4PTDA

Phosphatidylinositol-specific phospholipase c mutant d274n
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQNYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the roles of active site residues in phosphatidylinositol-specific phospholipase C from Bacillus cereus by site-directed mutagenesis.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
total genus 105
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1997-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4ptdA00
1T6MA 1DJXA 2OTDA 2OR2A 3OHMB 3V16A 4F2TA 1DJGA 3EA3A 5T91A 4I9JA 4OECA 5PTDA 1ZCCA 3MZ2A 1DJYA 3KS6A 3L12A 3QR0A 1DJHA 4RW3A 2ISDA 5T9BG 3I10A 1O1ZA 3RLHA 1VD6A 7PTDA 1YDYA 4I8YA 2ZKMX 1QATA 4I90A 3V1HA 1DJZA 1PTDA 2PLCA 3QVQA 4QJ4B 4Q6XA 3EA1A 3H4WA 2FJUB 1V8EA 3NO3A 3CH0A 3H4XA 1PTGA 3PTDA 3QR1A 1T8QA 3KS5A 2P76A 4QJ3B 1DJIA 4GNKB 1GYMA 2PTDA 3EA2A 2O55A 6PTDA 1XX1A 4RV3A 1AODA 2PZ0A 4S3GA 4F2BA 2F9RA 1DJWA 4PTDA 4I9MA 5T9CE 3RLGA 3V18A 4F2UA 4RW5A 4QJ5B 4I9TA 1QASA 2OOGA 4R7OA
chains in the Genus database with same CATH superfamily
9CGTA 5HDRA 4QQ3A 4IFKA 4D6HA 2WHJA 4F0MA 3QR0A 4DX3A 1JZ5A 4DYKA 3OGSA 1AD4A 1JR1A 1A3WA 9XIMA 1KWGA 1Q7MA 3W86A 2CLFA 1YPXA 2V82A 5H1WA 3HQNA 5GQBA 1QI0A 2ZYFA 4PBFA 1J6OA 4UIOA 3RO8A 1HJUA 2XUCA 3Q2DA 2B0MA 5U4NA 2CBUA 1DKWA 3I7QA 3P5YA 1TVNA 2F8QA 4WGXA 4JTUA 4LS1A 1VHNA 1WDSA 1NOUA 4PUWA 3U5UA 1HL8A 3O07A 4S3JA 3FCPA 4IPIA 5I0DA 4JTLA 4HOZA 3GFXA 2G3IA 4KMQA 1U5HA 4DBDA 1QU4A 1QW7A 1BTMA 3B0PA 4H01A 2OYLA 4JX4A 3NWRA 3PUEA 3QVQA 3WJWA 3VO0A 1XSIA 1NDYA 1V5XA 3UZXA 2Z1SA 3NQ2A 2CEQA 1XPYA 2GL5A 2ZZ1A 4DYJA 4NQ1A 1H49A 1G67A 1R46A 1XKJA 3TFXA 1Y8BA 4J2MA 3UWYA 3OG2A 4KFOA 2W91A 1T7LA 1HJWA 1VGAA 3T4CA 3FDKA 3BOXA 1MO0A 3TW6A 3NQDA 4MPQA 3CZJA 3G0SA 1PBGA 3UZ5A 4LUSB 1RQBA 2O56A 4QIUA 4P7OA 4PRTA 1JZ8A 1UR9A 3SJNA 5CC3A 4WKFA 4MYAA 1EEPA 3NPUA 4RE2A 5CGMA 1BD0A 4HMNA 3QMTA 2FYMA 4TU1A 3NUKA 5JVLA 1U33A 2V69A 4MZYA 3SDOA 4N02A 5CSYA 4QLLA 3TN6A 3OEXA 4AHPA 4C6LA 5REQA 3GXFA 1UUOA 4MKSA 5DT5A 2Y63A 1AA1B 3LTYA 3G0UA 2J9YA 3T8QA 2FVLA 1BYCA 3CQHA 1P1XA 3F2BA 2OB3A 4YTTA 2ABAA 3DBNA 1CYGA 3TA9A 3GHRA 4Q4RA 1IT8A 3OVPA 2J6XA 2P3EA 3N14A 4H6QA 1J96A 1UP3A 1UH4A 4RE4A 2DVUA 4MSSA 3L5LA 1YMYA 4GC4A 4K36A 1PYFA 1PHWA 2G37A 3W38A 1F5ZA 4EPKA 3KDNA 1BFNA 4CD4A 4DF2A 4JX5A 5K3VA 3WQOA 4ERGA 5JUVA 1PVNA 4XBSA 1QCWA 5AC6A 3KVKA 2EJ1A 3THCA 2DT2A 4X9YA 6XIMA 1CIUA 4KEVA 3RCNA 2WPGA 1NP2A 3CL6A 1G7VA 2PWHA 3I3DA 3ARVA 4HSNA 4FF7A 3UW6A 4XZBA 2D0FA 1AW2A 5H6HA 4GRSA 1UB3A 1EEXA 3FVDA 4GO9A 5C9XA 4U28A 2JIEA 4P5UA 1V3KA 3OBKA 2AQVA 3EOSA 2DUAA 3WBWA 4LVAA 1X38A 2X0SA 1V3JA 4AC1X 4RPQA 1XBZA 4IMCA 4YTQA 4V1YA 3L4XA 4MJ4A 1YE6A 2X05A 4C6JA 4GHRA 2HXUA 4IH3A 3W0KA 3SRFA 1N2VA 3O9NA 1QW8A 3UWVA 4R5EA 1DWFM 4E0CA 3AMDA 1KM0A 4B5VA 5A6TC 2C6QA 2V5JA 4LRTA 1ICSA 4LX4A 3MKVA 2ZUVA 1SUXA 4JXCA 3W00A 3GQYA 3PVFA 1Z6KA 2Z24A 4ZQRA 2XFYA 1QR7A 2C15A 1BG4A 5D03A 1ZAHA 1BQCA 2CBIA 3WK0A 1UWQA 1ISVA 1UPPA 3FJ6A 3R79A 1GEHA 1EJVC 3I10A 3C0SA 3COTA 4MNJA 1NSJA 4CLMA 3O0FA 5XINA 3E9AA 2R82A 2GJPA 3QR1A 4Y8FA 3PZMA 4W8LA 4UQDA 3B3DA 2UY2A 1KR0A 3U7VA 3JVAA 3KBJA 1Q65A 3F4NA 3AMCA 3GNPA 5HJXA 2YB4A 5AZ0A 1V77A 3WQVA 3E2QA 1W1A1 4IXXA 2CU0A 5IHSA 4URIA 3PHAA 1UWTA 2V9DA 1LOLA 3R2GA 2QDEA 1ZJIA 2BVTA 3CWOX 3VIGA 2ZX5A 3ABQA 4XZMX 2C3ZA 1XYAA 3GVVA 1C93A 3AXHA 3CO8A 2DW7A 5FJIA 1PKNA 3UU0A 4OTKA 3NG3A 1TFVA 1M3UA 3O8AA 1NWSA 4ZE5A 1NWUA 1W9XA 4GYPC 2I57A 4J3ZA 1RLCL 1S2WA 3N2OA 1R86A 3U57A 3LENA 3O15A 4WCJA 1KM2A 3BW4A 3LUTA 3AMKA 3CHVA 5JH2A 2EPKX 2CFFA 1Q4NX 3ES7A 4I7UA 4EP8C 4CNUA 4JTCA 2X30A 1SW7A 4IX2A 4GLEA 3OVQA 3MWCA 1VJZA 4DM1A 1W56A 1H7OA 4HN4A 1J6PA 4HNUA 3RCMA 1ZLPA 3CUIA 1WXYA 4C60A 4F0SA 3HF3A 4DELA 1DYSA 1TMQA 6CGTA 2NT1A 2TAAA 4MWAE 3LGDA 4JHOA 2OYMA 1S5WA 2WNWA 5FCZA 3TXZA 4GNKB 3HPSA 4FPSA 4FB7A 2J8TA 3WN6A 2V38A 3SADA 4U2YA 4JN7A 1TV2A 3F2CA 1DIOA 3P0XA 3E0WA 3BAYA 3PBYA 1JCLA 3GH5A 1A5MC 1V6WA 3AHXA 3C3UA 3C2RA 1R0MA 3KOYA 2E6DA 4RXGA 3E49A 1XIJA 4I6KA 1Z44A 7A3HA 1OCBA 2WC7A 3QMRA 3U9IA 1G0CA 4DWSA 5LNRA 4IJRA 4N4PA 2D0HA 2O9TA 4YU1A 5C9ZA 1K3UA 3GLCA 2F61A 2H90A 4FIRA 1IXQA 1N8IA 3ABZA 3NYZA 4HU0A 1VBUA 3PNZA 2NQJA 1BWLA 4RNFA 9XIAA 4YTSA 1P0DA 2WJZA 1HJQA 4NRSA 3O16A 4IUGA 4EPDC 1B4KA 1CXIA 1M9HA 4HJFA 4DBEA 4GNJA 1I75A 2Q8ZA 1BLIA 1B3OA 3EX1A 3NPVA 4UBPC 4NT0A 6XIAA 1RSCA 3KWXA 1GOOA 2ISFA 4AH7A 2OT0A 4PMJA 4I9JA 2WZHA 4H9MA 3VD5A 4GY1A 1WB0A 5AC5A 1UR1A 3LOTA 3MT1A 2PDLA 3HPXA 5C7HA 4POCA 3W74A 1S2UA 3QFEA 3CT2A 2XH0A 1E9LA 3P67A 3BARA 1LG2A 1JD9A 3TDFA 1XG3A 3BGGA 1AMYA 3T1GA 4PCTA 1JUBA 1DTUA 4UFIA 3O6AA 4DUWA 1UD4A 4XX6A 1M7OA 4HK7A 3LCWA 4BFAA 3OO2A 3TZFA 4E4PA 3NEHA 1MEHA 2VEPA 4H19A 5AVNA 3URNA 2AMXA 2V68A 3ZQ9A 5J04A 3GR4A 2VR2A 2PTZA 3S9YA 3LA4A 3WNPA 1PIIA 1EWDA 3R8RA 1HKMA 1VPXA 1KQZA 1E9IA 3OBAA 3AZSA 3M7WA 5DF0A 3C56A 1QNSA 1E73M 4GA8A 3BANA 4QS5A 1EX5A 3GKAA 4K8HA 1VFMA 1SSDA 1MUCA 4K3ZA 2WQDA 4DI9A 1XI3A 4JKMA 4FX6M 4FF5A 3ZOAA 1SO4A 3KHJA 1TPH1 3QQ1A 1FQ0A 3E5BA 4JYDA 4CQDA 4BQ3A 1E5JA 4H9XA 4RE0A 3ZMRA 2DT0A 2ISWA 3KP1A 2A2IA 4B3LA 4B3KA 2OZ3A 2VD8A 5FF4A 3ZIZA 3OA3A 3VYLA 4J40A 4KRUA 3I7SA 3MPGA 1BXBA 3N18A 1ITCA 1VBJA 2NX3A 3KOWA 1OX6A 2PDPA 3MO4A 2ZE0A 3EA2A 3LXCA 3BCDA 5BWFA 4UWMA 3VGDA 4F0LA 4FNSA 1K7FA 1GG1A 2NQ9A 2C1HA 3AYRA 2F7FA 4NAEA 3P7YA 5CPTA 3FA5A 1LOQA 1D7FA 1QI2A 3K4WA 4UCGA 4UQBA 3UQNA 2FB3A 4GNVA 3EX2A 3UWEA 4GQRA 3S8HA 2BOFX 3SM0A 4HK5A 1OYCA 3GDRA 1Z42A 3DAQA 4EWJA 2G8ZA 4JZ5A 3ME3A 4BEUA 1V6TA 2FJUB 3TOPA 4D9PA 5EMUA 4LAOA 3E96A 4S3BA 1UD6A 1KM6A 1Q8JA 1XM3A 3PB2A 3P84A 1BGAA 3E5PA 3B40A 1KC7A 1S5TA 1B9BA 3PP7A 3GR8A 3FS2A 2FZMA 4BA0A 4QR6A 1UKQA 3NFUA 3W7JA 2FTYA 2Y5SA 3ISIX 1VYRA 1FWHC 1RHCA 4NZ3A 1ICPA 1QBAA 3GXIA 3OGVA 1S3TC 2RDXA 4WY0B 3W23A 4IP7A 3L2LA 3AYTA 1XLKA 4I7VA 2QW5A 1M53A 2NX9A 3FVMA 3FXGA 3C0QA 2DZWA 3UA4A 4NI8A 2VEFA 5BXTA 2XIIA 4PL2A 2PFHA 1S2VA 2Z29A 5C9RA 2FFCA 2H3DA 1GQNA 4O1CA 4K2SA 1V51A 4D1JA 1UMLA 3UVIA 1H62A 1W3TA 4HPHA 5FL1A 3WD4A 4C1KA 1OF8A 3H54A 4QE4A 3S2MA 3L2IA 3ZJ6A 1WKDA 4IG2B 1UA3A 3M47A 4Q8MA 3VU2A 4GBUA 5FIPA 2HTMA 4ALDA 1NAL1 1LQ2A 3MCNA 1B9ZA 2EO7A 3QMSA 4ZZ9A 2V2DA 1F73A 1VLWA 3CQ0A 3S9ZA 2E6YA 2PTDA 3W7MA 4EOUA 4CEUC 3LNPA 3M07A 5LIXX 1AH4A 2E67A 3MMWA 2DZXA 4ZBCA 3K8LA 5GVJA 4AUBA 4LAMA 4CN4A 1P6WA 2CZEA 2CZVA 2VC9A 3VTRA 3L4VA 1GZ1A 1CZ1A 5KZEA 1VEMA 4S23A 4GWEA 1P0EA 1E4LA 2IXVA 3PWIA 3VDGA 3AROA 1PZ2A 2J88A 3VVGA 5XIAA 4GZ7A 2E8YA 4W5ZA 3BLDA 1YYAA 1H7RA 1E71M 1OX4A 4YTRA 5D9MA 2YCIX 4E2VA 1EXPA 4H8VA 2YDAA 3UGRA 1JCJA 4GXPA 5A95A 1X96A 1XL9A 3KL0A 3UWUA 1Q6QA 1ZGDA 2FHCA 2JKAA 4FXRA 3LNMA 4UXDA 3S1XA 4KEUA 1RP9A 4N9CA 3PZUA 3CUHA 3W7LA 4GUJA 1GT8A 4PMOA 4RKAA 2QJJA 4FSAA 2A3AA 1ZHAA 2FGZA 2RGLA 1JCMP 2X1IA 4YIWA 3LZ5A 2I56A 4BF5A 1TJ2A 1KBJA 3PSVA 2JF7A 1BG9A 5FJJA 4RXFA 3T6CA 3VIPA 5FF0A 3P93A 3QKEA 3W1RA 3IUDA 2D3NA 1GPFA 4S1FA 2HZGA 1L2UA 1XS2A 1U22A 4IHCA 2IUZA 4NJJA 2CLIA 4N9BA 4MJZA 1EC7A 3KCOA 2C91A 2I9UA 1HF6A 2YL9A 4WHBA 5CC7A 5C54A 1UKOA 1MQQA 3C6CA 1I2PA 4D6FA 1B3YA 2YA2A 3T40A 5LIWX 1MW1A 1E6PA 3GU2A 5IXEA 4IQEA 2NQ5A 5IFPA 5TF0A 3FSUA 3BAWA 4OQVA 1FKWA 1TTIA 2Z7GA 1K6AA 3BE7A 3OU8A 4QGCA 1FDZA 3E0FA 5HMFA 3WH7A 4JL2A 4LUYA 4XG1A 2V3EA 1N8FA 4DVOA 4LUIA 3SN1A 3DYOA 4IT1A 3V75A 4QG9A 1ZENA 4NIRA 3LYEA 1YRRA 1W5QA 3HM7A 4IWWA 5A8NA 1A49A 1PE1A 4XAFA 4RE3A 3EYPA 1CB2A 4ZGYA 3N29A 1VIZA 4Q7BA 2ZUNA 4W5UA 1ALDA 1TVPA 3ENLA 4MFEA 4R3UA 4DWSB 5HPCA 3CEUA 3C5QA 2MNRA 1H1NA 4U4MA 4F4RA 3WF1A 2BHYA 4DWSC 4ERAA 3EOEA 1DHPA 1A3HA 3PZOA 3GX9A 3MBDA 4WGHA 4C6IA 1TX2A 4F3HA 4HNLA 5C0QA 5AHFA 2I17A 5G1TA 3GFYA 2Y61A 3SQMA 3IVSA 4GCAA 2V3DA 2HISA 4ACZA 5TD4A 2DV0A 3LG3A 3VOCA 3GDKA 4V33A 4TX6A 4D2JA 3EMZA 3M0KA 5G2HA 1GCYA 3M6DA 2XISA 4R88A 1N82A 2YBVA 3NVTA 2ZC8A 2TODA 1VEPA 1S2AA 3WJZA 2NX1A 4MWAB 2XGZA 4Q8OA 3LGEA 1RV8A 3NDYA 4QP0A 3WLTA 1BKHA 4JS3A 3UA3A 3LU2A 3CAKA 1SVDA 1PPIA 2EG8A 4YLWA 1E4NA 3L23A 2PB1A 2ATSA 2PWVA 1H11A 1Q6FA 4PRWA 4PTNA 1TCDA 1DIKA 3TK7A 4MZ1A 3W71A 2X7WA 1P6BA 4Y9PA 1TE1A 2QNEA 4EIVA 5KZMA 3SEPA 4ATDA 3HV9A 1H51A 2A3HA 4AW7A 4JTJA 3DI0A 3BDKA 4UR7A 1TJ1A 5CAKA 1T5AA 2B4GA 5DBUA 3LPGA 4A3UA 1V02A 3N9SA 1TZ7A 2PWDA 3WDPP 4QNWA 2Y4SA 5AKQA 1FP9A 1YNPA 4GH3A 1IIHA 1C8QA 4M29A 2NZLA 2VD9A 1Z69A 1AZ1A 4IJBA 1UW9A 5H8PA 2QJIA 3GZAA 3ARSA 1IR1A 2J75A 3GYCA 4NU7A 4GUFA 5D30A 4R7WA 4XTDA 4QISA 4ZVJA 2PF0A 3TSBA 4FOKA 4WKAA 2CLOA 1X39A 3C2VA 3W1XA 2XDFA 1LT7A 4LBUA 1ZQ5A 3NQCA 3CZGA 4JTQA 5FI8A 3BLPX 4GABA 2ZQ0A 3WZ0E 4HYVA 1IHIA 5AOUA 1UP0A 1XYMA 4WY0F 3W82A 2ZXDA 4TOQA 1ZBKA 1JRBA 1JYVA 1ITUA 4Z2JA 1PKYA 1XD1A 5GJMA 4PULA 3MSDA 3DFNA 3EA1A 1R38A 5I23A 3WK1A 3DFQA 6REQA 1KBKA 3U7BA 2PDUA 4Z2KA 4M82A 5LIKX 4PC8A 2OR2A 2WVUA 4A29A 1ISZA 2G50A 4HKPA 2J7EA 3T44A 3POHA 3ZR6A 1GPWA 4BJHA 2HCVA 3WF4A 1KD0A 1NF0A 2QJHA 1L6YA 3WUGA 1SJAA 5EA9A 4AD2A 3SCUA 4UTTC 3BLIA 2GOUA 4KRZA 2PBGA 2XN0A 3EAUA 2EPNA 2VEKA 5CPOA 3V5OA 4OT7A 3LRKA 2J7BA 1M7PA 5EPDA 1Q2SA 1VC4A 2QV5A 4HHLA 1RVGA 1GYMA 2G41A 2PODA 1PWMA 3C0JA 1KFLA 1UP2A 3LPPA 3UG5A 1J0YA 4QNEA 1XIIA 4BF9A 4DJDA 3VIOA 3TCEA 3IPWA 4O1FA 3H4GA 4ADSA 4JQAA 3KBWA 4B5XA 3SQLA 4U31A 5BZAA 1O5QA 4X9SA 4W89A 5AC7A 1M1BA 3MSYA 2QR6A 1BHGA 3LY0A 4GVFA 3A4JA 4C1LA 1OADA 5CSSA 2C71A 3P82A 3NZGA 2IQTA 1EYEA 4LVFA 3MO7A 3MUIA 2GFTA 2YDQA 3U2OA 1O5RA 1JI1A 4FLQA 2V2CA 4HHPA 1DJZA 4KWWA 1J5TA 1OG6A 4ZR8A 3LTPA 4X63A 4QM1A 2V2HA 8XIAA 4ZFMA 5E1QA 3W7HA 1VFHA 3H7VA 2WNZA 1K8YA 1E56A 4O57A 4A8NA 1QNPA 1TTQA 1B57A 4JL1A 3RPDA 1KRAC 2VC6A 4QSHA 3W9ZA 3WJYA 1Q7ZA 4UFJA 2PEVA 3TR2A 2VP8A 5E6ZA 5DXYA 3QW3A 1K8CA 1EHAA 3QGKC 3WMBA 1EGMA 5FEWA 4LNYA 2QCDA 1CTNA 1YE4A 4X61A 1Y5VA 3QHNA 1WAWA 3H6OA 3N73A 4DPPA 2DSKA 1JXJA 1W32A 3W7QA 4R7OA 1I2NA 1LT8A 4OECA 3AQUA 1BQGA 3NAVA 2AL2A 3ZR5A 1A0DA 1ZAJA 4XAZA 2POTA 2VI0A 1HNYA 1LLWA 4H6EA 5EU9A 4P8XA 4S3AA 2NSXA 1X1ZA 2GSJA 5FJPA 2HQAA 2CPUA 3TTQA 1NH6A 1DP0A 4Z2IA 1SW3A 3ID7A 3N6JA 1BVNP 4QTGA 4RNJA 2H6RA 4MMWA 3VAVA 1C8YA 5LNUA 1QBBA 1GZJA 3WYZA 2KX9A 3EOLA 2VX4A 4ACZB 3DFSA 2H9AA 2OELA 4C6KA 3CHEA 3IK4A 1W1PA 3ARWA 1EZ2A 3NURA 2BZNA 4CCZA 3W7OA 1W1VA 2D2GA 4AMCA 1UYQA 5JIPA 3AMGA 3NPWA 5C2GA 1H61A 5T8GA 5BRQA 4HNTA 1OJXA 3M4HA 1K9FA 4JEJA 5E09A 3WY1A 2VOMA 1K1DA 4GUGA 5EL1A 1YDYA 3DXIA 2BDQA 1Z9AA 3TN3A 3U2CA 4AZ7A 2CHNA 3AXKA 2CW6A 1C29A 1RH9A 3WUFA 3PG8A 5K9XA 3HQPA 4BF7A 2GUYA 2ZXQA 4MWAA 5IRPA 3NEVA 1P7TB 4FAMA 4IGNA 1JZ3A 3QTGA 1W8GA 3I4EA 4GVHA 1WDPA 2VELA 4IIGA 4JCMA 1HO1A 2YA1A 5HULA 1XX1A 2HE5A 3IUIA 4ZO6A 2P53A 4Z1CA 1F3XA 2FHBA 4O1EA 3TLQA 4XISA 4LJ3A 3VCCA 3IARA 5LA2A 1IEVA 1V03A 5CPLA 1RBOB 1MQRA 4AVFA 3OZOA 3S3GA 2CETA 3E38A 3PBVA 2OOFA 4AZHA 1UD8A 3E0LA 3PTQA 1YHTA 2OZTA 1ZJHA 4Q33A 4IQDA 1PB0A 3D6NA 1OY0A 4YS1A 1ZTVA 1UC5A 1QI3A 3V3WA 4KCWA 2XSBA 3QPYA 3GO2A 1IEWA 2YFNA 3ZJKA 4KEMA 3D0CA 6TIMA 4D6GA 3KVJA 3EXRA 4L1GA 3NPXA 3AS0A 3ERPA 4ECLA 4DZHA 4REQB 3WQ4A 4ZE4A 2C19A 2RJHA 1R3WA 2A0NA 5B7ZA 2VXNA 2ZXAA 1R7AA 2XN2A 5AC8A 2C18A 3AI0A 2ACRA 2P1FA 1QNRA 4DUXA 1WA3A 1E0XA 1VRXA 4IISA 1RCXB 1X6LA 5TNVA 1TIMA 4KWUA 2R91A 4CUCA 5ABTA 1J8VA 1P7TA 5AVHA 3A22A 2FTWA 4UR9A 1ZJBA 4LV9A 4F0RA 1JYXA 4FXFA 4XD5A 4QE1A 1A5OC 3GHUA 3ZM8A 1GW9A 5C55A 1GHRA 1A5KC 1XIGA 1EO7A 1I8JA 3QV7A 4GINA 1QO2A 4H00A 4UQ9A 1BPLB 3V5CA 3MJMA 4CU8A 3T7VA 4LCQA 3SUUA 5G5IA 4LQ1A 4AWSA 1OCNA 1GUVA 1XLFA 2WO5A 3N6HA 2PU1A 3HGJA 5CZTA 3E02A 4I7WA 5KETA 3W26A 3CUXA 4Y9OA 2D2HA 5FKYA 2OGJA 2WSRA 4IFRA 5MKGB 4Z1DA 1JL8A 2GWNA 2EPLX 2ABBA 3LBCA 1MEWA 4MWAC 3RLUA 4JTRA 3VKCA 2W67A 2XSAA 3TFCA 3H2EA 3LBOA 4QFUA 3TXVA 4JN6A 2PRLA 1QNVA 1PEZA 2FGLA 3QGVA 5DMMA 4M6VA 1WDDA 1UZHA 5LHEA 2WMHA 4P7LA 3IUHA 3USZA 3AIQA 4B9YA 4ZQOA 4N9DA 1TTPA 1TWWA 5DFAA 3GUWA 1F3TA 4YVVA 1H1ZA 4X2PA 3THUA 1KBIA 3CL7A 2FH8A 1IGSA 1MQPA 1TQJA 1H0IA 3VD7A 1V02E 2ZTJA 3STFA 5A8MA 4ZQCA 1R3TA 1E40A 4UTWC 3UBPC 2QCLA 1NFPA 1B0IA 1IV8A 1DJXA 1UJQA 3LDVA 4J3WA 4FXSA 3BICA 4CNOA 4A21A 3PUGA 4PRRA 4OV4A 4TV5A 3WLLA 5MKGA 3SCRA 4BEQA 2YFOA 4HHHA 4JTGA 4MLJA 1R30A 3CB3A 4MM1A 3MC5A 2YX0A 3QZEA 1G1YA 1R9XA 5HATA 4UTHA 1YNQA 2DFAA 1JG9A 4JPGA 3N4AA 3I4KA 5A6KA 2XWEA 3LCIA 1O12A 3VDBA 1OZQA 3G3DA 3IJDA 1REQB 4QBXA 2VX5A 3NQ7A 3IGSA 3WLIA 4ML4A 1UQYA 2EG6A 4JAWA 2VM8A 3R8GA 2SFPA 4OUEA 4EVZA 2HNEA 4E38A 1AL8A 1XGZA 2ZCGA 3KCLA 4LY4A 4AF0B 4D6DA 5G4EA 1HXJA 2NUWA 1ISYA 3KE0A 2QCMA 4P7NA 1X1NA 1DL3A 4JBRA 2BP1A 4JTEA 3HU7A 3CAVA 5KZDA 3DZ1A 4IL0A 3HG5A 3ITVA 4H2HA 1ME8A 5BYWA 4L1XA 4W87A 2WKGA 3BV4A 1H0GA 1EJWC 3APYA 3QLLA 1XYCA 2ZUUA 1IEXA 2XJ7A 3WLPA 3THAA 4DJDC 1J79A 3R7MA 3RXZA 1J0KA 4QSFA 4LAKA 4YXGA 4NNAA 1IWPA 2PRHA 3B97A 3OODA 4TIMA 4XZLX 1JVNA 1TZ9A 3IJLA 3EMCA 2CLLA 2F6UA 1O5KA 1UUMA 2WQPA 3H2AA 1V0MA 1E3XA 3FY1A 1UD3A 4JTAA 1TE6A 3R43A 1XH2A 3FFSA 1XIDA 2HS6A 2DQWA 4IMEA 1H2JA 2G3FA 4UTTA 3KUMA 2OODA 1W5PA 3RYSA 3UXIA 2VFIA 4AWEA 1E1CA 1XLCA 2JIWA 1IT0A 3CNYA 1DORA 1VENA 3GNRA 4UFKA 4J3VA 1FX6A 4P7QA 1VLIA 4BHYA 3CO4A 3K30A 4NF7A 4GI8A 1PKLA 3JW7A 1RY0A 3H12A 2DDXA 4O52A 4E4FA 1IZKA 4FO4A 4J28A 4LW7A 3GNOA 3WJXA 4W9TA 1C7TA 3ICJA 4PUKA 2R94A 1CDGA 1JQXA 1PX4A 1DJIA 3INPA 3FAWA 4AD1A 3T81A 1VCVA 1OK4A 1CXLA 4L4MA 4Y6GA 1WUFA 4OBSA 2OOGA 2INZA 1EWEA 2XSXA 5AYZA 4DY1A 1YNYA 4ZSTA 5EB8A 2VWTA 4FIQA 4B5UA 2QUVA 1D8WA 4OBTA 2PF8A 3AWOA 1EGVA 1A47A 4RZ4A 2PLCA 3BMWA 4NAFA 2WSPA 4NNCA 4UFHA 1QFEA 4CU6A 3NL3A 3W1PA 3PTMA 1JNEA 5I7GA 4YL2A 4GPNA 3B0UX 3UWWA 2ZC1A 2G96A 2KZHA 3PJXA 5D9NA 4UCFA 3CYVA 2VEGA 1NEYA 3GS6A 3MW7A 5H8UA 4MNKA 3PC0A 4LV4A 3HG4A 5CZJA 1KNWA 4NZFA 2WJDA 4GD0A 2W62A 3FHAA 2O9PA 1SMAA 2ZICA 3CS2A 3EBVA 2RDTA 2ZVIA 4WDTA 2GPTA 4MY1A 3WDIA 5DMYA 5A6MA 3RAOA 2JK2A 1F6KA 2XG9A 1OC5A 5DELA 4BQ5A 3O06A 1SFLA 4B15A 3OQEA 3G1VA 1ZP3A 2DP3A 4FALA 1R3YA 3QHMA 4YMZA 3PJUA 4LYPA 3T0BA 3LV6A 2G3NA 5M3WA 2YW4A 1CCWB 2B7OA 2X1TA 4GYKA 4RL3A 1SZRA 3C8NA 4JTFA 1U5JA 4XIAA 1HKJA 3BJSA 4UOQA 1KGWA 3WENA 2C7FA 4WEVX 1XBXA 4EXAA 3WH8A 1UR0A 3GDLA 5I3FA 4M24A 4GFSA 2EJAA 3H7UA 2NV9A 5D33A 3WH9A 4Y96A 1EZWA 2DQXA 2J13A 1DJWA 1X8CA 4GY0A 2O9OA 3WX7A 2OSXA 1XRVA 1I6NA 4KKXA 3ZLFA 3BSGA 3DX5A 4JNZA 1VHCA 4K39A 2J27A 3WQFA 3W3OA 2JGYA 1OFDA 3TJLA 4HTYA 3B8VA 3G6MA 4ZA0A 4RNHA 1KGUA 3EWBX 2DUXA 1AW1A 5ABFA 3QRHA 3QQ0A 1PZ3A 1ZSXA 1F07A 4G7EA 1FFQA 4RZ5A 1YIXA 1JUEA 2DZVA 3A3XA 3IJ8A 1B30A 5HNTA 4PR4A 4L9ZA 3LS9A 1XD0A 3WK3A 1ZCOA 2QVNA 5KINA 2TPSA 3TSMA 3P62A 3TC6A 2E7FA 3N2BA 1F3EA 3W6YA 2VZUA 4N7QA 3MHFA 3HTWA 3PBUA 2YDSA 3BAIA 2GGHA 4N4QA 3KDOA 2FKPA 5I00A 4I3GA 3BWWA 5TIMA 3GD6A 4LALA 2JFEX 1XLHA 4WLCA 3W01A 2EPMX 2E68A 1SPQA 2VFGA 3M0YA 4WX2A 1FWBC 1AZ2A 4A2SA 5E70A 3GVGA 3RMJA 5H8MA 3WQ6A 1HJSA 2V3GA 5C6MA 1N55A 2WMJA 1ZY9A 3DECA 1X7FA 2ZIDA 3MANA 4RX0A 2Z2AA 3U5YA 4H41A 1K8XA 2BODX 4NNBA 3WD2A 4PUNA 5BCAA 1IQ8A 4Y9MA 2OWXA 1W3IA 4AFYA 3WNKA 3G8RA 1E9YB 2XWDA 5HINA 3FN9A 8A3HA 4E6MA 2ZRZA 3TYBA 2GSEA 1VFOA 4G56A 3KOZA 1OBAA 2VMFA 2ICSA 4R9XA 4C6QA 3B8UA 6A3HA 3CLMA 3T0TA 1KBBA 1XICA 4HJWA 4AY1A 5EMLA 4MNMA 3EWYA 1DJNA 3DEQA 4I9AA 2ZWZA 1QUMA 3FXYA 2GVLA 1VD6A 4QG8A 4IIHA 3W6LA 2CZDA 4MVAA 4C7GA 2PDJA 1E72M 4Y90A 2ZVRA 4A35A 4S2CA 3VC6A 4C6NA 1EYWA 4NZ4A 1FCBA 1AQMA 3MTWA 4MWAD 2OQHA 2R9RA 4HD5A 1FDYA 4UOJA 4E8DA 3F03K 3TVAA 1DQWA 4AD5A 3P74A 3XINA 5HMSA 1C8XA 3BV7A 1P0BA 2Z1WA 4PGLA 2CWXA 2C0AA 4FOJA 3KXQA 3AIWA 4Q7NA 2WV8A 3ABXA 2DZBA 1YTKA 3SECA 5FEPA 4IG2A 3N11A 4LUTB 1J12A 4TVUA 3EWXA 3AUJA 1OQFA 1IXOA 3WLSA 3BH4A 3DHDA 5C71A 4FP1A 3AU6A 1TV4A 4EKJA 2XU2A 2NVCA 5FA5A 2HEJA 3CHCA 2GQ9A 3UR7A 2AKMA 1TPC1 4CNNA 5CG0A 1OWQA 1ZS2A 4GX9A 1V79A 3HGOA 5AHNA 1XLAA 3GC4A 1E0VA 2I5GA 3WQCA 4O50A 1VJIA 1ELSA 4FA3A 4C7FA 5LKYA 3IRDA 4LCSA 4G7FA 2AQOA 3WQGA 4B4FA 4XZIA 4XVDA 4IIEA 2G4JA 2YBUA 1OEPA 1EB3A 1A53A 3TEVA 2YW3A 4O16A 1GWJA 4DO4A 2YZRA 7REQB 3IK2A 4A8IA 5HK4A 4CCCA 1W1IE 3NOEA 2QUTA 3LSCA 3B9AA 3NJ3A 3MUY1 1M7XA 4TMBA 4Q8PA 3WDJA 4L56A 1OIMA 4P8UA 4HMDA 4DXXA 2E8ZA 1UQZA 3BGAA 1BF6A 1NIUA 4L5ZA 1KKOA 2YGYA 3PK7A 5REQB 3OJGA 1AUSL 2NUXA 1ZRQA 4J3TA 4DNMA 2F6XA 4QQUA 5CPQA 3LLFA 1BTCA 2DJXA 3WMCA 3TIMA 1RD5A 3OLDA 3ZSTA 3CUFA 4Q8UA 1ODUA 3K4DA 2D1ZA 2H8XA 3TTOA 1ITQA 5GJPA 4W88A 3WFZA 2D69A 3SURA 2OFJA 1O95A 3W2KA 4DQWA 3NA8A 4M1BA 1ZFJA 4HMCA 4R34A 5CPSA 1WPCA 2DORA 4AIOA 5HMEA 3MMDA 2DT1A 2NXIA 4XBKA 3ZJ7A 2W9MA 3RUBL 4TX8A 1AK5A 3ZFHA 3QLDA 1I2QA 3NTYA 3E2RA 3RITA 3GB6A 5AYIA 5A6BD 4LT9A 4HSHA 1GORA 3PN8A 4JN8A 1FH9A 1XLLA 3NGFA 2WPBA 3AHVA 3D46A 5D09A 3PTKA 2V0TA 3G1DA 4DAFA 3VIIA 3S1UA 3L5MA 4MB4A 2D2OA 1JPDX 2J62A 3ABRA 1EP1A 2RJGA 3SCOA 1X6UA 1YEYA 2ZX8A 4OJYA 2DZTA 2V5DA 4UTLA 3N13A 3RN6A 4M3PA 4IPLA 5CBBA 1CXEA 2XIMA 4C6OA 1CGVA 5AN7A 5HAOA 2VCCA 3PJTA 2NVAA 4GI4A 3WBXA 3H4XA 1JFHA 3NQ6A 1UWSA 4ZOCA 1VYSX 2ANUA 4NZ5A 1XJBA 3GIQA 3TYZA 5D2TA 3KRSA 5D4YA 4B2DD 3CWNA 2XZ9A 3GDMA 4GUIA 4JR5A 1KFJA 2IXUA 3MI3A 3IANA 3H26A 4CQ8A 3QF0A 1R2SA 3N15A 4OHQA 2R1NA 3EMQA 4GZJA 2F2HA 1DTNA 4FR1A 3W24A 1DJYA 2QEZA 1FH8A 4IOTA 3T55A 1OB0A 4ZOBA 3RF9A 3BOFA 4CU7A 1M03A 4ZODA 3K4AA 5FJRA 1EC8A 1PX3A 3H24A 1TA3B 3T9PA 1Q6RA 2FMNA 1J0JA 2REQA 4ZOAA 4W85A 3BK0A 2VRQA 3EWWA 1LZOA 4D6JA 4BY3A 5G4HC 2Y6ZA 4AMAA 4QXIA 1W1B1 1MW3A 3AS1A 3NDOA 1FBAA 2XVLA 3WCZA 1H50A 4B5NA 3NO3A 3J7HA 4JKLA 1JZ4A 2DEPA 4G8TA 3BLOA 1PCKA 3MBFA 4Q8QA 1UUQA 4BI6A 2QJGA 3BJFA 3RU8X 4AHOA 2DSVA 1QATA 5DMNA 3TW9A 4AY8A 2JEQA 3IV3A 4ACYA 3BZJA 4UNLA 4NYYA 1KRBC 3SRKA 2QCGA 3N34A 3FNDA 2Y7FA 4XSMA 4A2RA 1QXLA 2L5HA 1VFLA 3IJ6A 3SZ8A 4XZNX 4KWVA 3PBGA 2ZA2A 3NL5A 2FMOA 3UETA 4G9PA 4S38A 2BNJA 2GVYA 3EDKA 3W81A 4S3DA 4DI8A 1EHNA 3LB0A 4ZO8A 2P0IA 1V0KA 3W27A 3QV8A 3U6WA 3DBPA 1H7WA 3M43A 1W9UA 5F7UA 3KX6A 2BV9A 4M8UA 3VABA 3UY8A 1JGMA 2TSYA 1FH7A 4ADUA 3CQJA 2BY0A 3CZEA 3AS2A 4H7VA 1Q6DA 1WXZA 3HPFA 2OQYA 4JFSA 1KRMA 3W1AA 1WBHA 4GFIA 2RGMA 1OC6A 4LFYA 1K70A 1RXOB 1TPUA 3AJXA 4PFHA 4QS6A 4IIFA 1S38A 3IACA 5F4WA 4X0NA 2D20A 2AAAA 4EXQA 1DWIM 2XTKA 4XAPA 3M64A 2NXGA 5EMKA 3ARPA 2UZ9A 1EO5A 2YXOA 3U8GA 4OWGA 4IP4A 1UROA 3CQIA 1J9YA 1R47A 3WUBA 1R9ZA 3MYPA 1KR1A 2FZ9A 5BRBA 1Y0EA 1C90A 4Z2LA 3W7CA 4XWUA 4NUWA 1EA9C 1HGYA 1GJPA 4FI4A 1LROA 1UPMB 2WXDM 5DY2A 3UG8A 2V8ZA 3OZPA 4CD8A 4LC8A 1DJGA 3EXSA 4J5NA 3JUGA 1X7IA 1KTCA 3RM8A 3G1SA 3V1PA 1JDCA 1B3XA 1W2VA 3E6EA 4IXHA 2CLEA 3L5AA 2P76A 1H63A 3UR2A 1FCVA 1S1RA 1EIBA 2A4AA 3A24A 1DQXA 2Q02A 2QKFA 3VOGA 1DJHA 2ZZ3A 1PSCA 4HNCA 2PBOA 3FYPA 3RLVA 3ZT6A 3N04A 5LIUX 3QQWA 1ESWA 2PGWA 4XAGA 3GU9A 8CGTA 4OU1A 5KMYA 3WMSA 1V0NA 1B90A 1UKTA 1S46A 2YDRA 2CLHA 1PO9A 3CMFA 2DSUA 3NO1A 4MJMA 1LOSA 3ZWSA 4GYPA 2HV5A 1TWSA 1H5YA 4B5TA 2DH3A 1XWYA 3GG7A 3AICA 2IW0A 4ML9A 2O9RA 3SGZA 2XM2A 1L0PA 2EEXA 2QUNA 1W5NA 3RR1A 5D9OA 4ZCWA 3FKKA 5TAOA 1EP3A 1CXKA 1EPXA 5D2YA 1OM0A 2A3BA 3DH7A 3KVLA 2WMIA 3RNDA 2X1UA 3F2DA 5BXRA 5IDZA 1XR2A 5ECVA 1TR1A 3GZ3A 4C6PA 5BOFA 3BCJA 3QPEA 1E43A 5C9UA 3AU2A 1GJUA 3I65A 3SSZA 1DJQA 2E09A 1M68A 4ZMGA 4Z17A 2VQUA 4OFCA 5BXPA 3ARYA 4WZHA 2RAGA 4LUTA 5K4ZA 2XVGA 1GZGA 3ELFA 1PIGA 2O4QA 2P10A 4GKLA 2NSOA 3UCQA 4HNVA 3VDHA 4HT3A 2O7SA 1C91A 5CSRA 2QGHA 2WHMA 1KLZA 2GVJA 2OMAA 1XH1A 2OLHA 1EX1A 5JMUA 4HA1A 4UNKA 3EKGA 4MAVA 2PWUA 4EAMA 1NP0A 4J3XA 2NV2A 1IE7C 2V5BA 2WVVA 4C5YA 4ZTXA 4P7RA 2BHUA 4UTJA 5HA7A 5I03A 1A0EA 1CECA 3AS3A 1RA5A 1TWIA 2FDMA 4O4WA 4LTSA 3OLEA 4HOXA 1FDJA 4DAIA 1V0LA 2F9RA 2HXTA 3P81A 4IQJA 3NL6A 1J18A 4IIDA 4EWND 2NWRA 3IWPA 4DZIA 4TV6A 1XCWA 4K8EA 1PZ0A 3EKZA 1L6SA 5HQMA 1EBGA 4E4UA 4C7DA 1KM4A 2I14A 3KBVA 1L9WA 1FVPA 4ZB2A 1LG1A 2V5LA 1Z41A 1TCMA 1S2CA 2IS7A 3TROA 5F4XA 3IVUA 2GGIA 2C1GA 1OZMA 4L7ZA 3GG1A 1L2QA 3DC0A 1OT1A 4G2DA 3STGA 5CGQA 4WDWA 5IDIA 4PUJA 5AHEA 2D24A 3G1FA 5LA1A 1DQUA 3W1NA 3KW3A 4BR1A 3TNOA 4DJFD 1JZ7A 3B8DA 4D6CA 1C3FA 3TQVA 4TTGA 3WK2A 1Y5XA 1BRLA 3CV2A 1PAMA 5CH9A 3TYDA 4PTVA 3SBFA 4AWTA 5T9CE 1GKPA 3V0TA 1QPQA 5BU9A 1XIBA 3S6OA 5HJYA 3GHSA 2GOKA 2XZ7A 1JPHA 5M5DA 3R4IA 2HBVA 4FK9A 2OLAA 2VZOA 1SFSA 3UJSA 2F6KA 1LORA 4MGGA 3B8WA 2QDGA 5F2LA 3GFZA 3W22A 4IFOA 2FIQA 3B4UA 3LLDA 1MVYA 1DPMA 5HBFA 1G7UA 3RJYA 3C3NA 4QRNA 1RK6A 1AQFA 3MMTA 1UWIA 3OHIA 2DJLA 4ICMA 1TYGA 3QN3A 3C2OA 3WLMA 3W6MA 5HXMA 1S1PA 1ZPTA 3LXAA 5D32A 1SZGA 1P1MA 1TR9A 4LYQA 4K37A 3A3HA 4LCRA 3VD9A 1W1YA 2BOEX 1BAGA 1GQLA 3UJ2A 2DT3A 3R89A 3TE9A 2UBPC 2EBNA 2F84A 1VS1A 4J1OA 3UZZA 3LPOA 2Y0FA 4AVOA 2QPUA 5IHRA 1KB3A 1V3LA 1KCKA 5KZ6A 4MJ2A 3QR3A 1TRDA 3SIMA 2ODOA 2D73A 4Q32A 3WL1A 4O15A 5FJOA 2WMGA 1L6FA 3U4AA 3WQEA 1IZJA 1KKRA 3V36A 5D04C 5AHIA 2D0GA 3P0WA 3ORWA 3EDJA 4KGJA 1AVAA 4LYRA 3HV8A 2IPWA 4LUJA 3MMUA 1F7BA 3PZ9A 2AKZA 3BW2A 2E28A 2GLKA 5HUPA 4GC3A 3BXWA 3G1RA 4GJIA 3V18A 2EAWA 3PWGA 3WD0A 3W7RA 3MVTA 1VJSA 1EJSC 2GVGA 3URQA 1B2YA 4RV8A 4KWSA 3AIBA 3N9RA 4NILA 1M01A 2OX1A 1QOPA 4LOCA 2E6AA 1EJUC 2VUYA 1XPGA 4E2DA 3R25A 4KEZA 3VIMA 2WMFA 3H21A 4JIQA 4L9XA 1WP6A 3GRIA 1W3LA 3GH7A 3MUAA 3BTNA 3VIJA 6ENLA 2HK0A 3ARUA 2YA0A 4TX9A 3STEA 2HVNA 1FXPA 2FH6A 3D5HA 4FOUA 1LYXA 1RCOB 3ARZA 5BWAA 2PZNA 4XTIA 5ENLA 1FOBA 4PCPA 2V3FA 2VURA 3SY1A 1QW9A 4PMDA 1XUUA 2FGBA 2GDQA 2RH9A 1MXGA 1V93A 2QJMA 2VDIA 2UY3A 3OYXA 3CXOA 3DERA 3M0MA 3W2NA 3BAXA 4D1IA 3BPWA 1CGUA 3ES8A 1GOMA 3NZQA 3LHVA 4MADA 2DY3A 4XSLA 3SCVA 4GJJA 1LM1A 1E15A 3VPLA 2NWSA 1CBGA 1CLVA 1G94A 3C2YA 1HL2A 4OVXA 3LK6A 4O8AA 1NARA 3KS5A 4ZQMA 1OCJA 4S3GA 3FX4A 2XFFA 1QHOA 5AB3A 1BF2A 1J10A 1E70M 4AEEA 1XF0A 3VM5A 2G95A 3PZNA 1XV8A 4NKCA 2HRWA 3FSTA 1ZBVA 4MNLA 3E1F1 5E9AA 2GK1B 3SN0A 5HWJA 5FEZA 3WQ8A 1MYRA 1F4AA 4DJFC 4KESA 3A5FA 5E0FA 3P8IA 3AALA 5D37A 4MZ8A 2R8WA 4H8NA 1DXFA 1EJ7L 1EDGA 2OGYA 1AMKA 3OZMA 1A5BA 1EC9A 3VUSA 2CHOA 1IIGA 4IGMA 2P50A 3CAWA 3CHFA 1LTDA 5DCBA 3JZUA 1FWCC 1H3GA 3PPHA 2QCNA 1RQEA 3L4YA 1F8MA 3ZO9A 1DWAM 4O14A 3UXLA 1GTHA 5F2GA 5J5DA 2GZXA 3WF0A 2OKTA 1DXEA 3E3HA 7TAAA 2FPYA 9RUBA 7ODCA 1ADSA 2ZZ4A 1QOQA 3I68A 1V08A 1LRQA 3F4VA 2V5CA 3EWCA 4B5SA 1TZZA 2J6VA 4PMVA 3L4TA 1TPFA 1OFEA 1V6XA 1H7NA 2PLKA 8TIMA 3FW6A 3IGHX 4QAWA 1K02A 1KCZA 2VNCA 1QHZA 2GGJA 2GDVA 4XKMA 2CYGA 4OV9A 3GW0A 4HCLA 1TJ0A 1WAUA 3M5ZA 1E0TA 3KRBA 2DH2A 4WR3A 2HROA 4RR4A 4QCFA 2VFFA 3U4FA 3ZYZA 1I1WA 3KBSA 3MV11 2ONEA 1Q85A 4FX7A 2YCLB 1XW8A 4ASTA 4Q8WA 6REQB 1GNXA 4WKHA 1HG3A 1NFGA 2ZZ6A 4L65A 3SY8A 3W1QA 2CCRA 2C79A 3H2FA 3T0AA 3ITOA 3F7JA 4RUBA 2FZ8A 3HMJG 4IZGA 3B4YA 3KTSA 1FUYA 1BVWA 3QYSA 1PIFA 2XN1A 1OYBA 3VK5A 2VDGA 1A5SA 3GG8A 4CGTA 1ZAIA 1G01A 1S5NA 2X2YA 4HCDA 4GZIA 3FK4A 2IKHA 2CXEA 1ZALA 4QDPA 1VBHA 3W29A 2EPOA 1RJRA 1FWWA 3M1ZA 2EKCA 2REQB 1JQVA 3BGJA 3HIJA 3Q58A 2WCGA 3XIMA 4JQ4A 2WZMA 4NY2A 3S2NA 4PCNA 3KOXA 3R12A 1GOQA 3LI0A 3A64A 2Y5EA 2OKOA 1XCFA 2VOTA 3AAMA 4RDZA 3LERA 1RVKA 2BXZA 3KS6A 1HQTA 4P8VA 1V6YA 1HUVA 3TKFA 3Q67A 1UIOA 3N2CA 4H9UA 1B3VA 3O6CA 2G97A 3TR9A 1NY1A 1JZ2A 3NZ1A 1RUSA 1SJCA 2J8FA 2QUUA 2VVNA 5E93A 2PDIA 2Z1BA 4RLIA 3PAJA 4J4KA 1W3JA 3GKFA 3L21A 1REQA 4TMCA 4MTVA 3AXXA 4GIEA 4ZL1A 2FTPA 1DHKA 2Z1KA 3EXTA 3HQ1A 3RX3A 3W7IA 1XRFA 4PZVA 1KLYA 4JFWA 1CB7B 4NP7A 4WDXA 3QZAA 1HP5A 3LM3A 4PCFA 1HJXA 4GYFA 2WNNA 4JDYA 3ZT7A 4W7VA 1V6VA 3W2JA 2PPGA 2OSYA 4AVNA 1JPIA 4RNIA 1KM1A 4QCEA 2R6OA 1ZP4A 2PP3A 1S3HA 2J8GA 2PWEA 2V5KA 1X6NA 4HNNA 2QAPA 3TCSA 5ECUA 1C9DA 3EPNA 4O0KA 4GO8A 4KF1A 5KTLA 4LANA 1V7YA 4NRRA 3NQAA 4WUIA 5BMXA 1R9YA 2O4MA 2W66A 2Z00A 1T99A 1UOZA 2PDCA 5BOEA 1M65A 1VH7A 4GG9A 2J79A 3N4EA 4BWLC 1VZWA 1TV8A 3O05A 1QI4A 2VRKA 2ZX7A 3GNNA 4JICA 3M5YA 4Z1YA 5L6UA 2JKEA 1LF1A 3AMLA 3B9EA 8RUCA 4JY8A 3FJLA 3UERA 4BCEA 3NYDA 3EOUA 1PXGA 1XSKA 3IRSA 5I3DA 4GIAA 1WZAA 4Q4PA 2NQZA 2A21A 4IMGA 4I8YA 5CLTA 4CNTA 2I1OA 7ENLA 2OSWA 3WD3A 4GQ0A 1D8CA 3SCSA 2XH4A 1DWGM 2PUZA 2GYIA 1WO2A 3S4TA 1B3ZA 3M0IA 1J5SA 5T9BG 3E74A 2EXOA 4N42A 1QPKA 4LXFA 2DVTA 2ZOXA 4DEFA 4LF1A 3PJWA 4HA4A 2QCEA 1R3RA 4XO7A 2ZA1A 4EX4A 3PPCA 3LPFA 3HURA 4U3CA 3SAZA 4ONVA 2WJEA 3M16A 1P0KA 4TVCA 4HGXA 3UYIA 1V3MA 5EBAA 1G5AA 4A8RA 3ITXA 3CPGA 2JALA 1TUFA 2A3EA 3QW4B 1XQLA 3TA6A 1EA0A 4PH6A 3DKLA 1J2BA 2CHRA 1EKOA 1UCWA 3TLLA 2J25A 2W92A 4LUSA 2CLKA 1YKWA 3ARRA 4HPNA 4EF9A 3CV1A 1FWNA 1GOIA 1R3VA 2AL2B 2R1MA 2C8NA 3T0CA 4DO6A 1V8EA 5DQPA 3STCA 2CZFA 4NASA 5DCDA 3A12A 3W72A 4I6VA 4JHMA 2J7GA 1T6MA 3SCWA 2PP1A 4QDWA 1QT1A 2PDMA 2ISDA 3MUZ1 1HO4A 1LL4A 1E1CB 3IGXA 4XUGA 2OJPA 1FWSA 2VT0A 4PUMA 1OGSA 3PNUA 2QHAA 1YX1A 5HR7A 2WZTA 2ESCA 4IICA 1R6WA 4DJED 2PDQA 4JGDA 4R9OA 1YDNA 4JY9A 3DI1A 5CGTA 4D6IA 4O28A 2ISVA 3PWAA 1EIXA 5A6JA 3MP3A 1GQKA 3WNOA 2RKXA 4FNPA 3L4UA 3W7DA 1FWRA 3EB4A 1LUCA 1HT6A 2INEA 4UZUA 5LIYX 1ADOA 5IFTA 1EPVA 1IWAA 2HVMA 2Z1VA 4AB4A 1U83A 1Q6LA 4O1BA 2YCKX 2VQTA 4H9YA 1TB3A 1Q3NA 4NJIA 5L9FA 1V7AA 1JCTA 3G2GA 2PGFA 5LXEA 4UQEA 4AXKA 4QROA 3GWQA 1GG0A 3W28A 1QMLA 4ZEPA 2DU2A 4DB7A 2VGIA 3V1HA 2PC8A 4FNUA 1QOXA 3R13A 4O11A 5AHLA 2ZFAA 3CV6A 2CITA 1Y5WA 3BLEA 3GYEA 1I0DA 3O1NA 4PE8A 4Q8NA 1FFRA 1CI1A 2OZ0A 2DVXA 1OG0A 1ONRA 2XH2A 4CN6A 5CAHA 1A0CA 4LEFA 1LUCB 1WCGA 2G4FA 6PTDA 1DWHM 3GNDA 2FVKA 3VOFA 4YCPA 1ZCCA 4PMNA 2BHZA 2CWNA 3UESA 4LWWA 4ATWA 3QC0A 4INFA 1Y65A 4Z42C 1R5YA 3WUEA 1ODZA 4LYKA 3SIZA 1Q45A 1VPQA 4PBEA 2VKZG 1IXNA 3KAOA 1K4HA 4GJ1A 2Y8UA 3GBDA 3NQVA 1OCQA 3WNLA 3HFYA 4WQ6A 3SJ3A 1ZUAX 4W93A 3S1GA 2NLYA 5HWMA 5CZSA 1KXVA 3NCOA 3MDWA 1OFAA 1K8ZA 2ALRA 2X0YA 5J8LA 5LZLA 4S2BA 4REQA 4DM2A 3MWAA 4GY7A 4K8GA 1MDLA 5C70A 3VGGA 2QAFA 3AHTA 3VNDA 3VZXA 4Z2GA 3W1MA 1VYPX 1EQCA 1QK2A 3W85A 1O6IA 1XQKA 2ACUA 1BWKA 3NSXA 3PZVA 5LNSA 4LVGA 4N9EA 1SYTA 1UBPC 3OVGA 8XIMA 3TQ0A 3VDCA 3UZWA 3ANVA 4L4PA 4AZ5A 4NAEB 5G1YA 3BL3A 1TMLA 4XD3A 1VFTA 1UBSA 1AJ2A 3SY5A 2IKIA 3QYQA 1A3XA 1KW1A 4PTXA 2BVDA 3SN4A 1PDYA 3E2SA 4S3FA 1MZHA 1ICQA 4AISA 2PDFA 3MKKA 4FLOA 5AYYA 4Q6JA 3MI2A 4MB3A 4WXYA 1GKQA 2A7RA 4GX8A 1Y7VA 4HIBA 3FV9A 2NVDA 2QS8A 3S5YA 3AIRA 4A3YA 5D9PA 4PTDA 4DWSD 3QSRA 3UZYA 3AOFA 5T91A 3I6EA 4H7ZA 5HPOA 4OIFA 3BQ6A 3KZPA 3HG2A 1US3A 1T40A 5TQLA 5DN1A 2Y5JA 3TSDA 1W8SA 4GQBA 2CBJA 1GVOA 1RZMA 4Q8VA 2R14A 3R10A 2QXWA 4KRTA 3HJZA 3G0XA 3I6TA 3FAXA 3RK8A 3GTHA 1VEOA 2RDWA 3QOMA 1N7KA 1O4UA 4UOZA 1E6ZA 1Q8AA 3S6DA 4JEQA 4AZCA 1QASA 4XQ6A 4YTUA 2VCAA 3MQTA 4GH1A 3A5VA 3WDHA 3UF9A 4HZ8A 1KFBA 3I3BA 1XHGA 3WD1A 3GXMA 3VM7A 4E2OA 1E3ZA 2RFGA 2WSYA 1RJPA 1RALA 3ZVHA 3NGJA 1Q13A 4Z2HA 1NF7A 3V4BA 1WKFA 2BY1A 3L4ZA 1W91A 2J24A 1JXKA 1BXCA 3MVIA 5CZ0A 5M1TA 1OFOA 2HVOA 4S3EA 3DYPA 3CAQA 2FQIA 3UEQA 4AZ6A 2DW6A 3ABSA 1BEUA 3CV7A 1ISWA 4UB9A 3UT0A 2X0HA 2QZRA 3S6TA 1XBVA 3HFTA 1GOKA 2GSHA 3L0NA 4H6KA 3AYSA 1THFD 4EPEC 3T8LA 3VMOA 1NQKA 3B06A 3F4CA 4YYFA 1YXYA 2HWGA 2JKPA 1SQ7A 4X60A 4EK7A 3W1UA 3O63A 1A5NC 2FPTA 1JUKA 3ITCA 2Z4GA 1TX0A 2CIPA 4M6UA 2J9ZA 4IL2A 2WB5A 1I9CB 2ZRXA 1RQHA 3EX3A 4GK8A 3P8JA 4Q22A 3AHYA 3DUGA 3MA8A 3QV6A 4OOZA 3SFWA 3REQA 1SR9A 2G0WA 3HJEA 1KWKA 3W02A 3CL8A 4KPLA 1NDZA 3MP4A 4H9VA 3VIFA 3S2LA 3KL3A 4G1KA 1XYBA 1NFBA 3R1ZA 4JTTA 2PDXA 3CEPA 3EX4A 4LBSA 4DO7A 5A8GA 5AECA 4UFLA 4HVXA 4FNRA 3TAKA 3BJTA 3TONA 3QJAA 5HNNA 2UY4A 4FLSA 4DYEA 4X3ZA 3NIYA 2VX6A 1Q7QA 1TQXA 2QULA 4RDVA 1VCFA 4Q7IA 3MCOA 3TNBA 2A3LA 2BWGA 4C6MA 3N3TA 3A4AA 1ADDA 3UVAA 3OPSA 4XKYB 3DFOA 3VOJA 3S5OA 2VC5A 3N25A 1MWOA 2G5WA 3PFRA 1UZDA 3A6OA 4DJEA 3Q4DA 2YIHA 1ONXA 1GVQA 3Q45A 2PE4A 1EBHA 4UZSA 2B81A 3LSBA 3W88A 3HO8A 2XVKA 4KFNA 1HTIA 1DIDA 2BBFA 5BW6A 1AG1O 4U5KA 4AU0A 2YXGA 5CLWA 3KM8A 3TMQA 5FD0A 1R8LA 1H7PA 4WJXA 2J7CA 3AZRA 1MDRA 4PUEA 3LGGA 1DVJA 3NZPA 1EXBA 1HZYA 1XRTA 2WW5A 3W4RA 3WH5A 4HQVA 3MYOA 1W9VA 3N17A 4GVIA 2YB1A 4HZ7A 2YL8A 2WLYA 3JZEA 3B9OA 1BRLB 1MMFA 4FS9A 3C4UA 1DXIA 2BASA 3VXGA 4K6AA 3TTYA 4JIHA 1XP3A 3QHOA 1G6CA 4NJKA 1IYXA 2UV8G 3B0VC 4FX8A 1P43A 4Q4SA 3QFWA 1LBFA 1E6QM 2WSQA 5A69A 1UMYA 3PM6A 5C2CA 5U7SA 1FHDA 2B7PA 2BXYA 3LI1A 1F4HA 2BOGX 4H8UA 1KRCC 5IM51 4O8RA 3VGEA 4O0QA 1EP2A 1Z48A 3BC9A 1OD0A 4EE9A 4QJ5B 1TREA 2HSAA 4IMDA 1X8FA 4ROPA 1HP4A 5A2AA 4L6DA 3O0KA 5FOOA 3QY7A 4C6CA 4K7VA 3ITTA 5D2XA 5JBEA 2IKGA 3SGGA 2C1IA 4C6BA 5A6AA 1PJ9A 4N0RA 3RCYA 1ONWA 1LLZA 2FZDA 1JNDA 1A5UA 4ZQPA 5AZ1A 2D23A 4I5UA 4G5DA 5I6SA 4MPKA 2ZDSA 2WC3A 3H2OA 4HZ6A 1J0IA 3Q65A 2ZUTA 2NUYA 1CEOA 1TV3A 2XM1A 2B7NA 4L64A 5CEWA 4A4AA 4PB3A 4FZIA 2I9EA 4LB3A 1UA7A 4EAYA 2PURA 2A3CA 1HKWA 4PB5A 1UR4A 4UMBA 4TVDA 3SRDA 4PUUA 1F76A 3CK5A 2QLYA 4LSBA 3S0CA 3GE7A 2Y70A 2JQXA 2O55A 3LRLA 4PTWA 1UR3M 1MNZA 4H9TA 5K9DA 3W7GA 1WDRA 3B9NA 4PFMA 3V5FA 1JGIA 4UR8A 2WWDA 4Y7EA 4U33A 4W7UA 5CC5A 1GEQA 2G3MA 3WQPA 3APGA 4JFTA 4NX5A 5I3KA 2YCEA 2WCSA 1E0UA 3ZSSA 2VO5A 3BMXA 1GVRA 4O4VA 4WJEA 4AWUA 1YDVA 2LLEA 1XDLA 5MF5A 3IJ7A 1B1YA 2A1YA 1GKRA 2HNHA 1DOSA 1QK0A 2QCHA 5CPNA 1ITXA 1TUXA 3JS3A 1Q2RA 2VX7A 1U2YA 2WBGA 5G2WA 1MSSA 3KRZA 1B54A 4IX0A 4JHZA 3S9IA 1OIFA 4I9MA 1UR2A 1GVIA 5I2UA 4JYEA 1TPVA 1UC4A 5BOOA 4LAUA 1UD5A 3F4DA 4BS0A 5K2ZA 2BGNE 4H9ZA 1A5CA 4GYJA 4DLMA 3AUOA 1BVZA 2EG7A 3UZJA 1OFQA 3RO6A 1KCLA 1HGWA 3H55A 4J27A 4O13A 3WJSA 3LM7A 5IBXC 3TN4A 3AJ7A 4HTBA 2X40A 4WRHA 5A8PA 3RPTA 1O66A 2WSKA 5I3IA 3B8IA 3U3HA 3MP5A 3UD6A 3O6YX 4R7JA 2J74A 2E25A 3DFYA 4BZYA 2Z1XA 4OZOA 1XIHA 1FY6A 3NO5A 3GAKA 3DGRA 1J93A 3UCDA 2OT1A 4C90A 3CUGA 3LRMA 3CZKA 4PSRA 2W79A 1A4MA 4OOUA 5A2BA 3USBA 4LY8A 2POZA 2TYSA 1JCNA 2CZ5A 4PYSA 1BGGA 4PMYA 3WLHA 4F79A 3MY9A 2BY2A 4KIEA 4UQAA 5I24A 4YWIA 4PMQA 3NQBA 3M5XA 4L4LA 1SGJA 3LMZA 4PMUA 3BSHA 3SUWA 3AXIA 4TR9A 3ONCA 3CYJA 3N2MA 3NQEA 1LRNA 1NWRA 4RDYA 3ALFA 1NDVA 4AYGA 3ITYA 3AC0A 3W84A 1XGDA 4LRSA 1F6PA 4W84A 3TQPA 2QPSA 3WQ5A 2VGBA 1XFBA 1MW2A 3CT7A 4V27A 3S47A 2PP0A 4HB7A 1FHLA 3II1A 2QMKA 3W2MA 3MV01 1GJWA 4LS2A 2Z0IA 2YPIA 3FA4A 4YHEA 1QVBA 1TV7A 2XVNA 1XLIA 4M7TA 3POCA 2J9XA 1E6XM 1IF2A 3S1WA 5JBDA 4RW5A 4KW2A 4Q3MA 1PV8A 2E1DA 4L6OA 3PZQA 2F2KA 3PZTA 4DXVA 4B90A 3MZNA 3N3MA 2YCJA 1VBGA 2A85A 2NW0A 3PBMA 1UZ4A 3VNLA 3UNDA 4N6EA 4L9YA 4PUDA 4IP5A 4IM4A 3THQA 1EUAA 1J01A 1FWAC 4DUVA 3L68A 4M1RA 2MUCA 3TTEA 1Z7AA 1ME9A 1LWHA 4RJEA 2FB2A 4DBWA 1LJYA 1NWTA 3K2GA 1J0HA 1AODA 3W76A 3K1GA 3UG3A 7TIMA 4H7CA 5LGXA 3K8KA 2P8BA 2Y85A 2VVSA 4Q4KA 1KTNA 2I5IA 4AIBA 1XLMA 2CNCA 1FHUA 2HPIA 4CNSA 1OSEA 2GJXB 5DRIA 1M6JA 5FEXA 1F05A 1CGWA 1RBAA 3NOYA 1MI3A 2XH7A 1VB9A 3UXKA 3HZ3A 5DX7A 1Q6CA 2ZRVA 4U10A 4Q8TA 3L12A 4WSKA 5FAGA 3A23A 2VR4A 4AX7A 1P4CA 2ASHA 3MJYA 4TUFA 1U1HA 3CASA 3ZLHA 3BLKA 1H09A 1QPNA 3NL2A 3VX1A 1CNVA 4J3UA 4C5ZA 5CC6A 1PZ1A 3RRXA 5C2XA 1R87A 3DC8A 5M2FX 3L9CA 1D3HA 4R85A 2PDNA 4NG3A 1VCGA 4XZWA 3L65A 4Y8EA 3A9IA 3IIPA 1DV7A 2CESA 4OGZA 4O17A 2HPMA 4PMRA 3TAOA 2B31A 3OVRA 3T07A 3HN3A 4Z0SA 2OTDA 2PDHA 3D3AA 4LF2A 4O19A 5I3GA 1K4GA 4NYUA 4KT2A 4HN8A 3IV8A 4IPNB 3W2UA 3MI6A 1CGYA 4QJ4B 2E0PA 3W87A 3CBWA 1CXHA 3VGFA 3REQB 4U2ZA 4D8AA 1QNQA 4ADTA 2Z2BA 3LMYA 2PZ0A 4ZXOA 4HBKA 3TH6A 6ALDA 2O0TA 4LEQA 2ZDRA 2XPKA 4QEHA 1K9DA 3PPGA 3DU0A 4A3HA 1Q5MA 1QWKA 4CQ9A 4HA3A 3RG6A 4Q6XA 2YLAA 1B3WA 1IEQA 4GQGA 4IIBA 4DPQA 4YHGA 3T78A 1R3SA 4BQ2A 5A2CA 2YLLA 2CXGA 1RY8A 3PZGA 1VP5A 4OKDA 3GVWA 4F8XA 1K9EA 3VNKA 3RPMA 3VFLA 1OX4B 3TWAA 4B5WA 3G3MA 1Q6OA 3W7NA 3GY1A 4ROQA 4MLRA 1JDDA 2VWSA 3WMLA 1J11A 1LBMA 1T0OA 3QV9A 3SCTA 1RBLA 4Q4QA 3CTLA 4N2YA 1WQ5A 1EJRC 1I2RA 2BX7A 3ECQA 1E1FA 3VE9A 2R1PA 3CHDA 3NM3A 4XAYA 4GI9A 1QPRA 4AZIA 4LBRA 1JI2A 3KBMA 1Q6GA 2ON3A 3OIHA 1PKMA 3PY2A 2OEMA 3LHZA 3SCNA 3APTA 4K38A 1OC7A 2OVLA 4GXWA 1HVXA 3R94A 3S46A 3M0XA 1U30A 5A6LA 2WLZA 4N6FA 2VGFA 4WY0A 4HU4A 1RCQA 1D3CA 1OINA 4JQ3A 4US6A 3R0DA 1QI5A 4JFUA 4MIMA 2GQAA 2OXNA 2QQ6A 2OU4A 1JPMA 3WL0A 1GVFA 1L8PA 1XLEA 3ZWTA 4Y2WA 1EDTA 3IAQA 3WKZA 4LVBA 4ZB0A 1TJRA 4HCHA 2IMRA 2E5CA 5HANA 2WANA 1TG7A 4ICNA 3T2OA 1F74A 4JIEA 3DG3A 3TYAA 3RHGA 3UWZA 3WF2A 1E0WA 4BI7A 4F2BA 3LZ3A 2PDGA 2J47A 5AFDA 5LA0A 5EMYA 2P3ZA 3QZ6A 1GGOA 5LNWA 2PTYA 2BXVA 1YXCA 3GXPA 2W27A 2P8CA 3W7KA 1AQ0A 1XDMA 3W70A 1I1XA 4ORMA 2QGYA 3UXAA 1UWAA 2OQLA 1O68A 5E0CA 3WNNA 2DIJA 2BGQA 2BS9A 4XD6A 3VCRA 4QE5A 1JEZA 1PL9A 2VJXA 1Q6EA 1SO3A 4WF7A 2YYTA 5I79A 1F2JA 3H2NA 5EMMA 3K8MA 4S39A 1OT2A 3UJFA 3VILA 1U1UA 1H7XA 3H23A 3GC2A 5K9CA 4J2PA 3KL5A 4CD5A 4CVUA 4RZBA 4NZCA 4DJFA 3PS7A 3S83A 3KTCA 4ZB5A 1TRIA 1YTEA 1C7SA 1KO0A 2JF6A 4D71A 3GXTA 3AIVA 4ATLA 3L0KA 4KBXA 1H4PA 1HFBA 2QIIA 3WBYA 4QJ1A 4EXBA 2E5DA 4ES4A 1W3KA 1HKVA 3FJ4A 2QCFA 2FJKA 4M51A 2VFDA 5A94A 3VD4A 1CWYA 1XG4A 4CQCA 1XYFA 3A47A 5D2VA 4QDMA 4YPJA 2ZX6A 4WSJA 5D8WA 1YLVA 3AHZA 1TPDA 1XH0A 1YTDA 4Z1BA 2GUUA 3GG0A 1MXDA 3QY8A 5DT7A 3W1LA 3DYMA 4HPJA 3VKKA 1LWJA 1RJQA 1RA0A 2IPJA 3RILA 2A5HA 3EWZA 1V3IA 3KLLA 2VR5A 3N12A 3ITGA 4UTFA 1B4EA 4PL1A 3TW7A 1I4NA 3AIEA 2XYLA 4E2BA 5I06A 2WK2A 3DCPA 4KWOA 5HQLA 2ALDA 2Y1HA 4RPPA 3CH9A 3EOOA 3TX9A 4CN1A 3IIOA 1XDJA 2OPJA 4H83A 3MB9A 5G2IA 2E5BA 3FYOA 3C52A 1D9EA 1G4EA 3B8SA 1UR8A 4DNHA 1SM9A 5DXXA 4W7WA 2ZUMA 1KV8A 2YL6A 3HMCA 3NSNA 2ZUWA 2VHLA 1H60A 3NZRA 5HOSA 2PWGA 4QLKA 2QVHA 3UXDA 3KLKA 5CKSA 3R6IA 3WLJA 5AHMA 2B7QA 3RRAA 4LAZA 1R85A 2PSNA 1EJTC 4ZTYA 1RPXA 5AY7A 3GVRA 3M46A 1FWGC 3KVMA 3VCNA 3Q37A 2AGTA 3NM1A 1IWBA 4JFVA 4RV3A 2PS2A 3W37A 3OHMB 3OBEA 4HYRA 1KFKA 3LHTA 4W4QA 2PDWA 3GXNA 1NELA 2OLSA 1S2TA 1E6SM 2R1LA 1U5VA 2ZRUA 3K13A 3M9YA 3VD3A 1K6WA 1HJVA 3O2LA 1UG6A 3PR2A 4G1NA 4H6RA 1F3WA 4PTMA 4QEEA 5CPMA 5JBFA 2VRJA 1B31A 5H91A 4OBRA 4NJGA 3EB3A 4WDUA 1K7EA 1FCQA 4GCXA 1IZCA 3N6QA 1DE6A 3GTNA 3L0GA 4TO8A 4AHQA 3GDTA 3HA1A 3VKBA 2MANA 4AIUA 2GWGA 4I9TA 1NTHA 3EDFA 3VNMA 4NJHA 1ZB5A 4GXMA 2QJNA 3QTPA 4DN1A 1W2PA 3ABOA 2DIEA 3VA8A 3CPRA 2QPXA 4B4HA 3RR4A 2TRSA 4PSPA 4ZSUA 5H2ZA 3SO7A 1WX0A 5EYWA 4UNIA 3NSMA 1TMHA 3TC3A 3WLQA 2VTFA 4LC6A 1US0A 5EKYA 5FJTA 2BLEA 2YR1A 4NVTA 4QAIA 4B3ZA 3IJQA 3A4WA 1L6GA 3SCPA 1QAPA 3L67A 4NL1A 1KM3A 1PS9A 3UR8A 2OCZA 1YQ2A 3ZJ8A 2Y8VA 1IXPA 4GGBA 1GTEA 2AOSA 4C1NB 3KOFA 5F1VA 4JDBA 5BRPA 3WO8A 5EBUA 5DMLA 3PUDA 3W2LA 1O60A 4M7SA 2Z28A 1NU5A 3D3FA 2EKGA 4H04A 4TTUA 1UASA 4UQCA 4PCSA 3FHQA 5A5WA 2YKKA 2R24A 3IIZA 2IKJA 4GIYA 3PAOA 2QCDB 2GVEA 1TTJA 2X1RA 1QTWA 4KCVA 3TOYA 1BXNA 1GYNA 3DG7A 2WWCA 5A8QA 3I3EA 4E8CA 3VI2A 3OLIA 1W9PA 4UMAA 2VENA 1AL7A 1DWJM 1T96A 3WBAA 5LYRA 3ZLGA 1I45A 4AD0A 2WKJA 4XD4A 3JU2A 3WQDA 2DZAA 1H5VA 4XV0A 3EPOA 3EA3A 1E5NA 4H1ZA 2PGRA 3B8TA 3LHWA 1AH3A 3FJNA 4LVDA 3SGUA 1XSJA 2ZZ2A 3URBA 3BUVA 3HPAA 2O92A 1XC6A 2WMKA 3LXBA 2BB0A 3C8FA 4US5A 1VFSA 1N8WA 2Z6IA 2ZZ7A 4C6EA 5M03A 3A3WA 4AY7A 2ZE3A 2PA6A 5I78A 2PTWA 3DHUA 1SO5A 2X8RA 1V4YA 4CNPA 2NT0A 2E9MA 1ZL1A 4HPXA 5K4XA 4A3RA 2XIOA 1VR6A 2YCLA 5CBJA 3R11A 5GNYA 4TQTA 5D38A 3CIXA 1VFUA 3P2VA 3CZ8A 2I7GA 3K1DA 4UTKA 4JNYA 1UIPA 1O1ZA 4ORIA 1Z3NA 3WEZA 4I90A 3A13A 2WM0A 3BZGA 2CC0A 3T4WA 2WCAA 3C61A 3GIYA 3G5EA 2OEKA 2DZPA 3QXBA 1M41A 1LDCA 1RP8A 7CGTA 2Y62A 2Z26A 1ZBCA 4KCUA 3GIPA 1EDQA 3SSJA 1UKPA 1DE5A 3R8HA 2GJNA 4ILSA 4AIEA 3ITLA 4XZ9A 3GTIA 3GU1A 1X1OA 3F1QA 5JQ9A 3H70A 1G69A 5K7JA 3EPMA 5GNXA 2I5QA 3TWBA 3YPIA 1UKSA 1XLGA 4L4OA 2A7NA 1E4MM 1KTBA 3ARTA 3WSUA 1SZNA 5BNKA 4E5TA 3W7EA 3ATYA 4AZBA 1SO6A 1HKIA 3QEZA 4ZQNA 2GGEA 4XIMA 3SUVA 3R0KA 4E3TA 1MUWA 2XIJA 2QF8A 1R2RA 1OHLA 3EWDA 3UWQA 2CERA 4WSHA 3WIJA 2PU0A 3GBEA 4DXKA 4M6QA 3UP8A 2WMIB 3DHPA 3E0IA 3S5ZA 1WKEA 2YJQA 2EF9A 4FHAA 1CLKA 3TC7A 3B03A 2HS8A 3VOHA 3TJXA 3G6LA 2FDSA 4LNCA 2PLMA 4F2TA 2C14A 3LLXA 3P6LA 4Z0JA 3BG9A 2Z2UA 1EL3A 7PTDA 5JIWA 2W3ZA 3L7RA 3WLOA 2R1KA 1SFJA 1V6UA 3PANA 1LLOA 3O3RA 1TSIA 4KERA 1O7AA 1SZFA 3MHGA 4IGHA 1JCXA 4R27A 5C5YA 3Q94A 3TYCA 2F38A 4I5RA 3AISA 2D22A 1VPYA 5FACA 2HMCA 3GC5A 1KGXA 1XKYA 3VNZA 3R58A 1JDFA 5BU6A 1W3HA 1KXTA 5CG7A 3H8AA 4C6DA 1M5WA 3FEMA 3U2ZA 5LSMA 2FZNA 1BYAA 5FESA 2Z7KA 1WOBA 3GNXA 1E51A 2ATMA 4KFPA 3RU6A 4LS0A 1TPEA 5IBXA 3OP2A 5A6BA 5FJUA 3DKJA 1P0NA 3W73A 4JKKA 4MKNA 1HKKA 3SCQA 1JF5A 1WKYA 1I0BA 5DY3A 2IQ0A 4IGSA 2BMBA 4XBJA 1FWDC 4XVEA 3ZZ1A 3M6YA 5KITA 5I07A 2OZ8A 3RJXA 2X09A 2J66A 2ZTKA 2E6FA 2VEIA 5HUOA 4GISA 4S3KA 3T05A 3LCGA 3LTSA 3FA3A 1T8QA 4UTMA 2VC7A 3LCFA 4GQQA 4KS0A 3GUGA 3CJPA 4C91A 3N4FA 3S2CA 3PSWA 5I09A 3G1YA 1ECQA 5GJNA 4AD3A 1UJPA 2E77A 2D3LA 2O7QA 3N1AA 3STPA 3G8EA 1S39A 3HQOA 4B92A 4PA8A 2V81A 2WBKA 4GOAA 3CB8A 3SRHA 2XIQA 2BY3A 5JH1A 2WJFA 2J7HA 3IIVA 4CKQA 1XLDA 4Y9AA 3WF3A 2GJLA 1DIEA 5B7YA 3WFLA 1CENA 2TMDA 3U0HA 5E5CA 2AGKA 4J3SA 3TJ4A 1XCXA 4DZAA 1OF6A 2AQWA 2YYUA 4P8WA 1YDOA 3ZXWA 1V3HA 1FWJC 3MCMA 1B5TA 3VX0A 4DBUA 3ARXA 1JF6A 3LHYA 5I5RA 4WOZA 4OE7A 5CQ1A 2D2JA 2HBXA 2FVMA 2ZRWA 4HA0A 5DRCA 1I60A 4JIIX 4GE8A 3W1TA 1KQYA 4MKVA 1H1YA 3S5SA 1VQTA 4P61A 6TAAA 2VDHA 4I5XA 1NJJA 4GMEA 2RHGA 4K1WA 4CD6A 4BK9A 1WNOA 2P5NA 3GK0A 3AFBA 5C8BB 1K03A 2DSZA 2FHFA 3W7PA 3O6DA 4V1XA 1Z32X 5HMDA 5J5RA 2VYOA 4Q4MA 3TU9A 4JTSA 4WJ8A 1XXXA 3S2JA 2DSWA 1DEDA 3A4XA 3HBLA 3OZYA 4MYXA 1FWEC 4DBSA 2V30A 4RCXA 2E9LA 3B0YA 3L4WA 1LWIA 2ZX9A 4FLRA 3I7RA 4BWLA 4O10A 1G4SA 3C2FA 4MY8A 3VFCA 2WZIA 4P2VA 1PTDA 1YADA 3RFAA 1TWDA 2P0OA 4NHVA 1K9TA 2PCQA 2QMJA 3HG3A 4HPGA 2Z6JA 2ZZ5A 2NXHA 4IUOA 2WZEA 2W63A 2DZUA 3EKLA 1S5MA 2PWFA 4M0XA 5HNUA 4C6FA 3CWHA 3DDMA 2C16A 1X98A 2PMQA 4JIRA 4JTKA 1AW5A 3ARQA 1GHSA 5AC4A 4H3DA 5I3JA 1MRAA 4PB4A 3OGRA 3AZTA 2GQ3A 1R3QA 4D72A 3PTDA 1EJXC 3UJRA 3GTFA 1A50A 4NZ1A 3MUCA 4UFMA 5RUBA 2BSLA 1C9WA 1KBLA 3CMGA 1JFXA 3C2EA 4ERIA 3KHDA 5CJNA 4LH8A 3I6RA 3IEBA 1GOWA 4M19A 4HNOA 2WHLA 3E12A 1OK6A 5FF2A 3VIHA 4DIAA 1F8IA 4XZHA 1W1ZA 1RR2A 4X22A 2H9AB 3SR7A 1YBQA 1UH2A 3CU2A 5TBOA 3KEHA 3K46A 3D47A 1MNSA 3G1HA 4NSBA 3T42A 3BAKA 1MW0A 1WE5A 4FEZA 4IF2A 5A3HA 3P60A 2PGEA 4GACA 3LHUA 1Q66A 4IMAA 2DPEA 2GJXA 3AWNA 4UTUA 1PYMA 1P5BA 3RIKA 4UTIA 4LGXA 1OYAA 3CMJA 5CXPA 4XUYA 1R2TA 4IFKB 1QDSA 3S5NA 5F2MA 3ANYA 5LNVA 1JJKA 1F61A 1XLJA 3EWUA 2Q3RA 4MUZA 3SUTA 4HZMA 3AIUA 1Q63A 3UPBA 1RPKA 4E3VA 1PTAA 1WDWA 2GDUA 1ENUA 3RX4A 4V15A 1TWZA 1JD7A 2JE8A 3B9DA 5E0KA 4MOZA 2GQ8A 2JGQA 3PF3A 4EF8A 1VIWA 2H8ZA 3IIXA 4JCLA 1SJDA 2Q8XA 1KFCA 1UOKA 3O7UA 2A6LA 3AYVA 1P6CA 2JEPA 1MUMA 1EH9A 2XFWA 3GXDA 1G4PA 4C65A 2W61A 1BYBA 1LCOA 3BCFA 4JQ1A 3TUUA 3W25A 1O5XA 2HE8A 2Y7DA 5EY5A 1CW2A 3CZLA 1CX9A 3DFHA 3FLUA 3WNMA 1T41A 1YPFA 5G4WA 3TP4A 1YBQB 4PN2A 3VOIA 2Q01A 3W83A 1WZMA 1TJPA 5FSEC 4ICCX 3LCLA 4AQLA 1LP6A 5JXQA 3W53A 3H4WA 3FDGA 2J77A 3DN5A 4DO5A 1YW1A 3VMNA 3FGCA 4A8LA 1PCWA 3U2EA 3T09A 2QCCA 4B91A 3BSMA 3BG5A 3OB8A 4D8ZA 2FZBA 2J4GA 5G1MA 5D2WA 4F0HA 1SSGA 1W0MA 5DBTA 3CTTA 5HQEA 1FWIC 5BXSA 4IPPA 5CBIA 2ADAA 5F1UA 4B9ZA 4PMZA 3U48A 3VINA 4R33A 7REQA 1W9DM 3VUPA 2VFHA 1BWVA 4KQNA 3ZVHB 5AYBA 3BAJA 2BG5A 3HOJA 2OX4A 5T26A 4DUOA 2YBTA 5A6SA 3MHUA 4L6HA 3RDKA 4YYCA 1POKA 1CPUA 2WVVB 1NM9A 4F66A 4RZ6A 1UHVA 3RM4A 4CCDA 1EF2A 1MFUA 3MDUA 3CUZA 2Y89A 1MXSA 3TZNA 1UWUA 4UMCA 3BOLA 1QRQA 4IQLA 3PZIA 2PI6A 3MKCA 1J4EA 1JAEA 3WEOA 2NV1A 4Q4OA 3BLLA 5D8ZA 1W31A 4O54A 1OX5A 4AAJA 4AG0A 4F40A 1E55A 3DGBA 4LB4A 4QG6A 1TVLA 1AFSA 2CKSA 3CIVA 3WBEA 4AZGA 2NQLA 3THDA 3TQKA 2VZTA 1O94A 4DRSA 4HMEA 3CM4A 3QH2A 4F0KA 4NX0A 3F5JA 2DZSA 3FGCB 2Z27A 3DFTA 5FAJA 3NDZA 4MHBA 4K68A 1XIEA 4U3AA 1D2KA 4GBDA 3K5XA 3PB0A 4US5D 4QLJA 3NVDA 2W5FA 1IEIA 3QOKA 2QF7A 3FIGA 3MS8A 1K77A 1JAKA 4JTHA 3QSTA 3VZZA 4HOWA 1E1EA 2GK1A 4QHRA 2P88A 4CVWA 3LV5A 5EMJA 4J9JA 1OGBA 3A21A 4DZ5A 3VE7A 3BVJA 3KZSA 4H8HA 1EGZA 4F48A 1KCXA 2BVYA 3BURA 4MDPA 4AC7C 3UG4A 4J35A 4EPBC 3CH0A 1PTGA 4B16A 4DWDA 1W17A 3M44A 3VGBA 1LBLA 1WYIA 1XUZA 3W07A 3LCXA 1A5LC 4BQ4A 5EFFA 1MZRA 5DANA 3VZYA 3WDQA 5I02A 3GH4A 5KEZA 5LXXA 1C92A 3KBNA 1MRQA 1HW6A 4H2CA 3OW1A 3H2CA 2HDJA 3LQLA 4HHMA 2W4XA 3CC1A 5FF7A 3VNYA 4S3CA 2QDDA 4B2DA 1GVSA 1FXQA 3RLHA 1WBJA 3BQ5A 2H3BA 3IJIA 2A6NA 3QPZA 3FEQA 2V67A 1NDWA 3LBMA 4WD0A 1H41A 3EB2A 3T08A 1E4IA 1VFFA 5FF3A 4PBGA 2OYKA 2Q09A 1E6NA 4WXZA 2JBMA 3WELA 5HR6A 1AQHA 4CQAA 3S42A 1OFBA 2XHYA 3TYUA 1CGTA 4CD7A 5JU6A 4XKYA 1XGEA 5ABHA 5LGZA 2Y7EA 4HP5A 1T8XA 2WKLA 2HK1A 4JOMA 4TXEA 2A7PA 1PWLA 3WLRA 4YN5A 3BLFA 1FWTA 3ZT5A 3SW6A 4O12A 4YWSA 3GR7A 3L2MA 3TN5A 2G3JA 4WIWA 5ABFB 3OTRA 2HJPA 1A4LA 4JIPA 3M41A 3FKRA 4YJ5A 1QJWA 4K1GA 4MUPA 4XO6A 3G18A 1FTXA 3QKZA 3C0LA 1W1TA 2ZBTA 4L1WA 4JYFA 1BSIA 3DESA 2VUNA 4XK2A 3KRUA 4AEFA 1HL9A 1C8VA 3CUJA 3H7RA 3TV8A 3EDDA 3V16A 3FOKA 1U1JA 2XGBA 3WDRA 4MB5A 3RMEA 3PG9A 3HGRA 4KCTA 4W8AA 2FLIA 5D05A 5F4SA 3NXFA 2ZKMX 3VKDA 4YVXA 2PDBA 2VFEA 4KGLA 5EGRA 4GIRA 1FRBA 1QNOA 2GGGA 1L8NA 3V7PA 3CQKA 4IPJA 4GVGA 1KV5A 1IGWA 3OYZA 3NNTA 1KXHA 3NXLA 4DHGA 2J78A 1TPWA 4LPCA 3MZ2A 5D02A 3L66A 4JTIA 1AJ0A 3G77A 1SZEA 3A9BA 1MEIA 5B80A 2YOCA 1E9ZB 2VL4A 5HWNA 2PC4A 1SFTA 1W6TA 2INFA 1GONA 1W54A 3SQSA 3VDAA 1G9HA 5CSUA 2VZSA 4EANA 1E6RA 2X16A 1YXDA 2GUBA 4UC5A 3B0XA 5GPRA 3OA5A 3TTSA 4BKNA 1XIFA 1M7JA 2IPFA 4YVPA 3WG6A 2E4TA 2XIBA 1EF3A 1MFVA 1JZ6A 2J7FA 4PEKA 3E0VA 3OOQA 1HVQA 1UD2A 4Z1AA 4O1AA 3JRKA 3UJEA 3WEMA 1YPIA 4A6GA 4ZO9A 2BGSA 3UY7A 1Q4WA 1J0ZA 1L6WA 3DENA 1HN1A 3B04A 4X0VA 1JULA 3NQFA 3UPMA 4V2XA 1ONEA 3DHFA 2X2GA 4J7RA 3PUOA 1XYZA 4M80A 1LQ0A 3MU7A 4PEEA 1TKKA 4KH2A 3ZR4A 1JDAA 2V63A 4FXJA 5LHFA 3M0LA 2I16A