3V5OA

Structural and mechanistic studies of catalysis and sulfa drug resistance in dihydropteroate synthase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
273
structure length
262
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILNPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Catalysis and sulfa drug resistance in dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 92
structure length 262
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2011-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 3v5oA00
4DJFC 4G9PA 2H9AB 3NOYA 4MWAB 1AJZA 4DJDA 3H26A 3H24A 4NHVA 3H23A 2E7FA 2DZBA 3H2NA 4CCZA 3BOLA 2DZAA 1Q7ZA 4O0QA 1AD4A 4MWAD 5JQ9A 2DQWA 3H2MA 3MCNA 4DJFD 4NIRA 4S3BA 1TWWA 4S3FA 2Y5SA 4DJEA 4D9PA 3K13A 1AD1A 4S3CA 4O1FA 4PZVA 1F6YA 3TYCA 4S38A 4S3AA 2YCLB 4O1EA 4S3DA 4C1NA 4HB7A 3H2FA 3TYBA 3TYZA 2YCJA 3H22A 3TYAA 2YCIX 3H2AA 1AJ0A 3MCOA 1Q7MA 1AJ2A 3TYEA 3V5OA 4NL1A 4S39A 2VEGA 3H2OA 2YCKX 3H2EA 2H9AA 1EYEA 4D8AA 4MWAA 2Y0FA 2BMBA 4DJEC 3TZNA 3TYUA 4DJFA 4DJDC 4D8ZA 3BOFA 4NILA 4DJDD 4DAFA 2OGYA 1TWZA 2VEFA 4DAIA 3H2CA 1TX2A 3TZFA 2VP8A 4MWAE 1Q8AA 3H21A 4S3EA 4C1NB 1Q8JA 1TX0A 3TYDA 1Q7QA 3MCMA 2Y5JA 3TR9A 1Q85A 4MWAC 4DB7A 4DJED 4S23A 2YCLA 1TWSA
chains in the Genus database with same CATH superfamily
5T9BG 3HV9A 1WZAA 3KHDA 4XTDA 3IPWA 1VFMA 3H7VA 2G41A 1U83A 1RJRA 3UWQA 4FF5A 1NOUA 3CUFA 3MC5A 4KFNA 2OCZA 2PUZA 2FZ8A 1VYPX 3IGHX 3UGVA 3ITOA 1WZKA 3TSMA 3A3XA 2Q6ZA 4D6GA 1NY1A 4UIOA 3MCNA 2BY2A 4C6QA 3K46A 1NJJA 4Z1YA 4EPEC 3W1AA 4PH6A 4AZHA 2OLSA 1XG4A 3K4WA 4GQRA 3HQPA 2CHRA 2POZA 2YCLB 5REQB 3W27A 1XLLA 3IV3A 1BYAA 2DZVA 2MNRA 3N2CA 1VEOA 2CLMA 1FKWA 3AIUA 2OPJA 3DKLA 4U3CA 3F1QA 4P7RA 4IF2A 7TIMA 2J4GA 3G1SA 3MHUA 3BH4A 3HPFA 4RW3A 1TE1A 3WO8A 1O94A 1FWWA 4IMAA 1OFQA 1IE7C 2GSJA 3LS9A 3F2BA 4LC6A 1TZ9A 4LRTA 1UP2A 2XGZA 2P1FA 4QE4A 3U8GA 1XINA 5AB3A 5H1WA 3HU7A 4GH1A 1MW2A 2P3EA 4Y96A 4JTDA 6A3HA 4XKMA 4CEXC 3EX1A 1XISA 3O3RA 5AY7A 2O4QA 4I7VA 3TJLA 1S2AA 3EX3A 2YOCA 1UP3A 5DMLA 3OHMB 2D2OA 4YTUA 2C8NA 2PGRA 2VGFA 4I5RA 4KT2A 1FHDA 4JTKA 1V77A 3UXAA 4GI4A 4BZYA 2GQ8A 1LLZA 3M5YA 5LNWA 4S38A 1ZP3A 5HWMA 1US3A 4JYDA 1XSKA 1OX4B 1MNZA 2VC9A 5LNSA 3IJ9A 3WDIA 2Z1BA 1ZLPA 1PTAA 3FSTA 5BW6A 1I4NA 3M0XA 3PBVA 2ZX8A 3D6NA 4ZXOA 3W7QA 4UTWA 3UZXA 2INFA 1TTJA 3Q45A 4UQEA 3LY0A 2VQTA 3PP7A 1UR8A 4REQB 3P80A 3VKKA 1IEXA 2Z1WA 4YVXA 2W92A 1K1DA 1IEQA 3M0MA 1EKOA 4WCJA 1WB0A 3W01A 4GCAA 1PKYA 3C2YA 1ELSA 4F0RA 1TQJA 3L65A 4C6EA 4US5D 4GPNA 2ZVIA 1CT5A 3OVGA 3KZPA 1E1EA 4LBSA 1W1TA 2CLFA 2Q02A 2CLPA 1XLEA 3RNDA 4JS3A 3IUIA 1HJUA 1ZBWA 2ZE3A 1KFBA 4R7WA 4ZO8A 3R5EA 4M7SA 1KD0A 1NM9A 4NI3A 2VR2A 2ZRUA 3II1A 4IIHA 1DWFM 3PAOA 1R2SA 3FEQA 2FPYA 2Z26A 4Q8TA 1FX6A 3W88A 3WN6A 3THCA 4HK7A 4IMDA 3WQVA 5PTDA 3RF9A 2VXNA 2OGJA 3DZ1A 4W4QA 2Y85A 3ABZA 4NZJA 3S9ZA 1G94A 2XH0A 5LGZA 4LYPA 1AA1B 4ZTYA 2OFJA 5D2WA 1XIGA 4DPPA 4OTKA 4M6PA 3M0JA 3UY8A 3WZ0E 4DYJA 4L6OA 3WQFA 1SGJA 4B5SA 1EF3A 1XLAA 1ZS2A 2TMDA 1KCKA 4UQ9A 4QROA 3KCOA 3GG7A 1AG1O 3HN3A 4XZHA 4O0ZA 3P93A 1UZHA 4PRWA 4JTAA 1E9ZB 1L6YA 4JR5A 3VOCA 4DUVA 3E1F1 5FOOA 3WDRA 2DSZA 3CTLA 3HFYA 2GUYA 3R79A 1TE6A 5BMWA 4K2SA 4XUGA 1HXJA 4ICNA 4QISA 4F0KA 5JUVA 1J11A 1VJZA 3LGDA 3AIEA 1F76A 2QDDA 1XRSA 3D47A 3IGXA 1E5JA 2Z2AA 3T9PA 2FTWA 3GK0A 5M2FX 9XIMA 1Q4NX 1EUNA 1M6JA 2Y70A 3H70A 4DWSA 2GGGA 1TWIA 2QCGA 1Q6OA 3TEVA 2NX1A 3EDJA 1ODZA 3NQEA 1J0ZA 2FH8A 3FA4A 3XISA 2YXOA 1XJBA 1BRLB 1D3GA 3KBWA 4NT0A 1EHAA 1KBKA 1XIFA 1VC4A 1FWCC 1UPMB 1JUKA 2NQLA 3W9ZA 3ATYA 2D3LA 4B9ZA 3U4AA 3GTIA 5I0DA 1BTMA 1BWKA 2VP8A 2VVSA 2XJ7A 3VZXA 4B5XA 4XD3A 4I90A 1H63A 4XO7A 1VJIA 2CBVA 5GNYA 1RR2A 2WQPA 3UZWA 2ZQ0A 5BCAA 4G7EA 3O1NA 2INEA 3CTTA 3GNOA 1RA0A 3KLKA 3E0FA 4UTWC 4HNLA 3VDBA 1J93A 5I6SA 3VGBA 3ARPA 2DVTA 5BXRA 1H51A 1QHZA 4LBUA 1L6GA 2BVYA 1EA9C 2QJMA 2QIWA 4H4IA 2DUAA 3UJ2A 3KL3A 1GKPA 3H23A 2NQJA 3I4KA 4QJ3B 5FJJA 2BODX 2UY4A 3PZ9A 3R25A 2EBNA 5K7JA 1TPB1 5A6AA 1Y7VA 4H9YA 1OFDA 4PUDA 1KV5A 2HRWA 2WZMA 2J7GA 2HE5A 3CL8A 4JPGA 3TTSA 4AHOA 2Y4SA 7REQA 3T0BA 3WD1A 1FKXA 1YLVA 1F3XA 4H00A 4JL1A 3CAWA 4BF7A 3GYCA 3WF3A 3DXIA 2DH3A 1UOZA 2D3NA 5C9XA 4E2DA 3EWWA 4PMQA 1IT8A 1K70A 4R27A 2Z25A 1EIXA 3MY9A 3QV8A 2OGYA 1T0OA 2WKGA 3GWQA 2D24A 1G4SA 1JD7A 4M1BA 3RM8A 2PLJA 2CHNA 1AVAA 1OZQA 3WUBA 3CU2A 4LGXA 3LX9A 1M41A 1TJ1A 5JIPA 3VD7A 1L9WA 4X61A 3BW4A 5L9FA 1R86A 1UR0A 1GZJA 2CITA 1RQHA 3BAJA 3HPXA 3UXKA 1OZMA 1V0KA 4XVEA 1WXZA 3W00A 3N3TA 5JVLA 1XYMA 2JEQA 1Q6EA 5ENLA 1GQIA 3EXSA 2ZVRA 2HROA 3K2GA 3SCTA 2W6RA 1JGIA 1HKMA 3GR7A 3Q67A 2OU4A 2KZHA 2IKJA 4PGLA 4NZ5A 3T0CA 4F3HA 1CXFA 1RK5A 3GU2A 3CYVA 1R0MA 3PZOA 4QQ3A 2NQZA 2CERA 4AX6A 1CXLA 2ZTJA 1DIDA 1UZ4A 1XSJA 3NWRA 1W9DM 3ARTA 3LOTA 4JY8A 3CWNA 4M3PA 3SQMA 2C1IA 4WGHA 4C60A 3M4HA 1H7OA 4LH8A 3WEZA 5FEXA 3WNLA 1MZRA 4QEEA 2VFHA 2BHUA 4LYKA 3ISIX 1M04A 3VM7A 2NZLA 1W3KA 3DI1A 2H90A 3C6CA 4BS0A 1DYSA 4MNJA 2EPLX 2WSPA 4PRRA 3EB4A 2OX1A 3VDHA 3B0VC 1W3IA 3BMVA 3TN6A 1TX2A 4DWSC 4AZGA 3S0CA 3DX5A 3NO5A 2PFHA 4S3KA 2VX6A 3FA5A 5HMDA 2CNCA 3ZT7A 2WHMA 3W6MA 1A0DA 2PD5A 4AZ5A 3LTSA 1W9BM 3IJ8A 4AHPA 4A35A 2C0HA 4YTRA 4ZB0A 1F9CA 4QXIA 3BTNA 1JI1A 1MXGA 4W8AA 4L1GA 4PSPA 4LNCA 2EEXA 1JCNA 1I60A 2DJLA 1HT6A 3WLKX 1QWGA 1JZ6A 1IWPA 1XIEA 3WQOA 3W1UA 5A95A 2P5NA 1E0UA 2ABBA 1QWKA 3EAUA 2Y1HA 3VD4A 1EP2A 3QVQA 3W73A 1BPLB 2UBPC 2YKKA 2WKJA 3NYDA 1I0DA 1GORA 5BRPA 4IGMA 3QV7A 4KFPA 4MB1A 4TR9A 4UQBA 3VNDA 1X96A 4PB4A 1XFBA 2WKLA 3BURA 1OT1A 3OVQA 2ZXQA 1XDMA 3NXLA 3CQ0A 5FAGA 1Q6CA 3U3HA 2HE8A 5C9RA 3QKZA 2W4XA 1VPXA 2V3FA 4US6A 2PTZA 4AH7A 4HYVA 4Z2KA 3MJMA 3W6YA 2CESA 2HVMA 1LT8A 1QAPA 4AZCB 1OGSA 4Q4KA 5HDRA 4H7VA 5AC8A 3OB8A 4DBUA 4MB4A 3I10A 4D72A 1A53A 5D03A 4HU0A 2PTYA 1YXDA 3BC9A 3I7SA 2EPOA 3DH7A 3BARA 4UZSA 3A4XA 2IKHA 3REQA 4M6QA 1GW1A 1H49A 1Z6KA 3NURA 4HMCA 2OZTA 4RDYA 2WCAA 4KCTA 5D33A 3BXWA 3AMGA 1OFRA 4H6KA 1UKQA 1V0LA 3CQHA 5I77A 5ECVA 4ATLA 5CZSA 4Q6JA 4WKHA 1H60A 1FHLA 3NQAA 1CCWB 3P3BA 3FVMA 4QLJA 3WNNA 3UR5A 2ZC8A 3ME3A 1J6OA 1KBJA 4JEJA 1J6PA 4PEEA 1Q5MA 1JPHA 1EYWA 1P6CA 4JFWA 3LA4A 4UTTA 1UMYA 4Q22A 5E93A 2ZICA 3RX3A 4ALDA 3TXVA 3IWPA 3LGEA 1KGWA 3AQUA 1MUWA 1DJIA 1FXPA 3LHUA 5CSUA 1GOMA 5DANA 1PKLA 3CV6A 1DWHM 3UCCA 4XBKA 2NUYA 1JDAA 2P0IA 3VD5A 3CAKA 2I56A 3WJXA 1EIBA 3W2UA 1MO0A 1P5BA 4O1CA 3ECQA 3AIBA 2PRHA 5A3HA 4LV4A 4J3VA 1G4TA 2GJXA 3MWAA 2JF6A 3PTQA 1V7YA 2VZOA 3GDBA 1UBSA 4ZTXA 4QS5A 2NSOA 2AL1A 4FNPA 3STCA 2XISA 4ZL1A 1QBAA 3MW7A 1VBGA 2WM0A 3LV5A 1XRTA 5CGTA 4RZ6A 5HUOA 5AHFA 1DJGA 3MBDA 1MQPA 9RUBA 4BF9A 4PMZA 1NTHA 3WBWA 1I2QA 1UOKA 2ZOXA 2O9TA 4F2UA 4JAWA 1W31A 2WSYA 5KETA 2WHKA 2QW5A 5AKQA 3FS2A 1J0HA 1J12A 2IXUA 1AL8A 1RCQA 3B04A 3BZGA 3DUGA 4AWUA 3H2FA 1TJRA 3S1GA 5F1VA 2R1PA 1N7KA 4CD4A 3JR2A 3AZSA 1GVSA 3EWUA 4NAFB 3ITYA 4PTNA 4PFHA 5A8QA 2YCEA 1PTDA 2GUBA 4N4QA 4D6IA 1ZJHA 4WDXA 3UYIA 3G1VA 3W7GA 3P84A 4UFKA 3PTKA 4Z1BA 2OZ8A 5AZ1A 2ZX9A 1CTNA 2EF9A 1J0KA 4XSMA 1GK8A 4Q4SA 3QMRA 1WDWA 3MDWA 3OPSA 2PP1A 4IIFA 1KBIA 3UZ5A 1ESWA 3AXHA 1AH3A 5CSRA 2EG7A 3ARYA 1LBFA 2UWFA 3Q65A 1ADSA 3M16A 5I3HA 2PSNA 1VCFA 2YCLA 5REQA 4D6DA 1OCBA 2QJGA 4W85A 2R9RA 4A3YA 1JUBA 5D30A 5HUPA 2EJAA 1FCVA 4DYKA 4ASTA 4XAGA 3E38A 4P8WA 4GQGA 5AVHA 3C2VA 5HMEA 4HNTA 1HP4A 3N17A 3VKAA 3EOUA 3N2XA 3G1AA 1TELA 3D46A 3IJQA 2TAAA 3AXKA 4D1JA 2OEKA 3BUVA 3GXMA 5H8MA 4H01A 4JQ4A 3T4CA 5FIPA 4PUMA 4AMCA 1MDRA 3GC4A 3UU0A 2D0HA 2OTDA 4JFSA 3TDFA 4FOUA 3HGJA 3W7IA 2J6XA 2X0SA 1PZ1A 4LAUA 4EACA 1F3TA 4U4MA 3VGEA 3OZPA 4LCSA 3ZOAA 2CEQA 3W25A 5DF0A 3G6LA 1DTUA 4PE8A 1FH8A 4B3LA 3CS2A 4UTTC 2DUZA 4GGHA 3T40A 3WD4A 1HJVA 1HQTA 1I2NA 2XVPA 1NOFA 1SUXA 2Y63A 4LVGA 3BLOA 3OP2A 4QG6A 3SUVA 2CFFA 2VC5A 1WNOA 4LCRA 3BL3A 1ZUAX 5TQLA 1OX4A 2R6OA 4GC3A 1R46A 1QNRA 5C9UA 4UFIA 4U31A 4R9OA 2LLEA 2AAAA 3GTFA 4AC1X 1PZ0A 4R34A 1Q63A 1K9EA 3RLHA 5G4WA 1XLHA 2V9DA 1PX8A 4OIFA 4ZVJA 4JFTA 1GJUA 2ESCA 4REQA 1OFPA 3MHFA 1LRNA 3WFLA 4PL2A 5I3FA 4ZQMA 5KSWA 3DFOA 3F03K 1CGVA 4P8XA 4DELA 2CIPA 4CQBA 1QVBA 1V3IA 3DYPA 1HJQA 2C16A 3ABSA 2ZFAA 2WZIA 1V51A 3C86A 4XVDA 3WELA 5FJTA 3FLUA 3AU2A 1E3XA 5CC5A 4WKFA 1WXYA 1EO5A 3NYZA 1QCWA 1U5JA 4PCPA 4R7JA 3WNOA 3EZ4A 1NWSA 3B97A 1E4NA 4U5KA 1YNYA 2YDAA 2QUVA 4L64A 1A5KC 2J6VA 1MZHA 4PEKA 2WMJA 3GAYA 4ZCWA 3HQ1A 1XXXA 2G3MA 4GIRA 2J24A 1PUDA 1BKHA 1GQNA 1EJRC 1CX9A 1UWSA 1KFWA 1LBLA 2OKTA 2GJNA 3T05A 1YDYA 1TPH1 3W7NA 4A22A 1X39A 5AYXA 2GOUA 2ZXBA 1FWIC 2J7FA 2QCCA 2CU0A 3TQPA 4NNCA 2NT1A 1NF0A 1DJZA 6CGTA 4U33A 5J04A 1HGWA 1CNVA 1TWDA 3TP4A 3B4YA 4HSOA 5DBUA 1DXFA 1LZOA 3E9AA 2GK1B 2ZUSA 4K38A 3WF2A 3TTOA 3H53A 1UQYA 1LRQA 1V6WA 4Y9OA 1S2VA 1CXKA 2J74A 4OOUA 1DQWA 3C0SA 4M29A 5F4SA 4H7CA 3CASA 4WQ6A 5AYZA 4Z1DA 1Q7MA 3SIZA 4FLQA 3UR7A 2P0OA 2O9OA 2J7DA 2WNQA 2XIBA 4AY7A 1DKWA 1GNXA 1NDYA 1JDCA 2DQXA 1VRXA 3A9IA 3WCZA 1W9PA 4AZ7A 3BQ5A 4QRNA 4E4UA 2FGBA 1E6RA 1JXKA 2R94A 2AKMA 4DF2A 3PAJA 3ITCA 1A50A 2NVCA 3BAIA 3ARQA 2POTA 1ZBVA 3NL3A 4G56A 3SR7A 3MSRA 2RDTA 4Z08A 3VVGA 3WKZA 3P0XA 4JN6A 3BV7A 2V2HA 4ROPA 2QXWA 1WE5A 1WKDA 1W1B1 4O50A 1TB3A 3AS0A 2Q8XA 4GIYA 1IR1A 3RO8A 4OBTA 3WDQA 1BRLA 3GKFA 4HYRA 2BV9A 1RVGA 2R14A 1FWRA 2HV5A 2BNJA 1KWKA 5E09A 2FDSA 1UWTA 1EF2A 1VPYA 2DW7A 4JN8A 5I3IA 4MPQA 4EE9A 2NWSA 3LQLA 2V2DA 4UOQA 3I65A 2PWUA 1E9IA 1OFBA 2DSVA 3MS8A 3BJTA 3PPGA 3DAQA 4E4FA 4BF5A 1VZWA 4NSBA 2RGMA 3UR8A 3LENA 4OV4A 2F6UA 1E43A 3TA9A 2IS7A 4KFOA 4LUTA 2OYKA 3T8LA 4HOWA 4E6MA 3BJSA 4GYPA 3FNDA 4K37A 5D02A 3A47A 5ABGA 1SZNA 3JW7A 1CBGA 4J1OA 1TV7A 4AIUA 1XLFA 3TYUA 4GY0A 4W84A 2XH4A 3BOFA 1FH9A 1S1RA 2AOSA 3LHWA 1UG6A 3L5AA 2VR4A 1U1JA 4M0XA 3STEA 4C5YA 1JCTA 2VUYA 1UH4A 1GONA 3M0VA 5AYIA 3NGFA 3RO6A 3PWIA 1YEYA 1E6XM 2J62A 4FLRA 1V08A 4GBDA 3H12A 2CLIA 2BXYA 1XF0A 3V36A 1VBUA 1LP6A 1PAMA 4C90A 4LX4A 1B31A 4K7VA 1YRRA 1H50A 4C7DA 3BV4A 2PGFA 2PRMA 2CLHA 1OM0A 1FH7A 3A24A 4MWAB 4ADSA 3VUPA 1KA9F 4WZHA 1U1HA 4TTUA 2EHHA 1EJXC 3QZ6A 1DWGM 4WDWA 2FZMA 3MKVA 2XTKA 4L61A 1VRDA 3LK6A 2YDRA 2CC0A 1DOSA 4MY8A 1XS2A 3DDMA 2GVEA 2QUTA 3WLRA 5I02A 3TW6A 3DCPA 2C3ZA 4JTHA 3U2EA 4I6VA 1HNYA 3P61A 4J3ZA 4Q3MA 3OLIA 3HG3A 2XSXA 4IP5A 2Z27A 2FMOA 3BGAA 1QR7A 3PULA 3JS3A 4URIA 3V0UA 2JIEA 3URQA 4FX6M 3GYEA 1M03A 2QNEA 3IUHA 5ECUA 3AYRA 4X0VA 1E0VA 3N9KA 1LL6A 2DT2A 3FJLA 2OR2A 1XCFA 3GTNA 2AGKA 2P3ZA 5FL0A 4B2DD 2H6RA 2BY3A 4H9ZA 4ML4A 1WV2A 3R8RA 3NPUA 1R7OA 2V5DA 3FKKA 1BYCA 3B9EA 4C6KA 1ZBKA 3A3HA 3E0WA 1CGUA 1VB9A 1VFTA 1RJPA 4UFMA 3TTYA 1SMDA 3MUIA 2HXUA 3WEOA 3QYSA 3LHZA 1QI0A 1E15A 2OWWA 2HDJA 1SFLA 2E1DA 3MMDA 4IX0A 1XPYA 2HISA 1D8WA 1NVMA 2QS8A 1NFBA 3H7UA 1KM5A 2B7NA 3QR0A 1TRDA 3HZ3A 3UWEA 3PHAA 3IJIA 1QNSA 3TXZA 4HCLA 4GXMA 3PG9A 1FY6A 3SDOA 4XZMX 1BSLA 1UWQA 3WMCA 1OC5A 5HPOA 3AIRA 2PDCA 3G3DA 4UNKA 4DBDA 3MA8A 4PMVA 1CECA 4UR8A 4Q6XA 2OLHA 1M7JA 5A6BA 4M56A 2UY5A 1XUUA 3COTA 3QJAA 5C0QA 5BWAA 2WQDA 1ECQA 4AIEA 3CZ8A 1XG3A 3FXGA 2GQAA 3XINA 3L0GA 3T42A 3OO2A 3CB8A 4JTIA 1T40A 1TIMA 2VEMA 2E1WA 3WLNA 1K7EA 3VNLA 4I5XA 3T08A 3ZWTA 1X6NA 1RBOB 3WLHA 1W1ZA 3AMKA 1TA3B 3MMUA 4P2VA 1MVYA 4NRRA 4GYPC 3TR9A 2V30A 1LLWA 3D5HA 3IK4A 4DYEA 1FP8A 1B4KA 4K7YA 4YYCA 4LY4A 4NRSA 1UP0A 2R24A 1OC7A 3TOPA 2PDLA 4WEVX 1EX1A 4YLWA 2ISSA 2AAMA 1XYAA 4CVWA 1E40A 4WY0F 2YA2A 1S2WA 3W7EA 1R87A 3OYZA 1U5VA 3UWYA 4G2DA 4K8EA 5TBOA 3TWBA 2YIHA 3B8WA 1SZRA 5CKSA 4E3TA 1FP9A 3NUKA 4J28A 4UMAA 3WQEA 4HSHA 1GG0A 2CKRA 1PEZA 3W24A 3PR2A 3GIYA 1PHWA 2AL2B 3FSUA 6REQA 3DFQA 2V5BA 4E2VA 1N8IA 1E6NA 3EDFA 3UJFA 1W1VA 1OD8A 3CZKA 3O6YX 1XX1A 3VDGA 4PMUA 4Z1CA 2FKPA 4BY3A 3WDJA 4F40A 1RJQA 4YJ5A 3AZRA 1JZ5A 1A80A 4PL1A 5BZAA 3H54A 1MRQA 3CUZA 1D8CA 3M43A 3AHXA 1OABA 5I00A 3QOMA 3FCPA 3VFLA 3K4DA 1KRMA 3EX6A 1W2PA 5A6JA 4NZ1A 2JK2A 4CD8A 3NOYA 4GJ1A 3KCLA 4FSAA 3S6OA 5D9OA 4Q8QA 4HMNA 4R88A 4Y2WA 3LG3A 5H8UA 3AWNA 1UUMA 4XD5A 3LD5A 4FOKA 4N9EA 4OECA 2J7BA 3IEBA 5FCZA 2C6QA 3AIVA 1ZY9A 3GVGA 4KERA 3GVQA 1M7OA 4F66A 1NWTA 1FCQA 4JDBA 5IOBA 3G24A 4N7QA 1A49A 4Z2IA 1YDOA 4TO8A 4UCGA 2OSYA 1PE1A 4GFSA 2WJDA 4IX2A 3CIVA 1CGXA 2QCDB 3ZYZA 5CZ0A 1HN1A 2WK2A 1FDYA 1DBTA 3ABQA 5K2ZA 1C9DA 4TV5A 3MV01 4HNNA 3M7WA 4GIAA 3P8JA 4A29A 2X0YA 2VZTA 5I24A 1E55A 1G6CA 2O9PA 3DGBA 5H91A 1F61A 5GQBA 5DX7A 1D2KA 4FO4A 1OG0A 3W1TA 1PBGA 3I7RA 3INPA 4O16A 5HNNA 3LMYA 1B0IA 4TTGA 4C6IA 5EBUA 1TKKA 4KEUA 3W7DA 3UG8A 4F8XA 1W3HA 2WVVB 3OQ8A 2DSKA 4H8NA 4PCNA 4OVXA 1RBAA 1QNVA 4QDMA 4WJ8A 2XGBA 1IXNA 3EXRA 3M0KA 1ZGDA 4X2PA 3QY8A 4LANA 1O66A 2OB3A 5GNZA 3LCLA 1G67A 8XIMA 1PV8A 1HG3A 2H9AB 4NZFA 3CB3A 5IBXA 4NAFA 4X22A 5TF0A 1FCBA 1H62A 3ARVA 5C6MA 1W3JA 3S47A 3SCRA 1QTWA 3WMLA 1HKIA 4IT1A 5CSSA 1OINA 4RX0A 1XL9A 4LC8A 1DQUA 4MB3A 3W2JA 3NSNA 3KOXA 3LCWA 3VMPA 4NJKA 1X8FA 1QUMA 1G4PA 4Q7BA 3VIIA 3HBLA 2Y8KA 5LHFA 3TMQA 3TYCA 3FOKA 3NXFA 4PMDA 4O1EA 4EWJA 4YTSA 5B7YA 3ALFA 2R91A 3DGRA 3WQ5A 4DPQA 3P14A 5E0CA 3BSHA 2PB1A 3EB2A 3GC2A 3F5KA 3F4NA 3F5JA 1RA5A 1RQBA 3KTXA 1FWJC 4GINA 3EPNA 4TV6A 1OADA 2Q71A 1SFJA 2FHCA 4HA1A 1MSSA 4HPJA 3OG2A 4ZE4A 5DN1A 2PODA 3NAVA 4CQ8A 4ATDA 4QAIA 3AYTA 4LS2A 1QW9A 3BLLA 3N19B 1DQXA 2VRJA 3S83A 4IPIA 1TO3A 4QEHA 1WZLA 2QGYA 3NZGA 1GOXA 3QM3A 3UD6A 3VMNA 1H7PA 4AYSA 2B31A 4MZ1A 1WOAA 5E0FA 4ZOAA 4X9YA 2XU2A 3CHVA 1P0BA 2G4FA 2VDHA 1SU5A 3N18A 3HGSA 3URAA 4PCSA 1Q65A 3P0WA 3QR3A 1X38A 3IARA 3M5VA 4I5UA 3PK7A 4AAJA 3IUDA 4AISA 5F4WA 1WUFA 4ROQA 3GO2A 2OQHA 2G97A 2Z2BA 2AMGA 4B5WA 1JI2A 5LNVA 2HPIA 4QP0A 4DJEA 3CGTA 4S3CA 3EPOA 3W7RA 3OBEA 4C6PA 3R4IA 2IPFA 4GWEA 2ZA3A 1ITXA 1JEZA 3PB0A 3NNTA 1LF1A 4IWWA 5LIXX 2VR5A 3KUMA 2XIMA 3LPGA 1UROA 1FWHC 4ORIA 5DY2A 4UTJA 4UTKA 3A21A 2ICSA 3RM9A 3SO7A 3N13A 4Q4PA 2XH2A 1Q2SA 2PDYA 3SFKA 5EBAA 2BLEA 1HL2A 2BGSA 3QLDA 3W1NA 2RUSA 5MF5A 1NOWA 4QNWA 4DNHA 3SJ3A 1JYVA 4IM4A 1I9CB 5DEZA 5FJUA 1G0CA 3NQMA 3C8NA 3P7YA 1TWSA 4RPQA 2J7HA 3T2QA 3ITVA 1XYFA 2WJZA 4MJZA 2OX4A 1KM3A 1CXHA 2VWTA 1BYDA 3GFXA 3MSYA 3KM8A 4DI8A 4H9TA 4CCZA 3TOYA 3ZJ6A 1QASA 5G2WA 4LAOA 3MUAA 5CPLA 3AHTA 2WNZA 3N14A 1GW9A 2WZEA 1S5NA 1EXBA 1VAHA 3QMTA 4PMNA 3CHDA 3UNTA 5IBXC 2WJFA 4DUXA 3B40A 3ATZA 1VHCA 3PF3A 1WP6A 3STFA 3D3FA 2V3DA 2I14A 4HPHA 3W1MA 2CLOA 5CC3A 2FGZA 3RCNA 1XKYA 4A8NA 4OFCA 1GYMA 2CWNA 1W5PA 1RLDA 2OO0A 2V81A 3FAWA 2VFEA 3VOGA 3NFUA 1ZRQA 3S5NA 5EL1A 1DE6A 3BCJA 2PZNA 4RCXA 5JBDA 4OQVA 4Q8VA 3TIMA 3UR2A 4IQJA 2IW0A 4GI6A 4L6HA 3T0AA 3U4FA 2E6AA 2ZZ1A 3RPTA 3TYDA 1GVFA 1AMYA 4BEQA 1G4EA 2OJPA 1JULA 3A12A 3GG0A 4IJBA 3KZSA 3KVKA 3MBFA 1CI1A 4ZODA 4PTXA 1HP5A 3SCOA 2QF7A 1MNSA 1GUVA 2DDXA 4X0NA 1DJWA 3W28A 3PWGA 2QDGA 5BRQA 2DZAA 3LHYA 1KBLA 1DEDA 4P7QA 4Q4OA 3TQKA 3PTMA 4FNQA 5GJPA 2WBKA 2WV8A 4HD5A 1J18A 1K9FA 4UQAA 2EPNA 3APYA 1IT7A 3W37A 1JDEA 1DWJM 1MFUA 3ZT5A 1MUCA 5AYBA 1C91A 6PTDA 2D2JA 4O8RA 3U5YA 5LIUX 1ZCCA 3PG8A 4J3UA 2VZVA 2BBFA 3DFHA 4ZFCA 5BWFA 1BD0A 4P61A 4AC7C 2V5LA 4O11A 3V35A 4DJEC 4AEEA 4DJDD 5CBBA 3PY2A 1GTEA 2PMQA 3L4ZA 1KXQA 1N55A 4PTVA 7XIMA 5I23A 3C0LA 3SB0A 3SN1A 3OGVA 4EP8C 1CDGA 4MWAE 4Q33A 4S3EA 3SRFA 5J8LA 2FH6A 1V0NA 4JDYA 3IVUA 1FA2A 4QITA 4IJCA 2ZWZA 1B3YA 2G3IA 4AD3A 2PTWA 4Z17A 1C9WA 3OVRA 3NSXA 5FF0A 2IXVA 5LIYX 1XRFA 4AF0B 3VKBA 2XVKA 3N6JA 4KF1A 4GO8A 3LNMA 1AJZA 4RZ4A 3W7PA 3VGDA 4CNSA 4XB3A 1R7AA 1A4MA 3LN3A 3F7JA 3BK0A 1GVOA 3VIJA 4I8DA 1SJCA 1E73M 3LLXA 3FFSA 2FVLA 3AYVA 3L5LA 3PPHA 3CQKA 3NGJA 4CLMA 3B0XA 3LM3A 1NP0A 1EGZA 1J10A 4PFMA 3KWSA 4AZ6A 2ASHA 4LYRA 1QNQA 3SY8A 4L5ZA 4KBXA 3IRSA 1FHVA 3QPEA 1YDVA 3IV8A 1I8JA 3UQNA 3NVDA 1JRCA 4XO6A 3OLDA 1FDZA 2RDUA 3OA5A 1V3HA 3B9DA 2QIIA 1RALA 4MWAA 3L21A 1ODUA 3DECA 4L1XA 2BMBA 4RE0A 3WH7A 3UETA 1LWIA 3WEMA 2B0MA 3KCJA 2A6NA 2V82A 3B9AA 1K77A 3T6CA 1SW0A 3W86A 3V18A 4MUPA 3UA3A 4CVUA 1C92A 2GWNA 1J96A 1YBQB 1ONWA 1Q6GA 4ONVA 2NQ5A 1BQGA 2V3GA 5CPSA 2A3HA 3OZYA 3LI1A 3AC0A 1PZ3A 2ALDA 1SQ7A 4CN1A 2OT1A 5GPRA 4AD5A 3H6OA 3WDPP 4IOTA 4NXKA 4C65A 3EOLA 4UOZA 3STPA 2Y2WA 4BA0A 4XZ9A 1IWAA 1UJPA 4R3UA 3W07A 2Y7GA 3OZMA 1UR1A 4HZ6A 3FJNA 1TJPA 4JIEA 2CYGA 2FZNA 3AS3A 1HKWA 4Y7EA 2OXNA 1XYZA 1IEWA 4E2BA 2GYIA 3O6AA 5BRBA 2VOMA 1L2QA 4JX6A 1Z8AA 2INZA 1DWIM 5B7ZA 2WXDM 1WDPA 3GRIA 1AJ2A 4UC5A 3U7VA 4DX3A 2ZC1A 5E5CA 1OSEA 4WVXA 1BG4A 2BFGA 3GC5A 3STGA 2YCKX 1QK0A 1IR2A 3QFEA 4B5NA 2W5FA 2Y0FA 4GFIA 3A4JA 3W75A 1VD6A 4DZIA 3QV9A 3RMJA 4PN2A 3VNIA 1TMQA 3L4YA 3VUSA 4DNMA 1A5SA 3KL5A 1ZSXA 4AXKA 3F2CA 4XBSA 1OGBA 3APTA 4RDVA 4P7NA 3RPDA 1HKVA 2Y5JA 3L12A 1T96A 1U1UA 5AHNA 4E38A 3ZLGA 3LUTA 3H7RA 3IAQA 3E0VA 2ZIDA 3TW9A 2GGIA 2TRSA 5EMMA 4MYXA 1B3OA 4M19A 4MZYA 3BGJA 2OOFA 4IPLA 5I7GA 2C71A 3W0KA 1GZGA 2WPBA 3EEGA 4WD0A 5I5RA 1KCZA 1MRAA 3CMFA 3WF1A 3NPXA 3R2GA 3GNDA 1ISYA 3EWYA 4B90A 3LZ3A 1LL4A 2XIOA 3A64A 3VIOA 2PLKA 4GD0A 1HL9A 5D2TA 1E1CA 5LKYA 2F2KA 4Q8UA 3LB0A 4M82A 5HJYA 1IWBA 2V5KA 5C7VA 4E8DA 3KRZA 3AHYA 1UIOA 4IGHA 5GJMA 1PSCA 2MUCA 2P88A 4FEZA 1WOBA 3HFTA 2RGLA 3B8VA 3S4TA 1J5SA 1SO5A 3P6LA 3AMLA 2F7FA 5G5IA 3VD9A 1HUVA 3S9YA 3IIPA 3C4UA 3TA6A 4IMEA 3CQIA 2PWEA 1XIJA 5F7UA 2CBJA 1BVZA 1ME9A 2F61A 2FZDA 2FQIA 5IRPA 4L80A 1UKOA 4J3XA 1W5NA 7PTDA 3D3AA 4MWAC 4RE4A 1OIFA 3VIGA 4MNKA 1IHIA 3V5FA 1XFCA 3TNOA 3G0UA 1DIKA 3QSTA 3I6EA 3IJ7A 3W7HA 1PO9A 3N6HA 3NDYA 1ZBCA 2ZRZA 2AL2A 4ORMA 5A8MA 3SCPA 1MXDA 1HJWA 2QULA 1F7BA 2O56A 1E6QM 4IL2A 1F5ZA 4LVFA 3MV11 4TQTA 2OVLA 3PZTA 1XUZA 1TZZA 2AMXA 2XM1A 4NJJA 3BLEA 4I9JA 3CUIA 1FFQA 3K13A 1BGGA 2QV5A 2QAPA 5HAOA 1JIBA 5FJIA 4DLFA 3VIFA 1RPXA 3BO9A 3OLEA 3CH0A 1LOQA 1SR9A 5LYRA 3HB9A 4RKAA 4IMCA 4E5TA 4IGSA 3NG3A 3E12A 4HOXA 3F4WA 4KIRA 3TZNA 4HNUA 4DJFA 4DJDC 5D05A 2BOGX 4A3RA 1W5OA 3SJNA 3RR1A 2A21A 1SO4A 4H8UA 2OMAA 1THFD 3L66A 1XGEA 3A5FA 2NLYA 1XLDA 4AEOA 1RV8A 3VE7A 4C1LA 5LIWX 2G37A 1KCLA 2EKGA 4KRUA 1B2YA 5CZJA 2XH7A 3SUUA 3MZNA 3PUEA 1B5TA 3DIPA 4CU6A 2A5HA 2GVYA 4W5UA 3G1XA 2GZXA 2PWFA 4Z2LA 4XZNX 3EPMA 1EJWC 1VIWA 3FHAA 3W02A 2X41A 2ZZ4A 1FBAA 1ZZMA 1R2TA 3GDMA 1Z41A 2CWXA 3E2QA 1P0EA 3MP3A 2YYTA 2ZRVA 2XWDA 1HVXA 4A3HA 3N15A 4JHMA 4MMWA 1L0PA 3BDKA 1V7AA 4B91A 5GVJA 3B3DA 1UKTA 2WVVA 3S1UA 3WG6A 4JIQA 2ANUA 3UZYA 4JFVA 3TYBA 3BSMA 3HA1A 5T8GA 2Y62A 4HA4A 1MYRA 5HQMA 3IIZA 1NEYA 1SR0A 1ISWA 3FEMA 3L9CA 4JCLA 3VZYA 1VGAA 5FKYA 2H9AA 3GUGA 4E8CA 3W2KA 1IXQA 4IISA 3GDTA 4YXGA 5HANA 3W82A 3AFBA 4F79A 1UYQA 3TSBA 1K7XA 4UQCA 1UD2A 2FFIA 3KVJA 2PTDA 2O92A 6TIMA 4JFUA 2FVKA 3VA8A 4XZLX 4LUSB 4NY2A 3PBMA 3U2CA 3C3UA 3BZJA 1ME8A 3DFYA 1NDWA 3CO8A 5A8NA 4IXHA 2TPSA 4I9MA 4Y9AA 3V0TA 1YNQA 2XPKA 4RZBA 3JZUA 2B4GA 2YB4A 5BXPA 4WK9A 4YS1A 1R3YA 4DRSA 4A21A 3MANA 3MP5A 4GLEA 1JFHA 6TAAA 2FJUB 3HQOA 4UNIA 1BTCA 1YQ2A 4H1ZA 1J79A 4GOAA 3RIKA 5K3VA 4IHCA 2E28A 1EHNA 2X1UA 3CXOA 4GZJA 3WBAA 2J8TA 3TNBA 5CC7A 3NDZA 2P8BA 4JX4A 4ZMGA 3QPZA 1GEHA 4S3DA 2HK0A 3M46A 3TYZA 1KXHA 5IFPA 4FPSA 2A3BA 1JYWA 5EFDA 2FTPA 3DI0A 1ISVA 1V8EA 4UZUA 2NX9A 1UIPA 4A6GA 4ZB5A 1EXPA 1NDVA 4C1KA 4LJ3A 3GH7A 4FP1A 4KRTA 3IVSA 2Y7DA 4O13A 2ADAA 5U4NA 3NPVA 4IFOA 4POCA 5FF2A 3H2CA 4N2YA 5CLTA 2ZX5A 1X7IA 2E68A 2EGZA 4ATWA 1HJXA 4LF1A 3UWZA 1KW1A 4Q7IA 2C1GA 4HK6A 1LLOA 1MW1A 4W93A 1U30A 1P1XA 4O14A 3HM7A 2Z6JA 3FYPA 4L7ZA 3TUUA 1WUEA 1A3HA 3QN3A 3QV6A 3GZAA 4DJFC 4E0CA 4WJXA 3AIWA 4PUUA 1FXQA 2WO5A 3VFCA 3RHGA 4MB5A 1TV8A 4MZ8A 1ISXA 3O06A 3W3OA 1SSGA 1GWJA 4LS1A 2WB5A 1IGWA 4IFKB 3VI2A 3TU9A 1K8XA 2FGLA 3LQGA 3W7JA 4HBKA 4S3BA 3W81A 2DT1A 3T78A 1QFEA 4H6RA 1F4HA 1JQXA 1W0MA 4TU1A 2PGWA 4CKQA 4HJWA 4WY0B 4KESA 3VXGA 3TQVA 4DZHA 4XTIA 1LG1A 2WWCA 1FUYA 4ZFMA 3MMWA 1EFZA 1CXIA 2Y7FA 3IJDA 4DN1A 3O05A 1R8LA 3S8HA 3TKFA 1PCWA 3CT2A 5I07A 1VFSA 2QUNA 3AIQA 1A3XA 5RUBA 4JKMA 2QPXA 5FD0A 1FFRA 4AXNA 3L4WA 5AOUA 4O4VA 4AB4A 4DXKA 3G1DA 1H3GA 5F1UA 2QCLA 4ZQCA 3PC0A 3FIGA 1CLXA 1NFPA 3TN4A 1F05A 2UY2A 1K8CA 2B7PA 4O0KA 2FDMA 1PIFA 2E9BA 5I09A 2XIJA 4MYAA 1OJXA 1GYNA 3IS4A 5FF4A 4RZ5A 3HG2A 3A3WA 3SZ8A 3P60A 4I3GA 3GSMA 1Y5XA 4GUIA 4MOZA 3R8GA 2PTXA 3EB3A 5IDZA 3G0XA 3VX0A 1EA0A 3IIOA 1XYBA 5C70A 2ZTKA 3GAKA 3QOKA 2AQVA 1CLKA 4K1WA 4NJGA 3UXLA 1UZ1A 1W3TA 2Y5SA 1LM1A 3UWUA 4AQLA 2VEIA 1TYGA 4GIEA 2JGYA 4C7GA 1K03A 2V6AA 2CZVA 1TPFA 3KRUA 2OEMA 4AY8A 2YCJA 4JTGA 1NQKA 4P5UA 5HR6A 4MGGA 3GR8A 4OKDA 1W1YA 3S2CA 4A3UA 2A6LA 2W91A 1KKRA 3QC0A 1AQ0A 1D7KA 9XIAA 3W1RA 3POHA 1TPC1 2NXHA 2ZCGA 2QMKA 1QPNA 4Q8PA 3CIXA 3DHUA 2WOQA 4GACA 5HXMA 1A0EA 4WXZA 1QPRA 2YBTA 3PM6A 2XWEA 1OHLA 3BAYA 1DXEA 2C18A 5F2LA 2PDPA 1PB0A 4OUEA 1R85A 1O95A 1P6BA 2CLLA 4GUFA 1XIBA 1N2VA 4UBPC 4PUEA 5BXSA 3QYQA 4OWGA 2BDQA 1RPKA 4V27A 3CUGA 3ZR6A 2IPGA 1WDSA 2ISVA 2CXEA 2E7FA 3T0DA 3RX4A 2I17A 2ATSA 4GZ7A 1HZYA 3WSUA 3O7UA 1AH0A 3B9OA 3VM5A 1XC4A 1D7FA 1GTHA 3G1RA 2O4MA 5IHRA 1X1NA 4HHLA 4B9YA 2CLKA 2W9MA 3AMCA 3CT7A 3ID7A 1TSIA 1EPVA 3CL7A 1SM9A 3NQDA 1W1IE 5IDIA 1NQ6A 2J7EA 4RV8A 3V3WA 2IMRA 4DBSA 2VFDA 3MVTA 3WF0A 3CHCA 2WNWA 4K1GA 1UKPA 4HN8A 2YFOA 4Y8EA 1M53A 5HNUA 4NI8A 1SPQA 4XZBA 4FIQA 1NWRA 4AF0A 3H2EA 5FACA 1T41A 2XZ7A 2QCEA 4IICA 4NILA 5FI8A 4ACZB 1GVQA 4Z42C 1I1XA 1I2RA 3IJLA 5DXYA 2VEFA 1KBBA 2DVUA 3VIPA 1RQEA 3ZLHA 1GOKA 4AX7A 4DVOA 2VHLA 1A4LA 3LBMA 4JIPA 1Z42A 1QI5A 1JCJA 1HFBA 1LROA 3AXXA 3THDA 2QQ6A 1FTXA 4O15A 3T2OA 3B06A 4IXXA 1A0CA 2TYSA 1LJYA 3C52A 1NH6A 1UHVA 5GJNA 4U10A 2PA6A 3SCWA 1VFUA 4M5PA 4LWWA 1O5XA 1QBBA 4YWIA 4DBEA 4ZGYA 2Q8LA 4YIWA 1BF2A 3MP4A 5EKYA 2YL5A 4US5A 2V68A 1ENUA 2DGAA 3A22A 1YBQA 1WA3A 4IPNB 4IJRA 2Y7EA 1JYNA 4HHPA 2BX7A 4CCDA 1UD8A 4OBSA 1JZ8A 3LRMA 1GVEA 1X98A 4XIAA 1W8SA 1YIXA 3CJPA 1DXIA 3W38A 3O6DA 1UUOA 5HOSA 2GLKA 1CXEA 3PZUA 3UCDA 1ISZA 3HO8A 3KOZA 1UD4A 2WCSA 2YGYA 3L23A 1E1FA 4LAKA 5EA9A 3PUDA 4RUBA 3APGA 4M6UA 3M44A 3L4VA 3KAOA 1UPPA 4J3SA 5L6UA 4MADA 4UTFA 4K68A 1EPXA 2ZZ5A 3SADA 1C7SA 1KO0A 4GO9A 3EWCA 3KX6A 4Y9PA 1IIGA 1O1ZA 1R5YA 1VYSX 5G2HA 4DIAA 2WC4A 2PZ0A 1BHGA 3ZJKA 3BLKA 4W5ZA 1VJSA 4OOZA 2ON3A 3U2OA 1E51A 3MDUA 2QKFA 2YL6A 3H2NA 4V1XA 1Z69A 2J88A 5DMMA 1X97A 4K3ZA 1ZB5A 1XH1A 1TVLA 3NOEA 4IQLA 3VDCA 1JD9A 5I3GA 3N11A 1KKOA 3IIVA 2VGGA 3PWAA 3LZ5A 1XBYA 2E6YA 4P7LA 1IT0A 3UG3A 3B0PA 2NT0A 1KFLA 3SN4A 3W53A 1XBXA 3KTSA 4NF7A 2D0GA 1JPIA 2A2IA 4M8UA 1P1MA 3L2IA 5LNRA 1YADA 3T55A 2DT3A 5EB8A 4PUNA 3KOYA 4UR9A 4FNRA 3MHGA 1VFOA 1XLBA 5DT7A 1EH9A 1KM6A 3RCYA 4DAIA 3KE0A 2REQB 4LS0A 5FEWA 5E1QA 3B8TA 1ZHAA 3IRDA 3PBYA 4QDPA 1TTPA 2XDFA 3AWOA 3VINA 2V38A 4RNHA 5CXPA 5D09A 3P62A 1M68A 3DFPA 3HGRA 4GCXA 3VGHA 4JKKA 1JVNA 2OSWA 2ZUTA 2Z29A 3EMQA 3VU2A 2XFYA 3ERPA 1WKYA 3U48A 3UFYA 2WVSA 1XM3A 2DSUA 2C7FA 2DZUA 1Q6FA 2HPMA 3DU0A 3FVDA 2W79A 2ACSA 3P81A 2GVLA 4GJJA 1AH4A 1DVJA 4H2HA 5I79A 4W8BA 4B16A 5AHLA 2X8RA 1Z44A 3GFYA 1JNEA 4AMAA 3RU6A 1TPUA 2PWGA 4DXXA 2BP1A 2A3EA 4RK8A 3RM4A 5E6ZA 8A3HA 3R58A 1QO2A 4G6CA 4M7TA 3GU1A 3TR2A 1GOIA 3UXIA 2DP3A 2BASA 2GOKA 3W29A 2GSEA 1ZQ5A 1F07A 4CQ9A 4PTWA 5D8WA 1C8XA 1EBGA 1F3WA 4GYJA 1PJ9A 2CCRA 1TMLA 1XH0A 3VAVA 5A94A 2QYGA 2J79A 3RXZA 3WFZA 4RL3A 2YSWA 2CZFA 1O68A 5EU9A 4JCMA 4ZBCA 2P50A 4HHMA 2IKGA 3OGRA 4AD0A 2J25A 5F2IA 4PULA 2EG8A 2VGBA 3WUEA 8RUCA 1AZ2A 3QTPA 3G0SA 7TAAA 2O0TA 3UCQA 3CLMA 3LPPA 3SRDA 4CNPA 2BGQA 1VENA 2BVDA 4NG3A 1XQKA 3PSVA 3L5MA 2QAFA 2PWVA 2WC7A 5HK4A 1TG7A 1ZL1A 3LMZA 1BXBA 1Q6DA 1SZGA 3NM1A 3S5SA 1Y0EA 3AXMA 1I2OA 5IHSA 4EKJA 2PDJA 1UWAA 2QDHA 2VX7A 1VLIA 5CLWA 3R7MA 4Z2JA 2OZ0A 4ZXLA 4EK7A 5EFFA 1PVNA 4H6EA 4GY1A 1TV3A 4H9XA 2HTMA 3B0UX 3TJIA 1WBJA 3NQCA 1JF5A 2QVNA 2VX5A 4JD4A 4JICA 1K7FA 5BMXA 1JFXA 1EGMA 1CGWA 5A1AA 3LYEA 1BYBA 3MVIA 4NUWA 3TAKA 1LRTA 3EDEA 2BZNA 2VCCA 2D73A 1TQXA 2XN2A 3BCFA 3NO3A 3UXDA 3WD0A 2VM8A 3KEHA 3VNJA 3M5ZA 2DU2A 1ADDA 5CBIA 3TQ0A 5D2YA 5EMJA 4ES4A 2G95A 1LQAA 2G8ZA 3ZVHA 7ENLA 4XBJA 4LRSA 1XP3A 1TMHA 4XSLA 2YFNA 1M7XA 3OLGA 2GSHA 2O9RA 4D1IA 1FQ0A 3P5YA 1H7NA 3ZXWA 1S39A 3MT1A 3LLFA 4H3DA 2F6XA 1H4PA 5KITA 1GPFA 1OCJA 1F8IA 1PS9A 5CJ5A 4WSHA 4BEUA 4KCWA 2FVMA 4AZBA 3WK2A 3ZJ7A 1J0YA 2TSYA 3KFTA 3ABOA 3U7BA 1P7TB 3CV7A 3SIMA 3MU7A 1ZTVA 4KCUA 3SQLA 3BOXA 1W9VA 4XK2A 4FHAA 1B4EA 3AUOA 1XD0A 3CZGA 4UB9A 1V79A 3M9YA 4XX6A 3E96A 1SW7A 3P67A 2ZXDA 3L0KA 2PCQA 3EX4A 2VWSA 3UJSA 1S5MA 4LUSA 1IEVA 4H9VA 2R8WA 3UWWA 4CNUA 3CMJA 1Y5WA 1OX6A 1DJQA 4JTEA 3LU2A 4J35A 1RCOB 3V1HA 2DY3A 1KCXA 4XISA 2FYMA 1GGOA 1LWJA 1Q3NA 1K6WA 2QDEA 3CIWA 3PUOA 1Y65A 3L4TA 2BOFX 3C3NA 3C5QA 4I7UA 3SAZA 1CENA 1TPVA 2IPJA 4XAYA 4RE3A 1KRAC 3E02A 1R3QA 4NU7A 2VZUA 3GNXA 4F0MA 1M1BA 2ZZ3A 2QLYA 3W7CA 2DJXA 3GY1A 4YU1A 5SWUA 3PJWA 1KNWA 3PVFA 3QR1A 4PMJA 1QXLA 4B5VA 3ORWA 1FWBC 3ARRA 2WLZA 1KLZA 1W54A 4S1FA 1V4YA 4HTYA 1GJWA 2DW6A 4MSSA 4CNOA 1CLVA 3S9IA 1FDJA 1IYXA 2OZ3A 3XIMA 1AD4A 2VEPA 2VTFA 2RHGA 5M5DA 4C6CA 3E2RA 4JX5A 3V75A 1V6XA 2A3LA 1QJWA 1T7LA 3F5LA 3QGVA 3N2OA 1FWEC 3ELFA 1KC7A 4IUGA 1VP5A 3I7QA 3EDKA 2GJRA 3WJSA 1ZJAA 1V3LA 4G8TA 3BAXA 3C8FA 2X7VA 4QG8A 4MY9A 1DL3A 2VVNA 4GKLA 3W72A 1JQVA 3AISA 1R3VA 2X1TA 2H3DA 1T5AA 1JG9A 4LQ1A 2FMNA 3CUJA 4IFKA 2NV9A 4J7RA 3K8MA 5HBFA 1DJYA 4FOJA 4JTLA 4L1WA 3NCOA 4QLLA 3FA3A 1PIIA 5C5YA 4K8GA 1YXYA 4GXPA 2XUCA 3GVRA 3L7RA 2QGHA 2I57A 2UV8G 3P74A 2E67A 5C54A 2X40A 4I9TA 3F2DA 1YHTA 1EBHA 3W74A 3GHUA 2GDQA 4LUJA 1RVKA 2YL8A 5A6SA 2QVHA 5A2AA 2ACRA 3I6RA 1O1HA 1W56A 4JTSA 1P43A 8XIAA 1CW2A 5LA1A 2WSQA 3QZAA 3ICJA 1FWNA 1EQCA 2P53A 4PA8A 4PC8A 1C7TA 2V63A 1S5VA 3OQEA 3MJYA 1EWDA 2J78A 4C6DA 4NZCA 3EBVA 4RE2A 3ARZA 4Z0JA 1UCWA 4BQ2A 4D6JA 3H2AA 2WNNA 3SW6A 4QS6A 2QV4A 1OQFA 2DZPA 1XW8A 2ZX7A 3GZ3A 2X0HA 3UBPC 4UMCA 2WPGA 3LPFA 4GUJA 3W26A 4YHEA 4E8GA 2RAGA 3WF4A 1KLYA 5ABHA 3IANA 4QHRA 1PIGA 4LVDA 4DAFA 1VFHA 3JRKA 3BLIA 2Z28A 4O1BA 5XINA 1S5TA 2IQDA 4GABA 4H7ZA 3H21A 3G2GA 3SUWA 3R89A 2ZUVA 3CV2A 3HJEA 4UTLA 1GPWA 1JZ2A 4EXQA 1H7WA 2PDQA 3ARWA 1QO5A 4BWLA 1VEMA 1TREA 3LGGA 1VFFA 3VOFA 3VPLA 4AIOA 3Q37A 2PU1A 2DSWA 5FJPA 3GHTA 1L8NA 2BB0A 4BI5A 2QCHA 1PDYA 1O12A 4QSFA 1GOOA 3BG9A 1J5TA 4KWSA 3SUSA 5EMUA 3GNPA 5HMFA 5AZ0A 4FR6A 4V1YA 3TH6A 2VFFA 3JVAA 2V0TA 3HF3A 2DV0A 2XYLA 5CBJA 4KIEA 2AKZA 1UR4A 4S3FA 4UNLA 4ZO6A 1J01A 1XLMA 2GPTA 4CN6A 1X1ZA 3GBDA 1MEHA 5LGXA 3HJZA 4G7FA 3FY1A 3MCOA 2YLAA 4J27A 4ZE5A 3O63A 1IV8A 4J5NA 1E4LA 1XI3A 1XLCA 2L5HA 4XG1A 4PTDA 3SEPA 1W1A1 2CW6A 1Q66A 2OYMA 3UZJA 1OF8A 2DIJA 5AC7A 4ZR8A 1V5XA 4WDUA 2OSXA 2YYUA 4QQUA 1DHPA 4F9JA 1XGZA 3OVPA 2XZ9A 1ONEA 3QTGA 5J5RA 3WLJA 1E0XA 1JXJA 4LF2A 1L6WA 4OJYA 2HCVA 2DIKA 3NZQA 3WBXA 3T7VA 2R1NA 3NQVA 3S3GA 4AIBA 4RJEA 4ZSUA 3NR0A 1OBAA 3NQ2A 3PZVA 7ODCA 1EP3A 4PODA 3FJ4A 4HMEA 2DZSA 2X05A 1NARA 3AICA 5JQ9A 1QU4A 2R1LA 4ACZA 1FRBA 1NU5A 4C6BA 3TCSA 4QGCA 1WYIA 1TCDA 2V69A 4WJEA 4Z0SA 3OHIA 3QQ1A 4O1FA 2ZDRA 4NNAA 2F9RA 1OD0A 1PTGA 5A8OA 3CO4A 2B7OA 1N8FA 1P0NA 1QK2A 2DPEA 3TTQA 3VE9A 5BXTA 2X30A 2X16A 4GY7A 3ANYA 1REQB 1JPDX 3BICA 4XD6A 3URBA 4MTVA 2VDIA 4D71A 4HPNA 4HNVA 4DZ5A 2FPVA 3L2MA 2ACUA 3RFAA 5CPTA 4NAEB 2ZA1A 3H55A 3HPSA 2ZE0A 3LXBA 4L9ZA 4CN4A 2VURA 3GW3A 1HKKA 3CUHA 3LXAA 1MQRA 5T9CE 1OFOA 3PN8A 2XM2A 2OELA 1A5CA 3QQ0A 3EA2A 5CPQA 1TUXA 3SCSA 3MKCA 3EMCA 4DBWA 3KP0A 4A3QA 1BFNA 4NJIA 4JTJA 3E0LA 1OF6A 4BQ3A 2EO7A 4JQ3A 5D2VA 3HPAA 4HCDA 4DWSD 3R0KA 2Z24A 2JALA 4JNZA 1GEQA 4NXSA 4HT3A 3BAKA 4GJIA 3LCFA 3PS7A 2C91A 3DEQA 3DOPA 1S46A 3OBKA 2GQ9A 4BWLC 3V7PA 3MMTA 1HIZA 1KQYA 2ISFA 5HPCA 4R9XA 4JIHA 1UB3A 3KS6A 1G01A 3SSJA 3QLLA 5HA7A 1E72M 4PMRA 4KCVA 1YNPA 4MNLA 3UY7A 4IL0A 4QIUA 4UTHA 2QJNA 3ZR5A 4N02A 3MI2A 3ZS4A 4N9CA 1W9UA 1HTIA 4GRSA 3GDRA 3A4AA 2NV1A 1HJSA 1GZ1A 1M65A 4L4MA 3NSMA 1U2YA 1XKJA 5KMYA 3QQWA 2PDNA 2NSXA 2NVAA 1DIOA 1XLIA 2VI0A 4WX2A 3BJFA 1GKRA 1XIIA 4IGNA 1N82A 4C1NB 1H7RA 1EGVA 3DYMA 2QUUA 3FYOA 2VUNA 1QI3A 4AHQA 1ITCA 1K6AA 4FXRA 4TVUA 1RCXB 2YA1A 3IVTA 1YTKA 2FJKA 2D1ZA 4IIGA 1X6LA 3M7SA 2E40A 1TJ0A 5D38A 2NQHA 5F2MA 4GVFA 4WOZA 5M03A 1OEPA 5XIMA 3TTEA 2A85A 1AMKA 1L2UA 4L9YA 4MAVA 1EDGA 3SECA 2A7NA 1BG9A 3QMSA 2DQWA 3SN0A 6XIAA 4NQ1A 1NFGA 1M5WA 1IEIA 5CAKA 2GVGA 2IUZA 1UR9A 4GC4A 2REQA 1VKFA 3ARUA 2JEPA 4HU4A 4AY1A 3PJXA 1F6YA 3TK7A 3RYSA 3W7OA 3CPUA 2SFPA 3OBAA 1AODA 2QJJA 2YCIX 1GQLA 1UWIA 1F6KA 3WNMA 3BLFA 4E3VA 4FLSA 2VRQA 3OODA 1LBMA 1RXOB 3UPBA 4NYYA 1MW0A 3VOHA 2PLCA 3GHRA 5AECA 4GHRA 1PKMA 3GVWA 4Q8MA 2BTMA 3WLSA 3GR4A 4DEFA 3VIKA 1LTDA 1XBZA 2JE8A 4HGXA 1SO3A 3RMEA 4A05A 1HW6A 3TN3A 2OG9A 3HMJG 4Z2GA 1B3VA 1EZ2A 1AZ1A 3FDKA 2WMHA 5JH1A 4M24A 3LCIA 5FSDC 3V0SA 1S2TA 3OZOA 4LUYA 2OQLA 5EMLA 3PZGA 1YXCA 4GQBA 1ZENA 3G1FA 3ZJ8A 4D6FA 3EOSA 2BVWA 3R11A 1XIHA 3W1XA 2HVNA 3AO0A 5H2ZA 4H9MA 3WIJA 3TSDA 1KTBA 4UFJA 5CZTA 1WPCA 2A1YA 1WXJA 4O28A 3WH5A 2E3ZA 3AU6A 2G3NA 2WAGA 1EC7A 2ONEA 4MLRA 1ZAJA 3C61A 3VIMA 3YPIA 1Q7ZA 5G4EA 4JTUA 1J0IA 1OFAA 5BNKA 1Y5VA 4FXFA 4UWMA 3SCUA 4CD6A 2BSLA 4LUTB 4HHHA 2OWXA 4L4OA 3OIXA 4JNMA 5LNUA 4O4WA 2I5IA 4LCQA 4DO5A 3WLTA 3ZFHA 4PCTA 1TPWA 4HB7A 4MJMA 1SJAA 3S1VA 4X2RA 1XDJA 5D04C 2J77A 2G3JA 3K1GA 1F2JA 4S39A 1C29A 3TW7A 4IQEA 2PE4A 1BGAA 3K5XA 3CV1A 2HS6A 1BKSA 2Q01A 3ONBA 4HTBA 4DI9A 3BVJA 3FXYA 3N4EA 4W8LA 2E09A 4PYSA 4JTTA 4K36A 4OUIA 5GNXA 3AJ7A 3FK4A 3RN6A 1QPOA 4ERGA 4QNEA 2Z1SA 1XWYA 2VZSA 3KLLA 4J40A 3DC0A 2VMFA 5DT5A 3AHZA 3USZA 3GNNA 5T26A 4J3TA 4MKVA 1JCLA 3B4UA 5DO8A 3IK2A 1V3JA 5A2BA 2BHYA 3RJXA 4EX4A 3S2JA 1PHQA 1K4HA 2RFGA 3EKLA 5EMKA 5KTLA 1GVYA 3PZQA 4R7OA 3E49A 3C0JA 2J9YA 3WLOA 2WMKA 3O15A 2G96A 4IPPA 7CGTA 4DO4A 1KM4A 4NHVA 5C8BB 4A8IA 1PCKA 4B2DA 1S2UA 4TUFA 4M51A 4AZCA 4O57A 2YBVA 4O0QA 1RUSA 4KEZA 3WY1A 1JR1A 4IUOA 4QJ4B 5J5DA 2I16A 3W22A 2GFTA 3RLGA 5DMYA 2G0WA 1IGSA 1J2WA 3WMBA 5I03A 1VPQA 3RUBL 3SQSA 1P48A 5AFDA 4YN5A 1OK4A 3DFSA 3WK1A 4UFLA 5FSEC 1D3HA 1ZJBA 4Q4QA 3OEXA 1VEPA 2HBXA 4BQ4A 1WKEA 5DELA 3W71A 3Q4DA 3LHTA 3G18A 3R8HA 1E4MM 3NEHA 4ZO7A 2QPSA 1P0DA 4CNNA 2I1OA 2RJHA 3M0YA 4CUCA 2PBGA 1EO7A 3MWCA 2XVGA 4QLKA 4JTRA 5HMSA 1P7TA 2W27A 4DUOA 2C15A 1QOQA 2GJPA 4DXVA 4DF1A 4XD4A 1X8CA 4PTMA 1A5OC 1GYLA 3VNZA 1CWYA 1ONRA 4Q8OA 4F48A 4KWWA 5CG0A 5I3KA 2RKXA 2NVDA 1MDLA 4GXWA 3AOFA 5F2GA 4QM1A 4EWND 1W6TA 3LBOA 4A8RA 4KKXA 1KQZA 4QFUA 5AN7A 3M1ZA 2AGTA 2WMIB 2VDGA 4W89A 1VR6A 1F4AA 3GM8A 3KBMA 3TCEA 4IP7A 5KINA 5JIWA 3WQGA 2XIIA 3ITLA 4Q4MA 4Q7NA 1JCYA 1EP1A 5ABEA 3MYOA 2J8GA 2V8ZA 4ZOEA 1BAGA 3NIYA 3VKDA 1H1NA 2O55A 5A6TC 4S3AA 1BXNA 4O18A 4IMFA 3H22A 3M07A 4WF7A 4H9UA 4E2OA 1I75A 4QTGA 3W2LA 3WNPA 4U2YA 4ERIA 4AVOA 4HJFA 1YPFA 3ZQ9A 1UH2A 4RW5A 1KRCC 4MM1A 2O7QA 3DENA 4IMGA 4V2XA 4BI7A 1BEUA 3AHVA 4W9TA 1BVWA 3P5ZA 3L2LA 1DIEA 5A8PA 5CJMA 1LDCA 4HPGA 4OZOA 4RR4A 1JZ4A 4IZGA 2E0PA 3DESA 1I6NA 1YPXA 5XIAA 1IZCA 3WJZA 4AFYA 5MKGB 4WIWA 4G1NA 1YX1A 1ZU8A 3HV8A 4LNYA 4JIIX 2Y5EA 1DV7A 3DYOA 2YJQA 4G9PA 3S5OA 3L4XA 3RILA 4HIBA 2PD9A 1JPKA 4M80A 2VX4A 4WLCA 3WQ6A 1G7UA 3VGGA 1TCMA 4RPPA 4KS0A 5F4XA 4O1DA 3W7MA 2DUXA 1NDZA 1K3UA 3WLQA 4BFAA 3VZZA 1M01A 4CU7A 3B8IA 5KZ6A 3EWXA 2CZ5A 1M9HA 1U22A 1RH9A 3EGJA 4UTUA 1XQLA 1I1WA 3H2MA 1XHGA 2I5GA 3NZ1A 1S3TC 1Z3NA 3THUA 3VCCA 3N1AA 2EKCA 6REQB 2PDGA 2PC8A 3EKGA 1RY0A 3CPRA 1EEXA 4F0SA 4AZIA 1KR1A 3VNKA 1OCNA 1T8XA 3SSZA 4MG4A 4EPDC 3SCVA 1SJDA 4Y8FA 3TYEA 3W4RA 2PU0A 3VILA 1BWLA 5FESA 1GQKA 4I6KA 4DQWA 1QOPA 1XSIA 1JJKA 4KQNA 4B3ZA 2D22A 4MAZA 3ITXA 2EG6A 3NVTA 2C13A 3RAOA 1OGGA 2NXIA 4Q8WA 3NDOA 3UA4A 4JGDA 2QCMA 1F8MA 1JUEA 1FOBA 4XAZA 1DTNA 3GLCA 4UR7A 1R38A 8TIMA 3M5XA 4HKPA 2NV2A 2NQ9A 2V5CA 5LHEA 3UT0A 3NL2A 1WX0A 5DCDA 2W66A 2PDHA 1BQCA 1ME7A 4LEFA 1S3HA 1Q13A 2ZWYA 2ZUUA 4MIMA 1UUQA 1RSCA 1OB0A 1H11A 4LB4A 1DE5A 5AHMA 3A5VA 4EXBA 4YTQA 3E3HA 3NZRA 3WBEA 2A4AA 2DEPA 5HINA 1KFJA 3W1LA 3WBYA 1EDQA 5FL1A 3B03A 3BG3A 1QT1A 1QPQA 4JNYA 3EA3A 1OK6A 4X9SA 3GTXA 4X3ZA 4LOCA 3G6MA 5TIMA 4S2BA 4A4AA 1IF2A 4WR3A 4RXGA 2PDKA 3WNKA 2J9ZA 3CH9A 2BXVA 3GXTA 3LCHA 2V3EA 3RU8X 4W7UA 1EB3A 3E5BA 2BXZA 3K4AA 3CMGA 4CU8A 2BGNE 5JU6A 4HK5A 4DY1A 2YW3A 3DHDA 2XSBA 4GBUA 5DY3A 2NUXA 2VD8A 2GGHA 3OTRA 3WQCA 3N2TA 4JN7A 2ZX6A 1UA3A 4Y90A 3WUFA 2FHBA 1TFVA 1PZ2A 1SO6A 5HATA 1SSDA 5CPOA 1E6PA 3CAQA 1R9ZA 3GQYA 1Q6LA 3GU9A 1R6WA 6ALDA 4KWOA 1RY8A 1ZALA 1GJPA 4JQ2A 2KX9A 3EXTA 3C2RA 2PURA 3M41A 3N12A 1JZ7A 2ZKMX 4GG9A 4HN4A 3AYSA 4OHQA 4D6HA 1B9BA 3NQFA 4FXSA 1W2VA 3DG7A 1H1YA 3CZJA 4IFRA 3EOEA 1XYLA 3QHNA 1G1YA 3IGSA 2JKAA 5D9MA 4WGXA 4UCFA 4OE7A 1OWQA 1E71M 5A2CA 3GBEA 4RNIA 1V02E 1MEIA 3LPOA 5EY5A 1C90A 4XZIA 4D2JA 4UTMA 3L68A 3KTCA 2X1RA 4CD5A 3CZLA 1AK5A 1G7VA 3KOWA 5D4YA 3ZMRA 3M0HA 1HGYA 1HL8A 4IQDA 1KM2A 2FLIA 3JU2A 5FA5A 4O53A 2QR6A 3WJWA 1E56A 3SRKA 4PBFA 2BWGA 3LERA 4U5IA 4JBRA 4GQ0A 1UD6A 3WQWA 2Q3OA 5JXQA 3WQ8A 2VCBA 4L65A 2GK1A 3V5OA 3S6TA 2Z4GA 4NL1A 5JH2A 3OIHA 4V15A 4H19A 1MFVA 1GQJA 2F8QA 1WBHA 2HK1A 3W23A 4C5ZA 3FGCB 5MHBA 3JZEA 3VDAA 3QY7A 2X2GA 5JBFA 3KHJA 1UC4A 1HVQA 3BG5A 4Q32A 2HBVA 2E5DA 4KH2A 3UPMA 2WW5A 3TX9A 3CEUA 3VC6A 1LL7A 1DPMA 1C8QA 3ZO9A 4C91A 1TX0A 2VCAA 4UMBA 4XZWA 2JF7A 2G4JA 3NQBA 1XLGA 4LY8A 1V02A 1QW8A 4DB7A 1TPEA 2JGQA 1PKNA 1SZFA 1UH3A 2BY0A 3N9SA 5LXEA 1B3XA 1VH7A 4B4FA 1QDSA 3ONCA 1JYXA 1WZMA 4PMOA 4GUHA 2D20A 2YX0A 4NJHA 1QNPA 2FIQA 1W9XA 1REQA 4KMQA 3R1ZA 3M0ZA 1LQ2A 3O07A 5DLCA 1ZP4A 3M64A 4KEVA 4JTQA 4NX0A 2C14A 5FAJA 1AFSA 5M3WA 3SGGA 3O6CA 4AVFA 3UPWA 3MI3A 4NAEA 1NF7A 2V2CA 3C2FA 3LSBA 3MUXA 3NM3A 3I68A 2XN1A 3OJGA 2J7CA 1LORA 3MUCA 1RP9A 3N25A 2ZRYA 3W85A 3WFAA 1V3MA 1BWVA 4HCHA 1R2RA 1EC8A 4C6NA 3SFWA 1W3NA 3TN5A 3V16A 1FVPA 3M0IA 1FWTA 3S6DA 4HZ8A 3BW2A 1AW1A 4U28A 3UJEA 2PPGA 3R0DA 3CWHA 2ZRXA 4B3KA 4R53A 2BHZA 1RP8A 3ABXA 1L6SA 3MO7A 4EANA 3FW6A 1EQPA 1XYCA 3K30A 4MFDA 3TFCA 3SCNA 2GGJA 3RPMA 4AWEA 2QMJA 3S42A 2WJEA 1GT8A 5AVNA 4BKNA 1EJVC 1I45A 4RNFA 2ATMA 4BQ5A 2WBGA 2GGEA 5DCEA 3CQJA 4C6MA 4FNTA 3ARXA 3Q94A 2GDUA 2WHJA 1YTEA 2EXOA 4D6CA 1FWFC 4PBEA 4PSRA 3EKZA 1PYMA 1VIZA 1SFTA 3EWBX 2Q3RA 1UMLA 3ARSA 4TXEA 4OU1A 1V6TA 3ZZ1A 3MKKA 1E6SM 3B8SA 1XRVA 2XVNA 5T91A 4YPJA 4V33A 5M1TA 3S5YA 1JRBA 5G1MA 5BOEA 4ZOBA 4OV9A 2PWDA 5C7HA 2FZ9A 1W32A 2YA0A 3PBWA 4CQAA 3N29A 1A5BA 3PBGA 2VKZG 3QSRA 1VHNA 3OGSA 4EAMA 4HSNA 1TVPA 1UC5A 1AW5A 5CPMA 5D32A 2X09A 2BG5A 3VC5A 5IXEA 5C9WA 4C1NA 1RK6A 5C71A 4O54A 3KRBA 3G22A 2XIQA 4YHGA 4FI4A 1W5MA 3O16A 1AQMA 1P6WA 4JKLA 4FNSA 2DZWA 3ABRA 2A0NA 1B1YA 4W86A 3BGGA 4H8HA 2DH2A 5D8ZA 4O52A 1KFKA 3NQ7A 2OWCA 1NSJA 3F4DA 1H61A 1ONXA 3ZSTA 4Z1AA 2ZADA 3E2VA 3WH8A 4PR4A 4ZO9A 2YLLA 4A2RA 4KGLA 3VIHA 3KRSA 3R10A 1P0KA 5KEZA 4UTIA 1A3WA 1CZ1A 2FPTA 1VCGA 1NP2A 2PDXA 3OU8A 1WO2A 1IZJA 4B5UA 5A69A 4S3JA 1O5QA 4MKNA 4H6QA 3GS6A 3U6WA 1JGMA 2PP3A 3T4WA 1IXOA 1FWAC 1E9LA 2IQTA 4DJDA 4JHOA 4PMXA 2EPMX 1UR3M 4DM2A 3R94A 3WLMA 1YYAA 1Z9AA 1PX4A 2YDQA 3PZMA 1YTDA 1KGUA 1XC6A 4J3WA 3AS1A 5G4HC 1KFCA 4CQCA 2A3CA 4FX7A 2CXGA 5FF7A 1JDDA 4NX5A 1RAKA 4H04A 3M0LA 2C1HA 3UP8A 3BLDA 1R47A 3PNUA 3B05A 3MSDA 1WQ5A 4S2CA 4AYGA 2YDSA 1H0IA 4WDTA 3LNPA 1V6UA 2GQ3A 4WUIA 1K4GA 1RZMA 1L8PA 3CLWA 4LAZA 3QRHA 4O17A 2Y24A 3H2OA 3K8LA 3PTDA 1MI3A 4LVBA 3VCRA 3LDVA 1Q2RA 1B57A 5EGRA 3AALA 1OC6A 3DN5A 3G8EA 3UW6A 2RDXA 2GJLA 1CIUA 1HO1A 4CGTA 4LB3A 1CGTA 1POKA 1UJQA 3WMSA 1JNDA 3PB2A 3VGFA 1TV2A 1YMYA 1Q8JA 1UWRA 1ZAHA 1N8WA 4HYWA 1WKFA 2PDMA 2YPIA 4HA0A 2NLIA 4MJ4A 5A6LA 1UR2A 1EC9A 4FIRA 1LG2A 3UG4A 3GVVA 2P76A 2WC3A 3QXBA 5AYYA 5CPNA 1TVNA 4AU0A 3EX2A 3LI0A 3GNRA 3WK0A 1GCYA 4JOMA 4L56A 5A6BD 1TA3A 2VO5A 4NYUA 4XKYB 3HPZA 1R3WA 3M6YA 4GQQA 3HURA 2X1SA 3O9NA 3DG6A 2CZEA 2V67A 5C55A 2PDWA 2PBOA 3R0UA 3VMOA 4PRTA 1RBLA 3GXPA 2OEJA 3LLDA 1H1ZA 2YR1A 1P4CA 3WL0A 3W7LA 3CL6A 4YMZA 2W3ZA 2Z1KA 1AJ0A 3GTHA 1HX0A 1G5AA 4B15A 5B80A 4I7WA 4S3GA 3AS2A 3NO1A 3KBJA 2WM1A 4LAMA 3GKAA 4W7VA 3USBA 4C6JA 1V3KA 4UUIA 4NNBA 3TLQA 4GGBA 5ABFB 3IJ6A 3V4BA 1PXGA 3MQTA 6XIMA 8CGTA 3TMLA 5CSYA 2C79A 3URNA 2OYLA 3RRAA 4MPKA 3I3BA 1EJUC 3ZM8A 3M47A 1O6IA 4AD4A 4HP5A 1XLKA 1JF6A 3EWZA 1Q85A 1UBPC 4S23A 3U57A 3VKJA 3RITA 2QUMA 4WOQA 3B8UA 3VNMA 1F74A 4AWTA 2XFRA 3H24A 3VOJA 4KWVA 2V5JA 1E0TA 3W2MA 4GNJA 2XG9A 4LPCA 4ZQOA 3AXIA 1KM1A 4QAWA 4IH3A 4CCEA 3RG6A 1E0WA 3TE9A 1Q6RA 1ADOA 4C6OA 4F2TA 4C6FA 3H4XA 1AD1A 1DHKA 2CETA 4LVAA 4JY9A 4FB7A 2BS9A 3QW3A 1Z32X 5AC6A 2JFEX 4NZ3A 2CBIA 3WQPA 5LIKX 3TONA 3ZLFA 3CWOX 1POJA 4J2PA 4QJ5B 2ALRA 1RD6A 3NL5A 4AW7A 5A5WA 2VT0A 4IIBA 1PPIA 2RH9A 3OG3A 4V28A 5K9XA 4I9AA 4RLIA 2VEGA 1M3UA 4A2SA 4JQAA 2D2HA 3KBSA 1FWDC 3FAXA 3C2OA 2WYSA 4GYFA 3T09A 3NEVA 2WMIA 4XV0A 1KFEA 2JBMA 3ANVA 1QHOA 3W84A 4ZEPA 1I2PA 2QCDA 2GDVA 3S2LA 1FWSA 2VC6A 2VD9A 4OT7A 1GVRA 4JHZA 4PBGA 1RLCL 1UQZA 5CEWA 3ZR4A 3RLVA 1LUCB 1A5MC 1B3WA 2WCGA 5CJNA 4M6VA 2WHLA 2CLEA 1OY0A 1YE4A 2EQDA 2IQ0A 4DZAA 3L67A 4J2MA 3GH4A 4CEUC 1KTCA 1PX3A 4TX8A 1E1CB 1PDZA 3VNYA 1KXTA 3D0CA 4LV9A 3W6LA 4OGZA 3I4EA 1KWGA 3WH6A 3LXCA 2Z00A 5H8PA 4HA3A 4BR1A 2VRKA 3U0HA 2VELA 4FZIA 3LCGA 2DT0A 4ECLA 4IIDA 3NQ6A 4WSKA 3F4VA 4ACYA 5I78A 1DWAM 1R3SA 1FCUA 4ZQRA 2XHYA 3V1PA 7A3HA 5MKGA 3HG4A 3VYLA 1OCQA 4KWUA 4HZ7A 5DCBA 2PDIA 1D9EA 5HJLA 1ZCOA 4FMVA 3CYJA 1SVDA 4PUJA 4XAFA 4QG9A 3HOJA 3N73A 4ADUA 3CM4A 3S1XA 1UASA 1K8ZA 2PCEA 5CG7A 2PF0A 1O60A 3I6TA 1F6PA 1AQFA 1IZKA 1NIUA 1AW2A 1VBRA 2UY3A 4GI9A 1YE6A 5HNRA 2G5WA 3AMDA 4ZZ9A 4EVZA 2D23A 3R12A 4N9DA 3QGKC 1EJ7L 3MCMA 5AHIA 3WYZA 2UZ9A 3C2EA 5M17A 3S2MA 1E6ZA 3BMXA 5G1TA 1C8VA 3B0YA 4NP7A 2PS2A 2ABAA 3B9NA 1A5NC 4HMDA 1J2BA 1R9XA 3GXDA 1JZ3A 2YXXA 2I7GA 4JZ5A 3PJTA 1ZFJA 3VD3A 4GVIA 2JKEA 3WL1A 1GG1A 2YBUA 4L4PA 3FX4A 4EPBC 4HOZA 3LV6A 3QEZA 3MYPA 3MTWA 1TPDA 3PPCA 4NIRA 1C8YA 2XFFA 2Z1XA 4H8VA 3QF0A 3S5ZA 2GUUA 1OX5A 4MJ2A 3HGOA 5DXXA 4WHBA 4PZVA 1GOWA 5DBTA 1QW7A 1JCMP 2YZRA 2E8YA 1G9HA 3W70A 1MUMA 4TOQA 3CHEA 4FR1A 4TX6A 3UZZA 1ICSA 1PWLA 4TX9A 5A8GA 3NJ3A 5CGQA 1E70M 4GZEA 4KRZA 4QX4A 3ENLA 1W17A 3QW4B 4JXCA 3GE7A 4LSBA 3T07A 2G3FA 3DBNA 4PCFA 3MZ2A 1EJTC 3Q58A 1LCOA 4AVNA 2VC7A 3THQA 2OKOA 2HSAA 2QZRA 4NASA 3UEQA 4FXJA 1L6FA 3VOIA 3W76A 1LT7A 2YZ5A 4DF0A 4FS9A 2VJXA 2B81A 3TZFA 5TAOA 3UGRA 4L9XA 1ZAIA 3G5EA 1J8VA 2B7QA 3TAOA 1SZEA 5EMYA 4IG2B 4X60A 4DJED 4BHYA 1C3FA 3ITGA 3TFXA 2J8FA 5E70A 3SY5A 2R1MA 4ZQPA 2A7RA 2HJPA 4KW2A 1TUFA 4R33A 2VYOA 3ZIZA 1XV8A 3GXFA 1TR1A 1U5HA 5TNVA 1UD5A 2YB1A 3H26A 4N0RA 3LCXA 3BE7A 5C2GA 3H8AA 4MLJA 5E6YA 2J66A 4GMEA 4YVPA 3PZIA 5K9DA 2ZBTA 3WLPA 1XIDA 1R30A 3TWAA 1IQ8A 3N3MA 3FN9A 3Q2DA 3PZNA 4W7WA 4CNTA 2Q09A 1K02A 4PUKA 3TYAA 1GHRA 3ANUA 4BK9A 1V0MA 3RRXA 2A3AA 3ZVIA 1XCXA 5I3JA 1EYEA 1VBJA 1H2JA 2PP0A 3CAVA 3WD2A 5K9CA 3MO4A 1O5RA 2DFAA 2W61A 2FHFA 3R6IA 3IACA 4EF9A 3WD3A 3MSGA 3VK5A 1IIHA 3E5PA 1OYCA 2XINA 3A4WA 1E4IA 1Z89A 1A5LC 1WAUA 5A6KA 3BAWA 2QF8A 3RR4A 1MXSA 1YPIA 1VLWA 2WZHA 1DJHA 3NZPA 4ADTA 1TTQA 2ZUNA 3DKJA 3E0IA 1UA7A 3UERA 3DG3A 5I3DA 4MNMA 2YW4A 4O12A 1A5AA 3VTRA 3QHOA 1CB2A 4Z2HA 2PC4A 1S5WA 3FGCA 1YDNA 4TVDA 3VO0A 3PJUA 4QR6A 3T44A 3L0NA 1V6YA 5HNTA 4CD7A 3LM7A 3PPFA 1PYFA 1BLIA 2P10A 1QATA 5CGMA 3N34A 2Z7GA 3SUTA 1W5QA 3SM0A 2Y8VA 3C56A 1GKQA 5D37A 3O0KA 3N6QA 5DFAA 1JPMA 2ZXAA 3H4WA 3LEPA 3PFRA 3UYCA 2E6DA 1KTNA 3ZSSA 1Q45A 1KV8A 3FHQA 3LRKA 3WQ4A 1RHCA 3BW3A 2A79A 1VYRA 2ISDA 4EPKA 3OA3A 4YWSA 4DO6A 2E77A 4D8LA 1VF8A 2J13A 3BPWA 3PANA 1H0GA 5U7SA 5HQEA 5CQ1A 3L4UA 5D2XA 1X7FA 1ZJIA 1SMAA 1QPKA 4UOJA 2E9LA 3WLIA 1EOMA 2EPKX 2HNEA 2KAUC 2R1KA 9CGTA 3AUJA 4AG0A 2OODA 2CHOA 3SRHA 4H41A 1BXCA 4I8YA 2QHAA 4LW7A 4H2CA 4F2BA 2H8ZA 3FDGA 5BOOA 4AWSA 4TMBA 3SBFA 3RLUA 1Q6QA 3W1QA 5K4ZA 3MUY1 1EZWA 1LYXA 1KGXA 1MQQA 2WWDA 1VCVA 1ZNNA 4KPLA 3WH9A 2X7WA 1OIMA 4U3AA 4BCEA 1H5VA 3IGUA 4K39A 3W83A 2W62A 3ES8A 3WQDA 1KRBC 1TV5A 2Y61A 5BROA 4AUBA 4J4KA 3N04A 1KXVA 1HKJA 5A6MA 1ZPTA 3A13A 4ZQNA 4O19A 1US0A 1JL8A 2Z2UA 1ITQA 4XQ6A 3TROA 5LA0A 4PUWA 4N9BA 1SW3A 3U9IA 1TZ7A 4KETA 3LTYA 2ZZ7A 3KXQA 3VCNA 2EJ1A 5C2XA 1E3ZA 3AJXA 4P8VA 2D69A 4YCOA 5LXXA 3R13A 2WZTA 2ZRWA 2X1IA 1C93A 4KGJA 4AD2A 1TWZA 1B54A 4KEMA 1KR0A 2HWGA 2ZYFA 4HU8A 1WDQA 4JYFA 2NUWA 5HR7A 2WANA 1J0JA 2VQUA 3PBUA 5LSMA 2VFGA 1S2CA 1Z7AA 2F38A 2JIWA 4J9JA 4XIMA 1DJNA 4QJ1A 3RJYA 2A7PA 1ITUA 3DC8A 2E8ZA 4JIRA 4EXAA 4LEQA 3GD6A 3WJYA 1EL3A 1LWHA 4MY1A 2FB3A 1GOQA 3U5UA 3EA1A 3POCA 3K8KA 4GZIA 3A9BA 4Y6GA 1A5UA 3UNDA 1W3LA 2GVJA 2ZDSA 1BF6A 1O5KA 4MWAD 2I5QA 4LFYA 3W7KA 2IKIA 3MUZ1 4N6FA 1CYGA 1EX5A 3EWDA 4HPXA 2HS8A 4NZ4A 3S1WA 3CZEA 4O1AA 3KBNA 4X63A 3LSCA 2WSKA 4LU0A 5DMNA 1W8GA 4ZB2A 2JQXA 1XH2A 1XLJA 3HIJA 3B8DA 3LTPA 1MWOA 3I3EA 1KM0A 5DQPA 3TC7A 4D8AA 1XBVA 1XD1A 4FA3A 3GDLA 4WRHA 4D8ZA 4GYKA 4QE5A 5E9XA 4LTSA 1W1PA 3DHPA 3VX1A 3J7HA 3SGUA 3UG5A 3THAA 2PGEA 3NQ8A 1QOXA 1B9ZA 1QMLA 3RCMA 1LQ0A 1TJ2A 4F0HA 4MHBA 3UJRA 1E5NA 4HVXA 3RGTA 2F84A 1V03A 2AQOA 3QFWA 4MDOA 4Y9MA 1OG6A 2Q8ZA 1F73A 3FV9A 4ICCX 1OFEA 2MANA 1EDTA 2BVTA 3G1HA 3CBWA 3A23A 5TD4A 3EDDA 1IXPA 2H3BA 1XPGA 4RNJA 1TV4A 3MB9A 3GG8A 3GXNA 3FJ6A 3T0TA 4EAYA 2G50A 1H7XA 4N6EA 1R9YA 3N4FA 3SGZA 1GHSA 2RJGA 4FAMA 2XFWA 3U2ZA 4O8AA 4P7OA 4RDWA 1FHUA 5IM51 2NXGA 2ODOA 1D3CA 2D2GA 4DUWA 1AL7A 4NVTA 4QSHA 3SCQA 1R3TA 3KS5A 5KZMA 2FB2A 4HNOA 5D9PA 4F9DA 2BOEX 2PDBA 4FK9A 1OVDA 2ZA2A 5BU9A 2ZUWA 5FEZA 4W88A 1QRQA 4JTFA