3QVQA

The structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
251
structure length
251
Chain Sequence
GMQSAYSFLPQVIAHRGSSGQAPENTLASLHLAGQQGIKWVEIDVMLSGDGIPVIFHDDYLSRTTDGDGLIYKTPLAELKQLDAGSWKGQEYQQETIPTLLEAIEVISQYGMGLNLELKPCEGLEEETIAASVEVLKQHWPQDLPLLFSSFNYFALVSAKALWPEIARGYNVSAIPSAWQERLEHLDCAGLHIHQSFFDVQQVSDIKAAGYKVLAFTINDESLALKLYNQGLDAVFSDYPQKIQSAIDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphodiesterase Olei02445
publication title The structure of an Oleispira antarctica phosphodiesterase OLEI02445 in complex with the product sn-glycerol-3-phosphate
rcsb
source organism Oleispira antarctica
total genus 96
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.2: Glycerophosphocholine phosphodiesterase.
pdb deposition date 2011-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3qvqA00
3RLGA 1DJYA 3H4WA 2PLCA 1DJGA 4RW5A 1PTDA 3L12A 4F2TA 5T9BG 1DJZA 1QATA 4S3GA 2OR2A 4QJ4B 5T9CE 4F2BA 4QJ3B 2O55A 3KS6A 3V18A 3OHMB 1T8QA 2ISDA 4I8YA 4I9TA 3H4XA 2P76A 1QASA 1YDYA 7PTDA 3I10A 5T91A 3QR1A 1ZCCA 1V8EA 2OOGA 1AODA 4I90A 4OECA 4R7OA 3EA1A 1T6MA 1DJXA 3NO3A 6PTDA 4I9MA 2FJUB 4GNKB 1PTGA 4I9JA 4F2UA 2OTDA 4RV3A 2PZ0A 3KS5A 3RLHA 3PTDA 4RW3A 1DJIA 3CH0A 2PTDA 2F9RA 1DJHA 3QVQA 1GYMA 3EA2A 2ZKMX 3EA3A 4QJ5B 5PTDA 3V16A 1VD6A 3V1HA 3MZ2A 1DJWA 4PTDA 4Q6XA 1O1ZA 3QR0A 1XX1A
chains in the Genus database with same CATH superfamily
1WPCA 1F61A 4JNYA 3G5EA 5CAKA 4JGDA 3MUCA 3PZMA 2R6OA 3J7HA 3WEOA 4Z1BA 2DZPA 3U2OA 3MCMA 1P6WA 1E9LA 2VWSA 4E6MA 2YYTA 4WOQA 3N9KA 2J78A 4DELA 3M0LA 2D0HA 2NX1A 3MZNA 7XIMA 4Q33A 1XQKA 3LCIA 3BW4A 4JIIX 5AYXA 1TMQA 3B9AA 3PZNA 1IIGA 4JHOA 4JYDA 3V7PA 2P76A 1ADSA 2OEJA 1C9WA 2ZRVA 1M68A 2V5CA 3B0UX 1MO0A 3GFXA 1IEQA 1XKJA 1YNYA 1IEXA 3WLHA 2ZUMA 5LA1A 1HP5A 2XFYA 1AQ0A 1V3HA 1IWAA 4JQ2A 4C6FA 1HL9A 2FGLA 1JAEA 1SUXA 1EIBA 2PUZA 4H00A 4IFKA 1AUSL 4HBKA 4C6EA 1PVNA 2PDJA 1NSJA 3E0VA 4U10A 2J8FA 1QBBA 2GVJA 4ROPA 4DY1A 1RPKA 1TB3A 3GNNA 2IQTA 4XBJA 4C1NB 4LRTA 2PTWA 1NELA 4L4LA 4NG3A 3L4XA 1ONXA 3QQ0A 3OIXA 3OIHA 1V08A 4H41A 2VDGA 2JF6A 1A3HA 1L6SA 5DT7A 1JCJA 1OWQA 3VMOA 2VD9A 2RFGA 2XSBA 3BQ5A 3QH2A 4A4AA 3WMBA 3H24A 3IIPA 3LTSA 3Q37A 3CAWA 4HMCA 4PUDA 4DN1A 4Y2WA 3E96A 4KKXA 4H6EA 5EPDA 1LRQA 1UIOA 4WXZA 5EB8A 4Q4SA 1UR4A 4PBGA 2GJNA 3K13A 5CEWA 4QGCA 4ZQNA 3CUFA 2P3ZA 2QW5A 1EUAA 5HWMA 1CTNA 3WH9A 1RBLA 4LC6A 4GGBA 1JDFA 2CXGA 5CZ0A 3A9IA 1XH0A 3WK2A 4AQLA 2UV8G 2CHNA 1XBXA 3OYXA 1ECQA 2X40A 3UY7A 2DZWA 4JTRA 1C7TA 3QR1A 4WDUA 1UMLA 2VZSA 1AQHA 1BWVA 1VAHA 3E49A 2O9TA 1W1VA 3TFXA 3AS1A 5I03A 1I2OA 4Z0JA 4BY3A 2QEZA 3AS3A 2J77A 4K7YA 5HJLA 3WD2A 3GNXA 3GTIA 4NYYA 4PB4A 3CAVA 1GOKA 5AZ1A 4V1XA 1YDNA 4IWWA 1OIMA 4ROQA 1FCVA 2XGZA 3VABA 1ITUA 3QTGA 3REQA 3KWSA 1T41A 4IFKB 3ENLA 4PUUA 1U1UA 4A3UA 3C2FA 4AXNA 1DJHA 2RUSA 3ABZA 2VGIA 1RUSA 3GWQA 3ITOA 1Q85A 5JH2A 3K8LA 4JIRA 5CGMA 4PMVA 3QN3A 4E38A 3A9BA 1HQTA 1MUMA 5I2UA 2FB2A 4XZLX 4GZ7A 2AQOA 4EE9A 3SJNA 1ODZA 2G3FA 4M82A 1O1ZA 1F74A 2WZHA 4QRNA 1G4EA 1UBPC 3I6TA 3OVRA 3SCUA 1K7XA 4WDXA 2PZNA 3HBLA 3NL2A 3UCQA 5KTLA 3ARXA 3W7JA 4BFAA 1FDJA 2NW0A 1NQKA 3S46A 3W85A 2PODA 5T9CE 1TKKA 2NT0A 4R33A 4GO9A 4D6IA 3L5MA 1UROA 4WDWA 1IXOA 3RAOA 2HVMA 2J9YA 1GVSA 1MXDA 1HKWA 1KKRA 3A22A 4WKHA 2GL5A 3ZFHA 1KA9F 5TQLA 3WN6A 4HGXA 6ENLA 1UZDA 4HZ7A 3DFOA 3M16A 1XUUA 4R53A 3UWYA 1DORA 1XHGA 3QJAA 4L1GA 2WCAA 3LK6A 2SFPA 4O19A 3LQGA 1QMLA 4AEOA 1KFKA 3E5BA 1LQ2A 1SJDA 3B0XA 3WLPA 4DLMA 1PAMA 1GJUA 1TJPA 1D3CA 1NFGA 2ADAA 1OT2A 1CLVA 4JIPA 1PYMA 3FSUA 3GB6A 1XLDA 1J79A 2IKGA 4GUHA 1IXPA 3GXMA 4Q6XA 1ML1A 1OBAA 3N2TA 1XG4A 1E6PA 3REQB 3RO8A 2E8ZA 1B57A 2ZZ2A 3R89A 2GVEA 2GOKA 3RX4A 3A4XA 2NVDA 1BKHA 3B4YA 3NQ6A 1NH6A 1J18A 2HE5A 4HJWA 3BMXA 3UG5A 1W9DM 2ON3A 2BZNA 2YKKA 2C1GA 4I7VA 3NEHA 1YHTA 4NNCA 4C6CA 3IAPA 4G1KA 3IJIA 3PTKA 1X6UA 4I3GA 3LM7A 6TAAA 2DUXA 1KFCA 4D1JA 1BAGA 3I10A 2YB4A 4HNOA 5E70A 4ATDA 2OG9A 3VNZA 3GUWA 2D23A 5IBXA 4J3WA 4XB3A 2XISA 2VFHA 1VR6A 1S2VA 1F3TA 3GFYA 2YCIX 4KFOA 3VC6A 1Q13A 4EXAA 5I24A 3FYOA 5BRBA 1CYGA 3SEPA 1PS9A 4IOTA 5LSMA 4O14A 1MRAA 5K9CA 3K5XA 3CHCA 5FAJA 4GA8A 3H4GA 4AD5A 4HYVA 1EJRC 5CPLA 4CQ9A 4QTGA 2VEIA 3CWOX 5FJPA 2V81A 1E40A 3LNMA 4D71A 1S5MA 1SGJA 3KWXA 4PBFA 3UWVA 3VD5A 3OU8A 3EWDA 3NQGA 2QCNA 4PTDA 4RDWA 3STGA 3L4WA 4OUEA 3TV8A 5JBDA 4MB4A 1E9ZB 4XVEA 3UYCA 1VBRA 3VDAA 2C3ZA 4AVFA 4LUSA 3SURA 2CLOA 4JTGA 1C8YA 4QP0A 4GC4A 3BAWA 2OELA 3W6YA 1RCQA 5A6SA 4TQTA 4GZEA 2E6AA 2G37A 1J2WA 4UTTC 1MZRA 3S9YA 1VFUA 2FZMA 3NYDA 2R1LA 1VJIA 2PU0A 1WYIA 4AH7A 2UBPC 1R8LA 4UZSA 3G1VA 2XN1A 3EWWA 3LG3A 2A3HA 1DJNA 4WGHA 2V63A 4D8LA 4PYSA 3UXIA 1EF2A 1TTPA 1JJKA 2CC0A 3VFCA 2I57A 5ECUA 2WSQA 1GKPA 1O6IA 3UWWA 3EXTA 2HEJA 3UWEA 2OEKA 3GVQA 4J4KA 4LAMA 4DZIA 3QLLA 3TMLA 4AD1A 5FL1A 2I14A 5HJXA 3EEGA 1VBUA 4S2BA 3UJSA 3CBWA 2GDVA 5LIUX 1BSIA 4GXMA 4PUNA 1VYRA 2DP3A 1TJ2A 2BSLA 3LSBA 2OU4A 1HJXA 3C86A 1HKKA 3UPBA 3MWCA 4FO4A 1M41A 3WK1A 1QOPA 1A5UA 3GG8A 3GG7A 2P5NA 5DY3A 4UMCA 1XYCA 5D8ZA 1TZ9A 2OCZA 4XAPA 5DY2A 1J93A 4O57A 5C9XA 1MDRA 3TC3A 2YYUA 4ZR8A 3TK7A 3TSDA 4ICCX 2Y7GA 2PLCA 1WO2A 4KERA 4KWOA 4S1FA 2DY3A 2J79A 5A8GA 3U48A 3I6EA 2F6XA 1HT6A 1H7OA 1E71M 1LQAA 1K3UA 4CQBA 1EHNA 2E67A 2VVNA 2D2JA 2C1IA 2WAGA 7PTDA 4LUSB 3SUUA 3W2LA 3ZM8A 1GWJA 4IF2A 1XLFA 2QKFA 4JYEA 4JTHA 3CUIA 1FWBC 3G0SA 3ZS4A 2WKGA 4HCLA 2CBJA 3UF9A 1BWLA 4QLKA 4TVDA 3N2CA 3RGTA 3KDOA 5DO8A 4Q7IA 4NJIA 2PFHA 3O8AA 2PGFA 3UQNA 4CNPA 3G1DA 2I5GA 3AQUA 4MF4A 1UIPA 1VIWA 3AC0A 4PEKA 4ZQMA 3VIPA 4DJFD 3CPRA 1G7UA 5D37A 3TZFA 4TMBA 4V27A 5BWAA 2C0HA 4NYUA 1A0EA 3SBFA 1GQNA 4JTJA 1IEIA 1ENUA 1LYXA 1JPKA 1CLXA 4HA0A 4J27A 2YPIA 3KCOA 1QWKA 1OEPA 3CZ8A 1Q63A 1D2KA 1OZQA 3AICA 3W81A 3GX9A 2A0NA 3IVTA 3UR5A 3GDKA 4WXYA 3EMZA 4OIFA 4Q8QA 1AMYA 2V8ZA 4KT2A 4KIEA 1RY8A 1W1ZA 2WNQA 4C5YA 4OBTA 4MZ8A 5LNSA 1EWDA 1ZUAX 3QHNA 2A6LA 2O92A 2WPGA 3WL0A 5LNUA 4KBXA 2DH3A 5A2CA 4M3PA 2VC7A 1JXKA 4MKVA 3GH7A 5GQBA 3KW3A 1UP2A 4IMEA 4IQEA 1LT8A 3JZUA 1JQXA 3QKEA 3UT0A 1UCWA 5CBJA 3BV4A 4FLRA 3AS2A 4XUGA 3LUTA 3NQFA 3QMSA 4C1KA 3OA3A 1TCDA 3S6TA 3M0IA 1L6FA 2C19A 5HDRA 4L4OA 3PY2A 1GHRA 3IJ7A 2PCQA 3CV2A 2D3NA 3CPUA 3HMJG 1H51A 5LHEA 3THAA 1M1BA 1ZENA 1AW2A 3L0NA 4REQA 3ZMRA 3H6OA 2JK2A 1KM1A 2PP1A 4WR3A 3SN0A 2J7HA 3BGJA 1EJTC 3NQAA 4LRSA 5REQA 1JCLA 3UESA 2EEXA 1XLJA 1PHWA 3SCQA 5IM51 2GFTA 1O7AA 3D46A 5H1WA 4NNAA 1PHQA 2DSVA 4GVIA 3EWXA 4YTRA 3CZLA 3WEZA 1W54A 4IJRA 4EANA 4IIHA 4H8VA 4LT9A 2GGGA 3T0TA 1POJA 1ELSA 2WMFA 2PPGA 1UD8A 4N9BA 5CZJA 1KC7A 2OLHA 4I6VA 5FF7A 3VNIA 1G01A 1QJWA 4H8UA 5D9PA 3O63A 1I0BA 2F2HA 1ISXA 5HOSA 1A80A 2O56A 1K9FA 4CKQA 2WVUA 1O68A 2J9XA 3D5HA 4NT0A 3DENA 1F8MA 2Z7KA 1QO5A 1G4PA 2GDUA 3KBSA 4H9VA 2HK0A 3T07A 3HG5A 4K68A 3AMKA 4ADSA 2QDHA 4MJ4A 2QIWA 1HVXA 2J8TA 3W2UA 5M5DA 3ARPA 4M6VA 1M01A 4YVVA 1Q8AA 2ZOXA 3W07A 4MY8A 2GPTA 3QHOA 3WF3A 4QM1A 4Q22A 2PS2A 2HBXA 4UTWA 1MUCA 2PDCA 1W0MA 4JICA 2GUBA 3RLVA 2RKXA 1MW2A 5DLCA 3AWNA 1C90A 2UY2A 1R9YA 4JTCA 4REQB 3SQLA 1BQGA 1RHCA 4MVAA 2QULA 3T4CA 3EZ4A 3AS0A 1UOZA 4V28A 1XIDA 3QTPA 5F2MA 4W89A 4Y8EA 3WDQA 2FHBA 4IMAA 4O1BA 5REQB 3VMPA 2DT2A 4DBEA 3MMTA 4HK6A 2IS7A 4PTWA 4AU0A 1KRBC 1PV8A 1Q3NA 2CXEA 1UOKA 4XD6A 3QQWA 4AAJA 4O11A 2DQXA 1OGGA 4PUMA 4LBRA 3T4WA 3ALFA 4GKLA 1S3TC 5A8MA 3FFSA 1ZBVA 1JF6A 4UFHA 2GUUA 1V5XA 3GQYA 4LUTA 3NO5A 2ZUTA 1O4UA 3L0GA 3DI1A 1GPFA 4B5VA 3PTDA 3JW7A 3HB9A 2PF8A 5JH1A 3N11A 4O0ZA 4WKFA 2V38A 3W1NA 3W86A 2PDGA 4EPDC 1V0MA 4XZ9A 4QJ1A 1I2QA 1XH1A 4EP8C 2QQ6A 5I3HA 4DPPA 1JCXA 1LOQA 5G4EA 3UR8A 4Z2LA 3B8UA 1A5MC 4Q8TA 3N17A 3DYPA 4DYKA 1D9EA 2VEKA 4LOCA 1XLMA 1XX1A 2JF7A 3M7WA 4O50A 1BEUA 3G0XA 5K9XA 2V30A 3UP8A 1ZBKA 3O6YX 3EOSA 4KEZA 4S3GA 4PN2A 1ZRQA 2QR6A 4MKNA 5KINA 1CW2A 3AAMA 3GU2A 3LN3A 3RMJA 1LQ0A 3MJYA 4JYFA 3K2GA 4ZMGA 1J0YA 4EF9A 3CB8A 1TA3A 1HZYA 1J6OA 4OFCA 1QRQA 2ZC8A 1MQPA 3W00A 1Y8BA 4AVNA 4YMZA 1BVZA 4M1RA 2XFWA 4C1LA 3V75A 3B4UA 2XZ7A 3RFAA 2PDXA 3ZT7A 1IGWA 4JL2A 4ECLA 1GVFA 1E0UA 1UWQA 3VGFA 2F9RA 2CBIA 1A4LA 2YGYA 3WUBA 3DG3A 3FKRA 4C5ZA 3V35A 1RD5A 4MM1A 3OGVA 1XWYA 3A3WA 4J35A 3DFPA 4P7NA 5G2HA 3H55A 5AECA 3F7JA 3CL6A 1PBGA 4P7QA 1A5OC 5BWFA 3LHWA 4IP5A 1DP0A 1TPEA 1O12A 5AC6A 4N6FA 2EF9A 3TCEA 3WF1A 4AWSA 4FR1A 1KFJA 3DFNA 3VNYA 1QNVA 3LCLA 2XZ9A 3N6JA 4IX2A 4KGLA 3W1QA 4IPNB 2HDJA 2V6AA 1WB0A 3UBPC 2EJAA 3IIVA 4MUPA 5T26A 1QVBA 5EFDA 1H09A 3DFYA 2HV5A 2J7CA 3ZXWA 2BY1A 3E3HA 4GJIA 3UERA 2X1IA 3UXDA 3BG9A 1V4YA 4L64A 4GO8A 2QCCA 2HE8A 2VELA 2OZ3A 3G1RA 3T1GA 1O66A 3JR2A 2VGBA 1OX6A 5HNNA 2EPHA 2XUCA 1WAUA 3S47A 3QPYA 1T5AA 3QYSA 2W92A 2GLKA 3EWZA 3UGRA 3LD5A 1EWEA 1WOBA 4UFKA 2D22A 3MUY1 4KRTA 1DJQA 3HG2A 1TCMA 4UQDA 1YXCA 3THCA 1M7OA 4CNNA 1T8XA 1ISVA 1FBAA 3GTFA 2PSNA 1JULA 3TTYA 1E51A 3EWBX 4EWND 3PPCA 5M03A 3O6CA 2UZ9A 1L2QA 4NJGA 2B0MA 4X3ZA 3WNLA 4N42A 3RPDA 7TIMA 3ABXA 3SGUA 2W3ZA 4C6JA 3VILA 5C54A 5CXPA 1CNVA 3STFA 2DSKA 1U5HA 2DSWA 3SGGA 1RQHA 3LENA 3N4FA 4PMZA 4LX4A 1UP0A 1XIHA 4ICNA 1PZ0A 2DQWA 2PU1A 5IHSA 1U1JA 3GHUA 3P8IA 4G6CA 1AJ0A 5K7JA 3S1VA 4MFDA 1Z3NA 1XINA 1KBBA 2EO7A 1A49A 3DESA 1NP0A 1L6YA 4JNZA 3UA4A 2OX4A 3HFYA 2VGFA 2ZUWA 1ZP4A 3RMEA 4E2BA 4NY2A 1BSLA 2NX9A 2I56A 3WLMA 2J13A 4B91A 1PX3A 2PBGA 4GI4A 2E6YA 4RXGA 3IIOA 2ZE0A 5FJOA 5A6AA 4D72A 1DTNA 1OJXA 3L4ZA 1YW1A 3IGUA 1NOUA 1TPFA 4BI5A 1KR1A 5AY7A 1LWJA 1SR9A 1ZSXA 1LTDA 2RHGA 3H26A 4OBSA 1DKWA 4CGTA 3WF2A 8TIMA 4AZCA 1NAL1 5BOFA 3WZ0E 1OG0A 3KCLA 1ZB5A 3AJXA 1JGMA 4A3HA 1KB3A 1G4SA 2JGYA 3PSWA 4JTUA 4JFSA 1RVGA 3FW6A 3GKFA 2ACUA 1TPB1 1PSCA 2R1MA 4MB5A 1W1IE 2DGAA 5DMMA 3PWIA 3N25A 1VZWA 3B0PA 3PNZA 1XD1A 1NDVA 1LLOA 5DELA 1VCVA 2PLKA 2O9OA 3B8SA 5A6BD 1JNDA 2ATSA 3K30A 3BARA 1E9YB 2Q8XA 4GUJA 4OGZA 2PDKA 1OFBA 1QNRA 1SJCA 1JUKA 3O15A 1M53A 4AISA 2XM1A 5KZEA 2WVTA 1K9TA 4Z2IA 3JUGA 2Y88A 3AIVA 1SYTA 3P0XA 3S6OA 2PRLA 3MA8A 5H91A 3N18A 1HN1A 1XC6A 1UPMB 2PDUA 5M3WA 2WOQA 3M0HA 4XISA 1RBAA 4WD0A 3MV01 4YL2A 2VT0A 1RCOB 2BBFA 4MFEA 1J01A 2PTYA 4ML4A 4RZBA 3BK0A 4GYPA 1YXYA 4JTQA 3WH5A 2I1OA 3S2NA 1Q6QA 4U3CA 1XFCA 5MHBA 1DOSA 3IAQA 4DJFA 1QK0A 4RNJA 3N6HA 5D9NA 3WMCA 2G96A 3AJ7A 3VOJA 3RCYA 4FXFA 4QAIA 3CQHA 5C5YA 3O1NA 3OQEA 4MWAC 2A6NA 1UJQA 5CJNA 4TMCA 4NP7A 3W75A 4GY0A 2D69A 4U2ZA 1W8GA 3V18A 3LX9A 3TYCA 3EXSA 1VEMA 4HU8A 2OZ8A 1GOIA 4AZCB 1EYEA 3W7LA 4Q4PA 1KV8A 5SWUA 1VQTA 4GRSA 4M81A 4XTDA 3NAVA 3E0WA 1V6XA 1GONA 1V8EA 3NCOA 1SJBA 1GZGA 2BOGX 2OOFA 2BDQA 1U5VA 1WAWA 4XD3A 2VYOA 5LHFA 2WQPA 2ZUNA 4L9YA 4I5XA 5BYWA 1Q6DA 3TYZA 4FNTA 4WLCA 5HANA 4MSSA 3NWRA 1L9WA 4ZENA 4IUGA 2OEMA 2YL5A 4TVUA 4DF1A 3RILA 1I45A 1B3XA 1MRQA 1PPIA 1YADA 3EKGA 3I7RA 2QJIA 4DBWA 4HZ8A 4CU8A 5AYBA 2YDSA 1E5NA 1V3MA 3K8MA 2OLSA 3VCCA 4GC3A 1YBQA 1GYMA 3VDBA 3GR8A 3LMYA 2O4QA 4UOZA 2FZNA 2JE8A 1W32A 4I7WA 3SY5A 4BR1A 4ZA0A 5F7UA 1OYAA 4HYRA 7ODCA 1CXLA 3E2QA 3LA4A 4C7DA 1UZ4A 1IR1A 2DT1A 3PJUA 1UR1A 1K7EA 1OY0A 1DWJM 3C2EA 4D9PA 4NILA 1DJZA 4PRRA 2YBTA 5HAOA 3GRIA 4B5WA 2UY4A 1DE5A 1LL4A 1GJPA 3NXFA 2CYGA 1LBLA 2PE4A 3SRHA 1IE7C 1QASA 5EMLA 2AGKA 2FTYA 5FJRA 5A94A 4EPBC 4URIA 3NL5A 4A05A 4D1IA 1QHZA 1KRMA 3L7RA 1PZ1A 3EDEA 3WK3A 2C7FA 3EPNA 1NIUA 3UVAA 3T08A 4AMAA 2Z24A 1EBHA 5DANA 4ZQOA 1PIIA 6PTDA 4XAZA 2H6RA 3T0BA 2TRSA 2MANA 1NM9A 3P2VA 1R86A 3VK5A 1W9XA 4PE8A 4E8CA 2J8GA 3AUJA 3O06A 3MCOA 5KITA 2FIQA 3EDFA 1V0NA 2TODA 1TTJA 3AZSA 1SZRA 5CJ5A 2KAUC 3DCPA 3DC8A 3GYCA 3P0WA 4GK8A 1ONWA 1HW6A 1OT1A 3I7SA 4K7VA 3W7MA 3V5CA 2XVNA 4UOQA 1J11A 1A5CA 3FXYA 3AZRA 1AH4A 4XX6A 4MMWA 1OZMA 1XISA 2WCSA 2ACSA 4RK8A 3S2JA 5CPMA 3GNRA 2FVMA 1B3ZA 1YBQB 5CAHA 3CK5A 4K39A 1FH7A 3BVJA 3DGRA 3VIJA 4XIMA 2X05A 3PZVA 2Z1BA 4HN4A 1R2TA 3OZYA 3MJMA 4AYGA 1PEZA 4CD4A 4KCVA 3BMWA 4AX6A 2IUZA 4D6GA 2QGHA 4H8HA 3MT1A 4YLWA 4DUWA 5FOOA 3BJFA 1WDWA 4K38A 4HMNA 1VEOA 3U4AA 3PBVA 3L0KA 2Y62A 4YN5A 1XRSA 1W3IA 3GTNA 4DJEA 1OVDA 1QCWA 1JGIA 4DM2A 2XWEA 3CIXA 1X96A 5GNZA 1EOMA 4GVHA 1CB7B 3HA1A 2DT3A 4GE8A 3DXIA 4GX9A 3L68A 1UWAA 2V3FA 3EPOA 1AJZA 2Q3OA 2QF8A 1XSKA 5AVHA 2GZXA 3W6MA 4K1WA 3WFZA 5TF0A 3OW1A 1UKSA 2A21A 3N14A 4JQ3A 5DFAA 3IUHA 2OODA 2XU2A 1R30A 3TZNA 3LI1A 1PL9A 3G6MA 4M6QA 2FPYA 3ZVHA 3CQIA 3BLIA 4CCCA 3LCGA 3BURA 1C3FA 4DB7A 3DBPA 5BRQA 3G6LA 1Q6RA 1PKLA 1BGAA 1C8QA 1RBOB 4NL1A 3L2IA 3WBWA 1M03A 2VFDA 2BP1A 5EKYA 2A2IA 2IPGA 3DECA 2XINA 1US0A 1I8JA 1XIBA 4GY7A 1BVWA 1U1HA 3MO4A 3L5LA 2Y2WA 4NX0A 3I7QA 4S3FA 3WQGA 3WNPA 1FFRA 5FCZA 3W7PA 3G3MA 4NZ1A 1R3SA 4UFMA 4DUVA 1ADOA 4PMDA 4GY1A 2XWDA 3SIMA 5BW6A 1S39A 3S6DA 2PD9A 2RH9A 4UCFA 3R79A 5F2LA 1FKWA 4EK7A 4RNFA 3PZTA 1TV4A 2DIKA 1V02A 3F4VA 1R7AA 2J24A 3AIBA 4XO7A 3RJYA 3OBKA 1EA0A 1ZY9A 1YDVA 3GDLA 3IACA 1XBZA 3WCZA 1UHVA 1TUXA 1PZ2A 4AZGA 2CLMA 3H53A 3IGXA 4WRHA 2G4FA 1AZ1A 3GZAA 3AXKA 1Q2RA 3T2OA 4LALA 5FF0A 1TJ0A 8A3HA 3HV9A 1BXNA 1DYSA 3NZGA 4MDPA 5I3KA 1KBLA 3B9EA 1DV7A 2PB1A 3PANA 4FNQA 4NKCA 1EUNA 4OHQA 1EJUC 1TV8A 3TQ0A 4AYSA 3MKCA 3V1PA 3NGFA 3O9NA 1THFD 3PG8A 4IISA 3UWUA 5H8MA 4B3ZA 5C55A 1P1MA 3VCRA 1OD0A 5CPQA 3ZVHB 4B9ZA 3URNA 3VIFA 1ME9A 2OYKA 3K8KA 1TRDA 1HXJA 2PI6A 3QLDA 2CEQA 4O4VA 2VEMA 1XLGA 1AD1A 2FTPA 4IIDA 4AD3A 1QFEA 3ALGA 2VC5A 1UPPA 4RNIA 1Q5MA 3PUGA 3R4IA 5FF4A 4X9SA 2ZRYA 3PZIA 4V15A 2FPVA 3BPWA 9RUBA 3AHTA 3V4BA 3KL0A 2PWVA 4HYWA 3V5OA 1P1XA 3NXLA 3N2BA 1P4CA 3E9AA 5D30A 5A2AA 1F4AA 3APYA 3A64A 4FK9A 1ZJBA 4JKMA 1PWMA 1TQJA 1XIGA 2XIBA 2NXGA 5BXSA 4D6CA 3N2XA 3FK4A 3BAYA 3PZQA 2ZZ5A 3W2KA 1CXEA 4X9YA 4U2YA 3A24A 1EP1A 4GABA 1K8XA 3FHQA 5EGRA 5ABTA 4HSHA 3KXQA 4U5IA 5EYWA 5D33A 3TH6A 4UR8A 2CESA 2AOSA 2DFAA 3KAOA 1R9XA 7A3HA 1WZKA 4PFMA 1MXGA 1KO0A 4UTTA 1VC4A 3MI3A 3F4CA 5DBUA 1Q66A 5HQMA 3TTOA 3B0VC 4C6NA 1SW3A 1O60A 5TAOA 3H7UA 3NZ1A 3ICJA 3OLDA 4KRZA 1LDCA 5D2YA 1E9IA 4IQLA 1ODUA 3PZ9A 3WFLA 4H2CA 1OX5A 3VGEA 1VGAA 4AWUA 3FSTA 1D3HA 1FVPA 4DM1A 4C6PA 3C2RA 2OSXA 4ZOAA 3M0KA 2W62A 4HPXA 4MB3A 2OVLA 2WNZA 1Q45A 4YS1A 4QDPA 2EKGA 4N7QA 3KEHA 4A3RA 3KRBA 3N19B 4M6PA 5HJYA 2B7QA 3BLOA 5AYZA 2PZ0A 5JIWA 2VGGA 3LGGA 4W7WA 3QQ1A 4FX7A 1A5SA 2CLIA 4O15A 3ZT5A 4B4HA 1O5RA 5AC8A 1UW9A 3ATZA 5HQLA 1FWCC 3PUDA 3RPMA 3H8AA 2P10A 3IJ8A 4HNTA 1RP9A 3FJ4A 1EC8A 3ITYA 4UTKA 4CLMA 3M0MA 1EA9C 4AHPA 5C9UA 1WZMA 3B97A 5HWNA 6REQA 2ZRXA 4AMCA 3P6LA 4R7WA 1VEPA 4N6EA 4WQ6A 2VVSA 3GW0A 3TNOA 2Q09A 2X16A 3LGDA 4UZUA 3EEZA 4DF2A 3RNDA 1AL7A 3EOOA 1JNEA 5G4WA 3N1AA 3LTPA 3U4FA 3W73A 2POTA 3LOTA 2PWEA 1FUYA 1A5NC 1TREA 1CECA 1ZTVA 1T6MA 1KBIA 1ISWA 3WLRA 4IZGA 2PRHA 3UA3A 4HP5A 1EJ7L 3RK8A 5G4HC 3HPSA 3H12A 3UU0A 6CGTA 4HD5A 1GTEA 4CQAA 5FEZA 3NYZA 3L5AA 2J6VA 4UQ9A 5C71A 3V0TA 4LBSA 2ZFAA 4FLOA 3EMQA 1RQEA 4IPPA 1SJAA 4DLFA 3LRLA 2J7DA 4MWAD 4G7FA 4M56A 2B4GA 5LNRA 5FEWA 3Q4DA 3PBWA 4PGLA 3WLLA 1A0DA 1XR2A 4O18A 3IEBA 2W27A 5AHEA 3LBOA 3FGCA 3N13A 4FOUA 4O8AA 1UKPA 4LYQA 4WKAA 1SU5A 4QIUA 4LVAA 3NSNA 3WH8A 1DVJA 3WD0A 4A3QA 1PX4A 3M7SA 4BF9A 4QQUA 3URBA 4PFHA 2BX7A 4PMRA 1QXLA 3AYRA 4ZXOA 3IRDA 1M9HA 1GOWA 4OOUA 3B40A 1MSSA 2VRJA 1U5JA 4HMEA 1QTWA 1S1PA 1ZHAA 3GC5A 2V5BA 5KETA 6REQB 1X1ZA 4X63A 4DI9A 3N29A 3P8JA 3D3AA 3O05A 1F6KA 4PTVA 1X8CA 3FY1A 4DUOA 4M19A 4ZBCA 4UQEA 4RNHA 1FWSA 3AIRA 2WYSA 3WO8A 1FHVA 3UJEA 2OTDA 4H9MA 1QI2A 3CPGA 1XYAA 2OYMA 5LIWX 4WCJA 3PVFA 2YXOA 3DDMA 3TWAA 5D2WA 1Z6KA 2CIPA 2GQ9A 1DWFM 3KE0A 3VD7A 1H60A 2E6DA 3KL5A 2ZADA 3NQ2A 1VFSA 4QJ5B 3N4EA 2VFEA 3RX3A 1FDYA 1GOXA 4IL0A 2P3EA 3CHDA 3TJLA 2O9PA 2DW6A 1F9CA 1KTNA 1XDLA 4H8NA 2OQHA 1NOWA 4RR4A 4Q8OA 2ZVIA 4DZ5A 4QEHA 3E1F1 4JOMA 3UW6A 4DVOA 2YA1A 3GSMA 4KFPA 3NZRA 3W1UA 3ANVA 2EXOA 4K36A 2HRWA 2FH8A 5E09A 5DMYA 3FGCB 4A2SA 3IARA 1ZPTA 3G18A 4IQJA 3N3MA 3TQVA 4H04A 1WKYA 2AAAA 4GUFA 4TV5A 1IWBA 1SMAA 2ZC1A 3MW7A 3PJWA 5KZ6A 2Q3RA 1JAKA 5CZSA 3UZ5A 3D0CA 5FJIA 1J5TA 4F9JA 1E1EA 1MEHA 3KOXA 2WPBA 2WK2A 3ABQA 4Y6GA 4W8LA 2F6UA 5LNVA 4JCLA 1E73M 2ZA3A 1XCFA 4XK2A 4FF7A 3HFTA 4KESA 1UC5A 1KWKA 4L6OA 3P82A 5E0CA 2QPSA 4M29A 4UTIA 1YTDA 2CHRA 2IKHA 3LRMA 1KBKA 3UY8A 1KFLA 4D6EA 4PUEA 4X2RA 2VCCA 2VP8A 3FKKA 2GWGA 3DAQA 1TELA 4FS9A 1XYLA 1KCKA 4Z1YA 4D6HA 3PBGA 4UR9A 4XAYA 4HT3A 4QSHA 4Y8FA 4YTUA 2V0TA 3CIWA 3WLKX 2AQVA 2Y61A 1K4GA 1K9EA 3OZOA 4J3ZA 1HVQA 4CN6A 4HNLA 2QUVA 1KWGA 2OMAA 3EDJA 2WZTA 1CXHA 1B30A 3TYBA 4NASA 4C6OA 3TXVA 3R10A 3OZMA 2G0WA 4BQ4A 3DG6A 3CQ0A 1JDEA 2G8ZA 1OF8A 2Q8LA 3M0XA 3SAZA 4PCSA 1WKFA 1V3KA 1SVDA 3ONBA 2HMCA 5A1AA 3WQVA 3LHZA 4PUKA 2A79A 1K7FA 3VI2A 4F40A 4ATWA 3W2JA 1EBGA 2V3EA 3ZLHA 4S3JA 3W6LA 4AY8A 3HJZA 2BB0A 3PZUA 1GORA 2QCDA 3PN8A 3FAXA 4D8ZA 3V0SA 5GJNA 3W27A 1GOQA 2FDMA 3TVAA 4W87A 1DXEA 1U33A 3NNTA 2GJRA 4QXIA 4XD5A 1VCFA 5CC7A 3W1RA 3QZ6A 3AFBA 3Q58A 4MWAE 4E3TA 5IXEA 2W67A 2VKZG 4ZFCA 5B7YA 1KRCC 3PNUA 3A13A 2GJXA 1QK2A 4JQ4A 3DFQA 3SUWA 1XSJA 2Y5JA 4A35A 5EMYA 5DBTA 5T9BG 3PFMA 3T2QA 4N02A 2J74A 3IJ6A 4Z17A 2R24A 8RUCA 2WNWA 2KX9A 1A0CA 1EGMA 5FSDC 3CC1A 3TJIA 3QEZA 4GJ1A 1BF6A 2QMJA 3FNDA 3UCDA 4M51A 4P7RA 3WQ6A 1KCXA 2ICSA 4C6QA 3H7RA 4WX2A 3N2MA 4IMGA 4CCDA 4J5NA 4ZO8A 1MEIA 1EYWA 3LHTA 3ITXA 2DEPA 3ARRA 4ZGYA 1R0MA 4H9ZA 4PMNA 1CPUA 2WC3A 3W4RA 1U30A 3U7BA 3GDMA 1E43A 4DBUA 4CU6A 1X8FA 3GXFA 5IDZA 4D6FA 3WLIA 4BS0A 3LDVA 3I4EA 3O07A 5E93A 1HJQA 4GYKA 1FH8A 3R11A 1QO2A 4MDOA 4W85A 3OLEA 5I3DA 2PLJA 1W2PA 3R8GA 2ZA2A 3QRHA 2GQAA 1ZCOA 4LCQA 2VXNA 2NQJA 2NSXA 9CGTA 4QE4A 4IIBA 4B5NA 2X0YA 1Z69A 3MV11 3S5NA 2ONEA 5JVLA 2CLHA 1SM9A 4WK9A 1XIIA 3R7MA 3CJPA 4JIHA 5HMFA 1CXKA 3HO8A 2IPJA 2X1SA 1I6NA 4AEEA 3GH5A 2OR2A 2VI0A 3CUJA 3CLWA 4M80A 4O8RA 5BZAA 4L6HA 2ISDA 5FF2A 4LUIA 2GJXB 5I5RA 1YDYA 3W01A 3SADA 3T78A 2ANUA 4JX4A 1E6NA 1MW1A 3K4DA 2L5HA 4LVDA 5I6SA 3IK2A 3NQVA 3WDIA 4X22A 1DJXA 1XYZA 2PURA 5J5DA 2PF0A 1S2TA 3A5VA 1ZQ5A 4MNKA 1F8IA 1HJSA 4FI4A 4PH6A 5FJUA 4V33A 2JKAA 3RIKA 1W3NA 3VX0A 3O6DA 1P48A 1TX0A 5LKYA 1FWEC 4AC7C 3IGHX 1MYRA 1XLLA 3IPWA 2ZVRA 1J4EA 1D3GA 1GHSA 5A6KA 3PSVA 1H63A 3AMGA 3HG3A 4I6KA 1NEYA 4BQ5A 1VBJA 3CV1A 4QCFA 1WDDA 3V16A 2VQTA 2NQZA 1Y5VA 4LS2A 3NG3A 3GO2A 1I1WA 3I3BA 1SW0A 3AZTA 4JTKA 2E6FA 3RXZA 4AY1A 3SW6A 1GQJA 2BOEX 2VEPA 4MYAA 1KV5A 3U6WA 1BHGA 4AIOA 3B8WA 3W9ZA 1FWAC 1QU4A 3VD3A 4S3EA 2HQAA 1I4NA 2REQB 2WKLA 2XGIA 1EEXA 1RPXA 1S2AA 3OHMB 1LCOA 4JZ5A 1OCQA 3KTXA 4X0NA 5HINA 3AMLA 3LGEA 5C9WA 4QQ3A 2Q02A 1XF0A 2PBOA 3WQFA 1Y7VA 1ZCCA 1YDOA 2YCKX 3EX6A 3C3NA 1N8WA 2OOGA 1WXJA 4JDBA 3CYVA 2R94A 3MU7A 4BEUA 4RZ6A 1UWUA 4QS5A 5BMWA 3APGA 3NQ8A 1GTHA 4LAOA 4MNJA 3C0JA 4H9TA 4ALDA 4Z2GA 2HROA 3W29A 3C2YA 2DUZA 3DKLA 1B9ZA 2DVTA 3VD9A 1ECEA 3BG3A 1NTHA 1PTAA 4E2VA 4HCDA 8XIMA 3FEMA 3HQPA 4QS6A 4AZ7A 2WC4A 3FJNA 3WQCA 2VWTA 1C29A 4LF1A 3MDUA 4HPNA 3P5YA 4A8NA 3UXLA 4JTFA 3URAA 3G1AA 2Y24A 2VDHA 3CMGA 3TNBA 5A6TC 1UUOA 4AC1X 1MQRA 5E9XA 1VD6A 1VPQA 4KGJA 1D8CA 3RITA 2E9LA 1CGYA 2C0AA 3E6EA 2Z6JA 3H2CA 4IGHA 3KRSA 2J47A 1SFTA 1GVOA 1RP8A 4OU1A 2PGWA 2ZA1A 4XWUA 4ZOEA 2VZUA 4XTIA 4L80A 3BOXA 3N04A 3WG6A 3N12A 1PXGA 1WBJA 4ORIA 3R25A 3OOQA 2GSEA 3TLQA 4JTAA 2ZX9A 3SCNA 1TTIA 3KBVA 3PB2A 2YXXA 1CLKA 3SB0A 4TTGA 3T42A 3LV6A 2QJGA 4ZTXA 2B31A 2TMDA 3GVGA 5T8GA 5HPCA 4PA8A 1OGBA 3OEXA 1VJZA 1UKQA 4ZFMA 2XGBA 4BA0A 3TLLA 3IANA 4X60A 5E5CA 3OODA 1Q7MA 3N15A 2JIWA 4UIOA 1H7XA 1X7IA 1NWSA 1MNSA 4DNMA 1X1OA 3SN4A 1VYPX 2NXHA 3DGBA 1QUMA 2J75A 1WDSA 3GR4A 3DU0A 2OKOA 1H7WA 2QZRA 1PUDA 1H62A 4Y96A 1H5VA 1Q7QA 1FX6A 1D7FA 3D6NA 3EDDA 1LOSA 1IGSA 5FJTA 4Q8VA 2QUUA 3KBMA 4H7ZA 3OYZA 4FX8A 4A3YA 1WKEA 4NHVA 3AHXA 1OQFA 3RLUA 4JN8A 2V5JA 3C61A 1I9CB 3GUGA 3M4HA 3UWQA 4O4WA 5K4ZA 4G7EA 3PUOA 1LOLA 2RGMA 1WX0A 4XSMA 1BG9A 3L4UA 2QDGA 2BXZA 4CQ8A 3OZPA 1KXVA 2XG9A 2Y8KA 3QY8A 1RJQA 2XHYA 4PRTA 3S1WA 3ANUA 4EACA 4JTLA 1QI5A 5FEPA 3FDKA 4JFUA 1R3YA 4AD4A 1UR2A 1VB9A 4UMAA 1GQLA 3LS9A 5FF3A 7REQA 5D2XA 3DC0A 1DTUA 4JEQA 4JEJA 4LBUA 3BZGA 2VX7A 1NFBA 1K1DA 1W1B1 4LEQA 3CHVA 1IT8A 3BH4A 3ZSTA 1KLYA 1ZU8A 4DZAA 4RE2A 3WBEA 3VTRA 4W7UA 2VUNA 1FWTA 4OT7A 1K4HA 1GQIA 2QPXA 3T0AA 3FCPA 3GS6A 1HIZA 1DWGM 2DSUA 4GCXA 5XINA 5FD0A 3CEPA 1M04A 3W72A 4DO4A 3PPFA 4G9PA 4A8IA 3TYEA 3NVDA 3NVTA 2VMFA 1US2A 3L2MA 2O9RA 3VMNA 1JZ4A 3G2GA 3BOFA 1UD3A 5ENLA 3G1XA 1TQXA 3LYEA 3OGSA 1R3VA 1A50A 4BEQA 3GD6A 3KBWA 4QDMA 1XGDA 3VC5A 4O12A 3UFYA 3ZJ6A 5DF0A 3FHAA 3F4DA 1HGWA 2P8BA 4MAVA 4CEUC 3BLFA 4DXXA 3MVTA 3QY6A 3U7VA 1UKTA 3GZ3A 1GVIA 3QYQA 4Q6JA 1V0KA 3MHFA 1I2RA 3PULA 1CENA 3MS8A 1W8SA 2MNRA 3DFHA 1JXJA 1NVMA 1B31A 4MZYA 4G7EB 3A12A 1TPVA 4AFYA 4IX0A 5HPOA 1XD0A 1S2UA 1G4TA 2INZA 1OM0A 4MNMA 2PDLA 2CITA 3P3BA 3T05A 5K3VA 3QXBA 4W88A 1XBYA 4WHBA 2DVXA 2QCMA 4ZB0A 3BZJA 3KOWA 5IRPA 3POCA 1X1NA 2CERA 1MEWA 3U2EA 1OFAA 1W3TA 4HVXA 1W37A 1OFOA 1UQYA 1XDMA 1YLVA 2JGQA 1VHCA 7REQB 2QT3A 3S1GA 1W31A 1BTMA 2JFEX 2YL6A 4M1BA 2ZUSA 1H41A 1SO6A 3WQDA 3EKLA 3E0IA 4HHMA 3W1XA 4D6JA 5CG0A 5BRPA 2C16A 4FXSA 4J3XA 5CG7A 3KRZA 2D2GA 4MPQA 3W24A 4ACYA 1JZ3A 1XSIA 4GGHA 2Z0IA 5DMNA 3QHMA 1J10A 4IFOA 5XIMA 4Q4MA 5EBUA 2CWNA 1XFBA 4GQQA 3BGGA 1NWUA 4NI3A 3N3TA 1JI2A 3ZR6A 1L2UA 2OZTA 3MANA 3QFWA 3F5KA 3SCPA 1TIWA 2HNHA 4ZSTA 5IOBA 3ZSSA 2AQWA 2YZ5A 1VH7A 1AD4A 3CH9A 1R3QA 1SR0A 4V1YA 3TAKA 2OWWA 2D0FA 4XZMX 3FJLA 2ZUVA 5E0FA 1EZ2A 1GQKA 1NDZA 2XFRA 3FDGA 4QHRA 4B2DA 5D02A 3C5QA 4M7TA 3BAXA 4XZHA 1PTGA 1HFBA 2OT1A 1CGVA 4HPHA 2OB3A 4TX6A 3Q94A 4ZO7A 3L66A 3SRDA 3WL1A 1PKMA 2DPEA 2X30A 5D2VA 1YTKA 1JPMA 4YYCA 3ARYA 3JRKA 1JPIA 2VJXA 3ZR4A 3KHJA 4ZB5A 3AI0A 4Q8UA 3BCDA 3HURA 1VFLA 2HISA 5HK4A 5A95A 3ME3A 3GG0A 1TR9A 2VEFA 3CO8A 1F4HA 2VNCA 3EWCA 4INFA 3SSZA 2XIJA 3LZ3A 3CZEA 3EGJA 4ZXLA 4NRRA 3ZT6A 1WKDA 3VOGA 1XI3A 2FHCA 3KBJA 3ZOAA 2FQIA 1BGGA 3E38A 4FALA 4FNPA 1VHNA 3CHFA 2J62A 2RJHA 4E8DA 4Z08A 3UPWA 2YW4A 3NQBA 4RCXA 4EAMA 4DQWA 1SFJA 3IUDA 1SFSA 1XCWA 1QNOA 1EZWA 1M7JA 1N55A 4FF5A 3TMQA 3PB0A 3SRKA 2ISSA 1I0DA 4IP4A 1NDWA 2VCBA 3PK7A 1XUZA 4MPKA 4YHGA 2BLEA 1ZBWA 2FGBA 3BSMA 2UY3A 3DFTA 4YYFA 4YXGA 3NZPA 4CVUA 2ABBA 4AWTA 3R12A 2Y6ZA 3QSRA 4NJJA 3YPIA 1KXHA 4C7GA 3TN3A 4NU7A 3LXCA 1DWHM 3M6DA 1AQMA 5CSRA 4WOZA 2Y1HA 5CBBA 5AC5A 3PPHA 2FZBA 2ZYFA 1GVQA 3R43A 1UH2A 3GXNA 4FA3A 2WM1A 3GVWA 3VNMA 5DXYA 4RW3A 2YSWA 4HA1A 2BFGA 3TEVA 2G3IA 3ISIX 3A3XA 4O54A 3E12A 3O2LA 3SFKA 4ZTYA 4HSOA 1GW9A 2JIEA 1TX2A 1VF8A 4AIEA 2JEQA 1EQPA 3TJXA 4MKSA 3MHUA 4EXQA 1SZEA 2HVOA 3U9IA 4LH8A 4S38A 3RCMA 1EB3A 1KTCA 1LM1A 2WSYA 4P8WA 2A3EA 3AXXA 1B5TA 1MVYA 4N0RA 1FA2A 1ZAJA 2NQLA 1JG9A 4QCEA 1DHKA 1FHLA 3UG3A 2RDXA 5JMUA 1E0VA 4UTWC 5I00A 4UTFA 2KZHA 5BU9A 2O7SA 1O5XA 1F05A 2VC9A 3UG8A 3SCWA 4O13A 1X6LA 3AYTA 1XCXA 5CZKA 2C91A 5XIAA 5K9DA 5LA2A 4LU0A 4KQNA 2ZCGA 2IPWA 4FNSA 4R7JA 3G8EA 1PO9A 2E7FA 3W7HA 4TVCA 3OGRA 4X61A 3B0YA 4XKYA 3GFZA 2V9DA 2V82A 2VOTA 3W28A 2G97A 3P93A 3AWOA 4NZFA 3CASA 3USBA 1FP9A 3R94A 4HNUA 4CQCA 2ASHA 1KTBA 5CLTA 2C71A 1Z89A 2FKPA 1UQZA 1WQ5A 3TSMA 3EX1A 4ZL1A 3VUSA 3GNDA 5EMKA 5I0DA 2A5HA 4PMOA 4RUBA 4GX8A 4LUJA 5MF5A 4I9AA 3TN5A 3L67A 2GGJA 1PTDA 2HS8A 3OG3A 2J88A 5AHLA 1TVPA 3ONCA 3QGAC 7CGTA 3SCOA 3CTLA 2WSRA 3LPGA 3UZWA 2EBNA 2QCGA 4XV0A 4G56A 4B5UA 2HK1A 3DYOA 4UBPC 4CD7A 1IQ8A 5DEZA 2CWXA 3F5JA 3BWWA 3ITCA 3OBAA 1JD9A 1QOQA 3RR4A 2ZX6A 2ZBTA 3EDKA 4DWSC 3A3HA 1DXIA 3NM1A 5F1VA 1IHIA 2E09A 1DPMA 5AC4A 4FXRA 3AROA 2P53A 4HQVA 3M1ZA 2VX6A 4IQDA 2P0OA 4ES4A 3NL6A 3AISA 3TR9A 4N4PA 3AO0A 2ZE3A 3OBEA 3U2ZA 3WBXA 1VCGA 1K70A 4C6BA 2X7WA 3TYUA 4O1DA 4FLSA 3T0CA 3WQPA 4B3KA 1YE4A 1YXDA 1FQ0A 3DHPA 4AF0A 2PTZA 3QMRA 4DAIA 1E5JA 2HXUA 2VC6A 3IJDA 5A3HA 5TD4A 4J40A 4US6A 4AVOA 4XKYB 3HGRA 4LV9A 2WBKA 4J28A 3CNYA 2WVVA 2FZ8A 1GCYA 2H8XA 4G1NA 4IIEA 3BCJA 1QNSA 3MP5A 1DJGA 1YE6A 1U2YA 5CLWA 4C6DA 4S3AA 3SY1A 1WXZA 2XH7A 3SGZA 5CSUA 3UG4A 5A6LA 4A8LA 1JVNA 3CZJA 4GQGA 2VR4A 1UH4A 4JDYA 4R27A 4X0VA 4AEFA 2WV8A 2ZZ6A 1EKOA 5FI8A 1C93A 4W8AA 3LMZA 1OK4A 2WWDA 1M3UA 1ZJAA 4KCUA 3VDCA 1TWWA 3DYMA 4XO6A 3IK4A 4C65A 2FZ9A 4TO8A 1SZNA 1RR2A 1RH9A 5CCZA 1VFHA 3KBNA 2DZVA 1DE6A 1L0PA 4J2PA 2R8WA 2V5KA 1H7NA 4LQ1A 5HUPA 2D24A 3FA3A 1W3JA 4WVXA 2R14A 2PDPA 5RUBA 2WHKA 2QF7A 4GBDA 4WJXA 3II1A 4FR6A 1JYWA 1HTIA 4GZIA 3QOMA 2IXVA 3EBVA 4R9OA 2I5IA 5LXEA 2XSAA 1E15A 4OJYA 5MKGA 5EL1A 3N34A 1B9BA 4UC5A 1DJYA 1KFBA 1O5KA 4ZCWA 3VNLA 1RY0A 3UJFA 4AF0B 4UUIA 5EBAA 2OWXA 3JS3A 2X1UA 3RM4A 2HNEA 3W1AA 4HK7A 3VIOA 4IT1A 4LYRA 3ARTA 1XJBA 1XG3A 2WVVB 2OGJA 3I4KA 2FDSA 1TIMA 3CV6A 1IWPA 2DIEA 5C0QA 1UR3M 3GM8A 1WDPA 4IG2A 2GQ3A 4WSHA 2E9BA 1Q6FA 4MTVA 4MZ1A 5A6MA 3U0HA 1BKSA 3SM0A 1E55A 2VX5A 3PWGA 4GFIA 4NF7A 3LI0A 2A3AA 4KEMA 3ECQA 4RV8A 1IV8A 2ZRZA 1I75A 4H01A 5LZLA 3S2MA 1XM3A 2QAPA 5BROA 3ZWTA 3ZWSA 2WZEA 4GIAA 4CUCA 1IZKA 2HSAA 2RJGA 3G0UA 5LNWA 2AMGA 4DPQA 4I5UA 3ZLGA 2YX0A 3RJXA 3O3RA 3MHGA 3QZEA 1NF7A 1XC4A 1KR0A 1R2SA 3LBCA 2A7NA 1VLWA 3BLEA 4IIGA 3ATYA 5D04C 4GH3A 1IF2A 5U7SA 5L9FA 4WJEA 1TV2A 1R87A 1WUFA 2DZXA 3T8QA 2VZOA 2HVNA 1HKMA 4LANA 4WGXA 4PC8A 1C92A 1TO3A 3RLGA 1S5VA 3NURA 4CN4A 3RYSA 3TCSA 1KGUA 2XSXA 3BXWA 4TX8A 1I2PA 1CXFA 3XISA 3WKZA 3ZVIA 3BGAA 2ZTJA 3AMCA 1QATA 2BASA 3NPXA 2WMIA 3W7IA 1EH9A 3ID7A 4AX7A 5MKGB 2ZZ7A 3NQDA 1TSIA 3TW7A 1B2YA 2CU0A 4MY1A 4UFJA 4DO6A 2PEVA 4CEXC 3KOYA 1XGEA 5C8BB 3IJLA 3PFRA 4FHAA 1JPHA 4PBEA 3BW2A 3AYSA 3GE7A 3TFCA 1EDGA 3SQSA 4ZE5A 2Y5EA 5A5WA 3UXKA 4JHMA 3KRUA 4S3DA 4C6LA 2VR5A 2J7GA 3VKKA 3RUBL 2OXNA 4XD4A 3GTXA 4A2RA 4YNGA 4IG2B 4IP7A 2EGZA 5KEZA 2Y8VA 5M2FX 4QISA 2FFCA 4U3AA 5C2CA 3O6AA 1TE6A 3LU2A 1QHPA 4HU3A 1Q6CA 2QJNA 1QPQA 1FCUA 2WMHA 3H23A 3WJXA 1VLIA 2HXTA 3QM3A 2AL2A 5LGXA 4GKTA 4W93A 3QR3A 5EA9A 3GBEA 5AFDA 2NV9A 4GYPC 4IM4A 3LXAA 1VFFA 4W8BA 5EY5A 1TMLA 2XDFA 5JIPA 1Q8JA 3UD6A 3S2CA 1JF5A 3KLKA 1ZL1A 4QSFA 1JRCA 4IJCA 4YCPA 3P61A 2GYIA 4UR7A 2WQDA 3WLJA 3SCSA 3W7QA 3MKVA 5KSWA 5DRCA 2PTXA 1E4LA 4KH2A 5H2ZA 4UTLA 1XICA 2WLYA 4IMCA 3QFEA 2WC7A 3DG7A 4RXFA 1RZMA 3HPAA 4ADTA 2WMIB 2OPJA 1IEVA 5AC7A 2VZVA 3W84A 4JIQA 4AB4A 1N8FA 3LY0A 2BGNE 4DJDC 3WLQA 2ABAA 1GZJA 2FJUB 1N2VA 2PDYA 1H1ZA 1US3A 1BYAA 1B3VA 4NZ4A 4LUTB 3W02A 4GISA 3PM6A 2NVAA 5LIXX 2Y7EA 4C1NA 3KOFA 3WDRA 2DVUA 2ODOA 3B05A 3HGOA 3H70A 5FSEC 1VRXA 2ZZ4A 4K8HA 3GHTA 3W2MA 2F7FA 3CXOA 1CBGA 3VO0A 1EFZA 2W79A 4LPCA 2YB1A 2ISWA 1CGTA 4IICA 1RQBA 3WQEA 1W3KA 3UVIA 1PDZA 3CMJA 1OIFA 1ITXA 5BOOA 4DBSA 2A7RA 4LW7A 3HU7A 4JFWA 4MGGA 3VX1A 1LZOA 1OYCA 3CMFA 1TPC1 4WUIA 2XIOA 2X09A 3MBFA 5AB3A 1W1A1 2EKCA 4FIRA 3WQWA 1OFPA 3CHEA 4YTTA 2ZXAA 1OK6A 1PJ9A 4JQ1A 1K9DA 2G5WA 1BG4A 3LCFA 2CZVA 3WFAA 2VOMA 5F4WA 4CQDA 3S2LA 4IXXA 1TA3B 1UYQA 1EL3A 5CGQA 4DHGA 3WENA 1OHLA 4JKLA 3OLIA 1BXCA 2NZLA 3WBAA 3H2AA 4HOZA 3S9ZA 1J96A 1YEYA 3CT2A 2PDMA 3B9DA 3RG6A 2A85A 4UB9A 1W5MA 3HQNA 3IRSA 1ZLPA 1BTCA 3E2RA 3PR2A 4IJBA 4BWLC 3KS5A 5DCBA 4GCAA 3SCVA 1TG7A 4PL1A 3GY1A 2G3NA 3LEPA 4Y9MA 1TYGA 2QV4A 2J25A 3MUIA 4AZHA 2OKTA 2DU2A 3CM4A 2PA6A 5FAGA 1SO5A 3NJ3A 1CI1A 4Z2HA 3TP4A 5FL0A 4BQ3A 3R0KA 3VIGA 1WOAA 1XRTA 5A8OA 2R82A 1VFTA 6TIMA 1R2RA 4FMVA 3W7EA 3H4WA 2BG5A 3SSJA 2PWDA 2Z25A 4YWIA 3WH7A 4QDWA 1EPXA 4H19A 4US5D 4A29A 4L5ZA 1YYAA 4AW7A 3KFTA 4E4UA 4QNWA 4NNBA 4DAFA 2E1WA 3EAUA 2V68A 4UFLA 4H6QA 1R46A 3MPGA 2D3LA 5T91A 4LEFA 3W25A 2QV5A 2ACRA 1TE1A 2BTMA 1BYCA 2WJDA 3GIQA 3R8HA 5GNXA 2HTMA 3GYEA 4M8UA 4BHYA 1DQWA 2QDEA 4OECA 3HJEA 3NO3A 4F3HA 2WM0A 3RF9A 1UA7A 3MUAA 1MFVA 2DSZA 3NDZA 1Q6EA 2EPNA 4Y9NA 1K6AA 1OG6A 3DBNA 5HATA 3EPMA 1RCXB 3DN5A 4N9EA 2WHJA 3MO7A 2CZ5A 3HM7A 4J3TA 3VZXA 3MUZ1 3M43A 4MJMA 4C6KA 2PAJA 3QVQA 4DJEC 3UZJA 4XZNX 5PTDA 4XSLA 2BVWA 4O0KA 2YBUA 1V6UA 3NFUA 4QROA 3CWNA 2EAWA 1CX9A 3TN6A 3G1HA 1RA5A 3AIWA 3RRXA 4KS0A 3GU9A 1RJRA 1E1FA 3GLCA 4ACZA 4UNLA 1FTXA 3H2MA 1N8IA 3OVQA 2WCGA 2XN2A 3QC0A 1W2VA 3BQ6A 4DXVA 4LB3A 4DWSD 3M5YA 3NSMA 1CCWB 4MJZA 4B5XA 2NUWA 3P60A 2F84A 1AQFA 1HJWA 4I8YA 4C90A 1KM6A 3KZPA 2NSOA 3RO6A 1G6CA 3EWYA 2VTFA 4GACA 1UWIA 3W1PA 4RDVA 1K03A 4ICMA 3F1QA 4E3VA 4F8XA 3VGBA 5D9MA 3GNPA 2PWHA 1O5QA 4R7OA 3LNPA 2IQDA 3G22A 1UWTA 2EG8A 4OQVA 1WCGA 3H7VA 4GD0A 2W91A 2LLEA 5KZMA 2QAFA 3WQOA 4R85A 2CNCA 1HGYA 2OQLA 1UASA 3B8DA 1PDYA 2EPOA 5FA5A 3SZ8A 1UZ1A 3KOZA 3U2CA 4E8GA 3SFWA 1KFEA 3AMDA 2XVKA 5I09A 2EG6A 1UZHA 3HGSA 4QG6A 3VE7A 1EF3A 1A5BA 3S8HA 1PZ3A 5H8PA 3KVKA 1EJWC 2ZX5A 4MIMA 5CSSA 2PDFA 4Q8PA 1KGWA 1ADDA 2V5DA 1A5LC 1FWIC 4H3DA 1FDZA 1TMHA 1SFLA 2AMXA 3QZAA 1HL2A 1TV5A 1VBGA 4S23A 8CGTA 1EO5A 1MUWA 4LNCA 2RDUA 3RDKA 3OPSA 2CW6A 4NAFA 3VU2A 4BCEA 2PMQA 4QG9A 3WJYA 1PKYA 4ONVA 4ZOCA 3VKBA 2BOFX 3STPA 2E5DA 5G1TA 1PWLA 4YVPA 2BXVA 4Q4QA 4QJ4B 3ITGA 1EO7A 3GR7A 1MMFA 1JQVA 4IL2A 5DX7A 2CFFA 2PRMA 1GT8A 3Q65A 1YPFA 3H2OA 1ZZMA 2C1HA 1JR1A 4ACZB 1A47A 4HIBA 4BKNA 3HF3A 6XIMA 4M7SA 3W74A 2DZAA 1EJSC 3TC6A 2X41A 2D2OA 4KFNA 1OB0A 4L1WA 3BTNA 3MY9A 3RN6A 3EMCA 3QW3A 5E1QA 1RALA 1QPOA 4Q32A 2WZMA 3C52A 3SIZA 4KCTA 5C7HA 5C9ZA 3HTWA 5CPOA 5CPSA 4BI6A 3TA9A 1XGZA 3MBDA 2CPUA 3XIMA 1ZNNA 4RPQA 4HPGA 4KF1A 2PTDA 3ZQ9A 3NQ7A 3S5SA 5GNYA 1VKFA 3CQKA 1TWIA 2IMRA 4LJ3A 1J8VA 4TUFA 1W5OA 1B4EA 3EX3A 1GUVA 4YTQA 3GDRA 2WSKA 5G1MA 3ARVA 3W3OA 2VHLA 4L56A 2P1FA 1Q4NX 4D2JA 4HA3A 3QR0A 4BK9A 1DIKA 1W5NA 1AMKA 3UNDA 4OWGA 2BHZA 1QNQA 1DEDA 3SUTA 3VA8A 3MVIA 1B4KA 2F38A 4F4RA 2YBVA 2NLIA 2Z00A 1JZ6A 4GQBA 2Z2UA 3G3DA 2Y89A 1FOBA 4W7VA 1C8VA 1CB2A 2TSYA 3MI2A 1MXSA 4NAFB 3W1TA 3PPGA 2CBUA 1G94A 1XYFA 3T55A 2O7QA 3WX7A 4XZBA 1R3WA 4EWJA 2W6RA 4RKAA 3G77A 3GVRA 1S2WA 5GJMA 3UWZA 2BXYA 4ZVJA 5FIPA 3M5XA 3K1GA 1RA0A 1OFQA 4Q7BA 3CEUA 2OJPA 2QDDA 4UOJA 3THQA 5EMMA 5F4SA 4HKPA 1NY1A 3GIYA 2XYLA 1OYBA 3AYVA 4Y9OA 3N2OA 4BI7A 5HR6A 3SJ3A 3VINA 3HV8A 3SI9A 1XDJA 4GUGA 2UY5A 5BOEA 2AL1A 2ZKMX 1SPQA 2YIHA 3E74A 4JY8A 3R58A 1W9BM 4OV4A 1OADA 4P8VA 4L7ZA 1H49A 2UWFA 3CZKA 3RU6A 1KM2A 1GG1A 1IYXA 4IGSA 3E0LA 3W37A 3DHDA 3FAWA 3LZ5A 2YR1A 2H3BA 1ZAHA 2E77A 1WXYA 3WD1A 2X7VA 3UPMA 3A4WA 1J9YA 3VVGA 2WWCA 3WD3A 2GK1A 3VIMA 2XVPA 1IT0A 5GJPA 2WMJA 1GW1A 3F2CA 4P2VA 3TONA 1E6RA 3IJQA 1WZLA 1S5TA 2GGIA 1B3YA 3U5YA 1V6YA 1RK5A 1IEWA 2WB5A 3LPPA 4CCZA 4H1ZA 4Z1AA 3UYIA 2E68A 1E6SM 1JFXA 3GU1A 1GYNA 3WLOA 1JL8A 2CLEA 4LGXA 4HPJA 4GVGA 1P6BA 3W7CA 3AOFA 3LCWA 1IXNA 4PZVA 1X39A 5JXQA 3EXRA 3BMVA 1I1XA 5D9OA 1JZ8A 4TX9A 4GH1A 4AZ6A 4AY7A 3VYLA 1XIJA 4IFRA 4JFTA 4OVXA 5A8NA 4XZIA 3I6RA 3BSHA 4Q3MA 4J3UA 1JDAA 1FFQA 3NO1A 1E6XM 3ITTA 5G2IA 3H2EA 3TSBA 2DORA 2GSJA 5GVJA 1B3WA 1FHUA 3RHGA 2A7PA 1G7VA 1ZAIA 6XIAA 1A4MA 3FJ6A 1H1NA 3T40A 2A1YA 3ZZ1A 1FWFC 1FRBA 1JZ7A 9XIMA 4HA4A 5K2ZA 2D20A 2PDNA 1NFPA 3PWAA 3LLDA 4WJ8A 3B3DA 3TWBA 2HPIA 2FLIA 2YCLA 3M64A 3PC0A 3HPXA 4I8DA 4B9YA 5ABEA 5E9AA 4NZ3A 3TE9A 1X38A 1L8NA 3R0DA 5BNKA 1AZ2A 4DJDD 5TNVA 4UQCA 1R38A 3ZJ7A 3MMUA 1OC5A 3GW3A 3RCNA 1C91A 2J66A 1BQCA 1TUFA 1VBHA 4N9CA 4CNOA 3U8GA 1Q7ZA 1HO4A 2OX1A 5I77A 4UNKA 3CWHA 1GPWA 3IV3A 4RLIA 3WLNA 2I9EA 1EHAA 1Z8AA 2VD8A 3EX2A 4AXKA 2WBGA 3VGDA 3MP4A 1TR1A 2GK1B 1QPNA 2XVGA 2VENA 4GNJA 4RZ5A 3M46A 3WJZA 4L9ZA 4ATLA 4QNEA 3NDYA 4RL3A 2D1ZA 3WQ5A 5G2WA 3FOKA 1LWIA 5BU6A 4JQAA 2QS8A 4E4FA 3CO4A 3ZYZA 2WSPA 3B8VA 3CZGA 1E0XA 4O0QA 1A3WA 1B0IA 4K37A 1LWHA 2BWGA 4Z1CA 2QVHA 1SO3A 3CYJA 2Z26A 3BE7A 2RDWA 5CPNA 4HOXA 2GJPA 3FV9A 1UB3A 2XJ7A 1NQ6A 1JUEA 4LVFA 2VDIA 5ABGA 3L4VA 3P67A 4PMXA 2PP3A 4K3ZA 4ZB2A 3UNTA 2OGYA 4NX5A 2JKPA 1QWGA 5KZDA 1BD0A 3GBDA 3VOIA 4O17A 4DO5A 5C6MA 3LERA 1C8XA 3PJXA 3VKCA 5LGZA 1TVLA 3MTWA 4O28A 5B80A 3IWPA 3PUEA 2W0UA 2PCEA 1IR2A 3FYPA 4AZIA 3A47A 3ITLA 2P50A 1L8PA 4ZSUA 1KFWA 1IIHA 4W4QA 3CS2A 2ZWYA 1ICSA 4P8UA 2ESCA 4IXHA 3HN3A 2Z4GA 4H9UA 2H9AA 3WIJA 2R1NA 2YCLB 1FHDA 1DQUA 1NF0A 2ZTKA 1LG2A 2QCEA 4R34A 3WF0A 4NVTA 3KVLA 1C7SA 3JZEA 3L4YA 2QCLA 3SR7A 1OC7A 4GLEA 4WEVX 3KTCA 1IXQA 1KKOA 3ZLFA 3BUVA 1TWDA 3BV7A 1SMDA 1SSDA 1Q65A 1ESWA 1Z32X 1V93A 1F6PA 2MUCA 3B9OA 3BAJA 3DERA 3ZIZA 2EHHA 3BJSA 5ABFA 4PUJA 2PGEA 4YTSA 3VKAA 3SQMA 4PCNA 2D73A 1K6WA 3A5FA 2C14A 2J6XA 3EWUA 4POCA 2Z1VA 2A3BA 1V6TA 3VNKA 1GEHA 2I7GA 2DJLA 3UETA 5JU6A 3LB0A 1H3GA 3IIZA 1ME8A 4U28A 3LPOA 5HMDA 3ES7A 2XVLA 4HTYA 5A2BA 2Z28A 4J1OA 4MLJA 2BVDA 3NTYA 5DCEA 2NV1A 3CUHA 3T44A 4Q4OA 4NJHA 3MMWA 4UNIA 2D0GA 4QFUA 2CKRA 2FGZA 2NT1A 4JTSA 4H9YA 3OLGA 2YXGA 2DJXA 4BF7A 2DZBA 1LJYA 1R3TA 2ZWZA 3D3FA 1EJXC 2CKSA 1T96A 4KWWA 4US5A 5H6HA 3PHAA 4JHZA 3IIXA 3KHDA 1V7YA 3AU2A 4F0LA 3W22A 4S3KA 4EAYA 2Y70A 4DJED 2ISVA 2PDWA 2FH6A 4L1XA 1V51A 3M0VA 2BHYA 3INPA 3S5OA 4L9XA 2OSYA 1FWHC 2H9AB 1FP8A 3QV8A 3W2NA 4GIRA 4UTJA 3W70A 4FOJA 1W17A 3BLLA 4XKMA 3G8RA 4IUOA 4IH3A 1W1PA 1P0KA 2GWNA 1HKVA 2Z1KA 4FPSA 4GI8A 2E8YA 1YTEA 4ERGA 1HO1A 5ABFB 1PE1A 3M47A 3CIVA 3VZYA 3PTQA 3NEVA 3HMCA 4HZMA 2IXUA 4MJ2A 4PEEA 1RLDA 1X6NA 4GOAA 2HBVA 4G5DA 5BXRA 3B04A 1AG1O 4JD4A 3F2BA 1J12A 1GYLA 1SO4A 3U3HA 2ZRWA 3BJTA 4MYXA 3GC4A 2ZX7A 3HOJA 2VZTA 3ZJKA 4TV6A 5A6BA 3QGVA 3G1YA 3A6OA 3NQMA 4EXBA 3BO9A 3MYPA 4DWSA 1GEQA 1GG0A 5I07A 5HMSA 3WYZA 3TW9A 1QT1A 1XP3A 2VX4A 1P0DA 4LSBA 5DCDA 1JRBA 4N9DA 1E0TA 3KP1A 3S83A 2IW0A 3LHUA 4UTMA 5D8WA 1SZFA 1EJVC 3FYYA 4QAWA 2J7FA 1MZHA 2DUAA 5I3IA 1EGVA 3WQ8A 3BL3A 3UR7A 1KNWA 1UUQA 3IV8A 2ALDA 2XN0A 4Q8WA 3WNMA 4UCGA 2VEGA 3S5ZA 1S2CA 3PZOA 3AU6A 3KVJA 3NPUA 1G5AA 2W5FA 4H6RA 3A4AA 4DWDA 3BLPX 5J04A 4FNUA 4PB5A 3KX6A 2AGTA 3WH6A 1PX8A 1PKNA 3CUXA 3KTSA 3M6YA 2V3GA 1M65A 3T9PA 2GVLA 2TAAA 2QCHA 4KWUA 2AAMA 3THUA 4Q8MA 3WJWA 3I3DA 1TPDA 2OYLA 1H0GA 1N82A 1Z41A 4LTSA 4YCOA 4ZEPA 2EPMX 1POKA 2RAGA 3RU8X 3ABRA 1DIOA 1RD6A 1ISZA 5HBFA 5HNUA 1H5YA 4QLJA 3TX9A 1HL8A 3K4WA 2Z2BA 3VCNA 3JU2A 1K8YA 7TAAA 2YFNA 2ZXQA 1JCMP 3VIIA 4UMBA 3BAKA 5EU9A 1OCNA 1BPLB 4C6IA 4O52A 3EB4A 3CQJA 1W3LA 4GNKB 2Y63A 1Y0EA 5LYRA 1BRLA 2OFJA 4DWSB 3EB3A 4NUWA 3B9NA 2CZDA 1S1RA 1TV3A 1EPVA 2P0IA 1UJPA 2Y0FA 1EXBA 1T99A 2EG7A 2O4MA 4MHBA 1EIXA 1U83A 2ZXDA 4AHQA 4DYJA 1W6TA 2VFGA 3WLTA 1BYBA 3OB8A 4NXKA 1EXPA 1VFMA 4JAWA 4PL2A 3W0KA 2FMNA 2H90A 1AW5A 3BOLA 4CD8A 2YLLA 1TPH1 3BDKA 5F1UA 1M5WA 1TPWA 1WE5A 4QLLA 5CGTA 4DNHA 2D2HA 2YCEA 1KM3A 4B5SA 5AHNA 3EYPA 3T8LA 4CVWA 5IHRA 1EX5A 3VZZA 3C56A 3RRAA 4Z0SA 1JYVA 2B7PA 2V2DA 1YKWA 1S46A 1IZCA 4E2OA 4S3CA 3LSCA 1H50A 4W86A 3ARZA 1G1YA 1HG3A 4IGMA 1KM5A 3OA5A 5HR7A 5AKQA 1F3WA 1PCWA 3EA1A 3HGJA 3NGJA 5I78A 1FXPA 1VPXA 3VNDA 2WW5A 4IHCA 4NZ5A 2Z6IA 4K8GA 3RM8A 4GWEA 3MP3A 3R13A 4CD6A 4TOQA 4GHRA 4I9JA 1PB0A 4GI9A 4UXDA 1JZ5A 1E72M 2YCJA 2E5BA 1LT7A 3R0UA 3QOKA 1UWSA 1E70M 1LLZA 3L2LA 4O1CA 1AH3A 3QC3A 3ERPA 5FJJA 3E0FA 2GUYA 1FWDC 4PTXA 3GKAA 1NU5A 1R85A 1BRLB 2PDHA 4NSBA 1AA1B 3MDWA 4DO7A 4NZJA 4J7RA 3RR1A 3UXAA 1DWAM 3VIKA 2DV0A 5D03A 2EQDA 3QF0A 3S4TA 2PGRA 1Z7AA 1XXXA 3QY7A 1DL3A 1Q2SA 1XPGA 4BQ2A 2WJEA 4OKDA 3CT7A 3WJSA 1IZJA 2EPLX 4Y90A 3AHVA 4MG4A 1ZP3A 2YDAA 3TTEA 1ONEA 4FOKA 4Q7NA 4QJ3B 4JTEA 1HKIA 3WNNA 3IGSA 4PRWA 2WO5A 3NSXA 2V5LA 3SCTA 2XH4A 5I7GA 3ABSA 1KXTA 4F0MA 1JYNA 4F48A 2E4TA 2ACQA 4HU4A 4LAUA 2E40A 1VS1A 1UWRA 2IKIA 3SN1A 1T0OA 4AG0A 3DHFA 4OTKA 1XLIA 4HN8A 1OC6A 4M5PA 4F0HA 3PF3A 3P74A 3ZJ8A 2B7OA 3LPFA 3CL7A 1K8CA 3FVDA 1QI4A 1G9HA 1V02E 1D8WA 4LFYA 1SZGA 1E6QM 1W5PA 1OCBA 1E6ZA 4JX5A 2JEPA 3W71A 4UQAA 4PMUA 3V36A 4L4MA 3VPLA 2WMKA 3GXIA 1X97A 3W26A 1WV2A 2A4AA 2V67A 3NR0A 3W7RA 2QMKA 1PCKA 1QAPA 4AIUA 4B3LA 4W5ZA 4FP1A 1QW9A 4IGNA 3T81A 2ZRUA 5ABHA 1FWWA 4UFIA 1DXFA 4H83A 3VD4A 2E3ZA 2Y4SA 5I02A 3TOYA 4E0CA 4LF2A 2Z29A 2QLYA 2NLYA 1TVNA 4FZIA 3QMTA 3TYAA 3OG2A 4UQBA 1OCJA 3R6IA 1F5ZA 4JTDA 4FEZA 1ZBCA 3RM9A 2CLKA 2QHAA 3U5UA 2DH2A 2JQXA 2G4JA 4ORMA 4KWVA 1RVKA 3BW3A 3MI6A 1P6CA 1LROA 5CC3A 1XW8A 5C7VA 3OVGA 1IT7A 3NUKA 2Y7FA 5LA0A 1HX0A 1MW3A 3FVMA 4YVXA 2W63A 1RLCL 4YPJA 3AIEA 1YPIA 2ALRA 3B8TA 4DJDA 1K77A 3ARWA 2I9UA 1L6GA 3SDOA 4DUXA 2G3JA 3TKFA 3FXGA 1LL6A 1BWKA 1Z9AA 2QCDB 3TTSA 4A6GA 2FVKA 1CGUA 4U5KA 5CSYA 3PTMA 2PC8A 1QR7A 1MDLA 1RK6A 4MY9A 5DN1A 4ASTA 3M0JA 4MB1A 4KEUA 1E4NA 2Y85A 3UCCA 1UMYA 1HNYA 4WZHA 2QIIA 1B1YA 1CIUA 2OO0A 1Z48A 3M5ZA 3BSGA 4JKKA 4GQ0A 1H4PA 3I68A 2X8RA 1CZ1A 4B5TA 2ZZ3A 4FAMA 4GYFA 4HOWA 4LV4A 4X2PA 1ZALA 2VQUA 3DI0A 1HUVA 4RZ4A 2CZEA 1EP3A 2YA2A 1JYXA 1OFRA 1P43A 1R5YA 2C13A 4D8AA 3LBMA 2INEA 2GSHA 3PAJA 4I9TA 3SECA 4Z2JA 4QBXA 1M6JA 1OABA 3ES8A 5E6YA 2BODX 3EKZA 3S0CA 3C8FA 3W7DA 1S5NA 4HB7A 4P8XA 1TJ1A 2WVSA 2YLAA 1BFNA 3OHIA 1JEZA 5AHFA 4A8RA 1VFOA 3L4TA 3FEQA 2EJ1A 3Q2DA 4FNRA 4OOZA 3PJTA 4TR9A 4I9MA 3TXZA 4ZZ9A 3L21A 3MCNA 3OJGA 4GG9A 4JCMA 1F6YA 4IMDA 5AHIA 1UD4A 1E1CA 2DZUA 3S1UA 2POZA 3IJ9A 5C2GA 3C8NA 2FFIA 4NAEA 3EOEA 1UBSA 4BWLA 1I60A 3BG5A 1S38A 2VCAA 2CBVA 1Q4WA 2OT0A 3TN4A 1GVRA 1E0WA 5D38A 4U4MA 1P5BA 3R5EA 4OV9A 3MWAA 3DH7A 2IPFA 3UZYA 3K46A 3PS7A 3AIUA 1J0HA 1JDDA 3VOCA 2X0HA 5HNRA 2V2HA 3PBUA 4JN6A 5CC6A 1MI3A 4CCEA 3ARUA 1TV7A 2Z2AA 1WUEA 5IDIA 2I17A 2XIMA 2ZDSA 3B03A 3TQPA 5CJMA 3W38A 1WA3A 4RJEA 4J9JA 5FACA 2Q6ZA 3H4XA 5LXXA 4HHLA 3JVAA 3FLUA 4O1FA 4XG1A 2OWCA 2XH2A 3HIJA 3RPTA 4QITA 3IS4A 3KL3A 3LV5A 2JKEA 3W88A 2NX3A 4PODA 1F73A 4ZQCA 2Q8ZA 1B54A 3BAIA 2BVTA 4QX4A 4QE1A 4AWEA 3V0UA 1FH9A 2VUYA 4LY8A 3GIPA 1VP5A 1GGOA 3GAYA 2DZSA 4AD0A 3LLXA 5DQPA 4DX3A 1UG6A 5D32A 1WDQA 2P8CA 3MUXA 3O7UA 4KMQA 1OD8A 4LNYA 5TIMA 1F2JA 1VIZA 5ECVA 4QR6A 1E1CB 2GDQA 2PWUA 3WD4A 1QOXA 1GOMA 3WQ4A 1AJ2A 1W1TA 4NAEB 4F66A 1LORA 3W83A 4ADUA 1GKRA 4KEVA 1D7KA 1RSCA 3SUVA 5DMLA 4KETA 2TYSA 4PCFA 4NI8A 3WDJA 4BF5A 4AIBA 1A5KC 1OFDA 6A3HA 4Z2KA 1XQLA 3DZ1A 4WY0A 4PUWA 1T7LA 2Z1WA 1H11A 3MMDA 2DZTA 1GJWA 4WF7A 1V6WA 3GTHA 1Z42A 3WLSA 2V2CA 2OQYA 3F4NA 1BLIA 1LBFA 3W7NA 1TZZA 4LC8A 1UD2A 1JZ2A 4KRUA 3STCA 5FESA 2XIQA 4MOZA 4ERIA 2PDQA 2BGQA 5IBXC 1H61A 2ATMA 3B8IA 5EFFA 2GJLA 2Q71A 4ZQPA 3WK0A 4XAGA 1UKOA 2I16A 2PP0A 3CAKA 3TOPA 5JUVA 1O95A 2ZZ1A 4HNCA 4TTUA 1CGXA 2PDBA 1U22A 3W87A 4LVBA 2XTKA 1LG1A 3BANA 3TQKA 2WHMA 4JY9A 3T2PA 2WNNA 3DKJA 4MWAA 1BXBA 3WUFA 1TTQA 3TA6A 4R88A 3H21A 2ZICA 3O0FA 4JXCA 3O0KA 3EB2A 4O10A 1AK5A 3VGGA 4HSNA 4LXFA 4E4PA 3C0SA 3UJRA 3GDTA 3N73A 3TROA 3QPEA 1P0BA 4UTHA 3A21A 3QW4B 2BY3A 2OLAA 2BY2A 3GDBA 2HZGA 3K4AA 4RE3A 5I23A 4PSPA 1Q6GA 4EF8A 1C9DA 2O55A 3VDHA 4N4QA 5E0KA 4EPEC 1XLKA 3KCJA 2C79A 4LCRA 1XPYA 4WSKA 2YFOA 3SCRA 2WANA 4L4PA 3I3EA 1DQXA 1ALDA 2ZDRA 4WY0B 2Z1XA 3EOUA 4DRSA 4CNSA 2Z1SA 1XL9A 5J5RA 4WDTA 1W1YA 1ZGDA 3W1LA 2Y8UA 4MAZA 3TR2A 1W9PA 4AZ5A 3NIYA 1Y65A 4DYEA 1W3HA 4F2UA 3I65A 5KMYA 4LVGA 3T7VA 1YMYA 2VFIA 4F0RA 3TTQA 4R5EA 1ZJHA 1GOOA 2XH0A 3N9SA 4AD2A 2R91A 4ENLA 3SRFA 4MADA 4M24A 2B7NA 3AIQA 4M6UA 2YDRA 3KM8A 3VGHA 1EEPA 3MKKA 1HKJA 4H9XA 3TW6A 1ICPA 3HG4A 2X2YA 5AYYA 3V1HA 4JNMA 3S42A 1DJWA 4ZE4A 4GVFA 2RDTA 5D2TA 1BVNP 2QNEA 5DRIA 3FX4A 3RX2A 3WF4A 4F9DA 1QPKA 4MWAB 2PD5A 3CUGA 1XLAA 1EC9A 3OQ8A 4K8EA 3FA4A 4NZCA 5I79A 1Y5WA 4Z1DA 4P61A 3Q67A 1B3OA 1WDRA 3QGKC 3MSRA 3CLMA 4I5RA 4ML9A 3TC7A 3PBYA 4GXWA 4CU7A 2GVYA 5GPRA 3FA5A 4WSJA 4JTIA 1UP3A 5HMEA 5DT5A 2ZXBA 1LRNA 5E6ZA 2X0SA 4CNUA 4LS1A 4KWSA 3UZXA 1Y5XA 2J9ZA 2NUYA 3AXIA 2WXDM 1FXQA 1P7TA 2XPKA 5I3JA 5AN7A 1J6PA 1G69A 1V6VA 4NXSA 4A21A 3V3WA 1REQA 1XIFA 4O1AA 4EX4A 5HXMA 2F61A 2CLLA 3CH0A 4I7UA 4ZQRA 3T09A 4Z42C 1WZAA 3HPZA 3EA3A 3P5ZA 1FCQA 3R8RA 3LCHA 4B90A 2YDQA 2GVGA 1EOKA 1NARA 1W9UA 2H3DA 3DEQA 4Y9PA 4GYJA 2A3LA 1UR0A 3B06A 3L12A 3VE9A 2WZIA 3GXDA 1P0NA 3VM5A 1UR8A 1J5SA 4O1EA 1KD0A 4BJHA 3DHUA 2YL9A 3GXTA 3MSYA 4J3VA 2NXIA 3ANYA 1YX1A 1LUCA 1GVYA 3DFSA 8XIAA 5F4XA 1PIFA 4GMEA 2IKJA 1FKXA 5B7ZA 4GIYA 2W61A 3WNOA 4JFVA 1RXOB 2HWGA 5LIKX 2CZFA 5HQEA 4YU1A 2YW3A 3W1MA 4UTUA 2G50A 4HMDA 3M0ZA 3E2VA 1BF2A 3C4UA 1MW0A 1UD5A 4GJJA 4R3UA 3QBUA 3WMLA 3KZSA 4WY0F 5G5IA 3F4WA 3NQEA 5BXTA 3CL8A 3MC5A 1CT5A 3VKJA 4R9XA 3W7KA 4GNVA 4PTMA 3C2OA 1GNXA 2X2GA 2IQ0A 3PZGA 2O0TA 2P88A 4JIEA 4AHOA 1YNQA 2I5QA 2ISFA 3NOEA 5AZ0A 1JCNA 5M1TA 2TPSA 3S9IA 3TAOA 2QXWA 5TBOA 1P7TB 3N6QA 3BLKA 4S3BA 4H7CA 4CNTA 1H2JA 3C0LA 1CDGA 4XIAA 1M7PA 1MWOA 3LCXA 1NWRA 1TWSA 3MB9A 1REQB 4GQRA 3A4JA 4U33A 4W84A 1HJUA 3VOHA 4Y9AA 1JPDX 1H7RA 1TJRA 1A3XA 1OINA 4XQ6A 4PCPA 1L6WA 2WKJA 1JCYA 1RV8A 6ALDA 4F2BA 1LBMA 1R6WA 1K8ZA 3KS6A 5HWJA 3BC9A 3SUSA 3QKZA 4FX6M 5AVNA 4W5UA 1UUMA 2PDIA 3GNOA 4GPNA 3T0DA 4FB7A 4C7FA 1NWTA 1JUBA 4L61A 4C60A 4DF0A 2W4XA 3V5FA 3APTA 4RE4A 5M17A 3UZZA 1XLCA 3OP2A 3GAKA 1NDYA 1V7AA 4NQ1A 2WJZA 3PG9A 4KCWA 3IVSA 3Q45A 3HQ1A 1TRIA 1LUCB 3WY1A 2DW7A 4IPLA 2ZX8A 3H22A 2XFFA 3NOYA 4QEEA 4PMYA 4ERAA 1J0KA 1KM4A 3H2NA 3W7GA 1DHPA 1FWNA 2WMGA 5HULA 4AZBA 2F8QA 4K1GA 4FSAA 2BGSA 3AUOA 3AHZA 5BCAA 3DOPA 2VR2A 4H6KA 1KGXA 4JS3A 1G67A 1ZFJA 1I2NA 5DXXA 4ILSA 5HNTA 1VYSX 3VIHA 3BCFA 4LWWA 1KCZA 1FWGC 2C18A 3P84A 1ITCA 3VDGA 1DBTA 4D6DA 3G1FA 1MNZA 4FIQA 1XLEA 3FS2A 3THDA 1JI1A 1KQYA 2Z7GA 5C2XA 3C3UA 3NZQA 4E5TA 4IPJA 3TU9A 3LQLA 4ZO9A 2CLPA 3DX5A 1OGSA 1E3XA 1VENA 4FXJA 4LY4A 4F2TA 4RPPA 1FWRA 4P5UA 4Q8NA 3L65A 1YRRA 1AL8A 1QW8A 3OVPA 5C9RA 4DI8A 1XYMA 3PP7A 1XBVA 4RE0A 1R3RA 3VFLA 1F3EA 7ENLA 4PMJA 2V3DA 2DDXA 3STEA 4Q4RA 1FWJC 4GZJA 3M07A 3WDHA 3KP0A 3T6CA 4DBDA 1UD6A 2A3CA 3ITVA 1AVAA 1H1YA 4PCTA 3BICA 5CBIA 3VKDA 1SQ7A 1XKYA 1AFSA 3ELFA 2R9RA 2XM2A 4HHPA 5A8QA 4MLRA 1OFEA 3ARSA 4TIMA 3LHVA 3E5PA 2HS6A 1AW1A 3RLHA 1TWZA 2VM8A 2C6QA 2CLFA 1E4IA 2C8NA 4XAFA 1YQ2A 4G8TA 1N7KA 3H2FA 3W7OA 4A22A 1V3JA 1ONRA 1QPRA 4BZYA 1P0EA 2BNJA 4JX6A 2NQHA 2Z27A 1V0LA 3KDNA 1H0IA 1XIMA 3IVUA 1NP2A 1OX4A 3AXHA 2W66A 2BV9A 4XUYA 2FMOA 4XVDA 3ARQA 2AKMA 2ZIDA 1KBJA 1HJVA 3G24A 3N9RA 3P62A