4PTDA

Phosphatidylinositol-specific phospholipase c mutant d274n
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
296
Chain Sequence
b'ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQNYINEKWSPLLYQEVIRANKSLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
molecule tags Hydrolase
source organism Bacillus cereus
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
total genus 105
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4ptdA00
2ISDA 4F2BA 1PTGA 4I9TA 3EA3A 1GYMA 3OHMB 2OOGA 3EA2A 4RW5A 5T9CE 4QJ5B 1DJHA 1PTDA 1T8QA 4QJ4B 7PTDA 5PTDA 1DJYA 4I9MA 3PTDA 5T9BG 1YDYA 1DJXA 4Q6XA 4S3GA 3V18A 1ZCCA 4QJ3B 1O1ZA 3EA1A 3I10A 1QATA 1VD6A 3MZ2A 2FJUB 2PZ0A 4OECA 3L12A 4I8YA 4RW3A 4PTDA 3H4XA 3KS5A 3KS6A 4I90A 3QVQA 2OTDA 3QR0A 4GNKB 3H4WA 2PLCA 3V1HA 6PTDA 1AODA 3RLHA 3CH0A 2ZKMX 2F9RA 2OR2A 1QASA 3QR1A 4R7OA 2P76A 2PTDA 3RLGA 4F2TA 1DJZA 1DJGA 1T6MA 2O55A 4RV3A 5T91A 3V16A 4F2UA 1V8EA 3NO3A 1DJIA 1DJWA 4I9JA 1XX1A
chains in the Genus database with same CATH superfamily
5HINA 1NQ6A 4V1YA 3KRZA 4MNLA 1KXHA 3WH7A 3PBGA 1DJXA 4DJDA 1EC8A 3EDFA 4GBDA 4E2OA 3QTGA 1W3TA 2VR5A 4Q32A 2JEPA 3T55A 1QCWA 5FEWA 4GC3A 3W1TA 3BAYA 3W02A 3XISA 3N12A 2HROA 4TTGA 3NEVA 1CLXA 2GDUA 3F5KA 2PCQA 1NP0A 4JDBA 2C16A 2C1GA 3EB2A 3W7HA 2BB0A 2VUNA 5A8MA 1E56A 4PB5A 2Y8KA 3O63A 2G4FA 3PNZA 4HTYA 4J3ZA 3K8MA 5FOOA 1ZU8A 4I9JA 4XZMX 3W1MA 3WZ0E 3MHGA 4HA0A 1PIFA 2WNZA 1VF8A 3GSMA 1KB3A 1SMDA 2QCDA 4O11A 3GTIA 1I2RA 1VS1A 1NM9A 3TU9A 5EGRA 1TRDA 3ONBA 2FTWA 4QHRA 1NVMA 2C6QA 3LYEA 3UFYA 3OW1A 2PDKA 3PP7A 1GYLA 1JPMA 1KCLA 3NQMA 1RXOB 4TVCA 4N4QA 1E6ZA 3TCSA 2G5WA 4Z2JA 3KWXA 4FR1A 3U4AA 4GGHA 1X6NA 3NO3A 2QMJA 3M0MA 1XIHA 4PUNA 4YN5A 1BYCA 1OFOA 3O16A 1SZEA 3T81A 1J11A 2VR2A 3N3MA 3CV2A 3RRAA 5I6SA 2QCDB 3C2EA 2ISWA 5AOUA 3WQ5A 1JZ7A 3AS2A 3DCPA 2DZXA 1JZ3A 3WJWA 2VOMA 2D0HA 2QCCA 2PDBA 3TQ0A 1A5UA 1XCWA 3GHTA 3AXXA 3MS8A 2ZQ0A 1VBUA 3QF0A 5A95A 4B5NA 1NDWA 1ADSA 2IXVA 3VINA 3TW6A 1ALDA 4LAZA 4RK8A 4AXNA 3DFHA 3OZMA 1F8MA 2X1TA 3CV6A 4IIFA 4HNNA 5CZTA 1SZRA 1FFRA 1VYRA 2BBFA 4BK9A 3NFUA 5IM51 3CAQA 4H7CA 1V4YA 4DBEA 3HZ3A 4PBFA 3V16A 3VNZA 1M68A 1YBQA 4AY1A 2PGWA 4CKQA 4CUCA 5LIKX 1POKA 1I8JA 2W5FA 3NZGA 3E2QA 4YTSA 4IXHA 1F3XA 1MEIA 1GQIA 1M5WA 4XTIA 4I5RA 4TVUA 4S23A 4PL2A 4B5VA 1XFBA 1DWAM 4G5DA 2OJPA 3A21A 3H2EA 3WG6A 1PKNA 3CHEA 5A1AA 1Q45A 1JD9A 3FCPA 1HVXA 4C6OA 4H6RA 4A3QA 3CL8A 1PZ0A 1M65A 4XZHA 3ZQ9A 1I75A 2BOGX 3BAWA 3DI0A 1WKYA 2Y88A 5KSWA 3R13A 2G3MA 2YA2A 2ISDA 1XICA 3PUOA 1ODUA 4ONVA 1LROA 3QW4B 5F1UA 4H9UA 3WDJA 4J40A 4DAIA 2JKAA 1S46A 3CIXA 1AW2A 5BNKA 3SGZA 3BLLA 2GZXA 1CXKA 2JGYA 3L5MA 5EYWA 1Q6GA 1GVSA 1RVGA 3C0SA 3L5LA 4ZO6A 2OSXA 4AHQA 1EB3A 3LCIA 4EE9A 5D2WA 4JHOA 4QAWA 4LJ3A 2GOUA 4UFIA 5H1WA 4RNFA 1O12A 2VRQA 3LBMA 2OXNA 2E68A 2O9RA 2C3ZA 2ZUSA 4V27A 4RW5A 5GNYA 2OT0A 3CZ8A 4YVPA 4A8LA 3KCOA 3D47A 2VX4A 4EXBA 1UD3A 3FYPA 3TA9A 1IT0A 5JIPA 3B9EA 2DP3A 1VAHA 3KHDA 3P82A 2F9RA 2DPEA 4OT7A 1W3IA 4MWAD 4D8AA 4B2DD 3W71A 5FCZA 4HMCA 5FESA 4PL1A 2PWFA 4W7VA 3TJLA 1RZMA 2Z4GA 3PTDA 3LHZA 1QDSA 1QHPA 1J0KA 1IQ8A 3I10A 1X8CA 1O66A 5DMYA 4HD5A 3QQ1A 1OFAA 5A8NA 1XLCA 3DIPA 3N25A 5AECA 4DN1A 3HM7A 4D71A 1BF6A 5M5DA 2GOKA 3NL6A 3PUGA 3OVGA 4PMYA 4F79A 1W31A 4MWAA 5J04A 1OX6A 1UZHA 3HO8A 2WO5A 1KV5A 1J2WA 3H7UA 4FLOA 2ZZ5A 5H8UA 3KVLA 4K39A 3IUDA 1GORA 1TJ0A 3H70A 5D2TA 3MANA 2BFGA 3P80A 3GG7A 4BWLA 5F4WA 4FHAA 5DMMA 1UP2A 1K9TA 3UXKA 4IQLA 4CLMA 3AHYA 2AQWA 4GIEA 1TIMA 1M3UA 3VIIA 1DVJA 1JDAA 3CXOA 2QJIA 4JNYA 3U4FA 1KNWA 1Q8AA 1LORA 4RZ4A 1VLIA 3O06A 3W28A 4J3VA 4GYPA 2PLCA 3TTOA 3VGFA 2W6RA 2J7DA 4HOXA 1GVFA 3DBNA 4IH3A 4JFUA 3QLDA 2DEPA 3WD2A 3I6EA 4KPLA 1DIEA 2QJNA 2XWEA 3CTTA 2ZTJA 3W27A 3TWAA 4EVZA 4FOUA 1Z32X 4B5SA 4B3ZA 2C18A 2V2HA 1XBZA 4S3AA 4O12A 2UZ9A 1W9DM 1R3WA 3JZUA 3VABA 4Z2IA 4BF9A 1TIWA 4JHMA 4TX8A 2VKZG 3KRBA 3GFZA 5FAJA 3SRKA 4F2BA 2NV1A 3KBJA 1TZZA 3MSYA 4S3FA 4DEFA 3SY5A 3UXIA 1UOKA 2ZRWA 3CO8A 3NAVA 3WYZA 2KX9A 4HB7A 4LUSB 5CBJA 4M1BA 2AMXA 4JTSA 4GK8A 4U5KA 4PBGA 4REQB 1IHIA 1VPQA 1M04A 3S1GA 3MWAA 1LL4A 3SZ8A 1NDYA 4DF2A 3NNTA 5AYIA 2J7CA 5CZJA 2CETA 4J4KA 4JQ4A 3DYMA 2QCHA 1KTBA 3SN4A 4HPHA 2PP0A 1FOBA 3BJFA 1W56A 4JL1A 2V68A 1H63A 4NIRA 1DV7A 3WN6A 4ACZA 3NDZA 3DN5A 3OLIA 3KCLA 4CQ8A 1K9FA 3P8JA 4GVGA 1FRBA 1EOMA 1ME8A 4GVIA 2CLMA 1P0DA 4AWSA 3VE7A 1A3HA 2OEJA 2CESA 2GFTA 3TZFA 4MB4A 4LS2A 3IK2A 3M6DA 1W5QA 4JL2A 3SJNA 3RN6A 3IS4A 3WJXA 4A3UA 1CEOA 3BLPX 3LMYA 1R3QA 1EDTA 2XZ9A 1MWOA 2V38A 1YPIA 4QE5A 4IGHA 4NAEA 4U33A 3IVUA 4JPGA 1QNSA 1BTMA 2AGKA 4GYKA 2D2GA 4DWSA 3UWUA 2FGBA 4UXDA 5DN1A 3OVRA 3EMZA 3LOTA 5CJNA 3AJXA 2HPMA 4L6OA 5EMLA 1BAGA 3IGHX 4MG4A 3WBEA 3WH5A 4R7OA 1K7FA 2B0MA 3T0BA 4DNMA 1Q2SA 3BANA 4IFKB 2H8ZA 1EYWA 3VIFA 3IUIA 5I2UA 4Y8EA 2TAAA 1PJ9A 2VDIA 1AW5A 3BGJA 3TC3A 3TYZA 1O5RA 4KMQA 3OGRA 1MUWA 5TBOA 3W29A 1JAEA 4QLKA 1RCQA 3GS6A 4RUBA 4PMQA 3LTSA 1YRRA 3MV11 1L6WA 3G1DA 1EP1A 1JI1A 4KWUA 4GY1A 2VT0A 4QGCA 1RCOB 4KIRA 1AG1O 2VZOA 1X98A 2E09A 4LX4A 4HU0A 3P93A 1E51A 4LCRA 1SW3A 4NF7A 4MVAA 2PA6A 5CZKA 2QF7A 2CXGA 1BKSA 1PHQA 5FKYA 2VX6A 5B7ZA 3GHSA 3FXYA 4UBPC 5M2FX 4UOQA 1HKJA 2HS6A 3BOXA 5CSRA 3DHUA 4H19A 2PDCA 1UWRA 1Y5XA 2PDQA 4ML9A 1SW7A 3B9AA 2ADAA 1HL8A 3Q94A 2IPGA 4PMRA 2FPTA 4C1LA 2NXIA 3VKDA 4CQDA 1HVQA 1W8SA 3F5JA 3LHUA 4JFVA 3S83A 5F2IA 4BA0A 2I5IA 4CU6A 2W63A 2R82A 4XAFA 2X0HA 1C7TA 2OFJA 3ABRA 2Q8ZA 2PTWA 3WDIA 4DJDC 2HK0A 2ZA1A 5FEPA 4IL2A 3GLCA 4A35A 1ZTVA 1DJQA 1J10A 4AEEA 4WD0A 2YGYA 1XCFA 1KWGA 3GVQA 3INPA 5A2AA 4JKKA 3CIVA 4X9SA 1EOKA 3W86A 1DQUA 2AGTA 2OQYA 1VKFA 4HSHA 4XKYA 3R11A 1QXLA 4DO6A 2PI6A 4YWSA 1M6JA 1H7NA 2VR4A 2OR2A 1U33A 4BR1A 4B3KA 1S2VA 4Q4PA 4JQ1A 2DGAA 2X41A 3W9ZA 3P61A 2OWXA 5C9UA 1CCWB 3GAYA 1ITUA 2CZFA 3ZT6A 4IXXA 3I7RA 4W85A 1KR1A 4NJHA 2CKRA 2Y63A 3LRKA 4UR7A 1JZ2A 1W0MA 4DYKA 3PZTA 5DMLA 4FPSA 1E9ZB 2J74A 3F4DA 1QFEA 4K37A 3VUSA 5I3JA 2XG9A 3ALFA 4P7OA 4WOQA 2PZ0A 1WX0A 3LQGA 1XWYA 3QSRA 3W83A 2Z1SA 1J93A 3NGJA 2OSWA 1FHUA 2BDQA 2V5CA 2V6AA 5D4YA 1XLFA 1HQTA 1QW7A 2VXNA 3JVAA 4IQEA 2MANA 3NXLA 4HPJA 4LCSA 1V6TA 3EWBX 4BI7A 3DKLA 3GVGA 4H04A 3TR9A 3P7YA 4Q7BA 3NQ8A 3F2DA 4MF4A 4OKDA 5HMSA 1SO5A 1MQRA 1EWDA 1DL3A 5TAOA 3C0QA 4HCLA 5I3DA 1XKYA 3MUZ1 3WMBA 4ZB2A 2GQAA 3G3MA 3K4AA 5K2ZA 4KWOA 3ARPA 5KITA 3OYXA 3VIGA 1IT8A 4DRSA 4GKTA 4ZR8A 2OLSA 1H7RA 4ZA0A 1I1XA 5A8GA 3EDKA 2Y70A 4EKJA 2XU2A 3VKCA 3RNDA 1W3HA 2QCNA 1XC6A 2YBUA 3FGCA 2GSJA 3H12A 4N0RA 4UOZA 2JF6A 3FIGA 5HJXA 3UCCA 4PA8A 3E6EA 1OT1A 1KM0A 5CPQA 1AD4A 4AEFA 4B90A 4S3JA 2ZXQA 3R8GA 3ZT7A 2NX1A 3N1AA 4KF1A 1V51A 3TV8A 4DF1A 1VR6A 3W3OA 1EH9A 2DW7A 3FY1A 4O28A 1BYAA 1HL2A 2OVLA 1UW9A 4DO5A 5LGZA 1OIFA 4PGLA 4IX2A 1UUOA 4Q4RA 1S38A 4WZHA 3W01A 1WDWA 3CAWA 3W7LA 2C79A 5DQPA 1JZ8A 2BY2A 3WL1A 4KERA 2DT2A 3WQFA 3CUHA 2D22A 3OZPA 3P8IA 2PWHA 2I7GA 3FVDA 5EL1A 3BG5A 4K6AA 4MNKA 1BPLB 1C29A 3VD5A 1W2PA 3VOHA 1T96A 3R1ZA 4PTDA 1B0IA 4QM1A 5HWJA 5A5WA 4N9EA 4NI8A 2YW4A 1GEQA 4AD2A 2A6NA 2BV9A 4I8DA 3VD3A 3GYCA 5DANA 3WJSA 2DFAA 1MXDA 3EKLA 3K13A 4H7VA 4ZCWA 4RZ6A 3CHCA 1GQNA 3UCDA 3Q67A 3TIMA 4A3HA 3O6YX 1W9BM 4C5ZA 4KRUA 2PGRA 4F9JA 3MQTA 4DWSC 3RLGA 1VB9A 3UPMA 3CQKA 1DHPA 4V15A 5C2CA 2F7FA 3AYRA 2EG8A 3RM4A 3R0DA 3DFTA 2P53A 4O10A 5E6YA 3E0IA 4RLIA 3CIWA 2AL1A 3UWVA 1DXFA 3TTEA 4RL3A 5HQLA 2P0IA 4R7JA 4FX8A 1IT7A 4H6QA 1MZRA 4DX3A 3TN3A 3RILA 4BQ4A 1NWRA 4FI4A 4Q8MA 3DDMA 4MAVA 3PZVA 3FJ4A 3ABZA 2I9EA 5FF7A 5C8BB 2JBMA 5IHRA 1KXTA 1AQFA 3UZZA 1BGGA 1DYSA 3GKFA 4MFDA 4OBRA 5U4NA 1KA9F 4HK7A 4F2TA 2ZA3A 1XC4A 5ABTA 1ZBKA 4WK9A 1AW1A 4O50A 3VYLA 3M0IA 1JGIA 3QYQA 2J9XA 2BG5A 4MYAA 1TJPA 4AD3A 3S4TA 2ZX6A 1FWBC 3AHVA 2XUCA 1E5JA 5DELA 1HO4A 3HQ1A 2X09A 3KTCA 4DM2A 2R24A 3WFZA 2V9DA 3AUOA 2XH4A 3P74A 4IMAA 2DH3A 2NUXA 2V5BA 4M1RA 3B8DA 1UD6A 4D72A 1ECQA 3S6OA 3ABQA 5KZ6A 4L1XA 3BCFA 1T5AA 4WVXA 3AXHA 3TR2A 4D6IA 1MZHA 5CCZA 3IIVA 3S2MA 3TQVA 4NZCA 3UY7A 2FIQA 1KRMA 1EJXC 4K8EA 3K4DA 3URNA 3SJ3A 4KRTA 1G4PA 5AVHA 5G2IA 3G6LA 2DIKA 1DJGA 5ECVA 2CEQA 5ABFA 3BMWA 2CZDA 2W27A 2I9UA 3A9BA 3RGTA 2B4GA 4GG9A 4JTDA 3BL3A 1M1BA 3VGHA 3SADA 4X63A 4Q4KA 1JUEA 1VPXA 1HFBA 1RK5A 4YL2A 3IPWA 2VGGA 3GQYA 4E4UA 1F73A 1THFD 3BK0A 1FH7A 5HNNA 3PPFA 1QI3A 3C0JA 3GIYA 1U5JA 4WSJA 1LL7A 3GDKA 3W7RA 1GOQA 3WQGA 4R34A 4RE4A 3SO7A 1Q6QA 5I3FA 4XAPA 1Q2RA 3HFTA 3B8WA 3UJ2A 1K7EA 1U30A 4P8XA 4UQEA 1BXCA 1PWMA 2GSEA 1V02E 5I79A 5JBDA 3TWBA 2QDEA 1UWAA 4MNMA 2QIWA 4UFHA 2HWGA 1AK5A 2OLHA 4V1XA 4PUUA 4AZ6A 3KX6A 1ISXA 4W88A 1B57A 3A4AA 5IBXC 2EPHA 4AMAA 1NOWA 1M53A 5D33A 1UPMB 1WXYA 3AU2A 2BGQA 1B3ZA 1QJWA 1RQHA 3WD4A 4B2DA 3R0UA 1EGZA 1GVRA 3NVTA 3L4WA 1DWFM 2PTYA 1QPNA 3FS2A 1TPFA 4OV9A 3F4WA 1LOSA 5LSMA 3WMLA 2G97A 4O15A 3TC7A 3VKBA 2QDHA 3GXIA 2ABBA 3OG2A 3T44A 1UQYA 3LLFA 3KXQA 4QCEA 1WXJA 2NQZA 3N17A 3SUVA 4MZ8A 1TCDA 2WB5A 4U3AA 4H6EA 5M03A 2V5JA 3IJ6A 2PDHA 1BG4A 4WKFA 2HV5A 4FXFA 1EPXA 4UTUA 2AMGA 3LCLA 4V28A 1XYLA 1EGVA 1PPIA 1NU5A 2ISSA 1TELA 3K8LA 2H3BA 1UBSA 4FX7A 4S1FA 3I7QA 2FVMA 2NWRA 3T0AA 1EEPA 1FWJC 2L5HA 3WF2A 1R47A 2BVWA 3HG2A 1OB0A 3EWDA 3W23A 4XSLA 3CYJA 4ZEPA 1MVYA 2DZTA 4HHPA 3APYA 3T2QA 3MMWA 4XBSA 1TQXA 2HNHA 4F0LA 4Z2HA 3EZ4A 1E55A 2F2KA 4TOQA 2XH7A 4W5UA 3MMUA 4OGZA 4BFAA 3ZJ6A 2GSHA 1REQB 4E8CA 4OFCA 5LA2A 2DJLA 2FGZA 4IF2A 3SN0A 3R25A 1J5SA 3Q45A 1G7VA 2YCLB 4N7QA 4JX6A 1F2JA 3QGKC 4AYSA 3UEQA 2HJPA 3H24A 2PWGA 4LC6A 3WF1A 3SGUA 5KZEA 2WHMA 3SUWA 2Q3OA 1OGGA 3WJZA 2XM2A 5EU9A 3BZJA 3OIHA 2WPGA 1J8VA 5E09A 2OEKA 2X8RA 1ZAIA 4A6GA 1VBJA 3B0XA 4HCDA 1TV8A 1XGEA 4NNAA 1HX0A 3EWCA 5TD4A 5F2GA 4NZ1A 2BOEX 3S1WA 4DI9A 4CQCA 3GFYA 1XP3A 4XKYB 4M19A 3FW6A 4YTQA 1K8CA 3A5VA 1RBOB 3R8RA 2XSXA 3IIOA 3AMGA 3RF9A 4IMGA 3M0ZA 4O1CA 3LCGA 3F4NA 4HK5A 4GXPA 4OVXA 2W0UA 4O52A 1W1PA 2VWSA 1PZ1A 5GNXA 3HU7A 1WOBA 4FP1A 3JS3A 3UYIA 3EOSA 4Y9MA 3WQEA 1UWQA 3T09A 1V8EA 1HKMA 3MVIA 2PDFA 4AVNA 2PODA 3P14A 4QISA 2J6XA 3TNBA 4ENLA 5L9FA 2ACRA 2VRKA 2A7RA 2NQHA 3H8AA 3N11A 2GGGA 1G5AA 4PE8A 1QNOA 1KTNA 3IIZA 3DHDA 3LNMA 4DJDD 4F0RA 1DJIA 3ZS4A 3E12A 4XK2A 1R87A 3MBFA 4AHOA 1E0XA 5FJUA 3S47A 3MHUA 3KDOA 4JD4A 5BOFA 4XD3A 4FK9A 4AYGA 2BZNA 2POZA 5CG7A 3HQPA 1TA3A 1BQCA 3UD6A 3G18A 1OBAA 3UXAA 3GZ3A 3AS3A 1XM3A 2VEKA 2VGIA 3FA3A 4YVXA 4WXYA 5FL0A 1W1VA 6CGTA 1LWIA 4XSMA 2PDLA 3QXBA 1EJVC 2E6YA 3UYCA 4C6BA 4XD5A 4S39A 1EQPA 3OYZA 3QV8A 1OJXA 2VP8A 1VHNA 1JCMP 2OMAA 1RALA 4HZ6A 3W1PA 4AISA 1D9EA 1GOMA 3SCQA 2Y5SA 5LNWA 2A4AA 4UZUA 3MP5A 3OA5A 4I8YA 3TUUA 1X6UA 1K9EA 3GC2A 3UXLA 3W70A 3N19B 3T0CA 1K7XA 3U9IA 3BSMA 2QEZA 1Q4WA 3L0GA 2VCCA 1SGJA 2QPSA 4AWEA 4P8WA 2ZZ2A 2Y2WA 4PCTA 2A3LA 5DCEA 1XIIA 3TTSA 4UNLA 5EFDA 3AIBA 3FKRA 5HNUA 4MWAE 4NU7A 3BAKA 1U83A 3NG3A 3W0KA 3NQ6A 1TX2A 4C60A 1CIUA 5FL1A 1GONA 4RDWA 1AMYA 3NTYA 1ZL1A 2REQA 3OB8A 1VFUA 2VD8A 3W7NA 2CFFA 1ICSA 2FHCA 3STGA 2GUYA 5A2CA 1VFSA 3ZT5A 4FS9A 2Z25A 2QJHA 1NWTA 3KOZA 5HMFA 3AC0A 3W1LA 2ICSA 4XZIA 1OFQA 3HPZA 3QMRA 3UZWA 5EY5A 4KCTA 3KBVA 1XFCA 2WSYA 3E2SA 3EX2A 3VAVA 4CU8A 3KFTA 3EMCA 1S2UA 1EGMA 1IV8A 3URBA 1TYGA 2RJGA 1RY8A 1NOFA 3QQWA 2W91A 1Q6RA 4GNKB 1GEHA 1YNYA 5IBXA 1F3WA 2PWEA 1DWHM 2PURA 4UWMA 3TAKA 2O4MA 2VFGA 2WMIB 2YZ5A 1UC4A 3AMDA 1SM9A 1UOZA 3KP1A 2PLJA 3MSDA 1H11A 5DBTA 4NP7A 3PTMA 3CUGA 3HFYA 1CB7B 4XZ9A 3VZXA 4KBXA 3CYVA 3CGTA 2QCFA 2YR1A 2PDMA 3ENLA 2QCMA 3QFEA 3CBWA 7ODCA 3SUUA 1I4NA 2J78A 5CLTA 2I5GA 1SYTA 2XN1A 1DE5A 2X30A 2X7WA 5PTDA 3ITGA 1D7KA 1EDGA 1A5KC 5LZLA 3KBSA 3S1VA 4W86A 2OTDA 1T0OA 2QJGA 2IPWA 1JVNA 3HTWA 2J24A 2DVXA 3ICJA 4IPLA 1O7AA 1BRLA 3PWIA 4O0ZA 5H2ZA 4AF0A 1NTHA 2BMBA 5CPSA 1YKWA 3UVAA 4OV4A 3FSTA 2C91A 3TDFA 2GVJA 4F48A 3VIKA 1V3HA 1BFNA 1A5LC 1Z89A 4N9BA 4EPKA 3A12A 3E0VA 4DWSD 3T6CA 2BY3A 1D8WA 3BGGA 3UQNA 1UHVA 1QRQA 4I9MA 1JYWA 3T7VA 1U1JA 4G56A 2D20A 3H21A 2ZIDA 2WK2A 3V1HA 2Z00A 3A22A 1ZAJA 4Z1BA 1QR7A 4I9AA 2ZZ4A 1PE1A 1QOPA 5K4XA 4QSFA 3M5XA 1EBGA 4I6KA 1XLBA 3C2FA 2XIBA 4FEZA 1LRTA 1X97A 1PIIA 4NSBA 5BOOA 2PDIA 1GQJA 2Q01A 3QPYA 4L65A 4XUYA 1PL9A 4PRTA 1BSIA 3RFAA 4ZFMA 3R8HA 4YYFA 1ZBVA 1NH6A 1V6UA 3D0CA 3N2MA 1KKRA 2VO5A 4S3GA 5BXSA 4I7UA 4EIVA 1SJBA 1JDDA 1Q6FA 4PBEA 2FVKA 4LUIA 1XRSA 4W8LA 3VUPA 1IYXA 3TXVA 1EFZA 1J6OA 4NX0A 3CMJA 7TIMA 4S38A 3KW3A 2UY3A 2F8QA 4F8XA 3B8TA 3GTFA 1QNVA 4J3SA 1EO5A 5HQMA 1JF6A 4OIFA 1JF5A 3TSMA 2QDDA 3AMCA 4QR6A 2P8BA 2Q6ZA 2VFHA 2YXGA 4Q8QA 3RO6A 5T91A 1HF6A 3ITLA 3IVSA 2ZXBA 1RHCA 3ATZA 3L4VA 1NIUA 2WAGA 3WK1A 3UZYA 1VJSA 1GKRA 3MKCA 1EP2A 1SJDA 4O19A 2R1NA 1B3YA 4Y2WA 2D1ZA 3JUGA 3BCJA 3SFKA 4US5D 2EEXA 1TPWA 3NZ1A 4C6KA 2W4XA 2WJDA 2YW3A 4DXKA 1XSJA 2DUZA 3LXCA 3S8HA 4A29A 3W74A 4W4QA 2KZHA 3VNMA 1AQ0A 1V79A 3VPLA 2WMJA 1TPB1 1CGYA 3ARWA 2PP1A 2CIPA 3VVGA 2I57A 5BXRA 1LRNA 3LHVA 5FJPA 3RX4A 4WF7A 2OZTA 3UWEA 3CEPA 1VEOA 2YCIX 4AZ5A 1IGSA 3NJ3A 4MAZA 3P84A 1BVNP 1PEZA 2D69A 1A5AA 5K9DA 1TB3A 3HGJA 2VEIA 4HOZA 4C6CA 2Y7FA 4L64A 3E38A 3TN5A 3S2LA 2PC4A 1E40A 3IUHA 2A2IA 1VJZA 1F7BA 1GPWA 3S2NA 3ITCA 4FXSA 3RK8A 1ISVA 1XYFA 1KKOA 2Q71A 4X61A 1Q7ZA 2EKCA 3A9IA 4JTLA 4JXCA 4FALA 2FZMA 2DSWA 4XB3A 1DPMA 4E3TA 3KS5A 1G0CA 3GNXA 3VNIA 3S1XA 1CDGA 3GW0A 1JI2A 1EF3A 1ITQA 4FNQA 3VOIA 1E4LA 2EQDA 4DBSA 5FJOA 4FNUA 1HUVA 5ENLA 3URQA 5FA5A 5MKGB 4ZFCA 3K2GA 1T99A 1TE6A 3FNDA 4LVBA 3OGSA 5BROA 1P0KA 4TR9A 3TAOA 4ORIA 4M6VA 4CN6A 3AHTA 5K7JA 2NVAA 3CH9A 1QNPA 2PF0A 5F4XA 3WBXA 3QGVA 3M0VA 3U57A 1XG4A 2OKTA 3AHXA 4CD8A 1XGZA 2GJRA 5CC6A 3FVMA 3IRDA 1JYVA 1YYAA 1VFOA 1PKMA 4GH1A 1V0KA 1FP9A 1LBLA 1QOQA 1VPYA 4AVFA 5BXPA 1YXDA 4ZBCA 3POCA 1NFGA 1UMYA 3FFSA 1KFLA 4YU1A 1AZ1A 1NDZA 4L1WA 2UWFA 1EO7A 3GUWA 1NDVA 3DERA 1TUXA 3GAKA 4YHGA 4BQ3A 4PUJA 1Q66A 2A3AA 3L4YA 4QEEA 1HJSA 3UNDA 5GJMA 5LGXA 1FCBA 1TG7A 3A24A 1OFRA 5FF0A 1R3YA 3LY0A 4I5UA 2DSVA 2UY5A 1SJCA 2QKFA 4N9CA 2YB1A 4E2VA 1DHKA 2NQLA 5E6ZA 3THDA 3GH4A 5DMNA 1S5NA 2PC8A 2AAMA 1R3TA 1GOWA 4PMVA 1QK2A 3GTXA 3NCOA 1EIBA 1HP5A 4MUZA 3GH5A 1EPVA 2YX0A 4JN6A 4HMNA 1FWWA 3HB9A 1R86A 3ARVA 4Z1DA 1C8QA 1GKPA 3NYDA 1UWIA 1XCXA 5A8QA 5AC8A 2ONEA 2CKSA 4LFYA 2YL6A 4CCCA 3N3TA 4R27A 1QBBA 3DXIA 4HT3A 1QASA 1XH2A 4PTVA 4CQ9A 2OKOA 4GUFA 4XG1A 3XIMA 4CU7A 2WM1A 3VA8A 1MW2A 4NAFB 1NP2A 2FZNA 1E15A 4GBUA 4PRRA 3EWUA 1HL9A 1DXIA 2DZPA 4O8AA 4G9PA 1KR0A 4Q8NA 1AJ2A 2HZGA 1EXPA 3WQVA 1WKDA 2ZICA 4WJ8A 3E2RA 3K8KA 2VFDA 1H1YA 4JQ3A 1JPDX 1QWKA 4F40A 2XSBA 3U7VA 2VGBA 3VOFA 3WLHA 4BZYA 2V5DA 3CLMA 4E2BA 4S3CA 3J7HA 3LV6A 4JX4A 3LCFA 1J4EA 3SECA 3O2LA 4XZWA 3L5AA 4GUJA 1M7XA 5C9RA 2I14A 1ZBWA 3NQFA 2MUCA 2RDWA 4ERIA 2VCAA 2UV8G 4HMDA 1TVNA 3WD0A 2VEMA 3CQHA 4DUOA 4XZNX 1ICQA 3QHNA 1XW8A 3E0WA 3L2LA 3KUMA 1QO5A 4ZSUA 3SGGA 3GHRA 4FOKA 4JNMA 2CBUA 1V3MA 3OJGA 1XLHA 2DT3A 4JIPA 1ECEA 1QHZA 1OC6A 2FTPA 2NSXA 4AB4A 4RW3A 2JKEA 2Z7KA 3W1RA 4ZQOA 4Q3MA 3VFLA 2ZCGA 3FJNA 4DZAA 5AHIA 3MI6A 1MYRA 1NF7A 3OG3A 4J28A 4KIEA 4QSHA 4J35A 3AO0A 4R9XA 2HRWA 3ARUA 2YYUA 1PB0A 1XUZA 3TYBA 1UCWA 3TYAA 3BW3A 5I3IA 2NW0A 2EPOA 4H9ZA 2XSAA 2ISFA 3O0KA 4JBRA 1YXCA 3IIPA 4LVGA 3KP0A 4NJIA 1C9DA 3S42A 3F5LA 4MSSA 1N82A 4XISA 3AI0A 2Y4SA 4CN4A 1ZAHA 4N6FA 4PR4A 3LM7A 1KXVA 3AZRA 1CW2A 1ONXA 5JVLA 3O8AA 1TZ7A 1UA7A 4UFMA 9XIAA 4JQAA 4KFOA 4YMZA 1JDFA 1ZUAX 3NL2A 3UW6A 4IPIA 3GIQA 3NOEA 3BJTA 3AHZA 3HPSA 4LB4A 3AXMA 4NNBA 3MCMA 5CSSA 3PSVA 4A3YA 3W88A 1EQCA 1QMLA 2Y61A 2PD9A 1UKTA 2J47A 1DQWA 1J2BA 4LT9A 3W85A 3SFWA 2PWUA 3LQLA 4MY1A 4X22A 4GI4A 4GYJA 2PDUA 3EX1A 1XIJA 4PCNA 1US3A 2SFPA 2DT1A 2F61A 2XIQA 1NSJA 1B3OA 1CLVA 4RE3A 5BWAA 4MB1A 1W1TA 3BW2A 4F4RA 4CEXC 1K9DA 3W7MA 1V0MA 4HU3A 4Z1AA 2XFFA 1XG3A 3JZEA 4AQLA 3AIEA 2YDSA 4U5IA 3ZOAA 2CLPA 4S3DA 2A0NA 3OOQA 7TAAA 4GISA 4I5XA 2OYMA 4US5A 4MHBA 4GINA 4ES4A 1ML1A 3PZ9A 3IJIA 4XO7A 1Q7MA 4KW2A 4UQ9A 1XD0A 4M56A 1J5TA 4LCQA 1SZGA 4QAIA 4NYYA 2CLHA 1E72M 3QPZA 2BHZA 3GC5A 4LV9A 3SEPA 3UR5A 1XYZA 2E7FA 2W66A 5G1TA 4QLJA 3CPGA 4B91A 7ENLA 3AYVA 1PS9A 4FNTA 4Q8OA 4NXKA 4HPGA 4GFIA 4JFSA 4ALDA 2PCEA 2OOGA 4GCAA 1PUDA 3N2CA 4FLQA 4IIEA 2G3FA 1GGOA 4G1KA 2RDTA 2BSLA 3OVQA 4YNGA 1XLKA 1TPC1 1NOUA 4H8NA 8XIAA 4KH2A 3CO4A 1D2KA 2E25A 1RBLA 2WBGA 1U5VA 4M24A 1HN1A 6REQB 2VEGA 3EA2A 2WZHA 3W07A 3NOYA 3VDHA 1OQFA 1Z8AA 4UQCA 2FDSA 3E1F1 3B05A 1NWUA 2VHLA 1ZY9A 3IV8A 2CW6A 1ZRQA 5D02A 3MYOA 4D6JA 2XN2A 1I2NA 5IDIA 1HP4A 1ONWA 4LS1A 3ID7A 1ZNNA 1P0BA 4UTKA 4C6IA 1SZNA 1UP0A 1H5YA 1OX4A 2GJXB 1H61A 3UWQA 3VDBA 4WDUA 4MB5A 4QBXA 1KBBA 2QIIA 1BG9A 2CXEA 5C9WA 1IR2A 3WLSA 3M16A 3VD4A 1RJRA 4Y6GA 2CHNA 3WQOA 3DEQA 3W7JA 1F4AA 1OIMA 5B7YA 2VMFA 1F6YA 4LF2A 4BCEA 1PSCA 1ZSXA 1LT7A 2WVSA 3AWNA 4OOZA 2W3ZA 2J27A 4LH8A 4IOTA 3HURA 4IWWA 4O13A 2Y62A 4DNHA 4YTUA 3EX4A 1JL8A 3MZNA 4O0KA 1FQ0A 3G0XA 5AB3A 2PBGA 1FDYA 1O4UA 3BAIA 5DRIA 2EKGA 3WLIA 1XHGA 1ZB5A 3GXNA 4DUXA 5I24A 3REQA 4H00A 4L9ZA 3BV4A 1P48A 4PUDA 4KS0A 1F5ZA 3D46A 4B5UA 3PSWA 1EHAA 3QMTA 1MEWA 4HIBA 3N6HA 2TRSA 5AHFA 3GNDA 5AC7A 3FKKA 1V02A 4N2YA 4MZYA 3K30A 4JTIA 2YLLA 4MNJA 1P6BA 4CNUA 4H83A 1W5OA 3VX1A 5HAOA 5K4ZA 3PJUA 3KTXA 2O9OA 2PE4A 1XYCA 3W7QA 1M9HA 2FPYA 1KLYA 1F9CA 3L2MA 4RZ5A 3VK5A 3IACA 4N9DA 1W32A 3KL0A 3LSBA 4D6FA 3AIVA 4C6FA 1GVEA 1W17A 4JIQA 5AZ0A 4HNLA 1L6SA 2UY2A 2JALA 1ZQ5A 2VNCA 2G3IA 2H90A 2V5KA 1JZ5A 5FEZA 3IIXA 5XINA 5D09A 5FAGA 1R9YA 2BP1A 4PCPA 4HA3A 3EOEA 2GJLA 3PANA 1YTDA 3ZYZA 3QR0A 1VJIA 4DHGA 1CYGA 1V6YA 4P7RA 1H41A 4IIHA 1D8CA 1F05A 3SIMA 3WNPA 3S2JA 5AYZA 2ZRZA 4GMEA 3LHYA 5FJIA 1H7XA 4TVDA 1C93A 3MVTA 2CERA 3T8LA 1NFPA 1XH0A 3PBWA 2OWWA 3W72A 1OVDA 1A0DA 4O4VA 4WY0F 3TOPA 1X7IA 2NV9A 3W24A 2CWNA 3L0KA 3GBDA 1L0PA 1OD8A 1ZGDA 3WLRA 1LM1A 3LD5A 1R38A 1XIEA 2QCLA 4IGNA 4A22A 3W7IA 4UTWC 2G8ZA 1DWJM 1RD6A 4O18A 1TWWA 3LPFA 3EWXA 1FA2A 3FJLA 3NZQA 4O57A 5I3KA 4X0NA 1AA1B 3WUFA 2C1IA 4IHCA 4OOUA 3PPGA 3LRLA 2V0TA 1WZMA 3DESA 1JUKA 2ZX8A 4BF7A 4H9XA 1X1ZA 4XKMA 2YDQA 4LOCA 4L80A 4OUIA 1A4MA 4EACA 1IXPA 2O0TA 3NZRA 3PAJA 4H2HA 4CNTA 1PTAA 1O60A 2UBPC 3N9SA 2YFNA 1GVOA 1BLIA 1KM1A 3QZAA 1KC7A 3VIJA 4CCZA 2PDXA 1GG0A 4LALA 1AJZA 1XQKA 1YEYA 3BCDA 4GJ1A 4L5ZA 1IXQA 6XIMA 4DM1A 3W53A 1WDPA 1E1CA 1UKOA 5IXEA 4Z1YA 1XPYA 3QKEA 4IG2A 1YDVA 3KRUA 4MDPA 4BQ2A 1ELSA 3GXPA 4P2VA 6REQA 3C2YA 4HTBA 4BEUA 1KLZA 2GVLA 1BF2A 1QI2A 1SO6A 1RPKA 3PBVA 5AZ1A 2ZUUA 2E67A 2XIIA 4H9YA 1QBAA 1S3TC 7REQB 1HGYA 4AX7A 1UB3A 3QRHA 1DWIM 3OP2A 2G37A 4IICA 3EA3A 1YE4A 1TV4A 3ARSA 2J4GA 1Z48A 2DY3A 3SSZA 4IUGA 1GVIA 4GQBA 5CBIA 2B7PA 2A3CA 2WW5A 3RHGA 2WLYA 1W3JA 4FXRA 3QC0A 1XLIA 3ABSA 2Z1KA 3AQUA 2FB2A 4JCMA 1FHVA 3FEMA 4ECLA 2BY0A 4ORMA 1A5SA 1VD6A 1C9WA 4F3HA 3RRXA 3UY8A 3PK7A 3P81A 3W1UA 4HHMA 1W8GA 2FGLA 4D6CA 4GE8A 1VFMA 4S3KA 2G4JA 4PODA 5C9ZA 1ZS2A 1W9PA 2VC9A 5HOSA 1JGMA 1E0VA 3L21A 1AZ2A 5A6SA 3MU7A 2X7VA 3GG8A 3M6YA 4J3XA 4FLRA 1KBJA 1JUBA 3AYSA 1GUVA 5GQBA 3WEOA 1SU5A 4DWDA 1J9YA 2VCBA 3CWNA 2PDPA 1SO4A 2VVNA 4ROQA 3HA1A 5REQB 1RBAA 1OZQA 4HJWA 1FWCC 1XBXA 3TZNA 3CWHA 2VC5A 2RJHA 3AOFA 4NZFA 2WMKA 4WRHA 2AKMA 4DB7A 2X1SA 3FDKA 4DJED 4MTVA 2QDGA 1TV2A 2TPSA 3VM7A 1WPCA 4PFMA 4RV8A 3VCRA 4LAOA 2OB3A 1DBTA 2ZUNA 3T78A 4CGTA 3WD1A 4NQ1A 4EOUA 3NPUA 1OC5A 3OODA 2VD9A 1UMLA 3OBAA 3K46A 5G4WA 1XDLA 1DEDA 1ZFJA 4AWTA 4D1JA 2OODA 1ICPA 2Z27A 5AC6A 1ODZA 1MW3A 1C91A 1BYBA 3N13A 2OWCA 4DWSB 1LLOA 3L12A 1OABA 3U0HA 3LLXA 3MP4A 4JTQA 3B8IA 4QE1A 2W61A 3W1NA 3WNKA 1JCJA 1W6TA 1BD0A 3EWWA 4FF5A 1B9BA 5H6HA 1LOQA 4OUEA 3NQDA 3YPIA 2I17A 4GUGA 2X2YA 2J79A 4WUIA 3M07A 2CBVA 1QPOA 1AUSL 4GVFA 3QY7A 1SW0A 2OSYA 3BO9A 1L2QA 3AU6A 1A3WA 4FIQA 4YCOA 4AIOA 4C7GA 1P43A 4NASA 3U3HA 1G1YA 3RX2A 2ZDRA 3CS2A 1OYCA 1MXSA 1JAKA 2WHJA 2OYLA 1R85A 3LK6A 1E0TA 1MDRA 1KBKA 3TH6A 4AMCA 3CU2A 2J8GA 4AG0A 3EAUA 4RR4A 2WSPA 2ZFAA 5DEZA 2HPIA 1JCYA 5JIWA 4FF7A 2BVDA 3H55A 3B9NA 3BE7A 5AC5A 1MXGA 2YBTA 3BH4A 2NUWA 4Z42C 2HE5A 2FMNA 2V69A 3E0LA 1YNPA 1H0GA 2GVYA 1MSSA 1P0NA 1LLWA 1UIPA 2QCGA 2VC7A 1J0JA 1OHLA 5TIMA 1H51A 2Z0IA 3IAPA 4H4IA 2FJUB 5EMUA 4H1ZA 4DELA 5C71A 1IF2A 4LYPA 1CZ1A 4GJJA 1SSDA 5KZMA 4XBKA 1V77A 1GTHA 4A21A 3GK0A 1QI5A 4NZ4A 3T4WA 3K1GA 1I2QA 4GC4A 5M17A 2X2GA 1LP6A 2HISA 3MSGA 1JXKA 2HXUA 4MLRA 3EEZA 5CJ5A 1HIZA 3T2PA 1XIFA 4XQ6A 2R91A 3FAXA 3W2JA 3W2UA 3LG3A 3NQ2A 1RK6A 3NA8A 4PSRA 3C8NA 4J1OA 1JQVA 1N8FA 4D6GA 2INZA 3G1SA 2DORA 3LTPA 2KAUC 2Y24A 1A5BA 1V7AA 3WQDA 4UQDA 3M0YA 3P60A 3RCMA 1B31A 2J75A 4W87A 7CGTA 5D32A 5I23A 4R3UA 1JCNA 3LV5A 4GYFA 3C2VA 3MUCA 4GGBA 3WMCA 4HN4A 2PD5A 1FVPA 3TYDA 3HGRA 1IGWA 1YDOA 4WJXA 3ZSSA 5HPOA 5IDZA 1MFUA 2NLYA 3MPGA 4EXAA 2XVLA 3GG0A 2QUTA 3RDKA 1EYEA 4MY9A 5C70A 1A53A 4YWIA 1Q6LA 1WKFA 2LLEA 3B0VC 5AC4A 1X96A 3BURA 3PJXA 3NDYA 4E2DA 4NUWA 3T42A 5HXMA 3GU2A 1ENUA 3PR2A 5BXTA 3F2BA 1ESWA 2EF9A 1GWJA 5E0CA 3WEZA 1FWAC 3WJYA 5E70A 1H0IA 1UJQA 3WDRA 3GTNA 2QNEA 3RU6A 8RUCA 1DE6A 2PRHA 4Q8VA 4K1GA 1KFCA 4Q6JA 5CBBA 3WO8A 2IMRA 4GXMA 4IGSA 5A8OA 3H2CA 1YMYA 2WKGA 1GJPA 3SCOA 1GT8A 5E93A 3B9DA 2AQOA 3DC0A 1OCQA 4IIBA 4ERGA 3UZJA 3LA4A 3I3DA 3M1ZA 3EB3A 3SQMA 4CNOA 4OWGA 4OBTA 3WK2A 4C6LA 1CWYA 1SSGA 2PMQA 3ZR5A 2CBJA 1TPH1 4WHBA 4DQWA 1KFJA 1S2CA 1MEHA 1X38A 4C7DA 3VX0A 1QVBA 5G5IA 4GQRA 4IPJA 4PRWA 3RO8A 3BW4A 2NWSA 4IMDA 1HJUA 3ZMRA 3VFCA 3WLLA 3I65A 1QI0A 4WSHA 3NYZA 1A4LA 4XVDA 3NSXA 1KM6A 3BOLA 2FLIA 2QJJA 1GVYA 5T9BG 4O0QA 1VCFA 3MC5A 4L61A 4A2RA 4E38A 5I3GA 2BS9A 1OSEA 2W9MA 4PTMA 3DBPA 2WMFA 3ECQA 3B06A 1RH9A 2BTMA 2DW6A 3CMFA 4NT0A 4ZVJA 3SSJA 3S5SA 2V3GA 4TO8A 3VNJA 2AOSA 8CGTA 5LIYX 3SRFA 4HYWA 1WDSA 2R8WA 3B9OA 4U28A 3BAJA 4O16A 3TXZA 1ZCCA 4MB3A 3UNTA 2GL5A 2RHGA 1CECA 1GOIA 4B5XA 2WC7A 1RA0A 4DXVA 4J2PA 2QMKA 3MUIA 2O7QA 3CTLA 4K8GA 3CZLA 3FEQA 2DU2A 4JTRA 4DJEC 3OLDA 4XV0A 5U7SA 3CHVA 3M0KA 4QLLA 4CD5A 2DZSA 3EXRA 1RLCL 1XSKA 1V3IA 4O14A 3CT2A 4PUMA 4TMBA 3Q58A 2WPBA 1HW6A 1PCKA 2CLLA 1EP3A 1MO0A 3USBA 1GPFA 4QX4A 3P0WA 1WCGA 1U22A 4G6CA 5K9CA 3LTYA 4B5WA 2ZZ1A 3HJZA 4PMXA 3PNUA 1SQ7A 5F2LA 3R4IA 1XL9A 2HBXA 3I4EA 3ME3A 1W3NA 3VDCA 2VQUA 3MI2A 4ICCX 3LGGA 4GUHA 3WX7A 4C90A 3KM8A 3CUJA 1UUQA 3VC5A 4M6QA 3HF3A 4UCFA 3AXKA 4PMJA 5M3WA 2C15A 3L23A 3QC3A 3STFA 3G0UA 4NJKA 3GBEA 2Q8LA 2GGJA 4PCSA 2NUYA 2BASA 2A5HA 1EXBA 1Z9AA 3ITXA 1YIXA 3V18A 4BJHA 4JYEA 3M44A 4XZLX 5EMJA 2TODA 6A3HA 5LA1A 1AODA 1F61A 3SCSA 1IZJA 4NAEB 3T2OA 1VBGA 1L6FA 2CWXA 4KETA 2FYMA 1E4MM 3JRKA 4R9OA 1BVWA 3AISA 1BWVA 1PBGA 4XX6A 4M51A 5IOBA 2OZ8A 1TSIA 3TJIA 4ADTA 1Q6CA 4CCDA 1RV8A 2OG9A 4EWJA 5LIXX 2WQPA 4W5ZA 3LUTA 4F2UA 2FH6A 1GYMA 3I6RA 4AX6A 2DZUA 2YBVA 3NM3A 4HNUA 5A6JA 3BLOA 3PC0A 3LCWA 1Y5VA 1MUCA 1FHLA 3QV6A 1V6VA 3BQ6A 3IAQA 4EX4A 1AH3A 1XD1A 2XVKA 2WSKA 1Q13A 1WZAA 2HVNA 2Y1HA 3NPWA 1YTEA 3LSCA 2WCAA 3W1XA 3M4HA 2C1HA 4M29A 3C56A 3TLLA 4PTNA 2DZBA 4QG6A 1AVAA 1UZ4A 4J5NA 2E40A 5HWNA 5BW6A 3B40A 2P1FA 3QR1A 3VNYA 2GK1A 2VEFA 4BI6A 1WOAA 2GDQA 4REQA 5C7HA 3L4XA 3GE7A 1NJJA 3H53A 2V3FA 1ADOA 4Q4MA 2PDWA 2D24A 2C7FA 4MJMA 3UJRA 1TR1A 3TYEA 1E4NA 4PUEA 1DTNA 3IEBA 3W6YA 4Q8PA 2X40A 4NI3A 2PWDA 1P5BA 1X39A 2PU0A 4PEEA 1K3UA 3ABOA 3GR8A 1B3XA 4D6DA 3QFWA 3GO2A 4AF0B 4IUOA 2V2DA 1YLVA 4IFRA 3TVAA 5CC5A 3B97A 4N4PA 3SCVA 3B8UA 1P7TA 4ZZ9A 3WFAA 3V7PA 4FNSA 3W38A 2VX7A 3CJPA 2VENA 4WY0B 3WDHA 4AZ7A 1SFJA 2ZZ3A 4GJIA 3A3HA 3UG5A 2YZRA 1JEZA 2GK1B 2ON3A 4GO8A 2IKGA 1WP6A 4UNKA 4AU0A 1Q6DA 3EKGA 4JKMA 4DJFD 5FSEC 3RU8X 3WUEA 2JEQA 4MUPA 1QW8A 5REQA 3SCNA 5FSDC 3DYOA 4UUIA 1EX1A 3N4FA 2ZVIA 2OX1A 1UQZA 1R3RA 4ZSTA 3EDEA 4KGLA 1KFEA 5D9OA 1TTPA 1OWQA 3H2MA 3BXWA 3MHFA 4B16A 1EUNA 2EG6A 2VEPA 2YYTA 2F84A 4KCUA 1JNEA 4ZO7A 4K7VA 2B7QA 1MMFA 1HKIA 2WLZA 4QROA 3B03A 2ZE3A 4HP5A 2VDHA 3N6JA 3ZWSA 3BV7A 2ACSA 2DZWA 2PDNA 1ZPTA 1TMLA 3FAWA 4YIWA 1UD5A 3STCA 4C6EA 4CNSA 3SW6A 2P50A 3N04A 3NUKA 2Q02A 4TV5A 1LUCA 2Y8UA 2BVYA 1CXHA 3UBPC 4EPBC 1W9UA 5HPCA 2V63A 1Q5MA 2QJMA 2XPKA 2YA0A 5A94A 1RVKA 3QKZA 4JTUA 5A69A 3HQOA 4IQJA 1UZ1A 3ZZ1A 4L4OA 4D2JA 4PMNA 3UXDA 1OC7A 4Q4OA 1E0UA 1AQHA 3L67A 3RIKA 4S2BA 1ME7A 1QPQA 3SY8A 2XGIA 3HPFA 1TREA 1D7FA 3CC1A 4AZGA 1GCYA 3K1DA 3AUJA 3S46A 3KRSA 4F66A 1YADA 1WNOA 1SFLA 1K6WA 2BXZA 3OU8A 1QATA 1FXQA 4EAYA 1B2YA 1C8VA 3QV7A 3ES7A 2PTDA 2GVGA 1D3HA 1JIBA 1VQTA 4QDPA 1TQJA 1IEVA 1L8PA 3JW7A 3THQA 2EPLX 4ZB0A 3S0CA 1BXBA 3GNRA 3V0TA 1ZCOA 3CB8A 1R9XA 3BSGA 4JEJA 3ARQA 4UTLA 3MMTA 3KTSA 1JYXA 2XH2A 3PJTA 3CNYA 1Y0EA 3BQ5A 2HK1A 2WQDA 4NILA 3RR1A 3O1NA 4Y7EA 3TE9A 4PSPA 4H8UA 3TFXA 2GDVA 1UKSA 3BOFA 1SMAA 1UA3A 5LHEA 3LPGA 5DBUA 3M5VA 4XD4A 2PDJA 2YB4A 2XTKA 2H8XA 1WE5A 3NGFA 3GVRA 1AFSA 4HA1A 3VXGA 2GWNA 4MMWA 4ADSA 3R5EA 4AD0A 5C7VA 1UH2A 2J9ZA 2VYOA 4JTAA 3TYUA 4LSBA 4CCEA 1Z42A 1VCGA 1JDCA 3AROA 1JZ4A 2HE8A 2YL8A 1UWTA 1E3XA 3SDOA 4Q4QA 5EA9A 3CH0A 3G6MA 2QCEA 5BU6A 1K8YA 2RH9A 5AHNA 4BI5A 2X05A 3S9ZA 2D3NA 1OG0A 2BX7A 4KEUA 2DVUA 3C6CA 4HNCA 1UIOA 3GVWA 1FH8A 1ZENA 3F7JA 3GVVA 2PSNA 2QT3A 3NQBA 1UD4A 1GG1A 4MDOA 2O56A 2VTFA 3OBKA 2OX4A 3KOYA 1XLDA 3DGRA 2QAPA 5F2MA 3RPMA 5A6LA 3MJYA 1V03A 2AQVA 1H3GA 4U2YA 3SQSA 1VFLA 3A4XA 3WD3A 1VEPA 3T0DA 4IIGA 3B0YA 4UOJA 4Q4SA 3VKKA 5BMXA 1ZJHA 5EPDA 4ZQCA 1TJ1A 4B9YA 3G1XA 2ZWZA 1W1IE 4GD0A 1MW1A 4RXGA 4AD5A 1PTGA 1QU4A 1XYBA 2J7EA 3WLTA 3U48A 5DO8A 1CPUA 1N7KA 3VGBA 2VELA 2R1MA 1XJBA 2IKHA 1R9ZA 1EJWC 2CNCA 1J96A 2NQJA 5JUVA 1GTEA 5H8PA 1YXYA 1F8IA 9XIMA 4U4MA 2VI0A 3C3UA 3UP8A 2W79A 3UCQA 2Y6ZA 3VD7A 1J12A 3LI1A 1PX3A 3OHIA 4LUSA 1KM5A 2WNNA 2BXVA 4NXSA 3SCPA 3BICA 3FLUA 1DP0A 3W7GA 3P6LA 1VZWA 1UR4A 2REQB 1Q85A 1Q4NX 2A1YA 1UR3M 4HZMA 3AXIA 4W89A 2OO0A 1PKYA 1F6KA 3PWGA 3ANVA 4P5UA 1DIOA 3P5YA 2DV0A 4YJ5A 2ZUTA 4NVTA 4JQ2A 2NSOA 4Y9OA 4GX8A 3GC4A 2HVMA 2QPUA 1EJRC 1VRXA 4IT1A 4M5PA 2WMGA 2XWDA 4DLMA 1E6SM 3VO0A 5AFDA 2BGNE 2Z28A 4WX2A 4GVHA 4LYRA 3PVFA 1W54A 2VURA 4ZTYA 1V93A 3LLDA 3ITYA 1JD7A 3V5FA 3EDJA 4INFA 3GIPA 2E9MA 4JIRA 3F4VA 2PPGA 4DF0A 4HZ7A 1UZDA 3PB2A 3C2OA 2FHBA 1W1B1 3HOJA 4AD1A 3SQLA 3ALGA 4MKNA 4GFSA 4L4MA 5HK4A 3GG1A 4IPPA 3ES8A 3ZR4A 2ESCA 1R2SA 3F03K 3V0SA 3SN1A 4AZIA 2ZRYA 5DT7A 1M7PA 4IM4A 4IPNB 1EJSC 5EB8A 3L4ZA 3AMKA 3IJDA 2FH8A 3I4KA 1CGVA 5D37A 3OQEA 1MW0A 1K8XA 3F4CA 2YFOA 4OTKA 1FP8A 1TV5A 3WENA 3RPTA 1BHGA 1IEWA 3KWSA 1OFBA 5T8GA 4B15A 2CC0A 2C0AA 2PP3A 1R0MA 1LQ2A 4K36A 3P0XA 4EF9A 3LPOA 3DG7A 2G3JA 1A47A 2WBKA 3GNPA 4H8HA 4M6PA 1OF8A 1LQAA 3WBYA 1TPUA 4KRZA 1FHDA 1OX4B 2J9YA 2JFEX 1CB2A 1OADA 2OEMA 1YHTA 3OLEA 5AN7A 3ZIZA 5D9MA 1YDNA 4KCVA 3L2IA 3R0KA 4ACZB 1M03A 1DTUA 5CH9A 4DYJA 2P3ZA 4O17A 2OU4A 1V5XA 2XHYA 3CHDA 3MB9A 1S5MA 2JKPA 4H3DA 1WV2A 3A3XA 2WC3A 1KFKA 2A3BA 1T7LA 3WQWA 4DO7A 3B4UA 4PFHA 3BARA 4L9YA 4NJGA 3LERA 2YXXA 3AJ7A 1TRIA 3LHWA 5I0DA 3MW7A 1V6XA 1XISA 4DYEA 3M5YA 3OZOA 1O6IA 1VC4A 1L6GA 1OGSA 2VWTA 1UPPA 3K4WA 2VVSA 4LUTB 4HBKA 4B5TA 3G22A 1TWZA 5CG0A 3PZUA 2PTZA 1B9ZA 2QZRA 1KGXA 3ZJ8A 3APTA 1IWAA 2F6XA 3U5YA 5T26A 4C1NB 5HWMA 1JCXA 3VM5A 1TVPA 1R30A 3MDWA 4JCLA 3VGEA 2TSYA 2QUVA 3MTWA 4E3VA 4S3EA 4BEQA 1F6PA 2FB3A 3M64A 1I60A 3DC8A 4UTMA 4HZ8A 2J7BA 3H6OA 3AWOA 1HO1A 4LF1A 3KHJA 1LBFA 4HNTA 1A50A 1WZLA 4A4AA 2HMCA 4H9TA 3KVJA 3R2GA 1I45A 2EPMX 1XIMA 3IGUA 3SB0A 1PTDA 2GJPA 1JZ6A 1Q65A 3NQ7A 2YXOA 4W84A 2ZYFA 1ZLPA 4LBSA 1QK0A 3WLPA 4E4PA 5I77A 1OX5A 3CZEA 2BXYA 2XJ7A 4C1NA 2ZOXA 1OFDA 3OZYA 3HMJG 4D9PA 4UIOA 3R43A 1P4CA 4DZ5A 1TV7A 5BMWA 4Y9PA 4KCWA 3ZVHB 3H23A 3LZ5A 5BU9A 3HG5A 3S9YA 3DUGA 1RA5A 2CPUA 1XYAA 2NQ5A 3CUIA 5TF0A 3PJWA 5HNTA 3PB0A 2WMIA 6ENLA 3NPXA 4FZIA 3TEVA 3PUEA 3VMPA 3O0FA 1AMKA 2WWCA 3BGAA 2DSUA 4ILSA 3GW3A 9RUBA 4HKPA 1FWTA 3GRIA 4URIA 1P7TB 2OGYA 2OO6A 2XZ7A 3GDLA 3ZVIA 3COTA 3B3DA 2P76A 4N6EA 1SVDA 2EG7A 4LNCA 1YE6A 4RV3A 1OD0A 3DFSA 4BHYA 4UMCA 3DI1A 3SUSA 4RDYA 4QQ3A 1O5XA 3G77A 4YCPA 2O9TA 2DDXA 1B30A 4IISA 1ME9A 2ATMA 4CD4A 1O5KA 2RDUA 1W5PA 2IW0A 3L66A 3GDBA 3OLGA 1NEYA 3ARZA 1IR1A 4GABA 1XLLA 4Y90A 3DH7A 4PC8A 1S5VA 5F4SA 4AIBA 1LTDA 3H2OA 1FY6A 1ISZA 5DLCA 5C54A 3UWYA 4TQTA 3NQCA 3A3WA 3HQNA 4GI6A 4E8DA 5G1YA 4O53A 3NWRA 3AZSA 3H2FA 1RQEA 4QIUA 4A05A 2OT1A 4KQNA 1CXFA 5HBFA 2YSWA 4Q33A 1W2VA 1W37A 4NYUA 2QLYA 3PUDA 1MDLA 2E28A 1IWPA 2PGFA 3QVQA 2J7HA 3F1QA 3F2CA 1H2JA 3W87A 3PG9A 3NQVA 2A79A 1H1NA 4MM1A 2ACUA 2NX3A 2WHLA 4F9DA 3URAA 4C6QA 1AH0A 1J0ZA 4IJCA 1C8YA 4DLFA 2RGMA 3OPSA 2ANUA 3MBDA 1O1ZA 1T41A 1TWIA 3JR2A 2QGYA 1XH1A 2QAFA 4LVDA 1US2A 1ZJBA 3P67A 4ICMA 3VDAA 3A47A 3GY1A 6TIMA 3WLJA 1Q3NA 2D2JA 1QW9A 3EBVA 1RQBA 2Z2AA 2NVCA 4X60A 1U2YA 4C1KA 3BG9A 3CPUA 3KE0A 3NSMA 2YDAA 2E3ZA 5FACA 3UJSA 4G1NA 5LXEA 4ZOEA 3L9CA 5DX7A 1V6WA 4QCFA 2QUNA 3UGVA 3U8GA 3ITTA 2GQ8A 3BLIA 3W7DA 1ONRA 1WB0A 1FWNA 1RCXB 4GH3A 4KFPA 2NVDA 2Q3RA 5BWFA 4F0HA 3CB3A 3PZMA 3QHOA 4H9MA 2QXWA 1Z44A 2CBIA 3G1FA 5ABGA 1JQXA 5HDRA 2FZDA 4OBSA 1XBVA 4C7FA 1OINA 4IIDA 3EPNA 2P8CA 5RUBA 3M7WA 3HMCA 3CQIA 3ERPA 4MPQA 3NVDA 3SURA 4G2DA 1A5NC 1E70M 1DJHA 4H8VA 3W76A 4MWAB 1XYMA 1CNVA 3TLQA 3C2RA 4AUBA 3ARRA 1W1YA 2ZC1A 2CYGA 3PZOA 2F38A 3IJQA 4WEVX 4ZGYA 1GQLA 1XINA 4DUWA 1OFEA 2V3EA 2Y0FA 4GIRA 4AFYA 3QTPA 3EWYA 3IGXA 3TCEA 3L4UA 7XIMA 4W7WA 5CSUA 3HG3A 2DUAA 4RDVA 4IL0A 4P8VA 3LCXA 2D23A 4XTDA 1EDQA 1GW1A 2BLEA 2NV2A 2GUBA 3GH7A 4PMUA 4Q6XA 4UNIA 4AY7A 4LRSA 4J27A 4ROPA 4KWVA 1E73M 2XIOA 2PDGA 4CD6A 1PVNA 4WKAA 2C8NA 1LZOA 4S3BA 2E6AA 3OTRA 3LB0A 2I5QA 4LYQA 1ITXA 3T4CA 4XAGA 1G4EA 4U3CA 4DBDA 4ZQRA 4O1AA 1IE7C 2QUMA 5BCAA 3QBUA 4J3UA 2P88A 1TJRA 1R2RA 3MKVA 3O6AA 3CQ0A 1C3FA 5T9CE 3PBYA 2QS8A 4M81A 4BS0A 3VCNA 4JYDA 3TJXA 1F76A 1V0LA 1MUMA 3ISIX 3MUY1 3VD9A 1K02A 1Y5WA 2X1RA 3N4AA 1GQKA 4DBWA 2ABAA 5BRBA 4LGXA 3OBEA 2WYSA 3Q65A 3FSUA 5BZAA 1TE1A 3C8FA 2WSQA 5G4HC 3GDTA 4JTGA 4NZJA 3L7RA 3WLOA 4YTRA 1I1WA 3NZPA 1QO2A 2C19A 4LU0A 1GZ1A 1A5MC 4I7VA 1B5TA 4A8IA 3I68A 3ZJ7A 4UTTC 3O9NA 3DFOA 3WL0A 2WCGA 2V2CA 4PMDA 3LCHA 3THAA 2XM1A 1IZCA 2QUUA 3VZZA 3GUGA 2OQLA 4IQDA 2YKKA 1G9HA 3LM3A 4FNRA 4NX5A 1XIBA 1AQMA 1TVLA 4ATDA 1R2TA 5FF2A 3VE9A 4FX6M 2EPNA 3BLEA 1JNDA 2O9PA 3BAXA 4L1GA 5I3HA 4GQQA 4WR3A 2JQXA 2FMOA 1UD8A 2WZTA 1B4EA 2POTA 3K5XA 2XINA 1U1UA 3TN4A 2OZ0A 1UWSA 1WDRA 1ZJIA 4UFLA 2A6LA 2Z1XA 4GIYA 4OQVA 3CPRA 3SCRA 3T9PA 3NR0A 2GVEA 3VMNA 4QS5A 3PZNA 4GZJA 1C8XA 5FD0A 4HOWA 4ZOCA 3CM4A 2VX5A 1EJUC 2WM0A 4JTJA 2ZC8A 2PLMA 4L4LA 1EC7A 1Z7AA 5LNVA 5D2YA 1J79A 5F1VA 3LS9A 3VKAA 4E0CA 2BWGA 5CZ0A 5DRCA 5D04C 5G1MA 3VI2A 3U2OA 3E5BA 4UFKA 2JF7A 2Z6IA 3G1VA 4Y9AA 4C6MA 3CUXA 2FPVA 3MCNA 4BKNA 3RX3A 2ZRVA 4CVWA 2Z1VA 1KO0A 2G41A 1PKLA 3N2XA 1V08A 4LANA 2YIHA 3WLQA 1B3WA 4JTFA 2FTYA 1FFQA 8XIMA 3MI3A 4W9TA 2WV8A 1NFBA 4WCJA 1CX9A 7REQA 3CHFA 1I2PA 5LIWX 1XDJA 3QGAC 3EGJA 3KZPA 2ZUMA 3A5FA 4Z17A 3NIYA 4QG8A 7A3HA 1TWSA 1FWHC 4PH6A 4XBJA 4GX9A 1XDMA 2Y7DA 1HNYA 5B80A 3B0UX 3W2NA 4MFEA 3TFCA 1G7UA 5HULA 1F3TA 2F6KA 1UASA 1C90A 1FWRA 2FFIA 2Y85A 3WH9A 1QPKA 2E5BA 1MQQA 1KM2A 4MWAC 1I0BA 1YDYA 1TZ9A 1LG2A 3O3RA 4H6KA 2GPTA 3V5CA 2PEVA 3FDGA 5IHSA 4ZO8A 1ADDA 4G8TA 4H2CA 5AYYA 1LWJA 2OQHA 1E1CB 3O05A 3QH2A 1TTIA 3WQCA 3WF4A 4EF8A 1E5NA 3OQ8A 2G96A 4R5EA 3V75A 2HNEA 2ZBTA 1JR1A 3VMOA 4LY4A 1TPDA 5CC7A 4GI9A 3FYOA 5I5RA 4GZEA 1VBHA 3CAKA 1BWKA 2FFCA 1DIKA 3SRHA 5CPNA 1XX1A 4JTEA 5LNSA 4I9TA 3CV7A 2EGZA 1BXNA 1TKKA 3EDDA 1TX0A 1T8QA 1GOOA 4D8ZA 3GU9A 4O1FA 2C71A 4ZO9A 2R1PA 3AIRA 3FJ6A 3H26A 3AALA 3II1A 5DXXA 2ATSA 3BLDA 2DJXA 5FJJA 3UR7A 3W6MA 4H9VA 1FUYA 2Y89A 3W22A 2PDYA 4DJFC 4DPQA 4Z2GA 1QUMA 1HKKA 3PZIA 5DCDA 2QQ6A 3MCOA 1X1OA 4XAZA 2Z26A 3ZLHA 1S2WA 5LHFA 1KGWA 2JE8A 4LWWA 1UJPA 3TQPA 3Q37A 4R85A 1WA3A 4TTUA 2ZXAA 2H3DA 4ZXLA 4IMCA 4OU1A 5J5DA 4QDMA 4LEFA 1Q7QA 1XLJA 3R89A 1CGWA 1VYSX 2Y7GA 1PO9A 1E1EA 1OM0A 4ICNA 4LAUA 4S2CA 1H60A 3H4WA 4LVAA 2W92A 2P0OA 1OF6A 1PZ3A 4XZBA 2OPJA 3KOXA 3TW7A 4TX9A 3CK5A 4C91A 4XIMA 4IP7A 4JS3A 3CEUA 3QSTA 1LBMA 3TK7A 4HSNA 3GXFA 2DT0A 3FYYA 2D2HA 3CZGA 4HHLA 4Z2KA 1R3VA 3GNOA 4GOAA 3UA4A 3BLFA 4L6HA 3ZSTA 3ARTA 3LGDA 2GJXA 5E9XA 1BWLA 1YPXA 4X3ZA 4CQBA 4AIEA 4K8HA 4DXXA 3E49A 4PB3A 2H6RA 3T8QA 3OEXA 4HU4A 1GZJA 4WGHA 3V36A 1H7OA 1R7AA 1G94A 4U2ZA 5HANA 4K38A 1IIGA 4K3ZA 4P8UA 5ECUA 4JKLA 2O7SA 1CGXA 1O95A 1HJXA 2I1OA 2ISVA 3M0LA 4M3PA 5EBAA 3KLKA 3ZVHA 3UWWA 3ZWTA 4ASTA 4O1DA 5IRPA 4E8GA 1OK4A 4IMEA 1B54A 4QITA 1QT1A 4LC8A 1WDDA 2NXHA 2GQ3A 2V30A 3EX6A 1P6WA 3KBMA 2E5CA 5DFAA 4PTXA 2JK2A 1E0WA 3GXMA 3HG4A 1MQPA 4CNNA 1E6QM 1XUUA 5CPOA 1GKQA 2E5DA 3UPWA 2WMHA 2ZX7A 1KCXA 3LRMA 1E6RA 4GNVA 3FHAA 5JMUA 4NRSA 4GI8A 2TMDA 3EKZA 2WC4A 1V0NA 3LXAA 1W3LA 4QJ5B 4DZHA 3GWQA 3BTNA 3KBWA 3T1GA 4NNCA 3S5ZA 1LL6A 2XFWA 1TPEA 2VZSA 1TUFA 3QLLA 2ASHA 2YL9A 3CAVA 2HCVA 4AC7C 3GU1A 3OHMB 4HPXA 4V2XA 1G4SA 1GOKA 2CITA 3G1RA 3PZGA 3BPWA 3UU0A 1HGWA 4D1IA 3D5HA 2INFA 1H09A 2C0HA 4Y9NA 1P1MA 4FAMA 1RR2A 4EANA 1GK8A 1VIZA 5LNRA 2O55A 1ZJAA 2BHUA 2A85A 1DJWA 2G50A 4KFNA 3WNNA 1IEQA 3GXTA 4IJRA 2ZX5A 1PAMA 2XGZA 1JPHA 3KCJA 3KVMA 3MDUA 4I90A 5HJLA 1Q8JA 1AL8A 2C14A 5DT5A 3FN9A 5HMDA 3U5UA 2DH2A 2QPXA 4CNPA 1EKOA 1X8FA 3NEHA 3M0HA 4RE2A 2X0YA 1TTQA 1A5CA 1WDQA 2YDRA 3UT0A 3RJYA 1GJUA 3NL3A 3DFPA 1WYIA 4ML4A 1CTNA 3KAOA 4GCXA 2IUZA 2CU0A 4NG3A 1O1HA 5XIAA 4MKVA 4MADA 1OZMA 3H4GA 4P61A 3O07A 4JN7A 1H1ZA 1KD0A 4UTHA 1R7OA 5EKYA 4M7TA 3AAMA 1Y8BA 4UQBA 5J8LA 4J3WA 5CJMA 2WJFA 2QHAA 4Z0JA 1E1FA 2A3HA 1G4TA 4UTWA 3AYTA 3W7OA 1ZP4A 3BC9A 2WWDA 1DIDA 3BJSA 2ZTKA 3IV3A 2BNJA 3RYSA 5E1QA 1CLKA 1VP5A 1XIDA 2QV4A 1SFSA 2EAWA 3WQ8A 5FJRA 3HPAA 2QR6A 1Z41A 5GJNA 1UWUA 4Z0SA 2QGHA 2OOFA 1XIGA 4ZQMA 4LUYA 4PMOA 3W7KA 3TTYA 4M0XA 3LBOA 2AL2B 4H01A 4RPQA 2Y7EA 3N9RA 3N9KA 2WJEA 2R1LA 3RMEA 1JG9A 5K9XA 1KXQA 2QVNA 3GDRA 2VZUA 3EWZA 2ALRA 2HS8A 3N18A 4XO6A 3W2MA 3Q2DA 4K2SA 3N4EA 4J2MA 3TC6A 4JTCA 2PB1A 2BHYA 5BYWA 2WNWA 3TSBA 4AC1X 1E6PA 1H4PA 4AY8A 4PCFA 2NT1A 1K03A 3WQ6A 3U6WA 4D6HA 3WY1A 7PTDA 3BLKA 4LRTA 4OZOA 8A3HA 3QZEA 4YS1A 4LUJA 4C6DA 4OJYA 3G8RA 3ANUA 4L7ZA 3QM3A 3TNOA 2D73A 3WQPA 4TIMA 3I6TA 1Y65A 4DIAA 2PWVA 3FA5A 3MWCA 1VBRA 4GKLA 1M41A 1SUXA 5E5CA 5I7GA 3MYPA 4O1BA 3QQ0A 3DHFA 1DWGM 1Z6KA 4J9JA 4JX5A 3GR4A 4LVFA 3DENA 3KEHA 2ZRXA 3SI9A 1SO3A 1IXOA 1CT5A 5HR7A 1WAUA 1K6AA 1TJ2A 3BSHA 4UC5A 5AHEA 3M9YA 1Q6OA 2CLOA 2E6FA 4XD6A 5KMYA 1UH3A 3G0SA 5I06A 5AHMA 5I78A 1IZKA 1MNSA 4WDTA 4K7YA 4Q8WA 1ZZMA 1I6NA 1I2OA 4EXQA 3GM8A 4HPNA 1TO3A 3PPCA 1N55A 1EWEA 5HA7A 4QJ3B 2CZVA 2J7GA 1G67A 3WNOA 4GNJA 4DO4A 3R10A 3C52A 1IXNA 4AW7A 1VFHA 2J13A 4QQUA 1DORA 2P5NA 1J18A 1R6WA 3PF3A 3UZ5A 1TTJA 3WF0A 1RLDA 4B4FA 1P0EA 4UR8A 4EAMA 4JICA 2D0GA 2V67A 3WBAA 4GZ7A 2QF8A 1LWHA 2R6OA 3AIUA 5KZDA 3WK0A 5A6KA 3G1YA 2WHKA 4AH7A 2WKLA 1KBIA 3WLMA 2CZ5A 1VENA 2ZUWA 4E4FA 3WUGA 1UP3A 1KCZA 3NQGA 1TV3A 4RPPA 2X1IA 4JFWA 1WAWA 1VGAA 4KEZA 3LU2A 2O92A 1MFVA 1BYDA 3M47A 3EX3A 1CGUA 4QTGA 2ZZ6A 1KRAC 5AYBA 1HZYA 1S5TA 1WZKA 3LZ3A 1BRLB 3MMDA 1PX4A 4R33A 3QZ6A 2J77A 3PFRA 4ZMGA 3KVKA 4MZ1A 3FGCB 4ZL1A 3DFYA 1BTCA 3WMSA 3O7UA 4JZ5A 4JFTA 4FIRA 1EC9A 3RJXA 4RCXA 1F4HA 4RX0A 3VDGA 1JPIA 5F7UA 3EEGA 3V1PA 3VCCA 1FTXA 2BVTA 1JFXA 1T40A 4EPEC 3OIXA 4JHZA 4RDZA 5DCBA 3UG4A 4DZIA 1CXIA 4IG2B 1HJWA 1E3ZA 1K4GA 2PBOA 2WKJA 2DQWA 4FSAA 3EPOA 3KDNA 3NQEA 4QNEA 4FNPA 1RPXA 4WY0A 2ZADA 3DZ1A 4EK7A 1RD5A 4F0MA 3VIHA 1KRCC 3BUVA 3QJAA 2E0PA 3TJ4A 4QJ4B 2F6UA 2GLKA 4M8UA 5E0FA 4LNYA 5JU6A 1IWBA 4FLSA 4ZODA 2QYGA 1QNQA 2FJKA 3WKZA 2DSKA 4HYVA 3MUAA 4J3TA 2HDJA 3IARA 4ZE5A 5FIPA 1UR0A 2B31A 3TTQA 3UPBA 1M7OA 1FKWA 4LB3A 5C55A 3PULA 1OG6A 2EPKX 3ARYA 3USZA 4LXFA 4NY2A 4LBUA 5CQ1A 4NZ3A 3GZAA 1XF0A 4QXIA 3RCYA 4ZB5A 4A3RA 4F0KA 2HSAA 3PG8A 1V3LA 4FMVA 3UWZA 2J62A 4A8RA 4AWUA 3RCNA 5CPLA 2XIJA 1LJYA 1QWGA 3FA4A 4GRSA 3W84A 1WUFA 5HMEA 3GX9A 2IXUA 4X0VA 3WEMA 3S6DA 4QNWA 4JN8A 1JRCA 3M46A 4HHHA 2YLAA 1JULA 2Z2BA 2R9RA 2B81A 3S3GA 4MJ2A 3W75A 5A6AA 2QVHA 3OVPA 1S39A 3MA8A 1JFHA 2WCSA 3M0XA 2J8TA 1WO2A 1AL7A 1A0CA 3CZKA 1NF0A 1Q6EA 3EPMA 1PIGA 2YOCA 3VIOA 2CLFA 4JY9A 3B8VA 3QPEA 4UTFA 1V3KA 5KEZA 1T8XA 3HV8A 3WLKX 3VIPA 2JIEA 3I3EA 3PM6A 1MRAA 3HGSA 3AIWA 3G5EA 3B8SA 1OT2A 3LMZA 5HJYA 1UBPC 3G2GA 4QFUA 3TW9A 3OA3A 2FDMA 4HCHA 2Q09A 3R12A 2DVTA 1S2TA 2HQAA 4NKCA 1UR2A 2PUZA 2E9BA 3I3BA 4EPDC 1PHWA 1U5HA 2GGHA 3TA6A 3TQKA 2Z24A 3E96A 3BMXA 4NAFA 5BRQA 1FCUA 2DZVA 5C2GA 1B90A 4J7RA 3MUXA 3TKFA 2WVVB 3S1UA 4IX0A 3QYSA 4UTTA 1QPRA 1J01A 4R88A 3S5OA 1E9IA 1W1A1 1RP9A 2E1WA 2V82A 5HQEA 4L6DA 3WH8A 5CAHA 6ALDA 3AFBA 2FHFA 5IFPA 2IQTA 5A8PA 2OZ3A 2Z2UA 1HKWA 3NL5A 3CLWA 4RNJA 3NO5A 3D6NA 3KOFA 3R7MA 2Q8XA 2WVVA 3GHUA 3IJ7A 3A64A 3RM8A 1TFVA 2GUUA 3DAQA 2X42A 2A21A 2FZ9A 3E0FA 3GDMA 4LQ1A 1E6XM 4AZHA 4Z1CA 3D3AA 1D3GA 1S1PA 3VGGA 3E5PA 1B3VA 4IP4A 4HSOA 2XYLA 3GTHA 5D30A 5D2VA 3UF9A 4QE4A 2A7NA 2IPJA 2RAGA 3RPDA 5BOEA 4ZXOA 2J25A 3SRDA 3VTRA 1E43A 4ACYA 1HJQA 2E4TA 2JIWA 3H54A 2ZVRA 4JDYA 4HQVA 4IGMA 1O94A 4DAFA 1POJA 1HJVA 5AVNA 4N02A 1XRTA 2J8FA 3M5ZA 4DBUA 2BGSA 2CCRA 3QHMA 3VGDA 2OELA 3CL7A 2DSZA 1XBYA 3E74A 2VM8A 1KBLA 4O4WA 3U2ZA 4QS6A 4M82A 2EJAA 1PDZA 5JBEA 3STEA 1KFBA 1X6LA 2CZEA 5AYXA 3G3DA 2Y5EA 3ATYA 5C6MA 1ZALA 4YLWA 5XIMA 3PN8A 3SCUA 5LNUA 1VRDA 5G2HA 1YPFA 2XIMA 5FI8A 3UGRA 3W00A 1NELA 1XRFA 3MKKA 2E1DA 3RMJA 3CT7A 3IRSA 3FX4A 1GJWA 5I00A 5D9NA 4L56A 1W1ZA 3VNLA 3EA1A 3C61A 4DJEA 3CMGA 1KFWA 2VFEA 5E0KA 4HNVA 3N6QA 3GR7A 9CGTA 1VH7A 3N2OA 3Q4DA 3QY8A 4TV6A 4JY8A 2V5LA 1LQ0A 3M7SA 3ZO9A 5AKQA 4DVOA 3W2KA 4JIHA 4AD4A 3AS1A 4GYPC 1C7SA 4UR9A 1F3EA 2GQ9A 5CLWA 3W2LA 1HXJA 4MJ4A 2RGLA 1K4HA 2V8ZA 2BOFX 1XR2A 3EB4A 3RLVA 1GZGA 4KGJA 4AIUA 4DJFA 4GWEA 1HTIA 2ALDA 3V0UA 4DUVA 1FH9A 1OY0A 4K1WA 4C6JA 4V33A 4Q22A 1ISWA 3IVTA 1JRBA 3CWOX 1BGAA 1KQYA 3P2VA 1K8ZA 3SUTA 4UTIA 3NO1A 4MOZA 3NURA 4WOZA 3T05A 3ELFA 3GKAA 1J0IA 1ONEA 4C6NA 1WUEA 1IEIA 4QDWA 4P7LA 1AJ0A 3UG3A 3GD6A 3D3FA 3WF3A 1DJZA 3C86A 2XH0A 3B04A 1NQKA 2ZA2A 2P10A 1UROA 4Q7NA 3TSDA 5SWUA 1UR8A 1DJNA 3PTQA 2WZIA 3THUA 1UUMA 5DXYA 3PWAA 3O6DA 1EL3A 4LS0A 1TMQA 1E4IA 2W67A 1BVZA 4JTKA 5A6BD 3R94A 5I03A 1P6CA 4RNIA 1K70A 4XVEA 4XUGA 4WKHA 3LBCA 2VRJA 5JBFA 3W7CA 3WDPP 4U31A 4OE7A 3OGVA 1UC5A 3SBFA 2HEJA 3UJEA 3FOKA 3QEZA 3RG6A 1VCVA 5D05A 3SCWA 4CN1A 1EA0A 3PFMA 3FHQA 4UMAA 1GW9A 4AXKA 4O1EA 2Z1BA 3FV9A 3R79A 3WFLA 1XXXA 1EHNA 4GPNA 3LPPA 3ORWA 4LYKA 3S9IA 2J88A 2WZMA 2VUYA 3W1QA 4JNZA 1S3HA 2AKZA 5K3VA 1FDZA 2WOQA 4PUKA 2VFIA 2Y5JA 3EOUA 5CGTA 4OHQA 1QAPA 1LOLA 2DUXA 2X1UA 3C0LA 2P3EA 5KINA 3QOKA 3VOJA 1AD1A 5H91A 1FWDC 3GNNA 1NARA 2WANA 4YTTA 2GGEA 3VILA 5J5RA 1UR1A 1B4KA 2YA1A 2HBVA 2V3DA 3PZQA 4QEHA 1JCLA 4PULA 3WLNA 2VL4A 3PY2A 3DFNA 3U2EA 3DGBA 3E2VA 4KWSA 3LHTA 3OO2A 4GQ0A 4UFJA 5EBUA 4HA4A 4HVXA 4AAJA 4LV4A 2XVGA 3UA3A 5CC3A 3N73A 4AZBA 4GA8A 5ABFB 4A8NA 5A2BA 2R14A 4M80A 4BY3A 4GO9A 3UERA 4FB7A 2VOTA 3NM1A 1QI4A 3H2NA 1W5MA 1S2AA 1IIHA 2VDGA 5EFFA 1CENA 3FK4A 1EJTC 6PTDA 2G95A 3GB6A 1KWKA 4MKSA 3T0TA 3RLHA 1FWEC 6XIAA 1XS2A 5CEWA 1PDYA 4FA3A 2XFRA 1RJPA 3ITVA 3ZFHA 4HYRA 2YCEA 1OCNA 4H41A 1JXJA 2MNRA 4P7QA 4R7WA 1O5QA 4QP0A 4CD7A 1KRBC 3SAZA 2RFGA 2DZAA 5EMYA 3QW3A 2OLAA 3CQJA 2CLIA 2CHOA 1GHRA 1HKVA 2CHRA 4O8RA 2ZXDA 1W3KA 3TN6A 4F0SA 5CPTA 3GYEA 4YYCA 5HATA 3VIMA 3N15A 1DOSA 5AY7A 3NXFA 5CKSA 1LCOA 3GXDA 3UESA 4W93A 2F2HA 3A4JA 5A6TC 3UETA 4E6MA 4JTHA 5FF4A 1MNZA 1OFPA 3ITOA 3STPA 3GFXA 3BVJA 1B1YA 4G7FA 4TX6A 4Z2LA 5C9XA 4FR6A 3VKJA 4HGXA 4GHRA 2J6VA 3NSNA 4D8LA 5D8ZA 1PZ2A 4ZQPA 3B4YA 1IEXA 3W81A 5G4EA 3W25A 4ZENA 1Y7VA 1DQXA 3DFQA 4RXFA 3POHA 4HJFA 1WKEA 1H49A 3W1AA 1EUAA 4JYFA 3MT1A 3ZR6A 4GXWA 4WDXA 2RUSA 3SCTA 2D3LA 4CVUA 3O6CA 4IZGA 3WH6A 3T40A 3MP3A 4ATWA 3BMVA 4ZTXA 3EXSA 5HUPA 1QNRA 3MJMA 3U7BA 1KV8A 2ZX9A 1XLMA 4JIIX 1BEUA 5KTLA 1H7PA 3KZSA 2V81A 2D0FA 5I07A 1UKPA 1M01A 4IP5A 3WUBA 4HN8A 2PRMA 1GNXA 2HVOA 2INEA 2EO7A 4UB9A 3L68A 5C5YA 3WELA 5DY3A 2H9AB 2RDXA 5CGQA 1R5YA 3LENA 3L65A 3LDVA 1FWFC 2QW5A 2EJ1A 3UVIA 3AIQA 2FVLA 3RR4A 3W26A 4IFOA 2JGQA 5DF0A 4NL1A 4NHVA 4POCA 3TX9A 1N2VA 1KM3A 1I9CB 4TMCA 4IMFA 1CBGA 4AVOA 5FJTA 2QULA 3UR2A 5BRPA 3DKJA 3MO7A 1J0HA 3G1AA 4O54A 4P7NA 3N2TA 1Q63A 3ZM8A 3PS7A 4RZBA 1J6PA 2H9AA 3W37A 3EXTA 2GGIA 4EWND 5A6BA 4JIEA 2B7OA 3AICA 1XLGA 3DG3A 1SPQA 3KBNA 4RJEA 3PBMA 4NJJA 2NQ9A 3ZXWA 3MY9A 3FXGA 1PWLA 5CZSA 1UH4A 3TONA 3V5OA 4GY0A 3H2AA 5LKYA 3ARXA 4HMEA 4YXGA 1OCBA 1S1RA 5LXXA 2GWGA 5CPMA 1F74A 2ZWYA 1YX1A 3TOYA 1A3XA 5I02A 1A80A 3IGSA 4JGDA 1GVQA 1NAL1 4W8AA 5HNRA 3P62A 4W7UA 2W62A 1TPVA 4W8BA 2NLIA 4KESA 2WSRA 1A0EA 2IKIA 4MYXA 4TU1A 1E6NA 3BDKA 1JCTA 3H22A 3KL5A 3LEPA 4LPCA 1F07A 1L6YA 4ZQNA 2I56A 1XRVA 1L9WA 1RAKA 3IWPA 3RAOA 1U1HA 4ZOAA 3THCA 4B4HA 3VU2A 5L6UA 3ANYA 1H7WA 3RLUA 1E9LA 3QY6A 3IK4A 1R46A 2WVUA 4GUIA 4GY7A 3PBUA 5GVJA 1XLEA 2IS7A 1EF2A 3EOLA 1KTCA 2C13A 4JTTA 3JU2A 3BWWA 4GQGA 5M1TA 1VEMA 1LUCB 3UG8A 1GOXA 1PCWA 1WXZA 4YVVA 2R94A 3WNLA 1FWGC 4UMBA 2J7FA 2R1KA 2XFYA 4ERAA 2PZNA 2VZTA 1XQLA 3B0PA 2ZE0A 1ZP3A 2IKJA 3A4WA 1G01A 2OCZA 1DJYA 2E6DA 2PFHA 5GJPA 2WVTA 3LNPA 3S5YA 2XISA 2ZDSA 2XN0A 3EMQA 3G1HA 4PTWA 4LW7A