3PZGA

I222 crystal form of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
357
structure length
357
Chain Sequence
b'FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila
molecule tags Hydrolase
total genus 155
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzgA00
1UUQA 3T2PA 1C92A 1CGUA 1M03A 3SUWA 1GPFA 3AZSA 3IJ7A 1KB3A 3POCA 3VGHA 4AC1X 1H0GA 3MMWA 2J7HA 1H2JA 3AIUA 1KWGA 4U5KA 2PWFA 4K68A 3D3AA 3W4RA 4IUGA 1TVNA 1FH9A 3AZRA 3VIFA 4CCDA 2BY2A 5I77A 3ZO9A 3ZT6A 4EAMA 1QI2A 1Q6GA 4M24A 3BSHA 3CIVA 1J10A 4DWSC 5IFTA 1KBKA 5CLTA 1CXFA 1WO2A 1V6YA 3VMNA 1WPCA 3AHZA 1KR1A 2DH3A 3MU7A 2WXDM 3THDA 4J3UA 3VDCA 1HJXA 1GQLA 1HKJA 1QNQA 2E0PA 5A6AA 3BAYA 4FLOA 5C8BB 2DDXA 2XFYA 1PJ9A 4GI9A 4ATWA 4P8VA 2WZIA 4S3KA 1JYVA 1J0HA 1L8NA 4W89A 1UWIA 5I23A 3AMLA 4EKJA 4CU8A 1IT0A 3GZAA 1J12A 4PTMA 3T0DA 1MW1A 1WDRA 1MFVA 4PTXA 5CG0A 3OLIA 3N18A 4PMZA 5A8NA 1PBGA 3SUVA 6A3HA 2YL5A 4HOZA 2GFTA 1TCMA 3KE0A 2VX6A 1W9PA 1CGTA 1E0VA 1HJUA 2C8NA 3CHCA 4UQEA 1XC6A 2G3MA 1JGIA 4MJ4A 5DF0A 1K6AA 3PHAA 1KXHA 4W8LA 3WEMA 4D6IA 2XVPA 5E9AA 3WENA 5D9PA 4L4OA 2RGLA 3N12A 4AZBA 3WBEA 1IV8A 4UTFA 2CBUA 4U3CA 4KH2A 1UR1A 5ABHA 3BC9A 1B3VA 3BXWA 5D9OA 1BYCA 4GZIA 4F66A 3GYCA 1W3LA 2G41A 2WZEA 4CU7A 4AZCB 2JIWA 3WDHA 2J4GA 1O7AA 1JXJA 4PCTA 2J25A 3PZMA 4DUXA 1XSJA 5E09A 3AIWA 2VMFA 1RP9A 1UD8A 4N42A 4J3VA 3VIOA 1A47A 1EDGA 3SCVA 2X0YA 1WZLA 3VNYA 1B30A 1E73M 4NRRA 3WDQA 3VD9A 1CWYA 1E6PA 3WUBA 1GUVA 4UFHA 1XCWA 1PX8A 4N0RA 1CPUA 4HTYA 4BQ3A 1CECA 1MW2A 3WH8A 3CPUA 3WH6A 3KL3A 2PWHA 3B8SA 2VJXA 4MAVA 1R87A 2ZX8A 4FK9A 1E9LA 1XH1A 3FNDA 5A2CA 3ZM8A 2W62A 2WK2A 1E0XA 4JL1A 3QOKA 1G5AA 1LJYA 4H2CA 1CTNA 4IPNB 3RCNA 1Q6DA 1MW3A 4D71A 1TR1A 3HN3A 3II1A 1S46A 3RDKA 5CXPA 1XH0A 1BYDA 2EPOA 2VNCA 2WVVA 2GUYA 4CGTA 1BTCA 1CBGA 2Z1SA 2ZICA 3RMEA 3TTOA 4UFKA 1W2PA 3UG4A 3G6LA 3GM8A 3MUY1 1V6UA 3SCSA 3N15A 2J75A 3L4WA 4HMEA 2VX7A 4AW7A 3RILA 3CLWA 2XSAA 3LMYA 1UH4A 3LPFA 1XRVA 9CGTA 3WNOA 3BCDA 3ZSSA 1NOWA 1ZBVA 4JAWA 4OKDA 2HISA 4BCEA 1XD0A 1GONA 2J7EA 4J7RA 1MQRA 4LYQA 5CQ1A 1CZ1A 1TVPA 4OOUA 3AIEA 1K9FA 2VUYA 1HXJA 1EO5A 3IJ9A 2OSXA 4RE2A 1W32A 5A1AA 3W28A 2FHBA 4PMXA 2D2OA 1DWJM 4LXFA 2QMKA 4AZGA 4W86A 1CXKA 3WD3A 2DSWA 1E55A 2WPGA 3DC0A 4RL3A 1PX3A 2BV9A 2V5CA 2YLAA 3S2CA 1ZS2A 3MUAA 3ARYA 1UR4A 5BXTA 3F5JA 5M03A 5ECUA 1CYGA 2X0HA 3SCWA 4AZHA 3ZJ6A 4HZ6A 2CKSA 3VIJA 1JZ8A 3ARQA 1PEZA 4H8HA 1UOKA 1V3MA 2VZSA 1TMQA 4WKHA 3WQWA 2JE8A 3SURA 5JBDA 3T09A 3VU2A 4UR9A 4ZE4A 4J27A 4AZIA 1H0IA 2PWDA 4D6EA 1JIBA 3BAJA 2XYLA 2D20A 3AMGA 3WF2A 1ZL1A 2XVKA 3MV01 1Q6FA 1HKKA 1OGBA 2ZX9A 3NYDA 2J62A 4H8VA 4BQ5A 1UR8A 2EPKX 3KWXA 4HU8A 5EFFA 3E1F1 3N04A 4M56A 4M29A 1C3FA 3I3BA 1KCLA 1JG9A 3KL5A 3AS0A 2JEPA 2WB5A 1XD1A 3ZSTA 3L4ZA 3FW6A 1O6IA 2GDVA 1D7FA 4JCMA 3QHOA 1G0CA 2WAGA 4KRTA 4CKQA 4UQDA 1E4IA 3AOFA 4AZCA 1ZBWA 1HF6A 2OYMA 1JF6A 4CU6A 3WSUA 5ABFB 5CPSA 5HNNA 1ISZA 3CZLA 2E9MA 2JFEX 2BNJA 1E4MM 5JUVA 1VJZA 3BAIA 3OLGA 1B9ZA 2D3LA 3AHYA 1W1VA 3G6MA 3WH9A 2VCAA 3M7SA 1TUXA 2WLZA 3WELA 1V3LA 1NM9A 1I1WA 1V6XA 1U30A 1VFMA 4X0VA 3U5UA 5DO8A 1JDAA 5DEZA 2GK1B 1J18A 4GIAA 4ZENA 2WVSA 5D4YA 4HPHA 5I2UA 2G3IA 2CEQA 1EHAA 4CD6A 1F4HA 4UOQA 3OZOA 3FHQA 2UY2A 2WMJA 2BY1A 1TE1A 2CYGA 1EXPA 4AIUA 2NT1A 4QAWA 1JFXA 3HJEA 4YN5A 4W7WA 3VX0A 3WY1A 4PMNA 1V0KA 2DQXA 1CDGA 4EE9A 3FXYA 3BMWA 3VIHA 2XVGA 4MDOA 1W9DM 2YBUA 3ZQ9A 1GOQA 5I5RA 2ZWZA 1KGXA 3QOMA 4V27A 1W1TA 1WKYA 1FP8A 3WD1A 4W84A 5LA2A 2XVNA 5CSYA 1V02E 5BYWA 4HMDA 5A69A 1WZMA 5EBAA 2PF0A 3MMUA 5FKYA 5CJ5A 2Y24A 4EK7A 3WFZA 2AMGA 2QPUA 4HP5A 1BLIA 2J78A 4AD2A 4NRSA 3VIGA 3EDFA 4AD5A 4B9ZA 3MUIA 3SCRA 4B3KA 5A8OA 1BVNP 1OT2A 4TOQA 3BAKA 1CLXA 1UZ1A 1KCKA 1N82A 4DUWA 4FF5A 3PZ9A 1VAHA 1VBRA 1CGXA 2XGIA 3B9EA 3CBWA 1E0WA 3FAXA 3K4AA 1QBAA 2B31A 2J7FA 2UY5A 2VL4A 5M17A 1JF5A 3TA9A 2WMKA 2E9LA 1PZ3A 4QCFA 1UKSA 2WCSA 1G94A 3ARUA 5A95A 3WUEA 2V5DA 4B15A 1SFSA 5FL0A 3BH4A 3UR7A 3PZNA 2A3HA 2J7GA 1R8LA 1BYBA 1KQZA 2VO5A 1ZJBA 2FHFA 1IZJA 3O6AA 4W7VA 3WF3A 1GQKA 2OWXA 1Z32X 5DMYA 1V08A 4ML4A 2QF8A 3LPGA 3ZOAA 3EDDA 4CVWA 4JKKA 2CCRA 3TTQA 3DYMA 3VVGA 1OT1A 1XV8A 3WNMA 4TVUA 4RE4A 1TZ7A 1ZJAA 1BVZA 1EH9A 1HT6A 3SIMA 1M04A 3F5LA 5HXMA 2DH2A 1NWUA 3N17A 1ISYA 1NWTA 2CETA 1W9VA 2AAAA 2YL8A 4JIEA 3VM5A 2AOSA 4FLQA 4UNIA 2EQDA 4WLCA 1LG1A 2G4FA 8CGTA 1TFVA 3T0BA 1CGWA 2DSVA 4LX4A 1OD0A 3T0AA 3W38A 4P8WA 4AMCA 3VNZA 4QCEA 2Y4SA 4JCLA 5D8ZA 2WLYA 2A3CA 2YL9A 4GKLA 2CBIA 3ARXA 4W8BA 1LWHA 3VTRA 2PI6A 3W26A 3APGA 3W29A 4HZ8A 2ZE0A 5EFDA 5BXRA 5D9NA 3ZMRA 4HOXA 1OCQA 1OM0A 1KR0A 3DHPA 3WQ8A 4AISA 1QVBA 1HKIA 2J47A 5FOOA 2WC4A 4OIFA 1B3XA 2GK1A 2WANA 2X8RA 2XM2A 2G3NA 5AYBA 3VMOA 2PC8A 2Y8VA 1MYRA 4PMDA 1JZ7A 3GDBA 4U33A 1UWQA 4P8XA 4TUFA 1H09A 1JD7A 2BHZA 4PSRA 4IPLA 1VFOA 2Z1KA 3WDRA 4LQ1A 1BQCA 1QHPA 4KGLA 1BHGA 2CNCA 4MNKA 4BS0A 4TXEA 1OD8A 2WHKA 4AIEA 1DWGM 2GDUA 5BWFA 2YDQA 1E4NA 3GNOA 1JAKA 7CGTA 4JKLA 4AZ6A 4MADA 1D3CA 1NWRA 2V3EA 3GTNA 1JZ3A 3VD7A 1LF1A 3AMKA 2EPNA 3NSXA 5GNYA 1E43A 1B31A 6CGTA 2UY3A 5LYRA 4MDPA 1DHKA 3ALGA 5GPRA 4OBSA 1FOBA 2WVUA 2DSKA 2WSKA 2PBOA 5A8PA 3VGEA 2BHYA 1BPLB 1C8XA 1WAWA 3T08A 3M46A 1DWFM 3CUJA 3LPPA 1B3YA 4JFTA 1WDQA 4DM1A 3MSGA 1EGZA 1E6QM 4PYSA 1Q6EA 4LYPA 3L4VA 1WDSA 3M6DA 1GOKA 1CGYA 5IFPA 1UR9A 5FD0A 1MQQA 5KEZA 4ZFMA 2BVYA 5IXEA 4TX8A 1XHGA 4C7FA 4L4PA 1FFQA 2WMGA 1W91A 3GXMA 2D23A 1JZ5A 4UOZA 2UY4A 4BZYA 1K9EA 2X1IA 4AZ7A 5EMYA 1HL8A 1LQ0A 3TTSA 1UG6A 2CESA 1CNVA 4QLKA 3U7VA 4DWSB 1CXIA 1UA7A 3OLEA 3GXIA 1MVYA 5A6SA 1D2KA 3A47A 1JYWA 5A94A 2IXVA 3OGSA 3VGBA 4RE3A 5C70A 4D6CA 4F8XA 3CHEA 1GOMA 4W5UA 2ZX7A 3IJ8A 3PZGA 4D6HA 2C0HA 3OG2A 4BA0A 3EDJA 3DHUA 2OYLA 3AXIA 4E4PA 5FL1A 1SMDA 3GNPA 3NIYA 2EPMX 2PBGA 2X2YA 4GXPA 1TG7A 1B2YA 3GBDA 4MPKA 2V3FA 5BRPA 4PSPA 3WQ5A 4OUEA 1SMAA 4Z2HA 4PUEA 1QI4A 4HA1A 2YKKA 2Y8KA 1UKOA 2VX5A 2XSBA 3VIIA 1CLVA 1UD4A 2D0HA 2WWDA 5E6YA 1JZ4A 5BRQA 4BQ4A 2MANA 1NQ6A 3OZPA 4MNJA 4M1RA 2CIPA 5D9MA 2V3GA 4URIA 5E0CA 2OYKA 1F4AA 3O9NA 4E2OA 1UKPA 4W7UA 2XVLA 1H1NA 4FLSA 2V38A 3SCQA 3W24A 1U33A 1OIMA 3K8LA 1B3ZA 4W5ZA 4FLRA 3FN9A 2DIJA 2X09A 1W1YA 2F2HA 3WFLA 4ACYA 1H3GA 1UZ4A 3OGVA 4TTGA 3CHDA 3FY1A 3WEZA 4AY1A 2ZWYA 2VCBA 1B1YA 5DT5A 3CH9A 4CN4A 2YJQA 4AWEA 1VJSA 1NOFA 1E6NA 1UHVA 2XWDA 3ZJKA 3CO4A 1V3KA 3BAWA 4CCEA 4NF7A 5A6BA 1J01A 1BF2A 3OLDA 2A3BA 3VM7A 1K9DA 4M81A 3AQUA 3WUFA 1OB0A 5I79A 2GSJA 2E40A 3SCNA 1W9BM 5F7UA 1QBBA 1YQ2A 5LA0A 1RPKA 1E1FA 1H41A 2XGBA 2VOTA 3ARSA 1MXGA 1OBAA 2JEQA 3W53A 2A3AA 1UD2A 3ZIZA 4W87A 3KEHA 3VIMA 3VGGA 3VDAA 2J7CA 4PCSA 3PTQA 4HA3A 2XIIA 4V2XA 4W8AA 3WMBA 1WZKA 2OWWA 4M8UA 4OBRA 1ZBKA 2EPLX 2DSUA 2BVDA 4CN1A 4WSJA 4IISA 2VT0A 4JHZA 3BMVA 2EJ1A 3M07A 4CUCA 1BYAA 4GI6A 4PMYA 4UCFA 2EXOA 3WKZA 3L4XA 3FHAA 1J11A 4YHEA 3WUGA 5EB8A 3N9KA 2DT2A 1X6NA 2WCGA 3I3EA 3A3HA 2WMHA 2XUCA 1BFNA 1HJWA 1RP8A 3K1DA 5JBEA 2ZXQA 4DWSA 2G8ZA 4X9YA 2J8FA 2W5FA 3CZEA 2A3EA 1EA9C 3CZGA 4TX6A 2NSXA 1H49A 3CMGA 4PMRA 1TA3A 4AEEA 1EQCA 2EO7A 3HU7A 4PRWA 1MQPA 1US2A 3WF0A 5HBFA 1GHRA 2OSWA 3VINA 4PMUA 2YA0A 5C71A 5CSUA 1QNRA 5HPOA 3VOCA 1W3KA 1QPKA 4UQBA 2VRQA 2WBKA 3K8KA 4HZ7A 1DP0A 3CUGA 4UFJA 1JYXA 1HKMA 1ZBCA 3SUTA 1R7AA 1UQZA 1OGGA 1UWUA 4XV0A 5CPTA 2W92A 1M53A 1DWHM 4FMVA 3AIRA 3QGVA 2J74A 4PMOA 4PUDA 4R27A 5E70A 4DM2A 3MS8A 1BGAA 2WBGA 1WE5A 1ODUA 4XZBA 4Y7EA 4CD4A 4J3WA 2W61A 1W9UA 1C93A 4W88A 1NP0A 1HL9A 3QR3A 2VR4A 1UKQA 1MXDA 1QW9A 5KZ6A 3RM8A 1B0IA 1Q6CA 4GI8A 1KFWA 4H8UA 4Z2GA 1W2VA 7A3HA 1BGGA 1WZAA 3T2OA 1HNYA 3UG5A 4U5IA 1GZJA 3UCQA 3TOPA 4X0NA 5I6SA 1QNPA 2WWCA 4MB1A 4Z2LA 1NH6A 2WW5A 1QHZA 3B9DA 1C8YA 3AROA 2IUZA 4UZSA 3W6MA 1E1EA 3A6OA 3MANA 4YPJA 3IAPA 3MV11 4QDMA 1GOWA 2WHJA 3WNPA 4W85A 4S3JA 3ARRA 1VEPA 1PZ2A 1J0KA 3AI0A 1V3IA 3N11A 3W81A 1OIFA 4MNLA 4ZE5A 1VEMA 3A4AA 3AMCA 3DYOA 1G01A 1BAGA 1H5VA 3AFBA 1E72M 3WQVA 4P7NA 5BXSA 1OWQA 4MAZA 1UD5A 3RM9A 1GCYA 2ZUVA 3AICA 4Q22A 4F9DA 2CBJA 2GJRA 4MNMA 3UR8A 2XJ7A 2TAAA 4J3XA 4KMQA 2WZHA 1J0ZA 3OA5A 5BROA 1GQJA 2YA2A 1WB0A 3PZQA 4PBGA 3PZUA 2QPSA 1E6ZA 1V02A 1UD3A 4JFUA 4OJYA 1E40A 1V3HA 2VQUA 3U5YA 1AMYA 2CHNA 3GH7A 4KGJA 1WNOA 3ZR6A 3K8MA 1JD9A 2E3ZA 3GH5A 2C7FA 4GO8A 3W25A 1NP2A 4NZCA 3SCTA 3WDPP 4LGXA 1LL4A 1PX4A 4MJ2A 4UFMA 1E4LA 1KGWA 1I75A 5E0FA 4Q7NA 4C7DA 1HP5A 2OLHA 3ARWA 1CGVA 1CENA 4U31A 2XHYA 4F79A 3CUIA 3CZJA 4PTVA 1GOIA 4TVCA 1FP9A 4ATLA 4R5EA 4GZJA 4B9YA 4JZ5A 3A4XA 4CD5A 3VILA 3AHVA 2ZUSA 4JFWA 3AIBA 2JALA 4ACZB 4ATDA 2CHOA 2D0GA 1VENA 5BXPA 3UETA 3CMJA 4CN6A 5JBFA 5I3DA 2Q8XA 5DT7A 4DUVA 3PBGA 2BY3A 4WF7A 1XCXA 2NT0A 3VGFA 1KGUA 1GW1A 2E8ZA 2WHLA 4D6FA 4LYRA 3GXFA 3I3DA 1H4PA 1ECEA 1W3HA 2QV4A 3RIKA 2VQTA 1QHOA 1DEDA 2VRJA 2XG9A 3OIHA 2VR5A 1GNXA 4HMCA 4PMVA 3WNLA 1CXHA 1AQMA 2QLYA 3NDYA 2ZX6A 2XM1A 4OOZA 3UEQA 5CZKA 1PIFA 1GQIA 3JUGA 1AVAA 3MKKA 4GZEA 1LG2A 4QFUA 5A8MA 1UWRA 2VCCA 3WDIA 3ARZA 4AD1A 4H04A 2D3NA 2ZUWA 5A3HA 4D6GA 3VDHA 1EQPA 2CPUA 4ZXOA 1FHDA 1KBBA 2PWGA 3POHA 3EDEA 1E3XA 1Y7VA 4KWUA 5HPCA 3AYSA 2Y5EA 4D1IA 1LWJA 2PWEA 3AHXA 2BVTA 3CHFA 1GVIA 2VURA 4DWSD 1FHLA 3PZIA 1JNDA 2DIEA 3TP4A 1JYNA 1M7XA 4C7GA 1LLOA 1R85A 1EO7A 3WD0A 1KWKA 2J7BA 1V0LA 2JF6A 1JDDA 2JF7A 2ZXDA 2YA1A 1BG9A 1HVQA 4UQ9A 3WF1A 4GO9A 4D1JA 3RM4A 5AC4A 4Z2JA 4UQAA 3CGTA 1BG4A 3WD2A 4XX6A 2X05A 4JFVA 1V6WA 1UQYA 1HP4A 3VIPA 1UH2A 5I0DA 5A2BA 3AZTA 3W27A 4HU0A 1E6XM 2E8YA 3OGRA 4D72A 3U7BA 4P7QA 5M3WA 2FH8A 4UOJA 4JL2A 2WSPA 3THCA 4KRUA 3F4VA 4UZUA 3ZJ7A 1C91A 1CEOA 1JI2A 4NSBA 2XPKA 3RO8A 3IAQA 5A8QA 4M80A 1UYQA 2GJPA 3ALFA 1G9HA 2WC7A 1RD6A 1US3A 4D6DA 3VUPA 2GVYA 3NSNA 1KXQA 1E56A 1P6WA 3SCPA 1E70M 2W4XA 4UFLA 3WNNA 1VB9A 2BXZA 3N1AA 1QW8A 3DYPA 5AC5A 1FH7A 3GH4A 4UFIA 2UWFA 1GORA 5TD4A 1C8QA 1CXLA 3L2LA 2F8QA 2XWEA 3EBVA 4NI3A 3BSGA 1TA3B 4TVDA 4P7OA 3IK2A 3N13A 3SEPA 1VF8A 2XIBA 1AQHA 3L4YA 4ZEPA 4P7LA 1R86A 1W1PA 4XUYA 3L4TA 1HJVA 4JHOA 5A6JA 3AYRA 5I24A 1FH8A 2DSZA 1ITXA 5HDRA 3NUKA 5ABEA 5IHSA 2ZIDA 1NWSA 2BHUA 5ABGA 3WN6A 1CIUA 1UA3A 2FGZA 1QOXA 4UQCA 3EYPA 3PZOA 1E6SM 1E15A 1E5JA 3NSMA 2V3DA 1LL7A 3W82A 3VMPA 2FGLA 2XFFA 3WD4A 8A3HA 1HIZA 1ZU8A 5A6MA 3WQ6A 1V0NA 2O9OA 1QI0A 4QLLA 5CGTA 4ACZA 2QHAA 1ISXA 1QNSA 4GINA 2YOCA 2J77A 5GNZA 3EMCA 1I1XA 4H7VA 4AD4A 5JIWA 1Q4NX 2NW0A 4OZOA 5CPQA 3WBAA 1WCGA 2YIHA 3CUFA 2WHMA 1EDTA 4MB3A 3TONA 3QHNA 4W93A 2O9RA 5HOSA 2F61A 1GJWA 2BY0A 1EHNA 4WIWA 1DWIM 1RH9A 2VVNA 3VDBA 2W63A 2WNWA 3EDKA 5BCAA 4GQRA 3AIVA 1C90A 4A3HA 1HX0A 1M01A 2CBVA 4CVUA 2VC9A 1HJQA 2ZXAA 2J7DA 5M5DA 2OWCA 1W3JA 4WSKA 2IXUA 2RGMA 2ZX5A 4XB3A 1JDCA 3WL1A 1JI1A 1YHTA 3SCOA 2ZUTA 3MO4A 1XSIA 2VVSA 4WKAA 2E4TA 2FHCA 3BAXA 1KQYA 5A6LA 2YDSA 2VX4A 1UWSA 5IDIA 1DTUA 4WK9A 3K4DA 3MMDA 5AYIA 3NDZA 1OINA 1VRXA 4MTVA 3CUHA 2FDMA 3WQ4A 2EEXA 1IZKA 3AIQA 2CITA 2ESCA 4B16A 4J3SA 1ITCA 4TTUA 1WDPA 5A2AA 3OB8A 4JKMA 3SUSA 3VPLA 3LPOA 3GXDA 2E9BA 3RJYA 3EMQA 3T2QA 2VRKA 1ODZA 1UR0A 2YDRA 1MW0A 4P7RA 4WJXA 3AHTA 3ARPA 1K9TA 2YBTA 3VO0A 2YL6A 3F5KA 1H11A 3PZTA 2GJXB 2ZXBA 3UESA 2VTFA 3ZT7A 1SR0A 1QNOA 3IANA 5D8WA 2HVMA 3W37A 3TTYA 3AXHA 4JFSA 3SCUA 5A6KA 2WMIB 1E3ZA 3ZR5A 3BLPX 2ZUMA 4LPCA 1XSKA 4A3YA 2D22A 4H41A 1XH2A 3WEOA 1X6LA 1V03A 1GJUA 4GQQA 3UG3A 4QP0A 5AY7A 1CXEA 4GPNA 3KZSA 3ZJ8A 2D24A 3WH7A 4PMQA 5DFAA 2VZTA 3K46A 3W6LA 2VI0A 2O9TA 1J0YA 3RPMA 4HA4A 1LL6A 2VZVA 2FH6A 3VD5A 2DPEA 1EDQA 3CZ8A 4U2ZA 3WNKA 5CLWA 1JFHA 4F9JA 4B3LA 3GNRA 1ZB5A 1UWTA 1B3WA 1PIGA 4MB4A 1XYZA 4ZXLA 3PN8A 4J28A 3AXXA 2ZUUA 3HMCA 4P8UA 1JAEA 1E71M 1AQ0A 3VIKA 1UH3A 3AS1A 3CTTA 2YLLA 1OSEA 1GOOA 2J8GA 3MUZ1 1E6RA 1ESWA 3RJXA 1NARA 3VGDA 3B9AA 3L4UA 3VD3A 2VZUA 1V3JA 4HPGA 1MFUA 1XGZA 2BS9A 2DT0A 1VFUA 1G1YA 1E5NA 5E6ZA 1DWAM 1SYTA 1V0MA 3NCOA 4CD7A 1VIWA 1NOUA 3PTKA 4AXNA 3A4WA 1J0JA 1R7OA 3VKKA 3WL0A 4XZWA 3WH5A 3ZT5A 1KXTA 1L0PA 3J7HA 3VD4A 1V6VA 4A4AA 3BLKA 6TAAA 3DECA 5IHRA 2WVTA 2ZOXA 1QI5A 3FAWA 1VEOA 2WKGA 2WCAA 2WC3A 3W0KA 2XTKA 3CZKA 3WIJA 2W91A 4D6JA 3ARTA 3WMSA 2BXYA 1VBUA 5CGMA 4AZ5A 1FA2A 2QMJA 1JNEA 1PPIA 2W67A 4WKFA 3NJ3A 2Y2WA 1GHSA 3AISA 5FIPA 2CERA 1J9YA 2D0FA 1HJSA 3QHMA 5LA1A 4U3AA 1HN1A 2WYSA 1GVYA 2J79A 2PB1A 4PEEA 3SUUA 2XFRA 4BQ2A 4J3TA 4AYSA 5JIPA 1ISVA 1EOMA 2DT1A 1JZ2A 3BCFA 4E8DA 4IM4A 3OBAA 4AIOA 5GQBA 2JIEA 4EANA 3AS3A 1OGSA 3GBEA 1KXVA 3U57A 1XYFA 1C7TA 1J0IA 5FCZA 1MWOA 4HOWA 5I78A 2D1ZA 4PN2A 4U2YA 1U2YA 1UR2A 1X1NA 3VX1A 1C7SA 3ECQA 1UKTA 2WM0A 2O9PA 3ARVA 5GNXA 1W9XA 3KL0A 4PTWA 1A3HA 1JXKA 3S6TA 1QI3A 4YHGA 4BF7A 2CKRA 3PZVA 4CD8A 3AJ7A 3MSDA 2WKLA 4V28A 3UERA 4AEFA 4E8CA 1EOKA 5A6BD 1PAMA 2WMFA 2W66A 2GJXA 1JL8A 3WDJA 4AD3A 1VFFA 1UD6A 1BSIA 1ISWA 4Z2IA 1EIBA 4CCCA 7TAAA 3PTMA 2DEPA 2EBNA 2WMIA 3L2MA 3WMCA 3EMZA 4MB5A 3BGAA 2G3JA 2OSYA 2DGAA 2ZUNA 1JZ6A 3AS2A 3O2LA 2CXGA 1WP6A 2WVVB 3AMDA 4QLJA 4M82A 3WF4A 1FFRA 4AD0A 1HVXA 2VZOA 2DT3A 3D5HA 1B90A 4Z2KA 5ABFA 2BFGA 2O92A
chains in the Genus database with same CATH superfamily
1IIGA 3CV2A 1GEHA 2ABBA 2QCHA 3IJ7A 1KB3A 3MMWA 1I0BA 2NX1A 3EA3A 4K68A 1IWPA 1LT7A 5IRPA 3W4RA 3TCSA 2I9EA 3CAQA 4CCDA 1OY0A 3ZT6A 4LYKA 4EAMA 3KW3A 1JPDX 1Q6GA 4M24A 4O19A 4UTIA 3BSHA 3LU2A 4JDBA 4RDVA 5K7JA 3PWIA 3NG3A 3V1HA 1XIBA 3QV9A 1VBHA 1WPCA 3L0NA 4DXKA 1RLCL 3SAZA 1FWDC 2HVNA 2WXDM 4LAKA 3TQKA 2A5HA 3DUGA 1OFBA 4GE8A 1X96A 1MNSA 3JU2A 5A6AA 1OG0A 1P6BA 2VFGA 5G2HA 3UWEA 5C8BB 1FQ0A 1LYXA 3UD6A 3FVDA 2G3FA 4NJJA 4S3KA 1J0HA 1L8NA 1UWIA 5I7GA 5EPDA 1H7NA 1YDYA 3ELFA 4QG8A 1JVNA 3TR9A 3T0DA 3EEGA 2X7WA 4ZB2A 3OLIA 1NELA 2PDPA 2QIIA 3B8DA 1K6WA 1TX0A 3GX9A 1ECQA 1PBGA 2GFTA 1TCMA 3KE0A 2XFWA 1E1CA 4NJIA 1S38A 1ZCCA 3N6QA 3ITCA 4UQEA 3ITLA 3CM4A 1JGIA 5DF0A 1KXHA 4CNPA 3T0CA 4W8LA 1MSSA 1ONWA 5C9WA 3WENA 5D9PA 3REQA 1OC6A 4UTFA 3LNPA 4U3CA 1VRDA 4NXKA 1B3VA 2QV5A 3KOWA 4O12A 1XLDA 3TFCA 4CU7A 5DRCA 4PCTA 3GG1A 1EUNA 3VCRA 1XSJA 3AIWA 3PM6A 1A5CA 4MIMA 1QWGA 4GH3A 3VIOA 1A47A 3R6IA 4E8GA 1VR6A 2O55A 3WDQA 4DAFA 1KV5A 2OEMA 3APTA 2BG5A 1A5MC 5JMUA 3WUBA 1EEXA 3W71A 2REQB 4BQ3A 1S1PA 1CECA 4CQ9A 3CPUA 1Q2SA 4LUIA 2YR1A 3MSYA 1P0DA 4L6HA 1R87A 3KX6A 3FNDA 2W62A 2WK2A 1G5AA 1CLKA 4XIMA 1MW3A 2PRLA 3H53A 2HMCA 3B3DA 4MWAC 1S46A 3INPA 3PNUA 1R3VA 1XH0A 3WK0A 5AC7A 4DI8A 2EPOA 3CYVA 4CGTA 1BTCA 1ADSA 4QNWA 2Z1SA 4C1KA 4UTJA 4UFKA 4JX4A 4BR1A 4ZODA 4C1NA 3N2XA 3W1UA 4UIOA 5FF3A 1F3TA 3DGBA 3L4WA 4HMEA 3BL3A 3RILA 3CLWA 3PBUA 1IXNA 4LUTB 4ZOCA 3LPFA 3QY6A 2BLEA 2VFIA 2PDKA 1LOLA 2AMXA 5FJUA 1WKFA 1SZEA 4G6CA 4BCEA 2CLMA 4J7RA 1MQRA 1RBLA 1GG0A 3GFYA 5F2GA 5GVJA 3B8IA 4RE2A 5A1AA 3W28A 9XIAA 2FHBA 3QY8A 4H00A 4PMXA 3CQ0A 3KBSA 1DWJM 4LXFA 4W86A 1CXKA 5CZ0A 2Y89A 4B4HA 3RPDA 4YCOA 3MBFA 2YLAA 4QRNA 2DW6A 3E2QA 3BOFA 3MB9A 3OEXA 3E0FA 5CZJA 4GJIA 2ZZ1A 4HZ6A 3QSTA 4OV4A 2HV5A 1LRTA 5F2LA 1PEZA 1V3MA 3R8RA 3CMFA 4Q4KA 3SURA 2JGQA 3T09A 4J27A 3BDKA 3RF9A 3GW3A 1OGBA 4GH1A 3H55A 3FK4A 4L1XA 2IQTA 1TPFA 1UR8A 2EPKX 1QPNA 3KWXA 4G7FA 5EFFA 1MDRA 3ORWA 1IIHA 3PSVA 4M3PA 3R11A 2GJLA 3HPSA 2HVOA 5K9DA 3VKAA 3IV3A 2FPVA 3FW6A 3KOXA 1D3GA 2CLOA 1DE6A 1G0CA 2WAGA 1OX4B 4KRTA 4YTUA 1E4IA 4GOAA 4WOQA 5EGRA 4LBSA 1W1ZA 1R3YA 2BNJA 4H1ZA 1VJZA 4JQ3A 4ZO8A 4IF2A 3BAIA 3AHYA 3G6MA 2ACRA 3UFYA 1TUXA 3TLQA 4H9ZA 1YYAA 3UY8A 1U30A 5HWJA 2Q8ZA 4W9TA 4MVAA 5DO8A 4AG0A 5DEZA 4GIAA 4HJWA 4ADSA 2IKIA 3A12A 3DHDA 4ADTA 3STFA 1EHAA 4CD6A 1F4HA 4UOQA 2VR2A 2X1RA 4EPKA 1RK5A 2FMOA 4ECLA 1OHLA 1P7TA 4MKSA 1EF3A 4QAWA 1JFXA 5LXEA 2ZA3A 2PDUA 3WY1A 1PKMA 4PMNA 3TA6A 1CDGA 1R2TA 3BJSA 1QW7A 3UZJA 2VDHA 4HHHA 3TYCA 4IFKA 4QG9A 3C2VA 3IRDA 3ZS4A 3ZQ9A 1OEPA 4K1WA 1RK6A 2WPBA 4L5ZA 5H8MA 4S23A 4MWAE 3LLDA 4WSHA 4W84A 2ZE3A 2XVNA 3BV7A 3NVTA 1OFDA 1BEUA 1HFBA 2QCCA 3NFUA 5EBAA 3CQHA 5CJ5A 2HJPA 1EZ2A 4NASA 3NQ2A 4AD2A 4B91A 3T8QA 3S5SA 4LALA 2RDTA 4B9ZA 3SCRA 4F0RA 2QVHA 1OT2A 4TOQA 3N3MA 1CLXA 3LG3A 1FWNA 5DXYA 1VAHA 2JGYA 1CGXA 4PODA 3CBWA 2FZBA 1QBAA 3RGTA 3G24A 1AMKA 5M17A 1J2BA 4IQEA 5GJMA 3TA9A 3RNDA 3RLGA 4LVGA 4QCFA 5AHLA 1V5XA 2WCSA 5CC6A 3M0XA 3IRSA 5A95A 3WUEA 4F48A 4DJFC 2V5DA 4A35A 4B15A 2FTPA 4JIQA 2QUMA 5CZTA 2QCDA 4HSHA 1EC8A 1BYBA 3ZFHA 1ZJBA 3TV8A 1GPWA 1BRLB 3NZPA 1XGEA 3LBOA 3WF3A 1GQKA 1Z32X 1BKSA 1DHPA 2VEKA 1T6MA 2D73A 1SQ7A 3TTQA 1XUUA 3DYMA 1QTWA 1EJWC 1FWGC 2AGKA 4X22A 3C2RA 3BTNA 2PLJA 2C71A 1IR1A 3SIMA 1M04A 3COTA 1GZ1A 3UPBA 5HXMA 2DH2A 4XD5A 3NM3A 1SZGA 1B4KA 3VM5A 2Z6IA 2VFDA 3CV1A 3TN6A 4GUIA 4HK7A 4C60A 4GBUA 1CGWA 3T6CA 3QVQA 3T0AA 3W38A 3MMTA 4AMCA 1OYAA 4QCEA 4Q8MA 1IQ8A 1OYBA 1QDSA 2WLYA 3KXQA 3ABOA 3SR7A 1QMLA 1SW3A 2Y7EA 4GFIA 3APGA 3W7HA 3GC4A 2Y63A 4OWGA 2ZE0A 5BXRA 1RQEA 2ZADA 1VFSA 3D6NA 4JHMA 3ZMRA 1YADA 3DHPA 4AISA 2V30A 1SR9A 3WLRA 3SGGA 4OIFA 4NZ3A 2INFA 4OUIA 2FFCA 3MP4A 3ANVA 3JS3A 2PCEA 3DZ1A 4YVXA 2PC8A 2VEPA 2Y8VA 3THQA 4DO4A 5D02A 3O8AA 4U33A 4B3ZA 1AL7A 3IPWA 4P8XA 4Y9PA 2A4AA 2BHZA 1OCBA 1YTDA 1XBYA 4IPLA 3LQLA 3W88A 4M6QA 2G4JA 4LQ1A 4KGLA 4C5YA 1BHGA 4PL2A 1M9HA 4WD0A 2TYSA 2YCLB 5FEWA 3GUWA 1RAKA 1JAKA 1GKPA 3SGUA 7CGTA 4ZQPA 3QPZA 1XI3A 2NQLA 1NWRA 1S5TA 4X2PA 3EX6A 1IGSA 1LF1A 2EPNA 3NSXA 5GNYA 3SQMA 1E43A 4CNNA 1SW7A 1V79A 2DP3A 2CLIA 3WZ0E 1DJNA 2DSKA 1FWFC 1XYBA 3V5CA 2FVLA 5A8PA 3JR2A 2BHYA 2DFAA 4XZIA 2I5GA 2B7NA 4XO7A 4HCLA 5IDZA 5FEPA 3T08A 5K4XA 3RK8A 4GYPC 3M46A 5LHFA 1U83A 3CUJA 3LPPA 1B3YA 4JFTA 1WDQA 3WFAA 4DM1A 3LLXA 1R9ZA 3MPGA 3W23A 1I9CB 4LYPA 4M0XA 2BMBA 1GOKA 1S1RA 2F6XA 2NV2A 3UZ5A 2F6UA 3HA1A 5FD0A 3UG8A 4ZFMA 3TYDA 4H9TA 2C3ZA 4C7FA 1F61A 3FJ4A 4BZYA 1G4TA 1K9EA 3QQ0A 4IP7A 1LQ0A 1HO4A 1SZNA 3BJTA 4RZ5A 2HS8A 3KTXA 1XLHA 1R30A 4DWSB 1SZFA 1T7LA 2IXVA 3GG7A 5C70A 3KZPA 2J9XA 3IJ8A 4S2CA 1UR3M 4NHVA 5AOUA 3OG2A 3I6RA 2Y61A 3I7SA 1DJXA 1KO0A 5DXXA 1TCDA 3H12A 4A22A 4AVOA 4L9YA 3GNPA 2WJFA 3NIYA 2EPMX 4Q8UA 1UUMA 4JTQA 1IF2A 3GBDA 5BRPA 3WQ5A 4OUEA 1SMAA 2QGYA 4PUEA 1NAL1 4HA1A 2GPTA 2QCGA 5E6YA 2WWDA 5BRQA 4J5NA 2JBMA 4J2PA 1KA9F 4GHRA 4S3AA 1NQ6A 1RJQA 4TIMA 2XH4A 2ZFAA 3OZPA 4MNJA 4RKAA 5HUOA 3STEA 2NUXA 2CIPA 3XISA 2BASA 1I0DA 3TN4A 2OYKA 2TODA 3SRKA 1ITQA 2GSEA 1KC7A 2PDXA 1H1NA 3MI3A 1EBHA 3TFXA 1MUWA 3W24A 1PHWA 3HGRA 4C1LA 2PPGA 4TTGA 2B7QA 2CLPA 3FY1A 4G56A 4GMEA 5BMXA 4AY1A 5DN1A 1KRCC 1B1YA 5DT5A 2VFHA 1B9BA 4AWEA 1NOFA 2BBFA 3VCCA 2ON3A 3ZJKA 1RPXA 3D47A 1XLGA 3CO4A 3BLIA 2NXHA 1FBAA 2A3BA 3W73A 2GVEA 4C6EA 3E38A 3AQUA 1Q7MA 3WUFA 5I79A 2Z00A 2GSJA 2E40A 3SCNA 1SZRA 4OHQA 1YQ2A 3AUJA 2VOTA 3ARSA 4MZ8A 1TJ2A 1V7YA 3CWNA 4IGHA 2A3AA 3SADA 3KEHA 5E5CA 4QM1A 3VIMA 3VDAA 1ZAHA 4K7VA 4W8AA 3UPMA 4QX4A 3GZ3A 2HEJA 4OBRA 3P8JA 4FI4A 4OTKA 2JK2A 4EACA 5LGXA 4JNYA 4LOCA 4JHZA 5EL1A 1J2WA 5AHIA 4C6JA 3MP3A 4NZFA 3V7PA 4O17A 3M07A 4CUCA 1BYAA 4DBEA 4GI6A 3B04A 4UCFA 1RQBA 1GKQA 4HIBA 1TQJA 4B5WA 2EXOA 3QH2A 3WBXA 4BK9A 1EP3A 4AWTA 1AD4A 3N9KA 2DT2A 5DANA 2XZ7A 3KS5A 2WCGA 3I3EA 1XM3A 2XUCA 1XBVA 4CNUA 4PUKA 1KFKA 1SW0A 4X9YA 2VC7A 3MJMA 2J8FA 5EYWA 2NSXA 1EA9C 2INZA 2AKMA 1H49A 3LK6A 4PMRA 3UXKA 3HU7A 1MQPA 4FR6A 4CNOA 3NO5A 2ZTKA 4OT7A 4HZ7A 3GG0A 1DP0A 1M1BA 4UFJA 3NTYA 3KS6A 1UWUA 4XV0A 1O60A 1GVFA 4G7EB 4ZO6A 5DY2A 1XKYA 1BKHA 1TV3A 3HQOA 3PP7A 2HXUA 5M1TA 3PNZA 3EB4A 1DV7A 3MS8A 3VNKA 1BGAA 1ODUA 5AYXA 1KRMA 4CD4A 2W61A 1JRCA 3TSMA 1W5OA 3R43A 4XD4A 1UKQA 1B0IA 1FRBA 1KFWA 5C7VA 3GK0A 3GNNA 4O53A 5CJMA 3UQNA 4NXSA 1WZAA 3GTIA 1HNYA 2QW5A 4YYFA 1KBJA 4MLRA 4X0NA 2WWCA 1A5AA 4PH6A 1P48A 3C2EA 2DZXA 4KERA 3IEBA 4LF1A 3AROA 2BOFX 1TPH1 2OT1A 3UWWA 4YPJA 3IAPA 3NQGA 1F2JA 1XIEA 3LYEA 1GOWA 1PCWA 2X16A 4W85A 1AK5A 4QEEA 1VEPA 1RA5A 1AW5A 1MDLA 1V3IA 4HMNA 4DAIA 1QAPA 3V5FA 4MNLA 3QY7A 1WXYA 3N3TA 3AAMA 2WV8A 4RK8A 4O1EA 4MY1A 1GCYA 3HM7A 1RY0A 2CBJA 4MNMA 3R79A 4O4VA 2XJ7A 1TB3A 3NO3A 3SW6A 1K8YA 3HG3A 2YA2A 3PZQA 1FVPA 3H6OA 3BW4A 4JX6A 1ALDA 5EMMA 1EC7A 1LQAA 1V02A 5DCBA 4JFUA 1TZZA 1WNOA 1FHUA 2FPTA 2E3ZA 2C7FA 1R6WA 2X7VA 1NP2A 3GU9A 4LGXA 1G67A 4UFMA 1E4LA 1O1HA 1TPVA 2NX3A 1NF7A 4HQVA 1HP5A 4LAZA 1CENA 1RHCA 2XINA 2XHYA 3QKEA 2FMNA 1X38A 4PB5A 4I3GA 5D2XA 2PWUA 3CZJA 1JRBA 4S38A 1GOIA 4ATLA 3P62A 4R5EA 3RR1A 4GZJA 3DG6A 4FNUA 1VP5A 4KWSA 4I9MA 3AHVA 3A3XA 4JFWA 4L65A 2ZZ2A 2JALA 4ACZB 4ATDA 1GEQA 3DFPA 1GYLA 3WQOA 5I3DA 3UU0A 5DT7A 3CAVA 1RA0A 3LSBA 2NT0A 1KGUA 2J8TA 1OF8A 1RVGA 1TRIA 2PRMA 2VRJA 2FTWA 4NG3A 5J5DA 2O7QA 2GYIA 2XM1A 4OOZA 6ENLA 4JN8A 1PIFA 1MEIA 1AVAA 3JUGA 3V75A 1LG2A 3MDWA 5LXXA 3WDIA 1XUZA 4R33A 2WZMA 4H04A 3ZLGA 4MKNA 3AC0A 2E68A 1KCZA 1EJ7L 1NEYA 4ZXOA 3S2NA 3POHA 2YZ5A 2RDXA 1VPXA 2C1IA 3NR0A 3P7YA 4A8IA 3AYSA 3N4EA 4M6PA 3R0DA 3ZWTA 3VOIA 1LWJA 1JNDA 3QQ1A 2DIEA 2E67A 3UY7A 3EKGA 1LDCA 5G1MA 1JYNA 1XF0A 1Y0EA 1R85A 1DVJA 2FB3A 2JF6A 1JDDA 4LVAA 1BG9A 1HVQA 3H2AA 4GO9A 3DFHA 3RITA 3CGTA 1BG4A 2GQ9A 4JBRA 1EXBA 4F2BA 1V6WA 1ZJIA 1UQYA 3AZTA 2E1WA 2E8YA 3BURA 3W1QA 4JOMA 1GGOA 1QK2A 3PUOA 1W31A 3QXBA 4IIEA 2ZVIA 5FESA 4NSBA 1NFPA 4Q4PA 1NDVA 1W8GA 3GHTA 3V1PA 4RE0A 4Q6JA 1DOSA 4LEFA 4D6DA 2GVYA 4UUIA 3NSNA 3VAVA 4A2SA 4HCDA 3S6DA 3UWUA 1XPYA 2BXZA 5LIXX 2QS8A 5KZDA 1FH7A 4UFIA 2ZA1A 2YCJA 5TD4A 4EXQA 1JCJA 4M6UA 4IQDA 1BTMA 4HK6A 3D46A 3BSGA 1TA3B 4FX8A 4TVDA 1KM0A 2ZKMX 3IK2A 5HANA 3NL5A 1DJHA 2XIBA 3EWWA 1K77A 4ORIA 4ENLA 1R46A 5CPOA 1KV8A 1HJVA 4JHOA 3AYRA 3EZ4A 3LQGA 1FH8A 2DSZA 1XR2A 1NWSA 2ZIDA 4KFNA 4RLIA 4B5TA 1CIUA 2FYMA 2PAJA 1Y65A 4JQ2A 3FX4A 4TX9A 3SDOA 5HQMA 2Q02A 1RUSA 4GC3A 4UQCA 3W2KA 1E15A 2IPGA 1YEYA 3B05A 1ME8A 4LTSA 1DJWA 1ICPA 1KKOA 4TO8A 2PLMA 5CGTA 3W22A 3W7RA 2BB0A 3STPA 3HPAA 1W37A 1PS9A 2NW0A 4C90A 1XRFA 4G1NA 4GVIA 3WBAA 1M41A 2RDUA 2I1OA 2CFFA 2P8BA 3QHNA 4WGXA 3DHFA 3ENLA 2OX1A 5BNKA 1RH9A 3BK0A 2W63A 1A53A 3EDKA 5BCAA 2DZBA 4GQRA 4UMAA 1W1B1 3DXIA 5DMMA 2VC9A 4LCSA 3MQTA 3HFYA 5C2GA 5M5DA 2GGJA 1TV5A 3H7RA 4QIUA 3HB9A 3VUSA 4FPSA 3MHFA 3WL1A 1EWEA 2XU2A 3VFLA 4Q8NA 1M68A 5DLCA 1TJ0A 2VDIA 2R8WA 3LGDA 5EA9A 5A6LA 1F07A 2YDSA 4JTUA 5IDIA 3M43A 4Z08A 4MZ1A 4KWVA 3WQ4A 2EEXA 3E0IA 3Q2DA 4H9XA 4JTRA 4JKMA 4NP7A 5AKQA 2E9BA 4HT3A 3FYPA 1SGJA 3W00A 1U1UA 3O3RA 5LNRA 2YDRA 3WYZA 3OHMB 4DQWA 4P7RA 3ARPA 1F5ZA 3VXGA 4LAUA 2YL6A 1T0OA 1IGWA 1FWCC 1RLDA 3CL7A 3ZT7A 4RX0A 5AB3A 1ZNNA 4CQDA 3TTYA 4Y9MA 2YCIX 3AXHA 2CLLA 4JFSA 3SCUA 3VE9A 1SPQA 3CUZA 1P0KA 2D22A 1RBOB 4NZ4A 1V03A 1S3HA 3CAWA 5AY7A 4BHYA 2D24A 4PMQA 3WJWA 1MRAA 4QQ3A 3B4YA 3H24A 1XYLA 4HA4A 4O0KA 2VZVA 3CZ8A 3G77A 2TMDA 4ZBCA 4AC7C 3GNRA 5D03A 4ASTA 1XDLA 4YIWA 3S2JA 4FP1A 4ZXLA 2WM1A 3GKAA 4HBKA 4P8UA 1JAEA 3P14A 1FY6A 4GNKB 3MKCA 4EPBC 2ZZ7A 3DG7A 1UH3A 2CXEA 4AU0A 3B8TA 2HCVA 4JY9A 4K2SA 1TSIA 3CTTA 3HQNA 4MLJA 3TC7A 3CL6A 3M0VA 3S5YA 3MUZ1 3NZQA 4WDUA 3KCJA 2Y1HA 3DOPA 2VZUA 1V3JA 1MFUA 2HRWA 1AJ0A 3S4TA 2DT0A 1I60A 3DIPA 4B5NA 3NCOA 3BLFA 2Y62A 4XBKA 3R89A 2H8ZA 5AN7A 3FJ6A 3A4WA 3M7WA 4LV9A 3VKKA 3MSRA 3C2OA 5G4EA 1Q13A 4AH7A 4TQTA 1GYMA 3VD4A 3LGGA 1V6VA 3CYJA 2PUZA 3EWZA 2G95A 4GJ1A 3UWZA 3XINA 1QI5A 3FAWA 1VEOA 1FCVA 3JZUA 3I68A 3TX9A 1I4NA 4KF1A 3W0KA 1UP2A 2QNEA 3WIJA 1FUYA 1VHCA 3GKFA 1A3WA 1GVRA 5AHMA 3MWCA 4AZ5A 1PPIA 6ALDA 2ISDA 3NPVA 3K5XA 3AISA 1TKKA 5FIPA 1HJSA 2CW6A 3FCPA 4O1CA 3S0CA 1Q7QA 2WNNA 2NZLA 3UZZA 2PB1A 1EJXC 3ABRA 3AYVA 4L7ZA 1SFLA 4JEQA 3BCFA 1XINA 3OBAA 3REQB 3W72A 3AS3A 3GBEA 4LEQA 3U57A 3T0TA 1DQWA 4UTMA 2D1ZA 4LWWA 2Y6ZA 1C7SA 3VZZA 1WDWA 1ME7A 1A80A 1JXKA 3WLSA 4F0HA 1YDVA 4DO6A 2NXGA 1ONRA 3IGUA 4AEFA 1FWTA 1P1XA 5LNSA 1H7WA 4KPLA 1XLAA 1NU5A 4Z2IA 1WUEA 1EIBA 3PTMA 1O5XA 1LZOA 4K8GA 4ZOAA 1K3UA 5FJPA 3BGAA 1IEVA 4PZVA 3O2LA 4C6PA 4AB4A 5FAJA 5BOFA 2DZUA 1Z7AA 1FFRA 1HVXA 2V8ZA 4Z2KA 1TPWA 2Y70A 1F3XA 4C1NB 2O92A 3DFTA 1UUQA 3T2PA 1C92A 5AVNA 1UUOA 1CGUA 1GPFA 4DO5A 5EU9A 2J7HA 1H2JA 3V0TA 5FEZA 3TWBA 3H2NA 3W01A 3PJWA 3H21A 1ZALA 1I2RA 5DBUA 3C8NA 4IUGA 4N4PA 2P53A 1KRBC 4QS6A 1NFGA 3VIFA 1F8IA 3ZO9A 3NQ8A 1VFLA 3QF0A 1FX6A 4S3BA 4BWLA 3GVWA 3CIVA 3W2JA 4JICA 3TVAA 3QRHA 3B9OA 1WO2A 2HNHA 3VMNA 3VOJA 3RX4A 1KR1A 2DH3A 3GYEA 1V51A 3THDA 2PZNA 1HJXA 1GQLA 4AF0B 1QNQA 2FFIA 1VFTA 3GD6A 3URQA 4FHAA 1J5SA 3AWNA 4QISA 4FLOA 2VOMA 5I23A 1UB3A 3C0JA 3AMLA 4EKJA 4CU8A 1IT0A 3S5OA 1ICQA 2ODOA 5HA7A 2PP0A 4PMZA 4FXSA 3K2GA 4LB3A 4RZ6A 2NWRA 3A23A 2GQ3A 6A3HA 4HOZA 1O5RA 3LOTA 4Y6GA 4DYEA 3TJ4A 1XWYA 4QQUA 3GIQA 3T9PA 1E0VA 2E28A 4ZZ9A 2YPIA 3W07A 3F4DA 4EOUA 1XC6A 4A8NA 1TPB1 4QSFA 3LZ5A 3NGJA 3WEMA 4D6IA 5IBXA 1MNZA 1QPQA 2RGLA 3FKKA 5F1UA 1UR1A 5ABHA 1XDJA 2Z26A 1KTNA 5CBBA 2GSHA 5U7SA 4F66A 1YMYA 4JNMA 1W3LA 2E6YA 2G41A 2J4GA 1O7AA 1JXJA 4G8TA 2OB3A 2NVAA 5HJYA 4N42A 1EDGA 3SCVA 4OFCA 1WZLA 4ZVJA 1B30A 3AU2A 3P6LA 1XLFA 1CWYA 5CAHA 3WQDA 1E6PA 3GXNA 4PUMA 1GUVA 4UFHA 1XCWA 3PBYA 3PBMA 3W02A 1CPUA 1MW2A 2V5BA 2YW3A 3WH6A 1JDEA 3B8SA 3M5VA 1OX6A 4E3VA 4MAVA 3H26A 3KRSA 2ZX8A 4KEUA 2PDMA 2R1MA 1E9LA 1XH1A 3LS9A 3MVIA 3ZM8A 4JL1A 3QOKA 1KFLA 3NEHA 4H2CA 4DXXA 1Q6DA 4C6KA 1TR1A 4JEJA 3A22A 1P7TB 5CXPA 4XG1A 4O15A 1BYDA 2VNCA 2GUYA 3UCCA 2WNZA 3SY1A 3W1PA 2OX4A 4B4FA 1W2PA 3OOQA 3TNOA 4IFKB 2Z29A 2INEA 3G6LA 4JPGA 5DCEA 3GC2A 2NVCA 3SB0A 4DY1A 3BUVA 3W2MA 4X9SA 2E5CA 4HTBA 3WK2A 2VX7A 4AW7A 3LHZA 1PXGA 2NVDA 3LMYA 2RUSA 4QE5A 9CGTA 1KKRA 3WNOA 4Y9OA 3BCDA 3ZSSA 4HNOA 1LLZA 1NOWA 1ZBVA 3IVSA 5K9XA 1BQGA 3GSMA 2R1NA 4JAWA 5TNVA 4RNFA 1YLVA 2VC5A 1XD0A 2W27A 3MC5A 2GVJA 5CQ1A 1A5UA 1K9FA 2ISWA 1XS2A 4HHMA 5FACA 3HIJA 4HGXA 1W32A 4Q8VA 4K39A 4AZGA 1E55A 2WPGA 2YCLA 3GVQA 1PX3A 4DX3A 3RG6A 3MHGA 3PWGA 3BLLA 1ZS2A 3MUAA 3ARYA 5KETA 3WLNA 1PDZA 1DIEA 5BXTA 4X3ZA 3W7MA 2X0HA 3W7JA 4IPJA 3QZEA 2CKSA 3VIJA 4IMAA 2BSLA 3ARQA 1UOKA 2GUBA 1TMQA 3ONCA 3WQWA 3BSMA 3LHTA 1FWHC 1TMLA 3VU2A 1H0IA 1XYMA 4PR4A 4GK8A 3FA3A 3UYIA 3ZWSA 4D6EA 3BAJA 4FEZA 1DQUA 2PDLA 5F4WA 1M7PA 2ZDSA 3SECA 4ALDA 1ZL1A 2ZX9A 4DJDD 3QEZA 1AZ1A 1PKYA 1TELA 5D37A 4WQ6A 3LCIA 2RJGA 4M29A 3SRHA 3QC0A 3F2CA 4KRZA 7TIMA 7XIMA 1JG9A 3KL5A 3AS0A 3ZSTA 3L4ZA 4J4KA 1O6IA 2YXOA 1D7FA 4JCMA 1ZUAX 3O16A 4H9YA 4AZCA 4CU6A 3WSUA 3PWAA 3TC3A 1CT5A 1Q8JA 3CZLA 4XZ9A 4HSNA 2E9MA 2JFEX 4S3FA 1B9ZA 2D3LA 1OG6A 1W1VA 3WH9A 3GRIA 2QCEA 2WLZA 3WELA 1V3LA 4X63A 3TEVA 2QZRA 2PDHA 4X0VA 3U5UA 3H4WA 2HQAA 2PA6A 2FKPA 2KAUC 2WVSA 4HPHA 4RNHA 2J27A 3QPYA 4RXGA 2PFHA 1Z69A 3OZOA 1FDZA 4IGMA 2WMJA 4H83A 1Y5XA 1TE1A 2CYGA 1EXPA 3ABSA 2NT1A 4YN5A 3ABXA 4W7WA 1V0KA 1IXQA 5D2WA 4EE9A 3FXYA 1P0NA 2XVGA 3NL2A 1Z44A 1W3TA 4XAFA 3E9AA 1GOQA 2DVXA 5K3VA 2MNRA 1GTHA 4YVVA 1W8SA 1X1ZA 3NQDA 4V27A 2FZDA 5LA2A 3WLJA 5AZ1A 1YTEA 4QHRA 4ZCWA 5A69A 4IL2A 1WZMA 1RR2A 4OQVA 4HPNA 3P80A 3MMUA 2YDAA 3NQBA 4US5D 2QPUA 4LRTA 1UP0A 4XVEA 4HP5A 3RN6A 4NRSA 2QUNA 3EDFA 4MSSA 3EWUA 3BAKA 3IGSA 2AKZA 2DUXA 4I5UA 1H51A 1UZ1A 2FQIA 1N82A 4DUWA 2OO6A 2XGIA 3Q58A 1E0WA 3K4AA 3URAA 1XLEA 2J7FA 3W7LA 1ZJHA 2W79A 3VC5A 4J40A 1XIHA 2WMKA 3IUHA 2FVKA 1G94A 1AODA 4C6BA 3ARUA 3N34A 4L64A 2V2HA 1D8WA 3IK4A 4JD4A 5FL0A 1F6YA 3IACA 3UR7A 1R8LA 1KQZA 4LNCA 4IH3A 4PRTA 4ZFCA 2FHFA 3MUXA 1IZJA 2FJKA 4YMZA 3UZYA 2PLCA 5DMYA 3TYUA 3O0KA 4HYRA 4ML4A 4YCPA 2ACSA 2QF8A 3GO2A 3LPGA 5CZSA 4CNTA 3LB0A 4JKKA 1EX5A 2J13A 1OZQA 4N6EA 4I9JA 1HW6A 1JUEA 1XP3A 1UBSA 1XV8A 4U10A 1TZ7A 1BVZA 1HT6A 3E2RA 3F5LA 5LSMA 2GDQA 4HKPA 1TYGA 3DI0A 4HD5A 1ISYA 1NWTA 2CETA 3LM3A 2AAAA 4JIEA 2AOSA 1SSDA 2C79A 3W83A 4YTRA 1TFVA 3T0BA 4PCNA 1W1A1 3GVVA 3VK5A 1IWAA 2PGFA 3QW3A 4LX4A 4NY2A 1OD0A 4P8WA 4AAJA 3G1FA 3LDVA 4JCLA 1DORA 4IJBA 5D8ZA 3R10A 1N8WA 1W5MA 1XW8A 3W70A 1GWJA 3W29A 3JZEA 1J5TA 4HZ8A 5J04A 1IYXA 3PULA 4HOXA 1OM0A 1KR0A 1QVBA 5KZMA 1YDNA 2J47A 2HE8A 4Z0JA 1PIIA 3BJFA 3B97A 2IS7A 3STCA 1B3XA 1CCWB 2GK1A 2XM2A 3WLKX 1K8CA 3USBA 3QYQA 3UXLA 1MYRA 1Y5WA 1EGVA 5BU6A 3M0MA 1JD7A 3QC3A 4QROA 4LY8A 4JQAA 1ENUA 1VFOA 3C52A 2R6OA 3HGJA 5KSWA 3GFZA 4BS0A 2X41A 2XN1A 4AIEA 1N8FA 2GDUA 4H9VA 5BWFA 1JR1A 2YDQA 5E93A 1E4NA 1VBGA 1TV7A 5H2ZA 3EX4A 3C61A 4JKLA 3URNA 1JCLA 4MADA 1D3CA 3GTNA 2WKJA 3AMKA 3T1GA 3O0FA 1B31A 3HPFA 6CGTA 1PL9A 3IS4A 2UY3A 4Q32A 2WSKA 3CU2A 2PBOA 3NAVA 2QAPA 3PPCA 1LBFA 2C19A 4E38A 3OYXA 3PJTA 7PTDA 1JPHA 2Z2UA 5MKGA 5E9XA 1R47A 1TIWA 4WRHA 3GR4A 1V7AA 2G50A 3MSGA 1K7XA 1PWMA 4PYSA 5T26A 1GT8A 3M6DA 3R12A 2BGQA 1WA3A 2AL1A 2VUNA 2BVYA 4WXYA 5IXEA 3FJLA 4TX8A 1KBLA 1AH4A 1W91A 3GXMA 2D23A 1PB0A 3B9NA 3RRXA 4AZ7A 2ZRZA 3GVGA 2QAFA 4UNKA 4O8RA 3TTSA 2CESA 3EOLA 3PJUA 1D2KA 3A47A 1JYWA 5A94A 3OGSA 3VGBA 1FXPA 2CZ5A 4S3GA 4F8XA 3BW2A 4C6OA 4D6HA 1AZ2A 1VYPX 1KCXA 4INFA 9RUBA 2Z4GA 2WSQA 3M0KA 1DPMA 2OYLA 3A13A 3ME3A 3HFTA 4E4PA 5FL1A 3B8WA 3KOYA 1HO1A 1W1IE 4MPKA 2BZNA 3PTDA 1RVKA 2Y8KA 2DU2A 4GY1A 1UKOA 2VX5A 4N4QA 3GDMA 2WQDA 4BQ4A 1CI1A 4HNUA 3BWWA 2IQDA 2I5IA 3QZ6A 2WZTA 1BXBA 5FF2A 3TZNA 4M1RA 4URIA 3E12A 4U4MA 5E0CA 2QGHA 4R9OA 4E2OA 4Q7BA 4GZ7A 1UKPA 3DFSA 4ORMA 4EXBA 4BF9A 4DF0A 1L6YA 3K8LA 1FWEC 1JULA 3LX9A 2DVTA 1H3GA 3WEZA 3B03A 2VCBA 1NVMA 3RLVA 1A0CA 3M16A 2YJQA 5D04C 1VJSA 1QRQA 5CH9A 1DJYA 3LI1A 4EF9A 1EF2A 4MPQA 1VC4A 1V3KA 3BAWA 4MG4A 1VKFA 5A6BA 1J01A 2PU1A 1BF2A 3OLDA 5T9CE 2VD8A 3VM7A 1U22A 1K9DA 4M81A 2XN0A 4D2JA 4DBUA 3D3FA 1QBBA 3G3DA 3IJLA 3EPMA 3L0KA 2XGBA 1A49A 3TAOA 4GYFA 1AJ2A 3EKLA 1FKXA 2VC6A 4GUFA 4O18A 2J88A 4UC5A 2J7CA 1EX1A 3OVGA 5B7ZA 2QKFA 1DQXA 3PY2A 1KLZA 3WMBA 3FSTA 3IV8A 1WZKA 2GWNA 1FCBA 2OKOA 3IUDA 4M8UA 1OC5A 4CN1A 3G1RA 4JTHA 3AXMA 4WSJA 2VT0A 4YTTA 2EJ1A 1OFOA 1HTIA 2Y5SA 2J9ZA 2OZTA 4DJED 2B81A 4WUIA 3V16A 4E4UA 2R1LA 3LSCA 2A7RA 3O07A 2Y5JA 1LBLA 3FHAA 2ONEA 1J11A 4YHEA 1WV2A 2P1FA 4U28A 1X6NA 4ZL1A 3A3HA 5AYYA 1RP8A 2F9RA 2X1SA 3R58A 2GQ8A 2Z27A 8XIAA 4GVGA 2W5FA 1EUAA 3CIXA 5C55A 2E6FA 4JTFA 3RR4A 1TA3A 4AEEA 1EQCA 3N25A 4I8DA 3HZ3A 4US6A 5U4NA 1B5TA 2YA0A 3AWOA 3QKZA 5HPOA 2VRQA 2WBKA 4MFDA 3EXTA 4S3EA 3CUGA 4IPIA 5AECA 4JQ4A 1OGGA 5C9XA 5CPTA 2W92A 1M53A 1XIDA 4FMVA 3LCHA 4BI6A 3AIRA 4PMOA 4CLMA 5E70A 3EX3A 4V1YA 3MZNA 3VC6A 4XZBA 2P0OA 2ZTJA 1IZCA 4Y7EA 1L9WA 1W9UA 1C93A 1XPGA 1S2VA 4RNIA 2AL2A 2VR4A 3B0VC 5KZ6A 4IFRA 1Q6CA 5GJPA 3BGJA 2ZBTA 7A3HA 1BGGA 4HB7A 1FWAC 2XZ9A 5TAOA 4XO6A 4U5IA 4R85A 5E0KA 1TJ1A 3BZJA 5I6SA 1QNPA 2DZTA 4Q8WA 3SM0A 3U48A 1RCOB 4EPDC 2WW5A 3AUOA 3B9DA 2V9DA 3P0WA 1QUMA 3GIPA 4UTTC 4IZGA 1E1EA 3R8GA 1Q6OA 1AH0A 2ISFA 3SSJA 2WHJA 3WNPA 2Z1XA 4C6MA 3ARRA 1J0KA 1GVEA 3N11A 3W7PA 3GTXA 2A3LA 1OIFA 1MMFA 4ZE5A 3BLOA 3L66A 1PZ0A 3FIGA 1BAGA 1H5VA 3WQVA 4P7NA 5BXSA 4GY7A 3AICA 2DW7A 1V93A 2NQHA 2GL5A 4L61A 4J3XA 1J0ZA 4PTDA 3NURA 1UJPA 1GQJA 1RCQA 1OFAA 3VKDA 3FGCA 2VKZG 5I03A 2V2DA 5CEWA 2QPSA 2ASHA 5LNUA 4XAYA 1AUSL 2QULA 5D30A 1JUKA 4OJYA 1V3HA 2VQUA 3TW6A 2CHNA 1XBXA 3GH7A 4YU1A 3ZR6A 4H9UA 2AAMA 4LH8A 1YPXA 1QWKA 1JD9A 4TR9A 2VWTA 1FWJC 1O95A 4ICMA 2ZQ0A 4RDYA 3SCTA 3WDPP 2OTDA 5E0FA 5HR6A 4C7DA 1J4EA 3T8LA 4U31A 5LIWX 3I6EA 1LRQA 5AYZA 4PTVA 3E2SA 2ISVA 1Z41A 4TVCA 1FP9A 3M9YA 2EJAA 3RMJA 2OZ3A 4B9YA 3N19B 3GS6A 4QGCA 1LUCA 3VILA 3AIBA 1BXCA 1X7FA 4LVDA 1UZDA 2D0GA 3GNXA 1QATA 1VQTA 3UETA 1E51A 1Z89A 3G8EA 2Q8XA 1ZENA 4FALA 1SSGA 3VGFA 2H3BA 4E2BA 2WHLA 4D6FA 3BGGA 3GXFA 1RALA 1EL3A 1ECEA 1EP1A 3BG9A 1DEDA 3DG3A 1OK4A 2VR5A 3IIXA 3LV5A 2A6NA 5CCZA 4HMCA 1LOQA 4EAYA 1LWIA 3IIOA 1XQLA 3U9IA 1O5KA 3ZLHA 3HGSA 2OODA 2QLYA 3UEQA 4GUJA 3MKKA 4CNSA 4GCAA 5HNUA 4UWMA 4Z1YA 1Z6KA 1Q4WA 3EXSA 2QCNA 1WBHA 4MM1A 5A3HA 5LZLA 1PUDA 1EQPA 2CPUA 1W5PA 2D69A 1T40A 1NF0A 1DYSA 3R5EA 4BI7A 2YFNA 3FLUA 1XRTA 5CBJA 3KBVA 4A3RA 2FB2A 2PZ0A 1YE4A 4XKYA 3E5BA 2BVTA 2ALRA 3TUUA 1FHLA 3PZIA 2Q8LA 4KETA 1K03A 1QOQA 3W1AA 2Y85A 4IX2A 4GGHA 1ZHAA 3F2DA 1M7XA 3NNTA 1OADA 4J2MA 3PSWA 3QPEA 3E6EA 2J7BA 1V0LA 3PG8A 2JF7A 4UQ9A 2ZXDA 2VGGA 2QR6A 1IEXA 2DZVA 5AC4A 2IPWA 3N4AA 2HSAA 2F38A 3LN3A 3WD2A 3LBCA 3O6DA 3ZR4A 4ZO7A 2OFJA 1UH2A 2VENA 1XBZA 1AA1B 1A50A 3LCLA 1E6XM 4D72A 4AX6A 1XXXA 4Y2WA 3U7BA 3WQCA 3U3HA 4R53A 3AYTA 4KRUA 3NQVA 1K8XA 5B7YA 3ZJ7A 1H1ZA 2P5NA 3NPUA 3CV6A 4KT2A 1E56A 2YBVA 3WNNA 2I7GA 1ZTVA 4POCA 3M0IA 8XIMA 3VYLA 3EX2A 1T5AA 3R94A 5AC5A 3GH4A 1GORA 1CXLA 1SM9A 2P3EA 2VD9A 4PCPA 5FEXA 4HJFA 1VF8A 5H8UA 1XGDA 2PU0A 5HJXA 4AY7A 3L4TA 3GXPA 2XIJA 3E2VA 3G1HA 4HN4A 1XFCA 1B3OA 6PTDA 1QT1A 1PZ1A 3OW1A 2NQ5A 4PL1A 5TF0A 3WN6A 4QJ1A 2FGZA 3WO8A 3MTWA 3PZOA 3OQ8A 3KAOA 2V68A 2V3DA 3W82A 4NT0A 2R82A 1FDJA 2FGLA 4PBEA 8A3HA 1TZ9A 3GXTA 1W6TA 1ZU8A 4ZB5A 1CB2A 2X40A 2O9OA 4QLLA 4MWAD 5DX7A 2Y0FA 4H19A 1QNSA 2V69A 3IUIA 3MKVA 2PWVA 3EMCA 3KRBA 4OZOA 5CPQA 1SJCA 1WCGA 4HU4A 3OA3A 1EDTA 4MB3A 1OCNA 1NFBA 2HROA 3PPGA 4UXDA 2C16A 2Y7GA 2BY0A 1EHNA 4ERGA 3VDBA 3BMXA 2WNWA 1VJIA 2SFPA 4RW3A 3SY8A 4A3HA 4PUJA 2CBVA 4GD0A 1IT8A 4IP5A 5TIMA 2WQPA 2ZXAA 4XZHA 2XIOA 4C6IA 5BOEA 4ZTYA 2RGMA 1KFJA 6XIMA 3L21A 1JI1A 4KEVA 2ZUTA 3MO4A 4WKAA 2FHCA 2NV1A 3G22A 3BAXA 3HOJA 3W1MA 1CX9A 4IOTA 1KM1A 4F0SA 2VX4A 4X61A 3TMQA 4IWWA 3K4DA 1EYWA 1ZRQA 4N7QA 3QGAC 1NQKA 1VRXA 4DLMA 4MTVA 1S39A 4QJ3B 4QE1A 4AF0A 1IZKA 3AIQA 2CITA 4J3SA 1ITCA 4BWLC 3SUSA 3BG5A 3GXDA 3RJYA 4N9CA 4JTIA 1KW1A 4WXZA 1UR0A 2QDEA 4DPQA 4XWUA 4DO7A 2I5QA 3AO0A 2VGFA 4HNCA 2PGWA 4GC4A 1K9TA 2YBTA 3F5KA 3UPWA 3PZTA 3U0HA 4ZO9A 1QNOA 4L9XA 3IANA 2HVMA 3W37A 2IKHA 3KLKA 4AQLA 3ZVIA 4KCTA 2I16A 2ZUMA 3PB2A 1Q85A 1TTQA 3M41A 1UWAA 4H41A 3WEOA 1GJUA 4O52A 3UG3A 4QP0A 3WQEA 3ZJ8A 3Q45A 4GQ0A 3WH7A 5DFAA 3P84A 1UBPC 2WJEA 2VZTA 3K46A 2FH6A 3VD5A 4B2DA 2O4MA 4B3LA 2OQLA 1ML1A 2ANUA 4AVNA 4F0LA 1B3WA 1PIGA 1TJPA 2IPJA 3SJ3A 2V6AA 3MW7A 4J28A 2NXIA 2ZUUA 3UXDA 1E71M 3UWYA 5IM51 1B4EA 1JPKA 3AS1A 4E2DA 3LXBA 4MY8A 1TRDA 1OSEA 4LS0A 1XFBA 3NM1A 1YPFA 2FJUB 2UV8G 1E6RA 1ESWA 3RJXA 1RV8A 1IXPA 4S39A 3VGDA 3B9AA 2OOFA 2PLKA 5JU6A 1Y8BA 2YX0A 4XVDA 1XGZA 3GDRA 4QJ4B 3UNDA 2BS9A 3ES7A 1G1YA 1VBJA 3LD5A 1DWAM 1V0MA 4C91A 3WJZA 3PR2A 3E49A 1R7OA 1W54A 3WH5A 2PDGA 3N2BA 3B0UX 4ML9A 4A4AA 3BLKA 2GVGA 3DECA 2ZVRA 4I7WA 2XTKA 2PTZA 3CZKA 4DZIA 4ICCX 1OFEA 1KFCA 2QUTA 2PCQA 1VBUA 5CGMA 5EMJA 1H60A 2QMJA 3QTGA 1JNEA 2W67A 1M7OA 3NJ3A 3WQFA 4P61A 5I09A 3S42A 1Z3NA 1I2PA 1J9YA 4BEUA 1S5NA 3PFRA 4M19A 3BARA 1HN1A 2WYSA 2H90A 2PDQA 4PEEA 1SO5A 4JTDA 1X8CA 4IP4A 3APYA 2A0NA 2HBVA 1JZ2A 1TO3A 3UJFA 4IM4A 5GQBA 2CZDA 4PUWA 3IIZA 2BOEX 3TN3A 5FCZA 3M64A 4HOWA 4JXCA 4PN2A 3H7UA 3VNMA 4LVBA 3VX1A 5D32A 3ECQA 3M4HA 3ARVA 1GOXA 3QTPA 1W9XA 3KL0A 4FIRA 4G5DA 3S6TA 1QI3A 1O5QA 4YHGA 1H1YA 4DJFD 3EB3A 3EKZA 4LF2A 3KDOA 3KHJA 4QTGA 4MMWA 1UIOA 2WKLA 5J5RA 4YXGA 1DJIA 1JCYA 1ONXA 4E8CA 4FSAA 1KLYA 4I6KA 2GJXA 2NUYA 2I17A 3LUTA 1LM1A 1PTAA 5HMSA 1LORA 1VFFA 1UD6A 4FZIA 4RDZA 3T05A 2VM8A 1ISWA 4MKVA 4CCCA 4R3UA 4LVFA 3SN4A 2DEPA 4O13A 2WMIA 1A5SA 3P82A 4H8NA 3EMZA 3CNYA 2G3JA 2OSYA 1UJQA 4JTGA 2DGAA 2CXGA 2Z2AA 4M82A 3KBMA 3FJNA 3OTRA 4E6MA 4AD0A 5HJLA 2DT3A 3IIVA 3W7GA 1B90A 5BMWA 2E1DA 2BFGA 2HPMA 3NQ7A 1XL9A 1WYIA 2A21A 1QPRA 3SUWA 4AC1X 1VLWA 3G0UA 6REQB 3TLLA 2UZ9A 4DPPA 2DIKA 4U5KA 2PWFA 2BP1A 4IX0A 1N7KA 3QSRA 1XLIA 3D3AA 3GU2A 1Q3NA 1TVNA 3AZRA 1R5YA 5I00A 5I77A 3TQ0A 3C3NA 4NILA 1TWSA 3NQFA 3QV7A 2FZ8A 3C0QA 4XAPA 4FIQA 5G5IA 1KTBA 1PVNA 4DWSC 4GISA 3ZXWA 2QQ6A 4WDXA 2PEVA 4XZMX 3W75A 5HR7A 1UC4A 3VZXA 2I57A 3VDCA 3LRMA 4B2DD 1HKJA 3LA4A 3PC0A 3CV7A 1R9YA 2Y88A 1K70A 3BAYA 2DDXA 2XFYA 3W7QA 1PJ9A 2R9RA 3QR0A 4OBTA 4GI9A 4ATWA 4P8VA 2WZIA 4F2TA 1JYVA 3QMRA 5MF5A 3B06A 4LBRA 3D0CA 5XIAA 1YNQA 1J12A 4PTMA 1MW1A 4LBUA 4O28A 4EXAA 1MFVA 5CG0A 1JCNA 3N18A 2FDSA 2V67A 3SUVA 2YL5A 4LCRA 3L12A 3TW9A 3FA4A 5C2XA 2QUVA 2VX6A 3KLLA 5B80A 3CHCA 4TV5A 3R2GA 3VDGA 1E9YB 4MY9A 4MJ4A 2YCKX 4IHCA 3OYZA 4LJ3A 1K6AA 3PHAA 3TMLA 3OHIA 2XVPA 5E9AA 2OMAA 3BOXA 3N12A 3NQCA 1JCXA 1HKWA 5F2IA 2CBUA 3L0GA 4FOJA 4KH2A 3DU0A 4UTKA 3BC9A 1FCUA 4JIHA 3GYCA 2WZEA 4AZCB 4EIVA 1GG1A 1EJSC 4FS9A 2FTYA 4DUXA 4I8YA 3EX1A 2VMFA 3PF3A 4OGZA 4J3VA 1IEWA 2X0YA 3VNYA 1E73M 3LM7A 4NRRA 3W87A 3VD9A 2YZRA 4LU0A 3KTSA 4NL1A 1PX8A 1FWWA 2V2CA 1RY8A 4HTYA 5SWUA 3WH8A 3DFQA 3QLLA 3UJEA 4HPJA 4YWIA 3KL3A 3BVJA 4QSHA 2QJNA 4WOZA 5A2CA 3B8VA 3NOYA 4IIHA 1LJYA 3EWCA 1CTNA 4IPNB 1F74A 2H3DA 1OFQA 4RPPA 3II1A 3RDKA 5EKYA 2QJJA 3E0LA 2AQVA 1CBGA 3OP2A 3VCNA 3TZFA 5K4ZA 3OIXA 3UVAA 2HK0A 3MUY1 1P6CA 1V6UA 3DENA 3SCSA 3N15A 4DBWA 1R3QA 1N2VA 1X39A 4NVTA 4LC8A 1UH4A 1XRVA 3PVFA 4Q4OA 1R3RA 4AXKA 2WNQA 2XSXA 4RZBA 3PANA 3GNDA 1RD5A 2PS2A 3CJPA 2HISA 1GONA 3QJAA 1FWSA 3AIEA 1EKOA 1EIXA 1MXSA 1M6JA 3IJ9A 1IHIA 1TWDA 3TXZA 4S3CA 3CIWA 2D2OA 2EKCA 3U2ZA 2DSWA 1DXIA 3DC0A 3OZYA 2Z25A 4RL3A 1SFJA 3RU8X 1RSCA 2BV9A 2ZA2A 2V5CA 3IJDA 1C9WA 5REQA 3A9BA 5HNRA 4WZHA 1SVDA 1I45A 1P4CA 3GTFA 1CYGA 4GQBA 2X42A 3ZJ6A 1JCMP 3NL6A 1JZ8A 3W7IA 1POKA 3ES8A 4H8HA 2VZSA 4K1GA 4JTTA 2JE8A 3N4FA 3WJXA 3W86A 3K4WA 4B90A 4HCHA 4WEVX 2D2JA 4AZIA 3PAOA 2QJMA 2CZVA 2XYLA 2D20A 2F7FA 3WF2A 2XVKA 3MV01 3OZMA 1HKKA 3NYDA 1K4GA 1M65A 4H8VA 3HG2A 1US0A 4FNTA 3HF3A 4I5RA 4A2RA 4XAZA 1F3WA 4M56A 1TR9A 1C3FA 1ZY9A 3QM3A 1SJAA 4QR6A 3BZGA 1LRNA 2P8CA 3S9ZA 3QHOA 4UQDA 2QPXA 3AOFA 3VA8A 1XLKA 5ABFB 2HE5A 1R0MA 3DH7A 1XICA 1PYFA 4JN7A 2OR2A 4NU7A 1U5JA 4PUNA 1E4MM 5JUVA 3OLGA 3HPZA 5T91A 3FOKA 2QCLA 3VNIA 3T07A 5HMFA 1QCWA 1H7PA 1NM9A 5DQPA 1V6XA 3W74A 2ACQA 3C2FA 3SN0A 3WLOA 4H9MA 3JRKA 2GK1B 1J18A 2I14A 5I2UA 3O7UA 3BLEA 4ADUA 1F6KA 3MT1A 2OZ0A 4V15A 4AIUA 3HJEA 4ZMGA 1ZGDA 4I90A 5FSDC 3VIHA 2C18A 4MDOA 1SJBA 5HWMA 2HNEA 2C1HA 2RFGA 5I5RA 4GIRA 1RQHA 2HPIA 4HHPA 2A7PA 2PC4A 3ANYA 2PTYA 3QOMA 4P5UA 3WD1A 9XIMA 3FS2A 3PAJA 5BYWA 4HMDA 4RPQA 5F2MA 3W7DA 4UTUA 2PF0A 1ZAJA 5FKYA 4EK7A 4QITA 4DUOA 3ID7A 3GY1A 1BD0A 3RO6A 3KCOA 1BLIA 4MYAA 3W1LA 3VIGA 4Y8EA 4AD5A 6TIMA 1BVNP 1MUCA 2QDHA 3MCNA 5TBOA 1WDDA 3NVDA 5MKGB 1UPMB 3UW6A 2VWSA 1KCKA 4UTWC 3T7VA 3O15A 2FPYA 2QJHA 2VL4A 4NAFA 5CJNA 1JF5A 4GIYA 1W5NA 1KRAC 2E9LA 3GHSA 1PZ3A 2PSNA 1JDFA 3GTHA 3DI1A 1UIPA 1SFSA 5GJNA 3H4GA 3P2VA 2A3HA 2OQYA 2VO5A 1KM3A 4H6EA 2PRHA 4RV8A 3O6AA 2NUWA 3HV9A 2OWXA 4F0MA 5EY5A 4XBJA 3F1QA 5I3IA 2HDJA 1Z42A 3EDDA 1JEZA 3K13A 1PSCA 1VCGA 2CCRA 3PUEA 2PD5A 5AHFA 1EJUC 5L6UA 4RE4A 4R9XA 1DTNA 3S9YA 1YDOA 4E4FA 1EH9A 1K02A 4Y8FA 5XIMA 2POZA 1A0EA 2F2KA 3N17A 5LIYX 3W7EA 2YL8A 3B0XA 3EWDA 4FLQA 4JYDA 2EQDA 5T9BG 2QXWA 2G4FA 3F4CA 3RLUA 2Z0IA 3S1UA 3TJIA 3NPWA 3BOLA 3KVMA 5CKSA 4HNTA 1W0MA 2Y4SA 3P61A 4JTAA 2A3CA 2R1KA 3A3WA 3M0LA 4GKLA 2CBIA 4W8BA 1LWHA 2PI6A 3P93A 5KZEA 4V33A 3H2OA 3CXOA 2Z6JA 1FXQA 1B57A 3VOHA 3CASA 1OCQA 5CSSA 2OGYA 1HKVA 4DVOA 2WANA 1L6FA 2DV0A 1OFPA 4IL0A 4PMDA 1L2QA 2NV9A 2IQ0A 3HMJG 4TUFA 4DNHA 1SUXA 1A5LC 4GLEA 2EAWA 1YW1A 1XCFA 2Z1KA 1GQNA 2X1TA 3LXAA 1QHPA 1UASA 4J3ZA 4MNKA 4RR4A 1J79A 1DWGM 4YNGA 1TREA 1REQA 4NYUA 3B4UA 4RXFA 4IPPA 3CTLA 3UGVA 4AZ6A 1XG3A 4CEUC 2V3EA 3E02A 4XISA 3UZWA 4RNJA 3MO7A 5LYRA 1DHKA 5GPRA 3UXAA 4OBSA 1FOBA 3DBPA 3T4WA 2Y8UA 1BPLB 1XIMA 4B5XA 1V4YA 1VD6A 1N55A 3F03K 1C8XA 3RAOA 1WAWA 3FDGA 3LENA 1G4PA 5C5YA 3O63A 2IMRA 1O1ZA 3MYPA 1EGZA 3R25A 1E6QM 4X2RA 4D8AA 3L4VA 2R94A 1WDSA 5FJIA 4LUYA 4O1FA 1CGYA 5IFPA 3Q67A 1UR9A 3SN1A 1ZZMA 1MQQA 3IJIA 5KEZA 3V0UA 4L4PA 4IG2B 4KEZA 2ACUA 2WMGA 3QLDA 1PO9A 4FO4A 4UOZA 2UY4A 5EMKA 2X1IA 3JW7A 3M5ZA 4DEFA 3WX7A 2J24A 5EMYA 4Z1DA 1U1HA 1CNVA 4QLKA 3U7VA 2OEJA 2NSOA 1UA7A 3OLEA 3STGA 3GXIA 1MVYA 5A6SA 5HQLA 2HWGA 4D6CA 1OCJA 3CHEA 1T96A 1GOMA 4W5UA 2ZX7A 5I3HA 2C0HA 3DBNA 3EDJA 4PRRA 2YW4A 5A6TC 3V0SA 4BA0A 4DBDA 1FTXA 4HYWA 4O1BA 4ZQMA 3AXIA 3UWVA 3QYSA 4O57A 1SMDA 4H6QA 2X2YA 4GXPA 1TG7A 1R2SA 3I4EA 1T8QA 4FOUA 4PSPA 3T81A 2ALDA 4LUSA 3G8RA 1QI4A 4IUOA 2X30A 1ICSA 2XSBA 1OZMA 3VIIA 1CLVA 3RU6A 4IIDA 1JZ4A 2CLHA 2Z1WA 2MANA 2DZWA 3V5OA 3WBYA 3WLTA 4CCZA 2I56A 4QAIA 1E0UA 4P2VA 4IIBA 1EA0A 1QOPA 4HN8A 5D9MA 2V3GA 4REQA 3W76A 4Q8QA 1DIKA 4NIRA 2HZGA 3TIMA 4GY0A 2AL2B 3CQIA 4NZJA 1XIIA 3O9NA 5EMLA 4W7UA 3H2CA 2V38A 3OBKA 3V36A 1K7EA 1U33A 1OIMA 2P50A 3FN9A 2DIJA 3UJSA 1W1YA 3WFLA 4ACYA 4KQNA 4QG6A 1FWBC 2E09A 3CHDA 3BPWA 5AC8A 5BW6A 1Z9AA 2GZXA 3N2OA 5LNWA 3TYBA 1DIOA 3CH9A 1XDMA 1PE1A 5C9RA 1YRRA 2XWDA 1R3WA 4AWUA 4NF7A 2G0WA 4GVFA 3M47A 2O56A 5RUBA 3O05A 2NQ9A 1UMLA 2E5DA 4QBXA 4DB7A 3QMTA 1W9BM 1YXCA 2OGJA 5F7UA 4NZ1A 3K1GA 4K3ZA 1E1FA 1G4SA 1H41A 3G5EA 2EGZA 3MYOA 4MWAB 3FGCB 2JEQA 3W53A 4XD3A 1UD2A 4PULA 4E0CA 4W87A 3GR7A 4AWSA 5AVHA 3VGGA 3PTQA 4G2DA 2O7SA 4HA3A 5KINA 4HNLA 2XIIA 2OWWA 3EOEA 1ZBKA 3TYAA 2R24A 2EPLX 3C56A 4O4WA 3ZVHB 5JQ9A 4IISA 4L6DA 3N29A 3BMVA 4DZAA 1XLMA 1XLBA 3IGHX 4GBDA 5H6HA 1M5WA 3BQ5A 2PGEA 4PMYA 3S1XA 1XIFA 3EGJA 3U2OA 4RZ4A 3M5YA 3I7RA 1F3EA 3L4XA 2VGBA 3WUGA 1LUCB 5JH1A 5EB8A 4M51A 4QNEA 4K6AA 4AHQA 3L67A 1BFNA 1HJWA 5JBEA 5F4XA 2OT0A 3HG5A 3MY9A 3CZEA 2A3EA 5K9CA 5C9ZA 4EWJA 4QJ5B 2AQWA 2EO7A 4XQ6A 4I6VA 4TMCA 3WF0A 2OSWA 3VINA 4PMUA 1R2RA 1QNRA 3WJSA 3VOCA 1W3KA 3NDOA 4UQBA 3LXCA 3K8KA 1WKEA 3ITGA 1Q6QA 1JYXA 3SUTA 5CAKA 2C1GA 3F4NA 2IW0A 3EOUA 1DJZA 3USZA 4Z42C 4PUDA 4DM2A 1TVLA 3UJ2A 2J6XA 3ITVA 1WE5A 5KITA 7REQB 3GHRA