3V5OA

Structural and mechanistic studies of catalysis and sulfa drug resistance in dihydropteroate synthase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
262
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILNPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords Dihydropteroate synthase
total genus 92
structure length 262
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3v5oA00
2BMBA 3H2FA 4NHVA 2OGYA 1TWWA 2VEFA 2VP8A 1Q85A 1AJ2A 4S3CA 4D8AA 3H21A 2Y5JA 2Y0FA 3H2OA 4C1NB 4S3DA 1Q7QA 3TYCA 4S3EA 4DB7A 4O0QA 2YCLB 4HB7A 3TYAA 4NILA 4MWAD 3H22A 1AD4A 1TWZA 3V5OA 1AJZA 4D8ZA 4DJED 4NIRA 3H2CA 2YCJA 1EYEA 4O1FA 2YCIX 3BOLA 4G9PA 4S3AA 4MWAE 3H26A 4MWAB 3TR9A 1Q7ZA 4S39A 2YCKX 4S23A 3TZFA 3TYBA 4NL1A 4S3BA 2YCLA 3H2EA 3TYZA 3H2MA 3H2NA 3H2AA 4DAIA 2DZBA 4S3FA 1TX2A 2H9AB 5JQ9A 1TX0A 2E7FA 3TZNA 4MWAC 4DJDA 3K13A 4DJEC 3BOFA 4PZVA 3H23A 1TWSA 2H9AA 1AJ0A 1AD1A 4CCZA 3NOYA 1Q8JA 4S38A 4D9PA 2VEGA 3TYUA 2DQWA 4DJFC 4DJFD 2DZAA 3MCOA 3TYDA 4C1NA 4MWAA 4DAFA 3MCMA 1Q8AA 4O1EA 3TYEA 4DJEA 4DJFA 1Q7MA 2Y5SA 3H24A 4DJDC 3MCNA 4DJDD 1F6YA
chains in the Genus database with same CATH superfamily
3DC8A 3HN3A 2NSXA 4B9YA 5TIMA 1PKNA 1VENA 2UWFA 4DF2A 4AHQA 4EAYA 1H7XA 3E5BA 1O5RA 5C71A 4O14A 1XIIA 5JBEA 3MMUA 2NV2A 3PFRA 5CZ0A 2NX1A 1CXIA 1Q6EA 1KRCC 3P7YA 4JTRA 5IXEA 5G1YA 1M9HA 4XSMA 3LU2A 4DYJA 1M1BA 3URBA 3VKAA 1R7OA 3LUTA 3LCIA 1IZKA 4UXDA 1M03A 3NDYA 5I78A 4M8UA 4PFHA 4U2ZA 3TYBA 1H7NA 1M65A 4ZQRA 1XFCA 3ATZA 1TPEA 1NDYA 2Z1VA 2C14A 2X1UA 1H11A 1OHLA 3KTCA 3CH0A 4RDYA 2FMOA 1IXNA 1M5WA 2J13A 5DMYA 3AS2A 2D0GA 2HSAA 4O1BA 1RJRA 3E49A 1MNSA 2W4XA 3U2CA 2FZBA 3KAOA 3L68A 4Y96A 4XUGA 3ABZA 5LNSA 4R3UA 3CHDA 4AD5A 1UH2A 4TOQA 4L1XA 4KIEA 4WGHA 2G4FA 3BLKA 4AHOA 2J9YA 1XPGA 5C2CA 1JULA 3ZT7A 3KP1A 2GOUA 3GO2A 2QVNA 6A3HA 2QVHA 4C6CA 5REQA 1CGUA 1RXOB 4ZB2A 5DEZA 3QLDA 1B30A 4G6CA 2AMGA 1UG6A 1B3XA 2HDJA 1BXCA 4O19A 1IE7C 2IXUA 4YVVA 3AXMA 3IS4A 1SM9A 1B0IA 2QUNA 1OX4B 3GBEA 1JRCA 3WQOA 3DFQA 1QNOA 3CMJA 1LZOA 1NU5A 2CLKA 1SW3A 3K1GA 4L4OA 3CO8A 4BS0A 5HPCA 5A8OA 3DFSA 2IW0A 3LA4A 2AKMA 3K4DA 4JXCA 1XBZA 3GSMA 4F48A 3BURA 4HNUA 5FESA 1UD5A 4M7TA 2D23A 4WDUA 1C91A 1DKWA 2E6YA 5C9ZA 1Z9AA 1R2SA 1ZQ5A 3FVMA 3LCFA 3VC6A 1R3VA 1IEIA 4LYQA 4GX8A 1TPVA 3MCOA 5C9WA 4NJIA 2Z1BA 3AYTA 5AYYA 3V18A 2R1LA 1A47A 6PTDA 2JFEX 2BDQA 3KOFA 4O11A 5DANA 3BSHA 1H60A 1Q2RA 4A3YA 4O53A 3N2TA 3S5SA 2PCEA 2BLEA 4DX3A 4GKLA 2INEA 3CUXA 4HB7A 1AUSL 2VEKA 2J9XA 1NQ6A 2CIPA 4MWAD 3PTMA 3PK7A 4C6PA 3QZ6A 2O9OA 1QPOA 3PPCA 2QDHA 4RW5A 4WSKA 4AXKA 4FI4A 4GXMA 4QQUA 2ZADA 4AXNA 4WIWA 1JXJA 3QEZA 3TTSA 3ZT5A 4L4PA 2I5QA 1GG1A 3QVQA 4QJ1A 1UQYA 4KWOA 3BICA 3MZNA 1LBFA 4M6VA 2QUUA 2J8TA 2HCVA 2H90A 3ARSA 3K4AA 3PZTA 3RPTA 4Q4MA 1GCYA 1XYFA 1Y8BA 1GVSA 3TW9A 1HGYA 3VKBA 5HDRA 5ENLA 3LHUA 1QHOA 3WEMA 3WLSA 3AZRA 3T05A 2BHZA 2EG6A 5BWAA 3TXVA 1S3TC 2RDUA 4AZBA 1PX4A 3HPSA 1IWAA 3LCLA 3HF3A 1Q4NX 4JTUA 2QJHA 4GC3A 2FTYA 5HMFA 4L4LA 4UIOA 2L5HA 2NWSA 2QCDA 2R1NA 5G1TA 2VMFA 3B4UA 4J2MA 1DJGA 4FALA 3M44A 3TX9A 4URIA 4F9DA 2GSJA 3HFTA 2WC4A 2PAJA 1PAMA 2V0TA 3GS6A 1F05A 5AHNA 1CLKA 5A69A 1VCVA 3EPOA 4XKMA 1Q6LA 1Q4WA 3OB8A 4LUSA 4KS0A 3CIVA 3QYSA 1IF2A 2DIEA 3UY7A 4HCLA 5FEWA 1QNQA 2GJPA 3M0YA 4X3ZA 2D0FA 4W93A 1CCWB 1O4UA 3IIZA 5K9CA 1BRLB 5LA2A 1UBPC 3MUCA 1YEYA 4O18A 3CTLA 3M9YA 1HO4A 3KBJA 1J0JA 4JBRA 2GJLA 4G7EA 1AK5A 4IICA 1GG0A 2XZ7A 2QJIA 1L2QA 4Q7IA 3UZ5A 1PBGA 4NF7A 3N2BA 3PP7A 1AJ0A 1Z48A 4M6PA 5LIUX 3WBWA 5I3KA 3VCNA 3OZOA 3LPGA 3WDIA 1O1ZA 1E6PA 5E0FA 1BYBA 3SCWA 3VE9A 1K8CA 2E77A 2GVJA 4FXFA 4MTVA 3R0UA 4WGXA 4GY7A 2FJUB 2VD9A 5HMEA 5TD4A 3W23A 2XVPA 2ZZ4A 2Q71A 5HATA 1DWIM 3W7EA 1XSIA 1PYMA 4CU6A 3UPWA 2BGQA 3LV6A 1QK0A 4HZ8A 3QV7A 3A13A 3L65A 4WQ6A 4PTDA 3GTHA 3RHGA 2AQWA 3WY1A 1UOZA 3TKFA 2CKRA 2J7HA 3PZQA 4X0NA 2ZA2A 1QNVA 3B8SA 3WDHA 1A0DA 3FXYA 6TAAA 3NQCA 1PV8A 1JCTA 6ALDA 2PDQA 2C1IA 3DH7A 4P61A 3TTYA 3EX6A 2PSNA 2PU1A 4JFWA 3G1VA 5AC7A 3P2VA 4J2PA 5IFTA 4R88A 3GU9A 3K1DA 3F2CA 3B0XA 2MNRA 3RLHA 4WY0B 4UOZA 5I5RA 4DELA 3SCVA 4WCJA 4N02A 1EXBA 3S9YA 1CB7B 2P88A 3I6TA 1XIDA 5CGQA 1OFRA 1EPVA 4A05A 1S5VA 5I3FA 2HS8A 2QPXA 3N18A 1WUFA 3PTDA 3EXTA 1HT6A 3W2MA 2Q02A 4NT0A 1EWEA 1V7YA 3WQWA 5AHFA 5AHEA 1M01A 1E43A 3AS1A 1FH9A 2NUYA 1TQJA 2RGMA 5CPTA 4BI7A 3WQGA 3NQAA 1FTXA 2XM2A 5REQB 2YL8A 1NOWA 2GDVA 4IFKB 2J24A 2NVAA 3C8FA 4GH1A 1SO6A 1EBHA 2A6NA 3QM3A 5C9UA 3EMZA 2CHRA 4JTSA 3ANYA 3ITGA 3H4WA 5FJUA 3EWWA 1QNPA 3TROA 3GVRA 1OX6A 2JKPA 2V9DA 5L9FA 1FCVA 4R85A 3CWHA 4MPQA 2IPFA 1HX0A 1WO2A 1K02A 3GVQA 2ZA3A 4UCGA 2Y7GA 2VDIA 1C90A 4HTYA 1US3A 1OX5A 1HXJA 2R9RA 3VIOA 1EDTA 4C6IA 3ATYA 1XRTA 2OPJA 4M81A 1R6WA 1XCWA 2QCMA 1LJYA 2OLAA 1KTCA 5A6TC 4AZ5A 4J40A 4L6DA 3BG9A 1I0BA 2BXZA 2P8CA 3S5ZA 4ROQA 2ZRXA 1UZDA 2E6DA 3KVJA 1YTEA 4ILSA 4IWWA 3CC1A 3EX2A 3MV01 4NZJA 3N3MA 4H8HA 3CU2A 4ONVA 4B5XA 2CZ5A 4MLJA 1K8ZA 4HVXA 4IQDA 3W7JA 3K30A 1FWIC 5BMWA 1EDQA 1EL3A 3D6NA 4IGMA 3OYZA 3IJLA 2FZ8A 1Y65A 5D30A 4CN1A 2OLHA 1W9BM 4AIBA 1K7FA 3QR3A 3SCPA 1FWBC 1POKA 4QE5A 1VFTA 4O15A 4F2UA 4UQ9A 1V6TA 4HNOA 4BA0A 5A8GA 5HQEA 4DWDA 3OG2A 1HKMA 1T7LA 4GC4A 2WPBA 2ZUNA 1KA9F 5BOEA 1E73M 1A5BA 4JNZA 4IMEA 2B7NA 4H41A 5CGMA 4Q4QA 3UNTA 2VO5A 4JIQA 3SQLA 1C7TA 4XZ9A 4O10A 3B8IA 3V75A 4GI9A 3JZEA 4L9YA 2Y8UA 3WL0A 4CU7A 4TV6A 1LYXA 4LYKA 2WK2A 3ARWA 3QZAA 3PPFA 1J01A 4IF2A 4RE4A 3PG9A 1QHPA 4R33A 1B4EA 4F66A 3KL5A 4HPNA 5CC5A 1PIFA 3VIHA 3F1QA 1OC7A 5DO8A 1FHUA 3VOFA 4LBSA 2C0HA 5EBAA 4ACZA 3PWGA 1H7RA 1H49A 1MMFA 2ZC1A 3LHYA 1CPUA 2FZDA 3WJWA 1DWAM 1CGTA 1Q8AA 4WY0F 1JCMP 3LRLA 3LBOA 1XQLA 1M53A 1ISVA 1ZAIA 1GYLA 2CLMA 1S5TA 1IEWA 1V0KA 2X30A 4HMEA 5BWFA 3TJLA 3CEUA 4NNBA 2F61A 3LTYA 4OWGA 1UWSA 3SUTA 1O5QA 2P10A 4HPGA 2H8XA 2Y2WA 4AY1A 4EACA 1IT7A 5GNYA 5I24A 3CAWA 3VNDA 5BZAA 4ZO6A 4PEKA 1FY6A 1OG6A 1FWWA 3VZZA 1TRDA 3O1NA 4XKYB 1EZ2A 4P7OA 4LYPA 2OQHA 3UW6A 4WDXA 3N6QA 5TQLA 5EMUA 2PE4A 3LX9A 1XQKA 3EKZA 3GR8A 1FP9A 3LTSA 3BZJA 2QS8A 2GJNA 1RCQA 2ZRYA 5CSRA 1QO5A 4Z2KA 4ZOBA 2PLCA 3VIIA 3VNKA 4JZ5A 1DJXA 1G69A 4NAEA 1FDYA 1XG4A 3AQUA 3A3HA 3BAJA 3NOYA 4J7RA 2WANA 3TYUA 3ZR5A 3FEMA 3B9AA 2OB3A 2ACRA 1J0HA 3FJ6A 3BG5A 2E4TA 3RGTA 4MWAA 4FX6M 3DHUA 3KXQA 3MV11 5FCZA 2YL5A 3WQPA 4GNKB 4OBRA 1S5WA 2WHMA 4DJDC 2PDIA 3PZNA 4QROA 3AUOA 1TVPA 1OFPA 1VLWA 4J3ZA 1TR1A 1A50A 2Z2UA 3W2UA 3BQ5A 5CJ5A 4JTIA 3WCZA 2I9EA 5A6SA 1C3FA 1VHNA 3BZGA 4QXIA 4JEQA 1U2YA 1F4AA 4LBUA 2WZEA 1YXDA 3IV8A 1V93A 2A3LA 5DBUA 1E0VA 1K1DA 2RHGA 5F4WA 5I7GA 4NXKA 3MO4A 3W2KA 1JR1A 3BQ6A 4S39A 3CUIA 4H7CA 1VAHA 1XC4A 4LV9A 4KESA 1WDSA 1GHSA 3S1UA 1QW9A 2CLOA 1LL4A 2YR1A 4MB3A 2VRJA 2CPUA 4B9ZA 3HPXA 3PB2A 1ZNNA 3VUPA 2DZSA 2YDSA 3SURA 1LLZA 1YRRA 4CD6A 2XTKA 1CIUA 3LZ5A 4Q8WA 4IP5A 4GQ0A 5C7HA 4IPNB 3KRSA 4GMEA 3AHZA 1I75A 3IIOA 3VIMA 1W1YA 3SM0A 2XUCA 1XISA 3TSBA 1ME9A 4LC8A 4M19A 1H61A 1NY1A 1XYBA 1J10A 3I4KA 4DJDD 1XCXA 3SQSA 4AW7A 2C8NA 2DORA 2VC6A 4UTMA 3L2MA 5FKYA 1EJSC 5A2BA 1OK4A 3HPFA 4PCSA 3AYVA 4JQ2A 3PJTA 1E9IA 2O4MA 3R0DA 1FXQA 5I77A 4PFMA 1XLKA 3VXGA 3ZJ7A 4G1KA 1GVIA 4MFDA 3NQ7A 1UW9A 1OFDA 2NQ9A 1A5KC 2RUSA 3L67A 4EOUA 4IISA 3ITOA 4R7OA 3TIMA 3NZ1A 3MSDA 1JZ4A 3S3GA 4Y9PA 2V2CA 3WEZA 5D37A 5CBJA 3L5MA 4B3KA 5J5RA 3W2LA 5D4YA 1PSCA 1K9TA 2Y1HA 3TZFA 4LCRA 2FGBA 1Z44A 1UWUA 2B7QA 4GXWA 1UWTA 3TMQA 3HMJG 3EA2A 3UG4A 4F0RA 4AX7A 3APTA 3RU6A 4KBXA 3QHOA 3O6AA 4O13A 3NZQA 2G50A 3GNRA 3V4BA 2ACQA 4HBKA 4DXKA 4JIIX 3PZOA 3BAWA 3OYXA 3FFSA 4TO8A 5C55A 3KRBA 2QUTA 1PKMA 3OBAA 1TPH1 4W87A 2DQWA 1MSSA 4L9ZA 6TIMA 2ZRZA 4KCTA 1VYSX 4DAFA 3IGXA 3UCCA 3TN4A 1WDRA 1XGEA 4I9AA 1EB3A 4HPJA 2F84A 1IXQA 1BF6A 3PFMA 1KXTA 4N42A 4O1DA 2WC3A 3AIEA 1XLEA 4D1JA 1N8WA 5BOOA 1DOSA 4GRSA 2EPMX 4D8AA 4N4PA 4GVGA 2R1MA 4W8LA 1AA1B 3Q2DA 3D3AA 1YBQA 4XV0A 4FNPA 3OZPA 3V5OA 4D8LA 1QK2A 4W4QA 1KWKA 1GVEA 2EPLX 4ZO9A 3UPMA 1X97A 4QGCA 2PZ0A 3I3EA 5LGZA 2J7GA 3GXPA 1CWYA 4E2DA 4GVIA 3VD7A 4CNNA 2YB4A 4UMAA 3GK0A 1SFJA 2H9AB 1OFEA 2PDLA 5AC8A 4S1FA 1YNQA 2WKGA 5G1MA 3A4AA 2PPGA 1K7XA 4QIUA 2FH8A 2CBUA 4ML4A 3DI0A 3MKKA 4V1YA 4L65A 2PRHA 4M1RA 5IHRA 1ISYA 1W1ZA 1KKOA 3N2CA 4HNVA 1DYSA 1Z8AA 5FAGA 3RK8A 4Q4PA 1U30A 4JTDA 1UH4A 3W00A 2HK1A 2RGLA 4O57A 4G2DA 3TR2A 2DEPA 3ZVIA 4AWTA 4FSAA 4M51A 2YA2A 3NZGA 4JQ1A 2V2HA 3B0YA 3ORWA 4EXAA 3RIKA 4QLJA 4OOUA 1SW7A 4KFNA 1HO1A 3A5VA 4REQB 4Q8PA 4US6A 3SN0A 3QY7A 4JFUA 2SFPA 2X16A 2ACUA 1MEIA 3SCRA 5TBOA 4FOUA 1B31A 1TV8A 4FIQA 1DP0A 2VGBA 3RM4A 2HVNA 3CQKA 3IRDA 1JCNA 1BTMA 4I9MA 4XTDA 2HNHA 1TMQA 2CETA 3QR1A 4AZ6A 1DL3A 1KBJA 3P93A 4AD4A 1ML1A 1UIOA 4EXBA 2WVSA 2PWHA 5HWMA 3EMQA 5FF4A 3HIJA 2ZUMA 4K8HA 1BYAA 3NNTA 5AHLA 2VVNA 2F38A 2J79A 3THAA 3IUHA 2WWDA 4DUXA 1OVDA 1PHWA 1GZ1A 4RNIA 3ZSSA 1OD0A 5EL1A 3AHXA 3B8UA 2C91A 1HJSA 1UH3A 2A5HA 3GTIA 5A5WA 4DLFA 1XLJA 4QJ4B 1R46A 3E0WA 4DJFD 4HOZA 2PWUA 4L61A 1VEMA 4AMCA 2BGSA 4YIWA 1QNRA 3ARVA 3P80A 3HG2A 4IUGA 2ANUA 2BVWA 4I7UA 5PTDA 1LROA 1RJQA 3VDGA 4HYWA 3QPEA 3MW7A 5E5CA 4F3HA 3HU7A 3MUIA 2GGGA 1O5KA 3LK6A 1XBVA 2VFHA 2UY5A 3TFXA 1Q65A 5LNVA 1W6TA 1D2KA 1AD4A 5D05A 3W28A 1FKXA 2XWEA 3MDUA 1Y0EA 1GTEA 3GW0A 4B15A 2ISSA 3W76A 5JH2A 2G41A 2OXNA 4OGZA 5AC6A 5B7ZA 5BCAA 4HNLA 2RJHA 5BXPA 4KEUA 5EPDA 5HNUA 1LQAA 3TVAA 2VCBA 1F8IA 2V8ZA 3BAYA 5DN1A 1MW2A 4AD3A 3B9NA 4GIRA 5E9AA 5H8UA 4H83A 3G0SA 4PMYA 3VM7A 4MY9A 4PMVA 3CUZA 3NQMA 2QW5A 3O0KA 1FOBA 1XYMA 3STEA 3BE7A 1YLVA 2E1DA 2EGZA 4AF0B 3GDRA 1YXYA 1PDZA 5U7SA 3SSZA 2J9ZA 3E96A 3IUIA 1OF6A 2PEVA 1PUDA 2CBJA 3KFTA 1XLIA 2QV4A 4UFJA 1LT8A 1M04A 3MO7A 5IRPA 3M16A 1OB0A 3QKZA 4DYEA 3NWRA 1H09A 4H7ZA 5A1AA 1NQKA 1XL9A 1ZBKA 2DVUA 4C65A 4EWND 3T0DA 2NQLA 4Y8EA 2ZX9A 3WELA 3UWQA 2DDXA 1ADOA 2UY4A 2WLYA 2CCRA 4E2BA 3VOHA 2CESA 1W17A 3W9ZA 3VTRA 2Y7FA 2OYMA 3U7VA 4C6NA 5C9XA 3SAZA 1RHCA 4J27A 1RA0A 3KCJA 1A5SA 1XYCA 2O9RA 2AAMA 3R79A 3TSMA 2ESCA 2NV9A 2D22A 4J4KA 4CVUA 3REQB 1ZGDA 2YIHA 3KX6A 3R8RA 1BGGA 4NQ1A 2R8WA 4A8RA 3WX7A 2AL1A 2GLKA 1ISWA 2VCAA 2R1KA 4JQ3A 1K6WA 2E8ZA 5GPRA 4OT7A 1UZ1A 1NSJA 1CI1A 1R87A 6REQB 2PDPA 1EJTC 2HNEA 1A0EA 2G95A 2HE8A 2DSZA 3N9KA 3KP0A 1R2TA 4ENLA 2E9LA 1K3UA 4KCWA 4ZTXA 4JFTA 3DI1A 1JD9A 4D6GA 1W9UA 4NAEB 1N8FA 5DMLA 3LHTA 3L4YA 3UR7A 2PP1A 4UTTC 1L8PA 3UG3A 4TR9A 4B2DD 3H54A 3UGRA 5M5DA 2OKOA 3R13A 2NX3A 4ZE5A 3LLFA 2GDQA 2QMKA 1Q7QA 1DHKA 3A3XA 3N29A 4E0CA 3PAOA 1NARA 3KOWA 1QATA 3LHWA 1HFBA 3E6EA 3N13A 4GBDA 3EDJA 1HP5A 2WZHA 3KM8A 2VUYA 4GO8A 1X38A 2WM1A 3CQHA 1XYLA 3S83A 5I79A 3SI9A 1ZUAX 4EIVA 2XIOA 3V0TA 3GD6A 1KXHA 3MVIA 2P3ZA 1E51A 1JDDA 1TX0A 2XN2A 1WV2A 2NQ5A 4BQ5A 4NI3A 3Q58A 4PMDA 3ZQ9A 1H5YA 3LGEA 2Y7DA 2O7SA 1VBGA 2GK1A 4O8RA 3MKCA 4B3LA 1RY8A 2QCHA 1WX0A 5BRQA 4F0MA 3A4XA 4B3ZA 3W7GA 3GIPA 2CFFA 2DIKA 1F6PA 4V2XA 3INPA 2AOSA 3N6JA 3M43A 5JMUA 1ONXA 4AEEA 3S0CA 4LH8A 3QXBA 3LHZA 1C7SA 4QLLA 1AZ2A 1HGWA 1S5NA 2FJKA 4UFMA 2BX7A 3MPGA 4MZYA 3DERA 4XB3A 3WLRA 1OGGA 1ECEA 1VD6A 1BWLA 3PBUA 2Q09A 2XSAA 3CGTA 1XKYA 1U83A 5DXYA 4BKNA 1VJIA 4GQQA 4XWUA 2JALA 3WL1A 5HQLA 1GQIA 6XIMA 2I17A 4FF7A 1OADA 2W66A 3IJQA 4TTUA 1KV5A 4GYPC 3L0NA 2JEPA 2QF7A 1V5XA 3T2PA 1UD2A 4IPIA 4NAFB 1WDQA 4US5A 1GYMA 1JFXA 4BWLC 2XFYA 1DJHA 4LGXA 4CEXC 3IVUA 1E5JA 3WLKX 4IUOA 5AZ0A 3SB0A 3VIPA 4QX4A 2X41A 3S6DA 3NVTA 1X6LA 4A3QA 1AZ1A 2YGYA 2QCEA 2XH2A 3L4UA 1OX4A 1F6KA 3N17A 3AXXA 4EP8C 4UB9A 1K6AA 2Z1WA 2ZQ0A 1LWIA 4RCXA 4UBPC 4HHMA 1L9WA 3BAIA 3R94A 3VKJA 3OLIA 1VJSA 3CNYA 2B31A 1TPUA 2Y5EA 1LLOA 3WK3A 4B16A 1QPQA 3DGRA 1YDYA 2NLIA 3W3OA 4NAFA 4LUTB 3DG6A 5KEZA 3NL6A 2HMCA 4LVFA 3T0TA 1TWWA 4TX8A 3W88A 1TVLA 5HR7A 5D2VA 1KTNA 5FJTA 1ZY9A 2GVEA 1HZYA 3LDVA 4QM1A 3VKKA 3W02A 4DYKA 3L7RA 3KDOA 3E2QA 4E8CA 4KCVA 5J04A 2UV8G 2J62A 3HPZA 1UWQA 1W9PA 2DSUA 5H2ZA 4JYEA 2CHOA 1TZ9A 3ES7A 3N34A 4WRHA 4AIOA 1VIWA 2QHAA 1W3LA 4W8BA 1UJPA 1V0NA 3T7VA 1E1EA 4F9JA 3BO9A 3OGVA 1JUKA 3URAA 2VX6A 3OVRA 4N9CA 2VX5A 3VO0A 4ZFMA 2Y62A 2CLHA 3IK2A 3S8HA 1R30A 3CBWA 2X40A 1P0NA 4N4QA 3Q94A 5HK4A 4HU3A 3GG1A 1VS1A 4LTSA 1OINA 2D2GA 3LPOA 3DHPA 4GHRA 3SRFA 5GJPA 3BARA 5C70A 1EJUC 1WXJA 2EQDA 4LVGA 2BFGA 3CZEA 4Z42C 3NQEA 1GGOA 2YFNA 2D3NA 2YA1A 2HK0A 1UPPA 1UWRA 4Z0JA 4TXEA 1DWFM 4DJFC 3VNJA 4CEUC 4FF5A 3WN6A 3W7KA 3GXMA 3MCMA 3WLHA 1EGMA 2WQDA 4HN4A 2FFIA 1JDCA 2NXGA 5I0DA 1T0OA 2HPMA 5IBXA 2W0UA 4LEQA 2PDKA 2Z00A 1YPFA 4KEZA 4NRSA 3SUWA 1H1ZA 1V3IA 2PDGA 1PKLA 3OPSA 4EPEC 1Q85A 5DRCA 4NASA 4X2RA 3AIVA 1JXKA 4LC6A 4AC7C 1EKOA 3SJ3A 4PRWA 3WQ5A 1MQRA 3RPMA 2ABAA 3TLLA 4Z2JA 4QJ3B 2E40A 1DEDA 1SPQA 3BW2A 1XGDA 5A8NA 4DEFA 1QPRA 4IP4A 3T07A 4E4UA 1MWOA 2EG7A 2X0YA 2G4JA 4TVUA 1MW1A 3NEHA 3WDJA 4MKSA 3WDPP 3I68A 1CBGA 2YA0A 3CYVA 2ZX6A 3VD5A 2QDEA 4Z2HA 3RLVA 1EZWA 1BRLA 2OGJA 3P5YA 2BV9A 3H7RA 1I2NA 5FOOA 3S2JA 3ZJKA 2V69A 2W63A 1HL2A 2DW6A 3N1AA 1WAUA 4DUOA 3A3WA 3K2GA 3W70A 1AL7A 8XIMA 4JKKA 1E3ZA 2GDUA 1RP8A 1UUOA 4U10A 2V6AA 1AQHA 4X9SA 2A3BA 1VFFA 2H6RA 3QV6A 4KGLA 1Q2SA 1W5NA 4EXQA 1VPQA 1O60A 1E70M 3G1AA 1S5MA 4H7VA 4DPPA 3LG3A 2GGHA 1S2TA 5LXXA 3QPZA 3TN6A 3GVGA 2FHCA 2X2GA 4BEQA 4GYPA 1DIOA 1XYAA 3BLOA 3M0IA 3IVTA 1FA2A 5LNWA 5JBDA 1TA3A 2O0TA 4FAMA 3GDKA 4JDYA 1GW1A 1PS9A 3E0LA 2VX7A 5LNUA 2OOFA 3W71A 3ARPA 1F76A 2A0NA 2WNZA 1GOKA 4OZOA 2Z1KA 3TCSA 3UJSA 2X8RA 5CZJA 4RV8A 1PZ3A 5AVHA 3F7JA 4IFKA 5DMMA 4AYSA 1E72M 3G5EA 3EWXA 3HQPA 3F4DA 3AMDA 4MWAB 1NWSA 5HUPA 4DWSB 2VZVA 3UERA 4FMVA 4CQBA 3H2AA 2VYOA 1OM0A 3RNDA 3GQYA 2GQ9A 1ICSA 3BUVA 1AMYA 4YTUA 3NQBA 3ALGA 1R47A 2J6XA 4ZXLA 3LV5A 1VYRA 4I7VA 4WLCA 4MNLA 1VFHA 4LCQA 3S6OA 5CC6A 3HG4A 1TE6A 3L12A 2BHUA 4FXJA 3KHJA 3WMCA 4B5TA 3MMWA 3UWYA 2DZAA 4GUHA 1KXQA 1O95A 3ELFA 3WD3A 3GE7A 2G96A 4Y2WA 4AIEA 3P3BA 4H9TA 1W1VA 1YDVA 3RX2A 1JPKA 1R5YA 5F4XA 1UD4A 1SZFA 1IIHA 1W3JA 3D3FA 4W88A 1HIZA 4ZGYA 8TIMA 4NNCA 1RPXA 3MWAA 2PD5A 1JIBA 3B04A 3CUGA 4HU4A 3C8NA 2OU4A 5EBUA 3TLQA 3BJTA 3TOPA 3TNOA 1KM5A 1H7WA 4NJGA 3GDTA 2J77A 3N3TA 3W85A 1HJVA 4PUNA 3U2EA 1A5AA 3W7HA 4ZE4A 1CXHA 1AH4A 2KAUC 2D3LA 3SCUA 1DWHM 3OP2A 3G1XA 4JX5A 4PUMA 5XIAA 1D3HA 1OIMA 1XYZA 3W1UA 3MA8A 4JN6A 4NJKA 3U0HA 2CBVA 2E0PA 3P8IA 4FX8A 4O50A 4W7WA 4F8XA 3TQKA 3N4EA 4NRRA 1E1CA 1UCWA 2CZEA 3UQNA 4JYFA 2VR5A 1GQLA 3DCPA 2XVGA 1XH1A 4P2VA 2PP0A 5CG7A 3FA5A 5DCDA 4XD5A 1EYWA 1J5SA 3VOJA 2NUWA 1ZBCA 3RILA 2HBXA 3DN5A 3W1PA 2C19A 1JYWA 3LOTA 1M7PA 1GOMA 1KM4A 2ZCGA 2VELA 4GNVA 3MYOA 5C8BB 2G97A 1KFJA 4JPGA 1GOQA 3FV9A 3QMTA 3UCDA 4KFPA 4CLMA 3R89A 3PBVA 1E4MM 4RZBA 1LORA 1SJDA 3DFYA 2WJFA 4MB4A 3H55A 1GNXA 1TRIA 2GYIA 4H1ZA 4O0QA 3TYAA 3NYDA 4NKCA 3PZVA 5F2GA 3F5KA 1VQTA 2C79A 1HUVA 5KZDA 5CEWA 3LQGA 2FDMA 2V82A 3V36A 3PG8A 4HU0A 1KW1A 3H2CA 1E3XA 5K7JA 3HJEA 4PBGA 2JKEA 1K8XA 3S2CA 2Z6JA 4IIHA 3R5EA 1HKJA 5M03A 4J3VA 4UTWC 1UR0A 4EPKA 3IIXA 3ZVHB 4ALDA 4LALA 3NPVA 1E6SM 3S46A 3WJZA 3DEQA 3KOZA 4DAIA 1D9EA 5L6UA 1GPWA 1ODZA 3U7BA 5A8MA 3VUSA 1PE1A 1V6XA 2V5KA 5HQMA 3A47A 4ERIA 1H50A 4PUWA 1LWHA 1VBRA 2CYGA 5TF0A 1PZ1A 2HE5A 4PEEA 4YL2A 1W56A 4H2CA 5D09A 4JHMA 3PS7A 3DFHA 1E4NA 3KCLA 1P1XA 1SFTA 3TYDA 3C6CA 4TX6A 1SSGA 3IANA 3UVIA 1HW6A 3NSXA 3ICJA 3G22A 1PHQA 4RE3A 4MG4A 1KRMA 3WK2A 4YNGA 3SRDA 2C18A 5FIPA 3AXIA 4JHOA 1KBIA 4JQAA 1OGBA 4BHYA 2Z6IA 4UQEA 3W1MA 2IQDA 1PCKA 2QJGA 4TIMA 2EKCA 3PBMA 3TYCA 2HJPA 4Y7EA 3HQNA 3BLDA 3E2SA 3WF2A 5K2ZA 4HQVA 1B4KA 1PKYA 2E5BA 2ZZ3A 4UTHA 1HP4A 2QDGA 2X0SA 3W22A 1UR3M 1B57A 2EPHA 3NQ2A 4QNEA 1VB9A 3KRUA 2QQ6A 5LYRA 1ELSA 2E68A 3W7QA 3HM7A 2NUXA 4ZSTA 4MJ2A 3BG3A 3EMCA 1Q6OA 5D2XA 4ZXOA 1M41A 4FZIA 2ISVA 1J2BA 3TH6A 2VRQA 2TRSA 3CUJA 1L6FA 5HR6A 3EAUA 4UNLA 1IZJA 4CCCA 4XD4A 3B8TA 2WSYA 2ZE3A 1EOMA 4O54A 1CEOA 1ZP3A 1Y5VA 2DUAA 2A3AA 4TVCA 2FHBA 1TPFA 4NZ5A 1FHDA 3C3UA 1TTJA 4GLEA 1HL9A 2NW0A 4A2SA 3XINA 1WDPA 4XZHA 2Y8VA 1ONWA 4GXPA 3G0UA 3G77A 4ZBCA 4E4PA 3VFLA 4Y9OA 4GGHA 1G9HA 3A4JA 2DU2A 1KFKA 3FYOA 1LUCB 3AS0A 1V51A 2XDFA 5G2WA 3RAOA 4UCFA 2CXGA 1A3XA 1UOKA 4WZHA 4LEFA 1WQ5A 4UQDA 4TU1A 1H0IA 2VT0A 5A6JA 3AMKA 3S9IA 3HG3A 4MY1A 1TPB1 3DBNA 4HA0A 8XIAA 2J27A 3WFLA 4YMZA 2WJZA 1UBSA 2QCLA 3UYIA 3ABSA 3FEQA 3C2FA 1XS2A 1D7FA 2XH7A 2YZ5A 5A6BD 2OEMA 4JL1A 4LBRA 1JF5A 3LXBA 3CHVA 1KGUA 3MMDA 3U4AA 3VILA 3EEZA 3T4CA 2TAAA 4N2YA 4X2PA 3SEPA 3KTSA 3APYA 4HA3A 5ECUA 1MQQA 1TTPA 2OMAA 1NM9A 2DT1A 1SZEA 1LCOA 3TEVA 3PZGA 4MLRA 2D1ZA 4I6VA 2FYMA 1ME7A 3R10A 2BMBA 1UPMB 3OVQA 4QS6A 4XD3A 3MS8A 1XRVA 5EMMA 3W25A 3CIWA 1US2A 3GHUA 1CDGA 3AROA 5J8LA 3H7UA 1RALA 1MRAA 4EPBC 1D3CA 4D71A 4UOQA 3EOEA 1G1YA 3N73A 4O4WA 3FDKA 4OUIA 1V3JA 1BVWA 3ABQA 4JY9A 5K4ZA 4LF2A 3ISIX 4OE7A 4LQ1A 2VX4A 4O16A 5HJYA 5I00A 2HBVA 2EBNA 4Q6JA 2HV5A 1N7KA 2XU2A 2X1RA 1VZWA 2J8GA 4IJCA 3QHMA 1KFEA 3R25A 3BLLA 4IMGA 5E0CA 3GG8A 1W1IE 4R34A 3WJXA 2FKPA 1DIEA 4DHGA 1DJYA 3FNDA 2PLKA 3H2MA 3WK1A 4O12A 3WLTA 3UZJA 1A3HA 1BFNA 4PH6A 1N2VA 4HA4A 2XSXA 4Q4KA 2J7CA 4YYFA 1TJ0A 4P7NA 4QFUA 2EF9A 1MXSA 3SFKA 3WMBA 3I65A 2VZSA 3GLCA 3ARZA 4DJEC 3UJRA 4W86A 5AKQA 1JDFA 4K38A 1UZHA 1PVNA 3W27A 3W72A 1FH8A 2AAAA 1KFWA 4BR1A 1X7FA 3WENA 1Q6RA 1BYDA 3NL3A 2FGZA 2ZUUA 3UA4A 1XIEA 3WLJA 5I6SA 1F8MA 2IMRA 4I5XA 4RX0A 4GFIA 3CZGA 5A6AA 4DJEA 2I57A 1VBUA 4DUVA 3U57A 4A2RA 3TU9A 1XINA 4XZBA 1GOOA 1QW8A 3NR0A 3SQMA 2BVTA 3N9SA 2ZBTA 1XV8A 2VL4A 3S47A 3CK5A 5AOUA 4HZ7A 7CGTA 4C1NB 2VFFA 4N7QA 3ZSTA 4JDBA 2ADAA 4BFAA 4W7UA 2OSYA 1VBHA 3GHSA 3TNBA 2QCNA 4ROPA 3N2MA 1JPHA 4QISA 1ZRQA 4H6RA 3P84A 1GZGA 2PLJA 4GWEA 2DV0A 1JQXA 1F9CA 1KFLA 4MWAE 2XN1A 2E9BA 1VIZA 2YCKX 1EDGA 4UTWA 3KBSA 3B03A 5TNVA 4AZIA 1S2CA 4OOZA 4O0ZA 4O1AA 3TP4A 1AG1O 5D33A 1BSIA 1D7KA 2REQB 2G37A 2OZ8A 5CCZA 1K7EA 3TJXA 4MJ4A 1H1YA 1WKDA 3LXAA 5JXQA 3ZS4A 2VGGA 4C7GA 3UR2A 2Y89A 5D2WA 1F74A 2JE8A 1ZJAA 2NX9A 4CD8A 5KSWA 5AY7A 3TK7A 1H7OA 2G3FA 2PLMA 4M7SA 1G67A 3CWNA 2OWXA 3CIXA 4GVHA 4FP1A 4BI6A 4MVAA 2ZA1A 4INFA 2G3MA 1Q7MA 5M2FX 4DIAA 4X60A 4AIUA 3VIFA 2DH2A 1E5NA 3COTA 4MF4A 2WMKA 2VP8A 3D5HA 4Q7NA 1I45A 2RAGA 4U2YA 3LYEA 1QI5A 3MBDA 3TTEA 2ONEA 3R1ZA 1AW5A 1QHZA 2CLFA 2PD9A 3E02A 4R9OA 1X1NA 1BTCA 4QCEA 3STPA 3B97A 1PTDA 2QZRA 3PTQA 1ITXA 1CGYA 1RUSA 4M29A 2OWWA 3I3BA 1QOQA 4QEHA 4V33A 1JPIA 2E5DA 3FSTA 4H6KA 1E6NA 4QITA 1ZJHA 3NDOA 3SCTA 5JBFA 1J96A 1HQTA 2OZTA 1TO3A 1G6CA 1FWGC 4JNMA 3IWPA 1W1PA 2OVLA 4WXZA 4C6BA 3B9DA 2Q8ZA 3LM7A 1R3RA 2BXVA 4MJZA 2ODOA 4XG1A 1EQCA 4PL1A 5BROA 1CZ1A 2YL9A 4I5UA 3PSWA 2UY2A 2YYUA 1GT8A 1OG0A 4Z17A 4HSOA 5B7YA 1ECQA 3NO1A 4D6JA 3NSNA 4X9YA 3E5PA 1U33A 3OBEA 3TN5A 1LLWA 3BLPX 4YHGA 1R9ZA 5K9XA 3VX0A 5C2XA 1YDNA 1JPMA 3M0JA 4DNMA 4DBUA 4TTGA 2F6UA 4ES4A 4CKQA 3DKJA 5JIPA 1UWAA 3UETA 5F1VA 3HURA 1XLBA 1V6YA 3H7VA 1QASA 4D6EA 5M17A 3W2JA 1TFVA 2WHJA 4PSPA 4PB5A 3KE0A 1UWIA 2YX0A 1OJXA 1UUMA 2PGRA 1BPLB 1QMLA 4TMBA 3EB2A 3HMCA 2GVGA 9RUBA 1I9CB 1H51A 3W1AA 4KRZA 1ADSA 3WDQA 4U3AA 3SRHA 4F79A 3PAJA 3WD2A 3G6MA 1UP3A 1OFQA 3ERPA 2WMIA 3Q65A 5GJMA 2ZUTA 1WXZA 2W92A 1QR7A 1EGZA 4MAZA 1ZS2A 4A21A 7TAAA 3UY8A 3BMVA 3TQPA 4WDWA 3GC2A 2PDXA 1H63A 2WZIA 3CT2A 4AWEA 4GIYA 5CXPA 1OQFA 2R82A 3U4FA 1P4CA 3GAKA 4MY8A 2O9TA 1EX1A 1HNYA 4G7EB 2NT0A 3KBNA 2ZZ2A 1H5VA 2BASA 4N0RA 1IXPA 1I0DA 1IEQA 1TJRA 2YW4A 3P61A 4L80A 3B8WA 5AYXA 3IRSA 3GDBA 1OWQA 3IJ8A 3C0QA 1XIJA 1R3WA 5C5YA 4B5VA 1SZGA 4IPJA 4AWUA 1QJWA 1US0A 2PFHA 1UJQA 3VDBA 1PB0A 1OFBA 3NO5A 3DYMA 2IKHA 4Y9NA 5C9RA 1BKHA 2F9RA 1A5CA 3O05A 4PRTA 1Z69A 3KBVA 1EXPA 2P1FA 1P6CA 2V2DA 2BODX 1R3QA 3M5ZA 3VNIA 1GW9A 3B4YA 4UFIA 5CJMA 1W5MA 3UP8A 3WSUA 3ZWTA 2DZPA 3CB3A 3SGUA 2J4GA 4OV4A 1UA7A 5A6MA 1MRQA 3CL6A 3QMSA 4O1FA 1TUXA 3QR0A 4Q8MA 4UFLA 3C3NA 2ZUSA 3PN8A 1JRBA 4Q3MA 3W7OA 4E2OA 2PGFA 4LB4A 4JIPA 3ZLHA 4AG0A 2V68A 3BVJA 5E6YA 3UWWA 3LD5A 4ZMGA 3RMJA 1FWTA 4Q33A 1W3IA 5HXMA 2WW5A 1KNWA 1B3OA 3PTKA 4IOTA 3NGJA 1R9XA 3QMRA 1GVFA 2DSVA 5D2TA 4DO5A 2GUYA 1V3LA 3OBKA 4GABA 3ZJ6A 1JCXA 5DXXA 1KO0A 1P7TB 3BOXA 3ANUA 1TZ7A 1QI0A 2CNCA 3M5VA 2BY0A 2OELA 2Z24A 2WLZA 3G8RA 3REQA 3M0ZA 4ASTA 3W1TA 3WH5A 4JTJA 1X1OA 1BF2A 1XLGA 4KW2A 5G5IA 2CW6A 2VHLA 1KQZA 2OX1A 3AISA 3M47A 3YPIA 3EB4A 1F2JA 4EE9A 1XBYA 2GGJA 3QFEA 2PTYA 1EP2A 1GKQA 3KOXA 4CNOA 5IFPA 4NXSA 3LPFA 4U28A 1NFPA 4F2BA 2WKLA 3GNDA 5CZSA 1HJXA 4HCHA 2J66A 1OYBA 4A8LA 3QH2A 2YCJA 3PY2A 4H9YA 2FZMA 5D04C 1CW2A 3UXKA 2CWNA 4TVDA 3W82A 3SZ8A 3P0WA 1TQXA 4XZIA 3PBYA 1E55A 3OQEA 5TAOA 4Q8OA 4Z1DA 1PTAA 4L7ZA 2QDDA 2WQPA 4UTUA 3LY0A 5JQ9A 3PULA 3ES8A 3KLKA 3AXKA 2XGBA 1EWDA 5A3HA 1CGWA 5CG0A 1JVNA 2QULA 2DJLA 3A22A 1TCMA 2QUMA 3VNZA 1Y7VA 5HANA 1H41A 3BL3A 1SFSA 4MB1A 3T81A 2ZC8A 3FSUA 1P5BA 5KZMA 1SW0A 4DBSA 3AU2A 3B9EA 4WJEA 4DBWA 1XM3A 2PP3A 3RUBL 1TTQA 5KITA 4H9VA 2R6OA 1VKFA 2WO5A 2XFRA 3EWZA 3NPWA 1XFBA 2ZX8A 2ZKMX 3QV9A 2GJXB 1BYCA 1KWGA 4KETA 4BK9A 4PA8A 3H22A 4CVWA 3EOLA 5C2GA 3GW3A 4JYDA 2YYTA 3OJGA 1V77A 2DPEA 2EKGA 3Q37A 4BEUA 1B3YA 1TPC1 3LEPA 4DZAA 1NH6A 1FWRA 2I7GA 4M5PA 4ZZ9A 1JNEA 4DRSA 3VDCA 3LB0A 3CV1A 2BG5A 4LSBA 4KEMA 7REQB 1ESWA 1I2PA 4QE4A 4IP7A 4FNSA 4MB5A 2X7VA 4GX9A 1CXLA 3GFZA 2BOEX 4QP0A 4K3ZA 5CBBA 3I7SA 1B3VA 1TWSA 4FNUA 3AHVA 3MYPA 1O12A 4GGBA 1GVOA 2FGLA 3QY6A 1LG1A 1UIPA 2BS9A 2V5CA 3SN4A 5D32A 3NPXA 3IGHX 1OBAA 1UC5A 2X05A 5T9CE 2DY3A 4RXGA 1VLIA 3K8MA 1WUEA 4HA1A 4WD0A 3LGGA 4QBXA 4GINA 4R53A 5FJOA 3QZEA 4F2TA 5CPSA 1RJPA 4KH2A 3NG3A 5CC7A 1SZRA 2ZFAA 4XAYA 2FTWA 4GUFA 4L6HA 5D02A 4FNRA 3WQ8A 4RPPA 3USBA 4ZQPA 1ZTVA 3F4CA 2DT2A 4WOQA 3N11A 4KWVA 2HVOA 3WH8A 4UTKA 1BWKA 4UZUA 1SR9A 2Y63A 3FAXA 3CMFA 1Q45A 3F5JA 4GH3A 4Z1CA 1JNDA 3EWYA 1Z89A 1BVNP 3A12A 4G9PA 1XLFA 3TR9A 4QHRA 3H4GA 4NY2A 5T8GA 3A23A 1EF3A 1RPKA 4L9XA 2G8ZA 3GYEA 5EFFA 3UWZA 3AALA 4LNCA 3PJUA 1GWJA 3OW1A 3WMSA 4PMXA 5AHMA 3QFWA 3BOFA 1EPXA 4H04A 5LGXA 3WLLA 4RUBA 4O1CA 3RO8A 3CT7A 1T8XA 5KMYA 2QNEA 4AY8A 1NJJA 2ALDA 3W83A 1U1HA 2RFGA 5I3IA 4S3KA 4XAFA 4PR4A 4P5UA 4BZYA 1X96A 1JEZA 3HO8A 1Y5XA 4QLKA 3ME3A 1QPKA 4U5KA 4DJFA 1MXGA 5GVJA 4LYRA 3VD9A 1XPYA 3NA8A 3M0VA 1EHNA 1J0ZA 3W1RA 5DMNA 1G7UA 4QRNA 1VRDA 5CKSA 1P0KA 2NXIA 3H2OA 3UFYA 4IMCA 3NO3A 1S39A 2V81A 3KL3A 4OFCA 3IVSA 4UR8A 2W79A 1G4PA 2DQXA 3OLEA 3SY5A 3BCJA 4FK9A 4PULA 2B7PA 3UWVA 1B54A 4BF7A 4PSRA 1VJZA 1I2QA 4YJ5A 2Z0IA 3SGGA 5SWUA 2BTMA 1XIGA 3N04A 4H9UA 4JKLA 3L0GA 1ENUA 5CPOA 4MSSA 2YCLA 3POCA 1HJWA 3CZKA 3CQ0A 3KOYA 1NP0A 3UGVA 3V7PA 4B4HA 2JIWA 3DXIA 4S3FA 4A35A 2Z2BA 3POHA 4BQ2A 3MSGA 1UD3A 3A4WA 3IACA 4LAZA 1JAKA 3DIPA 3T55A 5FEZA 4MWAC 3WD1A 1GQNA 3JU2A 1R8LA 4GZJA 2DVXA 5E0KA 4F0KA 3FYPA 3EEGA 1E6ZA 3QQWA 2Q8LA 4MIMA 2WSPA 4U4MA 2GWNA 2OKTA 2CZDA 2PZNA 1AH0A 1DJZA 3VYLA 1O68A 4C1NA 2AGTA 3MHUA 2Z7KA 4CQ8A 1JZ6A 2WMGA 3JVAA 3KBMA 1VP5A 1KM2A 1I6NA 2XN0A 3VZYA 3ZOAA 4LVBA 1XUZA 3C2OA 5A2AA 2V38A 2PA6A 4S3JA 3GU2A 3PBWA 3OGRA 4B4FA 1DIDA 3VAVA 3A24A 1JYXA 3VDHA 3GDMA 5AVNA 1FDZA 4MKVA 3OTRA 2Q6ZA 3VK5A 1T96A 4IIDA 2VEMA 3K5XA 1QI3A 1IEVA 5F2MA 2CLEA 5ABGA 3OG3A 2YXXA 2VC7A 4JL2A 3BGGA 2YXGA 2J88A 3DC0A 2G3NA 4R9XA 1G4EA 3TJIA 3A21A 2V5DA 2XVNA 3AJXA 1KR1A 3KS5A 3N4FA 5BOFA 4BI5A 3TWAA 1RCOB 3PPGA 1G5AA 4AMAA 3GG7A 3Q45A 3GH4A 4PCNA 3MI3A 4FNQA 1R38A 4YLWA 2PDYA 3WNKA 4RE2A 4O0KA 3AIUA 3QHNA 2FPTA 4QSHA 4AH7A 3UR5A 3ONCA 4Q4SA 2P50A 3PVFA 2EPNA 3U8GA 5I09A 4OHQA 1KM1A 3HPAA 3U2ZA 1F07A 5FA5A 2OSWA 3GAYA 1GEQA 1DVJA 2Y6ZA 2W3ZA 4AC1X 1W1B1 3L21A 3DKLA 3GY1A 2ZVIA 2D24A 4XAZA 4NJHA 4PMZA 3S1VA 4P8WA 3CUHA 2ON3A 1EP3A 3AHYA 4WSJA 1A5MC 3IAQA 4GI6A 3SCOA 3KBWA 4UFHA 4E2VA 3GTXA 5D9NA 4LUYA 3C2YA 5H6HA 1L0PA 1R9YA 2WCSA 4HN8A 4JOMA 1XSJA 2DZVA 1R3TA 4IXXA 1DV7A 3CLMA 1DWGM 4MAVA 2AMXA 4MPKA 2Y61A 3W26A 4ADSA 3S1GA 3GTNA 5G4HC 3MANA 3TOYA 2FB3A 3BK0A 4JQ4A 3ITYA 3S2LA 3CL8A 4Q8VA 2R14A 5I23A 2A3HA 1QNSA 2XVLA 3T40A 3V0SA 1EX5A 5CAKA 2PRMA 3PPHA 4HU8A 2R1PA 1VYPX 4GCXA 3NSMA 3R8GA 3AICA 3C0SA 4PB4A 2FHFA 3O6DA 1OCNA 1FWJC 2E5CA 3F2BA 4FR6A 4PZVA 4C6FA 4C7DA 4WOZA 3WNMA 1OK6A 3BCDA 3PUDA 1ISXA 1OC5A 1REQB 4CU8A 3M0LA 5ABHA 4EF8A 4AZCA 2XFWA 4LXFA 4UQAA 4W9TA 1JCJA 2ICSA 4Q8QA 2GPTA 3ONBA 1KR0A 3TYEA 3FGCA 3EDDA 4NI8A 1N55A 2A85A 3SCSA 4X0VA 2Y5SA 3MMTA 3H24A 4RLIA 4AYGA 2PTDA 3WD0A 3BC9A 4ZL1A 3NFUA 4PMJA 1P0DA 2DZTA 4KWUA 1PYFA 3TE9A 5D9PA 4JNYA 1XLAA 2WM0A 1FCBA 3MP4A 5LA0A 5ABFA 5BU6A 4G56A 4QR6A 1B1YA 4QS5A 5LIYX 1O5XA 3AU6A 2WHKA 3ZVHA 2QKFA 2XWDA 2VGIA 4GCAA 4BCEA 2NWRA 2OEKA 3BDKA 3BLFA 2POTA 1MO0A 4BJHA 4MJMA 1Q66A 1QW7A 3NXFA 1RV8A 3WYZA 3W6YA 1K9FA 3TTOA 2PWFA 8A3HA 2DZXA 1H3GA 4FO4A 2J47A 1JYVA 5KZ6A 4C6LA 3UZZA 4GKTA 4IQLA 4FLQA 1I4NA 2VOTA 2ZDRA 5T26A 1XG3A 4I9TA 2DIJA 2ZIDA 2E7FA 4NJJA 4QDWA 1DBTA 1F3TA 5GQBA 5A2CA 3DBPA 2OQLA 3S5OA 3VGHA 2OX4A 2WVUA 4FIRA 5FSEC 2ZZ6A 1GPFA 2PCQA 1CECA 5HBFA 4W84A 4XVEA 1CLVA 3RN6A 2BY1A 3WD4A 1K8YA 3UZYA 2Z26A 2O4QA 2F2HA 1CENA 3EX4A 2FDSA 3FJ4A 3VMOA 3M07A 3HQ1A 1NFGA 1EC8A 2EHHA 2PWEA 4WUIA 3ZR6A 3OLGA 3T08A 1HF6A 4GZIA 5K9DA 1T5AA 3MCNA 1ZBWA 5EMLA 2OGYA 5MF5A 3M64A 1GJPA 3DFNA 2OEJA 5LIWX 3NL5A 4RE0A 2I5GA 2ZVRA 4UQBA 3LNMA 1GOWA 3U5UA 5F1UA 1MVYA 2P8BA 3CZJA 3NTYA 1TPWA 2C0AA 1Q6GA 3T44A 1DJWA 3ALFA 3PZMA 4XD6A 3BXWA 2ZX7A 4ERGA 1U1UA 5LIXX 4P7LA 4YYCA 4D6FA 2E8YA 4HMCA 3WLIA 3ZLFA 3O6YX 2C7FA 4YPJA 3QOKA 1GZJA 4HMNA 1LRNA 1JDAA 3WKZA 4LCSA 2WOQA 3NURA 4US5D 5C54A 4LAOA 3WQDA 3FHQA 2VFEA 1V6VA 4N6FA 2VWTA 4BQ3A 3WNLA 2ZICA 5XINA 2W5FA 1J9YA 3WF0A 3LCWA 2D20A 5H91A 4FA3A 3WH6A 3O15A 4OBTA 1LQ2A 3UEQA 4K1WA 2NZLA 3L66A 4MFEA 3TA9A 1EEXA 2VQUA 3WNPA 3EKGA 1POJA 4A29A 4EX4A 2IS7A 2B7OA 2FLIA 2G3JA 2W9MA 3WNNA 4GZEA 4Z1AA 1XD0A 4D6HA 2AL2B 2ASHA 2PGEA 4K6AA 1WA3A 1FKWA 2WXDM 2YLAA 1E9ZB 2VEFA 2A3CA 3W1LA 4ATLA 3WIJA 1YW1A 5HUOA 4K2SA 5DRIA 1Z41A 1BAGA 1BXNA 1WKYA 3AOFA 1ZU8A 1ITUA 4GI4A 3BSMA 2P3EA 3IJIA 5LHFA 3NQ8A 3WEOA 1R85A 4HJWA 1YPXA 4GPNA 3A6OA 4DBDA 1UP0A 2V63A 3E38A 3NUKA 4OV9A 1I60A 4JX4A 4MGGA 1SUXA 4PTNA 1ISZA 1W3KA 3UJEA 3LS9A 3OIHA 4AD2A 1FCQA 3FLUA 1YNYA 3URQA 5HWJA 3FAWA 4M80A 2PWDA 1Q7ZA 2BP1A 4D1IA 3VMPA 1DQXA 2V3GA 1WAWA 5D8ZA 2A4AA 2GWGA 4PB3A 4QAIA 3OO2A 4C6DA 1GQKA 1XLHA 4NSBA 3U2OA 5FJJA 1JYNA 5C7VA 3VINA 2WB5A 1TYGA 4BWLA 1KTBA 3OA3A 4IT1A 4DM2A 2HWGA 1K77A 3APGA 4DZHA 3H12A 4R7WA 4TUFA 2ABBA 2BVYA 5H1WA 1LL6A 3GVVA 1X8CA 2QXWA 4BF5A 1Q8JA 1V0LA 3STCA 4CN4A 1WZMA 4XO7A 3QJAA 2VKZG 3PJWA 2YJQA 1CB2A 3PZUA 1BG4A 4UTJA 7ODCA 3WBYA 3GZAA 1BHGA 4RV3A 4LUJA 1IYXA 3J7HA 1UZ4A 3LBMA 4XAGA 2GSHA 3H8AA 2Y70A 2WVVB 1SFLA 2DP3A 5G2IA 3GFXA 1OC6A 2BNJA 1EYEA 4N9DA 2X1SA 4IG2A 1R3YA 2X7WA 2OOGA 3HTWA 1JF6A 5H8MA 1NDWA 4IH3A 4WXYA 4YHEA 3RU8X 4LB3A 1T6MA 2YBTA 1CNVA 2Z7GA 4NL1A 2WKJA 4HK5A 4OJYA 4DUWA 2VI0A 1OFAA 3LENA 3UXAA 4JTEA 3HBLA 1Q6CA 2NXHA 3AJ7A 4EPDC 4ATWA 4L6OA 1K9EA 4RNFA 4HIBA 1BSLA 1EHAA 4HT3A 1U5VA 2VWSA 3TTQA 3UXIA 3QW4B 4Y90A 3ITXA 4FPSA 3W87A 1I1WA 2Z1SA 1JZ2A 3VX1A 4UTLA 2QCCA 1KC7A 4WVXA 3F4VA 1IZCA 1VRXA 3QN3A 4ZQOA 1ZALA 3VABA 4PMNA 3E0IA 1ZP4A 3VGDA 3SRKA 3CV2A 5I3GA 3UR8A 4NHVA 4XZLX 5MKGB 3C2EA 4GOAA 4KT2A 1NELA 5D9OA 3T0BA 3R58A 5JU6A 1FVPA 3A64A 4JEJA 1S2VA 4OKDA 3LM3A 4CNSA 3CV6A 3QV8A 2NQJA 3CPGA 3EWDA 4NYUA 3W84A 1SSDA 3GNPA 4ZO8A 4BY3A 2YCIX 4L1GA 4AQLA 1FXPA 3ABRA 3C61A 3NDZA 1FCUA 4AZGA 3IJ7A 4IX0A 2PDNA 3MI2A 1OABA 3ITCA 3H4XA 3KZPA 3FJLA 2DJXA 2ZDSA 1BLIA 4IM4A 4QG9A 3TONA 5BXTA 4AD1A 3EA1A 2QLYA 3KEHA 2CWXA 2VGFA 3CQIA 3L4ZA 4DVOA 3W7DA 1A5UA 2W91A 3TDFA 3BW3A 2FZNA 2BZNA 4Q4RA 1FWNA 1B3WA 4R5EA 4LS1A 2WVTA 4FHAA 1PCWA 3T42A 1H1NA 5I3JA 4GI8A 1WDWA 2P0IA 4J3TA 2W27A 1AW2A 4X61A 1EF2A 4MKNA 2BOGX 1FH7A 4IXHA 4K7YA 4JFSA 1UMLA 1CX9A 1E6RA 1Z7AA 3VGBA 1YIXA 5FF0A 1KCZA 4AEFA 5KINA 3W1QA 1JJKA 2CKSA 4S3CA 3PNUA 1J0YA 4IHCA 3QSTA 3NZRA 3UWUA 1HKKA 1EO7A 3LN3A 1IWBA 2YCLB 3MI6A 2C1GA 2P0OA 1LQ0A 4ZCWA 1KLZA 3DX5A 3T4WA 3TSDA 3C2RA 4Y6GA 2V3FA 5LKYA 2FIQA 1AL8A 3IK4A 4EAMA 5AB3A 1J6PA 3DG7A 1TSIA 1F4HA 4XBKA 5EU9A 4AFYA 1W32A 1NEYA 3MUZ1 1XW8A 3FY1A 1VH7A 1UMYA 1UR1A 2VD8A 1WZAA 2ZRVA 3VGFA 1PX3A 4GISA 3MWCA 1MQPA 4G8TA 1ZBVA 1EP1A 4ZOAA 1IGWA 4WSHA 2WSQA 1V3MA 2RJGA 1MUWA 4FEZA 2OTDA 3T1GA 3FK4A 4NNAA 2IKJA 3BW4A 2I14A 1XC6A 3HG5A 1OYCA 1P1MA 1ME8A 4IIFA 3MHFA 4G7FA 1UR8A 1GOXA 4F40A 3C56A 2Y8KA 1RK6A 4P7QA 3PC0A 2QEZA 2INFA 4J35A 4BF9A 2Q8XA 3W2NA 2ZXAA 1SJBA 2IQTA 1T41A 4QSFA 4LFYA 3HZ3A 3PUGA 1LG2A 1NF0A 4RR4A 2XFFA 2X0HA 1XRSA 1Z3NA 2I9UA 4PMOA 3H21A 2EAWA 5CH9A 5LZLA 4HYRA 4L4MA 1WYIA 3GKAA 4HOXA 1OEPA 3NPUA 4UQCA 3JUGA 3SUUA 1XLCA 2VM8A 3S5YA 1OCQA 4ZA0A 7TIMA 1X7IA 4LY4A 3IJDA 1UP2A 4GD0A 3NQGA 1GKPA 3RX3A 2CITA 3W37A 4Q22A 2JQXA 1XIFA 1ITQA 2WJDA 4IMFA 4CQDA 4ICMA 4GG9A 5DCEA 3BAKA 1W5OA 4I9JA 3S2MA 4PN2A 4O17A 3LGDA 2QGHA 2V3DA 4MZ8A 2FB2A 3G1YA 4AVOA 5HNTA 3BTNA 4IJRA 3FYYA 4FB7A 1ITCA 1NWRA 5ABEA 2V5BA 1VFMA 4M56A 4C6EA 1UKPA 1AH3A 3RJXA 4HJFA 1OFOA 1GONA 1XF0A 2G3IA 3LI1A 1F3XA 2JGYA 3GR7A 4RW3A 4LNYA 3C86A 2PURA 4UMBA 2EJAA 3B0PA 3WLNA 2ZZ5A 3BCFA 4C6KA 4EF9A 1C8QA 1ONRA 2GJRA 4Z1YA 4GUIA 1EJWC 3S4TA 1UKQA 1MYRA 1XDMA 3TW6A 3QGKC 4S3DA 2FVMA 1UA3A 3EGJA 5U4NA 4XZMX 1JFHA 4HSNA 1KV8A 2XG9A 1ZB5A 4ZB0A 2GGIA 2WHLA 3UPBA 1V02E 1KM0A 4IPPA 5EA9A 3G6LA 1FHLA 3T2OA 4S3BA 2HXUA 5DCBA 1M7OA 2PWVA 2OZ0A 2PBOA 1FWFC 5ABFB 3ARXA 3WFAA 4KF1A 3WF3A 4W7VA 3QF0A 4FXRA 2YFOA 1LP6A 4DF1A 2OZ3A 1TV2A 1XRFA 2V3EA 1CGXA 1NFBA 2Z27A 3KCOA 2J7DA 2O92A 1ZAJA 2HVMA 1EJVC 5A94A 4IZGA 3DESA 2GQ8A 2D73A 3A9IA 1WBJA 3FKKA 4JTTA 3SCQA 3IJ9A 3EDEA 4HNCA 1ZCCA 3WQCA 1JZ3A 3MUAA 1DPMA 2JIEA 1GORA 2ZRWA 3STFA 4YCPA 3TQVA 2WJEA 4N6EA 4GUGA 4WDTA 4M6QA 4YVXA 4WY0A 3TMLA 3WBAA 4GYJA 2WBKA 3B0VC 2C3ZA 3DFPA 3MUY1 2PDWA 1SO5A 2QCGA 4ZSUA 2QJMA 3LNPA 5M3WA 1PTGA 4RDZA 4TQTA 3DGBA 2X1TA 3CYJA 3KWXA 4NVTA 2HS6A 3HA1A 3EB3A 1LWJA 5I2UA 1MZRA 3R12A 1OF8A 3H6OA 3NJ3A 3TN3A 1S46A 3KHDA 2Y7EA 3OLDA 1NOUA 5LHEA 3TYZA 4GE8A 3C2VA 3O3RA 3TCEA 3LRKA 2YW3A 1DTNA 1TX2A 1AMKA 1TWIA 5CAHA 4DZIA 2J8FA 4I7WA 4ADTA 2FFCA 4KERA 3CO4A 1RA5A 1YTDA 4JCMA 1PO9A 1UKSA 3P8JA 1SJAA 2GVLA 3GDLA 2VCCA 4MUZA 1XLLA 5CC3A 1V02A 2ZWYA 1KCKA 2C71A 1D3GA 2A21A 1J93A 1W1A1 1J2WA 2ATMA 4CD5A 1P0BA 1W9XA 2QR6A 4JY8A 3L5AA 4HKPA 4MMWA 2DFAA 1XHGA 1EIXA 1F3EA 3I3DA 2VZUA 1IQ8A 3O63A 3KL0A 3ABOA 4PTXA 3OVPA 1T40A 3WJSA 2HZGA 1ZJBA 1M7XA 3WFZA 4MNJA 2Z29A 3PM6A 4YVPA 5B80A 2YBUA 4O28A 3H2FA 1OZQA 4J28A 3QC3A 3GIQA 4B5WA 1VGAA 3II1A 5D38A 2QJJA 1RCXB 2BB0A 2VZOA 4RKAA 3V3WA 4NP7A 4GUJA 2DW7A 3IIVA 3VFCA 3P6LA 4PTVA 1I2OA 3QTPA 5LNRA 2JF7A 5FI8A 3GG0A 2IPGA 1LM1A 4H01A 1G94A 3VCRA 4S23A 3QLLA 1BQCA 4YU1A 3H2NA 3AHTA 2DUZA 1VPYA 1RR2A 2WMHA 2C1HA 1TMLA 3I7RA 4IMAA 5A95A 3UT0A 4IJBA 4PE8A 3N14A 1RBLA 3WMLA 1BEUA 4JFVA 4UNKA 3N4AA 4WKAA 1KRBC 3T8QA 4U5IA 4I90A 3GNNA 3USZA 4ZVJA 1E6QM 1DJIA 1EA9C 2OYLA 4Q8NA 1TIMA 4GK8A 1BD0A 1XBXA 3WUEA 4WKHA 1C29A 3GU1A 4KGJA 2JGQA 4PCTA 2WNWA 5CSSA 5E6ZA 3OU8A 3VIJA 1W0MA 1S38A 1G4SA 3VOCA 3S5NA 1QRQA 3MQTA 2PS2A 3LMYA 3M0MA 3W01A 4DM1A 3M5XA 1JAEA 4XZWA 2Y5JA 4CQCA 1YQ2A 2QAPA 3AO0A 4A3UA 3IAPA 3W07A 1AFSA 3IARA 1PWLA 2DT0A 2P5NA 2WMIB 4DWSA 4JN7A 2GUUA 3ARQA 3WO8A 2DVTA 4U3CA 4XX6A 3AS3A 4AB4A 1VFUA 3CAQA 2V30A 3PF3A 3H26A 1UR2A 3G1RA 1FHVA 1YPIA 1C9DA 2ATSA 4XVDA 3NQVA 1R86A 4JCLA 4MADA 3TWBA 1OT1A 3GYCA 3KZSA 3C4UA 1UROA 1EEPA 1GYNA 1KLYA 1XICA 2G5WA 3QW3A 4NX5A 4A22A 4PUKA 4XKYA 1LRTA 3T0AA 2JBMA 4JX6A 1CLXA 3LPPA 4N9BA 3RMEA 1AW1A 3O06A 1TV3A 4AVNA 2JF6A 3E0VA 2VNCA 2BWGA 3RO6A 3P82A 1TWDA 3SDOA 3VC5A 3VCCA 1VBJA 1QBAA 4E5TA 4HK7A 3BMWA 3R8HA 3N15A 4REQA 3VNMA 2QUVA 3G0XA 2BVDA 3T2QA 3FA4A 1WXYA 1R0MA 2EG8A 2X42A 1TTIA 3W75A 4LU0A 3ZZ1A 4HOWA 1D8CA 2FQIA 3GHRA 4WF7A 2QF8A 4Y8FA 1RY0A 2NSOA 2WCAA 3UA3A 2GOKA 1LT7A 2YDRA 3PSVA 3DU0A 2ZXBA 5C6MA 3PR2A 9XIMA 1K4GA 1TV5A 1Q63A 1H7PA 1KCLA 4MUPA 1EJRC 4A3RA 4LX4A 1GK8A 3XIMA 3LLXA 2C13A 4PGLA 3ANVA 3L2LA 4V1XA 5BW6A 1IR1A 1PIGA 2WBGA 2ACSA 2XH0A 5M1TA 1PDYA 4FR1A 4GY0A 4WKFA 1E15A 2PB1A 5CBIA 2PTWA 1W1TA 4ZODA 2TMDA 3HGJA 3NAVA 2FPYA 5LSMA 3C0LA 4ML9A 3T6CA 4ZQNA 5DQPA 4QG6A 1AQ0A 2ISWA 4I3GA 1DE5A 3VD4A 1PWMA 2NQHA 1G7VA 3RM9A 2Z25A 1JL8A 2O7QA 4JTAA 3L9CA 3FJNA 3WLOA 3O16A 3CQJA 1GHRA 4KRUA 4CD7A 1QAPA 4KRTA 2RKXA 4Y9MA 3TQ0A 1GVYA 4CNUA 3IEBA 1XIBA 3AFBA 1KBBA 5KZEA 4LRTA 4XTIA 3G1DA 1A49A 5DX7A 4IIEA 3OEXA 3W6LA 1M7JA 3OQ8A 1J0IA 3EA3A 2FPVA 4Q6XA 3V1PA 3NM1A 2Y0FA 1KFBA 1V6UA 1WB0A 1SU5A 4S3GA 1Q6DA 2XGIA 2OLSA 1NVMA 4J3WA 1VFSA 4HGXA 5EMJA 5I06A 3AMCA 3UXLA 3NOEA 2F2KA 5AECA 1X6NA 2TSYA 3S1XA 2WPGA 3BH4A 4HNTA 4UUIA 5HMSA 1V0MA 3CASA 4CD4A 5F7UA 1YBQB 4J3XA 5F4SA 3LZ3A 3IPWA 1P7TA 1HVQA 3MDWA 3ITLA 1DXIA 1QVBA 1TG7A 2D2JA 1HJUA 2G0WA 3GC4A 4H3DA 3V0UA 3WZ0E 1YADA 2J7FA 3EX3A 4LUTA 3ZLGA 1TELA 1J8VA 3QRHA 3DFTA 3VM5A 3VOGA 3NQDA 1BKSA 3B9OA 3DHDA 3V5CA 1R3SA 1KGXA 1HTIA 3P74A 5A8QA 3E74A 1QOXA 4ZO7A 4HSHA 3URNA 1BXBA 5AC4A 1B2YA 4O1EA 2X2YA 4PUDA 2A7RA 1WZLA 2DSKA 3FIGA 3ITTA 4HK6A 1P6WA 5EGRA 5DT7A 4Z2IA 1CXKA 2E25A 2I5IA 4LANA 4FLOA 2UBPC 1C93A 3ARRA 2CEQA 5AYIA 5CPNA 1W8SA 3N25A 4K68A 1WNOA 1P0EA 2WNQA 1IT8A 3GFYA 2BBFA 4K8GA 1JZ5A 3P81A 3ID7A 1K03A 3ZYZA 1XIMA 3ABXA 4PBFA 1KBLA 2QIIA 1KM3A 4LS0A 3CMGA 1VHCA 3E2VA 4C6JA 1V03A 1NF7A 3K8LA 4F0HA 4RPQA 1WE5A 3HV8A 4HPHA 4YXGA 1KXVA 2OG9A 1X1ZA 1I8JA 1TPDA 4KIRA 1DXEA 3SIZA 3JS3A 1Z32X 4K37A 5D8WA 1R7AA 4Z2LA 4ZQCA 3QBUA 2WV8A 4AWSA 4P8XA 4LOCA 3WUGA 3H70A 4AVFA 4RXFA 4ZTYA 4FXSA 4C91A 4OECA 1X6UA 1L6WA 1WOBA 1PZ2A 3QOMA 3MP3A 2ZYFA 4H9MA 1GJWA 1XH2A 4ORIA 2TYSA 2D69A 3RLUA 1MUMA 3VMNA 2J75A 2PDFA 4C5YA 3S42A 3L4VA 1VPXA 1FWCC 1W31A 3CZLA 3QPYA 1LTDA 3R2GA 3ZO9A 4UR9A 3WQVA 1UKTA 1JI2A 2F7FA 3SCNA 4AUBA 1ZJIA 3AC0A 1AJ2A 3O7UA 2ZOXA 2GVYA 3TC7A 3CTTA 4DWSC 3FHAA 4NG3A 1V4YA 2R91A 3FVDA 2PDJA 1XIHA 1TA3B 2PF0A 2OWCA 2WSRA 2FH6A 1SR0A 1DE6A 1IXOA 3TC6A 4Z0SA 2XSBA 3I6EA 4CN6A 2B0MA 1JUEA 3K4WA 4DLMA 1WBHA 4HPXA 2JEQA 3THUA 1NTHA 1PPIA 2FZ9A 4EKJA 3BOLA 3BV7A 4DI8A 4S3AA 2WWCA 3RM8A 4KQNA 3W7PA 1ZHAA 3BANA 2VFIA 4D6DA 3LTPA 4R27A 5HOSA 3BV4A 1GTHA 4YTRA 4JAWA 1M3UA 1NDZA 3BLIA 1NDVA 4QEEA 2Y88A 5DY2A 4S2CA 4U33A 1I1XA 3RXZA 3DECA 1Q13A 4IX2A 4HNNA 1J18A 1HKVA 2HQAA 2YDAA 4HZ6A 1LL7A 3KTXA 3PB0A 1CTNA 4D6CA 4G1NA 3AWNA 3CAVA 2HROA 3AMLA 4J3SA 4GJ1A 4YN5A 4HZMA 1VEOA 3K46A 4E3TA 3BMXA 4TMCA 1EBGA 5C0QA 2AQVA 3CJPA 3ZJ8A 1W5QA 1GOIA 1KFCA 4CCDA 5IDZA 3M1ZA 4NZ3A 3FN9A 1QDSA 3O0FA 3W7LA 4V15A 2PF8A 1J11A 4FLSA 3NYZA 2QV5A 1WKEA 1YE6A 4DWSD 4LRSA 4DB7A 1NWTA 5I02A 3WLPA 1L6YA 3MZ2A 3UD6A 2YL6A 3B8VA 4EANA 4D8ZA 2FTPA 1RLDA 1TV7A 1EFZA 9CGTA 6XIAA 4Z1BA 3OVGA 5EYWA 3DAQA 5GJNA 2F8QA 1LOLA 1A5NC 2DH3A 1IV8A 2E6FA 3DG3A 5A6KA 4LF1A 2Q3RA 2VC9A 3CEPA 4ECLA 5FAJA 2W67A 3EZ4A 1W3TA 1HG3A 2IQ0A 4HYVA 3V5FA 2PGWA 2O9PA 4DJDA 3N2XA 3DDMA 3PZ9A 2FVLA 4DF0A 3AUJA 1F61A 1UB3A 5I07A 2EPOA 3TFCA 3GXTA 4CCZA 4POCA 4NZFA 5RUBA 2O55A 1TIWA 2XHYA 3A9BA 2XIIA 5D03A 4E8GA 4C60A 5G2HA 2CZVA 3DYOA 1W3NA 2OFJA 1LUCA 2WSKA 2NQZA 3L23A 3M6YA 3GUGA 1VCFA 3GX9A 3RPDA 4DZ5A 2PU0A 3CHCA 1F6YA 5BYWA 4E38A 3I10A 2QPUA 4NUWA 5DBTA 4JTKA 3GB6A 2VEIA 1EC7A 5E93A 2VDGA 1W9VA 2KX9A 2VOMA 4YS1A 2R24A 3OZYA 1XKJA 5F2IA 1XR2A 2A79A 2ZTKA 2E28A 4DQWA 1FQ0A 1JCYA 3RLGA 3MSRA 2NVCA 3EOSA 3PUOA 3FOKA 4XIAA 1ZL1A 3ARTA 3LSBA 4CGTA 2QIWA 4LW7A 2X09A 1E0WA 1HVXA 3DENA 4JN8A 3E12A 3PANA 3BJSA 3VD3A 2D0HA 2E1WA 5DLCA 4A8IA 3S9ZA 2ALRA 1NP2A 5JVLA 3L2IA 3GH5A 1WP6A 3HJZA 3PHAA 4W89A 3G1HA 3P67A 2PDHA 5FL0A 1OCBA 1PX8A 1FP8A 3F03K 2RDTA 3GKFA 1QOPA 3MUXA 3T09A 3LHVA 3R4IA 3SECA 3UF9A 2XIMA 4JHZA 3WQFA 4YWIA 1GQJA 2GZXA 3M0XA 1TVNA 5MHBA 3PUEA 2YB1A 4GQGA 3W24A 4H6QA 1VF8A 1QXLA 3MVTA 1DJQA 1O7AA 2XINA 3E3HA 1NOFA 1E1CB 5AC5A 1KQYA 4AX6A 3KS6A 4NZ4A 4WEVX 1S3HA 3DHFA 5CPMA 4DI9A 1MZHA 4UTFA 1DQUA 5A6LA 1XSKA 5FF2A 4JS3A 4C6QA 1BWVA 1E40A 1UQZA 1QUMA 1XDLA 1JG9A 2V5LA 4F0SA 3N19B 1XJBA 3SIMA 1FWSA 4NZCA 1GEHA 1W37A 3VGEA 1YNPA 1EJ7L 4RDVA 3SW6A 3RYSA 3PWAA 2GGEA 2H3BA 3HV9A 1XLDA 4ATDA 7PTDA 1JGMA 1K9DA 2V67A 4LVDA 3QSRA 4IGHA 3W1XA 1YYAA 2BXYA 5DELA 3FCPA 2V5JA 2DSWA 2POZA 3S6TA 1RQEA 1CGVA 3DYPA 2XGZA 3GIYA 4OUEA 1EGVA 4MYXA 1W5PA 4LUIA 1TUFA 2VC5A 3GR4A 1QBBA 1IT0A 5HMDA 7A3HA 1ADDA 1NIUA 3G3MA 1AQMA 4ZOCA 5XIMA 1L8NA 1E56A 4R7JA 5HULA 4ZB5A 3NGFA 1GUVA 3VU2A 2IKIA 5IDIA 2A3EA 1E9LA 1S1RA 4H8UA 1QWKA 2ZTJA 4XBJA 1DQWA 1J79A 2VZTA 3LCXA 4GO9A 2XH4A 5H8PA 1TKKA 2REQA 1CYGA 1CT5A 3UBPC 1PZ0A 3EWUA 2Y24A 3M7SA 4PL2A 4AF0A 4K7VA 4PTMA 4Q8TA 1MDRA 3L0KA 5HA7A 4NYYA 3NQ6A 1LRQA 2Y85A 3RRXA 1EJXC 5CLWA 1ZZMA 1LBMA 4P7RA 4DBEA 3QGVA 3UESA 4RZ4A 4HHLA 1OD8A 1V3HA 2I1OA 3AIQA 4S2BA 2ZXQA 2PWGA 3ZIZA 4O8AA 1MUCA 4PTWA 3L4TA 4L64A 1V8EA 4PUJA 4C5ZA 3ECQA 1X98A 3EPMA 3IJ6A 3MSYA 4KPLA 4XBSA 5EMYA 1K70A 3THQA 1EC9A 4KMQA 2PODA 3NIYA 1TMHA 4LUSB 4LVAA 5HPOA 4UNIA 1YE4A 3NM3A 3VOIA 1V08A 2J74A 1V79A 4QG8A 1S2UA 2PDMA 2F6XA 2OODA 3NQFA 5DT5A 3LLDA 3WH7A 4UMCA 3SGZA 4KCUA 4E4FA 1L6SA 3WBXA 4TX9A 4IIBA 3RDKA 1YKWA 3CUFA 2PDUA 1TCDA 2ZZ7A 1ONEA 3CXOA 2DT3A 4IGSA 4RL3A 4K39A 4RZ5A 1O6IA 2B4GA 3FGCB 4M3PA 4IQJA 3GM8A 3ZM8A 2A2IA 4C7FA 5A6BA 2ISDA 4O4VA 1JGIA 5E70A 1REQA 2WVVA 2YLLA 1RZMA 3MHGA 1PIIA 1P6BA 4NILA 1KM6A 2OT0A 3IUDA 1TWZA 4JTQA 1K4HA 1GVQA 3GTFA 1MXDA 4QJ5B 4JIHA 1G01A 2YSWA 3O9NA 2YPIA 3I7QA 2YCEA 1ZPTA 1QI2A 8CGTA 3W0KA 1IR2A 1BG9A 4L1WA 3JR2A 5T9BG 3UVAA 5GNXA 3SUVA 4X22A 4AISA 1JD7A 2DZBA 2H3DA 2ZRUA 1J0KA 2WZTA 4WHBA 5A8PA 2GSEA 2XIJA 4Q7BA 3K8KA 1FX6A 4V28A 2E09A 3BGJA 3RR1A 4GIEA 6REQA 3HGRA 5D2YA 4CNTA 3LQLA 3BSGA 2YDQA 1E0XA 3UG8A 4PCFA 4WJ8A 4LS2A 4I8DA 4H8VA 3WDRA 2AL2A 2UY3A 4EWJA 4PRRA 3R43A 3UXDA 1AD1A 1FWAC 1ZSXA 3VVGA 2WMJA 3VIGA 2WC7A 1KRAC 4HD5A 3QGAC 2EXOA 4QE1A 2J78A 4JTHA 4F4RA 4O52A 3W81A 2QCFA 3VKDA 1FFRA 5BXRA 4RNHA 4Q32A 4WR3A 1EOKA 2AKZA 1D8WA 4Z08A 3QY8A 5FJPA 5K3VA 5MKGA 3CM4A 4ZENA 1UASA 4C6OA 3AIRA 3CL7A 3U9IA 1IIGA 3WF4A 3I6RA 5LIKX 1EO5A 1FWEC 1OYAA 1DHPA 4MNKA 1WDDA 3W53A 3Q4DA 1J4EA 4L5ZA 3AZSA 1S1PA 6CGTA 5IHSA 2WNNA 2GQAA 1H0GA 2NT1A 5HJLA 4GY1A 1P48A 4OIFA 2CC0A 3N9RA 1XCFA 3GH7A 2P76A 3JRKA 2EO7A 3CPUA 1DXFA 4E6MA 1RK5A 1R2RA 1MI3A 2VR2A 4A4AA 3ENLA 5LA1A 3QQ0A 3CZ8A 1RD6A 1ALDA 1WPCA 4J5NA 1NAL1 3BLEA 4RZ6A 1B9ZA 1PEZA 3GXFA 2PTZA 5T91A 1J5TA 3SN1A 3KW3A 4FX7A 4HP5A 4OVXA 3R11A 3TUUA 3LMZA 3VPLA 3V1HA 5BNKA 4FS9A 3IIPA 3TV8A 2BY2A 3HQOA 3UZXA 2C15A 4XZNX 2XISA 1UR4A 4HCDA 3ITVA 1FWHC 3E0FA 2VENA 3M4HA 4D9PA 1FUYA 5CSYA 3RCNA 1HJQA 3R0KA 4XO6A 3U3HA 4UFKA 1OY0A 3RX4A 2J25A 4AEOA 1L6GA 5JUVA 3VNLA 1KBKA 3AYRA 5I03A 2YZRA 3THCA 2VURA 4DO7A 4A3HA 2QAFA 3VDAA 2INZA 3S1WA 1Z42A 3RR4A 5IBXC 1BVZA 3W1NA 1SO4A 3P14A 3D0CA 3OODA 1W91A 3RCMA 1UD6A 1T99A 1J12A 1IGSA 5CPLA 2X1IA 4LJ3A 1EIBA 2E6AA 3GNOA 3N12A 3B06A 2HEJA 5BU9A 3CH9A 1OIFA 2NLYA 4AHPA 3H53A 2EJ1A 4E8DA 3A5FA 1QO2A 2XM1A 2ZE0A 3FS2A 1DIKA 4JTLA 1QTWA 3L4XA 2XIBA 1KD0A 4F0LA 1C8YA 1MEHA 3P0XA 1V7AA 3MU7A 3OHMB 3G1SA 3ARYA 3WQEA 4C6MA 1JZ8A 3AAMA 4CUCA 3EX1A 1F7BA 2OCZA 3DOPA 1H2JA 3CWOX 4IL0A 4B5SA 3TC3A 1SYTA 4AU0A 4QDPA 3WG6A 5BMXA 1DTUA 1W3HA 4OU1A 1X8FA 2O56A 3T9PA 1A5OC 2TODA 2Y4SA 1N82A 4D6IA 4MYAA 2A1YA 2FVKA 3HOJA 3EDKA 4OQVA 4IPLA 1XX1A 4LV4A 1XWYA 4DO6A 1A0CA 3EKLA 2PRLA 1TJPA 4JR5A 1SJCA 2PC4A 1RBAA 5JIWA 2DZWA 1RH9A 4A6GA 3EXSA 1Z6KA 4K8EA 3UJ2A 3SY8A 2GK1B 5EB8A 1AJZA 2ISFA 4Y9AA 5G4EA 1MW0A 4WX2A 3KLLA 3LCGA 2VFGA 3QC0A 1E4IA 2GL5A 4QDMA 4KWWA 1EQPA 4MDOA 5FJIA 3GXNA 3RCYA 1RSCA 3MTWA 1ZAHA 4JGDA 3BGAA 3GXDA 3WQ6A 3SY1A 1VCGA 4H9XA 3KWSA 2GJXA 2VEPA 2KZHA 3QQ1A 4C1LA 2CLLA 4ERAA 1B90A 1OGSA 1WCGA 1JQVA 4GJIA 7XIMA 1RAKA 3GRIA 3UCQA 2CXEA 1W2PA 4ICNA 5D9MA 1LDCA 3BJFA 2VVSA 4NX0A 5FEPA 4B5UA 1ZENA 3SBFA 1H4PA 4W5UA 2JKAA 2H9AA 5E09A 2VR4A 5I3HA 1Y5WA 3M0HA 2PI6A 1C92A 4Q4OA 4ADUA 3OGSA 1QI4A 3AYSA 5AZ1A 4P8VA 5KETA 1EH9A 1KKRA 3GVWA 1CXFA 1TZZA 1SZNA 2IUZA 3P62A 3VNYA 2OO0A 3JW7A 1YHTA 4QQ3A 1DORA 4CQAA 1UR9A 1GKRA 3N6HA 4QTGA 2BY3A 4AZ7A 1WOAA 4PODA 3AXHA 3SJNA 3TAKA 3SFWA 5CQ1A 3M0KA 4GYKA 1HKIA 3E1F1 1XDJA 4EK7A 2Z28A 3U5YA 3FKRA 5CPQA 4W85A 2ZUWA 2XJ7A 3I4EA 4JTGA 2AGKA 1M68A 3IV3A 4J9JA 4V27A 1QPNA 4S3EA 4KWSA 4OTKA 3L4WA 3W74A 1TREA 1TB3A 3NVDA 4GQRA 4HTBA 2QPSA 2IKGA 5HNRA 1Q5MA 3ARUA 3NL2A 4KEVA 3M41A 5BXSA 5FD0A 4RDWA 5AHIA 4D72A 3CLWA 3CB8A 2ZWZA 3QYQA 1IWPA 3KVKA 3KRZA 1RQHA 4GBUA 3TXZA 4PBEA 2OJPA 3QTGA 4UR7A 1Q3NA 4M6UA 3RFAA 4MZ1A 4GNJA 5CGTA 2YKKA 3CV7A 3W4RA 3WNOA 2HTMA 3G1FA 2HPIA 3GWQA 1VFOA 4GIAA 5CJNA 2OYKA 3K13A 2CLPA 3SR7A 3WUBA 2BGNE 1C8VA 1XXXA 5HINA 3GC5A 3ZR4A 2VJXA 5IOBA 3WBEA 1F73A 4ZEPA 4K36A 2VTFA 1F5ZA 4XK2A 2UZ9A 2BOFX 4M1BA 3KDNA 3M6DA 3FA3A 3PZIA 3EDFA 2Z2AA 1OCJA 5E9XA 4PCPA 2CHNA 3LXCA 2F6KA 3VZXA 1RQBA 2OO6A 3IGSA 1B9BA 4MHBA 1A80A 4NZ1A 3UZWA 1AQFA 1RD5A 4UZSA 3CAKA 4XIMA 2CU0A 2RH9A 3CPRA 2QCDB 1Q6FA 1XP3A 3AMGA 1UC4A 1I2RA 1VR6A 3MBFA 2PUZA 4JD4A 2Q01A 4DJED 2YBVA 4Z2GA 3EPNA 2ZXDA 3WLQA 2PBGA 2QJNA 4IFOA 1LOSA 3GBDA 5E1QA 4YCOA 3LSCA 3DZ1A 4IL2A 3VA8A 2ZZ1A 6ENLA 2MUCA 1SMAA 5KTLA 4LAKA