3LOTA

Crystal structure of protein of unknown function (np_070038.1) from archaeoglobus fulgidus at 1.89 a resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
310
Chain Sequence
DDVVIVTCAITGAIHTPSMSPYLPVTPDQIVEEAVKAAEAGAGMVHIHARDPKDGRPTTDVEVFRYICREIKKQSDVVINVTTGGGGTLGIPVEERAKVVPALKPEIATFNMGSMNFAIHPLLKKYKEFKYDWEPEYLEMTRDIVFRNTFKDLEALSRIFKENDTKPELECYDIGQIYNTAFMFHEGYLEPPLRLQFIHGILGGIGTAVEDVLFMKQTADRLIGRENYTWSLVGAGRFQMPLGTLAVIMGGDVRVGLEDSLYIERGKLAKSNAEQVEKMVRIVKELGKRPATPDEVREILGLKGKERVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PROTEIN OF UNKNOWN FUNCTION (NP_070038.1) from ARCHAEOGLOBUS FULGIDUS at 1.89 A resolution
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structure genomics, unknown function
molecule keywords uncharacterized protein
total genus 107
structure length 310
sequence length 310
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05853 BKACE beta-keto acid cleavage enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lotA00
4HNVA 3KVLA 3EWYA 2CW6A 3RLVA 5J5RA 3M41A 2YZRA 1X8FA 3TDFA 3JR2A 3CIXA 2QAFA 4NNCA 1AL8A 4RR4A 3TH6A 3L67A 4FNSA 2E5DA 3I6RA 3HQ1A 3PSWA 2Y7GA 5KITA 3UWQA 1Q6OA 5K9CA 1PCKA 1VHCA 4NJJA 4QITA 3S5YA 5KZMA 3NYZA 1I2RA 4K39A 4G1KA 2PCQA 3E0IA 4WZHA 3C2EA 4JX4A 4JTTA 3TUUA 5AHIA 4BI5A 4U28A 1XI3A 1JVNA 1D9EA 3P62A 2YDAA 1J4EA 4WOZA 1SO6A 4JTFA 1T0OA 5AC8A 5U7SA 2CLOA 1W3TA 4UTWC 1PE1A 3FOKA 5HWMA 3FJLA 4UTWA 2FPTA 1G4EA 2H8XA 3LV5A 4DBEA 3OVQA 3W2UA 4K36A 4CQ9A 2J88A 2Y7DA 4R53A 4TU1A 3PG8A 2RHGA 1FQ0A 3PB0A 4UMCA 3L5LA 4UTTA 3C56A 3W2MA 3UZJA 3STEA 3P5YA 1SO3A 2QCGA 3SSJA 1J2WA 3QW4B 1XKYA 4ADTA 3PUEA 3NQ8A 3PM6A 4NU7A 4XKYB 2QCCA 4UIOA 2QEZA 3TXZA 3M16A 3UZ5A 1Q6RA 2HMCA 1QOQA 2RDUA 4XBKA 5KZDA 8TIMA 1X7FA 3S5NA 3N14A 2Z6JA 2E5CA 1X1ZA 1W54A 6TIMA 3NL5A 3LCWA 4FO4A 3NPVA 3VKJA 3DXIA 4MY8A 4ZMGA 2XN0A 3TMQA 5G2WA 4KFOA 5DXYA 5A5WA 1KFCA 4HHPA 5EL1A 4HT3A 4S2BA 1DOSA 5D2WA 4JYFA 3USBA 4EOUA 2RFGA 1GQNA 3I7QA 1KLYA 3S8HA 2AQWA 4M19A 3MMTA 1WA3A 3LRMA 1HUVA 5LNVA 2QDHA 5AB3A 1WBHA 2EGZA 2A21A 2OZ0A 2CU0A 1Y0EA 1XCFA 3LLDA 4Q4KA 2GQ9A 3B4UA 4NJKA 3KVMA 1F05A 4JYDA 3Q37A 1KBIA 1TMHA 3NPUA 1VPXA 1SZEA 2HS8A 2JGQA 1ADOA 2E09A 2GQAA 5ABTA 5AYZA 1UCWA 3TC7A 2AGKA 4WD0A 3V1PA 4PODA 1OFAA 1W5NA 3WFAA 2ATSA 3FKRA 3PR2A 3LX9A 3PUDA 4PH6A 5E1QA 4O0ZA 3BG9A 1QWGA 2G95A 1LYXA 3IIXA 1THFD 3LHZA 1AG1O 2NLIA 4UNKA 3LBMA 2CZEA 3NQAA 2A4AA 4RKAA 5U4NA 1DV7A 1KM1A 1SFLA 4MUZA 3LRLA 1YTEA 3BW2A 1U5JA 3LXAA 4O28A 3TAKA 2V5LA 2GJNA 4UTLA 3O6CA 1S5VA 3G8RA 4X9SA 2ZZ7A 4J9JA 3QM3A 5D30A 1ME8A 2DZWA 1OK6A 3LCGA 2R91A 1W1ZA 3CM4A 3G24A 3TSBA 2BLEA 2EKCA 4LUIA 5KTLA 1TQXA 2H8ZA 4PEKA 2D73A 3LCHA 4ZQPA 1K8XA 1N55A 3HO8A 2Y7FA 1OFRA 1LRNA 4HN4A 4O1CA 2CLHA 3G1SA 1YXYA 1PV8A 4RX0A 1CX9A 4PCFA 1SR9A 1DBTA 3IRDA 3CC1A 1A50A 3WJYA 5LGZA 1EUNA 5DCEA 1I2NA 1SW3A 3IIOA 1K7FA 5FEPA 3P61A 3O06A 1VLIA 1FY6A 1TQJA 2NZLA 5AYYA 3LCIA 4UFLA 3W7CA 5FF0A 4I7VA 5DXXA 1DORA 4XUGA 3QPYA 1KTCA 4ORMA 2TMDA 2X1UA 3RNDA 4BF9A 2A85A 4PL2A 3QPZA 4WY0A 5DBUA 3GDKA 3W2KA 4JTJA 5K7JA 1XL9A 2Y61A 3G1XA 2B7PA 2J27A 1A53A 4AHOA 4CNOA 3S9YA 2Y85A 5FF2A 5EYWA 5CZ0A 1K7EA 3SJ3A 3VE9A 2VOMA 3DHFA 2V8ZA 3S0CA 1KV8A 4UUIA 3TK7A 2QCMA 1JCXA 1JQVA 1G4PA 5G1YA 4AWSA 4UMAA 4POCA 2A6LA 4UC5A 3P82A 2YSWA 3T40A 1LBFA 1H7RA 3ZS4A 1EUAA 4GUIA 1IXQA 4CNPA 1OFPA 4QAIA 2EAWA 1MEWA 2WPBA 4Z1BA 5H91A 4AF0B 4HPJA 1IIHA 3AJXA 3TJXA 5F2IA 5EPDA 3A24A 3W1AA 3CB8A 3DHDA 3HBLA 3PBUA 1OFOA 2H6RA 1TB3A 3SI9A 4IQLA 5C2XA 2FQIA 3W7DA 5D37A 1N7KA 3TNOA 3MBDA 3M6YA 2WSRA 3BVJA 3CEPA 4LV4A 3L65A 3YPIA 5LNRA 1C29A 3HPSA 2WJZA 3GXNA 1W3IA 4NZFA 3B05A 4MFEA 2A0NA 1EPXA 2ABBA 2VFDA 5TQLA 3NOEA 3W7HA 4YWIA 2WNZA 3DFPA 3QSTA 1I2PA 3GNNA 2FTPA 2WNNA 2OX1A 1HO1A 2R14A 4RLIA 1EP1A 1B4EA 5KSWA 3H53A 3DFQA 1KBJA 3NQGA 1OX6A 2CLIA 3S1WA 3O07A 2P1FA 3TSDA 3LHVA 5D32A 1AW5A 3F03K 1H7OA 1JUEA 4O1AA 3UPWA 5D38A 1DJNA 4UTMA 3LBCA 3SECA 1EX5A 3CIWA 3IIPA 3L21A 3LDVA 2ZTJA 1KFBA 4KWVA 3O15A 4QIUA 3L9CA 3LB0A 2C1HA 5H2ZA 2JKPA 1H61A 3MYPA 3G1AA 4LOCA 3W7PA 3GB6A 4O13A 4N6FA 2BX7A 1ICPA 3OEXA 4KFPA 5CZSA 2X30A 4ALDA 1H7WA 2G97A 3BLIA 7TIMA 3FJ6A 1Z48A 4LVAA 4S1FA 3DGRA 3W71A 1ZENA 1SFJA 4MPQA 3BLEA 3GK0A 1R46A 1BWKA 1H60A 3P8IA 1YADA 3ATZA 4ZL1A 3HGJA 3MI3A 1NVMA 2FDSA 4ORIA 5LGXA 2VFIA 1XC4A 4M7SA 3A22A 4GFSA 5AN7A 3ABSA 5C55A 4OBTA 2G96A 3LCLA 2E5BA 4FXRA 3TAOA 1XDMA 3W6YA 3QZEA 1LOSA 5D02A 3M43A 5CPNA 2ZZ4A 3W07A 3GZ3A 1RQBA 3A9IA 4HNNA 4LT9A 3M5ZA 1GVQA 3G18A 2JGYA 5C54A 2QKFA 4NUWA 1P0KA 4K38A 3VNDA 3UYCA 3PSVA 2C14A 4NXKA 4WUIA 4JYEA 1T8XA 3TSMA 4M6VA 3NL6A 4O11A 3E12A 3LRKA 5HNRA 2PRHA 3B0UX 3GKFA 1ME7A 2A7PA 1YLVA 3NDOA 4PFMA 4JDBA 1HL2A 3MP4A 2WOQA 4Z1DA 2PC4A 1TV5A 4DEFA 5IM51 3G1YA 3SFKA 3KHJA 3R13A 1GWJA 3P80A 1OVDA 1FUYA 2QCDA 4YL2A 2DZSA 5LZLA 4JICA 3SZ8A 1CW2A 2X1RA 3PS7A 4HNUA 4O14A 3CT7A 4CQ8A 2QCLA 3G1VA 1V7YA 1S5TA 1NF0A 1FDJA 4K7YA 1O95A 1RR2A 1OFDA 4Z1AA 3FYPA 4GE8A 5CSSA 1IXNA 1GG1A 5D09A 3NQVA 1EEPA 1YPIA 4ZVJA 3LHYA 4LTSA 1LOQA 4ML9A 1XBXA 4WXZA 3BPWA 4AHQA 2NWSA 3GDMA 4JR5A 3G1FA 3M5XA 4JGDA 3N9RA 3EX2A 1YTKA 1TTIA 4RXGA 1M5WA 1RD5A 2Y88A 4MOZA 1YYAA 5F1VA 1G4SA 3VE7A 4MZ8A 2ZRXA 1IXOA 1AK5A 1FXQA 3C2FA 1Z44A 3ANYA 4LVDA 5FF7A 3TX9A 2H3DA 3W1XA 3L68A 5FEXA 3F4WA 3NQEA 2ATMA 3NM1A 2DJLA 1JULA 5K2ZA 3EX3A 2WSQA 3IGXA 4TMBA 1ZAHA 2RKXA 1EP2A 1LORA 3GX9A 3KVJA 4HSNA 4AVFA 3HIJA 3GIYA 3NL2A 3PG9A 4IMFA 4IUOA 5L9FA 4TO8A 4O19A 4Y90A 1BKSA 3GYEA 3LCXA 3HJZA 3HGRA 3RU6A 3G3MA 3L0NA 1QCWA 1IXPA 3NQDA 4RZ5A 4S2CA 3ABOA 1GYLA 1LTDA 3UY8A 3M5VA 4A29A 3E9AA 4FNRA 2ZCGA 3GAKA 2CLFA 3W7JA 3RF9A 4MVAA 3C2VA 2V81A 5D04C 1ALDA 4FB7A 3GVGA 3C2OA 1ZFJA 3TKFA 3ZR4A 4OT7A 3B0PA 3KAOA 2A6NA 1T96A 4GUFA 4AHPA 3TFXA 3R89A 3E02A 3FEMA 2NV2A 1NFBA 1WOBA 3DU0A 1CI1A 2DZVA 3CU2A 5CPLA 3G1HA 5HUPA 4IXXA 3WJSA 4BR1A 4XWUA 3Q58A 4E2BA 2O7SA 5LKYA 2GJLA 2V2DA 4JTGA 2E68A 4IOTA 1QNVA 4MFDA 2ZZ1A 5MHBA 1W5OA 4C1LA 1GVRA 4AH7A 1H62A 1DQWA 3KFTA 1JR1A 4JIPA 2B7OA 1UBSA 3MI6A 3A23A 4LS1A 5D33A 3NNTA 3IIVA 2OT0A 4RJEA 1K7XA 4MLRA 4W9TA 4FX8A 1KTNA 3HG3A 3FS2A 3EX1A 3L2IA 4UFJA 3CPRA 3NQ6A 1TO3A 3RK8A 1TPFA 4N4PA 1PVNA 2R8WA 1LLZA 4ZQNA 4QISA 1H1YA 3TXVA 1I45A 4I7UA 4TX9A 5FF4A 2Y6ZA 3QYQA 3ZFHA 3BG5A 3IV3A 1R47A 3QMSA 3QEZA 3THQA 4DBDA 2QAPA 4DF0A 3MJYA 5CSRA 4JTSA 1MXSA 4YCOA 4UXDA 3W7QA 4Q33A 4UTIA 2ZRYA 3WK1A 4OGZA 1AW1A 3UXAA 4ADUA 4LVFA 2VEPA 1NF7A 4MKNA 3U8GA 3L5MA 2ZRVA 1F5ZA 1GPWA 4WJEA 4JX5A 3G0UA 1QAPA 1TJRA 2X1TA 2Q3OA 4OV4A 1A5BA 3DFSA 4NX0A 3TW7A 2V5BA 1JRBA 3B0VC 4K7VA 1VCFA 5SWUA 4LS2A 4KFNA 2QF7A 5DBTA 3WJZA 2YCEA 3W7GA 1SW0A 3VFLA 1RQEA 2VKZG 3EWUA 1BEUA 3PAJA 4GBUA 5DLCA 3I68A 3RLUA 1LRTA 4JTHA 2J9YA 2E6YA 1SSDA 3TV8A 3QW3A 1WV2A 3LHWA 3VCRA 3V75A 1L9WA 3S6DA 2ISSA 2FLIA 3W2JA 2YR1A 1KV5A 4O4WA 1BWLA 5C5YA 4DXVA 3S42A 2TRSA 2YXGA 3TMLA 3M5YA 1KTBA 1XM3A 1XXXA 1SO5A 4RZ6A 3NA8A 1OX5A 2CWNA 5AHEA 1GT8A 2W0UA 3SW6A 3P5ZA 4A21A 4EWND 1TPB1 6ALDA 3LHUA 2RDTA 1GOXA 3HGOA 3L5AA 3INPA 4M6PA 4FNTA 1PHQA 2B0MA 2QCDB 1XBZA 3W9ZA 3Q2DA 1E51A 4JTEA 4Y9AA 1JCJA 1EWDA 3GR8A 4O10A 3HMJG 3U6WA 1F76A 1VYPX 1HG3A 4BI6A 4N9CA 2VFGA 2Z1BA 3A21A 4IMCA 1W5PA 3HPXA 1H63A 2WKJA 1IGSA 2FPVA 3DFNA 3DI1A 3MI2A 1G4TA 3HPZA 1SSGA 3W1PA 1GEQA 3A5FA 3W1LA 1K03A 1FCUA 2NV1A 1H50A 2X2GA 1QO2A 2RH9A 2JK2A 1IIGA 5K3VA 4PA8A 2F84A 5BMXA 3O6YX 5IBXC 2YX0A 2WO5A 3W88A 1HO4A 3M0ZA 3FA5A 1JQXA 2VEMA 3NQ7A 4NNBA 2Z6IA 3P81A 2ZRUA 1NAL1 1RQHA 3LV6A 2BSLA 3GKAA 3S1UA 3TIMA 4LVGA 1WX0A 1ICSA 2QCEA 3ATYA 4UFIA 5I3JA 2ZTKA 3B06A 1KM3A 2EF9A 4KKXA 3P74A 4LC8A 3WJWA 1JUKA 3VI2A 5CZJA 2X1SA 4N2YA 2Y63A 3S5OA 5D05A 3L0GA 4BI7A 3NL3A 3TCEA 4Q32A 1I2QA 4UTJA 2ZQ0A 3NG3A 4JTIA 1I2OA 3W1TA 2DORA 2KZHA 1DJQA 3EX6A 3W1RA 4A2SA 2F7FA 3MP3A 2NUXA 4LRSA 3UPBA 3NQFA 1TREA 1YDOA 3GXTA 4KWWA 3FIGA 1EB3A 1R2SA 4ONVA 4NT0A 5CGQA 3DZ1A 3RMJA 4L4LA 4O1BA 2DJXA 3S1XA 3LCFA 1WYIA 1L6SA 3E96A 1DKWA 5DN1A 2V2CA 1D3GA 1GJPA 1VCVA 2CLLA 4UTUA 4O18A 3NEVA 1SU5A 2HS6A 2ZZ5A 3EWBX 3P67A 2GOUA 2XFWA 4MJMA 5LNUA 3M1ZA 4UTTC 2YYTA 5K4XA 4N9DA 1TTQA 1TTPA 3EEGA 1W5QA 5G2HA 3B8DA 3IVUA 2GUUA 5F2MA 5K9DA 1C8VA 3W23A 1LBMA 2HSAA 4N6EA 4LWWA 1FDZA 1ONRA 3LGEA 4ZQMA 1U83A 1OYBA 4X2RA 4IJBA 2B4GA 1FCVA 3PULA 3T4CA 2C19A 2B7NA 2I9EA 1RVGA 1WDWA 3WK2A 1JCNA 3SY5A 3W87A 4IMEA 2YFOA 1DHPA 1KFEA 5C6MA 1P0NA 2E77A 3W85A 1KFJA 5AFDA 2FB2A 2C3ZA 3H54A 4H6KA 4YMZA 1GG0A 4IPJA 1FWSA 5GVJA 4FIQA 5BMWA 2C13A 5AHMA 3N2XA 1RPXA 1LLWA 4TMCA 2V30A 4WXYA 4OWGA 2WNQA 1XBYA 3W3OA 5D2XA 5D2VA 2QCHA 1KA9F 1JJKA 3ZWTA 4AXKA 4UR7A 1FWRA 2VELA 5I3HA 2Y89A 1YXDA 1L6YA 3GAYA 2V82A 4C1KA 3DKJA 2RDWA 3ABRA 4PL1A 3PB2A 3PBWA 4O15A 2Z0IA 2QJGA 1K3UA 3MBFA 5HWJA 4AWUA 5L6UA 3KRZA 1OABA 4M6QA 4X22A 3W7RA 4DF2A 3KRSA 3B04A 3BARA 1LBLA 1OYCA 2C18A 5F4XA 4O8RA 5FF3A 1O60A 3I7RA 2ZBTA 1LROA 1G7VA 2DU2A 3C4UA 1TPUA 4X3ZA 4E38A 5D2YA 2H3BA 1GTHA 2P10A 1GVSA 2AAMA 3W73A 2DP3A 3PBYA 2NXHA 3L66A 4NZJA 1XUZA 4A22A 3R8RA 1R2TA 2C0AA 3H55A 2NX3A 1QPRA 3W2NA 3UWVA 5KZEA 1OHLA 1XUUA 5TIMA 3RFAA 1Z41A 1QOPA 2P0OA 1VH7A 1L2UA 3N2MA 2H90A 4N9EA 1SO4A 5F4WA 3GDRA 5G1TA 1FBAA 3FFSA 3IIZA 1DQXA 1G69A 4HKPA 4MY9A 3OVPA 3C6CA 1KFKA 2GQ8A 2VFHA 3QFEA 5HMSA 4UFHA 3TQKA 3C2RA 2A7NA 1OX4B 3T44A 1X6UA 4HPXA 4R33A 1W0MA 3B03A 3C0JA 4UFKA 3W1NA 3C8FA 3TFCA 3EKLA 3DKLA 3NO5A 1BTMA 1SW7A 4M7TA 5AHFA 2TYSA 5CZTA 2VEIA 4IGHA 3A5VA 3M47A 3NR0A 1JCYA 3O6DA 1PIIA 2YW3A 4HSOA 2BTMA 3LTPA 2ALDA 3KXQA 4BWLA 3W7MA 5G4EA 1SQ7A 1VYRA 3CLMA 4JNMA 4H3DA 4QSHA 1OG0A 4MZ1A 1FDYA 4TR9A 1D3HA 4R34A 1TYGA 1LP6A 3G0SA 2NXGA 3CHVA 1R30A 3KX6A 1EWEA 1I8JA 2CZFA 5I3FA 3LI1A 3PVFA 4GRSA 3FYOA 4D2JA 3CTLA 3NZRA 3W7OA 3BK0A 4NNAA 3UXDA 3HG2A 2A7RA 3HG5A 3KRUA 2G5WA 4OQVA 4XTIA 4N4QA 1OJXA 1C9DA 1YPFA 2DZPA 1AW2A 3DFOA 3QRHA 3QMTA 4B5NA 3BG3A 3E49A 3HGSA 1O4UA 4ZQRA 4AB4A 4MYAA 2YPIA 1PS9A 1H7XA 1H5YA 1FCQA 1M7OA 1AMKA 2Q8LA 1H7PA 4MIMA 3MP5A 2J9XA 1W3NA 4N9BA 4OHQA 5KINA 4BWLC 4ZZ9A 1WOAA 4OE7A 1F6KA 3NZ1A 4YCPA 4IMDA 3I65A 1N8FA 2XN1A 3W74A 5CPOA 3THAA 4JY8A 2J6XA 5EMUA 2QR6A 2W79A 4O53A 3TA6A 4JX6A 1QO5A 4JN6A 4HNTA 4CQAA 2I14A 2BXVA 1GTEA 1MSSA 3LXBA 3P8JA 4LS0A 3LTSA 2V0TA 3TE9A 1KM5A 1QR7A 3UY7A 1LRQA 5LNWA 1K02A 1TV8A 1VRDA 3W72A 3PWAA 4GC4A 4MZYA 3O1NA 4DF1A 1TRIA 4WY0B 5K4ZA 2CLEA 2ZYFA 2VFFA 3OBKA 1GVOA 3F1QA 2Q3RA 2ZZ2A 1RV8A 2A5HA 4MLJA 1EIXA 4Y8FA 2DZXA 1F7BA 4FNQA 3Q94A 2GVGA 3NPXA 4U4MA 3TROA 1LOLA 1G67A 4JD4A 2OMAA 5DCBA 5HJLA 1PCWA 4LUJA 2VFEA 4OV9A 1VZWA 5D03A 3LM7A 1Q6QA 2C16A 1A5SA 3GDTA 3W76A 3O63A 3TR2A 3EXRA 1QPQA 1F73A 1VYSX 5DELA 1TPEA 1RZMA 2ZZ3A 3ABQA 5DY3A 5A8GA 5DY2A 1YXCA 3QC3A 3QSRA 3EWWA 1X1OA 5I3IA 5BOOA 5F2GA 2TPSA 3UD6A 3GR7A 4AAJA 3G0XA 2NX9A 1OX4A 2VXNA 2ZRZA 2ISVA 4PC8A 3W7LA 1F2JA 2ABAA 1ZY9A 2ZFAA 2BZNA 3FLUA 4UR8A 4GNJA 2FFCA 1FXPA 4O57A 2EHHA 2OT1A 1DVJA 4HIBA 2QJHA 4XZ9A 2GVLA 3MUXA 3W2LA 3JS3A 4L4MA 1O94A 3MHGA 3IVTA 3F4NA 3R2GA 5AHNA 1WAUA 1HTIA 2QCFA 4CLMA 1LZOA 4RCXA 3QJAA 2UV8G 5G4WA 1OFQA 1ICQA 4AMAA 2OCZA 1VJIA 3IGUA 2ZDRA 3R5EA 2QDGA 3S1VA 2JKAA 2E6FA 2NXIA 3CQ0A 3U2OA 4N02A 4CNNA 5EA9A 4EF9A 4K6AA 1VLWA 5EY5A 4UTKA 5AC6A 1KM6A 1XDLA 2R94A 3P84A 3UWUA 1UUOA 5HINA 3TQVA 4Y6GA 3M9YA 5EBUA 3WJXA 2GVJA 5HR7A 3GXPA 2A1YA 3G3DA 1QDSA 3EKZA 4M5PA 3G1DA 4NXSA 4BFAA 3W84A 3T55A 3C61A 4UNLA 3IEBA 2NX1A 3UWZA 5AHLA 2QUTA 3DBPA 3LHTA 3W7EA 4AWTA 2VEKA 3HB9A 4IPIA 1P4CA 3QH2A 3W1QA 3M44A 4GUJA 3KOFA 3NM3A 1B3OA 5E0KA 1VS1A 4I7WA 3M7WA 1MEHA 4DELA 5HUOA 4QJ1A 3NAVA 3G22A 3BLFA 1VCGA 3WK0A 1H7NA 4DPQA 5FI8A 3LI0A 2LLEA 5AOUA 1WQ5A 5KMYA 4IX2A 4MYXA 3DFTA 2J24A 3W22A 2EPHA 1FX6A 5F2LA 3GLCA 3DH7A 3NPWA 4P61A 3HG4A 2ZA1A 4RV8A 3MYOA 2O7QA 4CCDA 1P1XA 3PBVA 5HULA 4JXCA 3TJLA 1TIMA 4IXHA 5LHEA 4JIQA 1B9BA 1I4NA 4GUHA 2NUYA 2V9DA 1VHNA 4AEOA 1ML1A 3UWYA 1EP3A 4LVBA 3LERA 1ZNNA 1YTDA 2FPYA 4FF7A 3GDLA 1KM2A 5FEWA 4RZ4A 4CCEA 3PUOA 4UTHA 1V5XA 4O17A 1B4KA 1TPWA 1GVFA 2ZRWA 1ZALA 1PL9A 1SZFA 3PF3A 4Z0JA 5BNKA 1EA0A 4XBSA 3LLFA 4O16A 4QNEA 4JTLA 4JDYA 4RXFA 5F4SA 2QUUA 4ADSA 3W75A 4IWWA 1TTJA 1Q45A 1FWTA 1VC4A 2CFFA 1QPNA 5I3KA 1QMLA 2ISWA 2PE4A 2YYUA 3TQ0A 2CZDA 3W7KA 2WQPA 5CPMA 1YDNA 4JTKA 2IQTA 3P7YA 1IF2A 1OFEA 3ZWSA 5HR6A 2NUWA 3W70A 4LC6A 1UB3A 3LTYA 1HFBA 4K8EA 3TU9A 1ZAJA 3EB2A 4ZQOA 4YXGA 3KVKA 3LXCA 1MEIA 4E0CA 3NXFA 4AF0A 5IBXA 3W1UA 2NWRA 4GXMA 1TPVA 3UWWA 1FWWA 4Y96A 1ME9A 4WX2A 4JY9A 2JBMA 5AYXA 1ZCOA 2Y62A 5I3GA 1JCLA 3W7NA 4LV9A 2Y70A 1R2RA 3GNDA 4GJ1A 3SR7A 5AC7A 1LM1A 2B7QA 1OK4A 4WOQA 1UUMA 1NEYA 3NGJA 2FJKA 1QPOA 1H1ZA 1KFLA 3STFA 1W5MA 3N73A 4DO6A 2DZTA 5T26A 4EVZA 3BO9A 3N9SA 4Z0SA 5E93A 4H4IA 1F6PA 1XFBA 5HQEA 2GPTA 4JEQA 4PTNA 4UCGA 5CG7A 4FXSA 3SIZA 3N3MA 3QMRA 4NQ1A 3SGZA 4I9AA 4LW7A 4NJHA 3NVTA 1PHWA 2WSYA 3UNDA 3W7IA 3BV4A 3ELFA 1KM0A 1ZJIA 4NVTA 1ZHAA 2E6DA 4K37A 1TPC1 1JUBA 4UMBA 1M6JA 1K8YA 3AO0A 4NX5A 2W6RA 1FCBA 1G6CA 1Q3NA 1OYAA 3EWXA 2FB3A 4MY1A 4E2DA 1TPH1 4O50A 2E6AA 2CZ5A 4DO4A 5BRBA 2Z2UA 4JTUA 4NJGA 4TIMA 4GWEA 5K9XA 2E1DA 4JS3A 3TC6A 4Z08A 1MZHA 4O4VA 5CKSA 3P60A 3PY2A 2TSYA 2HTMA 1TV7A 4NJIA 3UQNA 3NQMA 4A3UA 3W1MA 3MW7A 3C3NA 4O12A 1AL7A 2FIQA 2CLKA 4FNPA 3JRKA 3EWZA 1JCMP 3O8AA 4K8HA 3MO7A 2YW4A 4CCCA 3MHUA 5TBOA 1ZAIA 2JKEA 5HWNA 3BW3A 1H51A 3CWOX 4RK8A 3IGSA 1LDCA 3QQ1A 1J5TA 4OU1A 1GZGA 2OJPA 2VENA 1VR6A 2QCNA 3T7VA 2ZZ6A 5D2TA 3EX4A 1W56A 3W83A 1YDVA 1B57A 4P2VA 4LRTA 1OFBA 4R7JA 4ZQCA 1OF6A 3W86A 2PURA 1TPDA 3EXSA 3OG3A 5LSMA 1W31A 3HF3A 5FEZA 1W37A 3R12A 1JRCA 5F1UA 1GYNA 3WK3A 4FIRA 3DI0A 3MHFA 4YLWA 1SZGA 5EKYA 4FX6M 4FEZA 4DO5A 3S5ZA 4WY0F 1VQTA 4BK9A 5J5DA 4O52A 3PC0A 4DQWA 5LNSA 1WBJA 2A2IA 1DL3A 4ICNA 4MJZA 3STGA 1MO0A 1FWNA 1SUXA 3SGUA 3O05A 3BW4A 3DAQA 3OIXA 4IX0A 1SZNA 2DZUA 1KLZA 1S5WA 1Q6LA 3IVSA 3QQ0A 1TRDA 3OHIA 1O5KA 3O16A 2J9ZA 5G2IA 3D0CA 3OA3A 3QF0A 1UASA 3G8EA 4QM1A 3BGGA 5DCDA 1K8ZA 1Z42A 2QUVA 1KM4A 3CEUA 4O1DA 1TSIA 1W8SA 4XKYA 1NSJA 2C15A 4EIVA 4FHAA 4QNWA 4FNUA 3CWNA 3HOJA 1TJPA 1SPQA 4XTDA 1TCDA 1KW1A 5BW6A 1A5AA 2I1OA 3MWAA 1T99A 5LHFA 3I7SA 5FESA 2ZA2A 1XBVA 3DENA 2PRLA 3L0KA 3TW6A 4Z1CA 4O54A 1UJPA 3STCA 2BWGA 2Q8ZA 2V2HA 3FKKA 3N34A 2C6QA 2QJIA 4QQ3A 4LY8A 2CLMA 3K30A 4A2RA 4DPPA 2XN2A 2YFNA 1G7UA 4IMGA 4GUGA 3EXTA 4UFMA 3LOTA 2WV8A 1LCOA 3NQ2A 1OF8A 2YGYA 3BGJA 3C52A 1L6WA 4FX7A 1M7PA 1O5XA 1A5CA 4XQ6A 4LU0A 1QFEA 2VC6A 4O0KA 4WQ6A 2PRMA 1VGAA 5G5IA 3NQCA 4EF8A 1WXJA 4LNYA 3OVRA 1F74A 2X16A 2Y7EA 3T78A 1P5BA 2ZA3A 3N19B 1S3HA
chains in the Genus database with same CATH superfamily
3VM5A 4DJEA 3EWYA 1P6CA 3E3HA 1ZJAA 1RBAA 3GC4A 3GYCA 3M41A 1WKYA 1X8FA 4HYVA 4GIYA 4C6QA 1C93A 4MWAE 4RR4A 3H6OA 1WDRA 2OYKA 5DANA 5E0CA 3UWQA 3M0IA 4RPQA 4K1GA 1V3LA 4QITA 3S5YA 3GH4A 4HTBA 4K39A 3SUTA 2PCQA 3E0IA 3RLHA 3C2EA 4EK7A 1JVNA 1D9EA 3P62A 2YDAA 2P88A 5C9ZA 3RX2A 1UMLA 1T0OA 5AC8A 2CLOA 1O1ZA 3VDGA 3PUGA 3QXBA 2PDLA 3SCWA 3LV5A 3OVQA 5TF0A 2ZKMX 1XH2A 4F2TA 2J88A 3E0LA 3M0LA 3WD0A 4A05A 2FZDA 4UTTA 2UBPC 3W2MA 3PZOA 5I24A 4XSMA 3PN8A 2GOKA 2XIBA 3SSJA 4AD0A 5BXPA 2ACSA 4W84A 1J2WA 5HBFA 5FOOA 3PJTA 3PUEA 3QR3A 3DG3A 3PM6A 3AICA 4XKYB 4BCEA 2J78A 3TXZA 3R4IA 3UZ5A 1E70M 2RDUA 1V6YA 4XBKA 4H04A 2Z6JA 4Z17A 3KBMA 3NL5A 4KRUA 3VKJA 3BCJA 4FR6A 1VB9A 4Q7IA 5G2WA 4ZMGA 5DXYA 4DM2A 3BANA 4PCNA 4W7VA 5D2WA 1FWDC 4EOUA 2RFGA 3SY8A 4ATWA 1W1A1 3S8HA 2Z2AA 5LNVA 5AB3A 2EGZA 4GYPA 3F4DA 2ZUMA 4J35A 4V28A 1CXHA 3GG1A 3VD7A 4KW2A 1J0YA 3H7RA 1Y0EA 3LLDA 4XAYA 1TA3A 3KVMA 3M0MA 3USZA 1ADOA 1DJZA 2YBUA 5AYZA 4U10A 3ZJ6A 2ZE3A 4B9ZA 3PR2A 4MM1A 1F3EA 2DH2A 3ARYA 1M7JA 3IIXA 3LHZA 3FN9A 4UNKA 3ARPA 2PLCA 3MDWA 4RKAA 5U4NA 4HU3A 4YPJA 4R7WA 3TAKA 2GJNA 4UTLA 6XIAA 3O6CA 1RK5A 3BMXA 3G8RA 1JNEA 1V3KA 3GVVA 2XGZA 1GCYA 3CMJA 5GJPA 3KZPA 3CPGA 2DZWA 2VX4A 2PDIA 2VD9A 3G24A 4I6KA 1WUFA 4MDPA 4PMRA 3WQFA 1TQXA 3KS6A 1UHVA 4ZQPA 3UF9A 3HO8A 1J01A 1LRNA 4O1CA 1PV8A 3AJ7A 5AZ1A 4PRRA 2J7HA 4PCFA 1VBRA 1I2NA 1K7FA 5FJJA 2GJPA 2WCSA 4ZA0A 1CXKA 4LYKA 1R8LA 1VLIA 2DUAA 2BOGX 1BYCA 3LCIA 1DTNA 4IIGA 4GG9A 4GYPC 3RLGA 1HJQA 3QPYA 4RV3A 4ORMA 3KBVA 4P5UA 4BF9A 4HA1A 4PL2A 3QPZA 4IP7A 3D46A 3GDKA 1NOFA 4F66A 4QS6A 3UXLA 3KEHA 2B7PA 3RCYA 2I16A 1CGUA 5CZ0A 1K7EA 3VE9A 4H6QA 5A8NA 3DHFA 2QCMA 1G4PA 5G1YA 4POCA 2A6LA 3MA8A 1LBFA 1H7RA 1V6UA 1EUAA 4G1NA 3VOIA 4J7RA 2GUYA 4Z1BA 5CBIA 2OEJA 1A0EA 3F4VA 4LFYA 3HBLA 4CVUA 4E4UA 4EXBA 3SI9A 1QJWA 4LUSB 4FALA 2FQIA 1TZZA 4PMVA 1YPXA 4LSBA 3MBDA 3M6YA 3P2VA 3A4JA 1OB0A 4WLCA 2RUSA 3NDYA 4QROA 2A0NA 2QIWA 5TQLA 4PTVA 3W7HA 3KTSA 1UP0A 4B5XA 2WNZA 1I2PA 2FTPA 3POHA 1HO1A 1EP1A 2BV9A 4LAZA 4HK6A 5KSWA 2PUZA 2WZEA 2PGWA 1YQ2A 2JIEA 3NQGA 4LUSA 3QHNA 1E15A 4GOAA 3LHVA 5D32A 3F03K 3PTQA 1UPPA 2WZHA 2DQXA 4GXWA 1GUVA 3SECA 3CIWA 2PZNA 2ZTJA 1AQMA 4QIUA 1E0TA 2C1HA 2CERA 3MYPA 4Y7EA 4B5WA 3G1AA 3M0HA 3W7PA 1UOZA 3Q67A 2EO7A 3KOZA 1IZCA 3CL6A 3MMWA 3OEXA 2ANUA 4C6PA 3WQPA 4ALDA 4OOZA 4MUPA 3GNPA 4LCSA 5FJPA 1A5LC 3FJ6A 2DVUA 2HE5A 3W71A 3TYEA 3EB3A 1H60A 3BC9A 3P8IA 1CGWA 4J4KA 2GDUA 4ORIA 1JL8A 4M7SA 1B2YA 3KDNA 1ITQA 4XV0A 4G56A 2Q6ZA 5C55A 4OBTA 2G96A 3VTRA 4Q4MA 1SVDA 5D02A 1OC5A 2VI0A 4MADA 1ONXA 4AY1A 5CPNA 4EX4A 1UD8A 2VWSA 2D2OA 4YTUA 2JGYA 2QKFA 2OSXA 2F9RA 1P0KA 3EMZA 1HQTA 3FJNA 3KCLA 3PSVA 3FHAA 4I5XA 1IZJA 3TSMA 5JH1A 3NL6A 1CGXA 3U7BA 3E12A 3LRKA 1IEQA 3A4XA 1W1PA 4JHOA 4H6RA 1ME7A 3OBAA 4TXEA 2PDNA 4JDBA 3MP4A 1XLAA 1TV5A 1OCQA 4PN2A 1L8PA 1XX1A 2VX6A 3N04A 3BJTA 1VEPA 3P80A 3WNLA 1R86A 1UR0A 5LZLA 1AA1B 3SZ8A 1CW2A 4HNUA 1M53A 2QCLA 3TTEA 5EMKA 3UJRA 2ZVIA 1W3KA 5I23A 4K7YA 4YNGA 1XV8A 3DBNA 4HNOA 3FYPA 4GE8A 1GG1A 3NQVA 1YPIA 4GKTA 1XIIA 4LTSA 5JVLA 3WDQA 1UWSA 4WXZA 5A6KA 1R5YA 4AHQA 3M5XA 4INFA 1TTIA 4MOZA 1YYAA 5F1VA 4JN7A 1K4HA 4QQUA 2EG8A 3GTHA 3AOFA 1IXOA 1X6NA 1UWRA 4XZBA 4JTCA 1D3CA 1Z44A 3QLLA 3ARWA 4AFYA 5FF7A 3TX9A 2H3DA 3SCPA 1K70A 2O4MA 1B5TA 4H9YA 1JULA 1REQA 1LJYA 3KRBA 1V7AA 1EXPA 3IGXA 2XIQA 2ACUA 1ZAHA 3CZEA 3O3RA 4IJCA 3G1RA 1O12A 4AVOA 4AVFA 4HZ8A 2PDWA 4R27A 2BVYA 4Y90A 1R3TA 1CCWB 3WLPA 3GHUA 4H6EA 4HCDA 3EDDA 3RU6A 3L0NA 3U0HA 3ABOA 1GYLA 1UKTA 3UY8A 4D1JA 2QV5A 2G4FA 4W89A 3ALGA 2CIPA 3F2DA 1V3IA 4D9PA 4TVUA 2ZCGA 4PFHA 2CLFA 1R3WA 3EA3A 2OFJA 3EPOA 1RJRA 3ZR6A 4NY2A 2V81A 4L4PA 3TJIA 4L61A 3GVGA 2JALA 4TTGA 4OBSA 3KAOA 4QXIA 1T96A 4GISA 4E4FA 2XIOA 3R89A 2FGBA 1WOBA 5CPLA 3G1HA 2CHRA 1S2VA 2J75A 3WH7A 2E67A 5MHBA 1NJJA 4GI4A 1H62A 3KLLA 4MWAC 3GZAA 5CG0A 8CGTA 3DX5A 3RHGA 1PJ9A 3GDBA 3MI6A 4NYYA 2XHYA 3WKZA 3QY8A 1EHNA 3ES7A 1XYZA 1TO3A 1UG6A 1GOKA 2BY3A 4HK7A 1LLZA 3PZUA 1YNPA 4QISA 1PDZA 2OYLA 3TXVA 2GJXB 2WKGA 2Y1HA 3MKVA 4FPSA 1R47A 1HF6A 1AUSL 3THQA 4DF0A 2VCBA 1OM0A 3OOQA 3T4WA 1EDTA 2ZVRA 4IQEA 5BRPA 4ADUA 2VEPA 3U8GA 3L5MA 4GYFA 3JUGA 4MMWA 4WJEA 1JDEA 3G0UA 2PD9A 4OV4A 2Q3OA 1A5BA 1ESWA 1JRBA 3B0VC 1S38A 4CKQA 1MYRA 2BGQA 1B9ZA 2YCEA 3PJWA 5FJTA 4IQJA 2I56A 4RZBA 4TQTA 2HWGA 1RQEA 3S5SA 4L80A 4DI8A 3PAJA 4GBUA 1E9IA 1LRTA 4JTHA 4AW7A 1QI2A 1XIBA 5FA5A 3QW3A 5GNZA 2X42A 3H2EA 1XH0A 3NVDA 3S6DA 2YR1A 4HPNA 4I9MA 3PK7A 2TRSA 3ORWA 3E2RA 1PPIA 3H7VA 4FAMA 4RZ6A 4MJ4A 4E5TA 3NA8A 3OZMA 1D7KA 3IJLA 2CWNA 3MY9A 1GT8A 3I4EA 2W0UA 4DAFA 2E8YA 4EWND 4XAGA 1TPB1 1RAKA 2HRWA 1NFGA 6ALDA 3WDRA 4UOZA 3HGOA 3H2FA 5HAOA 1PHQA 2B0MA 1XBZA 4QG9A 4Z2GA 1E51A 4XD3A 4B2DA 1SJCA 4M51A 3GR8A 2CHNA 4O10A 4IFRA 1PIGA 1F76A 1VYPX 3HPXA 1H63A 2BVDA 5CPSA 1CTNA 3GFZA 4TV6A 3TCSA 3DI1A 1G4TA 3HPZA 4I9TA 1LT8A 2PDMA 4YTQA 2A3LA 4JL2A 4WR3A 1FWEC 3CHFA 1OT1A 2NV1A 5HNTA 2JK2A 1IIGA 4PA8A 5BMXA 3GIQA 4UR9A 3MUY1 3W88A 4PBEA 3M0ZA 5D9OA 4NNBA 3LENA 1PKYA 4IPLA 5E09A 1RQHA 3HV8A 3S1UA 3TIMA 4LVGA 4DWSB 1ICSA 5I3JA 3B06A 4BHYA 3WJWA 4LC8A 1GQKA 4N2YA 1V02A 2Y63A 5D05A 4BI7A 3K8MA 3TCEA 2HVOA 4MB3A 3LS9A 4Q32A 1I2QA 2X0HA 4H83A 1OINA 3MU7A 4AEEA 3N1AA 1JPKA 2BFGA 2Z7GA 2NUXA 3UPBA 2QDEA 3XIMA 1WUEA 1FH9A 2B81A 1TWDA 1A4MA 3FIGA 4ONVA 4IFKA 3CUJA 5CC6A 3BAYA 1L6SA 1DKWA 2HVMA 3VGGA 5CEWA 1GJPA 4YN5A 4L6HA 4O18A 1SU5A 4JIRA 4XZLX 3JW7A 2GOUA 3MUCA 2XFWA 3S47A 5K4XA 1A49A 1TTQA 4WSHA 5HJYA 4JIEA 3EEGA 5I7GA 2GUUA 1ISVA 5K9DA 1NTHA 4QHRA 4C7GA 4OKDA 2DFAA 2HSAA 1V51A 4NIRA 1FDZA 3LGEA 1KXHA 2OO0A 1UD5A 3U5UA 1OYBA 2GGJA 4X2RA 2XH7A 2B4GA 4YYFA 1PYMA 1V77A 1RVGA 4KMQA 1RLCL 4JZ5A 1JCNA 4IL2A 2NT0A 3SY5A 4IMEA 3GBEA 2WZTA 1RP9A 4F4RA 2YFOA 5DMMA 3KZSA 4IPPA 4PSRA 1KFJA 4H6KA 4KRZA 2V5CA 2WZMA 4PMOA 2CCRA 1LLWA 2R1NA 3OBEA 5D8ZA 2PD5A 3P3BA 5D2VA 3HA1A 5KZ6A 2ZUUA 1KA9F 1UWQA 1MFUA 3ITGA 4KF1A 5I3HA 3ZVHB 3AMDA 2X05A 2Y89A 3GAYA 2W92A 4C1KA 2QQ6A 1IWAA 5DRIA 3M07A 4WJXA 4PL1A 3PB2A 3KM8A 2YCJA 1XKJA 3N6QA 2I9UA 3H2OA 5E9AA 1R7AA 4W8LA 3H70A 2Z0IA 1K3UA 3MBFA 1UR8A 3URBA 2GDVA 4LAOA 4FLRA 1KO0A 4AWUA 1L8NA 5L6UA 3KRZA 1OABA 4M6QA 2F8QA 3KRSA 4KWUA 5BZAA 1ZBKA 2P5NA 4AZCA 3U9IA 4HU8A 3TW9A 2CESA 2FDMA 3KBNA 1O60A 4Y9MA 3W27A 4Y9PA 4RW3A 1E5JA 4W93A 4Q8UA 1LROA 4C6DA 4UOQA 1TPUA 4C6OA 5TNVA 3TZNA 4E38A 5D2YA 2PSNA 2WSPA 4MNKA 1NP0A 5FKYA 1RHCA 3GR4A 2P10A 2AAMA 5DRCA 4BQ3A 3PBYA 2NXHA 4NZJA 1XUZA 4A22A 2J47A 4F0HA 4QE4A 2VQTA 2NX3A 3EDJA 1QPRA 3M7SA 1ZZMA 2BVWA 5KZEA 1XUUA 4RNJA 2P0OA 1VH7A 2QT3A 3N2MA 2WMIA 4N9EA 4WK9A 5A8PA 3GDRA 4RDWA 3OHMB 4M8UA 1G69A 1XICA 4HKPA 3WX7A 3UBPC 3V5OA 2GQ8A 3BQ6A 3WLNA 4A8LA 5C9RA 3T44A 1TJ0A 2A7NA 2EG6A 4R33A 5FJUA 1CLXA 1W0MA 3B03A 3W1NA 1TIWA 3TFCA 1V79A 1PO9A 2VM8A 4M7TA 2YZ5A 3CS2A 2TYSA 5CZTA 1VP5A 4JNYA 2AL2B 2D0FA 5C70A 2DT1A 1JCYA 5A6LA 4J5NA 2PFHA 1PIIA 2YW3A 4ZO6A 4NKCA 3LTPA 4C6LA 1XLHA 1TZ9A 3CLMA 2BOEX 1E5NA 1OG0A 4MWAA 4TR9A 1XD1A 2VCCA 1LP6A 3AIBA 1Q66A 2WVVB 3PBMA 2BS9A 2NXGA 3CHVA 5T91A 3FDGA 2DIKA 4HYRA 3IUHA 2A7RA 3UA4A 3KRUA 3GU9A 3ITLA 4B90A 2PA6A 1UW9A 3H2CA 3PPFA 9XIMA 1XDJA 2QNEA 4B5NA 1IGWA 3BG3A 4C5ZA 1BXCA 4K8GA 4ZOEA 1PS9A 4XSLA 4EPDC 1H7XA 1H7PA 3C2YA 3MP5A 4DXXA 4OHQA 5BXSA 8XIAA 1PX4A 4A4AA 4OE7A 1F6KA 4YCPA 2OB3A 3I65A 4R9XA 1NY1A 3CB3A 1J6OA 3ZM8A 2OSYA 4F0KA 2QR6A 2E4TA 1WAWA 1FWIC 2BXVA 1GTEA 5A69A 4GFIA 4LS0A 2XVKA 3WQGA 1JCTA 5LNWA 1GQLA 3VKDA 2VZUA 1Q13A 1POKA 3WEMA 1W1VA 2PDBA 2QXWA 3WF2A 4I6VA 1LQAA 1XR2A 7REQB 1F7BA 3VCNA 2QGYA 1U22A 3MO4A 1BGAA 4CU6A 3LM7A 1Q6QA 4TX6A 3WNNA 7CGTA 1A5SA 3ID7A 1AFSA 1F8MA 1JAKA 3TR2A 3OB8A 1I60A 2EPOA 1M04A 2CEQA 2PGEA 4YIWA 2TAAA 4KQNA 3QC3A 1TX0A 4Y9OA 1X1OA 1HNYA 2WKLA 4NZ5A 3UCDA 4AAJA 3G0XA 1KQZA 4ICMA 2VXNA 2ABAA 1HVXA 3TYDA 3ARQA 3OPSA 3LMZA 3RILA 2BZNA 3FLUA 2EHHA 2OT1A 4C60A 4DHGA 2VGBA 2GVLA 2P76A 3AYRA 1ZBVA 1S2TA 3UERA 3F4NA 4EPEC 2R1KA 5AHNA 1WAUA 2QIIA 4RCXA 2UV8G 5G4WA 4AMAA 2OCZA 4KGJA 4Z1YA 4UQEA 3IGUA 3H4WA 1JFXA 4PMUA 1R87A 1VENA 3U2OA 2Y5EA 4CNNA 1J10A 1VLWA 5EY5A 5AC6A 2R94A 3UWUA 3K4WA 4OUIA 5M5DA 4Y6GA 3DYMA 3BXWA 2WMGA 2G4JA 2PDJA 1CGTA 4M5PA 3WN6A 1YHTA 3IEBA 2NX1A 3UWZA 4NASA 5AHLA 1UIPA 3THCA 4ZFMA 5HNNA 2UY5A 2QUTA 3DBPA 2OSWA 2XVGA 1T6MA 1M03A 3HFYA 1P6WA 4AWTA 2VEKA 5EFFA 3HB9A 1P4CA 2BHZA 2ZADA 3T07A 3NM3A 5REQA 5LIYX 1VS1A 2SFPA 4DVOA 1Z7AA 1JZ6A 2XVPA 2OELA 4ZODA 3SCOA 3MWCA 4C1NA 2CC0A 1E40A 2PU1A 4GY7A 1E0VA 1ZLPA 3A12A 1DIKA 2IW0A 3BAIA 3LI0A 2LLEA 5AOUA 4KWSA 5ABFA 2G3JA 1LF1A 1XYMA 4UB9A 3WD3A 2ZA1A 2O7QA 1ECQA 3KP1A 4JCMA 2GVYA 2CKRA 2J6VA 1TIMA 4HMDA 1OZQA 4IXHA 3T2QA 5AY7A 3BLLA 2HQAA 1JXKA 1PTGA 3NJ3A 1VHNA 4KCWA 3GXMA 1ML1A 4NZ1A 4MB4A 2QHAA 3AISA 4LVBA 1TA3B 1ZNNA 1YTDA 3N17A 3LMYA 1F61A 4O17A 3KWXA 1B4KA 1PL9A 1TVLA 2PGFA 1DXFA 4XBSA 2DH3A 4BF5A 3H21A 4O16A 4JTLA 3MUAA 2QUUA 2PTZA 4MGGA 3F2CA 1FWTA 5IRPA 1VC4A 3PP7A 1DQUA 1QMLA 2ISWA 1TG7A 1UA3A 3B40A 2YYUA 1HKIA 1EJTC 3AXKA 3ZWSA 1GYMA 5GJMA 1JPDX 2NUWA 1MVYA 2OX4A 4QCFA 5BXRA 3GTNA 3TU9A 4ZQOA 5IXEA 3VZYA 3OZOA 3LXCA 1PKNA 5IBXA 1NWRA 4GXMA 2ZX7A 1FWWA 2IUZA 2PDUA 1ME9A 4WX2A 1MQRA 5PTDA 2VURA 4B4FA 3W01A 3W7NA 4KEMA 4LV9A 4C7FA 5H8MA 4GJ1A 1KCKA 3T9PA 1Q7MA 4J2PA 1LM1A 2FMNA 1UZ1A 1W9PA 2FJKA 3HFTA 1H1ZA 1KFLA 3SRHA 3STFA 4DO6A 1KR1A 3TP4A 1XG3A 2YLAA 4I8YA 4H4IA 1F6PA 1XFBA 3EOLA 4PTNA 4UCGA 4IF2A 3N3MA 3QMRA 3UA3A 1E6QM 4LW7A 5XINA 2EQDA 4JL1A 5H6HA 1TE6A 2IKJA 5HXMA 1HKWA 2WBKA 3W7IA 1ZU8A 2XVLA 3BV4A 1K8CA 3D6NA 2H9AB 3PZ9A 4QP0A 4NVTA 5LA0A 1Z9AA 1PZ2A 2W6RA 1HZYA 4LGXA 1OYAA 1ZJBA 3N4FA 4E2DA 1ZP3A 2CZ5A 5D8WA 4DO4A 2Z2UA 3GIPA 4GWEA 5K9XA 1UIOA 2E1DA 3TC6A 4Z08A 1KGUA 4HHHA 5LIXX 4O4VA 4L5ZA 2XM2A 1YEYA 4NJIA 2QJJA 3UQNA 3C3NA 1AL7A 4O1FA 2CLKA 4FNPA 3WQCA 3EWZA 5C71A 1Q8AA 4LF1A 1RXOB 5ECVA 3BOXA 1PB0A 1WKEA 1H51A 3QTGA 3H7UA 2QLYA 2C1IA 3WLMA 4L56A 2VENA 1TVPA 4JKLA 3T7VA 2E9BA 3WZ0E 5JU6A 2D20A 2JIWA 3EX4A 1W56A 1ISXA 2XZ7A 4UQCA 3L2MA 2R24A 4HMCA 4GBDA 1X6LA 1OFBA 3AYVA 4GX9A 4R7JA 1OF6A 3SUWA 3BH4A 1TPDA 8A3HA 3ARTA 3F5LA 1W37A 3R12A 3SIMA 1MNZA 4B9YA 3E0VA 4PUMA 1K9DA 4KETA 4C6BA 1UQYA 3MCNA 1Q8JA 1VQTA 2VRKA 4AY7A 4BK9A 2GL5A 1JPHA 1TJ1A 4DQWA 1WBJA 1TE1A 5CSUA 1MUCA 3DDMA 3STGA 5IOBA 3SGUA 3RR1A 4L6OA 3BW4A 1QPKA 1FFQA 3DAQA 3R8GA 1P7TB 3GSMA 5CC7A 4FS9A 2MNRA 1GHRA 3FA3A 2J9ZA 3O16A 3OA3A 4QM1A 3BGGA 1J0JA 1KRCC 1KM4A 2ALRA 3CEUA 4CD7A 4XKYA 2BG5A 4FMVA 4EIVA 4FHAA 1RALA 1AZ1A 4PUWA 4XO6A 1OWQA 3HOJA 1HP4A 3ITCA 3UG3A 4EAMA 5LHFA 4D8ZA 2ZA2A 3CXOA 1UPMB 3TW6A 1BRLA 1JI2A 3STCA 2BWGA 2OZTA 4DPPA 3PPCA 1G7UA 4GUGA 1MUWA 3NQ2A 1LUCB 4FX7A 3NSXA 3NWRA 3FJ4A 2GZXA 4O0KA 3TYAA 1CENA 3NQCA 4EF8A 1QNPA 3OVRA 3P0WA 3B8IA 3RUBL 2ZA3A 4AC7C 4Q4QA 3R0DA 2OVLA 2YDQA 4S3GA 4S3EA 2CW6A 1CGYA 2Z25A 5DT7A 3A6OA 1JIBA 1W1YA 2BB0A 1DWGM 3LGDA 4GC3A 3L67A 2PDKA 3HQ1A 2FHFA 3PSWA 2UY4A 2BGNE 5K9CA 2E25A 4AU0A 4NJJA 5HNUA 4WZHA 4JX4A 3TUUA 3GNRA 2OGJA 4BI5A 1V3HA 3ERPA 1DYSA 2WVUA 4DO7A 3U4FA 1W3TA 4UTWC 1OG6A 4UTWA 4ZFCA 2CBUA 5A6SA 2GJRA 1G4EA 4UZUA 1PDYA 2BY0A 4LQ1A 4CD8A 4JHZA 3W2UA 4K36A 3BCFA 1G01A 2ONEA 4DWSA 3AIWA 3PB0A 1RUSA 3WL0A 3UXKA 3P5YA 1SO3A 2WCGA 1VFHA 4QG6A 2QCGA 3H2MA 2ODOA 1G94A 1DWHM 3EEZA 3NQ8A 4NU7A 2QCCA 2R1MA 1M3UA 1AH0A 4BF7A 2QEZA 3PZTA 3XINA 3M16A 3S2JA 1NWSA 2QPUA 5KZDA 8TIMA 4ZOBA 3CV7A 1X7FA 3N14A 3EPNA 4UQDA 2E5CA 4H7ZA 6TIMA 3LCWA 5M2FX 4FO4A 1PZ0A 4MKVA 3DXIA 5EL1A 4HT3A 4M24A 2CPUA 3B9AA 3VM7A 2PTWA 3USBA 2CZVA 2PP3A 1IEIA 1BG4A 1GKQA 3NEHA 3MMUA 4M19A 3CHDA 3MMTA 1WA3A 3LRMA 2QDHA 2NT1A 3PAOA 2C91A 3CO8A 1X7IA 4I8DA 2GK1B 1XCFA 4Q4KA 4HZ7A 4HGXA 3WDJA 2GQ9A 3B4UA 1A5MC 1B30A 4B2DD 5I2UA 3UR2A 4B5SA 1KBIA 3MB9A 4HA3A 4NRRA 1Q2SA 3ITVA 1SZEA 2VDIA 5I78A 5FACA 4AD2A 1M68A 2VC9A 5HOSA 3TWAA 1PAMA 2WHKA 3PFMA 6REQA 1OFAA 2ATSA 3PUDA 4O0ZA 4DXKA 2G95A 3E1F1 1IEWA 4UBPC 1SM9A 1Y5VA 3OO2A 2R1LA 5C9XA 1NARA 3LBMA 4DY1A 4AD4A 1G9HA 2X8RA 1YTEA 2ZUTA 1LG1A 1XLCA 1S5VA 1QI5A 4ECLA 1RA0A 1EX1A 3UR8A 4S3AA 1OK6A 3TSBA 3SURA 2H8ZA 3ES8A 4WIWA 1W2VA 2WM1A 4DAIA 3LCHA 1Q4NX 1I9CB 1XF0A 4LH8A 1UKPA 1DJWA 4HN4A 1YXYA 4QDPA 2QS8A 2WWDA 1CX9A 4HZ6A 4YVVA 2OOFA 1W9BM 3CC1A 3GXIA 1A50A 5LGZA 4N0RA 1EUNA 2XPKA 5DCEA 5FEPA 2UY2A 1S2UA 4EKJA 3O06A 1QI4A 1GKRA 2YOCA 3OGVA 1X38A 2PWUA 1P1MA 3WQVA 3FYYA 2NZLA 5AYYA 1S2AA 4M3PA 3W7CA 3ZOAA 3NZQA 4I7VA 5DXXA 1DORA 4XUGA 3UG5A 5CC3A 4WKAA 1GK8A 4DIAA 3QHOA 4GGBA 4JTJA 3L4YA 5K7JA 1Q6FA 4LB4A 1JDCA 4ROQA 2J27A 1A53A 2Y85A 2HVNA 1K9FA 5EYWA 1VPQA 1Y7VA 2VOMA 3WLSA 3EMCA 3GU1A 3KHDA 3TK7A 3ABXA 3SCSA 2IKGA 1TUXA 4AWSA 4UMAA 1KXQA 3T40A 1TV2A 4GUIA 4CNPA 4QAIA 1MEWA 2G0WA 2W9MA 4HPJA 1IIHA 3AJXA 3CTTA 3CLWA 2Q01A 5EPDA 3A24A 2AGTA 3MTWA 3DHDA 1F3WA 1OFOA 3PBUA 1CXEA 2YXOA 2PWHA 4Q22A 4IQLA 5C2XA 3W29A 3FGCB 4B5VA 3BAJA 3TNOA 3AU2A 3BVJA 3L65A 2G50A 5LNRA 3I10A 2WJZA 4NZFA 1BQCA 1AQ0A 3B05A 1ISYA 1EPXA 3UCCA 4RUBA 3ZJ7A 1JZ7A 3KBSA 3W6MA 3U5YA 3EDFA 4RLIA 4DJDD 2J7CA 3ME3A 1B4EA 4L9ZA 2PGRA 1NH6A 4UQ9A 1WB0A 4G7EA 3T8QA 3OYZA 4N42A 1DEDA 1UH4A 2INEA 4CQDA 4Q8MA 3LBCA 4AIUA 1UUQA 1EX5A 2FTYA 4RL3A 1KFBA 4KWVA 3EOEA 3W37A 5EMLA 3CIVA 5BU9A 5H2ZA 1H61A 2NV9A 3TLLA 5JMUA 4S3FA 1QATA 1JZ2A 3E5PA 5CZSA 2G97A 1H41A 1ECEA 3W24A 7TIMA 1P6BA 1DHKA 3SCVA 4C1NB 4LVAA 4S1FA 3DGRA 3S46A 3VD9A 1VRXA 4MPQA 4GA8A 3MI3A 1NDWA 2VFIA 1XC4A 3IJDA 3TN6A 1NU5A 1XIGA 3NGFA 4IGSA 2W62A 2O0TA 3KCOA 1AZ2A 2A3CA 2VP8A 3SCTA 4FXRA 4Z2JA 3TAOA 3QZEA 1LOSA 1PTAA 4Q8QA 2E40A 1I1WA 4RNIA 2ZZ4A 3CV1A 4IZGA 1MWOA 3GZ3A 5IDZA 4HNNA 4LT9A 2G3IA 4L1GA 1GVQA 2CHOA 4WDWA 5C54A 1TWIA 2Y5SA 2GGHA 2D2GA 3UYCA 4NXKA 2C14A 2OWWA 1DJXA 2WCAA 2ZC1A 3IARA 3LEPA 5HNRA 4V27A 3B0UX 2XINA 1L6GA 2PAJA 1DJIA 2ZOXA 2A7PA 1EF2A 4CU7A 2VEGA 5E6YA 3ZYZA 1S1PA 4L64A 4DEFA 4RDZA 1E3XA 3G1YA 3SFKA 4DUWA 5IM51 4L1WA 4CNUA 4DRSA 1QBBA 1OVDA 1PX3A 4PUKA 1ZQ5A 2QCDA 4YL2A 4WDUA 4JICA 1Q6CA 1MDLA 1FHDA 3DGBA 2X1RA 3CT7A 5CSYA 1V7YA 2E1WA 1S5TA 5CPTA 4PTMA 3ZT6A 4AZ6A 1ZJHA 3FHQA 1EGVA 4A3YA 3VCCA 4Z1AA 2DZBA 2OGYA 3AS0A 1EEPA 4ZVJA 3LHYA 1EL3A 3P0XA 2CLPA 1O5QA 4NSBA 3CQIA 3KBJA 3MSRA 2PB1A 3GDMA 1M5WA 2Y88A 3WUFA 1PX8A 2OZ8A 2Z1SA 3RM4A 1QVBA 5FIPA 1M7XA 2YL9A 4X61A 4AD5A 3GTXA 4GH3A 3VIGA 4QLLA 6CGTA 3W1XA 4BZYA 4JNZA 1MW2A 5JBFA 2X09A 1FKWA 2R6OA 4TMBA 2FGZA 1J2BA 2NQZA 4L1XA 3R43A 3NOYA 2WVTA 3QKEA 1LORA 4MSSA 1KC7A 3GHTA 3KLKA 3BMVA 4GJIA 4HSNA 3PG9A 5FL1A 4Q8PA 4IUOA 3T2PA 1BKSA 5KEZA 1H5VA 3EWDA 2YDRA 1B31A 1QI0A 3G3MA 3NQDA 4S38A 3M5VA 9CGTA 1G1YA 4A29A 1RK6A 3PWIA 4HQVA 4US5D 4FNRA 4MVAA 2DVTA 2YB1A 3TTYA 3AC0A 2V3GA 5D04C 2QUNA 3SADA 3TKFA 1OGGA 4IIBA 3JZEA 4OT7A 5M03A 1VKFA 3B0PA 3BTNA 3BLPX 2A6NA 4HU4A 4GUFA 4O8AA 5A8QA 3OODA 5CQ1A 2NV2A 3DU0A 1CI1A 3WJSA 7XIMA 1HGWA 5HATA 4LANA 2GJLA 1GVYA 2VD8A 3MVTA 1O66A 1W9VA 4MFDA 2ZZ1A 2OQLA 1V0LA 1BXBA 2VTFA 1JR1A 4JIPA 3MCOA 2XFRA 5D33A 3NNTA 3RRAA 3IIVA 1UA7A 1JD9A 4FX8A 1KTNA 3FS2A 4H8NA 2VWTA 1JZ5A 3QV7A 5ABGA 1TPFA 3RIKA 3A47A 2BVTA 1I45A 4PULA 5FF4A 3ZFHA 4Z2HA 1XPGA 3LBOA 2YA0A 1T41A 1XWYA 3QEZA 4DBDA 3MJYA 4JTSA 4C6EA 4YCOA 3W7QA 1PYFA 2ZRYA 3WK1A 1AW1A 4S3KA 1HKJA 2VCAA 2O9RA 4XBJA 4JX5A 1OCBA 3DFSA 3TW7A 1SMAA 2V5BA 1VIWA 1ODUA 4AD3A 1FP9A 4EP8C 3VKCA 3RITA 2WHLA 1SZRA 4W87A 4S39A 3IK2A 1I6NA 4IIEA 1SR0A 2D3NA 3VFLA 4LBUA 3V7PA 2NQ9A 3EWUA 5C9UA 4ZE4A 1T7LA 5JH2A 3DUGA 3CH0A 4FLSA 3RLUA 1SSDA 1XRFA 1WV2A 3LHWA 1UZHA 2B31A 1L9WA 3MKKA 6A3HA 2FLIA 1QU4A 3LG3A 3ZSSA 1KV5A 2GWGA 3BQ5A 4DXVA 3S42A 2YXGA 2PWFA 1KTBA 4XZWA 1TUFA 3ZVHA 4PR4A 1OX5A 5CXPA 1O6IA 5AHEA 1TELA 1TKKA 3WNPA 3P5ZA 1UZDA 3DFHA 1O5RA 4GI6A 3LHUA 2Y8UA 1MFVA 3GY1A 1LG2A 1GOXA 4PB5A 3HZ3A 3OZYA 4M6PA 4FNTA 2QCDB 1JCJA 3HMJG 3U6WA 1WZAA 3Q4DA 4QEHA 1LL6A 2VFGA 2Z1BA 4JQ1A 2WKJA 4C91A 3BOFA 4LUTB 1UOKA 4JHMA 2OO6A 3HMCA 1GEQA 3O9NA 3LN3A 3PZGA 3W1LA 1D2KA 1K03A 2GSHA 1KCZA 3CQKA 2X2GA 2RH9A 1C91A 1QHZA 1BPLB 3EBVA 3O6YX 2XUCA 4BA0A 5IBXC 1H49A 4NI8A 3K13A 1HO4A 4GJJA 4CN4A 1H2JA 2I5IA 3KL0A 3N6HA 2ZRUA 1KRAC 5HANA 8RUCA 1OD8A 4S3JA 2BXZA 1WX0A 4PRTA 2ZTKA 1GGOA 4GQQA 4PGLA 3T05A 2EF9A 4KKXA 2OQHA 3VI2A 5CZJA 2X1SA 1XRSA 3HTWA 4IMAA 3ARUA 3WMBA 2E9MA 2Z26A 5EMYA 1E4NA 1MXDA 3NG3A 2KZHA 4J40A 1DJQA 1AH3A 3GUWA 1WZKA 2F7FA 3OQ8A 4LRSA 4RE0A 3RJXA 3WUEA 4KWWA 1EB3A 3WNKA 3G6LA 1S1RA 3UJFA 1XCWA 1QI3A 3ZZ1A 4LEFA 3LCFA 3K4AA 1ISWA 1WYIA 4DUVA 3PPHA 4GIAA 2V2CA 4V33A 3A4AA 3QPEA 1VCVA 2FH6A 1P43A 4JFSA 3NEVA 2HS6A 2ZZ5A 3P67A 4MJMA 5LNUA 3M1ZA 4UTTC 2YYTA 2DIEA 3C86A 1B0IA 1J0IA 3IJ7A 1TTPA 5DO8A 1W5QA 3NIYA 4QS5A 3STPA 3GBDA 4E2OA 2QW5A 3RJYA 1NELA 5AC5A 1ONRA 2XM1A 4ZQMA 1DP0A 2PBOA 1U83A 2Z7KA 1FCVA 3ZMRA 2C19A 3VIHA 2B7NA 2VDHA 1H0GA 2AQOA 3CQJA 3WK2A 4FLOA 1KWKA 1DHPA 1W3JA 2C3ZA 5GVJA 3VPLA 1EYEA 3N2XA 3OLGA 4LPCA 1RPXA 3UP8A 4GY0A 2GDQA 1EKOA 5E70A 1CXLA 3GS6A 3W3OA 4FXJA 3R11A 2QCHA 1EO7A 4ZB5A 4AXKA 1FWRA 2QDDA 3SJNA 1YXDA 1L6YA 1SJDA 1R85A 2V82A 2RDWA 1FTXA 2IKHA 3GW3A 5HPOA 3G77A 1DPMA 1HJUA 3QV9A 3TVAA 4AC1X 4O15A 2EG7A 4HU0A 2QJGA 1DJGA 3H26A 2WMJA 3VOCA 3E74A 4M81A 1E0UA 3W7RA 2IXUA 4DF2A 3BARA 1DIEA 1OYCA 5A6JA 3RMEA 3I7RA 1FKXA 3WG6A 1JF6A 3C4UA 2VHLA 2ACQA 3SQLA 5HDRA 2H3BA 2ZC8A 1GTHA 1GVSA 4ZE5A 3QQWA 4BQ4A 3WMSA 4QJ3B 1U5HA 5I09A 2MANA 3N9KA 1R2TA 2C0AA 4CNTA 1DJHA 3SY1A 3WBYA 2C1GA 3APTA 3EYPA 1L2UA 3SN1A 1SO4A 4NI3A 5G1TA 4QDWA 4MY9A 3GVRA 3OVPA 5I3DA 2C71A 4R7OA 3C2RA 3KOXA 1X6UA 4HPXA 2YL6A 2NVAA 1W1IE 3C0JA 2IQ0A 3VGDA 3FK4A 1SW7A 5AHFA 3U48A 1JF5A 3DESA 4F2UA 2VEIA 3NR0A 3PANA 4Q4OA 5A94A 5C8BB 3MT1A 1J9YA 1EZ2A 4ACZA 3N2OA 2BTMA 5XIMA 3H22A 2VRQA 4BWLA 3BICA 3W7MA 3W26A 1R38A 1RCQA 4JEJA 4XAZA 1FDYA 4GIEA 3T0CA 1D3HA 3VXGA 1TYGA 1QRQA 4S3BA 4GRSA 2REQA 2YCKX 4OQVA 1WDSA 4N4QA 4REQA 4WDTA 3TN4A 1XIMA 1L6FA 2ZXBA 1AW2A 5B7ZA 3QRHA 1J11A 3QMTA 4AUBA 3HGSA 1O4UA 4ZQRA 4JFTA 1H5YA 5REQB 1ITUA 1AMKA 5AKQA 3EZ4A 4MIMA 3N2BA 4N9BA 5KINA 3QY6A 1CEOA 1YBQB 4QCEA 3NZ1A 5M17A 1N8FA 3WBEA 2BHUA 3SM0A 1U33A 4JY8A 1ZL1A 1Q2RA 1RBLA 3TA6A 4CQAA 4BQ5A 4GY1A 4UWMA 1MSSA 1W91A 3LTSA 1FWBC 1KM5A 1H4PA 3TE9A 3UY7A 1LRQA 5HQLA 3AYTA 4NP7A 3PWAA 4GC4A 2JF6A 1BF2A 4DF1A 2VZVA 1KCXA 1TRIA 4MF4A 1HN1A 3OBKA 1J0HA 2YJQA 1JYVA 2Q3RA 3OTRA 1TMQA 4DYKA 1Q63A 4Y8FA 4BEQA 2DZXA 2KAUC 3E38A 1LOLA 5DCBA 1JGIA 1PCWA 4LAKA 2VFEA 4OV9A 5D03A 4AY8A 4RE3A 3TEVA 4PYSA 3W76A 2RDXA 3HN3A 1U1UA 1F73A 5CH9A 4F0SA 1YBQA 3FEQA 1E56A 2G3FA 3ABQA 1YX1A 1N82A 5DY3A 1E0XA 5DY2A 1YXCA 2Z28A 5I3IA 5BOOA 2XISA 5F2GA 4Z2LA 5A6BD 3TN5A 3GR7A 2NX9A 1XLGA 4HD5A 4H7VA 2QZRA 1UKOA 3SUUA 2ZRZA 2ISVA 3CJPA 1F2JA 1YE4A 5C2CA 2DPEA 4UR8A 2FFCA 4O57A 1YMYA 2HBVA 5LA1A 2QJHA 4XZ9A 3MUXA 4JQAA 4IPNB 2JEQA 3JS3A 4YHGA 2VGGA 3ARZA 3VMOA 3MHGA 3IVTA 4OUEA 3R2GA 4K68A 4OECA 1CB7B 4RW5A 3CASA 4CLMA 1LZOA 4CNSA 3QJAA 1NOUA 1OFQA 1DWJM 2VC5A 2FGLA 3CNYA 2QDGA 2JKAA 2E6FA 2NXIA 5XIAA 4EF9A 4N02A 5HMFA 2DV0A 4K6AA 2PLJA 3G6MA 1W9XA 1KM6A 1EJXC 1UUOA 3N29A 1F6YA 3TQVA 3OLEA 3WL1A 1IQ8A 5EBUA 5HR7A 3G3DA 3T0AA 1KXVA 4NXSA 3CT2A 3V0SA 1XIJA 3W84A 2E8ZA 3AZSA 3KS5A 3IJ8A 3LHTA 1YKWA 1QHOA 2DEPA 2RGMA 3WMCA 2BY2A 3SRKA 3EOSA 3QH2A 3W1QA 4A35A 3KOFA 1HKVA 4AZ5A 5E0KA 4P7QA 4J1OA 1MEHA 4XKMA 5AYIA 4MJ2A 4QJ1A 3NAVA 1MW1A 2OPJA 1CB2A 4QTGA 4WGHA 1VCGA 1CGVA 3VZZA 4DBWA 4DJFA 5HJXA 2HPMA 1B3ZA 5KMYA 1ENUA 4IX2A 2HZGA 3DFTA 3RXZA 1F3TA 3W22A 1FX6A 4MB5A 1EOMA 2PDHA 3GLCA 3QOKA 4P61A 1KXTA 2PDGA 1EJRC 2CYGA 4KCTA 1XYFA 2VJXA 3TJLA 4GCXA 5LHEA 1SFSA 3BV7A 2REQB 1I4NA 5F7UA 1D8WA 3UWYA 3Q45A 1B54A 5DX7A 4XVEA 1X8CA 3AALA 4H8VA 3GDLA 1KM2A 5FEWA 1NM9A 3IJ9A 4RZ4A 3PUOA 3PNZA 3ZJ8A 3AHYA 2ZRWA 1ZALA 1SZFA 3HQOA 3WNOA 4JDYA 5F4SA 4XZNX 1LUCA 3W75A 1TTJA 1Y8BA 1TX2A 1VBUA 2BXYA 5E5CA 3WQWA 4UCFA 2OEKA 3U3HA 1V6VA 4A3HA 4ILSA 3W7KA 2WQPA 1AJZA 2DSVA 3P7YA 1G5AA 4Q6XA 1RH9A 3M0JA 3CUHA 1OY0A 2IXVA 4UQAA 3LTYA 3AIQA 1ZAJA 1OGSA 2A79A 4D6EA 3EAUA 1C7SA 3UU0A 2UWFA 2CWXA 1TPVA 4G7EB 4HK5A 4Y96A 6TAAA 2QGHA 4JY9A 4JAWA 5AYXA 4E3VA 2Y62A 1K6AA 2Y70A 3A9BA 4RDYA 4G5DA 4J3XA 5AC7A 3I6TA 3CGTA 2PF0A 3NGJA 4HNCA 3BJSA 4EVZA 2ZX9A 5CPQA 5E93A 5JUVA 3B8TA 2EKGA 4ZTYA 1I0BA 3EPMA 4NJHA 3S9IA 3L7RA 3NVTA 3RR4A 6ENLA 1RP8A 3GU2A 1D8CA 3IWPA 5D9PA 4DJFD 3MZNA 2QVHA 1IEXA 2DQWA 2FKPA 5HMEA 4PMJA 1M6JA 4M80A 2OXNA 5AZ0A 3DYPA 3EWXA 1WO2A 4L4OA 2E6AA 3S3GA 5BRBA 4JTUA 4H7CA 3WLRA 5ENLA 4I3GA 4JS3A 3A3WA 1TWSA 2YBTA 3L4UA 3D3FA 2W67A 5CKSA 3PY2A 2Q02A 2HTMA 3SRFA 3ZQ9A 2BBFA 3W1MA 3URQA 3MW7A 4O12A 2FIQA 3QTPA 4H9VA 3DFYA 3GRIA 1K4GA 4L65A 1JCMP 4MAVA 2YW4A 1XIEA 4MTVA 3MHUA 2PDCA 3QZ6A 1ZAIA 3SDOA 2JKEA 3BW3A 3BL3A 4GCAA 1ZBWA 2OLSA 1T5AA 3URAA 1A5OC 4GQRA 2NVDA 3VYLA 1JZ4A 2ZZ6A 4Q3MA 3UZYA 1B57A 3TJ4A 1PIFA 4ZO9A 4IHCA 3VX0A 3ZVIA 3RPTA 2CBIA 1W31A 2D23A 3RO8A 5FEZA 3WF4A 5FSEC 2NSXA 1GYNA 3VIIA 4FIRA 3A3XA 3DI0A 3MHFA 4ZR8A 4DNHA 3GWQA 2WVSA 2C7FA 1QW7A 3PC0A 5EB8A 1PTDA 5LNSA 1EJSC 4ICNA 3NXLA 3AS2A 4QEEA 3FVDA 2XZ9A 3FDKA 1MO0A 3BDKA 1SUXA 3O05A 4V1YA 1PWMA 3QZAA 4IX0A 1W9UA 4M1RA 3IVSA 3QQ0A 1TRDA 1KBKA 1TV4A 3QF0A 3G8EA 2PP0A 4MG4A 3QGVA 2WNWA 4O1DA 1TSIA 4EWJA 3QC0A 5GJNA 1X96A 1EJUC 2YA1A 2PTXA 2FH8A 1B3WA 2PC8A 4HPGA 1E6XM 1BTCA 1BYBA 3CWNA 3GG0A 2X7VA 1XCXA 2XSAA 1SPQA 2PRLA 3L0KA 1DJYA 1A5UA 3F2BA 2D3LA 2GVEA 4O54A 1KFWA 1E55A 1R9XA 2QJIA 1QWKA 1XLIA 4D6JA 4UFMA 2WV8A 3I3DA 1M9HA 1LCOA 2PF8A 3KCJA 3LNPA 3BGJA 4KWOA 1L6WA 1XSIA 1GOOA 4WHBA 4XQ6A 4LU0A 3VMNA 2G37A 2VC6A 1R9YA 3U2ZA 4GD0A 5G5IA 3V16A 1JD7A 1VFTA 4C6IA 2X16A 1OD0A 5MF5A 3PJUA 3EKGA 3PJXA 2XGBA 4HNVA 1XYBA 2WW5A 3RLVA 3B0XA 5J5RA 1N8IA 4CQCA 3TDFA 3JR2A 3R0KA 5BU6A 3WNMA 4LYRA 1NDZA 4EAYA 3TH6A 4LJ3A 4FNSA 4AZBA 4I90A 3B3DA 3A4WA 5KITA 1Q6OA 2QF8A 2CNCA 1BVWA 1V08A 3NYZA 1I2RA 4JTTA 4U28A 2VR5A 1J4EA 4PTWA 4WOZA 1SO6A 4A8RA 3XISA 5U7SA 3WF0A 2WC7A 4Z42C 1VFUA 2FPTA 3KTCA 4DBEA 2R9RA 4CEUC 3UGRA 1XISA 4CQ9A 3BZGA 3PG8A 2RHGA 4D6GA 3T6CA 4UMCA 1TVNA 3C56A 1ZUAX 3STEA 1FHLA 5C2GA 1XP3A 1Q4WA 2E3ZA 3QW4B 1XKYA 4IJRA 4ADTA 2PWGA 4YU1A 2J7EA 3VU2A 2OEMA 4UIOA 4DZHA 4K1WA 4AD1A 4AZ7A 2HK0A 5HMDA 1Q6RA 2HMCA 3MVIA 1QOQA 1FWFC 3ZO9A 3S5NA 3KOYA 4LEQA 2VO5A 1EJVC 3R6IA 2XN0A 3TMQA 4V1XA 4KFOA 5A5WA 3IPWA 3NSNA 1Q85A 4X2PA 1IHIA 4UNIA 3SO7A 6PTDA 3S9ZA 1FA2A 2NW0A 2P8CA 4JYFA 1NWUA 4KCVA 1VBJA 4PSPA 5DMYA 2PDYA 3T0BA 2AQWA 3KE0A 1U2YA 3E6EA 1E6RA 1WBHA 2A21A 4P7NA 1V0MA 4GIRA 3CZKA 2CU0A 5I77A 3ZSTA 4L9XA 1QW9A 1F05A 2YCIX 3WD1A 1UR3M 4JYDA 4QRNA 1TMHA 3NPUA 1OC6A 2V5KA 1VPXA 2HS8A 4ICCX 3O0FA 1RD6A 2GQAA 1W17A 4XD5A 3TC7A 3V1PA 4PODA 3WBAA 3R79A 3VGBA 3VD5A 1CECA 4H8HA 3TYCA 4J3WA 2VT0A 4CUCA 4BS0A 4PH6A 1YNQA 5E1QA 1HJVA 3JVAA 3UZWA 3RM8A 1F07A 1LYXA 4Q8WA 2Y0FA 1AG1O 3E0FA 3UG8A 2P53A 1NOWA 4PE8A 3NQAA 4ZTXA 4LAMA 1KM1A 1KB3A 3LRLA 4V2XA 2INZA 3HM7A 2V5LA 2V5JA 4GI8A 3VNMA 4A8IA 2ZZ7A 4TVDA 4J9JA 4U33A 5JBEA 1X97A 5D30A 1ME8A 4GYKA 3LCGA 4K2SA 2R91A 1W1ZA 3CM4A 5EBAA 2OR2A 3M4HA 3BWWA 5A2BA 3SAZA 2EKCA 3CAKA 2HDJA 1VAHA 2NLYA 3SN0A 3VX1A 4PEKA 4CCZA 2IS7A 1LWHA 1K8XA 1N55A 3BMWA 4IICA 1OFRA 2CLHA 1GPFA 4RX0A 4HPHA 2L5HA 4H9XA 5IHRA 4L9YA 2D22A 3IRDA 3J7HA 3R8HA 4M0XA 2WJEA 2WJFA 3GG7A 3P61A 1S5NA 3K46A 3PWGA 1UMYA 3MSDA 1B3VA 1FY6A 1S46A 3D3AA 3VZXA 1OC7A 3N25A 2J74A 4CEXC 1JG9A 1B3XA 3UJ2A 5FF0A 2Y4SA 2ISDA 3QHMA 5MKGB 4QE1A 2X1UA 2IPJA 3RNDA 3G2GA 1H3GA 1XS2A 2X2YA 2XWDA 4WY0A 3W2KA 1REQB 1P48A 3LSBA 4H01A 3G1XA 4D6HA 3LLXA 2O92A 4AHOA 4CNOA 3S9YA 4ZXLA 3QVQA 5FF2A 2V8ZA 3S0CA 1KV8A 1P0EA 4UUIA 4B4HA 3IS4A 2YL8A 2VYOA 4H9TA 4UC5A 1US0A 4EE9A 3BZJA 4IP5A 4NZCA 1V93A 3K4DA 1EF3A 1IXQA 1X1NA 3FAXA 1OFPA 3BAKA 2EAWA 2WPBA 3GNOA 4FOKA 3UJSA 3V36A 4CN6A 2QULA 1EJ7L 1U1HA 3TJXA 4PBFA 3W1AA 2O4QA 3P93A 1TB3A 1JYWA 1XLMA 3WBWA 1WNOA 3NQBA 2VC7A 2CBJA 2QMJA 4JIIX 3B0YA 3OYXA 4HZMA 3W7DA 1N7KA 3CEPA 2J62A 2WJDA 1JDAA 3YPIA 3HPSA 4Q4SA 2YBVA 3GXNA 1S2WA 2XFFA 3OLIA 4LUYA 4U3CA 4W5ZA 3H4XA 2ABBA 3V1HA 2VFDA 2G41A 3NOEA 1RCOB 3IRSA 1CYGA 4YWIA 1BSIA 2BMBA 5CAKA 1C90A 2WNNA 2OX1A 1XPYA 3DC0A 2R14A 2OZ3A 3M0XA 4MWAB 4GVIA 4P7LA 3AXMA 3H53A 3DERA 1V6XA 3DFQA 1KBJA 3T0DA 2CLIA 3S1WA 1EEXA 3O07A 4Q7BA 2FZMA 1LL4A 2P1FA 3TSDA 4V15A 2VRJA 4BEUA 5DT5A 3ENLA 4UTMA 1DJNA 1W1B1 3L21A 3IIPA 3L12A 1C8XA 1TWWA 2EEXA 3LDVA 4DUOA 5LIWX 3O15A 3L9CA 4HBKA 5H1WA 1EGZA 3CMGA 3TTOA 3C0SA 3GB6A 5BROA 4BQ2A 2BX7A 1ICPA 2XGIA 2FZ9A 4OVXA 2IKIA 1A80A 2X30A 1H7WA 4O1EA 4EPBC 4YJ5A 1F9CA 3B9OA 1Z48A 4GX8A 3WFZA 5D9MA 4FXFA 4PBGA 1ZENA 1SFJA 3BLEA 3GK0A 1R46A 4R85A 1AMYA 3GFXA 3ATZA 4H2CA 5DMNA 4OBRA 4ZL1A 1B90A 2MUCA 3HGJA 1F4HA 1NVMA 2FDSA 3RU8X 5LGXA 4QAWA 1A0DA 3OQEA 1RSCA 1A5KC 3BCDA 1BRLB 2QMKA 1RBOB 2E5BA 3NDZA 3CK5A 3W6YA 4UQBA 2Y2WA 3REQB 3M43A 1VBHA 3I3EA 2DGAA 3HQPA 1XLKA 2F6XA 1R3RA 3L4WA 1POJA 3QOMA 3G18A 4K38A 3VNDA 1QUMA 3AHVA 3DN5A 4G9PA 1T8XA 5C7HA 1QNRA 3MJMA 3N4AA 1JZ3A 3AYSA 4GI9A 3NDOA 2GGIA 3PPGA 2WOQA 4Z1DA 1Q7ZA 1Z89A 3AZTA 1BVZA 3R13A 4Q8TA 1GWJA 1NQKA 4AYGA 4O14A 4CQ8A 1UD3A 3OJGA 3F5JA 4DYJA 2AKMA 3ZR5A 2AMXA 1FDJA 2BHYA 3HPAA 3LQGA 1WZMA 1K9TA 4P7RA 1LOQA 3B9EA 4NF7A 1R3SA 3TOPA 3BPWA 1Q6DA 2W27A 5LIKX 4PMDA 3WELA 1GORA 3G1FA 3HURA 4RXGA 3T8LA 1RD5A 1G4SA 3VE7A 1RY8A 1UROA 2VR4A 4WEVX 5AVHA 2Q09A 1J79A 4HMNA 4LCRA 3C2FA 4QX4A 4OIFA 4ZSUA 3ANYA 5FJIA 4G7FA 3N18A 3AI0A 4JOMA 2ATMA 2WC4A 3AMLA 1TWZA 2DJLA 4HMEA 5K2ZA 3EX3A 1Q6GA 2WSQA 3N6JA 4KIEA 1XG4A 1EP2A 1GKPA 3GX9A 3KVJA 3ZXWA 4TV5A 3GIYA 3NL2A 4IMFA 5L9FA 4TO8A 3RPMA 3LCXA 3HJZA 1IE7C 3HGRA 1IWPA 2DW6A 1IXPA 4RZ5A 1E4IA 1AQFA 4OTKA 1LTDA 3WQ6A 5JIPA 5IFPA 4F3HA 3VO0A 2GJXA 2YLLA 1XGEA 3RDKA 1UR9A 4E8CA 1ALDA 4FB7A 2WAGA 9XIAA 3WH8A 1A0CA 2QPSA 3AWNA 2VMFA 3CUZA 2ZWYA 4E3TA 2ZICA 3TFXA 1CNVA 3AMKA 1Q6EA 1NFBA 1UD2A 3CU2A 5HUPA 4HSHA 4IXXA 4BR1A 4XWUA 5D9NA 3Q58A 4E2BA 2O7SA 3MZ2A 4PTXA 5EGRA 5LKYA 4JTGA 2Z1VA 1XLDA 1W5OA 4NL1A 4AMCA 4TUFA 1DQWA 1DTUA 3KFTA 4RNHA 4NAEB 1M41A 1UBSA 2B7OA 2YXXA 5DEZA 2VX7A 3A23A 4HJWA 4LS1A 2D24A 2OT0A 4MLRA 3HG3A 4U2YA 3LU2A 1QW8A 1OIMA 3EX1A 3L2IA 3CPRA 1JI1A 3RK8A 5IDIA 3UETA 4N4PA 1PVNA 2R8WA 3EA2A 4Q4RA 4ZSTA 3AIEA 1H1YA 3RN6A 3S2MA 2Y6ZA 3QYQA 4A8NA 3IV3A 1IT7A 3QMSA 3WDIA 1QHPA 3PTMA 4UXDA 3D5HA 4Q33A 4UTIA 3VOJA 4ERAA 4OGZA 4PZVA 1NF7A 2E0PA 4MKNA 3UESA 1MXGA 3MMDA 1GPWA 3RRXA 5LYRA 3AAMA 1OIFA 4U31A 3GG8A 2DSWA 4WDXA 4K7VA 5SWUA 5DBTA 2ZX8A 2F38A 2BASA 1F8IA 4A6GA 3LGGA 3SQMA 4PUDA 1DWFM 3W7GA 4D6CA 1BGGA 4HOWA 1BEUA 1OZMA 4H9UA 5DLCA 3W81A 3I68A 3OIHA 2VEFA 4KGLA 2ZXAA 1W6TA 3TV8A 3VCRA 3JZUA 2ISSA 1E1CA 1EH9A 4HB7A 4O4WA 4DJFC 3ZT5A 3SN4A 2XJ7A 1XM3A 4GPNA 4IFOA 2HROA 1SO5A 3NUKA 1RA5A 2PLKA 3KTXA 3SW6A 3PZVA 2PWEA 2R1PA 1TCMA 3TQPA 3SCRA 3QV6A 4W5UA 3L5AA 1UWAA 3R25A 2X0YA 4JTEA 4Y9AA 1EWDA 4AQLA 3AUOA 5I06A 1MDRA 3CZJA 4QBXA 2VUNA 3VOHA 4BI6A 3A21A 4IMCA 1W5PA 3CAWA 1DWAM 2PWDA 3UT0A 5FSDC 3TLQA