4X9YA

Wild-type human pancreatic alpha-amylase at true atomic resolution (1.07 a)
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Wild-Type Human Pancreatic Alpha-Amylase at True Atomic Resolution (1.07 A)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 177
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4x9yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4x9yA01
4P7QA 5BCAA 5BXSA 3GNRA 7A3HA 5A6MA 1GUVA 4LXFA 2JIEA 3GZAA 4WSKA 1PIGA 4AMWA 3D5HA 3N18A 3II1A 3KL5A 1WZKA 1I1XA 4ZFMA 2JF7A 3LPGA 2XFYA 3AMCA 4QLLA 2WHLA 2EBNA 4MJ2A 5DT7A 1GZJA 4KWUA 1Q6FA 2WCAA 1V3HA 4JHOA 1GW1A 1DTUA 4P8UA 2PBGA 3K46A 5LA2A 1VJSA 1OCQA 3FHQA 2EQDA 4Q22A 2E8YA 1NARA 4OIFA 1UQYA 4D6HA 3AFBA 1D3CA 2E8ZA 2WSKA 2ZUUA 2YDRA 1R86A 2GDUA 4YPJA 2X0HA 4UQ9A 3VMPA 1CIUA 1VBRA 5I0DA 3F5KA 5CLWA 2DT2A 4L4OA 1JYVA 3HN3A 3W6LA 3IGUA 3CMJA 2FE0A 1ZJAA 3VX0A 4XZBA 4PCTA 5CZKA 2PWHA 3GXDA 3RM8A 1US3A 3IAQA 1R46A 5A3HA 3TONA 4C7FA 4NX0A 1E70M 3B9DA 1E3ZA 4X0NA 4UFLA 3HJEA 3AS0A 1UWQA 3AIRA 5D8ZA 2W67A 3AISA 1A3HA 1OIMA 3PHAA 1UA3A 1TA3B 1H0IA 4XUYA 4PTWA 1SMAA 3BUPA 4AYGA 4CN1A 4CD4A 3VILA 2Y24A 1E0VA 4JFWA 4PCSA 1ODUA 2BFGA 4PEEA 4CGTA 3WD4A 1CXFA 2GSJA 3WQ5A 3ARRA 4H2CA 2GK1B 1V3LA 2J7EA 3LRLA 5CJ5A 1M03A 1UR2A 3WH7A 2G3IA 3H54A 3BAKA 4GO9A 3K8LA 4A3YA 2XG9A 1JZ5A 4AZGA 2WLZA 1VFUA 4Z2JA 1R47A 2VO5A 1XYFA 4PMQA 1DWJM 2EPNA 4D6CA 2NSXA 1WDSA 2VCAA 4LYQA 4NSBA 4UZUA 4E4PA 4TUFA 2XVKA 2VVSA 3DHPA 4UCFA 3A4AA 2CEQA 3VKKA 2J75A 4HA1A 2YLLA 3FHAA 4UNIA 2VQTA 2WVVA 2E9MA 1EQPA 3BVTA 2CBJA 1UKQA 1E6QM 5ABFA 4M82A 2X05A 1B3ZA 4DWSC 4UQCA 2WSPA 2QMJA 3AYRA 1GJWA 1TUXA 4HMEA 1E1FA 2J47A 3IK2A 4AD4A 2YLAA 4ACZA 3UR8A 3I3EA 1R7OA 3HG5A 1N82A 1W9XA 1CLXA 2V38A 1V0NA 2J78A 1VENA 2EPMX 3G6MA 2A3BA 3WL1A 1BFNA 1GQJA 4K68A 1V0LA 4U33A 2XYLA 4HZ8A 5A6JA 4DWSD 1PX4A 4UR9A 4V2XA 1E4IA 3VSVA 1C93A 3T2QA 5A6KA 2XWEA 1KGUA 1ISZA 2CITA 5BRPA 1KTBA 2F7OA 3GXPA 1HIZA 1US2A 1Z32X 4CKQA 1GORA 3ARPA 1E55A 4B16A 1TQSA 2ZXQA 1JF5A 1TMQA 4MPKA 3ZM8A 2DDXA 3BC9A 3WUFA 2A3EA 4W87A 3SUVA 3KZSA 2WMJA 2WPGA 4JL1A 3ZQ9A 5HOSA 3HG4A 5E1QA 2V3GA 4GIAA 2UY4A 1H09A 1J0ZA 4FNTA 1KR1A 2WBGA 1JYWA 3CZSA 3WH6A 5I23A 1J11A 3VX1A 1XCWA 1XSIA 1K9FA 3UG3A 4QCFA 3GBDA 3LX9A 2UY5A 4B15A 3GXNA 3SUWA 4S3JA 1QNSA 3D4ZA 4IUGA 3WEMA 1PAMA 4PUDA 2WMFA 1ISWA 4XX6A 5I5RA 3JUGA 3WDRA 3CZJA 3TTQA 4YHGA 5IHRA 1R75A 3VGHA 3CZKA 1NWUA 4MDPA 1J0IA 2WMGA 2W66A 2WKGA 2NW0A 3OG2A 3WSUA 1V6XA 3N9KA 2Q8XA 5ABFB 2E40A 3MSDA 1E5JA 5M03A 1WDRA 2XTKA 1XRVA 2VR4A 4TX6A 2D23A 1W91A 1Q4NX 2XWDA 4GPNA 2VX6A 2D0FA 1GCYA 3GNOA 3GNPA 2OSYA 1LJYA 3CHDA 5M5DA 3B9AA 5CSUA 2XM1A 3T0BA 4ACZB 1RH9A 3EJTA 3WY4A 4AD1A 4YN5A 2CYGA 4OOZA 4W7WA 2WYSA 5EMYA 1JDCA 1HKJA 5E70A 1PJ9A 2WMKA 1R34A 3WNOA 5D9OA 1FH9A 2ALWA 1W1VA 2VX5A 5CQ1A 1W9BM 1E6SM 3RILA 4D6DA 2CBVA 4JCMA 2J7BA 2J7CA 1KXHA 3N04A 3HG3A 4HOWA 4UOZA 1WZAA 1E1EA 4CD7A 4NXSA 3VMNA 1PPIA 1W2VA 2YL8A 2BHYA 1V6UA 3LXBA 1VEPA 4GO8A 1E4LA 1UWIA 3O2LA 5AC5A 3T0DA 1E6ZA 3ZO9A 4CN4A 3ARSA 4NRSA 2CERA 2VUYA 1MQRA 2VZOA 5I77A 1MW2A 5M3WA 1QW8A 3CZGA 3CUJA 2YKKA 3GTNA 4UTFA 3AICA 2X1IA 2CCRA 1VAHA 4CCCA 5A8NA 4H8HA 1V6WA 1HXKA 4X0VA 3ZR6A 3VD9A 4NZFA 3AHXA 4MNJA 4TVCA 2EXOA 3KWXA 3WNNA 3D51A 2DSUA 4PN2A 1XCXA 3W82A 3BCFA 1CLVA 3L4VA 4M24A 1C7TA 5D9MA 2Z1KA 1R8LA 1FH7A 1I1WA 3A6OA 1UD5A 2EPOA 3LPPA 4IPNB 3WD1A 1JD9A 4JFTA 2VX4A 4AZ7A 2PWDA 2YL5A 1ZL1A 2E9BA 1HJWA 1HJVA 1J12A 1CXEA 4AZ5A 3CC1A 1QOXA 1HJXA 1L8NA 1U33A 4W5ZA 1EHAA 1UWSA 1JI2A 1Y7VA 3ARXA 4P7NA 1JFHA 1MFUA 3I3DA 4JFSA 2DGAA 2ZX7A 3THDA 4TX8A 5I79A 3DYOA 1J10A 3WMCA 3GM8A 1OGBA 1W1PA 4WLCA 4JKMA 3CPUA 2IUZA 2OYMA 1CXHA 2CXGA 1ITXA 1A47A 3SUTA 3WMBA 2D24A 3FY1A 5E9AA 4J28A 5A2BA 2VCBA 3ZSTA 3U57A 5FL0A 3T0AA 4MB3A 2BV9A 3SCTA 3VIHA 3A4WA 3GH7A 5I2UA 3SCUA 1F4HA 3ARWA 3EBVA 4JKLA 1AQ0A 3BSHA 4AIOA 3TP4A 5C8BB 1KB3A 5ABHA 6A3HA 2CHNA 4L4PA 4J3WA 2GFTA 4N42A 2VMFA 1TG7A 1NQ6A 1LLOA 2YDQA 3MS8A 4AZHA 3DX1A 1CECA 1HTYA 3OA5A 2CBIA 1UWUA 1NH6A 4F9JA 1BYAA 4TXEA 3QGVA 5EB8A 4NF7A 2IXUA 3BLBA 3APGA 1UZ1A 2WM0A 3GXTA 4ACYA 1GHSA 1GONA 5A6LA 2EABA 3BXWA 4U5KA 1JYNA 2ZIDA 3K8MA 3ARUA 3WDQA 2DH3A 2G3MA 2CBUA 3A47A 3TOPA 4PTXA 1BG4A 4RL3A 1PS3A 3RDKA 3EMQA 3DC0A 3AZTA 4ZXLA 4ZEPA 1JFXA 3ZMRA 3ARQA 3L4UA 1FOBA 3I3BA 5DT5A 4EE9A 1J0HA 4W8BA 1CBGA 2JEQA 1W1TA 1BVZA 3BLPX 2WXDM 5AYIA 3LPOA 4J3UA 2CKRA 2JALA 3CV5A 4Z2HA 1WNOA 4FLRA 3PZ9A 3PZMA 2BY0A 1JGIA 4XB3A 3CZ8A 3VSUA 4PMVA 2FHBA 1CPUA 3ZIZA 1VJZA 3A23A 4R5EA 5I6SA 4W8LA 3VO0A 1NP0A 2J7DA 2IGTA 3MV11 2QF8A 1R7AA 4AISA 5AC4A 5IFPA 2FGZA 1LQ0A 3GH4A 2FHFA 1NWTA 3PZQA 1M04A 1GOOA 2VZTA 3L4XA 1ZB5A 1HL9A 2EEXA 2X8RA 2O9RA 2YJQA 1NOUA 3DDGA 3O9NA 3TTYA 2ZX9A 3BMVA 4LYRA 3OGRA 1UG6A 1J0KA 1ODZA 1FHDA 3F4VA 4JFVA 1WPCA 1CXKA 5A6SA 4D6FA 4AYSA 2G4FA 1XGZA 5AY7A 1QNQA 4J3VA 3VIJA 4GKLA 2CETA 5ABEA 3S6TA 4AW7A 4DM2A 4MAZA 1DWFM 2WB5A 3KLKA 4UQAA 4CU7A 1ZBKA 2AAAA 4UOJA 5C71A 2GJXA 4PUEA 1VIWA 1BYDA 3K8KA 1HP4A 1FH8A 4N0RA 5GQBA 4M8UA 1UH2A 5CGTA 1UWTA 1H49A 2JIWA 1ZJBA 3SIMA 1TR1A 8CGTA 1TE1A 2QV4A 1K6AA 1VEOA 4HTYA 5CPSA 5IDIA 3AMGA 1VFOA 3WNKA 1HNYA 5HXMA 4TOQA 1DP0A 4F8XA 4B9YA 4PMYA 1WE5A 2XHYA 4ZXOA 3W37A 2V3DA 4GINA 3M46A 3VGDA 1JYXA 1BHGA 4TVUA 5JIPA 3EDJA 1UH3A 2X0YA 1XD1A 3G6LA 1QW9A 1AVAA 3ZJ6A 2F7QA 1E9LA 3L2LA 4XV0A 3DX4A 2YA0A 3NYDA 2BVDA 1BLIA 1UQZA 4OJYA 5HDRA 3WENA 4JFUA 1BGGA 3SUUA 1UR9A 2G8ZA 3AOFA 1JXJA 1BAGA 5M17A 4D72A 7CGTA 4MJ4A 3HG2A 3OZOA 5IXEA 3E1F1 3D52A 4AIUA 1SMDA 3WMSA 2VNCA 2FH8A 4PYSA 3MV01 3CH9A 4HOZA 1C8XA 1IT0A 2OLHA 2YL6A 3BUDA 3OGVA 4P8VA 3W26A 4B3LA 1UD3A 5DMYA 1EO5A 3KE0A 3DX0A 2WHMA 2EPKX 3AROA 5BXRA 2J62A 3N15A 4V27A 1OGSA 1XV8A 3GXFA 5GNXA 1CGUA 3NUKA 5FD0A 2ZXBA 2D2OA 3MI6A 2FDMA 5FIPA 3SCPA 4AY1A 5EFDA 1CGYA 2EO7A 3ECQA 1OIFA 3U7BA 4W93A 1WKYA 3W81A 4AEEA 3WDPP 3TV8A 1QVBA 1KGWA 4HZ6A 2ZUSA 4WSJA 2EACA 4DWSB 3CTTA 4FK9A 2BHUA 3WELA 1E0WA 4FNPA 1QI3A 3BGAA 5HNNA 1B31A 4WKAA 1JZ4A 4HU8A 1MQPA 4TVDA 1MWOA 4OBSA 1BSIA 1TQWA 4QCEA 4D6EA 1Q6DA 3CO4A 4U2ZA 1UD6A 4MNMA 1D7FA 1EOMA 2GJXB 2BXYA 3N11A 3MUIA 1X6LA 1GQKA 3CUFA 2OWCA 2DT1A 3KLLA 5CPQA 3RM4A 1JG9A 2YA2A 4WKFA 1CGWA 2ZUWA 1V02A 4LPCA 3M6DA 2WHJA 2Y8VA 2JFEX 1U2YA 1C90A 4CUCA 2WKLA 2BHZA 2CPUA 4MB1A 3WD3A 1GOWA 3H53A 1KWGA 4FF5A 3FW6A 2OWXA 5A6BD 3A22A 1ZU8A 3GH5A 2CKSA 3RIKA 3SCVA 4CU6A 4LYPA 2O9PA 4E2OA 1UWRA 1QI2A 2FGLA 3A5VA 3CIVA 3N1AA 3OLEA 3OLIA 1LL7A 2VQUA 3MUAA 1EDQA 1EOKA 3KEHA 4J7RA 3WQWA 3VD4A 1W1YA 3FN9A 1GOMA 1ISVA 4AZCB 3EJRA 4U31A 4U5IA 1V6VA 1TFVA 1HL8A 2JEPA 4WK9A 1UA7A 3OLGA 3DYPA 1RD6A 3HU7A 4W88A 5E0CA 4PMDA 1KBKA 5FOOA 4P8WA 1K9EA 3GDBA 2BS9A 1GVYA 3EJPA 1BGAA 3VIOA 1MFVA 1EGZA 4DM1A 5C70A 1ITCA 1LWJA 1KQZA 2ZX6A 1MVYA 4D6GA 3AHTA 1O7AA 1KXQA 3EYPA 1V02E 5FCZA 2W4XA 1HWWA 4GZJA 3VDBA 1ZS2A 1ZBVA 1VFFA 3ZT5A 3WH5A 1V6YA 1KQYA 3AQUA 3HZ3A 2ZUVA 4J27A 4YHEA 4D1IA 1KFWA 1E56A 1Q6GA 3ZR5A 5A8MA 1H3GA 4AC1X 1JF6A 1I75A 1KXVA 2RGMA 3WUEA 3BAIA 4OGZA 1PBGA 4EANA 3RO8A 3EDKA 2XPKA 2J74A 3PTQA 8A3HA 1XSKA 2VI0A 4U3AA 3SCNA 1UD4A 3ARVA 3VIKA 1JZ8A 2D0GA 5DO8A 1B3XA 1ZBCA 1IZKA 2X2HA 2ZXAA 4E8DA 3W53A 4Z2IA 5JBDA 1TQTA 1EO7A 4Z2LA 2W5FA 5CSYA 1MXDA 4W5UA 1UUQA 1SYTA 2EADA 2EPLX 1UKTA 2OWWA 4OBRA 3LMYA 1UKSA 3RPMA 1FA2A 2J8GA 1SFSA 4AD3A 3AS2A 5A95A 4QLJA 2YIHA 1DWHM 1OT1A 3ARZA 3FAXA 5CGMA 1KXTA 1CXIA 1TCMA 1NP2A 1HJSA 4U3CA 1V3MA 1GQLA 1HKMA 4WJXA 4Z2KA 3LXAA 1FP8A 1UR1A 1WDQA 3WEOA 1B1YA 3PZNA 5D9NA 2DSVA 1HJQA 2AMGA 1QI5A 3AIBA 4Q7NA 2X2JA 2Y2WA 1ESWA 2F61A 1C92A 1K9TA 1PX3A 2GDVA 3QHNA 4UFIA 2PWFA 2E0PA 3LRMA 4PSPA 3GBEA 3WQ6A 3WUGA 4F9DA 1UZ4A 2J25A 3RJXA 2O9OA 5DEZA 2DH2A 4URIA 1F4AA 2HISA 1QI4A 5A94A 2XJ7A 4CD6A 1M7XA 3W4RA 2XIIA 2VJXA 1H5VA 2PC8A 3VU2A 3AXHA 3WF4A 5HBFA 1XH0A 1NOFA 1JD7A 2X2YA 3MSGA 3VIMA 3TA9A 4EK7A 4GQQA 3W25A 3AMDA 2ZWZA 1AQMA 3BVUA 4GZIA 4GQRA 2OYKA 5HPCA 2XGIA 2J7HA 5GPRA 3UR7A 1V3KA 3VIPA 4GI6A 3W38A 4MDOA 4Y7EA 3VSTA 2F7PA 2ZE0A 1C91A 4QDMA 5EBAA 2IXVA 3MMWA 1HVXA 1UOKA 2XSBA 2V3FA 2ZUNA 4CVWA 1E15A 3MKKA 2W61A 2DSKA 4FNRA 1OGGA 2ZX5A 3POCA 3WNPA 4ZE4A 3AZSA 3WY1A 1C8QA 2WWDA 4MB5A 4BZYA 5DF0A 2W91A 1VFMA 3LXCA 3SUSA 2ZOXA 3N13A 5BRQA 4ZENA 3UERA 1W9DM 3W27A 2Y8KA 4MB4A 2E4TA 1KCLA 4JL2A 1H41A 3OBAA 1XHGA 3W28A 3CHFA 1W9PA 1OINA 2EJ1A 4UOQA 4HA3A 2PI6A 2CESA 4IM4A 1HXJA 1E71M 2WC3A 2XFFA 3BUIA 2Y5EA 5E0FA 5KZ6A 1V0KA 3WDIA 2J79A 4J3TA 4KRUA 3VGEA 2J7GA 3WH9A 2ZUTA 3W0KA 3KL0A 4DO4A 5I3DA 5CLTA 3NDYA 2XGBA 1P6WA 2F2HA 3AHYA 1WDPA 4TTUA 1QWUA 3NSMA 4M1RA 5CG0A 3S2CA 4D6JA 1B2YA 5JBFA 3W29A 1PZ3A 3DX3A 2XN0A 3AZRA 3BMWA 3PTMA 3RJYA 1HVQA 1W3LA 4A4AA 4RE4A 4UFMA 5GNYA 1UYQA 2WVSA 4JAWA 2WCGA 4NRRA 1NWSA 3T09A 1OD0A 1UR0A 2GVYA 2TAAA 1J0YA 2YFOA 5A8OA 3CHCA 1H4PA 4B3KA 1YHTA 5ABGA 4CU8A 4HPHA 1QBAA 1NOWA 1BYBA 2VR5A 1KGXA 2XFRA 3AI0A 1FFQA 1E6RA 1UR8A 3L4ZA 3VDCA 3WQ4A 4A3HA 1FP9A 3AXIA 1XSJA 2NT0A 3CUGA 1OB0A 5E6YA 3WF0A 1GNXA 3VINA 5JUVA 3VDAA 4P7LA 2G3JA 1B30A 1VBUA 4BA0A 3UESA 4BQ5A 2FH6A 1DEDA 1MW0A 3UEQA 2WBKA 2VURA 2VVNA 3QOKA 3D4YA 3CZEA 1G0CA 4V28A 3MUZ1 4E8CA 5I78A 2ZX8A 3N17A 4OZOA 1G94A 2DT3A 4FNQA 2WAGA 4PRWA 1GOQA 1E73M 2A3CA 5FKYA 4W7UA 3SCSA 2ESCA 4BF7A 4KGJA 1J0JA 3NDZA 3AYSA 4BS0A 5TD4A 2VC9A 3DX2A 2D1ZA 4DWSA 5BROA 2VRKA 4BQ3A 5D9PA 1EH9A 1B3VA 1LL6A 3RM9A 3T2PA 2DSWA 4AZ6A 5FL1A 4UZSA 3BCDA 3CGTA 3D50A 3CHEA 1LL4A 4WF7A 1TQUA 1O7DC 2WZHA 3VIGA 1PZ2A 1QWNA 1DHKA 1V3JA 1W2PA 2X2IA 3VGGA 1CDGA 1RPKA 3VVGA 5JBEA 3POHA 3UCQA 4PMRA 4UFKA 3NJ3A 3VD3A 3VNZA 3U5UA 3WFZA 2BVTA 1RP8A 4FNUA 1HN1A 4C7DA 1GVIA 2W92A 2PBOA 4H04A 3BAXA 2JF6A 1C3FA 3NCOA 2VCCA 1X6NA 3VIFA 4CN6A 4NXKA 4H41A 4JIEA 1G9HA 3PZOA 3WNLA 2WMIB 4D71A 4FMVA 2VZVA 3A3HA 1W3JA 2MANA 4CD8A 5DFAA 1JXKA 4GI8A 3CUIA 3U7VA 2WZEA 3AMLA 3AMKA 3MU7A 2GJRA 3VM7A 3ARTA 1GJUA 1WZLA 3FXYA 2UY2A 1JZ2A 5A6AA 3GXMA 1JDDA 2J4GA 1QHPA 4AZCA 1PIFA 3VGFA 3IJ8A 4P7RA 1UKPA 3IJ9A 2DT0A 4PMUA 1SZNA 2A3AA 4UQDA 4X9YA 3BLKA 4RE2A 2VTFA 1MQQA 2D20A 1UD8A 3MUY1 1ECEA 2GJPA 3S5ZA 4W85A 3VMOA 3KL3A 1AMYA 4HMDA 2DPEA 1QNPA 2WCSA 3OB8A 1E4NA 1J9YA 3A24A 4J3XA 4HOXA 1W3HA 4ML4A 2QPUA 2DIJA 3DHUA 3WF3A 4FLOA 1MYRA 3WL0A 5LA0A 4AWEA 1HP5A 5D4YA 4JCLA 3GXIA 5D8WA 1D2KA 1CWYA 4Z2GA 2F1BA 4H8UA 4MTVA 2CIPA 1VEMA 2WANA 1FHLA 4ATWA 3UETA 1H0GA 4DUWA 1JZ7A 3AIQA 3AHVA 2D73A 1R33A 1B9ZA 2QHAA 1CTNA 2D0HA 2DQXA 4EAMA 3WY2A 1E6NA 2WLYA 2YBUA 2FHCA 1E43A 4AXNA 1PEZA 4BCEA 1ISXA 3LPFA 5F7UA 1QPKA 4DUXA 3A21A 3BH4A 3PZUA 4HU0A 1JI1A 3WN6A 1Q6EA 3SURA 4M56A 1M01A 4HZ7A 4FLSA 1E5NA 1BYCA 6CGTA 3QR3A 2A3HA 3WH8A 2C8NA 5BWFA 2XVPA 3AIVA 4XZWA 2DEPA 1B3YA 3MMUA 4KRTA 4P8XA 2YFNA 2VL4A 2Z1SA 3PN8A 1W3KA 2WW5A 3OLDA 1MW1A 2V5CA 2OYLA 5GNZA 4MAVA 3WDJA 1CZ1A 3J7HA 4H8VA 3BAJA 3WQVA 1JDAA 2W62A 2O9TA 1VF8A 2WC7A 1WAWA 2JE8A 4M81A 1EA9C 4HP5A 1JNDA 1T0OA 4CD5A 1TVNA 3AHZA 4TTGA 1EIBA 1VB9A 4GI9A 1BG9A 2YOCA 3VOCA 1RP9A 2WNWA 3O6AA 1CNVA 1K9DA 3SCOA 2V5DA 1UHVA 2WK2A 5HPOA 2GUYA 4M80A 4B9ZA 3VD7A 2O92A 1V08A 1OD8A 3CBWA 2OW6A 3L4TA 1LF1A 1C7SA 4H7VA 1HF6A 2RGLA 1LG1A 2XIBA 3U5YA 4BQ4A 3UG5A 5EFFA 4W89A 3ZJKA 3AS1A 2G41A 4PMNA 9CGTA 1KCKA 3BAWA 1JIBA 2YA1A 4W8AA 5CXPA 4J3SA 1E72M 3K4DA 4DO6A 1KR0A 3ZSSA 4W84A 1DWGM 4PMZA 3PZGA 6TAAA 1E6XM 4UQBA 3OZPA 3VIIA 2W63A 1YQ2A 1MW3A 1V3IA 1OM0A 4NZCA 4GZEA 1QHOA 1Q6CA 4HA4A 1QI0A 2F8QA 3WBEA 4UFJA 4HPGA 4KH2A 1CXLA 3IAPA 3AXXA 5BXPA 4BQ2A 1BTCA 1J01A 3RMEA 4JHZA 4LGXA 4MADA 4WIWA 2WMHA 3MO4A 1NM9A 4M29A 2BY3A 2WVUA 1E4MM 2OW7A 5A8QA 2F1AA 1JAKA 4AZIA 3W6MA 1OT2A 1E3XA 1B3WA 1EHNA 1JL8A 4NZJA 3GYCA 3MMDA 3AS3A 1H2JA 2E3ZA 4CVUA 5IFTA 1W9VA 2QPSA 2BY1A 1GHRA 3D3AA 4JKKA 3A4XA 1OWQA 5LA1A 2Y4SA 1CGTA 2YL9A 2WVVB 2YDSA 3WQ8A 3NSXA 4OOUA 3PTKA 2DSZA 4IPLA 2V3EA 5ECUA 3WF1A 3WD2A 3WF2A 5A1AA 2VRQA 1KTCA 4AMCA 4HMCA 4PBGA 3B9EA 3FAWA 3F5JA 4F79A 3AIUA 2VZSA 2G3NA 5LYRA 3QHOA 4U2YA 2QLYA 1NWRA 1HT6A 1JNEA 3EMZA 3M7SA 3WIJA 4CCDA 2D3LA 3CMGA 4MNLA 1TQVA 1HX0A 4RE3A 2D3NA 1G01A 1UKOA 3AIWA 3ZT7A 1XC6A 2J8FA 3AJ7A 1KBBA 2WVTA 1M53A 3LRKA 4UFHA 3BSGA 1HKIA 1CGVA 3OGSA 3EJSA 4NI3A 4PTMA 1BPLB 3AIEA 5A2AA 7TAAA 1XYZA 3PZTA 3ZT6A 2CNCA 1WZMA 2FYVA 4QP0A 5A69A 4JZ5A 1R85A 2C0HA 4KGLA 1UD2A 1JZ6A 3WY3A 2XN2A 1L0PA 1KWKA 5KEZA 1ZBWA 1XH2A 2AOSA 4FLQA 2WZIA 2XVLA 3T08A 3EDDA 4W86A 2X09A 4D1JA 4UQEA 1EQCA 1FFRA 1H1NA 3SCQA 4F66A 3CUHA 4GXPA 1R87A 3B8SA 3OIHA 2ZICA 4AD5A 4PSRA 1QNOA 1V0MA 4MNKA 4DO5A 2WWCA 3WNMA 4OKDA 2YBTA 4P7OA 1GPFA 2OSXA 1WO2A 1OBAA 5AYBA 5A2CA 4AIEA 2D22A 5IHSA 2VZUA 2ZWYA 3H55A 4R27A 2F7RA 1TVPA 3IANA 3SEPA 1IV8A 1QX1A 1OSEA 4ATDA 2WHKA 1B90A 1BQCA 3K1DA 1CENA 2B31A 1LG2A 4FNSA 3QHMA 1W32A 1X1NA 1HKKA 3VGBA 3L4YA 3WBAA 1CEOA 1GQIA 3FNDA 2ZUMA 1VRXA 2NT1A 3CZNA 4AZBA 4OUEA 3CZLA 3QOMA 1LWHA 3WUBA 5CPTA 3THCA 3WFLA 1PX8A 3BAYA 3CLWA 1EXPA 3WKZA 1AQHA 1BF2A 2XM2A 3SCRA 1E6PA 1IZJA 1UASA 2PF0A 1CGXA 2XSAA 3MANA 3WEZA 1XD0A 2ZXDA 3EMCA 4ATLA 4C7GA 5E6ZA 3HMCA 3PBGA 3VUPA 3ALGA 1DWIM 2PB1A 3L4WA 1GOIA 2WC4A 4CCEA 5BXTA 3BUBA 2CHOA 2WMIA 3NSNA 1XH1A 1GOKA 1O6IA 2VRJA 2UWFA 2PWGA 2XN1A 1QHZA 1W9UA 2BNJA 2F18A 4QAWA 4QFUA 3PZIA 1BVNP 4AD2A 1B0IA 4PMXA 3ALFA 5A8PA 1E0XA 1SR0A 3S5YA 4D6IA 2BXZA 3EJQA 2J7FA 2C7FA 4IISA 1U30A 4DUVA 4EKJA 3RCNA 1WB0A 3DDFA 3L2MA 3ZOAA 2XUCA 3BVVA 2VX7A 5JIWA 1MXGA 3IJ7A 4ZE5A 3BVWA 3WDHA 1V03A 4WKHA 1G5AA 3UG4A 3EDEA 1TA3A 1DWAM 3K4AA 2PWEA 1TZ7A 3WD0A 3W24A 4QLKA 1J18A 4KMQA 1G1YA 2E9LA 1HJUA 2XVGA 4W7VA 2J77A 4LQ1A 2OSWA 2VOTA 2BVYA 3VDHA 2VT0A 1CYGA 1E40A 4AD0A 5E09A 2GK1A 3ZJ7A 5I24A 3N12A 1C8YA 1UR4A 3T2OA 3EJUA 1QBBA 2UY3A 3VNYA 4LX4A 3VD5A 1H11A 3PZVA 5BYWA 1UH4A 2DIEA 3TTOA 3EDFA 3NIYA 3SCWA 3DYMA 2XVNA 1ISYA 1WP6A 2HVMA 3DECA 3BUQA 1JZ3A 4AMXA 3VPLA 3BVXA 1EDTA 1JAEA 5A6BA 3TTSA 1S46A 4PMOA 4AEFA 4S3KA 3VM5A 1QNRA 2EAEA 4PTVA 3F5LA 2BY2A 1EDGA 3ZJ8A 2QMKA 3VTRA 1WCGA 3ARYA 3M07A
chains in the Genus database with same CATH superfamily
4NOFA 1CX9A 7A3HA 3GDTA 2HS6A 5GJPA 1UZ8B 4I3GA 3N18A 1IFRA 3D85A 3GSQA 3VH8G 1D5MB 5G5DA 3CXDL 1J05B 1WAPA 1OD9A 5HTSA 3GG0A 4Z7UB 1ZSXA 3HRZC 4P8UA 1T5WB 2ZZ6A 5FF3A 1OE2A 3MHUA 1CMOA 3HMXA 3OF6D 1CZ8L 1T4WA 4NHUA 1NARA 3VXMB 5FKPB 5IBXA 3CO8A 1D3CA 4HF5L 2ZUUA 1TRDA 1KFEA 2YDRA 3GSVA 4JFFB 2YAFA 3SKMA 3T55A 2JJTC 4NN6B 1XIJA 1OSPL 3AQDA 4C4BA 5F7BA 1QZ1A 5BMWA 2X4TB 4MS6A 2FX8L 1I3UA 1FWDC 1P9MC 2WBWB 2IS7A 1MCCA 2F8IA 4HD9A 2XTLA 4M0XA 2YGYA 3PYCA 4LL4A 1R3IH 3Q1SH 3MJYA 1L5GA 2F54E 5J11C 1KFKA 6ENLA 4RA3A 3U0PB 4OB5L 3LRLA 3HRPA 4KJWC 5F21B 5J13C 4H1LA 2J5LB 3KNBA 3K8LA 4U6XA 4N2DA 4UT9A 3EOAA 4O2EB 4MD4B 3E6HB 1WDDA 5TIMA 4IRZH 1M9WA 2NSXA 4XVEA 4L0PB 1GS7A 1EX5A 5CAYB 2SFPA 2EDMA 1S9XB 4XBMA 4ZO7A 3TC3A 2DWYA 3UWEA 1U8IB 1OKEA 1N0LB 1QWKA 4O4WA 1SQMA 2X05A 1M6OA 5DWPA 5G4NA 3CQIA 2F54B 4AD4A 4YLBA 2XZAL 1D7BA 1JE6A 3AB0C 4LFHG 5D7LA 1VBJA 4HS3B 3P30L 1OZUA 2ADGA 3DIDA 5FF2A 1BFNA 3MRCA 4HCLA 2NNXA 2ZQKA 3CWHA 2Q8ZA 3DX5A 5K3VA 1SM3L 1CDUA 2F53E 4RIRB 2CITA 1C12B 2P7TB 5BRPA 3QMSA 3HZKB 1KKRA 1AGBA 3GXPA 4HS6B 1A3RH 1FVDB 5CPNA 4CMMA 3BOFA 3PWUA 2VM4A 3QPZA 1L9MA 1GR7A 3HURA 2ZXQA 3PJUA 5FO8B 3LEPA 1WVZA 4HETA 4YYCA 4PVMA 4NERA 3WKNA 1WOAA 5GS2D 1NDWA 4NNPH 3DX9A 3FNKA 4NUQA 4XZ9A 2K4WA 1F42A 5I1KH 4ZFOA 2YW3A 2FRGP 3DO3A 3VK5A 4XMTA 4PUDA 2F53B 5I5RA 4RMTA 3IJHB 3W56A 3CSTA 1GGOA 1DE4A 2PTUA 5ISZE 4NX5A 1RIVL 1B4JL 4MDPA 2DQTL 3HCVA 1Q4WA 3JVFC 4PRIE 4ODXA 5BW7C 2XKSA 3MCMA 2Q8XA 4TNGA 3H2FA 1JGVL 1EXBA 3W9DB 3PG2A 3O3EA 4E0CA 2BSTA 3G5VA 4XSLA 5EZPA 4JD4A 3FSWA 2ZRUA 1DE5A 2XHNA 1RH9A 4KK5C 4WCJA 4LV9A 3ILDA 1U8OB 1QASA 3DAQA 3J27A 5AW2B 1K7FA 1GY2A 3KPMB 4K71C 5C7ZA 1K5NB 1FGNH 4X2UA 2XWCA 3SKNA 3NPSB 3HG3A 4GP4B 3RRQA 4HOWA 4M7SA 5ISZB 2CDEA 4LDCA 3F4WA 4U1IB 3VFGL 2GOUA 1I9RH 1BVWA 4PRIB 4XBKA 3RO6A 4Y16C 1BQKA 4GO8A 4FHAA 3ILQD 1AJ7H 1SJEB 5AHFA 3F7JA 1S2WA 3U6XS 5AW9B 5EZLA 3QRHA 4ETQB 4DP1X 1EC9A 1VJIA 3GSNH 5LBSA 2WJ7A 1TPXC 1YQVH 3MI2A 4HIIB 3ZXWA 5DZ9A 3I6GB 2BSRB 4IMKC 3TCSA 1UD5A 2WMPA 3MRHA 3GW3A 4AZ7A 2AKRB 1SHMA 2PW2A 5EF2A 4IDLA 1ZV2A 1I85A 3BVDB 4UDTA 4PJ9B 5TFSH 2DZBA 1LZOA 4JFSA 3I75A 3IWUA 5I79A 4DF2A 1NEUA 1J10A 4WXZA 4MIMA 4BWLC 5DCDA 1XICA 2MCG1 2XG5B 4Q97A 1AQKH 4Y4HB 3W7NA 4HGKC 1IIHA 1F4HA 2WWMC 1AXIB 3EBHA 4PG2C 3DX1A 2H3DA 1A9BB 2WJFA 1M2OA 3V6FB 2VYOA 3R2GA 3D8MA 2YRZA 5D6CA 4DVBB 1DQVA 1S2TA 4TX9A 4PCKA 1FNGA 4BFJA 1AFVH 3X1NA 4RNFA 5A6LA 1T21B 3G1VA 4AXKA 2QJNA 1QSZA 3K8MA 4QRTA 3WDQA 3BKML 5C0BD 1BG4A 3UJJL 1U22A 4QS5A 3CT2A 1KV5A 3RVUC 3D30A 4LNRB 2JEQA 2YZ1A 5EFIA 3LPOA 4LO9A 3PVFA 2GSIA 2QHLA 4I3RL 5CKAA 3PQYD 1I1AD 6ALDA 4G6JH 1YXCA 1KPVB 4X6DA 2JIXD 3RLSA 5I6SA 2QULA 5IROD 4JDEB 4R7NB 4TSBL 4N3TA 3W2NA 1GGCH 4XB8A 2E3VA 5KVGE 1XKYA 4K7VA 2C26A 2NDGA 1UG6A 4NQ1A 1S1RA 1WPCA 2B7QA 2EE3A 4C6DA 4YDKH 2FIQA 4YVVA 1N12A 5EBLA 3UGUA 3NCEB 2G5RA 4JRYA 1JDFA 1YZZA 4YFDB 3PBYA 3ULUC 3M17A 4YHZL 1DSFH 5GSRB 3DA0A 2FQEA 2Y7EA 4PIBA 4KTDH 4LEFA 2IAMC 5T8IA 1TYJA 1NEZB 4YS1A 3MR9A 1HCFX 5B7EA 3DTXA 1F86A 3QIBA 2E7HA 1MNNA 2BZCA 3P74A 2G8ZA 4WJ5B 3S42A 1CG9B 3F6JA 3WMSA 3SN0A 3QK0A 2E6AA 1C9DA 3KE0A 4HH8A 3H3PH 2XPGB 1FYTE 4P2RA 5IOKA 3HPXA 4KJQC 2ZDSA 3FQXB 3QEQB 3NUKA 3TQ0A 2D2OA 5PCYA 5FIPA 4CVZB 2ANUA 1W8SA 3LHYA 2PO6D 3W81A 1HW6A 4NM8L 4XVUC 5EZOH 2C5DC 4D9QE 2RDWA 3SGGA 4FXLA 1R3IL 1A5OC 3Q1SL 1QI3A 4Y4KB 5E6IC 5B38A 4L8CB 4LU5H 4RAUB 4D0CA 1UD6A 1IM9D 4UTHA 3ZTJH 4N6FA 4FXGA 1R5VB 1C08B 5HGHA 4IRZL 4RE0A 2WLIA 5IUSA 5EOCL 4WZHA 1FYTB 1XJBA 1OHQA 2JKAA 2R1XB 1TVLA 4RX4D 4JFQA 1YNQA 1HDMA 3QXDB 1T83A 1TQCC 4J23A 3N34A 4R5TA 3H53A 5HHXH 2Z25A 3NIFF 3U4EB 4YOKA 3WAJA 3M0MA 4DPQA 1EDQA 4HCRA 4GY4A 2CLHA 3GXUB 1FHNA 3FO0H 3D85D 3GB7A 3DO7A 1FYHB 3RFZA 1K85A 3QYCA 1L9PA 3WGUB 1LWJA 4KQ3H 1ZTVA 2E5BA 2I9TA 3T6XA 1A3RL 1UBSA 2R69H 2CPCA 1H19A 1VFFA 4NLAA 2NX1A 2EO1A 4M9OA 1KQYA 1NKGA 5FJRA 3BP7A 4HXAH 5KSAA 1SZEA 4K1GA 5IW1A 4H83A 2P3ZA 5CBAA 4FDWA 4US5A 4XPTH 5FJJA 3RO8A 8A3HA 3LB6D 1ONQB 3V8OA 5HR7A 4NNPL 5A5WA 1RERA 1MG2C 3APDA 4JIRA 4EWJA 1XIWC 4IPPA 1MXDA 2CCLA 3ZTEA 4IT1A 2NY0C 2YIHA 1Z69A 1GGBL 3QR1A 4ZMTA 4UTIA 1H8NA 1PU0A 3CS2A 2NUXA 4PTTA 1OADA 4M7TA 2ARWA 1VRDA 2P76A 1R2RA 1WBYB 3UIZA 5L6UA 1UP3A 1E30A 3FH5A 2JWYA 2WXJA 4Y1SA 1DVFA 2HFEA 3EZ8A 4M1DL 2X3BA 2HN7B 3ULVH 3WF4A 1J2BA 1BOGB 2Y7OA 4PJGA 2PPGA 1R2TA 3ELAT 4ONFH 2WO5A 2FO8A 1N64L 5DRNB 2OX1A 1AQMA 1GKOA 2MMXA 3QIWA 5GPRA 3X3FL 3S3GA 3NOYA 1G6RL 3L2IA 5G4HC 4K5MA 3BWZA 2GUOB 5IJVB 1U4EA 5FA3A 3UYRH 4X60A 2V9DA 3DI2B 1AJ7L 4NO3B 4ZE4A 1KDIA 4MB5A 2PDBA 4ZENA 3OBAA 2IAAC 3BZ4A 2NUPA 3B0YA 3GSNL 3PWVA 1YG9A 1NBVH 4TLUA 4RGMB 1OTUD 1TVHA 4HA3A 4Q4IA 4H6QA 2Y5EA 3FT2B 1V0KA 1G9EA 5HQMA 5ANMA 4PJEA 4LV4A 1P6WA 4XZNX 3N9SA 3TO4B 4XOAA 3G5XA 3BMWA 4ODSH 4L6HA 3IEBA 5D2WA 3VXRE 4IBUA 5TFSL 2IPJA 2TYSA 2WCGA 1W0YT 4EUPB 2E68A 3KHOA 3CHCA 2KZKA 2C1GA 1NUDA 2ROXA 4KWSA 2OMAA 1OG6A 1AQKL 1QBAA 1G87A 2WGXA 1NA8A 1FFQA 5SWUA 4NQDA 4LVOC 3JWNH 1S3TC 3U6RB 2KC0A 3O1NA 2X0WA 3W71A 2XRAH 5GISH 2C18A 3QFEA 5B7FA 5E4EB 1MIMH 2MEJB 1AFVL 5LNEA 2VURA 2Y1ZA 5F1VA 3EYOA 1FWWA 2H32B 1ERNA 2ZXEB 4XZHA 3VXRB 2B1HH 2EVIA 2A3CA 4LAQH 1FLTX 1R3YA 2EXYD 2NW3B 2GK0A 1AYRA 4GQBA 1KJVB 1D5IH 5FL1A 5F3BB 3F7YA 1PUDA 3UAJA 4G6JL 2EILB 2VERA 4HJ0D 1X9UA 4I8YA 3UU0A 4W4QA 2UXFA 3OV6A 4HFUH 2Z00A 1VP5A 4UFKA 4UTLA 2M8XA 3AXKA 4NC2B 1S5HB 3EJJX 4ZMPA 1GGCL 2TRYA 2JF6A 4FA8A 5HYJE 4CN6A 1H6TA 5HA7A 3PZOA 3PM6A 4CD8A 4N8VG 2AV7B 1RZFL 3NDZE 4Q6JA 3AAMA 2NW2A 3BZEA 4OQTA 4J40A 5A6AA 3WLRA 4F8LA 2BRRH 1DSFL 4M1GH 3ME0A 2CC0A 3KPNB 2XC8A 1DN0B 4RE2A 3S1UA 1LORA 1P7KB 3WXVH 1S4IA 3S9ZA 2X1UA 4KTDL 3DI0A 4NN6C 3D0VB 4YU1A 2I16A 1C5DA 1COBA 1NUNB 3MGOA 4FI6A 1B2WH 2YCLA 2DJ4A 2JKTM 1TJRA 5HYJB 1INQB 3U1SH 3FQ2A 3WLKX 4JFDA 4ATWA 1XGPB 1UJ3C 1R33A 3OKOA 4MD0A 1E6NA 3GJFH 2VQ1B 1R38A 3MRLB 1B4TA 3NG5A 1N2RA 3EUDA 1A6VL 5JNYA 4TIMA 3H3PL 3V75A 1Q6EA 4TRPH 3IRPX 5F2MA 4A7VA 3WHXB 3NABH 1MCRA 1EGJL 3P60A 4GG6F 1XZ0B 4LGSB 3WDJA 1OAXL 3TEYA 5EZOL 1KSRA 3ONCA 2WC7A 3CVHB 2ZP8A 4N26A 3GW0A 3NJIA 4S11A 2WNXA 1ADDA 3I6KA 2R1NA 4CD5A 1FIEA 1WAAA 1K72A 4M4RA 4LU5L 4P4KA 3BEVB 3JWDH 1NSJA 1WHPA 3VFNA 5D1ZB 7TIMA 4F1ZA 3EB4A 3GF8A 1S8DB 3JVAA 4LRSA 3RBSA 4F7MB 4W89A 1L9NA 3AS1A 2OXHA 4IOSA 3SD5A 2PDQA 2WQRA 4JRYD 3AREB 4CA4A 2NOYA 5MKGA 1KCKA 4O8RA 2Y3AA 4A2RA 2D03L 5JPMA 4J3SA 2A7NA 2IQ0A 3OXSA 5HHXL 4PLKC 4EXAA 1FL6A 4AQ8C 5I82A 4HCDA 4MXVE 4IGBB 1K8XA 2EC9T 5DJ0A 3FN0H 2ICEA 5TBOA 3FO0L 5FDWA 1UZHA 4Z7QF 3CPLA 3QLLA 5EL1A 4NYYA 2J24A 3LLXA 1N2VA 4WI3A 1RIHH 1OF0A 1XF1A 4KQ3L 1CB2A 3WJSA 3QIBD 2QCLA 5KYYA 2Y6SD 1IQDA 2R69L 2YD1A 3K7UA 1JPTH 2JKSA 4K8RD 3SGDI 1JZHA 5DEFA 4JQXA 1CU4H 2Y4SA 3KP0A 4OOUA 4HXAL 3V0WL 5H94A 1KTCA 4P2RD 1IMHC 1BREA 2K6YA 4XPTL 5AECA 5FLVA 5C9KA 3ZT7A 5EU4B 5HHNA 4KVPA 1I0BA 5IV2B 1KBBA 1NC4A 5FWRA 2GL5A 1KW1A 3SBRA 4HVBA 2EDQA 3EGXA 1MCPH 5A2AA 2NMSA 4CJ0A 1RUQH 4AQ1C 3VGAB 1FG2B 2BASA 2P24A 3KLSA 3ZDZF 1DQLH 1IAII 4X5XA 1GEHA 1KWKA 4KEMA 1ZAIA 5J5EA 3G5YA 4FMFA 2J2ZA 2OULB 1EPFA 1ZHNB 4DP5X 3CUHA 5EO9A 2V5KA 2XINA 5JMOC 2FVMA 1E4XL 5I0XA 5HYSB 4LOCA 2ZWYA 4I4WB 2JJWA 1A5FH 3HO8A 3NPWA 3P0YH 2B7OA 5A3ID 1KC5H 1MDRA 4R4ND 4I18A 3L4YA 5GRZA 2ZUMA 2VUNA 1TU2B 4EN3A 3WFAA 4A6YB 3UYRL 4BZ2H 4ABWA 1M7DB 4J3OG 1AYOA 1IZJA 4WUUA 4Y4FD 3K74B 4PJ9C 4E9VA 4O1CA 5CJBA 1OFEA 1TG8A 1BD2A 4RDZA 5FFGA 1NBVL 2JJSA 4LGRB 3S48A 5KSAD 2KLSA 1JR1A 3DSFH 4V1YA 3X12A 1R3KB 3LCWA 4MZRA 1OAUH 3DPDA 2C7FA 5J6SA 3EPNA 1WB0A 1E9OB 1KJ3H 3UDWA 3L2MA 2VX7A 4FXRA 4A3UA 2Z6FA 2ADYA 1TA3A 4HKJA 5GGVL 4XC1H 5HJLA 1Y18A 2NY1D 4Y8DC 4EKXA 2FBRA 3N12A 3SFKA 4AK2A 5LIKX 4JGUA 4NNAA 2VITA 3HNSH 4QIUA 5HGGS 2XRAL 2NXZD 1T7WA 2DEYX 4BKSC 1DVFD 3LDBC 2GT9B 5EZJA 3PHSA 3EW3B 3VTRA 3ARYA 3FQNB 1UXSA 5F7WC 2LU3A 5EMUA 4LVDA 2BNQE 2VLLB 2A6JA 2X9ZA 6PCYA 5D9SA 3JQOB 4S3CA 4OKVA 1A6AB 1W8EA 4HC1L 5CD5D 3QIWD 3WO8A 5DY3A 1NCWH 1V3HA 1D5IL 3DUUB 2XZZA 1UJPA 2FATL 4RMUA 2MOQA 4JDZB 1QFPA 2PLJA 3BUTA 1T8QA 4HFUL 1JYVA 3HN3A 5LDUA 3LV6A 4QDGA 4XZBA 3GXDA 3C2AH 5IF0B 3NNTA 4XHQA 4NX0A 4PRDA 1PV8A 3AISA 2BNQB 3JR2A 4HSAC 2QCDB 2QIWA 4DJDC 1I4FA 3EWXA 1ND0B 5K1VA 3NACH 3ABRA 2GSJA 4DBSA 4Z3HA 1DCLA 4OF8A 3NR0A 2BRRL 5LXGH 4M6NL 1OY0A 2ATPB 4M8QA 4XCEA 2G3IA 4GO9A 3T8VA 5CD3B 2DQIH 1FSKB 3WXVL 1NLDH 2J6XA 2WLZA 1VFUA 3UWYA 3GSOB 2DQFB 3HGOA 3M0XA 3UJEA 4OF7A 3EKZA 4D6CA 4W6WB 4NQDD 1FBIH 4CCZA 1B2WL 3M5VA 2TRHA 2A99A 5DQ9A 4L2YA 5DK2B 1GC1C 1MCFA 3M47A 2D7TH 3X14A 3RUGF 5LNUA 1FV1B 2AJZB 5A2FA 3O6LH 2VXUH 2R82A 3B8YA 4I0KA 3O45B 1F3RB 4G8EB 3X1GA 3MU3A 1FCGA 3HG5A 2NY6D 5ID0B 3FRPA 3G6MA 3NABL 3RR1A 1BA9A 2VABB 4X8CA 1SVZA 1P5VB 1FCCA 1DHPA 5JZ7D 3UAJD 2QR0A 4G1EA 3NSFA 1LO4H 4YHIA 2BDNH 2WAQA 4LB4A 3UTQB 4GYPA 2ICWI 5DZPA 3H7LA 4MPKA 4YSRA 2R8SH 1PDKB 2Z29A 3NQCA 2WPGA 3JWDL 1XINA 4NZ5A 1V7AA 4X7SL 5DJCA 3FTGA 4OBTA 1KR1A 4W6YB 3BYYA 4LAKA 4AG4H 3DFOA 4X7TA 4UMBA 3TWYA 1ZPTA 3G1HA 5MEPA 4EZLA 1CN4A 2PCQA 2BVQB 3WDRA 3CZJA 3CLFH 5GS1C 1LWRA 1CE6B 2Y7GA 2NW0A 2VC2B 1WX0A 3H23A 5H35A 5M03A 3GNMH 3C0LA 3OVPA 2MFNA 1RIHL 3IMRA 3HB3D 1GYUA 4YXLH 3MRKA 2Z4QB 4JFDD 1SLXA 3MMEA 4AE0A 5EPDA 5D9OA 1JPTL 4U1JA 2NY2D 3FT3B 1CU4L 1W1VA 3KLQA 1HHKB 3P80A 1A3ZA 5D1QB 4RNIA 4M7KH 3BKCH 5D03A 3ZVHB 2Q7NA 2R94A 4I5UA 1U8NB 3T8LA 3L7EB 1X96A 3TA6A 4JN8A 4MRCA 5JDSA 5I3FA 1F1AA 2OJ1A 1EAJA 1GPWA 1IE5A 1IBBA 3HI6L 2GABA 1S9WA 4CN4A 4UV7H 2CERA 3NSCA 4GBXC 2QV5A 5I77A 3K80A 4H9ZA 2HRWA 4V2BA 1BQRA 2R2HB 3D9AL 3DKHA 3AICA 1MCPL 3LCYA 3FUJA 4K94C 4NZFA 1EBGA 2NX5A 4H9XA 1UG9A 3T77B 3AM8C 1S7XB 3WFCL 4PN2A 4P4KD 1GJPA 1BVNT 3QI9C 4CILA 3HJ0A 1EERB 1UPMB 5T26A 4G8IA 1GW6A 3G9VA 5FYJL 3PWIA 1VKXB 3V0GA 3PR2A 1JK8A 3LNHA 2AQQA 4IOSD 3SCMA 1H0DA 2XZQH 2CJUH 4NB7A 4TX8A 4XG1A 1A3LL 3UA4A 1Q6OA 1XF2B 3L5WA 1P4UA 5A2BA 5I00A 1A5FL 4OAWA 3T0AA 1FJ1A 3M5YA 4XMKH 3VIHA 4JKLA 3MJ7A 1KC5L 4QTIH 1YBQA 1T1WB 3E0WA 2GFTA 4N42A 1Q85A 3QXAB 5E2JA 1QQDB 2YPIA 3APFA 1H6EA 2X12A 2CBIA 4F9JA 1AIFB 4PUKA 4XP6H 3QGVA 3MRIB 2MIZA 3UJRA 3BAEH 1GA2A 4BZ2L 4MMYA 4F40A 1GT8A 3TBWB 2OO6A 2EE2A 1ZENA 5J6HA 5AHEA 5CGBA 5GGSB 3IGXA 2PXYC 4IU3B 5A16A 3S37L 3DSFL 1JSYA 3JBG7 2YD3A 4LP5A 3R13A 3ZE2F 2Z8WC 1INDH 5CSZA 2CLVA 1NC4D 3C5JA 3QC0A 3WTXA 2VSDA 2DMBA 5E4EC 2Q3RA 1FL3A 1A5AA 1X38A 1E7UA 5L4IA 4F3FA 4XC1L 2VKXA 3RE0A 3FB8A 1GOOA 4Z0XB 3KWVA 2KDGA 4EX4A 4QNEA 4Q32A 4UINH 1BQHA 5AB9A 4LCSA 1CXKA 5ABEA 3QNXA 1RQHA 4XXCA 3F58L 2OMVB 3HNSL 2Q8LA 5C71A 5EEVA 5D93B 5HI3C 2IDSA 2LHAA 4XXWC 1KIPA 4BE5A 2GSMB 4BIKA 2BNRE 4OZHE 1ZXQA 3LDVA 3K2IA 2IDCA 4GRLA 5DZOA 5J1AB 4BWUA 1G5GA 3ET9F 4X6CA 4TOQA 1SMOA 1SW7A 4KXZI 1UH3A 2RMNA 4X9GA 2BVDA 1ZSDA 1NCWL 1HL2A 4L8BA 2W07A 2NTFB 4NQEA 1SHXA 1T2JA 4EN3D 4JFUA 3GZPA 4QHMB 3N9GL 4N2IA 3MLUH 4ZYKA 3ULUH 4IS6B 3OXRB 4WUUD 3NJXA 2JTYA 5DHXB 1M6UA 3W26A 5DMYA 5DZVA 4K3DH 1BD2D 3ZL4H 5AKRA 1WXZA 2QQQA 4BUQA 5BXRA 3N15A 4ADIA 2BNRB 4OZHB 1XV8A 3N44B 5HMFA 1SXAA 1TPDA 3MRMB 1TQBC 3P4MA 3TJHC 5IR1B 1CGYA 1E2ZA 1TREA 4WY0B 3RFRA 3KVPA 3BWWA 1MEWA 1R3JA 3NACL 1R30A 5CHNA 4KJYA 3B2UD 4AIZB 1IXPA 4QHRA 5JPNC 1QOKA 4LEOB 3GLCA 1TQWA 4QCEA 4CNSA 2DQIL 2R29H 2CLZB 3IN0A 1NLDL 5AENA 2NY3B 1JXDA 3U46B 2XTSA 1GQKA 3KLLA 5CPQA 4E3TA 2X4PB 3STZB 1PZ5A 5GJMA 4PTDA 2FR4A 2R0ZH 1FBIL 2E1WA 1VIZA 3P8IA 4RJEA 2NUTA 2PDKA 2D7TL 4U1GB 3E0LA 3D1MC 3N1AA 1O1HA 5KVFE 3O6LL 1XLFA 2VXUL 2W65A 1V6VA 1HL8A 3UXKA 4UOW0 3STFA 4JQAA 4W88A 5FECB 2J6EA 5IQ9A 3P4OB 4JVPA 1X8CA 2VMEA 5C70A 2O93L 3LI1A 2ADJB 3CFBB 4O50A 4Y7MA 1P43A 4E5XG 3BSZA 1T20A 3NJFA 5DHEA 1KB9J 2BDNL 2Q2LA 4H4IA 1ZA6A 3A67H 4TQPA 3QZMA 3M44A 2F0CA 3AQUA 3TO2B 3A6BH 2KLTA 3A6CL 2YMXL 4AOFA 3UYCA 2R8SL 1DFXA 4QWWC 4DB7A 3SSGA 1RALA 2O7SA 3SCNA 2H6OA 4IIBA 1JZ8A 5DO8A 3OX8A 4HEMA 4GX8A 4FQHB 4WI5A 4JO3H 3DIFA 5FHBH 2W5FA 3N41F 3RL2B 3X1FA 2J8GA 1S7TB 3L95A 5IVZA 4DGWC 3MXVL 3DV4B 3B06A 3CLFL 5HHME 1UEYA 1QI5A 1BEXA 3RWJA 5FGRA 4AC7C 1NAMB 2VW7A 1ESWA 3GNML 2F61A 1IFHL 4J4PA 2DMCA 3H6JA 2EVJA 1HL5A 1DIOA 4EI6B 4BZ1A 4IPJA 2XIIA 1H8OA 5KZCB 3P2BA 4WI4A 5DZLA 4XPHL 3B8DA 1I7ZA 3G9AB 5G2HA 2V63A 1GMEA 4GH3A 4M7KL 3K81A 4EBQH 1MHPH 3V16A 2F7PA 5HHMB 3TN5A 5EBAA 4GMSH 1VADA 2GY7B 3OA3A 3Q5OA 3GVWA 4UV7L 1TO3A 1CB4A 2FB4H 5AZEL 3BZFB 4ISVA 4PMEA 5AYZA 2JKJA 1MFAL 1KCLA 2MCAA 1CFSB 2NQZA 4BGDA 1OINA 2BMBA 3E96A 2X16A 5AWNH 1U3HB 2BIQA 1I2NA 4L48A 1VSCA 1CL7H 2CD0A 3FQYA 5AUMA 3HW7A 4YDLB 3PGCB 3K2MC 1UM5H 1WYJA 2W0UA 3NZ8A 4ODWB 5EWIH 2OJPA 3W29A 1XIEA 1ZLPA 2K3TA 2XZQL 2CJUL 4UFMA 3Q01A 3O3RA 5A8OA 3QEUB 4AYID 3WQFA 3F12A 1N5YH 5C54A 4XMKL 4ODVH 3GAKA 2G5BA 1U2CA 1J6OA 3L4ZA 4PY8I 4QTIL 3BGGA 1JRHI 4UQ3B 4G7QB 3U4KA 2V5BA 4F5CE 4YAQA 3HVDA 2KLRA 3QG6B 1AMKA 1KTRL 4XP6L 3MGAA 4BQ5A 2NZIA 4PA8A 5E2UL 4IRSC 2E4FA 4XTRD 4DOHE 2V7HA 3BE1H 3CZEA 1UUMA 4REQB 2O7QA 5K1NA 3FDGA 4PRWA 1GOQA 3BP4A 3CFKA 1E9PB 3MOAH 2P5WA 5FKYA 2IGFL 4X0KB 5EF0A 4KGJA 4R2GD 5FO9B 3UBPC 1ET7A 3EH4B 3ARGC 2D1ZA 1FWXA 4DWSA 2VRKA 2BVOA 2INZA 3UTPE 1TV4A 2R9HC 4MLRA 4QMEA 1PKMA 1INDL 2D31B 3MPGA 4LE8A 2QQLH 3G24A 3ZTJG 1NM4A 4PTNA 3QCVL 3PIQA 4NIRA 2X2IA 1BXCA 1HK6A 3VVGA 5F1IA 3POHA 1TKWB 2ZZ7A 3NJ3A 3H8NA 1XLHA 2NX5D 3MBEA 4DOHB 1F4WL 5C86A 1HG3A 4QCIB 4FNUA 4IQHA 1XZWA 4JQ4A 1GG1A 2HK1A 4UANA 4OD1L 4UINL 4D71A 2VZVA 4FMVA 4Q7IA 1SUHA 4DLFA 1W3JA 3NG3A 2E7BA 4XAFA 5TDOB 4LBEB 4NENA 1G7LB 3SCMD 3GG7A 1T0NB 1AHWA 3QQ4B 3WIIH 3IJ9A 2XA8H 1ZHBB 2Q7AA 1EMTH 1S3KH 1JCNA 3MUY1 3Q2WA 5I1LB 5K9DA 2GJPA 5DANA 1IGJA 1RJYA 5INDB 2YWYA 1U8CB 2WSQA 4P57A 4UM9B 4ADSA 2CK2A 5I15H 4ML4A 2NXYB 4J3ZA 4TQHA 1SJAA 3RX8A 4TUOA 1G6CA 4AU0A 2EEFA 1UM6H 4FQQA 3MLUL 1UP2A 4U4IA 3LOTA 2QUUA 4HZAA 1CTNA 4HUKB 3WY2A 1VFAB 4PWEA 4GSUA 4FHJA 4GUCA 3EBAA 4K3DL 3ZL4L 2BWDA 1VCGA 3MN8A 4GLEA 4V2CB 4NM4H 3VXNA 2C8NA 2XVPA 1MQKH 3JT0A 4JY4A 5FW6A 2KMWA 1DUYA 4MAVA 4RW3A 3FOLB 4L56A 3S36H 3WQVA 1VF8A 4YSUA 2OGJA 2N56A 4MM1A 1XDJA 4DZBB 3QO0B 3TA3C 4U1NA 3WHE0 1VB9A 5E1IA 1W31A 3VOCA 4QLWA 3WLOA 2AK4A 4RMSA 1UHVA 1L9TA 2F5AH 1CICA 1KCXA 1BIIA 1ZLEA 5E5CA 3VD7A 3EO1A 4E0RA 1V08A 2ZZUT 2DQCH 1S2CA 4Z77B 5BOZG 3UYIA 4NZRH 2G41A 4PMNA 4I48B 5GGTL 4E42B 5CEZH 4W84A 4APQC 5C0CE 3V5HB 3DRQA 1P4LB 5BRZA 5FXCH 3QUMA 4ERGA 3SADA 4QF1A 4GRLD 1AL8A 3KM8A 2IQ9L 1DBKL 4KH2A 2XIOA 4GY7A 5KAQF 3IU4H 3MAWA 2LU5A 3ABZA 2B14A 4JFPA 4KZEH 4NQED 3PP3H 3S98A 1CDIA 2E7LA 3LCIA 4QS6A 4JY9A 2EUXA 4FKKA 3FL7A 5EUKA 5L2JB 3MJMA 3A67L 3C8HA 3WQ8A 1W16A 3TTEA 3A6BL 3SD2A 4LF3A 3OPUA 4Z17A 1FWJC 3WF2A 4UB0L 3FV9A 1MZHA 4X8GA 4FHKA 2DW7A 1MCOH 1HH6B 5DJAB 4FB7A 2R2EB 4HQQL 1HEZB 1E4JA 1DANT 4R96B 3AJ7A 3LRKA 3LXUX 1M71B 1E8XA 4UFHA 2XUWA 4JO3L 5FHBL 1WA1X 4C5ZA 4A7QA 3AIEA 3KTSA 3NJMA 2YMTA 3LKNA 3WOVA 5I76A 3OKLA 1R85A 3MRBB 2C0HA 3MV7E 3JWNG 3LKOB 1N8ZB 5DRWB 1NCHA 2FAUA 2X4UA 5D1QC 1UZGA 1ZGLA 4QRRA 1PYWB 2OMZA 3SE9H 3Q2NA 1P6BA 2VERN 4XP4H 2Y7DA 1MHHA 2Q01A 2QJHA 2IALA 3W39A 4GUQA 4XVDA 2PWVA 1EX1A 4R90H 1RZJC 2A3LA 2YPLA 4PAZA 3VC6A 4GVIA 3IT8D 1MHPL 3HC3H 2B7DT 2ZCHL 3R4DA 1LE9B 1Z41A 4F2BA 5KS9E 2CHDA 5KZMA 4GMSL 1S7SB 2QBWA 3CLWA 4NFDA 2XYBA 1KXVC 3KVQA 3PL6B 2FB4L 2IBZY 2BINA 2N01B 3O3UN 3EMCA 4O17A 4E36A 3CU7A 2C14A 4RCXA 3QKEA 4S1SH 5BXTA 3H7BB 5AWNL 2VRJA 3ESPA 5FUZH 3Q2LA 1MRDL 3QUKA 3W74A 1PCSA 1CL7L 2G3ZA 3BQVA 3UBXI 1UM5L 3K6SB 4PJDE 4HH9B 1OAYL 3O3AB 1QACA 2HDJA 4OJCA 2FPVA 5EWIL 4AVIA 4CNIB 2AJUH 2QJGA 3SSJA 4JPIB 2HTLD 1IRAY 2NNAA 5KS9B 2XWJB 4MZ1A 3EDEA 3K4AA 4FOKA 3ABOA 4XO4A 2ORBH 5FSEC 4GT7A 1CCZA 4YFEA 1J18A 3SECA 2VZ3A 3NK3A 4QRSA 1N5YL 3BGFC 2DUAA 4ODVL 3C5ZC 5BV7B 3PAZA 3EX2A 2V2DA 3SGJA 2H5UA 3FQ4A 3HZYA 4QT5A 3VD5A 4J4PD 2XZCH 4PBWD 5AVRB 1RK1B 1WP6A 4HHHA 4JG0L 3ZDXE 1YMMD 4PJDB 4S3KA 3BE1L 2PURA 4IOIA 3BMXA 3VE7A 5DQJB 3D3FA 4RAHA 1DN2A 4TLSA 4PW4A 4PULA 1F05A 1BM3H 1JNHA 4ZMGA 2BG5A 1I1XA 4ZMZA 1NDYA 1JTPA 2AABH 4OLYL 5E00A 1XIGA 1NFAA 1MI3A 1A9EA 1BKSA 2V2XA 3RVXC 1B4LA 4ZFFB 3G6DH 2QQLL 4OIIH 3CIXA 3JVGA 3ZDXB 3H0TB 3CMJA 2FE0A 4ZXBB 4AKPA 4P46B 4OY9A 4XNUH 3RRXA 5BZXA 5D8ZA 2PDJA 3DVFA 5K9KA 2OQHA 3NSYA 5LB1A 3IRDA 2WOYA 4JEGB 4RZKA 5AW4B 1G6VK 2G5WA 1M2VB 4IM8A 1BEUA 2PF8A 4MQTB 2VDMH 2HG5B 3WQ5A 2LGNA 3ARRA 2A74B 3HBQA 3WIIL 3V4VA 3LN5A 2YWZA 4N6RB 1E9QA 3Q2DA 5HGDA 2YMOA 1EMTL 3UCRA 1G7IA 4AZGA 4XH2B 1S3KL 4O00A 1IJNA 2B8OT 1R5YA 4QHUB 5I15L 2J75A 1IKOP 4ZFCA 3ZKXB 3MRGA 4L4JA 3E74A 2DBLH 1ZWIB 3L16A 3T3PE 4AJWA 1Y0LB 4QKTA 1XR8A 4R7WA 1TNNA 4K15A 4X2RA 2QMJA 2CZNA 2NCMA 4L8SA 1KKOA 3BLEA 1HILB 1WWWX 2YLAA 4RZ4A 3QDGA 2P5WD 5KJ4A 2D9CA 1VENA 4NM4L 1GQJA 4JTJA 1VH7A 1TKKA 3S3PA 4C8XA 4CC1A 4XD5A 1LVEA 2V0TA 4GIOA 4DWSD 3HPZA 4GB9A 4UTAH 5D04C 3QORB 2X40A 1ENUA 4OLZH 3S36L 1EUAA 2X1RA 2BMKB 1AD0A 3TWCH 3PDOB 4KFOA 1GC1H 5E1AA 4KI5C 1E65A 3T3PB 3PXLA 3MBED 4Z95H 5T5NG 5ACMA 2OMUA 3MBWA 5E1QA 1T5AA 3G6AA 4JLRA 2F5AL 3KHQA 4FNTA 1AR1C 2AXGB 2DQCL 1F3WA 4HG4K 1XCWA 4Y4FA 5FB8B 4HSNA 3KYOA 4NZRL 3TFKC 1P1VA 3GXNA 4H26B 1XF4A 5CEZL 4L3EA 2ZP0T 3PHQA 3MRNA 1BZ8A 5E9XA 4NUPA 3VCLB 2R9RA 1LMKA 4ILDA 4JM2F 3QUXB 3W1LA 3BJ91 3R8RA 3QJHA 5FOBA 3KGSA 3QAZC 3WSUA 1V6XA 7REQB 4L1TA 2V8MA 1BG1A 3MV8D 2NLJB 3DV6A 3ZDWA 2XWDA 4JG9A 4HULB 2AK1H 3IU4L 5I1KL 5I6LA 2R0WH 4KZEL 1FTXA 1XF3A 3CC5B 3MDJA 1M7IB 1MDLA 4FG4A 3VFTA 3ITLA 1RUAH 5C2CA 4MY1A 2Z0UA 3N04A 4UOZA 1NGXB 1MCOL 3CFCH 3H42H 1E1EA 3CSPA 4GC4A 4YH6A 2XBDA 2OLDA 5MHSD 2VFIA 4K5NA 5FEWA 4K6AA 2D9QB 3ZO9A 4G9DA 1KGYE 1MQRA 1PKLA 3CZGA 2Z31C 1B0GA 5BVJB 4H8HA 3D5OF 4JZJA 1V6WA 1FGNL 1S78C 1RKRA 2XH2A 4XE0A 2AK4D 1CLVA 3L4VA 4X5WA 2P8MB 1I9RL 1MI5A 5IHWA 1RY8A 1CICD 5I71C 4QLRA 1MSSA 2B59B 3SE9L 2XIQA 3VVVA 3CHOA 1YNTA 1EHAA 4IMGA 3WG6A 2G50A 5DVNA 2ZP9A 5BVPH 1YQVL 4D2NA 3V6OC 4AKQA 3ATBA 5BRZD 4Y5VA 5HQLA 4PG9A 3U9IA 4R90L 3ZSTA 4K94H 4RWYH 1T4KA 4JQVA 3A4WA 3CBKB 3EBVA 1AQ0A 3LNPA 3JZUA 4G43A 4TF4A 4AQEA 2DKUA 5C3TA 2NQ9A 3VFOB 3ZL2A 1TDQA 4LOFA 3U2JA 1JVLA 4HJGA 3UWWA 3CIWA 1TV7A 4WVRA 1US0A 3SE3C 4L4TE 1IE4A 4H6KA 2VMDA 4ZXLA 1H3PH 4XZLX 1UACH 1I3VA 1BQUA 4HWUA 1FOBA 3B9KA 1NFPA 5DT5A 5F2FA 4NFBA 1MWAH 1AG0A 3BLPX 3CDZA 1E0OB 3EO9H 4Z2HA 1QABA 2H6RA 2I26N 4I9AA 1L6YA 2AJUL 5TDPA 4N90D 1WBXA 2YB4A 1EXUA 4QRUB 3S2LA 4KX7A 1X5GA 4YFLF 1F6PA 5T1LA 2ORBL 3OOQA 4ZMAT 2Y36H 1EQWA 2A4ZA 2EEXA 1RZ8B 3FCBA 3TTYA 5SX4I 5D7HA 1J0KA 4EVNB 4L4TB 4D0BB 1JGDB 4QRRD 4J3VA 1ZAGA 2XZCL 1D8CA 3KLKA 3B9VA 2HJLA 1PNCA 1FH8A 4PWFA 3VNDA 3R25A 3VUSA 2P5NA 4XN5A 3QHTC 1KD0A 2IWFA 1A0CA 1Q2SA 1FFTB 3ALPA 5HXMA 4F8XA 2V3DA 1QR1B 4YDKL 2YD4A 2Y3NA 2YPLD 3TE9A 2AABL 2X0YA 3NH7H 5B3SB 3F4DA 1YEFH 4TTDC 1QOQA 2Y88A 1NDMA 2CZ5A 3EPOA 4GW4A 3BHBA 2G30A 3G6DL 1BAGA 1F11A 1A3WA 4OIIL 5KG9B 3S7GA 4LB8A 3FT1A 1A4JB 3AROA 1UCBH 2OTDA 5AKSA 3SBQA 1ZY9A 3D05A 3DFQA 4NP7A 4D94A 4XNUL 4XHJC 2P10A 2XN9A 2ASHA 3KDMA 1CFVH 4ADTA 5EFDA 3WJZA 4D8PB 5C7VA 2UVEA 2Z92A 4NQQA 4HK0A 3TAOA 4EO5A 1ZZMA 2ZUSA 2VD9A 2DI9A 3LVEA 4CSTA 3MW7A 3CTTA 2BHUA 1ANUA 3SAZA 1HYSC 1KM4A 4ERAA 4GH7B 1MF2H 4OBSA 3RRAA 2J5LC 1DDHB 5DEGB 2JXMA 3G1YA 1D7FA 2YXGA 3ARDA 2Y06H 1WTGT 1HKFA 4CQ8A 1HESA 4QIRA 2OWCA 1R2SA 1BQSA 4TMBA 3M6DA 2H6PA 4JM4H 3U48A 2WHJA 2Y8VA 1BECA 5FESA 3NPVA 1KWGA 2DBLL 1PBYA 4LY4A 2KX9A 3L9YA 3A22A 3LEYH 2CKSA 3WN5A 3W7LA 2IOIA 3OHXA 3OLEA 4KKLC 4AGQA 3VAVA 5C0DA 2DUZA 2E7FA 2V81A 2BP8A 3L5AA 4R85A 4Q6YA 4BI5A 2ATMA 1KBKA 3ATEA 1XQKA 3AXLB 1N6UA 1KV7A 4UTAL 2FTWA 5CJXA 1TWWA 4Y2LA 2DLGA 2ZKXA 4OLZL 1I7TA 1YE4A 3FGCA 4WD0A 3SPJA 5J0BA 4U1HA 1GC1L 2LLGA 3RWIA 5J04A 5DA4A 5FKAA 4ZSOE 1CDJA 1JVNA 4EAYA 1IO4C 4EANA 4PJ8A 4N0FA 2IH3A 4AVOA 4U3AA 3BJTA 2WKOF 1LMIA 4XVOA 2D0GA 1B3XA 1IZKA 1FIGH 1OF2B 4OI7A 3EOTH 3CN2A 1QLFB 3NGBB 4JFXA 3RPMA 2Q3OA 5M1TA 5GGUB 3AS2A 3S0CA 3SKUD 1BLNB 1DWHM 1HAWA 3DRTB 4HGMA 4NDMB 4LEBA 4LDOB 4C6OA 3IUHA 3TASA 2TPSA 3PWPE 2CZDA 4I5BA 5MERB 3G5ZB 4LCIH 1HINH 3MZNA 4K9EH 1FG9C 4ZSOB 1K9TA 4UFIA 1X5XA 2Z4GA 3AQYA 1UZ4A 3FSUA 2R0WL 3HC2A 2DH2A 2J8UA 4U10A 3O05A 2H3NA 3CD4A 3D0LB 4XI5D 5D2XA 2RR3A 3RAOA 3D25B 2K1MA 2P9RA 1M7UA 4EK7A 4XVJH 4XRCB 1YO4A 1RUAL 4Z7OE 3NPSC 2XGIA 3IXAA 3QDGD 5E7BA 2Y69B 3H42L 3PWPB 3WIHA 2Y22A 2X38A 4QM1A 3MX0B 2XSBA 3ULVL 4GUHA 4ZDHB 2QELA 3L08A 3L3KB 3CAKA 5F88B 2R0LH 4ONFL 4TNWF 2Y8KA 3Q44A 5TNVA 3TW9A 2PI6A 1IVTA 4EI5B 1H3TA 2FDBP 2J12B 5GGRY 2NZ9D 5EEWA 1WKEA 3WJXA 3W0KA 4Z7OB 5CLTA 3NDYA 4HKPA 2OB3A 2DPKA 2BC4A 2I9LA 3H7RA 3NXFA 1OCJA 4A4AA 4WZ9A 2OT1A 2WJEA 1CFQB 2VFEA 1OD0A 4L3ED 1J0YA 4KU1A 3UTTA 2KPWA 4JPWH 4Y4HC 2PCPB 1IAOA 4K94L 4RWYL 2HPIA 3GO2A 4MVBC 5KBMA 1KC7A 5K9QI 5FYKH 3ERPA 2JQAA 3G1DA 4ODSL 4P7LA 3EOBA 3DCPA 1GTEA 4N6QA 3UEQA 4PBDA 3D4YA 4PGBA 5AW0B 2VISA 4NSKA 5ANHA 2WAGA 5A7EA 3FPYA 2ZZ2A 3WLNA 4Z7WF 3XISA 3DUGA 5GIRB 3EFFB 1H3VA 4NI6A 5GISL 3PSWA 5BV7C 2ADIA 1MWAL 4AL8C 1MIML 5I1IH 3T2PA 1G1OA 3DUHA 3EO9L 3BCDA 2EH8H 1AD1A 1SZFA 3KPOA 3PS6A 1E9IA 1I8AA 5C6WH 2B1HL 4A67A 3SQMA 5T3XH 1RLBA 3H6AA 3E9AA 4ZZKA 4LAQL 1A4MA 3VNZA 1XRSA 4MA8H 4LVEA 5D71H 2RUSA 3PWJA 2VGFA 2Y36L 1GVIA 4IMFA 1O95A 2GGJA 3E2HB 4LHJB 2FO4A 2FYYA 3L81A 1V5JA 3VIFA 1MI5D 3WNLA 4F1SA 2P1FA 1THCA 2D2JA 1W5NA 1GJUA 4ML9A 3G7TA 1PWMA 2OODA 3IJ8A 1OHLA 4CNUA 4UQDA 4N4QA 1P6FA 2DU2A 3EWZA 1DQKA 4ZX5A 4GG8B 2KQMA 1K8CA 4JNZA 1U8PA 4MJJA 1E4NA 3NH7L 3MVSA 1YEFL 4FFVD 4HUXB 4Y8FA 4OUOA 1HSAB 4JN2A 5DMGC 4HKBB 4C1NB 1BBJB 4YDNA 3KH3A 5E8NA 3GDCA 1UB3A 1SO6A 1OM3H 4M1GL 4KITB 3HFFA 4NJAH 3E2SA 2DQXA 4EAMA 3ANVA 3AAZA 3KCLA 2YCKX 1RZGB 4JEJA 3U7YH 1UOZA 2YC1B 5L9FA 5ES4B 3QR3A 3ZE0F 3J8F7 2C6QA 3AUJA 3B9KD 2YFNA 1CFVL 1CUOA 3U1SL 4N6EA 5GS3A 1P0EA 4F2FA 3AY4A 2A2QT 1JDAA 3BLDA 3P84A 4Y4KC 2W9LA 4FXSA 1KIRA 1AGCB 2IQAB 1Q6RA 3LHAA 3VOGA 1EIBA 3BXNA 3VTAA 3LLFA 1G7QA 4TRPL 5IVNA 5T1LD 1X5AA 4GAJH 1CNVA 1JF1B 3OAUH 1SEQH 4PJIE 4G42B 3B37A 2Y06L 1OD8A 4FL4B 1JCVA 3CBWA 3HE6A 2KS0A 5EFFA 3CHQA 2DJSA 4JM4L 4C54A 1S1PA 3KPLA 1PD0A 1O6TA 4J1UB 1UOLA 2KUTA 1KM5A 5XIAA 5E08H 1JGEA 3V5KB 2BS71 3LUTA 3SE4C 2QCEA 2CR3A 1V3IA 4WGXA 4XN2A 2JKXA 3CSGA 2X4RA 5L9DH 4L9ZA 2IVFC 4X22A 2OMTB 4X8XA 1T89C 1RLDA 4MADA 2AGJH 4IIFA 4PJIB 2WVUA 5A8QA 2AL2A 4C58B 4WOQA 4NZJA 1XX9C 4LUYA 5IFTA 1HH9B 1HWHB 3A4XA 2VXTH 3H3KA 3TM6A 1LUCA 5JOPD 3MSYA 4KNTA 3FN0L 5CEYB 3WD2A 4R0LA 3P62A 4TNWK 4FXJA 4KXDA 2EDOA 4W9ZA 2XN9D 2DM7A 1P48A 2OR2A 3AIWA 3X13A 3FZUD 2W0FA 3FTYA 1FIGL 2A0LD 3NWRA 2X7WA 3EOTL 3HI1A 3TFBA 2Q20A 4N20A 2PD9A 4PTMA 3US0A 3PZTA 5IK3B 5KJRH 3QH3A 2D2HA 2B0MA 3CFQA 4UTBH 1KB5H 3FO9B 4LCIL 4BFGA 1F13A 1HINL 3ARDD 1OSZA 4K9EL 1ZHLB 4RW5A 4GH1A 4Z3EA 2WP3O 1ZMYA 4H0GA 3ELFA 4JHWH 4GACA 2HTMA 4LIQH 1RUQL 4FQCH 2E75C 4KAQH 1NQKA 3QO1B 1DQLL 1Y07A 1PG7H 4JKNA 5SV3A 4UC5A 3T4YB 4RMQA 5B22A 3IANA 3SQLA 1IILE 4X80H 1HKKA 4MQSB 3VGBA 4H9TA 2LOEA 3RWHA 4GW5B 1A4LA 2DOCA 2DEWX 2ZKHH 4J2PA 4GYJA 3UXLA 3WFLA 1PX8A 2V2HA 3GUFA 4OIAA 1U92A 2R0LL 1U93A 4XN7A 1QTWA 3KPTA 3C2VA 4RGMC 4X8JB 2W94A 3P0YL 3B3BA 3Q8CA 3B0XA 4JIQA 3E8UH 3ZBMA 1XGUB 3SPIA 4PGCA 2PWGA 1E42A 4MAYB 4OU3A 4LLMB 4YNYB 1RZJH 2NR6D 4WW2B 2IG2H 1NBZA 4PJ8D 1KBWA 4W9DC 3VRJA 5EBWA 1Y6NR 3KM1A 3TO4C 1SDAB 3U2IA 1PLGH 2VLRE 1RU9H 2OKOA 4NRXA 3GD6A 4ZB0A 5I3JA 1FNHA 3L9RB 3IV8A 4X61A 2H1LM 5JIDA 4C6JA 4JPWL 1HJUA 3DNKA 3CSFA 1UUSA 1TX2A 1E40A 4NBXB 1OAUL 5F8RC 1Q38A 4P05A 1JBJA 4E4FA 3KWWB 2WD0A 1KJ3L 3JZEA 1FZKA 3EDFA 5CZJA 2E77A 5TDNA 5D2NE 2GSGA 3HZVA 4FN0A 1QNRA 3UTZA 1BWWA 1EDGA 2VLRB 4HU2A 3M07A 3VOIA 5DO2D 2CLFA 5TK2A 3EPMA 5IB2A 1JDEA 2J72A 1WZKA 3BN9C 3RITA 1DJZA 2DIAA 4NQXA 4XNMB 1RD5A 1ONWA 1H8LA 3OKMA 3IVKA 3ZTCC 2WCAA 3TX9A 4OD2A 1XDLA 1G4TA 3QQXA 1FNSH 3PDDA 5LA2A 2FWOA 1MJUH 4PJCF 2CLEA 2OELA 2EH8L 2AV1A 2EQDA 3HUJE 1VFTA 2YPVA 3PABB 1N68A 1OZMA 3L6FB 5E4AA 3V8CA 2ZUYA 5D2NB 1NEPA 2VN5A 3MO1B 4XZUB 5D71L 1BQLH 1L0QA 1IC1A 4ZZFA 3NPXA 4NO0A 4PLNC 4PTWA 4WRLA 4DQOH 3P54A 4MGXA 3OP2A 4CD4A 3ZXAC 3CV1A 4PEEA 1O6VA 4CGTA 2ZZ3A 1NFKA 3AT0A 4LLDB 3BPLB 3KLAB 3DFTA 5EU3B 2CJSA 3C2AL 1IGYB 4G1MB 3HUJB 3UTTD 2ABBA 4EDWH 1JMXA 2YXFA 4IMLB 4MZ8A 5AW8B 3C61A 1SNRA 3KPPA 1TETH 3FHAA 5E8PB 3RWFA 1I45A 4N2GA 2Y2YA 3KZ8A 5L4FA 4ONVA 1OM3L 2CBJA 5LXGL 5EU5B 3MUCA 2Y5SA 3B7TA 2B20A 4KKAC 4NJAL 2ODIA 4HMEA 1YYCA 3D2TA 2EH7H 4DP4X 4LCWA 3I3EA 4P59H 3PBWA 3CAQA 3WL1A 4PMFA 5AB1A 4BHUA 3RGVB 3WIFB 4PLJC 1XMEB 5A6JA 3F03K 4KY2A 3TJEH 5EYWA 1U1HA 2V2TB 4WGHA 3NA4A 3NFUA 5DD3H 3VI3F 1HIZA 3C6CA 3CL8A 4GNVA 4C6KA 4KRPD 4HAGA 5FJPA 1JF5A 3PGDB 1GZGA 4W87A 3FOMA 4GAJL 4M1CD 5EMLA 3OAUL 5D1ZC 1SEQL 4B9CA 4AT6B 2OCZA 2H41A 4GIAA 5CSSA 4M4PA 5I8EA 2CHWA 4JTRA 4ZS7H 4WKXA 1Q9KA 2CIKB 3LNIA 3BISA 4L0ZA 3AREC 1XSIA 1K9FA 3GBDA 2BVUA 2PNDA 3QQDA 1ZVYA 2VFHA 1LO4L 3C5SA 3SUWA 2POTA 5E08L 1PAMA 5E56A 1YDPA 1DQJA 3MLZH 1JOIA 5DGRA 4OVXA 5CILH 4IGBC 4NO5A 2BW4A 3N06B 3PGFH 2WMGA 5KYUB 3TXZA 4LB3A 2XV2A 4IGNA 5KUKA 1S3HA 4AG4L 4UUIA 1Q4NX 1AZZC 2AGJL 3ZN6A 3P9MB 4PQXA 2D0FA 1OCOB 3B9AA 3QULB 3LHPH 2GEQA 4ACZB 3BUYB 3VXQA 1UVQA 1F1DA 4AD1A 3WKQA 1FO0H 3K72B 5BW6A 4JX6A 2YEQA 3OGCA 3NGBC 1G0XA 5CO1A 3L0GA 1E6SM 5BO0D 5JHLA 2P26A 3E80A 4W9GC 1DVUA 4EZMA 3VMNA 3LNEA 1MCJA 1V6UA 1YMMA 2PLMA 5DUMH 4YXLL 1E4LA 3LEXA 5EC2B 1P2CA 1W72A 2YS4A 2EAWA 1VZHA 1UA6H 3HGJA 3VGAC 4QRAA 5ESAB 3BKCL 5KJRL 1JWMB 3MRPA 4UNKA 5EEZA 3EFOA 3W82A 3BDXA 4L3CA 5IESH 2I60H 3SRKA 3LKSB 4WWPA 4E9XA 4FD0A 3HE6D 1U2HA 3RJDA 1JI2A 4LIQL 3MA7A 1RIUH 4FQCL 3U1QA 4AX3A 3CMFA 4N9GB 3P77A 1E1CA 1SGKA 1NFDE 1PG7L 1TZZA 4GHRA 4S10A 4C6QA 1GW9A 4EI5C 4LLUA 2WO2B 5BS0E 2A6LA 1H5BA 1O4UA 1NJJA 2FEJA 3Q3GA 2ZKHL 4IEFA 1JUFB 5EB8A 3QNZA 3APGA 4HWZA 5DURD 3NJHA 3REQA 3TJPA 3OSKA 3S8FB 5HDBF 3ILPB 1EP2A 3FUHA 1A5BA 1EZ2A 2ITDB 4FX5A 5IHUH 3A64A 5DTFA 5JOFB 4Q8VA 3ARQA 1NFDB 2FO1A 3L4UA 8XIMA 4TUUA 3HKFA 1RZJL 1J0HA 3N1PC 2ATSA 3W7EA 1CBGA 1D7DA 4PJHF 2IG2L 1ZAJA 2CO4A 3BAEL 2UZXB 1S5NA 3ESVF 4JXCA 4HU4A 5BS0B 4WHBA 1PLGL 3VSUA 2EDEA 2VAJA 1RU9L 3O0RH 4W8LA 4OLVH 2MTAA 5JXEC 3PLYA 3BP5B 1E4KC 3PZQA 1ZTXE 3G0UA 2B81A 3W1XA 4A05A 5IBUG 2ITCA 2Q86B 5GSVB 5HVFB 1OCZB 4FQJH 2GJLA 4D6FA 3HKZA 4AYSA 5ACLA 2IPKB 3D69B 3SJVA 3EXTA 4DM2A 4GLRH 3CH1A 3OKEA 3W9EB 3U6XA 3QWNA 5MI0B 3QVQA 5F6HJ 4EDXA 4HISA 3SYOA 3EG9A 3QFDA 1BF5A 4DH2A 2I07A 2C1PA 3BGMA 4AI7A 3Q2CA 3WLWC 3E5BA 1DP0A 1WE5A 1MLCA 2GQ9A 4PUWA 3ULSA 2QGEA 4UMGA 5GRJH 1KCVH 2BIOA 1AVAA 4OTXH 4RZCB 3LIZH 4WU7A 4IIQA 4L8DA 1G7MB 1FNSL 1UR9A 2NQJA 1MJUL 1PTZA 1A7QH 2DP3A 3FT4B 2GWNA 4B3VA 1SMDA 4NKMA 1EZLA 3MREB 3MV8A 5DMJB 3FOKA 2FJKA 4Y5YA 5IJCC 1QDSA 1GZQA 5EIQA 1BQLL 3W5NA 2IH1A 5FD0A 3D3VE 5B7YA 2Q76B 2EO7A 1IT7A 5I1DB 3N6JA 4S2SA 4DQOL 1AI1H 3ULUL 3QQNA 3L2NA 3M16A 2CNYA 2PDIA 5IG7B 3BGAA 2I17A 3GS7A 5DFVD 1RPUA 3QWOB 3IWVA 1Z7AA 1MNZA 1FSKC 3ZIMA 1FZOA 4EDWL 4MNMA 4JJHA 4F2TA 2YAPA 1NCAH 5EB9A 6PAZA 1QEXA 4J35A 2VFFA 4GXFA 1MZRA 1F45A 4FA7B 4YLCA 1J6PA 3PSVA 1HC1A 1HI6B 3ZVIA 5IBLC 3D3VB 4CUCA 4C55A 1RZ7H 1EDYA 3GRGA 3OG4B 3GH5A 4ALAC 2P5EA 2WLLB 4MSWB