4X9YA

Wild-type human pancreatic alpha-amylase at true atomic resolution (1.07 a)
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Wild-Type Human Pancreatic Alpha-Amylase at True Atomic Resolution (1.07 A)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 177
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4x9yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4x9yA01
1I1WA 3WQ6A 1QNOA 1ISYA 1FA2A 4P8UA 4AIOA 4Q22A 2X09A 3CIVA 1R33A 4FMVA 1UKOA 1UR9A 4CCCA 1V3KA 1JXJA 1XSIA 1ZU8A 4HMCA 4C7GA 1JF5A 2XWEA 2WPGA 1FFQA 1QWNA 3ZT7A 4TOQA 3ALGA 3LPPA 2WWDA 3DDFA 2CBJA 4AZCA 3HG2A 4U31A 4IISA 3T2QA 4AY1A 2VRJA 4A3YA 2V5DA 4QP0A 4AZ5A 3DX3A 2A3HA 3K8MA 2BVTA 2VL4A 2WCAA 3LRMA 3OZPA 4CD7A 4HPGA 5A69A 1ESWA 2VCCA 3PZTA 4RL3A 3CPUA 3F5LA 1UA7A 1R34A 3N18A 2FE0A 2JEQA 1EDQA 3EJRA 1Q6DA 4OIFA 2JF7A 1AVAA 1Q6FA 4ZENA 2D0HA 3CO4A 3LMYA 1R47A 4P7QA 2ZE0A 3SUTA 1UKSA 5CXPA 4V28A 3WF0A 5JBDA 2W67A 1ISVA 2E3ZA 4OGZA 4Y7EA 2EXOA 2D2OA 1R86A 2ZUMA 3OLDA 1K9EA 2Y5EA 5A6MA 1UKQA 4NI3A 3PZOA 2NT0A 2HISA 4D6IA 4WJXA 1EHAA 3RDKA 1G5AA 3WEZA 3ZJ6A 4CD5A 3MS8A 2QPSA 1W2VA 2WMJA 4A4AA 3ZT5A 3RCNA 3LX9A 4XX6A 3BLPX 2BHZA 3BVTA 8A3HA 1GOWA 1K9DA 3W53A 4WK9A 1EQPA 1E5NA 1IZKA 3GXMA 2NT1A 1J12A 3THCA 3KZSA 3GXPA 1G9HA 3WBEA 3CZNA 2C7FA 4LQ1A 4HTYA 1VFUA 2FDMA 2XJ7A 5C71A 4HP5A 3EJTA 3VINA 3S5YA 1ISWA 3DX1A 1GZJA 3A3HA 1W1VA 4YHGA 4YPJA 1W9UA 5I2UA 2BXYA 1H4PA 3EYPA 5CJ5A 4IPLA 1EO7A 1WPCA 1DWGM 3D3AA 2WVUA 2UY2A 4KMQA 1NWUA 3CV5A 2WC4A 4CKQA 1JD7A 5HPCA 5CLWA 4JKMA 4TXEA 3WY2A 3M7SA 1OT1A 4XUYA 1TUXA 1LG2A 3MSDA 5C70A 2D23A 1QX1A 3IGUA 3GZAA 1JZ4A 2XVNA 1V02E 3VX0A 4MNJA 3T0AA 2F1AA 5JUVA 2WB5A 2UY4A 5FIPA 3DX0A 2D22A 3T2OA 2OSYA 3M6DA 1ITXA 1LWJA 1XH1A 2J77A 3AS0A 5GNYA 4UOQA 4FNRA 1H0IA 1WDQA 2G41A 2V3EA 1OIFA 2YFOA 3VGFA 3AICA 3DYOA 4D6GA 5DFAA 1WZMA 2O9OA 5D9OA 5A95A 4UFLA 3DYMA 4CD4A 1IZJA 1C7TA 2BVYA 5BROA 2VQTA 1E6ZA 7CGTA 1MQQA 3U7VA 1GW1A 1BVNP 1R46A 3TV8A 1O7DC 4ACYA 1FHLA 1NWTA 1VBRA 3MUY1 4PTMA 3D5HA 3RM9A 1JZ2A 3M07A 3WQWA 2D0FA 4H8HA 4CGTA 2E9LA 3IAQA 4ZXOA 3AXXA 2XGIA 3A21A 3TONA 4UCFA 5M3WA 1V6WA 4GI9A 1JZ3A 1HKIA 2EPOA 4CUCA 3VDCA 1E6RA 1KB3A 3KL5A 5FL1A 5I79A 1WO2A 2IXUA 3N9KA 1BFNA 3THDA 3AMDA 1NARA 5D9MA 3KL0A 5A3HA 1KFWA 1QNSA 1TA3B 4M29A 1JAEA 3U57A 3G6LA 2GJRA 2WMKA 3N11A 2NSXA 4PCTA 2XN0A 3PZUA 4L4OA 1I1XA 1J11A 3CUGA 3FW6A 1FHDA 9CGTA 1TFVA 1HJXA 2CETA 1UR2A 3JUGA 3KWXA 1QNRA 1VFOA 1CECA 3SUSA 2J75A 4FLQA 1ODZA 3BAYA 4DUWA 1GOMA 1JF6A 3ZJ7A 2V5CA 5DT7A 2G3NA 1PX8A 3WMBA 1W9VA 1JD9A 2OW7A 4KWUA 2VVNA 1VENA 3VNZA 4UFHA 3APGA 3CHEA 1KXQA 4P8WA 2UY3A 4H8VA 1VB9A 1DWIM 2WC3A 1E6NA 4GQQA 3D4ZA 5D4YA 4W8AA 3W24A 1FP9A 2DSZA 3GXNA 1JG9A 3K8KA 3WY3A 1W3LA 3LRKA 1UWUA 3NIYA 4FK9A 3VD9A 3W81A 1V3JA 2PF0A 1WZKA 5LYRA 3VMOA 1E43A 2QLYA 1EIBA 2VX7A 4OJYA 4TVDA 4UOJA 3CZEA 3T2PA 3WD2A 1CYGA 4NF7A 2Z1SA 3GXTA 4AZCB 2EEXA 1US3A 1QI0A 3PN8A 1RPKA 4FNQA 1G01A 1NWSA 4NRSA 3AQUA 2WKLA 3VIIA 3VTRA 1BG9A 1TQUA 4UFKA 5I78A 2WBGA 4K68A 3VILA 3WFZA 1UA3A 1VFMA 3DHPA 3FAXA 1KTCA 2CKSA 1C8YA 2D3LA 5AC5A 3WF1A 1KWGA 3S2CA 4OOUA 5E0CA 4JKKA 3CUJA 3O2LA 4LYRA 2DSKA 3VIOA 3ZMRA 5A6KA 2V3DA 4D6CA 1B3ZA 3WNMA 4J27A 3A23A 3KL3A 1UD6A 3TTQA 3CUIA 3VPLA 2WBKA 1E73M 1MQPA 3FNDA 3B9AA 1GQJA 1OD8A 1VEPA 3OBAA 4S3JA 3WD0A 1D7FA 1AMYA 3ZO9A 4PMOA 3GTNA 2VQUA 3GNOA 2BY1A 1BVZA 2WZHA 4H04A 4V2XA 1SMDA 1CTNA 2VC9A 3K1DA 2XFYA 1J0IA 3VM5A 2CITA 3PZGA 3ARWA 1M03A 4FNPA 4U5IA 4EK7A 1DP0A 1WZAA 1SR0A 1VEOA 3N04A 2J8FA 4V27A 1W3HA 3LXBA 4JFTA 2DGAA 4PMQA 4ZE4A 1BYCA 1H49A 2WMGA 2J7FA 4PN2A 2C0HA 3WMCA 1FH8A 2J47A 1K9TA 3MI6A 4M24A 3BLKA 1DWHM 1Q6EA 2DSUA 3EMZA 4J3SA 1MVYA 2J74A 1AQ0A 2YDQA 3A22A 1HNYA 3OLGA 3CZGA 1D3CA 4PMRA 3H54A 2WVTA 1W3JA 2GDVA 4Z2JA 4FLOA 1LL6A 4H8UA 1UWRA 2A3AA 3AS3A 4M80A 1JI2A 3B8SA 2PWEA 1PZ3A 2EJ1A 1HIZA 3A4XA 3ZSTA 3UR7A 2VX4A 2VI0A 2BV9A 1XHGA 3FHAA 4PUEA 2XHYA 3D50A 4OOZA 4PTVA 1EA9C 1JIBA 1GHSA 1WDPA 3GH7A 4AYSA 1H5VA 1JZ8A 3ECQA 3UG5A 2OYLA 3WY4A 5I24A 2ZX6A 1H41A 4ACZB 1M04A 3PZQA 4KRTA 2WMIA 1HJVA 4DWSA 3MUIA 5IHSA 3ALFA 4JZ5A 4W88A 3GBEA 2VO5A 3AXHA 4AEFA 3CLWA 4PRWA 4MDOA 1UH4A 2YBTA 1HVXA 4AZIA 3SCSA 1EH9A 2PWGA 4WLCA 1HKMA 3AROA 4OBSA 1E3XA 3F5KA 5E0FA 2JFEX 1LJYA 4AMCA 2ZICA 1B30A 1JAKA 3NSXA 2WHMA 1EHNA 5A8PA 4D6EA 4PMDA 5CSUA 3VDAA 1V3LA 1Y7VA 5A6LA 2VX5A 1US2A 1CXKA 5HPOA 3WNPA 5IFTA 4HOZA 5AYBA 1R8LA 1BYDA 5IHRA 5BXRA 3AOFA 1UR1A 1PBGA 2Y4SA 2F61A 4M1RA 2NW0A 2VJXA 1BPLB 2WK2A 3TTOA 1TR1A 1WCGA 4QLJA 2VNCA 3SCWA 3KE0A 2WSKA 4DO5A 3GH4A 3QGVA 1P6WA 2V3FA 4X9YA 4OUEA 1A3HA 1OCQA 4JCLA 5HNNA 2E8YA 1UWQA 1UWTA 1HTYA 2CBUA 3GDBA 2EBNA 2Y2WA 3BUBA 1Z32X 3GNRA 4FNTA 3FY1A 4PMNA 3CH9A 4Z2IA 1CNVA 4BCEA 2G3MA 4MJ2A 1UH2A 1PS3A 3CGTA 5ECUA 3J7HA 5BXSA 3D51A 1XC6A 3VUPA 3AMCA 4MJ4A 3BVVA 3VIKA 1HVQA 4EANA 2CPUA 3IANA 1OIMA 2D20A 2O92A 3WN6A 1BF2A 3OG2A 5JIPA 1C8QA 4RE2A 3WMSA 4AZGA 1G94A 3K4DA 3SUWA 4W93A 4F8XA 3ZJ8A 4EE9A 5DT5A 1HL8A 2WVSA 3O6AA 3RM8A 1UKPA 1MXDA 4UQEA 2W91A 4XZWA 5LA2A 4GO8A 3OB8A 4WKHA 4JHOA 2ZXQA 3GBDA 4MNLA 2VTFA 5JIWA 2ZX7A 2QF8A 1V0NA 1B2YA 2ZUSA 4WSKA 3WY1A 1E9LA 4AXNA 4JHZA 1EGZA 4W86A 1UQYA 3HN3A 3D4YA 4MB3A 2C8NA 2IXVA 1EDTA 2PWFA 3OGVA 4BQ3A 4HA1A 3CUFA 4AIEA 4E2OA 4ZFMA 2ZX8A 5CPQA 2F1BA 5DMYA 1A47A 3VGGA 3W0KA 5CGTA 5BWFA 3VSUA 4HMEA 3FXYA 3ZR5A 1E4LA 1HF6A 4TVUA 3AIBA 4D72A 1HL9A 4OKDA 1JDCA 1GOKA 2IGTA 1GHRA 3UG3A 5LA0A 1KGUA 2WKGA 2JE8A 1OSEA 2QMKA 1QBAA 1WNOA 2EABA 4AIUA 4DWSD 1PJ9A 2JIEA 2WVVA 2GFTA 3GH5A 1GQLA 4RE4A 2PB1A 4IPNB 4BQ4A 3LPFA 2ZX9A 3AI0A 4KH2A 1V3IA 1GJWA 1UWSA 1C93A 3WQVA 2E9MA 3BAKA 1QI5A 4MAZA 4CN6A 1V6XA 2OWXA 4PMUA 2J78A 1UD3A 3LXCA 3VNYA 3VDHA 2ALWA 3BH4A 5EFFA 4J3UA 2XSAA 3MMUA 2FHFA 2DQXA 4A3HA 1KGXA 5A6JA 2VZUA 3HZ3A 3BXWA 1DEDA 1YQ2A 3AIVA 4X0NA 1VF8A 1H11A 4HU0A 2XFFA 4W8BA 3AHXA 1HJQA 4FNSA 3SCUA 1QHOA 3EDEA 1C91A 5CZKA 2JF6A 1OWQA 3EDFA 3WENA 1Q6GA 1HP4A 3KLLA 4DO6A 1J0JA 4DWSC 1SFSA 2J7EA 2W5FA 2VZOA 3HU7A 1M7XA 1V0LA 2A3CA 2CYGA 1B9ZA 3U5UA 1CXLA 5CLTA 3QR3A 5A6BD 3ARTA 3CZKA 3VGBA 2VZTA 4P8VA 4DUXA 3UCQA 1FFRA 1QHZA 3HJEA 1ISXA 3PTMA 1XCWA 2VURA 4QLKA 3K4AA 2GVYA 1SYTA 1R87A 2E0PA 1PAMA 3OZOA 7TAAA 5FKYA 4IM4A 1BYBA 1DWFM 1VFFA 1NOWA 3VU2A 1V08A 1E15A 3VSVA 1GQIA 1EOKA 1W1TA 4U3AA 4AYGA 2ESCA 3WIJA 2J79A 4LYPA 3NUKA 4QLLA 4PMVA 1QI3A 5ABGA 4GQRA 4C7DA 2V38A 2WLZA 1PEZA 1KQYA 1MXGA 3TOPA 1BGGA 4NXKA 4JCMA 4TTGA 3O9NA 4CU8A 4ML4A 3LXAA 1ZJAA 5HBFA 1IV8A 1U2YA 5ABEA 1UG6A 1UR8A 2JEPA 2WM0A 3CBWA 3HG3A 3ARPA 1XCXA 3NDZA 1B0IA 3BSGA 3MV01 5A2BA 1JYVA 4UFIA 5GQBA 2J62A 4PEEA 4JL1A 4XB3A 2PBGA 4D71A 5A8NA 6A3HA 5A6SA 1V6UA 1BYAA 1SMAA 1UWIA 4HMDA 3PZMA 2BVDA 2ZXBA 1MQRA 3L4UA 2WMHA 2VRQA 3VKKA 1JNEA 1QNPA 2YLAA 4EAMA 4ATLA 3W25A 3UR8A 3ARQA 3OGSA 4P7LA 1RP9A 1U30A 5KEZA 1UD2A 1UD5A 3N15A 4L4PA 1QI2A 3PZ9A 5A6BA 4WF7A 1E1EA 1KCLA 2J4GA 4U3CA 2GJPA 3W6MA 1BTCA 3VSTA 1OT2A 2OLHA 2UY5A 2F7OA 3WUGA 2PWHA 1V6YA 3U7BA 1NQ6A 5IFPA 2AOSA 2ZUUA 5F7UA 1DWAM 3T08A 1HXJA 3GXFA 3AMKA 2XYLA 4TVCA 1OGBA 1T0OA 3WDHA 4AD2A 4FLRA 2YA2A 4BA0A 1UZ4A 1ZJBA 1C3FA 1VJZA 1UH3A 3WNOA 1TVNA 2YL8A 3AIRA 4RE3A 5I0DA 3SCQA 3L4WA 3VIFA 1JDAA 3BVWA 1ZL1A 1VBUA 4MTVA 2DT1A 5FD0A 3BAWA 3VGHA 4NX0A 2GJXB 1KQZA 1XYFA 1BGAA 1ZBCA 1JXKA 3ARXA 5D9NA 1JDDA 2G8ZA 2OYMA 1KXVA 5DF0A 3I3BA 3DX2A 2W63A 1H2JA 4CN4A 3WH6A 1TZ7A 4GZEA 1C7SA 2CESA 2PWDA 1H0GA 1FOBA 2ZUTA 4H41A 4QFUA 3TA9A 5HDRA 4CD8A 2F7RA 3SUUA 1WDRA 4U5KA 4B15A 1W91A 4WKAA 2Y24A 4LPCA 2CBVA 3DC0A 4HPHA 1XD0A 3VGEA 1DTUA 2XFRA 2XM1A 3AJ7A 3WEOA 2YBUA 2D3NA 4H7VA 1V3HA 1JZ6A 1FP8A 3DDGA 1TE1A 3L4YA 3OLEA 1CPUA 4UQAA 4W8LA 3SCPA 4D1JA 1QPKA 1JYXA 2VMFA 5BYWA 4PSPA 1JNDA 4AMWA 3HMCA 3WNKA 1UUQA 1I75A 4P7NA 4AD0A 5A8MA 3A4WA 2EPNA 3WH7A 5E6ZA 3AYSA 1QOXA 2WWCA 2ZX5A 3WNLA 5I23A 3AIEA 3VD7A 2WSPA 1Q6CA 1OD0A 3PZNA 4W7WA 3LPGA 3VIGA 3A4AA 4BZYA 3F5JA 3VD5A 1XH0A 2X8RA 2EACA 3FHQA 3BUIA 1CEOA 3WQ4A 4DO4A 3WF2A 3WH8A 1YHTA 4UZSA 1TQWA 2WC7A 1BHGA 4KRUA 1WDSA 2YLLA 3N12A 1UQZA 5LA1A 4AEEA 1S46A 2YDSA 3K8LA 4GO9A 5E1QA 1LQ0A 1E0WA 2VOTA 1R7OA 2WXDM 1E55A 2W61A 1E4MM 1KXTA 3EJPA 2PC8A 3BUDA 4MDPA 2EQDA 5D8WA 2XSBA 5D8ZA 4NZFA 2BXZA 1MFVA 1UR0A 3VIJA 4PTXA 5IXEA 1ZBVA 4M56A 2G3IA 3BMVA 3W27A 3VD4A 3WDJA 3TP4A 2YJQA 5AY7A 4GI6A 3AZRA 1J10A 1UYQA 3MU7A 1PZ2A 2D73A 2E9BA 3W26A 3BMWA 2MANA 2AAAA 4UZUA 4PMXA 3POHA 4AMXA 2X1IA 1PPIA 1GORA 1ZBWA 2WMIB 3I3DA 1B3VA 1M53A 1CGTA 1LL4A 4NXSA 1H09A 3AFBA 3UESA 3NDYA 4D6JA 2B31A 1J18A 1MW2A 4J3WA 3PBGA 2ZXAA 2RGLA 4U2YA 4P7OA 3WDIA 4KGLA 1U33A 3WDRA 2YA1A 3UERA 4ZXLA 3GYCA 5A94A 1KTBA 1GPFA 4MNKA 4E4PA 7A3HA 3PZIA 3BVXA 4TX8A 2XM2A 1RP8A 1ISZA 3RIKA 3SURA 3A6OA 2J25A 2D24A 3CZLA 1B3YA 2CIPA 5FL0A 1E4IA 3NJ3A 2YL5A 3OLIA 1MYRA 1OGSA 1UOKA 3WD4A 5CSYA 3G6MA 4UQBA 3VIPA 4JIEA 2VR5A 2WHJA 2GSJA 2G3JA 1JI1A 1L8NA 4IUGA 1R75A 4UTFA 4U2ZA 1KR0A 1KBBA 1HJSA 2F18A 2X2YA 3CTTA 3EJQA 3VIHA 2YA0A 4JFWA 1GVIA 1E5JA 1W9DM 4D6DA 1M01A 3WF4A 4UQDA 3WL1A 3WEMA 4UFJA 3CMGA 2J7HA 5A1AA 1PX4A 3WF3A 4QCFA 2F2HA 1CDGA 4M8UA 5EBAA 2FGLA 1KR1A 2XG9A 3ZIZA 4BS0A 1CGWA 3IJ9A 4U33A 3W37A 1PIFA 3BAJA 3OGRA 3ZOAA 2YFNA 1UZ1A 4OZOA 1VEMA 3EBVA 2DH2A 4GI8A 3SCTA 2CHOA 1FH7A 3L4VA 3NCOA 4MAVA 5ABFB 1JFXA 4PBGA 1B3XA 1XRVA 3IAPA 1ECEA 3KLKA 4AZBA 3BVUA 2QPUA 1VRXA 2QMJA 3N1AA 1CLVA 1O7AA 4ACZA 4H2CA 3BCFA 3EDDA 3MUZ1 5A2CA 2CKRA 2XVGA 3BUQA 4D6FA 3EDKA 3MKKA 3PTQA 2CERA 2VZSA 1DWJM 3S6TA 4N0RA 2BHYA 1MW1A 1UHVA 1C8XA 1CXHA 5I3DA 1HN1A 4W5UA 3ZM8A 3VDBA 1CGXA 3CZJA 2XN2A 3AIUA 3AZTA 1TQSA 4CD6A 1QW9A 4NRRA 5FOOA 1LF1A 4X0VA 4CU7A 1XYZA 2ZUNA 1MFUA 1FH9A 4W89A 3GXIA 1UKTA 3CHFA 3B9EA 3PZVA 3VM7A 1WP6A 5AYIA 3RO8A 5A6AA 1ZB5A 1JYNA 3HG5A 4AISA 3AHZA 4J28A 2XVPA 4ZEPA 1H1NA 4GZIA 1CZ1A 1TCMA 2CBIA 2GJXA 2F7PA 5GPRA 3II1A 5A8OA 1CXIA 1J0HA 3MV11 1F4HA 3RPMA 4D1IA 4MNMA 1CLXA 1G1YA 4MB5A 4PTWA 3AHVA 3AYRA 2FGZA 4JFSA 2OWWA 2BHUA 2WCSA 4ATDA 3MSGA 2VVSA 1J0ZA 5D9PA 3H53A 4YHEA 1UR4A 4LYQA 2O9TA 1CGUA 1CBGA 2CCRA 4HZ6A 1OGGA 1HT6A 3QHMA 3TTSA 3WNNA 2WVVB 2V3GA 4XV0A 3ARUA 4AW7A 1O6IA 1Q4NX 5GNXA 2EAEA 1EDGA 4MB1A 5EMYA 4GZJA 3L2MA 1W9PA 4YN5A 2OSXA 4R27A 6TAAA 2EADA 1GOQA 1PX3A 4FF5A 2VZVA 4HA4A 3WDQA 1LLOA 4Z2LA 2J7BA 3A24A 4B3KA 4LGXA 3WUFA 1E72M 2WCGA 4M82A 3VGDA 2RGMA 3POCA 4CCDA 1V0MA 1XGZA 4F9JA 2DDXA 1B31A 1NP0A 3QHOA 1TQTA 3HG4A 3WDPP 3CHDA 4Z2GA 3ARZA 4NSBA 3ZR6A 3ZT6A 4CVUA 3AS2A 3CHCA 4MB4A 1KCKA 3MMWA 4AD5A 1E3ZA 2WHLA 3BSHA 1E6QM 1NH6A 5IDIA 4AWEA 2ZWZA 1N82A 3L4ZA 1J0KA 3IJ7A 1E4NA 4ATWA 1CIUA 4BQ2A 5CGMA 5FCZA 4W84A 1TA3A 3ARSA 3VMPA 3BGAA 4B9YA 3T09A 3BAIA 2BNJA 1UD8A 5BCAA 8CGTA 1X6LA 1E71M 2YIHA 1HWWA 1C90A 2WMFA 3TTYA 2ZUVA 4QDMA 2VCAA 1GQKA 2VRKA 4LXFA 3EJSA 5BXPA 2XGBA 1XSJA 1E6XM 4F66A 2D0GA 1J9YA 4HZ7A 1ZBKA 2J7GA 5M17A 3FAWA 2G4FA 2X0YA 3EMCA 3WBAA 4AD4A 3VVGA 2E8ZA 5C8BB 3AXIA 5BRQA 1GJUA 1X1NA 5EB8A 3W6LA 5CQ1A 2QHAA 3UEQA 2W92A 3WKZA 2VUYA 3QOKA 2W4XA 1VJSA 3AIQA 3CZSA 1HX0A 3M46A 1WAWA 5M5DA 3F4VA 1VIWA 3U5YA 1AQHA 1V03A 4GINA 3ZQ9A 4W5ZA 1NP2A 3LRLA 3N17A 2FH6A 2EPLX 4JAWA 2Z1KA 4GXPA 2DIEA 1E6PA 2OW6A 2TAAA 2E40A 2J7CA 3L4TA 1HJWA 4W85A 3EJUA 4HOWA 4MPKA 4PMYA 1HP5A 3SIMA 1DHKA 3VIMA 3LPOA 3W29A 1TQVA 1V02A 3VOCA 3N13A 3W4RA 4HOXA 3WH9A 1EXPA 1QVBA 1TVPA 3BUPA 3WQ5A 3SCRA 4UR9A 2WZIA 1LL7A 2J7DA 5CPTA 3L2LA 1TMQA 1NWRA 3GM8A 4Q7NA 1HJUA 2DEPA 4OBRA 1OINA 1GVYA 2ZUWA 4FLSA 4AZHA 1GCYA 1B1YA 1NOUA 3ARVA 3AHYA 3AHTA 1QBBA 1XD1A 2X2HA 1J0YA 3OIHA 3MUAA 2BS9A 5E70A 3WQ8A 2IUZA 1QWUA 3RJXA 1KXHA 1GOIA 3MO4A 4BF7A 4CVWA 3W82A 1B90A 3FN9A 1K9FA 4P8XA 1MW0A 5TD4A 1JL8A 4E8DA 4PSRA 2ZXDA 1CGVA 2FH8A 3S5ZA 4W87A 2CNCA 4J3XA 4GKLA 4QAWA 4EKJA 2D1ZA 1B3WA 3BC9A 3BCDA 3T0BA 1V0KA 1WB0A 4Z2KA 3DYPA 4R5EA 1D2KA 1K6AA 3D52A 1E40A 4KGJA 4AD1A 1BG4A 4DM1A 2WLYA 1E0VA 1EO5A 2WYSA 3GXDA 1L0PA 3DHUA 3ARYA 4J7RA 4AD3A 1W1YA 4BQ5A 1MW3A 5E9AA 3I3EA 4JFVA 3GNPA 4PMZA 3OA5A 2WZEA 4E8CA 1EOMA 2DT2A 2O9PA 5I6SA 2Y8VA 2GK1B 5GNZA 1JFHA 1CGYA 1EQCA 3DECA 5HXMA 3WD1A 6CGTA 3VO0A 2YL6A 3IJ8A 1J01A 1E6SM 2DPEA 4J3TA 3UG4A 2XTKA 3SCOA 4LX4A 4W7UA 3IK2A 4AZ7A 2JIWA 1KGWA 1E1FA 2XUCA 3UETA 3A47A 1LG1A 1BSIA 1VAHA 2BFGA 1BAGA 4UFMA 3NYDA 2O9RA 4DWSB 1CWYA 1WKYA 3WUEA 1RH9A 1AQMA 2OWCA 3AMLA 2Q8XA 2VX6A 4DUVA 3RILA 2YKKA 2X0HA 1KWKA 3EDJA 4UOZA 2UWFA 1GNXA 4F79A 1JYWA 2F7QA 3NSMA 4AZ6A 4HZ8A 4TUFA 5BRPA 2DSWA 4W7VA 1QHPA 2XIBA 2BY0A 4PYSA 2BY2A 3T0DA 1F4AA 3WFLA 1G0CA 2QV4A 1IT0A 3W28A 3AS1A 1JZ7A 2DSVA 4QCEA 3SCNA 4P7RA 1W32A 1MWOA 3QHNA 3CMJA 3K46A 4PUDA 5JBEA 2ZIDA 4NZJA 4WSJA 2X05A 3AIWA 1TG7A 4FNUA 4TTUA 2GUYA 3ZJKA 3AMGA 1ODUA 5HOSA 1V6VA 2CHNA 2FYVA 4JFUA 2W66A 3CUHA 4HU8A 2PI6A 1XSKA 2DT0A 4AC1X 2WHKA 2WAGA 2YL9A 1CXEA 2YDRA 4ZE5A 2FHBA 2GDUA 1LWHA 1E70M 4S3KA 4C7FA 1HKKA 4B3LA 2WANA 5E09A 2CXGA 4D6HA 1SZNA 1JGIA 1OBAA 1QI4A 1W1PA 4B9ZA 1W2PA 1NM9A 5I77A 2EPKX 3EMQA 4F9DA 2XPKA 4J3VA 2DH3A 2VCBA 1CENA 1RD6A 3SEPA 4N42A 4TX6A 2VT0A 3H55A 3SCVA 5EFDA 4XZBA 2DT3A 1WE5A 3W38A 1R85A 3PTKA 2GK1A 4JL2A 3WH5A 5A8QA 4NZCA 3WUBA 4JKLA 4UQ9A 4PCSA 1ITCA 2A3EA 5I5RA 2X2IA 2J8GA 1ZS2A 4B16A 3A5VA 5AC4A 5CPSA 3QOMA 5JBFA 1BQCA 1OM0A 3AISA 2F8QA 3WELA 2XIIA 3BLBA 1HKJA 1GUVA 1JZ5A 2EPMX 2XWDA 1PIGA 2E4TA 2VR4A 2W62A 2JALA 4GPNA 3MMDA 4UQCA 5KZ6A 3BAXA 1CXFA 1WZLA 1QNQA 2YOCA 1W9BM 2HVMA 3KEHA 3CC1A 1E0XA 5E6YA 3VX1A 1XH2A 4UNIA 5M03A 1HXKA 2WNWA 1V3MA 1BLIA 3RJYA 5ABHA 1GOOA 3AZSA 2A3BA 1OB0A 2WW5A 1H3GA 2AMGA 3MANA 5DEZA 4CU6A 3VD3A 1QW8A 3SUVA 2CEQA 2DIJA 4MADA 4CCEA 5CG0A 1XV8A 3RM4A 3L4XA 3NSNA 3DX4A 1UD4A 3CZ8A 3PHAA 4M81A 2ZWYA 3E1F1 2PBOA 2OSWA 1E56A 3ZSSA 3WL0A 4Z2HA 3WSUA 4WKFA 5DO8A 5ABFA 1R7AA 1C92A 2XVKA 5A2AA 4GIAA 1GONA 1NOFA 1W3KA 4WIWA 5BXTA 1UASA 3ARRA 2XVLA 1X6NA 3VMNA 2BY3A 2OYKA 4CN1A 2ZOXA 2EO7A 2Y8KA 4URIA 3WD3A 4DM2A 2FHCA 2XN1A 1KBKA 2X2JA 4HA3A 3B9DA 1W9XA 3RMEA
chains in the Genus database with same CATH superfamily
3TQ0A 3LQAC 8XIAA 5L7XH 3SQOL 4AIOA 4N2HA 5JHDB 1HG3A 4R0LB 3GE7A 2EILB 3BO8B 1XBZA 2AXFB 3QMTA 2J1KA 3RGBA 5D1ZC 3FOLA 3TH2T 2XFWA 4PJIB 4EPSA 4Y89A 2HXAA 4I1PA 1UR9A 5AYZA 4CCCA 2PN5A 4HMCA 1S7UB 4M7LH 2QKIC 4YHPB 3VXQA 1O60A 2OO0A 4OZIA 4J3ZA 3RFZA 1QWNA 3O4LA 5AVHA 4ADTA 3QNZA 4PJ9B 4UDTB 3PGDA 2PDMA 2OI9B 3L9BA 5KVMC 1DV7A 2WWDA 4I5UA 2W27A 3DTDA 3LN9A 2Z92B 4D2NA 3H4WA 1VZGA 2J2ZA 4U31A 4J2PA 4N9CA 4C6MA 3UH8A 1T4KA 4IKKA 1LBFA 4BGDA 4PFMA 4R2GB 4A3YA 3GTXA 4QP0A 3FULA 3DX3A 3STLA 2A3HA 4NP7A 4AZ5A 4FE9A 2VGLM 2HVNA 1UWGL 1BM3L 4HD5A 5HYEA 3ME0B 2WCAA 1GC1C 1JRHH 4CD7A 5T3XL 1SXNA 3VFTA 2P3YA 3QDMD 5A69A 1S6NA 2NTSP 3SCMD 5BWAA 2GPTA 2VCCA 2ORBL 1PHQA 3DRTA 1IARB 5F6IB 3PJSA 1EHLH 1MJ8H 3S2JA 4Q2ZA 4KRPB 4N8CH 2P5WA 4QXIA 4FXSA 3GJEA 1Q6DA 4OIFA 4OUUA 1LTDA 1Q6FA 4ZMWA 4RZ5A 2WQSA 3CO4A 2WW8A 4J8RA 4JQ4A 3LMYA 5I2IB 5CP3H 2H8ZA 3HS0C 4FRWA 5BUPA 4MZ3A 1NGPH 5JIHA 4JVPA 4HHLA 5I3JA 4ANKA 5DDHA 2Y63A 4KEZA 3QSRA 3IDYC 3DVGA 3G6JB 1SDDA 1ZSDB 5DJ2A 1QSED 4JTTA 3VXUE 5JBDA 2E56A 4OGZA 2OZ8A 1B3OA 4HNLA 4LAOA 2Y0SA 1OM9A 2W9DL 4Y5VB 2D2OA 3N42F 5AOJA 3QRLA 4XPTL 4QRQB 1K9EA 2QV5A 3DMMC 5IT2L 4R26H 2A9BA 1UKQA 4FFZH 3PZOA 4BIKA 2PWUA 2NT0A 3OEXA 1OG6A 4WJXA 1HYRC 1G5AA 2XFXB 5HUPA 1A6VL 4NZDA 4X5XB 5F7EH 2QPSA 1W2VA 3MS8A 3VFOB 4Y9FA 2HFGL 1ZGLM 3FOLB 4KZCA 3NQ2A 4U28A 4HJIA 2X4NA 5JXQA 3WQPA 5C92A 1XAKA 2RQEA 4LAQL 3RCNA 3LX9A 1J8HB 5TH2B 1XBVA 3UBXB 4JY8A 3ES8A 4UTBL 3OR7B 1GOWA 1M3IA 4H8WC 5JA9A 1TIWA 3JV0A 4HUXA 4I48B 5ESAA 2R0KH 4HZ7A 3VE9A 4XNUH 1EQPA 4I1NB 4MNGA 1WFJA 3IKCB 1ZRQA 4LKCA 1RY0A 1R3TA 3RIFF 1JGUH 2NT1A 3KP1A 1OX6A 5A6JA 3THCA 3NIGE 1V5XA 3GXPA 2POTA 1G9HA 5INDB 1YN6B 4DP6X 3WBEA 2WV8A 5ESQA 3CZNA 4P5TB 1EWEA 3M6YA 2V7NB 4HTYA 2NY5H 4C4UA 4LBAA 4ZMGA 2A74A 2FDMA 5LJYH 1QXLA 2I56A 1EV2E 2VDOB 1FORH 4GZ7A 1T2QH 4WUKL 1YN7B 3IMUA 4W68A 3VE0A 3VJ6B 2BDNH 2KQNA 3EJTA 3UP6A 3UPAA 1XEUA 1YEDA 2JB6A 3UCRA 1ISWA 1FHUA 3W2UA 1C12B 2QSCH 1EO8H 3IMRA 3A3HA 1SHMA 3KCPA 2K45A 3QAZC 4JO1L 4BQBA 1LO5A 1W1VA 1FO0A 2X40A 4YPJA 1DFXA 2BXYA 2FWOA 3EYPA 5I2UA 2E6JA 3SGJA 2EE2A 3S1WA 1NTHA 5H2BA 3NCMA 2J1ZA 4OI8A 4K6AA 1NWUA 1JDEA 2ITEA 1IX2A 1BAFH 1I6NA 3NPUA 5EZJA 5AFDA 5K9KA 1OJXA 1YXCA 3CV5A 1LBLA 2GTZA 4GCXA 5E24E 4PCNA 3EYQD 4BDVB 2XPYA 3HB3C 5D7JD 3ZL4H 2F54A 3QQ9C 4AXKA 1G9MC 1RXOB 4WCJA 4XUYA 4PMFA 1FXQA 2EPHA 4D0CB 1W16A 5F88A 1TUXA 1DANU 1VCGA 4PJ7F 2QXWA 1RQHA 3VWKC 3MSDA 5F71A 1QX1A 3PAJA 4TNWF 2JJVA 2VM4A 5DRXA 1JZ4A 5DCEA 5I3KA 4R2GD 3BZ5A 1FNHA 1A65A 4CDHA 3ULAB 2XNAA 1U3JA 1J86A 1V02E 2ITDB 3SRHA 5EBMA 3SDCD 1IGWA 2DV6A 3H4XA 3N9RA 1HS6A 2IOIA 1FWEC 1EJOL 2O7QA 5BOFA 3GHEH 4YXHL 2X6CA 4N90D 3KYAA 4P49A 2VXSH 4PY7B 3STGA 2I27N 5I09A 3GDCA 4HJ0C 1PDKB 4Q0XH 3BKJL 5A3ID 4UIKH 1GZ1A 1UJQA 1HIML 2D22A 4DN1A 4JM2C 1QMLA 2PF8A 3WL9A 5HY9A 1KFKA 5KYYA 4NNPH 2OSYA 1RZ8A 3M6DA 1LWJA 3WGUB 1ZLSH 3R12A 3RN6A 4AMAA 1YNTB 4WJG3 5K9OA 2F6KA 2R0LH 3FUHA 1MHPL 2XICA 2QSTA 3CZUB 4ALDA 1ROWA 4MYWB 2P5WE 4ABQA 4K7FA 3KZ8A 2CLEA 3F7VB 3LKSB 4OJEH 3IVUA 4U1KA 3N5AA 2DBLH 3AWGA 2YFOA 2BW4A 3DYOA 1PTAA 3AZUA 3MBWA 5J6HA 2TMDA 1WZMA 3IU3A 3QORC 4KPHL 4YEEA 2VH5L 5GIRB 5GJTL 2OO6A 1FZOB 4QHRA 3ISYA 3GIYA 1GEHA 3SN1A 4H9VA 1MAKA 4P3CL 2VR2A 4X8GA 3I02B 4UAHA 5BROA 3EYSL 3ZIYA 4WK2B 3N25A 5KBMA 1T6WA 1E6ZA 2XG4B 4LBUA 4B3VA 1JJUA 1QO3B 1RQEA 3Q5YA 1DBAL 3ZTNH 4L1XA 4PFHA 1E5UI 5DS8B 4ACYA 2OMYA 7TIMA 3IVKA 1DANT 3P02A 2E59A 4MNQA 5CFAA 4O12A 2WBWB 4LDLB 4OB5H 1VBRA 5H94B 5KTLA 1TPXB 1PJWA 1HCYA 1A7QH 2NY0B 3D5HA 4PTMA 4R2GC 5DZLA 1XYBA 3QQ1A 3M07A 4XN4A 3R25A 4H8HA 4JFOB 2FVLA 3TONA 1Y0LA 4HPJA 3EFOB 3K6DA 3HE7A 4GI9A 4PJBA 2AI0H 2BDQA 1KJ3L 1OK4A 1A6UL 4MLRA 1TTCA 2HVKA 4PRNA 4F7KA 4E0RA 3RXZA 1EZ2A 1A3RH 2ACSA 1NCCL 2XQBL 5ABDE 3P9LB 2QJHA 1Q5MA 3AYTA 1TTUA 2ZXGA 5FW8A 1JRCA 4K55A 3A64A 3K6SA 3KL5A 1IEHA 1EXUA 4L29A 5I79A 1IGCL 3T8VA 4NI8A 2XZZA 2IXUA 3UW6A 3QBTB 3WTWA 2AFNA 3ZKXB 5D8JL 1MHHB 4ANUA 2WJZA 3FCTA 4AMKH 4N1HB 5EBMB 3FT4B 3ABGA 3FLUA 2EEFA 3KL0A 3GG7A 4OF3A 2ITFA 1LDSA 3IGAB 5A3HA 3BGMA 3LEXB 4I0PB 2CGYA 1QNSA 3W07A 5C97A 1RSYA 3DJTA 4IU3A 2YSSA 4M29A 5ACZB 4HUKB 1TA3B 3PXHA 3WLTA 3U57A 2WMKA 1UOVA 1YMHA 1WFUA 3IU4H 1KJ3H 2NSXA 3BTNA 3T44A 2XN0A 1J1OL 1F3RB 1LEKB 1UM5H 1XF0A 3A67L 3E02A 3QSTA 5K33A 1PSCA 4GAYB 4GXVL 1BYNA 1X5XA 4IBZA 2L7QA 4Z42C 1Y6NR 4G80A 5MP6H 4AITA 1QJWA 2KDYA 1BZ9A 5DQPA 3KLQA 4DP8X 5JIMA 1FZOA 3MZTA 1N26A 2R6OA 1REQA 5BZDA 5E1IA 9CGTA 5U4NA 4KV5E 3UTSA 2C3XA 2RFXB 1TFVA 5F7FA 4UMGA 3CUZA 3JUGA 1K3IA 4RAUA 1CECA 4UXDA 1ODZA 5IKCB 4O57A 4JYDA 3EXJA 3SE6A 4Z7IA 1GOMA 1QW7A 3HPFA 3GSUB 1GWJA 1UWYA 1CE6B 2YD8A 3JTBA 1J2WA 4DEUA 4ZR8A 1MCOL 5IM51 4TRPH 3MUGB 1WD9A 2RB8A 3DBXA 1S3RA 3BPLC 5D2NB 1FWXA 4F58L 1DORA 1SY6A 2QDEA 4Q6JA 2YW4A 3WMBA 1KPVB 2YUZA 5C07E 3HRPA 1EFZA 2I9EA 1Q9KA 4W4OA 2XRAL 2OW7A 4UT7L 2PC4A 2X0UA 3NO5A 5BVPL 2VVNA 3VNZA 3B8WA 1I1YB 3VGAC 1QPNA 4UFHA 1DSFL 1UOLA 5IBTL 3VXUA 3APGA 3V0TA 4EPEC 1CB4A 2O5XH 3F8UB 4XR8C 1HXMA 4LOUC 5FO8B 1PZSA 3ULVL 2OZTA 3R94A 4YDZA 3TQPA 1WWCA 3QXDA 3QIWC 3FN0L 3O8XA 5HWMA 4ZA0A 2UY3A 3VRJA 1T8XA 2JKRM 3HG1B 4Q8BA 2GK2A 2WC3A 1CD1A 1SW7A 1OABA 5A43C 4P5TA 3FT0A 3HLAB 5C08A 3ABXA 3CJPA 4FG2A 4JQXA 4W8AA 4P46B 3OO2A 4GI4A 3SKOA 3WHXB 1F3JA 2H3BA 1ZLWK 2PO6A 1JGVL 2AJ3A 2NY6D 4R7NA 1W3LA 3T5WA 4NQEA 1UEMA 3SKNA 1UWUA 1Z9OA 4UTBH 4WU7A 5GGRY 3RGVD 3PHOB 1V3JA 2ZAGA 4GSDH 1TTAA 4I6VA 3F7RA 5DJ6A 5AW3B 2BSEA 4OJYA 1GAFL 1W6TA 3O2WH 2FD6H 1K6QH 1X9LA 1QRNB 2XZCH 1E4JA 4UOJA 5IUCA 3CZEA 4PB3A 3KLHD 4TVDA 4UILH 5IK3A 5FGCB 2H9AA 4EPBC 5L9FA 4X6DB 3DVNA 1JFQH 3QUXD 4RDBA 1IRAY 2UUDK 2CLLA 4G5DA 3GXTA 3Q0HA 3V6OC 2B7QA 2AQSA 3KRZA 3CDYA 4ANVA 2GUBA 5ABFB 5CU9A 1BZ9B 3RJDA 4HEME 3NPWA 1G01A 1KDJA 1J1PL 1NWSA 1TX0A 2ED7A 1YEGH 3PDGA 3GIQA 5I19L 1P53A 3FQWA 4C83A 1RPUA 3IWUA 4AZ8B 4KMLB 1KB5L 2GY7B 3GS7A 1X7TA 4KKLD 2ITDA 4M1GL 5DK2A 3VIIA 5C6TH 1BD2E 3R8GA 5CN2A 5M7QA 4UCGA 2ZRWA 4N9BA 4GRWE 5I78A 4EIBA 2BJML 1OW0A 4M6OL 4PJAB 4N9GA 4YHMH 1IKFH 2ICWA 4JRXD 1B6DA 2CK2A 2IPTH 3FAXA 3S97C 2BZ7A 3TW9A 3W1NA 1KTCA 5SWZB 3V4BA 3PUCA 4XP1H 5F8QC 3WKQA 2D3LA 2FR4B 12E8L 3FSUA 3USZA 3PGDB 3S2CA 4L1DA 3DIPA 1DN0B 4Z0JA 1ZIAA 5I3GA 4Z95L 4HETA 2V3DA 4D6CA 4HUMB 1JGLH 5GS0L 3GBNH 4U1MA 4H6RA 3CIAA 1HNFA 4JFDA 2YUWA 4UM9B 4GE8A 5GIRA 4JHAH 3KL3A 2ZPKL 3VNLA 3W39A 1FAIL 1I3RB 1FN4A 1D5XA 5JW4N 1BXXA 4G6KL 4Q6IA 1W5OA 3CUIA 2DZVA 3VC6A 3B9AA 3QIUD 5GJPA 3W7JA 1OD8A 1NGZB 1QTSA 3ZUCA 3N9SA 3P40A 4LSRL 3FTXA 5DHVA 5EZLB 1FCUA 5JHAA 2MQGA 4FTVA 4R7LA 3CAQA 5DSCA 5IVXA 3W85A 4QJ1A 1J2BA 3EUUA 4DHLA 3GNOA 1F02I 4GYJA 1BOGA 3O4OC 5A16A 3TYCA 5HHNB 1S5HA 2YCEA 4V2XA 2XY2A 4U1IA 2VWEC 4DK6A 3QFDB 2PDGA 3LN5B 3QHTC 3NM1A 3WLSA 4MD4B 2HJFB 2RACA 3OXSA 1IGML 5MERA 5TBOA 3ARWA 5KBDA 3LHWA 1M03A 1MRCH 4JREC 4ZQNA 3T4AA 3QH2A 4ZTXA 2JGQA 5DYFA 4OGQC 5IK3B 4NUJB 1XCQB 4PP2B 2H9AB 2YAQA 3KGRA 4Q58C 1IQDB 5DTFA 3BWAB 3KM1A 4KITB 1ODAA 3ILQD 3N04A 1QR1A 4E36A 1EBHA 3DH7A 3IEBA 4C91A 3DJZA 3SIKA 5T1LB 2CO1A 1YNPA 3PF2A 4UT6L 3L3GB 3MGTB 5DQJA 2FLMA 1BQSA 2DGAA 4XNYL 4YHNB 3EBHA 3L7RA 4PMQA 1W0WA 1AHWB 4HGKC 5H1WA 4PN2A 1YYMH 1OAZL 2WWMC 2ZF9A 4AZ8A 1OSYA 5DC4B 1X6UA 2ZC1A 3O3RA 1U1JA 3NTCL 4YVXA 2X0VA 3CNYA 1II4E 4PJFB 4WU5A 3C0QA 3UAJD 3UROR 2OLDA 4GAJH 1DWHM 1Q6EA 1JFQL 1FCGA 2CO7B 1JK8A 1IGTA 1MVYA 3LTVA 4X98A 2GQ9A 4JKPH 3Q6FB 5BS0E 4MFEA 5FAAA 4B92A 5CMAB 3A22A 5AOUA 1NCUA 3O2WL 1ZXQA 3V0DA 3IKKA 3R8BB 4M43L 4OU1A 5CBBA 3H54A 2OR9L 3PP3K 2ZC8A 3Q9PA 1Q7QA 1E1CA 2GDVA 4HIJB 1NPJA 4FLOA 4PU2A 3NQFA 1OAQL 4LEEA 3MKVA 3IDNA 3KAOA 5IM7A 3AS3A 4H9TA 5H8MA 3AADB 3F3HA 3VYNA 5L2KE 1U22A 3B8SA 2PWEA 3PQYE 3D34A 2VCOA 2E1WA 3VFSB 2GAZA 1A4CA 4KJPC 1CFVL 3T3PB 5I1LA 1Y1UA 1JQXA 5FGSA 2HJLA 3FJTA 3UR7A 4K8RH 5CJQH 1ID2A 5EZLA 2VX4A 1D6EB 4F7PA 3RJOA 3W74A 4QWWD 1IBDA 4RGOL 4R97B 4XCCL 1XHGA 3C3UA 4MXQC 1SYVB 3FHAA 4DQOH 4RDZA 5JHDE 2VLJE 4CMHC 1QZNA 1WFIA 1C08B 5KVGH 2B0SH 3HC0B 5MEPB 3P93A 4IMLB 4JJHA 4XZUB 3QW3A 4NNYB 2G50A 3GRWL 1NIEA 4AYSA 3SDDC 3QWRA 5CIPH 1PDYA 3SDAB 2E6AA 5KVEL 3VWJA 4AX7A 3IYLW 4ZUWB 3UZQB 3UADA 3V0AC 1H61A 3L17A 3GVVA 4PR4A 3VI2A 2CDFA 5KZCB 4CVXB 1H50A 2ZRZA 2VLRE 3MV7A 1EJWC 2Y07L 1XXFC 2EIBA 4GHRA 3HBLA 4JIPA 1VFAA 5E8OB 1SN2A 1HZKA 3QEQE 5DX7A 2OFJA 4Q3MA 3GM0A 4AJWA 5AD0A 4ACZB 4A7SA 1M04A 4HNUA 3PZQA 2ZQKA 4L0YA 1IC1A 1SLVA 3EO0B 1HJVA 3E96A 4GYPC 4DWSA 4JFDE 4P3DA 1S39A 2VLRB 4LSRH 4CMMA 2J8UF 3NSFA 5TQ2L 4JZ5A 3R4DA 4J40A 4DYEA 3GBEA 4ENLA 1UJTA 4PGEB 4H4NA 3GWQA 2YMXL 4GS7C 3VFGH 4K94H 2AI0L 1JNHB 1ROCA 4BUHA 3AC0A 4PS4L 3VKAA 2OK0L 1FRGH 4A63A 4WWKC 4DP9X 3TZVC 25C8H 4LARH 2UUDH 1JZEA 3FNKA 5LAXB 4AZIA 3IRPX 1I9EA 2OTDA 5EZOL 3ZXAC 5SWQB 2D4DA 3UMTA 1EC9A 3S83A 1DJWA 1I1FA 4GUIA 3I6GA 1MOEA 4RBPH 1EWHA 3T1WA 1AW1A 5C0FB 4WDUA 4BFEA 1TQBC 4CNIB 4RETB 3ZYZA 3T05A 1ILUA 1E3XA 1U8PB 1XIWC 2CPCA 2WIMA 1YY8A 4FCAA 4OUIA 3SY5A 1F9CA 5E0FA 1Q6LA 1TTBA 2YJLA 3PQYB 3D48R 5HD8C 4OAWB 4YSAA 1JAKA 4XNZB 1IWAA 1UZ6F 1RZFH 3QQXA 5ANMB 5IB3A 3VQMA 2H9GB 1JK9A 4WFFD 3MX0B 3EG9A 1J8SA 1SDAB 4HUWA 4AL8C 4XH2B 4PMDA 2G5BB 4KRZA 4DYKA 1J1XL 2BSSA 5EU3B 3UXKA 1U8JB 1V3LA 4DXXA 3DX6B 1Y7VA 4AQOA 3U4EA 1N6UA 4MASA 4RNRA 2EXTA 5JIQA 2VX5A 5J04A 1IBBA 1C16B 1AH0A 4F3HA 1MQ8A 4ZQOA 3WNPA 2C1GA 5DGRA 3WJLC 1KDIA 3NSDA 4N8PA 4HOZA 2WQRA 3ITVA 3A3XA 1P69B 3WFEH 2ODOA 2Y7LA 2BVOA 3QCUL 4KK9D 3MTXA 2QGYA 4EACA 3DPBA 3DFPA 1FNGB 2R8WA 2PU0A 4I48A 1XS2A 1BYDA 3SAZA 5IHRA 1U3ZA 2EVIA 2XIDA 4YMPA 5CEZD 1N67A 4NZRL 1XINA 5AW4B 3C2OA 2A85A 2Q8AH 4HKZB 3VXSD 3NZUA 3B7UX 4AQ1A 2NW0A 1E5CA 2VJXA 1Z6JT 2P80D 4JFHE 1EMTH 3TTOA 1ZRUA 1TR1A 4A22A 1X44A 4OGAC 4FJYA 4CC4C 5TQ2H 5LXVA 1WCGA 4QGCA 1M7IA 1FA4A 5C0CA 3Q8FA 5DJ0B 3T0TA 4XT1C 4FDWA 3SY0A 1XLDA 4HS3B 4DO5A 4YIQB 3WJJC 2OZ4L 5HSFA 1P6WA 3EJJX 2F58H 3GHTA 5GISL 3S35H 5JXAL 4D8PB 2WTOA 3NL2A 1OCQA 2WXRA 1FQ0A 5HNNA 3O6ML 4EE2A 2FWOB 3BEWB 2J6EH 4QHNB 5EIQA 5C55A 1YXYA 5ACZA 3WLBB 2X4PB 3LS5H 1UWTA 2NMSA 1V6TA 4Z7VB 2B20A 2CBUA 2D4FA 1MUCA 3QI9B 3GNRA 5LBSH 2M8XA 2ZSWA 4FNTA 5FC9A 3FQRA 2CO3A 2OMZA 5C0AE 4Y6GA 4DBWA 5RUBA 2JB5H 2QVFB 3ZWSA 1CNVA 5J5RA 1I7UB 2MMXA 2Q09A 2G97A 3E0IA 3CDZB 4A7GF 5FUZL 4I0PD 3CGTA 4WNJA 1Z5LA 3UTQA 3J7HA 5J12C 4M7KL 1PY0A 4N2KA 4GQ0A 3Q2LA 1H5BA 4ZXBA 4Y96A 1THAA 4QKTA 2ZE3A 1CDUA 2X10A 4HH9B 4PB9H 3P5ZA 3VIKA 5CC6A 2D7QA 4GXFA 5C0RH 1ETA1 1HVQA 2CPUA 4GMEA 5KAQF 2V17L 3PDDA 2O92A 1M57B 2H6PB 2QQKH 4OZGB 2CLVA 1QSFE 3MV8E 2N4IA 1D9KA 3BZ4A 2WNKA 4M1CC 3WMSA 4G1NA 4DQWA 3QXVA 4GSXA 5IB1B 4Z77B 3DBXB 3CWHA 3CV6A 1NGXA 4IGHA 1BX2B 1KBGH 3SGEI 3GBLA 1SLWA 4LCYB 4HNCA 4PBEA 3OKDA 3PV6A 4ZTPL 5LO7A 3ZHDA 1WXJA 5I0XA 4ZGYA 3CLMA 3E9UA 4MZRA 3WK1A 4Y19B 1DE4A 2SEBA 2HTLD 3TA3C 2FQGA 5BQ7B 3O4LD 3OPSA 1TYRA 1UKPA 4GUGA 4UQEA 1UENA 4DN4H 4GO8A 4OZIF 5FA3A 4NC1E 4KQ4L 4XCNB 1GOFA 2Y5TB 1P7TB 2X1PA 4MNLA 1P6AB 1X1ZA 2FZNA 5JIWA 4BSJA 3OKYA 4OD2A 5ECGA 1VRSA 4R34A 3VRJB 2E3VA 4ZX6A 3ENLA 1D5IL 1IE7C 4HK5A 4E2DA 4PD4J 3O6MH 1E30A 4E4UA 1XGPA 1W3TA 1Z3RA 5D7LA 2AMUA 3HN3A 3ZE2F 2VDGA 4M62H 3D4YA 2ARJB 3TBBA 1ZTXE 4XBSA 2C8NA 3DRTB 3FSWA 4IRJD 3PUDA 2VMEA 1LDPL 4L4VD 1EDTA 5JPMC 2NLYA 1F2QA 4MKMA 3CUFA 2X4PA 2MCMA 4AIEA 4ZMVA 1YEJH 4LNYA 4MKSA 1DDHA 4NNYA 4KWVA 2ZX8A 2E75C 1XCTA 3APYA 1HI6B 2A73A 3C5ZC 3QR1A 4QKXB 3SYQA 3V4UL 3S36X 2NLIA 1A47A 1NC4A 4W9IC 3M44A 3H6JA 4HSQA 5F3FA 2APFA 1UWAA 1ZJIA 2C0AA 3MHGA 3W0KA 2DI7A 3EUDA 3HB3D 1DYZA 4XMLL 5D7JC 3EF7A 5EA0H 5FYKD 2DFAA 4QHMB 3HV8A 4PJ5D 3VSUA 2CLFA 3VA2C 1TIMA 2PWVA 1FZKA 3STFA 3HG1E 3AIBA 4KTDH 3L3KA 4WI7A 4RXGA 4OKDA 4BFIB 1JDCA 4W4QA 3WUZA 1UGNA 1GHRA 1RVGA 2DKSA 4JZOA 4XNMB 2EDFA 2P88A 1YE4A 2FJFA 4PGDB 3WIHH 4BE6A 3BANA 4UB9A 4F40A 3MLWL 3GYRA 4P2VA 5IROD 3IDMA 3W3OA 1TNNA 3LS9A 1FRBA 2FLIA 2CU0A 5BNKA 2WVVA 2GFTA 2HRPH 1NDMB 4ANXA 2YSSB 5JLZB 1SO5A 4WUUE 1NMAH 3EBIA 5T91A 3LPFA 4XCYB 4KH2A 1RK0B 3SJVD 2VE6B 4BQ9A 5KSBF 1ZD6A 1HW6A 4OIIH 4BEQA 1IAII 2VLJA 3MLTB 3U4KA 3K72B 4XMWA 5J9PA 1A5MC 2HG0A 3BWUC 4H13C 1C93A 4POUB 1JPSL 3BAKA 4CN6A 1V6XA 4K8HA 5PTDA 4K3JL 3EYOA 4RRPA 5EMJA 3VNYA 1VFLA 1KIQB 2Z31B 1P7QA 4TS6A 3ZHNA 2Z35A 4M7SA 1Q1JH 3S5LA 1NF0A 2XSAA 1NCDH 3LQZA 4GUQA 3WV0A 5FKAA 3PQYA 1QUNA 5ALBH 1L7TL 2NY4C 3FEMA 3WLBA 4K2UH 1FNAA 2W65B 4K94L 3MBED 4XZLX 2YXVA 4X7SL 3VU1A 2DW6A 2WQWA 2V2XB 3VTAA 3GNML 3I50L 3OJ2C 1I8IA 3WXVH 2YMTA 1Q8JA 1RMFL 2BP8B 1CI1A 4UTWA 3T0VA 5ABAA 3S36L 1VF8A 1N0XH 2QFPA 5L6YH 3GMMB 2GGEA 2VKWA 4HCDA 2EKJA 4DN3L 5B3SB 2HH0L 3RUGB 2XFFA 1KBWA 3G1SA 3RG1C 1ZT7A 4O0ZA 3HCVB 2ZOKB 3KDNA 1DEEA 1FNEB 3P2VA 4IK6A 4GCAA 3PP4H 4Z7WE 1OC5A 2UY6A 2TRHA 2ZYSA 1PVHA 1HOEA 3EX4A 1OWQA 3R10A 4G2DA 3PNWB 4PJ7E 3O4LB 1CR9H 1E5ZA 2D7OA 5D4JA 4TQEH 1XB3A 3EW3B 4F7EA 1IAIH 3WLKX 1HEJC 4V15A 3QJZA 5T5FL 4JY9A 1IGJB 1SFSA 2J7EA 1UWEL 1HAWA 2ICCA 2W0FB 3NRFA 3DKHA 1BVLA 2B2XL 1B9ZA 1G4PA 4WTZA 3NGBB 1AYRA 2VDLH 3QJSB 4XPHH 3SB3A 4ADJA 1A4BA 3FH7A 1R5YA 3QR3A 3ARTA 1JF1A 3CZKA 5A6BD 3VGBA 2VZTA 2XA8L 1AZNA 3RWCB 5I6NA 1IEIA 3NZGA 4HHHA 5KW9H 1LRTA 1VCAA 3KXFB 2Q86A 1QRKA 4QJ4B 1ISXA 1V8EA 3CFQA 4NQDB 3C60A 2VURA 4QLKA 4YUEL 3FOMB 5ID0B 4PBWD 6PAZA 3H2EA 5CEYB 2FQIA 3VXMD 1LROA 2J71A 5EU5A 4U0RC 3Q37A 2Y1HA 3WFBH 2C1PA 4PJAE 3NBNA 1KEML 4Y16D 4Q8VA 1Z66A 2E0PA 2GHZA 4LRIA 4YXGA 3L9CA 1WUNT 4FXGB 1PAMA 3O41A 3QUZA 2HRHA 4WK4B 5F1IA 5FHAL 3F6IA 4LCCB 2QEJA 1BYBA 1DWFM 1WA2X 4MXVE 2C4XA 1BQGA 3GC4A 2I14A 3UC0H 3VSVA 2AKZA 1R3SA 5TF1H 3TBVA 2OEMA 4F57L 3N6JA 2CO6B 2R2BB 4DKFH 1W1TA 3TFCA 3FUFA 3LHYA 4AYGA 4K7VA 5BO0D 3MO1B 5IOPB 1U58A 3D08A 3FCGA 4LYPA 2Z64C 2CU9A 4Y5XA 5HHVL 3VI3A 5I15H 3UYRL 3HQ1A 1O5QA 1Q45A 1BZOA 2XPGA 3GS0A 5ABGA 3TT3H 4GQRA 4IMLA 4XZUA 5IF0B 3WS6C 1ORSA 1CT5A 2V38A 3CLFL 3MRQA 1KQYA 4JDEA 4NXKA 3GVGA 2IJ0C 3HI6L 1A4MA 2XSXA 4ML4A 2AKRB 2AKMA 1L0QA 2BSCA 2NW3B 4FQLH 4JG1H 5K9JL 1J5OH 2R69L 1MCRA 2GDQA 3GMRA 1UG6A 4IH3A 1W72H 1KACB 4JFFB 4QCIB 1TMHA 1AW5A 3QNFA 2HQAA 2VEGA 4RAHA 3SGEH 3FUEA 5D72H 1QMUA 5ICUA 3H42L 2Q3ZA 3FFDA 4J9JA 1SXAA 4GWEA 4GACA 4HCRL 3DBSA 4QHUA 3OWRA 4FP8L 3EGXA 3TA4D 1BVWA 5GQBA 2DZUA 2VWTA 4PRPA 4Y16C 4XB3A 4H9YA 4OCRL 4ZFOL 4IEFB 2N0KA 4D71A 4FTDA 3E0VA 2RQ8A 2J1YA 4ACTA 2MTAA 4EEEA 2OR2A 5A6SA 3JWDC 1FH5L 4AJVA 4FYQA 1Z0MA 2WGXA 5JQHC 4LCWD 3CIXA 1TZAA 1AW2A 1FWHC 2GSGB 4A8NA 5C2BH 4IIQB 3U2SA 1PYWB 2E7FA 3H21A 4PL1A 4JN2A 3W7GA 1OFAA 2FTPA 1QUNB 4EI5B 1YW1A 2GFBB 5LCVA 1MQRA 2VR9A 2WMHA 1E4XL 5DJ8B 2BGQA 3MRDA 3O4LE 4BK9A 2HBVA 3VKKA 3ITGA 3HZYB 1E9QB 4PWFA 3NL5A 4S2BA 1P1XA 1UWXH 4ATLA 5KTEL 2AJVL 2DQHH 5BVJB 3E8UH 3GFZA 2E6DA 4L8SB 2JK2A 3ARQA 3LZLA 4RSYA 2OA9A 2BMBA 4U3SB 1LRNA 4DLFA 3FU7B 3E5PA 1OLLA 5C3LD 3N19B 5KEZA 2HXTA 4DZIA 5C7ZA 2ZWLT 1N5YL 2ISWA 2B3RA 4O02L 3U2ZA 1SXSA 4GAGH 4Y8AA 5FB8A 3LMJH 5LN8A 2YK1L 5A6BA 1M71A 4MJHA 4N0FA 4P2OA 1PIIA 4PHZA 2BP5M 2XETA 2R1MA 4K7YA 4U3CA 4L61A 3BEVA 1QEWA 3B3BA 3SPHA 4CSSA 1DJNA 1BTCA 1KRAC 4R8WL 1N59B 1OT2A 1DBJH 1ZANL 1P84J 3HNSH 2OLHA 5LG1A 2G3FA 4ZZFA 1K8ZA 2ZUQC 1BVLB 4OKVB 2IPUG 4ZS6D 5FOBA 3U7BA 2DQGL 4J3OF 3LQGA 4RW5A 4W81A 4XPFH 1C1EH 5IFPA 4D9QE 2IPJA 2ZUUA 3UJTH 2HRPL 5GXBB 1TUFA 3GXFA 2D69A 5I0ZA 3N2MA 1B4RA 3J8F7 3TPUB 1HHIA 4H26B 2XYLA 4TVCA 2WSDA 3BAEH 2DWEB 1OGBA 4N2DA 2HVJA 4NLAA 2MUCA 4KXZI 2H47C 3LQZB 1R3HA 4ELKB 3CBJB 1BQHG 2B5IB 1V05A 1W8NA 5CEYA 3TH4T 4R5TA 2YA2A 2PDBA 2EXSA 4DKFL 1AYOA 4BA0A 1J9TA 4K23H 4Y5YA 3K6OA 1VJZA 2C1OB 1I2RA 5BV7B 1OZTG 4OZHB 4ZSOA 3SKOB 3WHXA 1X5JA 2YL8A 3ZQXA 5C07D 3PJWA 4RE3A 2TPSA 4NT0A 3UWWA 6PTDA 5H35B 3IGFA 1JDAA 4PVMA 3BVWA 5D71H 4IQJA 1SVDA 3OBKA 1CD0A 3PHOA 4F2EA 3VI3E 4YSSA 2YRBA 4QRPE 1LORA 3ARFA 3KLDA 4QAIA 3CN3A 3E7JA 1KTRL 1BGAA 1FWIC 4F9PA 4ZYKA 1HH9A 2KZBA 1JXKA 2UV8G 4G8FB 4QOKB 1AKJB 4OF8A 5FYJE 4F7EB 4HYTB 4TVPH 4XP6H 1JDDA 5DVLA 1A1NA 4YHLL 5FDWA 2NX9A 5EPDA 3IFLL 4HPYH 2WXMA 3I3BA 4XN2A 2B1HL 4PIRF 1H2JA 3CU2A 5IQ7H 4N9OB 1EL3A 1YADA 2AITA 3O0RL 3CVHL 3BZEA 2NY1C 4HWEL 1UIOA 2PWDA 4NPKA 4MF4A 3SDYL 5I6XB 3SKMA 4BK8A 4YHIA 3NIGB 2FEEL 4QFUA 4B5TA 3PB2A 4WFFE 4JTIA 3IDYB 2G4JA 1J93A 1SEQL 1BQ5A 2XXGA 3CVIH 1TSHA 2X4NB 3SUUA 1WDRA 1IIKA 5FCSH 2QQ6A 4U5KA 5TDNA 4FB7A 2IKGA 1PVNA 1L6GA 4PS8A 5J11C 2FTYA 3RZCC 2X89D 1W91A 2WXHA 1FV1B 3LNHA 5EU5B 1I1FB 4Z0BH 3KJ6H 2QPDB 4I85A 4W9EC 2CBVA 5AHNA 2NNFA 4PLJC 5IVXE 2X1UA 4FOJA 4WHYG 2WQAA 1J1OH 1DN0A 2HKHL 1F8TL 1LO0L 3FFOA 3SO3C 2OQYA 3WEOA 2CHXA 4AT6A 4LCCA 4PW4A 2Q71A 1FL5A 1DQLH 4G83A 1MF2L 1X5MA 1M68A 4LLYA 2GYIA 4D6DA 3A13A 2VZ3A 4WU7B 4P2RD 5AALA 3SE8H 2H90A 1MFCH 1CPUA 4WFGD 4A39A 1MCQA 4W8LA 4FG6C 4RNRB 4XNYH 3S1XA 5M2FX 2E76C 2NYKA 1A6PA 1QPKA 3KLSA 2OTPA 2YSTA 2YGPA 3IBEA 5BYWA 3BW9A 3RWFB 1ZPUA 3MUGA 4AMWA 5I17A 4U1IB 4Z1PA 1PCWA 1HL4A 1UW9A 1U2CA 3HMCA 4DZ5A 4XMKL 3K4ZA 3M0HA 1AXTH 2IOOA 4XZNX 1NCTA 1I75A 2X5PA 1OY0A 2IDTA 1GEQA 2P5EB 3FO9B 1NUGA 3A4WA 1OP9A 3BPNB 5ICZB 1A7OL 4KK8D 1OF0A 1IQDA 1H7NA 4KDTC 3H23A 1QOXA 5IQLA 1T8QA 1A9EA 3BW4A 4E4FA 5BS0A 3D9AL 2QQQA 5T1DH 1ZLDA 3W9ZA 4F0SA 1S7TA 2Y06H 3R43A 1KXQE 3MAWA 4U49A 1R0AH 1AL7A 1LO2L 3O3EA 1YDVA 3R18A 4A6YL 5A2FA 1KB9J 3HKFA 3HS0A 3ORJA 4BZ2A 1R6WA 1LMKA 1RMFH 3C5QA 4NQXA 3OMNB 4FKEA 1SLUA 2HZHA 4JN1L 5JW4Q 2X8RA 3BJLA 1BTMA 3D30A 3DI0A 4WD0A 1I7TA 3WMPA 2QGDA 3E0GA 4ZO8A 3UAJA 2OMXB 4P8QA 4A2GA 2BBFA 2Q3OA 2HE5A 3WF2A 4KKAC 4YLBA 1T5XA 1N8IA 5XIAA 4B41A 1TQWA 4L37B 4XCYA 3NZ8A 2J88L 2AQ1A 4GQBA 4P2OC 2XJLA 3C2AH 5B7EA 3VD2A 3PWGA 4LVGA 5ERWA 4EI6B 3QBUA 2YLLA 1A7OH 3N12A 4G2AA 2GYSA 4M48L 1EKOA 3B2PA 2WZAA 3LBCA 1KY7A 2DL9A 4HJ1A 2YDSA 3E8VA 4QSFA 4X63A 3S96A 3OOQA 4LUYA 1BWLA 4LLUB 3MQIA 3T3MF 1KENH 3FCSA 3MWCA 1FVDB 5J5DA 3NJFA 7FABH 4DFHA 1J96A 1E4MM 4FHBD 4XMTA 4P4RB 4ZO9A 3T0ED 4PJDE 1U8HA 4DK3A 3TIEB 1EFXD 1Z7JA 1KW1A 1OT4A 4HT1L 5E7BA 1EERB 1JVKA 3GSOB 3BUDA 3QFGA 2BLFA 4WI4A 5B1JA 3RX4A 4QNPF 2EQDA 5KN5A 4A3QA 2NXZD 1YYAA 3M1BA 3GHEL 4G9FA 4NBXB 1WQVT 4NZFA 1A7NH 2EKSB 3H0TA 2RA1A 1DE6A 3VKJA 1OGAE 2J4WL 1EAQA 5XIMA 1JHTA 3A6BH 3SRDA 5DZOA 4L3EA 5EB9A 4PTXA 4X6CB 2QUNA 1T89C 5DTFB 1P4CA 4GH7B 4NP9A 4F2MA 4PUWA 3W2LA 4PH8A 4UC5A 4Y5YC 3MR9A 4G1KA 1FE8L 3MLZL 4N20A 3VQ1C 3LI0A 3VD4A 3BP5A 2KL6A 1KRBC 4Y4KC 2G0KA 5CLYA 4UB0L 3VG9C 4OKVA 2PDCA 1M1BA 3F01A 2IXQA 2F9BT 4M3KB 2QR6A 4AC2A 5LVEA 3GK0A 5AC8A 5KINA 4FQ2L 1UYQA 1UB6B 3MU7A 4YK4C 2NY6C 4BY3A 5GZOC 3K91A 1NC2B 2P43B 1KBGL 4F2UA 1J9RA 2AAAA 5E6ID 4UT9H 4PMXA 3SGJC 3TWCH 4YVVA 4TSBL 2X1IA 3QUXA 2OODA 3FU5A 1BBJB 3MDUA 1KLFA 1PPIA 1GORA 4XC1H 4ICMA 1R9YA 4K3EH 1EEUA 5C1MB 3KPQA 4WXZA 2XG5A 3NAAH 4CC0A 3VXRE 3HURA 5DRZA 4FQHB 4GEIA 4NXSA 4UM8A 1H09A 4URKA 4ZB2A 3UESA 2NX1A 5HATA 2VQ4A 1S9WA 4A2MA 2FZ9A 4OZFB 2EVGA 4LAKA 2FEDD 4YWGL 1J18A 4JFZH 4FA3A 1DO6A 4QMEA 1MW2A 3MJ8B 5BMFL 2F8OA 1CBVH 4A55A 3V4PH 5I00A 1XL4A 3NACH 1IXQA 3WDIA 4M51A 1M2OA 1U33A 2CWXA 3HM7A 1A1MA 5L9DH 2EG8A 3UERA 2O5ZL 2WQUA 1DJZA 3BK0A 2BO0A 1V77A 1GPFA 1GSMA 3QRGL 1D6EA 4F7PB 5KSAC 3WHE0 3PZIA 2PR4H 3LCLA 4W9GC 3PWVA 3QN3A 1UC5A 5IHUH 4IOIA 2Q02A 3RIKA 2PXYA 4KZEH 2QQLH 4S3CA 1QNIA 2WD0A 3SURA 5HDOA 3T42A 1PG7X 2CO6A 4ONFH 5AZUA 5D37A 4PGDA 4EDWL 1KGCE 4XWGH 1CT8B 2NUXA 5T9CE 2GOKA 4FQXB 1LYXA 1S78C 3ECBA 4C8XA 1CYXA 2JKPA 3RWIB 3IGKA 1K2DA 1S9VB 1F07A 2YD2A 1BVNT 5CLZA 5HDWA 4HG4K 32C2A 2IC2A 1PD1A 3SO3B 4JIEA 2QLVB 1VZIA 1LNUA 4KXZH 2CDFB 2XVBA 5IMLB 1T1ZA 4L3EB 2G3JA 1JI1A 1GS6X 1I8KA 4YH6A 4R4FL 4FQ1L 1MSPA 5CCHE 3T2LA 4ENED 1JTOA 2EVHA 2HS6A 3HG1D 1R75A 4KC3B 4U2ZA 3TA3A 4IBTA 4KUZL 1HOCA 3EA2A 4R90L 1Z0NA 3H2MA 5C9ZA 2P8CA 1HJSA 1FVPA 3FO1A 2IGFH 3AXMA 5GGRA 1XIGA 1ZTVA 2CRZA 1XB6A 5MENA 4KKBC 5D7KD 2GL5A 4K5MA 1P0BA 4YDJB 3EX1A 3VIHA 4HDIA 3AUJA 1JMZA 1V54B 4JFWA 2ZZ1A 4PW9A 1GVIA 2QQNH 3R7QA 4GRLC 3UR5A 1M01A 4S2CA 3WF4A 3BZFA 3R19A 3ZLGA 3QNYA 1YJDL 1QQDA 4LBEA 4MCZA 4L4VE 3S3PA 5FGCE 1WA3A 4UFJA 5F70A 5K4XA 4I2XB 2YD4A 3ATEA 3UTTB 4U6HA 4K3GA 1PX4A 5KANI 2LR4A 4P05A 1QPXA 3W1ZA 1ZSXA 3WF3A 3LYRA 2YQ2A 3NCJL 4NO5B 5IV2A 5EF3A 3TJLA 3RLSA 5C2XA 1N55A 1TJHH 3VG0L 4QGTA 3FSAA 1CDGA 3VH8B 1NAKL 5D6CA 5JORB 2FGLA 2W9LA 5EBAA 3VOIA 1ZT7B 5AVYB 1OQFA 1XG3A 2VDML 3RTQA 3BEWA 2H6RA 4N4QA 3WN5A 2AGJH 2UZYB 1IEAA 3IJ9A 4N8VG 2FB4L 3DGDA 1XQLA 3H56A 3US9A 3QHNA 1MDLA 4WNQB 3PNWA 4PJHA 5D1QC 3SQRA 2DN7A 4GQPH 3T65B 4OZOA 1KM2A 2IDUA 1WRFA 3IFPA 1XX9C 2G5RA 4PI2A 3KBSA 4FZEL 1YEHH 3NCOA 15C8H 2XFXA 1K85A 1L6FA 3M7FB 1MLBB 1VPOL 1B3XA 3IAPA 5C0EB 3PG2A 2K6WA 1ECEA 3F7JA 4XX6A 4AZBA 1EJ6A 1H5YA 2DOCA 2XKNB 3M8OH 2QMJA 4GFSA 1XLCA 3L65A 2A5HA 3TO4D 2V2WA 1N8WA 4U1SB 1O7AA 4K5OA 3GKAA 4H2CA 3QPQD 1BXBA 1PHWA 3IJLA 4DJEC 1ME7A 5CEZH 1NCAH 3NN8B 3EO0A 4G8GE 2ZCLH 4L6OA 3MUZ1 5A2CA 8XIMA 2UYLA 1JPDX 4D6FA 2XYCA 3MKKA 4J35A 4NAEB 4URTB 1HILA 4CL7A 3BV7A 2NQ9A 5HPMA 4KHTH 4FI6A 5FSDC 3RL2A 2VISA 1ADWA 1QA9B 3MGOB 4LLAA 3KWTA 1YN6A 4N0RA 1INQB 3FT3A 3RVWC 3TO2A 5C8JB 5I5MA 1ADOA 3NQ7A 2HB0A 4Y8EA 4DP7X 5K4ZA 1XUZA 4OFQA 4WIQA 2BOFX 3LD8C 4NUGH 2V81A 4GQ9L 2E77A 4FULA 2O5NA 1OM3L 3VNIA 2HT2C 4PG2C 3O9WD 5IBLC 1POJA 4F33B 4MA3B 3DUSA 3VFMA 5H8DA 3M0KA 4U7KA 1FLRH 3JU2A 1KN2L 1PEWA 3D85A 1YY8B 2HRLA 2QKSA 4LCUA 3IJYA 4QRRD 1EFXB 1MCNA 4XKMA 1WCBA 4XBEH 1XYZA 4H9MA 3SCMA 4JPVH 3V0HA 3GXIA 3QYNA 3S35X 1WIUA 4YXHH 3VFLA 5GZOA 3TVAA 1NAKH 3GXUB 1D6VL 2JI3A 1PG7W 1U5HA 2OGYA 3NQBA 1B6UA 2YKLL 2Z0BA 4HEPG 3VM7A 4BDVA 5FF6A 4KERA 5AYIA 4DJFA 1A5FL 3T2NH 2YO3A 5MKGA 3FHEA 1JYNA 1YPZE 1B4EA 3IETB 4P2RA 1IAKB 3BQVA 4FQJL 2HLAA 5DWUL 4ZEPA 3VW3H 1UPMB 3FU9A 1IEAB 1AZBA 3QFJE 2M26A 4YHZL 1W3IA 4GOAA 1K72A 1K6QL 2XZCL 2GJXA 2BVOB 1HXYA 5C9XA 4QNPE 5GPRA 1FLTX 3DPBB 3II1A 2X4OB 4Y0GA 5DXYA 5HWNA 35C8H 3L1OL 2FX8L 1JCYA 5CJOL 2VDNB 3OXRB 4MNMA 2Z34A 1CLXA 1PQZB 1SUJA 1VRDA 4MB5A 1F73A 3S4SB 1UUSA 1BM7A 4JDTL 3PNUA 4PTWA 32C2B 5TJWK 3F7YA 4JO1H 2VLLA 2FGZA 3C2EA 4Y9EA 2OWWA 5TPWH 1RK5A 1Q13A 4QEEA 4J4KA 5FO2A 4MNHB 1Q72L 2PMZA 1MI5D 2WCSA 5DJ0A 1OSZB 2IVFC 1DE4B 4PWGA 4OHQA 4ATDA 3NN8A 1NCWL 3O6YX 5D9PA 1K8DA 1KCUL 1UR4A 2UYLB 2O9TA 5FEWA 1IGFL 2DM2A 1BFSA 1CGUA 4FMKA 4W4NA 5EEXA 1ZAIA 1ZV5A 4JS7A 3WFAA 4HZ6A 2Y5TA 1FWJC 2WBJB 1P7TA 5FEZA 1NBCA 4NUGL 3NIDE 5EV7A 5F1SA 4POYA 3E9AA 4EIZC 1HEZB 2UZPA 3FS9A 4G6ML 4OD3H 3ULUE 3D2UB 5ISZD 2C15A 1XBRA 2DY2A 4ZX3A 2DQDH 1UG9A 2EE6A 2CXKA 5K9OB 1OCWH 3GF8A 3EOTL 3H4GA 3QC6X 1N0LB 4LU0A 1BMGA 1FYTA 4YN5A 4BFJA 1ONWA 3TZFA 4LVHB 5HHPA 1WUZA 4R27A 1VYRA 5E08L 1GOQA 1Z9MA 4XVUC 5BMFH 2VZVA 3MREA 1FJ1A 1CBVL 6ENLA 5DEGB 5CIPB 1S2VA 3ZHLA 1X4XA 3GFUA 1URZA 1A3LH 1U8QA 2OS7A 3L5HA 3QAZB 4FQIL 3SYAA 1A0CA 3BFWA 3WN5B 2Q8ZA 5DCCA 3FH8A 5GRUL 2CHWA 4JANB 4F2TA 2XINA 1YC8A 1LEGB 1RJLB 1MPAL 1NCNA 1P7BA 4XBPB 2QUUA 4XXWC 1O94A 1MCFA 2W1NA 3F7KA 2AQVA 4B3KA 1OGAA 5LGHH 2DTSA 2WCPA 1E72M 2IALB 3KYOA 5E94B 2RGMA 3GKFA 4CCDA 3N2TA 5EBLA 4DVOA 1AAJA 3FK4A 2ATMA 1AE6H 1F90H 1DJYA 3A3YB 1P4BH 4F9JA 2OLSA 3QZBA 2AL2B 2DDXA 1B31A 3Q2NA 3PAVA 3NA9H 4HJSA 4ODSH 4AH2A 5A40E 3VWJB 3TYEA 4HHWA 4QBXA 1KULA 5BQ7A 3B2XA 2AV7B 1OM3H 3G04B 1DUZB 4CVUA 3LKPB 1A9EB 4R8WH 1RUAH 1N2VA 1KCKA 2GJZB 1S3TC 3WTVA 1EHLL 1OLZA 2GT9B 3ILQC 4IBYA 3LNMA 1H0DA 2NR6C 3D0LB 5CBAB 4TLSA 3LMJL 1SZGA 5DHVH 2OQHA 4LB8A 3BSHA 1E6QM 5DRNA 1NH6A 5JHMA 4XTRD 3EF4A 5DT1L 1N5YH 5FJPA 2B15A 4ONGH 2VC2H 2K6ZA 3FXGA 1EJUC 3L4ZA 5DU7A 4WOQA 1BGXL 3FFCD 3LSOB 3UNTA 4OZHE 4RX0A 3UTSD 3YPIA 4H8NA 1LO0H 3LAFA 5B7MA 4V1YA 5SWZE 3JWOC 2TSYA 3D85B 5FCZA 1U8NB 2VENA 4K5LA 1JVNA 3ARSA 1KFLA 5AOKA 1TA3A 1FGVH 2V82A 1T1YA 1A6AA 3C8HA 3W71A 3T09A 1XIFA 4GH3A 2K9FB 3RITA 1A0QL 5BCAA 8CGTA 2C1PB 4C1KA 4JQIH 1X6LA 4U1NA 4IKLA 2JF1A 2DJLA 5DBTA 3ZUNC 2V9DA 5D2NE 3O0KA 4MS8C 3TR2A 5GS3A 3JUYA 3J27A 1C90A 3N3EA 2G37A 5EF0A 1SEQH 7PAZA 4BCXA 3TJEL 1EVTC 1IKNC 2J5LB 4WI8A 4WWKB 2VRKA 43CAA 1QWGA 4PUBL 2NY2C 3MFGB 3RLGA 1P2CB 5MENE 1FL6A 3LGGA 1NEPA 3GB7B 3W7MA 3AREA 1XSJA 5AWNL 4XH2A 2XN9B 2EEBA 4FXFA 4S1RL 4BFIA 4LL1A 2ZTJA 4WEVX 1XO8A 4KJQC 3PUUA 2K7PA 5C0BD 2AK4E 5E23A 2G4FA 4KO6A 2YCLB 1OHLA 3EMCA 3V4PA 1L6PA 1W0MA 4AD4A 1OYBA 3LZQA 4N2LA 3M9YA 1JPFA 2AJSH 3RDTB 2Z91B 1B4TA 2ZG3A 5DCBA 5BRQA 4XNZC 1GJUA 5C9WA 3HHMA 2FSDA 2NR6D 3IFNH 3WKZA 3QORA 3Q8AA 2VUYA 3EO1A 3KW3A 1NM4A 3V75A 5H6HA 3Q6GH 1WISA 3ASNB 4GG6A 3LEYH 5M5DA 4V1XA 1E5AA 5M95B 1NMCC 5DUPH 3EXRA 1BYOA 2A7BA 1XIEA 1UTDA 3WS3B 1AQHA 4POZC 1V03A 1AIFA 1HIMH 3SFKA 1ZV9A 3U5YA 2WBXA 3SDDB 4OGXL 4Z7AA 3ZU8A 1NP2A 3D33A 1AKPA 1WKDA 3LRLA 1AFSA 3QKEA 1J87A 3GMLA 3C60B 3N17A 5HNTA 2DWDB 1ZA3A 1BQHA 2XY1A 3BSZA 3CJJA 4LHUB 1E6PA 4GXPA 4JAWA 1H0DB 3D0LA 5F9DC 4P04A 3VRLE 1IIHA 2J7CA 4LVDA 1QRNA 2Y25A 2W65A 3U7YL 1E9OB 3O2DL 4W85A 4N2OA 1I9RH 2V2XA 3L7EB 4JKNA 4FADA 3IMBA 2L8AA 3H9SD 3UACA 1HP5A 3MT1A 3VIMA 1KB5B 3UTSE 1F1DA 5E6RB 4PB4A 4NQSB 1V02A 1VPXA 5DA4A 4HJUA 3KM8A 1V79A 3VXOA 1PG7H 2AMXA 3BI9X 2K4WA 3C5SB 3RWGA 3WFDH 3QJHA 4ZPTB 3ULVH 3QCUH 2VXUH 3VFNA 2BK8A 5FUZH 3WH9A 1E0OB 1H8SA 2X42A 1V7YA 3PBUA 3VCNA 1QVBA 5F9WC 1ZS8B 2VZ1A 1TMCB 3EA3A 2VERA 4R88A 4IWWA 2Z0IA 1N2RA 4YDVB 5KYXB 3SCRA 4QO1B 2D2CC 3DFHA 5DJCB 5C3IA 1AL8A 2A6IA 3CPRA 2GCYB 2C26A 3C4UA 3CV1A 1LL7A 4PUNA 3CVDA 5C7HA 3G5XA 5MHSD 1EO8L 4M4PA 2YPLE 1V51A 3ARGB 3OMZA 5F7WC 1LEIB 1F3WA 1TMQA 2FX7L 4XO3A 1MCPH 4ZB5A 2LU4A 4OT1L 4MVBD 4O54A 1FFOA 4YDLC 1HJUA 4FHJA 4O4VA 1G6RH 5F3BA 4HU4A 1EZVX 1MUJA 2F58L 5IFJA 4EWND 2IIJA 2VFDA 2R4RH 4OFIA 3HQPA 3Q2DA 1NCBL 3QZAA 3H9HA 3D39A 2EUZA 3X14A 4N3TA 4LCYA 4AGQA 1R3QA 2GIYA 1T6BX 4UINL 1GGCH 3QZPA 5K2ZA 3MRMA 4S3EA 4Z7NB 1KA9F 3VC5A 4XP5H 4XNQB 1SBSH 3B34A 1N6QL 1K4CA 3O11B 3A67H 5KBPA 3HC4H 5KWYC 5E70A 4PWEA 4GMTH 4U1JB 5AVWB 1OVDA 3RWHB 3CC5A 4ESKA 2ACRA 1WAPA 1GMIA 3QI9D 4JS3A 1PZ5B 5CD5D 1QWUA 3TX9A 3U7AA 1RK6A 1AP2A 1XYMA 3F4DA 1DL7H 3GTFA 4DGIH 1USQA 2Y06L 3HIJA 4PJBE 3W82A 2DWDA 4N85A 4N2CA 2YAHA 4UNLA 3WSQH 3FQ2A 3TBVB 3S9ZA 2IF7A 4E8DA 3BLOA 1TVHA 4R9XA 4O8RA 4REQB 3SN0A 1L7TH 2ZZ7A 5F4WA 2Z1VA 4RPQA 3MVSA 4QAWA 4GRWH 4MXQD 3BARA 2D1ZA 4HPNA 5GJTH 1L6SA 1TV8A 4PB0L 1SHXA 2Q3AA 3BCDA 3T0BA 5KVFL 3OIXA 4AXWB 1M7DA 4GY1A 2HJFA 2VFHA 4C6DA 2YGYA 3RPTA 2N1TE 3NK3A 2QIWA 3IS0X 1JPMA 4FCHA 1KOAA 4DF2A 3QQNA 3GSQB 3G04A 3WAKA 1RSFA 4H20H 3IDUA 1BFVL 3U30C 1C5BH 3QXBA 2EDQA 4IM8A 1BG4A 3P4OA 3ETBF 4FLHA 2YPVL 1IQWH 4HGMA 4XZ4A 3WUWB 1E0VA 3RFZB 1KIPA 2XWJB 4X5QA 3DHUA 4RIRA 4UWQB 1VFBB 5SX5K 1MF2H 3TH3T 1DQLL 4G72B 4J7RA 4RISH 3C5XA 3KPRE 2QBWA 4YTSA 3VXNB 4UTAA 4K1WA 2YPIA 2J6EA 1FFPA 1VZWA 2FX8H 1R19A 3NJNA 2AVFA 3ULSB 4XD6A 4EIVA 4UTLA 1L9RA 3JT2A 1HCFX 3KPTA 4TIMA 1UROA 1KEMH 3I3EA 4Y2WA 1S7WB 2GAZB 4JFVA 3SBPA 4ZFZB 3C8FA 2VLJB 3SDXE 3WLLA 2OL3B 2PLTA 3JVFC 4N2BA 5I8KL 4E8CA 3PM6A 3GMOB 3LHUA 1CIDA 5L4IA 5ICYB 1L9TA 2EZ0C 2ISFA 3IDGB 2GK1B 3C75A 3QWOA 1AXTL 4M0XA 4FYSA 3I7QA 4MWAD 4PRRA 2R0LL 3VXPA 4DEWA 2CUHA 1I2QA 3DECA 1XIWD 4IOIB 4NJGA 2GBVA 1R5WB 5GRYA 1YEWA 3MRGA 3O8AA 4QEHA 1E9PA