3PZGA

I222 crystal form of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
total genus 155
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzgA00
1JD9A 2QF8A 1EHNA 1EGZA 3WF0A 1ZJAA 2E9BA 4AZHA 2V3DA 2JF6A 4IPNB 1OCQA 1JXKA 2NT0A 1B3ZA 2E8ZA 5A8PA 4UZSA 1FH7A 2FH8A 3LPGA 3MO4A 3F4VA 3O2LA 3OGRA 1B1YA 1GUVA 2WCGA 1WKYA 4AC1X 3EDFA 2V3EA 1WZKA 2PWFA 1HKMA 4C7GA 1FHDA 5BRQA 2J7GA 1PIFA 2YKKA 1E4MM 1U30A 3T2OA 1E72M 1XYZA 1E15A 5D8WA 3WEOA 3AIEA 5DO8A 1GOOA 3BC9A 3IAPA 2W67A 4M8UA 1H11A 1D2KA 3ZSSA 1C90A 3GM8A 1B90A 1G9HA 4CUCA 2JF7A 1MW0A 2DH2A 1KGUA 2FGZA 1DWFM 3QGVA 1BYAA 5A69A 1TA3B 4UQEA 3OGVA 5TD4A 5E09A 4AZCB 2WKGA 3GBEA 1CPUA 2D0HA 1AVAA 5FKYA 4PMYA 2JIEA 3VD3A 2BXZA 1RP8A 1GVIA 2Y8VA 1E3ZA 1PZ3A 1E4NA 4KRUA 5D9NA 3WEZA 1F4HA 1ZBWA 2YJQA 3RM9A 4XV0A 2W66A 2D3LA 2WCAA 4B15A 4FLSA 2FGLA 1OD8A 4Q7NA 1VEMA 4AD1A 1LF1A 2BY3A 3CZLA 1I1XA 4DUVA 1K6AA 4TVDA 5A6BD 4X9YA 2QPUA 4U31A 3AHVA 3L4ZA 4OBSA 3W82A 1J9YA 3AI0A 3A4XA 1V0KA 4LQ1A 2YBTA 3GNRA 1BGAA 1OGSA 1OWQA 1GQKA 3OLEA 2BVYA 1FHLA 3ZIZA 5IHRA 5CG0A 2ZX8A 3U7BA 2YIHA 1NOUA 1BVNP 1E6QM 2CYGA 2XGIA 3GXMA 2YA1A 4J3SA 1XD1A 1UWUA 3AIBA 1V3JA 3A4WA 4XZWA 2ZWZA 1QHZA 2YBUA 1B3XA 3WD3A 1BVZA 3VIMA 2D1ZA 3TP4A 3FW6A 2XVKA 3WF1A 4W88A 1ISXA 3UG3A 3WNPA 2ZXDA 3GTNA 1M01A 1QPKA 1HNYA 1Q6DA 3F5JA 4IISA 3WH9A 3AHZA 1ZU8A 1UWIA 2XFYA 5BXPA 4P7NA 4WSJA 3VM5A 2PWDA 3VIFA 2WWDA 2W91A 6CGTA 1UD4A 1W1YA 4FMVA 4MNMA 1JZ4A 2G41A 1FH8A 4PYSA 4W87A 2WVVA 2JFEX 2VRKA 2WPGA 4P8VA 2DGAA 5C70A 4ZXLA 1UD3A 4AIEA 4BQ2A 3ARXA 3IAQA 2YA2A 3N13A 3W26A 2ZX6A 4Z2JA 2UY3A 4W5UA 4AD3A 3WY1A 3ARUA 3IJ8A 5ABFB 1UHVA 1VB9A 2Y5EA 4U5IA 3VGGA 1WNOA 2E3ZA 1BPLB 2ZX9A 1AQMA 2EBNA 3OLIA 3W25A 3SIMA 3AYSA 1ISYA 3VGFA 2VNCA 2VUYA 3MUAA 2WK2A 4QCFA 1EXPA 4K68A 4IPLA 2OSXA 3K8MA 4PMQA 1KQYA 1KXQA 1Q4NX 2PBOA 4UQBA 5CLTA 1UKPA 1UA7A 5CLWA 2WMJA 4XUYA 2BXYA 3L4YA 5A6AA 4WSKA 4BS0A 4D72A 1H1NA 1H09A 1DWAM 1LG2A 2BHYA 5BXSA 3A4AA 1PBGA 4F8XA 1XD0A 1Z32X 1ISZA 5FCZA 3CZEA 4D1JA 3EDDA 5ABFA 4D6GA 4GPNA 3RIKA 1KXHA 3WDJA 2VZOA 4W89A 3BGAA 4Z2GA 2C0HA 1JL8A 4OKDA 4CCCA 1XH1A 2WHMA 2XG9A 2CNCA 3AIVA 1HKJA 4QAWA 1OGGA 1QNSA 2WC7A 2Z1SA 3L2LA 1JF5A 3SCUA 3RMEA 4ZEPA 3ZSTA 3VM7A 3L4UA 3THDA 2G3JA 5I78A 2B31A 1W91A 2CPUA 4A3HA 1ECEA 3ARSA 4JL1A 3AXHA 2PBGA 2GJXA 1FFRA 3ZMRA 2ESCA 3HJEA 1XSIA 1RPKA 2ZX5A 4UFHA 3DHPA 5CXPA 1NOFA 1RP9A 3VD9A 4JKMA 4ACZB 4JL2A 5AYIA 2W92A 3VVGA 4PTVA 1JFXA 3L4VA 3AICA 5M03A 2WW5A 4H41A 1NARA 1PIGA 1MFVA 3WNMA 2UWFA 2ZUWA 2V3FA 3KL3A 1E5NA 2VVSA 3VIOA 4GO9A 3T2PA 3CO4A 1J0HA 3CMGA 1K9TA 4QP0A 1J18A 5GNXA 5BROA 2GJRA 1ZBCA 5A3HA 1R7OA 5ECUA 4PRWA 4Y7EA 4B9YA 1JG9A 4GQRA 1E0WA 4H8UA 3AS3A 3BMVA 7TAAA 2ZWYA 3WKZA 4D1IA 2WAGA 3PHAA 2C7FA 3PZOA 1W9UA 5A95A 4CVWA 3PTQA 1CIUA 4HMEA 3GNPA 4GXPA 2ZICA 2CESA 3AROA 3T09A 1VBRA 3SCWA 2CKRA 1GHSA 4GI6A 1ITCA 1DWIM 4QLJA 2PB1A 3WBAA 1W1PA 2VZUA 3VINA 4AZBA 4NF7A 2IXVA 2XGBA 5CPSA 1MVYA 4CU8A 1K9DA 4OOUA 3EDEA 3SCTA 1PJ9A 1QW9A 5FL0A 7CGTA 1J0YA 4U33A 4E8CA 1UR1A 3GZAA 4Q22A 1VJZA 3U7VA 3ARQA 4JCLA 2JE8A 1VFOA 1V0MA 1VJSA 3WDIA 4MB1A 4CU7A 2EPKX 3MUY1 3KEHA 4MNKA 4U3CA 3UETA 3CUGA 1WZLA 2ZUNA 3JUGA 1XCWA 3ECQA 3L4TA 3N11A 2J25A 4ZXOA 3AS1A 2VX5A 2BY1A 3W0KA 4PCSA 2FHBA 2D0GA 2DT1A 4JHZA 1KXVA 1CZ1A 2YLAA 3VU2A 6TAAA 3ZT6A 3WENA 4L4OA 1V6VA 5CSUA 1JIBA 4MNJA 4ZE5A 4D6DA 1HN1A 4MB4A 1UZ4A 1XHGA 1EDTA 3SCNA 3WQVA 1BTCA 4AD0A 4B16A 3VO0A 1RH9A 4LX4A 2DEPA 1PX8A 2YL8A 4P7RA 3SUVA 5A2AA 1NWTA 3LPOA 2QMJA 2YLLA 1TVPA 3PZGA 5ABEA 3MMWA 1E6SM 4FK9A 1NWRA 1VIWA 4PMNA 1E5JA 1E73M 1Q6CA 2WMIB 1ITXA 1ISVA 4OIFA 2OWCA 2FDMA 4UFJA 1H3GA 2BNJA 4WKHA 4UR9A 2DT3A 4MADA 3AS0A 1GOMA 3UR8A 3BSGA 1WB0A 5AC5A 2JEPA 5I0DA 4GZIA 1DP0A 3QHMA 3N15A 4YHGA 1KR1A 4PSRA 5GNYA 3RCNA 1OB0A 1CNVA 3NSXA 1RD6A 4PUDA 4KWUA 3VOCA 4PMRA 1WP6A 3GDBA 1CECA 2Z1KA 1HVXA 1ZJBA 3K46A 1W3LA 2VRJA 2WMKA 2JALA 2WBGA 3O9NA 4J27A 4HA1A 3VGBA 4KGJA 4JFSA 3T2QA 3W6LA 3WD4A 1BQCA 2BVTA 4S3JA 3T0BA 4AY1A 3ZOAA 1R87A 1GQLA 5D9MA 3KWXA 1BYCA 3VDBA 2WLYA 1KBKA 5CPTA 1SMAA 1V6XA 3WDHA 3M6DA 3MV01 2VCCA 2VZTA 3PTKA 1A47A 2W61A 1WO2A 5DFAA 1OSEA 3CHEA 1KXTA 5A6KA 5LYRA 2D23A 3AZSA 1CGTA 3AMGA 1D7FA 3MV11 3EMCA 1OM0A 3ZR6A 4ML4A 2GFTA 3WD0A 4MTVA 3SUTA 3VD5A 3RPMA 4KH2A 3DYMA 4E2OA 2IUZA 4BQ5A 2WHLA 3ARRA 1QI4A 1GNXA 4N42A 5BXTA 4LXFA 3W28A 2WZHA 2F61A 1XV8A 2ZXBA 2WSKA 1J12A 3AMLA 5BCAA 1QI3A 1KWKA 1JDDA 2CIPA 1M03A 3WQ5A 2DQXA 1OIFA 4TVCA 4UFLA 1UG6A 5FIPA 3W81A 4CVUA 3WL1A 5HBFA 2XFFA 4M1RA 1CTNA 1KGWA 3WFLA 1C8XA 1SMDA 4JCMA 5FD0A 1GCYA 2BY2A 1US3A 1E1EA 2CHOA 1E4IA 1QBAA 1O6IA 3WN6A 2FH6A 1M7XA 3CUHA 2VT0A 1S46A 1L8NA 3A47A 2BY0A 2J4GA 1CXKA 4PCTA 2G3MA 1JAKA 4B9ZA 4FLOA 1CBGA 2VCAA 1HJQA 1BG4A 4U2YA 2XVLA 2HISA 1KR0A 1KGXA 1ODUA 2WVVB 4UQAA 1HF6A 4GIAA 1EH9A 1W3KA 2ZUMA 4H04A 3AHTA 4TX6A 2W62A 2DIJA 1I1WA 3WMSA 4TVUA 3UEQA 3PZVA 1CWYA 1JZ3A 1B31A 4CN1A 1HL8A 4DUWA 4RE2A 2W4XA 2XM2A 3OIHA 2PF0A 1QVBA 4AZIA 5I6SA 5IFPA 3CGTA 3OBAA 3KZSA 4D6HA 3ZJKA 2WC4A 4P7OA 2OYKA 1E0XA 1H41A 1UH2A 3WQ8A 1WAWA 2EPLX 1V08A 1IV8A 1XSJA 2VVNA 3ARWA 3N1AA 4M82A 4RE4A 3ZM8A 3VIIA 4AD4A 1ZS2A 2X0YA 5CQ1A 1C3FA 3SCRA 3GNOA 4P8WA 3IK2A 4WIWA 2VX4A 1UR4A 2ZIDA 2GDVA 4W8LA 3ARZA 4V2XA 1CGWA 3AIRA 2J7FA 4D6IA 1V3HA 3QHNA 4CN6A 2J7BA 1EDQA 4M24A 4W86A 1E1FA 3CUIA 2X8RA 4LPCA 1J0KA 4DWSC 2DPEA 3VMOA 4AZ5A 3W6MA 4JFVA 1NWUA 4AIOA 3K4AA 3ZQ9A 3FNDA 1VF8A 1CLXA 2A3AA 3NCOA 5C8BB 2D24A 2WSPA 4H2CA 3GXDA 3T08A 4TXEA 1J11A 3UR7A 3LMYA 2O92A 1TE1A 3ZT5A 4AMCA 4MJ4A 2VTFA 4MDOA 3VD7A 3BCDA 3CBWA 3POCA 3CPUA 1EOMA 3U5YA 2CHNA 2J47A 3FN9A 1UA3A 3GXIA 1KWGA 4IUGA 4ZENA 1EQPA 1CLVA 3WF4A 3IJ9A 2WZEA 2ZUUA 4PEEA 1JYVA 5A6SA 2WWCA 3SEPA 1C7TA 3VKKA 1KBBA 3NSNA 1AQHA 1UZ1A 3ALGA 2D0FA 2NT1A 1XC6A 1C92A 2O9OA 3GYCA 4C7DA 1SR0A 2G3NA 3PTMA 1HJXA 1J0IA 1IZJA 3EMZA 3B9DA 2CEQA 3NDYA 4CGTA 1DTUA 3B9AA 3I3DA 1H0GA 3I3EA 3WUFA 4DWSA 2OLHA 3WFZA 1HJWA 1TA3A 3AISA 3M46A 2WANA 3CTTA 5EB8A 1EO7A 3W24A 4OBRA 3VNZA 2XIIA 1E6XM 2O9PA 1CXHA 2EEXA 5IDIA 1XSKA 3DECA 1U2YA 4AD2A 1EHAA 3WNOA 6A3HA 3WMBA 1WCGA 3NSMA 3VMNA 5IHSA 3S2CA 4GINA 3ZJ8A 3MS8A 1JYNA 2BS9A 3RILA 1HJVA 1UH3A 2PWHA 2WVTA 3VIKA 3WQWA 3EMQA 4DWSB 5JIPA 8CGTA 2EPMX 1ISWA 1M53A 2XWEA 2W63A 1JZ8A 3EYPA 2GK1A 1V0NA 2VURA 1A3HA 4UCFA 2D20A 2WVSA 4AW7A 4AYSA 4M81A 1ESWA 4Z2LA 1GQJA 5CGMA 3FHAA 1EO5A 3NIYA 3RJXA 3VX1A 4U2ZA 3UG4A 4ZE4A 5ABHA 2ZX7A 3D3AA 1W32A 1CENA 2VCBA 4H8HA 2D2OA 4ACZA 2EXOA 4EK7A 3BCFA 3AXXA 2WZIA 1YQ2A 2AAAA 2J7HA 3F5LA 3AHXA 1W9DM 4JHOA 1GJWA 3APGA 1NP0A 4WLCA 4XB3A 2FHCA 1VBUA 1VRXA 2GSJA 3VGHA 5LA1A 2CKSA 3K8KA 4HPGA 4OOZA 2X1IA 3VDAA 3CLWA 2WLZA 1N82A 2A3BA 3VDCA 2V3GA 1W3HA 1E6PA 3BLPX 3NYDA 4PMUA 3MKKA 1E4LA 2VZSA 4BQ3A 1GZJA 4BQ4A 3BMWA 4W7VA 5E6YA 4ACYA 1UKSA 3OZPA 4XZBA 1K9FA 1UWQA 1UR2A 5CSYA 4JFWA 3G6LA 9CGTA 5A1AA 4GQQA 5I23A 4J3XA 2UY4A 2YL5A 3M7SA 2CETA 4BZYA 4E8DA 4TX8A 2J7EA 2DDXA 1ZL1A 2GJPA 4W7WA 4PMOA 4QFUA 4QLKA 4UOQA 3WMCA 1BYBA 1QI5A 3I3BA 4UFKA 5M3WA 3VGDA 5D9OA 4GZEA 4HOXA 4PMDA 3AIQA 4AZGA 1G5AA 4DUXA 1EIBA 1V3MA 1R85A 2RGLA 2GVYA 2X0HA 1VEPA 3AMKA 5JBEA 3N12A 3J7HA 3VX0A 2WB5A 2EJ1A 1BGGA 4X0NA 2J62A 1HKKA 3LPPA 3PZIA 3MSGA 1W1VA 3GH7A 1CXEA 3BAYA 2Y2WA 4W85A 1BYDA 1TMQA 5M17A 2WKLA 1P6WA 2G4FA 5E0FA 5HXMA 4LYQA 1QNOA 1JGIA 1W1TA 4AZ6A 2ZUTA 3U57A 1ODZA 3TTQA 1LG1A 4EKJA 1PZ2A 2ZE0A 1FH9A 3HMCA 2J8FA 3WF2A 1B3VA 1NH6A 1UYQA 4LGXA 2CCRA 4EE9A 4AZ7A 4EAMA 2J7DA 2XHYA 1WPCA 2E4TA 3CIVA 1LL6A 5EMYA 1G94A 3HN3A 1K9EA 3N17A 4NRRA 1QHOA 3W37A 4AZCA 1GONA 4HZ7A 1JF6A 3WH8A 2E9MA 3PZMA 1VFMA 3WELA 1TVNA 3KE0A 1NM9A 2VX6A 4AWEA 3KL0A 1GPFA 3VIJA 3W27A 2HVMA 1DHKA 3WDPP 3POHA 1MQPA 4UOJA 5JBFA 1H49A 1LQ0A 4HPHA 4WJXA 4Z2IA 1GW1A 4UZUA 1UUQA 3T0AA 2EPNA 2PWEA 1JZ2A 1DWGM 3WDQA 1MQRA 1U33A 1V02E 3L2MA 1OD0A 4JFTA 3OA5A 3SUUA 1CYGA 5D8ZA 4JFUA 3OZOA 1OINA 1JZ6A 4PUEA 3OGSA 3BAKA 1JNEA 3AS2A 2YDQA 1J0ZA 4UQDA 2CERA 5D9PA 2X05A 4HU8A 3FAXA 4MPKA 1NWSA 1DEDA 3PZNA 1E56A 1UD2A 1QI0A 3PZUA 3WH5A 1LL7A 1EA9C 1E6ZA 4PTMA 2EQDA 3W53A 2BHZA 3ARPA 5E6ZA 1J10A 1QW8A 1V03A 2VR5A 4JAWA 3ARVA 4U3AA 1X6LA 2EO7A 1OGBA 4MB5A 1BF2A 3F5KA 2WMGA 1HIZA 4D6JA 5A8MA 3B9EA 5EBAA 4W5ZA 5CGTA 1JDAA 1XH0A 3AQUA 3DYOA 1B3YA 3VPLA 4KGLA 4PTXA 2PC8A 1Y7VA 5IXEA 1UD6A 2AMGA 4HTYA 2WVUA 3NDZA 3BAXA 1WZAA 3MU7A 4NRSA 1E3XA 1HP4A 3EBVA 3WUEA 3CZJA 5ABGA 3RDKA 3FHQA 2E0PA 2VOTA 3SUSA 1GOWA 3IANA 3WQ6A 3EDJA 2WYSA 1H0IA 2DSKA 3TA9A 1M04A 2OWWA 4ATWA 3SURA 5LA0A 1UQYA 2O9RA 3CHFA 2J78A 1E55A 1UWSA 2G8ZA 2O9TA 1HKIA 2J79A 2BFGA 1ZBKA 3FXYA 3RM8A 1CDGA 2J75A 4TTUA 4OUEA 5M5DA 4IM4A 4PSPA 3M07A 1UKOA 2TAAA 2OYLA 2VX7A 3UERA 4MB3A 4D71A 3TTYA 1OBAA 1WDPA 3SCSA 1KCLA 5DF0A 4C7FA 2E8YA 4PMZA 5HPCA 4ATLA 1G0CA 3CHDA 4WKFA 1G1YA 1BAGA 2DSUA 1GOQA 1LWJA 4CD7A 1IT0A 5JBDA 2J74A 1C93A 1PX3A 4P8XA 2GDUA 3UCQA 1NOWA 4PBGA 3AYRA 5A2BA 3FAWA 4MAZA 1XRVA 1TZ7A 2V38A 1UR9A 4F9JA 5BWFA 3WF3A 3VMPA 1L0PA 3PBGA 3VTRA 1GJUA 3BAIA 4V27A 2YL9A 4MJ2A 3QOKA 1TG7A 1R8LA 1GHRA 3AIWA 2XPKA 2XUCA 3DYPA 4N0RA 4D6CA 1V02A 4CKQA 1UR0A 1EQCA 1UD5A 3WBEA 1E40A 2VJXA 2A3HA 4BA0A 5A8OA 3ZT7A 5AY7A 2JIWA 5DMYA 3VNYA 5AC4A 4UNIA 1EOKA 1Q6FA 2VR4A 4J3TA 4NZCA 5GNZA 4HMDA 5A8QA 3U5UA 3II1A 1V3IA 1JZ7A 3SCOA 4UQCA 5GQBA 1US2A 2YOCA 2ZXAA 3N18A 5I3DA 1XCXA 1HT6A 3VIHA 4W8BA 2CBVA 1SFSA 3FY1A 4A3YA 2VI0A 3E1F1 1WDQA 4CU6A 5LA2A 1E9LA 3W29A 2VQUA 1UQZA 3S6TA 1MFUA 3B8SA 1X1NA 4AXNA 2BV9A 4H7VA 3OG2A 1MW1A 2DSVA 2NSXA 1D3CA 2GJXB 2CBJA 1X6NA 3K8LA 5IFTA 5A6LA 1PPIA 3AIUA 2VO5A 2W5FA 1FOBA 4M29A 7A3HA 4NSBA 4MDPA 2MANA 4XX6A 4FF5A 3VUPA 3OB8A 3ZJ6A 1UWTA 3DHUA 5AYBA 3UESA 1UH4A 1PEZA 4B3KA 3CUJA 1W2VA 3GH5A 1E0VA 2VZVA 2DSZA 3WH7A 3WSUA 4J28A 2OYMA 2BVDA 3VIGA 4W7UA 1XH2A 1TCMA 2XJ7A 1JI2A 2WHKA 5A6JA 4BF7A 2YL6A 5I5RA 3THCA 2Q8XA 2RGMA 1JXJA 4JKKA 1O7AA 2EPOA 3BH4A 3MUIA 3TTOA 5F7UA 1R7AA 1E6NA 3RO8A 3WNNA 2WXDM 2WCSA 2XTKA 3VILA 4S3KA 1V3KA 4H8VA 1JZ5A 3BAWA 1CGUA 2J8GA 3N04A 4W8AA 1VENA 4W93A 1I75A 5I2UA 4QLLA 4AD5A 1JYXA 8A3HA 2CBUA 2WMHA 5I24A 4P8UA 2F8QA 3MANA 1GVYA 2DH3A 4DWSD 1SYTA 3A6OA 2D3NA 5A2CA 4GI9A 1PAMA 4DM1A 4AISA 1V3LA 1V6UA 3VDHA 4V28A 1BLIA 1DWJM 4JKLA 3RM4A 4CN4A 3AHYA 3AZRA 4NI3A 2XYLA 5HDRA 2OWXA 2Y4SA 1GORA 4F79A 3HU7A 1UWRA 4ATDA 3ZJ7A 1QI2A 4HU0A 3AZTA 3ZR5A 3RJYA 5A8NA 4UFIA 3WEMA 4HZ6A 5DEZA 1YHTA 4Z2KA 4WF7A 1FP9A 3ALFA 4TTGA 1BSIA 1LJYA 5A6MA 3MSDA 4JZ5A 1B3WA 2WC3A 2C8NA 2V5DA 4OJYA 1AMYA 3EDKA 1OT1A 4UOZA 4CD6A 1V6WA 5BYWA 2XVNA 4EANA 1GOIA 1NQ6A 3O6AA 2E9LA 2V5CA 2DT0A 2D22A 5CPQA 4P7LA 1WE5A 5E0CA 2GK1B 2QPSA 3WDRA 4GI8A 2F2HA 2CXGA 4F66A 3MMUA 4QCEA 4RL3A 2WMFA 3OLDA 5CJ5A 2XVGA 1BFNA 1QNQA 5EFFA 4D6EA 2VQTA 2VMFA 1FFQA 1PX4A 4M56A 4FLQA 3VGEA 2YA0A 1TFVA 1UD8A 4PN2A 1Q6EA 4HOZA 3VD4A 3WNLA 5HOSA 1V0LA 4ZFMA 4CD5A 1W3JA 3WL0A 1KCKA 1GOKA 1MYRA 4B3LA 1JYWA 3CZGA 1HXJA 1DWHM 1VAHA 1LWHA 1OIMA 1UR8A 2VRQA 3WUBA 3ARYA 4AEEA 4KRTA 2J77A 4YHEA 4PMVA 3GH4A 3ZO9A 1EDGA 3L4XA 5DT7A 1HVQA 1J01A 1JDCA 3AOFA 4X0VA 4TOQA 2UY5A 3SUWA 1B9ZA 4YPJA 4E4PA 5C71A 1H2JA 1QNPA 5E9AA 2VC9A 4J3WA 3CHCA 3CMJA 2WNWA 1KQZA 3BSHA 4PMXA 3WQ4A 3CZKA 1KFWA 1C7SA 1Q6GA 3L4WA 1NP2A 3SCPA 1TR1A 3D5HA 2XWDA 1FP8A 4MNLA 4FLRA 4HZ8A 1W9VA 4DM2A 4YN5A 1C8QA 2ZOXA 4KMQA 1AQ0A 4J3UA 3G6MA 3QHOA 1BG9A 3NJ3A 1KB3A 1H5VA 1JD7A 1H4PA 1HJUA 5BRPA 2BHUA 3SCQA 1UKTA 3GXFA 3KL5A 1E71M 3AMDA 4PTWA 5A6BA 2G3IA 1HJSA 1XYFA 3PZQA 4CD4A 3QOMA 1UOKA 3WUGA 1JNDA 4HA4A 4U5KA 2A3CA 3CUFA 3WH6A 3K1DA 4HOWA 2QLYA 2XFRA 5GPRA 4OZOA 2WHJA 1MW2A 3T0DA 1HX0A 1MXGA 2VL4A 4M80A 2X09A 2DT2A 2Y24A 4MAVA 3QR3A 4UQ9A 1CEOA 1ZB5A 1QHPA 1HP5A 5JIWA 2WM0A 3LPFA 1QBBA 5I79A 2PI6A 2XM1A 3VIPA 2CITA 3WNKA 4J3VA 1F4AA 1B30A 1CGVA 2AOSA 4CCDA 2GUYA 1W9PA 5FL1A 1UKQA 4AEFA 3NUKA 4P7QA 2WBKA 3AJ7A 1MWOA 1FA2A 1GQIA 3OLGA 4F9DA 2OSWA 1IZKA 2CBIA 5JUVA 1W9XA 1OT2A 4WK9A 5FOOA 1MXDA 4HMCA 3GBDA 1E43A 3AMCA 1BHGA 1CXFA 4RE3A 1W9BM 4W84A 3CH9A 3A3HA 3AXIA 3BXWA 1LL4A 1MW3A 5I77A 1JAEA 3MMDA 1VFFA 2XSBA 1ZBVA 4HP5A 1CGYA 1LLOA 5CZKA 1TUXA 5E70A 1QNRA 3PZTA 2FHFA 1CGXA 1JFHA 5KEZA 1E6RA 4L4PA 1J0JA 2XSAA 4J7RA 2E40A 2YDSA 4R27A 3UG5A 4TUFA 2OSYA 3WD1A 4CCEA 2QV4A 3TONA 1XGZA 4R5EA 5HPOA 1B0IA 1C91A 4QDMA 5DT5A 4AIUA 3TOPA 2QHAA 3BAJA 3WIJA 4UFMA 1WDRA 3AFBA 4BCEA 4HA3A 2NW0A 2DSWA 1VEOA 3K4DA 4GKLA 4GZJA 4A4AA 3PZ9A 4JIEA 1JI1A 4WKAA 5HNNA 3N9KA 5KZ6A 2PWGA 3DC0A 2YDRA 3IJ7A 3SCVA 4UTFA 4URIA 5A94A 2ZXQA 3TTSA 2JEQA 5BXRA 2UY2A 4D6FA 1C8YA 4Z2HA 3MUZ1 1W2PA 2WMIA 1CXLA 2XVPA 2A3EA 2J7CA 3W38A 4CD8A 1CXIA 1QOXA 3BLKA 2ZUSA 5EFDA 2Y8KA 2XIBA 5D4YA 1R86A 2QMKA 3CZ8A 4GO8A 2IXUA 1WZMA 4LYRA 3WD2A 2X2YA 4LYPA 1E70M 1G01A 2ZUVA 2DIEA 1B2YA 3W4RA 1MQQA 1V6YA 1WDSA 3PN8A 1VFUA 1HL9A 3ARTA
chains in the Genus database with same CATH superfamily
4LTSA 1JD9A 1ZTVA 1EGZA 1ZJAA 2V3DA 1QR7A 4G2DA 1K6WA 4GH3A 1ICSA 1GVEA 4O11A 4Z1YA 3BOLA 3EXSA 1B1YA 3EX3A 3WLJA 5AFDA 4PFHA 1BF6A 3CB8A 2J7GA 4FZIA 5DRIA 1XINA 2NVAA 4B5UA 3QW3A 3W01A 1E15A 3WEOA 3RU6A 1GOOA 2PLKA 3IAPA 1RY0A 3IVTA 1QASA 3R25A 5D32A 3BWWA 5AVNA 1C90A 3GKAA 2P3ZA 2TMDA 1EFZA 2JF7A 1MW0A 2AMXA 1KGUA 2IKIA 1PTDA 2RJHA 3ME3A 3R5EA 3NO1A 3NQ8A 1DWFM 1BYAA 3MCMA 4MZYA 4UQEA 2Q6ZA 1XX1A 5C9UA 4MLJA 3LCXA 3NO5A 4X2PA 2YXXA 7REQB 3B0PA 1XYMA 4XIMA 5F1UA 5CC6A 4RW5A 1CPUA 3R10A 5J8LA 1QJWA 1AVAA 3NPWA 2BXZA 1JCJA 3FGCB 3REQA 4KRUA 4FNSA 3VZYA 3TK7A 3WEZA 4H6KA 3KCOA 1F4HA 3EAUA 1R46A 3ITGA 4PFMA 3QV6A 4LUSB 4YNGA 3LY0A 4A8LA 3CAVA 2WCAA 1VEMA 1LF1A 4QNEA 1ME8A 4DUVA 4B2DD 1K6AA 4TVDA 4X9YA 1PTAA 4JTFA 4U31A 3WQOA 1TV4A 3AHVA 3OODA 3W82A 1TWWA 3S4TA 4UB9A 1J96A 3TLLA 1BTMA 3RO6A 1BGAA 1OGSA 2BVYA 3ZIZA 2A6NA 2IKGA 1BVNP 1S5VA 2UBPC 1V3JA 3K30A 1HZYA 4XZWA 3R94A 2PCEA 2X1UA 3WD3A 3HG3A 1Z41A 3M0ZA 3TP4A 4K1GA 4L6OA 2J24A 1I2QA 2XVKA 2C79A 1NF7A 5U4NA 2VD8A 1D7KA 4K37A 1ISXA 3UG3A 3KDNA 2OEJA 1X7IA 3GTNA 3PNUA 1M01A 4IJBA 3F5JA 2OZ8A 4CEXC 3WH9A 3RR1A 1ZU8A 1WYIA 4Q4OA 2XFYA 1VIZA 3EEZA 3QSTA 4LW7A 4FMVA 3EEGA 4C91A 4PYSA 2I14A 4W87A 2Y5SA 2PDQA 1KM2A 5C70A 2PDXA 4AIEA 3ARXA 3TEVA 1XIGA 3P2VA 3QR0A 3W7CA 1XGDA 1P6BA 1TZ9A 3PBUA 2UY3A 4M5PA 1F8MA 3ARUA 1B3OA 2F6KA 2Y5EA 3VGGA 1Z8AA 2ZX9A 1AQMA 2VUNA 3AYSA 1ISYA 6REQB 2VUYA 1UOZA 2HMCA 1XQLA 1K7FA 2ZC1A 4RW3A 2WK2A 4MUPA 1XRFA 1EXPA 3PBVA 1LRTA 4TQTA 3RLHA 1Q4NX 4MWAC 1UKPA 1UA7A 4CQDA 1AJZA 3DN5A 3L4YA 5A6AA 3L5AA 3IVSA 4RX0A 4KFOA 4Q3MA 1KC7A 3BO9A 3W2MA 1KD0A 2RHGA 3EDDA 4D6GA 1KXHA 1Q5MA 3BGAA 3A4JA 4ZTXA 4Z2GA 1SZGA 3UBPC 4OKDA 1O5KA 3QPEA 3HZ3A 1XH1A 3M43A 2G0WA 3AIVA 2FTPA 1OGGA 1QNSA 2WC7A 1JF5A 1C29A 1MRAA 2OVLA 3RMEA 3ZSTA 1R38A 5I78A 5AB3A 3V0UA 2CPUA 3AXHA 1CW2A 2GGHA 3AALA 1UROA 2ESCA 3HJEA 4HNOA 2ZX5A 3EWCA 4UFHA 2Y7FA 5CXPA 3L66A 3W7IA 2FFCA 2QJJA 4PTVA 5HA7A 4MG4A 4LBSA 1PIGA 4IGNA 4JN7A 3NM1A 3CEUA 2VFIA 4Z0JA 1E5NA 3GTIA 5LHFA 5LNWA 3T2PA 1Z44A 3EB3A 5A3HA 2OZ3A 1XIDA 4DJDD 1Z7AA 4H8UA 3V36A 3AS3A 7TAAA 4EWJA 4D1IA 1T8XA 3S9ZA 1ELSA 1W9UA 5A95A 4QJ1A 4RDWA 5LZLA 3SCWA 2CKRA 1GHSA 4EPKA 4MWAB 1VLIA 4AZBA 3QFEA 4NUWA 3R8GA 4CNSA 5CPSA 1MVYA 4CU8A 1K9DA 1HL2A 3HPFA 1QW9A 7CGTA 3GU9A 4E8CA 5LSMA 3FV9A 3P5YA 3U7VA 1P0BA 4JCLA 2JE8A 1VJSA 3MUY1 1A50A 3KEHA 4LNYA 2QCNA 4E5TA 3UETA 4K8EA 4L4LA 3E0LA 3I6TA 3JUGA 1XCWA 3ECQA 3N11A 3W7NA 2BY1A 1EWDA 3G1FA 3W2JA 1KXVA 4JHZA 4NAFB 2IPGA 4AY7A 1PS9A 4L4OA 3MT1A 4AF0B 4ERGA 2HBVA 4MNJA 3E5PA 2DUXA 2GWNA 3P84A 1M9HA 4MFDA 1PSCA 3UXAA 4LX4A 1Y0EA 2DEPA 1XLMA 2VGGA 3PSVA 4JQAA 5G2IA 4FOKA 3R11A 1NWTA 3LPOA 2QMJA 2YLLA 4S3BA 4ZQPA 3IUHA 1VIWA 4PMNA 3EA1A 4OIFA 1GKPA 2YR1A 4ADTA 4KQNA 2PRHA 1GOMA 3UR8A 1F6PA 5FAGA 2GOKA 3BSGA 1WB0A 5C54A 5AC5A 5J5RA 1IXQA 4GZIA 3QHMA 3N15A 1JDFA 4HSHA 4A2RA 3G1RA 3LI1A 5IBXA 3RCNA 4JTGA 4DPPA 3W1XA 3S8HA 1LWIA 1CNVA 3NQBA 3L68A 3VOCA 4PMRA 1O4UA 2R1NA 5AHMA 1LCOA 2QW5A 2Z1KA 3TYBA 3I68A 3UWUA 3W6LA 4S3JA 2VYOA 4MZ1A 3ZOAA 4QIUA 2WLYA 3WDHA 3M6DA 2VCCA 1TSIA 2VZTA 1A47A 4FSAA 3FSTA 1I0BA 2PDUA 3OHMB 4DELA 4B5WA 3CHEA 1KXTA 5LYRA 2ISFA 3AZSA 3WLTA 4FS9A 3MV11 4V15A 3WK2A 1OM0A 4KEZA 1NDYA 1EPXA 2WJEA 2GFTA 3R4IA 1N7KA 3SUTA 3RPMA 4KH2A 1TJRA 4GXMA 4E2OA 1NQKA 2IUZA 3SRFA 2J13A 3ARRA 3CMFA 3QKZA 4WOZA 4WOQA 2WZHA 3KCJA 2E67A 2V5KA 2PEVA 2TODA 2KZHA 2XIJA 4H19A 5BCAA 2QVHA 3WQ5A 3B97A 2DQXA 1E9ZB 4TVCA 3BLEA 2A3LA 4GNKB 1MNZA 3WFLA 1J6PA 1SMDA 3WJSA 4GBUA 3LQLA 4JCMA 3T8LA 5CBBA 1GCYA 2DZUA 4Q4KA 3IWPA 3NXLA 2NXGA 4HYVA 1JUBA 2QAFA 2FH6A 4S3CA 3L0NA 4E8GA 5C9RA 5FF7A 2BY0A 4HN4A 4KF1A 1CXKA 5JU6A 3H2CA 4PCTA 2QCDB 3MC5A 2XN0A 3KM8A 4FLOA 4L5ZA 1IWBA 3O15A 1A4LA 1SO3A 2XU2A 4IGSA 3P93A 4U2YA 2XVLA 3E02A 4HT3A 4UTHA 2FFIA 2VFDA 1MEIA 1XG4A 2RDUA 4GIAA 3WCZA 1QU4A 2DIJA 4CQCA 4TVUA 3W1QA 5EMMA 2H90A 5F4SA 3UG8A 5L9FA 5CCZA 3OIHA 2HS8A 4XAZA 3VKJA 2C6QA 3KZSA 3FEQA 4D6HA 3PANA 3CIWA 4HNTA 3TQKA 1XUZA 2PLCA 4A21A 4H7ZA 1UH2A 1RY8A 4EAYA 2EPLX 1A4MA 3GDMA 1V08A 3BOFA 4FXSA 3N1AA 4DAIA 3TROA 1T7LA 3WMLA 4CQ9A 4RE4A 2X0YA 5JQ9A 3GNOA 5EGRA 3EPOA 4PCFA 1XBVA 1NU5A 2Y85A 2GUUA 4RNFA 4QROA 3CH0A 1CGWA 2J7FA 4D6IA 2J7BA 4YCOA 4FXFA 4NZJA 1UC4A 4W86A 1E1FA 4JTIA 4GQGA 1XDMA 1VPXA 2E6YA 3SRKA 2DPEA 1BWLA 5BOOA 1XP3A 3NZGA 3PF3A 4J5NA 4MKSA 4WQ6A 1CLXA 3N6JA 2D24A 2REQA 2RDXA 1AODA 3E96A 3OJGA 3PFMA 3NL2A 3HGRA 3UR7A 1TE1A 4IQEA 3DGRA 2VTFA 3DOPA 4RUBA 4NI8A 2OEKA 1EP2A 1OFDA 3GR7A 3CPUA 3W74A 1V7AA 1W5MA 1XYLA 2VEFA 1D3HA 1IR2A 3RFAA 4PH6A 4D9PA 5C9WA 4NVTA 2R1PA 1CLVA 3LS9A 3MKCA 4HCDA 5LXEA 4AQLA 5C9XA 3OQEA 3VNIA 2QCDA 2WWCA 3SEPA 3NSNA 1Z9AA 4S3AA 3ALGA 2D0FA 3GYCA 1C92A 4C7DA 4GZ7A 1SR0A 2G3NA 1GVOA 3EOOA 3QQ0A 5LNRA 1J0IA 3EMZA 3T7VA 1M41A 1DIEA 3BLIA 4CGTA 2R1LA 1H0GA 3GW0A 1MUWA 3I3EA 3UXIA 4DWSA 3BPWA 1TPWA 3FKRA 3V75A 3NQCA 2NQJA 2OLHA 2V8ZA 1TA3A 1U1UA 3AISA 4XD4A 1EO7A 1CXHA 2MUCA 4PUKA 4EACA 1VBJA 4EXQA 3DECA 3QZ6A 3T8QA 6A3HA 1EEPA 1JQVA 2VC6A 1Q2SA 5IHSA 1VFHA 3HFTA 3ZWSA 2OZTA 4GINA 3N2XA 2ZVIA 3MS8A 2BS9A 1UH3A 3VIKA 2AQVA 1EBGA 1GVRA 1UP2A 2DZBA 5JIPA 1LOLA 1TTJA 1ISWA 1M53A 2W63A 1ADOA 1V0NA 3GRIA 4JR5A 2BMBA 4GCXA 3I7RA 1GQJA 4UCGA 1G69A 3VX1A 3E2RA 4O4VA 2FVMA 2EHHA 3IGSA 1FWRA 4NYUA 4EK7A 2AAAA 4JHOA 5J04A 3BLFA 1R3QA 4WLCA 3EXRA 2GSJA 1K77A 4OGZA 2KAUC 4HPGA 4EIVA 4OOZA 1YDOA 4C5YA 3CLWA 1OC6A 2OCZA 1N82A 2ISWA 2JGYA 1W3HA 1R3SA 1E6PA 2VFGA 3MKKA 5I02A 2Q3OA 4IQDA 1C9WA 2VZSA 6TIMA 4BQ3A 3H23A 4ACYA 2H8XA 1UWQA 5CSYA 1ZRQA 4H9YA 3AUOA 1IEIA 1TO3A 1FWTA 4TX8A 4LCQA 3STFA 4V1YA 1Z89A 1E0UA 3MKVA 2WV8A 4W7WA 3EWBX 4QLKA 4GH1A 4UFKA 3B8DA 3M5YA 5D9OA 4GZEA 4XO6A 3U2OA 4PMDA 4AZGA 3E0WA 1V3MA 4NYYA 3TXZA 3UWVA 1RBLA 3GNDA 5AHNA 3V7PA 4PZVA 3A3WA 2GVYA 3KRUA 3AMKA 3N12A 3J7HA 3VCRA 3VX0A 5BNKA 1OK6A 1RSCA 2EJ1A 3W75A 2J62A 1HKKA 3UGVA 4DF2A 5DLCA 3PFRA 1HG3A 3MSGA 1IQ8A 3WLIA 3GH7A 1J6OA 1CXEA 3BAYA 2CZEA 5LIKX 5HXMA 1QNOA 3VDGA 1RAKA 2ALDA 1P1XA 2ZUTA 3TTQA 1ODZA 2JGQA 3LRMA 5G1YA 3N6QA 1PZ2A 2ZE0A 4I9TA 3LXBA 3QPYA 1I0DA 3NZPA 1NH6A 4LGXA 4H6QA 4EE9A 4AZ7A 2I7GA 3LSCA 4EAMA 2F7FA 1VRDA 1FWCC 4HU4A 3N17A 4LC6A 4J35A 1F9CA 1GONA 1TX2A 2HK1A 3WELA 1TVNA 3TJXA 2GVEA 2VX6A 4O54A 1GEHA 3W27A 3ZLFA 1FXQA 4GYPA 2FJKA 4EXBA 4HPHA 5D2YA 3EWXA 3GX9A 3FDKA 3C8FA 3WDQA 4ROQA 2IPJA 4DJED 4MLRA 1F3XA 1CYGA 4BKNA 5D8ZA 1EJWC 1OINA 4PUEA 5HMEA 3OGSA 2O4QA 2YDQA 4IFRA 1J79A 2ZRVA 3S3GA 4MPKA 1NWSA 3TUUA 3C0JA 1DEDA 1UD2A 1S2UA 3SN1A 4MYXA 4PTMA 1X98A 3QBUA 3MYPA 1J10A 1SZRA 3UQNA 5AYZA 1HFBA 4PCPA 2VR5A 2QCHA 2PP0A 4MB5A 4UMBA 2HK0A 3F5KA 3EWUA 3T9PA 3AU2A 1F73A 3R79A 3AQUA 1XIJA 2BOFX 1ZSXA 3VPLA 3PK7A 1Q65A 4N02A 2FPVA 4E0CA 2PC8A 4P61A 4JTLA 1YE4A 1YBQA 2WVUA 2OKOA 3NDZA 1I8JA 4AHPA 4MY8A 4RR4A 1AK5A 1WZAA 1S5NA 3LNMA 1HP4A 3WUEA 3CZJA 1GOWA 2J9XA 1R6WA 2VDIA 5LA0A 3H22A 1UQYA 1XPYA 2J78A 5SWUA 1UWSA 2G8ZA 3WLSA 4IXHA 3N29A 2H6RA 1FY6A 3FXYA 1CDGA 5BZAA 1MUCA 4IM4A 3M07A 2TAAA 2OYLA 3UERA 4MB3A 1RCQA 2E8YA 5HPCA 3ANYA 3P7YA 2QNEA 4RE0A 5I03A 1HO4A 4Y8FA 4GKTA 3W2NA 5I09A 3VZXA 2PC4A 2YX0A 5D37A 3UCQA 3AYRA 3W7EA 4DJFA 1EF2A 1XPGA 3ITLA 4F9JA 5BWFA 2NWRA 3M0LA 2YL9A 3C2OA 3QOKA 1AFSA 5MF5A 3EX6A 4MVAA 5T91A 4IMEA 1V02A 2FYMA 2PDHA 4PUNA 3WBEA 3WLOA 1GPWA 2A3HA 1A3WA 3D3FA 1H7WA 3N2TA 3TC3A 8TIMA 2PDGA 5T26A 1ML1A 2VR4A 4NZCA 1KLYA 3BGGA 5FSDC 3II1A 1V3IA 4I6VA 1JZ7A 3MI6A 4JHMA 3SCOA 3MP4A 4UQCA 1QK2A 2QJHA 2YOCA 4QAIA 3EB2A 4LUYA 3N18A 3TWBA 3TFXA 4A3YA 4KPLA 4EWND 1EUNA 3FGCA 3REQB 5CEWA 4JY8A 2ZADA 1E9LA 2GVGA 1X39A 1W5PA 1XGEA 3B8SA 4QEEA 1X1NA 5LGXA 4AXNA 4ZODA 1JCLA 4Q8VA 2OOFA 2IKJA 1BD0A 1REQA 1FKXA 1MW1A 2QUUA 3K8LA 5A6LA 7A3HA 2MANA 1A0DA 4XX6A 1EPVA 1O5QA 3M5XA 1FWFC 3OB8A 4AU0A 1PEZA 3M5ZA 4IIBA 1VGAA 2PZNA 1PE1A 3M6YA 2VZVA 3M47A 3TCSA 4J28A 1A5AA 4H6RA 3KTCA 1XH2A 4O53A 1XS2A 2XJ7A 1JI2A 3QMTA 4XTIA 3LHYA 4R7WA 2RGMA 3G1DA 1YMYA 4HBKA 2PTWA 1EKOA 2EPOA 4LBRA 3KCLA 1VS1A 5H1WA 3VNJA 1XIIA 5I3FA 1UWAA 3SY1A 2XTKA 3VILA 4MZ8A 1Q7MA 3IIVA 1TVLA 1X8FA 4O1BA 3N04A 4KIRA 1NY1A 3HQNA 4LCRA 8A3HA 3SZ8A 2WMHA 5G4EA 1XIMA 2P53A 3MTWA 2X7VA 1RJPA 3RRXA 4RDVA 1FWHC 1G4TA 2QVNA 3CU2A 2D3NA 5MKGA 7ODCA 1BVWA 4DM1A 1VR6A 3PM6A 3N19B 3HQ1A 3SY8A 5LNUA 3RAOA 1BLIA 3NZ1A 4CN4A 4JKLA 3RM4A 3AZRA 1EWEA 4NI3A 3O05A 2OWXA 4U4MA 1Q6QA 3WK0A 3N9RA 3NVTA 3B05A 3UA3A 4HU0A 3AZTA 3ZR5A 1J2WA 3F4CA 4J3ZA 1KM0A 3EXTA 3KBSA 4UFIA 3WEMA 3NR0A 5DEZA 1MI3A 4BEUA 4WF7A 5KSWA 1EP3A 1F07A 1OEPA 4JZ5A 5C6MA 4JX5A 1HKWA 1XLDA 2F9RA 4S3FA 4MMWA 2YCJA 3GK0A 4EANA 3L0KA 2E9LA 3IK4A 3MSYA 4UTWA 1J2BA 4XO7A 1WE5A 2CHRA 2QPSA 3EZ4A 4M7SA 3WDRA 3IIOA 1EA0A 4L6HA 2VGBA 4ZOBA 4DEFA 4F66A 4OWGA 3G18A 1F2JA 1OX4A 2P8BA 3OYXA 4UTJA 5CC5A 2FJUB 5EMUA 3C8NA 3ITYA 4WVXA 2VQTA 3EPNA 4LB3A 1ZJIA 2VMFA 2W3ZA 3LG3A 3P74A 1GW9A 4DNHA 1ALDA 1UD8A 4J2PA 4M7TA 1V0LA 4ZFMA 4DBSA 3HV9A 3LGDA 1GOKA 2YYTA 4JS3A 3GHTA 4B3LA 1HXJA 3ZLGA 1LWHA 1OIMA 1F8IA 1UR8A 2VRQA 1T96A 3OVQA 1HKVA 2ZZ2A 3NQ6A 4AEEA 2NZLA 3VABA 3GH4A 4Q8OA 5DT7A 4LCSA 1J01A 3IJDA 4WRHA 4HHMA 5AHEA 5AZ1A 1H2JA 5XIMA 3AWOA 2DUZA 3VNKA 3LX9A 2BOEX 3BSHA 1X96A 2QGYA 3AAMA 1KFWA 4H83A 1Q6GA 3DC8A 3SCPA 3D5HA 4IQJA 2FPTA 3RLVA 3P82A 1UASA 2J9ZA 4KMQA 3TMLA 3G6MA 4LVAA 4NILA 4Q7IA 4Q4QA 3GFZA 5D2XA 5T9BG 1QWGA 3UZXA 2PSNA 3AMDA 4ZB0A 2YZ5A 5E9XA 2G3IA 3PZQA 3QYQA 4N2YA 1QPQA 1UOKA 1XG3A 4F40A 5C2CA 2WJDA 4U5KA 1TUFA 1VP5A 4V1XA 3URQA 2A3CA 3W1AA 1PUDA 3CUFA 5I7GA 3WH6A 4HPXA 2R8WA 4LANA 3B0UX 3LXAA 3W70A 1AH3A 3DFNA 1S39A 1LTDA 3LPFA 3P60A 2PDFA 1A5NC 1QBBA 5I79A 3M7WA 4RDYA 3VIPA 2CITA 3P14A 3WNKA 1GYNA 2HSAA 4YVVA 2GUYA 1LBLA 4NAFA 4Y9MA 1TPH1 2ADAA 3PULA 2WZMA 4Q6XA 2PDKA 2CBIA 5JUVA 1W9XA 4WK9A 3UVIA 2NX9A 3KFTA 3A21A 3AMCA 1ZALA 3B8TA 5J5DA 1FDYA 1L8PA 4EXAA 4W84A 1MZHA 3A3HA 1LL4A 1MW3A 4IMGA 2PU0A 2XSBA 2NQ9A 3NGFA 2RDWA 1YNYA 3GDKA 4I8DA 1LUCA 1P5BA 5KEZA 4L9XA 4L4PA 4C5ZA 1L6GA 1ONEA 4J7RA 3W7QA 1XLHA 5LNVA 1JPKA 2YXOA 4TUFA 1R3WA 3C52A 2V2CA 4XIAA 1F7BA 3IIZA 3UF9A 2OSYA 3CAWA 3KHJA 3HA1A 4DYEA 1XGZA 3UZJA 4R5EA 4C60A 2CU0A 1XDLA 4QDMA 4HMNA 3TN6A 4N9EA 5FEPA 2QHAA 2CWXA 2PDYA 1QDSA 4WDXA 3WJXA 3AFBA 1KM3A 1KO0A 5HWNA 2NW0A 2W27A 3K4DA 4A4AA 3PZ9A 4J40A 4JIEA 3S1GA 3RITA 5F1VA 3QYSA 3SRDA 3GVVA 1XM3A 2HROA 5C55A 3C0SA 1PKYA 3OP2A 3DC0A 3BLDA 3GSMA 4XVEA 1EJVC 4JNZA 2NQLA 1TTQA 2JEQA 5BXRA 2UY2A 1C8YA 4Z2HA 2WMIA 1CXLA 1VYRA 1TCDA 3FYOA 2FZDA 3SRHA 1T99A 2XIBA 4I7WA 2V68A 1WZMA 4LYRA 4GLEA 2X2YA 4LYPA 1E70M 3UZ5A 2ZUVA 3DG3A 2DIEA 1B2YA 3LZ3A 1MQQA 4LU0A 2NX1A 3PN8A 3WO8A 2QF8A 1EHNA 4HTBA 3LB0A 3WF0A 3KOWA 2JF6A 1B3ZA 4GFSA 1FH7A 1YPXA 3L5MA 3MO4A 1GUVA 4GQ0A 2WCGA 4O1EA 3UCCA 3ABQA 1WKYA 3EDFA 2E6AA 2PFHA 5DXYA 1HKMA 3OZYA 5BRQA 1E4MM 3TWAA 1XYZA 2VEKA 3TYDA 3BG5A 3XINA 3PAJA 5DO8A 1IEWA 3BC9A 3KVJA 3VKCA 2A7PA 1Q6RA 3LLXA 3MA8A 1B90A 3NDOA 1G9HA 3CLMA 2DH2A 1YTKA 3JS3A 4HK6A 5CSSA 1E9YB 3CQKA 2OKTA 4OHQA 3OGVA 4Z1DA 3MCNA 1UUOA 2QCMA 5E09A 2GLKA 4AZCB 4R9XA 4G56A 3VAVA 4IJRA 3GBEA 3PUDA 3FA4A 4LEFA 2WSYA 1R30A 2D0HA 4M19A 1FHVA 3VD3A 4GJJA 3KHDA 1GVIA 3GAYA 5DMNA 1E3ZA 1GTEA 4DO5A 1ZBWA 2YJQA 3RM9A 1EJRC 4GY1A 2W66A 4CNOA 3V0TA 3PWAA 5BOFA 4FLSA 4K6AA 2R94A 3PWGA 5EY5A 1DKWA 4BHYA 1IXPA 1I1XA 2PDWA 3H55A 4A3RA 3SW6A 2FVLA 4O0ZA 2WKJA 3MSRA 4OBSA 3K13A 2XIMA 3VUSA 3GG8A 3GNRA 1OFPA 4NZ3A 1ECQA 3SN0A 1OWQA 2HV5A 1I2OA 1NOUA 4S3DA 2CYGA 2VC7A 3WLLA 4QRNA 5G4WA 3ZVIA 4AYGA 2JKAA 3AIBA 2YSWA 3A4WA 1DIDA 2ZRZA 3E0IA 1F3WA 1TE6A 1QHZA 3LLDA 3HTWA 1B3XA 2V63A 4Q8TA 2D1ZA 4IH3A 2OZ0A 3NGJA 1M7OA 3WF1A 4W88A 2I17A 2VP8A 2Y1HA 1QPKA 1HNYA 1Q6DA 1GVFA 3S2LA 4OBTA 4K38A 2QS8A 5MHBA 2PWDA 2W91A 2O0TA 4MNMA 5FEZA 1JZ4A 1FH8A 2Y70A 4NXKA 2JFEX 2VRKA 2WPGA 1UD3A 1R3RA 1FCBA 3JZUA 3IAQA 3FA5A 2POTA 2PDIA 3T4CA 4AD3A 3GC4A 4PR4A 3FOKA 1UHVA 3E74A 1WXYA 1WNOA 3PS7A 5GJNA 1BPLB 2V5LA 4A35A 3SIMA 4NNAA 3W2LA 4WDUA 1PKNA 4OQVA 4OU1A 1OG6A 4IX2A 3MUAA 1L6SA 3NZRA 4QCFA 1K8ZA 4IPLA 3LERA 2ISVA 1TRIA 1T6MA 2V5BA 4PMQA 3LCLA 3VKBA 4H01A 2R6OA 4MYAA 4X9SA 4DLFA 3FYPA 1RQBA 2WMJA 3TSBA 3B8UA 1FXPA 2WQDA 2XN2A 1TWZA 2DZWA 4PRTA 3SECA 1H1NA 1UZDA 4EF8A 1LG2A 2BHYA 5BXSA 2PP3A 3USZA 3A4AA 3CS2A 3P81A 1XD0A 2VOMA 4D1JA 3WLNA 5ABFA 2Z27A 2VZOA 3N2CA 1V93A 3R43A 3NQ7A 1JL8A 2B7OA 2VELA 2XG9A 4GISA 3LCFA 3VKAA 1UW9A 3KBVA 2ACUA 3L2LA 3OU8A 3AUJA 2AL2A 4ZEPA 4IL0A 3OBEA 3P3BA 4A2SA 4A3HA 3ARSA 2VHLA 4X22A 2XN1A 1ZCCA 3I65A 1H7PA 3ZMRA 1VCFA 2PTZA 4PUMA 3TC7A 1IE7C 3MCOA 3DHPA 3WFAA 4IIDA 1RK6A 1RP9A 1YDYA 3VD9A 2W92A 4JEJA 6REQA 1ME9A 2G96A 2ZZ6A 4A29A 4O1AA 3LHUA 2ZUWA 2V3FA 4AY8A 1Q13A 3TW9A 5FJIA 4H1ZA 3NURA 3CV1A 3KLLA 3E2SA 2GGGA 4QP0A 1K9TA 4IUOA 1J18A 5GNXA 4JD4A 1BXCA 4PRWA 1QAPA 1JG9A 4LAKA 4GQRA 3E2QA 4CNUA 3TCEA 2WAGA 3U6WA 5DMLA 1WXZA 3DX5A 1VFTA 1YLVA 4YTQA 3PTQA 1CIUA 3GNPA 2CESA 3M0YA 4L4MA 7ENLA 3T09A 1S38A 1PZ0A 4GI6A 3WBAA 2PB1A 1W1PA 3KTSA 5RUBA 3TV8A 2P0IA 3JR2A 3LNPA 3LHWA 5IOBA 5KITA 1PJ9A 5FL0A 1J0YA 4U33A 1UR1A 2BG5A 3UY8A 1VJZA 5K9XA 3GB6A 2QCCA 1SZFA 1VFOA 5BU9A 3PUEA 3BZGA 2EPKX 3L67A 3BG3A 4KWVA 4WD0A 4N9CA 3EWDA 1XYAA 1SU5A 4RV8A 3K2GA 4ZQNA 3H12A 4L80A 2VX5A 3W0KA 5E0KA 3EWYA 3FIGA 2I9UA 1I2NA 2D0GA 2DT1A 3ABZA 2YLAA 3VU2A 1DQUA 3I4EA 5LXXA 1LYXA 4WSHA 1DXFA 1V6VA 3TZFA 3BW4A 1JIBA 1HN1A 4IIEA 1NJJA 4DPQA 4C1LA 4FXJA 3SCNA 3UCDA 3WQVA 1XLFA 1BTCA 2WJFA 3JW7A 4B16A 3HBLA 4Z08A 3VO0A 5FEWA 3KLKA 5C2GA 1V51A 1PX8A 1ZAHA 2YL8A 4P7RA 2OELA 1DL3A 1HGYA 1E6SM 4FK9A 3NL6A 2WMIB 5C2XA 1ITXA 1DJYA 2FDMA 4HHPA 3QR1A 1HUVA 4WKHA 1FWBC 3PAOA 2CLKA 3T55A 4ECLA 3E2VA 1KBLA 2R91A 1CB7B 1YKWA 2CWNA 3H53A 1W31A 1YTDA 3QGKC 3O07A 4YHGA 3GR4A 3M0HA 2NV9A 4ZO7A 4G9PA 5GNYA 1OB0A 1I6NA 4WXZA 1V79A 3MUCA 2EG7A 3WLRA 2AAMA 4YS1A 4KWUA 1CECA 4LY4A 5D38A 2YB1A 3B03A 3QV8A 4HA1A 1AA1B 3NTYA 3U0HA 4JFSA 2DVTA 3UZYA 4S3EA 3RPDA 4ZSUA 3WD4A 1RCOB 2BVTA 3HJZA 3UJRA 4GUFA 3MQTA 1GQLA 5D9MA 4JTJA 4DZHA 4XKYB 5CPTA 3IJIA 1WO2A 2VXNA 3SO7A 5DFAA 1BWVA 5A6KA 3ITCA 3BCJA 1D7FA 1K8CA 3N9SA 1QRQA 2V67A 3ZR6A 1XLAA 4GMEA 3CQIA 5IRPA 1R2SA 3UWWA 2WHLA 3ANUA 4OECA 2R82A 3Q58A 4Q8WA 3O63A 1NFPA 1J12A 5T9CE 3UXLA 2VFHA 4MKNA 1SQ7A 1JDDA 2POZA 1M03A 5EYWA 3GXTA 2X40A 1UG6A 1TPFA 3MB9A 3W81A 3AXMA 4REQA 5HBFA 3GU2A 4M1RA 3INPA 1QO2A 1VC4A 5G1TA 1C8XA 2GQ9A 5KETA 3VNLA 3I6EA 1C8VA 3P0XA 4NJGA 3N25A 3TIMA 2CHOA 1E4IA 2DZAA 2G37A 3CO8A 1EYWA 5CBJA 1QBAA 3WN6A 1R3VA 1P0EA 1M7XA 2ICSA 4JTKA 2VT0A 4F2BA 3A47A 4I6KA 2HNEA 2PS2A 1J5SA 1D9EA 2BASA 4B9ZA 4AHQA 4HHLA 1TV5A 4GA8A 1CBGA 3H21A 1ZAJA 1BG4A 4KEVA 4YTTA 2XZ7A 3M44A 1KRCC 2OGJA 4OV4A 1L2QA 1H7NA 1O1ZA 4H04A 5IBXC 4FP1A 4BEQA 1IIHA 2VEPA 3PZVA 1CWYA 1B31A 2PDCA 3EA2A 4XAFA 1ICPA 2BLEA 1QVBA 5IFPA 1K02A 3BZJA 4PBFA 1P0NA 3BUVA 1QPOA 2V0TA 4W9TA 2QGHA 4GE8A 3H6OA 1XSJA 1OF6A 3B0VC 5DX7A 3HGJA 3IJ6A 1GG0A 4YTSA 1JPHA 2E77A 3ZM8A 5A5WA 5AC8A 3G5EA 1C3FA 4ICMA 5CPMA 3QKEA 3SCRA 4P8WA 3IK2A 1RHCA 3BW3A 4F4RA 2VFFA 5XIAA 4V2XA 1V3HA 3PB2A 3QHNA 4CN6A 1ITUA 3VOJA 1EDQA 1X97A 3W7JA 3FJNA 1LQ2A 2H8ZA 4RCXA 1XQKA 4LPCA 2HCVA 1Q8AA 4DWSC 2VEIA 3SJ3A 3RX4A 3U2CA 3DZ1A 2GYIA 3IEBA 4AIOA 3HPXA 5FF4A 1IWAA 2DZXA 2WSPA 3G1SA 4XZ9A 3T08A 4JNMA 2L5HA 3R0KA 2NUXA 5HATA 1T8QA 4AMCA 3UPBA 4BF5A 2FDSA 3UWQA 3BCDA 2E09A 3CBWA 4XD6A 1EOMA 4DNMA 3FN9A 3GWQA 3GXIA 2F2KA 1FWSA 1WOAA 4IUGA 5I3JA 3L5LA 3NPVA 4EX4A 5HNUA 3IJ9A 3R6IA 2DJXA 5HWJA 3KUMA 4O28A 1JYVA 1SZEA 1MSSA 1KBBA 1AQHA 1UZ1A 4O1FA 4NU7A 1O66A 3L7RA 1XC6A 2O9OA 3BLOA 3T05A 4E3TA 1MXSA 2PGRA 4GQBA 1HJXA 3LOTA 4ZQRA 4AVNA 3NDYA 1KRAC 3B9AA 5DY3A 1E1CB 3M64A 4L65A 3O8AA 1J4EA 1K1DA 2CLPA 4RLIA 1S2CA 4F0SA 4KCWA 2O7QA 2WANA 3MDWA 3PP7A 3CTTA 4PA8A 5EB8A 3CQJA 3N2OA 5B7YA 2XIIA 1KNWA 2O9PA 4M6PA 1F61A 1XSKA 3GTHA 1U2YA 3L65A 4AD2A 6ENLA 2RH9A 5D2VA 3BV4A 2PUZA 4BY3A 3VMNA 2Y89A 5DRCA 5DANA 5HAOA 5F2GA 3S2CA 2ACRA 1HJVA 2J8TA 2Y7GA 4QE4A 1W6TA 2NV1A 1Q85A 1IGSA 1DV7A 2XWEA 4JGDA 4WDTA 1JZ8A 4MIMA 1K7EA 5AVHA 1ZUAX 2VURA 3MO7A 1A3HA 3UZZA 2D20A 4DHGA 3DERA 3GXPA 4AYSA 3IGUA 5CGMA 3RJXA 2ZFAA 2Q71A 3UG4A 5ABHA 4ALDA 4TV6A 2VCBA 4JQ3A 2D2OA 3BCFA 2CLMA 3AXXA 1O94A 4XZNX 3A24A 2FZMA 2J7HA 2ABBA 3LQGA 1W9DM 3NEVA 3APGA 1PDYA 2FHCA 4HIBA 1JGMA 2XSXA 4S3GA 3WG6A 2BSLA 3MJYA 2P5NA 4IPPA 4DB7A 3DBPA 3W1MA 2X1IA 4DRSA 2WLZA 2H3DA 2OB3A 2A21A 3BLPX 1Q3NA 3UZWA 2OPJA 5AHIA 4G7EA 1W5OA 3ABSA 1QO5A 3UY7A 1FHUA 4W7VA 4N4QA 2Z1VA 2ZYFA 5E6YA 3OZPA 4XZBA 1K9FA 2ATMA 2X42A 2V9DA 1VD6A 3G6LA 2FVKA 4QQUA 9CGTA 5A1AA 4G1KA 2OGYA 3E3HA 4DN1A 1P6CA 1THFD 3UGRA 3KOXA 4ZA0A 1W1ZA 4IFKA 1B57A 4PMOA 1V7YA 4JTUA 4QFUA 3KRZA 2ZC8A 4G7FA 5M3WA 3VGDA 3MHGA 3KP1A 1DYSA 3AIQA 3MHFA 3W3OA 2PWUA 3LTSA 3GIYA 3TR2A 3XISA 4Z0SA 3WQGA 2DQWA 3KBMA 4X0NA 2Y7EA 4A3UA 4KESA 3PZIA 4UUIA 1W1VA 5CZ0A 4WY0B 5M17A 1P6WA 2G4FA 3RXZA 3QV9A 5AYXA 1JGIA 4YVXA 1W1TA 3ES8A 3A5FA 1H1ZA 3HB9A 4DO6A 3GU1A 4ASTA 4B90A 2R1KA 3THAA 3OEXA 2XHYA 3NQFA 3CIVA 5HJYA 1G94A 2FIQA 2JK2A 3W37A 3PPHA 4JQ2A 3ZFHA 3CXOA 2E9MA 3PZMA 4HU3A 2BDQA 3KE0A 1LLWA 3OYZA 2X30A 3U8GA 3KL0A 1PV8A 1GPFA 3FYYA 4H8NA 3S5SA 2HVMA 3BJFA 3H2MA 3WDPP 2I5GA 4FNQA 5JBFA 1A0CA 3M0IA 4WJXA 4B5TA 4IZGA 3B3DA 1DJNA 1GW1A 1MDRA 4UZUA 3CUXA 3HG5A 3T0AA 2PWEA 1N55A 3SN4A 1MQRA 2X0SA 2IW0A 4JFTA 4L9YA 3OA5A 3SM0A 3TQPA 3SUUA 4GCAA 3OZOA 3IIPA 1JJKA 1LRQA 3AS2A 2PMQA 5D9PA 4TR9A 4LS0A 2X05A 4Q6JA 5G4HC 3R12A 1QI0A 3PZUA 4XKMA 3T0CA 1EA9C 2BBFA 2ZTJA 1E6ZA 3S6DA 2EQDA 3FJ4A 2HXUA 5E6ZA 1QW8A 1V03A 5FACA 4QXIA 1Q66A 4JAWA 3TNOA 2FZ9A 3ARVA 3CJPA 1VKFA 2NSOA 2EO7A 3MI2A 1Z42A 4YYFA 1BF2A 3EWZA 1HIZA 3B9EA 1IIGA 5KZMA 4KGLA 3N4FA 1Y7VA 1UD6A 1JPIA 2HEJA 2GSHA 2A7RA 4IFKB 5HNRA 1VYPX 5DELA 3BAXA 3QFWA 2B4GA 3SADA 1BKHA 5ABGA 3RDKA 3FHQA 5BMXA 2VOTA 3SUSA 3IANA 2HWGA 4RZ5A 3WQ6A 1POKA 3FSUA 2WYSA 4TO8A 3V5CA 3CHFA 4DVOA 4ADSA 1OHLA 4PBEA 4IMAA 4DO7A 2A2IA 2QXWA 2XIQA 4NNCA 2EF9A 2BFGA 1HTIA 3HF3A 3SI9A 2DP3A 2QR6A 2XDFA 5D04C 1B4EA 3KBNA 5C5YA 1T41A 4PB3A 2C71A 4PSPA 3W85A 5E5CA 3G2GA 1IEVA 3OTRA 1WDPA 4O50A 1F3EA 4C7FA 3P0WA 4IOTA 4ATLA 1G0CA 3THQA 9XIAA 4GHRA 1G6CA 3LM3A 3WLMA 1G1YA 1GOQA 1LWJA 1QOQA 1P0KA 5JBDA 2J74A 1EB3A 1PX3A 1OCBA 3O6CA 2DORA 1RJQA 2Z4GA 5CH9A 2X2GA 1UR9A 3VMPA 1L0PA 3VTRA 4E4UA 3W1NA 1XYCA 1JCTA 3DFPA 2PGEA 3W86A 4D6CA 4CKQA 3CV2A 4R33A 1UR0A 1EQCA 3FX4A 2FZBA 4LC8A 1RQEA 4LYKA 2QPXA 2A1YA 4ZB2A 3UW6A 3M4HA 2PRLA 4PL1A 3ZT7A 3RK8A 3UXKA 3WQPA 3F03K 4UNIA 1EOKA 1Q6FA 3TR9A 5BOEA 4GD0A 3W1LA 4IPIA 5A8QA 3U5UA 3MI3A 3ITXA 4P2VA 3O1NA 4RPPA 1TB3A 5I3DA 1W5QA 1FWWA 1HT6A 3VIHA 3WQFA 2V2DA 1PTGA 1WDQA 4QE1A 1LZOA 4O18A 1XJBA 2FLIA 5K2ZA 4ORIA 3S6TA 1V5XA 3MBDA 3KAOA 4KFPA 1VFLA 4GYKA 2NSXA 4NXSA 5D2WA 2GJXB 3BQ6A 1PPIA 3JRKA 2W5FA 1FOBA 1RLCL 4HB7A 4QBXA 3DHUA 4CCZA 5AC6A 2D73A 3UESA 4QR6A 4B3KA 1W2VA 1GYMA 3TQVA 3SGGA 4NX5A 2DSZA 2ATSA 3WH7A 3VIGA 4PMJA 1FUYA 3PPFA 4OTKA 4H9TA 4ML9A 1TCMA 1K3UA 2WHKA 5LKYA 4BF7A 2YL6A 3HMJG 3CK5A 3THCA 3S5NA 1JXJA 3CT2A 2V81A 2C0AA 1OY0A 4FHAA 5CKSA 2OQHA 3ZZ1A 1XRSA 1M68A 4S3KA 2YFOA 2Z0IA 5DQPA 3BAWA 4DJFC 4W8AA 4IP5A 3SFKA 2G50A 1K7XA 5I24A 3QZEA 2HE5A 4FO4A 2DH3A 4DWSD 4LVDA 3RHGA 4BWLA 3A6OA 4HSOA 3SGUA 4HK7A 3Q94A 2OT0A 1PAMA 3E49A 1VYSX 4INFA 3IUDA 3VDHA 3T78A 3R7MA 2C1HA 3AHYA 5K4ZA 1REQB 2XYLA 3GDRA 3GG7A 4F79A 3HU7A 1KW1A 1UWRA 3C61A 4IIFA 3S2NA 1J93A 1EJSC 3RJYA 2CLFA 5A8NA 3PJWA 4IWWA 3C3UA 1YHTA 3C2VA 3AXKA 5REQA 3LYEA 1FX6A 1RUSA 1FP9A 4TTGA 1BSIA 1LJYA 5A6MA 5T8GA 2WC3A 4GNJA 1GWJA 2GOUA 2C8NA 1DBTA 4K3ZA 4OJYA 3VFLA 3NEHA 4JTRA 3OPSA 4QSHA 4UOZA 2DW7A 1S2VA 2P10A 3PUOA 4CD6A 1V6WA 3FCPA 4NHVA 4IL2A 4DF0A 6XIAA 2V5CA 1RA5A 2BTMA 4P7LA 1EGMA 3CIXA 5E0CA 4ES4A 1EJTC 2CXGA 4H9MA 2G95A 4M6QA 1FWDC 3MMUA 4QCEA 3RGTA 4RL3A 2WMFA 1T40A 3OLDA 4US5A 3EOLA 1DJIA 3L12A 4Y2WA 4HSNA 3ANVA 1QNQA 1DHPA 4D6EA 1RJRA 3ZYZA 4ZOEA 1UJPA 2LLEA 1AZ2A 1FFQA 3NL3A 4M56A 3FVDA 3VGEA 3HFYA 2YA0A 4DXVA 4PTDA 3H54A 4PN2A 2INEA 2HVNA 3A23A 3ZWTA 4QISA 2QDHA 4CD5A 4O8AA 4WY0A 1W8SA 3NL5A 2PPGA 2HDJA 3M0VA 3WQDA 4NL1A 3WUBA 2PDNA 1Y5WA 2REQB 2J77A 2HPIA 1O5XA 4F2UA 4PMVA 1I2RA 3VA8A 1TKKA 3L4XA 2E6DA 4H4IA 1JDCA 4TOQA 2UY5A 2C1GA 5C71A 5E9AA 3PY2A 3R8RA 2OX4A 4J3WA 5H8UA 2XIOA 4PMXA 4XZLX 4UWMA 1RBAA 3WQ4A 1IZCA 3CZKA 3WLPA 2C14A 4XBJA 2MNRA 1NP2A 1TR1A 3WBYA 1FP8A 4MNLA 4HZ8A 4AMAA 2NQZA 4DM2A 4DI9A 2CLHA 2OODA 4ILSA 3QHOA 3NJ3A 4E4FA 5AC7A 5G1MA 4FPSA 3C2YA 3QMRA 2BHUA 4I5UA 1UKTA 1L6WA 1E71M 4PTWA 5A6BA 1UB3A 1YXCA 3B4UA 5FJPA 2QJGA 1SUXA 4IJCA 3LHTA 4CD4A 2XINA 4K1WA 1UUMA 2PDBA 3Q4DA 3UNTA 1PB0A 3K1DA 4RDZA 5GPRA 5CJMA 1C9DA 5M1TA 3T0DA 1HX0A 2Q8ZA 2OJPA 2I57A 2Y24A 3N14A 1BWKA 3H2EA 4XZIA 3URAA 5JIWA 3IVUA 3HPAA 1RVKA 1B30A 3H8AA 1CGVA 3NQAA 2ZE3A 4CCDA 1DIOA 1UKQA 1I4NA 4AEFA 2WBKA 5C7HA 1MWOA 4LF2A 4UTWC 3MP5A 5B80A 3T4WA 2OSWA 1IZKA 1Y65A 1OT2A 1XLCA 1MXDA 4XISA 3GBDA 2DZSA 3QF0A 2PLJA 4IP4A 1W9BM 3R58A 3AXIA 3BXWA 1OYAA 4H9ZA 3MMDA 1VFFA 2XH7A 3NWRA 5F2MA 1LLOA 1TUXA 1QNRA 3LTPA 3PZTA 1KBJA 2E5CA 3NQMA 3VKDA 4H9UA 4NP7A 3UG5A 5JH1A 4Q33A 4G6CA 3QMSA 3BW2A 3NQVA 3WD1A 2QV4A 4GOAA 4C6BA 5DN1A 2OXNA 4FXRA 5DBTA 5TIMA 1B0IA 5DCDA 1C91A 1S5WA 3TOPA 5HMDA 4M6UA 2YB4A 1UMLA 1VBGA 3STCA 4UFMA 3VCNA 3R89A 1S1RA 4BCEA 2OMAA 2OQLA 2DSWA 3UD6A 1VEOA 4GZJA 2QKFA 1KM4A 1JI1A 2PAJA 2ZRWA 3N9KA 2ACSA 2BGQA 4LUTB 3C2RA 3S1XA 3IJ7A 3SCVA 2J6VA 4BI6A 4O17A 1EL3A 4D6FA 5HWMA 4HJFA 4JTAA 4JTDA 1A5MC 5KZDA 3BICA 3UT0A 3V1HA 3G1XA 5FF3A 4IG2B 4F0HA 3CZ8A 4JX4A 4ZTYA 3MBFA 4NJKA 4IQLA 6ALDA 4JPGA 1G01A 4KWSA 1VJIA 3W4RA 1V6YA 3H2FA 1DJZA 4ZO8A 5HQLA 3UVAA 4DXXA 4P5UA 3LLFA 3KRSA 3PBMA 3LU2A 2D2JA 5FA5A 3E5BA 1TWIA 3W7MA 1OCQA 1JXKA 2A6LA 4CQAA 2NT0A 4UZSA 4AWTA 3HGSA 1TELA 1YDNA 1H61A 3F4VA 3O2LA 3OGRA 2V3EA 1WZKA 2BP1A 2PWFA 1FCVA 1PIFA 4K7YA 1R47A 1U30A 1E72M 1VFSA 4HNLA 2BX7A 3BVJA 4GC3A 5D8WA 3AIEA 4O57A 4DJEC 4FIRA 1G4PA 2P88A 1D2KA 1FWJC 3ZSSA 3GM8A 3WQEA 3N34A 1NIUA 4CUCA 4IICA 2BB0A 2NV2A 4RXFA 2GJNA 3W73A 4J1OA 4NAEB 2FGZA 2VWTA 5A69A 3GHUA 4HKPA 1ZLPA 4KFNA 1AJ0A 3H7UA 1PYMA 4H3DA 3G3DA 3B4YA 3TW6A 2Y0FA 3EKGA 2BGSA 2CXEA 1TR9A 1H62A 3LM7A 3W2KA 2HE8A 4L6DA 2JIEA 3H7RA 4GY0A 1RP8A 2RAGA 1PZ3A 1E4NA 1KRMA 3O7UA 1W5NA 5D9NA 1WUFA 2IS7A 1HGWA 1RK5A 2G4JA 1XR2A 1RBOB 4Q7NA 2Y5JA 2BY3A 3V0SA 1XFBA 4UMAA 5A6BD 2QPUA 5AHLA 1KCXA 3L4ZA 4Y6GA 3H2NA 1QK0A 3H7VA 4H7CA 3AI0A 1V0KA 2YBTA 3OLEA 1FHLA 2C91A 5JXQA 3RMJA 3U7BA 2QDDA 2XGIA 3FKKA 3R1ZA 3A64A 3GXMA 2YA1A 4J3SA 4ZFCA 4E2DA 2E6FA 1UWUA 4E38A 4MPQA 3STEA 3OQ8A 2ZWZA 3WLQA 2YBUA 4RZ4A 3HV8A 3WK3A 4C6MA 4LV4A 5H8PA 3FW6A 4C6PA 1F6YA 3QM3A 2ZXDA 3ATYA 4C6DA 2VFEA 3EA3A 2QDGA 2PCQA 3RPTA 1NFGA 8RUCA 4N7QA 2ON3A 5EL1A 4AEOA 2WNZA 3TTEA 3TKFA 4IISA 4EPBC 4XD3A 1UWIA 4P7NA 4QDWA 4S2CA 4WSJA 3OO2A 3VIFA 2WWDA 6CGTA 3PR2A 1OADA 2G41A 5K4XA 2WVVA 4P8VA 2DGAA 3WYZA 1PWMA 4X3ZA 4BQ2A 3ZS4A 2YA2A 5A8GA 4Z2JA 4W5UA 3IJ8A 1QOPA 1EGVA 3S47A 4U5IA 4DX3A 3C56A 1ZJHA 2E3ZA 3HPZA 3OLIA 3W25A 4NAEA 4Z17A 4O12A 3TZNA 3RU8X 3VGFA 2VNCA 1XXXA 5C0QA 1YNQA 4BWLC 1CCWB 5FEXA 1Q6OA 3LRLA 4ZB5A 3CPGA 3CB3A 1R2RA 3LSBA 1KXQA 4O0KA 4UQBA 5AOUA 5CLTA 2C15A 1ME7A 4WSKA 4LS2A 4D72A 4GX9A 1LORA 3KZPA 3W7PA 4F8XA 1ISZA 5FCZA 1D8WA 3CZEA 3QRHA 3WDJA 1VLWA 4I3GA 3EOSA 4XKYA 1YE6A 4DBUA 1GZGA 2QV5A 4EPDC 1HKJA 3BURA 1PZ1A 4QAWA 3T6CA 1AG1O 3SCUA 3VM7A 3C6CA 3THDA 4GX8A 3V18A 1W91A 2ZTKA 1ECEA 3PWIA 4JL1A 3ONCA 4AAJA 1L6FA 4Z1CA 2Z25A 1XLLA 3LGEA 2PDMA 3KW3A 3DFHA 1NOFA 4G1NA 3V5OA 3QQWA 4JL2A 5AYIA 2BODX 1L2UA 1R5YA 1CI1A 4OE7A 3L4VA 1GKQA 3W87A 5M03A 4H41A 3TDFA 3S0CA 3RG6A 3ELFA 5FJJA 3G8RA 3SIZA 3WNMA 3C5QA 2UWFA 1POJA 3V16A 3LENA 1OJXA 3VIOA 4YYCA 3DFSA 4GO9A 3CO4A 2HPMA 5AZ0A 2AL1A 1J0HA 4KEUA 3TAKA 1Q45A 2EG8A 1ZY9A 4LALA 5ECUA 2GGIA 4FA3A 1B5TA 4B9YA 5ABTA 4Y9OA 3BMVA 3Q45A 2ZWYA 4FOJA 4KEMA 3PHAA 2C7FA 5EU9A 1XLJA 3PZOA 2QQ6A 4F3HA 1JCYA 4CVWA 4JIIX 3C86A 3QLDA 2TYSA 2ZICA 3AROA 1Z48A 4S1FA 3GFXA 3F7JA 3H2OA 4QLJA 1ITCA 1DWIM 4HD5A 1PYFA 2VDHA 3PJXA 2VZUA 3VINA 3B8IA 2V2HA 3RR4A 1QFEA 3KVMA 1B54A 4JIQA 4OOUA 3EDEA 1EZ2A 1S3HA 1TPDA 3CC1A 1LT7A 2PLMA 3NPUA 1KBIA 3WDIA 1QTWA 3D46A 4MNKA 3CUGA 3BOXA 3LCHA 4ZGYA 2NVCA 3LCWA 1NTHA 1OFBA 1YBQB 3TX9A 1DJQA 1TWSA 1YPIA 2FHBA 4ERAA 1CZ1A 5D2TA 3C0QA 3ZT6A 4Q4RA 3MDUA 3WENA 4D6DA 5HANA 3S6OA 4MB4A 4UBPC 1UZ4A 3IGHX 2VD9A 4AD0A 4TMBA 3SUVA 3B8VA 5AYYA 5DXXA 3MUXA 1TVPA 5ABEA 1VHNA 5CC3A 1Q6CA 1DORA 1VHCA 3TMQA 1H3GA 4QG9A 2PD5A 3W7DA 4UR9A 2DT3A 4MADA 2J88A 1NDZA 5I0DA 3OA3A 1KR1A 1TTPA 4PSRA 1OK4A 2E68A 3NSXA 4I90A 4C1NB 4D8LA 1WP6A 3GDBA 3NQGA 1KFCA 3WJWA 3K46A 2B7PA 1WBHA 2VRJA 2IQDA 2WMKA 3APYA 2WBGA 4J27A 2P1FA 4KGJA 4S2BA 1KM5A 1SM9A 1AZ1A 3T2QA 1BQCA 1VPQA 3MPGA 1D8CA 2A5HA 3KWXA 2ANUA 5DCBA 1KBKA 1SMAA 1V6XA 5FF0A 4LOCA 3KBJA 4UTUA 2NUWA 2Z7GA 5DBUA 3G22A 1OSEA 3ZR4A 4JTSA 5D33A 5DY2A 4C6KA 4H9VA 2XGZA 1CGTA 4B4HA 4X61A 2X1SA 3WD0A 3T1GA 2P50A 3WJYA 4NJHA 3DYMA 3CL6A 1DVJA 1FQ0A 3BARA 1GNXA 4N42A 3C2EA 4LXFA 2NLYA 2ZXBA 2WSKA 3AMLA 4JQ1A 4ZR8A 1OZQA 1QI3A 4LRSA 2AGKA 2CIPA 5K9CA 4FR6A 4UTKA 2HBXA 5FIPA 3GZ3A 3TYEA 4ENLA 3RX3A 2QYGA 3F4WA 4JN6A 2CLEA 1KGWA 3R2GA 2BY2A 1V77A 4NJIA 1U5VA 1DE6A 3GLCA 5LHEA 1H63A 4O19A 3A12A 4EVZA 1O6IA 3E0VA 1VZWA 5DCEA 1S46A 3PTDA 2J4GA 5CZJA 2G3MA 5G2HA 3TLQA 4TIMA 1JAKA 3JU2A 4ORMA 3URNA 2H9AA 1XKYA 2I56A 2FZNA 3CWNA 2VCAA 2AGTA 5CAKA 1KR0A 1ODUA 2Y7DA 3AYTA 4UQAA 1YXDA 1EH9A 4DYKA 2ZUMA 4TX6A 2B7NA 2W62A 1I1WA 3QV7A 3UEQA 1JZ3A 2OU4A 3QY6A 4CN1A 4DUWA 2GJLA 5FF2A 1K4HA 3A9BA 2W4XA 4FNRA 4G5DA 3CGTA 3DESA 2GQ3A 4O52A 1MDLA 2WC4A 4P7OA 3NOEA 4XG1A 2OYKA 1E0XA 5H2ZA 1CLKA 4DJDA 3WQ8A 1WAWA 3IS4A 2IPFA 1IV8A 2VVNA 1XUUA 1RXOB 4M82A 1XDJA 1OC7A 3ES7A 1R3YA 1FBAA 3D6NA 2EKGA 3Q67A 1Z3NA 3VIIA 1ZS2A 5CQ1A 2QDEA 4WGHA 4ZCWA 3UPMA 1EC9A 4WIWA 3CUZA 1TPC1 1AW2A 4G7EB 2VX4A 3KOFA 1UR4A 4W8LA 4B5NA 2RKXA 4I9AA 3ARZA 2J27A 3W7GA 4R3UA 5HQMA 1LP6A 4HPJA 2ZQ0A 4YL2A 1XLGA 1JEZA 4LUIA 3G1AA 2VC5A 3CUIA 1J0KA 3QVQA 5D03A 3U4FA 1RCXB 1TJPA 3VMOA 2E5DA 1DQWA 1F5ZA 3CNYA 1NWUA 4IF2A 3K4AA 5DMMA 3ZQ9A 3FNDA 1DJHA 1VF8A 1OFQA 5C8BB 4AH7A 1P1MA 3VNMA 4OVXA 3VK5A 1TV7A 1J11A 3EKZA 4IMCA 2IQ0A 3LMYA 4DJEA 4MDOA 2ZDRA 3W9ZA 3POCA 4HN8A 3JVAA 4Z1AA 2CHNA 2J47A 1W0MA 4B4FA 4WHBA 4RKAA 4JTCA 5A6TC 2Z24A 4O13A 3M0KA 4ZENA 4JIRA 1EQPA 4QEHA 2E28A 1IXNA 1DXIA 3WF4A 5LIWX 2EGZA 3ITVA 1C7TA 4IPJA 2NT1A 1IZJA 4LT9A 2CEQA 3TC6A 5EMLA 3R8HA 3I3DA 4XQ6A 1KRBC 1YRRA 4Q8QA 4GVHA 1K8YA 4HCLA 3WFZA 1U83A 2JQXA 4J9JA 2PE4A 3M46A 2WSRA 1VQTA 1G7UA 3W24A 1E6XM 2DFAA 3DAQA 4H6EA 1YEYA 4CNNA 2EEXA 2YFNA 5IDIA 1BRLB 3SGZA 4JY9A 4JNYA 3WNOA 1WCGA 4GRSA 4IXXA 3ZJ8A 4DBEA 4PODA 3RILA 1JYNA 3EMQA 1UBPC 4DWSB 1BEUA 8CGTA 1VH7A 4GNVA 5FAJA 2V5JA 3VNDA 2WOQA 3TN5A 3FJ6A 4UCFA 5LIUX 3ITOA 2WVSA 4AW7A 4M81A 1TV3A 3DCPA 1ESWA 4ZOAA 4YU1A 4ZE4A 2YPIA 3QJAA 1BXBA 3D3AA 1CENA 4H8HA 4ACZA 3DKLA 3NNTA 2EXOA 3SQLA 1WX0A 1KM6A 3B9NA 2WZIA 1IWPA 1YQ2A 4KCTA 1XISA 1W3NA 5HMFA 3F5LA 4ICCX 2FB3A 1VBUA 4LAOA 1VRXA 4YMZA 3VGHA 3G8EA 1XIEA 1OC5A 4UTTA 3DDMA 5LA1A 2BZNA 2DVXA 4XAGA 5BW6A 3E38A 4HCHA 4I8YA 3VDAA 4IFOA 5F2LA 4LF1A 1ICQA 4AG0A 4M0XA 1E4LA 2Q3RA 1SFLA 1RQHA 1L6YA 2C18A 1GZJA 3BMWA 1UKSA 4C1KA 1NDVA 1W1IE 3W22A 4JFWA 4KT2A 1JDEA 1M5WA 4HK5A 4GQQA 1F76A 4J3XA 3TOYA 3M7SA 1G67A 4L64A 4BZYA 4E8DA 3CQHA 3ZVHA 2J7EA 2DDXA 4JTTA 1ZENA 2UV8G 1ZL1A 1GOXA 2GJPA 3G0SA 2Y6ZA 4IP7A 3WMCA 1BYBA 4QS5A 2CZDA 3I3BA 3LD5A 4US6A 1R85A 4L1XA 2CFFA 2OO0A 3B0XA 2X0HA 1VEPA 1RALA 5JBEA 1YYAA 2YZRA 1BGGA 3KDOA 2OOGA 3LPPA 3V3WA 4YTRA 4RZ6A 3AC0A 4W85A 1N2VA 2Y2WA 1BYDA 1TMQA 2XFWA 3MY9A 1XLKA 4M51A 2DZPA 1PO9A 4AZ6A 2PD9A 4EKJA 3BE7A 1FH9A 3PB0A 1TQJA 2J8FA 1TPB1 3UFYA 3SB0A 3PSWA 1B3VA 3EOEA 3CEPA 1ZHAA