4PTDA

Phosphatidylinositol-specific phospholipase c mutant d274n
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQNYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
total genus 105
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4ptdA00
4I90A 2OOGA 3QR0A 1DJXA 1ZCCA 1QASA 1GYMA 2O55A 2PZ0A 1DJIA 3H4XA 3KS5A 1O1ZA 4GNKB 3RLGA 3EA3A 2F9RA 5PTDA 4F2BA 1VD6A 4F2UA 3PTDA 2P76A 1PTDA 4RV3A 3NO3A 1YDYA 4F2TA 4RW5A 4QJ5B 7PTDA 3QR1A 3MZ2A 2ISDA 3V1HA 3V16A 6PTDA 3QVQA 3CH0A 2OR2A 1V8EA 2PLCA 4I9TA 5T9BG 4QJ4B 1AODA 4R7OA 4RW3A 5T91A 4QJ3B 1PTGA 1T8QA 3OHMB 1XX1A 3H4WA 1QATA 2OTDA 3EA2A 3KS6A 4PTDA 1DJYA 2ZKMX 2PTDA 4I9MA 1DJZA 4OECA 4S3GA 3RLHA 4I8YA 3L12A 1DJWA 4Q6XA 5T9CE 4I9JA 3V18A 3I10A 1DJGA 2FJUB 1DJHA 3EA1A 1T6MA
chains in the Genus database with same CATH superfamily
3C56A 4GOAA 2Z29A 5FF3A 4DBUA 3RCNA 1W6TA 4GI8A 4UNKA 4GACA 5A6MA 1HVQA 3VVGA 3DZ1A 1VBRA 3ZJ6A 1DJIA 1KQZA 3ID7A 1BF2A 3WMBA 2BG5A 4PR4A 3SO7A 4PGLA 3H2EA 2H6RA 5JIPA 2GQ3A 4HNNA 1V0KA 1V77A 4WOQA 4REQB 1BWVA 4WIWA 2XWEA 1XH0A 4UBPC 4N6FA 3G77A 2OQHA 1OX6A 2YL5A 3UZJA 4E3TA 5HWNA 3CV1A 1EFZA 3E0FA 1BKSA 4HKPA 1V6WA 4H9UA 1NOUA 4PRRA 1WZLA 3FKKA 1KV5A 1QTWA 1TO3A 1V08A 3MO4A 4IP4A 2VWSA 2FIQA 4MB5A 2VNCA 3B03A 3TTSA 5I3JA 2XVKA 4GQ0A 2B7QA 2TODA 3PWGA 3CPGA 5FOOA 1IE7C 2W79A 1L9WA 3UBPC 1GUVA 3WEZA 4GPNA 4XAPA 4DLMA 2NUWA 3L0GA 1E4MM 4LFYA 4ACYA 4F2UA 3S6OA 1FWNA 4DAIA 4W84A 3QVQA 1LWIA 3QOKA 4ZE5A 3CQJA 1GVSA 1SVDA 3W70A 3ARRA 2ZXQA 1YTDA 1UIOA 1A3WA 1JRBA 5ECVA 1W9DM 4MKSA 1E71M 4YYCA 4NNBA 2BB0A 2Z1BA 2FZNA 4G1KA 2MNRA 3PZTA 3UJFA 1SFTA 5LHFA 3GR8A 3OYZA 1WB0A 2Q01A 3CMFA 1IEWA 2XSBA 2QJJA 3OBKA 3PTMA 2FVKA 2C7FA 5EMLA 1I60A 4AZ5A 1ZUAX 3RJYA 3W3OA 1YDVA 4F79A 1ITXA 4Q4SA 2CHNA 3UNDA 3WLTA 2B7NA 3CV7A 1CXLA 5IOBA 3KE0A 1GGOA 3URBA 4EXBA 1K9FA 4P8WA 3CXOA 4JYDA 3PJTA 3MSRA 5AVNA 3WF2A 3FNDA 3G6LA 1DWHM 4RDYA 3C0QA 4OBTA 4HD5A 1XI3A 2B7PA 1UA3A 4C6NA 1NOFA 2Y7GA 4PCFA 3MC5A 1YE4A 3TKFA 3DESA 3VD4A 3HQNA 3HGRA 3NXLA 3W7PA 4AYGA 4AWUA 2PLCA 3VDGA 4JFVA 4MLRA 4Z0JA 1QXLA 5AHIA 1XLIA 4EAYA 4HMDA 1RCOB 4A8LA 3PBWA 4E2DA 1E4NA 4PRTA 4UTUA 3BARA 2ZVRA 3WD3A 3WLIA 3W22A 1VRXA 1JQXA 3GB6A 2YCLA 3QTGA 3C61A 5F4XA 1A4MA 1T0OA 1IZCA 1REQA 3GXDA 4WF7A 3GZAA 2W5FA 4LY8A 3VDBA 4NYYA 4N2YA 1WNOA 2RJHA 1HKMA 4AX6A 4IMDA 4JQ3A 2PDPA 2BOGX 2VGIA 2YXGA 3RITA 5LNVA 2VDIA 3ARZA 2DP3A 1PVNA 1UKSA 3P81A 1KO0A 1FWRA 4LUTB 3F4DA 3UEQA 5CSSA 2V5DA 2BVDA 4RE4A 4Z1AA 2PEVA 4PMRA 4BR1A 4KCTA 4UQEA 5I07A 3OGSA 4IIEA 3S1WA 2EG7A 2QZRA 5HQLA 3CZKA 1MW1A 1MRQA 4JQAA 3DHUA 4IP5A 4IIGA 3OVGA 1JPMA 3FS2A 3AMDA 3KL5A 3LLDA 4JD4A 1PZ2A 3DIPA 3NPVA 4JYEA 4WZHA 4LUIA 1PX4A 1I2NA 3LBCA 1KGXA 1W17A 4WJ8A 4GLEA 1YPXA 3C8FA 1YXYA 4OOZA 3TROA 3PFRA 1W3IA 3CQHA 3C2YA 4MAVA 4R3UA 5ECUA 4RW3A 2V5BA 3LXCA 3WN6A 5A69A 2QJNA 5BRBA 1OG0A 4YWIA 2SFPA 3IGSA 1J79A 4C6EA 2A6NA 4ZB5A 4BEQA 4DO5A 3S47A 3C4UA 1FWGC 3S5OA 1CGTA 3YPIA 4ZOEA 3S5NA 2IXUA 2V5JA 3H4WA 1SJCA 1XSKA 1OF8A 4LCSA 4NAFB 2A7RA 4JYFA 1B3XA 2O9OA 1WDWA 3G1AA 3VNDA 2VD8A 1HZYA 3LS9A 4W87A 3KCLA 5D4YA 3LHYA 4DF1A 3BAIA 4O50A 4R7WA 3L4XA 5CPSA 2NLIA 2I14A 4OUIA 1ZRQA 2PC8A 3CEPA 1UYQA 1T99A 1G94A 1A4LA 3GNDA 2WVTA 1OX4B 3UU0A 4F0SA 3C5QA 4Q8UA 1XCFA 3BJTA 3C8NA 3SUTA 3HMCA 4HYRA 3ITTA 3QLLA 1B1YA 3W1PA 3CTLA 2VC9A 3GDBA 4MPKA 2BWGA 2D23A 3QEZA 4AEOA 2QT3A 3SR7A 5KSWA 1GW9A 4NRSA 2FB2A 3S9ZA 1XLKA 1Y7VA 2XJ7A 1YW1A 2R82A 2XVLA 3G1VA 1I1XA 2QEZA 2O9PA 4RR4A 1MW2A 3G1YA 3NOYA 1P7TA 4WKHA 2ZZ4A 1W3KA 2ZQ0A 4KGLA 3MUAA 3E96A 1VENA 5K9XA 2GJLA 2FGZA 3KWXA 1F3TA 3THUA 2WVSA 3E02A 4UTTA 1W1IE 1P48A 3MMWA 4NJIA 3LX9A 3WNKA 1V5XA 4ERGA 3TP4A 4W8AA 3DXIA 4AZCB 2BDQA 3NPXA 3VNIA 1EHNA 2PA6A 4Q8TA 1TWSA 4ZQOA 3TYUA 1W8GA 3O0KA 2NT1A 5D32A 1F3WA 4DN1A 4NHVA 2P3ZA 2CC0A 5A95A 4ZFMA 4UTTC 3VDHA 1JXJA 3KVMA 1C7SA 4P5UA 3DCPA 2Z6IA 4K3ZA 1DJNA 1D9EA 3VKJA 1L8PA 1F74A 4AC7C 1S2WA 4QLJA 4AIEA 4JFWA 1U33A 4H8NA 1SYTA 3L65A 3A13A 1AJ0A 3WF1A 4H1ZA 1SJAA 4O18A 3WLMA 4E6MA 1JGMA 3SQMA 1RALA 1XUZA 4BHYA 5H1WA 1BD0A 4H3DA 2WCSA 3W1LA 4LVAA 5CSRA 4JOMA 3OZMA 3BMVA 2PDGA 2PWDA 3QQ1A 1JCMP 4RPQA 3HPXA 2Q8LA 5DRCA 4X63A 2A85A 3ONBA 2PDHA 4L1GA 5D33A 5CBJA 5LGZA 3OVRA 2VOTA 1AH0A 1MVYA 3WQOA 2VEFA 4E2VA 1JJKA 3KCJA 4JNZA 4OVXA 1WA3A 4U3CA 4X61A 1I8JA 2X8RA 4LB4A 5AHMA 3ZIZA 2YBTA 1B0IA 3UR5A 2R9RA 1Y65A 3GHUA 2A21A 1RK6A 3WD4A 4D71A 2NLYA 1TMLA 1ZJIA 5AOUA 1XF0A 5SWUA 4ENLA 1GPWA 1PSCA 3MUZ1 3I68A 3TONA 1QUMA 2PDMA 3W88A 2G3IA 4YMZA 3PBGA 5F2GA 1A5SA 4JIRA 3W0KA 3Q94A 4GQBA 3TFXA 5HNRA 2IXVA 4PEKA 3NWRA 5C70A 3H22A 3DBNA 4MB4A 3W24A 3CMJA 5LA2A 1MRAA 1XIFA 1HVXA 1GJPA 1V3JA 2E0PA 3ANVA 5XIAA 5FI8A 3LBMA 3T0TA 4LYPA 2OT0A 1TMQA 2ZC1A 3HJZA 3K13A 1BG4A 3F03K 4NP7A 4GYPC 1SUXA 3MY9A 4GYPA 2QJGA 1BPLB 1U5HA 3DG6A 3MKVA 3P80A 3KTXA 1W2VA 4IUGA 2QUVA 1LLWA 4DWDA 2J24A 4B90A 3HG4A 4ORMA 4CU7A 5A2BA 3PUDA 3KRUA 2UY4A 4GX8A 1U5VA 4RDWA 4ORIA 1E9IA 3TTOA 4CVUA 5A6BD 4CD7A 4E8DA 4XO6A 4OU1A 4F3HA 2HEJA 2DH2A 2WSKA 3LPGA 4R7OA 1US3A 5HR6A 1XIBA 3DGBA 3VDAA 4GI4A 1AMYA 3OP2A 1GOQA 4K8HA 3STFA 3WQ6A 3T8LA 1UBSA 3AISA 1FXPA 3W7LA 1PBGA 2XIJA 1F8MA 2V6AA 4MUZA 4LTSA 1SZFA 4DBEA 2VMFA 1WP6A 2P88A 3WH5A 2PGWA 3CAWA 8TIMA 5A6AA 1H11A 2PB1A 4UR8A 1MFVA 5E0FA 1EZ2A 3G0SA 4F0KA 2FZ9A 2PGFA 1W5NA 3SJNA 3BLPX 4RLIA 3HB9A 3EWUA 3U2CA 3NNTA 1NWRA 2QJIA 1XC4A 3ES8A 1ZS2A 3IGXA 4HPGA 5BNKA 1US2A 1KRBC 1E6NA 4KCVA 3UWYA 2Y7DA 2C0HA 1G4SA 1RQHA 1R47A 2RGMA 4F2BA 4ICCX 2F6KA 3W28A 4GUHA 3M5YA 3E38A 1HKVA 3CS2A 3TQKA 2X40A 1W54A 2Y61A 3WUBA 3AWOA 3UXDA 5HANA 3SCOA 1PTDA 4Z2LA 3FSUA 1GVIA 3LQGA 4Q7IA 4MNKA 2W63A 2X1TA 1JD9A 1K4HA 3T0DA 3MS8A 4I8YA 3P3BA 4O54A 1QK2A 2BMBA 1TX0A 4DYKA 3BANA 5CCZA 2VZTA 3A3WA 3N9KA 2FHCA 4H8UA 4JTKA 3W75A 1P7TB 4CN1A 2RUSA 2CBVA 4HU4A 2DUZA 1MXGA 1J9YA 1DQUA 1I45A 2UV8G 1JDFA 3PJXA 2ZWZA 1LDCA 4HNVA 2YCLB 3OA5A 3LHZA 1AVAA 3KOXA 3GVGA 3PHAA 1QWKA 1ME7A 3RFAA 2R1KA 4IJCA 5F1VA 1K4GA 4JTGA 2D2OA 5D02A 1CLVA 1L6FA 4JTIA 3S5ZA 5CBBA 5EBAA 4JKLA 2EQDA 1LRTA 3B3DA 2NV9A 4JNYA 5EMKA 1KWKA 3MYPA 3GC2A 2HE5A 1M03A 5I23A 4JIQA 4N9EA 5G4EA 3R94A 3EKZA 4U5IA 1M04A 4QSFA 3VZZA 3AALA 3TJLA 1W31A 4OHQA 2HMCA 5CBIA 3H2MA 5HWMA 4OWGA 3Q67A 3VMPA 3FFSA 2BGNE 4JTLA 1XS2A 4L9ZA 4RE3A 2XH4A 4K2SA 1VLWA 2ZDRA 4CCEA 4CQAA 2WHMA 1W0MA 3UT0A 2IKHA 3LLFA 4JTTA 3BH4A 3RMJA 1ZJBA 5D03A 1NF0A 3W1UA 1W5MA 4D6DA 3CWNA 3I7RA 2WZIA 2QGYA 3ENLA 3EA1A 2ZOXA 4KFPA 2OO0A 4XK2A 2YOCA 4AAJA 1ONXA 1VBGA 3L2IA 1DHPA 4DZIA 4H2HA 1MNZA 1TWWA 2OPJA 1JF6A 4OECA 1C8YA 4WKAA 4NAEA 4YVPA 1OHLA 3MSGA 4PTVA 2F2HA 3V35A 3KEHA 5EMJA 1AFSA 3CZEA 3GDLA 1ODUA 1Z7AA 3WELA 3HM7A 2BBFA 2DW6A 4MB3A 1BYBA 3TQ0A 3FDGA 4C5YA 4FOKA 3MSDA 5G1MA 3TNOA 2Y2WA 1ICPA 4IMAA 1VJSA 2BP1A 5D9PA 1NVMA 3SDOA 3NGFA 2GZXA 1TQXA 3VOCA 1JZ4A 4ADSA 3TYBA 4UQAA 1PTAA 2V3GA 2ZWYA 2D2JA 1ZFJA 1B57A 2Z0IA 4Q4KA 3WDPP 1WKDA 1EJTC 4AD1A 1LUCB 1QJWA 4HHPA 4UR9A 1UQZA 1E56A 3MCNA 4EANA 2VD9A 3QPYA 4C90A 4W93A 1A0CA 5HA7A 5FF2A 3H53A 3PY2A 3RXZA 3PANA 5B7ZA 4C6BA 4FSAA 3ZLGA 1A0DA 3L5LA 1AL8A 4CQCA 4IISA 4UZSA 3TXZA 4LS1A 3VCRA 3G24A 4LJ3A 3SN1A 3GXNA 5IHSA 2CLIA 3QV6A 1QHPA 3UWUA 5FCZA 5TD4A 4US6A 1S5TA 4HMEA 5CKSA 1B2YA 1JYXA 3DI1A 3EKLA 4M51A 1RBLA 1WZKA 4PULA 3K4WA 1XRSA 2DORA 4PC8A 3W7OA 2WXDM 2J25A 4GVFA 3H12A 4NNAA 3NL2A 5AHEA 4DUWA 4L4PA 4DO6A 4BF9A 2QIIA 2VX7A 2IKIA 4GVGA 3LI0A 3GDKA 2AL2A 4UOQA 1Q13A 3ORWA 1YNQA 3U4FA 5LZLA 3VIFA 1VJZA 1O5KA 4PMDA 4WK9A 2C19A 4QQUA 2CW6A 2WKJA 3U9IA 4K8GA 1UZHA 2G3JA 3EB3A 4GZ7A 1MDLA 3JZUA 3DUGA 3NQ2A 4IGNA 4Q6XA 2BVYA 1WBHA 2WMKA 4QE5A 1LLZA 3N25A 1YIXA 3GWQA 1FWSA 5TBOA 3KZPA 4YU1A 3CLWA 2TSYA 4QLLA 1UH4A 2WQDA 3QMTA 4IWWA 4BI6A 4S3CA 3AZRA 4LYKA 4H9VA 1XISA 3PR2A 2R1PA 5DT7A 1BQGA 3KL3A 1ONRA 3EWXA 3SY8A 3QR0A 3W73A 3WH9A 1VP5A 4A29A 2P3EA 4GXMA 2WZEA 4L7ZA 1GG1A 4GBUA 2WM1A 3G0XA 3LCXA 3IARA 1UKQA 1A5NC 3WQ8A 1QI5A 3B8DA 2Z2BA 3T8QA 1CWYA 3PZGA 3QMSA 4NI8A 2FMNA 3BG3A 4JHMA 1OABA 3QXBA 3RK8A 2FZBA 1TPC1 2J6XA 1H1YA 3K1GA 2PDXA 3TOYA 1WKYA 2YL6A 1D8WA 3F5KA 3ARUA 1EOKA 4GK8A 1Q4NX 3TYZA 4K6AA 4A2SA 2RDWA 2OELA 3KX6A 1BFNA 1K02A 3B05A 4L61A 2DVUA 4UTMA 3R0DA 5HINA 1CEOA 1S46A 1FH8A 3I3BA 2WYSA 2C1HA 1H5VA 2Z1WA 1NARA 3PBMA 1KTCA 3I4EA 3UP8A 3ZSSA 4E0CA 4GXPA 1XIHA 2HROA 2OCZA 5KITA 2GSJA 3CK5A 2HPMA 4JN6A 3DI0A 5AB3A 2OVLA 1CTNA 1EXBA 4C6IA 5HPOA 1OGGA 3GAYA 3VIGA 1GQNA 4EKJA 3IS4A 1ZCOA 3DECA 5DXYA 2O9TA 4LBSA 1F07A 3EPMA 1V0NA 2CZDA 1UD6A 3UZ5A 3UR7A 3MMDA 4HB7A 2CHRA 4IICA 3BLDA 5IFTA 4Y90A 3V7PA 1MUWA 3CEUA 1FHVA 2CERA 1ECQA 5CC5A 3WLHA 3W1XA 1FDYA 4MJ2A 2P8CA 3K2GA 3LEPA 1NEYA 3GYEA 4EOUA 2F7FA 1FP9A 3TE9A 3BURA 3FSTA 4FIQA 4MWAC 3UPMA 4NI3A 4AIOA 1E70M 4FNTA 2J8FA 4O1BA 1RA5A 3QGAC 4M7SA 1YMYA 4LBUA 1OCBA 2AL1A 4RE0A 1A5LC 4C6FA 2Y24A 1XIJA 1TPH1 3V5CA 2YCEA 2D2HA 2TPSA 2W9MA 3NQEA 1JIBA 1GZJA 5HNTA 1FWJC 3W87A 2HBVA 3NM1A 4KWVA 4O10A 2IPJA 3XINA 1SQ7A 2G3MA 3H8AA 1VIWA 3QPEA 2OEKA 3R6IA 4PB4A 4AQLA 5FEPA 1UH2A 3APYA 4EAMA 1DBTA 3E0VA 2V2CA 4XBKA 4ZSUA 4NAFA 3BSMA 4Q22A 2DFAA 1DTUA 2XG9A 3LGDA 3AS0A 3LHTA 3GVVA 5J8LA 2GYIA 3H54A 2NW0A 1I2PA 2NWSA 3KVLA 4OGZA 3CPRA 4Q8PA 4XZNX 4E4PA 4KWWA 3N17A 1LWHA 4JIIX 2B4GA 2YA2A 3PZMA 1WDRA 5MF5A 1AZ2A 3P0WA 1UZDA 3ES7A 1ZY9A 1W1ZA 1EX5A 4GGBA 5A6SA 1P6WA 1F4HA 2DT1A 3IIPA 3CIVA 4B16A 1F6YA 1QW9A 3D6NA 4C1KA 4FIRA 1GCYA 4OUEA 3U5UA 3AXMA 3FY1A 3FN9A 4ZODA 1QPKA 2NV2A 1EBGA 3W1MA 4HA1A 1XIGA 1QWGA 2Z25A 3N73A 3S5YA 1YBQA 2XISA 3I4KA 1UPPA 1NDVA 3L23A 3PPGA 3OU8A 4IP7A 4AF0A 3KDOA 1JZ2A 1DL3A 2E3ZA 1D3HA 3AIBA 3T0BA 2OB3A 2Z24A 1GQIA 1UP3A 2CXGA 2ZUUA 4UOJA 2NQ9A 2ZE0A 2INZA 1E15A 1H3GA 2E25A 2GVEA 2ODOA 4MM1A 3R1ZA 1N8WA 2YCKX 4P2VA 2ISDA 1TPB1 2AQVA 3CNYA 3NYDA 1J4EA 4IL2A 3R25A 3LY0A 3RX4A 3G22A 4DBSA 2A1YA 1R3TA 5CPNA 4JX6A 1N8FA 4LAZA 2DSVA 1C3FA 4XD5A 2IQTA 4E5TA 3SEPA 3T9PA 1VR6A 3GG1A 2ZXBA 1VEPA 4Y9MA 3UQNA 2CZFA 3LCFA 3T40A 1NDZA 1W9UA 1WKFA 1X98A 3A5VA 5FKYA 3EA3A 4PSRA 3GQYA 1J0IA 2BSLA 1UUQA 3BQ5A 5AC4A 3WNPA 1RCXB 2QMJA 3WLKX 4XAYA 4WEVX 3EB2A 2XFRA 5DT5A 2BV9A 1U1JA 3E0WA 1IQ8A 4LUTA 3BCDA 1I9CB 4QE1A 3UZWA 3TTEA 2GDVA 2E4TA 3W76A 4YJ5A 3RMEA 3STCA 3RYSA 4NIRA 1QDSA 2OEMA 4GJIA 3EX1A 2F8QA 2J8TA 3HFYA 4GD0A 4KMQA 3H70A 2EO7A 2PP0A 4HBKA 2F6UA 2HZGA 4I5RA 4WX2A 5HXMA 5CPLA 3LPOA 4WDUA 3GD6A 4LNCA 4TQTA 1WO2A 4WCJA 1E6RA 3HGSA 3W1AA 3KRSA 3PPHA 3ABSA 4H7VA 1OYCA 2V5CA 2BS9A 2CYGA 2HJPA 1C8XA 2O7QA 1JEZA 3F2DA 3H2CA 5JXQA 3GFXA 5ABTA 4ACZA 1OJXA 2Z7GA 4GIYA 5IM51 4POCA 1W3HA 4QG6A 3ANUA 5M17A 3ABXA 4ATWA 1H63A 3UVAA 4DYEA 3B9AA 3C2VA 3V0UA 3T2QA 4C6KA 4PCPA 4ZO7A 3BLLA 4GNVA 4LAKA 3CBWA 4TXEA 5HUOA 5C8BB 3AS1A 5T9BG 2LLEA 2PUZA 4XX6A 2QYGA 3VIMA 1Z6KA 4FXJA 3TSMA 2ZUSA 4IQJA 1YNPA 4XUGA 4B5TA 2ACSA 3T81A 2V69A 3ABZA 3UG5A 2I7GA 3ZT5A 5HJXA 4ROPA 3S9YA 3ME3A 1IEVA 4F40A 3SCUA 1V6YA 3U2ZA 3D5HA 3KFTA 1AK5A 4W7VA 3DC0A 5D38A 4UTHA 4LV4A 2CBUA 2WSRA 4V27A 3KHJA 1NFBA 3CZJA 3CYJA 1FWFC 1A50A 5EKYA 1V6XA 4DJFA 4KCUA 3TH6A 3TW9A 3FAXA 1ZL1A 1X7IA 3STGA 4R9OA 2ZCGA 3B8VA 3RAOA 2E9LA 4HU3A 4EACA 3HZ3A 4B3KA 3OODA 4AC1X 3EPOA 3HA1A 1TJRA 3NQDA 1Q85A 3FVDA 1T96A 5H6HA 1QCWA 3VOJA 1J2BA 1OVDA 1ADDA 1RA0A 1W91A 2PDBA 4J9JA 5E5CA 1NY1A 4H7CA 5BZAA 1RH9A 4QLKA 2WHJA 4HTBA 2Z2AA 2V8ZA 2E9MA 1XYCA 2VI0A 4ZB0A 2IS7A 4ZXOA 1ISZA 1PB0A 4WDTA 2FPVA 3LM7A 1LJYA 3WBXA 2G95A 3OLIA 5AY7A 3QOMA 2BX7A 4NZ5A 4DWSA 2GK1A 5E09A 1J0HA 2VFIA 4JIPA 3NQBA 3WDQA 1EXPA 1TV4A 5FF7A 1CGUA 2PDUA 4IQEA 4NY2A 3E74A 5CC7A 1Z69A 2YGYA 2Z4GA 2X1UA 1GJWA 2X2YA 3MANA 2XGIA 1DTNA 2BY0A 1QATA 1KM6A 3KBVA 3NA8A 2O7SA 1R7OA 2C15A 4FOJA 4NQ1A 4N9BA 2EBNA 3QYQA 4H9TA 4TU1A 1SO4A 1LCOA 1EC8A 3PBVA 4XVDA 3W1TA 1PO9A 1P1MA 1PPIA 1CXEA 1SW7A 4RK8A 1XX1A 3N04A 4WXYA 2PD5A 4E8GA 3RHGA 1E6XM 1TPUA 4F48A 2R6OA 1FWEC 5DX7A 3ZZ1A 1RR2A 1VFTA 3VUPA 5ABEA 3QHNA 1EPVA 1ME9A 2ABAA 3IJQA 1VEOA 3MJYA 2FDSA 4MJMA 3EEZA 3CM4A 2QDDA 1BYAA 4LVDA 2WBKA 4YIWA 4L56A 5I77A 3LRLA 4ZBCA 2R1NA 3S3GA 2OLAA 3PZOA 3NJ3A 3BJSA 1DP0A 3LZ3A 2G50A 4B2DA 2I57A 3QR1A 3QY8A 1EP1A 4A6GA 2Q8ZA 4GKTA 2ACRA 1UD5A 3GM8A 1SW0A 4RCXA 1POJA 1XICA 4UUIA 2YA0A 4UCGA 5BXTA 1UPMB 1RLDA 2H8ZA 4O1DA 1NWSA 3M0YA 5DO8A 1EDTA 1XWYA 2ZUNA 5D9MA 3VD9A 4A2RA 3UY8A 3PB2A 2Z00A 3KLLA 2ZRXA 3FJNA 5CJ5A 4YLWA 1EA0A 4EWJA 4XKYA 1JDEA 4S3EA 3PTKA 4ZTXA 2E8ZA 3W6MA 3R58A 4DRSA 1HXJA 5C55A 3L4ZA 1JD7A 4JTJA 1YDYA 4ZE4A 3SIMA 2B81A 6ALDA 2R8WA 5ABGA 4LYRA 4ZQPA 1QK0A 1UQYA 5D2XA 5E93A 3WO8A 1LRNA 2VC7A 5LXXA 4H9ZA 5DANA 3LD5A 4S2CA 4O13A 1NELA 2CZVA 4J3SA 3ELFA 2J47A 2TAAA 1GYLA 5HUPA 2R24A 3IGHX 4HCLA 1TTJA 3TC7A 4XV0A 3T4WA 3NZRA 3CJPA 3DBPA 5DBUA 3PK7A 4J27A 3LCLA 5GNXA 4I9AA 1DJYA 3WUFA 1JCYA 1DKWA 1UMLA 1OFDA 4XO7A 3IGUA 3DFHA 4DXVA 1B3ZA 2ZICA 5MKGB 4NT0A 3DHPA 2E28A 3RNDA 4JCMA 1QHZA 3GC4A 1E1CB 2JEPA 3CHDA 5D8ZA 2J6VA 2OOFA 4RXFA 4P8UA 5CXPA 1S1PA 1PIGA 3BMXA 4HNOA 4R27A 4O8AA 1YPIA 1E5JA 1XH2A 3DYOA 3FJ4A 1HJQA 2AQOA 4XVEA 3GXIA 1D2KA 3UXAA 3ZLFA 1A5CA 3G3MA 1X1NA 3NL6A 3M0IA 3LERA 5FIPA 4MY9A 4P7LA 1M9HA 2H9AA 3P14A 4LC6A 3HPZA 1E1CA 3QTPA 5HJLA 3DH7A 2PWGA 1IT8A 1TPVA 1EJ7L 4MJZA 4P8XA 5KZ6A 1OCQA 5JBDA 3KBNA 4DWSB 2BXYA 2O92A 2NZLA 4HU8A 1EQCA 1MZHA 1XCXA 1B9ZA 1Q7ZA 3WKZA 3DFTA 4HK7A 5G2IA 3UWEA 1UWTA 3ECQA 3E0IA 3CYVA 3ITGA 2QCFA 2F61A 2A3EA 3CTTA 4GYFA 1Q65A 2CZEA 5LSMA 4ZA0A 4DYJA 3TN3A 1NTHA 4HGXA 5LIWX 4JKKA 3LRMA 3W6YA 1PV8A 2VO5A 1KFWA 3KS6A 3P82A 2C0AA 2CWNA 1G4EA 4JDYA 2BXVA 4D72A 4FNPA 1OFBA 1YQ2A 2ZA1A 2YB4A 4RZ4A 1TREA 1IIHA 3GYCA 3N34A 1XXXA 1JCJA 4LOCA 1BVNP 5DN1A 1PCWA 3NQCA 4N0RA 2ZXDA 3KOWA 4KEUA 4ADUA 4ES4A 2GVYA 3O9NA 5K4XA 4AZBA 3TU9A 1SFJA 2QVNA 3HMJG 2PDKA 4RJEA 1RSCA 1UJPA 4Q33A 4DPQA 3MI6A 4FZIA 4QX4A 1NDWA 5CZJA 4ZL1A 3HV9A 1XH1A 2NVCA 4G8TA 6A3HA 1VGAA 4K7VA 5FAGA 4AWTA 1KBJA 4UMAA 1XGDA 2E6YA 3SRFA 2RDXA 3COTA 5DBTA 1VD6A 4DBWA 3GBDA 1IEQA 3UJ2A 3HURA 3MSYA 2CLHA 1QT1A 2IPGA 4UFIA 3DFYA 5AYIA 3GTFA 3ALGA 4C6DA 4L4LA 1UWQA 1SW3A 4ZQRA 1QNVA 3SN4A 3S2NA 3BW3A 5G2WA 1UCWA 3KHDA 4DELA 2FZDA 2V5KA 9XIAA 3DG3A 1VF8A 3QC0A 1A5UA 4GKLA 4PL2A 4NILA 1MQQA 4AW7A 2V9DA 1TFVA 1Y5XA 4FNSA 2EAWA 2X1IA 3MTWA 1P0DA 2ANUA 5LA1A 1LQ0A 1VS1A 1ZTVA 2VXNA 3UG3A 1WZAA 3VC6A 4HSOA 1WBJA 1EC9A 3NUKA 2WVVA 8XIMA 1EJXC 1XLJA 4RNJA 3BE7A 1ZCCA 4DI9A 2JF7A 2DZTA 4LW7A 2VCCA 3R0KA 4NRRA 4AZIA 1OBAA 2QCGA 4U5KA 3VNYA 4GI6A 4K1GA 4KFOA 4NAEB 3ARVA 5DMNA 1X38A 1KTBA 2OKTA 2WJEA 2XVPA 5EMMA 3MQTA 1HNYA 4GUGA 3SSZA 1XDMA 4Z17A 1YPFA 1GVFA 4DHGA 1CXFA 1CNVA 1SZNA 3FKRA 2YA1A 3DEQA 1HG3A 4GQQA 1H62A 2OTDA 1AH4A 4N4PA 1F6PA 1H1ZA 1FCVA 3PVFA 3GLCA 3FV9A 4M1BA 5AYZA 3M07A 1IIGA 2WK2A 3GZ3A 1JUEA 1ME8A 2CLEA 3NO3A 4QXIA 3AYRA 5EFFA 1I75A 3VAVA 1DXIA 4JTSA 4AIBA 2DQWA 4K39A 3IJ7A 3DYPA 1EGVA 1QI2A 5E6ZA 3SM0A 1TV3A 3W2JA 4JTRA 5AC8A 3VNKA 1JPIA 4L6DA 1Z89A 1JF5A 1NSJA 5D9OA 1VBHA 4Q4PA 3MZ2A 5CZTA 3IV8A 1LT8A 2WM0A 3C6CA 1Q6GA 3N4FA 1LZOA 4PMNA 2VUNA 5T9CE 1NU5A 4QSHA 1BXNA 3VMOA 3WK3A 2Y63A 1S5NA 2X30A 1PKYA 1Y5VA 3BLOA 4C6LA 4DB7A 4IX2A 1Q63A 2QQ6A 3QF0A 4NJKA 2PDJA 2POZA 1SR0A 4JDBA 2FGLA 1BXCA 3S2LA 3E5BA 1LBFA 1CLKA 4X22A 1KRAC 3RRAA 4V2XA 5AVHA 1IHIA 1JYNA 2Y4SA 2J7EA 5F4SA 3QC3A 4B5XA 3QSRA 3TW7A 3CO8A 3HFTA 4RX0A 4BI7A 4GIAA 4J40A 3MMUA 1C91A 4GYKA 1N55A 5IRPA 2A7PA 2NXIA 4C1LA 1JUKA 3KP1A 2X1SA 3E2QA 4PMZA 4IQLA 1MXDA 4HPJA 3MYOA 2X41A 3E9AA 1UH3A 4D6IA 1Q6RA 1OSEA 3O2LA 3N4AA 4WRHA 4N4QA 5JVLA 1E3XA 3ZS4A 5CQ1A 2CLKA 2ZRVA 1E1FA 3E0LA 3TSDA 1XSJA 1R8LA 1SFLA 2FHFA 4O14A 4C6MA 4HPNA 2FPYA 3FJ6A 3IK4A 5CPMA 4UQBA 4QR6A 4YTSA 3LN3A 5FD0A 1ZAHA 1JGIA 1UKOA 1FBAA 3VGBA 4S38A 2QCEA 5FL1A 4IUOA 2Q8XA 1KXVA 2WWCA 1FUYA 1DXFA 2B0MA 1RHCA 2F38A 1P0BA 3GXMA 3NVDA 1GWJA 3T78A 1S3HA 1E0TA 3TDFA 4MF4A 5KEZA 2CETA 1BTCA 3Q2DA 4PYSA 4RZ5A 4FAMA 4X0VA 4I5XA 1R38A 1WUFA 4M8UA 3UWVA 1E55A 2PP1A 2PU0A 4GA8A 2DIKA 3TJ4A 4FNRA 1H41A 1OCNA 3POHA 5HJYA 2FMOA 2YJQA 2XFFA 2WHKA 4OE7A 2FB3A 2ZZ6A 4R5EA 2NSXA 4MFDA 4ZMGA 4Y8EA 2FTPA 1POKA 2FQIA 2VCAA 1VH7A 2CLOA 2A6LA 3VABA 4TMBA 4YTTA 4QCEA 2NT0A 5IBXC 2QPXA 4JN7A 2VZUA 3TN6A 3VIPA 2EPNA 3D46A 4GY1A 3KUMA 3O6AA 3R7MA 1XL9A 4FPSA 1EKOA 1R2SA 5D2YA 1XBZA 1ALDA 4HOWA 2WZMA 3WEMA 2HNHA 1KTNA 4JTHA 5AFDA 2P76A 4H7ZA 1UZ1A 4UTLA 3LYEA 5IXEA 3BAJA 4C6PA 4ERIA 2HVMA 4G6CA 1XG4A 2DZPA 4S1FA 4F0RA 3OIHA 1N2VA 2GJRA 3ABQA 1E72M 1YEYA 2J27A 1GG0A 4CU6A 4I7VA 2PDLA 1ELSA 2ZUWA 1SO3A 4HQVA 3GG8A 5TIMA 3EMZA 2ZUTA 3IANA 6XIMA 1S2AA 3S1VA 1VHNA 2R1LA 2VX6A 5C9ZA 1ZALA 5K3VA 1MXSA 1W1B1 1TMHA 4EPBC 1OIMA 4B5WA 4QS6A 1RPXA 4H6EA 1ONEA 2HNEA 3D0CA 2ISVA 3RN6A 1Z32X 1E73M 3WF0A 1KM2A 1V6TA 3SADA 4CQDA 4DLFA 3GTHA 1F5ZA 1RVKA 3A9IA 2RFGA 2C79A 4XZMX 4CU8A 3ICJA 2CEQA 2F9RA 3EX3A 1G7UA 1NOWA 4QBXA 3L4WA 3HIJA 1Q4WA 4OIFA 4OFCA 2J7HA 1WAWA 2ZRYA 3QV7A 1UD4A 4XSMA 4M6QA 1EYEA 3CUXA 5JH1A 1HQTA 4KW2A 2NXHA 4XWUA 3VK5A 4WVXA 1A3HA 3PWIA 3TZFA 1KFBA 4FXSA 3EXRA 4IFOA 5CGTA 2X05A 1FVPA 3K4AA 4HJFA 4S3JA 3N13A 3PZNA 2X42A 1N7KA 1FQ0A 3N9RA 2QCDB 2J7GA 1UZ4A 4Q8OA 1W1A1 4J3ZA 3K30A 4WGHA 4ZFCA 2X16A 3NURA 3MP5A 4G9PA 2WZHA 1HJUA 3F7JA 1JYVA 4ASTA 4PMXA 1Q6DA 5CZ0A 1PKMA 3O15A 4MWAA 4A4AA 2I56A 1RY8A 4KEVA 4LX4A 5CGMA 4MHBA 3VO0A 1O6IA 1W8SA 4MZYA 4WHBA 1AQHA 3W1RA 3W2UA 4LF2A 2VKZG 3VNMA 1M41A 4HA3A 3WDJA 3GHSA 3N19B 1TWIA 4BJHA 3ALFA 3ARPA 4QJ1A 2HVOA 4HNCA 3AZTA 3UETA 1WUEA 1KWGA 1DWFM 3L2MA 4W5UA 2J7FA 1WYIA 7TIMA 2WKLA 3CUGA 3SI9A 1KGUA 4UTWC 3TLLA 2BASA 2GQ8A 1K9TA 2XSXA 2JF6A 1VCVA 1JCTA 1WX0A 2PE4A 3N2CA 2W4XA 3W2LA 2C1GA 1OADA 1I2QA 3KM8A 4J28A 1TJ1A 3ZM8A 3CT2A 3BV7A 5J04A 3L4YA 1CXKA 3QZAA 5EBUA 3N14A 3RILA 2Y5JA 4PZVA 2Y88A 3MWCA 4IIBA 2ZZ1A 3N18A 1LTDA 4W85A 4O8RA 2DPEA 5F7UA 1UWAA 1TE6A 4HPXA 4KBXA 1MI3A 3K8MA 1TPDA 3WDRA 1C90A 3IACA 1I2RA 1RAKA 2ADAA 5CAHA 3WBYA 3ATZA 1OX4A 4UFKA 3VX0A 4H9XA 4YYFA 2Z26A 1IXQA 4W88A 2PDIA 1ONWA 3NCOA 4XTDA 4H04A 3VXGA 4I6KA 4BQ2A 4FR6A 2ZDSA 3TW6A 2ISSA 3WQEA 2W67A 5BMWA 3W7NA 4TR9A 2CHOA 1GVQA 3QSTA 1EUAA 1OC7A 3IPWA 4O15A 4K68A 1BSIA 3KRBA 3NSMA 3RR1A 1IXOA 1I0BA 4NF7A 1Q2SA 2C71A 4B92A 3VGGA 2D2GA 7ENLA 2INFA 2V3FA 5EL1A 1A5OC 3SCRA 3NDYA 4W8LA 2OZ0A 3AU6A 4HA0A 1CXHA 5D8WA 4L5ZA 3LSBA 2DSKA 4A22A 5C5YA 3CPUA 3LPFA 4P7NA 1K8XA 4NG3A 5TNVA 3KDNA 1XM3A 4KCWA 4IMFA 3F1QA 2XN2A 1WXZA 1OFQA 2VGBA 4MADA 4C1NA 1GOWA 5BMXA 3R13A 3ZR6A 3TVAA 1DJXA 2J7CA 3WDIA 3MHUA 3D3AA 3LGGA 1L6GA 5FF0A 4M19A 2BVTA 3PPCA 3BMWA 1OT2A 4FNUA 3JW7A 4ACZB 1S2TA 4Z0SA 4JHZA 5M03A 2UBPC 2GPTA 4O1FA 2P50A 2ZZ7A 3OQ8A 1A0EA 2OLHA 3EOEA 1L6WA 1UB3A 3MWAA 5TQLA 1OM0A 2G96A 3BGJA 5C9XA 4AD2A 4YNGA 3ARSA 3MUY1 5EA9A 3OGVA 2O4MA 2CXEA 1IEIA 1ECEA 4EVZA 4QDWA 5AC6A 1NQKA 3PNZA 1W3TA 3W1QA 2J4GA 1CGYA 3W26A 4XZBA 1YYAA 3U6WA 4CCDA 1KFEA 3GUWA 1Q8JA 4D6CA 3EDDA 3GU2A 3PG9A 5AC5A 1F05A 3LK6A 4I3GA 4LANA 2EPHA 1XYZA 4RUBA 3BGAA 3EZ4A 1QR7A 4I90A 5DMLA 4UQCA 4QS5A 4PMJA 1BVWA 3W7KA 2D0HA 4BY3A 1EX1A 1E5NA 1Q7QA 2VQTA 4PUUA 5CG0A 3WMLA 1F8IA 5BWFA 5D09A 2BHZA 2DJLA 3OPSA 1UA7A 2Q3OA 4L9YA 2NUXA 5DCEA 3CUJA 2NVDA 1IR2A 1R86A 2PDQA 2ZC8A 4KERA 4F8XA 1DWGM 5IDZA 4J5NA 1GEQA 3AFBA 1HP4A 3N2OA 3W7JA 4OV9A 1MZRA 3AHYA 1VHCA 2Z28A 4Q7NA 1F4AA 3GR4A 4YWSA 3W02A 2A3BA 3ATYA 4A3RA 3S83A 1KM3A 1VCGA 4M6PA 4PE8A 4AFYA 3O07A 3Q45A 4D6FA 3VOGA 3EDFA 3TR9A 2QJHA 1V4YA 3KS5A 3MP4A 1VFMA 1TVNA 5BU6A 3KOZA 3EXSA 4X0NA 1V6UA 3L9CA 3REQA 3N2BA 3LLXA 2EJAA 2AKMA 3CHFA 4JEJA 3UXLA 1QPQA 1FCBA 4FR1A 4FK9A 1WXJA 2ZA3A 1CGVA 1DJGA 1KR1A 3MVIA 2E67A 1PJ9A 4M6UA 1EWDA 9XIMA 4UIOA 3CV6A 4B3ZA 1HGWA 3AJ7A 1XGZA 3W72A 4UFMA 4ZO9A 5J5DA 3BLIA 4IJRA 2Y7EA 1IZKA 4QNEA 3E49A 4J35A 4DM1A 1K7EA 2JBMA 4XUYA 3S1GA 1H7XA 4UQ9A 4O52A 1H7RA 6PTDA 2YXOA 3B9DA 4GH1A 3WQDA 3QN3A 5G4WA 1E0VA 3M16A 4WXZA 2AKZA 3IVTA 5CC6A 1B3WA 3W1NA 2EPKX 1U22A 4Y6GA 5A1AA 4CNTA 7ODCA 4PEEA 3T0AA 2PWHA 3SFKA 5LIKX 1KM0A 4O0ZA 3DENA 1T41A 1S39A 4S3AA 1XLBA 3JS3A 3C52A 2DIJA 1FOBA 1Q6QA 1WXYA 4QG8A 2IUZA 4QM1A 3L0KA 5T26A 1AUSL 4NXKA 3SRHA 2Q3RA 4K36A 2TMDA 3M43A 1K9EA 3MMTA 3ZXWA 2D69A 1KC7A 3IIOA 3K8LA 2XH7A 3CT7A 3II1A 3P8JA 4UC5A 4NKCA 2GOUA 4Y8FA 4LPCA 1JAEA 3VPLA 2XGZA 2X7VA 1KXQA 3CHEA 1VLIA 4R88A 1LOQA 5D9NA 5BW6A 5I6SA 1Q5MA 4XAZA 2YDRA 1DYSA 2HDJA 3VGHA 4BQ5A 4GO8A 2G41A 4FHAA 2XM2A 3WL1A 2P8BA 3R10A 1R0MA 5FEZA 5REQB 4B9YA 3ITLA 2ISWA 4PMUA 4B5VA 2PWFA 4KRUA 3TNBA 4IPJA 4ZZ9A 3LENA 3O6YX 1C93A 1IV8A 1XLCA 3M64A 1SR9A 3A64A 1OFRA 2PU1A 1KXTA 3EOLA 3QBUA 2C13A 4DUVA 3EA2A 2FTWA 1XIDA 4H00A 1U83A 1XV8A 2JALA 1R5YA 4UCFA 1UW9A 1PZ0A 3QFEA 3P6LA 4UMBA 4WSHA 3V4BA 2OJPA 5EMUA 3DX5A 2VVNA 2HVNA 3SQSA 2OFJA 1QNOA 4J4KA 2WLZA 5EFDA 3QZEA 1W5PA 4EK7A 1PE1A 3EOSA 3LTSA 4CN4A 1HUVA 2WMIA 1SU5A 5DF0A 5BOEA 3PFMA 3EEGA 1NFGA 1R46A 1FRBA 1TRDA 3R43A 4L64A 4AEEA 1V8EA 3W07A 1BAGA 4FX7A 4CCCA 3OHMB 1CZ1A 3A4AA 3L7RA 4A3QA 1VBUA 3W74A 5LKYA 4Z08A 3CQKA 2DH3A 3PZVA 4E4UA 3NZPA 1HL8A 4FLSA 3RLUA 4U28A 2FDMA 1RUSA 3PTQA 2KX9A 2CKSA 3B06A 2OR2A 3UY7A 3UZYA 1RD6A 5H8UA 1BVZA 1F73A 3H7UA 4AWSA 2DW7A 4GYJA 4TV5A 1VZWA 3MO7A 2QW5A 1XRFA 5DMMA 3FYPA 1UBPC 4U3AA 1XGEA 2NSOA 3SUVA 2VC6A 1B90A 1BYCA 4C7DA 2OLSA 4UNLA 1UUOA 1CDGA 4DJDC 2VRQA 4PTXA 1BRLB 4PCTA 1MQRA 3SGUA 1VYRA 3DHDA 3P7YA 1XYAA 1ZQ5A 3WJXA 3GXTA 3IUIA 4R53A 4R34A 1MEIA 1ZB5A 5I00A 4JXCA 3WH8A 4ZO8A 1EDQA 2PF8A 4E2OA 4CEXC 5F2LA 3WIJA 3NO1A 2PDCA 2I1OA 4NJGA 4HPHA 3JVAA 3RR4A 4RKAA 4U2YA 5FJJA 4XQ6A 4HNTA 3N29A 5AECA 3PAJA 2INEA 2VYOA 1TQJA 2GWGA 3WUEA 3FA3A 4B9ZA 1YXDA 3EB4A 3R4IA 1RP8A 1H51A 3AXKA 2AGKA 2F2KA 2YCIX 1Q45A 3L12A 3EWCA 1P0KA 1VFUA 3PN8A 1A80A 3M0LA 4I8DA 2GJXA 3MPGA 1XBYA 3GFZA 5M5DA 2DIEA 1H7OA 3A23A 1Z42A 2YIHA 3VGEA 2RDTA 3RM9A 3WJYA 4MDPA 2Y8KA 1SSGA 3AIWA 4GC3A 5T8GA 4XD4A 1FWDC 2Y85A 1ODZA 3MW7A 3N3TA 4HN8A 1KBKA 3WD1A 4PSPA 4L1XA 1V3KA 3KLKA 3B04A 3EOOA 6REQB 1K3UA 1XLDA 1H49A 4MOZA 4AZCA 3VOIA 2ATSA 4QQ3A 1B9BA 3WQ4A 3BGGA 1OF6A 3ZR4A 2EPMX 3TQVA 2H3BA 3BDKA 5CAKA 3THDA 1MDRA 2AMGA 3BOXA 5D2VA 4GUJA 1G69A 3CC1A 2DUXA 1OGSA 4BQ4A 3LXBA 1KLYA 4IFKA 3U8GA 4XAGA 1GVOA 1W3NA 5I3HA 4UFLA 2WQPA 4CKQA 5BROA 3KL0A 2VJXA 4P7RA 4TVDA 4V33A 4B4FA 2DUAA 2YCJA 1ZP3A 3A22A 3SCWA 4CQ8A 1HO1A 4FMVA 3QW4B 4QJ3B 9RUBA 4D1IA 1TA3A 4FB7A 2BTMA 1M7OA 3SN0A 2AQWA 3THAA 1MMFA 3BCFA 1XQKA 1RV8A 3S2MA 1HN1A 2A3HA 4MY8A 1M5WA 3VIIA 1BEUA 2VX4A 1EC7A 3VGDA 1HKJA 2OU4A 3R8RA 5GNYA 2CNCA 3LUTA 5AC7A 4JEQA 1U1HA 4JPGA 1OD0A 4ATLA 4JN8A 2Z6JA 4UZUA 5B80A 2WMFA 4HIBA 1UP0A 4JQ4A 4B5SA 4EP8C 3WENA 4AXNA 3TAOA 1GKQA 1L2UA 2XGBA 3SGZA 3LCIA 4C7FA 5I06A 2XDFA 1YHTA 3ZVHA 1ISVA 4DJFC 1PIFA 1QPNA 3W83A 4PTMA 3W6LA 2CBIA 3AU2A 2D20A 4LVBA 3VD5A 5M3WA 1XHGA 3MHFA 1O66A 3SQLA 2YFOA 1Z44A 3SUSA 4IGMA 3AXHA 2QXWA 1RCQA 3PZUA 1FFQA 3XISA 3QKEA 4KETA 4O57A 1EUNA 1ZBVA 2BY3A 3A4XA 3T4CA 3UJRA 5HR7A 3KTCA 1SJBA 4WUIA 2PTZA 8A3HA 1FFRA 3SGGA 2NQZA 4PL1A 4EPKA 5H8PA 2Y8VA 3KXQA 4QEEA 5CZSA 2IQ0A 4YTUA 4H4IA 1W2PA 3PB0A 4H6QA 4P8VA 3NTYA 1P5BA 1LWJA 3N6QA 4AZGA 1XDJA 2E7FA 3GH7A 5DY2A 1KA9F 3SUWA 2VZVA 3LOTA 3KOYA 1GONA 1LG2A 4LGXA 4D9PA 3BVJA 1H4PA 2OO6A 4QHRA 4F0MA 2QIWA 3WFLA 2WJZA 2ZE3A 3G8EA 3B8UA 3T09A 4RZ6A 3CZLA 1U2YA 5FACA 2JEQA 5E70A 1JRCA 4H83A 3U0HA 1PYFA 2YDSA 1TVLA 4QFUA 1B5TA 1VFHA 1CIUA 1EP2A 2A3CA 1XYFA 1A5MC 2R14A 1R6WA 1JDCA 3QV9A 2PWUA 5KZDA 7XIMA 1JAKA 2XINA 2P0OA 4CUCA 3H7RA 4CD5A 2IW0A 2GGGA 3HOJA 1DJWA 4I9JA 1H7WA 3IIVA 3UWQA 1GORA 3VOHA 2Y8UA 4BCEA 3VE7A 4LWWA 3TYDA 5TF0A 1VPQA 4A8IA 4ICMA 5GJMA 3W7MA 3TTQA 3CAVA 5KZMA 3ZO9A 4YCPA 1K8CA 1UG6A 4FLOA 1OWQA 5LGXA 2RJGA 3PJWA 5AHLA 2DSUA 2X7WA 3XIMA 4PTWA 3VOFA 4KESA 1MSSA 1EL3A 3V3WA 3M0HA 1E0WA 3R12A 4E38A 4HN4A 4GH3A 1ZAJA 4DM2A 3M5ZA 3E6EA 1JUBA 1XCWA 3ARYA 1V0LA 4GGHA 3V36A 5I0DA 3JRKA 4J3UA 3WDHA 3WEOA 5A6BA 4M81A 2JIEA 3V5OA 3M44A 1UR4A 1TA3B 2PCQA 3HQOA 4DX3A 2WNWA 1Z41A 1M68A 2FJKA 2ONEA 2CKRA 2QUNA 2V0TA 2V68A 3LU2A 3CO4A 4XIAA 4Q8WA 3VIKA 2VR2A 2VGFA 3UGRA 2W91A 3TYCA 3AO0A 5CJMA 4AF0B 1Q6CA 1MO0A 3L5AA 3RG6A 2XTKA 3H2NA 4HHHA 1G9HA 2HK0A 3BG5A 3T44A 4L9XA 4KWUA 3BAKA 4HCDA 2EXOA 2QMKA 2XFYA 2WO5A 1Z8AA 2QS8A 3AHVA 1A3XA 4AY8A 3IEBA 1E9YB 3TLQA 1VRDA 3OG3A 3CGTA 4NL1A 1MW0A 1J6PA 3VKAA 4O11A 5CPOA 3ZMRA 3WBAA 1G6CA 1H60A 3CL7A 4UTKA 3ZJ7A 5BRQA 1WV2A 4Q6JA 2WANA 2PTXA 2WJFA 3GXFA 3QJAA 4UR7A 2JQXA 1W1TA 3LTYA 1FHUA 1JPKA 1ZU8A 3FOKA 1JNDA 4QP0A 2OQYA 4MZ8A 2EPLX 2QDEA 3FEMA 3GDTA 3W53A 1B3YA 3W85A 4AY7A 4N6EA 4QIUA 4W89A 4J3TA 5I3FA 1XD0A 3A6OA 1K8YA 3QZ6A 1UD2A 4X3ZA 3MI2A 5A6JA 2Z1KA 4KEMA 4EF8A 1QVBA 2XPKA 1IWBA 4OBSA 5CG7A 5HMDA 4ZSTA 1UD3A 1S5WA 2YX0A 4LEFA 5REQA 3BLEA 2G5WA 4G1NA 3P0XA 3OA3A 4X2RA 4QJ4B 2DZWA 1R9XA 4GQGA 1ZP4A 2VC5A 3ARXA 2WWDA 3AMCA 1EF2A 3G3DA 4PTDA 5GJNA 3KWSA 3N6JA 1XG3A 4WR3A 4NX5A 4Z2KA 1S38A 1I1WA 4MNJA 1PWMA 4IXXA 4NZFA 1QPOA 4GCXA 3A4JA 3GIYA 5A8PA 3MUIA 4LB3A 1H2JA 4QJ5B 7PTDA 1ICQA 3A3XA 4TX9A 1QPRA 4DJDD 5D2WA 4JCLA 3OW1A 4W9TA 4MTVA 1B3VA 3GRIA 5FF4A 2Q09A 4O4WA 4L80A 4IQDA 4GNJA 5K9DA 2MUCA 2HCVA 1E0UA 3AAMA 4DNMA 4MNLA 2DT3A 3BW4A 2PC4A 4NSBA 1P1XA 3CB3A 5FEXA 4NUWA 4NYUA 4U33A 4WSKA 3WJZA 2OT1A 4CGTA 2H90A 4F4RA 1F7BA 3V5FA 1LL4A 3DYMA 1MUMA 1GQJA 3M0ZA 1AJZA 5HULA 1GEHA 1HTIA 3MV01 2X09A 1JYWA 1W9BM 3PBUA 3A21A 3KVKA 2R1MA 3V75A 1AG1O 4S3KA 3EDKA 2IKGA 3HBLA 1BYDA 1EQPA 2QCNA 2VRJA 3Q58A 4Q32A 3MDWA 1FWWA 5LNSA 4IMEA 3SJ3A 2KZHA 1PHQA 2VENA 2W6RA 3VKCA 1EZWA 2XWDA 2X2GA 2POTA 2HISA 3I6TA 3B9EA 2VDHA 3A4WA 4HYWA 2EHHA 3T6CA 4JZ5A 5A8MA 1QOQA 4PUMA 1MWOA 2WV8A 3GG7A 3W84A 3WNNA 2PDNA 3WUGA 4US5A 2I9EA 5GQBA 3VD3A 1VPXA 2P5NA 4LEQA 7REQB 3IJ6A 1QBAA 1IT7A 1VB9A 3CQ0A 1AQFA 1QI0A 3AYTA 3P84A 5E0KA 5HQMA 5EB8A 4DVOA 3EX4A 2VWTA 3GTIA 3QV8A 1YBQB 4M6VA 1OZQA 4DJED 2J88A 3L2LA 3W7IA 2PTDA 1KRMA 2TYSA 3FGCB 1W3JA 1R30A 1KXHA 3BAWA 5JMUA 3W4RA 4DJDA 3W71A 3THQA 5A2CA 2OSWA 4QAWA 3WF3A 3ZT7A 4PODA 1EHAA 2UWFA 1TJ0A 3WLPA 3HO8A 3W9ZA 1SM9A 3FA4A 4RDVA 3PS7A 1M7XA 4HNLA 4Y9AA 4MFEA 3TN5A 1ZBKA 2PGRA 4LNYA 1WKEA 1S2VA 2NVAA 3FGCA 4NZ3A 5GVJA 1QO2A 3BLKA 1B54A 4JTQA 4LS0A 3VM5A 1KFLA 1F61A 1IXPA 2FLIA 1ADOA 3NEVA 1ZAIA 2YZ5A 2RKXA 2EF9A 3STEA 5D05A 4IHCA 5CEWA 3FCPA 4JIEA 2D73A 4OQVA 3VIJA 1BWLA 1W3LA 3C2RA 3ERPA 1HO4A 3AIQA 3DFPA 3F5JA 3S42A 4MPQA 3S6TA 4NZJA 3ZLHA 1ZSXA 1K1DA 1VBJA 2RAGA 3FX4A 4W86A 2P0IA 3GR7A 1L6YA 1ISWA 2RDUA 4OOUA 3H2AA 3V1PA 3U57A 3UD6A 1PDZA 1Y5WA 4LUSA 4P7QA 2E9BA 4FO4A 1D7KA 1CT5A 3HU7A 3QGKC 1SPQA 3IWPA 3H24A 4QITA 3IIXA 4YL2A 1KW1A 5BXSA 1KKRA 3W25A 4DQWA 1Q6FA 2E09A 1ENUA 5BU9A 4IPPA 4P61A 1KM1A 1E0XA 4MJ4A 1VFFA 5K4ZA 3G2GA 3WMSA 1XYMA 3B9NA 3U4AA 4WSJA 1J01A 3HQPA 1H09A 3B97A 4IF2A 1HW6A 3W37A 3ZVIA 2J75A 5A6LA 1IEXA 1KFCA 4ZB2A 3LDVA 3M46A 2PGEA 5BXRA 4FNQA 3E2VA 5ABHA 1GVYA 1WE5A 1JULA 2NQHA 2NX3A 3AHZA 4KIRA 4CVWA 1S1RA 4PH6A 4RPPA 3UYIA 2PWEA 3S2CA 2ZX9A 3BK0A 1X96A 1Z9AA 1BKHA 4GVHA 3PUOA 4F0HA 3SCQA 4KFNA 2Z1XA 3W2NA 3ZVHB 4UTFA 2Z7KA 2ATMA 2ZX8A 5G1TA 1LQ2A 3B0XA 3HG3A 2OKOA 3ZYZA 4LSBA 5DMYA 2J78A 1T7LA 4JX4A 2PLMA 3O3RA 4Q4RA 5AYBA 1DJZA 4MB1A 1NJJA 6CGTA 1V3LA 4GUIA 3UWZA 1E9ZB 2DVTA 6ENLA 3DKLA 4M5PA 1GK8A 3U2OA 2BY2A 2GLKA 3BL3A 5BOFA 2V81A 3FXYA 4BI5A 3GNXA 3V0SA 4HHLA 3TV8A 2CIPA 4LH8A 3WNOA 3P93A 2C91A 5KINA 3BSGA 1XBXA 3PSVA 3GXPA 3BAXA 4HP5A 5XIMA 1HIZA 2ISFA 2FH6A 3VILA 1ZBWA 1UR9A 3NM3A 1OD8A 3BXWA 4F0LA 3M5XA 2V82A 4AX7A 3SY1A 3K46A 2OYKA 4A3HA 1VFLA 2E6FA 1OB0A 1BQCA 1CENA 3H26A 1M01A 3URQA 2ESCA 4XAFA 3WLLA 2VELA 3ZT6A 1IGSA 1E3ZA 5F2IA 1OC5A 4V1XA 1AW5A 2WVUA 2FH8A 5DRIA 1I6NA 1C9DA 2BGQA 4OKDA 3IJ9A 2PMQA 2XN0A 3C0SA 2ALRA 3IK2A 5E6YA 1FHLA 1FDJA 4ZOAA 3NZ1A 2XH0A 3ITXA 2DZXA 3CUFA 3GVRA 3MCMA 4R7JA 3EAUA 2KAUC 1BG9A 1BLIA 2AAMA 3B0YA 2E5DA 3REQB 1HKKA 4NZ1A 2J77A 1TSIA 4XISA 4LXFA 3TCSA 2CLMA 4NASA 2D3LA 1TTQA 1XBVA 4H2CA 2YDAA 3EBVA 1S5MA 4ILSA 1LROA 1KD0A 3STPA 2JKPA 1B31A 3KTSA 2VOMA 3DKJA 1RBOB 3GTXA 4AD4A 1CI1A 1GPFA 3VKDA 2OZ8A 1E1EA 1OGBA 2YPIA 3TK7A 2ZA2A 1WCGA 3B8TA 3WFZA 1YKWA 3KAOA 5EU9A 3Q65A 4U10A 4MMWA 3THCA 1EEXA 1E4IA 5LIYX 3JZEA 2WMHA 4K8EA 3I3EA 4QDMA 3GNRA 4AY1A 3TCEA 3MDUA 1LBLA 1R3YA 4ML9A 4MAZA 4BF7A 4RNIA 4LU0A 4DJEA 2Y5SA 2AOSA 5HBFA 1LG1A 2WPBA 5JIWA 2BHYA 1UR3M 4HJWA 5ABFB 3N2TA 3EYPA 1GW1A 4MVAA 4TX6A 1L0PA 3NQ8A 1CYGA 3KBJA 3NQMA 1IR1A 4HZMA 2Y6ZA 1JCXA 3SFWA 1XKJA 4A8RA 5C2GA 3QGVA 4F66A 3EWZA 1Q66A 4O1CA 2ZVIA 4W8BA 2J7DA 1YLVA 1TIMA 4GINA 3EX6A 4X2PA 1FA2A 4ZOBA 2X1RA 1YTKA 3CWOX 3QFWA 1XPGA 4C7GA 5ABFA 1CECA 1M7JA 3WF4A 1ZGDA 3SUUA 3ZQ9A 3EDJA 1YADA 4AH7A 1UJQA 3RRXA 4AG0A 2GDQA 4AHQA 4LYQA 3MCOA 4Y96A 3HGJA 1QW7A 5FJIA 1O94A 2PI6A 2QPUA 2YR1A 4U31A 4PUEA 1UR8A 4FOUA 4FI4A 2IMRA 2WOQA 1UWRA 1A47A 1Q8AA 2HTMA 3M1ZA 3T05A 1LQAA 3A5FA 3AMKA 2G97A 5LXEA 1F9CA 1FKXA 4J3VA 2XM1A 3GK0A 3UW6A 3HPAA 3BTNA 4BWLA 4KIEA 1RQBA 3ZSTA 3RLGA 3QKZA 4F9JA 1S5VA 2QCMA 1ICSA 3FEQA 1O5QA 4IOTA 1K9DA 2VDGA 2HS6A 5HWJA 2PTWA 1ZPTA 2ZKMX 4UFHA 3VNZA 2QDGA 5JBFA 1U30A 3TA9A 3F4WA 3SB0A 4CNSA 2JGQA 4N9DA 3N3MA 1CB2A 1V0MA 4LVFA 4GVIA 5C6MA 1XFCA 3K5XA 3OGRA 2Y5EA 2P53A 4O19A 1HP5A 4WOZA 4MKVA 1K6WA 1VAHA 1X1ZA 2WVVB 4Q8NA 3BLFA 2DVXA 1MQPA 5FESA 3L67A 3O0FA 3CQIA 2VX5A 3T08A 2VFFA 4AMAA 3OBAA 2J7BA 2QDHA 1NP0A 4Q8VA 2YW3A 1E40A 3AYSA 4PB5A 3VGFA 1PKLA 1EYWA 4RDZA 3MJMA 2QV5A 5E0CA 3H2OA 5MKGA 3ITVA 1GQLA 3P60A 4JX5A 3R8GA 2AAAA 1DQWA 4E4FA 4ALDA 2PLKA 3P74A 1J0ZA 3PTDA 4GFSA 2GJXB 5RUBA 3LCHA 1XYLA 3L4TA 3SW6A 2J66A 2DT0A 3PZIA 1GQKA 3BAYA 1AD4A 4C91A 4GRSA 2YSWA 4DF0A 1R3VA 1XW8A 4L6HA 3S1XA 4IG2A 2E8YA 4G7EA 3FK4A 5D37A 4BQ3A 1PX8A 4EX4A 1SZGA 3D47A 6TIMA 5GNZA 1W56A 1JZ3A 4FLQA 2ACUA 4PBEA 1ITCA 3RU8X 2IPWA 3WQ5A 1PEZA 5JQ9A 2A5HA 1XLAA 3EMQA 3NGJA 1UP2A 4GJ1A 3QR3A 1V02A 1KCXA 3VE9A 1FWAC 2DDXA 4MGGA 1BTMA 1FCQA 4HK5A 1V3HA 4FLRA 3GNNA 4IG2B 2NQJA 3USZA 1O1HA 5F4WA 2X0SA 4DUXA 1JCNA 5DCBA 4X60A 2WSQA 3MA8A 4JFTA 2DZUA 4HT3A 3WYZA 3EX2A 1THFD 2HXTA 4WY0F 3OIXA 3SRKA 3BC9A 3INPA 5J5RA 4Z2GA 5D2TA 3W7EA 2Q02A 3E2RA 5E9XA 5A6KA 1RJPA 4GX9A 3GS6A 2X0HA 2DV0A 1Q6LA 2A4AA 4Q3MA 1JG9A 1F3XA 3GE7A 2HBXA 1QNRA 2DT2A 1K8ZA 1K03A 2J13A 3GW3A 4QGCA 1GOIA 1UUMA 2ZZ2A 3WMCA 2VR5A 5BRPA 1AD1A 1EJSC 1H0GA 4AYSA 3S6DA 4IT1A 4I9TA 4IGHA 1HFBA 1JVNA 5C2CA 1RJRA 2V63A 3HN3A 1E9LA 4FA3A 1LF1A 1B3OA 4XZWA 3AOFA 5I02A 1DXEA 4JAWA 1SFSA 2VHLA 4D6EA 4DXXA 3O6CA 3KZSA 3NXFA 2C6QA 1LM1A 2GVLA 4C65A 3AICA 2FGBA 4ML4A 3CIWA 4GIEA 1VYPX 1H1NA 1Q2RA 1X6NA 3WLQA 2PODA 2HS8A 1DPMA 2DZAA 3AZSA 3T2PA 3DGRA 4UOZA 4TIMA 2YB1A 1TIWA 3QW3A 2BXZA 2A3LA 4J3XA 1QRQA 3MT1A 1O95A 4W7WA 2O56A 3WZ0E 2FYMA 5DLCA 4AZ6A 1BXBA 3DN5A 1ZHAA 3UA4A 1V3IA 1WOBA 4JGDA 3BSHA 3IJ8A 2V67A 3UA3A 3PUEA 1GHRA 4MY1A 4M82A 4RNHA 3BCJA 4HVXA 5FL0A 5D30A 2BOEX 3QY7A 1NIUA 1TV7A 4DBDA 3M6YA 2GGJA 4MLJA 1UWUA 4GQRA 4IMCA 3ZWTA 1IT0A 2OGJA 3AIUA 4Z1CA 3KBSA 4IIDA 2YL8A 2C1IA 1UMYA 1PX3A 3VCCA 2CLPA 3PBYA 2Z1VA 2VEKA 3DHFA 2I17A 1OFPA 2CITA 3F4VA 4K37A 2XZ7A 1TRIA 3LV5A 1GKRA 3FLUA 3UXIA 5FSEC 2VVSA 2RHGA 4GC4A 2OSYA 3OO2A 5HPCA 2YZRA 4QAIA 3CB8A 3C2FA 1A49A 4LAUA 3N11A 1JZ6A 2I5QA 3S0CA 3GHTA 3WCZA 1C7TA 2BFGA 1OIFA 4NZCA 5HMEA 1NM9A 1WAUA 4XKMA 3NO5A 4IL0A 1TV2A 2PS2A 2Q71A 1D7FA 3UR2A 4WKFA 3L68A 2BODX 4G7FA 1T40A 1XPYA 1BWKA 5CPTA 1XINA 4Y2WA 3OHIA 4PUWA 1OY0A 4DUOA 3CWHA 3EXTA 1XLGA 4US5D 2JGYA 3BV4A 3M0MA 1AW2A 1UR1A 3UGVA 3VNJA 4LV9A 4S39A 3S2JA 4JTEA 4INFA 3OOQA 4EPDC 3FVMA 1SZRA 1GJUA 1VJIA 2WBGA 4LCQA 1BRLA 5IDIA 3OVPA 4AD5A 2DZSA 4WY0A 2GDUA 2NQ5A 1PL9A 1A5BA 4H19A 3WLOA 1UR2A 1VFSA 3S8HA 4PRWA 4FX6M 1OC6A 1RBAA 1TWZA 1UD8A 4LF1A 2PSNA 3BICA 3PG8A 4HK6A 3DU0A 3ANYA 4RE2A 1H5YA 3W38A 2WLYA 1O68A 1R85A 4H8HA 3T07A 1UKTA 1VFOA 1J93A 5CSUA 3G1SA 1QI3A 2O55A 3OQEA 3ZOAA 4IIHA 3DFSA 1FH9A 2PURA 1AH3A 1XLLA 4BS0A 1LP6A 1SO5A 5K7JA 3CZGA 2DZBA 3H7VA 6XIAA 3PC0A 4IPIA 3VZYA 3VCNA 4MWAE 4H9MA 3TMLA 1QFEA 1RD5A 4ZTYA 1FCUA 1SGJA 4O53A 3B4YA 4A3UA 2G0WA 4PUKA 4HSHA 3TTYA 4IM4A 2V2DA 3LV6A 1R2RA 2XH2A 1RY0A 1HT6A 1EJVC 2Z1SA 3BWWA 4ZQCA 3ITYA 4B91A 2GGEA 5CGQA 1L8NA 2V3DA 4KWOA 4JQ1A 2G3NA 5L6UA 2WZTA 3CHVA 2ZTKA 4D2JA 1G0CA 4UTIA 3I6EA 1TX2A 3WD0A 1Q7MA 3WQPA 2HK1A 4ZQMA 3W81A 3O8AA 1K77A 4PUJA 3OJGA 4YXGA 4ROQA 4P7OA 2TRSA 3H21A 3BO9A 4E2BA 2WMGA 3IVUA 4PA8A 3RF9A 2ZUMA 1EO5A 2GSHA 4WLCA 2HQAA 3U2EA 1S3TC 3P62A 1JNEA 2I9UA 3LGEA 4O28A 4J2MA 1KFJA 3NSNA 4S3GA 2GWNA 2WJDA 1EJWC 4LUSB 5HK4A 2GVJA 1HL9A 5FSDC 4Y9OA 3TC3A 3U7VA 5LIXX 1S2CA 3R89A 2ZXAA 3K4DA 5GJPA 2QPSA 3EWYA 2QCCA 1AA1B 2GGHA 2CESA 1IZJA 8RUCA 3HTWA 4PFMA 4I7UA 2PFHA 1ITUA 3B0VC 5DEZA 3B0UX 2XSAA 1E51A 4MNMA 2QCHA 4IPLA 1U1UA 4H6KA 5DXXA 1TCMA 1PCKA 3M9YA 2ZFAA 1TWDA 1PXGA 1J0JA 3GX9A 1J0KA 1ITQA 2BVWA 3N2XA 1OEPA 3M0VA 3M4HA 2CWXA 3SSJA 1EIBA 3WJSA 3CASA 3OZPA 4UQDA 3M7WA 3GW0A 1R3SA 1KLZA 5LA0A 4S23A 4HMCA 1EPXA 1ZNNA 5LNRA 4U4MA 1TV5A 1VIZA 1JDAA 4JTUA 2NV1A 4HZ8A 4WDXA 5C2XA 1K7XA 2P10A 1XRVA 3UZXA 1EO7A 4XZLX 3B40A 1L6SA 3PULA 1P6CA 3LHVA 3TSBA 3PWAA 4ERAA 2EG6A 4Q8MA 3VFCA 3KVJA 4EE9A 1P6BA 1REQB 2QGHA 1TE1A 3NYZA 3AQUA 3QPZA 5I5RA 2FVLA 1B4EA 1PZ3A 3MUCA 2JKAA 3FJLA 4LVGA 3TX9A 3FIGA 2DSWA 3IIZA 3MHGA 5PTDA 5CC3A 1TZZA 3TJIA 1GNXA 1CCWB 2VGGA 2ALDA 3AIEA 3QY6A 1M7PA 5B7YA 3QH2A 2ZX7A 1FWTA 1AJ2A 2ZTJA 2JIWA 5IFPA 4KQNA 4GE8A 1HL2A 2CLLA 4ZEPA 1ESWA 3MP3A 3L4UA 1UWSA 3QHOA 2D0GA 3SURA 4CD6A 3NQVA 4W7UA 5GPRA 3U48A 1GZGA 3LMZA 3AXIA 1FY6A 1ISYA 2VL4A 3WSUA 2EEXA 1ZJHA 5FJUA 1P0EA 4LALA 3HG5A 1C92A 1KGWA 4C6QA 1W9VA 2I5GA 3B0PA 3AUOA 1ZZMA 2DJXA 2WB5A 2OX1A 3TEVA 3APTA 1SO6A 3M41A 1PKNA 4N9CA 2ZRWA 1G01A 4GFIA 2IKJA 1YNYA 3S5SA 3SECA 2D1ZA 3QRHA 1GTHA 1HX0A 2D22A 2C8NA 2NX9A 1RP9A 2J74A 1R3WA 3C2EA 3KP0A 3ZFHA 3AI0A 4J7RA 2CU0A 4BKNA 1DHKA 2B31A 2J8GA 4C5ZA 2XZ9A 2NXGA 2R94A 3NL5A 2WC7A 4Y9NA 1O5RA 5A8OA 2AL2B 3N9SA 2HPIA 1QNPA 4HHMA 1N82A 4JTAA 1TYGA 3UPWA 1O60A 2AMXA 3GVQA 1C29A 3VIHA 3DFOA 1IWPA 1TJPA 1OINA 1KRCC 2WNQA 7REQA 4EXAA 1AQ0A 5C9RA 4DO4A 3GVWA 2O9RA 1JI1A 4YVVA 1DIEA 3MKCA 1W1VA 4KF1A 3N6HA 4AUBA 1HGYA 3I65A 2GUUA 3MKKA 1P0NA 2GOKA 2W66A 4ZGYA 3I6RA 2FTYA 3WBEA 2CLFA 4RXGA 5A8NA 4DIAA 4YCOA 4LC8A 1EGZA 1MUCA 3F4CA 1YE6A 1IGWA 1LOSA 1DIKA 1JDDA 2VP8A 4EIVA 4GY7A 2Y70A 4K38A 4GO9A 4QTGA 5LNWA 3AHTA 1JPHA 2QUTA 3BW2A 3BOLA 1VPYA 2RGLA 2UZ9A 2VCBA 1C9WA 2QVHA 1H61A 4OJYA 3VNLA 1VKFA 2VEIA 1HF6A 3UNTA 4PN2A 2XIIA 5HOSA 3NG3A 1UHVA 5CSYA 1A53A 1FWIC 4Y7EA 2OYLA 3VU2A 1GYMA 3WLSA 3URAA 5I3DA 4OT7A 1UASA 1MEHA 3SY5A 2VM8A 1CBGA 3G0UA 5K2ZA 1UROA 1W5OA 3N4EA 3OYXA 1JI2A 5DELA 3PPFA 2NQLA 1FH7A 3URNA 3H2FA 3A3HA 3AMGA 1H50A 1TTPA 2XIQA 3EOUA 1E6PA 2PRHA 3P2VA 2VURA 4JHOA 2V38A 4AWEA 3TAKA 4DNHA 2GJNA 3LG3A 1J6OA 1R2TA 3M0JA 2BOFX 5I3KA 2OYMA 4NZ4A 1T6MA 5FJPA 3LBOA 3TR2A 3ITOA 4L4MA 4HZ6A 3S4TA 3UWWA 3T42A 4S3FA 4BK9A 4WJEA 3RLHA 3VM7A 2NWRA 3SIZA 3NAVA 3NVTA 1TVPA 5G1YA 1EF3A 5F2MA 4MKNA 3GU9A 3CAQA 4LBRA 2PRLA 1R3QA 4LRTA 2PF0A 1AQMA 1T8QA 3E12A 4IX0A 5D04C 4I9MA 2G37A 2G4FA 2WSYA 3LNPA 1PZ1A 3N12A 3GH5A 1DJQA 2VZSA 1R87A 4IXHA 4WGXA 3LI1A 3IJLA 1QO5A 4CCZA 2QUUA 4XTIA 4YS1A 2QCLA 1QBBA 4F2TA 2YLAA 3ARTA 3M0KA 3QQWA 2OODA 5T91A 3FYYA 2W61A 2CPUA 2O4QA 1U5JA 3PNUA 1CW2A 2ZZ5A 4K1WA 1XSIA 5HNNA 3VYLA 5CH9A 1KBIA 1XQLA 3O05A 2F84A 1Q6EA 2A0NA 3QQ0A 3TQPA 2ZUVA 1GVRA 4EF9A 2BHUA 2HSAA 2YLLA 3GIPA 3TYAA 4JQ2A 2QAPA 1P4CA 3I7QA 1TZ9A 4O4VA 3GUGA 1V7AA 4XZHA 1FKWA 5C7HA 4PMYA 2J9YA 4AHOA 1DV7A 3VINA 1SJDA 1AL7A 3V18A 5K9CA 4M0XA 4XSLA 1BSLA 1H7PA 3WL0A 1T5AA 4HCHA 4FP1A 1OZMA 2WMJA 3CUIA 4IGSA 2GFTA 1J18A 1RLCL 1PTGA 1W32A 2EG8A 2OWXA 2V2HA 3A12A 4FF7A 4M7TA 2IQDA 4HA4A 2ASHA 2VT0A 4AZHA 3VTRA 3RM8A 5KETA 1V03A 2A3AA 2QKFA 1CX9A 3K1DA 3ITCA 3N2MA 4YVXA 4Q4QA 5AHFA 3W7GA 3RCYA 5EYWA 3OLGA 1UOZA 3G1HA 3GDMA 2XUCA 4ATDA 1KV8A 2Y7FA 3AROA 2VFDA 3SCTA 3GY1A 4O0QA 4D8LA 3BZJA 4B5NA 3TXVA 3W29A 4PBFA 3P61A 4C6CA 4OV4A 1VEMA 3MVTA 3SRDA 2EGZA 3GHRA 4HZ7A 3NPUA 2E1DA 1D3GA 2XYLA 1X6LA 3T55A 1C8VA 4NNCA 4WDWA 1J10A 1J5TA 3W01A 2PRMA 3UESA 1VQTA 2WC4A 4LAMA 1KM5A 4KRTA 1FWCC 5A2AA 1NWUA 1J0YA 1B30A 2W62A 4KKXA 2YXXA 2XHYA 2QUMA 4IIFA 3TZNA 4E8CA 3BZGA 1PUDA 4JICA 3TWAA 1DIOA 1DOSA 3EKGA 3H4GA 4V1YA 1FWHC 8XIAA 4D1JA 3SAZA 1KCLA 2H9AB 1MEWA 3UCDA 3PF3A 1Y8BA 1AMKA 3V1HA 3T2OA 3DG7A 1OFOA 4UB9A 1YXCA 1I2OA 1MYRA 3RM4A 3IVSA 2DZVA 4RV8A 1V7YA 4MZ1A 1XJBA 5C9WA 3UG8A 1R3RA 1M65A 4IPNB 4BA0A 1QU4A 4L1WA 3HV8A 1C8QA 3FAWA 3MI3A 4Z2HA 4XD6A 1IWAA 4PUNA 4R9XA 7CGTA 2NUYA 4O0KA 1UOKA 3G6MA 2QJMA 3VC5A 2REQB 3M6DA 3KW3A 3AIRA 3W2MA 3I10A 1Q3NA 1S2UA 4M56A 5HAOA 5DCDA 4CQBA 2PAJA 3OZOA 2WMIB 4QG9A 4HTYA 2QR6A 4MUPA 2GK1B 3RDKA 1XUUA 3LNMA 4Q7BA 2Y62A 3USBA 5C71A 1OFEA 4JIHA 3RPDA 1IYXA 3AMLA 4PBGA 1EIXA 4DEFA 5HNUA 2EKGA 5H91A 4GABA 1DVJA 1GOKA 4QISA 1OK4A 3GAKA 3PJUA 1DJHA 4XKYB 4AU0A 3P5YA 5A8GA 1OYAA 4CEUC 3GC5A 4Z2IA 1DWJM 4G5DA 4JY8A 4V15A 3H55A 2ZADA 3RPTA 3NZQA 3RU6A 1XDLA 1UC4A 1EDGA 3G5EA 4C1NB 4DZAA 1JQVA 1K7FA 3MZNA 1EBHA 4GZJA 3EGJA 4GWEA 4JL2A 2WNZA 3NIYA 1EH9A 5HATA 1KM4A 3DC8A 4O17A 2XVNA 3EDEA 1JZ5A 1OQFA 3LB0A 4QCFA 2YBVA 4J2PA 4JTDA 3OTRA 4OZOA 3GSMA 2VFEA 5I03A 1TB3A 3FDKA 2YYTA 3W82A 5H2ZA 3R79A 3MB9A 4F9DA 4LQ1A 2HXUA 2OOGA 1VCFA 3CAKA 4Z1BA 3LPPA 3GO2A 2E68A 3CL8A 1CGWA 3L4VA 1TUXA 4G7EB 5G5IA 4L4OA 1TELA 2AGTA 3G1RA 3RX3A 4ZVJA 1YDNA 4FEZA 1R7AA 1MFUA 1XKYA 3W86A 3SZ8A 5DY3A 3UERA 4ZXLA 2ZX6A 2E77A 1A5KC 2FFIA 4BF5A 5C7VA 3CMGA 4DAFA 4MG4A 4K7YA 3MU7A 1JZ7A 2WCGA 1SMAA 1TR9A 2PD9A 2MANA 3VI2A 2EJ1A 2FKPA 1XRTA 1RXOB 1F2JA 4H9YA 1TKKA 3HPSA 2E5CA 2Z27A 1KKOA 4HU0A 2IPFA 1T8XA 4LT9A 5BOOA 3W7QA 4AMCA 3VIOA 3ABOA 4IZGA 1JR1A 2FZ8A 4O12A 2PPGA 3G1FA 2QV4A 4XBJA 2QCDA 3WG6A 4J1OA 3R2GA 2X0YA 4X9SA 2RH9A 2VEPA 1TZ7A 3N15A 4QEHA 3A47A 4D6HA 2WCAA 4GG9A 1GOXA 5BCAA 1JFHA 5I24A 2WHLA 3O1NA 3GKAA 4S3BA 1ADSA 1HJVA 3WLRA 4DY1A 3SCSA 4N02A 1YTEA 4GISA 1V51A 4REQA 3HG2A 4TUFA 2PDYA 4HSNA 4HNUA 2OX4A 4A8NA 2YW4A 3CZ8A 4J3WA 4IMGA 5KZEA 1E4LA 1LL7A 4CNOA 2FFCA 4CQ9A 1X7FA 3TN4A 5FA5A 3ABRA 1YX1A 1SZEA 3DFNA 3J7HA 3NOEA 1AODA 1J12A 3QHMA 3GTNA 3KCOA 2OMAA 3NEHA 2FVMA 4Q4OA 3WY1A 3WQVA 4RZBA 3NPWA 4CN6A 1LORA 4C6OA 1MNSA 3B8WA 3WK0A 3KBMA 1J5SA 3O6DA 5KMYA 2VZOA 4BEUA 1OFAA 2ZBTA 1XR2A 3WD2A 3SBFA 4CLMA 3EMCA 2C14A 2JK2A 1NQ6A 4PCSA 2R91A 3RO6A 4B2DD 3TOPA 3WLJA 1E43A 3M47A 4HOZA 1OX5A 1KFKA 4NJHA 3K8KA 1KBBA 4CD8A 3UYCA 1M1BA 5U7SA 2Y89A 5FJOA 4TTUA 3DERA 1QMLA 3MV11 1YRRA 4IFKB 3C2OA 3LQLA 1US0A 2B7OA 3CUZA 4KGJA 2C3ZA 1B4KA 3AXXA 2CBJA 1GT8A 2QNEA 1XIEA 3GDRA 3NDOA 3RPMA 4MYXA 3G1DA 4TO8A 1AZ1A 3LCGA 1NH6A 4M1RA 2OWWA 4GBDA 4FALA 4EWND 2YL9A 5A8QA 4LS2A 5CPQA 3LHWA 4KPLA 3T7VA 3SCVA 1FXQA 3TIMA 3IV3A 3WNMA 5HDRA 4U2ZA 3AS3A 5ENLA 1EGMA 3H6OA 4DJEC 1J2WA 3C0JA 3M7SA 3BOFA 1AW1A 1KQYA 4A35A 4FF5A 2QULA 1G4TA 5JBEA 4GHRA 3DFQA 2Y1HA 2G4JA 4JR5A 2EKCA 4BFAA 4Z1YA 4RNFA 4NX0A 4LUJA 1NWTA 3WQGA 5FAJA 1W9PA 4H41A 4DZHA 5BYWA 2VEMA 3LXAA 4B4HA 4O1AA 1J96A 3P8IA 1D3CA 3FXGA 3AS2A 2H3DA 3W7DA 5CLWA 1Z3NA 3POCA 1BHGA 2JFEX 2ABBA 1EEPA 4YPJA 5AHNA 1TR1A 2D24A 2BGSA 3TFCA 1WDQA 2GJPA 1EP3A 1R9YA 1N8IA 1Q6OA 3FW6A 5AYXA 8CGTA 4GI9A 2OEJA 1RZMA 1QNQA 4E3VA 3QYSA 1RK5A 1LRQA 4I6VA 4PUDA 1W9XA 4MYAA 5H8MA 1WDPA 3R11A 3GIQA 1ZBCA 3IAPA 3F2BA 1MW3A 3UF9A 3VA8A 1KB3A 1DWAM 2J9XA 2UY2A 3T1GA 3MBFA 4DJFD 3GU1A 5L9FA 4UMCA 2ON3A 3I7SA 1F6KA 1GTEA 3KOFA 1FP8A 1GOOA 3AIVA 1XIMA 2ACQA 4XZ9A 2Y0FA 4XBSA 2QAFA 3CUHA 2DY3A 4GIRA 1O4UA 1XLMA 1E6ZA 5AZ0A 5C9UA 4MWAD 3NQAA 2D3NA 3B4UA 4A21A 1M3UA 3IRDA 3UG4A 4FX8A 4D6JA 3CL6A 3WQWA 3MUXA 4TVUA 4ZQNA 5KTLA 2L5HA 2GSEA 3VZXA 3WJWA 2FHBA 4QDPA 1IXNA 4UTJA 3NL3A 5DQPA 4Y9PA 5I2UA 3UJSA 1JZ8A 2W3ZA 2W0UA 1XC6A 2EPOA 4JKMA 3LTPA 3L5MA 2XN1A 2DU2A 1TPWA 1NFPA 2VEGA 3WBWA 5CJNA 3SCNA 2WW5A 4PFHA 4L6OA 5JUVA 4JFUA 3ZR5A 6TAAA 4MSSA 4GNKB 3W27A 9CGTA 4ZOCA 4AB4A 2OWCA 1QAPA 2J9ZA 3DDMA 3UPBA 1QW8A 4DZ5A 5AZ1A 1KR0A 3IUDA 4LCRA 4MWAB 2DGAA 4JTCA 3KRZA 2CZ5A 3FHAA 3LM3A 3EWDA 2V3EA 4LY4A 2J62A 4HMNA 5CLTA 2YKKA 1DE5A 2P1FA 2WC3A 2UY5A 3A9BA 3CLMA 1FWBC 2GVGA 4GZIA 2PWVA 1LL6A 4AD0A 3V0TA 3LMYA 4EXQA 3CHCA 3LA4A 1SMDA 1G4PA 1ISXA 1W1PA 4G56A 3WFAA 1LBMA 3ARWA 3M0XA 4H8VA 4NVTA 2OZ3A 4UNIA 4XB3A 4QNWA 1VC4A 1K6AA 3RX2A 1HJXA 4G2DA 2BY1A 3UVIA 4CD4A 3AUJA 1OYBA 4UFJA 3NQ7A 1JXKA 1GYNA 1DEDA 3WNLA 1GOMA 5LYRA 2PLJA 2C16A 2YDQA 4DXKA 1TPFA 4CNUA 1ZENA 3TMQA 5FJRA 3RJXA 5A5WA 4JFSA 4DI8A 2REQA 3T0CA 3NZGA 3IJIA 4GY0A 1UKPA 1G7VA 4BWLC 4WJXA 2G8ZA 3UXKA 3TA6A 4KRZA 3B8IA 3ISIX 2O0TA 3GFYA 3I3DA 3JR2A 3R0UA 3LCWA 1TUFA 4TVCA 1X1OA 3RO8A 4LAOA 1TCDA 4S3DA 1WDDA 3L21A 4GUFA 5C0QA 1UR0A 4YTQA 1LOLA 3F5LA 3GKFA 3WK1A 4KH2A 3NDZA 1FDZA 3QLDA 5DFAA 2W92A 4PB3A 4DPPA 3CU2A 4W4QA 4AEFA 4M29A 4I7WA 1LLOA 4AVNA 4LUYA 3WQCA 2ZRUA 2OQLA 4AXKA 1X6UA