3QVQA

The structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
251
structure length
251
Chain Sequence
GMQSAYSFLPQVIAHRGSSGQAPENTLASLHLAGQQGIKWVEIDVMLSGDGIPVIFHDDYLSRTTDGDGLIYKTPLAELKQLDAGSWKGQEYQQETIPTLLEAIEVISQYGMGLNLELKPCEGLEEETIAASVEVLKQHWPQDLPLLFSSFNYFALVSAKALWPEIARGYNVSAIPSAWQERLEHLDCAGLHIHQSFFDVQQVSDIKAAGYKVLAFTINDESLALKLYNQGLDAVFSDYPQKIQSAIDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an Oleispira antarctica phosphodiesterase OLEI02445 in complex with the product sn-glycerol-3-phosphate
rcsb
source organism Oleispira antarctica
molecule tags Hydrolase
molecule keywords Phosphodiesterase Olei02445
total genus 96
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature ec 3.1.4.2: Glycerophosphocholine phosphodiesterase.
pdb deposition date 2011-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3qvqA00
3KS5A 1VD6A 1DJIA 1DJYA 1DJHA 3EA1A 3CH0A 3PTDA 2PLCA 1GYMA 2P76A 4PTDA 3RLHA 1YDYA 4I90A 4F2TA 3QR0A 4QJ4B 2ISDA 2PTDA 5T9CE 1DJGA 3MZ2A 1DJZA 1T6MA 1PTDA 4RW5A 7PTDA 5PTDA 2O55A 4F2UA 1ZCCA 2OR2A 4R7OA 4I9JA 2F9RA 3QVQA 4I9TA 3H4XA 1QASA 3I10A 4F2BA 4OECA 4GNKB 4Q6XA 1O1ZA 1QATA 4S3GA 1DJXA 1XX1A 2ZKMX 3NO3A 3QR1A 1DJWA 3H4WA 3EA2A 4I9MA 4RV3A 3L12A 3EA3A 1AODA 5T9BG 1V8EA 4QJ5B 3V18A 4RW3A 3V1HA 3RLGA 1T8QA 2OOGA 3KS6A 4I8YA 2FJUB 2PZ0A 2OTDA 4QJ3B 5T91A 3V16A 6PTDA 1PTGA 3OHMB
chains in the Genus database with same CATH superfamily
5A2AA 1QHZA 2VRJA 3ABQA 4EXBA 1FHLA 2R1MA 3L9CA 1H1ZA 1PPIA 3GZ3A 3E9AA 3SRDA 2W62A 3SDOA 1AW5A 4IMEA 1GVIA 1JPDX 3ITLA 4AD1A 3KVKA 3AISA 3UZJA 1LQ2A 1EBGA 5AKQA 4RDZA 2GK1A 3WUEA 3GZAA 4HYWA 3RU6A 2ISFA 2PUZA 4A2RA 4EWJA 3SB0A 4RLIA 5I3IA 3ZO9A 5CEWA 5HA7A 1RH9A 2P8BA 3V36A 4GZEA 4MJ2A 4M82A 2P0OA 2XIBA 3S1XA 1G4SA 3PF3A 4HYVA 3E2VA 3GIYA 5C8BB 1GW9A 2GLKA 3V5CA 1A5BA 3LRKA 1BVNP 2HWGA 2QPUA 3WH9A 3I3EA 5BNKA 3VD4A 1WKFA 3EA2A 3EPNA 4WXYA 3E49A 1LTDA 3AZSA 3C52A 4GJIA 2VZTA 3P6LA 3DUGA 4DB7A 3SY5A 4ZMGA 4URIA 1JXKA 4RNHA 2LLEA 3G1YA 5EMLA 5C7VA 3GC2A 4PUKA 4PB4A 1B3YA 4IGSA 1TREA 4JDYA 2C0AA 3WLNA 1QI4A 1W9UA 2ALDA 1UJQA 2G50A 3K13A 4LEQA 2BOGX 3GDKA 3A4JA 1OCBA 3BZGA 1TJ1A 1EP2A 4KS0A 5C9UA 2QIWA 1KWGA 4GBDA 4JNYA 1VEPA 2ZE3A 2DFAA 5E70A 2WKJA 4R9XA 2CU0A 4EPKA 1G6CA 4KEMA 3DESA 1SW7A 3W73A 5D2YA 1SZFA 2BY1A 1HF6A 1GYLA 1R3SA 3GH5A 3N12A 4B4HA 3SECA 4L9ZA 2OOGA 6PTDA 4EIVA 2VELA 2OJPA 3CLMA 2ZWZA 2ESCA 2PLCA 4E2OA 1OSEA 1AQ0A 1QPOA 1EJVC 4S3KA 1W5NA 5C9WA 2RFGA 1U30A 3QKZA 1KWKA 1K8ZA 4NHVA 3WLSA 3W2UA 1W3LA 4B3ZA 2F2KA 3AC0A 3TCSA 4GI4A 4RX0A 3RG6A 3TW7A 1V6TA 5BU6A 3WJWA 1H2JA 2VDHA 4RXGA 3MVTA 1B0IA 3NQ2A 4HCDA 3LK6A 2JIWA 3QHNA 2WCGA 3VGBA 3F2BA 4LS2A 3AS3A 4IL0A 1UZHA 1VYPX 1BEUA 2BY3A 2BLEA 3OP2A 3N9KA 4I3GA 2GL5A 4DY1A 4WEVX 1LLZA 1GZGA 3LLFA 1JPHA 3GTFA 2WLZA 3OZMA 2VOMA 2ZXQA 4GACA 3GFXA 2AGTA 2O55A 4D72A 5L9FA 2VC5A 1TJ0A 4GI9A 1PZ0A 4J27A 1FWHC 3H4WA 2ZRUA 1UD6A 1C8VA 4AHPA 2NXGA 2YCLB 4DUOA 1XIEA 1QNOA 3IJ9A 1PIFA 4B9ZA 1K1DA 1UD2A 4L9YA 3SI9A 2AL2A 1C7TA 1NOUA 1TZ9A 1GNXA 1OFRA 2HK1A 3MDWA 2DZVA 1LUCB 4IP7A 1PZ3A 2BVTA 1W1PA 4ADSA 1KR1A 3KM8A 4N7QA 3PVFA 3WKZA 4JAWA 1ME9A 1JZ7A 3B03A 1QCWA 3V3WA 1NOFA 4PTXA 4PUNA 1MXDA 1TV7A 5D30A 1GPWA 5HWNA 4CLMA 3E3HA 4PL2A 3F5KA 3STPA 3AU6A 4EX4A 1DWIM 3F2CA 1F4AA 4MY9A 1PZ1A 4HTYA 3TV8A 4LCRA 2FVKA 1E6SM 4A8LA 2IKIA 3HBLA 4S3FA 1VJZA 2FVLA 1KRCC 1CNVA 3EB3A 5DY2A 4MKSA 1FWDC 4LJ3A 3EWZA 3DEQA 3RILA 1M3UA 2AMXA 2WOQA 1C9WA 1Q2RA 1KV8A 1WO2A 2OQYA 2PDCA 4JGDA 3T1GA 1H62A 1UD8A 1H0GA 1M68A 5F2IA 3DFOA 4KWSA 3SZ8A 4Y9NA 3LUTA 4M7TA 1BGAA 4H2CA 3A9BA 1WDDA 3NM3A 2VNCA 2W67A 2ZX9A 4YS1A 3CMGA 1EGZA 5A8PA 1RY0A 3T0AA 3RNDA 2GOKA 3U5UA 3HQOA 4CQ8A 1X96A 3N3MA 1W9DM 4NASA 1R85A 1AUSL 1FDZA 3F1QA 2PB1A 5A6KA 2OWXA 1DE5A 2HE8A 4QJ1A 3GUWA 3REQB 3WG6A 3SGZA 3DHFA 3QV9A 4DWSD 5KTLA 3ZMRA 1JUEA 2J7DA 4I5UA 2O9OA 1TSIA 3AMLA 5CZ0A 2WZTA 1FCQA 2E28A 1YRRA 4GC3A 1XUZA 2C79A 4U4MA 5K7JA 3CUFA 2A3EA 2NT0A 3ALFA 3PPGA 5CPQA 3THUA 5E9XA 4A05A 4P8VA 1S1RA 1MQRA 3EYPA 2RHGA 4NL1A 2GZXA 2IXUA 3MSRA 1NTHA 4I8YA 1XLJA 2P50A 5KINA 2XFRA 1SGJA 2ZUVA 4QG6A 4Q7IA 3DC8A 3E2QA 2VOTA 3VILA 7XIMA 1GOWA 4WSJA 2VEFA 4PUEA 4LX4A 1AH4A 4BS0A 1PB0A 4KWVA 1EO5A 2L5HA 4BKNA 3S47A 2G3IA 3OIXA 4EOUA 1FHDA 3M0IA 4HNNA 2FHFA 4LAMA 2Z1WA 1W3IA 1EX1A 2WM1A 1W32A 1K70A 1OGGA 4OV4A 1VBGA 3OZPA 1EF3A 2Z1KA 3OJGA 2BASA 2YL8A 3UYCA 2ZE0A 4IICA 1L6WA 4AWEA 3VOIA 3G0XA 3EWUA 3BZJA 3LTPA 2VP8A 2C15A 3SCNA 4IQLA 2YDQA 4TTUA 1JYNA 2Y8UA 4OOZA 4PUUA 3P0WA 5GVJA 3EOUA 4PMVA 5D9MA 2CZ5A 1E1EA 1QWGA 3RLGA 3VU2A 3TJLA 3BUVA 4MUPA 4QNEA 5I23A 1TWDA 2OGJA 4WGHA 1WUEA 5DMNA 1O94A 7PTDA 3LV5A 1BXBA 1WQ5A 1NM9A 1KFWA 2DZUA 3NL5A 1H61A 3LGEA 1MNSA 5KZMA 1W3TA 1TPWA 2JKPA 2VL4A 3D3AA 2ZZ3A 2W91A 1XG3A 1ZTVA 1N8IA 5I2UA 3CBWA 3FGCB 4IPNB 4JCLA 1FFQA 2QUUA 3GXDA 2VR5A 1W3HA 2OZ8A 5LXXA 2PDWA 3ME3A 3BAKA 2DT2A 4LUTB 1LOLA 5MKGA 2DP3A 1P6CA 4W7WA 2FMOA 3E2RA 5EMMA 3MJYA 1CXLA 3EWDA 5CJNA 5EYWA 5BROA 4C90A 1EOKA 1NJJA 1IEVA 2R9RA 3PJXA 2Z27A 5A5WA 2G0WA 1R3TA 2C71A 2J13A 3ZQ9A 1E0XA 3O05A 5LNWA 3MPGA 1QWKA 1LDCA 4GOAA 3PS7A 4PMZA 4OKDA 4XB3A 4LUIA 2Y6ZA 3UT0A 4D6EA 1UHVA 2D0FA 4IH3A 4DUVA 1R47A 4O28A 4IMAA 4IIHA 1M7OA 1F8MA 4O13A 3NL6A 3PBWA 4KETA 3EXRA 1W9PA 3PAOA 2NV9A 3O9NA 5BXPA 5I0DA 1CECA 4BFAA 1WAUA 2YCIX 4A29A 3VUSA 3GVVA 1ME8A 3FJNA 2QR6A 4HIBA 3B8SA 4UFLA 4FX8A 1W54A 4PFHA 4CD6A 1JPIA 3EBVA 3QMTA 3WENA 1K8XA 2W63A 3WLKX 4OBSA 2E40A 3UGRA 1QK2A 4KGJA 4MGGA 1SR9A 4M24A 4P8UA 1DJZA 4NX5A 3INPA 4E2VA 4AU0A 4Y8EA 3NZRA 5CJMA 1KRMA 1QO5A 1TV4A 4O0KA 3VKDA 1TCDA 4S3AA 3GK0A 3AHZA 1UWSA 4JTCA 4GXWA 3RITA 1QI2A 1XDLA 2WCSA 2V6AA 3PFMA 4B90A 1EJRC 3A22A 3UEQA 3LERA 2D20A 1UUQA 5IDIA 4FPSA 1MZRA 5LIUX 3WD1A 2Y5JA 3N29A 3GTXA 4DAIA 4DM1A 2WWDA 4ERAA 4QJ3B 1QW9A 1E0VA 3C0JA 1GVYA 2DSUA 2NQLA 4FLQA 2ZUNA 3M07A 4IG2B 3B0VC 1MXGA 4JTRA 3VKBA 2P8CA 2ZKMX 1VBRA 1RY8A 2Y0FA 3M0XA 2J7GA 3WNPA 4IFKA 4JIEA 1H7XA 3GVWA 1QR7A 4PUWA 1I0BA 1LLWA 3T2PA 3BG9A 1PDYA 3E6EA 1B9ZA 2E8YA 3HJZA 1MEIA 4AF0B 4HZ6A 4HPJA 1PUDA 2PTXA 3H4GA 1WDWA 3OPSA 3SW6A 2ZDSA 2ZRZA 3DN5A 3IUHA 4WDXA 2JIEA 3WBAA 1MFUA 4B15A 3NQVA 3KCLA 2CW6A 3MO7A 1PIIA 5AZ0A 4PMNA 3MCNA 4KBXA 4BK9A 3RCMA 5CXPA 2BHYA 3WNNA 1OCJA 4S2BA 2V2DA 3BG3A 2BDQA 5D9PA 5CPNA 2HISA 5FAGA 1Z3NA 1CLXA 3WK3A 3HQNA 3C5QA 3ARXA 4JTDA 2OEJA 2F2HA 4A3YA 4WKFA 2WJEA 3LGDA 4BY3A 3OVQA 4XD4A 3GNXA 4B3LA 4L6OA 1E0TA 3CTTA 3LBOA 3CM4A 1WNOA 1Q65A 3FGCA 3LPFA 3UF9A 1IEWA 1QATA 1ZSXA 4TVCA 3HURA 2XH7A 4MDPA 5HNTA 4OUIA 3KZPA 4A8IA 3KOYA 1PYMA 3UR2A 4H04A 2CLPA 4PCTA 3PTDA 3DXIA 1NIUA 3AYVA 5A6JA 3VNMA 1KXHA 2XIJA 4O17A 1JCXA 1JCYA 2AL2B 4UQCA 2RKXA 4ZZ9A 5TD4A 1MEWA 4B92A 3PUGA 5D2VA 1AW2A 1IEQA 2PA6A 1OX4A 1XINA 5E0KA 3T08A 4YWIA 3COTA 4UR8A 4CKQA 4D1JA 1PTDA 4H83A 1TZZA 4HD5A 1XLGA 4EK7A 2XZ9A 2VDGA 4XZWA 3HG3A 4D6IA 1RJPA 4RUBA 4KPLA 3GW3A 4H41A 1DKWA 1P0EA 2YZ5A 1S39A 1TFVA 3CT7A 1EB3A 3P81A 3UWUA 3T4WA 3K1DA 4M19A 1ITUA 2J9YA 2R8WA 3ITGA 4NP7A 2OGYA 4M5PA 4QCEA 5H8MA 3TIMA 2QKFA 2B7NA 3FSUA 1UD4A 1VRDA 1H49A 2XFWA 3H53A 4UTLA 1E5JA 3W86A 5LSMA 1J8VA 4DO6A 4ZXLA 3AROA 4AW7A 2CBIA 5HOSA 2YDSA 2J77A 3LM3A 5CAKA 4RL3A 1OFQA 2AGKA 4K39A 5IOBA 3H26A 1X1NA 3DGBA 3ZR6A 4O1DA 1U1UA 3DG6A 3OG2A 2Z26A 3BV4A 2YA2A 5EBUA 1Y5WA 3HV8A 3TDFA 3QY7A 4G1KA 1A5OC 4S39A 3LXCA 3MMWA 5EL1A 1VAHA 1K6WA 2PF8A 2ZA2A 1NELA 1E5NA 4X9SA 2VR2A 3SIMA 1KTCA 1Q6OA 4PH6A 1A53A 1RJRA 4V27A 2D22A 4Q7NA 4ECLA 1UOZA 1W1B1 1UC5A 4DJDD 3H7RA 2PF0A 1OK4A 5KSWA 3CUHA 1BQCA 4LALA 1XF0A 1JAKA 1XBVA 4KF1A 1Y65A 2QIIA 2XGIA 1UKTA 2GSJA 4F2BA 5TAOA 5C70A 4I6KA 4D6GA 2OX4A 4ICMA 2RJGA 3CWHA 3BCDA 4QAWA 3UWQA 1M53A 1MFVA 2BSLA 2X8RA 3M1ZA 3WMSA 1YW1A 4C5ZA 3VGHA 3GE7A 3OU8A 5D32A 1TMHA 3CQHA 3WZ0E 5BZAA 1ZL1A 4Q32A 2YPIA 3WYZA 2GVYA 4PEEA 3VMOA 2BGQA 2NV1A 1YDNA 2PS2A 3W7GA 1R3QA 3N6HA 2GJXA 3TFXA 3QW3A 3AJ7A 3U48A 1ECQA 3F5LA 3OO2A 1DV7A 3UXLA 3WDJA 1XLCA 3NPVA 2BXYA 4A22A 3S5NA 3EOLA 4HZMA 3S6DA 4IWWA 2PLKA 1D3GA 4NVTA 4S3CA 2VTFA 5I09A 2J9XA 5D04C 3N9SA 1DYSA 1NWRA 4PCNA 1FWRA 2VC9A 5AN7A 1PJ9A 3OHIA 3MMTA 4D6DA 1ZJBA 3S6OA 3P60A 1XICA 3W29A 1S38A 1TWIA 2WVSA 4RNIA 4YNGA 3VFLA 3EEZA 4DUWA 1TE6A 2NUWA 3ZXWA 2A3AA 1WBHA 3S42A 1QUMA 1WB0A 3WD2A 2CXGA 1P4CA 3CPGA 2XWEA 2VR4A 3NPWA 1ZU8A 2R6OA 4PZVA 3B8IA 4PCSA 3C86A 3HGRA 3TCEA 2FHCA 1E4NA 3CHDA 4TOQA 2C13A 2EGZA 4YMZA 3N25A 4XIAA 3VDCA 1E40A 2VD9A 1K7EA 3WNMA 5IXEA 4C6KA 3H2MA 3VDHA 4O4VA 4IMFA 1W31A 2YXGA 4J3UA 3EB2A 1QI5A 4O10A 3R43A 3WCZA 4GKTA 4C7FA 3M0JA 1HJWA 4AZ7A 2PWFA 4UZSA 4AHQA 4DWSC 7REQB 1ZP4A 2E09A 4GQQA 3GAKA 1T0OA 1ZBCA 3WY1A 1XIJA 5C2CA 1EBHA 1HW6A 4ZGYA 1XKYA 4MWAE 3PN8A 1Z32X 3VNLA 2O9TA 3DZ1A 4HPNA 2I17A 2VGBA 4WR3A 3TTOA 4QG8A 4XBKA 5AC8A 3VNIA 4U2ZA 4HHLA 4IFOA 1V4YA 2A6NA 2X1IA 4O1FA 3PNZA 4IGMA 3TTSA 3A64A 3SUUA 4LV9A 1PKLA 2E5DA 3BW3A 2A79A 5B7YA 1VZWA 4S2CA 4KEZA 2QF8A 4QDPA 1NQ6A 3OVRA 2TODA 3LRMA 3JVAA 3N17A 1M6JA 3CAQA 3TAOA 1Q85A 3E0FA 5ABHA 2OU4A 1S5TA 3GS6A 4K7YA 4ORMA 3AS0A 3G1DA 3KOWA 2A0NA 2RGLA 3WSUA 2CWNA 4HA1A 2Z1XA 4L5ZA 1HXJA 2JF6A 2NX1A 1HTIA 3GVGA 2X42A 2H9AB 2YL9A 3P3BA 3VZYA 1D3CA 5JIWA 1VHCA 4ZFMA 3TFCA 3D3FA 2ONEA 1UP0A 3AYTA 4DAFA 3IUIA 4S3BA 1D3HA 3TTYA 3WFZA 4AG0A 3WQ6A 5LKYA 3UJRA 3GKAA 3U7BA 2WMJA 3RK8A 1C3FA 5EBAA 4I90A 3NDYA 3GG1A 4FXFA 1CTNA 3GXFA 4UQBA 1IT0A 4DJDA 5G4WA 3EX3A 2WSQA 1EJXC 2C1HA 2QNEA 2WZIA 4ZQNA 2WSKA 3ALGA 2D2HA 3GHUA 4AH7A 1JIBA 1S5VA 3KS5A 1SSDA 1UH2A 5BMXA 3FEMA 1V5XA 1QDSA 4I7VA 3EDDA 1B30A 2TYSA 3LYEA 2OCZA 2OODA 4Q6JA 1V3JA 1W9BM 3BW2A 3T9PA 4WD0A 4RXFA 1QPKA 4JTFA 2WSPA 3CAVA 3WLPA 5LIXX 3BWWA 3CL8A 1UWIA 3UWZA 2YR1A 4GGHA 3SFWA 2ZX7A 4HCLA 4W88A 4JTEA 5J5DA 5HAOA 3LENA 4D8ZA 4HP5A 4C6MA 1FY6A 3R0UA 1IR2A 3N2TA 5D2WA 3OLIA 1R2TA 3AWNA 4O19A 1V8EA 1TPFA 2RH9A 4U31A 1CGVA 4NG3A 3UXAA 3UD6A 2I57A 3BSHA 4K1WA 2GQAA 1H7NA 1R38A 1TWZA 3GB6A 4KERA 2V2CA 4D2JA 1JD7A 3GTIA 5HPOA 1Y5VA 1MYRA 3CV1A 3OG3A 2G37A 1XIHA 5FESA 3CUGA 2WPGA 4ACZB 4K6AA 4L1GA 3VD3A 2GUYA 2XIOA 1TO3A 4AXKA 2DEPA 1PO9A 3SJ3A 2J66A 3P74A 3D46A 4PRTA 5JXQA 2PZ0A 3VIGA 1JFHA 4Q33A 3ABOA 4L4OA 4QNWA 5JBFA 2FHBA 2PBGA 1CWYA 4LVFA 3WH8A 3A6OA 3AXHA 5C55A 2CZEA 1LJYA 2YZRA 1LOQA 4U10A 3T81A 2Y4SA 3VD5A 2BTMA 3WN6A 4JKMA 1XG4A 2J4GA 4TU1A 2J62A 4GINA 3NPXA 3SY8A 4MJZA 3MZNA 2UBPC 1Z7AA 2PWDA 1R86A 1PWLA 3C3UA 1YE4A 4QISA 4DF0A 1G94A 4M1RA 3SRKA 3MP4A 2VURA 2WHKA 1OFPA 3Q37A 1H1YA 4NYYA 4I5RA 1A5CA 1BG9A 2C7FA 2AQVA 3AHVA 1ALDA 3FV9A 1VLWA 2POTA 3BAYA 3FJLA 3PB2A 7TIMA 4GYPA 2X1SA 3AHTA 2Z24A 3ZS4A 2HK0A 3VUPA 1JUBA 2FB3A 3ARSA 3ES7A 4MJMA 3P84A 4ZB2A 4AD4A 1FH8A 1A50A 4M6PA 1BF2A 3BTNA 2YBTA 4ICCX 3M16A 3H22A 1LORA 5HUPA 2BOEX 1L6FA 1ML1A 4W7VA 3QOKA 4NAFB 2BS9A 2E7FA 1UWQA 3T2OA 1AD4A 3CZJA 3NQDA 3PSVA 3TP4A 4F40A 2DDXA 4JTKA 5T9BG 4KIEA 4AZCB 1MRAA 4HU8A 1JGIA 1Q13A 2E6AA 4W5UA 2WVVA 4UOJA 4PMUA 1WKDA 4DJFC 3EXTA 2XH4A 2ZX8A 1ME7A 3T44A 3SQMA 2I7GA 1K9TA 2I14A 5A8GA 3NZGA 1LG2A 3QHMA 3AZTA 4CD4A 3C3NA 5HJYA 4HNCA 1T8XA 2CXEA 4MJ4A 2TRSA 4H6KA 3GNRA 3SEPA 2PDMA 1DJXA 4O8RA 2R1KA 2VCAA 1EA0A 3CASA 4X2RA 4J3XA 4MTVA 4ZR8A 4ZBCA 3F4CA 3HO8A 3AHXA 2ZBTA 3RCNA 1EJTC 4QR6A 1YEYA 3IJDA 3O15A 1DWGM 2QCDA 4GHRA 9RUBA 1B4KA 3SCUA 3TQVA 1X6UA 2ACQA 3QPYA 4HN4A 3T55A 2CLHA 2ZADA 3N2MA 2VUNA 3ENLA 5I03A 3CGTA 2JE8A 1OJXA 2AKMA 3W01A 4OU1A 1DWJM 1J5SA 1RA5A 2DY3A 4WOZA 5EY5A 4P61A 1R8LA 2EKCA 1UIOA 3H6OA 2PRMA 2XJ7A 1XD0A 3IGHX 2QDEA 1OBAA 1QFEA 4AEEA 1NY1A 3BLFA 3FXGA 1K6AA 2YOCA 3W71A 4QX4A 3N2CA 2KAUC 5I77A 4HPGA 1J0HA 2E6DA 2QDDA 1V77A 4IIDA 1JF6A 3Q94A 4HU4A 3IJ8A 3OW1A 4X61A 4WVXA 5D05A 3BLOA 4Z2IA 3KLLA 4KFOA 1S1PA 1SQ7A 3BAIA 5DRCA 1CW2A 3LCHA 1CBGA 2WVTA 1XKJA 4HU0A 1W1TA 1GOKA 2DSWA 3WNLA 5BCAA 4MB3A 2PDNA 3TN6A 4GH1A 1AVAA 1XRFA 3LCLA 1Q6RA 3HIJA 1W6TA 3NGFA 3AAMA 3KEHA 1XYAA 4PR4A 4Y9OA 4K1GA 5DY3A 4IX2A 1NP2A 3CZKA 2HDJA 1CPUA 5H1WA 3MSDA 3HFTA 4QSFA 1TV3A 3SM0A 2FQIA 4JIHA 4CQBA 2A2IA 1IZKA 3IARA 1ADSA 4DX3A 2E5BA 2YGYA 4KCTA 5D9NA 1PAMA 3QYSA 1PYFA 1KFLA 2E25A 4PMJA 3SSZA 2VO5A 3LSBA 3OYZA 2X0SA 3C2VA 2D23A 2VYOA 3UWYA 1JFXA 4K36A 5FJJA 2Z1BA 3M43A 4GE8A 4BWLC 2PWVA 4N02A 4TX9A 3SIZA 3L0NA 4EF8A 1GTEA 1OYCA 3IJQA 1UYQA 4GIEA 3FKRA 4AYGA 2INEA 3M0LA 3O07A 2QMJA 4DI8A 3KRSA 3UJEA 3N1AA 1XLAA 1B31A 3W1RA 1VFUA 2O92A 3G8RA 3QOMA 2G95A 2XVKA 1OC5A 1IEXA 2V5JA 2D24A 3VE9A 4O0QA 1I60A 3BCJA 1GOIA 3LCWA 1MW2A 1LLOA 2WC4A 4JX4A 5JMUA 3ITYA 3M7SA 3CTLA 2PE4A 1A0CA 1SFLA 1JCJA 2XINA 3IVUA 2WMGA 3CZGA 1UQZA 4AX6A 5DT5A 4JFTA 3KDNA 5CQ1A 2JEPA 1J18A 4JTGA 1ICPA 1V6XA 2ATMA 3LG3A 3L4UA 5I02A 4DBUA 3KBMA 2B0MA 4Q8OA 3W0KA 3GNNA 1VC4A 2HXUA 2TAAA 1DVJA 1FWIC 4LU0A 5ECUA 1RBOB 2XIIA 3PBMA 1VCFA 2VZOA 3XIMA 3ZSTA 3CV7A 1PIGA 1RQHA 4ZODA 1PDZA 3IVSA 3AMKA 5LA2A 1IE7C 4WZHA 1FWTA 4JFVA 5BYWA 4AWSA 5E1QA 3SFKA 1B4EA 3B97A 1BXCA 3GC5A 3OQEA 3TKFA 4AVFA 3TWBA 2VFHA 4BWLA 1EZ2A 1RAKA 4FNRA 1J4EA 1FWFC 1PS9A 4J2MA 3LHVA 1V0LA 3OIHA 4LVBA 3RX3A 1J0YA 1OFOA 3HMJG 2C19A 4G6CA 5LGZA 4NJJA 3PUEA 2ICSA 1HKKA 3GVQA 4AVOA 1Q5MA 2CLLA 5DF0A 5JUVA 4DJDC 1QBBA 4PSRA 2XYLA 2G3NA 2PDBA 2A7PA 4J3VA 4N2YA 2VWSA 2BBFA 4GY0A 3AI0A 3WIJA 3KL0A 3T8QA 3WQPA 3N2OA 2PD5A 2PWHA 3SR7A 4AD5A 4M51A 1YE6A 1GZ1A 3FSTA 3V7PA 4C7DA 1B3XA 3CV6A 4N6EA 1XD1A 4WSKA 3LD5A 1Z41A 1JPMA 1CYGA 1E6PA 4HA4A 4IMGA 3UCCA 3L2IA 3RF9A 1OWQA 3WBEA 3R4IA 3M0MA 4Y2WA 3WJSA 1YNQA 1GQNA 3DYPA 2I16A 5LNUA 3DYMA 3ITCA 1ZENA 1X7FA 1LL7A 3KBNA 2GSEA 3RN6A 1NOWA 1ZGDA 1H5VA 1TKKA 1DJYA 3I4EA 3QR3A 3SSJA 1FTXA 1NDWA 1BFNA 3MCMA 1LL6A 1E6NA 1KA9F 1VYRA 1E0UA 3U0HA 3UWEA 4LAKA 2WMKA 2EJ1A 4FX7A 3BLKA 4UB9A 3N04A 3M41A 1QPRA 5EMYA 3JRKA 4ASTA 3IRDA 2ZYFA 3LOTA 2FVMA 3MUIA 1GPFA 1Q6FA 4W9TA 1GG0A 2R94A 2R1LA 3G3MA 1SMAA 3ZVHA 3PZTA 4MHBA 3GKFA 4ZO6A 1RVKA 2IXVA 4LUSA 4G9PA 4L1XA 4C6IA 2A3HA 5M03A 2QYGA 1TX2A 4HOXA 5CZJA 4HMDA 1QBAA 2GWNA 4EKJA 3OBAA 3URQA 3ONCA 3T8LA 3RJYA 1SJAA 1RCQA 1QXLA 2Q8ZA 3TSDA 5AYZA 3SGGA 3WQGA 1N7KA 1EPXA 1H1NA 3ARQA 1DQWA 1JCTA 4JFUA 1G9HA 4IXXA 4RZBA 1ZQ5A 1UH3A 4UQAA 2HROA 1ECEA 3WUGA 4ZQPA 4NRRA 4K8HA 7CGTA 3PG9A 1VP5A 1TR9A 1DQUA 4FR1A 1F3TA 4CNTA 1GJUA 3W2NA 3W7OA 2PGFA 1XYLA 3LPGA 1EXBA 4IJRA 1LWJA 3IK4A 1XYFA 3MTWA 2XIMA 2WK2A 2XG9A 1W3JA 3QHOA 2DVUA 4ZENA 4PC8A 2PLJA 4NI8A 2O9PA 1AFSA 2VQTA 3VKAA 4H19A 1QNSA 4U2YA 4K8EA 3BK0A 3MO4A 3W24A 1QNPA 1I9CB 1VPQA 3S2MA 1SMDA 3AXIA 3RLHA 1SW3A 3I65A 3JUGA 1GVFA 1ISYA 4GCXA 1DJGA 1XDMA 3OTRA 4A3RA 2XTKA 1ZBKA 3G1RA 4LPCA 4Q8QA 3VD7A 7REQA 4JNZA 1HKVA 3THDA 1W5OA 4FEZA 3NM1A 1HQTA 2W61A 2W3ZA 1OK6A 1ZHAA 2NVCA 4EPDC 2GUBA 1KKOA 1X39A 2REQA 3B0YA 3AIWA 1EHAA 3LLXA 3TR2A 1V6UA 3UERA 1W8SA 4XZIA 4R34A 1VCGA 3MUXA 5A2CA 3VGEA 3N9RA 4MF4A 4OOUA 4C6PA 2Z1VA 1A3XA 4AFYA 1JEZA 1ZNNA 4JEJA 5EMUA 1H7RA 2DUXA 1XX1A 3F5JA 1Q8JA 1F74A 2FGLA 4E6MA 2C16A 5DMLA 1VFHA 4M7SA 3WMBA 4O12A 2PURA 3RAOA 1GYMA 4F2TA 2BHUA 3DU0A 3GTHA 2XDFA 1WP6A 3VZXA 2VEGA 2OPJA 3A3WA 3ICJA 3QTPA 3OVPA 4S38A 1LRQA 4CUCA 1TJRA 1NWTA 1AQHA 1XGDA 2NQJA 3QY8A 3R11A 2X7WA 2HMCA 3IJ6A 4GIRA 3APYA 3B0UX 3CQJA 4MNJA 1R3YA 3GIQA 2JEQA 4R33A 1Q6GA 4E38A 4LF1A 3CB3A 3NQFA 3LPPA 3B9OA 4PTVA 2IW0A 4XKMA 3UY8A 1BLIA 2E3ZA 3M0VA 1XSKA 3RPMA 2V5KA 3MYOA 4M80A 4MNLA 1H63A 2PP1A 4G7EB 2CERA 1R7AA 3IVTA 3LCGA 3WJYA 1EDTA 4EF9A 5KEZA 4LV4A 4REQB 2C0HA 3O16A 2ISDA 3BDKA 1R9YA 3STEA 3GG0A 5DCBA 4WSHA 1HZYA 4JQ4A 3E74A 1XRTA 3K8LA 1K9FA 4OJYA 4FHAA 2G4FA 4LXFA 1PTAA 1REQA 3P93A 4W5ZA 5AVNA 4JYEA 3I68A 3QBUA 3NVDA 4RZ4A 1XM3A 1G4PA 3K4DA 2HBVA 3EOOA 4E4PA 1K8CA 2QV4A 1ZFJA 4DBWA 4QDWA 3L67A 3KXQA 3EWXA 2FDSA 1LWIA 3OODA 4C5YA 3QN3A 6ALDA 4AYSA 1L6YA 3H2OA 2DZBA 1V79A 2J6VA 2QJNA 3OZOA 3V0SA 3CXOA 4IP5A 1D7KA 1E6ZA 2VZVA 2AKZA 4M6UA 3S2NA 1PZ2A 3D5HA 4V1XA 2NT1A 4JQ2A 3IJ7A 2GQ9A 2QZRA 1A5LC 3S46A 1IGSA 2C14A 1XH2A 3TSBA 1XIMA 1GJWA 1RXOB 4DO7A 3IV3A 3PWAA 4H8UA 3NOYA 4XWUA 3GRIA 3KCOA 1V6VA 1PTGA 4KWUA 1I4NA 1EXPA 3WEOA 2Q71A 1TV2A 1UZ4A 4N42A 2JALA 1F2JA 3C2FA 4NNCA 2XFFA 4LB3A 1OC7A 3D47A 5FJPA 1LWHA 4S3GA 3M46A 3TQPA 1S2TA 3NO3A 5D03A 1OVDA 2J74A 1DJHA 4UWMA 2YYUA 1FKWA 3T09A 3MKKA 1P0DA 4UBPC 2OR2A 1MUMA 4ORIA 1EP1A 3FLUA 1IQ8A 3TK7A 4EAYA 3QC0A 3CYJA 4PB5A 5DEZA 2P10A 4G7EA 4EACA 5A8MA 3VIIA 2QDHA 3TQKA 4U5IA 2NX3A 2P3ZA 2GGHA 2YFNA 1OX4B 2BFGA 5JIPA 3WLLA 5DCDA 1E4MM 3ZWSA 4OECA 4H9TA 4R7WA 3UA4A 1DXFA 2DJXA 5CPSA 4CQCA 1PKNA 3QPZA 5D2XA 3SY1A 3S5ZA 1JZ5A 2JKAA 4RDVA 3WBWA 4GIYA 1TPC1 3WF1A 4CN1A 1R2RA 3BLDA 4LC6A 3A3HA 3TQ0A 1VJIA 4O57A 3KL5A 4B5WA 4JFWA 1AODA 3M5XA 4QM1A 4ZB0A 2YLAA 1XYBA 3GDBA 1H7WA 4JCMA 4OT7A 3GXNA 1O5KA 3S1WA 1LF1A 1CXEA 2CYGA 2VCCA 1EGMA 3PTKA 1FH9A 5HNRA 2WNQA 2QT3A 2ODOA 4Q8NA 3TYAA 4GY7A 3CH9A 4TR9A 5D02A 1IR1A 3PB0A 1GGOA 4FNTA 1M04A 3MHFA 4FALA 2PPGA 3CHFA 4FS9A 4TTGA 3VKCA 1UKPA 4YL2A 2QUTA 2Z1SA 1CB2A 4MAZA 4XD3A 1U2YA 3S1UA 1YIXA 3GY1A 1VFLA 3W22A 3O6AA 3K1GA 1Z89A 1HVQA 3A47A 1J6PA 3ARWA 1KXVA 2Y62A 2B81A 3O6CA 1F5ZA 1YXYA 3NZPA 1HKWA 2JK2A 1YNYA 3HF3A 4K2SA 1HL8A 1D8CA 2HZGA 3U9IA 4DZAA 3PM6A 2EPLX 1QNRA 4N9DA 2ZXAA 3VGDA 4Y9PA 5KZEA 2NW0A 3UNDA 1ZRQA 4XIMA 3KW3A 4JIPA 4MB4A 5I3HA 3U8GA 4ATDA 1QOXA 2V3FA 3O3RA 5BOOA 4YLWA 4BA0A 1E1CA 4XZMX 5DMMA 3W07A 1IXOA 4P7NA 3WH7A 2DW6A 4DF2A 2RJHA 5F2LA 5DO8A 2FYMA 4HJFA 1V0NA 4AY7A 4ATLA 4DM2A 4CU8A 2YA0A 4RE4A 4UUIA 3V0UA 3W37A 4LB4A 3ZVIA 1UKQA 4YYFA 3WFAA 2OYLA 4RV3A 3ARPA 5BMWA 1RCXB 3TW9A 4YPJA 1LYXA 2ATSA 5I3JA 4HSNA 2VC7A 4LBRA 3W1UA 3S0CA 5JQ9A 1JL8A 1JI2A 1ISZA 3QVQA 1R46A 5I3DA 4GNKB 5LNSA 1TJ2A 3AMDA 3OEXA 5GJMA 3P8IA 4WIWA 4OZOA 2E1DA 5K3VA 2W79A 1TV8A 3CAKA 1W0MA 4G7FA 1H11A 1VIWA 4LFYA 3RHGA 4DO5A 3WQWA 2ZDRA 3PC0A 1XIGA 3VIHA 1OM0A 1XR2A 1QASA 1HT6A 2FPYA 2NUXA 4M6VA 3DYOA 3PANA 4G5DA 1J11A 4UTFA 1X8CA 1TMLA 3CUXA 1XL9A 2WJDA 3S9IA 2IPJA 3A13A 2ON3A 4BHYA 3UW6A 5AYXA 1LQAA 3CZLA 4XV0A 1HO1A 3QV6A 4ACZA 1B3OA 3M5ZA 2XZ7A 1TIWA 2E6YA 2FB2A 1GKRA 1TVNA 1EJWC 4GI6A 3NSNA 2OMAA 3B04A 4US5A 2WMIA 4U3AA 4PE8A 4AIUA 3VGGA 3H55A 3S83A 5MKGB 2BP1A 3EGJA 1TJPA 2VFEA 3GTNA 4IIGA 1CX9A 4LOCA 4P2VA 5I06A 2XUCA 3EEGA 4U3CA 2VXNA 1MW3A 4R85A 3FX4A 1CB7B 2IS7A 3SJNA 3TXZA 2PBOA 5TIMA 1JZ4A 2R82A 5CPOA 4DWSA 1H5YA 4WKAA 1GVEA 5CPTA 3QLDA 4UCFA 1HJUA 1BYAA 1VB9A 3AOFA 4F0RA 4W87A 1LT7A 1EQCA 2J8GA 1EWEA 1ZPTA 5JVLA 1NVMA 2BZNA 1C90A 4LW7A 1J10A 3K4WA 3LU2A 3LNMA 5FJTA 1EYWA 4BI6A 4EAMA 2R91A 3CO8A 4E3TA 4R88A 3GHSA 2W9MA 1B57A 4HSHA 3PK7A 4AIBA 5I6SA 4ZOBA 2VT0A 3PHAA 3PZVA 3W6MA 2F6KA 1EDQA 3VIJA 3W1TA 3KBSA 4GQGA 3DERA 3L4WA 2TPSA 5I24A 2BODX 3W9ZA 2QJJA 3GBDA 4BI5A 4MM1A 4AZ5A 3TLLA 2VZUA 2BWGA 1DQXA 4HZ8A 4MB1A 4B91A 3DBNA 3VKKA 3GD6A 2ADAA 3DFYA 3VC5A 4IPIA 2FPTA 3GAYA 4R9OA 1ONRA 4UMAA 2FZDA 2VDIA 4X60A 2V81A 1SZEA 2VM8A 3R1ZA 4A4AA 1HL9A 3F4DA 3THQA 5DRIA 3EXSA 1HJXA 1IXNA 1SU5A 3SUVA 4UTMA 2GGEA 3U57A 2J78A 1KGWA 4MNMA 4KRUA 1UWAA 1KW1A 2PDIA 4BR1A 4O0ZA 2UY3A 4GX9A 1VLIA 3JS3A 2PTYA 1V0KA 3T0BA 3KBVA 3N2BA 4F0HA 1XRSA 4NXKA 3W25A 3UZXA 3P2VA 4H9UA 1QJWA 2B31A 4DEFA 2CLMA 2XN2A 1GVQA 1ICSA 1S2AA 3ZSSA 2FTPA 2DVTA 4C6DA 4W86A 1AD1A 1E70M 3C2RA 4HPXA 1OIMA 4G2DA 3K8KA 2DUZA 3RU8X 5F2MA 2DW7A 2Q8XA 1LCOA 3DFPA 2F84A 4XZBA 3MP3A 3DFNA 3AXMA 4WDTA 3GXTA 4WY0B 1TPH1 3F7JA 1UZ1A 3WLOA 1UMYA 1E0WA 3VE7A 5G4HC 1KXTA 1GQJA 3Q4DA 5AYBA 2NSOA 1S5MA 3R10A 3L4VA 3UPWA 4FNSA 5BXTA 1EFZA 1EJSC 3CL7A 4NJIA 2QPSA 1YXCA 2X7VA 1ZCCA 2QCNA 3WDPP 2VKZG 4HNTA 1UMLA 3WL1A 3URBA 4LTSA 2C3ZA 2EJAA 4IZGA 4NJGA 1KCXA 2CHRA 2X30A 2ZVIA 4HSOA 3D6NA 4S3JA 1B9BA 2VMFA 3C8NA 3WFLA 3TC3A 1M7JA 3TAKA 2IUZA 1GUVA 3BLIA 3NWRA 3AS1A 4Z1CA 4ZO9A 1A5NC 3BANA 5K9CA 2INZA 4JQ3A 4OBRA 3W7EA 1LQ0A 3C8FA 2PFHA 1HUVA 2X0YA 1DE6A 1KBBA 2DZXA 4DXVA 4JNMA 3NG3A 5H8PA 3SO7A 2PDPA 1TPVA 2NWSA 2J7FA 4F2UA 2YDAA 5D38A 3JR2A 3G1VA 5A94A 4UQDA 3HGJA 3M64A 1S2WA 3BW4A 5AY7A 3I7QA 5FD0A 4CD7A 4F0LA 3P82A 1X6NA 3HOJA 2VGFA 1E6QM 1H7OA 1JRBA 2JBMA 1MNZA 1CLKA 4BZYA 4DXXA 1W37A 2PDQA 1KFKA 1IF2A 3U5YA 4AISA 2Z28A 3MC5A 1UJPA 2Y24A 5J8LA 1UUMA 3WELA 4MPQA 4AAJA 1CGUA 3ITOA 4HOZA 5HQMA 1IXQA 3N34A 3N4FA 5A3HA 1XV8A 3GNPA 2PP0A 3CJPA 3DKLA 3NL3A 4G8TA 4KEVA 4ZE4A 2YCLA 2WQDA 1FCUA 5FJUA 3CHVA 3WJXA 1NARA 5FAJA 4LAZA 3HQPA 4V15A 1Z8AA 3PFRA 2Q8LA 4E8CA 2A5HA 2CEQA 4L4LA 5E0FA 1OT2A 5A6BD 1ZAIA 2ZZ5A 1IYXA 3SUSA 1GTHA 3TYCA 4H9ZA 3P62A 1G4EA 1TTPA 1NF7A 3QV7A 4AIOA 2C18A 4HHHA 1SO3A 3R79A 5HMDA 2Z6IA 3ID7A 1BWLA 4DJFA 4FNUA 3URNA 3MVIA 3CWNA 4RE3A 4WHBA 2Y7FA 2Z7KA 1V3HA 4OFCA 4GG9A 1FA2A 3VVGA 4PMYA 5SWUA 4JKLA 1RD5A 1KXQA 3NQ6A 1ZUAX 1NFBA 3I3DA 5AC5A 4LT9A 5D2TA 1W2PA 3BJSA 3JZUA 1MSSA 4LBUA 4UXDA 1RR2A 3W23A 1AZ2A 4I5XA 3WF3A 2OWCA 2ABAA 3IWPA 3VNKA 3DFSA 3MQTA 3WBXA 3ZJKA 2FGBA 1TQXA 3WK2A 1UG6A 4DYJA 4J28A 2CLOA 3ZM8A 3IIOA 1VFOA 3UXKA 3BOLA 4DPQA 1B90A 2QLYA 1XQKA 4C7GA 1US3A 3GDMA 1LRNA 1WZMA 2CITA 3WF4A 4E4FA 1XC6A 3VNYA 1GOMA 2WLYA 1V02E 1IWAA 1E3ZA 3R13A 4O53A 3TH6A 3ARYA 3NQMA 3UG4A 1ITQA 1OYBA 1UWTA 2XVNA 4JR5A 4FAMA 2F9RA 1UR8A 3QRHA 1JAEA 1C9DA 3LX9A 4ADUA 4WGXA 4LH8A 1TTQA 1L8PA 2X40A 3DKJA 4W8BA 2YJQA 1DJIA 1YPFA 3L4ZA 3TJXA 3AS2A 5CZSA 1NH6A 2Y5SA 3ZJ6A 4FLSA 8RUCA 1KFEA 3C2EA 2V67A 2WM0A 3T07A 5D9OA 1QNQA 2J27A 4IHCA 3M6DA 3P61A 3ABZA 3P5YA 3FS2A 4OTKA 3GNOA 2WNNA 2E1WA 3F4WA 4TIMA 3U2CA 2OELA 4GXMA 2ACRA 4M6QA 1P0BA 3LLDA 1SO5A 1FOBA 1Q6LA 4A35A 3NJ3A 4Q22A 2XSBA 3HPXA 1RK5A 4F0KA 4Z1AA 4ICNA 4ZVJA 1DOSA 3GIPA 4NZ5A 4P7RA 1OFEA 1RPXA 1E55A 2YDRA 3LGGA 4J4KA 3WUFA 5AHFA 4M81A 3E5PA 1K03A 2YA1A 3RDKA 4HNOA 1EPVA 2VCBA 4MIMA 4NAEB 2GDQA 3S3GA 3T4CA 5CLWA 4JQAA 2E9MA 4PTNA 4XK2A 4J3SA 3RFAA 2Y61A 3QGAC 2QCHA 1KCZA 4JHMA 4DBDA 2WMIB 2PU0A 5J04A 4CVUA 4FLRA 1AL7A 2HRWA 3WH6A 2YX0A 4HBKA 2DIEA 3AXXA 1PX8A 3AQUA 3KBWA 1I2NA 3EMQA 3R8GA 3A12A 1TTIA 4WY0A 1R3VA 2XVLA 2JGQA 4W84A 3T6CA 4IUOA 2EG7A 5A6AA 3ITVA 1DJWA 2WMHA 4DLMA 3CEUA 1AJ0A 1RJQA 5FJOA 1Z44A 4ZOAA 4ENLA 3OVGA 1FWAC 2X2YA 5AHMA 2ZZ4A 3G6MA 4XO6A 1W1IE 1H3GA 5CJ5A 4YIWA 3O06A 2VVSA 3WQOA 3LCIA 3VZZA 4GLEA 4I9MA 3RIKA 3BG5A 3MSYA 2ISWA 1POJA 5L6UA 4XBJA 1JDAA 2FLIA 4TUFA 4RZ6A 3IGUA 4GH3A 3NFUA 3WDQA 2HVNA 1PHQA 4ZXOA 3SN0A 4Q4RA 4MLRA 4WUIA 3TWAA 4YCPA 3RMEA 3TX9A 3QR0A 3FYPA 1WXZA 3QTGA 2VX6A 2I5GA 2V69A 1EC9A 4BF9A 5CC6A 1TIMA 3S9ZA 1UR3M 4PULA 4Z17A 3A23A 2WSYA 1DBTA 2WHLA 2VRQA 2V30A 4EPBC 3A24A 1TR1A 1Q4WA 5EPDA 4HT3A 5DXYA 1BD0A 1QT1A 5LGXA 3W7MA 2OKOA 4Q4OA 2QMKA 4UFIA 4DIAA 3KHDA 4RCXA 4GVGA 1MMFA 2Y70A 3TN3A 3VC6A 2P5NA 2ZUMA 1M01A 2AQWA 4RW3A 3VD9A 5DMYA 3DFQA 4AEFA 1GW1A 1VEMA 1DPMA 1S5WA 1JQVA 4QJ4B 3GWQA 2D2OA 1REQB 3I7SA 4TVDA 2OT0A 1JVNA 3A4XA 3MS8A 4Y9AA 4NILA 4L4MA 3RPTA 2Y63A 4O11A 4H8HA 4B5SA 3LI0A 1E9YB 6XIAA 1U5HA 5BW6A 3II1A 4WF7A 1GZJA 2GK1B 4R7OA 4EWND 1FDYA 4QP0A 3DI1A 1XCXA 3MANA 3MHGA 2DPEA 3HV9A 5FEXA 3GU9A 5BXRA 3WLTA 1KRBC 1FWGC 4O16A 1K8YA 4MWAD 1O4UA 1FWNA 1FCVA 4LYPA 3CV2A 3L21A 3TJ4A 1N8FA 4QLKA 4REQA 1JQXA 2IKJA 1U1HA 1OD8A 5KITA 3S9YA 4A8RA 1CGWA 4D6HA 1TV5A 1DIEA 3LBCA 4PYSA 3W6LA 2XN1A 1K3UA 4M3PA 3QEZA 1JNDA 3QSTA 1YBQB 1EWDA 1BRLB 4YVXA 2YW4A 1A3HA 3N13A 1BG4A 3L0GA 2HNHA 2BGNE 2NX9A 3A4WA 1WBJA 4FIRA 3ANYA 1XH1A 4OBTA 1TA3A 2VFDA 4EPEC 2H90A 2EEXA 2G5WA 5LHEA 3ZFHA 3UJSA 3OQ8A 4IIEA 1J79A 4QE5A 3G1SA 1A0EA 4UCGA 4AX7A 3HB9A 1Q7MA 1SSGA 2XM2A 3NL2A 2E4TA 4N4PA 1RA0A 2OZTA 2V5BA 3LNPA 4DNMA 3WDIA 4KRTA 3RX4A 1NDVA 2V3DA 4XSLA 3KRZA 4LGXA 4GO9A 3ONBA 4BF7A 2OZ0A 4G56A 2RDUA 1FXQA 3DDMA 3FA5A 1F73A 2PWEA 1KCKA 3MDUA 4UTUA 5A6MA 3LA4A 3QZ6A 1UPPA 2I5QA 4OWGA 2Z2AA 2D69A 4WJ8A 4AZCA 5M1TA 2UY2A 2Z6JA 4PN2A 2RDTA 3RRXA 3G3DA 3N14A 4TMCA 2OOFA 1A49A 3LI1A 4J7RA 3WLQA 3MT1A 1L9WA 4UTHA 1ZLPA 1JCMP 3WLRA 4RPPA 5KMYA 3QY6A 2A21A 1UP2A 1GQIA 1UP3A 2CBJA 1KO0A 4GXPA 4RPQA 3ATZA 1SM9A 4FP1A 3ZT6A 1OG6A 1YNPA 1U5JA 1LROA 1HGYA 3N18A 2Y89A 2ZA3A 4QRNA 2ZXDA 4AZ6A 1DIKA 3WO8A 1X38A 4H8VA 3UWWA 4GY1A 1J93A 1PBGA 3T2QA 5C7HA 1QRQA 3FXYA 2Y85A 1V51A 5DT7A 4ML9A 1WCGA 3KUMA 3B4YA 4KQNA 4QJ5B 1QTWA 2DSVA 1FDJA 2PRLA 3W27A 2CC0A 1BTCA 2J7CA 1K9EA 4GBUA 4LUSB 4NZ3A 1QW7A 5EMKA 6REQA 2V5CA 3QF0A 1FX6A 1DHKA 3U2EA 4KIRA 2ALRA 2O56A 4CNNA 3NXFA 4UTWA 1A5KC 1PX4A 3M0KA 3SCOA 4E2BA 2OEMA 4AXNA 4IPJA 3UWVA 5MF5A 3V1HA 3PJWA 2YBUA 3EWYA 4MUZA 1HGWA 3P14A 2DUAA 5CH9A 3UZ5A 5EGRA 2WJZA 3M0YA 3A3XA 1VR6A 3AFBA 3GXMA 3BJTA 8XIAA 2OZ3A 3SCPA 4KCWA 4FB7A 3B8DA 3S4TA 3DCPA 3TONA 4BQ5A 4JIRA 1NDZA 1XBXA 4O52A 5D8WA 2DQXA 2IKGA 4AVNA 4JTSA 4WQ6A 1UD5A 2BXVA 4YTTA 3LHZA 3IPWA 2PU1A 2ZUUA 1CEOA 3Q58A 2QCGA 2V5LA 3ZOAA 1GONA 4HNUA 4UFMA 1QAPA 1ZAHA 1EEPA 4GNJA 4J3ZA 4UR9A 2Z0IA 4DZIA 3RMJA 1RVGA 5A8QA 2C1IA 4GYJA 1PVNA 3B4UA 5B80A 1IIHA 3ARRA 2OG9A 4YTRA 3GSMA 3ZT5A 3O6YX 1WDPA 4R3UA 1GT8A 1J0IA 1T96A 3Q2DA 1J9YA 2XN0A 4NZJA 3SURA 1S3HA 5AHNA 4LUJA 2WC7A 1OT1A 2HPIA 4JIQA 1P1MA 1CIUA 3P8JA 4NZ1A 2NQZA 2Y7DA 4QITA 3CHEA 4HMNA 3R5EA 3LHYA 1GQKA 4L65A 3UG3A 1XIIA 2UV8G 1FQ0A 3G8EA 3WL0A 2P0IA 3B3DA 2JKEA 2A7NA 1IWPA 3EZ4A 2OX1A 1KM1A 3AZRA 5LNVA 4WY0F 1J0JA 3UPBA 1I45A 2WWCA 4ZE5A 4W8LA 4JKKA 1XLHA 5F4XA 3EWWA 2R14A 3FA3A 4IUGA 2QCDB 1VPXA 3EA1A 2DGAA 4L7ZA 3KE0A 4JIIX 2GJPA 5LIYX 3DH7A 2VRKA 3EKZA 2HBXA 3VOHA 1GCYA 1J5TA 3SADA 1KNWA 4UNKA 1Y5XA 5FEZA 1JCLA 3UR8A 1UH4A 3B0XA 1H60A 1LBLA 5C54A 4I6VA 2W0UA 2EG8A 3K30A 5AYYA 3SQLA 4L80A 4C6FA 2G96A 4X9YA 1W5PA 1RD6A 4RDYA 4GJJA 3OOQA 3T78A 4FA3A 1IZCA 2WHMA 3WEZA 3W7RA 5G2IA 5E6ZA 1ISXA 1XC4A 3CU2A 2DZPA 3W26A 1MVYA 3TC6A 4RK8A 4YVVA 3WBYA 4H7VA 2ISSA 1I2RA 4GGBA 3U7VA 1GOQA 1DEDA 2Z25A 2ZIDA 1CENA 4HYRA 4US5D 3S6TA 1E6XM 1F4HA 3DX5A 1RPKA 4CU7A 3GUGA 2WB5A 1AL8A 2W4XA 3IGXA 4ZO7A 2H3BA 4OE7A 3L0KA 4HZ7A 1OC6A 1G67A 2PEVA 1Z9AA 1RLCL 3QGKC 2YW3A 5FL0A 4GZJA 5I07A 3TLQA 2OSYA 1SJCA 2XGZA 2PDYA 4Q3MA 1HP4A 1X1ZA 4I9AA 1BSIA 3E5BA 3LV6A 1UR0A 3I10A 2WC3A 1NU5A 3DFTA 3PG8A 2GUUA 1IWBA 3L12A 3ELFA 3C6CA 3IK2A 1PEZA 3NDZA 1XXXA 1N55A 1ZCOA 4DELA 3LCFA 1WAWA 3W81A 3W00A 3RR1A 1UKOA 3USZA 2AL1A 4QEEA 1GQLA 4BI7A 4C6CA 5A8OA 3IAPA 1TYGA 1DWAM 2Y2WA 1FXPA 3QFWA 1F6YA 3MW7A 1IXPA 1MI3A 1QK0A 3TN5A 2QJGA 4KFPA 1P43A 4NY2A 5I3KA 3AIRA 1RBLA 2CKSA 3IS4A 4LYQA 4QQUA 4WLCA 1HVXA 4NNAA 1VH7A 2I1OA 3LB0A 1IEIA 4CCCA 4HK6A 4IX0A 4O1CA 4YWSA 4Z08A 3M9YA 3TROA 2Q01A 3R25A 1MEHA 1AA1B 3MYPA 4YJ5A 3NO5A 4QTGA 5G1TA 3L68A 1OF8A 4LVGA 3WX7A 1SZNA 1V6YA 2AMGA 1AW1A 2BGSA 1G5AA 3KTXA 1XIBA 1IT7A 2YSWA 3NQ7A 2X09A 3WMCA 4DBEA 3QPEA 2QUNA 3POHA 3W3OA 4B5VA 3W2LA 4XAFA 4PODA 1OABA 4D6CA 3BURA 4LUYA 3KOXA 2D3NA 2ZRYA 5AECA 3TE9A 5K4ZA 2PCEA 1OYAA 4QGCA 1UZDA 1EP3A 1W2VA 2D73A 4NKCA 4HHPA 1D9EA 4JY8A 1Q6CA 3M0ZA 5BWAA 2CESA 5I00A 2O4QA 2DVXA 4Y6GA 1P5BA 3GU1A 3POCA 1X98A 1US0A 5XIMA 3K4AA 3K46A 2C1GA 4PGLA 3IIPA 3M5VA 4YTUA 4RNFA 2SFPA 5LA1A 4W7UA 4MSSA 4KCUA 5FKYA 3HG2A 1ESWA 2BVWA 3BOXA 3VOCA 2W27A 3S1GA 4IOTA 2YB4A 4GNVA 1BXNA 2R24A 4EXQA 1R9XA 3EDEA 2QV5A 4Q7BA 2FPVA 4RZ5A 3H23A 3F03K 4HHMA 3GH4A 4GABA 1I1XA 3O2LA 1BWKA 2HSAA 4AUBA 1XLEA 4V28A 1DJNA 5A6BA 4GYPC 1NSJA 4H00A 3GFYA 3CUJA 2WW5A 4MYXA 3RM8A 2HV5A 1DORA 1QU4A 4F9DA 2BV9A 5CSYA 4QE4A 4H6QA 4EVZA 4IJBA 2P3EA 3BQ5A 4DN1A 4E3VA 1J96A 3O8AA 3E2SA 3RXZA 4DJFD 5JBEA 1M5WA 3W76A 3ANVA 6REQB 3EOSA 2XSXA 5G2HA 4YU1A 1SW0A 3ECQA 3XINA 4HNLA 1U22A 3V35A 1TPEA 4E2DA 4XZLX 1HP5A 1WOBA 5D8ZA 1DXEA 5HK4A 4F0SA 5F1UA 5EMJA 3H12A 1E9LA 2X41A 1OGBA 4A3UA 4C1KA 3VFCA 5CSUA 5T91A 2WNZA 2CLIA 8A3HA 4B16A 1BKSA 1JDDA 4L1WA 2PDKA 2QDGA 1SPQA 3FNDA 1UOKA 4MAVA 2VHLA 5J5RA 1EC7A 3KRUA 3LZ5A 4JOMA 2VZSA 1A47A 3OGVA 4BF5A 3QC3A 2GGJA 3D0CA 1H51A 1RP8A 3WEMA 1KLYA 5CBJA 1DIOA 5CGQA 5AC7A 2PCQA 2AAMA 1VD6A 3EPMA 1RUSA 2ZVRA 1KRAC 4KEUA 1XBYA 2IMRA 3ZJ8A 2E9BA 4Z1YA 4W89A 1BPLB 2A1YA 1XP3A 1EJUC 4S23A 3CQKA 3V75A 1XHGA 2C8NA 1UA7A 2MUCA 4X0NA 2XSAA 1CDGA 1XPGA 1B3WA 4LANA 1Q45A 4DI9A 2PRHA 4UTKA 3KWSA 1ADDA 1V0MA 1VBUA 1GKPA 4YVPA 3V5FA 1ZJAA 3BLPX 1YPIA 1I0DA 3B9NA 3RRAA 3EWCA 5BOFA 3IGSA 4I8DA 3PSWA 3GQYA 2F7FA 3VTRA 1LBFA 3N6QA 5DXXA 1RV8A 1UR9A 2Y7EA 3KLKA 2CHOA 1G69A 2ZC1A 1T8QA 3CB8A 1I2QA 3CZ8A 3QJAA 4JYDA 5IRPA 1W3KA 4UOZA 3FCPA 1HJSA 4Q4SA 4XTIA 1XYZA 1PX3A 4PB3A 3BCFA 5M3WA 4JTHA 3BICA 1KM0A 3KHJA 4QCFA 4IMCA 4DHGA 2PWUA 5HJLA 3MUY1 4AZBA 4LAOA 1R0MA 3MUZ1 2ZX6A 1UD3A 2CETA 4JTAA 2TSYA 4UTTC 1HFBA 4MYAA 3VO0A 1A3WA 3I3BA 3MI6A 3LMZA 4JXCA 3L7RA 3QMSA 4NYUA 5M5DA 4Q4MA 1E1FA 5CGMA 4JTJA 2UY4A 5LNRA 3CHCA 1E72M 3G1FA 4C1NB 5A2BA 1KFBA 3NQBA 3R0DA 2V63A 3W87A 3MZ2A 3T40A 4PEKA 2QPXA 3CYVA 1Z6KA 4QBXA 3S2LA 1J0KA 1MRQA 3PP7A 1JYWA 4GJ1A 3BPWA 5HBFA 5FEWA 4DWDA 1RZMA 2XIQA 2OLHA 3EDJA 3LDVA 3PPCA 4W8AA 4WCJA 3DI0A 3Q65A 3VGFA 1IIGA 5ENLA 2BX7A 3UZZA 3APGA 2WZMA 4PMDA 4TV6A 1RHCA 2OKTA 3LTSA 5DLCA 3M47A 3IACA 2YL6A 4E5TA 1SYTA 1XLMA 3C0LA 1C92A 4Q8MA 2V5DA 3E12A 1FFRA 1AJ2A 5AHIA 3W1NA 4F9JA 5BU9A 1FHVA 2HE5A 3E0IA 3AIVA 3IANA 2YCJA 4XZNX 3U4FA 2JFEX 4ZL1A 1Z42A 7ODCA 5FF7A 4MLJA 1JD9A 4OIFA 3QXBA 4U28A 4AD0A 5JH2A 4JICA 2FTYA 4QLJA 2ZCGA 3NQ8A 4DJEA 2QW5A 3I6EA 7TAAA 4Y90A 1WZAA 4FF7A 1YTDA 1MWOA 3NEHA 3TOYA 2CKRA 1CZ1A 1A4LA 2WNWA 4BJHA 3F4VA 4FLOA 3TA9A 1G1YA 4H6EA 5XIAA 2WKGA 2PGEA 4JD4A 2AOSA 5HDRA 5CSSA 2XFYA 3IUDA 5C9ZA 3R2GA 4F8XA 1Q63A 2NXIA 1GEQA 5A6TC 1FHUA 3VOJA 3TMQA 5B7ZA 3TMLA 2P88A 3DG3A 1KBJA 4XD6A 2YB1A 4B5XA 3R8HA 1E71M 3MY9A 1M7PA 3HZ3A 1KBLA 1QW8A 3WLIA 5JBDA 3FVDA 4RJEA 4F3HA 4AZHA 4JTLA 5FJIA 3PJTA 3PZGA 2GQ8A 1OEPA 1W91A 1PL9A 3CWOX 3M44A 4FOJA 2G4JA 2DJLA 3MBFA 4RV8A 1AQMA 3AMGA 2DT1A 4WJEA 1TUFA 4GA8A 1WKEA 3MWAA 4Y9MA 2Q3OA 3ABSA 2B4GA 2A3CA 1JR1A 2V2HA 4JY9A 3FDKA 3VCCA 3AIEA 1QI3A 3KBJA 2BG5A 4BQ4A 1EF2A 3W75A 2Z29A 1R87A 1GOOA 3G6LA 1JDCA 4J9JA 1ISWA 1F61A 3PR2A 3LHUA 1R9ZA 2JGYA 2BB0A 4JYFA 1LT8A 1SZRA 2ZTKA 3OB8A 3UP8A 3NAVA 3RGTA 1OD0A 1OF6A 4LYRA 2E8ZA 3BAWA 1O60A 4LQ1A 3WQ8A 2B7QA 5CC5A 1LM1A 4H8NA 2EPOA 5K9XA 3T7VA 1EEXA 4O1AA 2EG6A 2VFGA 1XFCA 3W82A 2D1ZA 3CZEA 1LUCA 4UNIA 3IAQA 3B05A 1VCVA 1I2PA 2PSNA 3HPSA 1W9XA 1FP9A 3O0FA 4OV9A 5HWMA 4OGZA 1OCNA 1EIXA 3ARTA 1VENA 4AQLA 4LNCA 6CGTA 2QCFA 4HCHA 3MWCA 4GKLA 4LCSA 1NFGA 3GG7A 4AWUA 4PMOA 2O7QA 3BJFA 3GO2A 4Q4PA 4H7ZA 2I5IA 2HVOA 2WANA 3PNUA 1R2SA 3QZEA 1C91A 3CK5A 5JH1A 4Q8VA 4O4WA 4GK8A 1TMQA 4GRSA 4XAZA 3BVJA 3PBUA 1UW9A 5IHRA 1LBMA 5A6SA 5IFPA 2CZVA 2GJXB 4H1ZA 5G1YA 5H2ZA 2V82A 3WLMA 1O7AA 1FWBC 1X1OA 3KP0A 3OHMB 3PZIA 4LSBA 3LPOA 2VD8A 2FTWA 1XGZA 4XG1A 4JDBA 5HANA 2BOFX 1YXDA 3MV01 4GC4A 1ZBWA 3PZNA 3VAVA 4O8AA 1JGMA 1TVLA 1P0NA 1SZGA 2J9ZA 3DHDA 3AIQA 1ZJHA 3USBA 4WJXA 1D2KA 3FVMA 3QH2A 1SFSA 3N15A 3UU0A 2H6RA 2Y8VA 3H24A 4H6RA 2UY5A 2WYSA 3RJXA 2HCVA 1DHPA 4JBRA 4R7JA 4Q6XA 1Q6QA 3AICA 4B5NA 5CBIA 3KX6A 3FN9A 5ABEA 2QVNA 4GQ0A 1S2CA 3VM7A 3PY2A 3S2CA 1KB3A 1VIZA 1EHNA 1XISA 1RP9A 4P7OA 1V3IA 4DXKA 1YTEA 2VX4A 1AZ1A 2PODA 1ITXA 3QMRA 3W74A 3HN3A 1E1CB 3ZLGA 2QHAA 2NSXA 3NYDA 1A5AA 4KWOA 5TQLA 3TXVA 3RR4A 3AYRA 1YDYA 1TE1A 2BVYA 3CL6A 3PZ9A 3H54A 3TW6A 4MZ1A 2QUMA 6XIMA 1W5QA 2F61A 2PTWA 1CXKA 5TNVA 1WXYA 2OSXA 2ZTJA 3DIPA 2RDWA 2NQ5A 3RPDA 1L6SA 3M4HA 4J35A 3FAWA 3WUBA 1OX6A 2WZEA 1T41A 6TIMA 4GUJA 2GGIA 3VOFA 4DUXA 4KRZA 4MMWA 5I3FA 3FEQA 4PSPA 3HGOA 3NYZA 3CEPA 3R12A 3WD4A 2IPGA 4A2SA 1EUAA 3CT2A 4UTWC 3E0VA 4YXGA 2VGGA 1DP0A 3W70A 1JXJA 1THFD 3S5OA 1MQPA 2OEKA 4EE9A 2PDGA 1O95A 4E4UA 2A6LA 4C6OA 2NVAA 1F76A 3NQGA 1AH3A 2J8TA 3E96A 4QROA 3S2JA 1YDVA 1UR1A 2X1UA 4QG9A 4HB7A 1Q2SA 2VUYA 1YKWA 4AC7C 2W5FA 4B5UA 2CLEA 3K2GA 2D2JA 5A8NA 3ES8A 4GQBA 3TOPA 1YYAA 4LCQA 1TPDA 4Z2LA 4QXIA 4UNLA 4RKAA 4CN6A 4ATWA 3ABXA 1QI0A 2DZTA 2QCLA 2ZC8A 4TMBA 2J25A 4IP4A 1ODZA 3VXGA 1U1JA 2Y88A 4FOUA 4EP8C 4PBFA 3I6TA 4W85A 1I6NA 3E1F1 4JHOA 3TC7A 4FXRA 3BAXA 3NXLA 2GVLA 1W17A 5HMFA 3ORWA 3R58A 2NQ9A 3G18A 4MWAA 4GYKA 2F6XA 1OADA 4UTIA 2DH2A 1OCQA 4J2PA 2OB3A 4D8LA 1KM4A 1E4IA 2WSRA 4MZYA 4ROQA 4CVWA 4DZ5A 1ODUA 2YYTA 2UZ9A 4B2DA 1JCNA 1JRCA 4AF0A 1E73M 2RDXA 3WDHA 3UVIA 1PXGA 3NZ1A 3PBGA 1G01A 1QOPA 2C91A 4WKHA 5E5CA 5EKYA 1X7IA 1ZS2A 4I7WA 3HQ1A 1JPKA 4GUGA 4GFSA 1XDJA 5GNXA 2I9EA 3UR5A 2VEPA 2D0HA 3LHWA 3EDFA 4JTIA 2CLKA 1QNVA 1CGXA 3P67A 2V3GA 3WD3A 4IQDA 4IM4A 3STGA 1NFPA 1WDRA 2X1RA 4GWEA 5EB8A 4IGNA 1BYBA 1NWSA 1J2WA 1UWRA 4FX6M 3MCOA 3UY7A 1QOQA 1TRDA 1UB3A 4GX8A 4B4FA 2VEIA 4E8DA 2EQDA 4HGXA 2A7RA 4GI8A 2GFTA 5FEPA 4O54A 1FH7A 3TNOA 2CPUA 3TA6A 4M0XA 3W7NA 2HS6A 2QGHA 1XCFA 1XSJA 1Q3NA 1HN1A 5CC3A 3OLEA 4NUWA 1JNEA 4J1OA 1TQJA 1QMLA 4D1IA 1CGTA 1OGSA 4S1FA 1WZKA 3G1AA 1BHGA 4PMQA 1BVZA 4MWAC 3S1VA 1S2VA 3NO1A 1M1BA 5JU6A 3HPFA 4IQEA 1FWEC 1N82A 3TYEA 4V33A 1ZB5A 3VI2A 4HOWA 4AD3A 3HPZA 4J3WA 3EOEA 1C8QA 1UPMB 9CGTA 1GOXA 4WOQA 2XVPA 3E0WA 3RYSA 1BRLA 4CCDA 1YBQA 3RX2A 1EZWA 1C7SA 3FY1A 1HJVA 1Q7ZA 3SCVA 3BMWA 4LUTA 4BQ3A 1NWUA 2ZX5A 3T0DA 1ONXA 1W3NA 4C1LA 2A4AA 1Y8BA 4ZCWA 5FF0A 2X0HA 4NZFA 4MY1A 3I4KA 2E5CA 2J24A 2J47A 2V38A 2D2GA 3UQNA 2HTMA 2WO5A 5C2XA 4UTJA 5D4YA 1TVPA 5CKSA 3N3TA 3W1LA 3KVJA 5C5YA 3MHUA 1P6BA 3WMLA 4CD8A 4LS1A 5DFAA 5TBOA 1X97A 1KLZA 4HVXA 1H41A 2VENA 1VPYA 2ABBA 2EPHA 3UJ2A 1UASA 2DV0A 4BCEA 4KKXA 4GD0A 3THCA 5CG7A 1Y0EA 3NUKA 1Q7QA 4JEQA 2DZWA 3WNOA 2WKLA 1WX0A 2XWDA 3G2GA 3M7WA 4NSBA 5DQPA 3OYXA 1B1YA 1T40A 1KQZA 1HKIA 5E93A 5FF4A 4GFIA 1RQBA 3G0SA 3OLDA 2FH6A 4GIAA 4CNPA 2ISVA 5K4XA 2ZZ6A 3V16A 4CQDA 3JW7A 5DBUA 4L6DA 2G3JA 1JYXA 2VWTA 1XYMA 3CPUA 3GC4A 5A95A 3DECA 1EO7A 1OFAA 4RNJA 4I9JA 3UA3A 3U4AA 3TYZA 1K02A 3V0TA 3ARZA 1XFBA 4KGLA 4D71A 5G5IA 1E9IA 3WK1A 5HMEA 2V68A 1ELSA 4FMVA 1XBZA 3S5SA 4JTTA 3OGRA 2OXNA 4XAYA 3FAXA 1VF8A 4K7VA 3ZWTA 3WQFA 3CQIA 2FKPA 1MXSA 1EX5A 2NLYA 3UBPC 1I75A 1YX1A 2J7EA 5FACA 6TAAA 1UUOA 3W7IA 4W93A 3ATYA 3PZUA 2XM1A 1D7FA 1UWUA 3EMZA 8XIMA 1V3MA 4H9VA 2VEMA 1S46A 1KGUA 2ASHA 4X2PA 3V4BA 3W84A 3VYLA 1GVRA 3OLGA 3ZR5A 3UYIA 3A9IA 2PI6A 3LQLA 4QSHA 2GQ3A 4Z42C 4QEHA 5CLTA 1U5VA 3PZMA 1XRVA 1F6KA 4Z1DA 4CQAA 5I79A 3RLUA 2WVVB 4MB5A 2FZNA 5FCZA 3SQSA 1BWVA 3UGVA 1NEYA 1JZ8A 1Z69A 2GVGA 1HKMA 4D6FA 2WVUA 3W7KA 7ENLA 4E0CA 3AHYA 3KL3A 2YBVA 1J01A 2YIHA 3MV11 4L56A 4UZUA 1T6MA 4A3HA 4BEUA 1K4HA 5ABGA 5DBTA 1V02A 2WCAA 4WK9A 1WXJA 4W4QA 4IIFA 3NOEA 2WAGA 3O6DA 3HTWA 1EKOA 1QPNA 3AUOA 3SCSA 3GLCA 1T5AA 3IEBA 4XBSA 2CZDA 4JTQA 3REQA 5DX7A 5A1AA 1US2A 2OFJA 3LY0A 2PC4A 2PDHA 4LF2A 3LQGA 4X0VA 3TEVA 2YLLA 2HS8A 3RCYA 2FJUB 5FF3A 4X22A 2VX7A 3GNDA 3KTCA 4DBSA 1JI1A 2YCEA 2GYIA 1RLDA 4TQTA 1QPQA 4GPNA 2P53A 4C6QA 3EX6A 2VQUA 4MWAB 4AY8A 5AFDA 2QULA 3EA3A 3PULA 4LS0A 1BYCA 1XIFA 5U4NA 3NSXA 4M8UA 1RQEA 5ABTA 4MOZA 1SR0A 3V18A 4C1NA 1V6WA 1L6GA 3W7HA 2CBUA 3ARUA 4A6GA 5AC6A 3M5YA 1KR0A 3MU7A 2Y7GA 1W1ZA 1HKJA 3VPLA 3N4AA 4NXSA 3W2MA 2B7OA 4ROPA 5FI8A 3W85A 4ERGA 1O68A 1DL3A 1XW8A 2PDXA 5CZTA 3CMFA 4TX8A 3TNBA 4PUMA 3IJLA 2E9LA 4C6NA 4E8GA 4LYKA 3BMXA 4PMRA 4JQ1A 3Q45A 1W1VA 1KGXA 4KCVA 1R7OA 4Q8UA 4Y7EA 4XKYB 5F2GA 3R0KA 1XUUA 3M0HA 3L4TA 2J7HA 1P6WA 4XZ9A 4FXJA 3FDGA 4MPKA 3L5AA 5C9RA 2A3BA 4EXAA 2YXOA 5I3GA 1LOSA 1KFJA 2Z7GA 3FJ6A 3VABA 2FMNA 1TPB1 2TMDA 3FYYA 3IIZA 2DU2A 4WXZA 3AALA 5E6YA 4PBGA 2ZICA 2WJFA 3SCRA 3BQ6A 4MG4A 3DBPA 3MA8A 2QEZA 2VVNA 4PRRA 3WQDA 4IG2A 1QVBA 3W6YA 1ZBVA 1UR2A 5IBXA 2Q6ZA 4P8XA 3GG8A 3CIVA 4Z2KA 1KD0A 4DYKA 3LZ3A 1O5QA 1JULA 2INFA 4UFJA 3I7RA 4UTTA 3OBEA 3P7YA 1EQPA 4YTQA 5HATA 3VNJA 3PTQA 2EPNA 4O14A 3FOKA 1MQQA 1W56A 3GDLA 4YN5A 4QE1A 2PZNA 3L4YA 3DAQA 4NZ4A 1RSCA 4XUGA 1N2VA 3N11A 2RUSA 1S3TC 3AIUA 3U6WA 1MDRA 4HMCA 1F8IA 2BMBA 2OQHA 2G3FA 4TVUA 4HQVA 2FFCA 1RK6A 3R89A 3B06A 1V3LA 3VKJA 3BL3A 4C6JA 3N19B 3G1XA 3PBYA 3CS2A 2GVJA 1TWWA 1LP6A 3BO9A 3WD0A 3AJXA 3N73A 1KBIA 3CIXA 4H01A 4P5UA 5C71A 3W53A 3EX1A 3ANUA 2O7SA 1E3XA 2GDUA 4WDWA 2PC8A 3LEPA 3SRHA 3F4NA 1O5RA 1XGEA 4H9XA 4NNBA 1KM5A 1NP0A 1F7BA 4J40A 3DHPA 4Y96A 2DIJA 1W9VA 2DT0A 3G22A 5LHFA 3G5EA 1HX0A 1SFJA 3NR0A 1GVSA 3VIPA 2DZAA 5M2FX 1Z48A 3LXBA 1G0CA 4XISA 3GFZA 4LY4A 4GQRA 1VKFA 1AMYA 4D8AA 3TYBA 5FSDC 5HULA 3VIKA 5ABFB 3QGVA 1VS1A 4TV5A 3SRFA 4GYFA 4GZ7A 1A4MA 4KH2A 3HPAA 3STCA 4V1YA 4CD5A 3CAWA 3VIMA 2DSKA 4CNUA 3RM4A 2OT1A 2PP3A 2PDLA 1ADOA 3E0LA 1WUFA 3I6RA 3NCOA 1W5MA 1XSIA 3STFA 1KCLA 2W6RA 5HWJA 3NQAA 4UC5A 1KV5A 3B0PA 4K38A 4AZIA 5HINA 1N8WA 1QO2A 4ZB5A 2QAFA 2OYKA 4B9YA 5F1VA 2WQPA 1MZHA 4ONVA 3KRBA 2V9DA 3DOPA 3QQWA 1EL3A 4NQ1A 3RLVA 3PUOA 1XI3A 1J6OA 3F2DA 1A5UA 1NAL1 3T0TA 4CN4A 4A8NA 4AB4A 2X05A 5BRPA 2NWRA 1PHWA 4UIOA 2G8ZA 5G2WA 5K2ZA 3MP5A 3R8RA 1V08A 3W7QA 2PDFA 3VDGA 1C93A 2E68A 1H4PA 3TN4A 4S3DA 1P7TB 2CNCA 5REQB 1FUYA 1PWMA 1VBJA 5GNYA 4DZHA 4WRHA 5DN1A 3W2JA 3SBFA 3WQCA 1JDEA 4Q8PA 3H2NA 1G7UA 1OFBA 3QR1A 2V3EA 3IV8A 3WQVA 1AH0A 4UFKA 1AG1O 3E38A 5AHLA 1JUKA 3W72A 1O12A 5DCEA 3BC9A 3NURA 4L64A 1OB0A 2V0TA 2IKHA 4AWTA 1TCMA 5BRQA 4RE2A 3W38A 1OZQA 1R6WA 4S3EA 3SUWA 1SUXA 4A21A 3MJMA 1L2UA 2EPKX 4IL2A 3WDRA 3W1AA 3P80A 5AC4A 1XLBA 2FIQA 4C91A 4PRWA 1X6LA 4ZQCA 3PUDA 4K68A 1ICQA 2FGZA 1ZJIA 3BSMA 2QCMA 3TTEA 2QS8A 1LL4A 3OGSA 2GJRA 1SVDA 4P8WA 4O50A 3SGUA 1SO6A 3LS9A 1E43A 3LTYA 4ZQMA 3E02A 1E15A 1H09A 2BNJA 1YQ2A 3T05A 3SN1A 1I8JA 4LNYA 4ZOEA 1GG1A 3BGGA 4O1BA 1BF6A 5KZDA 4NJHA 5LYRA 4GISA 4HKPA 3ITTA 5FIPA 4LWWA 1PKMA 4INFA 3LN3A 5GQBA 1TUXA 1A5MC 3ITXA 3UZYA 4DVOA 2PMQA 3UXIA 1F3XA 4MADA 1R3RA 1OX5A 2XVGA 3DGRA 5D09A 4K8GA 3HGSA 1JF5A 2F38A 3G1HA 3IIXA 3GHTA 4Z2HA 1GK8A 3R94A 1K7FA 1XH0A 2O0TA 1XJBA 1L8NA 2Y5EA 1V7YA 4M1BA 1YMYA 4QLLA 3UG8A 4PTMA 1HO4A 4QDMA 3TZNA 5CGTA 3WJZA 1GHRA 1KFCA 1M41A 1VFSA 3MKCA 4LVAA 3A4AA 5C9XA 3DENA 4UQEA 5H8UA 1O66A 1W1YA 3EPOA 4PA8A 3UXDA 4H4IA 3BE7A 3SCTA 3B8UA 4DQWA 1UCWA 2DH3A 5HMSA 3UPMA 4NX0A 3W1PA 3RM9A 3SAZA 4LVDA 2A3LA 1H7PA 2YKKA 2P76A 4XUYA 2POZA 3TU9A 3CC1A 1R30A 1YDOA 4XVDA 5AYIA 1TZ7A 1MW0A 3ISIX 2DSZA 1ZAJA 3M6YA 4MNKA 4PTWA 1ITCA 2ZZ7A 2ZQ0A 4RE0A 2O9RA 3UCDA 4KWWA 4N6FA 3H2EA 1L0PA 1HJQA 6ENLA 4OVXA 4X63A 1KTNA 4MFEA 3LCXA 1GWJA 3JZEA 4LY8A 3EX2A 4CCEA 3L5LA 4N9BA 1VFTA 2NQHA 3GHRA 3H2FA 4L4PA 2KX9A 4QFUA 4UR7A 1OG0A 1A0DA 2XH2A 5H91A 2G3MA 3GW0A 2KZHA 3AXKA 3R7MA 4GCAA 2PGRA 3OBKA 2D3LA 2GPTA 3ABRA 2GVEA 4NF7A 5C6MA 4XZHA 5FOOA 2QJIA 1C8XA 1IV8A 4GMEA 3IRSA 4HK7A 4IGHA 3NVTA 2OWWA 2VGIA 1IHIA 5C0QA 4L6HA 1VRXA 2QJHA 3T0CA 2OVLA 3WLHA 5HNUA 8CGTA 2OYMA 4MDOA 5GJPA 3WQ5A 4XTDA 3NA8A 3ARVA 1RALA 3SN4A 5GNZA 1TG7A 5EU9A 3PBVA 1GKQA 4I9TA 1XS2A 4YHEA 1JYVA 1E56A 1VBHA 9XIAA 2GJNA 2ANUA 1P1XA 2QUVA 2VJXA 4H7CA 3QQ1A 2PGWA 2F8QA 4H9MA 3H4XA 3KOFA 4IFKB 4NJKA 4M56A 3EWBX 4CNOA 4L9XA 4QAIA 5CZKA 5ABFA 2JQXA 5FF2A 4KT2A 4GVIA 1BYDA 5HPCA 2E6FA 1UIPA 4FK9A 3KCJA 1JZ2A 2O4MA 4NAFA 5RUBA 2IPWA 1NF0A 1YTKA 3RO6A 1FWJC 1MUCA 3NIYA 4MY8A 4ML4A 3EKLA 3DG7A 4JS3A 3QZAA 1YLVA 4QS5A 4RDWA 2Q09A 3CUIA 4PUDA 2HEJA 2IQDA 3EX4A 4NT0A 3NEVA 2J88A 3W83A 5IBXC 3VA8A 3GXPA 1IT8A 5I5RA 2BY2A 4IJCA 1C29A 1POKA 3FKKA 1FKXA 1PSCA 1XLFA 1KBKA 2A85A 4IPPA 3C2OA 4HA0A 3A21A 3NQEA 2YCKX 4NU7A 4GVFA 3VCRA 4BEQA 3W2KA 3B8WA 2PD9A 1G4TA 4EANA 1DXIA 1WV2A 1WYIA 3EDKA 1HNYA 3MI2A 1ZY9A 2FJKA 4UOQA 3H2AA 3AIBA 2D0GA 3BAJA 4NRSA 3K8MA 2R1NA 1RBAA 4PBEA 3O1NA 5KETA 4PL1A 3HA1A 5IFTA 4NIRA 2OLSA 1DWFM 2OO0A 1BAGA 4AD2A 2FH8A 3W1MA 3DC0A 3UR7A 4RR4A 5FSEC 4XSMA 2R1PA 4XX6A 3HG4A 1UA3A 4H2HA 4ZTXA 1SO4A 4Z2JA 4UMCA 1XCWA 3DHUA 4PCFA 3WF0A 3XISA 1YHTA 1VQTA 1U83A 4JN7A 3LSCA 3KFTA 1CCWB 5T26A 2OO6A 3MSGA 5EFDA 2EAWA 3C2YA 4C6BA 3L66A 5HR7A 2UWFA 3G0UA 1VJSA 1A80A 1PCKA 3KZSA 1EJ7L 2ZWYA 3HMCA 3GH7A 4XO7A 4DNHA 5IM51 3MKVA 3H7UA 4PMXA 1OHLA 2Y1HA 4KFNA 3OA5A 3FIGA 4AY1A 4AZGA 2WMFA 2ZXBA 4OHQA 4QIUA 2V8ZA 2ZRWA 1K4GA 4XQ6A 1HIZA 3CIWA 1JZ6A 3G24A 2WPBA 1WDSA 5A69A 4QS6A 4MVAA 1CXHA 1B3VA 1TB3A 4JX6A 4ERIA 1KM3A 3VNZA 1M03A 1GJPA 3QV8A 2RAGA 2QAPA 1RCOB 2NXHA 4F79A 2XU2A 2MNRA 4DLFA 1R3WA 5HQLA 3NNTA 3TTQA 1EC8A 3UVAA 2RGMA 3ZLHA 1FWSA 4A3QA 2BVDA 4B5TA 2PWGA 2Q02A 3LMYA 2VX5A 5HR6A 1O6IA 4ZSTA 5CPMA 4WDUA 2DORA 1V93A 4R27A 1B5TA 1CGYA 1YPXA 1EH9A 4QQ3A 3N4EA 1P48A 5EA9A 3BLLA 5F4SA 3W7PA 3A5VA 2F6UA 1LRTA 3L2LA 4B2DD 4C6EA 3VX0A 2DZSA 3AUJA 3VIFA 3HFYA 2J7BA 4AMCA 5GJNA 1U33A 1O5XA 1B54A 4PUJA 3O7UA 4LAUA 1I1WA 1EGVA 2GJLA 3BXWA 4CEUC 5LIKX 1AJZA 1P0KA 3FHAA 2FZBA 4Z1BA 1UR4A 2C6QA 3L23A 1R5YA 3VX1A 4QHRA 2E0PA 1XQLA 1AMKA 2BXZA 3BH4A 5FL1A 3C0QA 4LC8A 1TELA 1KM6A 4FF5A 4ZSUA 3GX9A 4Q4QA 1W1A1 3VDAA 1CXIA 2PAJA 1XYCA 2E77A 1MW1A 4ZEPA 3TYUA 4Z0JA 5FA5A 3J7HA 2ZUTA 4JZ5A 1WKYA 2ACSA 4IXHA 4POCA 4UFHA 1EIBA 1Q6DA 2CBVA 1J0ZA 4HK5A 3MUAA 5BXSA 4C6LA 1PCWA 4GUHA 2ZA1A 2Z2BA 4GUIA 2QCEA 4CCZA 5BRBA 3BOFA 4HN8A 3FW6A 4G1NA 4D9PA 1PKYA 3KVMA 3V1PA 1KC7A 3MBDA 1UKSA 3GBEA 1BKHA 3CO4A 3L5MA 3BV7A 2JF7A 2FZ8A 5HNNA 2WBKA 2G97A 3NZQA 2GGGA 4IQJA 8TIMA 1XPYA 1EOMA 4MKNA 3FHQA 3FK4A 3CH0A 3EAUA 2PTZA 4CGTA 2Z4GA 1G7VA 4FO4A 3GYEA 5HUOA 4GZIA 4HTBA 3PTMA 3ZJ7A 2IPFA 5CPLA 3QKEA 4FIQA 2IQ0A 1DTNA 4IT1A 2J79A 4JTUA 2PDJA 4GO8A 1S2UA 1CT5A 2NUYA 5F7UA 3GVRA 2NV2A 4AIEA 2DIKA 3KAOA 3CMJA 1E6RA 1V3KA 2J75A 3QW4B 3WF2A 2VC6A 1W8GA 3AU2A 4J5NA 1UBPC 1P7TA 2CCRA 5CSRA 2FZMA 1DIDA 1DJQA 1XLIA 1IZJA 3GU2A 3H2CA 5A6LA 1YADA 3TR9A 3CUZA 3TUUA 2XPKA 4XKYA 2CLFA 4P7LA 1H50A 3C4UA 4PFMA 4BQ2A 4NI3A 2H8XA 4O15A 2NZLA 2Y8KA 4NAEA 4Y8FA 4IPLA 4YYCA 1GHSA 3VOGA 1ZP3A 3ERPA 3B9EA 4IIBA 2FFIA 3FA4A 3B8VA 4P7QA 3W7JA 3WQ4A 1XWYA 4GUFA 1FRBA 1K7XA 4O1EA 2YFOA 2OTDA 2EXOA 1I2OA 2HJPA 3L65A 4US6A 3WNKA 4FOKA 3LBMA 2NVDA 4PTDA 1Q66A 3KP1A 1QHOA 2OLAA