1J2WA

Tetrameric structure of aldolase from thermus thermophilus hb8
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
212
structure length
212
Chain Sequence
MDLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPSYVAWVRARYPHAPFRLVTVVGFPLGYQEKEVKALEAALACARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVLKVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASRLGTSSGVALVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldolase protein
publication title Structure of aldolase from Thermus thermophilus HB8 showing the contribution of oligomeric state to thermostability.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 87
structure length 212
sequence length 212
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1j2wA00
1WBJA 3RLUA 1WOBA 4LWWA 1ICSA 2C19A 1R47A 1OX4B 1QDSA 3AJXA 1P4CA 3E9AA 1GYNA 3MUXA 4FX7A 4MLRA 3NQ8A 3W7JA 1U5JA 2ISSA 4CNOA 4O10A 1VPXA 1KTNA 4E38A 4HSOA 3HGJA 1J4EA 1LDCA 1PHWA 4JTTA 4O11A 3C4UA 4O52A 3UY7A 3G1FA 3I65A 2NZLA 3S9YA 2FJKA 1TMHA 4FNQA 1OK6A 3CB8A 4X9SA 4WD0A 3STEA 2NXIA 1VJIA 3LCLA 2V30A 1GG0A 1DL3A 1LP6A 5D2VA 4OV9A 3EWXA 1SQ7A 3M41A 1UUOA 4JICA 2NLIA 4O4VA 3UPWA 1TPB1 1B3OA 5K9XA 3UXDA 4RXGA 1XBXA 4CNNA 2OX1A 1RVGA 3LI0A 1HUVA 4S1FA 3QC3A 2A6NA 1LCOA 2QCNA 3DFOA 4I7VA 3NYZA 4JTGA 4RZ6A 4E0CA 4Q33A 3N9SA 4JXCA 5DN1A 4UTKA 2G97A 1Z44A 3G1AA 3KVLA 3BPWA 1FWSA 3O6CA 3CM4A 1PHQA 1H63A 3L5LA 3P81A 2BX7A 4N9EA 4HPJA 1I8JA 3OVQA 4AVFA 2YW3A 2CLOA 3GR8A 5C5YA 2GJNA 1QPNA 2YX0A 1G4SA 4O1BA 4WY0F 5D2YA 1JULA 1OF6A 4FX6M 4NJHA 4MYAA 5I3JA 3E02A 3EX1A 2VELA 5LSMA 1R2SA 2GQAA 1JCJA 1GJPA 1VCGA 1SW0A 2ZQ0A 5D03A 3HPXA 2FTPA 1FWWA 5H91A 3QPZA 3W71A 3GDLA 4LTSA 3WK0A 3P61A 3R8RA 3O6DA 4PL2A 3W76A 3NQ2A 3M16A 1UJPA 3G1YA 1RZMA 3NXFA 1L6YA 5DCBA 2YR1A 3GDKA 5TQLA 4XTIA 4AAJA 3RK8A 1HFBA 3EX2A 4R34A 3CLMA 3C52A 2ZTJA 4LS2A 4FNUA 2YDAA 2C15A 4K38A 1TREA 5D2WA 4XTDA 3BLIA 1JJKA 1VR6A 3SR7A 1EWDA 3GB6A 1VC4A 1LTDA 3BG3A 3HGOA 3QRHA 3HGSA 1YADA 4DBDA 3F4NA 2Y63A 2RHGA 1W56A 3GVGA 3S1WA 1JUKA 1X7FA 4D2JA 2NUYA 3MJYA 2YZRA 4TIMA 2O7QA 2X1SA 4RK8A 2V8ZA 2OJPA 3W72A 3INPA 1T99A 5D05A 1DJNA 3UD6A 1XI3A 2CZFA 2X2GA 3P82A 1JUEA 4IPJA 1G7UA 1QOPA 1VZWA 5AHLA 2CLEA 5HUOA 4NZJA 3G22A 3NL3A 1F76A 4LVGA 2FFCA 4FXRA 4N2YA 3KRZA 4TU1A 4LV9A 5FESA 4UCGA 5G5IA 5C55A 3IIXA 1VHNA 1TPFA 4IX2A 1OABA 4NJJA 2ZYFA 3FKRA 3DFNA 3D0CA 1R30A 3Q58A 1TPEA 3S5OA 5CZJA 4Y90A 3TSDA 3QMSA 2JGYA 1SW7A 3LV5A 1H1ZA 5D33A 3FLUA 2YYUA 3CQ0A 1H51A 3B04A 4S2BA 3PG9A 3QSTA 3CWOX 1V7YA 3TMQA 3M9YA 2YPIA 5FEZA 1H7PA 3VFLA 1W3IA 4IMFA 2DZSA 2VOMA 3QYQA 2ISVA 2A7NA 4RKAA 2BWGA 4NQ1A 1OK4A 3C6CA 4ZL1A 3PY2A 4DO6A 4MJZA 4XKYA 3NQ6A 3O07A 3DGRA 3BVJA 3F4WA 2ZTKA 3MI6A 1YDVA 1DKWA 2CZ5A 3A22A 4N9CA 4E2BA 1OYAA 5BOOA 1AMKA 4NJKA 4WOZA 4UTUA 3S1VA 1G69A 3G0UA 4KKXA 4UTHA 1XBZA 2NWSA 2A1YA 2NV1A 3QW4B 1AL8A 1ZALA 1YPFA 2R91A 4OHQA 5K4XA 4RLIA 4UTMA 4MZ8A 1LRQA 4GUHA 2J9XA 1GEQA 2ZZ2A 1R2RA 2RFGA 3W6YA 3H54A 2E1DA 4YCPA 1TJRA 3KFTA 1JCMP 4X2RA 1B9BA 4JTKA 1FY6A 2X30A 3PBYA 3MBFA 2ISWA 1TPH1 5DELA 1XDMA 3ZWSA 3HG3A 4UUIA 3O8AA 2QJGA 5E0KA 4AWUA 1XBVA 4MZ1A 1H5YA 1FWRA 1YYAA 3KRSA 4MYXA 1TIMA 1UUMA 5AYYA 3TC6A 1PE1A 1X1OA 2G95A 1JCNA 4L4MA 2QCGA 2AAMA 1B4KA 3OEXA 1KM3A 4YWIA 5F4XA 3GDTA 4O18A 3HPSA 1I2QA 3I68A 1AW5A 4ORIA 4O12A 3JS3A 3PF3A 3USBA 1VS1A 1IXQA 1WV2A 5D02A 4DPPA 4CNPA 3L5MA 1YTEA 4IMCA 1FCQA 4YL2A 2J24A 3M5XA 3CU2A 5T26A 1LLZA 4BWLA 1GQNA 4UNLA 4I7WA 3TH6A 1KFCA 5CZTA 2ATMA 5LNSA 1M6JA 5IBXA 4ADUA 3MHGA 1LBMA 3NQFA 3Q94A 4K39A 3UWYA 4JN6A 1DHPA 3IGUA 3DKJA 1F05A 1GWJA 1XM3A 1GYLA 2EHHA 1WX0A 3TA6A 1KV8A 4NNCA 3ELFA 1LRNA 4YXGA 3OA3A 3G8EA 2PRMA 3LLDA 3L5AA 1X8FA 2J6XA 1BKSA 2FB3A 5LKYA 2VEPA 2WNQA 1O5XA 3W7HA 3BK0A 4GUJA 1Q6RA 3T4CA 4JX4A 1W3NA 3P67A 4K37A 3MMTA 5FF0A 1FQ0A 3K30A 4GUGA 3A5VA 2X1UA 3P8JA 2C18A 3E49A 2J88A 3KX6A 1NFBA 4PFMA 4EIVA 2QAPA 4AHPA 1QCWA 2OZ0A 3VE7A 4TO8A 1LBLA 3FJLA 2QKFA 3W2NA 4XBKA 4HN4A 2DZTA 3G0XA 3F03K 1KFLA 3IRDA 4ONVA 5D32A 2A7RA 3IEBA 4IQLA 1ME9A 1SPQA 4IMDA 2WSYA 1AK5A 3NQAA 4M19A 2HSAA 2O7SA 5DCDA 4LOCA 2GPTA 1A5BA 1PIIA 1W8SA 1T8XA 4IGHA 1FCVA 1JQXA 4PH6A 5K9CA 1Q3NA 3FKKA 4PA8A 3C2RA 3W7CA 2X1TA 1QNVA 4FXSA 7TIMA 3EWBX 1N7KA 5K2ZA 2TPSA 3O16A 2RH9A 4BK9A 4HSNA 2B7OA 4MY1A 4MKNA 1Q6QA 1XDLA 3ZWTA 4O54A 4O1AA 3BGJA 3N9RA 3GXPA 1RR2A 2GJLA 3BW2A 1YXYA 1NF7A 2VFDA 4IXXA 2EF9A 3E96A 3QFEA 3W1TA 1ZAIA 2CFFA 5CSSA 1BWLA 3N34A 4OV4A 3S1XA 3OIXA 1OX5A 3W2UA 2FLIA 3FYPA 2Q3OA 3C2EA 1ZAJA 1YXDA 4UC5A 4NNBA 5CGQA 4BWLC 1H50A 2CWNA 3FJ6A 5HULA 2AQWA 6ALDA 1TJPA 3RNDA 4XQ6A 4RZ4A 4O50A 1L6SA 3UWUA 4MFDA 1RD5A 4JD4A 1EP2A 4M7TA 4JDBA 3QQ0A 4FX8A 5DLCA 2NX3A 3LBMA 8TIMA 2VFEA 3NNTA 4ZMGA 4UNKA 1KM2A 3MP4A 3NPWA 5EA9A 4A2RA 5EL1A 1JRBA 4CCDA 3EXRA 1KTCA 1HO1A 1QAPA 1BWKA 3MYOA 1G6CA 4JX5A 5BMWA 3N19B 2NV2A 2BXVA 4K7YA 1SZGA 4MFEA 1FWNA 3P60A 3HPZA 4NZFA 4O0ZA 2JKEA 1DVJA 3TFCA 3O15A 4J9JA 1KFJA 3C61A 3NQDA 2IQTA 5G4EA 4MVAA 1CW2A 3SSJA 4AF0A 2QDGA 2ZZ5A 3L68A 5EPDA 2V5LA 3B05A 1OG0A 4O28A 4FIQA 3PBVA 5AC7A 3PWAA 2B7PA 1Q45A 2I1OA 4BI7A 2B7QA 1K7FA 5I3HA 1WQ5A 3S5ZA 4DO5A 4JY9A 1SZNA 5G1YA 1IXPA 2VEKA 1DORA 3W7LA 4FO4A 4MUZA 5AC6A 1LOLA 1O5KA 1F5ZA 3EB2A 3S6DA 4KWWA 3TSBA 5HR6A 2F84A 4OT7A 3IIOA 4QNWA 4N4QA 3RFAA 3TQKA 4O4WA 5D09A 3T55A 3ZFHA 3TDFA 3ZR4A 2VKZG 2E5DA 1YDNA 3CC1A 3DENA 4CCCA 2YSWA 4JGDA 4RX0A 2ZZ7A 1L6WA 3M5YA 1AL7A 3SGZA 2X16A 1P1XA 3SY5A 3LOTA 3L2IA 1KTBA 3MHFA 4P61A 2Y88A 1GPWA 2GOUA 2RDTA 4HNUA 3PB2A 2DZPA 3EWZA 1MSSA 3LHYA 3NM1A 1DJQA 5I3IA 1FXQA 1KM0A 1Q6OA 3W1LA 5HMSA 2C1HA 5D04C 3T78A 1TCDA 3NQCA 1W1ZA 3TR2A 1QO2A 4WX2A 3PB0A 2DZVA 3TJXA 3NPXA 1KM4A 1QPQA 5D2TA 3HJZA 3W7GA 3ABOA 4Y9AA 1VCFA 1MEWA 1ME8A 1BTMA 4O0KA 4JTHA 5C2XA 1SO5A 2ZRVA 1G4TA 1IGSA 1J2WA 3IV3A 4K8HA 2FQIA 3TX9A 3G24A 3RLVA 4RJEA 1WYIA 5K9DA 5HWJA 3TIMA 5F2LA 2OMAA 4AEOA 3EWYA 4N6EA 5H2ZA 5J5DA 3FIGA 3L0NA 5J5RA 4HNTA 3I6RA 3UNDA 4UR7A 2UV8G 5D30A 3W07A 1FCBA 2E6DA 2V2DA 1W37A 3FFSA 4BR1A 4G1KA 5KZDA 1TTJA 3S42A 3QEZA 2DJLA 2QUVA 1ZFJA 4A29A 4QQ3A 4XKYB 3WJXA 4RV8A 5DY2A 1MEHA 4O1DA 4UIOA 1F74A 3NR0A 3TCEA 1A50A 3TU9A 1YDOA 2ZA2A 2VFFA 3HBLA 4UR8A 3NZRA 3IGSA 5SWUA 1SW3A 2JKAA 1VLWA 4YLWA 1TPWA 1W5NA 2OT0A 5HUPA 2A5HA 2CLIA 2VFGA 5TIMA 3EKLA 3B0VC 3W7OA 4H3DA 3LXBA 3BARA 4XZ9A 1CI1A 1WXJA 2Y70A 5CSRA 2KZHA 2H8XA 2TSYA 1SZEA 2Z1BA 1UCWA 4EWND 3O06A 5DXYA 5EMUA 2DU2A 4LVBA 4FNPA 1KFBA 3B8DA 3DU0A 1QWGA 2OT1A 3GLCA 3W7NA 2Y7EA 4MJMA 3ABQA 1KBJA 5EBUA 2Y89A 1W3TA 1SFJA 4GWEA 1O60A 2HS6A 5CKSA 3QF0A 2VFIA 4XWUA 5FF3A 3M5VA 3TXZA 1M5WA 2YGYA 2OCZA 4UXDA 3O1NA 1LOSA 4TMBA 2DZWA 3LV6A 2V81A 2E6AA 3RU6A 3LHZA 1RQBA 3PG8A 3TKFA 4FNTA 4ZQPA 1F6KA 2FDSA 1PL9A 3ATYA 2E6FA 4LRTA 3DAQA 4GBUA 4IXHA 2A2IA 1YTKA 4IMEA 3W22A 3M5ZA 3KOFA 5BW6A 1TTPA 5LHFA 4GRSA 3PULA 3V1PA 3FOKA 1IXNA 2Z6IA 3ABSA 3BGGA 3GXTA 3WK1A 2VENA 3IGXA 3EEGA 3G0SA 2BSLA 3LRLA 1C8VA 3IIPA 1I2RA 3W1XA 1XKYA 3ANYA 3UWQA 3S5YA 1KFKA 2DZXA 4ML9A 4R33A 1XFBA 3I7QA 3PUOA 4QSHA 5MHBA 4ZQCA 1Z42A 4GXMA 3UQNA 4UTIA 4R53A 3LHWA 3TQVA 3PC0A 3ABRA 4NVTA 2Y85A 3W83A 1F6PA 3EX6A 2QUTA 3LTPA 1H7XA 2C0AA 4WOQA 1H60A 1TSIA 3GKAA 2J9YA 3SI9A 3NQVA 3L21A 1Z48A 3N73A 3NPUA 3W86A 1K7EA 5F2MA 2NUWA 5DBTA 1RV8A 5U7SA 3PVFA 4Z1CA 3G1HA 4JTSA 3IVSA 3T40A 3NAVA 1UASA 3NQ7A 4E2DA 1OFEA 4POCA 1N55A 3S0CA 2C13A 6TIMA 3MP5A 3BG5A 2YCEA 4UTLA 2TYSA 2CW6A 5E1QA 2XN1A 3NEVA 1S5WA 1VYRA 1VH7A 3G1DA 1TPVA 3HG4A 2A6LA 2LLEA 2GVLA 1YLVA 1ALDA 5DBUA 3G18A 5LNUA 1ADOA 1H61A 1RQHA 4Z1DA 2ATSA 3SFKA 2YFOA 1FDJA 4JNMA 2E68A 3P5YA 3L67A 4Q32A 3PUEA 4UTJA 2XN0A 4ADTA 4WXZA 2EPHA 3W74A 1P0NA 3Q2DA 2CLFA 1ZNNA 3W7EA 1VYSX 3W7MA 1ZAHA 4HHPA 3Q37A 4IMGA 1XC4A 1KLZA 3LBCA 4O13A 1J5TA 3P7YA 1OF8A 3HMJG 4EF9A 2FB2A 4JTJA 4MOZA 3R13A 4YCOA 1N8FA 1SO6A 4GNJA 3SW6A 3OG3A 1F73A 4GJ1A 2A4AA 3CEUA 3W7PA 1IIGA 4N4PA 4IOTA 4WQ6A 1Q6LA 4C1LA 2B0MA 3QPYA 1YXCA 3P5ZA 3NGJA 4KWVA 4ZZ9A 3GDMA 4MY9A 2QUUA 2V5BA 3OBKA 4LVAA 2V9DA 1MEIA 3L0GA 3BLFA 1S5VA 4ZQMA 4AXKA 4LY8A 3TW7A 2A85A 3E0IA 4FHAA 4HIBA 4NXKA 4IUOA 3F1QA 3LLFA 5C6MA 3LTSA 1JCLA 3TAOA 5KITA 4JTFA 4A2SA 3H55A 1G7VA 2C6QA 3TQ0A 3NL2A 5D2XA 1PCKA 1R46A 3DZ1A 3QMTA 3S8HA 3CIXA 4IX0A 1GVOA 5EKYA 3W73A 2Z0IA 5LNVA 3W1NA 2VFHA 4FNSA 2ZZ6A 4B5NA 3W7KA 1F2JA 3QW3A 2R8WA 1W5MA 4Y6GA 3TMLA 3NL6A 1I2OA 1MZHA 5AHFA 4QIUA 3GNNA 1MXSA 1GT8A 3LHVA 4WUIA 3PR2A 4AF0B 3MP3A 3EWUA 3DFPA 3TFXA 2CU0A 4FIRA 3PM6A 4O57A 3LCFA 5FF2A 3NDOA 4KFPA 2B7NA 2B4GA 1H7NA 4LUIA 3HF3A 4WZHA 4UTWA 5G2HA 3DFQA 1HO4A 4LU0A 2GQ9A 3P62A 1VHCA 4LVFA 3EXSA 3JRKA 5D38A 5AB3A 4OU1A 4NT0A 2ZCGA 1B4EA 2AGKA 2VEMA 2ZRZA 3UXAA 5BRBA 1I45A 5CZ0A 5FEPA 2YXGA 3P80A 1KFEA 1TRIA 5A5WA 1DQWA 5KZMA 1VGAA 1SO3A 2CLKA 3B0UX 4KFNA 1TTIA 3NVTA 2JK2A 3E12A 3L9CA 3DHFA 5IM51 1L2UA 2C3ZA 3L66A 3KVJA 3QMRA 3RMJA 4JS3A 3B4UA 3LRKA 3CTLA 1W0MA 2WPBA 1OFBA 3CIWA 1G67A 1D9EA 3NM3A 2QR6A 2JGQA 4ZQOA 4LRSA 3W9ZA 4WY0B 3PAJA 5GVJA 1C29A 1P0KA 5F4WA 3BG9A 3LCWA 4I7UA 4O1CA 1DBTA 3A24A 2GUUA 2QJIA 2PRHA 2WNZA 2ZBTA 1TQJA 5LNWA 4K6AA 5DY3A 1KA9F 2ZA1A 1PS9A 4WJEA 5IBXC 4BI5A 4C1KA 1G4EA 1GOXA 2ZZ1A 4ZVJA 4BFAA 1EUAA 1SO4A 3BV4A 4M6QA 5CPLA 3TROA 1AW1A 3W3OA 1M7PA 4DF0A 2NUXA 3MYPA 4LC6A 4O15A 2BZNA 3CWNA 4JEQA 5G2WA 4AMAA 3C56A 3HO8A 4HT3A 5G4WA 1M7OA 3GYEA 2QCMA 4EF8A 1R2TA 1GTHA 4UFLA 2QCCA 3HG5A 5DXXA 5AHMA 4LC8A 1HTIA 3LTYA 2H6RA 4M7SA 1GVFA 1XCFA 3V75A 4K36A 3KHJA 4PEKA 4W9TA 1ONRA 1OJXA 5K4ZA 3W1UA 3EKZA 3W7RA 4JTEA 3PSWA 3QH2A 3GKFA 3JR2A 3N2MA 3GAKA 2P0OA 4IWWA 1JVNA 2Y7DA 4UTWC 3DKLA 1UB3A 4LVDA 3TW6A 2FPVA 1O4UA 2G5WA 4U4MA 4A21A 3WJSA 5FEXA 1K8ZA 4PCFA 4DXVA 4NXSA 3TE9A 3H53A 3U8GA 3UWVA 5HQEA 3M6YA 2QCHA 2E09A 3UPBA 5LGXA 3U6WA 2ZDRA 4DO4A 3GK0A 3LXCA 4MLJA 4JIQA 3NO5A 1JR1A 3W2LA 1S3HA 2QCDA 3N14A 4OGZA 3TAKA 1JCYA 4O14A 4GUFA 4S2CA 2ZRWA 3MWAA 1U83A 1TB3A 2ZRXA 3WJZA 2YYTA 2H8ZA 2X1RA 5KTLA 2Q8ZA 1LZOA 2DORA 1SR9A 3W7IA 2EAWA 1TO3A 3W75A 5CZSA 4N6FA 3TV8A 3G1VA 3C2FA 1OFAA 5HJLA 3AO0A 3VKJA 2R14A 1V5XA 4WY0A 4AB4A 1XUZA 2VEIA 3HG2A 4GE8A 2Z2UA 2EGZA 4X22A 3TJLA 4DF2A 4DF1A 1QPOA 5ABTA 3LI1A 3W87A 5CG7A 3YPIA 5A8GA 3KRUA 4UFKA 4UMBA 4O8RA 4JYDA 4ORMA 1ZY9A 4ICNA 4JTLA 4UTTA 4YMZA 2QAFA 3NPVA 4Q4KA 5KSWA 3OVRA 3SJ3A 4UFIA 1W5PA 1KLYA 1FDYA 4PODA 5KMYA 4OE7A 3SECA 4FB7A 2WOQA 3FA5A 3SGUA 1KW1A 3EX4A 4RZ5A 3T7VA 3S1UA 1JUBA 3WK3A 3LGEA 1QMLA 3SIZA 2ZRYA 2Q8LA 3GX9A 2H90A 3TUUA 2PRLA 1GTEA 5FF7A 3IVTA 3PS7A 2VC6A 1K8YA 1GVSA 3I7SA 3LB0A 1NEYA 4FEZA 1WAUA 2A7PA 1VRDA 4TMCA 1ME7A 5G1TA 3WFAA 2QJHA 5TBOA 4LT9A 1P5BA 4BF9A 2WKJA 3KVKA 3THQA 4GFSA 3HGRA 5FF4A 1W54A 3NQGA 4TX9A 2WJZA 1OFDA 4BI6A 5CPNA 1XXXA 4N9DA 3UWZA 3PBWA 3W7QA 3NOEA 4NUWA 3C0JA 5I3KA 4MZYA 3W1MA 1QR7A 4CLMA 5AHIA 3A21A 2NX1A 3WJWA 2WSRA 1DV7A 3M43A 4GUIA 3LM7A 2CZDA 3A23A 4DELA 3STGA 5I3FA 3NQMA 1TV8A 4TR9A 1FXPA 1Z41A 3DI1A 3G1XA 1D3GA 2W79A 3W1PA 3DXIA 4CQAA 4MY8A 1TRDA 2WO5A 3LCHA 2FPYA 5K7JA 2PURA 3FEMA 4QJ1A 5EYWA 4DPQA 3M44A 4PC8A 3P74A 5L9FA 1JCXA 2QEZA 3R12A 3G3DA 5U4NA 5LGZA 1OX4A 3A9IA 2CZEA 2ABAA 1GVQA 1VLIA 4NX0A 1FX6A 4ADSA 5HNRA 2VXNA 2F7FA 5AHNA 5D37A 5KINA 1XL9A 3DI0A 5AC8A 2Y62A 4CQ8A 2XFWA 4LUJA 4PTNA 1QO5A 3C8FA 2R94A 5AOUA 1EUNA 1YTDA 2ALDA 1KM6A 5KZEA 3UWWA 5F2IA 2FPTA 3MI2A 1FDZA 4UTTC 1IXOA 4JYFA 5F1VA 1X6UA 2HS8A 4QM1A 1OFPA 3QSRA 3WK2A 1OHLA 2DP3A 4RXFA 1XUUA 1F7BA 3CT7A 4AWSA 3PBUA 3HB9A 4H6KA 2ZA3A 1X1ZA 1EA0A 5CPOA 3GDRA 3M47A 1TPUA 2NXGA 2TRSA 3EWWA 1I2NA 3P8IA 1I2PA 1EP1A 4ZQNA 1OYBA 1EPXA 3DBPA 3W88A 4Z1BA 4DEFA 2JBMA 2V2HA 4M6VA 4A3UA 4AH7A 1T96A 2E5BA 1AW2A 1LOQA 1SSGA 5DCEA 1WOAA 4MPQA 1IF2A 3C3NA 1TTQA 2E5CA 1VYPX 2GVJA 4IPIA 4LS0A 3MHUA 1LYXA 4ZQRA 3PSVA 4KFOA 3N3MA 3LDVA 4R7JA 5AFDA 1OVDA 1H7RA 3QQ1A 5FEWA 1OFQA 5LNRA 3KAOA 5C54A 1PVNA 4ALDA 1SSDA 2ZRUA 4JTIA 2P10A 2Y61A 5AYXA 2NWRA 2I14A 4UFHA 4K8EA 3TK7A 3U2OA 3DHDA 4OWGA 1OYCA 1WA3A 2G96A 1W5OA 4JYEA 3CHVA 3W7DA 3QJAA 3NL5A 1LBFA 3G3MA 1LLWA 1HG3A 2CLHA 3SZ8A 4OBTA 3IVUA 4FNRA 3WJYA 2GVGA 5AHEA 5I3GA 2H3BA 1OX6A 1ZENA 3O05A 5G2IA 3GIYA 1TV5A 1OFOA 2W6RA 2QCLA 1LRTA 5L6UA 1W5QA 4NJGA 3VNDA 3R5EA 3HQ1A 4QAIA 4NNAA 3O6YX 4Z0JA 1I4NA 3ZS4A 3DH7A 4N9BA 2C14A 3O63A 1GZGA 4JY8A 4M5PA 3NQEA 3C2OA 2GQ8A 2BTMA 4JTUA 4EOUA 1CX9A 3BW4A 1TYGA 2QCEA 1C9DA 4LS1A 4XUGA 1EWEA 3KVMA 5HINA 1ICPA 1H7WA 1BEUA 2CLMA 4RCXA 3IIVA 3NZ1A 1EB3A 2D73A 3RF9A 4Z0SA 1FCUA 3HIJA 3VE9A 1ICQA 1Y0EA 2J9ZA 4Z1AA 1AG1O 3LCIA 3EX3A 4IJBA 3CEPA 2PC4A 1SFLA 1LORA 1KBIA 2QF7A 2C16A 3MI3A 3NG3A 3LCGA 2P1FA 5EY5A 1TV7A 2HMCA 3STCA 2NXHA 1SUXA 1FWTA 1ML1A 4O53A 1EP3A 2ZFAA 4HNNA 1JQVA 2E77A 5AYZA 4UFMA 3LRMA 2A21A 3G8RA 3ATZA 1VQTA 3R89A 3MW7A 3GNDA 2V2CA 2JKPA 1QPRA 1LROA 1TPDA 1XBYA 4WXYA 5AN7A 4I9AA 3FS2A 3LHTA 3GXNA 3UY8A 1IIHA 1ZCOA 4JDYA 1RQEA 3UZ5A 2Q3RA 3GR7A 4O17A 3W2JA 1RPXA 4JIPA 1S5TA 4JR5A 2Z6JA 1EEPA 3CPRA 4A22A 4HKPA 4DBEA 3LX9A 1KV5A 3TC7A 2W0UA 1VCVA 3TXVA 4H4IA 1K3UA 2YW4A 4LW7A 4RR4A 4CQ9A 4DQWA 4NX5A 3W23A 1EIXA 3VCRA 2QCDB 3C2VA 4QNEA 2CLLA 2PE4A 3R2GA 5F2GA 1B57A 4GC4A 2Y7FA 3G1SA 3GAYA 1H62A 4L4LA 3A5FA 1A53A 3B06A 3HOJA 3FYOA 1QOQA 3BO9A 1W31A 3OHIA 2BLEA 4OQVA 1O94A 3L65A 4UMAA 5CPMA 3MO7A 3OVPA 3P84A 1HL2A 1K7XA 3W1RA 2EKCA 3L0KA 2WV8A 4M6PA 4XBSA 4K7VA 3BW3A 3TSMA 1FBAA 3TNOA 1K02A 5HWNA 3EXTA 4Y96A 4HNVA 3M1ZA 3M7WA 4LV4A 2HTMA 2ZZ4A 2DZUA 2A0NA 4Y8FA 5FI8A 2V82A 4N02A 2I9EA 4P2VA 3UYCA 4EVZA 3NA8A 5HR7A 4U28A 4UFJA 4X3ZA 2PCQA 4CCEA 1DQXA 3DFSA 3VI2A 1D3HA 3W2KA 1DOSA 1A5CA 4JX6A 1NAL1 3T44A 3LERA 4MIMA 2ZZ3A 1OFRA 4NU7A 1H7OA 2XN2A 2NX9A 3B0PA 2RKXA 5HWMA 4NJIA 2Y6ZA 5LHEA 1EX5A 5K3VA 1A5AA 1YPIA 3QZEA 1H1YA 1TQXA 4PL1A 2QCFA 2H3DA 3MBDA 1THFD 5E93A 3W1AA 1NSJA 2WSQA 1JRCA 1K8XA 3GZ3A 2TMDA 2WNNA 4O16A 3W1QA 3I7RA 1PV8A 1E51A 1QFEA 3M0ZA 5BMXA 1A5SA 1SU5A 2Y7GA 1KM1A 3THAA 4AWTA 4FF7A 1PCWA 3W84A 1KM5A 2DJXA 3B03A 1ZHAA 4UMCA 2RDWA 4AHQA 3W70A 3S5NA 1LM1A 3LHUA 5BNKA 1GG1A 1G4PA 1WDWA 1GVRA 2ABBA 3LCXA 5F4SA 1WBHA 2YFNA 1SZFA 1TPC1 3W2MA 2V0TA 5F1UA 2E6YA 1K03A 4AHOA 4Z08A 3UZJA 3PUDA 3DFTA 1UBSA 1T0OA 3KXQA 2J27A 3STFA 5LZLA 1O95A 3W85A 4O19A 2QDHA 4QITA 1NVMA 3N2XA 4QISA 1MO0A 2FIQA 2WQPA 3LXAA 3BLEA 1ZJIA 1L9WA 4HPXA 1FUYA 1NF0A 4LNYA 2RDUA 3QM3A 3IIZA
chains in the Genus database with same CATH superfamily
3RLUA 3L4YA 1RBLA 3THCA 4GIRA 1ZZMA 1OX4B 1QDSA 3PJWA 1TFVA 3SCOA 3AJXA 4FX7A 4MLRA 3AZRA 2ISSA 3CMFA 4R9XA 5DRIA 1UP2A 1UKQA 5HANA 5A1AA 3BV7A 4HSOA 3W37A 2Q01A 2VR4A 4IFRA 1PHWA 2W92A 4D6DA 1KKRA 4O52A 3T0CA 2JE8A 4Q4RA 4X9SA 5DFAA 4TVUA 1VJIA 2V30A 1GG0A 3QY7A 5A8NA 3EWXA 3GW3A 4JICA 2G50A 4HHLA 4O4VA 3H8AA 5K9XA 3UXDA 3MUY1 1XBXA 3GBDA 2HPMA 4K2SA 5GPRA 1FH9A 1HUVA 1BVZA 4MGGA 1LCOA 3CMGA 4KIRA 4MWAC 3WQFA 4MUPA 4JTGA 3MJMA 4NHVA 4M0XA 4PTWA 4Q33A 4JXCA 2PDIA 2Z2BA 3B9EA 3N6HA 1VIZA 4R7OA 3KVLA 3BPWA 4H41A 3CM4A 3L5LA 3B8IA 1FHLA 2DH2A 4DUWA 4GIYA 1RJRA 5E6ZA 4RDZA 2YW3A 4AVFA 3GR8A 2ESCA 3AYSA 1IHIA 4FX6M 1XCWA 5I3JA 1R2SA 2GQAA 2ZQ0A 3EOLA 4DM2A 2D20A 4Z17A 3WDHA 2PGWA 1H1NA 3VX0A 1YE4A 2OZ3A 3W71A 2YBVA 3GDLA 1OG6A 1Q6CA 3R8RA 2HBXA 4NZ1A 4X61A 3M07A 1MQQA 3M16A 4J27A 5TQLA 5DCBA 3WLMA 2AQVA 2PLMA 4AAJA 3N6QA 2WPGA 4R34A 1XRVA 4RZBA 2ZTJA 3V7PA 4Q8QA 4KCUA 3BL3A 5D2WA 3BCFA 3GW0A 4F66A 3GUWA 3UZWA 1LTDA 2J7BA 1YADA 1C91A 4EPEC 1X7FA 2ZXQA 3MJYA 3ITTA 1QU4A 4RK8A 4UQ9A 2V8ZA 4AWEA 3VD5A 3E74A 2E0PA 4BQ3A 1OCJA 2FGZA 1LG1A 5A94A 2X2GA 1VZWA 4OTKA 2CWXA 4AIEA 4IGSA 4TX6A 1F76A 1OWQA 2FFCA 3F5JA 3AXMA 4FXRA 2CBJA 3KRZA 3DOPA 1UR8A 4HYVA 5FESA 1XYAA 4GACA 4B3ZA 5C55A 3K4DA 4Q22A 3IIXA 2VZSA 1MDRA 1TPEA 2CKRA 4F8XA 4L1GA 2XZ9A 3B04A 3UF9A 3PG9A 9RUBA 3AXIA 3CWOX 3GNOA 3S5SA 4MADA 4D8ZA 1QXLA 1W3IA 2HXUA 2PF0A 2DZSA 3QYQA 2ISVA 2BS9A 4NQ1A 1JPIA 3C6CA 4ZL1A 4DO6A 1MI3A 4MJZA 2XFYA 4XKYA 5AECA 3WQVA 2ZTKA 4QCFA 3A22A 1QNRA 4DX3A 5BOOA 3E6EA 4UTUA 3AS0A 3OZYA 3QV8A 3CASA 1TV2A 1O68A 1XBZA 1EGZA 2NV1A 2FHBA 5I0DA 1EZWA 4I9TA 3TN3A 3ANVA 1LRQA 1GEQA 2ZZ2A 1R2RA 3O6AA 2RFGA 3ZYZA 4YCPA 4XD3A 1TJRA 4ZOEA 3T05A 2ZUMA 3N04A 4ENLA 3QGKC 2X30A 5FIPA 4FAMA 5E0KA 4ZENA 3W6MA 2FZDA 4MYXA 4PCSA 1TIMA 2ZWYA 3WH8A 4JTAA 1JD9A 3E5BA 4L4MA 1KCXA 2AAMA 1FVPA 2GJPA 4QROA 4YWIA 1I2QA 1AW5A 2WMKA 4HN8A 1EEXA 5AC4A 2ZXAA 3VIJA 2F38A 2X2YA 4UOZA 4M81A 3COTA 4PCPA 4CNPA 4IMCA 3WQCA 4DJDA 4I3GA 1QHZA 4IZGA 5DMNA 5T26A 3NZPA 4DWDA 3ARUA 1LLZA 1GQNA 3TH6A 1KFCA 3UGVA 4LBRA 3ARYA 1M6JA 5IBXA 4ADUA 3NQFA 1S2AA 3UWYA 4M1BA 1DHPA 1HXJA 1M65A 1Q4NX 1P6WA 1M7JA 1GWJA 6TAAA 1GYLA 2EHHA 3BSHA 3ELFA 1LRNA 1R3WA 3G8EA 4RE2A 3L5AA 4AIOA 1BFNA 2VEPA 4F0KA 4C6MA 4NP7A 4B9ZA 3R58A 3P67A 1C8YA 4CNUA 1QK2A 2NT0A 1E15A 1QBBA 1FP8A 3W26A 3A5VA 2X1UA 3P8JA 4WKHA 4KEUA 1OBAA 1NFBA 2I16A 4GX8A 2R9RA 3B8SA 1RK6A 2QAPA 3NZQA 3RG6A 4WCJA 1R9XA 4TO8A 1LBLA 3FJLA 1W32A 4HN4A 1K9TA 4U2ZA 4LANA 5D32A 4PUUA 4B5SA 3O0FA 1UA3A 4M19A 2DY3A 2DGAA 4LEQA 4NRRA 5KEZA 4PH6A 4I5RA 4JPGA 3C2RA 2Y2WA 4WSHA 3VX1A 3OIHA 1KXVA 7TIMA 2HEJA 1N7KA 4D72A 1LUCB 4A8RA 3OTRA 4JTDA 3S2JA 3HU7A 1XDLA 3ZWTA 4AW7A 1EOMA 2UZ9A 1RR2A 3MCOA 1XYMA 3MQTA 3W1TA 1RK5A 1ZAIA 3F5KA 3N34A 3TLQA 3ZLHA 2Z1VA 4QDWA 3W2UA 4L1WA 1CXHA 2Z1KA 3WNNA 3MUZ1 3VD7A 4M80A 2RAGA 3K8KA 3T9PA 2WKGA 2AQWA 2NLYA 1OB0A 4MNKA 3K8LA 1L6SA 3B0XA 3UWUA 1EZ2A 2XWEA 3LN3A 1V6VA 5DLCA 3UJ2A 5JMUA 3WBAA 1DJIA 3W38A 1V6XA 3NNTA 4JHMA 2BV9A 3TYDA 4PR4A 4ZMGA 2QMJA 5EL1A 1KTCA 1XD1A 3LYEA 1WXZA 1G6CA 4JX5A 5BMWA 1QTWA 2ADAA 5B7ZA 2INFA 2XIQA 3HPZA 1A5NC 2GSEA 4UQCA 5CXPA 3UPMA 2JKEA 2V3DA 5KZ6A 2GYIA 3N15A 3F7JA 4ZTYA 1J0IA 1PKYA 3NQDA 3A4JA 1CW2A 2ZZ5A 1VPQA 2V5LA 4O28A 3QN3A 3PTKA 4BI7A 4H7VA 4H8VA 3E1F1 3KP1A 3F2CA 1SZNA 3DBNA 3VUPA 1S3TC 4RL3A 2XG9A 1A0CA 1DHKA 1ZBCA 2AL2A 1O5RA 3W7LA 4FO4A 5MKGB 1E5NA 4AVNA 3S6DA 4QLLA 3TSBA 4FOUA 4IICA 4OT7A 3IIOA 1P1MA 1XSJA 1HVXA 3E2VA 3ZJ8A 4O4WA 1TMLA 3TDFA 4GNVA 5CQ1A 2E5DA 3CC1A 3DENA 5EB8A 4JGDA 3CQHA 3LNPA 3SCPA 3SY5A 1P1XA 4JQAA 3LOTA 1B5TA 2Z29A 1W6TA 1GPWA 4GY0A 4HNUA 3PB2A 3EWZA 3FYYA 1H41A 1Q6OA 3AIQA 2CBVA 4TV5A 5HMSA 3T78A 1TCDA 2QIWA 2VWSA 4WX2A 3HQOA 4HNLA 1UKOA 1QPQA 2YB1A 3WG6A 3W7GA 3K4WA 5C9ZA 1ME8A 1BTMA 4MSSA 4O0KA 1BQGA 1XLGA 1U1HA 2PGEA 3W27A 1JXKA 3FK4A 3RLVA 3SQSA 3TIMA 2A3EA 3BE7A 2TODA 3FIGA 3CHFA 5J5RA 2V5KA 3I6RA 5A8MA 1B31A 2P8CA 1FCBA 3CT2A 3FFSA 3H22A 4G1KA 1TTJA 3QEZA 4GX9A 1VEPA 4A29A 1IV8A 1O7AA 4RV8A 3F2DA 4UIOA 3NR0A 3PTQA 4V2XA 1A50A 2ZA2A 1CZ1A 4UR8A 2D22A 1EL3A 4DJFA 3RRAA 1PTGA 1VLWA 2X41A 5BCAA 3EKLA 4CN4A 3T07A 2PMQA 4IG2A 5HOSA 3BARA 3S2MA 1WXJA 3VMNA 3P3BA 1SZEA 3O06A 3B8WA 4G8TA 5DXYA 5M3WA 3KWSA 5EMUA 3B8DA 4AC1X 4JIRA 3TCSA 2PZ0A 2O9RA 2ACRA 2Y89A 1WB0A 3BZGA 5FF3A 1W3KA 5E9XA 1ZJAA 2DZWA 5BOFA 1FKWA 2W4XA 2Z26A 3LHZA 3SY1A 1RQBA 2GGHA 1XW8A 1XINA 4DJEA 4FNTA 3WIJA 2OTDA 4ZQPA 1F6KA 4ZOCA 2XVKA 1J9YA 2A2IA 3NQBA 1JDAA 3RR1A 4GZEA 2BNJA 5BW6A 3PULA 3V1PA 3FOKA 4IP4A 2VVNA 4GVHA 3WK1A 3G0SA 4AYGA 4HA4A 4FR1A 7ENLA 3GC2A 2PAJA 4GKLA 2P76A 5FL1A 3L4VA 3ANYA 5A3HA 4XD5A 4IP7A 4ML9A 4QSHA 3I7QA 3PUOA 4DAIA 1UWQA 2YL9A 2WMIA 3AC0A 4H9YA 3OBAA 4UTIA 1J2BA 3ABRA 4D9PA 3PJTA 1FTXA 3LTPA 4ACYA 4W4QA 3AOFA 2X0SA 4PBFA 3OO2A 3GKAA 3VD4A 1FWBC 2J9YA 3NQVA 4QHRA 2WMGA 3RO6A 1Q4WA 2NUWA 5A6TC 5U7SA 2GGJA 3PVFA 2EQDA 3M0LA 4C6LA 1ISVA 4JHZA 3RM4A 1UASA 1TVLA 4S38A 5I6SA 3LENA 3EDJA 3UJEA 4MB3A 1M41A 3S3GA 1VYRA 4A3RA 1VH7A 4FXFA 2OELA 3ZT6A 4HOXA 4H6EA 3D5HA 2BG5A 2BOFX 1PPIA 4U2YA 3RX4A 2JEQA 2YFOA 1FDJA 6ENLA 4Q32A 4UTJA 1K4HA 1FWFC 5A2CA 3EOUA 1R8LA 1P0NA 4PUJA 3GU2A 2JQXA 2E8YA 4LF1A 9XIMA 2F6XA 3HMJG 3TEVA 4KCTA 1MUWA 4G5DA 1N8FA 1XLFA 1V3IA 4V27A 4GJ1A 2A4AA 4X63A 1DWHM 3W7PA 4BCEA 4N4PA 4WQ6A 2G3JA 1HGYA 2V69A 4PULA 4BKNA 3QPYA 4GVIA 2F61A 4ZZ9A 3D6NA 1VFSA 1ISWA 1AQFA 4EXAA 4GGHA 4LVAA 2V9DA 1JFXA 1S5VA 5D4YA 5FJPA 4MB1A 3UT0A 3TW7A 2A85A 2GGIA 2IPGA 3E0IA 4R3UA 4HIBA 2CYGA 1BYBA 5KITA 4A2SA 3VAVA 3H55A 4N42A 2CESA 4MTVA 2P53A 5D2XA 2DW7A 3QMTA 4YHGA 1XRSA 4AY7A 1UKPA 5CJMA 1UBPC 5GQBA 1BGAA 3I6EA 1P0DA 3W1NA 5LNVA 2VFHA 2HZGA 2PF8A 4AZ7A 3KOZA 4MAZA 4C1NB 1IQ8A 3XISA 1W8GA 3TMLA 1I2OA 1MZHA 1SJCA 4IIDA 4D6HA 3PR2A 1A49A 9XIAA 1XICA 4B4HA 2A3HA 4O57A 4IJCA 4H01A 3NDOA 2Y8VA 3I3DA 3KL3A 4HPHA 2B4GA 4LUIA 3QLLA 3HF3A 5B80A 3M7SA 4LVFA 3EXSA 1C7SA 3N12A 4XIMA 3GWQA 1X1NA 3G1RA 1KB3A 4EWJA 2YXGA 1K9DA 1TRIA 3P80A 2GGEA 2CLKA 5E9AA 3B0UX 3V0UA 3DESA 2XVNA 1E6XM 4W7UA 3EGJA 4LCSA 4DWSA 3LSCA 4E5TA 1YX1A 1ADDA 1V3JA 3I3EA 3UCDA 3B4UA 2WXDM 4GG9A 2CLPA 4AD1A 2G3MA 2PLJA 3WLSA 4AC7C 2JGQA 1IT0A 3FXYA 4LRSA 1QHOA 2OEKA 5C9WA 4IISA 2PBGA 3LCWA 2IPWA 4CVWA 2GDVA 3VZYA 3UJFA 1RUSA 2PRHA 4FF5A 1ITQA 4E3VA 3R25A 1TQJA 5LNWA 4K6AA 4GBDA 3DG3A 1KA9F 2ZA1A 4HZ8A 4PMVA 1GOQA 5IBXC 4LCRA 4C1KA 3EWCA 4GH3A 1EUAA 3R10A 1DEDA 3GYCA 5CPLA 4LEFA 1AW1A 4AXNA 3R1ZA 2IMRA 1XIBA 1K1DA 3CWNA 6XIAA 4H7ZA 5G2WA 3C56A 4HT3A 1M7OA 1HP4A 3MV11 4D6EA 2AL1A 4EF8A 2E67A 2YDQA 4WDTA 2HV5A 3BAKA 3HG5A 1TZ7A 3O3RA 1HTIA 2HE5A 3K8MA 3KL5A 1V0KA 5FD0A 2GDQA 1XCFA 1C90A 3G5EA 1XSKA 1IR1A 3ALFA 1OIFA 1ONRA 4GC3A 2VQUA 5LIKX 3CV7A 3EKZA 3PSWA 5T91A 4KH2A 4LUSB 5B7YA 3CUXA 1DJZA 1NDZA 2QJMA 3TW6A 4UR9A 1O4UA 5IFPA 4A21A 4PCFA 1OIMA 4QCEA 4XSMA 1HGWA 2QCHA 2E09A 4ZFCA 5GJMA 2J7CA 4GD0A 4B3KA 5LGXA 1UH2A 4DO4A 3NURA 1KWKA 3GK0A 4V1YA 3VDBA 1GOIA 3CXOA 2BVWA 3W2LA 1S3HA 3TWAA 3D46A 3N14A 5M17A 4TTUA 2YL6A 4US5D 2D3NA 4S2CA 5TF0A 1DTUA 3QZAA 1SFSA 3WJZA 1OM0A 3C0QA 1TO3A 3W75A 3HJEA 5CC5A 3TWBA 3G1VA 3ARQA 4NG3A 3SUUA 2DT1A 1OFAA 1BSIA 2ACSA 3RM9A 3F4CA 3VKJA 3OLEA 4QGCA 4WY0A 2OEMA 1TE1A 3CS2A 3BJSA 4E2VA 3MZ2A 4GINA 1HVQA 3HG2A 3N18A 1F3TA 3TJLA 4MKVA 1CPUA 4DF1A 2FTYA 4DF2A 1KBLA 2V5JA 3LI1A 3W87A 2VX5A 3V1HA 2PDLA 1LWHA 4UTTA 3KOYA 3NPVA 4TVDA 1PIFA 2GK1A 1W5PA 4DUXA 4GQ0A 2IKHA 3N9KA 4EAMA 3WSUA 4Q7BA 2W5FA 4FB7A 2WOQA 3FA5A 2PFHA 4RZ5A 3T7VA 3E0WA 1RCXB 3UR5A 1ODZA 1NWTA 3UR8A 4Y9MA 2PDWA 1QMLA 1NIUA 4IPNB 1A4MA 2ZOXA 1HJWA 7REQA 1Q5MA 2ONEA 1K8YA 3LB0A 3MB9A 2VRKA 1G9HA 1VRDA 3JZUA 3MANA 3CMJA 3BAWA 1P5BA 3KVKA 1DYSA 4PSRA 1MDLA 4M56A 5FF4A 4DXKA 1HZYA 1KBBA 4ERGA 1QW9A 2DZBA 4DNMA 4OIFA 3W7QA 4HMNA 1C8QA 3RCYA 3W1MA 1QR7A 5AHIA 1Z32X 3A21A 2XISA 3WJWA 2P8BA 3ONCA 3AU2A 3M43A 3H6OA 3LM7A 1UJQA 3FVDA 1XIIA 4XZWA 1U1JA 2C79A 3MUIA 1CT5A 1UD4A 3AYVA 5K7JA 2BASA 2PEVA 1PDYA 2HPIA 4QJ1A 5H6HA 5FJRA 5A69A 1JCXA 5ABEA 2BOEX 1D7FA 2CZEA 2Z25A 4NZ4A 3XIMA 1JZ6A 3VINA 4P7QA 3FSUA 3AMKA 5HNRA 2VXNA 1D8CA 4CQ8A 4M24A 1W91A 2X8RA 1CBGA 3KOWA 2ALDA 3AS3A 3QR0A 4B5XA 4EK7A 4UZSA 2R1LA 2FPTA 4YTUA 1E4NA 1QNQA 1E9LA 3VC5A 5JU6A 2HS8A 2YA0A 1OFPA 2OQHA 3QSRA 1OHLA 2D3LA 4RXFA 4XAGA 1NOUA 2YCLA 4PUMA 2WHMA 3ZJ7A 4ICCX 1XIDA 2ZA3A 4MB4A 1CYGA 3GDRA 1Q8AA 1Q8JA 5ABFB 4KF1A 2VEFA 2TRSA 1FHDA 4EE9A 1I2NA 4OOZA 1FH8A 4FLOA 1EP1A 4HNOA 3AAMA 3ENLA 4US6A 3QOMA 1EXBA 3FN9A 3PJUA 4AH7A 2RGMA 5DCEA 2VZOA 2BGSA 5H8UA 4HTYA 5A8PA 3IAQA 3ES8A 1VP5A 3MHUA 1LYXA 1FKXA 4XZHA 2OB3A 3N3MA 1P0BA 4DAFA 4R7JA 5AFDA 4L7ZA 4U3CA 1L8PA 1XIEA 5FEWA 5LNRA 3KAOA 3VIPA 3I4EA 3SBFA 4ALDA 4H6RA 1QNPA 1CEOA 1B90A 5AYXA 1HNYA 1H11A 4UFHA 3IPWA 3N3TA 3U2OA 5FCZA 3VOGA 3DHDA 3LMZA 4OWGA 3DYOA 1OYCA 4C6CA 1VFMA 5BYWA 2G96A 3CHVA 1DXFA 2V38A 1UD8A 3G3MA 4W84A 1LLWA 3VIGA 4K1WA 3IVUA 3TC3A 2E7FA 2VZUA 3U0HA 3KTXA 4DJEC 4PBGA 5I3GA 4YNGA 1J0YA 1EO7A 1Q63A 1QW8A 1PBGA 2ASHA 4GVGA 1ZENA 3O05A 3TR9A 5BZAA 3K2GA 4W7WA 4R85A 4UNIA 4F48A 1JCTA 3HQ1A 1AD4A 2PWVA 5MF5A 4NNAA 3MSDA 3DH7A 4N9BA 1HL9A 4U3AA 4KRUA 1GUVA 1GZGA 1B54A 3NQEA 2L5HA 3AIEA 4JTUA 4EOUA 4ZFMA 1EJ7L 1GONA 4CD8A 5EMKA 1C9DA 1LLOA 4LS1A 3KVMA 1H7WA 4DB7A 1BEUA 1XS2A 3KHDA 2YOCA 2EG6A 3AISA 2VNCA 4MWAB 3RF9A 3VE9A 1UR9A 3BOFA 1Y0EA 1EBHA 2D24A 1C8XA 4Z1AA 1AG1O 2VTFA 4IJBA 3EX3A 3U2ZA 3T0TA 1G01A 4H6QA 4AZCB 3AIRA 1KBIA 3MI3A 2QHAA 4S3EA 1AZ2A 3MA8A 5EY5A 1GKQA 1TV7A 1EP3A 2ZFAA 2E77A 2WKLA 3WUGA 3I10A 5HPOA 3LRMA 4J5NA 3G8RA 1CGTA 4ES4A 2QJJA 4LALA 1QPRA 3MSYA 2VI0A 4NRSA 2J8FA 4HPGA 4WXYA 1CGXA 4UOQA 3VXGA 1F9CA 3BH4A 3LHTA 3UY8A 4B2DD 1ZCOA 1RQEA 5EMYA 1J0JA 1EYWA 1ZGDA 4C91A 4KMQA 1YE6A 4Y8EA 2Z6JA 3CPRA 4DNHA 4WHBA 4MJ2A 4LUYA 3TC7A 4RPPA 2W0UA 1ZL1A 4QXIA 2BY1A 4MF4A 4H4IA 3PZOA 4GO9A 1K3UA 2YW4A 2JALA 2X09A 4CQ9A 3GD6A 5BROA 4QNEA 1HJVA 3JUGA 5F2GA 5JIPA 2Y7FA 3N1AA 4L4PA 3GAYA 1WDSA 3POHA 1MNZA 4XZBA 2GJXA 3VIKA 4RPQA 5FJTA 3B06A 3BO9A 5H8PA 4OQVA 1UZDA 3WBYA 3FJ4A 3MO7A 1PZ0A 3WD3A 1CDGA 3GC5A 5CBIA 3W1RA 4RE3A 2EKCA 3L0KA 4XBSA 3KL0A 4K7VA 3O7UA 3BW3A 1M7XA 1L2QA 5HWNA 3EXTA 4EACA 2OLSA 4HNVA 4C65A 3M1ZA 2ZZ4A 1UOZA 3H4WA 2H9AA 3NA8A 4U28A 4D6JA 4X3ZA 2PCQA 4PMOA 2J7GA 4B90A 3LQGA 2YCJA 3GTFA 4J3WA 1NAL1 2ZKMX 1HX0A 3LERA 4XUYA 1FWHC 2ZZ3A 3RX2A 5AVHA 4BEUA 2XN2A 3B0PA 5HWMA 1RA5A 5K3VA 4BEQA 2V3EA 3QZEA 1UKTA 1KGUA 5E93A 4ATDA 2NQ9A 2WSQA 2VHLA 3W1QA 4DZ5A 2ACUA 3I7RA 1UYQA 1PV8A 1QFEA 2VRQA 3M0ZA 3GG8A 5FSEC 2WYSA 1B3VA 3THAA 2JIEA 2YA2A 3W84A 3ZLFA 2XVLA 3GHRA 4JFWA 4QSFA 2DJXA 3CL8A 4L9XA 2RDWA 2GSHA 4AHQA 1W9DM 1XPGA 4WSJA 4AX6A 4L80A 3GVQA 4E6MA 3S5NA 1G4PA 3CK5A 2YFNA 1TPC1 3W2MA 2V0TA 1FOBA 2CCRA 5F1UA 1K03A 3TYCA 4D8LA 4KW2A 3UZJA 2CBUA 3STFA 5HMDA 3TN4A 3R0DA 5FJIA 4Z2JA 4NAEB 1PKMA 4CU7A 3LXAA 4HZ6A 2ISFA 1JYXA 2XPKA 3QM3A 2OODA 1VFFA 4HZMA 1WBJA 3T1GA 2QV5A 4W85A 4LWWA 1WKYA 1ICSA 1R47A 5BOEA 1GZ1A 3MUXA 3NQ8A 1VPXA 4E38A 1KR0A 2D69A 4GQQA 4IGMA 3HGJA 2C8NA 4X0NA 3WLIA 4F0RA 1LDCA 3QV7A 4O11A 5CSUA 4HP5A 4URIA 3G1FA 3UY7A 2NZLA 3S9YA 3KE0A 1TMHA 3CB8A 6A3HA 2NXIA 1ZP4A 2WC3A 3LCLA 1DL3A 5D2VA 2NLIA 2Z1WA 5A6AA 2ICSA 1B3OA 3FA4A 1DPMA 3NO1A 4NASA 1SR0A 3MMWA 4CNNA 2OX1A 1RVGA 4H19A 3VNZA 3NSNA 2A6NA 5FOOA 4KCWA 2YLAA 4I7VA 3NYZA 4H9TA 1CGYA 2O4MA 4N7QA 1Z8AA 1HJSA 1FWSA 2REQB 3O6CA 1TR1A 1QI2A 1H63A 3C0SA 4NL1A 2BX7A 2D2JA 1DE5A 1ZBKA 4MNJA 3OVQA 2NVCA 5C5YA 1NOWA 1G4SA 2YX0A 4O1BA 1HKMA 4JKKA 5XINA 5D2YA 1JULA 3AROA 4MYAA 1G94A 3E02A 3EX1A 4JFSA 1JCJA 1VCGA 3H24A 1PX8A 5I07A 2FTPA 3MKVA 2ON3A 4LAZA 2PPGA 3CO4A 4LTSA 3WK0A 3P61A 3BOLA 3WDJA 1X6LA 1UJPA 3SSZA 1L6YA 3GDKA 1PKLA 3CIVA 3WLLA 4Q4PA 5BXRA 4H00A 3WD1A 2OLHA 2VD8A 3EX2A 3N2OA 3H2EA 3CLMA 1F3WA 3C52A 2FHFA 4IL2A 4Q7NA 4Z2LA 3W02A 1X7IA 2YDAA 1TREA 3TA9A 3BLIA 3UNTA 1JJKA 3A4AA 2PGFA 3BG3A 3QRHA 1BWVA 2FMNA 4DBDA 4YJ5A 3WLRA 4ZCWA 2CC0A 3F4NA 2G4FA 3GVGA 2RHGA 1W56A 3REQB 3RILA 1I1WA 3WNKA 2ZUWA 2NVDA 4D2JA 4KGJA 3OOQA 5AZ1A 4IPLA 2VT0A 1FWEC 1RA0A 4NZCA 5PTDA 3INPA 1X96A 1T99A 4CEXC 5D05A 1DJNA 4XZLX 1V3LA 1Y65A 3BCDA 2CZFA 4CD6A 3P82A 4V33A 1JUEA 1G7UA 1QOPA 4NZJA 4LB4A 3NL3A 3WH5A 4N2YA 3EYPA 1CTNA 4LV9A 1WKDA 1BF2A 4UCGA 2V5DA 2ZWZA 1VBGA 1TPFA 3FGCB 4NJJA 1KCLA 4REQB 2E8ZA 3UR7A 2Y4SA 2QVHA 3HV9A 4NAFB 4W8AA 4GH1A 5D33A 3FLUA 5I78A 1ZP3A 3QSTA 1TELA 3USZA 3ZVHA 4GK8A 1FWCC 1BD0A 4RKAA 2BWGA 1OK4A 2HNEA 4J3VA 4OBSA 3OGSA 1PXGA 3DGRA 3BVJA 3FDKA 3P93A 5M5DA 3MI6A 1YDVA 4BJHA 3AHVA 3SUSA 5DEZA 2WJEA 4NJKA 3G0UA 4KKXA 4UTHA 2OSWA 2NWSA 2A1YA 1ZALA 2R91A 3AMLA 3E0LA 4RLIA 4UTMA 4FI4A 4I8DA 3P2VA 1RSCA 4X2RA 1X38A 4YYCA 2BODX 4MWAD 1ZBWA 3T6CA 1JF5A 3ZWSA 4GISA 1AQ0A 3NUKA 4HYRA 4AWUA 4XZNX 3KRSA 3M0YA 1EJWC 1G1YA 3SCRA 2GLKA 1X1OA 4RW3A 3ONBA 4PTDA 3WLJA 3ID7A 1B4KA 2F6UA 3CUGA 3DDMA 3CAQA 1XC6A 5F4XA 1E56A 3JS3A 2QYGA 1WV2A 5D02A 1KRAC 1DJHA 1IE7C 4JCMA 3PPGA 1YTEA 1J6PA 2XSBA 3C3UA 3BJTA 3M5XA 4LXFA 5CEWA 3CU2A 4D6FA 4UNLA 4I7WA 2ATMA 3VKKA 2I17A 1XQKA 1LBMA 3Q94A 4K39A 3SADA 4JN6A 3IGUA 3DKJA 4M1RA 1F05A 3UXLA 2R6OA 1BG4A 2D23A 2D2GA 3VDHA 1KV8A 2DIKA 4XD4A 2IPJA 2J7FA 4YXGA 3OA3A 1M3UA 1F07A 1X8FA 3GU1A 4FXJA 4ERIA 1BKSA 4UQAA 2FB3A 1NFGA 5LKYA 4KQNA 9CGTA 1LL7A 1GCYA 2HVOA 3CPGA 2CZVA 3T8QA 1Q6RA 3ARSA 1S39A 4S3BA 3CUIA 3G6LA 2HWGA 2FH8A 4LYKA 3RCNA 3DC8A 4EIVA 4XBJA 4AHPA 3MY9A 2OZ0A 3BMVA 2BVTA 2IS7A 2OLAA 4JIHA 3PPFA 1EBGA 4XBKA 1OADA 1V0MA 2IW0A 4V28A 4Y9OA 4LNCA 4PCNA 1KFLA 4JFVA 4ONVA 4Y2WA 2A7RA 1SPQA 3NQAA 1IEIA 2O7SA 2EJ1A 1PAMA 5CPSA 3ITGA 1LG2A 1Q3NA 1KGXA 3FKKA 5FJJA 1IYXA 2WZTA 3SRHA 3NVDA 4HSNA 2B7OA 3RPTA 1EJXC 3VGGA 2HK0A 1MW0A 3CHEA 1OT1A 3WNPA 1YXYA 4MNMA 1NF7A 2VFDA 2R82A 2EF9A 1GGOA 3E96A 3QFEA 2CFFA 2EG7A 5CAKA 3TW9A 1OX5A 2FLIA 1W1TA 4XAPA 1ZAJA 1C93A 4IIGA 1S2TA 1YXDA 4NNBA 5CGQA 4BWLC 2VD9A 3BANA 2G3NA 3URAA 1K9EA 1WZKA 3OP2A 1ZSXA 4O50A 2WZMA 3WFLA 1QRQA 5C2CA 2DV0A 1OQFA 1YNQA 4IMAA 4HZ7A 4DYKA 2GUYA 1LF1A 2Y5EA 3LBMA 2VFEA 7PTDA 3FX4A 3O2LA 4UNKA 1HT6A 2FDMA 3MP4A 2YZ5A 2Z27A 3NPWA 4A2RA 1A80A 3EXRA 2ZUUA 3URNA 1YKWA 1CECA 4KWOA 2NV2A 1JDCA 1IZJA 2DUZA 1IT8A 2QGYA 1SZGA 4K7YA 4MFEA 3UVIA 3P60A 1CLVA 4NZFA 4MMWA 4MJ4A 4AD3A 3M0KA 3VVGA 2HBVA 2OWWA 2G4JA 3Q45A 4PRRA 4YVXA 3KS5A 1U5VA 3RJXA 1I0BA 5G4EA 2O56A 4AF0A 3GS6A 2QDGA 2P0IA 1EJSC 2FVKA 4XKMA 3B05A 1FA2A 3PBVA 3PWAA 1V3MA 2B7QA 1AH0A 1K7FA 5I3HA 3W0KA 3H2OA 5G1YA 1G0CA 4JQ1A 4Q7IA 3CTTA 4MUZA 4TOQA 3NTYA 3HMCA 3XINA 1LOLA 4KEMA 1XG4A 4P7OA 4N4QA 3RFAA 3VOFA 4Z42C 3T55A 1CXEA 4QAWA 3KW3A 3ZR4A 2EXOA 2VKZG 3VIFA 4C6PA 2WCAA 4CCCA 1HF6A 1L6WA 4HMEA 1BYAA 2RDXA 3SGZA 1GOWA 2Y88A 3MWCA 3TOPA 1KNWA 2RDTA 2DZPA 1MSSA 3LHYA 4LY4A 3DFYA 3W1LA 2C1HA 1QI3A 1W1ZA 3TR2A 2V6AA 3U4FA 3CZJA 1A5UA 3NPXA 4UQBA 4BF5A 3BLKA 3EWDA 4ZEPA 5C2XA 5HXMA 1IGSA 1J2WA 3IV3A 3PZIA 5JH2A 2FQIA 1PYMA 1XISA 2XH4A 4RJEA 1TA3A 1D2KA 3U57A 3ZT5A 3EWYA 1TKKA 1AFSA 4ROPA 2UV8G 5D30A 3W07A 2E6DA 2VZVA 2V2DA 1MRQA 3R8HA 4E8CA 1V6TA 2DJLA 3GG1A 4XKYB 3WJXA 4DBUA 1MEHA 4XVDA 4HNCA 3ARZA 1E70M 2VFFA 3PZUA 2J78A 1SW3A 2O9TA 1CCWB 3DYMA 4P7LA 1KRCC 2GDUA 1M9HA 1XP3A 3B0VC 4JN7A 1XV8A 4ZO9A 3HFYA 4R9OA 1YEYA 4CNSA 1XYCA 3WF3A 2XM2A 1UR1A 1V6WA 4GZJA 3DG7A 1NP0A 1UCWA 4C6DA 4EWND 5EMLA 3UEQA 3CV2A 2DU2A 4LVBA 3VKAA 3QY6A 2OT1A 2BHZA 2Y7EA 4MJMA 1MMFA 3N17A 3LU2A 5EBUA 3WX7A 3A3WA 3VNMA 3H23A 3QF0A 2PDFA 3TXZA 3WELA 2YGYA 1XHGA 3LPPA 5LXEA 1W9PA 3IJ9A 4CNTA 3LV6A 3VYLA 2E6AA 3S9ZA 2XYLA 3ATYA 2E6FA 3DAQA 4D1IA 4GBUA 4IMEA 3W22A 3M5ZA 3WNOA 1ZJHA 2ZUNA 3H7VA 3OYZA 4QEHA 1XRTA 1F4HA 4QG8A 1TTPA 1NQKA 3ABSA 5AKQA 1KBKA 1JNEA 1SMDA 2INZA 3GVVA 1US0A 3BXWA 3QVQA 3URQA 4IIBA 4GYJA 4I6KA 3WL0A 1BXCA 3S5YA 1XFBA 1OGSA 1UP3A 4GXMA 3UQNA 4AYSA 4IQDA 4D8AA 4R53A 3TQVA 3R6IA 3CZKA 3E2RA 2F9RA 2Y85A 4US5A 1F6PA 1E71M 1WDPA 4YS1A 1ISZA 4WOQA 1H60A 3BLDA 3SI9A 3PZ9A 3L21A 3WUEA 1Z48A 5D8WA 2CXEA 5DBTA 3OZPA 5IDIA 4ATWA 3CYJA 5ECUA 2O55A 3G1HA 2OWXA 4ZODA 1YPXA 2G37A 4POCA 1N55A 2C13A 6TIMA 1REQA 1GHRA 1RVKA 3LPFA 3SQLA 2J8GA 4H8UA 2XN1A 3EDDA 4YWSA 1BG9A 4B16A 1S46A 5A6JA 2FTWA 2VX6A 4OVXA 1R3VA 3G18A 5LNUA 1RQHA 3SUVA 4Z1DA 3TVAA 2E25A 3ARWA 2E68A 2G8ZA 2PDYA 4PMJA 4ADTA 3ITVA 3W74A 1A5KC 1I60A 3Q2DA 3W7EA 4Y7EA 1XD0A 1VYSX 1EC7A 5REQA 2PTZA 2DEPA 1ZAHA 4O13A 1J5TA 1OF8A 2FB2A 1H2JA 2J6VA 1EJVC 3HPAA 1M53A 1MZRA 2WW5A 1SO6A 3OG3A 1PTDA 2XWDA 1UWSA 1HKKA 3PN8A 2OFJA 3CEUA 1VJZA 2JIWA 4IOTA 4F2TA 5JBEA 2QT3A 3B0YA 3MC5A 1YXCA 3QKEA 1MXDA 3P5ZA 5I5RA 2IKJA 3AHYA 1POKA 1E9YB 4ML4A 4MY9A 3CZGA 4GABA 1XQLA 2V5BA 4BQ5A 2HNHA 1EPVA 1GPFA 4FHAA 3ISIX 3LLFA 1E1CA 3E38A 2W27A 2XHYA 1TZZA 1G7VA 1KQZA 2C6QA 2ZX6A 4WIWA 1JEZA 3NL2A 1Z3NA 5BXPA 4DBWA 3S8HA 4IX0A 1GVOA 1UPMB 2Z0IA 3OJGA 3VOJA 2PCEA 3QW3A 1W5MA 2Z4GA 2ODOA 5FKYA 1NY1A 4WUIA 1R5YA 1I6NA 3VA8A 3TFXA 3TTQA 5HMFA 4A3YA 1V4YA 4MG4A 3VKBA 4YTTA 3MMUA 4Q4SA 4LQ1A 1U1UA 1H7NA 1P6BA 4WRHA 4UTWA 1OCNA 2AL2B 2HXTA 2XJ7A 3DFQA 4LU0A 5G2HA 3VDGA 2GQ9A 3P62A 3BLOA 3JRKA 3WQ8A 4MPKA 4NT0A 2XSXA 2ZCGA 1B4EA 2AGKA 3AYRA 4J3SA 5CZ0A 2OR2A 1DQWA 3U2CA 3VGBA 1SO3A 1NQ6A 1TG7A 4I8YA 4JQ4A 1U22A 4GJJA 4IFKA 2JK2A 4AQLA 3E12A 1BGGA 1AA1B 3L9CA 3DHFA 1VBJA 3BMXA 4HCHA 4LBSA 2C3ZA 3L66A 3QMRA 3CUJA 3RMJA 2YBUA 3CTLA 3GG7A 3LRKA 3CIWA 1G67A 5JH1A 2IKGA 1KWGA 3NM3A 2QR6A 3WD4A 2D2HA 5BRPA 2VQTA 3PAJA 3OLDA 4IM4A 5CBBA 2GUUA 3PNZA 3KBNA 2Q09A 1A3WA 2FZNA 4WK9A 4WJEA 1PWLA 5GNZA 1GOXA 2ZZ1A 4M3PA 4OUEA 1SO4A 4F2BA 3QGVA 4PMRA 3PNUA 2VC9A 4XV0A 1V08A 3WH7A 3MYPA 1KXHA 1K6AA 4O15A 2BZNA 3AI0A 4GNKB 2HDJA 3CQIA 3RPDA 5G4WA 2AKZA 5I77A 2PB1A 3LEPA 1MUMA 4IP5A 1TWZA 2QCCA 1V0NA 1XG3A 3SEPA 1GOOA 2GUBA 5AHMA 3N13A 1KRMA 3THUA 1XLAA 1CXLA 3QFWA 3OYXA 1GVFA 4EPKA 3KDNA 2I56A 3L4TA 3KHJA 4PEKA 2XIIA 4IG2B 5K4ZA 1HW6A 4JTEA 3AIUA 3VM7A 1T40A 4Z2IA 3GAKA 2P0OA 4H9ZA 5I7GA 3DKLA 1UB3A 4LVDA 3RN6A 3WJSA 5FEXA 3TE9A 4HBKA 5E5CA 2OWCA 2RGLA 3JW7A 3PANA 2BGNE 1EJTC 2P50A 2VDIA 5M2FX 1RBAA 1JAEA 4PMZA 3U6WA 3LY0A 1H3GA 2PI6A 2VVSA 1HKIA 4MLJA 4Z2KA 2WBKA 3AXHA 3LGDA 2QCDA 4OGZA 1JCYA 3KUMA 2DSKA 5A6SA 4WJ8A 4GI6A 1WUEA 2YB4A 1U83A 5FSDC 1TB3A 1BKHA 2YYTA 2H8ZA 1LZOA 3GFZA 2DH3A 2EAWA 1EC8A 1CGVA 5CZSA 5AY7A 1U33A 3C2FA 2J7EA 5HJLA 1AMYA 1YBQA 2UY2A 2R14A 4B2DA 4TX8A 2A3CA 1UMYA 2VEIA 1IZKA 4GE8A 5JBDA 1BF6A 3SCWA 1W9XA 4X22A 2EGZA 3UJSA 2QIIA 1PZ1A 3KRUA 1R7OA 1ZY9A 3EPMA 2WMIB 3UR2A 3SCTA 4Q4KA 3OVRA 1MW1A 4H7CA 3SJ3A 3UA3A 2C0HA 4PMDA 1ISXA 4HCLA 4LH8A 4RNFA 4OE7A 5KMYA 3V18A 4K68A 3DERA 4HTBA 3S1UA 3B9DA 3WK3A 3STPA 3SIZA 3VGDA 2DT0A 1UC4A 1GTEA 3IVTA 2ZX8A 3P14A 5ABGA 2VC6A 1DE6A 3LGGA 2A7PA 2P3EA 1GEHA 5CJNA 1EOKA 3W4RA 3WFAA 4JCLA 3EPNA 2WKJA 2ZE3A 3HGRA 3N11A 4F4RA 1W1PA 4A4AA 3SCNA 2WJZA 3U2EA 5CPNA 4N9DA 1H4PA 4G2DA 3UWZA 4ZO8A 3PBWA 4QG9A 1FWJC 4DUVA 2DIEA 5I3KA 2Q6ZA 3L4ZA 4C7GA 1AJZA 2PDHA 3H4GA 2OG9A 2NX1A 3U5YA 1RY0A 5CLTA 5E0FA 4GOAA 4GUIA 1LQ0A 3NQMA 3VNJA 4A8LA 2VDHA 3CYVA 4MY8A 3EDEA 3LCHA 2FPYA 4WF7A 3G77A 2PURA 3AJ7A 3QHMA 5A6LA 5EYWA 4WDWA 3M44A 3FDGA 5A8QA 1TV3A 1EHAA 3A9IA 5LGZA 2XUCA 1TMQA 3AHXA 3P6LA 4NX0A 1FX6A 2F8QA 2J62A 2F7FA 5AHNA 4M82A 4MB5A 1YW1A 5KINA 3DI0A 1Y5WA 2XFWA 4PTNA 3C8FA 2ZVIA 2C1IA 1OSEA 3UWWA 3GXDA 3OA5A 3MI2A 1FDZA 4JYFA 1RJPA 3OU8A 4ZXLA 4QM1A 3UG4A 1W17A 1NOFA 5JIWA 3MVIA 4Q3MA 3PBUA 3QTPA 4XK2A 2ZC1A 3ORWA 1EA0A 2WZHA 1TPUA 2NXGA 4PMUA 5I24A 4LAMA 4HGXA 4ZQNA 1DXEA 3ZLGA 2XH2A 1J10A 1PIGA 4MDPA 4ZB5A 4DEFA 2JBMA 4A3UA 3C0LA 1AW2A 1X39A 4QJ5B 1SSGA 1WOAA 1ZB5A 4CCZA 1H5VA 2E5CA 3WZ0E 4LS0A 4KFOA 3L12A 1E0WA 1OVDA 4XZMX 3A4XA 5C54A 2Z28A 1PVNA 1W1B1 5C71A 1SSDA 2MNRA 4KPLA 1TVPA 3EA2A 2Y61A 3O9NA 2I14A 3GVRA 3WNLA 2AAAA 3UZYA 2WZEA 3MVTA 1RP8A 1W5OA 3W7DA 4DWSB 1EA9C 1E6NA 3EOOA 3W25A 5IRPA 3LG3A 3ZXWA 4B5WA 2CLHA 2BP1A 3FAWA 3WJYA 5AHEA 1BXNA 3GIPA 2H3BA 4FR6A 3EPOA 4U10A 2W6RA 4AZ6A 2QCLA 5L6UA 3VNDA 4XVEA 4YHEA 2GSJA 2AMGA 1JYNA 3SIMA 3O6YX 1WAWA 1J0KA 4AY1A 1NELA 1YNPA 4Q8UA 1I4NA 2C14A 4JY8A 1O66A 3APYA 3POCA 3C8NA 2GQ8A 4Q6JA 3WDIA 2BTMA 3TZNA 4X9YA 3WY1A 1JI1A 1OINA 3W6LA 1UD2A 2XVPA 1EWEA 5HINA 1ICPA 3CBWA 1MW2A 2PWUA 1OC5A 4RCXA 1OY0A 1US3A 5JXQA 3NZ1A 1E6ZA 4JTRA 1ICQA 4DXXA 3S83A 3MO4A 4ZR8A 2V5CA 3UZXA 1VF8A 1W1IE 2X40A 1AJ2A 2DQWA 3LCIA 1DWFM 3CEPA 3GXFA 3AQUA 3B40A 1LORA 3B97A 2C16A 1A0EA 1UR3M 1U30A 4B9YA 3STCA 1SUXA 4BA0A 4HNNA 3KZSA 5AYZA 3TN5A 3QV9A 3WNMA 4UFMA 3R94A 4AZ5A 3KCOA 5HAOA 1PYFA 1VQTA 3R89A 3MW7A 5GNXA 4BHYA 3GY1A 1O12A 2JKPA 3T2QA 4JBRA 2I5GA 2TAAA 4S3KA 3RDKA 3JU2A 1A5MC 2W63A 2Q3RA 2VL4A 1UWIA 3QQWA 3GR4A 4JIPA 2PSNA 4JR5A 4ERAA 1RPKA 1Q7QA 3PZNA 5C9XA 4HKPA 1ITUA 5EFFA 1GW1A 1VCVA 3TXVA 4LW7A 4KEZA 4RR4A 4DQWA 1BQCA 3T2PA 3ARTA 3W23A 1EIXA 4CQDA 1W2PA 3V4BA 1JDFA 1EQCA 1PDZA 2GWNA 2ZX5A 4ZSUA 4L4LA 1A53A 3IJ7A 4PMQA 2BLEA 3ZJ6A 4B5VA 1O94A 1AQHA 4TUFA 3HTWA 1FWDC 1A5LC 3OW1A 1M68A 1X97A 3ANUA 3VDAA 1L8NA 1K7XA 1ZJBA 1J0HA 4M6PA 4RE0A 3FNDA 3WDQA 1QWKA 3M7WA 4LV4A 1GYMA 3VNYA 2O9PA 3BTNA 2I9EA 4IIHA 6REQA 2GK1B 6CGTA 1DQXA 1IGWA 3DFSA 3VI2A 1D3HA 2PA6A 1R7AA 1K9FA 1A5CA 3HQPA 4JX6A 3EAUA 2HJPA 3WD0A 2XIJA 1P6CA 4NU7A 2OEJA 2XGIA 3CO8A 3SY8A 4QP0A 3GFXA 2QCFA 2H3DA 1THFD 4X0VA 1NSJA 7REQB 1K8XA 5JUVA 2TMDA 4O16A 1EXPA 3RLHA 4E4FA 4DO7A 1Q6EA 4QFUA 1E51A 2EG8A 3T8LA 1CXIA 1SU5A 2Y7GA 3FW6A 1KM1A 1WP6A 1PCWA 1JPMA 3B03A 1C9WA 3OZOA 5XIAA 1W3JA 5BRQA 3LHUA 4U33A 1WDWA 1GVRA 2ABBA 1SZFA 5M03A 1AJ0A 2E6YA 3WCZA 3EOSA 2WBGA 3WL1A 4B91A 4Z08A 4HVXA 3DFTA 1UBSA 1T0OA 3KXQA 3QR1A 1O95A 3W85A 1WZMA 4QDPA 3SCUA 3VIOA 4O19A 1XR2A 4C5ZA 1R3RA 3QHOA 2QDHA 1NVMA 4QISA 1UZHA 2WQPA 5FJUA 1AH4A 5A95A 3BLEA 1ZJIA 2DUXA 2XH0A 3KZPA 4HPXA 1FUYA 4PTMA 5HNUA 4IH3A 2CXGA 1YNYA 2ZX9A 4PGLA 4E3TA 2C19A 4ZBCA 1MFUA 4GO8A 1GYNA 3GRIA 1U5JA 4CNOA 4QRNA 3TTYA 6XIMA 1R0MA 3WQGA 2J74A 2ISDA 2Y5JA 2NVAA 4JHOA 3I65A 5AC5A 3ZJKA 1E1EA 2VGGA 3L7RA 4Q8PA 4FNQA 4WD0A 2X0HA 4GJIA 1LP6A 4OV9A 1B30A 3HURA 1SQ7A 2YCLB 1JG9A 4LB3A 1FH7A 3UPWA 1FFRA 3KBWA 1POJA 3ICJA 3WQWA 2ZIDA 5IFTA 1HQTA 3RU8X 2ZICA 3MT1A 4A6GA 3VTRA 4S1FA 3QC3A 3GUGA 4PEEA 2QCNA 3DFOA 1VFHA 4LX4A 4HA0A 5HK4A 4RZ6A 2BY3A 3GNPA 1JPHA 3N9SA 1V77A 1Z44A 3A3HA 3P0WA 3RMEA 1PHQA 4NYYA 4CGTA 4HMDA 3TZFA 3KWXA 4N9EA 4PRTA 3WD2A 4C7DA 3RITA 4AZBA 4S3AA 4Q6XA 3TLLA 4S3GA 3II1A 4WY0F 1DWGM 2FH6A 4IPPA 1GJPA 1SW0A 5D03A 1BRLA 3VNKA 3VIIA 1XFCA 2HVMA 1KCZA 2R1MA 3H2FA 3VKDA 3O6DA 4PL2A 3W76A 2EO7A 2VM8A 1OEPA 3G1YA 1RZMA 3NXFA 4W87A 3ABZA 1MWOA 1HFBA 1R3SA 1XYFA 4YPJA 4LS2A 4JFTA 4FNUA 2DSVA 4K38A 4JZ5A 4H2HA 3KLLA 4J7RA 3GFYA 1VR6A 3SR7A 1EWDA 4DIAA 1VC4A 1JIBA 3HGSA 5HNNA 1DJWA 1B1YA 4EP8C 2Y63A 1ENUA 1PEZA 2NUYA 3UYIA 4TIMA 3EDFA 2O7QA 1XF0A 3PZVA 1DWJM 3L4WA 3E2SA 3W72A 1E73M 2WZIA 2HVNA 3U7VA 4LGXA 1AVAA 3FHQA 2WC7A 5I06A 4IPJA 3UG3A 3KBJA 1F8IA 3GO2A 4PSPA 4K3ZA 5HUOA 3G22A 3GNRA 2D0GA 2UY3A 4XAZA 4TU1A 1E40A 5G5IA 3WN6A 1VHNA 1QUMA 3J7HA 4W8BA 2YJQA 2ZYFA 1R30A 1ZTVA 3OG2A 2VGFA 3S5OA 5CZJA 4Y90A 2OZTA 3QMSA 4S23A 4PTVA 1SW7A 2RJHA 2YYUA 1S2CA 3EEZA 1H51A 1EJRC 3TMQA 1QK0A 3MS8A 2YPIA 5I23A 1H7PA 4C90A 3LPGA 2PP1A 3SUTA 3BURA 1FHUA 3CUHA 3IWPA 5A6KA 1XLMA 1ECEA 3ARVA 2O9OA 3F4WA 1EC9A 5I09A 4E2BA 3PTDA 4HYWA 1AMKA 3I6TA 3S1VA 2YL5A 1G69A 1PX4A 2WCSA 3QW4B 3S9IA 4DN1A 1R3QA 4OHQA 5K4XA 3H12A 1R3TA 3LSBA 2PDBA 1C7TA 2Q02A 2J9XA 1Z69A 4LAOA 3W6YA 3H54A 4C6NA 4IIEA 4GLEA 2GJXB 5E6YA 1DWIM 4JTKA 5CH9A 5DMLA 1JZ8A 2ZDSA 1FY6A 1J5SA 3PBYA 2ISWA 5DELA 1BVWA 3HFTA 4G9PA 3HG3A 4UUIA 2CNCA 3O8AA 4MZ1A 3WQOA 1CLXA 1FWRA 5AYYA 3E3HA 1PE1A 4LUTB 2NSXA 4WSKA 1JCNA 1KM3A 3REQA 3UESA 2PTWA 3V3WA 2DT2A 1DIDA 3GDTA 4O18A 3HPSA 3I68A 4ORIA 2H9AB 4O12A 4WKFA 1VS1A 1IXQA 3GHSA 1EQPA 1B2YA 3MSRA 1A3HA 3CZ8A 5JVLA 3CHCA 3E5PA 1CGUA 1W9BM 4R5EA 5LNSA 5TNVA 1WE5A 3APTA 2VC7A 1UH3A 4W88A 4RDYA 2A79A 3NIYA 1WX0A 4QE5A 4UOJA 4NNCA 3WYZA 3ERPA 2QMKA 4V15A 3LLDA 5TD4A 4D6CA 1GZJA 2WNQA 1O5XA 3W7HA 1GKRA 3BK0A 3DECA 4EX4A 4GUJA 1J8VA 4JX4A 1VBHA 4K37A 3MMTA 5FF0A 1FQ0A 4GUGA 1CXFA 2ZX7A 4JAWA 2C18A 3E49A 3KX6A 3JZEA 3CPUA 4PFMA 4BQ2A 2GJRA 1QVBA 3BLLA 4QJ3B 1QCWA 3TOYA 3VE7A 2C7FA 4JN8A 1TX2A 3W2NA 4MNLA 3O0KA 2DZTA 3IRDA 4OJYA 5HPCA 1FWGC 4KWSA 1WDRA 1AK5A 1EO5A 2I7GA 1BAGA 2HSAA 1B3WA 4LOCA 2GPTA 1A5BA 4P7NA 1PIIA 1TJ0A 1W8SA 1T8XA 3H7UA 5K9CA 4PA8A 2FGBA 4L56A 3MUCA 3W7CA 5LIXX 1P0EA 1V3HA 2X1TA 3AMDA 4FXSA 4Q8WA 4MY1A 4MKNA 1R85A 3A9BA 4J40A 1Q6QA 4HU8A 4IIFA 4O54A 3BGJA 3N9RA 2PC8A 4BQ4A 5LA0A 2GJLA 3TYAA 4GI8A 4LYRA 4PB3A 4IXXA 4GYFA 1K4GA 4GYPA 5CSSA 1BWLA 1Q65A 3S1XA 1VENA 1TUFA 1Y7VA 4DJDC 4KT2A 1L6GA 1UWTA 1H50A 2CWNA 3FJ6A 4RE4A 1TJPA 2V68A 3I4KA 4HCDA 3RNDA 4XQ6A 4PUWA 1NU5A 4ICMA 4RZ4A 4MFDA 4CN6A 2CBIA 1EP2A 1JPDX 2UY5A 3M0MA 3ZQ9A 4UTFA 3QQ0A 4FX8A 5FACA 2I5IA 4IQJA 2NX3A 4XD6A 2A3LA 2XDFA 2QULA 2EPNA 5JBFA 4YYFA 4CCDA 1ZRQA 1HO1A 1T6MA 3IRSA 2DT3A 1V93A 3MYOA 4H1ZA 1LT8A 2EKGA 3AXKA 3W00A 1ISYA 3NJ3A 3NCOA 2GWGA 3WF0A 3OHMB 4Y9NA 3BUVA 3O15A 4J9JA 3GXIA 3KEHA 1JAKA 4B92A 1KFJA 3C61A 2J75A 4G56A 2IQTA 4MVAA 3SSJA 5EPDA 5I79A 1OG0A 2B7PA 3ITOA 2E28A 5HQMA 4DO5A 4JY9A 2E9BA 3EDKA 1IWAA 2GZXA 1DORA 3ZSSA 1I9CB 1O5KA 1F5ZA 1MQRA 1UG6A 1UPPA 4CD7A 3ZOAA 4GHRA 1GJWA 5XIMA 5CG0A 2F84A 4QNWA 2KX9A 5BU9A 1PTAA 5D09A 1V3KA 4J35A 4KBXA 4PE8A 3WQ5A 2PP3A 2VMFA 3N2BA 3QC0A 3KCJA 2YSWA 2ZZ7A 2O0TA 2J13A 2X16A 7XIMA 3MHFA 4P61A 2F2KA 3BAXA 1UC5A 2DSUA 3NM1A 1DJQA 1GNXA 4FZIA 1AODA 5I3IA 1FXQA 5D04C 3IS4A 3S1GA 3V5OA 3TYEA 1QO2A 4JKLA 4H04A 3PB0A 2DZVA 4YVPA 4DI9A 3QKZA 4L5ZA 3AXXA 5D2TA 3ABOA 3R4IA 1VCFA 1UIPA 5I00A 3F2BA 1UIOA 2BBFA 1ITXA 2D2OA 1G4TA 2YL8A 3W29A 5CC7A 2R1PA 3MCMA 4CD5A 4CD4A 1QT1A 3TX9A 2W61A 5K9DA 5HWJA 4TXEA 5F2LA 4O1FA 4AEOA 5H2ZA 1DXIA 1WPCA 2OGJA 4XZIA 4UR7A 3UNDA 2CERA 1W37A 3ZVHB 4BR1A 2JF6A 3S42A 4QQ3A 2OKOA 1BTCA 4O1DA 2WVSA 1Z7AA 3OB8A 3TCEA 1YDOA 4UQDA 1NWRA 3WUFA 1EDQA 3NZRA 3IGSA 2XINA 2JKAA 2PS2A 1J12A 1W5NA 2IXUA 2OT0A 2A5HA 2CLIA 2VFGA 5TIMA 2FZBA 2QQ6A 5CZKA 3SCSA 3A13A 4XZ9A 4D6GA 1CI1A 1GK8A 3B8TA 2Y70A 2DPEA 3UBPC 5CSRA 2KZHA 4RNJA 2Z1BA 2E40A 4CU6A 2EBNA 2QUNA 4MKSA 1RCOB 4FNPA 3WQPA 4IFOA 1KFBA 3DU0A 3VGEA 4A35A 3GLCA 2ACQA 3W7NA 8CGTA 3ABQA 2HRWA 3C86A 4GWEA 2HS6A 5CKSA 2VFIA 5T9CE 5C70A 4UXDA 3O1NA 1JF6A 7A3HA 3RU6A 1PX3A 3PG8A 1LQAA 1RH9A 1BLIA 5BU6A 2HK1A 5IHSA 4GZIA 5A6BD 4LRTA 4FLRA 3VCNA 5ABHA 1B9ZA 4IXHA 1VFUA 1YTKA 1JZ3A 3SO7A 5HA7A 1MRAA 3KOFA 1YIXA 3UXKA 2FZ9A 3VNLA 5LHFA 4GRSA 3BGGA 4L6DA 3GXTA 2VENA 3EEGA 1IZCA 3LRLA 2P5NA 4XSLA 4P8WA 4XISA 1I2RA 1FFQA 1XKYA 3M0IA 3TTEA 3W1XA 3UWQA 4DVOA 1KFKA 5IHRA 5MHBA 2INEA 1M01A 5E0CA 2WC4A 4GCAA 4D71A 4XO6A 1DP0A 1EDGA 3RHGA 5M1TA 1EX1A 4PB4A 3LHWA 1HKVA 3PC0A 4LFYA 2DSWA 3TTOA 2QUTA 1H7XA 1L0PA 5CGMA 3NPUA 5DT7A 4XAFA 1XLDA 5F2MA 4A05A 4DJFC 4GMEA 1UD5A 1JYVA 2ZADA