4X9YA

Wild-type human pancreatic alpha-amylase at true atomic resolution (1.07 a)
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wild-Type Human Pancreatic Alpha-Amylase at True Atomic Resolution (1.07 A)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 177
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4x9yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4x9yA01
2BS9A 3KLKA 3ZMRA 3H54A 2AMGA 3SCVA 1EGZA 2D0GA 3RCNA 3AMDA 1NARA 3LXAA 4YHEA 1TQSA 2QMKA 2WZHA 1XSJA 1BVNP 4KWUA 4HTYA 2WW5A 2OYMA 4OKDA 4WK9A 3M46A 3LXCA 4W7UA 3F5JA 1FP9A 2F61A 4P7RA 3SUUA 3BGAA 3WD3A 4F8XA 2XIBA 3AQUA 3BCDA 3T08A 1JI1A 3EJUA 3VGDA 4FLOA 2D2OA 5I0DA 1OINA 3IJ9A 2J7HA 3VMOA 5FIPA 3N04A 1HJVA 1ZBVA 1V3MA 2W92A 3MMWA 2FHBA 2OLHA 3D50A 1TMQA 5EFDA 4J3UA 2G3NA 2V3GA 2Y8KA 1C93A 3AIVA 1MYRA 2CITA 5E6YA 5ABFB 4F9JA 2O9PA 4JIEA 4D6FA 3W24A 4XX6A 1V0NA 2XUCA 1US3A 4CN1A 1W32A 3RJXA 2Q8XA 2IGTA 3VDBA 1S46A 1CGXA 3GXFA 2VT0A 1IV8A 3DX3A 2D20A 3KE0A 1J12A 4J3SA 1ZBWA 4UNIA 4E8CA 1MW0A 5EMYA 2YLAA 4MDPA 2GDVA 3CH9A 2W91A 3AS3A 1Q4NX 2WHJA 1AQMA 3WIJA 2GK1A 4W84A 1OT2A 4D6IA 4W85A 4UTFA 2EQDA 1ZL1A 1TQUA 3BVWA 1GJWA 3D4ZA 3KEHA 4AYGA 2OWCA 4LYRA 4FK9A 4AD5A 2IUZA 1KCLA 1V3LA 1JDCA 4FLQA 2QMJA 1H2JA 5BRQA 3GNRA 1SYTA 1X6NA 2AAAA 4RE3A 1KGUA 4CCCA 1JG9A 1CXFA 2C0HA 4M80A 1BG9A 5CJ5A 3SUSA 1XHGA 2QLYA 4QAWA 4LX4A 5A8OA 3MSGA 2YL6A 3WBAA 3OBAA 5CQ1A 1US2A 1B9ZA 1HL8A 2CBJA 5F7UA 5KEZA 4A3HA 1TQVA 4CKQA 2O92A 3VSUA 1OIFA 1GW1A 3HZ3A 2J7CA 1UQYA 4U2YA 1W2VA 1BLIA 1PZ3A 2D1ZA 3M6DA 1ECEA 3W0KA 1JIBA 2XVPA 1ISXA 5A69A 5DT7A 3GYCA 3W26A 4U2ZA 4MB4A 1BYBA 5GNYA 1L0PA 3AHVA 1V3HA 2WB5A 4M29A 2Y8VA 3OB8A 4J28A 5HDRA 4GI6A 4IISA 4PCTA 1DHKA 1BGGA 5HXMA 1V6UA 3N18A 4PMVA 1QNRA 2E0PA 2EABA 2F1AA 1C8YA 5DFAA 3WQ5A 2WSKA 4H2CA 5CLTA 4HU0A 3VGHA 4WJXA 4HA4A 4J3TA 1NWRA 2UY4A 1QWUA 1ZBCA 4WIWA 3G6MA 3GDBA 3PN8A 2E4TA 4ACZA 5JIPA 4YPJA 1GVYA 4UFLA 3CZEA 2VOTA 4NRSA 3PZOA 3VDAA 5AC4A 5E1QA 2FHFA 2WWCA 2O9RA 3ARTA 1XV8A 3AZRA 4JHOA 3WELA 2XFYA 6A3HA 2XWEA 1T0OA 1HTYA 1VRXA 2WANA 2BY3A 2ESCA 1VJSA 1V6VA 1GHSA 5BXRA 5I79A 3WH5A 1C7TA 5E6ZA 1DWHM 3OIHA 4TX6A 1J01A 1KXQA 1GQIA 2V5CA 5IDIA 4P8XA 3VGGA 4IM4A 4GI9A 4ZXLA 1TQTA 1XGZA 4TUFA 3HG2A 1BAGA 2G41A 1H41A 2AOSA 3ZT7A 1G01A 3K8MA 1WE5A 2X09A 4W7VA 2VCCA 1E6NA 1KXVA 4M82A 4M81A 2DT3A 3ECQA 1R34A 3N1AA 4KGLA 2EAEA 5I77A 4Z2HA 2FE0A 3VU2A 4HA3A 2PF0A 1UOKA 1TQWA 1R8LA 2NT1A 5KZ6A 3ARQA 3AS2A 1TA3A 4L4OA 1JZ6A 3A4XA 2ZICA 2VX7A 4W89A 3L4XA 4PEEA 2HISA 1CXEA 4UQDA 4UOZA 5GNXA 1MFUA 1R75A 3PZMA 1V0LA 1HVXA 3F5LA 4PSRA 2A3BA 4TVDA 1EO7A 1MXDA 1NOWA 4DWSB 2NT0A 2ZX6A 1EQPA 1H0IA 2XVNA 3LRMA 4LYPA 5DO8A 3AYRA 5CSYA 1JAKA 2VCBA 1U30A 2GFTA 2WMFA 1U2YA 4EAMA 5I23A 1OD0A 3K4AA 3CBWA 3ARVA 1PAMA 1E3XA 1UR1A 3CUJA 2VZVA 3FAXA 4ZXOA 4DWSA 2DSWA 2OW6A 4X9YA 2UY3A 3PZNA 2G3JA 4S3KA 3FN9A 3VIPA 4D1IA 1CLXA 3VD3A 3N12A 4C7FA 1QNOA 1BF2A 2UY5A 4QLKA 2DQXA 1JYNA 4NXSA 1CGYA 2BHZA 4JCLA 2VZUA 1BHGA 4XV0A 3CTTA 3MUY1 1BQCA 4D6JA 5A6AA 3EDJA 3VDCA 5A8PA 1W3KA 1UR9A 1ZS2A 1Y7VA 1R86A 2WVVA 2CBUA 3WUBA 1E3ZA 3CZSA 2OYKA 2VMFA 4PMQA 1DWAM 3DYOA 1PEZA 3VIOA 1KQYA 2ZUUA 2F7QA 1KBKA 3BUIA 1XD0A 2VZTA 3UESA 1A3HA 3WH8A 2WK2A 4JZ5A 1V08A 3KL0A 1E4NA 1HKIA 2D3LA 3NDZA 2V3FA 3I3DA 1TUXA 1XSKA 4W5ZA 5A6BD 4A3YA 3WNMA 2CKRA 2DH2A 1ISVA 3CO4A 4JKLA 1CWYA 1XH2A 3GTNA 4D6HA 4UQBA 1TR1A 3A4AA 1GQKA 1VENA 3WUGA 1AQ0A 3RO8A 3CZNA 3B9AA 3TOPA 1KXTA 3NUKA 1W9UA 5E70A 4DO4A 3M7SA 1M7XA 3K46A 3VGFA 2EPMX 1VEPA 5D8ZA 4FNUA 4P8VA 3NCOA 3SCSA 2Y24A 1BTCA 1GHRA 2QF8A 4V28A 3RIKA 2XFRA 3PHAA 3O6AA 1OGGA 1UD8A 1MVYA 2WLZA 4J3WA 1A47A 2C8NA 2J8GA 1BG4A 3BUDA 2WHKA 4W7WA 2HVMA 1UKOA 3IJ7A 1ISZA 2EACA 1J0KA 2E8ZA 4HMCA 3WQ8A 1XH0A 3WY1A 3MV11 4HZ7A 2YBUA 1WB0A 4BZYA 2VO5A 5BXPA 3UG4A 1UWTA 2CETA 4OIFA 2YJQA 1HJWA 3FHAA 2EXOA 1J18A 7TAAA 4NXKA 4AZCB 2EADA 1M03A 4MADA 3ZJ7A 3D3AA 1NH6A 5A94A 8A3HA 5JBEA 2YIHA 2CXGA 3SCPA 5BYWA 4CU7A 5M5DA 5BXSA 1FH9A 1GOWA 1K9FA 3SCUA 2MANA 1C8XA 3BSHA 1RP9A 2A3HA 4AISA 1HJQA 4PTXA 3CZGA 1ZU8A 1G5AA 1J0YA 3S5YA 2XFFA 1C8QA 2XHYA 4HPHA 3AOFA 3ALGA 1JZ4A 3AZTA 3RM9A 3EYPA 3EDKA 2QHAA 2XM1A 4Z2GA 4PMRA 4URIA 3GH5A 2WWDA 1WO2A 2WPGA 4GI8A 4DUXA 4XUYA 4DO6A 2VCAA 5I78A 2RGMA 1AVAA 2G3MA 2J25A 5LA2A 4AEEA 2CEQA 3HMCA 3ARYA 1WDQA 2ZXQA 3ARWA 5FCZA 4W86A 2CBIA 4YN5A 4UCFA 4J7RA 1XYFA 2Z1KA 4WSKA 1WZLA 4OZOA 1ZJBA 3W29A 1HT6A 1GOKA 4D6DA 4UFMA 2F1BA 1VFOA 1E55A 1CGUA 1W9DM 4JKKA 1NWTA 4DWSC 5HBFA 5GNZA 1JGIA 1D2KA 1MW2A 4U33A 1JF5A 3OLIA 3W38A 1W91A 3FAWA 3L2MA 1E4LA 2VURA 1UKTA 1FFQA 2WCGA 1TG7A 1R7OA 4PMDA 2PWGA 1V02A 3TV8A 1UQZA 3A23A 1UR2A 3EBVA 4JFUA 4QDMA 1QBAA 4QLLA 3A47A 5CXPA 3MUZ1 4KGJA 1J10A 2CCRA 4WKAA 3WNKA 1VJZA 3VILA 4NZJA 3AMCA 3DDFA 1OGBA 2E9MA 1JD9A 2NW0A 4CUCA 3BVVA 3ARZA 1B0IA 4PRWA 1WZAA 4XZBA 3BMVA 3VIGA 5HNNA 1UD5A 3WH6A 1E4MM 3L4UA 2V3EA 3WKZA 1UKQA 1V3IA 3W6LA 3PZQA 2XYLA 3JUGA 1ZJAA 2OW7A 3LPOA 1PX8A 3BSGA 3AIBA 3ZR5A 5LA1A 1H49A 1F4HA 2J7GA 4W8BA 1W1YA 4CN4A 3AIEA 1XSIA 6TAAA 4LXFA 2V38A 3ARUA 4NI3A 4W8LA 3BUPA 2X0HA 1CTNA 3K8LA 3VKKA 4J27A 1QHPA 3WY2A 1W9PA 4QFUA 3ZM8A 3AJ7A 1C91A 1WCGA 2EBNA 3EJTA 4UQAA 2CHOA 2XWDA 1XH1A 2FYVA 2JALA 1NWUA 2VX6A 1NOFA 3DHUA 3ZOAA 5M03A 1SFSA 2XG9A 3EDEA 1KQZA 5GQBA 1QI5A 3MV01 3WUEA 3T09A 1NQ6A 4HMDA 4YHGA 3TTSA 3RMEA 3IAQA 4HOZA 1JD7A 1SZNA 4AD3A 4M8UA 3UERA 3OGRA 1LL7A 5EBAA 3BUQA 3T2PA 3LX9A 4GZIA 1CXHA 1V0MA 1U33A 3AIRA 4C7DA 3DX4A 1JZ8A 1E0WA 4MB5A 2JIEA 1H4PA 5FKYA 1KTBA 1MWOA 2BV9A 3RDKA 1LQ0A 2VRJA 3VGBA 3W37A 2B31A 3EJQA 1JYWA 4JFSA 2E3ZA 1W3HA 4A4AA 3AHYA 4KRUA 1K9DA 4LGXA 3KWXA 2V5DA 2WMGA 4D6EA 1E5JA 2TAAA 1JXJA 4UQCA 4Z2IA 5C71A 1XYZA 1W2PA 3OA5A 1E9LA 3PZGA 4UQ9A 3IGUA 2WCAA 3VIIA 1GUVA 1W1VA 2WZEA 1VEMA 1V0KA 1HP4A 3IK2A 2D0HA 1W3LA 2F7RA 1GOIA 1ESWA 4D6CA 5A3HA 3WDIA 1TFVA 3WQ4A 1HJXA 2DSVA 4CD7A 2PBOA 2VNCA 5GPRA 4AIUA 4AW7A 3A24A 3AMGA 2WVSA 2WMJA 1WAWA 3HU7A 2UY2A 4ZEPA 2ZIDA 3CUIA 1LWHA 4XZWA 3PZVA 3TP4A 1QBBA 3GXNA 3WFLA 2XGIA 1KCKA 3QOKA 4DUWA 3TONA 1EH9A 3VTRA 1RH9A 2QV4A 4BQ4A 3O9NA 3L4TA 3F4VA 2D0FA 1UHVA 1UWIA 3RM4A 3QHMA 3WUFA 4BS0A 1E71M 1Z32X 1UD3A 4NX0A 1GOQA 4TXEA 3AZSA 1WPCA 2A3EA 3D51A 3OG2A 3RPMA 4JAWA 4TX8A 2DIEA 4AMXA 3AFBA 3VM5A 8CGTA 1GQLA 5EB8A 5A8NA 1VFMA 4UZSA 4NF7A 4P7OA 2BY2A 3CMJA 4HOWA 3W82A 3IAPA 3B8SA 4RE2A 3W4RA 1P6WA 4HU8A 3HG5A 1E6PA 1B2YA 5JIWA 5JBFA 3WD4A 2ZWYA 1PBGA 4AD4A 3K1DA 3VIMA 2EPLX 3AISA 1L8NA 1I75A 4GINA 3T2QA 4JFVA 1M04A 1W1TA 1C3FA 1EDTA 2J7DA 1K9EA 6CGTA 4D1JA 2YL9A 2GJXA 1PX3A 4D71A 1OGSA 3MANA 2VR4A 2W61A 2GUYA 3LPFA 3BVUA 3HG4A 4MNKA 1D7FA 1J11A 2EPKX 4JKMA 3U7BA 2YA1A 1WDSA 3WDQA 1H1NA 1QX1A 3MU7A 2X8RA 4MJ2A 1KB3A 1BPLB 5BXTA 1R7AA 2Y5EA 3SEPA 4Z2KA 1E1EA 2G3IA 1R85A 1G0CA 2OSWA 3T0DA 1JDDA 1KR1A 1NOUA 2BHUA 3MMUA 5DMYA 3RILA 1C7SA 4PMNA 4H41A 3WEOA 4P7NA 4RL3A 1WDRA 1UWUA 4U31A 1H11A 2NSXA 3T2OA 2PBGA 1B3ZA 5IHSA 1JZ7A 4M56A 1JZ5A 2BNJA 3WMBA 2CIPA 3ZSTA 4PBGA 5M3WA 1UD6A 1WZMA 1B3VA 2A3CA 4BF7A 1TCMA 1E6ZA 1PS3A 3NYDA 1C92A 4B9YA 2YA2A 4NSBA 1HKJA 3U5YA 4AEFA 1UH4A 2FH8A 1V02E 3W6MA 3A6OA 2PWHA 2GJRA 3HJEA 3AIWA 4PTWA 3II1A 2WVUA 1QWNA 4L4PA 5CG0A 3OLGA 2GVYA 1ITXA 1J0JA 3OLDA 2CESA 4WF7A 4QLJA 2IXUA 3N13A 4UZUA 2ZX9A 4BCEA 3WL0A 2WMIA 3CV5A 1Q6EA 5A6SA 2WMKA 2BVTA 3PZIA 3CGTA 5ABFA 2VQTA 4MTVA 2F2HA 3VMNA 4B16A 5D9OA 4Y7EA 3RJYA 1HIZA 2YL5A 3UR7A 3MI6A 1LJYA 2DSZA 3DX2A 3N15A 1CEOA 4DWSD 2EPOA 1ZBKA 1E0VA 2WLYA 1OIMA 2ZXDA 1JZ2A 4HMEA 2WBGA 1PX4A 1QW9A 2VRKA 1GOOA 1IZJA 2J75A 4FF5A 1ISWA 4N0RA 3KL3A 3A3HA 3OZPA 4EK7A 1HKKA 1UA3A 4JCMA 1V6XA 1QW8A 1UKPA 1QNQA 3PZ9A 2WMHA 3BH4A 3N9KA 3WNLA 3WY4A 3SCWA 4AIOA 1KGWA 2X0YA 3POHA 1HWWA 3LRKA 5HOSA 4QP0A 4V27A 3NSMA 1K6AA 3BAXA 1UZ1A 4CU6A 2WSPA 2XSBA 4P7QA 1HVQA 3BUBA 4U5KA 1XC6A 2BFGA 3VVGA 5A2AA 3BAKA 4GO9A 2YDSA 3THCA 2BXZA 3O2LA 3G6LA 1V3KA 2GSJA 3S5ZA 2PWFA 2DSKA 2JEPA 2WZIA 1OD8A 5A6KA 5IHRA 5A1AA 2ZOXA 1G1YA 1GPFA 2J74A 2XJ7A 1EHAA 2FDMA 3ALFA 4AY1A 3VUPA 4H04A 3VNZA 5FL1A 3CPUA 4PUDA 1O7AA 4GPNA 2EJ1A 3TTQA 2PC8A 5CPTA 4ZFMA 2VC9A 4UFKA 3WMSA 1HP5A 2Z1SA 5D8WA 2WCSA 1V03A 3WY3A 2VX4A 3K8KA 1R46A 3BAWA 2XM2A 4PN2A 1WKYA 5M17A 3PTQA 1QHZA 2F8QA 3EMCA 3FW6A 3B9EA 1Q6GA 2XGBA 1GNXA 1CGVA 1HX0A 5HPCA 4C7GA 2YFOA 1EO5A 4BQ2A 1J0HA 4AD0A 4CD6A 4FMVA 3WH9A 2VJXA 3A21A 1HL9A 3VX1A 2WNWA 3PZTA 2VR5A 5E09A 4H8VA 2VL4A 5IXEA 3BCFA 1UH2A 4AMWA 4PTMA 1CXKA 3WD1A 4P8WA 2WYSA 1X1NA 1BVZA 2DPEA 3MMDA 3GNOA 4GQRA 5I2UA 4B9ZA 1XRVA 1J0IA 3L4YA 1UD2A 3H55A 3VGEA 4OBSA 1JNEA 2EO7A 4HZ8A 3WENA 4AD1A 2RGLA 1E0XA 3VD7A 1H5VA 3KZSA 3BLPX 4GKLA 1H0GA 1BYDA 2WVVB 5A2BA 2PWEA 4KMQA 4W93A 3I3EA 4IUGA 3WF4A 4MAVA 4CVUA 2YOCA 3DYMA 1RP8A 4B3KA 1EOMA 2O9OA 1E4IA 4AZGA 3S2CA 1CGTA 5CZKA 1CYGA 3WNPA 3CUHA 4GXPA 4JL1A 2OSYA 1OB0A 2J7BA 2F7OA 2F7PA 4W8AA 2YL8A 3FXYA 2G4FA 2W4XA 4MB3A 3CHFA 2W66A 4FNTA 2GJPA 3AXXA 2ALWA 1GOMA 2OSXA 3ZJ8A 3WEZA 4QCEA 1DTUA 3AHXA 4AZ7A 3EJSA 1VBRA 1E6QM 3CC1A 2Y2WA 4NZFA 4TVUA 3AS0A 1QOXA 1CXLA 3AMLA 2ZUMA 1FFRA 3L4VA 4HA1A 2DEPA 1UKSA 3UEQA 2BY0A 2CERA 1QNPA 1WNOA 2XTKA 3CMGA 1I1WA 1KWGA 3J7HA 3AYSA 2CBVA 1E1FA 1HXKA 3AXIA 5D9MA 4AC1X 4OJYA 3MUIA 1BGAA 3KL5A 4W87A 2YDQA 3GM8A 1DWJM 1HF6A 1HJUA 4AD2A 2DT0A 2VQUA 1O7DC 1E15A 1CPUA 3CHCA 1EIBA 3K4DA 5I6SA 4PMUA 4IPLA 1EHNA 3VIFA 2PI6A 2OWWA 3CHEA 1UR4A 4B3LA 5TD4A 2WHMA 4EANA 4AYSA 3ZQ9A 4WKFA 4MJ4A 5I5RA 3WBEA 4RE4A 2X2YA 1MW3A 3SURA 3SCQA 3GXDA 1NP0A 3U5UA 4TVCA 2YFNA 2ZX8A 4ATWA 3BVXA 3EMZA 3SCOA 9CGTA 1JF6A 2E9BA 1QI3A 2W63A 5A8QA 2D22A 3ZJKA 3BAIA 4ML4A 1G9HA 3A22A 3ZSSA 1CGWA 3WFZA 2W5FA 1JNDA 5CPSA 4PSPA 2J7EA 3AIUA 4R27A 3AMKA 2JF6A 1B3WA 2XIIA 3GXTA 2YKKA 1GORA 3VM7A 1B1YA 3E1F1 2CKSA 4GZEA 3PTKA 3N11A 1IZKA 3WMCA 4FLRA 3LRLA 3VIHA 1CECA 4LQ1A 2VZOA 2JE8A 5AYBA 5I3DA 3UETA 3WD2A 4AZ5A 1PIFA 1JAEA 1GONA 2XPKA 1H3GA 4FNSA 3WQWA 3BXWA 2ZUNA 4H7VA 4DUVA 1ODUA 1XD1A 2ZUSA 1VF8A 1DWFM 4Z2LA 3L2LA 2PB1A 1W3JA 4ATDA 5BRPA 1KFWA 3NIYA 1MQRA 1JFHA 2VTFA 7CGTA 4ZE5A 4FNPA 3WF2A 1J9YA 1DEDA 3QR3A 3PZUA 3QHNA 2ZX5A 3OGVA 1TVNA 2ZXAA 3WDPP 4PMXA 4E4PA 1M53A 2J78A 1F4AA 3B9DA 2PWDA 3DHPA 1E72M 3DX0A 4CD4A 2XN2A 3PBGA 3MSDA 2YDRA 3A5VA 4UFJA 3W27A 3APGA 2FH6A 3VD9A 1XCXA 5ECUA 4PCSA 1JFXA 3WD0A 4LPCA 3ARRA 5LYRA 3GZAA 1HXJA 3VINA 3D4YA 1VAHA 1YQ2A 3AIQA 3OGSA 3ARSA 3LXBA 1KXHA 5FD0A 2W67A 5BROA 5FOOA 4PTVA 1RD6A 2UWFA 3ZT6A 3VIJA 4QCFA 3ARXA 2DIJA 1G94A 3DECA 3SUTA 4WLCA 3EDDA 4AZHA 3WF0A 2WMIB 1M01A 3CIVA 3NJ3A 5BWFA 1B3XA 2E40A 1R87A 3VOCA 3IJ8A 4M24A 1V6WA 2VVSA 1QPKA 3SCRA 3CHDA 5CGMA 1VEOA 3AHTA 1WP6A 1UZ4A 3CZLA 1KWKA 1XCWA 2DH3A 1QI2A 1FH7A 3VO0A 3GXMA 1J0ZA 1BYCA 2YA0A 4ZE4A 2JEQA 1UH3A 3WDHA 4OOZA 5ABEA 4JFTA 2BVYA 3BAYA 1C90A 5ABGA 4H8UA 4LYQA 3UG3A 1HN1A 2WC7A 4CD8A 2QPUA 1CBGA 2JF7A 1QNSA 3AHZA 3GXPA 2E8YA 5E0FA 3SUVA 2X1IA 1GJUA 3HG3A 4X0VA 5E9AA 3TTYA 2D73A 1Q6DA 3GBEA 4DM1A 2EEXA 3VIKA 3WDJA 5A6MA 4MPKA 2D3NA 4AWEA 1EDQA 3VD5A 4H8HA 3BAJA 3WN6A 1YHTA 3AS1A 2WXDM 2GK1B 2WVTA 4U3CA 4Z2JA 2BY1A 4GO8A 3LMYA 5BCAA 3EMQA 4TOQA 3LPGA 3NSNA 2XVLA 2V3DA 2WKGA 4NZCA 4CVWA 1VFFA 2G8ZA 3BC9A 2JFEX 3BVTA 1GQJA 4XB3A 1LL6A 1DP0A 5C8BB 5CLWA 3NDYA 2VI0A 3WEMA 2DSUA 4TTUA 4V2XA 1D3CA 2J7FA 1NWSA 1Q6CA 4UQEA 2Y4SA 5FL0A 4F66A 2WKLA 1UD4A 4KH2A 2ZWZA 1Q6FA 3ZJ6A 5D4YA 1GCYA 3DDGA 1FP8A 4MNLA 4P7LA 2XN0A 2QPSA 2J62A 4ZENA 1UWQA 4IPNB 4W5UA 4ACYA 4HZ6A 1FH8A 3TTOA 1LL4A 1E5NA 1TA3B 4AZBA 4CU8A 4WSJA 4UFHA 3CZJA 2GJXB 3EJPA 1AMYA 2O9TA 3AI0A 4FNRA 1ISYA 1FOBA 5A6LA 3SUWA 2VUYA 1BFNA 3W53A 5AC5A 1LG2A 4K68A 4AZIA 3W25A 3SIMA 5HPOA 4J3XA 3FNDA 1EXPA 4HPGA 2CPUA 4KRTA 2ZXBA 4PMOA 3VSVA 3M07A 4UFIA 1UR0A 3KLLA 2JIWA 3WH7A 3L4ZA 4X0NA 1OWQA 3ZT5A 1HNYA 1TE1A 2FGLA 4CN6A 2E9LA 2X2HA 3BMWA 3GNPA 1RPKA 1OM0A 4CCEA 2VZSA 1V3JA 3GXIA 1W9VA 3T0BA 1JYVA 1VFUA 1H09A 1SMAA 1QI0A 3RM8A 3DC0A 1ODZA 3FY1A 1W1PA 1LWJA 1OBAA 3GBDA 2IXVA 1DWIM 2A3AA 4MNMA 1CDGA 4E8DA 4BQ5A 3WNOA 2WAGA 4D72A 1HJSA 1NP2A 3L4WA 2CHNA 2CNCA 1IT0A 4MB1A 2F18A 4BA0A 1V6YA 2DDXA 4M1RA 2X05A 1JXKA 5EFFA 1JL8A 3VSTA 4P8UA 1B3YA 3S6TA 4MAZA 1BSIA 5JUVA 1FHDA 4JL2A 1EOKA 1TZ7A 3AXHA 4HOXA 4OOUA 1B30A 3SCNA 4OGZA 1B90A 1UWRA 3DYPA 1X6LA 3FHQA 4ATLA 4UOQA 3VX0A 1E56A 2ZUTA 1ITCA 1EDGA 3AICA 4J3VA 2CYGA 2WC3A 1W9XA 1JYXA 5JBDA 7A3HA 1BYAA 5D9PA 5A6BA 1VB9A 1W9BM 3D5HA 3ZR6A 2WM0A 2DGAA 4D6GA 1LF1A 4PMZA 5ABHA 1E6XM 2DT2A 5CSUA 3QOMA 4Q7NA 4JHZA 1E43A 1I1XA 1KTCA 2C7FA 2FGZA 3OLEA 4FNQA 3DX1A 2X2IA 3D52A 1WZKA 5IFTA 1QI4A 3OZOA 4F9DA 4GIAA 1R47A 1EA9C 4ACZB 1MQPA 1SMDA 3CUGA 3WQ6A 1KGXA 3PTMA 2BXYA 4EE9A 3H53A 3UCQA 4CD5A 1PPIA 2FHCA 5A6JA 3CLWA 3VDHA 4AZCA 3BLKA 3HN3A 2WC4A 1ZB5A 4PYSA 3THDA 1O6IA 1UR8A 3CUFA 5C70A 3W28A 4R5EA 1CZ1A 1CXIA 3POCA 3NSXA 5I24A 3EJRA 2X2JA 4AIEA 4WKHA 2BVDA 3LPPA 3N17A 2J79A 2J8FA 4MDOA 1R33A 4JFWA 1E40A 2OWXA 2YLLA 3T0AA 3IANA 3MO4A 5DT5A 3WDRA 4UR9A 4N42A 1UASA 1FA2A 1QHOA 3EDFA 1EQCA 4Q22A 5AY7A 1HKMA 1CNVA 3QGVA 1VBUA 2ZUVA 3VD4A 1UG6A 2VVNA 1KBBA 3WF3A 1FHLA 2VRQA 2VX5A 4U3AA 3VPLA 1TVPA 3BLBA 2ZUWA 2XVGA 3U7VA 1OCQA 4GZJA 3GH4A 4B15A 3UR8A 3MUAA 3UG5A 1JDAA 4NRRA 1E73M 2J4GA 1PIGA 3A4WA 4CCDA 1MQQA 4OBRA 1LG1A 1E6RA 5IFPA 2D23A 3MS8A 4W88A 4AMCA 2ZE0A 1SR0A 1LLOA 5D9NA 1K9TA 1GZJA 3WSUA 4CGTA 4EKJA 2W62A 3WF1A 1WDPA 3WQVA 1E70M 1KR0A 3ZIZA 5AYIA 4AXNA 2BHYA 1PJ9A 1VIWA 1UYQA 5CGTA 1OT1A 2WBKA 3GH7A 4OUEA 5CPQA 4DM2A 4TTGA 4DO5A 3QHOA 1MFVA 3ARPA 2WHLA 4BQ3A 4UOJA 1B31A 4AZ6A 1AQHA 1OSEA 1CIUA 3CZKA 2D24A 2GDUA 2J77A 1GVIA 3WNNA 5E0CA 5A2CA 4U5IA 3W81A 1E6SM 3F5KA 3MKKA 5A95A 5DF0A 3U57A 1N82A 2YBTA 3ZO9A 2J47A 4FLSA 1QVBA 4MNJA 1UA7A 2XVKA 3VMPA 2OYLA 5A8MA 3TA9A 4F79A 1DWGM 3CZ8A 4PMYA 1JZ3A 1PZ2A 1CENA 4PUEA 4GQQA 2DT1A 2EPNA 1UWSA 3VNYA 1MW1A 4E2OA 1UUQA 3WL1A 4S3JA 5LA0A 2ZX7A 2XSAA 2XN1A 4HP5A 1CLVA 3I3BA 5DEZA 3SCTA 1MXGA 1JI2A 1NM9A 3AROA
chains in the Genus database with same CATH superfamily
2GBUA 4QOKB 2EIEA 4XAWH 1OALA 4ABUA 3H7RA 2CBQA 4AV4A 2VN6A 1SBBA 2HG5B 1KPUB 3NOEA 2D0GA 2R23A 2EICA 3GB7B 3MA7A 4PI2A 3C2FA 1HXYB 5EUKA 5DT1H 3ZPDA 1RFDL 1D5RA 1FFNA 2L4OA 1TMCB 4JM2F 3SY0B 2HNHA 2AERT 2EDQA 2QVNA 2VOMA 1XSJA 4YHIB 1CCZA 2E7FA 2G37A 4UZGA 1TENA 4UMBA 3G1AA 2DQIL 5IVNA 3TYCA 3MNDA 3N06B 5JHDB 3ES7A 3MMTA 2K6WA 4WK9A 4BJHA 5HWMA 3ISWA 2Q76A 5AB0A 3LXCA 4HHWA 1KM6A 2F61A 1KNOB 12E8L 1ZRUA 2V67A 1J5IA 1GC1C 1PTGA 1PZ5A 2VDKB 1D7KA 2XIBA 1XCTB 3GG8A 4HDIB 3OKLB 2NZIA 3VXGA 3X3FL 2Q10A 2B14A 1JI1A 4XCFH 2J72A 3EJUA 5CN1A 2PYED 3VGDA 1KBPA 1YY9D 5EIIA 1A65A 5HYSA 4DZAA 1PJWA 5SWSB 4EXPX 2H7WA 2VIRA 3IJ9A 3ECBA 3WFCH 1T4WA 1L6SA 3GFUA 3KW8A 4PRIE 5H35B 2E9JA 1DE5A 1CFQA 1MCOH 4PJXB 1DR9A 3NRFA 5GGSY 1U8CB 3VMOA 1OGAE 2GW5A 4ONFL 1NCDL 1UOZA 4EXKA 2F7IA 5A2FA 2TRYA 2QJDA 1PUDA 3TBVB 1V3MA 5GZOC 3MMWA 2YXMA 4U1LA 2OLHA 1DVZA 4GKSB 1R2SA 2G3NA 3WV0A 2V3GA 2ADFH 2NY3D 2PN5A 4JDEB 4QYAA 4M03A 5FGCB 5L0QB 2Y8KA 3AIVA 2EYRB 4JRYE 2X7LA 3HOJA 4GS7B 3NSCA 1AZRA 5ABFB 4ES8A 1Q9KB 3W72A 2AVGA 4F9JA 2FVMA 3MRQB 5M1TA 1I7UB 4U1IA 4ZQKA 3W24A 4YXHL 4XX6A 1A7QH 5EG6C 3T7VA 2A9MH 3QNZA 4HHPA 2AK1H 4HKZA 1Z9LA 2Y22A 3FQTA 2VLLA 4E9TA 2Q8XA 3KPSD 4UM8A 3VDBA 5TH2B 3GI8H 1I7RA 5K9KA 4OU1A 2PABA 3CFNA 4JDVA 1KPVB 2GHZA 5DEJA 2VEPA 5BW6A 2VT0A 3NXFA 1IV8A 3D39B 3DX3A 3R1GL 3KE0A 3RWIB 3SE9H 5I1EH 2C4XA 1KBGL 4J3SA 4HHGA 4RISH 4UNIA 3VXUD 3MV9A 1H7RA 3W7PA 2VR2A 2UZXB 3GPEA 1LQSR 1PDZA 2E67A 4C6MA 4H5SA 4UTBH 4UYPA 4DJFD 1RHHB 2WWNA 4NCC1 4PH8A 4MWFA 4N90E 1RUMH 5CGYD 4MDPA 1F1AA 2AXJA 3QPXL 2PYEB 5IJKC 4LSBA 2AJVH 1N7MH 1U8IB 4GXUM 1AYRA 4QRUB 1Q0XH 1Q4NX 5E8OB 4S0TD 4QITA 2J1XA 3F12B 4ZUVB 2QTEA 2AKRA 2MQGA 4EI6A 3MTWA 2HZGA 2Z35A 1Q0XL 1A1NA 4Y2OB 1I82A 3O3AA 4P5KA 3PV6B 4U6XB 4DBWA 3GHTA 3BVWA 3GNDA 1MAKA 3KEHA 3B8YA 1EGJL 1NAMH 4J5NA 1Q72L 4LKCB 2G3ZA 5TQ2H 2E7DA 3DBXA 3LD8B 4LYRA 1U3HC 4N0CC 4NAMA 4DP5X 1FVPA 3O11A 2H2PC 4IKIA 5KZDA 4BEIA 3U1SH 5HP5A 1L2UA 1BYPA 1S9XB 1WYIA 3GVQA 5B39B 1JDCA 3IRZA 4Z17A 3N2CA 1TPH1 3FFCE 2VW6A 4YDVA 2HMIC 5E8OA 1K03A 1PNDA 5BRQA 3MYPA 3W7CA 1TJXA 4PRPD 3MRFB 4NUQA 4N0YH 3BH8A 3QCTL 3ZDXB 3AADB 4YHOH 1A7OL 4P0DA 1OV8A 4QOKD 1R3SA 2GOKA 4RE3A 3UTQA 3AXKA 4Z7WA 3O05A 4H6EA 1FYTD 2DEYX 2WOYA 2DLIA 3P1VA 3HFMH 1CXFA 4YSEA 2C9PA 3K74B 3Q48A 2OXGB 5BW7A 4D0BA 3C3UA 1UOLA 1L6GA 1F00I 3L21A 3ABLB 4FZ8L 4H40A 1MO0A 3ALXA 4KXZH 4PRIA 3EH3B 4U1NA 1XHGA 4GT0A 1XBXA 4QAWA 3OHMB 4P2QD 3VQ1C 5A8OA 3MSGA 2YL6A 1NQBA 5TE4H 4ELMF 3N6JA 2F74A 3MCMA 3FQXB 3WCYA 3RGVD 1U21A 1US2A 4DKFH 3ZS4A 4FTVB 4RDBA 2B16A 4HUXB 1DBAH 2O92A 3LZPA 3AU2A 4P46D 3RIFF 2YSTA 5JQ6L 5CR8A 1DBJH 1NAML 2EC9U 1YPZE 1V05A 4Y2DB 2J20A 2X7LB 2XZAH 4NFBA 1NDMB 4DNLA 4H0HB 1GGIH 1FCGA 3M1CA 2PZNA 4JTUA 4NKCA 2Y8UA 3I2CH 2DQFB 2J7CA 4Y9BA 1UQYA 3PBUA 4U2YA 1BLIA 3J2PA 1X39A 3W0KA 2WIIA 2XVPA 1TKKA 1ORSB 1YEDA 2O6CA 2DZTA 5F7FA 5A69A 1N7ML 4HWUA 4IQEA 4KFMA 1FNSH 1OC7A 4AQ8A 3UD6A 3HS0B 2H45A 3ECBB 1QBML 1GYAA 1T7VA 5K39B 2VDOH 1OK8A 1O12A 4Z7QE 3K5XA 3B2XA 4OF5A 4P4RB 1W8GA 1L0PA 3TEZA 3SRKA 4M29A 3S4SB 2WB5A 3URQA 2Y8VA 4DY1A 5HDRA 3OAYH 4KRNA 4IISA 1L0QA 1D6VL 1DHKA 5BZDA 4QG8A 4KTEH 3DFPA 4B9IA 3EHBB 3ULAB 1BGGA 1K8ZA 3IMBA 3AREC 1XPGA 2P8BA 4XZUA 1OF2B 4AW4A 5IBTL 1QNRA 2J57A 5DYOA 5B7FA 2OZ4A 2IAMB 4HD9A 4BR1A 1JRHH 2BVOA 1FRGL 2LGNA 3K2UL 2CJUL 3LN4B 4ERIA 1WITA 2WSKA 3UEZA 4CVZA 1G5GA 2I60L 2RAMA 1A1NB 3APTA 4HU0A 4HG4J 1ZGLP 2J43A 4GUPB 3HQNA 4PJGB 4LF2A 3T4YA 2OSLA 2VR9A 1ZBCA 2V8ZA 2P45B 4PBDA 4J8QA 5E2TL 3OJ2C 3EB4A 4LLQA 1JUKA 5JIPA 3KAOA 3RITA 3I68A 3AITA 1GVYA 1MHHA 5F2FA 1N9PA 4CW1A 3G77A 5HA7A 4Q9CA 3TFKD 5I73C 3VCRA 3OWRA 5LVEA 4PCYA 1OAZH 5IROA 3O0RL 3P0GB 5AD0B 4NNYB 5DJAA 4CADB 1CF8H 5K59E 1JBJA 4XMKH 4KK9D 1MDRA 2O9RA 1AL7A 3FV9A 3O9WD 4KH9A 4JLRB 4GACA 4XSLA 3NPSC 1YEFH 3AWEA 2YB4A 4YU1A 3FB5A 1U8IA 4R5TA 1A0DA 1P9MA 2PS2A 5JYMA 4MJJA 2Q2LA 4YC2B 3G6AA 1BFSA 4AVOA 2E9IA 2UY6A 1FGVH 1GHSA 1V7ML 3F4DA 1UJPA 5I79A 3C09B 1C7TA 1DFBL 4K3DL 4WHDA 3SDDD 4JDYA 2YAFA 2ETWA 1WWCA 5IB3A 3FYOA 4AJVA 3NO1A 2WQPA 4FHKA 3IJSB 2XPGA 1E67A 2IAND 2EYTB 3PXJA 1REQB 1I3GH 4FHBD 3IKCA 4PRID 1LQBC 3MJ6A 3CSBA 4JDEA 3VGGA 4XK2A 2ICSA 5I74B 3LZOA 1FWCC 3PAJA 1B4JL 1CT8A 1N2RA 4Z7NF 3KCPA 1IWPA 5G5IA 1E6OL 3T1FB 1DJXA 5BXFA 2ESVE 2CK2A 1QZNA 1U36A 1HAWA 1BAGA 1SLUA 3FPYA 4UV4L 5TFSL 3VWKD 5I2IA 3QIWA 4LVHB 2SFPA 1H41A 3PWIA 1WGVA 3B8TA 2IANE 5DBTA 5EU4B 1G01A 1R9XA 1JP5A 3WEAA 1KJVB 1GGUA 5CH9A 2YXVA 1KCSL 1B6UA 1W8OA 1ZT1A 3ARDB 4MA1B 1Q65A 3OQ8A 1RZPA 3RDTD 1P7QD 4KHXL 4FFWD 5KTEH 3Q58A 3P4NB 2IPTH 2YK1H 1PKLA 4GSDH 3GBMH 3ECQA 3N1AA 1FIGH 4KCTA 3HZYB 4Z2HA 3VU2A 1M6JA 5D37A 4KBPA 1E5CA 4N9EA 4H1LH 2PF0A 3L9YA 3JWNE 5T3XH 5DVPA 5HGDA 2XOTA 4PMRA 1ADQL 4UQ3A 2A7BA 3V5KA 2NT1A 3AS2A 4MXWL 3SO3C 4L4OA 4LOFA 1J6PA 5CC3A 3LSCA 5FA5A 4WW1B 4M1GL 2PPFA 1L5GB 3I6LE 2BINA 3ZHFA 3H6AA 4HPNA 3KPQA 4JHMA 1RBOB 4A8NA 1LLZA 5GNXA 1WF5A 4JN7A 5B1JA 1ZGDA 2HBVA 2XYCA 1R75A 1SJBA 3UTTE 1MFAH 3V5CA 1I9IH 4N2NA 4K3EL 1UVQB 4FD0A 1D5BA 4L29B 5E1AA 1P6AB 2L0DA 4ALAC 3F5LA 4RZ4A 3GMNB 3WHXB 4HKJA 1MFEH 4JFPB 2VN7A 5AC7A 3STZB 3GHUA 1K8DB 4UIMA 3IGAA 5C3IA 5I30L 1NOWA 3KJ6H 1HQ4A 2CPCA 4U1KB 3GVGA 2Y07L 4RRPG 3PWGA 2J6EH 1IEXA 2ZX6A 1H60A 1QWKA 3KTXA 3ULUD 2PCPA 5IF0B 1H0IA 2PF6A 1WFTA 2DIBA 1KIPA 4HX1B 4BWTA 3QO1A 3OQEA 5AVZB 2X1WL 2PDFA 4ZMGA 2HKHL 3OTRA 4LYPA 3VXPA 1JAKA 3BOLA 2HJKB 2VCBA 2GFTA 3SJVB 3VCNA 4WQ6A 1U2YA 3L3KA 1JNJA 2VHLA 5I23A 2BSSA 4HPOH 4E41D 4P06A 2NV2A 4XD3A 4AH2B 5C09B 3ARVA 5IGXH 4XPFL 1NSNL 2ADGA 2CHXA 1TXKA 1QFWL 4AMKH 3CVHL 3W9DB 5BW7C 2C26A 2X70B 3VH8A 1U8NB 2BODX 5AWNL 1I3VA 2LLLA 1LBLA 3APFA 4H9UA 3CUJA 4BRVA 3ZE0F 4AB4A 1TZIA 5I1AB 1EK3A 4Y5VA 4ZXOA 3W7IA 3CE1A 2DSWA 2X44D 3M8OH 2E86A 1P5BA 4X9YA 3O0RH 4MFDA 2G3JA 1NIEA 2HT2C 3VD3A 2VW4A 3R13A 4F92B 5GS1C 4C7FA 1BF2A 3FH7A 2XTLA 5AZEL 2CO6B 5L4MA 1W1IE 1P2CA 2VXSL 3PHQB 4NI6A 3O3RA 3CWHA 3H2AA 4JANA 3PWVA 4P9ML 4APXB 1P7QA 1O7SA 3E49A 4E5TA 2B0SL 5D55A 4FG6C 4JCLA 1EJ7L 1YDYA 3I9IA 2VZUA 2NX1A 3FIGA 1P5VA 2KI6A 4DXXA 3FQRB 1JF1A 1HIMH 4LHUB 4XV0A 5FJRA 4H26B 1BQCA 4O52A 1XLLA 1OCRB 2ZUQC 5KYUB 3MLYL 2XC8A 1J8VA 1W3KA 3C56A 1QP1A 3TEWA 1Y7VA 3VWKA 1D9KA 2IWFA 3B5GA 3B9KB 4FQJL 3AG4B 3PUEA 1HTIA 5C7ZA 4UTBA 4KKRA 2P7TB 4JM2B 1S2CA 3IB4A 5J1SC 3V4VH 1BECA 2VR8A 4AQ8C 3UPRA 2NVDA 2ZSWA 1HHIB 4KAQH 4PMQA 4FYSA 4ICMA 3DRTB 2DY3A 3BP4A 1E4XI 3B56A 5EZIL 2OBGA 4DVOA 4F2ME 2WY3B 2DL9A 3EJYD 4HT1H 3VIOA 4O1FA 4WX2A 4JREB 4Q8NA 3QZPA 3BUIA 5CZTA 3V6FA 3MACH 3WH8A 4U6VL 2WK2A 3PQYA 3SQBA 4ROPA 1UXLA 1QBMH 2LVCA 4WI0B 4WW1A 1HKIA 1BM7A 4YDIH 3FFCB 3SQOH 3QCUL 1RZJL 4CDHA 4CNTA 2V3FA 3I3DA 5BUAA 3OVGA 1A4KA 3LNIA 4IKLA 1TRDA 4WTQA 1XIDA 5BMWA 4E4FA 2DLEA 3W9DA 3ANYA 3HLAB 2P80D 2VDIA 1R3HA 4A3YA 3CPLA 2R83A 2CKRA 3UMNA 1ISVA 1Y5XA 4WDIB 3GINA 1BTMA 4QRPD 1ZFJA 2BIIA 2B7DT 3CO4A 2RH9A 5KTLA 1VGKA 3LRSB 4UQBA 3A4AA 1ZT7A 3DJZA 3G08A 5SWZD 1IEAA 1GQKA 1N0XH 3VUSA 2NQLA 1AQ0A 4WTZG 5DA4A 5D09A 3FUJA 3F4NA 3GAKA 4V15A 2BNQD 2BERA 3P54A 3SKUD 3UWEA 1SLXA 3SCMD 3NUKA 3DHDA 4Y5YA 4Q4KA 1EX1A 3MU3A 1H7XA 3HN8A 4O17A 3K46A 2X6VA 3NZGA 1M05A 5IROC 5TQ0L 2N7SA 1A4KB 5E0KA 3O7UA 1VACB 1NMBH 4X2UA 1VEPA 1T1YA 4B2DA 4E36A 1A6PA 2DW6A 4AHQA 3FGCA 5D8ZA 1F45A 3PNWA 2PZ0A 1DIDA 4FFYA 4S2CA 2YC1B 4KI5C 3ROOA 4K7FB 2B1AL 4P8VA 1REQA 3Q44A 4H0IA 2FO8A 4P2QE 4RAUB 1GHRA 1JRHL 4BKLB 3WI9A 2CXKA 2I5YL 3PHAA 5IJCC 2E5BA 2IPKB 2B3RA 5C07A 1SZEA 1OGGA 3S88H 4AENA 2WLZA 1MVYA 4I1NB 3IGHX 4J3WA 5G1TA 3E80A 1QXLA 4I4WB 4LCWA 2VGGA 2YXFA 4ZQMA 1BG4A 3TIDB 1ZHNB 2Z91B 2X30A 4W7WA 3KPMA 3FZUC 2K7PA 4OZHB 4XMUA 1BZ7A 1SM3H 4OKVA 1UKOA 2Q6WB 5IFJB 3GS0A 2J4WH 4JFEA 3PJWA 2EH8H 3LSOB 1J0KA 4MD5B 2R0ZL 4PY7B 4F27A 3BPCB 2E27H 1JF1B 5L9DL 1QO5A 5EZIH 3C2VA 3MO7A 4R9OA 4GYPA 2NRDA 2OK0L 1XG3A 5HNRA 4XO8A 4KXDA 5L8LB 4JD4A 4JFDE 4YE4H 3L95A 1XIMA 2YBUA 4WHTB 5FYKL 2EDBA 3DSNB 2XWBB 3VW3H 1M2VA 4M7LL 4FI4A 1KC5L 1LP9A 1E9PB 3UG4A 1UWTA 4MMWA 4PG9A 3MYJB 1G6RA 1WIOA 2VXTH 3M88A 4TUKH 1CB2A 2BSTB 1XGYL 3PFUA 3IPEA 1NWPA 3GSNH 3NSYA 4JHBA 4GIYA 4KWWA 4CQ8A 2VM8A 3RR4A 4DGIL 5F7HA 3JWOL 1YJDH 1SN5A 4J3OF 3BWWA 2ZUYA 1J18A 1HWHB 3PWPD 1W3IA 3A9IA 3G0XA 2X1OA 5XIMA 3MW7A 1XFPA 4Z77A 1NH6A 4R4BA 5J13C 5A94A 8XIAA 1XL6A 3HIZA 1NDGA 3T4AB 3M1BA 5FEPA 5JBEA 1FN4A 1ZHKB 1AGCB 2C9QA 2YIHA 3KYKH 4FEMA 4LRNL 1VZWA 2VLKA 4MVAA 2E09A 5BYWA 4XX5A 1PXGA 4JO1L 5M5DA 3VRLF 3B04A 3C8HA 4YFDB 3QPYA 3APMA 1XBRA 4MJ6A 1RP9A 1N55A 3U7WH 2HZHA 3V4UL 4XI5D 2A3HA 3GMQA 3IGFA 1N18A 5AWNH 3LTVA 2MOVA 3D87B 1TV8A 3CZGA 4G9FD 4JG1L 4TULH 1ZU8A 3QPEA 3FXIC 3S5YA 3R7QA 4JQ3A 3WLRA 1MCIA 4JTJA 3IF1A 2XHYA 4POZD 4R3UA 3BKYH 3H9ZA 4NUJA 2FTYA 3RM9A 2XTSA 3HC0B 4WEMB 3ZGHA 1CLOL 4PQXA 4FA7B 5EBMB 2OX5A 1TITA 3HUJA 4LVNB 5FOBA 4W68A 2NW3A 1EUAA 1A3RH 3IJ6A 1QO3A 4KKLD 5B1CA 2VAAA 1YC8A 4YHLL 3EOOA 3NQDA 4URIA 4F8PA 3NGJA 5L9FA 5IQ9A 2BIHA 4AHPA 4U7SA 2ED7A 4PGDA 2XQ0A 4GI8A 5DQJB 3FGCB 4OLUL 3XINA 3MUGB 4XGZB 4XUYA 2I7OA 3CT7A 3VFCA 5I78A 4MA7L 3W7LA 5HVHC 3CVHB 2OTWA 3ESOA 3ZR4A 5E8EB 4DZBA 3URBA 4Z1CA 3LNFA 5BNKA 4AU0A 3HHSA 2IXQA 3W2DH 5FCZA 4XMWA 1JMZA 1OVDA 2QEZA 4RW5A 4GMSH 4W86A 4C6NA 2E5EA 3UYCA 3LBOA 2VDNH 2E1DA 5SWQA 4Z1PA 1JV5A 3OBEA 4EI0A 2ZXWB 3OKMA 4Q9QH 2I25N 5ALCH 3CN0A 3LZ3A 5DUBB 3U30B 1XYFA 1T5WB 4YE0A 4E0RB 1I4NA 2E46A 2P8MB 3VABA 2E3VA 3MI2A 4CMMB 3QZOA 4LO9A 1S7WA 1AD9B 1MVUA 1NC2B 4OD3L 4TL5A 1AD1A 2Q6ZA 2X0SA 1L8PA 3MSYA 4TU1A 4LPXA 4F2BA 1W9DM 5FF3A 5L7XH 1JUBA 3PJNA 4KV5F 4DWSC 4HXAL 1J5OH 2WKOA 1K85A 2HMID 1YEWA 4IFKB 2R7EB 1D2KA 4PC8A 3Q6FB 1MW2A 4U33A 1JF5A 3C5ZB 4XNYL 3FCUB 1W91A 2MH4A 4KNTA 4QRQA 3W38A 5I74C 1ZA6B 3OV6A 4HJJL 3D25A 3N42B 3QEGL 4HXAH 2ATPA 4AYEC 5HHNA 6PCYA 1J5OL 1E4LA 4ES4A 2CUAA 3L3HB 4JEQA 2NY6D 2WCGA 5D1ZC 5I0WA 2Y1VA 1TG7A 3UJRA 3R8RA 1R3TA 4MASA 2CKBA 2XWTA 4FFZL 3PPEA 4OQTL 3KXFB 4M6OL 2EEFA 1JDFA 3PBYA 4NZ1A 1IX2A 2VC2L 4ONOA 4C56A 1PG7X 1UR2A 5DRNB 2Y5JA 2F74B 4HIXL 2BC4B 4WY7L 5DFVD 2I56A 1KIQA 3IGXA 4JFUA 4LBUA 4Z7VE 1E7UA 3BJLA 2UVEA 3IDGA 4Z7WE 4R2GD 1SXSA 3C08L 3RGVC 4M6AA 4ZMWA 1DCLA 3QJZA 4WKXA 4X5WA 3A47A 5CXPA 2O56A 4G11A 3DJSA 4S3EA 4GRLC 4FR6A 2CCRA 5J0BA 4CNIB 5CJXA 4FABH 1A6WH 1GGYA 2J5LC 2UYLA 2ZZ6A 3DDFA 4D0DA 4LY8A 1T21B 3F7YB 3JBG7 2YBRB 1F86A 3L0GA 2YD0A 1FF5A 1JD9A 3ZL1A 4OFIA 1OZTG 4NGHL 4CUCA 2ORBL 3IMSA 1VFHA 4NWUL 1WAAA 4PJGA 3X14B 1JVNA 2W9DL 1YAZA 3BVVA 4P5MB 2R69L 2X41A 1S5WA 4NX5A 2H0EA 4NHUA 4DB7A 2FL5B 3RTQC 1F73A 3IU4L 3Q8FA 3HGRA 3ITTA 5JOFA 3GEFA 1K6WA 4K1GA 4QTIH 4LLYA 3HAEB 5AYTA 2ATSA 1H1ZA 5KAQF 3WH6A 4YBQD 4PRPE 4QI3A 3DFYA 1SU5A 4MAYB 2F8XC 3W2LA 3TVAA 5E2TH 2WWKO 3PZQA 3GZPA 4WEBH 2FR4B 1XI3A 1OY3B 1ZIAA 3CXHK 5FYKU 4TULL 1GVRA 3U48A 1ZJAA 1EFQA 1EUTA 2OW7A 1PX8A 2V9UA 3ATDA 3IT8D 4NQDB 1TZ8A 4P2YA 3G6AB 3V0AC 3ZN6A 5IB5A 2BNUA 1F3TA 4RZCB 2YDAA 3RLUA 1I8KA 1OSZB 5C0BD 4W8BA 3FJTA 4UM8B 1W1YA 1RAKA 3S1VA 2V2WA 4CN4A 3AIEA 4L9YA 1XSIA 1IKNC 1A50A 2ZT9C 1XB3A 5DUPL 2Q3AA 5CZSA 4LRNH 5GRVK 4HH9A 1SFTA 1YPZF 1U4FA 2PD9A 1LO0L 1I1YA 2R2BB 3E3QC 4W6WB 2E6DA 4X98A 3KNBA 1QLEB 3V8OA 4MIMA 3S37L 4XO4A 5D93C 1BD2B 2ZOOA 4QTIL 5B7MA 5C55A 3FSTA 1WBXA 2HUHA 3ATYA 1F61A 4JO8A 1JGUH 3MWCA 2WLJA 3GEWB 4ENEC 1XEUA 2ISFA 3EHBD 3LMJL 4PY8I 4GYPC 4BA8A 4F8LA 4RETB 1BXUA 4MZYA 3KOZA 3MA9L 1U9KA 2WB7A 3MLTA 2ED8A 2EINB 4N90D 3UTSA 3E5PA 2CK0L 1F74A 3G24A 3R6IA 3TZVB 4LCSA 3KWTA 4B7IA 4O0KA 5CP7B 1ES0B 1CCWB 3IVUA 3C6LB 4N8VG 1NQ6A 4PJ5D 5AVVB 3D2TA 3GSOB 2ABAA 3DX8B 4LW7A 4PMEA 5C0GA 2R1LA 3RVUD 3RMEA 3T3ME 4UAOC 3Q2LA 4NKIH 1TJ2A 5B3SB 5C08E 2FGWH 1GW6A 4HOZA 1H7OA 2OGYA 3I7RA 4FSAA 3C12A 1JD7A 1ODAA 4Z7VA 1SZNA 4YVNA 1I3RB 1ML0A 3T0VA 5KVEH 2HKAA 1YPFA 4H6QA 5FV2A 3D1MC 4XODA 1U1UA 2E7BA 1AH3A 4OI9A 2YKLH 1PFCA 3B43A 4YBHA 3TFBA 1U33A 5E9DB 1WHOA 5CAYB 4XVSH 4MQXD 3KGSA 5GGUB 3WJJC 3DX4A 1AFVL 2PGFA 3QPQD 2W80C 3KWUA 4D8PB 1JZ8A 3GXUB 1MFCH 1HL5A 4BK4A 5AW2B 4QISA 3U2OA 4A6YL 1AZ1A 5FKYA 3HFYA 4FP1A 4O4VA 1XDLA 3VXNB 3W7MA 3LEPA 3ZE2F 3GS4A 3BUTA 5DJ6B 3K81A 2NXZB 1NEZB 3VGBA 3BN9D 3SGGA 1YNQA 3PBMA 3B4UA 1WEJH 4D8LA 3QLDA 4WFFD 2QJMA 3CB8A 4HKPA 5JHMA 1TZ9A 4HPXA 2AJ3A 4RZ6A 3OPUA 2E3ZA 3KYMB 3HRZC 4A4AA 1EZVY 2QKIA 3APCA 2P8LB 3N43B 1C16B 4O2CB 4R26L 3RP1A 3AHYA 3LUTA 3SGZA 3SI9A 3VQMA 3F64A 5CJNA 3QO0A 1KBWA 3KWXA 2H6UA 3WK2A 1QYGH 4XVTL 2V5DA 1UWGH 3TDFA 1JXJA 3S0CA 4ODUB 4YH6A 4KRLB 4GY0A 4UQCA 3PP4L 1FKXA 3H3BC 2J6XA 2C19A 4P4KB 2QCCA 3P61A 1ANUA 3PZGA 2J88H 2PCFB 2YD6A 3DI2B 4TOYL 4WK4B 3C6LA 2WCAA 5C0AB 3DKLA 5F4XA 1NEZA 2HKFH 2QPDB 1G7UA 1LEKB 4LUTA 1FUNA 1M1XB 3FL7A 1UFUA 1VEMA 2OK0H 3SCNA 4BF5A 1PY4A 2CIIB 3N42F 4ZUWA 3BP5A 3RDTA 3BD5A 5I1LA 1RBLA 2D0HA 3OAUH 5DHDA 2OR7A 3QFDB 4FA6A 1ESWA 1BMWA 2PYEE 3WDIA 8RUCA 1AIFB 2UX6A 3U82B 3WN5C 3QDAA 2DSVA 3N3MA 4JTIA 4MSSA 4CD7A 3CPGA 3SDCC 1JUEA 2KZWA 3CFBA 3RFRA 1OF8A 1Q85A 2NUYA 3LCXA 3A24A 4RMQA 3X1EA 5JU6A 4LIQH 1QFWI 4Z7UF 5E51A 3ZTDC 1NLDL 2HFTA 4LDOB 1XGQA 5J8OA 3RLHA 1OAJA 2KZ1B 3F12A 4ZUVA 3VG0L 4ZI8A 2QZRA 2EIZA 1DN0B 2GBVA 3S9YA 2YO3A 4K9JA 4NN5B 3HU7A 3ZLGA 4W9HC 5D96C 4XZWA 4ZQNA 5K39A 3PZVA 1QUPA 3OO2A 1YVLA 5DANA 1D7BA 1SYSA 5D1ZD 5FR3A 3H2QA 2CDEA 3IU3B 4NO2A 2K4AA 3G1VA 3IBOA 4OQ1A 4YHKH 3VZZA 4DZ8A 2PDKA 3ASWA 5F1NA 4OGAC 4N87A 2E6PA 5K1JA 5EU6D 4MWAC 3SQSA 1T04A 1V55B 3NCXA 4BQ4A 3PK7A 4D8AA 1RK1A 3F4VA 2D0FA 3SSJA 5HQMA 3SPJA 3EFDL 4QSHA 1HEHC 5FV1L 3BIKA 3TC3A 1UHVA 4AV0A 2Z25A 3RM4A 1M9HA 5TPWL 4YHML 4O2FA 3R43A 2VDHA 3PJSA 5I3IA 4NSKA 4PJAA 4U1JA 1IIHA 1MRDH 3UACA 2A3EA 3CLMA 1FZOA 4TUKL 3ATZA 5J8LA 4GLEA 1ZA3B 4UIKL 4TX8A 4TNGA 2D4FA 2R1YA 4G8EB 5DSCB 32C2B 4MDIA 5IIEB 3EXSA 4QR7A 4LEEA 2EC9T 2X2UA 3OR7A 4NYLA 1RIUL 1BD2E 3VM5A 3ITLA 4PUKA 5EB8A 3KLHD 5T3XE 4A05A 1UWEL 1VFMA 2EDEA 3DETD 1I0DA 4NF7A 2HJLA 3LIUA 4HSQA 2ICES 2BZDA 1ACYH 2D31A 4MWFB 4OZHF 1RUAL 4ORZC 3B8SA 2AK4B 3BGGA 2IBBA 4RE2A 1IAMA 3W1ZA 3L5XL 4OGYH 3O8AA 3AAZA 1X7IA 1AXSA 1P6WA 1Z5HA 1EMTH 2P50A 3RUGF 4J40A 3MUCA 1B2YA 4NQQA 4FF7A 1J6OA 2YAQA 3TWYA 1QU4A 1MH5A 4CSPA 1JNHA 2X4SB 2ZWYA 3MJ9H 4FMFA 4Q89A 5T1KD 3W11C 1PBGA 2EKCA 4GBUA 1RFDH 3V5FA 2EPLX 3FU7A 2INFA 3OAYK 3O41A 3T2QA 3WO4B 4KNQA 3KBMA 4JRXA 1M04A 2PWVA 4HIIA 1EBHA 5ID1A 5JHBA 3GU1A 1HCVA 1FNGB 4WR3A 3H85A 3LHVA 4IOFD 3FONB 4KU1A 6CGTA 4L9XA 3RWGB 3LH9A 4U0RB 3B7YA 1CICC 4I5BB 4OLXH 4D1JA 5J6GB 5GS1A 4HCDA 4N2YA 1PYFA 4HYWA 2EIDA 4YNYA 1VHCA 2YXXA 4JN6A 5IB4B 2JQAA 2RB8A 5HYIA 3F7VA 5DQ9B 5T3XL 3S35H 3MANA 4L61A 2WUBL 3SGEH 3W0WE 5CCZA 1CMOA 4XMTA 1R3LA 2VR4A 1CE6A 5T1LA 1YBQA 2Z7YA 3HOGA 3SQLA 3V0HA 1HKWA 1T40A 2ALRA 1VADB 3BVUA 3PWAA 5DWUH 3CU7A 1WWBX 3I6SA 2P24A 4OJEH 5HPMA 3FQRA 1J11A 2EPKX 2CD0A 4JKMA 3K72B 2YA1A 1RZFH 2C3VA 1FDZA 3NVTA 5JIIA 2P3YA 4KDTA 4UT7L 5AENA 4XNXH 3RNKB 4G8IB 5IGXL 4NN7B 3LKNB 1AAJA 1WS7A 3MRRB 2PRHA 4MJ2A 3DTXB 4P49A 3P62A 1KB3A 4GUHA 2G75B 2Y5EA 3ESUF 4M62L 5JPMC 4F40A 3TMQA 1FZJA 2GDQA 1SMOA 4Z2KA 4XBMA 3K13A 4JO3H 2R29H 4L1GA 2BHFA 4Z0BL 4O57A 2G3IA 3MLWL 4I88A 1CDIA 1SHSA 1MNZA 5DHVA 4EACA 1IE4A 2ZOLB 4XNMA 2VM4A 3T0DA 2CXEA 5JDSA 4L0YA 1Z0NA 1JDDA 5DRXA 4Z0BH 2HMCA 4YX2H 3SCMA 3P7YA 1L9PA 1F11B 2RDWA 1S2EA 2BHUA 4XN1A 5C09A 3MMUA 1C7SA 4GUFA 4JR5A 4DOHB 1KCBA 3WE1A 2B7PA 3BZFA 4XZIA 1SZFA 4MY9A 1DQVA 3KDPB 1H11A 4N2DA 4PVLA 3T2OA 2PBGA 1E30A 4GAYA 1ZHLA 1QA9A 3P11L 5KVDE 2Q8BL 1B3ZA 1Q7MA 2DUXA 4CNNA 2R4RL 4M56A 4BRJA 6ALDA 5EV7A 2OCJA 5DD3L 5SX5H 3WMBA 5CJ8A 4U1KA 4A55A 4F15C 1RA0A 1V93A 3FFOA 5M3WA 4BF7A 1EFXD 2PAJA 1TCMA 3M7FB 4TM9A 3EO9H 1WISA 4IDLA 3RTLA 2CGYA 3EYQC 3CNYA 3GR4A 4ZFOA 4PGEA 1C92A 4JFFE 5J04A 1JV2B 3QFGA 3VFTA 3OKLA 3RA7H 3U5YA 4KI5D 1UH4A 5D6CB 4GG6A 1V02E 1T1XB 5DVKA 4LRIC 3FYYA 4G6MH 4LAQH 5GGVL 5IB1A 1OOWA 2PWHA 2GJRA 3H2FA 3QORC 4XAPA 3GS7A 1OFPA 2EE0A 4Y6GA 3IEBA 4ZTEA 3PPHA 2CLLA 3TESA 2EUWA 3WIIH 1K8XA 3DX6B 4PFMA 2OS7A 2CO7A 2IPTL 5JZ7C 3MNZB 4BZ1H 1EXUB 1PKOA 3UXLA 1J8SA 1KB9K 3MRGB 2EH7L 1HKFA 1TZIB 1UWYA 2AJUL 5AW6B 3WFBH 5I6XC 4JN2B 4XXWA 3Q65A 5KSAC 3NNTA 2BRRL 1U3ZA 2WCPA 3G6JF 4NENB 4WF7A 4LAMA 5F7KC 2ZX9A 3GHEL 3LS5L 5FFGA 1R3RA 4BCEA 1XXFC 1DJGA 1BEYL 1WQ5A 2WP3T 3JS3A 5RUBA 4Y16D 1BQKA 4O1AA 1KFLA 2VLKE 4OGXH 5DC2A 3CGTA 4AQ1B 5IROD 5KVDL 1F41A 5D7IE 2VQTA 5FA4B 4TQ8A 3DGDA 3I6KB 4NT0A 2QDVA 3QO1B 4NJ9H 1M71A 3SDAB 3LTYA 1UP2A 3QV8A 4IMLA 4HU3A 2DY2A 4LHJB 3TA3C 1RL1A 1HIZA 3KJ6L 4OZHA 2YL5A 3HE6A 2I9TB 3CYJA 3A0OA 3MI6A 1LJYA 1RZGB 1R3HB 3ARGC 1ET8A 1S7VB 5IVXF 4Q7IA 1D5IH 3ISRA 3QJXA 2WLYA 5JQIB 5DJCA 3S4TA 3ENLA 4YSRA 1OIMA 5TQLA 2AJUH 2X88A 5KBNC 4ZQCA 4IP5A 4Q4MA 3O06A 3RWGA 4CLMA 4XBSA 2A83A 1QW9A 4HKXB 5DHYA 1IZJA 3VXRA 3RBGA 4RNIA 4QXTB 2J75A 4UTCA 5GS3A 4X83A 2G30A 3E8UL 1CD1B 1BX2A 2FPVA 1RK6A 4ADSA 1SOKA 5E94B 2WXRA 5H6HA 3QRGH 1VDGA 4J1UB 3GC5A 2AXGA 5CEWA 3QORB 4ZX5A 4JCMA 3ME3A 4LSRL 3EO9L 2GABA 2B39A 1QNQA 4HYRA 2WMHA 3BH4A 3N9KA 2BSSB 5KYUA 3GTTA 3CQFA 4DELA 3SCWA 5IY5B 1N3NA 1KGWA 1UJTA 4ATTA 4XP4L 2C3VB 4PVBA 1XF0A 3POHA 1TEGA 2X0YA 3LLDA 2MOQA 1A9EA 5DI8A 1OP5K 2AK4A 1IEAB 5KBDA 1WA3A 5MKGA 4ZS7L 2Z2AA 1MVFA 4ZB0A 4JANB 3U7AA 4EAEA 4LLUB 1P7QB 3JWNG 4F7PB 4HT3A 2IADB 1XZWA 4JQAA 2FJSA 2EE6A 2YB1A 3V95A 2B2XL 2Z91A 2FDBP 5FHAL 1OYAA 3TVMB 1S9VB 2WSPA 2ZJSH 1P7TA 3PG9A 4WUUB 5B7ZA 2GCYA 1PCWA 3DXAD 4PJHB 3HM7A 3NZHH 5I16B 1UBPC 1VESA 2R29A 4TNFA 1DQMH 3O3DB 4Z0SA 3VVGA 5JOPE 3IFOB 3ARBD 3R0KA 5F7NC 5EYWA 4GO9A 2PF8A 1XXXA 2BXZA 3GMMA 2BZCA 1NAKL 3HHMA 4U6YA 3S5ZA 4PUMA 1NKRA 3BP4B 4ODVL 3SN0A 5CP3H 3ETTA 2OX4A 3CDZA 5A6KA 4F7EB 1FVDB 4V1DA 4KK5C 1BAWA 5KINA 1NFAA 2IOIA 3EOAB 1BJ8A 4OLVL 1CFNA 3QSRA 2LHAA 4UQ3B 2NYYC 3QPXH 4JGDA 3WJXA 3K0YA 4OM1H 4EDXB 4IHOB 1MG2C 3Q5OA 4AVIA 1V10A 2EDMA 3D39E 4OM0H 4FEZA 4AY1A 4D0CA 1R3LB 3KPMB 4AVFA 3W5MA 3GX9A 3KTSA 3CPUA 3HLAA 1XPYA 4OFQA 4E2DA 5J5RA 1QUMA 4PUDA 2B4CL 3ZYZA 1E2VA 5LQBH 3O9WB 1JGDA 2OMWA 1O7AA 2VUOA 4IP4A 4ZMVA 3LRSA 3MA8A 1AA1B 1R9FA 5CPTA 5ERWB 2B7OA 4ATDA 1IGMH 3NH7L 3U2SB 1EFXB 3HG0A 4GJ1A 3WMSA 4GRWB 2DZEA 1HP5A 2Z1SA 3HPSA 4IGSA 3NN8A 5D8WA 2BOBA 4GG6F 5FEBA 3GU2A 1QWHA 2EXYC 1TMHA 2R1PA 4U7KA 3QWQB 4KJYB 2HLAA 5AHIA 1R46A 3SO7A 3IMRA 2OFJA 4Z1DA 3EX1A 5FIEA 3NZRA 4S3DA 1ZHBA 5J1AA 1A66A 4UB9A 2OQLA 4YSUA 3FUMA 5HDBF 2NZ1A 4UV4H 5TFSH 3RVUC 5MHSE 2PU1A 1F18A 4FHJA 3S5LA 1AKPA 5BUGA 4BKNA 2BMBA 3L3OA 1XLEA 4C7GA 1F1DA 3U0TA 1NUFA 4NQXB 5A2JH 2C1PA 4P3CL 4UWQB 3UWWA 1RJZA 4IIDA 3FFSA 1NCAH 3BPCA 3GO1H 4LLMA 4NC0B 3GVWA 5B1AB 3UJIL 3G04B 3KVLA 1G1CA 3NVQA 3R7MA 3PXHA 5E09A 2DWYA 4PJBE 4L1XA 5FKPA 2WYZA 4L9LB 4JK0D 5I1CL 3BLOA 5IMKA 1SFDA 4DJEC 2R0KL 3T0EC 2Y1AA 2CBTA 3LKRA 2UZIH 2RJGA 1S1RA 3GSVB 1ME8A 1SM9A 5H4ZA 2J8TA 4GQRA 1OM9A 2JV6A 4XBGA 2JKIS 3PQYB 3SQBB 1VPXA 1Z3GL 4YL9A 5DHYB 4QHMA 2H9AB 4JPIB 1J05A 1T7ZA 2VDPB 5I02A 3VGEA 1DBBL 4EP8C 2HTKC 1EJXC 4Y4HC 4RX0A 3S4SG 1TTIA 2JKNA 1Y5VA 4Q8OA 2KT6A 2Z31D 2EO7A 3O0LA 1UR3M 4AD1A 4U4BA 5C0AE 4APQC 4AXWB 1EFZA 2BOCA 3H3PL 1H5VA 2JKTM 3BLPX 1QSEB 4HJGA 3AVEA 4Z7UB 5TE4L 5FO8A 2OI9B 2ZKWA 3PM6A 4M5PA 3TN6A 3ZW3A 1ASOA 5DK3A 2FIKA 5G2HA 2G60L 4GXVH 2PWEA 4KMQA 5F1OB 2Y88A 4GVGA 4IFRA 5FAAA 3FYIB 1YMMA 1Y0LB 2DUZA 5C3LD 3QQ3A 2W61A 3RX3A 1DBML 3OHXB 2FUQA 4Y16C 3B3IB 4XNBA 4MZ1A 1RP8A 1FWEC 1EOMA 5HHXH 1A5LC 3ZXWA 4HK0B 1CGTA 5CZKA 5GGSA 5IMMA 3MHGA 1CYGA 3EUDA 1XF4A 3HR5B 4LSSL 5AL0A 2QDEA 3WNPA 2D8KA 3CUHA 4LSDA 2OZ8A 1MAMH 3HS0A 3AWOA 1JXDA 1NL0L 5BOJA 1ZTMA 5KN5A 1LE5B 5B3NA 3IJLA 3PV7A 3SOBL 1FV1B 2F7PA 1CYWA 1LDPH 4W8AA 2X9YA 2ZD0A 1P6BA 1XYLA 4LVOB 4V1DE 1BD2D 1SFJA 2FFIA 3PFMA 4XWGH 1SVDA 3UPMA 3KVKA 2P5ED 1VA9A 2OSXA 5E4EB 5EZOH 1NVMA 4M4RB 2C15A 2NSMA 5HNTA 1BW8A 3VW3L 1RV6X 5HGBB 1SUHA 2QCHA 2IDQA 2G4JA 5K9QI 3OZLA 2VEMA 4Y4FB 1AODA 4CQBA 4WSHA 2Z0IA 1Y1DA 4DLFA 3DVIA 4FL4C 5D32A 4AIXA 3VRJB 5FI8A 2HRPL 5INCB 3LYEA 5CKSA 1B4LA 1QOXA 3ZDXF 1GA2A 4AEIH 4ODHH 3L4VA 3NJNA 5I76A 1T0PB 4NIKB 5IFAH 2OOFA 4HA1A 5HDOA 2BY0A 4L5FH 3EH5B 3HE7B 7FABH 4I1PA 2CERA 4JDBA 4PWHA 5DJDA 5E6ID 1WNOA 4O19A 3CMGA 5AOMA 1HE8A 3LKSB 5BO1L 5BRZD 5T1JA 2OM5A 4OF0A 1G6RH 3QNXB 1I1WA 2QV5A 2V6AA 3WD5L 5KYXB 3N1GC 5FO9A 1E1FA 1UPPA 3AXIA 2VDMH 1H3WM 2FEJA 3V4UH 5HYJE 2VFDA 2CGRH 3UR5A 4HH9B 3C9NB 2EDDA 4M6PA 2PP3A 2GITB 5KN5B 1DWJM 1HJUA 2OR9L 3M9YA 3RPIB 1IGML 4JHVA 3SY0A 2DT0A 4Y2WA 4FXKA 2BASA 1BD2A 4URTB 1O7DC 1R19A 1MJJA 5C2UB 1X8CA 4FTVD 4HBCH 3WFDL 5I6XB 4DWHA 3MT1A 4RPQA 2BP1A 1IGYA 3BT2L 3JYBA 2C9AA 4EMZA 4UT6L 4L9ZA 2X6MA 4A38A 1EHNA 4PMUA 5C9JA 5FGSA 1VHNA 3IKKA 4WO4A 3H1ZA 4LC6A 4LVOC 2Y6SD 4X5WB 3BWSA 3VIFA 1I8MB 2E7LA 2OWWA 1UR4A 2N4IA 2FJFA 2VIRB 3PG8A 4DYKA 2Z4QA 3LB6C 2ROYA 4JVPA 3S36H 3OC5A 3CV6A 4GWEA 2WLLB 1OF0A 4B0MB 2H2PD 4EANA 5AC6A 3WHE0 3D18B 4PJ7B 4J1OA 1VPOL 4L8DA 4ZFCA 4WKFA 5I5RA 4NQVA 1JZ4A 1YKWA 4RE4A 4IXXA 4U3XA 1MW3A 3LU2A 2QDWA 1S5VA 4QE1A 3SCQA 3GXDA 2N1KA 1NP0A 4P5MA 3CJPA 4N0FA 2FK9A 4E9VA 4EXAA 2DQCH 1FZMA 4RFOH 1EYWA 2IDUA 3OPZL 1YN6B 3QXAA 4FI8A 4PMJA 4NZDA 3IN2A 1Z3NA 1I8AA 2PUQT 5IEKA 2WBWB 2JK2A 3TXZA 2BLFA 5A7EA 3LBMA 2FNWA 1AMXA 2WQUA 2XV3A 3ABSA 2NDFA 4MCYB 1G9HA 3A22A 4ML4A 3ZSSA 1CGWA 3WFZA 3WLTA 3S88L 3ICJA 5KYXA 3IDXH 1YPIA 3LVTA 1U5VA 1G9EA 3FKKA 1HXYA 5EUKB 3GXTA 2NLJA 1IC4L 2GC4C 2YKKA 4AL8L 2FB2A 3VM7A 1NPNA 4TSAH 4BI5A 4QDGA 3OVPA 3MNMA 3E1F1 3RN6A 2WXMA 4GZEA 3KM2A 4IX2A 3ZL2A 1IZKA 4JDTH 3ZLHA 3JTSA 3WMCA 3ITYA 1SRDA 5C0GB 1AHWC 1ZCRA 4OCRH 3RL2B 1MJUL 3HNVL 4JFOB 4X4XA 2WINA 5GGTL 3W9EB 4S0HA 2ZDSA 2VZOA 2R9RA 1QSFD 3QYNA 1IGJB 1WUNT 4OF3A 1CFTA 3VFPB 2I57A 2P8LA 2ZG2A 1N6QL 3U6XS 3UETA 4LLYB 4Z3JA 1P0KA 1G84A 3D0LA 3B9KC 2ZRXA 4JB9H 1UXSA 2E5CA 1H3GA 4UINH 5AYUL 3E0WA 3M8OL 3L17A 3ITVA 3TJEL 2Y3NA 3WQWA 2ZUNA 4EZLA 4XISA 3BIBX 1ODUA 4PRBB 3UZQA 3EG9A 1VF8A 1GTHA 5BV7C 4MFEA 1IB5A 3VI3F 4RGNE 5G4EA 4AEHH 1X4XA 5C0FA 5CC5A 3DI0A 1PY0A 3X3FH 1FFPB 1W3JA 1S7QA 3EOYG 4A37A 3NIYA 4JPWH 2PCYA 1XFCA 2VTFA 1JFHA 4I7ZC 1MQRA 5JW4N 4LASH 1R0AH 1JPFA 3DMMC 5LDUA 3QR3A 5GRUH 3PZUA 2ZX5A 1B5TA 3CG8A 5CILH 5CPOA 1HH9A 1P6CA 5INCA 1UIPA 2AP2A 2DB8A 1P1VA 2G5BA 5EORL 3H2WA 1QRNE 1CDUA 1TLMA 1I3RA 4HQQH 3TZVD 2PR9A 4JY9A 3CCHA 1GC1H 4X7TA 4KJPD 2J78A 4AXKA 4QHUB 3BKJL 3OF6A 1J7VR 4F7CB 4JLRA 4ROQA 2QVIA 5GJMA 1E28B 1JJKA 2AGKA 4E8GA 4HDIA 5H37A 5D1XC 3BL3A 4DAGH 3O8XC 3LHUA 4CD4A 1GH7A 4AZ7A 1E4WL 2VR3A 1PDYA 1KN2L 2OPCA 4X6CB 4YHPA 2VLLB 4YUEH 3P73A 3TT1L 1TQJA 1UWAA 1N0LB 2YSWA 3DH7A 4UFJA 3GRBA 4XTRD 1AKJA 3INUH 3QSKB 4FP8H 1WD9A 2N0MA 3V6OC 3APGA 4O0QA 4HUVB 2FH6A 2OSLB 2V63A 3SN1A 1MFDH 5DJYB 2X1SA 3DG3A 4DTGH 4WUUD 4IRJD 4WCYH 5DA0B 5IUSA 5ECUA 4YTSA 1WFOA 1QAPA 1ZE3H 5AZUA 4JG9A 4B9JA 1LBMA 4GYKA 2YXWA 1Q63A 1ZE3C 1NJJA 2CIKA 2A79A 3ZKXB 5DU7A 3H6JA 1YIXA 2H32B 2NPLX 3GZAA 3D7PA 1HXJA 3IDIB 1EC7A 5IBUB 5GHWL 3LLXA 1KFJA 3IWVA 1OE3A 4HV8A 4XXDB 2PDPA 3AIQA 2LU3A 1CDHA 1A6UH 4DPBX 1F90H 1KCXA 1FHNA 1AOHA 4RMRA 1FWDC 3GDTA 2YRPA 3O6FB 4OCLC 5F7AA 3QQWA 4BHUI 3WCZA 1JUFA 2DTML 4DN4L 1QFHA 2ARJQ 4JRYD 4P4RA 2JKPA 5FOOA 2OJ1A 4PTVA 2FQDA 3CVHH 2XBTA 4I6VA 2WW8A 2HUEA 4WKZA 4YUEL 2ITDA 4MXQD 3PUGA 4UTWC 1XGRA 1C9SA 5JPMA 4G1MA 2X4RB 2WTOA 4GBXB 2NTFB 4WLCA 3B0YA 1NELA 4BM7A 3B2VL 2JF1A 5GS2D 1SQ2N 1NZRA 1UM4H 3C6SA 3O6MH 1C9DA 1E9ZB 1TQXA 3ID7A 5AVHA 3DX9A 1WICA 3U1PA 1J2BA 1IEVA 4WWOA 2W88A 3O4LA 2ATMA 3NL6A 3P8JA 1B3XA 1P53A 2ZRUA 3CHXA 3VOCA 5F88A 4CNPA 2D7TH 2PP1A 2DYPD 1DQML 1FAIH 1EXGA 3EF4A 3GHBL 3SGDI 1ITQA 2VVSA 1QPKA 3VI4B 1YEJL 4WZ9A 2FT6A 5KVDH 3SCRA 3EH4B 1FCQA 2XH2A 1LE9A 1VACA 3AHTA 1YECL 4KIEA 4L8CB 3QUXB 1BQHB 1QRNA 3GHEH 3LS5H 3NZUA 1KWKA 3F6LA 1H63A 1W8SA 5C0DA 4XN9A 5EBLB 3KS0H 1KRMA 3P6LA 5E93A 3BD3A 3VO0A 4ZNEA 3CFUA 4QKTA 4XP5L 2NQ3A 2NZ9C 2VLJB 5F9OL 4GAGL 5GJNA 4XN5A 5IJVA 2AQ2A 4LCQA 4XPTH 3U0HA 4MXVE 3DI3B 5I5JA 4DK5A 4Y5XA 1K77A 1CK0H 3QK0A 4GJTB 2GBAA 4NPJA 4FOUA 1Q2RA 2JIXB 3I74A 1Z1WA 3QQXA 1JN6A 3EKCA 3HG1B 4UINL 1KC7A 3IXAA 2NQ9A 2WUCL 1U92B 1G6VK 3DJ9A 1AQKH 1RHFA 4IDJL 5ANHA 3TM6A 3K6DA 3HV9A 2O5ZH 1ZHNA 4JQIA 4K2UL 4KC3B 3HO8A 2QPUA 3WLQA 1OE1A 1C9WA 1HEZA 3V5DB 4G7RB 1U8HB 2WUCH 3GJFA 1JHTA 3EBHA 3L9BA 4XMPL 1TF4A 1SXNA 3D05A 2K6ZA 2JCWA 1RQEA 4AIZA 4AQOA 3B2DC 4OCRL 3PIQB 3B06A 3Q6GL 1Q6DA 3Q5TA 2OULB 2GGEA 3GBEA 4ADGA 3INPA 5HQLA 3QPQC 4ETQA 4M6MH 4LCWE 1LDSA 4RGOL 3ROLA 3VIKA 5A6MA 1FRGH 2D3NA 1M2VB 2JGYA 2RHEA 2YPVA 3JXAA 4ODXA 4GUIA 3VD5A 1NSNH 2NX5D 2GSGA 4PRHD 3N2TA 4LPTA 4L6HA 2A1WL 5FYKH 4NUGH 4WW2B 2I32A 4F0RA 1YECH 1WAAE 1HHHA 1IAOA 2IGLA 4JRXD 4ORGB 4PJGE 5TK2A 3ZDZF 4ANKA 4DGYH 1J5DA 3KBSA 1KJ3H 1RMFH 4U3CA 3DSFL 3HC4L 5F96L 4QDWA 4FR1A 4I2XE 4GO8A 4LHUG 3TU6A 1PQZB 2J6WA 3LPGA 4WFHE 3IDJB 3IJHB 1T0NA 2ZYIA 5FYLL 1DE4A 2ICWJ 5HYSB 3BK0A 3DHFA 3I6KA 3AU6A 3QFJD 5CU9A 5D70L 5F7DB 1XFBA 4IMAA 1QFOA 1F3EA 4APQD 4JR9L 4XBPA 1BF6A 3LKQB 3FN0L 5EO9B 3BVTA 3GWQA 2ZVRA 3O63A 5EUOB 4HPYL 3BJ91 4W9LC 4JY5L 2GAZB 3FRPB 3TCLA 4N3TA 2PDMA 4W9TA 5JO5A 4BZ1L 1VR6A 3WEMA 1CIDA 3IFLL 3NDYA 1RJYB 3OX8B 3ABQA 3N4AA 4IL0A 3FT3B 3L2IA 2F8VA 1A4JB 1FL5B 1NWSA 1AI1L 3Q2NA 3THQA 1UFGA 3QRHA 4UQEA 1A7NL 1FVCB 3B8IA 5FL0A 5HJ3B 4GABA 4KH2A 3CFCH 1BQGA 3D09A 3UJJL 1K3ZA 4L9LC 1UZ8A 5AZEH 4JYEA 3M86A 3QAZB 4UMGA 4W6YB 5F89B 4ENED 3VXSA 4KTYA 3DDGA 4LLMB 3VFNA 4MNLA 5F1VA 4P2OB 1BJ1J 2XN0A 4APQB 3V0IA 2ZOKA 3PLYA 1RZ7H 4O02L 5FCUH 3RLSA 5HBBA 2ASHA 1UEYA 3B4NA 5C0JA 3EWZA 4H83A 2O6DA 3CU1A 4IPNB 2DV6A 4HH8A 1CFQB 4CL7A 1FH8A 1VGKB 3D3VA 3BKCH 4MRCA 5FWQA 3PWLB 3IAGC 2E6AA 1N19A 4KRPB 4IIBA 3EYFB 4AL8H 4JY5H 4GUOA 4H88H 1G7MB 4FTVE 4PJBA 4TUUA 3OKDA 4CU8A 3TROA 4F33A 1KB5H 1WGOA 4UFHA 3EBIA 3KZPA 4HQVA 2CZFA 1KSRA 1BXBA 1AJ2A 3NQBA 3SZ8A 1AC0A 1M56B 3CZJA 3EJPA 3ZKMC 1H3TA 1AMYA 3RDJA 1FOBA 2Z24A 4B5TA 4Q6XA 1A4BA 1YEIH 4DNMA 4XZ9A 4Y8AA 4JM2C 2HT3C 4K68A 3L5XH 3ISIX 4B5ZA 5C2XA 1DPMA 3CVIL 5HPOA 1NBZA 4RZBA 1S7TB 3FNDA 3M64A 3ZLFA 4DJEA 2R29L 2UX7A 4PJ9A 4KRTA 3QJQB 5F96H 2MQ3A 4PMOA 4PGZA 3VSVA 2F8OA 4MHBA 5DXXA 4UFIA 1FZJB 1MFEL 1OEPA 3ZTCC 2EKSA 5TTRA 1JXGA 3W71A 1OWQA 5I5IA 4Q74A 1TV4A 3OYXA 4Z08A 1MIEH 5CJXC 1UATA 2PGRA 3DIPA 2CBOA 4N24A 5GZNA 4W4OC 1GJPA 4QTGA 1SLWA 4KKNA 5KANG 2X2HA 5K9CA 2ITCA 1O9ZA 3ONCA 3VXPB 2XSXA 2NX5A 2ZF8A 4PRHA 5FA4A 4A2HA 3TSMA 1XMEB 2G50A 1Z5YD 2ZZ3A 5FJJA 3IWUA 1OAQL 2QBWA 5IFJA 4CCEA 3TV3L 4M43L 2PTZA 3LB0A 2V7NB 3ZTNL 3N6HA 2DIAA 3WO3B 4DVRL 1S2TA 3UQNA 4HUCA 5HNUA 4HXBL 2N56A 1HQTA 1ED3B 5IIEA 4GRSA 2MOGA 3P60A 4V1XA 3Q13A 1QSEA 5AALA 4CSTA 1QI0A 2P53A 2YUVA 4GZ7A 4U1HB 1EB3A 5BRBA 4H4NA 3DC0A 3MNZA 3RAOA 4A1RA 1BEXA 1ODZA 2GIXA 3AJXA 5EWIL 5CSSA 1W1PA 4C58B 3FXGA 4PHZA 2VDML 2IXVA 5M94B 2YD5A 2PLMA 1CU4H 3PF2A 2RQ8A 3V6ZA 5F0JB 5CG7A 4NDMA 2UUDH 4FX7A 4N4PA 2ZYRA 3MCNA 4PJFB 2PA6A 2TODA 3SAZA 1P7BA 3WNOA 3TCEA 4YIQB 3PC0A 2OMXB 2FX7L 1SJEA 3GVRA 2CNCA 1SHWA 3U9IA 1ETA1 4MB1A 2FO1A 4LCIL 1TVBA 4BA0A 4X63A 3SJNA 4M1RA 3R5EA 4FJ6A