4TOQA

Crystal structure of class iii chitinase from pomegranate provides the insight into its metal storage capacity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
273
Chain Sequence
GDIAIYWGQNGGEGTLASTCDTGRYAYVIVSFVTTFGNFRAPVVNLAGHCDPAAGTCTGLSDEIRSCQGKDIKVLMSIGGGAGDYSLVSEADADNFADYLWNNFLGGQSSSRPLGDAVLDGIDFDIELGTTTFYDTLARALSSRSTQAAKVYLTAAPQCPHPDSHLDAALNTGLFDNVWIQFYNNPLAQCQYSSGNTNDILSSWNTWTSSTTAGKIFLGLPAAPEAAGSGYIPPDVLTGQILPQIKTSAKYGGVMLYSKFYDTTYSTTIKDQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class III chitinase
publication title Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity.
pubmed doi rcsb
source organism Punica granatum
total genus 95
structure length 273
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4toqA00
2JIWA 1B3YA 1BVNP 3BAYA 1B3WA 1B9ZA 1JDCA 2XGIA 2XVGA 3NSMA 2XG9A 3BSGA 3MS8A 3WEMA 1GOIA 1BLIA 1X6LA 4TX8A 4PUDA 2A3EA 2CERA 2TAAA 2GJPA 3UG5A 2RGLA 3AOFA 3MV11 1JZ6A 4BZYA 3OBAA 2J77A 3SCSA 3PZ9A 1V03A 1L8NA 1EGZA 2MANA 3GNRA 3WY1A 4DUVA 1PIGA 1VBRA 3MUAA 2BY2A 3K46A 4IPLA 1BTCA 2QMJA 3AIBA 1J0HA 4GO8A 1UHVA 1KBKA 5A8MA 3B8SA 4AZCB 1ITCA 1BAGA 2ESCA 4AMCA 1V0MA 1ZBVA 2VNCA 4A3YA 3K8MA 4RE4A 2CHOA 3QHMA 3WDQA 1E6QM 3CIVA 1WAWA 3SCOA 5A2BA 1E6XM 2QPUA 2E9MA 2E8YA 4W8AA 1JIBA 3VGGA 2CBVA 3WH7A 1Q6CA 4W5UA 4W84A 3WF1A 1ESWA 4C7DA 4GI9A 5CPSA 2WSKA 2UY5A 1I1WA 1O7AA 3JUGA 2WC3A 2Y24A 1BFNA 4IISA 5E09A 4X0NA 1UKQA 1NP2A 2WANA 5BCAA 1CGWA 1GCYA 1OT2A 1SMDA 3N11A 3CLWA 3PHAA 4AD4A 1UG6A 4C7FA 3RM8A 1ZB5A 4XZWA 1JI1A 3VKKA 5A6MA 4KGLA 4ZE5A 5GQBA 3MU7A 1L0PA 3ZJ7A 1UUQA 3WUGA 3VX0A 4EE9A 2ZX8A 4XZBA 3OGVA 4E2OA 3RM4A 4H7VA 1S46A 2E0PA 2XSBA 1W9BM 5CQ1A 2IUZA 2Y2WA 1E6RA 3O2LA 2X05A 3F5JA 5AY7A 1KQYA 3CTTA 3ZR5A 1G9HA 3M7SA 4MPKA 3WDIA 5KZ6A 3M6DA 3VM7A 1Y7VA 1ODUA 2WMIB 1CNVA 4DM2A 3FHQA 4HA4A 1UWRA 5CLTA 1CXLA 1VEMA 3CUJA 4V28A 3CMGA 4J7RA 4MDOA 2JALA 3ZMRA 5A6SA 2D0HA 1B1YA 2UY2A 3CZLA 4JL1A 1PBGA 2W5FA 4TXEA 4UNIA 1F4AA 2JF6A 2WVSA 3UG3A 2WCSA 2J74A 2PWHA 3W53A 1MYRA 1V6YA 2BHZA 3LPPA 4KH2A 2GDVA 4URIA 4E4PA 1B2YA 4JFUA 5E6YA 1E6NA 2E9LA 1E4IA 4UR9A 1GHSA 4M29A 4PMYA 1QI2A 1W2VA 2YL8A 4UZSA 2VX6A 1QHPA 3QOMA 4FLRA 5DT7A 3RPMA 1H49A 1OIFA 4ZENA 2D3NA 6CGTA 2WVUA 1R86A 1U2YA 3EBVA 2CITA 1JI2A 1JF6A 2DQXA 2YLAA 1JD9A 2VO5A 3EMCA 3OZOA 3SUSA 5JBEA 2VRKA 4MB1A 1ISXA 2A3AA 3A47A 1G5AA 3MMUA 1LG2A 1UOKA 4UQEA 1UWQA 3WL1A 1EH9A 3J7HA 1XRVA 1DWAM 4AZBA 4J3SA 4D6CA 1UA3A 4Y7EA 4D1IA 1GVIA 2WVVB 4AW7A 3M07A 5D9OA 2BFGA 3WUBA 5D8ZA 1E9LA 2ZXDA 4DWSB 2Z1SA 3KL0A 2YDSA 5GPRA 1HF6A 5I78A 1LQ0A 1W9XA 3L4VA 3AMGA 4ACZB 5A6JA 3WH9A 3BLKA 2NW0A 2QHAA 4PMVA 2JEPA 5D9NA 3T09A 1HP4A 1LL6A 4MADA 3VUPA 3BAJA 2OLHA 4UFHA 2VTFA 2ZXAA 2C7FA 5I6SA 1E5NA 3I3EA 5AYIA 4BF7A 3W29A 4GPNA 1DP0A 1FH7A 1V3IA 1PEZA 1VEPA 2XIIA 4JFVA 1UWUA 4M8UA 5EBAA 1JZ3A 1P6WA 1JXJA 3T0AA 3SUWA 1PX4A 4D1JA 1GUVA 2FH8A 1J0KA 3ZSSA 3UEQA 3ZT6A 1V02A 3VM5A 2WPGA 4J3UA 1OD0A 1CXKA 1DEDA 2WCGA 3WDRA 4AZ5A 4A3HA 5A6AA 3O9NA 4AXNA 2G8ZA 4D6HA 1G01A 1NOUA 2DSWA 2YDRA 3OLDA 1M7XA 2JIEA 3CO4A 4X9YA 3WEZA 4UFJA 4P8VA 4IUGA 2E3ZA 1JZ7A 1HXJA 1VFMA 4D6DA 1HX0A 1KCLA 3AIRA 2D0GA 2C8NA 3BC9A 5D8WA 4UQCA 4UZUA 3PN8A 2WC7A 2FHCA 4MAVA 1KB3A 1NOWA 3GYCA 5ABGA 5M5DA 3SURA 1V0NA 3E1F1 4D71A 2BY1A 4U31A 1E0XA 1U33A 5HNNA 3MUY1 3HJEA 4QFUA 2O9OA 4OBSA 4QCFA 5A2CA 1LL7A 4YN5A 5HOSA 5JUVA 1QI0A 1TVNA 3G6MA 5CSUA 4J3TA 2VUYA 3RILA 3SCVA 5BROA 4GINA 1CGTA 5CXPA 1Z32X 1UR8A 4EANA 1H11A 3WBEA 4Z2KA 4M1RA 2CBUA 5EMYA 4AISA 3W81A 3AXHA 3TTOA 4TOQA 2DEPA 3TTYA 1KFWA 1J10A 3SCWA 3CHFA 2VI0A 4ATLA 1E5JA 3W27A 2BVTA 3BMVA 5KEZA 2XGBA 3B9DA 3VD3A 3QOKA 1UYQA 2PWEA 4UTFA 1DTUA 4RL3A 3TTQA 1H0GA 1HVQA 1K9DA 2ZWZA 3UERA 1B3XA 2VZTA 4PMNA 3VIGA 1FHDA 4GQRA 1E43A 4UOQA 4KRUA 4JAWA 2ZE0A 5JBDA 3WQ6A 4EK7A 3OZPA 1UD5A 3CZGA 1UWSA 3CGTA 3DHPA 4W7VA 1US2A 4CGTA 5EFDA 3KE0A 3WBAA 4BQ5A 4DUWA 2A3BA 3W0KA 1KGUA 4HOWA 3EMZA 1JD7A 2UY4A 1E1EA 1ZJBA 2J4GA 2FDMA 4IPNB 2GJXB 2VX5A 1UR4A 3IJ8A 2D20A 3W26A 1JGIA 1Q6DA 3VINA 5JIWA 3LPOA 1UKOA 3DYMA 1WKYA 3NDZA 1UWTA 2YL6A 2D23A 4MNLA 2XYLA 1M03A 3VIOA 4UFMA 2VOTA 1RP9A 2O9TA 3ZO9A 1J18A 3PTKA 5ABEA 1F4HA 4XUYA 2WHMA 3CH9A 4M24A 5LA1A 2WVTA 1PPIA 4PSRA 4B3KA 2WBKA 1E6ZA 3ZJ6A 5A8OA 2X2YA 3T0DA 5A6BA 3NUKA 2BY3A 3MUZ1 3VO0A 1QNQA 1JYWA 2EPLX 1CWYA 3AS3A 3IJ7A 3UETA 3GZAA 3UG4A 2WHKA 4ZEPA 3VIIA 3CUHA 4X0VA 3VGDA 3N12A 2OYMA 1V0KA 4GXPA 3VGEA 3IANA 1C8YA 4OJYA 3EMQA 3WQVA 4KGJA 3T2QA 5I2UA 2DT1A 3SCQA 1AMYA 1QNRA 3OLEA 1CECA 2UY3A 3SCUA 1ISWA 3GH4A 1MQRA 4CVWA 1MXDA 1A3HA 2YIHA 1W1TA 1K9TA 4TVDA 5BXTA 3A4WA 1JFHA 2CKRA 1UWIA 4B15A 1J0JA 1NP0A 1KXTA 2V38A 3AS2A 4PUEA 5A8QA 4YPJA 3AIEA 3NCOA 5IHSA 4NRRA 1V6WA 3SCRA 4Z2IA 4J3VA 5M3WA 4NI3A 4AD1A 3MKKA 2ZXQA 1FFRA 1OIMA 2PI6A 3CUGA 5GNYA 6TAAA 4QCEA 4CD5A 1R85A 1W9UA 4ACYA 3VDAA 3CMJA 3ZR6A 4WK9A 4BS0A 3CUFA 1E4LA 3U5UA 2YBUA 2W61A 2VZOA 1LL4A 3A6OA 2J7FA 1BYCA 1EO5A 1V08A 4PMDA 4OUEA 2DT0A 1H4PA 1JL8A 3AZRA 1UA7A 5F7UA 2OWWA 1E6SM 2OWCA 4AZIA 5E0FA 4EAMA 9CGTA 5A6LA 3TOPA 5DMYA 4AZ7A 3AQUA 1UH4A 5D9MA 1NWRA 1E70M 4TUFA 1JG9A 3RDKA 4D6FA 1UD2A 1JZ2A 4AD0A 1ITXA 1IZKA 2G4FA 3BCDA 4MJ4A 2W4XA 3K1DA 1EQPA 2BVYA 3ARSA 4M81A 1QPKA 3K8LA 1GOWA 3VVGA 1XYZA 1BG9A 1HNYA 3CZKA 1G94A 2XUCA 4M80A 5ECUA 2XFFA 2XVPA 2VCBA 1MW2A 3AYRA 3TONA 5A1AA 5EFFA 1FP9A 2WMKA 1B3VA 3ARWA 2Y8KA 1V3KA 2GUYA 3W28A 2F2HA 4PTVA 2VX7A 4E8DA 3GH5A 4LPCA 4TTUA 1UH3A 1C3FA 2G3JA 3OIHA 3K4AA 4AEEA 4UQ9A 4P7RA 1E55A 1FFQA 4W89A 2D24A 3WH6A 3S6TA 2F8QA 1HL9A 5D9PA 1PZ2A 3AHXA 4HU8A 4PRWA 1RP8A 3PZMA 1HKJA 1V3JA 1OWQA 5ABFA 1CENA 4B9ZA 1MXGA 3ARUA 3WF3A 4WSJA 4V2XA 1EDTA 4QLKA 4PMZA 4Q22A 2G3IA 4AIOA 3KL3A 2J7BA 3BXWA 1JZ4A 3OLGA 4QLJA 1FHLA 2WHLA 1OM0A 3WFZA 3L4TA 1JFXA 2Y5EA 1OSEA 1D7FA 4R27A 3N1AA 1HJXA 4JFTA 3W25A 3TTSA 3VPLA 3WUFA 4ZE4A 5BWFA 4NRSA 4H8UA 1VB9A 2VRJA 5FOOA 1MFVA 1SFSA 5DEZA 2WM0A 3APGA 1W3JA 2JF7A 1QNOA 4AEFA 4UQBA 5C71A 2VZSA 1UD3A 3WEOA 2IXVA 2GK1B 3BAWA 5M03A 4D6IA 1AVAA 1JNDA 2V5DA 1UZ4A 2BS9A 3RIKA 1LWJA 1UD6A 2O9RA 3AFBA 4AIEA 1R8LA 2CBIA 1CEOA 8CGTA 1CTNA 3FN9A 1J01A 5EB8A 1V0LA 1LWHA 4HU0A 4QLLA 3VDBA 3CHCA 1MW3A 3OB8A 2G3NA 1BYDA 4D72A 4J3WA 2W62A 1CXHA 5A2AA 2PB1A 3PZVA 1ECEA 3KWXA 4NZCA 3WKZA 1DWHM 5BRPA 1UZ1A 1V6XA 4QP0A 2VZUA 3HMCA 3WH8A 2BV9A 1ZBCA 4PSPA 4CD4A 3POCA 4MAZA 1HKMA 5BXPA 2BXYA 4P8UA 1HL8A 3WQ5A 3AICA 4Z2LA 3VGBA 1CYGA 1CGUA 3EDKA 1GQLA 2QPSA 4AZGA 3PTQA 2WZEA 4WKFA 4W85A 5A3HA 2CESA 3NSXA 1EHAA 2JE8A 5GNXA 2B31A 1OBAA 3ARQA 3IK2A 1UKTA 5GNZA 1GVYA 1DWGM 4RE2A 1D2KA 3TP4A 5CGTA 1WDPA 3FAWA 2NT1A 3A4XA 2ZICA 3AROA 3VMNA 5DO8A 5HXMA 1WPCA 1EHNA 1R87A 4K68A 4CU7A 2XTKA 4N0RA 1WB0A 4PYSA 3VD5A 4L4OA 1E40A 3OG2A 4CN4A 5FIPA 2VCCA 2ZOXA 3CZEA 1G1YA 4L4PA 5HPOA 1W32A 2HVMA 3KL5A 2XIBA 1TA3B 2BXZA 2WKGA 3CZJA 1V6VA 1HJSA 4GZIA 4F8XA 3A4AA 3B9EA 4F66A 5BXSA 1J9YA 5I79A 1GJWA 2ZUNA 1EA9C 3K4DA 3PTMA 4MJ2A 3WELA 4HZ8A 1TG7A 2EPKX 1AQHA 3AZTA 3VMPA 3BGAA 3ARXA 4P8WA 4ZFMA 2WLZA 1BYBA 2WAGA 4UCFA 4FLSA 2BHUA 1PAMA 1DWJM 5IFPA 5E9AA 2NT0A 3UESA 1QI3A 3L4ZA 1PZ3A 4WF7A 1E1FA 4MNKA 4M82A 1JXKA 2A3CA 1KQZA 1EDQA 2X8RA 4HTYA 1DWFM 2ZUVA 3OGSA 1E71M 1KBBA 1KR1A 1QW8A 4W88A 4OKDA 1PJ9A 1CGXA 2OYLA 4UFIA 2E40A 2PF0A 3WUEA 1UR9A 4UOJA 3WMSA 1UH2A 1WZMA 2EXOA 1TFVA 4HOZA 5HPCA 1V3LA 5A8NA 1K9EA 2ZUMA 4S3JA 3QHNA 4W86A 1MVYA 4WSKA 2XFYA 2YDQA 3WF2A 2HISA 1UD8A 1XD1A 1W1VA 1E15A 3ARTA 2DH3A 2E9BA 2X0YA 1CXIA 2DT3A 5JIPA 5C8BB 1MQPA 1H1NA 4DUXA 4MB5A 3WD1A 4N42A 2WCAA 2UWFA 5I5RA 1ZBWA 4ATDA 4KWUA 3MMWA 1CPUA 1B30A 1HT6A 4W8LA 4GI8A 2YA0A 1CDGA 5FCZA 1TE1A 1TR1A 2GSJA 1M04A 2F61A 2ZX5A 4MNJA 3NDYA 3RM9A 1ZS2A 3FW6A 2D3LA 2XSAA 4U3CA 4ZXLA 1JNEA 2WLYA 2G3MA 8A3HA 2VVNA 2WMJA 2V3GA 4JCLA 2DSKA 4Z2JA 1FA2A 1BVZA 2J7CA 2WMHA 3VD9A 1A47A 4WLCA 3SUTA 4B16A 2WMIA 4J28A 5LA0A 1H09A 2ZX9A 2WZIA 5JBFA 1VFUA 3W38A 4CCEA 1NWSA 3GH7A 1DWIM 1H2JA 3AI0A 5I0DA 2WSPA 3L2LA 2XM1A 3MSGA 3WNLA 2J62A 2V3DA 2X0HA 5I77A 3WL0A 1E4NA 4UOZA 4CUCA 1OT1A 1U30A 3KEHA 1SR0A 4B3LA 5A6BD 3WF4A 3B9AA 3AS1A 5E0CA 4PTMA 1E4MM 4F9JA 3W6LA 1HJQA 3AIUA 2O9PA 1UR0A 2W91A 4YHGA 1H5VA 3AHYA 3WQ8A 3FNDA 1C91A 1K6AA 3G6LA 3N15A 3DC0A 1V02E 3WMCA 1GQJA 5IFTA 4JKMA 3AZSA 2GDUA 4H41A 4UQDA 2EO7A 3ALFA 3T0BA 1ODZA 2CYGA 1XV8A 4CU6A 4OZOA 4JIEA 2Z1KA 3BAKA 3RJXA 2J7EA 1XC6A 4HPGA 3GXMA 4DWSD 1QI5A 3GXFA 3N18A 3WSUA 4MTVA 3WFLA 3N9KA 2DSZA 1GHRA 3WNOA 2X09A 2WHJA 1KXHA 2ZX6A 3CZ8A 1JAEA 4GKLA 3GBEA 2JFEX 1W9PA 2WB5A 2J78A 2XM2A 4GIAA 5HDRA 2OSWA 1WZLA 2WVVA 4OOZA 1BGAA 2DT2A 2DSVA 3GXIA 1Q6GA 1B3ZA 4GZJA 3NYDA 2WK2A 3VIPA 1CBGA 4DWSA 1C93A 5BYWA 1EOKA 3K8KA 1WZKA 1YHTA 1TZ7A 1WE5A 2D22A 4CN6A 3MMDA 2EPOA 3EYPA 1BSIA 3VILA 4HMDA 4ACZA 2XJ7A 1CIUA 3ECQA 2W66A 3U57A 2XVKA 5A69A 4EKJA 3SCNA 5DFAA 5I24A 3OLIA 4BQ3A 1EO7A 3WIJA 4OIFA 2OSXA 4TTGA 1CLVA 2ZWYA 1BYAA 1W2PA 2EEXA 2EJ1A 4V27A 4UQAA 1BGGA 2EQDA 4AD5A 5AC4A 1XH0A 2WNWA 3AMDA 4W93A 4QDMA 5FKYA 3BCFA 1W9DM 1JYXA 1E6PA 1CLXA 3AMKA 4U3AA 4GI6A 1PIFA 5CSYA 1Q6FA 3CHDA 1W3KA 1QVBA 2J7GA 3BH4A 4D6EA 1PX3A 1BF2A 3U5YA 3SCTA 1IV8A 1OD8A 3IAQA 4Q7NA 4JZ5A 4HA1A 3L2MA 2W63A 2OSYA 3VMOA 4QAWA 1UKSA 4JCMA 2CPUA 1XD0A 3AIVA 5FL0A 1X1NA 1LJYA 2J47A 2DIEA 2C0HA 4OOUA 4AYSA 1WP6A 1CGYA 3VGFA 3WD3A 3VU2A 1VBUA 2QF8A 4HP5A 1KXVA 2VX4A 1HKKA 5C70A 5CPTA 1WO2A 3VTRA 2WXDM 2WMFA 3AMLA 3AXIA 3L4UA 3EDJA 3ARZA 3SCPA 1CZ1A 1J0IA 1XGZA 3DHUA 4GZEA 4CN1A 2CEQA 4MDPA 4TX6A 4MB4A 1JZ8A 4JL2A 2J75A 3GXDA 2J7HA 3AIWA 3VIHA 1ISZA 1E0WA 4PMRA 2AOSA 4J27A 3VIJA 1FP8A 5A95A 2FHFA 3F4VA 4PCSA 3BAIA 5FL1A 5IXEA 4S3KA 1JDAA 3RMEA 1VF8A 3MO4A 3WN6A 1DHKA 5E70A 2ZUUA 4PMUA 4JKLA 1KR0A 2VR4A 7A3HA 1O6IA 3UCQA 2WWDA 3T2OA 1E0VA 3DYPA 3TA9A 1GPFA 1AQMA 4WIWA 3EDEA 4ML4A 3IJ9A 2W92A 1WCGA 4W87A 1VJSA 3ZM8A 4ATWA 2ZXBA 4WKAA 3WDHA 1C8XA 1V3MA 2EPNA 5A8PA 4E8CA 1EDGA 1RD6A 1HKIA 4JFWA 2VQUA 2VZVA 4U5KA 2Y8VA 1QHOA 1SMAA 2VC9A 3GTNA 5CGMA 3N17A 4NF7A 1MWOA 3VOCA 2GVYA 3RCNA 1UR2A 2VMFA 1UQZA 1QHZA 3O6AA 4XB3A 3WF0A 1TVPA 5CLWA 1RPKA 4W5ZA 2WC4A 4C7GA 3F5LA 1W3LA 2ZX7A 7CGTA 2VVSA 2PBGA 2WYSA 1MW1A 2J79A 3CHEA 5E6ZA 4BQ4A 4P7LA 4CCDA 2OWXA 3UR7A 5DF0A 1CGVA 3AHTA 3FAXA 1JF5A 2PWFA 4PTWA 1FH9A 2ZUTA 3FXYA 3GDBA 4AY1A 1BHGA 4AD2A 3ARVA 4M56A 2GJXA 3POHA 1NWUA 4JKKA 3VX1A 3AYSA 4MNMA 3ARPA 1XCWA 1JDDA 1VFFA 3KZSA 3UR8A 2Q8XA 4LYQA 4MB3A 1YQ2A 4NSBA 5BRQA 2DGAA 1NH6A 2YL5A 1WDQA 4FF5A 2XVNA 4JHOA 4JFSA 3WNNA 2XFRA 1WDRA 3CPUA 4U5IA 2CBJA 3M46A 4CCCA 2CNCA 2VRQA 1XCXA 2WWCA 4AC1X 2VL4A 2DPEA 3PBGA 1C8QA 2J8GA 1JAKA 4HZ6A 4J3XA 3WDPP 3AMCA 1KXQA 2CHNA 1NARA 4H2CA 3RJYA 2VR5A 1V6UA 2WMGA 3MUIA 3WQWA 2GJRA 1D3CA 1W3HA 4PBGA 4A4AA 4PTXA 3NSNA 4HA3A 2DH2A 1JYNA 3RO8A 1ZBKA 4Z2GA 3F5KA 2XHYA 2YJQA 4KMQA 3WH5A 4B9YA 1AQ0A 1BPLB 1VRXA 3LPFA 1H41A 1WNOA 3GNOA 3QHOA 1LLOA 3SUVA 2CIPA 3VDHA 1ISVA 3EDFA 3N04A 4KRTA 4FMVA 1SYTA 3VIKA 1OGSA 3WQ4A 3THCA 1VIWA 4CVUA 1IT0A 3ZT7A 1NOFA 1WZAA 1C90A 1LG1A 3WMBA 3GBDA 4U2ZA 2QMKA 1E73M 5BXRA 4W7WA 3BLPX 1XYFA 1HJVA 4D6GA 1H3GA 4LX4A 2CXGA 2PWGA 3AISA 4P7QA 1R7AA 1TMQA 3AIQA 3PZUA 3D5HA 4TVUA 1XSJA 2VCAA 2XVLA 1UR1A 2FGLA 4R5EA 3D3AA 1IZJA 2D1ZA 5TD4A 5HBFA 1KCKA 3W82A 1ISYA 2X1IA 4CD7A 3HU7A 2Y4SA 3PZIA 1I1XA 1BQCA 2E4TA 4AWEA 5A6KA 5LA2A 3T2PA 2PWDA 2W67A 1J0YA 1HVXA 3W24A 2J7DA 3PZGA 1MW0A 1EXPA 4PN2A 5D4YA 1XSKA 2CCRA 1W9VA 2BY0A 3ZJKA 4DWSC 1R7OA 3AS0A 3GM8A 1E3ZA 3VNZA 3L4WA 4TVCA 2YL9A 4JHZA 1CXFA 3LPGA 3VGHA 1Q6EA 1W1YA 2PBOA 2VJXA 1OGBA 3DECA 1TUXA 1VFOA 1QOXA 4LYRA 1NWTA 4PMXA 3BMWA 3IAPA 1KWGA 4BCEA 1LF1A 4LYPA 1GNXA 4AZCA 3W6MA 1CXEA 3PZTA 1M53A 3PZOA 4GO9A 1TCMA 4FK9A 4LXFA 1C92A 3OA5A 5LYRA 4IM4A 4WKHA 1E3XA 2WKLA 3AHVA 4HOXA 1B0IA 1W91A 1I75A 5CG0A 1QI4A 1HIZA 2ZUSA 4F9DA 4F79A 2RGMA 5AC5A 1VENA 4CD6A 2AAAA 2XWDA 1H0IA 2J8FA 1W1PA 4UFLA 1GQKA 3A3HA 1ZL1A 1XH1A 5AYBA 4U33A 1QNPA 1EIBA 2IXUA 2NSXA 1E72M 2DSUA 2BVDA 1XH2A 4P7NA 1FH8A 1M01A 2OYKA 2WBGA 1FOBA 1G0CA 5M17A 3MSDA 3N13A 5ABFB 4DM1A 3DYOA 2WZHA 3VIMA 3WDJA 5A94A 2WW5A 4P7OA 1OB0A 2FHBA 1QBBA 3W4RA 2V3EA 2VURA 4WJXA 1QNSA 4HPHA 2ZIDA 2E8ZA 1UD4A 3SUUA 4U2YA 6A3HA 1C7TA 1QBAA 2BNJA 1K9FA 3L4YA 4LQ1A 4W7UA 2AMGA 3SIMA 3WD0A 4Z2HA 3AJ7A 5IDIA 1VAHA 1J11A 4HMEA 2GK1A 1E56A 5FD0A 1GOQA 2ZUWA 3FY1A 3ZT5A 3LMYA 4PCTA 2D0FA 5I3DA 2XWEA 3BSHA 1GOOA 4AZHA 1GW1A 1BG4A 2EPMX 3L4XA 4RE3A 3ZJ8A 4PMOA 7TAAA 1JYVA 1OGGA 1MQQA 2XPKA 5IHRA 3GNPA 1HP5A 2V5CA 4ZXOA 2YLLA 4P8XA 3QR3A 1VEOA 3U7VA 4XX6A 3W37A 3SEPA 1KGXA 2YA1A 1EOMA 2G41A 1GQIA 3ZIZA 3CUIA 4FLQA 3AHZA 4YHEA 1V3HA 3BAXA 1GORA 1HJUA 2QLYA 5I23A 3WD4A 1Q4NX 2QV4A 2YKKA 1J0ZA 1WDSA 3WD2A 2VT0A 2PC8A 1GZJA 1GJUA 2V3FA 3ARYA 1OINA 4HMCA 3OGRA 3VD4A 2DIJA 4D6JA 1C7SA 3CBWA 3ZOAA 3I3DA 4UFKA 4AZ6A 2J25A 3EDDA 3NJ3A 4AD3A 3WNPA 1NM9A 3U7BA 3VNYA 4LGXA 2D2OA 3ALGA 4CKQA 4PEEA 3WNKA 1B31A 3MV01 1HN1A 1MFUA 3HN3A 1KWKA 1RH9A 1VJZA 4W8BA 4H04A 4H8HA 4CU8A 3WNMA 2DDXA 3VDCA 2GFTA 2O92A 1XHGA 3THDA 2EBNA 3I3BA 3MANA 1JZ5A 1OCQA 1B90A 1XSIA 2BHYA 2CKSA 1ZJAA 1GOKA 1UQYA 3T08A 2JEQA 2YOCA 1EQCA 1TA3A 3VIFA 3II1A 5CPQA 3AXXA 4CD8A 2FGZA 4GQQA 4OBRA 1US3A 3ZQ9A 3NIYA 3S2CA 3VD7A 1X6NA 3FHAA 2YBTA 5ABHA 3PZQA 2FH6A 3WENA 4AIUA 5CZKA 1NQ6A 3PZNA 4BQ2A 2A3HA 1HJWA 2CETA 1N82A 3ARRA 4BA0A 3ZSTA 4H8VA 1GOMA 5CJ5A 3QGVA 1QW9A 1J12A 1UKPA 4HZ7A 1GONA 1ZU8A 2VQTA 1KGWA 4XV0A 5DT5A 4PMQA 1PX8A 2YA2A 4FLOA
chains in the Genus database with same CATH superfamily
3QW3A 4RZ6A 1N7KA 1BVNP 3BAYA 1A3XA 1H7WA 4FALA 1B9ZA 3HPAA 2XGIA 3LI1A 2XG9A 4YWIA 1XL9A 3LCXA 2CERA 4QEHA 4L7ZA 2GJPA 3AOFA 3OBAA 4HGXA 2KAUC 1L8NA 1YADA 3GNRA 3PVFA 2YDAA 1PIGA 3MUAA 5C0QA 3B8UA 3LZ5A 3KBSA 3SFWA 3KBVA 4UTJA 4GO8A 4XAYA 5A8MA 3UFYA 3B8SA 4XO7A 3E0FA 4AMCA 1V0MA 3W7PA 4A3YA 2RFGA 3WDQA 2ZZ4A 5A2BA 3A21A 3S9YA 2E8YA 4W8AA 3VGGA 3WH7A 3B8VA 5TIMA 2Z2BA 1XI3A 4W84A 2PFHA 2V63A 3OG3A 4C7DA 1XLMA 1UPMB 1U5VA 3JUGA 3RAOA 2OCZA 1BFNA 1JCYA 3R8HA 5BCAA 1EZ2A 1CGWA 1OT2A 2POTA 1XIMA 1JPIA 4AD4A 1KKOA 3LRMA 5K4XA 4QQUA 4KGLA 3NXFA 5J5DA 1ZFJA 5EA9A 3WUGA 3E2RA 4EE9A 3SADA 2ZX8A 4FNRA 2JK2A 3KUMA 4J3ZA 3RM4A 3M44A 2FZMA 4IMEA 4Y9NA 1S46A 2XSBA 2IUZA 2Y2WA 3EWXA 3O2LA 4LBSA 2B7OA 3CTTA 1RY0A 4ROQA 2HVOA 4MPKA 1FWWA 1RSCA 4PUWA 1IWBA 3BARA 1W17A 1HG3A 1XJBA 4WX2A 4KW2A 5XIMA 1LRNA 2OO0A 3C2OA 3SW6A 5FJJA 1T0OA 2Z7KA 5CLTA 2PDPA 3WLTA 3CMGA 3KRUA 2FPVA 2V69A 3A64A 1O60A 5KINA 4QDPA 2UY2A 2YCLA 3CZLA 2QJHA 4M6UA 3SR7A 4TXEA 1F4AA 1V77A 1KRBC 1JDEA 3USBA 2PWHA 3TVAA 3W53A 1MYRA 3G1XA 4ZO8A 3NXLA 4KH2A 3EX1A 3QQ0A 4DZHA 1HZYA 4JN6A 1E4IA 4UR9A 1GHSA 4JYFA 3URNA 1Q85A 4H6EA 4DBUA 4NKCA 4DBSA 1H1ZA 3GS6A 3UWEA 2VX6A 1QHPA 1O68A 2WVUA 1U2YA 3EBVA 7REQA 1JI2A 2OLAA 4FA3A 1NDWA 5I3GA 3CASA 1JD9A 3EWCA 2ZZ2A 2VGBA 2VO5A 3MT1A 3OHIA 3UVAA 2BDQA 4LBUA 4L5ZA 3CH0A 1E0UA 4GUGA 4UQEA 4EVZA 2I9EA 4XZNX 1Z44A 2Y61A 3CEUA 4IL2A 4J3SA 4DZIA 1UA3A 4Y7EA 3M4HA 4CNOA 3Q2DA 3G24A 2WVVB 4S3EA 4GWEA 3TR9A 3C0QA 4JIIX 2A1YA 2BFGA 2HTMA 2YSWA 5LIXX 2RJHA 3S6DA 5D8ZA 4ECLA 1FTXA 3CLMA 3CU2A 3L4VA 4LU0A 3AMGA 3GG8A 2BASA 1Y8BA 4NZFA 4XBSA 4L56A 3T09A 3AYVA 5I06A 1LL6A 1EP3A 3T8QA 1RUSA 2NXHA 3EPOA 3W29A 1K6WA 1UWUA 1TYGA 4EXAA 5FAGA 4CQBA 2YX0A 1PX4A 4LVDA 1GUVA 3MY9A 3MDWA 3IIVA 3OVPA 3ZSSA 3RCYA 2E67A 1GG1A 4QX4A 3CL8A 3VM5A 1Z8AA 2GGHA 4YCOA 3SGZA 3WDRA 3ZLFA 4OE7A 5M2FX 4R33A 3TEVA 2DSWA 4QBXA 2CLFA 4CNUA 1RJPA 4LB4A 4C6NA 1M7JA 2JIEA 4X9YA 4AHOA 3WEZA 1KNWA 2PGFA 4WHBA 1WA3A 1XIIA 4IUGA 4M51A 2E3ZA 1J93A 1TWZA 1DJGA 2R82A 1KCLA 1Q63A 1SZFA 1T99A 1EJTC 3BC9A 5D8WA 1PVNA 4GNVA 4UQCA 3PN8A 3WX7A 2FHCA 1NOWA 4ZL1A 1QPRA 3GYCA 3SURA 1V0NA 1UIPA 3E1F1 4U31A 2CLKA 1R9ZA 4QFUA 1F3WA 1S1RA 4QCFA 4OV9A 4CQ8A 4YN5A 3TMLA 2DZWA 4GQ0A 4HCHA 4F0MA 3PBYA 4IX2A 3W9ZA 3SCVA 3WBEA 4XD6A 4FI4A 1UC4A 1OX4B 3W81A 3TQVA 1DJWA 1XIFA 1I2NA 1I2OA 3TTYA 2PLMA 4Q6JA 5AYXA 4RR4A 1J10A 3BTNA 4PUUA 3CHFA 2MNRA 1E5JA 4O12A 2PDYA 1TZZA 1UJPA 2HVNA 1E9ZB 4LTSA 4G1KA 1H7NA 3H53A 1QATA 3TA6A 5JMUA 4DPPA 4UTFA 2ZWZA 4Q4MA 3UERA 4WOQA 1QU4A 3KOYA 2P0OA 4R85A 3VIGA 1FHDA 4GQRA 4UOQA 3TJXA 3WQ6A 2P10A 1OF6A 2PDCA 3CGTA 3DHPA 1VPQA 1US2A 4IFKA 3UF9A 1EJWC 2A3BA 2J88A 3CB3A 4FNQA 1YXDA 3W7GA 4PGLA 2O0TA 4C91A 3IJ8A 1Q6DA 3QC0A 4Y8FA 4MZ1A 3VOGA 3NNTA 5JIWA 3QZEA 3W1QA 3FYOA 1OEPA 5JVLA 4MNLA 2XYLA 1EX1A 1DL3A 2ZKMX 3STEA 3ZLGA 2O9TA 2YFNA 3MUCA 4XIMA 3P0WA 5FJPA 1N8IA 2NZLA 2FMOA 2XGZA 3EX4A 2WHMA 1AW2A 3ATYA 4POCA 1OG0A 3LZ3A 1E6ZA 2Q8LA 3E6EA 3MUZ1 5BOFA 2DUAA 3IJ7A 4FHAA 1I8JA 3UWUA 3QKEA 3R2GA 2C15A 4Z17A 4M6QA 3OP2A 3JS3A 1E0TA 5LHFA 5HR6A 1AMYA 1L6YA 4CVWA 5HWNA 1FVPA 3V35A 4EWND 3FKRA 4HN8A 4P61A 2ZBTA 4OQVA 1LBFA 3M6YA 2NWRA 1L6GA 4N2YA 4YPJA 3AIEA 3CWHA 3FVMA 3NCOA 3MI2A 2WJZA 4PFMA 1K02A 3UJSA 4NI3A 3S4TA 2ZXQA 5F2GA 3WQCA 4IPIA 1W3NA 3E2VA 4ACYA 4IIHA 1WXZA 4N6EA 5G4EA 3VDAA 4YTTA 8XIAA 4XQ6A 3SFKA 3LSBA 4IQDA 3ZR6A 4WK9A 4C6KA 1ZENA 3CUFA 2YBUA 4C90A 2HK1A 4FIRA 1HO4A 3A6OA 2XZ7A 3IIXA 3K2GA 1D3GA 3QXBA 1GKPA 2DW7A 4OUEA 2DT0A 5BMWA 2OWWA 3WZ0E 2OWCA 1WDDA 5HMDA 2VFIA 4NUWA 2VDGA 4DJDD 4M3PA 4C6FA 4F4RA 3TMQA 5A6LA 4DI9A 3GXNA 1UH4A 4RJEA 2DVTA 3W85A 3ABRA 3NDOA 2DP3A 4D6FA 1UD2A 4AWTA 1Z42A 4AD0A 3MSYA 1IZKA 1JZ2A 1XRTA 2WO5A 2WQPA 4HNCA 4K1WA 2Z24A 3M9YA 1XYZA 3I7SA 3IJQA 4FNPA 1SW7A 2AKMA 2VGGA 5ECUA 2XVPA 4DAFA 1MW2A 3AYRA 2WNNA 4B5SA 1FP9A 1KKRA 2Y8KA 2GUYA 4BEUA 3N25A 4A8LA 2VX7A 3FA4A 3TW9A 4LPCA 4IWWA 1C3FA 2G3JA 3O0FA 5K9XA 3MSRA 1QOQA 1KD0A 4W89A 1GKQA 3B04A 4JS3A 1DJYA 3WH6A 4UTTA 1YXYA 3G8EA 3SO7A 3SY8A 4XVEA 4Y9OA 5EMJA 1HKJA 5ABFA 2PA6A 4FNTA 3A9BA 4B9ZA 3H54A 3GDLA 3B97A 4WSJA 3VNLA 4JD4A 3F4CA 3GNNA 3OLGA 2QV5A 4JTQA 4K3ZA 2VFFA 3WFZA 1OSEA 1JCNA 1D7FA 4HPXA 1JEZA 1M3UA 3MP4A 3WUFA 4ZE4A 5BWFA 2HK0A 2ZQ0A 4XZIA 1S2CA 3T7VA 1SFSA 1DXEA 1ZAJA 3APGA 3WG6A 4AEFA 2C6QA 2X7WA 3WEOA 3GHRA 1AVAA 1JGMA 2D73A 4JY8A 4O13A 3EWBX 1LWJA 2O9RA 3AFBA 4A3QA 3IIPA 3GU2A 2OJPA 3OYZA 3I4EA 1S2TA 3LCLA 1LWHA 3VDBA 3SSJA 4K39A 4XUGA 3TYDA 4X61A 3SECA 2CWNA 2POZA 1CXHA 3PZVA 3KM8A 3V0SA 3NZRA 5CH9A 4AF0B 3VKJA 5FF7A 2R91A 1FHUA 2A6NA 3A5FA 3MKVA 1UZ1A 5DLCA 2BLEA 1M68A 3QV8A 1RCXB 4JNMA 4PTDA 1L8PA 4DJED 3WH8A 4NNAA 4NP7A 4I9TA 2DV0A 4QJ3B 2V8ZA 2OKTA 1XQKA 3P6LA 3UY7A 3RU6A 1XLLA 3F4NA 2CLLA 4Z2LA 4ZA0A 1W54A 1CGUA 2QPSA 3G18A 2A3LA 4MLRA 5CC5A 2ZZ3A 4W85A 3W01A 4IIDA 3ARQA 3NZGA 1GVYA 3EXSA 3LRKA 4PBEA 1WDPA 2PGWA 2NVAA 3FAWA 4C6PA 3JZEA 3A4XA 2ZICA 3VMNA 3W71A 3GNXA 1EHNA 5FJIA 5KSWA 2PDMA 2FZDA 4GY7A 4N0RA 3HB9A 3VD5A 1OJXA 1BQGA 2AL2A 4ZVJA 2J6XA 4IOTA 1G1YA 4L4PA 3ZVHA 1TA3B 3H2OA 1X38A 5BRBA 1F9CA 3A4AA 3B9EA 3EOEA 4HVXA 5DCBA 3PTMA 1G4SA 3BLFA 4HZ8A 1TG7A 4S23A 3R58A 1AQHA 2OVLA 2QZRA 3VMPA 3ARXA 1XDJA 1JCLA 2YR1A 2ZZ1A 2J66A 2F7FA 3C3NA 3SSZA 4FLSA 5BW6A 4GIRA 2WJFA 2GVJA 2GJNA 1Z48A 3QEZA 4M82A 1JXKA 2AL1A 4HTYA 3IGXA 3S46A 3LBMA 3OGSA 3PC0A 1E71M 4I8DA 1KR1A 2YZRA 1QW8A 1FKWA 4W88A 4OKDA 1CGXA 1H7PA 2XH7A 2O4QA 3P5YA 3S5NA 3R0UA 4H3DA 1PTGA 3MUXA 5B80A 4N4PA 4HOZA 2NQ9A 5A8NA 1OFBA 5IBXA 3RK8A 2ZUMA 2Z29A 1A3WA 1T41A 4EACA 1U83A 1UD8A 3F4WA 2JGQA 3K13A 4DX3A 2HDJA 4AEOA 4Q4RA 3DFPA 3C8NA 2E9BA 4HBKA 3NTYA 3ABQA 2DVXA 4A29A 2R6OA 1SW3A 2DT3A 1ZCOA 3BZGA 1H1NA 3FX4A 4XAFA 1PDYA 4JIQA 1UC5A 3WQFA 3GFXA 4JIRA 3KBJA 4CLMA 4Q8NA 1KM6A 5MKGB 4C1LA 1CPUA 5REQA 1CDGA 1SFJA 5G1MA 1TR1A 2FIQA 3P74A 5K3VA 2ZX5A 1TWWA 3PPFA 3FW6A 3I68A 5T9BG 1C9WA 2G3MA 8A3HA 1BXNA 1XQLA 1MEWA 1G6CA 3W7DA 3PJXA 3KRBA 4K8HA 1RALA 4O14A 1FWRA 3UA3A 3GTHA 1VBJA 1J96A 3TYCA 5LA0A 2IPFA 4B4FA 1I60A 4JQ1A 1VFUA 4CCEA 1DWIM 1H2JA 3OO2A 3L2LA 3WNLA 2V3DA 2X0HA 1NIUA 4UTTC 2BZNA 3P84A 1UP2A 3PNUA 4REQB 4YCPA 1FWBC 2EG6A 5EKYA 3B0VC 3KEHA 1YTDA 4IG2A 3OZMA 2DORA 3AS1A 4YVXA 5TBOA 1E4MM 2BODX 4GBUA 1HJQA 3AIUA 2O9PA 1UR0A 2W91A 1KBJA 3LLFA 4DELA 5AHIA 3S47A 3PJWA 4Q6XA 3THQA 2IW0A 3O8AA 1SZEA 1R9XA 3NQ6A 3G6LA 3DC0A 1H50A 1WKDA 3NAVA 5C9ZA 3WMCA 4TX9A 4JKMA 3AZSA 4O0ZA 5BMXA 1SO5A 3T0BA 3ALFA 1ODZA 1XV8A 3LCGA 2VDHA 4OZOA 1XLKA 3HGRA 3RJXA 2OU4A 4DF2A 5ENLA 5K2ZA 3GXMA 1CCWB 1QI5A 3N9KA 2TSYA 2DSZA 2X09A 4B2DD 4NZ3A 3LGEA 3KTSA 5D37A 4PRTA 2JFEX 1W9PA 2WB5A 4GIAA 5HDRA 2OSWA 5L6UA 3WLOA 4LUYA 2HNHA 1TTJA 3G1FA 3S1WA 4GZJA 3W23A 1H7RA 3VIPA 2YCKX 1S2AA 4L61A 3N2TA 1UW9A 1VFTA 1TPVA 3M0HA 2D22A 1YBQA 2FZBA 3VILA 4HMDA 1CIUA 1DJZA 2OOGA 1D8WA 3QR1A 2IKGA 4H01A 5A69A 1TELA 3CAVA 3WIJA 4OIFA 3NQ8A 1JUEA 4PE8A 4TTGA 3URAA 1CLVA 3TQ0A 2EJ1A 4Q4KA 2Z6JA 1BGGA 2G0WA 4AD5A 3NFUA 2ZA1A 2IKIA 3OU8A 3AMKA 3GWQA 1PZ0A 1NELA 2VC7A 1TV5A 1Q6FA 3ITXA 2ALRA 4QQ3A 4ZMGA 1F8MA 1SSGA 2GWGA 4QG6A 4DJEC 3IAQA 1ZAHA 4V1YA 2B7QA 4ZQOA 1XD0A 3ZXWA 1ZPTA 2C0HA 4LY4A 1WP6A 1PHQA 3VGFA 3WD3A 2FPYA 2LLEA 4O11A 2QF8A 5DY3A 1VYSX 3HMJG 5A8GA 3LCHA 4FF7A 2WMFA 3AMLA 3AXIA 3IRDA 3ARZA 4A8IA 5E1QA 4GZEA 4NAEA 4ZOBA 4TX6A 1Z69A 2J75A 4AY8A 4GE8A 2J7HA 1KFJA 3G1YA 4GYPA 4IPJA 3AIWA 4L65A 1DIOA 3W1MA 1FCVA 3DX5A 3F4VA 4I9AA 1ZHAA 5F4SA 3F4DA 1A5CA 1P1XA 1JDAA 3BGJA 4JQ4A 3FCPA 3OBKA 4ZODA 1KR0A 2OTDA 7A3HA 4R9OA 3GB6A 1R0MA 2EG8A 2H9AB 3TA9A 1GPFA 4DVOA 3VNMA 4WIWA 1M5WA 3IJ9A 4HNUA 3HQNA 1U1HA 1OG6A 6REQB 1VJSA 4B91A 5A6TC 1R2RA 2Q3OA 3HQOA 1QPQA 2ZXBA 3FV9A 3WLPA 4O4VA 3W7LA 4XVDA 4TO8A 4C1NB 4S3CA 1SMAA 2VC9A 3GTNA 3QV7A 4NF7A 3VOCA 1GPWA 3RCNA 1QHZA 2ISFA 5IBXC 3W7KA 1W3LA 1W8SA 1LRTA 4GFIA 4JIPA 1WXJA 2PBGA 1YE4A 1MW1A 4P7LA 1KFCA 1WBJA 2IQ0A 4CCDA 5DF0A 3CTLA 1JF5A 3TFCA 3EAUA 4HKPA 3WLHA 4PTWA 1FH9A 3FXYA 4HD5A 4H00A 1BHGA 4AD2A 4MWAA 2VYOA 1REQA 4JX4A 1NWUA 4LNYA 1XCWA 1JDDA 3KZSA 1BF6A 3UR8A 4MB3A 1YQ2A 2YL5A 1WDQA 2B81A 3SQMA 3SQLA 3F7JA 4MG4A 4GKTA 2ZTJA 1JPDX 1B5TA 5CPNA 3M46A 3U48A 4CCCA 1G4EA 1XCXA 1VZWA 2WWCA 1BEUA 3GTXA 1C8QA 3BJFA 1KXQA 1ALDA 1TRDA 3RJYA 2YZ5A 4O1BA 3TSBA 2WMGA 4GUFA 3VNDA 3MUIA 3WQWA 1PYMA 5J5RA 1W3HA 5LXXA 3NSNA 1R3YA 4HA3A 1JYNA 3TNBA 1SU5A 3G1VA 4N9EA 1TIWA 4Q32A 4HJWA 3GR8A 5D38A 4KMQA 3V7PA 4B9YA 2QKFA 4JTGA 1KV8A 2HBVA 3GNOA 1XBVA 3H2FA 3PUOA 4CQ9A 1I45A 3LN3A 3EDFA 4FMVA 4KEZA 1SYTA 1R2SA 4KPLA 3O6DA 3THCA 4RZ5A 1NOFA 2H3BA 3GBDA 3L2IA 5BXRA 1XDLA 3HQ1A 1IQ8A 1FWTA 3UPBA 2OQLA 1JCTA 1J4EA 2ZRWA 2CXGA 2PWGA 3AISA 2QCLA 4JTEA 2QIIA 2V0TA 1R7AA 1TMQA 3D5HA 2VCAA 1UR1A 2BTMA 4XTDA 3D3AA 1P6CA 2UV8G 4LC8A 3UXAA 1QRQA 4I8YA 3A5VA 1KM0A 3MDUA 3VNKA 1VPXA 3HU7A 4A8RA 3PZIA 3UJFA 3V36A 4AWEA 3GC5A 3KLLA 3LYEA 3TC7A 2W67A 4MHBA 3SJNA 3W7RA 1LRQA 4GCAA 4IGNA 2O56A 3B8WA 3RRXA 4TV6A 1A53A 2R1NA 2YL9A 4JHZA 2ADAA 4IMFA 1W1YA 2PBOA 5DANA 4GVFA 3R4IA 1OGBA 1VFOA 4S38A 3TQKA 1FWHC 4LYRA 3GVGA 1LORA 1NWTA 3W02A 1M9HA 4HNOA 3TROA 2YW3A 1RVKA 3IAPA 1UP0A 1XBZA 3UXKA 2A7NA 4BCEA 3H55A 1GNXA 2DZVA 2PP3A 4UTKA 4HCLA 4IM4A 4WKHA 2WKLA 1B0IA 1YNQA 1W91A 5CG0A 4RZBA 2ZUSA 1NFBA 1VFHA 4D8LA 4F9DA 2RGMA 3IPWA 3STCA 1TIMA 3H7VA 3W86A 2E1WA 2ISDA 4B90A 3CK5A 3CQ0A 3FGCB 1ZP3A 2CLOA 3GU9A 3B3DA 3BOLA 2IXUA 1E72M 4US5D 4P7NA 4RLIA 3FA5A 3HGSA 1LT8A 3VOHA 1T7LA 3SI9A 4LCRA 3FIGA 3MHFA 1X39A 2VEGA 3KP0A 3DYOA 3HG3A 3F2DA 3B0UX 4C6JA 5HATA 3PY2A 1SO3A 2WW5A 5AC7A 4IQLA 1OB0A 2FHBA 3LHVA 3W4RA 1POKA 5DCDA 1XXXA 4EXQA 3W7MA 4GYPC 3SB0A 1N55A 2E8ZA 2A0NA 5C55A 4J40A 4LNCA 1C7TA 4ZCWA 1QBAA 2BNJA 4PR4A 2Z26A 5CG7A 5ECVA 5CEWA 1K9FA 4IIEA 1V6TA 4ORIA 2FZ9A 3WD0A 2OGYA 2A2IA 3HPSA 3TC6A 3W22A 3RYSA 5BNKA 2ZUWA 5HJLA 1IF2A 3LMYA 2REQB 1PTDA 3PK7A 4GUIA 5I3DA 2XWEA 3HFYA 5FJOA 4RE3A 3ZJ8A 3L4XA 3O16A 1IEVA 7TAAA 1JYVA 2GUBA 3GNPA 4E4UA 4ZXOA 3VFLA 4GG9A 3H2MA 4AMAA 1ZALA 4QNWA 3QR3A 3GXPA 3U7VA 1X96A 3W2KA 2W3ZA 1YYAA 1QK2A 1EOMA 3I6RA 2G41A 1K7FA 5FJUA 1OF8A 3AHZA 4J2MA 3BAXA 1GORA 4DO7A 5FAJA 3TLLA 3VZXA 2UZ9A 2ZC8A 2YKKA 3C2RA 3S42A 2XIOA 1WDSA 3WD2A 2QCDB 3JR2A 3RN6A 2V3FA 2CLPA 3B8TA 1A0EA 4G9PA 4GUHA 1A5MC 3OGRA 4HIBA 4LUJA 3H24A 1G4PA 4AZ6A 2Y5JA 3NJ3A 1UCWA 1GVOA 2NLYA 4KCWA 3GR7A 3NZPA 4MWAC 1NM9A 1DYSA 5SWUA 4PEEA 3EKLA 1GZGA 3WNKA 1HN1A 1UBPC 3HG5A 4H04A 3VCRA 3GRIA 3G5EA 3WJYA 3THDA 3T0CA 2EBNA 3I3BA 3LHYA 2GGIA 1XSIA 3GTFA 2PODA 4LS0A 6PTDA 3BO9A 3K1GA 1XBXA 2WV8A 2YOCA 1EQCA 3II1A 3AXXA 5FJRA 1US3A 4EOUA 2ZC1A 2W27A 3VD7A 1X6NA 5ABHA 4YU1A 4KCTA 2GQ9A 4DUOA 1YX1A 3GG0A 4F0SA 3IV3A 4MJZA 5CZKA 4IGSA 1NQ6A 3PR2A 3FS2A 3L68A 4MKSA 1GYLA 4WXYA 1TQJA 1WAUA 1N82A 3ARRA 2OO6A 4E5TA 1UASA 5CJ5A 3QGVA 1SW0A 3NQBA 4AWUA 1RCQA 3EGJA 4LUTB 1KGWA 1KC7A 4JPGA 5DT5A 4LALA 1SGJA 2BMBA 4WVXA 5H2ZA 4US6A 2WNQA 5KZEA 2JIWA 5EGRA 5CZJA 2XVGA 4OGZA 4YVVA 1GVEA 1O5KA 3EOSA 3T6CA 3MS8A 4RPPA 3OODA 4DF0A 1BRLA 2DVUA 1P0EA 1K8YA 1RXOB 3UG5A 3UZ5A 1JZ6A 3GVRA 4BZYA 3M64A 3L7RA 3SCSA 1V03A 1EGZA 3WY1A 4F0HA 4DUVA 4WDWA 1VBRA 3DBPA 2BY2A 2QS8A 3TU9A 2BOEX 4F0KA 3R0DA 1J0HA 3N3MA 3O1NA 3GX9A 1EUNA 1UHVA 3M0KA 4AZCB 2ESCA 1ZBVA 4CQCA 2PTZA 2VNCA 2Y7DA 5FSEC 3K8MA 4RE4A 1XYAA 1A0DA 1E6QM 3CIVA 1WAWA 3KRZA 1O5RA 4LVFA 3G1SA 1IEXA 1XUUA 1Q6CA 3VA8A 3QPYA 3WF1A 1ESWA 5CPLA 4GI9A 5CPSA 2PP0A 1V7AA 1VYPX 3LHTA 5G4HC 3KS6A 3OA3A 1UKQA 5HANA 1X1OA 1MUWA 1GCYA 1VRDA 3CLWA 4H9VA 1DE6A 2RHGA 4C7FA 2A21A 4XZWA 3VKKA 1ICPA 1L0PA 1UUQA 3ES8A 3VX0A 1WUFA 4BJHA 3OGVA 1V79A 3UWZA 4L80A 3CPGA 4B3ZA 4JEJA 3AYTA 4MY8A 2E5CA 2X05A 1CB2A 5AY7A 1KQYA 3M7SA 4X9SA 1XGEA 5KZ6A 3M6DA 3VM7A 1PSCA 4NAFA 4HA0A 4RPQA 1ODUA 5AOUA 2WMIB 2R1KA 2OR2A 1CNVA 3FHQA 3BGGA 2XIJA 4HA4A 1UWRA 4GH1A 4DLFA 3CUJA 3MCOA 4MDOA 2JALA 3TR2A 3O07A 3D3FA 2CZFA 3O06A 3L5AA 2X30A 4S1FA 3GHUA 1V6YA 4WJEA 3EOLA 5FEZA 4URIA 1LDCA 1XLDA 3KLKA 1I4NA 4CEXC 3MJMA 4PMYA 1QI2A 1W2VA 2B4GA 3QRHA 3V5CA 2CW6A 4UXDA 4UZSA 5LSMA 4FLRA 5DT7A 3RPMA 4KCVA 2X0SA 6CGTA 3TWBA 1B4EA 2CITA 2YXXA 1FRBA 2YLAA 5C5YA 3S6OA 4ZQNA 3HIJA 1W8GA 4JTAA 3SUSA 3UZZA 5JBEA 2A3AA 1OQFA 3A47A 1XFBA 1M6JA 1G5AA 3MMUA 2A6LA 1R38A 3UR2A 3HG2A 3LCFA 1UOKA 5D2XA 1UWQA 4IQJA 5GJNA 1EH9A 3J7HA 1DWAM 4WD0A 4AZBA 4Q8VA 1S39A 3G0XA 1GVIA 3CHVA 5C9RA 4A3RA 3C0LA 1NQKA 2FB2A 3M07A 2PDWA 3W2UA 4I3GA 3UY8A 3QR0A 1HQTA 1E1CB 3GW3A 3LLXA 2R1LA 2ZXDA 4DWSB 1FXPA 2Z1SA 2YDSA 3HTWA 5I78A 1KRAC 1XR2A 1YRRA 5A6JA 3BLKA 4PMVA 2JEPA 4A2SA 3IUIA 4UNLA 3BAJA 2VTFA 4JTFA 2C7FA 5I6SA 5AYIA 4GPNA 4HNLA 4M8UA 2XIIA 3LS9A 3T0AA 3SUWA 3IS4A 4H7ZA 1J0KA 2EG7A 5AHEA 3BE7A 1UROA 3V4BA 1ONXA 2WPGA 1S1PA 5A6AA 4H6QA 1BWLA 3LM3A 2V5BA 1G01A 2VC6A 1EC8A 3E49A 1TCDA 2QVHA 4H6KA 3K4WA 1TPEA 1IXQA 1M7XA 1IGSA 4IL0A 3T07A 3FKKA 1O1ZA 1JZ7A 4CQDA 4C60A 2X1SA 4QE5A 1EJ7L 2C71A 4AU0A 3G3DA 3AIRA 4UZUA 2H90A 2ICSA 2PF8A 2TMDA 4J2PA 4G1NA 1LT7A 1TUFA 4HHLA 4R34A 4D71A 2BY1A 2OPJA 5HNNA 2INZA 3MUY1 3G2GA 2VELA 1GTEA 2O9OA 5A2CA 1LL7A 4XBJA 4FNSA 5HOSA 5EYWA 3DGBA 1VLIA 3LXBA 3G6MA 2E7FA 5CSUA 3RILA 4ADSA 4O0QA 1H11A 4EANA 2IKJA 3BLDA 5EMYA 1P5BA 1QJWA 1AMKA 3N2MA 3BK0A 4I7UA 4KFNA 2H6RA 3SCWA 2VI0A 2NQHA 3EOOA 4DQWA 4PB5A 3LBOA 2QJMA 1TV2A 3CWNA 5KEZA 2XGBA 3VD3A 3DKLA 5DMMA 1MDRA 3PSWA 5AN7A 2PWEA 3IGUA 3ZFHA 3TTQA 1GTHA 2E6AA 1HVQA 4LS2A 2VZTA 4PMNA 3DERA 2B7NA 4LF2A 4UMCA 4JAWA 1HTIA 2ZE0A 3PP7A 2XU2A 4JGDA 3ATZA 1QOPA 3OIXA 1M41A 1UD5A 3WBYA 3CZGA 1UWSA 1YIXA 4QGCA 3M0YA 3FDGA 5EFDA 3OPSA 3W7QA 4QJ5B 4HOWA 1MRQA 3TH6A 1JD7A 1E1EA 1ITQA 3P60A 1UR4A 3TJLA 2D20A 3W26A 3ABZA 2VP8A 2FJUB 1UKOA 1WKYA 2GDQA 3LBCA 1GVQA 3GTIA 2GLKA 1M03A 2ATMA 4FX6M 3LMZA 3W07A 3VIOA 4QSHA 1E9YB 5HNRA 2PWUA 3L12A 1J18A 5EMKA 4LV4A 3TCEA 3BZJA 4XUYA 1W5PA 2NWSA 2XIMA 2WVTA 2PDKA 1PPIA 4H9ZA 4Y9MA 3AO0A 1JCJA 3KOWA 1FCUA 3S5YA 2JKAA 2OMAA 1CWYA 3AS3A 2E5DA 3GZAA 3UG4A 4JBRA 3BW4A 1ZRQA 4X0VA 3VGDA 1SFTA 5FEXA 3S1GA 4GFSA 1A80A 3VGEA 3IANA 1C8YA 4OJYA 3R13A 5I2UA 4E4FA 2FQIA 3KHDA 3XINA 3CC1A 3OLEA 2UY3A 3MTWA 3GH4A 1A3HA 1W1TA 1K9TA 5BXTA 3MI6A 3A4WA 4Z1BA 2GOKA 1J0JA 1EBHA 1KBIA 3ABSA 1KM1A 4GIYA 4NZJA 3P81A 4LUSA 4ZB5A 4PUEA 4QE1A 5IRPA 1LP6A 5A8QA 1O5XA 1V6WA 2WOQA 3SCRA 4IP7A 4J3VA 3NL3A 2PDLA 3TIMA 5CJMA 5AB3A 3CB8A 5M3WA 4AD1A 3MKKA 4O1DA 5GNYA 6TAAA 2Z7GA 1JCXA 4L9YA 3BUVA 5E5CA 4OT7A 3HGOA 1E4LA 3U5UA 4C5YA 2DUZA 1ZJIA 1LL4A 2PU0A 3UR5A 1S5TA 1BYCA 1HKVA 3L0NA 1GG0A 1V08A 4I6VA 4PMDA 3PBMA 1ZJHA 3F03K 2P50A 1H4PA 1AK5A 5C9XA 4OFCA 4KIRA 3ITVA 2D2HA 2G96A 1AD4A 5E0FA 5LGZA 2PWVA 3A4JA 3QC3A 4NNBA 3TOPA 5DMYA 1V93A 1UP3A 1YW1A 5D9MA 2VM8A 1E70M 4TUFA 4NXSA 3E96A 3U4FA 3BCDA 2G4FA 1BSLA 3R94A 2ABBA 3ARSA 4M81A 1BKHA 1GOWA 3K8LA 1BG9A 1HNYA 1G94A 4A35A 4S3AA 4Q3MA 3PJTA 1FWNA 2VCBA 4ZQMA 3TONA 4RCXA 5EBUA 3SDOA 3ARWA 1KM3A 2PTDA 3DFHA 3ITLA 3MHGA 3OZYA 2CZ5A 1FHVA 4DXVA 4DZAA 2CLHA 3GR4A 5FF0A 2Y89A 5HJYA 2D24A 1S38A 1PZ2A 2GZXA 9XIMA 3W7EA 3QFEA 1RP8A 2YCIX 1EDTA 4QLKA 1OFQA 3G8RA 4PMZA 1LZOA 4NVTA 2V82A 3AUOA 1FHLA 4NT0A 3L23A 2YCEA 2AGTA 3B0XA 3N1AA 4O18A 3SZ8A 4C5ZA 1Q6LA 4JFTA 1JDFA 3BG9A 3TTSA 3M5ZA 4O1AA 3FDKA 1PO9A 3PUGA 1MFVA 3H8AA 4DWDA 1OYCA 2WM0A 3B4UA 1W3JA 3GDKA 3UNDA 1IHIA 2VZSA 4FX8A 4JICA 1MO0A 5U4NA 3CT2A 3BAWA 2FMNA 2B0MA 4HSOA 3RIKA 4AIEA 1Q6QA 3P61A 4ADTA 1J01A 1V0LA 2QXWA 3BLEA 1ITUA 3UW6A 1Q66A 2C79A 3CHCA 1MW3A 5KETA 1UJQA 3ZWTA 3M0IA 3UWQA 4O50A 1G7UA 1DV7A 3GVWA 1DQXA 3NQGA 2QJIA 1H60A 3NPUA 1ECEA 4PUKA 3H7UA 3APYA 1DWHM 5BRPA 1AJZA 1FDJA 4FAMA 2BV9A 5EMLA 5EMMA 4CNSA 4XKYB 4UCGA 4IMDA 4MKNA 3QMRA 4XAZA 4H9MA 2BXYA 4H4IA 1HL8A 3WQ5A 3TSDA 3AICA 8RUCA 3VDGA 4DNHA 1UZHA 4WKFA 3UBPC 2JE8A 2QYGA 5GNXA 2B31A 1PV8A 1KFBA 1UKTA 3A3XA 4RE2A 4AX6A 4NZ1A 4Y9AA 1RA0A 3FEQA 4I5UA 4LVBA 5DO8A 3BOXA 2R1PA 3VE7A 1R87A 2OODA 1XYBA 1F6YA 5HUOA 4YWSA 5T9CE 3GHSA 1WB0A 1PCKA 4CN4A 3NYZA 1EB3A 2VCCA 1PDZA 2NUWA 4KWSA 5B7ZA 2HVMA 2XIBA 3TXZA 2BXZA 2ZZ5A 3R10A 3P7YA 2Z0IA 4F66A 2W0UA 1J9YA 1OVDA 1GJWA 2VKZG 1VC4A 3WJWA 3WELA 1I6NA 2GGJA 1A5NC 2EPKX 3AZTA 2QPXA 4M6PA 3S5SA 4P8WA 5JH2A 2WLZA 2R9RA 1BYBA 3BLLA 2V2DA 4UCFA 4G5DA 5LIWX 5T8GA 3IK4A 1FWDC 5IFPA 3W83A 3L4ZA 4EAYA 1E1FA 4MNKA 4YXGA 1XIGA 5DN1A 2C91A 1EDQA 3FSUA 3WLJA 2VR2A 3G1RA 2NQ5A 1VQTA 1KBBA 4Z1AA 2V9DA 3FEMA 2OYLA 2ACSA 5LNSA 1PHWA 3WUEA 4K38A 4KWWA 4ML9A 5J8LA 2J27A 4WOZA 3NM1A 3WMSA 1WZMA 5HPCA 1V3LA 4WXZA 2QIWA 4YYFA 5D05A 2XINA 1NEYA 1FWSA 3EB2A 5BWAA 3C6CA 2CHRA 4Q8PA 3WLNA 4EF9A 1LUCA 5I3KA 1J5TA 5JIPA 5C8BB 2XDFA 4UTMA 2Y7EA 4MB5A 1O95A 4I9MA 3NG3A 6XIAA 3TTEA 5I5RA 3LY0A 1YE6A 4QTGA 3MMWA 1HT6A 4GI8A 4C6OA 2QDHA 2HSAA 2YA0A 5FCZA 5CC3A 4TQTA 5F2MA 3KOFA 1M04A 2F61A 3KCLA 4MNJA 3RM9A 1YTEA 4N9DA 4YLWA 4U3CA 1FDZA 2WLYA 3L21A 4AC7C 1OHLA 4ZQRA 2PRMA 3PF3A 4P5UA 2EAWA 2J7CA 2Q09A 2WMHA 1A47A 3OYXA 1XKYA 4WLCA 4HYVA 4B16A 3WLIA 3SN1A 2ZX9A 2WZIA 5JBFA 4YNGA 1TMHA 3W38A 1J6PA 2PAJA 1W3TA 4DI8A 3AI0A 3DENA 2QT3A 1T8XA 2O55A 3GC2A 1XICA 3U2OA 3BMXA 4KIEA 4GLEA 4HK7A 4HCDA 4UOZA 4CUCA 1U30A 1F07A 3M5VA 3VCNA 2ABAA 3T4WA 4B3LA 5A6BD 3E0WA 4DJFD 5AFDA 3NQ2A 3CM4A 2G50A 1DJQA 1DPMA 4PTMA 3W6LA 2YCLB 1VHCA 3TLQA 3AHYA 3WQ8A 1C91A 4JOMA 1XDMA 5DELA 4A3UA 4CNTA 1GQJA 1IXNA 2I1OA 4H41A 4UQDA 4FS9A 2INFA 4CU6A 3BICA 4DJFA 4JIEA 2Z1KA 1SQ7A 1FWAC 4JN7A 4HPGA 2QNEA 4H8NA 3GG7A 3GXFA 2QUVA 4XZMX 3WNOA 3MCNA 3URQA 2WHJA 1I9CB 2ZX6A 3CZ8A 1Q6RA 4LUIA 2PRLA 4GKLA 3V1HA 4JX6A 2J78A 7REQB 1IIGA 4OOZA 1BGAA 1IT7A 1NDYA 3GXIA 2RKXA 4WRHA 2WK2A 1KFKA 5GVJA 5LIUX 1TZ7A 1OFEA 3RMJA 1VCGA 4CN6A 2QUMA 4UTWA 1BSIA 4XAPA 4ACZA 5CCZA 1ZNNA 2ZRXA 3U57A 4IJBA 2HE8A 3LUTA 5DFAA 3TXVA 3N2XA 3THUA 4JN8A 1BTMA 2EEXA 1OABA 3NQDA 3IUHA 3NURA 5H8UA 4V27A 1H62A 4KETA 3DHDA 1TMLA 1XH0A 3AMDA 4QDMA 3BCFA 3DG3A 2GYIA 4CEUC 4MGGA 4U3AA 2DY3A 4O16A 3IVUA 3CHDA 2PDFA 2J6VA 1YDYA 2CLMA 4RXGA 1XLEA 2P3ZA 3TJIA 1L6SA 1IV8A 3F2BA 2PDGA 2CU0A 2QCGA 3L2MA 4ERIA 1UKSA 4ZQPA 3LCWA 2CC0A 3L5MA 3AIVA 4WY0A 1IYXA 3N29A 4AYSA 3W6YA 1VBUA 2VX4A 3QY6A 1HKKA 5C70A 1WO2A 3VTRA 2WXDM 3DFNA 1S2WA 1CI1A 3TWAA 9RUBA 4NX5A 3FYYA 4MDPA 5TNVA 1VCFA 2DZSA 2FGBA 3E0IA 3OHMB 2PRHA 4PMRA 3CWOX 4J27A 3HPZA 1FP8A 3VIJA 5A95A 4WEVX 2FHFA 2DFAA 5LXEA 4PCSA 4HK5A 3OQEA 3R1ZA 3L67A 1XC4A 4RKAA 3RMEA 1UUMA 2PD5A 4IFRA 1MSSA 1VF8A 3MO4A 3WN6A 2VENA 5E70A 2ZUUA 4PMUA 4JKLA 5F4WA 2PU1A 1MRAA 3GSMA 3N9RA 1TV8A 4E3TA 2A7RA 2C1GA 3U6WA 2A85A 1AQMA 4ML4A 1K3UA 3A3WA 2D2GA 5DY2A 2PDUA 4PUNA 1C8XA 1V3MA 2BGNE 2EPNA 4KQNA 1RD6A 1HKIA 2YFOA 4K2SA 2VZVA 4QROA 2Z6IA 3N17A 4QXIA 3MWCA 2GVYA 3LSCA 1P0BA 1UQZA 4N4QA 5G1YA 3OEXA 3O6AA 4O1EA 4OECA 4XB3A 3WF0A 3FLUA 3DOPA 5CLWA 2WC4A 2ZX7A 4AFYA 1R3RA 2VVSA 2J79A 1A5BA 4Z1DA 5E6ZA 4BQ4A 4NJJA 1RLCL 3ITOA 3UR7A 3FAXA 4ZTYA 2PWFA 4QJ1A 5T26A 4JTTA 4FXRA 1UBSA 1MUMA 4DXXA 2GJXA 3VX1A 4K1GA 4QG9A 3AYSA 3TE9A 4MNMA 3PSVA 5G2WA 1XFCA 1VFFA 3N34A 3VC5A 5HMFA 3B9OA 4LYQA 4NSBA 3WNNA 4IFKB 1MDLA 3CPUA 4OHQA 4U5IA 3OOQA 2CBJA 5C7HA 2CNCA 1I2PA 2OX4A 1FCBA 3UA4A 3GIPA 4F2BA 3KBNA 5HR7A 4AVNA 3PBGA 2ASHA 4NJHA 3KBMA 4J3XA 1H1YA 2ALDA 2CHNA 4ZOCA 1ME9A 4O53A 2P8BA 2AQVA 2QCCA 1QPNA 2QCNA 4ICNA 4PBGA 1QUMA 3WQDA 3HBLA 1IZCA 2XHYA 2YJQA 2R14A 3GXTA 3LA4A 2P1FA 1Q3NA 1BPLB 3P67A 1MEHA 1EGMA 1WNOA 4ILSA 3TC3A 4M7TA 2BWGA 1LLOA 3O7UA 3SUVA 3FJ6A 1V8EA 1ISVA 4NX0A 4X2RA 2PDBA 3P8IA 2QDDA 1G4TA 3W1NA 3HOJA 2FB3A 4KBXA 4CVUA 1IT0A 5HA7A 5I3HA 3ZT7A 5BOOA 1LG1A 3WMBA 3PWGA 1RA5A 3UWYA 2P0IA 4BI5A 2XSXA 3ANUA 4U2ZA 2Y70A 2QMKA 5HAOA 4GYKA 1P4CA 3PG9A 1XYFA 1KRMA 5C2CA 3MYPA 4RNHA 3RLUA 1A5LC 4BKNA 4LX4A 5JU6A 1RV8A 4DO4A 2X42A 4P7QA 3AIQA 1P0DA 2I16A 4R5EA 1IZJA 4DJFC 2D1ZA 2NX9A 1F6PA 1ECQA 5TD4A 1ADOA 1TV3A 5HBFA 4Y90A 2GSEA 2AQWA 5M1TA 1XWYA 3M1ZA 4QNEA 2Y4SA 3PS7A 3AAMA 3VOFA 5HNUA 2E4TA 3TW6A 1KA9F 4KFPA 5LA2A 3T2PA 1J0YA 2V68A 2J7DA 4DEFA 4RV8A 1EXPA 1KCXA 1SR9A 3TYUA 3E5PA 2BGQA 3ZJKA 2DZUA 3RLVA 4G7EA 3QN3A 1WKEA 3WLMA 2G95A 3CXOA 4S3GA 4UTWC 2A79A 2IS7A 4EPDC 3VYLA 1UR3M 1T5AA 1CXFA 2QDEA 4I7VA 3QY7A 2E09A 4PMXA 1RK5A 1RCOB 3BMWA 1CB7B 3V16A 5CPMA 3UXDA 2DZBA 3W7IA 4G6CA 2PTYA 4AZCA 4DBWA 1K4HA 2ZZ7A 4GO9A 3VKCA 3CS2A 1TCMA 1XLIA 4FK9A 5JH1A 4LXFA 5LYRA 3L5LA 1XRSA 1GQNA 1XLGA 3RX2A 2AQOA 3UYCA 3MKCA 3H26A 5AC5A 1VENA 4FX7A 1GOXA 4CD6A 3EKGA 5ABTA 4ZSUA 2ZDSA 1H0IA 4NZ4A 1LLZA 2J8FA 4UFLA 1P1MA 4PUMA 4JTKA 4B5NA 1ZL1A 1XH1A 3M0XA 4W4QA 1A50A 3NO3A 2VEPA 5G5IA 3E0LA 4JTLA 2NSXA 1XM3A 2NQJA 1M7OA 1FH8A 1M01A 3IJ6A 3ICJA 3ITYA 2WBGA 2GVLA 3ME3A 4K7YA 1G0CA 2V5LA 4ERAA 5ABFB 3WYZA 3DGRA 2WZHA 3VIMA 4R88A 2XN1A 3Q4DA 1QBBA 2V3EA 3VKBA 4WJXA 1UD4A 3M5YA 6A3HA 3CAQA 3L4YA 4LQ1A 5LIKX 2QGHA 2AMGA 4Z2HA 4HMEA 5HJXA 2GK1A 2Z25A 1E56A 4Z0SA 1ZUAX 1MI3A 1HW6A 4NZ5A 1Q7ZA 1EPXA 5CBBA 1JUKA 3MMTA 3BSHA 3N4AA 4AZHA 1GW1A 1BG4A 4PMOA 3L65A 2Z4GA 1SZNA 4H9YA 1FWFC 1AODA 2YLLA 1FQ0A 4GYFA 1RR2A 1RQHA 4ENLA 4P8XA 4KF1A 1TPH1 6ALDA 1VEOA 1IR1A 1Y65A 1YDOA 4XX6A 3SEPA 1KGXA 5LNVA 2YA1A 1GQIA 3ZIZA 1QWGA 4C1KA 1D3HA 4Q4OA 1V3HA 3PTDA 1KM4A 1Q4NX 4GJIA 4TU1A 3VABA 3C2VA 3UG8A 1T40A 2PC8A 1GZJA 1GJUA 4DIAA 3ARYA 7ENLA 3BOFA 2ONEA 3MZ2A 4HMCA 1C7SA 4EP8C 2VFHA 2WZMA 3M0LA 1XF0A 3WO8A 3H2EA 1K77A 1R6WA 3T8LA 5F1VA 2QAPA 4Z0JA 4IGMA 2PEVA 4KEVA 1PB0A 2F38A 3U7BA 4GGHA 3VNYA 2D2OA 1DIKA 3ABXA 4CKQA 4L64A 1TX2A 5JQ9A 3WNMA 3S9IA 4FR6A 5AZ1A 3EXTA 2GFTA 1FDYA 3CO8A 1JZ5A 2VC5A 1G69A 4LEFA 1B90A 4Q33A 4PB3A 3LK6A 3F1QA 4HHMA 2JEQA 5J04A 1TB3A 3UWWA 2NXGA 2ZDRA 3G3MA 4GQQA 4OBRA 3ZQ9A 2XFWA 3FHAA 2YBTA 4HNNA 2FH6A 1E9IA 1GJPA 2AL2B 4KS0A 2TYSA 3T42A 3ZVHB 4AX7A 1ONEA 4GUJA 1OCJA 3VNIA 2CETA 2HPIA 4BA0A 4Q4PA 4GY0A 3FJNA 1GOMA 4RNFA 3AWOA 3LHZA 4MOZA 1K4GA 4JTCA 1TE6A 4HZ7A 5XIAA 2VQTA 1EF2A 4XV0A 1S5MA 4Q8OA 5C6MA 1PX8A 2YA2A 3DUGA 2BXVA 1Q2SA 1A5OC 2FVMA 4O28A 5I09A 3QKZA 2KZHA 3FJLA 1JDCA 9XIAA 4O17A 3BSGA 3DN5A 1F74A 3RITA 2DJLA 3WEMA 1GOIA 1BLIA 1X6LA 3MWAA 4TX8A 4PUDA 2TAAA 3S3GA 3MV11 1TJ0A 3PZ9A 5AKQA 2MANA 1A4LA 4M0XA 4WCJA 4DJDA 3A22A 3L9CA 5H8MA 1F73A 5IM51 5HWJA 4KEUA 4ZO7A 2QR6A 2NUYA 1QCWA 1KBKA 5CGQA 3VOIA 3IEBA 1ITCA 1BAGA 1IXOA 4LS1A 1AJ0A 1VPYA 4O8RA 3SCOA 3GAKA 3KWSA 2E9MA 1JIBA 2V6AA 2CBVA 4WJ8A 4LW7A 1EWDA 4MPQA 2WSKA 2UY5A 1XUZA 1I1WA 1O7AA 2PP1A 5LGXA 4IISA 4X0NA 2HEJA 3N11A 4GYJA 5HMSA 1UG6A 5REQB 2XISA 3RM8A 2NQZA 2JGYA 1ZB5A 3S1XA 4ZE5A 3H23A 1G67A 3MU7A 3ZJ7A 2CZEA 4XZBA 2J8TA 4H7VA 5FF4A 3ANYA 1BD0A 2DW6A 4BF9A 2WJDA 2EJAA 1L6WA 1XIBA 3F5JA 1G9HA 3QZAA 4TR9A 3PBUA 1Z9AA 4FXFA 5D2YA 2Q02A 1Y7VA 1P7TA 1A4MA 1CX9A 5FEPA 4R3UA 3E9AA 1CXLA 4E2DA 4J7RA 3ZMRA 4X22A 5A6SA 3A23A 2F2KA 1L2UA 3U2EA 3E74A 4EPBC 1B1YA 4MJMA 2OLSA 2E5BA 2NX1A 2FVLA 4LC6A 4JL1A 1PBGA 2W5FA 2JF6A 3UZYA 2J74A 2YXGA 2BHZA 2NXIA 4IG2B 2NVCA 2ZA3A 2GDVA 5DXXA 4E4PA 4N7QA 2F6UA 4JFUA 2IQTA 3OVGA 3QQWA 5E6YA 2E9LA 3UYIA 3C52A 2A4AA 2GJLA 3EWYA 3NQFA 4IIGA 4HYWA 2VDIA 4QR6A 1C9DA 4RZ4A 3W7HA 4I5RA 1H49A 1OIFA 4RW5A 2D3NA 4ZENA 3MP3A 3S9ZA 4KKXA 2DQXA 3KS5A 2OB3A 2QGYA 3EMCA 3IWPA 4GY1A 4C6LA 1MUCA 3GKAA 2VRKA 4MB1A 1ISXA 3MVIA 2BP1A 3DU0A 4IP4A 1LG2A 3CV2A 3U0HA 1Q6OA 2P3EA 1PKYA 1XRVA 3KOZA 4DJEA 4D6CA 1X8CA 3TW7A 8TIMA 4LV9A 3TN5A 4PEKA 4UR8A 2X41A 5F2LA 5D9OA 1F61A 3LCIA 3WUBA 3REQA 1E9LA 1N8FA 3D46A 1LQ0A 4O52A 1YBQB 3JVAA 3UVIA 1LBMA 3TX9A 3WH9A 1SO4A 2NW0A 2C16A 3GZ3A 2QHAA 1EZWA 5D9NA 1XRFA 5EY5A 3VUPA 4LB3A 1J2BA 3M16A 4F0RA 2OLHA 1ONRA 2WKJA 4UFHA 3RX4A 1FXQA 2ZXAA 1YMYA 1E5NA 3I3EA 5U7SA 1DP0A 1PEZA 1JZ3A 5EBAA 1P6WA 3VKAA 2VEKA 2RDUA 4DLMA 4GJ1A 3WFAA 4MF4A 1V02A 5FJTA 4Q7BA 4J3UA 1OD0A 2GGEA 4QISA 1CXKA 2WCGA 4A3HA 1VGAA 1WOAA 4AXNA 1X97A 2X16A 2Q01A 2G8ZA 1IEQA 4D6HA 1NOUA 5FF3A 2YDRA 3DFTA 3OLDA 3QF0A 4DYEA 3CO4A 2Y62A 3FFSA 4UFJA 1RLDA 4GISA 4YYCA 2WJEA 1AL8A 1VFMA 2I57A 3STPA 4RDZA 2BG5A 4YTRA 3EXRA 4HN4A 4JTJA 2ODOA 3ENLA 1HX0A 1EXBA 2D0GA 2C8NA 5AHNA 4NAEB 1KB3A 2G4JA 2ZYFA 4GC4A 5M5DA 2IPGA 1U33A 1VD6A 3HJEA 2Y1HA 3W87A 4XZHA 1R3VA 3CYVA 3W2MA 5JUVA 1TVNA 2P88A 4N02A 1AA1B 4HTBA 3DG7A 1W3IA 1CGTA 5CXPA 2Q3RA 2Y85A 5CZ0A 4ZOEA 1K8ZA 4Z2KA 2BBFA 4M1RA 4XKMA 4AISA 4CNPA 3OBEA 1KLZA 4J5NA 3UZXA 3TTOA 1KFWA 3B06A 4B92A 1DIEA 4ATLA 2ZRYA 4HZMA 1PYFA 1QNVA 3W27A 3QZ6A 5I3IA 1JQXA 2HQAA 3K5XA 3B9DA 2FPTA 4GACA 1UYQA 2X2GA 4RL3A 4DJDC 1K9DA 1WDWA 5FI8A 4AVOA 1E43A 4KRUA 4X3ZA 3TJ4A 3I10A 5I03A 3NPVA 2ZRZA 4XD4A 4GABA 3LDVA 3DCPA 4J35A 4CGTA 3KE0A 4EWJA 3RHGA 1EJUC 2FJKA 5FF2A 3W0KA 4DUWA 4D2JA 2UY4A 2J4GA 4MWAB 1C29A 2QUTA 2H8ZA 2HZGA 2WSYA 4IPNB 1AZ1A 1REQB 1OFAA 1TWIA 1JGIA 2Y63A 2YYUA 3VINA 2Z1VA 3DYMA 1S3TC 3NQEA 1UWTA 2D23A 3O05A 3E0VA 4UFMA 5AZ0A 4R9XA 3ZO9A 4GOAA 5ABEA 1F4HA 4M24A 4QIUA 1OFPA 4B3KA 3SM0A 2WBKA 4ADUA 5A5WA 4LAOA 5I02A 1J5SA 4NJIA 1R46A 3NUKA 2BY3A 3VO0A 1JYWA 1QNQA 2FZNA 4TMCA 3DI0A 3UETA 1YDNA 3VIIA 4NHVA 1RJQA 3PBWA 3N12A 2OYMA 5HWMA 2I17A 2Q8ZA 3EMQA 3WQVA 3T2QA 5DX7A 3SCQA 3SCUA 1CECA 1P6BA 3V1PA 4UBPC 1MQRA 2YIHA 4GVIA 1OX5A 4TVDA 3CV7A 1QTWA 1QO2A 2CKRA 4B5VA 1UWIA 4AXKA 3NQMA 4KWOA 1KXTA 3GC4A 3ITGA 3AS2A 1TZ9A 2YGYA 4B2DA 2VEMA 3I7RA 3H22A 1FFRA 4QCEA 2HRWA 4CD5A 1HFBA 2J13A 3R79A 1MNZA 1R85A 1W9UA 2GPTA 1OYBA 3W1LA 2GQ3A 1C8VA 4MY1A 2E1DA 2Z1WA 1VLWA 2KX9A 2J7FA 4ZO9A 3KHJA 5CBIA 4MFDA 4HJFA 1THFD 1EUAA 1E6SM 4AZIA 2X40A 5E93A 4EAMA 5HINA 3KFTA 4Y9PA 4RK8A 4AZ7A 3AQUA 1SJCA 1NWRA 3RDKA 5CSRA 3UJ2A 1ITXA 4MJ4A 3K1DA 1EQPA 1YNYA 5CC7A 3PAJA 3BLOA 3HG4A 3R25A 3U3HA 2OZ8A 3VVGA 3GAYA 4DYKA 1QWKA 4FR1A 3DFSA 1YTKA 4M80A 4ZOAA 2XFFA 1V7YA 1XKJA 2VD8A 2HWGA 5EFFA 2JKPA 1EF3A 5HMEA 3A9IA 5CAHA 4KWVA 3W28A 4RW3A 2F2HA 3CQHA 4E8DA 4QS6A 1UH3A 4IP5A 3OIHA 3K4AA 4AEEA 3U9IA 1E55A 1FFQA 3ZZ1A 2YB1A 3IVSA 4GX8A 1KO0A 3S6TA 1U1UA 1TWDA 3AHXA 2QUUA 4PRWA 1O1HA 1V3JA 3PZMA 1EC9A 1CENA 1MXGA 1XYLA 2QEZA 1W5NA 3WF3A 4UTUA 1OC6A 4V2XA 3SBFA 1WBHA 3N2BA 4Q22A 3N9SA 4AIOA 2J7BA 1JZ4A 1UB3A 2WHLA 3L4TA 4OTKA 4R27A 2OT0A 3W25A 2HV5A 3WK3A 5HQMA 4NRSA 3LNPA 1VB9A 5IOBA 4UC5A 5FOOA 3UJEA 2V81A 5DEZA 1GK8A 3H6OA 4S3FA 4GD0A 1QNOA 4UQBA 3TUUA 3V0TA 3KVJA 3C2FA 1JNDA 3VZYA 1Z89A 1SFLA 1R8LA 1CEOA 8CGTA 1CTNA 3DIPA 4QLLA 3KTXA 1NF0A 1TTQA 2A5HA 3EB3A 3OB8A 4LAMA 1BYDA 4JTDA 4D72A 3UWVA 4IZGA 5HUPA 4U4MA 2W62A 1TTIA 1XIJA 2PB1A 1ONWA 3S2LA 3GUGA 1Z41A 5EMUA 3IJDA 3T40A 3W1PA 1V6XA 4DO6A 4QP0A 2OEKA 1ADDA 2VZUA 3QY8A 2E6DA 3NZ1A 4O15A 3U2ZA 2ZVRA 4PSPA 1KCZA 3O15A 3NR0A 5BXPA 4F2UA 4P8UA 1WV2A 3TOYA 1CYGA 3LM7A 3EDKA 5H6HA 3ITCA 1EX5A 4J9JA 1U5JA 5D03A 1P0NA 4K36A 5PTDA 1P0KA 3EX3A 3HV9A 4AY7A 1DWGM 1D2KA 5DRCA 4DZ5A 5CGTA 1Y5VA 3E38A 4GI4A 1J79A 2NT1A 3AROA 5HK4A 3Q37A 1WPCA 1FWIC 3P5ZA 4K68A 3P93A 3DXIA 3SRKA 4FZIA 3IGSA 3OG2A 5C7VA 3RX3A 5FIPA 5CZSA 3S5ZA 2ZOXA 1I2QA 3AJXA 3RCMA 4AHQA 5HPOA 1W32A 3VNJA 1W1IE 3PFMA 2WKGA 3CZJA 2ACUA 3BANA 1ZSXA 4NJKA 4F8XA 1KV5A 5I79A 2ZUNA 2ZVIA 1EA9C 3RPDA 4MJ2A 2OXNA 2PZNA 5H1WA 1AQFA 3MB9A 3BGAA 2ZCGA 2WAGA 2OOFA 1WYIA 2BHUA 1PAMA 4GQBA 4BEQA 1R9YA 5E9AA 2NT0A 5CAKA 1QI3A 1PZ3A 4MUPA 4M7SA 3DHFA 4Y8EA 3QYSA 1S5VA 2A3CA 1DBTA 1X8FA 2X8RA 1GT8A 2NVDA 1DWFM 2VWSA 2ZUVA 1DQWA 2OEJA 2E28A 4E3VA 2G5WA 1PJ9A 2E40A 4IX0A 2BVWA 1IEWA 1WXYA 3TDFA 4DB7A 3P0XA 1UR9A 2XN2A 1AH3A 2BSLA 1YPIA 4UOJA 3TCSA 3UNTA 2SFPA 1EIXA 1UH2A 2EXOA 4KRZA 1BRLB 4W86A 4J1OA 4LWWA 2YDQA 3WF2A 3ID7A 3QPEA 1W1VA 2HPMA 3GIYA 4HMNA 2DH3A 3WJSA 1L9WA 5RUBA 2YB4A 4X2PA 1MQPA 4DUXA 1XYCA 4E8GA 4XK2A 2H3DA 3N3TA 4N42A 3CJPA 2O7SA 4AAJA 1ZBWA 4ATDA 3SJ3A 3LENA 3QPZA 1EP1A 3TZFA 3WLQA 3Q45A 4PFHA 4BF5A 2GSJA 1F8IA 5GJPA 1ZS2A 2AKZA 5I07A 1JNEA 4NQ1A 3IV8A 1S2UA 2J9YA 3DZ1A 2RH9A 3S0CA 2WMJA 4JCLA 5BU9A 3EPMA 1HKWA 2WM1A 1P48A 1AD1A 2HXUA 3VD9A 4V1XA 3ZVIA 3U4AA 4N9BA