4PTDA

Phosphatidylinositol-specific phospholipase c mutant d274n
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQNYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 105
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4ptdA00
1VD6A 1DJYA 1ZCCA 2O55A 1QASA 1DJXA 4R7OA 3KS5A 4F2UA 3CH0A 4QJ5B 1T8QA 4RW5A 4RV3A 2OR2A 5PTDA 2OTDA 2ISDA 2PZ0A 4S3GA 3MZ2A 1DJGA 3NO3A 3OHMB 1PTGA 2F9RA 3QR0A 5T91A 3RLGA 3KS6A 4I9JA 1T6MA 3H4XA 3V18A 7PTDA 1V8EA 2P76A 4F2TA 3L12A 4I9TA 4RW3A 6PTDA 4I8YA 3I10A 4OECA 2PLCA 4PTDA 3EA2A 1XX1A 1DJIA 4GNKB 3V16A 1DJZA 4I9MA 1GYMA 4QJ4B 5T9CE 3EA3A 3EA1A 3H4WA 2FJUB 4I90A 4QJ3B 1DJHA 2PTDA 4Q6XA 2OOGA 1QATA 2ZKMX 3RLHA 3V1HA 1PTDA 4F2BA 1AODA 1DJWA 3PTDA 3QR1A 1O1ZA 1YDYA 5T9BG 3QVQA
chains in the Genus database with same CATH superfamily
4JYFA 4LUYA 1XYAA 2R1LA 1YYAA 4C65A 1SSDA 3BANA 4XZNX 3BGJA 5LNWA 1NWRA 1UA3A 3FV9A 4Z2KA 3K1DA 4XK2A 1XIDA 4QG9A 3NL5A 3HGRA 1N2VA 2PDUA 1WP6A 3WBAA 3PAJA 3R58A 4D2JA 2PGWA 3HQPA 5DRCA 3W7DA 2ZZ7A 5LHEA 3ITVA 3WNPA 1A5SA 2YDRA 3GIPA 3OHIA 4ZZ9A 3ZO9A 4I3GA 1MYRA 3QC0A 3IJ7A 3MMUA 3NZGA 3ATZA 3M5XA 3CH9A 1G01A 1TVNA 4ROPA 2UWFA 1ZL1A 3OGSA 2INEA 1ITXA 1GJUA 1EWDA 1QOPA 4HPXA 3T2QA 2J79A 1GZGA 3N11A 1LT7A 4IIEA 2D1ZA 2JGYA 4ZR8A 3SY5A 5ABHA 1GTHA 3P0XA 4NZ5A 4M51A 4QX4A 1OD0A 3KCOA 1IGSA 3SFWA 3MKVA 3LRLA 3VIIA 3VOJA 4GI4A 1IWPA 3C0JA 2UY3A 1P0KA 3FLUA 2V6AA 1XBXA 4LUTB 5DT7A 3F03K 3NQCA 3P8JA 1K3UA 1QVBA 1UWAA 4PMQA 1EP1A 5GJMA 2G3JA 1H2JA 3JW7A 2V3GA 4ZFMA 1WDSA 3CUIA 4YMZA 1QASA 4JY8A 4FXSA 1MFVA 3N13A 3VKJA 4CQ8A 4GVIA 4J3ZA 3GNRA 2RJGA 1YDNA 2ADAA 3MVTA 1MZRA 1ICSA 2ISDA 3OGVA 3QLDA 4IIDA 3KM8A 2XPKA 1ZALA 1SYTA 1OFRA 5CGMA 4FR6A 1ODUA 3NEHA 2R1MA 3M6YA 2J8FA 3NQBA 4GO9A 2YCIX 8RUCA 4B90A 1OT2A 1XICA 4GX9A 4HYWA 4J3SA 3S5YA 3LSBA 3STEA 4TU1A 3I10A 4ML9A 2R1KA 5FA5A 1UZDA 2VR4A 1NFBA 4EKJA 4JTKA 1GVQA 1IXNA 2ZUWA 4H6EA 2YL6A 2XG9A 3CWNA 1SO6A 5F7UA 3SQMA 3W7CA 4WHBA 1CBGA 3TTQA 1XQLA 1FOBA 1QHZA 4A3RA 3SBFA 2PD9A 1Q6RA 4KF1A 4HZMA 2CW6A 2PWDA 2E25A 3VDGA 2B4GA 2B7PA 2KAUC 5I7GA 1ONWA 1QOQA 2RAGA 3NZRA 5LSMA 1IEXA 1FTXA 4ZXOA 3WFAA 1AZ2A 3M0XA 1M7JA 1VEMA 4AIUA 1B5TA 1A5CA 3MB9A 3Q2DA 3TW9A 3V35A 1JFHA 3VFCA 1E5JA 1W54A 1B3YA 3G1YA 1GYNA 1TUFA 3U6WA 2XN1A 4AZ6A 1GOQA 4PUDA 2WANA 4G8TA 1QT1A 2VZUA 1PZ3A 5FJTA 3V0SA 3WJWA 2VUYA 3W22A 3BTNA 1MUCA 4IXXA 2GYIA 5A8QA 4C7GA 1ZB5A 3M07A 3OVQA 5KSWA 3F2CA 2OG9A 2EPLX 4GYKA 4MAVA 2WQPA 1AW1A 1ODZA 3W7PA 3WBYA 4L9ZA 3OG3A 1JYXA 3N9KA 4I9JA 2F38A 1CGTA 4RR4A 1W0MA 8XIMA 2O4MA 3WH6A 4GCAA 3QN3A 5JBFA 5FSEC 3WMBA 2GJLA 3C5QA 4MWAD 3NG3A 4UFHA 5FI8A 1MUMA 3OZMA 2QJNA 1QHOA 1J0IA 3HA1A 3NM1A 2VKZG 1XSIA 5IDZA 2HNHA 1WDPA 2Z1VA 4GG9A 2QDDA 2Q3OA 3P74A 4W85A 1KW1A 2I9UA 4S39A 4JHMA 4R88A 3AU6A 2ISSA 3G1VA 1Y5WA 3KBJA 1NVMA 3AUOA 3EWWA 4PEEA 1IT8A 1WZLA 2Q8LA 3ZOAA 3ZJKA 4XQ6A 3TROA 3D46A 4HPHA 3R25A 1JPHA 3ZR5A 1J2BA 3GHSA 3LHVA 4UQCA 5CZJA 3LGEA 5HOSA 2VC9A 3ABSA 5C9ZA 3BJTA 4KWWA 3UWUA 3MYPA 1Z8AA 4CNOA 4R34A 3L5MA 1WKFA 3UR8A 3CZEA 2QQ6A 5CC3A 4LU0A 1FWHC 2D22A 4DUOA 5G2IA 3R8HA 2B0MA 1G94A 2ZTKA 4HN4A 5BRBA 4D8LA 3THCA 1J96A 4IMGA 4XO6A 4AX6A 3I3BA 1BXCA 3BK0A 1M41A 3LV5A 5GVJA 1I0BA 3BV7A 1JF6A 1UD3A 5LA2A 3VX0A 3LCGA 3HGOA 5I78A 1BQGA 2BXZA 2PODA 1V6VA 1Z41A 4JHZA 2VX6A 2XFYA 2CBUA 3SCUA 2V3DA 4V1YA 4JGDA 4DX3A 3TSBA 1V0KA 3GW3A 5A6LA 1G69A 3L4YA 5I03A 4HCLA 1TYGA 4GNKB 2INZA 5I3GA 2VFGA 2AMGA 3IEBA 1PX8A 3LENA 3IJQA 1MZHA 1V0MA 3W1NA 3E0IA 4UZUA 2QIIA 3QV6A 5JBEA 3BW2A 1V4YA 1J4EA 5I2UA 2JEQA 2NX9A 1YPFA 1FKXA 5D09A 5HJXA 2VFDA 1WX0A 3M43A 3GUGA 3BG9A 3NVDA 3WCZA 1V6UA 1LQAA 3GFXA 3R0DA 1W8SA 3UXIA 4NF7A 3ZVHB 3MI6A 1O12A 1L8PA 4WDWA 1G7VA 4S2BA 1UD2A 5HMFA 3R89A 3WH8A 3WLOA 3KS5A 5LIXX 2G8ZA 4IZGA 4KGJA 1REQA 3BCDA 4OTKA 1Q6CA 1A0CA 3SGZA 1QNRA 3WLIA 2GGGA 4UBPC 3TIMA 3TYUA 4S3JA 4XAFA 2J7GA 2E67A 1DVJA 4LAMA 3QR0A 3MBDA 4PUUA 2INFA 4AD3A 4NYUA 3UYCA 4Z1CA 4ZO6A 4PB4A 3GIQA 5CSYA 4E2BA 4FXRA 4QEHA 2Z29A 1GG1A 2J9YA 2O56A 3M5ZA 1PKLA 1WUEA 3CZGA 3KVKA 4PL1A 1XDLA 1H4PA 2YL8A 1HO4A 2HTMA 3SR7A 3DN5A 1NFGA 1A53A 4V27A 4XBKA 1UW9A 4A29A 4WY0A 3KUMA 5LXEA 1EF2A 2HNEA 4BA0A 1FWRA 1LCOA 3KRSA 2PTWA 1R3RA 1TPWA 1YNQA 4FSAA 3WNMA 3BZGA 3OODA 5E1QA 3M0IA 3RG6A 3MUAA 3R12A 4MB5A 5KETA 2YPIA 1XV8A 4GA8A 4YPJA 4JTUA 3W84A 3LHWA 1J0KA 4NZ1A 3SQLA 1VLIA 2IUZA 3K4DA 3VNYA 1DXIA 3QKZA 3VU2A 3EZ4A 4LV4A 3CAKA 5I0DA 3CQHA 2NQZA 3WLKX 1FHUA 3UZWA 4O0QA 4D6DA 2DJXA 3CZLA 4C6LA 3AC0A 4RDWA 3ITYA 4N9EA 4IIGA 5JBDA 3LGGA 2FDMA 2CZVA 1XSJA 2OTDA 3S4TA 1HX0A 4Q6JA 4F0LA 1VIWA 4I5XA 2NZLA 4HK5A 4QDPA 5I23A 1E1CB 3PUDA 2WC4A 3KFTA 3QF0A 2O9OA 4C6KA 3PBVA 4GGHA 4F0KA 2Z24A 2IMRA 4GX8A 4WIWA 4DWDA 3PC0A 1UPPA 3QYQA 3PZIA 4F9JA 1ZBCA 1S2TA 6A3HA 3H2OA 3HFYA 1EX5A 2WMGA 2ZOXA 3RX2A 3I7RA 1MSSA 4QSHA 1F8IA 3UGVA 2FTWA 3WLRA 6XIMA 3C61A 5FF0A 5HWNA 2ZA2A 3QM3A 1UHVA 4H2CA 4L1WA 3EDKA 5K7JA 1E9IA 1H7OA 3SCWA 1JI1A 1A0EA 4PSRA 3DERA 3UD6A 2ANUA 2ZVIA 1AK5A 3C0LA 3RITA 2XU2A 1TPC1 4KIEA 1Q45A 1Q65A 4RE2A 5TBOA 2GL5A 3TJLA 1LUCA 4F0RA 4ZEPA 4H9VA 2R82A 4WR3A 3VKDA 4UR8A 3UCQA 1H7WA 3GB6A 3BW4A 2BXYA 3T81A 3W7EA 3BSMA 3UXAA 2OCZA 4IFRA 3AYTA 3VNMA 3CPGA 1WZMA 3FCPA 3JVAA 1W1IE 4A8LA 4HU4A 1FFQA 4N02A 3C3UA 2P76A 4YN5A 2RHGA 4MDPA 4BF5A 1XYMA 4HYVA 4DB7A 4EX4A 3GXDA 4E3TA 4FNSA 1KBBA 3V5FA 5MHBA 4W5ZA 1HXJA 1GORA 2DZPA 3BAXA 3AS0A 2YCKX 3QLLA 3OVRA 1XLIA 3TU9A 1GUVA 4QGCA 2PURA 2BVTA 4LAKA 3OZPA 3NQFA 1OD8A 3ZLHA 4WXZA 4KWSA 4Z42C 3LHUA 4U4MA 2VRQA 4IH3A 4PZVA 3APTA 2V5DA 1V77A 2PDQA 3PZUA 1ME8A 1VFMA 1KM2A 3F4WA 1UJPA 1J8VA 2JALA 1SU5A 3BV4A 3B8TA 4CD8A 2YX0A 1H1NA 3A9BA 4HK7A 3U8GA 3GIYA 1QPNA 2BLEA 3MP4A 3RMJA 3K30A 3AIQA 4JOMA 1EJWC 4RV8A 2HRWA 5KEZA 2ATMA 4E2DA 4O10A 3WFZA 1SZEA 1P7TB 3MHGA 5D02A 4RZ6A 3ZZ1A 4WKFA 2V81A 1P1MA 4GIYA 3A4XA 1EQCA 3BH4A 3AIVA 3UPWA 1ZP3A 1CXFA 1KXHA 3EOOA 2A7RA 3WL1A 3WJSA 1I2OA 1VQTA 4YCPA 4XISA 3GWQA 3LQGA 2CBIA 4B9YA 1LP6A 1N82A 3TP4A 1TIMA 3F5LA 4NT0A 3LRKA 4NIRA 3N6JA 4ZQPA 2WB5A 3LPGA 4G56A 4GI8A 3WLLA 3NQ2A 3KBVA 3BLOA 3M0MA 3AIEA 1R38A 7TAAA 3U5YA 4ICNA 1OABA 1TPVA 3ENLA 2QZRA 3M0HA 3MCNA 4HSHA 3MSRA 3CIVA 4BK9A 2X41A 1E15A 4MWAE 3T8QA 4OUEA 1FWWA 4UMAA 4NAFA 4HA1A 1E4NA 2GWGA 2VZTA 5EFFA 2D3LA 1JZ8A 3TSMA 2O55A 2QW5A 3C56A 3N3TA 1HUVA 3AO0A 2Z1SA 1P0BA 1WPCA 3DOPA 3E12A 1UD8A 4GC3A 1TX2A 4HSOA 2HVNA 1TTQA 1KM0A 2DQWA 1K02A 4JTQA 4B2DD 3B0UX 4GJJA 4F9DA 3ITTA 4CEXC 5ABEA 3LUTA 4RL3A 3U7BA 1JDCA 5I3JA 2POZA 1IEVA 4GOAA 4N9DA 3GNOA 2WOQA 3WF2A 4Z1AA 3BGGA 4PRRA 3JU2A 3FJNA 4KERA 4L5ZA 4Q33A 4BQ4A 1GVIA 3UP8A 1LF1A 1R3VA 5H8MA 1NDWA 3HTWA 7CGTA 1OFOA 4FOUA 4P8UA 3H7UA 1AH4A 3TYBA 1CGVA 1LL4A 5FF7A 3GXFA 3WQ5A 5BRPA 1PKMA 1RY8A 5ABGA 3FEQA 4DIAA 1LLOA 2YFOA 1OCBA 3GZAA 3D0CA 2WCAA 3PZVA 5BOEA 3ARRA 3FDGA 1DKWA 1E73M 3APGA 3UA4A 1EJTC 5AKQA 1VAHA 3QPEA 3VE9A 1OZMA 4TVCA 2ZUVA 1IWBA 2YBUA 5JQ9A 1MQPA 3T9PA 3DIPA 2C0HA 3VIJA 4MLJA 3EXRA 4E8GA 1T41A 1O95A 3TOPA 1RLDA 2GGIA 3QR3A 4HNUA 3BO9A 4MZYA 4AZ5A 4O28A 2BSLA 3G5EA 4OBTA 2W4XA 3ONBA 1BQCA 3PG8A 1B9BA 1GZ1A 1FWGC 3EX1A 1RV8A 2WSQA 5FF3A 4ZOCA 1LJYA 2E9LA 3M41A 3MO7A 1EPVA 4U2ZA 1S3TC 1H50A 4OQVA 1UR4A 4O54A 1XIGA 3KDNA 5DELA 5DMYA 4DF0A 1OCQA 1BF6A 1ISXA 4K8EA 4IOTA 4P7OA 1FRBA 4O50A 4D6FA 1O68A 4DJDC 1I45A 2OO0A 5FL1A 1H11A 1Z3NA 2XSXA 3AJXA 3SUVA 4R27A 2E1WA 3DZ1A 2V2HA 1FHDA 3P6LA 3RAOA 3VOFA 5FJPA 3ZQ9A 1KTBA 3FN9A 3S2CA 1YRRA 3IJ9A 4K7VA 5E5CA 1SZFA 3S8HA 2CLHA 1J9YA 3AJ7A 2Q02A 3HMJG 3VMPA 3VA8A 3GVGA 3F5KA 1LRNA 4PMOA 2OB3A 2PDIA 1LDCA 4WKHA 2ZZ3A 1CLXA 1UBPC 2DIEA 2GK1A 3WO8A 4IIBA 4H01A 3H23A 4EOUA 2ACUA 3MKCA 5DY2A 3HPAA 2PC8A 4E5TA 4F2BA 4PTMA 2XSBA 5FOOA 2GOUA 1J6PA 4A3YA 3IVUA 1UC4A 1C7TA 3LGDA 2QCDB 4L9YA 1S5TA 1SMDA 3RFAA 4L64A 5A94A 4UC5A 5D9OA 1ISVA 3KLLA 5H1WA 1CEOA 2YDSA 2FJKA 1EIBA 3P60A 2GVYA 1W5NA 1AQMA 4GPNA 1OX4B 1OC6A 1FA2A 2WSKA 1A47A 1P0DA 3ZSTA 1M7XA 3ARTA 5B80A 5F1VA 4FA3A 2DUXA 4BY3A 4QS5A 2BOFX 3QZEA 1W9BM 3AHTA 4A8NA 2YZRA 1V02E 3IUIA 1HGWA 3B8UA 1J10A 1R2RA 3E6EA 5I3KA 3NDYA 2A0NA 3M1ZA 3GDMA 1T6MA 3TN5A 1H7RA 1QDSA 4ZO9A 2JKEA 3W9ZA 4C91A 2QPUA 3RCYA 4ZFCA 4W9TA 3DHDA 5I09A 1KV8A 3CPUA 4LS2A 2CLIA 2CWXA 1JAKA 5LIWX 4MY1A 2QJIA 2NUXA 2ZUMA 4LH8A 1FXQA 3H22A 3PM6A 2OYMA 3TW6A 9RUBA 3ITCA 2FJUB 3BL3A 3NXFA 4KEMA 1DIDA 3GG8A 2V30A 3Q65A 2IKJA 3SRFA 2HWGA 4DZ5A 1RBAA 4YL2A 5J5DA 4W7VA 4A3UA 4H04A 3WLSA 4PMJA 2XINA 2ICSA 2WV8A 2IS7A 3U9IA 2Y24A 3CO4A 4QROA 2UY2A 2NXGA 2ZVRA 3HG2A 5BWAA 2NW0A 4G6CA 3EB2A 3PPFA 7TIMA 3TAOA 3CB3A 4IFKB 7ENLA 4DWSA 1D3HA 1LRQA 1OINA 3DC8A 4I7UA 1JGIA 2FMOA 1GNXA 3ABRA 2WLZA 3LPPA 2F2KA 3WBEA 3S47A 4BF7A 1DL3A 5F4SA 5D2VA 3T42A 1NM9A 5G2WA 5CZTA 2WMIA 2I7GA 3N14A 3WQ8A 1QPQA 4C5ZA 4GNVA 4DBWA 1OSEA 3BJSA 4M7SA 3LDVA 2C19A 3RPDA 4HOXA 4LEQA 2GQ9A 3PJXA 4JEQA 1I2NA 4GY7A 3GY1A 1R3TA 3W2UA 4D1IA 3W1UA 3JZEA 2BHYA 4FS9A 2QCNA 4LQ1A 1ONRA 1PCKA 1PBGA 2HISA 2VJXA 3SRHA 5H6HA 3WQCA 1MRAA 1R85A 1W56A 1PB0A 1E56A 1PIGA 3MMTA 4PH6A 4WK9A 1V03A 5E0FA 1XL9A 2VWTA 2C71A 3U48A 3USBA 2XVKA 3Q58A 4OOUA 3H26A 4YJ5A 1XRSA 2PDPA 4N4QA 3WBXA 1A3HA 1E6XM 4F8XA 1ISWA 3C8FA 5TD4A 2ATSA 3WQPA 1TV3A 3C2VA 3VI2A 1QNQA 1KXTA 3O16A 4QLKA 4FIQA 1Q6OA 1F3TA 1Z6KA 2D20A 3GDBA 3GVRA 2CESA 3DHUA 2FDSA 1K7FA 1UR9A 1B4KA 1VFLA 4G7EB 3QBUA 2MNRA 2WKGA 3PB2A 3G22A 1W31A 4TX6A 4H8UA 2Z28A 4MNJA 4V1XA 1BG9A 4LYQA 4MKVA 4FB7A 3N15A 2HPIA 2O9TA 1K4GA 2C18A 4QQUA 4ZOEA 1EX1A 4TTUA 1OGSA 3LTYA 4ZE5A 2F6UA 3IJ8A 3EXTA 4XD4A 2AKMA 2WHJA 2YCLA 4OJYA 4JQ4A 3DYMA 2GJXB 4JTDA 2VWSA 3M0LA 2CLLA 4AY7A 3T0BA 3PP7A 1P48A 5C70A 2BXVA 2FQIA 2OZ8A 4N0RA 2AKZA 4ROQA 2CXEA 1VBHA 1QU4A 1ZAJA 2PTZA 3ZS4A 5C9XA 3LQLA 5CPTA 1KRBC 3C4UA 1CX9A 2ZADA 3P93A 3EA1A 2LLEA 4H9YA 2QV4A 4O15A 1NQ6A 3UR5A 3LB0A 4QNWA 5JIPA 2XHYA 2GZXA 4AZGA 1CIUA 1C8YA 3ZVIA 1M04A 3VO0A 1JAEA 3CIWA 1KTCA 3NOYA 4LFYA 1K8ZA 3U2OA 3G6LA 3CLWA 3I4EA 3TC3A 4RDVA 4LW7A 5CEWA 1JYWA 4ECLA 1N7KA 3M16A 5CPOA 1TSIA 2OZ0A 4LCSA 2AAMA 2VOMA 3ZYZA 1E5NA 2CBJA 5I24A 2REQB 5G5IA 3I68A 5DQPA 4O1BA 3MWAA 3GXTA 2B7QA 1U1HA 2BX7A 4ZA0A 4F0SA 5DLCA 4Z0JA 4PODA 4U3AA 3BAKA 2PZ0A 1K6WA 1SJDA 1V6XA 3UQNA 4KCWA 3H2FA 5HNTA 1GVYA 4AZCB 2HSAA 3KVLA 4ZO7A 3W37A 3HIJA 2YXGA 3VC6A 3WD4A 1E0UA 3HG5A 4X22A 1HJWA 3BOLA 1DWHM 4OECA 2YCEA 4LUJA 2EJAA 3WQDA 3CTLA 2XM1A 2NSXA 2YXOA 2FZ8A 1HNYA 1KKRA 3AMGA 1X39A 1GVRA 3TQPA 3VDAA 4R7WA 1Y7VA 2YW4A 5T9CE 3DGRA 1L0PA 1N8FA 4MFDA 4E8DA 4D9PA 1T96A 4IICA 1J0JA 1R47A 3XISA 2OWXA 3GU1A 3IIXA 3UWQA 5LNVA 8CGTA 4QFUA 4Q4SA 1XD0A 4I5UA 3F2BA 4PL2A 1M01A 3QR1A 4L1GA 3S2LA 1PWMA 1JDFA 3F4CA 3EOSA 5HBFA 3WLPA 2Y5SA 4HKPA 3LNMA 3IIVA 3TNOA 1ZAHA 1A4LA 1OB0A 4ATWA 4ZSTA 1PUDA 3E38A 4JIQA 2UV8G 3UJ2A 1C9DA 4ZL1A 5C2GA 2J25A 1TB3A 1R46A 5A6JA 1SPQA 1TR1A 1B54A 2WNQA 4H6QA 3HFTA 1BYDA 4RV3A 2ABBA 3IRSA 3SUSA 2PGFA 2ISVA 1F3EA 3CV7A 1ZENA 2QF8A 4GABA 2ZZ5A 3BGAA 1TCMA 3SCNA 1XLFA 2FZ9A 1DPMA 2Z6IA 5DBTA 3RF9A 1VS1A 3NL3A 4NZCA 3W0KA 1QI2A 3WF4A 2R6OA 5J04A 1Q2SA 2QULA 4DI8A 5HQMA 1PL9A 1OEPA 4ZQNA 3QGAC 4DWSD 4UNKA 1U83A 2XFFA 4JNMA 3NSMA 4J4KA 3UY7A 3WUEA 4JTFA 2FLIA 4JIHA 4TMCA 4ACZA 3WJZA 5EBAA 2Z00A 3CHEA 3A6OA 5A6TC 2C6QA 5LNUA 2JK2A 4DUWA 4XTIA 3NQ7A 5EMJA 1OYAA 2V5KA 3LYEA 4UTJA 1W3KA 5HQEA 3CUHA 2Z0IA 4N6EA 1QFEA 3O9NA 2QPXA 3QRHA 5ABFB 3P5ZA 2DJLA 1VRXA 1GT8A 4DRSA 1ZBVA 3WLMA 4WZHA 3VIKA 4Y7EA 2QNEA 1ZCCA 2ZRVA 2BGQA 3VIPA 2HROA 1XRFA 5AYIA 3ABQA 2DP3A 5K2ZA 3T78A 1E0TA 1Y65A 1EJXC 1H7PA 3VZYA 4LOCA 1FCBA 3GBDA 5FJIA 3BLLA 2E4TA 4UTHA 4H9ZA 3G6MA 2QGYA 1DJGA 4B3ZA 1WKYA 3CYJA 3DESA 2X8RA 3I6TA 3IIZA 2VEGA 4B92A 4HBKA 3IUDA 4TQTA 3FEMA 1OC7A 3TQ0A 1PX4A 3V18A 4GYFA 3EGJA 2C91A 3O0KA 1UC5A 2IKHA 2PDLA 3L4XA 4GD0A 1AD1A 4V2XA 3RN6A 4I8YA 2V0TA 4DZIA 1CGUA 1FXPA 1XPYA 3QPZA 3NUKA 1VC4A 3MTWA 3KOWA 4XVEA 4YIWA 1XHGA 3GHTA 1KWKA 4ADTA 3RO6A 2XSAA 4F0HA 2Y63A 4NRSA 1J79A 3PJWA 3O05A 3BCFA 4UFIA 5DXXA 3G1AA 2A21A 4LGXA 1D9EA 3ITLA 4MB1A 1B9ZA 1QO2A 2QS8A 1A5AA 1N8IA 4CQBA 1R2SA 2ZRZA 1XFCA 3ARWA 1XUZA 3L2LA 4ADUA 2VT0A 3WD1A 1ZJIA 3EEGA 1EL3A 3QPYA 1NDZA 4Q4PA 1U22A 2DZWA 2OLAA 3NO5A 3MMWA 2YGYA 4AHQA 4AQLA 4F48A 2ZWZA 6REQA 4MSSA 1KRCC 3I7SA 2DT2A 3M47A 2Z2UA 1YDVA 4HQVA 3WNNA 3TMQA 3GQYA 3MV01 3NSNA 4Q7BA 3E3HA 2BASA 4X2PA 4JIEA 1TV5A 3BURA 4LAOA 1TPFA 1GOWA 2E40A 4H6RA 1PJ9A 1XCFA 3U5UA 4AFYA 1F6PA 3VAVA 3FFSA 1H5VA 1KFLA 3A5VA 2E6DA 5FJRA 4K39A 1ZBKA 3CHFA 1EDTA 5JVLA 4R85A 3HQ1A 2AL2A 1V8EA 3GNPA 2PGRA 4F79A 2QJHA 1T99A 1PS9A 3BMVA 2QCCA 4NJKA 1SJAA 1V79A 4GYPC 4IMEA 3PZMA 4ASTA 1JR1A 3ITXA 4KRZA 4NNBA 1DJZA 3AU2A 4IQEA 3AROA 4DLMA 1HZYA 1YXDA 1GQKA 4REQB 3W7KA 2WW5A 3BAJA 2FVKA 2V9DA 4FNPA 1UR8A 2QUTA 3AOFA 4WKAA 2W6RA 3W81A 3VIFA 3REQB 5C9RA 5FEWA 1F7BA 3S83A 3LTSA 3RM9A 3AHVA 3TLLA 5BXRA 4I7WA 2YB4A 1G4SA 1UWUA 1S2CA 3CXOA 4FO4A 1TJ1A 3PJUA 4EXAA 4S3CA 5GNZA 3QKEA 1VD6A 4IPNB 2HJPA 3GZ3A 4IG2A 2EHHA 1QWGA 3LI1A 4O16A 2BG5A 4Y96A 3S1XA 1RCOB 1RK6A 3T44A 1VLWA 1O4UA 4C6QA 1I4NA 3UCDA 5AC4A 4NZFA 3N2BA 1NOUA 4NZ3A 4LX4A 3VMNA 1MQQA 3R8GA 2ON3A 4LYKA 5G4HC 3AXIA 3LZ5A 5XIMA 1LG1A 1V5XA 2CLMA 4YS1A 1CWYA 1XLCA 2WVVB 1I1XA 5T8GA 4M29A 5LIYX 3W7OA 3PWIA 2TRSA 1XIHA 4UQEA 4WDUA 3QW3A 3OOQA 3S9IA 3F7JA 1OCJA 3RILA 4C7DA 5D04C 4IWWA 4LUTA 4ZGYA 1CXIA 3DC0A 3MSYA 5D33A 4AD1A 2HS8A 2VTFA 3BC9A 3THAA 3USZA 5E0KA 1RY0A 3CIXA 4CCCA 1G4TA 1CXEA 1FDJA 4W4QA 2X1RA 1K4HA 4EPBC 3WMCA 3RIKA 1H5YA 1AL7A 1VJIA 4NL1A 1XIJA 3K1GA 3G24A 1CTNA 2WNWA 3GU9A 1MW2A 4P61A 3CQKA 1EOKA 3T4CA 2X0YA 2AL1A 2PRLA 2ISFA 5A8PA 2IPJA 1G4EA 2XIIA 4HPNA 3SN1A 1FHLA 1KCZA 4XSMA 1K9FA 1UCWA 4GUFA 2GQ8A 1V3LA 3NQ8A 1NELA 1A5OC 2QUUA 1FVPA 1JGMA 3SQSA 4NI3A 1PX3A 2WVSA 1BFNA 2EPOA 5XINA 1S5WA 3E5PA 4IXHA 1B4EA 1U30A 1XR2A 2PP1A 2ZX7A 3VIGA 3PG9A 3SUTA 4J27A 5HK4A 4JFSA 1TV2A 4U33A 1JCLA 4ZE4A 1XLEA 1IYXA 2FZDA 1O5XA 2E8ZA 3R79A 2W27A 4NAEB 3MI2A 1TJPA 1Q4WA 1W9VA 3LPOA 2WMKA 4W8LA 1OYBA 2C14A 3VKBA 1NWTA 4F4RA 2WMHA 1KQYA 4AD5A 3S9ZA 3N1AA 3CB8A 3E96A 3GTHA 1R9YA 3DENA 4GXPA 2QCLA 3V1PA 3H24A 3MJMA 3SW6A 2CWNA 1F6YA 4PN2A 4X0VA 1BWVA 2C15A 5HULA 1W1PA 1O94A 5C2CA 3QY6A 3ALFA 1EBHA 2XZ7A 2ZIDA 3NPXA 1TVLA 4AD0A 4ERIA 3URBA 1M03A 3WD2A 4OT7A 2GSJA 3SCQA 4Q8NA 2FZNA 1F9CA 4LYRA 2F6XA 2Z2BA 3GDKA 2VYOA 1DIEA 1KR0A 2OQYA 4G1NA 4OU1A 4DJDA 1VYSX 4AY1A 3QQ0A 1IIHA 4HN8A 1H41A 1CXLA 2OZ3A 3T08A 4J7RA 5JIWA 3R8RA 2X7WA 4ICCX 1D7KA 3CUGA 3BG3A 4PCPA 2BY1A 2OKTA 4IMCA 1QNVA 1XLKA 2PD5A 2FHCA 3P14A 3TA9A 3QHMA 1F8MA 2QJJA 2PF0A 4MIMA 1DWAM 2R14A 1X7FA 2YL9A 1XFBA 4IIHA 1EOMA 4Z1YA 1X6NA 1SFJA 4JPGA 4HCDA 1WCGA 1FH8A 1UP0A 4GNJA 4WSHA 4H8NA 3W1LA 3N4FA 4ZQRA 4C5YA 3DFNA 5D2WA 4R53A 1T0OA 5DMLA 5XIAA 1LL7A 3KOFA 1OM0A 3NL6A 2JFEX 5HNRA 4ADSA 4FLRA 1R0MA 1XBYA 4Q8UA 1OX6A 1TWDA 3T0CA 2UZ9A 3GYEA 2YA0A 2FVMA 2ZKMX 3BLIA 3UXDA 4AZBA 1VZWA 1HIZA 3N3MA 5I07A 2PU1A 5EMKA 1TE6A 2Q71A 1EZ2A 4OBSA 4XTDA 1XF0A 4JR5A 3S5NA 3OLIA 4AD4A 2CLPA 4W5UA 4A8IA 2IKIA 2NT1A 3W83A 5FJJA 1QO5A 4MJZA 4R3UA 4TV6A 5DT5A 3TZFA 1UP3A 2DT1A 1IZKA 1G9HA 1TV4A 1KR1A 3M7SA 3THDA 1B3WA 4IL2A 1UOZA 1TJ2A 1AFSA 2P3EA 1Y0EA 2ALRA 3GNXA 3AHXA 2E6YA 3CPRA 3T4WA 4EIVA 3MW7A 1MI3A 5AECA 4B5VA 3CO8A 2D2GA 4CNPA 2XH7A 3S5ZA 4Q8TA 4X63A 5G1MA 5EFDA 1W1YA 1VGAA 3MUXA 4C90A 1GPFA 4DPQA 7REQB 2J8GA 4CCEA 5BXPA 3VGFA 4PTDA 3EDJA 3CWHA 5DXYA 3GC2A 3T0TA 3EMZA 3ZVHA 1QUMA 1FWAC 3V16A 3EA3A 4JKLA 1KBLA 2OT0A 1O60A 2VRKA 3MANA 5HMDA 2GVLA 3APYA 4DJEC 4HMNA 1H7NA 4C1LA 1MUWA 4UNLA 1ML1A 5HMEA 3PNZA 1HVQA 4QE1A 3AAMA 4MOZA 2VMFA 1ME9A 2AGTA 1H51A 1IEWA 5FACA 5C5YA 4JKKA 5CAKA 3DI1A 1SW7A 4B5TA 1HKMA 4KWVA 1TPDA 5D30A 3MKKA 4Y9PA 1K8CA 3CBWA 1H3GA 4FZIA 3UVIA 3GNNA 2Z1BA 3OU8A 4LY4A 4XUGA 4XD3A 6TAAA 2ZICA 3WNOA 1EEXA 3U4FA 1PZ2A 4S38A 2PC4A 3W7IA 1CGXA 2QCGA 3LI0A 4GINA 1HJXA 1LG2A 2J77A 5A6AA 1YADA 1Q63A 3GX9A 5CLTA 4BQ3A 1UIPA 5IBXC 4XZ9A 1BEUA 1OG6A 2OELA 4C1NA 3RJXA 1KC7A 4RE3A 1VB9A 3C2FA 5GNYA 2RH9A 1DQWA 4RPQA 2J78A 3ES7A 3U3HA 3KWXA 1MDLA 1XIIA 1FQ0A 1FWBC 3GTFA 1XIBA 4C6JA 3L65A 2E9BA 2E7FA 1V3KA 2P0OA 2OWCA 1EQPA 2AQWA 3VGBA 2QPSA 5BU9A 1XLHA 2EG7A 1C90A 2IPWA 3HJEA 2PDWA 4YVPA 3B3DA 3UWZA 1MXDA 5EA9A 1RVGA 3TA6A 1UUMA 1JRBA 2YYTA 1E1CA 2JGQA 3VK5A 5D9MA 2XISA 1KLZA 3UXKA 1OIFA 4LT9A 3R13A 4FNQA 4AIEA 5I77A 3B4UA 2PWHA 1R87A 4DYEA 4JY9A 1EP3A 4WJ8A 4WQ6A 1XC4A 2GSHA 2GUBA 4CD6A 2JIWA 3O6DA 4GIEA 3A4AA 2YSWA 2PMQA 4LUSB 2HS6A 3NAVA 4IPLA 3UG3A 1VKFA 1TUXA 4BKNA 1FCUA 3M0JA 2Y2WA 1EBGA 2E77A 4R33A 3UZZA 3GVVA 3UR2A 1XYLA 4ZQMA 3IK2A 3FXYA 1BWLA 3MUCA 3DG7A 4LEFA 1ESWA 1S2VA 3WFLA 3CAWA 2GFTA 2ZRXA 4IFOA 4DJDD 1HT6A 3ZR4A 5BYWA 1XX1A 2O4QA 4IHCA 2WK2A 3ARYA 4B91A 4PRWA 3R43A 1AH3A 1UWSA 4YTTA 1YE4A 2MANA 4MUPA 2ZRYA 4LAUA 3BDKA 3AWOA 1ZSXA 3FAXA 4QG8A 1LTDA 3PFMA 3TFXA 4UFJA 4JN7A 1GOMA 4FF5A 3CUXA 4I7VA 1GW1A 4R7JA 1OCNA 4YVXA 2ZDRA 3SB0A 3RHGA 1IR2A 2Q8XA 4EXQA 5L9FA 1I8JA 3GTXA 3PUGA 1R3SA 3TCSA 1VENA 2AAAA 3W4RA 4LALA 4O53A 2HZGA 4AMAA 1X1NA 2EGZA 1XLMA 1PZ0A 4N2YA 2VCCA 4PUMA 4H9UA 2PTXA 2Q6ZA 1JZ6A 3LK6A 4DNMA 2W63A 1KFJA 4Q4QA 1R5YA 4IQJA 4O19A 2H3BA 4QAIA 4HCHA 1X96A 1PTGA 3LHYA 3N6HA 4C6IA 2FYMA 3G1HA 3MP5A 1DXEA 5A6BA 2DPEA 4TX9A 3S6OA 3E5BA 3ZXWA 1D7FA 3QC3A 4J2PA 4RE4A 1W3NA 1H7XA 5DY3A 1JZ4A 3EB4A 2J62A 3CL6A 5AVHA 3NQVA 3ZR6A 4FNRA 3WEOA 3O6CA 4KCUA 2WJEA 4JX5A 3S0CA 3PUEA 3TTYA 1BRLB 3VNLA 3P62A 4PMNA 2GJRA 3LA4A 3QTPA 3WK3A 1P7TA 3WQVA 4LV9A 5F2MA 2Z25A 3V3WA 3IS4A 2QMKA 4I6VA 3ECQA 4S3BA 5FESA 4L61A 2TYSA 3R6IA 3FJLA 4NJGA 2PZNA 2WM0A 4LS1A 1HVXA 4RX0A 3SY1A 1ZFJA 3UESA 1L8NA 2JIEA 5D2TA 3L2MA 1K8XA 1TQXA 2NLIA 4A05A 3SCRA 1DJXA 4UB9A 1Q6QA 4CCZA 3GM8A 3I6RA 5AY7A 2GJNA 1WDRA 4E0CA 3T2PA 2JE8A 4O0KA 4NXSA 4O52A 4G7FA 4RXFA 3T2OA 3LG3A 3DFSA 2W3ZA 4WD0A 1UOKA 3S1WA 4FOJA 4JN6A 4LJ3A 3WD3A 2NVAA 3T6CA 4YCOA 3NURA 3RYSA 3AIRA 1UQYA 4ERGA 3MA8A 4ZODA 5CC7A 1NFPA 3GAYA 1R3WA 1MW1A 3FA4A 2NWRA 3PR2A 3PS7A 1KCKA 5TF0A 2ZZ6A 3NQEA 1B3VA 4J3UA 4LS0A 3PPCA 3HURA 2BB0A 3SUUA 2DUAA 3R5EA 2WZIA 3BG5A 4D6HA 2BGSA 2VZOA 3R10A 1K70A 5KZ6A 5U7SA 4JTJA 2BHUA 1DWFM 1HN1A 1LWIA 3LSCA 4QLJA 5GQBA 1DORA 3MUZ1 1VBUA 1U5HA 3W00A 2D2JA 1HKVA 2V63A 2VC6A 3BMXA 2WAGA 5CH9A 4CU6A 4GE8A 4EP8C 4JX6A 4NG3A 3FJ6A 3IARA 2CFFA 2OZTA 8A3HA 4EAYA 1TRDA 4KEUA 3EWZA 3UU0A 3PN8A 1BXBA 4IUOA 1RP9A 2FZBA 1RJPA 1XIMA 1TE1A 4TMBA 4QJ5B 2XIBA 4QE5A 4WDXA 1FWIC 1L6YA 1E6NA 1UKSA 4XX6A 2IXUA 2GJPA 1Y5VA 2JBMA 2PCQA 1ZBWA 2VZVA 3UERA 4L4PA 5E0CA 5CBJA 3W1QA 1W2VA 1OFQA 4AAJA 5EKYA 2JQXA 5FKYA 2YJQA 3VGGA 3OBEA 3VOIA 1LOLA 4B5SA 5HQLA 1GW9A 3ITGA 1PYMA 1X8FA 2ZX8A 3SRDA 3EDDA 2WLYA 4O1EA 5I79A 3ZLFA 4U5KA 1GK8A 1DWIM 1QNSA 3G0SA 2OYLA 3BAWA 3VC5A 1VFOA 3F4VA 4ILSA 1WDDA 3UYIA 3DXIA 4UZSA 1QJWA 1C92A 2WO5A 3LZ3A 3MY9A 1OFAA 1TWZA 1QHPA 3WEZA 3HQOA 5G4EA 1Z48A 3N12A 1Y8BA 3VDBA 1QI4A 1NU5A 4MY8A 1VIZA 3HB9A 3VM5A 4DNHA 3TJIA 4YTRA 5AC8A 3FYPA 1WDQA 1UKOA 2WZEA 5LZLA 4MJMA 1X7IA 3CV6A 4DAIA 3CUJA 3DFTA 1AQ0A 1OBAA 1NH6A 4IL0A 1O5RA 1NDYA 4GYPA 1BLIA 1TG7A 1W91A 2A79A 1W1VA 5LYRA 4L6DA 1JCNA 1UWTA 3N25A 4HHHA 1C7SA 2EO7A 5KITA 4WVXA 4NILA 3QSRA 3C0QA 1DIOA 4QNEA 3GR7A 3LCLA 4BCEA 2PDMA 5A95A 2QCDA 1FCVA 2PDGA 1UWIA 2IQTA 3B8SA 4LB3A 4D8ZA 2IQDA 2AQVA 2VFEA 3DFQA 3L21A 4JQAA 1OX4A 2DV0A 5G1YA 2WBGA 1DWGM 4TR9A 4Y9NA 1S5VA 3BAIA 4IGNA 2GQAA 1FH7A 3I7QA 1KTNA 3SO7A 5A6BD 3LERA 2WZTA 3GO2A 2H8XA 1L6GA 2VQUA 3PK7A 1YKWA 4DI9A 3EBVA 2YDQA 2DW6A 3PBYA 3AMLA 3NEVA 1RPKA 3TONA 2GUUA 2DSWA 3AXXA 1IXPA 3DECA 4K8GA 3VD9A 3B4YA 4RK8A 3II1A 3O1NA 1XKYA 2OGYA 3KCJA 3PWAA 2NXHA 3W74A 5TQLA 2KX9A 1ME7A 3T0AA 3ZJ7A 1A0DA 1A5BA 4NASA 3W6LA 1TREA 1AW2A 4NQ1A 1OQFA 4E8CA 4UNIA 2I56A 1O5KA 1BWKA 1XH1A 4IGHA 3A47A 1EGVA 2E5BA 2QDGA 4J35A 5EMUA 3N19B 3EWYA 2XIOA 2HVOA 1PPIA 4DBSA 1EUNA 2YR1A 4HPGA 1RP8A 2W79A 3GTNA 5KTLA 5LGZA 4DZAA 1OZQA 4FLQA 1YE6A 4AD2A 4IFKA 1EA0A 3LX9A 1R8LA 2YFNA 3DI0A 1JL8A 3ONCA 4W88A 4XZBA 4JZ5A 3PANA 4CD7A 1H49A 2WBKA 3LHTA 1BVZA 1WV2A 3O63A 5HJYA 3PTDA 4B3LA 2J7CA 2QUVA 5T9BG 3GXMA 4KFNA 4TVDA 3GH7A 3GVQA 5DMMA 3NYZA 3KHDA 1LROA 3RUBL 2RDWA 4X2RA 2PRHA 1KGWA 4HMDA 4JL1A 3PZNA 1R7AA 2XGBA 1XSKA 3P61A 2ABAA 4DWSC 1S2UA 2J6VA 1KFEA 1NQKA 4CUCA 2QDHA 3L4ZA 1V02A 4O57A 1FP9A 3W71A 4EE9A 5AC7A 2PLJA 1KFWA 3KBSA 1OC5A 1KM3A 3UNDA 2VGFA 5CBIA 2R94A 3M44A 1OFBA 1GWJA 4MG4A 1SW3A 2KZHA 1W9UA 1FX6A 2QVNA 1H1ZA 4MGGA 3N6QA 3ZM8A 1UH4A 2VURA 1R3QA 4Q7IA 1WOAA 2E09A 4DEFA 1W2PA 2PS2A 1Z69A 3ARXA 4GWEA 1JDEA 2A6LA 1B3OA 4YHEA 2B7OA 2A4AA 3LMYA 1HJUA 1MW3A 1EJSC 3OQEA 3KP0A 3R2GA 5A8MA 2BY3A 5M5DA 1W3JA 3LPFA 4IPJA 2XN2A 1YXCA 2CEQA 4G7EA 4DJFC 3BSHA 1PDYA 5C7HA 3OVPA 4KGLA 1MMFA 3NVTA 3MDWA 4IM4A 3BW3A 1KM1A 2VDGA 5HANA 5AFDA 2A2IA 4M5PA 1Q7MA 1EA9C 4HA0A 1EJVC 1I60A 2GJXA 3G77A 3I3DA 2V82A 2VM8A 1H09A 2J7EA 1TQJA 1Z89A 2J27A 1S46A 2J47A 3S46A 3GD6A 1X98A 2YLLA 1CB2A 4CQAA 1WOBA 3EWBX 4JIRA 5IM51 1ONEA 1G6CA 4XAYA 3VDHA 3LEPA 1TPEA 3GG1A 1X6LA 4YTSA 1VFSA 3H54A 1XLDA 1OY0A 3DHFA 5BU6A 3WDIA 3URQA 4NX5A 1ISZA 3WEMA 4H8HA 3WZ0E 1VPQA 2Z1XA 1FCQA 1NSJA 1F2JA 5DF0A 4M82A 5CKSA 3KLKA 2PF8A 3E2SA 3ZJ6A 1GGOA 2QCHA 3ZLGA 4CU7A 3LS9A 4JKMA 3B9AA 2Y62A 2ZZ4A 3ANYA 5IRPA 1NJJA 1XLBA 2EBNA 4XKYB 2NVDA 4P8XA 1E9ZB 2REQA 1VBRA 5AVNA 2VFFA 3CMJA 4QISA 4E3VA 1CPUA 4PTWA 1WZKA 4RXGA 3MCMA 1Y5XA 3N2CA 3B9EA 2FMNA 3W7HA 4ZBCA 3W2LA 3EWXA 1GCYA 1U5JA 3KW3A 4B5XA 1JZ2A 1GHRA 3SCTA 1OGGA 4AZCA 4UFKA 1CNVA 1NP2A 2G41A 3N4AA 1E71M 3UG4A 4PYSA 3GRIA 3B8WA 1U2YA 4RZ5A 2L5HA 3O6AA 4MUZA 2VXNA 1DJYA 3S6DA 3FK4A 1KWGA 4GQBA 3AALA 1MXSA 1WBHA 3CH0A 4IF2A 4MYAA 1VBJA 3OA3A 2C1GA 2EQDA 3VZZA 3NM3A 4GUJA 3WDRA 4BJHA 3NSXA 1D8CA 2EG6A 4DXVA 4IJBA 1P6WA 5LA1A 5CC6A 4PB3A 2VO5A 3CS2A 3NO3A 3OHMB 1B3ZA 3B0PA 2A3EA 1QRQA 4CNUA 4CQ9A 2A85A 4POCA 1YW1A 1VCVA 3GKAA 3C6CA 4U31A 2HQAA 3N9RA 1IZCA 2OO6A 4DJEA 4LB4A 4HSNA 1BG4A 3EPOA 2UY5A 1QTWA 2DSUA 4AEEA 3DG3A 2A1YA 1O1HA 4HIBA 5REQB 3TSDA 1E0XA 4NNCA 2PDFA 3BOFA 4O17A 3RLVA 3VYLA 3CHCA 2XVPA 2C7FA 3VNIA 1JXJA 3EX3A 3TAKA 4HTBA 3PF3A 1W1ZA 2E5CA 4IX0A 1ZLPA 1HTIA 1NF0A 2X1TA 3NOEA 4HNCA 5KZEA 1UBSA 3BAYA 3RGTA 2J88A 2WJZA 4R5EA 5AHEA 1J5SA 5E6YA 5IBXA 4M80A 4QCFA 1UR0A 3OLDA 2HXTA 3QYSA 3VIOA 1YIXA 4M6PA 2YKKA 1EWEA 2D24A 2Y7EA 4XKMA 2WHKA 3AIUA 1TV8A 3XIMA 2HK1A 3W2NA 2G4JA 1WKDA 3D3FA 3LRMA 3GBEA 1TO3A 3OTRA 1Q85A 3A9IA 4Q4MA 1KFBA 3RU8X 4KCTA 3M0ZA 1HGYA 5EGRA 3IJDA 1E70M 7PTDA 2I5QA 1EC8A 2QJMA 3UWVA 1PO9A 1VF8A 5JMUA 5ABFA 4B2DA 3GXIA 3CEPA 4HHMA 5HAOA 2W62A 1JQVA 4UQBA 4HU0A 3MVIA 1QI3A 3CV2A 5C9UA 3VCRA 3NGJA 4QQ3A 3OO2A 3MSGA 4JQ1A 6TIMA 3BQ5A 4MNKA 6XIAA 3VIMA 3SIMA 5M17A 3CAVA 5D2XA 2QGHA 5DX7A 1E55A 2R8WA 1E9YB 1O5QA 3S1GA 4LAZA 1F61A 4S3DA 4NKCA 4M6VA 3AMCA 1G67A 3GH4A 4YVVA 3URNA 4R9XA 2FTPA 2VFIA 1LT8A 5A1AA 3R1ZA 3DFPA 4GQQA 3ABXA 1K7XA 1WXYA 3WK1A 3EDFA 3IK4A 1IF2A 3RLUA 1RD6A 3IGHX 4PBFA 4HNTA 1EF3A 2Y61A 1XM3A 1RXOB 3W2KA 5C8BB 1A49A 3V4BA 3P80A 5I06A 3OBKA 1EUAA 1I0DA 3KE0A 1H0GA 3THQA 1X1ZA 3ZFHA 1RHCA 3WQGA 1VPYA 3LXBA 2EKGA 1I75A 4PCFA 4BR1A 1B2YA 1CXKA 4GUHA 3WLJA 1XPGA 3QV7A 1EP2A 4UTMA 2GGHA 3CUFA 3LCHA 3FY1A 1XC6A 1F4HA 1D3CA 3FVDA 4JS3A 1C93A 5I3DA 4GACA 4CU8A 1QR7A 4PMVA 3VMOA 5BMWA 5A2CA 1P43A 3IACA 4LBRA 4NI8A 4LBSA 4H9TA 3DFHA 2Y7DA 3SRKA 1Q66A 4DELA 3FYOA 4H7VA 1GHSA 3O3RA 1A5KC 2PTDA 4NNAA 4PRTA 4XB3A 1QAPA 4GZ7A 5RUBA 1T7LA 4RE0A 2YA1A 3A13A 3FHAA 2OWWA 4S1FA 1XG3A 2GQ3A 3BSGA 2TMDA 4CD5A 3WDHA 4GFIA 4KMQA 3PFRA 2DZAA 3VABA 4DYJA 4PSPA 4LCRA 2WKJA 4L4MA 3L7RA 3BLDA 1PXGA 3HPFA 3P5YA 4EWJA 2WMFA 3H21A 3O06A 4PUJA 3SCOA 4M3PA 3CZKA 2FTYA 3WENA 4A22A 3WELA 1SFTA 4MM1A 3KEHA 3OZYA 1MEHA 1XXXA 4W89A 4REQA 3B06A 4TXEA 2HCVA 1AH0A 2Y8KA 1XW8A 1D8WA 2P3ZA 4HD5A 4P2VA 3REQA 1MXGA 4KFPA 4W7UA 3WLQA 5BWFA 5B7ZA 2P53A 4A4AA 3PZGA 1K9DA 3B0YA 3GUWA 1F76A 3LXAA 3AZSA 4UQAA 4LNCA 4W7WA 4LXFA 7XIMA 3G1DA 5BXTA 3VGEA 2BVDA 2F2HA 3H2NA 2EKCA 4K37A 2D0HA 3WSUA 3W70A 3WLNA 1OADA 1WE5A 4K1WA 3AXKA 4AVOA 1BYAA 3VGHA 1HL2A 2EPKX 3MO4A 1JYNA 4M0XA 2E68A 2WVVA 1PZ1A 1FDYA 4KESA 1P6CA 1SZNA 1WKEA 1DQUA 5TAOA 4DJED 3HZ3A 4L6HA 2QHAA 2R9RA 2H9AA 3DGBA 2NQJA 1W5QA 4CQDA 4GFSA 3D47A 1F05A 1QCWA 4ALDA 4F2UA 2P1FA 5AOUA 3BXWA 4FLSA 4EXBA 1BGGA 3CNYA 4PUNA 1DJQA 3PPHA 3EWDA 1A4MA 4CVWA 4AF0B 2J8TA 2OQLA 3GG0A 3OZOA 3EOLA 3QZ6A 3GNDA 3L5AA 4WF7A 5AHIA 5LKYA 1PYFA 2QUNA 5BNKA 5K9CA 3ARSA 2XIQA 4TUFA 3WUBA 3VKAA 4H1ZA 2OQHA 4UQDA 1ZP4A 2Y70A 3KWSA 1Q6DA 3KVJA 3TK7A 4KS0A 4EAMA 1G7UA 2CIPA 2YBTA 3N9SA 4CN1A 2BWGA 4MB3A 2QKFA 5FEPA 3TW7A 3M7WA 1LBLA 5BOOA 2A3AA 4LY8A 4WCJA 2CPUA 1XINA 3ANVA 2E9MA 4MPKA 3BLEA 4S3KA 4HHPA 1O1ZA 3ITOA 2OMAA 1YLVA 3WL0A 3GSMA 4NAEA 3W7MA 2GVJA 3IVSA 3W82A 2W66A 3L0GA 2C8NA 1XYZA 3W6MA 5IDIA 2XN0A 1AJZA 5AHLA 1BHGA 4QITA 1RLCL 4XSLA 3W1AA 4UMCA 2XDFA 3QV9A 4RDYA 3WDQA 1GKPA 3V36A 3TMLA 3H2CA 4RPPA 1BVWA 1RQHA 4NJJA 3RM4A 4A35A 4EANA 5EU9A 5BCAA 6ALDA 3L2IA 2P50A 1KD0A 4MZ1A 3L0KA 2XH2A 4PCNA 4CCDA 4ACZB 4ZQCA 1TR9A 8TIMA 4DY1A 3WDPP 3XINA 5JXQA 1NWUA 3N17A 4KWUA 5AHMA 3I65A 3S42A 5IXEA 3B9OA 4NRRA 2J7HA 2V3EA 2WXDM 1RR2A 3NZQA 4GIAA 5E93A 5FJOA 3E02A 3IIOA 1M6JA 3E49A 1M5WA 3N2OA 4UOQA 3DX5A 1ISYA 3ARQA 2DSVA 1DQXA 1IXQA 3KRBA 1FY6A 4HA4A 1GEQA 3MUY1 2BFGA 4JTLA 4OVXA 1FUYA 3S2MA 3QVQA 2UY4A 2XGIA 5CJ5A 5HWMA 1G5AA 5HPOA 1JJKA 2X1IA 1RD5A 1M68A 3UZYA 4Z17A 3PZQA 1XWYA 2VP8A 2PDNA 4PMRA 5FEXA 1F3XA 1R7OA 4AYSA 4Y6GA 4H7CA 3WK0A 5A8OA 3GHRA 2I5IA 1QWKA 5BZAA 1QPOA 4NUWA 1DEDA 1JZ3A 4GO8A 3ZMRA 2QYGA 2YZ5A 1QNOA 4MMWA 2I9EA 1NOWA 2QLYA 1Q6GA 1T5AA 3LBMA 3SSZA 5CZ0A 1IWAA 4L7ZA 1EJUC 2ZBTA 4H83A 3H4GA 3H4XA 4XAPA 2GGEA 4FP1A 1WYIA 3URAA 1KO0A 3PSVA 2XTKA 4AWTA 4U5IA 2X05A 1E1EA 4HMCA 1W32A 2ZZ1A 4DO6A 2WKLA 1TA3B 4H00A 1PHWA 1FBAA 3PHAA 1TX0A 4DYKA 2W92A 3HMCA 2RGMA 2AMXA 2Z7KA 3P7YA 3HOJA 4LPCA 1ZHAA 4RZBA 3NZ1A 3OJGA 1VJZA 4GZIA 3H2MA 1EC7A 1VYPX 1H1YA 2QR6A 3UJSA 4GKLA 2PDYA 1A50A 3QH2A 4PUKA 4XZHA 3WH7A 1VBGA 4ES4A 3V5CA 3PZTA 3ME3A 5IHSA 4AEOA 1Q6EA 2NUWA 4AIOA 4NXKA 1TTIA 2DZXA 7REQA 2AL2B 2OEKA 2QEZA 1FP8A 3P3BA 3B0XA 3MHFA 3QHNA 5ECUA 3BJFA 2R91A 1LOSA 1EYWA 1KRAC 1ZJBA 3D5HA 4ZTYA 4L9XA 1TCDA 2A3CA 4N9CA 3NDZA 1QPRA 1WB0A 3UA3A 4XV0A 4IGSA 1CW2A 1KGUA 4PTVA 4TIMA 2WCSA 2BP1A 1EGMA 4J3VA 4M81A 2TODA 4NZ4A 4C6FA 1S39A 2XH4A 5BXSA 1VFUA 1VP5A 4D6IA 2ZXDA 3TXZA 1DHKA 4YYFA 9CGTA 3WJYA 3UJRA 3VOHA 3KCLA 2G95A 4UWMA 2I16A 2WC7A 3EWCA 5GJPA 2J9XA 3MMDA 3CAQA 4MADA 4Q8QA 5CBBA 3TX9A 4QJ4B 1GJWA 1F07A 3NQMA 3WK2A 4QJ3B 2O7QA 1GTEA 4A8RA 5M03A 3PTQA 2ZE0A 4IG2B 4NY2A 4FALA 3E2QA 2HK0A 2WWDA 4KIRA 4UMBA 4WGXA 3LLXA 3NYDA 2C1IA 2QF7A 3NJ3A 3NXLA 4GBDA 3BMWA 3TTSA 2OXNA 5F2LA 4A3HA 4AWUA 1MNSA 1JG9A 4D6CA 3RR4A 2D69A 3P8IA 1AMYA 3AS2A 4OUIA 3SGUA 3NTYA 3EOEA 3STFA 4P8VA 4IMAA 3W7RA 1QW7A 3RMEA 2DW7A 4UTWC 1MFUA 3FGCB 5CLWA 5JH1A 2W0UA 1DTNA 3QFEA 3SCSA 1DIKA 3LV6A 4AYGA 1SMAA 3UR7A 2ZCGA 2BDQA 3UPMA 3WY1A 3FDKA 1TVPA 2WMJA 2V68A 4G5DA 5A5WA 3G2GA 1I1WA 4FX6M 4UTFA 3L12A 4QP0A 3AI0A 3PB0A 1F4AA 3WD0A 3BCJA 4DJFA 2EG8A 2A3BA 3TN3A 3DYPA 3EMQA 3W3OA 2B31A 4MY9A 1DE5A 3BLKA 4JEJA 2X2YA 4NYYA 1XIEA 2QVHA 1EO7A 3V5OA 1M65A 1RK5A 4EACA 3VD7A 4JN8A 4V33A 2VCBA 1C8XA 2OX1A 4M19A 4DPPA 3W88A 2NQ9A 4QR6A 3T55A 1XCXA 4XVDA 2PAJA 4LUSA 3POCA 3W23A 4C7FA 2E1DA 4DHGA 4IP4A 4JTGA 2OODA 5DCEA 2Y0FA 4OKDA 4UIOA 3S6TA 5FIPA 1H62A 1PE1A 4GCXA 4DXKA 4NHVA 5DBUA 2BOGX 2V5CA 2NQLA 2W67A 4BF9A 4JDYA 4LVDA 4M1RA 3POHA 3GC4A 4PMYA 5J8LA 2ZUUA 1AG1O 5K4XA 5HMSA 1M3UA 4R7OA 3IV3A 4LUIA 3AZRA 1UUOA 3QTGA 4HB7A 1PV8A 5I5RA 4HK6A 3UW6A 5F1UA 2ACRA 1Z9AA 3TFCA 4MAZA 1T8XA 2XVNA 5LIKX 1CENA 4Z08A 5A2AA 2OSWA 5T91A 3STPA 2YOCA 2TSYA 4Q3MA 2VQTA 3LCIA 4JTCA 4HNNA 4O4VA 3CHDA 2C16A 4BHYA 1V7AA 4BS0A 3PPGA 3OG2A 4I9TA 4KEZA 2BY0A 3VOCA 1H0IA 4PCTA 2FPYA 3DYOA 2WSYA 2PLCA 1LQ2A 3M46A 2G50A 3EKGA 2XYLA 2WPGA 1EDGA 1FWCC 3N2XA 3CU2A 1SW0A 3CZJA 4NX0A 2PDHA 4HTYA 1LQ0A 4WGHA 3LTPA 3NPUA 2HPMA 4GJ1A 3KTSA 1GYMA 3PZOA 3DBNA 3EPMA 1WXZA 1MWOA 1KFKA 2HE5A 3EPNA 4GZEA 3TTEA 1DYSA 1TMLA 3ABOA 1U1UA 4PR4A 4RNJA 2BTMA 3MCOA 5A2BA 1SZGA 1GG0A 1L6WA 5ENLA 1YDYA 1AMKA 1LWHA 3B8VA 2AOSA 3MU7A 3OBAA 1VHNA 4KKXA 3QFWA 1B30A 2DZTA 1XG4A 1EJRC 2V8ZA 1MNZA 3HBLA 2WYSA 4OZOA 5A8GA 3SCVA 3VGDA 2X2GA 4GXWA 3A4JA 1H61A 3L4UA 3GXNA 1OX5A 5C6MA 4PC8A 4RKAA 3W29A 4PTNA 4CGTA 1ICQA 1ZRQA 3EX2A 4J5NA 1LOQA 3G18A 1BRLA 3ID7A 1HW6A 5KINA 1SGJA 2V38A 1GKQA 1TPUA 1XS2A 4PFMA 3S1VA 1POKA 4WEVX 3T7VA 1F6KA 4OV9A 5HINA 4AMCA 4F40A 1UROA 5C0QA 2QAPA 2OX4A 2IKGA 4P7RA 4Q8PA 1JUBA 3FXGA 1IR1A 2G3NA 1WNOA 3VX1A 3KBMA 2E6AA 3KOZA 1VEPA 3LN3A 3CL8A 2ACSA 1LYXA 5A8NA 1B57A 1ECEA 3KRUA 4D6JA 3CGTA 1YPIA 4KQNA 1LBMA 4ACYA 3PNUA 4JTIA 4LBUA 1YBQB 3S1UA 4AHPA 4K2SA 2YDAA 1BTCA 1WBJA 4G9PA 1AW5A 4M8UA 1V3HA 1WUFA 4O1FA 4C6OA 3QY7A 4Q8MA 3E74A 3ATYA 2A7NA 4FNTA 1GYLA 4M24A 2NV1A 2WCGA 4OOZA 2CERA 3SZ8A 5G2HA 4AZIA 2ZXAA 3H70A 4US6A 4IQDA 5JUVA 3WJXA 4IQLA 4QE4A 3KP1A 3W6YA 3STGA 3W1TA 3AFBA 4Q22A 4HHLA 3VDCA 3DAQA 1XDJA 3UWYA 3C2EA 3NFUA 1SM9A 4B5WA 2CC0A 1LRTA 1RUSA 1V08A 2OKOA 4PULA 4I9AA 4INFA 2PDCA 3HPZA 2D0FA 1UD4A 5A69A 4KEVA 4DF2A 4W93A 2ZUNA 3HN3A 4HP5A 3M5VA 3T8LA 3MDUA 3OVGA 4K68A 4FX8A 4BQ5A 3QGVA 3WNLA 2PU0A 4FX7A 3EKLA 3EA2A 3DH7A 5AYBA 1P0EA 5CPSA 1NOFA 3HQNA 3FKKA 2Z26A 5HNUA 4K6AA 2ZX5A 5HJLA 4M1BA 5DCDA 1UB3A 1HP5A 2PWEA 2QCFA 3MI3A 5IOBA 5F2GA 3OEXA 3W1MA 5HDRA 1AL8A 4JTRA 1TZ7A 1EHAA 1JCMP 3QMSA 3WMSA 3H6OA 5CZKA 2OVLA 1GVSA 1VJSA 1E6RA 4AIBA 1SUXA 3GH5A 5T26A 1S5MA 4UXDA 4RNIA 2O0TA 2G97A 2NSOA 4E2VA 2OT1A 3A3XA 4ZTXA 1UKQA 2I57A 1M1BA 4DJFD 1CCWB 4MLRA 3WF3A 3SURA 1JCXA 1I2RA 1GQIA 4RCXA 3TVAA 4C1NB 1NY1A 1Z42A 2CLKA 1PWLA 3F1QA 3SN0A 1CECA 4WY0F 3HV9A 1TWSA 1C29A 4YXGA 3EAUA 1AVAA 3Q37A 3TN6A 1V51A 4ENLA 4X9SA 1V7YA 1XKJA 3D6NA 1M7OA 1UKTA 1B31A 1NDVA 4O8AA 1B0IA 2WZHA 4M7TA 3QXBA 3GVWA 1GOXA 1QI0A 4Y9MA 2FH8A 5CPQA 4MNLA 2QCMA 5HNNA 1D3GA 1BSLA 3INPA 4L56A 4XBJA 2B7NA 4Q8WA 5E9XA 2D0GA 1KBKA 4MKNA 2V5BA 3RXZA 5LNRA 1EHNA 4HNVA 5I00A 5D9NA 1UR3M 3T0DA 2PCEA 4C6PA 3EX4A 1RBLA 4S3EA 5E9AA 2ESCA 1KFCA 3B40A 5HATA 3DHPA 4K8HA 4WJXA 3GDLA 3CV1A 3IAPA 2Y5EA 4P7LA 4PEKA 1ZPTA 1NF7A 1DP0A 4AZ7A 3TDFA 4Y9OA 4C6MA 4H19A 4FI4A 4HZ8A 4F0MA 1HKIA 4AY8A 5F4XA 3WQ6A 1QK0A 4H41A 5DCBA 1C3FA 4O14A 3TC6A 3NDOA 1RZMA 3WIJA 2TAAA 4MYXA 4UTTC 1JD7A 2DH3A 1UUQA 2VFHA 2YYUA 2PGEA 1JPDX 3LY0A 1O6IA 1IGWA 1DHPA 3W28A 5HUOA 3MS8A 1V6WA 1WA3A 3YPIA 5K9DA 1HL8A 4HU3A 4LRTA 4I5RA 4KFOA 2Y6ZA 3EB3A 3TH6A 1V0NA 4Q7NA 3W02A 1DBTA 1TELA 3CASA 3ZIZA 2XM2A 6ENLA 1SJBA 2X1SA 3COTA 3FOKA 2FH6A 3NNTA 3UNTA 2PLMA 3OLEA 2PWVA 5GPRA 2EEXA 3M5YA 2P0IA 4TX8A 4AEFA 2FGZA 1G0CA 1J0ZA 3IIPA 1W9DM 4U2YA 3SSJA 3LLFA 3WLTA 1UH3A 4BI5A 1X38A 3TV8A 1UWRA 3V7PA 1UR1A 1LZOA 2HEJA 1DJIA 4C1KA 2BGNE 2OEMA 3OYXA 2RDTA 3DFOA 1BKHA 3H53A 3S3GA 2YBVA 1BKSA 4OFCA 4JICA 2VD9A 3KOYA 3TC7A 2Z27A 2VL4A 3KX6A 1DJWA 2W5FA 3HG3A 1ZY9A 2BVYA 2V2DA 3M64A 4Z2HA 5HA7A 2D2OA 1S1RA 3NQ6A 1FWFC 3N04A 3E9AA 3LD5A 4ATDA 2PWFA 2OGJA 4JFWA 3E2VA 4IMFA 2FKPA 3LNPA 1C8VA 2A5HA 2GDUA 2XH0A 4QM1A 3SI9A 1OG0A 4GI9A 3N29A 1US0A 3W7NA 4S3GA 1W9XA 3IRDA 1EXPA 1MO0A 1FFRA 4GBUA 1XBZA 1JPMA 2FIQA 4UTIA 1BYBA 2EPMX 5F2IA 2V69A 3HPXA 3TJXA 4H4IA 2BS9A 4A21A 1J01A 4KPLA 2DORA 3NWRA 4L1XA 2BBFA 3IUHA 4BI7A 3QZAA 2V67A 1P0NA 4GGBA 2J7DA 1JD9A 5EMYA 2J7FA 5K9XA 2A3HA 3OB8A 3T40A 3B04A 1RSCA 2Z1KA 3RPMA 5DRIA 2G3MA 4KRUA 5H2ZA 1QOXA 1W3LA 1QK2A 4US5A 4D1JA 4IT1A 3A64A 4JAWA 3UBPC 1WO2A 3IPWA 4Y8FA 3TYEA 3IVTA 3VVGA 1SR0A 1GONA 1SSGA 1XH0A 3N4EA 3PBWA 4S3AA 4S23A 4B9ZA 2JF7A 3AXMA 1JQXA 4ORMA 2PLKA 3AYVA 3I4KA 4JIIX 4JX4A 1Q3NA 1RQBA 2NQHA 2YL5A 4IP5A 1BGAA 3QMRA 2VGGA 2WQDA 3KHJA 3WQ4A 1SO5A 5MKGB 2FHBA 1CT5A 5AHFA 4GVFA 4FR1A 2OSYA 3TLQA 1KM4A 9XIMA 1JZ5A 4UFMA 3KBNA 1IZJA 5DMNA 2RDUA 2WM1A 1EO5A 2OEJA 3W24A 1D2KA 4HJWA 1NARA 4PCSA 3J7HA 2VEKA 4YLWA 4QAWA 5CPMA 2CHRA 4C60A 4F2TA 4OHQA 1YNYA 2CLOA 3OGRA 1TJ0A 4LVBA 4S3FA 5H8UA 4OGZA 4QSFA 1KCLA 1THFD 1KXVA 3P2VA 3W01A 4DZHA 3Q4DA 2NVCA 3UY8A 2BOEX 1B3XA 1ADOA 4QDWA 4WLCA 4Q8VA 4EPKA 3GR4A 2O9RA 1YEYA 3KL0A 1CLVA 5AN7A 1XRTA 4I8DA 2P10A 4O13A 1IE7C 4WSKA 4S2CA 5KZDA 3U57A 2Z1WA 3M0KA 2ZWYA 2A7PA 3B9NA 4YYCA 3OYZA 3E1F1 3ORWA 4BEUA 3W75A 3PBGA 5CGQA 4HU8A 3PAOA 3K8MA 3LLDA 3G8RA 2FFIA 1AQFA 4JTHA 5A6SA 1IV8A 3C2RA 3QY8A 4XKYA 4K3ZA 3T05A 3U2CA 1W1B1 4XZIA 2PPGA 1L2UA 1AZ1A 2X30A 2PP0A 4LC8A 1VRDA 1C91A 3WKZA 4B3KA 4NP7A 4MWAB 3GC5A 4QIUA 2VNCA 5KMYA 3W38A 1ELSA 1EZWA 4AXKA 4FXJA 3CJPA 3MT1A 5ABTA 3WG6A 3DFYA 3H8AA 2IPFA 4XG1A 5FAGA 4Q8OA 3AS1A 1MQRA 3P67A 5CSUA 3BICA 4UCGA 5E70A 3ISIX 1NIUA 1QNPA 2PUZA 4X3ZA 4FEZA 4N4PA 4M56A 3RLHA 3UF9A 2Y1HA 3VCNA 3O0FA 5IFPA 4D72A 4JFTA 2R24A 1PTDA 2VR5A 4XZLX 5AZ0A 4WSJA 1KM5A 2FB2A 1K77A 5FF2A 3NPVA 1ZU8A 3CQ0A 4GQGA 3AYSA 3IJIA 1KRMA 2QT3A 4JD4A 1OYCA 1XH2A 2X1UA 4GUIA 4MDOA 1TJRA 2I14A 1WAWA 2X7VA 3O2LA 1XYCA 4ICMA 2BHZA 1UWQA 1Q6LA 3GG7A 1CI1A 1SFLA 3G3DA 4ZB0A 4H7ZA 2PP3A 5REQA 4URIA 4QEEA 5FL0A 2EPNA 4U10A 2VDHA 4PMXA 3BQ6A 3CTTA 1UR2A 3TZNA 3W7LA 1BD0A 1RPXA 3R11A 3KZPA 1X97A 3QJAA 1GKRA 1M53A 3LCWA 4KCVA 3M6DA 3TNBA 2WNNA 2PI6A 4J1OA 4LRSA 3QV8A 1WQ5A 3C2YA 1DWJM 2DT3A 2J66A 3DG6A 2ISWA 3GAKA 4ERAA 4XZWA 5FEZA 4FNUA 3CQJA 4PBGA 1SR9A 2I1OA 1ZTVA 4ORIA 7ODCA 2X0SA 4A2RA 4PUEA 5DANA 1ITUA 2CZEA 3JUGA 4D6EA 1CZ1A 3GE7A 1S2WA 2G0WA 1UP2A 3B8DA 2CLFA 3C3NA 3U4AA 3QW4B 3WF1A 1GPWA 4YHGA 4KWOA 1XP3A 4UTWA 3W2JA 4AUBA 1QW8A 3RO8A 4CNTA 1SZRA 3L4WA 2ZDSA 3VD4A 3UJFA 1ZGDA 5LGXA 4H3DA 3SFKA 4XIAA 1ZUAX 1I9CB 4Y90A 4HJFA 2DGAA 4ZENA 1B1YA 3OQ8A 1UPMB 2VDIA 4F66A 3H7VA 4W87A 5K4ZA 4US5D 5LHFA 3GDTA 4Z2IA 1DJNA 2VVSA 2Z7GA 4A6GA 1VPXA 4ONVA 2XIJA 4CEUC 3W25A 4HZ7A 3RU6A 1A3XA 3QGKC 3ZWTA 4DF1A 1MDRA 2NV9A 1W3HA 1W8GA 1CGYA 2HMCA 1HJQA 3RNDA 2OJPA 1F74A 3KS6A 4EWND 4EPDC 2CKSA 4XWUA 1E72M 1JXKA 4XBSA 4CLMA 1JEZA 1XLLA 3G3MA 1PDZA 4XD6A 1FWDC 1XISA 3JS3A 3TQKA 2XIMA 5EPDA 4JQ3A 1XBVA 4Z2LA 3GU2A 1HP4A 2Q01A 4K38A 4GI6A 3WQEA 3OA5A 1OFPA 3QOMA 3TXVA 3L5LA 1GQJA 2WJFA 4L80A 2VELA 4KETA 2ZRWA 2EPHA 2Y8VA 3SIZA 1VEOA 1GJPA 2OOGA 1O7AA 1XGZA 2IQ0A 4JFUA 1BPLB 3SADA 3PBUA 2EF9A 4JCMA 4MZ8A 2X40A 4GLEA 4E38A 4LF2A 1KNWA 4ZB5A 1GQNA 4H2HA 4GXMA 1OIMA 4AHOA 1ENUA 4RNFA 1UD6A 4DN1A 4MTVA 5EB8A 4HOZA 2BZNA 5AZ1A 5EMLA 1LLWA 3AICA 1XRVA 4AH7A 4BEQA 1B90A 4NZJA 3ES8A 4TOQA 5U4NA 2TPSA 3L9CA 5GNXA 3GXPA 4YU1A 3N73A 3VD5A 2RKXA 4JBRA 4Z2JA 2IW0A 1GEHA 5CJMA 3K8LA 4OE7A 3W76A 1IIGA 3MZ2A 5K3VA 5TNVA 3Q45A 4NSBA 4O0ZA 2FPVA 3G8EA 4Z1DA 3FSUA 3WQOA 3UJEA 1QMLA 3RR1A 3NPWA 1W17A 2AGKA 5D8ZA 3VIHA 5MF5A 3UWEA 4WRHA 4L4LA 5C7VA 4J3XA 3T07A 1JDAA 3R7MA 3TYDA 1OHLA 3NGFA 3NZPA 1YXYA 1J5TA 3R94A 4FAMA 5CG7A 3I3EA 3TOYA 3N2TA 4NU7A 4JL2A 2DIKA 5GJNA 2YB1A 5D32A 3VINA 4JFVA 3BPWA 3BE7A 5HXMA 4Y2WA 3GW0A 2IXVA 4CVUA 2XFRA 2PBOA 1Q8AA 2VVNA 1P4CA 2WNZA 1W1A1 2Z4GA 1XGDA 3CMGA 3JR2A 3TQVA 3WBWA 3SGGA 3A12A 3SJNA 4W8AA 3C0SA 1E51A 2VZSA 1LORA 5BMXA 3GYCA 4I6KA 3L23A 3BVJA 4HT3A 1KGXA 1J0HA 3TUUA 5JH2A 1EIXA 3B05A 3UXLA 2QCEA 2PDKA 3KBWA 3AIBA 5AC5A 2YIHA 5EYWA 4IGMA 4LVAA 2ZXQA 4BWLC 3WH5A 3HG4A 1PKNA 4IPIA 3T1GA 3A3HA 4DVOA 3CL7A 2DY3A 3L4VA 4N7QA 2G4FA 1MRQA 5J5RA 1U1JA 2MUCA 2F7FA 1Q2RA 3UFYA 4PUWA 1OK6A 4E4UA 2QJGA 4R9OA 3TWBA 4YTUA 1TKKA 1JF5A 4HZ6A 4EVZA 1XD1A 1CXHA 4AISA 4DM2A 1JNDA 1E0VA 1JPIA 3MYOA 5DO8A 1KXQA 3G1SA 3RX3A 2DT0A 2Y7GA 2Y5JA 3BZJA 3K46A 2CU0A 3MV11 3PWGA 4A3QA 4XIMA 4P7NA 1A5UA 3RK8A 1F3WA 1TMHA 4AF0A 1E6SM 1JCYA 3N2MA 3NA8A 5D03A 4HYRA 3RJYA 1VHCA 3TCEA 1SQ7A 1A5NC 2DZBA 3MUIA 5A6KA 3QMTA 4PGLA 1H60A 3TN4A 2X09A 5CZSA 4B4HA 3S9YA 4LVGA 2VC7A 4JTTA 1TRIA 3WNKA 4IPPA 1K7EA 1S2AA 4QHRA 3Q94A 3QOKA 1EJ7L 2X42A 2HV5A 4LCQA 4HMEA 2ACQA 3BLFA 2GGJA 5KZMA 5LA0A 3AUJA 1PKYA 2ZXBA 1HG3A 4J28A 2D2HA 3GS6A 4OIFA 1PEZA 2CCRA 3ZWSA 5AB3A 2Z6JA 3MPGA 2VEIA 2W91A 4W8BA 5HR6A 2RJHA 5I3IA 2ONEA 3A3WA 1KBIA 2VX7A 5IHRA 3CYVA 3LBOA 1OJXA 3UCCA 1REQB 1YPXA 3SDOA 3FA3A 3W85A 1RCQA 4BFAA 2QXWA 1WXJA 4IJRA 4MJ2A 3VILA 5D2YA 3WX7A 1GOOA 1ECQA 3TR2A 1OVDA 4UTLA 1AD4A 4Q6XA 8XIAA 3FJ4A 1RH9A 2P8CA 5AYYA 4UQ9A 2DDXA 4JTSA 1R30A 3UG5A 3WQFA 4MJ4A 1J2WA 1WAUA 2V5LA 1YDOA 3FX4A 2P8BA 3B97A 1US2A 2DFAA 3MQTA 4ML4A 1EYEA 3G1RA 2ASHA 4Y9AA 2E8YA 4L65A 3IGUA 1V3MA 2DZUA 5BROA 2BY2A 3FSTA 1VFHA 2QAFA 3A21A 2GUYA 4WY0B 3H2AA 1E1FA 1XLAA 4E4PA 3P82A 5G1TA 1XYFA 3WF0A 4JDBA 5C71A 1UH2A 3JRKA 4DBEA 4RW5A 3P81A 4O4WA 3HF3A 4GY1A 4DLFA 4U3CA 3VTRA 3UGRA 2NLYA 4IX2A 2WJDA 4RZ4A 5BW6A 3EXSA 3W86A 5I02A 1QXLA 2JF6A 2J7BA 1JNEA 1R6WA 1EC9A 1W5MA 3CHVA 1V6TA 2OSXA 1LBFA 2XGZA 3F4DA 3PTMA 2HXUA 3PZ9A 2V2CA 3SCPA 4ZB2A 4HNOA 1G1YA 3PTKA 5L6UA 3LOTA 3C8NA 1FH9A 2C0AA 3VZXA 3L67A 2P88A 2CBVA 2JKPA 1TZZA 2PWUA 3PUOA 2VRJA 4IJCA 1ICPA 4GIRA 4TV5A 4UTTA 1MW0A 4UFLA 3SM0A 4X9YA 3WQWA 1BYCA 2FGLA 4UCFA 3VKCA 2HBXA 4KRTA 1M7PA 2DVTA 3MSDA 4UUIA 2F8QA 3HO8A 2ZFAA 2E0PA 1UZ1A 3T09A 3FNDA 1OFEA 4FMVA 3UT0A 3A23A 1AODA 1ZAIA 2X0HA 4HGXA 3QQWA 3KXQA 5HR7A 3WH9A 4AG0A 2GSEA 4B5NA 1FWSA 1QBAA 2W9MA 4GH1A 2WSPA 3PVFA 3C86A 4JYEA 1HFBA 2EXOA 1TA3A 4GYJA 1RQEA 5CPNA 3NR0A 2ZC8A 3DKJA 4Q4RA 4MF4A 5I3FA 2G3IA 1UA7A 3IJ6A 3F5JA 3WYZA 4MHBA 3W07A 4WOZA 1J0YA 4MWAC 3NQDA 3UZ5A 3GFZA 3FVMA 3V75A 1XIFA 3TJ4A 3G0XA 3B8IA 2VR2A 3CUZA 2O7SA 3VUSA 3ARPA 5CG0A 4RW3A 2DVXA 1LUCB 4CNNA 2C1HA 1U33A 2XVLA 3AYRA 4WUIA 2W61A 3M4HA 1NP0A 1Z7AA 3V0UA 1F5ZA 1X1OA 4UTUA 3AHYA 1GVOA 3GHUA 4UOJA 1Q6FA 3SY8A 3GLCA 1SVDA 1VFFA 3E2RA 1K9EA 1DJHA 1E4MM 3EWUA 3NL2A 2A6NA 1YTDA 1W6TA 3RM8A 2YCJA 3W72A 1XQKA 3MP3A 3W27A 2V5JA 5H91A 3U0HA 1BTMA 2O9PA 4QDMA 2XWDA 4Q32A 3M0YA 1J12A 3W7QA 1RVKA 3WDJA 3KTCA 1SO3A 3A4WA 4O1AA 4RDZA 3THUA 5A3HA 1JCJA 3A5FA 4CD4A 1GVEA 1UD5A 1YQ2A 1UMLA 4AB4A 3NQGA 2BVWA 2HDJA 3HGSA 2J13A 5FJUA 2SFPA 3ELFA 5EMMA 5BRQA 2YLAA 1IHIA 4Y8EA 2EJ1A 1HQTA 3K8KA 4G1KA 1L9WA 2RFGA 3AZTA 3PBMA 3ZT6A 4H9MA 1W3TA 4Z0SA 1XJBA 1MEIA 5E6ZA 6CGTA 1H63A 3IAQA 4WOQA 4B15A 5CPLA 1FWNA 1I6NA 1JUKA 1XDMA 2NT0A 4LTSA 2ZUTA 2DQXA 1PHQA 3WUGA 2PDBA 1SO4A 1JCTA 1PTAA 4JNYA 1T40A 1Q8JA 1Z44A 2ZX6A 3NO1A 2VGBA 3KL5A 2Y85A 5ECVA 4B16A 2C13A 3GK0A 1BF2A 1K8YA 3O15A 2H9AB 5AC6A 3FGCA 2JKAA 1ITQA 4XD5A 5D05A 1PVNA 2Y4SA 1HJSA 1VFTA 1OK4A 1K1DA 3H12A 3KDOA 3R0UA 4PTXA 2ZX9A 3ALGA 1JPKA 4QS6A 3AHZA 2HBVA 2CXGA 2D73A 4GUGA 4V28A 3UWWA 4FXFA 5CAHA 4GQ0A 4DM1A 1GOKA 4A2SA 3ZJ8A 4FF7A 3CT7A 1QI5A 3ARZA 3LXCA 3RCMA 1POJA 5DFAA 3VNKA 2DIJA 2R1NA 1KB3A 2DSKA 1CLKA 3EYPA 1AJ2A 1HO1A 4WX2A 1J6OA 1TZ9A 4Q4KA 1KCXA 2GDQA 3W7JA 1EPXA 4DUVA 2F9RA 3CT2A 4Q4OA 3RLGA 1RCXB 1XLGA 3AMKA 1HKJA 4NAFB 2H6RA 3LM3A 3MBFA 2WPBA 3P0WA 4JTEA 3RX4A 3CEUA 5FD0A 3ZT7A 1NEYA 2ZZ2A 4ZSUA 3NIYA 5DN1A 3FYYA 4IMDA 1N8WA 4K1GA 2PDXA 1QW9A 4GMEA 4D8AA 4PMUA 4C6EA 2ZA3A 3K13A 1RALA 5B7YA 1ZJHA 4QRNA 1TWIA 4DXXA 2OOFA 4AVNA 1KA9F 1VCGA 2VGIA 4JYDA 2PBGA 2E5DA 1TPH1 3FS2A 3QEZA 3HGJA 1UIOA 2VCAA 2WHLA 3L0NA 4DQWA 2GDVA 5CGTA 4RNHA 1FWEC 5M1TA 4DO4A 3IWPA 1DE6A 4PFHA 1PCWA 1ZZMA 3IV8A 1UMYA 1EFZA 3VOGA 4L6OA 1FHVA 4PMDA 1DOSA 4MFEA 3VUPA 2XFWA 3BWWA 1BSIA 3EDEA 2Y8UA 3PSWA 5HPCA 3O7UA 1DV7A 7A3HA 3UETA 2VUNA 4QCEA 4JXCA 2BODX 2J74A 1XGEA 2DEPA 3JZUA 2JEPA 4J3WA 1UZHA 3S5OA 1Q7QA 3FA5A 3CC1A 3EMCA 3W1XA 5PTDA 1US3A 3CMFA 3GR8A 3DU0A 3TWAA 2OFJA 1I2PA 1E0WA 1UJQA 3TR9A 2WWCA 5FSDC 5G4WA 1MVYA 2F61A 2WHMA 3OIHA 2C79A 4N6FA 4M6UA 4ZVJA 3LBCA 3N18A 2HVMA 2CZ5A 3HPSA 4M6QA 2VEFA 2VOTA 3TEVA 3K4WA 4CN6A 1TV7A 4KW2A 2EAWA 3NQAA 3K5XA 2ZTJA 1UQZA 2PWGA 1V3IA 4AX7A 3H4WA 1HJVA 1FWJC 1W37A 3N34A 3KVMA 4I90A 4E6MA 1IXOA 2H90A 4PA8A 3O07A 5AYZA 1RAKA 1OT1A 2DSZA 3CM4A 4HA3A 3GKFA 1ZS2A 1DXFA 1E6ZA 1GOIA 3PJTA 3PY2A 1AJ0A 1IEQA 1ONXA 4U28A 2RDXA 2PRMA 4LSBA 5LIUX 5C9WA 3LCFA 4WDTA 4OBRA 3VFLA 1LL6A 3UEQA 3ABZA 2BV9A 1EH9A 2AQOA 1JDDA 2IPGA 4O8RA 4XAZA 3B03A 2YXXA 2GK1B 4X0NA 4B4FA 4QXIA 5M3WA 3WMLA 1F73A 4EK7A 3AQUA 1ITCA 2QIWA 4MNMA 2B81A 1YBQA 2ALDA 1ADDA 2QV5A 1IQ8A 4GVGA 2DZSA 5I6SA 1LM1A 3W87A 1JVNA 1VH7A 5C55A 2X16A 4ZOBA 1KM6A 5FAJA 3TYAA 4C6BA 4ZMGA 3HJZA 4Z2GA 6PTDA 1W1TA 4WXYA 1UZ4A 3NCOA 3FHQA 3UPBA 3HM7A 1L6SA 4DBDA 2I5GA 3MHUA 1R86A 3DUGA 3CLMA 1KKOA 1EGZA 2RUSA 1L2QA 1ZCOA 2XUCA 4J3TA 2NWSA 2QDEA 2G96A 1P6BA 2CHOA 1V3JA 5AHNA 4EPEC 5C54A 2V3FA 4O11A 3ERPA 3CQIA 4O18A 1JUEA 2G3FA 3A22A 2QUMA 3G0UA 1A5MC 1U5VA 1A5LC 4LYPA 1MEWA 1NTHA 1E6PA 3AXHA 2FVLA 3TE9A 4KT2A 1Q4NX 3GTIA 4O1DA 2ZUSA 4GK8A 1NAL1 4GY0A 4XUYA 3RPTA 5D38A 1I2QA 1P5BA 2YW3A 3I6EA 5FF4A 4DBUA 2POTA 3TYCA 1YHTA 4YWIA 3OP2A 3ARVA 5SWUA 3DEQA 1FDZA 3QQ1A 2Q8ZA 1OF8A 4YNGA 2ZRUA 4BQ2A 3AWNA 3EOUA 3IJLA 3SJ3A 4ZQOA 4V15A 1TTJA 1C8QA 3IGSA 3W7GA 1BAGA 3AIWA