2XG9A

Crystal structure of barley beta-amylase complexed with 4-o-alpha-d- glucopyranosylmoranoline
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
487
structure length
487
Chain Sequence
VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-AMYLASE
total genus 191
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xg9A00
1QOXA 1C8QA 3VD4A 4WJXA 4BQ4A 3WL1A 4UNIA 2YDQA 3OGRA 2J62A 2OYMA 1WNOA 3T0AA 1G5AA 3K8LA 3NUKA 1HJWA 4AZHA 4CN6A 3HU7A 4JFVA 1HVXA 2WZIA 3L2MA 3OGVA 3WD4A 4GKLA 3WUEA 1W3KA 3SIMA 1LG1A 5HXMA 3CHEA 3L4WA 2BHZA 3PZMA 3OG2A 4XZWA 1UKTA 3DYPA 1AVAA 2J7CA 2GK1B 4X0NA 3UEQA 3CZGA 1M04A 1GQIA 4J3TA 5CPTA 2YBUA 4KWUA 2ZUUA 1C91A 2QMKA 4WKFA 3SCOA 1OIFA 2ZUMA 3G6MA 3SCNA 4LYPA 4UZSA 4J3SA 4MTVA 1ISWA 4UFMA 2DT3A 2WMHA 2DEPA 1QI2A 2XYLA 3QGVA 1Q6DA 4EANA 2WBKA 4JKLA 4PUEA 3RM8A 3VKKA 4XB3A 1GOMA 1EH9A 3BCDA 4AZCB 5I6SA 4Z2GA 4PCTA 2GFTA 3VMPA 4IPLA 1EO5A 1GORA 1TVPA 1NWSA 1W3JA 4FLOA 4M24A 3UESA 2YDSA 3I3EA 4UOQA 3TONA 8CGTA 2FGLA 2WBGA 3AIWA 3N17A 1HJUA 3WUFA 3ARYA 3FHQA 1GPFA 1ZBVA 4EK7A 3AYRA 4MPKA 1C8XA 1UD8A 2D0FA 2FHFA 2DH2A 1ITXA 4MJ2A 2PWEA 2OSWA 3QHOA 4P7OA 1OWQA 4UQEA 2VRQA 5IHRA 4U31A 4AZGA 3NYDA 1XGZA 3RMEA 2X2YA 2A3HA 4KMQA 3SUWA 3L4TA 1E1EA 1EA9C 1C92A 5E0CA 4BZYA 5A2CA 3SCUA 2DDXA 4XZBA 5M5DA 4B15A 5I23A 4LQ1A 4D6EA 4PTVA 3KL3A 2NSXA 2CKSA 3AXHA 3WNOA 3WBEA 3F5LA 3A4WA 1US3A 5A8OA 3LPOA 3SUVA 1WZMA 2VJXA 2WZHA 5C71A 4LGXA 3AHYA 4CU8A 5EFDA 5BXPA 2WZEA 4DUXA 2JEQA 4L4PA 4ZFMA 4ACZA 1KR0A 1CENA 4JL1A 4CCEA 3WQVA 5A6SA 2YDRA 1FP8A 1WAWA 3WMBA 1DWHM 5EBAA 2J78A 2FHBA 1TA3B 2E8ZA 4RL3A 1OB0A 3CH9A 2YOCA 3WD3A 1E6ZA 2QLYA 2CERA 4AEEA 2CKRA 1W91A 3WNMA 1UQYA 2WHMA 2A3BA 2XGBA 4GZEA 5FKYA 1WDPA 5AC4A 1KWKA 3SUUA 3AMKA 1JDDA 4F79A 4CU7A 2CBVA 5CLWA 2ZX7A 2Y4SA 4XX6A 3W29A 2VZSA 4MB3A 3AZTA 4E8DA 2DSVA 5CPQA 1CDGA 2JIWA 4C7FA 5E09A 3VD7A 2VVSA 1E15A 1K6AA 3KZSA 1KBBA 1RD6A 1KGXA 2EO7A 3UERA 4PMNA 4HA4A 2CHOA 3A47A 2WPGA 2BY2A 2O9PA 3NSNA 5JBEA 4LX4A 1BYCA 5A69A 3II1A 2G3IA 2ZUVA 1C7SA 3MUY1 4H2CA 2EQDA 3NJ3A 2W63A 3WD2A 1CGYA 4PUDA 3POHA 2DSUA 3BAWA 4M82A 2G8ZA 4CD5A 1N82A 1NARA 2A3CA 8A3HA 3OLIA 3WQ6A 2WMKA 4X0VA 4HOWA 2J79A 5E6YA 1HP4A 4HTYA 1W2PA 4DM1A 3CUGA 2WVSA 1F4AA 4U5KA 3OA5A 3RDKA 1XRVA 3L4YA 5BRPA 4TX8A 1JGIA 2V38A 4P8VA 1WKYA 4W87A 2WLYA 5I77A 2VL4A 2JIEA 3FAXA 2CEQA 1O7AA 1V0KA 5LYRA 3TTOA 4KRUA 1H49A 2CPUA 5DEZA 5GPRA 3PTMA 4DUVA 4AD5A 3PTKA 5A3HA 1JL8A 4TOQA 1JI2A 5CSUA 1J0KA 1MWOA 4P8XA 3UG4A 2NT0A 3G6LA 4JZ5A 3ALGA 2CBIA 5I3DA 3IK2A 1A47A 5M17A 4NZCA 3WDRA 3ARTA 4QFUA 1VFFA 1JDCA 5HPOA 3TP4A 3ZSSA 4F9DA 2C0HA 3GH4A 2J7GA 3N18A 3OBAA 1V02A 4WLCA 2XVLA 2YIHA 3ZSTA 2WSPA 1KGUA 3LPPA 4CCDA 1MW0A 2D0HA 1CECA 3CZ8A 2Y2WA 1AQMA 2GJRA 4OBSA 4AYSA 4B16A 2YA2A 3IANA 1E3ZA 1UZ1A 1B3XA 2GSJA 3CLWA 3IJ8A 3CZLA 1XSKA 4J28A 5A6LA 2WK2A 4PBGA 4WIWA 5A95A 3K46A 3B9EA 1Q4NX 2VZOA 1VFUA 4UFKA 4HZ6A 5AC5A 2VCBA 5JBFA 3BMWA 6CGTA 3EMZA 2OWWA 3VIOA 1EHAA 2WB5A 3U57A 2W61A 5DO8A 4GQQA 3VIMA 3CBWA 4M8UA 1J9YA 2YL9A 1ISYA 4BF7A 4C7GA 4K68A 3F5JA 1OIMA 2W4XA 3GTNA 4QP0A 4N42A 2YLLA 4MDOA 4HU0A 1HF6A 3TTSA 3VGGA 2BXZA 2E8YA 1EO7A 2CNCA 4UOJA 2OSXA 1NWRA 2XTKA 4GZJA 1CWYA 1W9VA 3RO8A 4NF7A 1K9EA 4AC1X 1H09A 3PZUA 2EPLX 3WKZA 1PIGA 3WIJA 2A3EA 1NP0A 4UTFA 3PZQA 1M53A 1E71M 3SCPA 4LXFA 2PF0A 4Z2JA 2YA0A 1GCYA 2WKGA 2YJQA 1PZ2A 3QHMA 1E1FA 4PMUA 1B90A 4R5EA 3ZJ8A 1PZ3A 5BWFA 3WH6A 3D3AA 2D24A 1UD2A 2O92A 4HA1A 3WQ4A 1LJYA 1K9FA 2ZWYA 2WSKA 3W4RA 2DIJA 4TX6A 1B31A 4YN5A 3BMVA 3L4UA 2IXUA 2J8GA 1FH9A 1PX8A 3W26A 4MNKA 3WSUA 3VNYA 4HMCA 2W67A 4M81A 5GNZA 4MDPA 4CD8A 2VX5A 1JD7A 1GONA 3CTTA 2J47A 1XH1A 1CXKA 1US2A 1XV8A 4Q7NA 3GBDA 3RIKA 1EGZA 5DFAA 3EDKA 5ABFA 3CUHA 5CSYA 4ZXLA 2VC9A 1X1NA 4J3XA 3GXFA 1EDGA 3N04A 2G41A 3N12A 5FD0A 3L2LA 2PBOA 1G9HA 5D9MA 1JG9A 3MUAA 1D3CA 3ALFA 3ARZA 5FCZA 2Z1KA 1HNYA 2YKKA 3ZM8A 4A3YA 3WY1A 4P7QA 1H0IA 4MAVA 1BFNA 1GOKA 4Z2KA 3U7VA 3KL0A 1CGWA 7CGTA 3VM7A 1E55A 1WPCA 4AMCA 4JAWA 1NWTA 1GOWA 2XPKA 1V08A 3AROA 3BAKA 3TOPA 2D1ZA 3ZOAA 3T2PA 1UWIA 4WKHA 3QOKA 2CESA 1FFQA 3DYMA 1J12A 1UD4A 1ISZA 1VEPA 2DQXA 2YL5A 2MANA 1PPIA 4FMVA 5D9OA 3WUBA 1QNOA 1MYRA 3L4ZA 4AZ6A 1R7AA 1JAEA 4E8CA 2E40A 4DWSC 1G94A 4HU8A 3WDHA 1H1NA 1I1WA 1UA7A 2JFEX 4KH2A 2XG9A 1E4NA 1NM9A 1XH0A 1JYVA 1XD0A 5JIWA 1JZ5A 4ATDA 2BV9A 4Y7EA 3AS0A 4CCCA 1VF8A 4Q22A 3OZPA 1WP6A 4HMEA 4V2XA 2DSZA 4E2OA 3KWXA 4D6IA 2ZUNA 1Q6GA 1DTUA 1PX3A 1MXDA 2BS9A 4FK9A 4JHOA 3AS1A 3I3BA 4AZ7A 4IM4A 2WMJA 2X1IA 3AYSA 3AHXA 3ARQA 1B3VA 3FNDA 1UR2A 1PIFA 2XWDA 1GZJA 3WUGA 2E9BA 1UH3A 3NSMA 3ZO9A 2VZUA 1D2KA 1HJQA 2QF8A 1W9XA 1AQ0A 3QOMA 3A4AA 2HISA 1HJSA 4AIEA 3WQ8A 2PWHA 1V03A 1GQKA 1Q6CA 1WZLA 2BY0A 4DWSA 2WMIA 1EXPA 3AI0A 3WNPA 4TVDA 3WENA 5A8PA 1DP0A 4AEFA 1UR9A 3GXMA 2VMFA 4D6DA 1BGAA 2WC3A 4PMYA 2WKLA 1Y7VA 5C70A 2J7HA 1GOQA 1CLXA 3VIIA 5A6JA 4J3WA 1ZBWA 1HL8A 2CXGA 3UR7A 1EQCA 3NDZA 2QPSA 3OLDA 3ARPA 2XIBA 4HP5A 1V3HA 3EMQA 4Z2HA 1XC6A 1BVNP 3DHPA 1V6XA 2ZUTA 3PZVA 1ZS2A 1OGGA 5BXRA 3MMDA 3FW6A 4FLQA 4AZBA 4HOZA 1NOFA 4V27A 2WVVB 2W91A 5BYWA 1EOKA 3WD0A 1JYXA 3D5HA 4ATLA 5I79A 5TD4A 1KB3A 5DT5A 5D9NA 2O9RA 3K8MA 2WHLA 4UFHA 1B30A 1MQPA 2EXOA 3CUFA 4CD7A 1UWTA 4JL2A 4NSBA 3VNZA 2ZXDA 3ZMRA 3MV11 2UY5A 3AIQA 2JF7A 4CU6A 3VD9A 4GIAA 1NP2A 3W6MA 1VFMA 1WZAA 4ZE4A 3VD3A 9CGTA 4BCEA 5HPCA 1CYGA 1QHPA 1G1YA 2VX7A 1JZ8A 5A2AA 3VGDA 2Y5EA 4FLSA 1HX0A 2G3NA 2XM2A 1U2YA 3WEOA 1E6XM 2EPOA 5I24A 1FA2A 5AYIA 4W93A 1E56A 1CXEA 1HJVA 3UG5A 1GHSA 6A3HA 4GO9A 2DSKA 3M6DA 2J7DA 1KXHA 7TAAA 5D8ZA 3UR8A 1ODZA 2VOTA 5IFTA 4GI9A 1MXGA 2J75A 4MJ4A 1VRXA 2PI6A 3U7BA 1I75A 1UWRA 5CLTA 4LYQA 1E0XA 4QLJA 5F7UA 1EOMA 2WHKA 4W5ZA 3CHCA 1FOBA 2VT0A 5C8BB 2ZUWA 4YHGA 1A3HA 1BPLB 1IZKA 4JKMA 4QCFA 3N9KA 4WK9A 2X8RA 3T08A 3DECA 1CGUA 1GQLA 2UY4A 3BSHA 4W5UA 2DT1A 3ARWA 2RGMA 1BSIA 3SURA 4OIFA 2NW0A 3K4AA 2FDMA 3AIEA 1E6PA 1VEMA 1GVIA 3ZIZA 1CGVA 2VR4A 2WCAA 3LMYA 4UQ9A 4YPJA 1LWJA 2DT0A 1CZ1A 5AY7A 2ZIDA 3CIVA 1O6IA 2XSAA 2CETA 4MNLA 3ARUA 3J7HA 1JYWA 3WNNA 2EEXA 1WDRA 1UHVA 3HN3A 2QMJA 3ZT6A 1QBBA 3W53A 1HP5A 3AOFA 5IDIA 2J7EA 5DMYA 3VIPA 1S46A 1V0MA 5DT7A 2ZX9A 2BHUA 2E3ZA 3IJ9A 3AS3A 4D6FA 3MMUA 2QPUA 1WB0A 3AIRA 2VCCA 2X0HA 4QAWA 2OWXA 2IXVA 4PMQA 1XD1A 3O9NA 3PZNA 1JZ6A 3PZTA 2J25A 1WZKA 2D3NA 4GINA 3SUSA 2XJ7A 1GUVA 2YL8A 1VEOA 3AZRA 2ZX6A 3KL5A 3ARVA 4JHZA 1RPKA 2ESCA 1D7FA 3L4VA 4URIA 5ECUA 3MMWA 3AFBA 1BF2A 1QNSA 3CO4A 4W8LA 1ZBCA 5HOSA 1E3XA 4TTUA 4ZENA 4AZCA 3GBEA 4HZ7A 3WF4A 3NSXA 3MSGA 4M29A 5KEZA 1B9ZA 2WXDM 1G01A 1NQ6A 3AZSA 1E4MM 1VB9A 2PWDA 3ZT5A 1RP8A 1ECEA 2VUYA 4HA3A 5BXSA 1IV8A 3AMCA 1J0IA 1H41A 4D1IA 1BAGA 4W8BA 1CXIA 3UCQA 3SCWA 3VD5A 1GJUA 3VX1A 5E9AA 1ZU8A 2BVDA 5EMYA 3VTRA 5BRQA 3EMCA 4UR9A 3OLEA 4D71A 4AIOA 2GVYA 2FGZA 1W1VA 3SCTA 3PZ9A 2YLAA 1UD3A 3B8SA 3WH5A 3CHFA 3OGSA 3VILA 1MQRA 4HPHA 1KXTA 2ZX8A 3VMNA 3QHNA 2WMGA 2VR5A 1BLIA 4AD4A 4JFSA 1HIZA 1BVZA 4L4OA 1UZ4A 3CGTA 1QNRA 4JFTA 1QNQA 2GDUA 1GHRA 1MW1A 2BY1A 4H8HA 2Y24A 1FHLA 1QW9A 2BVTA 1G0CA 1JNEA 3MSDA 3WH8A 1W9UA 4X9YA 5ABHA 4PMRA 1KQZA 3E1F1 4MNMA 1TFVA 1YQ2A 2E9MA 5DF0A 4W8AA 2GDVA 1JFXA 4H8VA 2HVMA 3AXXA 2WNWA 1LF1A 1UKSA 2X09A 3DHUA 4AY1A 4HOXA 1ODUA 2UWFA 5D4YA 2WMFA 3FAWA 5HBFA 3OZOA 3UG3A 4DUWA 1X6NA 3BLPX 2GUYA 1TVNA 1DWAM 1JZ2A 1V3LA 1OM0A 2BY3A 1E5JA 3WH9A 3CUJA 5LA2A 1KWGA 4WF7A 1E4LA 1F4HA 1CXLA 1WO2A 2WMIB 1L8NA 2YL6A 1E6RA 1JNDA 1DWIM 3CZJA 4B9ZA 2PBGA 3WDQA 3APGA 5I78A 4IISA 2XIIA 3MUIA 1JI1A 1QBAA 3AS2A 1QNPA 1E43A 1YHTA 1PX4A 3ZR5A 3TTYA 1LL4A 1Q6FA 1VBRA 2EPNA 4PYSA 4QDMA 4W86A 1E72M 2GJPA 4FLRA 1IT0A 2ZE0A 4PTWA 2VRKA 2OLHA 4W89A 4AD3A 1V3MA 4WKAA 1W32A 5A6MA 1MW3A 5A8MA 1UWUA 3THDA 3VGFA 4AD2A 3SCRA 4UQDA 1VJZA 4OKDA 2CITA 5D8WA 4ZEPA 1PEZA 2JEPA 3WFZA 4ZE5A 1UD5A 3GYCA 1MQQA 4GI8A 1J0HA 4AD1A 3VIJA 3B9DA 1QVBA 1UKPA 2DGAA 4M1RA 4ACYA 3VDCA 1SYTA 4TUFA 2CYGA 3MANA 3CMGA 3MS8A 2G3JA 2Y8KA 4OOZA 2RGLA 5A6BA 4J7RA 4D6CA 3LPGA 3GNPA 1JF5A 4BA0A 3VVGA 3BAJA 7A3HA 1CEOA 1MW2A 1FH8A 4UQAA 1QI3A 1LWHA 2EJ1A 1W9BM 1V6UA 1C7TA 1UQZA 3VOCA 4BQ5A 1BG4A 1XH2A 2JALA 1KR1A 3W25A 4KRTA 2B31A 1OSEA 4GI6A 4WSKA 4W7WA 3LPFA 5CPSA 1OT2A 5GNYA 1JZ3A 4BQ3A 3IJ7A 4IUGA 4CUCA 5E0FA 1UH4A 1V6WA 1ZB5A 2ZXBA 3GXDA 1WE5A 3N13A 3RCNA 1DWJM 3AMLA 4P8WA 3IAPA 3FHAA 2CBUA 1BHGA 1XYZA 3POCA 4CN1A 4W7UA 3WQWA 2JE8A 3L4XA 4QLLA 5E6ZA 2XVPA 3M07A 3BGAA 4B3LA 5I2UA 4DWSB 1V3IA 2XM1A 1C90A 4GO8A 2XWEA 4S3KA 4AXNA 4MB4A 3WMSA 1GW1A 1E0VA 2F61A 1J01A 2WW5A 3WNLA 2V3FA 3KE0A 5I5RA 2V5DA 1J0ZA 4PMXA 2W62A 1H11A 3A3HA 3ZR6A 4R27A 4RE3A 3VDHA 5I0DA 2J7FA 2PWGA 3W28A 1J11A 5E70A 4AIUA 1EIBA 2XHYA 1BTCA 1TE1A 4LPCA 3T09A 4TVCA 1W3HA 3WQ5A 4IPNB 3BXWA 5BXTA 5CGMA 1E6NA 3THCA 1JYNA 4ML4A 1CTNA 2F8QA 1LG2A 1TG7A 4PEEA 1R86A 3DYOA 3T0DA 1UWSA 3VDBA 3CPUA 2AAAA 4F9JA 1TUXA 1VFOA 1MFVA 2E9LA 4JIEA 4D6HA 2CIPA 2ZXQA 1XCWA 4D1JA 4UCFA 3VPLA 1UKQA 1KBKA 2J8FA 1QW8A 2Q8XA 3RM4A 2XVGA 3AXIA 2D20A 4GZIA 1QI4A 1C93A 2VVNA 2WC4A 3FN9A 2TAAA 3GM8A 2OYLA 4UOZA 5ABFB 5IXEA 2AMGA 4PMZA 4J3UA 3WNKA 1DWGM 2ZUSA 2CHNA 3WF3A 4AISA 1JFHA 4WSJA 3RJYA 1BQCA 4AD0A 3MV01 3VO0A 2VQTA 4PMDA 3S6TA 1JZ4A 4U33A 4AW7A 4OUEA 5A6KA 1UH2A 3M7SA 3GZAA 1EHNA 2BFGA 5ABEA 3UETA 1L0PA 1TZ7A 4CGTA 4F8XA 4N0RA 3VU2A 1HN1A 3EBVA 4ACZB 3MUZ1 4EE9A 1ZBKA 1HXJA 5A8QA 1UR8A 3VMOA 3AHTA 1C8YA 4W85A 4U3AA 2FH8A 3N15A 1HKMA 1PJ9A 4H04A 5CZKA 5FOOA 1LLOA 2ZICA 3VGHA 5A1AA 1JDAA 3EDJA 1J10A 2XGIA 3SUTA 4DWSD 3MKKA 1ESWA 4KGJA 1CLVA 1J18A 5EB8A 4FF5A 2FHCA 2XUCA 3T0BA 1XHGA 2A3AA 4CD6A 4CD4A 1R7OA 2Z1SA 3WDIA 1NWUA 3WF1A 1W9PA 2WCSA 1ZJBA 4NRRA 4ZXOA 4B3KA 3AHZA 2V3GA 5CG0A 4W88A 1HT6A 4JKKA 1B3YA 1H2JA 3PHAA 1GJWA 5LA1A 3T2OA 1QI5A 3AJ7A 4QLKA 4ATWA 3VM5A 1JF6A 4TXEA 3W24A 5BROA 1B3ZA 3PN8A 3K8KA 4HPGA 4XV0A 2AOSA 4XUYA 3ZJ7A 3PZOA 1E0WA 2V3EA 5BCAA 2E4TA 1UG6A 2DPEA 2G3MA 1K9TA 4JFUA 3BH4A 5A8NA 4UQBA 1V0LA 1W1YA 1OD0A 2DIEA 1TR1A 2WANA 3RPMA 1UA3A 3WH7A 3S2CA 1LL7A 1UD6A 4W7VA 1M01A 4BS0A 4C7DA 2XFRA 2CCRA 3BC9A 1VENA 2XFYA 1JXKA 2GJXA 4PTMA 2WCGA 1E73M 3IAQA 2VZVA 4H41A 4CVWA 1M7XA 3N1AA 4PTXA 4UFJA 3VDAA 4UFLA 4H7VA 1FH7A 1VJSA 1FFRA 2Y8VA 3GNRA 1GVYA 1BG9A 1E4IA 2ZOXA 2J7BA 2PB1A 1QPKA 1BYDA 3GH7A 3VIKA 5M3WA 3BAYA 1GQJA 5GQBA 1JD9A 1KXQA 1OD8A 3WEMA 4NRSA 2WVUA 4JCMA 4BQ2A 4D72A 3W82A 1MFUA 3WN6A 1CBGA 1J0JA 3VINA 2WVTA 5JBDA 1UOKA 4GPNA 4H8UA 2YA1A 3WELA 3PZIA 1KCKA 2XFFA 2O9TA 1TMQA 3VGBA 4JCLA 3PZGA 3AIUA 4D6JA 2W5FA 1UR1A 4PN2A 1R85A 1OT1A 5JIPA 1V6VA 4GQRA 1BGGA 2QV4A 4A3HA 1XYFA 4Z2IA 2D0GA 3JUGA 1UYQA 1JAKA 2VI0A 1QHZA 5AYBA 3ARRA 3BCFA 1CGTA 2DSWA 3F5KA 1BYBA 2WVVA 3M46A 4J3VA 2PWFA 3EDFA 1KQYA 4OJYA 3VIHA 1LL6A 1W1PA 5FIPA 4EAMA 2IUZA 2EBNA 1UWQA 4M56A 4MAZA 3F4VA 4U5IA 4V28A 2OYKA 1HKIA 3PTQA 4PMOA 1CGXA 3B9AA 1E6QM 2D23A 4MB1A 5A6BD 2VO5A 5A94A 4U2ZA 4HMDA 4PRWA 1ISVA 5JUVA 1V0NA 1OCQA 1SFSA 1SR0A 2J74A 1CXFA 2WC7A 2BHYA 3DC0A 4J27A 4KGLA 3FXYA 1U30A 1HJXA 4A4AA 5CXPA 2UY2A 3W27A 1H4PA 2X0YA 2W92A 4AWEA 1H3GA 2F2HA 3NIYA 3VGEA 3WBAA 1IZJA 1OBAA 4CKQA 4F66A 5KZ6A 3W81A 3HMCA 3BLKA 4OOUA 3ZJKA 4P7RA 3W0KA 5M03A 4AZIA 3GXIA 1FP9A 6TAAA 1JXJA 5CGTA 3VUPA 1J0YA 5IHSA 2VX6A 3MO4A 3OLGA 2BXYA 1TCMA 2VURA 3RILA 3BAXA 2VRJA 1Q6EA 2EPMX 5D9PA 2ZX5A 1H5VA 1CPUA 5IFPA 3WF2A 3N11A 3VIGA 3KEHA 3RJXA 4U3CA 2D2OA 3CHDA 1KFWA 1KGWA 1ZJAA 1CXHA 3U5YA 2VX4A 3AMDA 1KXVA 4E4PA 1Z32X 1H0GA 4YHEA 1HKKA 1V3KA 1E40A 1CIUA 3MU7A 1PBGA 3A6OA 5EFFA 1C3FA 3A4XA 3HJEA 4P7LA 4QCEA 4AZ5A 4JFWA 2XSBA 3PBGA 3AHVA 1HVQA 1WCGA 1AQHA 4P8UA 1DHKA 1QI0A 1QHOA 3TTQA 3K1DA 2XVKA 1K9DA 2ZWZA 1OGBA 3CMJA 4UZUA 1U33A 1B3WA 1TA3A 1NH6A 1LQ0A 3BSGA 3CZEA 1E5NA 1WDQA 4TVUA 3WDPP 3W6LA 3NDYA 3WL0A 3EYPA 2GK1A 4PCSA 3VX0A 2JF6A 2WWDA 3TA9A 1AMYA 3WEZA 2DH3A 5FL0A 2OWCA 1V6YA 1UUQA 4HZ8A 4GXPA 2X05A 3WD1A 1UKOA 3ARSA 4PMVA 3NCOA 3T2QA 1JZ7A 5CJ5A 1VAHA 1E6SM 1NOWA 3WMCA 3ECQA 3AISA 4B9YA 1KCLA 1RP9A 2OSYA 4D6GA 1M03A 4OZOA 2WWCA 1OGSA 1XSJA 3EDDA 2D3LA 4P7NA 1P6WA 3AICA 1SMDA 3VIFA 4EKJA 2C8NA 1BYAA 2BVYA 2FH6A 1HL9A 2E0PA 3I3DA 4W84A 5LA0A 1FHDA 3BAIA 1W1TA 2VTFA 2G4FA 4UQCA 3SCVA 1I1XA 1VBUA 3RM9A 1GNXA 3GNOA 1UR0A 1OINA 3U5UA 4U2YA 1GOIA 2WM0A 2YBTA 1EQPA 5GNXA 2XVNA 4NI3A 1PAMA 1EDQA 1R8LA 5CQ1A 1UR4A 4UFIA 2DT2A 1B2YA 4PSPA 2GJXB 1ISXA 3AMGA 2VNCA 3ZQ9A 4TTGA 1JIBA 2VQUA 2ZXAA 3AQUA 2QHAA 3OIHA 1X6LA 3GH5A 3O6AA 2PC8A 1B1YA 1VIWA 2C7FA 4DM2A 2D22A 5ABGA 1W3LA 2V5CA 3EDEA 1R87A 5A2BA 1HKJA 4MADA 4CVUA 1SMAA 1DEDA 1EDTA 1E70M 3GDBA 4MB5A 1ZL1A 3QR3A 3FY1A 4CN4A 3W38A 2VZTA 2J4GA 4PSRA 3WFLA 5A6AA 2O9OA 3OB8A 4MNJA 1XCXA 1E9LA 2V3DA 3O2LA 3W37A 2WAGA 3CUIA 3WDJA 2WYSA 1W9DM 3CZKA 1RH9A 5HDRA 3AIBA 2EPKX 1DWFM 2UY3A 4RE2A 2BNJA 1NOUA 5HNNA 2W66A 1V02E 4S3JA 4RE4A 2VCAA 2J77A 4OBRA 4M80A 3ZT7A 3ZJ6A 1V3JA 1XSIA 5FL1A 1MVYA 3K4DA 1ITCA 3WF0A 2NT1A 2WHJA 4LYRA 4Z2LA 3SEPA 1CNVA 2CBJA 1GOOA 3AIVA 1B0IA 3SCQA 3ARXA 2WLZA 1WDSA 3SCSA 1W2VA
chains in the Genus database with same CATH superfamily
3KVMA 1X1ZA 3PF3A 2AKMA 3KUMA 4H6RA 4WJXA 3MBFA 3ZR4A 1RD5A 4UNIA 1VYPX 3N9RA 2J62A 3GNXA 2ANUA 1TYGA 3NQDA 1G5AA 1HJWA 4AZHA 3H8AA 3KZPA 2WZIA 3ZWTA 3OGVA 4XQ6A 3WUEA 4R3UA 3SIMA 1SO6A 2G95A 4UTWC 2VR2A 1R9XA 4QTGA 1P48A 1Q6QA 3URNA 5D2VA 4MLJA 3CZGA 3HO8A 3FLUA 1HW6A 5CPTA 3WJWA 2YBUA 3LGGA 1UMLA 1QPOA 1M5WA 1LQ2A 4WKFA 4U10A 3MQTA 4LVBA 3G6MA 3SCNA 1ISWA 2DT3A 1QI2A 2XYLA 1Q6DA 3CQHA 4KQNA 2ISFA 2ZYFA 2A7RA 3ES8A 3R6IA 4JTSA 1S2TA 2XZ9A 1YIXA 4ZO9A 3SSZA 4NAEB 5F1VA 4IPLA 3M41A 1EO5A 1JULA 1SQ7A 1VBJA 4FLOA 3BGJA 3I3EA 4US6A 3G3MA 3TONA 4ADUA 2FGLA 4FX6M 4OBTA 3NQMA 1UUOA 1XIDA 3QV9A 3KVKA 1K7EA 1E0UA 3ZZ1A 3KBNA 1NEYA 3I10A 3QMRA 2D0FA 3HURA 5AHIA 2PWEA 4GGBA 3QHOA 4P7OA 5IHRA 2R94A 4LV4A 2V82A 2X2YA 2P3EA 1YTKA 3OODA 3SUWA 1EA9C 1HZYA 3IARA 5E0CA 1GJPA 4FS9A 2QGHA 4O4WA 3LQGA 5A2CA 2DDXA 4IQEA 1Z69A 5I23A 3W87A 4D6EA 2GVEA 3WBEA 4ZOCA 4PE8A 4S3DA 1US3A 1M9HA 4IP4A 3W1NA 2VJXA 3THQA 5BNKA 2Y7GA 2AGKA 1XYAA 3VABA 3AHYA 1H7NA 2QCNA 2WZEA 4FXRA 4BR1A 4DUXA 4MKVA 4L4PA 4WRHA 4ASTA 4LS2A 4JL1A 4CCEA 5A6SA 4C6KA 1FP8A 1WAWA 1J96A 5EBAA 1P5BA 3P82A 4I5XA 3H4GA 3WD3A 2R24A 4LUIA 1OFRA 4XD4A 5GJMA 3TU9A 5J5DA 4QX4A 1WDPA 2FQIA 3AMKA 4F79A 4XX6A 2Y4SA 5CSRA 4E8DA 5CPQA 1EJRC 3DDMA 1RLCL 4FOJA 3MWCA 2VVSA 3L0GA 2HS8A 2Z1WA 5H6HA 3KHJA 1TWIA 2CHOA 4WGXA 2O9PA 3NSNA 4KCTA 3BG5A 3UR5A 1TPEA 4LX4A 1BYCA 4P61A 5HNRA 4O1FA 3II1A 2ZUVA 1GVFA 3PFRA 5E0KA 1LRQA 3BAWA 4M82A 5DCDA 2G8ZA 4CD5A 1N82A 4EAYA 3WG6A 1XUUA 8A3HA 1MZHA 3OLIA 3WQ6A 2V2DA 2GOKA 1Q85A 1PCWA 2J79A 3OZYA 2DVXA 5E6YA 3EOLA 2Z2UA 1ML1A 2WVSA 4U5KA 3OA5A 2PF8A 4H9UA 1TPB1 4F40A 1R30A 2BGSA 3TSDA 2JIEA 3EWWA 2VGBA 4HN4A 4YTUA 4OGZA 1V0KA 3VC6A 5GPRA 4TOQA 1JI2A 2NT0A 3CO8A 2CBIA 3C2FA 4WX2A 4AF0B 3IK2A 4NZCA 3ARTA 4E3VA 3GQYA 3GDKA 3R79A 1V93A 4GCAA 1DHPA 2YFNA 1JPDX 3QH2A 1Z42A 3N18A 1ZP4A 3TYEA 4BJHA 1V02A 3W7OA 1O95A 4WLCA 2XVLA 2PRHA 4LALA 1WV2A 3EPOA 2WSPA 3UPWA 3RMJA 3KRSA 4XISA 2D0HA 3ATYA 3C3UA 3B9OA 4B16A 3IANA 1E3ZA 1KTCA 2YZRA 1BXBA 3CLWA 3OIXA 2ISWA 5I02A 5CBBA 4HYRA 3C0LA 2O7QA 2WK2A 3E5PA 4XAZA 3T05A 3UVAA 2WM1A 1OG0A 2I17A 3GZ3A 1VFUA 2YB4A 4RW3A 2VCBA 3UJFA 2ZZ2A 2FPYA 3V1PA 2EKGA 5CSSA 3U57A 5C2GA 2YL9A 1Q8AA 4C7GA 3UPMA 3F5JA 1XG3A 4QP0A 4N42A 4BHYA 4HU0A 1QFEA 1EO7A 1WDDA 1QWKA 3VOJA 1VH7A 5H8UA 2HROA 4AEOA 1RK5A 3DKLA 4YJ5A 4GZJA 4BI6A 2OXNA 3DN5A 1FX6A 1B4KA 3RO8A 1KFEA 3SSJA 2V2HA 1K9EA 1O12A 1TTJA 5T9CE 1ME7A 4OECA 1OF8A 5FF7A 4HQVA 2PCQA 4LXFA 4Z2JA 2YA0A 4GYKA 2JGQA 3QHMA 4PMUA 4B5WA 3VOGA 3WH6A 4HA1A 4MFDA 2XFWA 1JJKA 1H5YA 2ZDRA 4NU7A 4YWIA 1K9FA 3UR2A 2DIJA 3OU8A 1AW1A 2J8GA 4Y9MA 2C1HA 2VEPA 3W26A 1JUEA 3CB3A 3GUWA 3VNYA 1F76A 4G1NA 3GLCA 3OEXA 4M81A 3QPZA 4CD8A 2VX5A 3VA8A 5LIWX 3CTTA 1OX4B 1P1MA 3LHVA 2J47A 1XH1A 1AD1A 2B7NA 4DF0A 1AODA 1PIIA 8XIAA 2OX1A 2ISSA 1VQTA 3QC0A 5EKYA 2VC9A 4WOQA 5TNVA 3HPFA 4K8HA 4KCUA 3EPNA 1EDGA 1QO5A 1RQHA 3N04A 4QG8A 4OE7A 1O4UA 1N8FA 2PBOA 1G9HA 4Q4SA 4V1XA 5D9MA 2ZZ3A 1ZZMA 3LHZA 1TSIA 1KC7A 1JCXA 5FCZA 1HNYA 2YKKA 1TKKA 3U4AA 4P7QA 3EEZA 1D3GA 1BFNA 3DOPA 2IPWA 3RGTA 3U7VA 1EEXA 1DBTA 1CGWA 5JH1A 5C54A 3NL6A 5FJRA 3TFCA 1E55A 2B7PA 1WPCA 1GOWA 2XPKA 3CYVA 1Q6RA 1V08A 2DUXA 3B03A 4GLEA 1OFAA 1UWIA 4WKHA 4Q7IA 4JPGA 4RK8A 2QKFA 2NQ9A 3DYMA 1ICSA 1UD4A 4M6VA 1Z6KA 1ISZA 4DJEA 1Y5XA 2PWUA 3LQLA 4BWLC 2AKZA 2FB3A 4FXJA 4HU8A 4IHCA 3E9AA 2ZA1A 1I1WA 3NPVA 2ADAA 3AC0A 2XG9A 3KDOA 3W1PA 3KBVA 4Y9NA 1JZ5A 4ATDA 3HFYA 4QBXA 3SIZA 1VF8A 4Q22A 4HMEA 2WNQA 1A80A 4D6IA 2ZUNA 4OHQA 5A5WA 1Q6GA 1LOQA 4IM4A 2WMJA 2X1IA 2IMRA 3AYSA 1B3VA 1PYFA 1UR2A 3P81A 5F1UA 3WUGA 3TX9A 3NSMA 4C6MA 2VZUA 1D2KA 3TLQA 2I14A 1HJQA 1W9XA 1AQ0A 1DQUA 2EG8A 4MLRA 1XLDA 2I1OA 1HJSA 4AIEA 3DI0A 7PTDA 2GWGA 3GYEA 3GR8A 1JVNA 4MZ1A 2WMIA 2HCVA 4TVDA 3WX7A 4JICA 2F2KA 3STEA 2HQAA 4CQ8A 5A6JA 1ZTVA 5EYWA 4J3WA 1FDZA 4NZ4A 2B4GA 3OZMA 1UWAA 1HL8A 1EQCA 1K4HA 4RV8A 2QS8A 4I9MA 2R1KA 5FJOA 3W7QA 1BVNP 3DHPA 4G7EA 2ZUTA 1OGGA 1KLZA 5ECVA 4DBDA 1SVDA 2EAWA 1W1ZA 3COTA 1LUCB 3FW6A 4RJEA 4AZBA 3OHIA 1TWZA 4GC3A 7XIMA 1NOFA 4DEFA 3W86A 3KVLA 1F3EA 3UGRA 2ACRA 4JTJA 3WD0A 1ITQA 3QC3A 1A5AA 4KF1A 5DT5A 3S1UA 3P14A 2O9RA 3PJUA 2WHLA 4UFHA 4C91A 1B30A 1MQPA 3CUFA 1UWTA 4GA8A 1IR1A 4JL2A 2XGZA 2ZXDA 3HG5A 3ZMRA 4XBSA 3QV6A 1SFJA 1KNWA 5F4XA 2GOUA 2A85A 3NQ8A 1I2PA 1WZAA 4IT1A 2JKEA 4ZE4A 2OMAA 1IXQA 3KBMA 3W23A 4DQWA 3NEVA 3RRAA 1QUMA 4TQTA 1QHPA 1UJPA 4ZSTA 2VGIA 1KCXA 4NAFB 2XM2A 1E6XM 4IP7A 1O5XA 1E56A 1EP1A 4WDUA 3UG5A 6A3HA 4XG1A 4RUBA 1JPIA 2HVNA 1V6TA 1KBJA 3I65A 4KKXA 4E3TA 4GI9A 1MXGA 4MJ4A 4LAZA 4NZJA 2PI6A 1KM6A 2QQ6A 2E68A 2ABBA 5C9ZA 4JN7A 4OQVA 5J04A 4QLJA 1EOMA 4UTTA 3IVUA 2A79A 2QUTA 3CT2A 1FOBA 2KZHA 1WAUA 3TXZA 3B3DA 4CQCA 4GVFA 3MUXA 2ZUWA 4UTJA 4YHGA 3QQ1A 3O05A 2OPJA 4WK9A 3DECA 4ZO7A 1IE7C 3R2GA 4NP7A 1CGUA 4W5UA 2DT1A 2OT1A 3V75A 3ARWA 3U2EA 4I9AA 2PSNA 1RCQA 4AG0A 4O0ZA 3H12A 1NDWA 3H7VA 4KFNA 3EOEA 1QMLA 3MJYA 3ZIZA 1CGVA 2PDUA 4N7QA 1LWJA 2DT0A 1CZ1A 3USBA 5AY7A 2A6NA 3CIVA 4RPQA 3P3BA 4R85A 4NJGA 3V7PA 4MG4A 3TQPA 3LHYA 1WDRA 3VOHA 3CQJA 3TLLA 1K3UA 3W53A 4QQUA 3AOFA 5DMYA 2R82A 3M47A 1SW7A 1V0MA 5DT7A 2ZX9A 4B5SA 3TOYA 4C90A 1X7IA 3IJ9A 3AS3A 1D3HA 3MMUA 1FCUA 4L5ZA 3W7DA 4LJ3A 3KLKA 2VCCA 2X0HA 3BCJA 3KOFA 1Q63A 2IXVA 4R53A 4L1GA 3O9NA 3GK0A 2FLIA 4ERGA 2D3NA 1PO9A 5K9XA 3CUXA 1W0MA 3I4KA 2OG9A 5FA5A 2H90A 3L5AA 3M5VA 4EP8C 1SW3A 4GJIA 1SJAA 4JIQA 3AWNA 2HBVA 3R0DA 3CO4A 5HOSA 3UWVA 4ZENA 3GBEA 1LT7A 2Z26A 4UCGA 4M29A 1RZMA 2XH7A 4O18A 2VHLA 1NQ6A 5HWNA 4JYFA 3RPTA 1XIHA 3LNPA 4H3DA 1VFSA 3VNKA 1YDYA 4INFA 5BXSA 5CPOA 3AMCA 3P8IA 2QIIA 1J4EA 1DIDA 2VDGA 4S38A 3FDKA 4MWAB 2GGHA 4IJCA 3UCQA 1GJUA 3VX1A 1DYSA 4QS6A 5DN1A 3OBKA 3PBWA 2E5CA 1RQBA 2BVDA 4PUWA 4MF4A 1YW1A 4X61A 2ZRXA 1LLZA 4AIOA 2NQZA 3HFTA 4HT3A 3W84A 1G4EA 3CQIA 1NDZA 3ABXA 4HPHA 2ZX8A 2F9RA 2WMGA 3F4NA 3TAKA 3DFOA 5ENLA 1RBLA 4YTQA 1AJ2A 3QM3A 3UNDA 3CGTA 3R1ZA 4JFTA 4AUBA 3E38A 2PTXA 4JIIX 2O56A 3P93A 6XIMA 1OF6A 1FHLA 4KETA 3LCIA 1G0CA 2Y8UA 4O52A 3CQ0A 2IQTA 4MOZA 1W9UA 4X9YA 1FWTA 1FTXA 2W0UA 2WNWA 4Q4PA 1G4PA 2X09A 3BOFA 3WJYA 4DZ5A 1ODUA 5D4YA 1PS9A 1IEXA 1VCGA 3UG3A 4HHMA 2H3BA 1FXPA 3KTXA 3P5YA 2A4AA 5DCBA 1DWAM 1V3LA 3GB6A 2BY3A 1E5JA 9XIAA 1DIEA 3HG2A 3O15A 1G4TA 3WDQA 2XIIA 1J2BA 1QRQA 1E43A 3AYTA 3TTYA 1LL4A 1Q6FA 5GJNA 3MY9A 2OODA 4GCXA 5JH2A 3V0SA 2CZ5A 4QDMA 1P0KA 4NASA 5K4XA 3G18A 2OLHA 3E0IA 4A3UA 1DJQA 1TV2A 5HA7A 3B40A 1EZWA 3M5YA 3UXIA 1H60A 1B5TA 4M7SA 3THDA 4RNJA 2FVKA 4UUIA 1RQEA 3T0CA 1S2AA 4JBRA 3GNDA 2CITA 5FSEC 2AL1A 4YTSA 2JEPA 3WFZA 1UD5A 3GYCA 4KWOA 1MQQA 4AHOA 2F38A 4EPKA 4AD1A 4KFOA 5E5CA 3LSBA 2NUWA 3M0XA 4F3HA 3VDCA 5CJNA 2Y8KA 4OOZA 5BZAA 2Z7GA 1NAL1 3G8RA 4J7RA 4D6CA 3GNPA 4GQGA 3VVGA 1F5ZA 3BAJA 2O4MA 3TC7A 7A3HA 1EBGA 4FNRA 1TCDA 1PZ1A 1DJZA 1V6UA 4BQ5A 3NXLA 2DJLA 2JALA 1P4CA 5AC7A 1H7PA 4HZMA 4CNNA 5CPSA 3VOFA 2W27A 4IUGA 3TW7A 3Q4DA 5E0FA 3R25A 3M9YA 4PB4A 1UH4A 4B4HA 2P88A 1B3OA 1QNVA 5C0QA 4JDYA 3AMLA 3MYPA 1XR2A 3IAPA 3R43A 2NWRA 1BRLB 3V5FA 3POCA 4DYJA 4FIQA 1DIOA 1EJ7L 4B3LA 3KHDA 3IUHA 2XM1A 1C90A 3MC5A 4AXNA 4MB4A 2WW5A 3TCSA 3WNLA 3KE0A 1DV7A 1SFTA 3W7JA 1J0ZA 4PMXA 4KCWA 4K8GA 3NA8A 4B5TA 5J5RA 2YCLB 4IMCA 3UT0A 1BSLA 3G1VA 2XIJA 1TE1A 3T09A 2ZRVA 3WQ5A 3N4EA 3BXWA 5AC8A 4AY8A 5BXTA 3ITLA 3W7KA 1JYNA 2R1PA 2REQA 1LG2A 3MPGA 5KZMA 3DYOA 3CPUA 3W1MA 2WQPA 3DENA 3BV7A 1TUXA 1MFVA 4C1NB 3SQSA 1A5MC 4YIWA 2ZXQA 5DX7A 1MO0A 4EF9A 2HEJA 3EXRA 1KFLA 1KBKA 3E2VA 4LEFA 2Q8XA 3HJZA 3WBWA 4Q4KA 5FEPA 4ZA0A 4GZIA 5IXEA 2TAAA 2RDUA 2OYLA 1EP3A 3NGFA 1QK0A 2X1UA 2HPIA 4L1XA 3WQCA 1BQCA 3MSRA 3LCWA 3VO0A 4JTUA 2R8WA 3WO8A 3S6TA 4H4IA 1CI1A 2BVWA 4OUEA 3L23A 4JX4A 3WLMA 5A6KA 3M7SA 3GZAA 1EHNA 4IFRA 4S3BA 2QVNA 4CGTA 4PMJA 2ACQA 5I3HA 4KW2A 3G1HA 1GEHA 1TWSA 2FTWA 4LYKA 3LHTA 2V6AA 3N3TA 1O94A 1R6WA 3M16A 1GYMA 2Z1VA 2LLEA 2ZRWA 1HKMA 1PJ9A 1Y8BA 1I4NA 3TK7A 1LLOA 2I5QA 3NQ7A 4DO5A 2Z00A 3W2UA 1JDAA 3R8RA 3EDJA 3TYBA 1J10A 1H62A 2XIOA 1CLVA 4IP5A 4FF5A 2XUCA 4ZQOA 1PWLA 4CD6A 3O63A 3NQ6A 4GUGA 2OEKA 1W1A1 3ZLGA 1PTAA 5DLCA 3H7RA 2FJUB 2G50A 4B3KA 4NXKA 4JKKA 3PHAA 4B4FA 5LA1A 4IMAA 4QLKA 4JTIA 5BROA 1B3ZA 3RYSA 4XUYA 1TTPA 3PN8A 4XV0A 3RK8A 4BY3A 2PD9A 1E0WA 2DPEA 1K9TA 1R5YA 3WLNA 5D30A 1GYNA 1BWKA 1EP2A 1XLMA 1S38A 3SW6A 3T07A 2YR1A 3DZ1A 3S2CA 4FR6A 3DHFA 4Z1AA 4OWGA 1Y0EA 4G7FA 1TWWA 3ISIX 4A3QA 4BS0A 1A4MA 2XFRA 2CCRA 3BC9A 2XFYA 5C2XA 3M0JA 3NM3A 3T4WA 4DJED 5D2WA 3DC8A 4ZTXA 1IIGA 2RKXA 1W8SA 1E1CB 4BK9A 3MB9A 4M51A 4NHVA 2Y8VA 2ZOXA 3PPCA 4WDXA 1DJWA 4LUTB 3M0ZA 4D9PA 4MKSA 2DIKA 3WK3A 3BG3A 3EX2A 3B0VC 2R91A 4WSHA 1OEPA 3CC1A 2P76A 3E0WA 1OX5A 1EIXA 3NPWA 1US0A 5AFDA 2WVTA 1F07A 5JBDA 1XDLA 2OKTA 2YA1A 3PZIA 4HCDA 2PA6A 4BF9A 3U2ZA 3RX3A 2O9TA 1SM9A 5I00A 1REQA 3S8HA 3JVAA 5JIPA 1T96A 3CV1A 2D0GA 4BKNA 5HUPA 6PTDA 4ICCX 2VI0A 4RDWA 1CGTA 2FYMA 3LXAA 3GVQA 1VFTA 4J3VA 3LRLA 4PTNA 4R88A 1FDYA 3BGGA 1HO1A 3S83A 3NQEA 3K1GA 1RHCA 2OZ0A 4F2BA 4V28A 3ID7A 4C65A 4EPEC 3PTQA 3GKAA 1CGXA 3W3OA 5A6BD 2VO5A 4NY2A 5A94A 4HMDA 1PZ0A 4C5ZA 1SR0A 4TO8A 2J74A 4UC5A 4ZMGA 1CXFA 2WC7A 3W22A 4J27A 4KGLA 1SSDA 3EOSA 4IIEA 1U30A 3HB9A 3ITVA 1FWAC 1KO0A 4L56A 1WUEA 2NQLA 3W27A 3N2BA 1H4PA 2VKZG 1CLKA 2QNEA 2R1NA 1H3GA 5DMLA 2CLKA 1KRCC 3VGEA 4L4MA 1VPYA 4CQBA 3M5XA 4FNQA 3BL3A 1W1IE 3ZJKA 1GKQA 1EEPA 1S5WA 3C4UA 5JMUA 4QQ3A 5CGTA 2C19A 3VKDA 1TCMA 2BDQA 4F0MA 2VURA 3PWAA 1O68A 3BAXA 2EPMX 1AJ0A 4PUKA 1AW5A 1O5KA 3LTYA 4RZ4A 4G56A 1G7VA 3WF2A 3N11A 1YXYA 3KEHA 4ZQRA 1LM1A 4DLFA 3UZYA 3ZXWA 4O13A 1EJUC 1SZFA 2Y88A 2VX4A 5FEZA 3AMDA 3T81A 4E4PA 2NX3A 2V5BA 3LV5A 3MU7A 3FOKA 3VUSA 5EFFA 3ITCA 1V7AA 4AZ5A 4QCEA 3G24A 1BVWA 2PZNA 1JUKA 3QXBA 1A3WA 1RAKA 3SJ3A 1GT8A 1QI0A 1QHOA 4FNUA 1U1JA 5H1WA 4ZGYA 2Z2AA 2PDFA 1U33A 1S3HA 1B3WA 1TA3A 5TF0A 5CCZA 3GRIA 4GIEA 3CZEA 2PU1A 3I7SA 4UR8A 3WDPP 3EYPA 4QE5A 1VLWA 5DY2A 4PCSA 3D3FA 1EB3A 5G1MA 2R1MA 1H7WA 5D33A 4IIGA 1R46A 4GXPA 4YWSA 3PJTA 1FXQA 1ZHAA 4XUGA 1MI3A 2VDIA 3T2QA 1JZ7A 4GXWA 5CJ5A 4O16A 4B9YA 1AUSL 1RP9A 3GU1A 4D6GA 1M03A 4NT0A 2BMBA 3UWZA 4ZQPA 3FKKA 1OGSA 4EWJA 1OG6A 3LRMA 1BYAA 1HL9A 2E0PA 4IFKB 1FHDA 3N25A 3VI2A 3WLLA 2VTFA 4UQCA 3SCVA 1B4EA 1GNXA 5HWJA 3NZQA 3SAZA 2YCEA 1EQPA 3B97A 3ELFA 4F2TA 5CQ1A 5CBJA 1JQXA 5GJPA 3T0TA 4DBEA 3H7UA 2G37A 3W07A 3I4EA 3ZQ9A 1FCQA 3RLUA 4DI9A 3RRXA 3AQUA 4A29A 2QHAA 3OIHA 2PGEA 1SO5A 1XDMA 2VEMA 3GH5A 1LTDA 1ECQA 1B1YA 3RITA 2YX0A 4S2BA 2C7FA 4DM2A 3QKEA 3KTSA 3R4IA 4C6EA 3GTHA 1EWEA 1R87A 5A2BA 3W2MA 4MADA 4NAEA 2IQDA 2OT0A 1DEDA 4QNWA 2VFEA 1MEIA 3RHGA 2GGJA 1IXNA 3DG6A 2DZWA 5FAGA 4NILA 1ZL1A 2F84A 3QR3A 4M1BA 4RNFA 4ZB2A 3QW3A 1P0NA 4NNCA 4PSRA 5A6AA 2O9OA 3FJ4A 3C8FA 1RUSA 4RDYA 1XCXA 2V3DA 3QFWA 1XL9A 2VEGA 4JEQA 5JXQA 1S2VA 5H8PA 1W9DM 1Z44A 1F73A 2EPKX 1LP6A 4OUIA 1YNQA 4RE2A 2BNJA 2YB1A 4YL2A 1GW9A 2Y7EA 4LBSA 3LZ5A 2YCJA 3E0FA 2ICSA 4M80A 4QITA 2CLFA 1V3JA 4ROQA 1MVYA 4PULA 3CYJA 1ITCA 3WF0A 2NT1A 5LIYX 1CNVA 4JTGA 2CBJA 4UMAA 7REQB 4WUIA 1GOOA 1B0IA 3SCQA 1MMFA 3FYOA 1N8IA 4R9OA 3PNUA 1JEZA 1QOXA 1ADSA 4EACA 1FWRA 1B9BA 4BQ4A 1OC6A 1Z41A 4A6GA 3WL1A 1ZCCA 2HWGA 3LZ3A 1WNOA 5DMNA 1UBPC 4ADSA 1VP5A 1HVXA 2V30A 3WD4A 4GKLA 1L6GA 5HXMA 1LG1A 3GR4A 3CHEA 5K7JA 3PZMA 1UKTA 3DYPA 3NO5A 3UEQA 2ALDA 1J8VA 1TV8A 4KWUA 3ZLFA 3LCFA 1C91A 4IQDA 3WLOA 2B7QA 3L0KA 2WMHA 1PDYA 2DEPA 4IICA 3IVTA 4LC6A 4PUEA 2Y0FA 3EX1A 4AU0A 3VKKA 1M68A 4XB3A 3STCA 3UP8A 4Z1BA 5I6SA 3N29A 3YPIA 4Z2GA 1YPIA 4PCTA 2PUZA 3VMPA 4LFYA 1C8VA 5EMKA 4TMBA 1TJ1A 1WX0A 1J79A 1H7XA 1TVPA 1NWSA 1W3JA 3N34A 3EWBX 3PSVA 4M24A 1V8EA 3UESA 3LBMA 4B5VA 1QO2A 2Y61A 4O15A 1HQTA 4L7ZA 1ZBVA 4B92A 1KLYA 2I57A 2X1SA 3UBPC 2J66A 5FAJA 1C8XA 2H9AB 1UD8A 1XQKA 4S3CA 3M0KA 1L9WA 3O1NA 1YNPA 4IFKA 3GX9A 1UPMB 4GNKB 4UQEA 2VRQA 1DJNA 4U31A 4AZGA 4DAFA 1PUDA 2NXGA 2GSEA 4GVHA 1ZNNA 3PBVA 5AKQA 4KMQA 4DNHA 3OW1A 1E1EA 1C92A 3BQ6A 3SR7A 3ERPA 5M5DA 4B15A 4FP1A 4QJ1A 2Y5SA 3KL3A 3AXHA 3HPXA 4JQ2A 3LPOA 2DFAA 1M7PA 5C71A 2FFIA 4LGXA 5BXPA 4KWSA 2JEQA 4H01A 4ACZA 1KR0A 4HHLA 1PTGA 2JBMA 3MKCA 3FCPA 3TN6A 4GK8A 1DWHM 2FHBA 2E8ZA 3VKJA 1XG4A 4BWLA 4Q6XA 2QLYA 3STFA 1J6OA 4AEEA 1XRSA 3A3XA 1W91A 1W3TA 2WHMA 2A3BA 4GZEA 4IIHA 5AC4A 3GUGA 4MY1A 3SUUA 2CBVA 4K3ZA 2VZSA 3B9NA 5HMEA 1CDGA 4HA0A 2QT3A 3IIXA 1LBFA 4C7FA 3LLXA 1AFSA 4D8ZA 1YTDA 3LSCA 3SRHA 1KBBA 3MYOA 2VD9A 2EO7A 4AFYA 4PMNA 1R3QA 2NQ5A 2CZFA 3PY2A 4HA4A 4ICNA 1BTMA 4BEQA 2WPGA 2BY2A 3ZYZA 3WJZA 5A69A 1CT5A 3UYIA 2G3IA 4X60A 1C7SA 3MUY1 2ZFAA 4H2CA 4HD5A 3K4WA 4Y6GA 4XZNX 1EX5A 3WD2A 4PUDA 2TSYA 1NARA 3ABQA 4HGXA 3DBNA 3CQKA 1ZAIA 4X0VA 3PTDA 4S3AA 4X63A 1BXNA 2V5KA 2C6QA 1R9YA 3CUGA 4AHPA 2DZUA 1SJDA 3GDMA 2FTYA 2V38A 1SW0A 2EKCA 1A5UA 3VXGA 5I77A 2VL4A 4JD4A 4DNMA 1O7AA 1MEHA 3UZZA 5JVLA 5LYRA 3TTOA 4KRUA 3KOZA 5DEZA 4GZ7A 3PB2A 4PFMA 5A3HA 1JL8A 2WNZA 2RDTA 5CSUA 1EC7A 2QDHA 1J0KA 4XZLX 2A3LA 3B06A 3DBPA 1AG1O 1A47A 3WDRA 4QFUA 1VFFA 1JDCA 4DN1A 4J3ZA 4NXSA 1TVLA 3GH4A 4GQ0A 1YMYA 3ANVA 3AJXA 1QTWA 1MW0A 4GD0A 3OVGA 4OBSA 4AYSA 2YA2A 3EX6A 1UZ1A 1B3XA 3CZLA 1XSKA 1A5LC 4J28A 3WLQA 5A6LA 2BX7A 3DFHA 5A95A 1TO3A 3K46A 3NQFA 3B9EA 2WSRA 3BANA 2BXVA 3VKCA 4PCFA 3NOEA 1PKLA 2PDKA 2QUUA 4HZ6A 5AC5A 2BSLA 6CGTA 1ZPTA 4R7OA 4M6QA 2ZTKA 1LWIA 6ALDA 3VIOA 3OA3A 3QYSA 2WB5A 3K5XA 1XIJA 1GG0A 4KRZA 4D8LA 1J9YA 3NPXA 4BF7A 3QZAA 4K68A 3AALA 1SR9A 4LC8A 3WYZA 1X39A 2BXZA 2E8YA 1QAPA 2CNCA 1NWRA 3DFPA 1M1BA 4GIYA 1J5SA 4NF7A 4ZQCA 1K8ZA 1H09A 3CEUA 3W7CA 3NXFA 3C8NA 1ONWA 4YMZA 2ZTJA 4ZB0A 7TIMA 3UJEA 4UTFA 3PZQA 1JCTA 1E71M 1GCYA 2WKGA 2YJQA 5HQLA 2I5GA 2FVLA 3ZJ8A 1PZ3A 4ZTYA 2XDFA 1EC8A 3D3AA 2D24A 4KEMA 1ICQA 4XKMA 3WQ4A 3N14A 2ZA2A 4LUSA 5LIUX 1V51A 2G96A 2D69A 1UC5A 4IPIA 3L4UA 1DXFA 1PX8A 1YLVA 4MNKA 4HN8A 3O16A 4HMCA 2W67A 2BOGX 3TKFA 3QPEA 1GONA 3KBWA 4GFIA 3MCNA 3V0TA 4JX6A 3H2OA 4C6CA 2XZ7A 1EGZA 2VFHA 1SO3A 5CSYA 4ZXLA 2INEA 4Q8PA 2G41A 4HPNA 3L2LA 2QXWA 4PL1A 3ORWA 3T40A 2Z1KA 1KFJA 4IX2A 4AVOA 3SGGA 1VLIA 3KCOA 1P0DA 1GTHA 3CV7A 3VM7A 3QEZA 3WLIA 4AMCA 4JAWA 4C1KA 3BAKA 3TOPA 2D1ZA 1PTDA 1S1PA 4JNMA 4REQB 4FB7A 3N19B 1HG3A 4FOUA 1YDNA 1FFQA 3PWIA 2DQXA 1VEPA 1OK6A 1QNOA 1MYRA 3L4ZA 3C52A 3OVRA 4I5UA 4IMEA 4AH7A 1JAEA 2ZCGA 4NQ1A 2JFEX 1GVOA 4DELA 3R5EA 4O53A 2OJPA 1E4NA 1NM9A 4PBFA 1XH0A 3O6DA 1XD0A 3S6OA 3IIOA 3UD6A 7ENLA 2BV9A 4JTTA 4Y7EA 4EIVA 5G5IA 3QFEA 3GFZA 4US5D 1OY0A 4E2OA 2ZZ6A 1OJXA 1MXDA 5PTDA 5JU6A 5CZTA 4QSFA 3LNMA 3AHXA 4MIMA 1MSSA 2V5LA 1PIFA 2XWDA 2X7VA 2HBXA 2E9BA 3A23A 1H7OA 5I3JA 1GK8A 5FF4A 1I8JA 2TMDA 2ZZ5A 3QOMA 2NV1A 2HXTA 2GLKA 2QYGA 5E1QA 3U6WA 4MYAA 3LK6A 1V03A 1WZLA 2BY0A 2QVHA 2HE5A 3NZRA 5A8PA 3LI0A 1XISA 1DP0A 1UR9A 3GS6A 4OVXA 2AL2B 2WKLA 1Y7VA 4N9DA 3VIIA 3USZA 1ZBWA 3EX3A 4H8NA 3ONBA 5GVJA 4Q8NA 4AC7C 3UR7A 2REQB 4O54A 4J9JA 1A5OC 4LVDA 1V3HA 1TPH1 3EMQA 1UP3A 3UJSA 4GG9A 3MMDA 1UCWA 4GY7A 2YGYA 3HOJA 2IPJA 2WVVB 1W5NA 2WZTA 1WKDA 4PR4A 2I9UA 4LUSB 3D5HA 5I79A 2QCGA 1KB3A 5D9NA 4ZQMA 2FKPA 3RLHA 2EXOA 3TAOA 4K37A 4NSBA 3STPA 3C2RA 2UY5A 3MW7A 4RXGA 3VD9A 2P8CA 2Z4GA 4WXZA 1VFMA 2Z28A 3TSBA 3VD3A 4KERA 1QT1A 3PG8A 2BGQA 3MSYA 1W5MA 1G1YA 1I2RA 2AQOA 2QUNA 1YE4A 4RZ6A 4WY0F 3W2NA 2Q09A 4L6DA 4RCXA 3DEQA 3DG3A 1FA2A 5AYIA 3WBXA 1YYAA 1HJVA 2YCKX 3SQMA 2ZRZA 4GO9A 3XINA 2Y1HA 4IPJA 4JR5A 1XW8A 1VHCA 3UR8A 2Z7KA 5IFTA 4O4VA 3N2TA 4QISA 3PULA 5HATA 3DGBA 1VRXA 3U7BA 4MWAE 1H51A 1DOSA 5FF2A 1IEIA 2GL5A 1TRDA 1AA1B 1L6WA 4W5ZA 4ILSA 1F6KA 2X1TA 4WZHA 5BWAA 1UR3M 2VC5A 4WJ8A 1JCNA 1IZKA 4ZO6A 4JKMA 4QCFA 2ZQ0A 3C0JA 2DORA 3OVPA 3T08A 2W3ZA 3VNIA 1YBQA 3N4FA 4O57A 5LIKX 1GQLA 3BSHA 3L21A 5I03A 2QCMA 1TQXA 5D09A 2D2JA 3OO2A 1XPYA 5TIMA 5H8MA 3QY7A 3SURA 2QCLA 4LH8A 2NW0A 3GSMA 2VFGA 2C3ZA 4UQ9A 4YPJA 3A9BA 4XVDA 3NDOA 2XSAA 3ATZA 4PZVA 4LW7A 1SSGA 2OU4A 4LF2A 2EEXA 5C55A 5TQLA 3SRDA 4A2SA 3HN3A 3EXTA 3LX9A 1O5QA 1HP5A 2QIWA 2JK2A 1U5HA 5IDIA 4EF8A 3VIPA 1S46A 5CPLA 3D0CA 2E6FA 2QCHA 2E3ZA 4TIMA 4FSAA 2QPUA 3AIRA 1KFCA 3BLIA 4F4RA 2OWXA 1GPWA 3EKGA 3A24A 1XD1A 3PZNA 1JZ6A 1S2UA 1Z89A 1Q65A 4N9CA 1WZKA 5CZSA 3SUSA 2XJ7A 1AH3A 3AZRA 3OQ8A 3BW4A 1ONEA 1UUMA 1PSCA 3KL5A 4A8NA 1NFPA 5CKSA 4LAOA 4URIA 1TJ0A 1S5VA 3PR2A 1QNSA 4IFOA 3D46A 2Z2BA 3ABRA 4TTUA 4HZ7A 1M3UA 3WF4A 2X40A 1B9ZA 3AZSA 3VCRA 3DFQA 3NAVA 1RP8A 1ECEA 3BPWA 3BSMA 3OG3A 3OYXA 2PC4A 2GQAA 4GXMA 1PHWA 1IV8A 3PBUA 4FF7A 1BAGA 4FNSA 3REQA 3UFYA 1EUNA 2DW6A 1P7TB 1XLBA 3VD5A 5EMUA 7ODCA 1X8CA 3REQB 1XDJA 3KTCA 1ZU8A 1TV5A 1DKWA 3VTRA 4UR9A 3DI1A 3EMCA 2GVGA 4LF1A 1AZ1A 4J1OA 3LV6A 1IXOA 2PTZA 1ADOA 2BOEX 2ZC1A 5EBUA 3GFYA 3SCTA 4FPSA 1YXCA 3B8SA 3WH5A 4XWUA 3OGSA 5TBOA 1CCWB 2H8ZA 1KXTA 3QHNA 1DIKA 3WK1A 2VR5A 3EGJA 3VCCA 3CAVA 1UZ4A 1QNRA 1OFBA 1QNQA 5LIXX 2GDUA 3FEQA 1KM5A 1GHRA 5BOFA 2BY1A 4I9TA 2RDXA 5IM51 4CQ9A 3T7VA 1FY6A 1EUAA 3MSDA 2DV0A 3WH8A 4A8RA 2PGRA 4PMRA 1OC7A 3W1XA 4C1LA 1ME9A 3SY1A 3NTYA 4H8VA 1S2WA 3AXXA 1AJZA 3LS9A 3LERA 4S1FA 4QAIA 4KWVA 2OKOA 3TC3A 2IPGA 2OEJA 3ABOA 3FAWA 2CZVA 5HBFA 3FSUA 4DUWA 3KRZA 2IKJA 1TVNA 4X3ZA 1XBXA 3ZS4A 1JZ2A 3IRSA 4GISA 3QSTA 3S2LA 2QZRA 2CWXA 5LA2A 1D8WA 3UCCA 4WF7A 5HJXA 3KRUA 3A22A 1JNDA 3PUDA 1VBGA 4NJJA 4B9ZA 4PTDA 4IISA 3A4JA 5LGXA 3NVDA 4QIUA 2QGYA 4K6AA 3VK5A 3ZR5A 4PYSA 1OVDA 2V8ZA 5KTLA 1E72M 1IT0A 3NQ2A 1OABA 2VRKA 2QW5A 3G1AA 4W89A 1V3MA 3F4CA 4IUOA 1W32A 3W2JA 1I60A 1MW3A 2QAPA 4GOAA 3U2CA 1UWUA 3VGFA 2PP3A 4AD2A 2HV5A 1U22A 3W88A 4XAYA 3CNYA 4FHAA 3QKZA 4PRTA 5D8WA 1L6YA 4WHBA 1T8XA 2OZTA 3UJRA 3V5OA 3V1HA 1IT7A 3GIPA 4TUFA 5CC3A 2C0AA 3MS8A 1N2VA 2G3JA 2RGLA 2QCEA 3LPGA 1CB2A 1CEOA 1MW2A 1QI3A 1XKYA 1DJIA 2AMXA 1LWHA 4J5NA 1FWEC 2INZA 3TC6A 2E09A 5DMMA 1KV8A 4GI6A 3TMQA 4Q4OA 5DRCA 3LPFA 5GNYA 1I6NA 5HK4A 3IJ7A 4CUCA 1IT8A 1TPC1 4K38A 1XLHA 3PBMA 1PYMA 3NO3A 4JX5A 3A13A 3C5QA 4NZ5A 3BOXA 3OBEA 2VGFA 1SGJA 4O1BA 3O3RA 4M7TA 1ZAHA 4P8WA 4WDTA 3L0NA 3FHAA 2QDEA 4CN1A 4Q33A 4QLLA 4DLMA 3M07A 3BGAA 4WXYA 5U4NA 1LCOA 4GO8A 4DY1A 5D02A 4S3KA 3EAUA 3IIVA 2B7OA 3QR1A 2V3FA 2VC6A 5I5RA 1XS2A 3RAOA 4QNEA 3TZNA 4R27A 1ZUAX 2X7WA 3IRDA 1GQNA 2H3DA 3GFXA 1BD0A 2PWGA 3W28A 1J11A 5LXXA 1LQAA 4G7EB 1PDZA 4TVCA 1F8IA 4LCQA 2OEMA 4ML4A 3MCOA 3P61A 1TG7A 4PEEA 1R86A 4FAMA 1XLEA 5D37A 2QULA 1XIBA 1FBAA 4F9JA 3PSWA 4G8TA 1UKQA 3IJDA 3QMSA 4C6NA 3UA4A 3JW7A 2XVGA 3UU0A 4LVFA 2ZA3A 3TN3A 2WC4A 4XZMX 4UOZA 4R33A 4G9PA 4PMZA 3WNKA 3H2CA 3QQWA 2ZUSA 2CHNA 1JFHA 4AD0A 2DZXA 1C9DA 3UGVA 4PFHA 3G77A 1BWVA 4YU1A 5AYYA 1UZDA 1JGMA 1W1B1 2QCFA 1L0PA 1TZ7A 2BOFX 3GXTA 4N0RA 1XI3A 3VU2A 2CLPA 1NELA 4ORMA 5FF3A 2YXOA 1ZBKA 4LNYA 4L6HA 3VMOA 3P8JA 3UA3A 3N15A 4H04A 3M44A 2PDQA 5CZKA 3M1ZA 2P8BA 2ZICA 4Z42C 2VD8A 4AB4A 2GGEA 3MKKA 3PJWA 4KGJA 3W1QA 3TN5A 1AH0A 4JTEA 1Q6LA 3T0BA 6ENLA 3T55A 1OYAA 1R7OA 4MSSA 4Q32A 1NWUA 3WF1A 4XAFA 4O14A 1S5NA 1ZJBA 4RXFA 4ZXOA 3V3WA 2V3GA 3CL7A 4JS3A 5LXEA 3FXGA 4W88A 3S2NA 3QLDA 1GJWA 3T2OA 3AJ7A 3IPWA 5HNUA 3VM5A 1AZ2A 3K8KA 3NQCA 5HMFA 4H9ZA 2V3EA 3W7NA 1KTBA 1UG6A 5AN7A 3GHUA 4GUJA 1FWHC 3VYLA 1MUMA 4LOCA 2OO0A 5A8NA 1V0LA 4IJBA 3FSTA 1TR1A 3MZ2A 2WANA 1UA3A 3WLSA 3WH7A 4F0LA 1X96A 3QMTA 1TJPA 3CK5A 1K70A 4LY4A 4QHRA 4LVGA 4IGSA 4IJRA 2C15A 3U9IA 2GJXA 3WLHA 5AHNA 4AYGA 4CVWA 1NFBA 3KFTA 3L9CA 2RFGA 3CWHA 4ZOEA 3N9SA 1FH7A 4NZ3A 1FFRA 3P7YA 4X22A 1BG9A 2HRWA 1QPKA 3GR7A 4Q6JA 4I9JA 4FO4A 5GQBA 1IEQA 3HPZA 1KXQA 5EL1A 3WEMA 3P67A 2PTYA 4I6VA 4ALDA 1GVEA 8XIMA 1R3TA 3ZWSA 4H8UA 2ABAA 2XFFA 1XWYA 1UW9A 2DUZA 3T8LA 3G1DA 4JCLA 3AIUA 2E67A 4D6JA 4BEUA 4JTFA 1BRLA 4PN2A 4RDVA 3U2OA 1V6VA 4GQRA 1BGGA 2QV4A 4A3HA 3QZ6A 4Z2IA 3HGJA 1FWSA 3JUGA 3AUOA 3GHSA 1UYQA 4DF1A 1QHZA 5AYBA 3ARRA 4N2YA 1XLKA 3RLGA 4XSMA 3F5KA 1BYBA 1J5TA 1U5JA 3M46A 3PWGA 4LBRA 5M2FX 1KQYA 3KP0A 4HNOA 3VIHA 1Q8JA 1IQ8A 1FWJC 4GMEA 3P84A 4EAMA 4M6PA 1F7BA 3MMTA 4GNJA 3WJXA 3MWAA 1I45A 1UWQA 4M56A 1KD0A 4U5IA 1XPGA 1UPPA 3F4VA 4F0HA 4PMOA 5AZ1A 2OGJA 2GGGA 1NDVA 4U2ZA 5JUVA 4M0XA 3FJ6A 3MZNA 3SI9A 3FXYA 5A6TC 1JPMA 2RAGA 5LNRA 2CZEA 3IV3A 1HJXA 1OCJA 2VFIA 2PDPA 3EXSA 4GYJA 4Q8WA 5FJUA 1Q6OA 3EOUA 5LZLA 4JIHA 5AHEA 4AWEA 2F2HA 3NIYA 3WBAA 3C2VA 4PB3A 5KZ6A 3M0LA 3BLKA 3O0KA 1YX1A 5EMLA 3GIYA 5LSMA 5M03A 1UB3A 1JXJA 3KLLA 3PPHA 2VX6A 4V1YA 3BJTA 3OLGA 2BXYA 2P53A 5XINA 5LNSA 4C6JA 3S6DA 3N73A 3FX4A 5G1YA 3KXQA 1AK5A 4U3CA 1BWLA 1KFWA 4Z17A 3U5YA 4HYWA 2DVTA 1KXVA 1T0OA 4YHEA 4L9ZA 2PRMA 5AECA 1HKKA 1CIUA 1I2QA 1PBGA 5F4SA 3W9ZA 3IJIA 3FS2A 4H6QA 4I8DA 1WCGA 3RPDA 3W1AA 3W71A 4P8UA 1OK4A 3NFUA 4B5XA 3K1DA 1K9DA 3H4XA 4RR4A 1HUVA 1DE6A 2VFFA 2Z0IA 3H55A 4IG2A 3WL0A 1W5PA 3XISA 4MMWA 1JRCA 2R6OA 4JTLA 5C7VA 3CV2A 5FEWA 5FL0A 3INPA 1UUQA 1FHVA 2XH2A 2E77A 2X05A 1P1XA 4IGMA 1Q13A 3B8UA 3NCOA 1PV8A 3L5LA 4DBWA 1TMLA 4WVXA 3IJQA 4ZOBA 4UIOA 5FJPA 4HPXA 3UWYA 4OZOA 4IQLA 2PDJA 4NJHA 1O1ZA 3AICA 1SU5A 4DJDA 3EKZA 3AXKA 2C8NA 4EKJA 3T9PA 4ZZ9A 2FH6A 1P0EA 2O4QA 4W84A 5HQEA 1Y65A 1HKVA 3ITGA 4L61A 1W1TA 2PEVA 1VBUA 3RM9A 3NM1A 1W3NA 1BEUA 4U2YA 1GOIA 4JYDA 2DU2A 1Z7AA 3HV9A 5GNXA 1MEWA 4NI3A 1QASA 2HS6A 4IGNA 5C9UA 1EDQA 1R8LA 4UFIA 2DT2A 1B2YA 4S3GA 3LXBA 2X30A 4YTRA 2Y62A 3SO7A 3AMGA 3AXMA 3TQKA 3QV7A 1X6LA 3I7QA 2YCLA 2RH9A 4KESA 1PKNA 2V67A 2V5CA 3SRFA 1HKJA 1SMAA 2PAJA 3LGEA 4L1WA 4GGHA 4A3RA 4HSNA 4HNVA 3SJNA 5FESA 4MB5A 2PMQA 2Q01A 2PTDA 3EKLA 2VZTA 3WFLA 2C16A 3W7EA 1F05A 2J9ZA 3KS6A 4LAMA 4NI8A 2ZZ1A 2C18A 3CUIA 3WDJA 3URAA 2UY3A 5HNNA 1XGEA 1Q7MA 1WYIA 2W66A 4S3JA 2ATMA 2VCAA 4QG6A 1RALA 4MFEA 3H4WA 4IIDA 1FWBC 4JDBA 3MP3A 4XO7A 1TX0A 4UTHA 2DZTA 2QV5A 3SEPA 4HHHA 1XRTA 4CCZA 5DANA 3KM8A 1KFBA 1K8CA 5LGZA 2QJJA 4FA3A 4MZYA 4O50A 3PG9A 2O55A 4E0CA 4GX9A 1TELA 1C8QA 3VD4A 1F2JA 1Q2SA 5H2ZA 3LRKA 3EWUA 5LHFA 2OYMA 4F0SA 4LWWA 3CMFA 3T0AA 4DJEC 3NUKA 4LV9A 2WJEA 3CXOA 3O06A 3HU7A 5DXYA 3BO9A 1FDJA 3S42A 1W3KA 3L4WA 1AL8A 2X0SA 3TSMA 2BHZA 3OG2A 1D7KA 2J7CA 4OV4A 3DHDA 5D04C 4XKYA 1M04A 3BLLA 3W75A 3AAMA 2O0TA 3SCOA 2ZUMA 2QJNA 1ZAJA 4LYPA 4UZSA 4MTVA 3QGVA 3DUGA 4EANA 3FEMA 1D9EA 3G1RA 3HGRA 3W1LA 4UTIA 1ONXA 3KW3A 4WEVX 3U48A 2GSHA 2GFTA 1IWPA 3W83A 1JDFA 1GEQA 3CWOX 4LCSA 2WSYA 1F8MA 3L67A 4A8IA 3GDTA 3P60A 4MZ8A 4GJJA 4O1DA 4E2VA 5HUOA 1QK2A 3AIWA 1H50A 4Z1DA 1LBLA 2BG5A 4NJKA 3N17A 1HJUA 1F9CA 2ATSA 4S2CA 4I5RA 1GPFA 1PB0A 5F2GA 4XO6A 1WBHA 2X42A 3TTEA 1TB3A 3P80A 4ZCWA 4N6FA 1TV7A 1KM2A 2DH2A 1AL7A 3EWXA 3GC2A 1ITXA 3M0MA 4MJ2A 2OSWA 2XN1A 5I3GA 4ZB5A 3NYDA 3RMEA 5HR6A 2A3HA 4J2PA 4HCLA 2WKJA 3L4TA 4LUYA 3SCUA 4QE1A 4NG3A 2CKSA 3WNOA 1TWDA 3A4WA 5A8OA 1WZMA 2RJGA 4PCPA 2WZHA 3KX6A 4H9TA 2WV8A 4V15A 4ZFMA 4Q8OA 1I0BA 1XLJA 1CENA 1W8GA 3OYZA 3WQVA 4LUTA 1R2TA 2Y85A 4GVIA 2PZ0A 4GIRA 3UJ2A 2E5DA 3VNLA 2ALRA 3CH9A 2UV8G 2YOCA 1Z8AA 3V4BA 4NL1A 2PLKA 3IJLA 3TJLA 3R12A 2CERA 4Q8VA 2CKRA 2NLYA 3WNMA 3W73A 1UQYA 2XGBA 1I2OA 3N3MA 4S3FA 1POKA 1KWKA 2GWNA 3OPSA 2ON3A 5CLWA 1T41A 3W29A 3AZTA 1VRDA 2DSVA 3Q94A 1EGVA 4BI7A 2DJXA 2JQXA 1DJGA 5E09A 1ONRA 1EF2A 5MKGB 1XC4A 3G8EA 5FJTA 3TW9A 1E15A 3AWOA 1RD6A 1KGXA 3EWYA 3JZUA 4ZODA 3A47A 1XGDA 5JBEA 3BJFA 1TIWA 4E5TA 4Q4QA 2RUSA 2EQDA 2P5NA 1CGYA 3POHA 3W7MA 2A3CA 2RJHA 3HQNA 2Y89A 1F3WA 4GRSA 5T9BG 1J93A 5CPMA 4TU1A 4HTYA 1W2PA 3QRHA 1F4AA 4XAGA 4F0RA 3M4HA 3MKVA 1EJXC 4HU4A 4ADTA 1JGIA 4P8VA 1WKYA 4W87A 1GYLA 2WLYA 4XIAA 2CEQA 3S9IA 1H49A 3FVMA 2CPUA 3PTMA 3IUIA 2FZ8A 4AD5A 4D2JA 1NVMA 4LUJA 1T6MA 1E9IA 4P8XA 2O7SA 2AGTA 3G6LA 3IGXA 5HMSA 3QJAA 1JR1A 5I3DA 3KOXA 1L6SA 2P3ZA 5M17A 3L66A 2J13A 1PL9A 5AC6A 1KRAC 1XBVA 3TP4A 3FA5A 3CIXA 4F9DA 1YDOA 2Q3OA 2J7GA 1E1CA 2Y7FA 2G3FA 1NFGA 4ONVA 1GZ1A 2J9XA 4CEUC 3S2MA 5C2CA 1XLGA 2YIHA 3ZSTA 4UMCA 2IPFA 3BOLA 3TJ4A 3WK0A 3RR4A 3DFSA 2WJDA 2Y2WA 1X97A 3H21A 1AQMA 2GJRA 1S1RA 4O8RA 5FEXA 3GW0A 2FTPA 2GSJA 2FJKA 3IJ8A 3MBDA 4LAKA 1RCXB 4PBGA 2PWVA 4WIWA 3F2CA 4Y8FA 1Q4NX 2VZOA 2QJGA 4UFKA 5JBFA 2DY3A 2PDXA 1THFD 3EMZA 2OWWA 1R38A 4GQQA 3VIMA 4HJWA 2BTMA 1ISYA 4AVFA 8TIMA 2P1FA 3GTNA 1TREA 3L5MA 4ERAA 2GVJA 4A8LA 3KBSA 1QCWA 4UOJA 3W85A 3OVQA 1EPVA 3G1YA 4NUWA 1CWYA 4I8YA 4CLMA 1W9VA 1ZJIA 1RXOB 4JEJA 4DXKA 4G5DA 2EPLX 3WIJA 2A3EA 1NP0A 3PS7A 1BXCA 2OO6A 4KEUA 1QDSA 1PZ2A 2Z1XA 2A6LA 1XIIA 1ITUA 1WXJA 3SECA 4JN8A 1W37A 1YNYA 5D2TA 3TVAA 2BWGA 5I3KA 1LJYA 2ZWYA 5DY3A 1FCVA 3W4RA 1TE6A 4TX6A 4AAJA 2J27A 2E1WA 4H83A 3BMVA 2IXUA 3OP2A 1FH9A 5F2LA 4IQJA 4B5UA 4U28A 4HBKA 4HJFA 3GVVA 5GNZA 2VENA 1JPHA 1FWWA 1JD7A 3CUZA 1CXKA 4XZHA 3GVWA 1DORA 3RIKA 3GE7A 3DG7A 3EDKA 5ABFA 4WJEA 3CUHA 1UIOA 1S5TA 3OJGA 3N2CA 2IQ0A 3N12A 3MA8A 3ME3A 1LDCA 3SRKA 1DJXA 1D3CA 3ALFA 3ARZA 3QYQA 4HMNA 1EJTC 4RZBA 3ZM8A 2DZAA 4A3YA 2PTWA 3XIMA 4MAVA 1GOKA 4Z2KA 3ITOA 4LBUA 3KL0A 2AQVA 7CGTA 3PUOA 4F48A 1NWTA 5TAOA 3NURA 3AROA 1QU4A 3ZOAA 3DCPA 3HQOA 4WGHA 3QOKA 5BMWA 1S3TC 1J12A 1P6BA 4FMVA 2YL5A 2MANA 1PPIA 1K02A 3LCLA 5D9OA 2CWNA 3TJIA 3WUBA 4AZ6A 1R7AA 2E40A 1G94A 3WDHA 1H1NA 2PS2A 5D32A 1UA7A 3TR9A 4AWSA 2I16A 1JQVA 1A49A 3AS0A 4CCCA 3NQGA 4HPJA 1WP6A 4V2XA 2QPXA 2DSZA 1AD4A 3KWXA 3RF9A 2QUVA 1WXZA 1OADA 2A7NA 1DTUA 1H7RA 3AS1A 4AZ7A 1CX9A 3DFTA 3IK4A 2TODA 2OB3A 3A5VA 5CC7A 3H54A 2NLIA 4IX0A 5CBIA 3ZO9A 2Y63A 3LU2A 3SQLA 3M0IA 3V35A 3A4AA 3QF0A 2PLMA 3VNJA 1H1YA 9XIMA 4GKTA 2PWHA 3U0HA 3ONCA 4DWSA 3M64A 1EXPA 3AI0A 5FJIA 4KPLA 5I3IA 3BMXA 2CW6A 3WENA 3G1SA 3QV8A 4AEFA 3B8TA 2VMFA 4D6DA 1BGAA 4PMYA 3UG8A 2J7HA 2Q71A 5T26A 1Q45A 4JTQA 4UXDA 3S1GA 3OLDA 3FJLA 4ZQNA 1VC4A 4HP5A 4RV3A 4QSHA 2C13A 4Z2HA 2WPBA 1V6XA 4JTKA 2NXHA 1E9YB 2QJIA 1I0DA 5LKYA 1EPXA 4FOKA 4FLQA 1YKWA 4AF0A 3SDOA 4JQ3A 1R9ZA 1A0EA 1KFKA 1F6YA 2W91A 3QBUA 3MI3A 4A05A 1JYXA 2HNHA 3B04A 1HFBA 3SFKA 4S39A 4HK7A 3E2QA 4UB9A 3KCJA 1HGYA 4XTDA 4FI4A 3MV11 3AIQA 3R89A 4CU6A 4XBJA 4YYCA 4GIAA 2VEKA 3UF9A 3W6MA 3CAKA 2I7GA 3WZ0E 4BCEA 3GHTA 2PDNA 5AYZA 5B80A 2VX7A 5G4WA 5A2AA 2Y5EA 1WKEA 4FLSA 5EY5A 2FZ9A 2G3NA 1U2YA 1KV5A 2HSAA 3QR0A 2DQWA 2I9EA 4W93A 1CXEA 4PRRA 5FI8A 2DSKA 1V4YA 3M6DA 2J7DA 2BODX 3RUBL 3QN3A 1KXHA 7TAAA 3B0PA 5D8ZA 2GVLA 1PKMA 2GUUA 1Q4WA 4E4UA 4N9BA 3G0SA 1K4GA 1UWRA 2GQ8A 5CLTA 1IIHA 4LYQA 3H70A 3CASA 5F7UA 1RBOB 4K2SA 1U5VA 3BK0A 3UVIA 4TMCA 5J8LA 1G7UA 2VT0A 3K2GA 4MWAD 5C8BB 1A3HA 2QJMA 4NYYA 3DXIA 5DQPA 3N9KA 2NWSA 4MWAA 4H9MA 3TYDA 2PLJA 3G22A 3RCYA 4H00A 1BF6A 1QJWA 2UY4A 5CH9A 4H1ZA 3TV8A 3SN0A 2YYUA 2RGMA 1BSIA 3B0XA 1UASA 2OQYA 3BV4A 2FDMA 5IDZA 2YYTA 1GVQA 1VEMA 5M1TA 1Z48A 3LA4A 1GVIA 3MHUA 3LMYA 3CT7A 1Q5MA 1UC4A 1W5QA 2XINA 3S9ZA 1O6IA 3SM0A 2CETA 3R0UA 2CLOA 4MNLA 2PP1A 2HPMA 3QY8A 1J2WA 1UHVA 3TUUA 1FWDC 2UBPC 1QBBA 2OVLA 3G5EA 3EB2A 5LHEA 2J7EA 2BHUA 4LANA 4QE4A 1PVNA 4D6FA 2V69A 5I06A 4XAPA 4N4QA 1WB0A 4HB7A 3DESA 4QAWA 3JZEA 4PMQA 1FCBA 1K03A 4C6OA 3PZTA 2R9RA 2J25A 3ZLHA 2YL8A 4WDWA 5CAHA 4GUHA 1UP0A 4IGHA 2ZX6A 2PGWA 5HWMA 4J4KA 1RPKA 1RVGA 1KA9F 3MMWA 1BF2A 3O6YX 4W8LA 4XD6A 4CNTA 3UNTA 1E3XA 1YADA 4AZCA 2YXXA 3GDLA 4ZSUA 1C9WA 3IEBA 1JPKA 4RE0A 3NSXA 1VPQA 5KEZA 4LB3A 2WXDM 4NJIA 3GTXA 4H9YA 1E4MM 4RPPA 4YVXA 2OLAA 2B0MA 1ZJHA 4A22A 3E6EA 2J6VA 4QRNA 2D73A 4LS1A 3BW2A 4D1IA 3AU2A 5EGRA 4W8BA 4OFCA 1CXIA 3SCWA 2HVOA 2E6YA 5E9AA 3HGSA 2YBVA 3WFAA 4GC4A 5BRQA 4GUIA 3VDGA 5CG7A 2C91A 3W1TA 5AHMA 3KAOA 3N2OA 4YTTA 3MVIA 1PXGA 4MJMA 4QEEA 1MDRA 3H26A 1W1VA 3PZ9A 5CJMA 1VHNA 3CHFA 3VILA 3TWBA 2ZADA 1MQRA 4E8GA 1KM0A 2HTMA 7REQA 1BLIA 1HIZA 4Y2WA 2PDIA 1MXSA 3AUJA 1MW1A 3M43A 4QDPA 5H91A 3TE9A 3CH0A 3N6HA 4NVTA 1VZWA 3E1F1 1TFVA 4XTIA 4AWUA 2E9MA 5DF0A 4W8AA 2GDVA 1JFXA 3SN1A 1AQFA 3SBFA 2HVMA 1L6FA 1UKSA 4ZBCA 2PURA 4MHBA 1K7FA 2DZBA 3AYVA 4JIPA 4HOXA 2UWFA 2WMFA 3C2YA 3OZOA 2WJZA 2OX4A 3NL3A 3NL5A 1FWFC 3WH9A 3CUJA 1E4LA 2PRLA 3E0VA 1F4HA 1CXLA 2G0WA 1WO2A 3O7UA 4S23A 1L8NA 1XCFA 2YL6A 3L68A 3CWNA 4AX6A 3CZJA 2PBGA 3APGA 3MO7A 3PPFA 3AS2A 4O0QA 3RXZA 1QNPA