2XG9A

Crystal structure of barley beta-amylase complexed with 4-o-alpha-d- glucopyranosylmoranoline
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
487
structure length
487
Chain Sequence
b'VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-AMYLASE
publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 191
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xg9A00
4W8LA 4V27A 4QCFA 4J7RA 1UWIA 2IXVA 4UFJA 1DEDA 3VINA 5GNXA 3AI0A 1UQZA 4ML4A 1Q6EA 4AY1A 5CXPA 4GZJA 3AICA 1LLOA 1PX8A 1UD4A 1NOUA 5AC5A 3WKZA 1TMQA 2DT0A 4RE4A 1LQ0A 1JYNA 5BXRA 3NIYA 4MB1A 5AC4A 3LPOA 5FIPA 4AIUA 1W9VA 3VGGA 4BQ5A 3ARUA 4E4PA 3WMCA 1A3HA 1KR1A 3BAYA 1VBRA 1V02A 4W8BA 2W5FA 4XX6A 3CPUA 1HJSA 1EOMA 5KZ6A 4ACYA 4UZUA 1LL7A 2VX4A 1ZJBA 4KRUA 1W2VA 3CUFA 2XIBA 2VURA 4MTVA 2G3IA 4ZE4A 5EFDA 1CXHA 1XYZA 1V6XA 4U2ZA 3RIKA 5M3WA 2J7GA 2VZTA 4YPJA 2EPMX 1AVAA 1OB0A 2EJ1A 4A4AA 4OIFA 3WUFA 4WKHA 1YQ2A 2BVYA 4P8XA 4NRRA 2CPUA 4MPKA 2W4XA 3ALGA 1OGSA 4QP0A 1I1WA 1UA3A 1HJXA 2CBVA 2ZOXA 4MB5A 5CLWA 2D0FA 1QNQA 1C7SA 1WP6A 3PTMA 3MV11 4DUWA 3BLKA 3B9EA 2YL9A 5HPCA 1CGTA 2VL4A 1UKOA 3VMNA 4MB4A 3VDHA 2DPEA 3VMPA 3GBDA 3VX0A 4PCTA 1QNPA 3ZJ7A 2ZE0A 2FGLA 3CBWA 1HXJA 4MADA 3A6OA 3PZIA 3UG5A 2XVNA 4KRTA 2WMJA 5LA0A 2X0HA 3FN9A 3DC0A 3ARQA 2PBGA 4WKFA 3MUIA 3AS0A 3EDJA 1XRVA 5JIPA 3HJEA 5D9OA 4PTVA 1DHKA 3EMZA 3G6MA 2E9LA 3D3AA 4GIAA 1UR2A 3SCRA 3AHYA 1KB3A 1CLVA 2VZVA 5A8PA 2D22A 4JFWA 1V0NA 3ZT7A 1E0WA 3ARSA 5I0DA 2JEQA 2PWFA 3TOPA 2YDRA 2PBOA 1I1XA 3WN6A 3VD5A 2YIHA 4ZENA 4P7RA 3POCA 1HKKA 1W9XA 3SCOA 2GJXA 2XWDA 3AXHA 5A2BA 1LF1A 3AHXA 3U5UA 4AMCA 1R85A 4F79A 3FXYA 1ZS2A 1N82A 1E71M 1QPKA 3SUVA 3AISA 3BC9A 1C93A 5GQBA 4XZWA 5TD4A 2NW0A 1UR0A 4J27A 2CIPA 2CETA 1DWJM 3WH6A 3BGAA 2CBIA 1W3HA 1C8XA 1LWJA 5I77A 2V38A 4PMVA 1NM9A 3BCDA 3WEMA 3VD4A 2XG9A 2WPGA 1J01A 2D20A 1G1YA 2XSBA 2XJ7A 2HISA 3FHQA 4W8AA 2X0YA 4PTWA 1TUXA 4GI8A 1RP8A 2AMGA 3PZGA 3RDKA 4AD4A 4BF7A 1BYCA 4HMEA 3WD0A 4H2CA 1V02E 1ZBKA 4UFLA 2J79A 2ZWZA 1JFXA 3L4XA 4H41A 1VAHA 3WNNA 1SR0A 4RE2A 5A8NA 1CXFA 4Y7EA 1LWHA 1OIFA 2GVYA 2YL5A 3ZT6A 4AD2A 1JDAA 1CXEA 3SUTA 1EH9A 4CD4A 5HBFA 1M03A 1J0YA 2WKLA 4MDPA 3AROA 3WQVA 4WK9A 5D9PA 4C7FA 1Y7VA 3N18A 3CO4A 3W81A 4UQBA 4W5UA 4D6IA 1C7TA 3MMUA 4YHEA 2J47A 2PB1A 3CZJA 4URIA 1UWTA 4GO9A 1BVZA 1JI2A 2OLHA 3OGRA 4DWSD 5D8ZA 4AZ7A 1E6NA 1K9FA 4U31A 3VM7A 3VIHA 4HOWA 3II1A 2G4FA 4UCFA 1Q6CA 1OBAA 1VRXA 2WSKA 4U5KA 2DH2A 4P8VA 3PN8A 2PWEA 2GK1B 4DWSB 3VDAA 1WDSA 3N15A 3WF1A 2V3DA 1GVYA 3ZT5A 1TCMA 2VT0A 3WY1A 9CGTA 2UY4A 4DUXA 2JF6A 2WMFA 1VJSA 2CESA 3EDEA 1QBBA 3W25A 1XD1A 4AZGA 1UKSA 3DECA 4J3TA 3WNMA 3MMWA 1B3ZA 1BYBA 4UQEA 1EQCA 3WDJA 1QOXA 2XIIA 4M1RA 4OKDA 3W24A 4AD1A 1B1YA 2Y5EA 3AYSA 4QLKA 1JNDA 2CHOA 4W87A 1OINA 3AHTA 1HJQA 5CQ1A 4ZXOA 2XPKA 2XM2A 4AYSA 1WB0A 2CKSA 2WC4A 1FFQA 4D6CA 5CSYA 4D6HA 3WFLA 2GJRA 3I3DA 4B3KA 1JDCA 3N11A 3ARRA 3TA9A 5ABFB 2ZUNA 1GOIA 2WCSA 3MANA 1J11A 3PHAA 5GNYA 4QAWA 3L4WA 4KH2A 1QI3A 2Y8KA 1WE5A 3FHAA 3EYPA 1WZLA 3EMQA 1VFFA 3CZEA 1ESWA 4FLRA 3VO0A 1FOBA 2E9MA 1XH1A 3NSXA 4M24A 4GO8A 4AWEA 4LX4A 4Z2HA 5CG0A 4FLOA 4CD8A 1NARA 3AMGA 5CPTA 1HP5A 2D23A 3N12A 3N04A 1J0ZA 3VGBA 1OWQA 4CD7A 5JUVA 2Y24A 2EPNA 4TUFA 5A6SA 2BHYA 3W6MA 3VIJA 1JD9A 4LYPA 4UQ9A 4J3VA 3SCVA 1UKQA 2G3JA 1NQ6A 1LG2A 2OWXA 1KCKA 2ZICA 4Z2IA 2DSVA 1VFMA 1H11A 3UETA 1DWIM 1H2JA 3CHCA 2J7EA 5DF0A 3S6TA 3L2MA 3MMDA 1OGBA 4AEEA 3T0BA 3SCTA 4CU6A 5BCAA 1BFNA 5FD0A 3OB8A 2WMGA 3S2CA 2F8QA 4B15A 1QI5A 1Q6DA 1TVNA 2JIEA 1H1NA 4ATWA 4A3HA 1UHVA 3T08A 2WMIA 4JCMA 1XSKA 3PZMA 1HVXA 1GJUA 1BLIA 4RE3A 5I78A 2WLYA 3VDBA 4MJ4A 5D8WA 1V6YA 3IJ9A 2Z1SA 1JZ2A 5JBFA 1NWTA 1JZ6A 2RGLA 3BAWA 2VZUA 3KEHA 3IAQA 1JDDA 1PBGA 4TTUA 4CGTA 1UG6A 3AMKA 1BF2A 1WDPA 5D9NA 4XZBA 1PAMA 3WDIA 3AS3A 3PBGA 2VQTA 4CVWA 2O92A 3M46A 1H0IA 2OSYA 1ZBWA 2WW5A 3OLGA 3ARZA 3KWXA 4CU7A 4M56A 2WHJA 2W92A 4GQQA 5A2AA 2JEPA 4TXEA 2NSXA 3VU2A 1K6AA 4UOZA 1UOKA 5FOOA 4FLQA 3WH7A 1E43A 8CGTA 4HZ8A 1B2YA 1XC6A 4Z2GA 1ZJAA 4PMQA 1CYGA 5A6LA 1ISWA 3A4AA 4HPGA 5EB8A 1CGXA 1PJ9A 1RH9A 1CGWA 1MFUA 3SCWA 4AD0A 1B3VA 2X09A 2WVUA 4WSJA 1CDGA 3B9AA 1GVIA 3N13A 3WQ6A 1KR0A 3HN3A 1Z32X 4C7DA 1RD6A 2BVDA 1FFRA 3CUHA 3SCPA 4TVUA 1UA7A 4FK9A 4F8XA 3AMDA 3K1DA 1K9TA 4YHGA 2D2OA 1C8YA 5JBEA 1JYXA 2DT1A 1LG1A 5A6AA 1I75A 1CPUA 3AIWA 3RMEA 3UR8A 5I23A 5E9AA 1UH2A 2DIJA 3AXXA 3F5LA 4P7NA 1W9UA 5I2UA 3WBAA 1LJYA 2EPOA 2CNCA 1UR1A 2OSWA 3THDA 1J10A 3KL3A 1OT2A 4KWUA 1QI2A 3BAKA 3GZAA 1NWUA 3AMLA 4Q22A 2YDQA 1JF5A 1XCXA 2WYSA 4ZEPA 1CECA 3AYRA 3PZVA 1PX3A 1GUVA 1B0IA 2W63A 1UKTA 5E6YA 1G0CA 1OD0A 3QOKA 4W88A 1US2A 1Q6FA 2WB5A 3T0DA 3TTQA 4ATLA 1LL6A 3OBAA 3SEPA 1ZBVA 3O9NA 3GDBA 3AHVA 4LGXA 1E6QM 3WDPP 1GW1A 4V28A 5AYBA 3L4ZA 4FMVA 1V08A 6CGTA 4LYRA 1MQPA 2V3GA 1VJZA 3GBEA 1E6SM 2WC7A 3UEQA 3VIPA 5E0CA 2WMHA 1JFHA 2YA2A 4IPNB 5I3DA 3OLDA 2VRJA 1RPKA 4JFVA 2VUYA 1OCQA 3AZSA 3GXIA 2WVVA 1E0XA 2ZUMA 3CZKA 1BHGA 3DYMA 2YKKA 2VZSA 1W32A 1NP0A 3NSNA 1NOFA 4PMOA 1R8LA 1UD8A 3VNZA 1BTCA 4D6DA 2WCAA 2YA0A 1J0JA 2FHFA 2X1IA 3VIIA 2VVNA 4D6GA 2V5DA 3J7HA 3NUKA 5BYWA 1E3ZA 4P7LA 2DSWA 1OGGA 4HP5A 2ZXQA 2QF8A 4CN1A 4Z2JA 5CPSA 2ZX8A 5EBAA 3ZR5A 2C7FA 3RM8A 1B3YA 4AZ5A 2DEPA 2VX5A 2W61A 3WNLA 2ZX7A 1B90A 1GOWA 1HJVA 2PWDA 4HU0A 5E09A 5A6JA 2A3CA 1XGZA 1J9YA 4MB3A 1O7AA 2OWWA 4N0RA 1QI4A 5A8OA 1UD6A 3M07A 3QGVA 1EDTA 4BZYA 4CU8A 3W38A 3PZQA 1W1VA 5IDIA 3SUWA 3BAIA 2Z1KA 4JIEA 1FH7A 2ZX9A 2G3NA 1CGVA 4JAWA 1WDRA 4AC1X 3HMCA 2ZXDA 2J7CA 2OSXA 2WMKA 3IJ7A 5CLTA 3W27A 2A3AA 4EK7A 3WH9A 5ABGA 1H4PA 4HMCA 3WF4A 3SURA 2ZX6A 3CUIA 3K4DA 4M82A 4DM1A 3VGFA 4WLCA 1JAEA 1GOOA 4UQDA 4TVDA 4HMDA 4KGJA 2VC9A 2YLLA 3ARTA 1HT6A 1W91A 1CXKA 4PSRA 1QHOA 5ABFA 3AS1A 2ZX5A 3BMWA 2CXGA 1GQIA 2X2YA 3VGDA 3T2QA 4HPHA 2W67A 1WNOA 3VGHA 3AIBA 1XD0A 1WAWA 1XH2A 5I5RA 5C70A 1B3WA 1GNXA 3BAXA 3AJ7A 5E6ZA 2WKGA 3RM9A 4MDOA 2EPLX 2E0PA 3WQ4A 2C0HA 3WQWA 1KXQA 3CUJA 3QR3A 1M01A 3KZSA 1E1EA 5IHRA 2X05A 1GQLA 3UR7A 1MVYA 2CKRA 1BGGA 2YA1A 2D3LA 4JFUA 1F4HA 3CLWA 2FHBA 1BVNP 4W84A 4ACZA 1DWGM 3PTKA 2XVLA 3TTOA 2OYMA 5BXTA 7A3HA 5DEZA 3PZOA 1SMDA 3ECQA 3ZOAA 3GH7A 1E3XA 2Y4SA 2EXOA 5LA2A 1GJWA 3K4AA 1GPFA 2VCAA 2EBNA 1M7XA 3TTYA 2VR5A 2XGBA 1B31A 1HX0A 1L0PA 1GCYA 2PF0A 1G01A 4HOZA 5IFPA 2ZUVA 4HZ6A 3NJ3A 5BWFA 1WZAA 2AAAA 3DHUA 1EGZA 4JKMA 1CIUA 5GPRA 3MUY1 1J0KA 2FH8A 3HU7A 1G9HA 3BAJA 5LYRA 3BH4A 1EO5A 4DM2A 2WZIA 2ZXAA 4KGLA 1W2PA 2WAGA 1B9ZA 2XFRA 1E40A 3WFZA 1TZ7A 4DUVA 3VDCA 1OD8A 2YL6A 4W86A 3OLEA 1CZ1A 1UD3A 3KE0A 3KL0A 1Q4NX 2WHLA 2CHNA 2QLYA 1XH0A 4L4OA 2WANA 2J7FA 4PMZA 4CKQA 3BSGA 2PWGA 2BY3A 2DDXA 3VPLA 3VKKA 4ZXLA 1UWRA 2DH3A 1DWFM 4W93A 1UH4A 2J25A 4IM4A 3VVGA 1TG7A 5BRPA 4CN4A 5GNZA 1UR4A 3APGA 1GOMA 2D24A 1V0LA 4CVUA 4S3JA 1AQMA 1WPCA 1X6NA 3A47A 1SYTA 1UWQA 1AQHA 4OJYA 5I79A 1W1PA 1DWAM 1E6ZA 1X1NA 3UCQA 3WEZA 1V3KA 2XFYA 1VIWA 4P8WA 4BQ4A 1UYQA 2ZUTA 4MAZA 3CHFA 2HVMA 4JZ5A 2JE8A 4ZE5A 1GONA 4UNIA 4XV0A 1FP9A 1CBGA 4FF5A 3TTSA 4AZIA 1W3KA 3FW6A 1UR8A 3AQUA 4AZBA 4MNLA 4CCDA 4PMDA 3E1F1 1TA3B 1Q6GA 1E1FA 2EEXA 3MS8A 3W37A 1ODUA 4U2YA 3AIVA 2WZHA 2VQUA 4PTXA 2IXUA 5AYIA 3QOMA 4E2OA 1U2YA 5DO8A 3VIMA 1HIZA 5A6BA 4AZCA 2GSJA 3WD4A 1E4LA 4D1JA 2BHZA 1ZL1A 3AMCA 1VENA 1UKPA 5M5DA 1VEOA 4PMNA 4QFUA 4U3AA 1KCLA 4AD3A 4BQ3A 5E70A 1C8QA 1K9DA 3WBEA 4PRWA 3CIVA 5IFTA 2GFTA 4IPLA 4PUEA 2Q8XA 1ISVA 3O2LA 4H8VA 2J8FA 2RGMA 3VIFA 3GNPA 1JYVA 2XFFA 1BAGA 4AW7A 4HA4A 2VRQA 1KBBA 1H0GA 2VO5A 3AXIA 1H5VA 2WWDA 4U5IA 1VEPA 3AHZA 3U5YA 3W0KA 4B9ZA 3AZRA 4TX8A 2BXZA 5A69A 1G94A 2BS9A 2UWFA 1WO2A 1W1TA 3RM4A 1ISZA 4D6FA 1MQQA 5ABHA 2WSPA 2Y2WA 4PCSA 4RL3A 1EXPA 4NZCA 5FL0A 2J62A 4N42A 4IISA 1H3GA 3OZPA 3SCSA 4UQAA 1E4IA 1C92A 4CD6A 2W91A 1V3HA 1P6WA 5I6SA 3LPGA 2OYKA 3AOFA 2QPSA 5BROA 5A95A 1FH9A 4EANA 3PZTA 4M81A 5M03A 2BHUA 4J3UA 1BPLB 2WHMA 3L4YA 1QBAA 1XSIA 5CPQA 3SUSA 5KEZA 4ZFMA 4OBRA 4LXFA 3RPMA 2QMKA 1XV8A 1UZ4A 1ISYA 1D7FA 1HL8A 3SCNA 3RJXA 4GZIA 4D71A 5D9MA 2VCCA 3ZO9A 4EAMA 3VMOA 4PMRA 4CD5A 2XVKA 2XHYA 3W4RA 1GORA 3TP4A 2XWEA 1C3FA 1K9EA 2WXDM 2VR4A 1NP2A 2W62A 3F5KA 3L2LA 1A47A 1JIBA 1GZJA 6A3HA 1W3JA 3KL5A 4LYQA 4B9YA 3EDFA 2GDVA 3F4VA 1V0MA 1OSEA 3WF0A 4H8UA 5C71A 1KWKA 5IHSA 2WVTA 3VX1A 5CGMA 4W7WA 3NSMA 3ZM8A 2VI0A 3AS2A 3MO4A 4X9YA 2YLAA 4PMXA 3IK2A 2E8YA 1DTUA 2F2HA 2TAAA 4JHZA 1V6WA 3SCUA 2G3MA 1UH3A 3GNRA 1OM0A 2XGIA 5C8BB 3MSGA 5HDRA 1JZ4A 3JUGA 2IUZA 3L4TA 5BRQA 2WBKA 1BG4A 2J75A 4H7VA 3TONA 2J8GA 5A1AA 1CWYA 1HKIA 1MQRA 1W9PA 1NH6A 4OZOA 1IT0A 1AQ0A 2DT3A 3A4WA 3T09A 1KXVA 3N1AA 2F61A 2D0GA 1E6RA 1VEMA 3EDKA 2YOCA 4MNKA 3L4VA 2CBJA 3VD3A 4S3KA 4PSPA 3OG2A 1CLXA 3CZGA 2BV9A 1JXKA 5I24A 1JZ5A 3WDRA 3UERA 2MANA 3L4UA 1HP4A 4KMQA 3ZJKA 1MXGA 3CH9A 1E5JA 4H8HA 3SCQA 1QHPA 4QLJA 1J18A 4JKLA 1EA9C 7CGTA 1UD5A 4W7VA 1JNEA 1TE1A 1IZKA 2J7HA 3U57A 1E4NA 3WDHA 2Y8VA 1E5NA 3OA5A 2J7DA 2VRKA 4U33A 4W89A 5E0FA 1W1YA 1EDGA 3ZIZA 4UFHA 3VD9A 4A3YA 1CXIA 3FAWA 4J3SA 1VFUA 2A3EA 3O6AA 4AZHA 4F9JA 1R86A 2ZUWA 1GHRA 3NCOA 3WUEA 2DGAA 1BG9A 3FNDA 4AIEA 5A6MA 1ZU8A 2BFGA 2WMIB 5LA1A 3M7SA 5HNNA 4MJ2A 1R7OA 2OYLA 3POHA 1JGIA 1HJUA 2NT1A 4YN5A 3WEOA 4GQRA 3ALFA 1UQYA 3U7VA 4B16A 1E72M 1AMYA 2E3ZA 1MFVA 4UQCA 1JZ8A 3DYOA 4JCLA 1PPIA 3PTQA 3QHNA 3LPFA 3B9DA 1B3XA 4C7GA 2WC3A 3GXFA 3WMBA 4JHOA 1E6PA 2BY2A 4JL2A 5EFFA 1CNVA 5A6KA 3ZR6A 4L4PA 2PWHA 3I3BA 1KBKA 5AY7A 2O9PA 1XYFA 1L8NA 2WZEA 3NDZA 4PMYA 2GK1A 1H09A 3VGEA 2O9OA 4DWSA 2VJXA 1CGUA 2YJQA 3ARWA 1E4MM 4D6EA 4PTMA 1V0KA 3THCA 1HKJA 3WSUA 1EO7A 4JFTA 1ECEA 1J0IA 2E9BA 1QW9A 2JIWA 1KGWA 3EMCA 3MUZ1 4P7QA 3CZ8A 1PEZA 4ATDA 3PZ9A 8A3HA 2DSZA 3ARPA 3OIHA 4GXPA 2B31A 3W26A 1WZMA 2G8ZA 3VOCA 2XTKA 3MUAA 2J77A 3GXDA 2WCGA 2O9TA 5HXMA 1QNSA 1V3IA 2DIEA 4F66A 1QW8A 2DT2A 4E8DA 2ZWYA 4WJXA 4PYSA 1H49A 1VBUA 1ISXA 1KWGA 3WIJA 3AFBA 1PZ2A 3FY1A 3WUGA 3IJ8A 2BNJA 1TR1A 2V3FA 3WD2A 3F5JA 4UFIA 1J12A 2CBUA 1YHTA 5DFAA 3ZQ9A 3QHOA 2EPKX 2WM0A 2ZUUA 5FKYA 3CHEA 3CMJA 3W28A 1U30A 4LQ1A 1HF6A 1TA3A 2C8NA 1EIBA 3CGTA 4UFMA 4JL1A 3GYCA 3K8LA 3K46A 4X0VA 6TAAA 5CSUA 3WH5A 1GQKA 1CTNA 1ITCA 1PIFA 4AISA 5IXEA 2J74A 1D3CA 2J4GA 2WLZA 1PZ3A 3AIUA 2WWCA 2UY2A 1FHDA 1JZ3A 1FHLA 2VVSA 3VUPA 2YL8A 3WELA 3W29A 3RCNA 2VNCA 5ABEA 3OGSA 3GTNA 4FLSA 3ARXA 1X6LA 3LPPA 1HN1A 2J7BA 2BY1A 4BCEA 2ZUSA 4AEFA 4HTYA 4JFSA 4CCEA 1VF8A 3VIOA 5DT5A 2E40A 5JIWA 4JKKA 1HNYA 4OOZA 4HA1A 3OGVA 4LPCA 1DP0A 4TTGA 4MAVA 1KGXA 4TX6A 4TOQA 5DT7A 1FP8A 4NRSA 2DSKA 2WVVB 4M80A 5HPOA 4QLLA 2VX7A 1FH8A 3SUUA 4QDMA 1BGAA 3BSHA 2D3NA 4PMUA 4M29A 1JI1A 1LL4A 5A3HA 4HOXA 5A8MA 2XUCA 3SIMA 2UY5A 4J3WA 7TAAA 4IUGA 2FH6A 1E15A 1US3A 4NF7A 4B3LA 1U33A 3CTTA 2OWCA 3T2PA 5ECUA 2FHCA 3GNOA 3AIQA 3UG3A 1TVPA 1PIGA 3UESA 2WBGA 1JL8A 1IV8A 1EQPA 3GH5A 2GUYA 3GXMA 4UOQA 4TVCA 3WNKA 1D2KA 3VTRA 1ITXA 2A3BA 1HKMA 2JF7A 2CEQA 2X8RA 2BY0A 3W82A 2EO7A 4PBGA 1RP9A 1MWOA 1M04A 2WNWA 1VB9A 1QVBA 2WHKA 4GI9A 3ZSTA 3WNOA 1CXLA 1KXHA 3BLPX 3OLIA 4WIWA 2A3HA 2GJPA 1JD7A 1GHSA 1R87A 1V3JA 5F7UA 1VFOA 2E4TA 3ZJ8A 3N17A 3WD3A 3WQ8A 3CUGA 1MW3A 3VD7A 3VNYA 2VCBA 2ESCA 4X0NA 4MNJA 1C91A 3WF3A 5FL1A 1ODZA 3OZOA 1NWRA 4D1IA 5BXPA 2YBTA 1UWUA 1CEOA 3BXWA 1E55A 3NDYA 2CCRA 2DSUA 1ZBCA 2XVGA 1GQJA 4BA0A 1WDQA 3AIEA 4P8UA 2WK2A 1S46A 3ARVA 2VOTA 5JBDA 2GJXB 4CN6A 3MKKA 4D72A 3ZSSA 1FA2A 4XUYA 1E70M 2J78A 2CITA 5BXSA 4J3XA 1EHAA 4HA3A 1R7AA 3A4XA 1H41A 3GH4A 2GDUA 5A2CA 3AZTA 2ZIDA 4R5EA 4UOJA 1DWHM 2VZOA 1E56A 1JYWA 2JFEX 1MYRA 1KQZA 4NI3A 4E8CA 1BYDA 1V6VA 3EDDA 2XVPA 1E73M 1CGYA 2D0HA 4H04A 3MU7A 4BQ2A 1KXTA 1SFSA 2UY3A 1JZ7A 4J28A 2AOSA 1UD2A 3K8MA 2E8ZA 3VIKA 4BS0A 1G5AA 2JALA 2V3EA 1EHNA 1QNOA 1HL9A 5EMYA 4Z2LA 1KQYA 3WNPA 1KGUA 3D5HA 1JF6A 1IZJA 1HVQA 3T0AA 1QHZA 4ACZB 1B30A 4GINA 5A94A 2CYGA 2YDSA 3K8KA 2NT0A 2XM1A 2W66A 2XYLA 4AD5A 4UR9A 5FCZA 1W3LA 3WUBA 3LMYA 3T2OA 1OT1A 2PC8A 4M8UA 2G41A 1JAKA 3BCFA 1V6UA 4OOUA 4HU8A 3WDQA 4V2XA 4F9DA 1MW2A 1WKYA 3ARYA 3DHPA 3I3EA 2FGZA 4PUDA 4Z2KA 4GKLA 4Q7NA 2VX6A 5HOSA 1JG9A 1MXDA 3NYDA 1TFVA 4PN2A 1SMAA 1EOKA 2FDMA 1E9LA 3U7BA 1BQCA 1CENA 3W53A 1UWSA 1V3MA 2V5CA 4R27A 2WVSA 1V3LA 4DWSC 4K68A 3MV01 4W85A 2CERA 4AZ6A 3EBVA 4OBSA 4OUEA 3W6LA 3WQ5A 2QV4A 4CUCA 3N9KA 1WZKA 2YBUA 3M6DA 4UFKA 2EQDA 3DYPA 3B8SA 3UG4A 3BMVA 1E0VA 3WD1A 2XSAA 3G6LA 3WL0A 3CZLA 5D4YA 3GM8A 3WH8A 1WCGA 2D1ZA 5M17A 4HZ7A 5DMYA 4EE9A 3VM5A 2DQXA 1UZ1A 3IAPA 1W9DM 1KFWA 3QHMA 1J0HA 1C90A 1NWSA 3AIRA 5CGTA 4QCEA 1M53A 3A3HA 1XSJA 3PZNA 2PI6A 4WF7A 1V03A 3RJYA 1OIMA 1BYAA 1HJWA 4P7OA 3WF2A 1PX4A 1NOWA 1MW1A 3VIGA 4AXNA 2QMJA 3ZJ6A 1UR9A 3FAXA 1F4AA 3RILA 2VMFA 1GOQA 4UZSA 3IANA 3CMGA 1GOKA 2O9RA 4MNMA 4U3CA 2BVTA 4WSKA 4EKJA 5A6BD 4UTFA 5A8QA 1JXJA 3ZMRA 1QI0A 3WMSA 1QNRA 1XCWA 2QHAA 5CJ5A 1MW0A 3RO8A 1E6XM 1EDQA 3PZUA 4GI6A 2QPUA 3VILA 2ZXBA 1ZB5A 3WL1A 2BXYA 5CZKA 1UUQA 3MSDA 4WKAA 4GPNA 4AZCB 4NSBA 4AIOA 3WENA 1BSIA 4PEEA 4W7UA 4XB3A 3CHDA 4CCCA 4W5ZA 4D6JA 4GZEA 1W9BM 1XHGA 1O6IA 2VTFA
chains in the Genus database with same CATH superfamily
4V27A 3QLDA 1UC4A 3G1DA 1UWIA 2IXVA 4UFJA 3VINA 2GJLA 1UD4A 1VYPX 3WQEA 1XM3A 5HMDA 4EWND 3DIPA 3WKZA 1K8XA 7REQB 4FF7A 5BXRA 4MB1A 1L6FA 4KFNA 4DB7A 3VGGA 4N02A 1A80A 2Z25A 3G2GA 2VGBA 4P2VA 4E4PA 3BQ5A 1YLVA 1KR1A 3BAYA 3R2GA 2GVEA 4NQ1A 1GW9A 3UPWA 1Q6LA 4W8BA 4XX6A 4DO6A 4AC7C 2QCMA 2J6XA 1XLJA 5KZ6A 4MFDA 1R9XA 2PU0A 4AFYA 3EA1A 4JTFA 4MTVA 2G3IA 4DO7A 4ZE4A 1R2TA 1XIFA 2WNZA 1OYBA 3KBMA 3QGAC 1XYZA 3PG8A 4M7TA 4OV9A 2IKIA 5EKYA 3WUFA 4P8XA 4KEMA 5LXEA 1QPRA 4QP0A 4UNLA 1BXNA 1R2SA 3GX9A 3S2NA 2CBVA 4AH7A 4MYXA 4QE4A 4UMBA 1PTDA 3MV11 3QFEA 1ZAJA 1CGTA 1A4LA 4Y96A 2VL4A 1GEHA 1QWGA 4YU1A 3GO2A 7TIMA 3VDHA 2DPEA 4K7VA 3BW3A 3ZJ7A 2ZE0A 2FGLA 1S2AA 5E1QA 4MADA 5F2IA 3PZIA 3UG5A 4KRTA 2WMJA 4M6VA 4WKFA 3NOYA 1BRLA 1TQXA 4O1AA 4PUWA 1IWBA 3I68A 3Q67A 4NL1A 2E9LA 3SO7A 4BKNA 3GIPA 2DZBA 3BLFA 5JQ9A 3RR4A 3TLQA 1YBQB 4IG2A 2V2CA 1V0NA 1E0WA 4IIBA 5I0DA 5IBXA 3WN6A 1TJ1A 3VD5A 5BZAA 4MWAC 3VE9A 4ZENA 3H2NA 2GJXA 3E0IA 1POJA 3AXHA 3GSMA 4YTQA 4HIBA 3PUGA 4XD3A 4EVZA 3FA3A 4AMCA 4F79A 3LG3A 4ZOAA 4DJDC 5FJUA 4UTTC 2E6YA 2V81A 4KWWA 1JJKA 3TIMA 3AISA 1PWMA 3E2RA 1C93A 1UR0A 3H55A 1W8GA 5HJXA 2QEZA 1I2NA 2ISSA 1VFLA 4LWWA 4FO4A 3TW7A 3N6HA 3GKFA 5G2WA 5IM51 1VPXA 4YYFA 3N6QA 3ZR4A 2R8WA 4EWJA 1V77A 3ORWA 1D9EA 4E0CA 3U48A 4CNUA 4Z0SA 4IF2A 3F4CA 4H6RA 8TIMA 2QZRA 4UFLA 1JFXA 2Z7KA 4MLJA 4H41A 3KLLA 5CH9A 1YNYA 2H8ZA 3T4WA 1FWEC 5DELA 1LWHA 3S1WA 1OIFA 1CXEA 1XBXA 3TX9A 2WKLA 3PTDA 3V1PA 1X39A 3WQVA 4C7FA 3CO4A 2I5IA 2OT1A 3GHRA 1BVZA 1JI2A 9XIAA 4FSAA 3VIHA 3MHUA 2HV5A 3MQTA 4IWWA 4UCFA 2CLOA 3PN8A 4JQ4A 3AC0A 1M5WA 2GK1B 3CEUA 1W5NA 1TTJA 3WF1A 1T8XA 5FF2A 4GVHA 1RK5A 3KP1A 4DUXA 2JF6A 2WMFA 3TWBA 1XD1A 3WQFA 1XF0A 4NZ4A 4B5VA 4J3TA 4GJIA 2YZ5A 2NUWA 3VI2A 1GKQA 3HIJA 3MMWA 2PLMA 1X1ZA 1PHWA 4B5SA 2FJKA 4OKDA 2B0MA 5DMMA 1JNDA 3QF0A 1OINA 5AVNA 4CCZA 4GABA 2XPKA 1WB0A 2C15A 2Y61A 2V68A 3QQ0A 4PCFA 4N7QA 3VNDA 3QJAA 1QK2A 2BGSA 1I45A 1MUMA 3M0YA 1GVEA 1ME9A 3CQKA 5ABFB 1GOIA 3FS2A 1XYLA 3FEMA 4P5UA 3TK7A 3NL5A 1KLYA 3L4WA 3M47A 4KH2A 1RD5A 2GVJA 2Y8KA 1N8WA 1WE5A 1WZLA 3W7RA 3CZEA 3LK6A 4MWAA 4F2TA 4FLRA 3N3MA 2GUBA 1K03A 3BGJA 1OC6A 5AHMA 4GO8A 2BOEX 3MCMA 5DXYA 3U2EA 4Z2HA 1LBMA 4G7FA 5CG0A 5J5DA 4DJDA 5CPTA 1KFBA 1HP5A 2IKGA 3N04A 2OLSA 4GYJA 2NQ9A 2HS8A 3GG1A 1XBZA 1XQLA 3U2OA 1U1HA 4YTSA 1NQ6A 1Z8AA 3WZ0E 1LG2A 4CNNA 3WBWA 4ZOEA 1H11A 1GKPA 4GBUA 4B90A 3B8VA 3P5YA 3LXAA 2V5JA 3MMDA 2W6RA 2G50A 4HNTA 3SCTA 3L5AA 5BCAA 2WMGA 2F8QA 2YCLB 1AFSA 5D32A 2PRHA 2PCQA 3TE9A 4Z42C 1OZMA 4N9DA 2CWXA 3OTRA 1I2PA 5I78A 1QK0A 1EYWA 2NXHA 2OPJA 4JQAA 3FKRA 1L8PA 1V6YA 1IEVA 2VWSA 2GPTA 3EPOA 4IFRA 1RY8A 1JZ6A 5H91A 3KEHA 4REQB 2Y5SA 1PBGA 3QQWA 2ZA3A 1NU5A 3AMKA 5FEXA 1OQFA 1AA1B 5D9NA 3TEVA 3SGGA 2IKJA 3V0TA 3TZNA 3NDOA 2VQTA 1KKRA 3STPA 4CNPA 5DCDA 4GBDA 2WW5A 3ARZA 4Z1DA 4CU7A 4M56A 2WHJA 3B0VC 4RKAA 4GQQA 5A2AA 2W9MA 4TXEA 1K6AA 4UOZA 3SIZA 1KV5A 1JPHA 3DEQA 2DVTA 3P81A 1B2YA 5D04C 5EY5A 5A6LA 1ICQA 1ZNNA 1UROA 2Z6IA 3IV8A 4KWOA 1RH9A 2R14A 4IPIA 5JH2A 2X09A 3ES7A 1CDGA 2GWGA 1X6UA 5BWAA 3N13A 4PEKA 3WQ6A 3HN3A 1Z32X 3GTXA 4C7DA 1FFRA 4NU7A 2UV8G 2Y8UA 3LTYA 1H7XA 4NY2A 3S5ZA 3AMDA 3K1DA 1K9TA 4YHGA 4O50A 2V8ZA 3OVRA 3RK8A 3R13A 1C8YA 5JBEA 3K1GA 4D8LA 1RVKA 3ZLGA 3BZGA 1JCNA 3RMEA 3R8GA 4GC3A 2DP3A 5I23A 5JMUA 1ZCCA 1UP3A 3F5LA 3WBAA 3GW0A 2EPOA 3IIPA 3CMFA 1UR1A 4M6UA 2YCEA 1J10A 1OT2A 2QAPA 3GU9A 4LH8A 4KWUA 5D05A 1QI2A 1WV2A 5GVJA 1NWUA 2NWSA 4IIHA 4XSLA 3WQPA 2FLIA 3UPMA 1CECA 3VCRA 1FWGC 3TYDA 1OYCA 4GNVA 3A22A 2BODX 4W88A 3UWZA 2PDHA 2BTMA 1EKOA 4DZ5A 3G5EA 3TTQA 3GQYA 3SEPA 1ZBVA 3O9NA 3S1UA 2HPMA 4DRSA 3AHVA 4LGXA 2ZC1A 4LV4A 1WXYA 3B9NA 5REQA 1EBHA 3WX7A 4FZIA 1RA0A 4ENLA 4Y9OA 1WUEA 4IMGA 4S3CA 1SFTA 2NV2A 3UEQA 1K8CA 2PGEA 1DJXA 2YA2A 5I3DA 3OLDA 2C71A 2VRJA 4RE0A 4ZO7A 2VUYA 3GXIA 1XL9A 3P82A 5HNUA 1E0XA 3H4GA 4NJJA 4O1FA 4A21A 3NSNA 3CPGA 1UD8A 4J35A 3G1YA 4D6DA 2WCAA 1QAPA 3VIIA 2X1IA 3U0HA 2VVNA 3FA4A 1R9YA 3J7HA 5BYWA 4PUUA 1OGGA 4K39A 2PWVA 2QF8A 4CN1A 4Z2JA 3XIMA 3WQGA 1YDNA 3RNDA 2C7FA 1WQ5A 2DEPA 3E0WA 2J13A 4KETA 3MI3A 2VX5A 3OG3A 3VABA 1B90A 1HJVA 2X41A 2A3CA 1XGZA 1U5VA 2YCIX 4NYYA 3U9IA 5XINA 5HK4A 4ZSTA 4CU8A 3W38A 2WSQA 3PZQA 5IDIA 3W22A 4JIEA 5I3GA 4O17A 4C6BA 2G3NA 1UC5A 1CGVA 2X42A 1WDRA 2ZXDA 2OSXA 5CLTA 3E0LA 1OVDA 4EK7A 3GAKA 3LLFA 3WH9A 4F48A 1AL8A 1H4PA 3CYVA 1QUMA 4I8YA 3BLLA 4HTBA 1KRBC 4GUHA 3REQB 3L5LA 1X7IA 1X96A 1RCQA 3HB9A 3K4DA 4M82A 1P6BA 1WKDA 1GOOA 4UQDA 4MVAA 3VKAA 1F6PA 2PDXA 5AOUA 3DUGA 2YLLA 4XSMA 1HT6A 1V6TA 3BG9A 3NGFA 4AB4A 2CXGA 2X2YA 2ZZ1A 3EWZA 1TJPA 4HPHA 3ZLHA 1S38A 4FHAA 1HO4A 3D47A 1WAWA 1XH2A 4KERA 4O10A 3TR9A 5C70A 1B3WA 1GNXA 5EPDA 1KNWA 4MDOA 5G5IA 2EPLX 3O0KA 2Z1BA 1IQ8A 3S5SA 3WQ4A 1KXQA 3CUJA 1OFRA 3R8HA 3KZSA 1DL3A 3W2NA 4GMEA 1FX6A 1BWLA 2ZA2A 3ZXWA 3MBDA 4PCNA 4NNAA 1KCXA 1MVYA 1TWSA 2YA1A 4JFUA 2QDHA 1EPXA 3PFMA 4XISA 4HD5A 1W6TA 2OYMA 1O1ZA 3NXLA 7A3HA 1M3UA 4LFYA 3ZOAA 2PDGA 5EA9A 3PSVA 1OYAA 4J2MA 2Z2AA 4DBWA 3WQCA 3CLMA 2XGBA 1RK6A 1XLCA 1YTDA 1G01A 3LTSA 2ZUVA 4ZB5A 4X2RA 1TTQA 2AAAA 4JKMA 3OQ8A 3P8IA 1A5AA 3VZZA 3IEBA 5I7GA 4DXKA 5LYRA 1FWCC 4WDTA 2H8XA 2WZIA 4FNQA 2XFRA 1E40A 4C6PA 2PDUA 2H6RA 1PVNA 2XIJA 3FJ6A 3OLEA 4LB3A 2V2HA 5DY2A 3KE0A 3KL0A 3WJSA 3C56A 3W7DA 2Y1HA 4IPPA 1XH0A 3W76A 3T81A 3BSGA 3G0SA 1VFSA 4MY9A 4H1ZA 3RRXA 3WG6A 2JBMA 3LMZA 1A5CA 5KETA 3QN3A 4HNCA 4B5UA 4CN4A 1GOMA 3E2QA 3UG8A 4CVUA 1WPCA 1X6NA 2Z4GA 1R5YA 3B05A 4MUZA 1UWQA 1QU4A 3NQEA 1SW7A 2EJAA 3BDKA 4OJYA 3MHGA 2BASA 5AZ0A 4I3GA 5I79A 1DWAM 2NVDA 1X1NA 1S2UA 2RH9A 1MUCA 4ADTA 4E4FA 1F61A 1K4HA 4N4PA 2ZBTA 4D8AA 4DI8A 3HPXA 3M0KA 4H9TA 4FF5A 4DNMA 3TTSA 1W3KA 4S23A 3UXLA 3AQUA 4GCXA 3H24A 7ODCA 1Q6GA 3W37A 4U2YA 2WZHA 3WLJA 3QY8A 5AYIA 3TCSA 1BTMA 2CZVA 4GUGA 2NZLA 1KLZA 4UBPC 1L6SA 1DJWA 2NQHA 2RJGA 1U2YA 1RCXB 5DO8A 3OHIA 3O8AA 4AZCA 3Q2DA 4D1JA 5RUBA 3THAA 2B7QA 1VEOA 3GAYA 3SJ3A 4HGXA 1K9DA 4PRWA 1LBLA 4AYGA 3W2JA 4LAMA 4TR9A 3B04A 3MSRA 4H8VA 4Z0JA 1AK5A 4XWUA 1JYVA 2XFFA 4AW7A 4HA4A 4C6KA 3GW3A 4DO5A 7REQA 1H5VA 4FB7A 1YPFA 4U5IA 5DX7A 4EPBC 1JDEA 4ZQOA 4TX8A 2ZFAA 2WSYA 1OFPA 2BS9A 3TNBA 3RM4A 3YPIA 3LV6A 5C9RA 1IHIA 4RNJA 1H5YA 4NZCA 3S8HA 1CI1A 1J2WA 2AL1A 3OZPA 1E4IA 4XD5A 1R0MA 3IUIA 1V3HA 1P6WA 5I6SA 4IJRA 4CQCA 2OYKA 4AVOA 1PWLA 2Z1WA 2OVLA 3GTFA 1TJ0A 1QMLA 1JPDX 4KIEA 1W8SA 4JTHA 1XIEA 3EB4A 4RDYA 3G1AA 2BHUA 5LXXA 4LVFA 4J3UA 1BPLB 3L4YA 1XSIA 4N2YA 3RPMA 1H60A 2P3ZA 1XIJA 1ISYA 4ECLA 2VM8A 4C6OA 3SCNA 2CWNA 2ZVRA 4HMNA 4Q7BA 4I5XA 3VC6A 5D9MA 2VCCA 4PMRA 4CD5A 3IGUA 5AHIA 3W4RA 4NT0A 2XWEA 3U6WA 4O0KA 2WXDM 4N6EA 1NP2A 3ZVHB 2X7VA 1H62A 4Y90A 1ZRQA 1GZJA 6A3HA 4LYQA 4LCSA 3EDFA 4WY0F 1V0MA 3TU9A 1FWFC 1XGDA 4GE8A 4GH3A 2WVTA 2NSOA 2CLPA 1YBQA 5AB3A 1XUZA 3E5PA 1XLFA 1LBFA 3N29A 1XICA 3MI2A 4DF2A 1GVOA 3MVIA 2YLAA 2E8YA 1DTUA 3O1NA 5D02A 1W1B1 3CT2A 1TV8A 4Q8PA 3T9PA 3HMJG 3KVKA 4H9XA 3GNRA 1TRIA 5C8BB 3MSGA 4KKXA 1JZ4A 5MKGB 3JUGA 4H7VA 3TONA 3LS9A 4ORIA 1HKIA 1W9PA 1RXOB 3LXBA 3A4WA 1KXVA 3N1AA 1GZGA 1MNZA 3S2LA 3VD3A 4FR6A 3PVFA 2CBJA 1I0DA 4A8RA 3MP4A 4UTWC 5FF4A 3A21A 3KBNA 1JZ5A 3WDRA 4UCGA 1MXGA 5FF3A 4QX4A 4GXWA 1I9CB 3KCJA 2WNQA 4AF0B 4JKLA 7CGTA 4EPKA 4W7VA 4JEJA 4Y8FA 1IZKA 2J7HA 1EIXA 3WDHA 5DANA 4L6OA 4U33A 3MHFA 4UFHA 4QRNA 3VD9A 2PDCA 4LNYA 2VEIA 3FAWA 5B7ZA 1DIEA 4J3SA 1R86A 1UZHA 3UJEA 2W0UA 1HGYA 3WUEA 4HHHA 2D2GA 3N14A 1ZU8A 2BFGA 1KRMA 1XIIA 5LA1A 3I6RA 3POHA 3RLHA 2NT1A 4GNJA 4GQRA 3LCXA 4WGXA 1PL9A 2C1HA 1V51A 3S47A 2TPSA 1H63A 4AY8A 3IARA 4JCLA 1PPIA 4Z1CA 4PBFA 2YCKX 3B9DA 4UXDA 1RJPA 3TTEA 3GXFA 3WMBA 1QASA 4JHOA 2BY2A 4NIRA 3IJQA 3GR7A 2PWHA 3M0HA 3WO8A 1XYFA 2V5LA 2GK1A 1MEWA 3NM3A 3DN5A 3SQSA 3D0CA 1ALDA 2WKJA 3I6TA 5K9DA 1RCOB 1NELA 4JIIX 2PFHA 4ICNA 3K4WA 3L5MA 3DCPA 1PEZA 3DGRA 3PZ9A 3ARPA 3OIHA 4O57A 3HGRA 2B31A 3W26A 4M0XA 4YWIA 1TUFA 2G8ZA 3TW6A 4YVPA 5HXMA 1QNSA 2VDGA 3QKZA 1QW8A 1OEPA 4IX0A 2ZWYA 4Q8VA 1H49A 3FJLA 4X2PA 5CJNA 4BEUA 5D03A 3WUGA 3GFZA 1TR1A 1T5AA 2V3FA 3F5JA 3HV9A 3HGSA 2CBUA 1YHTA 4I7VA 2EPKX 2PP1A 5BU6A 1EWDA 2NLIA 1TA3A 2C8NA 4IGMA 5HNTA 3NPVA 3CV2A 2PMQA 4JL1A 2HE8A 3K8LA 3K46A 4X0VA 3GNDA 2O4QA 3D6NA 3Q58A 2CC0A 1QW7A 1P48A 4AISA 1DIOA 3W71A 3IJ6A 2GYIA 1D3CA 1PZ3A 5HMSA 4ZMGA 2UY2A 2ZDSA 4N9BA 1I6NA 3OYZA 4XZLX 4PTDA 3VUPA 2HMCA 3APTA 3SQMA 2TRSA 4H6QA 1OCNA 1RVGA 4UTWA 2PZNA 4S3EA 4LCRA 4CCEA 3VIOA 4BHYA 4JKKA 4YIWA 4TTGA 2PGRA 3CNYA 4OTKA 4ICMA 1FP8A 1XR2A 4NASA 2DSKA 4M80A 4XQ6A 2YCLA 3DG3A 1GKRA 2JQXA 1V8EA 3L68A 1FH8A 3SUUA 3GVVA 3OODA 1OK6A 1Q85A 3OPSA 1JI1A 2J27A 4HOXA 4RK8A 1H51A 2FTPA 5T91A 3RN6A 5JU6A 2CFFA 4I9TA 4WVXA 4YS1A 4MY8A 3NQ7A 4H9MA 1US3A 3OZYA 4REQA 4AIBA 3JZEA 3T2PA 3OZMA 3GNOA 3AIQA 3UG3A 1TVPA 2BZNA 4QNWA 3UESA 3P6LA 3BLIA 4GIEA 3C5QA 4GACA 2X1SA 3EWUA 5G2IA 3M0MA 4XZIA 3Q4DA 4Q8NA 4US5D 3W7HA 1CXLA 1O5QA 3OLIA 4WIWA 3W1NA 3HQ1A 2A3HA 1GHSA 1E0UA 5F7UA 2YB1A 2E4TA 1RLDA 5DRIA 3WD3A 1Q7MA 3WQ8A 3CUGA 2ESCA 4IP7A 4MNJA 3P60A 4QJ1A 1C91A 3W01A 4E2BA 2FZNA 1NWRA 4D1IA 3P74A 3NDYA 3B97A 3ZFHA 1GQJA 4QEEA 2UBPC 3AIEA 4KWVA 4P8UA 3PP7A 1QPNA 2DZUA 1HL2A 1SGJA 3PWIA 3UWUA 1CB2A 3VOJA 4FOKA 5LIXX 5JBDA 5CC5A 5LHEA 1ZJIA 3C8NA 3LBOA 4ZO9A 5DRCA 3WJZA 3PR2A 4XUYA 3EA2A 1E70M 3LGEA 4PGLA 5BXSA 3W1QA 4HA3A 1R7AA 2PDQA 3BMXA 3CB8A 2XH0A 1WA3A 3FXGA 5CZJA 2VZOA 1FCVA 3OEXA 2WJDA 1DJZA 2CZDA 4Y6GA 3NPWA 3V0SA 1MYRA 1SUXA 1BYDA 3EDDA 1E73M 5AHNA 2D0HA 4H04A 1KXTA 1OHLA 2UY3A 4AHPA 1JZ7A 1EJXC 4IFKB 2AOSA 3K8MA 2E8ZA 3AJXA 3VIKA 3E2SA 1QNOA 5BMWA 1HL9A 3FYOA 4BK9A 1KQYA 3BLEA 3DFTA 1QDSA 5T9BG 3HG2A 1GTEA 1IZJA 4ACZB 1PS9A 2NT0A 1QJWA 2J66A 5TAOA 1SSGA 4F0HA 2ATMA 1LTDA 3T8LA 1R3TA 3BG3A 1QWKA 3EB2A 1O12A 1JCMP 2I1OA 2PC8A 4HA0A 3O6DA 3NL2A 1K1DA 4LW7A 1TCDA 1JPKA 1MW2A 3ARYA 3DHPA 4C6EA 3QC3A 4Z2KA 4Q7NA 3UNDA 3TN3A 3OOQA 1CW2A 1MXDA 3MO7A 4FX8A 2FDMA 1E9LA 4JTKA 2G37A 4DWSC 1P5BA 1YXDA 3MV01 4PC8A 3RF9A 1M9HA 2OFJA 4OUEA 4HB7A 1ML1A 5C2XA 4JDBA 1L2UA 3N9KA 5GJPA 3ITGA 1DQXA 3G8RA 1Z42A 1A3XA 4QNEA 3SGUA 4CQ9A 3B8WA 4E4UA 5CBIA 4AWUA 1UB3A 1YEYA 1PTAA 4PRRA 3LCHA 1E0VA 4F2UA 3IV3A 3WL0A 1KBJA 2CLKA 4XZHA 2ASHA 2WJZA 4EE9A 2DQXA 1KFWA 3R1ZA 1C90A 1NWSA 3AIRA 3S3GA 1M53A 4JTRA 1YADA 1Q45A 1XSJA 1V03A 1UPPA 1OIMA 4FNSA 4HSNA 2HPIA 1Z48A 1LT7A 3VIGA 1NOWA 5JVLA 1UR9A 4QITA 4DPPA 3UWVA 3MB9A 3RILA 4HJWA 3IANA 3OVGA 3TZFA 2INEA 3C3NA 3SGZA 1KO0A 1T0OA 4EKJA 5A6BD 4IX2A 5A8QA 3GB6A 2OT0A 1QI0A 4O14A 4IQDA 3FJNA 2QHAA 4ZOCA 3H2FA 5FF7A 3OJGA 4E8GA 3W7LA 3DFNA 4H00A 3HPFA 2BXYA 3PY2A 4JIRA 4W7UA 4XB3A 3M5XA 2D2HA 3CHDA 5AKQA 3MC5A 1GG1A 4AX6A 2RDWA 3TYZA 1W9BM 4OHQA 1G7UA 3OVPA 1O6IA 5LZLA 3WLRA 1NFPA 3EOLA 1DEDA 3H23A 1R30A 1UQZA 5U7SA 1S1RA 5FI8A 3AICA 1LLOA 3FEQA 5L6UA 5FJOA 2DORA 4X9SA 1JCYA 3ELFA 4RE4A 1JYNA 3NIYA 4KESA 4AIUA 1W9VA 3S83A 4OE7A 3ARUA 3WMCA 4M6QA 1KRAC 3GG8A 1FUYA 1UR3M 2QKFA 2D73A 1X1OA 2NUYA 3CV7A 4D8ZA 1QPOA 3AUOA 3RUBL 1LL7A 5EMLA 2QUUA 1EJUC 1Q8AA 1L6YA 4QEHA 2VURA 1ZAHA 1E0TA 2FVKA 3RPDA 5ABTA 5CC7A 1NDWA 1XP3A 4U2ZA 3TYBA 1FWAC 3VFCA 2J7GA 3BO9A 2EJ1A 4A4AA 5K3VA 4WKHA 4BR1A 5LKYA 1YQ2A 5IOBA 1V7AA 3NA8A 4NRRA 4GLEA 2CPUA 2W4XA 3ALGA 1OGSA 5G1YA 1I1WA 4FEZA 2VHLA 1UA3A 3KX6A 3USBA 4TV5A 5CLWA 1QNQA 3WLSA 1FWWA 1C7SA 3PTMA 2NQLA 2ICSA 4DUWA 5HPCA 3B9EA 1F3EA 2IQ0A 3ONCA 4L65A 3R0KA 1FWTA 4MB4A 1FHVA 2AQWA 3B0PA 4PCTA 2I7GA 2XISA 3HOJA 3SB0A 3MMTA 4U10A 3A6OA 2J88A 2XVNA 1GYMA 1P7TB 5DCEA 2X0HA 3FN9A 2ISFA 3ARQA 2CW6A 5XIMA 4H2HA 5JIPA 3HJEA 1G67A 1DHKA 3PG9A 3G6MA 3N34A 3W7CA 3D3AA 1S5NA 3JR2A 2Y89A 4L1GA 4DBUA 3LQLA 3P3BA 1Z69A 1UMYA 5FAJA 1EZWA 1KB3A 2BVWA 4ZQCA 3W1AA 5A8PA 3NNTA 2D22A 2E6DA 3B03A 3M1ZA 3ARSA 2JEQA 3DI0A 4XBJA 5C2CA 2I14A 3O07A 1I1XA 3L0KA 4HN8A 1TZZA 1G4TA 5C2GA 1JDFA 4IL0A 2AGKA 4A3RA 2PSNA 1HKKA 2AQVA 2XWDA 3TMLA 4Y9AA 3RU6A 3LI1A 2QCEA 4G1KA 1LF1A 3M7WA 2BP1A 3AHXA 3U5UA 4C6LA 4O53A 3G3DA 1R85A 1O1HA 3MTWA 1ZS2A 5E9XA 1TB3A 3GD6A 3SUVA 3BC9A 5GQBA 3A3XA 4OT7A 2VUNA 3BGAA 3OQEA 1C8XA 1LWJA 5I77A 2G5WA 1YMYA 4E2VA 3VD4A 3M6YA 2DZWA 1YE6A 1J01A 1LORA 2D20A 1I0BA 2HISA 1S2WA 3EZ4A 4W8AA 4Z1AA 1F05A 5PTDA 4UTIA 1EJSC 1RP8A 3STCA 1SQ7A 2E6FA 1Q8JA 3PAJA 3PZGA 3WK3A 3RDKA 4UTLA 2QCHA 1BYCA 4HMEA 3WD0A 4H2CA 2TYSA 1BF6A 2R91A 3S6DA 3L4XA 1VAHA 4ML9A 1KTNA 3P5ZA 1PE1A 1CXFA 1A5SA 2TMDA 4MMWA 4Y7EA 1VPQA 2GVYA 2YL5A 3HQNA 4K8EA 3TAOA 1FCBA 4A2SA 3GY1A 4MDPA 2PP0A 1N8IA 3N18A 4JX5A 1YRRA 4D6IA 1Q7ZA 4URIA 4R85A 3CZJA 1W1A1 2P50A 2OLHA 3OGRA 3LA4A 3CQJA 3W7KA 4U31A 1L9WA 4AU0A 1OG0A 1Z7AA 3ZVIA 2OO0A 1YKWA 4Y8EA 2WZTA 1VRXA 2R24A 4P8VA 1B57A 3KXQA 1XLIA 2DZAA 4DXVA 3LLDA 3N15A 1I4NA 1YW1A 3G0XA 1FDYA 1TCMA 3VKDA 3EKZA 3WY1A 3RO6A 2UY4A 1VJSA 2C1IA 5HINA 1TSIA 3FKKA 1OK4A 4JYEA 2H3DA 3TUUA 1OZQA 1BYBA 1IEWA 4GXMA 3EOSA 1KW1A 4M1RA 2QW5A 3CJPA 2Z2UA 4ZB0A 4AD1A 4O16A 1A5MC 4CNSA 4QLKA 3EOEA 3H2OA 1WUFA 3IRSA 1HJQA 1Q5MA 1JVNA 5CSYA 1XWYA 2P0IA 3QQ1A 1F3WA 3I3DA 4B3KA 1JDCA 3QPYA 5HMEA 3NQBA 3N11A 4C6JA 1PZ1A 2OX4A 2DY3A 3W7IA 4QAWA 5HNRA 5ENLA 4C1NA 2X1TA 3UZYA 3FHAA 3EYPA 3TQVA 3UXAA 3EMQA 4IGSA 5D2XA 5BW6A 2G0WA 4G7EB 1ESWA 4G9PA 5MKGA 4V15A 3VO0A 3NSXA 5CPNA 4WUIA 1DJHA 2VP8A 4AWEA 1SVDA 1SFJA 3HPSA 4FLOA 4H9ZA 4CD8A 1NARA 5CC6A 2QXWA 3UFYA 3DH7A 1J0ZA 5HMFA 3W84A 4J1OA 3T07A 3CTLA 1GPWA 1JR1A 4IMAA 3W1UA 1K4GA 4TUFA 4EXAA 4QDWA 3VIJA 1JD9A 5DMLA 2O7QA 2G3JA 2QUMA 3N4FA 3VCNA 2JKAA 1ELSA 4KFOA 4B5TA 2XH7A 4AF0A 3NO5A 2V63A 2I17A 3O06A 1DVJA 3M4HA 2J7EA 4WQ6A 4IGHA 3L2MA 2WJEA 4MZ1A 4EXQA 1OGBA 1NSJA 1BXCA 4CU6A 4JTJA 1TPDA 1VPYA 3ANUA 5K9XA 3WFAA 3KVJA 4M51A 1UHVA 3GC5A 3KZPA 3UVIA 3WCZA 1P0BA 4ONVA 4HNLA 3LM3A 4HQVA 5I3JA 4Q8OA 2C79A 2FPVA 1BLIA 4JIQA 4FNPA 4X22A 4XKYA 3I4KA 1JZ2A 2RGLA 2VZUA 3IAQA 3RCYA 3TYEA 2I9UA 4AWSA 1XLHA 3SRKA 1QT1A 2PTXA 5FEPA 1ZSXA 3DFQA 1PAMA 2AAMA 4R3UA 3PBGA 2NV1A 1KRCC 3RU8X 1TTIA 2PEVA 3D46A 5FEWA 3PJXA 1TPFA 1SZNA 5AN7A 2NSXA 3CM4A 4L64A 1CCWB 1IXOA 3WH7A 4IFOA 1DBTA 1S2CA 4AXKA 3G1RA 4QG6A 4NNCA 1V4YA 2ZCGA 5CPMA 4HPGA 5EB8A 4WX2A 1CGXA 1PJ9A 1CGWA 3QFWA 4P61A 3SCWA 4WSJA 2Q3RA 2DIKA 3B9AA 1JGMA 4XD4A 3F1QA 4Y9MA 1TX0A 5KZMA 2Y7FA 3CUHA 2FFIA 3UGRA 1KA9F 5C7VA 2Y7GA 1JPIA 5EL1A 2D2OA 2DT1A 1LG1A 4X63A 5A6AA 1I75A 4MWAE 3S9ZA 4FA3A 5E9AA 1UH2A 1W9UA 5I2UA 3N4EA 3B0UX 2CNCA 2CHRA 4GVFA 2OSWA 3KL3A 1XYBA 4JN8A 2OB3A 3AMLA 2L5HA 1DJGA 1ZZMA 3IACA 2YDQA 2WYSA 3TVAA 4L6DA 3W73A 1S1PA 3C0LA 1B0IA 3KM8A 1UKTA 1Z44A 3V4BA 1OD0A 3NYZA 2OZ3A 1IWAA 1A0CA 1US2A 4DLFA 4O4WA 1Q6FA 4LVAA 2ON3A 3T0DA 1LL6A 5G4WA 3IWPA 2A2IA 4OUIA 3GDBA 3WDPP 1GW1A 2INFA 2XN2A 4FMVA 4O4VA 1V08A 1OC5A 4LYRA 3ITOA 1VYSX 3GBEA 3M43A 3KUMA 2WC7A 5M2FX 3LI0A 4QS5A 1JFHA 4IPNB 3NFUA 1EJWC 4EX4A 1QO5A 4DBEA 2WPBA 3PK7A 3CZKA 5F4XA 2PDPA 3DYMA 3WLNA 2QT3A 3WQDA 1NOFA 3IK4A 4PMOA 3W7QA 3PNUA 3VNZA 1IXQA 1BTCA 3B0YA 1J0JA 4D6GA 3L9CA 5D2TA 1UMLA 2V5DA 2X30A 3PWGA 3UY7A 2X2GA 3NUKA 3WJYA 4S3FA 1QFEA 4HP5A 3W7GA 2ZXQA 1ZHAA 2GOUA 5CPSA 2J9XA 2ZA1A 4HYWA 4RNIA 3E6EA 2WQDA 5EBAA 4OFCA 4O52A 4Q6XA 3N9RA 2ODOA 3RM8A 2OGYA 3R4IA 1SJDA 2PZ0A 4A29A 3TMQA 2W61A 2G3FA 1TELA 5E09A 4DYEA 3PAOA 1V93A 1MZHA 3HFTA 2DFAA 1ICSA 3H26A 3KOXA 3UQNA 1DQUA 3M0LA 3QGVA 1EDTA 4XUGA 3SUWA 3BAIA 1HKVA 4W4QA 1N7KA 1XLMA 4MYAA 4JAWA 4AC1X 3W27A 5G4HC 3E2VA 3T44A 2A3AA 4HHMA 3SRDA 1W37A 4DELA 4QISA 3SSZA 2VGGA 2ALRA 4LU0A 3SURA 4B4FA 4ORMA 1BXBA 2J9YA 3VGFA 4WLCA 1JAEA 4IXXA 4DJEA 4KGJA 2VC9A 2OZ8A 3ARTA 3WLTA 1H7NA 4O11A 1W91A 4PSRA 4WXZA 3WBYA 1D3GA 2OTDA 3FA5A 1J5SA 2W67A 2HCVA 3AIBA 1RQHA 5H8MA 4J5NA 3BAXA 3AJ7A 3E12A 4S3BA 1DJQA 3ENLA 2A6NA 3WQWA 2B7PA 4W9TA 1M01A 3PUEA 1VR6A 2X05A 1FXPA 3HG3A 4NJIA 2IW0A 2D3LA 5GJNA 1DXIA 4F4RA 4ACZA 2XVLA 3I7QA 3PBMA 3PZOA 1SMDA 4XIAA 3ECQA 3W1LA 1E3XA 5CBBA 4LF2A 1UPMB 3R8RA 3P8JA 3QW3A 2EBNA 4O8RA 1QNVA 3UJRA 4FXSA 1R46A 2BDQA 4AVFA 1NFGA 2PA6A 1HX0A 1L0PA 2PF0A 1FWNA 4E2DA 3LB0A 3CEPA 1EGZA 3GR4A 1KM2A 4RDZA 5TIMA 5GPRA 3MUY1 2FH8A 4H9UA 5KTLA 1G9HA 2FQIA 3BAJA 3BH4A 1B4EA 4DM2A 2WAGA 1FQ0A 1B9ZA 4RR4A 2HBVA 4L7ZA 3R89A 1F6KA 1AZ1A 2JK2A 1OD8A 2QYGA 3TC3A 3DBNA 1UD3A 5CSRA 4HU4A 2QPXA 4GRSA 2WHLA 2QLYA 1W5OA 3ZS4A 2HSAA 3A64A 2PWGA 3VPLA 1UWRA 2DH3A 1UH4A 3QTGA 2J25A 3VVGA 1TG7A 5GNZA 1UR4A 1V0LA 4WDUA 1IE7C 4JTIA 1AQMA 4S3JA 3H2EA 2HZGA 1SYTA 4WHBA 4RNFA 3UJ2A 4A05A 1W1PA 2E5CA 2GGHA 4J3ZA 1R3WA 4ROQA 2V30A 2PTDA 1V3KA 4NVTA 3W7JA 3MY9A 4LC8A 4PE8A 4MAZA 3CHFA 2XZ9A 4JZ5A 4UNIA 4JQ3A 1CBGA 3ZZ1A 4AZIA 5G2HA 1UR8A 1XYMA 4NAEB 4AX7A 4CCDA 4PMDA 4IUOA 3N3TA 3T7VA 1ME8A 4YMZA 1ODUA 2R1KA 1IT7A 1XX1A 5AHLA 2VQUA 2QJIA 1PSCA 1ECQA 1Y5VA 4EF9A 5A6BA 2YYUA 3G22A 1UZDA 3SSJA 1ZL1A 3AMCA 2E77A 3V1HA 5DN1A 4AHQA 3BTNA 3DESA 1THFD 4AD3A 1F8IA 5E70A 3U2ZA 2OR2A 1D7KA 3H70A 3CIVA 4IPLA 1AD4A 3FCPA 1ISVA 3VKBA 3G18A 1QATA 3M41A 4KEVA 1IR1A 1BAGA 4IIEA 3M64A 1KBBA 1H0GA 2WWDA 5C9ZA 3U5YA 4B9ZA 1YTKA 3CYJA 4KCVA 2BXZA 1G94A 1F7BA 2O0TA 5LNSA 3L23A 3ITTA 5DBTA 4JOMA 1MQQA 1H1YA 3SADA 5HUPA 2WSPA 3BOFA 3IJDA 2DJLA 1M7OA 4OWGA 3ERPA 4PCPA 3KWSA 3XINA 3W87A 5FL0A 1I2QA 2HXUA 1NFBA 2NX3A 3SCSA 1LZOA 4UQAA 3RLGA 1XFCA 4I5UA 2W91A 4ZA0A 5I00A 3LPGA 3MP5A 3VUSA 5A95A 2V82A 4EANA 1PO9A 1ZJHA 4XO7A 3PZTA 5M03A 2J9ZA 2QAFA 1L2QA 1QBAA 3SUSA 2OX1A 2BOFX 1XV8A 1UZ4A 1Z3NA 3VAVA 4LNCA 3GIYA 4LAKA 2P76A 3CUXA 3TV8A 2GGEA 4IMFA 3RJXA 3NQGA 2FZDA 4GZIA 3LLXA 3A5FA 4OU1A 4D71A 3BE7A 1OFEA 3ZO9A 3ID7A 4EAMA 2OKOA 2OO6A 2ZRZA 1C3FA 2VDHA 2Z6JA 1K9EA 1H7RA 2VR4A 2F2KA 4JTQA 3MSYA 1P7TA 4GI4A 3L2LA 1A47A 2GLKA 3NVTA 1UP2A 3KL5A 1P6CA 2BMBA 3STGA 1OX6A 2NVAA 1TJRA 5C71A 3NQAA 1ADOA 4L5ZA 3I7RA 4I7UA 2EF9A 3EB3A 3VX1A 3T6CA 5CGMA 2EGZA 4QE5A 1VBHA 3AU6A 3S5NA 3ZM8A 3R11A 2VI0A 4XKMA 5H1WA 3MO4A 4X9YA 3TDFA 1TV7A 2F2HA 2IPFA 5C9UA 4NJHA 4GQBA 2CLLA 3SCUA 1SJAA 1UP0A 2RHGA 1QO2A 4H01A 3DHDA 5CBJA 2IUZA 2WBKA 4PFHA 5I09A 5A1AA 3ONBA 1CWYA 1I2RA 4FIRA 4RZ5A 1WOAA 4DF1A 4IGNA 4NILA 1ZY9A 4AEOA 2XN1A 4MNKA 4PFMA 4HNOA 1XLLA 1CLXA 1FWHC 4IIFA 2OZTA 5I24A 2QVNA 4RV8A 1HP4A 3BLOA 3GFYA 1E5JA 3EXSA 3GNNA 4Y9PA 3NQVA 1VC4A 3TQ0A 2HTMA 1EA9C 1UASA 1JNEA 1TE1A 3U57A 4C6IA 3W86A 2Y8VA 3P14A 4QS6A 2J7DA 2VRKA 4R53A 4KIRA 3H8AA 1PV8A 1W1YA 1EDGA 5TNVA 3ZIZA 3PBVA 1BWVA 4A3YA 1JRBA 1VFUA 2A3EA 4F9JA 2FVLA 1HQTA 4CQBA 2KX9A 4Q7IA 4AIEA 2HK1A 3T05A 3VNLA 3TLLA 2A7RA 4MJ2A 4O1DA 3G8EA 1HJUA 2PDWA 4GYPA 3U7VA 3HV8A 3E74A 4S2CA 1K77A 4UQCA 2OLAA 3QHNA 3LPFA 3DG7A 4GVIA 5EFFA 1W0MA 5MF5A 3I3BA 5AY7A 3NDZA 3JVAA 3R12A 2O9OA 2VJXA 2ZADA 1CGUA 1TREA 5D2VA 1O5KA 1E4MM 4PTMA 1V0KA 2INZA 4HPXA 4UB9A 1EO7A 1OFOA 1ECEA 2E9BA 2JIWA 5C7HA 4XIMA 1AH0A 4E38A 1ZCOA 3MUZ1 4P7QA 3CZ8A 4A3UA 4ATDA 8A3HA 1H7OA 1RPXA 2AL2B 2AKMA 2XH4A 2PLKA 5DBUA 1WX0A 3GLCA 1T99A 3GXDA 2WCGA 3BLDA 4S3DA 4O28A 2REQA 3LY0A 4HT3A 4FIQA 2VC5A 3V35A 4WJXA 2FZ9A 4PYSA 2XINA 1VBUA 1KKOA 3FY1A 1ITQA 3BANA 3IJ8A 4V1YA 3PFRA 2PP3A 4J9JA 4UFIA 1J12A 1EL3A 1W1ZA 1TMHA 3UXIA 5BOOA 1MEIA 5FKYA 4H19A 3MJMA 1U30A 1NDVA 4RLIA 1LLZA 3CGTA 2BB0A 2VYOA 3T4CA 3LGGA 5FF0A 2E68A 1VFHA 4ZO6A 1H7WA 3B3DA 4S38A 1ITCA 2WQPA 5IXEA 3NL6A 1FDZA 2WLZA 2Z24A 2WWCA 5AYZA 3TC6A 4I6VA 3CWHA 3GIQA 4QSHA 3IJIA 4AHOA 4UTMA 2HQAA 1Z9AA 4AVNA 3RCNA 3GS6A 5LNRA 2OEJA 3DDMA 4WCJA 3AWNA 3OGSA 4DJFD 1P4CA 4FLSA 3EOUA 4FOJA 2J7BA 3V7PA 4JFSA 4BI7A 3MCNA 2E40A 6TIMA 2F6UA 5L9FA 4XAPA 5JIWA 4F0LA 1HNYA 3BSMA 3OGVA 3K13A 4TX6A 2WVVB 1KM6A 1EZ2A 4QLLA 3COTA 4QDMA 1LDCA 1BGAA 3BSHA 1DJIA 4PMUA 2VGIA 3GXTA 2PLJA 2XUCA 3VNMA 3SIMA 4DWDA 2Q8LA 4J3WA 1EC9A 2FFCA 2C19A 4IUGA 5D09A 2BXVA 4LALA 4JQ1A 4NF7A 1MRAA 5ECUA 2DJXA 3ME3A 1TIMA 2ZQ0A 1AW1A 1PIGA 4IMDA 3HG4A 2WBGA 1EQPA 1R3RA 4UOQA 3WNKA 2A4AA 1D2KA 3EX6A 2PWUA 4C1KA 1XG3A 2BY0A 2ZZ3A 1KBLA 4PBGA 1RP9A 4GI9A 3B8DA 4QG9A 2GJPA 1TV4A 1JD7A 2VD9A 2EKGA 3C4UA 1R87A 4PUMA 5K9CA 2ACUA 4JDYA 4LS2A 3EWXA 1BRLB 1MW3A 1RR2A 1PUDA 4X0NA 4KEUA 5A5WA 5I3HA 3W72A 5D2YA 1S2VA 1ODZA 2C3ZA 3GTHA 3S1XA 1NY1A 2DW7A 3WK2A 4NYUA 3BPWA 1R3YA 3BXWA 1W56A 4GHRA 1EEPA 4HK5A 4PB3A 1P1XA 2VEMA 2XVGA 3G0UA 2GOKA 4BA0A 1WDQA 1EX1A 1TQJA 2WV8A 3AAMA 4QJ4B 1S46A 3ARVA 1EGVA 2VOTA 2GJXB 2J78A 2CITA 4FALA 1EHAA 2I5QA 3A4XA 1A4MA 2CZ5A 3ABXA 2ZIDA 3M0ZA 4R5EA 1NTHA 3M5VA 2OQYA 1S5TA 3KRSA 3HO8A 2JFEX 1KQZA 4NI3A 4C6DA 1AUSL 1V6VA 4GIRA 1SFSA 4WD0A 7XIMA 5CEWA 4DLMA 4UTTA 4J28A 2FZ8A 4BS0A 3UZ5A 3BOXA 1G5AA 4GH1A 2DVXA 4L9ZA 2VFIA 3WNPA 1KGUA 1JF6A 5T26A 3T0AA 1B30A 3QTPA 5A94A 5GJMA 4KS0A 3K8KA 4DYKA 1VP5A 2EG8A 2W66A 3Q65A 4AD5A 4F40A 1W3LA 2RDXA 3LMYA 1EPVA 2G4JA 3T2OA 3UCDA 3QSTA 1DXEA 3S1GA 2G41A 3BCFA 4UR8A 4OOUA 3EKGA 3N2MA 4HU8A 1XLKA 4V2XA 4F9DA 1WKYA 3I3EA 1LWIA 4KFPA 1FWBC 4JTGA 2VX6A 1LUCB 3MZ2A 4HN4A 1TFVA 1EOKA 1HZYA 2RUSA 4JTTA 5FACA 2E28A 2JKEA 2IS7A 5FJRA 1SO4A 4G8TA 2OQLA 3PPFA 3HGOA 1RZMA 5HATA 1PCKA 4WGHA 3VNKA 1PKNA 3EWBX 3QR0A 4Q4MA 4B5WA 4LRSA 3M6DA 4DBSA 2EQDA 3SZ8A 2V0TA 2IMRA 3BMVA 4GX9A 2XSAA 3UYIA 3CZLA 5D4YA 4OVXA 1P0NA 2AMXA 4WOZA 3WH8A 2D1ZA 2H90A 5I3KA 5J5RA 3VM5A 1UZ1A 3IAPA 1UIPA 3PZNA 4MIMA 2HROA 2PTWA 1EC7A 3RJYA 1BYAA 1WXZA 1HJWA 3QRHA 3URBA 3O05A 2PC4A 3WF2A 4AXNA 2NX1A 2ABAA 1U5HA 4O18A 3G1SA 3RGTA 2OG9A 2VEGA 2PPGA 3LCFA 3CMGA 3N2CA 2O9RA 2ZZ5A 5D2WA 1VHCA 3ANVA 5CSSA 3P84A 3SFWA 2BVTA 4L6HA 4UTFA 3L2IA 1W3IA 1KFKA 2PDIA 3WMSA 4DHGA 2PDMA 3RO8A 2VFHA 1E6XM 4ZQPA 3PZUA 1OY0A 4GI6A 3VILA 1WYIA 5DY3A 4K36A 4QBXA 3WL1A 1W3NA 4GKTA 3UA4A 6XIMA 4PA8A 4AIOA 3O6CA 3STEA 3WENA 1BSIA 4PEEA 5FSDC 1A0EA 3A4JA 4CCCA 4D6JA 4JR5A 3N2BA 2YPIA 3CH0A 2VTFA 4HYRA 4GWEA 3AYVA 1BEUA 5EMMA 3AI0A 1PXGA 4H6KA 4AY1A 2GJNA 3FJ4A 5CXPA 4GZJA 4R7WA 5AC5A 9RUBA 2DT0A 1DE6A 2EAWA 1LQ0A 1JCJA 4K3ZA 3SM0A 1O60A 4EPEC 2J6VA 3LPOA 5CG7A 5FIPA 3QH2A 3SBFA 4HNUA 1E9IA 2UZ9A 4EPDC 3IGSA 1VBRA 1V02A 1J4EA 5HR6A 2SFPA 2Y0FA 1HJSA 2Q8ZA 4KF1A 4UZUA 2VX4A 4TV6A 1ZJBA 4KRUA 2WO5A 3CUFA 1JEZA 3DKJA 4H3DA 3IGHX 3WLOA 1CXHA 1V6XA 3RIKA 5M3WA 2NX9A 2VZTA 4YPJA 1F76A 3KS5A 4OIFA 4WXYA 5KZEA 1T8QA 3O15A 2VWTA 2BVYA 1ZFJA 4O1EA 1GK8A 4MPKA 1GTHA 1PDZA 1HJXA 4GA8A 4TMBA 3UWEA 1XYCA 3KTCA 3TH6A 4MB5A 2D0FA 4ZL1A 4K2SA 3BLKA 3L0GA 2YL9A 1TPUA 5TQLA 2A6LA 1UKOA 2A79A 3VMNA 1TTPA 1JPMA 2QJMA 2ZTJA 3G1HA 3VMPA 1A5NC 3VX0A 2JKPA 4RDWA 4F0MA 1D3HA 3CBWA 1HXJA 2Q71A 4NZJA 2HS6A 4IL2A 1K8YA 2R1LA 1I8JA 2Q02A 2EG7A 2PBGA 1KFCA 3LV5A 3HA1A 4PTVA 5AVHA 4GYKA 3ABOA 3EMZA 2VKZG 1OG6A 2GZXA 3SCRA 4AG0A 2VEKA 3AHYA 4FS9A 3H6OA 5HQLA 3TCEA 3W23A 5AC7A 3UBPC 1FDJA 3B40A 2FMOA 4ZVJA 3TOPA 2PBOA 1ONXA 4GGHA 2YIHA 3BJFA 4WRHA 4C6CA 3N2OA 1W9XA 3SCOA 4LBRA 1FWIC 2DUAA 3B9OA 4NXKA 2DZVA 2V5BA 3FXYA 3V75A 1QPKA 3ITYA 3LSCA 2NW0A 1IXNA 2CIPA 1DWJM 3WH6A 1W3HA 2XFWA 4PMVA 1NM9A 3BCDA 3WEMA 2XG9A 4G56A 2WPGA 1PB0A 2Y5JA 4K7YA 3FHQA 2X0YA 1TUXA 3N19B 3S2JA 1BKSA 1A5KC 1AJ2A 2AMGA 5C9WA 1G69A 2YDAA 3MUCA 3MWCA 5K7JA 3C2EA 4ADSA 1IIGA 3KBJA 3UXDA 3PPGA 3T78A 1ZBKA 1WXJA 2E1WA 1CLKA 2ZWZA 2Z2BA 2QCGA 3RITA 1DIDA 3IIZA 1K7XA 3WNNA 2VFEA 3CK5A 4RE2A 4AD2A 1JDAA 4L9YA 2E5DA 3NQ6A 4TX9A 4CD4A 3R58A 1M03A 3MP3A 4C6MA 4R7OA 5D9PA 4IJBA 1Y7VA 4UQBA 3BURA 4Q4QA 4YTUA 4I90A 2J47A 1XFBA 4GO9A 4MM1A 3S6OA 3W3OA 3NQ2A 4DWSD 5D8ZA 1K9FA 4JQ2A 3VM7A 4HJFA 4HOWA 2OCZA 3II1A 2G4FA 1Q6CA 3DOPA 1OBAA 2DW6A 2WSKA 3GZ3A 4U5KA 3HTWA 1TV2A 4I8DA 1Z6KA 2PWEA 4LRTA 5AC6A 3R25A 3TA6A 4DWSB 3VDAA 1W31A 2V3DA 4NG3A 9CGTA 2OGJA 1UKSA 3KCLA 4GUFA 3FYPA 2BX7A 3CV1A 1B3ZA 4UQEA 3UNTA 4Q4PA 2Q6ZA 4R33A 3RR1A 4JNMA 5K2ZA 1RLCL 2Y5EA 4L9XA 2POZA 4YL2A 2CHOA 3LHTA 3AHTA 5CQ1A 4ZXOA 2XM2A 3B06A 4RX0A 4D6CA 3F2BA 4D6HA 1M7JA 2GJRA 4LC6A 1SO6A 1Q3NA 3CWNA 3BK0A 3URNA 3ARRA 2ZUNA 3EGJA 1J11A 2H9AB 4JPGA 3FSUA 5GNYA 4O0QA 3UA3A 1QI3A 3CC1A 7PTDA 1VFFA 1VZWA 1A3WA 2DZPA 3MYOA 1Q6RA 3MKVA 3B0XA 2E9MA 4XD6A 4M24A 1WBHA 1Q7QA 4XTDA 5CPOA 4JN7A 4DXXA 2O7SA 1GVQA 3AMGA 3N12A 1UOZA 1W5MA 2Z28A 3BGGA 3EX3A 2PUZA 4L4MA 4BF9A 1QCWA 5A6SA 1E1CB 3S9IA 5T8GA 2GGIA 1PYFA 4LYPA 4UQ9A 1L6WA 4CEXC 2GSEA 2OWXA 1KCKA 2ZICA 2ZRVA 4DJFC 4Z2IA 4QROA 3HGJA 1DWIM 3JS3A 3KW3A 5DLCA 4K8HA 3UP8A 2FDSA 3R10A 2QUTA 3LERA 3S6TA 1S2TA 1XINA 3ITVA 1XLDA 3KCOA 3ITCA 4KCWA 4IP4A 1FHUA 4JYFA 3UWQA 2FMNA 2VD8A 3OB8A 3VE7A 4B15A 1Q6DA 2JIEA 3OHMB 1B3OA 3CQ0A 1UCWA 3TW9A 4GISA 3TKFA 3T08A 4H4IA 4C91A 1XSKA 3A3WA 3LCGA 4YYCA 1HVXA 1KFEA 3STFA 4XZ9A 1DOSA 2YB4A 3M16A 3E0VA 3TQKA 1OJXA 4X60A 4B91A 2ZC8A 4MGGA 5JBFA 1NWTA 3TJXA 4TTUA 1P0DA 4MLRA 5C6MA 1UG6A 1BKHA 8RUCA 1BF2A 3K5XA 1WDPA 1OFDA 3LNPA 4XZBA 4XVDA 1XJBA 2VFGA 5AECA 4CVWA 5EBUA 3WBXA 2TSYA 3M46A 2PD5A 2OSYA 1ZBWA 4S1FA 3OLGA 4GGBA 3KWXA 1DJYA 3GWQA 1IYXA 3O3RA 3DBPA 2JEPA 3DFSA 1GYNA 3TFXA 3EEZA 1AH3A 8CGTA 3ATZA 1AJZA 1C9DA 2AL2A 3C2RA 4R88A 4G5DA 3VC5A 3TN4A 1XC6A 4Z2GA 3EPMA 1ZJAA 3CAWA 1OFBA 4FNTA 4ERGA 2ALDA 3EX4A 4F2BA 1LOQA 5IBXC 3OYXA 1XRSA 1KR0A 3N73A 1RD6A 2FZBA 5BOFA 2XIOA 1UA7A 4FK9A 4F8XA 2NLYA 1FY6A 2W79A 2ADAA 3UGVA 3B8IA 1JYXA 3KRBA 2DIJA 2R1NA 3AXXA 4XG1A 1V5XA 4P7NA 4HK7A 1LJYA 3VKJA 4H8NA 3IUHA 3C52A 3THDA 3HF3A 2ZYFA 3GZAA 2YFNA 1JF5A 1EEXA 4ZEPA 3PZVA 1PX3A 1GUVA 2W63A 3R6IA 4GYFA 1G0CA 4MUPA 3QOKA 3CL6A 3PUDA 3IGXA 1GG0A 4ATLA 3GG0A 3VCCA 5LGXA 1ONWA 4XAGA 1E6QM 3OVQA 3BICA 3FSTA 5AYBA 3L4ZA 2V3GA 1O5RA 1XLAA 2VENA 2WMHA 3E0FA 3GDTA 4DJFA 4UTKA 1RPKA 4E5TA 4JFVA 2ABBA 1GEQA 3AZSA 2WVVA 1XS2A 3B8TA 4OV4A 3FGCB 1BHGA 3ATYA 3WK0A 4JTDA 3L12A 1R8LA 1JCTA 1O94A 1K8ZA 2HNHA 1X8FA 4ZB2A 4JTUA 2DQWA 3ITLA 4P7LA 3QZEA 4TU1A 1U5JA 2YBVA 4TMCA 2ZX8A 3ZR5A 3M0IA 2HDJA 3G1VA 1EC8A 4AZ5A 1T96A 3KHJA 3WNLA 3S2MA 4NP7A 2ZX7A 1GOWA 4LEQA 3TYCA 4MY1A 2QCFA 4Z08A 1J9YA 4MB3A 3C2VA 1O7AA 1XIBA 2OWWA 3VK5A 1UJPA 4MFEA 5A8OA 6ENLA 4BZYA 1W1VA 2QJJA 4HYVA 3UD6A 5DXXA 1QOPA 4I9JA 1FBAA 4MZ8A 2Z1KA 1FH7A 2P3EA 2ZX9A 3HMCA 3QSRA 3IJ7A 4BJHA 3N6JA 5LNWA 1MDRA 4LUSB 4LVGA 3SY1A 3BVJA 4JX6A 3WF4A 1AJ0A 4A6GA 1G4PA 1OF6A 3QR1A 4PL1A 4C1LA 3TR2A 1NF7A 3APYA 5EMKA 4JIHA 2VGFA 3NEHA 3BJTA 4TVDA 4HMDA 1TWIA 4IJCA 1CXKA 1QHOA 5ABFA 4YXGA 3HM7A 3BCJA 5F4SA 3T2QA 4M1BA 4DYJA 1WNOA 3GU1A 5SWUA 3VGHA 2DUZA 1XD0A 1WKFA 5I5RA 3EWDA 3W7NA 3NPUA 2CLEA 1IWPA 5E6ZA 4AY7A 4I6KA 1ADDA 2WKGA 1IF2A 1UBPC 1EJVC 2C0HA 3QR3A 3F2DA 1E1EA 4JD4A 4IH3A 3H4XA 1FCUA 2CKRA 1BGGA 3UU0A 2VELA 3U2CA 2FHBA 2NQ5A 4IQLA 3TTOA 5BXTA 5DEZA 3I10A 2ZTKA 3LCLA 3LRMA 3GH7A 5EMJA 5I02A 3GDKA 3TYAA 2Y4SA 4DO4A 3PPHA 3KOWA 3O7UA 1GJWA 2HVNA 2IPGA 2VCAA 3HBLA 1K6WA 3GG7A 3TTYA 1C29A 2PGFA 1B31A 3C2FA 2F9RA 1TPVA 5IFPA 3NJ3A 5BNKA 3KLKA 5BWFA 3IS4A 1LUCA 3DHUA 4LAOA 3W1MA 4PL2A 2ZRYA 2G96A 1XLEA 4IXHA 1EO5A 1NJJA 2FJUB 1W2PA 5HQMA 1V7YA 3PF3A 3OU8A 3WFZA 4X61A 4IOTA 4DUVA 3DU0A 2P10A 1LM1A 3M9YA 3GVQA 5BMXA 4JXCA 1Q4NX 2HE5A 1N55A 3VNJA 4JNYA 4BI6A 4PMZA 4O1CA 1DE5A 4CKQA 4UTJA 2BY3A 2DDXA 2X7WA 1ZALA 3NQFA 3NZQA 1DWFM 4W93A 4IM4A 1Q2SA 4GUIA 4QJ3B 3APGA 2D24A 1AD1A 4LVBA 2GQAA 1B4KA 5HULA 1SSDA 2R6OA 3IPWA 1AQHA 5CZSA 2BG5A 2X0SA 3D3FA 3TAKA 1ZP3A 1E6ZA 2XFYA 4P8WA 1XXXA 3R5EA 4BQ4A 2ZUTA 3TQPA 1P0EA 3JRKA 1RJQA 5LIKX 3UR2A 5MHBA 2JE8A 1YIXA 4ZE5A 2NXIA 4IP5A 4UC5A 3FDKA 4C60A 2W3ZA 3W70A 4MNLA 4YJ5A 1JULA 3E1F1 1TA3B 4N4QA 2EEXA 1EX5A 1XIGA 3AIVA 4PTXA 2IXUA 3A13A 5F1VA 7ENLA 3KOZA 3QOMA 4E2OA 5IDZA 5B80A 1A53A 1HIZA 1T6MA 4OQVA 1IEIA 1E4LA 4JY9A 2BHZA 3LD5A 1VENA 1YDYA 2DV0A 4HHLA 5EU9A 5AHFA 4PMNA 4U3AA 1KCLA 3F4WA 4A2RA 1VCFA 2VR2A 1OC7A 2POTA 3WBEA 3ZYZA 2ZVIA 3QV7A 5IFTA 2Q8XA 3NO3A 3O2LA 3IIXA 1JCLA 3S46A 3CXOA 1EXBA 2CLFA 3GNPA 1S3TC 4EIVA 3AXIA 3UZWA 2OEKA 1GOXA 3AHZA 3W0KA 4GQGA 4M7SA 3AZRA 3PJTA 4JTEA 1DTNA 3NQ8A 2PGWA 3VXGA 3VOHA 4A8IA 5HWMA 4D2JA 4UMAA 1VIZA 2QQ6A 4GOAA 3OW1A 1FKXA 5ABHA 5AC8A 1RBAA 3C6CA 4PCSA 3VA8A 1EJ7L 4LB4A 4N42A 1ENUA 3RX4A 4UMCA 4LS1A 1Q65A 4IISA 1YPXA 1RBLA 2ZRXA 1H3GA 4CD6A 1OX5A 4KW2A 1YE4A 4OECA 4RPPA 5BROA