2XG9A

Crystal structure of barley beta-amylase complexed with 4-o-alpha-d- glucopyranosylmoranoline
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
487
structure length
487
Chain Sequence
VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-AMYLASE
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 191
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xg9A00
1J0JA 3L4UA 4MNMA 4AY1A 3ZR6A 4D6CA 3ALFA 2BXZA 4KGLA 3IJ9A 4ZENA 2VZTA 4Z2JA 3VMOA 4E8DA 3WIJA 4D1IA 2WZHA 2WXDM 3DECA 4KMQA 1UWTA 2UY2A 1BYCA 2WCSA 4DWSB 4AZ7A 2OWCA 2ZUNA 3VDAA 3OIHA 4TVCA 3VIJA 4C7GA 1GNXA 3OBAA 2ZUVA 2E8YA 1V0LA 4HZ7A 1OCQA 1XCXA 4W8AA 3IAQA 4ACYA 1QI2A 2VZOA 2WZEA 2YLAA 2VZVA 1XYZA 2CBJA 1HN1A 3ARWA 3CZKA 3SUWA 1G0CA 1VJZA 1J18A 4K68A 1O7AA 4PCSA 3II1A 3WQVA 4LPCA 2HISA 4PRWA 1E4MM 4Z2KA 3GYCA 3D5HA 5A8MA 4Z2LA 4UFHA 1JIBA 3LPPA 3WH7A 1V6WA 3ARYA 4MB5A 4ZXLA 2WANA 5I6SA 4J3XA 5AYBA 1KR1A 2WHMA 4MPKA 1Q6CA 1M7XA 2XVGA 2PBOA 3WQ6A 4PMVA 1NOFA 1J0KA 2DQXA 3WNLA 3APGA 2PI6A 2WW5A 4PEEA 3ZMRA 3U5UA 3WD1A 4D6JA 4QLLA 4AZCB 5ABEA 3WDIA 4AD5A 2ZUWA 2QMJA 1PIFA 2CEQA 2CKSA 4AC1X 3OGRA 1TA3B 1B90A 3W4RA 1TG7A 3U5YA 4JL2A 1CBGA 1FHLA 1QI3A 2CPUA 3QOKA 1MW3A 2ZOXA 1WZAA 1QNOA 4J3WA 4B9ZA 2EXOA 4GI9A 3WEOA 2J74A 3B9EA 5LYRA 1UZ4A 2DSWA 9CGTA 2YJQA 2V3EA 1C7SA 3NCOA 2Y24A 2ZE0A 3IJ7A 1W1PA 3WNKA 1KWKA 4FLRA 4WK9A 2A3EA 4HA3A 2Y4SA 4C7DA 5E6ZA 2VTFA 1HKJA 2DH2A 3VGBA 1QI4A 1DWHM 4JFTA 4AW7A 4YN5A 4F79A 2OYMA 1GOIA 3BH4A 2WSPA 2D22A 4V27A 4P7OA 3FNDA 3AZRA 1V3MA 2UWFA 1QI5A 5FOOA 4BA0A 1W2VA 3F5JA 4W87A 1BPLB 4ATWA 4D6IA 1E43A 1AQHA 4XZWA 4TVUA 2XHYA 3RO8A 4MNLA 4GQQA 1BHGA 3W25A 4UFMA 1QPKA 3UG4A 2ZUUA 4GIAA 3QOMA 2QV4A 2Z1KA 4YHEA 2VJXA 2YDQA 4AD3A 4EKJA 4PMQA 1BVZA 2D24A 3AROA 3SUVA 1K9TA 1V0NA 3POCA 4Z2HA 1KR0A 4OKDA 1E9LA 4H7VA 1D7FA 4RE4A 3EDDA 2VQTA 3AHXA 1Q6FA 3RMEA 1B3YA 2JALA 3MV01 1OGBA 2XYLA 4UCFA 4WLCA 1DWIM 4ZFMA 2GJPA 2D23A 4F66A 4WF7A 1KXQA 4CD5A 1X6LA 1OINA 3EMZA 5AC4A 3PZTA 4H8VA 5CPSA 1LWHA 3BC9A 3ZJ8A 1OGGA 1HJSA 2XSAA 4W5UA 3AS3A 3WD2A 2WKGA 3G6LA 3N9KA 5DMYA 4J7RA 2NT1A 1HJWA 1FH9A 2OSXA 1MQRA 5IXEA 1WDRA 4AEFA 4AEEA 5HBFA 4M81A 2YOCA 2WCGA 1H41A 2YA0A 1O6IA 1KGXA 3VILA 1Q6DA 4TXEA 1GOMA 1UHVA 2YLLA 2PF0A 3LPFA 4MNJA 1JDDA 3K8MA 3BLPX 4CD8A 3KL5A 2E4TA 3VO0A 4HZ6A 1GOWA 1V03A 3SCQA 3A3HA 3HJEA 1UD4A 1UR1A 3WH5A 3WH8A 4ACZA 5A6SA 5I5RA 2VX6A 1UH3A 3RIKA 2E9LA 2GFTA 3W53A 4CD7A 1GCYA 1IZKA 1KGUA 1ODZA 3QR3A 2PWDA 4QCFA 4CCDA 4DM1A 4BF7A 3AICA 3CUHA 4N0RA 1PBGA 2YBTA 5I3DA 4UOJA 3GM8A 1M01A 2GK1A 3AS2A 4UQAA 2XWDA 3UG5A 2IXVA 7TAAA 2WHLA 3B9DA 3BAXA 3AYRA 3N04A 3WDPP 4AIEA 2OLHA 2J25A 4AMCA 3KWXA 4U3AA 3PZ9A 4JIEA 1JF6A 2YL9A 1GPFA 1OM0A 3TTQA 1EOKA 2WMJA 1EGZA 3SIMA 4IISA 1E40A 4FLQA 3ZR5A 3IJ8A 3AIVA 1E0WA 2DT2A 1PX4A 2XIBA 1ISZA 1NARA 1HP5A 1LL6A 4KGJA 3CUGA 1EH9A 5I78A 3AISA 1E6NA 1UWQA 2EO7A 3VU2A 1NWTA 3A4WA 1BTCA 5GPRA 4JKKA 1W91A 4JFUA 3T2QA 1QBAA 1XYFA 1OSEA 3WUEA 2RGMA 3AHZA 3BMWA 5AC5A 2VI0A 1KGWA 1UKTA 1VRXA 4UFJA 2J7CA 1TZ7A 3AZTA 3K46A 2QF8A 2DT3A 4EANA 1HVQA 4PMXA 3GNOA 3RILA 5FL0A 1E3ZA 4GZJA 4JFWA 1QI0A 1ZB5A 4U3CA 3AMLA 3LMYA 1E6PA 3HMCA 4XV0A 1PPIA 1CZ1A 1NWUA 4F8XA 4CN4A 1VBUA 1JZ2A 1QVBA 3OZOA 1B0IA 3SEPA 4M29A 3VIKA 3GBDA 4RL3A 1E5JA 3VNYA 3WF3A 1J9YA 1EDQA 3CLWA 1V6YA 4J27A 3GNRA 3WBAA 1UKSA 2XG9A 4A3HA 1A47A 3UEQA 4HA4A 2YDRA 4MJ2A 1ECEA 3KZSA 5HDRA 3VIFA 1ESWA 1I1XA 5A69A 2XSBA 3SURA 1EO5A 2WVTA 2ZWZA 3VD5A 2PBGA 4ACZB 4EE9A 2FGLA 2GDUA 5A6KA 1B31A 1GW1A 4CN6A 1XV8A 4WSKA 3CTTA 1R7AA 3AJ7A 3MSGA 1JAKA 5IFTA 2W67A 2J7GA 1GONA 1HXJA 4M1RA 4M8UA 2ESCA 1DWGM 4PUEA 4QDMA 1FH7A 3OB8A 1SFSA 4V28A 2WB5A 1UQZA 3AMKA 3FAWA 1CEOA 3EMQA 4GO8A 1L8NA 3SUTA 3WDHA 4UQ9A 5BXRA 4FLSA 2EBNA 2WAGA 3U7VA 4OBRA 3WNNA 3GXMA 1TR1A 1CNVA 3VM5A 1PZ2A 2QPSA 3WSUA 3NIYA 1BSIA 1BFNA 1EHAA 1V3LA 2OYKA 1BVNP 3DHUA 4S3JA 1JDCA 3MKKA 4UR9A 3ZSTA 2WVUA 1C91A 2J75A 4HOWA 2Y5EA 1EDTA 3MSDA 3TP4A 3VINA 1NP2A 5BWFA 4JL1A 4MDPA 4KWUA 3W28A 4HMCA 1J0HA 2CBUA 1GOQA 4FMVA 4DM2A 1JNDA 3O6AA 4RE2A 4AD1A 4BZYA 4AYSA 3NDYA 3UR7A 1PIGA 5D8ZA 2D2OA 2MANA 4PMYA 4CD6A 1AMYA 1UWIA 1KBKA 3GXDA 3IK2A 3SUSA 1G5AA 3AZSA 2GJXA 3KEHA 3W81A 1JI2A 3BCFA 3WQWA 1ZU8A 2J7HA 1H3GA 5EB8A 4Y7EA 3EMCA 4B9YA 2F61A 3W82A 4X0VA 2WSKA 3WMBA 5A6JA 3GH5A 3RJYA 3VGHA 3RPMA 3IANA 3OLGA 4R27A 2CERA 4CVUA 3FXYA 1UKOA 3M46A 4AISA 5JBFA 1PX8A 1ZL1A 4FF5A 1KQYA 4IPLA 1ITCA 5LA0A 1WZMA 2ZUSA 2ZX8A 5JIWA 2O92A 4ZXOA 1Q6GA 2BFGA 1US3A 3WF2A 4CD4A 4J3TA 2JIWA 1DWJM 2V5DA 1UH2A 1EQCA 1E15A 5D9NA 3BLKA 1WB0A 3WNPA 2GSJA 5BXSA 2Y8VA 2GVYA 4AD2A 2WC7A 4D6EA 1TUXA 5ECUA 3F5KA 1W3LA 1ISXA 2PC8A 1KWGA 3MANA 2GDVA 5D9PA 3CUFA 2DSVA 2VZSA 4PTMA 3WQ5A 1OWQA 4P8WA 1G94A 4W5ZA 4W88A 1G1YA 1H1NA 1E73M 2JEQA 1XH1A 2WZIA 3RM9A 2DSKA 3W26A 3WL1A 5M03A 1GOOA 1VENA 5M3WA 3WMSA 1VF8A 3ZT5A 1CGTA 1CGXA 3TONA 2FHCA 3UR8A 2UY5A 1W2PA 3AXHA 4PTWA 8A3HA 5A8NA 1TVNA 3VD4A 2X1IA 5GNYA 2CNCA 4QFUA 4HU0A 3RDKA 3ZIZA 4XB3A 2GJRA 1LG2A 1W9DM 2ZXDA 2BVTA 2O9TA 1K9FA 3THDA 4BCEA 4TX8A 4NZCA 5D4YA 3RM4A 4TOQA 2VCAA 2XVKA 4KRUA 3BAWA 4GO9A 4L4PA 3VGDA 1ISVA 3UG3A 3TOPA 4CVWA 1GORA 3VIIA 4NF7A 4W85A 3GDBA 2E9MA 4X0NA 3AMGA 4AZIA 1YQ2A 2GJXB 4KH2A 4PTXA 1MFVA 2EPMX 3SCRA 3VD7A 2A3BA 2YL6A 1E71M 2JE8A 3WL0A 1V3KA 1XHGA 3W38A 5HNNA 3CO4A 3CPUA 2XPKA 3BAJA 2YKKA 2X0YA 5BROA 2XM1A 3BSHA 1BYDA 1KXHA 1E4LA 2WCAA 1J01A 1BF2A 4J3SA 5FD0A 2YA2A 4P7LA 1UD6A 3WNOA 4AZGA 1CGUA 4Z2IA 4M56A 2J47A 5AY7A 3VX0A 3VKKA 2VUYA 3ARPA 3K4AA 4W7VA 3ZOAA 5BRPA 2VVSA 3ZO9A 1ZJBA 3L4TA 3WF1A 1UZ1A 1DWFM 3O9NA 2OYLA 5A8QA 3K4DA 4KRTA 4UQEA 2JFEX 4E2OA 1UR8A 4JZ5A 3OLIA 1IZJA 1BGAA 1CXKA 1GQKA 2G3MA 1JL8A 1HKMA 2XIIA 4W93A 4CU8A 3T0AA 3F5LA 3TTOA 1MYRA 1RH9A 1ZBCA 3QHNA 1RPKA 4Q22A 2FH8A 1JFXA 1MW0A 1B30A 1JGIA 2WKLA 1MQQA 1GQLA 3WFLA 2OSYA 2BY0A 3WENA 1W9PA 5CPQA 1AVAA 3ZJ7A 1WPCA 4NSBA 3ZQ9A 5M5DA 3AMCA 2YL8A 3SCUA 1HJVA 1RP8A 5E6YA 1JXKA 2ZXQA 3U7BA 3WD3A 4B3KA 2D0HA 3WD0A 1V0KA 2XWEA 3L4VA 1U30A 5CG0A 4EK7A 3EDEA 5C8BB 1PEZA 3QHOA 4FK9A 4JCLA 2V38A 1GOKA 2W63A 5FIPA 2V5CA 2VVNA 4HOZA 2ZICA 3UERA 1DWAM 1N82A 3N15A 3GZAA 3AIEA 1WE5A 3UETA 5I0DA 1QBBA 1RP9A 2J62A 2W62A 4H41A 5DT5A 2WWDA 5CSUA 3HN3A 1HF6A 2HVMA 2NT0A 3DHPA 4HZ8A 3NDZA 2BY2A 1HIZA 3SCWA 1Y7VA 2Y2WA 3AIBA 4A4AA 3KL3A 2WC3A 2FHFA 3AS1A 2X09A 3M07A 5A2AA 3MUZ1 4U33A 1LL4A 1CDGA 2QPUA 1NQ6A 3FHAA 3IAPA 4CGTA 2ZX9A 3A6OA 1BYBA 1GQIA 3CBWA 2PWHA 3VTRA 4RE3A 2IXUA 3AIRA 1E1FA 1CPUA 3EYPA 4AD0A 1R7OA 4UQCA 3K8LA 1NOUA 1CYGA 5CLWA 4JCMA 1F4AA 1SR0A 3CUJA 3PHAA 2YA1A 1B1YA 1QNSA 2JF7A 2XVPA 4YPJA 2WMIA 5A94A 3CMGA 1E3XA 5CGTA 3ARTA 4PSRA 1XH2A 4GI6A 4Z2GA 5FKYA 1QNPA 2DDXA 4JHZA 4P8UA 3T08A 1E4IA 2BVYA 1J10A 1JDAA 1FOBA 4MB3A 5E09A 4TX6A 2E0PA 5DT7A 2G41A 1QNQA 1CTNA 2WHJA 1JZ8A 2VCBA 3E1F1 4UFLA 3L4ZA 4PMRA 4GI8A 3WELA 1XSIA 2Y8KA 2J7DA 5JBDA 3CZEA 2UY4A 1XCWA 3AHTA 3OLEA 1GJWA 2BVDA 3DYPA 1GHRA 3WFZA 2CESA 3J7HA 2XVNA 1FFRA 4W86A 3AI0A 1WZKA 2BY1A 3WH6A 1UD3A 1UR9A 2XFRA 1VB9A 2WVSA 1CGVA 4MADA 4ATLA 5A6BA 2VCCA 3VGGA 5D9OA 4J3VA 1VFMA 3NUKA 3ARUA 2QLYA 1V3HA 1G9HA 2EPNA 4UZUA 4N42A 2YL5A 1EO7A 2VX7A 1AQ0A 1KQZA 2XGIA 2FDMA 2YDSA 2DGAA 2CYGA 3K1DA 3G6MA 4ZE5A 4PYSA 3T2OA 2AOSA 2W4XA 1QOXA 5A2CA 4UFIA 1XRVA 2J8GA 1OIFA 1JYNA 5KEZA 4LXFA 4P8VA 2XUCA 1W3KA 4PMUA 3WUBA 3NJ3A 3MO4A 1UG6A 5HPOA 4W8BA 3SCTA 5IHRA 4AZ6A 1E5NA 2CXGA 4JFSA 2F2HA 5I24A 2W61A 1YHTA 3L2MA 2OSWA 3L2LA 4TUFA 5HPCA 3EDKA 5E9AA 1UQYA 3FW6A 2WBGA 4H8UA 1ZBWA 4GKLA 2ZIDA 1V6XA 3F4VA 5GQBA 3AFBA 4C7FA 1VIWA 3ZT6A 4HOXA 2E3ZA 1UOKA 5FCZA 4JKMA 2WLZA 4MJ4A 4AIUA 1NWSA 2WMIB 4QLJA 2XJ7A 3ARZA 3CHEA 5JBEA 2WMKA 2GK1B 1CIUA 1P6WA 1BLIA 3CZGA 3PZQA 4MNKA 4LGXA 3MS8A 5CJ5A 5ABHA 1C8QA 3W6LA 3GXIA 1JZ3A 2BHUA 1D2KA 1F4HA 2G4FA 4UZSA 2WLYA 3CUIA 4HA1A 3VIGA 2D0GA 2V3DA 4NRRA 1HJXA 3BAIA 3AIUA 1LWJA 1FA2A 1W3JA 1ISWA 1C7TA 1S46A 2O9OA 2ZX6A 4IUGA 3UCQA 3WEMA 3N13A 1E0VA 1E6SM 1LQ0A 3DYMA 3VIHA 3WD4A 1V6VA 1FHDA 1LG1A 2BHYA 3WBEA 2Q8XA 2VT0A 4QP0A 4PMDA 3AHYA 4WIWA 5EFDA 1KXTA 3AYSA 4LYPA 1LL7A 2J4GA 3NSMA 5ABFA 4WKAA 3N18A 4GXPA 1GZJA 4U2ZA 3ALGA 1GJUA 3VM7A 1CXLA 1R8LA 1QW8A 4R5EA 3BCDA 1W32A 2XFFA 2X0HA 4W8LA 2ZX7A 1Q4NX 1GHSA 1L0PA 3AHVA 2VO5A 1J11A 4E4PA 4QAWA 2DPEA 1WCGA 2ZX5A 4D71A 4GPNA 3VOCA 7CGTA 1MFUA 3T09A 3W27A 3OZPA 1PJ9A 2FHBA 1M53A 2W5FA 2WMHA 1H11A 5CZKA 5A6AA 2W92A 1C92A 4PMOA 5CPTA 4PCTA 2J79A 2G3NA 2E40A 5A6BD 1GVYA 2UY3A 1B3ZA 4DUVA 2A3HA 3GH7A 4B15A 3TTYA 2VX5A 3CIVA 1CXFA 4P7NA 3WUFA 5A8OA 1HX0A 1UWUA 4H8HA 1WNOA 1CXEA 1V3IA 4CUCA 2D3NA 3VDHA 3L4YA 1W3HA 3THCA 3CZ8A 4IPNB 5CXPA 2PB1A 4GZIA 3ARVA 4UOZA 1MW2A 1QW9A 2DSZA 3S2CA 2X05A 2WWCA 4XX6A 3AQUA 5EBAA 4CU6A 1J0ZA 2V3GA 2JEPA 4WSJA 2CCRA 5D9MA 1TFVA 3AIWA 1W1TA 5FL1A 3SCNA 4WKHA 1WDPA 3KE0A 3PBGA 1XGZA 1VFOA 1CGYA 3RM8A 2A3AA 5CGMA 2JIEA 4M82A 1EQPA 1EXPA 1FP8A 1HVXA 1V3JA 3PZIA 1WAWA 4CCEA 4UQDA 1W9UA 2DIEA 3ZJKA 3N1AA 5E0FA 5I77A 3VDCA 1JZ6A 2WYSA 2VNCA 4ML4A 3L4WA 2JF6A 4AIOA 5BYWA 5GNXA 2OWWA 2VRJA 4W7WA 2EJ1A 4W7UA 1RD6A 1AQMA 2X2YA 4IM4A 3MUAA 4UNIA 4H04A 1E6RA 4OBSA 4PSPA 4DWSD 3AS0A 2BS9A 4TTUA 3WUGA 4D6HA 3LPGA 1JYWA 4PUDA 5CQ1A 1HJQA 4HPGA 3A4XA 5TD4A 1B3WA 1WZLA 4B16A 1KXVA 1EA9C 3MUIA 2C7FA 1QHOA 5ABFB 3CZLA 1DEDA 1E6ZA 4Q7NA 1W1VA 1HL9A 1ZS2A 4D1JA 4HPHA 1V02A 2FH6A 5M17A 4HU8A 1ZBKA 3FN9A 4W89A 1V02E 1UWRA 2C0HA 3T0DA 3A47A 1UH4A 4OJYA 1M04A 1B3VA 1CECA 2J7EA 1M03A 1A3HA 1UKPA 5F7UA 2DIJA 5CSYA 5I2UA 3WMCA 5IDIA 2O9RA 1E4NA 1HKKA 4NI3A 4B3LA 1I75A 1UR4A 3RCNA 4DWSC 3WQ8A 1C8YA 2J7FA 1VFFA 2V3FA 1FH8A 4LYQA 1V6UA 4AWEA 1JAEA 2J77A 3N17A 4FLOA 3EDJA 3PZVA 3GTNA 3ZM8A 1DTUA 1H2JA 1VJSA 1D3CA 1BQCA 3NSXA 2ZXAA 4P7RA 1EIBA 1GUVA 4ATDA 1WO2A 4M24A 1C8XA 1JFHA 2WC4A 4MAVA 3UESA 2WBKA 4OZOA 3AOFA 1PZ3A 1KCLA 4GINA 2NSXA 1B9ZA 3EBVA 3MUY1 4JAWA 1SYTA 4CU7A 2CITA 1DHKA 1JNEA 4MDOA 2YIHA 3PZMA 3N12A 1R86A 4U2YA 3VMPA 5DFAA 1BGGA 1KBBA 1E72M 3I3BA 2G3JA 3PZGA 3EDFA 5AYIA 1SMAA 1BYAA 1WKYA 1V08A 1CENA 3GNPA 2XFYA 4HMEA 2CBIA 1US2A 2AAAA 1MW1A 4PMZA 1OGSA 1OT2A 1ITXA 2BHZA 1K9EA 2WMFA 1HJUA 1K6AA 5HXMA 2W91A 4P7QA 4BQ5A 3CHCA 3GXFA 1C93A 3ARRA 3RJXA 1VEPA 5IHSA 3ARQA 3BAYA 1MVYA 1HP4A 1XD0A 4MAZA 1J0YA 1JZ5A 1WDSA 2J8FA 1C3FA 1OD0A 4LYRA 4OUEA 1CXHA 3OGSA 4UQBA 2EPKX 2VURA 2VQUA 1JYXA 2DT0A 5BXPA 3W37A 1E0XA 3ZJ6A 1PX3A 4H2CA 3DYOA 2FGZA 3BAKA 4TVDA 3U57A 1J12A 3K8KA 6TAAA 4BS0A 3CHFA 2TAAA 2ZUTA 3WKZA 1E6XM 1H4PA 5DO8A 2ZXBA 1NP0A 4OOUA 1JD7A 1ZJAA 1PAMA 4M80A 2CETA 1VAHA 3WH9A 4W84A 4A3YA 3VMNA 1HKIA 3FAXA 3W24A 3VGEA 3WF4A 1UA3A 1EOMA 5DF0A 1XC6A 3VX1A 1TVPA 3T2PA 2G8ZA 3M7SA 2B31A 1XH0A 1H49A 1U2YA 4HTYA 4MB1A 4E8CA 2WNWA 4OOZA 2XVLA 2D1ZA 3OGVA 1KB3A 1QNRA 2OWXA 1DP0A 5D8WA 2D0FA 1LF1A 2XM2A 3ZSSA 4QLKA 2G3IA 2WMGA 4L4OA 1UYQA 2VRKA 5ABGA 3CHDA 2VR4A 1MXGA 4D6FA 3QHMA 5BCAA 4CKQA 3TA9A 1MQPA 2C8NA 3VPLA 5A8PA 1H0IA 1JZ7A 4AXNA 2IUZA 2DEPA 3OA5A 2XTKA 5JUVA 5A6MA 1NM9A 3MU7A 1NOWA 4EAMA 1VBRA 5C70A 5A95A 4DUWA 3PTQA 2PWGA 3OG2A 5CLTA 2CIPA 2ZUMA 5E0CA 3OLDA 2DT1A 1B3XA 4AD4A 2WVVA 2VR5A 3VVGA 2AMGA 1NWRA 1JXJA 1H09A 2VL4A 5C71A 3PTKA 5I23A 2DH3A 1OBAA 1E56A 1W1YA 1UR0A 4UFKA 3WDJA 3MMUA 2RGLA 2WHKA 5A6LA 4BQ2A 3SCVA 1UUQA 2O9PA 1X6NA 3B8SA 2D20A 3WN6A 1ZBVA 1V0MA 4J3UA 1TCMA 3POHA 4CN1A 5KZ6A 3CMJA 1EHNA 1EDGA 1W9XA 3DC0A 3MMDA 2W66A 1BG4A 1E55A 4BQ3A 1I1WA 1LJYA 1UR2A 4LX4A 1K9DA 3TTSA 2VOTA 3GBEA 3WNMA 5HOSA 2CBVA 3SCOA 2XGBA 2A3CA 2WPGA 1LLOA 2CKRA 3VGFA 4X9YA 3VUPA 3VIMA 3VD9A 3LPOA 1VEMA 1IV8A 4U5KA 5BXTA 3MV11 1CXIA 2CHOA 3SCPA 1ISYA 4GZEA 4S3KA 3AXXA 3FHQA 1E1EA 3BXWA 1HL8A 3SUUA 3PZNA 5A2BA 3PTMA 2WK2A 1J0IA 7A3HA 4AZ5A 3W6MA 2NW0A 4XZBA 1C90A 4OIFA 1VFUA 1W9VA 1U33A 4BQ4A 2VRQA 1JD9A 1KFWA 3HU7A 2CHNA 3QGVA 2X8RA 1Z32X 1UD5A 1UA7A 3CGTA 1H0GA 3VD3A 2BNJA 1UWSA 4PN2A 1BG9A 8CGTA 2EPLX 3O2LA 3W0KA 5EMYA 1R87A 2GUYA 1JF5A 4U5IA 1NH6A 1MXDA 4AZBA 2J78A 1TMQA 2YBUA 4DWSA 4DUXA 3JUGA 1HT6A 1MWOA 3SCSA 1SMDA 2E8ZA 3GH4A 3ZT7A 1HNYA 2Z1SA 4JKLA 4URIA 5JIPA 5I79A 3ARSA 4JFVA 4D6GA 1QHPA 3WQ4A 3VIOA 3FY1A 3A4AA 4PBGA 4D72A 3N11A 3KL0A 1XD1A 4WKFA 1FP9A 1B2YA 3WEZA 4TTGA 1Q6EA 1OB0A 2D3LA 1TE1A 1VEOA 4GQRA 3W29A 1BAGA 3S6TA 1XSKA 5LA2A 2WVVB 3BGAA 3ECQA 3VDBA 3NSNA 3NYDA 2VZUA 4J28A 5BRQA 1XSJA 4F9JA 1CLXA 3WY1A 1FFQA 5IFPA 1CGWA 2EQDA 1WP6A 1JZ4A 1W9BM 3PZOA 3AIQA 2BV9A 2QHAA 2EPOA 1JI1A 3BMVA 1QHZA 1E6QM 3PN8A 4AZHA 3B9AA 3AXIA 4CCCA 1IT0A 3L4XA 4LQ1A 3VIPA 2VMFA 4V2XA 4JHOA 3M6DA 4NRSA 1R85A 4PMNA 2PWFA 6CGTA 1KCKA 4AZCA 1JG9A 1UKQA 4HP5A 1E70M 1GVIA 2BXYA 2QMKA 1UD2A 1OD8A 4U31A 5GNZA 1X1NA 4WJXA 3ARXA 3I3EA 1TA3A 2DSUA 3VNZA 3D3AA 2BY3A 2E9BA 2F8QA 2J7BA 5A1AA 1ODUA 2EEXA 4XUYA 3WF0A 4ZEPA 3MMWA 5DEZA 4UTFA 4ZE4A 4MTVA 3PZUA 4HMDA 2WM0A 1GQJA 1CLVA 3AMDA 5EFFA 4UOQA 2VC9A 3I3DA 4YHGA 5E70A 3BSGA 4MB4A 3CH9A 4QCEA 1OIMA 2VX4A 6A3HA 1UD8A 3WDQA 5LA1A 5A3HA 1G01A 3CZJA 1JYVA 4P8XA 1H5VA 1CWYA 4F9DA 4PTVA 3T0BA 2ZWYA 4D6DA 2PWEA 1OT1A 3WDRA 1WDQA
chains in the Genus database with same CATH superfamily
3TNOA 1PXGA 5HMSA 1Q8AA 3VZXA 3B40A 3ZR6A 4D6CA 3ALFA 2BXZA 4ZENA 3M5VA 2WJFA 2DFAA 1U22A 3WIJA 2V8ZA 1CW2A 1H7RA 3MB9A 3F4DA 5CC3A 2VC5A 1TTPA 3M9YA 1BYCA 2OQHA 4GWEA 3R10A 2OWCA 2ZUNA 4C7GA 1GNXA 3OVPA 1L6GA 4HZ7A 4FNRA 4W8AA 2P5NA 3IAQA 3W00A 2YLAA 1FWTA 2VZVA 3A23A 2CBJA 3KTXA 3ARWA 1C29A 4HN8A 1T96A 4G9PA 4GCXA 4S3FA 4LPCA 5CBBA 1E4MM 3D5HA 4F2UA 3WH7A 1RD5A 1UP2A 1SVDA 1D7KA 4MB5A 4LVBA 1MUWA 3RYSA 3AUOA 4GA8A 4J3XA 3CAKA 5AYBA 2WHMA 5D30A 3IPWA 1BRLA 1Q6CA 1M7XA 2XVGA 2PBOA 4KFOA 4PMVA 3CV1A 2DQXA 2HRWA 3P3BA 2WM1A 2PTWA 2WW5A 4ZSTA 4DJFA 2RFGA 5CPOA 5M2FX 1AJZA 4D6JA 1R3WA 4AZCB 3EA2A 4ZFCA 4KF1A 4IJBA 2CEQA 3A3WA 1EPVA 3L68A 4JTEA 1XIDA 2VP8A 4HU4A 1TG7A 3WLSA 3U5YA 2QDDA 4JL2A 4KCUA 3GC2A 3QOKA 1MW3A 3UA4A 3TJLA 4O0KA 3LEPA 4Y8FA 3TR2A 4NZ5A 3QW4B 4B9ZA 4GI9A 2J74A 2P0OA 3AYVA 2YJQA 2JKEA 1AA1B 4YTSA 3NOYA 5CPLA 1S5TA 4FLRA 4WK9A 4B2DD 4C7DA 3B9NA 1FUYA 3O16A 3C86A 1QI4A 4LSBA 1DWHM 4NNCA 4YN5A 3CHVA 1NFGA 4Z42C 2ANUA 2WSPA 2D22A 3I4KA 4P7OA 3RLGA 1V3MA 2QJHA 2PTDA 1MZHA 3N2MA 1FWCC 2AGKA 1Y8BA 2DUZA 4PL2A 3FA5A 1CI1A 4GQQA 4AWUA 3MZ2A 1XUUA 3CYVA 3BQ6A 5K9CA 2CZ5A 4NJGA 2Z1KA 5ENLA 2VJXA 9XIAA 3PM6A 4EKJA 3CUZA 4GX8A 4HYRA 3ANVA 3MHGA 2D2HA 1EF3A 4A22A 3SUVA 1K9TA 1V0NA 3OQEA 4RR4A 1KR0A 1S2VA 5LXXA 4OKDA 4H1ZA 3GG7A 4ML9A 3NXLA 3KOYA 2VQTA 2O7QA 1SO3A 4NU7A 3LLDA 3GDRA 1DOSA 2XYLA 4R53A 4ZFMA 3IIZA 4AEOA 2VFGA 2D23A 4RDYA 2V5BA 4AAJA 4H8NA 2AKMA 3D0CA 4FX8A 3PZTA 3VKBA 1BRLB 1OGGA 2PDMA 4W5UA 3G6LA 3OG3A 1TR9A 2A7PA 1FH9A 2OQYA 1MQRA 1WDRA 3CQKA 4AEEA 5HANA 2YOCA 4WHBA 1GVQA 1H41A 2PDYA 3IIPA 4R34A 1KGXA 1Q6DA 1H7NA 4F3HA 4IG2A 2PF0A 3LPFA 4IGNA 4MNJA 4Z1DA 2Y8UA 2C6QA 1VLIA 1ZAIA 2BBFA 4GNKB 3V16A 3GDMA 3SCQA 3A3HA 1UR1A 3WH8A 2E9LA 2GFTA 2Q8ZA 4PB5A 3NNTA 4LUYA 3VNKA 3WBWA 1EBGA 3KOFA 2EG7A 3RLVA 2PWDA 3AICA 3CUHA 4N0RA 3N4EA 4OGZA 5TNVA 4JTHA 3FKRA 4GGHA 3GM8A 4NJIA 5DANA 4C60A 5G4WA 2NVDA 3WDPP 2XH2A 2OLHA 3R89A 1U5JA 2Y5JA 3SGUA 4UTLA 5FJIA 1V6TA 1FWDC 1JF6A 1GOXA 1GPFA 2PCQA 1D3GA 1EGZA 3OJGA 3KCLA 3C2YA 1G7UA 1E0WA 2DT2A 3SY1A 1S1PA 1V93A 1TQXA 1JJKA 3BLDA 1J4EA 1E6NA 2EO7A 1EIXA 1F2JA 1NWTA 3B06A 3A4WA 4L80A 3USZA 1BTCA 3R7MA 5GPRA 4JKKA 2P50A 4HIBA 3R8HA 3ZLFA 1W91A 2CZEA 3T2QA 1QBAA 1XYFA 4JQAA 3LRMA 1R47A 3BO9A 1OSEA 3W87A 3STGA 5AC5A 2VI0A 3LDVA 3ZVIA 4NQ1A 3ITOA 4HD5A 1UKTA 3V5CA 1VRXA 2J7CA 1TZ7A 1OYAA 2QF8A 4DZIA 1XYLA 3OOQA 4XTIA 1E3ZA 2QVNA 1QI0A 1VHNA 3TJXA 3AMLA 2HS6A 1EC9A 3V4BA 4FS9A 4QDPA 1WXZA 2GZXA 3TFXA 3AUJA 3OZOA 1B0IA 3VIKA 3T4CA 3GBDA 4F0LA 3D6NA 1QMLA 3F4WA 1TX0A 2PF8A 4XQ6A 3CLWA 5EY5A 1QR7A 2DVUA 3PUEA 4ERGA 3L9CA 3SW6A 4IG2B 1UKSA 2PDPA 3UEQA 4HA4A 2B7OA 3KZSA 4MJ2A 2FB2A 3VIFA 2YXOA 4LC8A 2CW6A 3K13A 1SJDA 4O53A 2ZWZA 4DO7A 2HBVA 5A6KA 1AW2A 2QNEA 2OQLA 4WSKA 1ZCCA 2J66A 1K8XA 1LROA 3V36A 3LCHA 4AB4A 4O4VA 3GTIA 4MKSA 4W4QA 1R3QA 1DWGM 1GEHA 1PKMA 1FH7A 2WQDA 1GKQA 4S38A 3EOUA 1TV8A 2OZ8A 4N6EA 4ZB0A 3QXBA 1O68A 4UQ9A 4O14A 5BXRA 2PE4A 5MKGA 3QV8A 4OBRA 3WNNA 2ZFAA 1PZ2A 2QPSA 4KPLA 3MP3A 1BFNA 1V3LA 3E5PA 1BVNP 3CIXA 4X63A 3MKKA 3L67A 3TW9A 1EDTA 3A5FA 3TP4A 1P0EA 4IWWA 2VFDA 1VFLA 3W28A 1J0HA 4UR8A 3QN3A 3FJNA 3MYPA 1WOAA 4AUBA 4QS5A 4FMVA 1JNDA 2Q3RA 2R1MA 3QKEA 4RE2A 3TXVA 3VOGA 1RK5A 6XIAA 3FJLA 3NDYA 3NXFA 5D8ZA 3GXDA 3MWCA 4BJHA 3DG3A 2GJXA 3ITTA 4I8YA 1PIIA 3SAZA 3TC3A 3O15A 3G1VA 1P4CA 2Y88A 2QCEA 3BW2A 5CAKA 1QFEA 1FXPA 4BI5A 1VJIA 2WSKA 4N9EA 5A6JA 2FB3A 1TTQA 2XZ9A 4R27A 2CERA 3ID7A 4HNNA 4JTDA 1YNYA 1XJBA 1Q65A 4ZO9A 2A5HA 3WLPA 2C3ZA 4FF5A 4IPLA 3LA4A 1HO4A 3B8WA 5HMEA 4GUIA 2EJAA 2G37A 1R3SA 1US3A 4S3AA 3WF2A 1R30A 2GWGA 1VS1A 1LRQA 1NU5A 1Q2SA 4KWSA 3WNPA 2GVJA 4IGSA 4HPNA 3P14A 3B0UX 2YZ5A 3PJUA 4AD2A 2WC7A 4D6EA 2OTDA 4S1FA 1TUXA 5T9CE 3NQAA 3M43A 5D9PA 3N3TA 5I3FA 2V5KA 1G94A 3KDOA 4W5ZA 1G1YA 2WZIA 4DZAA 3UZXA 2DSKA 5MKGB 3IIOA 1RALA 1GOOA 4Z1YA 3IV8A 3YPIA 5M3WA 3WMSA 4FIRA 2FHCA 1PVNA 4PTWA 3ZWSA 8A3HA 3RU6A 2OELA 3H21A 4NNAA 1M41A 4RNJA 2Z24A 4QFUA 4JQ1A 5G2HA 1DJYA 1O5KA 2A2IA 4S3GA 4NZCA 3H7VA 3RM4A 1UPMB 3W1NA 5DXYA 2VCAA 4GO9A 1FDJA 3TOPA 1GORA 3VIIA 4GNVA 4W85A 3OQ8A 3GDBA 2NQJA 2GJXB 2FIQA 2XU2A 4DBEA 2EPMX 1DBTA 3ES8A 4XD3A 1X7IA 2PTXA 4LAMA 3W1TA 1TKKA 5HNNA 1WBJA 3HGRA 1A5KC 3CPUA 3G2GA 4IQDA 3BJTA 2OKOA 1KM3A 2XM1A 3BSHA 4EAYA 5CZSA 1LYXA 3DBNA 1LLWA 1E4LA 3U2ZA 2WCAA 1J01A 3PAJA 4IFKB 3W2JA 1DE5A 4J3SA 1F61A 3VOHA 4P7LA 3DI0A 3VX0A 3ARPA 3K4AA 3RF9A 5JMUA 1ZJBA 3L4TA 3QFEA 2OYLA 5A8QA 3GC4A 4FALA 3SADA 1B57A 3OLIA 1M6JA 4R33A 3LLFA 2BX7A 3V35A 4L1WA 1VZWA 1JL8A 3OVRA 3T0AA 3KBSA 1OQFA 4Q8TA 4Q22A 3P93A 4P61A 1JGIA 4L9ZA 3SI9A 3WENA 1KKRA 1TMHA 5CPQA 1LORA 3ZJ7A 1XLKA 4Q8MA 3NPXA 4C6DA 5KMYA 2X0SA 3PANA 5D09A 1W3IA 1R3TA 2J13A 5E6YA 1HQTA 2ZDSA 1XL9A 2PU1A 3ABOA 5L6UA 3LX9A 4FOUA 3W2NA 3SJNA 4EK7A 1PEZA 4F0RA 4FK9A 5GVJA 1RVGA 1UBPC 2V38A 2V5CA 3F1QA 3UERA 4YL2A 4ZVJA 2J8TA 3BVJA 1BXBA 4XAGA 3AIEA 3RCMA 1WV2A 2W62A 1WYIA 1E1CA 5C6MA 5CSUA 4IXHA 1ZNNA 1HF6A 4GBDA 2PDGA 5I00A 4DO6A 1HIZA 5DELA 3WK0A 4HK6A 3AIBA 5CZJA 5LSMA 4NL1A 3AS1A 5AB3A 3R0UA 3CS2A 3IAPA 2ZX9A 3A6OA 1GQIA 3H2CA 3LGEA 3VTRA 4RE3A 2IXUA 1E1FA 4EP8C 1CPUA 1NFPA 3PY2A 3M0JA 3K8LA 3VE9A 1NOUA 1QO2A 5CZTA 1SGJA 1SR0A 1QNSA 2JF7A 3RFAA 5TBOA 3H2MA 5A94A 1E3XA 2POTA 4JQ2A 3ARTA 5FKYA 3T08A 1SW0A 4DF2A 1UR3M 4HVXA 1FOBA 4MB3A 5E09A 5DT7A 5H8MA 2WSQA 3E1F1 3BG5A 1CT5A 2B0MA 2YW3A 4PMRA 2JK2A 3LTSA 1EWEA 1XSIA 2J7DA 4O16A 1XCWA 3E9AA 4KEMA 4O17A 1F6YA 1GHRA 3DYPA 1F8IA 3NTYA 3OIXA 3GXPA 4GG9A 2F84A 1MZRA 2DVXA 1UD3A 3EXSA 1BWVA 1M1BA 1S2UA 2PA6A 3GC5A 3VGGA 5D9OA 1FWEC 4J3VA 3NUKA 3EWBX 1L2QA 3VA8A 1RY8A 1G9HA 1DJGA 2EPNA 2YL5A 4Z17A 2H6RA 2XGIA 3HJZA 3O7UA 3BL3A 1E9IA 3SIZA 4NXSA 1Q6QA 1REQA 1O5XA 2W4XA 1XRVA 3W7IA 1MO0A 1LWIA 1E1CB 2BXVA 1OIFA 4C1NA 4KCWA 2DORA 3R58A 4US5D 3W1RA 2J9YA 2JKAA 4FB7A 1EJVC 4M6PA 1W3KA 4PMUA 4FI4A 1M7PA 1BXCA 1F7BA 4ERIA 4AZ6A 2VGIA 1YDVA 4DF1A 3L0NA 1CB2A 5G1MA 3L2MA 2A79A 4TUFA 5HPCA 3H53A 2OEKA 3TEVA 3FW6A 3KVMA 1PO9A 5CG7A 2WBGA 1UUMA 2PDCA 5FEZA 4G7FA 4GKLA 1T40A 2GLKA 2AGTA 4K38A 1V6XA 2VELA 4M0XA 3G1HA 2FVMA 1A4MA 2Z29A 5FCZA 4JKMA 3LTYA 4JX5A 1QWGA 1NY1A 4QLJA 5A8GA 2H8XA 2WMKA 2GK1B 2BMBA 3FV9A 3DFNA 3D3FA 5G1TA 3BJFA 1RCOB 2X7WA 3NZPA 5CJ5A 5ABHA 1J96A 2YW4A 1IWBA 3N4AA 4YVPA 1DTNA 3ABQA 3THAA 1JCXA 3V3WA 1MDRA 4UZSA 4HA1A 5F2MA 2CZFA 1IR1A 1I8JA 2D0GA 4MJZA 5DCEA 3W83A 1LWJA 3EWWA 4IL2A 3WEMA 3DUGA 1L6YA 3E6EA 2XINA 3PULA 3VIHA 3WD4A 4NT0A 3OP2A 4E0CA 4ADTA 4FZIA 1XLBA 2ATMA 1DXIA 4WIWA 3C2RA 4LYPA 2PDXA 3PNZA 1LL7A 1VBHA 2J4GA 3UP8A 4C6FA 1GZJA 4PUUA 2OEJA 4U2ZA 5LIUX 1CXLA 2Z4GA 2OVLA 1XIMA 1W1B1 1ADDA 1D9EA 3BCDA 3NPUA 1A3WA 4NHVA 1Q4NX 5DXXA 1REQB 2REQA 1J11A 3S9ZA 1WCGA 4Q4MA 3H22A 4C1NB 7CGTA 4YWIA 1SO5A 2QCGA 5CZKA 1QPOA 4Y9OA 2W92A 2QJIA 3GD6A 4PMOA 3LV5A 1XBZA 2HJPA 3GH7A 4B15A 3JU2A 4UTIA 1ZP4A 3S2MA 1IZCA 4OHQA 5FJUA 3MT1A 5AHIA 4FNUA 1UWUA 2QUUA 1WNOA 4AYGA 1V3IA 1DIKA 4CUCA 1QW7A 4IPNB 4GZIA 5HMDA 3GLCA 3TE9A 3ARVA 1MW2A 1QW9A 1R2RA 3UZZA 2DSZA 3VKAA 3WLHA 2WWCA 2DZPA 1H1YA 4A2RA 4WSJA 3P81A 3Q45A 5E9XA 3PBGA 1XGZA 2GDQA 2A3AA 1T7LA 4ROQA 3RX4A 3KS5A 3NZ1A 1I2QA 2QUTA 4PUJA 3RX2A 4M3PA 1WAWA 2G0WA 4DXKA 2QIIA 5G4EA 4Q4QA 2Z7KA 1RVKA 2CHRA 3S4TA 3L4WA 4AIOA 4I9MA 1VLWA 3ABXA 1GT8A 2EJ1A 1UROA 5CBIA 2DZAA 4W7UA 1NF0A 4IM4A 2A4AA 1E6RA 3DC8A 2EGZA 4D6HA 1JYWA 1XKYA 4A35A 4H01A 4E38A 2PFHA 5TD4A 1B3WA 1WZLA 1FWJC 1EA9C 3CZLA 4HZMA 4ZOCA 3UT0A 1BKHA 1SSGA 1HL9A 4B5VA 4KIEA 4HPHA 1KTNA 2FH6A 4JEJA 1V02E 4EWND 3T0DA 2REQB 2NUWA 1CECA 4H7ZA 2DIJA 2O7SA 5CSYA 5I2UA 4NI3A 4LALA 5D33A 4GUGA 5DRCA 3TSDA 1A0DA 3UWZA 5BRBA 4BY3A 3P67A 4E5TA 3DXIA 2V3FA 1JGMA 3S42A 3HG4A 3SN0A 4Y9NA 3N17A 3B8TA 1H2JA 1VJSA 3GS6A 1D3CA 3CV6A 4PBEA 3TLLA 2X16A 4GC3A 2W9MA 4ATDA 3EWCA 4HTBA 3AC0A 3DFPA 4AVFA 5F2IA 4NAEA 4WOQA 4OZOA 3AOFA 4OBTA 2FZDA 3MUY1 1SYTA 2O55A 2IPGA 2ZZ6A 2CLHA 1P0KA 2X2GA 3MI6A 1FKWA 3EEGA 3XIMA 1R86A 4U2YA 1SJAA 1OZMA 1TELA 3R4IA 1I6NA 3I3BA 3EDFA 4LEQA 1SMAA 4WZHA 1V08A 2XN0A 5E93A 4ZB2A 1M3UA 1W1ZA 3NFUA 4PMZA 4GJJA 1HJUA 2DZBA 1K6AA 4FAMA 5HXMA 2E7FA 3MUXA 4BQ5A 4WSHA 4AQLA 1VEPA 5IHSA 4YTTA 4WXZA 1XD0A 4RDWA 1S39A 4AX7A 1JZ5A 3JW7A 4LYRA 2P3EA 2EPKX 5KTLA 2ACQA 4MWAD 4XBKA 1QK2A 2HEJA 3UCDA 1ONEA 2C1GA 3MW7A 2X7VA 3RPTA 1J79A 4LCRA 3WLIA 4G8TA 3H8AA 4TVDA 4BS0A 4HN4A 3CHFA 2TAAA 3WKZA 1E6XM 3R1ZA 2EKCA 5DO8A 4CQCA 2C18A 2D69A 2ZC1A 1PAMA 3WH9A 3LXBA 1NEYA 2NQ9A 2WOQA 3FAXA 1K8YA 3VGEA 5DF0A 2QCDB 3VX1A 4XO6A 3IGUA 4NP7A 1U2YA 1S5WA 4E8CA 4NI8A 4GABA 2XVLA 1PS9A 5HAOA 2XM2A 4DB7A 1JPDX 2OU4A 3CB3A 1EF2A 3CEPA 3FFSA 3CHDA 3LM3A 5HNUA 1P0BA 1AG1O 3B0VC 1Q63A 4G1NA 2BGQA 4IFOA 4CKQA 1MQPA 4E4FA 3GAYA 1EEXA 3BLIA 2KAUC 2IUZA 3PUDA 1AL7A 2QS8A 2C71A 3EKGA 3HA1A 3PPGA 4NAEB 4DUWA 5CLTA 2CIPA 2R8WA 1OVDA 5M1TA 4MY9A 2FZ8A 2AQVA 3OLDA 1B3XA 4K7YA 2WVVA 1FX6A 4C91A 3DERA 2AMGA 3NQGA 5REQA 2PTZA 3PTKA 1AMKA 5I23A 1MNZA 3VOIA 3GVQA 4PH6A 3AWOA 4O4WA 3M0VA 5C54A 5FJJA 1S2AA 2WHKA 4JD4A 3B8SA 4O15A 1V0MA 1YPFA 3LRKA 3PTDA 2NQ5A 4Q4OA 3CNYA 3GR8A 5D2XA 4LY8A 1RUSA 3TR9A 1BG4A 4JDBA 4BQ3A 3S5SA 1K9DA 3GBEA 4DWDA 3FA4A 3SCOA 5FJPA 1X8CA 1NELA 1DV7A 1N8IA 4X9YA 2VEPA 1H7OA 4Q33A 3VD9A 4DLMA 1DKWA 5HJXA 4DBDA 3TOYA 3T8QA 2DZXA 3MV11 3ONBA 2HVOA 2VUNA 3SCPA 4R7JA 1ISYA 4TQTA 4GZEA 1MNSA 3PUGA 3HF3A 3I68A 3FHQA 1QNVA 1O60A 3JZEA 1HL8A 2GYIA 3KOZA 1ML1A 1QO5A 1KW1A 1XLCA 3W6MA 2NW0A 1AJ0A 1H50A 2FYMA 4RXFA 2OO0A 4DX3A 1BTMA 3V1HA 4BQ4A 1JD9A 3TWBA 4K3ZA 2X8RA 4O10A 2BNJA 8CGTA 4EX4A 2HVNA 3W7OA 1W37A 1MUCA 4PUKA 5EMYA 1G4SA 2EPHA 1R87A 4IJCA 2OZ3A 4AMAA 3NOEA 1TTJA 3QC0A 3WLLA 4C6EA 3JUGA 4DUXA 3WMLA 4LT9A 2Z1SA 1UZDA 4JKLA 5JIPA 5I79A 5FEXA 4JFVA 1QHPA 4XO7A 3VIOA 1DIEA 3FY1A 2A3LA 1XBYA 4D72A 1POKA 1XM3A 1XD1A 1IEXA 1FP9A 1B2YA 4DJDC 1XG3A 3LCLA 2D3LA 3R12A 3GHSA 3NO1A 1CB7B 4PCFA 5FACA 3FEMA 4KWVA 2WVVB 2X42A 1XLIA 1EX1A 3HZ3A 5REQB 4TV6A 1A4LA 3BGJA 4IXXA 3V5FA 2XH7A 2FMNA 4CCZA 5DMMA 3PWAA 3UGVA 3UXAA 3PZOA 3AIQA 2QHAA 3GDLA 4S3CA 1R3VA 1QHZA 3PN8A 4LB4A 3AXIA 4LYKA 2VFEA 1IT0A 4CCCA 4XK2A 4LQ1A 3MC5A 4HNUA 3LGGA 2OX1A 4CNUA 2W6RA 1UKQA 2QMKA 1UD2A 4WJXA 2PLCA 1OF8A 2Y61A 4HSNA 2GOUA 3I3EA 1HL2A 3D3AA 1DQWA 2F8QA 5C7HA 4H7CA 3S47A 3VZYA 5A1AA 1VH7A 2I9UA 1F05A 2QJJA 3E74A 2PEVA 2J24A 2Y7EA 1XLMA 1KFKA 1UZHA 1GQJA 1CLVA 2VC9A 3I3DA 4YHGA 1IHIA 1DJIA 5E70A 3KLLA 3CH9A 3FYPA 4MB4A 4QCEA 1OIMA 1F9CA 4BHYA 3MI3A 5T9BG 1JYVA 4KW2A 2OG9A 1TV2A 1CWYA 3TW7A 3I65A 2ALDA 2G5WA 4DXXA 4PTVA 2ZWYA 3WQFA 1M7OA 1Z8AA 1EB3A 3GW3A 1WX0A 3EPMA 1N7KA 3T0TA 4GFIA 2ATSA 4KGLA 1AUSL 1BWKA 5HWJA 3VMOA 4KESA 5AVHA 1LDCA 3DH7A 2WXDM 2VC7A 3WLJA 3O05A 3QPZA 1UWTA 2UY2A 2WCSA 4Q7BA 3AXMA 2O56A 3OIHA 4EPDC 3NQ8A 4TVCA 3VIJA 1V0LA 1OCQA 1XCXA 1R9ZA 1XGDA 2DVTA 3U9IA 1QI2A 2VZOA 1R38A 4LFYA 2ZRWA 3N2BA 3TYDA 1HN1A 4O1CA 3N34A 5KINA 3ES7A 4K68A 5F4WA 4PCSA 5AN7A 3P74A 2I9EA 3WQVA 1VC4A 4Z2KA 3EXRA 3Q4DA 4C6KA 2TRSA 1PTDA 3ARYA 3CIWA 2WANA 5I6SA 1PDZA 3QV6A 4JY8A 1KR1A 1T6MA 4Z1BA 3IK4A 3AALA 4ZQMA 3GX9A 5HUPA 5BOFA 2A85A 3WNLA 1POJA 3APGA 3S0CA 2FDSA 4PEEA 1A0CA 4LVGA 3ZMRA 3W1MA 3U5UA 4DPPA 3MHFA 1ZJIA 2OXNA 4AD5A 2ZUWA 2QMJA 1ZAHA 4I5UA 1PIFA 2HPIA 1W8SA 2CKSA 4AC1X 1B90A 2ALRA 4GKTA 4C1LA 2VEKA 1CBGA 3HBLA 2Y89A 1WZAA 4FSAA 1EA0A 1QNOA 4WY0B 2INEA 1R3YA 4Q4RA 3WEOA 2VR2A 1EC8A 2W0UA 3B9EA 3VFCA 1C7SA 2Y24A 2ZE0A 2SFPA 1RBLA 3WNKA 1KWKA 1S2TA 3G77A 4XVEA 3S5NA 4HA3A 3LG3A 2ISDA 1TYGA 3GVRA 3L66A 1HKJA 3WLMA 2F6UA 1O4UA 2VWSA 3U0HA 4JFTA 1JCLA 2HNEA 4HSHA 3O8AA 4IFRA 4KWOA 2PWUA 3UR2A 4AC7C 2GJNA 3IGHX 2UWFA 3F5JA 4D6IA 2CZDA 4CEUC 3EX6A 2XHYA 1YYAA 3RO8A 3OYXA 1BHGA 1H7XA 2ZUUA 3RGTA 4GIAA 4ADSA 2Z7GA 2YDQA 1B3OA 3RO6A 1P5BA 1EGMA 1X39A 4PMQA 1M68A 3FVMA 5DBUA 4HMNA 3OO2A 3QMSA 3POCA 1P1XA 4CQ9A 5HATA 2MUCA 4H7VA 4S3EA 4FOKA 1XPGA 3EDDA 4ZOEA 3RK8A 3TYBA 3HG2A 3RMEA 2JALA 3K4WA 2Y1HA 4DJDA 4WF7A 1KXQA 1OK6A 3I6EA 1F3WA 3P5YA 4DYJA 4OV4A 5AC4A 1EZWA 1N55A 4AY7A 4H8VA 1OK4A 1LWHA 3BC9A 1HJSA 1AODA 4LC6A 3AS3A 1J2BA 3WD2A 3N9KA 1QUMA 4J7RA 3GKAA 1XIEA 2CLEA 4OU1A 5IXEA 3FK4A 5HBFA 2QULA 5LNVA 4OTKA 7PTDA 4WDTA 3B04A 1O6IA 3VILA 1N2VA 4IMCA 1XI3A 1OY0A 1UHVA 2YLLA 3EOEA 3WFAA 3HV8A 4CD8A 1EP3A 1M5WA 3EKLA 4FXRA 4LF2A 1GYNA 3TQVA 3LD5A 4GI4A 4PFMA 4GISA 1EEPA 3B8IA 4HZ6A 2FZBA 4JX6A 4XAPA 1V03A 4ACZA 3EOLA 4RZ4A 1MEWA 1BKSA 1D3HA 5D2TA 3UYIA 4JTRA 4R9OA 1EPXA 1KGUA 2B81A 3DFTA 4JTIA 3B4YA 2QYGA 3LI1A 1YDYA 1ODZA 3A9IA 3QR3A 4DM1A 4QCFA 4CCDA 1GKRA 4M6VA 3DENA 4GE8A 4UOJA 5MF5A 8TIMA 4XWUA 1DXEA 1M01A 3AS2A 1W1A1 2AL1A 1TZ9A 4GMEA 3AYRA 4AIEA 4HCHA 2J25A 1J6OA 1XKJA 2YZRA 3NQ2A 1EXBA 4U3AA 3N25A 1T5AA 1DE6A 1Z44A 1OM0A 4IISA 2FTPA 3S9YA 2KZHA 3AIVA 3LQGA 1H63A 1PX4A 1ISZA 1NARA 2XN1A 3CUGA 3WLKX 1EH9A 5I03A 1H61A 1OC6A 4FX7A 2Z2UA 1XS2A 3T7VA 4JTTA 4K6AA 1Q85A 4H6RA 4Q8OA 5CZ0A 1RJRA 3MBDA 3BMWA 1DJNA 4ZQRA 3G1DA 5B7YA 1L6WA 1KGWA 2HK0A 2XN2A 2QCCA 1KRMA 4X22A 3RILA 1CLKA 5FL0A 3U3HA 4LVDA 4LAKA 2YCJA 1ZB5A 2CWXA 3GY1A 4YVVA 3LMYA 4XV0A 2OFJA 1NWUA 1VBUA 1JZ2A 1VYRA 2QDEA 4M6QA 2R1KA 3CL8A 3SEPA 4M29A 4EPKA 2IKJA 3WF3A 2Y0FA 1LT8A 1MEHA 3O6CA 4JYEA 3EWXA 3GFXA 1TWDA 4DEFA 1ECEA 5HDRA 1ESWA 1FY6A 1I1XA 2R82A 2B7QA 1TPC1 4LS2A 5A69A 1EO5A 3B0YA 2PBGA 3VD5A 4ACZB 1BQGA 4QDWA 2IKIA 4YTUA 3CWOX 4WY0F 4Z1AA 4RDZA 1R7AA 3AJ7A 2Y63A 3GB6A 1JAKA 3EB4A 5IFTA 3W86A 3P60A 3G0SA 2J7GA 1HXJA 3LI0A 5E1QA 4CEXC 4GHRA 1F74A 1SQ7A 4X3ZA 1XLFA 1GTEA 3G1AA 2NWRA 1IGWA 1SFSA 3WBYA 2NX3A 2WB5A 1UQZA 3ZLGA 2DW7A 3AMKA 3BG9A 5DLCA 1CEOA 3EMQA 4YJ5A 4LAZA 3SUTA 2XGZA 3GU2A 3B0PA 1A80A 5AYXA 1ZTVA 3SBFA 1JUEA 4HJWA 2EBNA 2WAGA 2XIOA 1TR1A 1J2WA 4GOAA 2QUVA 2YYTA 1EHAA 1L6SA 2OYKA 5XIAA 3KLKA 3DHUA 1GWJA 4S3JA 1JDCA 1TJPA 3ZSTA 5HWNA 2GQAA 1C91A 4HOWA 3MSDA 3LXAA 3VINA 3SFKA 2PD5A 5BWFA 2YFNA 1QCWA 4KWUA 4MYAA 1GOQA 3W2MA 2R94A 2HBXA 4BZYA 3LMZA 3DCPA 3L0KA 3UR7A 1XYAA 4CD6A 1IWPA 1AMYA 1KBKA 4GXWA 1G5AA 1V77A 3IARA 2DZTA 4XUGA 3KEHA 4N2YA 4Q4KA 3W81A 4FXFA 1RBOB 4WDUA 5G2WA 5F2GA 1JI2A 3BCFA 3QY8A 1RXOB 2WZMA 3WJSA 4IMDA 1YLVA 4Y7EA 4XKYA 3W82A 1H5YA 3LBCA 4X0VA 2F9RA 3GSMA 1K77A 1DIDA 1O95A 2DJXA 4GRSA 1UKOA 5DY3A 3TU9A 5JBFA 2CLOA 1ITCA 3MPGA 1WZMA 2ZUSA 2ZX8A 3F2DA 4C6JA 1US0A 3MY9A 1DIOA 2O92A 4ZXOA 1Q6GA 2BFGA 4CD4A 1Q8JA 4PUMA 4Y8EA 5BOEA 1Z41A 1UH2A 1RY0A 1EQCA 1EFZA 4JBRA 5D9NA 1TRDA 3BLKA 2GUBA 5CC5A 5GJNA 1E9ZB 3DU0A 2W3ZA 4LS0A 2GVYA 1Y5VA 3WLQA 5ECUA 3F5KA 1W3LA 1ISXA 2PC8A 2PU0A 4YS1A 1GJPA 2GDVA 1P6BA 2VZSA 3WQ5A 1OWQA 3QC3A 4IQEA 3RR4A 4ALDA 4W88A 3T05A 4GLEA 1H1NA 4QSHA 5HJYA 4LU0A 2JEQA 1G6CA 5B7ZA 3NEHA 1IIHA 1ZALA 3VNDA 1EYEA 3WL1A 2ACRA 1VENA 2YX0A 1X1ZA 1KBLA 3GKFA 3GUGA 3ZT5A 4IP7A 4EF9A 3TONA 4XKMA 2UY5A 4C5ZA 1Y0EA 2X1IA 1THFD 4HU0A 3ZIZA 3W07A 4UR7A 2GJRA 1LG2A 2ZXDA 3VNIA 3PJWA 2O9TA 1K9FA 3THDA 2FMOA 4JIHA 4BCEA 5D4YA 4RDVA 4TR9A 1GTHA 4KS0A 4KRUA 3BAWA 3BLOA 2E6DA 3W1AA 2P8BA 4CVWA 4NF7A 2G96A 4WDWA 1WKEA 3TLQA 4XSMA 1LM1A 5HK4A 1R9XA 4AZIA 1YQ2A 4PTXA 2FJUB 3G18A 3CLMA 3KCJA 1IXQA 2PGEA 3INPA 4GYKA 1E71M 3WL0A 1O66A 2VGFA 1KV8A 2QT3A 3PJXA 3NQCA 3V0UA 3BWWA 1NJJA 4XKYB 1QOPA 2BB0A 3BAJA 3QBUA 5BROA 3A13A 3H26A 3UXKA 2ZRYA 1KTCA 2CLFA 5FD0A 1LOQA 1UD6A 3SO7A 1TV7A 1CGUA 2BOGX 4QJ4B 3VKKA 3ZOAA 5IM51 5BRPA 2OOGA 4DN1A 3RRXA 1KM4A 3IRSA 4HK5A 3OHMB 1UR8A 4JZ5A 1IZJA 3FOKA 3LENA 4TMBA 1CXKA 4AVNA 3GNNA 3WO8A 3D47A 2G3MA 4CU8A 1HKMA 2XIIA 1OADA 5CJNA 5C9XA 1ZBCA 3QHNA 2GQ9A 1RPKA 3HFTA 3H24A 4S23A 1GQLA 2OSYA 2BY0A 1TV3A 1W9PA 3VZZA 3L23A 1M9HA 1W0MA 1WPCA 4US5A 5KSWA 4NNBA 1VRDA 2BZNA 2X1RA 3DEQA 1RP8A 3UJRA 1ZSXA 4D8LA 3WD0A 4UTUA 1Z48A 3HGSA 3L4VA 5CG0A 4RPPA 1FXQA 3PPHA 4QX4A 4NXKA 2VVNA 4HOZA 5LHFA 3CEUA 2ZA1A 5C0QA 4ZOBA 1XPYA 2V69A 5U7SA 1KLZA 3UETA 5I0DA 1QBBA 4H41A 2WWDA 3KBWA 5C5YA 3PPCA 2NT0A 2PTYA 4RW5A 2Y5SA 2QCLA 3W75A 4IHCA 2ZYFA 3CMFA 4IIGA 3GFYA 5HULA 3GFZA 4JY9A 2Y2WA 1XBVA 4Q6JA 4A4AA 1YNQA 2Y62A 2OX4A 2WJDA 3GIYA 3NM1A 3ERPA 4JDYA 4N6FA 1CDGA 2C16A 3TW6A 1Q45A 3Q37A 1OJXA 4TIMA 1RBAA 1BYBA 4E4UA 2PWHA 2P3ZA 2RDTA 1Q7QA 4AG0A 3UNTA 5DX7A 1LCOA 3PWGA 4UQCA 1IQ8A 3HGOA 7ENLA 1B1YA 2R1PA 4MWAC 1GW9A 1UMLA 4YPJA 1R46A 3WQOA 1IEQA 2WMIA 2P10A 4PSRA 2DDXA 1E4IA 4AFYA 3CYJA 1J10A 3SB0A 5LIKX 3MSRA 2C91A 4BI7A 2WHJA 2X30A 5D38A 1JZ8A 4H9TA 4ORMA 3MA8A 1FCUA 3TKFA 3GIQA 5FEPA 4UFLA 4H4IA 4RXGA 4GI8A 3WELA 5LNSA 2PDKA 5H6HA 4H9VA 1NSJA 1A5BA 4YXGA 5IOBA 2IW0A 2UY4A 2H90A 3HO8A 3WFZA 3J7HA 2XVNA 4LB3A 1FFRA 3GVWA 3M44A 3WH6A 4UTWC 1XDLA 4IUOA 4JXCA 1OHLA 1O94A 1XFCA 4B90A 1T99A 4ICMA 3VK5A 1OFDA 4RV3A 2ZZ2A 1XLAA 2VX7A 2FDMA 3ZYZA 4OE7A 2CYGA 3LN3A 3VKCA 4L6OA 4PYSA 5D2WA 2R1LA 2QXWA 4W9TA 2CFFA 3E2QA 3MCMA 3E12A 3UVIA 1P43A 4GY1A 4UWMA 1Y65A 4P8VA 4DBWA 3MO4A 1UG6A 4CNOA 1QU4A 3BQ5A 4JFSA 3QM3A 1YHTA 2FJKA 4R3UA 3E5BA 3EDKA 1TO3A 3KW3A 3EPOA 5K7JA 3EWYA 1ZBWA 5FA5A 3TAOA 4UXDA 3QV9A 3MSYA 4RW3A 2ZIDA 3F4VA 3QRHA 5LIXX 3MI2A 1PUDA 4Y6GA 4MFDA 5BNKA 1AZ1A 1UOKA 2RJHA 2NSOA 1NDVA 3BOLA 1GG1A 1NWSA 2WMIB 2A7NA 3LM7A 1XLGA 2OEMA 4I90A 3CZGA 4MNKA 4LGXA 3WLNA 1OG0A 1SZRA 4QE5A 1TPDA 1XDMA 1EX5A 3W6LA 2HTMA 2BHUA 1YE6A 4RE0A 1CCWB 3N2XA 2G4FA 3M0KA 4HHLA 3A4JA 3H2AA 5I7GA 3WK2A 1UWAA 4MFEA 4NRRA 4Z1CA 3BAIA 3AIUA 1ISWA 3IJIA 4YTRA 2YXXA 1EJWC 4D8AA 1YRRA 1DL3A 3UCQA 2PGFA 2PSNA 1EJXC 3WLRA 4BKNA 3DYMA 3M4HA 1AZ2A 2VEIA 3WBEA 4XD5A 2Q8XA 2VT0A 5JH1A 3WJWA 4K1WA 3TN6A 3T9PA 1A53A 3MCOA 5ABFA 1OFPA 4WKAA 4GXPA 5EU9A 3ALGA 2ZA3A 3EWUA 3LSBA 1QW8A 1B4KA 4CNPA 1G4PA 4U10A 4W8LA 1GHSA 1L0PA 3STEA 4DQWA 3LCXA 3W7KA 2DPEA 1PV8A 2ZX5A 4GPNA 3G22A 1MFUA 4GJIA 3IUIA 1PJ9A 2AMXA 1HZYA 4ONVA 3M1ZA 4O28A 5DY2A 1AJ2A 5CPTA 3S1GA 5D37A 4MUZA 4PCTA 3RCYA 5A6BD 3E2RA 2WPBA 2D2GA 3TZFA 4XAFA 3BUVA 3WJZA 3EAUA 1FWIC 2VX5A 4JOMA 1SO6A 3CIVA 4JGDA 2P1FA 4LF1A 2V5JA 5A8OA 3LYEA 3F4CA 3WZ0E 4CNNA 3M0HA 4MMWA 3W7DA 1F6KA 2XDFA 2X05A 2J6VA 3AQUA 5AHNA 2V3GA 5HQEA 3WYZA 3SCNA 1A5UA 3DFOA 5A6TC 3GU9A 3NVTA 2ICSA 4Q6XA 4MWAA 3CO8A 3KTCA 3RM8A 1FWAC 1K1DA 3IJLA 2AL2A 4NX5A 5CGMA 4HA0A 1EQPA 1EXPA 1FP8A 1OZQA 4M82A 3W1LA 4IMAA 3MP5A 4HKPA 5H91A 4UQDA 1SZFA 1W9UA 3ZJKA 3MMTA 3MCNA 4MIMA 5D05A 4C6PA 2VNCA 2OWWA 3TMQA 1RD6A 4QISA 4IP4A 3MUAA 4H04A 1YE4A 3LY0A 4PSPA 1SPQA 2Z2BA 2HXUA 1LT7A 1OFEA 3BPWA 2RJGA 2V2HA 1EKOA 4BI6A 1LBLA 4PUDA 5CQ1A 4WXYA 1HJQA 3F4NA 2AQWA 1FWSA 5H8UA 2JKPA 1W5PA 5T8GA 4B16A 1O12A 5ABFB 4UTWA 3QH2A 1W1VA 1SFLA 3AJXA 1OC7A 4DYKA 4OQVA 4GUHA 4HU8A 1AH3A 4NJHA 1GGOA 5CEWA 1PZ1A 1UWRA 2C0HA 1UH4A 5I3IA 3HQNA 1M04A 4ASTA 1P0DA 3LZ5A 1OX4B 2OGJA 2O9RA 1E4NA 3URNA 3QQ0A 4HNVA 1IEWA 3RCNA 2JQXA 4GVGA 2J7FA 2GGHA 1OFBA 2PRLA 4O1AA 4A6GA 3WLTA 1V6UA 1PWLA 3MUCA 4S3DA 4IICA 3ABSA 4Y96A 3EDJA 4BK9A 3GTNA 1XDJA 3ZM8A 1Z69A 3UZWA 3GDKA 4RPQA 4PA8A 4HNLA 3Q67A 1UMYA 1YMYA 4P7RA 4QSFA 1EIBA 4J40A 1X6UA 3NVDA 1WO2A 4IPJA 3L21A 3AWNA 1KTBA 4FP1A 3GVVA 4FNTA 4YWSA 2H3DA 3T6CA 2NSXA 1B9ZA 2FVLA 2XH0A 2CITA 1DHKA 2J9XA 4MDOA 3Q65A 3NL3A 4WR3A 4C5YA 4MWAB 4HB7A 4JX4A 3JS3A 1Y5XA 3VCNA 3VMPA 2AL2B 1S5VA 4R88A 3TAKA 2Z25A 1AW1A 2G3JA 3PZGA 3QTGA 5KITA 2I57A 1WKYA 1F76A 3R5EA 1EUAA 2XFYA 1YADA 1US2A 2CBIA 1MW1A 5GJMA 2ZRUA 3W1XA 5FEWA 1OGSA 1OT2A 1F8MA 1IEIA 3LHWA 1K9EA 3HTWA 3BCJA 3TXZA 2ZBTA 3H70A 4LS1A 5FESA 3ARQA 3W1PA 1MVYA 3E0IA 3I7SA 3W73A 1ADSA 3W7HA 4UQBA 4B5XA 1CXHA 1XW8A 4JTQA 3RHGA 5EMMA 4QNEA 2DT0A 3W84A 3ZJ6A 3UG8A 3GE7A 3U57A 1J12A 1FWWA 4GH1A 2ZUTA 1H4PA 5DMLA 3O06A 2CETA 3LBOA 4HPXA 3T07A 1HKIA 4AH7A 2YGYA 5JU6A 3QPYA 3UPMA 1EOMA 1XC6A 2VWTA 1JCYA 3T2PA 2G8ZA 3M7SA 2B31A 1QPNA 3LUTA 4NYYA 4HTYA 3OVGA 2QIWA 2ZTKA 5CPNA 3P0WA 2WNWA 2PDLA 3IVTA 2ZRVA 3OGVA 2I5QA 3NQMA 1JCTA 5ABTA 1LF1A 2QJMA 2RUSA 2G3IA 2OT1A 3CM4A 3P80A 2GGIA 5G2IA 4KFPA 5ABGA 1VKFA 1OYCA 1MXGA 4D6FA 3SDOA 3SRFA 2OLAA 3QHMA 3H12A 5A8PA 2Q8LA 1JZ7A 2DEPA 1I2NA 1AH4A 5U4NA 3P82A 4DYEA 5AHMA 4Q8NA 4Q8UA 5C70A 3PTQA 4F0SA 4L64A 4L4MA 3AO0A 4BEQA 1DPMA 3IIXA 1XR2A 3ZZ1A 2PDFA 4AD4A 1IT7A 4UNKA 4MLRA 3VVGA 5KZMA 3C61A 2GJLA 1MXSA 1H09A 1KCZA 1B54A 4ZMGA 2Z28A 4BWLA 4KEVA 3ATYA 2Z6IA 3VAVA 3M5ZA 1MI3A 5CC7A 2NV1A 4UFKA 3WDJA 5A6LA 2OJPA 1VD6A 4XTDA 3VI2A 1U5HA 4PL1A 3WN6A 1XRSA 3POHA 5K4ZA 4CN1A 2WJZA 1EDGA 4LBRA 3LCFA 1E55A 2CLLA 2J27A 1LJYA 1UR2A 1JRCA 4BEUA 4Y2WA 3K2GA 1LLOA 3KAOA 2CKRA 3VGFA 3ISIX 3RAOA 2V30A 3W7PA 3LPOA 1VEMA 3NR0A 1N8FA 2CHOA 3NQ6A 3FVDA 4QS6A 1FCQA 4KQNA 4NIRA 1HG3A 4L1GA 2Z00A 1J0IA 5CGQA 2C0AA 3OZMA 4GFSA 5HQMA 4OIFA 3GTHA 4PR4A 1VFUA 2VD9A 2YXGA 3JZUA 2QDGA 1U33A 3BLLA 3KUMA 4BFAA 1V7AA 3LOTA 4GD0A 3HU7A 2C1HA 3BOFA 5D04C 3GG0A 3QGVA 1Z32X 1UA7A 1H0GA 4DJDD 4UTKA 4AXKA 3ONCA 2CZVA 3CL6A 4XBJA 2GUYA 4U5IA 2VEGA 4AZBA 2J78A 4M19A 4I9TA 1YTEA 4MF4A 1MWOA 4F40A 3ZT7A 7REQA 1UUOA 4URIA 3WQ4A 1V5XA 3V18A 3Q2DA 3GYEA 4XZLX 3QFWA 4WKFA 1ME7A 4TTGA 1SJCA 3U4FA 1RJQA 1BAGA 3S6TA 1XSKA 4PRTA 4XD4A 3ECQA 1H1ZA 3NYDA 3QKZA 2DZSA 2VZUA 4F9JA 3ITCA 2R91A 3FJ4A 1ZQ5A 1W9BM 4B3ZA 1KRBC 2EPOA 4DRSA 1UW9A 4JYDA 3B9AA 1Q3NA 3U6WA 3KVKA 3USBA 3Q58A 2ZZ3A 1RCXB 2W27A 4V2XA 4JHOA 3VOFA 2Z27A 3M6DA 2VFIA 1PWMA 2E09A 3V1PA 4HP5A 3WG6A 4IIFA 2DSUA 2E9BA 4HQVA 2DP3A 2PDHA 3GW0A 1ODUA 4IQJA 3MMWA 3PZUA 4HMDA 2WM0A 5EFFA 4PB4A 1J5SA 3BSGA 5I3GA 4HHHA 2FZMA 3ME3A 3ORWA 2F7FA 1PYMA 2G4JA 4IFKA 2HE5A 5K4XA 1Z6KA 1L8PA 3ITLA 3T0BA 3M0LA 4D6DA 4B4HA 3B05A 6TIMA 3UD6A 4K37A 1WDQA 3C6CA 4IH3A 3L4UA 4MNMA 3N2TA 3QYSA 4I9AA 4AY1A 4POCA 1TUFA 3C3UA 3ANYA 3IJ9A 2VZTA 3C56A 3IRDA 1DJXA 3TUUA 2DU2A 3QMRA 4UMAA 2WZHA 1KC7A 2BWGA 4KMQA 1TJ2A 2OZTA 3NWRA 2CU0A 1O1ZA 4Q32A 2CC0A 7REQB 3OBAA 2ZUVA 2E8YA 3G1XA 3ITYA 3PBWA 5D02A 2RDUA 4OV9A 1U5VA 3L5AA 3LHVA 1SR9A 3N14A 3KRUA 2VEFA 1Q6RA 1SUXA 3CZKA 3SUWA 1SW7A 2YCIX 3DFSA 3TVAA 5LKYA 4N9BA 2ADAA 1O7AA 3GR4A 1V4YA 4PRWA 3GYCA 5A8MA 3R0DA 2FKPA 1JIBA 3LPPA 5HR6A 1SFJA 4RZ6A 3VUSA 1V6WA 4ZXLA 3IGXA 5FSEC 4EXQA 5FJTA 4WQ6A 1TREA 4MPKA 3WQ6A 1NOFA 2BOFX 2GVGA 2PI6A 3LXCA 3IJ6A 4PFHA 3WD1A 4WVXA 2HQAA 5ABEA 4QAIA 4J2PA 5J5DA 3TYUA 3CWNA 2Z1XA 5T91A 2CPUA 4ZO8A 1Q4WA 2PZNA 2ZOXA 3NEVA 2ZZ1A 1PSCA 2Z1VA 1DORA 2X1SA 3EGJA 5LYRA 2DSWA 3CWHA 1HO1A 3QMTA 3NCOA 1IXNA 3IJ7A 3CQIA 4ERAA 3M6YA 5HJLA 2PWVA 2PPGA 2Z1BA 2Y4SA 4KCTA 3HOJA 5E6ZA 5G1YA 1WQ5A 2VTFA 3L5LA 1PL9A 1UCWA 2DH2A 4AW7A 4IQLA 5EKYA 4LRSA 4V27A 2CLKA 7ODCA 1S3HA 3WQPA 3HPFA 5FOOA 4BA0A 4W87A 3L0GA 4ATWA 1E43A 1AQHA 2ZDRA 3GZ3A 4MNLA 3WJXA 3FCPA 5JH2A 2FZ9A 4UFMA 1QPKA 3UG4A 2VENA 4YHEA 1O1HA 1JRBA 3P8JA 1BVZA 2WSYA 3DGRA 2D24A 3EWDA 3AROA 3PB0A 5EA9A 1I0BA 4Z2HA 1XQLA 1D7FA 2V81A 4RE4A 1PE1A 1R2SA 1MDLA 3MDWA 3VXGA 1B3YA 1OGBA 4UCFA 4WX2A 1DWIM 1FBAA 3OW1A 3UWYA 1C9WA 4AVOA 4JICA 1UP0A 4HK7A 1RV8A 1TWSA 4CD5A 1X6LA 3EMZA 1RLCL 4OVXA 4QBXA 3WK1A 5CPSA 3TFCA 5I07A 1I4NA 2XSAA 3AXKA 3KVLA 2WKGA 5J04A 4BR1A 4EOUA 5LNUA 4HPJA 2I1OA 4H19A 3TWAA 2NT1A 1HJWA 3T42A 3GG1A 4M81A 1GVFA 2ZRZA 4MLJA 2EF9A 2V0TA 2YA0A 4ZOAA 1RLDA 1YXYA 4TXEA 1OCJA 3F2BA 1W3NA 3NL5A 1JDDA 4S3BA 3QW3A 3KL5A 1ICSA 1QJWA 3F03K 3VO0A 3WLOA 3CAVA 4PGLA 1TPB1 3HJEA 4JNZA 4J9JA 4JS3A 5A6SA 1A5NC 4A8LA 5I5RA 2H9AA 3U8GA 3RIKA 4CD7A 2P53A 1GCYA 1XQKA 2TSYA 4Q4PA 4A8NA 2IPWA 4MVAA 2PRMA 4GGBA 4BF7A 5KZDA 1PBGA 4DO4A 5I3DA 3ABZA 4BF5A 3EEZA 2GK1A 3UG5A 4UQAA 4O12A 3PVFA 2IXVA 3I7QA 4XZHA 2WHLA 2A21A 1S1RA 1XIIA 4V33A 3PZ9A 4V15A 5AHLA 1LRNA 2YL9A 4X60A 4GUJA 2KX9A 3OYZA 2WMJA 4LANA 4O57A 1E40A 1UJPA 1PTAA 3ZR5A 4QHRA 2XIBA 2PLKA 3WBXA 1HP5A 1E9YB 5TF0A 3NL6A 3TN5A 5I78A 3EX3A 3AISA 4KT2A 4QE4A 5JVLA 1NVMA 1UWQA 3QR1A 4JN7A 3VU2A 3LSCA 3G1YA 4GBUA 3PNUA 2DUAA 4DLFA 4TX9A 2ZVIA 4HYVA 5CBJA 3WUEA 1Y5WA 3BARA 1ZAJA 4L4LA 1XUZA 3S6DA 4S2CA 4K7VA 1FCBA 2DT3A 2A0NA 4PMXA 3GNOA 2VGBA 1D8WA 2GWNA 4FO4A 3KRZA 2OODA 3ICJA 4GZJA 4JFWA 1W5QA 3QZAA 4L9YA 1FWBC 2VC6A 4NKCA 3U2EA 3N9RA 3E49A 4F8XA 3BLFA 1XX1A 3A21A 4RL3A 1E5JA 3VNYA 4F0HA 1J9YA 4JNMA 4GH3A 1EDQA 3LCIA 3BW3A 1S5NA 3H4WA 4J27A 1P6CA 3MVTA 1GVRA 3GNRA 3P61A 2XG9A 1A47A 4ROPA 3MTWA 4KFNA 3QGKC 2NQZA 3DKLA 3GIPA 3CV7A 1LQAA 1SO4A 2XSBA 3SURA 2WVTA 3QJAA 2FGLA 3UBPC 2ZCGA 2H9AB 4JQ3A 1GW1A 2R14A 2V9DA 1XV8A 1KFLA 1RSCA 3KRSA 3MSGA 3ZS4A 3VABA 3LHTA 1I45A 1GQNA 1ONWA 4M8UA 3JR2A 4PUEA 4C6BA 3AYTA 4QJ5B 1JCMP 3FAWA 3V0TA 3DHDA 4M5PA 4PTNA 1JVNA 2ZTJA 3CPGA 2DUXA 3UXIA 1KCXA 3VM5A 3C8NA 1TJ0A 3NIYA 1QRQA 4I5RA 4DJEA 2ISWA 2XH4A 1EBHA 3RG6A 4GQ0A 4MDPA 4HMCA 2CBUA 4ENLA 2FFCA 4DM2A 5AC7A 4EXAA 3O6AA 4AD1A 5J5RA 4AYSA 2NZLA 5C9RA 1IYXA 1U1UA 1KM2A 5CH9A 4GIYA 1FWFC 1R2TA 2DJLA 1UWIA 2HK1A 3AZSA 2YCLA 3UXDA 3PS7A 1EL3A 5CPMA 4JTCA 3NQEA 4UMCA 4A3UA 4LVFA 2Z6JA 1DHPA 4YYCA 2DW6A 3LHYA 3W22A 4TO8A 1H3GA 1H62A 4GZ7A 1IWAA 1XBXA 3SGGA 3WMBA 1V7YA 3VGHA 2IMRA 3IANA 3OLGA 4E3TA 4CVUA 3N2CA 3FXYA 4REQA 2ISVA 4O54A 3KVJA 4AISA 4FA3A 4IX2A 3W2KA 1KQYA 3HQPA 4WJ8A 1T8XA 1PKYA 1OYBA 4A21A 3NPWA 2GGEA 2JIWA 2ZZ7A 3KRBA 3UPWA 2QW5A 1W17A 2E67A 3M16A 2GSJA 2OPJA 5BMWA 2B4GA 1J93A 3P6LA 3PG8A 1MSSA 1KWGA 3MANA 3L2IA 3FEQA 2DSVA 1DJZA 4P8WA 3TN3A 4UTHA 4L6DA 1ME8A 1E73M 1XH1A 2Y7GA 3RM9A 2PAJA 3XISA 3W26A 4MPQA 3EA3A 2JBMA 3IIVA 5IBXC 1TTIA 3CL7A 4XIMA 4Z0JA 1CGTA 3PBVA 3KBNA 1CGXA 1VGAA 5DBTA 5A8NA 3VD4A 3HURA 5A5WA 2RAGA 2CNCA 3RDKA 3N6JA 3GHRA 3MO7A 2Y7DA 1W9DM 2BVTA 1Q6LA 2DIKA 4TX8A 3W7RA 3LBMA 4RJEA 2BGSA 4H9ZA 4H9UA 2BASA 4XD6A 1ISVA 3UG3A 2CLIA 4YTQA 1AK5A 3ITXA 2E9MA 1EYWA 5SWUA 2YCLB 4UC5A 3PP7A 4KH2A 3W2LA 1ZPTA 1MFVA 3NM3A 4AHQA 3CQ0A 3QYQA 1IT8A 3W7QA 3VD7A 1TIWA 2YL6A 1LZOA 4IF2A 4HGXA 1NAL1 3O3RA 1KFJA 3SRDA 3CO4A 4ILSA 3FYOA 1ITQA 3G8RA 1I0DA 4JTUA 2I56A 4LNCA 2BP1A 2YKKA 2X0YA 2QCDA 1R6WA 1KXHA 4ZTYA 1H51A 4REQB 1NF7A 4JHMA 3WQGA 4AZGA 5AYYA 2RH9A 2J47A 5AY7A 1DJWA 2VUYA 4B5UA 4W7VA 2VVSA 3P5ZA 1OFOA 4BF9A 3SM0A 4CNSA 5EGRA 1UC5A 1DWFM 1UZ1A 5BW6A 4UQEA 4KRTA 4A2SA 2INZA 2JFEX 2DZWA 1EZ2A 2X1UA 3UGRA 5IRPA 4QR6A 3SN1A 3QQWA 3TH6A 4PEKA 2I5IA 1TJRA 1RH9A 6ENLA 2ODOA 3P8IA 2FH8A 1JFXA 3QEZA 4ZTXA 1MW0A 2ISFA 1MQQA 3RX3A 4NUWA 3WFLA 4CQAA 1RQBA 2PDBA 1AVAA 1FRBA 5TQLA 2H3BA 5M5DA 3E0LA 5HA7A 2YL8A 4UCGA 3SCUA 1HJVA 3LTPA 1JXKA 3UWEA 1QXLA 3WD3A 1XGEA 3PFRA 3DGBA 1KV5A 3B9OA 4KEZA 1V0KA 2HPMA 1FTXA 2XWEA 1KRCC 4DF0A 1JUBA 4JCLA 4XZ9A 5FIPA 4B5NA 2ZICA 4IGHA 4AX6A 1W5NA 4PCNA 2J88A 4QTGA 3M0MA 1WE5A 4G7EA 3OEXA 1RP9A 2J62A 5DT5A 3SQLA 1PZ0A 4N02A 1IGSA 3OTRA 1FDZA 2HVMA 3DHPA 1TV5A 4KERA 4HZ8A 2BY2A 5FAJA 3UW6A 4LTSA 2QGHA 3T8LA 1TRIA 3KL3A 3PJTA 1I2OA 5DCDA 2FHFA 2GQ8A 4I7WA 5IDZA 4U33A 4XZIA 1LL4A 3HB9A 4CQ8A 3LQLA 3IS4A 3CASA 2E1DA 3EYPA 4L56A 1XG4A 4I8DA 1SFTA 3W6YA 1CYGA 5CLWA 3E02A 4JCMA 9RUBA 1F4AA 4MZ8A 1P48A 5FF2A 2XVPA 2FFIA 3FIGA 2NQHA 2Q6ZA 1XP3A 3DZ1A 5CGTA 3LHUA 4XBSA 2PS2A 8XIMA 4GI6A 4Z2GA 4JHZA 1LOLA 4JYFA 2BVYA 4NASA 4DZHA 3TCEA 3C52A 5F4XA 1JDAA 5F2LA 1V51A 5F1VA 4TX6A 3M0YA 1L2UA 3KBMA 1QNQA 4M7SA 1CTNA 4XZNX 1A5CA 4H9XA 1XRTA 4EXBA 3TSBA 2P8CA 3DG7A 3TMLA 3EB2A 3OODA 3O6YX 1OX6A 2Y8KA 3P2VA 3T78A 5H8PA 5JBDA 3RRAA 5LIWX 2EKGA 3OLEA 1GJWA 5HR7A 1Q6OA 4QEEA 3G8EA 2EHHA 4MHBA 3UWQA 2VFFA 1WZKA 2BY1A 4EPBC 1I2RA 1ZGDA 1VB9A 2XFRA 5EMJA 2FPVA 1CGVA 4MADA 4ATLA 5A6BA 2VCCA 2QCHA 1VFMA 3ARUA 1V3HA 2PDNA 3UJEA 1AQ0A 2D73A 1K4GA 1KQZA 2YDSA 5IBXA 3TV8A 3K1DA 3ZXWA 3G6MA 1RPXA 3T2OA 2AOSA 5H1WA 3VDGA 5A2CA 4UFIA 4G7EB 1TIMA 5TIMA 2WV8A 5C55A 4WGXA 1K4HA 5LNRA 1JYNA 4DI9A 3TYCA 2XUCA 2BTMA 3NQ7A 3WUBA 1X97A 5HPOA 4W8BA 3SCTA 2GSHA 5IHRA 1NIUA 1E5NA 2CXGA 2F2HA 2EG8A 4TV5A 3GHUA 1PHQA 2OSWA 3G1SA 4O1DA 3ZVHA 3L2LA 3NAVA 2FPTA 5E9AA 3DAQA 1UQYA 3R25A 4GNJA 4KKXA 4RUBA 3T40A 1ONXA 2P88A 5FSDC 4C7FA 1VIWA 4G56A 1QT1A 3ZT6A 2E3ZA 3I6TA 3V75A 2WLZA 4MJ4A 4AIUA 1UJQA 4A3QA 3E96A 2XJ7A 3CHEA 3HV9A 2HROA 3CT7A 1CIUA 3PZQA 5I06A 2OGYA 2FTYA 1VR6A 4C6MA 3MS8A 4GUFA 1UASA 4C1KA 2QUNA 1EGVA 3VC6A 1C8QA 1BVWA 3APYA