3QVQA

The structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
251
structure length
251
Chain Sequence
GMQSAYSFLPQVIAHRGSSGQAPENTLASLHLAGQQGIKWVEIDVMLSGDGIPVIFHDDYLSRTTDGDGLIYKTPLAELKQLDAGSWKGQEYQQETIPTLLEAIEVISQYGMGLNLELKPCEGLEEETIAASVEVLKQHWPQDLPLLFSSFNYFALVSAKALWPEIARGYNVSAIPSAWQERLEHLDCAGLHIHQSFFDVQQVSDIKAAGYKVLAFTINDESLALKLYNQGLDAVFSDYPQKIQSAIDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphodiesterase Olei02445
publication title The structure of an Oleispira antarctica phosphodiesterase OLEI02445 in complex with the product sn-glycerol-3-phosphate
rcsb
source organism Oleispira antarctica
molecule tags Hydrolase
total genus 96
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.2: Glycerophosphocholine phosphodiesterase.
pdb deposition date 2011-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3qvqA00
1T8QA 1VD6A 5PTDA 5T9CE 2ZKMX 4I9MA 2FJUB 1ZCCA 2ISDA 1QASA 3NO3A 1DJZA 4Q6XA 4QJ3B 3MZ2A 4F2TA 3CH0A 4I90A 4QJ5B 3H4XA 3KS5A 1AODA 2OTDA 4R7OA 3KS6A 1GYMA 4F2UA 2PLCA 4QJ4B 1DJXA 4RW5A 3QR0A 1DJYA 3H4WA 3V16A 4RW3A 5T91A 3OHMB 1DJGA 4GNKB 1PTGA 4I9TA 4I8YA 1XX1A 1DJHA 1PTDA 4PTDA 7PTDA 3L12A 4I9JA 2O55A 6PTDA 3EA3A 1YDYA 1DJIA 3I10A 1DJWA 2PZ0A 3PTDA 2P76A 4F2BA 1O1ZA 3V18A 2PTDA 3EA1A 3RLGA 3RLHA 2OOGA 3QR1A 4OECA 5T9BG 1V8EA 3QVQA 1T6MA 1QATA 3EA2A 4RV3A 2OR2A 2F9RA 3V1HA 4S3GA
chains in the Genus database with same CATH superfamily
1E51A 4IUGA 3CTLA 7REQA 3QLDA 3HG2A 5H8UA 4OQVA 4NAFA 4DWSA 1FDYA 1P7TB 3DCPA 1CLXA 1I2OA 1BKHA 4JN6A 4XZ9A 4GGBA 1PX3A 3U4FA 4I7UA 4P61A 2IQ0A 5BWFA 2O7QA 1P0EA 3LTPA 1Z8AA 1SW0A 3NJ3A 4MWAD 4L4LA 1O94A 4KFNA 3SM0A 2QMJA 3PBWA 4MTVA 2WSPA 2QDHA 1Z32X 4P7RA 3CWNA 1SW7A 3UWEA 3EGJA 1RA5A 3WQOA 1UUMA 4QR6A 4LAKA 2MANA 1TMQA 4S3BA 1XLEA 1PAMA 5AHNA 2D2JA 3W1RA 2PCEA 1E6ZA 1DQUA 2PB1A 4N9DA 1EOMA 4V33A 1FBAA 2YCLB 2I9UA 1A5NC 4JTUA 3VIJA 2OZ8A 2P76A 3EDKA 2WNQA 3ZR5A 1I8JA 3NDYA 4K68A 1NOWA 5HPCA 1LOQA 2VYOA 3U2EA 2V82A 5FF2A 3EMZA 1W1PA 5CSUA 5LXXA 1B3OA 4QCEA 4Y8EA 2GOKA 3PBUA 2JFEX 2XTKA 3IGHX 5CPMA 2ZE3A 2PP1A 2Z7GA 1FWIC 4J3XA 1E6NA 5K4ZA 2IPJA 1DBTA 5AHMA 5C7VA 1QNPA 5CBIA 3NGJA 2D2HA 2VR2A 3GR7A 2WSQA 4GD0A 3EOOA 1LWIA 1K9DA 4W86A 5FAGA 5GJPA 2YA1A 3ARRA 4PMZA 3QFWA 3WDRA 4FXSA 2Y24A 3CHVA 3RRXA 4KGLA 3GX9A 1CGXA 1RQBA 4EWJA 1DTNA 4FHAA 4R53A 3BXWA 1XFCA 3WD1A 3MO7A 3QY7A 4LAUA 2VVNA 4WIWA 2NX1A 1XIBA 4F8XA 4IX2A 4RUBA 3QKEA 1XDLA 3EDEA 3H24A 4N42A 1G69A 2DZSA 4NX5A 4ACZB 1SZNA 3LHVA 1K3UA 3LS9A 3F7JA 4B9YA 3HGJA 2POZA 3T0AA 3BAWA 4WDUA 2V81A 4JQAA 3UD6A 3QLLA 3R94A 1ALDA 2X1RA 1YDOA 1NFGA 4S3KA 4H8NA 1SJBA 4MLRA 4NVTA 3BUVA 3GVQA 2JQXA 1EF2A 4IJBA 2VRKA 3ZFHA 2ZE0A 3PTKA 2PCQA 1A0DA 3IV8A 1V0NA 1P0KA 3B0YA 3INPA 3CUHA 4MM1A 2GGEA 2X0YA 3V36A 3CL6A 1YXYA 2DIKA 3EDFA 3WDIA 2TRSA 5GNYA 1QNQA 2HE8A 3BURA 3L9CA 3N3MA 4DLMA 1MW1A 3A4JA 2BASA 4Y6GA 1EC8A 4HTBA 1NF7A 3G8EA 4HT3A 3WBYA 3TYEA 4AX6A 3R8HA 2WLZA 4TTUA 3HQNA 5A6MA 5E1QA 2QDDA 4F2TA 4J1OA 3BAYA 4HPHA 4X61A 2VEPA 3QPEA 5CJNA 3M0VA 2PLCA 4C7GA 4NJGA 1DORA 3MVIA 1HN1A 3GH7A 4HCHA 1WOBA 3E9AA 1MWOA 1J0ZA 1LRQA 3B0UX 3H2CA 2NQ5A 3WF3A 4GGHA 1EPXA 1YTEA 2VKZG 1E43A 2VELA 2GGJA 1E9LA 3HO8A 3NQEA 5HMEA 2QCEA 4Q7NA 1JYXA 3CK5A 4LVAA 4C6EA 3VGDA 4LPCA 2OEMA 4UTTC 2Y8UA 3RXZA 3JRKA 3PZNA 3VMOA 4YVPA 2VP8A 4NQ1A 4DBEA 2JBMA 4PTXA 1GW1A 2C1HA 3NZ1A 3UG8A 4FLRA 3ZT6A 4B5NA 1ISVA 1TPVA 2WC4A 1NAL1 1JPDX 3OO2A 3OHIA 2YW4A 3W2MA 3QKZA 2PF0A 1XRSA 2JKPA 4L6OA 3MW7A 3W7DA 1LORA 3ARXA 5A8GA 3R0DA 1V6XA 3F2CA 4A3RA 1H11A 1KBBA 1RV8A 3DKLA 5JMUA 3GH5A 1Q6EA 4R34A 7TAAA 3Q94A 1ME8A 1WDDA 3GVVA 3ITLA 3AIQA 3MV11 3S2MA 3NSNA 5XINA 1JYVA 3HM7A 4IM4A 3PJTA 3APYA 1KFEA 2JK2A 4GZ7A 2NQLA 1KGUA 3S1UA 1LBMA 4NRSA 4UXDA 3TN6A 5IRPA 1X6UA 3I3EA 3P84A 2XUCA 1OWQA 4I9JA 1NARA 3W71A 1G4EA 3TAOA 4PB5A 4CCCA 1DIDA 4NRRA 2W3ZA 5HDRA 2PWEA 4LWWA 1A5MC 1IXNA 1WB0A 3S2CA 4ZO7A 5IFTA 3MDUA 1JULA 3GRIA 1EA0A 2BOGX 3IACA 1Q63A 1V3KA 4IICA 3CASA 3VDHA 1PSCA 2QV4A 5H8MA 4AYSA 4KS0A 1N8FA 2WAGA 3PWAA 2PTXA 3QV9A 4XSMA 4A21A 4WLCA 2J66A 4IPIA 4ERAA 3BPWA 1W3NA 3M7WA 3REQA 3CQJA 4XB3A 1TB3A 1S3TC 3S1WA 2INZA 5FD0A 4AD1A 2FYMA 4QG6A 3S5OA 1E1EA 1XLIA 4JTEA 3B0VC 3KVJA 1XH2A 3MY9A 4OBSA 1OC5A 2C7FA 2CBVA 2CNCA 3V3WA 5A95A 4LXFA 3P81A 2YA0A 2BVYA 1JF6A 2ONEA 5H1WA 4MJ2A 3I7SA 2BXZA 1FOBA 3DFNA 4DJDA 2GDQA 4ATLA 3ABSA 4PRTA 1YBQA 2OVLA 1ZCOA 4JOMA 1AL8A 1EP2A 1REQA 1H09A 3R79A 2J78A 4U10A 3LERA 3POHA 1IXOA 4RDYA 3RRAA 1GOIA 3AIVA 5BXRA 1NF0A 2QGHA 2OYMA 4MGGA 3WZ0E 3W7PA 4FEZA 4WQ6A 3W4RA 3NDZA 3WLJA 5CSRA 3AUOA 2XFRA 4LVGA 2ZWYA 2E67A 1B3WA 3ANVA 1JGMA 3NO5A 3CB3A 1FWJC 1B31A 1VFHA 2O9TA 1BF6A 2CZ5A 1ZJBA 4HNUA 3FHQA 3FVMA 4NNBA 4IFRA 3U48A 2WHLA 3THUA 2GUUA 2XVLA 2J6XA 1C7TA 4UBPC 4AVNA 4QLLA 1BFNA 4XTDA 5G1TA 3SAZA 5AC8A 1TVLA 4BF9A 3ABQA 5LNRA 1KFCA 1XM3A 4LBUA 4TO8A 3VGEA 1TJ0A 5I03A 3N13A 1EWEA 4LGXA 4JIIX 5D2XA 1T7LA 3VTRA 1SR0A 3STPA 3MBDA 4NXKA 4WKAA 2Y70A 4NZJA 3N25A 1SQ7A 3S5SA 1P6BA 5A6TC 4B90A 3ABOA 2WJDA 1PX4A 1OEPA 3EDJA 3I7QA 2HK0A 2G5WA 4Z1BA 4P7QA 3BANA 1CLKA 2YL8A 4UOZA 1OCBA 4X60A 4EF8A 3A6OA 1MEWA 2C3ZA 2OYKA 1M01A 1W54A 2PFHA 4JYEA 2O9PA 3OQEA 2VR4A 4BF5A 2KX9A 4EXQA 3BGJA 4HYWA 1ZL1A 3CXOA 5D30A 1EJXC 4HA4A 1QR7A 1BSIA 2PRHA 4UTJA 3KHJA 3SURA 2EJAA 4KERA 2I16A 5KINA 3CYVA 4AIUA 4ERGA 1VPYA 3BAJA 4QEHA 1PZ1A 3TTYA 4IL0A 1F6KA 3UR5A 3B8UA 3P5ZA 3RUBL 2GQAA 1F3XA 3SY5A 1GCYA 1JDEA 2H6RA 3DDMA 3ORWA 5CSSA 1XBXA 2C13A 4PN2A 2PWHA 3BJFA 3OZOA 3NOEA 2GSHA 2CBUA 1TTIA 4FK9A 2D0GA 1SZEA 2HWGA 3PP7A 2QAPA 3KFTA 2VGFA 3B04A 4G1NA 1GQLA 3HPSA 2CPUA 4OU1A 3WF0A 4W7VA 3KBNA 1KO0A 3NURA 1Y5WA 4E0CA 1IEXA 3H55A 5LIXX 2CKRA 3LB0A 4HA0A 1YEYA 3TC6A 1E72M 2DSUA 4LANA 3O15A 4PL2A 4ROQA 2XIOA 1VBGA 2R1MA 3AFBA 2VOTA 4NILA 5FSEC 2Z1XA 1VBJA 4DUWA 3MDWA 3LHUA 3BTNA 3OZMA 3APGA 4P8XA 4NXSA 4DJFA 2ZUTA 2X09A 1F73A 4AU0A 1QI4A 1FCVA 1TIWA 2G97A 1J8VA 2V63A 3TN5A 1SO5A 5FF0A 5C9XA 4HPXA 2GUYA 3PS7A 4NZCA 1P0NA 1U1UA 2YB1A 3KCOA 3ZSSA 3N34A 4CNNA 2DQWA 3UFYA 2OR2A 3JZEA 1DXIA 3WD0A 4XAFA 2RDWA 1IWAA 1LL7A 2QF7A 3ABXA 3FX4A 4LEFA 2EJ1A 4JKLA 3ZXWA 1Q6LA 4MADA 2YB4A 1FDJA 2WQPA 4BKNA 3DFOA 1G7UA 1QCWA 1TQXA 1S2TA 1ZQ5A 3CZ8A 2ZVRA 1US3A 2WWCA 2XSXA 1G4SA 4XBKA 1ZY9A 1MNZA 1KKRA 4JTRA 2W61A 1GOQA 3C3NA 9XIMA 1QPNA 4W88A 3NNTA 2FJKA 1RK6A 5JH1A 3W1LA 1YQ2A 1NH6A 3ZLGA 4L1XA 2F8QA 2XHYA 2Y88A 3GFXA 3O6AA 1SPQA 1JZ4A 1IR2A 4C1LA 1L2UA 2PBGA 3LN3A 1XLCA 1FQ0A 5M1TA 4ADUA 5TNVA 4ORIA 4I5UA 5JBEA 1EUAA 1V02A 1TPFA 4WOZA 3GYCA 1JZ3A 3B4UA 1HVXA 4YLWA 3M43A 3CT2A 2VZVA 3GTFA 4NJKA 4C7FA 1VLWA 3RCNA 1HL8A 3GDBA 3UY7A 1NWUA 1T6MA 2OGJA 4E8GA 1UBSA 3ZVIA 4JNZA 4Z2HA 2PE4A 2PTWA 4WY0B 4QE1A 2XIQA 1ZRQA 1L2QA 3LM7A 2D2GA 4S1FA 4QGCA 5TBOA 1E4NA 3V4BA 4DXVA 5CG7A 3GQYA 4H6QA 1G7VA 4K8EA 4F48A 3LX9A 2FQIA 5HQEA 2ON3A 1Q6GA 1O1HA 1CXKA 1WZMA 1UKSA 4NNCA 3FOKA 3VDBA 1T96A 3D47A 4MKSA 3UJRA 1GVOA 5CPQA 2FZMA 1K9TA 3N19B 4ASTA 4B4FA 1S5TA 4BJHA 2C15A 1LG2A 2NLYA 4L56A 3LD5A 5I3FA 2GJXB 1MO0A 4PTVA 2O0TA 5CEWA 3MI3A 3LCGA 2WSRA 1UD5A 4PR4A 5CJ5A 5F1VA 1E71M 2P8BA 3T8QA 4E3TA 4JYFA 2ZRXA 2CBJA 4O4VA 3M0XA 1SW3A 4IT1A 2QVNA 3F4NA 3NZPA 4RLIA 3ZVHB 4JEQA 1ONWA 4DJEC 1CNVA 1TX0A 3QYSA 1CB2A 4L64A 1TJRA 4WRHA 3NR0A 1GOOA 4BQ5A 4P8UA 1Y0EA 4PMXA 3WEMA 1ZHAA 4V1YA 2VVSA 4HOZA 1UG6A 2VFIA 1CB7B 2V5CA 1HJXA 3IJIA 3YPIA 5DRIA 3B05A 3C86A 1MUMA 1GG0A 3IARA 1Z3NA 1R3WA 2A3AA 3G1RA 4IMGA 1P1XA 1W5NA 2A3EA 4J28A 3V0UA 4F0LA 2E6AA 1TA3A 1VBRA 2GPTA 4HHMA 4PFHA 2Y7DA 2EHHA 3ZZ1A 2E5DA 4Z2KA 3ONCA 1EWDA 1WV2A 3S83A 3BLOA 1D3GA 5RUBA 4FNTA 1LQAA 1XLMA 3LBOA 1NJJA 2V5DA 3HG5A 1WKEA 3KRSA 1LOSA 4PMUA 4Z0JA 2ACUA 4CN4A 1R87A 4O1BA 2GWGA 3N4FA 4M6PA 1LLOA 1LL6A 3UXIA 2IKJA 3DI0A 4QRNA 2YJQA 4ZODA 3T40A 2CESA 1DWJM 4UB9A 1TPEA 4H8HA 1MFVA 1YPIA 6ALDA 1R3SA 4AC1X 1CI1A 3N3TA 1DXEA 1BYCA 4RDWA 3SIMA 2EPNA 3W1PA 5DY3A 4ADTA 4CNSA 4XAPA 3SQSA 4UFHA 5EY5A 3RFAA 5K9DA 1KC7A 4HOXA 2VWTA 4C1NA 1M7PA 4JX4A 2XGIA 4Z42C 3GD6A 4K1WA 1ZBCA 1RLCL 3VGHA 1VH7A 1UWUA 4H7CA 4LYKA 3PUEA 4MDPA 5E9XA 2XVPA 2WCAA 4IPNB 4TX8A 1MRQA 4ZVJA 1XLFA 2I1OA 4C6CA 2OWCA 4LVFA 3EEZA 1TPC1 1J5SA 5LNUA 3B8SA 3CEUA 3GVRA 4ZTYA 4M1BA 1H62A 4AZCB 3WL1A 4US5A 4XAGA 4O28A 1B90A 1C9WA 1Y5VA 2JE8A 4YYFA 2JF7A 4WXYA 2PODA 3H4XA 2E6YA 4S2CA 2JF6A 3P74A 5FKYA 3RMEA 3EB3A 3TYDA 2E6FA 4IMAA 5LNVA 3EPNA 2A21A 2R82A 4GIEA 3KRZA 4R85A 4RW5A 1WQ5A 1E0XA 4NT0A 1VRXA 3LOTA 2NSOA 3IEBA 1VKFA 1TJ2A 5C54A 1QAPA 1R9XA 4DAIA 4O19A 3A22A 4YWSA 1TV8A 1NQ6A 3TE9A 1AW2A 5DT7A 4NJHA 1OFOA 3HGSA 4JFUA 2C19A 5HNNA 1GQKA 3QYQA 3ARUA 3BCDA 2ISVA 3NPVA 1DJNA 2RFGA 1BYAA 3QZAA 1FFRA 2ALRA 3T2QA 2C14A 3DGRA 3RLGA 2FHFA 4BK9A 3TQPA 4RPPA 2V67A 1US2A 4W5ZA 3BVJA 1MZRA 1EKOA 5G4HC 3QZEA 4FXFA 4YTRA 1R46A 4MKNA 4HU3A 3WK3A 4O52A 2WKLA 5K9XA 2G3NA 2PMQA 4JIEA 4NP7A 5BU6A 1BG9A 3IIVA 4HZ6A 2J7DA 4UFIA 3RCYA 3R8GA 1SSDA 4Z0SA 4X9SA 2BVTA 1H7NA 2V2HA 1TTPA 4EE9A 2GQ8A 2XIIA 4HVXA 1XQLA 1F5ZA 3TXVA 1X96A 3M07A 1C7SA 2VEGA 4B2DA 5I3GA 2QR6A 1V6TA 3NSMA 1A5KC 4IFKB 3GR4A 1H1NA 1W1IE 3P8JA 1A50A 2VCBA 4O1CA 3R58A 1QOPA 3WKZA 1GOKA 2G3MA 1ME7A 3K30A 4AB4A 2NW0A 3BSGA 3DAQA 3CHDA 1W3JA 3PFRA 3MUAA 4JIHA 2XN1A 3OLDA 1FVPA 1NQKA 1XLAA 5KSWA 2UY5A 1QO2A 1VFSA 2WYSA 3P62A 4UR8A 1B3ZA 3B9OA 3ICJA 1K8YA 4GFSA 5CKSA 3TOPA 1KM1A 2Z00A 1TV5A 3VNJA 3CNYA 1IZJA 3KDOA 5CBBA 2Z28A 4RK8A 4KCWA 5AHEA 4LF1A 1D3HA 1UPPA 1L6SA 1NM9A 3STCA 5CPOA 4R5EA 4HJFA 1BSLA 4JY9A 1UWRA 1QNSA 3WQFA 3LMYA 4QITA 4BI7A 1A4MA 2YPIA 2FKPA 3AMDA 1NY1A 4ZBCA 2QLYA 4L5ZA 2EAWA 2AAMA 3IGUA 5I02A 3GHUA 1EJRC 1IEWA 1GKQA 7XIMA 2ISWA 3WLNA 3W7NA 2J4GA 4X0NA 2GOUA 1ONEA 2C18A 2Q02A 3RLUA 1KBJA 5BXPA 3T6CA 1DHKA 4TU1A 4Q4QA 4GLEA 4QJ4B 3URAA 3R89A 4AD2A 4QP0A 2WZHA 5A2BA 4XZWA 2HXTA 1FRBA 4NI8A 2EPLX 2GJLA 3BG3A 4A3QA 3SFKA 1R38A 4W85A 3UPBA 1ONRA 3SSJA 1MEHA 1PTGA 4PGLA 1XCFA 1PV8A 3QSTA 1OD8A 3OIXA 3GXMA 3S9ZA 4U28A 1TELA 1MSSA 2WMHA 3SUSA 4GI9A 1GJUA 3PTDA 4HHHA 2FFIA 4DVOA 2XH7A 1X38A 3K46A 1QPKA 1RBAA 1P0BA 4FXRA 3MT1A 1R2SA 3QPZA 2WCSA 1TPDA 2WJEA 3KHDA 2VX7A 2PLJA 1N8WA 3IGSA 4H6RA 3L66A 2ZOXA 3O6DA 1TR1A 5D09A 3PB2A 3BZGA 1B9BA 1ODZA 2IPFA 2Q09A 1E4MM 2BMBA 3QTGA 2VDGA 1A49A 2NV1A 1EEXA 2YDRA 3O06A 1RH9A 4UTMA 3KTSA 2FH8A 5HWJA 4GY1A 3WK0A 3NQ8A 1QNRA 2REQA 1YW1A 3AHXA 2Z26A 3M47A 1IE7C 5CPNA 3L5LA 3FFSA 2F84A 3V0TA 3W1MA 3CJPA 1DP0A 5HNRA 1RK5A 3DC0A 4M19A 2NUWA 1P48A 3IV3A 3HZ3A 5GQBA 4KETA 1JI2A 2F6UA 3G1FA 3CTTA 4MWAA 1EC7A 3C4UA 5IDZA 1KFBA 3EX2A 1ELSA 1C91A 4E3VA 3L2LA 3KDNA 7CGTA 1JGIA 1CEOA 1Q4WA 1XLLA 3MP3A 4I9TA 3LBCA 2VZOA 1QFEA 4DO7A 1FHDA 3ZT7A 5DELA 2PS2A 3W38A 5IHSA 3GG0A 1B9ZA 3TK7A 3GTXA 4PMDA 2BTMA 1F07A 2FFCA 4S3FA 2QGYA 4LUSB 3C0SA 3P0WA 3GC2A 1Q7ZA 2CWNA 2YA2A 3FNDA 2HBXA 3DHUA 3TW7A 5I24A 4IP7A 3G1AA 2Z2BA 1C8QA 1XGZA 1PJ9A 2OYLA 4XVDA 3SR7A 1KV5A 3N4AA 2XVGA 4WJXA 1UWQA 4MOZA 1UPMB 1EQCA 2Z0IA 3FA3A 2ZYFA 2XSAA 2A1YA 3V0SA 1XLKA 2HXUA 1JZ8A 3PB0A 3P61A 3ZO9A 4QE4A 1HKIA 2BLEA 2BHYA 2P1FA 2OX1A 1HF6A 1OGSA 4YWIA 3KW3A 4IG2B 1F76A 2WNWA 4TVUA 1BRLA 2WVVB 1GJWA 1FWDC 2V5BA 2XWDA 3H12A 4ZCWA 4QTGA 3TR9A 1MUWA 2NQJA 2A4AA 3H6OA 5A5WA 3LCXA 5FJPA 1HO1A 2X16A 3SEPA 5E0FA 5K9CA 4B16A 3T08A 3B06A 1TREA 3WF4A 5FOOA 4MY1A 3E0LA 1W9BM 3GIQA 4ZXLA 3R1ZA 3LHZA 3WJYA 1XCXA 3MA8A 1KFWA 3EA3A 3ME3A 3WNLA 2A3BA 3ES8A 3DC8A 2FVLA 3TEVA 5HK4A 3CO8A 1BTMA 2R1PA 1BVNP 1N7KA 3V18A 1R5YA 3WQGA 1UYQA 2VZTA 3BE7A 3WNKA 1A5LC 2XYLA 1IWPA 3T42A 2XWEA 4QAWA 3VYLA 3SGGA 2BGQA 4EPKA 3KL5A 1KBKA 1EJTC 3OGVA 4QG8A 4E2VA 1K8XA 1AQFA 3UJFA 1HKJA 3C2OA 3G6LA 4WVXA 2BDQA 5BYWA 2OKTA 2ZZ5A 2TODA 4AF0A 1H3GA 1V6YA 2QDEA 4QG9A 1OT2A 4AEOA 3LZ3A 4HYVA 2G37A 1GVIA 2ASHA 2R91A 3DERA 3LENA 1LT7A 4N2YA 3W53A 3TTEA 3MCMA 4NIRA 3VIIA 4IQJA 5BU9A 1KCZA 1TWSA 5A8QA 1XG4A 5G5IA 4XO7A 4GUIA 2V9DA 3HPXA 3RGTA 4TTGA 4YL2A 3QQ0A 4DM1A 4JBRA 1W1VA 3PY2A 3E0WA 3S5YA 1DJGA 4M24A 1WOAA 2V3DA 4GVFA 3W76A 3B8IA 1VYRA 2AQWA 3P0XA 4CVUA 3WMLA 3NM1A 4WX2A 3N29A 3EWZA 1LF1A 2EBNA 1NDYA 3IVSA 1D8WA 1F4AA 3L68A 2WVSA 1LUCA 3UY8A 3JU2A 1QRQA 3CAWA 1N55A 1X8CA 4I7WA 3O3RA 3DFHA 5AZ0A 5CBJA 2E28A 2X30A 1AD1A 1KKOA 4JICA 1ICQA 1J0HA 5C2XA 2ATMA 4KRTA 4OIFA 3NZRA 1X1OA 4IIGA 3FLUA 3SCVA 4D1IA 2NV2A 2YCJA 1P0DA 2O9RA 4BQ3A 3W7CA 3QJAA 2QUNA 3A24A 2GVYA 4Z2LA 1EIBA 2HEJA 5MKGB 1RA0A 3N04A 3VMNA 2Z2AA 4KWOA 2Z1KA 3DXIA 3BLIA 3ZYZA 4KPLA 3SRFA 4O1EA 2DUAA 4A2SA 1K7FA 1RCOB 4WK9A 4XD4A 3VD5A 3OEXA 3BLKA 4R9XA 1D3CA 1XUZA 3GG7A 4UQ9A 3K13A 1UR3M 3TONA 3BJSA 1FWRA 1KR1A 1W9XA 2DW6A 5G2IA 1OIFA 3ARQA 5ABFA 1KM4A 4JFSA 1RSCA 3OZPA 1TR9A 2ZZ3A 2Y8KA 4AZBA 2A0NA 4YHGA 4IJRA 3WEOA 5F2GA 3PTQA 1GVRA 1ZTVA 1W1TA 1C9DA 1OVDA 4GQGA 1JQXA 2YXOA 3KCJA 4NZ3A 2CLIA 3LG3A 3EMQA 3GXPA 3UJ2A 3CAKA 1MDLA 4B92A 3SN4A 3T09A 2YOCA 1E9YB 4O15A 3I6EA 3LEPA 1OB0A 2BFGA 6TAAA 3LA4A 1JCMP 4WDXA 5BRQA 1I1WA 4RNFA 4PB3A 2P0IA 5CZJA 4OBRA 3JS3A 1B57A 3PANA 1R86A 4LB3A 4AWUA 1X39A 4MNMA 3QMSA 3W1NA 4MSSA 1RJRA 3VZZA 2QZRA 4WF7A 4P2VA 4PMQA 4CNTA 1M6JA 2QW5A 4W7UA 3EWYA 4AZIA 1KRBC 5DT5A 3VNIA 1J0JA 2C71A 4Y9AA 1NWTA 1XXXA 4K2SA 1IZKA 4XKMA 3UG5A 3GY1A 3EAUA 4YTUA 1Z48A 4FPSA 4R7OA 2NT0A 3WNMA 3F03K 3S5NA 2RDXA 5F4XA 2YYTA 2ICSA 1IR1A 1P6WA 3LQGA 1QVBA 3C2EA 4RW3A 2EKCA 1H7RA 1H0IA 3AO0A 3L65A 3AMGA 4WDTA 2OJPA 2BVWA 2GJNA 1W31A 4EVZA 1RPKA 3AI0A 3W01A 2G3JA 5FJOA 1ODUA 1OINA 1QW7A 1OFAA 4NASA 4GQ0A 1VHCA 1JYNA 3GU9A 5K4XA 2Z24A 3VAVA 3AXMA 3KUMA 5AC6A 3C2VA 3I4EA 3W7RA 4TMBA 3U5UA 2GUBA 1HJQA 1JPMA 1JQVA 2E6DA 2BOFX 5A8OA 1CT5A 5A2AA 3B8TA 3TFXA 3FEQA 1HXJA 3G77A 3MKVA 3K4WA 5IBXA 4DHGA 2CLOA 3LCFA 3LGGA 4WHBA 4DB7A 4DUOA 6CGTA 2E1WA 1PKYA 3AHZA 4G2DA 5AN7A 1JXJA 1MQQA 2PGWA 5CQ1A 1F9CA 2IPGA 3D5HA 1IYXA 2DV0A 3UXDA 2FPYA 3LNPA 2YCKX 3DHPA 4IFOA 3S47A 3CQIA 4QNWA 3VD4A 2VR5A 4Z1YA 4FO4A 1JZ7A 4PTMA 3Q67A 1PEZA 1IHIA 2IXVA 3ZJKA 3UGVA 3TYBA 3QBUA 3ECQA 3EPOA 1QI2A 2E5BA 1XWYA 3H21A 2G3IA 4LUJA 3GUWA 2AQVA 1TQJA 4YTSA 2OLAA 1AL7A 5A2CA 3LXCA 2ZDSA 2B4GA 1HW6A 5IM51 1CYGA 3KL3A 2X7VA 1GUVA 1HKKA 2GDUA 3CMFA 2ZRWA 1JCNA 3AZSA 1SO3A 1KFKA 4B5VA 4MIMA 3TIMA 3N18A 1FA2A 1K77A 4UTFA 3CZLA 5HQLA 2ZWZA 4I3GA 3M5ZA 2ZX8A 4WJEA 2O4QA 1XBYA 4Q8OA 2YLAA 2DZTA 2HTMA 5I2UA 3A47A 3UCDA 4E5TA 4PUWA 3MI6A 3DG3A 1M7OA 2JKAA 3D0CA 3ZR4A 4J3WA 4UZSA 1VD6A 4NAEA 4M1RA 1SJCA 4GJIA 5D2YA 4J3VA 1VP5A 4GNJA 1ZCCA 3GFYA 4FOKA 5I07A 4PMYA 2LLEA 1IIHA 3AUJA 4AH7A 1D8CA 3GNXA 3XINA 2QYGA 4WUIA 2R14A 1X6LA 3T05A 4UNKA 3GAKA 4XKYB 1S1PA 5EMJA 1U1HA 4HSHA 4H9ZA 3W7JA 3NZQA 4ZXOA 2V5LA 3EWUA 3AYRA 1YNYA 1EJ7L 4JQ4A 3W1UA 5AC4A 5JVLA 3QF0A 5REQA 1FHVA 3AS1A 4E2OA 1EDQA 3H8AA 1IEQA 4GVIA 1M04A 3HFTA 4W84A 5C6MA 4MAVA 3BARA 5FAJA 2EGZA 3F2DA 4M81A 3EWBX 4DF0A 5JU6A 1DJQA 4N6FA 4HMDA 4UCFA 2ZBTA 2JGQA 1XFBA 4GC4A 1GPFA 2QJMA 3S46A 4GYKA 1K4GA 1KM3A 1DJWA 3UU0A 3GKFA 3G24A 1UR9A 4GX8A 3STGA 1XLBA 3GXTA 4W7WA 3GIPA 5HJYA 5HNTA 3W74A 4G7EB 5BXTA 4PL1A 2TYSA 3ATZA 1GVYA 1SSGA 1K9FA 4ZO6A 1G6CA 3UCQA 1TCDA 2WMIB 2POTA 3OTRA 2EG7A 4JTHA 1BEUA 2VQTA 2PA6A 5HUOA 2GZXA 3IUIA 4CLMA 1XIJA 4Y9OA 3C2RA 4U2YA 2VEKA 4D2JA 1A53A 4QHRA 2OB3A 1P7TA 2DT3A 2X2GA 1DWIM 3MSYA 2Y8VA 4CD4A 2WZTA 4JTDA 1Q7QA 2B7NA 1QBBA 1PKMA 2CXEA 4HU8A 3BGAA 2I5GA 3LRKA 3RITA 5E9AA 1EGZA 3VNLA 5HAOA 5G2WA 3TCEA 4IPPA 1OC6A 2W63A 1E0UA 3M0IA 3TMQA 4WOQA 2ACSA 2DVUA 2V68A 1E0WA 4D71A 2WMJA 3E3HA 2CITA 4CCDA 4KWVA 4AD3A 1FWWA 5C9WA 1EEPA 1JZ5A 1MXDA 4OWGA 2YCLA 4B3KA 3IIPA 3P80A 4O0ZA 3SY8A 1NOFA 3DHDA 5FF4A 9CGTA 4GK8A 1LDCA 4XD5A 4HK7A 1GZ1A 1O1ZA 1O7AA 5TIMA 2ZUWA 2P88A 4ML4A 3HA1A 2R1NA 1LWJA 2ISFA 3OLEA 3L0NA 4DYJA 1KCLA 4YYCA 1O60A 1DOSA 2H8ZA 3TOYA 2QKFA 2VWSA 4RV3A 3PBYA 3LCLA 1Z42A 2XISA 1IQ8A 3N9KA 2I5IA 1K6WA 3DENA 3GVGA 2NVDA 1Q7MA 2V30A 1NDVA 3QGKC 1XG3A 3OP2A 4QQUA 2WM0A 2DZUA 1YX1A 3RJYA 2QCDB 1RVGA 5TF0A 5I3DA 3MU7A 4ZSUA 2VHLA 4HN4A 3SCTA 3CMJA 3SFWA 3Q45A 4NZFA 3TZFA 3BLPX 4MB1A 4MB3A 5A8MA 4Q7IA 2CHOA 2HBVA 1JEZA 1LZOA 1OYCA 2Q01A 2J9XA 1T41A 3S6DA 3G1HA 4LRTA 4B5UA 1Q6CA 4TVDA 4A8RA 2VENA 3FJ4A 3V35A 4EF9A 3BL3A 3O16A 3W7QA 3SQMA 3MTWA 3LMZA 3KBJA 1ZS2A 3M6DA 3VXGA 1RUSA 4JTKA 4LCSA 4ACZA 1H63A 1ZGDA 1VBUA 1GW9A 4CD8A 4D72A 1HKVA 4XD3A 3AS3A 3S6OA 2GLKA 2ZA1A 1DJIA 3AWOA 1H1ZA 1OCQA 4F0KA 1WXZA 3URQA 3PHAA 2ZRUA 3KOWA 1RZMA 4HKPA 3J7HA 4A8LA 3CPGA 4HNVA 2FPTA 4DBWA 4HNTA 4P7LA 1AVAA 2YL5A 4DLFA 4XTIA 1C90A 5D8WA 1HJWA 3K8KA 4AZ7A 3RX2A 2OT1A 1TWZA 4Q4MA 2YXXA 1TV2A 4K39A 1XD1A 3WF2A 3G2GA 6REQB 4W89A 5IDIA 3WUBA 2WVUA 4GO9A 3ZJ6A 4ZEPA 4YNGA 3UP8A 3TC3A 3PJXA 4CKQA 3HG4A 1YXDA 3NM3A 5AC7A 3G1VA 3TYAA 2ZX9A 4MUPA 4GE8A 1GVSA 3N9RA 3U3HA 1UMYA 1UWSA 2ZXBA 2WJFA 3C0QA 4GI6A 1C29A 4HA1A 1PWLA 1C8VA 3RU8X 4Z17A 1PHQA 3PBGA 3D46A 4PMJA 3NQFA 1R0MA 1DQWA 1S2UA 1Q2RA 1LT8A 1GVEA 5F4WA 4CQAA 4LS2A 3OOQA 3KRUA 3PZIA 3WLHA 3HPZA 2ACQA 3M5XA 5BZAA 5E0CA 3OODA 4CEUC 4IIHA 1D7FA 1VFMA 4C7DA 4CN1A 1XIGA 4RNHA 4FX7A 3TZNA 3T8LA 3W83A 2J79A 4B5SA 2BODX 3N15A 1VCGA 2V2DA 1IEIA 2XINA 1QOQA 1OFEA 3DOPA 1UASA 1UA3A 4YHEA 5I3IA 3PWIA 4GXMA 4IIDA 3DFTA 5B7YA 3LK6A 3M0MA 3HQOA 2DW7A 1CXIA 3O8AA 4XISA 4H7VA 1DWHM 4EXAA 4QJ1A 3PM6A 3EXSA 3QW3A 3PPFA 4UWMA 4NHVA 1TYGA 3CAVA 1PUDA 3HQ1A 1FWNA 1BD0A 4GACA 4GVGA 3KWXA 4GYPC 3MWCA 5C9ZA 4C90A 4PTNA 4HNNA 3W29A 5JIWA 3BICA 4NKCA 3SGZA 4J2MA 3FA4A 2IQTA 1J5TA 3O0FA 1GYMA 5DXYA 1O68A 4LALA 3IIZA 4DIAA 3KOYA 2XIMA 1F3EA 5A8NA 3TNBA 5FEPA 3H2AA 4Z08A 1AJ0A 4DWSC 5C70A 3XIMA 3BK0A 1LROA 2ZQ0A 5EMKA 4PMRA 4ZMGA 4FF5A 3RO6A 1ECEA 3BV7A 5C2GA 3W6LA 1V6VA 3MMDA 5AYBA 4FX6M 3VIOA 3DBPA 3AOFA 1XGEA 2BSLA 3NG3A 3OZYA 4O1FA 5HULA 2E4TA 1HP4A 3GUGA 1LP6A 5F1UA 4PUDA 1KXVA 5AVNA 3U8GA 1ESWA 3W70A 1XPYA 3ARZA 4QBXA 4JD4A 1OYBA 1W5OA 1VEPA 3C8NA 3Q37A 4RV8A 3VDCA 2EPKX 3M6YA 3W2NA 3GZ3A 4XZLX 3MKKA 1WX0A 4ES4A 1JAKA 4PSPA 3FYPA 3MUCA 5TAOA 4YVVA 1T99A 1JCXA 2PD9A 3IUHA 1Q6OA 2P53A 5K7JA 1RJQA 1UP0A 4AG0A 1PPIA 3AMLA 3BG5A 1H50A 4NZ4A 1Z41A 1WAUA 2WANA 3N4EA 3Q2DA 4R88A 2YL9A 1WDSA 4AWTA 4UTKA 1CECA 1V79A 2PDMA 5AY7A 1TG7A 5I09A 3S2NA 2F38A 2QPUA 3VOFA 2A7PA 2UWFA 3QV8A 3AALA 2E68A 4UOJA 3B3DA 4TXEA 2VMFA 2QCHA 1B54A 3HV8A 4UQAA 4S3EA 4LUYA 1UCWA 1ZALA 4PZVA 2X42A 3ARPA 1VYPX 4HMEA 5E5CA 3G3MA 1XR2A 3VIMA 3G18A 5HR7A 1AJZA 2DSWA 2DDXA 3WDQA 2J88A 2HVOA 1KQZA 1XH0A 2XVKA 1OFRA 1W3KA 3CL7A 2VEMA 5FESA 2ZRZA 4GCXA 2AMGA 4KMQA 3GAYA 3NAVA 1UR1A 3VE7A 4XIAA 3N73A 3ALGA 2Z1VA 1L6YA 4FNPA 2VXNA 4YPJA 1XC6A 1SZFA 2BWGA 3N2MA 2UZ9A 1UJQA 2DIEA 1WNOA 2OT0A 3RPDA 4ZQMA 2CLKA 3ITOA 3MKCA 3IJDA 1NELA 2XM2A 5LGZA 4DO5A 1WKDA 2AQOA 3ZLFA 3PUDA 1G9HA 4H9YA 1EO5A 2OWWA 2CXGA 3R25A 3G0SA 2XZ9A 3W7KA 4MNKA 2PWVA 2QCFA 4QDMA 4EXBA 1UW9A 4MJZA 4CQ9A 1UZDA 4H8UA 2CW6A 2VOMA 4WSKA 2J8TA 1RY8A 1LLZA 1ZAJA 2H3DA 1LCOA 4LY4A 2PBOA 2VC9A 2W6RA 1EF3A 4UFKA 1SM9A 4A3HA 3UF9A 3KTXA 4JPGA 2VNCA 4KIEA 2V5JA 4GBUA 5LKYA 5BCAA 3LGEA 1W1ZA 1NP2A 4L4PA 3HIJA 3WMSA 1UUOA 2J47A 1EDGA 5KTLA 4K8HA 3LSCA 1NIUA 2WMFA 4DUXA 4KEVA 1RY0A 3BSMA 3ZWSA 3G1DA 3WD2A 3WYZA 1KM5A 2GWNA 2DY3A 4IX0A 3U6WA 4OUIA 1E9IA 3QY8A 1W0MA 1LYXA 2UV8G 3W28A 4D6DA 3RLHA 3VIHA 3DU0A 4WCJA 1WDWA 2KZHA 1I45A 1GHRA 1TZ7A 1VFFA 4NZ1A 2D3LA 1ZBKA 3GKAA 4C91A 3CLMA 4M0XA 2OODA 1R3QA 3F2BA 3XISA 3EXRA 3CUXA 1TMHA 2I5QA 3CB8A 2VUNA 1YIXA 4PUNA 3ZS4A 2Y5JA 4MKVA 3PF3A 1PZ0A 5AOUA 2YDSA 4A29A 4JY8A 1GVFA 1W6TA 3SCOA 3VGBA 1B4EA 4TUFA 2PP3A 2UY4A 2EPHA 1Z7AA 4AD0A 4JTCA 4DZHA 2J9ZA 1DE6A 1M3UA 4M7SA 2HJPA 3T55A 2TMDA 3MUY1 1O5RA 3E49A 1QDSA 3DX5A 1K02A 1TUXA 1B0IA 4UFJA 2VZUA 3OB8A 3FCPA 4FS9A 1DE5A 1MZHA 4LC8A 4DUVA 4YCOA 1LRTA 2E7FA 4IXHA 3W1TA 2Z29A 5BMWA 4A3UA 4AW7A 3N6HA 1YPXA 1YNQA 1E15A 5FL0A 2GJPA 3L0KA 3UG4A 3NQCA 2QIWA 3CH9A 5I23A 1V4YA 4FALA 1CTNA 3WUEA 3W7GA 3R8RA 4ZB2A 1DIOA 3GIYA 3RN6A 3HJEA 4HCDA 4LAOA 1EFZA 4GISA 2PAJA 1TV7A 3MMUA 2Z4GA 5A3HA 3W0KA 3A3XA 4OOZA 4N9EA 1GTHA 5J04A 3OPSA 4RL3A 3I3BA 1Q85A 3L4ZA 2E77A 2QUVA 4MZ1A 1TKKA 4E6MA 4GBDA 3M9YA 4XSLA 4H8VA 3VKAA 3KP0A 3IS4A 4RDVA 3LXAA 3JUGA 1BWKA 4LNYA 4J9JA 2EXOA 3MCOA 2NV9A 5AFDA 3NQ6A 3QZ6A 4IP5A 1EZ2A 2E25A 3QOMA 4RJEA 3PBMA 2ZC8A 1V7AA 4MDOA 3PN8A 4DJDC 1L6FA 2ZXQA 3HQPA 1NFBA 1ZPTA 3RG6A 1HQTA 4XAZA 1ZBWA 2P3EA 4IZGA 2ZUMA 1BYDA 1BXBA 4GUHA 2WSYA 4WY0A 1JZ6A 2AAAA 1M65A 3AIEA 3SECA 1S46A 2F2HA 4XV0A 2DH3A 3W7OA 2ISSA 3VNKA 4YCPA 1ENUA 1XDJA 1NVMA 2R8WA 3RHGA 4CU6A 2Q71A 5C7HA 4RR4A 1YTKA 1OGBA 3DH7A 4H41A 3T44A 3AQUA 1K6AA 5AHLA 3TYUA 1JCTA 1W9VA 3WCZA 1ISYA 1WKYA 3NQ2A 3AIBA 4LBRA 1V7YA 1B30A 1TPB1 3N2BA 3QY6A 2GJXA 2WCGA 1RR2A 3VGGA 3TLLA 5A94A 1Y5XA 4AY8A 4H6EA 5HQMA 1GJPA 4JCLA 2A6NA 5XIAA 2BX7A 1HX0A 2WOQA 4HPNA 3GC4A 3A4XA 1AG1O 4GNKB 3CWOX 3UZJA 2L5HA 3ITTA 3C5QA 2QULA 2A5HA 2DZWA 4AQLA 4I5XA 2O56A 5DFAA 2DZPA 4DI9A 1TJ1A 1UD8A 3T81A 3ZVHA 3ZMRA 1VIWA 2G41A 1XD0A 2DJLA 2PWFA 2HRWA 2ATSA 1EQPA 1AJ2A 5A6AA 3BMWA 1XIEA 3VOCA 2DSKA 1M9HA 3RYSA 1UD4A 1KWKA 3WNPA 2XFFA 1E1CB 3QGVA 3A3WA 1K7XA 3E2VA 2Y4SA 5CAHA 4QLKA 1W5MA 2PDJA 4IIEA 3WSUA 3O63A 3H2EA 1A3HA 3TU9A 3LU2A 1NP0A 3SRKA 4IQDA 3TC7A 3C2YA 1ZJIA 3I68A 4FB7A 1I0BA 3CQKA 1AZ2A 1FWSA 3LHWA 3CC1A 1TPUA 3AYTA 5D9MA 2D0FA 2FZBA 2ZTKA 1WBHA 3T78A 1NTHA 4J40A 2CC0A 3MHFA 2NT1A 2RUSA 4R27A 4D8ZA 3FK4A 4O0KA 4PTDA 1BVWA 1W9DM 1MVYA 1L8PA 4A8NA 3UR8A 4L7ZA 3PAOA 3GTHA 3T4CA 5DN1A 2QMKA 3IANA 1Z6KA 4IIFA 3ARVA 4YIWA 4GQQA 3HBLA 4JEJA 3ZLHA 2HNEA 3T0TA 3MHGA 4IQLA 1C92A 4LNCA 1JRCA 2I57A 4QROA 3WJWA 3UZYA 4JL1A 1B2YA 9XIAA 2G8ZA 4ICCX 4ATWA 5FEZA 2OSYA 4DWDA 1RP9A 4DJFC 4S3GA 1RJPA 5CG0A 2IPWA 1OF8A 4A35A 1E73M 1BWLA 2Q6ZA 3AC0A 1UMLA 4BI6A 1PXGA 2VX4A 3DIPA 1XKYA 4AZCA 1DIKA 3T0CA 2ZX6A 4ML9A 2BGSA 1FHLA 1DYSA 1UR2A 4NSBA 3MS8A 2OXNA 2SFPA 5HWNA 2HK1A 2OX4A 1VAHA 2QJIA 1DJXA 1T8XA 3FY1A 1E6XM 4N6EA 4GH1A 4AUBA 3BW4A 2BVDA 4CNPA 2W91A 3UYIA 2YYUA 2PURA 4FF7A 1RCQA 2PDFA 1QTWA 1YKWA 3GDMA 4F40A 1VJSA 8RUCA 2XGBA 4MNLA 3SN0A 2XJ7A 3FN9A 3BH4A 2WJZA 1BYBA 5JBFA 1JCYA 4BEQA 4Q4RA 4JXCA 3W6YA 2ADAA 1S1RA 3LTYA 3T7VA 3GNDA 3WD3A 5I3KA 1E55A 3M5VA 5EMYA 3KRBA 2D24A 5G2HA 2ZZ6A 3QHNA 5CXPA 1JUKA 2WMGA 4KF1A 3SCUA 3DN5A 3RM4A 4ZB0A 4HPJA 3THDA 3OVRA 2GDVA 3MPGA 3P3BA 3K1GA 3L2MA 2F9RA 1HO4A 2AL1A 3TW6A 1U83A 4XX6A 3BQ5A 4Y9NA 2RH9A 4REQB 1H7PA 4ZB5A 4K3ZA 3GDTA 3TFCA 1Y7VA 1FUYA 4Z1AA 1VC4A 3OGSA 3VA8A 3HGOA 4UQCA 3E2SA 2CETA 2VGIA 3AXHA 5D9OA 5JQ9A 4ZTXA 2VEIA 4IFKA 5AYZA 5CZ0A 3UZXA 3NIYA 1GVQA 5CGMA 1M68A 1K9EA 1S5NA 3AIRA 3LSBA 2QXWA 1EX5A 4ILSA 3VCNA 4GG9A 2FGLA 4PMVA 4UFMA 4YU1A 5FCZA 1W9PA 5HOSA 2CERA 3TJIA 4U3CA 4IH3A 2J7GA 2F6XA 1AMKA 4KT2A 3W7MA 2PI6A 4FX8A 1KW1A 2FH6A 2X7WA 4FAMA 2Z1BA 5DBTA 4RKAA 4LJ3A 1F8MA 6PTDA 2X41A 1EPVA 4G1KA 2EF9A 5I0DA 2VX6A 2WZMA 4JTQA 3D3FA 4R33A 4KESA 2QQ6A 4OVXA 4PBEA 2HQAA 2QJNA 3MV01 4GMEA 2RGMA 2X40A 2Z1WA 5CC7A 3EOLA 4UMCA 1W3HA 3M7SA 2VO5A 5DLCA 1X6NA 8XIAA 1XISA 4ZO9A 2NQZA 4DBDA 1OD0A 4WEVX 4LVBA 5XIMA 1G01A 3H26A 4UQDA 3EYPA 5IHRA 3L2IA 4I9MA 3TDFA 3NO3A 1G4PA 3RDKA 5I06A 3GNOA 4O0QA 1GNXA 2G95A 2VRQA 4J5NA 3L7RA 2WKGA 4NL1A 5DEZA 3CQ0A 1HZYA 2D20A 1XIFA 3AISA 3A3HA 3QR0A 2ZCGA 4WSJA 3QH2A 1XL9A 3PZVA 2F61A 2QPSA 1NDZA 3BDKA 4XWUA 3A12A 3MP4A 2NLIA 1NU5A 4M7TA 3THQA 2PLMA 3H2NA 4ALDA 5A6SA 2WZEA 2DU2A 2XN0A 2X0SA 4UOQA 4DZAA 1WAWA 4K7YA 1VHNA 1DL3A 3DYMA 2OWXA 5DCEA 3AMCA 4E4PA 3WL0A 2VT0A 4KCUA 3N11A 2PDXA 3UGRA 3B9DA 2A6LA 5AKQA 3AAMA 2FDSA 2VUYA 2HISA 3OA5A 3IIXA 4WZHA 2J27A 2PWGA 4C6NA 3MBFA 1OZMA 2PRLA 3AXIA 4MG4A 3LPOA 4GKTA 3OA3A 4W87A 4GUFA 4G6CA 1GKPA 3GHSA 4HSOA 1WDPA 1QU4A 1W37A 2DVXA 4IGMA 2AL2B 1ECQA 1PDZA 3C8FA 3CYJA 3LHTA 3UZ5A 4Q32A 6A3HA 1UOZA 3A23A 2VCAA 4J3TA 3WH8A 1MFUA 1EYWA 4DY1A 5CAKA 3HG3A 1B3VA 4PEEA 1Q6RA 1QI5A 2F7FA 1XYLA 2ZZ2A 4IPLA 4N4PA 1VPXA 3CO4A 4P5UA 3WLOA 2FVKA 4RCXA 1GEHA 2O92A 4QCFA 3SADA 3R2GA 3UXKA 4JCMA 1EBGA 5ABHA 3MMTA 3GH4A 1TIMA 1XBZA 4GZEA 2CHRA 5CPSA 4LUSA 3I10A 1KBIA 3DFSA 3WLKX 1TVNA 2J7EA 3BSHA 3MJYA 1PIFA 2Q8ZA 1RD5A 1Q8JA 3TA9A 1R3YA 5A8PA 3MC5A 4ZQOA 2AKZA 4JR5A 4RZBA 1QW9A 4XBJA 1SMAA 1SR9A 2E5CA 2VTFA 3CIVA 4JX6A 4IGNA 1L9WA 4JTLA 5L9FA 1H61A 1KFJA 3KL0A 4GCAA 4C5YA 4O50A 2PDYA 4H19A 5F2MA 5SWUA 3IPWA 4PFMA 4DX3A 3CV6A 3HMJG 4L65A 1VZWA 1EP1A 5HPOA 3QW4B 3VKDA 1RXOB 3RX4A 1MXSA 4IG2A 1PB0A 5DX7A 4AHPA 1I9CB 3UXLA 3R11A 2WVVA 4RPQA 1YMYA 2INEA 2YL6A 4JHOA 1UWTA 4GZJA 3WENA 1D2KA 4EAYA 5DRCA 2QCCA 3SCWA 1GQNA 3W1XA 1WKFA 1I75A 2P5NA 3PG8A 2QDGA 3NQDA 3H70A 1ZSXA 4BY3A 1O95A 4AXKA 3PZUA 1THFD 3KZSA 3W7LA 2WSKA 1VYSX 1QW8A 4LEQA 3VFCA 2VFHA 5T91A 4GOAA 1ZAIA 2GJRA 4AWSA 2XIBA 3P82A 2R1KA 4LS0A 3K8MA 1R3TA 5FI8A 1PIGA 4JYDA 4ACYA 2Y89A 3TWAA 3G22A 3S6TA 4GQRA 2WWDA 2XVNA 5JIPA 2ZUNA 4S3AA 5M3WA 5K3VA 3QSRA 1SJAA 4AD4A 3WD4A 3GLCA 5LHFA 2PTZA 3NA8A 1GPWA 1QMLA 2CYGA 2X1TA 1OK6A 2Y5SA 4KFPA 4H2HA 3LDVA 4LQ1A 1J0IA 1U5HA 2Y62A 2WPGA 3O2LA 2ZXAA 3MYPA 4WGHA 4HP5A 3FYYA 5FF3A 2W0UA 3APTA 5GNZA 2WPBA 4Q33A 1OX5A 3UWUA 4Q3MA 4TX9A 5LIUX 3VZYA 3BV4A 1TE1A 1OCJA 3R5EA 2PDGA 4GIYA 4INFA 2VGGA 5HWMA 1U22A 1UQZA 3NPUA 4JKKA 4MB4A 3B8WA 1EJUC 1XRTA 1JPKA 3GU2A 2ISDA 3FAXA 3WLMA 2VGBA 4P8VA 3PVFA 4JQ2A 3U7VA 2C1IA 4J3SA 1V51A 1EHAA 1ICPA 3VIGA 3W2LA 3C6CA 1WDRA 2EKGA 1TWWA 5C9UA 3P60A 3KBWA 1O66A 1F61A 3D6NA 4ZSTA 4N4QA 3TH6A 2UY3A 3VDGA 1EA9C 4BS0A 3V5OA 3U4AA 2I17A 4IHCA 1B1YA 4E8DA 1SJDA 4C6FA 4TR9A 4BI5A 1FXQA 8TIMA 2HVMA 1UIOA 3S1VA 1YDYA 1XYAA 1EJSC 1SUXA 3WQPA 4YTQA 3WQDA 4J7RA 2CFFA 1YADA 3N6QA 4XG1A 5TQLA 4MVAA 2PP0A 4JHMA 2TAAA 1ZFJA 2R1LA 1E0VA 2QCLA 1SMDA 3B9EA 3MHUA 4GIAA 4H3DA 3BAKA 3F5JA 1XIMA 4HNLA 2BHZA 1FX6A 1F8IA 2NWRA 4DPQA 1EYEA 5MKGA 4J3ZA 2OLSA 1RLDA 3DFQA 3RF9A 3UZWA 3BAXA 1UH2A 3OU8A 3PUOA 5G1YA 1AW5A 4GI8A 3CZJA 3N14A 2W66A 4EWND 4I90A 2Z25A 2O9OA 1BXNA 2WV8A 4M6UA 2AGTA 3BOLA 3O6YX 5FJJA 1UR4A 1FWGC 4WDWA 1H51A 4FZIA 2DT2A 2VJXA 4CVWA 3VDAA 4DJED 3H4WA 3EKZA 2G0WA 2ZXDA 3VKJA 2W27A 1UZHA 3BWWA 3CIWA 3V75A 2Y63A 5BOOA 4Y96A 1VB9A 3AZRA 2FVMA 2J8FA 2WNNA 3VD3A 8CGTA 1YYAA 2VD9A 3ARYA 4AYGA 1RP8A 2V6AA 1KV8A 3GWQA 1UKPA 2YGYA 4MWAC 2NX3A 4GVHA 4NZ5A 4HMNA 2OO6A 2QIIA 2W79A 4JNYA 2ZADA 2CIPA 5BXSA 2AGKA 2QUUA 3EA1A 4V2XA 4JDYA 2QS8A 4DYKA 2EG8A 4H4IA 3CWHA 3FJ6A 4GWEA 3ALFA 1MUCA 2HCVA 2Y7FA 4GXWA 2FTYA 1ZP3A 1JUEA 4M5PA 1JIBA 3QQ1A 4O17A 4Q6JA 4QIUA 1VBHA 1KBLA 1W1A1 3P5YA 1FP8A 2EG6A 3OLIA 5EBUA 3PPHA 2P3ZA 1S5MA 3VUSA 3MZ2A 5CZKA 4QJ5B 2GK1B 4FOUA 2V3GA 5I7GA 1S38A 1US0A 4P7OA 4RZ6A 3L4TA 2DGAA 1FTXA 2WZIA 5HR6A 4TQTA 3S42A 4A05A 1DJYA 3VU2A 3W7HA 5D2WA 1XLJA 2DT0A 3IAQA 3HTWA 4OGZA 4F9DA 4QM1A 3TKFA 5E93A 1EJWC 2FGBA 3I65A 2CZDA 5DANA 2ZX5A 3VUPA 1ADSA 3VC5A 4LYQA 3G1YA 3C3UA 3FSUA 2WBKA 2OEJA 4NY2A 1BVZA 2I7GA 3NUKA 4NX0A 2ZZ1A 1Q6FA 3V1PA 4Q8NA 5C55A 4C6MA 4TOQA 4X2RA 2FZDA 3NCOA 2BY2A 3WJZA 3QR3A 4OZOA 5C0QA 4J2PA 2OLHA 3BLEA 2OO0A 3GSMA 3NZGA 4RZ4A 3KLKA 1RPXA 3UPWA 3ZM8A 4F4RA 4U4MA 5PTDA 4HA3A 2DT1A 4H2CA 3UA4A 1WO2A 4MPQA 3KLLA 1FWHC 4LY8A 3VIPA 4H9VA 1CPUA 5H8PA 1XJBA 4IQEA 2Z6JA 2FMOA 3RR4A 3BOFA 4L61A 2BBFA 2Y61A 1UH4A 3KVKA 1XPGA 4FI4A 2TPSA 1A47A 3UWYA 1GYLA 3H7UA 3RPMA 4B4HA 4D6HA 3QM3A 1F4HA 1O5KA 2QF8A 3R0KA 1UC5A 1ICSA 1OT1A 3M64A 2B7QA 3OVQA 3N17A 2DZBA 4MYXA 2W5FA 2WC3A 4U2ZA 4O13A 1WDQA 8XIMA 4XK2A 3VZXA 1XBVA 1QXLA 2C79A 3SJNA 2CLMA 1KNWA 5DF0A 3W37A 1S2VA 3BLLA 1UJPA 1S2WA 3E0FA 4V27A 1YNPA 3N2XA 5AB3A 5DY2A 1A4LA 2VD8A 4BWLA 3KWSA 1S3HA 4D1JA 3TTQA 4EPDC 2PGRA 3H2FA 3WUFA 3W23A 4ZE5A 1XH1A 3PBVA 1JAEA 1ZUAX 2DSZA 5G1MA 2J6VA 3LZ5A 2ZRVA 2PZNA 4DF2A 2XH2A 3SJ3A 4F79A 1P43A 1DIEA 2J24A 4KQNA 3MCNA 1B3YA 2XH4A 1KXTA 1QBAA 3WBWA 3E12A 2VFEA 4N02A 1UUQA 3L4UA 3LTSA 4GH3A 2W92A 4G7FA 3WJSA 3ARWA 5D32A 4TIMA 5HUPA 4JKMA 3B8DA 1GORA 4XKYA 2NXIA 4QJ3B 2QEZA 1UB3A 4IMDA 4UTWA 4LOCA 3KS5A 2J7HA 1XS2A 2B81A 2OFJA 3GC5A 1FH9A 1LG1A 1VS1A 2C6QA 1WZAA 4OT7A 3QV7A 4D6EA 4L4OA 1PCWA 1BGAA 1W5QA 3L67A 1DTUA 1HL2A 3VX1A 1W8SA 3IGXA 3SCNA 1ZJHA 4AZHA 2WM1A 3HV9A 1VFTA 3URBA 4OUEA 2J25A 1OYAA 1FH7A 4GYJA 3NFUA 1A3XA 2X05A 1C93A 4G7EA 1DQXA 2WLYA 3TQVA 5ENLA 3B0XA 2YIHA 4DN1A 1Z69A 3WF1A 5AYYA 3MANA 2ZRYA 5MF5A 4QS5A 3WLLA 3H7RA 3VM7A 2EO7A 5D9NA 2WMIA 4C60A 3EA2A 5C9RA 1OK4A 1A5SA 3IK2A 5DMNA 1TO3A 3VGFA 1CXLA 2QHAA 1XQKA 1IXPA 4ZGYA 1KGXA 1W17A 3TYCA 2FIQA 1BQCA 2CHNA 4LAMA 3H23A 4PODA 1Q66A 1YLVA 4LT9A 2GVEA 4ONVA 3CQHA 1Q6DA 1WXYA 4GFIA 4E2BA 1SO4A 3KVMA 5LGXA 2QPXA 5AYIA 3ZJ8A 4DO4A 1LQ0A 2ZA2A 1HJVA 4FIQA 1OGGA 1GQJA 3E5BA 2ALDA 1TVPA 5H2ZA 4F3HA 3BO9A 4KWUA 1JD7A 1HJUA 3BLFA 2QVHA 5LHEA 4GRSA 1GWJA 2GSJA 5I77A 5FJIA 3GG1A 3FAWA 3F4VA 4LV9A 2WB5A 2XDFA 4IF2A 1NFPA 2H8XA 5EB8A 2PRMA 1HT6A 3W72A 1XSKA 3EZ4A 3MSDA 2YW3A 5B7ZA 4MAZA 3MQTA 1U33A 2R94A 2ZTJA 5JUVA 4AMCA 4PE8A 3KOXA 2W67A 1A3WA 5C2CA 2DORA 3N12A 2Q8XA 4WJ8A 3SGUA 4Z1CA 3VOHA 4GINA 4M6VA 4A8IA 3TV8A 1YE4A 3WH9A 4F0SA 1Z89A 5F2IA 4A2RA 1E3XA 4ZENA 5BWAA 1J0KA 2PDWA 5I78A 4JQ1A 1XSIA 1G5AA 3EWDA 3PK7A 3BOXA 4ZE4A 4HPGA 4ZOBA 2QCDA 3W24A 3EOSA 4PULA 4V28A 3QHOA 3LV5A 1OX4B 3M46A 3MUZ1 4BF7A 2Z6IA 1K8CA 3TSMA 4Q8VA 1LQ2A 2IXUA 5A6BD 4KW2A 4HZMA 1G1YA 1CXEA 1V3IA 4Q4SA 2VC5A 3QV6A 1OIMA 2BY0A 5IBXC 4JTJA 1WA3A 4R7WA 1X7FA 3E02A 2GFTA 4AHQA 2DPEA 5CC3A 2G96A 4HZ8A 2QJGA 4M6QA 4C6OA 3SQLA 3C0JA 5A6LA 3RK8A 3EEGA 1RBOB 1CW2A 3SBFA 2YZ5A 1WZKA 2BB0A 2PDBA 4OV9A 1N2VA 1JL8A 3A4AA 5LA0A 1PCKA 2RDTA 2VFDA 3OVPA 1LJYA 3GR8A 3TQKA 1I2NA 4NU7A 2HMCA 1E56A 1EIXA 3L5AA 5BMXA 4KKXA 3FEMA 1AQHA 3MO4A 3BZJA 1OADA 4UTUA 3VK5A 2A85A 2OKOA 3LHYA 1QOXA 1J10A 4HQVA 4HN8A 2YBUA 1R30A 3AHYA 3PZ9A 2NSXA 1E40A 1TSIA 2IKHA 3ZIZA 1V02E 4AISA 2NQHA 3IJ6A 3LYEA 1BG4A 1OSEA 3VABA 4PBGA 2BV9A 6REQA 1H1YA 5GJNA 1PKLA 4DM2A 5BOFA 2Z2UA 3BC9A 4PUJA 4UNLA 4XBSA 5C71A 3LPFA 4HHPA 2Z7KA 1JFHA 3NQAA 1QHZA 1RHCA 1B5TA 3NYZA 4NJJA 2E0PA 2YBTA 4D6IA 1MW3A 2HROA 1E1FA 2CLHA 3ZSTA 3RPTA 2BXVA 1KRAC 3AWNA 2X1IA 2PWDA 1EO7A 3I4KA 1VLIA 3AJ7A 3K4AA 2J62A 4HD5A 4S23A 1QK2A 2CEQA 3THCA 3TXZA 1W56A 4QSFA 2FMNA 3BLDA 1GT8A 3NOYA 4GUJA 4L9XA 4LW7A 2W9MA 3AS2A 4HIBA 3II1A 4V1XA 1E0TA 5JBDA 2YFNA 3TJ4A 4O54A 2Z1SA 1A5UA 3R6IA 4ZO8A 1K7EA 3HB9A 2ODOA 3ITYA 4ATDA 4JZ5A 5LNWA 1UROA 1CGWA 3OG3A 1R8LA 4KBXA 4QEEA 4E2DA 1V0MA 1MEIA 4OV4A 1DV7A 1LL4A 3BMXA 3NDOA 3U2ZA 2CZVA 1E6QM 3IVTA 5BOEA 2C8NA 3W3OA 3S9IA 5CZTA 4HMCA 2CLPA 3S0CA 2ZDRA 4YJ5A 3RR1A 4FNQA 4HU0A 1F2JA 4ENLA 3WLQA 1PVNA 2V8ZA 1PWMA 3I6RA 4PUUA 4F0MA 1KCKA 4X9YA 3GBDA 1POJA 3UJSA 1EJVC 3VC6A 1XIDA 4AMAA 1WE5A 3VKKA 5DMYA 1BAGA 4F0HA 2XZ7A 3U5YA 2AKMA 4C6BA 1VQTA 3PULA 4CN6A 2VDHA 2OGYA 2YR1A 2X1SA 4AEEA 3PSWA 3FGCB 4UTTA 1F3TA 4FLQA 1WUEA 2WHMA 1XKJA 3WFLA 4LUTA 2PD5A 3AS0A 1OHLA 4H9UA 4ZQCA 1RAKA 3H22A 5IFPA 1ADDA 3FJLA 2P50A 1E5NA 2V38A 2RKXA 2R6OA 4Q22A 3TX9A 3BCFA 2PZ0A 4M51A 3UNTA 4LCQA 1VENA 1W3TA 3W27A 4FOJA 4S3CA 3AICA 3WLRA 4RXFA 4JN7A 1EUNA 5M5DA 1W2VA 1TV3A 3GB6A 4O1DA 4DXKA 3LCWA 4DRSA 4UMBA 3FJNA 4LH8A 3CUZA 4DXXA 4AIEA 4M82A 1C8XA 3HFYA 3BMVA 1H7OA 3NVTA 4GHRA 4M8UA 3UG3A 3WQ8A 1Q13A 3T0BA 1CXFA 3TQ0A 1KTCA 4KEZA 7REQB 1QHPA 5HMDA 2HSAA 1K03A 1XLGA 3W81A 2IKGA 3W2UA 4NAFB 4DWSB 4XUGA 3DI1A 1LTDA 4QISA 4KH2A 3GHRA 3IJ8A 4WY0F 3BQ6A 2XPKA 2E9LA 1U1JA 4M80A 3LRMA 1E6SM 4CD5A 3T2PA 4OFCA 3DHFA 3WMBA 4Y7EA 5DCBA 5HMSA 4B9ZA 1Q6QA 2NUXA 5FF7A 2QUMA 3VO0A 5E6YA 2HE5A 4LV4A 1Q2SA 4WGXA 3DKJA 1SYTA 3VIFA 5A6KA 2IW0A 3UBPC 4UQBA 4A4AA 4QX4A 4QDPA 2ZICA 1QI0A 2YDQA 4D6JA 3CU2A 1XYMA 1H7XA 4LC6A 1G4TA 3VI2A 5A1AA 3PZOA 3PAJA 4Q4OA 3B0PA 2V3FA 3I3DA 1BPLB 3FXYA 4YVXA 2V5KA 3WH5A 5K2ZA 2ZUSA 5FIPA 3CUJA 4X3ZA 1KRMA 4FP1A 5LA1A 4FLOA 2OOGA 3GXFA 2D73A 1PO9A 2J74A 1IT8A 3AROA 3B03A 1WCGA 3K8LA 3A13A 2JEPA 2E3ZA 3FIGA 3UT0A 1EGVA 2G4FA 2RHGA 3S8HA 1B4KA 1OY0A 1WP6A 3IJ7A 1KQYA 3P14A 4RE2A 1K70A 3U0HA 2IQDA 3M0LA 1P4CA 1L0PA 5ABEA 2OQHA 1AA1B 1CBGA 4Q4KA 1R47A 1BLIA 1CZ1A 4GUGA 4ROPA 3S4TA 1W1B1 1QUMA 4E4UA 5D2TA 3EDDA 4W8BA 4CCEA 3E2QA 3E2RA 4MF4A 4TMCA 1XYFA 2QCNA 1KR0A 2PGEA 3LLFA 1QT1A 1J79A 2HVNA 5CCZA 1SU5A 4GABA 1IWBA 3UXAA 1SFLA 3M0HA 1CGVA 2CZFA 4X63A 2HV5A 1MNSA 1FCQA 3IJQA 4JHZA 5A69A 1KLZA 4O16A 2NUYA 3MUXA 4HOWA 4LB4A 1JUBA 3CHCA 2DH2A 1BGGA 4AFYA 3SIZA 4IL2A 2YFOA 5GPRA 1AMYA 1F7BA 3O7UA 1UA7A 5E09A 4Z1DA 1GGOA 3Q65A 1SFSA 3HU7A 2BGNE 5M03A 1CCWB 1S5WA 4Q8WA 4FMVA 5FA5A 1XDMA 3F5KA 4FIRA 3HGRA 4OE7A 4L80A 3AMKA 1E4LA 3SRHA 3KEHA 1JZ2A 1IT0A 3COTA 4PRRA 1GK8A 3CL8A 4JTIA 1FY6A 1L6WA 3FV9A 5HJXA 2CWXA 2IKIA 4X2PA 4D8AA 1GQIA 1XCWA 4UCGA 3WQ4A 3W9ZA 5EKYA 4HU4A 3IJLA 3ZJ7A 3M44A 3MUIA 4NI3A 2WC7A 3I6TA 4YN5A 3BW3A 3C61A 4V15A 3GBEA 4CUCA 2PUZA 3WQVA 2OPJA 1QASA 4Y8FA 4J27A 3VE9A 3ID7A 3KBVA 3W2KA 1ZJAA 1XGDA 4O18A 3B4YA 1M53A 4ICMA 4OOUA 4Q4PA 2JIWA 4EPBC 3KS6A 4EX4A 1V3HA 3TLQA 1U5VA 4RNIA 2BY1A 5ABTA 2WO5A 1XLDA 1VGAA 1I60A 1FWEC 4UR9A 3KP1A 4XIMA 1KGWA 3UESA 3W22A 4ZOCA 2WXDM 3C56A 1UZ4A 5HMFA 1KA9F 2PTYA 2FLIA 2PDLA 2FZ9A 5B80A 5HINA 4GJ1A 4US6A 3NL3A 5AYXA 4HYRA 2IUZA 1A0EA 1KD0A 2YBVA 4S2BA 5ECVA 2D2OA 3EKLA 2OELA 1SZRA 2OZ0A 2PDIA 5CGQA 1SO6A 4LRSA 3UNDA 1QWKA 2W62A 4O8RA 2PSNA 5AVHA 4ZQPA 5I00A 2X2YA 1ADOA 4K7VA 3TSBA 3W02A 4O10A 4H04A 7TIMA 3HF3A 4U33A 2FGZA 1QATA 5I6SA 2HS8A 1R3VA 3NXFA 1GHSA 3RX3A 2VZSA 3P7YA 1J18A 3VM5A 3SN1A 3AZTA 3AHTA 4KWSA 2D69A 2XM1A 4B3ZA 3W00A 4WXZA 3GE7A 4H9TA 3STEA 3VVGA 1F05A 3TAKA 4M29A 4U5IA 3GM8A 4X22A 3FSTA 1AODA 1Q5MA 3FW6A 5HANA 2J13A 3THAA 4C6LA 1E70M 1H49A 3LLDA 1D9EA 4WKFA 3PZQA 4TV6A 4H7ZA 3TVAA 3HPAA 4MFEA 3OW1A 2NX9A 2I14A 2J9YA 4GYFA 3EKGA 1E9ZB 1I0DA 1XUUA 5FJRA 4MJMA 3RLVA 2B7PA 3VINA 4A6GA 1KTBA 1QNOA 4XUYA 1EZWA 3FKKA 3SCQA 3QGAC 1JFXA 2BHUA 2FTWA 5CZSA 4MWAE 3G8RA 3WQEA 5D05A 1PYFA 3FYOA 3PZMA 3OJGA 1P5BA 3VCRA 5BW6A 1XINA 1V3JA 3LPPA 2RJGA 1AUSL 1JI1A 4XZBA 5G4WA 1H0GA 4JX5A 5J8LA 1GYNA 7ENLA 2NQ9A 1EBHA 4ZL1A 5CC6A 1PIIA 5LZLA 3ZT5A 3DYOA 4AEFA 1H2JA 3PNUA 3LCHA 3WDJA 3UJEA 2XN2A 2XH0A 2QCGA 2VFGA 3E5PA 3GVWA 4S3JA 1JDCA 2YSWA 4GJJA 1XIIA 4HB7A 4I6VA 1JF5A 1R7AA 1A5OC 5AHIA 2HNHA 3ABRA 4K38A 5BRPA 3A5FA 4KFOA 1OX6A 4IISA 1DJZA 4PC8A 1CGTA 3REQB 4JNMA 3MP5A 5L6UA 3FS2A 5CH9A 4D6FA 1LM1A 1PYMA 3PUGA 2ANUA 3F4DA 4Z2GA 5AC5A 3KZPA 1QWGA 2VC6A 3KX6A 2A3LA 3RMJA 3WQ6A 3OGRA 3L21A 4CU7A 3LXBA 2X8RA 1V3LA 1C3FA 1ZZMA 2DSVA 3DEQA 1JVNA 1Q65A 4W5UA 1U2YA 4GA8A 2DUZA 5DO8A 3W25A 1QJWA 2G4JA 3P93A 1Q3NA 1I2PA 3JVAA 4BFAA 1GG1A 4P7NA 4XZMX 1SGJA 4B5TA 3EX1A 1YBQB 4XZNX 1QPQA 1YTDA 3TCSA 1REQB 3QXBA 1KXHA 1XICA 1AZ1A 3DFYA 2D1ZA 2NXGA 2Y5EA 1J6PA 2YXGA 3CLWA 1V5XA 4MPKA 1IXQA 4O4WA 1LRNA 3A9IA 4IOTA 2YKKA 4AY1A 4Y90A 1BKSA 1E1CA 1ZLPA 2C0AA 1NWSA 3IK4A 2CCRA 1VEOA 4KWWA 1V77A 5ECUA 1NDWA 2C91A 4CGTA 1NOUA 4C6DA 1AQMA 5EBAA 3SSZA 2Y1HA 3M0YA 4E8CA 4JAWA 5C5YA 1X7IA 4MY9A 5HATA 5EU9A 2C16A 1CX9A 3E96A 3ELFA 3VD7A 1MI3A 1YPFA 4DZIA 4QAIA 2GL5A 1JR1A 5KZ6A 1HNYA 1Y65A 3QQWA 4YMZA 1L6GA 2ZUUA 3V16A 3OIHA 4DJEA 4F9JA 1G0CA 4NUWA 3NXLA 3UWQA 4OJYA 4OBTA 4LFYA 3TNOA 3T4WA 2YCIX 1PTDA 1V6WA 3UW6A 3UZZA 1H60A 4UTHA 4PYSA 1HKWA 4KCTA 1MMFA 3CPUA 3CUIA 3VNYA 6TIMA 3RJXA 4ECLA 4PUKA 1XHGA 1CDGA 2V69A 4RE4A 2A2IA 1EH9A 3DFPA 3G0UA 3M1ZA 3SCPA 4BA0A 4EACA 1P1MA 3UERA 4RX0A 4JIPA 3ANYA 1BQGA 4LYPA 3W73A 3NWRA 3PC0A 3WEZA 3HPFA 4ZFMA 1E4IA 1YDVA 2VDIA 1O12A 2ZKMX 4GPNA 4NNAA 4JL2A 3PFMA 3LRLA 7ODCA 3GZAA 3WQWA 3WY1A 3T0DA 1JDFA 4L1GA 2WVTA 1HP5A 1ZP4A 2FB3A 3WIJA 4XZHA 4LUTB 3QC3A 1H5YA 3H7VA 4WSHA 2J7BA 4IXXA 2E8YA 1TV4A 4JQ3A 4N0RA 3RCMA 1FXPA 4MFDA 2FPVA 3G1XA 3CV2A 4GX9A 2DUXA 3SY1A 2UBPC 1EXPA 4ZOEA 1S2AA 1K1DA 1W3LA 2RJHA 1M03A 1J4EA 3GNRA 4Y9MA 3DZ1A 3NQVA 2PDQA 2VI0A 3R10A 2A3CA 1E5JA 3W2JA 4H6KA 2B0MA 3AHVA 3LNMA 1JCLA 4DNMA 5JXQA 3EB2A 3GXIA 4HK5A 1KLYA 4UIOA 3AU2A 4RNJA 1GONA 4REQA 3TA6A 4QE5A 2ABBA 4CCZA 3W84A 4F0RA 2P10A 3GDKA 2WK2A 5D8ZA 3LQLA 4HNCA 4DWSD 4H9MA 5D04C 3GU1A 4CD6A 3B9AA 2G3FA 3FDKA 3ZWTA 3EX4A 3WFAA 1CLVA 4G8TA 1KCXA 1X8FA 3VKBA 1UIPA 3RO8A 1FWCC 1MRAA 3MZNA 3PZTA 3LV6A 1FFQA 4TVCA 3DECA 1JPHA 1PBGA 5CSYA 4TV5A 2XFYA 4W8LA 1W2PA 5U4NA 3E74A 3WLIA 4UC5A 5HA7A 2JKEA 2Z27A 4EKJA 5GJMA 4B5WA 3K2GA 1UR8A 1WUFA 1OG6A 3VOGA 1IGSA 3G3DA 3CBWA 1QI3A 4QNEA 3L12A 3R13A 3TMLA 3NQGA 1YE6A 4PB4A 2ZIDA 3O6CA 3WBAA 3ABZA 1AH3A 1EL3A 3EMCA 1M7JA 1A5CA 1OFBA 3ZR6A 1OCNA 4PH6A 2YX0A 2PTDA 5LSMA 4POCA 1J96A 1ZB5A 4OECA 4C65A 1J0YA 1VEMA 1TWIA 1BHGA 1KB3A 3MVTA 3SW6A 1A5AA 3L4XA 3TN4A 3QMTA 2DEPA 6XIMA 1V0KA 4PBFA 3KE0A 3GW3A 4L9YA 4GO8A 5MHBA 1HIZA 2H3BA 1LWHA 1IV8A 2A7RA 3N2TA 1HGWA 4QSHA 2D3NA 3VD9A 5GNXA 1WBJA 1XRVA 2WHKA 3HURA 2IS7A 3E0IA 5FJTA 1ITQA 3WK1A 4IPJA 2YCEA 4KRZA 4D9PA 3CZGA 5JH2A 1PHWA 3PPCA 1F6PA 1UP2A 3VPLA 2TSYA 3WLSA 2MNRA 3W1AA 4FA3A 4ZA0A 5BNKA 2NZLA 3WFZA 1NWRA 4Y2WA 4LUIA 5LIWX 3GNNA 1I6NA 3R43A 1JDAA 1DJHA 4PCSA 4KIRA 1E3ZA 1U5JA 4AX7A 3WLPA 4R9OA 7PTDA 2BOEX 4LX4A 4CNOA 3W87A 2NVCA 2WNZA 3P2VA 1UOKA 3QOKA 1AK5A 1EX1A 2JGYA 4EP8C 5KMYA 2WBGA 1CWYA 1MW2A 2E40A 4PRWA 3F4WA 3SO7A 2GGHA 3CGTA 5F4SA 3CIXA 3U2OA 1UKTA 2P0OA 4PUMA 5T9BG 4E4FA 3WMCA 3GK0A 5BROA 1R7OA 5M2FX 2PU0A 3WNNA 3UA3A 3CV7A 4C6KA 1T0OA 2QV5A 3M16A 4I9AA 4C6QA 3R4IA 1EP3A 1ZAHA 2DFAA 1WYIA 3PNZA 4O57A 2AL2A 1HG3A 5T9CE 3Q4DA 2DVTA 4MZ8A 4UR7A 1W9UA 1VJIA 3MSGA 3PWGA 3NL2A 1TA3B 2VFFA 1J93A 4L4MA 2OSWA 4O1AA 3PPGA 4URIA 4KGJA 2XFWA 2ZZ4A 1PTAA 1IF2A 3DESA 1UD6A 4F2UA 3LI1A 2VEFA 4JTAA 1KWGA 3W26A 2CLLA 3JR2A 3CEPA 3UQNA 5CLWA 1IZCA 5I79A 3BAIA 4N9BA 3NPWA 4DAFA 3UEQA 1XX1A 3UCCA 1XF0A 4PMNA 3R7MA 4CU8A 4BEUA 2BNJA 2GSEA 3ITGA 4L9ZA 2VURA 3FXGA 3WQCA 2WKJA 4UZUA 3CHEA 3EXTA 2QJJA 2YZRA 1TUFA 3SDOA 4F2BA 2E9MA 3NEVA 3H2MA 2FZNA 2J7CA 4C1NB 5CPLA 4O8AA 4AZ5A 4D8LA 4O12A 4AIBA 5FSDC 4RDZA 3K1DA 4DF1A 3OG2A 3VX0A 1GZGA 4CEXC 4LU0A 3SUWA 4MLJA 3A21A 3VOIA 4DPPA 4ZZ9A 5CGTA 1AH0A 3EWWA 5DCDA 3HOJA 4Q8TA 4I6KA 3WQ5A 4DZ5A 1RVKA 1TE6A 4Q6XA 1V93A 2CLFA 1DHPA 1W3IA 2XGZA 1ZU8A 1DWAM 4HZ7A 5A6BA 1EHNA 1P6CA 4FSAA 3USBA 1BWVA 1R85A 4CD7A 2I56A 2XIJA 4MHBA 4ZFCA 4N7QA 4AHOA 4G9PA 4I8DA 2ESCA 1V0LA 1FCBA 4O14A 1OG0A 4GNVA 4KEUA 4N9CA 1M41A 4K36A 3WLTA 1JNDA 1FWFC 1CIUA 2WMKA 4CQCA 4KRUA 2D0HA 5I5RA 1ITCA 3B8VA 4L1WA 3A5VA 1AFSA 3MB9A 3NGFA 1Y8BA 2PWUA 4ERIA 3DUGA 2OEKA 1VFLA 4H1ZA 4B91A 3CT7A 3O05A 3UR7A 3N2CA 3GS6A 3QTPA 1N8IA 3W07A 5D4YA 3ATYA 5DMLA 1UD2A 3C2FA 3L5MA 2PDUA 4UFLA 4LTSA 3PJUA 1N82A 3IWPA 2ZC1A 5A6JA 5U7SA 4XO6A 2XG9A 4RXGA 4MYAA 4JS3A 2BS9A 1J6OA 4DQWA 3S3GA 4Q8QA 1KM2A 2A3HA 3H2OA 3RM8A 4QQ3A 1QHOA 1CGYA 1TMLA 2GVLA 3P67A 4H83A 1YXCA 3ANUA 2PGFA 3ERPA 1M7XA 1XP3A 3MSRA 3OBKA 2CLEA 1FWTA 4BR1A 4XD6A 3CH0A 1VRDA 2PDCA 4LAZA 2RAGA 3VFLA 5DQPA 2VC7A 1EB3A 3TUUA 1SVDA 3M41A 1KTNA 4LVDA 1VPQA 1JRBA 3SCRA 2VQUA 1RALA 4LYRA 4HSNA 1GZJA 3LPGA 4QLJA 3F1QA 1I2RA 4BZYA 1XYCA 2OOFA 4S3DA 2E9BA 3IIOA 3OHMB 2VM8A 2CKSA 4E38A 4PCFA 4DJDD 3UWWA 3F5LA 3GG8A 3KVLA 4IGSA 4LS1A 2NVAA 3G0XA 5EMMA 1JPIA 4QS6A 1ZBVA 3M4HA 4QDWA 3EBVA 1E6PA 1DWGM 2VRJA 3CZKA 2IMRA 2XU2A 4PTWA 4AAJA 3POCA 3L23A 2PDHA 2PF8A 3GNPA 4MB5A 4J4KA 4L6DA 1W91A 3IVUA 9RUBA 2V3EA 4U5KA 1J12A 1M5WA 3NSXA 3W6MA 4AZGA 4FNSA 3GXNA 5FEXA 4XAYA 2W4XA 3UVIA 1TZZA 2OCZA 1GOMA 3B9NA 3TTSA 2ACRA 4JGDA 5F7UA 4B15A 1G67A 1T8QA 2C0HA 2DZXA 2WW5A 4IJCA 3GO2A 3EPMA 3UVAA 4XVEA 2OQLA 2QT3A 3T1GA 3S2JA 3U57A 4D6GA 4HCLA 4WR3A 4RE0A 3WH7A 3PG9A 2A7NA 3PJWA 5KITA 3NL5A 2OQYA 1SZGA 4IMEA 5D02A 4J3UA 1V3MA 4W4QA 4HGXA 3S1GA 3ARSA 3URNA 4UQEA 2DZVA 3ONBA 3P6LA 3OYXA 2P8CA 1GOWA 4B5XA 1XLHA 1F3WA 3WBEA 1RBLA 1CXHA 4TX6A 2GQ3A 5C8BB 3TJXA 5LA2A 1E6RA 3FDGA 2H9AA 3JW7A 3KTCA 3TSDA 5KEZA 1BTCA 2FB2A 2O55A 2RGLA 1UC4A 1LLWA 3VOJA 3PTMA 1UD3A 1V08A 1XV8A 2X0HA 3LCIA 1PZ3A 1JXKA 4PCPA 5HNUA 4C6JA 2XSBA 3S9YA 1GTEA 3AXKA 3LM3A 1A80A 3L4WA 4B3LA 1J9YA 4HHLA 1HJSA 1GEQA 1JCJA 4JFVA 1H4PA 3S2LA 1W32A 2OZTA 3OBAA 3M0JA 3H4GA 4DEFA 1S39A 2Y6ZA 4LCRA 3IRSA 5EA9A 4NYUA 1J2BA 5D03A 3LI0A 3O07A 4DYEA 2NWSA 4MMWA 2PEVA 5E0KA 3OBEA 5AZ1A 1TRDA 4HJWA 2I9EA 3GYEA 1F6YA 2REQB 4MY8A 4HK6A 2B7OA 2GGIA 4YTTA 4H01A 6ENLA 2GK1A 4S38A 3N6JA 5D2VA 5D33A 1DXFA 3QHMA 1XYZA 3USZA 4CNUA 2OTDA 4AVOA 5D37A 3FHAA 4C1KA 3BG9A 3LUTA 2Y0FA 3LY0A 4M56A 3TYZA 3UPMA 1F74A 4PMOA 1PDYA 3HN3A 1JJKA 3NO1A 1QPOA 4JTTA 3Q58A 4FNUA 1UZ1A 5D38A 3G6MA 4IUOA 2D23A 4CQ8A 4MWAB 3S5ZA 1ML1A 4Q8PA 3CMGA 4W8AA 4C6IA 3SUUA 3E1F1 4KCVA 4OTKA 1H7WA 1H5VA 1Z9AA 3N9SA 2FDMA 2B31A 2YDAA 4AC7C 2FHCA 3CUGA 1XW8A 3EX3A 1XI3A 3SRDA 3W7EA 4BQ2A 2O4MA 4AXNA 3NVDA 2ZX7A 4DJFD 2UY2A 3FKRA 5I3JA 4PEKA 4R7JA 3PR2A 3QRHA 1UKQA 3RILA 4IP4A 2ABAA 4G5DA 1M1BA 4Q8UA 1OF6A 1X97A 2J8GA 3FA5A 1K4HA 3NYDA 3IJ9A 2R9RA 1OFDA 1R9ZA 3BCJA 1OABA 3QVQA 3M5YA 2QUTA 3WELA 4C5ZA 1GOXA 1UP3A 5KZDA 1H41A 3HMCA 4CQBA 4K1GA 3ENLA 3AJXA 1Q45A 5J5RA 3VIKA 2FJUB 3P8IA 1EC9A 3AIWA 4HNOA 3MMWA 4DBSA 2GVJA 2PDKA 4GC3A 1MDRA 4U31A 3TP4A 1VFUA 1BRLB 4WD0A 1W1YA 3GFZA 4EIVA 2OU4A 3TN3A 4P8WA 1FKWA 2PU1A 1OFPA 4MUZA 1NSJA 1J2WA 4IMCA 3RIKA 1S2CA 1AQ0A 2E8ZA 1HL9A 3L4YA 5KZMA 4MNJA 4W93A 3OYZA 3QC0A 1DPMA 3NTYA 5DMMA 5HJLA 1O5QA 1MYRA 4O53A 4UTIA 3WDPP 4IWWA 4FXJA 3V5CA 1Q8AA 1HVQA 3KBMA 3BW2A 4AD5A 2Y7GA 3WN6A 1G94A 2EQDA 4ORMA 2DZAA 2HDJA 4ZOAA 1JD9A 2A79A 4PUEA 4GQBA 1T5AA 1UWIA 3O0KA 3OLGA 4UNIA 1KRCC 4A3YA 3QMRA 3CHFA 1RCXB 3W85A 3C0LA 4Q7BA 3BJTA 1DEDA 4DNHA 3IAPA 4GZIA 3MWAA 5ABGA 1R2TA 2VX5A 3AYSA 4K6AA 1EGMA 4BHYA 4JTSA 3UWVA 1OJXA 3RM9A 3STFA 3RAOA 1UH3A 3U9IA 1HFBA 1ISXA 3H53A 3HJZA </