2XG9A

Crystal structure of barley beta-amylase complexed with 4-o-alpha-d- glucopyranosylmoranoline
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
487
structure length
487
Chain Sequence
VNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKEFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDSEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemical Genetics and Cereal Starch Metabolism: Structural Basis of the Non-Covalent and Covalent Inhibition of Barley Beta-Amylase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-AMYLASE
total genus 191
structure length 487
sequence length 487
ec nomenclature ec 3.2.1.2: Beta-amylase.
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2xg9A00
4HPHA 5FKYA 3W27A 3OZOA 2WMJA 1W9BM 4W8BA 2BY0A 2PF0A 4QLLA 4B9ZA 2YDQA 2RGLA 3VIGA 2J74A 3ARXA 1C90A 1E6PA 2ZXAA 2CBVA 8A3HA 2TAAA 1E9LA 2X0HA 5DT5A 2ZX9A 3WIJA 5FCZA 5ECUA 1AQ0A 4P7QA 5D9OA 2DIEA 4B9YA 1RD6A 3K4AA 3WNOA 3NDZA 1WCGA 2BFGA 4UCFA 4L4OA 4JAWA 4AZCB 1V3HA 1KWKA 3DYOA 4DUXA 5JBDA 3NSMA 3UG3A 3ZR5A 4HA1A 2AOSA 3WMBA 1DWHM 1UUQA 3CBWA 1PX8A 3THDA 5AC5A 4U3CA 3L4WA 1QNPA 3PZIA 2CPUA 3N1AA 3OLIA 2WMIB 4PMXA 2WPGA 3AYSA 1D3CA 2YDRA 1UOKA 2J47A 3MMDA 2EO7A 4UQ9A 4MAZA 3WD0A 2O9RA 2GFTA 3NSXA 1B0IA 4AD1A 4D6DA 3F5JA 1RP9A 1MFVA 3AHTA 2ZE0A 3ZR6A 4HTYA 1KGXA 2F2HA 3UCQA 1FP9A 1Q6GA 2D0HA 4UQAA 2WZIA 4ATLA 2BY1A 1ZBVA 3VGHA 3PZQA 3CZJA 1GZJA 4ACYA 2AMGA 2G4FA 1W2PA 1W3HA 3GBEA 4LYQA 1OD8A 2OSYA 5CPQA 1EHNA 4JCMA 3VVGA 4PTVA 1C7TA 1JDDA 3HN3A 4F66A 1HKKA 2DH3A 4XZBA 3CZGA 2O9TA 3KWXA 5A8NA 3W37A 4M81A 2XHYA 1E72M 3EDJA 2XG9A 4QCFA 1R85A 2G3NA 3AQUA 4PMUA 3NSNA 1BYBA 3L4YA 4V2XA 2ZX8A 1LWJA 3RJXA 2WAGA 2ZOXA 4YPJA 5GNZA 3AFBA 3KE0A 4D6CA 4V27A 1TFVA 4PSRA 3OZPA 3AMGA 3MUY1 4J3XA 5I77A 1Q6EA 2XFYA 1BFNA 3WQ6A 1M04A 2PI6A 3HMCA 3GDBA 4OOZA 2JF7A 2PB1A 1W9UA 1YHTA 5LA0A 4UFIA 1V08A 3RM4A 1BVZA 5LYRA 3T0DA 4HMDA 2J75A 1OT1A 3U5UA 2VCBA 4D1JA 1W1PA 3WH6A 5C71A 1JFHA 2VX4A 3SCUA 5BXSA 1WAWA 2WCSA 4ZXLA 2DSVA 3AZSA 1WKYA 1H1NA 5HBFA 3PBGA 1KBBA 3ZJ7A 2A3BA 1ISVA 2ZUMA 1JL8A 5TD4A 2Z1KA 4HPGA 2J79A 2Y8VA 3KL0A 3LPOA 3L2LA 1B3YA 4JKKA 5FD0A 5A8PA 1R8LA 1CECA 4TTUA 3AIVA 3PTMA 1DP0A 4WK9A 5IXEA 5A6BD 2XVGA 1LG1A 2FDMA 4AY1A 3SUSA 4W5ZA 5AYIA 2WZHA 3VINA 4JHOA 3WH5A 5CG0A 3BMVA 2OSWA 1OGBA 3W28A 2EPLX 4F8XA 5I2UA 4EANA 1OB0A 2QV4A 4ZE4A 1FH7A 1CGWA 2CXGA 3W38A 4HZ7A 3IAPA 3K46A 4IISA 4J3WA 4PEEA 5BRQA 2JE8A 2WC3A 3VUPA 4AC1X 1H4PA 5CPSA 2BHUA 3J7HA 2QMKA 5A6SA 1X6NA 2CNCA 5IHSA 2EXOA 3BLPX 2CERA 3AICA 4W8AA 1JYVA 4HOWA 1UWUA 1EQCA 3OGSA 1WDRA 4EAMA 1C3FA 2YL9A 3GZAA 1JZ4A 3O2LA 3WF1A 4MDOA 2O9PA 2W62A 4CD6A 5IDIA 1BYAA 3VIFA 4JHZA 1K6AA 1ZB5A 1NWRA 2J8FA 2W92A 1QHZA 5A1AA 4M29A 3WEMA 2QMJA 2YA1A 4W87A 1MW0A 2XIBA 2DPEA 1L8NA 1UD3A 1MYRA 3DYPA 2DT0A 4PMDA 4HZ6A 3AMKA 4CD8A 5HXMA 1M01A 3OB8A 1E4IA 3WBAA 5A6LA 2X09A 2GJRA 4MB3A 3WQ8A 1FP8A 1GUVA 2CESA 4MB1A 3OG2A 1AQMA 2VTFA 1H3GA 6CGTA 4M80A 1V0KA 1KCKA 4AZGA 5E9AA 3M46A 1ISXA 2VUYA 3GNPA 3VGBA 1OD0A 3TP4A 2VQTA 1QNSA 2VMFA 1TE1A 3RM9A 5CLWA 3AJ7A 1JDAA 1H5VA 3BAIA 2JIWA 5A2AA 2WVUA 5E6ZA 1CGTA 3A4WA 2OLHA 3N17A 3AMLA 2EPKX 4NZCA 4AD2A 3BAXA 1CBGA 1E6NA 1J0IA 1EHAA 1KXQA 3MMWA 3NUKA 5F7UA 3AIBA 3WY1A 2YLAA 1TMQA 2JIEA 4HU0A 1UD8A 5JUVA 4XB3A 4NRRA 4A3HA 3N18A 3WD4A 1NWSA 3DHUA 4HA4A 4AD3A 5CPTA 3VMPA 1NH6A 1E43A 3SUVA 4D6JA 1JZ5A 3BAJA 1BYCA 1GOIA 1UA3A 1V3IA 2X1IA 1WO2A 3CMJA 3F5KA 2ESCA 3AROA 3T2QA 1B31A 2XVPA 2XVKA 1CLXA 4CVUA 5HPOA 3WH9A 1V0MA 3TA9A 3AHXA 4BF7A 3GXDA 3ZO9A 1K9FA 3SCVA 4PMYA 2WHMA 2ZXBA 1KGUA 1JI1A 3UG4A 2XJ7A 3WD1A 3CLWA 4CD7A 4W5UA 3DC0A 1PEZA 3IJ9A 1J18A 1WDQA 3AS2A 2EJ1A 2A3EA 2FHCA 4UOJA 3ARVA 2E40A 5CLTA 1DHKA 2DSWA 1M7XA 1NM9A 2CITA 5HDRA 2DSZA 2JALA 4QLJA 4QCEA 2VZSA 5HNNA 2YIHA 2V3GA 4AD0A 2E3ZA 1CWYA 1HVXA 1PPIA 3SCSA 2V3EA 1HJVA 3AMDA 3CUJA 3CH9A 3WQ4A 2IUZA 2FHBA 2OYKA 4AZCA 1HJUA 4MNLA 4DM1A 2XVNA 4F9JA 1QNOA 3BCFA 1PZ2A 1NP0A 2WVSA 4GINA 3VD9A 3VMNA 4DWSC 3L4TA 2CETA 5E09A 1ZBCA 2VZOA 1C7SA 2G41A 3CIVA 1E40A 1XRVA 4CN6A 3UR7A 3VGDA 2V3DA 1HP5A 3L4XA 4J3UA 2JFEX 2XVLA 1SR0A 4X9YA 1XH1A 4NSBA 1JFXA 4E8DA 4LYRA 2CHOA 2VJXA 1U30A 1E0WA 4ZE5A 4EKJA 3A6OA 3UETA 4CU8A 3ALGA 5EFFA 3RPMA 1UWTA 2DT3A 2ZX7A 4DWSA 2VR5A 4HZ8A 4JFWA 4R27A 1JF6A 2W63A 3VD3A 1TCMA 2WZEA 2V3FA 3EBVA 4MAVA 1SYTA 4AWEA 2QF8A 3M07A 3M6DA 4C7DA 5A95A 1CXLA 1XSKA 4XUYA 4D72A 1UYQA 2WBGA 1I1WA 3PTQA 1JNEA 2OWWA 1ISYA 2BNJA 5ABHA 1CXFA 3D3AA 3MU7A 4PTWA 1US3A 3HJEA 2OSXA 4PMRA 1JI2A 1E0VA 3K8KA 1VFUA 1E15A 3VPLA 4DUVA 2YL8A 1UR0A 3GXIA 3K8MA 1HF6A 2HVMA 2IXVA 1XSIA 4TX6A 3WFZA 1WP6A 3WMSA 3AS0A 3KL5A 4AD4A 2FHFA 3CGTA 7CGTA 5JIWA 1EO5A 1CPUA 1E55A 3ARPA 1OBAA 2OYMA 1JZ7A 4PCTA 2WMKA 3G6LA 4QP0A 3POCA 3MO4A 2VOTA 3K1DA 1OGSA 1MVYA 4XZWA 2WCGA 1GOMA 1R87A 3ZSTA 1EQPA 3LPGA 2ZIDA 2A3AA 3SUTA 4DM2A 1UHVA 1CXHA 4HOZA 1V6WA 2J7HA 4QLKA 4HOXA 1VFMA 1XH2A 2EQDA 5A8OA 1SFSA 5CGMA 4JFTA 1QI5A 3THCA 4HMCA 4LX4A 1TA3B 2FH8A 1PIGA 3WD2A 3O9NA 3BAKA 3VU2A 4K68A 1LJYA 4CVWA 3MUZ1 2WANA 5HPCA 3WD3A 1R7OA 2NT1A 4H8VA 4BS0A 3DHPA 1W1VA 4AW7A 3WDHA 5A6JA 3WNMA 2X0YA 4W88A 1B3WA 2OWXA 2YBUA 3MSGA 2ZUVA 1H0IA 4KGJA 3AOFA 1JG9A 4A4AA 4W8LA 3W24A 1RPKA 3RCNA 1W1YA 3T0AA 3BAYA 1BG9A 2J7FA 2Q8XA 4J3TA 5D9NA 5I5RA 3UERA 4NI3A 4AIUA 4AZ6A 2GK1B 3WDIA 1M03A 5IHRA 4GQRA 4J28A 1H0GA 2UY4A 1FFQA 1JAKA 2YOCA 3VX1A 2BVTA 4F79A 1NQ6A 1UR9A 3RM8A 2PBOA 3EMQA 4N42A 4H8UA 1CGUA 1V3JA 1DWAM 3S6TA 1G01A 4NF7A 2WYSA 2XSBA 3WN6A 1VRXA 1OSEA 1US2A 4OOUA 1WPCA 3VIKA 1DWJM 3L2MA 4Z2LA 4BQ5A 3BXWA 1J0KA 4HMEA 1E5JA 2W4XA 2GJXB 1CYGA 7TAAA 4WIWA 1XCWA 2NW0A 3ARTA 1W1TA 2WM0A 1UQYA 3WF2A 3VOCA 2WKGA 1V02E 2J8GA 5I78A 1MQPA 2CBUA 4OBRA 3CUIA 1ITXA 4U5KA 1JF5A 1BQCA 5BXPA 5A6KA 4OZOA 2YL6A 5FL0A 4TVCA 3QHNA 2YL5A 4S3JA 1D7FA 3EMCA 3NYDA 2E9MA 2J62A 1PJ9A 1W91A 4JIEA 1ZBWA 4BQ3A 3VIJA 4OIFA 1IZKA 4E4PA 3FAXA 2J25A 3A47A 4MJ4A 1W3KA 3UR8A 5A2CA 2WVVA 2VCCA 1GQJA 2C0HA 2VRQA 1B9ZA 4MADA 1R86A 2GVYA 3RIKA 1JYWA 1FOBA 4UFLA 1HIZA 1DWIM 5D4YA 5CZKA 2DGAA 5GQBA 5I24A 2E8ZA 5EMYA 2WVVB 4WSJA 3WH7A 4RL3A 4D71A 3KZSA 1VIWA 2GK1A 3GNRA 2QPUA 1TVNA 4IM4A 2GSJA 1SMDA 2CEQA 2VX5A 4J3SA 1YQ2A 2UY2A 1E73M 2EBNA 4Y7EA 1H41A 1TZ7A 1UKQA 2WC7A 1H11A 3QR3A 3VILA 4H2CA 4B3KA 4QFUA 4JFVA 2E9LA 2XWEA 1KQYA 4H04A 3GM8A 2Y24A 5A8QA 3WF3A 1UWIA 3BSGA 4AISA 3VD4A 5AYBA 2FGZA 2D22A 2UWFA 4AMCA 1WZLA 3ZMRA 3B9AA 2VR4A 2V38A 1CGVA 3IANA 5AY7A 1XCXA 4MNMA 1OWQA 1LF1A 2VX6A 4BA0A 1N82A 2X05A 3NDYA 1XYZA 1I75A 1BAGA 5I3DA 3TONA 4CCCA 4CU6A 2WK2A 2CHNA 5CJ5A 1OCQA 5D8ZA 3PN8A 2B31A 2W61A 2VL4A 3WELA 1CEOA 1ZS2A 3I3EA 1OM0A 1ZBKA 9CGTA 5A6AA 1EXPA 3CHEA 2BY3A 3AS3A 2BVYA 2A3CA 4ATDA 1E6XM 1VBRA 1ITCA 4WKFA 4W86A 3CZKA 2O9OA 1E4LA 4OUEA 3PZGA 2PBGA 5LA2A 4UR9A 5I0DA 3BSHA 1ZJAA 2VVNA 5JIPA 2ZX6A 1E56A 4PBGA 5BWFA 1JD7A 1GW1A 1Q6FA 4ATWA 2WCAA 3AIRA 1IV8A 4H41A 4CCEA 2W66A 2VZVA 1HP4A 3PTKA 1A3HA 1G9HA 3SCRA 1E0XA 2D23A 1W9DM 1NOWA 4MB5A 3PHAA 2CBIA 1W32A 1TA3A 3MV11 1TVPA 2UY5A 5DO8A 4ZXOA 3VGGA 3MV01 3A4XA 1EDQA 3AS1A 1EDTA 3VIIA 3UEQA 4X0NA 3SUWA 4GKLA 3WFLA 4UFMA 1FH9A 3EDKA 2EPOA 2BV9A 2CCRA 3GNOA 1QNQA 1GOKA 4QDMA 2IXUA 5LA1A 1G0CA 1HL8A 1LL6A 1MFUA 4D6IA 1LL4A 4AZ7A 1E6ZA 1IZJA 2D2OA 6A3HA 1UD5A 1UZ1A 4WKAA 5DT7A 3ZIZA 3A3HA 2PWDA 4X0VA 4KMQA 3G6MA 3VDCA 4PSPA 1JZ3A 3B8SA 3FNDA 5DEZA 2D3LA 4W7UA 1XHGA 3I3BA 1HKJA 3CUGA 3TTQA 1UD2A 1LL7A 1VEMA 5C70A 4FLSA 2WXDM 1GNXA 4HU8A 1G5AA 4M8UA 4M82A 1F4AA 5IFTA 1UR1A 3GXMA 4U33A 3S2CA 1H49A 1UKSA 3WL1A 2G3MA 2XFFA 4GIAA 1K9TA 3W6LA 3CUHA 5EFDA 3AIWA 3AMCA 1G1YA 3VIOA 1E4NA 4DWSB 8CGTA 4LPCA 5A69A 3ARUA 3ARSA 4FLRA 5D9PA 1F4HA 1MXGA 1UR2A 3TOPA 1J0YA 1W2VA 5ABFA 3WUGA 1GQIA 3WDQA 3ZT5A 2WC4A 3CZEA 1EGZA 3NCOA 1EDGA 4BQ2A 1J10A 2VRKA 4AZBA 5C8BB 4J27A 2WWDA 2X8RA 3IJ7A 1V3KA 1QI0A 2EEXA 2WHKA 1E1EA 4UZSA 1HJSA 1HJXA 2ZUUA 2QHAA 1MW1A 1GHRA 3WNKA 4MTVA 3BC9A 4M24A 3QOKA 4D6HA 3OLGA 2WB5A 2PWHA 4MNJA 4RE2A 3EYPA 1U2YA 1GJWA 1CDGA 3VM7A 4W7VA 5M03A 1AMYA 2WSKA 4D6GA 3FN9A 3WF0A 1MW2A 4LYPA 1VAHA 4GZEA 2WBKA 2YBTA 4IPLA 1VFFA 4L4PA 1JYNA 3M7SA 1CLVA 1S46A 3CHCA 5BXTA 1QI4A 4DUWA 4ZEPA 1HX0A 2F61A 4E2OA 1HXJA 1C93A 1UH2A 1VJZA 1FA2A 1GPFA 6TAAA 2ZUSA 3WH8A 3UESA 1KXVA 1B30A 4RE4A 5FL1A 2CIPA 3B9EA 1XD0A 3II1A 3SUUA 4BQ4A 4UQCA 2YA0A 2XM1A 2J77A 2VT0A 4P7NA 4AZHA 3N04A 4Q7NA 1CXEA 1VB9A 3WNNA 1HJWA 3VDBA 4R5EA 4OBSA 1UKTA 4OJYA 1CXKA 3PZUA 3VIHA 1HNYA 1QW8A 3GH4A 1ISWA 4KH2A 3CTTA 4UFHA 1PIFA 2VQUA 1AVAA 2BXZA 3FW6A 2PWFA 3UG5A 1MQQA 2DT1A 1KGWA 2VI0A 2WLYA 2GUYA 1WZAA 2PWGA 7A3HA 1UH4A 1Q6DA 1JZ2A 2DEPA 1BVNP 1OIFA 1EH9A 3ARZA 4U5IA 1CXIA 1V6YA 4CU7A 4ZENA 3WQ5A 2HISA 3SCPA 4M56A 1JGIA 3BCDA 1OIMA 1BF2A 4UQEA 3EDDA 4WLCA 1KR0A 1HN1A 4W84A 1CGYA 3N11A 4QAWA 4EK7A 4F9DA 1V6UA 3AHVA 1W9PA 3BAWA 1IT0A 4UQBA 2O92A 3GH7A 2XUCA 3OBAA 1VBUA 4C7FA 1WDSA 2X2YA 4MB4A 1E6QM 1JXJA 1QHPA 1XGZA 4UOQA 4UOZA 3AXHA 3WF4A 1JD9A 3W29A 4PTMA 1EA9C 1M53A 2J7GA 3W4RA 3NIYA 2ZUTA 3TTSA 3WUFA 4Z2GA 1X6LA 2E4TA 1HJQA 4CD4A 3MANA 3ARRA 1UZ4A 1BPLB 1HVQA 2QLYA 3L4ZA 3ZM8A 1C8QA 1CTNA 1FHLA 1UD4A 3JUGA 5KEZA 2Y4SA 5M3WA 4FF5A 4Z2IA 2J78A 1K9EA 4Q22A 4TX8A 1XC6A 3T0BA 1GHSA 3OGRA 3ZOAA 3ZT7A 4PUDA 3WEOA 3IAQA 4JL2A 2OYLA 1E3XA 1B90A 1JZ8A 3FHQA 3GXFA 1GQKA 3A4AA 1C92A 4ZFMA 5M5DA 1MWOA 1JIBA 4GPNA 3PZOA 4HA3A 4FMVA 1CGXA 1TG7A 1GQLA 3WBEA 4P8UA 5GNXA 2D3NA 3W6MA 4U31A 3WKZA 4B16A 2Y5EA 1CNVA 1MW3A 2OWCA 2C8NA 4GO8A 3RILA 3N15A 1ZL1A 4WJXA 2D0GA 4IPNB 2YDSA 1JZ6A 5A94A 3BLKA 5JBFA 2PC8A 3DYMA 2GJXA 3WDRA 2DT2A 3O6AA 1FHDA 2WLZA 1UKPA 3OIHA 2Y2WA 1KWGA 1NOUA 3WSUA 1MQRA 2W91A 2WVTA 3IK2A 1GJUA 4WKHA 4MJ2A 3CMGA 3N9KA 1KBKA 1VF8A 3VTRA 3VKKA 1B2YA 3GBDA 3VDHA 4UZUA 3SCTA 4YN5A 4WSKA 4ACZA 4PMZA 3WQWA 2YA2A 2WW5A 2XM2A 2WHJA 2A3HA 3ZSSA 4V28A 4W7WA 5CGTA 3ZJKA 1D2KA 2E0PA 3WNPA 3AZTA 1J12A 1Y7VA 1PBGA 1KQZA 3W25A 2DQXA 4DWSD 3WMCA 4E8CA 3CPUA 3D5HA 3CUFA 1CIUA 2EPMX 3W81A 1LQ0A 4AYSA 3SCNA 3AIEA 3ZT6A 5BCAA 5FIPA 3KEHA 4PYSA 1G94A 1OINA 2WKLA 4JKLA 3U5YA 4JCLA 4D1IA 5JBEA 1UKOA 1JAEA 1E4MM 3AISA 1V3MA 4RE3A 3L4UA 4H7VA 3SEPA 3WDPP 3FY1A 3CZLA 3ECQA 1ZU8A 2XGBA 4ML4A 4AZIA 2BVDA 4TVDA 1GONA 4PTXA 3BGAA 3U7VA 1UWRA 3RDKA 2V5CA 1V0LA 3K8LA 1B3XA 2Z1SA 5CQ1A 1VEOA 1E1FA 3VIPA 1WDPA 2G3IA 3ARQA 5E0FA 1ISZA 1ODUA 4W89A 2VO5A 3LPPA 1DWGM 3TTYA 5KZ6A 3OGVA 2FH6A 4P7OA 5D8WA 3RMEA 2ZUWA 4M1RA 1BTCA 1ESWA 2E9BA 1E71M 1PAMA 3PZTA 1BLIA 1BGGA 3SIMA 2XGIA 1QBBA 2V5DA 4AXNA 1VENA 3FAWA 3TTOA 3WDJA 3ARYA 3LMYA 4CUCA 3F5LA 4AZ5A 1HKMA 1RP8A 4UFJA 1E6SM 3VD5A 2CBJA 1KR1A 1MXDA 1RH9A 2ZWYA 5ABFB 4AD5A 1NP2A 3L4VA 3GH5A 1L0PA 3T09A 1QI3A 1P6WA 2XFRA 5A6MA 3ARWA 1W3LA 2Y8KA 1QVBA 2J7EA 1UA7A 2XYLA 3E1F1 3U7BA 1V3LA 1WB0A 4CN4A 2EPNA 1XV8A 1GCYA 3ZJ6A 3WL0A 1GOWA 3PZNA 4PN2A 1BG4A 3AZRA 3VGEA 1E70M 1VEPA 4FLQA 3VO0A 1ZJBA 3ALFA 1GOOA 4U3AA 1B1YA 3AXXA 3NJ3A 2BHYA 5BROA 4GO9A 1HKIA 4TTGA 4PRWA 1H09A 2D0FA 1BSIA 1W9XA 5A8MA 3VNZA 2ZUNA 4AIOA 2VVSA 3CZ8A 3T08A 4YHEA 3BH4A 4KRTA 3N12A 4B15A 4U2ZA 3APGA 4N0RA 1X1NA 3N13A 4W93A 1TUXA 4H8HA 4JZ5A 3AIUA 4CD5A 4TOQA 1C8YA 1WE5A 5CSUA 5EB8A 5BRPA 1EIBA 5E6YA 4UQDA 2VZUA 1J01A 4PUEA 2FGLA 3CO4A 2W67A 4HP5A 1U33A 2J7BA 2JEPA 5DMYA 2WHLA 2QPSA 1V0NA 3VDAA 2VZTA 4FK9A 1QNRA 1Q6CA 3VD7A 4JL1A 5BXRA 3VNYA 4PMNA 1V6XA 1WZKA 4D6FA 2D24A 1LLOA 4J3VA 3W82A 2XPKA 1ECEA 5CSYA 2G3JA 5AC4A 2WNWA 4P8XA 3MUIA 4BZYA 1NARA 1UR8A 5ABEA 2VRJA 2JF6A 5DF0A 1AQHA 2XSAA 4EE9A 5GPRA 4P7LA 3VGFA 4P8WA 3W53A 3GTNA 2GJPA 2D20A 4CKQA 5A2BA 1XH0A 3AYRA 2YJQA 4GI6A 2BXYA 1KXTA 4LQ1A 2DH2A 4NRSA 1A47A 2CYGA 1C8XA 1XYFA 1WZMA 1OGGA 4P8VA 3OLDA 1GVIA 2WSPA 2DIJA 3I3DA 1H2JA 4GI9A 3VIMA 2GDUA 5EBAA 3MMUA 1Q4NX 3PZMA 2BHZA 1NOFA 4GI8A 2VNCA 4P7RA 1LG2A 1WNOA 2WMHA 4ACZB 1PX3A 1O6IA 1EOMA 1UG6A 1V02A 2C7FA 4TUFA 2GDVA 4C7GA 1PZ3A 4KRUA 5FOOA 2J7DA 1FH8A 1R7AA 1TR1A 2CKSA 2ZXQA 3W26A 4AEFA 5M17A 1JXKA 1V6VA 4U2YA 4PMOA 4CGTA 2ZICA 1QHOA 3QHMA 4OKDA 4PMVA 1E3ZA 4S3KA 2G8ZA 3T2PA 4Z2JA 3LPFA 4FLOA 4Z2HA 4WF7A 1FFRA 1XSJA 2BS9A 2NT0A 2WMGA 1O7AA 1J9YA 1OT2A 3T2OA 1B3VA 4AEEA 1GVYA 3EDEA 3U57A 2AAAA 1VFOA 2VX7A 2VURA 2RGMA 3AXIA 3POHA 4MPKA 2XIIA 2MANA 1KCLA 3VX0A 1PX4A 3AI0A 4A3YA 4PCSA 1LWHA 2YLLA 1W9VA 1DTUA 3HU7A 1NWTA 3PZ9A 1BHGA 2DSUA 2J4GA 3B9DA 4URIA 4GZIA 1E5NA 1UQZA 1HL9A 1QOXA 3CHDA 1C91A 2E8YA 3OLEA 3AHZA 1NWUA 5DFAA 1KFWA 1UWQA 4UTFA 1K9DA 4LGXA 3FHAA 3BMWA 4YHGA 5GNYA 1SMAA 5A3HA 2J7CA 4KGLA 4GXPA 3DECA 3SCOA 1CENA 4JFUA 5I79A 2XTKA 3F4VA 5BYWA 1JDCA 3K4DA 1CZ1A 1BYDA 1GOQA 1JNDA 4MNKA 2D1ZA 1QI2A 1ODZA 1QW9A 2JEQA 3SCQA 3PZVA 1QBAA 1Z32X 1KXHA 2F8QA 1XD1A 5E70A 1B3ZA 2NSXA 1JYXA 1UD6A 1UWSA 3WNLA 2XWDA 3MSDA 4UFKA 1J11A 1KB3A 1J0ZA 5ABGA 2BY2A 2UY3A 2DSKA 2WWCA 3WQVA 4UNIA 3ZJ8A 4TVUA 3RO8A 1BGAA 2WMFA 4PMQA 3MS8A 1UH3A 2W5FA 4D6EA 5I6SA 1E6RA 4J7RA 3MKKA 4CN1A 3OA5A 4MDPA 4XV0A 3VMOA 4GZJA 1I1XA 5D9MA 5I23A 2CKRA 3IJ8A 3AIQA 4B3LA 2ZX5A 4CCDA 5HOSA 4XX6A 4JFSA 4JKMA 3SURA 4BCEA 1DWFM 3FXYA 3QHOA 2YKKA 1J0JA 1DEDA 3VM5A 2PWEA 3EMZA 1V03A 3ZQ9A 3AHYA 3WENA 1UR4A 2DDXA 1W3JA 2ZWZA 4IUGA 2VCAA 1VJSA 2WMIA 4AIEA 3QOMA 4GQQA 5IFPA 3W0KA 3CHFA 2ZXDA 3SCWA 3WUBA 4W85A 1EO7A 3QGVA 4TXEA 3WEZA 5CXPA 3KL3A 4LXFA 5A6BA 3RJYA 1HT6A 3GYCA 1GORA 3EDFA 1QPKA 1EOKA 4Z2KA 2VC9A 3WUEA 3MUAA 5E0CA 1J0HA 4KWUA
chains in the Genus database with same CATH superfamily
1M65A 5LIYX 4B9ZA 2TYSA 4IIEA 3ARXA 2HMCA 3DZ1A 3NL2A 1E9LA 3MI3A 2QCGA 1UZHA 2PDGA 5FCZA 2C19A 3OG3A 4UTTA 5FJJA 2EG6A 2VXNA 3A21A 1NTHA 4J9JA 1EP1A 2GVGA 5H1WA 2BFGA 3LCWA 2VEFA 1B57A 4DUXA 3D47A 4XIMA 3NSMA 1ZP4A 3UG3A 4N6EA 1XLHA 3WMBA 1XIBA 2PCQA 1PX8A 3LXAA 4ADTA 3THDA 4XO6A 2XIOA 2KZHA 4U3CA 3TUUA 2ZRWA 1R5YA 3HQ1A 4FX8A 4O4VA 3KCLA 3LHYA 1TPC1 4LF2A 4OBTA 4KESA 4ZTYA 3PG9A 3P93A 5E9XA 1WUFA 1UOKA 1XRTA 1Q4WA 2GFTA 4JTDA 3W86A 1L9WA 1F76A 3WLKX 3I4KA 4WHBA 1BD0A 2FZ9A 3QF0A 4HQVA 3ZFHA 1MFVA 3L0NA 3KHJA 3SQLA 2F2HA 3UCQA 1YMYA 1Z7AA 3VOJA 3ZLFA 3QXBA 3R2GA 3BLEA 2J8TA 4UQAA 4Q3MA 3MO7A 1GZJA 1UIPA 3E0IA 2G4FA 1W2PA 1W3HA 3GBEA 4OHQA 1AJ0A 1EHNA 1QAPA 3V5FA 2V5BA 4WY0A 2DH3A 3W7PA 3KWXA 4M81A 3FLUA 4JTAA 3DESA 4MGGA 4EXQA 4PMUA 1BYBA 2ZX8A 3JRKA 2ZOXA 3AFBA 4HU3A 4OECA 4X9SA 2YZ5A 1KFCA 1TFVA 5KZEA 3OZPA 2V8ZA 5PTDA 3W7RA 1MNSA 3EB4A 1BFNA 1S5WA 4TQTA 5EMMA 4H01A 4OOZA 2JF7A 4JQ1A 3MWAA 3ZR4A 3NL5A 3RM4A 2CC0A 1BVZA 1Z8AA 5FAJA 3T0DA 4JNZA 1OT1A 2VCBA 1ICPA 5M2FX 1JFHA 4ONVA 1WAWA 2WCSA 2DSVA 3AZSA 1G4EA 3I7RA 3W7HA 3CV2A 1EBGA 2H3BA 1N8FA 2A3BA 3IUIA 2I9UA 2ZUMA 1K3UA 1O5XA 2Y7EA 1JL8A 5TD4A 1AW1A 3DU0A 2GVJA 3UVAA 3L2LA 1B3YA 1TX2A 5A8PA 1R8LA 3TLQA 3AIVA 5IXEA 1RCQA 2XVGA 4GBUA 3P82A 4AY1A 3SUSA 5CG0A 2OFJA 3WH5A 4DIAA 2Y7FA 4G7EB 3GFZA 3W28A 4F8XA 3A24A 1OB0A 3CT7A 1FQ0A 3S5OA 1CGWA 3W7OA 5LNSA 3W38A 2V5JA 5AHIA 5FF4A 3K46A 4NJIA 1RJQA 2VGGA 2WC3A 3SDOA 4R7WA 4WGHA 1H4PA 5CPSA 2J9ZA 3KVMA 2BHUA 3J7HA 4LVDA 3GAYA 3KHDA 4X2RA 4HOWA 2CWXA 3OGSA 3PB2A 5LNWA 4C91A 4JN6A 2YL9A 3NQBA 2GUUA 3WF1A 3GC2A 3LTPA 4DVOA 4JHZA 1VIZA 1ZB5A 1ZAHA 2RKXA 4K3ZA 5A1AA 3AWNA 1QU4A 2VEKA 3WEMA 3P2VA 2DZXA 3TNOA 1L8NA 4AXKA 3OQEA 1ZP3A 4WOQA 3EOSA 3M41A 1FWAC 3OB8A 4MB3A 2C13A 2GVEA 4NX0A 1GUVA 2L5HA 4IGSA 1H3GA 6CGTA 3LCLA 1V0KA 1M7JA 1ISXA 3VGBA 1OD0A 2VQTA 3IIPA 1I60A 3NPWA 4KWVA 4H2HA 1XDMA 3BPWA 1TMLA 3WLNA 3HGOA 5E6ZA 1GOXA 4MKVA 4NZCA 1LBLA 4AD2A 4A3RA 1E6NA 3CAKA 2DFAA 2YYUA 1C8VA 1J0IA 2PWUA 1T40A 3AU2A 4TMCA 3AIBA 2YLAA 1TMQA 4KFPA 3EXSA 2J9YA 2NVCA 3DHUA 4B5WA 1LROA 3GVRA 5CPTA 3VMPA 1NH6A 3V3WA 4FNTA 1AL8A 1JZ5A 3BAJA 1BYCA 1GOIA 3CL6A 4IJRA 3FGCA 1W8SA 3B9NA 2X1IA 3CAVA 4LUTA 3UR2A 2ESCA 2VM8A 1EP2A 3T2QA 2XVKA 4HPNA 4L1WA 1V0MA 1TPFA 1Q7QA 1GZ1A 4IFKB 3SCVA 2YDAA 5C5YA 3WD1A 3CLWA 1UCWA 1XYMA 3MP3A 3IJ9A 1OCNA 4LBRA 3NQGA 3GTXA 4QEHA 1PXGA 2A2IA 1OFEA 3QH2A 3FA3A 2HE5A 1VFLA 4QG6A 4GXWA 2V63A 1UB3A 2E40A 3GFYA 3VCRA 2DSWA 1K77A 4DXKA 1XBYA 3CLMA 5FEZA 4F2TA 2JALA 2TODA 4QCEA 2VZSA 1I6NA 4AD0A 2DZUA 3TQ0A 4DO7A 1HVXA 1PPIA 2V3EA 5DLCA 3O0FA 3PP7A 4KWSA 3GU9A 2IUZA 1NY1A 3TOYA 4US5D 1POJA 1C9DA 4DM1A 1F5ZA 1OFAA 1NP0A 2VDHA 2REQA 4K2SA 4GCXA 3PF3A 4OGZA 3BW4A 2PMQA 3ELFA 3VD9A 1H61A 1ZBCA 4HNNA 2G41A 1WBHA 4DLMA 3LHVA 1XRVA 2Q01A 1KM1A 3CTLA 4CN6A 3KVJA 4AWUA 1RA0A 4YWIA 1JRCA 1T8QA 1LBFA 1ZQ5A 4JXCA 3TK7A 2UZ9A 4YNGA 1Q85A 3TLLA 1OK6A 4ZOCA 2VJXA 1TJRA 3LEPA 4L1GA 4Q4SA 4EKJA 3UETA 3R8GA 2ON3A 3I7QA 1XINA 3UXDA 1F6YA 2Y63A 1Q6RA 2DZAA 2ZX7A 3B8TA 4RXFA 3H6OA 7REQA 3PWIA 1TWSA 3HG3A 4R27A 4ERGA 1SR9A 3VD3A 1TCMA 3M07A 2WQPA 3EOEA 1CXLA 4RZ6A 1XLDA 1XSKA 3PTQA 2JGQA 3MWCA 2BDQA 3QPYA 2OWWA 5EBUA 5ABHA 2DUAA 2EHHA 3MU7A 3PM6A 1WKDA 3BZJA 4PMRA 3K8KA 4WRHA 1E15A 1GVEA 3HV8A 1AK5A 2PGWA 2VUNA 1XSIA 3WFZA 3AS0A 2E67A 3SJ3A 3CGTA 1U22A 1E55A 1V7YA 3ARPA 3UJFA 4IGHA 1OBAA 2OYMA 4O4WA 4DJFC 2WMKA 2FTYA 4QP0A 3MSRA 3KOYA 3S4TA 1MVYA 1Z9AA 2ZZ1A 8TIMA 4PA8A 2ZIDA 2A3AA 2BOGX 2GGIA 1MDRA 3LYEA 4B2DA 5HANA 1V6WA 2J7HA 4GABA 4UWMA 4QLKA 1VFMA 4ZR8A 2EQDA 5I3JA 1QI5A 3THCA 1K8YA 3BAKA 1L6WA 1Q6OA 1XJBA 4AX7A 2WANA 3STCA 5HPCA 3GIYA 3WD3A 4NQ1A 4H8VA 3WNMA 1ZTVA 2TPSA 4BI5A 1BEUA 1B3WA 3S8HA 1I2NA 2C6QA 2OWXA 3BJSA 1XQLA 4KRZA 3AOFA 1JG9A 3W24A 3HQPA 1RPKA 3RCNA 3DXIA 5D2VA 3T0AA 5KZMA 4DEFA 3NVTA 4AIUA 1RLDA 2GK1B 1W5PA 5IHRA 2GVLA 3P3BA 2HJPA 2OKOA 5LKYA 2UY4A 2G0WA 1DXIA 3R43A 3W70A 4MUZA 2PBOA 2ZZ6A 4N42A 3ORWA 1G01A 2OQLA 2WYSA 5H8MA 3WN6A 4B5SA 1TR9A 1US2A 2ZADA 2QDEA 1DWJM 3L2MA 4KT2A 1DYSA 3F7JA 1QPNA 1J0KA 1E5JA 4PUJA 1TYGA 1CYGA 4WIWA 1XCWA 4RKAA 2WM0A 4LSBA 3BW3A 3M1ZA 5K2ZA 3WF2A 5C6MA 4RNIA 1RCOB 3H2NA 5DN1A 3FJNA 1XF0A 2CBUA 2NLIA 3RPDA 3KBVA 5BWAA 4TVCA 2YL5A 1D7FA 4Z0SA 4YXGA 1PJ9A 2YBVA 4DJDA 4PODA 1FWRA 1I45A 1IZKA 4E4PA 2HS8A 2DORA 1IZCA 3NQ6A 3UR8A 1JCXA 2DVXA 2WVVA 2VCCA 2C0HA 2VRQA 1B9ZA 3RIKA 4CQAA 1IEWA 4UFLA 3DI0A 4L56A 1GG0A 1AZ2A 5FJIA 1EJWC 1TWZA 2DGAA 3GR7A 4HT3A 1F6PA 1O68A 5LNUA 1PTAA 1KW1A 4RL3A 5C2XA 4FP1A 4D71A 3OU8A 2QPUA 3NTYA 1LOLA 3S1VA 3W71A 2CEQA 2VX5A 4S3DA 4IUOA 1YQ2A 3F2BA 4QX4A 4LS1A 2EBNA 1TZ7A 1PZ0A 1UKQA 2WC7A 1SJAA 1PSCA 1O12A 1XISA 1K6WA 5T26A 4JFVA 2XWEA 1KQYA 3ATZA 3TCEA 1OFBA 5A8QA 1QRQA 4QQ3A 4NL1A 3QPZA 3N9SA 4KEUA 1O4UA 3PBMA 4AISA 5LNVA 3VD4A 2UWFA 3TC6A 3H2FA 1LP6A 2GL5A 1KFLA 4ZO7A 3TR2A 4IH3A 4ZQPA 3JS3A 2O4QA 2VX6A 3LENA 2X05A 3NDYA 1I75A 3H2CA 4CU6A 4JYEA 5H8PA 2CHNA 4RNJA 3SIZA 4U10A 3SY5A 4AAJA 3WELA 1WOBA 1ZBKA 4O8AA 1XLKA 2Y6ZA 4PTDA 1XDLA 2PDKA 3DX5A 3QZAA 4IMGA 1EA0A 3CAQA 1ZZMA 4B5UA 2C1GA 1VBRA 5EA9A 4OUEA 1TPVA 3FYPA 4JQ3A 3S6DA 3BSHA 5CBBA 4R3UA 2VVNA 2ZFAA 5JIPA 2ZX6A 3B06A 4AQLA 1O5QA 1SFLA 5MKGA 1JRBA 3KM8A 1Q6FA 3LBOA 3ZLHA 1JUEA 4KQNA 1IV8A 4CCEA 2O7QA 2VZVA 2DIKA 2D23A 4IPJA 1NAL1 3EAUA 5CGQA 1W32A 3URQA 1G67A 1GT8A 2Z4GA 3VGGA 1VYRA 3AS1A 1EDTA 5TQLA 4XKMA 4TU1A 1FH9A 2GJLA 1OYCA 1Z44A 3EX1A 2BV9A 1R38A 4GNVA 5F2GA 3NL6A 4I7VA 4NXKA 1HL8A 4FXSA 2J88A 3VZYA 4F3HA 4QJ5B 4AF0A 3CWHA 4BHYA 6A3HA 4LH8A 6XIAA 1A3XA 4H9MA 1F74A 4KMQA 3G6MA 3F4DA 4GA8A 1KCXA 4JTCA 2ISSA 3FNDA 5DEZA 3TIMA 1HKJA 4OFCA 3A9BA 1VEMA 1T99A 3ITTA 5EL1A 1Q2SA 4QAIA 5EMUA 5DMMA 4HU8A 4C5YA 4M8UA 1SUXA 4DJED 4GWEA 1F4AA 4GYJA 4CCZA 2I16A 2JK2A 4JPGA 1UR1A 4N6FA 4DF1A 5LGXA 1IWBA 2B7NA 3WL1A 1K9TA 5EFDA 4Q8VA 4DWSB 1QUMA 3LTYA 2XN1A 2BBFA 3NL3A 5D9PA 4FLRA 4I6VA 1J0YA 2V2DA 5CC7A 2AL1A 3WUGA 1W3IA 3NCOA 3B05A 1J10A 4CQ8A 4XAPA 2DV0A 4J27A 2WWDA 4YCOA 3C5QA 1HJXA 3IJIA 4JNYA 1MW1A 4J4KA 4H4IA 5IM51 3QOKA 3TFXA 3LM7A 1EYWA 1CLKA 5D09A 7XIMA 1UASA 2PWHA 5F2MA 4H6EA 3TTEA 3SQSA 4PCPA 5FESA 4D6GA 2VHLA 4FNRA 3ES8A 3LXBA 1VFFA 4S3EA 4ZCWA 1L2UA 1NSJA 2O0TA 3M7SA 1CLVA 1W5MA 1OCJA 2ANUA 2NVAA 4ZEPA 3UZZA 1UH2A 1QK0A 1YX1A 3KOZA 1A5SA 5FL1A 3B9EA 4ZTXA 3O06A 3N9RA 4O12A 2YA0A 4DB7A 1MZHA 2GPTA 3GDTA 1XUZA 4UTIA 4ZBCA 2QUVA 1I4NA 1VB9A 3C0QA 3VDBA 4R5EA 4OBSA 2E09A 4N9EA 4CQCA 2C71A 3GH4A 3MHFA 4AVFA 4C6KA 1XFCA 3N73A 4UNLA 4MWAE 2VQUA 2BXZA 5U7SA 3UG5A 4JX6A 4E3TA 3W87A 2FMOA 4FIQA 2VI0A 4L61A 2XIQA 4A21A 2UV8G 5D2XA 5C7HA 2WO5A 2BTMA 2VEGA 4FNPA 4JTSA 2HVOA 3T1GA 1T7LA 5LIXX 2R1KA 4M6QA 2C1IA 4M56A 1JGIA 3BCDA 1OIMA 2H6RA 4XBJA 3HO8A 3N6QA 4AEOA 1WBJA 1CGYA 1EYEA 3C8FA 5C55A 4LRTA 3UWYA 1U1HA 1E9ZB 3N11A 1VBJA 4QAWA 2QXWA 1PHWA 3BAWA 1IT0A 4MIMA 2XUCA 4ASTA 3AYTA 2OX1A 4HYWA 2NUWA 2HVNA 4A22A 1XICA 1JXJA 1EX1A 3PPFA 3NURA 3NO1A 1JD9A 3NNTA 1TPH1 3SFKA 5T8GA 4GKTA 2OMAA 3TSDA 4GXMA 4HZMA 5I3GA 2ZUTA 3NO3A 4X22A 3WUFA 5XIAA 2G37A 3GNNA 3TE9A 4E8GA 5DXXA 3HG4A 1K7FA 4Z08A 2QAPA 3W1TA 5KEZA 3JUGA 3D6NA 1RY8A 2NZLA 3SY8A 4FF5A 5M3WA 2ZE3A 1K9EA 2ADAA 5BNKA 4HB7A 1W1IE 1E3XA 2PU0A 4HNUA 1S5TA 3GXFA 1C92A 3BV4A 5FJUA 3T55A 5M5DA 3PSWA 1IEQA 3VDGA 3IACA 2PDNA 4FMVA 1SVDA 3DG6A 5TAOA 3S1UA 1GQLA 3WBEA 5GNXA 2D3NA 1A5LC 2QCCA 2C8NA 1U1JA 3ABOA 3E3HA 4WJXA 5HNTA 1DKWA 2D0GA 7TIMA 3BLKA 4E3VA 5FJRA 2PC8A 2INZA 3DYMA 2GJXA 4N2YA 1DORA 2WLZA 1F3WA 4TMBA 2Y2WA 2W79A 1FDYA 2GOUA 3WSUA 2WVTA 2W91A 3N9KA 1KBKA 4EPEC 2OO0A 3SRDA 5IBXA 4UZUA 4GNKB 4AU0A 4R88A 3AUJA 4O54A 2VC7A 3HFTA 2WHJA 1GVRA 1ZENA 3W1RA 4V28A 5CGTA 3AZTA 3XISA 1VCFA 4KEVA 4Q4QA 1KQZA 1KO0A 5J8LA 1Z48A 3M4HA 3CPUA 3D5HA 3CUFA 4LAKA 2A79A 1LQ0A 5FF2A 3SCNA 4M6VA 4HKPA 4PYSA 1BRLA 3LX9A 3Q58A 5CC6A 4JCLA 1JAEA 1F8IA 2MUCA 2RFGA 4RE3A 3L4UA 1UUMA 2GZXA 4JOMA 1SW3A 5D2WA 2CLOA 2E6DA 4UTJA 2XGBA 3DDMA 4H3DA 4XZ9A 1TCDA 1TZ9A 4H8NA 1A49A 4RW3A 3INPA 3K8LA 5CQ1A 4JN7A 4RK8A 1DOSA 3T05A 4FS9A 3VIPA 4YLWA 2WV8A 3KVLA 2G3IA 3ARQA 2RJHA 5E0FA 1IF2A 3Q37A 4HHMA 4W89A 3LK6A 4AB4A 1AW2A 3WQCA 4L80A 3LPPA 2XIMA 3UBPC 4P7OA 5D8WA 1TV2A 1BTCA 2E9BA 4MF4A 2V2CA 4AF0B 4Z1AA 2H8XA 3I4EA 4AXNA 1VENA 3FAWA 3E2RA 2VFGA 2BOEX 3LMYA 4WY0F 4DZIA 2YW3A 4GC3A 3F5LA 2HNEA 1MXDA 4C6QA 2XFWA 4AD5A 4FSAA 4UMAA 4ZOAA 2ISVA 1DJIA 3GW3A 3ARWA 3RLGA 2FVMA 4CN4A 2EPNA 3SY1A 4LBUA 4DI8A 1VLIA 4FLQA 4LNYA 4D8LA 1ZJBA 1GOOA 5REQA 2ZKMX 1V79A 1HKIA 1H09A 4YTSA 3IIOA 3WQPA 5A8MA 1E9YB 4Y8FA 2VVSA 2IQ0A 4LYKA 4Y2WA 6REQA 4JTIA 4Z1CA 3N12A 4B15A 3H26A 2J9XA 3APGA 2GQAA 4N0RA 1H1ZA 1SJBA 4JZ5A 5K4XA 1PDZA 2NQLA 1C8YA 2G50A 3GUGA 5E6YA 1J01A 1GEHA 3KLKA 4XBSA 4IICA 1HTIA 3L66A 4I9TA 4Z1DA 1EB3A 1QNRA 3VD7A 5D32A 3VXGA 1FDZA 4GVHA 5TBOA 4ZB5A 4Q8MA 2DZVA 3LBCA 2G3JA 5AC4A 3BTNA 3SM0A 4BKNA 1NFGA 3ENLA 4P8XA 1O66A 1DXFA 3WBWA 1NARA 2VRJA 2JF6A 3G1DA 2XSAA 3RAOA 4EE9A 2PDBA 5DX7A 3DFOA 3WG6A 3RPTA 4HVXA 4P8WA 1GK8A 2GJPA 4GISA 5MKGB 3COTA 3BARA 2CWNA 1A5AA 3W73A 3SADA 4GI6A 1KXTA 4XKYB 1IHIA 2GGHA 3IRDA 3BLLA 1Q7ZA 1MUMA 3M0YA 3W01A 1XYFA 1TTJA 1LRNA 4WJ8A 4JDYA 1GVIA 4ZZ9A 2DIJA 1Z42A 4GI9A 1U5VA 4HYRA 2GDUA 3PZMA 2A0NA 4GJ1A 3E0FA 4ACZB 4FHAA 3NGJA 3FOKA 3P5ZA 4JIHA 3W00A 4QE1A 2QUNA 1H50A 3RGTA 4S2BA 3AU6A 5D38A 1GWJA 4GG9A 4M6UA 1ME8A 3STEA 1QK2A 2IW0A 3WJZA 2ZVRA 4TX9A 4DZAA 2CHRA 4CGTA 3F4WA 3PAJA 5AC7A 3M0ZA 3SN4A 3M7WA 1QHOA 3LMZA 2YFOA 1XRFA 4OKDA 1M5WA 4S3KA 3UWEA 5TNVA 2VC6A 4MZ1A 3GC4A 2Y70A 4Z2HA 4BI7A 4L7ZA 2WMGA 3PG8A 2ODOA 2OOGA 3T2OA 1B3VA 1P0BA 1BXCA 1BF6A 3U57A 1SZRA 2VX7A 2VURA 1AJZA 2VKZG 2RGMA 1GYMA 4MPKA 2MANA 3DKJA 4B4FA 3LLFA 1FKXA 3CEPA 4PCSA 5CCZA 1U5HA 1EEPA 2JQXA 3GKFA 3EWCA 3PPHA 3LTSA 3TMQA 4GZIA 1E5NA 1GYLA 1ZCCA 4NAEB 1AH4A 2ACQA 3OLEA 5GJMA 4QHRA 4W9TA 3EWWA 1JCJA 4LGXA 3TV8A 3BMWA 5A3HA 4D8AA 3GE7A 4XAGA 5D2YA 2IQDA 5BU6A 1E51A 4O52A 1EEXA 3GIQA 3OTRA 3RU8X 3OZYA 1JNDA 1UROA 3V0TA 4B3ZA 3FS2A 2F84A 3AYVA 2Y85A 1R30A 1QW9A 3FJ6A 1TRIA 5G4HC 1NEYA 1FWDC 3NXFA 2OR2A 1N8WA 2F8QA 3KTCA 1XD1A 5E70A 1B3ZA 2NSXA 3N34A 4L65A 1KRMA 1UWSA 2ZA3A 3MSDA 4IQEA 3MHUA 1J0ZA 2UY3A 5D33A 1XFBA 2FTPA 3UD6A 3THAA 4N4PA 4UNIA 1MI3A 3RO8A 2NQHA 3MBDA 1CX9A 1BGAA 3MS8A 5LZLA 3TJ4A 5I6SA 4CN1A 3DUGA 3OA5A 3E38A 4MDPA 4RUBA 2V5KA 4LCSA 3LN3A 5CAHA 3S5NA 3L21A 3GSMA 4HMNA 3AIQA 4ADSA 1A5MC 4N02A 3MDUA 4CCDA 5HOSA 4XX6A 4O19A 4QDPA 2E7FA 2F38A 3EPOA 1DWFM 3ES7A 3FXYA 4UTUA 4I7UA 2QPXA 4WDUA 3W1NA 1DEDA 3EMZA 3ZQ9A 3K1GA 1ZJHA 1CT5A 3AHYA 2JKAA 2QJNA 1UR4A 2DDXA 1XG4A 4HNOA 3W2MA 1UC5A 4AX6A 5ENLA 2P8CA 3A64A 3QKEA 1OC7A 5KITA 3W0KA 3UG8A 4IMCA 1KCZA 3SCWA 3LERA 4CQDA 1I8JA 3IVTA 4LXFA 4WCJA 4GMEA 5A6BA 1EWDA 3RJYA 3BURA 3VOGA 3TWBA 4LF1A 2CLEA 3EDFA 1H7RA 1EOKA 3WUEA 2BZNA 3W7EA 5G4WA 5BU9A 2Z7KA 5FKYA 3W27A 2WMJA 1W9BM 3GG8A 4A6GA 4RDVA 3VIGA 2J74A 1C90A 4LC8A 3V5OA 8A3HA 4DY1A 4R9XA 2QNEA 5DT5A 3I65A 2ZX9A 2KX9A 4DJEC 4N9BA 5D9OA 2DIEA 4ERAA 2FZMA 2YCIX 2I57A 1ZSXA 1EPXA 2OU4A 3QC0A 1WCGA 1Q2RA 3OVPA 4L4OA 4JAWA 3G1XA 4AWTA 3TC3A 3HV9A 5JBDA 4ES4A 3NDOA 2AOSA 1DWHM 3S9YA 1MUWA 3DC8A 3TFCA 5DCBA 3MSYA 3L4WA 1QNPA 2E6FA 5FF3A 4NZ4A 3PBUA 3ZWSA 5G2HA 3H7RA 3PJWA 1ZJIA 4DQWA 4MZ8A 1VPQA 3PJTA 3NQMA 3VZZA 1HKWA 2WPGA 3WJSA 3AYSA 5H8UA 4BY3A 2J47A 3GU1A 3GVWA 3UJSA 1Z69A 3VFLA 4NZFA 3WD0A 2O9RA 1DXEA 1B0IA 4RW5A 3IIVA 4EIVA 2BXVA 4ZQNA 5HUPA 4QJ1A 4IFKA 4X60A 3AHTA 1UPMB 5H91A 1KGXA 1FP9A 1WXZA 1Q6GA 1HG3A 2ZC1A 2G4JA 3MTWA 1Y5XA 4KFNA 3TWAA 1KV8A 1QDSA 1I2OA 4JNMA 2VC5A 3MPGA 3SRFA 1X96A 2BY1A 4UTWC 4X61A 2ICSA 4LAMA 3S2NA 3CZJA 4ACYA 4JEQA 4KWWA 2OSYA 4JCMA 4PTVA 2WOQA 1JDDA 3HN3A 4F66A 2X16A 3UXLA 3W2KA 5AKQA 3KBJA 3VE9A 1A5UA 3PUDA 4YTUA 3EDJA 2XG9A 3EPNA 3D0CA 2G3NA 3AQUA 3R8HA 3L4YA 1LWJA 3BJTA 3LLDA 2WAGA 1K8ZA 3CUZA 3KE0A 4D6CA 2HEJA 4EPBC 3GIPA 2YXXA 5BOOA 3MUY1 1OABA 2XFYA 4FIRA 3KBMA 3HMCA 3RX3A 2OEJA 5LA0A 4UFIA 3BLOA 1W54A 2AQVA 4HMDA 2J75A 1NDWA 2P0OA 3M0MA 4HSHA 3W1MA 3BG5A 5C9RA 1KFBA 3ZYZA 4D1JA 4JTLA 5BXSA 4ZXLA 1WKYA 1H1NA 3OOQA 3KCJA 1SFJA 2C18A 3DOPA 3PBGA 3CL8A 3W2UA 3ZJ7A 3HTWA 1TIWA 2J79A 4CEUC 3NZRA 2VDGA 4HHPA 2ACUA 4XD5A 4DXVA 5FD0A 1CECA 3VYLA 4TTUA 3PTMA 4WK9A 3MBFA 1XW8A 1YDOA 2TRSA 1CI1A 2FDMA 3OPSA 3EWXA 3VINA 4JHOA 2QUMA 3PPGA 2ACRA 1Z6KA 3T8QA 1B4EA 4F4RA 1UIOA 1S2VA 2ALRA 2CXGA 3H4WA 1A53A 1FBAA 2CZFA 2C1HA 4PEEA 5BRQA 4AC1X 4HHLA 1CW2A 4IHCA 5DMNA 4M7SA 1DHPA 4LUJA 1TRDA 5A6SA 1X6NA 3P14A 4HK7A 5IHSA 1P6CA 4HJFA 3AICA 4W8AA 1JYVA 3UYIA 1EQCA 3WJYA 3CV1A 4EAMA 4Q6JA 3P60A 4A8NA 4KCUA 1OVDA 3O2LA 2O9PA 3LCXA 5IDIA 3W1QA 4LB4A 1YPIA 4Q4MA 1FKWA 4G1KA 3N2MA 1UD3A 8XIMA 5DANA 4HZ6A 1K4HA 2GWNA 5HXMA 4LAUA 4B4HA 1M01A 1AL7A 2QIIA 4IQLA 2VGBA 1PYMA 1O1ZA 1KCKA 3GQYA 3AXMA 2VUYA 5HULA 1Q8AA 2Z27A 4IFRA 2VMFA 1TE1A 1BWLA 3F4NA 1JDAA 3LQLA 1UWAA 1EFZA 5I3HA 5A2AA 1PKMA 5K9DA 3N17A 2OLHA 3AMLA 2ISDA 1OJXA 3BAXA 1CBGA 1DJGA 1K1DA 3MB9A 1EHAA 1KXQA 4A8IA 2Q3OA 3NUKA 2W9MA 3N2XA 5F7UA 4XBKA 4HU0A 1NWSA 3LS9A 2PDCA 2P5NA 4DF2A 3SUVA 5IDZA 1HUVA 2IPFA 5F4SA 4BF9A 3OBEA 4ZFCA 4A35A 1G6CA 5EMKA 1WO2A 1QPRA 4EXAA 3F5KA 1MMFA 2OX4A 4E5TA 3RNDA 4LTSA 4I9MA 1RUSA 3GXDA 4RZ5A 3ID7A 1K9FA 3TN6A 3UG4A 5G1YA 3FVDA 3NQFA 2NX9A 4Q8OA 1TV7A 2PDPA 4F2UA 1RK5A 1S2TA 3NAVA 3GVGA 4B91A 3TJIA 3LA4A 5D03A 5I03A 4A05A 2Y88A 3DCPA 1XLBA 4J40A 1M7XA 1WX0A 1NM9A 4RX0A 4O0KA 1OYAA 5HDRA 2DSZA 3HGSA 4AIBA 1O60A 3R89A 1XIMA 3EB2A 4H9ZA 1FXQA 3LG3A 2Q6ZA 1W3NA 5GVJA 1Y5VA 2OYKA 4IMAA 5CZ0A 4MNLA 1JCMP 1OQFA 3P0WA 4F9JA 3W7MA 3BCFA 2HXTA 3KRZA 4GINA 4JBRA 3NQVA 2EF9A 3GKAA 3VMNA 1SW0A 5E09A 3I10A 3CIVA 1E40A 3IPWA 1H62A 3TA6A 3NQ2A 3OA3A 3FVMA 4E2DA 5EPDA 1OZQA 1YXDA 1S2AA 2JFEX 2XVLA 4KW2A 1S5NA 1SR0A 3LRLA 1XH1A 4ZB0A 1X1OA 3UCDA 2YCLB 4E8DA 1IT7A 2IKGA 4IL2A 3V36A 1TJ1A 3KBSA 3G8EA 4JQ2A 4CU8A 1HKVA 4RV3A 1ZAIA 3R94A 2DZBA 4HZ8A 1TO3A 4DO5A 1RJRA 3CIXA 1SYTA 1WYIA 4G8TA 4CQBA 4PB4A 3H12A 4DJFA 2X1TA 5I07A 3B0YA 2ZZ2A 3T4CA 4HCHA 1ISYA 3OIXA 3U8GA 1CXFA 1OFOA 2H90A 3IWPA 5FJTA 4PTWA 1QWGA 3WQEA 1JI2A 1E0VA 3VPLA 4DUVA 3GXIA 1HF6A 4HD5A 2IXVA 2POZA 1WP6A 3JVAA 1RALA 5M1TA 2FHFA 2O7SA 5E0KA 3D3FA 7CGTA 1KM6A 2XU2A 1CPUA 5JIWA 3U2ZA 2R1LA 1QFEA 1AA1B 4LOCA 3MO4A 2VOTA 3G2GA 2XH0A 1U5JA 3WO8A 1RQEA 4NZ3A 2FLIA 5C7VA 1MO0A 2A6NA 2PRLA 3VKCA 5HQMA 3B3DA 1TUFA 4I9JA 3SUTA 2QVHA 1R9ZA 3CT2A 3UW6A 4E6MA 1CXHA 1KBJA 3FJ4A 1W5OA 4HOXA 1XH2A 1IEVA 3RR1A 4JFTA 3B4YA 3WBXA 1RA5A 4DZ5A 3VUSA 4F2BA 3UQNA 2NXHA 1R7OA 3N3MA 1NDZA 2NT1A 2OZ0A 3IVUA 3DHPA 5T9BG 1US0A 1V6TA 4W88A 2ATSA 2YBUA 4KGJA 2GQ3A 4W8LA 1BG9A 2J7FA 3GO2A 5D9NA 4NI3A 3QPEA 1XIHA 1R3RA 2X40A 4O28A 4NNAA 3QBUA 1H0GA 3WZ0E 4GRSA 4GUGA 4Q4RA 4E4UA 4F79A 5CPOA 1UR9A 3RM8A 2BSLA 1M41A 2A85A 4DWDA 3QV7A 4H8UA 2NV2A 4MOZA 4B92A 3S6TA 5A6TC 3EX3A 4NF7A 4MJMA 4H9VA 3WX7A 5EMJA 2QT3A 3VIKA 4Z2LA 4HMEA 3OVRA 4QG8A 4DJDC 2W4XA 2GJXB 7TAAA 2NW0A 3ARTA 1OX4A 4DJEA 4M0XA 3NR0A 4FA3A 3H24A 3PWGA 3WLMA 5G1TA 3NXLA 3LI1A 1BQCA 1OF6A 4MMWA 1F9CA 1DPMA 1ME7A 4LS0A 1P5BA 4OZOA 3IV3A 2E9MA 1Q6QA 3N19B 2VFIA 3NVDA 3ABXA 3G0UA 5HA7A 2DUZA 2Q8ZA 4BQ3A 3VIJA 3FAXA 3T81A 3TJLA 1V7AA 1XC4A 3DGBA 5F2LA 5A2CA 1VPXA 3HPFA 2P0IA 3TX9A 1JYWA 1A80A 1HIZA 4H6KA 1R2TA 3MY9A 2AGKA 5D4YA 3OW1A 2IKJA 3GU2A 1H5YA 5GQBA 4H83A 5D2TA 2P3EA 3GNRA 4MYAA 1TVNA 2IQTA 4IM4A 3T07A 3SO7A 1L6YA 3BV7A 2GSJA 1LBMA 3OO2A 4MPQA 5AHLA 4AUBA 3NPUA 2HPMA 4Y7EA 1H41A 1KM2A 1H11A 1ENUA 3R13A 4QFUA 1MEWA 4PFHA 1PDYA 4H04A 3GM8A 4AH7A 2Y24A 1UWIA 2V0TA 1P48A 1RY0A 5AYBA 4S38A 2XISA 4AMCA 4Y9NA 2BGNE 2VR4A 2OTDA 3CM4A 4JTTA 1TWDA 3S1GA 1OX4B 4MNMA 3NOEA 2YCJA 3S2LA 3VOHA 3E9AA 1X6UA 3KBWA 3L0GA 1KBIA 4OQVA 1QW7A 5HINA 5AHMA 2Y62A 2VEIA 3QLDA 3NM1A 4J1OA 3PUEA 5CJ5A 5HJLA 2B31A 1WAUA 3TZNA 2OELA 1CEOA 3ISIX 1ZS2A 2QJIA 2ONEA 3SECA 1NF7A 4DAFA 3CHEA 4UMBA 3H8AA 3URAA 2P1FA 2V2HA 4ATDA 5AECA 1ITCA 4WKFA 4W86A 1LT7A 3PZGA 1BTMA 2PBGA 1PWLA 4LC6A 4LT9A 4UR9A 1RZMA 1ZJAA 4D8ZA 5HWNA 1E56A 2A5HA 3EX6A 1TV8A 1GW1A 3SN0A 2DU2A 3A5FA 1FY6A 2WCAA 1EUNA 1R3YA 2WJEA 4S1FA 3PTKA 1A3HA 1G9HA 2BB0A 4ZQCA 1E0XA 3EZ4A 2W6RA 1W9DM 3CQHA 3SGGA 3SB0A 4FOJA 2PDHA 2UY5A 1MDLA 3MV01 3NPVA 2GWGA 3A4XA 3VIIA 4X0NA 4DUOA 5HMDA 1NDVA 4GKLA 1Y5WA 3LHZA 3STFA 1Q13A 2CCRA 4HNVA 1QNQA 2I56A 2IXUA 5LA1A 1BQGA 3N25A 4IG2B 3CWNA 3BQ6A 5C2GA 1MFUA 2QCEA 4D6IA 3B8DA 4HTBA 4AZ7A 1E6ZA 2D2OA 3DERA 4S3AA 2Y89A 5DT7A 4ORMA 3ZIZA 3LHUA 4IXHA 1SZFA 1QT1A 1FWHC 3VDCA 1DQUA 1JZ3A 3VNDA 3B8SA 4W7UA 3I3BA 3QTGA 1MRQA 1RV8A 1XLMA 3NQ7A 2INFA 3CUGA 1TJPA 1J93A 1UD2A 1XBZA 2WXDM 2ACSA 1GNXA 2D2JA 4MLRA 3LRMA 1BXBA 3H4GA 1V51A 5D37A 1TV5A 5IFTA 5ABTA 1TTPA 1H49A 1UKSA 4GIAA 3W6LA 3CUHA 3AIWA 3AMCA 1G1YA 3QY6A 8CGTA 4LPCA 4LEFA 3ARUA 4ZO9A 2ZZ3A 1Z3NA 3CQJA 2FZNA 3AAMA 3ZT5A 2WC4A 3CZEA 5AHFA 1CB7B 4KIRA 1P0EA 3Q4DA 2X8RA 3IJ7A 1V3KA 3IGUA 2EEXA 4MWAB 1E1EA 3MVIA 1HJSA 1T5AA 1ZGDA 2V9DA 4DHGA 2E25A 4BJHA 1KFJA 1GHRA 3DBPA 4MTVA 4H9UA 3CK5A 3TCSA 4D6HA 3TN4A 2G96A 2G97A 5I02A 4Y9PA 4WEVX 4QXIA 4RJEA 3VA8A 3BK0A 1D7KA 1R2RA 1RSCA 3OYXA 1PO9A 1GJWA 4UB9A 3VM7A 1S2UA 4W7VA 1AMYA 2HSAA 4S39A 2CLPA 1JGMA 2JKPA 1F3TA 3O6YX 4H00A 4BWLC 1RAKA 4NX5A 5FACA 2HS6A 1QR7A 3UPWA 2YBTA 2ALDA 4JTQA 3EPMA 4RLIA 2QUTA 4E2OA 3T40A 3G3DA 1C93A 1GPFA 6TAAA 1N55A 3GG0A 3QV6A 3UESA 1XS2A 4I9AA 5FF7A 2CIPA 3II1A 3SUUA 2YZRA 2XM1A 3FJLA 5F4XA 5ECVA 3SFWA 1RQBA 3U48A 4ZO6A 1HJWA 3SZ8A 3TYUA 3M64A 3SI9A 3PZUA 1HNYA 1LT8A 3LOTA 1OADA 3B8WA 3A23A 1Y8BA 4UFHA 1PTGA 4NU7A 1PIFA 1EZ2A 3M0XA 3OZMA 1XIJA 1AVAA 3GDLA 3ERPA 1EF3A 4XVDA 4HK6A 1EJTC 1AMKA 1VS1A 2PWGA 2Z00A 3REQA 1UH4A 3W88A 3NOYA 2INEA 2HE8A 1H60A 1BVNP 2GSEA 3DG7A 1EH9A 3ARZA 4M51A 2P50A 1NU5A 1HGYA 2HBXA 4C1NB 4GVIA 1CXIA 4FR1A 3WQ5A 4DX3A 3TSMA 3EDDA 4I3GA 4O16A 1ITQA 1F6KA 2NVDA 4KEZA 3T7VA 3TAKA 3LM3A 4EK7A 3W7KA 2GJNA 3QQWA 1HO4A 2B7OA 3QSTA 3C2EA 2PGRA 1FCQA 5C0QA 4MWAC 3URBA 4UQBA 4AFYA 1OYBA 1VBUA 3BGJA 1AG1O 2OZ3A 1WA3A 1XGZA 3AXHA 3UA4A 3GAKA 3KRSA 2HDJA 4IL0A 4ZGYA 1EA9C 4BEUA 5D04C 3TTSA 4O10A 3EOLA 1X97A 4R34A 2Y5JA 1EJUC 4IFOA 3H21A 4CD4A 3GVVA 4HA0A 4GK8A 3PULA 2ZVIA 2O4MA 4NG3A 4Q6XA 5I3IA 1CTNA 1JPHA 3N4EA 4J5NA 4Q22A 1NVMA 3UCCA 3OGRA 4PUDA 1SO3A 3FHQA 1W3TA 1GQKA 2JKEA 2DZTA 4ZFMA 1MWOA 1O94A 2XN0A 4NUWA 1JIBA 4HA3A 5AHEA 1R2SA 2AMXA 2QUUA 3A4JA 1CGXA 3M5XA 4I8YA 3GDMA 4UR7A 2AKMA 4B16A 3DFQA 1CNVA 1HZYA 1MW3A 3L5AA 4JS3A 4LALA 3KX6A 4LB3A 3ANVA 1ZL1A 2GQ9A 5HUOA 4LCQA 1JZ6A 5A94A 2F6UA 3WDRA 3O6AA 5CZTA 1FHDA 3IJDA 4YS1A 2R82A 1KWGA 2JBMA 4S3BA 3OVGA 3WQDA 4WKHA 3SR7A 3CMGA 3FK4A 4GX8A 1S39A 1VF8A 3VTRA 3HGJA 1B2YA 1HFBA 2QW5A 3VDHA 3HA1A 1KBLA 4O17A 3AJXA 3SSZA 2YA2A 2WW5A 2R1PA 3QMRA 3ZSSA 4W7WA 1D2KA 2OB3A 1PBGA 1FWFC 4IQJA 3W25A 3KXQA 2DQXA 4DWSD 3WMCA 3O0KA 1XKYA 4E8CA 1PKNA 5J5DA 4KIEA 3LRKA 6PTDA 1W31A 5BCAA 1EF2A 4M3PA 5CKSA 5FIPA 3B0XA 3KW3A 4JIIX 3FYOA 2R1MA 4O1BA 3U5YA 3QYQA 3ITCA 1E4MM 3AISA 4K7VA 4UMCA 4KFOA 1FWWA 5GJPA 3GTIA 4H7VA 3K2GA 3CZLA 3L68A 1ZAJA 4ML4A 1PE1A 1EPVA 4TVDA 2YYTA 1XRSA 3FDGA 3QSRA 1UWRA 1VYSX 3LZ5A 1H7WA 3RDKA 1HW6A 3VKAA 1ADOA 1XLFA 2YW4A 4LAZA 1VEOA 1TPEA 4LU0A 1E1FA 1KLYA 3FX4A 1ISZA 1ODUA 2FZ8A 1UP0A 4R7OA 1SPQA 4GQ0A 3EWYA 3USZA 3OGVA 2FH6A 3GFXA 3XIMA 1JEZA 3TKFA 4LAOA 3KDNA 1QNVA 3BGGA 3PZTA 1PAMA 3BLFA 2XGIA 4JYDA 5AHNA 1QBBA 1OF8A 3TTOA 3WDJA 3ARYA 2YB4A 4M5PA 4E38A 2Z0IA 2PGFA 4O50A 4O1AA 3H7UA 5I09A 1RP8A 4UFJA 3NO5A 1KR1A 3PR2A 5ABFB 3MQTA 6ALDA 2HRWA 3QQ0A 3BMXA 3XINA 1YBQA 2BLEA 3L4VA 3RFAA 3S9ZA 3NZ1A 3EX2A 1OY0A 1OC5A 2VOMA 4NT0A 4K1WA 1QJWA 2Y8KA 1QVBA 1UA7A 3E1F1 1PUDA 1WB0A 3R8RA 1R3TA 7REQB 1GCYA 3WL0A 3KRUA 1GOWA 4PN2A 1BG4A 3VGEA 1SJCA 1Q7MA 2QF7A 1TX0A 2CLLA 3ALFA 1B1YA 5BROA 2CW6A 4PRWA 1W9XA 4NP7A 3TYAA 3KWSA 3VNZA 2ZUNA 5KINA 4WDXA 3CZ8A 3T08A 2XN2A 4PBFA 4MVAA 3QY7A 4S23A 2RDXA 1X1NA 3CL7A 4H8HA 4DJFD 1WE5A 2X0SA 5EB8A 2XDFA 4I5XA 3DFSA 4ZQRA 4LUTB 1ECQA 5BRPA 3LSBA 2REQB 4PUEA 3CO4A 3LLXA 2J7BA 3CU2A 5DMYA 2ZZ4A 2QPSA 3VDAA 1XYLA 4FK9A 1Q6CA 3DEQA 4OVXA 2I5GA 1SZGA 4PMNA 1WZKA 2OXNA 4WXYA 5CG7A 1THFD 2XPKA 1ECEA 5LIUX 4PUKA 2X1RA 2WNWA 3QY8A 3DIPA 1Q65A 4XTDA 4BZYA 3C0JA 4FNUA 1LM1A 3R79A 5ABEA 5DF0A 3LHWA 5BMWA 2QCHA 5I3KA 3GTNA 4PCFA 3PTDA 4UXDA 2D20A 4CKQA 4HYVA 3EEGA 1N7KA 2BXYA 4LQ1A 3DFNA 1A0EA 3B8VA 3PUOA 2CYGA 3TQPA 4C6OA 1C8XA 2IMRA 1JQVA 2VFHA 3APYA 3VIMA 4QM1A 4A3UA 5EBAA 4CLMA 4GI8A 2VNCA 4P7RA 1LG2A 1UG6A 1V02A 1T0OA 3QN3A 5BZAA 1PZ3A 1W1B1 2Z24A 2QGYA 1PB0A 2ZA2A 4FAMA 1K7XA 2ZXQA 1XBXA 4AEFA 3E02A 4G5DA 3HQOA 5LHEA 1DV7A 1KTBA 4JTUA 3LCIA 1DJQA 4PMOA 3ITVA 4US6A 3WQGA 4B90A 3R6IA 3QHMA 2O56A 4JQ4A 2ZZ7A 1E3ZA 2HQAA 2G8ZA 1B4KA 3PVFA 3T2PA 3SGZA 4Z2JA 2WM1A 4WF7A 4LANA 1XSJA 2NT0A 1O7AA 1J9YA 3WK3A 3MP4A 3EDEA 2AAAA 3P7YA 2PDJA 1QO5A 3UPMA 4XQ6A 1S5MA 4EWND 4XZIA 3NQDA 1PX4A 3N6HA 1D3GA 4PC8A 2DSUA 4I5UA 4URIA 1UQZA 1QOXA 3M5ZA 2E8YA 3AHZA 3UZYA 1VP5A 1X98A 1ADSA 2XH4A 4F40A 1KFWA 4K7YA 1UWQA 4UTFA 3MZ2A 4ENLA 1XL9A 4YHGA 3ITXA 2J7CA 4QDWA 3NYZA 4CEXC 3S42A 2W3ZA 5BYWA 1LCOA 1YE6A 3K4DA 2OT0A 2PC4A 1I0DA 4MNKA 3WMLA 5KTLA 5HWMA 2GOKA 3QZ6A 5KMYA 3EX4A 3USBA 3SCQA 1SO6A 1QBAA 4O1CA 1DJWA 2PWVA 1IT8A 3TW9A 3QYSA 5T9CE 2AL2A 3GHRA 2BY2A 3ONBA 5DELA 3DENA 4GZ7A 2WWCA 3WQVA 1IR1A 3MI2A 3HZ3A 4NHVA 4HGXA 2QKFA 3FSTA 1TWIA 1G7UA 1UH3A 4D6EA 4J7RA 4XV0A 4K39A 1RR2A 3TXZA 3CNYA 2V67A 1UP3A 5D9MA 2YCEA 5I23A 2CKRA 4DRSA 4XZNX 1XXXA 4FXRA 4JFSA 5FEWA 2PDXA 4QBXA 2WNQA 4LRSA 4ILSA 3VE7A 1PIIA 3VM5A 2PWEA 3ITYA 3E0LA 2W0UA 3WENA 1QO2A 4MFDA 5AVHA 1W3JA 4IGMA 2ZWZA 3RCYA 3W7LA 3KUMA 2VP8A 2PP1A 3QOMA 1SZEA 3CHFA 3WUBA 3S3GA 1YE4A 1EO7A 1TIMA 3C4UA 5CXPA 3W02A 3QZEA 3OBKA 4V1YA 1VFTA 2B7QA 1KTNA 9RUBA 1HT6A 2MNRA 4DLFA 4NIRA 2DQWA 3W1UA 1M68A 1QPKA 4Z2KA 3MUAA 5E0CA 1J0HA 3OZOA 1SSGA 2BY0A 1NJJA 2PF0A 2ZXAA 2HXUA 1KM5A 4HN4A 4A2SA 3QM3A 4WDWA 2X0HA 1D3HA 4AG0A 1WOAA 3WIJA 4IIHA 2WNZA 2EKCA 4P7QA 4MZYA 1Y0EA 3QW4B 4B9YA 3K4AA 3NDZA 4OV4A 4AZCB 1V3HA 1NFPA 2GQ8A 2IKIA 1VKFA 3ITOA 3ZR5A 4HA1A 2B0MA 3B40A 1UUQA 1YNPA 3CBWA 4G2DA 2J66A 5AC5A 3M0IA 4GUHA 3BWWA 1YW1A 3UZ5A 4Y9MA 2CPUA 3EKZA 1XLJA 3OLIA 2NUYA 2WMIB 2WSQA 2ZQ0A 2PP0A 3MMDA 4LUSB 4O8RA 3GXPA 2V68A 4AC7C 4GLEA 1ZNNA 4G6CA 2FJUB 2BWGA 2YXOA 3NSXA 1VHNA 3V75A 1LLWA 4D6DA 3KRBA 1IIHA 2NV9A 3R7MA 3N2OA 1MZRA 3IVSA 2XGZA 2OT1A 3P62A 4FF7A 4Y8EA 3WLSA 3JU2A 5FJPA 4HJWA 3GDRA 2CZ5A 2WZIA 4ATLA 2YB1A 3O3RA 1T6MA 3PFRA 3CWOX 3VGHA 3PZQA 3H55A 2AMGA 1UPPA 3VVGA 1C7TA 1D9EA 1GYNA 3CB3A 1HKKA 4XZBA 3CZGA 4JTFA 1DE5A 3VNMA 3W2NA 5G4EA 3W37A 2BP1A 3ZXWA 1LDCA 1KTCA 2XHYA 3C0SA 1F05A 3Q45A 1AH0A 3P8IA 2PTDA 1XYBA 3QJAA 4V2XA 3RJXA 5LHFA 4YPJA 2WJZA 5GNZA 3LV6A 4L5ZA 3L9CA 4PSRA 3P61A 3AMGA 1OK4A 4G9PA 1EIXA 3HJZA 4E2BA 4GGBA 1UJQA 4J3XA 1BRLB 1FWJC 3CEUA 3N14A 3V0UA 1M04A 3GDBA 2PB1A 1W9UA 3O07A 3GXNA 3QV9A 5DQPA 2PDYA 4J2MA 2FFIA 1VCGA 2F6XA 5LYRA 3ME3A 1A4LA 5CBJA 3U5UA 3HGRA 1W1PA 3U2OA 3WH6A 3UP8A 4O0ZA 2VX4A 3SCUA 4EXBA 5CZSA 4INFA 1ZFJA 1QASA 4HHHA 1KBBA 2PODA 2Z1KA 4HPGA 2CZEA 2BG5A 4QSHA 1R6WA 5A8GA 3KL0A 3S0CA 3CH0A 3RX2A 2ZA1A 4JKKA 4FR6A 5CBIA 1RHCA 4BI6A 1QPQA 1UC4A 5A6BD 1LG1A 5EYWA 5AYIA 2WZHA 3DG3A 3BMVA 1N2VA 2OSWA 1OGBA 1YPFA 2EPLX 5I2UA 1SM9A 2VWTA 2E5BA 2OO6A 3V1HA 1PL9A 4ZE4A 1VD6A 2QZRA 3IAPA 4IISA 3LCGA 4Q7IA 4C6JA 3F2CA 3VUPA 1ONRA 3T4WA 1XGEA 3GB6A 4R33A 2QMKA 1O5RA 3R4IA 2CNCA 3WJWA 1XIDA 2EXOA 3BLPX 4O53A 4DJDD 5CC5A 3K4WA 5I00A 4LVBA 3FCPA 1YXYA 2V5LA 2Z1WA 1H7NA 1O95A 4CD6A 2W62A 1F3EA 1BYAA 3VIFA 1F61A 3NQCA 1OFPA 4F48A 1NWRA 2W92A 1QHZA 4M29A 3THUA 1Q63A 2YA1A 3NG3A 1LUCB 1RPXA 1MW0A 2YFNA 1SJDA 4TO8A 4XTIA 1BWVA 1IEXA 1MYRA 3DYPA 2DT0A 5CZJA 3PK7A 4CD8A 1XCFA 1E4IA 5A6LA 3WQ8A 1FP8A 4Z17A 3FSUA 2CESA 4MB1A 3OG2A 1P4CA 1AQMA 2VTFA 4M80A 2FJKA 3EA3A 4AZGA 5E9AA 2HROA 3GNPA 2P3ZA 1PKYA 3TP4A 4QGCA 1QNSA 5CLWA 3AJ7A 2DJLA 1H5VA 3GD6A 1NDYA 1R9YA 3BAIA 2WVUA 1GTEA 3A4WA 3VI2A 2ISFA 1J2BA 4A3QA 2R8WA 2RDWA 4ZSUA 3T6CA 4Q8QA 3WY1A 1VHCA 2JIEA 3N6JA 4GY0A 2ZRUA 2GYIA 4XB3A 4NRRA 5JUVA 3WD4A 4HA4A 2OLSA 3QLLA 2F2KA 2Y7DA 4D6JA 1DJZA 1TV4A 1V3IA 1Q3NA 1ML1A 3CMJA 1VCVA 1W56A 1QXLA 4DBWA 1RK6A 2PDIA 1TVLA 6XIMA 3AROA 5XIMA 1B31A 2XVPA 1CLXA 4CVUA 3JZUA 4M1BA 3WH9A 3MYPA 2R24A 4BF7A 2WHMA 3W22A 4ZSTA 1KGUA 1JI1A 2X1UA 2XJ7A 4NJKA 4H7CA 4Q4OA 2DZSA 4CD7A 3DC0A 4HSNA 3SGUA 1J18A 1WDQA 1E9IA 1OFDA 2R9RA 3AS2A 5IBXC 2EG8A 3QGKC 4UOJA 5AFDA 3CUXA 3MA8A 4GBDA 5T91A 3SQMA 3IJLA 4QLJA 4L9ZA 5HNNA 2YIHA 1IR2A 2C91A 3PWAA 3VNJA 3SCSA 4PB5A 1HJVA 3DFHA 3LNMA 1EKOA 3CH9A 1SFTA 2NSOA 2XVNA 1QNOA 1PZ2A 3CYVA 4L4MA 4QTGA 3KP0A 3E2VA 4LBSA 4BK9A 4C90A 4Z1BA 3G3MA 2WVSA 4GJIA 2P76A 1H1YA 2CETA 2DY3A 1IIGA 4CNPA 3PC0A 2A7RA 1JULA 3BJFA 2V3DA 1HP5A 3L4XA 3TJXA 4ZQOA 5FSEC 1E1CB 1YTEA 4X9YA 4NSBA 3JZEA 4NZ1A 1FHUA 4LYRA 1Q66A 2CHOA 1TELA 1U30A 4GE8A 4RDZA 4ZB2A 3NM3A 5EFFA 1A5NC 4FZIA 4HCDA 2DT3A 3O7UA 1LRQA 4DWSA 3NQ8A 1XYCA 4JY9A 1JF6A 3VKDA 4Q8TA 1P0KA 5B7YA 2V3FA 3VNIA 3UJ2A 4JIRA 4MAVA 4AWEA 2QF8A 4C7DA 5A95A 1IWPA 4XUYA 4RE0A 2PLMA 1I1WA 3HFYA 3UZWA 1VLWA 2C0AA 3LUTA 3L5MA 3GHTA 4LS2A 2C79A 4KS0A 3ICJA 1X8CA 4O15A 4JYFA 4GYKA 4WD0A 2G3FA 3W7NA 4FX6M 4TX6A 3WMSA 3M6YA 1GTHA 4AD4A 4FXFA 1EO5A 1BWKA 1U83A 3C3UA 1S38A 3FKRA 3W2JA 4IXXA 2FPYA 2ASHA 1OGSA 3C2FA 3P81A 1XLIA 4XZWA 4Q4PA 2WCGA 3CQIA 3BZGA 1GOMA 1R87A 3EEZA 3VNLA 3C3NA 4LWWA 3ZSTA 1EQPA 4ML9A 3LPGA 1UHVA 3N3TA 3LNPA 4GACA 3T78A 4HOZA 3B0VC 4R53A 3RITA 2WQDA 1ICSA 1XG3A 4H1ZA 1SSDA 3H2EA 2XZ9A 2CLFA 5A8OA 1SFSA 4XIAA 3IGXA 4HMCA 1Q45A 4LX4A 2FH8A 1PIGA 5IOBA 3O9NA 3A3WA 2E28A 2H8ZA 4K68A 2FB3A 3VU2A 3MUZ1 2EGZA 4TIMA 1P0NA 4K36A 2A1YA 4BS0A 3EKLA 4AW7A 1M9HA 1FVPA 5FAGA 5L6UA 3MSGA 2ZUVA 1H0IA 3C2VA 3EWZA 4A4AA 2X7WA 5AYZA 3BAYA 2JGYA 3CQ0A 4HNLA 2X1SA 5E93A 3TZFA 2POTA 3BQ5A 4QSFA 1M03A 1XWYA 4W4QA 3T0TA 4J28A 1GEQA 1YTKA 3R0KA 3IUHA 3M43A 1JAKA 2YOCA 3CASA 3AALA 2BVTA 1NQ6A 2I1OA 4I7WA 5BMXA 3EMQA 1W5QA 3JR2A 1CGUA 4GFIA 2BX7A 4NILA 1DWAM 3VC5A 3NEHA 1OSEA 4LY4A 4OOUA 2OZTA 3LCHA 1AZ1A 2C14A 3N2TA 3LI0A 3KCOA 4KF1A 2ZDSA 1UQYA 4JY8A 2WKGA 3W74A 4IIDA 2GDQA 5I78A 2PRHA 2PDQA 1JF5A 1IGWA 1AODA 5BXPA 3QRHA 5DCEA 2P88A 3QHNA 3E0WA 2I7GA 4S3JA 4JICA 3EMCA 1OCBA 4RNHA 2J62A 2Z6JA 3EWDA 5I06A 4C5ZA 4PH6A 4IJCA 2PUZA 3HIJA 4JIEA 1AH3A 1TZZA 1ZBWA 1CCWB 1JQXA 4OIFA 3BICA 2J25A 4O13A 4NYUA 3A47A 1JUBA 1W3KA 3ZVHB 3BE7A 1GQJA 1PCKA 4GHRA 1GVQA 2F7FA 1R86A 2GVYA 3QR0A 2OCZA 4IMFA 4YVVA 5B7ZA 4QRNA 3PSVA 1DWIM 5AB3A 5CZKA 3FA5A 5AZ1A 4C6DA 1YIXA 2EKGA 2WVVB 4WSJA 3WH7A 1P0DA 1JCNA 3KZSA 1VIWA 4JTGA 1SW7A 1RBLA 1SMDA 4JEJA 4M6PA 2GGGA 4J3SA 4RPQA 1E73M 3I6EA 4FB7A 2YR1A 3QR3A 4H2CA 4B3KA 4LEQA 4LUIA 5EMLA 2E9LA 3RR4A 3GR8A 3W1PA 1PYFA 3WF3A 4CNSA 3BSGA 4O1DA 2FGZA 2NXIA 2FGBA 1WZLA 3G1HA 3PB0A 4IP7A 3CJPA 4H9TA 1GZGA 3W7JA 4RNFA 3A13A 4C6CA 3IANA 5AY7A 1XCXA 5HAOA 1OWQA 2RHGA 1N82A 1XYZA 3UJEA 2J13A 3T0CA 5I3DA 4P5UA 4CCCA 2WK2A 3EKGA 1OCQA 3PN8A 2W61A 3I3EA 1OM0A 9CGTA 4OU1A 4WUIA 1WXJA 4Z42C 4U4MA 3VC6A 4A8RA 1QPOA 1M7PA 5F2IA 1XLEA 2QDDA 4GX9A 4FI4A 3E2SA 1E6XM 2D2GA 4ICMA 2O9OA 2YX0A 3WQFA 5I0DA 3L23A 3C0LA 3Q65A 3W9ZA 2DJXA 4PBGA 3DGRA 5BWFA 4LUYA 1JD7A 1YNYA 4ATWA 4AYGA 3AIRA 2W66A 1HP4A 1RXOB 2B4GA 1YRRA 2QCMA 3SCRA 4MB5A 2X41A 1LRTA 1MNZA 4O14A 4NYYA 3MV11 4UBPC 1TVPA 2HBVA 4ZXOA 1J96A 3VKBA 1T96A 1DIDA 3O6DA 3FKKA 1EDQA 3R5EA 2QIWA 4UTMA 3MCOA 3SUWA 5JMUA 4ICNA 2EPOA 3GNOA 4QDMA 3RRAA 3DHDA 1LL6A 1LL4A 5BRBA 4ZA0A 1IZJA 1UD5A 4GY7A 3P0XA 3SSJA 3TDFA 1X39A 4PSPA 6ENLA 4LV4A 1FWGC 2D3LA 2E6AA 2VD9A 1KFKA 5HK4A 1LOSA 3SJNA 3TTQA 2E77A 1LL7A 2XIJA 3B8UA 4XAYA 4HNTA 5C70A 1LQ2A 5HWJA 1XDJA 1G5AA 4QITA 1IXNA 1I0BA 4M82A 3GXMA 3NEVA 2DZPA 3S2CA 2G3MA 2RAGA 2XFFA 2NLYA 1MEIA 5A69A 1BVWA 4OE7A 1S5VA 4REQB