1W3TA

Sulfolobus solfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with d-kdgal, d-glyceraldehyde and pyruvate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
293
structure length
293
Chain Sequence
PEIITPIITPFTKDNRIDKEKLKIHAENLIRKGIDKLFVNGTTGLGPSLSPEEKLENLKAVYDVTNKIIFQVGGLNLDDAIRLAKLSKDFDIVGIASYAPYYYPRMSEKHLVKYFKTLCEVSPHPVYLYNYPTATGKDIDAKVAKEIGCFTGVKDTIENIIHTLDYKRLNPNMLVYSGSDMLIATVASTGLDGNVAAGSNYLPEVTVTIKKLAMERKIDEALKLQFLHDEVIEASRIFGSLSSNYVLTKYFQGYDLGYPRPPIFPLDDEEERQLIKKVEGIRAKLVELKILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-KETO-3-DEOXY GLUCONATE ALDOLASE
publication title The structural basis for substrate promiscuity in 2-keto-3-deoxygluconate aldolase from the Entner-Doudoroff pathway in Sulfolobus solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Lyase
total genus 114
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2004-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1w3tA00
4XUGA 4KWWA 3M41A 4Q33A 4LRSA 3LCGA 3O6DA 5LNWA 4UMCA 4JTFA 4LVAA 1W31A 2TRSA 2NXGA 3THQA 1FY6A 1SSGA 2VENA 4RZ4A 3TC6A 2O7SA 1LDCA 4DPPA 1XBZA 3SZ8A 1YDVA 3IIZA 4N6EA 1JCYA 1BTMA 2QUUA 3LXBA 5KMYA 4EIVA 1R46A 1P4CA 5I3GA 3OVRA 4A29A 4PL1A 1LOQA 2CLHA 3T7VA 3QPZA 4LS2A 2YYUA 1G67A 3W7DA 2KZHA 3JRKA 2ZZ7A 2CLMA 1YXDA 2ZZ1A 1B3OA 4BF9A 1WXJA 2J9XA 1IXPA 3GNDA 5SWUA 3NO5A 2NZLA 1L6YA 2ATMA 5AYXA 4FIRA 3LI1A 1MO0A 4O52A 1G4TA 1EP3A 3N14A 2WKJA 3EXTA 1XBVA 3W7QA 1UUOA 2NWRA 1YDNA 5MHBA 1C29A 1ZAIA 2FDSA 2B7QA 1B57A 1L6WA 2FPVA 4GRSA 4TO8A 5I3IA 3IIXA 4JN6A 4PODA 3DKJA 4O10A 1TSIA 2QCHA 2Y88A 5FEXA 3Q94A 5I3FA 4UR8A 2Q3OA 3NQ7A 2X1UA 3P60A 4QISA 3TXVA 4NUWA 1BWKA 3M0ZA 2QDGA 4ZZ9A 3W1XA 2OT0A 1W1ZA 1ME8A 3C61A 3W85A 3BLEA 2QKFA 3UWUA 2NUYA 1W5PA 3RK8A 4N4PA 4RCXA 2X1SA 4FX7A 1LTDA 1XL9A 3UD6A 1YXYA 3LERA 5D37A 2YPIA 3M5XA 3LCIA 4U4MA 1B4EA 3W3OA 4LUIA 2FJKA 5FI8A 3ZWTA 1WBJA 2GVGA 3CT7A 1XBXA 3O63A 3DFNA 3RFAA 1KTNA 3OHIA 2DORA 4HNUA 2C16A 3A5VA 1I2OA 4OV9A 1PV8A 1KFEA 5K4ZA 1R2SA 5EPDA 1SR9A 1XI3A 1W3NA 5I3JA 1SUXA 2P1FA 2YGYA 3MWAA 3F1QA 2ZZ5A 4UTHA 3PB2A 4GXMA 2VEKA 3TCEA 5DCBA 1NFBA 1O5KA 3NL5A 3MI6A 2ZTJA 2RFGA 5D32A 2EF9A 1VYRA 4FX8A 1OX6A 1ZAJA 2Q8LA 3BG3A 4HIBA 5CZ0A 5K2ZA 1OFBA 4E38A 1FXPA 3V75A 3E49A 4OHQA 3HPZA 5LZLA 4FNPA 3S1WA 2HSAA 5DBUA 5LGZA 3A23A 1FCQA 4NNAA 3BW2A 3M16A 4B5NA 3N34A 5IBXA 3GVGA 2C0AA 1JVNA 4UFMA 1RVGA 3R5EA 1ZHAA 3GX9A 5EYWA 3M5VA 1KM5A 1XBYA 2CWNA 3GKFA 1P0KA 3C4UA 2DJLA 5IM51 3W7RA 3LCFA 5HWMA 1VC4A 1KA9F 3GB6A 3QMTA 1YTKA 4KFNA 2JK2A 1OK6A 4K38A 2DZUA 2ABBA 3G1SA 4MZ8A 2Y7GA 3BK0A 4TX9A 5CG7A 4RZ5A 5D04C 3SECA 2EPHA 1FWTA 4MFDA 3MO7A 3STCA 4WXZA 4ZQPA 3B0PA 2V9DA 4LVBA 1DJQA 4UFIA 1VCGA 3SR7A 4GUFA 1VZWA 4AF0A 1R47A 3MBFA 4NU7A 4IMDA 2W6RA 1SQ7A 1UB3A 3QSRA 2A7PA 4RK8A 1E51A 1H1ZA 2Y70A 1I2PA 1W3TA 1F73A 5F2IA 3W84A 3O05A 1H50A 3G1HA 5EBUA 5C2XA 4NJKA 1D9EA 3G0XA 1PIIA 4X3ZA 3STGA 4C1KA 1G4EA 4IX0A 2ISWA 3PY2A 3TDFA 3W22A 1KFJA 1M7OA 4CNOA 5C6MA 2QCNA 3KRUA 4K8HA 4H3DA 5D2XA 4P61A 3G22A 2QAPA 1GPWA 1OX5A 3W7NA 3M5YA 1LLWA 3MMTA 4AAJA 1QAPA 1GOXA 3NPXA 5CZTA 5EMUA 5C5YA 2R91A 3LV5A 3BGJA 4WX2A 3TSBA 3DFQA 1LCOA 1KLYA 1TPUA 2DU2A 4O4VA 3D0CA 4BK9A 1R30A 1RQBA 3W1AA 1TRDA 4O0KA 4TMBA 1JCMP 3SJ3A 1VLWA 1WOAA 3N73A 3NOEA 3G8RA 4A2RA 1SO4A 1OF6A 4NT0A 1D3HA 3VE9A 3NZ1A 4X2RA 1OFOA 2NXHA 2ZDRA 1BEUA 1XUZA 3W2JA 4RKAA 2J27A 2DZTA 4CLMA 3KVLA 1UASA 3L66A 4YXGA 1KFLA 1Q6OA 1AK5A 1C8VA 1WDWA 3L5MA 1SO5A 1X6UA 3O1NA 1GEQA 1OX4A 2I9EA 4RXFA 2QCLA 3RU6A 4WOQA 2EGZA 4WY0A 5AHMA 4K6AA 4QM1A 1GYNA 2Y63A 2FTPA 2J24A 2OJPA 1JR1A 3LCLA 2WQPA 1ALDA 4JYEA 4O8RA 3GDLA 1IGSA 4Y90A 1A5BA 4MOZA 3LTSA 1LRNA 2ZA3A 3HIJA 3PBUA 4JTIA 5D30A 4DO4A 4UCGA 2FPYA 2V81A 3WJXA 3N3MA 1EP1A 3EXSA 4LWWA 3HG2A 3R13A 4XKYA 3QQ1A 2H6RA 4R53A 1T99A 1DVJA 5HULA 3BLIA 3CLMA 3CEUA 4ZQMA 1HO1A 4NX5A 3FLUA 1ZAHA 4K7YA 2DP3A 2C6QA 5FF7A 5C55A 2F7FA 2TMDA 3L2IA 1L6SA 4IX2A 5DELA 5LNRA 4FHAA 3NEVA 3LRLA 3M7WA 3TR2A 5ABTA 1O94A 3W2UA 4LVDA 3PR2A 4JX5A 5LSMA 3ZR4A 2NX3A 1VYPX 4HPXA 1A5CA 5AHEA 4LU0A 2YZRA 1QCWA 3M9YA 4HPJA 3B0VC 1AL7A 1FWNA 1H7NA 3HGRA 4JGDA 3W76A 4NJGA 1M7PA 2R94A 3BGGA 4MVAA 1DV7A 2C13A 2E5DA 4FXRA 3IVSA 1L2UA 4O12A 4KFPA 3A24A 2ZA1A 2JGQA 2ZQ0A 1LZOA 1TPVA 3B03A 4O19A 3ATYA 1Z42A 2WSRA 4WQ6A 2QCDA 3M5ZA 3RNDA 4K7VA 4NZFA 3S8HA 1P0NA 4CCDA 4UTKA 1KBIA 4LTSA 4O13A 3E02A 3NL6A 3G3DA 3UYCA 4BI5A 4Y8FA 1VPXA 5DXYA 4I7UA 1WOBA 5CSRA 3IIOA 4ZQOA 3N9SA 1DQWA 3MYPA 2B4GA 2WNZA 4KWVA 1EWEA 1IXNA 3HG5A 3NQEA 4BWLA 3THAA 3OBKA 4UMBA 1AW2A 3A5FA 3G0UA 1X1OA 3GR7A 3MJYA 4U28A 2TYSA 4IMEA 3RF9A 2CFFA 2Y7FA 4JIPA 4N6FA 1MSSA 2PRLA 1TIMA 1GZGA 3W7IA 2Z0IA 3GDTA 4ADUA 3WFAA 1SZGA 3TX9A 3PSWA 1S5TA 2FB2A 3P84A 3DI1A 3OG3A 4LVFA 1HG3A 3RLVA 2ABAA 3EWXA 3LHZA 4FB7A 4DBDA 1ADOA 2TPSA 2E6FA 4GWEA 4MY1A 3TJXA 3GAKA 4IXXA 4K39A 1KW1A 2GQ9A 2PURA 1XKYA 5FEWA 2P0OA 3VI2A 2W79A 2IQTA 3P8JA 5BW6A 1FCBA 1GG1A 5D38A 4XBSA 2B0MA 5F2LA 5DXXA 3FYOA 1JJKA 3C2RA 1TPB1 4HKPA 1GWJA 4AH7A 3E9AA 3W7HA 3NQ8A 3TSMA 4S2BA 4BFAA 3G1YA 2A6LA 3BV4A 1ICQA 4ADTA 1DKWA 4MFEA 3UZ5A 1GVFA 2CZDA 3KHJA 3R89A 2G97A 1TREA 3I7RA 1SW3A 3O07A 2DZXA 1KTBA 4LS0A 1LBFA 3EEGA 2QJIA 2C14A 1SPQA 3WK2A 4JY8A 1I45A 3NPWA 1RV8A 4MLRA 3LLFA 4NJJA 4OGZA 3HQ1A 4N4QA 4MKNA 3SGZA 2CW6A 3TU9A 1WBHA 3NQFA 3L5AA 4UNKA 1M5WA 5E93A 2E6YA 1O60A 3W7PA 2WOQA 4IPIA 1HL2A 2FIQA 4S1FA 3FKKA 3R8RA 2JBMA 4D2JA 3CIWA 3GIYA 5FF2A 5CZJA 5LGXA 2OT1A 1KM6A 1RR2A 3ABSA 2R8WA 3QMSA 2VFIA 4NNBA 2NX1A 2UV8G 4CQAA 4YCOA 3LRMA 5D02A 3EX4A 3W86A 3QC3A 1F7BA 2V2CA 1OFDA 4Q32A 3HOJA 4UTTA 2X30A 5LHFA 3LRKA 4IXHA 1VYSX 1LP6A 4UTJA 5F2GA 3W1UA 4O28A 3W2MA 3N19B 4O1DA 1C9DA 3O6CA 1TTJA 3I68A 5FEZA 3FIGA 1TPWA 1FDJA 1KBJA 4QJ1A 2BXVA 3W9ZA 5EY5A 1QO2A 1QMLA 3GDMA 2TSYA 3G1FA 2YR1A 3S5OA 1TTQA 1I2QA 3L0KA 5HINA 2Y85A 3W83A 4DQWA 3ZS4A 4H6KA 2VXNA 3GLCA 4ORMA 2QEZA 2P10A 3VNDA 1YXCA 3PUOA 4YMZA 1PHQA 5LNSA 1FDYA 3W75A 4DEFA 2AQWA 3P61A 2QUTA 4EWND 2NV2A 3FA5A 1IIGA 1GYLA 1VH7A 3NQMA 2WSYA 1H61A 4K8EA 5CKSA 4L4MA 3C6CA 2WO5A 1DHPA 5F4WA 5HR7A 3EX2A 1LORA 2XFWA 1VCFA 2YFNA 1KTCA 2OZ0A 4A2SA 1FBAA 1SSDA 4K36A 1Z48A 1X1ZA 2FB3A 1TPH1 1RQHA 5D33A 5DN1A 3W2KA 2ZBTA 3B0UX 3LM7A 2ALDA 1KV8A 1PHWA 4O18A 1KV5A 3LHYA 5E1QA 4MY8A 1YPFA 4TMCA 2DZWA 2RDUA 5A8GA 1VS1A 4ML9A 2A1YA 2YFOA 3SI9A 1QFEA 1F2JA 2V5BA 2Z1BA 1VRDA 4N2YA 3VCRA 2JGYA 4Y6GA 1KM4A 1GG0A 1I8JA 5I3KA 3UXDA 1WV2A 2WPBA 4NJHA 3TFXA 3C2EA 1A5AA 1HTIA 4WXYA 3UWYA 5KSWA 5DCDA 1V7YA 1H60A 4R34A 2RDWA 3NQAA 2YW4A 3BO9A 1IF2A 1SZNA 3TW6A 2E6DA 1QOQA 2NV1A 1IXOA 3C0JA 4AB4A 1G4PA 4N02A 3UWZA 3G1XA 1TTPA 3PULA 1OF8A 1PVNA 2C3ZA 4MYXA 3CIXA 3G8EA 4UFKA 2Y62A 1JRBA 3NM1A 4MZ1A 5KZMA 4WJEA 3C56A 5KZDA 3PB0A 3BPWA 4PL2A 2OCZA 3NPVA 1F6KA 3W6YA 3ZWSA 1GVRA 3BG9A 3PF3A 3I65A 4O17A 5BOOA 5G4WA 3CWNA 2CLFA 1H7RA 1ME9A 2PCQA 1DORA 3SGUA 2FFCA 1KM0A 1G7VA 1OABA 3UXAA 3ABRA 1EUAA 2D73A 3LCHA 4LW7A 1AL8A 4POCA 3EKZA 4P2VA 3QYQA 3NPUA 5I3HA 1XXXA 1OFQA 2QCEA 5F1UA 4TR9A 3SW6A 4IPJA 1PE1A 4QIUA 1H63A 1I2RA 1NAL1 4ZL1A 5D09A 3Q37A 1W3IA 5CGQA 2GUUA 4UIOA 1EA0A 4DF1A 4O16A 3TMQA 1W5MA 2A0NA 4DO6A 4TU1A 3DFSA 1S5VA 3LTPA 1T0OA 4JY9A 3M44A 3PG9A 4LUJA 1EPXA 3S5YA 3NZRA 3GR8A 3NVTA 1TYGA 4IJBA 4PTNA 2X2GA 3NM3A 4RZ6A 1OHLA 1OVDA 2ZRUA 1RQEA 3CM4A 1XDMA 2A6NA 3CQ0A 1YPIA 3DGRA 1QWGA 3TH6A 1PCKA 4JNMA 2C15A 3B04A 4OWGA 3INPA 1ZALA 1W8SA 3W88A 4O1BA 2EHHA 1JQXA 1OG0A 5K9XA 2Y7DA 4A22A 3TQ0A 2VEPA 1SFJA 3NXFA 1LLZA 2ZCGA 4FIQA 4DXVA 4XBKA 3H53A 3HGJA 2BSLA 1CW2A 1TV5A 4N9BA 2WV8A 3MI3A 3FS2A 2YXGA 2HMCA 1Q6RA 1XFBA 3LHUA 3QMRA 4CQ8A 4JTHA 2ZFAA 3BG5A 3EWYA 2PE4A 2A5HA 4UTUA 1TTIA 2Q3RA 3SIZA 1WA3A 3DENA 3RMJA 4ZQNA 1RZMA 2QR6A 5DY2A 5T26A 2GQ8A 3KAOA 4XWUA 1NSJA 3DHDA 5FF4A 2Q8ZA 3IIPA 3LDVA 2I14A 2V8ZA 4RXGA 4UTMA 2A21A 2I1OA 3GK0A 5AHFA 3P5YA 2QF7A 1U83A 2CLOA 2V30A 4QQ3A 1VQTA 2ZZ6A 2C1HA 3P74A 4ZMGA 3SSJA 5AOUA 1SFLA 1EX5A 3PM6A 3FOKA 1XC4A 3IGUA 4JYFA 3NYZA 4LVGA 1A5SA 1QPQA 5HWJA 1NEYA 4RLIA 5LHEA 2EKCA 3N2MA 3PAJA 4Z1DA 3BW4A 3LI0A 1O5XA 4I7WA 1R2TA 3W1TA 4O0ZA 4BI7A 4M6PA 1TPEA 1D3GA 3G18A 5HUPA 1G69A 3C3NA 3GNNA 4WUIA 1ME7A 1XUUA 2VFEA 4KFOA 1S5WA 3LCWA 3U6WA 3FKRA 1ONRA 1TV7A 3C8FA 1F5ZA 3Q2DA 3L65A 3PS7A 3UWWA 2HS6A 1OFAA 3E12A 3IEBA 4O11A 1DQXA 2YSWA 3QW3A 5D05A 3MW7A 4JX6A 4Z08A 1K7XA 5K3VA 4AF0B 4CCCA 4CQ9A 3PBYA 1SW0A 4UTWA 3DH7A 3GXNA 1N8FA 1TQXA 3TIMA 3PSVA 3WK3A 1W54A 1YADA 1TJPA 1TPC1 1DL3A 4JTLA 3TK7A 4WD0A 3W7KA 4DBEA 4O1CA 5CPMA 3G1VA 1OYCA 1AMKA 3B4UA 3NQ2A 1A50A 3H54A 4ORIA 3P82A 1X8FA 2E09A 3P62A 4M6QA 1TO3A 4WOZA 2E5BA 2NXIA 4GE8A 1FCVA 2DZSA 2DJXA 5C54A 1V5XA 4DF2A 5J5DA 3A9IA 1EIXA 1M6JA 5D03A 4EVZA 2YW3A 4LT9A 3DU0A 1GVSA 3LHWA 1VGAA 4FNTA 4IWWA 4JD4A 4UFJA 3TSDA 1JUBA 4GNJA 1WX0A 4UMAA 1K7EA 4M5PA 2X1TA 2QDHA 1O4UA 1QDSA 2E1DA 4NJIA 2QJGA 1JCXA 2BZNA 4HHPA 4AHPA 5H2ZA 3FYPA 3G1DA 3QF0A 1H5YA 4H4IA 2Y89A 3STFA 1OFEA 1W5OA 3MBDA 4MYAA 1XDLA 3DBPA 1AW5A 3ABQA 5FEPA 1GVOA 3WJZA 1UBSA 3BW3A 1Q6LA 5BRBA 4JTUA 2RH9A 2VEIA 2W0UA 5HR6A 4DPQA 4JTEA 1ICSA 4O4WA 1O95A 1K8ZA 1OX4B 3EXRA 3FFSA 1OFPA 2ZYFA 3NG3A 4DELA 5K7JA 2O7QA 4WY0B 2JKPA 5DBTA 3GKAA 4ZVJA 5DLCA 1TCDA 3KXQA 5E0KA 2CLIA 3C52A 4LV4A 1DBTA 1PS9A 4NX0A 4HSNA 4UFHA 1SO6A 1QPNA 3NDOA 2NX9A 1VLIA 2B7PA 1IIHA 2XN0A 4JR5A 3EX6A 4Z1CA 3BLFA 5CPNA 4KKXA 4O50A 4XKYB 4N9CA 3GYEA 3KVJA 4DO5A 5BNKA 3ELFA 1ZCOA 4JTJA 1WAUA 4HNTA 3AO0A 4I9AA 3TV8A 3K30A 3EX1A 2PRMA 1VJIA 3ATZA 5AYYA 1UUMA 2OX1A 4NNCA 4G1KA 4TIMA 3TAOA 2OMAA 4OT7A 2FPTA 1CI1A 3T40A 3LLDA 4FNUA 3KOFA 2ZRWA 3JR2A 3W7CA 1FX6A 3W1RA 5AC8A 1W0MA 3M1ZA 3SY5A 1JCNA 5G2IA 1LROA 1FWWA 1S3HA 4EF9A 3QM3A 1QR7A 4FNQA 4IMFA 4YCPA 1K8XA 2A7RA 5HJLA 1QO5A 1TQJA 4IMCA 4MY9A 3HO8A 5G2WA 5AN7A 3TAKA 2CU0A 1GT8A 3GXPA 3T55A 4XTIA 3LGEA 5GVJA 4GC4A 4PA8A 4JEQA 3P81A 3G0SA 4ALDA 2QCDB 3W07A 5D2TA 4FO4A 3FEMA 2VELA 4PEKA 3DFPA 4CCEA 4UTLA 4WY0F 2CZFA 2QCCA 1RPXA 1YDOA 2V0TA 3CWOX 5AFDA 1MXSA 3TROA 1H7XA 4IGHA 5F4XA 3KVKA 3PWAA 4OV4A 3W7MA 3M6YA 3W7EA 4O54A 1BKSA 2RHGA 3IVUA 3O15A 2CZ5A 3G1AA 4GUIA 4YL2A 4I7VA 4HN4A 3QQ0A 2VFGA 2WJZA 5K9CA 3GZ3A 3S5NA 4HSOA 1HUVA 2V2DA 3CTLA 4GUGA 3ZFHA 3HG3A 3LCXA 3TKFA 3TNOA 4EOUA 4CNNA 1EUNA 2VEMA 5AHLA 1OFRA 1YYAA 4MJZA 3NA8A 3YPIA 3G3MA 2RDTA 3SFKA 2ZZ2A 3PUDA 1KM2A 4NQ1A 5AHNA 2ZTKA 1W56A 2GJLA 3W2NA 3UQNA 2VKZG 4AWUA 5G5IA 1H7OA 4JTGA 1PCWA 4LOCA 3QJAA 3CC1A 4Z1BA 7TIMA 3C2OA 5AB3A 3W1LA 4O15A 1SO3A 1SZFA 3TUUA 4O1AA 3W71A 3F4NA 2R14A 1JCJA 3R12A 4AVFA 3KRSA 3L9CA 1JUKA 4W9TA 1ZNNA 4UTIA 2H3DA 2Y7EA 4A3UA 2X1RA 5BMXA 4K37A 5AC7A 3B8DA 1LOLA 1LM1A 5LNVA 2WSQA 1VHCA 3AJXA 3QFEA 3N9RA 2FLIA 4BI6A 4JDYA 3TJLA 3NQ6A 1KLZA 1EEPA 5L9FA 3E0IA 3B06A 2ZZ3A 3VE7A 4OBTA 3IGXA 3DHFA 3STEA 2VFFA 4QSHA 4XQ6A 4RX0A 3TA6A 2VOMA 1SW7A 3P7YA 4FF7A 3CEPA 3WK1A 5FESA 3UWVA 1ZENA 3UPBA 1KM1A 3L67A 5EA9A 3NL3A 4MIMA 3M47A 3LHVA 1K02A 4Z0SA 3FJ6A 3CHVA 3TC7A 3F03K 3I7SA 3L5LA 5AYZA 3USBA 4AHQA 1EP2A 1F76A 1Y0EA 4FXSA 4UTTC 5HUOA 2HTMA 1I2NA 3ANYA 1TMHA 1NF7A 2BX7A 3NR0A 3HPXA 3W74A 5HMSA 1P1XA 4WZHA 3UY8A 1EWDA 3DFOA 5KINA 4JTKA 3UY7A 1T8XA 2QAFA 2YYTA 1FWRA 3EWBX 2H8ZA 2YCEA 1LBLA 3UZJA 4M7TA 1Q3NA 1IXQA 2ZRYA 2PC4A 3NL2A 4OQVA 3T4CA 3HF3A 3QSTA 3O06A 4JIQA 3O16A 3KVMA 1Z44A 3IV3A 3PC0A 3OIXA 2C18A 1TPDA 2BLEA 3NAVA 3OVPA 4PC8A 2GQAA 4A21A 1GTHA 3BVJA 3S5ZA 1LRQA 1R2RA 2CLLA 4MPQA 1A53A 2ISVA 3DZ1A 1HFBA 1GJPA 3S42A 1F6PA 4LRTA 4RJEA 3NQCA 4AEOA 1AG1O 3S1UA 1RD5A 1BWLA 4FX6M 3IRDA 3O8AA 4ICNA 2NLIA 4JS3A 1QNVA 4AWSA 3T78A 4EF8A 3EWZA 5G1YA 2F84A 1ZJIA 2AGKA 4RV8A 3B05A 1OJXA 2RKXA 1JULA 5TIMA 5AHIA 5BMWA 3W87A 4XTDA 4JXCA 2J88A 1XM3A 3G24A 3MYOA 3U8GA 1B4KA 1J5TA 4LC8A 3TMLA 3IIVA 2ZZ4A 5F1VA 4LNYA 3PBWA 3S9YA 1TB3A 2J9YA 1NVMA 4DF0A 5D2YA 5AC6A 4HT3A 3PVFA 1XCFA 1X7FA 2YDAA 1JRCA 2JKEA 1W5NA 2FQIA 5EL1A 5H91A 2QCMA 4ADSA 4JICA 8TIMA 2GPTA 1P5BA 3HB9A 1FWSA 2PRHA 3HG4A 5HWNA 5LNUA 3H55A 2Z6JA 3EKLA 3L21A 1VCVA 3I7QA 5U4NA 3CPRA 4MZYA 2B7NA 3NQVA 4ZQRA 1U5JA 2EAWA 1AW1A 3NQDA 2HS8A 1OYAA 3L0GA 3QH2A 2H3BA 3MP5A 4LV9A 3MHFA 3S0CA 1THFD 5G1TA 4NZJA 1Q6QA 2E5CA 4MJMA 1TV8A 4Y96A 4S2CA 4YWIA 5IBXC 3MUXA 5KZEA 5L6UA 3LB0A 1HO4A 2G96A 3TE9A 3HGSA 1LRTA 3S1XA 1EB3A 2G95A 3VKJA 3DI0A 1PL9A 5CZSA 5G4EA 1W5QA 4O14A 4JTTA 4IQLA 1KFCA 5CPLA 4LC6A 5FF0A 3GAYA 4N9DA 3W7JA 1N55A 5CPOA 3TQVA 1W37A 2ISSA 1JQVA 3W1PA 3P8IA 1KM3A 1H1YA 3MI2A 4E2DA 1H7PA 4PCFA 5TBOA 4NXKA 3L0NA 2LLEA 3UWQA 1SU5A 3A21A 3F4WA 3W7OA 5CSSA 3IVTA 1G6CA 3OVQA 1K8YA 1K3UA 1FXQA 5F4SA 3CU2A 2A4AA 4UXDA 4UC5A 3LOTA 2A2IA 1K7FA 2Z6IA 1TRIA 3HMJG 3C2VA 1JUEA 4RR4A 5TQLA 5K4XA 3R2GA 3PG8A 3TW7A 1VHNA 1ZY9A 4IOTA 4IUOA 5DCEA 4ZQCA 4JTSA 4UUIA 1F74A 4PH6A 1FQ0A 1OYBA 1LBMA 3M43A 4X9SA 2CLKA 1KFKA 3DAQA 6TIMA 5KITA 2G5WA 1QOPA 5U7SA 1G7UA 1VR6A 3A22A 3OA3A 3QZEA 3W72A 1ICPA 3EX3A 4HNNA 1T96A 4AMAA 3W70A 2BTMA 5DY3A 3UNDA 1MEIA 3VFLA 4OU1A 4R7JA 3HBLA 5LKYA 2QUVA 1MZHA 4AXKA 3NGJA 1H62A 1JCLA 3QPYA 1H7WA 4CNPA 2WNNA 4C1LA 3MHUA 3MP3A 3KX6A 5J5RA 3T44A 2NWSA 2V2HA 3DFTA 3TQKA 2CLEA 3QEZA 5D2VA 2H90A 3U2OA 2ATSA 1TJRA 4AWTA 5K9DA 3ABOA 3IGSA 3KRZA 4E2BA 4HNVA 3DXIA 2X16A 3LBMA 3HJZA 3OEXA 3L68A 2XN2A 3V1PA 1DOSA 5G2HA 4MUZA 3LHTA 5D2WA 4Z1AA 4IMGA 4JYDA 2VFHA 4L4LA 4UR7A 3TXZA 1GTEA 3O6YX 2GVLA 2VC6A 1Z41A 2A85A 4AHOA 3GDRA 4GBUA 1TPFA 4FNRA 2GOUA 3W1QA 3MHGA 2GVJA 4Y9AA 1LOSA 4E0CA 4OE7A 6ALDA 3LX9A 2A7NA 1J2WA 1DJNA 3W2LA 3LXCA 1FCUA 4JDBA 2V82A 4GUHA 1LYXA 3EWWA 3MP4A 2NUWA 2ZRZA 5HQEA 1F05A 3C2FA 3QW4B 4O57A 2E68A 3W73A 1ZFJA 4M6VA 4X22A 1ML1A 3P80A 3HPSA 2ZRVA 3I6RA 2QCGA 2VFDA 3EB2A 5KTLA 3QRHA 3W1NA 4ONVA 3WK0A 1UCWA 2XN1A 1CX9A 1Q45A 4JX4A 1GQNA 4QNEA 4N9EA 3RLUA 1H51A 1QPOA 2CZEA 4M19A 5EKYA 4UTWC 4O53A 3LV6A 3PBVA 2E77A 4XZ9A 3P5ZA 1K03A 2GJNA 3CB8A 5HNRA 2YX0A 1J4EA 4UFLA 3EWUA 2ZA2A 2Y61A 1FUYA 1I4NA 1MEHA 4QNWA 3NQGA 1GVQA 1YTEA 4GJ1A 5A5WA 1WYIA 3WJSA 3W7GA 1OK4A 2QJHA 4NXSA 2V5LA 4Q4KA 3W7LA 4QITA 3S6DA 3WJWA 4MLJA 2E6AA 2H8XA 3GXTA 3LBCA 3P67A 2AAMA 2QCFA 3NNTA 4QAIA 3PUEA 3Q58A 4FEZA 4J9JA 2B7OA 3UPWA 1N7KA 2NUXA 4GUJA 5FF3A 3HGOA 2J9ZA 1YLVA 4UNLA 3W1MA 2J6XA 4FNSA 2C19A 5F2MA 1G4SA 3LXAA 1YTDA 3BARA 4BWLC 2Y6ZA 4GFSA 2BWGA 3TFCA 3GDKA 1QPRA 1B9BA 4M7SA 4LS1A 1L9WA 3S1VA 1WQ5A 4BR1A 4PFMA 2Z2UA 1FDZA 4NVTA 3E96A 1SZEA 4R33A 4YLWA 2DZPA 3N2XA 1NF0A 3WJYA 2ZRXA 2JKAA 4Z0JA 1MEWA 3KFTA 3LTYA 3W23A 4LY8A 1UJPA 1KFBA 3FJLA 3JS3A 2DZVA 3DKLA 2WNQA
chains in the Genus database with same CATH superfamily
2AOSA 1MW2A 4AZHA 4P7OA 3VM7A 4HA3A 2X09A 1I75A 2NXGA 1X8CA 1SSGA 3SIMA 5EU9A 1V02A 3AXXA 4HK5A 3DUGA 5CSUA 3LXBA 1S39A 4EIVA 1R46A 1P4CA 5I3GA 3OVRA 3W7DA 3JRKA 2ZZ7A 1IT0A 4GGBA 3WLSA 3C3UA 1B3OA 3F4VA 3GVWA 2F9RA 3TYZA 2NZLA 1YEYA 1L6YA 3GDBA 4F0LA 1G4TA 3M0KA 2NWRA 1MUMA 4N42A 2B7QA 1IEVA 4TO8A 5I3IA 2DVXA 1TWZA 3IIXA 4JN6A 2WKGA 3NZQA 5I7GA 4O10A 1TSIA 2QCHA 2Y88A 4ERGA 3Q94A 4UR8A 2Q3OA 4C6EA 3TXVA 4NAEA 3SURA 2QDGA 4ZZ9A 1BGGA 4KEMA 3N6JA 1OCBA 3C61A 1QUMA 3EB3A 2NUYA 4JKMA 1W5PA 1UH2A 3VZZA 2H9AA 1ZUAX 3WUEA 2DIEA 4WJ8A 3W3OA 4LUIA 1WBJA 4R9OA 4CU6A 1Q6EA 1CXFA 2AL2A 3WDQA 1FWJC 4GIYA 2VC7A 5J8LA 3OHIA 4HNUA 2YDSA 2C16A 1Q8JA 3KL0A 3ZOAA 2YCJA 5CJNA 3DGBA 1GJUA 1XI3A 3TN6A 2INFA 1QHZA 4AX6A 3CHEA 1O5KA 3MI6A 2RFGA 1VYRA 4F2TA 1PKLA 1ZAJA 3V75A 4PUEA 3LZ5A 1OWQA 1ZBVA 4I8DA 3S1WA 4UQDA 3GNOA 3UERA 2R1LA 2C7FA 3EMQA 2CERA 2ZC8A 1GVYA 1FCQA 3A23A 3ITLA 3BW2A 2ZIDA 3M16A 4XZIA 3T81A 3GVGA 1C93A 2X0HA 1RVGA 1C7SA 2ALRA 1ZHAA 5EYWA 1TWDA 3NGFA 1XBYA 3RDKA 2WJDA 2I5IA 3GKFA 5IM51 3UVIA 3W7RA 3NCOA 1YBQA 2CLPA 2VUNA 1LQAA 1KA9F 3T4WA 3QMTA 2XUCA 2JK2A 4GI8A 4J28A 2WM1A 1VBHA 1EJRC 1M3UA 1VF8A 1OC6A 3ALFA 2CESA 2Y7GA 3AIBA 4UTFA 1VAHA 1IT8A 3S3GA 2EPHA 4PUJA 3H23A 3UF9A 1DWHM 4X63A 1EFZA 4LVBA 1DJQA 3TN3A 1NDZA 3AROA 1L6GA 1VZWA 3MBFA 5A8PA 4IMDA 2HISA 3QSRA 4MAVA 4RK8A 1H1ZA 1I2PA 1DIKA 4AD2A 3GH4A 2HK0A 3RR4A 4C1KA 3VGFA 4FF5A 4IX0A 3W22A 1H4PA 5E5CA 4B5UA 3GC5A 3BC9A 3AMKA 3KRUA 5I77A 4K8HA 5D2XA 4P61A 5BOEA 2QAPA 3RG6A 5ABFB 3W7NA 3M5YA 5A8MA 3QR1A 1LUCA 1CLKA 4DBSA 2W9MA 1QAPA 3LNPA 2PDXA 1EHAA 3EA1A 2PDWA 3OGVA 2PWUA 4AW7A 3BGJA 3DFQA 2WZHA 5GJMA 3VIJA 1TPUA 1YHTA 3D0CA 4BK9A 2HROA 1RQBA 3W1AA 1TRDA 4TMBA 3N73A 4FALA 4IH3A 1XX1A 2J66A 1RSCA 3PP7A 1JPDX 1OF6A 4J5NA 4PMUA 1UR3M 3VE9A 3NZ1A 4HNLA 3WNKA 1BEUA 1JDDA 3W2JA 2IPJA 2VGBA 5HPCA 4Z2KA 3G77A 4IIHA 2DZTA 1UASA 1QJWA 1Q6OA 1C8VA 1EO7A 4JTRA 1KQZA 3NOYA 3RU6A 5FOOA 6REQB 1PKYA 2J24A 2OJPA 4V33A 2D0HA 1ALDA 3H2NA 3PZUA 4JTAA 1QNOA 3BJSA 4PUDA 4V15A 5D30A 3K4DA 3KBNA 3AZRA 4UCGA 2V81A 3WJXA 3N3MA 4LWWA 3EXSA 4XKYA 1JD7A 2O0TA 3UCQA 3VDCA 2H6RA 3E0WA 2OYKA 5BWFA 2PLCA 4M8UA 3BLIA 3CLMA 2RJHA 1LL7A 1RJPA 5CEWA 5DANA 3CMGA 1REQB 2JEPA 4US6A 2PBGA 2IMRA 4DJEA 2VZOA 4O1FA 1FHLA 1MQQA 3PR2A 4FLSA 1FKWA 3T1GA 3EDDA 1A5CA 3RM4A 4XZMX 5C7HA 1AL7A 1FWNA 2VM8A 3L4UA 3W76A 3HTWA 1XWYA 1ZBKA 1FWIC 1G1YA 2C13A 1S2VA 2V69A 3QLDA 3SRFA 3A24A 3POCA 2ZA1A 1Z42A 4GX9A 3AHTA 1UUQA 3RNDA 1UHVA 2PDJA 4NZFA 1P0NA 4YPJA 4UTKA 1KBIA 4LTSA 3NL6A 1DE6A 1TWWA 3M0MA 4KEVA 1Z8AA 4GBDA 2EBNA 1F07A 4WK9A 3IIOA 3BOFA 1XS2A 2WKLA 4KWVA 1CBGA 1E6PA 1IXNA 4GGHA 4UQCA 4QFUA 4GINA 3TN4A 2OZ8A 4YU1A 1AW2A 3RAOA 1OT1A 3KUMA 3MJYA 2TYSA 3IJ7A 4DRSA 5M5DA 4HA4A 2Y7FA 1GZGA 3GU2A 4OUIA 4TVDA 4REQB 1PWMA 3JU2A 5KEZA 3DI1A 4H9ZA 1KXTA 1M04A 3EWXA 1E4MM 2TPSA 4N7QA 4DLFA 4IXXA 4K39A 2PURA 1XKYA 2DSVA 2P0OA 3R7MA 1W3HA 2P50A 2IQTA 3P8JA 1FCBA 1T7LA 4IPNB 1KCLA 3NIYA 5F2LA 3QOMA 4RZBA 1JJKA 3TWAA 6PTDA 2P8CA 3E9AA 3RO6A 3W7HA 3TSMA 3IV8A 1UR9A 1VKFA 2Y24A 3G6LA 2A6LA 3BV4A 3RCYA 4ADTA 1GVFA 3R89A 3VIFA 3L4TA 2G97A 4GI4A 1GW9A 3CWHA 2J7GA 4V2XA 4QJ4B 1E3XA 1FH9A 3OO2A 4JQ2A 4MF4A 5HMEA 1VD6A 4JY8A 1V0MA 1WAWA 3T0AA 1B0IA 3WENA 4FXFA 1XIEA 3Q65A 2PDCA 3HQ1A 4N4QA 1F61A 2CW6A 3NQFA 3L5AA 5A6KA 1M5WA 1US3A 1LWHA 5E93A 4ASTA 3DC8A 2E6YA 3W7PA 3VPLA 1U2YA 3QN3A 3S47A 2FGZA 5LGXA 1XRVA 3EOLA 3SUUA 3UA3A 1RR2A 4FR6A 1GKRA 1FHDA 2R8WA 1UWQA 2J75A 2UV8G 3LRMA 3ES7A 2DDXA 4Q32A 2HXUA 3HOJA 5LHFA 2X30A 4IXHA 2V6AA 3W2MA 1E1EA 1OG6A 3EWCA 5FEZA 1GK8A 1H49A 1EO5A 1QO2A 3BLLA 1TTQA 1I2QA 1MQRA 2Y85A 2PCEA 3FSUA 3QZAA 3CZJA 4AISA 1ZP3A 4PRRA 2AQVA 2PDUA 4ORMA 4XD4A 1UPPA 3EDEA 1V0LA 2P10A 1YXCA 1O5RA 1GZJA 1BXNA 4YMZA 1FDYA 2AQWA 3I4KA 4WIWA 4EWND 2CWXA 5A2CA 2PLMA 1GYLA 2QV4A 1VH7A 3SUVA 3LGDA 4EX4A 1TR1A 1H61A 4RUBA 3M0HA 3EX2A 2XFWA 1VCFA 2OZ0A 3VNJA 3KHDA 5I79A 1SSDA 1S5MA 2FB3A 1X1ZA 1TPH1 1QU4A 3B0UX 3SM0A 3BQ6A 2YL5A 1HP4A 3LM7A 2ALDA 1KV8A 1PHWA 1X7IA 3ZSSA 5LIXX 4MY8A 2FYMA 2ANUA 4GIAA 3L4ZA 1OC7A 2A1YA 3VKCA 3SCVA 3SI9A 3L2LA 2VD9A 1QFEA 4N2YA 5C9WA 4Y6GA 1Z3NA 1KM4A 4RPPA 2V5KA 2CYGA 3TFXA 4GABA 5KSWA 3H2MA 5DCDA 4J2PA 3BUVA 4F9DA 2E6DA 3C0JA 1IXOA 3AWNA 4N02A 3BCDA 2E4TA 3REQB 1L2QA 1MNSA 4DAIA 3G1XA 3PULA 1JDFA 1CGXA 1PVNA 4IGSA 1NY1A 3QBUA 3CIXA 4MYXA 3G8EA 3WF1A 1JPHA 1JRBA 2WANA 5KZMA 3OGSA 3BPWA 2OCZA 3VU2A 3A64A 3FCPA 1BXBA 3U2ZA 2R24A 4IMAA 3LEPA 3UJSA 4O17A 1JPIA 4KQNA 3A6OA 5BOOA 4WKFA 5HANA 4ZXLA 3PAOA 3S6OA 3STPA 5JBFA 1W9BM 4POCA 1K9DA 4LYRA 1VENA 1ZJBA 4C6DA 1XXXA 2QCEA 4C6KA 4HNCA 4QIUA 5C2GA 1W1PA 3GY1A 3VX1A 4ZL1A 5D09A 3CS2A 2DIKA 1XSKA 3ID7A 2HPIA 2Y5JA 3DDMA 4GISA 4U33A 3LTPA 5FSDC 1E9ZB 4JN8A 4JY9A 3SADA 1WCGA 4KESA 4LUJA 3WIJA 3NVTA 2HVOA 4I90A 4ZO8A 4AD0A 3OGRA 1OHLA 3ES8A 3C8NA 1XDMA 4ROQA 3I4EA 3L12A 3TVAA 1YPIA 3DGRA 3TH6A 2CCRA 4KCTA 3A4AA 2XGBA 2OQLA 4OWGA 3INPA 2XZ7A 1A5KC 1ZALA 3LPFA 1W8SA 2VWSA 5CH9A 4BEUA 2PGFA 1GOIA 1K6AA 1HKJA 1KRBC 3WD2A 2NW0A 2Y7DA 4B5SA 3WL0A 1DWJM 4DM1A 2VEPA 1F8MA 2OSYA 5FA5A 1PSCA 2RJGA 4FIQA 3RJXA 3HGJA 3M46A 1SMAA 3P14A 2WV8A 3MI3A 3FS2A 2YXGA 2HMCA 3LHUA 1XFBA 4AY1A 4YYFA 1R9XA 4EAYA 1RA0A 2A5HA 2Q3RA 3SIZA 1EDGA 2CHOA 3UZYA 2QR6A 5T26A 4L5ZA 2QZRA 1Q2SA 4C65A 3KOYA 1NSJA 1A80A 3SQSA 4EAMA 5FF4A 3LDVA 1P48A 2WAGA 2YA2A 2Z24A 3APYA 1IR2A 3L2MA 3PBGA 3GHUA 3V5CA 1E6NA 4L6HA 1XD1A 3MSRA 4LCSA 2C1HA 3POHA 3T0BA 4ZMGA 1O7AA 2GFTA 3BE7A 4IL2A 5TNVA 1SFLA 4RW3A 1EX5A 3FOKA 4JYFA 3NYZA 1LWIA 1SFSA 2IQDA 1TMLA 3WKZA 3CV7A 3VNKA 1F3XA 5HWJA 1PTDA 1U1UA 3PFMA 3U7BA 1JAKA 4LNCA 2YL8A 4Q8UA 3PAJA 4DO7A 4Z1DA 3MV11 3GUWA 3LI0A 4I7WA 3IS4A 4MWAA 3UETA 1D3GA 3T07A 1KGUA 3MO4A 1S3TC 1LT7A 4WUIA 4H01A 4REQA 4KFOA 1RY0A 2UWFA 3LCWA 3U6WA 3DFHA 1GNXA 4NZ4A 3ZT7A 1F5ZA 1KB3A 3PS7A 4H7VA 1VFTA 2JIEA 3M07A 2REQB 1J18A 4LEQA 3MW7A 2XIBA 3SAZA 4AF0B 4H2CA 3BLDA 4UTWA 3DH7A 3WK3A 1N8FA 1TQXA 4U31A 1XLEA 3GIQA 3M64A 2BMBA 3TK7A 3WFZA 1ONXA 2QUMA 1XYMA 5A8QA 3MY9A 4US5A 3BLPX 4ORIA 3F7JA 2E09A 3W02A 3N29A 1TO3A 1QNQA 4WOZA 1AA1B 4GE8A 1HP5A 3R10A 3TR9A 3FJNA 4KWOA 3A9IA 1M6JA 4NYYA 5D03A 1VGAA 2FTWA 4IWWA 1JGMA 1JYVA 4JHZA 4M5PA 2QDHA 3SO7A 4NJIA 4UR9A 5E70A 5I07A 3GG8A 2PTZA 3N4AA 1ZLPA 1M7XA 3U57A 4HHPA 3RLGA 4GYPA 4WKHA 1H5YA 4Q3MA 3E0FA 2Y89A 2ZWZA 3STFA 1EL3A 4Z2GA 4LBUA 7REQA 2ZUWA 3UESA 4BQ2A 3BW3A 5EGRA 3GQYA 2CKSA 1Q6LA 1XLFA 4JTUA 1TUFA 4ZE5A 2W0UA 1ICSA 4B2DD 4DHGA 2EQDA 3IUIA 4J3TA 4DELA 2O7QA 3OHMB 4WY0B 5DBTA 3CT2A 1NOWA 5A1AA 5E0KA 2CLIA 3C52A 4RE2A 4EPEC 5BRPA 4NX0A 3DG6A 2CKRA 4UFHA 1SO6A 4B3KA 1QPNA 3NDOA 2NX9A 3AYVA 3BAYA 2B7PA 1IIHA 1EF3A 3TYDA 3BLFA 1UR0A 4J4KA 4N9CA 4GQ0A 4CD6A 5A6LA 1NQKA 3FNDA 4JTJA 4PCSA 3U5YA 1RJRA 1M7JA 4C6QA 2O56A 4I9AA 1UPMB 1VJIA 3KBJA 2FZDA 4G1KA 4TIMA 3RITA 4NY2A 4OT7A 1CI1A 2QULA 3WQGA 1BXCA 4FNUA 2HQAA 1F4AA 3APGA 2XVPA 4U3AA 3F4DA 1ENUA 5LIWX 3THUA 1VFSA 1JCNA 5G2IA 1LROA 1JAEA 2PUZA 4FNQA 4IMFA 2QXWA 4IMCA 3DC0A 3HO8A 3WBXA 4DXKA 1M53A 1V93A 1EC8A 1GT8A 3AS3A 3A3HA 3T55A 2VDIA 4XTIA 3LGEA 1O12A 3IACA 4CGTA 1BYDA 3B9DA 1EC9A 4PA8A 1H0IA 4GYFA 4ZR8A 4JEQA 1R5YA 4MDPA 3P81A 4ZO9A 2QCDB 1R7AA 3REQA 2P5NA 4Q8PA 3ARWA 3FEMA 3DFPA 1NELA 4CCEA 3ZT5A 4UTLA 3TTYA 3UA4A 3CWOX 3H12A 1J9YA 3FVDA 3TROA 1H7XA 4HA1A 4IGHA 3CUXA 5F4XA 2UY5A 3PWAA 3RPDA 4M6UA 2V68A 3BSGA 3GTFA 3W7EA 4O54A 3S5SA 2WSPA 1XRTA 1BKSA 2RHGA 3O15A 4GUIA 3IJDA 2VFGA 2HJPA 5K9CA 3CTLA 4S3BA 3BZGA 3HG3A 2W61A 3TKFA 4EOUA 1U33A 3VIPA 5REQB 1OFRA 4W85A 3QTPA 4P5UA 1BYBA 3WDRA 1NFPA 3SFKA 4C6CA 1HJQA 4HTBA 1ADSA 1V51A 4YVVA 3GXMA 2I17A 2GQ3A 4AWUA 3WZ0E 3S9IA 2A3HA 1QRQA 3CC1A 1NU5A 1JI2A 3W1LA 3BJFA 4LAOA 4TVCA 4O1AA 1XYLA 3UU0A 3CNYA 3GNRA 4HCLA 1DYSA 3L9CA 1XIJA 3BLKA 4W9TA 1MWOA 5EMMA 1ZNNA 4AD4A 3N15A 3EB4A 4H1ZA 5C70A 5AC7A 3B8DA 5CGMA 2EJ1A 1GOMA 1YMYA 1DEDA 3AJXA 5L9FA 1KLZA 1E4IA 1OIMA 3RN6A 3VE7A 3HV8A 3STEA 2VFFA 2Y8VA 4G7EA 4QSHA 1EA9C 4IF2A 1SW7A 1IZJA 2W5FA 3LS9A 5BZAA 3CEPA 4GO8A 4L6OA 3UPBA 1KM1A 5EA9A 3NL3A 4MIMA 2A3EA 1PPIA 3B8WA 1IEWA 2ZXAA 2CBJA 3FJ6A 3CHVA 1J0IA 2CXGA 1EP2A 2HTMA 1AQHA 3CZEA 3ARUA 2VR4A 2WMKA 3HPXA 3QVQA 4ENLA 4WZHA 1WE5A 1Q7QA 1EWDA 2XU2A 2ONEA 5KINA 2OLHA 5D9OA 2XJ7A 4JTKA 4FI4A 5EFDA 4ECLA 3EWBX 1FWRA 4M7TA 4C1NB 1EDTA 2VQUA 4QDMA 3HF3A 3O06A 1CWYA 4KMQA 1QNSA 3NFUA 3KVMA 3QZ6A 4XK2A 4GJIA 1BHGA 1FP8A 5CC7A 5CC6A 5LYRA 4A21A 3BVJA 3S5ZA 4MPQA 4D1IA 3IJQA 2ZDSA 3E1F1 5MKGB 4PTDA 3KOWA 3UCCA 3TA9A 2EXOA 1FA2A 3RU8X 3NQCA 3EZ4A 3N11A 2NLIA 1Z89A 1QNVA 3B8VA 4AWSA 4D6EA 2ZX9A 3WQ4A 3T78A 4YJ5A 4BEQA 3URNA 2AGKA 1UOKA 4M29A 1P6WA 3B05A 2RKXA 3GFYA 5BMWA 1X1NA 2ZX6A 4MMWA 3U8GA 5FJPA 5D9NA 2V38A 1KR0A 3IIVA 2WC7A 5F1VA 1WZKA 3WO8A 3GYCA 3B40A 4HYWA 3RM9A 1CGWA 4HT3A 4JFUA 2QGHA 1DIOA 1X7FA 4B3ZA 4JN7A 1DQUA 1JIBA 1BG9A 5IDZA 2YXOA 4Q7IA 3WQPA 4V1YA 4F9JA 8TIMA 1FWSA 5HWNA 5LNUA 1GVEA 3ARRA 2Z6JA 1K4GA 5U4NA 1M03A 4ZQRA 2J8TA 1GEHA 4YS1A 2NQJA 2VX4A 2HS8A 1BKHA 2H3BA 3WLLA 2ON3A 5G1TA 4W7VA 4MJMA 1ZL1A 4LUYA 2RDXA 4MWAD 1QW8A 4QHRA 3AAMA 3CB3A 3KLKA 3KDOA 2G96A 3HGSA 1LRTA 2WB5A 3S1XA 1EB3A 2AMGA 4MADA 3H4WA 2G95A 3VKJA 3R43A 1PL9A 1OY0A 1HIZA 4JTTA 2W3ZA 4WDTA 2WHMA 1KGXA 3AWOA 2VCAA 2C1IA 1N55A 3TQVA 3B9EA 4CKQA 1W37A 1JQVA 5B80A 3MI2A 4NI8A 1H7PA 5TBOA 9CGTA 3H4GA 4LGXA 1WDPA 4R3UA 3OVQA 1EJSC 3PTQA 1K8YA 3WQWA 1JF5A 1QPKA 1FXQA 4US5D 1FWGC 4C6FA 3R2GA 1L0PA 3TW7A 1J79A 3QHMA 4V1XA 5DCEA 2PDLA 3UG3A 3WUGA 5CAKA 4AYGA 1Y5XA 2YA1A 7ENLA 2Y4SA 4LUTB 1FQ0A 1Z9AA 4IL0A 3M43A 2JQXA 1VFFA 1YKWA 4GY1A 1UYQA 3RGTA 2XFRA 3UJFA 4XB3A 2GVEA 5BWAA 1G9HA 1DPMA 2WK2A 3EDJA 5DMYA 3FEQA 2IKGA 3UNDA 3SRKA 3GUGA 4R7JA 1ZBCA 1FKXA 1J0KA 3NGJA 3SSZA 3QPYA 1E0WA 4CNPA 1DJWA 1KCKA 3MHUA 3KX6A 3T44A 3TONA 2GVYA 2V2HA 2G4JA 3TQKA 4AIBA 2PDQA 5GNXA 3MSGA 5ECUA 2XIMA 1TJRA 1HT6A 3PPHA 5K9DA 1XPGA 4DN1A 4U10A 4B90A 4E2BA 2KAUC 4B92A 1ODZA 3ZR5A 3OOQA 2PDBA 2BVWA 3LBMA 3L68A 4FLOA 5G2HA 2POZA 4IP7A 4Z1AA 4Q22A 3WLKX 1Z69A 3FA3A 4JYDA 3PK7A 3RO8A 2TODA 4L4LA 1EF2A 2GGIA 2J47A 2VC6A 4J3WA 1NOUA 1Z41A 1ECEA 5T9BG 4FNRA 3W1QA 3MHGA 2GVJA 4Y9AA 1LOSA 2VNCA 1JXJA 2FZMA 3EA2A 2BDQA 1W1A1 4E8GA 2VC9A 3DIPA 3LX9A 1VEMA 2VEGA 1ZCCA 1X6LA 2W66A 4JDBA 2BY3A 4DJFA 3K1DA 5HA7A 3F4CA 1UKQA 1G5AA 3U3HA 1XF0A 5HQEA 1F05A 4D8AA 3C2FA 4O57A 4EWJA 4IQDA 4X22A 3P80A 3E74A 3HPSA 3NDYA 2VFDA 8XIAA 3MUZ1 4B4FA 5CBIA 1E43A 2BB0A 4NZ3A 5REQA 1CX9A 1Q45A 3TW9A 1GQNA 4N9EA 3RLUA 1H51A 3I10A 4M56A 1VFUA 1YW1A 3NVDA 2E8YA 2XISA 4J3SA 3CB8A 5HNRA 1GGOA 1E55A 1XIHA 4UFLA 2EPMX 4E4PA 2Y61A 1FUYA 1FRBA 2FHCA 3RYSA 1YTEA 2Q71A 7XIMA 2J7HA 5A5WA 3WJSA 3W7GA 3R11A 4IZGA 2FJUB 3S6DA 4E3TA 4Q8WA 3OG2A 4QQUA 1HKIA 2YL6A 2Z29A 5JH1A 2ZUMA 2WLZA 4MGGA 4E4FA 3Q58A 3BTNA 4J9JA 4F0SA 2Y1HA 4WR3A 4H8NA 3QHNA 4GUJA 5FF3A 3WBAA 3HGOA 4FNSA 2C19A 1G4SA 3LXAA 4BWLC 1JZ6A 3MPGA 2BWGA 4B3LA 1GQJA 4E8DA 3FHAA 1DHKA 4BR1A 3AMDA 4DUXA 4IG2A 3EDKA 4AZCA 4OOZA 4KGJA 2DZPA 3WJYA 2HZGA 2ZRXA 3TJ4A 3OZOA 3PTMA 1P7TB 1FH7A 1M68A 4FIRA 4Q7NA 3DKLA 1V6YA 4KWWA 4Q33A 3O6DA 4JTFA 4C7FA 2TRSA 2B81A 3SUWA 3KZSA 2VENA 4L1WA 4DPPA 1Q2RA 3SZ8A 4HN8A 1YDVA 1JCYA 2D3NA 2QUUA 4HMDA 3MZ2A 3FJ4A 1AQFA 4HB7A 3N04A 3T7VA 3WLIA 3QPZA 3MUAA 1W8GA 4TV6A 3CL6A 1FHUA 1UP3A 1MFVA 2I56A 1D8CA 1IXPA 1EGZA 3GNDA 3M4HA 1XBVA 4QDPA 1ZAIA 1L6WA 3RX2A 1W1B1 3T0TA 5DQPA 1IEIA 2BNJA 2Z1XA 3NURA 5ABHA 5JU6A 3DG3A 3NQ7A 8A3HA 2X1UA 4QISA 3APTA 1N8IA 5I02A 5G4HC 1UWSA 6CGTA 3F2DA 2NT0A 3V0TA 1EGMA 3W1XA 4KCVA 3W85A 3BLEA 1KCZA 3UWUA 4O1EA 1Y65A 2X1SA 1R8LA 3VNMA 1E4LA 3ANUA 3BANA 3LERA 1KXQA 2GVGA 3VIHA 4HCHA 1XBXA 2D22A 2I5QA 1N82A 3DFNA 1KTNA 4B91A 1PV8A 4XD6A 1HKWA 1W3LA 3SCOA 5JQ9A 5EPDA 4GQBA 2XPKA 1AUSL 5I3JA 5CBBA 2YGYA 2HXTA 3F1QA 1R3TA 1YNPA 2WZEA 3PB2A 3PPCA 3WD1A 2PA6A 4FX8A 1TKKA 4PRTA 3E49A 4OHQA 2PS2A 3UXKA 5LZLA 3VAVA 4D1JA 4FNPA 1OINA 1BF2A 1W3KA 1Q65A 1BQCA 4W93A 4NNAA 4DY1A 1QNPA 4AD5A 4C91A 4F48A 4CD5A 2C0AA 4DZAA 3FSTA 2Q01A 1BG4A 1V08A 1KM5A 2X7VA 5C71A 2XSBA 4S3GA 1U22A 5FJOA 5GNYA 3CAWA 5J04A 4XZBA 4PEEA 4F40A 3IAQA 1TV3A 3CHDA 3OW1A 3H8AA 3P0XA 3BOLA 4PB3A 3PZ9A 3SQLA 4H41A 2Y5EA 3QOKA 2YBUA 3BK0A 4TX9A 5CG7A 4RZ5A 3SECA 2JALA 4JTCA 4BQ4A 1MUCA 4C6IA 3DYOA 5AVHA 2YA0A 3B0PA 3W37A 3SR7A 4V28A 3D3FA 1ONEA 3SRDA 4QEEA 5E0FA 3HQPA 1UB3A 3TTQA 3CAVA 2Y70A 3NYDA 4C6MA 2E9LA 1F73A 5F2IA 4XD5A 1D9EA 3G0XA 1A3XA 1ISVA 1JDEA 4JHOA 2ISWA 7ODCA 4MPKA 2NVDA 5C6MA 1S46A 5CGTA 4DYKA 2G3FA 1PB0A 5A2BA 3G22A 2Y5SA 1QBAA 2D2GA 1RXOB 1UD6A 4E2OA 3NPXA 1RK6A 3OODA 4R88A 5EMUA 4WX2A 1LCOA 4EKJA 4JTDA 3TZFA 1Q4NX 3MANA 3GRIA 4ZODA 2E40A 1PZ0A 3NOEA 2F6UA 3G8RA 4A2RA 4GACA 4GI9A 1E6RA 3O3RA 4X2RA 1OFOA 2ZDRA 3U4FA 4RKAA 2PZNA 2PWGA 4CLMA 1XLAA 4NZ5A 3AXIA 2J79A 3L5MA 3Q45A 4F4RA 3O1NA 2I9EA 1ITXA 5E09A 3ARQA 5AHMA 4QM1A 1E70M 4A4AA 2Y63A 2YB1A 3CUZA 3FA4A 4JYEA 3GDLA 1C90A 1A3WA 2WJEA 1LRNA 2ZA3A 4KRZA 1AJ2A 2Q8XA 2FPYA 4QP0A 2QQ6A 4IJRA 3R13A 5HQMA 5AYBA 5C2CA 4Q8NA 1RJQA 1X98A 2HV5A 2ASHA 4CVWA 1DJZA 4NX5A 2X1IA 1RVKA 3JZEA 3WDPP 2D2JA 1S2AA 2CNCA 1NDYA 2EG7A 2C6QA 2F7FA 4JFWA 1MXGA 4DJFD 3SCTA 1CEOA 1QHOA 4PUWA 4FHAA 1WKFA 3LRLA 3VKBA 3M7WA 4DVOA 1IHIA 1FOBA 5XINA 2IKJA 3N9KA 2ZUTA 4RDWA 2F2HA 5AHEA 2YZRA 1QCWA 3OZYA 4KETA 4F3HA 5CJ5A 1PTAA 3G5EA 1CPUA 3GXDA 2EO7A 3CQIA 4B15A 3MSYA 1EC7A 4NRRA 5ABGA 4BQ3A 1GQLA 1QASA 2E5DA 4FXRA 4O12A 5JIPA 3A3XA 2JGQA 2ZQ0A 1JYWA 3ALGA 4M3PA 2XINA 2GUBA 3UWEA 2WSRA 3HMCA 1VP5A 3FVMA 3RX3A 2OEJA 2PWEA 4B5XA 3RCMA 4K7VA 3IRSA 4QLLA 4ZOCA 1C8XA 4GK8A 1BQGA 2PD9A 1EQCA 3WDJA 3G3DA 3UYCA 4AG0A 1IWPA 1NQ6A 4G2DA 1P7TA 4LANA 4FMVA 2D2HA 3LYEA 3MYPA 1QWKA 3HG5A 2PWDA 4WSHA 4BWLA 1PYMA 3IARA 4B9ZA 3MVIA 3L23A 1D7FA 3A5FA 1X1OA 1WKEA 4LF1A 3UYIA 5IDIA 5JBEA 3T6CA 3RF9A 4JIPA 2OYMA 2WVUA 1MSSA 1R9ZA 2PRLA 3M0YA 3W7IA 3GDTA 3WFAA 1HGYA 3P93A 3PSWA 4EXQA 4TVUA 3GVRA 1LLOA 3AICA 1FTXA 2PP1A 2VWTA 3KOZA 4HD5A 3T8LA 5A6JA 3EA3A 1S38A 4KCUA 3CQHA 4GWEA 3WEMA 4PUNA 3NWRA 1EJ7L 4NI3A 5BW6A 3QHOA 5D38A 3MU7A 4XBSA 4TTGA 5DXXA 2WVSA 4LJ3A 4TUFA 2TAAA 4HKPA 4AH7A 3W82A 1KKOA 3IJ8A 4S2BA 4KF1A 3S4TA 2DW7A 3G1YA 4Q7BA 4MFEA 2CZDA 3KHJA 3I7RA 1SW3A 2O9OA 4TOQA 4LS0A 1IGWA 1LBFA 3EEGA 2QJIA 2V5CA 1XICA 3K8MA 4MLRA 4MJ4A 4OGZA 1ZZMA 1CGTA 2E8ZA 3F5LA 5JXQA 4CU7A 3E2VA 3CUFA 1GZ1A 2WOQA 1F8IA 5ENLA 1TWIA 3GIYA 1W2PA 4UZUA 3WQVA 5FF2A 5CZJA 1HGWA 2OT1A 1V6XA 3SY8A 4XV0A 1HF6A 4GLEA 3ABSA 4TXEA 3RX4A 3WX7A 1JPKA 3QMSA 2VFIA 2Z4GA 2NX1A 3EX4A 2ZICA 1F7BA 2V2CA 3PFRA 4UTTA 4L4OA 4UTJA 1B9ZA 1C9DA 3UEQA 1TTJA 2G41A 2WMIB 4IPLA 1FDJA 2BXVA 2V3EA 5EY5A 4EE9A 1W1VA 3GDMA 1XLGA 3L0KA 4AIEA 3W24A 4LB3A 2UY2A 3ZS4A 2OQHA 4H6KA 1UR8A 2VXNA 3ITTA 3F5KA 4C6NA 4Z42C 4NG3A 2QEZA 3VNZA 1PXGA 2VZSA 3SCQA 5LNSA 3FAWA 1MW1A 1K8CA 3KBMA 2J7FA 3P61A 1OCQA 5M2FX 3LGGA 3C6CA 4TV5A 5F4WA 4ZB2A 5FJUA 5HR7A 2VO5A 2DV0A 3VO0A 3WF2A 3QFWA 3FHQA 3WMSA 1IZCA 1RQHA 5DN1A 4W8BA 4EPBC 4XAFA 4O18A 3LPGA 3LHYA 1OD8A 2RDUA 5HNTA 2ACRA 1T40A 4H9TA 5DRCA 3TOPA 2E0PA 1F2JA 2V5BA 3CZGA 3RCNA 3QTGA 4L9ZA 1UG6A 3XIMA 3M7SA 3SFWA 3OJGA 3UWYA 2XVNA 2G0WA 3LUTA 4FXJA 5CPSA 1V7YA 1H60A 3NQAA 3WH9A 1H11A 3WD3A 4HNOA 5A6SA 4DI9A 4BQ5A 1OZMA 3MZNA 3GTNA 2OOGA 1MUWA 1OF8A 4Y9OA 3UZWA 2PTWA 4UFKA 2BXYA 1OGSA 3IJLA 4MZ1A 2XHYA 3GBDA 3C56A 4NILA 2ACSA 3NPVA 2WC4A 2DPEA 3I65A 4BKNA 4W8AA 5G4WA 1IR1A 1W9PA 1DORA 3SGUA 1PUDA 1QK2A 1KM0A 3P2VA 1EUAA 3PNZA 2FH8A 4U5KA 5CXPA 3J7HA 4YHGA 3EKZA 3ZQ9A 3SW6A 3BOXA 4IPJA 4P8XA 5CAHA 1H09A 1T6MA 1PE1A 1NAL1 4QLKA 1X97A 4PMRA 2GUUA 4UIOA 1B3WA 1EA0A 4O16A 3RMEA 3TMQA 3W4RA 1A0CA 1W5MA 5CLWA 3E3HA 1S5VA 2YBTA 3CO4A 3ITYA 1NWTA 5A6MA 2O9RA 2MNRA 1TELA 3BJTA 2ZE0A 3GR8A 4LYPA 5I6SA 3NM3A 5A3HA 2C79A 5LIKX 1OVDA 3NQBA 3WMCA 1QWGA 4PB4A 3VKKA 4PBEA 2ESCA 4P7RA 4W5ZA 5IRPA 2HWGA 5KZ6A 3SB0A 3WF0A 4QXIA 1HNYA 4OOUA 1G0CA 2H9AB 4NF7A 4ZB5A 4A22A 1LLZA 2OG9A 3WQ6A 3S6TA 2BSLA 1CW2A 1TV5A 4ATWA 1W91A 4QROA 3MT1A 2J8GA 2OR2A 3DENA 1V77A 4ZQNA 2GQ8A 4Z2IA 3KAOA 3SUSA 4UZSA 4AEFA 4XWUA 1EKOA 1RA5A 5CG0A 1KO0A 2WHJA 4UTMA 1DTUA 1F3WA 2WZTA 3ZLHA 3BAKA 2ICSA 3ORWA 3TTSA 1VQTA 2ZZ6A 5AOUA 3BSMA 1E1CB 4AZIA 1ZTVA 3IGUA 2DGAA 2HNEA 1A5SA 1NEYA 3SCPA 4S23A 3BCJA 1CLXA 1QXLA 3V18A 3S2LA 5AKQA 3UW6A 1GHSA 1O5XA 2YLLA 4JQ3A 3W1TA 3HPAA 3WYZA 1YBQB 1E0XA 4O0ZA 4WF7A 4M6PA 1PJ9A 3OB8A 3G18A 3WD0A 1J6PA 5BOFA 5I00A 3PZGA 2OSWA 1ZPTA 1G69A 2D69A 3C3NA 3GNNA 1TJ1A 4PTVA 1ME7A 2VFEA 3E0VA 2DH3A 1XH1A 2P88A 1ONRA 4H9MA 1X39A 4U2YA 3KBWA 4IIFA 3L65A 3UWWA 1OFAA 3ARSA 3WLRA 3ARYA 3PJWA 2F6KA 1VRXA 3QW3A 4H8UA 5D05A 4JX6A 4S3DA 3A4JA 5K3VA 4CCCA 4CQ9A 4DJDA 4DNHA 1SW0A 4P8VA 1RBAA 3HZ3A 1DL3A 2PP0A 4JTLA 1Q63A 4J3XA 4ZOEA 2OKTA 3R58A 3W7KA 5CPMA 3G1VA 1AMKA 4U3CA 1A50A 3R4IA 3P82A 3UVAA 1VEOA 4OECA 3W81A 4M24A 2E5BA 2NXIA 3VIIA 1S2UA 1FCVA 1XSIA 3VABA 2DJXA 4I9TA 1V5XA 5A95A 2I16A 3F5JA 1ISYA 2INZA 2PDYA 5J5DA 3PHAA 1LUCB 4QG6A 2QDEA 1YE4A 5E9AA 1JUBA 3H26A 1GUVA 4GZJA 2X1TA 4NL1A 1O4UA 1QDSA 4PCTA 1NFGA 2OLSA 1XD0A 3N2CA 4S3EA 4PULA 1MFUA 1JCXA 1GORA 3QF0A 2QPXA 1LQ0A 4PMNA 4K8GA 4QDWA 3XINA 2YBVA 1E6XM 2Z25A 3RPTA 4D6IA 1XDLA 1N8WA 3O0FA 5FEPA 1A5NC 3WJZA 2PGRA 3QLLA 2OZTA 4IFRA 1AJZA 4XBJA 5HR6A 1O95A 3N12A 1PKNA 3GH5A 2ZYFA 2MANA 1W32A 2QJJA 3NEHA 2J13A 3GKAA 1TCDA 2E9BA 4KCWA 1XH2A 4ICMA 2BG5A 4H6RA 4GI6A 4UB9A 2GJXA 3EX6A 3BH4A 2GGHA 4XKYB 1RAKA 3GYEA 1Q85A 3KVJA 1MZRA 1ZCOA 3FGCA 4GY7A 4HNTA 3AO0A 3IANA 2OWCA 2PGWA 1Q5MA 3K30A 3R8GA 4XVDA 5C9RA 4Z2JA 2WYSA 1UUMA 3H2CA 2VRKA 2OX1A 1ISWA 4NNCA 5CSYA 4PMJA 1VFOA 2XIQA 3B97A 2BVYA 1HJWA 3T40A 3LLDA 2VX6A 4GY0A 3W1RA 1W0MA 3M1ZA 3PZQA 1A49A 2XFFA 1AH3A 2JE8A 4PSRA 1FWWA 1S3HA 5FCZA 5HJLA 4XG1A 3AIEA 1TQJA 4MY9A 4JOMA 1CLVA 2CU0A 3SN0A 3GXPA 3HQOA 3WLOA 3T9PA 2Z00A 4XAZA 1TZZA 3W07A 4JKLA 5D2TA 1SJDA 4FO4A 4EACA 3IJ9A 2VELA 4PEKA 4WDWA 2QCCA 4PCNA 1RPXA 2V0TA 4L61A 4W89A 1MXSA 4ZFCA 3KVKA 3W7MA 4LFYA 2WVTA 3M6YA 4Q6XA 3UBPC 1PDYA 5CC5A 4YL2A 4IGNA 1HUVA 4GD0A 3KE0A 1V6UA 4CU8A 4CNNA 2VEMA 5AHLA 3YPIA 3WCZA 1SFTA 3G3MA 4JKKA 2OWXA 2ZZ2A 3PUDA 4R85A 3VOIA 4NQ1A 2ZTKA 5RUBA 2VKZG 3ZO9A 4F66A 2G3JA 4WDXA 4Z1BA 7TIMA 3C2OA 5AB3A 1SO3A 1SZFA 3CH9A 3B0XA 1JYNA 1US0A 3F4NA 4KRTA 3WQ5A 3B3DA 1JCJA 4AVFA 2D3LA 2QMJA 4AYSA 3ZJKA 3PWGA 2V67A 5BMXA 1MRAA 4K37A 3AYRA 4BS0A 1B54A 2HBXA 3N9RA 2FLIA 3E0IA 3OVGA 2ZZ3A 4FOKA 2DUAA 1X38A 4TX6A 4IIGA 1JXKA 4XQ6A 4AZGA 4HHHA 2DIJA 5FESA 3UWVA 1ZENA 4Z0SA 4QS6A 1P0BA 3AYTA 3F03K 3L5LA 3GVVA 3USBA 3GC2A 1J12A 1HL8A 5LA2A 4FXSA 1JI1A 2DFAA 2NV9A 1SJCA 3ANYA 1ESWA 3NR0A 1NP2A 5HMSA 2ACQA 3UR7A 3TTOA 3VDBA 3DFOA 4Y9MA 3RRXA 3JZUA 1CB7B 2G3NA 3B8TA 3LENA 1XIDA 3WNOA 5C0QA 1R0MA 3MMWA 3QC0A 4LPCA 1ITQA 4JIQA 2PC8A 3QSTA 3FXYA 3O16A 1Z44A 3MDWA 1E1CA 3PC0A 3E5PA 3MQTA 4GXPA 7CGTA 1TPDA 2BLEA 4H19A 4PC8A 1R2RA 1A53A 3T42A 3EWDA 4S39A 3TJIA 1UR2A 3DZ1A 4AD3A 1A5MC 1HFBA 2OEMA 4F79A 4GNKB 3S42A 1F6PA 1DJXA 1AG1O 4IP4A 5LA0A 3O8AA 4ICNA 4JS3A 3PZIA 3CK5A 3A3WA 3TYUA 3EKGA 3EWZA 4YIWA 5G1YA 1ZJIA 4RV8A 1OJXA 7A3HA 4BZYA 4WKAA 4RV3A 5D8ZA 1KWKA 4BF7A 3A12A 3IUHA 3KP0A 3PBWA 3S9YA 1A0DA 2CZVA 2J9YA 2X0SA 3K2GA 1YIXA 4MB3A 3I3BA 1KKRA 4JICA 1P5BA 2PRHA 3L21A 3KCOA 1TZ7A 4JCLA 5GNZA 3NQDA 4AFYA 3MHFA 2GGGA 4PCPA 3S0CA 4LBRA 1K9EA 1Q6QA 4ACZA 4X0VA 2E5CA 1TV8A 3QYSA 4YWIA 3UNTA 2PF0A 3GHSA 3MUXA 3KCLA 5KZEA 5L6UA 3LB0A 1HO4A 1Q7ZA 2WBKA 2PODA 3OYXA 5I24A 3AMLA 1XRFA 5CPLA 7PTDA 1U30A 5FF0A 3W7JA 2R1NA 4XUYA 5CPOA 2BHUA 2ISSA 4JHMA 4L1XA 3P8IA 1H1YA 1F9CA 4XD3A 1CGUA 1Q4WA 4PCFA 4NXKA 4DJDD 1PO9A 2LLEA 4F0KA 3ZT6A 2V5DA 3A21A 1B3ZA 3N3TA 5CSSA 2ZVIA 5A69A 4GH3A 1G6CA 3VGDA 2EG6A 4UC5A 2A2IA 1TRIA 4E8CA 2QHAA 4IOTA 4IUOA 3Q4DA 3ZVHA 1GQKA 4UWMA 2IKHA 1FP9A 3MVTA 4X9SA 2GWNA 1C91A 2X42A 5KITA 1TZ9A 1WB0A 4ZCWA 1D7KA 2HCVA 3N18A 1G7UA 1V6VA 5E6ZA 3D5HA 3WQOA 1R3YA 2D24A 5AZ1A 3PJTA 3H70A 4AMAA 1EBHA 1EIBA 2WZIA 3W26A 3KRBA 5LKYA 1MZHA 4AXKA 4LAMA 4C6PA 2WNNA 4C1LA 3H7RA 3N17A 5J5RA 4YTRA 4Q4OA 2NWSA 4WCJA 1YRRA 4LB4A 4BCEA 1XSJA 3WL1A 5GQBA 2CLEA 5M3WA 3U2OA 3TTEA 4R5EA 1RHCA 3KRZA 3IGSA 4HNVA 4LUSA 5FSEC 1ZSXA 2OZ3A 1IWBA 3HJZA 1JYXA 3DX5A 1E0TA 2R9RA 3BAWA 4XAYA 3QGVA 2AGTA 2DT1A 4QTGA 4IMGA 1FHVA 3WUFA 4XZNX 4GIEA 4F2UA 2VD8A 3CQJA 3TXZA 1GTEA 1V0KA 4XIAA 4C7DA 5DX7A 4AHOA 4GBUA 4UOQA 1OGBA 2BOGX 4WGXA 2GOUA 4R7OA 2W62A 4NZCA 4MWAC 4J3UA 2GJRA 5FD0A 2A7NA 1J2WA 5DRIA 3W2LA 2PDNA 4IIDA 1SYTA 1N2VA 1XLJA 1CIUA 4AC1X 1K4HA 5C7VA 3WBYA 4PR4A 4HZ7A 2NUWA 2HDJA 5DFAA 1PDZA 3SN1A 4C7GA 4HPHA 4HMEA 1GKPA 2EPOA 4ERAA 1I6NA 1ML1A 3QY6A 2GWGA 2FKPA 3O0KA 2FVMA 1MI3A 3VXGA 4AZ6A 3EB2A 3W1NA 4ONVA 1UCWA 2XN1A 4JX4A 2YLAA 4MWAB 4D9PA 1QPOA 4DX3A 2CZEA 1HN1A 4D72A 4M19A 4UTWC 4O53A 1Y5WA 2OO0A 1O6IA 1DWGM 3I6EA 4XZ9A 3P5ZA 1TMQA 4IISA 1OIFA 2G3MA 4PZVA 3LK6A 1SMDA 2V3DA 3NQGA 3SCUA 1GVQA 3ZIZA 5DEZA 3H2EA 4KWUA 2BY0A 3TYCA 4GJ1A 1OK4A 3BDKA 1LJYA 4S3CA 3W7LA 3WG6A 3UZXA 4MLJA 1BF6A 3V36A 3GXTA 3LBCA 4H00A 5AC4A 2VEFA 2AAMA 2D2OA 3B9AA 3WBEA 2EEXA 3NNTA 3GSMA 4AWEA 3PUEA 1MW0A 2XH0A 1UZDA 2E7FA 1N7KA 2WMGA 3ZVIA 1XIIA 1WUFA 4UNLA 1PIFA 4MJ2A 3HN3A 4B2DA 5F2MA 4GYPC 8CGTA 2DW6A 1OEPA 3DYMA 1B9BA 3NUKA 3BXWA 3M0LA 3HFYA 3OBAA 1L9WA 1E9IA 3S1VA 4PFMA 4G56A 2Z2UA 4M1RA 3E96A 1JNEA 1IEQA 2WM0A 2QF8A 1KFBA 3FJLA 1XIGA 3QYQA 4MDOA 1UA7A 3M41A 3KL5A 4LRSA 3LCGA 5LNWA 4UMCA 4GYKA 4LYQA 3THQA 2XM1A 4KIEA 3RIKA 4CNTA 3CJPA 1TR9A 1XBZA 2J6VA 4N6EA 7REQB 1BTMA 5KMYA 3VYLA 3L7RA 1AFSA 1LOQA 2W92A 2KZHA 4IFKA 1E4NA 3GHRA 2CLMA 2ZZ1A 4BF9A 2BHZA 4D6DA 1WXJA 2J9XA 6XIAA 2VTFA 3VIKA 1ZJAA 1V6WA 5SWUA 2BS9A 4ZEPA 1P1MA 4DWSA 3LI1A 1MO0A 3OQEA 1EP3A 3GD6A 2WKJA 4W84A 1UUOA 1C29A 3O9NA 4RDZA 1B57A 1KGWA 3KTSA 4D6FA 5T91A 3NO3A 4MNKA 5FEXA 3NZGA 3ONCA 3LA4A 2IUZA 3C2YA 1UH3A 5I23A 5A6BD 2WNWA 4J1OA 3ITGA 1TX2A 3N6HA 4HZ6A 4B16A 1JF6A 4RCXA 1QHPA 3S2CA 3G2GA 1LTDA 2OYLA 3RPMA 1WKDA 4QE1A 3M5XA 3RJYA 3KBSA 3ZWTA 5FI8A 4UBPC 3OP2A 4IQEA 2FFIA 1UZ1A 3CUGA 3N1AA 3O63A 3RFAA 3WEZA 2WVVA 3GTHA 2EJAA 3A5VA 1I2OA 3RM8A 1KFEA 1R2SA 1DWAM 2IPGA 4AIUA 1W3NA 1SUXA 2P1FA 2ZZ5A 3URAA 4GXMA 1JZ4A 2VEKA 4NASA 4EP8C 5HNNA 5DCBA 1TE6A 5D32A 1OX6A 2Q8LA 4GVGA 2PP3A 1UIOA 2VZVA 4HIBA 5CZ0A 5K2ZA 4E38A 1FXPA 2NLYA 1J0YA 2Z2AA 4CN6A 5AVNA 2HSAA 3AMGA 2BODX 4B5NA 5BXSA 3N34A 1ONWA 1JVNA 4UFMA 4CEUC 3R6IA 3GX9A 3DYPA 1XLKA 2Z1VA 1XFCA 3N4FA 4N0RA 4B5VA 2CWNA 1P0KA 3C4UA 3H2OA 2DJLA 4JEJA 3A13A 4I6KA 1Q13A 1UWIA 3OLDA 3EOSA 1VC4A 1YTKA 1BPLB 4K68A 4L56A 1OADA 2PTXA 5HOSA 1HQTA 2DZUA 3QQWA 3VIOA 2GK1A 2F6XA 1NARA 3WD4A 5MF5A 2Z7KA 3PJUA 4G8TA 4TTUA 4AUBA 1H41A 1JGIA 1LL6A 4JIEA 3VGHA 1JEZA 3IJIA 5HK4A 4UFIA 1VCGA 3QPEA 1TVNA 2WZMA 2W67A 4DYJA 4XSLA 3MCMA 4NU7A 1XPYA 3AUJA 4G7EB 1W3TA 5JVLA 3WFLA 3VC5A 3O05A 1H50A 5EBUA 5C2XA 1OB0A 3QKEA 4X3ZA 2D0FA 2RGLA 3TCSA 1G4EA 3PPGA 3VUPA 2I5GA 1KFJA 1M7OA 2QCNA 4JTQA 3N2TA 3T08A 1GPWA 4EXBA 3EPNA 1LLWA 3MMTA 4GX8A 2PF8A 1GOXA 5C5YA 3KL3A 3CZ8A 3LV5A 2VT0A 3KTCA 2HVNA 1SZRA 3TSBA 1ZRQA 1XGDA 1KLYA 1Q6GA 3LN3A 4O4VA 5BXTA 2PEVA 4O0KA 2IKIA 1JCMP 1VLWA 1WOAA 2WPGA 3WLTA 1ZJHA 2EPLX 1SO4A 4F8XA 1D2KA 4IGMA 1P43A 1U5HA 3USZA 3SUTA 1XUZA 1MMFA 2ZUSA 1WDRA 1S2WA 2VZTA 3KVLA 3L66A 4YXGA 1FWDC 1KFLA 2J8FA 5CLTA 4J7RA 1IYXA 1X6UA 1OX4A 2QCLA 3VOHA 4WOQA 2EGZA 3QV8A 4K6AA 1PTGA 4PMYA 2ADAA 2FTPA 1XRSA 1JR1A 3LCLA 3V1HA 5BXPA 2WQPA 5I09A 5TD4A 4O8RA 1IGSA 4Y90A 1A5BA 2VDHA 3LTSA 4WHBA 4JTIA 3U7VA 2HK1A 2GZXA 3K4AA 1EP1A 2CITA 3HG2A 3QQ1A 4R53A 2FGLA 5HULA 8XIMA 2NQZA 3QKZA 1HO1A 1ZAHA 3ENLA 4XO7A 2DP3A 5FF7A 2ZXQA 4HPNA 5C55A 2TMDA 1LL4A 4OIFA 3L2IA 4DLMA 1L6SA 4IX2A 3MC5A 2PU0A 3MWCA 3W6LA 5LNRA 3LLXA 5ABTA 3W2UA 4LVDA 4JX5A 1ZGDA 5LSMA 2CBVA 3GW0A 3ZR4A 4HPXA 4LU0A 3M9YA 4HPJA 2Z7GA 4JGDA 4YTTA 4NJGA 1M7PA 1L8NA 2QJMA 1UQYA 3W6MA 1UMYA 4HA0A 4JFTA 4YTQA 4F0HA 5PTDA 1JFXA 4ZXOA 1V3MA 1K77A 3VNIA 2PZ0A 3E2RA 1W1IE 4O13A 1OCNA 3E02A 1VBJA 4EK7A 5DXYA 4I7UA 4DUOA 2FVKA 1WZMA 1O5QA 3MCOA 3OIHA 3VILA 1DQWA 3QV9A 2B4GA 2WNZA 1NDWA 4JFVA 2FHBA 1BRLA 5A8NA 3U48A 4DI8A 3NQEA 3THAA 4FLQA 4LEFA 5DMMA 3EDFA 4H2HA 3NO1A 1GKQA 4U28A 2PDHA 2X7WA 4LF2A 4RNFA 3TNBA 3HV9A 4EPDC 4N6FA 5E9XA 2GUYA 3A47A 3S46A 1ZB5A 5HPOA 2X0YA 3CL8A 5LIUX 4HGXA 1CXLA 1S5TA 3OG3A 2WXDM 1UKTA 3RLVA 2ABAA 4DBDA 1ADOA 1WUEA 2E6FA 1W9XA 4A8RA 4MY1A 3GAKA 1KW1A 4J27A 3W27A 4AX7A 2PWFA 2W79A 2PSNA 1J8VA 2Y8UA 1XLMA 3GG0A 4NSBA 1I0DA 3FYOA 1Q7MA 4HHMA 1TPB1 3NDZA 4NAFA 3COTA 1E15A 2WSKA 4I5RA 1B31A 1Z32X 1OSEA 3VOFA 5EBAA 1OGGA 1G01A 1FWFC 1ICQA 5I78A 3URBA 1PZ1A 3WUBA 3GVQA 2NQ5A 3O07A 1KTBA 1MDLA 1S1RA 2OX4A 1R9YA 1DJGA 2C14A 1SPQA 1I45A 2PDPA 2PLKA 3H24A 3NPWA 4DJFC 1XYAA 2Z2BA 1US2A 5IXEA 4Y7EA 1GCYA 3LLFA 4DWSD 1WP6A 4MKNA 3B8UA 3LMYA 3TU9A 3B8IA 1WBHA 1O60A 2YXXA 2QPUA 2FIQA 4S1FA 3FKKA 4CNUA 3EPMA 1VFMA 2JBMA 3AFBA 3CIWA 3MA8A 1KM6A 2DUXA 3OTRA 4UQEA 4NNBA 5D02A 2QYGA 1VB9A 3W86A 3QC3A 1KXHA 1UP2A 1OFDA 3CLWA 4EPKA 4XISA 1LP6A 3CZLA 3W1UA 4O28A 3M6DA 3TN5A 4Q4PA 3I68A 5BROA 1CTNA 4MAZA 3FIGA 2DEPA 1QVBA 1TPWA 3ZZ1A 4RL3A 3GM8A 3WNPA 1QMLA 3IPWA 2D0GA 2Z28A 2PMQA 5HINA 4DQWA 3CL7A 3THCA 3SBFA 5AY7A 5D9MA 5HNUA 3WQ8A 2QLYA 3HQNA 1Y5VA 4A3YA 3S2JA 3C0LA 1NP0A 3VNDA 1UKSA 3PUOA 1PHQA 3S83A 1JL8A 3W75A 1AD1A 2NSXA 2ZE3A 2NV2A 1P0EA 1IIGA 3FA5A 4FZIA 3NQMA 1ISZA 3VD4A 4P8UA 5CKSA 4L4MA 5H8UA 1CXIA 1LORA 3FY1A 3T0CA 3G1RA 4A2SA 1NH6A 3QR0A 1FBAA 3GNPA 1Z48A 3QR3A 1J0JA 5D33A 4M81A 3UR2A 3E2QA 4J35A 2XTKA 4D8ZA 1XIFA 3CZKA 4FAMA 3IK4A 1F3TA 3K8LA 3BZJA 2HBVA 1KV5A 3AIWA 4I5UA 3GO2A 5E1QA 4TMCA 4KERA 2DZWA 4Q8VA 2OOFA 3VKDA 4W86A 2GDUA 4ML9A 3DEQA 5CCZA 1EPVA 3TLLA 2ZC1A 1VRDA 1C7TA 2JGYA 1AODA 2PD5A 1GG0A 1I8JA 1DP0A 1TA3A 1WZLA 1WV2A 1A5AA 3PTKA 1HTIA 4AY7A 2RDWA 4AQLA 3BO9A 1SZNA 1IF2A 1Q6FA 2NV1A 3SJNA 3ZLGA 4AB4A 9RUBA 1G4PA 4IG2B 3ITXA 4AZCB 1AZ1A 3UWZA 3PZVA 1TTPA 3U0HA 2C3ZA 3NM1A 3VZYA 4WJEA 2GOKA 2QV5A 1UWRA 5KZDA 3W0KA 1XG3A 2QJNA 3PB0A 4PL2A 3W6YA 3ZWSA 1GVRA 5I06A 1B90A 1RBOB 2Z26A 5CC3A 1JZ5A 3CWNA 1VPQA 3ZSTA 2CLFA 3CQKA 4PMOA 1ME9A 2PCQA 3VCCA 1OABA 4NP7A 5H1WA 2W4XA 1AL8A 4L9YA 5EB8A 3XISA 4P2VA 3NPUA 2FZ8A 4FR1A 4ZFMA 4TR9A 1O66A 3UPMA 4H9VA 4KT2A 5LA1A 3H7VA 4JBRA 1U1JA 1H63A 2AKZA 5BRQA 4NYUA 3L4WA 4PB5A 4QCEA 5CGQA 3WH6A 1NWRA 1RP8A 2CBIA 3VDAA 2ISFA 3E6EA 2A0NA 4TU1A 3DFSA 1QI2A 3M44A 1HKMA 3WLNA 3NZRA 2O55A 2NVCA 1HJVA 1R86A 1VBGA 1UA3A 4IJBA 2X2GA 3V16A 2YOCA 3CM4A 2A6NA 3CQ0A 1XIMA 4KBXA 3WMBA 2QVHA 2C15A 3UG8A 4PRWA 3W88A 3T09A 1TJ0A 3UXLA 5K9XA 3UGVA 4YTUA 1FWBC 1SFJA 2ZCGA 2VMFA 4IICA 2PU1A 4FS9A 4N9BA 3AJ7A 1Q6RA 4CQ8A 3QMRA 4JTHA 2DZAA 2ZFAA 3BG5A 3EWYA 2PE4A 1TTIA 1XYBA 2PBOA 1WA3A 4AU0A 3OA5A 5FJTA 3H22A 4B9YA 4HK7A 1QNRA 3TYAA 3DHDA 2W63A 2Q8ZA 3IIPA 2ISDA 2I14A 2DSUA 4W87A 2V8ZA 4RXGA 4H7ZA 3GK0A 5AHFA 5JUVA 2QF7A