4PTDA

Phosphatidylinositol-specific phospholipase c mutant d274n
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQNYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
total genus 105
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4ptdA00
3QR0A 3NO3A 2OTDA 1DJHA 5PTDA 1T6MA 4F2UA 4GNKB 4I8YA 1GYMA 3RLGA 4PTDA 7PTDA 4S3GA 3H4WA 1DJXA 3KS5A 3V1HA 5T9BG 1V8EA 2P76A 4I9JA 3EA1A 4RV3A 4I9MA 1AODA 3QR1A 2PTDA 1DJZA 2FJUB 4QJ3B 1QASA 2ZKMX 3L12A 4RW3A 5T91A 1O1ZA 2F9RA 3OHMB 3PTDA 1XX1A 3V18A 3EA2A 4I9TA 1ZCCA 1DJYA 3MZ2A 3H4XA 2O55A 1QATA 3QVQA 4F2TA 1VD6A 4RW5A 3CH0A 3KS6A 3RLHA 2PLCA 1PTDA 1DJIA 3V16A 4R7OA 4I90A 2ISDA 1DJGA 4Q6XA 1T8QA 3I10A 2OOGA 1DJWA 3EA3A 4QJ5B 1PTGA 2OR2A 4F2BA 6PTDA 4OECA 5T9CE 2PZ0A 4QJ4B 1YDYA
chains in the Genus database with same CATH superfamily
2VQUA 4RXFA 2BY2A 4WOZA 3Q58A 2YW4A 3CYVA 3SI9A 1K4HA 4JIRA 1Z69A 3CUXA 1EZWA 3TNBA 1JPMA 2DV0A 2OELA 3DHPA 3G6LA 1J0JA 3FIGA 1FDJA 4US5A 4FNSA 1BXCA 1ELSA 1BTCA 3WNMA 4B5NA 1LBLA 4B9YA 5A6SA 2JGYA 1XDMA 2PDIA 4UNKA 4CD4A 2YL9A 4GGBA 3WD3A 2V6AA 4TUFA 4ZR8A 5BXRA 4HMCA 4I9MA 3TOYA 1SU5A 2IKGA 4MLRA 3W29A 1M7PA 3DERA 4HA0A 4KEUA 4IFKA 3GHTA 3PWGA 3VKJA 1OFAA 4Y8FA 3IGUA 4IM4A 4MNJA 2PF0A 3HPFA 4S3FA 5D2TA 1TQJA 1XCXA 4DJFD 4QQ3A 3O06A 1G4PA 3B9OA 3H55A 4G8TA 1W1B1 4PE8A 4E4UA 3PB0A 2Z0IA 3RR1A 1TTJA 1NVMA 1FWSA 1M1BA 4UMCA 4XK2A 2Z1VA 3T78A 2WMKA 1HT6A 3EBVA 4BCEA 1I2OA 2Y24A 2PDXA 1GOMA 1OF6A 6PTDA 3S1GA 1DV7A 1HVQA 3GB6A 3I3EA 1OGGA 4UTKA 3GH4A 3T0CA 1E55A 1W1YA 3FJ6A 2ZX5A 4W4QA 2ZTKA 3H7VA 1UKQA 4PB4A 4XISA 3WD2A 4ONVA 1FWRA 3IWPA 4B5XA 1LT7A 1WX0A 1FH9A 4QFUA 3STEA 5CEWA 1F6KA 4H6QA 4CD7A 5G1MA 3AUOA 1WZKA 4JQ1A 3W1MA 2OQLA 4TO8A 2DQWA 4XTDA 3AIUA 3RO6A 3S2LA 5A6JA 2XPKA 1JCJA 3UG5A 3T05A 1CXIA 4PUDA 1HO1A 3MMUA 3BUVA 3IUIA 3REQB 1NIUA 4R9XA 1H51A 2WQPA 3QC3A 3TLLA 1KC7A 4A05A 3NCOA 5KITA 3KBNA 4IUGA 4W9TA 5HJLA 3UJ2A 2Y61A 1SZGA 3SM0A 2O92A 2AL2A 1XICA 2Z25A 3FW6A 2ACUA 2VT0A 4LUTA 4HCHA 5E6YA 3PNZA 4B5TA 2GJRA 4PC8A 3K30A 5D2YA 2ZC8A 2ISFA 3TJXA 4GBDA 1M7XA 1TO3A 3WLQA 4C6OA 4TV6A 4CGTA 3N29A 1R87A 2BHYA 3R94A 2WC4A 2QUVA 3GUWA 4FOUA 4U3CA 3MWAA 3UCDA 4NZ1A 3GNNA 4C6BA 3QLLA 4Y8EA 1ZENA 3DECA 1RLDA 2VYOA 1TREA 2OWWA 4N6EA 3ZWSA 1HKIA 2RJGA 3B0XA 3P61A 5CC3A 1KCLA 1FBAA 4Q8QA 1TRIA 2VCAA 5HOSA 3DU0A 1HXJA 4S3GA 1YPFA 3IAQA 5FJOA 1PVNA 5I07A 4F3HA 3E0LA 5ENLA 2ACSA 2ODOA 1ICPA 5C7VA 5AHNA 2PP0A 4AY8A 4MPQA 2P88A 5M1TA 3RYSA 3VNLA 2G37A 4ZTXA 1KM6A 1RALA 4D71A 3A22A 1HIZA 3ARPA 3POCA 1EFZA 3N3TA 3PSVA 2BGQA 4WY0F 3FNDA 1ZY9A 4E5TA 1B54A 4MADA 2WZMA 4TX8A 1Q13A 2XN0A 1UMYA 4K36A 3R2GA 1BTMA 3S2JA 3S5NA 1RV8A 3UW6A 3PWIA 4LVGA 3WIJA 3GNXA 1MDRA 3VTRA 2O55A 4IJBA 2PI6A 4P7OA 3CHFA 1QW8A 1WAWA 2QW5A 2GK1B 2V5JA 3TNOA 4JFTA 3HZ3A 4GFIA 4YCOA 3THUA 3D46A 1WCGA 1OVDA 5DCBA 1VJZA 1UB3A 4Y9AA 3CUHA 2PWGA 4UZUA 1F76A 4ZFCA 4PUJA 4HK6A 3M07A 4QLJA 2YCLB 3W22A 1OT1A 4Z1BA 2ABAA 3GR8A 1RP8A 2WSKA 4MJ4A 4ERIA 3N25A 3RX2A 1E73M 1VENA 4V15A 4FX6M 3W28A 1VBHA 4DLFA 1XINA 5AZ0A 2J9XA 1UPMB 1ZJHA 4UTUA 4EXQA 1X1ZA 2QULA 4HTBA 3NGFA 4GK8A 4A8NA 1E40A 3L5AA 4DF2A 1K8ZA 2CLKA 1A5BA 4MY8A 4QHRA 2ZZ7A 1CECA 3IGSA 4HOXA 4GQBA 2FB2A 3UQNA 4LJ3A 3LZ3A 6TAAA 4YCPA 2QIWA 4HU3A 1XIBA 4IICA 2PP1A 3O6CA 4YXGA 1UC4A 1RQEA 1VYSX 2ZBTA 2WO5A 3P8IA 1AL8A 3K5XA 2WNWA 3UXIA 1ITQA 4P7LA 2CZ5A 3W88A 4XAGA 3E02A 3ZJ6A 3WFLA 4M7SA 3S2NA 3TN6A 3VINA 1BLIA 4X3ZA 1V6WA 1XIDA 4FF7A 4LYPA 3G1AA 1C91A 1LT8A 2PPGA 4AFYA 3GE7A 1G67A 1SJDA 1JZ5A 1XLEA 1GT8A 2VC7A 4I5RA 1FCBA 1NDWA 3NQ2A 1EHNA 2HVOA 1UPPA 2VFIA 3A13A 2TMDA 4GI4A 4BWLA 4U33A 3RRXA 1DJHA 2MANA 5BOEA 1KBJA 1QTWA 3E5BA 1GGOA 1WKEA 1Z32X 3OJGA 2QVNA 3C4UA 4O52A 4YTQA 1BYBA 1CXEA 1B3XA 5HWNA 1UR3M 4NT0A 1QNRA 1AZ2A 3N04A 2VTFA 1CX9A 1RJRA 3KL5A 3WQCA 3M43A 4PTVA 4NX5A 1K8CA 2EBNA 5HK4A 1G4TA 1AQHA 2RDWA 3FDKA 1B9ZA 1I75A 3R1ZA 4NY2A 1N7KA 1TWSA 2X42A 2XM2A 5FAJA 1IF2A 4JFVA 5DMNA 2ZZ1A 1JXKA 3N11A 4O1EA 2Z27A 1OJXA 5E09A 1TPFA 4H04A 3EPMA 1QOPA 4HMNA 3VX0A 1YX1A 3A4JA 5I3HA 3TAKA 4GC4A 3BWWA 1ISYA 4P61A 1RY8A 2YCJA 3CV2A 1XW8A 1HVXA 3USBA 2XIMA 3TTEA 2C14A 3PG9A 2Y62A 4ZO7A 3CC1A 3HMJG 1IHIA 1WDSA 4Q6JA 3W2UA 3L23A 3CUZA 3GYCA 4M29A 5BCAA 3A6OA 3RM8A 1VPXA 3NQ6A 5MF5A 1W3TA 2NSXA 1B5TA 3LUTA 1FQ0A 3B0UX 2YB1A 3WQ5A 1QO2A 3TDFA 3KRBA 4E3VA 1DYSA 3KRSA 1H7WA 2WKGA 3WELA 2E68A 5JH1A 2JKPA 5F7UA 1VH7A 2C15A 4KEMA 2VO5A 3WH9A 4LEFA 4NX0A 4IX0A 3U8GA 4HSHA 4HU0A 4N02A 4GA8A 2PWHA 4JFUA 2OQYA 4JQ4A 5CSYA 4F0HA 2FPVA 3URNA 3OG2A 1K8XA 3O6AA 3B9NA 3GU1A 1EBGA 1RQHA 3TU9A 5I7GA 3G0SA 3P62A 4WR3A 5IHRA 3QH2A 3LZ5A 2YCKX 3CB8A 1JGMA 1Q8JA 5TNVA 3ABOA 3T7VA 3TW9A 3R13A 1ZGDA 3AJXA 3IPWA 1B4KA 3VIFA 1JD7A 3PVFA 1PWMA 1PIIA 5D4YA 3LGEA 5FL0A 4JBRA 1HW6A 1FH7A 2RDUA 3TCEA 1LLWA 3I10A 3THAA 4QRNA 4M8UA 3W74A 1Z7AA 1JPDX 1LUCB 4UQBA 1LF1A 3WH6A 1ADSA 2CLOA 4GQGA 3H8AA 4G6CA 1TMLA 4M1RA 3NWRA 1XKYA 1JCMP 1L8NA 3O9NA 1F5ZA 2YFNA 4S3DA 2YLAA 5BROA 1T99A 1Q65A 3N6JA 1FOBA 4MSSA 3QKZA 2QJIA 1PDYA 4Q4PA 3VD9A 3VOJA 3CL8A 2ZX7A 3KDOA 3M9YA 4DXKA 2Q71A 1UWSA 2V82A 4I5XA 4Q33A 2FVMA 5HA7A 2WPGA 4NASA 1UJPA 1T0OA 3ISIX 1TX2A 4LALA 4WKFA 2WSPA 4MIMA 1W1VA 1YBQB 4PMZA 3HO8A 1R3QA 3PZOA 4L4OA 2Z1BA 3ANYA 1VEOA 3H4XA 4S3BA 4MVAA 3UXDA 4U31A 1QI2A 2R8WA 4EXAA 1TJ0A 3HN3A 2H3DA 4C6JA 3GHRA 3UR8A 1XD1A 5CKSA 4UR9A 2Q8ZA 4NJKA 1R47A 1A5LC 1E4NA 1OX4A 3WJWA 3HPAA 4EPDC 3MP5A 1PTGA 3WQOA 3URQA 4K8GA 2Z7GA 4IX2A 5CJ5A 2BZNA 5DY3A 2PODA 1AW1A 3CQKA 3GTHA 3IRDA 4TVCA 4FXRA 5I3DA 2YGYA 2HWGA 3OQ8A 4G9PA 3LPGA 1A5KC 4NP7A 1RCQA 4YTSA 4IPPA 1C8YA 2B31A 3ZJKA 3PM6A 1MW1A 5H8MA 1PCWA 2P53A 3PANA 1Z3NA 2XGZA 5IFPA 1UZDA 2ICSA 4D8ZA 5DN1A 1Y0EA 5AYBA 3TTYA 1ZP4A 3PZNA 3ZVHA 3MMTA 2D2GA 4S39A 4UTJA 3ZLGA 1G4SA 4QEHA 2ZUTA 3M5XA 1BSIA 3GSMA 4DYKA 1WXYA 2QF8A 1GONA 3PUEA 3CASA 5FJTA 3SN0A 2ZE3A 4MPKA 2B81A 1QI4A 1E5NA 4CNOA 2EJAA 4H19A 4Q3MA 1GUVA 2I5IA 4D8AA 1JYXA 2X05A 1XL9A 1JDAA 3UG8A 3CUIA 4C6LA 3S0CA 3LLDA 1M53A 5EB8A 3UGVA 1KCKA 2W27A 2XIQA 3ITLA 1Z44A 1VBUA 3VCRA 3CEUA 4AZGA 2WMFA 2VEGA 1HJUA 1DKWA 1ONXA 3BW2A 3A24A 1ZRQA 1AA1B 1XD0A 4WKAA 3GR7A 2G4JA 2WPBA 1YMYA 2WJEA 2HV5A 4MAVA 1GK8A 3UF9A 4FAMA 1KWGA 2QS8A 1J0IA 1JDDA 2FH8A 5I02A 5JBDA 3ID7A 1IZJA 3UVIA 1Q6GA 4QLLA 2PU0A 2WNQA 3BAWA 1EZ2A 1HKWA 1KXVA 1KW1A 2BXVA 2AAAA 1CXLA 1KFJA 3SSZA 1SQ7A 2XVPA 3ANUA 4IGNA 1XLLA 3DYMA 5HMDA 3KVKA 4OV4A 1ZU8A 3GG1A 5JQ9A 1GPFA 2IS7A 3RU6A 2J13A 5C9XA 3M47A 4OOZA 4XQ6A 1WB0A 4O28A 2X16A 4UR8A 3NDOA 2Y7GA 2WBGA 1J5SA 1XQKA 3O0KA 4NZJA 4LVDA 3CT7A 1ITUA 2AQOA 3OGRA 3RX3A 3VDHA 1W2PA 2J24A 2GQ8A 2WJDA 5IXEA 4L4MA 4LVAA 1UWIA 2QDHA 1PX3A 4PCSA 2H9AB 4QDMA 1UH4A 1O5XA 3NNTA 1A0DA 4Q32A 1Y7VA 3PBUA 3ATYA 4GC3A 4O10A 1SO3A 1YEYA 3GXTA 3LCFA 2A3HA 4BF5A 3UBPC 3CV7A 1XBXA 1DWFM 1BAGA 1JZ7A 3R89A 5DMYA 5FI8A 4OTKA 1JCYA 3AQUA 4FXJA 4JIHA 5M5DA 4HJFA 2PGEA 2F8QA 3TV8A 1U5JA 1LYXA 3NO3A 1K3UA 5E0KA 2Z2UA 3IJ8A 2CWXA 4JX4A 1DIKA 1QW9A 4BF9A 3SCOA 1JZ2A 2WMHA 2X1RA 3N2MA 1V7AA 3GXMA 2B7NA 1BG9A 5B7ZA 2BFGA 2Y2WA 3ITTA 1W5OA 1YDOA 5KTLA 4FP1A 1YQ2A 3CUFA 1P0KA 1IWAA 5FSEC 2UY3A 3MY9A 4HZMA 1V8EA 1S38A 4H7CA 3TH6A 1ENUA 1W3LA 1G1YA 5F4XA 3RJYA 3CAWA 4HPXA 4HT3A 4H8UA 4IL0A 2Z4GA 1HL8A 1FCVA 4WXZA 1XGZA 1GW9A 3TN5A 3KOFA 5HATA 1G5AA 4E2BA 5H1WA 1GW1A 3WLHA 3QMTA 5HMSA 3LBCA 5AB3A 2X09A 2VOMA 3VD7A 4DWSA 3B0VC 3GH7A 3L0NA 4LCRA 2HCVA 2UY4A 4LQ1A 4R88A 4UTWC 4L1GA 2NV2A 2BB0A 3BCDA 1ISZA 3AHYA 5FJJA 1V0NA 3QMSA 3A4AA 3E0WA 4O11A 4PCNA 3SN1A 1S2VA 4RDVA 2RKXA 2XVLA 3OOQA 3RPMA 1W9BM 1WBJA 1GEQA 3EX2A 4DBUA 2CHOA 1TELA 2XH0A 2PWUA 3MHGA 1GVSA 4NYUA 4KIRA 3NSXA 5H2ZA 4RDZA 2VM8A 4DBDA 9RUBA 3S6TA 1R6WA 2JEPA 3LMYA 2A2IA 4GQ0A 4RKAA 2BSLA 3KOYA 1UZ4A 1BWLA 1XUZA 1E9ZB 2D2JA 2OOFA 1DE6A 4C6CA 4JNZA 4E2DA 5BU9A 1NOWA 5A8GA 4IMFA 2V69A 4JY9A 3RCNA 1X8FA 2QPUA 2DZPA 1XLGA 1QBAA 2IKHA 1ZZMA 3QFWA 1P4CA 3PUGA 3SUTA 3H21A 3H6OA 3ORWA 1KR1A 3W7JA 3EX1A 3T55A 4BEQA 2LLEA 2E9LA 4YMZA 3BMWA 5K7JA 2IPWA 4LF2A 1GVOA 2DSKA 5JXQA 1NF0A 3M0LA 3LHWA 2X1TA 2QQ6A 4DF0A 3UPMA 5C9WA 2DPEA 1NF7A 3HBLA 3TQVA 1R3VA 1EA0A 4DUXA 1HUVA 3STFA 1UH2A 5J04A 3VFLA 3ARUA 1YW1A 4S2CA 3W7HA 4KH2A 3IARA 3BCFA 2XUCA 5ECVA 2OYMA 3ONCA 4AEFA 3GD6A 4DYJA 2YKKA 1FXPA 3HM7A 2G3FA 5D38A 4EVZA 2HJPA 2OSXA 4O1BA 2OU4A 3TXVA 4FIRA 1Y65A 3R0DA 2E0PA 2H8ZA 2FFCA 3AYRA 3W84A 4EWND 1ZNNA 1GVIA 4JX5A 1FVPA 4XD6A 5HNTA 3E2RA 3T2PA 3WG6A 4CEUC 3GDKA 2XINA 2AQVA 3PSWA 2E67A 4KFPA 3VDAA 1KRAC 1OFEA 4J40A 3KFTA 4XTIA 5D05A 3G1DA 3JU2A 3N73A 3B8IA 2QIIA 4H1ZA 4YTRA 1GQKA 4K3ZA 3DAQA 4BI5A 1A50A 3UEQA 1QFEA 2QJHA 2BVWA 2C71A 2Y8UA 4Z0SA 4GZ7A 5DO8A 4JTHA 2GGEA 4IPIA 4EANA 4C6FA 4TXEA 2YB4A 1N8FA 3KBMA 1UROA 4RX0A 4EF8A 2HMCA 4AUBA 1F4HA 3GRIA 2QGHA 4EK7A 2WLYA 4RNHA 4C1NB 1AJZA 3ZR4A 1FH8A 2NLIA 4MFDA 2W62A 3AMDA 1EIBA 4XWUA 2G50A 4NAFA 8CGTA 2CERA 4I6KA 1TJ2A 1NQ6A 2G97A 3APTA 4F2UA 3B9EA 3VOFA 1KLZA 7REQB 1P48A 1R30A 1S46A 1XIJA 2GSJA 1JFHA 1DTUA 2E40A 5DCEA 4DJDD 3P0XA 2YSWA 3NQMA 2A21A 3TSBA 3QZEA 1WDPA 4MYXA 1HKMA 2J66A 4BI7A 1R2TA 1GJWA 2PURA 2VC6A 4PRWA 1UASA 2EKGA 3QOMA 1YKWA 2DT0A 2CLEA 2EPNA 2NXHA 2QT3A 1ZBKA 2GJNA 4D6EA 3T1GA 1VP5A 4I9TA 5D2XA 4QROA 4YYCA 3NL5A 2OEJA 3TMLA 3VYLA 1U1JA 1MW0A 3AYSA 4PODA 3CO4A 5EMUA 1EPXA 4C1KA 2V2CA 3PG8A 4ORMA 5DX7A 1SZFA 2W66A 2XIIA 1X98A 3C2RA 1PUDA 3UCCA 3FYYA 1GQIA 3GFZA 5HMEA 2DORA 1MRQA 3GO2A 4QE1A 1S3HA 2Y4SA 3NPVA 4AVFA 3VM7A 3DYPA 3RK8A 4AD0A 3VOHA 1J5TA 4Y9PA 4PSRA 1SW0A 2I17A 3WL0A 3ZR6A 1OZMA 4GFSA 4RE2A 1AZ1A 3CUGA 3PY2A 3IEBA 1XBVA 1Z8AA 3POHA 1GKPA 3MO4A 1I6NA 6CGTA 3MBFA 4O1DA 2HK1A 2GVYA 1IQ8A 3ALGA 3BICA 3PTQA 1XIEA 4RK8A 1E0VA 2P8BA 3H70A 3UJSA 4XIMA 2X1IA 1O5RA 2I9EA 4G5DA 1KTCA 1AMKA 5E5CA 3OU8A 3NZ1A 4FZIA 3WFZA 2INZA 3GU2A 2O9RA 1C9WA 2INFA 3KHJA 2DUAA 1ECEA 2E1WA 2ONEA 4GUJA 4K7VA 4YS1A 3L4ZA 3I3BA 2VRKA 4E4PA 3KCOA 4HNUA 1QRQA 5A1AA 1BQCA 3BGAA 2Z1KA 3EMZA 3MMWA 3F2CA 3FN9A 2G41A 2QNEA 5DFAA 4O0KA 4KETA 3HG5A 4RUBA 3UU0A 1ZJAA 4ERGA 2XYLA 2CU0A 3QYSA 4W88A 3OPSA 4BWLC 4QJ4B 3GW0A 4ZVJA 1IWPA 1Q66A 1J18A 2F84A 4HNTA 3FAXA 4UFKA 1M3UA 1FWEC 3EKZA 1FX6A 2DZTA 2RDXA 3G3DA 1PEZA 1SMAA 2Y5JA 1M9HA 5LIUX 4O16A 3D5HA 3GG0A 3T0TA 3C6CA 4IGHA 5AC8A 2G0WA 1VFOA 3AXXA 4AEEA 5C8BB 3E38A 4JZ5A 1KM5A 4HPHA 5FF0A 3A4WA 1CCWB 3B0YA 1QXLA 2ZICA 1SFLA 2NUXA 4EACA 8XIMA 3TTSA 2F6XA 2VGGA 5HXMA 3H24A 4M1BA 4IG2B 5H8PA 1M7JA 4Q8UA 1AG1O 3CTTA 4OQVA 3SY8A 3TXZA 1XX1A 1RA0A 5KEZA 3KRUA 4GIAA 4JQAA 5J5RA 4LB4A 4UQEA 3IVSA 2D20A 1LL4A 1V4YA 4LNCA 3FCPA 4GG9A 1B3WA 3JS3A 4AXKA 4E8CA 3TWAA 1GORA 4M24A 5FEPA 4AYSA 3W7PA 4I7UA 1RXOB 4NAEA 4JKKA 1KBIA 5AVNA 4LS0A 4A8RA 2BV9A 4HNOA 1OFBA 1REQB 5I3GA 4TX6A 1EDGA 1PCKA 2BHZA 1TTQA 3WLIA 1PAMA 2FDSA 1ESWA 1WKFA 3E0VA 4CU7A 2P5NA 2ZWYA 3KM8A 1ONWA 2PUZA 2BVDA 1XLMA 4P7QA 3TFXA 4XZIA 3I6TA 3M5ZA 1E6XM 3L2MA 2WK2A 3L4TA 4Q4QA 1JCTA 5A6KA 1CB7B 4RDWA 1GYMA 3F5JA 3MV11 5DBTA 2NQZA 3WK0A 4QBXA 8XIAA 3QY7A 3H4GA 2GJPA 4ZO8A 4B92A 4IIEA 3NL2A 1AQ0A 3WLMA 3UNDA 4IP4A 3B8VA 4AQLA 1K4GA 2VWTA 1W56A 1M03A 2BMBA 1FWGC 3VM5A 5DMMA 1XBZA 2E5CA 4QGCA 3VIJA 3TROA 2GVGA 3VUSA 2V0TA 2J4GA 1Q6DA 4O13A 2ISWA 4MYAA 4K8HA 1FWAC 2O7SA 6ALDA 3WLLA 1C8XA 3RCMA 1HTIA 3B8SA 4IQJA 1CNVA 1RQBA 2EXOA 1EWEA 1RD6A 1WQ5A 3OODA 1LBFA 3CNYA 1BEUA 3IIOA 3BQ5A 3ITXA 3FY1A 4LWWA 3PPFA 3Q4DA 3KOWA 5IBXA 2HROA 2ZXDA 1NDYA 2C18A 3TP4A 1XG3A 3UWWA 4RNFA 4ROPA 1AVAA 3V1PA 1N55A 2R94A 3TQPA 2PLMA 2OYKA 5T26A 4I9AA 1KFLA 1PBGA 1S5NA 4UQ9A 1X1NA 1VBRA 3KS5A 3IANA 3NEVA 4DO5A 3HU7A 1TV7A 4PCPA 3M6DA 1CYGA 3ENLA 1SFTA 4FK9A 4CLMA 4DO6A 4U2ZA 1AODA 2EPLX 1E6SM 3T42A 4B5UA 4JFWA 4YWIA 3IVTA 3KWSA 2RGMA 4YIWA 1IXOA 1J12A 3L5MA 5CAKA 1KR0A 1LLZA 1LBMA 3DBNA 3IV3A 3LNPA 5F1VA 3HMCA 3CBWA 1M68A 1CWYA 1VFUA 4AZCA 2KX9A 4XKYB 4MKVA 4CU8A 4JR5A 4GH1A 1G0CA 3RLHA 5CLWA 1Q8AA 2P1FA 4CCCA 3LU2A 5I3IA 3C2OA 1EUAA 4XAZA 4KWSA 1HKJA 2XH2A 3NJ3A 1KRCC 3SUSA 1EBHA 4AIEA 4HHMA 3ZM8A 3CV1A 6REQA 1B3OA 1LRTA 1W5QA 4WJ8A 5XIAA 4LT9A 3MKVA 4MM1A 1ONRA 1QMLA 4PB3A 1AD1A 3WQ8A 1E0WA 4RNIA 4GVHA 3EWWA 5LNVA 2ASHA 1ALDA 3FDGA 4MZ1A 3W7CA 1E0TA 2A85A 1CT5A 1YNYA 1Q7QA 1F8IA 2GLKA 1W1A1 1LCOA 3OYXA 2OX1A 2C1GA 4DM1A 3CWHA 3KW3A 1J8VA 3M5YA 2DZSA 3O6YX 3WLSA 3VZZA 3UD6A 3DC8A 3GVWA 3VX1A 1W54A 2GGGA 3G18A 1TJRA 1UG6A 2CYGA 3A64A 3EWCA 4DJED 3BLFA 3T8LA 2GYIA 3GZ3A 2ZKMX 4U5KA 3M0IA 3F4DA 3MTWA 1RJQA 5IM51 3QRHA 4LOCA 4A4AA 1OM0A 1G01A 3ES8A 1M5WA 3VGDA 1GTEA 2QVHA 3M0VA 2CZVA 2DH3A 4IQDA 3UY8A 2QCDA 4IZGA 1SZNA 1JI2A 1L6WA 3CAQA 3MCMA 3QSRA 1EEXA 4Z2GA 1XLJA 2H3BA 1IZCA 3FK4A 5FF3A 1VZWA 3PTKA 2DT2A 4FLSA 3G1HA 4Q8TA 3VGGA 1W9PA 1OBAA 4E8GA 1R3SA 4MMWA 1VPQA 3KWXA 2V5DA 3F03K 2E5BA 4PULA 4ACZB 1OD0A 2VI0A 1L9WA 5G4EA 4AISA 5JH2A 2E6YA 4S3KA 2REQA 3LRLA 3P5YA 1XSKA 5A8NA 1XPYA 3NQDA 3R5EA 9CGTA 4JTSA 3DZ1A 3T08A 1XGEA 4YNGA 2DJLA 3S6DA 2IPJA 4B2DD 4S3AA 1VR6A 3U0HA 4PRTA 1QVBA 4UOQA 4NNCA 3QQ1A 1PDZA 4J27A 4ATDA 3S46A 3ZSTA 1S2WA 1AL7A 4JS3A 3MMDA 2WOQA 4Q22A 5EY5A 4PMXA 4GVIA 1W1ZA 5M2FX 2YIHA 1AQMA 2XFRA 1ISWA 1KO0A 1H7PA 2P10A 3ZZ1A 3VPLA 4A8IA 4UTFA 3W7KA 3P60A 4IFKB 4GZEA 2Y7FA 1T5AA 2X30A 3BMXA 1TWDA 4E2VA 3RGTA 4M6UA 4GO9A 3QEZA 4AC1X 4GX8A 4A2RA 2X1UA 3VUPA 3QJAA 2Q6ZA 1AUSL 1E15A 3GNPA 1UP2A 3HG4A 1DXIA 4W5ZA 3T40A 3M0ZA 3NQEA 3A12A 2Y5SA 3AMLA 2A6NA 4W8AA 3FSUA 4JTLA 3F1QA 4UTHA 4RE0A 3T4CA 1QCWA 4H7ZA 4NI8A 4F0SA 4GIYA 4XZMX 1FP8A 3R43A 4PR4A 2QPSA 1J4EA 2I14A 5AHLA 2VDHA 2R1KA 4L80A 2VDGA 3FS2A 2WBKA 1OK6A 3NAVA 1QUMA 4ZL1A 1JDFA 1PZ1A 3GVRA 3VU2A 1A5AA 3OP2A 1KRBC 2Y8VA 2GZXA 4KERA 1EO5A 1AK5A 1FRBA 4AVOA 4PH6A 5HAOA 4P5UA 3UYIA 3MSGA 4KQNA 2Z00A 3UWZA 2W79A 3UA3A 3NZGA 2E6DA 3MJYA 3MP3A 4XB3A 4DWSC 2PLJA 4RJEA 2G4FA 3M0KA 4XZHA 1OCJA 3SADA 2GOKA 4ZA0A 3LYEA 2J9ZA 1RPKA 1W31A 2J77A 1S5MA 2WKLA 3QYQA 1W91A 3HGJA 2X40A 3TN4A 3LXBA 4J3UA 1QO5A 4LSBA 4MJZA 1IE7C 3C56A 4LEQA 1OFQA 1QOXA 3MKKA 1Q2RA 4H83A 3W53A 1N8IA 1HZYA 2PBGA 3AXMA 1QBBA 1R9ZA 2FHFA 1SUXA 3MSDA 1CB2A 4Z2KA 4LAZA 4C90A 2D24A 4PBFA 2C13A 3WLNA 5L6UA 1TUFA 1EC9A 2HRWA 2CBIA 3F4CA 1HFBA 4PFHA 2EKCA 3EWYA 1I4NA 4PCTA 1G4EA 3UWYA 3S2CA 1GJPA 1RP9A 4ZENA 4HGXA 3IV8A 4TQTA 3CQIA 3N13A 1ZHAA 2CHRA 2Y88A 4D6FA 1KFEA 3REQA 4IGMA 1D3HA 1P5BA 2NWSA 2Z28A 5FJPA 4RZ4A 5E0FA 3SDOA 1XC6A 5FF7A 2QV4A 1AW2A 2ZQ0A 2XWEA 2VKZG 4AVNA 4J1OA 1QI5A 5TQLA 3GDTA 4I8DA 1JF5A 3SCTA 5HQLA 1L6SA 4IP5A 5BYWA 4EIVA 2V68A 4LBRA 4YHEA 3HQ1A 4E6MA 7TIMA 3G6MA 3OGVA 3IAPA 1QU4A 1YHTA 3QV6A 4B3KA 3URAA 2YBTA 3F4WA 1H5YA 3N2OA 4H9MA 1E71M 1MUWA 3QR0A 5CZJA 1UD3A 1QNSA 2Q3OA 3VDGA 2ZRWA 1EDQA 1PX8A 2ZXAA 4K1WA 5FKYA 1BVNP 3RHGA 5HR7A 1H7RA 1NDZA 2ZX8A 4KCWA 5BRBA 3TYDA 3MBDA 4HCDA 1QK0A 1I0DA 1MXDA 1R9YA 3EKGA 4MKNA 4FX7A 4UUIA 4BQ5A 1XH1A 3FVMA 3TONA 3FYOA 3V0SA 3DOPA 1RSCA 1R85A 3L4UA 4IT1A 3I6EA 2BG5A 1E70M 3S2MA 3SZ8A 4OT7A 4MNKA 1GKRA 2VUNA 2XIOA 4NZFA 2ZX9A 3UG4A 1V77A 4MTVA 4FS9A 4D1IA 1VBGA 1A5NC 7A3HA 1XLCA 4IIBA 4R5EA 2CBJA 3RO8A 3QC0A 1JFXA 2P50A 4UWMA 1JCNA 1DWGM 1W6TA 2EPKX 1D8WA 5D03A 3UNTA 2YCIX 4ICMA 3Q67A 3CT2A 2F2HA 2FDMA 4BQ3A 2PWFA 4HZ6A 3F5LA 4B9ZA 2OLAA 1OY0A 1TR1A 3CPRA 1FKXA 3MA8A 2E28A 3OLIA 1I2RA 3H7UA 2FKPA 1E3ZA 3S9ZA 3AZTA 3RCYA 2EG6A 1W32A 2R1PA 4AC7C 1T8QA 1NFGA 2CEQA 1QWGA 2Z2AA 1CXKA 5CPOA 5G4WA 3WF4A 5E1QA 3ES7A 4HNCA 3B0PA 4LC6A 3CZJA 4HHLA 4HK5A 3OIHA 5I09A 5LNWA 4XZWA 2EG8A 1W9DM 3QHNA 4UBPC 2VR5A 1A80A 1EJTC 3AJ7A 3QHOA 2G3IA 4KCTA 4K1GA 4K39A 3LSCA 2W92A 4FF5A 2VELA 3TSMA 3TJLA 4L4LA 2QCHA 1QT1A 4L61A 3KL3A 1ADOA 4O8AA 4ZB5A 2PSNA 3PTMA 2XN2A 2JGQA 3T2OA 3NYDA 4Z08A 4PMNA 4O18A 1R38A 3SGUA 4GUIA 2R9RA 5C9RA 4N2YA 2VX6A 3FA5A 5E0CA 3MYPA 3U2ZA 4CKQA 4J2MA 3TSDA 4I6VA 1MYRA 3LQLA 4ATWA 4S3JA 3T0DA 3L2LA 3L68A 2DSUA 4ZBCA 4Q7BA 2HBVA 4MG4A 1FWCC 3N4EA 4AWTA 2OX4A 1O66A 5LSMA 3TC3A 3SUVA 3SRKA 4IUOA 2PTYA 3RG6A 1XF0A 1AD4A 4J5NA 2XGIA 1PKYA 1VD6A 3I4KA 5EBAA 5HANA 5AYZA 4KBXA 3MSYA 1EDTA 4QE5A 4KGLA 4H8NA 3BW4A 4MOZA 2R1NA 3FHAA 1W3IA 2EHHA 5I3FA 3AXHA 1PJ9A 2DZBA 3CWOX 3NO1A 4LAKA 3WJYA 2F6KA 1JYVA 5HNUA 4PUUA 2BODX 3LOTA 3DHDA 4FNQA 3G1VA 3H2MA 3O0FA 3W7DA 4AIUA 4ASTA 3W70A 2PTZA 2NV1A 8TIMA 4ZCWA 4DJDA 4PGLA 3NPXA 3HIJA 3K4WA 5U4NA 1W3JA 5BOFA 3ARRA 2BGNE 4F4RA 4CU6A 1MXGA 1NOUA 4DF1A 3GW3A 4UFJA 1E6QM 3RUBL 3EYPA 5LXEA 3DG7A 4REQA 3W25A 3CLWA 4A3YA 3W1TA 1LM1A 2G8ZA 1GEHA 1Y8BA 3QR1A 4XSMA 4MWAE 4MWAD 2QJJA 3ZMRA 2EF9A 2ZRYA 1WNOA 2HQAA 4UTTA 4UQDA 7CGTA 4HP5A 2D69A 3ZLFA 3S6OA 4NYYA 4AWUA 1O1ZA 1WOAA 3GYEA 1F3EA 1S2UA 5HNNA 4M80A 1JRCA 3P8JA 2TSYA 4ZSTA 3AU6A 2J27A 4JTQA 5CSUA 4Q8NA 2DIJA 4OE7A 4C6KA 1V6VA 3NQ8A 3GTIA 4QCFA 4QITA 4GKLA 4C6MA 5DT7A 4EF9A 4KESA 3MHUA 1DJGA 1UYQA 3R6IA 3IGHX 3OHIA 4MUZA 1X1OA 3BLLA 2WHKA 5G2WA 3DG3A 1J0ZA 4MF4A 2WANA 2YBUA 2NUWA 2VZVA 3BG5A 2BY1A 3E2VA 3G8EA 1V3KA 3TVAA 1D3GA 2WCAA 1OYAA 2ZZ3A 3C0LA 1ZCOA 3B97A 3VC6A 3CK5A 5XIMA 1QOQA 1OADA 2IKIA 3BQ6A 4N9EA 1CEOA 4HYWA 3SIMA 1UA3A 4YVVA 3TYBA 3DFSA 4LXFA 5D2WA 5MKGB 3M7SA 5A6BD 1CGVA 2PTWA 2R6OA 4BQ2A 3GIPA 1DPMA 1NWRA 1TPB1 5D8WA 1KNWA 2Y6ZA 1IEIA 4AD4A 2WC7A 3OVQA 2YPIA 1HJXA 1V03A 3FFSA 3WQ6A 4LGXA 2W4XA 3W24A 3GC2A 3I7RA 2WXDM 1J96A 3SURA 5EA9A 4Z1DA 3IIXA 1H4PA 3DFNA 3KLKA 1UMLA 3EX6A 5AC7A 5BRQA 1YE6A 3ITYA 2AQWA 4IQEA 4NVTA 1RK6A 3WF2A 3STCA 1KM3A 4BJHA 4AAJA 4TMBA 4XVDA 3CHVA 3N6HA 4YJ5A 3ZQ9A 4LX4A 4A3QA 1VIZA 3U57A 2WB5A 3GTFA 4ACYA 4NIRA 5ABGA 3U9IA 3K8MA 5I2UA 1ISXA 1GTHA 3NVTA 4GWEA 1OX4B 2ZUUA 1BYAA 3ZVIA 4YVXA 2QUMA 3LM7A 1US3A 2J6XA 1VFHA 3TE9A 5GNYA 1UWAA 3UT0A 3FKRA 4UFMA 2RFGA 4HNNA 4AWEA 5A94A 3UERA 4EKJA 5AYYA 1TTIA 2J7HA 3GVQA 1I0BA 3W23A 5FJUA 1EQCA 2V38A 1HX0A 3GNRA 2XU2A 4E8DA 3SCPA 4A22A 3UR7A 3BDKA 4RZ5A 2OKTA 3NL6A 1ZALA 1J79A 3LENA 4QJ3B 2J79A 1NY1A 2E09A 1FDZA 2PDGA 3W2NA 2ZXBA 3N2XA 1TV4A 4GE8A 1F3TA 4WJXA 3VDBA 1MI3A 2WAGA 3VDCA 4TMCA 4UTLA 5AHMA 3C52A 2CHNA 4AZ5A 4DNHA 2PC8A 4X63A 5DELA 3N9SA 3MI6A 2PRHA 2ZRVA 4A2SA 2PS2A 4KT2A 3E9AA 3V16A 3ITGA 1HJQA 4IIHA 3LBOA 4PCFA 3WLPA 1R7AA 3S5OA 3HF3A 4C7FA 3IIVA 3SFKA 3G1XA 3NL3A 3MT1A 2PDPA 5E93A 2W63A 4QLKA 3PJTA 3VZYA 4O1FA 3UXLA 1O7AA 4WZHA 3M6YA 2VEIA 2VGBA 2YZRA 1YDYA 1WUFA 4XUGA 5IBXC 2DUXA 3HQNA 1PSCA 2C6QA 3B9DA 2SFPA 5FF4A 4L9XA 4Q8VA 2OVLA 1GHRA 3ZT6A 5DCDA 1C8QA 3P81A 4NZ3A 4ZXLA 5M03A 4I3GA 3RLGA 3TR2A 2DH2A 3O3RA 5I00A 3M0YA 4R33A 3I7QA 2A7RA 1FXQA 2E77A 4F40A 1E5JA 2WMGA 3PAOA 3BANA 3AS1A 1KXHA 1VCVA 5CLTA 2DT1A 2Q09A 4JICA 3LCGA 1J0HA 3R8RA 3WBXA 4YWSA 2WZEA 2V2HA 1CGXA 5JIWA 1H0GA 4HA3A 4B5WA 4US5D 1XH2A 1UKPA 3WH7A 1ZAIA 5DMLA 3WK3A 3CHDA 3BXWA 4HVXA 3E3HA 3LM3A 1JQVA 3CWNA 2QUTA 3G22A 6ENLA 3L4YA 1A4LA 5CJMA 4MZ8A 3TC6A 3VIHA 2VEFA 2BOEX 1ECQA 1E1CB 5ABFA 4IIDA 2E9BA 3GXFA 2CESA 4XZBA 5T9CE 2KZHA 3IJIA 4J35A 4FNRA 1BSLA 2OO6A 4QG6A 2XWDA 1C93A 1V93A 3DKJA 3KZPA 1GOQA 3W81A 2ZC1A 3LX9A 1NQKA 1IR2A 3QGKC 2Z1SA 1LQ0A 3OVRA 3TX9A 1JNDA 1ZFJA 1US0A 1UD2A 3BH4A 4CQBA 4AF0A 3NG3A 2D1ZA 3E0IA 3H22A 5KETA 1T8XA 2WHLA 3I68A 1S3TC 4DZAA 3V1HA 4ALDA 2OZ8A 4GUGA 3O05A 3QSTA 1C29A 4XBSA 2CETA 1NP2A 3FAWA 3S47A 3PZUA 4DBSA 3B40A 2IPGA 2YOCA 3N2CA 4ZB0A 4Z17A 1QPRA 2J8GA 3GDMA 5A69A 3VC5A 3ZJ7A 1A5SA 1LOSA 2A4AA 4PUMA 4HIBA 1PHQA 4PTMA 4LS1A 2E7FA 3WCZA 4F66A 1VHNA 2FGZA 1AW5A 2X8RA 4JGDA 3GIQA 4PMOA 3ZYZA 3DN5A 3TYEA 1ZTVA 4TVDA 3W7OA 4YHGA 2AGTA 3BAKA 2R14A 7ODCA 3LHUA 3W7EA 3WO8A 1IT8A 2BXZA 4JN8A 1XR2A 3SUWA 1OCNA 3TQKA 1EH9A 3LTYA 1JG9A 3CLMA 3QMRA 4O1AA 2FFIA 1XYCA 2VDIA 3W3OA 4AHQA 3ZS4A 3GNDA 3O6DA 5M3WA 3EB4A 4DBEA 1MDLA 5CZ0A 3WUGA 5A8QA 5BWFA 2WW5A 1NP0A 3TA9A 4R7WA 5IDZA 2V5BA 3LPFA 3WNPA 1EJSC 1ZLPA 3S9IA 3IS4A 2FH6A 3CIXA 3R0KA 5CGTA 3MWCA 4OHQA 1W8SA 1D7FA 1Q6FA 3OB8A 4QDWA 4FLOA 1DJXA 1QWKA 4Q4MA 3AYVA 4GHRA 1EX1A 3WD1A 4RL3A 1HJSA 1P1XA 3STGA 3O2LA 4HNLA 5AHIA 2GSHA 1K02A 3U7VA 3EDKA 2A79A 1L6FA 2PGRA 4EP8C 4MGGA 4O57A 1ZBWA 5M17A 3AZRA 3KDNA 5I6SA 3KCJA 2DJXA 2CLPA 3W7GA 2QZRA 3UCQA 4GBUA 1OGBA 1Q4NX 4YTUA 3PULA 1B3VA 2X41A 1TYGA 1WAUA 2IKJA 3IJ7A 4D6HA 1XLIA 2J75A 2DVTA 4Z2HA 1O5QA 4LVBA 2NWRA 1C8VA 3GIYA 3CAKA 1X8CA 4NHVA 5EFFA 3RILA 4W7VA 1K6AA 5A6LA 1PYMA 2Z26A 1SO4A 3ABRA 2ZRZA 4D1JA 1DTNA 3HPXA 3SQLA 4ML9A 3BURA 4RR4A 4LTSA 2V3FA 3N19B 3CL7A 3WLOA 1LROA 2V8ZA 3UA4A 4F8XA 2O0TA 1UR8A 1VFLA 2Z29A 3BMVA 1R2SA 5HQEA 3VIKA 5EMMA 2Q8XA 3ERPA 4O50A 3WSUA 1B90A 3KOXA 5I79A 5HWJA 1NWTA 2DFAA 3W7MA 5L9FA 4B3ZA 1RVKA 3MVTA 2J47A 3WQPA 3VNKA 4YTTA 4MUPA 1F9CA 1UWRA 3N4AA 3TK7A 1LL7A 4X61A 5CBBA 3BPWA 2GUBA 3QHMA 3SBFA 3E0FA 3OEXA 3ZT5A 3FSTA 1ADDA 1TRDA 3VNMA 4NJGA 4UTIA 1A0CA 2TODA 5FEZA 3RM4A 3T09A 4EXBA 3LRMA 4DIAA 1U33A 3WMCA 4QIUA 2VHLA 3P0WA 4C60A 4AD2A 2VUYA 3BGJA 2POZA 1DJYA 3W07A 5CG0A 1TV2A 4FLQA 4L6OA 1HJWA 2W3ZA 3A9IA 3VMNA 1EOMA 4MDOA 1X97A 3J7HA 3LHTA 3RITA 5REQB 4QX4A 4CNUA 4UMBA 5LKYA 1MW3A 4D6GA 4AMAA 4DO7A 4F48A 3WKZA 1E3XA 4PL1A 4TV5A 2D0GA 1R2RA 2YYUA 1IXQA 4R7JA 1X96A 5JMUA 4W89A 4H41A 3WBEA 3L2IA 5F4SA 2CXGA 4ZOAA 4ICCX 1HG3A 5A2AA 4PTNA 1VFFA 1UA7A 3BL3A 1X38A 5GNZA 2VFDA 2J78A 2CLIA 2A3EA 1W17A 4KEZA 2E9MA 3QXBA 2C7FA 4GPNA 4Y96A 3W1NA 3WNKA 4B4HA 4AW7A 3WZ0E 2DQXA 3VVGA 5G1TA 3WQ4A 4QNWA 1R0MA 2DY3A 3DFYA 3VKBA 3W1UA 3CJPA 1WKYA 1I45A 2R24A 4HYRA 1CLXA 4GMEA 4P7NA 2FGLA 1I8JA 5A5WA 1NELA 5RUBA 4NRSA 3CQ0A 3W37A 3VKKA 1J9YA 4S3EA 3G8RA 3BLOA 3TKFA 1PZ3A 3DKLA 3SB0A 3VD3A 3PTDA 1D2KA 1F6PA 1XQLA 2P3ZA 3IIZA 2ZUNA 2FGBA 4S1FA 1TTPA 5EU9A 3ARQA 1F61A 3T0AA 5E9XA 1KBBA 1VBJA 2XZ7A 5AN7A 4HPJA 3BC9A 5XINA 4ROQA 5DXXA 5CH9A 3KRZA 1IXPA 3SY5A 4JTCA 2RUSA 1G7VA 2FLIA 1W3KA 4D72A 3DEQA 1C90A 3IK4A 1X39A 3M4HA 2BLEA 3W00A 4NU7A 2CZEA 3MO7A 4HOWA 1WZLA 5FL1A 3BSMA 4B5VA 4M7TA 3W26A 1CGYA 2DEPA 1TA3A 1R3YA 3CZKA 1X6UA 4L56A 1S1RA 4MJ2A 1FWDC 1US2A 4V1XA 2VP8A 2WKJA 4PBGA 3A3XA 2PAJA 1PL9A 3ARYA 5A95A 2CKSA 2CIPA 3PJXA 3LCLA 3BOFA 2PMQA 4DUVA 4M5PA 4QDPA 4WLCA 1YRRA 1XJBA 3BW3A 4J3TA 3TWBA 3TYUA 3RIKA 3VFCA 1L6YA 4BZYA 3CV6A 4O1CA 4LYRA 1DIOA 1Q3NA 2A7PA 4UR7A 4WEVX 1I2QA 1RBLA 1DWIM 1R5YA 4A21A 3A47A 3GQYA 1LORA 5I3KA 3WQEA 1MSSA 1OFPA 1F74A 5A6TC 3L4XA 4HSNA 2ZRXA 9XIAA 2Q02A 3SY1A 1M01A 3RDKA 1PXGA 4AH7A 5K3VA 5BMXA 4TR9A 1G94A 1XLBA 3N9KA 5HPOA 1W0MA 2J74A 3W75A 1K03A 2YA0A 4XD5A 3N4FA 4UIOA 2HTMA 4GYPA 2VX7A 3COTA 3CGTA 3L21A 4AD3A 4D2JA 4WSKA 3GXPA 3UGRA 4HHPA 1TVLA 2EO7A 3QTGA 4PA8A 1DJQA 2FZNA 4AX7A 3UY7A 1FCQA 3EPOA 2O9OA 3SO7A 3CXOA 3MZNA 4QG9A 1ZB5A 2ALRA 2WSQA 1MWOA 5CCZA 1EPVA 1PE1A 4P8VA 2WYSA 3MP4A 3WEOA 3THCA 5B80A 1H1YA 4J3WA 1R9XA 4Q7NA 4GVGA 1H0IA 2DSVA 4Y9NA 2V2DA 2V9DA 2Y8KA 7ENLA 4ZO9A 2VX5A 3CZLA 2PBOA 3IVUA 1GVYA 1XIGA 3A3WA 1CTNA 4IIFA 2ISVA 2XSAA 1B1YA 2PDCA 3UJRA 5LIYX 2AKMA 1EJRC 4X60A 4M3PA 5CSSA 2YDQA 3LQGA 1K7EA 1VRXA 2FJKA 2PCEA 3BJTA 4M6PA 3QR3A 4PMRA 4BY3A 1HF6A 4DWDA 3P74A 1DQUA 3DH7A 4H8VA 1ME9A 4OFCA 2QEZA 5BRPA 1E43A 1U5HA 4DXXA 1PV8A 3SCQA 3LK6A 2C16A 2D23A 3PFMA 1TVNA 2GVJA 3EMCA 4CD8A 4N0RA 1EUNA 3MW7A 4LFYA 3P7YA 4XBKA 1DL3A 3UXKA 1FWWA 1YPXA 4DJDC 1P0NA 2VJXA 4ADUA 5EPDA 1GOWA 1IV8A 5C5YA 3VK5A 3UZJA 3HFTA 1GOIA 1OC5A 1GVQA 1E0XA 1HGWA 2ZUSA 4QQUA 3IGXA 4DAIA 3BAXA 3H4WA 4ZE5A 3FA3A 1FHLA 4IPJA 1B4EA 4QNEA 3MJMA 3QZ6A 4I9JA 4B90A 1FWFC 1TFVA 3UZZA 2FZMA 1S1PA 3O7UA 3EMQA 3KP0A 2DU2A 3P93A 1EGZA 1JEZA 3W2KA 2IPFA 1TV5A 3ZWTA 4UTTC 4DM2A 4F0LA 5C2XA 3GH5A 1PHWA 3UPWA 3OBAA 1CW2A 4PTWA 1CI1A 5LHFA 1XSJA 3AYTA 1AH3A 2JQXA 1JULA 1E4IA 1H7OA 2WHMA 3U2EA 1KTNA 3ALFA 1TPUA 3EEZA 3Q37A 4C5YA 1KBKA 4JHZA 1RBAA 1BYDA 4OIFA 1TZ7A 1CLVA 1VEPA 3LDVA 3DDMA 2A3BA 2H6RA 2E4TA 4ZQNA 2PDJA 3EDJA 4I90A 1W3HA 2G95A 1JI1A 5LZLA 4Y9OA 1JZ6A 3T9PA 5EFDA 4Q7IA 2G5WA 3THQA 1FDYA 2XN1A 1BGGA 3WL1A 3WENA 4GLEA 1ODUA 3U7BA 2NQHA 1V5XA 4O19A 1YXCA 3FJNA 3V5OA 1XLFA 2WSYA 1UC5A 7XIMA 5IHSA 1CPUA 2QUNA 1S2AA 4P7RA 4GY7A 4S23A 3TZFA 3GDLA 2HXUA 4MAZA 2I5GA 1VB9A 1OINA 2PGFA 2X1SA 1RJPA 2IQ0A 3D3FA 3QPYA 4LY4A 5LA1A 3FX4A 4HTYA 4I8YA 2VZSA 6XIAA 3HJZA 4LPCA 4J9JA 2FPTA 1GNXA 4HPGA 4PTDA 5FA5A 5IOBA 2IMRA 4QS6A 1HL2A 3IRSA 3RN6A 5E6ZA 4LYQA 3SW6A 4FOJA 4MWAA 3VNYA 4BKNA 4IP7A 4JD4A 4IMDA 3V5FA 2DIKA 4GXMA 3S1XA 1AH4A 1SO5A 3VI2A 4A3RA 2XM1A 1BXBA 4JKMA 3WDJA 2NQLA 3NR0A 3QN3A 4EE9A 2WVVB 3P84A 1SJBA 2CKRA 4KW2A 1A49A 2ZRUA 2OXNA 3BLEA 2IW0A 2ZDRA 2ZA3A 4MDPA 4U3AA 3G1FA 3FHQA 1SGJA 1KXQA 4HCLA 1YTDA 2VZTA 3UFYA 2JBMA 1P6BA 1SJCA 3EWBX 2OQHA 4EWJA 3MV01 2QHAA 4EPBC 3H53A 3EAUA 5ABTA 4S38A 4AZCB 1XHGA 4DRSA 1Q6CA 4OBRA 4LV4A 1CDGA 1DIDA 1F2JA 2VVSA 4JTGA 3B06A 4JFSA 4NF7A 1BWKA 1HJVA 3U2OA 3OA5A 1XBYA 3M16A 3DI0A 5HNRA 3UZXA 2OTDA 2VD9A 2Y70A 3H2AA 2XVNA 4URIA 1KTBA 1ME7A 2ACRA 3ABXA 1JD9A 3NQFA 3WLJA 1JYWA 1AQFA 3W2LA 4WIWA 3W6LA 2VD8A 2VZUA 4PMYA 2QCFA 5A6BA 5FESA 1LLOA 1Q85A 1VAHA 1KXTA 3OBEA 3V36A 5GJMA 4L1XA 1VEMA 1W9VA 3NQVA 5BXSA 1FA2A 4Q4RA 3QOKA 2CFFA 4FXFA 4CNPA 3IJLA 1DOSA 4QEEA 3PS7A 3PPHA 2VVNA 1RPXA 3B8UA 4KGJA 3XINA 4KMQA 4IISA 1P7TA 2V30A 3DHUA 4JIEA 1GOOA 2WMIB 3WNNA 4JTKA 2DZXA 3ARSA 1QPOA 1VCGA 1E9IA 4C7GA 5JIPA 5CZTA 4ZMGA 3LEPA 3C2FA 1KCZA 4PMVA 5GVJA 3WK2A 3DUGA 3DFOA 4XKYA 5AC6A 1XLDA 1ZJIA 2C0AA 3WH8A 3N12A 1RR2A 1TWWA 4C6NA 3NQGA 3NQ7A 2QCLA 1PZ2A 1H11A 3N1AA 3QV7A 4XO7A 2GUUA 1BVZA 1R46A 2BVTA 4YL2A 2XH7A 3WMBA 1BXNA 2WVUA 2QCDB 5KZMA 4X9YA 2NX1A 1XSIA 3SRFA 3UETA 3L5LA 1OFDA 4C5ZA 1GVEA 1ITXA 1JUKA 1R86A 1TR9A 4QE4A 1GYLA 4DQWA 3FXYA 2J7EA 4IF2A 4W7WA 5A2CA 1D9EA 1T41A 3OQEA 3W0KA 2WNZA 5JBEA 3AC0A 4AU0A 1FY6A 2E6AA 2ZIDA 1Y5WA 2YZ5A 2MNRA 3NPWA 5AY7A 2QYGA 4CQCA 1L0PA 1TCDA 2FZBA 2REQB 1A5OC 3P67A 1Q7MA 1TPEA 3QZAA 3N3MA 3P2VA 3WQFA 5HINA 4JN7A 1YLVA 4PUWA 1TQXA 4LU0A 1TZ9A 1DORA 1LP6A 1V0MA 5T8GA 3ITOA 2I57A 4KRTA 4LUJA 3AIQA 1JZ4A 4GX9A 3R0UA 1BRLA 3IUDA 3G0UA 1OYBA 5B7YA 4BS0A 2YX0A 1MXSA 3FOKA 2NX9A 1ONEA 2BP1A 3HQPA 5G2HA 3TMQA 3RLVA 2CLLA 2QJMA 5JBFA 1IT0A 1RY0A 3KTCA 2HPIA 4G7FA 1PKLA 5C70A 1RCOB 3UXAA 2GVLA 5CC6A 1B3YA 2ZZ5A 1QDSA 2VEPA 3BZJA 2BY3A 2Y85A 2BVYA 1BWVA 1UH3A 3E6EA 2GOUA 3GFXA 4R9OA 5KZ6A 2X2GA 2DW6A 3N15A 3L7RA 1XIIA 3GBDA 3ARVA 1IR1A 5H91A 4F9JA 4K38A 1EXBA 5FF2A 1Q63A 3KBSA 5TF0A 2GGJA 3H26A 2JF6A 3RX4A 1A53A 2JKEA 4FA3A 3C8FA 3A5VA 4D6IA 3DGBA 4KKXA 4H00A 1SJAA 2ZUMA 3AU2A 2NVDA 4ATLA 3WQWA 5AZ1A 4W8LA 1UZ1A 3PBYA 1LOQA 1U30A 3AHXA 4JXCA 3W7IA 1XRSA 4M6VA 1EL3A 3PN8A 1MQQA 4KWUA 4NZ4A 3VGEA 4GZIA 2V5KA 1KGUA 4G56A 1ZCCA 3AISA 2YYTA 1U2YA 2DUZA 3SQMA 3LLFA 4RW5A 2INEA 1PX4A 1WUEA 1UKOA 1IIHA 2JF7A 3TCSA 2PLCA 3CS2A 2HVMA 1RZMA 3W76A 5CAHA 5FACA 2XIBA 1UOZA 3BG9A 3LCIA 2FZDA 4EPEC 1QHZA 5AC5A 4XKMA 1SW7A 4KFOA 3L4VA 3UJEA 4R85A 4GISA 2AMGA 4B91A 4QSHA 4CCEA 1KQZA 1OX5A 5ABHA 1Z42A 2VEMA 4C6EA 4HNVA 4XAYA 1FKWA 2WSRA 4ES4A 1JVNA 4FOKA 4IFRA 1MUCA 3Q65A 1EJUC 1K7FA 1SR0A 2XIJA 3QGAC 4ZO6A 2GQ9A 1XI3A 3BK0A 4DJFA 2ZYFA 2PB1A 4AD1A 4DJEC 2Y63A 3WJXA 1OG6A 4XV0A 2WZIA 3GR4A 5LIXX 2HS8A 1A5MC 3FYPA 3NSNA 3EXSA 3ARTA 3MB9A 4PYSA 4U5IA 2NT1A 1Q5MA 1UWTA 5J5DA 3A21A 4GVFA 4NXSA 1X7FA 5LYRA 3EDEA 5C55A 2GWGA 3LSBA 2ATSA 2RGLA 1O94A 2GQ3A 1YXYA 1S2CA 4EPKA 4PFMA 1C92A 4JTAA 4PRRA 1VYRA 2FTYA 3LA4A 3CH0A 3NZRA 3GC5A 4Z0JA 1WPCA 2Z24A 4AHOA 4J28A 3C5QA 3STPA 1UJQA 1MNSA 4QSFA 3BE7A 3S1VA 3CQHA 2QMKA 4DY1A 4OUEA 4IL2A 2J7DA 1WXZA 3URBA 4CN6A 3YPIA 1H3GA 3RU8X 4DI8A 3GXDA 5AOUA 1XWYA 1ZAJA 2HEJA 1MQRA 4H9XA 4XBJA 3SN4A 2ON3A 1HKKA 3R8HA 4AZHA 5D8ZA 3LPPA 4PUKA 2J62A 3WUEA 5HJXA 5F2MA 1RLCL 1NTHA 3VGHA 2WJFA 3WUFA 1P0BA 1DIEA 1SYTA 5C0QA 1YADA 2AOSA 4ZFMA 3JZEA 3FJLA 4MY9A 4RDYA 3IIPA 5C2GA 3FV9A 2WM1A 3CMGA 2CBUA 3LXCA 3WMLA 3E49A 1YXDA 4QISA 3PZMA 4HMDA 4PL2A 4HBKA 4HHHA 2OKOA 3VKAA 4E3TA 2RAGA 3O15A 1R3TA 4HOZA 4ADSA 5KMYA 3W7NA 1JAEA 4BFAA 3LS9A 1H2JA 3F4NA 4C91A 1H50A 1XYFA 4QG8A 1BGAA 1H7NA 2C1IA 3IK2A 3QQ0A 4O17A 2GPTA 3TN3A 1KA9F 4A29A 4JDBA 1E9LA 1OWQA 1XKJA 2VRQA 3WY1A 5FOOA 4K37A 2A3CA 3T4WA 4WRHA 4Y7EA 1Q6RA 2XFFA 2J7GA 4R53A 2QCEA 4B4FA 1WYIA 1YIXA 1UIOA 1WV2A 2WZHA 4IFOA 4W87A 2VMFA 4F2BA 2V3GA 2A3AA 5JU6A 4QM1A 3FGCA 2HVNA 2DP3A 4HU8A 2X0YA 3JUGA 1JR1A 4W93A 2IUZA 1IEWA 3GTXA 3BLPX 1EYWA 4INFA 3ZOAA 1LJYA 2NQ5A 1ISVA 5BU6A 3W6YA 1LTDA 4JCLA 4F9DA 3XISA 3F4VA 2HSAA 3CO8A 2ZZ2A 2PP3A 1YE4A 3BAJA 4HKPA 3AIVA 3TTQA 5C9UA 1H5VA 2GJXA 1K9FA 4H3DA 5DBUA 2G96A 3ITVA 4WX2A 3WX7A 4GZJA 1VHCA 4O4WA 5DT5A 2PF8A 1KM0A 2UY5A 2AMXA 2I5QA 1CGTA 2XZ9A 4GINA 2ZFAA 3QLDA 2DDXA 1NJJA 3U3HA 4GNVA 2BBFA 1W1IE 2OPJA 3OHMB 1H09A 1IGSA 4H9YA 3L66A 4MLJA 5K4XA 4CQDA 2C79A 2WV8A 4ZOBA 4WSHA 5DLCA 2DVUA 4DYEA 3NDZA 5CZKA 4L64A 4DB7A 1ICSA 2F6UA 2XVKA 3EWDA 4I5UA 3BLIA 3WQGA 2EGZA 1NU5A 3M0JA 4WOQA 5IDIA 1KM2A 4JKLA 3DFHA 3PAJA 4AB4A 3IUHA 1J10A 2Q8LA 1POKA 3S4TA 5KINA 1RBOB 2W61A 4TU1A 2PCQA 4NILA 1EJ7L 3AMGA 3LXAA 4D6JA 1K8YA 1E72M 6XIMA 4POCA 1GZJA 1JJKA 2RDTA 1YTEA 1MW2A 4Z2LA 4JTDA 3DI1A 1XIMA 3NPUA 4FNTA 1V3MA 3LG3A 2WCGA 2ZE0A 1CXFA 1W37A 3MS8A 1LWHA 4G7EA 3AAMA 1I9CB 3VKDA 5AFDA 1TE1A 2ATMA 4YN5A 2GDUA 2Q3RA 1BFNA 4JNMA 4KCVA 1SVDA 3G24A 2PRLA 5ABEA 4FXSA 1W5NA 4GYFA 3WK1A 2WVTA 5DRIA 4REQB 3WD4A 1J6PA 3IACA 2F9RA 1ZUAX 1SFJA 1EO7A 3F7JA 3S42A 1DWJM 4KFNA 3OLEA 4C6IA 4GJ1A 1A3XA 4JEJA 1FWIC 1DP0A 4LY8A 2ZZ4A 2FIQA 1NAL1 3R79A 3AXKA 1UD6A 2V3DA 3NURA 1NEYA 1S5TA 5SWUA 3CH9A 1EGMA 4EAMA 1EB3A 1B30A 3BSHA 3CTLA 4RPQA 3W1LA 3NDYA 3NM3A 4GYPC 4WVXA 5D9PA 1B3ZA 1E4MM 1XISA 2C3ZA 4XVEA 2OR2A 2OT1A 4CQAA 2EPHA 3H2CA 2Z6JA 3LRKA 4RV8A 3GKFA 1F73A 3HB9A 1XFCA 4US6A 2I9UA 3LTSA 2PWVA 4LF1A 1MQPA 4PEEA 4Q8MA 4DNMA 1TMHA 1ZJBA 3BJFA 3K13A 3O1NA 3UWUA 2VRJA 3EKLA 4N42A 4HJWA 3SIZA 4JCMA 4DELA 2FPYA 3M46A 3PPCA 3K4DA 3C2VA 2OZ0A 4IMEA 3TEVA 3LN3A 1J93A 3SRDA 3K2GA 4MB4A 3Q94A 1WE5A 3TOPA 5D32A 2Y7DA 1WDWA 1XCWA 3F5KA 3PJUA 2QPXA 3E5PA 2VGFA 4RW3A 2XHYA 3IJQA 4C6QA 3ARXA 1JPHA 3EDDA 3OLGA 1O60A 3MC5A 2HISA 5DY2A 2VFHA 4AG0A 1LWIA 3B4UA 4JTJA 3M5VA 2HPMA 2J7FA 5DANA 1U1UA 3I6RA 4EOUA 2FYMA 1WDRA 5DF0A 3OVGA 2CZDA 4NJIA 4M56A 2WCSA 1V6UA 4JEQA 4IMCA 1BYCA 1TV8A 3LMZA 3ECQA 2A3LA 1W5MA 1MEWA 1EOKA 3GVGA 1DXEA 1SW3A 1GVRA 5KSWA 2OLSA 5TBOA 2DIEA 3NFUA 3PZQA 3MUAA 1O95A 4PEKA 3KX6A 3LB0A 4MJMA 4O0ZA 3ZR5A 5CC7A 3F2BA 3QY8A 4D9PA 4DPPA 2P3EA 2V67A 2QJGA 2J6VA 3U2CA 3NQAA 1M7OA 4J3ZA 4J4KA 2WM0A 3Q45A 1KD0A 4WY0A 1NDVA 4PUNA 2FVKA 2NUYA 2NXIA 3KVJA 1K9DA 1UW9A 1C3FA 4WSJA 4PN2A 4UMAA 5AC4A 4Z2IA 3FA4A 3SCNA 4L6HA 4JIPA 4B15A 1HN1A 2R1LA 5MKGA 2F61A 4KEVA 1RVGA 5AKQA 3HQOA 3CM4A 1YDNA 2W67A 4X22A 1H7XA 4JTIA 3CIWA 1QASA 1L6GA 5KZEA 1C7TA 1AJ2A 4O14A 4DHGA 1PTAA 1KWKA 1IIGA 1UUQA 4WDXA 3UYCA 1XDJA 2YW3A 2ZX6A 3SCVA 3VNJA 4QP0A 2QF7A 1JRBA 4GKTA 5D04C 4H2HA 3U5YA 1LRQA 4ZQOA 4FNPA 2JIWA 4DZIA 3AMKA 2GQAA 2ESCA 3WYZA 2VWSA 3CMFA 1ZS2A 3W73A 4AY7A 1MVYA 2UWFA 1EXPA 1TJPA 2VGIA 2FTWA 2E5DA 2ZCGA 4RPPA 1LDCA 1O4UA 3LI1A 4UFHA 5A3HA 4YU1A 2UY2A 2GDVA 4QXIA 5I3JA 4AYGA 3ZIZA 3A4XA 3M1ZA 4FHAA 1VFTA 1PO9A 3PB2A 2C0HA 1PPIA 2OGJA 4M82A 4ZEPA 3MQTA 5A8PA 3W71A 1EF2A 2NZLA 2ZVIA 3PJWA 4UOJA 3AI0A 3EOEA 4NNBA 4MWAC 2ALDA 4M0XA 5I0DA 1OIMA 2J9YA 1SZEA 3MCNA 5KZDA 6A3HA 4GGHA 1GJUA 3PR2A 1IWBA 1GWJA 1MRAA 4BI6A 2CC0A 2OZ3A 4Z42C 2FTPA 3LD5A 4GQQA 3T07A 3AS0A 1FWNA 3HV8A 3CU2A 1PYFA 1NM9A 1UOKA 1MFUA 3TLQA 2Q01A 4C6DA 2VCCA 1KGWA 3SCRA 4ENLA 2YL5A 3V7PA 5BMWA 4Z1YA 2VNCA 1W8GA 3THDA 3LCHA 1SM9A 3FJ4A 2VURA 4KRUA 2EPMX 2PDBA 3LGDA 4N6FA 3NO5A 1K77A 3W2JA 2J8TA 3CZGA 1NFBA 2JKAA 4ZODA 1QHOA 1TWIA 4V33A 1L8PA 3WBWA 3NUKA 2DGAA 3QV9A 3CPGA 4OBSA 4H01A 5ABFB 4PZVA 1J2WA 2CW6A 3BV4A 1E0UA 3ZT7A 3UR5A 2HE5A 1FHVA 4LBUA 2ZVRA 1OFOA 4LANA 2PC4A 1IXNA 4RNJA 1VLIA 1E1EA 3HPSA 2UZ9A 1VF8A 4M19A 4OV9A 4AF0B 3HPZA 2GL5A 3JR2A 2YFOA 3C0JA 4DI9A 3AUJA 4TIMA 3HFYA 4WDWA 2OG9A 3SEPA 5BXTA 1AH0A 5HMFA 1S39A 3Q2DA 1TPDA 3QGVA 3S5SA 1BD0A 2WZTA 1V6XA 2OB3A 4L6DA 4FALA 1A5UA 1EF3A 1KFBA 5HDRA 4HYVA 2I1OA 4DN1A 5AHFA 5BXPA 5CJNA 3R10A 2ANUA 2GFTA 4H6EA 1CIUA 4LH8A 1Z48A 4LUSA 3SQSA 3VILA 3RMEA 3AWOA 4WQ6A 1G9HA 1E56A 2P0OA 3S1WA 3WEMA 1TV3A 1T40A 3S5YA 5D33A 3RJXA 1XRFA 1YDVA 3GZAA 1E1CA 5I23A 3W01A 4H8HA 1TPWA 2NV9A 1V02E 1CENA 1DBTA 1H49A 3H2NA 3KE0A 1OG0A 1F05A 4DBWA 1DJNA 2XFYA 4UQCA 1KCXA 3N17A 3NA8A 4I7VA 1NWSA 3G2GA 4HK7A 3W1RA 3BAYA 4Z2JA 1FWTA 4A8LA 5DXYA 3GDBA 3KP1A 3B3DA 2WWDA 3S83A 3BVJA 1QNOA 4R3UA 7PTDA 3H2FA 4Y2WA 1XLHA 1P6WA 2OFJA 5T9BG 1SMDA 3T8QA 2DSZA 1V51A 1OC7A 3P80A 1R3WA 4G1NA 1ME8A 4OGZA 1O6IA 1TG7A 3EOSA 2QLYA 5DEZA 2AL2B 2BOFX 6TIMA 1Z6KA 3EA2A 5CZSA 4LUTB 4GXWA 3MANA 5C7HA 1LG1A 4GY1A 4O15A 1QATA 4GCAA 1GKQA 3LV5A 3VIIA 3SGZA 3DGRA 4FNUA 2NXGA 1TE6A 1W9XA 4TVUA 4PMJA 1EIXA 4GI6A 4QAIA 1UWUA 3W7QA 3N14A 1DJWA 4BR1A 1EX5A 2QV5A 2GDQA 4PMQA 3RF9A 4GQRA 1YPIA 2B7OA 4FX8A 1P1MA 3W2MA 3WN6A 2CITA 5GJPA 1FHDA 4UCFA 3C0SA 5CSRA 3D3AA 2V5LA 2JALA 1P0EA 5I5RA 4JN6A 3N6QA 1R3RA 1EP2A 4K68A 4IPLA 3CPUA 3K8KA 2QUUA 2GUYA 3AICA 1ZL1A 1OC6A 3LCWA 3PC0A 1J6OA 2QCMA 3CEPA 1B0IA 4DAFA 3CHCA 2W9MA 4JTTA 1XLKA 4DUOA 1BHGA 4OOUA 4GUHA 2D2OA 2IXUA 3UWEA 3FVDA 1V6YA 1U83A 3WLKX 1LL6A 3V75A 2R91A 2PDMA 4O12A 2DSWA 1GPWA 3DFTA 2NVAA 3GX9A 1S2TA 3PUOA 1Z9AA 4NG3A 3G1SA 4LV9A 2OSYA 3DFQA 2QCNA 3KBWA 4J7RA 4XUYA 1KV8A 2CXEA 1XPGA 1IT7A 1PIFA 3OBKA 1XGDA 4Y90A 1DQXA 2OZTA 3L67A 3GG8A 3UZYA 4OKDA 2PGWA 3W7RA 4X0VA 1JZ3A 4AZ6A 3LHVA 4OECA 1V3HA 4FB7A 3RFAA 1BVWA 4GI9A 2PFHA 3MUZ1 1XCFA 1VFSA 4HQVA 4JNYA 4WXYA 1EJVC 4XO6A 3LY0A 1HNYA 2B4GA 2QDGA 3GG7A 1V0LA 2A6LA 3SCWA 4D6CA 4AIOA 1GG1A 1MFVA 3AO0A 2G3JA 4KIEA 3LHZA 3H2EA 3K4AA 2ZXQA 2ZDSA 3D47A 4PUEA 3S1UA 2QCGA 1TJ1A 3H54A 1PWLA 4AX6A 2JE8A 4DJFC 2NLYA 1JCLA 2XSBA 2DZAA 4WKHA 2Y0FA 4JOMA 5K4ZA 4IMGA 5K9XA 4QAWA 1XXXA 1IEVA 1DEDA 2EJ1A 4LRTA 3TJ4A 4DXVA 3CL6A 5CPQA 3T0BA 4JHMA 3WEZA 2JFEX 4Q8PA 4UCGA 3KVLA 2GK1A 4BK9A 3L12A 1JDEA 3V0UA 1OCQA 3OO2A 4MZYA 5EKYA 4FIQA 4JTFA 2VEKA 3CZEA 1KB3A 1TVPA 3NOYA 3A9BA 5FEWA 3NOEA 2YDRA 4QS5A 1ICQA 3MUIA 3WDHA 3NQBA 2YCLA 3AIWA 1LZOA 3R58A 4KCUA 1XRTA 1E6ZA 4TX9A 4L9YA 1RA5A 3RMJA 3T81A 4S3CA 1EC7A 3VCCA 1A5CA 5REQA 1F8MA 3NYZA 1O12A 3CYJA 1E4LA 1RAKA 1V0KA 2PZ0A 3TIMA 3VCNA 3UR2A 3HV9A 3DYOA 3PZTA 3G3MA 3WF0A 4H9UA 2R82A 4LCQA 4UFIA 3G0XA 2F38A 3ANVA 3I3DA 1UD8A 1XIHA 3WH5A 5K2ZA 1TA3B 2VENA 1IGWA 3W4RA 2YCEA 2ADAA 4G1KA 3V3WA 2DZUA 2WVSA 4BQ4A 4QJ1A 4RCXA 4CN4A 4OBTA 3WLRA 2VFFA 2WLZA 3O8AA 5C71A 1ZBCA 1I1XA 4PMDA 3INPA 1JF6A 2IQDA 3VZXA 4ZZ9A 1FCUA 2W91A 4C65A 3N18A 4QCEA 3NGJA 4GOAA 3VKCA 3LLXA 3WJZA 1ZP3A 3T2QA 2BY0A 1JDCA 3PZVA 1EP1A 2AKZA 3VO0A 1TKKA 1JL8A 2J8FA 2PDUA 4CUCA 4B5SA 2XG9A 4AY1A 2O7QA 4CD5A 4UNIA 3GTNA 2QKFA 1HGYA 3B8TA 3SSJA 2HDJA 2HS6A 4IOTA 2BXYA 1GG0A 4JQ2A 3EGJA 2GVEA 2W0UA 4N7QA 1QNQA 3IJDA 1XRVA 3TW6A 1W2VA 1F3WA 3GS6A 1GZGA 1WOBA 2PWEA 3PUDA 3AS3A 2A7NA 2XVGA 2FHCA 1VQTA 4WDTA 3P3BA 1D3CA 4F0RA 4ZQMA 2OT0A 4X2PA 1WZAA 1QPKA 2XISA 2NW0A 1X7IA 2QCCA 2AL1A 3GK0A 4U28A 3W02A 3GY1A 3G1RA 2CZFA 5CPLA 3U5UA 2F2KA 2V3EA 5PTDA 4LYKA 4RZBA 1VCFA 4F79A 2OEMA 1LQAA 1F7BA 2HNHA 4AZIA 3S8HA 1FWJC 5TD4A 4RLIA 1BF2A 4XZLX 3R8GA 3UVAA 2P0IA 1T7LA 2VX4A 3TYAA 3LI0A 1YYAA 3GBEA 4IJCA 2ABBA 2PDQA 2IXVA 1F6YA 2RH9A 3UWQA 2W5FA 3R7MA 3RLUA 1F07A 1HO4A 2G3MA 1EQPA 4P2VA 2ZWZA 1XM3A 4JYEA 3BGGA 4J2PA 1BG4A 1XH0A 1NARA 1U1HA 5EBUA 3OZOA 1WKDA 3C2YA 2PD5A 3OVPA 1WBHA 2PDLA 2E8ZA 4O8RA 3W86A 1QW7A 2UV8G 4RE4A 3GKAA 1V3JA 4JHOA 4Q6XA 2NQ9A 1I2NA 3HA1A 2E25A 3SJ3A 1XYMA 4U2YA 4TOQA 1GHSA 3FEQA 3VOIA 2CNCA 1W3NA 4JDYA 2PE4A 1OCBA 3S3GA 3DXIA 4ICNA 2POTA 1RCXB 1JXJA 1PZ0A 4JIIX 1UUOA 1KM1A 1FHUA 1VGAA 3UG3A 5FJIA 3NQCA 1Q7ZA 2W6RA 4H9ZA 3N34A 3GC4A 3U6WA 4I7WA 5LGXA 1CLKA 3TTOA 2CLHA 3CQJA 3MYOA 4NRRA 1ZPTA 2FMNA 4Z1CA 2KAUC 3MU7A 4WF7A 4JAWA 3VNDA 4BF7A 4RV3A 4MHBA 4DO4A 3C8NA 3QBUA 4J3SA 3TJIA 1QPNA 2DZWA 4MNLA 4JTUA 1VLWA 3ABSA 1J01A 4V28A 5HPCA 2NX3A 5T91A 3I65A 4IXHA 2QAFA 3PBVA 1N2VA 1J0YA 3VE9A 1H63A 1DHKA 1WP6A 4GCXA 1D7KA 3ATZA 3MUCA 4WDUA 3HJEA 2OODA 2CLFA 3QVQA 4GIRA 3WDIA 4WJEA 1LUCA 3MPGA 3EXTA 4N9BA 4FSAA 4L1WA 1P43A 4H6KA 1XYAA 4IH3A 5HQMA 4MKSA 4HPNA 2ZA2A 3A5FA 3NIYA 3VAVA 3GWQA 4OZOA 1DJIA 4N9CA 2O9TA 5HUPA 1VJIA 2J88A 4CNNA 1G6CA 1WA3A 2HBXA 3WJSA 4ZQPA 2DT3A 3L65A 3ONBA 3UZ5A 8RUCA 3WDPP 3USZA 2XSXA 3NTYA 2PWDA 4IHCA 3BSGA 2WWCA 2XTKA 5CPSA 2WC3A 2ZA1A 3ABQA 2VR2A 3B4YA 4GY0A 4IQLA 4DZHA 1J11A 5LA2A 1R7OA 5F2GA 3KLLA 3M7WA 2BTMA 3CIVA 3KBJA 3VD4A 3TQ0A 2E8YA 3W9ZA 2C91A 1VFMA 1JUEA 3H2OA 4KPLA 3OYZA 3BAIA 4AMCA 4GRSA 3ZVHB 1YBQA 1H62A 2AGKA 4ML4A 1KQYA 3ZSSA 2PDKA 1EKOA 3PZIA 2Y5EA 3HOJA 3JVAA 3W72A 1IYXA 1H1ZA 3TZNA 2YXOA 3A23A 4DEFA 5CC5A 3OTRA 2XGBA 4MNMA 4MWAB 4AIBA 5CBIA 2H8XA 3RXZA 1N82A 4ILSA 5F4WA 4BEUA 3MSRA 5E70A 2EG7A 5F2IA 4F2TA 1MO0A 2FMOA 1UWQA 4WHBA 4UB9A 1CBGA 4Q8OA 1WZMA 3BO9A 3BJSA 2WNNA 4LW7A 5H8UA 1ODZA 2I16A 1H1NA 2V81A 1W5PA 3P5ZA 3JW7A 2YLLA 3G5EA 2HK0A 1TZZA 3U4FA 1G69A 4EAYA 3PF3A 3RRAA 3PBGA 3CB3A 5GQBA 3TYZA 1LOLA 4MB3A 3GHUA 4H7VA 5HWMA 4LBSA 4JTEA 3MUY1 1SR9A 2P8CA 5FAGA 4XG1A 1SZRA 4JL2A 2PA6A 3KVMA 1JZ8A 4HZ8A 1EWDA 3TA6A 2CBVA 2XFWA 3R25A 1KLYA 3AALA 3LHYA 5U7SA 2VC9A 3W1QA 3KOZA 4CNTA 3B05A 1XLAA 1F3XA 4W84A 5E9AA 9XIMA 5I03A 1JQXA 5A6AA 3MDWA 5HR6A 2P76A 4NQ1A 2DW7A 2Z2BA 3TW7A 3B03A 1HL9A 2FJUB 1QNVA 3H23A 3MHFA 3H12A 4NL1A 4M6QA 3V0TA 4JYFA 3RAOA 1RK5A 5D09A 2WVVA 2G3NA 2YA1A 1QR7A 2C19A 3B8DA 3SCSA 1XS2A 1OD8A 5D9NA 4M51A 4G2DA 1O68A 3HGRA 2HE8A 5F1UA 1QK2A 4LRSA 1V08A 1ZBVA 5HJYA 3O63A 3OW1A 3KBVA 1P7TB 3WF3A 2PU1A 1RHCA 4GIEA 4QJ5B 3TC7A 1UIPA 1P6CA 4JX6A 2JK2A 3ICJA 3RPDA 3TAOA 3W1PA 1DE5A 1LQ2A 3B9AA 1LRNA 2YL8A 3NEHA 2TPSA 4XIAA 2Y89A 3DX5A 4A3UA 3P14A 3V5CA 2FVLA 1TMQA 3DBPA 5A8MA 1HQTA 2B7PA 2D0HA 3GUGA 3L9CA 3K1GA 5CG7A 3H7RA 3OA3A 4D6DA 4CCDA 2A5HA 1S5VA 4KRZA 4UNLA 3OLDA 3T6CA 3EDFA 4HD5A 2ZUVA 1BF6A 4O0QA 2BHUA 3MCOA 2H9AA 2QMJA 4LAMA 4Y6GA 2PDYA 2J7CA 3ZXWA 1U22A 3V18A 4DWSB 2NT0A 1S5WA 4MY1A 2WMIA 5DQPA 2GJLA 4E2OA 3C86A 2YR1A 1VRDA 1TPH1 2V5CA 1MEHA 1FUYA 1GVFA 3QPEA 1BRLB 3F2DA 1OZQA 5LHEA 1NH6A 3ZLHA 4ZE4A 1UBSA 4TTUA 2J25A 3E2SA 3RPTA 4LUIA 4B3LA 1J2BA 3FLUA 3TUUA 4R34A 3DENA 3AIRA 4XX6A 3VABA 2DZVA 1WDQA 2OO0A 4HSOA 1EP3A 2X7WA 4DJEA 2Y7EA 3KTSA 3PZGA 4LVFA 5G1YA 4M81A 1TIMA 3EOLA 3DESA 3R11A 1GQJA 1V79A 3P6LA 3W1AA 1Y5XA 4V27A 3S9YA 3NXFA 3DC0A 3GDRA 2QR6A 3LPOA 5LGZA 1XYLA 4Y9MA 1A47A 3VA8A 2PRMA 2PDNA 4MB5A 3DIPA 3EA1A 5FJRA 4GJIA 2WMJA 3FEMA 3I7SA 3U4AA 1IZKA 1DJZA 4FMVA 1XG4A 2YDAA 1UQZA 1MNZA 4CD6A 3ME3A 3OZMA 2EAWA 1M04A 4BHYA 5D9MA 4OVXA 5DRCA 4XZNX 4CVWA 4RE3A 3CMJA 5CPTA 2YDSA 4KF1A 2VOTA 5EMJA 2WHJA 2X0SA 4DVOA 3MVIA 1UR9A 3EX3A 1KKOA 4P8WA 5LIKX 5D2VA 1OIFA 3BCJA 1SPQA 3VIPA 2D22A 1EJWC 3VMOA 1XIFA 2AAMA 4LAOA 5IFTA 4B2DA 2TRSA 4CQ9A 3KZSA 2V63A 5BZAA 1EA9C 3WD0A 3PWAA 3QQWA 3BLKA 2D0FA 3WMSA 1I1WA 2YJQA 3EZ4A 2EQDA 1EHAA 2DVXA 4NZCA 2WQDA 4NNAA 1XDLA 4ADTA 3VNIA 4ZSUA 4GABA 2YBVA 4CVUA 5FEXA 5BNKA 1VKFA 1T96A 1MZHA 1FFQA 5A6MA 1Q2SA 1XYBA 2CLMA 3LERA 5BWAA 2O4QA 2L5HA 1OK4A 1UD4A 1GCYA 1DQWA 3GM8A 3DFPA 3EX4A 5D9OA 1B2YA 1K70A 2PDHA 1SSDA 4L5ZA 1AJ0A 2BOGX 3G77A 4NXKA 1JPIA 3E74A 3OGSA 4N9DA 1K6WA 4UTMA 1UR2A 2OWCA 1KGXA 4P8UA 1TUXA 4WGHA 1VIWA 4V2XA 2OJPA 1H60A 1OQFA 2B0MA 2YXXA 1OYCA 2H90A 3MI2A 3SFWA 4CEXC 2I56A 4JIQA 1TB3A 3KL0A 3KAOA 4QTGA 3LGGA 4JYDA 1XC4A 3ITCA 1M65A 2JEQA 2XH4A 3EEGA 5JUVA 5C9ZA 2ISDA 3N2TA 2O9PA 1V02A 2GSEA 1Z89A 3KEHA 3D6NA 1GYNA 1I60A 1UKSA 5K9DA 1KFCA 2QXWA 4NAFB 1E51A 4A6GA 3ELFA 2X2YA 3FKKA 2QGYA 2OMAA 4H9TA 4U4MA 3E1F1 1XP3A 2PZNA 3PNUA 1G7UA 1RUSA 3PK7A 4WCJA 3RR4A 1EEPA 3SAZA 5EMLA 1O5KA 4JQ3A 4W85A 3V4BA 2EPOA 3JRKA 1H41A 1FWHC 3CAVA 2OCZA 1JGIA 2IQTA 4NSBA 2OLHA 2B7QA 4LUYA 1VYPX 5AECA 4FEZA 4BA0A 3MKCA 3PBWA 3LTPA 3C3UA 1GOKA 2VR4A 2NSOA 4HZ7A 1VJSA 4GXPA 4IMAA 4UC5A 2EEXA 3KTXA 3W83A 2QDDA 4TTGA 4IJRA 1RD5A 3KCLA 3AOFA 1TX0A 3MDUA 4LB3A 1OB0A 4C6PA 1E6RA 5C54A 4UXDA 2A1YA 1SFSA 1W1TA 4AD5A 4LAUA 4QR6A 4IPNB 5FSDC 1KFWA 1K7XA 1THFD 4O53A 2VC5A 3S5ZA 4C1NA 3L0KA 5CXPA 4AXNA 3E2QA 3W1XA 4ZQCA 4V1YA 1H61A 4FR1A 1UR0A 3VIOA 3BZGA 4K6AA 7REQA 4Q4SA 1EGVA 5CGMA 2RHGA 4DLMA 2X7VA 5HBFA 1JYNA 2WJZA 3WQVA 1C7SA 4CCZA 1JIBA 3O07A 1QNPA 1TWZA 4E4FA 1ML1A 4DZ5A 1XUUA 1MMFA 3PFRA 4KWOA 4PMUA 5GJNA 3SCUA 4XZ9A 1BPLB 4GNKB 3AHZA 1TPVA 3FGCB 4DX3A 4L65A 3CZ8A 3W6MA 3B8WA 1UR1A 5JVLA 2FB3A 2I7GA 5EGRA 3OG3A 2X0HA 5EYWA 1ITCA 3IJ6A 5CBJA 4H4IA 1UZHA 2ZOXA 3HGOA 5IRPA 4H6RA 2RJHA 4FR6A 3C2EA 3VNZA 3EXRA 4F0MA 2BS9A 3RM9A 1YTKA 2HZGA 1UD5A 3R12A 2GJXB 2VXNA 4IXXA 4C1LA 4B16A 1QHPA 1F4AA 1SSGA 4JTRA 1UKTA 1ZAHA 5MHBA 5F2LA 2ZZ6A 4GI8A 4GUFA 4W8BA 4AWSA 1L2UA 2VL4A 2OGYA 4NZ5A 1UR4A 3EWXA 1ZSXA 1M6JA 3EOOA 1Q45A 2OWXA 5AVHA 1W9UA 2BASA 3AZSA 3C3NA 3VD5A 4A3HA 1M41A 3AS2A 5TIMA 3GAKA 3QM3A 3BARA 1MEIA 3ABZA 4P8XA 3BV7A 3SECA 1GQLA </