1NP2A

Crystal structure of thermostable beta-glycosidase from thermophilic eubacterium thermus nonproteolyticus hg102
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
426
structure length
426
Chain Sequence
AEKFLWGVATSAYQIEGATQEDGRGPSIWDTFARRPGAIRDGSTGEPACDHYHRYEEDIALMQSLGVGVYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLAAGITPFLTLYHWDLPQALEDRGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAGARRVGIVLNFAPAYGEDPEAVDVADRYHNRYFLDPILGRGYPESPFQDPPPAPILSRDLEAIARPLDFLGVNYYAPVRVAPGTGPLPVRYLPPEGPVTAMGWEVYPEGLYHLLKRLGREVPWPLYITENGAAYPDLWTGEAVVEDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVDFPSQRRIPKRSALWYRERIARAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-glycosidase
publication title Structural Basis for Thermostability of beta-Glycosidase from the Thermophilic Eubacterium Thermus nonproteolyticus HG102.
pubmed doi rcsb
source organism Thermus nonproteolyticus
total genus 151
structure length 426
sequence length 426
chains with identical sequence B
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2003-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1np2A00
3AIWA 6CGTA 2WWCA 1OM0A 3N11A 3RJYA 3PBGA 1JD9A 1DTUA 3SCPA 2G3JA 1D2KA 1E70M 2UY4A 1UH2A 3VIGA 1W32A 5TD4A 4MB3A 2VTFA 3WKZA 2EPKX 5A1AA 1AQMA 5D4YA 2YBUA 1UD4A 2GVYA 3ZJ7A 3IJ7A 3PZGA 1ZL1A 1UR8A 2XTKA 1M7XA 2ZX8A 1XSJA 2WMHA 4CVUA 4C7GA 3NIYA 4JZ5A 3VD3A 5DF0A 3WH9A 5HBFA 3MMDA 2E4TA 4MJ2A 3WF0A 5ECUA 1FHDA 4U5IA 3ZM8A 3ARRA 5LA0A 1KXQA 5C8BB 4A3HA 1UQYA 2ZUMA 1AVAA 1GORA 4Z2JA 1KBBA 3RDKA 4GZEA 3AIEA 1ODZA 4GPNA 1XH1A 4Z2IA 1ZBVA 1W3JA 2WWDA 4V27A 1MW2A 4GZIA 5JBDA 3AISA 4M1RA 4S3KA 2VC9A 1W2PA 3BAIA 3VGDA 4JFWA 3II1A 4W7VA 5ABFB 1CWYA 1VFOA 1E3ZA 4JFUA 2A3CA 2J7GA 1WP6A 3ALFA 2YA2A 3ZT5A 2JALA 2WZEA 1G01A 3GNOA 2BS9A 1LWHA 1KWGA 3ALGA 3DYMA 5HXMA 1M53A 3IAPA 2NSXA 3W28A 1B2YA 2W63A 2VMFA 3MSGA 1W3HA 1BVZA 4D6JA 2CBIA 3U7VA 5JBEA 8CGTA 5IHRA 1GQIA 2BVYA 2FHBA 5CGMA 4KMQA 1BFNA 3UR8A 5M17A 1W9BM 4MAVA 3FAXA 4WLCA 2PF0A 1UH4A 2J7FA 3AHTA 1V0NA 1K6AA 1A3HA 4F9JA 2VVSA 1DEDA 3ARSA 3W53A 2W66A 2WSKA 1UR4A 4AZ5A 3D5HA 1PAMA 1B30A 2EBNA 4MB4A 3RILA 5BXPA 1V3KA 3M7SA 4W7WA 2RGMA 4RE3A 2WC7A 1E6SM 3BCFA 1NARA 1VFFA 4FF5A 2WMGA 4CKQA 2QHAA 4QLKA 3SUSA 2VVNA 4GQRA 2CEQA 2J7BA 2WCAA 1BG4A 1HF6A 4MAZA 4CD4A 1JXKA 3DYPA 2BY1A 2EPOA 4HOXA 1ZB5A 4GKLA 1E0VA 3PZVA 1Q6GA 3WQ6A 4H8VA 4TTGA 2YL8A 5JUVA 3O9NA 3RO8A 5GNYA 1Q6EA 5D9OA 2WVUA 3VMPA 4W5ZA 2WK2A 4HA1A 5IDIA 1VRXA 2EEXA 1TA3B 1UR9A 4OOZA 1QPKA 1GQKA 4P7RA 2XSAA 2ZUTA 4IPNB 3IAQA 3TTYA 1OD0A 1KXTA 4URIA 1LG2A 3AXIA 2DSWA 3OLEA 2GK1A 4ZENA 4QCFA 2IXVA 1KR1A 4QDMA 1UKTA 3HN3A 1I75A 3AZRA 3MMWA 4W86A 3MKKA 5D8WA 3N13A 1ISWA 2BHZA 1MW3A 2CBVA 1JYXA 4JCMA 3VIFA 2YA1A 3DC0A 2E8ZA 5FD0A 5A6BD 4HOZA 3GDBA 4DWSC 2VRQA 3SCOA 4H41A 5ABEA 4QAWA 5D9MA 1GHRA 2VI0A 4W93A 3W6LA 2EQDA 5KZ6A 1UKOA 7A3HA 1QNPA 4QCEA 4D6CA 2BVTA 3VDBA 1E4IA 4GI6A 1XD0A 3CO4A 4KGJA 3ECQA 4CGTA 3T09A 1OIMA 3WL1A 1HL8A 5EBAA 3L2LA 4PCTA 3WNNA 1BPLB 1GVYA 1UD6A 2O92A 4PCSA 3WUGA 2GDUA 1QBBA 2XFRA 3KL3A 3B9EA 4XV0A 4H2CA 4GO8A 4CCEA 4W7UA 4UZUA 1O7AA 3VGBA 3O6AA 3SCQA 1E9LA 4A4AA 2W62A 4Z2LA 5BWFA 1G9HA 3K8KA 4P7LA 1SYTA 3CUIA 4MNJA 1LJYA 2J4GA 3GM8A 1E6QM 1KGWA 2VCAA 4U3AA 2J75A 4OBSA 4W8LA 2XHYA 1FH9A 5CPSA 4YN5A 1WZAA 5A69A 5I6SA 1ISZA 3UCQA 3IJ8A 1VFMA 2WBGA 3AS3A 5LA1A 2BHUA 3AXXA 4AIUA 4BF7A 1C7SA 3NSXA 1ECEA 3GBDA 3W26A 4CN6A 1CGXA 3NCOA 1OGGA 3A3HA 3EDKA 4P8VA 2BY2A 1MFUA 4BQ5A 5I78A 1GW1A 3GZAA 3ZMRA 5EB8A 5A6KA 4N0RA 3SUVA 1KFWA 3LPOA 1E6XM 2VNCA 4PUDA 1QI5A 4WSJA 5DFAA 4P8UA 1YHTA 4LQ1A 2XUCA 2XM1A 4XZWA 1JAKA 3AMCA 1CGVA 1UZ4A 2V3EA 3CZGA 4ML4A 5AC5A 4M8UA 2ZUNA 1FH7A 3WNMA 1XSKA 1LLOA 1VFUA 2ZUVA 4HZ6A 4RL3A 4EE9A 1JDDA 4LPCA 3VIHA 3VKKA 1KCLA 4U31A 1D3CA 1DP0A 2JIWA 1SR0A 2GJRA 4OOUA 1KXVA 4S3JA 3HMCA 1OGBA 5A3HA 1EXPA 6A3HA 3PN8A 2D3NA 1U30A 3WH7A 5A8MA 4LXFA 3MV11 3M46A 2VX4A 1M04A 3SUTA 3FN9A 4TVUA 3ARUA 1X1NA 4MDPA 1FFQA 5EMYA 5GNXA 2GK1B 1VAHA 3VM5A 2G41A 1U33A 3WF1A 1XSIA 1UWRA 4ATDA 1EH9A 4NZCA 3RM8A 2ZXBA 3WFZA 1GJWA 1HT6A 2CXGA 5BRPA 5AYIA 4JKMA 4PMQA 2XG9A 5CPQA 5E0FA 2IUZA 3NSMA 3WQWA 1KQYA 4JFSA 1ZBKA 1ISXA 4AEEA 5BCAA 3L4VA 4UQ9A 1OCQA 2WB5A 4PTXA 1B1YA 2ZIDA 4JL2A 1JD7A 4MJ4A 1W9UA 2E9MA 5IXEA 4DM1A 4ATWA 3JUGA 4XX6A 3WDPP 3BLKA 5M5DA 1E4MM 1V6YA 1J0ZA 4F79A 3CZEA 3AMLA 2ZUUA 5ABHA 1HVQA 4WF7A 3DECA 1JF6A 2BY3A 4W88A 1B31A 2WHJA 4DM2A 1GOWA 4JFTA 3T0AA 2CPUA 2WKGA 1D7FA 5CSYA 2WVVA 4ZEPA 5A6BA 1E6RA 2PB1A 4LX4A 4AMCA 3VDAA 4GIAA 1HIZA 5I2UA 5ABFA 4EK7A 2QLYA 1WKYA 1YQ2A 2DT0A 3SEPA 3WQVA 2FHCA 2WMIA 4JKLA 2DQXA 4D1IA 1CEOA 1J10A 5A6AA 3BSGA 3ARXA 1ESWA 1PZ2A 1UH3A 5EFFA 5E9AA 4EAMA 3EDFA 3WFLA 2JEQA 1UKPA 3ZJ6A 4AZCA 2D24A 4R5EA 1BF2A 4XB3A 2OWWA 4FLQA 3WD1A 4W87A 2YLAA 1QI2A 3TTQA 1MYRA 4LYRA 5CXPA 1FHLA 1UG6A 2FHFA 1NM9A 3ARTA 2RGLA 4HU0A 3WNOA 4WKAA 1GQLA 4CD6A 3APGA 4FLRA 1NOFA 4PMZA 3MO4A 4TTUA 4H7VA 1O6IA 4B9ZA 3NDYA 3TTSA 3ARZA 4Z2GA 3KE0A 3WSUA 5E0CA 3AFBA 3BAYA 1MQQA 2WLZA 4DUVA 1HKJA 4WJXA 1E6ZA 4B16A 4AD1A 5A95A 3TOPA 5DT5A 4X0VA 3WH8A 3WF3A 2DT1A 1WDPA 3GXFA 1JZ4A 2DPEA 3CZ8A 4TOQA 2CKRA 1CYGA 2DH2A 2QPSA 3FW6A 1OGSA 4TX6A 5D8ZA 1GUVA 4UOJA 4OUEA 2J62A 3VGEA 3N12A 1QHOA 4GXPA 2V5DA 9CGTA 2WHMA 2XM2A 1TFVA 1H49A 5FOOA 1R7AA 1JF5A 2WCGA 1R7OA 4Q7NA 4DUWA 1W1TA 4Y7EA 2DH3A 4H8HA 4Z2KA 4J27A 1R87A 1JAEA 1XYZA 2PWGA 1XGZA 1JI2A 1KQZA 1TA3A 5I23A 4GI8A 1R86A 2VCCA 1IZKA 4JFVA 3T2PA 3WN6A 3WELA 1H3GA 3W37A 1MXGA 3ZIZA 2Y8VA 4JCLA 1DWAM 3EMZA 2AAAA 3ZT6A 4AZHA 3VIKA 2EPLX 2J8GA 3GXIA 3S6TA 1C93A 4AZ7A 5BXSA 4HPGA 3TP4A 3UETA 4U3CA 2V3FA 4MPKA 4BQ4A 3KEHA 3AYRA 2UY3A 5CPTA 2WNWA 3VUPA 1BQCA 2VO5A 2YA0A 3T2OA 1CXIA 4B9YA 5BXRA 2J47A 2B31A 1PIFA 1AQHA 3SCRA 2NW0A 3L2MA 2HVMA 1HJUA 2XVNA 3VIPA 4LYQA 3ARWA 3W38A 1UWQA 1EQPA 4UCFA 3AHVA 2WVVB 1MW1A 3ARVA 4AISA 2G3IA 2X0HA 3AS2A 3MUZ1 1JZ3A 5I77A 3CUHA 4AIOA 2V3DA 1H4PA 1OIFA 1CGWA 1HL9A 5A8QA 2D0FA 1QI3A 3EMCA 2WMIB 1CGUA 1UWIA 3UG3A 2WXDM 3K46A 1WZMA 1C3FA 1JDAA 4A3YA 2VRKA 4PMUA 3G6MA 1MQRA 4NRRA 1WPCA 4AZCB 2BV9A 2A3AA 1W3LA 1H41A 1V3LA 3NDZA 4J3WA 3WH5A 1CLVA 4LGXA 4J3TA 1OD8A 1HKMA 4UQBA 1Q6DA 3AJ7A 2D22A 3FXYA 5A2CA 5JIPA 3AI0A 5HDRA 3ZQ9A 5BROA 3AIBA 1E3XA 3MMUA 1N82A 3VIIA 1OB0A 1QNOA 3NJ3A 2MANA 3SCSA 5E6YA 2NT1A 4OKDA 1L0PA 3CIVA 4ZXLA 3MUIA 3BAWA 1WDQA 1CXLA 1TVPA 1ISYA 2JIEA 1E40A 1UHVA 1JZ5A 2BY0A 3CZLA 4NF7A 3VGFA 1BYCA 3WQ8A 4HPHA 3VDCA 2BFGA 3EDEA 3E1F1 2ZXDA 1DWIM 3O2LA 2VX6A 2XVGA 1XH2A 1CGYA 3WEZA 4AIEA 3N04A 4P7NA 1OINA 2PWHA 5DO8A 1OWQA 1DHKA 2GJXA 1SMAA 4PYSA 2Q8XA 3W27A 1CENA 3VOCA 1M01A 4PN2A 1Q6CA 1JYVA 3CMGA 1J0YA 4PEEA 1XRVA 3M07A 1E6NA 1W1YA 4DUXA 3CTTA 3SCVA 1P6WA 4PMVA 2EO7A 4J3VA 1TMQA 4M24A 4QLJA 3F5JA 3F4VA 1CECA 2YJQA 4AXNA 3WD4A 1GPFA 3UESA 2OYKA 4D6DA 3T2QA 1V3JA 4RE4A 3W4RA 3PZMA 2FH6A 3WDQA 4KGLA 3WEMA 1L8NA 3N15A 2J7HA 1GOMA 3ZO9A 3IJ9A 1XV8A 2XIIA 2CBUA 1KGUA 1HKKA 3K4AA 3ZR5A 2F8QA 3HU7A 2FGZA 1RP8A 2ZOXA 2XGIA 1WAWA 1ITCA 3ZR6A 2WHKA 1HNYA 1BGAA 4W8AA 1JGIA 3AMKA 2UY2A 5DMYA 1VB9A 1NOUA 2O9PA 4L4OA 1GCYA 2QPUA 5BXTA 2D2OA 3SCNA 4MNKA 1I1XA 1V02E 4UZSA 1PEZA 3UEQA 3OBAA 3GBEA 4J28A 4OZOA 1B3YA 5A6SA 3VINA 1ZBWA 2VZOA 4NSBA 4AWEA 3WUEA 1NOWA 2IXUA 3AZSA 1MXDA 1J9YA 1RH9A 5C71A 4ACYA 3OLDA 2ZWZA 2Z1SA 3PZOA 2ZE0A 3WMBA 3CZJA 1US3A 3LPFA 1VEOA 1HVXA 3LMYA 3CUJA 4F66A 2JF7A 1DWGM 4AD5A 5BRQA 1XHGA 3WBEA 2WANA 3WF4A 3AMGA 3A4WA 2WAGA 1OBAA 5D9PA 4ZXOA 1UWSA 3WH6A 1E4NA 3VD4A 1BHGA 3K8LA 3VMOA 1KR0A 4NI3A 1S46A 4PTMA 3SCTA 5I79A 3VD5A 1ZBCA 4CN4A 4AZBA 7TAAA 3AS0A 5GNZA 2ZX7A 1BTCA 2Y24A 4PMRA 2CHOA 4UNIA 1JYWA 2E9LA 4J3XA 3PZQA 2VX5A 2VJXA 1HJSA 5CGTA 1JNEA 1HJVA 1E72M 4B3KA 3RIKA 2FDMA 2VX7A 4M56A 2ZXAA 3WD3A 2V5CA 1EA9C 4PMDA 2D20A 4U2ZA 3VGHA 1BLIA 3PTQA 2W92A 2PBGA 4PMOA 4CCDA 2DIEA 4W85A 4YPJA 1GOOA 4P8XA 2DIJA 4QFUA 3AZTA 1QW9A 2BXZA 3ZSTA 4P7OA 1UR0A 2CNCA 2J25A 1UR1A 4EKJA 1X6LA 3MUY1 1JIBA 1NP0A 4MNMA 3GNRA 1ZU8A 4M29A 1HP4A 3CLWA 2E40A 2J77A 1UYQA 3L4TA 2XVLA 4AY1A 4CD8A 2GJXB 1W9DM 3AIQA 2GDVA 3L4ZA 2FGLA 3IK2A 3CUGA 1W9PA 2XVPA 1WDRA 2QV4A 1C8YA 4TUFA 1VJZA 1KBKA 1XYFA 4E4PA 3L4UA 3W81A 4PBGA 2WBKA 2Y4SA 1J0IA 3PZTA 3D3AA 1E15A 3A4AA 3CHEA 1H11A 4DWSB 1E0WA 3I3DA 3MANA 4W89A 4PSPA 4M82A 4B3LA 1UD8A 1EDGA 1G5AA 1PJ9A 2ZX9A 3N1AA 1A47A 2WW5A 4JL1A 2EJ1A 3GXDA 2WLYA 2XVKA 2J74A 1E43A 2ZICA 3WUBA 2DDXA 3MUAA 5A8NA 3GH5A 4TXEA 2OWXA 4YHGA 1W9XA 4OBRA 2OYLA 4WSKA 1GQJA 1UZ1A 4PRWA 1C7TA 1CXHA 1PPIA 5JBFA 2BNJA 3EDJA 1G94A 2XSBA 3OA5A 3CGTA 3SUUA 4HP5A 2XWEA 1WCGA 3AQUA 2ZX6A 3WMSA 1V08A 5GQBA 2Y5EA 1DWJM 4QLLA 1CLXA 5A94A 1I1WA 4V28A 2WHLA 2OYMA 5HPCA 3LPGA 2XJ7A 1EIBA 5CLWA 1HXJA 1EQCA 1QW8A 4IISA 3BSHA 3SURA 3WUFA 4PTVA 1WB0A 4W84A 1JG9A 4FMVA 1C8QA 1VIWA 7CGTA 3PZIA 3CH9A 1CIUA 3U7BA 4BS0A 4JIEA 3CZKA 4FK9A 4ACZA 3AICA 3WQ5A 3AIVA 1J0HA 1PX4A 3AS1A 4CVWA 5A6LA 5A8OA 1NH6A 1CGTA 3WDIA 1BVNP 1EHAA 4IPLA 4M81A 5M3WA 2VT0A 3AIUA 1E1EA 3BLPX 4HMCA 4F8XA 1GJUA 3FY1A 4GQQA 2PC8A 3GH7A 4FLOA 1E5JA 1LF1A 3KZSA 4UFIA 3I3EA 2VR5A 4HZ7A 3B8SA 2Y2WA 4TVCA 3W0KA 4ATLA 2J79A 4C7DA 2YL5A 4U33A 2WC4A 2W4XA 4FLSA 5E6ZA 1QNSA 3OB8A 1RPKA 2VCBA 2WM0A 4D6IA 3PZUA 4AZ6A 1DWFM 2GUYA 4CD7A 3CHFA 3T08A 6TAAA 2PWFA 4MB5A 1H5VA 1UUQA 1J11A 1FA2A 2V3GA 2X1IA 3QHMA 1JFXA 1JDCA 3PZ9A 4UQCA 4V2XA 1UWTA 4D72A 3QOMA 4IUGA 3WEOA 1JL8A 1EDTA 5FCZA 4AYSA 1EGZA 3VNYA 3WDRA 2J7DA 1HX0A 2DEPA 1VEPA 3QHNA 3VVGA 5I24A 1W1VA 4DWSD 1V6WA 3ZJ8A 2A3EA 1QVBA 3G6LA 3UERA 4BQ3A 3AIRA 2UY5A 1G0CA 1Z32X 4WIWA 1V03A 3VIOA 3WY1A 4PMNA 3WNKA 1KB3A 3WNLA 1EDQA 2O9RA 4ZE5A 2CHNA 1J01A 1QI0A 4UTFA 3POCA 2G4FA 4AD4A 1KXHA 2VL4A 1ODUA 3BH4A 1E55A 4AC1X 4D6EA 1LL4A 2WZIA 3FNDA 1SMDA 2EPNA 1LG1A 4UQEA 1E56A 1OT1A 2YLLA 5KEZA 1GOQA 4J7RA 4HMDA 5IHSA 4OIFA 1WO2A 2DT2A 4IM4A 1QOXA 4JAWA 2TAAA 2QMJA 1JZ2A 3THDA 1PZ3A 1C91A 4HA4A 3EBVA 1R85A 3W6MA 1H0GA 1V0LA 4F9DA 4B15A 3CHCA 3WENA 3VNZA 3OZOA 1CDGA 4H8UA 5AY7A 4AEFA 2Z1KA 3MV01 4X0NA 1H09A 4UFMA 3GYCA 3DHPA 1V3IA 2VR4A 2XIBA 3L4WA 3VO0A 5BYWA 2WC3A 3L4XA 1XD1A 1XC6A 2XWDA 1IV8A 3S2CA 1HJQA 4CUCA 5DT7A 2D3LA 1B3ZA 4RE2A 2YL9A 4BA0A 2FH8A 1NWTA 1MFVA 2CERA 3THCA 1F4AA 4XUYA 3ZJKA 2YKKA 4W5UA 3K4DA 2ZWYA 4ACZB 3QOKA 5FL0A 3UG5A 4W8BA 3WQ4A 2YDQA 3RM9A 5LA2A 3U5YA 4UOZA 4UQDA 4NRSA 3TTOA 3EYPA 3QR3A 2YBTA 2J7EA 1BG9A 5IFTA 4WK9A 4HTYA 3AROA 1RP9A 3VTRA 2VRJA 3U5UA 1JFHA 5CQ1A 4D71A 1J0KA 1V6UA 1GNXA 3AXHA 1JNDA 1QHZA 1WE5A 3VX1A 2O9TA 4XZBA 1QNQA 1V0KA 2C7FA 3PTMA 5HOSA 1TZ7A 2VURA 1US2A 2D0HA 1C8XA 3M6DA 4UFHA 2DT3A 4PMXA 1B3VA 4Q22A 3CUFA 5I5RA 1B3XA 2ESCA 3K8MA 3I3BA 2XFFA 1LQ0A 4N42A 1ZS2A 4UFLA 1FOBA 1TCMA 1HKIA 1HJXA 1RD6A 1J18A 3PZNA 1M03A 2D0GA 4HMEA 1VBRA 1H0IA 1WZKA 3NSNA 2CIPA 4WKFA 3OGVA 1UQZA 3WF2A 1UD2A 1V3HA 1HN1A 2QMKA 3WNPA 1V3MA 1JZ8A 3AMDA 3BXWA 3N9KA 2CBJA 1K9TA 2CESA 2DSKA 3ARPA 3FAWA 4MADA 2AOSA 1EO7A 3VILA 4P7QA 1TR1A 1UKQA 1LL6A 3W29A 1UD5A 3VDHA 1HJWA 1PBGA 2E8YA 2WKLA 4AW7A 5HPOA 1B9ZA 4JHZA 4D6FA 3RJXA 4QP0A 2G8ZA 4M80A 2DGAA 3NYDA 3FHAA 3ZT7A 4CU8A 2C0HA 4ZE4A 3U57A 1MW0A 1KGXA 4MTVA 4D6GA 1HP5A 3HJEA 3SUWA 4AZGA 3ARYA 1E4LA 1VF8A 4DWSA 2CYGA 1PIGA 4LYPA 1CXKA 2YDRA 3CMJA 2OLHA 5LYRA 1CZ1A 1CPUA 1JXJA 2F2HA 1UA7A 5A2BA 4AD2A 5F7UA 3TA9A 1XCWA 2VZUA 2WZHA 3T0DA 3BAJA 3J7HA 1GZJA 2VZVA 4D6HA 5I3DA 1B3WA 1TVNA 4UFKA 4MB1A 3AHYA 3MSDA 1V0MA 3F5KA 4U2YA 2QF8A 3VMNA 3ZSSA 2WPGA 1V6VA 3L4YA 3SCWA 3VIJA 4CU7A 1DWHM 2VQTA 2XFYA 1XCXA 1ISVA 2VQUA 5ABGA 1W1PA 1UA3A 3VX0A 3BMWA 4GI9A 2JFEX 5AC4A 2JEPA 4KRTA 1LWJA 2YL6A 1E1FA 4GZJA 3AYSA 1MQPA 2OSWA 3AOFA 5M03A 2WSPA 2GFTA 2J78A 3BMVA 3OGSA 4YHEA 5C70A 1VEMA 1WZLA 1UKSA 5IFPA 3LPPA 2J8FA 1FH8A 4UOQA 1W2VA 2DSZA 3BCDA 4UFJA 1MWOA 2E9BA 1KWKA 4EANA 1FFRA 3OG2A 2VUYA 5I0DA 1R8LA 3VU2A 3FHQA 3PTKA 2WMFA 1TE1A 1Y7VA 5CSUA 2F61A 1C90A 3OZPA 3BAXA 2OWCA 4D1JA 3KL0A 4PMYA 2E0PA 3BC9A 1J0JA 3UR7A 4UQAA 1EHNA 2WVSA 1PX8A 4JKKA 3RPMA 2X8RA 1H1NA 2E3ZA 2CKSA 1WDSA 1E5NA 4P8WA 3UG4A 5HNNA 5CG0A 1EO5A 3K1DA 5E09A 2JF6A 1VJSA 2V38A 3WMCA 1CXEA 1NQ6A 1E71M 4TVDA 3W82A 2X09A 5E70A 1Q6FA 4BZYA 3A6OA 4AD0A 1V6XA 3WL0A 1FP8A 3WDJA 1JYNA 3VD9A 3POHA 5FKYA 1NWUA 2CCRA 4Z2HA 2J7CA 3EMQA 2YIHA 1UWUA 4K68A 4PUEA 4C7FA 3OIHA 3N17A 4KH2A 1JZ6A 5D9NA 3VIMA 1W3KA 2X0YA 4R27A 3OGRA 3WBAA 1AQ0A 1CNVA 1J12A 2CITA 2WMJA 1JI1A 1FP9A 3VM7A 3IANA 3BAKA 2ZX5A 4WKHA 1GONA 1ZJBA 3VD7A 3W24A 2UWFA 2A3BA 2VOTA 3SIMA 1WNOA 1BYDA 3T0BA 4H04A 1BYAA 1XH0A 2WYSA 5A6JA 2BVDA 2PWEA 1QI4A 1BGGA 4TX8A 5CLTA 3WD2A 2GSJA 1BAGA 2WMKA 4KRUA 3OLGA 5A8PA 3W25A 1B90A 2W5FA 1UD3A 1KCKA 1PX3A 3CHDA 3MU7A 3AHZA 4E8DA 2AMGA 3AHXA 1LL7A 1SFSA 1VBUA 3PHAA 2X2YA 2OSXA 1Q4NX 5FIPA 2WCSA 1ITXA 1NWRA 3OLIA 3CBWA 1IZJA 1E73M 1E0XA 2NT0A 4J3UA 3N18A 1IT0A 1G1YA 2DSVA 4MNLA 1B0IA 3MS8A 4HZ8A 3GH4A 2XGBA 1CBGA 3GXMA 1K9DA 3RM4A 3QGVA 2PBOA 1ZJAA 4OJYA 4BQ2A 1JZ7A 1MVYA 2OSYA 1QNRA 2PI6A 1UR2A 1E6PA 3B9DA 4UR9A 4GINA 1TUXA 2A3HA 4CN1A 1OSEA 1BSIA 1BYBA 5CZKA 1U2YA 2VZTA 2CETA 3A47A 2C8NA 4PTWA 4PSRA 1CXFA 3WDHA 2Y8KA 5CJ5A 2ZUWA 4MDOA 4BCEA 1TG7A 1H2JA 4CCCA 2ZUSA 4HA3A 3RCNA 5A2AA 4U5KA 1EOKA 1F4HA 2BXYA 2G3MA 2YDSA 3A4XA 4J3SA 1QBAA 2BHYA 1C92A 3WD0A 2EXOA 3DYOA 1K9FA 3GTNA 3TONA 1QHPA 2ZXQA 3NUKA 4E8CA 4GO9A 3ZOAA 2EPMX 3RMEA 4CU6A 3QHOA 1OT2A 2XPKA 4CD5A 2GJPA 3F5LA 4HOWA 8A3HA 5A6MA 2D23A 1GOIA 5GPRA 2D1ZA 5EFDA 2HISA 1EOMA 2DSUA 5DEZA 5AYBA 2WVTA 1NWSA 1W91A 2W61A 2W91A 1V02A 4AD3A 2G3NA 2YOCA 3CPUA 1VENA 5FL1A 1GVIA 5JIWA 3KWXA 3DHUA 3VGGA 3WIJA 2VZSA 2W67A 1GHSA 1CTNA 3KL5A 1W9VA 4E2OA 2X05A 3VPLA 1GOKA 2O9OA 3GNPA 3BGAA 2JE8A 4L4PA 4AZIA 4HU8A 2XYLA 3SCUA 3B9AA 1UOKA 4X9YA 1AMYA 4JHOA 1X6NA 1K9EA 3ARQA 2PWDA 3EDDA 4ZFMA 4KWUA 1NP2A
chains in the Genus database with same CATH superfamily
3AIWA 3FYPA 4C1LA 1RVGA 3RJYA 1JD9A 4DO7A 3STGA 1E70M 2UY4A 1LBLA 2NX1A 2AL2B 3VNDA 4MB3A 2QCEA 2VTFA 3WKZA 3C52A 4IJCA 1QNVA 3TJLA 1PVNA 4AHQA 3QV7A 3EKLA 5A1AA 4HJFA 3BW2A 2V5BA 5D4YA 4Y9OA 2YPIA 3IJ7A 4QQ3A 1YEYA 3VOGA 4NILA 2ZX8A 4Y9PA 3C8FA 4XG1A 2UV8G 3IVSA 1XLLA 3TXZA 4AQLA 5SWUA 3NIYA 3VD3A 3QEZA 4E3VA 3MI3A 2R1KA 3GO2A 1B57A 1NEYA 4QAIA 5B7YA 3RDKA 3G8EA 4E6MA 4PRRA 2VXNA 5JBDA 4XWUA 3V1HA 3VZZA 3ISIX 3VGDA 5B7ZA 3LNMA 1R3VA 3II1A 3QFWA 3E5BA 3N73A 3E96A 4JFUA 5CC5A 2Q3RA 3N6JA 3ALFA 3ZT5A 4FNQA 4UTIA 5HA7A 4FSAA 3FJLA 1KWGA 5HXMA 4HNVA 3IAPA 2TSYA 4WHBA 2VMFA 2ZRVA 4JPGA 1W3HA 2F38A 3UZXA 4C91A 1KO0A 8CGTA 1TPC1 1GQIA 3UR8A 1XP3A 3HG4A 2PF0A 3M43A 4K7VA 3DI1A 3LU2A 3MDWA 1V0NA 4HSOA 2WSKA 2OLAA 1YX1A 3TYCA 4MB4A 3M0XA 2IPJA 4WDTA 5CZJA 1V3KA 3GNDA 4W7WA 4DLFA 4RE3A 3LTYA 4J40A 3L23A 4JY9A 2NXHA 4QXIA 1E6SM 1XRSA 4QITA 1NARA 5TF0A 2WMGA 2QJNA 2D69A 2VD9A 4J4KA 3T78A 1TIMA 1X96A 3PUOA 4FEZA 3P82A 4F0HA 4MAZA 1P1XA 3DYPA 2EPOA 1UUMA 4CQ8A 4HOXA 1E0VA 1Q6GA 3W7CA 3Q45A 4PGLA 2YL8A 5JUVA 3T07A 3SRFA 4EAYA 2CZVA 2P53A 4F2TA 3B04A 2WK2A 4W5ZA 4HA1A 4GC4A 4J9JA 1LWIA 3GYEA 3W7RA 1VRXA 3WLHA 3GUWA 4ZQPA 1QCWA 3F03K 3KVJA 4P7RA 3N3TA 3QKEA 4LUYA 3KBWA 5TAOA 1ZZMA 3FLUA 3TZNA 3GIPA 3W23A 1LG2A 2XIQA 2QZRA 3OLEA 1FKXA 4IGHA 2IXVA 2VKZG 2PS2A 3FV9A 4GA8A 3LNPA 4XAPA 3I65A 4QDMA 4L6HA 1UKTA 5HUOA 1UCWA 4W86A 2R9RA 3O6CA 1ISWA 1MW3A 2CBVA 3PJXA 3P81A 5I3HA 5A6BD 3QTPA 4HOZA 3GDBA 4DWSC 4QJ5B 2HQAA 2FB3A 3H24A 2DUZA 2CLIA 4JR5A 4D6CA 2BVTA 3VDBA 2ZZ7A 3CO4A 4GI6A 3ECQA 5FAJA 3VCNA 4HA0A 4CGTA 3F2DA 5G1YA 1HL8A 3L2LA 1BPLB 1UP2A 2ZRUA 1W56A 4JBRA 4Q4OA 3LGGA 3VE9A 2TODA 1PHQA 4UZUA 3VK5A 1E9LA 4A4AA 3CUIA 5CCZA 4JTCA 3TC3A 2J4GA 3RN6A 1E6QM 1QK2A 4U3AA 3R8GA 2XHYA 5CPSA 1WZAA 5REQB 3NQBA 5A69A 5I6SA 2XH7A 3QW4B 2VDIA 2CLPA 3AS3A 3ZWTA 3AXXA 4LAOA 4B5TA 1H7RA 3LLXA 4WZHA 3BJTA 4R7OA 3E0VA 1SO6A 4QSHA 3KS5A 3WLTA 3GBDA 2E68A 3CL8A 4GISA 4O0QA 4WVXA 4QG9A 4P8VA 1J5TA 3T55A 2BY2A 4BQ5A 1GW1A 3GFYA 4CEXC 2BLEA 3V5OA 3C56A 5DMNA 3LPOA 1QI5A 3BOXA 3W7EA 2XIOA 1U1HA 3ABOA 2NUWA 4P8UA 1R38A 4LVBA 3PP7A 1YHTA 3CHVA 3PB0A 2YGYA 3AMCA 4QR6A 1OYBA 3B0XA 1LQAA 3WNMA 5KINA 1VFUA 4S23A 2OOFA 3UCDA 2BBFA 2ZCGA 3EX2A 4NJKA 1D3CA 2JIWA 2F6UA 2GJRA 4OOUA 3LCIA 4XIAA 2FZNA 4S3JA 4PUMA 4QEHA 3U2CA 1EXPA 2D3NA 1QOPA 2EG6A 1U30A 5A8MA 4CLMA 1FY6A 5FEWA 4XQ6A 3M46A 1LT8A 1O94A 4WD0A 1T40A 3LYEA 5LIYX 2C19A 1XLAA 3OQ8A 2WZMA 3P14A 1FWNA 1X1NA 3BARA 4MDPA 1FFQA 4L1WA 1G4TA 2ATMA 2GK1B 3VM5A 1MEHA 4QHRA 1U33A 4JOMA 3DHFA 4WOZA 2OZTA 3A64A 1M41A 4MKVA 2I9EA 2INZA 3MMTA 1GJWA 1HT6A 2WOQA 4JKMA 4PMQA 1VFLA 2R1NA 3NSMA 8RUCA 3N25A 4HBKA 3S9ZA 1ISXA 3L4VA 3MBDA 1OCQA 4KEVA 2WB5A 3PVFA 4JL2A 4ZQCA 4EWJA 4Q6XA 1NDWA 4DM1A 2AAMA 2PE4A 1XL9A 3G0UA 1UP3A 4XX6A 2OX1A 1E4MM 3EAUA 1XXXA 1G4EA 3KBSA 4XVEA 3CZEA 4QQUA 4FOJA 4ROPA 4K3ZA 3SDOA 2RUSA 4L6DA 3W2UA 3AU2A 1Z48A 5I3KA 3PPGA 3B9NA 4IIDA 4FB7A 2WKGA 2CLFA 3EPNA 3R8HA 2YX0A 1E6RA 4AMCA 4QGCA 3LHUA 1HIZA 3IJIA 1NQKA 4GMEA 4HNNA 4D8AA 2WMIA 4OV9A 4WX2A 4JKLA 2QXWA 4CNPA 1PZ2A 5EFFA 3ITXA 4EAMA 3GY1A 1A5CA 1UKPA 2JEQA 3TZFA 3ZJ6A 1C29A 4AZCA 4KWSA 2PDHA 4FX8A 2VD8A 3N14A 2YLAA 3W84A 3EWDA 3EB2A 5M1TA 1VPXA 1FHLA 1UG6A 3ARTA 3WNOA 4CD6A 1OFEA 3R89A 4IWWA 2VR2A 5CSSA 5BU6A 4PUUA 3GX9A 4H7VA 2DFAA 3ID7A 4NAEB 3GR8A 3ARZA 3UY7A 3CV6A 1M5WA 5E0CA 4B5VA 4WR3A 4JYDA 5HK4A 4EP8C 5A95A 1LUCA 2GWGA 3TOPA 2GGIA 1F3TA 4HK5A 2DT1A 1OFPA 3P6LA 1ZLPA 2A6NA 1H7WA 3LUTA 1YXCA 3CZ8A 4Y9MA 1GVEA 3SY8A 3FW6A 2QPSA 3NGFA 2JGQA 3G22A 3SSJA 2NSOA 2KAUC 2OG9A 3P5ZA 4OUEA 4RNHA 5EY5A 4OFCA 4GXPA 2XM2A 3NQ6A 1UOZA 1X8FA 5LXEA 4O10A 3APTA 5FOOA 1T6MA 2Y62A 5H8UA 3EPOA 1UIPA 6REQA 2DH3A 1JAEA 4MZ1A 4C1KA 1XGZA 2NXGA 1XLDA 4FXRA 5AKQA 3BZJA 4NZ5A 5I23A 1QR7A 4DJDA 4F0SA 3N9SA 2VCCA 3HIJA 3ZLHA 3QY7A 3MSYA 3GHSA 4JCLA 1DWAM 4UCGA 3ZT6A 3C2EA 2XU2A 3VIKA 4Q8UA 4ZO9A 3SQSA 3WYZA 2HE8A 1LRNA 3S6TA 5DX7A 2GSEA 1W5PA 5PTDA 4HPGA 3TX9A 4U3CA 2QQ6A 2HXUA 5CPTA 4B2DD 3UWYA 4B9YA 1CXIA 3GUGA 3GS6A 2J47A 1QWKA 1OF6A 5D04C 1S5NA 3DHDA 2ACSA 3DKLA 4LYQA 3VIPA 4IL2A 3ARWA 3W38A 1EQPA 3OZYA 4Y96A 1U5HA 2HNHA 3IK4A 4GNVA 4AY8A 3AS2A 2DZUA 3CUHA 4AIOA 3H21A 1A5AA 3RLVA 5JU6A 1R3TA 4K8GA 1HL9A 3SBFA 2P76A 3EMCA 3EWZA 2QCCA 1UWIA 3UG3A 4LRTA 1MEWA 2WXDM 4LJ3A 1J5SA 1KW1A 3LCWA 3N2OA 2C91A 1PSCA 4XSMA 2DY3A 1WPCA 2BV9A 1QXLA 1W3LA 1V3LA 3NDZA 2OQLA 3WH5A 3PNZA 3S46A 3CAQA 4R88A 2HROA 1OFRA 4UQBA 2ZZ4A 1TRDA 3ZQ9A 5HDRA 4LVFA 3AIBA 4S3BA 3MMUA 3M5YA 1N82A 2J27A 3HPZA 3NJ3A 3SCSA 2P3EA 3CIVA 3BAWA 2WO5A 2A7RA 1SZFA 2JIEA 2F9RA 1JZ5A 4BWLA 4ES4A 3GQYA 3GHUA 3Q67A 4L6OA 3W85A 4CNUA 3MHFA 1GG1A 4DAFA 4ZCWA 2ZXDA 1KM2A 1DWIM 4KKXA 4MVAA 4AIEA 3ABQA 4ZO7A 3W1XA 2PWHA 3BGGA 3OW1A 5DO8A 3P62A 2R8WA 3ABRA 3HA1A 4AFYA 5MKGB 2CZ5A 5EMJA 1SMAA 1PWMA 1GQNA 4JTFA 4LH8A 4Q8TA 3TH6A 1YTEA 3H6OA 3WLOA 3LBMA 4EOUA 3W22A 1V8EA 4MY9A 3CTTA 2Y0FA 2ZRZA 3G1YA 2EO7A 1TMQA 1EPXA 4QLJA 3F5JA 3F4VA 1CECA 5E93A 4C6IA 2NV9A 1GPFA 2EG7A 3TYBA 4TU1A 1V3JA 3W4RA 1EJSC 1DJYA 4A05A 1GOMA 3IJ9A 4B91A 2X16A 4EXAA 3PFRA 3ZR5A 3HU7A 3IRDA 4W8AA 2BSLA 4M51A 2BVWA 5HANA 2O9PA 1DJIA 4DZAA 1MRQA 4NIRA 5BXTA 1LDCA 2ZRXA 1V02E 2DZPA 3UJSA 1PEZA 3LHZA 3GBEA 4J28A 3P8IA 3S47A 1B3YA 4ZB2A 4NSBA 3WUEA 1SZGA 2IXUA 3AZSA 1MXDA 1TPFA 3PWIA 3D0CA 3DFOA 2Z1SA 2XGZA 3WMBA 1L6WA 3NR0A 5C9UA 1VEOA 3CUJA 4F66A 3MW7A 4E38A 1DWGM 4GGBA 1S5WA 4I8DA 4ZOEA 3A4WA 2V8ZA 5D9PA 2A2IA 1GOXA 3PWAA 3VD4A 5MF5A 1UZHA 5D32A 1OEPA 5I79A 1QAPA 2AMXA 1ZBCA 3ITLA 4CN4A 7TAAA 3GLCA 2ZX7A 3QBUA 5FJIA 5I09A 2CHOA 1JYWA 3BUVA 2E9LA 1HGWA 1H1ZA 2IQDA 3UGRA 1HJSA 4NQ1A 4CNSA 3RIKA 4ZB5A 1A4MA 4U2ZA 3VGHA 1BLIA 4CQBA 3GKAA 3FOKA 3B8TA 4Q7IA 4GRSA 4PMOA 3BTNA 1GOOA 3FX4A 4P8XA 3G0XA 4A8RA 3AZTA 3FEMA 3ZSTA 1KM5A 2Y7GA 4NAEA 1X6LA 4GQGA 4FX6M 3W3OA 1JCJA 3CLWA 4AY1A 2PGEA 4GCAA 3L4ZA 1CW2A 2JKAA 1ZPTA 2A7NA 4S39A 3CUGA 3CU2A 5C9XA 1W9PA 3TW9A 2VC7A 3CAKA 1XLBA 2PRMA 2XDFA 1KBKA 2OGYA 1OQFA 2VEGA 3PZTA 1VYSX 2FB2A 3CHEA 3O6DA 1H11A 5G2IA 1E0WA 4XBKA 5LNVA 5EMUA 1L6GA 2FDSA 3CYJA 4WRHA 1FKWA 4TQTA 1AZ1A 3GH5A 2OWXA 3M0IA 2E09A 2CZDA 2OYLA 1GQJA 4P5UA 3T4CA 5J5DA 4MPQA 3A9IA 1C7TA 4IGMA 3S8HA 1B9BA 3EDJA 3NFUA 3ATYA 5T9CE 1WUFA 4HP5A 2BOFX 2JGYA 1DWJM 3TMQA 5A94A 4O1BA 2R82A 5HPCA 3LPGA 1EIBA 1HXJA 1U83A 3M0YA 3FSUA 4FMVA 4GD0A 2CLEA 3LMZA 3PZIA 3CH9A 3K1GA 3O1NA 3NPVA 4BS0A 3R0KA 4O8AA 4ACZA 3CL7A 1J0HA 3ATZA 4YIWA 1PX4A 1W3IA 4CVWA 5A8OA 1IT8A 3PTDA 1YKWA 1NH6A 5C6MA 1RCQA 1EHAA 3R79A 4M81A 3CNYA 1D3GA 4M7SA 3SRHA 3BLPX 4YTQA 4F8XA 1GJUA 5DY3A 3UWQA 2PDLA 3GH7A 1FWGC 1E5JA 4HPNA 1XIJA 2VDHA 4HZ7A 5IDZA 4GY7A 4GI4A 2ZQ0A 3W0KA 2J79A 4U33A 3PUDA 2PC4A 4O0KA 4HGXA 3R5EA 4EF9A 3KM8A 4YL2A 1R3SA 4IQEA 4RXFA 3M6YA 4FHAA 3TCEA 3P2VA 3CHFA 3T08A 3W2MA 1DQXA 4B5WA 2ZTJA 1PIIA 4MKNA 1UUQA 3GC4A 4MHBA 4PCPA 1I9CB 3UPBA 2P8CA 4RDZA 3C2OA 5HR7A 1FWBC 3QHMA 3PZ9A 1JDCA 4AC7C 4WSHA 4Z0SA 4D72A 3QOMA 3SN0A 2TRSA 1EDTA 5FCZA 1EGZA 4E4UA 1HX0A 5DXYA 4E2BA 2XZ7A 1VEPA 3QHNA 3P60A 1V6WA 4O50A 2GYIA 5IM51 2VDGA 3VAVA 3R0DA 1Z32X 3VIOA 1RQBA 1JDFA 2QGHA 1U1UA 2PA6A 2Q8ZA 2O0TA 1EDQA 3WNLA 4KFPA 3G1RA 3DI0A 3TN3A 4FNTA 4AD4A 1Z69A 2VL4A 3LB0A 2XISA 3E49A 1VC4A 4FOKA 4AC1X 4D6EA 4LALA 2OMAA 5L6UA 2EPNA 3V3WA 1SQ7A 5KEZA 1GOQA 3UD6A 4MFEA 1BXCA 3U2ZA 3HOJA 1RA5A 2WJEA 3BW3A 4MOZA 3GDLA 1Q7MA 3EBVA 4ZTXA 3W1QA 3W6MA 3W7IA 5E0KA 3MWCA 1W1A1 1H0GA 1SZEA 2JKPA 3LM7A 1R3WA 4F9DA 4FP1A 1RBLA 3HFYA 4FR6A 3MV01 3CWHA 3TSBA 3M5XA 4NHVA 3B06A 3DXIA 3I4KA 3EOSA 4ZQRA 1M7JA 4PA8A 3VO0A 2YR1A 3PB2A 5BYWA 2XWDA 3CAVA 3B40A 2Y61A 3S2CA 1HJQA 4I5XA 3W1MA 1H51A 4RE2A 2ZDRA 4OGZA 3VXGA 3LLFA 1F4AA 2YKKA 1RK5A 4DJDC 1FDJA 3B0VC 2VM8A 5FL0A 3UG5A 3S4TA 3FKRA 3FYOA 5LA2A 1JRCA 1EUAA 2PD5A 4GC3A 1JQXA 3HQPA 4MGGA 1ICQA 3V7PA 4UQDA 3QV6A 3S0CA 4ERGA 2X1TA 3DFYA 3W1UA 4HTYA 4LAKA 2GGEA 3I7QA 2OZ0A 2V67A 3MKCA 2BODX 2QDGA 5BRBA 4D71A 1TX0A 1V6UA 3AXHA 3RCMA 4CNOA 1US2A 1X7FA 4QDPA 4IX2A 1EF3A 4Q22A 5I5RA 1E51A 2NQ5A 1IEWA 2ESCA 4N42A 1ZS2A 3G1VA 1FOBA 4R85A 2XINA 4MSSA 1HKIA 2FTYA 2J88A 3TROA 1HJXA 4KFOA 1RD6A 4N6FA 4O28A 4L5ZA 2E5DA 1H0IA 1P48A 1K6WA 2WSYA 1EB3A 2G5WA 1JCXA 3QZ6A 4PE8A 1Z6KA 2DSKA 4D9PA 4N9CA 3LV6A 1E9ZB 2E77A 4RV8A 2DIKA 2V9DA 3VDHA 3KRBA 1F3WA 4HNCA 1B9ZA 3DFQA 2G8ZA 4O1CA 4Y9NA 1MW0A 4H9VA 2ZZ2A 1ZALA 4HHLA 4BWLC 2VGBA 1EGVA 1KGXA 3T81A 1XX1A 3RF9A 2VFDA 3ARYA 1GYLA 1XLKA 5F1UA 4UTLA 4LUSB 3VCRA 2BB0A 4LYPA 1ZP3A 3L0GA 3VNKA 4NJJA 6TIMA 4GJ1A 4OT7A 3QKZA 3CYVA 1RUSA 3TA9A 4HHPA 2WZHA 3T0DA 1D7KA 5CC6A 1F74A 3EXSA 4MB1A 2WZTA 3W2NA 2QF8A 3VMNA 3SCWA 4CU7A 5AHIA 3QM3A 1PYMA 2XFYA 3UZWA 4WY0F 1M1BA 2V0TA 4JNMA 1OVDA 4ZOBA 1UA3A 3NXFA 2RDUA 4XZHA 1JR1A 2JEPA 1G69A 1LWJA 2YL6A 1CX9A 1KA9F 4KCWA 2OSWA 3AOFA 4JNYA 2DZSA 4L9YA 3KTXA 4GVGA 5HATA 2GFTA 2J78A 3KXQA 2WQDA 4IMEA 2QV5A 1PTAA 4RDYA 2Z27A 1TWSA 2VEMA 3C2VA 1GZ1A 5JXQA 1P0EA 4UOQA 3BCDA 2GVGA 3FGCB 3RX4A 2VYOA 5I02A 1VRDA 3SIZA 1FFRA 3B8WA 4R7JA 1KM3A 2YXXA 2Y7FA 3LX9A 1R8LA 1Y7VA 1CLKA 2PUZA 1Q3NA 5CSRA 4G1KA 2HVNA 3OZPA 1XLIA 2OWCA 4D1JA 1IXNA 1SJCA 3PBYA 1PXGA 1J0JA 4UQAA 1EHNA 3STFA 3RPMA 1AW1A 1H1NA 5LIXX 2E3ZA 4WXYA 3HMJG 2GVEA 3R12A 3FYYA 1G4PA 1PTGA 4JIIX 4H3DA 5EPDA 3FVDA 1TRIA 5E09A 4QG6A 3B03A 1CXEA 1NQ6A 5LXXA 1OYAA 3S1VA 4HMNA 4LAZA 1PYFA 4HNOA 2JKEA 3A6OA 2PU1A 3H26A 1V6XA 2PTDA 4IMCA 3WDJA 1J4EA 3FA4A 4OHQA 3NOYA 3T9PA 3IUDA 4M7TA 3PAOA 1T96A 3NZRA 3TUUA 1L6YA 3CIXA 2YIHA 1UWUA 3ES7A 4NJIA 2POZA 4DIAA 4KH2A 3NWRA 1W3KA 4G5DA 1XG4A 1J12A 3F7JA 1ZAJA 3H4WA 1FP9A 4IMFA 3ZLGA 1XDJA 2FFIA 3KOYA 3VD7A 3HG2A 5K9CA 1KFKA 3RU6A 3TU9A 1YPXA 4Z1YA 2P88A 3RYSA 5A6JA 2BVDA 1NF7A 3UVAA 5CLTA 4I9JA 2QAPA 4K6AA 5E1QA 3OLGA 3TNOA 2G4JA 2I17A 3AHXA 4XD6A 4YTTA 3B9OA 1RALA 2OSXA 1EBGA 5FIPA 2WCSA 1Z7AA 4FNUA 3OLIA 3L68A 1RJQA 4HSHA 4AEOA 1IZJA 4IG2B 1MNZA 2NT0A 1EUNA 3ZWSA 3UNTA 1G1YA 1LBFA 4MNLA 3MKVA 1EX1A 3BDKA 4JN6A 1CB7B 2XH2A 1PL9A 3GXMA 3WZ0E 3VOFA 3C0JA 1GYMA 1H63A 1JZ7A 4F0KA 2A6LA 4L4LA 1UR2A 3S42A 1E6PA 3TW6A 3TDFA 4NZ4A 3M0VA 4S3CA 1VBHA 1BYBA 1F61A 5CZKA 6ALDA 1DOSA 4PSRA 1CXFA 2PTWA 4Q4SA 3WDHA 4H19A 5CJ5A 4QISA 3KTSA 3N29A 1E1CB 4BCEA 1TG7A 1H2JA 4CCCA 3DH7A 1QRQA 5HJLA 4U5KA 1UR3M 1PDZA 3CLMA 2FTPA 2BHYA 1WDDA 3L5AA 4DI9A 1K9FA 4C65A 2ZXQA 4GO9A 3RMEA 2R91A 1POKA 4KT2A 4ZGYA 5EGRA 2D23A 1P0BA 5EFDA 1EOMA 2Z7KA 2DSUA 3N6QA 1ZJIA 3LBOA 3C4UA 4LBRA 1W91A 2ATSA 1V02A 2YOCA 3GC2A 1F6PA 3L0NA 2DP3A 4MJZA 4L1XA 3VGGA 2ALRA 3W1NA 3A5FA 1V4YA 3EX6A 1GHSA 3KL5A 3CAWA 4LOCA 1PKNA 1V79A 4E2OA 3VPLA 3GNPA 5HWNA 2JE8A 4AZIA 4HU8A 3QLLA 5DRIA 4CEUC 3SCUA 1UOKA 1P43A 4Q8NA 1A50A 3ARQA 5KZMA 4KWUA 4DNMA 3IPWA 3SY5A 4JTEA 4JEQA 1VIZA 4FF7A 1OM0A 3N11A 1TJPA 1DTUA 3SCPA 2G3JA 3UNDA 1D2KA 1Q2SA 4LUSA 5DXXA 1Y5XA 3VIGA 5F2GA 1ZTVA 5TD4A 4NX0A 2EPKX 2FMOA 3G8RA 2V30A 4LCRA 3IRSA 3PZGA 1V51A 3MQTA 1UR8A 3M41A 1S1RA 1M7XA 1W5MA 3C2YA 1B3OA 3ONCA 4DPPA 1FCQA 4WDUA 2I5IA 3WH9A 5HBFA 1XYBA 3MPGA 3URQA 4KWVA 5ECUA 4ROQA 4J2PA 1XBYA 4GK8A 1ITUA 2PDJA 3ARRA 5LA0A 3O3RA 1UQYA 3SSZA 2ZRWA 1GORA 4Z2JA 1HZYA 3S2MA 3EWYA 1XGDA 3AIEA 2QVHA 1Y5VA 4Z2IA 3PFMA 1W3JA 3MP4A 4V27A 3W88A 2P3ZA 4S3KA 2VC9A 2RDTA 3H2EA 4UTWC 4Z17A 4JQ2A 3FGCA 4HNLA 5ABFB 4NYYA 2ZZ1A 5EBUA 3HGRA 1SW7A 3K30A 4IFRA 4CCZA 3GU2A 1VD6A 4NU7A 4O1AA 1FBAA 1G01A 3GNOA 4O18A 3Q37A 2BS9A 4RZBA 1ZHAA 3DYMA 2SFPA 1JCLA 3OOQA 4QIUA 3VKAA 1ZQ5A 2IQ0A 3W28A 1B2YA 1V7AA 3G1FA 1BVZA 5JBEA 2X42A 1NFGA 2FHBA 5CGMA 4AF0B 4KMQA 4WCJA 2C16A 1IWAA 1WX0A 1W9BM 3FAXA 3DENA 2A5HA 3U48A 3GXPA 4IP7A 1K6AA 1DEDA 2YZRA 1XYLA 5CBBA 2W66A 1QATA 3KOZA 2ASHA 5CKSA 1UR4A 4N9EA 3E74A 4EVZA 4H00A 2R1MA 4XKYA 3C2FA 4AAJA 8TIMA 3TW7A 3AU6A 4QE5A 4NXKA 2C18A 4GX9A 2CC0A 1VFFA 3A12A 3CWNA 3IIXA 1VP5A 3ZVHA 4QLKA 2VVNA 2C1GA 2J7BA 3HM7A 1PKYA 2WCAA 3Q58A 4PL2A 4YTUA 3WLPA 1SZNA 1N7KA 3S1UA 1A5BA 2BY1A 5K2ZA 3EX4A 1ZB5A 3RXZA 1TJ1A 2QS8A 2Y89A 5D03A 1B4KA 2X7WA 2VC6A 3NQMA 3H2MA 5JQ9A 3O9NA 3LQGA 3RO8A 1J6OA 1Q6EA 3E2VA 5IDIA 1Z89A 3TJXA 1TA3B 1QPKA 5AN7A 4A3RA 3L2IA 2XSAA 3W1AA 4XK2A 2J9YA 1SU5A 4URIA 4QJ4B 3AXIA 5HNTA 1XBXA 2GVJA 2CW6A 4ZENA 1X98A 1KR1A 2JQXA 3ZYZA 3VKDA 3HN3A 3AZRA 1QK0A 3U4AA 3MMWA 2C71A 5D8WA 4DZHA 3N13A 2BHZA 4XAFA 4WXZA 2EF9A 3VIFA 4JD4A 5BNKA 4XBJA 2VRQA 1EC7A 1BWKA 4O4WA 4H41A 5L9FA 4QAWA 4QM1A 3PBVA 4U4MA 4C1NA 2VI0A 4IIHA 3W6LA 2EQDA 2GOKA 2LLEA 7A3HA 1QNPA 4QCEA 1QW7A 3UJFA 3VZYA 1BTMA 1LOLA 1Q5MA 2FZ9A 4PCTA 3LZ3A 1UD6A 3WUGA 4FS9A 3TR9A 1XW8A 1ZRQA 1V6TA 2XFRA 1OHLA 3B9EA 4XV0A 4GO8A 3HGJA 3UT0A 3BVJA 4CCEA 3LI0A 3VGBA 3D46A 5D2WA 3TMLA 5BWFA 1G9HA 2HTMA 2FZDA 3QSTA 2WSQA 3NL5A 2J75A 3PPHA 4MF4A 2QDEA 4HSNA 1R30A 1FH9A 4QS5A 4H9UA 2DJXA 3TQVA 3UCQA 3E2RA 3IJ8A 1Q2RA 3URNA 2BHUA 4UNLA 4AIUA 4N2YA 3UWZA 1EBHA 3UWUA 4BF7A 1C7SA 3NSXA 5FF7A 2Q3OA 4S1FA 1CGXA 3U6WA 2O4MA 1MFUA 1LOSA 5I78A 3GZAA 5EB8A 4N0RA 2YCEA 2VNCA 1SW0A 4WSJA 3HQOA 4GVFA 1FWEC 2Y85A 1ITQA 3BWWA 2XUCA 3DG3A 4S3DA 2AKZA 4IOTA 4JTIA 1CGVA 3CZGA 4ML4A 1T8XA 2ZUNA 4ECLA 1IHIA 1XSKA 1LLOA 2GJLA 2ZUVA 4EE9A 5D2VA 3VIHA 3VKKA 3WK2A 1KCLA 4U31A 1DP0A 3KTCA 3NO3A 1SR0A 3UCCA 3GDKA 4QBXA 3EB3A 4LB3A 3WH7A 1TWDA 2UZ9A 3KWSA 3MV11 3IJLA 3KBNA 1KTCA 2PCQA 2VX4A 2ONEA 3IUHA 4RW5A 4NAFB 5D30A 1UC4A 3ARUA 4AHOA 5EMYA 4DNHA 4JTJA 5H2ZA 4C6FA 3VKJA 2G41A 4IIEA 4I7VA 1UWRA 1OX5A 2XH0A 1EH9A 2OX4A 3KCLA 2ZXBA 3WFZA 2Z0IA 4NZJA 2CXGA 5BRPA 4GXWA 3LERA 5CPQA 5E0FA 1FUYA 5F4XA 2J66A 3KFTA 1EF2A 4JFSA 1ZBKA 4FPSA 6PTDA 4R9OA 3A5VA 1MDLA 4IP4A 1FWSA 4UQ9A 4XTDA 3TN6A 1VGAA 3MZNA 2V63A 1B1YA 4YVPA 1W9UA 4DX3A 1EP3A 4FX7A 3WQFA 1UWAA 1K8CA 3DCPA 1RV8A 4FOUA 3RU8X 4WF7A 2REQB 2WHJA 2P0IA 4DM2A 1GOWA 2NVCA 3GG1A 1GPWA 4I5RA 2L5HA 3W2JA 5CSYA 2WVVA 5A6BA 1AH4A 2PB1A 1O68A 1IT7A 2V6AA 3VDAA 4GIAA 4XO6A 4D2JA 5ABFA 2QLYA 3S1WA 1FWCC 1YQ2A 2DT0A 1OZMA 3SEPA 3A4JA 1WOAA 4QRNA 4D1IA 1CEOA 1AH0A 1J10A 4FZIA 1UH3A 1J93A 5E9AA 5C2GA 3WFLA 2R1PA 3TEVA 4MLJA 4R5EA 3I7SA 2OWWA 5D2TA 1FCUA 4DI8A 3F4DA 1QI2A 3VABA 5CXPA 1XR2A 1B4EA 2RGLA 2PODA 3PJTA 4WKAA 4FLRA 2YZ5A 2V5JA 1NOFA 2VUNA 2YCKX 2PSNA 4PMZA 3MO4A 4B9ZA 3TTSA 1XQLA 3WJZA 3N34A 1HKJA 4B16A 5C54A 2NXIA 5DT5A 2AQOA 4X0VA 3WF3A 3NYZA 1WDPA 1JZ4A 2ZZ6A 4TOQA 3CIWA 2CKRA 4LYKA 5G2HA 1TJ2A 3OVPA 2ZTKA 4TX6A 1GUVA 4GGHA 3V75A 2J62A 2PU0A 3N12A 1QHOA 2V5DA 4GUFA 4E3TA 2EGZA 4OUIA 1JF5A 5EL1A 2WCGA 2Y63A 3FA3A 3NGJA 4IJRA 4DUWA 1DKWA 1JPDX 4H8HA 4Z2KA 2QUTA 1R87A 4NI8A 1TA3A 3BLIA 3EB4A 1XFCA 1W8SA 3CUZA 3H2FA 3UR2A 4B5XA 3T2PA 7ENLA 1XINA 2DZVA 3WELA 1H3GA 4PUKA 3UXLA 3NQEA 3E0FA 4AZHA 5G1TA 3TFCA 5I3JA 5HNUA 4AZ7A 3TJIA 3NL3A 3W7DA 3UG8A 4I9TA 1DQUA 2V3FA 2FJUB 4MPKA 5C2CA 3AYRA 2X7VA 2VO5A 4E0CA 3STEA 4EIVA 5BXRA 3EXRA 2B31A 1AQHA 1R3RA 4PUNA 3SCRA 4RJEA 3L2MA 1IGWA 1HJUA 4RDVA 2WPBA 2PRHA 4L61A 4UCFA 1B5TA 1VS1A 3AHVA 1MW1A 3KCJA 2VEKA 2G3IA 3U4FA 3PC0A 3P67A 3UXAA 1K77A 2V3DA 2VEPA 4E2VA 1OIFA 5A8QA 2D0FA 4FXJA 4JXCA 4OU1A 1JDAA 4A3YA 4LANA 4FR1A 2ICSA 1MQRA 1EKOA 2R6OA 2X1RA 1Q13A 2ZVIA 2A3AA 2DQWA 1H41A 3BANA 4ZO8A 5U4NA 5LHFA 3W7JA 1OD8A 4XTIA 4IMAA 3AJ7A 5D2XA 2D22A 1Q7QA 4HYWA 4DUOA 2HEJA 1YE4A 2NT1A 4OKDA 4EACA 1AD1A 3U0HA 1AODA 4YTRA 3TJ4A 1NFPA 3CZLA 1BYCA 2FVLA 3B97A 3DAQA 1ENUA 3EDEA 4K38A 4JIQA 5RUBA 1DORA 3NQGA 1I2OA 4PR4A 3O2LA 4ADSA 1HO4A 2PDQA 2XVGA 1REQB 1CGYA 3WEZA 1H62A 1YDVA 4P7NA 4AUBA 3LENA 2WKJA 4LUTB 1HUVA 1JUBA 3SR7A 2QCGA 3HQNA 2CLOA 2Q8XA 3DKJA 3W27A 5I7GA 1CENA 1GVRA 3GW0A 5FSEC 3WJYA 3VOCA 3ENLA 1M01A 4KWWA 4GCXA 5FJPA 4BY3A 3CMGA 2QCMA 4X2RA 1R0MA 3LI1A 4PEEA 1W1YA 2UBPC 4PMVA 3NXLA 4J3VA 1IGSA 2G0WA 3QMRA 2C1IA 2X0SA 1XYCA 3WD4A 1F05A 1W5OA 5KSWA 3FK4A 1RVKA 3KLLA 4KGLA 3OG3A 2NV2A 2RJHA 1XV8A 4HK7A 5JVLA 1NF0A 3LRLA 4X3ZA 2PMQA 5AHFA 3K4AA 2VFIA 4E4FA 1WAWA 3OIXA 1MZHA 3ZR6A 5T8GA 1BGAA 5DMYA 3VFCA 1EJRC 5D02A 2D2OA 2OEMA 3SCNA 3P74A 5LIKX 1C8VA 3UZZA 1NDVA 3NZ1A 4GUGA 1U5VA 2PTXA 1L8PA 4O15A 1Z8AA 4AWEA 4RPQA 1EWDA 1NOWA 4R53A 1PTDA 1JPHA 1J9YA 2H6RA 4L1GA 3U9IA 4ACYA 2ZWZA 3PZOA 2ZE0A 3HQ1A 1TE6A 1A4LA 3LMYA 3Q94A 3DDMA 3PUGA 1JPKA 2JF7A 2NX3A 3BQ5A 4H7ZA 5BRQA 3WBEA 2WANA 4B2DA 3AMGA 2XFWA 1NDYA 4KCVA 1VZWA 1SR9A 2PDMA 3G5EA 4Q8QA 1UWSA 3MCOA 3K8LA 1KR0A 4NI3A 1EZ2A 2DVTA 3C8NA 3AAMA 1PE1A 3TA6A 4GIYA 4C6PA 1L2UA 3A21A 4AZBA 1PV8A 4TX9A 3AS0A 5GNZA 4PMRA 4QTGA 1RAKA 3BOFA 2VJXA 3LG3A 4CQCA 1JNEA 1HJVA 3M16A 4B4FA 3P3BA 2FDMA 4M56A 2BOEX 5I3IA 1EA9C 4PMDA 1UBSA 3QV8A 1TV8A 2DU2A 3KHJA 1I2PA 4FNSA 2PBGA 4RNIA 4YPJA 1FRBA 3AWNA 2WJFA 1QW9A 2BXZA 3EWUA 4P7OA 3OP2A 2J25A 4PFHA 1AW5A 3UXDA 4UR8A 1JIBA 3GNRA 4HN4A 5F2LA 4M29A 4WY0B 1V93A 2E40A 4AVFA 1UASA 4KIRA 2PDNA 2XVLA 4CD8A 3H70A 2GJXB 4ZSTA 1W9DM 1GKPA 3AIQA 2GDVA 4H8NA 1RK6A 2VHLA 3C0LA 4DJFC 5H8PA 3IK2A 4QJ3B 1I2QA 1RQHA 3WK3A 2TPSA 2E28A 5KZDA 4E4PA 5BOEA 4DN1A 2WBKA 2Y4SA 3ELFA 3LRMA 2HJPA 1I2RA 3HZ3A 3U8GA 3KOWA 4WDWA 1KV5A 3MANA 1PCWA 3KX6A 1EDGA 1YLVA 5F2MA 2ZX9A 1A47A 4PFMA 3E0WA 4JL1A 3CWOX 2E6FA 3UZJA 3N4EA 1A0DA 2ZICA 2DDXA 5A8NA 4G1NA 4TXEA 4IXHA 3BL3A 1A5SA 5EYWA 3R13A 3UWVA 1AW2A 3VCCA 3IGXA 3VC6A 2OEJA 2XSBA 2WNZA 4O8RA 3NPXA 3AQUA 2YB1A 5GQBA 1UROA 4QLLA 4K7YA 5HMDA 2WHLA 4AVNA 1Q65A 3U3HA 1H5YA 3C86A 2XJ7A 3A22A 4A3UA 4IISA 3BSHA 4PTVA 1WB0A 4K1GA 4W84A 4BI6A 1C8QA 4YYCA 1MMFA 1VIWA 7CGTA 4JIEA 3AICA 1ME8A 3NQAA 1D8WA 1XYAA 4Q4MA 3BE7A 3O15A 4RR4A 2C0AA 1CGTA 4Q8VA 4IPLA 4AU0A 4OV4A 3W7NA 1DV7A 3F2BA 4IIBA 5DCDA 4AXKA 2H3DA 4GQQA 1A53A 2JBMA 1ZSXA 2D73A 1AA1B 3N4AA 1AQFA 3EXTA 3I3EA 2VR5A 3B8SA 3Q2DA 1DPMA 1UP0A 1E9YB 4TVCA 3UW6A 1NSJA 3TN4A 1KLZA 4C7DA 3MVIA 4DRSA 2EKCA 2O56A 1LROA 4NYUA 4EWND 4ZR8A 2WC4A 3BV7A 5ENLA 1LRQA 4FLSA 4GZ7A 1ONWA 3WLQA 4XZNX 3BURA 5E6ZA 2I7GA 3M0HA 1BF6A 1ECQA 2WM0A 4RX0A 4B92A 2QPXA 3MY9A 4CD7A 6TAAA 5T9BG 4MB5A 4GWEA 1J11A 4UMBA 4P2VA 2DJLA 4XKMA 3PF3A 5C7VA 2GQAA 3P7YA 4NP7A 1VH7A 4IUGA 4MWAC 1REQA 3PWGA 4AYSA 4E8GA 1XM3A 2FPYA 5I24A 1TV4A 2Z26A 1W1VA 3ZJ8A 2A3EA 3NURA 3G6LA 2GUBA 4YMZA 4IHCA 1G0CA 3GG0A 4PMNA 1KB3A 3V0SA 4ZE5A 4DELA 1QI0A 4A22A 4UTFA 1G7UA 3POCA 2G4FA 4NKCA 3T1GA 4JX5A 1KXHA 3G18A 1ODUA 3LTPA 2W3ZA 1LL4A 1BD0A 3P5YA 4HMDA 1WO2A 4MY1A 1R6WA 4IM4A 1QOXA 4JAWA 3M9YA 1SFLA 3EKGA 1JZ2A 3MZ2A 1PZ3A 4UBPC 5LKYA 3CHCA 3WENA 2OTDA 4H8UA 4AEFA 3I7RA 1J79A 3YPIA 1H09A 4UFMA 3ZR4A 3GYCA 1IWBA 1SW3A 2BWGA 4DZ5A 3L4WA 4XZIA 1XCFA 4Z0JA 1IV8A 4RW3A 4RV3A 1NWTA 1SJBA 3NPUA 2CERA 3THCA 3ZJKA 4W5UA 1WYIA 4F48A 1Q63A 3I6TA 3N2TA 3RM9A 3GVRA 4CNNA 4KS0A 1WKEA 2J7EA 1Z44A 4R33A 3OYZA 2NLIA 1NIUA 5CPLA 4WK9A 3MJYA 2GQ8A 2ZZ5A 3VTRA 3IIPA 4GE8A 4JYFA 4DJED 1A5LC 3LHTA 4O1EA 1GNXA 3W7KA 2P0OA 1JNDA 2I57A 3W1RA 4LF1A 1WE5A 1XGEA 3JVAA 4XZBA 2EJAA 2OR2A 1WXYA 1TZ7A 2D0HA 1F7BA 3M6DA 4UFHA 4DPQA 2DT3A 1GEHA 4PMXA 3C3NA 3CUFA 3M0ZA 2G97A 4JIRA 5K7JA 3C61A 5GJMA 2FYMA 1M7PA 1WDWA 3TYEA 1TUFA 3QW3A 4Y90A 2X41A 2IPFA 4HMEA 1TMHA 1VBRA 4YLWA 2KX9A 2CIPA 1XWYA 3OGVA 4GNJA 1UQZA 3WF2A 1V3HA 3WNPA 1V3MA 5CPMA 3N9KA 3BXWA 5G4EA 5DCEA 2CBJA 4MADA 2CESA 3ARPA 3QMSA 4ML9A 3DFPA 3VILA 5GJNA 1LL6A 3OEXA 4AW7A 3IJ6A 3TCSA 5HPOA 1Z3NA 2QUMA 3CEPA 4XZ9A 4JHZA 1M7OA 2W9MA 3F4WA 3RJXA 3O6YX 4QP0A 7ODCA 4M80A 3NYDA 2C0HA 3UBPC 4D6GA 1E0UA 3IACA 1HP5A 2RDWA 3SUWA 4C6BA 3B3DA 1E4LA 1FTXA 1VF8A 5DN1A 1PIGA 4G7EB 1IXOA 1KBJA 4FNRA 1KV8A 4Y9AA 1DBTA 1Q6LA 2YW4A 3V0TA 3O07A 1O66A 2VZUA 1GZJA 1TPB1 5I3DA 1B3WA 1TMLA 5FJRA 3AHYA 3MSDA 3SN4A 1W3NA 2GL5A 1LYXA 2E1WA 2QUUA 1DWHM 1ISVA 5EMMA 1OC5A 2ABBA 4XAYA 3LGDA 3BMWA 4WDXA 4HHHA 2JFEX 1S2CA 1JVNA 4H6EA 1ELSA 3ZXWA 5EMKA 2PDUA 1Q66A 5AC8A 2HNEA 1WBJA 5M03A 4GYFA 4PULA 3KLKA 3NQ2A 5LSMA 3OGSA 4YHEA 1V5XA 5C70A 2FFCA 3S5ZA 4UTMA 3S5SA 3CTLA 1H7NA 3LPPA 2J8FA 4DLMA 2AQWA 3EOLA 1F9CA 3PUEA 2DSZA 1Z9AA 3SFWA 1BQGA 2QIIA 2E9BA 1KWKA 1T0OA 2ZFAA 4LY4A 4EANA 1YDNA 3LLDA 1BEUA 4PCFA 1VHCA 2ZC8A 4O14A 4BF5A 2MNRA 3FHQA 3PTKA 2WMFA 1TE1A 5CSUA 2F61A 4ONVA 3BAXA 2FPVA 4Q4QA 2BP1A 2WSRA 3KL0A 3SQLA 2KZHA 3ZFHA 3BC9A 3S1GA 2C3ZA 1PX8A 1X1OA 3COTA 4JKKA 2X8RA 4TO8A 1H50A 2CKSA 1O1HA 1E5NA 4P8WA 3HB9A 5CG0A 2JF6A 1LQ2A 1QWGA 1E71M 3R11A 1FWRA 3IUIA 4K2SA 2BTMA 1SJDA 4LS0A 4V33A 4BZYA 3IWPA 1T41A 2PP1A 4AD0A 2VEIA 3LHVA 3UA3A 3KRSA 3R1ZA 1S3TC 1Q8JA 3POHA 5LZLA 1G7VA 3R6IA 3BCJA 3EMQA 1YYAA 5HWJA 1NU5A 3TSMA 4QE1A 3N17A 5AYXA 1AQ0A 1CNVA 2CITA 2PTZA 2WMJA 1MUMA 4NX5A 4WKHA 1UJPA 2Q71A 4LUJA 2UWFA 2E6AA 3SIMA 3CT2A 1PZ0A 1K8ZA 4LNYA 3LK6A 1EIXA 2WYSA 3W07A 1BGGA 3WD2A 2AL2A 4HKPA 4H4IA 4UTTA 3WLSA 3W25A 1B90A 1UD3A 4WJEA 4Q8WA 1ICPA 1PX3A 1A0EA 1TYGA 4GUIA 1SFSA 1VBUA 2X2YA 3WLLA 4C6EA 1NWRA 1P0KA 3CBWA 3N2BA 4LW7A 3LS9A 4AG0A 1AJZA 5HMSA 4OBTA 2Y8UA 1IE7C 4YS1A 1IT0A 2FZMA 5BOOA 4S3AA 4J5NA 5CAHA 2QYGA 3QJAA 2IPWA 4HT3A 2XGBA 3TLLA 4UNKA 1XG3A 1CBGA 5CPOA 4QJ1A 2RDXA 3OU8A 3QGVA 4XBSA 1GKQA 2HS6A 4OE7A 4GNKB 4OJYA 1KRCC 2OSYA 4LCSA 1W1B1 3B9DA 1IF2A 1ONEA 4ZQNA 1Q85A 4GINA 1TUXA 1K8XA 2A3HA 5HQMA 1AZ2A 3QGAC 4G9PA 3RG6A 4X22A 2NZLA 3A47A 2C8NA 2H3BA 4PTWA 3UJ2A 1FWIC 2GSHA 4QROA 1IWPA 2ZUSA 4HA3A 3RCNA 1EOKA 2RJGA 2BXYA 1C92A 2EXOA 2AQVA 3GTNA 5E9XA 3TONA 3NUKA 3EOOA 2ZDSA 3XINA 3F5LA 1HL2A 4LY8A 5AZ1A 2B7QA 1AJ0A 4LVDA 4ADUA 1DJHA 3IEBA 4RK8A 1S2UA 2ZA3A 5A6MA 4LU0A 1RQEA 3TQPA 1GOIA 2D1ZA 2QCDB 3UJRA 4BI7A 1GK8A 1NWSA 1K7XA 1SM9A 3WCZA 5JIWA 3KWXA 3DHUA 2W67A 3LXAA 4PB4A 3IV8A 5J5RA 1GOKA 4JYEA 4ENLA 3B05A 1F3XA 5HWMA 2W27A 4X9YA 4JTKA 1JCNA 2C14A 3HGSA 4H9MA 2J8TA 3NAVA 3EDDA 3W7HA 3GKFA 5DELA 2Y70A 3G77A 3L0KA 4RKAA 2PGWA 6CGTA 4MIMA 2WWCA 3L5MA 2Z29A 4G7EA 4C5YA 2D2JA 5AOUA 1ZJHA 2IMRA 1MZRA 1W32A 2Y7DA 3CO8A 3AUOA 2HE5A 4IH3A 4Y8EA 5AHMA 2PAJA 2YBUA 4GBUA 4AHPA 1R9ZA 4IFOA 4WUIA 1ME9A 1XSJA 3CM4A 2YFNA 3P61A 4O54A 1XICA 2PF8A 4JZ5A 1NELA 4BFAA 4IXXA 5EKYA 3MMDA 5K3VA 4MJ2A 2IW0A 3WF0A 1FHDA 3ZM8A 3T42A 1FWHC 3N19B 4ORIA 1KXQA 5C8BB 3RX3A 3CB3A 1O12A 5JH2A 2ADAA 3DGRA 2ISDA 5LIUX 1KBBA 4GZEA 3W7GA 1H7PA 1ODZA 4GPNA 1XH1A 1DQWA 1AH3A 3P0WA 4GZIA 1XDLA 4M1RA 4FA3A 3BAIA 1TZZA 3KP1A 3KS6A 4E2DA 4W7VA 1CWYA 5FJJA 3ZVIA 2J7GA 1WP6A 2YA2A 3W76A 2WZEA 3DZ1A 1SZRA 3P93A 5EU9A 4HU4A 2NSXA 3RCYA 3MSGA 4D6JA 3VKBA 4U28A 5REQA 1PO9A 2B7PA 2FIQA 2QT3A 2BVYA 3CQ0A 4PC8A 4JTSA 5M17A 3NA8A 3AUJA 3WLKX 4WLCA 4DHGA 4IMDA 1UH4A 2PWVA 2J7FA 3E3HA 1AUSL 4F9JA 4ICMA 3W53A 4XD3A 2PWUA 3H2OA 2FLIA 3D5HA 3FXGA 4C6CA 1K3UA 1PAMA 4EX4A 3RILA 5BXPA 1GTEA 4RNJA 1W5QA 3M7SA 4S2BA 2RGMA 2GVLA 1K03A 2DW6A 2WC7A 5CEWA 1EWEA 3BCFA 4F4RA 3CB8A 4CKQA 2QHAA 4Z1BA 5K4ZA 3QF0A 5G4HC 1Q45A 3UGVA 4C6QA 2CEQA 4GYKA 3UWWA 1BG4A 4CD4A 4ASTA 1JXKA 3KVMA 3RO6A 1PWLA 1D9EA 2I14A 4GKLA 3PZVA 4EPDC 2DZAA 9RUBA 3WQ6A 1UMLA 4H8VA 1I0BA 1XLCA 4TTGA 1DL3A 1ZCCA 3T4WA 1LLWA 2WVUA 4LBUA 1F2JA 3WK0A 1DHPA 5C2XA 2EG8A 4OOZA 1UR9A 1PDYA 2D2GA 3M5ZA 1GQKA 5HUPA 4GVIA 4IPNB 3E0IA 3LCLA 3N2MA 3OO2A 3IAQA 3GNNA 3QYSA 2GK1A 2YCJA 4ALDA 5I06A 3GZ3A 4R7WA 2OO6A 4LUIA 4WGXA 1L2QA 2FZ8A 4HHMA 2FVMA 5IOBA 1JYXA 4JCMA 1IXPA 1Y5WA 1JJKA 2J9XA 1VKFA 3V1PA 5F1VA 5CZTA 3SCOA 2Z7GA 5ABEA 4IF2A 5D9MA 3AJXA 2Z1XA 4O0ZA 1O60A 1E4IA 3QN3A 4Q4KA 1OIMA 3WL1A 4KETA 3WNNA 3LCGA 4KCUA 3MJMA 1GVYA 4V15A 5LNSA 2B81A 2O92A 4GQBA 4PCSA 2GDUA 3CPGA 1QBBA 1QO5A 4RLIA 1TPH1 2VWSA 4H2CA 4YVXA 3SN1A 3R25A 4RPPA 3O6AA 1PCKA 4US6A 1BRLB 5K9XA 4P7LA 1DIDA 3RPDA 4MNJA 3KOXA 1LJYA 3GM8A 1FDYA 1GJPA 4O13A 1KBLA 4XO7A 4OBSA 4W8LA 2GQ9A 4JTDA 1VHNA 4AMAA 3PANA 4U10A 2DZWA 2PLMA 2WBGA 1XLEA 5LA1A 4UC5A 4CQ9A 1HTIA 1OG0A 4O11A 5I03A 3WMLA 4ILSA 4PODA 5CH9A 3W26A 4CN6A 3NCOA 1OGGA 3A3HA 1RXOB 2E25A 4PUJA 3APYA 2P1FA 5A6KA 3FJ4A 4LNCA 3SUVA 1KFWA 5JMUA 5E5CA 2BXVA 1O5KA 5CC7A 4NJHA 3L21A 5FF2A 4Q7BA 4XZWA 4HNUA 3CH0A 1UZ4A 2CWXA 4L56A 3SJNA 4XSLA 5FEZA 1FH7A 1DE5A 2B7OA 2HV5A 4HZ6A 2O4QA 1JDDA 5XIAA 3FS2A 4LPCA 1K7EA 1W5NA 4DBEA 4HB7A 4Z1AA 5AHNA 2YSWA 3P84A 4HIBA 1TV3A 3HMCA 5A3HA 3QR0A 3PN8A 4UIOA 4OECA 4LXFA 1G4SA 3PG9A 3LD5A 4LVAA 4QE4A 1UB3A 1M04A 4TVUA 2VELA 2G96A 3GK0A 1ADOA 5GNXA 2NWRA 1X97A 2GDQA 1VAHA 3WF1A 1XSIA 4ATDA 3QPYA 1YE6A 4ZSUA 3RM8A 3HG3A 1F5ZA 1Y0EA 5AYIA 3BPWA 2XG9A 1OFAA 3HPSA 3NM1A 3MYPA 3REQB 3WQWA 4NNBA 3SGGA 5BCAA 3R94A 4EPEC 5BOFA 1TX2A 2PDIA 4PTXA 2ZIDA 3ITCA 5IXEA 5H6HA 3LZ5A 4ATWA 3JUGA 3SADA 4OVXA 3AYVA 1X39A 2GZXA 3WX7A 1V6YA 3B8VA 1J0ZA 3MUCA 5HULA 1L9WA 1FX6A 4F79A 3D6NA 3AMLA 3THUA 1HVQA 2C1HA 4UTTC 1B31A 1I4NA 4MKSA 1OCJA 6XIMA 1I2NA 4JFTA 4IGNA 3T0AA 2CPUA 1LRTA 2PD9A 2GUUA 9XIMA 1YNQA 4ZEPA 4Y2WA 4HJWA 4LX4A 3PK7A 3TR2A 4DVOA 4UB9A 4J2MA 1VLIA 1Y65A 5IBXA 3WLNA 4C6LA 3EX3A 5I07A 5I2UA 3C5QA 4EK7A 5BU9A 2R94A 3ICJA 3CV1A 3OZMA 4BEQA 3EEGA 2DQXA 5A6AA 3ARXA 3VC5A 1ESWA 4IIFA 3EDFA 2Z4GA 3P0XA 3LY0A 2OVLA 5XINA 3OPSA 4XB3A 3AALA 5FA5A 2E1DA 4W87A 5CBJA 3TTQA 4MFDA 5G5IA 1VQTA 1MYRA 4LYRA 3STPA 1D8CA 2CLKA 3TK7A 2FHFA 4HU0A 1LTDA 1DJWA 1TSIA 4DF0A 5DY2A 1DJQA 4Z1DA 2ACQA 1IIHA 1IZCA 4US5D 3AXMA 1O6IA 1I6NA 3OBKA 1UC5A 3NDYA 4UTJA 2HPIA 4HVXA 1WOBA 1H60A 3DFTA 3KE0A 3WSUA 3BAYA 2WLZA 4DUVA 1NJJA 3H2CA 1E6ZA 4GVHA 1XIDA 3WH8A 3UXIA 3MHUA 1XS2A 3GXFA 2P50A 4M1BA 4O1FA 5I3GA 1CYGA 3MWAA 1OGSA 5D8ZA 5MKGA 2OB3A 2ZYFA 9CGTA 1TTPA 1SO5A 2BASA 2XSXA 1TFVA 1H49A 4HU3A 4I8YA 3EA2A 3HF3A 1R7AA 4C90A 2GOUA 1R7OA 1TVLA 4Q7NA 4Y7EA 3S5OA 4J27A 3PBMA 1XYZA 5FF4A 2PWGA 4OTKA 3ITTA 1XLJA 4AIBA 3IARA 4GI8A 4UMCA 4QDWA 3EX1A 3UP8A 1R86A 3QQWA 4D8ZA 3DOPA 5HAOA 3WN6A 4YXGA 1MXGA 3ZIZA 2Y8VA 4LS2A 5AHEA 3VNLA 2GWNA 5AHLA 3R10A 3S9IA 5I3FA 4DYKA 1FCVA 2J8GA 3B4YA 2DUAA 3GXIA 4G2DA 3HG5A 1EP2A 1ZCOA 4RUBA 3SZ8A 5BXSA 1KFEA 2XIMA 3TP4A 4Z08A 4XD5A 3DESA 3KEHA 2UY3A 1VFSA 5HQLA 1JCTA 1BQCA 1C9WA 1R46A 3GU1A 5CBIA 2YA0A 3QVQA 1TPEA 3T2OA 1FHVA 4MUZA 1PIFA 3MVTA 3QSRA 3M1ZA 2I1OA 3V35A 4XAZA 5D37A 3H4GA 3JU2A 3ARVA 4AISA 2X0HA 1IEXA 4GY1A 5I77A 4DJFD 1H4PA 5H91A 1CGWA 3S6DA 3HBLA 2WMIB 4ZQOA 3QLDA 4Q4PA 4JQ4A 1ONRA 1WZMA 3H53A 1BRLA 3K46A 1C3FA 2Q6ZA 4JIPA 3G6MA 1A3WA 2Z2AA 3TIMA 4AZCB 1K7FA 1RJRA 3RLGA 4LGXA 4J3TA 5AFDA 1HKMA 1GWJA 5A2CA 3PJWA 5JIPA 3QXBA 2QGYA 5BROA 4X63A 3VIIA 9XIAA 5E6YA 2GPTA 1L0PA 2WJDA 2INEA 4ZVJA 4ZXLA 3OBEA 3MUIA 5FF3A 2G37A 1CXLA 1TVPA 1ISYA 1E40A 1UHVA 2BY0A 4A2SA 1BXBA 3VGFA 3WQ8A 4HPHA 3VDCA 2BFGA 1IIGA 3LV5A 3E1F1 1LUCB 1XQKA 2QIWA 4Q8MA 2X1SA 1YADA 2VFFA 4XAGA 2VX6A 1XH2A 3MP5A 1O5QA 3N04A 2DV0A 2YB4A 1OINA 1CI1A 4MZYA 1OWQA 2DZTA 1G6CA 3BV4A 1DHKA 4PYSA 1RSCA 2E5CA 3GB6A 5H1WA 5HR6A 2V81A 4PN2A 3RITA 1J8VA 4MMWA 3LSBA 3ERPA 1XRVA 6REQB 2QJHA 3MT1A 2YJQA 5C7HA 4AXNA 3UESA 1P4CA 2OYKA 2ZC1A 1WXZA 3T2QA 3W7LA 3PZMA 1RPXA 3EWWA 3N15A 2J7HA 3ZO9A 2XIIA 1MUCA 3THQA 3RHGA 2CBUA 3DC8A 1HKKA 4AYGA 2F8QA 3RNDA 2FGZA 3GG7A 4NZ1A 1ITCA 4N7QA 3NEVA 3W7OA 2UY2A 3REQA 1NOUA 2RH9A 3NZGA 3EOEA 3NEHA 4XVDA 3G1AA 1ZY9A 1I1XA 3IGSA 3H4XA 3UEQA 1XC4A 5AYYA 5A6SA 3VINA 3QV9A 1ZBWA 2VZOA 3H23A 4GLEA 3TYDA 3W86A 4N9DA 3MBFA 4KQNA 2A85A 3C0SA 3M44A 5C71A 4N4PA 4MWAD 3CZJA 1US3A 1BXNA 3LPFA 3WQPA 2R14A 3TAKA 3G1SA 5AC7A 1XHGA 3RX2A 3WF4A 2A0NA 3TWAA 3UQNA 1OBAA 2HRWA 2G3FA 3WBWA 4ZXOA 2BGNE 3BLFA 4PTMA 3SCTA 4ZOAA 1VYRA 4K8HA 1TTJA 3PS7A 1RLDA 1U5JA 1BTCA 2Y24A 4UNIA 4I90A 2AGTA 3PZQA 5F4SA 2VX5A 5CGTA 4KEMA 3VYLA 2HZGA 4B3KA 3EA3A 3W00A 2VX7A 2ZXAA 2V5CA 3OHIA 4K36A 3PTQA 5FJUA 2W92A 4CCDA 2DIEA 2I5QA 3O06A 4IJBA 4QFUA 3AYTA 2QUVA 2BMBA 4LFYA 3MUY1 1NP0A 1ZU8A 4Q32A 3BOLA 2Z1BA 1HP4A 4ERAA 2J77A 1I60A 3CASA 3L4TA 3OODA 1RBOB 4L65A 4OQVA 4JTLA 1SSGA 4ZO6A 3O7UA 2FGLA 2D2HA 2PDCA 3NTYA 3QR1A 2GJNA 2Y1HA 4DO5A 3I6EA 2OELA 3T6CA 2CWNA 1JUEA 1C8YA 3QPZA 1XYFA 4V1XA 1MNSA 1P0DA 2FVKA 3L4UA 3W81A 3HPXA 4PBGA 4XZLX 3MO7A 4KCTA 3ITGA 3QFEA 1J0IA 3D3AA 4AH7A 3QY6A 2VGGA 1BVWA 3PNUA 3I3DA 2Y5SA 3CS2A