3PZGA

I222 crystal form of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila
molecule tags Hydrolase
total genus 155
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzgA00
3ARXA 4M8UA 4UTFA 2WWDA 2X8RA 2W67A 4M56A 3WH8A 2XSBA 4KRUA 4YHGA 1OGSA 4WF7A 4PMDA 3A6OA 3UETA 3GNPA 1HJQA 4P8UA 2CBVA 4D6GA 1UWQA 2XFFA 4GINA 9CGTA 2GVYA 4QLKA 3VIMA 1VAHA 3ZJ7A 2DQXA 2XGIA 4AC1X 3N17A 3NSNA 1W9PA 4GO8A 1A47A 3RJXA 2VT0A 3PZGA 1UWUA 5HXMA 4LPCA 5ABFB 3W25A 1W2PA 1SYTA 1ZJAA 2WZHA 5A8MA 4B9YA 2GSJA 1B9ZA 1RP9A 5HPOA 1O7AA 4QCFA 3WFLA 1J0KA 1DWGM 1LL4A 3EDKA 2E3ZA 3U57A 3GTNA 1E55A 4YN5A 1XSKA 3M07A 3WQ5A 3CZEA 2XTKA 1JYNA 3A4XA 4Z2HA 1EOMA 3T0BA 4FLSA 4HMDA 5JIPA 3A3HA 3T0DA 4GIAA 2XM1A 4PYSA 2DSZA 3SCWA 3WDQA 1F4AA 1W3LA 3GXIA 2YA2A 5GNZA 1CXEA 4AZBA 1HP4A 4LYPA 3AHXA 3EDFA 3OIHA 3MS8A 3FN9A 8CGTA 4EANA 4HTYA 4XZWA 3SIMA 4IM4A 3OA5A 1UWTA 4MJ4A 3KE0A 2WHLA 5BXTA 2WCSA 4WIWA 2WMJA 3L2LA 3WNMA 5IHSA 1UOKA 2ZX5A 1KBKA 3WDPP 2J7GA 5DFAA 1WDPA 5C71A 5BROA 3GNOA 4BQ4A 1LJYA 2HVMA 2ZXBA 3WSUA 1C3FA 3WL1A 2BVTA 2J25A 5CPSA 5JBFA 1EA9C 1W1TA 2YL6A 2Z1KA 4OBRA 2CESA 2ZOXA 3WNPA 1J9YA 4DWSA 1BQCA 4CD4A 2YBTA 4JIEA 4YHEA 5FL0A 4BS0A 2XYLA 3AMDA 4GI8A 1JZ3A 1UQYA 2V38A 2ZUTA 2ZIDA 1C8QA 2DSKA 3LPOA 1AQ0A 1BFNA 4BQ5A 4QLLA 4M24A 4GZIA 2EPOA 2DGAA 3EDDA 5M17A 2CKSA 1JYXA 1E4MM 2DH2A 4MNJA 3HU7A 3MV01 2EPNA 1KGXA 1CYGA 3KL0A 3W0KA 4GXPA 2CPUA 1BYDA 2DSUA 5ABEA 1TR1A 2WK2A 5CQ1A 4BCEA 3UCQA 3SCOA 4UQ9A 1BSIA 2EBNA 2JALA 2XVLA 4JCLA 3RM8A 1MYRA 1GOIA 3T09A 2A3AA 5HNNA 3K4AA 3VUPA 2X05A 1FP8A 4P7RA 3VX0A 1GOOA 2HISA 2ZWZA 4UFHA 5ABFA 2VJXA 2X09A 5I24A 1W3KA 4F9DA 3BMWA 1QPKA 1JZ4A 3MANA 4U2ZA 1AVAA 3WQ8A 5IDIA 2VR4A 2VZUA 4UQAA 3AICA 3MSDA 3GNRA 3QHMA 2WMHA 1TG7A 2CCRA 1BPLB 2BY1A 1OGBA 1QI3A 1KXVA 1OB0A 3UG5A 5A6MA 1TMQA 2X2YA 1HF6A 1AQHA 4FMVA 1CIUA 4FK9A 1E56A 4C7GA 1WKYA 1L8NA 4J28A 3AZRA 3I3EA 2XIIA 3OBAA 3MO4A 2WHJA 5M03A 3OB8A 2JEQA 3ZMRA 1UKQA 1BG9A 1GQLA 4IUGA 1V3IA 3WUEA 3TTOA 1OD0A 3GYCA 4CGTA 2VUYA 5A2CA 4MB4A 2BY0A 3RDKA 1CECA 1W32A 5BXRA 1CLVA 2OYMA 3S2CA 2CETA 3VNYA 5A8OA 5ECUA 1XHGA 1G01A 4RE4A 3SCNA 3FY1A 4AYSA 4H8UA 2YL5A 1JYVA 1DTUA 2GDUA 2WB5A 3AIVA 3DYOA 2WXDM 4JZ5A 4MAZA 2FGZA 1HKJA 2J62A 2ZUNA 3CHDA 1W1PA 1MQQA 3AIEA 4UOZA 4L4PA 3BLKA 2EPKX 3ZT5A 4AY1A 1CGUA 4M82A 3PTQA 2AOSA 2WVSA 4ZENA 4DWSD 3WF2A 5I3DA 4PTWA 4TTUA 3T0AA 4ZFMA 1VFMA 4B15A 1W91A 3I3DA 3UR7A 1E72M 5GNYA 4LXFA 2XGBA 2UY4A 1GVYA 4FLOA 1MFVA 3SUVA 1UR2A 3CUHA 3RPMA 3CHFA 1E4IA 2CITA 2BHZA 4ML4A 3AHYA 3RMEA 3K1DA 2YA0A 2PBGA 3WH5A 3WD1A 2YDQA 1W9BM 4M29A 4W7UA 2XFRA 3VGBA 3RO8A 2IUZA 1Q6FA 3BSHA 3T2OA 1UKTA 2WWCA 3VDAA 4AD4A 4XV0A 3BCFA 2CKRA 1UA3A 2DSWA 1KR1A 3G6LA 3VO0A 4HZ6A 3CBWA 1TA3A 3OZPA 3CZKA 3F5LA 1K9EA 1NOWA 1ISXA 1B90A 1ZJBA 4KRTA 4ZE5A 1VB9A 1VEMA 1JZ6A 4HMEA 1UKOA 1WAWA 2F61A 1ZBWA 3FXYA 1B31A 3VIIA 4PMXA 1H41A 4QDMA 5D9MA 4DUXA 5I2UA 2A3CA 1DWHM 1C8YA 3B9EA 4NI3A 2UY3A 3NSXA 4CD6A 3GBEA 4CD7A 2WKGA 2CNCA 1QHOA 1JFHA 1E15A 3I3BA 5EB8A 4HOWA 2WC7A 2XWDA 2G4FA 3VMNA 4XUYA 1J0JA 3WNNA 3W4RA 1H09A 1KQZA 3BGAA 3W29A 1B3VA 2XPKA 1F4HA 1M01A 3VDCA 3WH9A 3WQ4A 3DECA 1MQRA 3O6AA 1KBBA 3DHPA 3D5HA 1VEOA 3BSGA 2CBUA 4P7QA 1US2A 1JGIA 1W1YA 4MB1A 1QBBA 2CHNA 2YIHA 3LMYA 4JKMA 2BV9A 3VIOA 4JKLA 4AZ7A 2J79A 2DEPA 4JKKA 3TOPA 3VD4A 2BHYA 4B3LA 3OLGA 5LA2A 2XVKA 1QI2A 4UOQA 5A2AA 2D24A 1C91A 4A3HA 3TTQA 3FNDA 5FOOA 3NUKA 2E9LA 1XD1A 2VL4A 3AMCA 4JCMA 2CBJA 4HMCA 3WQWA 3L4XA 1HIZA 3AMGA 5CSYA 3PZUA 3B9AA 1DWFM 3FHAA 1QNOA 2WMFA 1PBGA 2VRJA 1IZKA 1VRXA 2WSPA 2J7BA 4WKAA 1EO7A 3ARTA 1Q4NX 2AMGA 2PI6A 3CUFA 4RL3A 3RJYA 2VR5A 1H4PA 3L4WA 2UWFA 4J7RA 3UERA 1M03A 4AZCB 5CPTA 1KCKA 4GKLA 2OLHA 2E8ZA 3EYPA 1GONA 1NP0A 3WUBA 5DF0A 3VVGA 3G6MA 4NF7A 2B31A 3RM4A 1UR9A 3UG3A 3HJEA 1EXPA 4J3UA 1CZ1A 1MW0A 4AEFA 3OG2A 2D0GA 3PZOA 2QMKA 5BWFA 3VDHA 2XIBA 1KGWA 1UH4A 4J3SA 3W24A 2WM0A 2W66A 1HNYA 4GQQA 4H41A 4CN1A 2XVNA 5A1AA 1SR0A 3BC9A 4OUEA 5A3HA 3GDBA 4W8BA 1E4LA 1PJ9A 4ATLA 2NT1A 2O9TA 4PMYA 2Q8XA 4W5UA 2WAGA 3CMGA 2WVTA 2O9RA 3UESA 2O9OA 2WMIB 3EBVA 1BVNP 2A3EA 4HOZA 3SCPA 1GZJA 1NOFA 3APGA 1MQPA 4CU6A 1I1WA 1W3HA 5CXPA 1EHNA 1B2YA 2BNJA 4E4PA 5JBEA 3SCSA 2WPGA 2A3BA 2J8FA 2OYKA 5LA0A 3POCA 4TX6A 1X6NA 1J11A 2J7CA 3QOKA 4PTXA 1CXLA 2YBUA 3L4VA 1V08A 1XH1A 3VD7A 2WVUA 4JFSA 3AIQA 2JEPA 3WY1A 1H3GA 4W8LA 1ZU8A 7A3HA 1YQ2A 3GH7A 3IJ9A 3A47A 3N15A 1S46A 4AWEA 3AS0A 3ZOAA 2ZX8A 1KB3A 1TE1A 5EBAA 2G3JA 1OIFA 1E3ZA 4B16A 1NH6A 1DWIM 1MW3A 4P8VA 1IT0A 3VIPA 3ZR5A 2WZIA 4MADA 3WL0A 5HDRA 1FP9A 3WFZA 5EFFA 1MXDA 1VFOA 3ZIZA 4UQEA 1E4NA 2GK1B 4PMNA 3VU2A 1JDAA 3IANA 2BS9A 4DUVA 2FH6A 1Z32X 1JZ7A 1HX0A 4J3VA 4F8XA 1ODUA 2JIEA 1G5AA 1ZS2A 2XFYA 1ITCA 1FH7A 1H49A 4IPLA 3BAXA 4Y7EA 2W91A 3AIWA 2X0YA 1B0IA 5D8ZA 3ECQA 4MB3A 2WCGA 3WDJA 2CERA 1CGWA 4HA3A 2J4GA 2FHBA 3WD0A 1OINA 4MJ2A 3FAXA 2WMKA 5I77A 1HJVA 1JXKA 4AZCA 2BFGA 5I0DA 3OZOA 2J75A 5FIPA 3CUIA 3ARQA 5C70A 1E6QM 3VPLA 4PMUA 4PMOA 2QPUA 3EMQA 1LG2A 1XH2A 1V02A 5AY7A 2BXZA 1UD5A 3AMLA 1TVPA 3VD5A 1JZ5A 1HVXA 1HJXA 4TUFA 1B3YA 1GOMA 5E0FA 6TAAA 1HL8A 1NWRA 2IXVA 1NQ6A 2O92A 1QBAA 4D6DA 1W9DM 2BHUA 4AEEA 1MW1A 4UFIA 2OWXA 1LG1A 3NJ3A 3VGEA 3AZTA 2WMIA 1V03A 1OGGA 2IXUA 4B9ZA 4CU7A 4DM1A 5ABHA 3NSMA 5C8BB 1W3JA 4AMCA 4NRSA 3VDBA 2YL9A 3FAWA 3SUUA 1BHGA 4FF5A 1OD8A 2JIWA 1ISZA 2BVYA 2YL8A 3KZSA 4H8VA 1UD2A 2CYGA 2JE8A 4M80A 3VMPA 3DYPA 2D0FA 4AW7A 4W89A 5A6KA 1WB0A 1D3CA 1NM9A 2V3EA 1E5JA 2WCAA 3SCVA 1CXHA 1E0WA 2Y2WA 4OKDA 5BXSA 1M7XA 4PTVA 2W5FA 3ARUA 1ISWA 4GZEA 4UR9A 1ZBVA 4U5KA 2VQUA 1WDSA 3N11A 2VVNA 4LYRA 1PIFA 3TP4A 3SCQA 4J3TA 2GK1A 3PBGA 3CGTA 4MAVA 1BYAA 1E6RA 1JF5A 1HKKA 2QPSA 1ITXA 3WNOA 2WMGA 2UY2A 2E8YA 4PMQA 3WH7A 5A6SA 1PZ2A 1UH3A 1HKMA 3NDYA 1ECEA 5CGTA 3LPFA 2Y24A 1CXFA 1Y7VA 1MFUA 1UR8A 1OSEA 1QI4A 2E0PA 2XHYA 1KXQA 3U5UA 4W7WA 2VVSA 2EPLX 4P7NA 4D6JA 1JAKA 2W61A 2QV4A 3VM5A 2GJXB 1GUVA 3AROA 3UR8A 4CCEA 3ZM8A 2E40A 3EDEA 1B30A 1QNPA 4UQDA 4U31A 2D22A 1V6XA 2J47A 3KL3A 4PEEA 4ZXLA 1OCQA 4ZE4A 3WNLA 1GOQA 1V6VA 3WEOA 1G94A 1B3WA 1UZ4A 3NDZA 3NYDA 1AMYA 1E1EA 3W82A 3CZLA 2VX6A 1WO2A 4PTMA 2WLZA 1PX3A 4KWUA 3IJ8A 2ZUVA 1UKSA 3WUGA 3MUIA 2WW5A 2YDRA 1ODZA 3VIFA 3M46A 1UD3A 3EMZA 1E1FA 5TD4A 3N04A 3QHNA 2V5CA 3BAIA 3CO4A 3CZJA 4MB5A 1RD6A 3WKZA 1UD6A 1JIBA 2CHOA 5A6AA 3VMOA 1JD7A 1XYZA 3WDIA 1GVIA 4OJYA 2EPMX 4CD8A 5D9PA 1P6WA 4J27A 2Y8KA 1KGUA 4OOZA 1DP0A 4AIUA 4BA0A 1D2KA 1E70M 3OGRA 5DT7A 3OGVA 3WD3A 5D8WA 5CJ5A 1N82A 1JXJA 2QMJA 1SMAA 5E09A 4MDOA 1LF1A 1E6XM 1I1XA 1XD0A 2V3DA 2FGLA 3WDHA 3VGHA 1FA2A 3TA9A 4W86A 1TFVA 4PBGA 1JDDA 2YDSA 4RE2A 4W87A 4H8HA 4L4OA 1G1YA 5A6LA 5DEZA 2VRQA 4NRRA 5A6JA 2DT2A 1PX8A 1HKIA 1WP6A 4J3XA 3K8KA 1WCGA 3VD9A 4Q7NA 4MTVA 4Z2KA 1W9XA 3OLDA 2WYSA 2WC3A 2D2OA 5E0CA 1V0MA 2E9BA 4B3KA 1ZL1A 5M3WA 1CWYA 4CKQA 2VX4A 1KR0A 1ISVA 3WF4A 1C8XA 1KFWA 3L4TA 1PPIA 2D3NA 2QHAA 1V6YA 3VM7A 4UFJA 4W88A 1ZB5A 5E9AA 3IK2A 1CXIA 3VIGA 2XG9A 1VBUA 3GH4A 1D7FA 1QNRA 5A8QA 3B9DA 2WNWA 2J74A 2YLAA 3AIRA 2VNCA 4ATDA 3A4AA 4PCTA 2J77A 2ZXQA 1XH0A 1KWKA 4JHOA 3PZVA 3U7BA 4HP5A 1Q6EA 4D6CA 4URIA 3AHTA 3THDA 3WUFA 2GJXA 1CLXA 3HN3A 2EQDA 2MANA 5FL1A 4ZXOA 3SURA 2G3IA 4P8XA 1XYFA 2WZEA 3A4WA 3MU7A 5A94A 1B1YA 4U3AA 2D20A 4BQ2A 1GOWA 3DC0A 5I78A 2Y8VA 1EO5A 4CVUA 1WE5A 1E40A 3VX1A 1OBAA 1ZBKA 3AFBA 2J7DA 2G3MA 2G8ZA 1JD9A 2V3GA 4W84A 1BG4A 1JYWA 3WF3A 3ARRA 4TX8A 3AJ7A 5DO8A 4HPHA 4F66A 3ARVA 4PUDA 1TCMA 4A3YA 1CBGA 3ZSTA 4W7VA 1E6SM 3ARPA 3AMKA 3CMJA 4UZUA 1BTCA 2ESCA 3N18A 4WSKA 1V3LA 1QHZA 2PWEA 4TVUA 3UEQA 1WPCA 3BCDA 4EE9A 3SUTA 1MXGA 4EKJA 4BZYA 4JL2A 3ZQ9A 2WKLA 3VTRA 3AQUA 1BGGA 1E6NA 1CGTA 4QAWA 5LYRA 3AXHA 1BLIA 1GQIA 4M1RA 4AD5A 3MUY1 1TZ7A 1UQZA 3AHVA 3OLIA 1WZAA 1ESWA 4UOJA 2PWFA 5A95A 5GNXA 3AYRA 1O6IA 1JL8A 2W4XA 1V0NA 1CTNA 4D1IA 3ZR6A 2XM2A 4KMQA 3WEZA 4GO9A 2OWWA 2XVPA 4UFLA 1K6AA 3BLPX 4KGLA 1HJUA 4P8WA 3DHUA 5CSUA 2VC9A 3QGVA 4GQRA 3TTSA 2FDMA 1FHLA 4PUEA 4X9YA 4AZHA 1ISYA 1QNSA 4WJXA 2V3FA 1NARA 4WSJA 3AZSA 1H5VA 3AXIA 4XZBA 1VIWA 1W2VA 5AYBA 4DUWA 1K9TA 5IXEA 2OWCA 3LPGA 4D72A 4AXNA 4PMZA 2C7FA 2A3HA 2OSWA 3E1F1 1EDGA 4D6FA 1FH9A 1HL9A 2GJRA 8A3HA 3W28A 1VJSA 1BGAA 3VNZA 4AZIA 3AISA 4PRWA 4FLQA 1UD4A 4TXEA 4YPJA 4AD2A 3WNKA 1H11A 5JBDA 1FFQA 1UR0A 1VEPA 1X1NA 4GPNA 1E43A 2XSAA 4UFMA 4U3CA 5I5RA 4UCFA 2NT0A 1PIGA 1BAGA 3N13A 3K46A 3GXMA 1DWJM 2EEXA 2VCCA 3CH9A 1UKPA 4LYQA 3IJ7A 2EO7A 4MDPA 4HPGA 3FW6A 1UG6A 2VZVA 3WELA 2TAAA 4TVCA 1AQMA 2G3NA 3O2LA 1C7TA 4OIFA 1GJUA 3W6LA 1C92A 4OZOA 4H04A 2V5DA 3CTTA 3OGSA 5CZKA 1QW9A 4C7FA 3JUGA 1DEDA 2Z1SA 1LWJA 1E3XA 5A2BA 1K9DA 3CIVA 1JI1A 3SUSA 1MWOA 4KH2A 4X0VA 1UR1A 1UD8A 5D4YA 2ZICA 1BVZA 2PF0A 1HVQA 1V6WA 3ARZA 3WN6A 4CCDA 4F9JA 3VKKA 3CHCA 2NW0A 2YA1A 3M7SA 1J01A 3AS1A 3SUWA 3S6TA 2ZE0A 1GHRA 1VJZA 1M53A 4D6EA 1R86A 1H0GA 3T2QA 4AISA 3SEPA 2DSVA 5AC4A 2ZUSA 1NWTA 2VCAA 2OSYA 4UFKA 3GM8A 1KCLA 4LX4A 1TUXA 2ZXDA 3ALFA 2YLLA 1JI2A 4S3KA 3WH6A 2ZWYA 3L4ZA 3FHQA 2WC4A 5E6ZA 1J0HA 2BY2A 5DT5A 1BYBA 2VURA 3POHA 3PHAA 3VOCA 1CDGA 1GQJA 1VF8A 1X6LA 1LWHA 3N1AA 3GBDA 4CN6A 1PEZA 1EGZA 1UYQA 1UUQA 1HJWA 4UNIA 4PSRA 4NSBA 4Z2IA 1U33A 2W63A 3WD4A 1V3MA 3W37A 2PWDA 3HMCA 4EAMA 1QW8A 4D1JA 1OT2A 4UQCA 2Y4SA 4U33A 1V02E 3ZT7A 3NIYA 3PN8A 4KGJA 4CD5A 3LPPA 3W81A 1YHTA 2CEQA 3CHEA 4QLJA 5I6SA 3VGGA 2FHFA 1HJSA 4MNLA 4CUCA 1EOKA 1FOBA 3W53A 4PMVA 1W9UA 4P7LA 5KEZA 5EFDA 3O9NA 5GQBA 3AYSA 1HP5A 1FH8A 3GZAA 4PMRA 2ZX7A 4QCEA 1UWIA 4E2OA 2ZUWA 4AZGA 1WNOA 4V28A 4NZCA 2DIJA 2E9MA 3QR3A 4K68A 2ZUMA 4HZ7A 3PZMA 4V2XA 3W26A 1ZBCA 1OIMA 3PTMA 4OOUA 1CPUA 1E0VA 3SCTA 5IFPA 1GW1A 5IFTA 1V0LA 1VFFA 3BAWA 1V3JA 2PWGA 3MV11 1H0IA 2VOTA 4HOXA 4JFWA 2EXOA 1NP2A 3WMCA 1HXJA 6A3HA 1JDCA 3D3AA 3ZJ8A 1J0IA 3VILA 2WVVB 2BVDA 3MKKA 4CU8A 1TA3B 2FH8A 3PTKA 3ARSA 5CGMA 1QOXA 3DYMA 4AD0A 1GHSA 2VZOA 4HU8A 2GJPA 1RH9A 2VX5A 3N12A 3VIKA 3WF1A 4QFUA 2RGMA 5EMYA 1VENA 2DIEA 1W1VA 2PC8A 3F4VA 3AS2A 1G9HA 1M04A 4E8CA 1H1NA 2ZX9A 2YJQA 2FHCA 3EMCA 4JFTA 4R5EA 5FCZA 4HA1A 2J7EA 2C8NA 4D71A 1RP8A 1CGYA 3ZO9A 4TVDA 4E8DA 3L4UA 1OM0A 5A8NA 4HU0A 1PZ3A 3VD3A 1WDRA 2VZTA 4Q22A 3GXFA 3AI0A 4WK9A 1EQCA 3RCNA 1VFUA 1KWGA 2ZUUA 4JAWA 4RE3A 1B3XA 1E5NA 2X0HA 5A6BA 2DT0A 2PWHA 1MVYA 1JG9A 3ZSSA 1VBRA 1JAEA 1SFSA 3ALGA 2E4TA 5BRQA 5CLTA 4DWSC 3AS3A 2VQTA 1QHPA 3AIBA 2WANA 4U5IA 3L4YA 1KXHA 1CGVA 4JFVA 1JZ2A 2WSKA 2CBIA 2J8GA 1IZJA 1A3HA 1XRVA 1EDTA 3VIHA 3QOMA 2CIPA 4ACZB 3WBAA 5FD0A 2D0HA 2XWEA 2ZX6A 2OSXA 2VRKA 4CN4A 1GORA 1GQKA 3BAYA 3IAQA 1GOKA 3UG4A 1J0YA 3II1A 1UHVA 2GFTA 3F5KA 5FKYA 2VI0A 5GPRA 6CGTA 3PZTA 3KEHA 1QNQA 1XCWA 2VCBA 4XX6A 3K8LA 3K4DA 1EQPA 5D9OA 3N9KA 4CCCA 1H2JA 4BF7A 4H2CA 5HBFA 2Y5EA 2JF7A 1E6ZA 3VINA 1WZLA 1C90A 2D23A 4R27A 1GJWA 3ARWA 4IPNB 1EIBA 1C93A 3SCRA 1UZ1A 4QP0A 4W85A 2OYLA 3ZJKA 2GUYA 3CUJA 1E71M 1XC6A 2WLYA 1LL6A 5M5DA 3BH4A 2D3LA 1CEOA 1EDQA 1WDQA 1WZMA 3ZJ6A 5HOSA 4GI6A 1WZKA 4HA4A 1V6UA 4ATWA 2W92A 1FFRA 3NCOA 4WKFA 1HT6A 7CGTA 4AZ5A 3CZGA 4GI9A 4W8AA 1GCYA 4LQ1A 4DM2A 1CXKA 4MPKA 5ABGA 4V27A 4N0RA 4ZEPA 4X0NA 2WVVA 1LL7A 4H7VA 1US3A 2QLYA 5AYIA 5F7UA 5BXPA 5KZ6A 2QF8A 2F2HA 3MUAA 1EHAA 5JIWA 2DT3A 3CZ8A 2EJ1A 3VGFA 1JZ8A 3GXDA 1LQ0A 1NWUA 3MMDA 3U5YA 3T2PA 2JF6A 4D6IA 3ZT6A 5A8PA 2BY3A 2DH3A 1R87A 2F8QA 1RPKA 4N42A 1E73M 4F79A 1R85A 5E70A 1G0CA 3WENA 4TOQA 1NWSA 4A4AA 2UY5A 3PZNA 1Q6DA 4P7OA 2YOCA 1MW2A 3TTYA 3WMSA 4PCSA 1BF2A 4UZSA 5A6BD 4ACYA 2JFEX 4PN2A 1UWSA 2X1IA 3AIUA 1XV8A 4BQ3A 1BYCA 4OBSA 4W5ZA 1B3ZA 2WBKA 5JUVA 1UR4A 4EK7A 1U30A 2PB1A 4FLRA 3W27A 2WBGA 1JFXA 3RM9A 2RGLA 2J7HA 4AIOA 1E0XA 4GZJA 1LLOA 2VZSA 3KWXA 3B8SA 3WF0A 2XUCA 5BCAA 3W6MA 4C7DA 1XSJA 3CPUA 3VGDA 1PX4A 3EDJA 2O9PA 5I79A 1DHKA 4ACZA 1K9FA 3RIKA 3PZQA 4Z2JA 2J7FA 3AHZA 1R7AA 3BMVA 5E6YA 4LGXA 4CVWA 4AD1A 5D9NA 2WHMA 2VTFA 1UA7A 2G41A 5IHRA 1UH2A 1KQYA 2YKKA 3KL5A 1U2YA 1Q6GA 2DPEA 4HZ8A 4S3JA 2C0HA 3WQ6A 7TAAA 4JHZA 4D6HA 1C7SA 3L2MA 3T08A 3WD2A 1UWRA 2VO5A 1XSIA 3WMBA 3MMWA 2CXGA 3TONA 5I23A 3WBEA 1E9LA 3J7HA 4TTGA 3PZ9A 1L0PA 2GDVA 1Q6CA 1J12A 5HPCA 5CLWA 3ARYA 2AAAA 2BXYA 3MSGA 5DMYA 4JL1A 1PAMA 1KXTA 2W62A 1EH9A 4J3WA 1J10A 1FHDA 3GH5A 3AXXA 5BRPA 1XGZA 3U7VA 3WDRA 4PSPA 3IAPA 1OWQA 2VX7A 1R7OA 4XB3A 1OT1A 2PBOA 4UQBA 1QI5A 5CPQA 1QVBA 3K8MA 3RILA 5CG0A 2XVGA 1R8LA 3MMUA 1I75A 4WLCA 2ZXAA 5BYWA 1IV8A 2VMFA 2NSXA 3THCA 3WIJA 2DT1A 1GPFA 1TVNA 1E6PA 1HN1A 3CUGA 1CENA 4M81A 1V3HA 5LA1A 4AZ6A 2XJ7A 4MNMA 1CNVA 1V0KA 1DWAM 5AC5A 1W9VA 1V3KA 3F5JA 2D1ZA 1JNDA 3M6DA 3MUZ1 4U2YA 1GNXA 5A69A 3CLWA 4AD3A 1CGXA 1JNEA 4MNKA 4DWSB 3BAKA 1NOUA 4Z2LA 3OLEA 1J18A 1J0ZA 3QHOA 4IISA 3WQVA 3VIJA 4AIEA 3SCUA 4W93A 3AOFA 1JF6A 2WHKA 1XCXA 3PZIA 4WKHA 3BAJA 3W38A 2DDXA 3BXWA 4JFUA 1QI0A 3WEMA 4Z2GA 2J78A 1SMDA
chains in the Genus database with same CATH superfamily
1P6CA 3N2MA 4GYJA 4ZQCA 4JTRA 3CTLA 3WLLA 2XSBA 4FPSA 4WF7A 1Z3NA 1TWSA 3H53A 4P8UA 2CBVA 4G6CA 3UYCA 9CGTA 3NPUA 1TVLA 3KOWA 4NY2A 2ZDRA 1FX6A 2NSOA 4C1KA 4NP7A 4AC1X 1KTNA 3EEZA 1P6BA 3MC5A 1IWAA 1A47A 2VT0A 2XISA 5T26A 1UWUA 4H00A 3ES8A 4B4FA 3FA4A 3GDKA 1SYTA 2WZHA 5AYXA 4B9YA 1QPOA 1RP9A 5HPOA 1XBXA 4KCVA 3M0YA 1PWMA 1LL4A 3OW1A 4LAUA 4YN5A 3M07A 3WQ5A 3CZEA 1EL3A 1KKOA 4YTQA 2XTKA 4XVEA 3GW3A 4Z2HA 2Y62A 4E0CA 4HHLA 4FLSA 5AFDA 3T0DA 1HO4A 4RDYA 3SCWA 5G5IA 1W3LA 4F0MA 5LIWX 1TMLA 5GNZA 2YA2A 1X7IA 4AZBA 1EP2A 1KLZA 2KX9A 1NFBA 1FWNA 1E9IA 3BVJA 3MS8A 8CGTA 2CXEA 3OA5A 4RE0A 4O16A 1YADA 4HSHA 2JK2A 1X39A 2WHLA 1EJRC 4Q4KA 1NDWA 3WNMA 3QYQA 1SQ7A 4PUUA 2PURA 4QM1A 2ZX5A 1R2TA 1KBKA 4MJMA 1DORA 4BQ4A 2HVMA 5AC7A 1TE6A 1IEWA 4YVPA 1FRBA 3LI1A 2E7FA 2J25A 4IFKA 1EA9C 2E6FA 3W87A 1UMLA 2CESA 2ZOXA 3C5QA 2XYLA 4GI8A 5CSRA 2GVJA 4L1WA 2ODOA 3HV8A 1AQ0A 4NZ1A 3QPZA 3W86A 4HNTA 3VK5A 2V69A 3CO8A 4IL0A 4KWOA 2QNEA 3W7KA 4GZIA 1GG0A 3WCZA 2EPOA 3BLDA 3IV3A 1JYXA 1CLKA 1F73A 1T0OA 4JYDA 3T05A 3GKFA 2QJJA 1KGXA 3IARA 4GJJA 4A3QA 4BCEA 2FZ8A 5CQ1A 3LV6A 3UCQA 2QUVA 4QROA 1W5OA 4NUWA 4LAMA 1EC8A 3K4AA 1FXQA 3L65A 1GOOA 1Q3NA 2O0TA 3PPCA 4WY0B 3P61A 3O05A 1OYAA 2VJXA 4XZHA 4F9DA 3BMWA 1H60A 1JZ4A 3PUOA 2UZ9A 3VKBA 4U2ZA 1FHUA 3LHTA 1AVAA 2H90A 4GJIA 4UQAA 1MRAA 3GNRA 5B7ZA 4DZIA 1PV8A 4LNYA 2BY1A 1JDEA 1QI3A 3GIQA 2EF9A 1KW1A 1TMQA 2HPMA 4GA8A 2X2YA 4WDUA 4JY8A 1Q6OA 2GJLA 3OBAA 2WHJA 3K2GA 3OB8A 1UKQA 5CZSA 3W7PA 4YCOA 4IUGA 3WUEA 1V3IA 3E0LA 2VUYA 1UPMB 5A2CA 4WSHA 3QYSA 1XLJA 1CECA 1J4EA 1H7WA 4AVNA 2PU0A 1GKPA 2JGQA 3VYLA 2ABBA 1D7KA 2QCGA 5A8GA 4QRNA 1HO1A 4RE4A 3UZJA 3AIVA 1RK6A 4JZ5A 3DEQA 1FWDC 1HKJA 2J62A 3CHDA 2Y85A 1WX0A 1FCUA 1QU4A 1R2RA 2PDWA 4GUIA 4L4PA 4C6FA 3QPEA 1HZYA 4I6KA 3BLKA 4XISA 1A49A 3PTQA 3KRSA 1SSDA 3WF2A 4MVAA 2V2HA 4L6HA 3GR7A 3KOZA 3R2GA 4RKAA 4TTUA 3LZ5A 5LKYA 4IMGA 3GHTA 3ZS4A 1XDJA 1QFEA 3IACA 1XF0A 5GNYA 1TWWA 3OYXA 1MFVA 1MEIA 4ZQMA 3GHRA 2WJEA 4LAZA 3RPMA 5I03A 4Q8VA 3CT7A 3DH7A 4ML4A 2PDGA 2G97A 1VHNA 2PBGA 3NEVA 2YDQA 1W9BM 4M29A 4FB7A 4NAEA 4M6QA 3T2OA 4G56A 4JX6A 4TMBA 1UA3A 1KR1A 3G6LA 2OZ8A 4HZ6A 3CUXA 1Q8JA 1BKHA 4A8IA 1UZHA 1I2PA 3CBWA 4MOZA 4MZ1A 4JQ3A 1LBFA 2OZ3A 1B90A 5G2IA 4L80A 3QEZA 3HF3A 3ATYA 4WXZA 4WD0A 1L6YA 3UGVA 1B31A 1JQVA 1RR2A 5CSSA 4AEOA 1DWHM 5T9BG 4I8YA 2WJFA 4XBJA 1C8YA 3SO7A 3LB0A 3RYSA 4REQB 4CD6A 4ZQOA 1XLIA 1LBMA 4ZSTA 2V82A 3WNNA 1JUKA 3APTA 1S2CA 4FP1A 1B3VA 1SFLA 1M01A 1IXQA 3H21A 4O0QA 1MQRA 3GNXA 3LBMA 3GDTA 5F1UA 3M0IA 1IT8A 3KDNA 2JQXA 3S4TA 5HWNA 2F6XA 4P7QA 3QMRA 1W1YA 3W1AA 3KZPA 3D0CA 1P43A 4R7WA 4HB7A 1T99A 3VIOA 4PL1A 1G7UA 2J79A 2DEPA 1OX4B 4EPKA 3VD4A 1TELA 2PDUA 1XG4A 4FNTA 3EOEA 4G7EA 4N6EA 2NLYA 4UOQA 3N6QA 2GUBA 2J27A 3NAVA 3TTQA 4LVGA 4LBSA 5GJMA 4Q8WA 3TOYA 3PUDA 1TPB1 2V68A 5AZ0A 3GYEA 4IPIA 3L4XA 4HNUA 1WBHA 4RUBA 6ENLA 2YZ5A 3SQLA 3GKAA 4WKAA 3FXGA 2O4MA 3G22A 2QQ6A 3CUFA 5C2CA 3UZWA 2VGBA 5C0QA 4GXWA 4DAIA 4H9YA 4KIRA 4NHVA 1M3UA 3OEXA 3BV7A 1KCKA 2C3ZA 2RHGA 2G95A 3N29A 3MSRA 1HGWA 2HSAA 4J4KA 5PTDA 4F3HA 1CZ1A 2ZVIA 3IWPA 5LNWA 1JGMA 2QMKA 4UUIA 1A0CA 3NQAA 5BWFA 1ICPA 2W66A 3S6DA 4GQQA 4I7WA 4DIAA 5A1AA 3NWRA 2R9RA 2A21A 4OUEA 1U5VA 1W31A 3O0FA 4ATLA 3W1NA 3CNYA 2Q8XA 2CLMA 3UESA 4EP8C 1RPXA 2WMIB 3VNJA 8XIAA 2A3EA 4L9ZA 1SPQA 1JUBA 1ZSXA 3WLKX 1MQPA 5CXPA 1B2YA 4AH7A 1KCXA 4Q4OA 2WPGA 2A3BA 2J8FA 5LA0A 4GZ7A 3W02A 4Q7IA 4TX6A 1A4LA 5C9UA 3SY8A 3AIQA 4Y9NA 3GDMA 7A3HA 5LSMA 3IJ9A 4IIDA 1WKFA 4PBEA 4ZODA 1SJBA 1H50A 1SZRA 4AWEA 1RD5A 4GVGA 2ZRVA 1MUMA 3LLDA 3Q65A 1TE1A 5EBAA 1X7FA 2G3JA 4BY3A 3UWYA 3UWQA 4YCPA 1OFDA 3WL0A 2Y63A 2YCLB 4F2BA 3G1FA 4DJEC 3MHFA 3T7VA 1MXDA 1VFOA 4UQEA 4JX5A 2GK1B 1Y8BA 2BS9A 1A5BA 1VZWA 1Z32X 1LUCA 4GE8A 2Z29A 1UMYA 1XIDA 1G5AA 2XFYA 1ITCA 1H49A 2W91A 4FZIA 2PP3A 4MB3A 2WCGA 2CERA 3QPYA 3ABQA 2J9YA 3P8JA 1Q6LA 4HA3A 4UB9A 1K6WA 3E2RA 1VLIA 1SUXA 1VRDA 3WD0A 3DKJA 3G1XA 2XN2A 3IVUA 3OZOA 5LXXA 5FIPA 3AJXA 1M6JA 3ARQA 1SU5A 2Z27A 1E6QM 3JW7A 4JTCA 4PMUA 3RU8X 2HQAA 2VUNA 2JKPA 1Q8AA 3EMQA 1O5QA 1V02A 2BXZA 3CS2A 1TVPA 1XIJA 3O15A 1L6SA 1HVXA 3RU6A 4TUFA 1KRAC 4PC8A 6TAAA 3LCFA 1RXOB 1F8IA 3P74A 3N14A 4R9XA 3NG3A 4EWJA 1TIWA 4I8DA 1RHCA 1LG1A 1RV8A 3NJ3A 3TYZA 1RLDA 1V03A 4M7SA 1KCZA 2WZMA 1OGGA 2IXUA 2NVCA 1UJQA 4B9ZA 1PKMA 5FAJA 3SQMA 5EA9A 2FVKA 5EU9A 1ONEA 4AMCA 4XD6A 3GXPA 2NWRA 3EKGA 3UZXA 3B8WA 2NZLA 3KZSA 4Z42C 1P1MA 4H8VA 3GG7A 2CYGA 3A64A 3MKCA 3QMTA 1VBGA 4AW7A 5BMWA 1XQKA 1D3CA 2MUCA 1E5JA 3ELFA 2Y2WA 3HA1A 3T42A 1ZP4A 1IF2A 4GVIA 3CQJA 3VCNA 1WOAA 1VYRA 3S1GA 3ZVIA 3G1SA 1WDSA 2ZE3A 1B4KA 1XKJA 4LYRA 1PIFA 1RBAA 3F7JA 1FXPA 3BV4A 2QS8A 4BR1A 1E6RA 1I0DA 3H2AA 3UXAA 2C13A 2QPSA 5DRCA 3WNOA 2UY2A 2WM1A 4ORIA 2A1YA 4QG8A 4H6RA 4K6AA 2YR1A 3LPFA 3I10A 5FAGA 1CXFA 1UC5A 1AH0A 2HNHA 3STCA 3RPDA 2E28A 3FJ4A 3F2CA 2FZ9A 3U5UA 5B80A 5KETA 1PDYA 3N2OA 3AROA 3UR8A 2OPJA 2PRMA 3EDEA 3FVDA 1QNPA 4NXSA 4UQDA 4PRTA 4S38A 3KOXA 3NR0A 3VFLA 1V4YA 2D22A 3B8UA 3KL3A 4PEEA 2PGEA 2CWXA 3WNLA 1WBJA 2W0UA 5E1QA 3PB0A 4Q4SA 2C1IA 1G94A 4JTAA 1S2WA 1AMYA 4HNNA 3CZLA 2H3BA 5DXXA 2VYOA 4RLIA 4EX4A 2WLZA 1PX3A 4S3DA 2ZRUA 4PCPA 3STGA 3UNTA 3MUIA 1BXCA 4MKVA 4WDWA 2G96A 3VIFA 3M46A 4LSBA 1E1FA 1W56A 3C0QA 4PUKA 5TD4A 2DZVA 3CZJA 3G1DA 3QZEA 4IGHA 5HA7A 2XU2A 5I3JA 1T7LA 2EPMX 4Y8EA 5C7VA 3MI6A 3SN0A 1DQXA 2Y8KA 1DP0A 3S42A 3OGRA 4HJWA 4XD4A 3WD3A 4D8ZA 1XD0A 1ITUA 3IRSA 3VGHA 3SGZA 3P7YA 1FA2A 4HK6A 2YDSA 4BI7A 1B5TA 2GPTA 4W87A 4C60A 4PUMA 5I07A 5A6LA 5DEZA 2VRQA 4NRRA 1QXLA 4I3GA 3LU2A 2NXGA 4FNSA 3VUSA 3BTNA 1HKIA 4XQ6A 5HUOA 1FKXA 1W5QA 1JDFA 6PTDA 3UY8A 1YTEA 1A5KC 4Z2KA 3OLDA 3LUTA 2HE8A 4IJRA 1XUZA 2WC3A 2E9BA 4B3KA 1TB3A 4QS5A 2VX4A 2YB1A 4UTTC 1LOLA 3WF4A 5RUBA 1EJ7L 2QHAA 3VM7A 4X63A 3G1RA 3ZLFA 2R1MA 8RUCA 1NY1A 4C6NA 3VIGA 4QJ3B 4LANA 3UW6A 5TAOA 1VBUA 5A8QA 3S5ZA 4L9XA 2YX0A 3AIRA 3NPXA 4HN4A 4YYCA 1GTEA 5FJIA 4JHOA 1NDZA 4HCDA 4D6CA 1LQ2A 4E3TA 1NU5A 5FEWA 2EQDA 4O18A 4BEQA 3UWZA 1PZ1A 3SURA 3TYAA 1FDZA 1XYFA 1YIXA 3G0XA 3KTCA 1XLMA 1OX5A 4JIRA 4US5A 2WPBA 4HHMA 1ZBKA 4S23A 2WSQA 1AA1B 1POKA 2J7DA 2G3MA 1JD9A 1BG4A 1JYWA 3IIVA 3N6HA 3V1PA 3AJ7A 3KRZA 5DO8A 4F66A 2HPIA 3R6IA 4B5XA 4GD0A 1AL7A 1K4GA 3ZSTA 4XZNX 1E6SM 3A24A 1PZ0A 4F4RA 3CMJA 3N18A 2IQ0A 3EPNA 2OODA 2PWEA 4PH6A 5D38A 3UEQA 4EKJA 2C19A 3NYZA 4AX7A 4H8NA 4QITA 2P53A 3W75A 1DVJA 2PDYA 2NVDA 3KFTA 2QVNA 2ZYFA 5LYRA 2QUMA 3EA1A 1BLIA 1GQIA 2YYUA 4M1RA 3A9IA 3I6EA 2PD5A 1TZ7A 1UQZA 1J5TA 1DJIA 3LQGA 4DBUA 2PWFA 2X1RA 5FJUA 3AYRA 3NURA 1M9HA 1U5HA 3OVGA 4TIMA 4GJ1A 4IG2A 3PWGA 3WEZA 1NQKA 4GO9A 3W22A 2BG5A 4DJEA 3BLPX 1VJIA 1HJUA 5FA5A 3B8DA 3BG3A 5JH2A 2ZRYA 3DHUA 4QS6A 2FDMA 4NKCA 2ISDA 3TVAA 4X9YA 3RHGA 3UWUA 4AZHA 4WJXA 2V3FA 4LVAA 5DMNA 2Q6ZA 3AXIA 1VIWA 5HJLA 5KZEA 3C4UA 1RY8A 3QLDA 4DUWA 4TV6A 1KFLA 2OWCA 2TRSA 1CI1A 4PMZA 4GLEA 2A3HA 3THQA 5F4SA 3E1F1 3ATZA 1SZNA 1YXDA 2HS6A 4HYVA 2IKHA 1UW9A 3EB4A 4AZIA 4FLQA 4TXEA 4AD2A 4L1XA 1H11A 1GVFA 1FFQA 3TEVA 2PDBA 2X7WA 2XSXA 1X1NA 4GPNA 1E43A 3A23A 3ZVHA 4NJKA 5TBOA 1BAGA 3K46A 4IIGA 1O1ZA 1UBSA 4EIVA 1F7BA 1W0MA 4US5D 1R30A 1V8EA 3WQEA 3IJ7A 2EO7A 3A3XA 3PS7A 2Q3OA 2QCNA 5K7JA 1UG6A 2VZVA 2VC7A 2ONEA 3N3MA 2G3NA 1C7TA 4OIFA 4JNYA 3W6LA 2NX1A 1KFEA 4OZOA 1EJWC 3C6CA 1OFAA 3CTTA 3OZYA 3MPGA 5LXEA 3MWCA 2R6OA 4ZO8A 2KZHA 1SJAA 1QW9A 2CZ5A 4H01A 4O1DA 5AHFA 3LGEA 3NL2A 4WXYA 2A79A 3CIVA 2HRWA 1P7TA 1XICA 1UR1A 5AOUA 4H9TA 3JR2A 5D4YA 1BVZA 2ZZ3A 5I3GA 1SJCA 1V6WA 1E9YB 4JGDA 1PTGA 1Y5WA 5FI8A 4ADTA 1TRIA 1QOQA 3G5EA 4D8LA 1A5OC 3AS1A 3FEMA 1GVSA 2IPJA 2VM8A 3ITCA 3S6TA 1GHRA 4JTTA 4IJCA 3N25A 4ZB0A 5B7YA 5I00A 3O06A 4DJED 3TN6A 4YWIA 2DSVA 3GVQA 4UMAA 2PLCA 3KUMA 2ZXDA 1LRQA 3S83A 3WJXA 3WH6A 1XLEA 3P80A 3OIXA 3M4HA 2BY2A 3POHA 2VURA 3PHAA 4OV4A 2MNRA 5LIKX 3LQLA 4L64A 5HNTA 3PG9A 3N19B 3NZ1A 1XLDA 4LWWA 3A4JA 1I9CB 3JU2A 2DV0A 4RW3A 4R3UA 3BPWA 1TX0A 1IXNA 1UOZA 1V3MA 2EG6A 1L2QA 4GQGA 5ENLA 3TN5A 4GH3A 4Z17A 1V02E 3ZT7A 2C91A 4XK2A 3LPPA 3UWWA 1YHTA 3HQOA 1UWAA 3CHEA 5IDZA 3VGGA 3LRKA 4MNLA 1EOKA 4KCUA 1F3XA 3KCOA 1W9UA 2I56A 3PUEA 1Q13A 1WDDA 5MKGB 1FH8A 4M7TA 3I7SA 3K5XA 1PS9A 2Z25A 1WNOA 4IUOA 3R79A 2NUWA 2ZUMA 3C8NA 1ITQA 1CPUA 1W1IE 4F2UA 3KBWA 5IFTA 2YBVA 4O14A 1VFFA 2XZ7A 1U1HA 4B5SA 1V3JA 6XIAA 1TJ0A 3RLGA 5HULA 4HOXA 4JFWA 3WMCA 3WYZA 1C29A 3BOLA 1JUEA 4QGCA 3D3AA 3ANVA 1J0IA 2WVVB 1TA3B 3W23A 1GHSA 2VZOA 3TC3A 2GJPA 4HU8A 1EEPA 5LHEA 4QJ4B 1JCMP 3W2LA 2VGIA 1W1VA 5FF7A 2CLHA 5C2XA 3GVVA 2ZX9A 3EMCA 4R5EA 1F9CA 3B03A 3S8HA 1CGYA 3W7IA 3VABA 1P1XA 3IRDA 1OM0A 3BDKA 3HQPA 2DUXA 3FK4A 1VFUA 4UTTA 4ZTXA 5GJNA 1B3XA 1E5NA 5A6BA 3SSZA 2Z6IA 1JG9A 3TSMA 1NSJA 5BRQA 4B92A 5CLTA 5LNSA 2X2GA 2E6AA 1T96A 1QHPA 2XH7A 1OFQA 3QY7A 1X6UA 3L4YA 3VDGA 4ROQA 4JFVA 1JZ2A 5FJPA 2C0AA 2J8GA 1XRVA 3QOMA 2Z4GA 2V0TA 1P0DA 4GACA 3B05A 1PB0A 3EX4A 4CN4A 1GORA 4IQJA 3IAQA 1J0YA 3TJXA 2I14A 3D47A 1ZY9A 4IHCA 3V5OA 5ABTA 3IUDA 1ME8A 4UBPC 6CGTA 3PZTA 3F4DA 3NZPA 1PKYA 4K3ZA 4XX6A 3O0KA 4BF7A 3PB2A 5HBFA 4R85A 1Q7QA 3I68A 1C90A 3ZLHA 3GVRA 2ZZ2A 4A8RA 1YXCA 2FB3A 3SCRA 4WQ6A 4ZOEA 1FBAA 3MZ2A 3THUA 4QP0A 2GUYA 1XC6A 3A5VA 3JS3A 2D3LA 3ICJA 4UTHA 2NQZA 4N9BA 1WDQA 1WZMA 1SR9A 2P3EA 4HA4A 1W6TA 3NCOA 4AZ5A 4W8AA 1KRCC 1CXKA 1W3TA 5ABGA 3HURA 3C2YA 1NTHA 5FJRA 1KTBA 4MYAA 1US3A 2QLYA 5AYIA 5F7UA 2POTA 3W2MA 5BXPA 4IL2A 2QF8A 2F2HA 1EHAA 5CZTA 2EJ1A 1YNYA 3GXDA 3NQ7A 3U5YA 2J6XA 3M0ZA 1U83A 2GVLA 1OZQA 5CBIA 1IIHA 2JF6A 3DAQA 2IKIA 1VC4A 4F48A 2F8QA 4N42A 3T8QA 4AWTA 3M64A 3NGJA 4TOQA 4DXXA 3IVSA 3U8GA 3WQCA 2QR6A 5KITA 3HQNA 1W5MA 3NM3A 5A6BD 3DFPA 1A5NC 4KWVA 4PN2A 2Y89A 4HJFA 3L21A 4ZO7A 3M0HA 4QJ5B 2X1IA 5TIMA 1UR4A 4FLRA 4C6DA 2HDJA 1FWSA 3H4XA 4AIOA 1LLOA 3TNOA 3KWXA 1AJ2A 2WV8A 1KBJA 3WF0A 1UP2A 5BCAA 3W6MA 1XSJA 3CPUA 2FZDA 3EDJA 3O6DA 1DHKA 1R9ZA 4ACZA 3RIKA 4UR8A 1Q6RA 2OZTA 2PP1A 4O1BA 3BMVA 4LGXA 5FJOA 3V7PA 4E2VA 3B4UA 2P5NA 3EX3A 4E4UA 5IHRA 3A9BA 1KLYA 1DTNA 3NQ8A 1OABA 2YKKA 3P84A 3V18A 2FLIA 3I4EA 5CJMA 1EYWA 1TQJA 1C7SA 3L2MA 3T08A 3GC2A 2HK1A 1UWRA 1EJSC 1XSIA 3WMBA 3NQVA 3B0UX 3B0VC 3OOQA 2CXGA 4XZIA 2ZZ7A 1D9EA 2J8TA 1B9BA 3WBEA 1B4EA 3J7HA 2ATMA 3RLVA 1HFBA 2A7PA 2ANUA 5CLWA 1QK2A 2BXYA 4JN8A 4ROPA 3W7RA 2W62A 1EH9A 3NZRA 1DBTA 3TFCA 5BRPA 1YE4A 2VX7A 3DFQA 1OT1A 1QI5A 3NL5A 4KBXA 5AHMA 2OQLA 3K8MA 3RILA 1R3WA 1UB3A 3MTWA 4N4QA 3BW4A 3SRFA 1LDCA 3R0UA 3SGGA 4ADUA 4MJZA 3QLLA 3E12A 4PB5A 1Q5MA 2DT1A 3UXLA 1NF7A 3GDLA 3TWBA 5E5CA 3LM7A 4AZ6A 1VFSA 3STFA 4MNMA 1V0KA 1DWAM 4IFKB 1V3KA 3F5JA 4LYKA 2WNQA 1TQXA 2R1PA 1GNXA 3TN4A 3H26A 4MNKA 3BAKA 4Z2LA 2CFFA 1HTIA 2QKFA 1XCXA 4ZMGA 4WKHA 1R38A 4ZOCA 1XIIA 3U2EA 2NV1A 3CB3A 1BVWA 3WQGA 4Z2GA 4DLFA 1SMDA 4M8UA 4UTFA 2ISWA 4AYGA 2REQA 2NV9A 4YHGA 4UNLA 3FDKA 3GNPA 1HJQA 2ASHA 1UWQA 3OP2A 4HD5A 2QV5A 2GVYA 4QLKA 1VAHA 5HMSA 2DQXA 5FEPA 1VFLA 3N17A 3NSNA 3SW6A 3W1LA 2FZBA 1L9WA 4LPCA 3W7NA 4RV8A 1W2PA 4S39A 1GVRA 5A8MA 5G2WA 1J0KA 3DU0A 2NVAA 2E3ZA 1Z41A 3MJYA 1GQNA 1DJYA 3SJ3A 2X41A 1A5AA 1K8XA 1F05A 3A4XA 1DXFA 3CWHA 4LEQA 4DZ5A 4N9DA 2DSZA 3P2VA 2R1LA 4KWWA 2V5JA 3GXIA 1O5RA 3NFUA 3EDFA 3FN9A 2YYTA 3CIXA 3UCCA 3SIMA 2WNZA 4IM4A 3LCHA 3ENLA 1REQA 1Z44A 3LHVA 5BXTA 3MCOA 5DQPA 4LC6A 5D2TA 2WMJA 3L2LA 1UOKA 1TZZA 3S2JA 3WDPP 5C71A 3GNOA 3S5NA 1LJYA 2IKJA 3GHSA 3O7UA 3MW7A 1C3FA 4CEUC 2BVTA 4HA0A 1G7VA 4X61A 4TU1A 3NQ6A 3DCPA 5JBFA 3RCMA 2Z1KA 2A3LA 1QOPA 4RZ5A 3SRKA 4L61A 5FL0A 4BS0A 3SIZA 4A8NA 1UQYA 2V38A 3NO5A 2ZIDA 3UF9A 3LPOA 2I57A 4JTHA 1KC7A 4BQ5A 5EGRA 3T0CA 4JDYA 1E1CA 4M24A 3VOIA 4QXIA 1XISA 5I7GA 5M17A 2CKSA 4RDWA 1CB2A 5K4ZA 4DI8A 4MNJA 3HU7A 3R58A 4V15A 4NAEB 3T4CA 1BYDA 2DSUA 1TR1A 3QSTA 1YDOA 3KVKA 3SCOA 1YLVA 4UQ9A 2GGHA 3U6WA 3ABRA 5D37A 3USBA 1BSIA 2HVOA 3STEA 4ORMA 3S9ZA 4JCLA 3RM8A 3T09A 2NUXA 1JCNA 3WLOA 8XIMA 4ZGYA 1FP8A 3CAVA 4UFHA 3HGJA 5ABFA 1XL9A 1EWDA 3F4NA 2X09A 5I24A 1W3KA 4B5WA 4B2DD 1SO3A 3MANA 5BU9A 5AN7A 5IDIA 3QW3A 3ZR4A 3T44A 2QUTA 1XBYA 2WMHA 3C0SA 4KW2A 4OUIA 5AHNA 1ME9A 3S46A 1KBIA 3UG5A 1XS2A 1AQHA 3CC1A 1GPWA 4CNUA 4C7GA 3TMLA 1L8NA 1XLBA 2VDGA 3I3EA 3MO4A 2VP8A 1ME7A 2QIIA 2B0MA 2IPWA 3VCRA 2PGRA 1FVPA 1GQLA 1QDSA 1CB7B 1UUMA 3GYCA 5D2VA 4AUBA 1NEYA 2YSWA 4Q4PA 3T07A 1OEPA 1WA3A 1DQUA 3TE9A 1V77A 4B5TA 2WNNA 2I7GA 3V16A 1A5MC 1EFZA 4H8UA 3LTPA 1DTUA 2UBPC 2GDUA 1VR6A 3DYOA 3LLXA 4MAZA 2FGZA 4G7EB 2R24A 1JR1A 3PBWA 1MQQA 3AIEA 4PE8A 4ERIA 3ZT5A 4H83A 5HUPA 3CQKA 5D32A 5K3VA 1IR2A 1CGUA 4ILSA 3MQTA 4DHGA 1Q63A 3UJSA 4LS1A 4DYJA 2DQWA 3SECA 3TW7A 1W91A 4EXAA 3UR7A 1E72M 3KCLA 1SZFA 2UY4A 1IXOA 3TZNA 1GVYA 1UR2A 3CUHA 1PE1A 4PUWA 3VC6A 4EF9A 1GYLA 3AHYA 3TZFA 4FS9A 3WH5A 3WD1A 4Y9OA 1I8JA 2BMBA 1S5MA 1JCXA 2XFRA 3FFSA 2IUZA 3CAKA 1Q6FA 1UKTA 4AD4A 4XV0A 3BCFA 2CKRA 2DSWA 3VO0A 1OFPA 1Q7MA 2X0SA 4GIRA 4MKNA 1K02A 3W7MA 1QMLA 5FJTA 3PK7A 1W17A 4YL2A 1K9EA 4DO7A 1NOWA 5C9XA 3V0UA 5EY5A 4XTIA 7ODCA 4O10A 1VB9A 2OCZA 1OK4A 2H6RA 1JZ6A 3UZYA 3BLFA 4GABA 4HMEA 1WAWA 2F61A 3FXYA 2E5DA 3EKZA 3QV9A 1P5BA 1H41A 2AQOA 2AQVA 2HXTA 1ZAHA 2A3CA 4FEZA 4QNWA 1NIUA 4QQUA 3B9EA 1KM3A 1EUNA 3H2OA 1LORA 1JFHA 4K7VA 4IX0A 3VOJA 2WC7A 2AL2A 2XWDA 3C3UA 1Z7AA 2G4FA 4XUYA 1EKOA 4M1BA 1KQZA 4R88A 2A6NA 4YVXA 2GQ3A 3VDCA 3WH9A 1G4TA 1EPVA 4KF1A 3KX6A 3NXFA 1XIMA 4JTFA 2E25A 3EX1A 1J93A 3C8FA 4JR5A 1VEOA 1RY0A 4YU1A 5LZLA 1US2A 1JGIA 2Q09A 1XYMA 2YIHA 3U0HA 4S2CA 4NNCA 4ICMA 4MY9A 1WV2A 1ZAIA 2Z2UA 4B3LA 5CC7A 1LTDA 3RITA 1N7KA 3KOYA 3PBMA 4HK5A 2Y61A 2C79A 3HOJA 2VL4A 4DRSA 3W7OA 1ZALA 3EWXA 4JTUA 1BWVA 4UC5A 4AXKA 4HMCA 4I7VA 4XAZA 3USZA 3AMGA 1XLLA 1LUCB 3BURA 5CAKA 1QNOA 2WMFA 1TPEA 4DB7A 4ZFCA 3ARTA 2AMGA 3CXOA 4J9JA 3PSWA 1MUCA 3LV5A 2XH0A 1H4PA 2UWFA 1KFJA 3QV7A 1KTCA 1M03A 2QCDA 3HG2A 5KZDA 1YX1A 3VVGA 1QK0A 1H7RA 4NF7A 4FHAA 4Z0JA 1UJPA 4AEFA 3QKZA 3OG2A 3DFSA 1E51A 1YKWA 4HT3A 1MZRA 1S1RA 4YWSA 1E0UA 2HBXA 1UH4A 3UPBA 2RKXA 2Z1XA 3P81A 3AXMA 4O52A 3RF9A 4H41A 3TJLA 1KM0A 2XVNA 3UXKA 1SR0A 1OX6A 4XO7A 2EAWA 4US6A 1SW0A 3GDBA 4W8BA 3W70A 1PJ9A 1AH3A 2GVEA 4PMYA 3AO0A 4W5UA 2WVTA 1TUFA 3EBVA 1GVQA 4LTSA 2R94A 4FNUA 3SCPA 1GZJA 1OG0A 4Q6JA 4EVZA 1W3HA 3C0JA 1EHNA 2C14A 1AW2A 5JBEA 3SCSA 1O66A 2OYKA 4B3ZA 2VGGA 4PTXA 5CJNA 3L4VA 1LOQA 5CAHA 2WVUA 1S2VA 1I2NA 3H4WA 3GU2A 3N15A 1VFHA 4GBDA 3EX6A 2D69A 3ZOAA 5IOBA 4ZO6A 3FYYA 3H2EA 3HPAA 1E3ZA 1GYMA 4B16A 1KNWA 3B3DA 5CPLA 1FDJA 1MW3A 3E74A 3R94A 1IT0A 5HDRA 1W1A1 3WX7A 3F4CA 3NQMA 1FP9A 3WQFA 1UIOA 3WFZA 3ZIZA 3SY1A 3W1TA 1AMKA 5TNVA 2C18A 4LU0A 4J3VA 4F8XA 5H2ZA 4IPLA 3PSVA 4JTGA 1B0IA 3ECQA 4L7ZA 1IQ8A 4AF0A 4FOKA 4OTKA 3GIYA 2DORA 1VKFA 3ID7A 1OINA 3FAXA 2GGIA 4UMCA 5I0DA 1H63A 4GRSA 3CUIA 1ZP3A 3BLOA 4JQ1A 3G1HA 3UA3A 4QDPA 4PMOA 5I02A 2QPUA 3P67A 4DZHA 4Q8OA 3H22A 1UD5A 4NILA 3AMLA 3VD5A 2X1TA 1GOMA 3U4AA 2IXVA 2ZBTA 4WJEA 2P1FA 4V1XA 9XIAA 2BHUA 1GKQA 3E5BA 1KFKA 4AEEA 3MP5A 1MW1A 3HFTA 2C16A 3UBPC 3I7QA 3ZWTA 4JDBA 4V33A 3B4YA 1RCQA 1ECQA 4TO8A 3EXTA 1VYSX 3TLQA 4NU7A 1EA0A 4DM1A 5ABHA 3DI1A 4CQDA 4Q4MA 3VDBA 3C2OA 2ZFAA 4FF5A 3A21A 4ES4A 2YL8A 5CEWA 4UTUA 3W72A 4O8AA 3RGTA 3O8AA 1O4UA 1A3XA 3VNIA 4PODA 3KTSA 3DYPA 2D0FA 4MWAC 4W89A 3WK3A 1VIZA 3SGUA 4UCGA 1PWLA 1W8SA 2ZCGA 3W7EA 2GDQA 3O1NA 1RJQA 2RJHA 2G37A 3ARUA 4UR9A 3QW4B 4GY0A 2BLEA 2VDIA 2INZA 3AALA 1AJ0A 3EOSA 2V67A 2C15A 1TTIA 4GCAA 3M5YA 4DPPA 4J3TA 1G4EA 5HMDA 3PBGA 1AODA 3CGTA 4MAVA 1ICQA 3QC0A 4LB4A 3W07A 2WMGA 3TW9A 2XDFA 3WH7A 5A6SA 4O57A 1PZ2A 1BF6A 4JIHA 3KVJA 4FALA 3C2VA 4A29A 2E0PA 2WKJA 4M6UA 5CZ0A 4W7WA 2VVSA 2EPLX 2VENA 1JAKA 3B8IA 2QV4A 2BDQA 3VM5A 3BJFA 2QUNA 1JCTA 4MMWA 1GUVA 1Q85A 1B57A 3PJXA 3P60A 1V6XA 2GWNA 2XN1A 4P61A 1OCQA 4C1NA 1M5WA 1B3WA 4FXJA 4XKYA 3NDZA 4PFHA 4AVOA 1WO2A 4PTMA 2GJNA 4KWUA 4OECA 4FIRA 2OQHA 2ZA3A 2GWGA 1ODZA 4O19A 2E6YA 2XIQA 2P0OA 3W1XA 3M5ZA 3AAMA 4YMZA 3KOFA 1DE5A 3QHNA 4JS3A 6REQA 2QIWA 1UD6A 3AU6A 3P5YA 1Q45A 2V30A 3VMOA 1XYZA 1GVIA 5D9PA 1KGUA 4ZB5A 3PPHA 3OGVA 3SR7A 1KBLA 1PDZA 5CJ5A 2QMJA 3A3WA 4MDOA 1CCWB 1E6XM 1I1XA 3WDHA 2XIOA 2CWNA 5CKSA 1Z9AA 1TFVA 3QBUA 4RE2A 1AUSL 4H8HA 4JTJA 4L4OA 2P10A 1G1YA 1LP6A 5HQMA 3PBVA 4CQAA 3DHDA 1PX8A 4J3XA 5AYYA 1WCGA 3VD9A 2F7FA 1QPNA 4Q7NA 4MTVA 4QX4A 4IG2B 1J79A 2OEKA 2E5BA 4HU3A 1XGEA 2AQWA 1V0MA 2BOEX 1W5NA 1ZL1A 1IEVA 3UJ2A 5M3WA 3TQKA 3UWEA 5CC5A 4TQTA 4AHPA 3LLFA 1FWGC 1KFWA 3L4TA 1XQLA 2WOQA 4UFJA 3SY5A 2RUSA 2X16A 4ZZ9A 4GK8A 2QJNA 3DGRA 3IK2A 3LCGA 4ZTYA 3LBCA 4PA8A 4L56A 2XG9A 1QWKA 3MVTA 3TYEA 1D7FA 5HR7A 1F61A 2YLAA 4LNCA 2VNCA 4OGZA 4EPDC 2QJGA 4MY1A 3FJNA 6ALDA 5DANA 1KWKA 3CH0A 3BQ5A 5EYWA 3T4WA 3NQCA 4AHQA 2GJXA 1CLXA 3HN3A 3RLUA 5FL1A 4S3AA 1VPYA 4JD4A 4ZXOA 2VD9A 3MU7A 4GVHA 1A50A 3UR2A 1JULA 2FGBA 4N2YA 3GFXA 4YTTA 2ICSA 4DX3A 2XZ9A 2D20A 4UIOA 3V75A 1PYMA 4IMCA 2ALRA 3DC0A 1GJPA 4BKNA 1HUVA 3P93A 1LYXA 4CVUA 4HZMA 4KERA 3K30A 1OBAA 3G2GA 3AFBA 5EMKA 1TJ1A 1JCLA 3P0WA 4S1FA 2G8ZA 4TX8A 1MEHA 2G3FA 4IGMA 1K8CA 4AB4A 3ARVA 3VXGA 2ZA2A 4A3YA 1CBGA 4W7VA 3B06A 2QDHA 3ARPA 3AMKA 1AZ2A 2ESCA 4O15A 4CLMA 4WSKA 4TVUA 3PFMA 3BCDA 4EE9A 1I2RA 1P7TB 2D2HA 3FYPA 1LBLA 2PTDA 1O5XA 3AQUA 4W4QA 4IIFA 5I3KA 4AD5A 4QR6A 1VPQA 1ENUA 4TV5A 4WEVX 3A13A 1KKRA 4HNCA 5FEXA 3VA8A 3QN3A 2C1GA 1S2TA 5J5DA 4TX9A 4MM1A 1Q6QA 1DJXA 1M1BA 3FKRA 1A5LC 1RJPA 3B04A 2W4XA 4MY8A 4KMQA 1LZOA 4M19A 3LHWA 4UFLA 5CBBA 1LLWA 5D30A 4RCXA 2VC9A 3QGVA 4GQRA 2Z26A 4PUEA 1R47A 5G2HA 1ISYA 1QNSA 1EF2A 4Q3MA 4ERGA 1W2VA 4PEKA 2B7QA 3M43A 4J5NA 5IXEA 4AFYA 1Q4WA 4LUIA 4D72A 3W01A 2PODA 5AHLA 2C7FA 5HNRA 1FH9A 1EC7A 3LENA 3R12A 3M0KA 3QY8A 1VJSA 1BGAA 1GK8A 3EWUA 2EGZA 4QTGA 1ADOA 1UD4A 3P5ZA 2X7VA 5JBDA 9XIMA 4O4VA 4FAMA 4JIPA 2XSAA 3N73A 4U3CA 5I5RA 2NT0A 3G8EA 3N13A 3GXMA 4GQBA 1DWJM 2YB4A 1G6CA 3K4WA 3ISIX 3LS9A 4LV4A 1TTQA 3KVMA 5F2GA 2VCCA 4LYQA 5AKQA 2GQAA 1T40A 3FW6A 2TAAA 3W7HA 1GJUA 2C6QA 4S3FA 4H04A 2V5DA 1PVNA 2RH9A 3URBA 3M41A 1EP3A 2Z1SA 3ITTA 2CZDA 4GY7A 1ONXA 2W79A 2NXHA 4X0VA 4JTKA 3TCSA 4CNSA 4ZL1A 4A22A 2PF0A 4MWAA 3UU0A 2HE5A 3NO3A 2IMRA 2DIKA 1O12A 4EAYA 3MI2A 5BOFA 4CCDA 2XIJA 1YPIA 3VKKA 1Z6KA 2Y5SA 2NW0A 3M7SA 4OU1A 3S6OA 2ZDSA 2G5WA 2PDCA 1J6PA 2WZTA 2GUUA 1H0GA 2X1SA 2VCAA 4KQNA 3R1ZA 1LOSA 2C71A 3GM8A 1KCLA 3B9OA 4LX4A 2YFNA 3TSDA 2YLLA 3NEHA 2PU1A 2WC4A 4JNMA 1P4CA 3I6RA 3URAA 1MDLA 1WXYA 2ZTJA 3VOCA 3IPWA 3B9NA 1VF8A 3NZQA 1SZEA 3EPOA 3S5YA 2IQTA 1EGZA 5LNUA 3N2TA 3QQ0A 4C65A 1O60A 1KRBC 2IW0A 4X60A 1U33A 3E2SA 3WD4A 3LHZA 3W37A 1XLFA 1QW8A 3FX4A 2Y4SA 1OYBA 3PN8A 3TJ4A 2PTYA 4CD5A 4DPQA 4QEHA 2PDMA 4N9EA 3BG9A 4P7LA 1MUWA 2BB0A 5KEZA 3KVLA 4PR4A 5GQBA 3WJWA 4PMRA 1Y0EA 4QCEA 1C9WA 1NAL1 3UWVA 5FSEC 1NJJA 5CBJA 3W74A 2E9MA 1XLCA 4K68A 4HZ7A 1DXEA 3W26A 3Q58A 1ZBCA 1OIMA 3PTMA 4OOUA 3S2NA 2PF8A 1V0LA 3W7QA 3BAWA 3MV11 4IQLA 1H0IA 5CH9A 4NG3A 3DN5A 6A3HA 3W71A 7ENLA 3N2XA 1MEWA 3O63A 3WLTA 2A7RA 1DJZA 1JDCA 3ZJ8A 3T8LA 3BJSA 4CU8A 1QOXA 4AD0A 4EF8A 1EBHA 1RQBA 3WF1A 4MWAD 4K1WA 3BLEA 4GUGA 1YRRA 2PC8A 5G1MA 3F4VA 2V5BA 1DKWA 3RR1A 3OPSA 3WLHA 5DXYA 1YXYA 5FCZA 4C6LA 4D71A 3IS4A 4TVDA 4K8HA 4E8DA 1K3UA 5A8NA 2FQIA 3QR0A 1M41A 1R3TA 2FJKA 1WDRA 4BFAA 2VZTA 3W73A 4Q22A 3GXFA 3AI0A 3PANA 1NFGA 3EEGA 4E3VA 4NI8A 4JAWA 2X0HA 3V3WA 4FI4A 2PWHA 1MVYA 3ZSSA 1JAEA 4GFSA 3ABXA 4H7ZA 3L5MA 4QJ1A 4DWSC 1JRBA 3WLSA 3SRHA 2PDXA 2QDGA 5CGQA 3AIBA 2WANA 3HQ1A 4MUPA 1DYSA 3KBSA 3W3OA 3CPRA 4DWDA 2QXWA 3WJSA 1A3HA 7REQA 3ZWSA 3FA3A 2VEMA 1X8CA 3ANUA 1EDTA 4IIBA 3JZEA 2TYSA 4ACZB 2PWUA 3H4GA 2QJHA 2ZX6A 5LIUX 2VRKA 2O4QA 4Q8UA 1PCKA 4LCRA 4Z08A 1OFBA 3UG4A 1UHVA 2QVHA 3I65A 3F5KA 2Z6JA 3PG8A 5FKYA 5XINA 3LERA 2VCBA 5D9OA 4YLWA 4CCCA 4HCLA 1X1ZA 1I4NA 1DIDA 2D2JA 2JF7A 3VINA 1WZLA 2D23A 3MUXA 4R27A 3E3HA 1GJWA 4ZQNA 1SZGA 1UZ1A 5DN1A 4C6MA 3KDOA 1F74A 2OYLA 3Q45A 3GB6A 3CUJA 1KM2A 2Y8UA 3DHFA 3HBLA 1SGJA 1DV7A 1CEOA 1JCJA 5HOSA 2H8ZA 1WZKA 5HMFA 1FFRA 7CGTA 3M1ZA 2ADAA 5JVLA 4LQ1A 3GUWA 4MPKA 4ZEPA 4ZOAA 4H7VA 4N6FA 4KESA 2CZFA 1OHLA 5KZ6A 3MUAA 2NQ9A 3QVQA 1IGWA 1EGVA 1KA9F 1LQ0A 4DO4A 1EYEA 3MWAA 4MLRA 3ZT6A 2BY3A 5LGXA 1R87A 5FESA 1RPKA 1FQ0A 4AMAA 3CUZA 4YTSA 1IHIA 2JGYA 1GEQA 3KS6A 3WENA 3DESA 2OKTA 2VFHA 4N7QA 3PZNA 4INFA 4ECLA 3U4FA 1W3NA 1BF2A 1QO5A 4GHRA 4MZYA 1DE6A 2ZTKA 2WBKA 3TMQA 4EK7A 1IIGA 4QE4A 3M0MA 3MZNA 2QCFA 3UXDA 4DBSA 1RQEA 2VZSA 3LA4A 3W1UA 2DUAA 4NASA 3M47A 4Z1BA 2AAMA 2REQB 4MUZA 4FNRA 3R7MA 5REQA 2O9PA 1GZGA 1UC4A 3MYPA 3TK7A 4Z2JA 1GZ1A 3E2VA 3QSRA 3FVMA 3R0KA 2QW5A 4LY8A 4CVWA 3MJMA 2ABAA 2WHMA 1UA7A 1TZ9A 1IYXA 3GY1A 1I6NA 5CPMA 4HZ8A 3DG3A 2C0HA 1TCDA 2A0NA 5BOEA 3R8RA 4JHZA 1ML1A 3CV6A 3N3TA 4DF2A 2Y7DA 5JXQA 3W1RA 1VH7A 3L12A 2NQLA 3TONA 5I23A 3E5PA 1E9LA 1SVDA 1AH4A 2PSNA 1GGOA 4L5ZA 2OT0A 3V36A 4IMAA 2AAAA 3TXZA 4JL1A 1OYCA 1AZ1A 3MDUA 4Q6XA 1TKKA 2OGJA 4J3WA 1J10A 1FHDA 1S38A 2Z1VA 3QKEA 4PSPA 3IAPA 1PO9A 5G4EA 4X22A 1K77A 2PBOA 3SADA 2BGNE 3LHUA 4L4LA 1VBHA 2GOUA 5CPQA 1REQB 1R8LA 1I75A 4JIQA 1QWGA 2ZXAA 3E0WA 2NSXA 4JTEA 3QRHA 3THCA 1U1JA 3R11A 4LVBA 1E6PA 1QUMA 2PDIA 3CEPA 4M81A 1F8MA 5LA1A 5HANA 1Q2SA 3LCIA 2BXVA 1VS1A 1CNVA 5AC5A 1W9VA 2D1ZA 3RX2A 3F4WA 1JNDA 2FZNA 3UJFA 2CLIA 3M6DA 4BK9A 5L6UA 4I9JA 2AL1A 1H1ZA 5BMXA 1W1ZA 4QEEA 1J18A 4IISA 4AIEA 2DP3A 4W93A 1D8WA 3ABSA 3AOFA 1JF6A 3PAJA 4F40A 4O1AA 3BXWA 4JFUA 1E1CB 2Y70A 2CW6A 3WEMA 1PUDA 1TO3A 4O1FA 2PTXA 2WWDA 2X8RA 3WH8A 1RALA 4LC8A 4KRUA 1OGSA 4PMDA 3UP8A 3UETA 4D6GA 1H7OA 2DJLA 5J8LA 4ONVA 2XH4A 5FF3A 3VIMA 3ZJ7A 2XGIA 4OFCA 1W9PA 4GO8A 4PFMA 3SFKA 3PZGA 1IXPA 5HXMA 2YCIX 1L6WA 5ABFB 3N4FA 3GSMA 2CHRA 3TQPA 1ZJAA 2GSJA 1OVDA 5TF0A 4QCFA 3WFLA 4CQBA 4NQ1A 4KRZA 5DLCA 3UYIA 4I5RA 5LHFA 1WDWA 3EDKA 3QZ6A 2EG7A 3T78A 1SO6A 3ITOA 3G3MA 4GBUA 1JYNA 3CQ0A 1WAUA 1ZFJA 3NPWA 2CLOA 1EOMA 1U22A 4IQDA 4JEJA 3S2LA 4HMDA 5JIPA 3A3HA 2ZADA 2NX9A 4GIAA 2XM1A 2DU2A 3QTPA 4WOZA 5DMLA 4KPLA 3WDQA 4MWAE 1IT7A 4I5XA 1CXEA 3N4EA 3QXBA 4DXKA 3SAZA 2OT1A 4EANA 4HTYA 4XZWA 3L23A 1BQGA 4MJ4A 1F3WA 1AK5A 3H6OA 4WIWA 2PLKA 3C61A 4M3PA 4OQVA 3G77A 5DFAA 5BROA 2YFOA 4J40A 2ZXBA 3WL1A 4RR4A 5ECVA 2F9RA 1YMYA 5CPSA 2Q01A 2GZXA 1FCQA 4IXXA 1F5ZA 3CAWA 1W1TA 2YL6A 2YCKX 1ZAJA 4UXDA 4LT9A 4OBRA 3WLMA 2OGYA 3SB0A 2VHLA 3WNPA 1V7AA 4DWSA 1BQCA 3PJUA 1R46A 4Q32A 4CD4A 1EXBA 2POZA 3PPGA 1R3YA 5F1VA 3W85A 2ZUTA 3G24A 2I9EA 1TSIA 3W88A 4CNOA 2DSKA 2OG9A 6XIMA 3GXTA 1H7PA 4QLLA 3RRAA 2F6KA 4XWUA 3W9ZA 3G18A 4XAYA 3EDDA 4RDVA 3KP1A 1E4MM 2DH2A 3MV01 2J66A 1XIGA 1CYGA 3KL0A 1R6WA 2PAJA 3W0KA 4GXPA 4RPQA 4CQ8A 5ABEA 1S2AA 1PTDA 3G3DA 1H1YA 1GOIA 2A3AA 3VUPA 4XVDA 2NQJA 5C7HA 1M65A 5U7SA 3P82A 3CK5A 3GG0A 1QPKA 2OB3A 1R2SA 4WHBA 4S3GA 3WQ8A 4GUJA 2VZUA 3AICA 4KEMA 3MSDA 2HNEA 2PDQA 2V2CA 1QASA 1TG7A 3BOFA 1N55A 1OGBA 1KXVA 4NAFA 4NXKA 5CG7A 1XP3A 2AL2B 3EAUA 4FK9A 1E56A 2QULA 1WKYA 3LXAA 3PJWA 2E5CA 3KRUA 4J28A 3AZRA 4FIQA 3TYCA 2XIIA 2JEQA 4MIMA 3TC6A 3ZMRA 4JX4A 3UGRA 1BG9A 5EMLA 2I9UA 4Z0SA 2VELA 4WDXA 3WZ0E 3TTOA 3GQYA 4CGTA 1I0BA 2RDTA 2NV2A 3RDKA 5BXRA 5E9XA 1EX1A 2PS2A 1TTPA 3UR5A 1R9XA 3S9YA 4HMNA 5A8OA 3EWWA 3BO9A 3HG5A 1QO2A 1G01A 4AYSA 1S3TC 4CNNA 1SM9A 1POJA 1IZCA 5E0KA 1RQHA 2QDDA 2EPKX 2PFHA 2J9ZA 3QFEA 2H3DA 4M6PA 4NIRA 4RPPA 2AOSA 2WVSA 4RW5A 4DWSD 4LVDA 5I3DA 1XRSA 3IIZA 1M7PA 4LFYA 3DC8A 3QMSA 4AY8A 2QAPA 4GH1A 4ZFMA 3I3DA 5AC8A 3T40A 4PBFA 3MMTA 3UJRA 4FLOA 2AGKA 4GVFA 3DI0A 3CHFA 1ICSA 3KBMA 1W3IA 1E4IA 2DZPA 4MGGA 5C9WA 3GS6A 3K1DA 2YA0A 4L1GA 1TPH1 3RR4A 1I60A 4H6KA 4O1CA 3BSHA 1Q65A 3VDAA 2HS8A 5CC3A 3O6YX 3HPSA 5F2MA 4C6OA 2INEA 5CPNA 1TA3A 3M44A 3W1MA 3CZKA 3F5LA 4MKSA 1OCJA 2AMXA 1ZZMA 3LM3A 3QY6A 1ZJBA 2JKAA 4KRTA 3LNPA 3ITGA 3S9IA 2PUZA 3OQEA 4J1OA 3KLLA 1VEMA 4PB3A 1UKOA 1ZBWA 3ITXA 4K38A 3VIIA 4PMXA 1WXZA 3DOPA 1RBOB 4QDMA 4DUXA 1WQ5A 4S3BA 3U2ZA 4KIEA 4NNBA 1X1OA 4CD7A 3F03K 2J9XA 1QHOA 3XISA 4HOWA 3I3BA 3VMNA 3RPTA 4WGHA 1J0JA 4FF7A 3W4RA 1H09A 1RA5A 2XPKA 2GSEA 1F4HA 4WY0F 4GQ0A 3WQPA 1TJRA 3WQ4A 3L0KA 4Y9PA 1KBBA 1RZMA 3D5HA 2CBUA 4FXSA 1QBBA 2CHNA 8TIMA 4P5UA 3HG4A 3LMYA 2VR2A 4JKLA 3OBEA 5D09A 3WJZA 2FVLA 4JKKA 3TOPA 2FIQA 2J78A 3WK1A 3SSJA 3DX5A 3EWZA 1K8ZA 4O53A 4AVFA 3FCPA 4HYRA 2D24A 1C91A 3TQVA 3FNDA 3G0SA 3NUKA 4JPGA 4F0KA 2E9LA 4RXFA 5BU6A 3NGFA 4ZQRA 4GC4A 3AMCA 3WQWA 4CQ9A 1WKDA 1TV4A 3KCJA 4FSAA 3KTXA 5CSYA 1EZ2A 4UTKA 3WK2A 1DWFM 3FHAA 3HIJA 4A3RA 1IZKA 2WSPA 2J7BA 2VC5A 5J04A 1Q4NX 2OX4A 2YPIA 2PI6A 1KV8A 4YIWA 4AF0B 2VR5A 2PCEA 3TAOA 2P0IA 4H9XA 1YYAA 1UCWA 3G1VA 3MCNA 3GNNA 2PMQA 3NPVA 5CPTA 5DBTA 2OLHA 3EYPA 3H23A 5LNRA 3RUBL 5DF0A 3G6MA 2B31A 4AU0A 3HJEA 3T1GA 3MYOA 1S2UA 1IEXA 2D0GA 2CZVA 2B81A 3VDHA 4UTJA 3BCJA 4CCZA 3LD5A 2GQ8A 1L2UA 3CT2A 1QT1A 5EKYA 2G0WA 5A3HA 1E4LA 2Z28A 2NT1A 3LSCA 2O9TA 3MBDA 1MI3A 3L9CA 1BVNP 1DHPA 4HOZA 3L7RA 5K9CA 5XIMA 3APGA 1YPXA 4CU6A 3IJQA 2OKOA 4RNHA 4ERAA 1BRLA 3A5FA 4IZGA 4E4PA 1EJTC 3WLPA 4HYWA 1A80A 3NL6A 1BTMA 2WSYA 2J7CA 4KT2A 3QOKA 3O3RA 1OCBA 1XH1A 4JFSA 3Q37A 2JEPA 3WY1A 1NDYA 4W8LA 3A47A 4ICCX 4XZLX 5EMUA 3H2FA 4IIHA 1DL3A 3BQ6A 1KB3A 1EJUC 3Q2DA 4QSHA 1Y5VA 3UCDA 1EP1A 3XINA 1NH6A 4DUOA 1QCWA 1W5PA 2DVTA 4P8VA 3ZR5A 2WZIA 2HTMA 3PM6A 1XWYA 2VFFA 3VU2A 2QGHA 2CLPA 2FH6A 3CASA 3S1XA 3SJNA 1HX0A 3PPFA 2DZWA 4Q4RA 3ZXWA 1ODUA 1ZS2A 4DF1A 1Q7ZA 3I6TA 3MCMA 2GVGA 3WDJA 1TWDA 4OWGA 1CGWA 2F84A 3LTYA 2J4GA 4JYEA 4EACA 4DF0A 3REQA 1HJVA 4AZCA 2BFGA 4LRTA 2FMOA 2J75A 3FV9A 4B90A 1JVNA 1J96A 1LT8A 3DFYA 5C70A 4C1NB 3VPLA 3UZ5A 4XKYB 3XIMA 4G1NA 1LG2A 3HPXA 1XH2A 5AY7A 1J6OA 3NXLA 5HJXA 1JZ5A 4MF4A 2A5HA 2L5HA 4FXFA 4R7JA 1NWRA 1NQ6A 4GYPC 3NQEA 3SM0A 1QBAA 4DNHA 3W76A 1ADSA 4CEXC 3CB8A 4O12A 6REQB 3VGEA 4MFDA 4XAGA 2HBVA 3I7RA 2B4GA 3V0SA 4UNKA 3CAQA 4CU7A 5LGZA 3BUVA 5C8BB 1W3JA 4NRSA 2FZMA 2ZVRA 3GNDA 1OD8A 2JIWA 3NQGA 1ISZA 1UD2A 4DEFA 4M80A 3JRKA 3CIWA 3LNMA 3C0LA 3WBWA 1HKWA 1WB0A 4I6VA 4X2RA 4AC7C 3C2FA 3C3NA 3CV1A 2V3EA 3KP0A 2WCAA 4RZBA 3SCVA 3EWDA 1E0WA 1PHQA 1TMHA 1M7XA 3EA3A 3VC5A 3T55A 4PTVA 1OC5A 4GZEA 5K9DA 2BOFX 1ZBVA 2VQUA 3N11A 1I2QA 2VVNA 1YTDA 4IOTA 2OEJA 3HPZA 3QH2A 3IIOA 3TP4A 3SCQA 2VWSA 3E2QA 3W1PA 1JF5A 1HKKA 2FB2A 1VCGA 4XUGA 4DAFA 3RNDA 2E8YA 4PMQA 1UH3A 3NDYA 1ECEA 5CGTA 1YE6A 2GSHA 1THFD 3FGCA 1Y7VA 1UR8A 3EB3A 2GLKA 1OSEA 3TW6A 1JCYA 4JTDA 1BKSA 1TV5A 3GG1A 2ACRA 4P7NA 2GJXB 3GHUA 2E40A 4OE7A 2ZRXA 3W7CA 3H7VA 3IJ6A 4U31A 2J47A 4ZXLA 5J5RA 4ZR8A 5H91A 1GOQA 4QE5A 3LGGA 4AIBA 1V6VA 1TREA 3WEOA 1XYBA 3QR1A 4G5DA 1UZ4A 3NL3A 3NYDA 3W82A 1E1EA 4DYKA 5XIAA 2VX6A 4H9MA 2O56A 1OK6A 2ZUVA 1XX1A 2PTWA 1UKSA 2WW5A 2YDRA 3H12A 4DNMA 1AJZA 3EMZA 1EUAA 3W84A 3R89A 3N04A 1Z8AA 3FSUA 3CO4A 2VDHA 4MB5A 1UP3A 3WKZA 1TTJA 2JKEA 4OJYA 4CD8A 1P6WA 4J27A 3GO2A 4AIUA 4F0HA 1E70M 1GOXA 3LBOA 4O4WA 4A05A 1JXJA 5E09A 4A21A 1LF1A 2XINA 4H4IA 1R5YA 1EEXA 4LOCA 1IEQA 4W86A 4KS0A 4K7YA 4LY4A 4PBGA 1ZJIA 1XGDA 2INFA 1A0EA 4LUYA 2DT2A 2IPFA 1Z42A 4ZA0A 4WCJA 3PNZA 1PYFA 3MT1A 2OU4A 2J88A 4DVOA 3K8KA 1O68A 3CJPA 2I5GA 2HVNA 2D2OA 3W7DA 3GG8A 2HEJA 3UD6A 1OJXA 3WFAA 4DO5A 2QCHA 4LCQA 2VWTA 2OMAA 1EF3A 3Q94A 1T8XA 1PPIA 4C6BA 2D3NA 1V6YA 2P76A 4W88A 1RLCL 4HCHA 5E9AA 1CW2A 4M6VA 1CXIA 1K4HA 2WSRA 2W27A 4L9YA 3GH4A 2FJUB 4LH8A 3UNDA 5HINA 3B9DA 4G7FA 4DO6A 3HMJG 4PRRA 4PCTA 3GR8A 1DJNA 2J77A 5C55A 1KM4A 1XH0A 3PZVA 4FNQA 4HP5A 5G4WA 3AHTA 1MNZA 4X3ZA 3MO7A 1K03A 2G3IA 4P8XA 1XYLA 2WZEA 2X1UA 2RAGA 4RJEA 1G4SA 2R1KA 3SZ8A 4BQ2A 1GOWA 2ZRWA 2CU0A 3N2BA 4RDZA 5I78A 2Y8VA 1EO5A 3VX1A 3ZFHA 2OO0A 3V1HA 1XM3A 4IWWA 4Z1DA 2Y7EA 1M7JA 1GG1A 3WF3A 4AWUA 4L6DA 4YS1A 1ZPTA 1PSCA 4PUDA 1TCMA 5JU6A 2YXGA 3NVDA 4HNLA 3VNMA 1WUEA 3GTIA 3UJEA 3B8VA 1H7XA 4LUSA 5CPOA 1WPCA 3SUTA 2PDJA 4H2HA 4ADSA 4JL2A 2OELA 3ZQ9A 3KS5A 2WKLA 3R8HA 1A0DA 3Q4DA 1CGTA 3MBFA