4PTDA

Phosphatidylinositol-specific phospholipase c mutant d274n
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
296
Chain Sequence
b'ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQNYINEKWSPLLYQEVIRANKSLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 105
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4ptdA00
4F2UA 4I90A 1O1ZA 4RW5A 1DJIA 2FJUB 3I10A 2PZ0A 3NO3A 4I8YA 4QJ4B 3OHMB 4S3GA 3EA1A 4PTDA 4QJ3B 1DJHA 1V8EA 1QATA 1PTDA 3QVQA 2PLCA 4R7OA 7PTDA 5T9BG 4OECA 5T91A 3CH0A 1AODA 5T9CE 1YDYA 2P76A 4I9JA 3H4XA 1XX1A 3H4WA 4GNKB 2O55A 1DJWA 1DJZA 3MZ2A 1ZCCA 4RW3A 4I9MA 3V18A 2OR2A 2ISDA 1PTGA 3RLGA 1T6MA 3QR1A 4F2TA 2OOGA 1T8QA 3PTDA 4Q6XA 3V16A 4F2BA 1GYMA 5PTDA 3KS5A 4QJ5B 3QR0A 3EA3A 3L12A 4RV3A 2ZKMX 2OTDA 2F9RA 3EA2A 3V1HA 3RLHA 1VD6A 1DJXA 3KS6A 1DJYA 1DJGA 6PTDA 2PTDA 1QASA 4I9TA
chains in the Genus database with same CATH superfamily
4GQGA 1UIOA 2GPTA 3C0LA 3S9YA 1OYCA 5CBBA 3BGGA 4GXMA 1CGWA 3AS1A 2ZUWA 1KGXA 4AWSA 3ZJ6A 1XLHA 2X2YA 1DKWA 3CZLA 4E8DA 5F2LA 4ONVA 4ZODA 2XJ7A 3SCNA 5AN7A 1XGDA 1HL8A 1DTNA 4IIFA 2XIIA 9XIMA 1UWAA 4DQWA 1FWJC 4HYVA 2PD5A 4JL2A 1HJQA 4PMUA 3N34A 4Q4MA 3DG3A 4C6NA 3CQ0A 3N19B 5I78A 3RM9A 4Q33A 2PWDA 2D0GA 2WQDA 2GVYA 1X39A 4BFAA 1TJPA 3T7VA 2Q71A 1Q6FA 2VD9A 3CH9A 3NURA 5IFTA 2W67A 3URAA 3VX0A 3GG7A 2XWEA 3EX3A 3WF4A 5JU6A 1EGZA 3BANA 2ZZ3A 3W7HA 2E40A 3GU2A 2EG8A 2ACQA 3UXAA 1QFEA 2BGNE 4PL1A 1VYPX 3NSNA 2I14A 1OFQA 4GLEA 4V2XA 4QITA 3OGVA 4XSLA 3KM8A 1HQTA 3R5EA 5H8UA 3EOSA 2ZRWA 3WBXA 4WXYA 2CBIA 1E43A 4B90A 4CNNA 3GDLA 4DAFA 3WEMA 5CGQA 3HPSA 3PTKA 3GZAA 4YIWA 4GO9A 2Y7GA 4KKXA 1XLKA 1YNPA 3LMYA 4XO6A 1CLXA 1YXCA 4ECLA 1P1MA 2CEQA 1L8PA 1TX2A 3VFCA 1ZJIA 3GXIA 4WXZA 1UWRA 3LCXA 1XC6A 1ISYA 4K39A 2DT2A 4X3ZA 5BNKA 3DHDA 1JIBA 1A0CA 1W9DM 3AS2A 4HGXA 1UD5A 2HK1A 3KOWA 1EP1A 4E38A 1ICQA 1A5SA 1LBFA 3S46A 4PTWA 1J2BA 1JAKA 1DWJM 4FLRA 3MHUA 1V93A 3ARQA 4PSRA 2OQHA 3H12A 4RPPA 3S2JA 4C5ZA 3OOQA 1SYTA 1EHNA 1FCUA 4XVEA 4WF7A 3QR1A 3O6DA 3W87A 5CAHA 4KEZA 3E0LA 1BEUA 1IF2A 4XBKA 2OXNA 5FEWA 4CD8A 4PCTA 4LWWA 2GFTA 4UTLA 5K9DA 2TRSA 3KBJA 3ZZ1A 4H6KA 3KTSA 4AZHA 5K9CA 4H9TA 2O9RA 3AS0A 4J3ZA 1S2TA 3NXLA 5BOOA 3P84A 1H41A 2OLSA 1P4CA 5F1UA 3VFLA 4MADA 1A0EA 2X1RA 3W74A 4LSBA 3S2LA 3WQ6A 3DHUA 3WH7A 3EWWA 4JYFA 4AC7C 3Q65A 4OT7A 1BFNA 1AW1A 1J0YA 1UWTA 2DZSA 1UZDA 5HMFA 1V3KA 1VR6A 4L6DA 5K4ZA 1ZQ5A 1KGWA 4FOJA 1VPXA 3C8NA 2WBKA 1G4TA 5HWJA 2I5GA 3FEQA 3IUHA 2C19A 2X40A 3CUHA 4W8AA 1WAUA 3PG9A 3KHJA 1NF7A 4BI5A 5CBJA 4PUWA 2Z7GA 5EB8A 1ALDA 5LIXX 2GVLA 4UQBA 3W81A 4F48A 3BTNA 4KEUA 3KE0A 3F2BA 4NZJA 3MS8A 4C6FA 2AGKA 3LBOA 3CHFA 2VD8A 3M7WA 3AYTA 1QBAA 4DJEA 1BPLB 2PEVA 4DYEA 3RO6A 1E15A 3BUVA 4P7NA 1CCWB 3S5SA 5BXRA 1X1NA 5CZJA 3MY9A 3VUPA 3A4JA 4M24A 1K8YA 4OV4A 1WZAA 3NZRA 5CPOA 3L12A 3UBPC 3WY1A 2WXDM 4M51A 3U57A 2F9RA 3C8FA 5BRPA 2YZ5A 3GVQA 3ZIZA 3W86A 2WMGA 1B4KA 3S2MA 5LZLA 4C60A 3GXPA 1QO2A 1FA2A 3SJNA 4JX5A 4S3BA 3SGGA 1UC4A 1UH4A 4MZYA 3VD3A 1OJXA 5BU6A 1DWHM 2NVAA 1Q5MA 3INPA 5L6UA 1HJSA 2OYKA 4DF2A 5A6BA 4LS1A 2GUYA 1F05A 4JTGA 1J11A 1N55A 2CETA 2ZE3A 2V63A 2WZTA 1VQTA 4K1GA 4I9AA 4MMWA 2VQTA 3OA5A 1NQKA 3GW3A 2ZFAA 4PTXA 1JAEA 2WC4A 1LG2A 4EAYA 3ONCA 2V8ZA 3TSMA 1HNYA 2CLFA 4XZNX 1YADA 2CLLA 1SFLA 1JZ3A 4RR4A 3AYRA 4HP5A 4IMGA 1H5YA 2X2GA 3M0HA 4HCDA 3IIXA 4LUTB 2XVGA 3C2YA 2HSAA 5AYZA 2QW5A 3GTNA 4NAEB 4GY0A 3MUXA 2O9PA 1EXBA 1GG0A 3QEZA 4JTEA 3B8IA 3S5OA 2NT1A 2EO7A 4MWAB 4PUKA 3HPXA 1NH6A 4ALDA 4N42A 2QUTA 4IFOA 3COTA 3NIYA 3W01A 3VNLA 4LNYA 4JIEA 4GRSA 3HG4A 3N2BA 3AC0A 3TWAA 3DKJA 4KEMA 4MYAA 1P43A 4Q4KA 1GOXA 2I57A 3ABRA 3L4VA 3UWUA 2PDBA 3MWCA 4NG3A 3S6TA 4Y7EA 2NWSA 1UKQA 2BB0A 5KMYA 4MJ4A 3A5FA 1S2WA 1NTHA 1C8XA 1F07A 1LJYA 5HDRA 3GD6A 3MCOA 3K5XA 1BLIA 1A5NC 4D72A 4MSSA 1W3TA 1GVIA 1D8CA 2V2DA 3QR3A 4Z1CA 5AHNA 2QCMA 1MQPA 1XINA 2FFIA 4K7VA 3CGTA 5FA5A 4J3VA 3H23A 3OHIA 4L9ZA 4H01A 1OCJA 3FJNA 2R1MA 3TTQA 2WOQA 2Q8XA 1CDGA 1UUOA 3WBYA 3FDKA 2B81A 3A3XA 3NQEA 2D69A 4ZBCA 1DIKA 1G4PA 2C3ZA 2WZMA 3MDWA 2B7OA 4FXRA 1BKHA 1TPVA 1VC4A 5T91A 3CH0A 4X9YA 3P7YA 4H83A 1V4YA 1BYAA 1NVMA 2WMIB 1LQAA 1R3SA 4MF4A 5GJMA 3U2OA 5ABHA 1C8QA 3CZEA 3RN6A 3OZYA 5CLTA 2HISA 1T8XA 3FGCB 4C1KA 5G4WA 5EFFA 1HKJA 1RJPA 4NX5A 2GGEA 2W62A 4IGHA 2IW0A 4MLRA 1UKSA 2PDFA 2O7QA 2Y89A 4V1YA 1EIXA 1V3IA 3SGZA 1IEQA 3AIBA 4D1JA 3SY5A 3O6AA 3CUIA 5D2WA 1SJDA 4Y6GA 2YYTA 3NL3A 4ML4A 4U3CA 4TIMA 3W24A 4AZCA 2DSZA 1Z8AA 2EJ1A 3JS3A 3KBVA 3WBEA 3VO0A 3R94A 5H1WA 2INEA 4FNUA 1TTQA 3DC8A 3S1WA 3TCSA 3S9IA 3GDRA 1V3MA 4N6EA 1RR2A 3HF3A 3KBWA 1EH9A 3MB9A 5H2ZA 1JZ8A 5AC7A 2YA2A 3TJ4A 2AQOA 2B7NA 1OYAA 1GORA 3KL3A 2R94A 3Q4DA 4LYPA 2XWDA 3NA8A 2Z6JA 2ZADA 1X6UA 3HO8A 2EG7A 4PCPA 2CPUA 3E6EA 3T4CA 3BG5A 4EIVA 1ISVA 3QFWA 1FWTA 2FJKA 3ES7A 4XAGA 3WQGA 4UMCA 3WBAA 3WF1A 4L7ZA 2NX3A 2XFRA 4GIEA 1EC7A 1XGZA 4K2SA 1ICSA 3GXDA 3W1QA 2Y1HA 1XRSA 1A80A 3L4YA 2FZMA 3NTYA 3HQPA 3CWHA 4YWIA 4DUWA 1S5VA 4HNLA 2RKXA 4PUJA 3CASA 3EGJA 2Y2WA 1F61A 3TYUA 4HOWA 4C6PA 1XLBA 3N25A 4NT0A 4P2VA 4O15A 4A3YA 2BODX 1SFJA 4CNSA 3SSZA 1G94A 2WHJA 2EPOA 1CT5A 1DOSA 4W85A 5DELA 2VJXA 3APTA 1ZBCA 2DJLA 3QZEA 4PMJA 4JD4A 4IIDA 3IVSA 4GI8A 1PS9A 4W87A 1DJXA 1KFBA 1HP4A 1RVKA 3BO9A 3KRZA 1EJXC 1T0OA 4PB5A 3M46A 1MXSA 5I3JA 1FBAA 1VEOA 3WL1A 2BY2A 1KKOA 1XIJA 3G24A 4F0SA 4UNLA 3V5CA 2RDXA 3RRXA 1PE1A 3W38A 2XGZA 3KOXA 3DBPA 4O12A 3IIPA 3DU0A 1ZBVA 2O92A 1J0HA 2IPGA 3R4IA 2J77A 2RDWA 3WLRA 2PU0A 4B5XA 2CLMA 3TN4A 4MHBA 3N18A 1NOFA 2P1FA 3LS9A 1GQNA 4U31A 3RCYA 3LRKA 3W7PA 3P0WA 4UNIA 4LTSA 1M7JA 4LU0A 2P88A 2E0PA 4W5ZA 4EKJA 3GG1A 4GE8A 4GMEA 4H2HA 4I9MA 2ZA2A 5F2MA 1GHSA 1XPGA 1L6WA 2QXWA 3WMCA 5FJPA 1GZJA 2VR5A 4IWWA 1HXJA 3AZSA 4PN2A 3B4UA 2Q6ZA 3VKDA 1R5YA 1VJIA 5LGZA 1LRQA 5LHFA 1PB0A 2E5CA 4W84A 4BWLA 1UD2A 3VNIA 3IV3A 1TUXA 4P7OA 3NJ3A 3M0IA 5G4HC 4QG9A 4S23A 3GLCA 4G1KA 3B05A 1VFHA 5DT5A 1V08A 4KWOA 4Z2JA 2BOEX 3MCNA 1FH8A 3QGAC 4UZSA 2EKCA 2DFAA 4WRHA 5KITA 3EWXA 1A47A 1O5QA 4O16A 2GL5A 3RK8A 4E6MA 4IJCA 2A6NA 4W5UA 2E77A 4HZ6A 1FCBA 2ZZ7A 1B3VA 3GVGA 1FWSA 2AMXA 3O8AA 4UBPC 4K6AA 3TAKA 4HNUA 3BJTA 3WLKX 1XP3A 4TV5A 4ZVJA 3W07A 2X05A 3DI1A 2ZXBA 3VGEA 4Z1AA 3SCPA 1EKOA 2VFGA 1O4UA 3TWBA 4GUJA 1DWAM 2CZDA 3QMTA 5F2GA 2CNCA 4JL1A 2YXGA 3QPEA 4AISA 4B92A 1E4MM 1R46A 4LW7A 4RCXA 4JQ4A 2Y24A 1EUAA 3BAXA 1MI3A 3NPXA 4C6KA 4G9PA 3PZQA 3HGSA 3TFCA 1MFUA 1AD1A 3SUTA 4GFIA 2WBGA 1A3WA 3VKAA 3NPVA 5LNVA 2BGQA 1JZ2A 2OTDA 3U6WA 5BOEA 2WQPA 5C9UA 1OM0A 3V5OA 3STCA 3M07A 4B2DD 1RPXA 3KS6A 2J7BA 3H2EA 4EOUA 4GD0A 1IEXA 4C7DA 1HL2A 3N6JA 1XUZA 3LK6A 1PKLA 2PWGA 1UOZA 3UYCA 1RCXB 6REQA 2R91A 1IEWA 1I9CB 2Y0FA 1W54A 4ZSUA 1TPWA 3M44A 4V28A 5DCDA 3MI2A 3NO3A 1O68A 1YYAA 4FOUA 1DIOA 4BR1A 5IBXA 3WLTA 3FYYA 1HP5A 3TOPA 2J75A 5CJNA 4YVVA 2X16A 3VIHA 5ENLA 3QF0A 5FJOA 4Z0SA 3EMCA 3IJ7A 1RK6A 5BYWA 4BI6A 1VLIA 1XM3A 1DORA 3GYEA 4CCEA 4NF7A 2G96A 1XKYA 2WZEA 2X7WA 1FHLA 4FIQA 1J8VA 2GSEA 3W1TA 3S1XA 3MC5A 1TWSA 4LAUA 2ZXAA 3AISA 3RR1A 1OFPA 5A6JA 4KETA 3LB0A 1RZMA 3T0TA 1XYBA 1GNXA 3M6DA 4HB7A 3G0SA 1AQFA 4C6OA 2F6XA 4BJHA 4RE3A 2OO6A 2ZRYA 2YBUA 1XBZA 3HG3A 1SSGA 3EMQA 2J9XA 1U1UA 5EU9A 2EBNA 2PTXA 4HVXA 4LRTA 4NJIA 2A3BA 4CD4A 1KM5A 3P5YA 5A2CA 1ZHAA 2ZX9A 1P0DA 1YRRA 3A3HA 5CG7A 4DJFD 2CCRA 4YXGA 4YVXA 3GDMA 1P7TA 4PUEA 1CLKA 4M7SA 3ZOAA 2IKIA 4F66A 4ACZB 5HNNA 3CMGA 4DZHA 3KAOA 5A6SA 2VC7A 1R8LA 2OWXA 2Y62A 5FF0A 2O4MA 3TFXA 3L21A 3E0IA 1W1YA 1JZ6A 1HJXA 2ZIDA 3FX4A 3JR2A 3M41A 3HTWA 1Q4WA 1YDNA 1E4LA 2OEMA 3RUBL 4LRSA 4Y9MA 4S3KA 2OFJA 3LQLA 4GJJA 3W83A 3V75A 1L2UA 4B3LA 2PDJA 1K7XA 3M5XA 4ZZ9A 4F0HA 3UD6A 3B04A 3F5JA 4Q7IA 3VD9A 4U5KA 3MI3A 1GYLA 2GZXA 3N11A 4F0RA 1S2VA 5CLWA 2PDWA 3PPFA 3N13A 1G5AA 2V9DA 4MZ8A 2XSAA 4FNSA 4D71A 4QNEA 3PB0A 3GBEA 3OTRA 3W72A 4HNTA 4KRTA 3W6MA 1PTGA 1Q4NX 2OMAA 1WDPA 1V6WA 1PZ1A 2NQLA 3N4EA 2YX0A 4Y8EA 2V2HA 3ZJ8A 4K8HA 4N0RA 4R9XA 1QHZA 3ME3A 4AYGA 3A9IA 3CAKA 1GQKA 2ISWA 2YBTA 4B5SA 3W53A 2XGBA 3ERPA 3WJWA 1DJGA 1MSSA 5DBTA 4CUCA 2V5KA 3ARRA 3M1ZA 4OWGA 1AFSA 4GI6A 1HTIA 4KMQA 3BMWA 4KT2A 1QPKA 1IIHA 5BMWA 4YHEA 3LXCA 3PK7A 2V30A 3RX2A 2HNEA 2E3ZA 1XW8A 3LGGA 3GXTA 1QNQA 3W25A 2FYMA 5JIWA 3QKZA 4V15A 1Q3NA 3JZUA 3MT1A 4M1RA 4UR8A 4E4PA 1EX1A 5AOUA 5I3HA 4CVUA 4OUEA 2C14A 2HRWA 3WZ0E 3WNOA 5I00A 4AXKA 4FLQA 1MW0A 1V51A 3UVAA 1ADDA 1M6JA 4R85A 3WD4A 1G4EA 3TTYA 3FCPA 2NV1A 3V1PA 3H4WA 3R12A 1TJ0A 2VRKA 1A3XA 1XDJA 2YCLA 2Y8UA 4HNVA 1TTJA 4IP5A 3W28A 4NUWA 2DP3A 1WDQA 2Z1WA 2JBMA 4FAMA 1S46A 2V82A 4CEUC 3F4CA 1MUCA 1NDVA 1OY0A 4FXJA 3EX4A 1GGOA 2OZTA 3PP7A 4QEHA 1E70M 2FZNA 3UGVA 4Q8OA 3PTDA 2ACUA 1SZRA 1GW1A 3TYAA 3NQ6A 4PMNA 2BVWA 1OVDA 2ZZ4A 1ZP3A 1R30A 4JKMA 3TONA 2NT0A 3BAIA 3UESA 3RDKA 1FHDA 3ITGA 5GNYA 3POHA 1PDZA 7ENLA 4UTUA 1VRDA 3M7SA 1VD6A 4MB3A 5FAGA 1I75A 3GFZA 1KC7A 1H0GA 4N2YA 2PTDA 2RDTA 3MJYA 5LNWA 2P3EA 2BOFX 4G7FA 3TJLA 2WVVA 2HVOA 3ZXWA 4F9JA 3ES8A 3LMZA 4B15A 3ZR5A 1Q13A 4K36A 1ADSA 5AYXA 2OB3A 4NAFB 5BWFA 2D2HA 3BURA 2NUYA 3UPWA 4UQCA 5EGRA 2ZXDA 1C8VA 1N8WA 3L7RA 4ML9A 4N4PA 3RPMA 4GUIA 4Q8WA 1XQKA 2HDJA 4R27A 1ML1A 3ZJKA 4ZQRA 3QGKC 3EAUA 1H7OA 1X6NA 2GWNA 5ABTA 2EG6A 4A3UA 4ZXOA 4IFRA 1QUMA 5FSDC 1ELSA 3RMJA 3T2QA 3VNDA 4N9CA 3S2CA 1K77A 1S2AA 1T99A 5HWMA 1HKWA 4BQ5A 2ZX7A 3CZJA 4ZOCA 1M03A 2XHYA 4MB1A 1R7AA 3PWIA 3CM4A 4FO4A 2Z0IA 4WK9A 3STGA 1MEHA 4H7ZA 3IIZA 4ICNA 2RHGA 4GY1A 4AZGA 2R8WA 1XD0A 3PS7A 2XIJA 4LUSA 2OSXA 4DJED 1JYNA 3N14A 4DPQA 3BH4A 3CTTA 1JUKA 4IT1A 1KM0A 4UTTC 1UD3A 4DF0A 2FDMA 1XH0A 1OGGA 5CPSA 1FHUA 4JICA 1JQXA 3WQPA 3BMVA 1T41A 4D6GA 3LV6A 1SSDA 3R2GA 4EXAA 1SMDA 3SDOA 1KFJA 1M41A 1TR1A 4K68A 4LAOA 2QLYA 2Z1KA 3CZ8A 4JBRA 2GGGA 3N17A 3WLNA 4Q3MA 3R8HA 1BXBA 3OB8A 1D3CA 5T9BG 5A6BD 2YCEA 4GUFA 1XH2A 3FJ4A 4I6KA 4CD7A 1A5CA 1GYNA 2OSWA 4W7VA 2X1IA 4D1IA 1FRBA 2BTMA 5F4SA 3MW7A 1IT7A 1M04A 2A7PA 5RUBA 2G4JA 4ZO7A 2PBOA 5MKGB 3NQ8A 5C55A 1JULA 1I2OA 3WH6A 3HU7A 3W2LA 4WZHA 4P61A 3DFPA 3KOFA 2WJDA 3BMXA 4Q6XA 3ABZA 1ESWA 1TV2A 5MF5A 6CGTA 1KRMA 3MZNA 4NASA 4A4AA 6XIMA 3UWVA 2Q8ZA 3DESA 4HSNA 3LHTA 4CNTA 3PJUA 3VE9A 2MNRA 1W32A 1UW9A 4ZSTA 4GINA 4M3PA 1VFTA 2QV4A 2C13A 1TE1A 2WSKA 2CIPA 1O1ZA 3WNMA 4HHPA 1WKEA 4IQEA 4FEZA 2NX1A 3AIVA 3BLFA 3N3TA 2CESA 3UNDA 7TIMA 1RLDA 3QTGA 3XISA 3VINA 1S5TA 2JIWA 5JBEA 1J0KA 5HNUA 4M7TA 4X9SA 2JE8A 2GJPA 1XLGA 2UY3A 2NWRA 3ARVA 3PUGA 3I3BA 4IMAA 1Q8AA 2DDXA 5B7ZA 2XISA 3VOIA 1KM1A 4LEFA 1OHLA 3WMBA 1PZ2A 2V38A 3DFYA 3NDZA 4GA8A 2C1HA 2C7FA 2IQTA 2Z29A 3C6CA 4Q8QA 3VKCA 3WENA 3SCVA 1RQHA 2Y5SA 2CC0A 1W5MA 2RFGA 1CWYA 4CQDA 4RNIA 4AY7A 3RX4A 1NQ6A 4ERIA 5AHFA 3HG5A 3GNDA 4NNBA 3L65A 3TR2A 5G1TA 4JY8A 1UWIA 2B7PA 5GJNA 1VBUA 1JGMA 1KFKA 4M56A 2Y4SA 3EKZA 4R7JA 1FH9A 4KIEA 5IDZA 3ZVIA 4R34A 4Q4QA 4HT3A 3WF3A 4WKFA 2HNHA 2WWDA 3GTHA 2E6AA 3PZMA 3QPZA 1M3UA 1QDSA 5CPTA 1XS2A 4RW5A 1YPIA 1TREA 3ITTA 3JZEA 2VX6A 1NOUA 1MEWA 3SN4A 3SN1A 1WOAA 4F0LA 3TNBA 2YL5A 4RE0A 4TMBA 3W00A 4MAVA 1BHGA 2X42A 3ZLFA 2RJHA 1QNSA 3LZ5A 3DYMA 2IQDA 3GKFA 1QVBA 1AJ0A 3NVTA 2IPJA 2Z7KA 2VEPA 1CGTA 2NW0A 2BZNA 3TA6A 2XG9A 4CN6A 4DB7A 3MMUA 4D6CA 2BV9A 4Z08A 4QROA 3H54A 2IKJA 3PWGA 1TVPA 2A7RA 4IP4A 2D0FA 1QNOA 1OX4B 3AIRA 4ORIA 2OCZA 3V4BA 3ZT6A 5M17A 3SZ8A 3VTRA 2ACRA 2WYSA 4TVDA 4ZFMA 5D9NA 5EMMA 2PRMA 4DLMA 4DPPA 3HMJG 1FFQA 1M53A 1DVJA 1EDTA 4CD6A 5T26A 4G6CA 3LTPA 3QHMA 4NNCA 2A21A 3SCOA 3EEGA 2XSBA 1GZ1A 2SFPA 3V16A 4AMAA 1QNPA 3T0CA 1TPUA 4S39A 1SZEA 4YJ5A 4AY8A 3ZMRA 2AL2B 2X41A 4Q8MA 1XUUA 3GSMA 4DZIA 3FAWA 2DIJA 4U4MA 1EB3A 4M29A 2XINA 2BVTA 3LD5A 2FQIA 1RD5A 3AMKA 3OODA 1PZ3A 4Q22A 1BG4A 4NZ1A 3H24A 4P7RA 1WZLA 2PBGA 1XLCA 3DBNA 3MJMA 3SFKA 4MJZA 1EQCA 8TIMA 3W2NA 2GGIA 1AZ1A 4XX6A 3RFAA 2DZPA 3VIMA 4DWDA 4I8DA 1QW9A 4S3GA 1E9YB 5C8BB 5JBFA 1JCMP 3W1LA 3RU6A 2INZA 2C91A 3GNNA 3OZOA 1OYBA 5G2WA 3WQ5A 4PBFA 1WX0A 3THDA 3DERA 3ZLHA 2OGYA 1EA0A 1ZGDA 3BLKA 1SJCA 3G1SA 1DQUA 4B5NA 3AWOA 2PODA 2D22A 3CHDA 1F3XA 3AUJA 5LSMA 2V5DA 3BCFA 3BOXA 3RM8A 1JZ7A 4HMNA 1J4EA 3LCIA 1CB7B 2I5QA 5AYBA 2CHOA 4WVXA 2W91A 4K1WA 2PDUA 3C3NA 2E6FA 1TMQA 3BJSA 2HPMA 1HGYA 1VCGA 1NAL1 4IHCA 1RJQA 2UZ9A 3GM8A 4P7LA 4C7FA 3VOCA 2KAUC 4QG6A 3CU2A 3D3FA 1UB3A 2BASA 3G22A 1R87A 3VABA 4BQ2A 1OX6A 4TR9A 2Z6IA 3WUEA 3VOFA 3EMZA 5CXPA 1XLIA 1MZHA 1WZKA 2VZVA 2IS7A 1W9XA 4I5RA 2JEQA 4PA8A 1KGUA 4IGSA 3CQIA 4JTTA 3AIQA 4OBSA 4O1BA 2DORA 7XIMA 4LNCA 2P10A 5T8GA 3DFTA 1UWQA 5FCZA 1XC4A 4IX2A 3VD5A 4S38A 1H3GA 5A8PA 4Z42C 1QK2A 1CEOA 1WDSA 3B9DA 1MNSA 2ADAA 4QS6A 2VOTA 4OVXA 2VZTA 1HJVA 2Y5JA 2QMKA 2PLCA 1K9EA 4PH6A 1LT8A 2YFOA 2BWGA 3W2UA 4J27A 3HBLA 1EWDA 5B7YA 3QZAA 4HPHA 3ANUA 4DBSA 3DYPA 4LUTA 3NEHA 3AUOA 4KCVA 4A2RA 1S1PA 3AROA 1OCQA 1REQB 5D04C 2QT3A 3LPPA 2GQ3A 3EX1A 2ZX8A 1CBGA 1S3TC 2VC5A 3GNPA 3HGJA 5CBIA 3BSMA 1WKYA 3CIXA 4HTBA 1GPFA 1UKPA 4EF8A 3GFXA 4IM4A 2F6KA 4K8GA 5LYRA 2Q02A 2ZUSA 2JALA 2NQJA 3O2LA 1KXQA 1E6RA 4H8UA 3EWBX 2ZZ6A 1LYXA 2QQ6A 1AJ2A 3W73A 1A49A 3SCTA 1XBYA 2GWGA 4PTMA 3EDJA 4HN4A 4DJFC 2PDYA 1LLWA 2MUCA 2QPSA 3PZGA 4TTGA 4WDXA 3CUJA 1A53A 4IIHA 1Q63A 3QPYA 3RX3A 1TA3B 4O0ZA 5CAKA 4B91A 2IXUA 2Q01A 2HS6A 2OEKA 4KEVA 1P6WA 4QAWA 5A8GA 1GOIA 4IISA 4G8TA 2DVUA 3DX5A 2QAPA 4LBRA 1ZCOA 4L6HA 1AH0A 1EC9A 4JXCA 4E5TA 2WM0A 5D8ZA 3L0GA 5AKQA 1JZ5A 1YTKA 2BNJA 4JQAA 2CLOA 2VZOA 3FIGA 2PGEA 1ZBWA 5DY3A 3AIUA 4X63A 1VFSA 3B0VC 3QY7A 3UQNA 1KQZA 1XDMA 1TVLA 3N9KA 2MANA 5IOBA 3ABXA 4RE4A 4QFUA 3IGHX 3AOFA 3LCWA 1JI2A 4XZ9A 4D8LA 2WMIA 4AVOA 1IIGA 5AC5A 2ESCA 3NQVA 5EPDA 3P62A 3V18A 4AF0B 4Q6JA 3TSBA 2VCBA 3GIQA 3EB2A 4LVBA 3RLGA 3QOMA 2GOKA 4TX8A 1VFLA 1ZPTA 1SU5A 2GUBA 1QNRA 2VGBA 4J4KA 5G2IA 2PDPA 3NM3A 5HAOA 1Q6LA 3STFA 1VZWA 2PDMA 2FVMA 5D4YA 2ZC1A 1DE5A 4JHOA 1GT8A 2WWCA 3OYZA 3W2JA 2Q3OA 3Q45A 3P5ZA 3CAVA 4AEOA 3QHOA 2ON3A 3BLOA 1YKWA 3HG2A 1VPYA 4MKNA 3WLMA 3BDKA 3L4ZA 1BYDA 2JKPA 1ITQA 1VCFA 4LB4A 1L8NA 4GVHA 4XB3A 4DO5A 1JXKA 3UG8A 2Z1SA 4O13A 3RGTA 4R3UA 4FF5A 4YWSA 4AIEA 2GGJA 3CT2A 3N6HA 1DE6A 3I65A 1SJAA 3MSGA 1OFDA 3UW6A 1AK5A 3E2SA 3SUVA 1ME7A 3UCDA 2HWGA 1Q2RA 2GJRA 4B4FA 5DCEA 1VGAA 3SJ3A 3N12A 2WNQA 3THAA 2EF9A 4H9ZA 5I02A 4EXBA 4GZEA 3UXKA 3DEQA 1F4HA 3WK3A 2GDVA 2C1IA 1Q6OA 4Y9OA 3P60A 3TE9A 1J79A 3AAMA 2Y70A 1SVDA 5FACA 2J27A 4LPCA 4Y9NA 2VOMA 3R79A 3VM5A 1E0XA 4L64A 1ADOA 4FR6A 3SUWA 5TQLA 4ZTYA 1QU4A 3DZ1A 4J2MA 4IJRA 4NSBA 3D47A 4GWEA 1H63A 1TMHA 1F3TA 3JRKA 4PMRA 4HYWA 1KCLA 1M7OA 1Z89A 4R33A 4TUFA 3M0JA 1JYVA 1RH9A 3Q37A 3KRSA 5HQLA 4CU7A 1I60A 2DT1A 2YXOA 4I7VA 5FD0A 4JIIX 3KTCA 4JTJA 2PA6A 1LOLA 3JU2A 4IMDA 1QWKA 4L5ZA 1US2A 1FWGC 1ECEA 4Q7NA 3PTMA 1F73A 4LAKA 3W27A 4W89A 1AD4A 5I3GA 3RU8X 2GDUA 3B9NA 1I2NA 3KCOA 3C2VA 1LWJA 3G1HA 2QCCA 5HJLA 3UJFA 3VD7A 3GX9A 2JFEX 3U2ZA 2V5BA 5AYIA 3IPWA 5CZ0A 3FJ6A 4BEUA 4XKYB 1ZFJA 5KZMA 5A6KA 4CU6A 2WSRA 2NLIA 2ZTJA 3HPFA 1XRTA 1XFBA 1DL3A 4M1BA 3CAWA 1PDYA 5EA9A 2FPTA 2IKHA 1DXEA 3EPMA 4V33A 1BQCA 1X1OA 1Z32X 4DJEC 4QNWA 4D6HA 2PC4A 5K9XA 1TPC1 4HCLA 4UNKA 1CECA 4BQ3A 4HK6A 4CNOA 1LF1A 3MUZ1 1E6SM 3I3EA 1UP3A 1D3GA 3OLDA 1QK0A 1SO4A 3WX7A 4NL1A 1O12A 4A8RA 4H04A 3AXIA 3H2CA 4L65A 5C0QA 2G41A 3VILA 1FUYA 2HK0A 2ISSA 4MB4A 3T44A 2DSVA 3SAZA 3W1AA 1KXTA 2XUCA 4BCEA 3BXWA 3MCMA 2BMBA 3PUOA 1YDOA 3ATYA 4ZCWA 1CGVA 3A22A 2J7DA 2A1YA 1ZRQA 1H7NA 2BSLA 3HN3A 2WJFA 4TOQA 1TPB1 3DOPA 5E0KA 2VURA 4IH3A 2NVCA 1WAWA 3RYSA 3UT0A 5T9CE 3M0MA 3GXFA 1F76A 3QV6A 5LXEA 2FH6A 3A64A 4EWJA 3WJZA 3GC2A 1IEVA 3BICA 2DW7A 4XD6A 3WFLA 4W86A 3R8GA 4ICMA 4DF1A 4QJ1A 2FFCA 3R58A 3PZVA 4JYEA 4K8EA 4ZE4A 4MOZA 3VX1A 4OBTA 2V5LA 2YDQA 1UR8A 4JFTA 3OW1A 2QDGA 1QI4A 1QPOA 1HGWA 4IMFA 3IAQA 3LCGA 2EGZA 2ZC8A 3PN8A 5CPLA 3R6IA 2Q3RA 2A3LA 1PIIA 1JDFA 4NZFA 3BAYA 4GCAA 3O6CA 4MAZA 4GABA 4BZYA 3OGRA 3BLEA 2X30A 1W56A 1UROA 5C5YA 3I10A 2XVLA 3AMLA 1IWBA 4W4QA 3GNOA 1AUSL 1RJRA 2O7SA 4IQJA 5AC6A 5C7HA 5IRPA 5FF2A 3T2PA 3E2VA 1OF6A 6ENLA 5IM51 1H7WA 2QIIA 3N4FA 1BXCA 5FSEC 5A2BA 3R8RA 4YCPA 2O0TA 1G9HA 5U7SA 5D02A 4UMBA 1K9TA 3IUDA 4NXKA 2OVLA 3EXSA 4AHPA 2Z26A 3FEMA 3FW6A 3A3WA 3P61A 1M7PA 3DFHA 2FTWA 4YTTA 3EKLA 4M8UA 4K38A 3WLJA 2R24A 1EQPA 3GRIA 4U2YA 3B9AA 5CGTA 2EEXA 4FALA 4UTHA 3AHXA 1RSCA 3GYCA 2GJNA 3WLLA 1BVWA 3R0KA 4Q4SA 3NEVA 2NV9A 5F4XA 3W75A 3BGJA 4QE4A 3AI0A 2FB2A 3TXZA 4JOMA 2QMJA 2FLIA 7CGTA 5JMUA 4QCEA 3G18A 3VNMA 4DRSA 4IUGA 5ABFB 3QOKA 2J6VA 3PPHA 3EDKA 3KHDA 1OK4A 4HJWA 4QS5A 3LSBA 2IQ0A 5F4WA 1BYBA 5DMYA 3G8EA 1JF6A 1RBLA 4JR5A 2E5DA 4UFLA 1KBLA 4NZ4A 2ZDSA 2G4FA 2OZ8A 1GJWA 4GUHA 3SADA 3SFWA 1KRCC 4EACA 1GOQA 1L6YA 3TOYA 3MUY1 4Z2HA 1WKFA 1RY8A 4IP7A 3AHZA 1TE6A 1EXPA 5CQ1A 5LKYA 4LAMA 1NU5A 3NQAA 4DLFA 5AZ0A 1R9ZA 4A2SA 3QV7A 1E72M 3SRHA 2X1TA 2DQXA 1HT6A 1LM1A 2W6RA 1KTCA 4LXFA 3KUMA 1I2RA 1LCOA 1OINA 1O7AA 1DJYA 1QPNA 1VH7A 1V6YA 2VL4A 3HM7A 2DGAA 4J35A 7REQB 4JX4A 2H3BA 2WNNA 3GNXA 2OZ3A 3OP2A 1SR9A 5BZAA 4QP0A 1NELA 1H1YA 2ZE0A 4MKSA 4RDYA 3FYPA 2AQWA 3W1XA 4AY1A 1UH2A 1FXQA 4PGLA 2ABAA 3PPGA 3SO7A 2YLAA 4LVGA 4QLJA 3HGRA 4QJ3B 1RQBA 2QR6A 3UCCA 1M1BA 4H1ZA 1KFLA 1V8EA 3C86A 3UXIA 1EBHA 1TV4A 2J78A 1QTWA 4GOAA 3SUUA 1U33A 3VIJA 4J9JA 1U30A 4YL2A 1WNOA 3BW4A 1D7KA 3D0CA 5DF0A 1D8WA 5GPRA 4PMVA 2AKMA 4OIFA 2ZX5A 3W7GA 5FAJA 4J40A 4QE1A 3P0XA 1PHQA 3DYOA 3A21A 1EOKA 2F8QA 1LUCA 1W3KA 2E1WA 5BRQA 5C2XA 4GZIA 1I8JA 3FJLA 4QJ5B 2CBJA 2HEJA 3EA3A 3CEUA 1BSLA 1QRQA 4FNPA 3QGVA 3VK5A 3BOFA 2R1KA 4A3QA 5KZEA 4LUIA 4AZ5A 3FKKA 4FK9A 1YTDA 2YL9A 3TCEA 4KCTA 3VGDA 5IXEA 4BWLC 1NP2A 2VEFA 2VFDA 5A8OA 1PSCA 5C9RA 3LRMA 1W8SA 2H9AA 4UFKA 3JUGA 3QXBA 4NAFA 2JK2A 4QJ4B 1PBGA 2V68A 1XYCA 4PR4A 4J1OA 2VX7A 3DHFA 1GPWA 4NILA 1FXPA 2W61A 1G0CA 4QEEA 4Q4OA 1T40A 3GKAA 2PLKA 3H7VA 3CLWA 1NFGA 3QQWA 2BBFA 3DGRA 5MHBA 4QISA 4XZIA 4YTRA 5TBOA 1MNZA 2XDFA 5FEZA 2WC7A 3DC0A 1JYWA 1JFHA 4XO7A 2VR4A 1FWBC 3XIMA 3EBVA 3P2VA 2ZCGA 1V3LA 2PWHA 4D6IA 1EP3A 4C90A 1DWGM 5HANA 2V3FA 4JQ2A 2I56A 4UB9A 1Y5WA 1WOBA 4U10A 1OT1A 4DUXA 2NLYA 5FKYA 1Y65A 3W7NA 3MMTA 3ABQA 2D2OA 1SZNA 4LV4A 4MPKA 1JGIA 1J0JA 3VIFA 4O17A 2G37A 4H4IA 4HBKA 3M4HA 2WSQA 1R2SA 3VKBA 4ZENA 3RRAA 5GVJA 1AW2A 1V3JA 1V6TA 1Q6DA 5E1QA 4LYRA 1R3WA 2Y5EA 1E40A 4DN1A 3W1RA 2YW3A 4OTKA 3TROA 1VIZA 2CWNA 3HV8A 1UMYA 1ZP4A 3DH7A 3HQ1A 5D2VA 1ECQA 4FP1A 2W27A 3OO2A 4M6PA 4QHRA 1UR4A 3PZIA 3I7SA 1QPQA 1E0VA 1Q45A 2CKRA 8A3HA 3MP4A 4UZUA 2J9YA 1UBSA 3G0UA 4JHMA 1WP6A 4HSOA 1P0BA 3G6LA 1RA0A 4UQ9A 3IJLA 1EDGA 2OGJA 1GEHA 3ABSA 5IBXC 5HR6A 5FJTA 1BD0A 3UERA 3WDIA 4NIRA 2AL1A 2V67A 1HJWA 1JUBA 4AFYA 2ZRVA 3CQJA 3L5MA 3C2EA 1FOBA 2I9UA 1GCYA 1MUMA 3FNDA 5H8PA 1CLVA 1PKMA 5MKGA 3UWWA 2VFHA 2A6LA 2Y7DA 3B40A 1T8QA 4EF9A 1LL4A 2XM2A 2Y85A 5BXTA 2VKZG 4MGGA 7A3HA 1W3HA 2Y6ZA 5ECUA 1E1EA 1OIMA 4D8ZA 3FY1A 1Q66A 4JTCA 2DVTA 1E4IA 2DUZA 6PTDA 4Z1BA 4TX6A 2WMFA 1HG3A 2XVKA 4YLWA 4QQUA 3SGUA 4MYXA 2W79A 1F6KA 5I6SA 2IXVA 3IARA 2P53A 1HUVA 4Q32A 2OWWA 3IUIA 1X97A 1Y7VA 3QMSA 4R9OA 3QFEA 1JUEA 5BXPA 3T6CA 4LBSA 3M5ZA 4GO8A 4WR3A 4GX9A 4S2CA 5K4XA 1YXYA 3UZYA 5LIYX 1ONEA 2VDHA 1SO5A 3PZTA 3M43A 3NZ1A 1JR1A 3GTFA 4NJKA 1VEMA 2G3JA 4L80A 5E9XA 5LNUA 3PZUA 1E9ZB 2C79A 1IV8A 1NEYA 2G5WA 4PMOA 1YMYA 4AG0A 2ATSA 3NM1A 1VJZA 3AMCA 4LC6A 2QJGA 2IPWA 4KWSA 1RBAA 2VNCA 1BF2A 1KWKA 3URNA 5B80A 4BKNA 1UKTA 2XM1A 2VENA 4Z2LA 3KVKA 1KXVA 3TN6A 3CL6A 3UJSA 1SQ7A 1FQ0A 5EBAA 3B8TA 1J96A 5CCZA 3W1PA 2C18A 2RUSA 3QW3A 2J79A 5C2CA 2F61A 3AJXA 3K46A 2JKAA 3BQ6A 3LPOA 2XN2A 6A3HA 2PD9A 1PKYA 1B3ZA 1FDYA 2NQ9A 1EF2A 3E74A 1TZ7A 3ISIX 3ZR4A 2O56A 5JBDA 3ARZA 1QXLA 2Z24A 3S47A 4UWMA 1GVFA 1R0MA 3N6QA 3AYVA 1TZZA 1WUEA 3MV01 4UFMA 2GVGA 1QATA 3TLQA 1Y5VA 3VA8A 1OCBA 5FIPA 1YPFA 1RP8A 1VBHA 3EDDA 3PZOA 4ZQCA 3ARWA 3W7OA 1MO0A 4MNKA 2J7FA 4GJ1A 4AZ7A 2XH7A 2DZVA 1VEPA 2XSXA 1GG1A 3KCLA 1OX4A 1G67A 1E5NA 3T1GA 4H6RA 5CC5A 3KL0A 5M1TA 4X0VA 5E93A 4F0MA 4PFMA 4GXPA 4HA3A 1KR1A 3NOEA 2PF8A 1FWAC 3W7KA 2C71A 1LROA 3N15A 2CLEA 3AHVA 5TD4A 1CXLA 1I1WA 3IJQA 1CXIA 4AHQA 2BHZA 3WK0A 3BJFA 3B06A 1X98A 3N1AA 4WHBA 3T40A 5FEXA 1P6CA 1Z69A 2AL2A 1OWQA 4X61A 1MUWA 5CPMA 3PJXA 3S1UA 9XIAA 1K9DA 1SO3A 2FGBA 1RV8A 2ZZ1A 3UFYA 3E49A 4CLMA 3OZPA 4ADTA 4GKLA 3K8KA 4NJHA 4C6CA 1XIIA 3HURA 4N9DA 4YTSA 5D32A 4NP7A 4I90A 3WQVA 3C0QA 1SW0A 3AXMA 4O10A 4C1LA 1JCXA 1R3TA 3CO4A 2BG5A 3QY6A 2WJZA 3EWDA 3M0VA 2FJUB 1VYRA 2ODOA 2B31A 2CXGA 4JFWA 4OOZA 1OZQA 3VAVA 4CU8A 5A5WA 5HINA 4UR7A 2OLAA 4RNJA 1QNVA 4UQDA 1F8MA 2PURA 2G95A 4K3ZA 1IWAA 3BAKA 1OD0A 1E6PA 3OQ8A 4DX3A 2WCAA 3HB9A 2O9OA 2Z2AA 3LCHA 3NQCA 5EFDA 1KRAC 4HNCA 2V3DA 4UQEA 4LF1A 4OOUA 3KEHA 1UP2A 2QJNA 2FPVA 2HQAA 1K70A 3OLIA 3G77A 1XXXA 4FI4A 3E2RA 5C71A 3AALA 3SR7A 4ASTA 4F2TA 2UY5A 1NF0A 2VWTA 1VIWA 2PTZA 5J5RA 1VP5A 3OVPA 5M03A 3VI2A 2HXUA 4IPIA 3NZGA 1ODUA 2Y61A 1X7FA 3SRDA 4AMCA 2V6AA 3G1XA 2Y7FA 3P93A 4Z0JA 3R89A 4NY2A 2VM8A 1CENA 2ZA3A 4MUZA 4XTDA 1TPEA 3HGOA 3AU2A 4UFIA 4DBUA 1FTXA 1UR0A 3FXYA 3OIXA 3MP3A 4O1FA 3ZQ9A 1E55A 3R7MA 3HIJA 2YFNA 4GH3A 4AZCB 2OODA 3NL5A 5CSYA 5HMDA 4O28A 3HPAA 2VI0A 2EPKX 1UZHA 1W1ZA 4PMDA 1BXNA 4AU0A 3NQFA 1GVYA 1G69A 3S5YA 2JGQA 1FVPA 4O0QA 1J0IA 3M64A 1YTEA 3UF9A 1JQVA 2PLJA 4TVCA 1PCWA 1XRFA 4MUPA 3WELA 3WKZA 1AH4A 1DJZA 4KCWA 3W7JA 3T55A 3M5YA 1REQA 1XSIA 4GK8A 3VDGA 3GIYA 4QBXA 2VVNA 3EWCA 4CKQA 2E9BA 3N2MA 3EOEA 4X2RA 4RDWA 4EE9A 1ISXA 4EPKA 1WA3A 3C0JA 4UMAA 4LS0A 4GQ0A 3S9ZA 1XFCA 1D7FA 1IGSA 1ZB5A 2W5FA 1TA3A 5JH1A 1QAPA 3LTSA 3MUCA 5CH9A 3P80A 1C93A 2W4XA 1ZJHA 1CNVA 1C9DA 3USZA 3GH5A 4ADUA 1QOPA 3BPWA 1H49A 1RPKA 1M68A 1E4NA 3NYDA 4PTDA 4PE8A 4TVUA 2VHLA 2HE8A 8XIMA 3QW4B 4HJFA 3KLKA 2H8ZA 3VMOA 3CEPA 4ATWA 3GNRA 2B7QA 4PZVA 1IXPA 3PPCA 1W8GA 4AX7A 7PTDA 1UD8A 3W82A 3DKLA 2CW6A 1K6AA 3W7EA 4DO6A 1RHCA 3AMGA 3MDUA 3BE7A 1J01A 3MANA 1KBBA 1PIGA 3GU9A 2DZXA 4M6QA 1W1B1 3MKCA 2QJMA 4GGHA 3IVTA 1QI2A 1RCOB 4E3VA 4JDYA 3QH2A 4RE2A 3WLSA 5HMEA 2CLPA 1YIXA 3B0UX 1F3EA 3REQA 4Z2GA 5FF3A 2DIKA 1WUFA 4PB4A 7TAAA 3GHTA 4OZOA 1LZOA 1KR0A 3K1GA 3LHWA 2I5IA 3CMJA 3WIJA 3E96A 4RNHA 4CN1A 4IXXA 5CJ5A 4FMVA 4JDBA 4U33A 1MXDA 3STEA 2Z2UA 1VFOA 4QDPA 1QMLA 3EA2A 4JFUA 1A5MC 3NSMA 5FJUA 1B1YA 3DN5A 5KINA 2GDQA 3GHUA 1KNWA 1RD6A 3LDVA 2O4QA 2ZUTA 3TYZA 1K3UA 3HV9A 2HROA 1WDRA 1XYFA 2FMOA 4A8IA 1TCDA 3IV8A 3MU7A 1WB0A 1TV8A 3H55A 4CCCA 2CXEA 3JVAA 2XVNA 3V3WA 3L0NA 2OG9A 3TU9A 3LPFA 1OC5A 3TTEA 5JIPA 2XZ9A 2WSYA 2ASHA 4LT9A 1VJSA 1BWKA 1XLFA 3EPNA 2P8BA 3N73A 1H61A 2BFGA 3ARYA 4O54A 1XCXA 1IYXA 3GUWA 3LNPA 4KGLA 3W2MA 5D2XA 3GK0A 2REQA 3QKEA 4DBEA 2GOUA 4XIMA 1UP0A 4H3DA 3WJSA 1OF8A 2BGSA 4YPJA 4GACA 3OBEA 3WJYA 1YE4A 3TQVA 4WDWA 3GXMA 2E6YA 3E0FA 3TW9A 4H2CA 3TN3A 3Q58A 3Q67A 1GYMA 1QR7A 4R7WA 2J7GA 3LBCA 3CLMA 2CU0A 3TN5A 3RLHA 3RMEA 1F7BA 3CV1A 4EPDC 1GQLA 1P6BA 2QJJA 5EMYA 1JD7A 2VRQA 4DZ5A 1TCMA 1X38A 5C7VA 3LBMA 4FA3A 1GVOA 2VZUA 2G50A 4TX9A 2BDQA 3G1FA 3F7JA 4CQ9A 5LNRA 1B31A 1NDZA 1GVEA 3WEOA 3AICA 2AOSA 4AQLA 1K7FA 4LVFA 4J2PA 3PVFA 1E6XM 3A23A 4IICA 1DEDA 2QCFA 1KM4A 3FA5A 5D05A 3WD1A 2Z1XA 4CNUA 1XISA 1H7XA 4IJBA 2ICSA 1FWRA 3A9BA 5DCBA 7ODCA 4NZCA 3TXVA 1A4MA 2H3DA 3I6RA 2HCVA 2W63A 1OABA 2FB3A 4E2BA 3LCLA 3SURA 3DAQA 2RAGA 3WUGA 3H7UA 1ZL1A 1BGGA 3OQEA 2WVUA 3WBWA 2HBVA 3E0VA 4QGCA 3PJWA 4HPXA 1XG3A 1NDWA 4MIMA 1ONXA 4LALA 3UETA 3K2GA 1OGSA 5LHEA 1TTIA 4XKYA 3TQKA 3NXFA 5M3WA 1W6TA 4UCGA 3MYPA 4W7WA 2YDSA 1V79A 4PSPA 5LIUX 4UQAA 1ZUAX 1PV8A 2ISVA 3B97A 1IR1A 3VC5A 2DQWA 1EJVC 3G2GA 3UG3A 1TIMA 2PC8A 3QSTA 2ZVIA 5C9ZA 4RZBA 2XIOA 2XTKA 3SI9A 5A6TC 3VIGA 1VAHA 2GK1A 3KRBA 3FLUA 1J6OA 3H53A 1FDZA 1TPH1 2YXXA 3F1QA 2J88A 2FDSA 3LSCA 4EPBC 1H7PA 1GKPA 4F40A 4JFSA 1JD9A 2QNEA 1FDJA 4PUDA 1P7TB 4L4PA 1KBIA 4ZL1A 2AGTA 3B8WA 4O1EA 2FZBA 4B16A 4F79A 1CYGA 1R85A 4G2DA 3GWQA 4JNMA 3KWXA 1O60A 1B3OA 1EZ2A 1F8IA 1C7TA 1LBMA 4AD3A 3U2EA 3UZWA 3EB4A 1O5XA 1H4PA 2PTYA 4HN8A 3ALFA 4FOKA 4WIWA 1KV8A 1P0NA 2I9EA 4P8XA 1JEZA 4PFHA 1PXGA 3U7VA 1EJSC 3OJGA 3UR8A 1KTBA 5D09A 3QYSA 3OVQA 4D6DA 5DXYA 1WXJA 4RPQA 4LANA 2BLEA 4URIA 1W3IA 4C6BA 5I3IA 5CKSA 2PUZA 2QDHA 4CQAA 3T2OA 4UUIA 2CZFA 3A5VA 4XVDA 2EHHA 3GDTA 1WXZA 5FF4A 2C16A 4WLCA 4ZEPA 1W5PA 4FS9A 2WHMA 3BW2A 4NYYA 3BQ5A 4QR6A 3UJEA 3KCJA 4WOZA 5DEZA 2OQYA 4ZQNA 3VOJA 1Y8BA 1C7SA 3KFTA 3UJ2A 4HU4A 1XSKA 3LHZA 5HUOA 1MEIA 3ZVHB 1XIBA 2DT0A 1X8FA 1PYFA 4FHAA 1NFPA 4JYDA 5LGXA 1D9EA 1PVNA 1E9IA 2F2KA 3TH6A 1MQRA 4AD5A 3NR0A 2Y8VA 4FX6M 3PWAA 3W9ZA 2G97A 2VUNA 3G6MA 2F38A 3CAQA 3DCPA 3SIMA 3O0KA 4OV9A 3PSWA 1HKVA 1B3XA 4KW2A 2DEPA 4ZFCA 4EPEC 4RDVA 1W5OA 3TYCA 1V6XA 2J9ZA 3LLXA 1MZRA 5BWAA 2I16A 3TYEA 4RDZA 1DJWA 2DJXA 1XIDA 2A79A 1UBPC 3VM7A 4D8AA 1FY6A 1IZJA 2ISDA 3SUSA 1A0DA 3GDBA 5E5CA 4E4UA 3C56A 1LRNA 3VVGA 1LLOA 3PUEA 1XCFA 4ZOEA 2PCEA 2YCLB 4LQ1A 1DYSA 2PGWA 1SM9A 1E6QM 1EA9C 3IVUA 2WB5A 3CBWA 1H60A 3T0AA 4JNYA 2A3HA 1XCWA 1WDWA 2XIBA 3W7CA 5BCAA 4Q7BA 2ZX6A 3CUZA 3IRDA 4C1NB 1IT0A 3FV9A 4WGXA 3PTQA 3WQEA 2CBUA 3QV9A 2J8TA 3GB6A 4HU3A 4MWAE 3PY2A 5L9FA 1IGWA 5FESA 4GHRA 5D37A 3WQ4A 5AECA 1SJBA 2OZ0A 4GI9A 1CZ1A 2ZICA 4AD0A 4S3AA 2WVVB 2PSNA 1PX3A 1B9ZA 2CLIA 1XKJA 5BW6A 1XLMA 2C15A 3ENLA 5A6AA 1LP6A 3KBMA 2XIQA 2PDIA 2VX4A 5BXSA 1XI3A 4N6FA 1LT7A 3NQDA 9CGTA 1AQMA 1DWFM 4HZ8A 2BHUA 2DIEA 4GCXA 3B4YA 1ME9A 1R3YA 4MTVA 4WD0A 1PIFA 1SPQA 1EWEA 2D24A 1DTUA 4IFKA 3TX9A 4MNLA 1VFFA 4MFEA 3BCDA 4NVTA 1JRCA 3ECQA 5E6ZA 3U3HA 2QF8A 5HWNA 4NJJA 1RK5A 3PZNA 4US5A 2YDRA 1Q65A 4KF1A 4AVNA 3V7PA 5I2UA 4NU7A 2YSWA 4W8LA 3O05A 2VMFA 1RVGA 3UPMA 3MWAA 3NPWA 3PR2A 1W0MA 5BROA 1QO5A 1TELA 7REQA 1ZZMA 5I06A 4QDMA 3VMNA 2TYSA 4A3RA 1PKNA 3G1VA 5XIMA 5AB3A 2QV5A 3Q2DA 1UR9A 2V3EA 3EOOA 2WCGA 5HQEA 1R2RA 5A2AA 3B3DA 3A13A 1NFBA 2OWCA 2QJHA 3M5VA 3UZXA 3K4WA 1LOQA 3EKGA 2Q8LA 1R2TA 4GVIA 2FVLA 1XV8A 4RKAA 3ZWSA 3U2CA 3WLIA 4JN6A 4Q8TA 3DFSA 2QZRA 4XBJA 4AIUA 2QCDB 2HXTA 1A5AA 1EL3A 4H19A 5ABEA 2UWFA 3DFOA 3UXDA 2NSOA 4DYJA 4QM1A 3T05A 4AD1A 2Z00A 3FAXA 1DJNA 1S2CA 1R3VA 3FYOA 4H9MA 1XR2A 2QCEA 2ZQ0A 3ZO9A 3IIVA 5CC3A 5A8MA 1XLAA 2JF7A 3H21A 4K7YA 4J5NA 3G3DA 5CZTA 3NO1A 2EKGA 1GOMA 4RV3A 2WCSA 3YPIA 2POTA 2Y8KA 4RZ6A 4IPJA 4MDPA 1EPXA 1V77A 3HZ3A 1XLEA 1UD4A 2E9MA 1XSJA 1UPMB 2VWSA 1GQJA 4XBSA 3SB0A 4D9PA 3KDNA 2NUXA 3MBFA 1RAKA 3N4AA 1OEPA 1XH1A 3MHGA 2VFIA 4G7EB 1IT8A 1H09A 1OFOA 2YLLA 4AXNA 1F5ZA 1N82A 3SQMA 3UZJA 3VE7A 1BTMA 2E8YA 4L6OA 5TF0A 4N9BA 2GJXB 2XU2A 1SUXA 4C6QA 3W0KA 5FF7A 1D2KA 4Y90A 4R7OA 3W71A 4ACYA 1RCQA 2E7FA 3LERA 5JXQA 2I7GA 1CGUA 4JQ3A 2DH3A 3UR7A 1EFZA 2X0SA 1ZAHA 2L5HA 3SCWA 4JGDA 1I6NA 4XAZA 3CC1A 5BMXA 4OQVA 1CGXA 3I7RA 2WW5A 1F4AA 3W26A 3UR5A 4LCSA 2IMRA 1LRTA 4HMEA 3WD2A 3E5PA 1T96A 3WDHA 3W88A 3PJTA 1W1VA 1JFXA 3IEBA 1U1JA 1W9BM 3VNKA 4WSJA 2X1SA 5FL1A 3AQUA 3PAOA 4FXFA 4NRRA 1V7AA 3QZ6A 4IXHA 1NSJA 1M9HA 1ONWA 3RAOA 1X96A 3ZFHA 3LA4A 4IGNA 2A7NA 1L6FA 4JEJA 4PL2A 1BVZA 1Q7ZA 2RGLA 3RG6A 1GUVA 1U5VA 3GH4A 3F2CA 3WLQA 1TUFA 1XDLA 3MHFA 5HMSA 4C6IA 1SGJA 1ZLPA 4UTWA 2J66A 2AQVA 3SQSA 3NQBA 4LGXA 3V35A 4GIYA 1IZCA 3VNJA 2NX9A 1FKXA 3WG6A 1J18A 3ITOA 4MJMA 1MRAA 1ICPA 3EZ4A 1J5SA 3KX6A 4PMQA 3EYPA 4HMCA 2PMQA 3LYEA 3GU1A 1K7EA 3DECA 3JW7A 4KBXA 1E3ZA 1EYEA 3V0SA 3BLLA 1LTDA 1WXYA 1KM6A 5CSUA 3IJ8A 3HQOA 1THFD 3WUBA 2OJPA 3C0SA 4AWEA 4XZMX 1E9LA 5D2YA 3P82A 2PAJA 2WANA 3S83A 2QULA 4RZ5A 2OO0A 4RL3A 2ZZ2A 3VIOA 4H6QA 1TRDA 3CL7A 1W91A 2V69A 1QHOA 1EYWA 4B9ZA 1W9PA 3S6DA 1HVQA 3LI0A 1NP0A 3OPSA 3UWYA 2Z27A 5CSRA 4REQA 2W66A 2VP8A 3DFNA 4BQ4A 4IMEA 1KV5A 3ARTA 5I24A 3WLOA 4H7CA 2YKKA 1AA1B 1W1PA 3VKJA 3ID7A 4FLSA 4M6VA 3OG3A 4H9VA 1HJUA 5K7JA 3RIKA 1R47A 1V5XA 2ZUNA 2CFFA 1H51A 2QF7A 4RK8A 3UP8A 5E9AA 3GY1A 3H2MA 4OU1A 3LU2A 4IG2B 4IQLA 5AHEA 4JTHA 2J13A 4MY9A 3AS3A 3ORWA 4UOJA 1XBXA 3WEZA 5EMLA 3R43A 1NWUA 2ZWYA 3R25A 4ZQMA 4IF2A 1W17A 4YYFA 1VPQA 4JIRA 1UWUA 1SZFA 2D2GA 5I23A 2VCCA 3CUGA 2VX5A 1UUMA 4O50A 3RITA 2O55A 3WQCA 5HK4A 1ZNNA 2PDCA 4DWSA 1Q6GA 3CUFA 1TVNA 3FDGA 4PRWA 3NWRA 4DUOA 1K8XA 1KQYA 3WCZA 1UHVA 4JTKA 5AVHA 5AVNA 1BRLA 1E1CA 3G1YA 3TQPA 2P0IA 4LF2A 4GYPA 4HZ7A 3II1A 1W37A 5REQB 3S3GA 4U2ZA 1CIUA 4JAWA 4AD2A 5DQPA 5JVLA 3I6TA 1OB0A 4LAZA 1UZ1A 2BY1A 3CB8A 1BVNP 2F6UA 3P8JA 4F9DA 1OC6A 3APYA 1CXFA 5A8NA 4AAJA 4GIAA 3AMDA 3MBDA 4PMXA 2XH0A 3H22A 3EX6A 4HIBA 4PYSA 3DFQA 3E0WA 4LEQA 4H9XA 1F2JA 5KTLA 3KWSA 2J74A 3UU0A 1SO6A 3LM7A 3VOGA 3OVRA 1W9VA 2INFA 1U5HA 4N9EA 3M9YA 4I5UA 3LHYA 3T78A 4KFNA 2PGRA 4YTUA 6TIMA 1ZY9A 3EWZA 1I0DA 1MWOA 3L67A 2E68A 3EWYA 2P76A 4I9JA 3M6YA 2J24A 5HQMA 3TYDA 4CEXC 4DO4A 2OU4A 3IJ6A 4XD5A 3GXNA 4HOXA 5BOFA 4UTMA 4HK5A 1W9UA 2QYGA 3KVMA 4PB3A 4PTNA 1C29A 1OGBA 5AY7A 3LENA 3DGBA 5IHSA 3D46A 2XVPA 3KTXA 4U5IA 3G0XA 2QAFA 4IIGA 3PFMA 3APGA 1O1HA 3VCNA 3B9EA 4IX0A 1ZALA 4H8NA 3WNNA 4B5UA 1OG6A 5J04A 4M5PA 3UA4A 4O52A 4H41A 3CMFA 2DUXA 2HTMA 2F84A 5CC7A 1MW3A 2VEGA 1FP9A 1Q6CA 4OHQA 4KRZA 1H50A 1SFTA 2E09A 3RXZA 2PDQA 3ZJ7A 4IGMA 4PCNA 4E3TA 2TSYA 4QSHA 3U9IA 4B5WA 2YCIX 3CQKA 3MPGA 3VIKA 3URQA 5HUPA 3IK4A 1TKKA 1L6GA 3H70A 3L4TA 3NVDA 4WSKA 5CGMA 2GVEA 4H7VA 2DUAA 3S8HA 1T5AA 1J0ZA 3W22A 1YEYA 1AZ2A 3QMRA 5CZSA 4QSFA 2TODA 1G01A 4EVZA 5K3VA 1F9CA 3PSVA 3SW6A 4OBRA 2WKJA 3TEVA 4L1WA 1OADA 3F2DA 4GX8A 3AZTA 3FN9A 4LVDA 1J12A 3O9NA 1K4GA 5HPCA 4A05A 1AW5A 3ALGA 3PBVA 1TQXA 1XIEA 3L2MA 3RJYA 3NQ7A 4JY9A 3SCQA 2AAAA 2VELA 2X7VA 2VO5A 2X0YA 3ITVA 4KRUA 4DAIA 1VCVA 4N7QA 2WAGA 3BL3A 4XZHA 5EL1A 1JPHA 3S5NA 2DVXA 3TMQA 4BHYA 2PPGA 3DG6A 4AZIA 5DT7A 3LG3A 4OJYA 2OPJA 1PO9A 4GIRA 4GFSA 2PDXA 4NRSA 1VF8A 1WQ5A 3L5AA 3ATZA 4IPLA 4DJDA 3GO2A 4EXQA 1JCLA 3LXBA 2OKTA 3ITXA 5KEZA 2QDEA 5LIWX 3C61A 1DHKA 2FTPA 1TQJA 2RH9A 4XIAA 1NDYA 1QT1A 4XSMA 4AEFA 2VFEA 5HNTA 3WL0A 2GQAA 2AAMA 3LHVA 1Z7AA 3N04A 4ZR8A 4ZOBA 1JF5A 4Z17A 1H7RA 2E6DA 3G5EA 3NOYA 1Z41A 1JVNA 1ZCCA 3E3HA 3LI1A 1H2JA 4O1AA 3HOJA 4DNHA 3ANVA 2ALDA 2G3IA 3GTIA 4AC1X 1E5JA 4O53A 4B4HA 1NARA 3FKRA 1NWRA 5CPNA 2WC3A 3SQLA 1AH3A 2QUUA 3MVIA 1G6CA 4Q4PA 1TB3A 1JI1A 2OOFA 4R5EA 3W3OA 2PDGA 1JDCA 3OVGA 3PC0A 1B2YA 2Z28A 4QQ3A 4C6JA 8CGTA 3KP0A 1QWGA 3QBUA 1NY1A 3TDFA 4CNPA 2WVTA 1Z9AA 3H6OA 2VRJA 1CI1A 1HFBA 3CIVA 1P1XA 2XPKA 2J8GA 1AL7A 4ZTXA 2HV5A 3IJIA 1WO2A 4H00A 4DIAA 3W1NA 2VDGA 3DI0A 2E5BA 2HS8A 3HQNA 4TO8A 4B5VA 4LFYA 4IMCA 4WJEA 3OA3A 3N2TA 3VZXA 3AO0A 3WF2A 5IFPA 1C92A 1US0A 4IPPA 4F4RA 2C1GA 3O6YX 4OFCA 4HCHA 4MG4A 3UA3A 2WZIA 4NAEA 2VYOA 2OELA 3B8UA 3MSRA 1TV5A 4J3XA 3WJXA 2QPXA 4MWAA 4OKDA 3PUDA 1HKIA 2W0UA 2ZA1A 1J5TA 1H1ZA 1MVYA 1OQFA 4B5TA 1VFUA 4JCLA 4GI4A 1NOWA 2EPMX 3P8IA 3NCOA 2Z1BA 1UQZA 4UTKA 4RNFA 1HW6A 3MV11 3UG4A 3QLLA 4DUVA 2D0HA 5FOOA 2W92A 3CPUA 4ZO8A 1O95A 3F4DA 3SIZA 1FWFC 1R38A 3WK2A 1ODZA 4PRRA 4CQCA 3FVDA 4ZXLA 3R11A 1LBLA 2V81A 3HFTA 3M0LA 1BQGA 2EPNA 5DFAA 3E12A 4KCUA 4GG9A 1TRIA 1V6VA 4PEEA 4I5XA 3P67A 1W5NA 4JTSA 1VENA 1WBJA 1ZAIA 2CYGA 1P0KA 4PEKA 2EXOA 3K4DA 1QOXA 3R10A 1YNYA 4MKVA 2DT3A 3RM4A 4LY4A 4YNGA 2VEMA 2W9MA 2VC6A 4CGTA 3U48A 4XK2A 1L9WA 2J62A 1XRVA 1IR2A 2BY3A 1LL6A 3F5KA 1A5BA 1ZAJA 6ALDA 1BWVA 3IGXA 3MKVA 3V36A 5BU9A 4QLKA 5HOSA 3B9OA 3AHTA 5E0FA 5GJPA 3FGCA 3NZPA 1TPDA 1GJPA 4OECA 2J8FA 2G8ZA 1U22A 3NGFA 3UY8A 4PUNA 4WY0B 3FSUA 4UXDA 2FGZA 1NWTA 4YTQA 1T7LA 1XX1A 4NQ1A 3LLFA 4GNKB 1B5TA 5D9MA 2XFFA 4N02A 4INFA 2G3FA 4XUYA 1YDVA 1B0IA 3R0DA 1PZ0A 2A4AA 6XIAA 2ISFA 2A3CA 4AIOA 3S1GA 3WDPP 3QLDA 1XIFA 1XIMA 5HJXA 3LM3A 1BYCA 1YQ2A 4Y9PA 4UTFA 4CD5A 1FWEC 1EO5A 1N7KA 3CHCA 3G1RA 1QI5A 3RPTA 3WO8A 4GZJA 1YBQB 1IQ8A 2J4GA 4DZAA 1H0IA 4DEFA 3H2NA 4MFDA 1XIGA 3DIPA 3UY7A 1FWWA 3CS2A 1G7VA 3A6OA 3ZSTA 3I6EA 4F2UA 1TFVA 3IK2A 1EJ7L 4X22A 1EZWA 1UQYA 3T4WA 3CNYA 4WQ6A 1CXEA 5JH2A 4US5D 4XAPA 2YZRA 1A50A 3IRSA 3K4AA 3A47A 1S2UA 2P8CA 2ZRXA 4QRNA 1C91A 1JJKA 3W6LA 3BCJA 2DSUA 3S1VA 3VDAA 3MUAA 3CT7A 3IS4A 3K1DA 3PBUA 2ZTKA 4RLIA 4BS0A 4YCOA 2RDUA 4AW7A 4PC8A 1BAGA 4ZB5A 1XD1A 1VHCA 2DW6A 2GYIA 1KCKA 2QCNA 4JEQA 4KS0A 3H4XA 1FX6A 4DI9A 3UPBA 3O7UA 3PBGA 3A4WA 3MSYA 1OFEA 2PZNA 1XWYA 4IIEA 2QUMA 2OQLA 2BOGX 3NQ2A 3EX2A 5C2GA 3CZKA 4TQTA 4YYCA 2OYMA 3E9AA 2QIWA 4XUGA 4IZGA 4W9TA 4E0CA 4MY8A 4LYQA 3VIPA 3P14A 4GJIA 3WSUA 1HIZA 3V1HA 3FOKA 4AB4A 5GNXA 3NYZA 1UKOA 1PEZA 3ABOA 3O0FA 2V5JA 1KCZA 1RY0A 3FXGA 3OIHA 4HD5A 1TTPA 2ZYFA 4FB7A 4UFJA 5D8WA 1HF6A 1XYLA 3GQYA 3L4XA 3MMWA 4BA0A 1C9WA 4I6VA 1ZJBA 3W84A 4C6DA 1D3HA 1MDLA 1V0MA 3W7QA 4QTGA 3NO5A 1Q85A 3ZWTA 3MI6A 5EKYA 1PCKA 1QHPA 3T81A 1Q7MA 3GDKA 2XN1A 3WH5A 3G1AA 4XZWA 1JYXA 3MTWA 3B8VA 1J93A 4CQBA 5I3DA 3TLLA 5AC8A 3BWWA 5G4EA 1MW1A 1FCQA 4HPJA 3EOLA 3ARXA 2R1LA 4GYJA 5EMKA 1DP0A 5A94A 1TJ1A 2PE4A 4XQ6A 3T09A 2WLYA 2OX4A 1LWHA 2J7EA 2DV0A 1KM3A 2DZUA 4HK7A 4ZE5A 1WPCA 1O66A 4LYKA 5D9OA 3LLDA 2PRLA 3KBNA 3WQFA 3F03K 4MJ2A 5H8MA 5C54A 2NVDA 5I0DA 3IGSA 2WKLA 3N2OA 4B3ZA 1EO7A 1OK6A 3Q94A 1WE5A 4FX7A 3VD4A 3E5BA 3CPGA 2YA0A 1POJA 4WDUA 4A29A 1DIEA 1IZKA 2QCGA 4GQRA 2YOCA 4FPSA 1XG4A 1C3FA 2GJLA 3CV2A 3H8AA 3LZ3A 4NX0A 1DXIA 1XYMA 6TAAA 2EQDA 2P5NA 4HTYA 3W29A 1VB9A 3T42A 3QQ1A 2ZWZA 3ZVHA 3CYVA 4PULA 1CXKA 4PUMA 3ZM8A 1S1RA 4D6EA 3V5FA 4PODA 4W8BA 3J7HA 2Y7EA 3PULA 5E70A 5LNSA 3EA1A 1OCNA 4C6LA 5EBUA 3GBDA 2OEJA 1F74A 3PBWA 3S42A 1X6LA 3M0KA 3QC3A 1J10A 2BY0A 4GPNA 4WX2A 3VNYA 1GW9A 4XAYA 5E0CA 4JKKA 2CITA 1JNDA 5HXMA 4WUIA 3GR7A 2VUYA 3WFZA 3F5LA 4UOZA 1TWIA 2P0OA 2H8XA 3MKKA 3QYQA 3DG7A 2NQHA 1E6ZA 5AC4A 1EJRC 1SZGA 4X60A 4A21A 4M80A 1T6MA 5I07A 1IEIA 2PRHA 3XINA 3TYBA 1UG6A 4LH8A 2A5HA 2BXZA 3PAJA 4HSHA 1EC8A 5DLCA 4KFPA 3GVWA 4MLJA 1TSIA 1HO1A 3BAWA 5I09A 1B3YA 1KTNA 5DRIA 1FWHC 3BC9A 1XJBA 1JCJA 2CHRA 1EP2A 1LUCB 4MM1A 3A4AA 3HPZA 3W7MA 3IAPA 3VUSA 4ATLA 4LY8A 1GTHA 1IXOA 1IE7C 4WSHA 4C1NA 5TIMA 2CZEA 3KOYA 3VDHA 2UBPC 4R88A 3WLHA 3R0UA 2FGLA 4TXEA 1VBJA 4IPNB 4XISA 4XKMA 4JFVA 4AHOA 3I68A 2Z1VA 1ITXA 2H9AB 4H8VA 5H91A 3SRFA 3GFYA 3KDOA 4GYFA 1B4EA 4YS1A 1UCWA 1K9FA 3LUTA 1DQWA 5FJIA 3BV7A 1J9YA 1QPRA 4JTFA 1K8CA 1ZU8A 1ITUA 4EX4A 4Q8UA 1FWCC 2DH2A 3ICJA 1AQHA 3GR4A 4GH1A 4AZ6A 3NDYA 3L5LA 1AG1O 3U0HA 3WDRA 3POCA 3MO4A 1HKMA 2C0AA 1KD0A 1MYRA 4WCJA 3QY8A 3TP4A 1C8YA 3I4KA 3QN3A 3C4UA 5EMUA 3DUGA 1LG1A 1JCYA 1YLVA 4DWSD 1BGAA 3NFUA 4ACZA 1I2PA 1SW3A 3PHAA 2R1NA 5DX7A 1R9XA 4H6EA 3OG2A 3VXGA 1EGVA 1W3NA 2YB1A 4FIRA 4YN5A 1GVSA 4RV8A 4NYUA 2VZSA 4HU8A 3WK1A 4L9YA 2ZDRA 3W02A 3P81A 1AMKA 1NIUA 2HE5A 3D5HA 1PTAA 3THUA 2TPSA 1W1TA 3W85A 1BTCA 3WQOA 3O07A 5DANA 1AL8A 4HA1A 3QQ0A 4RUBA 3OLEA 4FNRA 4F8XA 4JTQA 2EAWA 1OZMA 4IIBA 3QVQA 4HMDA 3V0TA 4J3WA 1A5KC 4L4LA 4ENLA 3S5ZA 3EEZA 1E1FA 4HPNA 1R7OA 2YB4A 2YCJA 2Y63A 3MP5A 3SRKA 1YDYA 2GQ8A 5FL0A 1FH7A 2DSKA 2QCDA 1EF3A 4PTVA 4JHZA 5IHRA 4RW3A 1B9BA 3ITYA 1JNEA 4L4MA 2F2HA 1UA7A 1Z42A 4W93A 3URBA 3OBKA 4FR1A 3LCFA 3LHUA 3VZYA 3W23A 3W70A 4OGZA 1CPUA 1F6PA 2PGFA 4KERA 1J6PA 3BSHA 5DMMA 3CJPA 1P48A 2QGYA 1N8IA 3VIIA 4JZ5A 3E38A 3N9RA 3N9SA 4GBUA 4PBGA 4O0KA 4BF7A 2BHYA 3EXTA 5D33A 2QPUA 3WDJA 1Y5XA 4EP8C 1S38A 2WPBA 3RPDA 4L1GA 3L2IA 2ZXQA 4KH2A 1R6WA 3B0PA 3SCUA 4GQQA 1TPFA 1MMFA 5A6MA 1TR9A 1W3LA 4QG8A 3GHRA 4G7EA 3CO8A 3OBAA 2R9RA 1U2YA 4J28A 3OGSA 4ZA0A 1QOQA 5I79A 5A3HA 4XV0A 1SR0A 2FH8A 2DZBA 1XICA 4KPLA 2GJXA 4YVPA 1V0LA 3GG0A 3VDCA 3TIMA 4GQBA 3LX9A 4DYKA 3TZFA 2YGYA 1OSEA 3WLPA 4O8AA 1EJTC 3VGFA 4W88A 4S3CA 3SBFA 1F6YA 3STPA 2W3ZA 2KZHA 5AHLA 3CB3A 4U3AA 4AX6A 4WJXA 3I4EA 3LGEA 1KXHA 3RILA 3TW7A 2O9TA 1S5WA 2JEPA 5TAOA 4JN8A 2GLKA 4LS2A 1TWWA 2OOGA 3FHQA 1L6SA 1LL7A 2DZAA 4WJ8A 3F4WA 3PANA 4D2JA 1EDQA 2WV8A 2XFYA 4UFHA 3H26A 5D9PA 3PF3A 1PYMA 3N2XA 3P3BA 4S3FA 3WH9A 4ADSA 2WMHA 3GVRA 4EANA 3T0BA 4GISA 5I5RA 4PUUA 3ELFA 3USBA 4RXFA 2DPEA 3NPUA 3UJRA 2LLEA 2CBVA 1OG0A 4J3UA 1K03A 3UZZA 1W5QA 3LPGA 1G1YA 4I8YA 5AYYA 3EDEA 3BARA 4V27A 3VOHA 3RCMA 4HA0A 2ONEA 4DM1A 1UA3A 1ZBKA 3A4XA 1TV3A 1BSIA 2VVSA 2OT0A 4LV9A 2GVJA 5FEPA 4KQNA 2ABBA 2DZWA 1GZGA 2PDKA 3GG8A 4HZMA 2E25A 1Q2SA 4Z2KA 4DJDD 3NQMA 3R1ZA 2ZBTA 2V2CA 3W2KA 4DVOA 4LC8A 1UIPA 4HU0A 2I1OA 4Y9AA 3L66A 1JZ4A 4OUIA 4ERGA 2CERA 4O19A 4C6MA 4WOQA 1LWIA 1SFSA 1E3XA 2WKGA 5ABGA 3AU6A 1U1HA 9RUBA 2FMNA 1FWIC 1GTEA 1Z44A 1X7IA 5A1AA 4LJ3A 3OLGA 3GHSA 2KX9A 3EWUA 4XWUA 3AWNA 4A8NA 1O5RA 2GUUA 3G3MA 3U5UA 2UV8G 1JPMA 3O06A 1BF6A 2AKZA 4ZQOA 5DBUA 3AXHA 3CWNA 4HYRA 2EJAA 1VBRA 3WD0A 5CSSA 3L9CA 5E6YA 1V03A 4U28A 4E8GA 2GQ9A 4FZIA 3C52A 4XD3A 4JNZA 3NQGA 2QGHA 4AZBA 3FS2A 5K2ZA 3THQA 1KLYA 3LRLA 3O63A 3TW6A 1NJJA 2QEZA 1FKWA 1GHRA 2P50A 5FI8A 4IG2A 5F1VA 1GONA 3TTSA 3KL5A 4P7QA 3GVVA 4HPGA 2VGIA 2BVYA 2G3MA 3BZJA 5HULA 4CCDA 1O94A 4DO7A 1Q6QA 2NQZA 4AD4A 5I7GA 1N2VA 3GIPA 1W2VA 4UR9A 1I45A 4PMZA 2HJPA 3C2RA 1J2WA 5H6HA 1GWJA 1KB3A 3QRHA 2PDLA 1Q8JA 1V02E 2YJQA 1BKSA 3OU8A 3BV4A 3LTYA 1Z6KA 4MWAD 4KIRA 4GKTA 2GGHA 2FHCA 4M19A 1R3QA 4J3TA 3WQWA 1B57A 3PNUA 2DY3A 5DN1A 4FX8A 1DWIM 3W7LA 1V0NA 1BWLA 4AWTA 3NL2A 3BGAA 4X0NA 1YPXA 2XGIA 3VCRA 2PP3A 5REQA 3UYIA 2ZOXA 3V0UA 2CLHA 3ARPA 3O1NA 1XHGA 4ZO6A 2F7FA 5D2TA 3LV5A 3CL8A 3UG5A 1H11A 4Y8FA 2VDIA 3FA4A 3BOLA 1PX4A 2X8RA 1OFRA 3CV7A 4PCSA 2HVNA 3C2FA 3N2CA 4CCZA 2PDNA 3CQHA 2ZVRA 3M0ZA 1EOMA 3TAOA 4TMCA 3TSDA 1S39A 4H9UA 3H4GA 5SWUA 4BK9A 2QDDA 5HR7A 5D03A 1KRBC 1JG9A 1I4NA 1UD6A 2D20A 2ZUUA 3PG8A 2X09A 1Q6RA 4KWUA 4NJGA 1TWZA 2NZLA 2Y88A 8XIAA 3AZRA 4US6A 1GEQA 1KM2A 4M6UA 1FCVA 2CKSA 2Z4GA 4UTIA 3UWZA 4JIHA 3CK5A 3K30A 3W7DA 3VGGA 3SSJA 1WZMA 2PFHA 2PDHA 4AEEA 1VYSX 4TU1A 5I3FA 3S6OA 1MDRA 4FNTA 4HNNA 5C6MA 3K8MA 3QJAA 4GNJA 4DELA 1US3A 1Q6EA 3U4FA 4F2BA 4C91A 1XYZA 1WV2A 2JIEA 3QR0A 4UTJA 3ZYZA 1PPIA 4RZ4A 4YU1A 4NHVA 4WEVX 4M0XA 4S1FA 1N8FA 3CV6A 4Y96A 1GKQA 5HA7A 3VU2A 3HA1A 3MMDA 1V3HA 2R1PA 1ISWA 1UASA 4BEQA 3T8QA 2VXNA 4ILSA 1BG9A 5HPOA 2ZRUA 3DDMA 3LOTA 2ATMA 1CTNA 4O8RA 4GVGA 3TUUA 3CXOA 1GVQA 3BK0A 2GSJA 2D3NA 4WKHA 2OT1A 1MW2A 3AHYA 1XIHA 4MNMA 3ITLA 1XLJA 1DQXA 3GAYA 3UGRA 1A3HA 4LUJA 2FZ9A 2X0HA 3RR4A 2J25A 4M81A 2PWEA 2A85A 3RCNA 5A95A 2TMDA 3LGDA 4POCA 3S0CA 1JPDX 2EPLX 2FHFA 2OKOA 5XIAA 2RJGA 3TNOA 1TWDA 2NXHA 1OX5A 1QCWA 3T07A 5DY2A 3F4VA 8RUCA 4P8VA 4B9YA 1CB2A 3ITCA 2OYLA 3WH8A 2QVHA 1AVAA 3RLUA 1B30A 4DY1A 3LEPA 2OR2A 3L68A 5GQBA 4Z1YA 3ZLGA 2NV2A 1H62A 3B0XA 3TV8A 1NM9A 4V1XA 3PBYA 1W2PA 1UYQA 2QHAA 2ALRA 2BXYA 4KGJA 1W1A1 4JN7A 1H5VA 1V7YA 3THCA 3W1MA 3O15A 4JTAA 3A12A 1KBKA 4BY3A 4JIPA 3KOZA 4I7UA 3REQB 4PBEA 4UOQA 4IUOA 2JGYA 5CPQA 1LDCA 1ISZA 2FZDA 4EAMA 3CIWA 1CXHA 2WM1A 3WMSA 4QIUA 3IJDA 2FZ8A 2B4GA 3C5QA 4FXSA 5DRCA 3M0XA 2YL6A 5I77A 2CLKA 4CN4A 1EX5A 3IACA 2E67A 1PUDA 2YYUA 2A2IA 1XLDA 1RBOB 2PP1A 1B54A 1RLCL 1TZ9A 4AUBA 2EPHA 4MVAA 3VGHA 2ZUMA 2YPIA 3L23A 4GC3A 5KSWA 4NKCA 4LUYA 2WSPA 5CZKA 3TC6A 2E1DA 1ZSXA 3SECA 5EY5A 3FA3A 3VYLA 4UC5A 4UTWC 1IXNA 3C2OA 3H7RA 3BG3A 2PLMA 3B03A 3H2AA 5G1MA 4QLLA 4QX4A 1CGYA 2QCLA 2XFWA 1GQIA 1VLWA 3TTOA 3RO8A 2VQUA 2X1UA 3B0YA 2NUWA 4E4FA 1YW1A 4PMYA 1I0BA 3KS5A 1O6IA 1E56A 1TV7A 2REQB 4NXSA 4Q4RA 2CZ5A 1DV7A 3AJ7A 3UWEA 1PL9A 4RJEA 4GUGA 2PF0A 2XYLA 1YHTA 4FSAA 4ICCX 2CHNA 2Q09A 3SN0A 4O4VA 2JKEA 1EEPA 1OC7A 3WYZA 5KZ6A 1JPIA 1M7XA 3OYXA 1EGMA 4GVFA 1VKFA 2BXVA 3KZPA 3ZS4A 1FWNA 4KESA 5DMNA 4Z2IA 2FHBA 1W31A 3TA9A 2WHLA 3MYOA 4O1CA 1XQLA 1KWGA 3O3RA 3WDQA 1PTDA 1H1NA 2PB1A 4P8WA 4EWND 3DHPA 1RUSA 4HQVA 1P5BA 3PZ9A 1S5NA 2AMGA 1K4HA 4I7WA 1GOWA 1TMLA 1VRXA 3I3DA 2BVDA 2VT0A 2A3EA 5EYWA 2UY4A 1Y0EA 3TMLA 2FTYA 3EXRA 2RGMA 2WNWA 1KCXA 1X8CA 1GOOA 3GS6A 3RF9A 3GR8A 1EIBA 1UZ4A 4O18A 4H9YA 4ROQA 2D1ZA 3CHVA 5HJYA 1KFWA 2NXIA 3UXLA 3LQGA 3U5YA 4DWSC 2Z25A 4XG1A 1OFBA 2IPFA 3PNZA 1QW8A 1G7UA 4P8UA 1JL8A 4RXGA 2HVMA 4JCMA 3QV8A 2QCHA 4GYPC 1B90A 5J8LA 1JCTA 3ZT5A 2J47A 3NDOA 1ME8A 3CWOX 4FNQA 1GKRA 3AIEA 4J3SA 4O1DA 1C90A 1DJIA 3QTPA 3WFAA 2WPGA 4L61A 1K02A 3W37A 2HPIA 3NG3A 1KFCA 1FFRA 2GK1B 1WCGA 1G4SA 2PU1A 3IGUA 4Q8VA 3U7BA 2C6QA 2WO5A 4XZLX 3SY8A 2G3NA 4AYSA 1KLZA 3HJZA 1Z3NA 3VCCA 3ARUA 4AF0A 2V3GA 1RP9A 1V6UA 1AODA 1A5LC 4W7UA 4WY0A 4X2PA 1ZENA 3L4UA 1HL9A 1R3RA 2YIHA 2P3ZA 1JPKA 4BF9A 3ZSSA 4GGBA 3VPLA 3MVTA 4LCQA 1NWSA 1IHIA 2B0MA 3AYSA 5BRBA 3AFBA 2QUVA 5CC6A 5LA0A 4IL2A 3W7RA 4DBDA 3M0YA 4BI7A 4JTUA 1DXFA 4HHHA 1UR3M 1DIDA 5PTDA 4QXIA 2YDAA 4QCFA 3TVAA 4XZBA 3DENA 5M5DA 3MA8A 1LLZA 1PJ9A 2OSYA 4L1XA 1KO0A 4GBDA 3VDBA 1SMAA 3NL6A 4Q8PA 3BW3A 3B8DA 1YBQA 3FSTA 4LCRA 4FLOA 1LQ2A 3EDFA 3CPRA 3QSRA 4GNVA 3S2NA 1UOKA 4C6EA 4QE5A 1PAMA 4WY0F 1U5JA 2I17A 2WNZA 2YL8A 1VBGA 1WBHA 2E9LA 1XYAA 1WYIA 1CX9A 2VGFA 1QW7A 2YR1A 4O11A 1QJWA 4R53A 1K8ZA 1YXDA 2VEIA 4IQDA 4S3JA 5DO8A 4S2BA 4AH7A 4ROPA 4UIOA 5E09A 3B8SA 1V0KA 1E71M 4JTLA 5IDIA 3UR2A 1E0WA 3CHEA 2XZ7A 2D23A 3CTLA 4MDOA 5C70A 1ZJAA 3BLDA 4S3DA 2ANUA 1EJUC 4JS3A 4Y2WA 5I3KA 3BLIA 1RALA 3BZGA 3MQTA 1EJWC 4LVAA 1AMYA 2A3AA 4ZOAA 4HHMA 2G0WA 4GY7A 4ZGYA 2WJEA 5LA2A 1PWLA 2V5CA 4UTTA 3NZQA 1F3WA