4TOQA

Crystal structure of class iii chitinase from pomegranate provides the insight into its metal storage capacity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
273
Chain Sequence
b'GDIAIYWGQNGGEGTLASTCDTGRYAYVIVSFVTTFGNFRAPVVNLAGHCDPAAGTCTGLSDEIRSCQGKDIKVLMSIGGGAGDYSLVSEADADNFADYLWNNFLGGQSSSRPLGDAVLDGIDFDIELGTTTFYDTLARALSSRSTQAAKVYLTAAPQCPHPDSHLDAALNTGLFDNVWIQFYNNPLAQCQYSSGNTNDILSSWNTWTSSTTAGKIFLGLPAAPEAAGSGYIPPDVLTGQILPQIKTSAKYGGVMLYSKFYDTTYSTTIKDQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class III chitinase
publication title Crystal structure of class III chitinase from pomegranate provides the insight into its metal storage capacity.
pubmed doi rcsb
source organism Punica granatum
molecule tags Hydrolase
total genus 95
structure length 273
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2014-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4toqA00
5CQ1A 4W89A 5FKYA 4H7VA 3EMCA 3ZSTA 1WDPA 1GOMA 2OYLA 5BCAA 1CBGA 1X6NA 4UFIA 2J7EA 4P7NA 3K8KA 1IZKA 1J11A 1QW8A 5I78A 1NOFA 2CHOA 2JF7A 1IV8A 3GXMA 1G1YA 1DWJM 3DHUA 3SCQA 5I0DA 1RPKA 5KZ6A 1WE5A 2BY0A 1NWRA 2WBKA 2WHJA 3PZNA 4QLLA 2J4GA 3U5YA 2ZE0A 1EH9A 2VZVA 1J9YA 3GTNA 5HNNA 1XH0A 5M17A 4UCFA 2WK2A 1NWUA 3EMZA 3PBGA 1SMAA 5E70A 2J74A 3VD7A 2VRJA 3G6LA 2YL6A 2EPKX 3L4XA 2XFFA 5CJ5A 4FLRA 5DEZA 1WDSA 1VBRA 3AMKA 3UEQA 5A2CA 2DH3A 2DQXA 3WD1A 3CZ8A 4ZEPA 3AHZA 1XHGA 4BF7A 1WNOA 1OB0A 2WVSA 3J7HA 4WSJA 2GK1B 3OLGA 1MFUA 3GH7A 3M6DA 2QHAA 3W29A 3LPOA 4J27A 4JKMA 1EGZA 2OLHA 4PMOA 1KR1A 2V3FA 5LA0A 5TD4A 3TTQA 1N82A 3WDJA 5BYWA 2VRKA 1MW2A 4H04A 1V6UA 4UQBA 1V0KA 1TG7A 3ZJ7A 1QHZA 4PMYA 4W7VA 2ZIDA 2CXGA 2VO5A 4JL1A 4DWSA 1YHTA 4R5EA 4AISA 1XGZA 2ZUUA 4LXFA 5KEZA 1XH1A 1US2A 3BCFA 1E6QM 1EIBA 2O92A 4UQEA 2ZX7A 3GH4A 4AD4A 3VIIA 3N18A 3AFBA 2WLYA 4NZCA 1E4LA 4S3KA 4UFKA 4OJYA 3WMBA 4B9YA 2XSBA 3K4AA 5AC5A 1UWTA 5D4YA 2WLZA 2E9BA 1M7XA 3L2MA 1EO7A 3WUGA 4IUGA 4GQQA 3NCOA 3JUGA 1V3IA 2WWCA 1HJWA 1UA3A 3NDYA 2A3HA 4K68A 3S2CA 4A4AA 4GZJA 2OSYA 5HPOA 1J18A 3W6LA 3CMGA 1UR1A 4AZGA 4UOJA 2RGLA 2QV4A 2Q8XA 4JKLA 2WMIB 2AOSA 6CGTA 4HOZA 3EDJA 5CPSA 2ZX6A 1W1PA 3KE0A 3VDBA 1IZJA 5M5DA 5F7UA 2PWHA 3MKKA 4U5IA 2D0GA 1OIMA 1NM9A 4PTMA 1J12A 2WC3A 1WPCA 2E40A 4CD8A 3WDRA 2OYMA 1BAGA 5BWFA 3AOFA 5E0CA 3ARWA 2FH6A 3CUIA 2XUCA 4D72A 1JFXA 1HP5A 2VNCA 4PMDA 4J3VA 1JYXA 3KEHA 3VKKA 1VJSA 3RM8A 4M80A 3MS8A 1RP8A 2G3MA 1J0JA 1A47A 3WIJA 3AIRA 4JHZA 1U33A 4BQ3A 2VT0A 3T08A 4DUXA 5A8NA 1HJVA 1KXVA 2VX7A 2VMFA 1G9HA 2W61A 1VAHA 4NRRA 5AC4A 4GI6A 3AYRA 4M82A 4WKHA 2YL5A 1XSKA 2G3NA 4MAZA 1CTNA 1E73M 4PRWA 4S3JA 4XZBA 1UWRA 1WZMA 3FXYA 3VNZA 4U31A 1JAKA 1J0ZA 3ZJ8A 3KL3A 3RMEA 1VRXA 3VIKA 2GFTA 3WF3A 4PMVA 1J10A 1LL7A 1V6VA 1E6RA 1GHRA 1QI3A 3RIKA 1GJUA 4UQCA 3VVGA 3F5KA 8CGTA 4CD5A 1BVZA 2PI6A 1D2KA 3WMCA 2F8QA 2WHLA 4JFWA 4H2CA 4WIWA 5DO8A 2WVUA 2BFGA 4HZ8A 1XYFA 4YHGA 3VILA 2ZUWA 3CZGA 1BLIA 3CUGA 3BH4A 5CPQA 5CXPA 1PX3A 5I24A 4AD5A 3FW6A 2CITA 4EANA 3RDKA 2Z1KA 2WMHA 4ATLA 3SURA 1MFVA 1DWHM 4C7GA 3VDCA 1K9FA 6TAAA 3VIOA 2VQTA 3W26A 3WF1A 3PZVA 1CXFA 3EDKA 4L4OA 4EAMA 2XYLA 3WF0A 4X0VA 1H11A 1PJ9A 3PZTA 1KB3A 2WKGA 2Y2WA 3A6OA 1YQ2A 2OWXA 1BQCA 4AZ6A 2GK1A 2WSKA 4PMZA 3VINA 3QR3A 2ZXQA 2B31A 1PBGA 4OIFA 4J3SA 4E4PA 4J3TA 4NSBA 1HX0A 1E4NA 4QAWA 4TUFA 5JBDA 1W3JA 2IXVA 4N0RA 4URIA 3EBVA 1E3XA 3ZR5A 4E8DA 5ABHA 3NIYA 2A3CA 3WNMA 4W85A 3GH5A 1B3WA 1EHAA 4N42A 2NSXA 1MW3A 4F66A 4ATDA 2W67A 4AMCA 3AIEA 1H0GA 1U30A 2VR5A 3PHAA 1TVNA 3W6MA 3B8SA 3WH7A 1PIGA 2OWCA 2Y5EA 2VZTA 3N13A 1CEOA 3EDEA 1BFNA 1UD4A 1SR0A 1JZ7A 1QNSA 3WNNA 1KXQA 4X0NA 3RJYA 4FK9A 1R87A 5A8MA 1QNOA 1OD0A 2GJPA 1KQZA 1JD7A 3TOPA 1ZBKA 8A3HA 5I77A 3WUEA 5CSUA 2W4XA 3WQWA 1EDQA 4W86A 3WQ4A 1HNYA 1KBKA 5CPTA 4JKKA 2W92A 1EDTA 4Q7NA 4E2OA 3EYPA 1JI2A 2BY1A 4W8AA 4OOZA 1J0YA 1W1TA 3CBWA 4CD7A 1VJZA 1UKOA 1JFHA 3WENA 2Y24A 1KWGA 4XV0A 2QPSA 2EO7A 2HISA 3BAYA 4J28A 4R27A 4HPHA 4EK7A 2GVYA 4U2ZA 4GIAA 4IISA 4P8WA 4HA1A 3UG3A 4DM2A 3AS3A 3OA5A 2VZSA 2VX6A 3W0KA 1R85A 3PZUA 1RD6A 3N9KA 1Q6GA 1MYRA 1GW1A 3BGAA 1BYCA 3II1A 1OINA 3AHVA 3T2OA 3PN8A 2G3JA 1TA3A 1JYNA 2YL9A 2ZUMA 3N12A 3OLDA 1QI2A 4DWSD 1V6WA 1BG4A 1R7AA 1ODUA 1OT1A 5JBFA 1HIZA 2J75A 1HJXA 1G94A 2QMJA 2J77A 1MWOA 4GKLA 3VMPA 3U7VA 1K6AA 3TTSA 3CO4A 4M24A 5D9NA 4OBSA 1GOWA 1GNXA 3L4TA 1Y7VA 1UD2A 2XVLA 4H41A 2EEXA 1UR0A 2CETA 2W66A 1NARA 3UG5A 2WC7A 2ZXAA 1WCGA 2XIIA 3CUJA 4XUYA 2F2HA 2UWFA 2X09A 4PYSA 3K1DA 4UOQA 3APGA 3FHQA 2XVPA 4M81A 1VEOA 3AXXA 1ISXA 2WHMA 4PMXA 1JYWA 4D6JA 3OBAA 1HKIA 3I3BA 1HJSA 2W63A 1BPLB 1CXEA 4TVUA 3ZQ9A 1WZKA 3K4DA 5LA1A 1XC6A 5LYRA 5HXMA 4WJXA 2CHNA 3MV11 1HKJA 4HP5A 4W5ZA 3QHMA 3FAXA 1H5VA 3SUSA 2D2OA 3NUKA 1H0IA 1I75A 3M46A 1VEMA 2J7BA 4HPGA 4CVWA 1CGXA 3AS0A 1GONA 5A6LA 5FL0A 4U5KA 3VNYA 1GQIA 1UWUA 3WQ6A 4GINA 3MMWA 1TE1A 1CXHA 1V6XA 3B9AA 3CZJA 1W2VA 2WVVA 3T0BA 1ISYA 1ZBVA 4Z2KA 2CPUA 5A6MA 4TX6A 5IHSA 2C0HA 2WB5A 1VF8A 3SCNA 4W7UA 4AY1A 4NRSA 4P7OA 2YA0A 1MW1A 3F5JA 4W87A 2CNCA 3GYCA 4MNJA 1LLOA 2CBVA 2O9PA 3VD3A 1KR0A 2JF6A 1MXDA 4IM4A 2BY3A 4P8UA 3AJ7A 1WKYA 3KL0A 3FY1A 4CU8A 1FH9A 3UESA 5ABFA 1HL8A 1I1WA 3IK2A 4CN1A 2VZUA 1SFSA 4AIEA 1NWTA 3ARRA 2FGZA 2DEPA 4JHOA 3VIMA 1UA7A 4BQ4A 1C90A 4D6GA 4MTVA 5CGTA 2DPEA 5BXTA 1HVXA 1V02A 1CGUA 1ITXA 3A4XA 2WXDM 3ZT7A 1PX4A 3AIUA 1OGGA 1TFVA 2J7DA 4BQ5A 1V0LA 6A3HA 3W28A 5GPRA 2XFYA 1DHKA 2WSPA 2WAGA 2EXOA 1ECEA 4BZYA 3FNDA 3OIHA 1B1YA 1UUQA 1S46A 4HA3A 4MJ2A 4PN2A 2CIPA 4MB1A 1M53A 3L4YA 1CGVA 4QCFA 1K9DA 3UG4A 1JNEA 3MANA 1KWKA 3N1AA 3SCSA 9CGTA 1JZ3A 1WB0A 1V6YA 4KWUA 3ECQA 4BS0A 1H1NA 2GDUA 4W88A 4V27A 4ACZA 1W3LA 2C7FA 1R8LA 4TTUA 2DH2A 2ZWYA 3UR7A 3AI0A 4LGXA 1JGIA 3N17A 3WNPA 7TAAA 3WEOA 1SMDA 5M03A 3QOMA 2JEQA 4PBGA 4PMRA 1OIFA 5BRQA 3WSUA 1HP4A 3SIMA 1U2YA 3ZR6A 1M04A 4QLKA 1FHDA 1JD9A 1E0VA 4CU7A 5BRPA 4P7RA 2J8GA 2PC8A 4J3UA 4H8UA 1CIUA 4FLQA 1L0PA 3GM8A 1E6PA 4MNKA 2WYSA 5HPCA 4AEFA 4MDPA 1CNVA 3AS2A 4Q22A 4U2YA 3W38A 2A3EA 2BHYA 4PEEA 3WFLA 5E0FA 3AIBA 1CLVA 3O2LA 4JCLA 2F61A 4J3WA 1UZ4A 2GJXA 1LQ0A 2XTKA 1OWQA 1QBBA 4D71A 2XWDA 5EB8A 4Y7EA 2J7FA 4PUEA 2J47A 1BYDA 1EDGA 1G01A 2IUZA 2YDRA 3K8LA 3UR8A 2OWWA 3WL1A 1LL6A 2YDQA 3SCVA 1QW9A 2D22A 1UD5A 4WF7A 2GDVA 2VCBA 4UQDA 4HOWA 1HN1A 1VFMA 3RPMA 5A6JA 3FN9A 1B2YA 4GQRA 1FP8A 2DIJA 1UH2A 4RE4A 5EFDA 5CSYA 3K46A 3TTOA 1AMYA 4PCSA 1XSIA 1XD1A 4EKJA 4M1RA 1XH2A 5D8WA 5D9PA 1WAWA 2X0HA 4U3CA 1Q6DA 3ZIZA 2PBGA 4LX4A 1PZ2A 1FH8A 1V3MA 2DT2A 1AVAA 3QHOA 4OZOA 3WL0A 3PTKA 1I1XA 2ZXDA 2QLYA 4D1IA 2VC9A 2NW0A 3WUBA 4J3XA 3ARXA 1PX8A 3RM4A 2PWDA 3ARPA 3WDIA 2XHYA 5JBEA 3AMCA 1QI4A 1AQMA 4GZIA 3MUIA 4F9DA 2GUYA 1WDQA 3MUAA 3WDPP 3VIHA 3DECA 3WN6A 1AQ0A 1GVIA 1V3KA 4JCMA 3WUFA 4CD6A 3DYOA 3PZMA 3ALGA 3WF4A 3NDZA 1EHNA 1R86A 3VIJA 1J0IA 2PWFA 2JIWA 1DEDA 3DHPA 5JIWA 2WANA 4CN6A 2EPOA 1UKTA 2FHBA 3OGVA 2XM2A 4YN5A 1E6XM 3MSGA 4MPKA 1QNPA 1GJWA 4MB4A 3WH5A 2YOCA 1JG9A 2VUYA 5A94A 1UZ1A 5A6SA 3T2PA 1E1FA 4JFSA 1V3LA 1BG9A 3F5LA 4AZ7A 3OLEA 4AZBA 3CHDA 1FFQA 2XVGA 4HTYA 4TTGA 4ZE5A 1VFUA 3OZPA 3HJEA 1P6WA 1E43A 4WK9A 1FFRA 2VTFA 3WFZA 3RCNA 5I3DA 1C7SA 2BVDA 3WH8A 1G0CA 1M01A 5A6BA 3GXDA 3CGTA 4AZCB 4PSPA 2QPUA 3E1F1 1C92A 1F4AA 3A3HA 2YDSA 4OOUA 1V02E 1LG2A 2YKKA 3VUPA 1W1YA 4JFTA 1VIWA 2ZUVA 1E6NA 5C8BB 3LPPA 4TVDA 2YJQA 1AQHA 1WP6A 1DWGM 1LJYA 3WEZA 4FLOA 2WZIA 5A8QA 3THDA 2UY3A 5BXPA 4GO9A 3VU2A 2E9LA 3CHCA 2QMKA 3D5HA 4MB5A 4MADA 2UY5A 2BVYA 4UZSA 5I23A 4LQ1A 3ZSSA 4WKFA 2J7GA 4MJ4A 4AZHA 2PF0A 4TOQA 2WMIA 4CVUA 5DFAA 3RILA 1BGGA 4ATWA 4XB3A 5A3HA 2UY4A 5E09A 2WHKA 2OSWA 3AISA 1KGUA 4Z2LA 2XFRA 3EDFA 5A1AA 3ARUA 3WBAA 2O9OA 1E15A 1QI5A 1C8YA 2J79A 2XIBA 3ZM8A 1SYTA 1UR2A 4YPJA 5D8ZA 4GZEA 2BY2A 2DSUA 3AYSA 4UNIA 3ZJ6A 4DWSC 1PPIA 1E3ZA 1LL4A 1JDCA 7A3HA 1ISZA 4JIEA 4TX8A 3SUUA 1VBUA 3VGEA 1KXTA 1KGWA 3VIPA 1EQCA 1M03A 1V03A 4P8VA 3W81A 3M7SA 2VR4A 2WMJA 1JDAA 4HA4A 2CESA 5JUVA 1JZ8A 2VCAA 3KZSA 1XCXA 1H4PA 1JIBA 2WBGA 2GJRA 2CBJA 1W1VA 2CEQA 4AW7A 3ARTA 3CZKA 3RM9A 4LPCA 4AEEA 4E8CA 1MQRA 2DT1A 3LPGA 1W32A 3U7BA 2ZOXA 4M29A 2JFEX 4RE3A 3NSMA 2VL4A 2ZWZA 1KQYA 3FAWA 1LG1A 4DWSB 1E4IA 3WMSA 4PCTA 1RP9A 4MNLA 1QHOA 1BYBA 1ZU8A 4NI3A 3UETA 1GQKA 5D9OA 1C91A 5A2AA 1CGYA 5JIPA 4F9JA 4MAVA 1H3GA 4RE2A 2YA2A 1B30A 1OSEA 3OLIA 1OGSA 1B3YA 3WQ8A 3BAIA 2ZICA 1IT0A 1FP9A 3WH6A 1CWYA 4CN4A 4KRTA 3RO8A 3OB8A 3VDAA 3WQVA 3L4UA 1MXGA 2PB1A 1R7OA 5IDIA 1GOIA 1BVNP 3BAXA 1V08A 1QOXA 2XG9A 2YIHA 3CHEA 4HMCA 2DSKA 4W7WA 1JF6A 2XVNA 2XM1A 3DYMA 1KCKA 4PTXA 1BYAA 4UQAA 3WD4A 1CECA 1QVBA 2DSZA 3GZAA 4AZ5A 2D20A 3MMUA 3K8MA 3KWXA 4D6FA 1OT2A 3AMGA 3BAKA 4PMNA 4PMUA 1UOKA 1JZ4A 3ALFA 5I2UA 3S6TA 1UH3A 4Z2JA 1C7TA 4OBRA 3I3DA 2D0FA 2WVTA 1JL8A 4CCDA 1BHGA 2WMFA 2D24A 2X2YA 3CIVA 3N11A 2X8RA 2G41A 1JYVA 3TP4A 1E56A 1FHLA 2J25A 2JALA 4B16A 1GQJA 2V5DA 3B9DA 3WH9A 5EBAA 3ARYA 1HKKA 3GBDA 1LWJA 3AS1A 2RGMA 2WWDA 4CGTA 1V3JA 3IJ7A 1UKPA 2DGAA 3SCRA 1NOWA 2CKSA 4F8XA 2E4TA 4CCEA 5C71A 2NT1A 3VGFA 1ZS2A 3EMQA 1GHSA 2VI0A 1QHPA 4AD3A 1NWSA 3IAPA 1W3KA 3ZO9A 4ML4A 4D6IA 2ZX9A 1UHVA 2X1IA 1VFFA 3CMJA 5ABEA 1UWIA 1TMQA 4MNMA 1Q6EA 1QI0A 4D6HA 1GVYA 1CXIA 1UKSA 3AICA 1TVPA 2G8ZA 2A3BA 1E40A 2XSAA 3IAQA 4AZIA 1EOKA 5ECUA 5I79A 1VB9A 3BLKA 3BSHA 1FA2A 3VM7A 4HU0A 3T2QA 2OYKA 5BROA 1QNRA 3CZLA 2WM0A 3WD0A 4C7FA 4XX6A 4HOXA 3W53A 3A47A 1EOMA 3SUTA 2EJ1A 2ZX5A 4ZXLA 1E70M 4M56A 5DMYA 1FOBA 2XWEA 4JZ5A 3WD3A 4B3KA 3LMYA 4WKAA 1HJQA 1W9BM 1GZJA 1XRVA 4W5UA 3VD5A 4ZENA 1VEPA 2YA1A 3VGHA 1E72M 1JDDA 3MMDA 3OG2A 1E5JA 4FF5A 1BGAA 4UR9A 2FHFA 4CUCA 1ZJAA 4MB3A 4UFHA 4UQ9A 3W24A 3AZRA 1BF2A 3AZSA 2YBUA 3NSNA 1E6SM 4X9YA 5FIPA 2BXZA 1B3ZA 1GQLA 2G3IA 2V3EA 1V0NA 1E5NA 1W9PA 3ZMRA 4B3LA 3ZT5A 3SCPA 1DWFM 1W2PA 3HN3A 2OSXA 3AIWA 3CZEA 4XZWA 1B3XA 4TXEA 1Q4NX 4JFUA 4JL2A 2VURA 4HZ6A 5A6BD 5BXRA 1GORA 1KFWA 3I3EA 5HOSA 5FOOA 3AHXA 5E6YA 5BXSA 4J7RA 1V0MA 3WBEA 3A4AA 4DM1A 4YHEA 1UR9A 3ARVA 5GNXA 3AHTA 3BLPX 4C7DA 2O9RA 1EO5A 3DYPA 2FH8A 2MANA 5DT7A 3CTTA 3QGVA 2J7CA 4HMEA 3GNRA 2BV9A 1MW0A 1ITCA 1UH4A 3GNPA 3ARSA 5LA2A 2W62A 3PZIA 3AMDA 1OCQA 4F79A 3VTRA 1GCYA 3AROA 5CZKA 1UQZA 2O9TA 1BSIA 1OM0A 3CH9A 3THCA 2VVNA 3MUZ1 5AY7A 2EPMX 3AZTA 3SUVA 1XCWA 2ZX8A 5A2BA 1CLXA 2JEPA 1X1NA 3OZOA 4BA0A 2VRQA 1JZ5A 4PSRA 3L2LA 3KL5A 1L8NA 1CENA 3AXIA 2CCRA 2ZXBA 2NT0A 2WCSA 2CKRA 3WEMA 5D9MA 1ESWA 1J01A 2WPGA 3HU7A 4V2XA 5IFTA 2V38A 5I5RA 1UG6A 3F4VA 3WQ5A 4AIUA 1NP0A 3BSGA 4AD2A 3SCUA 2BNJA 1ODZA 2WZEA 1UD6A 2FGLA 4UFMA 3WF2A 1TR1A 4DUWA 4Z2GA 3WKZA 3AQUA 1JZ2A 2WCAA 5FCZA 3T0DA 1J0HA 3VPLA 4ZE4A 2E9MA 3OGRA 2CERA 2A3AA 1E0WA 4BQ2A 4P7LA 3NSXA 1WZAA 2JE8A 3CUFA 1UR8A 2D3NA 4AWEA 1JXKA 3GDBA 1JXJA 3WNKA 2CBIA 2ZUSA 3GBEA 5A8PA 3WDQA 3VM5A 1JAEA 2DDXA 3UERA 1UKQA 2XVKA 1PEZA 1XYZA 4QLJA 4Z2IA 5AYBA 1HKMA 2J7HA 3IJ9A 2X05A 2G4FA 1WZLA 4NF7A 1TA3B 1XD0A 4KGLA 3D3AA 3FHAA 3VMOA 1UWSA 1X6LA 2E0PA 1C93A 1PZ3A 3PTMA 5CG0A 1TUXA 2EPLX 4LYPA 2Z1SA 1CGTA 1W9UA 3BAWA 3TTYA 3VGGA 3L4VA 1Q6CA 4AC1X 1KGXA 1KBBA 3MU7A 2E8YA 5C70A 1C8XA 4DUVA 2Y8KA 1UWQA 2EQDA 4PMQA 1ZB5A 3WD2A 2QF8A 3RJXA 4HU8A 3PZOA 1GOOA 2XJ7A 2AMGA 2YLAA 1DP0A 1EXPA 5FD0A 1J0KA 2Y4SA 3MV01 4QDMA 4AIOA 3A4WA 4W8LA 1GUVA 4GXPA 4ZXOA 1NP2A 1ISVA 2PBOA 1E71M 4JAWA 2D1ZA 3AMLA 1UD3A 2VCCA 1UYQA 2AAAA 1O7AA 1US3A 1E6ZA 2BHUA 3M07A 3HMCA 1C8QA 5IHRA 4D6DA 2CYGA 3PTQA 3TA9A 2X0YA 3SCWA 3WELA 2PWEA 1E55A 1H09A 1JF5A 4W84A 3AIQA 2WMKA 2DT0A 2JIEA 1GOKA 1CXLA 3GNOA 1ZBWA 4LYQA 1HJUA 2YLLA 1NOUA 1JNDA 5EMYA 2VOTA 3VMNA 1K9TA 5FL1A 4MDOA 3VGBA 4CU6A 1CGWA 3NJ3A 4FMVA 4A3YA 1B9ZA 4QCEA 2WVVB 4B15A 3W37A 1OD8A 3MSDA 5CGMA 2BS9A 2V5CA 2V3DA 4PTWA 4KGJA 2C8NA 1DWAM 3AHYA 4UZUA 4A3HA 1MQQA 2CBUA 2VJXA 4HZ7A 7CGTA 2FDMA 1KCLA 2WZHA 3PZ9A 1KXHA 2WW5A 3IANA 1DTUA 2W91A 1CYGA 1CPUA 4P7QA 4L4PA 4OUEA 3VO0A 5M3WA 1O6IA 1VENA 3POHA 1PIFA 1LF1A 1B90A 1MQPA 1ISWA 1FH7A 2WNWA 1E4MM 3ARZA 4IPLA 2XGIA 1WO2A 5HDRA 5GQBA 5ABFB 2WMGA 1ZJBA 3AIVA 3PZGA 3W82A 5IXEA 2YL8A 1OGBA 1K9EA 1QNQA 3WDHA 4D6EA 2DT3A 5AYIA 5CLTA 3WY1A 2FHCA 4PTVA 1B0IA 1W3HA 2D23A 2ESCA 2VZOA 4ZFMA 3TONA 3VOCA 5EFFA 4AYSA 3LPFA 4U33A 5A69A 3O9NA 1LWHA 1QBAA 1GOQA 1VFOA 1E0XA 3BAJA 1V3HA 3W25A 2EBNA 4KRUA 2W5FA 4AXNA 1WDRA 2DSVA 4RL3A 1TCMA 3B9EA 4EE9A 3IJ8A 2WCGA 1JZ6A 1TZ7A 1NQ6A 3VDHA 2D3LA 4H8VA 1ZL1A 3VX0A 3T09A 5CLWA 3BC9A 1G5AA 3SUWA 4AD1A 3GXFA 4QFUA 2XPKA 4JFVA 5GNYA 3N04A 4ACZB 1HF6A 2J62A 4QP0A 3U57A 4TVCA 5ABGA 1HVQA 4UFJA 2VVSA 1UQYA 1UD8A 1HXJA 3UCQA 2J8FA 3G6MA 3SEPA 2DSWA 1Z32X 2PWGA 3OGSA 2E3ZA 1QPKA 4PUDA 3VIGA 1EA9C 2YBTA 3CLWA 1HT6A 3BMVA 4GPNA 2EPNA 3ARQA 3VIFA 3AXHA 2BHZA 2WKLA 4Z2HA 1B3VA 2BVTA 3L4ZA 3QOKA 5DT5A 5E6ZA 2ZUTA 5E9AA 1W91A 1H41A 4V28A 4IPNB 1XSJA 1OBAA 3WNOA 4FLSA 1C3FA 2ZUNA 1CZ1A 2IXUA 1W9DM 3BMWA 4W93A 2WC4A 5HBFA 4KMQA 2Y8VA 4H8HA 3CUHA 4GI9A 1H49A 4W8BA 2J78A 1UR4A 5GNZA 3BCDA 4WLCA 3U5UA 2GJXB 3POCA 3L4WA 1E1EA 3O6AA 1F4HA 4CKQA 1D7FA 1W9XA 2VX5A 3GXIA 3SCOA 3EDDA 5A95A 1BTCA 1JI1A 4UTFA 5A8OA 3N15A 5A6AA 3T0AA 4M8UA 4UFLA 2TAAA 1ZBCA 3QHNA 5A6KA 3SCTA 3VX1A 3MUY1 3CPUA 2D0HA 1Q6FA 1E9LA 2HVMA 1DWIM 5I6SA 3WNLA 4AZCA 2BXYA 2VX4A 4HMDA 1H2JA 4ACYA 3ZJKA 3W27A 4U3AA 3W4RA 4AD0A 1W9VA 4GO8A 4GI8A 2V3GA 1XV8A 1CXKA 1PAMA 4LYRA 5IFPA 3PZQA 4CCCA 4WSKA 4UOZA 3VD9A 3BXWA 2E8ZA 4P8XA 2GSJA 1RH9A 3ZT6A 4OKDA 1A3HA 1B31A 5DF0A 4D1JA 3VGDA 1HL9A 4CD4A 3DC0A 2VQUA 1CDGA 1GPFA 3CHFA 4B9ZA 3VD4A 2DIEA 4BCEA 3NYDA 1MVYA 1NH6A 3MO4A 4KH2A 2UY2A 4D6CA 3ZOAA 1D3CA 2XGBA 1EQPA
chains in the Genus database with same CATH superfamily
5CQ1A 4W89A 4IICA 4H7VA 4NZ3A 3EMCA 4IX0A 1QOQA 1TELA 4LAMA 3NQAA 2J7EA 3K8KA 1SW7A 4O1AA 1X96A 1J11A 4O1EA 3SQSA 2JF7A 3GXMA 1G1YA 5M2FX 4PTDA 2AMXA 5KZ6A 4J1OA 1NWRA 1FDZA 3UFYA 3TW9A 3EZ4A 2ZE0A 3N29A 2QJIA 1XH0A 4UCFA 2WK2A 3CV2A 3EPNA 3VD7A 2VRJA 3TW7A 1PTDA 2EPKX 4G2DA 3TTEA 5CJ5A 1WKFA 1X6UA 1WDSA 5A2CA 3EOLA 1PS9A 1O1HA 4KFPA 2HNEA 1KTCA 4ZEPA 4LSBA 1R9YA 2Y70A 4WVXA 5IDZA 1WNOA 3J7HA 3V0SA 3NXLA 4BI5A 4NG3A 3USZA 5LXXA 2QHAA 3W29A 4J27A 3NQ6A 4JKMA 2ON3A 5REQB 1K02A 1H63A 2V3FA 5LA0A 1N82A 3PBMA 1GTHA 1YXYA 4H19A 4NJKA 5BYWA 1MW2A 4H04A 5DBUA 3E0LA 4K8GA 3EWWA 1V6UA 4UQBA 3QV6A 1POKA 1QHZA 1W31A 2PSNA 3NG3A 4PMYA 4G56A 4W7VA 2CXGA 2VO5A 5CPMA 2QKFA 4DNMA 2ZUUA 3TN3A 3BCFA 1EIBA 3GVGA 1FCUA 3PY2A 4G9PA 5HUOA 1ELSA 1YEYA 5B80A 3N3TA 3VIIA 2Y1HA 2FFCA 2WLYA 4NZCA 3QZ6A 1GZGA 2ABBA 2XSBA 3K4AA 4ZO9A 3R8HA 1QMLA 4HSOA 1MUWA 5D4YA 4C6PA 4PFMA 3WUGA 1ZAJA 4GQQA 3NCOA 5HQLA 3JUGA 4LS0A 1V3IA 2WWCA 5FEWA 4K68A 4GRSA 3TQKA 2YFOA 3NEHA 1N8FA 4EF9A 3WLIA 2QV4A 4GUIA 3BANA 1VQTA 5T91A 2WMIB 1AW5A 3VA8A 1TV8A 1ZHAA 1YE6A 1TRIA 5CPSA 3AYTA 3KE0A 3GU2A 1J4EA 1IZJA 1RCXB 3KP0A 3MKKA 1MRQA 1VS1A 1J12A 2WC3A 4AY7A 2P3EA 3T78A 2DY3A 1AFSA 4RNJA 3CJPA 1ME9A 3QQ0A 1JFXA 4O54A 2ISVA 4MFDA 8XIAA 2V2CA 3XIMA 3P93A 4GWEA 4EF8A 1LBLA 1JULA 3MS8A 3LMZA 1RP8A 1J0JA 2VFFA 3WIJA 4JHZA 1U33A 1BF6A 2VT0A 9RUBA 2YR1A 1R3YA 5A8NA 1HJVA 1AZ2A 3B97A 3DUGA 4M82A 3F4WA 3SB0A 1Q7QA 1VCVA 3BQ6A 3IGHX 2GJLA 4DJDC 1W1IE 4MAZA 4ES4A 3ONCA 3DKJA 3D0CA 4S3JA 4Y2WA 1AH4A 1WZMA 2QIWA 3FXYA 4U31A 1I2QA 3LG3A 1JAKA 1MZHA 1NY1A 1XG4A 5EMKA 2BTMA 3ABZA 2ZA3A 4H9UA 3Q94A 4J35A 4RX0A 1OG0A 1E6RA 1E9ZB 3STEA 4UQCA 5DMMA 3UVAA 3STPA 3AJXA 4DX3A 4NNCA 2CLLA 4MPQA 1BVZA 5D2VA 1D2KA 2F8QA 3OOQA 4M3PA 4X60A 1NFPA 4Q8OA 2PTYA 2X30A 2C3ZA 5HWJA 2A7PA 3CUGA 3BH4A 3UJRA 3EWCA 4S3GA 2OB3A 2FVLA 4HYRA 4E4FA 2VFHA 3W7NA 2CITA 3CS2A 3RMJA 4JTHA 1YADA 2Q3OA 3FDKA 1MFVA 2OGYA 3C4UA 1DWHM 1RD5A 3NPXA 1K9FA 3MSRA 6TAAA 1OFEA 4C1NA 2VQTA 5AHIA 1EC9A 2C1HA 1FWHC 3EDKA 1IF2A 2GVLA 3FCPA 1FRBA 3CUZA 4J2PA 3PZTA 5T8GA 2WKGA 3IIXA 1WBJA 4N6FA 5EPDA 4PMZA 5DN1A 4UUIA 2C0AA 4NZ4A 2CLEA 3D46A 5FSDC 3FXGA 1QAPA 2W27A 4J3TA 4QXIA 5JBDA 1A49A 3N14A 2IXVA 2YFNA 2PCQA 3EBVA 4URIA 1XIMA 3WNMA 4W85A 1B3WA 4QNWA 3DX5A 3RNDA 1YIXA 3BV4A 4A8LA 3TYUA 3L12A 1S5WA 4DZHA 2MNRA 2V5LA 1PIGA 3DH7A 3KLKA 4A3RA 5KMYA 3TE9A 5CCZA 2VZTA 4C6CA 1RCOB 1CEOA 4C6OA 3BG3A 4BWLC 5XIMA 1QNSA 4A05A 3VNKA 4MLJA 1NEYA 5I3KA 4O8AA 3FS2A 3TAKA 1W3IA 1EC7A 1GG0A 2Z7KA 1EDQA 3TXVA 2KZHA 4Y6GA 5FF0A 5CPTA 1KM0A 3IPWA 4N9DA 2XZ7A 1EDTA 4Y8FA 3VOHA 4RDVA 5IBXA 3W1UA 3GTXA 1J0YA 1MDRA 4UR8A 3OYXA 1A5BA 1W54A 1VJZA 3QGKC 3W70A 1MRAA 1NIUA 3BOXA 1UKOA 1DIEA 1KWGA 4XV0A 4Q8NA 2QJJA 4J28A 4R27A 3GNDA 4AQLA 1GPWA 4U2ZA 2GWGA 1RZMA 3M0ZA 4DM2A 3AS3A 4V15A 3BPWA 3CM4A 3W7GA 1R85A 3B0UX 3H7RA 2Z24A 1OC6A 3OVGA 1TV3A 1H7OA 1ICSA 2PWUA 1UBSA 3HFTA 2R6OA 2ZUMA 1PWLA 3WQGA 2HVNA 1DJGA 4YTUA 1RJRA 3SRFA 3E38A 1HJXA 2QMJA 3GFXA 3S9YA 2J77A 3NQFA 3U7VA 1K6AA 4M24A 3ZWTA 3DFHA 2R94A 4KEMA 4YWSA 1UD2A 1V4YA 3PBUA 2XVLA 1H1YA 2VD9A 3EAUA 2CETA 3NZRA 2QZRA 3LV6A 1BWVA 1PWMA 3IIVA 3UG5A 2QJNA 4JQAA 3LCGA 4JN8A 2XIIA 5AZ1A 3CV7A 3ZWSA 2X09A 4PYSA 4DAFA 3F4DA 1RJPA 3HV8A 3EB4A 4IFKB 4TV5A 4WOQA 1PKYA 4C91A 1F6KA 3HURA 1BPLB 3QFWA 3G3MA 4GYPA 2HQAA 2FJKA 4N2YA 4NIRA 3W72A 5HXMA 4WJXA 1RVGA 4JNZA 2PDLA 1ZNNA 3SUSA 3TNOA 2ZVRA 4CQDA 1H0IA 1I75A 3QYQA 1SGJA 1VIZA 1VEMA 3M46A 2J7BA 1R30A 3NQGA 1CGXA 3DBPA 5A6LA 1GQIA 1UWUA 3HZ3A 2C91A 3WQ6A 1XBXA 1FKWA 1I0BA 3CZJA 1BXCA 3QPYA 3E5BA 3T9PA 1HKVA 5C9WA 1KW1A 1ISYA 1ZBVA 4MG4A 4HMNA 4L9ZA 1VF8A 4Q4RA 3GXNA 4W7UA 2TSYA 1QRQA 3H23A 3DFQA 1PB0A 4M6PA 4LAOA 1OCBA 3HO8A 3VD3A 3VC6A 4IM4A 2ZA2A 1MXDA 1WKYA 3KL0A 4CU8A 1YW1A 4IMAA 4AEOA 3FJNA 4CN1A 4HNTA 4M19A 5LHEA 4JHOA 4WJEA 3VIMA 1D8CA 3W1NA 3KS6A 3TYAA 5CGTA 5BXTA 3E02A 5HMDA 1ITXA 1PX4A 4GQGA 4JICA 2NLIA 5HAOA 1OGGA 1TFVA 4LVDA 2H9AA 3ITOA 4BQ5A 5GPRA 1TJRA 4KIEA 1PHQA 2R1LA 5F2GA 1D8WA 3IS4A 2EXOA 3LB0A 3THAA 3I6EA 1US0A 3FNDA 4YCPA 4ICMA 1AD1A 4PN2A 4NU7A 4MB1A 4ZGYA 4U4MA 3L4YA 1RJQA 1CGVA 4QCFA 3SY1A 2ZC1A 3GTHA 3UG4A 3MANA 2V82A 3QPEA 1KWKA 1HO4A 2EAWA 4PBFA 4XTIA 3NQMA 4PUMA 4W88A 5D05A 3WLJA 1RK6A 1R8LA 3C3NA 2PZNA 2DH2A 4TX9A 4LGXA 1SPQA 3WEOA 1WDWA 1SMDA 3S5ZA 1XLMA 1NJJA 4PMRA 1P1MA 3UJFA 3ZR6A 5JMUA 1I9CB 1TE6A 2E67A 2O7SA 4QS5A 2QVNA 3TZFA 5J5RA 3V0TA 3R0UA 2J8GA 2XH7A 1XLCA 1AG1O 1XIJA 4J3UA 3AUJA 4J5NA 4E3TA 3LSCA 4MDPA 4U2YA 2E09A 4E4UA 3W38A 2A3EA 2WKJA 3NVTA 3TYZA 5E0FA 1RK5A 3R89A 2FVMA 3O2LA 4JCLA 2QYGA 2F61A 3GR8A 5K4ZA 1UZ4A 1LQ0A 3M5VA 3SECA 2AQVA 4GE8A 3WLKX 3PUDA 4RUBA 4MVAA 3NL2A 4NYYA 2XWDA 4IGSA 3RAOA 2J7FA 3H2NA 1DJWA 3K8LA 3RO6A 3R11A 2YDQA 4GYFA 1Q4WA 3UGVA 3CU2A 4LC6A 1Y8BA 5BWAA 3GTFA 3S2JA 4HPJA 4GQRA 2EHHA 1FP8A 3L7RA 4US6A 2DIJA 4AG0A 1V51A 1D9EA 3TTOA 3IEBA 4O18A 4PCSA 4QQUA 1UMLA 1XSIA 3VOFA 3EWBX 3WBWA 4GC4A 4U3CA 3KHJA 3DEQA 1M9HA 4RNHA 1JPDX 1E0UA 4GNJA 3SN4A 5G1YA 4JD4A 4HHLA 1DXFA 2VC9A 4DF0A 1IXQA 2NW0A 1TRDA 1LROA 3ARPA 1P0KA 4S3BA 4WX2A 2QEZA 3O05A 1QI4A 1AQMA 3L23A 2PLCA 3DBNA 1R3QA 3MUIA 1PCKA 2GUYA 3MUAA 1XKYA 1ZRQA 4LF1A 3DECA 3MDWA 3C8FA 1GVIA 2ZQ0A 4Y90A 1TX0A 3W83A 3WF4A 1IYXA 3NDZA 5T26A 2OQLA 4HYWA 4U28A 3W02A 3E5PA 1K4GA 1DQXA 4YN5A 3B06A 3R1ZA 1EZ2A 3LCLA 1KM1A 1F7BA 1E6XM 3B8WA 1MZRA 1JCNA 4BF9A 1QNPA 3M0IA 4MB4A 4HTBA 3BO9A 3WH5A 1C29A 2YOCA 2JQXA 3OBEA 5A6SA 4BFAA 5I3IA 3HGOA 1LP6A 1YMYA 3TQ0A 2Z28A 2X2GA 3KBWA 2F38A 1EXBA 1DJHA 4AZBA 2E7FA 2DJLA 4GACA 2XVGA 4RNFA 1LRTA 4UBPC 3HJZA 3IIOA 5CBIA 3PWIA 3RCNA 1KFJA 5D37A 5DMLA 3UNTA 4IOTA 1A5LC 4QSHA 4O57A 1RBLA 4PSPA 2QPUA 1F4AA 3A3HA 1XISA 3CV1A 3M64A 2ACSA 3RXZA 3CIXA 1W1YA 1ZJIA 2QCFA 3V18A 4E8GA 1WAUA 1KFEA 3DZ1A 1T96A 3LPPA 4HB7A 4TVDA 3R5EA 4RXFA 1DWGM 4NX0A 1Z44A 4FLOA 2Z26A 3ZVHB 3L67A 5KZDA 3HPSA 3CHCA 2BOEX 3D5HA 5AHFA 4NY2A 5I23A 1TMHA 4GQBA 3VXGA 2CZ5A 4TOQA 4BEUA 4HHMA 4NXKA 3N2MA 1BGGA 4XB3A 5A3HA 5E09A 1TPC1 3WLPA 2Z2UA 4KRZA 2OSWA 4GNKB 2P0OA 1F8MA 3ARUA 1KKRA 2O9OA 1E15A 3LQLA 3ZM8A 3TN5A 4JOMA 1UR2A 4YPJA 5HQMA 3AYSA 4DWSC 3W1QA 2OXNA 4M6QA 1GVSA 3SGZA 4DZIA 2ONEA 1KRCC 2QNEA 1XPYA 1ISZA 4JIEA 3GKFA 5CPOA 1KGWA 4YU1A 1IXNA 3VIPA 2ZVIA 4FXJA 3PUOA 4PA8A 2Q02A 1OG6A 5CPLA 6ALDA 2OU4A 2FGBA 2OX1A 5U4NA 3EPOA 3KZSA 2E6FA 1XCXA 1H4PA 3KBNA 1JIBA 1XLKA 2WBGA 2X7WA 3H24A 1W1VA 4WZHA 4G7EA 3DENA 2PDMA 3AC0A 1QR7A 3ANYA 1V77A 3P81A 1TWIA 4RE3A 2QDDA 1KQYA 3TFXA 1JPKA 1A50A 1SZFA 2G96A 2OKTA 3URQA 4TO8A 1RP9A 1DL3A 3KS5A 4E3VA 1QHOA 4C6QA 1V7AA 3VFCA 5D9OA 1C91A 5A2AA 3NGJA 5LXEA 4WOZA 4RE2A 1H1ZA 3LHYA 3H4GA 4J4KA 5J8LA 2PGRA 3WQ8A 1TV2A 3BAIA 2I5GA 3UWVA 4Q8QA 3UCDA 4BK9A 1Q63A 3URNA 4KRTA 3RO8A 3G1RA 3KM8A 1R7OA 4DJDA 1V08A 5E93A 4AU0A 4NILA 2XG9A 1JF6A 3M44A 2XM1A 3BLLA 3DYMA 3UY8A 1KCKA 1BYAA 5CJNA 3HA1A 3PJTA 3GIYA 1XIIA 4AZ5A 1KTBA 4LCSA 1XI3A 3GG0A 3BAKA 2RDUA 4PMNA 5HMFA 1UOKA 1JZ4A 4ZQPA 3THUA 3DERA 2DZXA 3T8QA 4Z2JA 3QV9A 2VGIA 4EVZA 3BURA 2VUNA 2WVTA 2AL2A 3UW6A 1JL8A 3GK0A 4CCDA 2VP8A 3CIVA 4K7VA 4C90A 1YX1A 3L2IA 2G41A 1JYVA 1I4NA 2V5DA 2E1DA 5AOUA 1A5NC 1ENUA 1TQXA 2NVDA 3IACA 5I09A 1LWJA 4JQ2A 2RGMA 4U10A 3R8GA 3G1VA 3WK1A 3W73A 4LU0A 1O4UA 3TYEA 1W6TA 1NOWA 3USBA 3GAYA 4DXVA 5C71A 1A5MC 3VGFA 3IAPA 4XZLX 4D6IA 1JRBA 2XDFA 1UHVA 1IZCA 1ZENA 1MEHA 1X38A 1W5PA 4D6HA 1CXIA 4O28A 2XSAA 1F2JA 1XXXA 4D8AA 3BSHA 4UMBA 2YPIA 3PSVA 1DV7A 2O0TA 4HCHA 3TJXA 1VJIA 3WD0A 4C7FA 1EOMA 3SUTA 3LERA 3LGEA 4ZXLA 4M56A 2HDJA 1FOBA 1VPXA 2Z6JA 3F2CA 1SO4A 3L5AA 3GC4A 3M47A 4JZ5A 4MUPA 1E51A 1WOAA 4UTLA 3JVAA 4JHMA 4D8LA 2XFWA 1JDDA 4EOUA 1FQ0A 4QJ1A 2QUNA 1WXZA 4O14A 2QULA 2IKJA 1ZJAA 5CG7A 3W24A 3QN3A 3AZRA 2HPIA 1EBHA 3C6CA 2YBUA 5H8UA 2ZZ7A 3NURA 3C2VA 3NSNA 1R2SA 5FIPA 3DAQA 2NX3A 1E5NA 3LHUA 3DGBA 4XKYA 3UJSA 1SO5A 3GLCA 2QCMA 2PRHA 5FF3A 3CZEA 4TV6A 4TXEA 3PC0A 8XIMA 3UA3A 2PDKA 1XYLA 2PLMA 4Q4PA 4S1FA 2HXTA 4I90A 3ABSA 4DO7A 3WQPA 3UQNA 3AHXA 5AC6A 4LBRA 3T05A 4F0KA 1AJ0A 1TCDA 1UR9A 3ARVA 2QDEA 2O9RA 4BEQA 5AYYA 3DYPA 2FH8A 4H83A 3GNRA 1XIHA 2ANUA 3NO5A 4LH8A 2W62A 5GJNA 3PZIA 3UJ2A 4B2DA 1IEXA 3AMDA 2CU0A 4FX6M 3NOEA 3W22A 2TMDA 2QVHA 4Q3MA 4Z1YA 3CH9A 5BNKA 1Y5VA 3O6YX 5BMWA 3LHZA 3NA8A 2ZX8A 2UV8G 4BA0A 3VNIA 3LI1A 4R88A 3SSZA 3BW3A 4PSRA 4Q8PA 1L8NA 1P48A 3AXIA 4XQ6A 3JS3A 2NT0A 4ZO8A 1DJZA 3ERPA 3KVKA 3D3FA 4YCOA 4GUJA 2C1IA 5IFTA 3OIXA 4IPPA 3FSUA 3BSGA 3WLHA 3I4KA 3QY8A 1GVFA 4UTTC 2WZEA 1UD6A 3WF2A 4DUWA 1A4MA 3WKZA 1JZ2A 2DW6A 4AWSA 6XIAA 3PJXA 3UG8A 1AL8A 2OTDA 4LVAA 2OZTA 4ZE4A 3DGRA 3MC5A 1E0WA 3UYCA 4BQ2A 1FWAC 4P7LA 1WZAA 1JXKA 4GG9A 4Z1CA 4QHRA 1VGAA 2QT3A 3WNKA 4JY9A 2ZUSA 1VYPX 5AHLA 1Q2RA 3I6TA 3WDQA 4B90A 2V5JA 2BGSA 3MO7A 2DDXA 3THQA 1XS2A 2CZFA 3KUMA 3COTA 4Z2IA 1YPIA 2VC5A 3GE7A 5FACA 4AWUA 2G4FA 2HK0A 1T5AA 1M7PA 1F3TA 3D3AA 4A29A 1Q6LA 3C8NA 2POTA 2CWNA 1TUXA 4GI4A 4LYPA 2VFIA 1CGTA 4GIEA 4IUOA 1TPEA 2PLKA 4AC1X 3NGFA 1KGXA 3MBFA 3G3DA 4XAGA 2Z2AA 4JTFA 1EL3A 1C8XA 4XO7A 1NDVA 3H7UA 1PKLA 4OV4A 1L6YA 2XH2A 4HU8A 2JKPA 3PZOA 2OPJA 2OO0A 3U8GA 2AMGA 3RFAA 2YZ5A 2PU1A 4KKXA 1EXPA 4AIOA 4W8LA 1XLLA 3MUCA 3S6DA 3PPCA 4O0ZA 2CHRA 3GC5A 1E71M 4JAWA 1OQFA 2FPTA 2AL1A 3N73A 2CZVA 4NT0A 1UD3A 1Z8AA 1UYQA 1PDYA 2Y5JA 1XBZA 2VGGA 2ALRA 2BHUA 2QCEA 1C8QA 5IHRA 5AHNA 3TMQA 3WLRA 3GQYA 2X0YA 4IMDA 3T81A 1GVOA 2PWEA 4PEKA 1H09A 3PPHA 2BSLA 3HG5A 3EEGA 3DHFA 4JNMA 3MCOA 2Y63A 2DT0A 3GNOA 2IKGA 2YLLA 1EIXA 1JNDA 1AW1A 1I6NA 3MI3A 4UR7A 1K9TA 3VGBA 4CU6A 4A3YA 4PCNA 2X1SA 3VDGA 4QEEA 1B9ZA 4NJHA 4RDZA 1TPB1 4Y9PA 2V2DA 4WEVX 1XLIA 4HPNA 1QU4A 4KCTA 3QV8A 4K1GA 3IANA 1FWJC 2XIMA 3VNMA 2XU2A 1CPUA 4P7QA 2IKHA 4L4PA 4OUEA 4RZ6A 3VO0A 1O6IA 3V1PA 4JS3A 2WNWA 4EACA 3S2NA 1RUSA 2OGJA 4P5UA 1N8IA 2XZ9A 2XGIA 2JGQA 5GQBA 3LD5A 1AODA 4GA8A 2WMGA 4H6QA 5HJYA 4ZB2A 4OT7A 3W82A 3LCWA 1K9EA 4JXCA 5C6MA 1QNQA 1RBAA 2B0MA 2HJPA 3S47A 3TFCA 1ME8A 3BZGA 3L9CA 3ES8A 2HBXA 1L6SA 4PTVA 5HJXA 1W3HA 2ESCA 3GYEA 5EFFA 2ZCGA 4U33A 2R14A 1J6OA 5CC3A 3GDTA 1V79A 4IQJA 1V3HA 4AY8A 3B8UA 2EBNA 3MY9A 4KRUA 1WDRA 2DSVA 5DLCA 4RL3A 1UIOA 1TCMA 1FCVA 4L6HA 4A3QA 3B9EA 2PDNA 2WCGA 5T9BG 1TZ7A 4MYAA 1R9XA 1NQ6A 4EWND 2G37A 3MKCA 3VDHA 2J9YA 2D3LA 4H8VA 3VX0A 6REQB 3T09A 4HNLA 1G5AA 3GXFA 4AX7A 5CSSA 3NOYA 1KM6A 1OHLA 4ACZB 2J62A 1EFZA 3U57A 2AQWA 3LBMA 5G4EA 1XW8A 3A3XA 1R3VA 3TEVA 2J8FA 3GVVA 5F4WA 4QDWA 3G6MA 1Z32X 1PE1A 3OGSA 4R33A 4G5DA 4PUDA 3VIGA 4QAIA 3CLWA 3RLVA 3EOOA 3VIFA 3IUDA 1H41A 2JKEA 4IPNB 2NQHA 1TJ1A 2ICSA 1V6TA 4S3EA 3U4AA 1G6CA 2PTZA 1KBLA 4KMQA 2GLKA 3W2JA 2HXUA 5KSWA 1UR4A 3GVQA 2GJXB 5EBUA 2ZRUA 1E1EA 3O6AA 4DYKA 3GXPA 4JTAA 1IT8A 1F6PA 3LLFA 5GJMA 4IMEA 3SDOA 2ZRWA 4D9PA 3FJLA 1JI1A 4JTKA 1GK8A 5A6AA 4M8UA 1ZBCA 3OG3A 3H4WA 3QHNA 5A6KA 3SCTA 1XIFA 3B04A 2VX4A 4HMDA 1H2JA 5AKQA 1EJRC 7ENLA 1ZPTA 3A4JA 1K8XA 1XV8A 4PODA 2YCKX 1R2TA 2E8ZA 1UROA 2GSJA 4QBXA 3R79A 4H9VA 4MSSA 1REQA 3PNZA 1HL9A 1SO6A 4Q6XA 4B9ZA 5M1TA 3EWZA 5H6HA 4D6CA 2X16A 4XIMA 1W3TA 4K6AA 4WGHA 1D3CA 2PDXA 3QLDA 3UF9A 3ZSTA 1WDPA 1JJKA 4H6RA 1K03A 2XH4A 3L5MA 3N2XA 3LQGA 4P7NA 3PM6A 4F0HA 1QUMA 3BOFA 1QW8A 3NPVA 5CC5A 5I0DA 2Q71A 2ZA1A 1XC4A 1ME7A 2BY0A 1VFLA 3OHIA 3WYZA 2WBKA 2WHJA 4EPDC 1MUCA 4QLLA 1GYNA 3U5YA 1BVWA 4O1CA 1S5VA 1EH9A 5D2YA 4NJIA 3SRKA 1JDEA 3HG3A 1RHCA 1NWUA 3EMZA 3PBGA 1BXNA 4YVPA 1TJ2A 3QRHA 3CB3A 1O60A 2Q01A 3EX1A 2D2JA 1VBRA 4O4VA 4C1NB 5RUBA 4TMBA 4AWTA 2DQXA 3G0SA 3C86A 1O95A 3AHZA 4BF7A 1U5JA 4WSJA 3OLGA 1MFUA 3M6DA 4LVBA 2CLPA 2GJNA 1R38A 1OX4B 2CXEA 4PTNA 3KW3A 1WXJA 5TD4A 3TTQA 4S39A 3WDJA 1M68A 1G7VA 4I8DA 3TAOA 4RCXA 3QTPA 4DBDA 2ZIDA 1L9WA 4X3ZA 2DFAA 4DWSA 2IPWA 1YHTA 4F2BA 1XBYA 4AISA 1XGZA 5KEZA 3TYCA 1BSLA 3T4CA 3N25A 2ZX7A 4REQB 2INZA 3EOSA 4XZ9A 5HMEA 2FZBA 4YS1A 2EG7A 3TK7A 4UWMA 4PE8A 2X42A 3CAVA 2BXVA 4MZ8A 2OEMA 1C9DA 1MNZA 2REQB 4AF0B 1UWTA 2E9BA 1M7XA 1EO7A 3S6OA 3MCMA 3VFLA 3NDYA 3S2CA 2PD9A 1VFTA 3CMGA 1UR1A 1WKEA 4AZGA 4UOJA 4WXYA 1KCXA 2Q8XA 4JKLA 3EDJA 3GTIA 2ZX6A 3TA6A 3E0VA 1Q6QA 2NLYA 2D0GA 3OJGA 4MZYA 3WLQA 1UUOA 4K8EA 3MJYA 2ACUA 2IQTA 3WDRA 1BAGA 3U0HA 5E0CA 3RLHA 3I7SA 1B9BA 3CUIA 4ICCX 4Q8TA 1UMYA 1VHCA 2GQAA 2FYMA 4J3VA 4EXQA 3VKKA 3RM8A 1WYIA 2W0UA 4HQVA 2PUZA 4ZODA 1A47A 3AIRA 3ITCA 2VFEA 4BQ3A 3ZLGA 3T08A 4DUXA 5SWUA 2Q8LA 4Q7IA 1KXVA 2VX7A 2W61A 4NRRA 4GI6A 4MMWA 3TSDA 3LK6A 3N4FA 2YL5A 5A5WA 3NL3A 4MWAA 1SZEA 2G3NA 4PRWA 1TPDA 4XZBA 3FIGA 3VNZA 2RDWA 4A3UA 3ZJ8A 3RMEA 1VRXA 4US5A 2GFTA 5JVLA 4PMVA 1M6JA 1E9YB 4GYKA 4XZNX 3MJMA 4R9OA 3NQDA 3LXCA 3PG9A 1POJA 3H2FA 4IIDA 1H7RA 5D03A 3N2OA 5LIKX 1G4SA 3LZ3A 5AC7A 4CD5A 2PI6A 2EG8A 4LV9A 4FOKA 3PP7A 3F1QA 4JFWA 2PAJA 3DFPA 3PPFA 2QAPA 3L5LA 4ORMA 1JRCA 2ZUWA 4NNAA 2YX0A 5CPQA 2J88A 2QIIA 2QJMA 4OE7A 2Z1KA 4WRHA 3UXKA 2FTWA 3DFOA 4ATLA 3L65A 1LOSA 4O52A 4QEHA 4LJ3A 4GGBA 4ADUA 2XIOA 1F6YA 3VDCA 2C6QA 3I6RA 3VIOA 1TYGA 4IX2A 1JPHA 4L4OA 3OQ8A 4FNTA 3WF0A 3IGXA 1A80A 4X0VA 1KB3A 1YQ2A 4DYEA 1BQCA 3QH2A 1SZNA 1T8XA 3WMLA 5C7HA 4W4QA 5CZSA 3QR3A 2ZXQA 3VINA 3GY1A 4OIFA 3FA3A 2VC6A 3BL3A 4YTQA 4NSBA 1HX0A 1E4NA 4TUFA 4GJJA 4N0RA 5F4XA 3AU6A 3NIYA 2A3CA 1U1UA 2OFJA 3PF3A 3QFEA 3GH5A 1EHAA 2NSXA 2UZ9A 4F66A 3UPMA 1Z9AA 3HPFA 5DQPA 3W7IA 4AMCA 4HKPA 2W79A 1MUMA 1U5HA 2ZDRA 1EX1A 1H0GA 5DCEA 4C6EA 2ZTKA 2OWCA 2VXNA 3L66A 2Y5EA 3C0QA 4LAZA 1BFNA 1UD4A 3W01A 1SR0A 1JZ7A 2Y6ZA 4HT3A 3WNNA 1S5MA 1J93A 3PFRA 4S23A 2HE5A 4N6EA 5A8MA 4GOAA 1OD0A 3PJUA 1ZBKA 8A3HA 5CSUA 3WQWA 3URBA 3WQ4A 4FIRA 1DKWA 3OQEA 4ENLA 3UZWA 4Q7NA 3DKLA 4Y9OA 2H8XA 4OOZA 1W1TA 1CLKA 1X8FA 5AHMA 4WUIA 4ZQMA 1FBAA 1FWEC 2ODOA 4S2BA 4ZOAA 5LIXX 1JFHA 3WENA 3DG7A 1JUKA 2EO7A 3KAOA 4H3DA 2HK1A 4EK7A 5CAKA 4H2HA 5BOOA 3LA4A 3QKEA 3MDUA 4HA1A 3OA5A 3FJ6A 2VX6A 3W0KA 1PL9A 6XIMA 2FZMA 3MVTA 1MYRA 1GW1A 3BGAA 1OABA 3II1A 4XZHA 1IEVA 3CNYA 1LWIA 1OINA 2VDGA 3F4CA 4F0SA 3H21A 2G3JA 2RJHA 4OWGA 1JYNA 3M6YA 4PRRA 5LZLA 3QMSA 1V6WA 1BG4A 1XLFA 3CAWA 4CEXC 3LENA 5JBFA 4E2DA 1YBQB 1G94A 1MWOA 4HBKA 1P7TB 3GG7A 1VPYA 4YMZA 4MWAE 4AB4A 1OFOA 4GGHA 4QNEA 1WCGA 4XUGA 2F2HA 3A12A 3K1DA 3H54A 4KW2A 1YPFA 1BQGA 2GQ9A 3AXXA 1ISXA 2PDWA 4O13A 4D6JA 3P82A 3I3BA 2W63A 1QOPA 4IFRA 3AAMA 2OR2A 1WZKA 4WDXA 5HATA 3UYIA 5LYRA 3KOFA 3MV11 4MKSA 4GMEA 4F0LA 3CQHA 4Y8EA 3S0CA 3FAXA 4F48A 5MKGA 1E1CB 1XP3A 2PDGA 1R47A 4HPGA 4CVWA 2E68A 1GONA 1ICPA 1WQ5A 1TE1A 3W2UA 1CXHA 4B3ZA 3S46A 1W2VA 3MYPA 2WVVA 4GXWA 3T0BA 4UTWA 3C2OA 1EZWA 4TX6A 3BARA 5IHSA 2YW4A 4LUJA 2NQ5A 2WB5A 4RNIA 4DLFA 4P7OA 1XLGA 4W87A 1AUSL 3KP1A 1LLOA 3A23A 3E2RA 1ICQA 3MWCA 2X1UA 2CBVA 1FKXA 3Q2DA 2QJHA 5KETA 4X63A 3B0PA 1HL8A 1I1WA 2VZUA 3GVRA 4AIEA 2DEPA 5D33A 3RR4A 3N9RA 1Q66A 3OEXA 1V02A 1LOLA 1XINA 2NZLA 2YCIX 3BGJA 3A4XA 3ZT7A 3T44A 4M51A 2J7DA 2VGFA 6A3HA 3W28A 2XFYA 3RR1A 2POZA 3GD6A 5F2LA 2E28A 1ECEA 2PGEA 1DE6A 1B1YA 3FLUA 1V8EA 4HNVA 3F4NA 1UUQA 1XCFA 4HA3A 4MJ2A 4YJ5A 3N4EA 4WY0A 3LI0A 1OF6A 3V5FA 3SCSA 5AECA 9CGTA 2A5HA 1WB0A 2PTDA 4NZJA 2GDUA 1PYFA 4V27A 1W3LA 2C7FA 4TTUA 3M0YA 4AHQA 1Q8AA 7TAAA 4L65A 3KRSA 3P0XA 4LAKA 2WJZA 2E6YA 4I5RA 5BRQA 3WSUA 4ZMGA 1CX9A 3QMTA 4WD0A 3SIMA 1KM4A 4LAUA 2GSEA 1FHDA 3IARA 3Q67A 5IBXC 1PXGA 4DXXA 5BRPA 2PC8A 4I9JA 1CIUA 4PUUA 4MNKA 2WYSA 1QPNA 2FMOA 4S38A 4AEFA 5HPCA 1CNVA 4LUTA 3TC6A 2ZFAA 2GUUA 3WFLA 2WNNA 3AIBA 3LHVA 4J3WA 3TH6A 1M41A 2IPGA 1UP0A 3PBWA 4KWSA 3KX6A 1BYDA 4A2RA 3MA8A 4H7CA 2IUZA 1PZ1A 3UR8A 2OWWA 3FEMA 1Q7MA 2F6XA 2CLOA 1F73A 1QW9A 1UD5A 2GDVA 2Y5SA 4HOWA 3REQA 2Z27A 1NAL1 3HGJA 3PB0A 4NVTA 3FN9A 1XX1A 3VKAA 1S2TA 1UH2A 4BJHA 2QUVA 2E77A 1AMYA 1FWFC 2ZKMX 5D9PA 3CC1A 1WAWA 4UC5A 2X0HA 3UZ5A 2Z4GA 4OHQA 4LX4A 1PZ2A 3FA4A 1AVAA 4OZOA 3PTKA 2NUWA 2ZXDA 4Z0SA 2QGYA 2XN1A 4D1IA 4GCXA 2DZSA 5G2HA 4J3XA 2G3FA 2YBVA 2PWDA 2V0TA 5ECVA 1JR1A 2XHYA 3CV6A 1OFDA 3E0IA 1JCTA 1S39A 3NQBA 1T6MA 4C65A 3WDPP 3VIHA 3CWNA 4JEJA 4CD6A 3ALGA 3VKJA 5JU6A 1FWNA 4J2MA 1XLEA 2JIWA 2PWFA 1DEDA 3DHPA 3LLXA 4AAJA 1UKTA 1W1A1 2FZ8A 1TZZA 2XM2A 3VI2A 4R7WA 4C6JA 1F9CA 1Q7ZA 3P5ZA 2B4GA 4ML9A 3T2PA 1E1FA 4JFSA 1EP2A 1FWGC 1V3LA 2FLIA 2GGGA 3EXTA 3F5LA 4AZ7A 3OLEA 1X1ZA 3CHDA 2Q3RA 5REQA 4ZE5A 1DTNA 3G0XA 3B03A 3HJEA 3CLMA 4O10A 4PGLA 1FFRA 2VTFA 1G0CA 5A6BA 2OLSA 1FHUA 4AZCB 3W85A 3PULA 1C92A 1V02E 1LG2A 2YKKA 3VUPA 3M7WA 4G7FA 3W1XA 1KD0A 3NO3A 3CO8A 1VIWA 5C8BB 2YJQA 3O7UA 3DOPA 2DJXA 3A9IA 4O15A 4BI6A 3LRLA 4Q6JA 4DAIA 4KPLA 3TCSA 5BXPA 3W7HA 3ID7A 2C19A 4UZSA 5FAGA 2YXOA 4O1DA 1A5SA 3QY6A 1EEPA 2PF0A 4ZA0A 2WMIA 3DIPA 4KEZA 1VKFA 5FI8A 2NXIA 4F40A 3AISA 3WG6A 3EDFA 2DORA 3GZ3A 4IHCA 2E1WA 1K1DA 2XIBA 5C9XA 4IT1A 1TVLA 3GU9A 3H8AA 4AC7C 5D8ZA 1H7WA 1PKNA 2BY2A 1AH0A 2DSUA 4DI9A 2GVJA 1LM1A 3S3GA 3W7RA 1TZ9A 3U2ZA 1JDCA 7A3HA 4L80A 4LY4A 4C6MA 4GX8A 1VBUA 3VGEA 1KXTA 4HGXA 5FJPA 1EQCA 1UZDA 2Q09A 4KS0A 2NQZA 4FSAA 1WV2A 2V5KA 1I0DA 4HA4A 5JH2A 2HVOA 3M0HA 5JUVA 1TWWA 1L6GA 1NDZA 1T99A 1EP3A 2CBJA 2PURA 1EJWC 4AW7A 1K8CA 1W5MA 3KBSA 1MQRA 2DT1A 3ZFHA 3MI6A 4YVVA 4Z0JA 2EG6A 4AHOA 1KRAC 2ZOXA 4M29A 1O5XA 2JFEX 1S5TA 2ZWZA 3FAWA 4L4LA 3DDMA 2CZDA 2PP3A 1BYBA 4OVXA 1TUFA 4B5WA 5AB3A 1X8CA 1KM3A 1H3GA 3WQFA 3LRMA 1B30A 4XBKA 4A2SA 4NZ1A 2FFIA 1QDSA 3RRXA 1JPMA 1XLHA 4JIQA 4CN4A 5F2MA 2PDHA 4UNLA 2ZYFA 3PSWA 3OB8A 3VDAA 3L4UA 3O8AA 3Q4DA 2A2IA 5IDIA 1GOIA 4DZ5A 3BAXA 4I6KA 1QOXA 3LX9A 3WLOA 3ORWA 3SQMA 2YIHA 3W86A 2G95A 1Q45A 4UQAA 1K3UA 1SM9A 3IUIA 2DSZA 2Z1BA 3W71A 1IGSA 3MMUA 2HPMA 1XUUA 3WK3A 2QUTA 4KFNA 4KESA 1M3UA 3S6TA 1KRMA 1C7TA 3L0GA 4B5UA 4ZOBA 3TWBA 1BHGA 2QCHA 5TF0A 5AZ0A 3N11A 2ZDSA 1N8WA 2J27A 3HBLA 3GDLA 3AYVA 5B7ZA 3RUBL 3B9DA 2VEMA 3KCLA 3XINA 3WH9A 4H9MA 5EBAA 4XBJA 5C5YA 4N4QA 4ZCWA 4CGTA 3RITA 2QV5A 3DFTA 5I00A 1Q6RA 5U7SA 3A24A 1UKPA 1TPWA 2DGAA 3UP8A 2E4TA 3TR2A 4JIRA 2NT1A 3EMQA 4OECA 1QHPA 3F7JA 1NWSA 1W3KA 5CBBA 1JUBA 1UWIA 2YB4A 3LCHA 5K3VA 4EIVA 1GVYA 1UKSA 3HGRA 1MMFA 4WCJA 3AICA 4X9SA 3AO0A 1EOKA 6ENLA 5BRBA 1LCOA 3TYBA 3HQOA 1JVNA 3HPXA 2FZDA 2OYKA 3UR2A 3CZLA 2WM0A 3TQPA 3E2VA 3A47A 2H90A 2BZNA 4AUBA 4DYJA 4JX6A 4FOJA 1KFKA 4EXBA 3WD3A 4B3KA 4IP5A 4WKAA 1HJQA 4XSLA 1XG3A 5HR6A 1VEPA 3VCRA 3O16A 3VGHA 1E72M 3MMDA 3OG2A 1OC5A 1LBFA 3CEUA 1ZZMA 2FHFA 1XRTA 4FNSA 4UFHA 4ZQNA 1BF2A 3N6JA 1XFCA 4B5NA 3G77A 5G1MA 2BXZA 1B3ZA 3V5CA 2G3IA 2V3EA 1V0NA 3FGCB 3ZMRA 1G67A 3BWWA 1W2PA 1O12A 2OMAA 1FWBC 3AIWA 2BB0A 2P0IA 2A3LA 3LOTA 2P5NA 4JTLA 3TN6A 1GORA 3KHDA 3I3EA 4AH7A 5E6YA 2J6VA 5BXSA 4K3ZA 2YW3A 1OADA 3MVIA 5I3HA 3A4AA 4IIBA 4DM1A 4YHEA 3N2CA 2W9MA 3ZZ1A 5GNXA 3BLPX 4C7DA 1U1HA 5I3GA 2MANA 5D2TA 5DT7A 3TX9A 2DU2A 3UXDA 1MW0A 1XWYA 2H3DA 3GNPA 2F84A 4WDTA 3ARSA 5LA2A 2I57A 3BG9A 2J13A 5FA5A 3QW3A 3VTRA 4OUIA 1KFBA 1MDLA 3MUZ1 4GVHA 2OJPA 4IFKA 1S2AA 5D38A 3PTDA 1YDVA 3SUVA 1G69A 2W3ZA 2DZPA 5A2BA 1DIKA 1CLXA 1ZP3A 1JZ5A 2PDUA 3MHFA 4LUIA 3VZYA 3L2LA 8TIMA 3I65A 1TTJA 3S9IA 2WCSA 2CKRA 3WEMA 5D9MA 1GVQA 1A0EA 2WPGA 3B3DA 3QZEA 5I5RA 1UG6A 3F4VA 3WQ5A 1BKSA 2YCLB 2G97A 4AD2A 3KBJA 2BG5A 1IXOA 3SCUA 2BNJA 3EA1A 2VD8A 2ABAA 4A8IA 1Z89A 1XLBA 4HJFA 2YGYA 5FCZA 3T0DA 3BJTA 4ZOEA 3MB9A 2J24A 1UR8A 2D3NA 4AWEA 2HBVA 2V67A 1W5OA 2ZRYA 4ZO7A 3EOEA 1JAEA 2XN2A 4AFYA 1VYSX 3KOZA 1UKQA 4QLJA 5K9DA 2J7HA 1IIHA 2X05A 4NF7A 4OV9A 1TA3B 3GU1A 4KGLA 3NZ1A 1X6LA 4BI7A 1Z6KA 5CG0A 2WO5A 2P3ZA 4KERA 2Z1SA 1O1ZA 2IMRA 1HKWA 4MKVA 3TTYA 2WJDA 3L21A 3OZMA 3CUXA 5C70A 3PG8A 2Y8KA 1UWQA 1ZB5A 1UPMB 2QF8A 5C2CA 1Y0EA 4DY1A 3W7DA 3TSBA 3HQPA 3MV01 4QDMA 3A4WA 4DJDD 4H01A 2INEA 1NP2A 4GNVA 4IJRA 1ISVA 3MHGA 2PDYA 1QWGA 1W5QA 4C5YA 2D1ZA 2X0SA 1PHWA 5BU6A 2ISSA 1OK4A 2AAAA 1XBVA 3B4UA 3QKZA 5HMSA 3IRDA 2V63A 4D6DA 1AZ1A 4FI4A 3TA9A 1LUCB 2GZXA 1EJ7L 1S1PA 3WELA 1JCXA 1JF5A 2V81A 3AIQA 3GHUA 1GOKA 3DG6A 4LYQA 1HJUA 2QJGA 1NOUA 3TIMA 4P2VA 2VOTA 3VMNA 4DHGA 4MDOA 2V30A 1CGWA 2GQ8A 4B15A 4O12A 3H2MA 5FJTA 2C8NA 1DWAM 4A3HA 2BWGA 3P2VA 4MY1A 3VZZA 2WZHA 3PZ9A 4G8TA 4QJ4B 3IJ6A 4RJEA 1DTUA 1SJBA 3VAVA 3B8DA 4ZQCA 5M3WA 3R43A 1PIFA 3S2MA 3M0MA 4DJEA 5E9XA 2PTXA 3MCNA 1ISWA 1FH7A 1YNYA 5H8PA 4LB3A 1WUFA 2YCJA 3ELFA 1R6WA 2XH0A 4YYFA 3VYLA 3NQCA 1YDOA 4ERAA 9XIMA 5ABFB 1ZJBA 4DZAA 1XDJA 3E2SA 2NXHA 1KO0A 1ECQA 2QDGA 4W9TA 1IWPA 1BWKA 3G2GA 4PR4A 4IG2B 3KBVA 4QSFA 4KT2A 3TJ4A 3SGUA 1FUYA 4NAEB 3C61A 3LPFA 3M9YA 4UTIA 5JXQA 1DQUA 2P8CA 4S3CA 2W5FA 4AXNA 4I5XA 4IIEA 4EE9A 3IJ8A 4G1NA 1JZ6A 2QF7A 3MZ2A 4DF2A 2YXGA 1EF3A 1U1JA 4ADTA 1ZL1A 3P0WA 1Z3NA 5CLWA 5E0KA 2ZZ2A 3SUWA 1XRSA 1SVDA 2XPKA 3N04A 2DVUA 1Q8JA 1NF7A 4TVCA 5ABGA 1HVQA 1E0TA 1UD8A 5DY3A 3UCQA 3T42A 5HWMA 4M7TA 4Y96A 4ADSA 3MPGA 1DJQA 4E5TA 1K77A 4RK8A 2WSYA 1QPKA 2GYIA 1EA9C 4ZL1A 4K2SA 3VUSA 4DBSA 5CSRA 1NFGA 1TIMA 3K1GA 2WKLA 3GX9A 1YDYA 1B3VA 4KQNA 3L4ZA 5DT5A 2G5WA 5E6ZA 5CJMA 2E5CA 1W91A 3TOYA 1JQXA 3WNOA 3LGGA 2ISWA 3JZEA 1W9DM 5HBFA 4DLMA 2V6AA 4IP4A 4DN1A 2Y8VA 2Y7FA 3P7YA 4W8BA 5HNRA 3ITVA 3R13A 2BP1A 5GNZA 3BCDA 3U5UA 3INPA 3H12A 4IF2A 3POCA 1H7PA 2DZUA 3V35A 1F4HA 3E74A 1D7FA 4DJFA 2Y89A 3E0WA 3HM7A 3EDDA 4UTFA 3T0AA 1ZSXA 4HIBA 4HU4A 4F2UA 2YB1A 2Y7DA 1XIEA 4O0QA 1TO3A 1NTHA 4KETA 3RPTA 1EEXA 3LLDA 1NSJA 1X98A 2HVMA 4PL1A 5AFDA 4S2CA 3M16A 4ACYA 3ZJKA 4U3AA 3CT2A 1W9VA 1PKMA 4GI8A 3RCYA 2V3GA 3ITYA 1OCJA 1CXKA 2DQWA 5IFPA 3RU8X 3LDVA 4WSKA 2FTYA 4UOZA 3S1GA 1W37A 3ZT6A 1IWBA 1JUEA 1GKRA 2XSXA 4LOCA 3ZVHA 1LT8A 4CD4A 2RHGA 1H62A 4XTDA 2DIEA 4BCEA 1NH6A 5C9RA 4GXMA 2WSQA 1SO3A 1DIOA 3S9ZA 5FKYA 2VEKA 5BCAA 1CBGA 4NJGA 1X6NA 4DUOA 3Q58A 3LBOA 3ME3A 4UFIA 3U48A 1LZOA 1IZKA 3PBYA 5I78A 1IV8A 4CNNA 3SCQA 3DHUA 1WE5A 4RV3A 2ATSA 4JTDA 3PZNA 2J4GA 4L9YA 1GKPA 4HD5A 4PFHA 3SIZA 1QPOA 3S1VA 5D2XA 1ADSA 1J9YA 5HNNA 3KDNA 3N3MA 1UASA 1DE5A 2YDAA 2E6DA 1SMAA 1S2VA 2J74A 5E70A 4DI8A 5I3FA 1U22A 3G6LA 4UTJA 2XFFA 2ZBTA 1OF8A 4XK2A 1MO0A 3QVQA 2Z1WA 3AMKA 4XVDA 4RLIA 3DG3A 2XINA 3PANA 1AL7A 3ZS4A 1P0DA 2OZ3A 4N9EA 1K7FA 4TQTA 4DEFA 2WVSA 1CT5A 3K4WA 3LPOA 1UJPA 3HGSA 1WOBA 3NL5A 1EGZA 4PMOA 1KR1A 4PB3A 1DXEA 2VRKA 3GW0A 3EWYA 1O5QA 4XAYA 1V0KA 1TG7A 4E2VA 3N2TA 4JR5A 5FJJA 4R5EA 4HSHA 3TJLA 4K36A 3W1RA 5ABTA 1E6QM 2O92A 4UQEA 3GH4A 4LB4A 3QR0A 3BLIA 3HQNA 4H9YA 3HQ1A 2NV2A 3N18A 2DV0A 1UWAA 1DOSA 3AFBA 4HCLA 4UFKA 2QCDB 3WMBA 4B9YA 3FEQA 5AC5A 4S3FA 4IL2A 4PCFA 2WLZA 3H53A 1Q6OA 4IUGA 4C6IA 4MZ1A 4ZTXA 1HJWA 1UA3A 2O56A 1SU5A 1PYMA 4GZJA 5HPOA 4X61A 2YYUA 4Z17A 2BOFX 2RGLA 5HJLA 4IGNA 4JTEA 5AC8A 6CGTA 1H7XA 4HOZA 3VDBA 4RE0A 5M5DA 3E3HA 2PWHA 2XIJA 1V93A 4U5IA 2NX1A 4GYJA 2QCLA 4PTMA 1OIMA 1NM9A 4QDPA 2X1TA 3VCNA 2E40A 4MF4A 3TWAA 2OYMA 5BWFA 3BV7A 1P4CA 5LNVA 1TJ0A 2G0WA 3MMTA 4D72A 2VNCA 1ZCOA 1P5BA 4AVOA 3KEHA 1S38A 1BKHA 3B05A 1XIDA 4LC8A 2BLEA 4JDBA 3SZ8A 3W23A 3LBCA 5C7VA 2BGQA 3T0CA 3WQOA 4JTGA 3KTXA 4QS6A 1G9HA 1VAHA 3NO1A 2GVEA 4LUSB 1VCFA 1WDDA 5AN7A 2HROA 3S5NA 5FSEC 3G24A 3H2EA 2Z1VA 4H8NA 1B4KA 1J0ZA 1ONWA 2OZ0A 1ML1A 4HPXA 1LL7A 1V6VA 1UC5A 2C15A 4M7SA 4DBWA 4QGCA 3RX3A 1GJUA 3F5KA 5BU9A 5G2WA 4OTKA 2BASA 4CNPA 1AA1B 1FHVA 1MXSA 3TYDA 8CGTA 2A6LA 3WMCA 1AQFA 4UTHA 2WHLA 5DO8A 3ITTA 1XYFA 5EMLA 4K39A 2AQOA 4OQVA 4YHGA 3W75A 3CZGA 1TV7A 3OPSA 3BVJA 4DF1A 1QW7A 3AWNA 3Q37A 5I24A 3UWUA 1DJXA 1IEIA 4Q7BA 4AD5A 3EB3A 4EANA 4C1KA 3QSRA 3SURA 3FDGA 1H7NA 1Z48A 3W1MA 4FALA 3EX4A 4RZ4A 3W7QA 3EEZA 2OLAA 4ZBCA 3WF1A 3PZVA 3LXAA 3P8IA 3MP5A 4L1GA 4LUYA 4MYXA 1CXFA 4EAMA 2XYLA 5EYWA 1O68A 1H11A 1PJ9A 1ZQ5A 1T40A 2Y2WA 3A6OA 1EYWA 2GK1A 2WSKA 1ZALA 3NZPA 4IIHA 1SZGA 3F03K 5G4HC 4B91A 2YXXA 2B31A 1PBGA 4E4PA 5JQ9A 1H60A 4QAWA 3V4BA 1W3JA 1E3XA 3ZR5A 5ABHA 1SFTA 4LCQA 4NAFB 4PBEA 4H7ZA 4N42A 1MW3A 3F2DA 4ATDA 2H6RA 3ANUA 2W67A 5KITA 3AIEA 2NUYA 3MI2A 2VR5A 3P62A 4QE4A 3PHAA 1TVNA 4RV8A 5LGXA 1IEQA 3BG5A 2PDIA 4UXDA 3B8SA 1PV8A 3WH7A 3UXAA 2WQDA 4UIOA 3N13A 3KLLA 4YTRA 2P1FA 1KXQA 4X0NA 5FAJA 3RJYA 1W1B1 1R87A 4ZSTA 2WOQA 2ZZ5A 1VP5A 3WJYA 3L0KA 4HNUA 2Y8UA 5LSMA 2GJPA 1KQZA 5D02A 1JD7A 3TOPA 3WUEA 3QGAC 1IR2A 1X7IA 4PB4A 7REQB 4LYKA 4JKKA 2W92A 3BLFA 4YL2A 2OT1A 1JI2A 2BY1A 4UTKA 4W8AA 1J79A 4XO6A 3P74A 3CBWA 4CD7A 4H9XA 4QITA 1YRRA 4YTSA 5AYZA 1J2BA 1DYSA 2TRSA 2WJEA 3BJFA 1KNWA 4N02A 4L5ZA 2QPSA 4L64A 3W2KA 1FDJA 1B5TA 2HISA 5F1VA 4HPHA 3SFKA 4S3AA 4GIAA 4IISA 3UG3A 3WFAA 3PZUA 2GOUA 2PRMA 1Q6GA 4UB9A 3PPGA 1J5SA 4IXXA 1SSGA 2HTMA 2VWTA 3FFSA 3AHVA 3T2OA 3TC7A 4RPPA 3N12A 3PWAA 3LTPA 4DWSD 1JGMA 3RK8A 5HULA 2HNHA 3MZNA 1OT1A 3H26A 1IQ8A 4I7UA 3LU2A 2WNQA 2J75A 2YCEA 3CPRA 3TSMA 4GKLA 3O3RA 2Z6IA 4BY3A 3LCXA 3ATZA 3V16A 2PE4A 3P80A 1GNXA 2FPVA 3BK0A 4QE5A 4H41A 1VFSA 1UR0A 3M0LA 2W66A 1NARA 4Z1BA 2Y62A 2WC7A 4H4IA 1KBIA 1S2UA 1TREA 1YXDA 2ATMA 4XUYA 2UWFA 3APGA 4ZO6A 1W1ZA 2XVPA 4M81A 4NP7A 4O1FA 4TIMA 3FVMA 1XRFA 4LF2A 3UA4A 1CI1A 2VOMA 4PMXA 4MWAC 2VHLA 3GSMA 3OBAA 4L6DA 3A3WA 4GVFA 2Z1XA 4B92A 1OFBA 1OFRA 1EWEA 4TVUA 3ZQ9A 5BOFA 3TDFA 5LA1A 1QO2A 3FSTA 2HRWA 1Q65A 1B3OA 4MLRA 2A85A 2CHNA 4QJ3B 3W00A 4HP5A 3QHMA 1H5VA 3LUTA 2D2OA 3KRBA 4NQ1A 3LN3A 3AS0A 2EKCA 4O19A 5FL0A 3VNYA 4Q4OA 2KAUC 3EXRA 1AD4A 1NDWA 2OQHA 2AGKA 1UIPA 3W76A 3UZZA 2CPUA 2ZRVA 2DUZA 2E25A 3GW3A 1V7YA 2WV8A 2C0HA 4YNGA 3CH0A 3W3OA 4MWAD 1VC4A 1ADDA 1AJZA 4AY1A 1BD0A 1R9ZA 1MW1A 2NWSA 4JEQA 4N9CA 1B57A 2CNCA 3GYCA 3G1XA 3ZLHA 1R3WA 3GRIA 4US5D 1GW9A 1HL2A 1LBMA 2JF6A 3KDOA 5CBJA 2BY3A 3GFYA 2PDQA 1FWRA 4GH3A 1A5OC 3FY1A 4TU1A 3W7CA 1TX2A 3IK2A 4IXHA 1LT7A 3ZLFA 3ARRA 1C90A 2OEJA 4D6GA 4ONVA 2D2GA 1TB3A 1CGUA 1TJPA 2JK2A 4XZMX 3H6OA 1R3TA 4GBDA 5EKYA 1V0LA 3EXSA 4DNHA 1XGDA 3E2QA 3E49A 5DRIA 2WSPA 4IPIA 2ZZ1A 1QK0A 2WAGA 2ZRZA 3BTNA 4BZYA 4WGXA 3VKBA 1QJWA 2YZRA 1P1XA 3G8RA 2CIPA 3HV9A 3PR2A 3M0KA 2PEVA 1GKQA 1MSSA 6REQA 4F0MA 3QYSA 1JZ3A 1HO1A 1V6YA 2VFGA 4KWUA 5EGRA 3BW4A 3BE7A 5CEWA 1X1OA 4ACZA 4HK6A 2ZWYA 3UR7A 3ZYZA 1GZ1A 1JGIA 3N17A 4PUNA 3GIPA 3SGGA 5M03A 2J9ZA 4Q8VA 1LTDA 1OIFA 2ASHA 3QY7A 3MYOA 1ZCCA 3CAKA 3QC3A 1U2YA 1EUAA 3EX3A 3I7QA 4B5SA 1M04A 1KC7A 4HU3A 2OOFA 1E0VA 4O8RA 4P7RA 3VC5A 2B7NA 4FLQA 2GGJA 3NAVA 1QASA 3GM8A 3OO2A 4ZQOA 4PCPA 5D2WA 3DC8A 4Q22A 4JIHA 1S3TC 1Y5XA 3RRAA 5C9ZA 4GK8A 3QLLA 2BODX 2GJXA 2XTKA 1OWQA 1TIWA 3ZVIA 1QBBA 2R91A 3VZXA 4CQCA 5EB8A 1VFHA 4KWVA 1CB2A 2IKIA 2J47A 5TAOA 3NL6A 1EDGA 3AXKA 2YDRA 1R2RA 1Z42A 1JCYA 3M0XA 3SCVA 1YKWA 1EWDA 1RQHA 3QQ1A 1OFPA 4UQDA 4I7WA 1VFMA 5A6JA 4FHAA 1B2YA 1BRLB 1LDCA 4ZZ9A 1SQ7A 1A53A 5EFDA 4X2RA 5CSYA 2J66A 3QBUA 3D6NA 4MHBA 4XAZA 3GXTA 2Z0IA 4A8RA 1XD1A 5D8WA 4B5VA 4PB5A 3G1YA 4FXSA 2AKMA 3V36A 2OKOA 1V3MA 2DT2A 3LNMA 4S3DA 3QHOA 3WL0A 3K30A 1I1XA 2Q8ZA 3YPIA 4JYEA 3HOJA 1SW0A 3ARXA 1PX8A 3G1AA 3RM4A 5BMXA 1GOXA 4LFYA 3WDIA 1CW2A 3JZUA 1HW6A 1KRBC 5FEPA 4KIRA 1IIGA 3AMCA 1H51A 4J9JA 1PUDA 4YXGA 5HNTA 3D47A 2E6AA 2OEKA 3WN6A 3GUWA 1AQ0A 1V3KA 4JCMA 2A4AA 2Q6ZA 3QMRA 3WUFA 3DYOA 3PZMA 1EHNA 2RJGA 3W7EA 1OC7A 1J0IA 4IP7A 2FVKA 3H7VA 2X1RA 2PS2A 1IE7C 5I7GA 2E5BA 2WANA 4G6CA 4CN6A 2EPOA 5JIWA 2GVGA 2FHBA 1KBJA 1A3WA 2F9RA 3ABOA 3MSGA 4MPKA 4E0CA 1YE4A 1UUMA 5DBTA 1R0MA 1A5AA 3BLEA 1S1RA 2ISFA 3KFTA 2VUYA 4NZFA 3GIQA 4UTWC 4KCVA 1BG9A 3ABRA 2PP1A 2HZGA 1F07A 2JGYA 1W8GA 1X97A 1W0MA 1FFQA 3SRDA 1OX4A 4HTYA 4TTGA 3HTWA 4XAFA 2IPFA 3WFZA 2H3BA 1TMLA 1C7SA 2BVDA 3WH8A 2XN0A 1M01A 1WA3A 1ZLPA 3FYPA 3GXDA 3MWAA 2F7FA 3FJ4A 1U5VA 3E1F1 3VNDA 3WLMA 2NV9A 4OOUA 4D2JA 2R1PA 1JCMP 4REQA 7ODCA 1UP3A 4JFTA 2OZ8A 1SJCA 5L9FA 2IQDA 1AQHA 4CNOA 3TQVA 1WP6A 4PUKA 2R9RA 3PWGA 4I3GA 1LJYA 4RXGA 3WEZA 2REQA 4AF0A 2WZIA 3C56A 2Z2BA 4XD4A 1XJBA 1SR9A 3VU2A 3BICA 3UT0A 4NX5A 2GGEA 2QMKA 3NQ8A 3DHDA 4MB5A 5EMJA 5FF7A 2RH9A 4LQ1A 4XSMA 2J7GA 5HANA 4R7JA 2G50A 2EF9A 4CVUA 3LM7A 5DFAA 1T0OA 4K38A 3RILA 1AW2A 5FJIA 1VBHA 2WHKA 3P14A 1KGUA