4X9YA

Wild-type human pancreatic alpha-amylase at true atomic resolution (1.07 a)
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
publication title Wild-Type Human Pancreatic Alpha-Amylase at True Atomic Resolution (1.07 A)
rcsb
source organism Homo sapiens
total genus 177
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4x9yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4x9yA01
5A6JA 1CYGA 1HX0A 4H7VA 1ZL1A 5CGTA 3PZ9A 5JBEA 1WZAA 4M8UA 3N9KA 4UR9A 2PWGA 1CGUA 1D7FA 1LG2A 2DH3A 2CETA 3KL5A 3WH7A 1OGSA 2ZUWA 1ZBCA 4KRTA 2WZHA 4BCEA 1W91A 1MFUA 2XFFA 4UZSA 3VMNA 3LPFA 3M07A 1VEMA 1G1YA 3BUDA 1GCYA 3DYPA 4W85A 1H3GA 1W3JA 1E70M 1R34A 4ATWA 1JNDA 2PI6A 2YL8A 2E9BA 4QDMA 1KWKA 3UETA 1GJWA 5M5DA 1XSIA 4ACYA 1NARA 2ZUNA 4D6CA 2G41A 4AMWA 2BY1A 4XZWA 1E72M 3S2CA 4H8VA 3WD1A 1JI2A 4QLKA 3ZJKA 1XCWA 5BRPA 4CVWA 2XN2A 5EFFA 2VCAA 1C7SA 1KXHA 2E3ZA 5M03A 3CZEA 1NP2A 3CZLA 2PC8A 4QCFA 2V5DA 3IAPA 3DX3A 4BA0A 4HOZA 1LWJA 1QHPA 1UWRA 3N15A 3I3DA 1DWJM 1GHSA 3AIWA 3BMWA 4Z2IA 4FNRA 2JALA 2J79A 3BUPA 1GONA 1CGWA 3BSHA 3ZQ9A 5I23A 3CPUA 4FK9A 3T08A 1KCLA 4DO5A 1K9DA 3WD4A 1HL8A 2J8GA 1K9FA 2DT1A 2Y4SA 1GPFA 5DO8A 3VD5A 3MU7A 3GXTA 5A3HA 3ARTA 4NZJA 2WHLA 4F9DA 5EBAA 4UQEA 2BXZA 1TQVA 3N04A 5E09A 4E8DA 3CUFA 3LPOA 1DWHM 2XWEA 1V3HA 3SCNA 2EPMX 2JIEA 4AISA 4D6DA 1IZJA 4TTGA 1KQZA 3BH4A 1BYBA 1VFMA 3AYSA 4NZCA 1U30A 4FNPA 1LF1A 1TE1A 2MANA 4R27A 3VSUA 2CCRA 4PUEA 3D4ZA 5A1AA 4C7DA 5BWFA 3SUVA 4DWSC 2PWEA 1HF6A 4IPNB 1BG4A 1CGXA 2GK1A 1PZ2A 1PX4A 4W5UA 5IHRA 1JYWA 4DWSD 1NOUA 4U5IA 2GUYA 4PMQA 1R75A 5EB8A 1B31A 3TTOA 3APGA 4M80A 3WY4A 5FCZA 2DT3A 3BAYA 2D22A 1HKKA 3CGTA 2FHFA 3ZSSA 1K9EA 2WCAA 2WVUA 2D0HA 3CZSA 5FKYA 1NH6A 5BCAA 3ARSA 2A3EA 3SCRA 3KL3A 7A3HA 3WF3A 2YA2A 4XZBA 4AZ7A 5A6SA 1JIBA 3VMPA 5AY7A 1C91A 2NT0A 4M56A 3WIJA 3IJ9A 3SUUA 1BFNA 2BHUA 3RM4A 1XYFA 3SIMA 2WMIB 6A3HA 2W61A 3MSDA 5C71A 4TUFA 2ZE0A 3T0AA 3MUAA 2G4FA 3N18A 3AXIA 3L4TA 3AIRA 3EJTA 5I5RA 3LRMA 3SCPA 4D6IA 2BHZA 4JL2A 4HZ8A 2O9TA 2BNJA 4QLJA 2D23A 2X1IA 4UQAA 4GPNA 2VRJA 1HJUA 4FLQA 4UZUA 3WMBA 5CSYA 3WF2A 2E9LA 4U2YA 5F7UA 1US3A 1RP9A 3BVTA 4J27A 4NZFA 4CD6A 3CC1A 4W7VA 1EOMA 4JKMA 4J3WA 4UQDA 3VNZA 2ZICA 4B16A 1W9XA 4EAMA 4LGXA 4PTVA 1V02A 3WFZA 1CTNA 4PMXA 2XFRA 5A6KA 1GVYA 2ZWZA 1UR2A 4EKJA 5CLWA 3GH7A 3WQ8A 5GPRA 1PBGA 1LG1A 5E9AA 4MTVA 2BY3A 4W89A 3TTSA 3BCFA 3WQVA 1XD0A 1J0KA 3BLPX 2PB1A 4TXEA 2YDSA 4AIUA 2XUCA 1UD8A 4W93A 1AQMA 1UD6A 4DM2A 1BSIA 5LA0A 2OSYA 3IJ8A 2WANA 3FW6A 3CV5A 4KH2A 3VVGA 3HG5A 2F1AA 2FGZA 4WLCA 3AHXA 2J62A 5HDRA 4FNQA 4HTYA 4NSBA 4PMOA 3W29A 3W6MA 1E73M 4ZE4A 1QVBA 1MW3A 4KWUA 3B9EA 2EBNA 2VMFA 1C8XA 1TVPA 3BAIA 1V3MA 3GTNA 3EMZA 4DO6A 1Q6EA 3GZAA 3UR7A 4CN4A 3POHA 5DEZA 2UY4A 3T2QA 3D51A 1YQ2A 5I24A 4Y7EA 1F4HA 1AQHA 1B3YA 1ZBKA 2DT0A 5DT7A 4CD8A 1Z32X 3WEMA 2F1BA 1HTYA 1PX3A 3IK2A 1R7AA 1W2PA 3AI0A 1E6NA 4QP0A 4UFJA 5LYRA 1UA7A 2RGMA 3KWXA 5IFPA 1PZ3A 3TA9A 4PBGA 4ML4A 2VC9A 2W66A 3NSMA 1I1XA 2YLLA 4CD7A 3G6LA 1H41A 2Y24A 2WAGA 5BROA 3VTRA 1V03A 2CHNA 1J01A 5KZ6A 1HXJA 1E6SM 1ECEA 3KE0A 3W37A 3WUFA 3WF1A 2EPKX 9CGTA 1QNOA 3WMSA 4LYRA 1J0YA 2YFNA 1AQ0A 1UD2A 4MPKA 3TV8A 1BQCA 1KTCA 3OGRA 4DUWA 2W63A 1NWTA 3L4ZA 4BS0A 4MDOA 1UZ4A 1XYZA 3FHAA 1BYAA 1ESWA 2BXYA 4X9YA 1VIWA 3WNKA 4M1RA 3ALGA 4JCMA 4Z2LA 1UA3A 2OW6A 4PEEA 2XM2A 3WL0A 4DM1A 1E4IA 4JFUA 1XSKA 1K6AA 1KXQA 2WLYA 1C8QA 1VJSA 1UOKA 3AXHA 1UR9A 5D9PA 1L0PA 1QNRA 1C92A 2QMJA 4B9YA 3VDCA 1VENA 2QPSA 1F4AA 2QV4A 2XG9A 1CGTA 1KQYA 2CYGA 2V5CA 3K4AA 4D6EA 1GOMA 4S3KA 3WD0A 3L4UA 1UWIA 2W67A 3QR3A 1ODZA 1FHDA 2JEPA 3H54A 1UASA 3D3AA 1PIGA 1R7OA 3AIUA 1H49A 2BVTA 4JKKA 2NSXA 3WFLA 1G5AA 3CMJA 4IUGA 1V02E 1OIFA 4QLLA 1CXIA 3BAXA 1QI5A 4H04A 1WNOA 2BVDA 5A6BA 1B3VA 1E6PA 5I77A 4HOWA 3BUBA 2WB5A 1JYXA 3T09A 3VSVA 1WCGA 2A3HA 2FHCA 1UH2A 3MV11 5D8ZA 1UR0A 1C8YA 3SCVA 3AROA 2XM1A 3W24A 3VD7A 2DH2A 3F5KA 2DSVA 1DWGM 2E8YA 4AIOA 4JFSA 2XPKA 3WH6A 2XTKA 3VDHA 4KGLA 3DDGA 1LJYA 1VFUA 4GZIA 1E4MM 2XN1A 4L4PA 5FL1A 1UD4A 2DSWA 3VMOA 2JF6A 4WF7A 4DWSB 3WY3A 1CXLA 1OGGA 1KR0A 3D5HA 3GXDA 4P7LA 3VIJA 1W1TA 1UKPA 4V2XA 3MUY1 4RE3A 3GNOA 2WMIA 3VGDA 2WWCA 2J7DA 3WF4A 2GJXB 4AW7A 3OG2A 5BXPA 3WBEA 2FGLA 3BAWA 4C7GA 2GDUA 5TD4A 3ARZA 2XSAA 1TA3B 2VT0A 4S3JA 3RO8A 1JFXA 1V6VA 2ZXBA 3EJRA 2DDXA 2XWDA 2D1ZA 3S5YA 4AD3A 4PMDA 2XN0A 2E40A 2YJQA 3BVWA 1HJQA 2WBKA 4MAZA 1SZNA 3EJQA 4PCSA 2PWDA 3AS3A 2VRQA 3AHZA 3A5VA 5A2BA 3OLEA 2DGAA 3VUPA 1MW0A 1E4NA 1HVQA 4MB3A 5E0FA 1WDSA 1ZJBA 3LXAA 3WDPP 1V3JA 4WIWA 1JAKA 2ZX9A 1CXEA 2CBIA 1XHGA 1E5JA 1WB0A 1H09A 3CUJA 4AEFA 1UWSA 3MI6A 3VPLA 3W4RA 3VIOA 1TCMA 5BXSA 1PPIA 1ISWA 4IM4A 4LQ1A 1E1EA 3BGAA 4E8CA 4K68A 4CN6A 2J7FA 5CG0A 4LYQA 3DX2A 3W81A 3UG5A 2Y5EA 3RJYA 5A6LA 6CGTA 1OBAA 2TAAA 4D1IA 3EJUA 1DEDA 5A2AA 2VL4A 2XIIA 3PTKA 5C70A 5I6SA 4CCDA 1OD0A 2WCSA 3AS0A 2VURA 4AZ5A 1JXKA 1V0KA 2UY3A 3GH4A 1BVZA 1JZ8A 5GNZA 2EO7A 3T2OA 3ZMRA 4NX0A 1ZB5A 4RE4A 1NWSA 1HKJA 4PYSA 4RL3A 2EQDA 3CHCA 2J7EA 2B31A 4CU6A 4URIA 5CLTA 2QLYA 3FAXA 3EDEA 4JZ5A 2VZOA 2CITA 4PTXA 4J7RA 3SCWA 3L2LA 1SR0A 1D3CA 2ZX8A 1KBKA 4CVUA 1TQTA 2W62A 3NDZA 1CBGA 2PWFA 4HMCA 1UR8A 3AS2A 2EXOA 2E0PA 3W25A 1HJWA 3FN9A 5DMYA 1V08A 4JCLA 2F7RA 2O92A 4HMDA 1Q6GA 2YL5A 3BUQA 4TX8A 1DTUA 1P6WA 1N82A 3IGUA 3A4AA 3VM5A 3AS1A 3TTQA 4OJYA 4U3CA 4XX6A 1NM9A 1CXKA 3O6AA 4ATLA 5A8OA 1D2KA 2ZUVA 5IXEA 2C7FA 4OOUA 1VFOA 4AY1A 4H2CA 1E0XA 2WNWA 2XVKA 1FFRA 2CBUA 3FHQA 2G3MA 1IT0A 4U2ZA 3KL0A 2W92A 2VR5A 1VJZA 1WDRA 3RILA 1OD8A 2RGLA 3AXXA 2DEPA 4Z2HA 4HU8A 2OYLA 3ARYA 4CD5A 3AHVA 2JIWA 5E0CA 5I79A 1GNXA 5E6YA 1V3IA 3PBGA 4ACZA 1GOQA 3D50A 4MNJA 3LX9A 3K46A 3WQ5A 2GJPA 4AZBA 2VCBA 5HBFA 1H1NA 3EMQA 3DC0A 4YN5A 3HJEA 4BF7A 5CPSA 3ARPA 4PCTA 1J9YA 2ZXDA 1WE5A 1LL7A 5A8PA 3W82A 3ZJ7A 2F8QA 3AMDA 1JDDA 1XV8A 3BVXA 2EJ1A 1ZU8A 4HA3A 2W5FA 4GI6A 5DFAA 4Z2GA 3TONA 1UYQA 1DP0A 4M81A 3WSUA 4AMCA 3WEZA 1V6UA 1AVAA 3LPPA 3WY2A 2VZUA 2DIEA 2XFYA 5A8MA 3WENA 2G3IA 4J28A 1JZ6A 3G6MA 2VO5A 2YL6A 3M6DA 1JD9A 2VOTA 4P7RA 3ZJ8A 4TVDA 3WUGA 2G3JA 2NW0A 3AMKA 2Z1SA 5CPQA 3K1DA 3AQUA 4MNLA 5A6AA 3L2MA 2OSWA 4JIEA 1EO5A 3AZSA 4WSJA 1Q6FA 3QOMA 1TR1A 5FOOA 4UCFA 2C8NA 3CHFA 1CLXA 4RE2A 3HMCA 4ZXLA 2WVVA 2WMKA 4Z2JA 2WMHA 1MW1A 4OUEA 2Q8XA 3EDFA 4ATDA 2VUYA 1JG9A 4GXPA 4Q7NA 3PZMA 3DHPA 1J11A 3W28A 1B1YA 5JIPA 1ISZA 2X2YA 5FIPA 2XSBA 1E3ZA 4M29A 5ABFB 4AD0A 3KEHA 3F4VA 1J10A 2DQXA 2WSKA 2ZUSA 1GJUA 4HA4A 1EQPA 1UKQA 1BYCA 4GKLA 3N1AA 2E8ZA 1KGWA 1NWUA 4HZ7A 2D20A 1MQPA 1W32A 1MYRA 2HISA 1UQYA 2VX7A 3WBAA 1KXVA 4AZCA 4P8XA 1G01A 1V3LA 4XUYA 4JFVA 4N42A 1W1VA 2J7HA 4AYSA 4AZIA 1JZ7A 1QWUA 4X0VA 1X1NA 2UWFA 4H8HA 3WDQA 1QW9A 3ZT6A 3TP4A 3ECQA 2VVSA 3A24A 5I78A 2V38A 3RM9A 2HVMA 3WD2A 1B30A 2XVLA 4V27A 4CCEA 1KBBA 2J7GA 5FD0A 4LPCA 2VQTA 1JZ3A 2DPEA 2A3AA 5IDIA 1RD6A 5E1QA 2OWWA 2CXGA 5CXPA 3PZNA 3RJXA 1US2A 2WC7A 3IJ7A 3VIGA 2FYVA 3KLLA 4XV0A 3PZQA 4YHEA 3UEQA 3L4YA 4XB3A 1HNYA 2FDMA 3VX0A 1FFQA 2D2OA 4PN2A 4B15A 1E6ZA 4P8WA 2GFTA 3EYPA 1Q6CA 3HG2A 4MDPA 1JFHA 1HKIA 4U31A 3W53A 1LLOA 3MANA 3VIHA 1IV8A 7TAAA 1PAMA 4AC1X 1EXPA 3WNMA 3ARWA 3WF0A 3BMVA 2V3FA 1FH7A 1BGGA 3WUEA 2E4TA 1XH1A 5GNXA 1C7TA 5DF0A 4F8XA 4UTFA 1UKTA 1S46A 5CPTA 1OB0A 1R46A 5AC5A 3OLDA 4OOZA 3ZT5A 1WZKA 5FL0A 1V0LA 2BV9A 1M7XA 2YDRA 1EDGA 2CBVA 2JE8A 1HT6A 3HN3A 1JZ5A 1TUXA 3LRLA 3SCQA 3WDIA 5GQBA 2F2HA 7CGTA 3MUIA 4W87A 1OGBA 2WKGA 1W9UA 2BFGA 3PZTA 4C7FA 3KLKA 3WUBA 3A23A 5HXMA 5EFDA 4AD5A 2VRKA 1BYDA 3L4VA 5JUVA 2WVTA 3LXBA 1OSEA 3VGHA 2OLHA 3S6TA 3K8KA 3UG3A 3WKZA 5BXRA 4FLOA 1SFSA 3QHMA 2J7BA 4ZENA 4AWEA 3H53A 4NRRA 4U3AA 1UQZA 1W1PA 3L4XA 3PZOA 3M46A 3SEPA 1BVNP 1OT1A 2BS9A 2J4GA 1BHGA 2EABA 3VX1A 2IUZA 4TTUA 2F7OA 4BZYA 2WWDA 3BLBA 1GOIA 2WC3A 4CKQA 3T0DA 4CU7A 3CH9A 1TQSA 2NT1A 2XJ7A 3T2PA 2QMKA 1JF5A 5LA1A 4NRSA 1HWWA 1JXJA 3PTQA 2QPUA 3AIEA 1HVXA 1PJ9A 5A8QA 3EDKA 1E56A 1R33A 4D6FA 4AD2A 3ARQA 2CPUA 1E3XA 2JEQA 2JF7A 1BGAA 1R47A 4BQ4A 3CHDA 3WQWA 4H8UA 4N0RA 2PWHA 4BQ3A 2VZTA 3ZR5A 1GOWA 2C0HA 4GZEA 2D3LA 1HP5A 1E71M 1QBBA 1GW1A 4QFUA 2UY5A 4TX6A 1FOBA 2ZIDA 1FP9A 5D9OA 2WBGA 2VX5A 3BLKA 2WSPA 1V0MA 3CZKA 3CTTA 4GO9A 2YIHA 3NUKA 4PRWA 2GDVA 3SUWA 4UOZA 1KCKA 4GZJA 5EMYA 2VX6A 4PMZA 5A6BD 5HPCA 1UHVA 5CGMA 2X05A 2GVYA 5ABHA 3GM8A 2WW5A 2YBTA 4W88A 1G9HA 1WPCA 1EDQA 3VOCA 2FH6A 1A3HA 3BAJA 3ZT7A 1EDTA 1QOXA 4DUVA 3VSTA 1TQWA 3VKKA 3MO4A 3F5JA 3K8LA 1HP4A 1WP6A 3J7HA 3RCNA 3HG4A 1QNQA 2D24A 2GK1B 2IXUA 3OLIA 2ZX6A 3OBAA 4NXSA 1E0WA 1C3FA 3GYCA 2EPOA 1NWRA 1R86A 3CUHA 2X2HA 3RMEA 1BLIA 1H2JA 3UESA 3CZGA 4GINA 3WY1A 1ISVA 3A47A 1W1YA 4UFMA 1GVIA 4P7OA 2AMGA 3A4XA 4D6GA 2OSXA 3B9AA 4W8BA 1QWNA 4ZFMA 4WK9A 3ZM8A 3JUGA 2ZOXA 4HA1A 3VGEA 1H11A 2YDQA 1AMYA 1EH9A 4HZ6A 1GOKA 2UY2A 5D9NA 2BY0A 1ZJAA 3CLWA 3WEOA 3NJ3A 3MMUA 1B0IA 3PZIA 3BUIA 1B3WA 1JGIA 3CZJA 2VJXA 3EDDA 2FH8A 3ARUA 2ZUMA 1L8NA 3KZSA 3BXWA 3GDBA 3HG3A 1W9PA 4UFKA 3O2LA 4B3KA 4D6HA 4UFHA 3LRKA 4AZGA 1XRVA 3VGGA 2J75A 1JZ2A 3PZGA 4LX4A 1CLVA 3K8MA 4MJ2A 3TTYA 3NDYA 3U7BA 1EIBA 1UD5A 1W9VA 4MJ4A 3L4WA 5I2UA 1VBUA 1KGXA 1WO2A 5JBDA 1NQ6A 5HNNA 1X6LA 2J7CA 4R5EA 2WVSA 5I0DA 4AIEA 4GI8A 3QHNA 2YA0A 3AYRA 3GNPA 5D9MA 3WDJA 1H5VA 3AHYA 1EHAA 1QX1A 4HU0A 3AISA 3DYOA 3ALFA 3CBWA 2YKKA 4MADA 3HZ3A 3SCSA 2XVNA 3NIYA 3II1A 4FF5A 4YPJA 3PTMA 1TVNA 1KGUA 1K9TA 1XC6A 4OZOA 3WDRA 4EANA 3ARXA 4W7WA 3FAWA 1UD3A 1E15A 1O6IA 2EADA 5CSUA 3N13A 4CCCA 2VI0A 1A47A 2EACA 3BSGA 1LWHA 3CUIA 3GH5A 4KMQA 3VNYA 3RM8A 3CIVA 4JFWA 1VB9A 4UFIA 3UG4A 2ZUTA 2X0YA 3RPMA 1QBAA 5AYBA 2CKRA 4MNKA 2V3EA 2YFOA 4PMNA 1TMQA 1UR1A 1E5NA 1EQCA 4D6JA 2OYKA 5A94A 2OW7A 4JAWA 1MWOA 2J78A 1B3XA 2CIPA 1OIMA 5D8WA 2PF0A 1BPLB 2BHYA 3CHEA 2IGTA 3WH8A 4F9JA 1E55A 2WMGA 3SCTA 4BQ2A 2VZVA 1VAHA 1OINA 3ZOAA 1R87A 3K4DA 1X6NA 3GXMA 3ZR6A 3CZNA 1ODUA 3N11A 1E6QM 2VZSA 3S5ZA 1JNEA 3PZUA 3IANA 3MMWA 1M03A 3N17A 1CIUA 3EMCA 2G3NA 2OYMA 1WAWA 4TVUA 4QAWA 3SUTA 3B9DA 1ITXA 1WDPA 3AZRA 4UOQA 3VM7A 2DSUA 3ARVA 1C93A 4QCEA 3OZOA 1E1FA 1U2YA 3A3HA 3A6OA 4W86A 3AICA 4J3TA 3MMDA 1UH3A 4MAVA 1QNSA 1I1WA 3MSGA 1XH2A 3D4YA 1PX8A 4GO8A 1ZBWA 3NSXA 4IPLA 1CNVA 1MFVA 4PMVA 4L4OA 5IHSA 3WNNA 3SCUA 2EAEA 4GI9A 1TQUA 3OA5A 5E70A 4Q22A 1CECA 3WNLA 3NSNA 5AC4A 1HJSA 3GBDA 2WMFA 1O7DC 5CJ5A 4W5ZA 1I75A 1G94A 1YHTA 2X09A 4PSPA 4E4PA 2X2JA 3N12A 4JHZA 1W3KA 3WD3A 3VDBA 4HMEA 2CESA 2ZWYA 4AMXA 5BRQA 1GQJA 1UG6A 2CERA 3ARRA 2O9RA 3QOKA 4DWSA 3LXCA 4MB1A 5JIWA 2XVPA 2Y8KA 1V6YA 1FP8A 2XHYA 4IISA 3DHUA 3AOFA 1FH8A 1JDCA 1XD1A 2VTFA 1HJXA 1UZ1A 2WPGA 1VFFA 2GJXA 4W8AA 1XCXA 3VD3A 3AIVA 3GBEA 1SMDA 1JAEA 1M04A 2QF8A 2J47A 3U7VA 1MQRA 2QHAA 4P8UA 2D3NA 1E6XM 1TA3A 2GSJA 1Q4NX 3AFBA 2O9OA 4NI3A 1XSJA 3UCQA 5ECUA 1O7AA 3RDKA 3WN6A 3VILA 3WQ6A 5A2CA 2WHMA 1EA9C 4CU8A 3U5YA 1E43A 2X2IA 8CGTA 1EHNA 4WKHA 1EO7A 3GXNA 2CKSA 1JDAA 1CEOA 5E6ZA 3HU7A 3B8SA 3BCDA 1OCQA 2DT2A 1GZJA 4B9ZA 1OWQA 2XGIA 1OM0A 4H41A 1G0CA 1TZ7A 1ZBVA 4NF7A 4HOXA 3THCA 2YA1A 2WC4A 1HN1A 3POCA 4OKDA 1HIZA 4BQ5A 2W91A 4PTWA 1CXHA 1GQLA 1KTBA 4E2OA 3OZPA 3W27A 1KWGA 2J74A 1EGZA 1C90A 1KXTA 3AMLA 1SMAA 1OT2A 3OGVA 5DT5A 2G8ZA 3ZSTA 2PBGA 2CEQA 4DUXA 1B90A 4ZXOA 1T0OA 1CZ1A 3VD9A 1MQQA 3EBVA 4CGTA 5LA2A 1H4PA 2X0HA 2FHBA 3WL1A 3BAKA 3VIIA 1CDGA 1NP0A 2WM0A 3PN8A 4AZ6A 1UKOA 1VRXA 4A4AA 4JL1A 2WMJA 1QI2A 4AZHA 1ITCA 5BXTA 3WNPA 3DECA 3BC9A 2Y2WA 6TAAA 1DHKA 3MKKA 2VX4A 1GOOA 3OGSA 1H0IA 4YHGA 4MNMA 1UH4A 2PBOA 5BYWA 4EE9A 4MB4A 1QHZA 1MW2A 4OBSA 2XYLA 2WCGA 1VBRA 3LMYA 3VGBA 1CWYA 4PMUA 3DX1A 1GHRA 3FXYA 1ZS2A 1J0IA 4FNUA 4U33A 4CN1A 2ZXAA 4FLRA 4D71A 5M3WA 4UFLA 3ZO9A 1SYTA 4FMVA 4WKAA 3PZVA 1BAGA 2F7PA 1E9LA 3AZTA 4J3VA 4PUDA 5C8BB 1UR4A 1VEOA 3QGVA 2DSZA 3UERA 3AJ7A 5D4YA 5CQ1A 2ZX7A 2VCCA 1DWIM 2XVGA 2O9PA 1KB3A 3VO0A 5I3DA 4JKLA 2GJRA 3BVVA 2OWCA 4D1JA 4UQBA 2WK2A 1JL8A 3MV01 3OLGA 1KFWA 1RPKA 1ISYA 3WQ4A 3TOPA 4M82A 1UUQA 4OGZA 3WDHA 1HL9A 3CZ8A 3D52A 4NXKA 2AAAA 2EPNA 5ABGA 4FNSA 3WMCA 5IFTA 4KRUA 3SUSA 1W3HA 1FH9A 1V6WA 2WKLA 3WH5A 4ZEPA 4FNTA 1J0ZA 2ZX5A 2F61A 1V3KA 2BY2A 3UR8A 3MS8A 5KEZA 1FHLA 2WXDM 1HKMA 2V3DA 4A3HA 1CENA 2F18A 2DSKA 1KR1A 3EJPA 4TOQA 3VIFA 5CZKA 2WYSA 3W6LA 2XGBA 4HPGA 1VF8A 2Z1KA 2AOSA 4MB5A 4TVCA 1WKYA 1QI4A 3GXIA 3SURA 4AEEA 4CUCA 3NCOA 3SCOA 2D0FA 3DX4A 1DWAM 3O9NA 1M53A 1MVYA 1PIFA 3VGFA 2ALWA 2A3BA 4OIFA 1GQKA 3DYMA 1PEZA 1W3LA 3VD4A 2EPLX 3U5UA 2XIBA 1BTCA 4W8LA 2VVNA 4OBRA 4P7QA 1DWFM 2VNCA 1JYNA 2E9MA 1GUVA 1GORA 4ACZB 4W7UA 3FY1A 3W26A 1UWQA 4PTMA 1QI3A 4J3SA 4P8VA 4ZE5A 3DX0A 2V3GA 2CHOA 5AYIA 1J0HA 5HOSA 2EEXA 3AMGA 1BG9A 4DO4A 3VDAA 3MUZ1 4JHOA 1FA2A 1JYVA 4PMRA 3W0KA 3IAQA 2J25A 1JF6A 1XGZA 4UOJA 2WHJA 4GIAA 3THDA 5A8NA 1LL6A 2VR4A 4PMYA 3U57A 1NOFA 1MXGA 2YBUA 4AD1A 1W2VA 1CGYA 1W9DM 8A3HA 3VU2A 1HXKA 4WKFA 2VQUA 4GQQA 4FLSA 5ABFA 5JBFA 3EDJA 1UKSA 3W38A 3A21A 3I3EA 5A95A 1E40A 3WNOA 1UWTA 3A22A 2YL9A 1PS3A 1QNPA 4B3LA 1GQIA 3PHAA 4V28A 1Y7VA 2FE0A 1JI1A 1UWUA 3E1F1 3QHOA 4KGJA 4M24A 1B9ZA 4F66A 2WZEA 4LYPA 1RP8A 3GXPA 1V0NA 2DIJA 1M01A 2ESCA 1VEPA 3EJSA 1J0JA 1ISXA 3I3BA 3A4WA 4J3XA 1E6RA 3T0BA 2CNCA 3RIKA 3H55A 1JZ4A 1W9BM 4AD4A 2Y8VA 3VIMA 1RH9A 1JD7A 4X0NA 2WVVB 3NYDA 2ZUUA 5A6MA 3AMCA 4P7NA 1WZMA 4LXFA 2WZIA 5GNYA 1U33A 1R8LA 4J3UA 3OIHA 4A3YA 1CXFA 4D72A 3DDFA 1HJVA 2A3CA 3WELA 4U5KA 1H0GA 2J8FA 1LL4A 4UQCA 5HPOA 2J77A 1MXDA 3FNDA 1IZKA 3AIBA 3GNRA 2D0GA 3CMGA 1J12A 3AHTA 4WJXA 2F7QA 2BVYA 3F5LA 2W4XA 3ZJ6A 2IXVA 4UQ9A 3M7SA 2YOCA 4HP5A 4F79A 4CD4A 3CUGA 4HPHA 2CBJA 1WZLA 1QPKA 1XH0A 1NOWA 1BF2A 4JFTA 5A69A 2ZXQA 1E4LA 2WLZA 2JFEX 4W84A 1QW8A 1TFVA 4AZCB 2YLAA 1B3ZA 3VINA 3VIKA 1QI0A 1V6XA 1Q6DA 4UNIA 1B2YA 2OWXA 3OB8A 3ZIZA 1CGVA 2D73A 1TG7A 1EOKA 1R85A 3VIPA 1J18A 5ABEA 1QHOA 4EK7A 1WDQA 1LQ0A 5M17A 1CPUA 4PSRA 2X8RA 2WHKA 3WH9A 4AXNA 4GQRA 4Z2KA 3LPGA 3BVUA 3CO4A 4WSKA 1E0VA 3AIQA 3GXFA 4AYGA
chains in the Genus database with same CATH superfamily
2Z1BA 5KYWA 3RL1A 4UR9A 1GYUA 2N7BA 1I7TB 3D85B 1OGSA 2C9RA 2FRGP 4QRPE 3QDJD 4GYFA 3F2CA 2WZHA 2X4RB 3KHOA 4JN1H 1G9NC 1O5KA 3DJTA 4H88H 3E2QA 3N43B 1U6AL 5DJYA 3QY7A 3BKML 5F7NC 3SDXF 3CUXA 5FUOL 5GRYA 3HI5H 2ZRZA 1SDYA 4HNCA 3IDMA 1GYAA 3MCOA 2A6DA 4ZZFA 1NP2A 3CAKA 3ZDYF 2O4MA 4KZDL 5ES4B 4DBDA 5EZIL 1DXEA 3CDGA 1N64H 5HI3C 2I14A 3MOAH 2J71A 1FG9C 1MQ8A 1HL8A 4GFXA 3A4EA 5A3HA 4MZ8A 5EU4B 4PGDA 1F07A 2MMXA 4AMKH 3IIXA 4L3EE 3V9FA 5JORA 4TUJB 5TDNB 4QPEA 4AISA 1S7QA 4ZQOA 3HG1B 3SO5A 4MFHA 1U30A 3P0VH 4GE8A 2D31B 3MWAA 2AAMA 4GSQA 4QM1A 3CFUA 2PWEA 3WMQA 4DJFA 7FABH 1QQDB 4O4YL 4G56A 2WSYA 2ZG2A 2JKWA 1P6AB 3MUHL 4OZGB 1NEZB 4MXVE 3LBCA 4OIIH 4IRZA 3BAYA 5FCSH 4FNLH 1PSCA 1A6AB 4QOKE 5FKYA 4NO2B 2ENYA 1KMGA 1NBCA 4HK5A 3PIQB 1H6TA 2YA2A 4XZBA 4R88A 3NL6A 1OX6A 3ROOA 5CZXC 1KTDA 3UZZA 1WKDA 2OAAA 3G04B 3VSQA 4LCWD 2NVCA 4FXGC 1CDHA 3P3UA 1BD2D 5I9QB 1WXYA 1UBPC 2JTDA 3W9DB 1F3JA 1ZLPA 1S9VB 3BVTA 1U3HC 4XWOD 5EBMB 2VSDA 5KVEH 1T5XA 1FZOA 1UOVA 5KSAB 5CP3A 4L2YA 3B8DA 2P80D 2BY3A 1A14L 3VXSE 7PCYA 3M1BA 1AQMA 1UD6A 5C2UB 1BVKA 3DRTA 5AENA 1SGKA 1A25A 4WLCA 3EOUA 4PJBB 2H0JA 2QDEA 1N8OE 3S3PA 4OKVB 4FPSA 4N0UE 3DFQA 1Z9OA 5JHLL 1D9KD 4ZO6A 3EJZD 3SKJH 3V6OC 3POHA 3VNDA 5KINA 2UY4A 2DJXA 1MEXH 4MD4B 4F7EA 3ZKND 4JPVH 5DT7A 1UVQA 4IZGA 5C0RL 3ECVA 1SYSA 3I2CH 4WJ5B 4QP0A 1AQKH 3CV2A 1PZ3A 4BFIB 3SJVB 5LIKX 1I1XA 2X0WA 2YLLA 3ARBC 4YHIA 4PUMA 5F6HJ 4DPPA 1UGKA 3LRSA 1IEIA 2JB5L 4LNVA 3WIAA 1AQ0A 1AJ7L 1R19A 4UBPC 2AZUA 1X5MA 1UZ4A 1Q9KB 3L5XH 3M17B 3REQB 4R7VA 4LO9A 3T8VA 1BXUA 4O1AA 1AKJB 2XM2A 3S35X 2TMDA 3MBXH 4YEFA 2AEPH 5D2LE 4DNMA 2X88A 3AXHA 3C2AL 2G4JA 2VCOA 4ABWA 2N0MA 1WKFA 3HBPA 1SN0A 4TSCL 4MMYA 1OTSC 4BK5C 2ZNXA 3CMJA 4QLLA 5EORH 3GO1L 5K9JH 3EHBB 4JD4A 3A3YB 3GSNB 4HOWA 3BUBA 4B3VA 2HV5A 1Q9WB 4G1MA 3NRPA 4XCFL 5E2VL 3RIFF 2APVA 1KM6A 4HFUL 2DH2A 1DCLA 5HHQA 4X22A 1DWGM 2GQ9A 1DJZA 3BIKA 1YDNA 2DBJA 2DFAA 1OGGA 2P3ZA 3WKYA 2BW5A 2EKCA 1ZGLB 3GNOA 1A7PL 2J7DA 3ATAA 5LDSA 2F9RA 2I5QA 3X3FH 4P5KA 1RZ8B 2ZXBA 3H56A 1CD1A 5ABTA 3B0UX 1R3RA 5INDA 4CBZA 4RZBA 5IROA 1N2RA 4OLZL 3W76A 3Q6GL 2GJZB 2PWDA 1TU2B 4EBQH 5A2BA 4FQXC 3MROB 2X1RA 4JTFA 3RX3A 4APQC 1GZQB 5E0FA 2XQBL 4BCYA 4G7RB 3MP4A 4ZMLA 5CBEB 1KM5A 3UJTH 4QDWA 4F58L 1RLCL 4M4RB 1K85A 1WAPA 3CH1B 3HN8A 1PPIA 2YKLL 4IM4A 3W01A 1CB2A 3B3IA 6CGTA 1OBAA 4D1IA 1BYPA 2GWNA 3PR2A 3VUSA 1HG3A 4TUKH 4HBQA 2BWDA 2OEJA 3G08B 3RFZC 2G9HB 1X9QA 1JZ8A 2EO7A 4XVUC 2UWEE 1XFPA 5L9FA 1KJ3H 1RK6A 4AQ1B 2C16A 4CU6A 4MHHI 3QDJA 1MOEA 2DYPB 2VUOA 3WFHA 1ID2A 3R19A 1EJUC 4Y2DD 1PB0A 4G5AA 4OFCA 4GBXC 3NM3A 1MN4A 3VYNA 4OR1A 4FP8H 3W25A 1HJWA 5D7LD 4PJEB 4HC1L 1FUNA 1KGCD 1A6UL 2DWTA 4ML9A 2FUTA 3UNTA 1FE8H 3GKWH 1TTAA 5IB3A 5HNUA 3UYIA 2VDNH 1JJUA 2UY7A 2R1WA 2C7FA 2X89D 2YPLD 3S46A 3TCLA 2LW3A 4KJQC 4OGXL 4Y2OA 1FFRA 4PV9A 1UOWA 3TIEA 3FHQA 1XKYA 1TUPA 5KZCB 4KU1A 3BJLA 2VYOA 4GY1A 4KZEH 3W2LA 3L3OC 5DZJA 3RILA 4XIMA 4LSQH 3GFYA 2ESVB 3ETBF 4UQ3A 2IWGA 2JQAA 1F86A 4HF5L 2IDSA 3GMQB 2HS6A 4XX5A 4U1NA 5D6DA 3FH7A 4YN5A 5E4IA 5AAMC 5HATA 2WXOA 1HOEA 3W82A 3WIFB 2P5WD 1XMEB 3QV9A 2W5FA 1EO8L 1JPDX 5F0MB 3ZHNA 4DP4X 1FTXA 3GGWB 4MY1A 3FPYA 1UB3A 2VZUA 2DMCA 4XAZA 1GA2A 3ZJ8A 1EHLH 1P1MA 1W8SA 3UWYA 5CPQA 3ZDZF 1ETB1 4Q97A 1Q6FA 4CILA 4AZ8B 4XAKD 1CLXA 3HMCA 3G0UA 3IE4A 2INEA 5IW1B 3BSZH 2OX5B 4YFEA 1ZWIB 4OUEA 3ZN6A 3L6FB 3O2DH 5DRWA 3TQKA 2L0DA 2OZ8A 4UTTC 4BELD 1B1YA 4DEPC 4YYFA 3KPLA 4JKPL 1N2VA 1KJVA 3UAJD 4LCWA 1GJUA 4Z5RA 1FNSH 1FN4A 3W5NA 1AIZA 1BD2A 1OQXA 1MQPA 2HISA 1I3VA 3GWJA 2R8SL 3GY1A 3AQZA 1GC1L 5IMKA 1QW9A 1HH9B 3TP4A 4YDNA 1I7RB 1TPFA 5DEGB 1WHPA 2MCAA 4A38A 3EJYC 2P80A 1KBBA 4F7CA 1ZE3C 3VXUD 5IDIA 5DJDA 3TA3C 5MEND 5CXPA 5E5RB 4XNMB 4WO4D 1XYCA 1TPUA 2W9DL 4TRPH 3M7OA 1GY1A 1XIWC 4MZIA 1I4FB 1UFGA 1HNYA 3WLKX 3QR1A 4JREB 3NSFA 3GAYA 1USZA 1FJ1B 1TSRA 1HKIA 2ADJB 3T1FA 3GJFA 1D9KA 2DLGA 1WFUA 1INDH 5GNXA 1ZT1A 2J5WA 4I13B 3MHUA 2UV8G 4I3SH 4YNYA 3KWVA 3QULB 2HRPL 3EWWA 4U1KA 5KYWB 4E9YA 2F2HA 4W87A 1W9UA 2TSYA 5F2FA 1FL3A 3U2IA 4WEMB 2ICSA 5GHWL 1RSFA 4H1ZA 3FDKA 3LXBA 4ES4A 3UG3A 2Z8VC 4XZIA 5EIIG 5DJYB 1RCYA 3L4XA 3M46A 1Z5YD 5AYTA 3QJOA 2YGOA 1XIHA 1QNZH 3H2NA 1I8LA 3IDMB 1DQTA 4H20H 3BWAA 2A6DB 4HAFA 4LVDA 1WCBB 3GZOA 1LO3L 2R1XA 3G3LA 3W5MA 3LEYL 5J5DA 2JEQA 4PVLA 4F92B 4ZUVA 3CDGB 2VZTA 5T3ZD 1HHKB 4UTLA 5LZLA 4HYRA 3Q2WA 1FP9A 4YFLF 2VX5A 3H0TA 4YXHH 2NV1A 3MPGA 3G6JA 2VDPH 4PGDB 1VACB 3SQMA 4K3JH 5F89B 3MMTA 4G2DA 4C83B 1FZMA 2TYSA 2NX3A 5EU7C 2C7UA 4NZ5A 2NNAB 2Y1ZA 1I9RH 3APNA 5AD0A 3NQ7A 3LPWA 2EXYD 3QC3A 2XYCA 1E9YB 3I9AA 2QGHA 4LEFA 4FTDA 3L9RA 4AVHA 1BM3L 2V5JA 3LD5A 1XF3A 3ZM8A 1IIHA 3C12A 5FM5O 2HRLA 4DWDA 5D4IA 4PJDE 3OQ3B 1WXJA 1VHPA 3BW2A 2YW4A 2XRAH 1KOAA 3WO4C 5L7XL 1ORQA 3ARUA 3VFNA 3VC6A 1VZIA 2J6EA 4FQQA 5F4WA 3V9CA 3ROOB 3RWIA 1KTDB 3NAAH 4B3KA 1GS6X 3CQIA 2VO8A 3C2OA 4CC1A 2JKTM 4ICNA 3FK4A 3V0VA 1Q8AA 2QULA 1EXBA 1L0XA 4PLNC 4G6JH 4XAFA 1I1YB 3D18A 3AYRA 2WLLA 2X1UA 1EHAA 1WFIA 1LDPL 1AE6H 4K9EL 4WW1A 5I6KA 1FZOB 4V2BA 3UTTE 2ZFAA 5AHIA 1E15A 3VXME 3CN2A 2VI0A 2CMRL 3R6IA 4N6RA 2J2ZA 4RDWA 5DMIH 3KHDA 3DUUA 1U8CB 2BC4A 3M1BB 5D7IE 4NJJA 1QMUA 1BVKB 5JQ9A 3DRTB 3FC8A 2WOBA 4Y2DA 3D0VA 3DTUB 1EB3A 1PWMA 2R0WH 1BPLB 3UC0H 3OVUB 4M1DH 5D7LA 3KM1A 2B2XL 4Q58C 3JVAA 1VAHA 3OJDA 1HQRB 1AIFA 1XL4A 4WDTA 4TPRH 4F7EB 3O2VL 1XCFA 3RWGA 2WO4A 2UXTA 2YPLA 2X89A 3L8QA 2DQCL 1MCKA 4BXVA 1SYSB 3IANA 3SRFA 3W1MA 4BWUA 5KAQG 2G3NA 2XXGA 4N5UA 1FWTA 1S1PA 3V0FA 3SUTA 4YHIB 4L80A 2P43B 3CX2A 3LRSB 1J5SA 2H8XA 3W9EA 3ULAB 1PX8A 4MPQA 4NJGA 4Q6IB 5IHSA 4FX8A 5IB1B 4JFEE 4JNYA 2P5WA 3HFML 1OZTG 2X53A 4PTDA 4MOZA 1J88A 4HIIA 2H45A 3WBDA 3ILQD 5F8RC 1YHTA 3LH2H 3R0KA 4XNDA 1NTHA 4D7BA 1JDCA 4UIKH 1BZ7A 5DD3H 4ESKA 3KM2A 2VC7A 3OZMA 4M6PA 4OD1L 4JOMA 2J47A 3P40A 4BD4A 4GJIA 5AAWC 1TA3A 2BG5A 3KDMA 1IX2A 2C1OB 2FGWL 3U0PA 1SXBA 4RUBA 3LKOB 4G1MB 1FWJC 4Z7QE 4QYOA 5HHQB 4LEXH 1ZBVA 3RHWF 3QDGD 1DZBA 3A0OA 3UAJA 1B88A 1U2CA 5GRVL 4DZBA 1ZQ5A 4I7ZC 3GI9L 2EICA 2ZG3A 3P4LA 2NMSA 2CEQA 1E6JH 2J88H 1K8DA 1FIEA 4P5KB 3WKMH 4HHHA 3DFTA 1UKOA 1PE1A 3C2SA 1CD1B 1EGJH 3VXRD 4RMVA 4X3ZA 3JWDH 2YXVA 4B5SA 4ODUA 3VXUA 2OM5A 4IT1A 4X7DC 2VX4A 1N2RB 3SCMB 5MENA 1GTFA 1ADSA 4YHGA 4WO4A 2B7PA 3TCXA 3C52A 4PJXA 3K71B 2XTJB 3IK4A 5CEZH 4WI9A 3KS6A 4HIEA 3SAZA 4CNNA 5G5IA 1VLWA 3AZTA 4I7VA 3RVXD 3DERA 1VGKB 2ZT9C 3KPSD 1UEMA 3BL3A 2QHRL 2X4SA 3DH7A 2IKIA 4JYEA 4DF1A 3B3IB 4HG4J 5D2NA 5ACLA 4Q2ZA 2N4IA 5EZJA 3VFPA 4C4BA 1MHEA 3TROA 4CQBA 1XS2A 3FEMA 2GUBA 3WQ4A 1AZ1A 4LVBA 3CUZA 1IGTA 4ZB0A 3PVFA 4Q8OA 3T71A 2G5UA 3WMCA 2P28B 3WH5A 3WFHB 2XH2A 1PZAA 3P0WA 1WWWX 3H8AA 5KEZA 4XBKA 2X6AA 3CXHK 5FFLA 2OJ1A 4LNCA 4MKVA 4JQXA 4QXIA 1FCQA 2VDMH 4YHYC 4ODWA 1KENL 1VZWA 1D2PA 2HRGA 5IB3B 1RUML 2UY7B 2R1WB 2X16A 3TCLB 2Z25A 1RKRA 2VC2H 1EAOA 4OIFA 4US6A 3F2BA 4GO6B 1QVOA 2HTLC 4ZR8A 4V15A 1K8ZA 4OE7A 2F5BL 4UT6H 4PCPA 4UQ3B 1HTIA 3FY1A 2O5XH 3BLEA 5KS9A 4YVXA 4I3RL 2AXHA 3MUZ1 4U1NB 4XO8A 2QGCA 1FWIC 1BXVA 2V7HB 4JO1L 1DJWA 1GGUA 1JF6A 4A3RA 4DHLA 4Y4KC 1HNFA 5M7QA 3FUKA 3RP1A 3KW8A 5JQ6H 1WUFA 2XA3A 1MCNA 4A7VA 3SPCA 3CQ0A 4NP4H 3BLIA 2VITB 1CLYH 4V1XA 2VXVH 3D87B 3ATDA 1DQXA 4P46D 1R5WA 5HAOA 5EBUA 4M4PA 3C9NA 4HEPG 2JFCA 3V4VB 4X4XA 5CFHA 1H5YA 2EEFA 1PKYA 3MBWA 5J3HC 2XH7A 3BDYH 1IE5A 1DTNA 2HQAA 3EKCA 3QCVL 2DVTA 3DX6A 2ED7A 2V2TA 3IDNA 5KVDE 5HY9A 2GZXA 5I8EB 4OZIF 4P9HH 3EPOA 3FFCD 5DRWB 5AECA 3H9HA 5KSAD 2JLPA 1K8XA 3CVIH 3KPLB 4MKMA 2ZKMX 4KXBA 5AW3B 6TIMA 4FG0A 2IXVA 4CNIA 1KJVB 4LCWB 3TXZA 4C91A 3S3SA 1HJCA 3CUGA 1BD2B 1XH0A 2I5GA 4DGIL 1DLHA 4M61B 3N0PB 2YEZB 3NSCA 1HINL 4YJZL 3GRIA 2OMVA 4JN6A 1RY8A 1PUDA 1UIPA 1CGVA 1A1MA 5IMKB 1PTAA 2FB4H 5M17A 2OULB 4HZAA 3ULSA 1I8UA 5FAJA 5IVXA 3LPGA 2TSAA 4WVRA 4F7CB 3D0AA 2NCEA 1EGMA 5A6JA 4RKAA 2XV0A 1WZAA 2XWZA 3DTXA 2YPVL 4AJYV 4YXLL 2Y9RT 1WUEA 4LCUA 4KHXL 4O1BA 3SJVD 2CO4A 1R38A 2QR6A 1FO0A 4JRXE 3H26A 3T1FB 4JNZA 5IQMA 3SDXE 1EA0A 1ZT1B 3KPPA 1AW1A 1NARA 5GJSL 1SPQA 1U8JB 2C9SA 4YNYB 3GSUA 4OI9A 2XQ0A 1R30A 4X6CE 2W79A 4U1KB 2PC8A 3GEFA 2PTUA 3IAPA 3UJ2A 3ASOB 4HOZA 1LWJA 4S1QL 3ZZSA 1V6TA 5AWNL 1FL3B 1MCBA 1BQ5A 1CLOH 3UGUA 2XV6B 1OAYL 2Y7EA 3DX8A 3QQ3A 3NOYA 5GRWA 3SE3A 1CT8A 1TQVA 5ALBH 3DSFH 5BNKA 3EHBD 1EJ8A 4G6CA 3KLQA 4DF2A 3S36H 3F01A 1GGIL 1LF1A 2GJNA 1II4E 2CKBA 5A1AA 4C7DA 2YZ8A 1PZ2A 2V5BA 1WS8A 3P54A 2CD0A 4KRLB 4RJEA 3MCKA 3QUHA 1W2KT 2CCWA 2ICCA 5H1WA 5EC1A 1AGDA 4CMMA 4XZMX 2WCAA 4QG8A 3H0TB 3LERA 5C08E 2CDFA 3G6JB 1AHKA 2AV1A 2QKIA 2RD0A 4A2EA 2ABAA 1DBAH 1I85A 4NKCA 1QNIA 2DWEA 4FFZA 1I3RA 3LS5H 1BWLA 3IU3A 1UWXH 3AY4A 3QDGA 2YD0A 1P9MC 2C7UB 3CS2A 3X13A 4UMCA 3TGXA 4YBHA 3LM7A 5AD0B 2WMIB 3LA4A 3L9RB 2HXUA 3OAUL 2X1IA 1HJUA 4Z17A 4JANA 1RP9A 3R25A 4FZ8L 3RX5A 4GRWB 3VXRA 2BIHA 3HAEH 3UZEC 4LB8A 4EKJA 2AXFA 4W68A 1JRHH 5F3HA 4KHTL 1ORQB 4N2DA 4W89A 3VFNB 4UDUA 5AVVB 3W2DL 4FQQB 3HB3C 5IEKB 5KVFL 4LCIH 3RWIB 3GQYA 3ESMA 4W93A 1BSIA 5BZWA 3O6KL 3LNDA 3TQ0A 5HD8D 3V0VB 2HTMA 4J40A 3KOXA 5DXXA 2DYPD 3KPSA 3HC2A 2G60L 3DPDA 3EWCA 1TVPA 4J23A 3D18B 1OAQH 2WLLB 3UP1A 5ANME 1LK2A 4UT9L 1EJOL 5F7FA 4Y7EA 4WW1B 2XN9B 5JMOC 3NGBC 3CL8A 5JLZB 1PX3A 4H0LC 3CDCA 1VSCA 1WBHA 4N6RB 1OCCB 2NXGA 2BC4B 5KZ6A 4BZ1A 1J1OH 4O0QA 2F6XA 5KZCD 2IPUG 1D9EA 4OZ4A 5IJVB 1D5ZA 1QNOA 3D0VB 4XC3H 1DVQA 4G8IA 4E9RA 4ZGYA 1KTCA 4RRPG 2EVGA 1NBQA 4NN7B 1OFEA 2FX8H 1K8IA 3OJDB 4UILH 3PCYA 1NZRA 5GGQL 3DXAD 3RWGB 4TUJA 3QV7A 2ODOA 1TJHL 4O58H 4FRWA 1L0PA 5D9PA 4UT7H 3WJMA 5GJTL 2XG9A 4Y1TA 1QP1A 2VJ8A 3AWOA 1UWIA 4MZ1A 4XP6L 2RAGA 3W9EB 3GR4A 3SE8H 2VD8A 2Y7SA 4M5ZL 4OUUA 2ODIA 2FTYA 1IQWL 1JYXA 2P5WB 1A6AA 4NO2A 2JLLA 2QFPA 1HEHC 4Q56A 2DSVA 4QR6A 3K4WA 3SQOH 5FW8A 1WYIA 2XPKA 2QTEA 4L4PA 1MIML 2JF6A 1E0UA 2F53D 4P46A 3NK3A 4EIVA 1UKPA 4V2XA 4HUWB 4FC3E 2VJ0A 3WF4A 3W0WE 5E00A 2N7SA 3RHGA 1TA3B 3W9DA 1NANI 3RO8A 1YRKA 3U4FA 3KDMB 3OG4B 3VD2A 3U0PB 3JWNG 3MXWH 3FFCA 4O9HH 2WBKA 3DJRA 1D5XA 1KM3A 3V0TA 4O53A 5JHLA 3SZ8A 1X7SA 4M43L 4DZBB 5D7HA 2HSIA 4F5CE 4PJCA 4K3ZA 2LT9A 4YSOA 1IM3B 1P0KA 4PJBA 2YCKX 1UWSA 4U7KA 1KCVH 5GRZA 4LQ1A 1UUNA 3UJJL 1TELA 2OZTA 2EIBA 4ODUB 3VXUB 4GXMA 4ZUWB 4LT7A 4QO1A 1OP5K 1ZHBA 2I69A 1XL9A 1PG7L 5HJDA 4WJ5A 2YMTA 3SJVA 2ZXGA 2OL3L 4PJXB 2XVBA 4URIA 1R6WA 4DIXA 3W1LA 4Y1SA 4H8WH 3P3BA 4HIEB 2ZA1A 4BF5A 4IIFA 3B8UA 4JO3L 4DW2H 1V7AA 5DBTA 1OKEA 2DJ4A 3U4KA 1CBGA 1UWYA 3BQUD 3VA8A 2F7RA 1F61A 2YL5A 1KF9B 1N82A 3M17A 1JS4A 4TSAL 2PCQA 4Q2ZB 5EZJB 1CQKA 3LH9A 2ITFA 4OB5H 2CQVA 3QBTB 4P3CH 2E7MA 1RUSA 1IBHA 2X6UA 3ENEA 4H2CA 3EKGA 1IGTB 3IJLA 2Z65C 2C3HA 4JPSA 2QSTA 3MSYA 5U7SA 4XODA 5D5MF 2KHAA 3MV7E 4O15A 3V0JA 2JIWA 1GNXA 1JCVA 2B8OT 1KTLA 5HBFA 4JJHA 5LGKA 1H1NA 1LDCA 2H3XC 1KLYA 5CP7A 2WV8A 3QW3A 1OCWH 3ZJ7A 3O3UN 3FCBA 2H1XA 2HUHA 5C7VA 4ODWB 4F9PC 2QF7A 4HCIA 1RU9L 2QGYA 2FPTA 3L1EA 4HCLA 1QHQA 2J6VA 3W9ZA 1QSVA 4G8TA 4FN0A 5A8MA 1JZ6A 3G6MA 1QVOB 2VO5A 3NL5A 4IPPA 2O30A 1ZGLA 1CBVL 4PJ5D 3GNDA 1E5AA 3ZMEA 2K3TA 3L2MA 4PL1A 3PPCA 4MHBA 1A6ZA 3BKCH 3Q4DA 1GPWA 5CG7A 5KS9B 4L2LA 4XQ6A 3PPSA 3TPUA 4LL4A 3CHFA 4PGBA 1VPXA 3RGHA 2IAMA 1BAWA 3TJIA 3U2OA 1J48A 2YCJA 1MREL 2VUYA 1E42A 1JG9A 3JVGC 4WV1C 3PZMA 3STCA 3RTQC 1EANA 1WJ3A 3ULUE 4IMCA 3JQOB 4XMKL 2DQXA 2DZAA 3LRHA 2E7LC 1ACYH 3MROA 2NY1B 4Z7IA 1IYXA 3JT0A 4DGVH 1TWSA 1JTTA 1R5WB 4FA6A 5H91A 4R0LA 2WJEA 3QQWA 4X4XB 2J66A 1TCDA 3RBGA 1LE9A 3MBWB 2HMID 4GGBA 3CH1A 1A1NB 3ERPA 3DX6B 2HVMA 4KJPC 3NDOA 2V2TB 4IDJL 4TSBH 4FCAA 3FQRA 3VQMA 1UBSA 3CBRA 3H9HB 4WENB 4AY8A 5E2TH 4WU7A 3G08A 4HC1A 5EPMA 2G9HA 3VZYA 4Z7UE 4CNIB 1SW0A 3JZUA 4EVNA 2QZQA 5CD3A 2NW3A 3L9YA 2DYPA 1DLHB 1XPGA 4M7LH 4B92A 3VH8G 4DT2A 3WNMA 4F0KA 2OMVB 2CG9X 3MGOA 2Q02A 3E1ZA 1Z5HA 3F1QA 1OF2A 1A1MB 1NBYA 3PUEA 5GSVB 3KTSA 3ULSB 4A3UA 5IVXB 2G5RA 4N86A 5CJBA 1UR3M 1JZ5A 4KKQA 3SCQA 4FMFA 1JUKA 5GQBA 5INCA 5K69A 3DTXB 4QRAA 3HGOA 3M47A 4LCUB 2PW1B 1OM3L 5JXEC 1FO0B 3VXNA 5F7BA 1RERA 2LLLA 4IGBD 4IL0A 3ZZLA 1U5JA 4KRPD 3LCIA 2BS8A 4V2CB 5MEOA 5BO1H 1XQLA 1K02A 2CO2A 4PRTA 1BHGA 2PTXA 4DKEH 3DXAA 3TN6A 3H2OA 5BW6A 3GSUB 1FCVA 2P47B 1VBJA 4QY8A 1JXJA 4K0OA 3UP8A 3PXHA 2PXYC 3EDKA 5C09D 2B77A 1R33A 3KVQA 4W9CC 3HCVA 4MAYC 1DEEB 3NCXA 3MJ9L 4R3SA 4ERSH 1ZLWH 5KBNC 2WGXA 3DX8B 4EXQA 3W02A 5J9PA 1Z1WA 5I5IA 2CLRB 2BVEA 1CT8B 3QWQB 1M7DA 3BZDA 5AOJA 4Z0SA 1CL7H 4JB9L 5A7EA 5IW1A 5EMMA 2OX5A 1ZWIA 3TA4D 3L6FA 3KPOA 2H3KA 1EUTA 2F53A 2CKBB 1RK0A 1HP4A 5EDSA 3GVWA 1QNQA 4KUCD 1JUEA 4M6MH 1NLDH 2PPFA 5K9XA 3GR8A 1XCQB 3GYCA 3MCKB 3QPQD 3CZGA 3PGDB 5EC1B 3AWFA 3FCSA 4CMMB 4YLCA 3GIZL 2YDQA 1R3HB 2CDFB 2AV1B 5HPMA 1F7BA 2QKIB 3C5ZD 2BY0A 3UWVA 2DWEB 3MC0A 1I3RB 4PEKA 3IU3B 1B3WA 2ICEC 4PRPE 2JCCE 3X13B 3I6TA 3SCMD 2WZMA 3U4EA 4HGXA 5E9NA 1I4FA 3V18A 3TXAA 1E1CB 4HQVA 2XTJD 3L4WA 1FJ1A 2ZZ6A 1U8IA 3O41B 4JANB 3ABLB 1QOPA 3NA9H 1KXQE 3OAYH 3FUEA 4NP9A 4NAMA 3VXRB 3AG3B 1F13A 2NVDA 3VOIA 2XPYA 4W7WA 3SSJA 2AXFB 5F3HB 3QULA 1Y6KR 4UDUB 1LWHA 1XTMA 3QEZA 3ZE0B 2NY7L 1VB9A 1ZENA 5BZWB 2OMXB 3LENA 1NQKA 1S7UA 5LUMA 3SE4C 1YNTA 4AX3A 2VDOL 3KPSB 3FT2B 3BQUA 3QRGL 4EZMA 4LU5L 2E1WA 3WH8A 4XPTL 1LK2B 3DBNA 5BMXA 3BE1H 4I4WA 4CVZA 3K4DA 1X6NA 1M3IA 3CZNA 1KZQA 4ZB2A 4WUIA 3TFBA 3HURA 5A16B 3R8QA 3BPLC 1V79A 4F40A 1A5LC 4OF7A 3FVDA 4IFRA 1EJ7L 3W2KA 1WCBA 1YG9A 1Y65A 1U36A 2NY5C 4AW4A 3P8IA 3EIFA 4OZ4B 1I1WA 1JPIA 1D5ZB 5IDZA 1ZBWA 3UF9A 4G8IB 1XBRA 1HHKA 5L0QC 1RUPL 3UBXB 3U1SL 1GAFH 1YEJL 1IGIL 1K8IB 5HQMA 4MXQD 3GTHA 1VACA 1TX2A 5F89A 4R4NC 5CHNA 4PB9H 4C83A 3H3BC 3TBYA 1ZANH 4KXAA 3WD3A 3WJMB 2NNAA 2O9RA 1SJDA 2C1IA 1T03H 3EOLA 3KS0H 3ZLQC 4PJ5A 3ALPA 1ZNNA 2F1EA 2F38A 4J4PC 1I2QA 4LEQA 1RALA 5F96H 3DX9B 5SV4A 3UH8A 3AFBA 3BVJA 4GUPB 1FZKB 2Y3NA 4OUUB 2AK1L 2R56L 2X6CA 3DROB 4UB0L 3CFJA 5A40E 3IDXL 4AQEB 1OCQA 3QO0A 2XY2A 1S3HA 3NPXA 3C86A 2PDXA 1KFJA 2CR3A 5F9OL 3PDOB 1CXHA 2AABH 5D4HA 4P46B 3BJTA 3E8VA 2WXLA 3FONB 5E00B 2FZ3A 4GABA 4GNJA 3OTRA 5LWYH 5I1KH 1O68A 2WZ6A 1RURH 4LZKA 2GGEA 2GVLA 4AZ6A 2V69A 1I1YA 3TIMA 4J1UA 2OTUA 2J7LA 3IMBA 4MZ2A 3BC9A 3FFCB 2D4DA 3EYUH 1D5XB 2A21A 2FTPA 4XP9L 4E36A 2COQA 4KKBC 1G69A 4M7JL 5FHAH 4HZMA 3LMYA 5C55A 1XBYA 4HUUB 1U8CA 1ZS2A 1S78D 4MJJA 2GG1A 5JYMA 4RNIA 3DXIA 4WKAA 4PJCB 4J3VA 3QGVA 1JQVA 2VXNA 3O9WC 3UERA 2CKNA 4PJ7F 3KJ4C 4HALA 1FA4A 1WYJA 1IC7L 4MSSA 5D37A 3TS8A 1YDYA 1HQRA 4XVDA 1U41A 4QO1B 1ZHBB 2V5SA 32C2A 1UUQA 5F72S 3UWUA 5FYJD 4P59H 5I8OL 5AOLA 2AAAA 3TJEL 4IGBA 4U6HA 4K5PA 2AQSA 1BF5A 3FO0H 5KYXA 5ABDE 3B2XA 4Q6IA 3QZLA 4KDTA 3NO5A 5IB1A 4A2SA 1JPSL 1N5AB 3W7EA 5KSBA 5J1SC 3AQXA 4OZHF 4B60A 4JFZL 1C8VA 3QM3A 3U2EA 2WWKO 3VACA 3NCOA 4WCYH 3QUXC 5C09A 3ISYA 3S2NA 4PLJC 2EPLX 1GGOA 4L1SA 2XT1B 3S48A 4IKNA 1OARH 4XMPL 4W7UA 3CQFA 1IM9D 1CDBA 2I60L 4LEEA 4J3SA 3V4PH 1ASOA 1KTLB 2IH8A 1J5OH 1IFGA 4H6EA 1FA2A 3ATFA 5CP7B 2C1OA 1AH1A 4HS3A 2VR4A 2ASHA 2ZNWA 3LKOA 2YR1A 1W9DM 2ACRA 4LWWA 3RY5A 1D8CA 4FLSA 1Z42A 2FYYA 4XMLH 4P2QE 3GAKA 2DW6A 3RMJA 2VKXA 3UPAA 4PJGA 1QNPA 3FSTA 4JRWA 3K74B 1ZV5A 1HI6A 4KWOA 3LS9A 2C3VA 3GXPA 3S5SA 1VEPA 1ISXA 3G1VA 5T33H 5JOEA 2Q8AH 2WTPA 1A6ZB 3PFMA 3H55A 4ZS6D 1PLCA 3U79A 3TPUB 4OZIE 1IEXA 3C5ZA 4PGBB 3P0YL 2GK2A 3VQ2C 2IAMB 4MMZC 4HLJA 4IP4A 4LDCA 4ACPA 1CLKA 5K9OA 5FAAA 2J77A 5E7FA 1XRFA 2ZWSA 3SCMA 4KK5C 3F5LA 4FHAA 4K3DH 2YD2A 1R3JB 4CD4A 3L54A 1CR9L 3K71A 5I1JH 1KKOA 3ULVC 5CC6A 3PWAA 2VR8A 2JFEX 5M1TA 3OTTA 4R0LB 3RJQB 4YO0B 1B3ZA 4IRSC 5IBUB 3IACA 4EAYA 1B2YA 3EPNA 1QSEE 1VGKA 1AKPA 1LE9B 3GSVB 3G1YA 3A3XA 1RQEA 4EK7A 1CPUA 3STBA 3I9IA 3FQRB 1OD7A 2IAND 2XN9D 3RNDA 1GJPA 2Q0ZX 1CYGA 3WLIA 2B0MA 5K9CA 4WU7B 5EPMB 1L6YA 2XZQL 4JFFE 4EVNB 3LSCA 2ZUWA 5CD3B 2O5ZH 2NW3B 1S7WB 3OZKA 4UZSA 5ETUA 3I85A 4Q4EA 3MGOB 3CHSA 3LLXA 4DWHA 4QDMA 3OR6A 1Z69A 1OF2B 4L1DA 1NBYB 1ZLSH 4DZ5A 1SEQL 4XZWA 1E72M 3UYRH 5LBVA 1QR4A 3NQDA 2OI9B 3DO4A 1ZEAH 4OCYL 3P9LA 4JY5L 2NY6C 4XPGH 4NL1A 5INCB 1Q0YH 1JPHA 3N15A 5LCVA 1VRSA 1OSZA 4TU1A 4HCRA 4JUSA 1C5BH 3VXNB 4HJUA 5CJMA 3S96A 3T4AC 3US1A 2Y06L 1OK4A 1HH6A 2BASA 3FMGL 3NA8A 4H0IA 2Y4SA 5MEOB 3FUJA 3ECUA 3GXTA 1NC2A 3FB6A 2YWYA 3FYPA 4KAQL 5FACA 2V7HA 3DXAB 1MFEH 2Q20A 1Z9AA 4QY8B 4PB3A 3E8UH 4FNPA 4X2UA 4LESA 5E9DD 4PRHD 3VXOA 1D7CA 5GVJA 4YSSA 4NYUA 2VITA 3MJ8A 3HCVB 4LHUB 3Q45A 4R3SB 1GS8A 1XYAA 1TJGL 4AKOA 4LQFL 3V4VA 2YD8A 1NFBA 5J9PB 3VKJA 1M7DB 4Z95H 3KL3A 7A3HA 1US0A 4X7TB 1FYHB 5I8EA 3KPOB 4GOAA 1GGCH 3RAJL 3CSPA 4HYVA 1P53A 4ELMF 2F53B 1QFOA 5DU7A 3JSSA 3SIMA 1NKRA 1RK0B 2O6PA 4CNPA 2EDOA 4URKA 1K03A 1EEYA 5HHME 2O7QA 1G6RL 1H8OA 4YSUA 2B1HL 3WAKA 3QG7H 2XZAL 4M61A 3TSDA 2YEZA 1OABA 4DBSA 5K9DA 4EZKA 2EH8H 3FCSB 3FSZA 3GRWH 1IM3D 5F97E 3TYAA 4B16A 4WKZB 5HPMB 1A5UA 1R9YA 2NPLX 4HW6A 5E8OA 3WZ0E 1ZJHA 3ZDWA 5LA0A 3LGGA 3U4EB 1R3IH 3IJ8A 1XLCA 4L4JA 5ADPL 4OLUH 4JZNB 2FGZA 5E6UB 1QLRA 1U8IB 3M43A 2VMFA 5GZOC 4ZODA 4QX4A 4WWKD 3HNVL 4CC4A 3T2QA 1OAKL 3MLRL 1UJQA 1U8JA 3F3HA 1QAPA 2VDQH 5E4EC 2GFBA 5F88B 3PAZA 5I09A 4Q74A 3R18A 2B0SL 1AR1C 3K81A 1ZVYA 3M5ZA 1S7UB 1VGEL 3PABA 1YNTB 2AERT 4F8TA 3T5WA 3ABMB 3BQUB 4Q4SA 1W5NA 1Q1PA 2PMZA 4BS0A 4QHPA 3ATYA 3TNMA 5I19L 1YYLL 5ISZE 5C0EA 4AGPA 4ZFGL 3PBVA 4I4WB 4CVZB 1TIMA 4JCMA 4N8PA 5D7EA 1A0QH 5HYQB 5F9JA 1C8QA 4GYPA 1R3KA 5E6IA 2QPSA 2PRHA 4DVBA 2GIMA 3THQA 1IGFH 5I02A 1LXMA 4MWAE 1LJMA 3QXUA 5EMUA 5KVEE 2JEPA 4NPYA 4LBEA 5EC2A 5LBSL 1IM9A 4PRNA 4L5FH 1YQVL 4MKNA 3NEOA 5FFOA 1JDEA 2LU4A 1A3WA 2XXCB 3PPHA 1VKFA 4PR5A 3LMJH 1F2QA 3GC4A 3DKLA 3RWDB 8XIAA 2FHCA 3KRZA 1AC0A 1S2VA 5CHNB 1WWAX 3F5KA 4CQ8A 3TBYB 5FWQA 4RMWA 4NI8A 1LJYA 4PREA 3OJMB 1UD4A 4KFMA 3S2JA 1M6JA 5TF0A 4JGNA 4S38A 4AVIA 2WMIA 4KI5D 4PJ5B 1IGYB 2NY1D 4TNFA 3BAWA 3AWGA 3V8OA 1BMWA 4CQ9A 3CPGA 1AGFA 3GB6A 5DDHB 3EFFB 3GD6A 3TFKC 4QRBA 3CFJB 1P1ZA 1TNMA 3BVWA 4FQCL 2OBGA 1B5TA 4N1EA 3NCEB 3QO0B 2NZIA 3D09A 3RVUC 2X3AA 3LNIA 1NGQH 3CN3A 2WQWA 5IEKA 3V4UL 2CU9A 2WWMD 5F7KC 3WDPP 1YUKB 5LQBH 1U8HA 1TJIL 4NZ1A 2FZ3B 4NZRH 3C6LC 1Y18A 5EBWB 1QSZA 2OX4A 3ZWSA 1ISWA 3T2LA 1ZAHA 4J1UB 2OTUB 2AQ1A 2NZ9D 2R9HC 3CJPA 4FKEA 3L3KA 2IANA 2IFFL 2XN9A 4XKYB 2R15A 1JHTA 2WN2A 2UY3A 5JLZA 4HWZA 3B2VH 3WKNA 4LASH 3BOLA 1KCUH 3A3WA 2GI0A 3KOYA 2VZOA 4JTJA 2ZX8A 1DVZA 5I1EH 3NDZA 2H6UA 5IJVA 2OOFA 3B83A 4BUHA 1UR8A 4JX5A 5I6XB 2CZDA 3TR9A 3CU7A 1ZOXA 1KFGA 3KH4A 1CFVL 4PP1C 2HXTA 4ZNEE 3CPLA 3DK0A 5D7SL 1WQ5A 2GSGB 3O1NA 4X4ZA 5I73C 4JN8A 4OJYA 2PDNA 5EEXA 1RXOB 4ATLA 3IUDA 4Q52A 2NQ3A 1EBAA 4JQ2A 32C2B 5ID0A 2QLVB 5DD5H 1QLEL 2JKRM 4N0FB 4ATTA 1Z9MA 4U2ZA 3G1AA 2DVUA 4Y9PA 4IGBB 2R2HA 4U6HB 3CB8A 4HU8A 2WJ5A 4ZUTA 4KRPB 5D93C 1GOQA 3K46A 4JQ1A 2GJPA 2PYFB 5KYXB 4HKZA 2WAQA 3UJEA 2HG5A 3SGGA 3J27A 3HEIB 3VNKA 1MJ7L 1OPOA 3X17A 3AMDA 5KSBB 2ZA2A 5EF2A 1XV8A 3BVXA 1J1PL 5E9DA 4PRHA 5DJXA 4B3ZA 2HKAA 5SX4I 4AL8H 2FB3A 4B7LA 5C09B 4OFYD 1PKNA 4JNMA 5PCYA 4I2XA 2G3IA 2VOTA 1UB5A 3PAVA 3AMKA 3UADA 4KTDL 3ZUNC 4LSVH 4HUWA 4KOBA 5GIRA 5HHVH 5A6AA 2IC2A 3GHEH 5D1XB 4U49A 1FC1A 3HNSH 4UTWC 5F6HI 3R0UA 4J3BA 3T81A 1F3XA 4J6RH 3RWCA 2WMHA 5I82A 1WDDA 3X12A 3MP3A 1UUMA 4HS3B 4I18A 3SE9L 3A12A 5F7EH 5LGZA 3RK8A 3F7JA 1MAKA 2WBJC 2FYYB 4X4ME 1A7BA 1FNFA 4GMEA 4PJGB 4Q89A 1ZLUK 4B5VA 3P7YA 1U1UA 3I02A 4ASTA 1HI6B 1ZDSA 2YRZA 1JCXA 1ECQA 2C3VB 2PYED 2XIQA 3BZFA 1MFMA 3VYPA 2NX9A 4KROC 1G01A 1G0XA 1IM3A 1X4YA 2OL3A 1AY1H 2W80C 4PVMA 2VERA 4WJG3 3C5ZB 3NQ8A 5IWLA 4KX7A 3RLVA 4CCEA 2I24N 5L6YL 1XFBA 3M16A 1BFTA 5K9OB 1FNAA 4ZUWA 5EGRA 2WC7A 1MQKL 4PWFA 4LSPH 3TN3A 3WFEH 1SO5A 1D6VH 3QZWA 4A7QA 2A1YA 1UOLA 1MO0A 2LLGA 4AGQA 3QPKA 4AC1X 4I0PC 2A3TA 1AW5A 3WF0A 1Z3GL 1O7DE 4WWKA 4A6YH 2VGIA 3E9UA 1E2VA 4FYTA 3LIZH 1ED3B 4OOZA 3M0HA 3VRJA 1WZKA 5FL0A 2B3IA 2QGEA 2JE8A 1ACCA 1KPRA 4GQ9H 35C8H 3NH7L 3WAJA 3QYMA 4EUPA 4GMTL 1PG7X 3EYQD 4B0MM 2FDBP 5FA3A 2PDBA 3A23A 4RNRB 1GYMA 5EU9A 3ME0A 1EX1A 1LZOA 3CWGA 5ETUB 5FUZH 2CGRL 1OZQA 3OR6B 1XINA 4QTHA 3TJPA 5AEAA 4OU1A 4UTAH 2QVHA 3CH9A 3C5SA 3P9LB 1X5XA 5LA1A 5CZRA 3B7TA 3HFTA 5A8QA 4PU2A 5LGHH 1RQHA 4U1GC 3SDYH 4LBAA 1OSZB 1R47A 1WZ1H 3CMOL 3KVDD 3T0EE 3WTSA 2YQ3A 5BVPL 1HP5A 1NFKA 3S96B 5T1JA 1DBMH 4F2UA 3F8UB 1HH6B 3PLYA 1NC2B 2Z8WC 3L7FA 3N44F 3FB6B 1R5VA 1UP0A 2FEDC 1NMAL 5IQ7L 3MLVH 1W1ZA 4MGXA 3WFBL 5ABHA 1H3XA 2CRMA 3VXOB 4XB8A 3QIUB 4B5NA 1TZHA 1PKQA 3EH5B 4JG1H 2LAAA 4UMSA 3MJ8B 2OMAA 2EPOA 3C2FA 5CJQL 1ISVA 3R4IA 2G37A 4WK9A 2F68X 5IHZA 2VDKL 1KLFA 4TKWA 1EERB 3CYVA 5FAGA 3VQLA 1FDYA 1OCRB 3K2UL 3N3MA 5AHLA 5B1KA 2F6UA 3ABQA 1A1NA 3CLWA 3H2WA 4OT1L 2VJXA 1Z7AA 2GQAA 3U4BL 3GVGA 2H2PD 1XR2A 2R0KH 1VPQA 2PR9A 1RZPA 1GOXA 1EEYB 3K8MA 5I0XA 1HYSD 2XZ7A 4FI6A 4DI8A 1JPTH 4Z7NE 4JX4A 4AIEA 4GI8A 2PRLA 2HPOA 3P74A 4IMKA 4CSPA 4IH3A 4UQ2A 4EANA 5GSVA 5KBMA 2RH9A 3CT7A 5E8OB 1XEDA 2JNZA 5JH1A 3RM8A 4NZTL 3TTEA 3FV9A 4PMNA 1PZBA 2PW1A 4NJKA 2QKSA 3EA1A 1DFBH 3U1QA 4OQVA 1QLRB 3BICA 3VXPA 4TV5A 4HIBA 2HRHA 4XVSL 3ZIYA 4HN8A 1XVSA 3EEZA 4W81A 4I48A 4QTIL 2ISDA 3MJ9A 3W23A 3FIGA 1FFOA 3LEPA 3FTZA 4DRSA 4CEXC 3KLHC 4PYHA 3S5ZA 1QBLL 3G1FA 3DTDA 3PRZA 1E5BA 3MMWA 2GFBB 3ZDYE 3ID7A 1AZ2A 1XLHA 1S9XA 2R29A 4RPPA 1X4XA 4OCWH 2ALRA 1C08A 2ZC1A 3DMMC 3PABB 1DEEA 1GKQA 4L4TD 1G7PB 1X5HA 3LQAL 3O81A 3TNMB 3DG7A 2CLRA 5C0EB 1YHPA 1IBGL 1J9CT 3KYKH 5B39A 3K6OA 4NFCA 1BQGA 2V8MA 4G7VH 5F9JB 1R3KB 4OFYA 4MLSA 5K1NA 4JKWA 5IB2A 5E6IB 4MKTA 1IVTA 4DWSA 1KFAH 2XVPA 4DVBB 1AD0A 4JVWA 1LOSA 1V6YA 1UZDA 4C6FA 1JGDA 2CHWA 2VTFA 3MRPA 4NPYB 1VFFA 1H6UA 4LBEB 5EC2B 5FM5M 5AVWB 2YAHA 1IM9B 4AZUA 1XCQA 4PRNB 1M04A 2IH1A 4NJAL 1A3QA 2XZZA 4NI3A 3NSJA 3PGDA 3HLKA 4YHKL 4N9OB 3VILA 5CIPH 4PR5B 3BJFA 4U6VL 1DE5A 3BT2H 5B80A 3MNWA 2Q76B 1F58H 1R3HA 1JDAA 1Q85A 1MF2L 1AGEA 5IMLB 3PWVB 5HMEA 5IB4A 1GZJA 1RJQA 1OV8A 2ATKA 4W6YB 2IAMD 1DXFA 2K9FB 1G0CA 4Y9GA 3THCA 4DJDC 4Q6KA 2DJMA 2WC4A 4PREB 1IUZA 3NTCH 5BV7C 3A5FA 2XKUA 3FXIC 2AJUH 5HDLA 1C90A 2PYEA 4WI5A 5AVTB 1RIHL 1E1CA 2HVBA 1E67A 2FJUB 2VERN 3TXVA 4M93B 3BAKA 1AGFB 3O41A 2Z91B 5LAXB 3NT0A 3AU1A 5CGYD 3GBNH 5G4NA 4AZHA 4D94A 5BQDA 1LP9F 1P1ZB 1SJEA 4NY2A 4J1OA 5CCKH 2BDNL 3NIGF 4TULH 1CVRA 4B53A 3IIOA 2XYLA 4O4WA 1OG0A 5CSRA 3SDCC 3FQXA 1JN6A 4G7YH 2A38A 2E28A 3LCGA 4U33A 3GRGA 4CNUA 2OMXA 4FLRA 3PC0A 1U8HB 5HYJE 5HWMA 4TV6A 3ZO9A 1SYTA 4DKFH 1Y18B 2E86A 4RW3A 5SWSE 4HCGA 4QE1A 4ICCX 3WHE0 3FT2A 4NKIL 1QUPA 3REVB 4YSQA 3W70A 3PJWA 3UL4A 1MCIA 3VO0A 4AVFA 4K3GA 4JR9H 3QQ1A 1OYCA 3L3KB 2IANB 2CUIA 1EAJA 3QEQE 1JHTB 5A16A 1FHVA 2ZUQC 3GZPA 4HWZB 3GK8L 1D5RA 1F05A 8PAZA 3LHVA 5ABGA 1HZHL 4WI8A 1MZHA 4GQ0A 4KO9A 4D9LH 1SUXA 2ZTKA 3SBPA 2AK4D 2A74A 3UFYA 1QFWH 2NYKA 2EXWD 3UBXA 2C0AA 4POYA 3CPLB 2CBOA 3VG9B 3QNZA 2B4CH 3KHQA 2YJLA 1GZHC 4ZW8A 3H2CA 3BP6A 1N0LA 2ALWA 5ID0B 4FOUA 5D1QB 1CG9A 3GU9A 3A6BL 3BXNA 4NQCE 1YMME 2FAUA 4PS4H 2R2HB 3UTSB 3RWFB 2ENPA 4ZUTB 2QZRA 3D39E 3HKFA 2YCIX 2HH0H 4F57H 1PO9A 1T40A 4PB0H 4LHUD 5HOSA 5HVGB 4HKZB 2E6YA 3DX9A 4GUPA 1FZKA 2HG5B 3RRAA 3PFQA 2QTVA 4DOHB 3W11C 3DROA 1CC3A 3C0QA 2AJXL 5CEZE 3WD5L 1NBZA 4AQEA 1IKNC 5E9DB 4PRHB 5DJXB 1VPOH 3S88L 4CSSA 1RUKH 1UKSA 4L1TA 3PUUA 3QGAC 4YWGH 3PDOA 3A22A 4I2XB 2Y7LA 1S5MA 2Z0UA 3CQKA 2LQRA 1UB5B 5GIRB 1R3SA 1ITQA 5T26A 3FONA 4M62L 4Y4FD 3TVAA 3O4LE 2BNRD 4UV4H 3EXLA 2ITDB 1RH9A 4MTMA 5T1MB 5H37A 3FKUS 1XGYH 5FOJA 4DSYA 3RWCB 4LXFA 2IPGA 3X12B 4I18B 4PWKA 3WELA 4Z42C 1JFQH 3LSOA 4P49A 1G7IA 3ZHKA 3S5LB 3SO3B 3IPWA 2EIJB 3ESOA 3EJJX 4HUUA 3S2AA 4JPIA 3I02B 4GUIA 2PPGA 1TFVA 2B1AH 5DR5L 3BZFB 5IGXH 3QUZC 4LVEA 2OL3B 5JHMA 2D73A 1ZHLA 2FR4A 1YZZA 3S98A 4GQRA 1TXKA 3FBQA 5CBBA 5KZDA 3QUML 3OZYA 1GZGA 4YC2B 3AIQA 1PSKL 1DSFH 2DH3A 5CM1A 4XD6A 3KL5A 3PWLA 1FBAA 3GNXA 5MP6L 3QZWB 1MFUA 1VEMA 4LP5A 1G1YA 4PCKA 1HQTA 4BUGA 1XLEA 4KX8A 1P4LB 2YL8A 4WWKB 2BX5A 1AXTH 2QHLA 4BFGA 4H2AA 3LV3A 2QUMA 4XP1L 4PWGA 1ZTVA 1DQKA 1BJ8A 3VFWA 3K0YA 3IFNH 1GMIA 3VRJB 4DYJA 1N5AA 3DGDA 4ZX4A 3QFDA 2G3XA 3SODB 3CNKA 3Q94A 1SOXA 1KPRB 2DL2A 1ICTA 4QCFA 4EUPB 4L8SB 3OJGA 1QHPA 5FA3B 4Q9RH 4I5RA 1QZ1A 4LPWA 3BSHA 3ME0B 3BKJL 4L4TA 3QJFB 1ZP3A 4FK9A 4HK3J 2Y5TA 4DO5A 2NYYC 9XIMA 3WMLA 5LKYA 3NPSB 3ARTA 4GY0A 1BEYH 4QTHB 4XP5L 1MFAL 3NM1A 3CUFA 3DA0A 3AITA 4N9EA 3O16A 3HE7C 4JKNA 1H5BC 3C5SB 3W57A 3SUVA 1RAMA 1K2DA 4PR4A 5B8CB 4MAUH 3LAFA 4JUTA 1JYWA 3HZYB 3ZDZE 3REWA 5GS0H 2PR4H 3KH3A 4AKQA 1Q72H 4R7JA 2DQWA 5L9DL 4XO6A 1LE5A 2DT3A 4HNLA 3ZSSA 4CMHB 4ZZ9A 1FZJA 4LVHB 3L7FB 1T66C 4WY7L 1R5VB 1NJJA 5BW7A 2E6DA 1XF0A 3EZ4A 4IICA 2FATH 1RPQA 4ODVH 2DY3A 1TZGH 1U8LA 4LCQA 1SO4A 3U7WH 5GGRY 3UGRA 5AL0A 4D0BA 1OM9A 2W61A 1TZHB 1PKQB 3KUMA 4RFOH 1R3JA 3QB7C 4HSOA 3GC3A 3VJ6A 4UZUA 2E76C 3I68A 4O10A 2QJMA 2ZKHH 1MCWW 4YO0A 1EOMA 4O1FA 4JKMA 3DESA 2WCPA 5IHZB 4AY7A 1KLFB 3RKDD 4LGXA 3GSVA 3WFZA 3SD5A 4Y96A 5FCUH 3WLNA 3NFUA 3WQVA 1W37A 4HG4K 1UD8A 2GWGA 3T0TA 5DZNA 4ZMOA 3KWTA 3MHZA 1ILUA 4QHNA 2F1AA 4AIXA 2IPKA 3VNMA 1S7WA 3EOTH 5AVSB 2OODA 4LEOA 2ZCHH 1WISA 3GHBL 4CN4A 4MZYA 1A5FH 5DEZA 5KAQF 1ML1A 4TQEH 1F02I 3F84A 4OLYH 4UQ2B 1OCJA 1HTYA 4D0CA 4LP8A 4O13A 4AWJC 4OTKA 2E7BA 2VC9A 3LN4A 1R1CA 1EYEA 5CNHA 2R9RA 4L9ZA 5C2GA 1WA0X 3PF3A 1FPTH 1J0YA 4U0RC 2WZPD 4MPKA 1VLIA 4XI5D 2AK4A 3VXPB 1I9IH 1BQCA 2MNUA 4WI2A 4MDOA 5FXCH 3V4LA 3RIAK 4QXTA 1VIWA 4I48B 4XNYL 2WQ8A 3ALGA 1AOZA 1FFOB 5KBKA 2QADC 3TR2A 4DM1A 1JGVL 4FADA 4M8VA 1UR9A 1QNRA 4UU9A 1S9XB 3ZDXF 3IJ6A 2W65A 2P7TA 3ZQWA 3L4UA 3QR3A 2C9QA 2FVKA 4IFOA 1C08B 1AZUA 1KELL 1WT5A 2J20A 3QR2A 4LHUA 2DF3A 4BSJA 3L2IA 4IL2A 2QCEA 3MLZH 3WLPA 1OC6A 3AQDA 5AVRB 4CNSA 5D1XD 3FLUA 3TSMA 1JPST 2A2QT 3DG3A 5B39B 2M8XA 1JZHA 3W24A 2EUWA 4XN9A 2OJZL 4X7TA 2D2CC 1RZJL 5FL1A 3U30C 5IB2B 3RUBL 1FYTE 4Y5YC 4DWSB 5C7XL 1HZLA 1AD0B 1ET5A 2R24A 1JGDB 3TWYA 4LY8A 3HTLX 2ZRUA 5HA7A 4XC1L 4NLHA 3MRPB 4QKXB 1SW3A 4Y4FA 2QYGA 2IH1B 4X9GA 2BNRA 3NSYA 4ZTEA 1G7QA 2X44D 1OP9A 1JFXA 3S8FB 3EX6A 4BHUI 3UW6A 2D1ZA 2CZFA 1XG3A 2YJQA 4WKZA 3MNWB 3R58A 3VXTA 1W31A 3NXFA 4MAZA 1AGEB 5IB4B 2ATKB 1CB4A 4DQWA 3M0KA 3A4JA 2H2SD 4HN4A 1S2EA 4N6QA 3VG0H 2EUZA 1HVQA 5I26A 1OK8A 1B2WH 4UZGA 4XPHH 2VDGA 4WIWA 4KRMB 2PYEB 4JZNA 4M03A 2RDXA 2NXHA 3BO8A 4GQPH 2WMPB 3MI6A 2NSQA 1O4UA 1BEUA 1QU4A 1FKWA 3AU1B 1WBXA 3TJHC 3UACA 3RJYA 1E9QB 2VDOB 3ZTNL 1SJEB 5C70A 4AZ5A 4IFKA 1HUVA 3ZMRA 3URAA 2CA4A 4RE4A 5F88A 5BUPA 5J6SA 2J7EA 5SV3A 1QYGL 3FQXB 1JN6B 4KFNA 1FSKC 2BZ7A 2C1HA 1D3CA 1D5IH 3OZLA 3RN6A 2W62A 2E1DA 4JM2D 3RU8L 3HMXL 3AM8A 2EXOA 4QXUH 1J9SA 3ZLHA 4QEHA 1TRIA 2PO6C 2HZHA 2IV9A 1EJVC 4M1GL 2XINA 4E41D 4PRDA 4NWUH 4OLWH 1FL6A 5HYQA 1TJ0A 3IJDA 1JNNH 3WTYA 1MCOH 2VH5L 4NQTA 2XG5A 4A7GF 1X39A 4TMPA 4PWIA 2WNQA 2P45B 3DFSA 3AHVA 5AHFA 4FG6C 3QORC 1M71B 2AEIT 2A74B 2GW5A 4PJAA 5JQIB 2PPCA 4DESA 5BRBA 1AO7B 4DGUA 4U6YA 1NC2D 4ERGA 2F8QA 3RWDA 4AEHH 2YS4A 3V6ZA 3UO1H 1ZTXH 4C6EA 3QNZB 4C54A 4DGYL 4F9LC 1DP0A 4YCOA 3WSUA 3BP6B 3WYZA 1N0LB 3WEZA 2C9UA 1KBGL