3PZGA

I222 crystal form of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila
total genus 155
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzgA00
4K68A 2W4XA 3LPFA 2WK2A 4WSJA 4MAZA 1V02E 1B9ZA 3CUHA 1MYRA 4J28A 2O92A 1X1NA 5BYWA 4FK9A 2A3HA 2WKGA 1HKMA 1XRVA 2X05A 3CPUA 3BAIA 4JAWA 1PPIA 1LLOA 1JYWA 2JEQA 4AIEA 3VIGA 4EANA 3ARYA 5IDIA 3N1AA 2YLAA 1NP2A 1W1TA 4JFTA 1QI0A 1F4AA 4MNLA 4AEFA 3IJ9A 4PSRA 4L4PA 2FHFA 3L2LA 1CBGA 3GM8A 3B9EA 1NP0A 1ZJBA 1JF5A 1H41A 3ZQ9A 1E4NA 5DMYA 3BXWA 1V0LA 3IJ7A 4FLRA 1E1FA 3VILA 5LA2A 1MFVA 4TXEA 2ZUMA 3CZKA 2ZX8A 1BYBA 1XGZA 1D7FA 5JUVA 2CBUA 3W82A 1VAHA 4AC1X 4UFKA 5A2AA 1E15A 3WF3A 2G4FA 1C91A 2XFFA 1RH9A 2WMIA 5CLTA 4H7VA 4J3XA 4R5EA 1HJSA 1W2PA 1K9DA 1JL8A 2D3LA 1EHAA 2XVKA 2BXYA 2OWWA 2OWXA 4PMXA 1I1WA 1E0XA 4F8XA 4HOWA 3AFBA 2BNJA 3PZQA 2PWDA 4UFMA 1Y7VA 1K9TA 1AMYA 5JBFA 3NJ3A 1HF6A 4H41A 2VZVA 3SCTA 3W6LA 3WFLA 3WUEA 4CD7A 1VJSA 3L4VA 2ZUTA 3AHZA 2CHNA 4MB1A 2CKRA 3RMEA 3VD7A 5AY7A 3SCUA 1OM0A 2YDQA 4PEEA 3ZO9A 3E1F1 4S3KA 1J9YA 1KBBA 1H2JA 3VD3A 2J75A 1US3A 3RDKA 1WO2A 2X2YA 3BLPX 3WH9A 4ACZB 1UQZA 1UH4A 3ZJ8A 3VDBA 2ZUVA 1QNRA 3ARQA 2BVDA 2XUCA 4D6GA 2W91A 1V3MA 1WDRA 5I78A 3T09A 3NSXA 2WCSA 2W67A 1ISXA 1C3FA 3WNLA 5JBEA 1PEZA 5ABFB 2JE8A 3PTQA 3OIHA 2GSJA 1NM9A 2FHBA 3DYOA 3KE0A 2JIEA 5EFFA 2YOCA 1CGUA 5A8PA 3CUIA 1EDTA 3U57A 1F4HA 1VFUA 2DEPA 2RGLA 1KR0A 2DPEA 2F61A 1QHPA 2WWCA 1CXLA 1WZMA 1W9XA 3TP4A 1HN1A 4AZ6A 4X0VA 4J3WA 1MW0A 1LL6A 4PUDA 1EOKA 2PBOA 1E5JA 4GI8A 1UG6A 2GVYA 1QI5A 4LYQA 3WDIA 3L4XA 3CHFA 1V0MA 3VTRA 1HX0A 2XHYA 3WY1A 1JAEA 4X9YA 3ZJ6A 2PB1A 5DT7A 1V0NA 1XSKA 4QCEA 3VINA 4W85A 1OINA 5CGMA 1KCKA 4M81A 1ISVA 4MPKA 2OYKA 2D0GA 6TAAA 4M1RA 3WQ8A 4W84A 3O2LA 5A6BA 1FP8A 4PMVA 3VGDA 2XYLA 3ARSA 1MVYA 3T0BA 3MUZ1 4QP0A 4BS0A 2WC7A 2O9RA 5C70A 2ZWYA 2QLYA 3BC9A 2DDXA 2D3NA 3AMDA 1CGTA 1B90A 1VB9A 4D6JA 4WK9A 2UY5A 4U31A 1M7XA 2QHAA 5A2BA 1JF6A 5A94A 1G1YA 4XUYA 2WBKA 5D9MA 4V27A 3NCOA 3VX1A 5A6MA 1GOKA 1WDQA 1HXJA 1HJUA 3W28A 3CZJA 3N15A 3VMPA 2VL4A 5A8MA 4CCDA 1G9HA 5E6ZA 2WC3A 1GOWA 2ZUSA 4QDMA 2ZXBA 2D23A 2X0YA 2XVGA 1EO5A 3ZR5A 5EFDA 2WZIA 3GZAA 4HZ7A 5TD4A 3ALGA 4Z2GA 1HP5A 5A1AA 4CVUA 3AS0A 1ISZA 1KXQA 4D1JA 1JYVA 2GDVA 2FH6A 2FDMA 3A47A 3HU7A 4S3JA 4CVWA 1EIBA 1KGWA 4PMOA 4LGXA 4AD5A 4NZCA 3BH4A 3PTMA 3L2MA 3WDJA 5IFPA 1E4IA 5A6LA 1J0ZA 2BVYA 4URIA 4ZFMA 1H3GA 1W3KA 1EQPA 4QCFA 2FH8A 1PZ3A 2Y8KA 4MJ2A 4CD4A 1GQIA 3KWXA 1O6IA 2YIHA 3GTNA 3AQUA 1DWFM 1TMQA 2ESCA 2J8GA 2GK1B 4PTMA 1A47A 1E3ZA 3OG2A 3WD0A 4F79A 5C71A 1ODUA 3N11A 3W24A 3CGTA 1HVXA 3L4YA 5ECUA 2QPSA 3A4AA 1NWSA 2D22A 1M04A 1TUXA 2YL5A 4HZ8A 3POHA 2V3DA 1V3LA 1JNDA 4PTXA 4ZENA 2DIEA 3J7HA 4CCCA 4AD4A 1S46A 2W92A 3WUBA 3SEPA 1BYCA 2BV9A 5A8OA 2EPKX 5CSUA 3CZLA 1PX4A 2Y5EA 4U3AA 2UWFA 2XTKA 1PX8A 2EO7A 3DC0A 1ZJAA 2V3FA 3RO8A 1NOUA 1TVNA 3IANA 4UFIA 4UOZA 2J25A 2VRKA 3A3HA 1RP9A 4OJYA 4JKMA 3IAPA 1VJZA 1CXEA 2VVNA 4NRSA 3AROA 4UNIA 4JZ5A 4AISA 1VRXA 3NSMA 1VBRA 4V28A 2VZTA 1VFOA 2BY1A 3AZSA 3VPLA 1UWUA 4W8LA 4U5KA 4CN1A 5DT5A 5E70A 3GNPA 3DHUA 2DSZA 3L4UA 1UWTA 5BRPA 1Q6GA 5BXRA 3AZRA 1E6PA 1V03A 1UKOA 3VD4A 6A3HA 3VMNA 2OWCA 3SUSA 4Z2JA 4H8UA 5GQBA 1UD6A 1HKJA 2E9MA 3MUY1 3RIKA 2J4GA 1ISWA 3AS2A 2VTFA 1C7SA 3PZTA 1CEOA 4EE9A 4BQ3A 1E5NA 3QHOA 3UEQA 4A4AA 3A6OA 2A3EA 1DWIM 4JFUA 3DECA 1MQPA 1UD2A 1VEMA 2CITA 1H0IA 3LPPA 4PMNA 3VIKA 4MB3A 1CXIA 3MS8A 2XPKA 3FHAA 3AHYA 4M56A 4YHEA 3THCA 4AZHA 1E1EA 2ZX5A 2Z1SA 5M17A 5IHRA 2ZOXA 1JI2A 1GOOA 4N0RA 2NT1A 3N18A 5F7UA 1PIGA 1EH9A 2YKKA 3W53A 3KEHA 5IHSA 4NRRA 3VNYA 1HL8A 2BS9A 1KCLA 1RD6A 4QLKA 1HJQA 1HP4A 1ZB5A 2HISA 5D4YA 2GDUA 4JL1A 2WVUA 1WDSA 4LXFA 2VCBA 2CETA 3S2CA 5E9AA 4LYPA 1KXHA 1AVAA 4AZGA 1MXDA 1C90A 1BG9A 2Y4SA 3FNDA 4RL3A 3WNKA 1UZ4A 3UERA 4BQ4A 1W1PA 2D1ZA 2WCAA 4KMQA 3M7SA 5BXPA 1JDDA 2AAAA 2Y24A 1CXKA 3PHAA 1W3LA 3QHNA 1P6WA 4DWSC 1G0CA 1OIMA 5D9OA 1H5VA 1NOFA 4C7GA 1BQCA 1HJWA 1QVBA 1L0PA 3W27A 3S6TA 3I3BA 2WMGA 4LX4A 1E72M 3WDPP 3AJ7A 1HIZA 4JHOA 1CGXA 1E6QM 1BPLB 1JGIA 1W2VA 1KFWA 5ABFA 3GNRA 1QI3A 2GJRA 2OLHA 3W25A 1UR2A 1W1VA 1SMAA 3CUJA 4B16A 4GINA 1KQYA 4AYSA 5KZ6A 3RM4A 4Z2HA 2D0HA 1MW1A 3F5JA 1JXJA 3F4VA 4HOZA 2J7BA 4P7RA 2CCRA 2ZICA 3OGSA 4UFHA 4JFWA 2IXUA 2WSKA 2O9OA 5AC5A 3BCDA 3VGEA 1QHZA 5I5RA 2WB5A 3PZGA 2J78A 2QF8A 4DWSD 3N17A 1E71M 1E0WA 1FH9A 2PWGA 1FFQA 1M03A 2WCGA 1SYTA 4UZSA 1GQJA 4TVUA 1B3ZA 3AISA 3VKKA 3WF4A 3WNNA 4PRWA 2XGBA 3GBDA 4NF7A 4AMCA 1BF2A 2VVSA 3ZT7A 3CBWA 3QHMA 5HOSA 1TZ7A 3GH4A 5FIPA 4L4OA 4OBRA 3I3DA 1J12A 1OGBA 2Y2WA 1VEOA 3VGHA 1QNOA 3WIJA 4H8HA 3TTQA 3WEOA 3ARPA 4JCMA 2XWEA 3SCNA 1XH2A 4ZE4A 3GXDA 5DFAA 2VRJA 1NARA 2BXZA 3WUGA 3AMLA 1FP9A 4UFLA 5A3HA 1LQ0A 4PCTA 4J27A 1CWYA 1GVYA 1IT0A 3GNOA 1ESWA 3KL0A 3K8KA 2EPMX 1CLXA 1KQZA 4CU6A 4KGJA 3MO4A 1PX3A 3MMUA 1GOIA 1XH0A 5I2UA 4PCSA 1BVZA 2QPUA 2WZHA 1H1NA 1OB0A 1JFXA 3NDYA 4F9JA 3ZJ7A 1XD1A 3SUVA 2DT3A 2WHLA 3APGA 4M29A 3EMQA 3FAWA 2WMFA 3W29A 2VRQA 4D6CA 4HPGA 4PTWA 1KB3A 1J0KA 3SURA 1W32A 1Q6CA 2NSXA 4ZEPA 3SCQA 3VIJA 1XC6A 1JI1A 1R86A 5I77A 3CMGA 1XD0A 3WMBA 4EK7A 4PYSA 3ZSSA 5CZKA 2X0HA 1VFMA 1H0GA 4B3LA 1O7AA 4D6IA 3MV01 4ATDA 1XYZA 5FKYA 1UR4A 3VD5A 3VM5A 2CIPA 4U2ZA 2JFEX 3AIBA 1OCQA 4RE3A 2GK1A 2YBTA 2CEQA 3WN6A 4E2OA 4ZE5A 5ABHA 4LPCA 3F5KA 3ARRA 3VIMA 2NT0A 1UKSA 4MJ4A 4WKHA 3W37A 1NQ6A 3SCWA 5I23A 1AQHA 2VOTA 2VR4A 1ITCA 2E3ZA 1Q4NX 4X0NA 5CSYA 2XSBA 4W5UA 4P8WA 1NWRA 4MTVA 2D0FA 3LPOA 5ABGA 3IAQA 1JZ3A 4NSBA 1LL4A 2EPLX 3VDAA 1AQ0A 3U7VA 4Z2KA 1UH2A 1FOBA 2CYGA 1GQLA 1IV8A 3ARUA 4UQEA 3MANA 2WHMA 2BY3A 1XHGA 3BSHA 3AHTA 4J3UA 3PN8A 1OIFA 4XX6A 4ACYA 1B30A 1UHVA 1FFRA 2DSWA 2GJXB 3WFZA 4LQ1A 4M8UA 1UOKA 1H49A 2YL9A 2XIIA 3CZGA 4XZBA 3RPMA 3EDFA 3ZSTA 2XM1A 3L4ZA 4TTUA 3POCA 4W86A 3KL3A 4CD6A 3M6DA 3WBAA 1BFNA 1KXTA 3RM9A 2DT0A 1JDAA 3DHPA 3B9DA 3SCSA 1LF1A 3U5YA 4B9YA 1WE5A 3SUTA 1HJXA 2DH2A 1G5AA 3EDJA 3NIYA 9CGTA 3RJXA 5EB8A 4AZCB 3WH8A 4GIAA 4BCEA 1MWOA 4Z2LA 1B3WA 1WZKA 5LYRA 1E4MM 4FF5A 3WQVA 2XGIA 5BROA 2CBJA 2ZX7A 3OLGA 4MB5A 2XM2A 1GVIA 4GKLA 1UA3A 2WBGA 2XG9A 2XSAA 5E09A 4JIEA 3M46A 3SCPA 5KEZA 2WHKA 3AS3A 4GQRA 4U33A 2EBNA 3II1A 1UR8A 5FD0A 4GQQA 4IM4A 4BZYA 3NYDA 2A3BA 4UCFA 2WVTA 2VMFA 1ZS2A 2YL6A 3VIOA 5CPTA 4AY1A 1RP8A 1DWJM 1J18A 1V3IA 3ZR6A 4PMQA 2NW0A 1TG7A 2WLYA 2E4TA 3EDDA 1FH8A 2VUYA 3WF1A 3WEMA 5C8BB 4A3HA 2XVPA 1EXPA 1CTNA 3AIRA 1J10A 3QOMA 1B1YA 1W9PA 3QR3A 1QOXA 1V6UA 7A3HA 4HA1A 4OUEA 4C7FA 5BWFA 2J7HA 2YA1A 3VIFA 3WDRA 5GNYA 2YDSA 3OBAA 4P7NA 2W66A 1IZKA 3MMDA 5FCZA 2JIWA 3DYPA 1WZAA 2BHZA 4FLOA 3EBVA 1Q6EA 1CZ1A 1EHNA 1OT1A 2C0HA 2ZUUA 3QOKA 4NI3A 3WNMA 4D6DA 3ARXA 1J0YA 5D8ZA 1E9LA 3WQWA 3O9NA 1HKIA 4W7UA 4JL2A 5CJ5A 1Q6DA 4R27A 2BHUA 1EGZA 1LWHA 4TTGA 1D3CA 1K9FA 4HA3A 4TX6A 1BTCA 2V38A 1CLVA 4JKKA 4H2CA 3PZ9A 2E8YA 1JZ6A 4UOJA 3W81A 2J62A 4P8VA 1CECA 4GO8A 4IUGA 1CIUA 4CN6A 5E0FA 2WMJA 3VMOA 1W3JA 4CU8A 4AXNA 1JDCA 2ZXDA 4MDOA 3TTOA 3BMWA 5ABEA 2CKSA 3U7BA 2X09A 2DIJA 1UKQA 3TOPA 5HPOA 4W7VA 1BGAA 3WMSA 4ZXLA 3L4TA 4CGTA 3T2OA 1M53A 1Z32X 7TAAA 4AWEA 1KWGA 2VQTA 2E40A 4PTVA 1VF8A 3CMJA 1HJVA 5BXTA 1DWGM 1RPKA 4Q7NA 5GPRA 1PJ9A 2CNCA 3G6LA 1ZU8A 1V02A 1LJYA 4IISA 2WWDA 3WL0A 3BSGA 3OZPA 5CGTA 4FLQA 3OLDA 2WHJA 3VDCA 2XFRA 1MXGA 4Q22A 4TX8A 1MQRA 2WMKA 1CGWA 1TA3B 2F8QA 4WSKA 3FW6A 4M24A 3GYCA 4N42A 3PZNA 2WMHA 1E6SM 2E9LA 4J3SA 1XCXA 3GBEA 2TAAA 5EBAA 4DM1A 5M3WA 4P8UA 3AIEA 5FL0A 1GPFA 4OBSA 1W9UA 2XVLA 4KGLA 2D2OA 1V3JA 1C93A 2WSPA 1BVNP 2VO5A 2CBVA 1A3HA 1UA7A 2DT2A 2AOSA 4Y7EA 5I24A 1BG4A 2J7GA 1VENA 3UETA 2DQXA 2J7DA 1V0KA 3MSDA 3B8SA 4QLJA 5A6BD 1JZ8A 3VD9A 4PMDA 3WUFA 4MADA 3AXHA 1H4PA 3EDKA 3W6MA 3WD3A 1WB0A 4YN5A 1E4LA 3EMCA 2VR5A 3WH6A 1XV8A 3FXYA 1UZ1A 2VC9A 2W5FA 3PBGA 1IZJA 4AW7A 4KH2A 2XFYA 4MNKA 2IXVA 4WF7A 3AMKA 2UY3A 1V6VA 3OLEA 1EOMA 2Z1KA 1Q6FA 4PUEA 4HU0A 1W9BM 4XV0A 1TR1A 3GXMA 2WZEA 2D24A 2OYLA 3NUKA 5EMYA 3RCNA 1E6ZA 3K4AA 2WC4A 4AD2A 4CUCA 5AYBA 1E6RA 3OA5A 2HVMA 2ZWZA 5GNXA 5I79A 4RE4A 1WCGA 1YHTA 1UR1A 3EYPA 4KRUA 4W89A 3VIPA 2JEPA 1KGXA 1MFUA 1DHKA 5HXMA 1X6NA 1LG2A 1CPUA 3CHCA 1LG1A 4P7OA 8CGTA 1GJUA 2WVVA 4UFJA 3W38A 5E6YA 3BGAA 3SCRA 7CGTA 5E0CA 4AZ7A 4F66A 1VEPA 3CTTA 3ARZA 5CPQA 1GZJA 1U33A 3CH9A 3UG3A 1PAMA 1GORA 4DUWA 2WW5A 2CERA 5LA0A 2GJXA 2G3MA 1QW9A 4P8XA 3BLKA 4U3CA 4UR9A 1MW2A 5D8WA 4AZIA 1D2KA 3PZMA 5CXPA 5A95A 4QLLA 4MB4A 2FHCA 4QAWA 3K1DA 2DSKA 4DWSB 4H8VA 2VZSA 1TVPA 1ZBKA 2CESA 4GZEA 3UR8A 4U2YA 2J7FA 5A6JA 4UQDA 1UR9A 2XWDA 1BHGA 6CGTA 2VCAA 2ZUNA 1JIBA 1HKKA 3WQ4A 5A6AA 3WD2A 3AICA 4AZCA 3WNPA 4OZOA 3GDBA 2WVSA 3PZVA 1B31A 3N9KA 1HL9A 5HBFA 4H04A 2QV4A 1B0IA 1GOMA 1QI4A 1TE1A 4AD3A 3CZEA 4XZWA 3OZOA 1R8LA 4JKLA 3WEZA 3MUAA 1BGGA 4CD5A 2G8ZA 2JF7A 2F2HA 3BAWA 3AS1A 4EAMA 4UQ9A 2D20A 2VQUA 3B9AA 2G3JA 3AI0A 4PMZA 1AQMA 4B9ZA 2OSXA 3AXIA 1JG9A 3AIVA 4WKFA 4HMDA 1JAKA 3G6MA 3VIHA 4ATWA 3SCOA 2J74A 3GH5A 3UESA 2QMKA 2WPGA 3FAXA 1EDGA 1OWQA 5I6SA 2VX5A 4W88A 3SUUA 3TA9A 3UG5A 2G3NA 2OYMA 4GO9A 5DEZA 1JZ4A 1QNQA 4MNJA 5CLWA 1OD0A 3W26A 3BAKA 2OSWA 1C8YA 3SUWA 1WKYA 1WDPA 3PZIA 2E0PA 3HJEA 4W8AA 1ZBVA 1GNXA 4P7QA 4HPHA 1W3HA 2E9BA 3AIWA 1GQKA 3UR7A 5DF0A 1BAGA 1E0VA 2BY2A 2DGAA 1CGVA 2V5DA 2E8ZA 4OKDA 1TFVA 1LL7A 4E8DA 4J3TA 4HMEA 2YJQA 3VNZA 3AHXA 1WPCA 3WBEA 1JYXA 1JNEA 1UR0A 1W9DM 4C7DA 5AC4A 3IJ8A 1WP6A 2J47A 1H11A 4CCEA 5CQ1A 3K8LA 4JFSA 1DWAM 2EJ1A 2ZXAA 3AIQA 3W4RA 2DT1A 3WENA 2YA0A 2RGMA 1PBGA 1QW8A 2Y8VA 1UWQA 4KWUA 1OGGA 1W91A 4AD1A 3EDEA 1I75A 4AEEA 4OOUA 1V3HA 2WVVB 1SR0A 1E55A 2EPNA 1J11A 2UY2A 4QFUA 5A2CA 4BQ2A 1FA2A 3HMCA 2YL8A 4M82A 4ML4A 1UD3A 2BY0A 1BLIA 2ZUWA 1EA9C 3N04A 4WIWA 2PBGA 3MSGA 5LA1A 5BXSA 5HPCA 2JF6A 4CD8A 1FH7A 1XSIA 2C8NA 1HNYA 2VCCA 4B3KA 3VX0A 3TTYA 3PTKA 2CXGA 1JD7A 1KGUA 3EMZA 1GOQA 3PZOA 3ZT5A 1V6YA 3A4WA 1CNVA 1ITXA 3GXIA 5A8QA 4PSPA 3CLWA 4W87A 1M01A 3WQ6A 4CU7A 2GJPA 1OBAA 1WAWA 2BFGA 3AOFA 1PZ2A 2VI0A 4GZIA 4PMYA 3VGBA 2PI6A 4JCLA 3LPGA 1ZBWA 1CYGA 3FHQA 3ZOAA 1TA3A 4UQBA 3WQ5A 4MNMA 4ZXOA 5GNZA 2QMJA 3VVGA 2ZIDA 3WD1A 1XCWA 1HT6A 4PBGA 1UWIA 2VT0A 4U5IA 5JIWA 4RE2A 3ARVA 1U2YA 4MAVA 1GUVA 2W62A 1MQQA 3UCQA 2O9PA 1K9EA 3F5LA 1BSIA 4J7RA 2EEXA 1DEDA 1OSEA 1CXFA 2DSUA 1E40A 2WAGA 4P7LA 3CO4A 3CHDA 4GZJA 5DO8A 4F9DA 2ZX9A 2PWFA 3K8MA 3AHVA 2PF0A 4UQCA 2VX4A 5JBDA 1E70M 1E43A 5IXEA 1E6NA 4W7WA 3VGGA 1NWUA 2W61A 2J79A 1CENA 5HDRA 4OOZA 1C8QA 5AYIA 1FHLA 1UQYA 3OLIA 4D72A 2G41A 3K46A 4UOQA 3AZTA 3MUIA 3CUGA 5I3DA 4OIFA 4W5ZA 4J3VA 1B3YA 4TUFA 3N12A 5HNNA 4BF7A 4WKAA 3T2PA 1SMDA 1X6LA 4IPLA 3RJYA 2XIBA 1JFHA 3VIIA 3ECQA 1BYAA 5I0DA 1GW1A 1H09A 1NWTA 3WNOA 1JZ5A 1E3XA 1B3XA 1DWHM 2WKLA 4HU8A 2BVTA 2CHOA 2VX6A 2WYSA 3ARTA 1EQCA 4ATLA 3WD4A 3WELA 1OT2A 2WMIB 2GUYA 3CUFA 4M80A 1QHOA 1C8XA 1VIWA 2VZOA 2FGLA 1ODZA 2FGZA 1QPKA 5A6KA 1JZ7A 2X1IA 3AYSA 4TVDA 2GFTA 5A8NA 4IPNB 2JALA 1C7TA 1UD4A 3RM8A 1DP0A 1LWJA 2EXOA 1R87A 3ZM8A 3SIMA 3WMCA 4XB3A 3L4WA 4AIOA 4D6HA 4WJXA 1B2YA 1ZBCA 4YHGA 1J0IA 3CZ8A 1VBUA 2VURA 1L8NA 3I3EA 3WH5A 2DH3A 2DSVA 4DWSA 1GHRA 2YLLA 3DYMA 3ZJKA 4B15A 2PC8A 5CG0A 3OGRA 3D5HA 1GJWA 1I1XA 3N13A 3KL5A 4FMVA 5CPSA 1V6WA 3AMCA 1OD8A 1XSJA 2OSYA 1K6AA 4YPJA 2PWHA 2V3GA 3OGVA 1GCYA 3MU7A 1XYFA 1WNOA 5D9NA 1QBAA 4A3YA 4D1IA 5M03A 5D9PA 1CDGA 4AIUA 3K4DA 5BCAA 2VNCA 3AIUA 1CGYA 2BHYA 2J8FA 3M07A 4KRTA 4D6FA 3WKZA 5BRQA 1HVQA 1UUQA 3BAYA 2X8RA 3KZSA 5A6SA 1JYNA 2VX7A 1XH1A 4HP5A 1E56A 4BA0A 2G3IA 1NOWA 4HOXA 4E4PA 1E6XM 3CHEA 1YQ2A 4DUVA 4HTYA 4JFVA 1NH6A 3ZIZA 5JIPA 1GHSA 1ECEA 1J0HA 1V08A 2ZE0A 4PMRA 2ZX6A 1V3KA 4TVCA 3WL1A 4DUXA 2C7FA 2WLZA 1JD9A 3NDZA 3GXFA 3AXXA 1FHDA 1R7AA 3BAXA 1QNSA 2A3CA 3THDA 3HN3A 3A4XA 4AZBA 1UH3A 5M5DA 1UWRA 3WF2A 3AMGA 1KBKA 3VM7A 2CBIA 4UTFA 1UD8A 1W1YA 1UWSA 1MW3A 3MMWA 2ZXQA 4BQ5A 3O6AA 3TONA 1SFSA 3AYRA 2MANA 1KWKA 2WANA 5A69A 1R85A 4TOQA 4Z2IA 2V3EA 4UQAA 3FY1A 3GH7A 2V5CA 3ZT6A 4D6EA 2B31A 4JHZA 4CKQA 1QI2A 3SCVA 3IK2A 4HMCA 1G01A 3VDHA 4E8CA 3T0AA 3VGFA 4CN4A 3ALFA 3UG4A 4DM2A 4GI6A 4UZUA 4HA4A 1J01A 1BYDA 4WLCA 2WM0A 5IFTA 3OB8A 1UKTA 2AMGA 1OGSA 3U5UA 1ISYA 1KXVA 2EQDA 1UKPA 4AZ5A 4FLSA 3CIVA 1C92A 3TTSA 1ZL1A 4PN2A 1JXKA 3ZMRA 1V6XA 3BCFA 3PZUA 3T08A 1DTUA 2YBUA 4W93A 2Q8XA 2J7EA 3JUGA 4W8BA 1J0JA 2YA2A 2J77A 3RILA 2PWEA 3NSNA 3BMVA 4ACZA 3WF0A 3W0KA 1E73M 1UD5A 2A3AA 4V2XA 3WSUA 4HZ6A 1US2A 8A3HA 1TCMA 2CPUA 3QGVA 3ARWA 2WXDM 3VOCA 4GXPA 1QNPA 3MKKA 2XJ7A 3T0DA 1UYQA 2IUZA 2W63A 3VUPA 1WZLA 2UY4A 1EO7A 2VZUA 1GONA 3BAJA 1G94A 1PIFA 4AD0A 1B3VA 3LMYA 4D71A 1JZ2A 1W9VA 4LYRA 1R7OA 1QBBA 3FN9A 1VFFA 3WDHA 4PMUA 3WH7A 4MDPA 4GPNA 3MV11 2EPOA 1CXHA 1KR1A 3WDQA 3VU2A 2XVNA 2O9TA 2WNWA 1N82A 2VJXA 3D3AA 3VO0A 2YDRA 1EDQA 2J7CA 5FL1A 5FOOA 4GI9A 1U30A 4EKJA 3T2QA
chains in the Genus database with same CATH superfamily
1AH4A 4DPPA 1EKOA 4MAZA 1V02E 4A3RA 4J28A 4KEVA 4LT9A 5BYWA 3UZWA 3QH2A 2WKGA 4J2MA 5LIUX 3M41A 3VNMA 2BX7A 2EKGA 3LERA 2FKPA 4PCNA 2JEQA 3U4FA 2BOFX 4EANA 3FGCA 4GBDA 1F4AA 1WA3A 3MUXA 1TTQA 4L4PA 3L2LA 4N2YA 5CJNA 1PYFA 5TNVA 4LF2A 3URQA 1JF5A 4JIHA 3H7RA 5AYZA 3GR4A 3W1LA 4E2BA 3TYZA 3BXWA 4RLIA 2Q8LA 1V0LA 2OXNA 3DG7A 2X7VA 4FLRA 1FXQA 3G0SA 3R89A 4IG2B 5LA2A 1HW6A 4I9AA 3W9ZA 1D3GA 4C5ZA 3SN4A 2OO6A 4IMFA 4O11A 1BYBA 3W82A 1VAHA 1Q6RA 4PZVA 1RH9A 2OQLA 5CLTA 4DNMA 1K9DA 1UP0A 2EG6A 2XVKA 2I5QA 4PMXA 1I1WA 1E0XA 3DUGA 4HOWA 2BNJA 1ZCOA 2FIQA 5JBFA 1JUEA 2VZVA 3WUEA 3BO9A 4DYJA 4PMJA 1VJSA 4LY8A 5FEPA 4O0ZA 2ZRZA 1EYEA 1MO0A 2CKRA 2DQWA 2FPYA 3RMEA 3VD7A 5AY7A 1OM0A 2YDQA 3ZO9A 1ZY9A 3E1F1 4LYKA 3SQMA 3OYXA 2P53A 1DXIA 5MKGB 3WH9A 3BLPX 3NQ2A 3WK3A 1UQZA 1QK0A 4I9MA 5I03A 3QZ6A 3BV7A 2HJPA 4DO7A 2BZNA 3B8VA 3ARQA 4D6GA 2VKZG 1V3MA 2DZWA 2OT0A 2PUZA 4ZO8A 4L9XA 3WNLA 3NTYA 4YTSA 3DGRA 3AO0A 3PTQA 3W70A 2FHBA 1FWTA 3GDKA 1SW3A 2Z29A 3PUEA 1EEPA 1RLDA 1KFKA 1F4HA 3EB3A 1VFUA 2FFIA 3S5ZA 1KR0A 2DPEA 2F61A 1HN1A 4J3WA 1MW0A 3EOOA 4PUDA 1EOKA 4JIRA 3GHSA 3TSDA 5EMLA 1UG6A 2WJDA 3PWGA 3V4BA 3KBSA 5HJXA 4UTLA 5E5CA 3ZLHA 2QS8A 2TSYA 3WY1A 1ICQA 3KVMA 1Y5WA 4X9YA 1TJ2A 2PB1A 4BI6A 3WK2A 3VINA 1BKHA 1MEHA 2D0GA 6TAAA 1UBSA 2X40A 3LSBA 4LNCA 5FAJA 3VFCA 1QTWA 4W84A 1BWKA 3VC5A 3VGDA 2XYLA 4UTWC 2PFHA 2O9RA 5TQLA 3BC9A 2QZRA 2Y7DA 4NAFB 3IJLA 3WQEA 4D6JA 4JICA 4Y6GA 2ZKMX 3WLOA 3WJZA 5A2BA 1JF6A 1RAKA 3TW9A 4KWOA 4XUYA 1SPQA 1G7UA 2Z2BA 4Q8PA 4HYRA 3ZWTA 4MUZA 5D9MA 4OFCA 1JPIA 4PBEA 5A6MA 1O94A 3PPFA 1US0A 3TKFA 4NJJA 1DBTA 3W28A 4K3ZA 3CZJA 1F05A 3AWOA 3N15A 4KBXA 4HPXA 3O07A 4U28A 4XVEA 5EFDA 3WZ0E 1VZWA 4HZ7A 5TD4A 3M4HA 1RCQA 4ZFCA 1ISZA 1JYVA 4PUKA 1JEZA 1EJXC 1POKA 4S3AA 4Q8VA 1KGWA 1XLJA 4IH3A 3FXGA 4LGXA 4P5UA 1XDJA 3PTMA 3WDJA 3S5NA 1E4IA 5A6LA 1J0ZA 2ZA3A 1XLGA 4O18A 4B5NA 2Y8KA 3JZEA 2PLCA 4CD4A 3NGJA 6REQB 3W87A 2FVMA 2MUCA 1TMQA 3NG3A 3WLKX 3BANA 1VFHA 1E3ZA 4F79A 1YPXA 3TIMA 4DNHA 3QTGA 4IPPA 3P8JA 5ECUA 3V0UA 4HHPA 4H8NA 4H4IA 1XLKA 2Z2AA 1AL8A 3UYIA 5FESA 3SM0A 3OPSA 4ZENA 1N55A 1TTJA 4Q8QA 2E6AA 5G4HC 4QISA 2NLYA 4O16A 3CZLA 3CS2A 1M1BA 3OVRA 4U3AA 4XKMA 5BNKA 3H2EA 3WBYA 2EO7A 1TV7A 1H7WA 1ZJAA 4H6QA 5XIMA 3W7CA 3I7RA 1IGSA 2J25A 1XL9A 3C86A 3A3HA 3U9IA 2QCFA 4JKMA 2QDGA 3MBDA 1VJZA 4X63A 1MUCA 1CXEA 2VVNA 2EJAA 3VNJA 1F07A 1K8YA 1O5XA 1FWJC 1VBRA 1UC4A 2BY1A 2C1HA 3VPLA 4LS0A 2PDLA 1ZNNA 3ABSA 4W8LA 1ONWA 2NXGA 5DT5A 5E70A 1B54A 1S5TA 2DSZA 3L4UA 3UFYA 2X16A 1E6PA 2HDJA 3VMNA 3SUSA 1ZENA 3B05A 3E5PA 2E9MA 3O6YX 1ISWA 4YWIA 4GBUA 1C7SA 2CLPA 3BW2A 1E5NA 4H6EA 3GTXA 2ZBTA 2Y1HA 4OWGA 4DO5A 3A6OA 5T26A 2GOKA 1UR3M 2A3EA 4YTTA 4IIBA 3LEPA 1FHUA 1Z6KA 1UD2A 1H0IA 1GOXA 1SUXA 4IG2A 1TX2A 1OG6A 4GJJA 4I6KA 1H62A 1F73A 1S3HA 5IHRA 1JI2A 1GOOA 4N0RA 2NT1A 2QUUA 3BL3A 4QGCA 4QRNA 2YFNA 4BI7A 3VNYA 2BS9A 4ADUA 4Q4RA 1RD6A 3QMRA 1HJQA 1SFTA 4F4RA 4Q8OA 2GGIA 5D4YA 3W2NA 2GDUA 2QW5A 2WVUA 4O28A 1RLCL 3S2CA 3STFA 1AVAA 4GY7A 3SO7A 3WNKA 1UZ4A 3UERA 4BQ4A 3M0KA 1WQ5A 1R9XA 4RV3A 4TO8A 1SO6A 2Y24A 1CXKA 4J9JA 4A21A 1W1B1 5MKGA 4WQ6A 5LHEA 4B5TA 2Y62A 3W27A 3NL5A 5GJPA 4JHOA 1CGXA 4AH7A 2PTYA 4OVXA 2A79A 2B7NA 3PY2A 2G3FA 2OLHA 3UNTA 5F2GA 3QEZA 1SMAA 1H1YA 1QU4A 2FYMA 3CLMA 4GINA 2CZ5A 5DANA 1HL2A 3F5JA 2HTMA 4H83A 1ALDA 2CCRA 3LNMA 4JFWA 5I3FA 4MGGA 4C1KA 5I5RA 1TRDA 5LIKX 2J78A 1E0WA 3FA5A 1UJPA 3AU2A 4MY9A 4GUHA 1M03A 1F8IA 1GQJA 1SJAA 4TVUA 3AISA 3G1XA 3BK0A 3EOLA 4EX4A 1KC7A 4MSSA 1DQXA 1FVPA 1S3TC 4NF7A 3LENA 3UA3A 1UCWA 5BW6A 2QUVA 3P14A 3CBWA 3LYEA 3T44A 4ERIA 4BEUA 1TZ7A 3NDOA 4HNLA 4LBSA 1YADA 3FYPA 1VEOA 3LXCA 3O15A 1RJPA 2ON3A 3AAMA 3HOJA 2NVDA 3ARPA 3VKCA 3SCNA 4DBSA 4OV4A 1JUKA 3P3BA 5DFAA 3WUGA 4PB3A 1DVJA 5A3HA 2V6AA 1SO4A 4PCTA 1CWYA 2XN0A 3ZS4A 1GGOA 3NPXA 4UNKA 3K8KA 5HJYA 4RNFA 4PR4A 3HF3A 2PTWA 2OZ8A 3S6DA 2XSXA 5J8LA 1Q4WA 3SBFA 2OO0A 3T07A 5I2UA 8RUCA 1BVZA 1TPB1 3MP3A 3NDYA 2IPGA 1SSDA 3KP0A 2QCDB 5DCBA 3SUVA 3ABZA 3EMQA 3W29A 5LXXA 4J1OA 4PTWA 1J0KA 3SCQA 1GKQA 1XC6A 4HA0A 1R86A 3VOHA 3CMGA 3PUOA 1UIOA 2PU1A 1HKWA 4LVDA 5C6MA 5CC3A 4RUBA 3CH0A 6REQA 4GC4A 1OCQA 1FKXA 1M7JA 4RZ6A 3F5KA 3ARRA 4MJ4A 3TW7A 3W37A 4EP8C 1NQ6A 2C3ZA 1LLZA 5SWUA 2VOTA 4C6JA 4L80A 4W5UA 1AODA 3KDOA 1E51A 1NWRA 4GIYA 3G1RA 4CEXC 2Q6ZA 3OZYA 3TVAA 3U7VA 1YIXA 2BXVA 1UH2A 5CSRA 1Z9AA 2CYGA 3MANA 4G5DA 4IPIA 3KP1A 3PN8A 1OIFA 4ACYA 1KRAC 2A7PA 1UOKA 3GG8A 1ZFJA 4W86A 1V51A 4GE8A 4Q8UA 3RM9A 2DT0A 3JS3A 1JDAA 3HPZA 1DL3A 2DUAA 3SCSA 1L2UA 1LF1A 2WZTA 2YXGA 3BG3A 4G1KA 1EEXA 1EPVA 3EDJA 4AZCB 3TYEA 4QQ3A 4O15A 3S9ZA 3PPCA 3KDNA 4MY1A 5LYRA 4QDPA 5GVJA 3WQVA 2DP3A 2PTZA 4EOUA 4MB5A 4GKLA 1UA3A 1XRFA 3SCPA 3GU1A 2L5HA 3NVTA 4L6DA 4ZODA 1VFLA 1NDVA 4DPQA 4DZHA 1CT5A 4GQQA 4IM4A 3HPXA 3NYDA 1AL7A 2WVTA 1PIIA 3VIOA 4WD0A 4MOZA 2WKJA 4KCVA 2W79A 4L1XA 1V3IA 3ZR6A 1OCJA 2VUYA 1W5MA 5C8BB 3WBWA 1MXSA 2R1KA 4K37A 2R24A 1J10A 4WY0B 1Q8AA 1B1YA 4H9TA 1QOXA 3EOSA 3W2LA 3AYTA 1XS2A 1XLHA 3NZGA 1VFSA 2A85A 4JYDA 1ENUA 5GNYA 3OBAA 4I8YA 4FI4A 4FX7A 3IIVA 4DXKA 3EBVA 3E0WA 1Q6EA 2FTWA 5E9XA 3QQ1A 3CO8A 4JN7A 4RW5A 3N6JA 1OT1A 3QOKA 3BARA 3E2VA 4D6DA 1E9LA 3HO8A 1O5RA 3W2KA 2BHUA 3GTIA 4N7QA 4TTGA 4TX6A 5C5YA 1GEHA 1UZHA 1W5QA 3IACA 4OBTA 1XYMA 2BWGA 4QJ5B 1T7LA 1RA0A 3PZ9A 5FAGA 2G5WA 2J62A 6TIMA 3WQCA 1CECA 4GO8A 4MWAC 1ME7A 4CN6A 5E0FA 3S42A 4GQGA 4Q4PA 3VMOA 1W3JA 1FCUA 1QUMA 4CU8A 4IZGA 3L5AA 2JQXA 1JDCA 3OIXA 5ABEA 3N3MA 1KW1A 3KBMA 3TN6A 1UKQA 2QULA 5HPOA 4W7VA 1EX1A 4ZXLA 3W1NA 4GFIA 3AUJA 3G1SA 3L4TA 2GVGA 1JCJA 4CGTA 1DJWA 1M53A 1XM3A 3HPFA 4RDYA 1KKOA 3TZFA 1DWGM 4FP1A 4Q7NA 1EC9A 2DZBA 1DJXA 2CNCA 1ZU8A 2Y5JA 2B7QA 2F7FA 1LDCA 3KLKA 3A23A 5CGTA 1OFEA 2GQ3A 4Q22A 2J13A 3FW6A 2CC0A 4WDXA 3NPVA 3GYCA 4JS3A 2QQ6A 3KVKA 3R1ZA 4RPPA 1E6SM 3T7VA 3EAUA 3W76A 3GBEA 5EBAA 3C2YA 4Q4OA 2F2KA 1W9UA 2XVLA 3LLFA 4KGLA 1V3JA 3P0XA 3DG3A 1C93A 2WJEA 2WSPA 2VO5A 1IEXA 1A3HA 5LNVA 2HCVA 2AOSA 1VBGA 4NILA 2XN1A 1BG4A 2QCDA 1JZ8A 2BB0A 1EZWA 3WUFA 2E5BA 3EDKA 1KFBA 1LT7A 1E4LA 4YN5A 1Y5VA 3WH6A 1XV8A 3FXYA 2VC9A 2ZTKA 2W5FA 1I6NA 3PBYA 5EYWA 3BMXA 2DZSA 1V77A 4FZIA 2XFYA 1TMLA 1EJVC 4H2HA 1FXPA 1K4GA 3U2OA 3IRSA 3DEQA 2UY3A 1Q6FA 2QCLA 5C9UA 3LTPA 2ZC1A 1LQAA 1E6ZA 4N9CA 5D2YA 1PHQA 4CUCA 3CQKA 2GQ8A 3FSUA 2ZWZA 4UIOA 1TSIA 1UROA 2YCKX 1FHVA 4KRUA 3DFHA 3FJNA 1Q5MA 3H4XA 3P8IA 1VCVA 1LG2A 2XIQA 5C2CA 4FPSA 3CHCA 2POZA 1LG1A 2BDQA 2PE4A 1NJJA 3R10A 1GJUA 2WVVA 4LVFA 4UFJA 2GSHA 2C13A 1LCOA 2OOGA 4DN1A 4A35A 3D47A 3VKDA 5DMLA 2PP1A 5CPQA 1NF7A 4NJGA 2WW5A 3PM6A 2HXUA 4U3CA 1MW2A 3EWZA 4XWUA 2V5LA 3FJLA 2DUXA 5CZJA 3T05A 5A95A 4NJHA 4QLLA 1L2QA 4HU3A 2QGYA 2FHCA 4QAWA 3K1DA 5K2ZA 3N2OA 1TVPA 1ZBKA 2CLLA 5A6JA 4GYJA 2VP8A 4LH8A 1EGVA 1CB7B 4FOJA 3DC8A 6CGTA 4MZ8A 4NXKA 1FWAC 3WQ4A 4EXAA 5A6AA 3LXAA 4AZCA 3GDBA 1PZ0A 2PDYA 3N9KA 3P93A 1OFQA 5HBFA 5I3KA 1AZ1A 1QI4A 3QVQA 3FEMA 4JKLA 3APYA 3WEZA 3WQDA 2PCQA 1K7XA 1M41A 2G8ZA 2IPFA 3NZ1A 3BAWA 3M0YA 1K7FA 1KBLA 1FUYA 3GXTA 4PB5A 1XFBA 5I00A 1SW7A 4WJ8A 4W9TA 1T5AA 4WGXA 4AHOA 3CK5A 1DJHA 4B9ZA 4OHQA 4QIUA 3VCNA 3Q37A 5A5WA 4ATWA 3GHTA 3QY7A 1DJIA 3GH5A 3KW3A 3EPMA 2BBFA 3NWRA 5F4WA 2CZVA 1WX0A 1YYAA 2G3NA 4XKYA 3DH7A 4EVZA 4JXCA 1D3HA 5XIAA 4Z1AA 1C8YA 2PODA 1N7KA 3IIXA 3OVPA 2WO5A 3HJEA 3QR1A 2FMOA 4UNLA 5AYYA 2WM1A 3VDGA 5F2MA 1ZHAA 1W3HA 2E9BA 1GQKA 5DF0A 2DGAA 4RK8A 1NDYA 2FLIA 2E8ZA 1YX1A 2YJQA 1XBZA 5FEZA 4A2RA 4CNTA 1W56A 3NA8A 3THUA 2JGYA 5HUPA 2ZYFA 2FDSA 3W7GA 2FZDA 4UTIA 3K8LA 4JFSA 4KS0A 5D04C 4Z0SA 4NYUA 1W1A1 1QW7A 3Q4DA 5HANA 3UBPC 4E2VA 4DO4A 4HHLA 4AD1A 3Q45A 4OOUA 1LBFA 3PK7A 4JTJA 3T8QA 2E6DA 1J11A 4QFUA 4YCPA 2AKZA 2YXOA 3PWAA 1SZGA 2E6YA 4PFHA 3R25A 3IJIA 3KCOA 1EA9C 2FB3A 3S8HA 1BVWA 5CEWA 2INFA 4C6IA 2XGZA 5BXSA 3SN1A 1XSIA 3R7MA 1WXZA 3CPGA 1TWSA 3TTYA 2NZLA 3A21A 4GCAA 3PTKA 2CXGA 2IW0A 3EKZA 3TXZA 3E0IA 1CNVA 3P61A 3CLWA 3KX6A 4W87A 1V7AA 3WQ6A 1OBAA 2O4QA 2DV0A 1RPXA 3O6DA 3QPZA 4LAMA 4UTHA 3S9IA 3VGBA 2OEMA 4HGXA 4QE4A 5CBIA 1VJIA 4JCLA 1REQB 2P76A 1XX1A 4H01A 4OU1A 4MNMA 1XIBA 3KHJA 3ERPA 3VVGA 3WD1A 5CPOA 2VT0A 3TYAA 2HE5A 4HN4A 1A5SA 2IQDA 3ARVA 4K8GA 1TWDA 3OOQA 4B91A 1GUVA 3LD5A 2W62A 2VGFA 3UCQA 1K9EA 1Q45A 5LHFA 5BWAA 4GH1A 3CC1A 1E40A 2WAGA 4P7LA 4N4QA 4JTEA 3TX9A 2WQDA 2ZX9A 3AHVA 2VX4A 1E6NA 1NWUA 3BQ5A 2I5IA 2PP0A 3OEXA 4H7ZA 4KESA 1O1HA 5HA7A 4LVAA 4XZ9A 1KM0A 4IP5A 3M9YA 3UYCA 1IGWA 3V18A 1FHLA 1Z7AA 1AD4A 3H7VA 3GWQA 4GYPC 4Q6XA 1TELA 1IIHA 1VD6A 3RRXA 3JVAA 4XZNX 4YNGA 5HNNA 4BF7A 4F2TA 3RJYA 3RO6A 3S2MA 3UJ2A 3WLPA 2DUZA 1VFTA 2J24A 3WNOA 1B3XA 4LBRA 1KO0A 2WKLA 2CHOA 5CPLA 3TYDA 1LZOA 1EQCA 5DY3A 2WMIB 2OQHA 1OABA 4L6HA 3FKKA 3TUUA 3CUFA 1JPDX 3CQHA 1TPVA 2FGZA 3MC5A 1WUFA 1QPKA 5A6KA 4TVDA 3A3WA 4IX0A 3U8GA 1C7TA 1G4SA 3IGHX 3NM3A 4ZTYA 4YL2A 3HGSA 3ZM8A 2H6RA 3QGKC 3ZFHA 3LTYA 4LUTB 4UUIA 4XB3A 5FF4A 2KZHA 2YB4A 4WJXA 2UZ9A 3EX6A 1B2YA 5KMYA 1J0IA 4MYXA 1RCOB 4MHBA 1L8NA 1TB3A 4IJRA 1RJRA 1IR1A 2YLLA 1FBAA 2IPWA 4B15A 2KX9A 4IFKB 3OGRA 1TZZA 4YLWA 1GJWA 3NL6A 2Y0FA 1IXNA 3KL5A 4FMVA 5HQMA 3W72A 3LI0A 1KM4A 3CUXA 3RU8X 4M19A 2OSYA 3LHYA 1K6AA 4JQ1A 3VABA 3LQGA 1BD0A 3THQA 3RU6A 1AK5A 1CDGA 3U3HA 5BCAA 1P6BA 2VD8A 4DHGA 2BHYA 4KW2A 3AJXA 3GIPA 1EJ7L 3DHFA 2Y5SA 2R6OA 2Z1WA 4KRTA 3KFTA 4D6FA 3WKZA 1UUQA 3BAYA 3PFRA 1QAPA 1LBMA 4HP5A 4BA0A 2G3IA 1NOWA 3LV5A 1E6XM 4M6QA 5BRBA 1YQ2A 4HTYA 1QPNA 1OX4A 5JIPA 1GHSA 3VYLA 4WOZA 3B40A 4TVCA 1I9CB 3G1VA 4CNUA 3EX3A 3LLXA 4GISA 3S4TA 3VXGA 3CB8A 5JVLA 1FHDA 3THDA 3G1YA 3RLVA 3A4XA 5LIWX 4PGLA 1OC7A 3EA2A 3VZYA 1UWRA 1DJGA 1A0CA 2DZTA 3O0KA 5AC6A 3C2EA 1GYMA 3WO8A 4ALDA 2VD9A 2R8WA 3SGZA 2IS7A 3PUGA 5EU9A 1FDYA 4FO4A 5LNUA 1FDZA 2XIMA 4AWUA 3COTA 3P80A 3GUWA 3FY1A 2C1GA 1PUDA 2OZ0A 4IXXA 3ZT6A 1KD0A 1UUOA 4AIBA 3PNZA 4CKQA 4HMCA 1S1PA 1KM1A 2NQ5A 1ZCCA 4CN4A 3UG4A 1GVRA 4DM2A 2P50A 4HA4A 5IFTA 3U5UA 2EQDA 3GW0A 1UKPA 4HNCA 3O8AA 3GR8A 3CIVA 1XIHA 3OG3A 1ZL1A 3BCFA 3V5CA 2Y63A 4W93A 1FWIC 1J0JA 3NNTA 1W1IE 3EWYA 1T40A 4UMAA 2VWTA 4BF5A 3S83A 4GIEA 2TMDA 4ACZA 1TE6A 5HK4A 2CLOA 4HZ6A 2V2HA 3QGVA 4L65A 3UWUA 1QNPA 3MHGA 2XJ7A 4QE1A 3VUPA 1PWMA 1WZLA 1EO7A 5IBXA 3CIXA 1G94A 4F2BA 3M0ZA 4AD0A 5LNWA 1A5OC 2W6RA 2QAPA 3MI3A 3N34A 3WH7A 4EPBC 3MV11 3URNA 1KR1A 3C3UA 2HBXA 1REQA 1W31A 3VU2A 2ZTJA 4PCPA 4I7VA 3EWUA 3CV2A 3D3AA 3F4WA 2YDRA 1BXCA 3K30A 4RZ5A 1EDQA 3A12A 1W6TA 2H3DA 1OYAA 1TZ9A 3G0XA 2HVOA 3T2QA 4JTRA 2W4XA 3LPFA 4NIRA 3V3WA 4RCXA 2Q01A 3QSRA 3CUHA 1IF2A 1MYRA 3IEBA 1V6TA 5KITA 4C90A 1HKMA 3R0KA 1OZQA 3V1HA 1VPYA 1XRVA 3F7JA 1E0TA 1FWDC 3BAIA 4DJFA 3NEVA 4KETA 1PPIA 4OTKA 4AIEA 2ABBA 3ARYA 5IDIA 2YLAA 3TOYA 1TMHA 1W1TA 4JFTA 1FQ0A 4RXGA 3O05A 5EMMA 3NQ8A 1TV3A 4AEFA 4AMAA 4PSRA 3G1DA 4GA8A 3B9EA 4XISA 3MCOA 1P0NA 1TWZA 4H6KA 4RJEA 4O54A 2OFJA 1E4NA 4R3UA 5AECA 5DMYA 2HNHA 4GGBA 3WJSA 4IP7A 3IJ7A 1JCMP 1TJRA 3GFZA 4E4UA 1E1FA 3ZYZA 1XKJA 1ADSA 2ZUMA 3CZKA 1NDZA 4A8NA 1D7FA 4AC1X 1UMLA 2BOEX 3EA1A 3WF3A 4YVXA 2WMIA 4YIWA 4EF8A 4H7VA 4UTKA 2HVNA 3QGAC 2ISDA 2BXYA 4WVXA 2OWWA 3SW6A 5G5IA 1YXCA 4FAMA 2Z7GA 4PRTA 4FXSA 4UFMA 3ZVIA 2GQ9A 4M3PA 2QNEA 1HF6A 1Q7MA 3W6LA 1EXBA 1GYNA 4LUTA 3WFLA 1A3XA 1DIKA 3OQEA 4LF1A 5DMNA 1POJA 1W3TA 4O17A 3UY8A 2HK0A 2HE8A 4JY9A 3P5YA 3HIJA 1I2PA 1KBBA 3VD3A 2OR2A 2J75A 1JCYA 1US3A 4IFKA 3RDKA 1WO2A 1RD5A 3TJLA 5IDZA 4TV6A 3KBVA 1KKRA 2J9YA 2W91A 1KM5A 3NSXA 1ISXA 2R82A 4HNOA 4N6FA 1YMYA 2GSJA 2WPBA 4S3BA 1NM9A 3LHWA 5K7JA 3KE0A 1G6CA 2JIEA 5AN7A 7REQA 5EFFA 2V2DA 4NP7A 2YOCA 1CGUA 4WZHA 3B9NA 3U57A 2PD5A 1KLYA 4JX4A 1O66A 4J3ZA 2RGLA 3TLQA 4EAYA 1EJWC 1CXLA 3GDMA 1W9XA 3GYEA 4ZR8A 2HEJA 2LLEA 5HQLA 3STPA 2PBOA 3TWBA 1PTGA 1E5JA 4B2DD 3WDIA 4H1ZA 2OCZA 1JRBA 1XKYA 1V0MA 3R0DA 4IMGA 1JAEA 4MMWA 3DFYA 3N4FA 2Z27A 2AL1A 1XSKA 3P5ZA 5CGMA 1KCKA 4M81A 1ISVA 1QATA 2BP1A 1ZP3A 3WQ8A 3O2LA 5A6BA 4CQCA 1FP8A 4WY0F 3E9AA 4QP0A 2WC7A 5CCZA 4H19A 3LRLA 3VNDA 2D3NA 1JPHA 2F6UA 4U31A 4XO7A 1E9ZB 3R79A 4R9OA 5D2TA 4LUYA 4ZTXA 4AX6A 4V27A 3VX1A 3LBOA 1F61A 3LCWA 2YYUA 2NVAA 4NAEB 2A6NA 3VMPA 3TDFA 2R91A 4DJEA 4QDMA 3G22A 2XVGA 1ELSA 1EO5A 3N6HA 4QJ1A 5K9XA 3GK0A 5A1AA 4PCFA 5D09A 1KXQA 4AQLA 5HWMA 2INEA 2RFGA 2FDMA 3A47A 3TA6A 3V7PA 3LG3A 4CVWA 1P1XA 3SECA 2X1RA 3DGBA 1NF0A 2TYSA 3P74A 3ANUA 4NZCA 3BG5A 4XAPA 1AW1A 3UA4A 3L2MA 1XC4A 4QAIA 3CWOX 3SY5A 3QY6A 3GNDA 1H3GA 7XIMA 2FH8A 1PZ3A 5BOFA 2PGRA 3G0UA 4JN6A 2Z1VA 1R2TA 2OKTA 5AB3A 3KWXA 3GE7A 2YIHA 3ENLA 1DWFM 2J8GA 4WOQA 2GK1B 2PDHA 3OG2A 2ACRA 5AVHA 1ODUA 3TEVA 3N11A 3W24A 1JULA 3CGTA 3L4YA 4Q8WA 4GNJA 1HGWA 4QEEA 1V93A 5FSDC 3POHA 2ACQA 4WSHA 5FF7A 1XLAA 3Q58A 4I9TA 1V3LA 1SJCA 2DIEA 2PDXA 3B0XA 3J7HA 4CCCA 3V16A 3T4WA 4B5SA 2O7QA 5CSUA 2EPKX 3Q67A 3SSZA 3MVIA 2Y5EA 5EKYA 3RO8A 3IANA 1EIXA 2VRKA 2VEIA 2WJZA 3IAPA 1C9WA 4MWAE 3AROA 1J6OA 4YTQA 3MHUA 1PS9A 1VRXA 3NSMA 3LN3A 2VZTA 3AZSA 4UCGA 1QO5A 1A5LC 1YTEA 3A4JA 2ACSA 5FJUA 2R1PA 4MKVA 2GWGA 3R58A 3LM7A 3V5OA 3EOUA 3MSRA 1TV4A 1Q6GA 1U5JA 3AZRA 3VD4A 5DRCA 6A3HA 3SAZA 5GQBA 1UD6A 3KBJA 3WLJA 1HKJA 3UZZA 5CC5A 2VTFA 1DQUA 4UTJA 3PZTA 3BOLA 3UEQA 1HZYA 4JNZA 4A4AA 1X97A 1TWIA 4LS2A 4HK7A 3QKZA 1VEMA 3LPPA 5DBTA 3GIYA 4MB3A 3ZZ1A 1VR6A 3MS8A 2XPKA 4AZHA 4I3GA 3NL3A 1E1EA 1M5WA 2ZX5A 3I65A 2ZOXA 1Q63A 5F7UA 4LALA 4AVFA 4JDYA 1HL8A 3UZYA 4DAIA 1ML1A 2R94A 4FSAA 1QPQA 5HWNA 2D2HA 4JL1A 4O13A 1E9IA 3UXAA 2ICSA 1WDSA 3BUVA 4LXFA 1PHWA 2V67A 4LUSB 3NZQA 1LQ2A 1KXHA 1PKYA 4AZGA 4RL3A 5F2IA 1W1PA 2H90A 3L5MA 4KMQA 4CCZA 1A0DA 3C3NA 3TAOA 2QIWA 4B5WA 2OB3A 1W3LA 3QHNA 3TQKA 1P6WA 1YBQA 3I6EA 3C0QA 5D9OA 1S2UA 4C7GA 1HJWA 1ICPA 1QVBA 3EKGA 4ZO6A 2QCNA 3BQ6A 1QT1A 1NFGA 4FX8A 2NQLA 1EX5A 2BSLA 3QPYA 2WMGA 1E72M 3TLLA 3WDPP 4C65A 2E28A 1E6QM 3BJTA 1LT8A 1JGIA 2OELA 1W2VA 2C18A 4KPLA 5T9CE 3ME3A 4GWEA 1AG1O 1UR2A 3CUJA 4L9YA 2YDAA 4AYSA 1Q6LA 3H2MA 1HO4A 4Z2HA 2RJHA 2D0HA 3GC5A 4HOZA 3GAYA 2G95A 3OGSA 3NQVA 2IXUA 2O9OA 5AC5A 2PMQA 5AZ1A 3CIWA 3P2VA 2IKHA 3B04A 3S1WA 4DWSD 2YB1A 3N17A 1F2JA 4H00A 3BLOA 1ZPTA 4GGHA 1KA9F 2TODA 5JU6A 1SYTA 4R9XA 1WUEA 2JKEA 3R11A 3WNNA 5D38A 3GBDA 4AMCA 1XG3A 1BF2A 2VVSA 1LWIA 3B06A 1FCBA 4JTDA 1YE4A 3QHMA 5EBUA 5B7YA 3I3DA 2Y2WA 1TRIA 1QNOA 1QFEA 4JN8A 4JCMA 1OFPA 2XWEA 1A53A 3LLDA 3OA3A 1XH2A 3EWDA 3EB4A 3UVAA 4H3DA 3WCZA 1NARA 4NJKA 1XDMA 1XLIA 2BXZA 1FP9A 4JQ2A 4UFLA 4GRSA 1LQ0A 2EGZA 1ESWA 1TIMA 2DJLA 3GO2A 2EPMX 2JBMA 1KQZA 4QITA 3VOJA 1XW8A 4CU6A 1S2WA 4KGJA 4WUIA 3WLMA 3F2BA 1PX3A 1XIJA 1XH0A 4DJDA 4AWSA 4PCSA 2QPUA 2WZHA 1F5ZA 1ONEA 3N29A 2WHLA 4TQTA 1VYRA 2OPJA 5AHLA 2WMFA 5C2XA 4PL2A 3PBVA 5AC7A 1I45A 4EPKA 2HK1A 1R6WA 1Q6CA 1JI1A 3A5VA 3U0HA 1XD0A 1PCWA 3WMBA 3TH6A 1DE6A 5DY2A 4JTAA 3ZSSA 4E5TA 2X0HA 1L6SA 3B0UX 4D6IA 3QLLA 4ATDA 5I7GA 1R47A 1JVNA 1UR4A 3VD5A 3VM5A 2CIPA 2IKJA 1A3WA 3DHDA 2GK1A 2Z4GA 2CEQA 4ZE5A 5ABHA 1F9CA 1Q6QA 3ITXA 3NYZA 2NT0A 1UKSA 4WKHA 1I60A 1VYPX 2CWXA 4HD5A 4YWSA 1JDEA 3RPDA 3P82A 3NURA 4X0NA 5KZDA 1QCWA 4P8WA 3P84A 2NUXA 5HMEA 1MDRA 4KQNA 5ABGA 1JZ3A 4XZLX 4NSBA 2EPLX 1AQ0A 1Q7ZA 2B0MA 1TPWA 3F2CA 4NVTA 2Q02A 1IV8A 4UQEA 4NJIA 1UBPC 2BY3A 3MYPA 3BSHA 1RY0A 3O6CA 3AHTA 2YSWA 1B30A 2F9RA 1FFRA 5EA9A 1T6MA 2ZRVA 4LQ1A 4M8UA 1H49A 1WBJA 2YL9A 1GW9A 2WV8A 1W8SA 3EDFA 3ZSTA 3L4ZA 4TTUA 4TX9A 4PE8A 1KXTA 4C91A 4OUIA 1YPIA 4HPJA 4JR5A 3U5YA 1A80A 4B9YA 3ATYA 2HRWA 4Z17A 2YBVA 2DH2A 3PC0A 1K03A 5C9XA 4FIQA 4GIAA 4BI5A 1MWOA 1XDLA 1BWLA 2QDEA 1PV8A 3E5BA 1X7FA 3E02A 5DMMA 2CBJA 2AQVA 3I10A 1XYAA 3SQLA 4E0CA 1UASA 2VDIA 2X2GA 5E09A 4GQ0A 1KTBA 4A8LA 4O4VA 2WHKA 3BZGA 3LHZA 4B5VA 4OQVA 3C52A 2XZ9A 4PUWA 3II1A 1OVDA 2Y70A 3PANA 4F0MA 2VMFA 3PUDA 1DWJM 4RDWA 1J18A 5JH2A 4GXWA 1XLDA 4EACA 1VCFA 4A3HA 3IV8A 4C5YA 5JMUA 1PZ1A 3AIRA 3S6OA 1W9PA 3QR3A 4K7YA 4YTUA 3EPOA 4MM1A 4HA1A 4M7TA 1P0KA 3SJNA 1R38A 2A2IA 2HPMA 1J5TA 1NIUA 4A05A 4QX4A 3P81A 3W02A 2YDSA 3I4KA 4M6UA 5DX7A 4IFRA 4LUSA 4P7NA 1IZKA 4MKNA 2JIWA 1WZAA 4FR1A 3TMQA 1ZRQA 3FJ4A 4B3ZA 2QJNA 4JNYA 2ZUUA 3EXTA 1NVMA 2VFFA 3WNMA 1KFEA 2CWNA 2QUTA 3M0IA 2R1NA 4W7UA 4JL2A 1HFBA 4GC3A 2DZUA 4YYFA 1EGZA 5HNTA 5FJIA 2QJIA 2F38A 2V38A 1NELA 4RDVA 4JX6A 1EPXA 3R12A 2E8YA 3W81A 4LY4A 1LOSA 5GJNA 5EL1A 3WJYA 4IUGA 1CIUA 2WMJA 2AMXA 4V1YA 4O1EA 1MMFA 2VHLA 1F3WA 4AFYA 4AXNA 4TIMA 2ZXDA 1Y5XA 4ML9A 1O1ZA 1HQTA 2BLEA 2X09A 4ZOAA 3W7PA 3QJAA 1P7TA 5H8PA 2P8CA 1BGAA 2PDJA 4KWVA 4MJMA 4O1FA 4NY2A 2HXTA 2PLMA 1PXGA 3M43A 1Z32X 2DVUA 2E40A 3WG6A 2C15A 3CMJA 4B5UA 3IIZA 3NVDA 5BXTA 1RPKA 4ES4A 1H7NA 4I7WA 5JH1A 1DJZA 3KBNA 3PAOA 3OO2A 1CW2A 6ENLA 3GU2A 3WL0A 1F3TA 3QXBA 3OLDA 2WHJA 2WMKA 4RZBA 4M24A 1RCXB 2YZRA 2E9LA 3KOWA 3CTLA 4DM1A 2TAAA 4ICMA 4P8UA 1GPFA 4OBSA 2RDXA 3PSVA 4JPGA 2XFWA 1EZ2A 1BVNP 1WOBA 3FIGA 8XIAA 1UA7A 1B3OA 5E93A 4E3VA 1I8JA 1GVSA 2J7GA 3F03K 2DQXA 2J7DA 3KRBA 3BG9A 4US5D 2GGHA 3CV1A 3AXHA 1H4PA 3CXOA 3WD3A 2VR5A 2O56A 3GDLA 1ME9A 1IZJA 4AW7A 3G5EA 6PTDA 4KH2A 1S38A 1JDFA 3LZ5A 1SGJA 1BTMA 2NV1A 3TJIA 4WF7A 1IXPA 4IQJA 1P0EA 3KRZA 5F1VA 2PA6A 1EJRC 2Z1KA 4PUEA 1KNWA 2OYLA 2D24A 1Y8BA 3NUKA 5EMYA 2YZ5A 3K4AA 5KTLA 4JQAA 3HFYA 2G0WA 3OA5A 2HVMA 4JEJA 4RE4A 3SQSA 1UR1A 1FWWA 3EYPA 1JCTA 1GTHA 4AF0B 4GK8A 1KGXA 4Q4SA 1MNZA 1DHKA 3TV8A 3DESA 3DU0A 1CPUA 3RLGA 8CGTA 5E6YA 7CGTA 5E0CA 1IYXA 2Z00A 4F66A 4V15A 1VEPA 3CTTA 1XIFA 3QMTA 4KCTA 1WV2A 3DFOA 1GZJA 3UG3A 1JQXA 1P6CA 4DUWA 3WBXA 4LAUA 2PTDA 3REQB 3CL6A 4GHRA 4UR9A 5D8WA 1GG0A 1TIWA 3PZMA 4LC8A 3OVGA 4K7VA 3QQ0A 4MUPA 1KRCC 2VZSA 4XBJA 2CESA 3UR8A 1OCNA 4U2YA 4DF0A 1K02A 3NM1A 4UQDA 3QLDA 2XWDA 1BHGA 4HNTA 2VFEA 2VCAA 2ZUNA 4OZOA 3PPHA 2WVSA 3BDKA 4DYKA 2WSYA 1HL9A 2C71A 4H04A 1GOMA 3ABQA 3A64A 4I90A 1TE1A 3W00A 3CZEA 3OZOA 1R8LA 1IQ8A 1BGGA 4CD5A 1XIIA 3KRSA 4IIGA 7ENLA 3UW6A 1BRLB 4IX2A 5U4NA 3NQGA 2OOFA 3B9AA 2ZZ2A 1VLIA 2ZA2A 4FX6M 1OCBA 3AXIA 3AIVA 4HMDA 4YCOA 2OEJA 2QMKA 1EDGA 3QRHA 3TK7A 2VX5A 4UTWA 3UG5A 3EPNA 1JZ4A 4FNPA 1QNQA 4MNJA 4JTFA 4XIAA 1R3QA 2DZVA 5CLWA 3W26A 3BAKA 1WKYA 4O14A 3TWAA 1WDPA 2RKXA 3PZIA 3R2GA 1WKEA 2E0PA 4FXFA 3BJFA 1H7PA 1ZBVA 1DKWA 1GNXA 4P7QA 4F2UA 1J8VA 4HNVA 3N9RA 3AIWA 4XBSA 2BY2A 2V5DA 3LCLA 4HMEA 3AHXA 1WPCA 1W5NA 1UUMA 2GVLA 1JNEA 1A5AA 2J47A 1H11A 3MZNA 1BWVA 3TNBA 3G3MA 1DWAM 4IJBA 2EJ1A 4IT1A 2G97A 2ZXAA 3PP7A 4NUWA 1K8CA 2PDPA 2CLKA 2RGMA 3W3OA 3PJXA 1NFPA 3BW3A 2QGHA 2WNNA 3PWIA 2Y8VA 3UWZA 1OGGA 2ACUA 3EDEA 5A8GA 3P67A 4AEEA 4DAFA 1D8WA 2EPNA 2UY2A 5A2CA 4C1LA 2YL8A 3SY8A 3L9CA 4NI8A 1HUVA 1N8WA 2ZVRA 4Y9MA 3V75A 3STGA 4L4LA 1Z3NA 3KBWA 3LUTA 4XD6A 1PO9A 1LYXA 1FH7A 3QR0A 4JTCA 1ZGDA 3U4AA 1M9HA 1LRNA 3H2OA 1M7PA 4E8GA 3WK0A 3H70A 1GOQA 3ZT5A 4FNSA 4RW3A 3QV6A 3GXIA 3D3FA 1OF6A 4ZOCA 3HG2A 4CU7A 1D9EA 2WOQA 5ENLA 2VI0A 4AY7A 3PULA 4GZIA 3ES7A 4F0KA 3LPGA 3UWYA 3DX5A 3O0FA 5C0QA 4XAFA 4S39A 1B4KA 2QMJA 4MIMA 3U2CA 1XCWA 1UWIA 1NAL1 4RPQA 4U5IA 5JIWA 1XLCA 4QG6A 1QWKA 1MQQA 4B90A 4GVHA 3F5LA 3W83A 1AZ2A 2QCCA 4HBKA 1XYCA 1JJKA 2DSUA 3KCJA 2GQAA 3H4WA 3UXIA 4US5A 4GZJA 4P2VA 5DO8A 1YNYA 1U1JA 2VFHA 2PF0A 4UQCA 5JBDA 4O53A 1E43A 3CU2A 4GQBA 4HB7A 4OT7A 3EWBX 1K1DA 2PGFA 2AQWA 2W61A 1CENA 4H6RA 5HDRA 1F3XA 3P62A 1R46A 4GXMA 1IEIA 1UQYA 2Y6ZA 3IARA 3K46A 4UOQA 4NZ4A 3AZTA 5B7ZA 5I3DA 4HIBA 1MDLA 1ZLPA 5C9RA 1T0OA 4J3VA 4LB4A 4TUFA 3N12A 4WKAA 1OZMA 4FB7A 4XBKA 2YCEA 4IL2A 1JFHA 3ECQA 1BYAA 5I0DA 4NASA 1KTCA 1NWTA 5JXQA 1JZ5A 3DFNA 1DWHM 1EJSC 4HU8A 2WYSA 3L66A 3WELA 1XLEA 3VKJA 3ANVA 1KV8A 4IQEA 2GUYA 2C91A 3HGRA 4M80A 1GEQA 3B4UA 1C8XA 3QQWA 2VUNA 5G1YA 1ODZA 4YU1A 1AFSA 3LGEA 4YVPA 3GC4A 4IPNB 3PG8A 1YDOA 2G4JA 1UD4A 1IT7A 3N14A 3I6RA 3QC3A 3REQA 3HG4A 3GLCA 4IGNA 4AIOA 4D6HA 5FEXA 3MJMA 4WDUA 3UXLA 3CZ8A 4XD5A 2DSVA 2V68A 4YMZA 3DN5A 2VR2A 4H9UA 1RA5A 3WQGA 4DZIA 3KVJA 1V6WA 3AMCA 3PF3A 1XSJA 3W7KA 4MJZA 4IPJA 1XCFA 4YPJA 2PWHA 3GZ3A 5HULA 8XIMA 3H2AA 4WCJA 2WSRA 1XYFA 5D9NA 4DEFA 2W27A 5M03A 4ECLA 4AC7C 4K39A 3FJ6A 4MWAB 1R2SA 4ROQA 3QW3A 4EWJA 4M0XA 4MYAA 3M1ZA 4C6EA 3CAQA 5BRQA 1HVQA 1BRLA 3LGGA 2HSAA 3RFAA 2Z26A 2ZRYA 2I14A 1E56A 1XWYA 1UPPA 4JX5A 1G67A 1JPKA 4JFVA 1NH6A 3N2XA 1ECEA 1J0HA 1YXDA 2Y89A 2ZE0A 2FGBA 1V3KA 1OF8A 3WL1A 2WLZA 4JBRA 1JD9A 3K2GA 3BICA 3HGJA 4PULA 1QPOA 3GXFA 3MO7A 5CH9A 1DORA 1R7AA 3BAXA 3HN3A 4AZBA 4E38A 1UH3A 1EBGA 3WF2A 1Z41A 3VM7A 4X2RA 4UTFA 1UD8A 3BPWA 1C9DA 2GGGA 4MLJA 2ZXQA 3W7NA 1DXFA 4PTNA 3IIOA 2D73A 3AYRA 3S1XA 1FDJA 2MANA 1VGAA 1XR2A 4N6EA 4MPQA 1KWKA 2WANA 3IVUA 4TOQA 4UQAA 1NQKA 3GH7A 3W01A 3MT1A 1N8IA 2B31A 3LZ3A 4JHZA 4LS1A 1O5QA 1H51A 4GOAA 5T9BG 3IK2A 4LCSA 4QNWA 4EPDC 1SFLA 3GW3A 4Q3MA 3VDHA 2NXHA 4IXHA 3VGFA 4HJFA 3ALFA 4GI6A 5FJTA 1K70A 4UZUA 4JTSA 2WM0A 2XH0A 3DI1A 4F40A 1A0EA 1D8CA 4AZ5A 3WMLA 4U4MA 3DENA 3SZ8A 1JXKA 5C54A 1V6XA 2CLHA 1XPYA 1PVNA 2Q8XA 3LY0A 3E96A 4FXRA 2J77A 3PVFA 4C6FA 1XF0A 2PWEA 4N9BA 4BWLC 3NSNA 1TJPA 1OFBA 3WF0A 3W0KA 1UD5A 1J5SA 5HMFA 4C6QA 2CPUA 1H50A 1A50A 3S2JA 4XD3A 2IUZA 4WXZA 1OK6A 2W63A 2UY4A 3TMLA 1S2VA 3BAJA 4ZQPA 3GKAA 3LMYA 1AQFA 3WLQA 3C2VA 4D71A 3P60A 4LYRA 1QBBA 3FN9A 2YW4A 4PMUA 4GPNA 2EPHA 3WDQA 3KAOA 3IUDA 1LROA 1VS1A 2O9TA 3LCXA 1XFCA 2NLIA 3QSTA 2GYIA 2J7CA 3NZPA 3PAJA 5FF3A 3W1RA 4GI9A 4EKJA 4K68A 3IVTA 1TKKA 2WK2A 2OX1A 3AWNA 3TYUA 1AJ2A 1VKFA 4FK9A 1AD1A 3GD6A 2A3HA 3K5XA 4GACA 4DZAA 2Z24A 3DOPA 1JYWA 3HTWA 4NAFA 3VIGA 3N1AA 5ECVA 3A3XA 4GY1A 4XZIA 2BVWA 4MNLA 2C16A 1RQHA 3RAOA 3IJ9A 3H2FA 1VH7A 4HTBA 1R2RA 2DIKA 3ORWA 1NP0A 2AL2B 2NWRA 3EOEA 5H2ZA 3W1QA 2I9UA 1A5KC 3S1UA 2QVNA 3H54A 3H7UA 3WLHA 4Q7IA 1IEQA 1MFVA 4TXEA 2ZX8A 2CLIA 1XGZA 1F76A 2CBUA 3EX1A 5A2AA 1E15A 1SZNA 4LVGA 2G4FA 1C91A 4J3XA 1R3RA 4R5EA 5H8MA 3ZVHB 3UPBA 2X42A 1HJSA 4NNCA 2E77A 4KWSA 1EHAA 1EBHA 2OWXA 2VELA 2EG7A 4C6PA 1J6PA 3UT0A 3IGXA 3NQAA 3WQFA 4DBUA 3PZQA 4ZL1A 1CB2A 4MF4A 3C8NA 4H41A 4CD7A 5DLCA 2VGBA 4QHRA 2CHNA 4MB1A 2AQOA 2AGKA 4HSNA 4TU1A 3SCUA 4PEEA 1ECQA 3HZ3A 1J9YA 1MZRA 1H2JA 1AH3A 3C2OA 2X2YA 5D33A 1FWRA 1UH4A 3UXKA 3PR2A 1KRBC 5H91A 5C55A 1QNRA 2I57A 3G8EA 2XUCA 3UNDA 5I78A 3MCNA 4PC8A 3SRHA 1W8GA 2FVKA 2XINA 4X9SA 3MW7A 1THFD 3OIHA 2VDGA 1PYMA 2ZZ4A 3CUIA 5B80A 3GVGA 3WJXA 3MA8A 2DEPA 2PSNA 3K1GA 3GVVA 4HN8A 4AUBA 1QHPA 2WWCA 3KXQA 1WZMA 3TP4A 1LL6A 4GI8A 3NOYA 4KERA 3O1NA 1QI5A 3FA4A 4OGZA 3L4XA 3CHFA 1YXYA 1HX0A 1DJYA 3M0LA 1K6WA 4JTGA 5I3IA 3RNDA 3QN3A 1Q2SA 3RHGA 1XRTA 3F4DA 1V0NA 3EXRA 3G77A 1OINA 1X8CA 2QPXA 4FXJA 3KTCA 1CX9A 2OYKA 1MEWA 4M1RA 5HMSA 3GFXA 1MVYA 4TR9A 1A49A 1EYWA 3VC6A 3AMDA 1CGTA 1VB9A 1JRCA 4QS5A 3SI9A 3B8DA 1G1YA 4JQ3A 5FF2A 2A0NA 3C2FA 1LORA 3W7EA 3WQPA 2WBKA 1XUUA 3CUZA 3S47A 1R9YA 1GOKA 1WDQA 3DFSA 4DO6A 1WKFA 2A7RA 1GYLA 4NX5A 3W07A 4CCDA 5E6ZA 4X22A 1GOWA 2ZUSA 4ENLA 4HCDA 2D23A 4XTDA 3ZR5A 5CAHA 4QG9A 3GDRA 3ALGA 4UTMA 1A5MC 4Z2GA 1IR2A 2I17A 1A5BA 4D1JA 2GDVA 2FH6A 3W7RA 4HSHA 4S3JA 2OTDA 3L12A 4PMOA 1KM3A 3BH4A 2VEGA 4Q4KA 5IFPA 2POTA 1JUBA 2BVYA 4URIA 4ZFMA 3MZ2A 5BU9A 4BY3A 3F4CA 4FOKA 3IVSA 4RKAA 2BMBA 1LRQA 3UQNA 5EPDA 3B8TA 2Y88A 3GTNA 1JCXA 3AQUA 2ESCA 1T8XA 3TSBA 4PTMA 1A47A 4EIVA 3LGDA 1HVXA 4OECA 3TROA 3A4AA 2D22A 3IK4A 1M04A 1TUXA 5M2FX 2YL5A 4HZ8A 5C9ZA 4WRHA 3CEUA 3MDUA 3WLSA 2V3DA 4LVBA 4PTXA 4DX3A 1O95A 1RALA 1S46A 2W92A 3H21A 1QJWA 3SEPA 2I7GA 5DBUA 3A24A 4UC5A 3ZR4A 2XTKA 4C6CA 3RK8A 2V3FA 3CASA 1TVNA 1W5OA 4UFIA 2FZNA 3HB9A 1MZHA 1RP9A 2GJLA 3N3TA 3TFXA 4PL1A 4NRSA 2V5JA 4XVDA 3V1PA 3VKAA 4V28A 1VFOA 1Q6OA 1UWUA 3UP8A 1H7OA 4LTSA 4U5KA 1F8MA 4J4KA 5IM51 1S1RA 4GYFA 1YPFA 3DHUA 1UWTA 3M0VA 5BZAA 3GKFA 2YR1A 3MI6A 2RUSA 1YDYA 3RXZA 1UKOA 3TR9A 4DF1A 2OWCA 4Z2JA 1PCKA 1L6GA 3MUY1 4GG9A 4GKTA 4EWND 2J4GA 3RR4A 5K4ZA 1OG0A 3WX7A 3TFCA 3AS2A 1X6UA 3HJZA 2AL2A 3QHOA 2YFOA 5D32A 4GCXA 1LP6A 1DWIM 4JFUA 3DECA 5CAKA 3TYCA 3SY1A 1QPRA 2XDFA 4GZ7A 4PMNA 3VIKA 3DCPA 2NQJA 2BGSA 2GL5A 5EY5A 4UBPC 1CXIA 3IJQA 1Q85A 2FZ9A 3AHYA 3GU9A 3THCA 1V79A 3IS4A 3N18A 2GPTA 1PIGA 4UMCA 1EH9A 2YKKA 3TQ0A 3W53A 3KEHA 1W3NA 1XQKA 3ZVHA 1PDYA 4MZ1A 3N2TA 1OFAA 1KCLA 4QLKA 5I3GA 2HISA 2QUNA 2QUMA 1V7YA 5AHMA 1OX6A 1GVEA 3QF0A 2GUBA 4IP4A 2PEVA 3AU6A 4TMCA 5E9AA 4LYPA 1MXDA 1C90A 3K13A 1BG9A 3SRKA 4DYEA 4BHYA 1LOQA 2D1ZA 3HQ1A 3SR7A 3PHAA 3W2UA 4LBUA 4DWSC 1G0CA 1H5VA 1NOFA 1BQCA 4IUOA 3HQNA 1WDDA 3ZXWA 3W7JA 2PDMA 3BV4A 5CC7A 4WEVX 3S6TA 1M65A 2O7SA 1Q7QA 2REQB 3AJ7A 1HIZA 1W1ZA 4IHCA 1T41A 4PRRA 4PUUA 1WDWA 3T0TA 4NZ5A 4I7UA 1QI3A 3R13A 5CZ0A 1CCWB 3PPGA 4R53A 1F6YA 3W25A 3PB2A 4ZCWA 4PB4A 1KQYA 5KZ6A 3RM4A 1GPWA 2J7BA 4P7RA 1GKRA 2ZICA 4UFHA 3IJ6A 2WSKA 3GY1A 3LNPA 3M64A 3BCDA 3VGEA 3S5OA 3UG8A 2VC5A 2WB5A 1PTAA 2QF8A 2QR6A 1Y0EA 1L6YA 3E0VA 1FH9A 1OADA 2PWGA 1W37A 4KT2A 2SFPA 1FFQA 4H9ZA 4UZSA 4X60A 1B3ZA 3GDTA 2XGBA 3KTXA 5CPNA 3D6NA 1QWGA 4L4MA 3ZT7A 2HS6A 2B81A 5HOSA 4L4OA 5KINA 4OBRA 1J12A 1OGBA 4I6VA 3L68A 3WIJA 3DI0A 4H8HA 4S3CA 3TTQA 1OX5A 2ISSA 2ATMA 5L6UA 4AG0A 3C61A 5DXYA 1S2AA 4QE5A 2P3EA 2VRJA 3VCRA 4QTGA 2NQ9A 1GVYA 1IT0A 3GNOA 4MFEA 1EFZA 3H12A 4FEZA 3HMJG 1R3SA 4PODA 3LCHA 3MO4A 2BTMA 3MMUA 2Z1BA 3Q94A 1TYGA 4BKNA 4WY0A 2YCIX 4RR4A 1SO5A 1H1NA 1JFXA 1QNVA 4ROPA 3T40A 1XD1A 2EAWA 3FV9A 3APGA 3XIMA 4M29A 1S5NA 3FAWA 3P6LA 5AKQA 3TAKA 1F3EA 4GUIA 1QDSA 5AVNA 3UZXA 2V81A 4PTDA 3VIJA 4GYPA 2X1UA 2DFAA 5I77A 2Q8ZA 4QG8A 3DERA 4EK7A 1JQVA 1YW1A 4PYSA 1Z44A 3MQTA 5CZKA 1VFMA 3UJSA 3KUMA 4ZQRA 1TPC1 3IWPA 3VA8A 1XYZA 3TTEA 3ZWSA 4L1WA 3R8RA 4G6CA 4RE3A 4S2CA 2YBTA 4REQB 4S3GA 3SCWA 4XAGA 1AQHA 3B9OA 2W9MA 2VR4A 2PDUA 3UPWA 3ITLA 2HBVA 1Q4NX 3MSYA 3BCJA 3VNIA 3W1XA 2I5GA 2ZDSA 3VDAA 1LL4A 4GYKA 4Z2KA 1FOBA 2IQ0A 1GQLA 1DOSA 2ABAA 2WHMA 3U6WA 2X41A 4Z1YA 4XX6A 1SU5A 1KLZA 2DSWA 3WFZA 2PDQA 2C1IA 3FFSA 4R34A 2XIIA 3CZGA 4ICNA 4KFNA 3U48A 2XM1A 3V0TA 4CD6A 3M6DA 2FTYA 3WBAA 1BFNA 4EPEC 2QCMA 4DLFA 4HHHA 4NNBA 3NQFA 3QFEA 3BZJA 3GNXA 3B9DA 5F1UA 4Q8TA 1H7XA 1K3UA 1SQ7A 3SUTA 3RUBL 1G5AA 9CGTA 2A5HA 4GX8A 4BCEA 1CLKA 4Z2LA 3TZNA 3C4UA 3NZRA 1QO2A 3SDOA 4NZ1A 2XGIA 2ZX7A 1XPGA 3OLGA 1U1UA 2XG9A 2XSAA 4F0LA 4JIEA 4NKCA 3AS3A 3LK6A 3OODA 4JOMA 1UJQA 2A7NA 5RUBA 3TE9A 2EBNA 1UR8A 4GLEA 3QYSA 1T99A 4LEFA 4C6MA 4BZYA 2A3BA 1ZS2A 2YL6A 5CPTA 1RP8A 1YTDA 3USBA 3GG1A 4DJFD 4PMQA 2NW0A 2GDQA 2GJNA 5TBOA 1FH8A 4DY1A 3WF1A 5D02A 3D46A 5LSMA 3ELFA 1EXPA 3KS5A 2YCLB 1CTNA 2ZQ0A 4DBWA 3QOMA 1V6UA 4DBDA 3GUGA 1IZCA 3TN5A 5BWFA 2YA1A 1TCDA 2PWUA 3SFWA 3ITGA 3EZ4A 3T42A 3IUHA 3VZZA 4R85A 5F4XA 2W66A 1DIEA 2OQYA 1S2TA 5FCZA 5LGZA 3DYPA 3MDWA 4RNHA 1CZ1A 1EHNA 3LCIA 4JGDA 4LUJA 1EB3A 3PJWA 1AMKA 3WQWA 4FNUA 3O9NA 2NV9A 3MKVA 4QROA 3VOIA 1Q6DA 1J96A 5J5DA 4HNUA 4Q32A 2PDWA 3HM7A 1LWHA 2REQA 1D3CA 1K9FA 4HA3A 4JKKA 4JIQA 1V8EA 3NOEA 4LC6A 2VGGA 4PH6A 1LBLA 4WX2A 4R7JA 4UOJA 2NVCA 3THAA 2NV2A 3MPGA 1VBJA 1NY1A 3RPTA 2V5BA 1IEVA 4M5PA 4S3FA 3SFKA 4RNJA 4NNAA 3BMWA 4NT0A 1ADOA 1CI1A 2CKSA 1XIMA 4Q4QA 4IICA 2DIJA 3ITYA 3UWQA 5K3VA 3N2CA 2R9RA 2CZFA 1ZAIA 3LDVA 3T2OA 1J93A 4IQDA 3UU0A 4GX9A 7TAAA 4AWEA 1KWGA 4PTVA 1VF8A 5CBJA 1HJVA 5GPRA 4HYWA 4IQLA 5A6TC 1V02A 3TQPA 4IISA 2WWDA 3BSGA 3P7YA 4XUGA 2PS2A 3OZPA 3FVMA 3VDCA 2XFRA 1AJ0A 1NU5A 3R43A 1CGWA 1WXYA 3I7QA 4JY8A 4N42A 1S5WA 1XBVA 5LXEA 4J3SA 1XBYA 4XSLA 3OTRA 3ONCA 2OGJA 3ABRA 3VZXA 2JKPA 3GSMA 2PC4A 2VXNA 4HPNA 3UZ5A 2CBVA 3VFLA 2ZRUA 1L6WA 2DT2A 5I24A 5LIXX 4HNNA 2X1TA 3ZLGA 3DFTA 3S2NA 2AKMA 2NX3A 1VENA 1GKPA 3B8SA 3H4GA 5A6BD 4MADA 4RNIA 1KCXA 3LI1A 3RF9A 4D8AA 4LAOA 1TUFA 1UZ1A 4Y9AA 4O1BA 5FSEC 3PBGA 4O1CA 3NQBA 2DW6A 1MNSA 4YS1A 1MUMA 5HNUA 3SSJA 3AMKA 1V6VA 4KKXA 4HU0A 4NL1A 4XV0A 1TR1A 4S3DA 5C7HA 1DIDA 4JIPA 3RCNA 3T6CA 3AXKA 4NG3A 3ZLFA 1O60A 5GNXA 5I79A 3GB6A 1WCGA 4REQA 1SM9A 1YHTA 4DJED 2A3LA 1FWCC 2C6QA 2NXIA 3VIPA 4JIIX 1MFUA 1UOZA 4NZFA 5HXMA 1X6NA 5LNRA 4ZSTA 2YPIA