4X9YA

Wild-type human pancreatic alpha-amylase at true atomic resolution (1.07 a)
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Wild-Type Human Pancreatic Alpha-Amylase at True Atomic Resolution (1.07 A)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 177
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4x9yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4x9yA01
2CHNA 2CIPA 1UKOA 2XIIA 3VD4A 3BVVA 3GXNA 3GXDA 2WSPA 3BSGA 4OKDA 1HP4A 3WF1A 1OGSA 3U5UA 4BS0A 1W32A 2CBJA 1B3WA 1GOOA 2F61A 4QLJA 4DWSC 1E0XA 4FLQA 2WW5A 4TOQA 4TUFA 2WANA 1BVZA 1CECA 1BQCA 1UWRA 2YL8A 1KB3A 2VNCA 3WFZA 2J7EA 3AHZA 3DYPA 4A3YA 2WB5A 4AZIA 1H1NA 3EJPA 2F7QA 1TQWA 3VGFA 3FXYA 1JI1A 1R86A 1Q6CA 4B15A 1V6VA 2XTKA 4UQAA 4XUYA 1H5VA 1V3LA 2X2JA 3PZUA 4MNMA 2VRJA 4C7DA 3CUHA 4D6DA 1NOFA 3VIMA 3AHYA 3W38A 1MW1A 2WHKA 4Z2LA 3AXXA 4ZXOA 4F66A 2D0GA 1UWQA 3SUWA 1CXLA 3L4TA 2YLLA 3NDYA 3KWXA 4CCEA 4CCDA 1V02E 3FN9A 2QPUA 1QI0A 3K46A 4LYRA 4OOZA 3DX1A 3WY3A 3VINA 4NXKA 4LX4A 1ZBWA 1U2YA 1JF6A 2J77A 2ZUSA 2WZHA 2GUYA 2VX7A 1WO2A 1W91A 1FOBA 3CUIA 3EDJA 3VX0A 1VFFA 2ZE0A 3WF3A 5FCZA 1ZS2A 2ZX6A 1UUQA 3DHUA 3LPPA 3DX0A 3ARQA 3KLKA 6CGTA 3OLIA 1J12A 1TA3B 2W61A 4QCEA 3TV8A 3A47A 1UKQA 3AROA 2WXDM 3MANA 5E70A 1AQ0A 1R33A 5HXMA 3TTYA 5ABEA 4U5IA 1OD8A 3NSMA 2WHLA 4W5ZA 3VM5A 3ZT5A 1QHOA 1B90A 1ISXA 2D22A 5AYBA 5C70A 1UD5A 1W1VA 1J0YA 3VMPA 5A2CA 4W88A 2VTFA 3GM8A 3HG5A 4AW7A 2G8ZA 4D6JA 1GOWA 4GIAA 1O7AA 2WKGA 4UZSA 5E0CA 1Q6DA 4YHGA 3EBVA 4PMYA 4PMNA 4FNSA 4EAMA 1BGAA 1B3VA 2A3CA 1MFVA 3W24A 3WNLA 2ZWYA 3DX3A 2GFTA 4N0RA 2D2OA 4OZOA 2MANA 2D20A 5D9PA 2G3IA 1NQ6A 4L4OA 3WL1A 2Z1KA 4PUEA 2VZOA 1JDDA 2CKRA 3F5LA 3OIHA 2OWXA 2QLYA 2YA1A 3D3AA 5M17A 5D9MA 3A3HA 3WQ5A 2WMFA 3EJRA 3DYMA 2F7PA 4Z2GA 2PWGA 2YL5A 3RM8A 2J7CA 3EJQA 3VIOA 1HKKA 5ABGA 1LF1A 4AIUA 1UH3A 1R46A 5I5RA 3VUPA 3VGHA 1D3CA 4U3CA 3L4YA 2WCSA 1EA9C 1ISWA 4AIEA 3NCOA 4TVCA 3ZM8A 2X2YA 4GXPA 3DHPA 3WQWA 2J47A 4AZCB 5D4YA 3WD4A 2VUYA 3K1DA 5LYRA 4DO6A 1ZBKA 2VX4A 3B9EA 1EDQA 5A6JA 3D5HA 4M56A 2JF6A 3ZR5A 1J18A 3WDIA 3MV01 4AMCA 6A3HA 3POCA 3U5YA 2WC4A 3GXMA 3CH9A 4WJXA 3L4VA 2VURA 1BYAA 5A2AA 2NW0A 4F79A 3GDBA 3HU7A 3DC0A 1PIFA 3D4YA 1UWUA 1OD0A 2D1ZA 2J7GA 4TTUA 2ZX7A 1ODZA 3MUY1 5A6BA 4TTGA 1QBBA 3L2LA 4WIWA 2TAAA 2GSJA 4ATWA 1E4NA 3PZNA 1I75A 1BVNP 1LL6A 5I0DA 2VVSA 2XYLA 3BLKA 4DO5A 4AWEA 4D72A 1FP8A 1UR1A 1HXJA 3W6LA 3ZJKA 4RE4A 2QMKA 4LYQA 1LL7A 3W4RA 3BXWA 4PN2A 3VSVA 1XCXA 4PYSA 1KFWA 4IUGA 1GQJA 3WD3A 4D6IA 3BC9A 4UR9A 4NI3A 1H2JA 3LXCA 3CTTA 4IPLA 3PTQA 3ARWA 2WC7A 4H41A 4NXSA 2VR4A 3CZKA 5E0FA 3SCNA 4OUEA 3WUFA 4D6FA 3OLGA 2XSBA 3UG4A 1KBKA 3OLDA 4AD5A 1G5AA 2YJQA 1D7FA 3DECA 1WB0A 3PTKA 3H55A 3TTOA 4MNJA 1UOKA 5BXSA 5A6AA 1XH1A 3WMBA 1DWIM 2XPKA 2CBUA 3U57A 1HX0A 3LXAA 1EOKA 3CHDA 4D6GA 1H3GA 5D8ZA 5IXEA 4S3KA 3BLPX 3WQ8A 5DT7A 4P7NA 1OWQA 2GJXA 4MAZA 3VGBA 2OSWA 2BVTA 2DIJA 5A8NA 1E73M 1GOKA 1PX3A 1UKTA 1E5JA 3WELA 3EJSA 2BVYA 2ZUWA 1UD6A 1GNXA 2DH3A 1E4MM 1K9TA 4D6CA 2GJPA 3PTMA 5CSUA 2GJRA 3SCVA 3VIHA 3N9KA 3PHAA 4DUWA 3KL0A 3ARTA 3ARRA 3O6AA 1EQPA 4HZ6A 4AZ5A 4FF5A 1E1EA 1VFMA 2VJXA 1HKMA 4UNIA 1ISVA 2EPLX 1HWWA 1MQPA 2CESA 2WLYA 1WDSA 2YFNA 1J11A 5HBFA 2CEQA 4HPGA 4M81A 3W6MA 3VDBA 4W84A 4QDMA 4AISA 4UFLA 4GQQA 3SCOA 1VIWA 3FHAA 3RIKA 1FHLA 3ARVA 5I23A 5BXRA 2Y5EA 1HJSA 3L4UA 3IK2A 3WNPA 3WSUA 3GH5A 5CZKA 4PMRA 4OIFA 3VX1A 1V6WA 4LGXA 4ZE4A 1KGUA 2W66A 1QNPA 5E6YA 1IZKA 3A24A 3LPFA 3AYRA 4PRWA 3RPMA 4XZBA 1QNQA 4FLSA 2X09A 5BROA 4CUCA 1Q6FA 2WVSA 4ZENA 4CN6A 1E6ZA 3AYSA 1SMAA 3GTNA 3M46A 3SUVA 3MSDA 1ZL1A 1QI2A 5I79A 4YN5A 3UERA 4KGLA 5FD0A 3D4ZA 3WD0A 1V03A 2W92A 1CXHA 4M8UA 1LG2A 3U7VA 3HJEA 1F4HA 4C7FA 1SR0A 3BH4A 4GO9A 1W3HA 2OYMA 2EPMX 2WZIA 2A3BA 4F8XA 1JF5A 3AS1A 1R47A 1GZJA 4B3KA 3EDEA 1US2A 1UWTA 4P7OA 1QPKA 1R34A 5KEZA 1DWAM 1JDAA 4FNRA 1EDTA 5LA1A 2WMIA 4UTFA 3AMLA 1C7SA 1GVIA 1HTYA 3VMOA 1ODUA 1KWKA 2IUZA 1TQTA 2PI6A 4E8CA 2Y24A 2BNJA 3LRKA 5GPRA 2OYKA 1W3KA 2QHAA 1SZNA 1EIBA 3DDFA 1NOWA 3THDA 2VI0A 5CJ5A 2VZTA 2DEPA 3PZIA 1UG6A 4ZE5A 3GBDA 3CV5A 3L2MA 4CN4A 1J0KA 2ZXBA 2UY2A 2VT0A 2E8ZA 2WVTA 5M5DA 1B0IA 3A21A 2YDQA 2PB1A 1UYQA 3MV11 1JI2A 1E4LA 1M01A 3WD1A 3QHMA 1GJWA 2J7BA 3UR8A 1CYGA 4LYPA 4AZHA 4FK9A 5JUVA 1X1NA 4PEEA 3APGA 2WCAA 1R7OA 1JZ7A 1LQ0A 3WQ4A 1LJYA 1Z32X 3F4VA 1J0ZA 5I77A 5A6MA 2WBKA 1HKIA 1HF6A 4D1IA 5BXPA 2VX6A 4P8VA 2VZSA 3AXIA 3VIIA 3PZGA 1R7AA 2F1AA 3POHA 1KXQA 2O9TA 3NIYA 1VEPA 1R85A 1JGIA 1KR1A 4D71A 7TAAA 1W3LA 1XHGA 2VCAA 2W62A 1UWIA 5IHRA 3T08A 4LXFA 1IT0A 4QP0A 3D51A 1W9DM 1JD7A 1E6RA 1ZB5A 3J7HA 5IFPA 4RL3A 1TMQA 3EYPA 5CGMA 1W3JA 4PMDA 4X0VA 1HL9A 2XFRA 1E56A 5I3DA 4EE9A 1A47A 1MWOA 5E9AA 4HA1A 5TD4A 2WVUA 3W27A 4GO8A 1G0CA 3SCWA 2YA2A 3SCUA 3ZJ8A 3GH4A 2GDUA 2ZX5A 2UWFA 4DUXA 1NP0A 1US3A 5CLWA 3ARYA 1R75A 2JF7A 3AIVA 4UFKA 1UZ1A 2J7DA 1V0NA 3QR3A 2WMHA 3VIPA 3RILA 3S2CA 2PBOA 2G3MA 4JHZA 2E3ZA 1PX8A 3QHNA 1JZ5A 1U33A 1GHSA 1FHDA 4FNUA 2QPSA 5E1QA 1UR8A 3T0AA 2X2HA 4WKFA 1C8QA 4HMDA 1GW1A 3BLBA 4P8UA 4PUDA 2XVGA 3CHFA 4H8HA 4AZGA 2J25A 1EDGA 3NUKA 2VZVA 1ITCA 2Q8XA 1RP8A 1VJSA 5AY7A 5JBDA 1CDGA 4KH2A 3WNOA 2XGIA 1C93A 4M82A 2G4FA 4BA0A 3BMWA 3N12A 1KWGA 5A8OA 1EHAA 3RJXA 2RGLA 3WQ6A 2FE0A 2GK1A 1UD3A 2D73A 1ZU8A 4P8XA 1G1YA 2YKKA 1CZ1A 2VX5A 3ZSSA 1FA2A 1WAWA 1VFOA 1WZKA 1NH6A 5I24A 3GH7A 1VFUA 3KLLA 2CBVA 3I3BA 1CGVA 1MW0A 1V0KA 1CGUA 3ZT7A 2D3NA 2ESCA 2X05A 1SMDA 1J10A 2WHJA 3BUPA 3BAIA 1JYNA 2EEXA 4J3TA 1QWUA 1GOQA 3WF0A 2E0PA 5BWFA 5A6LA 1R8LA 3S5ZA 4BQ4A 4M24A 3BAXA 4E8DA 1JZ4A 4HPHA 1GUVA 4DO4A 1BHGA 1WDPA 2WSKA 5CLTA 4H8UA 3VDHA 1HT6A 3B9DA 4GQRA 4CU6A 1NWUA 5DO8A 4H7VA 3SCQA 4JFVA 4NZJA 4JCMA 2QV4A 3UCQA 4GINA 4B9ZA 2ZUNA 3UG3A 3VILA 3ZR6A 3EDKA 2WPGA 1V6YA 1HJQA 4PCSA 3T2QA 2VC9A 3ZT6A 1QBAA 2XGBA 2V3GA 2EPKX 3L4XA 3AMCA 4KWUA 2EPNA 4AZ6A 4EANA 4P8WA 4HOWA 1GCYA 3VMNA 3O2LA 2DT3A 2ZXDA 4TVUA 1AMYA 4U31A 3TONA 1Q4NX 1VEMA 4H2CA 2DT2A 3SCRA 4FNQA 3VD5A 3JUGA 3N11A 4OGZA 4CCCA 1C91A 1EQCA 3WH6A 3ZO9A 3VNZA 2NT0A 2A3EA 2ZX9A 2XSAA 4M29A 1QNRA 2GJXB 3K8KA 2PF0A 3BVWA 2OWCA 2CETA 4AY1A 3GXFA 3MMUA 1V6XA 1E3ZA 1VBUA 4C7GA 1LG1A 3K4DA 1E6QM 2C8NA 3I3EA 4D6HA 2XJ7A 3WH8A 5GNZA 4NZCA 4W7VA 3MMDA 1XD1A 3OB8A 3OGSA 1TZ7A 1CLVA 5IDIA 1QNSA 4LQ1A 1WDQA 3FW6A 3VGDA 5DEZA 4U33A 2EXOA 1B1YA 2BY1A 1KTCA 2FHBA 3BUBA 4AMWA 4ATDA 4BQ2A 1CPUA 4CD8A 3EDFA 4GI9A 1JYWA 1GHRA 4ACZB 3AS2A 4F9JA 1XGZA 3IAPA 1HNYA 5C8BB 2DSVA 2F7OA 1TQUA 3PBGA 1XH0A 1W9PA 3O9NA 3WN6A 3PZQA 3FAXA 2BHZA 3W53A 1V0LA 1VBRA 1OM0A 5HPOA 2XVPA 3VOCA 3N18A 2DPEA 1UH4A 3BAWA 5KZ6A 3CZNA 1XV8A 3TA9A 1V02A 3UESA 4FLOA 3N15A 3A6OA 3BUIA 5C71A 2CYGA 1GONA 2D24A 1MQQA 1PBGA 4Q7NA 3WH7A 1WE5A 1NP2A 3GXTA 4AD0A 3N17A 4CVWA 2DSUA 3HG3A 1QW9A 3SURA 3VIGA 1FH9A 4PMUA 3ZQ9A 2BXZA 3F5KA 2BV9A 3WUBA 2E9BA 4GI8A 1O7DC 4PSPA 1V0MA 1LWJA 1UKSA 4WKAA 4NF7A 1W9BM 3DX4A 5GNXA 1W9UA 3T09A 2YA0A 1WKYA 4AD1A 4N42A 4WLCA 2DSKA 2EO7A 1WZAA 4AEEA 4OJYA 5ABFB 1H0GA 3B8SA 1JZ8A 4BF7A 1N82A 1J01A 4NSBA 5HDRA 5AYIA 1NARA 3FY1A 4XV0A 4PTWA 1GQKA 5IFTA 4TX6A 2W63A 4Z2KA 1KGWA 4MTVA 3W28A 5EMYA 2WMIB 4W85A 4XX6A 1OGGA 3WDQA 2BHUA 1OT1A 2OW6A 4JFWA 1XYFA 2WKLA 5JIWA 1JAKA 5A6BD 3CUGA 4MB4A 2ZX8A 4KMQA 1W9VA 1CXIA 3T2PA 4CGTA 4UFMA 1V6UA 1E3XA 1E72M 5E09A 2J62A 3AXHA 4UQCA 1ZBCA 3K8LA 1UQYA 3WF2A 2Z1SA 4HU0A 1GJUA 3L4ZA 3EDDA 1TFVA 1XYZA 3VSTA 2D0FA 2PWHA 2FYVA 3FNDA 2FDMA 4W5UA 1Y7VA 2ZICA 1IZJA 5A8PA 3IANA 1HXKA 2F18A 2W5FA 3VD7A 4MADA 1B9ZA 1E71M 3W29A 3IJ7A 3LPGA 2XN2A 1UWSA 2HISA 2W91A 5CGTA 1EGZA 2V5DA 3BUQA 1ECEA 1F4AA 4D6EA 1GOMA 4ZFMA 4XZWA 2AMGA 3U7BA 2AAAA 4WSJA 1NOUA 2EACA 1HVXA 1PAMA 4PSRA 1K9DA 3SCSA 4UCFA 1G9HA 2DIEA 4X0NA 3GNOA 1XH2A 3VGGA 1UR0A 3WNMA 4W7UA 1U30A 1JYXA 3PZ9A 1PEZA 1BF2A 1K9FA 3ARXA 1VB9A 1LWHA 2WVVA 3WBAA 5EB8A 1UA7A 3TOPA 2PC8A 4CU7A 1CIUA 1OINA 3AIEA 3PN8A 1UQZA 5LA2A 3W0KA 3OGRA 2ZUVA 3WIJA 1UKPA 1UD8A 3FHQA 3DX2A 3LPOA 4HMEA 3MU7A 4J3SA 2DSZA 2E40A 3W82A 1AVAA 3AJ7A 2X1IA 3WEMA 3LMYA 1HIZA 2BFGA 1JZ6A 3AHTA 1PZ3A 2CHOA 3A4XA 1CNVA 5BXTA 1J0IA 3LXBA 1SFSA 2YDRA 2DGAA 1M53A 4DUVA 4TXEA 2OLHA 4AXNA 4H04A 4E2OA 4X9YA 1PIGA 4ZXLA 1KXHA 5HOSA 2XM1A 2E8YA 2FH6A 3PZTA 2E9LA 4PTXA 4A4AA 2V5CA 4MNKA 3MO4A 2JIEA 2FGLA 7CGTA 4WSKA 4JFUA 3CZGA 1KQYA 5FL1A 3H53A 3NYDA 2VRKA 2BHYA 2GK1B 1H11A 3CBWA 1VAHA 1EOMA 5F7UA 3M6DA 3CMJA 2X8RA 1C92A 1TUXA 5BRQA 4U5KA 2YBTA 2XUCA 1BYDA 2X0HA 1UA3A 2XWDA 4WKHA 1W2VA 1EO7A 1TVNA 4GZJA 3BVXA 3G6LA 3OLEA 1FH7A 4JZ5A 3UEQA 1CBGA 4M1RA 3WY4A 3VU2A 4J3WA 4HZ7A 1E6SM 4HP5A 1TE1A 4JKMA 4ATLA 5EFDA 1YHTA 3BVTA 4JKKA 1JYVA 3ALFA 2EJ1A 4JHOA 4HZ8A 1I1WA 2ZOXA 3AHVA 3LRMA 1J0JA 3ZOAA 1QHZA 5D9OA 2CCRA 2V3DA 2YL6A 3SUSA 2J74A 4W86A 3CZ8A 3SUUA 1L0PA 4DWSA 3M07A 3PZMA 4W87A 2OSXA 1M04A 3S5YA 2B31A 2ZIDA 4MDPA 2XVLA 5I2UA 2X0YA 4B9YA 2XVNA 3AQUA 4JL1A 2C7FA 2F1BA 1E0WA 3IJ9A 1JFHA 3AZRA 4AEFA 1FP9A 1NWSA 4EK7A 2HVMA 1UR9A 5JBFA 3IJ8A 4KGJA 3WH5A 1E4IA 1CLXA 2IXUA 2NSXA 4ML4A 1AQMA 1TQSA 4PMQA 1KCKA 2CXGA 4L4PA 4PCTA 1BAGA 3EMCA 4QFUA 2Y2WA 4LPCA 1JDCA 3CO4A 4UQ9A 4WF7A 3E1F1 3EJTA 2E4TA 2WMJA 1K6AA 2WM0A 2YLAA 2DQXA 5FIPA 4B3LA 5CG0A 4UFIA 4W7WA 5I6SA 4QLLA 3ARZA 4W93A 3THCA 3CC1A 1C90A 3WUGA 3ALGA 3WDJA 3A5VA 4YHEA 2UY4A 1M03A 4PMOA 3MUZ1 3QHOA 2PWDA 1ISZA 2A3HA 2EABA 1KTBA 3IAQA 3VIFA 3NSXA 4HMCA 1A3HA 1LL4A 3VTRA 1K9EA 1PZ2A 3W25A 2DSWA 3BUDA 4MAVA 3ZSTA 1CGTA 3WY1A 1OCQA 2XVKA 1V3HA 1XSKA 3WNKA 3KE0A 4QLKA 2XFFA 4ZEPA 4Q22A 3VO0A 1XRVA 2OW7A 1OIFA 4U2YA 3AS3A 1BG9A 2VZUA 1XSJA 1R87A 1VJZA 3AMKA 1D2KA 3DYOA 3WBEA 5A1AA 5AC5A 4JFTA 1MXGA 2WBGA 1WZMA 5A2BA 2CPUA 2J8FA 3LRLA 2CNCA 3PZVA 3A23A 4J3XA 1E15A 3WL0A 2O92A 3WENA 3VNYA 1E5NA 2ZUUA 4UFHA 3D50A 4BQ5A 4Z2JA 3MSGA 1HL8A 2XG9A 1BYBA 2OYLA 3VKKA 3KEHA 2RGMA 4AD3A 1JNEA 4U3AA 3RMEA 4Z2IA 2CERA 3N1AA 5EFFA 4UQEA 5M03A 2D0HA 4P7RA 3EMQA 4J3UA 3B9AA 1FFQA 4AZ7A 1V3IA 1QHPA 2X2IA 3VM7A 2WMGA 1VF8A 3MUAA 4KRTA 4QCFA 1QI3A 1G94A 4M80A 5IHSA 1B2YA 1RD6A 3OG2A 3MUIA 3WQVA 1WNOA 3VPLA 1VEOA 2V3FA 3CZSA 4FNPA 8A3HA 5FOOA 2ALWA 1S46A 2JEPA 1JZ3A 3BMVA 2F2HA 1MW2A 2JFEX 1NWTA 4DM2A 4TX8A 1VRXA 1P6WA 2XM2A 3ARPA 2WAGA 3CZEA 2FHFA 2XWEA 2XFYA 4GZIA 5CPSA 1JAEA 2VQTA 2Y8VA 3AZSA 1RP9A 3AIQA 1H09A 3HZ3A 2IGTA 3QOMA 3EJUA 1OBAA 4MJ4A 7A3HA 2O9OA 5BYWA 2ZXQA 3AI0A 2V38A 3AISA 1DWGM 3H54A 3WDRA 2G3NA 2ZWZA 3GNPA 4HA3A 4PMZA 1H4PA 1PJ9A 2YBUA 1UD4A 5FKYA 4CD7A 2ZUTA 4AYSA 1C3FA 5E6ZA 3BGAA 1HKJA 1SYTA 3OA5A 3CHCA 1HP5A 1LLOA 2J7HA 1V3JA 3WUEA 3WEOA 1C7TA 1E9LA 1E1FA 1W1TA 1PX4A 1DWJM 1H49A 2J79A 4Z2HA 3A4AA 1E0VA 1ITXA 4HTYA 2EADA 3M7SA 3PZOA 3A22A 1GORA 3WFLA 1V3KA 1RPKA 4AZBA 1CTNA 2D23A 3G6MA 4NRRA 1EO5A 2IXVA 1B3ZA 5I78A 4FMVA 3MI6A 2VMFA 2VVNA 3RM9A 4CD6A 1KGXA 3GBEA 4IISA 1X6LA 4JIEA 2PBGA 3AZTA 2F7RA 3WDPP 1QVBA 4UFJA 3WMSA 3AIWA 1PS3A 3AICA 2VCBA 1JNDA 3BSHA 3CGTA 1CGYA 2WVVB 2W4XA 3KL3A 2DDXA 1X6NA 1PPIA 2FGZA 1QNOA 2CBIA 1UD2A 1UR2A 2JE8A 2G3JA 2WK2A 1B31A 2J7FA 4PBGA 4HOXA 1J9YA 1BSIA 1KXTA 2G41A 1TCMA 2XIBA 1GQLA 1CWYA 1W9XA 3AFBA 3AIUA 3BCDA 3GZAA 5A69A 1E70M 1W2PA 4GZEA 4CKQA 4R27A 1CXKA 3RO8A 1JXKA 2J78A 3CUJA 4TVDA 4MB1A 3BVUA 5BRPA 1L8NA 1DP0A 4W8AA 3CUFA 2FHCA 2WNWA 5CXPA 3FAWA 5A8QA 1E6NA 4W8LA 4MNLA 1MW3A 1XSIA 2YDSA 3GXIA 4JL2A 4BZYA 3HMCA 3CHEA 2XN1A 3VD9A 1JXJA 2FH8A 5DT5A 3AS0A 2VQUA 4NRSA 4V2XA 5DMYA 2EPOA 1JD9A 1WPCA 4D1JA 2EBNA 1E6XM 1TA3A 3EMZA 6TAAA 1CGWA 2GVYA 2W67A 3WH9A 3WDHA 2PWEA 2VL4A 1JG9A 3GNRA 4GPNA 3WMCA 2F8QA 2NT1A 4GKLA 3AHXA 4J7RA 2VO5A 1XC6A 3MKKA 3WKZA 3CZJA 2JEQA 4K68A 2QF8A 1DHKA 8CGTA 2OWWA 4CD5A 1GOIA 3T2OA 5D8WA 1IV8A 3RDKA 4AD2A 4RE2A 3WF4A 5DF0A 1BTCA 4AIOA 2ZUMA 2J4GA 3MMWA 2Y8KA 2BY3A 3NJ3A 1BFNA 5A6SA 2J75A 4J28A 3OBAA 4FNTA 4P7QA 3HG4A 2WC3A 2BY0A 1HJWA 3AMDA 4V28A 1QW8A 1UHVA 1OSEA 4DWSB 1MQRA 3VD3A 3RM4A 4CU8A 5GNYA 2O9RA 3SEPA 1KCLA 5JIPA 2BY2A 1CEOA 1EXPA 2UY5A 4WK9A 1ESWA 1MYRA 1DEDA 4NX0A 1RH9A 3K4AA 2YL9A 3W37A 2XHYA 3RJYA 1EHNA 3ZIZA 5EBAA 1B3XA 1GVYA 2D3LA 4DM1A 4PTVA 1QOXA 3S6TA 3ECQA 5JBEA 1O6IA 1I1XA 4ACZA 3F5JA 4JAWA 3CZLA 2PWFA 4J27A 1E40A 3DDGA 4IM4A 3KZSA 4PTMA 4ACYA 1BG4A 1FFRA 1QI5A 3VSUA 1MFUA 1QWNA 4AZCA 3CMGA 1M7XA 4MDOA 4HA4A 3WNNA 2WYSA 1W1YA 5A6KA 1JL8A 4QAWA 1TG7A 1WP6A 4Y7EA 3UR7A 3UG5A 3SUTA 1HVQA 5ABHA 2OSYA 2YIHA 4MB5A 5CSYA 5A95A 3OZOA 2Y4SA 2JIWA 4BQ3A 9CGTA 3QOKA 4J3VA 1C8XA 3A4WA 3SCTA 4PMVA 3W26A 2WZEA 1TR1A 3I3DA 1BGGA 1AQHA 1V08A 2A3AA 1KQZA 4MJ2A 1CXFA 1OGBA 1GQIA 1MXDA 1DWHM 3BAKA 3CLWA 1WDRA 2WMKA 3VVGA 3WEZA 2BS9A 1UH2A 2EAEA 3GXPA 4HOZA 5A8MA 2V3EA 3RCNA 5D9NA 2WLZA 3W81A 5CPQA 1EH9A 4UOZA 2AOSA 3TTQA 1CXEA 5M3WA 1OIMA 1KXVA 5ABFA 4AC1X 1BYCA 4A3HA 4OOUA 5GQBA 1B3YA 1V3MA 1UR4A 3OZPA 1TVPA 4P7LA 2GDVA 4OBSA 4W89A 3LX9A 1GPFA 3CPUA 3GYCA 4F9DA 1E6PA 4BCEA 1W1PA 2WCGA 3AIBA 1TQVA 2WHMA 3WD2A 4H8VA 5A3HA 1C8YA 1H0IA 4CN1A 1XCWA 1NWRA 2CKSA 2DT1A 5HPCA 4W8BA 4UQDA 1Q6EA 3N13A 5LA0A 3ZJ6A 5BCAA 3HN3A 4UOJA 2QMJA 3ZMRA 4XB3A 3SIMA 3IGUA 3WY2A 2XN0A 3QGVA 3BCFA 1XD0A 1KR0A 4CVUA 4OBRA 3BAJA 1HJVA 1DTUA 4E4PA 3HG2A 2WWDA 3L4WA 3TTSA 4PMXA 3ARSA 1KBBA 1JZ2A 3VIJA 3BAYA 1UASA 2VRQA 1G01A 5CPTA 1JIBA 5ECUA 3N04A 4JCLA 1J0HA 1QX1A 1BLIA 4UZUA 3TP4A 4URIA 3NDZA 1E55A 1ZJAA 3VGEA 4AMXA 4JFSA 3T0BA 2ZXAA 1VENA 2J8GA 4AD4A 4NZFA 4R5EA 1HN1A 3OGVA 4KRUA 5DFAA 2DT0A 2VOTA 1E43A 1MVYA 1YQ2A 1WZLA 1WCGA 4U2ZA 2YFOA 2JALA 3MS8A 4RE3A 4FLRA 4S3JA 3ZJ7A 1JFXA 1B30A 4MB3A 1ZJBA 5HNNA 2VR5A 3II1A 4GI6A 4UQBA 4MPKA 5CQ1A 4JKLA 3CIVA 1H41A 3SCPA 2C0HA 1BPLB 1ISYA 2BVDA 1Q6GA 4B16A 4DWSD 1UZ4A 2UY3A 4IPNB 5A94A 3KL5A 3VDAA 3AMGA 1CGXA 3VIKA 3UETA 1QI4A 1OT2A 3K8MA 2E9MA 1ZBVA 5AC4A 2BXYA 1HJUA 3ARUA 4UOQA 3T0DA 4YPJA 3D52A 1DWFM 1T0OA 2EQDA 1NM9A 3VDCA 3NSNA 2DH2A 2CITA 4HU8A 2O9PA 4AYGA 2WWCA 3AIRA 3AOFA 2YOCA 1CENA 4EKJA 4V27A 2VCCA 1OB0A 5FL0A 1HJXA 4CD4A 1FH8A
chains in the Genus database with same CATH superfamily
4NRYB 1HEZB 2J5LB 5EMLA 3K1GA 3GK0A 3F65A 4GMSL 3N2MA 1PD0A 3OR6B 2JB6A 2O61A 3R1ZA 3U0WH 4J40A 4BWLC 1T22A 4H5SB 1CECA 4M6OH 1IUZA 3W3BA 1P7HL 1MG3C 3DYPA 3LNDA 1KM5A 3WTTA 1CB7B 2PCXA 4W1TA 1V6VA 3QI9B 1NOFA 1E9PB 2VDMH 3C6SA 5HJ3A 2UVFA 3V6OA 2OGYA 2A2QT 1YE4A 1J05B 1PG7X 4XNZC 1KFAL 5EPDA 4NWUL 4K2UL 4TMBA 5AYTA 1WAPA 3PWPA 2ZZ1A 4U6YA 2J77A 4H9ZA 1QSFA 3GNML 1XWVA 5DJYB 3STBA 4HHMA 1BQSA 5MERB 2QQKH 3GMMB 3LPPA 3KLKA 4Y2OA 3AU2A 1AQ8A 5J5DA 1PTDA 2W61A 4QCEA 1BTMA 4M0XA 3USZA 4Z1AA 1BMGA 5C6TL 3T4AC 3UC0H 2YKLL 4TL4A 3IIZA 4IQHA 3SO3B 2D22A 4U1NA 4CSPA 1YNTB 3S2AA 1ADQA 3ARBC 5HGAB 1AQDA 5FJUA 4D9LL 1U5JA 5C2CA 2I9LB 2RFGA 3NK3A 4EAMA 3UU0A 2EKSB 1P6AB 2HQAA 4HALA 3WL1A 3B06A 3E12A 3IMVA 3TIDA 1UJ3C 4CMHC 5FO8B 3SOBL 5AVHA 2DQTL 4KO9A 1AO7B 4YFEA 3DDMA 3L95A 2XIMA 4XD3A 2YL5A 4EOWH 1NAML 3ORWA 4KRPD 1DJXA 4YLWA 1R46A 4JFQB 2C5DC 3VUPA 4P9HL 4JQ1A 3T3ME 4GW5A 1GTNA 1ZKAA 4NHCH 1PFCA 4GEJA 1TJIH 1PZ5A 4EUPA 3BE1H 4RESB 2CKNA 1R3IH 4PJIE 1YYAA 4V1DB 3OU8A 3RK8A 3CUZA 4R85A 4IBQA 5I1GL 4KXDA 3HU7A 1JNLH 2WZPA 2OEJA 1DLFL 5G4MA 2AQSA 4FLHA 4WIWA 1XL4A 4AB4A 1NDVA 4MY1A 3BDYL 3WMQA 3H2EA 4AJWA 3EO1B 4RPQA 4Z77B 3Q13A 1ZK5A 3I6RA 4PGCA 2X70B 3MP5A 1ZNNA 1YN6A 1GQJA 1AUSL 3GMRA 3CTTA 3UO1L 2ADFL 4RZKA 5EBMA 1QBLL 3WG6A 3OLGA 3ZLQC 2DLIA 2NZLA 1VJIA 3ARDA 2J43A 3SDAA 3WMBA 1T40A 3HOJA 4P3CH 2FO4A 4P7NA 3TZVD 2LQRA 1TNMA 4HK0A 4YGVB 4MLRA 2DH3A 5C9WA 1UROA 4ZTPH 3GIZH 3PTMA 1ZP4A 3VIHA 5C07B 2W0PA 3ULVC 1NCDL 2OTWB 3ZW3A 3UDWC 2F8OA 3SOTA 1KEGH 4GQQA 2YZRA 5EZJA 4Q8PA 1HWHB 5CC3A 1CC3A 3ZTJH 5D7LE 3GB7A 3VXOB 2ZZ2A 1KGUA 4JVWA 5EKYA 2DQMA 4PZVA 5DQJA 1N7MH 1URIA 2BSTB 3RWFB 3P81A 4CN6A 1UADC 4QG6A 1OCRB 1WOBA 5T1DH 2FTPA 2OJPA 4UBDD 2O72A 4EN3C 3VYNA 2X4NA 4IHOB 4EVNB 1CWVA 2Y6SC 5IBTH 4JTLA 2AQNA 5EULV 4JD4A 2A3BA 3QJUB 1QNZH 4CQDA 5HYJA 5AC6A 2EVJA 1YPXA 1EDTA 3BZ4B 3HE7B 3VWKB 4AK2A 4XNQB 3U0TA 4E3TA 3CEPA 4UNLA 3VMOA 1PDKB 3N40P 5ALCL 4I3GA 1FFTB 1E4KC 1YPZB 5HDBE 1NOWA 1HJCA 4KWVA 1VKXB 3CT2A 2UY2A 3OG4B 5M5DA 1KPUA 3C2VA 4G6MH 5DN1A 3V2AR 1XIEA 4DNLA 5C0RL 4LKXB 4X98A 4UZGA 1HKIA 1HF6A 1DXFA 4PJ8A 1WA3A 2AK1H 2BASA 2UZYB 1R85A 2R4SL 1NGXB 5EMKA 1DBKH 4BQ6A 3KGRA 2PABA 4R4FH 4B60A 2ADGA 1HHHA 2PYED 4ENZA 3V6OE 3VRLE 2XFRA 3HGJA 3PCYA 3W27A 3SCUA 1A5FH 1BQHA 1GGBH 1A7QL 4G1EA 4FAMA 2NQLA 2CKBB 4J12A 2L5HA 3D3VA 1TQXA 1QSFE 3E2HB 3SGKA 3OKLB 3S2CA 5MKGB 3S3CB 2PBOA 4Q4SA 4IP4A 1SQ2N 3DETC 1D5XB 2VQ1A 2OR9H 4APXB 5DFVC 3PFQA 4KX7A 3RZCD 3BH8A 4F2FA 1GW1A 2QKIC 4P8UA 1J8SA 1TETL 4LSSL 4G42B 4OUUA 1RJQA 4TUOB 1FX6A 5AVZB 2H3DA 1M05A 4APQD 2NY0C 2H4EA 2A0NA 3GSVB 2D2GA 4LSRL 2QJJA 3BZEB 1Q0YH 3SE3A 3F8UB 2DS4A 5IKCB 1AGBB 2H7WA 1AG0A 1RZ7H 3CSTA 3FN0L 1XG4A 2O5YH 2WN2A 4IGHA 3LSOA 1NCAL 3WS3B 4AUUA 2GUOB 2KX9A 3NH7L 2VMDA 4R5TA 5FM4A 1N8FA 4DPCX 1GUVA 2OL3L 3ZE1B 3QS2A 3MRHA 3FKRA 1BX2A 4JN6A 4WEBL 1KIPB 1RJYB 4P8QA 1XR9B 3NPUA 5H4YA 1UXMA 3MRLB 4DJDA 2CC0A 3M4HA 2DORA 4IQJA 4RV8A 3LXUX 5TQ2H 2QV4A 1ACZA 3VXSD 4RZ5A 1S8DA 4PCSA 3PUCA 3BWWA 4DAGL 2BCKB 4KZDH 2ESVD 4YL2A 3AITA 1F18A 2VE6B 1YADA 3W7PA 5D5MF 2YDAA 1Q4NX 4N24A 2VD9A 4XT1C 1E5ZA 3VD5A 4GK8A 4X6BB 3N11A 5HHOA 3BI9X 2A3EA 2GJXB 1G7HB 3GMPA 3QB7C 3WQCA 1GK8A 4K71B 4GI4A 1G43A 4HT1L 3THQA 5C2BL 4L9LA 3B3IB 1TZGH 2IGFL 1A0QL 5H37G 4D6HA 3EYQD 3OJDB 3R89A 4WDIB 4FI8A 3LQLA 3HTWA 5I07A 4XXDA 2XN9D 3E0LA 5I1KH 1K8YA 1IX2A 2BHZA 4CNTA 4Z42C 1OF2B 4IBUA 1U93B 1TZHA 4K23L 3CZNA 1FFPA 3VRIB 1V02A 1NCGA 1WZ1H 4W4NA 2BWGA 4Q7NA 2YYUA 1G7IB 3QO1B 2NW3B 2VJ0A 2HS6A 3FU9A 2A74C 3WL9B 2FYYB 2B15A 2R69A 3DIDA 3SE8L 1P1XA 4NF7A 1W9UA 1JHKL 2YA0A 1WKYA 1AJZA 2JWYA 2DSKA 2ILLA 3AUJA 5SWZA 5ABFB 2E6PA 4ENLA 4IOSD 1XXXA 2X42A 5E8PB 2A6DA 5BXFB 1OPGH 1ZQ5A 3HAEA 1OT1A 5F6IB 5A6BD 4QGYA 5GRWA 2A1WH 3T2PA 5LBGA 1H0DA 5KYUB 6XIAA 1MCOL 6ENLA 4XWUA 1HGYA 3BT2L 2B81A 3EDDA 2FDMA 1G9EA 5DD6B 3D85D 5DVKA 1NDTA 3F12B 4LU5L 5HYSG 3T44A 2PTTB 2Y69B 1EB3A 4LVHC 3W86A 4J8RA 4RFNC 1I9JH 3EFFB 3CVHB 1C9SA 5T3ZH 5XINA 5FYKH 3TFKC 2H6PB 2XWTB 4OFKA 1AKPA 4WSJA 4XTIA 3IGHX 3IJQA 1KIRA 5AUMB 4N8VG 2DIEA 3QXUA 1ED3B 1TZZA 3M0HA 1VADB 2R39A 4PVNA 2W0FA 4NZDA 4MTMA 2Q02A 3BGGA 1IHIA 1LWHA 5MEQB 3TQKA 3V16A 3TOPA 1VA9A 2R0LL 2AJZA 1BZQK 1ZLSH 3BW3A 1YEDB 1D9KB 1ASQA 3QTPA 3WIJA 3WLMA 1B2WL 4OQTL 5K9QI 4GRWE 3QEQA 4PJGB 2EAWA 1CFMA 5IB1B 3KLAA 3FJTA 4N3UA 3R0KA 5CD3B 4X5XA 2OMAA 3PPCA 2J71A 1C12A 1MCWW 4WV1B 4LAZA 4MZ8A 3ARFC 4L1BA 2BP8B 2FGLA 2NX3A 5SX4H 2EVFA 3CC5A 2N56A 1OKEA 4DY1A 4M8VA 3W1LA 5I8KL 4RW3A 1C92A 4OJAA 1DJZA 4I3SL 5DQ9B 2AKMA 3KBPA 3QF0A 3RVTD 3AREC 4Y0GA 3P02A 5I71B 1GKPA 1LK3L 5ERWA 4ECLA 1T20B 2FEEL 4C6FA 4GRMA 3ECBB 2PTDA 4PJXA 1QHZA 1MI5D 2V3DA 3SUUA 3VH8G 4QRAA 5F71A 3M07A 5LNSA 4BWLA 3WNJA 5I09A 2J24A 2VLMD 1W8OA 4OU1A 4N2IA 3JWOL 2PLTA 4UDUA 2WWKT 1QO5A 2WWKO 2B1OA 5DFWH 4TSBH 3K6FA 4KK5D 3IMWA 2FQDA 4FCHA 4EK7A 1Z9OA 5JQ6L 2PR4L 5LDUA 3VWJB 4PMQA 4BRVA 1MCEA 3TNOA 4MX7A 4YNYB 1HI6A 3RIFK 2WQUA 3HPFA 1I7UB 1YNLL 2YOAA 5F9JB 2NY6B 1B54A 4CEUC 2F9RA 1OEZW 3CU7A 2ZOKB 3UBXI 1SXAA 4AI7A 3QXWA 3VXMB 2B9BA 4M3JA 4UINL 1ISZA 1LMIA 3T4AA 2IPGA 3L66A 5HHOE 4NLHA 4W9FC 1H5YA 4KMTL 3B6SB 3U0PB 1OCQA 1R0AL 1RBOB 2K1MA 4F0RA 4Q22A 3UYCA 3G1SA 1VGKB 4L6OA 4PV9A 1SJHB 4ZB2A 5A1AA 1DDHB 1N0XH 1MNZA 2HRGA 1YW1A 3V6BR 3NIDE 1KGCD 4PRPA 4MWFA 4U0RB 3ULUL 4I5UA 3W2KA 4PJ9D 3HC2A 4DUOA 1AD9A 3MSGA 4ZFOA 1XXFC 3QUMH 1GGIL 1ONWA 1JEZA 3UCCA 3N1AA 2OEMA 3B7RL 4MNHB 2EDQA 2WMGA 1ZTVA 3MUAA 1NEZA 2K3TA 4BK9A 3QUZD 4P5MB 2EDYA 2QZQA 3QKZA 4Y4FC 4UT6L 5CG7A 1NY1A 2INFA 3BQUB 5AOMA 5F7HA 4GBXB 2F38A 4QWWC 3BEVB 3QPQD 4ZB0A 1P6WA 4WU7B 4C8XA 2HKFH 1MUMA 1CUOA 4J3OH 2XQBH 5ACLA 3EJUA 2H8XA 1UZ6F 2KZWA 2XNAA 4DF2A 4PMZA 4KFNA 4NN6B 2VDKB 1T0MA 1FO0H 5FM5M 2O30A 1I1AC 1DBML 2JIXA 4GYJA 1LL1A 1NCIA 1OZTG 3QVAA 5DO2D 3NIFE 1E1FA 1KO0A 1DWJM 2LTQC 4X61A 3M7SA 1UXLA 1DSFH 1Q4WA 1B4LA 5I30H 3G1FA 4QISA 3UCDA 3QDAA 4JO8A 3BK0A 4P57A 1T5WB 2EHHA 2JCCF 3QHZL 4A22A 4HIHB 3CGTA 2OV0A 4MMWA 4YDMA 5I06A 5C0EA 1NFAA 4OLUL 1H3XA 4ZMQA 1QNOA 2BOCB 3QUYD 3JYBA 4KKCD 4XC1H 2OELA 2I25N 1UQSA 3RPTA 3M0IA 3GZAA 2NOYA 3NZQA 2Y1AA 5A69A 3ZTJG 5E9DB 4HAFA 1HIML 4KKBD 1DJWA 3FO2B 4L9ZA 2FHCA 3FU3A 2VXUH 1OTSC 3E9UA 4K37A 4K8RL 3U48A 1OCNA 2P0OA 1RJLB 2J5WA 3QE5A 1E6XM 1J8HA 2WXGA 5C0BD 3GBMH 1W1IE 9PCYA 3V7MA 4KV5F 5AW0B 4MXQD 3AHXA 4PEKA 2JXMA 1GOIA 1Q8MA 1M7IA 4ZPVA 3U4KA 2P5EE 2Y23A 3QEGL 1M3IA 4DGUA 5ETUB 1XB6A 3G6JA 3ARGB 5IMKB 2AAVA 2Z91A 1R5VB 4KESA 4A1RA 4KJQD 1UHVA 3T6XA 1U8MA 1B3JA 5E00A 4B41A 2BY2A 2IPTL 3FKKA 5IV2A 4WK9A 5LUMA 1MYRA 5DR5L 5HK4A 2ZYIA 1BZ7A 4ERSH 3BVJA 4PCNA 4J27A 1WBXA 3L9EA 3T4YB 3SECA 5E0QA 2V17L 1CLCA 1QI5A 3TLRA 2E86A 2DEWX 4CVZA 3SZ6A 5GGUA 4PJXE 1WG3A 1A3LH 1L6WA 5FX3A 3LN4B 4PMEA 5EEWA 4LLQB 3L6FB 5L8JB 4NUWA 1G6VK 4J39A 1RIVH 4Q0XH 5J5EA 3A6CL 5J06A 4UYQA 1KFLA 3BE7A 1LOLA 1GQIA 4NT6A 3WEZA 12E8H 3NZSA 5FI8A 3ZDXE 1P0EA 3STLA 3QDME 5LGJA 1XF3A 2WLZA 5CPQA 2WQPA 4M5SA 1U2HA 3DX9A 5M3WA 5JLZB 5LIWX 3N41F 1FBIL 4CC4A 4AC1X 1U8NA 2GSGB 1OO2A 4WW2F 1UR4A 3N43F 3L65A 1G7LA 2OT0A 1GPFA 3TJLA 2JCWA 4N8CL 5F97E 2MQ3A 4DXXA 4WDUA 1DXEA 4ZOCA 1GY2A 2GQAA 2QKIA 4O50A 2V68A 3PP7A 4LDOB 4F57L 5CJOL 3I6GA 4JNZA 4NQTA 1UB6A 1JK8B 2OMTB 4LHUA 2ATSA 3N1GC 4UQ2A 3V0SA 1DE4B 5CC7A 1G01A 3DHJA 1SO5A 1FZJB 3CDFA 4PUMA 3MBFA 3VFTB 4LNRA 1AL8A 5B7EA 3ZL1A 4QHLB 2CALA 4PWIA 2FIKB 3MLTA 2QCLA 2J8GA 5FJTA 1E6OH 5DC9B 1T6VN 1HN1A 3LN5A 5BU9A 1E43A 1MJ7H 3Q2DA 5C8JB 5B39A 4IIBA 2CLZA 4S3BA 4XVSL 2MRYA 4F0SA 3DTDA 1QTWA 1S2EA 5LHEA 4OM0L 2Z27A 1Q6GA 5A94A 1OT2A 5F4XA 3HPLB 4K7FB 5FACA 2VDOL 2ZXEB 3O3DA 2EF9A 1V5XA 2UZXA 3T0DA 4YPJA 3ME3A 3JV6B 2EC9U 4AUJA 1DQML 4WDTA 3L4CA 5J0BA 3V4UH 1ORSB 3T5WA 1KGIA 4NO5A 3NP4A 3DGRA 1QNIA 1UKOA 3X1GA 1UM4L 3WO4B 3ZL4L 3N4EA 4BWUA 3VD0A 3RAJL 2YPLA 4JHAH 1H7PA 1JQVA 2XWBA 3PJNA 1BWWA 4EZJA 1QOPA 2WW5A 2YXFA 2WB5A 1U42A 1EZ2A 2CGRH 1YQVH 4XUYA 1NANI 1W5MA 2VRJA 1PE1A 4D6DA 1EEQA 4YSTA 2MWCA 2WHKA 1J79A 3AXXA 1U36A 2V7HA 3AQYA 3F5WA 2QDDA 2QPUA 3QN3A 4LYRA 4X4ZA 4OOZA 4X80L 2J6WA 3PWUA 3GC3A 3ULVE 4YCPA 2PLMA 5I1IL 1VFFA 1U8PA 1BIHA 2CDGA 3GJFA 2H3XC 2IH3A 2A74A 4GVHA 1A3RH 2E67A 3WD5L 3APNA 1AQ0A 1GYMA 5BW7C 4YO0A 5IB4A 5TH2B 1YEFL 1CS6A 5T5FH 4W88A 3MJ7A 4U3HA 4AZ8B 4JO5A 1AW5A 1Z42A 4FNSA 4PHZA 3NCFB 1BMZA 4GG9A 5D4HA 1J8HE 5CSSA 4OCMC 3SBWA 3CXOA 1W0YT 1MCJA 2ODHA 3MBEB 4LCSA 3LQAH 4WHYH 1HKKA 3HZMB 4WX2A 2HJKA 1XTLA 2WOQA 1WH0A 3SDCD 3G6JE 3AWFA 3DHPA 1BQKA 1KLGB 4POZC 5D4YA 5LYRA 4DO6A 1KF9B 5BZAA 1CD1A 5C2GA 5DD1L 3S36H 2BVWA 2WXFA 4WJXA 1DJIA 2I7SA 3RNKB 3DC0A 4XPBH 5CZRA 3OG3A 3L2LA 2GTZA 2ZG1A 3BPLB 4H0IA 5CHNB 2E5BA 1IGYB 2XYLA 1Q90A 2X9YA 1CFNB 1FNSL 3ABSA 2V8ZA 2P8LA 2P88A 3Q58A 4D72A 1SXCA 4GS7B 3ZJKA 1EV2E 1RZ8A 1VQTA 4QHPA 3W4RA 4HWZA 2H2PC 4Q9CA 3AC0A 2AEPH 3LXCA 3ZHFA 1X5YA 3L7FA 5I7GA 2WC7A 5E0FA 5BVJB 2WZ5A 5CBIA 3CBKB 1KLFB 5EO1B 3HS0A 3IDXL 2AFNA 1VD6A 1S2WA 3QQXA 1UOKA 4JREC 4M93C 4JNYA 4QHMB 4E8GA 4IMEA 1EOKA 2Q8AH 2OOFA 1A7PL 1A6UH 5LNRA 4Y9PA 5FA3A 4AK1A 3BLPX 3WQ8A 3ARFA 3FO1B 2WXKA 2J73A 1A4LA 1AXSA 3TQPA 2LLGA 1E5JA 1TQCB 3M0MA 4R2GD 1GNXA 3MHGA 4TNVF 1SPDA 3WG7B 3QQ9D 2X3AA 2VLKB 3N9KA 1I2OA 4XAPA 4Z8FL 4XPGH 2WZAA 3AQZA 1E1EA 2XV2A 1NAKL 3VYLA 1HWWA 2WLYA 2CESA 1C29A 3GIVA 3AREA 2FZ9A 1JV2B 1VR6A 4HEPA 3LMJL 2H1PL 2QSCH 3WSUA 3HHSB 5D2LB 3LNHA 2B59B 1ZAIA 4PRWA 4YMZA 1HH6A 3DU0A 5BROA 3L7EA 1ACXA 4AVFA 4A2SA 2R27A 4X4YB 3L45A 4QG9A 3G5WA 1N6QH 2E77A 3N06B 1TPFA 4G6AD 4A8RA 1A14L 1WUNT 5FHAH 2ZCGA 3MLXL 5GSRB 3ARDC 2EYTA 4DN4L 3SDAC 1DE6A 1HQ4A 3IGFA 5EMUA 4NZRL 1Z5YD 4EN2A 3HW7A 3A4FA 5CFAA 1ENUA 2JKLA 5LA1A 3GI8L 3PUGA 4CNPA 3V36A 3TFBA 4JFYB 1P7QA 1RK0B 1RZKC 2Y24A 2Z4TA 2Y5SA 3UYRH 3R19A 1NCOA 1ONEA 2GSMB 3SDDB 3TNBA 4XP1L 1T4KB 2OP4H 2VC2H 4FK9A 4JN2B 4MXWH 1R7OA 2NUTB 1PYWA 5T91A 3MGOA 3W23A 2G5WA 4POYA 2KDYA 2JBMA 1R7AA 1A3XA 4V11A 4AGLA 5DUML 3NEHA 3P84A 2ZC8A 2QTVA 5MENE 4Y4HB 2WYHA 2MNWA 4IU2B 5D32A 4ONVA 4TVPE 4WY0B 1A47A 4HLEA 3FU8A 3KBMA 3SCWA 5KVEE 3TWCH 1O9VA 3WFDH 3FQRA 3GLCA 2BSEA 4XAKE 2ENSA 3ARYA 1RZGB 3TJEL 3NABL 4ONGL 1A7RH 4LP4A 3ASOB 4WVRA 4WO4D 3GKAA 3P9MB 1FV1A 1EUNA 4XGZA 5FYKD 3V0DA 1CZ8L 3C5QA 1EAOA 4OM1H 4J3OG 2Z64C 3K6SB 5KSBB 3RA7L 4G7FA 3FT3B 5EG6C 3EB4A 2XVGA 1AZVA 4KX9A 5H8MA 3U0HA 1P4LA 2WNXA 3PGCA 4MWAA 3OKDA 3VFMB 1KWGA 4GJ1A 1TREA 3OKEA 1A5LC 3NXLA 4S2SB 2A21A 2HTKC 1GC1L 4MQ7A 5JZ7C 2X4OB 1C9WA 2JF1A 3DO7B 3RVXD 3QQWA 2WLMA 2HVKA 5KVFH 1A5MC 4PJ8C 1I9RH 2IBZX 1OB1A 2DBJA 2H32H 1KCUL 1OSZB 5C0NC 3NURA 2AI0L 3GRWL 5FF2A 4QPEA 4YBQD 4HPHA 2AMXA 4K73A 2QSQA 3MV9A 4NZUH 3TPUA 3C60D 4Z7UA 4Z3EA 5GRJH 1SY6L 5JO5B 2CJUH 3SCQA 4M8QA 35C8L 1K5NA 2DWEA 4H0LC 1V6YA 1HJQA 2X12A 3IFOA 3DX8A 1VPYA 3SGKC 2GPTA 4AEHH 4LDLB 1GCYA 3MZGB 1NELA 5DXXA 1XLBA 3CCHB 4XCYB 3P5ZA 3B0XA 3K6IA 3EAUA 3IGKA 3MA8A 4JCWA 2XSAA 1MJ8L 2X89A 3KHOA 1TPEA 2ZAGA 3DOSB 4N3TA 1Q7ZA 4ADGA 4EACA 1PSKH 4NP4H 4QTHA 3HKZA 4RRPG 2FBOJ 5HVWA 3K4DA 1BQUA 2NYKA 4LQFH 3I3EA 3SE3C 1V6TA 3DK0A 1XO8A 4P2YA 2QV5A 2AQ2A 3U1SL 2P3ZA 1NL0H 2AJVL 4K5LA 2QV2A 4G7QB 4ZMNA 4BQ2A 3KYKH 5DRCA 4V33A 3LEXB 5C8BB 3TIEB 4ACPA 2VXVH 1BF6A 1JCKA 3F7VA 4QXUH 4GW4B 2VWTA 4JZNA 4R7VA 2X7VA 3THAA 4N4QA 4DJDC 3H3BC 2D24A 2YBGA 1J5DA 2JJSC 4LF1A 3MMTA 5TQLA 4HYRA 4H2AA 2GIYA 3SURA 3VIGA 1FH9A 3KW8A 5GGVH 5E4OA 3ZO0A 4BCYA 2PETA 4GI8A 1X9RA 4YBLB 5GNXA 4AD1A 4YVPA 5JHLH 4HUVA 4RZCA 3BIKA 4KU1A 5HDRA 3FUDA 5B7YA 2KZBA 1YECL 2W63A 1DQQA 1A7BA 2FDBP 5EMYA 4Q4IA 4JO3H 3GBNL 3LKRA 4LOUD 3JWDC 5C09B 5E09A 5F3HB 3HI1B 4KBPA 1T21A 1X98A 3O3EB 3TS8A 4MJID 1QLFA 5C08A 4JYFA 2NV1A 4ZD3L 2W5FA 4IJ3C 1A6AB 1TTGA 1JV5B 5I1HL 2IXQA 3KAOA 1MDTA 4XNAA 1HE8A 3O81A 2VIRA 4YLBA 1W0VA 4JTAA 3OR7A 3RITA 4XZWA 32C2A 4J3OD 3TEZA 1IB5A 5JMRA 3Q8CA 4TQEL 1D2PA 1AS6A 4YJ5A 1U30A 2DQWA 4F2TA 1B4RA 4A8IA 1VPXA 3NDZE 2GYIA 3APCA 2VAJA 2YUXA 2BSCA 2GDQA 1U8LA 2ZVIA 1E4WH 3S35X 2OJZH 2BOLA 5L2JB 3P4MA 4F8OA 4JDYA 4D8LA 4HIIA 2VGLM 1ME7A 2X1IA 2IAMB 4NNYB 1OTUC 1XCQB 4JO4H 3K3QA 3GG1A 3M1CA 3EFOA 3SDYL 1XINA 5IQ9A 4E2OA 3ELAT 4X8JB 5HGHB 5IVXF 4HU3A 5EOCL 3MO1B 1KQYA 2GJZB 3H24A 1YMYA 2BHYA 1Q8JA 2JLPA 3V4VB 2E6FA 1M7DA 2JKJA 4LLMB 4B90A 2DBLH 2GJ6A 2CFFA 5CGYC 3SKNB 3BPOB 4RGNE 1MNNA 3L5XH 1TVNA 1NWOA 1FH7A 4IDLA 1ODAA 5DURB 2AGKA 3BANA 4LARL 4J3WA 5E4IA 1GSMA 4JY8A 4MWAE 3EZ4A 1TEGA 2HROA 2PPDA 1J0JA 3NACL 1CF1A 5D7SL 4DGVH 1EEZB 3LZFH 3HOGA 2XWRA 4IGBB 1SJEA 4IBYA 3IXTB 4CSTA 3WK2A 3BZJA 1UM5L 1WFNA 4RFOL 4LB4A 5KS9B 4ZQMA 5I2UA 5I74B 1PG7L 3TMQA 3AQUA 4MNQD 3FONA 4L64A 3TYUA 2WD0A 4HJFA 4F7MB 3SDOA 4IL0A 4HJTA 1T80A 3GT6A 4Z7UE 2EDFA 3RWDA 4L4PA 3MXWL 3UNDA 3FCPA 1N2RA 2F53A 1GHFH 1X7QA 4PCKA 4JPVL 2VDNH 2J88H 1A21A 1ZHKB 3KRZA 1OHZA 5DJXA 4F7PA 1HCYA 1ETB1 1QEWB 2Z4GA 4BUGA 3JTTB 3ZZ1A 3MGTA 5D70H 3WUGA 1L5GB 3G0SA 1MFCL 5BW7A 3DV6B 3PP3H 3UBPC 3S2NA 3W25A 3A67L 4BV1A 1GPOH 4ORIA 2O1AA 1TO5A 1V3HA 1XSKA 4GY7A 1IGCL 1Q6RA 1TLKA 5CN1A 4Y90A 2J8FA 5HD8C 1MHHA 2W1NA 4J3XA 5T33L 3U3HA 4HNOA 2QKSA 5AALA 3EKCA 2W65B 1TCRB 1JNEA 2BNUA 2HRPH 1LEGA 2OO0A 3FT2B 3KG5A 5CMAB 3B9AA 4AZ7A 3LBOA 2C34A 1BBDH 3F03K 2ZPKH 3PGDB 4Q2ZA 3A4JA 4M80A 4CBZA 4ODUB 2F8IA 4KXZH 2QHRL 5FOOA 3QMTA 1F74A 3S6OA 4B7IA 4JFFA 3VFPA 3LEPA 3QO0A 3QAZB 1TPDA 3R0MA 3GMNA 3MWCA 1GYAA 2H5UA 2DZTA 4KKQA 4MA8L 2DWSA 2VJ8A 3H54A 4P23C 4JJ5A 3K7UA 4IRZA 5E6ZA 2ZWSA 5E93A 1XBXA 2QQLL 1SYTA 4M9OA 1T99A 1K2DB 2AC0A 4NNCA 2A3LA 1IEXA 2Z92A 1CTNA 2D23A 5EZLB 2OJ1A 2C1OB 3B2MA 1QMLA 2G37A 2VVNA 1DVXA 1ZT4A 2NTFA 5C08E 4PJ7F 1E5CA 4CVXB 4UFJA 2VN5A 3BO8A 5JDSA 4OTXH 3CH1A 4JQVC 4AKPA 3KBNA 4E5XG 3KBHE 2CUIA 1A1OA 2OSLB 2FDSA 3VB9A 2VN6A 2YXOA 1BSIA 4BFAA 3AIUA 4OJDH 2N7SA 2CPCA 1IXPA 5FF6A 1M2VB 4M03A 4J1UA 1CXKA 3DIFB 3FOLB 1DEEA 4XMXA 3UWWA 1LE5A 1OWWA 4UTBH 5JHDB 1K8DA 2JKSA 3GXIA 1NZRA 2UUDK 1TX0A 4JO2L 3WUWA 2DQDL 1IIHA 3FIGA 3UAJD 3WSQH 2PWEA 2QPFA 4MD5A 1QFEA 3ID7A 4GPNA 1QWGA 3E9TA 5JMUA 2NT1A 3RWJA 3GMQB 1NUNB 4AD2A 2LLEA 2ABAA 1IQWL 5DFTA 6XIMA 4EDWL 1BXBA 2XFGB 1QDSA 1G6RB 2IADA 3C8DA 2J75A 3QIUC 2CZFA 4WJ5B 1YMMD 2GJ6E 4L1GA 2ZDSA 2BHFA 4YK4C 3VD3A 3EKGA 4XN7A 2P53A 3BUYA 4FA7B 2UY5A 3SYCA 1FWJC 1ESWA 1RH9A 3W7JA 3R7MA 1T04B 4L4MA 4MKVA 4HK5A 4PRDB 2PWFA 3V55A 2AVGA 3U6RA 1QLEB 4P4RB 3FB6B 1FFRA 4DXVA 2B0SL 3MRMA 5KSVB 3CMGA 4PRHD 2GGHA 3CPRA 2DY2A 2Y6ZA 1IR2A 3GKZA 5EFIB 3WFCL 5CSYA 3GUFA 4HNCA 5I19L 3QKEA 4J3VA 5KETA 3K2MC 3XINA 3WKYA 4KXCA 3S34H 2WKJA 1XYMA 1IGIH 4NOFA 2ADIA 3QJVB 5I6NA 2BVQA 1NFIA 3HNTH 4L3ED 3ZRSA 1PCXA 2VAAA 4OOUA 2F53E 2YR1A 4WFHD 4JANB 3QNXB 2KUTA 3KLHD 3LKQA 3W7GA 1CI3M 1WBYA 1EKOA 4I0KA 4O53A 1SGJA 4IOFC 3LTSA 4PB4A 2HJLA 5EUOA 4UNTA 4F58H 1L3WA 1H50A 2X3CA 4QXWA 3FQNB 1AZUA 1BIIA 3PG8A 1BGXL 3ALPA 5AQ0A 1NBVH 3TJXA 2E6AA 1H7NA 5CR8A 2YPVH 1LOSA 1DTUA 3ABZA 2VM4A 4OQ1A 4M48L 4KZCA 3GZKA 4N2BA 4WXZA 3BJTA 1QX1A 2FSEB 3TP4A 4EDXA 4TNFA 1S7WB 1EC8A 3O6FB 4GW1B 1NCCL 4JFSA 5EYWA 2ODIA 4KIEA 3V0TA 1DBBL 4YQXH 2Q3AA 4DI8A 4HDIB 3H4XA 5IM7A 1W6WA 4GRLB 1CGSH 1IAIL 2B4CC 3O2WL 4GI6A 2V7NA 4PULA 2Q76B 3M0YA 2VGIA 2V4LA 2BDNH 3AU1B 4ZQKB 3SCPA 4XBSA 2HG0A 1W37A 1PVNA 1IAKA 4NN7B 4IJRA 2BVDA 3L3OB 3O0LA 3KNBB 4FFYL 3BYTA 4CC4C 2YJLA 3NEXA 4BFIB 3HZVB 3QNZA 2F6UA 3FTYA 1M3UA 2MTAA 4TUKH 3KYMB 2CQVA 1GG1A 4JFFE 3L9RB 1T0OA 3Q6GH 3NSNA 3OKKB 3FB8B 4YU1A 4PRBB 3STCA 3PJSA 1FWXA 4L18A 3KDNA 4C60A 2X4UB 4XMLL 4PJCB 4TNVK 4L4VB 1QSEA 2WTRA 3M64A 4XSMA 2HPTA 5HDQL 3FYIB 3DXIA 2AQ1A 2GEEA 1WXJA 4Y1AD 1OGSA 5FV1L 3Q43A 3T0CA 2PU1A 4HIXH 4FMFA 4KF1A 1GOOA 1OJXA 2YB4A 2X4RB 2LVCA 4HPOL 1UWRA 4FQ2L 4WEMB 2J7EA 5H2BA 4K9JA 3VYPA 5HBBA 3TA3C 4HC1A 3PZUA 3NJGA 1RY7B 2IJ0C 1AY1L 3M1BA 1JRHI 2BOBA 5A6TC 1DFBL 3KPMA 2Q7YA 4BFGA 1G4RA 2KT6A 1Z5LB 4KPHL 4IIQB 1AW1A 2NMSA 2OI9C 1G1OA 3P0VH 1U2YA 4OKVB 2ZUSA 3FGCB 1WO2A 2JJSA 3T0TA 2BWQA 4M51A 1TPXB 2A5UA 4P46C 2VO8A 3MLWL 4P3DB 5HHXH 1MJJA 1JNHB 4WHCA 4OLWL 3PPHA 2J1KA 4BH7A 5CILH 2YHGA 1ISXA 5C70A 1TEYA 1H9VA 4XNMA 4LIQL 3QW4B 2F7FA 2FATL 1A4KA 5C9RA 4MD4B 3EBVA 3P3SA 3NJMA 4JM0A 2MANA 1XZ0A 4MKTA 1GXEA 4WW1B 5EF0A 3GSXB 1JWUA 4FOKA 4XCEA 1HILA 2V2WA 2PWGA 1NF7A 2HB0A 3PNRB 5AD0A 1XF1A 1I2PA 1IT9H 3NO5A 3K2GA 1NEYA 1I3GH 2MCG1 2A6JB 1I8KA 2J47A 3ZIYA 3D5HA 3N50A 3CIWA 3DOHA 2JF6A 3QQ1A 4HUKB 3BJFA 2HK0A 1I31A 1BYNA 2VURA 3LN3A 2NVDA 3U0WL 2P43B 1XP3A 1TTBA 2PO6C 2ZX7A 2LV4A 4M6OL 1KJ2A 2NUWA 1BOGA 3IT8D 3KXFE 4E4FA 1K70A 3UJTH 4DO5A 4R7XA 2OG9A 4IFKB 4NJ9L 5ID1A 1T1YA 4AY7A 3EOTH 3GSNA 3IRSA 1NCWH 4ISVA 1KFWA 4F8QA 3BC9A 3ILDA 5DD3H 1JGLH 5KOMC 4PFHA 3UBXB 1RALA 4GD0A 4HKJA 4HUUA 4X9GA 3UA4A 4NPKA 4L9YA 2QQKL 4G71B 3HPZA 2VLJD 3SBWC 1XYLA 2PP8A 5BZZA 4WWKD 1THAA 3ISIX 4OF7A 3LZOA 1F2JA 1IF2A 4ONFH 1WFTA 1EAPB 3C0JA 3UC0L 4MQSB 5L4MA 2C9VA 4NP7A 3N29A 1PCSA 3WELA 4OZFA 3QUKB 4OI8A 2DRUA 1YPFA 1PB0A 1MSSA 5EUOE 2GUUA 4P06A 2VJXA 3UTSB 3LNFA 3MI3A 4AXKA 3OKYA 4R96A 3VXNA 2B20A 4JPIB 5CD5C 4HTBA 3EXRA 2NX5B 2OXHA 3G3LA 4EOWL 2OZNA 3UL4A 1QNPA 3FYOA 3S7GA 1A6TB 1K1DA 3RKDC 4NHCL 1TJIL 1QI2A 2PDGA 2NY2B 3BE1L 5ENWB 4E9VA 1LO4L 2IMMA 3GPEA 3HS0C 3WJMA 4FQIH 3NXFA 4YH6A 1BD0A 1JNLL 2DV6A 2ERJB 3N44F 2LOEA 2OQJA 2ADJA 1TV4A 3LQZB 1R47A 5E1GA 3RPIA 1OSYA 4JN1L 5HWNA 2HFEB 2P5EA 2A9AA 1XDJA 2YXGA 3PJUA 2QCCA 4L2LA 2HCVA 3ONCA 2OZ8A 3CV5A 4F15B 4MSWA 3OKNA 3TTEA 3NZRA 1QSEE 2P8MB 4AZHA 4BFNA 1C9DA 4QRSB 1M56B 5FEXA 4P3CL 1FWTA 5JUEH 2CO2A 4ODBD 1AGEA 4PIRF 4O8AA 4AXWB 5GGSB 1JPFB 3UZQB 3HUJF 4ZTPL 1KR1A 1S7RB 2EPHA 1MQKH 3RX3A 3WMPA 1A49A 4HYWA 3D51A 4PP1C 3P54A 5LNUA 3RX8A 2CM6A 5BUPA 3RYSA 5AVRB 4YUEH 4EBQH 5MF5A 4HBCH 2GHWB 1ZV5A 1KEGL 1L7IH 4JRXB 3WKMH 3QDMA 4NOBA 2ZX5A 1BVLB 5EIQA 4GJIA 4N4PA 4RMSA 4JFOA 4U6VH 2Q20A 2J2ZB 3RILA 3R13A 2MHAB 5TDNB 1N7ML 1JZ5A 3E2RA 3S2LA 5ISZA 4F9PC 2HYMA 1EP2A 4WFED 1FZMA 5FUZH 1Y1UA 5T1DL 3FB5A 4X5RA 2IWKA 3IF1A 1DOSA 5KANG 1ITCA 4MJ5B 2H1XA 2XG4B 5DZLA 3MW7A 5DC2A 1MAJA 3RPKA 2H26B 5IBTL 3RJXA 1SHSA 4P23A 1QNZL 3WLOA 3GS0A 4G8EB 2G75B 3DKLA 2Q87A 3MVSA 4DYJA 3L5WB 2CBVA 1ZVHA 3KVDD 4Z7WE 1CGUA 2CO7B 3H2OA 4RETB 2ESCA 4Z7OF 3L5MA 4A63A 2WHJA 1XFPA 1SJBA 1QRKA 5HY9B 2NQ3A 4C6MA 1JZ4A 4LSQL 1URZA 5DJ2A 4LVNB 2OTPA 4AENB 3I65A 1ZGDA 3QXTA 2PYFB 3B9OA 4G6ML 4ZA0A 2LVEA 3P3RA 4GYPC 4DGIH 3G5YB 4JQVA 4RMVA 3D18A 4H7VA 1X5JA 4B2DD 2WJDA 2VGBA 2NY5H 4NJGA 4YS1A 5CJXC 3OSVA 1ZEAL 5E2UH 2AK1L 3AWEA 3PHQA 4UT9H 4AZ6A 1BVKB 3KCPB 5E94B 1SJAA 1TPUA 2VLRD 4RGNC 5CM1A 5ESQA 4LVFA 3C2AH 5TE4L 4LBEA 4RX0A 3F6JA 2WXMA 2Z4QA 2JKIS 1EQCA 5LIYX 3LZNA 4UU9B 4MWAC 4RNFA 1ZANH 1A5FL 2ZRWA 3LHVA 4HN4A 2Q0ZX 1IM9D 3DBSA 1S7VA 5FJJA 3R10A 2J20A 3O06A 1FVDA 1E9QB 5B4MD 4R83A 4OFCA 4LQ1A 4W6WB 4IKIA 4GGBA 4AHPA 3P0WA 1HKVA 4XC3H 2OR9L 2BNQA 3LQMA 4PLOB 4IIFA 1PGRB 1DIOA 1T6WA 2EIBA 3PZQA 5HMEA 1PZCA 4LSVH 1CICB 1E65A 4BK5C 2HTMA 5T9CE 4DOHE 3K13A 3QIUA 5IMOA 1E9YB 4QE5A 4QOKA 2XPGA 1XW8A 5C6MA 2ZUQC 3PP3K 1FSKC 3WO3B 5HATA 2FJHA 4O8RA 1Q0YL 4AX3A 4YJZL 2P5WD 5E5LA 4XE5B 1NCUA 4DF1A 4RX4D 4RMBA 4BFOA 1RZ7L 1UBPC 1V0MA 3E6HA 4FNLH 2O5YL 1TZOA 4RDWA 4E4UA 2MQ0A 2EO7A 1RZQA 4EKXA 3PAOA 2WB1A 3RTQC 3OHXC 1CFSB 4NQCA 3QR0A 3FV9A 3O4LB 3KBFA 3RL2A 3LD5A 3TNNB 2R82A 3ZL2A 5BMWA 1EFXA 4PRNA 4TNWF 2QADD 1USQA 3BOXA 1ZGLP 3W2UA 3BKCH 4ZTXA 3MKGA 2RFXA 5TQ2L 3OZ9H 4PTUB 3MRQA 3NZ1A 2XETA 3RWCB 1V79A 4KZDL 2PKDA 4ZDHB 2Z1SA 3NQCA 4BCXA 2TPSA 3PREA 2D0FA 4X2PA 3OJVC 4W5UA 5FOBB 3VXTB 2H3NB 1P2CA 3CXHJ 4MADA 1IYXA 1B9ZA 3DVIA 2XN2A 4S11A 3CZUB 3DPBA 2CLEA 6TIMA 4PRAA 2ANUA 2NY1D 1ONQB 4CNNA 5D93C 1CG9B 4ZFMA 1TZGL 4HJ1A 4F24A 1X8FA 3U7BA 4E9RA 4K0OA 1QQDB 1CVRA 3SCSA 1G9HA 2K4WA 1T3FA 3MKCA 3U2SA 2WXLA 1EEPA 3REWB 1UR0A 1DBTA 3HZYB 2WQSA 4D8PA 3FA4A 1UA7A 5I1KL 2BSSB 3S42A 4OCRH 3HBPA 2ZZ3A 4PJ5B 2DSZA 1WCBA 1XPGA 3W0WB 1WZ1L 5MI0C 3QJHA 3WEMA 5GRVK 2Q6WA 1S5VA 5HI4C 1SFSA 2DGAA 1SF3A 4K38A 4FG6D 1AHWC 2OLHA 2O6FA 4M5ZL 2DQIH 4MJ6B 4ZMPA 2CO6B 4N2MA 2OMWA 3GGWA 3IWUA 1MZZA 4QO1B 4JKNA 4WEUD 1R3KB 1NDYA 1CL7H 1CFTB 5E0KA 5EU4B 3I7QA 2XFXA 5F7UA 3DX7B 5ISZE 4NBZB 3A13A 2OB3A 1OPGL 1NCTA 4ORGB 1R1CA 5AKRA 2AKZA 3WIIH 1ZSDA 1H6EA 3S88H 3H2NA 5BOPA 1A5OC 1TYRA 2A1WL 4FXKC 3GD1C 1BZ9A 5HR6A 4YVNA 5F2MA 2EE9A 4XN8A 3QZLA 2YCLB 5AHFA 1IGFH 2YL6A 5K39A 1ZPUA 3IJHB 3QVQA 4ANKA 3EYFB 2G9HB 3RNDA 3LTPA 2O5XH 3TA3A 4QITA 4P2OC 1I9JL 1U41A 1H1YA 2QGEA 3IJ9A 2BOGX 3GHBL 5FYKL 3ZLGA 5JBFA 4KGJA 2RH0A 4YXKH 2JJWA 1S38A 3TH2T 2PRLA 2APWA 2QT6A 1NMCC 4N2CA 1US0A 2PGRA 3MNWB 1Q6LA 1LUCB 4DP7X 1FWWA 1M68A 1KB5B 1LBFA 3KJ6H 1N5AA 3PQYE 5CEWA 4P46A 1ZENA 2AQPA 1ZLSL 4Y9OA 2WXPA 2KI6A 1PKLA 5DJZA 1RZIA 1I9CB 2WWMD 3E96A 1Q3NA 5AOJA 1LL4A 2WTOA 4O2CA 4WI0B 4UOW0 4AM0A 5JA9A 1H5BC 2FEEI 3SQMA 3SJNA 3GUTB 3A5FA 3AS3A 1XHHA 4KK8C 4FKEA 1N8OE 25C8H 3QSRA 3WIHA 4JFTA 1EP3A 3LRLA 5GGTA 4I0PC 2GKIA 3QZEA 1I1FA 4JG0H 4PJFA 1L9RA 2ACUA 2FLMA 4UFHA 3SE9H 5IJVB 2BNQE 4N25A 3KEHA 3G6DL 1GZQB 3S35H 5MENA 2UUDH 3DUUB 3REVB 1Z8AA 3IV3A 3VAVA 3EMQA 4JMNA 5B1AB 1ZXQA 4MJJA 1V27A 3C5JB 3S9ZA 4G2DA 4QOKE 2FZNA 3B8WA 1DLHA 1F4XH 5IHSA 4AJYV 4FXTA 4Q8BA 1DYSA 4PJIF 3VNLA 4IK7A 3ECVA 5TFSH 4PG2C 4HIQA 3S4SA 2PO6A 5AVVB 4WK4B 3WJZA 1E4HA 3KPPA 1TKWA 2F54D 3HQPA 4D8AA 2P24A 3HMWH 4AGNA 5IOKA 3KUMA 5C1MB 3JSSA 4NQCE 4TSBL 3WNIA 2WMPA 1L9TA 2OTUB 4XNDA 2YPKB 1DWGM 2CXEA 4QRTA 5IJBC 4LLWA 3LVEA 1H4PA 2YXWA 4CD7A 5INDB 5BWAA 1B3IA 1M1SA 2F5BH 2J7HA 1FHUA 5F2IA 4RGOH 1H49A 3TJHC 1IQDB 2E28A 3F3HA 3F7YB 4NRRA 3IVKA 5EH1A 2EH8H 4Y5YB 1KPRB 2CCWA 3GBEA 3AZTA 3C8FA 1FWAC 1W5OA 1MLBB 4A04A 2WYZA 2QT3A 2WVVB 5F89A 3KL3A 7PCYA 2CWRA 5BV7H 3K81A 3QZWA 2J8UF 1VFAB 3W9ZA 2AV7B 3WQOA 3C8KB 4BUQA 1TCMA 3MRCA 4NQUA 5EN3A 3FCBA 4JHVA 2FZ3B 1ZT7B 3SCMD 1A6VH 3AUWB 3H2CA 3L3JB 4IL2A 2FX7H 4WOQA 4Z08A 1L8NA 4N0FA 5DJAA 3QUML 4LEQA 1EANA 4ELDA 5CZXC 4Q6IA 2Z31B 2VSDA 4TU1A 4ILSA 3W7LA 4KEZA 3NPVA 4R33A 2J1XA 1XLKA 3GZPA 3HQNA 1QTPA 5D05A 3VABA 1G4EA 5GHWL 3A4DA 4Y4KD 4GUQA 2QF8A 1DHKA 8CGTA 2C4XA 5D8WA 3N3EA 2WLJA 3TC6A 1H3PL 2HKFL 5EPMA 2W5PA 1XIGA 1BTCA 4Y2LA 2XQBL 2ZUMA 2VDLH 3N2BA 4FE9A 5A6SA 2WQDA 3SGEH 1YDOA 5F1IB 2NYYD 4PREB 4XKYB 4NSKA 4GQ0A 3WBYA 3U2CA 5HDBF 3W7CA 1AR1B 1FO0L 1G7PA 4J35A 2OX5B 4OVUA 2QDVA 3RJYA 1W1A1 3CASA 5HNUA 4YVVA 5EU3A 1I1XA 1RIUL 2V9RA 1JGDA 1DSFL 4UNVA 1NC4D 4EZKA 2R0KH 3G1AA 2OMNA 3KOXA 4Y7EA 1GW0A 1MFAL 3SUTA 4XBJA 1PBYA 2YIHA 2AL2B 3VOHA 3OXRA 4AH2B 2OT1A 5KUMA 2FK9A 3GSUB 3W26A 1HKLH 3C6LB 3GRBA 3MJMA 2DM4A 4XMKH 2LABA 2WV8A 4AM0Q 2CZ5A 5A8MA 4JDBA 4FA8A 4Z76B 2RHGA 3VRLF 4BFEA 1NBQA 2NXZB 1CMOA 4UOZA 4NRXB 4G8GA 5T1MB 5DCDA 2EKJA 2NY3C 4H6EA 1EJUC 4X99B 1VPOH 1B3YA 3PPSA 4ZXBD 2NSOA 1KT2A 1NCJA 1EZSA 1IC5H 4F9DA 2VXUL 3ZWTA 1X4XA 2NNAA 2VXQA 1SOXA 3VCLB 5GS2H 3V0VA 1XCWA 4QEGA 1SEBB 4F9PA 2DT1A 3UXAA 4LUSA 2CU9A 3VUSA 2YUVA 2OO6A 1AR2A 2RJMA 2ZKHH 8PAZA 2FZ8A 3CFBA 2BP0B 1TEFA 3VW3H 5CSZA 4M02A 1BLNA 3ZMRA 3GBML 3VE7A 4WAFA 4A68A 1KR0A 4CVUA 1RSCA 6FABH 4P4KD 4PMXA 3ARSA 1ZLUK 4O1FA 5HVHB 4JX0A 3KHQA 4RXFA 5FFLA 5FK9B 4GLRI 4LWWA 1J0HA 1E51A 4TNGA 3NDZA 3LV3A 1IVLA 5EEYA 4AMXA 1JP5A 5HJGA 2YXXA 1RXLA 4PJFE 1VENA 4R5EA 2YSSA 4P5TC 5FUOH 1IKFH 5DFAA 2PDBA 3OGVA 5EIVA 2CA4A 4YHZH 4MB3A 3MLRL 5KVDE 5HNNA 1W72L 3MNVA 1OT4A 1W3IA 1PQZA 2VDRH 5CBEA 3MYJB 4ERSL 2QGYA 2XKSA 1LYQA 3HPXA 4GYPA 5F9WB 1VH7A 1Q94B 4IPNB 1H8OA 1TZAA 1ROCA 1F90H 4QUOA 2WNZA 3CQJA 1V55B 5E8OA 4A2EA 5CJXA 1S4IA 2KC0A 4Y5XC 1T7LA 4OQVA 1A3LL 4UI2A 5T3ZD 4UOQA 4PGLA 1QRND 2HSIA 2NVCA 5LBSA 3SKUD 4MSSA 4GXVH 1VLIA 1K8CA 3CN0A 4EO5A 3VDCA 4ONHB 1TMLA 2PDHA 4JQXA 1RIVL 4Q0XL 2RDXA 4G43A 3AIRA 5D7JC 5AVSB 3EYOA 4PRIE 4Z5RB 5ITBL 3TC7A 2XG5B 12E8L 4GIOA 2W8CA 5F88A 1FE8H 3CFQA 2OMXA 1Y6KR 4EUPH 4H6QA 2FYMA 5G2WA 2YMTA 3FQXB 3IDGA 4FFTA 3SGJA 3TJ4A 2IH9A 1TQBC 1QFHA 3G5VA 5L0QC 4A3YA 1GYVA 4AZIA 4KWSA 4LW7A 3EJPA 3VGFA 2APFA 2EVHA 1OPOA 4ADJA 5IG7B 2LHAA 3JZUA 1J5HA 2I57A 4XZHA 3F4DA 1ONRA 3EBAA 4BK5A 3RR4A 1QPXA 3ZZLA 1QI0A 2IANE 2XTJB 4KOBA 4HIEA 4GXUN 3EO9H 3HS9A 3HG1D 4PGDB 2DM3A 2D7NA 3MLPA 3XISA 4JE0A 3DX0A 3APFA 3OLIA 3LS5H 4YHKH 4AQAB 3ZVVA 3S3PA 3U1PA 4E2DA 1UPPA 2JQZA 1E28B 1E6OL 3SGUA 2FB4H 3P11H 1MWAB 1MRDL 3RTQA 1MJ7L 3OHXA 4F40A 2VTFA 5EOCJ 3I9PA 3ZMNA 4KHXH 2PGWA 2WKGA 4UZSA 2GGIA 3CWOX 1XYBA 4PMYA 4UAOC 1I9IH 1BGAA 5JXEC 2Z35B 2HTLD 3WNLA 4R34A 3FFCD 1MCLA 1QCWA 2EJAA 4HHPA 4BK4A 1WAEA 3VG0H 3A3HA 1A6ZA 1EJVC 4MY9A 4GWEA 3QCTH 3W11C 2PURA 1JZJA 4AIUA 1A4JA 2DL2A 3V4UL 1DIDA 2EDLA 2PF8A 1J5IA 3BGMA 5E6IA 4QHUB 2XYBA 1TPC1 4HK6A 2AK4B 2VX4A 5LWYH 3W7IA 4JHAL 4AIZA 3L2NA 1IC0A 4WZHA 4XCNB 2J55A 4JG1H 2AXWA 4ODXA 1Y5XA 4JFEA 5EU6E 1ODZA 3MUY1 1MY7A 4BKLB 2TAAA 3CD4A 2CGRL 1YQVL 3QUXB 4MCZB 4YS4A 1U6AH 1FP8A 3U4AA 3W6LA 3MACL 4KKPA 5SWQA 1R6WA 4PN2A 2L7EA 2V0AA 4Q58C 1TTPA 1SZRA 3HTLX 3UCRA 3ARWA 3SY5A 4FS0A 3IE9A 5DJCB 1OGAB 2PLKA 4FQXA 4GRWF 4AD5A 5TNVA 2Z29A 3BP7A 2VM9A 3E49A 4MNJA 2CJTA 2Z26A 1EQWA 2C71A 3LXAA 3RLGA 4IKKA 4RUBA 1AHWA 1A3RL 2G30A 4G8GE 3MV7B 4PP2A 5L88H 1XMWA 5SWSB 5CBBA 2BINA 3ILQC 1B0GA 2F68X 3QXAB 2J66A 3LNMA 5DMGD 4UM9B 2BVYA 4JY4B 3IXAA 5T5FL 2WJZA 4A7SA 3PDDA 3NFNA 5CP7A 5EEZA 1EQPA 4GUOA 3VFUA 3DGGB 4G9FD 3DO3A 3LEVH 4LLVA 4FXKA 3IK2A 1YO4A 4OIFA 3LQAL 4LGXA 2B7NA 3WJJA 5ESVB 2RJHA 3VXRB 3ATDA 3BHBA 3KPRB 1E5UI 1G7MA 1A9BA 5EC2B 3AYSA 5CINH 3BP6B 4G8IB 4PBWD 2DJMA 3PXHA 4JLRA 4YN5A 4P2OA 3S36L 4M8UA 4ZODA 1KTDB 3QPXH 4HFUH 1LG2A 3LHYA 3ABQA 4XPBL 1W3HA 3GHTA 3C5ZD 4GP4B 4YHIB 3OF6D 3QC6X 5I1LA 4AKQA 4C6PA 3MOAH 4H1LA 4LHJB 2QR0A 3NFSH 2P28B 1NCBH 2AEPL 3RDTB 1BVNT 1QAWA 1JVKA 3DVGB 4UQ3B 3QFJA 2DEPA 2H9GA 2OMUB 3L2MA 2WXOA 1NFDE 2DQEH 5EN2A 1QO2A 4QRNA 3FSOA 1E0UA 4G6JH 4PEEA 1KIUB 3L0GA 1H5BA 3B8TA 3MREA 4JPKL 1A6UL 5EU7C 4HLZH 4XD5A 1TPVA 1WIOA 4LCCC 4D9RD 4I0PA 3NIDF 3BWUC 5C9JB 1DVFB 3MCLH 1NIEA 4LL1A 3N9GH 2CHXA 4XPGL 4D94A 2BZ7A 2IH1A 4IMLA 5DRZA 3DI0A 3B8YA 1P84K 2DW6A 4GO8A 1OFQA 4TNWK 3ES8A 2VDQH 3FQ4A 1JN6B 3V0AC 3IJDA 4PFEA 4UUJA 1MRCL 5G4HC 5HINA 1I60A 1I8AA 3WIAA 3ASWA 4PG2A 4YAQB 4F37F 1NSNH 2RAMA 2ICWJ 4YYFA 1U58B 1N6QL 4XNYH 1AC6A 3DXAD 5EF3A 5I17A 3FUJA 4AZGA 1S9XB 3ATAA 3DFPA 2AEOA 1W80A 3F85A 3WYZA 2Z3FA 5D1ZC 4F20A 3QDJB 2QCGA 4IJTA 2D9CA 1BSLA 1WAWA 3D05A 3CG8A 4HV8A 3ZDYE 3NIFF 4L4TA 2DZSA 2R69H 4WHYG 3I10A 4KXBA 1JNJA 5T1LD 4QTIH 4KCWA 3WF0A 5BWFA 1R8LA 3UYRL 2B8OT 5E8NB 3KBEA 2OP4L 2WN3A 3BESR 2VC2L 4MXWL 3HAEH 2XIJA 4LOVA 3I85A 1TVBA 3O4OB 2PPEA 4NHUB 2BOEX 2IKGA 4JFEE 5CAHA 1IWBA 1G9NH 3BVNA 4TVUA 1JPIA 4HGWB 1VEMA 4GJJA 3TWYA 2INEA 3O8XD 3EGDA 3RRQA 4N4YB 4W6XB 5T3XE 3WFDL 3EOBA 4FXJA 5CN2A 1VBUA 1TWIA 4MLIA 4WUUD 1X6UA 3QMSA 1A7RL 3APDA 4US5A 2XXGA 4U33A 4P0DA 5FAAA 1KTCA 4GI9A 3KWWA 4ACZB 4OM1L 3P14A 3LKPA 2F7OA 1TQUA 1W9PA 1KBVA 3O9NA 1I8MA 2NY4B 4NAEB 4NO2B 5EBWA 3KPNA 1ICTA 2BC4B 3L3IB 4D0BA 3HIZA 2YZ5A 1QG3A 3TW9A 3FQUA 4WUKH 5DVPA 4NDMA 4N6QA 2X4QB 2YZ8A