA 4GVHA 4KH2A 3I10A 2JF6A 1Q7MA 1KFWA 1BYBA 3E49A 1XQKA 3KP0A 1EC8A 4RNFA 1XIDA 1UIOA 2ZX9A 3W26A 3AIQA 1FOBA 3BV4A 2F2KA 3MUY1 4DX3A 3G2GA 1PAMA 5HR6A 1JQXA 4W85A 1X97A 1F3WA 1DE5A 3FSTA 5D9MA 1DP0A 3WQEA 5AHFA 5LXXA 3H7RA 4Z2HA 5BMXA 5FESA 1LORA 5HPCA 3F2BA 1H5YA 1V0MA 2KZHA 4YJ5A 1X39A 2XTKA 1KR0A 1V02E 1KFCA 1R3VA 2BVDA 1L9WA 5HWMA 5CPLA 4JCLA 2XIBA 4LY4A 3DFSA 2DFAA 2VL4A 4UQ9A 1XBXA 3UYCA 3BSGA 3ZR5A 1LLOA 4FB7A 3MO7A 4HCHA 4O52A 2DVTA 4QE4A 1Z41A 5D09A 5CSRA 4U31A 3TW6A 1P7TB 1VCFA 3TP4A 4B3LA 1UR4A 1M04A 1UMLA 1I4NA 2V3FA 3ICJA 3TA9A 5MF5A 5AKQA 1XD1A 4CQCA 4YN5A 2XN0A 1WBJA 3BOFA 1GCYA 2WMGA 4P7OA 2OSXA 3REQB 4HP5A 1Y5XA 2TPSA 2XINA 2ZZ2A 1JCXA 3VDGA 2PC4A 5M3WA 3VD4A 2H90A 4OQVA 3NZQA 3TJ4A 3EMZA 4GYKA 1NP0A 3N2BA 1J8VA 4AVNA 5JIWA 2GQ3A 2DUAA 4EWND 2DSUA 2CBIA 1EDQA 4ERGA 4LPCA 2D3LA 3GH4A 3LBMA 3U9IA 1RUSA 4H6RA 1OIFA 1KB3A 3ARXA 4NXKA 4J1OA 4JTQA 3LCHA 5GQBA 1HX0A 5A8PA 4XAYA 4V2XA 3O6CA 1A5NC 4LJ3A 3NNTA 3B0VC 5DMYA 1A0DA 4NIRA 1K7EA 1RCXB 3WLKX 4PCSA 1JCJA 1LL6A 2VDHA 4CN4A 1MNSA 3PBUA 3ECQA 3L2MA 4GIYA 3NPXA 4A3YA 4O1FA 1VRXA 1TA3B 3T6CA 3ZWTA 3WQ8A 1O5KA 2GPTA 2ZX6A 3SCWA 3C52A 3VYLA 1XSKA 5CG7A 4M51A 1ADDA 3EB2A 3SI9A 1Z69A 1OFQA 4NNAA 2D73A 1TPWA 6ALDA 1UR0A 3N25A 2ZOXA 4J28A 5EBUA 4GZEA 1KRCC 2NXHA 3E3HA 2ZX7A 3N4FA 4AIUA 5U7SA 3VC6A 3ARQA 3G8EA 1FWCC 3R25A 2PZ0A 4ZTYA 3W7HA 1HG3A 3BG9A 4PCPA 4UC5A 3ZLFA 4A3RA 1B3XA 4O1DA 4S23A 3APTA 4N9CA 5LA2A 1H60A 2BHZA 2HE8A 1W9VA 1A3XA 5FOOA 3B8IA 1CB7B 1EX5A 3QPEA 1RPXA 3RRXA 1MW0A 4IXHA 1FDYA 2R8WA 3BWWA 3AYRA 2CITA 4G9PA 4PC8A 4LALA 4FR1A 3M4HA 1N7KA 4KRUA 1VFHA 2C0AA 3NGFA 8XIAA 3VD3A 3C0SA 2ACUA 1R8LA 1ODUA 4KMQA 2D2GA 4W4QA 4WJ8A 6REQA 4EXBA 2BLEA 1Y5VA 1SZRA 2Z4GA 3E9AA 2J47A 2IPWA 3VK5A 1S38A 1B30A 2G95A 4XAGA 2J8GA 2PP1A 1W1YA 2YDSA 1JRBA 1YNQA 4MUZA 4BQ2A 4OVXA 1WUFA 3AXMA 1ISYA 2DGAA 4X63A 5E9AA 1VBUA 1IGSA 1M03A 1WP6A 4GVIA 1E56A 3IUDA 4E2DA 1TQXA 2WMJA 1A5MC 1E3ZA 4M1BA 4B5NA 3OBKA 5JH1A 2GSHA 1GONA 4AWSA 5LKYA 4HYWA 4URIA 5C2CA 4DIAA 2BVYA 2AQWA 2P10A 4XTIA 4ZOBA 4D1JA 1OWQA 1H7WA 1E43A 1YE4A 3WLSA 4KRZA 2J27A 3MJYA 5E0CA 5I3GA 1E73M 4MAZA 3N15A 4ZFMA 3TQPA 1IIGA 5DO8A 5J8LA 4Q8OA 2PCQA 1L6YA 2WKGA 4PUJA 2GJXA 4HU8A 4ML4A 4W86A 1VHNA 2PDUA 4YL2A 3WY1A 4O57A 1BG9A 2X7WA 1REQB 3ZR6A 3H2OA 1NH6A 3KDNA 4M6VA 3CTLA 4NL1A 2PD9A 3D46A 3NDYA 2PAJA 1EGZA 3ZLGA 1W1VA 4JTRA 3P67A 3QLDA 3MSRA 2CBUA 2V5BA 3GU9A 2JQXA 3B9OA 2Z1WA 1ME7A 3EX2A 4PMZA 3S42A 3VGFA 1SVDA 2IMRA 3QV6A 4M7SA 1HVQA 3SBFA 3LNPA 2GK1B 4IFRA 4LOCA 3MV01 3G18A 2NUWA 5D8WA 3RDKA 4NSBA 1HKMA 3VIOA 3T8QA 2V9DA 4ALDA 4IWWA 1UD4A 3MKVA 5FEXA 3VIJA 1R0MA 3EDFA 1UWRA 4U2YA 1E5JA 5FCZA 3PBVA 3CGTA 3SADA 5H8MA 2FH8A 2EKGA 2HPIA 2WLZA 3OIHA 3ARYA 3S5ZA 1VC4A 1BQGA 1TPDA 1XPYA 2Y2WA 1JUKA 4GX8A 4F9JA 3E2RA 1JFHA 3VMPA 4GLEA 3NDOA 4NG3A 3PN8A 5FKYA 3H7UA 5I3FA 2TYSA 4TUFA 4L5ZA 3FGCA 4L6HA 5LA1A 3T2QA 1VJSA 2HVOA 4DYJA 4E4PA 2VP8A 4XBKA 3TWAA 1T8QA 3EOSA 3EPOA 4DJDC 4WY0A 4XV0A 4GZJA 2INEA 5DT7A 3CEPA 3CUHA 1W3LA 1P6BA 1C91A 5G5IA 3TMLA 4DNMA 2YPIA 3FHQA 4Z1AA 1G94A 4UMCA 2JIEA 4LH8A 4TR9A 3A4WA 2BY2A 2YCLB 3I3DA 3QQ0A 1OB0A 2XJ7A 3OYXA 4J3UA 3LB0A 4HU3A 2WOQA 4F66A 3H22A 4QDWA 1KBIA 2ZRXA 4G2DA 2VZOA 2ODOA 4S1FA 1SZGA 3W73A 2ZZ5A 3G5EA 2W4XA 4QLLA 3VX0A 3NEVA 1PJ9A 5LZLA 2DSVA 3TZFA 1OZMA 5CJMA 5G2HA 3GIYA 4LT9A 3URBA 1RPKA 3W1TA 2C3ZA 4O19A 1M01A 1J12A 2A7PA 1MQQA 5BOOA 2C6QA 1CGUA 4RR4A 4WKFA 5FL1A 3QR3A 5FEWA 1B4EA 1N8IA 1VP5A 1LRQA 3S5NA 3M16A 4MB3A 1KXQA 4AD1A 3OZOA 3F4CA 4XD6A 1J0HA 2YA1A 3LK6A 1GNXA 3NQ6A 4IX2A 3ID7A 3NPUA 3WBWA 1V93A 2R6OA 4F0KA 3DDMA 3AZTA 3GBEA 4ZQPA 3SUVA 1XIHA 4UTTC 1DL3A 2HQAA 4LRTA 3WELA 4CCCA 4D6FA 2IXUA 3L4YA 1V6TA 4DJDA 1A0EA 4UFLA 3W1AA 4NKCA 3VD5A 3MZ2A 4KGJA 4JTKA 3MANA 1IEIA 2W5FA 2E6YA 3KAOA 2W67A 3W72A 4WJXA 3O1NA 3PNZA 1KM0A 2D24A 3FIGA 1W3IA 5HUOA 2EO7A 1LWHA 2Z2AA 3DCPA 3JVAA 2VGIA 3AI0A 3M5YA 3CNYA 4LAKA 1WDWA 1FHUA 3SJNA 1RALA 4DO5A 2CXGA 4AW7A 2ALRA 2ZQ0A 2FFIA 2QEZA 1Z6KA 1G4PA 1OFBA 2Q6ZA 3T0CA 4S3JA 1E0XA 3CZ8A 4ICMA 1TJRA 2E7FA 3S2LA 4AY7A 3MZNA 4QISA 2R94A 4C65A 1W37A 4ENLA 1CXLA 3AYVA 2DSKA 2PRLA 4MNJA 4L64A 1W1IE 4ZGYA 1U5JA 2YXOA 4K7YA 1G7UA 1DXEA 4KCWA 2A3BA 3QY8A 4I7WA 3VNKA 4UTTA 1V02A 4V1YA 3B8DA 2D2JA 5I2UA 2PGFA 1JD9A 4ORMA 3V75A 1NIUA 4WXYA 2OFJA 2DW6A 1CECA 5EMUA 4JY8A 3WBXA 5AYZA 1YRRA 5LHEA 3LHVA 3QKZA 3SY8A 2H3BA 4GINA 1HJXA 1RQEA 1OK6A 2WSKA 4YS1A 1HVXA 2G4JA 3ZOAA 2FQIA 1NFPA 4ASTA 2I7GA 3NQCA 1IR1A 3M43A 4QE5A 2BSLA 1O66A 1IT8A 3HFYA 3CK5A 2BBFA 2VRKA 3GKAA 1XUUA 3KZSA 3H24A 3N2OA 4LB4A 3LCGA 3HF3A 1ME9A 3ZT6A 4KKXA 3GXMA 3LLFA 2CLLA 1Y65A 2J7GA 4R88A 4CQBA 2X0HA 1H41A 4DZHA 4EVZA 5H2ZA 3KTXA 4KFOA 4BF7A 3M0ZA 1RY0A 4DZIA 3E96A 4EANA 1A5UA 1P0BA 1UJQA 4NILA 1J79A 3B3DA 5F4XA 4GCAA 2WJZA 4RPPA 5KZMA 2PP3A 5AHIA 3PJWA 3TMQA 1DIDA 5E0KA 4P8UA 5A3HA 1UD6A 2NQHA 3VPLA 3T78A 3ZJ8A 2ZRYA 4G7EB 1MZRA 4ACZA 3UCCA 4BQ3A 1AW2A 4LRSA 4OHQA 2OYLA 1ENUA 2ISDA 1XYFA 2Z1KA 3MT1A 4PUMA 2P3ZA 3VX1A 1PEZA 3A5VA 3CQKA 3HPZA 5EA9A 1E6ZA 2F84A 1TTJA 5CPQA 4AZGA 3EX6A 1W3KA 4NZCA 3QZ6A 3QYQA 4JGDA 1E4MM 4PUUA 2XSBA 4GACA 1V3KA 1KGWA 4DJDD 4YTUA 1V7AA 3EWWA 3W25A 1VEPA 1V6UA 3TUUA 3U57A 4DUVA 4JNYA 1LQ0