1J2WA

Tetrameric structure of aldolase from thermus thermophilus hb8
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
212
structure length
212
Chain Sequence
MDLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPSYVAWVRARYPHAPFRLVTVVGFPLGYQEKEVKALEAALACARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVLKVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASRLGTSSGVALVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Aldolase protein
publication title Structure of aldolase from Thermus thermophilus HB8 showing the contribution of oligomeric state to thermostability.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 87
structure length 212
sequence length 212
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1j2wA00
1W0MA 1W5PA 4TX9A 4OBTA 1HTIA 1YDNA 1F05A 3BV4A 4E2DA 3LLDA 2E5BA 4R34A 3LCWA 1EWEA 4O13A 3FIGA 3W7PA 3NNTA 4D2JA 1ZJIA 1LORA 2J88A 1TO3A 2QCCA 4OGZA 1ICPA 1KV8A 2X1TA 1LRTA 3LM7A 2Z6JA 3KVJA 4NNAA 5LHEA 5BW6A 4EVZA 2QKFA 2Y88A 2NLIA 2Y6ZA 3O6DA 1MEWA 4JR5A 5DBTA 1D9EA 5EY5A 1GG1A 3CB8A 2B7PA 1H61A 2JGQA 4FNRA 4IMGA 3TU9A 2WQPA 1OX6A 3B04A 3BG3A 3DAQA 4AF0A 1C29A 5FEWA 1KW1A 2ZRVA 1TPB1 5EBUA 2OJPA 2AQWA 3W3OA 3W7HA 3QMTA 3OEXA 3Q2DA 4RZ4A 2NUXA 4NT0A 1QPNA 2YX0A 2Y7EA 1XC4A 3DHFA 4IWWA 4ZVJA 5I3GA 1RQBA 3IGSA 1WXJA 3FLUA 3ZWSA 3IEBA 1YYAA 3O1NA 5TQLA 4ML9A 5TIMA 1KLYA 3LRKA 1Z44A 1SW7A 1GVQA 3P84A 4LVDA 4E0CA 2NX9A 5F2LA 1LBLA 1FWWA 3QJAA 2Q8LA 4AWUA 1WDWA 4LV9A 3M6YA 3QPYA 3TAKA 2V9DA 5AYZA 5HJLA 1WYIA 5FEXA 1YTKA 5HULA 1W1ZA 4XWUA 4MZ1A 1C9DA 5CZTA 2VFHA 3W1QA 3QFEA 5HQEA 5FF3A 3SFKA 2ZRUA 4UTTC 2QCNA 3RMJA 2ABBA 3E12A 1W56A 3HO8A 1G69A 1TTQA 1QPQA 3FJLA 2QCFA 4O50A 4O10A 1VCFA 3ZFHA 3HQ1A 3LTPA 2GJNA 4JY8A 3W7IA 1TMHA 2FDSA 4MLJA 1P1XA 1TV7A 2EF9A 3LXAA 4JICA 3ZWTA 3DI0A 3OVPA 1QWGA 5BOOA 2E5CA 1FDJA 2NXHA 3CIWA 2UV8G 5G4WA 1FXPA 1T8XA 3KAOA 1SO4A 3WJYA 3LDVA 3W9ZA 2OX1A 2ZRXA 4LOCA 3FJ6A 3L68A 2FPVA 2ISSA 3DFNA 5G1TA 3C8FA 2HMCA 5KTLA 3B0UX 2QEZA 3TDFA 5K7JA 2TSYA 1JJKA 4BF9A 2VFDA 1RZMA 3D0CA 2OT0A 4H6KA 5F4WA 1TQJA 3WJSA 2DJLA 3BW3A 1PCWA 2ZZ5A 4IMDA 2WSYA 3MHGA 2BZNA 3UPWA 4WY0B 2BWGA 3ATYA 1SUXA 4A3UA 4S2CA 1FCBA 4IJBA 3MWAA 2VFFA 2WSRA 3NDOA 1OX4A 4JTLA 3I68A 4Y96A 2GQAA 1Z48A 1O5KA 4JTJA 7TIMA 1NFBA 3SY5A 3FA5A 4QNWA 4FXRA 1B9BA 1OFQA 1M7OA 2WPBA 4UFLA 2C1HA 1G7UA 4QM1A 3W72A 3H53A 2R14A 4QSHA 3MI6A 1A5SA 3LRLA 1JQXA 3FKKA 1M7PA 4M5PA 3GR8A 3IVUA 2WOQA 1W3IA 4QAIA 3EX4A 1R2SA 1TTJA 5DBUA 2H3DA 2QCEA 1TREA 1EA0A 5A8GA 1QOPA 4N4PA 3HPXA 3TC6A 1GZGA 3O06A 3PM6A 1OVDA 3P80A 3IIOA 4JX4A 4WY0F 4IGHA 1S3HA 1W37A 3G1VA 4NXSA 1ZNNA 2EAWA 3CPRA 4KWWA 3TXVA 5C54A 5J5DA 3C2VA 3NM1A 4PODA 2E68A 1TTIA 1WBHA 2B7NA 3W2MA 1OJXA 3P5ZA 5BMXA 2VFEA 1KV5A 3O6CA 1JUEA 3PSWA 4XKYA 2HSAA 4DF1A 4NJHA 4ZMGA 3TIMA 1L2UA 3PBYA 3VE9A 1NAL1 5U7SA 1H1ZA 1DBTA 1F6PA 2OMAA 3E49A 1SR9A 1S5TA 2LLEA 3GDLA 3LBCA 4MY8A 1KM4A 3DGRA 1X6UA 4GJ1A 2V82A 4GUGA 1GPWA 2JK2A 1OYBA 2P1FA 3C4UA 3NM3A 3QEZA 2CZFA 4YLWA 1GJPA 2ATSA 2CW6A 3GB6A 3E02A 3TC7A 1GVOA 3L0KA 3M16A 4LTSA 4GRSA 2C14A 1WA3A 4IPIA 3DFOA 3NZRA 1EUNA 5GVJA 2ZA2A 1ME7A 1I45A 3EX6A 3M1ZA 5EYWA 4UFMA 3CIXA 1OYCA 3KVMA 1G4TA 1R2TA 4K8HA 5AC7A 3OG3A 2P0OA 3KRSA 2AGKA 3MO7A 3PWAA 4NU7A 3TJXA 4ADSA 3T40A 3L0NA 5KZMA 2YXGA 3S1VA 3F03K 1LYXA 4JTKA 5AHLA 1EUAA 1CX9A 3PSVA 4N4QA 4O18A 4O53A 4LV4A 4N9CA 4RLIA 4L4LA 4EOUA 1F7BA 5G2WA 3L67A 1FDZA 3HOJA 1ZHAA 3N3MA 4O19A 3KRUA 5G4EA 1LLZA 3ABQA 2GUUA 4JY9A 4KFNA 5K9CA 4O17A 3G24A 4JTHA 4TIMA 1JCYA 4MFDA 4YWIA 1SZEA 1WX0A 4CNPA 1P5BA 4GUJA 1THFD 1H5YA 4MIMA 2FB3A 4A29A 4JD4A 3IV3A 4MFEA 1M6JA 3TH6A 4UFHA 1IF2A 1WAUA 3PUEA 2QCDB 4JTTA 4X3ZA 3N14A 4PFMA 2F7FA 4JTIA 3S8HA 1VYSX 1HO4A 2NV2A 3LHTA 2Y62A 3I7QA 2ZA3A 1EX5A 4H3DA 2ZYFA 2DZUA 4R33A 4RJEA 3W7OA 2JKPA 2GVLA 3NAVA 4IQLA 3W7GA 5FEPA 1PV8A 4JDBA 1DJQA 3GXTA 4NUWA 2QUVA 3NL6A 2Y63A 3PVFA 4UTHA 4B5NA 5DY3A 5D09A 3LV5A 1EB3A 1JULA 5AYYA 3HPSA 1KTBA 1WQ5A 3UWZA 2GQ8A 4CCDA 4JTEA 3W2JA 4DPPA 1A5AA 2YW3A 3EXSA 3PG9A 4MOZA 3LI0A 3MYOA 4GUHA 2ALDA 4S1FA 5F2GA 4DBEA 1AG1O 4JTFA 3W85A 5IBXC 5AN7A 4RK8A 3UNDA 1SU5A 3UY7A 3SW6A 3W86A 3CTLA 2KZHA 4AXKA 1X8FA 4Z0SA 3TQ0A 4RZ5A 2RDUA 1SO3A 6TIMA 2NWRA 1MEIA 3MJYA 3S0CA 2QCHA 2WV8A 4M6PA 1EP2A 3A21A 2G97A 3HJZA 1P4CA 3N2XA 3TQKA 5I3IA 1F6KA 3TFXA 3U2OA 2DJXA 3S6DA 3W7RA 1LBFA 3R5EA 3L5MA 5E93A 3EKLA 1K7FA 3WJXA 3LCHA 4HIBA 1QR7A 1AW5A 4O12A 3PBWA 3BLFA 3MUXA 2Y61A 4GUIA 5FF0A 5IM51 2DZVA 4UUIA 2E5DA 8TIMA 1XM3A 5KZEA 3NZ1A 2JKAA 1I2PA 4FNTA 1MXSA 4UFKA 4ORMA 3KHJA 1KFEA 3EX2A 3GKFA 1BKSA 4AHPA 3FOKA 2DZTA 3NL3A 4NVTA 4EIVA 3SECA 4Z1AA 3TXZA 1DORA 1VS1A 3NQGA 3G3DA 4XTIA 3E96A 3EWUA 4JYEA 1JRCA 2VKZG 3NPVA 3C2EA 3BLEA 2BXVA 1UB3A 3S1WA 2CLHA 1JR1A 4HT3A 3QQ1A 2HTMA 2QJHA 1TPWA 1PE1A 1QO2A 1H7WA 4HSOA 3YPIA 3DKLA 4PEKA 1RD5A 3GVGA 4CQ8A 1OFEA 3S42A 2YSWA 3P60A 3LXCA 1P0NA 5HR7A 2QCLA 4UNKA 2JKEA 3R12A 4IPJA 4XZ9A 3R13A 1T99A 1QFEA 3NQCA 4JX5A 4O4VA 3GXPA 2QCGA 3QMRA 4RXGA 2A6NA 5U4NA 2G5WA 3LCIA 2PC4A 1FUYA 3SSJA 3UPBA 1R46A 4O1BA 5HNRA 5KMYA 5E0KA 1B57A 3L65A 2VC6A 1AW1A 4M6QA 1OG0A 3VKJA 4LRSA 3PC0A 1ME8A 4LUJA 1IXNA 4TMCA 1O60A 5DXYA 2QDHA 1TRDA 3B8DA 3C52A 4TR9A 1QO5A 2I14A 2ATMA 3LOTA 3G8RA 1ZAHA 2ZRWA 4IX2A 1LBMA 3NQ2A 4Z0JA 3QZEA 4O28A 3O6YX 4EF8A 3ABSA 3HMJG 3HGJA 4WY0A 5AFDA 2QF7A 2Y7FA 4UCGA 4K37A 1ZAIA 3LHYA 2A85A 3NQFA 1Q6LA 3ABRA 3S1XA 1FQ0A 2FJKA 1W5OA 1W3NA 4UC5A 2CZEA 3CEPA 4O11A 2RFGA 4PL1A 1TB3A 1KM2A 3M5ZA 3I7SA 4R7JA 2PRLA 1W31A 2J9XA 4L4MA 2YYTA 3OIXA 2ZZ7A 3K30A 3INPA 1KM5A 1LZOA 5BMWA 3IIZA 5FI8A 1OFPA 4ZQMA 3N2MA 4TO8A 3P7YA 1BTMA 4X2RA 1G4PA 3H54A 1TIMA 3UZ5A 4GFSA 1LP6A 3R2GA 4LS1A 5DN1A 4RR4A 2C18A 4AMAA 3BW2A 3W1NA 3UY8A 4DEFA 1TPH1 5HUOA 3NPUA 4A2RA 2H8XA 1GVFA 3HIJA 4A21A 3TFCA 3LCXA 4K8EA 2ZZ1A 3CEUA 2OZ0A 2Y85A 5DCEA 3SIZA 4NNCA 2TPSA 5LNWA 3MBFA 2C3ZA 4BI7A 1VLIA 3W7NA 4ZZ9A 3G1YA 3CQ0A 1D3GA 3T4CA 1ICSA 1TPVA 1YPFA 3G1XA 2X16A 3R8RA 5C5YA 2OCZA 1KFCA 1TQXA 2A5HA 1OX5A 2E6AA 3MI2A 5E1QA 3W1XA 3N34A 5D2VA 1FWRA 2E6DA 3NQDA 4OV9A 5C6MA 1FX6A 2D73A 2YFNA 1OYAA 3BLIA 5HMSA 2J24A 2DU2A 5EA9A 5G1YA 5DCBA 3PF3A 2W79A 4NZFA 1OABA 3LERA 3NQ7A 3W7KA 3W71A 2CWNA 5F1VA 1QAPA 3TSMA 3UXAA 1KTNA 2FIQA 2V81A 2J9ZA 5EPDA 4ADTA 4HNUA 3UZJA 4WX2A 3WK0A 5EMUA 3TSBA 5LNRA 1XI3A 1VC4A 3DFPA 4RX0A 2EGZA 4BWLA 3ZS4A 3HG5A 1ZAJA 1YTEA 2G96A 3HG4A 5DXXA 1V5XA 2NWSA 1SO6A 3TA6A 1YDVA 3W73A 1ICQA 2QJGA 3STGA 5LGZA 3O05A 3GDMA 4AB4A 2C15A 1SSGA 1EP1A 2ISWA 1RPXA 2A7NA 1K8XA 5LKYA 1VCGA 2ZFAA 4DO6A 1UJPA 3DU0A 4PC8A 1TPUA 4MVAA 3N73A 5HUPA 2XFWA 4AVFA 2YYUA 3THAA 4G1KA 3QQ0A 5CPOA 1FXQA 1I2OA 2HS8A 3DZ1A 1K02A 3NL2A 1R2RA 4LUIA 1A5CA 1OFOA 3WK2A 5KINA 3GDRA 1YXCA 2ZA1A 4PL2A 2FFCA 1GVSA 4LC6A 1O95A 3PBUA 3UWQA 3SGZA 1U5JA 1ADOA 1KFBA 3W1TA 1Q45A 1N7KA 2V2HA 1K8YA 3SJ3A 2A0NA 2R8WA 3EX1A 3BVJA 3GYEA 3DHDA 3STFA 3LTYA 5AYXA 2QCDA 2V2DA 3JS3A 4Z1DA 1MO0A 1JCJA 3M9YA 2I9EA 1VJIA 4JNMA 3S1UA 4XTDA 3PUDA 2FPYA 1XFBA 2CLKA 2O7QA 1GVRA 3QW4B 3S5NA 3THQA 2J9YA 3STEA 1B4KA 3FKRA 3CT7A 3DKJA 1W5MA 1OFRA 4DBDA 1LOLA 2E77A 1LOSA 4I7UA 4LNYA 1OFAA 4NNBA 4AWTA 2WNNA 1H63A 1Z41A 2Y7DA 4JTUA 5D33A 1KBIA 4WQ6A 1VR6A 3PB2A 4UMBA 4A2SA 3G22A 4FNQA 4AWSA 4HSNA 1SPQA 3IVSA 4AH7A 1EWDA 3ATZA 1AL8A 3ANYA 4JIPA 4PTNA 2W6RA 4O1CA 1X7FA 1AK5A 3PR2A 3WK3A 3F4NA 4AHOA 1KLZA 3OVRA 4K6AA 4MZYA 3GKAA 4O57A 2CFFA 4NJKA 3G18A 3W2LA 4U28A 4O52A 1DV7A 1VYRA 1SZNA 2CZDA 1SFLA 2CLEA 4DO5A 4ZQOA 4P61A 3PAJA 4FIQA 3M5YA 4KFOA 1UCWA 4FNPA 1IGSA 2AAMA 3W7EA 5CPMA 4GC4A 3KXQA 3W70A 4RV8A 3W2NA 1PHWA 4WOZA 3DH7A 1UUOA 4ZQNA 3HGOA 2YFOA 3TQVA 3LB0A 2YCEA 2XN2A 5FF7A 3W7JA 2B7QA 1F74A 2CLOA 3UWUA 3LBMA 1H1YA 1K3UA 3C56A 2H3BA 5CSSA 2X30A 2RH9A 4C1KA 3M41A 2I1OA 2NZLA 5FF4A 3RFAA 1K03A 3T7VA 1F73A 1LRNA 2FLIA 1TSIA 4QJ1A 5A5WA 3DXIA 4U4MA 1P0KA 1H62A 4E38A 4NQ1A 3GR7A 1JUBA 3N9RA 2H90A 5D04C 1H7XA 4JS3A 1I2QA 4XUGA 1SQ7A 3MP5A 4DQWA 4UTKA 3W1RA 1FCQA 1L6YA 5AHNA 1KTCA 1G67A 1I8JA 2IQTA 1DHPA 1XBZA 5F4XA 4JYFA 4DELA 1VPXA 1KFKA 2H6RA 2E1DA 3EEGA 3EWBX 4JGDA 4NXKA 1GOXA 4QIUA 5CGQA 2QUUA 4ICNA 4HHPA 5T26A 4JDYA 4UNLA 3LV6A 1K8ZA 5AOUA 1O5XA 3PULA 1AMKA 1TPFA 1AW2A 1JCLA 1KBJA 1JUKA 1K7EA 1SSDA 4WXYA 1CI1A 3HGRA 4MLRA 4O8RA 3IVTA 1Q6QA 1JCMP 3TKFA 1A5BA 2W0UA 3VFLA 2HS6A 3DENA 3GLCA 1F5ZA 3W84A 2R91A 2ZTJA 3MYPA 1GQNA 4NJJA 5G5IA 5I3JA 2Z2UA 3LI1A 3NPXA 4FHAA 3FEMA 3FFSA 2DZWA 1XCFA 1VQTA 1MZHA 3BPWA 3PS7A 4LVGA 3CWNA 2X1SA 4WZHA 1QPRA 5LSMA 4O1DA 3NO5A 4K39A 3RK8A 2XN1A 2YPIA 1WOAA 3TSDA 3G1HA 1FDYA 4FEZA 3W2KA 4OE7A 3A24A 1RR2A 5LNVA 2CLFA 4UTLA 2ZTKA 3NQMA 2NUYA 2BLEA 4UFIA 3C0JA 3NYZA 2DZPA 3HBLA 3PG8A 1GTEA 3BO9A 4YCOA 4O1AA 4K7VA 3IIPA 3C6CA 4ONVA 1GT8A 1Y0EA 5D03A 3L9CA 3RU6A 1SZGA 2TMDA 2RDTA 4IXXA 3C2OA 1IIGA 3BK0A 2Z6IA 4K7YA 3G0XA 2V5BA 5DELA 2B4GA 1UUMA 4M7TA 1KM1A 2FPTA 1KFJA 3M43A 2ZZ6A 3KVLA 2ABAA 1XXXA 1LLWA 4KFPA 5D2XA 1KFLA 4IMEA 4CQ9A 1VHCA 3A23A 4GBUA 3MBDA 3W7DA 3SR7A 2CLIA 1HL2A 2DZXA 2GVJA 4CNNA 3TW7A 5HWNA 3P8JA 1X1OA 4OT7A 1S5VA 1I2RA 1FCVA 3A5FA 1GWJA 1VLWA 4GNJA 3QW3A 3V1PA 1R30A 1OFDA 5KZDA 4EWND 1VZWA 3G1SA 5G2HA 4IMCA 5D2TA 1PVNA 1K7XA 1SW0A 2TYSA 1M5WA 2PE4A 3NQEA 2VEIA 5LNSA 1JRBA 2QUTA 4ZQCA 2EKCA 1NEYA 1JVNA 3DFSA 2WNZA 4ZQRA 4Q4KA 1J4EA 5I3HA 3HG2A 2CZ5A 3EX3A 4N2YA 5D30A 4QQ3A 4FXSA 1DQXA 2Z1BA 1EEPA 4JIQA 1NF7A 1LRQA 3T78A 1T0OA 1DL3A 2VELA 2NXGA 3G1FA 4JEQA 4S2BA 1ONRA 2EHHA 4BR1A 3R89A 1YDOA 3NQ8A 1Q6RA 2WSQA 2ZRYA 4HN4A 3G8EA 1RQHA 5DLCA 1PS9A 1WOBA 5DY2A 3STCA 3QF0A 2NX1A 3A5VA 1LOQA 1H7OA 3W1UA 1W5QA 3TUUA 5G2IA 4MPQA 2CLMA 1DKWA 1LCOA 3JRKA 4BI6A 5FESA 4JTGA 1Z42A 3W22A 3E9AA 5LNUA 3O63A 1TV8A 3M0ZA 4DXVA 5CKSA 1YXYA 5BNKA 3HPZA 3G3MA 3GK0A 2V5LA 2VENA 1QOQA 3VCRA 4BI5A 1SZFA 2Q3OA 5CSRA 3IIVA 3LCFA 1TPC1 1N55A 3P62A 3W1MA 4P2VA 1DJNA 3GDKA 1FCUA 3L0GA 3HG3A 3W2UA 4X9SA 4JTSA 1T96A 1XKYA 1JQVA 4N9DA 4ZL1A 2YGYA 3WJZA 4Y90A 5D32A 4R53A 1SO5A 2H8ZA 4LWWA 2BSLA 1PL9A 4O0KA 1IXOA 1YLVA 1JCXA 3TMLA 1KA9F 4O15A 5AB3A 3OA3A 3MI3A 3W7MA 1I2NA 4A22A 3HB9A 3CWOX 1VYPX 2PURA 3KRZA 1IXQA 2OT1A 3C2FA 3GNDA 3Q94A 4O14A 1HG3A 3NL5A 5SWUA 1RV8A 1TTPA 4YXGA 3ZR4A 4K36A 3W7CA 3L66A 1E51A 4C1LA 3MHUA 1YADA 1G6CA 5F2MA 1XBXA 3EWWA 2V2CA 2NX3A 3TW6A 4NZJA 1JCNA 4RZ6A 3A22A 5DCDA 6ALDA 1LTDA 3M5XA 1X1ZA 4MKNA 1ML1A 1N8FA 2VEPA 1FBAA 2Z0IA 3UWVA 3AJXA 4N6EA 4HKPA 3NR0A 1ZALA 1OF6A 1S5WA 2C19A 1VRDA 5AHEA 3LHVA 2QAFA 3O8AA 5K9XA 5K3VA 4Q32A 1IIHA 2GVGA 2RKXA 3LHUA 4RKAA 1D3HA 1UASA 3TK7A 1TPEA 1XUZA 2FB2A 5H91A 4FIRA 3CU2A 2J6XA 1VH7A 1G4EA 2WKJA 1L6WA 3BW4A 3ABOA 3L5LA 4UTMA 5LZLA 3UWYA 4OWGA 4O4WA 2GPTA 3W1LA 4EF9A 2ZBTA 2E09A 2ZRZA 3P82A 4MUZA 5C55A 3ELFA 3LHZA 3IIXA 3KOFA 3BGGA 4UFJA 3I6RA 4CLMA 2J27A 4HPXA 1TJPA 3FYOA 4XBSA 2Y70A 3GXNA 1WV2A 4LW7A 2ZZ2A 2ZQ0A 4UTIA 2G95A 4FF7A 3LCGA 3Q37A 1BWKA 2QJIA 3WFAA 2C13A 5K9DA 4LS0A 1W54A 4POCA 3V75A 1ME9A 3DI1A 4OV4A 3B0PA 2WJZA 1GEQA 4TU1A 4Y9AA 2Q8ZA 1H50A 3NVTA 3NEVA 2A1YA 2C16A 2ISVA 3BG5A 4YCPA 4FX6M 1J2WA 1DOSA 4O54A 3TMQA 1QNVA 2R94A 1QCWA 3RLUA 1FWNA 2Q3RA 4YL2A 3W83A 3I7RA 5TBOA 1YPIA 5D02A 4UTJA 4JYDA 1YXDA 4NJGA 3F1QA 2ZZ3A 2YZRA 3EWYA 3FS2A 4N9EA 1SW3A 3TCEA 1VCVA 3RLVA 5HWMA 5HWJA 3GX9A 5FEZA 3W76A 3UWWA 1B4EA 3G1DA 4Y8FA 3NXFA 3OHIA 2A6LA 4IUOA 3W1PA 4BFAA 2GQ9A 4AF0B 4IXHA 4GWEA 5K2ZA 3TV8A 4ADUA 1XUUA 1QMLA 1G4SA 3PB0A 2O7SA 4UTWA 1H51A 2C6QA 3KVKA 2FQIA 3LLFA 3RF9A 3TJLA 5BRBA 3EXRA 1MSSA 1NSJA 4CQAA 2YR1A 3UQNA 5CZSA 3FYPA 4LT9A 1WBJA 5I3KA 2RDWA 3P74A 5H2ZA 4M7SA 2V8ZA 1H60A 3NG3A 4M6VA 4MYXA 1QPOA 3GNNA 5D2WA 3C2RA 1DQWA 3TNOA 3TAOA 5EL1A 3L2IA 2CU0A 3PY2A 3DFQA 3B4UA 3P61A 2C0AA 4LVFA 4OHQA 4W9TA 4DF0A 3DBPA 2DP3A 2E6FA 4Z08A 2DZSA 4Z1BA 4DPQA 1SFJA 3IRDA 4HNTA 5D2YA 2NXIA 2QR6A 2RHGA 3WK1A 1CW2A 2VXNA 2PRHA 1V7YA 1XL9A 3IGUA 4OQVA 2EPHA 2A7RA 5CZ0A 3W87A 1R47A 2VOMA 1PIIA 5AC8A 4K38A 3GAKA 1J5TA 2F84A 4QITA 2TRSA 3QSTA 4UXDA 3W23A 3H55A 4BWLC 1H7NA 3GAYA 4JN6A 3P81A 1XDLA 3EB2A 4I7WA 2Y7GA 3QSRA 4O16A 1L6SA 4XQ6A 4GXMA 5IBXA 5D38A 3VNDA 4BK9A 4AEOA 1H7RA 3W74A 3S5ZA 3QRHA 1A50A 1AL7A 4OU1A 1A53A 2V30A 3GIYA 3N19B 2Y89A 3VI2A 4QISA 4N9BA 4DF2A 1W5NA 3W75A 5MHBA 1TJRA 1I4NA 5K4XA 2ZDRA 1ZENA 1KM6A 5F4SA 3LHWA 4UIOA 3PBVA 3AO0A 1HFBA 1TV5A 2BX7A 4CCCA 1NF0A 4UR7A 3LX9A 1BEUA 4CCEA 2QAPA 3O16A 4IOTA 3TR2A 1LM1A 3M44A 3SGUA 1ALDA 1W8SA 3GDTA 2B7OA 1Q3NA 3MMTA 3NPWA 1OX4B 1UBSA 4N6FA 1H7PA 1EPXA 3PUOA 4FO4A 4FB7A 3F4WA 2X1UA 4FNSA 3O15A 4MY9A 3NOEA 2DORA 1O94A 4UTWC 4IMFA 2YW4A 4ZQPA 4FX8A 1W3TA 2BTMA 4DO4A 4Y6GA 4WXZA 4UMAA 3WJWA 1TYGA 3NA8A 3BGJA 5EKYA 2X1RA 3DFTA 4GUFA 2ZZ4A 4LVBA 1ZY9A 1QDSA 1VGAA 3S5OA 5KITA 1ZFJA 3GZ3A 5HINA 4MJMA 1F2JA 4RXFA 4M19A 4X22A 2CLLA 3HF3A 5L6UA 3T44A 3CC1A 4XBKA 1FWTA 2GOUA 4MJZA 3C61A 3QH2A 4LS2A 4I9AA 3W07A 5KSWA 3CHVA 4Z1CA 5HR6A 3LXBA 4LC8A 3M47A 4XKYB 3TROA 3W6YA 3EKZA 4CNOA 3UXDA 3QMSA 5K4ZA 2YDAA 3Q58A 3W88A 3B0VC 1OF8A 1O4UA 3CM4A 1KM0A 4N02A 5CG7A 2VEMA 3L21A 2V0TA 3HGSA 1F76A 5FF2A 1OFBA 4FX7A 2WO5A 3MP4A 4UTUA 3NQVA 1MEHA 2VFGA 5D37A 4LVAA 3E0IA 3IGXA 2QCMA 3CLMA 5C2XA 2NV1A 5L9FA 1LDCA 5F2IA 3SZ8A 1HO1A 1YTDA 3EXTA 3P5YA 1FY6A 1DVJA 4NJIA 4I7VA 5LHFA 4AHQA 2FTPA 1OK6A 1PCKA 1BWLA 1LROA 3P8IA 3KFTA 1TRIA 4PA8A 3S9YA 4WUIA 3W1AA 4E2BA 1U83A 4PH6A 5J5RA 4NX5A 3QYQA 3TX9A 3N9SA 3B06A 2WNQA 4MYAA 2ZCGA 4ORIA 3NQAA 4MY1A 3LTSA 5F1UA 2NUWA 3G1AA 3MHFA 2XN0A 3M7WA 3EWZA 2B0MA 4KWVA 4UR8A 2A21A 5LGXA 1B3OA 2PCQA 4J9JA 3OBKA 1PHQA 3QC3A 4RCXA 3W7LA 1FWSA 4LRTA 3BG9A 1RVGA 3B03A 4YMZA 1IXPA 5AHFA 1EIXA 4TMBA 1RQEA 5I3FA 3TE9A 2PRMA 1OHLA 4JXCA 1EP3A 2E6YA 3KX6A 4WOQA 4LU0A 4UMCA 3SI9A 3EWXA 3U8GA 1XBYA 3LRMA 1OK4A 3W7QA 4HNNA 4WD0A 4HNVA 3VE7A 2VFIA 3LCLA 3P67A 3A9IA 1XBVA 2JGYA 1ZCOA 2GJLA 5CPLA 4FNUA 4HPJA 5CPNA 1C8VA 3MP3A 3O07A 4O0ZA 4Q33A 5AHIA 4ALDA 4JX6A 5CZJA 1HUVA 2P10A 4MZ8A 3U6WA 4PCFA 2JBMA 3I65A 3USBA 3C3NA 3MW7A 1GG0A 5D05A 4UTTA 3UYCA 1KM3A 4KKXA 1GYNA 4LY8A 3G0UA 1TPDA 3QPZA 3T55A 4AAJA 2QDGA 1GTHA 1L9WA 3QM3A 2A7PA 3BARA 4QNEA 3JR2A 2X2GA 4NX0A 3NGJA 4IX0A 3L5AA 3B05A 1NVMA 2VEKA 5AHMA 3OVQA 4WJEA 3UD6A 3NQ6A 5ABTA 5AC6A 2A2IA 2A4AA 3M5VA 1TCDA 3S5YA 1VHNA 4GE8A 3RNDA 1Q6OA 4H4IA 1XDMA 1G7VA 3G0SA 3LGEA 1GYLA
chains in the Genus database with same CATH superfamily
1XH0A 4B5TA 3RLHA 4E2DA 3OYZA 3LLDA 1AQHA 4JQ4A 2E5BA 4D6JA 4DUVA 3E0LA 3LCWA 2R1LA 3V16A 4JAWA 4O13A 1XLEA 3W7PA 3FAXA 1GNXA 1LORA 1V02E 3F5JA 4OGZA 1V3KA 3KLKA 1KV8A 3UEQA 3GNRA 4YHGA 1M01A 2YB1A 5BW6A 2G41A 4M1BA 4EK7A 2Y88A 1UZ4A 2NLIA 2Y6ZA 3B9OA 3VCCA 5EY5A 1GG1A 2NQ5A 1UR0A 4BF5A 2WQPA 1FWBC 1I75A 4GYPC 1ZL1A 3MV01 3UR8A 5FEWA 4R9XA 4WSHA 1KW1A 1PZ2A 1WZKA 4EANA 5LA2A 2NUXA 4X9YA 3OZMA 2YX0A 3LYEA 1DJYA 1ZBVA 2Y7EA 3ZR5A 5C8BB 2XZ9A 2Z27A 5I3GA 1CXIA 3FLUA 3IEBA 1YYAA 1VBGA 5TIMA 3RRXA 1G0CA 3UG5A 2CKRA 3AIWA 4HCLA 3ZVIA 5I24A 4YTUA 1LBLA 5F2LA 2Q8LA 1YRRA 4DB7A 3M6YA 3QPYA 1JXJA 5AYZA 3ARQA 3FSTA 1YTKA 1W1ZA 1E5NA 4WGHA 4QEEA 3W6LA 4CCZA 1VKFA 5HQEA 3SFKA 4DI8A 1NELA 4L61A 2QCNA 4PMOA 3RMJA 3H2CA 5D8ZA 2OZTA 5I6SA 2PWDA 1Y5WA 4IIDA 3HO8A 1G69A 4D72A 1BVZA 4O50A 4O10A 4HHLA 4K68A 8A3HA 3MV11 1HL9A 3W7IA 4LEQA 5BOOA 3THUA 4GI8A 3CIWA 3C5QA 1CXFA 3VILA 1B31A 1VIZA 1T8XA 3KAOA 3PNZA 3WJYA 4WSKA 2OX1A 3U5YA 2ZRXA 2JEPA 1WKFA 2IPJA 3FJ6A 4NY2A 1GVIA 3B97A 5G1TA 2HMCA 3WD1A 3B0UX 3MQTA 3TDFA 4HSHA 1G1YA 3EA2A 1X6LA 5BOEA 1MQRA 4BQ3A 4JL1A 4Z17A 8XIAA 2OT0A 3L12A 4GK8A 2V69A 3WJSA 4QXIA 4A6GA 2E67A 1GEHA 3T6CA 2ZZ5A 2WSYA 3MHGA 1BGAA 3ATYA 1YW1A 2UY5A 1CXLA 4S2CA 7TAAA 2XJ7A 4F0KA 2VFFA 1KWGA 3EGJA 4JTJA 2GGJA 3N2TA 4M8UA 4HJFA 3PK7A 1LLOA 1M7OA 2F6UA 4CNTA 4BEQA 1G7UA 4W8LA 3W72A 5ABFB 3RPMA 3LRLA 1JQXA 3ECQA 1W3IA 3PPFA 4NRSA 2PGFA 3WD4A 2H3DA 2OG9A 3GRIA 1EA0A 3ZLGA 5A8GA 3TC6A 2I57A 4MWAE 4NF7A 5AZ0A 1F8MA 2WM1A 4JX4A 3B9DA 4IGHA 4WY0F 4B15A 4NXSA 3H70A 3CPRA 3TXVA 1IYXA 5E9XA 2J78A 3NM1A 2CBVA 1WBHA 3NJ3A 4KRZA 1JUEA 3H23A 4WDWA 3SN0A 3VE9A 1NAL1 3P3BA 1H1ZA 1DBTA 5ECVA 4H1ZA 1GZJA 1S5TA 4QROA 3OG2A 4Q4SA 3RHGA 1XYCA 1HJVA 1GPWA 2JK2A 1OYBA 2XWEA 1A3WA 1UP0A 2P1FA 3C4UA 2WMKA 1GJPA 1W1VA 3CS2A 3WF3A 2D69A 3GB6A 1A5MC 3ZJ8A 3BAIA 1EQCA 2GSEA 4QHRA 4QRNA 3LA4A 3AS2A 1W9UA 3HV9A 3OHMB 5GVJA 3I6TA 3KL5A 1I45A 2XU2A 2E3ZA 5EYWA 4MWAC 1M03A 2D0GA 4H01A 2IQDA 4UFMA 4ZXLA 1G4TA 1KB3A 4K8HA 3OG3A 3KRSA 2VVSA 3RUBL 4NU7A 3TJXA 5JVLA 1DWFM 1W3HA 3T40A 3L0NA 1GKRA 3ZM8A 1ITCA 3GTIA 3PHAA 5AHLA 1PDYA 3V5FA 4MDOA 3TZFA 2WVTA 2W62A 3VD4A 4L4LA 1F7BA 3BSHA 5G2WA 1FDZA 1RA0A 3ABQA 2GUUA 1DJXA 1WX0A 4GJIA 4RNJA 3FAWA 2VCCA 4ERAA 4F0HA 3DECA 4MWAD 1H5YA 2FB3A 1W2VA 3TH6A 4UFHA 2HJPA 3TVAA 4JTTA 1PX3A 1XIGA 1BF6A 3TYUA 4PGLA 1BHGA 4ZOBA 4ZGYA 1XPGA 3R43A 5D9MA 4RJEA 2OEJA 3W7OA 3MPGA 2JKPA 2GVLA 3W7GA 4JCLA 3ITLA 1GKPA 1PV8A 3GXTA 2OO0A 3EB4A 3NL6A 4B5NA 4ZE4A 4P8WA 1TR1A 1GKQA 5D09A 4MSSA 1ISZA 4Q4OA 4AD3A 3HPSA 3VK5A 1WQ5A 4CEUC 1HN1A 3ZQ9A 4FR6A 3SY1A 1KCKA 1YKWA 4R3UA 1EJSC 4N42A 3CAQA 4XD5A 3WEZA 3LI0A 3MYOA 4M51A 4O1EA 1MDLA 5F2GA 1AG1O 4LNCA 1D7KA 4DYJA 4WDUA 3UY7A 3VGGA 1GOQA 3CTLA 4IPLA 7XIMA 1X8FA 3WQ8A 4H8HA 2G4JA 3LGGA 1TV2A 3ONBA 1VB9A 4IP4A 1SO3A 1V3MA 2NQ9A 5CH9A 2NWRA 1BVWA 4WJXA 4A8IA 3A21A 1GOWA 1P4CA 3N2XA 3DHPA 5CSUA 3PZVA 3TQKA 3WUEA 5BWAA 3PBGA 4LEFA 2DJXA 3R5EA 2WHLA 3GTXA 3WJXA 2CPUA 1QR7A 7CGTA 3T0BA 1AW5A 3F5LA 5DANA 4O12A 3BLFA 4EP8C 2WLYA 4XAZA 2D3LA 2JIEA 3RJXA 3PJXA 1K1DA 4GG9A 4M3PA 4L5ZA 2WSKA 2YDRA 1WZLA 3W81A 4AHPA 4IQEA 3XIMA 3NL3A 3OLGA 4AIEA 1O6IA 3WCZA 3TXZA 4IT1A 2VRKA 3E96A 1JRCA 2PC8A 3NPVA 1FH8A 3ZT7A 1PJ9A 1C91A 4HT3A 1EC7A 4LYRA 1H7WA 4J40A 5DF0A 2YSWA 5I5RA 4EAMA 1J93A 3GM8A 5EFDA 1JF6A 2JKEA 3R12A 4IPJA 1DPMA 4ZO8A 2OWXA 4ZOAA 1E4NA 1E6PA 4JX5A 4O4VA 4ZO6A 2WCSA 4HNCA 2BB0A 2YCLB 2AL2A 3QN3A 4NZ1A 1FUYA 4KESA 1JDFA 3EOLA 4O1BA 5HNRA 4PB4A 1MVYA 2VC6A 3B4YA 7REQA 1OG0A 4FXFA 3ENLA 4ZFMA 2JF6A 1IXNA 4PYSA 3LMZA 2QGHA 1O60A 1UR2A 2PFHA 4R5EA 3B8DA 4TR9A 5JIPA 1QO5A 3LOTA 3G8RA 4WCJA 1ZAHA 2ZRWA 3NQ2A 1LT7A 2Q6ZA 4XSMA 3O6YX 2DFAA 4EF8A 2Y7FA 4K37A 1Y5XA 1ZAIA 3BQ6A 1OT1A 1E3ZA 1W5OA 5CC5A 4M24A 1J0KA 2XIIA 3ZOAA 3VNMA 6XIAA 5A6KA 7A3HA 4C5YA 5DEZA 2J9XA 3ITYA 4ZEPA 3GH7A 1KM5A 3UP8A 4H7CA 3M46A 3O0FA 4X2RA 1KGUA 4ACZB 1H11A 4UQ9A 4EPEC 3E3HA 2DZAA 1BYAA 3AYSA 4H2HA 5I00A 4RR4A 3VMOA 4AMAA 3W1NA 4AU0A 4YTSA 3DEQA 1TPH1 4A2RA 4L1GA 2VT0A 3HIJA 3W01A 3TFCA 3URBA 5IDIA 3STPA 3VZZA 2Y85A 3WBEA 1R0MA 2TPSA 2EPNA 1TMLA 3W7NA 3WDRA 3T4CA 1ICSA 1TPVA 3KZPA 5A69A 1TUFA 1O68A 5C5YA 2OCZA 4KCVA 4E8GA 3TOYA 3GG0A 3MI2A 4MM1A 3ARPA 2F2HA 1JNEA 3FSUA 3MC5A 4HA3A 1FX6A 1OYAA 3C8NA 2J24A 1DHKA 1CWYA 4AZ6A 4NZFA 2PZ0A 1KGXA 4XKMA 2I5IA 5DO8A 1CT5A 1J8VA 3XINA 1TV4A 3TYEA 2DV0A 2V81A 1AZ2A 2FZBA 2XH2A 2Z26A 4ADTA 4HNUA 1MMFA 1F3WA 3MMDA 1UKPA 1EGZA 2EGZA 2BOGX 1J11A 3ZS4A 4OOZA 1YTEA 3N18A 1JAEA 2Z28A 4LFYA 3BZJA 1D3CA 3W73A 1ICQA 2QJGA 4ZO7A 2E28A 1SSGA 2WLZA 2A3BA 4DNHA 1E6QM 2REQA 4HD5A 4DO6A 3A47A 3FVMA 4AVFA 3QV7A 2J8TA 3KDNA 3GFXA 1RLDA 4GIRA 3CUIA 2HS8A 3KS6A 4WDXA 3EMQA 5EMJA 4FAMA 1YXCA 2NQZA 1GVSA 2J7FA 3DGBA 5LIUX 4LC6A 3PBUA 2DSVA 3UG3A 4F40A 4S39A 3I3BA 2Q02A 3W1TA 3QY7A 2Y8KA 3VOFA 1EJXC 3A4AA 3DUGA 3WQGA 3BVJA 1J5SA 1ZPTA 2EJAA 2WBKA 1ELSA 2QCDA 3WEMA 1MO0A 1JCJA 5C9WA 3UJEA 1O66A 3PUDA 2OQLA 3QW4B 4PTXA 2A3CA 1QI4A 1XDJA 3THQA 2VGFA 4AD0A 4BA0A 3FKRA 5CXPA 5BXTA 3T2PA 4DBDA 1LOLA 1LOSA 4TTUA 4LNYA 1OFAA 4L65A 3S4TA 2Y7DA 4ECLA 2DH3A 4PUJA 4WQ6A 1VR6A 2PZNA 4OBSA 4LYKA 4MAVA 3IVSA 3WL1A 3ATZA 3TYDA 1M65A 2W6RA 3IAPA 3F4NA 1KLZA 3LM3A 3GKAA 4JIEA 2VR4A 1RA5A 4U28A 5FJUA 1FHLA 3JW7A 1VYRA 1YE4A 1SZNA 4P61A 2CERA 4HMNA 1KR0A 4GC4A 3EA1A 4GZJA 5M17A 3BGAA 4ZQNA 3GFZA 3FJ4A 2X09A 2XN2A 4HPHA 4S3EA 1F74A 2FHCA 2DSWA 5I07A 2CLOA 1EJUC 3LBMA 4IP7A 2H3BA 2I5GA 4JTRA 3H6OA 3M41A 1BVNP 1ECQA 1TWIA 1SVDA 1E0TA 4C65A 5EGRA 1R5YA 5CSYA 2BV9A 1XS2A 1DWJM 5DQPA 4H9MA 4GLEA 1F73A 3WUGA 3W02A 5XIAA 1TSIA 3DXIA 2WWCA 4PMNA 3R7MA 1W9VA 3LUTA 4YHEA 1I2QA 4U31A 2OB3A 1AQFA 3N04A 2WZHA 1QNPA 2VNCA 3W1RA 2VVNA 1GORA 1KTCA 5I77A 4IPPA 1I8JA 3CH9A 3K8MA 1NJJA 2PUZA 4HK7A 4N0RA 3GG1A 4JYFA 4I5RA 3EWBX 3KBSA 3AHYA 2OKTA 4GINA 4NXKA 3ZT5A 2J47A 1GOXA 3RPTA 2CXEA 2OODA 3AS3A 1BQCA 4ICNA 5HPCA 2Y24A 3IJIA 1AQMA 4JDYA 5T26A 1ISXA 2D22A 1TPFA 3P93A 1RBLA 3WSUA 3SRKA 4DIAA 1LWJA 1JUKA 4WXYA 5AC4A 4MLRA 1Q6QA 2NQLA 4KBXA 1US3A 4FP1A 2I9UA 2QIIA 2Y2WA 3RLGA 2D24A 4C90A 3GLCA 1PAMA 2X40A 2DT0A 1GQNA 3VZYA 3MSYA 4OFCA 4NJJA 3LI1A 1DWHM 2PLJA 3KCJA 2R1NA 4M29A 4FHAA 3FEMA 3QZAA 1V8EA 3PS7A 1HVXA 4MNMA 1DWGM 3DYPA 3L4UA 4IZGA 2XFYA 3NO5A 5CBBA 4V15A 3RK8A 1WOAA 3WNNA 3S2CA 1FDYA 1RK5A 4OJYA 3W2KA 5I3DA 1HKWA 1BYCA 1U1UA 1RR2A 1KCLA 2IXVA 4OOUA 4UTLA 2BLEA 3HURA 3C0JA 3M0IA 4QDPA 3VIHA 3PG8A 4O1AA 4K7VA 1GT8A 1Y0EA 2XIBA 5D03A 2CC0A 2RDTA 1AA1B 4JFVA 1XG3A 2Z6IA 4E3VA 4HMEA 5DELA 1OEPA 4Y8EA 3LNMA 2DY3A 4K3ZA 2J79A 3N2CA 2BOEX 2PDYA 3P14A 3TOPA 1VHCA 4C6FA 4GBUA 3MBDA 2F6KA 4S3DA 3UJRA 4RNHA 1NWSA 2DZXA 3P8JA 1KQYA 5M1TA 1G5AA 1FCVA 3WUFA 5D9PA 3QW3A 3MB9A 5KZDA 4PUNA 4EWND 4HNLA 3GIPA 4HU4A 4IMCA 3AZRA 5D2TA 8XIMA 4H6RA 2PE4A 2WQDA 3NQEA 4M82A 3CT2A 3SBFA 3UZXA 2EKCA 3RCNA 1JVNA 3DFSA 4Q4KA 1J4EA 1P7TA 2QV4A 3DHUA 3GUWA 1XIIA 3BLKA 1VENA 1T0OA 1DL3A 2VELA 1OIFA 4BR1A 1YDOA 1K9FA 4QG9A 3HU7A 4HN4A 1PS9A 4LBUA 3LBOA 3QF0A 3A5VA 1LOQA 2C71A 4GI9A 4FA3A 3F4DA 1N2VA 3AYRA 3TTOA 5FESA 1DKWA 1LCOA 2CCRA 1Z42A 5CKSA 5BNKA 4LB4A 1MFUA 5EFFA 4QLKA 5A8MA 3WQEA 1H41A 4P7QA 1Q4NX 4J1OA 4BQ5A 4KMQA 3EPNA 3QV9A 1XRSA 3E0WA 3CUJA 4GH3A 4MNJA 4GXPA 3W2UA 2JIWA 4JTSA 4X9SA 1XKYA 1JQVA 4N9DA 2YGYA 1A4MA 2WMIA 1W9BM 3WG6A 4MADA 4AEEA 1LL6A 4DX3A 2XH0A 3GVRA 3TMLA 3WBWA 1XKJA 4O15A 5AB3A 3OA3A 3MI3A 3W7MA 4AYGA 3OGVA 3R8GA 3RGTA 1AUSL 1UBPC 4LBRA 3CO8A 2WM0A 4KH2A 4A22A 5BRPA 2FMOA 1OB0A 1VYPX 1W1PA 2PURA 5D9OA 3KRZA 4AUBA 2OT1A 2HE8A 4NAFA 3NURA 1GVEA 3NL5A 5SWUA 1JI2A 3PZGA 3RO6A 3ZR4A 4YXGA 3S6TA 4C1LA 3MHUA 3TLLA 3IJDA 4PMVA 1VFOA 4PMJA 1XFCA 3FJNA 4IMAA 1JCNA 1VJZA 3EWDA 3VUPA 2IMRA 4EXAA 4TOQA 3ZJ6A 1N8FA 2GJXA 2VEPA 1FBAA 4DJDA 3AJXA 3WLOA 5C9XA 4REQB 1EBGA 4H9TA 1GOKA 1H4PA 4DUWA 1EGVA 2QS8A 3O8AA 5K9XA 4GVGA 1GUVA 3CZGA 3CMFA 4RE2A 1S2CA 2HBXA 4NI8A 4HJWA 4C6NA 5FCZA 4FIRA 4IFKB 3MO4A 1VH7A 1H2JA 2WKJA 4AZGA 2BODX 1J0IA 3ABOA 3N6JA 5LZLA 1B30A 5CJ5A 3UVAA 5FAGA 4AD4A 3WDPP 1VFSA 1MZRA 1V6TA 4MUZA 2HZGA 1QK0A 3VXGA 4J3ZA 4OIFA 2J27A 1M7XA 4W89A 4GGHA 1FHVA 1WV2A 2HNEA 5I78A 4V1XA 3PFMA 4Y9MA 4LS0A 4QJ5B 1W54A 4POCA 3V75A 1ME9A 2INZA 3B0PA 3B40A 1GEQA 1JCTA 4E5TA 2Q8ZA 1H50A 4I6KA 3NEVA 4YCPA 5JIWA 4HOZA 3PNUA 4RUBA 4FLRA 3GTFA 1KR1A 1FWNA 4QBXA 2A3HA 4UTJA 4NJGA 2I17A 2D2HA 4L9YA 1CENA 2YJQA 1SW3A 4HHMA 4NASA 3RLVA 1XLKA 1UH3A 4L56A 3UZYA 4C60A 3GNPA 3W82A 1PO9A 3SRFA 3N3TA 4Y8FA 1BKHA 3W1PA 2GQ9A 5KETA 3AFBA 3TV8A 2QMKA 4H9VA 1XUUA 1ADSA 2PTZA 2HPIA 1DTUA 4FLQA 1CB2A 4LJ3A 1H51A 3PJTA 4Z2LA 3GC4A 1XSJA 4MUPA 3TJLA 2HV5A 3EXRA 1MSSA 1NSJA 3VIGA 2YR1A 3UQNA 5CZSA 2VR5A 1DJZA 5I3KA 1R6WA 2XIMA 4JFSA 3WQOA 5H2ZA 2GYIA 1UH2A 1KBLA 2GUBA 1AJZA 2KAUC 4MPKA 1OZMA 4MYXA 1LJYA 4XIAA 3I10A 3GNNA 1OCQA 3CQKA 3JU2A 5CPTA 5D2WA 3CPUA 2CU0A 1PPIA 3DFQA 3OODA 2C0AA 4LVFA 3DG7A 4W9TA 4A05A 4A4AA 3BJTA 1T5AA 4QCFA 1E6SM 2VI0A 2DP3A 3COTA 2HE5A 5E5CA 2C79A 2I7GA 3IRDA 4GFIA 4HNTA 1DP0A 2QR6A 3WK1A 4UNIA 3S9ZA 3VABA 2EPHA 2Z1XA 2E4TA 1CTNA 2I56A 2A7RA 1V6XA 1V0NA 4DI9A 1LG1A 5F7UA 3GAKA 4L9ZA 1J5TA 4QITA 3QSTA 1KRAC 1J12A 3W23A 3H55A 1XDLA 4KWOA 3JUGA 3S47A 4I7WA 1L6SA 3O3RA 1JZ8A 1EIBA 3S5ZA 4DM2A 4CUCA 4NZ3A 2ZXBA 1CXKA 4OU1A 3GIYA 1IT0A 3N4FA 4QISA 4DF2A 1WDRA 2Y8UA 1EXPA 1M7JA 2VCBA 1L8NA 2FJUB 3QLLA 3R4IA 4XZBA 1HFBA 2BX7A 2DUAA 3PAOA 1LM1A 2IPGA 5CC6A 2W63A 1FWDC 3ARZA 3WQ6A 1SZRA 5FL1A 1UZDA 3MMTA 1EGMA 3NPWA 1JPKA 4A3QA 4AZ5A 1Z3NA 3FGCB 1Q8AA 4FB7A 2GSJA 2X1UA 3SADA 2DGAA 3APGA 1O94A 1SJBA 3MUAA 3M0HA 1VFTA 2OR2A 4FX8A 1MRAA 4DO4A 3UR2A 1R3TA 1QI5A 4NAEA 3MKVA 4LVBA 1ZY9A 1QDSA 3LEPA 4YTTA 2DQXA 3SUWA 2WPGA 3F2DA 3GZ3A 5HINA 4M19A 3HF3A 5L6UA 4UQDA 3LZ5A 3TTEA 3PTKA 1MDRA 4LS2A 3F4CA 1B3XA 4M81A 2NQJA 3FHQA 5FJRA 1JPIA 5C0QA 2C0HA 4U5IA 4LC8A 4ASTA 5H8PA 5CLWA 4XG1A 2OSXA 3TROA 3EKZA 3C0QA 3APTA 1O4UA 4S3JA 1A5UA 3OTRA 3L21A 3HGSA 4AZBA 5FF2A 4JKKA 4FX7A 4EE9A 4CGTA 2QCMA 3BICA 2ZADA 3VDAA 1YTDA 3CJPA 4KS0A 4NJIA 2VTFA 2FTPA 1PCKA 3FDKA 2F8QA 1TRIA 3O0KA 4PA8A 3S9YA 5CBIA 3WNLA 3QYQA 3TX9A 1PDZA 3ZJKA 2OFJA 1JZ2A 1B9ZA 2DEPA 4ORIA 1A80A 3M7WA 1R3VA 4KWVA 3VNKA 2PCQA 4D1IA 3OBKA 1YBQB 4JN7A 1XIDA 1QT1A 5JH1A 1KNWA 4LRTA 3MY9A 2BHYA 4YMZA 4GJJA 4HBKA 1JXKA 4JXCA 2QULA 4B5SA 4WOQA 4LU0A 4UMCA 2W3ZA 3OZPA 1OK4A 3NIYA 2D23A 4W7UA 2OYMA 1A49A 1KGWA 4HNVA 2VEFA 3RM4A 3LCLA 3P67A 4I9MA 1CDGA 5CPLA 4Y9OA 2FTWA 3WLSA 3F2CA 1L8PA 1BQGA 3V18A 3N12A 3G77A 2OZ3A 4ALDA 5CZJA 3CO4A 1HUVA 4GZIA 4G7FA 3BAXA 3RR1A 2JBMA 4TUFA 4MGGA 1NP0A 3USBA 3UYCA 5M5DA 4KGLA 4KKXA 2ZIDA 1GYNA 4R27A 4UCFA 3T9PA 5AYIA 3T55A 4F0MA 2QDGA 1W3LA 1SR0A 3ORWA 4J3WA 3QM3A 2A7PA 3BARA 1D8CA 1PYFA 4GNKB 4X0NA 4NX0A 4WSJA 3KLLA 3B05A 3GU1A 5AHMA 4R88A 3VYLA 1QUMA 3HA1A 3NQ6A 2WANA 4YS1A 2JALA 3SUVA 1H09A 4AVOA 1Q6OA 1WP6A 1CB7B 3UGVA 1TCMA 3URAA 3G0SA 3LGEA 1GYLA 4HCHA 1W0MA 4TX9A 2YBTA 1HTIA 3NO1A 1YDNA 3WQVA 4DZHA 1F05A 1VEMA 3IUHA 4BQ2A 4R34A 1EWEA 3CV6A 1QXLA 3FIGA 4E4FA 1ZJIA 2VZSA 3UERA 4XZWA 1LRTA 2JE8A 3E2QA 1V0KA 4NNAA 4C7GA 5LHEA 3RITA 1XSKA 1BG4A 2QKFA 4DYKA 4JFUA 5DBTA 1QW9A 5M3WA 4FNRA 4QE1A 1ZGDA 3E74A 1EDTA 1HKVA 4W5UA 3DAQA 1C29A 4ZOCA 3W3OA 2QNEA 2WW5A 3QMTA 1YEYA 1MUWA 3DERA 2P53A 4RZ4A 1TX2A 5ABFA 1MYRA 1QPNA 1UYQA 4NZ4A 3CUXA 4PCSA 1D2KA 5TQLA 3LRKA 3U7VA 1UUQA 4AY7A 1GVQA 3FNDA 3P84A 3SUUA 4E0CA 2J7EA 2FHBA 4M0XA 1W1YA 1WDWA 1VFMA 5A6JA 4LV9A 3TA9A 3TAKA 1M1BA 2GFTA 2V9DA 4J3VA 1N8WA 1WYIA 5HULA 3VCNA 4XWUA 1HKJA 1OCNA 1C9DA 3M0KA 3U9IA 3W1QA 2X8RA 1US0A 4Y9NA 3GY1A 1V79A 1TJ1A 4PMUA 4AW7A 3VUSA 1W56A 4PTMA 1EYWA 4XZLX 3QXBA 1CIUA 1EJWC 3GSMA 1LUCA 3KEHA 3FA3A 1QPQA 1P48A 3BJSA 1DYSA 1VCFA 3ZFHA 4DY1A 2Q8XA 3LTPA 3NEHA 1OG6A 2GJNA 3CWHA 3UYIA 1TMHA 2FDSA 1R3YA 3LXAA 4JICA 4HZ6A 3ZWTA 3DI0A 1QWGA 2E5CA 3ARTA 1JGIA 2NXHA 1GYMA 2UV8G 5G4WA 1UJQA 3MKCA 4F2TA 1FXPA 1EZ2A 4W93A 4PMRA 4DLMA 1BXCA 3LDVA 4GQRA 3W9ZA 7REQB 3RX3A 4HMCA 3SURA 4QSFA 3HMCA 3L68A 2FPVA 2ISSA 3DFNA 2V3GA 3VVGA 3I3EA 1S1RA 3TZNA 2QEZA 1K70A 1UWIA 2TSYA 3PZOA 4V27A 2DVXA 2PB1A 3D0CA 3AXXA 4HNOA 4IFRA 3IPWA 3EMZA 3MA8A 4H04A 4DM1A 1PCWA 5HAOA 4IMDA 1R38A 2BZNA 1VPYA 1JD9A 2XM2A 3AU2A 4KCWA 1SUXA 4A3UA 4C5ZA 1FCBA 4KIRA 1V6UA 3MWAA 1BSLA 4Y96A 3I68A 2GQAA 1O5KA 1WDDA 4A8NA 4QNWA 4LH8A 4FXRA 1B9BA 1OFQA 2WPBA 3BSGA 2C1HA 3WF1A 1U1JA 1Q7ZA 4Q7BA 2WVSA 5MKGA 2AL1A 5I79A 1FVPA 3V0SA 3VIOA 3Q65A 2WOQA 1R2SA 3CTTA 4QQUA 1E3XA 2P0IA 4C1NA 1PWMA 1OWQA 1QOPA 3O06A 4DJEA 6REQB 1GQLA 1HJSA 1S3HA 3DOPA 5GPRA 1W37A 2EAWA 4KWWA 4QLJA 2PODA 4ACYA 3C2VA 1BG9A 5A6AA 1TTIA 3H4GA 2B7NA 1OJXA 3P5ZA 5BMXA 2VFEA 2OKOA 3PSWA 3TC3A 4XKYA 4ZMGA 3TIMA 4GQBA 1TJ2A 1TJ0A 3H2MA 1E9LA 4P8UA 3OQ8A 3KZSA 5U7SA 1K4HA 2QGYA 1F6PA 2OMAA 4YTQA 1FFQA 3GDLA 6XIMA 1E5JA 1KM4A 3AC0A 1S2TA 2V82A 3SQSA 3Q4DA 2ZE3A 1E6ZA 3VNZA 2GWGA 3ID7A 3NM3A 3QEZA 4YLWA 1BD0A 3EA3A 2ATSA 2CW6A 2E40A 2PI6A 3TC7A 5DMMA 1GVOA 3NSNA 4OUIA 4NIRA 1WA3A 4IPIA 3W24A 3QZ6A 3DFOA 4G2DA 5T8GA 1ME7A 2VEGA 3M1ZA 4H8VA 3RDKA 3WQCA 1T8QA 4H2CA 3CIXA 3ARRA 4HYRA 3VZXA 2CYGA 2PWGA 5AC7A 2P0OA 2PDMA 3T42A 4AC7C 2REQB 1QHPA 3LSBA 2QW5A 5HATA 4CN6A 2CHNA 3HM7A 1DTNA 3E1F1 5G4HC 2WYSA 2YXGA 3WD2A 1OBAA 3S1VA 1HIZA 1LYXA 3R0UA 4JTKA 1Q66A 3M64A 4O18A 2XWDA 1S1PA 1K9DA 1AODA 4RLIA 1FOBA 3KRUA 2PP0A 5I23A 2O92A 4KFNA 1LQ0A 5C9RA 4QR6A 4XX6A 4YWIA 1KKOA 1SZEA 2Z1KA 2QJJA 4CNPA 4Z2JA 5RUBA 1OCJA 3B9AA 5GQBA 4GD0A 1OM0A 1B5TA 4Q3MA 5CLTA 3LMYA 4JD4A 2ZXQA 1YQ2A 3K8LA 4MFEA 3PUEA 1RCXB 2QCDB 3GHRA 5FAJA 5BU6A 4G8TA 2ZA3A 2EKGA 1PYMA 2VD8A 1EX5A 5FKYA 1E6NA 2DZUA 2ZYFA 4R33A 3ABZA 3GC2A 3R79A 4G7EB 1W9XA 4HU8A 1O12A 3AZTA 5FEPA 1DJQA 3UBPC 1E71M 2YCLA 5DY3A 1A4LA 3VA8A 3AYTA 1DXIA 3CXOA 1JULA 5AYYA 1KFWA 4Q8QA 3GFYA 2GQ8A 1UC5A 4CCDA 7ODCA 1QW8A 4JIIX 1UD4A 3ME3A 4FOKA 5A6LA 1VEPA 4DHGA 4RDYA 3VMNA 4MOZA 5I06A 4GUHA 5HMEA 3H8AA 4A35A 4B3KA 4J7RA 4Z2GA 4KEZA 3AUJA 4RK8A 4IG2B 3UNDA 2JEQA 3PJUA 1CZ1A 1VAHA 2VUYA 3SW6A 2VO5A 4PMXA 3EB3A 4XAFA 3HTWA 1UR8A 2YCIX 3WENA 4X61A 1K8CA 1MEIA 2XGZA 4CKQA 3S0CA 2QCHA 1EO7A 4W5ZA 2YDSA 1R86A 3ISIX 3OLEA 1OIMA 3TFXA 1BYBA 3S6DA 3L4YA 1KBKA 3KTXA 4LYQA 3PP7A 1K77A 4WR3A 3E6EA 1RCQA 3QV8A 3MUXA 2Y61A 4GUIA 2DZVA 4UUIA 1XM3A 5KZEA 3NZ1A 1TV3A 1RK6A 2UZ9A 3GW3A 3GKFA 1L6GA 1EH9A 2BP1A 3IJ9A 4NVTA 3TYCA 1DORA 3EWUA 4CD5A 3GS6A 1WZAA 1Q2RA 4DZ5A 2VKZG 4V33A 1MRQA 3C2EA 3BLEA 2BXVA 4ZB2A 3S1WA 3KBNA 2WCAA 1PE1A 1B90A 1Y7VA 3ZYZA 1Q13A 1QO2A 3KOXA 4U3AA 3QR3A 3YPIA 3DKLA 1OFEA 4QS6A 3PPCA 4B5XA 2OLAA 4KPLA 1IEIA 1U22A 2O56A 1ZUAX 3R13A 4DXXA 1T99A 1ZJBA 2BY0A 1OGGA 2QCGA 3W00A 4RXGA 2A6NA 1HXJA 2WXDM 1I1XA 1HKKA 3B8IA 1R46A 5E0KA 5E09A 1AW1A 1JYNA 5HQLA 3VKJA 3BCDA 4ZOEA 5HXMA 3PC0A 1A5KC 1ME8A 1M41A 4TMCA 1IEQA 4XAPA 5DXYA 4GKTA 1TRDA 4O1FA 1PTDA 4ERGA 2VWTA 3UT0A 4IX2A 1J01A 1QU4A 3QZEA 4B2DA 3ABSA 3HGJA 4WY0A 4Q4MA 4UCGA 3IWPA 4MDPA 2CBUA 2A85A 1Q6LA 3B8SA 2FJKA 1W3NA 1XINA 4UC5A 1JZ5A 2RFGA 1TB3A 4RPQA 1KM2A 2PRLA 1W31A 4US6A 1UROA 3QTPA 2PMQA 5HPOA 3OIXA 3K30A 1LZOA 5BMWA 2O4MA 3SCTA 1YNQA 1OFPA 4ZQMA 2CHOA 2QJNA 1Z6KA 4YYFA 4E2VA 4TO8A 3SN1A 1EHNA 2X41A 3H54A 1TIMA 3UZ5A 4GFSA 2PWFA 2OOFA 2Z00A 5B7ZA 5DN1A 4IF2A 2FVKA 3T07A 1ZP3A 5TNVA 3M0MA 2H8XA 1GVFA 2ZUWA 4K8EA 1IEWA 2OZ0A 4CD4A 3BAKA 4IUGA 5LNWA 4NNCA 3MBFA 5JQ9A 2XIJA 5BYWA 1W1IE 3L2MA 1IGWA 1DE6A 2QXWA 2HPMA 2X16A 1AZ1A 2A5HA 4KCUA 4JQ2A 5E1QA 3DN5A 4CD7A 2UBPC 1FWRA 1I9CB 3BLIA 2PP1A 2DU2A 2GDQA 2W79A 2VX5A 2VX4A 1WUFA 3LERA 3UFYA 3W7KA 3W71A 3MWCA 5F1VA 1QAPA 3FK4A 2BFGA 1GHSA 1B2YA 3TSMA 1LQAA 1KTNA 2FIQA 2GGHA 4H19A 2J9ZA 3UZJA 3WK0A 3CAVA 9RUBA 5EMUA 3TSBA 3V5OA 4RX0A 1DWIM 2OXNA 3SCUA 3V3WA 4IQDA 4BWLA 1UZHA 1ZAJA 2G96A 4BCEA 5DXXA 1SO6A 4JZ5A 2OWWA 3STGA 2ALRA 3O05A 1ITXA 4KEMA 4AB4A 2A7NA 9XIAA 2ZFAA 1MQQA 4W7VA 4QFUA 4YN5A 5HUPA 4D6FA 2XFWA 3THAA 1KRBC 1BXNA 5AY7A 3TN6A 1VFHA 5CPOA 3POHA 4NAFB 1K02A 1R2RA 3QC0A 3WK2A 2ZA1A 1FWGC 4MB3A 1A5LC 4X60A 1O95A 2GDVA 3ICJA 1K6WA 2AMXA 2D2JA 1DEDA 1KFBA 1MUCA 1E43A 6A3HA 1RBAA 1K8YA 4J3SA 1RAKA 3EX1A 2G3JA 1NH6A 2V2DA 4Z1DA 4LAZA 3M9YA 2I9EA 2VQUA 3B9NA 3S1UA 4W88A 4GKLA 1TE6A 1QW7A 2J9YA 3LU2A 1B4KA 4LCRA 4C6BA 1W5MA 3DKJA 2BNJA 4I7UA 1IT8A 5C7VA 3SAZA 3CUZA 3PB2A 3G22A 4HSNA 1SPQA 3GW0A 4DWDA 2L5HA 5JBFA 1F4AA 3BLDA 5KZ6A 4UBPC 1AK5A 3PR2A 4AHOA 4O57A 2CFFA 4MJ2A 4NJKA 4AD1A 1T40A 1SM9A 2XVKA 4O52A 4RL3A 3UZWA 4ZQOA 3L7RA 4FIQA 3B0YA 4FNPA 3WEOA 1IZKA 1LQ2A 1TWWA 2AAMA 3C0LA 2H9AB 5CPMA 4S3GA 4INFA 1C9WA 2NQHA 3KXQA 2ZUUA 2IW0A 1PHWA 3QHMA 1Q6DA 1UUOA 3NSXA 3TQVA 3LB0A 3H12A 3W28A 3W7JA 2CWXA 4V1YA 2C7FA 4GZ7A 1UKSA 1K9EA 2X30A 4Q7IA 2RH9A 6CGTA 5D4YA 2I1OA 2NZLA 4L4PA 2DVUA 3SN4A 2ACUA 2X42A 1D8WA 1K03A 2MANA 3IARA 3S3GA 3T7VA 1HJUA 3RIKA 4HK6A 4QE4A 4PMDA 3VO0A 4E3TA 4QP0A 5A5WA 4R7OA 1P0KA 1HJXA 1H62A 4E38A 2PWHA 4NQ1A 4U5KA 1R8LA 1UWTA 5HJXA 3G5EA 1FWEC 5D04C 2ZWYA 2PWUA 2XVNA 1JDCA 2WZMA 1G67A 5F4XA 1J0YA 5A94A 1VPXA 1KFKA 2E1DA 1O5RA 4C6JA 2ZUVA 4LF1A 2QUUA 1J18A 1XGZA 2BHUA 4UNLA 1B3VA 3VM7A 3U0HA 4I8YA 4AISA 2D20A 1JCLA 3PN8A 1WPCA 5CAKA 1YX1A 1JZ4A 4Q8PA 3IUIA 4ZTXA 4Y9PA 1HKMA 3TKFA 4O8AA 2W0UA 3NZGA 3CGTA 4CU6A 4G9PA 3I3DA 2FGLA 2WK2A 3MYPA 3SUSA 2ZUSA 3WD3A 3NPXA 2Y5JA 1VQTA 3VIKA 4HOXA 3BPWA 3RJYA 4LVGA 4H6QA 3FA4A 5CGTA 1XH1A 4K39A 2E9BA 3TSDA 1BRLA 5FIPA 1JPHA 3WQFA 3OZOA 1Q6EA 3A64A 2ZTKA 1U30A 3E2SA 1ONWA 2NUYA 4IFOA 1UR9A 5IHSA 4PMQA 4YCOA 4W4QA 4E4UA 4PUKA 3IJ8A 4ONVA 3WQ4A 3THCA 3L9CA 1SZGA 1XLMA 1MXGA 2TMDA 3WFZA 3CB3A 3C2OA 3DC0A 4D8ZA 2V5BA 2QPUA 2B4GA 3U2EA 1UUMA 4Q4QA 2OEMA 1KFJA 1U33A 5I7GA 2ZZ6A 1FWIC 1IV8A 2ABAA 1XXXA 4X63A 4KFPA 3RX4A 1XLGA 1UWQA 4Z42C 2Y4SA 4IMEA 2CIPA 2D1ZA 3AWNA 4FS9A 4CNNA 5HWNA 3TW7A 1IEVA 1H49A 1RHCA 1OGSA 3OGSA 2YIHA 1VLWA 1XIJA 2G4FA 3V1PA 1K4GA 3G1SA 4E4PA 2AKMA 1M5WA 1EJ7L 2R9RA 2VEIA 2CBJA 2HVOA 4PN2A 2F9RA 4ZQCA 4ZQRA 2WNZA 3D5HA 1BXBA 5A8OA 4DYEA 4AZHA 1Z7AA 4REQA 4N2YA 4FXSA 2HQAA 1DQXA 2Z1BA 3T78A 1Q6FA 2R1PA 2EHHA 5CC3A 4URIA 2PDIA 3NQ8A 4F0SA 1JAKA 4S38A 5EB8A 3ZLHA 3QHNA 1S2UA 3K1DA 3K13A 1H7OA 4HB7A 1W5QA 5HK4A 3VIIA 1RALA 5CZKA 1JPMA 4MPQA 3R11A 3E9AA 4YU1A 5LNUA 4DXVA 4D6GA 3UR5A 3G3MA 3GK0A 4JN8A 4OECA 2VDIA 3LNPA 3VCRA 4LUSB 1TZ7A 2VWSA 3LCFA 3T08A 3POCA 1RY8A 3WLTA 4P2VA 3SRDA 1FCUA 3L0GA 3BAJA 1QOXA 4K1WA 1XC6A 1JFXA 1SO5A 2H8ZA 3SUTA 3VPLA 3AUOA 3MU7A 3PBMA 1WB0A 1EBHA 1CXHA 2GZXA 4RDWA 5HOSA 3C2FA 1EF3A 3ALGA 3WDJA 5FA5A 3Q94A 3AOFA 2P88A 2PDUA 2F61A 1WKDA 1RV8A 1NFGA 3SFWA 2FKPA 2OSWA 1E51A 2EXOA 4NILA 5F2MA 3EWWA 4P8VA 3VGEA 3M0JA 3NVDA 1V7AA 4RZ6A 4R9OA 1BLIA 3A22A 1PKMA 1LTDA 4GI6A 3H22A 1X1ZA 3KTCA 3MDUA 4KCTA 2Z0IA 1F07A 3CHEA 3UWVA 4N6EA 2PLKA 4V2XA 1S5WA 2C19A 4UQBA 1VF8A 4XUYA 5MF5A 3LHUA 1CCWB 1UASA 3TK7A 1XUZA 1JDDA 3IRSA 2GK1B 3VKAA 2J6XA 1Q6CA 1G4EA 1E4MM 1NWRA 3CH0A 4OWGA 2GPTA 3MTWA 3WH5A 5CJMA 4ZCWA 4IH3A 4EF9A 2A79A 2E09A 2IS7A 5IHRA 4B4FA 2WHKA 3ELFA 3KOFA 4UFJA 1NQKA 2EJ1A 2BVDA 3I6RA 2G8ZA 4HPXA 4EPDC 1HJQA 1TJPA 4RE0A 3FYOA 1WDQA 4XBSA 2ZQ0A 2G95A 3Q37A 2QJIA 2C13A 2VDGA 3RO8A 1H3GA 1EX1A 1S3TC 3NVTA 4JTCA 1V93A 2C16A 3BG5A 4O54A 3TMQA 3AZSA 2QDEA 4GVIA 1X97A 3R94A 4D9PA 1MW3A 1B3ZA 3RG6A 1W1A1 3I7RA 5TBOA 2O9PA 5D02A 3P0WA 4WLCA 2ZZ3A 3MSGA 2W67A 1EJVC 3WIJA 3WMBA 4C7DA 2NT1A 3K4DA 4F79A 3TCEA 1VCVA 4QGCA 1VFUA 2G0WA 4J2MA 1TWZA 2PGEA 3GX9A 2I5QA 3WNKA 1ZU8A 1B4EA 1FHDA 3NXFA 4M80A 2A6LA 4BFAA 2WJFA 1Q8JA 1GW9A 5K2ZA 2B81A 4IJCA 4H7ZA 3KL3A 2CEQA 2PEVA 3FGCA 4D8AA 2HEJA 2J7DA 3CQIA 2PP3A 3URNA 2O7SA 4B2DD 3KVKA 3V0UA 4XVEA 3RF9A 5BRBA 4Q4PA 1OZQA 5AECA 3USZA 4KRTA 2CBIA 5H8MA 3W53A 3KHDA 2POTA 3N25A 3ES7A 4WIWA 2VURA 1HVQA 3TNOA 3ZSSA 5EL1A 3AMLA 3B4UA 2V67A 4J5NA 1NWUA 1XGDA 1WO2A 1YHTA 4BZYA 1J6PA 3CV7A 4DPQA 1SFJA 5D2YA 2FVLA 2ACQA 3GNXA 4WGXA 1LUCB 5A2AA 1W2PA 3VOHA 3IGUA 4OQVA 2XH4A 4K38A 3E5BA 2VDHA 3A4JA 4UQCA 3U5UA 1GJWA 4CQBA 2ZXAA 2DT1A 4ERIA 4BWLC 1U2YA 3KRBA 3FHAA 1GHRA 3P0XA 2GGIA 3QSRA 4XQ6A 2HVNA 3AMGA 4BK9A 1XYLA 3JZEA 2W4XA 3W74A 4ZSTA 2IQ0A 3LY0A 4PRRA 2F38A 4NZ5A 1H5VA 5LIXX 1A3HA 1A53A 4L7ZA 3RN6A 2R82A 4ZENA 2O9TA 1TJRA 1HF6A 2YZ5A 4GZEA 1VJSA 3ZXWA 3LHWA 2PDFA 1TV5A 5KEZA 4J3XA 4UR7A 4CCEA 2QAPA 4IOTA 4I9TA 3CUFA 4Y2WA 1ALDA 1YBQA 2DPEA 1W8SA 3GDTA 1XLDA 3U2CA 1UOKA 2DT3A 3EEZA 1V3HA 5IRPA 4N6FA 1H7PA 1EPXA 4Z2KA 3EDEA 5FD0A 1E1FA 4HU3A 3NOEA 4UTWC 2ASHA 4DO7A 5MKGB 4IMFA 2BTMA 1WDSA 4Y6GA 4WXZA 3WJWA 1TYGA 1RUSA 5EKYA 2FYMA 4GCAA 2GQ3A 3OB8A 3DDMA 4I8DA 3DFTA 4GUFA 2ZZ4A 4C1NB 3WDHA 1VGAA 1CGYA 3BLLA 4ZODA 3E2VA 1JFHA 3LENA 3QHOA 1CGWA 4HYWA 1F2JA 1XRFA 1J10A 4BS0A 4XBKA 1FWTA 2YCJA 1KXVA 3KWXA 2ZVIA 4I9AA 2PTDA 5KSWA 1VIWA 2XUCA 4TXEA 4FLOA 2IKIA 3NGFA 2ZX8A 4XKYB 2GL5A 1X1NA 3W6YA 1AD1A 3UXDA 5DMLA 5K4ZA 2Y1HA 3Q58A 1OF8A 2X1IA 3CM4A 4HZ8A 2PGWA 5CG7A 3W25A 2VEMA 2PDGA 4IP5A 3VKBA 1NDWA 4PMYA 4HA4A 5A6BA 1XPYA 3BL3A 1OCBA 4AEFA 5L9FA 4AD5A 5F2IA 1OT2A 2WVVB 1CLVA 5LHFA 4AHQA 1OK6A 1BWLA 1LROA 4WUIA 4E2BA 2C1IA 5J5RA 4NX5A 3GNOA 4HTYA 5AVHA 3VIJA 3K1GA 4MYAA 3CZEA 4EPKA 2OGYA 4GYFA 4MY1A 5F1UA 4U10A 1XIFA 1VP5A 3G1AA 3EWZA 4UR8A 2A21A 1R3SA 2J74A 4PCTA 3A4WA 3BG9A 3B03A 4QDWA 4TMBA 5HA7A 5EU9A 4G1NA 7PTDA 4Q8TA 4BQ4A 2V5JA 3EWXA 2YL8A 3T0TA 3LRMA 3W7QA 1ZZMA 1QI2A 1T7LA 4WD0A 3VE7A 3TLQA 2FZ8A 3A9IA 5AYBA 3VFCA 2BGSA 3O9NA 1RVKA 5GNXA 1W17A 4XO7A 1C8VA 3MP3A 3O07A 4O0ZA 2MUCA 2FTYA 5AHIA 2QYGA 4EXQA 2P10A 4MZ8A 3U6WA 1PKLA 3I65A 4DBSA 3C3NA 2NLYA 3CHDA 3MW7A 5D05A 1KM3A 3R1ZA 3QPZA 2G3FA 1DE5A 4PUUA 2O0TA 3S83A 4QNEA 2X2GA 5EMMA 4NYUA 2YA1A 1I1WA 3MZNA 1NVMA 5J04A 2POZA 5AC6A 2A2IA 3OA5A 2A4AA 1XRTA 4LX4A 2YXOA 1NY1A 1UQZA 4QS5A 4GA8A 5C9ZA 2O9RA 3RNDA 1S5MA 3AMDA 3PPGA 3WD0A 1P6WA 4LSBA 4FPSA 2OEKA 3NSMA 3N4EA 3R25A 2PDBA 2DVTA 3CV2A 1QNOA 5CQ1A 3WMLA 1EFZA 2ZUMA 4JL2A 4D2JA 5JUVA 2J88A 2QCCA 2DSKA 1ICPA 3LM7A 1L6FA 3KVJA 2BGQA 4RW5A 2Z2AA 3TTQA 4EVZA 2ZKMX 1OADA 3ITGA 4U3CA 3CL8A 2EG8A 4PZVA 1MEWA 4JR5A 1TMQA 3HQNA 1D9EA 2O4QA 1H61A 2PF8A 4IMGA 3V36A 2BVTA 1OX6A 4S3FA 3BG3A 1QNRA 1UIOA 4D6CA 3L4TA 2AQWA 4C7FA 2PDQA 2OX4A 1XLHA 3BCFA 3Q2DA 2FGBA 1LT8A 1XC4A 1CGXA 2OYKA 1GQKA 2UY3A 1NDYA 1RQBA 1WXJA 1XP3A 2GUYA 3EPMA 3O1NA 1ADDA 4ML9A 1ZS2A 3E2RA 2BY2A 1SW7A 5AC5A 4LVDA 3V1HA 2XH7A 1HZYA 2XIQA 6REQA 4AWUA 1FWWA 2JQXA 1DXEA 2QF8A 3WLKX 3LLXA 1OC7A 5FEXA 2P3ZA 4KWSA 4HVXA 3ERPA 4MZ1A 3ITXA 3VKCA 3W0KA 2J8FA 1FP9A 5CZTA 1GCYA 3QFEA 5BCAA 7ENLA 5DRCA 3MSRA 4JQ3A 4UTTC 1EZWA 2ABBA 2VZOA 2FZDA 4DWSC 1H1NA 1UD6A 1NOFA 3FJLA 2QCFA 3AHTA 3HQ1A 3C86A 4JY8A 3WYZA 5LIWX 1ITUA 1P1XA 1TV7A 2XGIA 3OVPA 1F3TA 1FDJA 1YMYA 3WL0A 3ARSA 4FXJA 4W7WA 1I0BA 1SO4A 3VIPA 1Q7QA 1VRXA 4DZIA 3QQWA 3C8FA 5GJMA 5K7JA 1CNVA 1XIEA 4BF9A 4DWSD 1RZMA 2FDMA 2DZBA 3KTSA 4H6KA 5F4WA 3RRAA 1ZBKA 3EMCA 3VAVA 4PFHA 3UPWA 4WY0B 2BHZA 1GOOA 2BWGA 3VC5A 5ABGA 3ANUA 4IJBA 2WSRA 4PTWA 4JTLA 2WB5A 3VOCA 1J2BA 7TIMA 1E1CB 1NFBA 1IE7C 3SY5A 4E2OA 3WH7A 2INFA 4XZHA 4UFLA 4QM1A 2BG5A 2P5NA 4HU0A 3H53A 1UQYA 1E15A 3IJ7A 1M7PA 3IVUA 8CGTA 3ARWA 2BVWA 3TW9A 3VNYA 3EAUA 1TREA 2PLCA 4N4PA 4P7RA 3HPXA 3SSZA 5B7YA 3D46A 4ML4A 4WEVX 1GVYA 1GZGA 3PM6A 1OVDA 3IIOA 3PFRA 3DFYA 1AQ0A 4K1GA 2VRQA 5J5DA 3V5CA 1G9HA 4PODA 1CBGA 1A0CA 3N17A 3W2MA 3LQLA 4G7EA 1S2WA 4XVDA 5JBEA 1UC4A 3RCMA 1L2UA 3AALA 3PBYA 2BXYA 2DSZA 3KP1A 1R9ZA 3B9EA 2P8CA 4HA1A 2PDHA 2LLEA 2DIJA 3DGRA 2EG6A 1X6UA 3PUGA 1F9CA 4TVDA 4GUGA 4NL1A 2DW7A 1QPKA 1V77A 1DJGA 2CZFA 3OVGA 4H9UA 3MSDA 2BASA 3L0KA 2WCGA 4IG2A 4GRSA 2C14A 2VMFA 3PTQA 4W8AA 2V3DA 1UG6A 3WLJA 2RJGA 3NZRA 1JZ6A 3EX6A 4AZCA 1Q85A 4IIHA 1R2TA 1AFSA 4FK9A 1XLBA 2AGKA 3PWAA 1PZ3A 4YTRA 4ADSA 2FZMA 3WX7A 1A0DA 3EDFA 1EUAA 1CX9A 3PSVA 4J28A 4N4QA 4S23A 3WDQA 4O53A 3NZQA 4LV4A 2W92A 3SY8A 3L67A 1W3KA 3HOJA 5G4EA 4Y7EA 1LLZA 1JZ3A 3S46A 4JY9A 5K9CA 1FP8A 4ZO9A 4O17A 5C71A 4JTHA 3D3AA 1FWFC 4TIMA 3S2JA 1TZ9A 4Q7NA 5TF0A 4XSLA 2J7GA 2WJEA 4IGNA 1XQLA 3AMCA 2Z1WA 1W91A 2IKHA 1BFNA 3L4WA 1THFD 4MIMA 4A29A 2AOSA 5FSDC 4C6LA 1R7AA 3VOJA 1RBOB 4X3ZA 1PKNA 2F7FA 2Y62A 4H3DA 3CL7A 1FH9A 3WNOA 3W29A 2IKGA 5E0CA 4IQLA 1NWTA 4IGSA 3TP4A 4CVWA 1XWYA 3VGBA 4NUWA 3WKZA 2ZX5A 2Y63A 4UTHA 5DMNA 3QYSA 4B9YA 3GXMA 1N8IA 5HJYA 3E5PA 1JD7A 4EKJA 3W2JA 4QX4A 4DPPA 4GISA 2YW3A 3M0VA 5REQA 4S1FA 2Z29A 4DBEA 3W85A 3BOLA 3SIMA 1MW0A 4UTFA 1SU5A 3W86A 2QV5A 1B54A 4AXKA 1PKYA 5ABHA 4Z0SA 4RZ5A 5JXQA 1VFFA 3MJYA 4UZSA 4XZIA 2WV8A 4M6PA 1EP2A 4PBFA 4LUTA 2G97A 3HJZA 4A3RA 5I3IA 1F6KA 3AXKA 3WLHA 3U2OA 1TX0A 3W7RA 3OZYA 5E93A 4XV0A 3EKLA 4WKHA 1K7FA 3VKKA 3LCHA 1XX1A 3PBWA 4DBUA 5FF0A 2YLLA 2E5DA 4C6OA 2JKAA 4LUYA 4FNTA 5LYRA 3MDWA 4ORMA 1LF1A 3KHJA 1KFEA 3EX2A 4GOAA 3N9KA 2X05A 1V0MA 2WC3A 2DZTA 4ATWA 2PBOA 4EIVA 1VS1A 3L2LA 3G3DA 3NQGA 4XTIA 3I4KA 4JYEA 3SQMA 3FX4A 2HVMA 1UB3A 2CLHA 1JR1A 3QQ1A 2HTMA 2QJHA 1TPWA 2VRJA 4F2UA 4J35A 4PEKA 3GVGA 4CQ8A 1X39A 1XCXA 1T6MA 3P60A 1P0NA 3WLMA 4YPJA 1HP5A 4XZ9A 2WMFA 1QFEA 3NQCA 2AQOA 3QMRA 4PCPA 5U4NA 3REQB 3LCIA 1C7SA 2RGMA 2PC4A 3WLQA 4F66A 3OLIA 5T9BG 3UPBA 2DIKA 2OTDA 2PDWA 4JEJA 3L65A 1E4LA 1CLXA 1BRLB 4Z2HA 2OWCA 3SQLA 2QDHA 3FDGA 2HISA 4IIBA 5GJNA 3RPDA 1LBMA 4FSAA 4U2ZA 1EXBA 3RM8A 4O28A 2E9MA 2WSPA 1FH7A 3RILA 2XSBA 3UG4A 1FRBA 4ROPA 1XISA 3WDIA 1XLJA 3S1XA 1FQ0A 4F48A 1V03A 5A6MA 1GONA 2CZEA 4MJ4A 4O11A 4PL1A 2WZTA 3ZVHA 3LSCA 2JF7A 3I7SA 5A6BD 2DW6A 4L4MA 1PTGA 1NM9A 2YYTA 2ZZ7A 1V08A 5JBDA 4ZB5A 3O7UA 5IDZA 3N2MA 4PE8A 1G4PA 3IK4A 1LP6A 3R2GA 4LS1A 1QHOA 5I2UA 1XW8A 2C18A 3BW2A 3M7SA 2J66A 3UY8A 3ZO9A 2AKZA 4DEFA 5HUOA 2YOCA 3UWEA 4QE5A 3LCXA 1IWPA 3FCPA 1I60A 3L4ZA 3B8TA 4LALA 1Z32X 4H9ZA 4JKLA 1MWOA 3CBWA 3THDA 3CZJA 2EG7A 1YPFA 3G1XA 1QI3A 1UW9A 1KFCA 5M2FX 2GGGA 1OX5A 1XD1A 4JCMA 3W26A 3F7JA 3W1XA 5D2VA 1QBAA 4Q8NA 4OV9A 4PSPA 2D73A 2YFNA 3WNMA 3E0FA 1XLFA 3AS1A 2OYLA 5EA9A 3PF3A 1NDVA 3NQ7A 1RY0A 4L9XA 1TG7A 3TQPA 1GPFA 2H9AA 1UD5A 3M0LA 1BAGA 3GVVA 1EQPA 3TEVA 3LN3A 2YXXA 2PWVA 4QDMA 1O1HA 5LNRA 1WKEA 1B3WA 1CECA 4XIMA 2J7HA 3FVDA 1V5XA 2NWSA 3WLRA 4MTVA 3UESA 4CNUA 1JGMA 3TNBA 3WO8A 1QI0A 1S39A 2I16A 2C15A 1A47A 5HNUA 1VCGA 1UJPA 4PC8A 1TPUA 3BLOA 4GACA 3N73A 1V3LA 3CASA 1OD8A 4XAYA 1XYMA 4AYSA 1FXQA 1TWDA 3A3WA 3DZ1A 4LUIA 3RAOA 5KINA 3GDRA 4PL2A 2FFCA 1MNSA 4EACA 2PD9A 1DJHA 3UWQA 1XYZA 4EX4A 3SGZA 1U5JA 3OJGA 4NRRA 3MUY1 4DVOA 4NG3A 2VOTA 3SJ3A 3AJ7A 4FLSA 1L2QA 3AXHA 2VX6A 1RCOB 3AXMA 4LB3A 3DHDA 3LTYA 5AYXA 3JS3A 2DIEA 1X6NA 1UR3M 4I9JA 5ABEA 5JH2A 2O7QA 1HT6A 1UP2A 3MCNA 4W85A 2XPKA 3CT7A 4FR1A 4NNBA 4AWTA 1H63A 3GHTA 4GO8A 4UMBA 1QBBA 4AWSA 1EWDA 1AL8A 1S5NA 1AMYA 1UPMB 4JIPA 4PTNA 4O1CA 1X7FA 5GJPA 3WK3A 5D9NA 5IOBA 1ZBWA 4MZYA 4K6AA 4PTVA 1P6CA 3G18A 3W2LA 2Z1VA 3BTNA 4XD4A 4C6CA 4LAKA 2CZDA 2XTKA 3ZT6A 3VGDA 3PAJA 2B31A 3CAKA 1IGSA 3SO7A 3KW3A 4RV8A 3W2NA 3BQ5A 4RE3A 4MNKA