1J2WA

Tetrameric structure of aldolase from thermus thermophilus hb8
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
212
structure length
212
Chain Sequence
b'MDLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPSYVAWVRARYPHAPFRLVTVVGFPLGYQEKEVKALEAALACARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVLKVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASRLGTSSGVALVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldolase protein
publication title Structure of aldolase from Thermus thermophilus HB8 showing the contribution of oligomeric state to thermostability.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 87
structure length 212
sequence length 212
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1j2wA00
4DELA 5G1TA 2QKFA 3ABOA 1VYRA 1R46A 1ZHAA 3WK0A 3ZS4A 4NUWA 5K9CA 2QR6A 4O53A 3DBPA 4IPJA 3EX2A 4JYDA 4UCGA 2ZA1A 1QCWA 2ZA3A 2QCNA 3SJ3A 3W1UA 3CTLA 4Q33A 5BMWA 1W5QA 2YW4A 3PY2A 4AVFA 1BWKA 3TMQA 2A0NA 2DZTA 2Q3RA 3CWNA 3KVKA 2Y61A 2ATMA 2B4GA 1J5TA 3B0PA 1A5SA 5F2MA 1SR9A 2PC4A 4DBEA 5LGXA 1VCGA 3RLVA 4N9EA 3TROA 4GC4A 1SO4A 2OT0A 1Q6RA 1Z42A 5K4ZA 4LV9A 1F6KA 3LRLA 1DJQA 4ADSA 4I7WA 2NX9A 4FNQA 1I2RA 5D2TA 3HO8A 3NR0A 2NV2A 4UFHA 5C55A 2QUTA 3CB8A 3S5ZA 2ZDRA 2YSWA 4JEQA 3EWBX 2ZRXA 1TYGA 2JKEA 4O4WA 2JGQA 1TSIA 4OHQA 1M5WA 1MEWA 1QO2A 3GB6A 1PIIA 4IMDA 3NDOA 4U4MA 3LGEA 1F74A 3EWZA 1ICQA 5AB3A 4JTIA 4Z1BA 5BNKA 4JTHA 1ML1A 4UIOA 2J27A 3HF3A 5G2HA 1U83A 2XN0A 4O11A 3UY7A 1IGSA 3STEA 3QW4B 1YYAA 1H1ZA 1SO5A 3MJYA 1TPB1 3NYZA 4A22A 4O16A 2DP3A 4QNWA 3IVTA 1IXOA 1LCOA 3ZWSA 3TFCA 4M7TA 4CCCA 4HPJA 1H50A 1YPIA 5AHIA 2Y7DA 2AQWA 1JQXA 3R13A 4RXGA 1JRCA 5D2XA 4JTEA 2GPTA 5CKSA 4JTSA 3GKFA 1W0MA 3C0JA 1X1OA 4CLMA 3DI0A 3LCWA 3T44A 4E2DA 4ML9A 3KRSA 1VCFA 3LHWA 4E0CA 1GWJA 1EPXA 4RXFA 5G5IA 3IIOA 2ALDA 3ABRA 4OT7A 4X2RA 3PSWA 3G1AA 3V75A 4GWEA 5AYXA 3W3OA 1TPFA 3RK8A 4MLRA 3W72A 1DKWA 1HO4A 5F2LA 1I45A 4FHAA 1ADOA 3G1YA 3G1XA 3TQ0A 2WJZA 4LS1A 4HSOA 4JTKA 2BSLA 3L9CA 3NQGA 2HTMA 4TMBA 1QDSA 4MJZA 2C3ZA 3GXTA 5I3GA 3NPXA 3RU6A 1A53A 5FF2A 1JCNA 3FJLA 5FF4A 2DZXA 4K8HA 4IUOA 5DY3A 3FJ6A 3KAOA 1GVSA 1OFQA 5K9XA 4ZQOA 2V2CA 1AK5A 5DCBA 4DF1A 1ME9A 4IXXA 1AG1O 2G97A 1YDVA 4N4QA 2GVGA 3GDLA 4LVBA 1KFJA 1X7FA 1KM3A 5CPMA 1F7BA 1DL3A 2J9ZA 3FKRA 4CQ8A 2GUUA 3SFKA 1LDCA 1HUVA 1W8SA 1OX4A 4JY9A 3GYEA 3L0NA 4YMZA 2X30A 3B8DA 3A5FA 3MBFA 4N9DA 4CNPA 2EPHA 3LTYA 3PG9A 2FPVA 1HTIA 1G7VA 2QCGA 4O1DA 3TC7A 2I1OA 1FCQA 2H8XA 2V30A 4TO8A 4N02A 4PODA 3NQEA 4O0ZA 4PL1A 4WOQA 1JCJA 4MPQA 4K38A 4HHPA 1LLWA 3W7MA 1PS9A 5D04C 4NNCA 3SGUA 1RV8A 3W7QA 1SSDA 3DFQA 3O16A 1QPNA 4UUIA 3UYCA 3W7CA 2TYSA 3SI9A 4M7SA 1W5NA 1V7YA 1Y0EA 4NT0A 4TMCA 2KZHA 2QEZA 1F2JA 4UC5A 1VR6A 1HFBA 1UASA 1JCMP 1EB3A 3EB2A 4LRTA 1GTEA 1N7KA 3NQMA 2GVLA 1W3NA 4O19A 2FPTA 1SZGA 2YR1A 4PC8A 3QW3A 4YL2A 4XBKA 3Q2DA 5TBOA 3E49A 2RDTA 1G7UA 4O1CA 3ZWTA 2Z2UA 1SW7A 4FX8A 1IIGA 1F76A 3DFSA 3Q58A 3T55A 1V5XA 4UFJA 5BMXA 1GOXA 4XKYB 3KVJA 1ONRA 4FB7A 2GJNA 3KRUA 3QC3A 3PB2A 1N8FA 4GRSA 3VFLA 2Z6JA 4D2JA 3STCA 1XCFA 4TIMA 4ZQMA 4RLIA 4GBUA 3LDVA 5HR7A 5LGZA 3W1TA 3TJLA 2YX0A 4QISA 1UB3A 3M5ZA 1EP2A 3NEVA 1LBLA 4O15A 2V5LA 3W2MA 1QAPA 5LNUA 3O07A 3W86A 2ATSA 3G0XA 3NM1A 3TC6A 1KBIA 5KZMA 4BFAA 1I8JA 1K8ZA 1EWEA 4TU1A 4LC8A 3QPZA 3A5VA 5G4EA 3PAJA 1O5KA 1MEHA 4LS0A 3W1RA 2BLEA 2WO5A 3W1LA 4GUGA 2JKAA 3ABQA 1J2WA 1QPQA 1M6JA 3CU2A 5LHFA 3O05A 3MYPA 1QOPA 1ICPA 4JTJA 5AHEA 5G4WA 3M5VA 3O6DA 3PB0A 2DZWA 2A7NA 5BW6A 2ZZ2A 1WQ5A 3MMTA 4GNJA 3NVTA 1JJKA 1D3GA 4IGHA 1RQBA 2CLEA 3GLCA 3L0KA 4NJIA 3T40A 1D3HA 1VGAA 2ISWA 3L65A 3TU9A 2ZCGA 2NUXA 4NXSA 4HNTA 1KBJA 2QCMA 3W70A 4NNBA 3MI2A 5DELA 5D30A 2WSYA 2W6RA 4FNUA 2PE4A 5HUOA 3LXBA 3UWVA 4MZ1A 2E1DA 4N4PA 4MY1A 2ZRYA 5CG7A 3FIGA 3O6CA 1K3UA 4H3DA 3G0UA 3TIMA 2A7RA 3OEXA 3I65A 3N3MA 3TA6A 1KW1A 4UTTA 5K3VA 4EF9A 1QPRA 1VYPX 1SUXA 1OX4B 1OVDA 3WJSA 5LNWA 1GEQA 3HBLA 2RFGA 3KXQA 3PVFA 4AAJA 4BWLA 2QCFA 2ZRWA 3TFXA 1W54A 3FLUA 1YADA 2Q8LA 3W2JA 4CCEA 4MVAA 1K7EA 1NEYA 2V8ZA 3GR8A 4K7VA 4MFDA 3UNDA 4P61A 3PSVA 3UPBA 2R8WA 3BK0A 5AYZA 4HNUA 1H62A 3LXCA 1SSGA 2WNZA 5J5DA 3I7RA 3CM4A 6ALDA 3F03K 1J4EA 1ZY9A 4JYEA 2B7PA 3LHTA 2X1SA 1OFRA 3HB9A 3W9ZA 3U8GA 4FNRA 2QCDB 3ANYA 3UXAA 4BI5A 1LOQA 3NO5A 3G1FA 4DO5A 2RH9A 3NGJA 3QFEA 1GYLA 1W3IA 1Q6QA 3VE7A 3BVJA 2CLFA 3SW6A 1MZHA 3W7EA 5HR6A 3BW3A 3OHIA 1SPQA 1OG0A 4UTIA 4EVZA 4DPQA 3M6YA 5KINA 4XUGA 4JTUA 1H5YA 4MZYA 4O14A 2QJHA 1K02A 3NL3A 3M47A 1SQ7A 4LV4A 2B0MA 4DO6A 4DBDA 4UTWC 3W2LA 4IOTA 5TIMA 3NL5A 2YCEA 3SIZA 4IMEA 3W7GA 2ZA2A 1TV5A 4ZQRA 5T26A 4PH6A 4KFNA 3NA8A 2VFHA 2I14A 2J9YA 5DCEA 3UWQA 3NPWA 4WJEA 2FJKA 3TDFA 3HG3A 1H7NA 4Y90A 1GG1A 1VJIA 3NQDA 1S5TA 1O95A 4BF9A 3GDMA 1EWDA 1LP6A 3EWXA 1K8XA 4K7YA 2FB3A 3W2KA 1FWSA 4L4MA 3THQA 3F4WA 1K7FA 4WUIA 4AH7A 2NX1A 4WY0F 1JRBA 1LRNA 3HIJA 4FF7A 4MUZA 3CPRA 3W07A 3EWUA 1HL2A 4GFSA 4J9JA 1DHPA 3C4UA 3M5XA 3P62A 2F84A 3MHUA 1R2TA 3W7PA 1H7RA 4LUIA 5HQEA 4O17A 4UTLA 5EMUA 3N9SA 2JK2A 4A2RA 1F73A 2ZZ1A 3H55A 1I2QA 1VYSX 2RDUA 1SU5A 3LHUA 1X8FA 1KFEA 5AHFA 4X22A 5F2GA 2TMDA 2A2IA 3MP3A 3EEGA 1H63A 2E77A 3BG3A 4S2BA 5DY2A 5C5YA 2X1TA 1DV7A 2WQPA 3GVGA 1OFAA 2NLIA 3DENA 1OX6A 3LHVA 4JX4A 2YFOA 1KM6A 5HWJA 3WK1A 4DF2A 4C1LA 3L21A 3T7VA 3NZ1A 3PBUA 3QEZA 1LM1A 4JTLA 4M6VA 5EPDA 1EEPA 3W6YA 2G96A 3G18A 3KX6A 3GXPA 4XQ6A 2E6DA 1ZFJA 2GQAA 2ZRUA 4GXMA 3DFNA 1B57A 3S1VA 2ABAA 2Y70A 1A5AA 3IIVA 4O57A 1AL8A 2V2HA 4PCFA 2P0OA 3C61A 4PTNA 3KHJA 1ZAIA 3C2VA 1UJPA 3E96A 3QJAA 5KZDA 4ZQPA 4NJGA 1U5JA 3TXVA 4JXCA 1Q6LA 4JYFA 2W0UA 1R2RA 1LLZA 1PE1A 3ATZA 3P74A 3ZFHA 3GAYA 4Z1AA 2P10A 3W83A 3NQAA 3HGRA 4WXZA 2PRHA 4NNAA 4LTSA 4MLJA 4NZJA 2GQ8A 3IGSA 4GUHA 3DHDA 1BTMA 2OMAA 4O0KA 1GZGA 2RHGA 1H7XA 3LCIA 1G4PA 3TH6A 2CLMA 3S5OA 1TTPA 3DH7A 4MYXA 3I68A 3RF9A 4P2VA 5EY5A 5K9DA 3F4NA 3BV4A 1TTJA 5LKYA 4IWWA 1YXCA 3MUXA 1MXSA 4ICNA 1EA0A 5E93A 3KVMA 5I3KA 1WXJA 2ZZ5A 3A9IA 1FCUA 3OVRA 3O8AA 3W2UA 1MSSA 2WPBA 1L6YA 5E1QA 4FX6M 1IIHA 1XFBA 3LTSA 4FXSA 1KFCA 1KM2A 1P0NA 3GZ3A 4OV9A 2H90A 3PM6A 5CSSA 3A21A 3BLFA 4U28A 2HMCA 1XKYA 4I9AA 1LOSA 4Z08A 3HMJG 3WJWA 4LVGA 4H4IA 4A21A 1DQXA 4OGZA 3VNDA 3IV3A 3WFAA 3P8JA 3PF3A 1TV7A 2QCLA 4IPIA 3LCGA 2GQ9A 2A7PA 4M19A 4UXDA 5DCDA 3OG3A 2ZZ6A 3PBWA 3IRDA 3P61A 2BXVA 2NV1A 3P8IA 3HGJA 3W73A 2DJLA 5AHMA 4UTHA 2TPSA 3KRZA 3SSJA 1GPWA 4UMCA 1XDLA 1JUKA 2ABBA 5C2XA 1W37A 3P67A 3CQ0A 2ZBTA 3DI1A 3WK2A 1XUUA 3M0ZA 2AGKA 2E6AA 1FWNA 1TPWA 2NUYA 2YDAA 1FXQA 5ABTA 3C2FA 3FEMA 4YCOA 5F2IA 3NL2A 4OWGA 3P84A 4RZ4A 1EP1A 2RKXA 3NPVA 3P5YA 2FTPA 1FX6A 3PBVA 2QAFA 1TPC1 3NQVA 1T0OA 3O06A 1GT8A 1FCBA 1GTHA 1KM4A 4UFLA 3BO9A 1TQJA 4JDYA 2VEIA 3CIXA 2CFFA 4UNKA 3TW7A 3BLEA 1TPEA 2VENA 2NX3A 4Y9AA 2CZ5A 4JIPA 2R91A 4ZL1A 4W9TA 1PCKA 2DZUA 3G1DA 4NU7A 3PUEA 3FYOA 3TAKA 5CPOA 3BARA 4RK8A 4PL2A 2J6XA 2NXIA 4WXYA 5K4XA 2W79A 4MFEA 4O12A 2DZSA 4HSNA 5I3FA 4DXVA 3P80A 1WX0A 4FIRA 3CWOX 4BR1A 3S6DA 4E2BA 2Q3OA 2XN1A 4N9CA 2AAMA 4LU0A 1RQEA 1GJPA 2OT1A 2YGYA 4IMGA 1IXPA 2FLIA 1H7OA 3LRMA 1A50A 2H6RA 3TMLA 3M41A 4N2YA 2NZLA 1A5CA 1PHQA 1RQHA 5F4WA 3W1MA 5LHEA 4ZQCA 2HSAA 1NF0A 1RZMA 5U7SA 3WJZA 4ADUA 4M5PA 1RD5A 3UWZA 3LCXA 1OJXA 3UXDA 1P1XA 3TJXA 2EKCA 5CZ0A 1R2SA 3VI2A 1HG3A 1XL9A 3ABSA 1F05A 2YFNA 4YXGA 3O63A 4OV4A 5DLCA 3QM3A 5AC6A 2R14A 2FB2A 3Q37A 3PWAA 3VCRA 3EX4A 3L68A 1C29A 1VC4A 4UMBA 3EX1A 1JULA 5CPLA 1FBAA 3H54A 5CGQA 3DFPA 3N9RA 1JUEA 4JY8A 5IBXC 2QF7A 3W7LA 2E5BA 5CPNA 2B7QA 4IX0A 4FNTA 2GOUA 2E09A 3CT7A 1G4TA 4HT3A 1KA9F 4QITA 4AWTA 4L4LA 5CZSA 1S5WA 3W88A 1H1YA 1XXXA 1PVNA 1NAL1 1MEIA 2WSQA 4AHQA 1W56A 3EKZA 1TRIA 1VLIA 2ZFAA 3FOKA 1RPXA 1VPXA 1WAUA 3IIZA 4WY0A 1K8YA 4LNYA 2C1HA 4LRSA 5L9FA 4JR5A 4LW7A 1GQNA 1C9DA 3MHFA 5HULA 3N73A 4Z1CA 3QZEA 5FF7A 1H7WA 2VEKA 4MJMA 4Z0JA 3QRHA 5KITA 5CZJA 3W7DA 1O5XA 1TMHA 3TXZA 3GDRA 1QOQA 2DU2A 1QR7A 1GVQA 3PBYA 1SO3A 3HG4A 3HG5A 1FWWA 5AFDA 3E9AA 3L2IA 2J88A 1TPDA 5HMSA 5DN1A 3I7SA 1XDMA 3BLIA 3TNOA 4K39A 3G1HA 3RFAA 2G5WA 5DXXA 3IGXA 5D33A 4JICA 4IQLA 4DEFA 4QJ1A 3M44A 1FUYA 3M43A 3YPIA 4K37A 4BWLC 1JR1A 3CLMA 1R47A 4FO4A 2X2GA 5FESA 5D38A 4NJKA 1O60A 1TV8A 2FQIA 3LXAA 5KTLA 3H53A 1TTQA 2ISSA 3OIXA 1LYXA 1JQVA 3TQKA 3G22A 5HNRA 1OFPA 2C18A 4XTDA 4TR9A 1PL9A 2DORA 1NFBA 4Y8FA 5LNVA 2A1YA 5I3JA 2H3DA 3L66A 5CZTA 2DZVA 2QJIA 2Y7FA 3TK7A 3M16A 3FKKA 3B0VC 4AWSA 3P82A 4LVFA 2HS8A 2Y63A 3S0CA 1LOLA 4ADTA 1WOAA 3B0UX 2X16A 3R8RA 2Q8ZA 3PUDA 3MP4A 3ELFA 3IIPA 1OF6A 1LORA 1M7PA 4I7VA 5AHNA 2WOQA 4R33A 1EIXA 2R94A 4A29A 5AHLA 3NQ6A 4JIQA 5KMYA 3UPWA 4EOUA 5F4SA 1FWTA 4XZ9A 3A22A 3INPA 3KOFA 2ZZ3A 2B7OA 5F4XA 3GXNA 3M9YA 1VH7A 1KM0A 5AC7A 1FDZA 4LT9A 4UMAA 4JX6A 3L0GA 2X1RA 2E5DA 4DQWA 1Z41A 5D02A 2ZRVA 3GR7A 4ORIA 4JGDA 3W7IA 3GIYA 2PURA 4JTFA 5U4NA 3QF0A 3MYOA 4NZFA 1ME8A 4AHPA 3NAVA 1QFEA 3LLFA 2NXHA 4AF0A 1ALDA 5I3HA 3G8EA 1M7OA 4G1KA 4WQ6A 1UUMA 3R2GA 1FWRA 2TRSA 2C14A 3EXSA 3G24A 4QIUA 4PFMA 3G0SA 3W7KA 2J24A 3IVUA 1I2NA 1S3HA 2WSRA 3CEPA 3TX9A 4DO4A 2FPYA 3MHGA 1WBHA 3E12A 1BWLA 4WX2A 1FCVA 3GAKA 1GYNA 1ZCOA 2CLHA 1I2OA 4K36A 3S1UA 3TSDA 2J9XA 4PEKA 4GE8A 1LROA 2Y62A 3EXTA 5C6MA 1NVMA 2A5HA 5DXYA 3T78A 2VFEA 4O1AA 3NQ8A 1LRQA 4FNSA 1VS1A 2Z6IA 1Z44A 3C6CA 3NZRA 5G2IA 3W74A 2VFGA 4KWVA 4UR7A 3QQ0A 1ICSA 4UFKA 3MI3A 1KTCA 3O15A 4RX0A 1BEUA 2YZRA 4M6QA 5D2YA 3LV5A 2QJGA 1ZENA 3W76A 1DBTA 5F1UA 2CLOA 5HWMA 1OK4A 1T96A 2A85A 1LZOA 1QWGA 3NG3A 3EXRA 1B9BA 2A21A 2WNQA 1W5OA 2BTMA 2P1FA 2VOMA 4Z0SA 1EX5A 3PS7A 1ZJIA 1OFOA 1AL7A 2EHHA 3W1QA 2H3BA 3RMJA 1N55A 4NX0A 4AHOA 2X1UA 1SFLA 2EAWA 5L6UA 5E0KA 1W5MA 4UTJA 5EYWA 1LBFA 3LBCA 4RR4A 5D09A 1QNVA 2H8ZA 3W71A 1TB3A 1Q3NA 3UWUA 3EX6A 1GVOA 3DXIA 4MZ8A 5FEXA 3QQ1A 1JVNA 3P81A 2NXGA 5F1VA 4KFPA 1SO6A 2OX1A 4O13A 3HGSA 2QCCA 3W87A 4KFOA 1YDOA 4LVDA 1I4NA 3NPUA 2E6YA 3FA5A 3K30A 1TJRA 4R53A 4GUJA 3PC0A 3NQ7A 3THAA 3FS2A 2PRLA 5BRBA 4UTKA 1ME7A 5G1YA 3C3NA 5GVJA 2CLIA 1KM5A 2GJLA 1AW1A 4UFMA 2IQTA 1PV8A 3NM3A 4ONVA 2QCHA 3GKAA 3USBA 3EWYA 3S5YA 4NXKA 3ATYA 3QPYA 2V2DA 1KLYA 3LI1A 3MI6A 1LTDA 3TR2A 1TIMA 4RCXA 1XBXA 3KVLA 1XBYA 4JTGA 4FIQA 3TV8A 1YPFA 2YXGA 3S1WA 2D73A 4HNNA 3GX9A 1KV5A 3C56A 3S9YA 4XKYA 4O28A 2C16A 3FFSA 2BZNA 3I6RA 4JN6A 2CZEA 3NOEA 5D32A 4C1KA 3O1NA 1NF7A 5HJLA 4LUJA 4BI7A 1RVGA 3HPZA 3VKJA 1YXYA 3D0CA 4NVTA 3PG8A 3AO0A 4LOCA 2YW3A 5LZLA 1KM1A 1H61A 5EBUA 3W22A 1ZAHA 2E6FA 3M1ZA 3W1PA 4XTIA 4GUIA 4AF0B 4XWUA 3TQVA 4AMAA 2I9EA 1VLWA 1KFLA 4O54A 5HINA 7TIMA 4UTMA 3W7JA 3W84A 4K6AA 1W3TA 1X6UA 1BKSA 4B5NA 1C8VA 3IGUA 1JUBA 3Q94A 4MKNA 3WJXA 4QNEA 1T99A 3HPSA 2QCEA 1HO1A 3LBMA 3LCHA 4Y96A 5IM51 4ZQNA 1GG0A 4RJEA 4IJBA 2ZTJA 2V5BA 3G8RA 4NJHA 3JR2A 1THFD 2YYTA 3JS3A 1YXDA 1IXNA 2Y85A 1B4EA 1H51A 1TREA 4Y6GA 4K8EA 4MY8A 1DVJA 3E02A 1YDNA 4AXKA 4JNMA 3DFOA 5K2ZA 1LRTA 2JGYA 2C13A 4EIVA 2VKZG 3NXFA 3LI0A 2ZQ0A 4QQ3A 3E0IA 3P7YA 5LNRA 4YCPA 5FEWA 3G1SA 3OBKA 1EUNA 2ZZ4A 4FX7A 3CEUA 1G4SA 2BX7A 2E68A 5LSMA 3PULA 4WD0A 3A24A 2GVJA 3IEBA 1EUAA 3C52A 4BI6A 4CQAA 1O4UA 3L5MA 4CNNA 4KWWA 3TCEA 5EA9A 3TKFA 4JX5A 3TSBA 4LC6A 5D05A 1G67A 4Z1DA 4OBTA 3AJXA 3W7RA 2LLEA 4MOZA 5AC8A 3C2RA 5FF3A 5BOOA 1KFKA 4O50A 1VQTA 1CW2A 1P5BA 3DGRA 3CIWA 3QMTA 3F1QA 5FI8A 3BW2A 4JD4A 1KTBA 3FYPA 4RV8A 4AEOA 3B4UA 3R12A 1G6CA 3TW6A 3QMSA 4HPXA 1MO0A 1XC4A 3GNNA 3LB0A 4O52A 4NX5A 3A23A 2Y6ZA 1XUZA 4LVAA 3MWAA 5CSRA 3GNDA 1G4EA 3TAOA 1B3OA 4ZVJA 4FNPA 5D03A 1I2PA 1PHWA 3PR2A 5I3IA 1SZFA 2A6NA 4ZZ9A 1XI3A 4A2SA 3DKLA 2RDWA 4HKPA 3BW4A 3N14A 4AB4A 2O7QA 1SFJA 3LLDA 3C2EA 1OF8A 5EL1A 3N2MA 2QCDA 1RR2A 2V0TA 3DFTA 4I7UA 5K7JA 2Y89A 3W7HA 5H2ZA 2VC6A 1TTIA 3R89A 3UWWA 2V82A 1Q6OA 4OQVA 3SGZA 1VZWA 3S42A 2QUUA 3NQ2A 1WA3A 3LERA 3S8HA 1XBZA 4OE7A 1GVRA 5DBTA 2ZTKA 3NNTA 4IX2A 1WDWA 1PCWA 3IIXA 3V1PA 3NQCA 1VHNA 1WYIA 3BGGA 6TIMA 1OFEA 5A5WA 2OZ0A 1L6WA 3P5ZA 2CW6A 2DJXA 2CLKA 1H7PA 3LOTA 4O18A 4LWWA 1E51A 4NJJA 4OU1A 1TJPA 3R5EA 4JS3A 3BPWA 1JCLA 3TSMA 3EX3A 4YWIA 1IXQA 2HS6A 3QSTA 1K7XA 4BK9A 4UTUA 1OYAA 2CZDA 1OK6A 5C54A 4JDBA 5IBXA 3HJZA 2CLLA 1S5VA 3QH2A 3TE9A 1KFBA 3IVSA 2V9DA 2Z1BA 4S2CA 1XBVA 1OABA 1SW3A 1ZALA 2VEMA 1JCYA 1FY6A 2VFDA 2Z0IA 3RLUA 4ALDA 3PUOA 1WBJA 3QSRA 2DZPA 3SY5A 2QUVA 2XFWA 1CX9A 1TPH1 4LY8A 3QMRA 3STGA 3L5AA 3BG5A 4R7JA 5AN7A 4N9BA 4UTTC 3LM7A 1AW2A 3UY8A 3MO7A 4HIBA 2Y7GA 3BG9A 4Q4KA 3W2NA 2ZRZA 1KLZA 1O94A 3LX9A 4MY9A 1WOBA 3OVQA 1YTDA 4RZ5A 2A4AA 4LS2A 3T4CA 3W1NA 1K03A 1L9WA 5LNSA 1OFBA 1R30A 4R34A 1H60A 4UNLA 1FQ0A 2EF9A 4MYAA 3U6WA 2CWNA 1YTEA 2VFFA 2OCZA 4QSHA 1TO3A 4DF0A 3WK3A 3UZJA 5KSWA 1ZAJA 4KKXA 3W23A 3SR7A 4O1BA 1CI1A 1OHLA 5FF0A 1ZNNA 3OA3A 2B7NA 3S1XA 1Q45A 1VHCA 4HN4A 3W75A 3GK0A 3N2XA 1DJNA 2PCQA 1W5PA 1OYCA 1AMKA 4JTTA 3W1AA 3UQNA 2ZZ7A 2BWGA 1DORA 3N34A 3B06A 1QMLA 1OX5A 1QPOA 1G69A 4DPPA 5AYYA 5FEZA 2QDHA 3LHYA 5MHBA 2NUWA 3DAQA 2ISVA 3HOJA 3CC1A 1XM3A 4X9SA 4EWND 3VE9A 3B03A 1SW0A 3TUUA 1EP3A 1SZEA 4MIMA 3EWWA 4XBSA 4WOZA 4QM1A 5D37A 1KV8A 3BGJA 3OVPA 2Y7EA 4N6EA 3G3MA 4UFIA 4WZHA 1L6SA 3B04A 2WNNA 4TX9A 3UZ5A 3I7QA 3HPXA 1IF2A 5FEPA 2VEPA 3LV6A 4Q32A 1VCVA 4RZ6A 1TPUA 2WKJA 5HUPA 4N6FA 2UV8G 3U2OA 2CZFA 4UR8A 2QAPA 2JBMA 2OJPA 1UBSA 2A6LA 4EF8A 3CHVA 3UWYA 5H91A 2E5CA 1NSJA 3LTPA 1A5BA 4ORMA 5D2VA 3KFTA 2V81A 2XN2A 3WJYA 4FEZA 5J5RA 2JKPA 2VXNA 2G95A 3HQ1A 1DQWA 1UCWA 3B05A 3NL6A 4NQ1A 3UD6A 4CNOA 1JCXA 1GVFA 4M6PA 1QO5A 3L5LA 3L67A 1WV2A 2QDGA 1AW5A 1LBMA 1VRDA 3W7OA 2TSYA 4HNVA 1B4KA 4X3ZA 1KTNA 1TQXA 5EKYA 3M5YA 4CCDA 2WV8A 3RNDA 4GJ1A 5DBUA 3P60A 1FXPA 2VELA 4O10A 4IXHA 3SZ8A 3JRKA 2ZYFA 3LCLA 4WY0B 1P0KA 1UUOA 3G1VA 1DOSA 5TQLA 3STFA 2FFCA 3LRKA 5A8GA 3M7WA 5AOUA 2C15A 3ZR4A 8TIMA 4A3UA 2NWRA 3MW7A 1YTKA 3S5NA 3HGOA 3MBDA 4QAIA 3LCFA 3DZ1A 1TRDA 2YPIA 1FDJA 3C2OA 1W31A 2EGZA 1Z48A 3MP5A 1SZNA 4GUFA 1F5ZA 2CU0A 4IMCA 3G3DA 1X1ZA 3N19B 1W1ZA 1TPVA 4UTWA 3GDKA 3GDTA 3DKJA 2C0AA 5D2WA 5G2WA 1OFDA 1FDYA 2FDSA 1P4CA 2Y88A 1OYBA 1D9EA 2F7FA 1T8XA 2O7SA 4FXRA 2YYUA 4RKAA 1F6PA 4CQ9A 4H6KA 3C8FA 2FIQA 4E38A 4S1FA 3DU0A 1L2UA 3SECA 3W1XA 3O6YX 2C19A 4ZMGA 4AWUA 3EKLA 5HWNA 1YLVA 4O8RA 3W7NA 2C6QA 3W85A 3NQFA 2VFIA 4YLWA 5SWUA 3QYQA 2NWSA 3LHZA 4PA8A 2PRMA 4POCA 5KZEA 3HG2A 4IMFA 4O4VA 1TCDA 3DHFA
chains in the Genus database with same CATH superfamily
2QKFA 2OX4A 4E3TA 1RHCA 3A3WA 2BGSA 1SJCA 4GG9A 2AL2B 3AHVA 5PTDA 4O53A 2EG7A 1QCWA 3QBUA 2QCNA 3SADA 3W1UA 1VJZA 2WC7A 4ZB5A 1BAGA 1UROA 2Q3RA 2PDNA 2B4GA 1DYSA 3K8KA 4NZ1A 1J5TA 1SR9A 3WNLA 2DEPA 2QULA 4N9EA 4GC4A 1SO4A 2OT0A 1H41A 3OZPA 3RN6A 2NX9A 2NV2A 3GNOA 3UJFA 3V0UA 2QUTA 4P8VA 1PB0A 3XIMA 2ZDRA 4JEQA 3KBMA 3F4CA 3DG3A 2ZRXA 4IZGA 2JKEA 4O4WA 2JGQA 3OIHA 1GOWA 3WUBA 2BMBA 4H8VA 4H04A 1FWAC 1MEWA 5CSUA 3COTA 4BHYA 4MUPA 3S9IA 4GVHA 1O1HA 3QZAA 3QR1A 4Z1BA 5BNKA 4JTHA 2UWFA 2VGIA 1OIMA 5G2HA 2D2OA 3ZOAA 1U83A 3TN5A 4X0VA 1I1WA 3UY7A 1IGSA 3WUGA 1H1ZA 1SO5A 4JFTA 1PTAA 1TPB1 3C3UA 4GZIA 3TFCA 2WMJA 1LQ2A 5JH1A 3UG4A 1JQXA 3R13A 4RXGA 1IR2A 1VBGA 3GG7A 5H1WA 1W0MA 3N6HA 1C91A 4LAZA 2FTYA 3MANA 4NZ4A 1TMLA 1J0HA 1VCFA 3CZ8A 2JIWA 5G5IA 3ABRA 3G1AA 3V75A 3EEZA 5AYXA 1TPFA 3GXIA 2VM8A 4RNIA 3W72A 1DKWA 1HO4A 5F2LA 3T09A 2XGZA 1ADOA 3G1YA 7CGTA 3TQ0A 3NQGA 2HTMA 4TMBA 4YTSA 3WLJA 3GXTA 5ABFB 2PBGA 2EEXA 1JCNA 3FJLA 3GG8A 4HPHA 4K8HA 5DY3A 3S2JA 2VR2A 5E6ZA 1OFQA 5K9XA 2V2CA 4UCFA 1YDVA 4N4QA 4H6RA 3MKKA 4LVBA 1KFJA 2VR4A 4LF2A 5LIUX 5CPMA 1F7BA 3UF9A 1IHIA 1ZP3A 4L6DA 3FKRA 4CQ8A 2GUUA 3C86A 3R0DA 2YA2A 3VC5A 2B81A 4YMZA 3B8DA 4CNPA 4N9DA 4Z2JA 4TVUA 4DVOA 3LTYA 4I6KA 1G7VA 4O1DA 3O3RA 3VM5A 3KCOA 4IFRA 4N02A 1TV2A 4EP8C 4WOQA 3KOWA 3BAYA 1LLWA 3HV8A 3KTSA 2VI0A 1UZ4A 4NNCA 3SGUA 1RV8A 3CBWA 3DOPA 1TG7A 1QPNA 4XD6A 3QXBA 3SI9A 1UD8A 2NV9A 1V7YA 1Y0EA 1D8CA 1HFBA 3BQ5A 1K8CA 4KCVA 4A3YA 3FDKA 3HTWA 1N7KA 3WNNA 3WLRA 3SRDA 3BOLA 3L4XA 2P8CA 5EMLA 4UOZA 5I24A 3CWHA 3NSNA 2QYGA 3QYSA 4ML4A 2RDTA 1G7UA 1EQCA 4O1CA 1XD1A 1SW7A 5A6SA 1IIGA 4JKKA 1PKNA 3BICA 1PKYA 4XKYB 4WKFA 4LCSA 5CLWA 1DTUA 3QC3A 3PB2A 3FCPA 3ABZA 4KRTA 3PBMA 3STCA 3UJSA 4CGTA 1VFHA 4PCPA 4ZQMA 3GNRA 5LXEA 1PEZA 2Z29A 4DJFC 3LDVA 5A2AA 3TJLA 1AJ0A 4W89A 4R9XA 3NEVA 4V15A 4O15A 3WSUA 2DPEA 1JGIA 1XQLA 1NWTA 3W2MA 2XWDA 4AZCA 4QJ5B 4D8ZA 4KRUA 3G0XA 3NM1A 4LJ3A 3AIWA 4FR6A 1C92A 4REQA 4TU1A 1VFLA 3PAJA 1A5NC 2PI6A 2BLEA 4GUGA 1J2WA 3QV9A 1M6JA 2V68A 2Q71A 3QOKA 3MYPA 1R87A 3P0WA 4GCAA 1ICPA 5A2CA 5AHEA 3O6DA 2F6UA 3PB0A 2DZWA 2IQDA 2NVCA 1GVEA 1WQ5A 4ZXLA 3NVTA 3V5OA 1S38A 3L2LA 1D3GA 4KS0A 4TTUA 3L0KA 4NJIA 5H8MA 2HVMA 2NUXA 4NXSA 1TWDA 3MI2A 5DELA 2W6RA 1B1YA 1P7TB 2PE4A 4FNUA 3TCSA 3V36A 3UWVA 4MZ1A 2E1DA 4N4PA 1PIGA 1YHTA 4UQBA 1RLCL 3FIGA 3O6CA 1XIDA 2UY4A 4AZGA 4A8NA 4P7RA 3R6IA 2DVUA 1QPRA 4GOAA 4PZVA 1OX4B 4WKHA 3WJSA 5LNWA 2DDXA 1CXIA 5FAGA 1X38A 3SRFA 4BWLA 2QCFA 4LCRA 3LMZA 3TFXA 3W2JA 2OSYA 2ZICA 2BP1A 2QV5A 2V8ZA 3PSVA 4FS9A 1UKTA 2HK0A 4KETA 1H62A 4PCTA 1XSKA 3CM4A 5HXMA 2I5QA 3VK5A 4NZCA 3L7RA 3LHTA 5C7HA 3HB9A 1BRLB 2PTDA 2ICSA 1ADSA 4PE8A 3NO5A 3NXLA 1TVLA 2XIJA 3NGJA 3QFEA 4OBRA 2INFA 3VE7A 3BVJA 3UG5A 2G3FA 1TR1A 4GZJA 5D9OA 3BW3A 3OHIA 4WF7A 1OG0A 4UTIA 1H5YA 2QJHA 1K02A 3M47A 1V0NA 3WY1A 3GVQA 4LV4A 2NQJA 2OTDA 4PB5A 3W2LA 1GPFA 1GHSA 1OGBA 1YX1A 3KCLA 3NL5A 3SIZA 1UQYA 2ZA2A 1JDAA 4PH6A 1REQA 3VGHA 3CMFA 1J6OA 2I14A 4HYWA 3GO2A 3NPWA 3R0UA 2G41A 3VGBA 1Y5XA 1M03A 4TUFA 4H6QA 1J2BA 3RR4A 4Y90A 3VCNA 4E4UA 4UBPC 2C8NA 1VJIA 4J35A 1O95A 4G2DA 1EWDA 3W2KA 1GKQA 4PTXA 4U10A 4RUBA 4AH7A 1A3HA 3P14A 1DHPA 3C4UA 3IJQA 5C9ZA 2WPGA 3GG1A 3UETA 1H7RA 3WL1A 4O17A 4UTLA 5EMUA 3N9SA 3EOEA 1RY0A 3GC4A 1VYSX 2RDUA 4E5TA 3J7HA 1PPIA 3PZOA 1O68A 4X22A 3KLLA 3T0BA 3MP3A 1H63A 2E77A 1A0CA 5DY2A 5C5YA 2X1TA 3KRBA 4H9XA 1HVQA 1VAHA 2PLMA 2AKZA 4JX4A 4OJYA 3Q45A 1KM6A 4ZE4A 2E25A 2J47A 4DF2A 3GFYA 3OB8A 4C1LA 3EOOA 1T7LA 3IANA 4Y9NA 5C0QA 3NZ1A 1LM1A 3MY9A 5CPSA 1J9YA 2XUCA 3W6YA 3OVGA 3GXPA 3SUUA 5I3DA 4PMVA 1RA5A 4J2MA 1B57A 1MQQA 2Y70A 3UCQA 3EA2A 1H09A 4KIEA 3JW7A 1JNEA 1AL8A 5EMMA 1YPXA 4PCFA 2Y8KA 3C61A 3KHJA 3E96A 3QJAA 4JBRA 4OOUA 1W3JA 3MCMA 1XISA 3C0QA 4DX3A 2O9RA 3ATZA 3B8IA 1HKVA 3GAYA 1JAEA 4Z1AA 3HGRA 2O92A 3U4AA 1ZBVA 3GZAA 2GQ8A 1EX1A 4IP7A 3T9PA 4GUHA 1QTWA 4ZXOA 2OMAA 3SCTA 1CBGA 2GK1B 3LCIA 1G4PA 3TH6A 3S5OA 3I68A 4A3HA 3F4NA 3RPTA 1ONWA 1YXCA 2YDRA 2FZBA 3LG3A 3MUXA 3PNZA 4ICNA 4AW7A 4DY1A 3KVMA 5JVLA 1WXJA 1GCYA 1XYZA 3A9IA 3AYSA 2V3GA 2WPBA 3EA1A 5E1QA 1MWOA 4IFOA 3LTSA 4HMEA 4WGHA 1TVNA 2DZBA 4MNKA 1P0NA 3BCDA 4YVVA 1UR1A 2FH8A 3A21A 1XKYA 1ONEA 3HMJG 4V1XA 3TZNA 2UY5A 5M3WA 3MC5A 1DQXA 4A21A 1RUSA 3CHCA 4L6OA 2A7PA 3TOYA 3OG3A 3PBWA 3GG0A 5HK4A 3H2OA 2NV1A 3W73A 3OYXA 4UTHA 2TPSA 2PGEA 3KRZA 1JUKA 2Y2WA 4NSBA 1EJVC 4U3CA 4PN2A 3UR5A 3WK2A 2D3NA 3DFYA 2E6AA 4IIFA 4AXNA 1JYNA 3QFWA 3P84A 1EP1A 2FTPA 3O06A 3RRAA 1S5NA 4JDYA 3CIXA 5IHRA 1W1A1 2AKMA 3B8TA 3BLEA 4JPGA 1GOIA 2R91A 4NU7A 2OEKA 3PUEA 3TAKA 3BOFA 4ZODA 5CPOA 3BARA 4H8NA 4J3ZA 3H7UA 2EPKX 2J6XA 1RCQA 4LB3A 1MW0A 4AIBA 2FH6A 5I3FA 1WX0A 3CWOX 2XN1A 3GWQA 1GJPA 4DUVA 1NELA 3WMBA 2FLIA 4XIAA 1R7OA 3CZLA 3T8QA 1AODA 2FGZA 1OC5A 1ZBWA 3IJDA 2PPGA 2PDUA 3M4HA 4R7OA 4H2HA 1RD5A 3LCXA 2H9AB 5ENLA 2X7VA 3UXDA 1P1XA 4LUTB 5FJJA 3T05A 2EKCA 5CZ0A 3VI2A 4OUEA 3UW6A 4HZ8A 1F05A 2YFNA 1EJTC 4FMVA 5AC6A 3UT0A 4CD6A 3Q37A 3TYUA 3VCRA 3EX4A 3L68A 1C29A 2J7DA 5A8PA 3RLGA 5CPLA 3BSGA 1ITXA 4KGLA 2RUSA 1EJRC 4JY8A 1DJIA 4D8AA 2B7QA 4IX0A 4FNTA 3ZLHA 4ERAA 2RDXA 1EYEA 2CERA 3WG6A 1KA9F 5CZSA 3W88A 4B2DA 1QI4A 1JPDX 2VVSA 2WSQA 1W56A 3EKZA 3FY1A 3CZEA 2ZFAA 1RPXA 3IIZA 5BZAA 2PDCA 1JDEA 1K8YA 4LNYA 4ZOEA 4NZ3A 2C1HA 2TODA 4LRSA 4U31A 4LW7A 1WKDA 1WP6A 5TD4A 3TYDA 4PEEA 3WQDA 4UNIA 4Z1CA 1R0MA 4FSAA 3MUCA 3AWNA 4KGJA 3AIBA 3T1GA 2OLHA 4QROA 5KITA 3W7DA 1O5XA 1TMHA 3OGRA 4JKLA 2OQYA 1QR7A 2CIPA 3OO2A 2WM0A 2DT3A 3TZFA 3RXZA 1EGVA 4JAWA 5FOOA 3TNOA 3G1HA 2ZXBA 1R3WA 1JD7A 1FHVA 4ZO9A 3ARZA 1WDDA 3VNKA 3D6NA 3M43A 1UIPA 1XR2A 1E4LA 4QS6A 5D38A 4NJKA 5CEWA 3LXAA 2V6AA 2BGQA 5KTLA 5JQ9A 1TTQA 3APTA 4GYFA 2QLYA 3HQNA 1LYXA 3TQKA 3VDHA 3WLQA 1AH0A 2OZ3A 4Y8FA 2A1YA 4QQUA 1K4GA 2R82A 2H3DA 3WUFA 2YZ5A 4ZOBA 1S1RA 3TK7A 4YTUA 4HB7A 3H7RA 3F7JA 3P82A 2HS8A 2Y63A 2HZGA 3KBVA 1V02A 1A4MA 4AIUA 1XRFA 1B9ZA 1BKHA 1E55A 3PUDA 3G1RA 1M04A 4G9PA 4I7VA 8RUCA 3OODA 4A6GA 1EIXA 8A3HA 1E1EA 2YXOA 1U1JA 7TAAA 3UPWA 4MMWA 1MXGA 1OCBA 2I9UA 1FWTA 1YBQB 2ZXDA 1WKEA 3A22A 2B7OA 3GXNA 4MWAD 2DQXA 3UYIA 1VH7A 1CXEA 3N29A 1NP0A 3U2EA 4XSMA 2E5DA 2EXOA 5AYIA 2PDIA 3W7IA 5KEZA 3GUGA 4J4KA 4DUWA 4AHPA 3NAVA 3FA3A 5I3HA 3G8EA 4WQ6A 5M17A 2ONEA 2BY0A 7PTDA 3M0XA 2C14A 2QUMA 1XYFA 1A0EA 3W7KA 5JH2A 2J24A 1NJJA 1AVAA 4CVWA 4ASTA 4S3GA 1XYMA 4QGCA 1HJWA 4WX2A 4R85A 3GAKA 3THCA 4K36A 2HEJA 4Q4MA 1PXGA 1XLIA 1XPYA 2EG6A 4ICMA 3EXTA 1NVMA 3USZA 4Y9OA 1TMQA 2BVTA 5ABHA 3NCOA 1VS1A 4QP0A 4HNOA 3NZRA 1ENUA 2BODX 2VFGA 3QQ0A 3MI3A 4BQ4A 2GDQA 1ITUA 2YZRA 3TLQA 4M6QA 1ZENA 4JTDA 4V1YA 1ECQA 2ZIDA 1A3XA 5F1UA 2OGJA 3URAA 5ABFA 1S39A 1B3WA 2WQDA 5IXEA 1T96A 2A85A 1WXYA 3N2TA 5D8WA 2HK1A 3EXRA 1B9BA 1W5OA 3VUPA 2GGIA 3PS7A 3GY1A 1ZJIA 4NY2A 4M29A 2PDKA 3W1QA 4I9JA 1N55A 1HGYA 4NX0A 1XLDA 3UR8A 1P0EA 1M7XA 3CH9A 4CNSA 3E5BA 1US0A 3S1GA 1GZ1A 1XKJA 4NIRA 3VILA 1NM9A 3PUGA 3VKKA 4I5RA 4QXIA 4B3KA 1EF2A 3EX6A 1HXJA 3DXIA 2Z00A 5FEXA 2NQ9A 3AHXA 3P81A 2JF6A 2AMXA 2QS8A 3ZJ8A 5F1VA 1V3IA 4BQ2A 1YDOA 1A5KC 1I4NA 3NPUA 3TW9A 1VBJA 4GUJA 4GBDA 4LY4A 4UTKA 1ME7A 4Q8UA 5GVJA 2QT3A 1XLEA 4P7QA 2IQTA 1PV8A 2D69A 3NM3A 1YIXA 1RPKA 2DW6A 3RCMA 3VINA 2REQA 1V6XA 4Z42C 4ZFCA 3BWWA 4PMZA 2V2DA 4Q4OA 3WFLA 2V3EA 2ZX8A 1L8NA 3EWDA 1VKFA 3IJLA 1LTDA 3TR2A 3GYCA 2DZAA 4RCXA 1XBXA 3KVLA 5DT7A 5A6JA 3WIJA 4AMCA 4WK9A 4FIQA 1YPFA 2YXGA 3URBA 1XIMA 1R9YA 2VX7A 3PTKA 4XKYA 4E2OA 6XIMA 1XIEA 2D0HA 2GL5A 2C16A 3WKZA 3I6RA 4JN6A 2CZEA 1OZMA 1W1IE 1NF7A 1QPKA 1TJ1A 2R24A 1YXYA 1ZU8A 2PTWA 2YW3A 1B54A 3SB0A 2E6FA 4ZENA 1AMYA 4GUIA 4AF0B 4AMAA 3SQLA 4GINA 3TEVA 4KF1A 2DSVA 3W84A 4K6AA 1W3TA 2HNHA 3QTGA 1XLBA 4BQ5A 3PWGA 4XV0A 4J3UA 1LL7A 3E3HA 3RITA 3LBMA 3LCHA 1KC7A 1UG6A 1SGJA 4L61A 3WNKA 3URNA 3G5EA 1F4HA 5A6KA 2HISA 2OG9A 1H51A 4MNMA 4OVXA 2IW0A 3APYA 3DFOA 2J74A 4GYPA 1HN1A 4Q8TA 1UH4A 4OBSA 2F2KA 2ZQ0A 3B0YA 5AC5A 1ZZMA 1FHLA 4MWAE 3WLIA 3G1SA 3OBKA 3ZXWA 2ZZ4A 3CEUA 5LSMA 3A24A 1YNYA 2GVJA 3MVTA 3PJTA 4GC3A 1O4UA 2WM1A 1ZRQA 5A6AA 2XHYA 1JDDA 2G0WA 3TSBA 4LC6A 5D05A 2LLEA 4MOZA 4I5UA 4XD5A 5FF3A 1J11A 4W7WA 4O50A 4QR6A 2W92A 1JD9A 1VQTA 1QHZA 2CKRA 1P5BA 1WDPA 4FA3A 5FI8A 4JD4A 4AEOA 2VX6A 2GSHA 3WNPA 3PP7A 3PZVA 3R12A 3V5CA 3TW6A 3VIIA 4F0LA 2O9OA 1XC4A 3GNNA 4O52A 4RE3A 4R27A 4LVAA 2R9RA 2P53A 3GNDA 3R58A 4KT2A 4NL1A 3PR2A 3JZUA 3LM3A 4BY3A 3U4FA 3DKLA 2Z4GA 4PB3A 1SFTA 4AB4A 4W86A 1BRLA 2FZDA 2PLJA 5EL1A 3N2MA 3DFTA 4M81A 9CGTA 1J0JA 1PDYA 3PANA 1UR3M 1K6AA 3SM0A 4DWSC 4DYEA 4E4FA 2SFPA 2J75A 2OPJA 2QQ6A 3S8HA 2VCAA 2ZTKA 4DIAA 3SURA 4XB3A 1WDWA 3MV01 1QU4A 4C6BA 5HJXA 2XH4A 1F07A 1QNQA 2NLYA 6TIMA 3ZT5A 4L7ZA 4HOZA 2OZ0A 4AZ5A 4XAFA 1HW6A 2HBVA 4HCLA 4C6FA 4NJJA 3R5EA 3H8AA 1G9HA 3N18A 5HQLA 1K70A 4B91A 3WMSA 4GXPA 4JEJA 3THUA 1IXQA 1QI2A 1IWBA 2ON3A 1VFOA 5C54A 4JDBA 5IBXA 3WH6A 2Z1BA 1KXTA 2J8FA 1FY6A 1GVIA 1M1BA 4AYSA 1XIJA 2CITA 4JQAA 5CC6A 3STGA 4HP5A 2J8TA 1DIKA 1DWAM 2ZWYA 4C7FA 4Q4KA 1KLZA 3NGFA 3GRIA 4LS2A 3W1NA 1V08A 1K03A 1GK8A 4UNLA 4HZ6A 1CYGA 2WW5A 3ARWA 4KWOA 2J7FA 1JXJA 3CQKA 1BVZA 3UZJA 3CASA 3W23A 1SZRA 4AX6A 4O1BA 2BGNE 4CUCA 2PWDA 5BXSA 3N2XA 4JTTA 4JCLA 1DJNA 2Y4SA 2F6XA 1J0KA 4XKMA 1CWYA 4YN5A 4DPPA 5AYYA 5FEZA 3CZJA 4J3WA 1UJQA 1I6NA 7A3HA 3SN0A 4MPKA 3L4TA 3CC1A 1ZBCA 1XM3A 4G7EB 4X9SA 4EWND 1SW0A 2PWFA 4MIMA 4C6PA 1KBKA 1D8WA 4QM1A 1KV8A 5HJYA 2E67A 3BGJA 4R7WA 3AHTA 2Y7EA 4UFIA 2J7BA 4WZHA 3B04A 3EB3A 4TX9A 1GUVA 4W84A 5AECA 4JHOA 3HPXA 1D2KA 5FEPA 3LV6A 1TPUA 4K1GA 5HUPA 2UV8G 4Z2HA 2CZFA 4UR8A 1S5MA 1CGWA 5AKQA 2A6LA 1ADDA 2E5CA 1NSJA 4F3HA 4ZR8A 1R5YA 1S2UA 5E0FA 1LUCB 3FW6A 5EFFA 1E15A 3MSDA 5F7UA 1UCWA 2ZX6A 1J12A 4CNOA 1T5AA 1V6VA 3L67A 4FLRA 1LBMA 1K1DA 3LNPA 2JEQA 5T9BG 4D6FA 1TQXA 3S3GA 3M5YA 3RNDA 2UZ9A 4HA1A 4C6QA 2VELA 4C7DA 9XIMA 3OZOA 3ZT7A 2ZYFA 1P0KA 1ZJAA 3R0KA 3GNPA 1VBRA 1CLXA 4JFWA 5TQLA 3DYOA 1EXBA 4FALA 2FFCA 3LRKA 5A8GA 3FEQA 3Q65A 6XIAA 3APGA 2BY3A 1E71M 2PC8A 2HVNA 3S5NA 3MBDA 3KS6A 3C2OA 4LPCA 4XISA 4F79A 1E9IA 2EGZA 1OZQA 3FV9A 4H9YA 1DP0A 3K4WA 4PYSA 5GNYA 3G3DA 3FK4A 2NT1A 3PZTA 1P4CA 4JHMA 1PYMA 3U2ZA 4HOXA 1KKOA 2I5IA 4MNJA 1T8XA 2YYUA 3T6CA 4CQ9A 4H6KA 1FH9A 4E38A 3KZSA 1MRQA 3DU0A 1KFWA 3VZXA 3W1XA 1LL6A 4LAKA 2X0SA 4JNYA 5HMEA 3D47A 3I3BA 4TVCA 1CT5A 4DLFA 2PZNA 2IPWA 3LHZA 1YW1A 3CPUA 3S2CA 4POCA 4UB9A 4IMFA 4CQCA 1NQKA 5G1TA 3ABOA 3GVVA 3AS1A 1J01A 1VYRA 1MFVA 1R46A 1LT7A 3GC2A 4C6IA 3BJSA 3ZS4A 4NUWA 5DEZA 5K9CA 4IJCA 3DBPA 1TVPA 4UWMA 1S2TA 4Q33A 1W5QA 3P0XA 3PY2A 1BWKA 2DZTA 3CWNA 2Y61A 4M8UA 2QZRA 4IGNA 3SCRA 4DBEA 5LGXA 4LAOA 3BAKA 3WQOA 1OIFA 1VFUA 1XGEA 2H9AA 3FHQA 2IXUA 1V79A 4IPPA 4I7WA 2WZIA 4FNQA 1I2RA 3IWPA 2HPMA 3NR0A 1CGXA 4D1IA 4PTDA 5C55A 4MADA 4GIAA 2YSWA 3WLNA 3RPDA 2YA1A 1PWMA 2G50A 3UEQA 1M5WA 3ONBA 1V6WA 2WHKA 1VIZA 1QO2A 3WH9A 1M3UA 4U4MA 5JMUA 3UXLA 4IQDA 1F74A 1ICQA 4JTIA 5CPQA 4ZGYA 1V3HA 3MZ2A 3UG8A 3HF3A 4JTCA 2XN0A 1R3YA 1LLOA 4KEUA 1FVPA 1IEVA 5BU9A 3TJ4A 5CSYA 3Q4DA 3QW4B 2PTYA 2WCAA 5FJPA 4ZE5A 3NYZA 2DP3A 4QNWA 1IZCA 1VEOA 4E6MA 2EO7A 1UR2A 4MAZA 4NAEB 3SDOA 2FYMA 4ZOCA 1S1PA 5CKSA 1B30A 3C0JA 2WVVB 2CLPA 1OG6A 4CLMA 3DI0A 2BG5A 3LCWA 2GGJA 3T44A 3KRSA 1NDYA 4W5UA 5HAOA 3GBDA 5CAKA 2PLCA 5C9RA 2L5HA 2BOEX 3N04A 2IKJA 4MLRA 5FIPA 3EB4A 4FHAA 3G1XA 4I8YA 2WJZA 4LS1A 4JTKA 2BSLA 3L9CA 1NDVA 4IL2A 3WELA 1FH8A 4ATLA 5I3GA 3NPXA 7ENLA 4XZBA 1DHKA 1UOZA 3CQIA 4LAUA 3AHZA 5CQ1A 2J7CA 5FF4A 1Q7QA 2DZXA 4IUOA 4W8AA 1P0DA 4ECLA 4ZQOA 3VZYA 2BVYA 2Z7GA 4XG1A 3NSXA 1KM3A 1C9WA 1DL3A 3WQFA 3GFZA 4LUSA 1LDCA 3SFKA 1LWIA 3NSMA 3KW3A 4YWSA 3GYEA 3MUZ1 2X30A 3A5FA 4OIFA 2EPHA 4JQ4A 2FPVA 2NQHA 4F0KA 2VQTA 3ZJ6A 1FCQA 2V30A 4AQLA 5LIKX 5AVHA 3IJ7A 3N1AA 2PUZA 4JIRA 5D04C 4ES4A 1EGZA 5A69A 4HGXA 2WLYA 1A5UA 3LZ3A 3O16A 4H7ZA 3A47A 4B5WA 3TWBA 4GISA 2HDJA 1V7AA 4M7SA 3TVAA 4TMCA 1F2JA 1QJWA 1VR6A 1UASA 1JCMP 1YBQA 3NQMA 2OZTA 1QK2A 5A8NA 2ZE3A 1CB2A 2YR1A 1FP9A 2Z27A 4W8LA 4GZEA 1E0TA 3ZSSA 2O55A 3R79A 3PZ9A 5EBAA 1KRBC 4XBKA 4K8GA 2CYGA 1PX4A 3Q58A 3DFSA 4ATWA 4FB7A 2ZADA 2V5DA 2GJNA 1W17A 3TONA 4YU1A 2BY2A 3DG6A 1BVNP 2WXDM 3VFLA 3ZSTA 4H01A 1DJXA 4RLIA 4GBUA 4QG6A 4DXKA 5HR7A 4US5A 4M56A 3W1TA 3U2CA 3QR3A 3VOCA 1LBLA 5FJOA 3AXIA 3W86A 2ATSA 2BASA 1LJYA 3M46A 1BD0A 4IICA 1KBIA 2FMNA 5KZMA 1I8JA 1EJSC 1K8ZA 1EWEA 4LC8A 4GQQA 4QE1A 4QJ3B 2J7HA 3A5VA 1J6PA 3QGVA 2ASHA 5G4EA 3I3EA 3H6OA 3NDZA 3W1LA 3ABQA 1QPQA 3LZ5A 4WR3A 5LHFA 3W28A 1EL3A 1DWJM 3O05A 4QG8A 1EXPA 3JZEA 3PPCA 2C0HA 2WMKA 4JTJA 5G4WA 1ZQ5A 4AEEA 3RM8A 1X39A 2ZZ2A 1KXVA 1MUWA 4A05A 1Z8AA 4IGHA 3GLCA 1POKA 2P3ZA 4O1EA 4ZA0A 3ZR5A 4WSJA 3CZKA 2E8ZA 2ZCGA 4HNTA 1KBJA 5HA7A 4NNBA 3DIPA 1WO2A 1F4AA 3SY1A 4HYRA 3H7VA 4H9VA 3ARRA 6CGTA 1S46A 4MY1A 4XZNX 1XCXA 1VF8A 3T2OA 3G0UA 3OEXA 3MA8A 5K3VA 1V3MA 1VYPX 3LU2A 3VIFA 3B40A 4QEHA 4AFYA 1Z9AA 3U5YA 1OVDA 1QK0A 3XINA 2NQ5A 2X1IA 2RFGA 4AAJA 3AOFA 3U57A 1O66A 3POCA 2OWWA 3F2DA 1EQPA 1YADA 1EZ2A 1ZS2A 1XGDA 4ZB0A 4PMUA 3GR8A 4K7VA 4P61A 1PBGA 2FZ9A 4HNUA 1E6XM 2J13A 4LBUA 4GQBA 2ZUTA 3KTCA 3VDAA 4HHMA 2JE8A 2ZVRA 1P6BA 2FTWA 1W1B1 2YOCA 4GI6A 3WDQA 3F03K 1J4EA 3DERA 5IDIA 2X1SA 3W9ZA 4C6JA 4FNRA 4JIEA 4DBWA 4YYFA 3FXGA 1LOQA 4R88A 4BI5A 3EPOA 3G6MA 1UW9A 3G1FA 1VIWA 4F2TA 5BRPA 4WHBA 5CGMA 2WZMA 1SYTA 3WEOA 5A94A 2CLFA 2YL5A 1MZHA 4H19A 5HR6A 4QJ4B 3FX4A 4W7VA 1K9EA 1E6QM 1Q8AA 2XVKA 4EXBA 3C5QA 4Q4SA 4O14A 3VMPA 3DHUA 1OCJA 4HSHA 1C7TA 4DO6A 1VEMA 4UTWC 2BXYA 5ABEA 2Z2BA 3H2EA 1PUDA 4D9PA 2YCEA 5A6BD 1TV5A 1KRCC 3AS0A 1HF6A 3DG7A 3HU7A 2YL8A 3C2YA 2DIJA 3NA8A 3GH7A 1NOFA 3QQWA 3BC9A 3F4VA 2WCGA 3MKCA 4IIBA 4AZCB 4D6IA 4C90A 1BXCA 3BDKA 1QBAA 4Q6XA 4F4RA 4RZBA 1S5TA 1GZJA 2VURA 1ITQA 4B5TA 4CQBA 4W4QA 1K8XA 2YDSA 1OADA 3NVDA 4IH3A 3F4WA 1K7FA 2Z7KA 4WY0F 1LRNA 4WLCA 2WSPA 4MUZA 4PULA 5JBFA 2VTFA 1F61A 3EWUA 1HL2A 2OGYA 2QPSA 4PMJA 3M5XA 4AC7C 2E40A 3LSCA 1GJUA 2KAUC 4IMAA 1KQYA 5D4YA 1WCGA 3W7PA 4F0RA 1BYAA 3OA5A 1OT2A 2VO5A 3B97A 1R8LA 2JK2A 1E6RA 3B8UA 4PUDA 2ZZ1A 3H55A 1I2QA 1E43A 1EYWA 4GGHA 4WDUA 3LHUA 1KFEA 1DJWA 2A2IA 3EEGA 4D6JA 5BXTA 3BG3A 4HNLA 4MWAB 2V67A 2WQPA 1OFAA 2NLIA 3UNTA 1ZJBA 1OX6A 3LHVA 2P76A 2G3MA 3CAVA 1OC6A 3T7VA 1JCTA 1J5SA 3ALFA 3QEZA 4JTLA 4GX8A 1UR8A 3WEMA 4M6VA 5EPDA 1EEPA 1DWHM 1EO7A 2PWGA 1PZ2A 1KQZA 2BHUA 3WBWA 3WLHA 1BGGA 3DFNA 2G3NA 1YE4A 1TX0A 2ABAA 1A5AA 4Q8QA 4J3TA 3IIVA 4O57A 1DE5A 4OUIA 2V2HA 1XLCA 1CTNA 3VD5A 2J62A 4QLJA 3C2VA 1F9CA 1UJPA 2VZTA 2VYOA 2AGTA 3GTXA 2W0UA 3ZJKA 4FXJA 1R2RA 1LLZA 1PE1A 3P74A 4PSRA 3T81A 2VDHA 5E70A 3W83A 4X61A 4WXZA 2PRHA 4LTSA 2QW5A 3RAOA 3U9IA 5CC5A 3MV11 4O0KA 1GZGA 2CLMA 3GXDA 1TTPA 3D5HA 5LYRA 4DHGA 2DVXA 1PYFA 3AU2A 3B9DA 4HQVA 4DJDA 2WMHA 1EA0A 5E93A 5I3KA 2ZZ5A 4DM1A 3AALA 4IIHA 2VEGA 1MSSA 4FX6M 5T9CE 1IIHA 1XFBA 4F66A 1KFCA 1KM2A 3GZ3A 3PM6A 1DE6A 5CSSA 2NVAA 3CV6A 3QTPA 4LVGA 3OQ8A 4OGZA 2PSNA 3VNDA 1UPMB 3WFAA 2OR2A 4S3FA 1TV7A 2QCLA 2INEA 2R1LA 4XBJA 1E0WA 2OWXA 1NWSA 5DCDA 2VL4A 3K4AA 3HGJA 2JFEX 3VD4A 1RXOB 1XWYA 1UD5A 2VMFA 3SSJA 1EC9A 4UMCA 5C2XA 1BFNA 1W37A 3P67A 1GOQA 1PTDA 4BF5A 4Q7NA 5FL0A 3DI1A 1XUUA 3NUKA 3RRXA 3BH4A 3C2FA 1NOUA 1J10A 4DLMA 3NL2A 3VD7A 1H1NA 1U30A 3NQVA 1T0OA 3ANUA 1GT8A 3OYZA 4AUBA 2QMKA 2J78A 1NP2A 1GORA 3TW7A 2Q8XA 1YQ2A 1TPEA 2NX3A 3LPFA 2CZ5A 3UZWA 4IQEA 1PCKA 2DZUA 3G1DA 2DFAA 2X41A 3FYOA 3FGCB 2BBFA 3K8MA 1DIEA 4KPLA 4W88A 5K4XA 4MFEA 1EO5A 1PJ9A 2DZSA 1UPPA 4DXVA 4WCJA 2GJXA 2R6OA 4J7RA 4PMDA 4FIRA 1FHDA 1P0BA 1W9DM 4BR1A 3S6DA 2Q3OA 3DGBA 4PUJA 4N9CA 4LU0A 2OT1A 4DZ5A 4G7EA 4IMGA 1IXPA 1EH9A 1H7OA 3GQYA 1KD0A 3TMLA 3M41A 3QLLA 1A5CA 1PHQA 5F4WA 4EANA 3W1MA 1W1VA 4AEFA 5LHEA 3AIEA 2VT0A 1NF0A 4D72A 2CHRA 5IOBA 4NG3A 3UWZA 3E2QA 3CUZA 1E72M 1TWSA 3WF0A 4J1OA 3PPHA 4EKJA 1KB3A 1CGTA 3ONCA 3W4RA 2R1KA 1XL9A 5AZ1A 3MCNA 1W3HA 3GHUA 2W4XA 3O63A 1MUCA 3QM3A 2FB2A 2WZHA 3PWAA 4H2CA 3TN6A 3T07A 2OXNA 1FKXA 3EX1A 1KGUA 1JULA 1YE6A 1YMYA 3DFPA 2V3DA 3W25A 3E6EA 3K1GA 4LBSA 5IBXC 4YTRA 3WLMA 3WDIA 4HZ7A 3UP8A 4HCHA 2E9MA 2CHNA 2E09A 1G4TA 3PTQA 1XCWA 4QITA 3A4JA 4AD1A 1H11A 3WLPA 5B80A 1S5WA 1MMFA 2ZUWA 1H1YA 1TWWA 2CNCA 5CXPA 4AHQA 1ZPTA 1A5LC 3FOKA 4ACZB 3GE7A 3SJNA 4H83A 4JR5A 2XIQA 2V5JA 5HULA 3N73A 3ZM8A 4GY1A 3AMGA 1OD8A 4AWEA 2V69A 3AC0A 4B3ZA 5FF7A 2VEKA 4U5KA 3EOUA 4KEMA 2I56A 3QV8A 1QHPA 3NFUA 1JZ8A 2CBJA 3KBJA 3TXZA 3O9NA 1GHRA 4ZCWA 3PBYA 4E8CA 2J88A 3I7SA 4E3VA 3RFAA 2G5WA 1DJHA 5DXXA 5DFAA 4URIA 4QJ1A 1JR1A 2X2GA 4QEEA 4LAMA 1E73M 4RPQA 2FQIA 4G8TA 4JTAA 3N12A 1SMAA 2R1NA 3UGVA 1E0VA 3M0MA 3GIPA 1JQVA 3CK5A 3GBEA 3N4EA 3G22A 3PJUA 4PMQA 2HNEA 2Y8UA 2C18A 3GDBA 2D2HA 2VUNA 5I02A 4MKVA 2P8BA 4EPEC 3POHA 3WYZA 1AQ0A 4AZ7A 2GWNA 4L80A 3ITVA 5CZTA 1Q7MA 2DZVA 2QJIA 3WLKX 3M16A 1RBAA 3UZZA 1KR1A 1V0KA 3T4WA 5DRIA 4W87A 4W85A 4LNCA 1E0XA 1XHGA 3VUSA 3B9OA 2X16A 3L12A 3R8RA 3MP4A 3NURA 3ELFA 3IIPA 3BJTA 1T8QA 1U1UA 3R7MA 4YVXA 1Q7ZA 2WOQA 4Y2WA 1UP2A 2WZTA 4XK2A 2OOGA 4JIQA 1L8PA 3N3TA 4EOUA 1S2VA 1G5AA 3SCUA 2FVLA 3INPA 4G56A 1GW9A 3DEQA 4GI9A 1TE1A 1Q6EA 2PDLA 2V38A 1FDZA 1JF6A 4L4PA 3KWXA 1UBPC 4QX4A 5C2GA 1PWLA 2ZOXA 4G7FA 3U7VA 2ZRVA 4OKDA 3CO8A 2PURA 3IS4A 4JTFA 3QF0A 3VDGA 1RVKA 1JG9A 4NZFA 4CEUC 4RE4A 1ME8A 4Q8NA 1QFEA 3LLFA 2JQXA 3IAQA 4A35A 1ALDA 4DZHA 1M7OA 4N0RA 4JCMA 2D3LA 3CQJA 2WAGA 3R2GA 1XICA 2QJNA 5JXQA 3G0SA 3WMCA 4JTQA 3IVUA 3OLDA 1LT8A 1I2NA 4EXAA 1S3HA 2OELA 3TX9A 1GQJA 4X2PA 3MHGA 4P7LA 5E0CA 2PBOA 2PWEA 1IWPA 4R3UA 1I2OA 4AZ6A 2WVVA 3TTEA 3UERA 1TR9A 2J9XA 4PEKA 4GE8A 2ISDA 2Y62A 3VKBA 4BA0A 4GGBA 2JIEA 4JQ1A 4U33A 4TX8A 1ITCA 3W74A 4UR7A 1ICSA 4NKCA 4Z1YA 3PAOA 2PA6A 3O15A 3U0HA 2XSXA 1JEZA 1X98A 3SSZA 2Z1XA 2OQHA 5DX7A 4DWDA 2QUNA 2PF0A 3KDOA 3LV5A 4CQDA 3W76A 4P5UA 4ERIA 1EFZA 5HWMA 2WMIB 4N42A 3CUXA 2A21A 2XZ9A 2ZUNA 4DM2A 2VOMA 2BTMA 2X42A 3VA8A 4GABA 3R8GA 4IF2A 1UZ1A 3RMJA 1MQRA 1EJWC 2X1UA 1W9UA 2Y0FA 5L6UA 5E0KA 2HV5A 4UTJA 5CG0A 3VIHA 3VOJA 1LBFA 3LBCA 3E0LA 1QWKA 5D09A 1DWIM 2Z1VA 3W71A 1TB3A 1XIGA 3C0SA 1F3EA 3EZ4A 1HX0A 3K8LA 4X0NA 4ZTYA 2W66A 4KFPA 4JFUA 2QCCA 3FA5A 3K30A 5EFDA 1QNOA 3GNXA 3ABXA 3THAA 1JZ2A 2PRLA 1KKRA 5BRBA 3DFHA 2HE5A 2CLIA 3ZVIA 5DQPA 3W82A 1U22A 6REQA 2HXUA 1SVDA 1OT1A 3EWYA 4NXKA 3ATYA 4LYRA 3WH8A 2XIOA 2GZXA 2Q6ZA 3T2PA 2HXTA 1VJSA 4JTGA 5GNZA 3TV8A 3QGAC 3OOQA 4HNNA 3S9YA 2YLLA 3NJ3A 4Q7IA 3FFSA 2BZNA 5D32A 2WC4A 3CMGA 9RUBA 1N82A 3HPZA 1KR0A 1T40A 2YL6A 3R1ZA 4YS1A 1JYXA 2FVMA 1O5QA 1W6TA 1KFLA 4O54A 5HINA 7TIMA 4UTMA 1GOOA 1DJYA 4RV3A 4HYVA 2UBPC 4B5NA 2XGBA 3B9EA 4MKNA 5LIXX 5I23A 4Y96A 1XPGA 3QHNA 4IJBA 1A0DA 3G8RA 4NJHA 1WKYA 3KBSA 1YXDA 2IS7A 4IGSA 2Y85A 1B4EA 2RJHA 4K8EA 4Y8EA 4O0QA 2VCBA 1BTCA 1R3QA 3ARTA 3E02A 4S39A 1MNSA 2J77A 1Y7VA 4JNMA 3RYSA 5T8GA 2C13A 3NXFA 4HMCA 1Q6CA 3N13A 2AOSA 3CL6A 1WDQA 3KP0A 1PSCA 2BX7A 3MJMA 2VX4A 3A12A 1J0IA 4KW2A 5FA5A 1CB7B 3VNYA 4DJDD 1EUAA 3C52A 4F0MA 2KX9A 3S47A 3QKEA 4CNNA 4KWWA 3CPGA 4GYJA 5EA9A 4C91A 4Z1DA 1ZSXA 1NY1A 4WSHA 1KXHA 2BOGX 3DESA 4Z2LA 1HQTA 1NWRA 2RAGA 1IR1A 5E9XA 4RV8A 3CUGA 1GNXA 3HFYA 3T0AA 2ZDSA 1WE5A 2OVLA 1Q2RA 4A3RA 3MS8A 4NX5A 3A23A 1XUZA 3VDCA 1A80A 3HFTA 1B3OA 4ZVJA 5M03A 2XSAA 4FNPA 2MUCA 4Q8WA 3S5SA 4EWJA 3CV2A 3OLIA 3VIGA 3ITGA 4OZOA 2PDJA 1P6WA 2A6NA 4ZZ9A 3VMOA 1D3CA 3BW4A 4JIIX 5LA2A 2O7QA 4C1NB 1SFJA 4CD4A 5CJ5A 3BZGA 1HL9A 1RR2A 3OBAA 2REQB 1BYDA 5H2ZA 4AY1A 3R89A 3BAJA 3BJFA 2QUUA 2Z1WA 5DANA 4M0XA 3OJGA 1EEXA 1XBZA 3ISIX 4OE7A 1GVRA 3H2MA 1PCWA 3NQCA 1VHNA 1WYIA 1HNYA 5A5WA 3NDYA 1AD1A 4O18A 4LWWA 1Q65A 2BVDA 1XYAA 3BPWA 3MB9A 3TYBA 1F6YA 3EX3A 3QSTA 1UD2A 1VBHA 4UTUA 3SCNA 3E38A 1GQKA 2CZDA 4AVNA 2C1GA 3GH4A 5C2CA 3HJZA 4S3DA 2CCRA 2CLLA 1S5VA 5JIPA 3TE9A 5JBEA 3LEPA 3IVSA 2ZC1A 4EK7A 1OABA 5REQB 1ZALA 2MANA 1JCYA 2Z0IA 3PUOA 3IGHX 5BROA 1ZB5A 1WBJA 1KCKA 2DZPA 3PZQA 1PX3A 2XFWA 2OLSA 4JQ3A 4LY8A 4US6A 1XDJA 4NYYA 3L5AA 3BG5A 2V5KA 3CO4A 1QNSA 3ITLA 1OEPA 3WDRA 2Y7GA 3HMCA 5A95A 4MY9A 1K9FA 1WOBA 2VX5A 2XH2A 5AVNA 5LNSA 4XUYA 1IV8A 4HA4A 1ISVA 2AAAA 1FQ0A 2EF9A 3FYYA 3LYEA 3U6WA 2CWNA 1YTEA 2XM1A 3WQPA 2ACSA 2WJFA 2OCZA 3Q67A 1GOKA 4ZFMA 4UQCA 4MWAA 5HMDA 1RP8A 3QGKC 2OYLA 3WK3A 4EPKA 2XIBA 3B9AA 4WEVX 5FJRA 4L1XA 4HU0A 1R3TA 2QMJA 3AI0A 1CPUA 1JDCA 7XIMA 1VHCA 3TYCA 3GK0A 2PCQA 1W5PA 1OYCA 7REQB 1TX2A 3W1AA 3O0FA 4PTVA 1PZ0A 2E8YA 3CUFA 2QDHA 4GVGA 3DAQA 4DZIA 1JI2A 1M9HA 4HN8A 3B03A 3EWWA 3L4WA 3F5JA 3R8HA 2WMFA 5D37A 3VX1A 1QBBA 1JAKA 2TAAA 3G3MA 1L6SA 1RY8A 2ZX7A 1IF2A 4RZ6A 4Q32A 1VCVA 2WKJA 4N6FA 3M0VA 1BG9A 1V0LA 2OJPA 1UBSA 2VRJA 2XJ7A 5A8QA 4LH8A 1JPKA 4QCEA 3KFTA 3HJEA 4S3KA 2V81A 1ZCCA 1EOKA 3FA4A 4FEZA 2JKPA 2G95A 3HQ1A 1Y5WA 3ES8A 2XU2A 1EJXC 3UD6A 3H24A 2PWVA 2PZ0A 3REQB 2ZWZA 1QO5A 2PTZA 4DJED 4C6LA 3WQGA 2QDGA 4C6EA 3WQ4A 5CBJA 2VJXA 3NWRA 5A6LA 2E9LA 2TSYA 4HNVA 1DXIA 1B4KA 3UJEA 4F2BA 4X3ZA 4A3QA 4CCDA 2QPUA 1UR4A 3P60A 3SCOA 2HJPA 4GH1A 3UU0A 1DQUA 3LCLA 3WF3A 3T42A 3LENA 3H4XA 5IHSA 4F9JA 3TC3A 3ZR4A 3A64A 1FOBA 4QAIA 3LCFA 1N8WA 2V63A 2E9BA 1TRDA 4AG0A 2YPIA 4FOKA 1TELA 2ALRA 2CU0A 3N2BA 3NEHA 1X1ZA 3D3FA 1CXFA 3GDKA 4GIEA 3TTOA 3BCFA 3DKJA 3RX4A 2Y88A 1XJBA 2YCJA 2AQOA 1UIOA 5BYWA 2BV9A 5D9NA 4M1BA 2W3ZA 1W2VA 4RKAA 1QI0A 3C8FA 2GGGA 2ISFA 4FOJA 3VKDA 4NRSA 4S1FA 1L2UA 3WUEA 2O56A 4ATDA 4OOZA 4X63A 3TP4A 4RNHA 1MDLA 2XH7A 3QYQA 3E1F1 3FGCA 4KWUA 4JN7A 3HPAA 4O4VA 5C8BB 1ZP4A 1E9YB 2JALA 3AMCA 1ZHAA 1ECEA 1TJ0A 2WVTA 3EX2A 4IPJA 4UCGA 2ZA1A 2ZA3A 3CTLA 1R3SA 5BMWA 2YW4A 1B3ZA 4JIHA 3TMQA 3VNLA 3KVKA 4J3VA 3E2SA 3TA9A 4NYUA 1A5SA 2PC4A 2J66A 1P48A 3WCZA 3DX5A 4LX4A 4LV9A 3FAWA 4HK5A 3N2CA 3PFMA 3LRLA 4WVXA 3OZMA 1KGXA 3DDMA 4UFHA 1U33A 1TZ7A 2YCKX 3VNIA 1QI3A 3GC5A 3N15A 2VRQA 3S5ZA 2X7WA 3EWBX 2PGFA 3WBYA 2D1ZA 2IPJA 1L6FA 4F0SA 3K5XA 2EQDA 3VGDA 3GB6A 1PIIA 4IMDA 3NDOA 2XYLA 3LGEA 2GYIA 2VR5A 5AB3A 4TV6A 3ARXA 2PMQA 3AQUA 4ZB2A 4WJ8A 2RGLA 4JQ2A 3STEA 4ZBCA 1HL8A 4S3EA 1YYAA 1XGZA 4Q3MA 3N11A 3MJYA 4A22A 4O16A 1GKPA 4MDOA 4B5VA 1IXOA 4ACZA 1LCOA 3ZWSA 1MVYA 5A1AA 4M7TA 4CCCA 1H50A 2Y7DA 1JRCA 5D2XA 2VHLA 2GPTA 3VNZA 4JTSA 3GKFA 1X1OA 1CCWB 4A8IA 4D6CA 4E2DA 4ML9A 4E0CA 1GWJA 2WJDA 1EPXA 3FSTA 2FKPA 4OT7A 4X2RA 3PSWA 4GWEA 3W3OA 4M24A 5CAHA 3CZGA 4PCSA 1NDZA 4Q8MA 1EHAA 3GVWA 3MPGA 1PAMA 5M5DA 3QV7A 2EPOA 1UH3A 4GIRA 1FWEC 3FJ6A 3KAOA 1GVSA 1Z89A 4XVDA 1E9LA 1AK5A 4DF1A 2QVNA 3H23A 1ME9A 2A3CA 2PLKA 3SQMA 4U3AA 1CECA 3MWCA 1UA3A 3KEHA 4GVIA 4J28A 2J9ZA 4YHGA 3C8NA 3V1HA 3AZRA 1LQ0A 4I9MA 1HJQA 2YIHA 1OBAA 4A4AA 1BGAA 2C91A 1US2A 3AXKA 5HDRA 3RX2A 3IPWA 1HTIA 1E6ZA 1FA2A 2QCGA 2DIEA 2H8XA 3NQEA 3EA3A 4PL1A 3MKVA 3ZO9A 1JCJA 2VWSA 4MPQA 4K38A 3NZGA 4HHPA 3W7MA 2YCLA 4TXEA 2GSEA 3W7QA 2W63A 3A4WA 1IEXA 4HVXA 3UYCA 3W7CA 4GZ7A 2YA0A 2I7GA 3VZZA 1W5NA 3A13A 1EHNA 4NT0A 4UC5A 3QVQA 1CXKA 1NFGA 4LRTA 4GQRA 1GTEA 2GVLA 5BWFA 4O19A 1OCQA 1FKWA 2FPTA 1SZGA 2Y24A 3DBNA 4PC8A 4P7NA 3Q2DA 5TBOA 2XGIA 3ZWTA 3GR4A 5C9UA 4PFHA 4JL1A 3T55A 4EAYA 1TV4A 4UFJA 1GOXA 3KVJA 1ONRA 1XLGA 3KBNA 1I1XA 5I5RA 4JN8A 1CXLA 4MSSA 1YNQA 2Z6JA 1EDGA 1XCFA 3AYTA 3VNMA 4PMNA 2YX0A 1UB3A 5E9AA 1TWZA 2A3BA 3ITTA 1GOMA 4B9YA 1W1TA 3FXYA 5LNUA 1BXBA 5H8PA 4Q7BA 3R10A 3AICA 3TC6A 2AMGA 4DRSA 4IPNB 4BEUA 3DYPA 1BYCA 3I4EA 4PTMA 1CZ1A 1J0YA 3W02A 1O5KA 4P7OA 3E74A 1Q66A 2WO5A 1SJDA 3TN3A 2HROA 4I6VA 2JKAA 5J04A 1QOPA 3EDFA 3VMNA 1E56A 3FSUA 3UZYA 3WL0A 3M5VA 3KLKA 4AD2A 5FJUA 2A7NA 5BW6A 5GJPA 3CH0A 2GSJA 3L4YA 4GNJA 2CHOA 4H9ZA 1R6WA 4GFIA 1JJKA 3LK6A 1E4IA 2WMIA 2P50A 3OPSA 3UGRA 4HK7A 1RQBA 5C9WA 4CU8A 1UA7A 1D3HA 2ISWA 1NARA 3TU9A 1KCLA 3M07A 2QCMA 3W70A 2QDDA 2DSWA 3K4DA 5HUOA 4DBSA 4BQ3A 3L2MA 1I60A 4CN1A 2ZRYA 4HD5A 4XIMA 3I3DA 4RDVA 3HZ3A 5M1TA 2FZNA 4UOJA 3TIMA 2A7RA 1KW1A 2HBXA 1Q6FA 1QVBA 4UTTA 3V7PA 1SUXA 4LUSB 1M68A 3EMZA 1GEQA 3HBLA 3S83A 1O12A 3KXQA 3PVFA 5CPTA 2NT0A 3AAMA 2Y5SA 2ZRWA 3PK7A 2Q8LA 3AS2A 1ZGDA 1QW8A 4MVAA 1K7EA 4MFDA 2EPLX 4DJFD 4IT1A 1J0ZA 1CLVA 2R8WA 1CEOA 3BK0A 1EDTA 1SSGA 2WNZA 4DI8A 6ALDA 3LBOA 2B7PA 4JYEA 1K9DA 1QI5A 3E0WA 1CGVA 1OFRA 3B8WA 3E0FA 4C6DA 1BSIA 3TJIA 3JU2A 3MCOA 2VC7A 4DO5A 3CHDA 1Q6QA 3W27A 5DMMA 1EBHA 1JPHA 3TYEA 1IEQA 3M6YA 5KINA 4XUGA 1HIZA 4JTUA 2Y5JA 1UP3A 3STPA 3NL3A 1A4LA 3CL8A 4E4PA 1W2PA 4DBDA 2OSXA 4Q6JA 2OB3A 3M0LA 3NIYA 3EBVA 1H2JA 4IOTA 3WLSA 3KL0A 4IMEA 3W7GA 1OGGA 3QZ6A 4ZQRA 3B4YA 3H22A 1JNDA 1XSJA 2VFHA 1E4NA 2J9YA 1G94A 1R85A 4D8LA 3OW1A 4FLSA 3BSHA 2FJKA 3TDFA 4UQAA 1H7NA 3SUWA 4LBRA 3GDMA 4IG2B 3EWXA 3CUJA 4F2UA 4L4MA 4WUIA 2NX1A 1JRBA 3CPRA 5GPRA 4GFSA 4J9JA 4C65A 2X0YA 2VD8A 3P62A 3A6OA 2F84A 2FHCA 3MHUA 1R2TA 3HN3A 4LUIA 3GTNA 3DHPA 1ISYA 2F8QA 1F73A 4A2RA 4GI4A 3WLOA 4DO7A 1SU5A 1X8FA 5AHFA 3ZVHB 2VCCA 2DT1A 4NI3A 2QVHA 4HCDA 2A3EA 1DV7A 4PUWA 5ECUA 5H6HA 2DT0A 3DENA 2VD9A 4S38A 2BDQA 2DUAA 1JZ3A 5HWJA 3SY8A 1XYLA 2DV0A 4GJIA 1N8IA 1CENA 3L21A 3G77A 4JOMA 2V5CA 3PBUA 3AYRA 1HT6A 1RBLA 3K2GA 3KX6A 3E0VA 4XQ6A 2BHYA 2ZRUA 2GQAA 4K68A 4S3AA 4GXMA 2QDEA 4LANA 2FMOA 2A3LA 1XX1A 2Y8VA 2P0OA 1XP3A 4C6NA 1ZAIA 1NFPA 5KZDA 5I06A 3VDBA 2QHAA 4NJGA 1U5JA 3TXVA 3WNOA 1Q6LA 4LB4A 3ZFHA 4XZIA 2DY3A 2RJGA 4C1NA 4GACA 3NQAA 4NNAA 3VCCA 3TWAA 4MLJA 3IGSA 3DHDA 3WBAA 2PDXA 1H7XA 4AYGA 3RF9A 4DAIA 5EY5A 5K9DA 1EA9C 3I10A 5MKGA 3LY0A 1TTJA 5LKYA 1J79A 1IGWA 1WKFA 3NO1A 5HOSA 1XIBA 3V5FA 1B2YA 1A3WA 3OVRA 1L6YA 4WDWA 4OV9A 2H90A 4ZTXA 1UZHA 3BLFA 4K1WA 2HMCA 4I9AA 1LOSA 1OM0A 4TTGA 2WSKA 3WJWA 2PEVA 2OFJA 1R38A 3IK4A 5A6MA 3PF3A 4IPIA 4UQEA 4WSKA 2GQ9A 1TA3B 2I57A 4UXDA 3VNJA 1GGOA 3JVAA 3VPLA 3P8IA 4R9OA 4EACA 4NI8A 4AD5A 4KMQA 4YIWA 1NIUA 2WCSA 3E2RA 5REQA 1Z32X 1J18A 4PMRA 2J25A 9XIAA 3M0ZA 3RGTA 1GQIA 1FWNA 2YDAA 1FXQA 1Z6KA 2HWGA 1T41A 4OWGA 1UD3A 3NPVA 6TAAA 4V28A 1FX6A 4Q4QA 5AZ0A 1VPQA 4QFUA 4UFLA 2JF7A 1W8GA 3BO9A 2XFYA 1E5JA 2WMGA 2VEIA 2WYSA 3T08A 3RR1A 3CS2A 1MW2A 1DJGA 3RJYA 2VENA 1C3FA 4Y9AA 2X0HA 3ZR6A 4JIPA 2GUYA 3WF1A 3GSMA 4RK8A 4PL2A 2NXIA 4WXYA 2PDHA 7REQA 2NW0A 4HSNA 3EGJA 3P80A 3WO8A 3OG2A 1DJZA 2ZUSA 1UWRA 2AAMA 1DWFM 1W9PA 4NP7A 5B7YA 3FJNA 2YGYA 3N9KA 3IJ9A 2OQLA 3U48A 3LRMA 3ARQA 2H6RA 4N2YA 3FVDA 2F9RA 4AU0A 3VYLA 2VP8A 4QLKA 3K1DA 1XG4A 3GTIA 4HPGA 3TNBA 4Y9MA 4L4OA 5I00A 4M5PA 1UD6A 1OJXA 2QF8A 3BL3A 5HPOA 1XYBA 1XLJA 3TJXA 1H4PA 2WHMA 1OC7A 4YXGA 4OV4A 5DLCA 1FWIC 2IKGA 2R14A 1U5HA 5TNVA 1ESWA 1KCXA 2XTKA 5RUBA 2WVUA 1FBAA 3H54A 3O6AA 5CGQA 5C71A 4CNUA 3VVGA 4MKSA 1MUMA 2P3EA 3BLDA 1OY0A 1E1CA 1JXKA 2E5BA 3CGTA 1UZDA 3REQA 5CPNA 3ES7A 2PP1A 4GA8A 5TAOA 4HT3A 3AROA 3W6LA 4MDPA 2EJAA 1EIBA 4BZYA 4E8DA 1NAL1 5FJIA 1MEIA 3VC6A 1LG2A 2PDPA 4MNLA 3KOYA 1BQCA 4PRTA 3S2LA 1VPXA 1WAUA 3W00A 4F9DA 4DWSA 5L9FA 3OTRA 2HE8A 1GQNA 1JL8A 1WDRA 3MHFA 2C1IA 1C7SA 2RGMA 3JUGA 4MWAC 4RDYA 3WD0A 1H7WA 5CZJA 1SFSA 4QAWA 1UMYA 3SBFA 3LN3A