3QVQA

The structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
251
structure length
251
Chain Sequence
GMQSAYSFLPQVIAHRGSSGQAPENTLASLHLAGQQGIKWVEIDVMLSGDGIPVIFHDDYLSRTTDGDGLIYKTPLAELKQLDAGSWKGQEYQQETIPTLLEAIEVISQYGMGLNLELKPCEGLEEETIAASVEVLKQHWPQDLPLLFSSFNYFALVSAKALWPEIARGYNVSAIPSAWQERLEHLDCAGLHIHQSFFDVQQVSDIKAAGYKVLAFTINDESLALKLYNQGLDAVFSDYPQKIQSAIDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an Oleispira antarctica phosphodiesterase OLEI02445 in complex with the product sn-glycerol-3-phosphate
rcsb
source organism Oleispira antarctica
molecule tags Hydrolase
molecule keywords Phosphodiesterase Olei02445
total genus 96
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.2: Glycerophosphocholine phosphodiesterase.
pdb deposition date 2011-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3qvqA00
7PTDA 1DJXA 1XX1A 1T6MA 1QASA 2OR2A 4Q6XA 2PLCA 2ZKMX 6PTDA 3L12A 5T9CE 1DJIA 2OTDA 2P76A 4I9TA 4S3GA 3RLGA 4QJ3B 1AODA 3V1HA 4OECA 1T8QA 3NO3A 1VD6A 1DJYA 5PTDA 3MZ2A 1ZCCA 3V16A 1O1ZA 4GNKB 3H4XA 2F9RA 1DJGA 3RLHA 4PTDA 4F2UA 1DJZA 3QVQA 1PTDA 1V8EA 4I9MA 3V18A 2PZ0A 2ISDA 5T91A 3OHMB 2O55A 4I9JA 5T9BG 2OOGA 3CH0A 3QR1A 1DJHA 3EA1A 4QJ5B 1PTGA 1DJWA 4RW5A 1YDYA 4F2BA 3H4WA 3EA2A 4R7OA 2FJUB 4I8YA 4I90A 1GYMA 1QATA 3PTDA 3KS6A 3QR0A 4RW3A 4QJ4B 3KS5A 4RV3A 4F2TA 3EA3A 2PTDA 3I10A
chains in the Genus database with same CATH superfamily
3RR4A 3RK8A 3GHTA 4KERA 4GNVA 2FHFA 4DJDA 1UD5A 1W5PA 1FCUA 3DZ1A 1EJUC 1AK5A 2A3AA 4WX2A 4UQBA 4D6FA 2YIHA 3O6AA 4XSMA 3UCQA 3EXRA 2Y1HA 3T8QA 2WVVB 1W9PA 2I5QA 4ZE4A 3FAXA 2PRMA 4B5WA 5C0QA 4CNNA 2PWGA 2TAAA 1S2AA 1IR1A 4Z2HA 3QXBA 4GI4A 3DGRA 1I0BA 4MSSA 5CPMA 3URQA 3FJLA 3GS6A 5EMMA 1EC8A 3LM7A 1E43A 4PMJA 4UB9A 5I3HA 4JEQA 4JZ5A 5IRPA 4F8XA 2JGQA 3SRFA 1OFPA 4PH6A 4JIQA 1EEXA 5D05A 5L6UA 3BTNA 3VO0A 1UG6A 2PUZA 3S1UA 1CECA 1KA9F 3BUVA 3H23A 4AY7A 2VKZG 3BW2A 1B3YA 3EOUA 3UWQA 1JD7A 1F8IA 2OT0A 3S6TA 4XO6A 5D9MA 5TNVA 3XINA 3GXDA 4R33A 3FN9A 4QQUA 5A8QA 4Z2LA 5C9WA 1H63A 3MKVA 2WPGA 4JYEA 3VYLA 2EJAA 2W61A 2PDCA 1WDPA 5EBAA 2HK0A 1JF6A 4UC5A 4Z17A 3ISIX 2ZZ6A 3R58A 4RUBA 1RQBA 3IJLA 3IGUA 5DO8A 3GNPA 3NAVA 1BD0A 4FA3A 1V6TA 2ADAA 2ZZ3A 3CLWA 3VOFA 1S1PA 2OVLA 4X60A 1UUQA 4L80A 2V5DA 5I09A 2Q8XA 2WV8A 4AD5A 4EP8C 3ANYA 1UC4A 4MYXA 2OWWA 2E6AA 3S1XA 1GQLA 1XYZA 4QSFA 1J0YA 1FWBC 1IT0A 3CUXA 1WKDA 3DGBA 5CZ0A 1AFSA 3SURA 2QUNA 2C18A 2C0AA 1YDNA 2DT3A 2X1RA 3ES8A 3VGHA 1UCWA 3KVMA 3UEQA 3LENA 1F3EA 1LJYA 5REQA 4Z0SA 4XVDA 2WHKA 4QROA 1JXKA 5AHNA 2GGJA 4FXJA 4F66A 1US2A 3M5YA 1E72M 1FFQA 1RVKA 2PTXA 4US6A 2HS8A 4DUOA 2PPGA 6REQA 4HB7A 4QDWA 4ML9A 2QMKA 3GVWA 3RILA 2PDNA 3NDYA 3WLIA 3M16A 5CKSA 1XIGA 2VZTA 3VIIA 1CXLA 5HNRA 1M01A 1ZQ5A 4X63A 2UV8G 1F3XA 2O7SA 5A94A 4OHQA 4GVHA 2GPTA 3CH0A 3QR1A 3ZT7A 3BLEA 1TPEA 2ZRVA 1WCGA 2DV0A 3R1ZA 3R5EA 4ERGA 4I9TA 4WSKA 1E1CB 3G1RA 3WNOA 4HSOA 1ZB5A 4HA3A 5ABTA 1S38A 1BKSA 1BVNP 4JTGA 4R27A 3BLIA 2QUMA 2PRHA 1HL2A 4ML4A 1VCVA 1TCDA 2D2JA 3VDAA 1ONXA 3B40A 5DBTA 2D3NA 1H0GA 4KEVA 4ORMA 1TELA 4JX5A 1B90A 3BVJA 2UY4A 3TQ0A 4WR3A 1JJKA 4IMFA 1WUEA 1UASA 1RA5A 3UYCA 4L1XA 2VOTA 3WMCA 4WOZA 3W01A 4QTGA 3E5BA 1IGWA 3GR4A 3BLKA 5KTLA 4IT1A 5CSSA 1I2QA 4MFEA 1HF6A 4AZCA 2OLSA 2BMBA 1NF0A 4P7RA 3BAJA 3IWPA 3SM0A 1B3WA 3IPWA 2VGFA 2Z4GA 3M0XA 1CLVA 4CQAA 2J13A 4GY0A 2OKOA 3QSTA 3PY2A 4AQLA 2EQDA 1L2UA 3WNKA 4ZMGA 1VJZA 4QG9A 4WRHA 4ADTA 3ARRA 4ZQRA 1LP6A 1S46A 3WJZA 3KAOA 2BXVA 3BMWA 1MVYA 1Q6LA 2W4XA 1JL8A 1IGSA 4LTSA 3ZXWA 1I8JA 3H7VA 4UWMA 2ANUA 4ZQMA 1V02E 3I6RA 3ALFA 4NNAA 3GFYA 1UD4A 2ZXQA 3MBFA 3W29A 3TW9A 1QPOA 5HJYA 3AISA 3B03A 2H8ZA 3WIJA 4JTRA 4L9YA 2Q71A 3MUZ1 1UKTA 1EWEA 2QDGA 5I3FA 2J62A 1FHUA 1V02A 1SFLA 4KQNA 4UTWC 2X1SA 1V3KA 1O66A 4N6EA 2XFFA 2EPLX 2FPTA 3BV4A 3VZZA 4MJZA 3VVGA 2YCEA 1OYCA 1DEDA 2GL5A 2GQ9A 3UG3A 1EGMA 3GLCA 5AYXA 2V2DA 2C13A 3W84A 4C1KA 5DXXA 2I9UA 2VGBA 4ZB0A 3M0HA 1I2NA 3RU8X 4RCXA 5I07A 1V3MA 5KINA 4ZQPA 3P6LA 1L6FA 1FUYA 4TQTA 1RPXA 1KRBC 2C6QA 1LG1A 4JICA 2KAUC 1Z42A 1TX2A 4IIGA 4L6DA 5CJ5A 4A6GA 1TG7A 1F5ZA 4M7TA 5I77A 2EG6A 3GX9A 1I2OA 1KTNA 3IJ6A 1S2CA 4OECA 4HNTA 3W7MA 1UA7A 2KX9A 4CD5A 1J0KA 1G5AA 1AH4A 1G4SA 3IAQA 3KBWA 1JPHA 4GJ1A 4DVOA 3LOTA 3TTSA 1VZWA 4Y9AA 4K8EA 4ZQNA 2YZRA 3O6YX 4PC8A 4JPGA 2WSQA 4H8UA 4JTSA 2VX6A 1AG1O 4FF7A 4YHGA 2FZ9A 4AZ7A 4Q7BA 1LRQA 4C6KA 2VVSA 4ZQCA 3NPUA 4HNCA 5JVLA 4MLRA 2CITA 1MRAA 5F4SA 4BI5A 4KS0A 3EX6A 1WDRA 2GQAA 4LJ3A 2A6LA 2OYKA 2PA6A 5T8GA 2E28A 1OZMA 3ABRA 1M7OA 3PTDA 1JZ4A 3MUIA 2C1GA 4GPNA 1OFRA 5FACA 2WNZA 3QHOA 1JDFA 3TNOA 2R9RA 2BB0A 5CZKA 2CZEA 3UY7A 2UY3A 4N02A 4O4VA 3ZLHA 1LBMA 4O0KA 3EWUA 4H1ZA 3C2OA 4S23A 2VVNA 5DCEA 1PZ0A 3W7PA 1PVNA 3GH7A 1C7TA 3DFOA 4LALA 3PBWA 7REQA 2DGAA 3QN3A 7CGTA 2WSRA 3U6WA 1HJVA 4WHBA 3BMXA 5HWNA 3NL5A 5D09A 3QW3A 3PTMA 2J79A 2WO5A 4AEEA 1KBJA 5HOSA 5H8UA 2J7GA 3DFSA 1HN1A 1KLYA 4BWLA 4O1AA 2ZVRA 3FY1A 1XLKA 3W2JA 5H6HA 3IJ9A 1AA1B 1BVZA 3L5LA 3KE0A 4CQ9A 3NO3A 3EAUA 4A22A 5IFPA 4KEMA 1KBLA 3QY7A 3OJGA 5I3JA 3FYOA 3ABXA 1DQUA 3FYPA 1RJPA 1VR6A 1HKMA 4O16A 1AL7A 2UBPC 4FB7A 4DM1A 3GNOA 5AZ1A 5LIUX 4I5UA 1X8CA 5ENLA 5C6MA 1D7KA 3W1XA 3UCDA 2GOUA 3P74A 4S39A 3NQVA 3BL3A 1F3TA 3BZGA 3CL8A 4XAPA 4PTXA 3AXIA 4W5UA 2HJPA 3SGGA 3CWOX 3VX1A 3QF0A 3ZLFA 4NAFB 3BARA 3H55A 2Y89A 3C0LA 1SO3A 4PUWA 4KWVA 1GOOA 3D6NA 3LXCA 2YW3A 1KTBA 1DJNA 3NG3A 1D8CA 4HJWA 1JCLA 4CEUC 2PWVA 5FEZA 4GUGA 3OEXA 3REQB 4UTHA 1DIEA 1FHDA 3A6OA 3RM8A 4KBXA 1UWSA 5E0KA 2PRLA 3THDA 1J9YA 4W88A 1V0LA 4O14A 5CAKA 2BHYA 1TTPA 4DZAA 3V5FA 1YTKA 1FP8A 4JFUA 4HQVA 4GC3A 4ZOAA 3SCSA 5DXYA 2V3EA 3MPGA 3RGTA 4DY1A 1WZLA 3LU2A 2PGRA 3GTHA 1ALDA 2ZBTA 4KWSA 2HMCA 4Z0JA 4YCOA 1XLJA 2DU2A 1XIIA 4YS1A 4JFSA 5CZSA 3BJSA 4IQJA 2X41A 3C3UA 2BHZA 3FEMA 1U83A 4ERAA 3N13A 4MKVA 2BHUA 3UA4A 4W9TA 4JTLA 2VR2A 4BQ3A 2IQDA 3UZWA 4WDXA 4L5ZA 5HJXA 3NQAA 3VU2A 2ZUUA 1UPMB 4H9ZA 4QQ3A 1HKVA 2J75A 4PB4A 3KL0A 4EE9A 3TOPA 2VGIA 2X7VA 3EGJA 1ICQA 3EDEA 4IPNB 4W7WA 1IYXA 3AMGA 5FF7A 3R43A 3FSUA 1XW8A 1W2PA 3L0KA 5AVNA 3LQGA 4M82A 5E5CA 3R25A 4H6EA 4E8DA 1N7KA 3O0KA 2Y88A 3PK7A 1SFTA 2ZTKA 5G5IA 1KFKA 5DCDA 4NP7A 2BV9A 3H2EA 1PL9A 2J7BA 5I2UA 1ZZMA 2Y5JA 3LS9A 2DZUA 3CBWA 3H4GA 2V81A 3UZ5A 1ZJIA 2INEA 3WLKX 1ZY9A 1A5NC 2DSUA 4IP5A 4TVCA 1LT7A 4FLSA 4CNSA 3MYPA 1Y5XA 2BXYA 1EQCA 1JXJA 3TTOA 2OTDA 1KM6A 3MVIA 1ZGDA 3W1NA 4Y8FA 1XDJA 3AMLA 1NH6A 3EWXA 5GNZA 1FP9A 1BPLB 3WD4A 4HN8A 3RCYA 3S5NA 1PDZA 1Q6GA 2I5IA 1FWRA 3BAKA 4IWWA 2P10A 1SQ7A 3IJDA 2P50A 3VINA 4HU8A 1J0ZA 3CHCA 3NCOA 3DFPA 2BY3A 2ZWZA 2VCBA 1XLIA 5HNUA 1LBFA 3AHTA 4JTJA 2ZC1A 5A6SA 1BG4A 4KESA 3W7IA 2HROA 2YL8A 3VD5A 2G96A 4JNYA 1Q2RA 3LMZA 1VYPX 4ZODA 2NLYA 3U7BA 1YDYA 2BVWA 3I3EA 1JDCA 1FBAA 1AH3A 1R38A 2PP1A 4HU4A 1R46A 4JHOA 4FXFA 1O7AA 3DUGA 3HQ1A 1IIGA 1EZWA 1CXKA 4NKCA 2QT3A 3FHAA 3W3OA 2E9BA 2YYTA 3LN3A 3AUOA 3W71A 3ZZ1A 1M03A 2V30A 1NOUA 1TYGA 4B91A 4X9YA 5D30A 3UERA 1XS2A 1ZBKA 4I90A 1XSKA 1T99A 5CGTA 4UOQA 4XKYA 1FWTA 3N3MA 5FJOA 4E4FA 2TPSA 1MXDA 1M7XA 3HMJG 1GYLA 2ZUWA 5A6BA 2NUWA 3A3XA 4IXHA 4JN6A 1VEOA 4LUYA 4GXWA 3WDQA 4D1JA 3PZOA 3W7DA 4EIVA 1LG2A 5A6TC 5IBXA 3ID7A 4NZ4A 3GHRA 2WMGA 4MPKA 3N4FA 2ZZ4A 4X0VA 2HVNA 3CU2A 1UIOA 2J9XA 3VD9A 2VM8A 4XZ9A 1KKRA 4I5RA 2CLEA 2DJXA 1YTEA 4L4MA 2NQLA 3VIPA 3I65A 3KVLA 3WNPA 2PDXA 1E5NA 4I7WA 4FNPA 2IMRA 3RO8A 2GVLA 3THUA 3TUUA 3MP5A 1MRQA 2ON3A 4MOZA 4BF7A 3BLOA 1VBRA 3ERPA 1PYMA 4ZTXA 1VFFA 1DJQA 4O18A 1OYAA 4AC7C 3WD2A 1ZENA 5DMMA 4U31A 3II1A 1Q6CA 1XDLA 1VPXA 2F7FA 1NDZA 1UUMA 4JFTA 4LAUA 2FGBA 2BY0A 2AGTA 2OQLA 4HSNA 4H6RA 2OG9A 4AF0B 1OINA 4DZIA 2CHNA 3DHFA 2O4MA 1K9FA 1GHRA 1GOIA 3SADA 1WNOA 1AW1A 2J74A 3N14A 4MVAA 4IP4A 1VFSA 1OFBA 2PU0A 2WKGA 3TA6A 5CSUA 2VR4A 4WJ8A 1KFJA 4J3UA 4ASTA 4R7WA 3FK4A 5BOEA 4MLJA 1SO5A 1QNOA 3GTIA 1N82A 1T6MA 4ZOEA 2AL2A 4ZENA 4S3GA 1OCJA 4PMXA 1YPXA 4FX7A 3LGGA 4JQ3A 4EXQA 3PWIA 5BW6A 1XH0A 3RU6A 3N2MA 3QPYA 3QR0A 4KETA 3ANVA 2OSWA 3REQA 2VEIA 1FHVA 2G8ZA 2VZVA 3J7HA 4P7OA 1HO1A 1FCVA 4O52A 3DEQA 3BURA 1H60A 3K1GA 4DIAA 1T41A 4JL2A 2OOGA 3GAKA 1R7AA 2Z6JA 4Z2JA 1GJPA 3B9EA 1W56A 1ISXA 2WHLA 4P8XA 3LHZA 3V4BA 2IQTA 2OLHA 3NL2A 3FFSA 4NI8A 3ZWTA 2YCIX 3MUAA 2NQ9A 4B3KA 1SJBA 4LSBA 2J24A 1TB3A 3CUHA 3V7PA 1TE6A 2JKAA 4ICNA 3GDBA 3MB9A 2WC7A 1EX5A 3VOJA 3VGEA 4M6VA 3S46A 2Y8VA 3G1SA 3CHFA 4ILSA 4D6IA 3W23A 3TVAA 3N4EA 3GIPA 4J4KA 3DHDA 1YDOA 2J8GA 3R0UA 1TIWA 4DPQA 5C9RA 4RDWA 4QHRA 4HZ8A 5I3DA 5LGZA 4OU1A 3L65A 3W9ZA 4N2YA 4M6PA 4JTIA 3E9AA 4IF2A 4AEFA 3ABZA 4PZVA 1OK4A 3WQ5A 2XDFA 3ARQA 4XTDA 3T7VA 5LXEA 4CVUA 5CBIA 3RUBL 3EA2A 3G0XA 2DQXA 4H01A 3HPFA 3P2VA 2VWSA 4AD0A 1XYAA 4NRSA 4AWEA 4GGBA 4AZBA 4GI6A 5D2WA 4ACZB 1ZAIA 3LSCA 3LCFA 1I60A 3VDCA 2WB5A 2ZDRA 3DFYA 1MYRA 4XBJA 2G5WA 5A8NA 1H4PA 1AZ2A 1A5SA 3CT2A 4U2YA 3W7JA 2BVYA 3BGAA 3N2OA 1JUEA 1OFQA 2OSXA 1VBHA 4AD4A 1X7FA 4UTLA 3TC3A 6XIMA 4KGLA 1AQMA 1P5BA 3VAVA 3UXIA 2V5LA 2QJIA 3C5QA 1EGVA 1J18A 1SZEA 4UIOA 4GRSA 3EMZA 1GKPA 3WQ4A 4QEHA 2BOEX 3SCPA 2ASHA 1V3LA 3AOFA 1R2TA 1B3XA 1WX0A 4J35A 1W3HA 3R6IA 3CASA 1PJ9A 4KH2A 3N12A 4G5DA 4A8NA 3LI0A 2VX7A 4A3RA 2VC7A 4AW7A 4FNTA 3U3HA 4F4RA 3E6EA 2E6FA 2YDSA 4S2CA 4FOUA 1ITXA 2J77A 1E56A 3CXOA 1LOLA 4V1YA 4B9YA 3EKZA 3TNBA 4PUKA 4Y7EA 4E0CA 5K9CA 4NZCA 3VM5A 4LVDA 3PC0A 1B30A 2Y70A 3EWDA 3KCOA 1XUUA 1DHKA 3Q94A 3UR7A 3G5EA 1I9CB 3GNDA 2DT0A 4EK7A 3ZM8A 2OQYA 4PULA 3CTLA 4UXDA 1H5YA 4F0SA 4QNWA 2FZBA 2DVTA 3C52A 4GOAA 2RDTA 3CK5A 1QTWA 3Q2DA 3RG6A 1PIIA 2DZXA 2QS8A 4OWGA 2FKPA 1ZAHA 4XZIA 3VGBA 2NW0A 1O5RA 4PCTA 4H4IA 1QI3A 3CJPA 3OA5A 4MNLA 5HUOA 4HNUA 4I6VA 1K8ZA 1LL7A 3HQOA 2YB1A 3NL3A 2VENA 5B7YA 2POZA 4JQAA 4H83A 2HNHA 3I7SA 1V6YA 3WLHA 4LOCA 1HJWA 2NVDA 3E0LA 4DZ5A 2HV5A 4E6MA 4N4QA 3MYOA 4GGHA 4H8VA 2CZVA 1PBGA 3U57A 2J7FA 1IWPA 7ODCA 3CHDA 4FALA 3A23A 4ZXLA 3W7GA 5U4NA 2NT0A 3SCNA 4HZ7A 3ZYZA 3FSTA 1AJ0A 3WL1A 3OIXA 4V33A 1XFBA 1QPNA 1OZQA 3AIEA 2VZUA 1JRBA 5HQEA 4U33A 3KOXA 2EKGA 5DT5A 1TQXA 2QJGA 1EP1A 1JI1A 2I7GA 4GFIA 3WLTA 3EXTA 5D38A 2GGHA 3CL7A 5DX7A 4OV9A 1FWDC 3MTWA 4D8AA 4MKSA 4OTKA 3AYVA 2QGHA 3HV9A 3DFTA 3GIQA 1RK6A 1U1JA 5J5DA 3CMGA 4UTUA 2Z2UA 4B5SA 1XBVA 1NY1A 4XBSA 5FL0A 3WFLA 1NELA 2B31A 2NVCA 3UQNA 3IUIA 4DJDC 3TDFA 2NUYA 2OX1A 1CB7B 4JX4A 4AZIA 4MYAA 4L4LA 1EOMA 1P6BA 3SY8A 4A4AA 1QVBA 1GG1A 3FCPA 5K4XA 7ENLA 4K7VA 3RRXA 3ARSA 4C6BA 2WMIA 3WBAA 2EHHA 5LA1A 1CWYA 2RJHA 1C92A 4QR6A 1V6XA 4MY1A 4H9MA 1G94A 1HQTA 4LCQA 4GMEA 5I24A 1WUFA 1K4HA 1R3WA 1MUWA 1CCWB 2EBNA 4RNHA 1QI2A 2QVHA 2OJPA 4JN8A 2VXNA 4HP5A 5I0DA 4DQWA 4BK9A 2Q3OA 3CQKA 5HBFA 3R11A 2E6DA 5FF2A 3C4UA 1HG3A 1SW3A 4XB3A 4JX6A 1UWIA 2PODA 3CEPA 3RJYA 3LMYA 1TTJA 1GGOA 4H9VA 3H24A 5AHMA 2INFA 3HMCA 3MW7A 4E3TA 4QE5A 1J6PA 3PFMA 1JGMA 3QOKA 5HR7A 1LLWA 1S5VA 1GK8A 2YL9A 2XN1A 4DX3A 1BXNA 3OP2A 1NFPA 1ME9A 4JGDA 2V2HA 1XIHA 1QNVA 3VOCA 4HOWA 2AQWA 1R3RA 4IJCA 3SQLA 2POTA 2OB3A 2VZOA 2FVLA 4HU3A 4JD4A 3UJFA 4IH3A 1W0MA 3ZJ7A 1DL3A 4A8IA 2F38A 2WBGA 3W7KA 5AC6A 4G9PA 3QTGA 3GC5A 3CB3A 3RF9A 3RITA 4Z2GA 5CJMA 4E38A 3WF3A 3UXLA 4OT7A 1KM4A 1J0IA 3RN6A 2WQPA 1JZ3A 2PTWA 3W26A 4RL3A 4KWWA 4DJFD 1Q6FA 3BGJA 4CQBA 5JH2A 3LZ5A 3UETA 4ECLA 4H8HA 1ONRA 4G6CA 1E4NA 3G1VA 3W75A 1XLHA 5K9DA 1BXCA 1RHCA 4I7UA 4PBEA 3W7RA 4UTKA 1U1HA 2JALA 2UY2A 1PHQA 1O95A 3M5ZA 1JCJA 3DENA 2FVMA 3DU0A 3QVQA 2YDAA 4AY1A 3L4YA 4QDMA 2X1IA 5G4WA 1RP9A 3L4VA 4NZJA 4DWSA 1OSEA 4BR1A 1QR7A 3DDMA 5IFTA 4LBRA 2BASA 1DJIA 2O92A 4IMAA 1F07A 2WHMA 1J2WA 2EJ1A 4OUEA 4PRRA 3KBNA 2WSPA 1MXGA 3G8RA 1XLAA 1Z8AA 1UKSA 3LCHA 1CXIA 3RDKA 1O12A 2MNRA 5AHIA 1KR1A 3QLLA 5I06A 3BDKA 4FEZA 1SFJA 5H2ZA 3GY1A 1L6SA 3C6CA 2R1NA 2C1HA 4MHBA 2XH2A 4QJ4B 3OBAA 3IV3A 3T2OA 4C6LA 4XZMX 4K38A 3APYA 1TMHA 1F74A 3BLFA 2WCAA 3W2UA 2Z26A 1ZBWA 1QOQA 4HNVA 1UROA 2W66A 3T44A 3VD7A 3T42A 5BXRA 2G3JA 2NXIA 1FWFC 3VIJA 3O06A 3RLVA 3AFBA 4Q8TA 4R7OA 1P0NA 2X09A 4A3QA 2R1MA 2VEGA 4B92A 3I68A 1W17A 1EUNA 1S5WA 3UP8A 1E6PA 1V6WA 2OZTA 2QCGA 3QZAA 2DVXA 1UR1A 4I5XA 2VEKA 3B8WA 3GUGA 1UWTA 2VUYA 4R3UA 2HBVA 1NWSA 1VLWA 1EC9A 1QNQA 1P0EA 1YLVA 5JIPA 4GYFA 2BP1A 4GYPC 2HVOA 1LCOA 4PUJA 3QW4B 1C7SA 2HE8A 1J5TA 1L6WA 4OIFA 2QCEA 1H7RA 1HKWA 1N55A 3A3WA 1ITUA 3CUIA 3ARYA 3GZAA 3NNTA 4ZQOA 3VNKA 2DSVA 1KGUA 2W3ZA 4XD5A 1V93A 1WYIA 1WKYA 1OIFA 4WEVX 1E0XA 2WANA 2XISA 3UXDA 1E6QM 1VHNA 3CWNA 1H3GA 5LA2A 4IQLA 4Q8QA 1TV4A 3NM3A 4HA1A 3FXGA 5D03A 1AQHA 1EQPA 2PC8A 2R8WA 2UY5A 2ZWYA 3PUDA 1OCNA 1XIBA 4YLWA 3TCSA 3ITCA 4RW5A 3TA9A 3BSHA 3UD6A 3ES7A 5LKYA 2WVUA 4HVXA 1YX1A 4G56A 1XQLA 3EDJA 1H1YA 1WBHA 1PCWA 4XAFA 4FHAA 3IJ8A 4WQ6A 4KRZA 1MW1A 3WF4A 3S5YA 1M3UA 4MY9A 4ACYA 4UTWA 4UTTA 5LGXA 1QU4A 1BTMA 1QRQA 2ZXAA 2E68A 5K3VA 5MF5A 3PZGA 2LLEA 3PTKA 3IGHX 5E93A 2AMXA 6PTDA 4JNMA 4HYVA 4AIBA 2XINA 3TKFA 4DBSA 4O8RA 1KCLA 3QYQA 3TYZA 4GY1A 1I1WA 2D0GA 4B5UA 4J28A 4IUOA 5A8MA 3H70A 4Y90A 1V6UA 4YWIA 3KOYA 1IWBA 3GTFA 3TN5A 3HG4A 4NJGA 2XN0A 3EYPA 2XG9A 4GCAA 1LLOA 2C7FA 4KKXA 1F6KA 2DZBA 1DJWA 3H22A 3TONA 3PBGA 5M17A 4AD1A 3SN4A 4U3CA 2XIMA 2WMJA 4Y9MA 2JFEX 1CW2A 4KWOA 1M41A 1DOSA 1KM2A 1HO4A 3UGVA 5A6LA 2GQ8A 1JYNA 4P8VA 2QV5A 1MDRA 3VIKA 1K7EA 3S1VA 2J88A 3EA3A 3I10A 2W62A 4NJHA 3ZVHA 4J1OA 3M46A 5HULA 1FKXA 3N29A 3SCQA 4LWWA 3V1HA 1BSLA 3QQ0A 4AVFA 4HNOA 3O07A 1UZHA 1HW6A 1ZAJA 3V3WA 3HF3A 4KCUA 1CGUA 3CPRA 2BNJA 5BRPA 3F1QA 3MCMA 1I2PA 1CLKA 3M0YA 1E4IA 2AMGA 3Q67A 2CKSA 4PMZA 3I6EA 4TIMA 3UNDA 2GWGA 1Q8JA 3S5OA 4S38A 1LWIA 1M7JA 2PDQA 2I9EA 3UG5A 3W81A 4O1FA 1SU5A 1W1TA 5CQ1A 4GZ7A 3CNYA 4D8LA 1GPFA 4GG9A 2C91A 3W6YA 2B7OA 4K1WA 4LNCA 1OGBA 1TWZA 2NZLA 1M5WA 1CNVA 2RUSA 5DCBA 3RLGA 2KZHA 4LS0A 2Y7FA 4M6QA 1PX8A 5CBBA 3N6JA 4AHOA 1TWWA 3WUEA 3TTQA 5F1VA 2GWNA 2VT0A 1W5MA 3AS2A 1CXHA 4TX8A 1Q65A 4CCDA 4F0MA 2A0NA 1PX3A 4HYRA 4V15A 3BH4A 4XUYA 3BAXA 1OJXA 5EFDA 4D71A 3WFAA 1F4HA 3AI0A 3TJXA 1GWJA 4C90A 3VGDA 1YADA 3OTRA 3M9YA 1E6NA 3L4TA 8RUCA 5CG0A 1VBUA 3OGVA 4WUIA 3CIXA 2ISWA 3VNZA 1VFMA 1TA3A 4KRTA 4B16A 3P8JA 3H8AA 4XIAA 3HG2A 3AMDA 2R6OA 3NDOA 3LBMA 3DERA 4IX2A 4R53A 4D2JA 4EPDC 2PGFA 1HJQA 2WC3A 3LA4A 1SZGA 4PMOA 4MB5A 2QAPA 1XISA 3TYDA 3TTYA 4HMDA 3E5PA 4GUJA 3PUOA 3IAPA 3B9OA 3OVGA 4PFMA 1IE7C 1JZ8A 3MMUA 3K4WA 3L2IA 2V3DA 5BMXA 1E6XM 1G4EA 1UWUA 4N4PA 3KLKA 2REQA 3NGFA 5JMUA 2CXEA 3T40A 1TRIA 2WJEA 2VZSA 4QGCA 4A05A 1FTXA 2GJXB 4AX7A 3JR2A 1OK6A 1GEHA 4WY0A 3W38A 3L12A 4XV0A 3FAWA 2GSJA 4DJEA 1XLGA 1IHIA 4DI9A 3VI2A 1RUSA 3GAYA 3M43A 4LRTA 4QIUA 2ZUMA 5EL1A 3IANA 5EMYA 3B9AA 1J12A 1CIUA 1NAL1 3CHVA 2DSWA 1VLIA 3N9SA 5HPCA 1EPXA 1I0DA 3W7CA 1TKKA 4BQ4A 4KFOA 1R86A 5LIWX 5M1TA 2PDKA 1XL9A 3WEMA 5F4WA 4GZJA 4C6OA 5F2GA 1UBSA 5A3HA 2QUUA 4GA8A 4CD7A 2FB3A 1OADA 3K46A 1BF2A 3GFZA 3PBVA 1OX6A 3MMDA 3THCA 2X42A 5K9XA 3TFXA 1RA0A 4GD0A 3QTPA 5BMWA 4HIBA 4PRTA 1C29A 3EDDA 3AU2A 3T09A 2G37A 1TJPA 2J7HA 3HGSA 1QPKA 3IUDA 4PB3A 1W9DM 1XIJA 1OD0A 1N8IA 1UD6A 4GUHA 1WAWA 3BK0A 3AQUA 4V27A 2NQJA 3WD1A 4JTTA 2PDGA 1W9VA 3LNMA 4YTQA 2QMJA 2NT1A 2ZYFA 5LXXA 2V67A 3WDPP 1LL6A 4QRNA 4GO9A 1OYBA 3BANA 1MNSA 5G1MA 3BG9A 3Q65A 4US5A 4MNJA 2BWGA 3JZEA 1XP3A 1DJYA 2PDWA 3HIJA 4L1GA 1VFOA 3R4IA 2HS6A 3OYXA 3P67A 3S4TA 3GFXA 3ITYA 3RXZA 1Q4WA 1RBLA 1U5JA 2V68A 3NJ3A 1XSIA 5G1TA 4AISA 3VDGA 1M53A 1E1FA 3WQEA 4K39A 2I56A 1V4YA 3G0SA 4LANA 1UP3A 3CIWA 4TTUA 2XSAA 3N2CA 3LXAA 5AYYA 3PB2A 4NXSA 2J7DA 4PUEA 3W1LA 2Y5SA 1TV8A 2Y85A 3PTQA 5C2XA 4GH1A 2QQ6A 1TMQA 2EG8A 5IXEA 3ECQA 4DWSD 2NLIA 3P7YA 4MADA 4W87A 1H7WA 2ZZ7A 4QG6A 3EX3A 3LCLA 3D3FA 3NQDA 1VBJA 1TJ2A 2QEZA 2Q6ZA 4ORIA 3ZSTA 4Z1YA 1E3XA 4QNEA 4GBDA 3THAA 1NVMA 1AW2A 1D8WA 3KOWA 5GNXA 4DYKA 1QPRA 1SYTA 3OLEA 1ZCOA 2W63A 2WJDA 5E09A 3MV01 2ZRZA 1KWGA 2O9TA 4BA0A 3UFYA 1LLZA 2QPSA 4GKLA 4P5UA 1ISVA 1KLZA 1NDYA 2B7PA 2HBXA 1AMYA 3GW3A 1GW9A 4W4QA 5T91A 5D33A 5EMKA 2PWFA 2PAJA 1R9ZA 4EPEC 2GLKA 3QMSA 4B5NA 3SCWA 2DSKA 4UTJA 3UZJA 4EAMA 3R94A 3E0WA 2CW6A 1Q6OA 2QLYA 3TR2A 4CNTA 4MFDA 5EU9A 3W25A 5CCZA 3VK5A 4S3AA 1UW9A 3SJNA 2QNEA 2DY3A 4MY8A 1M9HA 4IFKA 1OEPA 4Q6JA 1JRCA 4QJ5B 3LERA 1GCYA 3T0BA 2PDYA 2G3FA 1RCQA 4XG1A 3W22A 4D6DA 2OZ8A 1FDZA 3FHQA 2JGYA 1L9WA 4PGLA 2ZZ5A 3H2MA 3V0SA 1KM3A 2H9AB 4WDWA 3N34A 1FA2A 3UA3A 2VGGA 2W6RA 3MSYA 1QUMA 2Y62A 1LQ0A 4O11A 5JH1A 1FRBA 3E0IA 1W3IA 4HSHA 2W67A 1W9UA 2ABBA 3W1TA 3MDUA 2W79A 1OX4B 4HCHA 1F4AA 1E6RA 1Q8AA 3VABA 1V51A 2HISA 4G8TA 4DB7A 2QDEA 3LSBA 4ZO9A 3HM7A 4P2VA 2DW6A 1DV7A 1ICSA 2XVLA 1V6VA 4HK6A 4E3VA 2D2OA 1CGYA 4B5VA 3F4VA 4WDTA 4O12A 3G1HA 4JHMA 4PODA 3QPEA 3N25A 3MKCA 3VC5A 3QLDA 1K9DA 5CPNA 3IARA 3GBEA 3B0XA 3E2VA 2P1FA 4NILA 3SGZA 5FF3A 3KWSA 2EO7A 3FA3A 2XSBA 3O1NA 1HT6A 3BICA 3RLHA 4DNMA 4WXZA 3TN6A 3PFRA 2DIEA 2GYIA 3L21A 2G3MA 3NQ6A 5D4YA 2JEPA 4ALDA 3KDNA 4MNMA 1KFBA 3N15A 3WH5A 4LCSA 2NWRA 3HTWA 4KIRA 1O60A 4UUIA 1D2KA 1PS9A 4D1IA 4ICMA 3G6LA 2YZ5A 2BGSA 3HQPA 1QHPA 1AH0A 4P7QA 3E0VA 1XRSA 4DEFA 3WBXA 1PIFA 1SR0A 5DRCA 5KMYA 2PU1A 3I6TA 4FOKA 3EPMA 3WSUA 3ANUA 2AQOA 1DE5A 2Z27A 3HO8A 1Q6EA 4IIEA 4M19A 2IXVA 1XBYA 3L4UA 3WQWA 4KW2A 3QSRA 4AZCB 1CGWA 3W37A 2Y4SA 2EXOA 4FZIA 1IIHA 2O56A 3ZFHA 3VMOA 3G1YA 1S3TC 3DC0A 3N6QA 2QJJA 4H2CA 2PURA 5LHEA 1YNQA 4UQ9A 5AC4A 2WNWA 4U28A 2O55A 2GGGA 4H19A 2C79A 3TAKA 2PDHA 3N2BA 1M65A 2Z28A 2EKCA 2DVUA 4L64A 1JPDX 1BHGA 1TPWA 2I5GA 1E4LA 3O6DA 2V2CA 1WQ5A 4LYPA 1WDQA 1KC7A 1TQJA 1UR8A 4CCEA 4OQVA 3OLIA 1KB3A 1VPYA 1W5NA 2YL6A 3UZYA 3LPFA 2AL1A 4IFOA 4HTBA 1SZRA 3CS2A 3S2NA 3OW1A 3WX7A 3LBCA 1OGSA 4QSHA 4JTCA 1WZMA 1JPKA 4LS2A 3N17A 1SJAA 3OZMA 5CSYA 5FESA 3KVJA 2G0WA 2VO5A 1M6JA 4TX6A 1VQTA 1S5NA 3Q4DA 3UPBA 1VKFA 1WPCA 1ZNNA 2FZ8A 1U5VA 2A79A 2IW0A 3LV5A 2ZRXA 1PEZA 2PWHA 5RUBA 3WEOA 4LAZA 4G7EB 1UQZA 1TWSA 2YSWA 2DZTA 3ARXA 3KS6A 3LV6A 1KCKA 3UZZA 3K8LA 5KZ6A 3AWOA 2FVKA 3EMCA 4FNSA 1ZALA 1YPFA 2IPFA 1IZJA 2VFIA 3GTXA 3APTA 1FWIC 2V5JA 5GQBA 1B3VA 2PTZA 3E96A 4PMYA 5DMLA 1H11A 1VJIA 1TR1A 4L61A 1NWUA 4DO7A 1XYCA 2QDHA 2YR1A 1GOMA 4KCTA 5D2XA 3IRSA 4DXXA 3KHDA 4GHRA 3UWEA 3TSDA 1VEMA 3GH4A 1QI0A 4REQA 1ODUA 3MY9A 1A5OC 1A5BA 3ZR6A 4C6EA 3IIOA 5HINA 2YA1A 2NXHA 2D2HA 2PWEA 5FD0A 3WK1A 3P82A 1SMDA 4RLIA 2VEMA 3PP7A 3C2VA 1RBOB 1OG6A 4RZ4A 1SO6A 2YL5A 3FVMA 1L8NA 4DJEC 3APGA 1E55A 2WOQA 1E9YB 3D3AA 2ACSA 4ZBCA 2CBJA 5U7SA 2PBOA 2J6XA 3GKFA 1DTUA 5ABFB 2JE8A 4XX6A 2C1IA 1E6SM 3UJRA 2PCQA 3M47A 2P0IA 3C3NA 4PSRA 1GJUA 1JGIA 1TJ0A 4C7DA 4PUDA 3MSRA 1HGYA 1EJXC 3GNNA 4MZYA 2WKJA 1VENA 2FGLA 3CWHA 4REQB 1WXYA 1UR4A 4Q3MA 1KM5A 3UWWA 4IFKB 3S6DA 1R8LA 4MWAD 3O2LA 1OFAA 3PULA 2A5HA 3ZJKA 1EIXA 2YFOA 4WDUA 1XYBA 3NQ8A 3UWVA 3ABQA 4IGSA 4HHHA 3PPCA 3TX9A 2IQ0A 1KD0A 3OIHA 2WMIB 3WQFA 3WBWA 5IM51 6XIAA 1E71M 2J9ZA 2BLEA 2BS9A 5CLTA 2PDIA 1VD6A 1EOKA 2FIQA 5F2LA 1VCFA 1U33A 4LUSA 4B90A 1E6ZA 3OG2A 3GRIA 2ZRYA 2YDQA 6CGTA 3SCTA 3BOLA 1MI3A 4GZIA 2DH2A 4XQ6A 3NO1A 4QAIA 3LPGA 1OB0A 3NEVA 1AD4A 3F2DA 4H00A 1TJ1A 3BJTA 3AYSA 2DJLA 2WJFA 3TC7A 2JKPA 5C70A 2YPIA 3PJXA 2VUNA 4D8ZA 2QIWA 1RJQA 1B31A 3WH7A 4P7LA 1S2TA 1ZSXA 2R1LA 4TTGA 2FB2A 3FLUA 1FWCC 3SQMA 2WZMA 1YW1A 4TO8A 3JUGA 2D22A 2HEJA 1FH8A 2PE4A 3ARZA 3QBUA 3O8AA 5CC7A 4DUWA 1Z32X 1K7FA 2ZX6A 4V2XA 3BZJA 3BAIA 4NT0A 3OVQA 4CQDA 3UR5A 1W1ZA 3AAMA 1IEVA 4CVWA 4OJYA 3WQ8A 3VDHA 4MWAA 2QYGA 3E0FA 1Q3NA 1CT5A 4NRRA 1R3YA 2WVSA 1X6LA 1NWRA 1EPVA 5H8PA 4DBDA 1O1ZA 1UPPA 1DVJA 3H4XA 2Q01A 2O7QA 4UMAA 3U7VA 1IT7A 4S3EA 4NUWA 2GSHA 2J47A 3MDWA 4D9PA 5HMFA 4W5ZA 4BEUA 1G7UA 4ERIA 3KTXA 9CGTA 1W9BM 2GDQA 3H2CA 3P84A 1RSCA 3RYSA 4DJFC 4EF9A 3GTNA 1KCZA 3MA8A 3R79A 1R9XA 2A3EA 2ZUSA 3N04A 4C65A 1NFGA 3QRHA 1WDSA 3R2GA 3AIBA 1P7TB 3DIPA 1O5KA 3S9IA 5C7HA 3H12A 4YVPA 1V77A 2V82A 3GR7A 5I3KA 4UQDA 5HDRA 3SN1A 3MZ2A 3TW7A 1CENA 1JF5A 2E09A 4UOZA 1XHGA 4J3ZA 3MVTA 3QY8A 3SUTA 2ZXBA 3NURA 1BRLB 3VIMA 5CJNA 1CGTA 4ATWA 4LEFA 1ZP4A 2E5CA 1JDDA 3CMFA 3W83A 3EOSA 3L68A 1XBZA 1YYAA 4DO4A 3BE7A 4JQ1A 2WMFA 5CPQA 1TPB1 1XIDA 4JKKA 5DY3A 1UH3A 1XYLA 2XFRA 1NOFA 3CH9A 3NTYA 2P5NA 4DZHA 3TC6A 2OGJA 2IPGA 2Z1BA 3CV7A 3CQIA 4Y8EA 4RDYA 4H7VA 4W8BA 2JIEA 3S8HA 1YXDA 3KOFA 1X1ZA 4DUVA 3QPZA 3NUKA 4F9JA 4GINA 1E3ZA 4EKJA 1VBGA 5A1AA 5IDZA 4C6DA 4F2BA 3G77A 5IBXC 1TA3B 1EL3A 4ICCX 4EAYA 1PWLA 1MXSA 3KL5A 3B8DA 3KBJA 4TOQA 2E1WA 2E8YA 3L5AA 2YXOA 1KXTA 4E8CA 3AO0A 1OX5A 4Q4PA 1ONWA 1WKFA 2QPXA 2F2HA 2PF0A 5BXPA 2V3GA 5A69A 4IJRA 1BGGA 1LWJA 5XIMA 4WZHA 1UIPA 2ZICA 4H8NA 3ARUA 5LIKX 1B9BA 1U5HA 1W1VA 3GD6A 1QNPA 4IIDA 3VNYA 4OFCA 1R3SA 3GXTA 3VD3A 3RX4A 1W1A1 3C2YA 3GYEA 4GQQA 2NQHA 1G69A 4IM4A 3WMLA 4NU7A 3A24A 3DI1A 1P48A 4MB4A 2D23A 3R89A 1AL8A 3OVRA 3EKLA 3LCIA 5CC6A 3UGRA 3KRUA 4DF0A 2ICSA 4M1RA 3VX0A 2FZDA 5BXTA 4XZLX 3FIGA 3KRSA 3GU1A 1K3UA 3HN3A 1RV8A 3KVKA 4MNKA 2VRQA 5ABFA 4UCFA 1X97A 5CPSA 2VP8A 3IS4A 5FIPA 2XIBA 3T55A 4LX4A 2WCSA 1OF6A 3G6MA 4PCSA 3WQOA 4JIIX 4K37A 1EFZA 2DQWA 3RMEA 3AUJA 3WJSA 3Q45A 4QS6A 1TUXA 1JYWA 3K8KA 3VIOA 3WDHA 4A29A 2OPJA 4JR5A 5D8WA 4GFSA 4M24A 3NA8A 3NZPA 3W1MA 4K3ZA 2R91A 1QWGA 4G2DA 1R2SA 3UF9A 1A4LA 3W2NA 1V8EA 3BLPX 2C3ZA 1J79A 3V5CA 4DN1A 1FXQA 4AZHA 3WY1A 1UWQA 1JZ2A 5A8OA 5LIYX 3TWAA 1A3HA 4K2SA 3VUSA 4ZO6A 2D3LA 2FZNA 5FAJA 1A53A 2V5CA 3B0UX 1UJPA 3ARWA 2VURA 3D5HA 3AC0A 2GZXA 2FDSA 4MUZA 1IEQA 2X0HA 5H1WA 4AD2A 2YKKA 4CQ8A 1GHSA 4XD4A 3W2LA 4WKAA 2GK1B 4UFHA 3W1PA 3B0YA 2E6YA 2Z24A 4LUTB 2ZIDA 3USZA 4CU8A 4LS1A 1JZ6A 2VFHA 4PYSA 4IG2A 2PZ0A 3WG6A 4AU0A 1TWDA 1TRDA 1OIMA 1A5KC 3WQGA 4LC8A 1A5LC 2V9DA 1O6IA 5BYWA 3DBPA 5CPTA 3USBA 1FCBA 5DANA 2QCDB 3E49A 2FGZA 3LDVA 2VQTA 2D1ZA 2YLLA 1ONEA 4AUBA 3XISA 3FVDA 4D6JA 4W8LA 3M6YA 1QXLA 3AXXA 5DMYA 3WQDA 3UG8A 1R87A 2BODX 5DFAA 4M0XA 1ECQA 3GC4A 1ITCA 2PTYA 3GVGA 2GK1A 4N42A 4WIWA 1TUFA 2CETA 2PB1A 1US0A 3M0IA 2XN2A 2NX1A 5HK4A 3T81A 4GX9A 3BO9A 3LRMA 2PLKA 1NDVA 1DXIA 4NI3A 5EFFA 1A4MA 4P61A 3AMCA 4MJ4A 1BYBA 2BOGX 2BZNA 1THFD 4AMAA 1XGEA 3PZIA 3MMTA 5HR6A 3DECA 3S6OA 2J25A 1TZZA 5HMSA 4NJJA 2H8XA 2WWCA 5FJUA 4ZGYA 5H8MA 2RH9A 4HT3A 2F6UA 2HTMA 3RMJA 3LD5A 3ARVA 4I8DA 2ZXDA 2YBUA 4MB3A 4I9AA 4HA4A 4BKNA 2VC9A 4I6KA 2WNNA 1AUSL 2IKHA 2VFGA 3H2FA 3WQPA 4RJEA 4FR6A 1KBBA 5G4EA 4PRWA 3IUHA 1FH9A 1OWQA 3WH6A 5BWFA 3VXGA 3KWXA 1LTDA 4DF2A 3AHXA 1ME7A 1Z69A 2GJPA 4JXCA 3TMLA 3ARTA 4HCDA 5I5RA 3W74A 2HRWA 4FIRA 4HK7A 1KKOA 3NPVA 3ENLA 1HX0A 3OGRA 1KV8A 4YTRA 3KS5A 4TVUA 1EF2A 4LAKA 4MZ8A 3VIHA 1IXPA 3KCLA 4CD8A 1JZ5A 3KRBA 4C7FA 2FDMA 1QCWA 2RGMA 3OGSA 1X6NA 3TJLA 1GOQA 1KRAC 3QH2A 3ABSA 1B0IA 2VOMA 4I8YA 3S1GA 4YN5A 4D72A 3GVQA 2HPMA 3HBLA 2B4GA 4QS5A 4URIA 3BLDA 4L6HA 2PDFA 4FIQA 1JNEA 4XZBA 1OFOA 1YXYA 1Z41A 1TPFA 2FTWA 5K2ZA 4QXIA 3LK6A 4JIEA 2IKJA 4PTVA 5A6KA 4JCMA 3OG3A 4TXEA 3W1RA 3LB0A 4GH3A 1C93A 1XIFA 3C8NA 1BTCA 5CPLA 3K2GA 1Q66A 2J78A 4UMBA 1TV7A 4LB3A 3S42A 2BSLA 4WKHA 2DW7A 4QLLA 1KQZA 1Z48A 2ZX8A 4HBKA 2G3IA 1UQYA 1TPDA 2FMNA 4DJFA 1BYCA 5CPOA 4O0ZA 1DP0A 1ZUAX 2VL4A 5LNVA 1K6WA 4I3GA 2XPKA 3MV11 2Q8LA 4ZL1A 4G1NA 4GVFA 2J27A 4PCFA 3LQLA 4HPNA 3Q37A 4P8UA 2OZ3A 1ZU8A 1LYXA 5I02A 3N19B 2HZGA 1OC7A 3P60A 3A47A 3B97A 1DXEA 4R85A 2PLJA 3TYBA 1H50A 5D04C 3VE9A 4BWLC 1QPQA 5E9XA 1BG9A 2A7RA 3L2MA 2GDVA 2CNCA 3ZR5A 3F4CA 3C0QA 1BGAA 2WMHA 2EF9A 3T07A 2CEQA 4XAYA 2B7QA 4E5TA 3SN0A 4A3HA 1G9HA 4DBEA 3MP4A 1LUCB 1N2VA 3DHPA 5FJIA 4FO4A 3KTSA 2V38A 1DJHA 2DZSA 3COTA 3K5XA 2J6VA 5AC5A 1A0DA 4JAWA 3WO8A 1EIBA 2WAGA 2Y61A 3VCNA 1ITQA 3XIMA 3P80A 1C8YA 1D3HA 4AEOA 1RP8A 4AHPA 1R3VA 4NX5A 2YJQA 1QI4A 5D9PA 3BXWA 3ITTA 4PTWA 4Q4SA 2NV1A 3L2LA 1J11A 1BWVA 3T78A 4YTSA 2RFGA 3M7SA 3K4DA 4B3ZA 3IIZA 4ATLA 1GOXA 3NOYA 3R8HA 5JUVA 2GUYA 2X05A 3MMWA 3UJSA 3EPNA 3SSJA 5B80A 1LROA 3A4JA 1H41A 1EJSC 3GVVA 1PDYA 4AXKA 4PMRA 4M3PA 1JDAA 2CBIA 4FK9A 2FZMA 4ROPA 1I75A 2NWSA 4UOJA 3LCWA 2YOCA 1ZBCA 3NQCA 3QOMA 4JTFA 4YWSA 5M3WA 4XTIA 1OY0A 2X8RA 4AB4A 3MO4A 2H3DA 2R1PA 4GYKA 4ZOBA 5BRBA 3FJ4A 5IHRA 3BC9A 1D9EA 4IL2A 3CT7A 2PD5A 1XFCA 2H9AA 4M56A 2XVPA 4BI7A 4IIFA 4HNLA 3E2QA 3NSNA 2E0PA 4GQGA 3SUWA 2VMFA 4WJEA 2PD9A 1V5XA 3TOYA 3LLDA 5G1YA 4F3HA 4S3DA 1H09A 1VRDA 1X8FA 1XICA 4ADUA 4C6PA 2Z29A 3V16A 5DN1A 1M1BA 3BSGA 1GQNA 5C2CA 3P14A 4PL2A 1A80A 4CKQA 5GNYA 1W32A 3HPXA 5EMJA 1W37A 3H2NA 1KGXA 5F7UA 5G4HC 4X9SA 4UNIA 5C5YA 1CXEA 3W87A 1FWNA 1NM9A 3RCNA 5JIWA 4D6EA 3U4AA 1C8XA 1VGAA 1YBQA 3A5FA 1C8VA 1UR2A 3Q58A 4DBWA 1Q45A 1XRVA 4AIUA 3S83A 3I4KA 5FOOA 5PTDA 1ZCCA 4YL2A 1ENUA 1EUAA 1SW0A 4XUGA 3U2ZA 1TV2A 2BY1A 2CYGA 3TYCA 1JPIA 1E0TA 2AKMA 3VNJA 5C54A 1Q7ZA 4JN7A 4FI4A 3DHUA 1KTCA 4JBRA 1M7PA 3TWBA 1JAEA 1NSJA 4DXVA 3C0SA 4HMCA 4I7VA 4W93A 6REQB 1S39A 1QNSA 3AIVA 2HQAA 4IQEA 3IIPA 2XIJA 1P0KA 1I2RA 5T9BG 1UH2A 3U5YA 4F0KA 3EBVA 3CYVA 3IVTA 1VFTA 5BWAA 4L4OA 1H7XA 2E25A 2XH0A 4KF1A 1TR9A 4UFJA 2C15A 1K6AA 5I6SA 4W84A 3CL6A 3TXVA 4JCLA 3C8FA 3V0TA 1XJBA 3OZOA 4M29A 1EH9A 4ZA0A 2BVTA 4QX4A 2Z1XA 2DIJA 2ZVIA 1JDEA 3ZT5A 1OFEA 5H91A 2C71A 3WBEA 2JIWA 1PUDA 3SAZA 2HXTA 2E77A 5D8ZA 3SW6A 1YIXA 3MO7A 2XVNA 1B54A 2CZ5A 2Z6IA 4DXKA 1EDGA 5LSMA 1BXBA 5C8BB 1TWIA 4NSBA 3AU6A 3SUVA 2FHBA 4OOZA 4B5TA 3PB0A 1J10A 1TE1A 3ITVA 1Q6QA 4MAVA 3W6LA 1DWGM 1JFHA 2PDLA 3FJ6A 2A21A 1BYAA 1VFHA 3GNRA 1XC6A 1EJRC 1GZGA 4KPLA 1ESWA 3HJZA 1QATA 1TSIA 1GTHA 4F0LA 4TU1A 3HB9A 1SFSA 4O1DA 1UP0A 1YPIA 4GX8A 1PSCA 4O1EA 2TODA 2ZRWA 4BJHA 5SWUA 1OM0A 1CLXA 3QY6A 4WJXA 2ZUTA 4UFIA 2EEXA 1T5AA 4C5YA 1BSIA 4BFAA 6TAAA 2PGWA 3STPA 3W85A 3NSMA 4Q4KA 2A7NA 1NDWA 3H4WA 3L7RA 1VC4A 3MCOA 3V5OA 1PV8A 4GUIA 4J3TA 5FSEC 4Z1DA 1PKYA 5E1QA 1K4GA 1PXGA 1EA9C 3UZXA 2XYLA 1AD1A 2P8CA 4E2BA 4RKAA 3LLFA 1JULA 3STGA 2Q8ZA 2RAGA 3NVDA 1W3JA 1P6CA 3OO2A 3PNZA 2Z2AA 5DY2A 3H2OA 2YLAA 3RPTA 1YDVA 3GDMA 4AYGA 1VHCA 5CZTA 1RY8A 3DN5A 1XLDA 2PS2A 2O4QA 3TXZA 3L67A 2VX4A 1CXFA 4FR1A 4P7NA 1VRXA 5FJJA 2FPVA 3LTYA 3TLLA 3C61A 1E0UA 3H2AA 4Q4QA 1WE5A 4L1WA 3KM8A 1FWJC 1Q2SA 4K1GA 1LQ2A 3TV8A 1B3OA 4PMQA 3OBEA 3T0DA 5DBUA 1A5MC 2I1OA 1H7OA 2AGKA 3B0VC 5EGRA 2A3CA 4JS3A 2ZA3A 5KETA 5D9NA 1UOZA 3ABOA 3OPSA 3A3HA 1W54A 5AHLA 3STEA 4ZZ9A 3UVAA 3R0DA 2OO0A 3GB6A 3T0CA 1S3HA 3TJ4A 5KEZA 2J8FA 4GUFA 3LHVA 2BOFX 4XZHA 2Z1SA 3DG6A 4YXGA 3PUEA 1IWAA 4IIHA 2OKTA 3M0LA 1GORA 2A3HA 3RX2A 4M80A 3M6DA 1V0KA 2WJZA 4C91A 3K1DA 1RY0A 4Q8VA 4XKYB 1VF8A 4PMUA 3M41A 1GT8A 2BFGA 3C2RA 3FNDA 3G1FA 5F2MA 2QHAA 3JU2A 3O0FA 4YMZA 4S1FA 1GOKA 3WF2A 2Z1WA 4NY2A 1TZ9A 4GBUA 3WDRA 1XM3A 2OR2A 5C55A 3W0KA 4FX6M 3G1DA 1EXPA 3AHVA 3G22A 4FAMA 3IK4A 1UJQA 2O0TA 4EANA 3WD3A 2PZNA 1ZPTA 1XLEA 1D7FA 4D6CA 4UTIA 2E5DA 3NXFA 1QOPA 1FX6A 2VDGA 3NIYA 4EXBA 1QT1A 4UNLA 4ZO7A 5L9FA 4Q6XA 4DYEA 2XZ7A 3C2EA 4MUPA 4RDZA 1GW1A 3SZ8A 7TIMA 3N2XA 2CBVA 1TX0A 4JDBA 1Z3NA 3T4WA 3NQ7A 1XV8A 3GKAA 3OU8A 2Y0FA 1RCXB 2A3LA 1XI3A 3W1UA 2P8BA 3MI3A 1A3XA 4QG8A 4NJKA 3K8MA 2PMQA 2YCKX 3ATYA 4YYCA 4XAZA 3H54A 4CUCA 3EDFA 4X3ZA 1RD5A 1YBQB 1T7LA 4EOUA 1S5MA 2ACRA 2WZIA 4A2RA 3TIMA 3KFTA 2QPUA 2ODOA 4IISA 4JIRA 5D2YA 2QCMA 4K7YA 3WUBA 1E15A 5IOBA 1R5YA 3CZLA 1QDSA 3CAQA 1HXJA 5M03A 1HL8A 2ISVA 1XLFA 2BXZA 3BSMA 1HJSA 3KBMA 4UNKA 4ZSUA 3EZ4A 5CC3A 3VNIA 4J5NA 1E4MM 2X2YA 4LUTA 3VD4A 1KXQA 3IK2A 4GQ0A 5FJPA 1WDDA 4PE8A 4IZGA 4PA8A 4QAWA 1NOWA 2WM1A 3O7UA 2AL2B 3A4WA 4PCPA 4W89A 4RE3A 4CN4A 4B3LA 3PZ9A 2ZOXA 1F05A 3IJ7A 1SMAA 4ATDA 1M68A 2WMKA 4YPJA 2F84A 3BWWA 3OBKA 4Z42C 1QW9A 3VGFA 5ABEA 1Z6KA 3S9ZA 3MSGA 5KZEA 4JTHA 4YIWA 1EO5A 5EY5A 4R7JA 3T4CA 2GSEA 3WH8A 2TMDA 3DYMA 1R30A 3P62A 4RE2A 3SFKA 3SJ3A 3S2JA 3EB2A 4DAIA 2QCFA 4KEZA 5FEWA 1HZYA 1IEWA 4IJBA 1A5CA 2J8TA 4LBSA 1J96A 2A7PA 3U4FA 4XAGA 2Y7DA 1GVEA 4OGZA 2VFDA 3WK3A 4U2ZA 2QGYA 1JIBA 2X2GA 1RCOB 3BAWA 4HCLA 4IPJA 1BRLA 4WSJA 5D2TA 3SFWA 3WK0A 3RAOA 5HAOA 1WZAA 5JQ9A 1IR2A 1JEZA 3V75A 3F5JA 1GKQA 4CD6A 5J5RA 4KWUA 3DXIA 4R5EA 3NL6A 1PTGA 2QZRA 3GXPA 4Y2WA 3WFZA 4Z2IA 3BQ6A 1WZKA 3GK0A 2WBKA 1U1UA 2QW5A 3I3BA 3KP1A 2HXUA 4PR4A 5J8LA 5LNSA 4GCXA 3A9BA 1R3TA 3NWRA 4AIOA 3D0CA 3GUWA 1P4CA 1K02A 3WDJA 2C16A 1E73M 1JFXA 2WK2A 4NNCA 3I7RA 4P8WA 4NX0A 4A21A 4HPXA 4GISA 1QI5A 1A47A 5CXPA 4US5D 2G41A 1KNWA 4HHLA 1E0VA 2QJNA 2HDJA 4DLFA 4EPBC 3SRKA 2PDJA 4XISA 2REQB 4WOQA 3SRDA 5BROA 1ZBVA 1W3NA 2E3ZA 4UTMA 3U9IA 1MEIA 3L0NA 3LUTA 4ZXOA 3NQ2A 4DJED 3IVUA 4QFUA 3D46A 4AX6A 4KCVA 1WAUA 4CNUA 3VOGA 3NR0A 1GVOA 4UZSA 1AJZA 1X6UA 4J3VA 2H90A 3IACA 2XM1A 1G4PA 3L5MA 2QCLA 1DIOA 2ATSA 3EWZA 3VCCA 3CUZA 3LM3A 1M04A 4UFLA 2CERA 1X38A 4X2RA 4YU1A 3NM1A 2F8QA 2OWXA 1KM1A 4KGJA 1YRRA 5HPOA 3W6MA 3TP4A 3AS0A 4Q4RA 3GHUA 1YQ2A 4LC6A 4C6FA 3O9NA 2EPNA 4RK8A 3GG1A 4IQDA 1W8SA 1VYSX 2OQHA 4GE8A 3SY5A 1CPUA 4DM2A 5T9CE 1IQ8A 5EBUA 4RNIA 3CQHA 3FDKA 4RNFA 3FW6A 3QHMA 4PMVA 3W07A 4UFKA 3VMNA 1EF3A 4TMBA 2PDMA 3VOHA 3CV1A 4U3AA 1WA3A 3W24A 2ISFA 4FXSA 3AHYA 4FOJA 5E6ZA 1XPGA 3GQYA 4LT9A 3ZT6A 3HJEA 1G67A 4RZBA 3U2OA 1RBAA 1ML1A 4IP7A 3CAWA 3O63A 1K9EA 3MZNA 4LFYA 2HNEA 3VKAA 3CM4A 4MF4A 3ZMRA 3H53A 1E5JA 4UR8A 1PTDA 4PL1A 2L5HA 3L4ZA 1NQKA 4DAFA 3GDRA 2YA0A 1XIEA 3UG4A 3QV8A 3PWAA 4PUMA 3TCEA 1S1RA 2V0TA 3OHIA 3RPMA 1PZ1A 3AZSA 4Q33A 3F7JA 1HVQA 5I78A 3WCZA 2DSZA 4PMDA 5G2HA 1AJ2A 4B9ZA 1W31A 4LNYA 1ISYA 1G1YA 1LBLA 4IMGA 4GIAA 4JFVA 2QAFA 3ZR4A 1SGJA 2ZQ0A 3SGUA 3WLQA 1UWRA 4AC1X 1QNRA 1NQ6A 5TIMA 4DHGA 1G4TA 4GABA 4UFMA 3SCVA 4Y96A 1SO4A 2ZX9A 3T08A 4JTQA 3WJYA 4CCCA 2VDIA 5LNRA 3RJXA 5FAGA 2TYSA 1HNYA 1S2VA 3KHJA 3LPPA 1PKMA 4R34A 3AZTA 3CAVA 3PR2A 1RK5A 3UPWA 1WXZA 1GYNA 2XIIA 3QMTA 1GVRA 2QJMA 3QC0A 4NAEA 2Y8KA 4OBRA 3THQA 4K8GA 1K9TA 3CMJA 1SPQA 5JBEA 4O15A 1X98A 2WVTA 3WEZA 4K68A 3PWGA 3GG7A 5A6MA 1OHLA 3KDOA 4Z1CA 1IT8A 4KFPA 3UY8A 3QKZA 1Q85A 2NX9A 3EEGA 4DWSC 4NAFA 4WY0F 4F9DA 2E8ZA 4E2DA 3S3GA 3T0AA 4AZ6A 1K70A 2CCRA 4IMEA 4Q8WA 3TSBA 3RNDA 2HPIA 1JR1A 3PM6A 3GR8A 2FMOA 3U0HA 1V7YA 2XU2A 4UQAA 4CU6A 2NSOA 4PTNA 4ZCWA 1F8MA 1J93A 3FV9A 3QEZA 5EPDA 3AMKA 4RZ5A 2YFNA 9XIMA 2CLLA 4PUNA 4NAEB 1O5XA 1OCQA 1OX4A 4GQBA 3RFAA 4CEXC 5JU6A 3BV7A 1YMYA 3F4NA 2QUVA 1CB2A 4QE1A 3AXMA 3RO6A 3W53A 2BG5A 5E0FA 1TIMA 3QV9A 3ME3A 5T26A 1P1XA 4AFYA 2PDBA 4WGHA 4HD5A 1Y7VA 3CZGA 2X16A 3VZXA 4IHCA 2YGYA 1ISWA 5CZJA 3WZ0E 2QR6A 1A49A 3LHUA 1B57A 3WDIA 3S1WA 3K30A 3LYEA 1JPMA 2X7WA 3MI2A 2J7EA 3MANA 1C8QA 3F5LA 1B2YA 2PBGA 3STFA 1RVGA 3L4WA 1KO0A 4C7GA 3WYZA 3DKLA 4RX0A 3WNMA 1Z89A 4LUJA 3A64A 1H2JA 4PBFA 3GDTA 3KXQA 4FF5A 4A3YA 1E1CA 3HG5A 4FSAA 3E74A 1QJWA 1JAKA 4QITA 4WGXA 2Z7GA 2XH4A 1UZ4A 3KTCA 1H51A 1V3JA 3POHA 1XH1A 4JIHA 1O94A 3BPWA 5E6YA 3QV6A 5AYBA 4BQ5A 1OC5A 3V0UA 3PHAA 2D24A 4WD0A 3PPFA 2BGQA 2CKRA 5D9OA 3IRDA 3TQPA 4DBUA 1XD1A 3ITLA 3QFWA 1SJDA 4H7CA 3F4DA 4NYYA 1ECEA 2D69A 3URAA 4AWUA 1FWEC 3UWYA 1G01A 3IIXA 4QE4A 2AOSA 3EDKA 3IGSA 5C9UA 3O6CA 4BHYA 3E12A 5AC8A 5B7ZA 5BCAA 4WSHA 2C14A 3AIUA 1YE4A 4QBXA 3PZMA 1LL4A 1TREA 4HKPA 3IJIA 2F6XA 6ALDA 3E1F1 1I45A 3VKKA 4EX4A 4Z2KA 4UTTC 3LRLA 3T0TA 8XIAA 4LRSA 3GYCA 4QLJA 3F03K 4LV4A 1ISZA 3HPSA 2FH8A 1LM1A 4H6KA 1DORA 3B4UA 2C19A 3NQGA 4O1CA 4DO5A 4GJIA 1EO7A 3B9NA 4JTAA 1CBGA 3G1AA 4LH8A 2D20A 2RHGA 1LOQA 4N7QA 3EX2A 4K6AA 1VPQA 3M44A 1DYSA 1PIGA 4S3CA 3LTPA 2XTKA 3QGAC 2XIQA 1TTQA 4WKFA 4LYKA 1VAHA 1BQGA 3E38A 4LF2A 2WVVA 1FHLA 3QR3A 3AICA 5HXMA 4FNQA 1CZ1A 2QIIA 3QM3A 5EKYA 1GTEA 3UR8A 3A4AA 2O9PA 2R82A 1QASA 3ATZA 4GWEA 2CPUA 1LUCA 5DMNA 4F79A 5FSDC 1G7VA 1QW8A 1TZ7A 5A6JA 1UD8A 3W7LA 4HTYA 3KP0A 1LF1A 2VQUA 4LPCA 3EOLA 1GPWA 5DQPA 4DELA 4R88A 1RD6A 3RPDA 3SIZA 1UD3A 3W7OA 2XFWA 3O16A 1HP5A 7PTDA 5HWMA 4CQCA 4C6QA 2ZKMX 4RDVA 3W7EA 3EWYA 1OVDA 2YA2A 3CPGA 2O9OA 2YCLB 4OBSA 2WZTA 2PLMA 4E2OA 4MDOA 1K1DA 3M0ZA 2W9MA 3M7WA 2CHRA 3H21A 1UUOA 4J7RA 1E9IA 3W73A 4DWDA 4MM1A 1BYDA 3L23A 1GVSA 2A3BA 3P5YA 1XLLA 2E67A 4DF1A 5BRQA 3R13A 2ALRA 1DQWA 1NP2A 3ITXA 3URNA 1REQA 3P81A 1ZP3A 5HNTA 4H04A 3V35A 4IX0A 3MWCA 3K4AA 5ABHA 4LVBA 2G97A 3U2EA 2DIKA 1WKEA 2V3FA 4LV9A 2VX5A 3MQTA 3B06A 1MEWA 3MWAA 3QYSA 2FTPA 5GPRA 4IPLA 5BU6A 4L9XA 3RIKA 1EHAA 3UR2A 3B8SA 3RLUA 2OELA 5BNKA 4M5PA 4NF7A 4MWAC 3ZS4A 2W5FA 1JCYA 1CX9A 1Q7MA 2HE5A 2CBUA 3NEHA 3LHWA 1MFVA 1V3HA 5AHEA 1Y65A 1AW5A 3TYUA 4HPJA 4YJ5A 3GVRA 4UQEA 2CIPA 4AYSA 2RDXA 3BMVA 4OV4A 1VJSA 4Q8MA 4JOMA 2W0UA 3WQ6A 1BQCA 3HZ3A 1I6NA 1LRNA 4Z08A 4J2MA 4HJFA 4JTUA 2GDUA 2CC0A 1VS1A 5F2IA 2G3NA 3GDKA 4AXNA 4CD4A 2NSXA 4F0RA 4LAMA 1W3LA 1UBPC 1KBIA 2CLOA 3AXKA 4E4UA 3DBNA 1DIKA 1FDYA 1XQKA 2JQXA 4LXFA 4GIEA 1A0CA 2PEVA 1YE6A 4BI6A 4U5KA 1LRTA 1WB0A 3HPAA 3I7QA 5HMEA 3ALGA 5LA0A 3BCJA 3V36A 2WSYA 1KW1A 3WN6A 3ITGA 5EA9A 4EF8A 1GVIA 3RM9A 2CZFA 3WMBA 4HPGA 2G50A 1E70M 1ZLPA 1EKOA 4QCFA 3KOZA 5EYWA 1OQFA 5MKGB 1L8PA 3BG5A 3EB3A 1OT2A 1EC7A 4FLQA 1IXOA 2CLFA 1MDLA 1DQXA 4XKMA 2NQ5A 4L65A 2Y6ZA 3RR1A 2CWNA 3WLMA 5JBDA 3QGVA 4TV5A 1R9YA 5FA5A 4Z1BA 4A3UA 1V03A 4HOXA 1MQPA 5F4XA 5EB8A 3CC1A 1RR2A 1XRTA 4B2DA 4DWSB 1WDWA 3CUGA 1WP6A 4S3KA 3W28A 2DH3A 5C2GA 1HFBA 1ICPA 1CI1A 4I9MA 3BLLA 4D6HA 3PSVA 1OGGA 2ACQA 4D6GA 3GZ3A 3KLLA 1W5QA 3LY0A 4L56A 3PUGA 2V63A 3CO8A 4L7ZA 3BW3A 1RXOB 3TMQA 3VKCA 2ZA1A 3HOJA 3W00A 4EPKA 4HZMA 1EHNA 2A1YA 4ADSA 2X30A 5KITA 1AVAA 3WQVA 1KFCA 5GJNA 2A85A 1VCGA 1H61A 4ACZA 1I1XA 4JTEA 3W76A 5AN7A 3UYIA 1WOAA 2EPMX 4KIEA 4J3XA 3VCRA 4H3DA 1V3IA 1A0EA 5HQLA 3AS3A 3DYOA 1R85A 3LX9A 4R9XA 3PG8A 3PPGA 3MJYA 4UBPC 2E9LA 5AC7A 1XYFA 2VCCA 4IFRA 4HHPA 1OG0A 4GVGA 3W72A 1XDMA 3AJXA 4QM1A 4FS9A 4MKNA 3IGXA 1YNPA 2E1DA 1R3QA 1E40A 2CESA 4AH7A 1K7XA 4RNJA 1QK2A 2ZE0A 1H7NA 1FFRA 4RR4A 2DEPA 3S0CA 4IPPA 4RPPA 1KRCC 2VRJA 3W7NA 3WUGA 4DNHA 4IXXA 1TCMA 1OABA 2NQZA 4X2PA 2V6AA 3CZ8A 2NXGA 3QFEA 4LY4A 3E2RA 4LW7A 3KUMA 3NDZA 5DELA 3QKEA 4JKMA 5MHBA 3IIVA 1UZ1A 1DPMA 1K8XA 5AVHA 5HATA 1WXJA 4WY0B 4Q32A 4A8LA 3W7HA 4EWND 4BQ2A 1J4EA 4M1BA 1RQHA 1BFNA 1P6WA 3R0KA 4YNGA 2E40A 3R10A 1PE1A 4X22A 2NUXA 4NHVA 4CU7A 1TJRA 1EEPA 2ZCGA 2VCAA 1H62A 3H7UA 1GKRA 4S2BA 2EAWA 4N9DA 2GVGA 4FLRA 4O0QA 3VUPA 1NEYA 3TN4A 5GJMA 3BGGA 2XH7A 1V0MA 3G2GA 1D3GA 1HL9A 4CNPA 1ZJBA 3DOPA 2WLZA 2H6RA 3WH9A 1H5VA 3SSZA 1HJXA 2ZE3A 3GNXA 1NIUA 2DZAA 1UWAA 4KEUA 4O8AA 4LVFA 3FS2A 5HQMA 1GVFA 3PAOA 1O4UA 1ODZA 3ORWA 5A2BA 4F2TA 3AROA 4MB1A 3QQ1A 4GIYA 2DFAA 2XFYA 4XD3A 3MI6A 3HURA 1BAGA 2YXXA 1PZ3A 3B8IA 4NQ1A 5IHSA 3AWNA 3S9YA 4E4PA 2ZA2A 3SECA 4PEEA 1E9LA 4FX8A 1OCBA 1S5TA 1ZRQA 2PWDA 5CAHA 2E4TA 5AYIA 4KRUA 4YTTA 5I7GA 1F61A 1N8WA 3C56A 1Q6DA 2VWTA 4QJ1A 3LNPA 3AS1A 5KZDA 1RAKA 3C2FA 3H26A 3W27A 3EX1A 3E3HA 3LXBA 1T96A 4ZB2A 4LUSB 2FJKA 1QWKA 4NZ1A 1EJ7L 5DF0A 5A8GA 4H2HA 4IGMA 3S2LA 4ONVA 1DWFM 1J5SA 3EWBX 4PTMA 1O1HA 4OKDA 3HGJA 4HK5A 1Q5MA 2Q02A 3OQ8A 3W2KA 1VFUA 3JZUA 3ZVIA 4KCWA 5A2CA 4GJJA 5AY7A 3BCFA 3GHSA 3RM4A 3FOKA 9XIAA 2VEPA 1SM9A 2HCVA 1TVNA 4HA0A 4DYJA 2VTFA 4TR9A 2OMAA 1F6YA 2GUUA 3C86A 4BF9A 2OT1A 2QUTA 3M07A 2JF6A 2PFHA 1EJVC 2Y5EA 2DZPA 3BAYA 4U4MA 3P5ZA 2P3ZA 2YW4A 3VKBA 5I03A 3MU7A 4GI9A 5G2IA 1MQQA 1QAPA 3N9RA 1F73A 1Y8BA 3SY1A 2OEKA 4MG4A 3LTSA 1PYFA 3QC3A 1HVXA 1KGWA 2VFEA 3RHGA 3G18A 4JIPA 2A2IA 1TO3A 3NQEA 4W8AA 3INPA 4N9BA 1Q63A 4X0NA 1W1IE 3TN3A 1B1YA 2ONEA 3VNDA 1DJGA 4QP0A 1CEOA 4KT2A 3OHMB 4Y9PA 3R8RA 4L9ZA 2QJHA 5K4ZA 1CGVA 1TPUA 1TPVA 3A13A 2GUBA 2PC4A 4RW3A 5EMUA 2W27A 3GXIA 1UHVA 4Q8PA 1EDTA 4NNBA 4XZWA 3EOEA 3YPIA 1A3WA 2WXDM 3FA5A 1GUVA 2A4AA 5C71A 2XHYA 4J9JA 2QV4A 4HHMA 2ZDSA 3AXHA 3FGCA 1EWDA 3VNLA 2VHLA 1W6TA 1O68A 2G4JA 3HV8A 3RRAA 3GXMA 1LOSA 3OA3A 4JL1A 4XWUA 3EKGA 1KXHA 1GJWA 1QHZA 2B0MA 5I3GA 4YTUA 1RLCL 4AF0A 2WQDA 4WVXA 3NSXA 1DWJM 1H1ZA 3LCGA 3TYAA 4UMCA 5AOUA 1OC6A 3CZEA 2IUZA 3ZVHB 1MZHA 2F61A 1R2RA 8XIMA 5A2AA 1DJXA 5FEPA 1Y0EA 1JNDA 4UCGA 2IPWA 1QK0A 4LAOA 5I00A 3I4EA 3GM8A 1ADOA 3T1GA 4C1NA 2E9MA 2VC6A 1XPYA 1ELSA 4ZVJA 1RJRA 1BF6A 1NWTA 1KXVA 2FLIA 3QQWA 3LPOA 4IPIA 4RV3A 1BLIA 1ZHAA 2BGNE 2GJXA 1VIZA 3BOFA 1UR9A 3H7RA 2JK2A 2HSAA 4GXMA 4O4WA 1GONA 3CO4A 2WCGA 5TAOA 1VB9A 3WLSA 5AZ0A 2GVEA 3EPOA 3TROA 3MBDA 2VYOA 3NGJA 1KV5A 4R9OA 3B04A 4DJDD 1UMLA 5M5DA 3N6HA 4GKTA 3GDLA 1IZKA 3SBFA 3NZQA 1MUCA 1XGZA 1FOBA 2XGIA 4GO8A 3L66A 5HUPA 4WK9A 4TVDA 3A21A 4ZB5A 1TPC1 1DXFA 4F48A 1TVPA 1LWHA 4JEJA 1NF7A 1B3ZA 3SEPA 4H9XA 1YTDA 5E9AA 4C6JA 3LGDA 3U5UA 4C1LA 1EZ2A 4N6FA 1B4EA 4J27A 4GY7A 1U22A 2INZA 1EB3A 4XK2A 1A5UA 3GW0A 5HNNA 3UBPC 1JCXA 3MHFA 3T9PA 1GVYA 4TV6A 1EGZA 2X1TA 4N0RA 4AHQA 3SCUA 2NV9A 1XCWA 2VJXA 3NQMA 3VKJA 4O53A 1T8XA 5CGMA 1HGWA 2TSYA 4CLMA 4WCJA 2E7FA 4PB5A 3NPWA 2Y63A 4H9UA 2YB4A 4J3WA 3A12A 4XIMA 4GI8A 3AIWA 3GBDA 3CIVA 3MP3A 2XIOA 3G3MA 3GO2A 1Z44A 2QCNA 3WLRA 2C8NA 4JYFA 3HFTA 1A5AA 2OEMA 4JFWA 4CN1A 1UKOA 2Z1VA 3GE7A 3JVAA 4V28A 1J8VA 5ECUA 3R7MA 3U8GA 2ZX5A 3L0GA 5DT7A 1YKWA 1DKWA 2PDPA 2ZZ1A 3CPUA 3SCRA 4MTVA 3B8TA 1I4NA 1DE6A 4RXFA 3GG8A 2FFIA 2FPYA 1XSJA 2I17A 1T8QA 2ZRUA 3SCOA 1X1NA 2XZ9A 3EXSA 3M1ZA 2D0HA 4NIRA 1SR9A 1FH7A 1XUZA 2QCHA 2NX3A 1Y5VA 3N2TA 4MDPA 4E2VA 1R0MA 2PTDA 2QF8A 4G7EA 4JKLA 1G6CA 2IKGA 1ZJAA 1WOBA 2RDUA 3MJMA 4NZ5A 3PZTA 3A22A 2GGEA 1O5QA 3WNNA 4AIEA 1YNYA 4F2UA 4F40A 2ISDA 4JQ4A 1GG0A 1R7OA 1EBHA 3LHTA 3PN8A 4G7FA 3QZEA 5ECVA 1OFDA 1UC5A 4NZ3A 3G3DA 3PBMA 2VC5A 1B5TA 3WKZA 3ZLGA 3ZWSA 2DT2A 3BQ5A 2TRSA 5AECA 4AMCA 3RX3A 5G2WA 4N9EA 3TAOA 3NVTA 1JCTA 3QGKC 3VTRA 3EA1A 1KWKA 4IG2B 7XIMA 2Q09A 3TSMA 2CLHA 4S3FA 2CLIA 2HVMA 3WMSA 4C60A 3UU0A 3MHGA 4O13A 3P0XA 2DPEA 1JZ7A 1Q6RA 4MJMA 1XH2A 4IGNA 3GU2A 3A4XA 3ITOA 1MEHA 3AALA 3JRKA 5JXQA 3NYDA 1SSGA 4AZGA 1E51A 3TU9A 2WPBA 3B4YA 3WLPA 2OU4A 2DORA 3MC5A 3NO5A 3OODA 1W3KA 2Y2WA 1LZOA 3NXLA 3OYZA 3NZRA 1XF0A 2YCLA 4M51A 3EX4A 4O17A 3MT1A 3L4XA 2WC4A 5A6BD 6A3HA 3ZIZA 3S5SA 1UB3A 4U10A 2Y7EA 1JCNA 3ZJ6A 3AIQA 5BZAA 5KZMA 4GYPA 4OE7A 4JDYA 1KCXA 2P3EA 1SSDA 2FYMA 4L6OA 3VFCA 3DYPA 1Z7AA 4C6CA 5LZLA 2OODA 4HZ6A 6TIMA 3G8EA 2BY2A 1XINA 5A6AA 3A5VA 1XG4A 3UXAA 4GXPA 1QO2A 1EYWA 5CH9A 2OWCA 1LDCA 2GGIA 1C9WA 2P53A 1V0NA 2VELA 1D3CA 5FKYA 2YCJA 4BY3A 3SDOA 3FGCB 1VH7A 4NYUA 2ESCA 2VDHA 3P0WA 1MMFA 5JBFA 1XRFA 2WWDA 1DWHM 3W86A 3NQFA 5I3IA 1JCMP 1LORA 3F2CA 3TW6A 3B8VA 1TV5A 1GEQA 1C3FA 2PF8A 3L9CA 7TAAA 3WENA 3R12A 5AB3A 2EG7A 1DIDA 3VA8A 3FXYA 2OCZA 3GSMA 5C7VA 3HQNA 3PSWA 4BS0A 3V18A 3M0KA 2P0OA 3PAJA 2OGYA 1F7BA 3ONCA 1H1NA 3KZSA 1UMYA 2O9RA 3N4AA 2CU0A 4C1NB 2FFCA 3GH5A 4O54A 2Z1KA 2VNCA 4H9YA 1HKJA 2BVDA 5A8PA 1OT1A 3U48A 3VIGA 3B05A 4NZFA 4PCNA 1ADDA 3UXKA 2VEFA 3W2MA 2SFPA 1OF8A 1GQIA 1X39A 2XVKA 1MNZA 2WSKA 3TZNA 3MUCA 1P0BA 2Y7GA 1P43A 1XLMA 5AHFA 5LYRA 5BU9A 1FQ0A 1V08A 5FJTA 4BF5A 3ZOAA 3GIYA 4YCPA 4A8RA 4DUXA 4DRSA 1XKYA 4OUIA 2QF7A 2Q3RA 4HPHA 1F3WA 4INFA 3IVSA 3FDGA 1UYQA 3N11A 4M81A 2P76A 3DAQA 1WO2A 3MKKA 1HUVA 2UZ9A 3T6CA 1HP4A 2DZWA 5IDIA 1X96A 1FXPA 2X0SA 1FWAC 1TV3A 5MKGA 1JQVA 4GACA 2WLYA 3OB8A 1GVQA 2XGBA 5E70A 2A6NA 3SQSA 2VRKA 5FCZA 4HU0A 5I23A 3PZUA 4HN4A 2FQIA 3G1XA 1KFEA 1QBBA 3E02A 4ZR8A 2CWXA 3ZJ8A 4MGGA 1FKWA 2EPOA 1FDJA 2OYMA 3LG3A 3W02A 5DLCA 1PTAA 3DG3A 3HA1A 1ADSA 3S5ZA 2I57A 4YHEA 3TK7A 4EVZA 3EWCA 3WELA 3P3BA 1TPH1 1B4KA 1MO0A 5FF0A 3CEUA 1J2BA 3NZGA 4J3SA 4EWJA 1X7IA 1CGXA 3HGRA 3W88A 2OEJA 2YBVA 1KQYA 4RZ6A 3HFYA 1KFLA 1QOXA 1XGDA 1W3TA 3LGEA 1C91A 3DI0A 3EOOA 3PVFA 1MQRA 1XXXA 1XCFA 3W1QA 5XINA 3UJEA 1E0WA 4HYWA 1ZFJA 4DO6A 4LYRA 1WV2A 4PN2A 4Q22A 4NXKA 1PZ2A 1Y5WA 5J04A 3N18A 4S3JA 3CYJA 1K03A 1P0DA 3O05A 5E0CA 3B9DA 2XWEA 2QKFA 5C9ZA 2OX4A 3TH6A 5BXSA 4O28A 4IMDA 1L6GA 4G1KA 4W85A 2QDDA 2FTYA 2QULA 2DZVA 2C0HA 1FWSA 1FCQA 2RJGA 3PJTA 5D37A 2F9RA 3WD0A 1PHWA 3EMQA 4RXGA 1IXQA 1YEYA 1K77A 2AQVA 1JI2A 2WKLA 1SUXA 4JHZA 2HWGA 1R47A 2Z00A 3KCJA 3FJNA 3TR9A 3UWUA 4OVXA 4Q8OA 4IL0A 3FX4A 4O57A 4NVTA 4ZE5A 1NJJA 3PBUA 2DP3A 2PCEA 2YYUA 2D0FA 2JEQA 2CLKA 3QV7A 3T05A 3M0JA 1Z9AA 3GU9A 3TQKA 1JUKA 4J2PA 3T2QA 1W8GA 4ZEPA 3MSDA 4XD6A 4NG3A 4OOUA 3VILA 4YVXA 3SR7A 4EACA 1EA0A 4KMQA 2AAMA 1REQB 2ACUA 4W7UA 1BVWA 3PS7A 3I3DA 5AKQA 3DFNA 2OXNA 3DESA 4PSPA 3M64A 4Q8NA 3DKJA 2IKIA 3R8GA 1W9XA 1ME8A 3MHUA 1IF2A 2J7CA 3SO7A 1XC4A 2XWDA 4FPSA 5TF0A 3PNUA 4WXYA 3SRHA 3EEZA 3OLGA 4PTDA 2GJLA 1DJZA 2WW5A 1EX1A 1XKJA 4C6NA 2JKEA 3LBOA 5C9XA 3D47A 1PAMA 4Q7NA 2Z0IA 3M5XA 2PI6A 1IV8A 3KRZA 4IUGA 2ZX7A 1V7AA 5FL1A 3OQEA 2V69A 3S47A 2EGZA 2XM2A 4LVAA 1DBTA 1EJWC 4IICA 4ZO8A 1JYXA 2G95A 3N3TA 1N8FA 3HGOA 2GQ3A 3SB0A 1LQAA 1YXCA 3WK2A 2OFJA 5M2FX 2OZ0A 3LZ3A 4H9TA 2X1UA 1XD0A 4MWAE 2WHJA 3GXFA 1GYMA 3TYEA 2BTMA 4N9CA 1P1MA 1VEPA 1XIMA 2PDUA 3UW6A 3AHZA 4CGTA 3JS3A 3AYRA 2I14A 1DWAM 1GQKA 4QDPA 4Z1AA 2Z2BA 3UJ2A 3NQBA 2WZHA 1PKLA 1PX4A 3VIFA 2PP3A 3GC2A 1KRMA 1NFBA 3DFHA 2R14A 1XWYA 3FEQA 2VFFA 1PWMA 2GOKA 3ARPA 2H3BA 4XZNX 1VYRA 3ZSSA 2BBFA 3VDBA 3KL3A 3KBVA 3FYYA 3N73A 3FA4A 3UCCA 3BJFA 3H6OA 1ZL1A 1PCKA 4K36A 4B2DD 1AMKA 4KFNA 3NOEA 2DDXA 2QCCA 1Q7QA 2OOFA 1KBKA 1IEXA 3PG9A 1SJCA 2QCDA 3W1AA 2ZTJA 3CB8A 1AQ0A 5TBOA 1EYEA 1IZCA 5A95A 2ZFAA 2YX0A 4B4HA 2EPKX 3IEBA 4QEEA 1QBAA 1K8CA 4FXRA 3G0UA 3DFQA 2R1KA 3MCNA 2WM0A 4ENLA 3U2CA 1W2VA 3N1AA 2V5BA 4M6UA 3VM7A 4Q4OA 4BEQA 4DPPA 3DG7A 1J6OA 2OLAA 1NP0A 1FVPA 3CTTA 4FLOA 1AQFA 4XBKA 1EXBA 1C90A 1J01A 1W1PA 1ZS2A 4ZSTA 4GLEA 1HKKA 2CLPA 5D32A 4TUFA 3NPXA 1QO5A 3CUFA 4O50A 2DUAA 3UT0A 3ZO9A 3HU7A 1UR3M 1MW0A 4LBUA 3CZJA 3W70A 4O1BA 4Q8UA 1W91A 1HKIA 1RH9A 3T2PA 2J9YA 3CGTA 3M4HA 1Q13A 3ZQ9A 4IGHA 4MZ1A 4TX9A 1XG3A 2PSNA 3PANA 3OLDA 2ATMA 2XGZA 2HK1A 5LHFA 2V8ZA 3FKKA 4FNRA 4GQRA 1U2YA 3KZPA 3K13A 3OVPA 4RE4A