4X9YA

Wild-type human pancreatic alpha-amylase at true atomic resolution (1.07 a)
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Wild-Type Human Pancreatic Alpha-Amylase at True Atomic Resolution (1.07 A)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 177
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4x9yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4x9yA01
2WYSA 4HP5A 1UUQA 2BNJA 2W4XA 2BVDA 2VL4A 3LMYA 1E15A 3MUY1 1CXFA 2VI0A 3VD9A 1AMYA 4J3UA 3BH4A 2UY3A 4EE9A 3EBVA 1UWUA 1M53A 3VSVA 1OIFA 2WLYA 1XCXA 4AC1X 3CUFA 3SCOA 2BXZA 2W67A 1NARA 3LXAA 3QGVA 1BHGA 5KEZA 2D24A 3D52A 3WH7A 4JFUA 1UD5A 1PJ9A 1WE5A 3DX2A 2BVTA 2WMFA 1LLOA 3BAIA 3DYMA 3IAQA 1R47A 3BAXA 1RH9A 3CZGA 5I77A 2YJQA 2BS9A 4ZEPA 4X9YA 4J3SA 1E9LA 4V2XA 5JIWA 1MW0A 1OBAA 5EBAA 3ZO9A 2A3CA 4UTFA 1ZJAA 4DWSC 2ZX8A 2VVNA 2DQXA 1ECEA 2WMHA 3WDHA 3OGSA 3B8SA 2V5CA 1V3JA 3WEZA 1QI2A 3MV11 3AJ7A 2VZOA 2YDQA 5ABHA 1E40A 3MUIA 2WVTA 6TAAA 2E9LA 3DDFA 1J10A 1DWHM 3DHPA 1VEOA 1S46A 1VFUA 4TVUA 1HL8A 3L2MA 2UWFA 2JEQA 1MWOA 1KXHA 4DWSB 3ZM8A 1UD8A 3EJTA 1EHNA 1BSIA 1PS3A 2F1AA 2CKSA 3CPUA 3OG2A 2YL6A 5FIPA 2YA0A 4OJYA 1EDTA 3TONA 4TVCA 5KZ6A 3W29A 3BLBA 1WZKA 4KGLA 1FH7A 1R8LA 4PMOA 5M17A 3LX9A 3MU7A 4AISA 4MB1A 4GPNA 3NYDA 1VIWA 2DT1A 5ABFB 1JZ3A 4KH2A 1QI5A 3NCOA 1LJYA 1PIGA 3BUQA 2DEPA 4AIOA 2W66A 4B15A 3ZJ7A 2F7OA 5JBFA 4W7UA 3HG3A 4HZ6A 4DWSA 1DWJM 2D20A 3CZSA 1G1YA 3H55A 3POCA 1JG9A 1ZJBA 1UKOA 4LYRA 6CGTA 2ALWA 4F79A 4GQQA 3CHFA 2CEQA 3ZMRA 1J0IA 2DSUA 4CGTA 2D22A 1ZBVA 3N12A 5I0DA 4M81A 4IM4A 1XH0A 1TZ7A 1GQJA 3UEQA 5DT7A 4ZE4A 2DH3A 3ZJ8A 1SYTA 4JL1A 4QAWA 1QBAA 2G41A 4W7WA 1J0JA 1TQTA 1LL6A 2V38A 1DEDA 2Y4SA 5A8MA 2PWFA 2CCRA 3VIIA 3SCTA 4K68A 2EPKX 4C7GA 1XSIA 1BYCA 4WKAA 3ARUA 2XIIA 2WWCA 4AXNA 1UR8A 3IJ7A 1JYWA 1OD8A 3NSMA 2GSJA 3BVWA 8CGTA 4NZFA 5CQ1A 3ARSA 1HVXA 2XN1A 5DFAA 2X0HA 2YDSA 3VUPA 5IHSA 2PC8A 2F61A 2XN2A 3T08A 3J7HA 4KRTA 2VRKA 4ZXOA 1LG2A 3UG5A 4W86A 5GQBA 3WD3A 1MW1A 4FLRA 3UG4A 4EK7A 1Q4NX 3ZSSA 3PZNA 3AXXA 3MMUA 1RP9A 1UR1A 2FHBA 1QHZA 5D9MA 1K9EA 4AYGA 1HIZA 2PWGA 3M7SA 4AEEA 3THCA 1XSKA 2XFYA 1TMQA 3CHEA 2VR5A 4WSJA 1E0WA 4S3KA 1FA2A 2PWHA 3A6OA 2OSWA 3GNRA 1UR4A 2IXUA 3WMSA 3AYSA 3N17A 3TTQA 1EHAA 2A3EA 4KMQA 4PTVA 3T09A 4M1RA 4M24A 1BPLB 3SUUA 3OZOA 1B9ZA 1O6IA 3RM4A 4D6EA 1UZ4A 3LPPA 7TAAA 1VAHA 1ZB5A 5CJ5A 3MMDA 2J7DA 4LGXA 3WH9A 1EH9A 2E8YA 2Y5EA 1H4PA 5CPSA 3VINA 1CXKA 1GHRA 2GVYA 3WH5A 3EYPA 3RCNA 3NSNA 4FF5A 3T0BA 3WDRA 2CITA 1Z32X 3IANA 3S5YA 2XHYA 4L4PA 1JZ6A 1QWUA 1OD0A 4PMXA 1JF5A 1C90A 1KB3A 3CZJA 3WNLA 3ARZA 3GXPA 3FY1A 5A6SA 2DT3A 2ZXBA 1JXKA 4MB5A 4M8UA 1WO2A 2RGMA 3GH5A 1V0LA 1CGYA 5LA0A 1UKQA 2CBIA 3WNOA 5BWFA 5LYRA 3VM5A 3NSXA 4WKHA 4CCEA 2DH2A 3NDYA 4P7LA 2ZWYA 1R86A 4W89A 4CD7A 3AMKA 3A21A 2JF7A 5A6KA 5A8NA 5BXPA 5I2UA 3ALFA 1TQUA 3BSGA 1LL7A 2O9PA 1ESWA 3N11A 1VBUA 1LQ0A 2D0FA 4CD5A 4UFMA 3I3EA 2NW0A 4CVWA 2VNCA 2G8ZA 3W6LA 2W61A 1OWQA 1XYFA 1J11A 4WK9A 2BY2A 1E6NA 2D0GA 3D3AA 4MNMA 1CTNA 2ZICA 1E72M 1B3XA 4Z2IA 3GXDA 2QHAA 3VGGA 3ZJKA 2D1ZA 2OW6A 1KBKA 4URIA 2YA1A 3WY2A 2J62A 1TR1A 3O2LA 1ZBCA 3WELA 1XSJA 4D6IA 1GOWA 3VDBA 2YBUA 1UH3A 3VGFA 5A6JA 2AAAA 4HZ8A 1EQPA 4W5UA 4Z2KA 2OYKA 1B30A 1UD6A 3K4AA 3CH9A 3AZSA 4XB3A 4W88A 2E0PA 1UWQA 1WCGA 3BC9A 1CGWA 3OLGA 4QCEA 2EPLX 4JZ5A 3L4VA 1FH8A 3A3HA 2A3HA 1AVAA 3WD1A 3RM9A 4ZFMA 2PB1A 5IHRA 4L4OA 3WF0A 1V03A 3ALGA 1E6RA 1V3MA 3VIJA 4B9YA 3BAYA 4W85A 1JDCA 2UY4A 3FAWA 3PZVA 1O7DC 3VIFA 2XFFA 3WUFA 3VILA 2Z1SA 3T0AA 2WHJA 1US2A 3WDIA 3D4YA 1RD6A 2XUCA 1I1XA 2CYGA 1V0NA 1MW3A 4CKQA 4IUGA 5CGMA 1MW2A 3TTOA 2OWCA 3EDJA 2FDMA 3GH7A 1AQMA 1CENA 1GORA 3WDPP 1XC6A 2BY0A 1NOWA 2XM2A 5CSUA 3A22A 4AEFA 1KCKA 2C7FA 4AD2A 5A6BA 1E3ZA 1W9BM 2ZUWA 1C8YA 1NM9A 3W81A 3D5HA 2WPGA 3AIRA 5IFTA 4FNPA 3A4AA 3SCPA 3KLLA 4H04A 1EOKA 2XFRA 3HG2A 1JFXA 1LF1A 1UH2A 3SEPA 3LPFA 2V5DA 2WSPA 1TQVA 1IZKA 2UY2A 3AS0A 3GXFA 3T2QA 2XVNA 3OBAA 2JIWA 1SFSA 2X0YA 4CD6A 2VRJA 4JFTA 3DX0A 1UKSA 4FNSA 3AISA 1JGIA 3K46A 3WQ5A 1N82A 4P7QA 3SCSA 1CBGA 1GJWA 2ZUSA 2VRQA 1T0OA 3IGUA 2J25A 1C91A 3AHTA 2IXVA 1R87A 1UG6A 1TA3B 5DMYA 2ZUTA 3FN9A 5CXPA 2ZX9A 3PTQA 5I6SA 4PTWA 2BXYA 1CGUA 3VOCA 1JZ7A 4OGZA 1SMDA 4M29A 3TV8A 3BLPX 2YFOA 5C71A 5D8ZA 1I75A 2V3DA 2X05A 2CHOA 3VPLA 1UR2A 4ML4A 3AOFA 5FOOA 7CGTA 4LX4A 2WBGA 5A2CA 1KWKA 1XYZA 2DIJA 4OOUA 2CETA 2J7EA 1E4MM 1C3FA 3SUWA 3NDZA 3AS2A 4PN2A 4P7NA 3ZQ9A 2VQUA 4BZYA 3AIUA 3VD5A 2WW5A 1MQQA 1XHGA 1ISVA 1DWIM 3EMCA 1UWRA 1XGZA 1TA3A 3VGEA 3QHOA 2PI6A 5JBDA 1UASA 5CG0A 5M5DA 1H5VA 2JIEA 1QNOA 4D6CA 4OBRA 4ZENA 2G3IA 5D9PA 1E0XA 1W32A 2WCGA 3FW6A 1KQZA 1UWIA 2V3GA 1C8QA 5A8OA 1W9XA 2OYLA 1E56A 4MB4A 1W3LA 1E73M 2VX5A 4TOQA 3L4YA 4UOQA 3LRLA 2EPOA 3VGDA 3CGTA 1WPCA 1OGBA 1QI0A 3WUEA 4V27A 4IPNB 1D3CA 1KFWA 4U2ZA 2GJPA 3D4ZA 1HP4A 3MS8A 3AI0A 3WQ4A 5I78A 2XWEA 2NSXA 1B3YA 1E6PA 4ATLA 3WENA 1JNDA 1QPKA 3KE0A 1C7SA 1OCQA 3AIQA 1KWGA 4CD8A 5I79A 4JKMA 2ZXDA 2GK1B 1KQYA 5D4YA 1HKIA 4WKFA 1B90A 1KCLA 3VIPA 4Z2GA 5E1QA 4MNKA 2Q8XA 1TQSA 1M03A 4E8DA 1JYXA 2CHNA 4A3YA 1B2YA 1JZ2A 2X2HA 1GOKA 4H41A 2DGAA 4BCEA 1V08A 1E6ZA 4FLOA 2WZEA 4AMWA 1V6WA 3WQWA 5GNZA 1KR0A 4JFVA 1H0IA 1ZBKA 2ZXQA 2VCAA 4PCSA 1F4AA 4AYSA 4JAWA 5BRQA 3CTTA 1BF2A 2XIBA 3BSHA 5A94A 5FL1A 4AWEA 3WD4A 2WMIB 1XD0A 2BHYA 4R5EA 1BQCA 1J0KA 1ZS2A 2VMFA 3NIYA 4QCFA 3HU7A 4JFWA 3CMJA 2GJXB 5DO8A 3CZEA 3MV01 2W91A 4KGJA 3GYCA 4ACYA 1X6LA 1WAWA 2O9OA 3GBEA 1J0ZA 2XYLA 4J7RA 3VIOA 1FH9A 1XRVA 3O6AA 3CUJA 1UOKA 4WF7A 5AC5A 1HN1A 3TA9A 4PYSA 5E70A 4MDPA 5DT5A 3AIWA 4Q22A 3A47A 1K6AA 4JKLA 3QOMA 4Z2JA 3N9KA 4HA1A 3AYRA 4D1JA 3AMCA 1P6WA 1ZL1A 4GZJA 4HZ7A 3AIVA 2EBNA 4XUYA 2DSKA 3K4DA 3L4UA 2VZVA 4PMDA 1TVNA 1W1TA 4MJ2A 5M03A 4LYPA 1CGVA 1TQWA 1ITXA 2GJXA 1UWSA 1JI1A 3WQ8A 3VGHA 1GVYA 4TTGA 4S3JA 4ACZB 1JDAA 4TXEA 5CSYA 1NOUA 3SURA 3B9EA 3GXIA 2EJ1A 4GINA 1W9DM 3ARWA 1CXHA 1MXDA 2MANA 1NWUA 2WMGA 1QW9A 1UWTA 2C0HA 5FCZA 4JL2A 1W9PA 1CGTA 3VD3A 2YLLA 2PBOA 3WEMA 2BFGA 2ZOXA 4N42A 3BCDA 5DF0A 4QFUA 2UY5A 5ABFA 1UR9A 3DC0A 4D6GA 3CUGA 1HXKA 3D51A 2XM1A 2F18A 1JI2A 2ZWZA 4B16A 4CD4A 2J74A 4NSBA 3F4VA 4H8HA 1CXIA 1BYAA 3I3DA 1ZBWA 1BG9A 4AW7A 1CNVA 4LPCA 1E43A 1HJSA 2XGBA 3NUKA 3KWXA 3VVGA 1U33A 3QHMA 3CZ8A 3GXMA 3E1F1 4NI3A 1UD2A 2EADA 2YLAA 5CLTA 5CZKA 1GOOA 1V02E 3EJRA 2VO5A 4MNJA 1MYRA 5BROA 2WZHA 2WKGA 1W1YA 4MJ4A 3FXYA 3CO4A 3FHQA 3W0KA 2VCBA 4GZIA 5E09A 4JFSA 3WDJA 2CNCA 2IUZA 1QNPA 2CERA 2XVPA 3AICA 4PMYA 1CDGA 3II1A 4BF7A 1YQ2A 3K1DA 3BUPA 1PBGA 1LWJA 3VU2A 1VEMA 1DTUA 3EJPA 3OLEA 4W8LA 1TUXA 1B1YA 4W84A 1EXPA 4NXKA 1Q6GA 3VGBA 4D6HA 2BY1A 2QV4A 2JE8A 2F2HA 2PWDA 4F66A 2F8QA 4AMXA 1UA3A 2ZE0A 1F4HA 1CGXA 1OINA 5HXMA 4HA4A 4E8CA 2YKKA 4XZWA 4TTUA 2WCAA 3VNZA 4UFLA 1HX0A 4E4PA 1BAGA 1UD3A 4DUWA 3KL3A 4PMNA 4OIFA 2FH6A 4BA0A 3RJYA 4NF7A 1AQHA 3UESA 2WANA 3W82A 1HF6A 1R7OA 2WM0A 4AZCB 2EAEA 4AZ7A 1L0PA 1DHKA 3LPGA 4WLCA 3QR3A 4PBGA 1XH2A 2WVUA 1C8XA 3RPMA 2BVYA 3ZIZA 2E3ZA 3GBDA 2RGLA 1IV8A 1M04A 3GH4A 5A69A 2XVLA 3OA5A 1GOMA 3WL1A 2VOTA 5TD4A 3PZIA 1GJUA 1XD1A 1GONA 1VBRA 1R7AA 1TE1A 2E9MA 2WCSA 3EJUA 1JD7A 3W25A 3VDCA 1E1FA 3VNYA 1HJWA 4EKJA 2GJRA 1EGZA 1ISZA 1GQIA 1UHVA 1V6VA 1JZ5A 2JFEX 1VB9A 2VVSA 2J7HA 1OIMA 3WEOA 1M01A 4JIEA 3VX1A 4UQEA 3ZJ6A 1FHDA 3W26A 4UQBA 1H11A 5FL0A 3L4XA 2HVMA 1XH1A 2QPUA 4PUDA 1SMAA 1I1WA 4MADA 2CBUA 3K8LA 4FMVA 5D9OA 1V6XA 1UKPA 1B3VA 1PPIA 1JIBA 2V3FA 1R75A 1WZLA 1PX8A 1KTBA 5CPTA 1NWRA 1NWTA 4AMCA 4F9DA 4RE4A 4U3CA 1E5JA 4NXSA 4PMRA 3LXBA 3BUDA 3WD2A 3M07A 2EQDA 1V6YA 3NJ3A 3BLKA 4J27A 3K8KA 2X09A 3UERA 2F7RA 1GQKA 3A5VA 3MUZ1 4AD3A 1V0KA 1CLVA 4U5IA 1KGXA 1H2JA 1JZ8A 2CPUA 2WC7A 1DWFM 3BXWA 1HWWA 3AXIA 1TG7A 6A3HA 4AIUA 2FGLA 1VJSA 3ARQA 4XV0A 2OSYA 3ZT5A 1BFNA 4JHZA 3CV5A 5HPOA 5BXTA 5GPRA 3CHDA 4D1IA 3VKKA 1KXVA 3ZSTA 3IJ8A 1FHLA 4U5KA 1IZJA 4AZHA 2YA2A 1W2VA 4AD1A 1KGWA 3PZUA 1B31A 1W3KA 3CUHA 4CU8A 4CU6A 2D3LA 1UKTA 3W27A 1GW1A 4F9JA 2J75A 1VFMA 1VEPA 5CGTA 2VC9A 4W93A 1TVPA 2ZXAA 3WF4A 1EIBA 3OZPA 4QDMA 1V0MA 3N04A 5HBFA 4GKLA 1EDQA 3WQVA 1Q6CA 2DSWA 4UQ9A 1QI3A 2VTFA 1QNQA 3MSGA 5E9AA 5EFFA 1UD4A 4AZ6A 1JFHA 3WN6A 1G5AA 2PF0A 3A4XA 4QLJA 4B3LA 2OSXA 2CESA 4UZSA 3SCWA 3AS3A 2TAAA 3GXTA 2XPKA 2F7QA 3AHVA 1J01A 2GDVA 1KBBA 2FE0A 3CHCA 3HN3A 2CXGA 5JIPA 4P7OA 4GZEA 1W1VA 2O9TA 4M56A 2J4GA 5LA1A 1XCWA 3ZR5A 3WKZA 2X2YA 1CXEA 1Q6EA 3M46A 5EMYA 2EXOA 4M82A 3HG4A 3VX0A 3AS1A 3BGAA 3RMEA 3DX4A 4FNUA 5JUVA 1MQPA 2OWXA 3U7BA 3HMCA 1UH4A 2WZIA 3POHA 3JUGA 2J8GA 1WDRA 4W8AA 1GOQA 3W37A 1VFFA 3VSUA 1BG4A 1CPUA 4MAZA 2XN0A 2OWWA 2D2OA 4U31A 2J8FA 1J0YA 1W1PA 1FP8A 4B3KA 1BLIA 2WSKA 2EPMX 1R85A 3VDAA 3GTNA 3A24A 2WMKA 3L4ZA 3DYPA 1U2YA 3D50A 3WFLA 3VO0A 1ODZA 7A3HA 1KXTA 2WHLA 4DO5A 3CBWA 4UQAA 3VM7A 2WNWA 5A6LA 3CC1A 1GUVA 3IAPA 1E4IA 4H7VA 1RP8A 3MO4A 3OIHA 3U5UA 1HJVA 1CYGA 3BVXA 2J7CA 3UR8A 1UR0A 3GDBA 3T0DA 5EFDA 2YDRA 4PMZA 1EDGA 4YHEA 3TOPA 1VENA 4HA3A 3AMLA 3N1AA 4MNLA 4YN5A 1SR0A 4HOZA 1E0VA 1JD9A 4Z2LA 4BQ4A 3BVVA 3UETA 3DX3A 4JKKA 3B9DA 3AHYA 2BHUA 1BVZA 2E40A 4PTXA 2J7BA 4WSKA 1HNYA 2FHFA 1QNSA 4RE2A 5E6ZA 3WDQA 1JNEA 1J12A 2Y24A 2XJ7A 5AYIA 2WVVB 2YFNA 3LPOA 3GNOA 1CXLA 3DECA 4X0VA 1WDQA 3MANA 1VRXA 1E4NA 4MTVA 1WDPA 3MSDA 4D6DA 4AZIA 1J0HA 1V3LA 3I3BA 1IT0A 1H0GA 4PSPA 3RILA 3PTKA 3G6LA 2CIPA 2F1BA 5BXRA 4KWUA 4OZOA 3AIEA 2W62A 4ZXLA 1KXQA 3SCVA 4PTMA 1C92A 5A6AA 3PBGA 4NRRA 2X8RA 3BAWA 1UA7A 1EQCA 4IPLA 1MVYA 1BVNP 1ISYA 1H09A 2X1IA 9CGTA 1TFVA 3VIMA 2DSVA 3WMBA 3W28A 2VR4A 4PSRA 3N18A 1E6SM 3VD4A 1A3HA 1ISWA 1G9HA 1Y7VA 1VJZA 4A3HA 1ODUA 3T2PA 1Q6DA 2WVVA 2Z1KA 1JAEA 3W6MA 1PX4A 4EANA 1GCYA 1FFQA 1LL4A 2ZUNA 5HPCA 1W3JA 5A6BD 1LWHA 4A4AA 1R46A 1WZAA 5HDRA 3AROA 4W8BA 1HP5A 3ARTA 3QOKA 4HOXA 5JBEA 3WFZA 4XZBA 4YPJA 3VIHA 3BMWA 4D71A 3HZ3A 1FP9A 3HJEA 4CN6A 2D23A 1ZU8A 2ZX7A 1E4LA 3SCRA 3W53A 2WC4A 2VX7A 3ECQA 3T2OA 4PCTA 1GHSA 5I3DA 2DSZA 5FKYA 4CCCA 4CU7A 5BXSA 3ZOAA 1H3GA 2GK1A 3PZMA 3WF1A 4FLSA 2PWEA 1W3HA 3GXNA 4H2CA 2VZTA 3VIKA 3EDDA 5AC4A 1QHPA 2E9BA 2WKLA 2AMGA 4AZ5A 4HPGA 4B9ZA 5IFPA 3MUAA 3W4RA 4JCMA 4P8WA 4MAVA 1WB0A 1EO5A 2WC3A 3AMDA 2XGIA 3KL5A 3QHNA 4MDOA 4Z2HA 2DT2A 5BYWA 2OW7A 3EDEA 3N13A 4C7FA 3CZLA 2CBVA 3VMPA 4NZCA 2X2JA 5D9NA 1PX3A 3TTYA 1MFVA 2WMIA 2XTKA 1CECA 1K9DA 3WIJA 1JAKA 2D3NA 3CZKA 3MKKA 4D72A 2G4FA 2G3MA 2BHZA 3AZRA 1MXGA 1L8NA 2VZUA 1NP0A 3BVUA 2JEPA 4J3XA 3PZ9A 2XVGA 3GZAA 1V3IA 4HU8A 3BVTA 3K8MA 4OOZA 2JALA 1V3KA 4DM1A 4CCDA 2G3NA 2AOSA 2EABA 4RL3A 1R34A 3OGVA 3RO8A 1D7FA 1QVBA 4W5ZA 1B0IA 1U30A 1CEOA 4C7DA 1XV8A 4P8XA 2D73A 2Y8KA 1ISXA 3W24A 1W9VA 3SIMA 3U57A 4GI8A 4N0RA 4DUVA 1E70M 3TTSA 5DEZA 1VF8A 2OYMA 3LRKA 2XVKA 1JF6A 5IXEA 2FH8A 3ZT7A 3W38A 3WL0A 3L2LA 1GQLA 1HKKA 1JXJA 3OLIA 1HT6A 3L4TA 1QHOA 3THDA 3BUIA 3WUGA 5EB8A 2IGTA 2YL9A 1JL8A 1J9YA 2CKRA 2E4TA 4GI9A 3WNMA 3MI6A 2J78A 4ACZA 3PZQA 4HMDA 1RPKA 2NT1A 4X0NA 3RIKA 4YHGA 2O92A 4ATWA 3RM8A 1E3XA 1DWAM 1HTYA 4GXPA 3ARPA 3S5ZA 4P8VA 4UCFA 1OGSA 5GNXA 2PBGA 2BV9A 3MMWA 3VD7A 3KZSA 2VQTA 2WXDM 4JCLA 5ABGA 2ZX6A 3L4WA 2VURA 3TP4A 2QF8A 1HXJA 3AHZA 1E6QM 2XSAA 1HL9A 1R33A 5AYBA 3OLDA 2QLYA 3PZOA 4AY1A 2D0HA 4OKDA 1X6NA 3CMGA 2ZUUA 5A95A 4NRSA 1OT1A 4HPHA 3DX1A 4J3VA 1E55A 1HKMA 1WNOA 5M3WA 2DPEA 4PMVA 4AZGA 1JZ4A 2GUYA 4UFJA 5A8QA 1HJQA 3EJQA 1E1EA 5F7UA 4FK9A 2NT0A 2WHKA 1B3WA 3WY3A 1JYVA 4UFKA 4UOJA 4IISA 2CBJA 1AQ0A 4GQRA 2DT0A 2VX4A 1WKYA 3DHUA 5I24A 3DYOA 4TVDA 3WY4A 1US3A 3WNKA 3OB8A 1SZNA 3OGRA 2WK2A 2WAGA 4P8UA 3ARYA 3N15A 1OB0A 3EDKA 3EJSA 4PMUA 3SCNA 2B31A 1G0CA 1PZ3A 4LYQA 1VFOA 3ARRA 3UR7A 2BY3A 4CUCA 3FNDA 3WSUA 4UZUA 1WZMA 4OUEA 4AD5A 1GZJA 4TUFA 1YHTA 4UR9A 4M80A 1UZ1A 1HJXA 1GPFA 1O7AA 1A47A 4FLQA 1ITCA 4QLKA 1QI4A 4DWSD 4HTYA 5BRPA 3BUBA 4ZE5A 3A4WA 4DUXA 3CZNA 4UQCA 2DIEA 3SCUA 1UYQA 3AQUA 1PZ2A 4KRUA 5A3HA 2WB5A 2ZUMA 4J28A 3WUBA 1TCMA 3ZT6A 1LG1A 2WLZA 1PAMA 4BQ5A 4R27A 1GVIA 1GOIA 1KR1A 2VCCA 2X2IA 3IJ9A 4XX6A 4E2OA 4DO6A 2XWDA 4PUEA 3M6DA 1FOBA 4AZCA 1E6XM 3VIGA 2WMJA 3S2CA 4UQDA 1NP2A 4BQ3A 1M7XA 4HMEA 4MPKA 5A2AA 4Q7NA 3BCFA 2HISA 3PZTA 3AFBA 4D6JA 4U2YA 1E71M 3SCQA 1B3ZA 1GNXA 4D6FA 3AMGA 1UQYA 3PHAA 3KLKA 1C93A 1CLXA 1Q6FA 1J18A 1NH6A 3F5JA 3IK2A 4H8UA 1NQ6A 1OT2A 3PZGA 3S6TA 4P7RA 3BAKA 2A3BA 1QW8A 4FNTA 3CIVA 5AY7A 3DDGA 2OLHA 2J7GA 4CN1A 1NOFA 4QLLA 5CPQA 4H8VA 2ZIDA 4TX8A 4FNRA 1HVQA 3BMVA 3WQ6A 5IDIA 1HJUA 4U33A 4GO8A 2C8NA 3FHAA 4PEEA 4CVUA 4AD4A 2FGZA 1WDSA 5BCAA 3G6MA 1OGGA 2WVSA 2J77A 3WBAA 1EO7A 1QX1A 4ATDA 1H1NA 1JYNA 4LQ1A 4PMQA 4J3WA 3BAJA 4J3TA 4UOZA 2VT0A 1K9FA 5A8PA 3ARXA 3WNPA 3VTRA 1BTCA 1MQRA 4JHOA 2F7PA 1X1NA 3H53A 3U5YA 4GI6A 3ZR6A 3KEHA 2ZX5A 2EPNA 1QNRA 1BGGA 2J7FA 3CUIA 2VJXA 4PRWA 3VSTA 4TX6A 4Y7EA 2EEXA 2FHCA 4UFIA 1QBBA 4WIWA 2O9RA 3RDKA 4NZJA 1UQZA 1CZ1A 5LA2A 3EMZA 2YBTA 2YL8A 1JDDA 3WY1A 3GNPA 3PN8A 3WMCA 4DO4A 5E6YA 4EAMA 5HOSA 3LRMA 2J47A 1WP6A 5I23A 2WBKA 5A2BA 2GDUA 1V3HA 2J79A 2QPSA 2W5FA 3B9AA 4WJXA 3RJXA 4RE3A 3EMQA 1FFRA 2V3EA 2WWDA 3APGA 2FYVA 4DM2A 3LXCA 2W63A 3UCQA 1H49A 1H41A 1BGAA 2Y8VA 2XSBA 4W87A 3WBEA 5FD0A 2G3JA 1QOXA 4FNQA 4AIEA 5ECUA 5HNNA 3WD0A 1CWYA 2YIHA 2ESCA 2VX6A 2JF6A 2WHMA 5CLWA 1BYBA 3H54A 4QP0A 2A3AA 4AD0A 1EA9C 3O9NA 1KTCA 1DWGM 4F8XA 1G01A 3VDHA 4UNIA 3WH8A 2Y2WA 4AZBA 2EO7A 2DDXA 1W9UA 5A1AA 5C8BB 1W91A 1W2PA 3AXHA 1DP0A 5C70A 4GIAA 2VUYA 2VZSA 1MFUA 3WF2A 3F5KA 2YOCA 1EOMA 3FAXA 1OM0A 4NX0A 3WNNA 3F5LA 4W7VA 2QMJA 8A3HA 2EACA 3HG5A 4UFHA 3KL0A 3SUSA 4OBSA 4LXFA 1G94A 3AZTA 5E0FA 1K9TA 4BQ2A 1D2KA 1PIFA 3U7VA 3VMNA 3WH6A 2QMKA 1KGUA 5I5RA 4CN4A 4HMCA 5E0CA 3SUTA 3A23A 3UG3A 4GO9A 3AHXA 1OSEA 4MB3A 3ARVA 4V28A 3CLWA 1V02A 4BS0A 4U3AA 2ZUVA 2W92A 5GNYA 3EDFA 2YL5A 2GFTA 5ABEA 1PEZA 1E5NA 3AIBA 4HOWA 1V6UA 3GM8A 4HU0A 1BYDA 5A6MA 3VMOA 2XG9A 3SUVA 5D8WA 1HKJA 1C7TA 1CIUA 3PTMA 1NWSA 1QWNA 2E8ZA 3WF3A
chains in the Genus database with same CATH superfamily
5ELIA 2VL4A 3BW4A 4FA3A 1GS7A 3EH3B 4I9MA 1DUYA 2QJHA 1HHKA 1S2CA 1N0XH 3ZDXE 4XNYL 2RR3A 5I15L 3W2UA 3WLBB 4LW7A 4HAKA 1CMOA 3GBMH 3KPRA 1ADQL 3B8UA 1K77A 4QG6A 1LLOA 5U4NA 2NYYC 3WS6A 4ZMXA 4OWGA 2YJQA 5HQMA 4P57A 2WXGA 4ZEPA 4OD3L 5I19H 4PY8I 2H6PA 3G1YA 3VI2A 1AZZC 2GQAA 2MNJB 3RX3A 3S3BB 4GVFA 2QIWA 1UXWA 2IH8A 3D85A 4J8QA 3APFA 3IPEA 4XPGL 1GAFH 2H1PL 4AMKL 3ATDA 3PY2A 4Y6GA 3MTXA 1HL8A 1QLFB 3OA3A 4FQQB 4DP8X 4ALDA 1MWOA 2E1DA 1OGPA 5AVNA 3N1FC 3SYPA 3UPWA 1BSIA 5MP6H 4QQUA 4PYHA 1K3ZA 4KTYA 1A5UA 2ODHA 1K3UA 4P3WA 3GFZA 3CDZB 3UO1H 1FH7A 2HRWA 2WZ0A 3CCHA 3C2AH 4DIAA 4R26L 4X5XA 4TL5A 2DAVA 1KJ2A 4LNRB 4HNVA 3HRZB 5MHBA 3CFCH 3FYPA 1E9QB 1NIAA 2W38A 2O6DA 4EIUA 5IVZA 2F7OA 5D4HA 1KY6A 3HBGA 4WRHA 1JBJA 1JG9A 2E09A 2FFCA 1LEKA 5B3SB 3T81A 4PH6A 5EIQA 3L5AA 3NJHA 3UEQA 3T6VA 2I25N 2ZXCA 4HF5L 1J0JA 1TQTA 3PWJB 4C7GA 5ICUA 3TCSA 1RURL 2VYRE 2GSJA 1I9IL 4OHQA 1RHHB 1FYTD 4HU3A 2VLRA 3T08A 3W2DH 2HFFA 2H8ZA 3IUIA 3MOAH 3WTYA 3MMUA 1TJHH 1P5VB 3NACH 4H9YA 4J6IA 2K6YA 3P0YL 3C5ZB 3FHEA 4LAZA 2VP8A 1MHHB 3VCLB 1AMKA 1W5NA 4XP9L 3RM4A 3HR5B 4LU0A 4PTUB 1OY3B 5L8LB 4A3UA 1EH9A 5C08B 2Z27A 3WH5A 3FCBA 8PAZA 2BTMA 5E1AB 2HTMA 3B05A 2OZ8A 3DFQA 3WNLA 4QTIH 4JFDA 3TXVA 3GH5A 5TPWL 5C0BD 3WNOA 4ONOA 5T9CE 1IQWH 5C2UB 3DIFB 4MS6A 4XN4A 1F5WA 2V17H 2XWTB 4P23D 3SSJA 1REIA 3MV8B 5DMIH 2BP3A 2QQKL 3FF7A 1GW0A 3EYSL 1YO4A 1SGKA 4XVTL 1SQ2N 2Z93B 1TR1A 5JPMA 1QXLA 2AXJA 1YPIA 2X3CA 4Z2KA 4L61A 4HLEA 4X4ZA 3UAJC 1OQFA 4HN8A 2WZ5A 1ZA3A 3FUKA 4BSVA 2A3HA 1AVAA 1IGYA 1LO5A 1N7KA 4AY8A 2XWCA 2EILB 5EU3A 4H9UA 3B56A 2AHIA 3VIJA 4LRNL 1ZTMA 1JDCA 3NEEA 5HYJD 2HZHA 5KYYB 4EF8A 2DWDA 1AGDA 2PE4A 4J1OA 1OP3H 2IF7A 1RZQA 3ARBA 3LERA 3VTTA 4K73A 3EDJA 5JDJA 1XC6A 3MDWA 2NX9A 3OVPA 2BSSA 1S6NA 3GSRB 3R58A 3VRJA 4PJDF 4RRPA 5J0BA 4UV4H 2PCXA 3NFNA 3QUYA 4HUUA 5I1JL 4GBDA 1XYAA 2Y62A 2ZCKL 5G2WA 4QDGA 1WWBX 1B0RA 4WY7L 2PTZA 2IXVA 5AD0A 2Z28A 1J6PA 2BXYA 2LVCA 5HHNB 4FQ1H 4M29A 2J1ZA 3BLPX 5E99L 5D8ZA 2R9HC 4U6HB 4LPXA 1EPXA 4AVNA 7CGTA 4J1UA 4HT1L 5CCHE 4ANWA 2DM2A 5CKGA 3RLHA 1AGFB 3GTTA 3S98A 2XA8H 3BJTA 1R6WA 4OCNC 1XDMA 1A6VL 4D8AA 4DCQA 1IBBA 3NQMA 2R2EB 4KW2A 3LHPH 1KBLA 3RKDC 2A6DB 4MB4A 2VX5A 3RL2B 3BT2H 1SBBA 4FQIH 2EIZA 1OGBA 2VR9A 1J05B 4IMAA 4O10A 3OR7B 5I78A 5AKRA 2NSXA 4O18A 1EHKB 2PS2A 2ACQA 1TPXC 3KE0A 1S3KH 5I8CB 1CDHA 3QCUH 1N55A 4NQXA 5H2BB 3QZBA 1VKXB 1FJ1B 1MVFA 5CGBA 1ZT7A 1DDTA 3HN8A 1E2WA 2Q8XA 3NN8B 2VR2A 4GRSA 2IC2A 4K4KA 2PYEB 4NWUH 1CWVA 5J1AA 4Q9RL 1IQDA 5GRYA 4OM0L 1B2YA 4XWOC 1YY9C 5KSUB 4KK8C 1LYXA 4MNGA 4AMWA 3NJIA 3MYOA 1AXTH 4F7PA 5FYLH 2B3RA 4XNQB 4M7LH 4AWEA 3KNBB 4ZFFB 3HFFA 2AJSL 2XC8A 4DPAX 1ZS2A 4O2CB 3QXDA 3FUMA 1OYAA 5BW7C 3CZEA 2YAEA 1GOHA 2W91A 5DZVA 4LDCA 4L8SB 3NPUA 3MLXH 2XYLA 3GR7A 3I68A 1OB1B 3GB6A 1GKEA 1LRTA 1NEZB 1OFDA 4UTBL 2E5CA 3O3DB 3U82B 2XDFA 5DVOA 4ICMA 1ZHLA 4WDIB 4JN1L 4QHPA 5ESVB 5FFOA 1ZL1A 5FX3A 4XVSL 1WBJA 1Z9LA 1TVNA 3ROLA 1QAWA 3DI2B 1IBFA 2BVOB 4KKAC 4TULH 1RLDA 5AWNH 3PHOB 1U5HA 3C2SA 5AKQA 1RQ5A 3H3BC 5LCVH 3VE7A 2GJ6D 1BJMA 1QFWI 1MCCA 3FO1A 3VC5A 2ZOXA 4NO2B 4N42A 3GJFK 5DF0A 3IMUA 3LM7A 1UR9A 3MNDA 1YADA 2DZWA 2XA3A 2WJZA 4AW7A 1K5NA 4LASL 2F08A 4MQXD 3RGHA 2NDGA 2NY4B 3GR4A 1BX2A 2Z6FA 2IEPA 1W1YA 1OO2A 2BMKA 4XX1G 1HHHB 2YK1L 5HHPA 5JMUA 3WDJA 4AC4A 2Z1PA 3EBGA 4PMYA 1YQ2A 3U9UA 3BTNA 3QZWB 3RVVD 2OMYA 1Q4WA 5DEGB 4JY5L 2JJUA 3OBEA 4D6HA 3SPVB 2XQ0A 2PWDA 1QNZH 4X63A 1T8XA 4XISA 4GUGA 4ILDA 4JE0A 4YMZA 4EI5C 4XAPA 1XDTT 2Z0BA 2FUTA 3JWNC 1PL9A 4WGKA 2QKIC 3ZIZA 2WVUA 2Y69B 5H35A 8FABB 2E3ZA 5DGQA 4FZIA 3IN0A 4QXWA 3G6AB 3UC0H 3OJMB 1G7VA 1MFDH 4OGAD 5I1IL 1SUJA 3TJLA 5IR1A 1TZOA 3ZDZF 1A53A 1HZLA 3SE9L 5M94B 4IIQB 1KENH 5G4WA 1NIEA 1RULL 5HGBB 4NASA 4BI5A 3TNNB 2Y06H 2HFGH 4P0DA 2FZ3B 3BN3B 4Y19E 2ITDA 1EJWC 2BSTA 5EZLB 1CYWA 3REQA 1M42A 4NQDD 1CLVA 4Q7IA 2VDLL 3LRSB 4XOBA 3BXWA 5D2XA 2IMMA 3IU4H 1FWGC 3M5YA 1S8DB 4ADJA 2BSBA 1PYWA 3L95B 4JHZA 4WNQA 4KRPD 2P5WB 1REQB 4D1IA 3T3PB 1X97A 2O61B 1Z0NA 2YA2A 1IEVA 1KGWA 2EDMA 5GGTH 3EUUA 5I26A 5IJKA 1PSCA 1MJ8L 1KLGA 4IYKA 3GJEA 1ICSA 2QFPA 3CVDA 1I8JA 3G1DA 3GNDA 3BOVA 3VXSB 1H9VA 1SUHA 1UZDA 3G18A 1N70A 3M0KA 43C9A 3CAWA 1BQRA 4QXUL 4M1DL 3D30A 3REWA 4WW2B 4NIRA 4FZEL 4JG0L 1UJ3C 2RGSA 4J5VA 2EXOA 5IP4A 4C4KT 3OAZH 4IPIA 4X9HA 2QULA 4NWTL 1EO8H 2WZIA 3HHRB 3TCLA 4PRIE 5FO9A 2EIBA 1ECQA 5HJLA 4POUB 2A73B 3P4OB 1BLIA 2W59A 4BKLA 1EPVA 4LJ3A 2YD7A 3V9FA 3E6HB 2H3BA 1EVUA 3SDDA 5FW6A 4JQ1A 4O00A 4PTDA 3CBWA 5DQJB 5A6LA 1NGQH 3BPWA 5B8CB 4DLFA 3TL5A 2KLTA 2B0MA 5KG9A 1J8RA 3C5SB 4OD2A 4TV3A 3EYQC 4IKJA 5M1TA 1IKNC 2YZ8A 1TQCC 1VENA 2J6XA 4GYPA 1ZTXE 1JD9A 4Z2LA 3UPCA 4U6VH 2OQJA 4LVNB 4IK7A 4OGQC 3RGVA 4PD4J 3KFTA 4M7JL 4WSKA 4RE2A 5E6ZA 3OKDA 4QPEA 3WDQA 4C6IA 1AZUA 1EXGA 3WFDL 3U0PA 4S2CA 2WVVB 1FHNA 3V1PA 1T5XB 5SX4I 2YD9A 3GIPA 3OWRA 2R2HA 2WTPA 3C9NA 4CDHA 1GGOA 3BH8A 1C92A 3ENLA 1UZ8B 4LB3A 1UA7A 5I1CH 4OZIA 3VA2C 2HAZA 3FKRA 9CGTA 1EVTC 5TQLA 1AC0A 3GE7A 1U8MB 1A3HA 3SE4A 3T2PA 2Z1KA 4RA0C 2UZYA 6TIMA 3KJ4B 1H50A 2HJKA 4B5UA 3ZUNC 3QIWC 1I8MA 1WZAA 5HDRA 1TV4A 4GZ7A 4PUNA 4YPJA 2O26U 4D71A 3HZ3A 2I9TA 4LU5L 1E4LA 1CFTB 2XYBA 1HL2A 5LGJB 3UTQA 2DMCA 5GGVH 5FKYA 3JZ7A 3HBPA 3N3TA 4Y2OA 5BXSA 4ZUTA 3S1GA 4BDVB 2LR4A 1X5HA 3WF1A 1NIBA 3DKLA 3DI0A 2YYUA 3SQRA 4X0KB 3BT0A 3DVFA 2JTYA 1WXYA 5JZ7D 2MCPH 5J9PB 2OW7A 1S7QA 3KPSD 1HNFA 5D7EA 1MY5A 1WBHA 3HVDA 2L04A 3WIJA 3R19A 1MLBB 4D72A 1MI5B 4RFOL 1JVKA 2ZRXA 4NN6C 3GMLB 4OCXL 2BOFX 4YHIA 1QABA 4J3XA 3GZAA 4S0TD 5C0AA 1CK0H 2F53A 2YXMA 4K5OA 2V0TA 2BDNL 2IH3B 4Y7OC 1GKQA 1V3KA 2FZ8A 2CPCA 3LK6A 1VA9A 5I74B 1UWEH 3K74B 1QRND 4PJEF 4F8PA 1M6UA 2PLTA 3O07A 3S36X 2F5BH 1IAIM 1HL4A 2GHZA 1IIGA 3ULVH 3P73B 3GS4A 5E8NA 1J79A 5C0GA 5KVFE 5FM8A 1K8IA 4MJID 4AT6B 4PMFA 1Z66A 2FQDA 5GJSL 4H9TA 5IB2A 2NY0C 4D7PA 3RVXC 3THUA 3MFFB 2F54D 3P3YA 5CJOH 3B8WA 2PTYA 3W0WD 1P1ZA 4PYGA 1OGSA 4PRHB 5HY9B 2QZRA 2YEZA 5E6ID 2VURA 1IAOB 3M5XA 3AHZA 3JYCA 4FOUA 3QBUA 3FULA 1G6RA 4YSPA 2B08A 3CMGA 5GZND 1BLNA 2BX7A 3WAJA 5HVHB 2F8IA 3RKDD 3V4UL 4TXVB 4Z7QE 1PYMA 3KOZA 3ASOB 2E7CA 1SO3A 3T6QC 1A2YA 5JORA 2NY3D 4IISA 1SDYA 1B2WL 2VDKH 2VX4A 1HHGA 3KH3A 3S3PA 2DQFB 4Q8VA 2FL5A 3I9IA 2ZP9A 3AFLA 3B1TA 2ZUXA 3QI9B 3I50L 3OMIB 4HCIA 4YO0A 2WNXA 4PL2A 3N44B 1I3RB 2YXWA 3IDYC 1QI4A 4DVBA 1YYCA 2ZUQC 3MBEC 1RUPL 1VFTA 5A3HA 2PGWA 1TCMA 1JEZA 1LG1A 4RZ5A 1PAMA 4BQ5A 4EN3B 2FVKA 4A39A 5D1QC 4Q6IB 3BSZA 2CJUL 3IJ9A 1DFBH 5CUSH 3MHGA 3ZTEA 4G8EB 1EFXD 2ROXA 2VZ3A 3S2CA 3BZDA 4EQ3A 2QVNA 1IEAA 1PZ1A 1HW6A 1HGWA 2OL3A 4KRMB 3BCFA 4E5XG 3SIKA 5I1EL 2ATSA 4JY6B 2OXHA 4UAHA 1GNXA 3KLKA 2OKOA 3ZX1A 1YDVA 3IK2A 4QRUA 4OT7A 3VA6A 4PW9A 2ZZUT 3PSVA 5BVPL 4GVHA 3HFYA 3G0UA 2J3SA 2OLHA 3P9WB 3UZQA 3WK2A 5CPQA 3P8JA 5JQ6L 2ZIDA 1SQMA 4NM4H 4URTB 1U6AH 3LTPA 4ZR8A 1ZE3H 4P61A 5T1JA 3K2GA 3W2NA 4GY0A 4NT0A 1MNUH 5SWSA 2WVSA 3MRMA 1TPFA 1KPUA 1XAKA 1HQ4A 1BEYL 4B5XA 1QX1A 4CQBA 3ZIMA 1DQUA 2Z6JA 2VDML 4ODVL 2VXUH 4FQLL 4GB9A 1IJNA 2GBUA 2R1YA 3ARXA 4HXAL 3WTSA 5AN7A 4JHOA 3GTVA 2XINA 3WXWL 3C4UA 2ESVD 2F7PA 2O6PA 2EPNA 3V6ZB 3RPTA 2MFNA 2Y36L 5E2VL 1SVCP 1T4KB 4H3DA 1E2ZA 1NUNB 1UQZA 4LCWD 2W60B 4POZD 1O4UA 4GH1A 4JB9H 2G2RB 4FXTA 2AITA 5I5JA 1NCDH 1NY1A 2H90A 5ALCH 2L3BA 4M3JA 5GRWA 3HB9A 3TZVC 2VLJB 2V3EA 1A65A 2B7NA 3LXCA 4GRMB 1DQJB 4HYVA 2P1FA 2OMXA 3QG7H 4DVRH 2G3JA 1G43A 1HJBC 5CU5A 1S9WA 4N0UB 2XRAH 3PY9A 2PO6A 1JCLA 4JGJA 1BFTA 3IVTA 4LGSB 5INDB 4FQXB 1OE3A 4ERIA 4PLKD 2W9DL 5T5FA 3TC6A 3L45A 3SCMB 3KPPB 4TQEL 1G7MA 6ALDA 3P84A 4A6YA 1XBZA 1A9EB 4K38A 3D3VE 2WQAA 1FH5L 4GA8A 1LILA 1U95A 3UZXA 2VFGA 3VI4A 3L9RA 2PW1A 1RV8A 3KDMB 3ITCA 4AOFA 1K9TA 4XHJD 1XDJA 4F57L 3QDAA 3QUMB 4BRVA 3K6SA 3G2GA 2F5AL 1PNCA 2NX5E 2EDRA 3T4YB 3TVMC 3IKCA 4B5EA 1S5NA 2ZUVA 1VFBA 2ED9A 5ECVA 4ZQMA 4JFOA 1LQBC 1AP2A 5G4HC 1JUKA 5L2KA 1YEJL 1UUQA 3TU9A 3HAEA 3O06A 1BCIA 2NQCA 3PIQA 3U4EB 4F92B 4RFEA 2QDWA 4MCMA 1K1DA 2DMBA 4ZYKA 2YCLB 1WVZA 2XZZA 3O63A 3PPHA 1Q6RA 1I8LC 1RMFH 2B5IB 5FOBB 2FB2A 4HJJH 1PV8A 4AY7A 1UD5A 1GR7A 3FCSA 3TTEA 4JN2B 1YNPA 3MRPB 4PJ8B 4Q89A 4B53A 3QPXL 3KLAA 3QNZB 4YSSA 3L66A 4JY4B 2CNYA 5AAPA 4NX5A 4XCYB 3MRNB 2ZE3A 3AACA 5JW4Q 3PGCB 5C0CE 2C3WA 3DO7A 4Z7UE 2DQUL 2WO4A 1QI2A 4XPAL 3VUAA 1FNGB 4Z7WB 4YHPB 1DWHM 4QRTB 1TJPA 4TSBL 4DWSB 4HX1A 3QV7A 1MFCH 3OG2A 2YQ2A 1AD0A 1U8CA 3ZY7A 5JW3L 3HE7C 4DYJA 1BPVA 4BI7A 1NBZA 4FFVD 3QDGB 1WJ3A 4LNYA 2DWXA 3EPOA 3TWAA 1T8QA 3GC2A 4ADTA 3I7RA 3V7PA 2NUWA 3MV9E 1DJIA 1H3XA 4HZ6A 1H6EA 4OAWB 2D20A 1X5AA 3K2MC 1XRTA 3T8VA 1FO0A 3W2JA 2J88H 4L4VB 3RR4A 4PBFA 4XZLX 3J27A 1A0EA 4G5ZH 1GVQA 1LVEA 4PRBA 2EC8A 4F79A 2Q8BL 1L0YA 1JCYA 1ZOXA 2HQAA 4QMEA 1HS6A 2X4QB 4CDGC 2DOCA 3ITYA 1DQQB 1G4EA 1K4DB 3ARDB 1K02A 4GJIA 5JU6A 1ZY9A 3NJFA 2GUBA 3VIIA 1U8KB 2MWCA 3W9DA 3F2DA 1EF2A 4E41E 1OC5A 1ACYH 4WEBH 4CMHC 3LNPA 4GAJH 2YPLA 3DWTA 1ZHNA 4ZGYA 4J6RH 1BEUA 3GSQB 4ES8A 1F2JA 3CLEH 4J4KA 1KXQE 3V1HA 2Y23A 4LCQA 4PGZA 4RV8A 4IUOA 3OKMB 3W7DA 2V2XB 2C1OB 3SYCA 5EZOL 3V18A 3LMZA 5SWZE 4B4FA 5FK9A 1P4BL 3GNRA 1UR4A 2DI9A 1IEHA 5J57B 2YD8A 3JBG7 4JNYA 1QNVA 2X70A 4P2VA 4C5YA 3SDXB 4BF5A 2J7DA 2CLHA 5C0DB 3MJMA 2AV1A 1Y8BA 3RZCA 2W1NA 5KN5A 4NQCB 3OZ9H 1H3UA 1C5DB 3WDRA 2W0PA 2ZRWA 3H3KA 3NVTA 1U8IB 2OMBA 4HDIB 2QVFB 2QR0A 5MI0B 3FY1A 2XKUA 3N2CA 2OMUA 4ZUSB 5CP7B 2Y7SA 3IWVA 3ZJAA 2O7SA 3F5WA 4XP4H 4QF1A 3NSXA 4P7LA 4LUSA 3MCKA 3AU0A 5BS0B 4H83A 1YN7A 1PLCA 2FR4A 1D7KA 2I07A 3KPOB 4MAYB 1N8OE 3U4KA 2H32B 2D0FA 4E2BA 4UFMA 2Q6WB 4O02B 4GP5B 4WK9A 1E6NA 3F62A 3A3XA 4U6YA 4MNQD 4AUJA 3V79C 3JWDL 3S1XA 3UR2A 1KTDA 3ENEA 3M17A 4GOAA 4M3PA 1YQVL 3PF3A 4TMCA 4PHXA 1KT2B 3VCRA 5SV4A 3KBWA 1W2KT 1T4WA 2C4FU 4OLWH 3ZVHA 4XUGA 1CGWA 2W0KA 2YD6A 4PVMA 3TGXA 5LNVA 1ZVSA 2EKGA 2VIRA 4LLDA 3KG5A 1YYLH 1GPWA 1TYEB 2XG5A 3TJHD 3ULUF 2UBPC 3AXMA 1E6RA 2NZ9C 2ZZ7A 3QJFB 2B9BA 3I7SA 3IFLH 2F84A 5D2NE 4AXWA 3RUGA 4O1DA 3IE4A 1AS6A 3RGTA 4GACA 3FSVA 2P88A 5C07B 2QKFA 5G4EA 2CYGA 2GVLA 1FL6B 4JVPA 3O9WD 4CKQA 2PTUA 4BXSV 3ARFB 2FDMA 4LDLB 3RTQB 3O0RL 4HN4A 4L4VE 1E3ZA 2R29A 3U4BH 2LW3A 3CL6A 3BP4B 3V35A 1QO3A 3GLZA 4H9XA 2MQGA 4L8DB 1LOLA 3KJ6H 3RNKA 3T1GA 1HZHL 3MC0A 2XT1B 1OJXA 1B6DA 1G7JB 3HIJA 2VRJA 5D4JA 2IPGA 2VLME 1JRHL 2VRQA 1T0OA 4E4UA 1T7XA 1U21A 1YW1A 4IFKB 4BQ8A 4BE5A 2NSOA 2PDJA 2FYYB 1ZXQA 4TSAL 5FGRA 1RV6X 3LJ3A 3VPLA 2PF8A 4ML4A 2EG8A 3WXVL 2X53A 4WWPA 1XGPA 5K2ZA 4E0RB 5D2LE 1KTLB 2UZ9A 3L0KA 5CBAB 1UM4H 4F37K 3TBWA 1HG3A 1WKDA 2EXTA 5ES4B 4UNVA 4XWGH 4M8QB 1ZLWK 1TQBC 5C1MB 1S5IH 1ADDA 3QHOA 3JWDC 7TIMA 5E8EA 1XUUA 2JI1A 1WDDA 1QNOA 2IOIA 1E5AA 5D9PA 4YFDB 5FV1L 1PG7L 1E6OH 1E56A 2X88A 1W3LA 3RU8X 4LSQL 1JFQH 1D5MB 4YFEA 3E9TA 1FA4A 5C9RA 1KFWA 4WCYH 3S5NA 3EO9H 1HP4A 1CICA 3RFAA 4NQCE 3UW6A 2PP0A 4Y9MA 4XVJL 4BQBA 2NWRA 2BSCA 3T0WA 2QCNA 1UB6A 4ANVA 4D9QE 1R30A 4Y4HD 3ABSA 4J3OD 4E8DA 1JWSB 5IVOA 3W7RA 4JRXD 5DXYA 4KTEL 2IO5A 1A6WL 1CQKA 4FLOA 5J56B 1CDBA 2TRSA 1KFLA 1GS8A 4QG9A 3TBSA 3JTSB 4XBSA 3S35H 4LF3A 3ZDYE 3EFDL 3QIUA 2PRHA 1VLIA 1TPH1 1QFEA 4JDVA 2YZ5A 1TETL 3C60B 5DJCA 2K9FB 3WJLC 8RUCA 3F4CA 4OZHA 4NBZB 1N59A 1U58B 3LZLA 3QNYB 4YXGA 2ZG2A 3QQ3A 4XVOA 4LPYA 1LLAA 2A5HA 2RA1A 4LAOA 2YUVA 1J7VR 4MIMA 3RPDA 2NXYD 4R4BB 2DV6A 4P23C 3P69A 1IWPA 4TUKL 2WLLB 3AIWA 4Q22A 4LFHG 3HQNA 3WQFA 1GTHA 1RQBA 1WS8A 2ATKA 5G2IA 2FTPA 4ANUA 5F9WB 5HK4A 4RZCB 1DXFA 2JQXA 1XO8A 4M61A 5I73B 3EWBX 5IHWA 1FLTX 1HXYA 5MKGB 3JWNG 2VDIA 5EORL 3TZVD 4LSUL 3PABA 3MUXA 2YCJA 1YN6A 2B14A 2HT3D 2EG7A 1W9PA 4LNVA 4L5ZA 5TF0A 3TSMA 3GMRB 1BZ8A 4UNUA 4JFFD 3BQUA 3OKEB 3RY5A 2J74A 5CIPB 4ODSL 3EO1B 3ZYIA 5TDPA 3L23A 1OVDA 1TJGL 1K6QL 4HKBA 1NUFA 1S7WB 3AB0B 3URQA 2X9WA 1NDMA 3Q5YA 1RU9L 3Q6FB 5BQDA 5BROA 2WKGA 2R1WA 3NIFF 2EIJB 1I7TB 4IPJA 4H13C 2JKWA 2H47C 2IUZA 2Y7MA 3MXVH 1I8UA 3K1DA 5FYKD 3FU5A 3GQFA 3TX9A 3KMDA 3RYSA 4FXKB 4X6DF 5T1KA 2Z35B 3CO8A 1E5YA 3X17A 3QZLA 2NYKA 4WSHA 5BO1L 1UA3A 4OQTA 3MLWH 3X12B 1Q0XH 2ZYIA 5C8JB 1A5BA 3R89A 1AZ1A 32C2B 3UESA 4OIIL 3AU2A 2IOMA 5DRNB 1L0PA 4IJCA 3LPGA 4HH9B 4ZCWA 5I1LA 1GHFH 4DH2A 3JV0A 2VOTA 1Q94A 4GKZB 3ZLHA 3CAVA 2OTWB 3W25A 3Q2LA 1S9VB 1FZMA 2JFEX 3ZDXB 4JZJA 1Q2SA 3I02A 4BH8A 4IGSA 3VX1A 2X0VA 2XQYK 1P1XA 2CDFB 4EXKA 2HPMA 5J11C 3VE0A 2AP2A 1PPIA 2V3FA 1PG7X 4NZTH 4K7FB 3TASA 4CGUB 3BLKA 4OIAA 1D3GA 1QR4A 5G1YA 4N2BA 2DIBA 1S7UA 3ARQA 5E2TL 2G2NA 1XGUA 3BEWA 4XMVA 5FAJA 3S3SA 2IAMB 4HVXA 3U0WH 1XLCA 4CVXA 3JRKA 4GFXA 1B54A 1T1WA 2D3LA 1KYOJ 4MVAA 4A22A 1IIHA 1G87A 1FBIH 1SW0A 4LV4A 4GXFA 4J23A 4AHQA 4IMDA 2L7EA 5J12B 4AEHH 2EP6A 3OHXC 4UQ9A 2TRYA 3QHZH 1LE9B 3L68A 4QYOA 5PAZA 4A7QA 2NYZA 2FJFB 1ZPTA 3AS3A 3GXTA 1PGRB 3M8OL 4H0LC 4LL9A 5I0YA 3KHOA 3QS2A 4HLZG 1GXEA 5LA1A 3Q67A 5B1JA 4DVOA 4NN5B 4F93B 1DJGA 3GU9A 4FNUA 4AKOA 5B3NA 5KBPA 3S5LA 2VFIA 4YLQT 1W3IA 5K9JL 3UD6A 2KYIA 2C91A 4J39A 4IH3A 4YH6A 1WC7A 3VDAA 4B9FA 2DQCH 4OVXA 1OSYA 4O0ZA 3RWCB 4L9LC 1HFUA 1Q13A 1M71A 3O6ML 4LCCC 1NANH 2W94A 2GSGA 4JLRA 1UGNA 4P2RA 3SJVE 2K7PA 1HSBB 3ZLQC 4HA3A 5AHLA 5D96B 3FCTB 2OKMA 3UETA 3GS6A 4JKKA 2PCPB 1BVZA 1A3RL 4MQXC 4KV5E 2DJLA 4WDTA 3CV6A 2OV0A 2XACC 4GXUN 5I09A 5E9DD 1RJLA 2N7AA 5AYIA 1I1RA 3CN4A 1J48A 3DMMD 2YKLH 3N19B 4XXDB 4L3CB 1XWYA 4PSPA 1B4JL 1OFPA 2D2HA 1OF2B 4WTZA 2F74B 2ADYA 4PRDB 1LO2H 1QFWM 1IARB 1EQCA 1N68A 3AZUA 3ZE0E 4NGHH 2H32H 4PN6A 2JI2A 2IPJA 2X1IA 4YDNA 3UZZA 1PLBA 1RUAH 2ID5A 1GZHC 4P46B 5AALA 3FCUB 4EANA 1GCYA 2EE6A 1ZA6B 1LWHA 4MKVA 1U8PA 3RY4A 3MJ8A 3U8GA 2Z1VA 3RB7A 1MH5B 4R9OA 4U1IB 3U1PA 3SPJA 1J9SA 3HV8A 3ULAB 1WISA 4IHCA 4LSVL 2MTPA 2UZIH 3VXMB 1UJTA 3SM0A 2IV8A 4FXSA 4HK7A 3K6FA 3ASWA 3FOMA 4Y2NA 4ZMVA 2D2JA 4CCCA 2DFAA 2YR3A 1NDGB 4OGAC 1FN4B 3EOEA 2C3VA 2W9MA 2NZ9D 1QHPA 5KAQF 2ZSVA 4S2SB 1OZMA 1I7RB 2CWRA 4H40A 5CZSA 2DT2A 3IWPA 2X4NA 4TNWK 3VI3E 1MCPH 1IE5A 4WEUD 1EJSC 3TTYA 4QRRE 3V9CA 2EG6A 2WMIA 3SKOB 4YPGB 1IT9H 2R1XB 2FYMA 1LK3L 4ORGB 2VZUA 1YNKH 4JPKL 4JJ5B 4RGOH 4GO6B 1Y0LB 1EEZB 2APVA 1LCOA 4KRPC 3LEXB 5HGAB 4DKFL 4ZUWB 2BIIA 1U30A 4WV1A 2V5LA 1SO6A 1ZS8B 5C09E 2CZ5A 2F9BT 5F1SA 1AGBA 1NDVA 3ECBA 5IMMA 3I6GB 3W7MA 4MA3B 3TW6A 4ELMF 4H25B 1NCAH 1GQLA 1QU4A 3G0SA 1XFPA 4K6AA 4G70B 1C1EL 1FVDB 4GUCA 5ERWA 1ZFJA 1T04A 5E94A 2YXVA 2VOMA 3RWEA 4F2MA 4ACZA 4GPVA 4MXWH 5IROA 3B9NA 2NT1A 4X0NA 3TPKA 4YHGA 5DMKA 4J8RB 3C6LA 4WY0A 4DETA 3IXTA 3MU3A 3AG4B 2PBGA 1AIFA 3QN3A 3WE1A 1MHCB 4PJ7A 1NGXA 3MC5A 3D18A 1U1HA 1QQDA 2EUWA 3VAEA 2D0HA 1X6NA 2J73A 4HPHA 2X0WA 3PUCA 3CHQA 2OJZH 2BNQA 1XRFA 4O58L 4XBJA 3IGXA 4PVLA 5F1KC 5KAQG 2R0ZH 2JCCA 3CSFA 2FSEA 3FS9A 4YHKL 2DT0A 3S46A 1PDKB 3E80A 4N8CL 3TIDB 4NKOA 4CADB 1KJ3L 1L2QA 4DBEA 2V9QA 3ARYA 4AGQA 1ES0B 1CLZH 1OCNA 1VH7A 4HK0A 4MBRA 1YPZB 1C16B 4EI6B 2R1PA 1EJRC 1HXMA 3UXLA 4N6RB 3CZNA 1PDZA 2QQLH 1WUZA 3NIDB 5I16A 4OFVA 2ZUMA 1DBMH 5IESH 2VXNA 2VCCA 1P84J 2DQTH 3BSMA 5C0FA 3EOUA 4XX6A 5GS0H 3F7LA 3GMPB 2XWDA 2FZ9A 1QFUL 3B8DA 2Y1VA 5EBLA 5KBDA 1OD9A 5SWUA 2BNUA 4R97B 3GM0A 2HISA 3AFBA 2Y7OA 4IDLA 4U2YA 2MEJB 3V8CA 3K71B 3NK4A 1PO9A 1CLYL 3NQVA 1NIUA 2A2QT 4LANA 1NQ6A 5IFAL 2ZYSA 3VXME 4P7RA 2A3BA 1YEEL 3FQ2A 3B37A 5D7IF 3GFYA 4RK8A 4R3SA 2OMZA 3VCCA 5DHVA 2Q10A 3R94A 2NW3A 3P9LB 1QFHA 2Z2UA 3B5GA 3LS9A 4V2BA 3GKZA 3QO0B 1L0QA 4PEEA 4IU2A 1XF3B 5F21B 1WDSA 4C4UA 1F1AA 5L9FA 3PL6B 4WUIA 5GGUB 4QXGH 5CIPH 4F8LA 3EXJA 3RWFB 4NP7A 4MZ3A 5JZ7C 1SO5A 1NTHA 1H0DA 2H2SD 2YUZA 2FHCA 3RIFK 2CKBB 2GYIA 1ZLUK 3K5XA 1J8HA 5GGSY 3RK8A 2B0SH 2AEPL 4LPTA 3WKPA 4YWGH 4NCC2 2P4AB 3U4FA 2DQDL 1TZGH 1R4XA 3FFCE 1NFBA 2OR7A 3CSTA 4Q8BA 1F07A 4K8GA 5B39A 2F19H 3FXIC 3H54A 3L3KA 3SYAA 1QLEL 4GIRA 2UVEA 1G01A 3KLHD 2CXEA 2H0FA 3FB8A 3V6FB 2EO7A 2OB3A 2DDXA 3I2CH 3RLSA 3ITGA 4WI5A 1Z48A 3UBGA 1YDYA 1Z1WA 4MMZA 3UBFA 1XL4A 2YOCA 1QBMH 4PJHF 3WLSA 4HIJB 5IHLB 3IU3B 2RHEA 3DV4B 5CEZD 3HTWA 1P6FA 1XZ0B 3SDCA 4HMCA 2BVWA 1SYVA 3ZZ1A 1OSEA 4MB3A 5E6IC 1X5JA 4NQVA 5K4XA 4WHBA 3ITTA 3VFWA 4MSWB 3FFDB 5IVXF 5GZNC 2JB6A 3GM8A 2Z9TA 1GQNA 1MIEL 5J6HA 4FXJA 3DBXA 3O41B 1V79A 2BNJA 2W4XA 2R56L 4UTJA 2VI0A 2NY3C 1YPZE 1I3GL 3O6FA 5I1DA 4QJ1A 2G50A 4KHXH 3BUYB 2CQVA 4IMLA 3DX8B 1GC1L 3N40P 3NIDE 1CTMA 1AHMA 3GD6A 4K1WA 4JFUA 1JPDX 2WMFA 1YMHA 1ADWA 2F7FA 3LCFA 4F15C 1JGMA 3IAQA 3CZGA 4GMSH 2Z29A 4O2EB 1T7LA 2AJZA 3RE0A 2OG9A 4F3HA 1IAIH 3BGMB 3TYAA 3QJHB 1U3HA 3ABGA 4Y19B 2OPJA 3MKVA 4DPPA 4WWNA 1UZ6F 1HIML 5BOJA 3NJLA 2A4ZA 3EYOB 4PRAA 5DSCB 1V7AA 2JB5L 3DDFA 3C56A 1XB8A 3NMEA 3MTWA 1KCVL 5DUPL 5FDYA 1WKEA 1KLUA 1YC7A 1A7PL 4AUYA 3Q06A 3T0CA 3APCA 1SF5A 2ENPA 5KSAB 3F7VA 4R0LA 3CFJA 3VQ1C 4X2PA 4KGLA 4AB4A 4P2QE 2ZJSL 3MU7A 5B7ZA 2C9AA 4HPJA 5E2WH 4ELKA 1PIGA 4JR5A 1VRDA 4JG1H 4BGDA 3UXKA 4Q6JA 4IRZL 4B15A 3VFTB 4GSDL 4CBPA 4HETA 4KJYB 5KVDE 4LVGA 1MDLA 3R1GL 4MWAD 2JQMA 2ED8A 1P5UC 3NZ8B 2VWTA 1AGCA 5GRVK 4BZ2L 4IMKC 2WKOF 1SR9A 5MEND 4OCMC 4D9RE 1T21B 4X6CA 1J0IA 1NCBL 3UBXG 3Q8BA 1X6UA 5T33L 5KS9F 1NGZB 5I0DA 2EDFA 3GK0A 3TIMA 5E56A 5F2MA 3FTXA 2J8UF 5IKCA 1T83C 4PRIB 2VGGA 2YRZA 3OAYH 4DW2H 2G41A 2A77L 3SE8H 1SZRA 4MMXB 2WBJB 3LHYA 4RNFA 3L7FA 3WJJC 2PLKA 3R1ZA 4POZC 2V63A 2WWCA 4NKQB 3LG3A 3ANVA 4ZT1A 1GC1C 5DFAA 1N7ML 5D6DA 2D03H 3FQRA 3MRCA 3QEHA 3P74A 2P5EA 4WI0B 4KRTA 3QEQE 2PTDA 1XLHA 1Q9OA 3GSUA 1GOXA 2FJUB 4F1ZA 1UR1A 3OYZA 4OLZH 3M7SA 1NPNA 4HJEA 4KDVA 2Q7YB 4WSJA 4S3KA 1IXNA 2BLFA 4ES9A 2MOQA 1X7FA 4PLKC 2XXGA 5I1KL 4I18B 1AJZA 2PDQA 4GQ9L 3FK3A 4N0FA 1KGYE 3R25A 5JO5B 2VEMA 1OZUA 3WH9A 2Y5EA 1XCTB 4ZUUB 1AIZA 1GHRA 4TTDD 3EYPA 3TC3A 1FX6A 1TZZA 1AFVL 4XHJC 1DN0A 1Z32X 3K81A 2I9LB 3RITA 5DWPA 3ARZA 3O2WL 5LWYH 5IWLA 4F7TA 1LRNA 4LHQB 3I9GL 5CLZA 2CBIA 1NBCA 1XR8A 5LXXA 3O0FA 3AREB 3AMKA 3CFEB 1R5IA 1A7NH 5I2UA 3SBWC 3HZYB 4H8PA 3V7AE 2O9PA 3W7OA 3N11A 2Q3RA 5FECB 4HK5A 5HUPA 4FAAB 3NXLA 2W61A 3LCYA 1OWQA 3UNDA 5EN3A 1FNAA 4XC3H 1E90A 1CTNA 4Z3EA 1N8FA 3QEUA 1LT8A 3JW7A 7REQA 4DJDD 5D1XE 4ACPA 3PJWA 2OYKA 1KRMA 3S36L 1XGYH 2R1NA 4A55A 3BKYH 4JZ5A 3S6CA 4X8CA 4DF1A 1QT1A 1F5ZA 5IW3A 4ZFMA 4EJ1C 1V03A 3VOFA 2EKCA 4DOHE 3UZVB 4DBWA 4QHLB 3QUXA 1ZRUA 4HKZB 1WEJL 3SDOA 2IGFL 3W7CA 5DD3H 1CBJA 3WDIA 2HT4D 3AADB 5CGMA 2OWCA 2R69A 2DEYX 4BR1A 5IIEA 3MP3A 2VXQH 3TFXA 3JWOL 4PY8J 2CLZA 3KLDA 4PS8A 1C8YA 4FFVC 1SJEB 3KBVA 2PDXA 1INQA 4CJ0A 1ZENA 1X39A 3G3MA 3GXFA 2XVNA 3URBA 1KV8A 4HPYH 4GG8B 1F58H 3QH3B 4TNGA 1TA3B 5LGZA 4P3CH 2ZUTA 2LTQC 3QHFH 2XI9A 5I1GL 1I1FA 3FB5B 3TZFA 1XKJA 1E9OA 4NUMA 2V3DA 1AKJB 1VGEL 1E9YB 3TM6A 1ERNA 5EEYA 1GGCH 2AK1H 4L8BB 1C5CL 3VRIB 1O95A 1T6WA 1AHWC 4Z7QB 5LCVA 5FF0A 4A2MA 3M0XA 1MQQA 2C0AA 1CT5A 1GZPA 3WIIL 1TU2B 3GS7A 3GIZH 2E7LC 1H1ZA 4OBRA 4BELD 2ICSA 5CPLA 2YAPA 3GWJA 1LEIA 2V3GA 3GMNB 2NUTA 2IQ0A 3GNML 3FONA 3R43A 4I90A 4UINH 4M48L 3RLUA 4AF0B 4RAUA 1TZHB 5FYJE 4YHOH 1VYRA 2H1XA 1MFEL 1YEYA 4IFRA 1FFTB 3D39E 2DQJL 3KBFA 3LKSA 1AK5A 4WZHA 3HI6H 1TQSA 4N25A 4PBDA 4YGVA 2BGNE 4RNJA 3IJLA 2NPLX 2FVLA 3MKCA 5HJ3A 2REQB 1V08A 1XW8A 1KR0A 1H0IA 4O8AA 3JWOC 1AH4A 1ZWIA 3QDMA 3KRZA 4AYFA 3WLBA 4PG2C 1Y07A 3ETBF 3LN5B 3OAUH 4XP5L 4LCIL 3NIGE 5DO8A 1IGCL 4IOSA 3WKMH 2NZIA 4HQQH 4PJ9A 2XH0A 1EX1A 3MLTB 3VIOA 3RKPA 5GXBB 4DKAA 1AD9B 2DQEH 1NUDA 3F7YB 2QSCL 5CO1A 5DT5A 3UCRA 1WWAX 1K6AA 2CKBH 4JKLA 4X5WB 4Y2DA 3PSWA 3CIQA 4XODA 4YOKA 2PFHA 3F6IA 2X30A 1I4NA 4PMDA 5ITBH 1W1TA 3DRTA 1O9ZA 3REVA 1TV8A 4XD5A 1FUNA 4G82A 3CASA 4HHAB 2VXTH 3P61A 1UWSA 1QLFA 4XPHH 4X2RA 1IGML 3HLKA 1UEMA 2ACSA 4S3JA 5E00B 3CJPA 4LL1A 2F58L 4WI8A 1JCMP 3SGGA 3UJJH 5IB1B 1TE6A 2LU4A 3CDZA 4JL2A 4RSVA 3E6FA 3TJHC 2A6LA 1UPMB 5TFSL 1P6CA 4HCRL 4LNRA 4GS7C 3HRZA 1E9QA 1BQ5A 1ZLPA 3I3DA 2Z7ZA 4J2MA 3NDZE 3O9WC 4IQEA 3B8IA 2E77A 3WCYA 2O5XL 5GGTA 5BU9A 1NBVH 5F7DA 3BWWA 5D32A 2HKFL 3T07A 3LD8B 3U30B 2BOGX 5F9DC 3V95A 3UTTD 2CO6B 2TSBA 4CNSA 3RDTC 2CNCA 4FALA 3VZYA 1T5AA 3D3VB 1H15B 4OCWL 1VEMA 2ZRUA 2YBVA 4A7TA 2B15A 1PKOA 4AH7A 1L7IL 5G2HA 1H7PA 1RUQH 2KDGA 1RHHA 4GAGH 3KXFB 2NX5B 2BWDA 3X14B 4E8CA 4REQB 4PUKA 3L6FB 4DUWA 3ISIX 3KL3A 1HESA 4M43H 5JIQA 2HVBA 3KHQA 3VC6A 1A4AA 4WLCA 4O4WA 4JO3H 3TJEL 1P5VA 4OI9A 1HCVA 4ZTXA 4NM8L 2UY6A 4DUOA 2VERN 5FYJU 2H9AB 1JPTL 4F8NA 4LAMA 3KZPA 1ISZA 3A12A 1VB9A 3W7NA 2G3FA 3IDIB 3VCLA 4ANKA 4ZOBA 5FL0A 4L1XA 2HG5B 2HVMA 3E2HB 1MFAH 1XCQB 4PTUA 5CCKH 2EGZA 2B7PA 2ZOKB 4IP7A 5C08A 1OYBA 3AC0A 2E9IA 5H8DA 1ID5I 2A4CA 1L8PA 1JGEA 3KBEA 3EOAA 1GQKA 1ORQB 1C8PA 3PWPD 5C0CB 1HAWA 5IVNA 4ADUA 4Z7UB 1S7RB 2GGEA 3VWKD 1WFNA 4QLRA 3NTCL 4Y4HC 4RFNC 2OSYA 4N3UA 1RQHA 2WCPA 4J3OC 4HW6A 2FJKA 2E5BA 3HZKA 4NP9A 5FYKL 2MH4A 4JVWA 2K9UA 1ITQA 1BOGB 1FHLA 1NOLA 2XWTA 2QPXA 3EUDA 1S9YB 1PLGH 1PKMA 2DF3A 4ZPVA 3DHDA 3DSFH 3HOGA 4UTHA 1L7TH 4FS0A 3FU7A 2Z7UA 4DQAA 1MELA 5E9AA 4OR1A 1K5WA 4Y9NA 5FEPA 1UD4A 4ZZ9A 1FL5B 2OSXA 3MV9B 3TR2A 4MYAA 5D7LD 2NXYC 1SFDA 1NCWL 1FFNB 1J01A 2OODA 2CXGA 2JKTM 3S4SG 1F1GA 4GZEA 4PH8A 2CLOA 1B6UA 3UJFA 2O6CA 3HG4A 4LOVA 1OL0A 4HJWA 2GJNA 2HRPH 2NQ5A 2GWGA 3JUGA 1U2CA 2WO2B 2OWWA 4ICWA 5T5NF 4G9DB 4B3KA 1ZTXH 4XTRD 4AGNA 3QEZA 4L5FE 2HT3C 2ZXWB 3D50A 4KUCD 3GSRA 2WHLA 4EPDC 4E41B 5GS2D 5CS7A 1ZPLA 3WK0A 3ZR4A 4HFUL 2F6XA 4H9VA 1UPPA 1INDL 1IGIH 4IQJA 1W17A 4MD4A 5SWZB 1R19A 2AK4E 3IN2A 3U9PH 2YXOA 3GI9H 4B7IA 3GNOA 1ND0B 1Z5YD 2Q0ZX 1WICA 2Z8VC 3KXFE 1G7IA 2R39A 2PZ0A 1E4NA 1IIIA 4DEWA 1AGFA 5JPNC 3BDXA 3PBGA 1Q6QA 3UADA 2HH0H 4WWKB 4MMWA 3EJZD 1LD9B 4RMWA 1H09A 1PKLA 2ZKYA 4DTGH 4G6KL 2GI0A 3D12B 4DI8A 1ML1A 2R2EA 4HULB 3RZWA 2GSMB 4JTTA 1ED3B 2Z6IA 2A6DA 1ZJHA 4RUBA 3BZGA 3RL2A 3MNZA 1HP5A 3C8KB 1J05A 5AKSA 3EF4A 5I0VA 1FAIL 5I8KL 4XZBA 1IE7C 1FP9A 4TPRH 2D23A 2O4QA 3C86A 3N3EA 3TO2B 4O8RA 5I8CA 1JN6B 4ZK8A 2RDUA 4BFOA 1DR9A 3QFJE 5DJAB 1BYNA 3QKZA 1VKXA 5T5NG 3MO1B 3PZMA 2I32A 1FJ1A 4FLSA 3S0CA 3FSAA 3NN8A 2GTQA 3DA0A 2WKLA 2DM3A 5F3HB 3H26A 7PTDA 1MRFL 3O6LL 4FSAA 5KSUA 1EUUA 5C86A 1HU8A 3VU1A 3H0TA 4ML9A 3ZTCC 4NZCA 4XNQA 1W8NA 3KNBA 4ZFFA 3MKKA 4O2CA 4B2DD 4HWNA 2Q3ZA 4MVBD 4YJZL 3RJQB 4QLWA 5D2NB 4L8SA 1L9SA 4G7SB 3FB6B 4G6FD 3WMLA 2PDMA 4X4YB 1NEZA 1D7FA 3O3DA 4I5XA 2E75C 1UBPC 4Y9OA 4GI8A 4WDIA 3NOEA 2X0UA 4EUPG 1WBXB 5ESVA 2R23B 1C9WA 3EFFB 5AKTA 4CEXC 3MRJB 4Z7VE 2XNAB 4YCPA 3OLIA 4M93C 2H41A 2BVOA 1ZP3A 4R6UA 1G4PA 3ROOB 3BUIA 3PHOA 1NQKA 3KPRD 3WNMA 4HMDA 3RIKA 3Q01A 1NJ9B 3SIZA 2Y1ZA 5D7HA 3FDGA 2QSQA 3KR3H 3GGWB 3GHTA 4NO2A 4KITB 4RISH 4HG4J 2X9YA 1Z7JA 3GFXA 3RU8L 1YNQA 3D85D 1G1OA 1JERA 2ZUUA 3L67A 3DX1A 2JJTC 5M3WA 4IHOB 5D2LB 3GZPA 4DKDC 3TA4D 4X7TA 4EF3A 5EV7A 4M4RB 1AQ0A 1XIIA 1K8ZA 1TVBA 4XNXH 5HNRA 1HHHA 2ZPKH 3WNKA 3NESA 2XWBB 2KLRA 5KTEH 4KPLA 5BRBA 4KUZL 4PU2A 4ONHB 3QZWA 3QUKB 1PTZA 1CR9H 2WPBA 5DEGA 3QC0A 5DJ6B 2EVHA 4C6BA 3IFNH 4KI5D 4AE1A 1QO5A 1L9WA 1KN4H 1XIEA 5BRPA 2EDQA 1OIOA 4FQHB 3FTUA 2GJZA 5GRJL 3V4PB 4W70A 4Y90A 3DMMC 3ZT6A 1THFD 2J5WA 4E2OA 1IGWA 3KP0A 1E6XM 5DJ8A 1R3JA 1BXNA 1P0BA 8FABA 4FQCH 4YXHH 3C2RA 3SCQA 1TYRA 3GZQA 5BRZD 3EGXB 3G6AA 3ZDYB 4E2VA 1M4KA 2FEEI 4RDBA 3MJ9L 1NICA 1UUSA 1J96A 3PJNA 4OUIA 3CQPA 2VLRD 3T2NL 4HHMA 2P8LB 4IIQA 5HGBA 5AOUA 3TNNA 4JYFA 4AYID 3WQ6A 2BP8B 1CT8B 4B3VA 3K6DA 1UROA 1RVFL 3TWCH 2FT8A 1B4TA 2IANE 2J77A 3VH8A 3WBAA 4YXKL 3PGFL 4Z1CA 3LRSA 1A14L 3NR0A 1E7UA 2VT0A 1K9FA 5GGSB 3L95A 4P5TB 1RCOB 1HDMB 4Z1DA 2DZUA 1REQA 2P5WA 3FO0L 3HZVA 2FBJL 4C6FA 3TEYA 4L80A 1C5BL 3QDJE 3MTRA 3EH5B 4UFIA 3W70A 2R0WH 5TF1L 3W07A 1I4FB 5E95B 4ONGL 5I18L 5TQ2H 2G60H 4YFLI 5I23A 5EU7E 3VXSA 3RDTD 1AFSA 3T3ME 4I9XA 3A6BH 2Q20A 4WK0B 3WBEA 1FWXA 1QFWH 5I28A 1QOXA 4GSRA 1E42A 4H0GA 4OI8A 4BSWA 3GK8H 1DBBL 4WW2A 1J9TA 4JNZA 1DJWA 5M95B 4AD0A 1YZZA 4UNIA 5C54A 4PJCF 4L9XA 2PAJA 3QJAA 3RL1A 1DL7H 5FFGA 3I9PA 5JR1L 1LTDA 3PDOB 1D2OA 2A73A 4N0YH 4WJG3 3P4OA 3GTIA 2NQ3A 1CBVH 3E6HA 4MAUL 4P3DB 1YYMH 4PAZA 4GO9A 5DQJA 2Y7GA 4PJGE 3QORD 3LV6A 3CLWA 3C5SA 2W92A 1ODAA 3EDFA 4JFZL 1RFDL 2F38A 3MLRL 3QF0A 4K71B 1NGPH 3SDYL 4D7BA 4DGVL 1CDJA 1XG3A 2V5KA 2OI9B 3M1OA 2BVDA 3KW8A 3VXNB 3B0UX 4LEFA 3URAA 4MZ1A 2QIIA 1UWUA 2W95A 3LV3B 4ODUB 5A3ID 1T5XA 2X1QA 4XD6A 1R3HB 3QP3A 1JZGA 2ZKHL 1P7KB 3MGAA 3NBNA 1PTAA 4ZOCA 4MYWB 3QUYD 1VRSA 1UZ8A 3TO4B 4RBPK 2GTZB 3SJ3A 2J72A 3MUGB 1U8MA 2XTLA 4YBQD 3OG6B 1Q85A 1V3JA 3SADA 3AJ7A 2V30A 4IBYA 1LBFA 4KZCA 1NFPA 3FYEB 3DHPA 1E6JL 4Z3HA 3VXRD 3VG0H 2PDUA 2JEQA 2FX7L 3FJ6A 3NCMA 3ZM8A 4Z08A 4GHRA 5I6NA 4AQOA 1INEL 2V9TA 5H91A 1G1KA 5CEZL 5FIPA 1CFTA 2YA0A 5DO2D 5LGJA 1DIDA 4ZS7H 4RIRA 3UZEC 4IBZA 4BDVA 5C3IA 1DO5A 3IXAB 2PXYB 4KXCA 4WX2A 3QO1B 4G8FB 2ZZ1A 4KH2A 4HJ1A 4QHNB 1N8WA 3C2FA 4X0KA 3AUVA 2DZTA 5LAXB 1XIWD 4U28A 4P9HH 7ODCA 5JBFA 5AOZA 5J9PA 4YIQA 5CD5D 4QE5A 5DYFA 5F0LB 4OQ1A 1RZJC 1NGYB 3W9EB 2FD6H 2C14A 2Z91A 1MI5A 1E0UA 4Y88A 5BJTB 3GMLA 4DEPB 4YYCA 1BWLA 3PWUB 4LNCA 4FFZL 4HWUA 2IH3A 4UM8B 1JXDA 4DIXA 3EH2A 1SYTA 1X44A 2WHVA 4X7SL 2H2SC 2OS7A 1LL6A 3D07A 2V38A 4JEGB 2JLLA 1B4KA 2Y85A 2COQA 4KKXA 1GGBL 3P73A 4YHNB 4K68A 1D5ZB 4LSSL 3CAKA 4NZFA 4H2HA 3FX4A 2GUUA 3S2AA 1OAZL 3QUMH 1B5TA 1CQYA 1DBJL 3B3BA 5LVEA 2DDQL 3SJVB 4MRBA 4I8YA 3P02A 3TT1H 1N8IA 3MFFA 3H9SE 1LWRA 4U1LB 1BXXA 2PWGA 4AEEA 3MCNA 9XIAA 1XSKA 3N43F 1D9KD 4PRHA 5KANI 2BXVA 4JW3A 3KLHC 5CR8A 1GGUA 3TTQA 3LIUA 3FN3A 4A8LA 1MZHA 2MQ3A 5J1SC 3SUUA 2P46B 3OEXA 4QE1A 4BFFA 3O2DL 3RFZB 4MY9A 5DHDA 2BPBA 3ZE0B 3UMNA 2I60H 4IRSB 5SX4H 1OVZA 3CZJA 3ZE1E 1M41A 5A6SA 2DQFA 1JXKA 1GL4B 1ROWA 5AECA 3W23A 1DJXA 2BCMA 3LA4A 5CSRA 1JJKA 4NAEB 1WA1X 1CDCA 1R86A 4W89A 3QI9A 4C1LA 3PNWB 4DB7A 3FJTA 3NL3A 1PW3A 1P7TB 2ZSWB 4M5ZL 1GK8A 2VKXA 4OV4A 1I3RA 1E4WL 3CN3A 4NFBA 2Z8WC 4PVBA 5D6CB 1DLFH 1XSOA 2D3JA 4H8NA 5CNHA 4ZX3A 2DICA 4BI6A 2D1ZA 3RB5A 1KM1A 2J62A 5HVFB 4Q6IA 4MFEA 3VFOB 1XSJA 5HANA 4G8EA 1JNLL 4HZ8A 1B30A 1F8MA 2F8OA 3GMMA 1S2UA 5ACLA 3PQYE 2WUBL 4RGMC 3VI3B 3LD5A 5IGXH 3WJXA 4QRRB 5CHNB 1GPOH 4HMNA 1UP2A 4Q3MA 4Z3JA 2R8SL 2E5DA 4A2FA 4R7NB 3SFWA 3BAYA 2UY4A 3QXAB 2LLNA 4OFIA 4ZMNA 1DJQA 5AB2A 1DQWA 2CJSA 5BMFH 3ZDWA 3H42H 3AT0A 2ICEA 2HX9A 2ORBL 3R4DA 4IJRA 1EK3A 5C09B 3LHAA 1MW2A 3TTOA 2OQHA 2WNQA 3A22A 1E4JA 2PYFB 2J8OA 2A99A 4U3HA 4ZW5A 1MZZA 4K0OA 1O60A 5L88H 4KCWA 1T4KA 1N82A 4G11A 3IB4A 2FBOJ 4MWAC 3KVQA 2W60A 2G2RA 1W5PA 5I6SA 1KPVB 4PTWA 1UGKA 4OGXL 4LLWB 1OABA 4LC6A 4LKCB 4XMPH 4HYWA 3UU0A 2VLJA 1UM5L 1MAML 4LX4A 5F70A 4RGNE 4GRMA 2K3HA 4JPVH 2QVTA 1XYZA 3C09C 2ZRZA 3BPOC 1C3FA 1PYFA 3SUWA 2YRLA 3PC0A 3MV7D 5CC3A 2WW5A 3N1GC 1HI6B 4FQXA 4G7YL 1XVSA 3ESNA 4LTSA 1Q8AA 2BOBB 3SCMA 3KPPA 2PI6A 5HMEA 4HUWB 5KVEE 2A6JB 3GU2A 3NK3A 3W73A 1WYIA 2J8TA 2DWSA 2E6FA 3JVFC 2MCMA 4HSOA 2WINB 4TN9A 3KDMA 2C16A 2YDAA 2YSTA 2XTJD 2X6UA 3AI0A 4JDEA 4WKXA 4IGHA 1UR3M 3WENA 3VA8A 1DDHA 5H4YA 2Z7WA 2WXRA 4O02H 3T4YA 1LBMA 2A9MH 4BRJA 4RNRB 4Z2GA 4MNKA 3ATZA 3TX4A 4XH2B 4LIQL 4YNYB 3X3GL 4EX4A 4JO4H 4ZI8A 4TTDC 3KM2A 4GG6F 2FWUA 2JSFA 3C0LA 3VTMA 4PRPE 3HS9A 4ECNA 5KYUB 4PCSA 2W5PA