3V5OA

Structural and mechanistic studies of catalysis and sulfa drug resistance in dihydropteroate synthase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
262
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILNPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dihydropteroate synthase
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 92
structure length 262
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3v5oA00
1Q85A 1AJ0A 2VEGA 2DQWA 3H2FA 1EYEA 3H23A 4MWAB 2H9AA 4PZVA 4NILA 2Y5SA 4O0QA 3K13A 2VP8A 3TYUA 3BOLA 2DZBA 2Y5JA 3H2AA 1TX2A 3H22A 3TZFA 1Q8AA 4DAFA 4G9PA 4S3FA 3TZNA 2YCLA 4DJEA 3H21A 4CCZA 4MWAC 2VEFA 4MWAE 4S3EA 1Q7MA 2H9AB 4S3AA 4DJED 5JQ9A 1Q8JA 4DJFC 4S39A 2OGYA 2YCIX 3TYCA 4DJDC 1TX0A 2E7FA 4D8ZA 3MCOA 3TYZA 1Q7QA 3H2MA 4NIRA 3H2OA 2DZAA 4NL1A 3TYEA 4S3DA 4C1NA 4DJFA 2YCLB 3H2CA 4DJFD 4O1FA 4DJDA 2YCKX 3H24A 3MCNA 4DJDD 3BOFA 4O1EA 3MCMA 1AD1A 1TWZA 3NOYA 4S23A 1AD4A 3TYDA 3V5OA 4NHVA 4DB7A 1TWWA 4S38A 3H2NA 3TR9A 4DAIA 3TYAA 4MWAA 2Y0FA 4MWAD 3TYBA 4D9PA 4C1NB 4DJEC 2BMBA 4S3BA 3H26A 1AJZA 1Q7ZA 1F6YA 2YCJA 3H2EA 4S3CA 1TWSA 1AJ2A 4HB7A 4D8AA
chains in the Genus database with same CATH superfamily
3VUPA 3LLDA 3WQ4A 2RH9A 2X7VA 4LAMA 3KVJA 3VIIA 3S6OA 3AYVA 3ANVA 3CH9A 3LX9A 1JYWA 3LCHA 1KCZA 3VM5A 5G4WA 1G94A 1MFVA 4C6EA 2ZXQA 3TA9A 4Q8QA 3C2OA 3V5FA 3HPZA 4F0LA 4K39A 4GG9A 4WXZA 3VDHA 3NPWA 3W7RA 3M9YA 1QUMA 3SFWA 4FNSA 2CLOA 4EPBC 4U4MA 1M7JA 1UH2A 1ICSA 3H54A 3GHUA 2J24A 3PWIA 1LQ0A 4WGXA 1Q2RA 1I0BA 4ZA0A 1SVDA 1ZRQA 1CYGA 1EJSC 3H2MA 3FNDA 3NPVA 2QLYA 3BPWA 4ICNA 1TPB1 2D0GA 2WK2A 3S4TA 1R30A 1ISYA 1A5LC 3WUGA 1ISZA 1EJUC 2VFIA 3SBFA 2NT1A 4Q7IA 3DHUA 1OWQA 1GTHA 5I23A 3I3DA 2J6XA 2VEMA 1H1ZA 2VHLA 1Z32X 4CKQA 1CI1A 3W07A 5C70A 4HMNA 3EWYA 1UKOA 3CEPA 2BXZA 4PN2A 5K9XA 3PZTA 3WNPA 3UXAA 3G6MA 3TU9A 1ALDA 1GVRA 3I6TA 4XVDA 1K02A 5EMMA 3W00A 4ATLA 4UTUA 4LAKA 1BTMA 2VXNA 3LA4A 3GVQA 3ZT5A 1FA2A 3CU2A 3LGDA 3M07A 3B97A 2XGZA 4M81A 3MI2A 4L9ZA 4O17A 3L5AA 1OD8A 4M51A 4F2UA 5D32A 5FJPA 4DIAA 2BGNE 1G7UA 4DY1A 4NZFA 4QDMA 2ZUUA 1LLWA 5TIMA 4ADUA 2ZZ6A 1EJTC 4ZB5A 1ZLPA 4RUBA 1TVNA 2TODA 1ZCCA 4ATWA 1SW0A 2HDJA 3GYEA 3UR7A 3VOGA 3VNZA 5KINA 1K77A 3TSBA 4S2CA 2PF8A 5I3GA 4N9CA 2FFCA 3KE0A 2BB0A 2DSVA 3DC0A 1J6PA 3FGCB 2WQPA 2Y8UA 3DG3A 5D8WA 3IUDA 6XIMA 1A5AA 3TWBA 2CKRA 2RHGA 1FFQA 4NYYA 2IUZA 4XV0A 2EPKX 4HSNA 4GQQA 2PDLA 4NU7A 3WD1A 4GH1A 3BOXA 3KX6A 3QGVA 1R3YA 4ERIA 2XN0A 4DO4A 2HS8A 4J3ZA 5IOBA 5CC5A 4HYVA 5CLWA 1H5YA 4BS0A 2Z4GA 4GGBA 4QM1A 5K9DA 1V6XA 4YU1A 1U1HA 2V3DA 3HPAA 4IMAA 1B54A 3UNTA 3A5VA 3BLDA 5FEXA 3VGGA 4I9MA 2A3EA 3ZZ1A 3CEUA 4NRRA 4B5XA 3ITOA 3FY1A 3W01A 3PTQA 1OC6A 2LLEA 4PBEA 4AUBA 2PSNA 1VC4A 2DVXA 4E38A 1DJWA 3ITGA 1J5SA 1MI3A 1TJRA 5EMJA 1SZGA 2ISVA 3TONA 2F9RA 4C6LA 1XD1A 3CHEA 1OCNA 3S5OA 3E0VA 1PE1A 2JFEX 2VCCA 3W2LA 1UD3A 1TUFA 4IPLA 4IGMA 1GYNA 4I9AA 4ACYA 1F4HA 1V02A 3W6LA 1IZJA 2YOCA 4WJXA 1DWGM 4GYKA 3UZZA 1BG4A 4GD0A 3WSUA 4TO8A 4RPQA 2E5CA 7ODCA 1S38A 3S1GA 2XGBA 3QMTA 4DUOA 2V5KA 3ZYZA 3N2XA 3OQ8A 2DT0A 4ICCX 2OKTA 4AVOA 4M1BA 3CUFA 4IMDA 5DMLA 1PTGA 2WM0A 3RPDA 3GS6A 2YIHA 2QHAA 2OCZA 4IFRA 1MUWA 1AJ0A 3GTIA 2VDGA 3OU8A 3MP3A 5J5DA 3EWBX 4RDVA 1VCFA 4U10A 2Z24A 3GFYA 3FIGA 4L61A 4BWLA 1H7XA 1FRBA 3L65A 4TTGA 1TMQA 3L7RA 1TE6A 3FSTA 1U5HA 3TV8A 2ZKMX 4JTQA 1P5BA 2XINA 1GEHA 1O60A 1WZAA 1M5WA 3VD7A 2V6AA 3W2JA 1KXHA 4L6OA 4X9YA 4Q4OA 4UNKA 3II1A 3C0QA 3UBPC 5DBTA 1K1DA 1OFEA 3IIOA 4NYUA 1NM9A 3GR4A 3G0XA 4LEFA 5FACA 3VD5A 2FPVA 3WJWA 4EXAA 2QAPA 1FWTA 4H9ZA 2OYMA 3PSVA 2YCLB 3O6CA 4CNSA 3EBVA 2XZ7A 1DJYA 2BP1A 3C2FA 3H7RA 4IWWA 1POJA 4Q4MA 5D03A 1CCWB 3ARVA 5FJRA 1XH2A 2NUWA 4ZSUA 3STGA 1E1FA 3W29A 1X8FA 3AXMA 3F4DA 2VD9A 3GXPA 2WVSA 3SUUA 4QJ5B 2DSZA 4J3TA 1UR4A 3S9IA 1BG9A 3UZ5A 1H7NA 3I3EA 3GHSA 3B0PA 4ROQA 2CLMA 3H2FA 1R2SA 2VYOA 1WBHA 2GJXA 4AIOA 1U83A 1GWJA 3EKLA 4ZB0A 4DWSA 2BOGX 2I16A 4X22A 1E6PA 1DE5A 3QLDA 4J1OA 4AZIA 3LTYA 2ZWYA 5D4YA 2JF6A 4DZIA 3QR1A 2VFEA 4UQ9A 5EFDA 3G5EA 3SB0A 4NSBA 2ZVIA 2ZZ7A 3UWWA 3WDHA 2PGRA 3SZ8A 1P1MA 4FHAA 4MMWA 3N17A 3TN6A 1LBFA 2NWRA 4TVUA 2OGYA 4S1FA 4XAFA 4G5DA 4WSKA 5JUVA 3MO4A 3L4TA 1IWBA 2UY3A 3RX3A 5K4XA 1CX9A 4MNKA 2XJ7A 3DERA 3EX1A 1ONEA 2CU0A 2O4QA 3C61A 1CGYA 1ZNNA 4B90A 4EX4A 3STEA 1DE6A 1DOSA 3CYVA 4ZE4A 2WCSA 5FESA 4CD8A 3EX6A 3VE7A 3NZGA 1HX0A 4MZYA 3NSXA 4RLIA 5DY3A 1UBPC 4XX6A 4RE0A 3VNYA 4G2DA 1JR1A 1SW7A 1VFHA 2Z28A 1VEPA 2Z7KA 3C8FA 4BWLC 5CJMA 4DNMA 1I6NA 4KRZA 3THDA 2CKSA 1JZ6A 3L4VA 6PTDA 1Z9AA 2QXWA 4JGDA 4LAZA 3ZT6A 4K36A 3R8GA 3S6TA 5G1YA 1TR9A 4Y9OA 3N6HA 4LS2A 4D6EA 3NYZA 1EPVA 1W1TA 3TYUA 4DUWA 3URBA 1LG1A 2BGSA 3QZEA 1EDQA 4KIRA 4PSRA 4GXWA 1MNZA 1DJZA 2OWCA 3RMJA 4GCXA 3G0SA 4AYGA 1FKXA 4OE7A 1CZ1A 3FW6A 3CYJA 4CCZA 2PWEA 2HSAA 3GRIA 5I03A 4P7QA 1UUOA 4WY0A 2XPKA 2XDFA 5HJLA 5CZKA 1KKOA 1F8MA 3TLLA 2BSLA 2OYKA 4GGHA 3WQGA 1HKWA 4RDZA 1EIBA 4E3TA 2GVGA 3WK1A 3H2CA 1MRQA 1GOQA 4YWSA 3SCUA 2FJKA 1J9YA 2OLAA 2YCEA 4NXKA 4ZOBA 3I3BA 3VGFA 1E6SM 3OA3A 1CNVA 3IIXA 4HPXA 3UGVA 4O18A 5HMFA 4KCVA 1GW9A 4KWOA 5JIPA 1Q45A 4AIBA 3U4AA 1RLCL 2Y63A 4AMCA 5FIPA 4KFNA 4DWSC 3TDFA 3E2QA 2VM8A 1BGAA 4CGTA 3ID7A 1HXJA 2NXHA 1OCQA 2I1OA 3EKGA 4J2MA 2AAMA 1DJGA 3LCFA 1G9HA 1ESWA 3G1SA 1JVNA 2QKFA 3N3MA 3FA4A 2XG9A 3SJNA 4JL1A 4TX6A 2QAFA 2WSPA 3RITA 3SM0A 2BXVA 1PX3A 2O92A 3D47A 4S3FA 4JY9A 5H6HA 3I6EA 1KTNA 3MZ2A 4FF7A 4KRTA 4W8BA 1RY0A 5EGRA 3CUIA 3WBYA 5HAOA 1B30A 4AZ5A 4AEEA 3AHVA 1HF6A 4A6GA 4IXHA 4UOQA 2WCAA 1E15A 1ZFJA 3QPZA 1S2AA 2DZUA 1LF1A 1W1A1 3F5JA 4R33A 5LZLA 4CUCA 4XZBA 2C1IA 2REQA 2QUMA 2FMNA 3RXZA 4XIAA 1HG3A 4L80A 1DV7A 2R8WA 1W8GA 4LF2A 3IIPA 3ZJ6A 1RBLA 5FJUA 2Y1HA 3NPUA 4ATDA 4ROPA 1P4CA 1UWSA 4MGGA 1TJ1A 3EEZA 1H7OA 3T2QA 3ARPA 2BXYA 4H7ZA 3B0YA 3R0UA 4BQ2A 3WBAA 3W81A 4JFUA 2HPMA 5CAKA 1Q13A 5A6MA 3AOFA 4UTFA 4N42A 1XW8A 2C18A 4FNUA 5EY5A 1R5YA 2CC0A 4DZAA 4IOTA 3EYPA 2QUNA 3HU7A 1VP5A 3SO7A 1D7KA 2XFWA 1NAL1 3UWEA 1ODZA 2QCEA 1Q8JA 1JULA 2I5IA 4RDWA 3W02A 2Z29A 3AISA 2EG7A 3JW7A 2HV5A 1UMYA 2QCHA 3ABZA 3TEVA 1TE1A 3BURA 2IQDA 5I3FA 4FX7A 4S2BA 2NQ9A 3DGBA 2A3LA 3UCCA 5DX7A 1RZMA 2OEJA 1PTDA 5TNVA 2G37A 4LFYA 1KRBC 4TR9A 1Q4WA 3FLUA 6A3HA 3PPHA 1EX5A 3F2DA 1TPC1 3WN6A 5C54A 1H0IA 1GJWA 1H1YA 4AD2A 4C1LA 1FWGC 1S2VA 1DWFM 4JFTA 4MYXA 4BFAA 6XIAA 4JN7A 1LTDA 1PXGA 2PRHA 4ADTA 1A3WA 4D8LA 3PZVA 2OKOA 5A6BA 4M82A 4Q4KA 4PRRA 2P0OA 4FXFA 1JD9A 4GYJA 3P80A 2ON3A 4OQVA 3LRKA 5BNKA 4A3YA 3AMKA 1VYRA 2GGIA 1B90A 3IWPA 1AW1A 2ZRXA 2ZZ5A 1IT7A 1PDYA 3WF3A 1I2PA 1JL8A 1XSIA 3UG8A 1TG7A 2RGLA 4ZTXA 3AJ7A 3RLUA 2BOFX 2EPMX 3BO9A 3FA5A 5CAHA 1A0CA 3KVLA 3NO5A 6ENLA 2PTXA 1TPFA 3TCSA 4QIUA 4DJED 2FH8A 4X9SA 1CT5A 1HT6A 1B1YA 4IHCA 5M03A 1FH9A 2NUYA 4XAPA 4CN4A 2XFYA 4ZFCA 1P48A 4FLSA 4ZXOA 1GQIA 1XM3A 1NEYA 2QUVA 3EDDA 4YJ5A 4ZCWA 3ZWSA 3TTSA 3N12A 2XH2A 2HBXA 1HKJA 2NVDA 1K8ZA 4TU1A 1AL7A 1AFSA 3BLFA 1FWWA 3M0VA 3W0KA 4FAMA 2ZTJA 3LB0A 2VFGA 4NKCA 4JYDA 1TPEA 3V7PA 5AYIA 2VWTA 1V6VA 2VRKA 1VCVA 4Q8VA 3U2ZA 4XIMA 1UKQA 5AKQA 1JNEA 1DP0A 2WO5A 1VKFA 4Z1CA 4JIRA 1Q85A 4H9XA 4CNUA 1VFUA 3PY2A 3R0DA 5A6LA 1A5KC 3T40A 1W9XA 1XIGA 2H9AA 2BFGA 3GG7A 1T96A 4O1CA 4XAGA 1R86A 4AX7A 1UIOA 2BY3A 4BI6A 4U33A 4J27A 5E70A 4AD5A 1Y7VA 3O05A 1WDPA 3AUOA 3A24A 4H41A 3ANUA 3GDMA 4G9PA 3HQOA 1JPIA 2ZXDA 4LBRA 3VZZA 2PDNA 1FCVA 3OHMB 3PZQA 1RP8A 1ONRA 1LL4A 1EZ2A 1TWIA 3B0XA 1TIWA 3FKRA 4LVGA 3T7VA 1B0IA 3WLLA 3AMLA 5EMUA 4J3XA 3WLJA 1BVWA 4GACA 4ZQNA 5BU6A 4W93A 2DZTA 1O95A 1UP2A 4HCLA 3R4IA 3LOTA 4PTNA 4DF1A 1PWMA 2ASHA 4M3PA 3TSMA 2ZX6A 4N6EA 3N18A 2ZRYA 1KFJA 1JPDX 3WK0A 4PBGA 1QRQA 3A4XA 3MSGA 3PJWA 4E5TA 1KBIA 4PMRA 3M7WA 3GHRA 3G2GA 4EXQA 3UY8A 2FHCA 4IM4A 4GI8A 4W89A 4PUNA 3GNDA 1LUCA 4O1AA 4XO6A 3U48A 3TH6A 4YVVA 2E9LA 3K1GA 5DCDA 3QMSA 4PUDA 3G3DA 3KOZA 3VOJA 1EKOA 1AW2A 3EZ4A 3NJ3A 3Q2DA 4K7YA 4W7WA 1GJUA 3QC3A 4KETA 1EX1A 3Q4DA 4HCHA 2FMOA 3BUVA 3V36A 2GSHA 2Y61A 5ABHA 4S39A 1CXKA 3Q94A 5ENLA 4DBDA 4NP7A 3N14A 3R7MA 1SJCA 1I75A 1YBQA 3NQEA 5JXQA 4FI4A 4EWND 3ARTA 1E6RA 3I65A 3MHFA 3R5EA 4Z2GA 1X1NA 3PVFA 4PTDA 1DYSA 4E2DA 3W22A 2WVTA 2GK1B 1R2RA 3OHIA 1WOAA 1CLKA 1WZKA 4S38A 1DIKA 2J75A 4HMCA 4ZO8A 5DRCA 4RZ4A 3LBOA 3N9RA 1YX1A 2DH3A 4CQAA 1Z41A 3CZEA 3V1HA 1E72M 3NR0A 1W17A 1CGVA 2ZC8A 1G4PA 4AZGA 3DYMA 4HNCA 4HOZA 1RPXA 2QF8A 5GNZA 4RNFA 4TTUA 4Q4PA 2XVKA 2DFAA 1QXLA 1K6AA 3WQ5A 1KV8A 1XRVA 2ICSA 3VM7A 1F6PA 1KM3A 2BVDA 1RD5A 2OZ8A 5DRIA 3UJRA 1QPQA 4JQAA 3S5SA 3LLXA 4G7EA 2J7HA 1NTHA 1MSSA 5EMYA 3GW3A 3M16A 1T41A 4IICA 4WY0F 4NZCA 1GQLA 4A29A 4WLCA 4N6FA 1A53A 3VIPA 2E09A 5D04C 4DBEA 3EA2A 1KXTA 2WZEA 2RJHA 1MEHA 3O06A 3YPIA 3K1DA 1TR1A 3NXLA 5KTLA 3M5XA 3PBGA 2GJNA 4XD3A 5HMEA 4PH6A 4ZENA 3WDIA 4HA3A 7TIMA 4JN6A 1Z7AA 3OLDA 3B9OA 4RPPA 3N2TA 1E1CA 1JI2A 3MU7A 4B9ZA 1RJPA 4L1WA 4XBKA 2FZNA 4GNKB 3DFOA 2OYLA 1Y5XA 2ZX5A 1UHVA 1BFNA 1HKKA 2F61A 3BG5A 2DT3A 2OX1A 4S3BA 1BWVA 3VDCA 3P61A 2F6UA 3PZ9A 4ZQPA 1DQWA 3TWAA 1AJ2A 5HPOA 1HKMA 2OZ0A 1XF0A 4JX6A 1T5AA 3RMEA 4GISA 3BCFA 3CK5A 3SSJA 3M0XA 5GPRA 1PVNA 1TVPA 1M1BA 5HWJA 1HL2A 3AAMA 4FX8A 1SSGA 5FF0A 1EGMA 3FYPA 4Z0JA 1SUXA 1FWEC 5AC4A 1XBZA 3AXIA 3DECA 5F4WA 1UR8A 1UKTA 1HFBA 5A94A 1KGWA 4LUSB 4L9XA 4ML4A 4LANA 3GX9A 3NNTA 2E67A 1A47A 3SJ3A 3LLFA 1RA0A 4MZ1A 1O5QA 1W0MA 3VC6A 4GOAA 1X96A 2KZHA 1RQBA 2VD8A 3NZQA 3KOXA 1ZJAA 3WK2A 4JEJA 3W73A 1REQB 1J4EA 5I3KA 3USBA 5E0FA 3QYSA 3DEQA 1GOKA 1XJBA 2PTWA 3G18A 1R6WA 3MCMA 1QNRA 2JIEA 1FXPA 3EOLA 5HPCA 2BZNA 3GR8A 3TJIA 1F76A 4PL1A 5A8OA 3EWZA 3L4YA 1NDVA 4GIRA 5CQ1A 4C1NB 4MF4A 4M6UA 4LCRA 3UWQA 4KBXA 2WC4A 4GY7A 4EOUA 2IS7A 3MUCA 1H5VA 1GOOA 3QV7A 3F7JA 5FEZA 1Q2SA 4BK9A 3AWOA 1LLOA 3QVQA 4ZO9A 4B5NA 2GJPA 4A8NA 1LM1A 4B5SA 5KETA 1TV2A 2FYMA 1VPXA 1M03A 4TMCA 3F2BA 3SGGA 3B8SA 1I2RA 4PMDA 4PL2A 4HNUA 3ABOA 4Q4QA 2ZWZA 3HQPA 3VD9A 2WHKA 2PRMA 2OVLA 4Z17A 4LEQA 1UA3A 3JVAA 1VJZA 4GXMA 3EPMA 1HJSA 4AQLA 2OXNA 4NL1A 1RR2A 1I9CB 1JQXA 1F8IA 2HJPA 1EC7A 1S1PA 2DIEA 4IX0A 4QCFA 3HMCA 2Z2BA 4IMEA 2G3IA 1XIEA 2VGIA 2YFOA 3RUBL 1C8XA 5LIUX 2J74A 4PUWA 3PR2A 3D46A 1E0WA 3P5YA 4GC3A 2QJMA 3APYA 3ZLHA 3TNOA 3S5NA 3I7SA 4C65A 1UC5A 2PBOA 1U30A 4LUTA 3SEPA 1XLGA 1XINA 4FNPA 4X63A 5E1QA 2XZ9A 7XIMA 3LI1A 2JEPA 4D1IA 4AF0A 1PKLA 1GPWA 2NQHA 4OV9A 3TTYA 3BTNA 4CQDA 3KLKA 1EGZA 3L68A 3QV6A 3FXGA 4MTVA 5F2LA 1LRTA 5DXXA 3SQSA 2XIJA 3VFLA 4AAJA 4LRTA 1VZWA 4O14A 2C0AA 1R87A 1GVOA 2QCLA 1MVYA 1QW8A 4KWWA 4TVCA 4XK2A 4O16A 1NOFA 1PSCA 1B3VA 2HNHA 1GZJA 1E6QM 4UC5A 1LP6A 1D3HA 4GO9A 1FWAC 5LA0A 1PB0A 2VKZG 5E9XA 4Y6GA 4QLLA 3A5FA 4XAYA 5KZEA 3U0HA 4I3GA 2XSXA 2GVEA 2CNCA 3ZVHB 4ENLA 3K4WA 2ZUWA 4MHBA 4E8GA 2J4GA 4XSLA 3C3UA 2D0HA 3IV8A 4MWAA 4FXSA 4NRSA 4UTTC 3RLVA 1E73M 3A9IA 3T4CA 4E3VA 4DZHA 1QNSA 2PUZA 1V08A 2ADAA 3S5ZA 1W5NA 4H4IA 5K2ZA 1LWHA 2VURA 4Q4RA 1W1PA 4IIDA 4JTJA 4QRNA 3KRSA 3THAA 2O9OA 2CZVA 3SUWA 4QJ4B 4A3HA 3GVRA 1W5PA 3TC7A 3VD4A 4GJIA 3HB9A 4O12A 4HCDA 4ACZB 1K9TA 5A1AA 2GGHA 3M0ZA 1RCXB 1S2UA 3RN6A 4QFUA 1B3YA 1BQGA 4IPIA 4KT2A 4AXKA 1SJAA 4AD0A 4B16A 3CL8A 3SN0A 3U2OA 2X2GA 2GQ8A 1ENUA 3QPYA 3FVMA 2J88A 1XQLA 3NCOA 4OVXA 4IMCA 3GC4A 3PPFA 5AOUA 3VKAA 3ALFA 3S1WA 4BI5A 2UY2A 3WF2A 4YTRA 1XYFA 3IJQA 4GX9A 1YRRA 2G8ZA 1V4YA 2OMAA 3XINA 2TAAA 5AHNA 1F6KA 1RSCA 4X0VA 2E25A 2W4XA 4PEEA 2OO0A 1JZ8A 3KFTA 3P8JA 3CZJA 3WF0A 4WXYA 4UQBA 4PUKA 5E9AA 3AZSA 2PP1A 1QASA 3GZ3A 4KCTA 2CXEA 4MNMA 1TTJA 2Z1BA 4WGHA 3FYYA 4W88A 3W7PA 4HU3A 4DYJA 2PFHA 3ERPA 2QDHA 1YDYA 4IX2A 3SDOA 5CPMA 1ADOA 1XRFA 2X7WA 3OVQA 4IZGA 2A7PA 1SZNA 5J5RA 3CTTA 3UA4A 1H2JA 3HPSA 4DWSD 4Q6XA 4UTHA 5SWUA 4O28A 2NSOA 4HD5A 2E9BA 1UOKA 4JTGA 5HATA 3F5KA 1BKHA 1QNOA 4L1XA 2C15A 2Z27A 3NO1A 2VOTA 2R1PA 2FQIA 1J8VA 1H63A 3KZSA 3M0HA 2GDQA 2GZXA 4BR1A 2J66A 3HQ1A 4N0RA 3CUJA 4L4OA 3N6QA 1UKPA 2CESA 1XYBA 3OIXA 4H01A 5FAJA 3SRDA 1R85A 5I0DA 4J4KA 3CQHA 4AHPA 4GCAA 4XZIA 4JL2A 4UIOA 1IGWA 1OX5A 2PGWA 4AX6A 3A4JA 2PDPA 1AH3A 2D22A 2EPNA 3P81A 4HMEA 2QCCA 4XBJA 3BGGA 1XC4A 2Z0IA 2CWNA 3U7VA 3QY6A 4WHBA 4C60A 2DQXA 4QJ3B 5AN7A 3I4EA 3EXTA 4PSPA 5L9FA 1TMHA 1GJPA 4PCFA 4WDXA 1RVGA 2FPYA 3W7QA 4MKSA 3POCA 1IZKA 1J0KA 2VZTA 1BHGA 3EMZA 2X05A 1A0EA 3L2MA 4FOUA 4LWWA 2FZBA 3NO3A 1KFBA 4MPQA 4IH3A 3NZRA 1KO0A 4IQEA 1AA1B 1WXZA 2YKKA 1FWFC 3HZ3A 4Z2JA 1RP9A 3E0FA 5F2MA 3UFYA 4AZ7A 3GVVA 4PRTA 3ITLA 1GOXA 2W27A 3VMPA 5FJIA 1W3IA 1FQ0A 4AWSA 1VFSA 2WHJA 3FX4A 3WZ0E 2Q09A 4U2YA 2PWFA 1XX1A 2DVUA 5A3HA 1DQUA 4U2ZA 4DI8A 2ZZ4A 2XUCA 2WPBA 1OG0A 1ZPTA 1ZB5A 4IXXA 3MTWA 1L8PA 2VFDA 4QNWA 3G1VA 4UMBA 3G6LA 3R8HA 3S46A 1CECA 1W2VA 3GTNA 4L7ZA 4TOQA 5T8GA 1S5VA 1TIMA 1ZP4A 3B9EA 1G69A 2A85A 2JGQA 1P0NA 3IJ6A 2QJIA 2PS2A 5FI8A 3CV2A 3W6MA 3C2VA 3I68A 3EOUA 3LM3A 3IVUA 3NQMA 4DF2A 4S3GA 4QDPA 1B3ZA 3V5OA 1QO5A 4RXFA 5AYYA 3UR5A 5AYZA 4G56A 4I5RA 4JTKA 1H7WA 3NL3A 4HZMA 4J7RA 1V6UA 4Q32A 1UASA 4IFKA 2YPIA 5C0QA 5I5RA 1KBJA 3CWOX 2C19A 2YGYA 3KWSA 1E0UA 3W70A 3CQJA 3KCLA 4M7TA 2NWSA 4H3DA 3VDBA 3W6YA 1F9CA 2I56A 4CEXC 2Z1WA 2QMJA 2A6LA 3HM7A 4B4FA 2Y8VA 3RILA 2VQUA 1YPXA 3C4UA 1BXNA 3STCA 3W7GA 4QITA 4IJRA 2A2IA 2VP8A 5HANA 1UCWA 3GUGA 5C9ZA 3NEVA 3ABRA 5F7UA 5BZAA 4MNJA 1HL9A 5IHRA 3ONBA 3U9IA 3W7LA 2QF7A 4V15A 3W1MA 5A6SA 1FH8A 2CEQA 4M1RA 4LUIA 5IDIA 4GH3A 3LERA 1F74A 4ZOCA 4QCEA 4LYPA 4HA4A 1VH7A 4O1DA 2I7GA 3GH4A 4LS0A 4AFYA 3KOWA 2X30A 4DJFA 4DN1A 3EPNA 3OJGA 4G1NA 3ZXWA 3DCPA 1CTNA 1F05A 1IQ8A 5CPNA 3UJEA 2HQAA 4YTQA 1JG9A 1QPNA 1EJVC 2PDQA 1EF2A 4UR8A 3CUHA 1Q63A 1I4NA 1WYIA 3A23A 2Y0FA 1W91A 1W1B1 3NQVA 4NNAA 1NU5A 2PTDA 4LB4A 4LPCA 2VC5A 2HEJA 2PDMA 2A3AA 2GVLA 1AJZA 4GKTA 5A8GA 4C1KA 2YCJA 6REQA 4FIRA 2Z26A 1VRDA 4HHMA 3NZPA 4KWUA 1JYXA 4CNTA 3HQNA 3LPGA 3PK7A 1NVMA 3E5PA 1P6WA 1EWDA 2VENA 3CAVA 4CNNA 1LRQA 1OY0A 1I2QA 4AB4A 2G3NA 3SGZA 4FP1A 5A6AA 1JUBA 3K4DA 3OIHA 4LYKA 2P5NA 3MUIA 1IEVA 3WBEA 3HFYA 1KM6A 2VZOA 2ACQA 1AODA 3TZNA 3W1XA 1V03A 3GW0A 2IPGA 4QISA 4KEZA 5D2WA 4K6AA 2CCRA 3PZOA 1XLAA 1IF2A 1EOKA 4DELA 3M7SA 4W84A 3T4WA 1XLCA 1EBHA 1GHRA 4MAVA 3HG4A 4Q22A 3VMOA 2DY3A 2YFNA 1DIOA 4IG2B 4MSSA 5EB8A 5TBOA 4C6BA 3BAKA 3GNRA 1EJWC 3MSRA 3ZJKA 1CB7B 4FMVA 3L0KA 1XPGA 6TIMA 1EYWA 3EWCA 1BPLB 3ZWTA 1RUSA 5M5DA 2FTYA 4B9YA 4HJWA 2PPGA 3S8HA 4M6PA 4JTUA 3W7KA 1LWIA 1QO2A 3WF4A 3W76A 3TYBA 2V5DA 1TV5A 4MPKA 4JX4A 4Z2KA 3POHA 3BGAA 4P2VA 1VHCA 2ZICA 3OVRA 4D6HA 3BQ6A 2PWGA 3DBNA 1PIIA 3AIWA 5A8MA 3KBWA 4JTEA 2Y5EA 5A6BD 3SUTA 4JFVA 5CSYA 2FGZA 1CXHA 1HQTA 1P7TA 4OU1A 5PTDA 2C8NA 3TAOA 3QGKC 5FKYA 5CGMA 1EA0A 4GYPA 2D20A 1FWCC 2GQAA 1RV8A 4FNRA 1DHKA 1WDRA 2B7QA 4XSMA 4FOKA 5LNUA 2ALDA 2FFIA 3NAVA 2VX7A 3U5YA 3L4WA 4GVHA 2GJXB 2DZSA 3H4WA 3DFHA 4ILSA 1ODUA 1QAPA 1SO3A 4S3AA 4DWSB 1TTPA 4V33A 3RU8X 4DJFC 1OHLA 4BQ5A 4ZGYA 3FKKA 3E2SA 3UWYA 3TW6A 3TYZA 2CLPA 1XGDA 5HNRA 3B40A 2VWSA 3E0WA 1CWYA 1MEWA 2CBUA 2EPOA 3TMLA 3N2OA 3NTYA 4GUFA 2WNQA 5G2WA 1IEIA 4N02A 1HGYA 5LGZA 4AIUA 1WXYA 1CXFA 5LNVA 2V38A 5DMNA 3P60A 1EBGA 1F4AA 4ZBCA 3LCWA 4U5KA 3NWRA 1DORA 2NSXA 3CZGA 1XLBA 4WOZA 2R14A 3OVGA 4ORMA 2VDHA 4FXRA 1GQJA 2PP0A 3AYRA 4EF8A 5HUPA 5CXPA 2VELA 3MMTA 1YEYA 1VQTA 4JKLA 1XLDA 3WQWA 1B9ZA 1GTEA 5LIWX 3CM4A 4FR6A 3QW4B 4GC4A 3TC6A 1TSIA 4NI8A 1X7FA 3QR0A 2AQWA 5H8PA 2BNJA 3GNPA 4WJEA 2FZ8A 4JTDA 3UZXA 4A2SA 4GINA 1DBTA 2W9MA 3TX9A 1RVKA 3ITXA 3W2UA 4XUGA 2G50A 3V18A 2CLFA 5D2VA 4IUGA 4INFA 3MUXA 1P0BA 1YNQA 1G7VA 2H3DA 1RAKA 1RH9A 2P0IA 4KERA 1I0DA 3P14A 4QAIA 3TUUA 4DM1A 2BVTA 1VFFA 3HGOA 4EIVA 4PCTA 1BF2A 2YL6A 3AIRA 1XYCA 1UD5A 2IPFA 1U22A 4WY0B 3NGJA 3CB8A 1M3UA 3ENLA 2NVCA 1JCYA 5BROA 2OO6A 4LSBA 4DB7A 1EJXC 4AZCA 4RZ5A 3AHTA 2C79A 3FJ6A 2G0WA 1YDVA 1IZCA 4ZOEA 1QT1A 2J7FA 3DYOA 2PGEA 1WUFA 4OTKA 1F6YA 4OV4A 1IT0A 4NJGA 5DLCA 3AWNA 1EHNA 2BX7A 1FP8A 1VF8A 4LF1A 3O7UA 4UBPC 5AHIA 1A5OC 1POKA 3VGEA 2NT0A 3MDWA 4HTBA 3K13A 1VFLA 3KCJA 1P0DA 3TJXA 1J0IA 1FVPA 1P1XA 1L2QA 1GGOA 3V1PA 1P6BA 3H2AA 1TZ7A 2J7DA 2ZVRA 2DV0A 3AYTA 3THCA 5BCAA 3AIBA 3S6DA 5C71A 3PBVA 5IBXA 4MY8A 1BWLA 5JH1A 1QTWA 1OFQA 3A3XA 3RPMA 2X1TA 4KPLA 1OT2A 1T0OA 1FFRA 9XIAA 3AXHA 3DAQA 4JQ2A 8XIAA 4CD7A 4CD5A 3CPRA 1X38A 3MCOA 2J8GA 3KP0A 1OG6A 4UOZA 2Z7GA 3EEGA 5DCBA 4ZR8A 1XYZA 3LMZA 3R1ZA 2ZCGA 3MDUA 5CBIA 3WQPA 5FEPA 2ZIDA 3K5XA 1QCWA 3BLPX 4O8AA 3TTOA 5H2ZA 2JK2A 1D8WA 3CUGA 3EDJA 3S5YA 3OVPA 3RR4A 3VE9A 3OQEA 1T8QA 1W3LA 1EUNA 3D3AA 2D69A 3DN5A 4E4UA 2Q3RA 2XVNA 1VFTA 3DG7A 3LG3A 1ECQA 2REQB 2YYTA 2WBKA 1YYAA 4HIBA 3NDYA 3BK0A 3RM4A 1RXOB 4LUJA 1DJQA 1BVZA 4IQLA 4J5NA 3PZGA 2UZ9A 1UWAA 2I5GA 2O7SA 4RL3A 4CQ9A 3S2MA 4YYCA 2WM1A 2XIQA 3LNPA 5E0KA 3MYPA 2OSYA 2O9PA 4MUPA 4XTDA 1UQZA 2CIPA 4IGSA 1E4MM 4HNTA 2E3ZA 4GNJA 4REQA 5ABEA 4CN1A 3VI2A 3ORWA 3EWUA 2PC8A 4FF5A 3OBAA 1GORA 3DIPA 4N2YA 4Y2WA 5I00A 4M0XA 3W87A 2FVKA 1PCKA 2WANA 1Z42A 1MXDA 2C14A 1CENA 3FEMA 1AH0A 5CPLA 2P53A 1FCBA 3MUY1 1BRLA 2INZA 3GXMA 3HURA 1V0LA 1VAHA 2DU2A 4QS5A 3W1TA 4C6FA 1YTDA 2EG6A 1L6GA 2DPEA 4R9XA 4E8CA 1H3GA 1K8YA 3VNMA 3AIVA 1XDJA 1LBMA 2NV1A 2VCAA 3M46A 4F48A 4CD6A 1XPYA 3KLLA 2V68A 2EXOA 1V02E 4NASA 1GVYA 1KB3A 4C90A 4ZQMA 1Q5MA 3P5ZA 3H23A 3WLOA 1KV5A 4YMZA 1SZEA 4MFEA 3ARZA 1T8XA 4Y7EA 3W53A 4JIPA 1KWKA 2YDAA 4UNIA 3STFA 3QY7A 4AY1A 3DENA 3B04A 2XSBA 1OZMA 3S9YA 1ZGDA 1WP6A 1W9DM 1ITQA 1QW9A 2ISFA 1KRAC 3E2RA 3A12A 1OD0A 1E51A 4EPKA 3Q58A 3XISA 1GYMA 3UW6A 1FWRA 3RX2A 4I7WA 4D8ZA 4BKNA 4ERGA 2YW3A 3GBDA 3SRFA 4KFPA 4NG3A 4MLRA 3GUWA 2WJFA 4LX4A 2YLAA 5G2HA 2ZFAA 1GQNA 1JDCA 1R9ZA 2DW7A 4ZO6A 2YA0A 2AKMA 2TPSA 3NM3A 5DMMA 2YX0A 4L4PA 1RA5A 1KM4A 1NOUA 2OOFA 1BXBA 4JOMA 2J8TA 4GIYA 3NQDA 1FDYA 1VLIA 4CCEA 1N2VA 3S47A 4DJEC 3BLEA 1R3TA 1PHQA 5C9RA 1IEQA 4JIIX 4S3CA 2VJXA 3HGRA 1BSLA 4PB3A 3U57A 3NSNA 1W2PA 3B0VC 4DX3A 3PSWA 3LYEA 1ZP3A 1OZQA 2YZ5A 3SIZA 2JKPA 3C6CA 2C91A 4C91A 4J28A 3R58A 4F79A 1FWIC 1YXCA 4ZZ9A 3QHMA 3T0AA 3AHYA 2QPUA 2PLMA 5CPSA 5FSEC 2PWHA 3GQYA 1LOSA 3BV4A 2JKEA 2H9AB 1EWEA 1K9DA 3GXIA 3HG5A 2WB5A 1NWUA 1W1IE 2ZRZA 3W2KA 2VL4A 2HMCA 3VKJA 4O4VA 4UUIA 1V3LA 1WV2A 3O0KA 3NZ1A 3IJ9A 1ISVA 1BEUA 4FIQA 3A64A 1NDYA 1WKEA 3GU9A 4GABA 4DHGA 3C5QA 3UWVA 3UZWA 1GVIA 4GQ0A 3W72A 1XLIA 2CZDA 1J5TA 4PEKA 3M43A 5FJTA 1TJ2A 3MMUA 4EF9A 2ZUVA 1OSEA 4XWUA 1HTIA 5CPQA 5HQLA 1H09A 3L9CA 1HUVA 1XCXA 4H7VA 4W8LA 3WBWA 1MWOA 2F84A 4H8VA 1QWGA 1W54A 1JIBA 1YE6A 4PYSA 4Q8UA 1JCNA 2J7BA 1F73A 2ZADA 2E6DA 4MOZA 3NL2A 1UJPA 3WUBA 4DWDA 4GMEA 4K37A 3VIHA 4L9YA 4XZLX 4C6CA 4CCCA 3RCNA 1UR1A 3M0IA 4AZBA 3MJYA 2C0HA 5D38A 5EYWA 3SR7A 3LY0A 4YIWA 4J3VA 3RJXA 1U5JA 1LUCB 1S5MA 4H9MA 4XZWA 1LORA 1JUEA 4FLRA 1NDZA 3IGUA 2ZTKA 1TPWA 3ZM8A 3NFUA 3U4FA 1MW1A 1WOBA 2IW0A 9XIMA 1LT8A 4K38A 2PRLA 3TYEA 2PBGA 2VZUA 4H8HA 3LHTA 1XIBA 2HRWA 1EZWA 4Z2LA 3QEZA 2W62A 1BTCA 3H24A 3MI3A 5CSRA 4HPGA 5K9CA 2W66A 4L65A 1HNYA 1GQKA 2OT0A 1KQYA 3MC5A 4LQ1A 3SADA 2F2KA 1YBQB 4C6PA 3LBCA 2WC7A 1KR1A 2ZYFA 4MWAD 4UXDA 3GC2A 4DRSA 1K7FA 3P3BA 4EACA 1XLLA 1WXJA 1XS2A 4IMFA 4HK5A 3SSZA 1EP1A 3I6RA 3UF9A 3T0BA 4GBUA 1H11A 1TREA 3N3TA 4HBKA 3FHAA 3QSRA 1XD0A 2Q01A 4R9OA 2XH0A 3SCWA 2CLLA 1VPQA 1P0KA 1OX6A 4GFIA 4TQTA 5KMYA 1LOLA 1MMFA 2QPXA 2WNWA 4NI3A 4JTIA 2WKJA 1VFOA 1ZENA 1RJRA 4KEMA 4L4LA 3TOYA 4F0HA 1QR7A 5EMLA 3W75A 1FBAA 1WAWA 2ZZ2A 4GIAA 1E3ZA 3VDGA 1JDDA 3BAWA 3S3GA 3PJXA 1ME7A 5FF7A 1CEOA 4G7EB 1QWKA 1FHDA 1SMDA 4B15A 3F4NA 5HULA 3SCVA 3WDPP 2OEKA 4NZ3A 4F2BA 3LHYA 2Q02A 3PUEA 5XINA 3ABQA 3W2MA 2XYLA 3MA8A 2WPGA 5I7GA 1OYBA 3EB2A 3GVWA 1BWKA 5A6TC 4L6HA 4GIEA 4CLMA 3B4YA 3RFAA 5HBFA 1J79A 3OG2A 5LXXA 3PTKA 4H04A 3VIMA 1S3HA 1TB3A 4TVDA 2BODX 2Z2AA 4CNOA 3BQ5A 1GOWA 3H7VA 1YQ2A 4FLOA 1E1CB 1O5RA 1RBAA 2XIIA 2XFRA 5A2AA 5D30A 1BAGA 2GQ3A 2CZEA 3CV1A 4JQ1A 2QCDA 3FSUA 3S42A 1AQMA 2ACUA 1TTQA 1QVBA 2FVLA 4N7QA 1KC7A 3EA3A 4CVWA 4BCEA 1JNDA 2UY4A 1BD0A 4G7FA 1B3WA 2WMJA 3ARQA 1KNWA 3A4WA 3WQOA 3WLKX 1YIXA 1MQQA 1SSDA 5AVHA 3E49A 3A47A 1XXXA 5CSSA 3ME3A 4PMZA 2VZSA 2VT0A 1C8VA 4QAWA 4ERAA 3W85A 2HXUA 4WF7A 2GDVA 2IXUA 3LDVA 1K7XA 3KCOA 3T8LA 4WIWA 1OFRA 1Z6KA 4Q8NA 2PD9A 4Y9PA 3R13A 1XYMA 4F0KA 5HQMA 1OYAA 4GVIA 3DOPA 3CB3A 1WNOA 1U5VA 4EPEC 5FCZA 3IRSA 2A3CA 3H2NA 2QJNA 5C7HA 3VPLA 1QNVA 2PC4A 1W37A 3SY8A 3FDGA 2XSAA 1FCQA 1M9HA 3FXYA 2AGTA 3G1HA 4LNYA 3JUGA 3A13A 1L6FA 1W5QA 1SR0A 4UTIA 3P0XA 1W56A 1J2WA 1QHOA 3G3MA 1UUMA 3CLMA 3NM1A 4NXSA 3CHVA 5LNWA 3SUVA 3BJSA 4W8AA 1KRMA 3KS6A 3RLHA 4AHQA 4M6QA 3FK4A 3CIWA 3T81A 5E5CA 1VBUA 4BEUA 3W1RA 1H60A 3RHGA 1VYSX 2E40A 4IIBA 1JAEA 1LG2A 1OFDA 4MDOA 5AFDA 2Z6JA 3AHZA 4EP8C 3P74A 1OCJA 1SR9A 2XH7A 2V2DA 1H0GA 3ZVIA 2FDSA 4H1ZA 1FWHC 4AY8A 4I5UA 3DFQA 2ZXAA 4YCPA 3PC0A 1WA3A 2PWUA 3RX4A 4LCSA 1L8NA 3UPMA 4JTHA 4RW5A 5HMDA 1G4TA 3WLTA 1X6LA 3GXNA 4HU8A 3B06A 4TUFA 1IHIA 3URAA 1DVJA 4A8LA 1MDLA 5ECUA 4AU0A 2GWGA 3O8AA 5I3JA 1QI3A 4DXKA 1PHWA 3LRMA 2QEZA 2OZ3A 3W1NA 3ABXA 1PZ2A 2D0FA 1ZBWA 2OLHA 4US5D 4PUJA 2MNRA 3IIZA 2ZUSA 2WSQA 1GK8A 4ZQRA 1X39A 4EE9A 3PANA 3I7RA 2KAUC 2NLIA 2YZRA 5FF3A 4DPQA 3MUZ1 3DFSA 3W38A 3T8QA 4LUTB 1GG1A 3QN3A 1OB0A 3R10A 3EXRA 4PCSA 2O9TA 4WCJA 1BYDA 4ICMA 5JQ9A 2DZPA 1NQ6A 1B5TA 1QPOA 3RNDA 3DHPA 3UY7A 4BF5A 1GVEA 1K70A 1ZJIA 2ZE0A 3H4XA 3NG3A 4MAZA 4DUVA 1VENA 4P8UA 2WQDA 5BRBA 4RDYA 4S3DA 1LQAA 4LOCA 3GLCA 2IQ0A 2PD5A 3AU6A 4DJFD 4N4QA 5CJNA 4UTKA 1OBAA 3BE7A 3KW3A 2YL9A 5CC3A 2V82A 3NOYA 4A3RA 4C7GA 3W1QA 1HL8A 5A2CA 1J6OA 3BMWA 2YBTA 4PTXA 3U3HA 3C2EA 1OGSA 2YDSA 3HA1A 9CGTA 3BG9A 3FN9A 2ZX7A 4GHRA 4D9PA 1CXEA 1JQVA 4Y8EA 1LROA 4UOJA 4GE8A 5LNSA 2AGKA 2DGAA 1J96A 3BAIA 4WSHA 2WC3A 2V0TA 2GSJA 4R7WA 2O7QA 4MWAB 4PMNA 1K4GA 2TRSA 5DCEA 2ZOXA 3W82A 1V93A 2P1FA 3OO2A 3MT1A 4Z2IA 3UG3A 3M0YA 3V0TA 1YTEA 2DJLA 3TQKA 2DIJA 3ZMRA 2OODA 1TV8A 4O4WA 4JTLA 4KGJA 4EK7A 1DEDA 4DAFA 4P8WA 5DBUA 4C5ZA 4CD4A 4PMJA 4NZ1A 3HN3A 4DO6A 4DF0A 2R6OA 1UP3A 4RE4A 2G4FA 3RGTA 4UCGA 4PR4A 5U4NA 4HNNA 1BGGA 3DC8A 1VFMA 4PUMA 3PFRA 3TYCA 1E0XA 4WEVX 2W6RA 4ZB2A 1OADA 1AZ2A 3L2IA 4P7NA 3FJLA 4GA8A 3P8IA 2PGFA 5D2XA 3LM7A 3VGHA 5CPTA 5AC7A 4UB9A 5EMKA 3VVGA 3AS0A 1JZ7A 1ZJBA 3C2YA 4DJDA 1EJ7L 1UG6A 4JTRA 3VKDA 4H8UA 3NDZA 5HUOA 3RIKA 2F8QA 2GK1A 3UERA 4V28A 3V16A 5CBJA 3W1LA 4GQBA 4GQRA 5D9PA 3NUKA 1SJBA 1XGEA 4HHPA 4IIFA 2DUZA 5CC7A 1UW9A 3ARWA 4FR1A 1KLYA 1LDCA 3E2VA 4H7CA 5ABTA 4IPJA 3BLOA 3OZYA 4HB7A 3NQGA 3UT0A 2J7GA 1RY8A 3DFTA 3VK5A 5FL1A 2WWDA 1VJSA 2G97A 2WVVA 3L66A 8XIMA 3IAQA 5BXPA 1K4HA 4LAOA 3LPFA 2W91A 3IUIA 3OP2A 5A95A 2PWDA 3CPGA 1IXNA 1EO5A 3OBEA 1TX2A 4XTIA 4FALA 3ITYA 2PI6A 1R9YA 5M1TA 1MUCA 1WDWA 4LS1A 3QHNA 2CLEA 5AVNA 4DLFA 2VX6A 3KRUA 4MIMA 4FXJA 2A3BA 3WQ6A 1W3TA 1QI4A 1BKSA 1XV8A 2BBFA 4U3CA 5IHSA 4M6VA 4H19A 4H9YA 4RNJA 3GE7A 4W5UA 4WOQA 5FEWA 2WHMA 2NW0A 3KRZA 5C2XA 4PFMA 3WMLA 1B4KA 4MM1A 2GGJA 4GJJA 1UKSA 2CLIA 5IFTA 1R46A 1M53A 5HXMA 4Z08A 2D3NA 1U33A 1B3XA 5XIAA 3ONCA 4O1EA 1XG3A 1H7PA 5FJOA 1TV4A 4CVUA 3TYDA 2Y7GA 2WSKA 2X1IA 3PJTA 1PAMA 1NFGA 3TN5A 5AHEA 3TFXA 4AXNA 3MSDA 5AYBA 4E2OA 1TV3A 1J12A 4ALDA 1KFCA 2BASA 3F1QA 3WDRA 3E3HA 4FO4A 3AICA 1XBYA 3CMGA 1WKFA 4DI9A 5I3DA 5E09A 4RNHA 3AZRA 5JBDA 3WO8A 4DEFA 4C6JA 1PYMA 3SN4A 1A0DA 3P6LA 5DT5A 5A6JA 2WBGA 4LYQA 2VC9A 3W2NA 8RUCA 4KFOA 3UU0A 3BARA 5C7VA 2Z1VA 1KD0A 1NP2A 3PZIA 2Y70A 4LBSA 3THUA 1NFBA 4LNCA 1N8IA 5M3WA 2E0PA 4E4PA 3GH7A 1J11A 1M41A 1TYGA 3UWUA 1WKDA 3PBWA 4DM2A 3RYSA 4DJDC 1PKNA 3E38A 3NQAA 1XC6A 1E9ZB 1XRSA 2EF9A 3LXCA 5BWFA 1R3VA 3ZLFA 1ME9A 2WW5A 1DWHM 3GTHA 2VVNA 3QKZA 2PAJA 4MJ4A 4S3JA 1KM5A 1R9XA 1XFBA 4Y9AA 1PX8A 3B8WA 4AC7C 3PBMA 5CC6A 3VO0A 2WJDA 3HV8A 4W9TA 4R7OA 3W7EA 5A8QA 3LNMA 2OQYA 3MW7A 2EKGA 2OSXA 1A4LA 3UETA 4OIFA 1UQYA 3O16A 3WNNA 3WNMA 4I9JA 4M29A 3IVTA 3CZ8A 2IPWA 1ICQA 1TV7A 2FTPA 5AC8A 4H2HA 3VXGA 3DHDA 3O3RA 4QXIA 4D6FA 1CXLA 2P10A 4CNPA 2Y8KA 3SUSA 4OKDA 3T08A 3GFZA 5G5IA 1PTAA 5ABFA 2VEPA 1EYEA 1JFXA 2QCGA 1TQJA 2ZA2A 2GLKA 4HPNA 3QZ6A 1ZQ5A 2D2OA 3W23A 4IFKB 1K6WA 1SPQA 1MQPA 3N15A 3VU2A 2B31A 4X61A 3WELA 3QTGA 3N13A 3UG5A 2VEFA 3GR7A 2EPHA 4S3EA 4MJZA 2GYIA 3PZMA 2HE8A 2HXTA 2D2JA 2NUXA 1NELA 3H4GA 1XLJA 2PDYA 1KFEA 2A3HA 1JCTA 1SMAA 3CIVA 4L64A 4ZO7A 1WB0A 4UFJA 5U7SA 4GLEA 3SCPA 2FGLA 8A3HA 2PB1A 1D3GA 1UR0A 1S5WA 3N2MA 3WJXA 4H9TA 1HGWA 3E74A 1AW5A 2GUYA 5J04A 3M6DA 3R25A 3S2JA 1WDSA 3RCYA 3C0JA 3CQ0A 2NVAA 5K3VA 4MB1A 1N82A 2PDWA 3WL0A 4OFCA 2D24A 2Y7FA 4QNEA 1MRAA 4D8AA 2OWWA 3VNJA 1MO0A 2PP3A 1RPKA 3WEOA 4AWEA 2QGYA 2DORA 5CZJA 4MKNA 4EKJA 3AFBA 4V1XA 4YL2A 3EKZA 2VUYA 2V3EA 4ZL1A 1LJYA 4UR7A 4QG6A 3L67A 1OFBA 2BTMA 6REQB 2E28A 2EG8A 1HP5A 2NQJA 4KQNA 3BSGA 3ABSA 5A2BA 1NWTA 4LVAA 1J2BA 2V63A 3LENA 3GU1A 4UMCA 1HVQA 2XU2A 3SFKA 3WK3A 5C5YA 3KTSA 1TWDA 1LWJA 3NQCA 3T0CA 2BVWA 3LS9A 6CGTA 1SFLA 3PTDA 4RW3A 3ITVA 1XCWA 3BANA 1FHUA 4BZYA 3VFCA 4D6DA 4DVOA 4JBRA 4O1BA 1LQ2A 7ENLA 5BRPA 1WZLA 3CT2A 4LVBA 1Q6EA 3SW6A 4H6KA 2DW6A 3VOCA 4S23A 3S1VA 3UXLA 4OJYA 2Y89A 4N4PA 5CSUA 3WLPA 3TJLA 5BXSA 1V7AA 1ADSA 5AECA 1RD6A 3OB8A 3R43A 4MLJA 4KWSA 2MUCA 4IIGA 1Q7ZA 4W5ZA 1R3RA 1XFCA 3W24A 2VO5A 1UWRA 1GG0A 3BMXA 4Y90A 1O94A 4UR9A 3PTMA 5JIWA 4YHGA 3KAOA 1S1RA 2WZIA 5I3HA 1EDTA 2RAGA 1W9BM 3QM3A 3AI0A 4AIEA 5FAGA 3CAQA 5HMSA 3FDKA 2WSYA 2OSWA 1O66A 1TO3A 1TZZA 1F07A 5RUBA 4YPJA 2OT1A 5E6ZA 2P3EA 1D7FA 1FWJC 1E9IA 3KVKA 1QMLA 1RLDA 1Y0EA 3OGVA 1Q6FA 2C7FA 2Q8LA 4I8YA 3VC5A 3AS3A 1B2YA 3CQKA 4MWAE 1C29A 2A1YA 1YHTA 1M7OA 2YCIX 1E6NA 1HKIA 5LHEA 3O6DA 2OGJA 1GKPA 3E02A 2XTKA 4GYFA 4JCLA 4JNYA 2BWGA 3WLSA 2PDKA 1VHNA 1DHPA 5CEWA 4L1GA 2YXXA 3V75A 3MKCA 3GNXA 2FZMA 3GY1A 3M4HA 1L6SA 2YW4A 4NHVA 2I5QA 3K4AA 3WDQA 4F2TA 3AALA 5TQLA 3BJTA 3F4WA 4MB5A 5LNRA 2DEPA 4AC1X 3R89A 1FWDC 4DQWA 2GGGA 3DG6A 1XIMA 5KZDA 1ONWA 3CAKA 3VA8A 2SFPA 5LSMA 1D3CA 3IJLA 3LV5A 1JD7A 3L12A 1XRTA 4UTWA 2R24A 5FSDC 1CDGA 5A8PA 2DUXA 3LTSA 1ML1A 3VX0A 3MV11 4K2SA 3R8RA 3K8LA 2CHRA 2QDGA 4IPPA 3V3WA 4JIHA 3WBXA 4YLWA 2ZC1A 1V7YA 4F0MA 2A0NA 4WKHA 4V27A 1JUKA 4M56A 3W7IA 1US3A 1CLVA 1CXIA 3RU6A 1W8SA 2QW5A 3KBNA 3GXDA 2OB3A 4HT3A 1H62A 5F1VA 2Y7DA 2OELA 5C2CA 3OLGA 1S39A 3SECA 3B8DA 1XH0A 3FCPA 4R5EA 4MJ2A 4B5UA 3R79A 2CXGA 2HE5A 3H2OA 5E6YA 1VBRA 3MV01 3SI9A 4A8IA 4FOJA 3MYOA 4IP5A 5G2IA 1EQPA 1EP3A 4J9JA 2PDIA 3W7CA 4DBSA 4HOXA 3LN3A 4RV8A 1E5JA 1UOZA 3CQIA 4FS9A 1CB2A 5GNXA 1GVSA 2CLKA 1XIIA 3IANA 3QRHA 3OYXA 1W6TA 4XG1A 3BMVA 1FWBC 3QQ1A 4GUJA 2Q71A 3TIMA 1K9FA 1WO2A 3QKEA 1DIDA 4AZCB 2DQWA 3NIYA 2W92A 4KCUA 4E6MA 2Y6ZA 4RZ6A 2WMKA 3W71A 4GVFA 5HDRA 1E43A 2V9DA 4CQCA 1M7PA 2POZA 1UUQA 2JIWA 3AU2A 1VLWA 1Z8AA 2AL2A 4I9TA 3P67A 2A79A 1NY1A 2PEVA 1NFPA 3QLLA 2W3ZA 1XLHA 3DZ1A 3M44A 2DSKA 2INEA 2QJHA 4IGNA 3DYPA 3M47A 4O0KA 5AZ1A 1JZ5A 2OJPA 3GIPA 4GO8A 1L6YA 3EX3A 4WUIA 2E8YA 2CZ5A 5L6UA 1JFHA 4HNOA 1PZ1A 1YLVA 2QDDA 3GB6A 2DZAA 2D2GA 3RDKA 3NVTA 2H8ZA 5CZ0A 5ECVA 1GCYA 4LY8A 1NJJA 3LPPA 1RBOB 1OFOA 2HWGA 4LW7A 1YW1A 3PHAA 3AHXA 3LHUA 5EL1A 4ZVJA 1XDLA 5D02A 2QNEA 4IP4A 3UQNA 4DAIA 3TYAA 1ITCA 2ESCA 1Q65A 5IRPA 4UTWC 4GI4A 5XIMA 3LUTA 3AMGA 3O2LA 3WY1A 3FAWA 3B4UA 3BSHA 4Y9NA 1U1UA 4R34A 1Q6DA 1XCFA 3C2RA 3SURA 1C9WA 1PKMA 5H8MA 3BWWA 3A4AA 2V5LA 3WFZA 3N9SA 1UWQA 4A21A 1H50A 1RJQA 5HNUA 3GU2A 3REQA 2Y4SA 2QT3A 3HGJA 4LCQA 1A5UA 2Y5JA 3TE9A 4TMBA 5F4SA 4HP5A 1EL3A 1HIZA 4O53A 4PRWA 2WJEA 7TAAA 3ZR4A 1DJHA 4Z0SA 2CBJA 4W7UA 3DI0A 3QXBA 1PCWA 2DH2A 4CU6A 4C6OA 4XD6A 3WX7A 5BMWA 1Z89A 3ARXA 1EF3A 3QMRA 1KRCC 3WJZA 4GUGA 1M01A 2AMGA 1RK5A 3T2PA 4REQB 1KXQA 2YSWA 2W5FA 2JQXA 5HWMA 5FL0A 3KHDA 3WLMA 4QG9A 2QPSA 3G8RA 4EANA 2BHZA 2FKPA 1RK6A 3BW2A 1A49A 2X42A 3V4BA 4IPNB 2O56A 2BY0A 4JPGA 4C6NA 3LSCA 1BRLB 2EBNA 1MYRA 3KZPA 4Q7NA 3K2GA 3NEHA 1R3SA 1JDAA 1ZAIA 4NQ1A 2YBVA 2HISA 3W88A 1O5KA 3HJEA 1AQHA 2YA1A 1A5CA 1UZDA 2ALRA 3UZYA 4GXPA 1VCGA 2B4GA 4YVPA 1TRIA 3TVAA 2PF0A 3KBMA 2V3GA 3O6YX 3AYSA 1UD8A 2G41A 5LIXX 4AEFA 3LMYA 3GDBA 3WNOA 3AXXA 1N55A 3UJ2A 1ISWA 4P8XA 3Q45A 2V2HA 3OA5A 2R1NA 4PCPA 3ARYA 1DJNA 5M17A 2BOEX 1C90A 2NV2A 3B8IA 1F3TA 5D33A 4IG2A 3SN1A 1DXEA 1TKKA 3SCOA 1NH6A 4Q4SA 4UTJA 2VTFA 1MXSA 4IJBA 2QQ6A 4IIHA 3MCNA 2INFA 2CZFA 3L4XA 1SJDA 3N73A 1QOQA 1W3KA 4W86A 3B03A 4Y9MA 3TR9A 2E5BA 2GGEA 2G3MA 2C6QA 4LAUA 3W84A 2ZX9A 2ATSA 2GSEA 3ZJ8A 7REQA 1T6MA 3WQDA 1L9WA 1JZ4A 2FZ9A 1P6CA 1XKYA 4NZJA 4DO7A 1OC5A 3VOHA 1UMLA 2GOKA 3CO4A 1OCBA 1YTKA 1QHPA 3TAKA 3FA3A 4RE2A 2V69A 3IGSA 3PN8A 1TELA 3GG8A 1XL9A 4HA0A 3K8KA 1QPRA 4B5WA 1QJWA 4I7UA 3TTQA 4J2PA 3ZR6A 1GHSA 1XYLA 4G6CA 4KIEA 4HZ8A 4P7LA 3M0KA 4AZHA 4MY9A 2OTDA 3MI6A 4ONVA 1A4MA 3CWHA 3W4RA 2PDUA 4MJMA 3CGTA 3W1UA 3C0LA 5JVLA 5B80A 4FZIA 4QEEA 1IE7C 4BQ4A 1VBHA 2E1DA 3OOQA 1O12A 4CQ8A 5FF4A 1H61A 5REQA 3N19B 1ZBVA 4CCDA 1D2KA 3WH5A 4UFLA 4Z1YA 2H90A 5BOFA 1M04A 3WH6A 2Z1XA 3ELFA 4AY7A 4YNGA 4A2RA 1DXIA 1S3TC 1UH3A 2H6RA 3GZAA 3BLIA 3F5LA 3EMQA 2Z1SA 4Q8WA 5H1WA 4XB3A 5HK4A 5HR7A 1B4EA 4HVXA 1TJ0A 4PE8A 2DT1A 1JXKA 3VKBA 1GKRA 1UZHA 4O52A 2J8FA 3KBJA 3HO8A 4G8TA 2X40A 2W79A 3BXWA 3GTXA 3LHZA 4GNVA 2A7RA 1V0NA 3GTFA 2OOGA 1UZ4A 1M6JA 2WJZA 2RDXA 1V51A 1QFEA 2PU0A 3CBWA 1E9LA 3AIUA 3VKCA 3VYLA 3H12A 3VGBA 5AHLA 3F4CA 5KITA 1K9EA 3G22A 3OGSA 5HJYA 3SRKA 2OZTA 1AMKA 4LU0A 1JJKA 3V5CA 2DUAA 4CU7A 3CHDA 4AG0A 2ZRWA 4ZQCA 1E71M 4LH8A 1OIFA 3IACA 4WKAA 2MANA 2FGBA 1VPYA 4JYFA 4RE3A 4OHQA 1ZUAX 1E4LA 4C6QA 2VCBA 2Z1KA 1TPVA 4IGHA 1W3HA 2IPJA 3E6EA 1SYTA 3EOSA 3GG0A 2EJAA 4WSJA 2QIIA 4OBTA 8TIMA 4PMOA 2OU4A 3OEXA 4IISA 5MKGA 2HVNA 3LHWA 1J0JA 5LHFA 5I78A 3EB4A 4PMYA 2BHUA 4QE1A 1ZALA 4I90A 5AB3A 3B0UX 5LIKX 4A22A 3TNBA 3QGAC 4GVGA 2YBUA 4EAYA 3QHOA 3U7BA 1A50A 4HYWA 2Q8ZA 4AW7A 2DT2A 4J35A 3U2CA 2WAGA 3WMCA 3UZJA 3QH2A 3UNDA 1ADDA 3CASA 5JH2A 1A5BA 1TFVA 2FB3A 1PIFA 2DZVA 2VGFA 4P61A 4F40A 5LXEA 4OZOA 3LHVA 1DJIA 2E6FA 3W86A 1EXPA 2H3BA 3KTXA 2C1GA 2XN2A 4I8DA 4KRUA 3Q37A 5DY2A 1HJWA 1OIMA 3LK6A 1IEXA 2DP3A 3QYQA 2Y2WA 2G5WA 4Z2HA 3ZOAA 2CHNA 1CLXA 4PMXA 2P76A 5D09A 1K8XA 5CBBA 3UEQA 4NJJA 3MO7A 1LOQA 1OX4A 5G4HC 4MWAC 2E77A 4A05A 4OOUA 4BF7A 4C6IA 4YN5A 3DFNA 3L23A 2JF7A 3GO2A 2GVJA 3NQBA 4EAMA 5AHFA 3KHJA 3UP8A 3ZS4A 5C55A 3IVSA 4XKYA 3AMDA 4R7JA 3P62A 1PBGA 1KBKA 1PO9A 2D23A 4Z1BA 4IMGA 1O6IA 1YXDA 3TLQA 6TAAA 1XUZA 1LCOA 2IKHA 4NAEA 1EPXA 3KXQA 4K8HA 3SQLA 4DJDD 1XIFA 1XHGA 1XR2A 2FH6A 4KCWA 1VGAA 2RFGA 3TFCA 2GFTA 1DPMA 1IWPA 2J6VA 2W0UA 1L0PA 5TAOA 1UP0A 3SCTA 1CIUA 5HNTA 1QBAA 4LC8A 2BVYA 4A3UA 4BA0A 3LCLA 4HNLA 2VC6A 3GIQA 4ZE5A 1DWIM 4C5YA 1H4PA 4LC6A 5GVJA 4WQ6A 3HV9A 5IXEA 1MW3A 2VEGA 3WH9A 3IS4A 1KTCA 5C8BB 4ZTYA 3WQFA 5F2IA 5LYRA 1VIWA 4HMDA 1EC9A 4AHOA 3QFEA 4A3QA 6ALDA 1C8QA 1XGZA 3HMJG 1ZBKA 1SO6A 1JCXA 4RNIA 5CG0A 1US2A 4JEQA 1E55A 3GWQA 2X1UA 4V1YA 3CH0A 5IM51 4MY1A 2PZNA 3GVGA 5DQPA 3L4ZA 2EPLX 2PDJA 3O1NA 1QU4A 4HK6A 2WXDM 3H8AA 1RCQA 3A6OA 3V0UA 3QF0A 1JAKA 2QCDB 4EPDC 2VGBA 1Q7QA 3SY1A 1HKVA 3W7OA 4XAZA 1Q4NX 1QI0A 2JALA 4LALA 2YLLA 4LV4A 4FX6M 3DI1A 4WRHA 4IQDA 2OLSA 4AYSA 3MKKA 3FAXA 4RX0A 2VR4A 1WKYA 3ISIX 1I60A 4DXXA 2PU1A 3LU2A 2J77A 4ML9A 4NVTA 3N29A 1TWWA 4FPSA 1QI2A 4KEUA 1V8EA 1NF0A 2L5HA 1K03A 1OK4A 3BCJA 3CXOA 2GQ9A 3IPWA 4E2BA 1W1VA 3L21A 4JKMA 3QSTA 3SCRA 3VOFA 3BAXA 2ZZ1A 4GPNA 4H9UA 1TCDA 2PTZA 4K7VA 2VX5A 1IR2A 3E0LA 3QW3A 1M65A 4A35A 4L6DA 3COTA 3IAPA 1VBGA 3LPOA 1KBBA 4XUYA 3CAWA 3VNIA 2YB1A 3BV7A 2Z00A 3K8MA 3KOYA 3U5UA 5IDZA 4Z1DA 4B4HA 2DIKA 3VNKA 5BYWA 2VFHA 1EOMA 3DGRA 3HG2A 1XDMA 2CLHA 5D37A 2NQ5A 4MNLA 1AH4A 3GK0A 3OGRA 3WG6A 4HN8A 3DHFA 3HTWA 4WVXA 1UC4A 2UV8G 5T91A 1AK5A 1KM0A 3M5YA 1W32A 2OQLA 3HF3A 3UR8A 1UWUA 1DWAM 4JQ4A 4NAFA 2WMIA 4JDBA 4L4MA 1VD6A 4U3AA 4H00A 3M41A 3KL3A 3W7MA 3B05A 2PDGA 4BI7A 1E5NA 2B81A 4LVFA 3CL6A 4D1JA 1JDFA 3QBUA 2VZVA 1UH4A 2CWXA 1GT8A 4PA8A 3QZAA 3GM8A 3NURA 1IEWA 1JDEA 3N4AA 3P7YA 4QDWA 3KS5A 1J0HA 2OR2A 3GAKA 4AVNA 1DTUA 1I45A 1SFSA 1KM1A 4K8GA 1SZFA 1XIHA 4F0RA 4QSHA 4WDUA 2E68A 4U5IA 5C6MA 1JPMA 2DZXA 1C92A 4RCXA 1XH1A 1OGBA 3IJDA 1NWRA 1BXCA 4M5PA 5CGQA 3DH7A 1VRXA 1XSKA 2NXGA 3AQUA 1SO4A 1TA3A 1H51A 3K46A 3KM8A 2HK0A 4LVDA 3UWZA 1GUVA 2WZHA 2PDCA 4PFHA 3TZFA 2O9RA 4ZXLA 3WUEA 3URNA 2D1ZA 3LGGA 3PFMA 1EDGA 1FDJA 3GHTA 4QQ3A 3NOEA 3S2NA 3SY5A 3MJMA 1JRCA 1TRDA 2B7NA 1TX0A 3BLLA 2VRQA 3EX4A 3NPXA 3D0CA 3C8NA 3TQ0A 3WLHA 3IK4A 2QVHA 2E5DA 4O1FA 3MBFA 1JF5A 4AEOA 2BS9A 3L5LA 2PDFA 4H6RA 2YYUA 1MFUA 3UESA 2V5JA 4JHMA 1AD1A 2WHLA 3SAZA 3UCDA 2WMHA 2ABBA 3STPA 1VIZA 3CS2A 1O5XA 4QQUA 1F3XA 3HFTA 2ZBTA 3JZEA 3TMQA 4R88A 3IV3A 3CZLA 4JIEA 4LJ3A 2F6XA 4P8VA 4ZFMA 1JGIA 3KL5A 3P82A 4F9DA 4X60A 2Q3OA 3P0WA 1OYCA 3EA1A 5EFFA 4HOWA 1E3XA 4JZ5A 3TC3A 3VIOA 3G1DA 3INPA 3KBSA 1E4NA 5I79A 1A3HA 1EA9C 1CGWA 1RQEA 1OC7A 3CWNA 1W9VA 3WF1A 5DELA 4R27A 4FNQA 1HO4A 3TW7A 3VNLA 1E56A 3UJFA 3AC0A 4F0SA 5I06A 1J93A 3W9ZA 1G67A 1AMYA 1RCOB 1ZBCA 4UZSA 4D71A 1G6CA 3FV9A 4UFKA 3M0JA 4WDWA 1K3UA 3E96A 3WKZA 5I2UA 3OZPA 3ALGA 1DXFA 1JCJA 2F2HA 1ONXA 2J9YA 4AWUA 2VEIA 4Q8OA 1B9BA 4B3KA 1C3FA 1XI3A 2NLYA 2VGGA 4MUZA 1X8CA 1X97A 4BJHA 2X0YA 4C7FA 3GKFA 3FEQA 3W25A 4LV9A 3UXIA 4JX5A 5CCZA 1D8CA 3ZLGA 2JGYA 1V5XA 3QY8A 4N9DA 4OOZA 4K68A 4DBWA 4W87A 1MW2A 3GNNA 4GKLA 5A6KA 3JU2A 1I1WA 4YTTA 3OBKA 1AG1O 4OECA 3ZFHA 2PZ0A 3RM8A 1T40A 1OVDA 3G24A 1V3JA 2GWNA 5BXRA 3PZNA 1ZHAA 2X09A 3BG3A 4DXVA 4PMQA 4WR3A 4DUXA 1X1OA 3HPXA 4JD4A 3E9AA 3MANA 1RQHA 1V6TA 3USZA 3C3NA 1LBLA 3S2CA 3VKKA 5CZTA 1NSJA 3ATZA 2DSUA 2YXGA 4B2DA 4YTUA 1Y5VA 4KWVA 1C7SA 3G1YA 4MB4A 2J79A 4HPHA 1R7OA 2R1KA 1R47A 2GOUA 3KBVA 4IT1A 5G1MA 3B8TA 4AD4A 3HBLA 2ISDA 4NNCA 1IT8A 3EDKA 4PUUA 3VIJA 2WVVB 4RK8A 2UWFA 2A4AA 1A5MC 5D9OA 4K1WA 2QCFA 1A3XA 3CNYA 2Y7EA 4NIRA 1HO1A 3W83A 2WZMA 2YXOA 4E2VA 3RO8A 1UJQA 3CPUA 1G4EA 1EUAA 2YA2A 1NQKA 3Q65A 4K1GA 5D05A 2VVSA 1K7EA 3KTCA 3MMWA 2EKCA 3FVDA 4GYPC 1KFKA 2GUUA 3EWXA 1VEOA 3N9KA 2X8RA 3VNDA 3RO6A 1UD4A 1KBLA 4LBUA 3W7HA 3HGSA 1NDWA 3PBYA 2YL5A 3PF3A 5LA2A 3H26A 3THQA 3NQFA 4DZ5A 5LGXA 3WL1A 3MHGA 3QR3A 1QK2A 1QNQA 3F4VA 2F6KA 3NQ8A 2JKAA 1EH9A 4JFWA 4N9BA 4OUEA 3PG9A 1WCGA 5I07A 2WLZA 2VNCA 3CZKA 4NJHA 3TP4A 3MHUA 4WX2A 4WD0A 4JAWA 4MDPA 4QJ1A 4GY0A 3WMSA 5BMXA 4LXFA 3NVDA 4DNHA 1IV8A 4JHZA 2FLIA 2J47A 1OFAA 2GUBA 2WKLA 4ECLA 4KW2A 4K3ZA 3LQGA 3NYDA 1EQCA 3EGJA 3S1XA 1BYBA 2WOQA 1R38A 2Z2UA 3FGCA 3QQ0A 1GOMA 1OEPA 2XWDA 3G1RA 4QR6A 3U6WA 1KFWA 2NQZA 1ZAJA 4YHEA 2RUSA 2PLJA 2QIWA 3OODA 2B7OA 1IGSA 3FJNA 1SU5A 1CPUA 1LZOA 4JCMA 3GNOA 5H91A 4GY1A 3TQVA 1ZSXA 5IFPA 5J8LA 4M8UA 3W3OA 7A3HA 2ZX8A 1FH7A 2ZDRA 3AS2A 5C2GA 4ZEPA 2EEXA 2J78A 4XBSA 1Y5WA 2V5CA 3AMCA 4Q8MA 1UZ1A 1EHAA 4A8RA 4BEQA 4Y96A 4D6CA 3OYZA 3Q67A 2XIOA 3RRAA 3AXKA 5DEZA 5GNYA 3SQMA 4PTVA 3D6NA 2D3LA 2EHHA 2AQVA 1MEIA 1XISA 4HHHA 2VDIA 2UBPC 3PNZA 2HVOA 3HJZA 2HROA 4URIA 1JZ2A 3GIYA 4HU4A 4RXGA 1D9EA 3S9ZA 4HJFA 1BVNP 3N4EA 1KR0A 4HPJA 3LTPA 4FB7A 4C6KA 2WMFA 2QV4A 3PP7A 3MS8A 4YYFA 1EC8A 1PL9A 2RKXA 3P93A 1F2JA 5MF5A 2A5HA 4Z1AA 5ABFB 4LGXA 1JEZA 3TXZA 3DDMA 4UTTA 1F3WA 4XISA 1GPFA 1UA7A 1R8LA 4HHLA 4OWGA 3PPGA 5BWAA 5DMYA 4CU8A 1KGUA 1FDZA 3RLGA 3TSDA 1FCUA 3VX1A 3NA8A 3SCQA 1YPIA 3MP5A 2XVPA 3WQCA 2XIMA 1B3OA 3CTLA 1E70M 2XVLA 2FDMA 3BH4A 1TUXA 1GVFA 2W61A 1AUSL 1OT1A 4JXCA 3CT7A 5HR6A 2Q8XA 4HKPA 3O9NA 3AIQA 1W9UA 4W4QA 5BOEA 3ITCA 5I09A 3O15A 3GDTA 3DX5A 1FWSA 4M80A 1ELSA 4PC8A 1FUYA 1KGXA 3T05A 3BZGA 3WIJA 3ES8A 1GVQA 3MSYA 1U2YA 5IBXC 3CHCA 2PDBA 4UFMA 3M6YA 5FA5A 3LZ5A 4LT9A 4QLKA 1HN1A 3VZXA 3BC9A 1WUEA 4DYEA 4KGLA 1B57A 3TTEA 2YB4A 4I6KA 3IK2A 2J25A 4GZIA 4NILA 3CUXA 4RV3A 1KA9F 3CIXA 2QJGA 2CFFA 2XISA 2OQHA 5DN1A 1V6WA 2VFFA 5T26A 1C8YA 3TN3A 5CZSA 3ARSA 5DO8A 1W31A 1YE4A 3JS3A 2YCLA 5HQEA 3WCZA 2BGQA 1EFZA 4Q8TA 5LKYA 1SW3A 3N6JA 1GZGA 5GJNA 1AZ1A 3NQ7A 1Y8BA 4JYEA 1RHCA 1S46A 1WDQA 3NL6A 3UCQA 2E7FA 3K30A 3WQEA 3LCGA 3TW9A 3BJFA 3UYIA 1ITXA 2HS6A 1X6NA 3UXKA 1MZHA 3FFSA 4UQDA 3BW4A 2YDQA 1SGJA 1R2TA 3APGA 4ZMGA 1PV8A 3RCMA 2AKZA 2I57A 4JICA 3WLIA 4M19A 1XLKA 5D9NA 5HA7A 3WLNA 3MUAA 1E0TA 2JBMA 2G3JA 1XIJA 4ADSA 1TCMA 4O8RA 4DLMA 2HPIA 2CBVA 2W67A 4NY2A 2RDTA 4TXEA 2BV9A 3VD3A 3ZSTA 1ICPA 1W1ZA 4IIEA 3AO0A 3IARA 4FLQA 3IIVA 1W5OA 1WQ5A 4GQGA 3DESA 4M7SA 4TV5A 3NL5A 4B3LA 2YDRA 1F5ZA 2UY5A 1DJXA 2R91A 2VR5A 1Z3NA 4GJ1A 3QC0A 5D2TA 2C71A 3GAYA 4QS6A 1Z69A 2OWXA 3R2GA 2ATMA 2V5BA 1QI5A 4IFOA 4IF2A 2F7FA 4B91A 5I3IA 5G1TA 3GG1A 1PS9A 5I24A 3CC1A 3EX2A 1EEXA 4JS3A 3IEBA 3VINA 3FJ4A 3C52A 3T0TA 3LXAA 4ES4A 5KZ6A 2J27A 3ZJ7A 1AQ0A 3AS1A 1LRNA 1R3QA 1Q6QA 2QS8A 1FOBA 3LI0A 1NOWA 3ZR5A 4OBSA 5AY7A 2DDXA 3GBEA 1HJQA 4LY4A 1YDNA 4PUEA 1TWZA 2RGMA 1PZ3A 2X1RA 1NWSA 4XO7A 3JR2A 1WX0A 3WQVA 3GDRA 3WNKA 1ZJHA 1G0CA 2D73A 1BF6A 1VS1A 1Q6RA 1EP2A 3HOJA 1WAUA 1TPH1 2V8ZA 2XM2A 4JIQA 2ISSA 1EJRC 1H1NA 5EA9A 3T1GA 3MB9A 3GDKA 9RUBA 5F4XA 4CEUC 2TSYA 3B9AA 3FS2A 1JCMP 2NV9A 5AZ0A 3TKFA 3IJIA 3RRXA 2X0SA 2QCMA 1MZRA 3OZOA 5FD0A 2QVNA 2VX4A 4GUIA 1KKRA 1ZAHA 3VDAA 4B3ZA 2DZWA 1UWTA 4JQ3A 4D6JA 1HP4A 3J7HA 3LCIA 2Q6ZA 3C86A 5I6SA 3CL7A 3H21A 2H8XA 4BF9A 4LRSA 2NQLA 1UWIA 1XP3A 4PCNA 3W26A 4KS0A 2CERA 4PGLA 3UG4A 3RR1A 1UR2A 1FY6A 1QPKA 3W7JA 5EBUA 3P84A 4KKXA 1Q6OA 4XQ6A 2E6YA 3GKAA 1DQXA 4AMAA 2F38A 3DFPA 3N11A 1X6UA 3TROA 1B31A 4QE4A 1PX4A 4GZ7A 2GDUA 1XKJA 5G4EA 4RJEA 4Y8FA 1QHZA 5M2FX 1HZYA 2QDEA 3RM9A 3L0NA 4B5TA 4NUWA 1HJUA 4UTLA 1KTBA 4U28A 3VCCA 1IXPA 1XLEA 2XM1A 3P2VA 2HK1A 1SM9A 2PE4A 3UVAA 4ZQOA 1LL7A 2HZGA 4XZ9A 3LV6A 3H70A 3E12A 4FEZA 3LQLA 3BL3A 4QGCA 1ZU8A 1EGVA 3EDEA 2VC7A 3R12A 5JBEA 3M64A 3ZSSA 3WJSA 4O57A 2E8ZA 1S2CA 2P50A 4WK9A 3WNLA 1YDOA 3EWWA 4MVAA 2IQTA 4LB3A 3T2OA 1PZ0A 3EDFA 3KRBA 1VBJA 2QR6A 1GONA 3VIFA 3QV9A 2IXVA 1V3HA 2OEMA 3PB0A 1FX6A 3LEPA 2NZLA 2WYSA 3GSMA 3W1PA 3GXTA 1TPUA 1OABA 3PBUA 3N1AA 3QOKA 2AL2B 3T78A 4X0NA 3H55A 4RKAA 4MADA 5EKYA 4JN8A 2HVMA 5DF0A 3BAYA 4C6MA 1J01A 3A3WA 1XBXA 3SIMA 1FHLA 1GKQA 3ECQA 5JBFA 2E4TA 1FTXA 4PBFA 4QBXA 1XICA 2P8BA 1EXBA 2NXIA 4DPPA 3R11A 4KESA 3RAOA 3MZNA 3PWAA 1US0A 2I14A 5DT7A 1M68A 2FZDA 1IIGA 3O0FA 5BRQA 2ZRUA 1XBVA 4AD1A 2QZRA 3W28A 2PODA 4UCFA 3MVIA 3TK7A 5I02A 1UR9A 1WPCA 1WE5A 2WNNA 1V0MA 3ANYA 3G1AA 3EOEA 4M24A 1NIUA 2PDXA 1TJPA 1TMLA 4PULA 1VB9A 2J13A 2VQTA 3MP4A 2DZBA 1MW0A 3KUMA 2Y62A 1Q3NA 1OQFA 3LXBA 4IL2A 3PG8A 2Y88A 4CN6A 1Q8AA 3VUSA 5A8NA 4US5A 3O6AA 1GZ1A 4LYRA 3WLRA 2FPTA 3FHQA 3N25A 3A9BA 4H6EA 1V79A 1NARA 1XIDA 3B9DA 1G4SA 2PTYA 2ONEA 1PUDA 3REQB 2EJ1A 2YR1A 1UPPA 1OF8A 1H7RA 3I4KA 2V2CA 5AC6A 2VRJA 1XSJA 3MMDA 4POCA 3M5ZA 4PB4A 3QTPA 3UA3A 5EPDA 4KF1A 4L5ZA 3T44A 4OT7A 2RJGA 4X2RA 2FB2A 2YCKX 3BGJA 2HTMA 3GFXA 4TIMA 3WD3A 2IKIA 1TTIA 1WDDA 2RDUA 5GQBA 4RR4A 2PLKA 5HINA 1JPKA 3LBMA 4NZ4A 3N2CA 1QK0A 3APTA 2ZDSA 3NSMA 3R94A 4GFSA 1FP9A 3MY9A 3WH7A 3W1AA 2WMGA 3F2CA 3M0LA 1ZZMA 4F8XA 1J0YA 4J3UA 5BXTA 3TR2A 1UIPA 1WBJA 2ZZ3A 3TXVA 1UPMB 3A3HA 1GW1A 1FXQA 3WH8A 4NX0A 2ACRA 2Y5SA 3PUGA 3LRLA 2EAWA 4LUYA 4RZBA 1K8CA 1DL3A 1EO7A 4YCOA 3VIGA 1XLFA 4F3HA 4GBDA 2NX3A 4U31A 3WYZA 1N7KA 3UGRA 4ZSTA 2JEQA 1HW6A 2Z25A 1EB3A 3ARUA 3W27A 4ZOAA 4PMVA 3OG3A 3HG3A 1A5SA 4GI6A 3UPBA 2ZUMA 2P88A 4XZMX 5AHMA 3D3FA 1OJXA 4E4FA 3DFYA 1YADA 4YXGA 4JTAA 3NQ6A 3H6OA 3DXIA 3W37A 4D2JA 4L56A 3FOKA 3BCDA 3S0CA 3GH5A 1Q66A 3JRKA 1ZTVA 4KH2A 1OF6A 4IQJA 1C93A 3V35A 3RJYA 3W74A 3AJXA 1C91A 4P7OA 3TA6A 1S2TA 5GJMA 2P8CA 1ITUA 1PWLA 3OLEA 4O19A 3EWDA 3EB3A 1XUUA 2O4MA 1MDRA 2R1MA 4I7VA 3MQTA 1KM2A 4HGXA 3B3DA 1SQ7A 3A22A 1HJVA 3PAOA 3B8VA 4HYRA 2BY1A 2R94A 2ZUNA 3A21A 4P5UA 3VGDA 3N4FA 4DYKA 2JE8A 4WJ8A 2PMQA 5A69A 1JXJA 5EU9A 2DSWA 5B7ZA 2B7PA 3GXFA 1O1ZA 4Q33A 1QATA 2J9ZA 4AF0B 3S83A 3RK8A 4PZVA 3WDJA 1DTNA 4MFDA 3LGEA 4W7VA 4AZ6A 2TMDA 3D5HA 2AL1A 3ATYA 5FF2A 1XLMA 7REQB 2ZXBA 3CV7A 3H22A 1QNPA 4K8EA 4QE5A 3UPWA 3N34A 5HOSA 1YKWA 4QSFA 4JTCA 1GEQA 4PTMA 3RPTA 1G5AA 3VIKA 4O10A 3JZUA 2QMKA 4UFIA 2POTA 1SZRA 4D72A 3G1XA 4NNBA 1A5NC 3KEHA 3RF9A 1AQFA 3L4UA 1JRBA 2I17A 2XFFA 5EBAA 1YPFA 4S3KA 3U2EA 4PODA 1ISXA 3C0SA 5K4ZA 4US6A 4R85A 4J3SA 3UJSA 4NX5A 2A21A 2QUTA 3WD0A 2XWEA 4YTSA 1PKYA 2BLEA 1BLIA 3AZTA 3E5BA 3ICJA 5TD4A 3UD6A 1V6YA 1OM0A 4H6QA 3BSMA 3XIMA 3ZIZA 3VMNA 1V0KA 4XVEA 3SCNA 1KCKA 4HSHA 1IXOA 4AD3A 4C7DA 3VCRA 1KXVA 5BU9A 4B5VA 2FIQA 2C1HA 2PWVA 5REQB 1F7BA 5TF0A 4AVFA 1LL6A 3DUGA 1YNPA 1W5MA 3CUZA 3SGUA 2TYSA 2Y24A 4I5XA 4Q7BA 5C9XA 2V67A 2G4JA 1E4IA 3OW1A 4I6VA 3BAJA 3VABA 1I1XA 1MQRA 1E6ZA 3H7UA 2CETA 5HJXA 4NJKA 7CGTA 2VEKA 3IGHX 1GYLA 1J10A 4HK7A 2ZA3A 1L6WA 1ME8A 4MYAA 4UQAA 2BG5A 1UB3A 3BZJA 4B92A 1I2NA 2YL8A 3PAJA 1E9YB 3O07A 4KMQA 4IP7A 3PPCA 1C9DA 1KQZA 3HPFA 4HTYA 2XIBA 1YXYA 2AMXA 2AAAA 1V3MA 4NZ5A 2ABAA 1IYXA 5B7YA 4UWMA 3ZQ9A 2CW6A 3L5MA 2GPTA 2XHYA 3BICA 4JHOA 5T9CE 3PJUA 4GUHA 2X1SA 3LZ3A 1QOPA 1S2WA 2VMFA 4QP0A 3VTRA 2ZUTA 2QUUA 4AWTA 1G1YA 3CHFA 5DFAA 1PJ9A 3ARRA 2ANUA 3MWCA 2CPUA 1W3NA 2PDHA 2VOMA 1Z48A 1PPIA 4H83A 1SO5A 3RG6A 1MNSA 1TPDA 1IIHA 4MB3A 3EPOA 4Q8PA 1BYAA 2QYGA 4PB5A 2O55A</