4I8YA

Structure of the unliganded n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
303
structure length
303
Chain Sequence
b'DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
total genus 114
structure length 303
sequence length 303
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i8yA00
1DJIA 2FJUB 4F2BA 5PTDA 3H4XA 4I90A 3CH0A 3KS6A 1PTDA 1XX1A 4S3GA 1YDYA 4F2TA 1O1ZA 3I10A 4PTDA 4QJ3B 3V18A 1V8EA 4GNKB 3EA2A 4RV3A 4QJ5B 3PTDA 6PTDA 2O55A 2P76A 1T8QA 3V1HA 4I9JA 1DJZA 1PTGA 5T9CE 1T6MA 4OECA 3QR0A 2PLCA 2OOGA 1VD6A 4R7OA 2OTDA 2F9RA 5T91A 4I9TA 4I8YA 1DJXA 5T9BG 2PZ0A 3H4WA 3NO3A 2OR2A 3KS5A 3QVQA 1DJGA 2ISDA 1QATA 7PTDA 3OHMB 4Q6XA 3V16A 4RW3A 3MZ2A 3RLGA 3EA3A 2ZKMX 4QJ4B 3EA1A 1DJHA 3QR1A 3L12A 4I9MA 1GYMA 3RLHA 1QASA 4RW5A 1AODA 4F2UA 1ZCCA 1DJYA 2PTDA 1DJWA
chains in the Genus database with same CATH superfamily
5IXEA 2EPHA 4V33A 5FF0A 4H41A 3KVMA 4C6IA 1VGAA 3WL1A 2FVMA 3R0UA 3G8RA 2I9UA 4HB7A 2OCZA 1M7PA 3E38A 5CAKA 3AWNA 1EDGA 4JN7A 3GG0A 5C7VA 4UQCA 3FDKA 5CBIA 4UFKA 1W5NA 2ZDRA 3QFWA 3FIGA 3B0YA 2CZDA 4F0RA 4OUIA 1JCNA 3ZO9A 3WNPA 3PPCA 3QMRA 4IF2A 4FLQA 3QPZA 5FEXA 4X0VA 2PP0A 4WJXA 5GPRA 3TU9A 4H9UA 5FL0A 3UJEA 3GK0A 4F40A 5K7JA 4PUJA 1SZEA 6ENLA 3IARA 1RJRA 4B2DD 5IBXA 1EUNA 1GPWA 2P10A 3BXWA 4NY2A 1RJPA 1HKJA 4AF0B 2OZ3A 4AC1X 3BQ6A 2VR4A 2Y6ZA 2H3BA 1GGOA 3A6OA 1GYMA 3RLHA 1GKRA 3EWXA 4GQRA 1LQ2A 3MSGA 3PAJA 1R7OA 1HO1A 3WDQA 3WQ5A 2GOKA 2PF8A 5F4XA 1GZ1A 3ZWTA 2VEKA 5LA0A 5I0DA 5M1TA 1VEMA 4PL2A 4H9VA 3C0SA 3NSXA 2PLJA 3U2CA 4QEEA 3RR1A 1CGXA 4Q8PA 3PZOA 2PF0A 3CC1A 3MW7A 3KEHA 1VYRA 4IGHA 1IZKA 4AHQA 3W22A 4QSFA 1FWCC 4KERA 1UA3A 3EB2A 3KX6A 1JUEA 1DJZA 5T9CE 5T26A 3VD5A 5JMUA 2Z00A 4JX6A 3U2EA 3QR0A 4XZHA 3VZYA 1OZMA 4JTUA 5FI8A 5CH9A 5A6SA 3LPGA 2NZLA 5D30A 1G01A 3B8DA 3XIMA 5C6MA 4NZ3A 4QG9A 1ADDA 4L6HA 2WSRA 1THFD 3CUFA 4YTUA 3A5FA 1I2OA 1RBAA 1XH1A 1ZBWA 3SY1A 2DU2A 5D2XA 2C0AA 1CECA 5HMSA 2DJLA 2F6XA 2RDWA 2ZXAA 2FGBA 4JQ4A 2VFFA 3BLPX 1TG7A 3E5BA 4W86A 1JF5A 3ZJ8A 4QAWA 1BPLB 1BKHA 4IP7A 4RW5A 1EQCA 2JIEA 1RY8A 2PDWA 1JCYA 4S3AA 4NX5A 1W1IE 4N02A 3GVRA 4ZODA 3UCQA 2AGKA 1VJSA 3M41A 3INPA 1TRIA 2ZWYA 3WF2A 5BWAA 3LPFA 1HTIA 4UTTC 1YXYA 4DAIA 1DP0A 1QOQA 3PFRA 5EKYA 2IMRA 3CTTA 4TTUA 2R1KA 3KBSA 4ZA0A 1A5MC 3DHDA 2QCNA 3CWNA 1FQ0A 3UEQA 2XN0A 4AIBA 1QPNA 4WGXA 4G56A 5HDRA 5FIPA 2O9RA 2X2YA 1P5BA 2G3FA 1XP3A 2C71A 3Q94A 3AXKA 1FDYA 1YDOA 3M0MA 4TOQA 2Y5EA 1RY0A 5FJRA 4PEEA 2W92A 2VX4A 4ZO8A 2NX3A 1KM3A 3DN5A 4FS9A 1VB9A 3VGDA 3DIPA 3P81A 3VNZA 4IJCA 3TAOA 3G1SA 2HNHA 3WLJA 2F8QA 1R3VA 4WJEA 3UZXA 1G6CA 3GS6A 1R9YA 3LMYA 3STCA 2GFTA 5CAHA 2WANA 5A6BA 5F1UA 1VPQA 3C2FA 3MUCA 1DJHA 4HGXA 2VZUA 1W1YA 3QGAC 4UFLA 4LOCA 3N34A 3RYSA 1OF6A 2IW0A 2PDYA 2EPMX 4JGDA 3FAWA 3P84A 4C5YA 2VELA 2OX1A 2FPTA 1XS2A 3N73A 3W1QA 4RNJA 3WKZA 3MV01 4B5TA 1VH7A 4JIEA 2OVLA 2HJPA 4P5UA 1XSJA 4MAZA 1K3UA 4RL3A 3SAZA 4B4FA 5KETA 1JVNA 4NU7A 4CD6A 1L8NA 3CHDA 4FEZA 4CEXC 1TELA 2CBJA 1SW7A 4JBRA 3BSMA 5IM51 4WX2A 4JL1A 3W82A 1Y5XA 1XGDA 4I3GA 2OZ0A 3HQOA 4GD0A 5A8OA 3SIZA 1TV3A 3GHRA 3QOKA 3EWYA 3TQKA 2BS9A 3LPOA 4A3HA 2PC4A 1JRBA 1PWMA 3ITYA 5H2ZA 3RG6A 1Q6GA 2YBTA 4ZR8A 3Q2DA 1M04A 5HBFA 1FCVA 5MHBA 3GVQA 4KMQA 1SMDA 2EPKX 2YZRA 3B8WA 3DYPA 2Z2AA 4UFJA 3GHSA 4O4VA 7PTDA 3U2OA 1UR4A 4RW3A 3L2IA 4PTVA 4HOZA 4AYSA 3RF9A 1FVPA 4YVPA 1GOIA 4ZMGA 3E1F1 1KGWA 4EPBC 4IMDA 5L9FA 2VI0A 1K9DA 3RIKA 2EPOA 4JFWA 2O56A 3B9EA 4ATWA 4E2OA 1K7XA 3IPWA 4YU1A 2X1TA 4MKVA 1W3LA 6A3HA 1GQIA 3DXIA 2WNNA 1H7WA 1F6PA 2E4TA 5LIYX 2ZTJA 3BAKA 4LCSA 2ATSA 2WMFA 4O0QA 3I3BA 1DORA 3FDGA 4Q8NA 3CZ8A 3S2CA 5DF0A 3BO9A 3VI2A 2PU1A 1N8IA 1EOMA 3PPHA 4AUBA 3KUMA 2VC7A 1ICQA 4AZHA 3S1VA 2MUCA 5BRPA 2QXWA 1Y0EA 2V2DA 1DOSA 4UQBA 2ASHA 3H8AA 1SFLA 4D6HA 3TSMA 1M1BA 2J24A 3NPXA 1D8CA 5FF7A 1XXXA 4W89A 5C55A 5C9WA 3BANA 2WQDA 3BV7A 3G5EA 4YNGA 3QC3A 3NWRA 1W8GA 1KBJA 1L2UA 4HU3A 1A0CA 3VABA 4H6QA 4QNWA 3HPZA 2R14A 3W2KA 7ENLA 1QDSA 4E5TA 5REQA 1Q4WA 2QJHA 3FX4A 4IZGA 3EPOA 1OIMA 4R9OA 4G2DA 1PX4A 4GFIA 1E6NA 3WD2A 1EWDA 3TR2A 2DQWA 1TJ2A 4LYPA 1Z9AA 5CJNA 1FHVA 5EBUA 3AUOA 1XV8A 3BZGA 3OHMB 4FXFA 3VU2A 1A4MA 4MUZA 4R88A 5C9RA 2YIHA 4FNPA 3NVDA 4S3BA 5HWJA 4A35A 4DELA 3VNLA 2PGEA 5HINA 4JQAA 1SW0A 1XFCA 4A29A 3HPXA 2VC6A 4P8UA 4ZB5A 3THDA 1ICSA 3NQMA 3WK3A 4O13A 1ZGDA 3GAYA 1EH9A 4R7JA 1F8MA 1P0DA 3SCSA 2W62A 4NJHA 1H0GA 1Y5VA 1R6WA 3REQA 2DEPA 3CUIA 4JICA 4C1KA 2J7GA 1HKIA 3TOYA 4JHZA 4MOZA 6TAAA 2Y63A 1JDDA 3VGEA 4IPLA 2XG9A 3BGGA 3ZJ7A 1R30A 3QV6A 4KWOA 1ZS2A 1KA9F 1P0BA 3FKKA 3N14A 3GG8A 1JNEA 3MWAA 4J3ZA 4OTKA 1CZ1A 4B90A 4JQ3A 2YL5A 3K46A 3FK4A 1OEPA 2XFFA 4KW2A 4K7YA 4GUFA 5I3IA 2BOGX 2BY0A 1Q2SA 1KTCA 3ZSTA 1RR2A 4W8LA 3W1AA 2OTDA 5FESA 5CPLA 2BLEA 3M07A 3W24A 4JFUA 2Z1KA 1HJSA 3M0VA 3RX4A 1UIOA 5I03A 4G5DA 2QCLA 3CQ0A 3MP4A 3CHFA 3MYPA 4AD1A 4WIWA 4QM1A 2VXNA 4WEVX 3MJMA 1ZCOA 2VX7A 1GK8A 3LG3A 3W73A 1IT0A 3RCYA 4AAJA 1E1CA 3LCGA 1V4YA 4EX4A 2E28A 4H4IA 1OFRA 1E55A 3K5XA 1OQFA 2J9YA 2GLKA 4AZGA 4EACA 2QYGA 4NJJA 3C4UA 3C56A 3VD4A 1UR8A 2R1LA 1CT5A 1B1YA 5D9OA 3RM8A 4QCEA 1W9VA 4DZ5A 1FWNA 3NXLA 2ZA3A 2QDHA 3NXFA 1KBIA 1ODZA 1EP1A 3HO8A 3E74A 7TAAA 1MW1A 4GIRA 3LHYA 3WELA 1BSIA 3HQNA 1XCXA 2PU0A 1W3KA 3R7MA 3WUBA 4EP8C 1UBSA 3BOXA 3T2PA 3YPIA 1UQYA 1ITUA 4WUIA 1YDNA 1W2PA 2V3DA 3AMLA 3L0GA 4AIOA 3GBEA 3W2JA 1IEVA 1YMYA 4A22A 3WQWA 1AD4A 2VM8A 3TWAA 1AJ0A 3WLQA 4OVXA 1FTXA 3FV9A 3IJ6A 4GHRA 4EK7A 1LWHA 4I8DA 1HL8A 3ARPA 2DZWA 4Z0SA 2EJ1A 2HTMA 3AQUA 3N13A 2PDXA 3CEUA 4RXFA 1ML1A 1PKNA 4M82A 2IKHA 1QHPA 2O7SA 2UY3A 4ZO9A 4PRWA 2OB3A 3TKFA 1P7TB 4B16A 5IDZA 4QE1A 2PODA 1AH4A 1KNWA 2D22A 4Q22A 2GVEA 1RA0A 3BSHA 4S3FA 3FFSA 3NL6A 1IT7A 4UR8A 2X1SA 3RNDA 1GG1A 3GYCA 3LBCA 4W85A 3K2GA 2WZMA 4JTFA 3L68A 3WF0A 1GJUA 3FVDA 1OADA 1KCKA 5K9DA 4DO7A 5ABHA 2VMFA 4PN2A 3WQ8A 5HANA 4TR9A 1XLIA 1JZ6A 2J8TA 4JTHA 1HQTA 1XYAA 2X1UA 4ZOBA 1E9YB 4PSPA 1PX3A 2I56A 4KWVA 3WUEA 2QMJA 2BP1A 4O53A 1R0MA 5JH2A 1WNOA 4GUIA 3VD3A 3WQGA 3VIGA 3T08A 1R5YA 4AU0A 3CZKA 3AUJA 2CLEA 1HP5A 1WXJA 3UR8A 3QN3A 2HRWA 1IEQA 3V36A 4YS1A 4DEFA 1X1NA 8TIMA 1UYQA 1XYZA 4M6QA 3LQGA 3ZZ1A 2R24A 4NZCA 4GX9A 1SW3A 2CLMA 2QDGA 1X38A 1DJGA 4CCCA 2EG7A 3SADA 1SO3A 3L23A 3LYEA 1NF0A 2VUNA 5IDIA 1UMYA 5LXXA 2MNRA 3UETA 1YKWA 1ITQA 1JDFA 2POZA 2V68A 4B91A 2J74A 5E6ZA 2Y8VA 3EDFA 1BYBA 2VEPA 2HCVA 5A5WA 4C6OA 3VAVA 3Q45A 2QVHA 3IAPA 4ADSA 3W26A 1P0EA 5IHRA 4O52A 2GQ3A 3TOPA 1VBHA 1NWSA 3VZZA 3T4WA 5EMLA 2QCFA 4EPKA 4HZMA 4RPPA 4U28A 5FAGA 3LUTA 1JUKA 2FPVA 4PTDA 4H1ZA 4QP0A 1D8WA 3TMLA 3AHZA 2E1WA 4IFKB 4MYAA 4RKAA 3GNNA 4MWAB 2E5DA 1WQ5A 4Q4PA 1EP3A 5XIMA 3PBGA 2WHMA 2J75A 4O0ZA 4OHQA 3WLTA 1CXLA 4WKAA 4QLLA 2B7QA 3BGJA 4MLJA 1VD6A 4WD0A 2QCMA 2P0OA 1WCGA 5BYWA 4UTIA 4TIMA 4E2DA 3O1NA 5AKQA 3R12A 2YXXA 5C7HA 3IIOA 3ZT6A 4LUSA 1LCOA 1W1A1 1FKXA 2BNJA 5FF2A 3VDAA 3T09A 4GZIA 4KCVA 3KTXA 4AIUA 4F0KA 5HWMA 3PP7A 5IFPA 1WB0A 3LLFA 5F2LA 4GJJA 4DRSA 3UESA 3ITVA 1W3IA 2ODOA 5T8GA 4QJ4B 4N42A 2HE8A 4ZE5A 4DXXA 3IIZA 4GIYA 3UW6A 4D6GA 1ZJAA 1DIDA 4YYFA 2NQ5A 5ABFA 2YX0A 5JBEA 3N18A 2ZRXA 4QTGA 1NARA 1QCWA 3TLLA 1XDJA 2XIOA 1S39A 2BOEX 1GOQA 2WKGA 1P48A 4Z1AA 2RDXA 1GVOA 2VCBA 4V28A 3AC0A 1NWRA 4HHHA 4KEMA 4AWUA 4AZ5A 3M5YA 4NNBA 2Y62A 3STPA 3U2ZA 3CAWA 3VA8A 1YNPA 3WY1A 2F2HA 2ZUWA 4JTLA 3UVAA 4FNUA 1Z89A 3I7QA 1FBAA 4GINA 5HATA 3WJYA 1TE6A 1QTWA 3UZYA 4IL0A 3TTEA 3VPLA 2VDIA 3E9AA 4LGXA 5H91A 2VCCA 2BB0A 1DVJA 5I3HA 2ZX9A 1NP2A 5KZMA 5D9PA 3M6YA 3FGCA 5LGZA 1VAHA 3KOWA 2GJPA 1K9EA 3R10A 4AX6A 1LL4A 3WDHA 9CGTA 4PE8A 1TMHA 2I5QA 2BWGA 3SCOA 2QV5A 1JPIA 1T8XA 1DQWA 2DW7A 3TFCA 2AKZA 4AFYA 2W5FA 1MDLA 4GUJA 1EOKA 3AXMA 1UP0A 3G1YA 1VF8A 3EB4A 1I2NA 4GFSA 4GYJA 1OZQA 3BC9A 3E49A 4OU1A 4QFUA 4ROPA 3WLPA 4MB3A 4UFIA 1F4HA 1MDRA 2UY5A 1GEHA 3RXZA 1SU5A 4RR4A 5EPDA 3UY7A 1RSCA 2IPFA 1ONXA 1TPVA 1U1UA 1LT8A 1OYAA 2P50A 1ZBCA 2QCDB 1YDYA 3H7VA 1ME8A 1KLYA 4HCDA 3SSJA 3K4DA 2ZZ7A 4MZ8A 1H7RA 4GZEA 1XDLA 1ME9A 4MDPA 3T40A 4GNKB 3WH8A 1XC6A 4QJ5B 1HX0A 4C6CA 2VFHA 2GGHA 4PCNA 2OEJA 3N12A 5BOOA 4HJFA 2YDSA 3MHGA 3CZGA 5CPSA 3VM5A 1I1WA 2QKFA 3PBVA 1LM1A 2YR1A 4W7VA 3U6WA 3LCLA 2X0YA 2DUZA 4NZ4A 4HBKA 3G22A 2YW3A 3LY0A 3E2RA 5F2IA 1JCXA 1BYCA 3VOIA 3ARSA 4V1YA 4MM1A 1VBJA 1QI5A 1EJSC 1BWVA 3RHGA 2ZDSA 3EWUA 4N9DA 3KM8A 3ABRA 3R94A 3H24A 4DN1A 1VQTA 4H2CA 2A85A 3O05A 2VR2A 4XZLX 1W37A 1W5QA 4KWSA 2XH7A 1CENA 1PHWA 4JTAA 3D46A 1XLBA 4AVOA 4QG6A 3FA4A 4Z2GA 2TSYA 1J12A 3A13A 2E5CA 2BVYA 4BI7A 3QEZA 5LNUA 4HYRA 1J0HA 2E9BA 3NZQA 5A94A 4JIIX 3W4RA 3W7QA 3FHAA 3AIRA 3GNXA 4G7FA 3MUXA 4XZMX 4UMCA 4UTJA 5CEWA 2EG6A 5CSUA 1KKOA 3CMJA 3MU7A 4C60A 2J7DA 2IS7A 3UP8A 4JIPA 1HL9A 2D20A 3DI1A 1GORA 4X61A 2JKEA 1HW6A 4P2VA 3T42A 3FJ6A 4LQ1A 1KXQA 4M6PA 4KFNA 2Z28A 1S2VA 1VFUA 4MWAD 3FSUA 3IGXA 7ODCA 4L9YA 5FF4A 3LERA 1YIXA 4K3ZA 1CGWA 4LUTA 3OLDA 1X1ZA 1XGZA 2VEGA 3DCPA 4GX8A 1FWSA 4GNJA 4S39A 1PDZA 4GGHA 2ZZ3A 1DIOA 2TAAA 4D6EA 3GU1A 4K6AA 1EC8A 2VWSA 2BY1A 3S6DA 2WC4A 1QI3A 3PBYA 4OIFA 3NSMA 2HDJA 3B8IA 1ZNNA 5BXTA 1XYCA 2J88A 2PGFA 3LRMA 4RE2A 1CB7B 3W7CA 2JKPA 5XIAA 3P93A 3W2LA 1JZ3A 4IIBA 3KOYA 4O0KA 1B4EA 2E7FA 2NUYA 3N2BA 1JCJA 4XD6A 2H6RA 3H4XA 3SCTA 3FYPA 3HM7A 3MT1A 3UR2A 3HJEA 1E43A 1ESWA 3BUVA 2ZVIA 1Y5WA 3BJFA 4S3EA 1XF0A 1V77A 4XUYA 4QBXA 3C6CA 2MANA 4HHLA 4F9JA 3S5NA 3AHYA 1SFJA 3BAWA 1XR2A 1TTJA 1M7JA 2DSWA 3N11A 4DUOA 4HA4A 3CWOX 4DIAA 4I9JA 3AMGA 2WSYA 3GU2A 2ZZ1A 1OG0A 1NQ6A 4C6PA 1O4UA 4RNHA 5A6TC 4PCFA 1SR9A 4A4AA 4CVWA 3CV1A 2EPNA 4R27A 1XIDA 5EU9A 2QW5A 3AMDA 1HF6A 4J2MA 2OEMA 3PULA 4WVXA 3TW9A 3ELFA 3RX3A 3WK1A 5M5DA 1C8VA 2XH0A 3ID7A 1QWGA 3GWQA 8A3HA 3WENA 2Z27A 3ZVHA 4CCDA 4W8BA 2OSWA 3WJXA 4YIWA 4MUPA 5JQ9A 1DJWA 3P2VA 3TZNA 4M24A 4Q8TA 4TUFA 3GVGA 1XSIA 4K37A 1WP6A 1T41A 5CG0A 4ZBCA 4M1BA 4IG2B 4BEUA 3EOUA 2XVGA 4I5UA 2ON3A 1F2JA 3WFZA 4W4QA 1JDCA 1GOOA 1VFTA 3NR0A 4HNUA 5DANA 2DIJA 3NQEA 4UTUA 3VDCA 2V3GA 3ZM8A 5TAOA 1GKPA 3MCNA 2CZFA 5KSWA 4EKJA 4QISA 1K6WA 3V0UA 1PYMA 3WK0A 2TRSA 2YLAA 5AN7A 1XKYA 4RDWA 1PZ2A 3E0WA 3EMCA 3W1RA 4JNMA 2NLYA 3I6TA 3K30A 4AEOA 3VIJA 4W88A 2ZBTA 2YL8A 4AEEA 3VIMA 4I7UA 1R3QA 1PXGA 3CASA 1RZMA 3R8HA 1DWGM 2OYKA 4ZE4A 3BAIA 4GOAA 2XIIA 1YTDA 1HL2A 2QGHA 4JIRA 1G7VA 4UNIA 4I9MA 5DFAA 5FEPA 2F7FA 4BCEA 5IBXC 1W1B1 1A5AA 3KP1A 2D23A 4YVXA 3TYAA 2YLLA 3L5AA 4HSNA 1CX9A 2Y85A 1NH6A 1KFJA 3VNDA 2NW0A 1XYFA 4LAUA 2D0FA 2VQTA 1X98A 3AYSA 4D8ZA 5J5DA 3T0DA 5I77A 3CH0A 1JF6A 1F3EA 4C6FA 4ZOEA 2NQLA 4GYPA 5DRCA 3TJLA 4H9TA 4PUWA 1PKLA 2DZPA 4KH2A 2CXEA 2J77A 4YJ5A 3SQSA 2I14A 1NAL1 4ZSUA 2IPGA 1PO9A 1PB0A 2FFIA 3E0IA 2PDHA 3OZMA 3FOKA 3MCOA 1KRCC 2DUXA 2Q8XA 4AMAA 3WDJA 3U57A 3N1AA 2OZTA 2PWGA 3A3HA 2HK0A 5FA5A 2W67A 1J6OA 2ZA2A 1KM5A 1QU4A 4EANA 3NTYA 2X40A 3WD0A 5L6UA 2D0HA 4QLJA 2ZZ5A 4C91A 4U5KA 4PMZA 3ZLGA 4LALA 4IMEA 2PS2A 3KOFA 2WQPA 1U1JA 4QDWA 3IIVA 3M0HA 4GK8A 1V93A 5B7ZA 4GI8A 4NRRA 2WMIB 4M8UA 4C90A 3CLWA 1TCMA 3T2OA 2Z2BA 4OOZA 2ACQA 3LSBA 1F07A 4AY7A 3RLGA 3U48A 1IZJA 3PG8A 1TTIA 3P0XA 3OIXA 4M1RA 3UR7A 3ITXA 4UCFA 1XRVA 1NFGA 4NASA 5I23A 2WVVA 3NQGA 3C61A 4IGMA 2DVXA 5PTDA 3VNIA 4K68A 1F4AA 4GRSA 4J28A 3BAYA 2ACSA 4L1XA 1O1ZA 5CKSA 2VFIA 3OIHA 3IJIA 1CGUA 1KM4A 4DYKA 2VC9A 2R91A 4UXDA 4O28A 4RE0A 4PYSA 1DV7A 2WB5A 3T0AA 4L64A 4C6MA 3W7KA 2CBIA 2CZEA 3M0IA 4UFHA 5G4WA 1PTGA 4ZZ9A 1LT7A 4JYFA 1W0MA 5FOOA 3GB6A 3RILA 1ONEA 3GHUA 1GG0A 1UWTA 1TX0A 4PB3A 4KRUA 4U5IA 4I8YA 1TE1A 2PZ0A 1OF8A 2BXYA 4GKTA 2Z0IA 2J7BA 3CNYA 1KR0A 3AXIA 1I8JA 2PP3A 4FX8A 4WXZA 2DZSA 4CNNA 2V63A 5HNUA 4PMDA 5CBBA 1U2YA 1A5SA 1X1OA 4ZENA 4XG1A 2XHYA 2YPIA 1B0IA 4O1FA 3UWWA 4FOUA 5LSMA 2TPSA 1I0BA 1N2VA 4S2CA 3OU8A 4FPSA 3UJSA 5H8MA 3CUGA 4ACYA 1DJIA 2FJUB 4DX3A 4O17A 5AHMA 3POCA 4AZIA 3I4KA 1IWAA 3WLNA 4IM4A 3S5ZA 3WLMA 3C0LA 3ZJKA 1T0OA 2HV5A 3T1GA 2FGZA 1H60A 3PAOA 3SB0A 3S6OA 1EBGA 1CEOA 1QW8A 4A2RA 1U5JA 4U2YA 2Z25A 4HOXA 4D6CA 1FWAC 3A4AA 3CUHA 4ZTXA 3C86A 2G50A 3W7PA 1EIBA 4WK9A 4IMCA 1TJ1A 1FY6A 5AC5A 3ONCA 1V5XA 2VHLA 1E15A 3DFOA 3WH5A 2BOFX 3KBNA 3OGSA 4XKYB 4XD4A 3CYVA 4YTQA 1AW5A 1UW9A 4HK6A 2QCCA 2IQ0A 2IXVA 3KWSA 3VFLA 1TA3B 1EJXC 5ABTA 4L6DA 1ZUAX 4L7ZA 4NXSA 3AAMA 9RUBA 1WBJA 2Q71A 4J27A 3U7VA 1XL9A 4HZ7A 1Z44A 1IEXA 2WZIA 2YDQA 3LHZA 5F1VA 4GY0A 3RFAA 2J7HA 4ZQRA 2PWFA 2Y8UA 1BHGA 5JIPA 2YYTA 3PZMA 3GFZA 3CH9A 4CNPA 2GVJA 1SFTA 3ZSSA 1EA9C 1VLIA 4JKLA 3UD6A 3STGA 5FF3A 1XUUA 3AIEA 4IHCA 2NQHA 1VCFA 5H1WA 1AW1A 3IJ9A 2QF7A 1NDWA 3UG3A 1ZQ5A 1AL8A 3L2LA 2KAUC 3A23A 4LUTB 2A0NA 2CZ5A 1GZJA 2I17A 2FHFA 2D2HA 1ZLPA 3VD7A 3PZUA 1CB2A 4MADA 3D3FA 1D3CA 2OG9A 3N19B 2GZXA 1Q6FA 1J6PA 3TA6A 1JIBA 1R86A 2J78A 4XD3A 1EPVA 4FNSA 4D71A 2ANUA 1J0KA 2PLCA 4PSRA 1TTPA 3FN9A 4M56A 3HGRA 5BWFA 1TJRA 4ICNA 3VMPA 5J5RA 3W7DA 3IACA 3UZ5A 3GXTA 3HV8A 2AMXA 1KFLA 4MJMA 4D6JA 2PFHA 5AOUA 4C65A 3GR7A 2CBVA 4H00A 1YDVA 2ZZ4A 4R3UA 2ICSA 2Z7GA 3CO4A 3ZQ9A 2VRKA 1VIWA 1TPWA 2CPUA 3NL3A 3QW3A 3G6LA 1PVNA 1OHLA 3MHFA 1QPQA 3LD5A 2XN2A 1S1PA 4UMBA 4B9YA 3AZTA 1QWKA 2PTXA 2ISWA 2XSAA 3WLSA 1NP0A 1ZP4A 1DIKA 3HF3A 2CWXA 3WD1A 4GISA 3W84A 1J0ZA 2OQHA 3OA3A 4ZEPA 5BW6A 2GVGA 3LX9A 4IQLA 3EDEA 3AS0A 4BF5A 1MUMA 1UKQA 3ITOA 1Z41A 3F2CA 4C6DA 4CLMA 4JNZA 3GNDA 4ML4A 3EX1A 5K9CA 4YLWA 1FWFC 5E6YA 2J7CA 3I3DA 4GI6A 4MSSA 3M47A 4IOTA 2BBFA 4FXRA 4HYWA 2V30A 3CB3A 4X0NA 5K4XA 3R13A 2XVKA 3GX9A 4JAWA 1CXFA 2PDQA 4WSKA 1E51A 4ZQNA 1WDPA 3TIMA 2WK2A 5TIMA 2PTZA 2GJXA 1F05A 2FPYA 4UTHA 3W85A 1BD0A 3NQ8A 3N4AA 5DQPA 1DJXA 2QR6A 5DO8A 4JY8A 3LM3A 1K9FA 3PFMA 4Y9OA 1P0NA 1Y7VA 3P0WA 3E12A 1GJPA 3B8VA 3LDVA 1TPH1 4HK7A 4D8LA 2VZTA 3VKBA 1LTDA 3TTOA 2Q01A 1BF6A 2C6QA 5HMEA 3NZGA 2ESCA 2CW6A 1XRTA 1JYWA 3QR1A 3GZAA 1R3SA 3IEBA 4GQQA 2PD5A 1C7SA 2ADAA 1E6QM 3DBPA 5H8PA 1TRDA 3CQIA 3IGSA 1KFKA 3CAKA 1TUFA 3MS8A 3NEVA 4X2RA 2PRLA 3W70A 1HKWA 3S47A 4OBTA 1DQUA 4S3GA 3QQ0A 3DH7A 1S2UA 4XSLA 1RLDA 4DAFA 4HK5A 3WNLA 3CS2A 4LUIA 4XAGA 1H4PA 2WNWA 4QNEA 1MSSA 4IXXA 2DT3A 3OYXA 4IXHA 4ILSA 3S8HA 1JQXA 1VFSA 4QRNA 4H7CA 4M80A 1DXEA 5FD0A 3WZ0E 4AW7A 2A1YA 3TXZA 4ERIA 2PDUA 2UY2A 1WKEA 2YCKX 1M7OA 1XLKA 3F03K 4REQA 1DWFM 2PCQA 3R25A 4X3ZA 1V08A 1Q6EA 4CNSA 1E9LA 4N6FA 3LHWA 3TMQA 4AZCA 4A8LA 2X41A 4DWSA 4PR4A 3TE9A 3LNMA 5K4ZA 2FTPA 5DMYA 1Q2RA 3TSDA 4AY8A 3P6LA 2WLZA 2P53A 4RDZA 3ARTA 3ZLFA 1ECQA 1TWDA 2D3LA 4NIRA 3LA4A 3RN6A 1WZLA 5EYWA 2H90A 3UJ2A 2DZAA 3G1XA 3OOQA 1XBVA 4G9PA 4F48A 1OFOA 4CN1A 5LNWA 3T7VA 1F3XA 3HGOA 1WUEA 4FOKA 1A53A 1UD5A 2HMCA 1OX6A 3MZNA 2HVOA 4A3UA 1QOXA 1A4LA 3KCLA 3NDZA 4US5D 4XUGA 4TU1A 3Q65A 2C0HA 4GQ0A 5C2XA 1TQXA 3B8UA 3VO0A 3KBJA 4GKLA 2NXGA 3H23A 5CPNA 3DHUA 2B31A 3UJFA 2OKTA 1EDTA 4LC6A 1TIMA 4XAPA 3AWOA 1WPCA 1VFLA 4O57A 1B9ZA 5A2AA 1MVYA 3APTA 1M9HA 3PJUA 4IPJA 3IV3A 1W9UA 5E0KA 4XBSA 1XLCA 5FJPA 2WMHA 4FK9A 3CMGA 2CLIA 2E5BA 4AZ7A 3WLRA 1EJWC 3NAVA 1NTHA 4F4RA 1Q5MA 4PUMA 8XIAA 1XQKA 5JIWA 4D6IA 2W3ZA 2V67A 4NNAA 3WNKA 2HSAA 1I6NA 1WX0A 3E02A 1E0UA 1QI0A 1FUYA 3ABSA 2WVVB 1QI4A 3FA3A 2FB3A 2WPBA 1DWJM 3TVAA 4JCLA 4JOMA 4NAFA 2OWCA 2BY2A 1UZHA 1KC7A 1VJIA 5E70A 5HPCA 3WJZA 3VIKA 1SGJA 3PUOA 3ABOA 1W9XA 5LZLA 3GC2A 4Y9MA 4JYDA 1Q8AA 2G0WA 4LPCA 3HG2A 2Y70A 4ENLA 2CLOA 3W6MA 1KQYA 3EXSA 4XZWA 3GD6A 1UIPA 1NF7A 4QDMA 3R8RA 4NZ1A 1QNRA 3WQEA 5EMKA 2Q3OA 4BF9A 5EBAA 2ZCGA 4YWIA 4QX4A 2AMGA 2PDNA 4GUGA 2GUBA 5A6KA 2VFDA 3PZNA 4J1OA 2G5WA 1V03A 1GTEA 3VIPA 4LBRA 2PEVA 1QUMA 4ECLA 4GGBA 2QCGA 1XRSA 4ZQOA 3CUZA 1KBBA 1KB3A 4LH8A 5H6HA 3KBVA 2ZX5A 5G1YA 2UY4A 3CL6A 2WM0A 1QR7A 2DH3A 4IT1A 2XINA 3IV8A 4DLMA 1V3HA 1FFQA 4YHEA 1HVXA 1O7AA 4G1KA 3TW6A 3N9SA 3OJGA 3MMWA 5BU6A 2C15A 3NGJA 4OV9A 3OZOA 2R1MA 1Q85A 4UTWA 4CGTA 4UQDA 2E8YA 2R82A 2X30A 2VFEA 3VE9A 4P61A 2QPXA 3C52A 2WM1A 1V7YA 3CUXA 3VX0A 4US5A 1JZ7A 4CCZA 2W91A 1EZWA 3MUAA 4YCOA 4O14A 5BXPA 5EMMA 8CGTA 4FIRA 4E8GA 2V38A 3SY8A 5A1AA 3L9CA 1QBBA 1FH8A 5DELA 1BG9A 3VM7A 2FZ9A 4O1EA 3KRUA 1WA3A 4Y7EA 4ML9A 3HPFA 3OB8A 4OOUA 3LK6A 4X9YA 3OZYA 1QNSA 3CB8A 4RE3A 1Q7QA 3CEPA 3CL7A 3W1UA 3SCUA 4BFAA 1J2BA 4YN5A 2BFGA 4UTMA 1ENUA 3LHTA 4E4PA 1UWRA 2HWGA 1G69A 1O68A 4GYKA 1OCBA 3EWBX 3ARYA 4FZIA 2CESA 1J0IA 5T91A 3UWUA 2VL4A 4PMYA 1DWAM 3NVTA 3EZ4A 4NAEA 3PB2A 1V6TA 1UOKA 3WJSA 3MVTA 2VNCA 3TNOA 4JTSA 3LOTA 4NP7A 3WBAA 1W32A 4YMZA 1BRLA 3GG1A 4Q8WA 3RR4A 1EC9A 1OT2A 3HQPA 7A3HA 3N2OA 3W38A 4JS3A 1XGEA 4KFPA 1E6XM 3WO8A 1UC5A 2BTMA 4DO5A 1BWLA 2BXVA 5DEZA 1B57A 4B5XA 4E0CA 1MQPA 4N4PA 1BVWA 3F4VA 2QJJA 2YGYA 2Y0FA 1B2YA 1H7NA 4GZ7A 4CVUA 3I6EA 1NVMA 2AQVA 1GHRA 2EPLX 5MKGA 4PUNA 4RZBA 4HPHA 4W9TA 1RK6A 2PWHA 1EIXA 4MKNA 3BLOA 5GNXA 3VGFA 4TX9A 1OCNA 2RH9A 4RZ4A 1W3HA 3ABZA 4WOQA 4YL2A 2F61A 3MTWA 2FQIA 2HBVA 2Z1SA 3EX4A 1O5XA 3LEPA 3GTIA 4XD5A 1S38A 3SSZA 2P88A 1QJWA 1PWLA 3BGAA 3TAKA 5RUBA 3B3DA 1BTCA 1W31A 4JTGA 1WAUA 1MQRA 3KBWA 3I6RA 4OWGA 1FDZA 1IEIA 1IV8A 2Y5SA 1B4KA 4UR7A 3RDKA 3EEGA 4HMCA 1JPKA 1GVRA 5I2UA 4Q8VA 2FYMA 3D0CA 3M7SA 4QIUA 4TMBA 3RJXA 2SFPA 4S3JA 4UB9A 5A3HA 3UQNA 3VX1A 2DPEA 2QS8A 2DIKA 3NNTA 2BASA 3WFLA 1AL7A 1GYNA 2B81A 2BGNE 5GJPA 2E1DA 3LS9A 1EZ2A 3RRXA 4AWEA 4GBUA 3VKJA 5LIXX 4DJDD 2XSXA 2DVUA 1W9PA 1H7OA 1JGIA 2VD8A 5LHFA 3CIWA 1SR0A 2XZ9A 4JX4A 4HHPA 1M3UA 1OWQA 3HN3A 2OU4A 1YBQB 3WLOA 5G2WA 2DP3A 3B0PA 1WZAA 2RGMA 1TWIA 1POJA 1XCWA 2VJXA 2V6AA 1JAKA 1K02A 1PIIA 1FWDC 2RDUA 2A21A 4J35A 2H8XA 1F61A 1QNQA 4RPQA 4IP4A 1OC7A 4MAVA 5GQBA 3F4WA 2VGFA 4D72A 2Q3RA 4A8RA 4M81A 2VOTA 5E0CA 3QHMA 3CXOA 2GVLA 1KCXA 4FOJA 2OGYA 2QJGA 3WG6A 5D2VA 3SECA 3EKGA 5FKYA 1YPIA 2HNEA 4ZO7A 2QHAA 3GU9A 5LNVA 4LS0A 3T0BA 4J3UA 4ZTYA 4Q8QA 1SUXA 5M17A 3E3HA 2PURA 4D9PA 3LI0A 5HQMA 3NL2A 6CGTA 4L4PA 1BXNA 3AIBA 3AXHA 3O6AA 4H3DA 1ECEA 1UB3A 5I5RA 3FEMA 4F0HA 5C71A 4EF9A 2PWDA 3GYEA 2VD9A 3EA3A 2G41A 1S2CA 3PB0A 4FF5A 3VTRA 3OPSA 1E3XA 1G9HA 2CYGA 2V9DA 3OHIA 3ORWA 1F5ZA 2V81A 2V3FA 2X42A 1J4EA 4LCQA 5CSYA 4JFVA 3PSVA 2XVPA 1L2QA 5A95A 1OFEA 1XJBA 3LRKA 3W1NA 3VOFA 1JDEA 2GGIA 3O2LA 1BVZA 4Q6JA 5BRBA 2CC0A 4K1GA 3GKFA 4YTTA 3EX3A 4ORMA 2CHOA 2FTWA 2PDKA 1W1ZA 1Q6CA 4DUWA 5KMYA 3CUJA 3NDYA 4REQB 4LY8A 2EKGA 4B5VA 3BLLA 3QYSA 1AVAA 1UR2A 3LENA 3TYUA 3PK7A 3W29A 1AMKA 3UCCA 4DJDA 1PX8A 3MO4A 3TJ4A 1Z32X 3CLMA 1VKFA 4DI9A 1HO4A 3PHAA 3S5YA 1K8CA 3W7HA 1OK6A 1LUCA 3NZ1A 1POKA 1YTEA 1XLGA 3NQ2A 3BK0A 5GJMA 3KS5A 3KP0A 3UG4A 1WE5A 2WZEA 1GW1A 2HPMA 4I5RA 4CQ8A 4JL2A 3QJAA 1VYPX 2GUUA 2GUYA 3UU0A 4E3TA 5AECA 4WY0F 1UZDA 1WDQA 1JYXA 4FXSA 1R2SA 2GJRA 2YDRA 2PP1A 1YRRA 3MBFA 2J7EA 1SJCA 1R2TA 3F4NA 1RHCA 4TVUA 1QK0A 5DMLA 2J25A 1EYWA 2W0UA 3ARXA 5EB8A 4CQBA 1OX4A 3H54A 1H41A 4BZYA 1ZAIA 3KS6A 1PCKA 3F5JA 3ITCA 4JD4A 3LTYA 5HR7A 3B9OA 3W76A 5BMWA 4ACZA 4QHRA 4IIFA 4LSBA 3AS1A 4KKXA 4MPKA 1VLWA 3ISIX 2VZOA 4WKHA 3W23A 1B5TA 3CAVA 2YCJA 5E5CA 3BAJA 3L2MA 3AHVA 1XPGA 2E40A 5HJLA 4H19A 3R6IA 3QY7A 5LYRA 3LGDA 1X8FA 3OBEA 1XIIA 1OGGA 1UZ4A 3T07A 3RJYA 4D6FA 3TFXA 1IGSA 4P7QA 1PKMA 2YB1A 2DW6A 1TIWA 1HT6A 5EMYA 3SURA 1V0NA 4GIEA 3NQAA 4DXVA 4RUBA 5K3VA 2DSZA 4EXBA 4LEQA 4E8CA 4JQ2A 2O0TA 4H9MA 4S3DA 4DBEA 5CCZA 2EJAA 1HKKA 3BLDA 3LGGA 4MFEA 4KGJA 4LT9A 3B8TA 1U1HA 2ZTKA 1IHIA 4JQ1A 1KRMA 3URAA 4LU0A 2WSKA 5FL1A 1ZAJA 3WBWA 1K9TA 4FR1A 2DZXA 5EL1A 2PTYA 1IWBA 2PSNA 4V2XA 2DORA 2GOUA 5CZSA 4XAZA 5BNKA 4ZQCA 2VC5A 1FWRA 1LBMA 1JGMA 3V1PA 7REQA 4J9JA 4BQ5A 2XVLA 3GAKA 2OODA 2REQB 3ME3A 4LYRA 3AJXA 1VBUA 1KXVA 4F0SA 3CPGA 1VCVA 2OGJA 4GUHA 1LQAA 3E5PA 5EFFA 1K8YA 1LYXA 2E77A 2P76A 3Q4DA 3N2XA 2V5BA 2FGLA 3GSMA 3TN6A 1B3OA 4GYPC 1MWOA 4JXCA 3MV11 3TLQA 2I16A 1SYTA 3SO7A 3RRAA 4O1BA 3DFSA 1H0IA 3B05A 3IVTA 2ISFA 1XLAA 2X09A 1P1MA 3EMZA 3H2CA 5U4NA 1OC5A 4K36A 4Y2WA 5HUPA 1KO0A 2RUSA 4NHVA 1EL3A 3WNMA 5A69A 2PI6A 1PUDA 2GPTA 4JPGA 1TV7A 4O50A 1NEYA 2WVTA 3UNDA 1HKVA 3LSCA 4L80A 2C7FA 3FEQA 1S5NA 4K1WA 4N0RA 4HP5A 3K4AA 1VRDA 3BW2A 2H9AB 3II1A 1YQ2A 1U22A 1XDMA 4LW7A 1V0LA 4ZXOA 2ZXQA 3BCJA 3DEQA 1J0JA 1G67A 1KV5A 4HIBA 2PLMA 1TPEA 4IFRA 3KRBA 1DWIM 1F76A 3S1WA 2VGIA 1NDYA 4GYFA 1A3WA 1UD6A 2ZA1A 1C8XA 1VFMA 3ES7A 1SPQA 2G96A 4C1NA 4LANA 3W83A 1VHNA 2XTKA 1G1YA 4NAEB 1XG4A 2PDGA 4O10A 4LUYA 2PBOA 2QT3A 1RV8A 3GDKA 1A47A 2VVNA 3EX2A 5JBDA 5I3GA 1E3ZA 1BRLB 3AXXA 2GQ9A 1C92A 4WY0A 3ZJ6A 4UMAA 1JFHA 4BF7A 1E0XA 4AD3A 3LCXA 3EOOA 1HNYA 3BJTA 3TYZA 2BHUA 3LXAA 3PTMA 4NX0A 5F4SA 1BVNP 4PMNA 3WD4A 1ZB5A 3NOYA 1ELSA 3FKRA 2J79A 2BGQA 1MXDA 3JZEA 2JEPA 3QPEA 3UYIA 3AHTA 3W2UA 3TEVA 1JPHA 1MW0A 4WJ8A 1KBKA 2WC3A 5U7SA 4GY1A 3N15A 6REQA 4OZOA 3AFBA 3S46A 2V5KA 1FWBC 4Q4QA 1GEQA 2XIQA 4Q8OA 4LVBA 3W72A 2IQDA 3L4ZA 3UG8A 5KZ6A 1DPMA 1QO5A 3L67A 2A2IA 2PDMA 1B3WA 3OVQA 3PR2A 4B2DA 1GQKA 4H2HA 3W7EA 4Z17A 4DNHA 4IH3A 1L9WA 3RU6A 1ZTVA 3QLDA 5D33A 1R9XA 4AHPA 1QXLA 3PTQA 2QZRA 3W07A 1SSDA 3ZT7A 3PZIA 3UNTA 3NQ7A 1BAGA 5DRIA 4DUXA 3B03A 1WOBA 1RP8A 2ZE3A 1RCOB 3CV7A 5AFDA 5LIUX 4KT2A 1KLZA 1TR1A 2AL2B 4TO8A 4FNQA 3LCHA 3U9IA 5C2GA 3G1HA 1BYAA 2F9RA 2WYSA 2OXNA 3URQA 4MY1A 1I2RA 2OO6A 4RV8A 3WLIA 4Z1YA 2RJHA 4G1NA 3P82A 3L4VA 3LV5A 4EPEC 5C9XA 1R3YA 2Z4GA 3DGBA 1PV8A 3C8FA 3NQFA 2QDDA 4YCPA 2YYUA 3SEPA 1LJYA 3H2EA 2RDTA 1CNVA 4N4QA 3VCCA 1HN1A 4AXNA 3ANUA 3EA1A 2IKJA 1LLZA 3V5CA 3WN6A 4A3RA 4GXWA 5KZEA 1HKMA 3B4YA 2GK1B 3IK4A 4HMEA 1N8FA 4M6VA 4ZXLA 4JTRA 4Q4SA 3PBMA 1JD7A 1MO0A 1DTNA 4FSAA 3AIQA 3PNZA 3VIHA 3CZEA 3W7GA 4CD4A 1J2WA 3N2TA 5CJ5A 1TV8A 5CZJA 4PZVA 3QM3A 2P1FA 3GFXA 1PKYA 4UOJA 1GW9A 1VBGA 3IVSA 1UD4A 2W63A 3RLVA 4DXKA 1V3MA 2BMBA 3GG7A 2I5GA 2QPUA 3NDOA 3EOLA 2QUNA 1TPDA 4JR5A 1X8CA 3VNYA 2OSYA 2JK2A 5DCDA 1X6UA 3IJDA 4FLRA 4M7SA 3VDHA 1QHOA 5D03A 5D09A 4J4KA 3MWCA 4IPPA 1JXKA 2C16A 2C14A 3ALGA 1R46A 1M03A 1J93A 3MBDA 5LA1A 3A3WA 3DERA 1EHNA 1YYAA 3A12A 1RBLA 3AS2A 2DIEA 1BEUA 3IIXA 1R3RA 2FLIA 2WHKA 3LQLA 2DZTA 1XIMA 4OT7A 3SCWA 3KTCA 3UWVA 1S2WA 3LBOA 1G5AA 4QE4A 1EXBA 1S5TA 3SGZA 3F7JA 2XSBA 4H7ZA 3VDBA 2E6YA 3PZ9A 1S5WA 4RZ5A 4ES4A 3MMDA 2XWEA 4HPXA 2Z1WA 1Z8AA 3ZWSA 4E38A 4W93A 3GO2A 4B5NA 4UQEA 1TUXA 2Y89A 1UA7A 4XBKA 4YHGA 1O95A 4Q4KA 4PTMA 3C2YA 2Y7EA 1RJQA 3W37A 4BEQA 4PC8A 3EDJA 4I6KA 3FLUA 3MJYA 1PTAA 2ZX7A 7XIMA 4QR6A 2O92A 3GQYA 3OODA 3SUSA 7CGTA 1UHVA 2J47A 1MEWA 3L4YA 4G7EB 3PY2A 3NUKA 2CHRA 4GBDA 2CIPA 1V6UA 3PJXA 1REQB 2XGZA 1D3HA 2PD9A 3K1DA 1SQ7A 4XO7A 3QKEA 3HG5A 3UCDA 1FXPA 2YBUA 4HHMA 3W28A 3S2LA 1OFAA 3DHFA 1OCJA 2CEQA 3L7RA 1UR1A 1R7AA 1AZ1A 3MA8A 4N9EA 3VCNA 1OX4B 1RA5A 2F6UA 1VS1A 1TTQA 2XFRA 5FSEC 1JEZA 1RD6A 2PAJA 1BWKA 4IMGA 2LLEA 3A24A 2OQLA 4GXMA 1F8IA 2NX1A 3CWHA 3FA5A 2ZXBA 3BG9A 2I5IA 2A3HA 1Q4NX 3GLCA 3SI9A 1OC6A 4Y6GA 4LRTA 2HVNA 1HJXA 4FNRA 4LVAA 1U83A 4RCXA 1FWGC 1V02E 1C93A 2FHCA 4F2TA 3NJ3A 4HQVA 2BHZA 4DJFD 4OQVA 3WX7A 2XJ7A 4AF0A 1PJ9A 3UF9A 1G94A 4J2PA 1QPRA 4TMCA 3COTA 4GVHA 5A8MA 4C6JA 3CZLA 3IS4A 1OY0A 3L21A 1HJVA 3CU2A 3IJQA 5TF0A 3V7PA 4HN4A 1D7KA 3BWWA 2GJNA 4JTKA 3UWQA 4MZ1A 2Y5JA 4PTWA 1FX6A 4URIA 1VC4A 4NYUA 1GNXA 1EHAA 1BLIA 1B3XA 5BRQA 2DZUA 1TFVA 2R94A 4JTCA 1TVLA 5D2TA 1MQQA 5AHEA 3ZYZA 2WJZA 5CPMA 1P6WA 1VENA 3T4CA 2Y1HA 4DO4A 4JDBA 3O8AA 3G1DA 4DWSC 4L65A 3QR3A 4HSHA 3SRKA 5HAOA 4S2BA 2C8NA 2XIMA 2QGYA 3APGA 1W3NA 3UBPC 3C0JA 3WUFA 1MNZA 3HOJA 1AA1B 1E6SM 3LLDA 5C8BB 2QUVA 2TMDA 3A4JA 3IRDA 2OSXA 4WF7A 2GGJA 3NQ6A 3DKLA 3NFUA 1NU5A 2ZX6A 1TX2A 1RLCL 2J27A 5TD4A 2F6KA 4GPNA 1NDZA 5JBFA 4V1XA 1VEOA 2C19A 1Q6QA 1RAKA 2H8ZA 5AYIA 3W25A 3A5VA 4Y9AA 2ZIDA 4O4WA 4MZYA 4PCSA 3L65A 5C9ZA 2VX5A 1V3IA 4BJHA 2R1NA 3H2AA 2V5CA 3CTLA 3ARRA 2E6DA 3GXIA 4QQ3A 1O66A 3R79A 2E9LA 2EXOA 2WZHA 2YSWA 4NJIA 3K13A 5AHNA 4H8VA 3VZXA 3VOCA 3S9IA 2O9PA 1NOWA 4W8AA 1FHUA 1LROA 1NSJA 4Z42C 1EFZA 3JUGA 4E6MA 2DH2A 6ALDA 4JNYA 4PTNA 1L8PA 1R38A 4CN6A 5D38A 1E6ZA 1B3YA 4HCHA 1XLDA 4M3PA 2FH6A 1CLKA 1U33A 3AALA 3GH4A 3I65A 4YXGA 2CKRA 4XZ9A 4LTSA 1PL9A 1PHQA 4DJFA 1CGVA 1HIZA 2HXTA 1GVSA 3NQVA 3RMEA 2FDSA 3S2MA 3FY1A 1TPB1 3MY9A 1WO2A 4O19A 4MFDA 3PSWA 3MQTA 1DQXA 3DC0A 4ONVA 6XIMA 3KLLA 3WYZA 5LHEA 4BWLA 4DQWA 2YCLA 2WBGA 1Q45A 4MNJA 3N3TA 1H5YA 2D0GA 2ZRUA 3DU0A 2HZGA 2DVTA 3HGJA 4FMVA 1LORA 3LTPA 4FI4A 3KZPA 3HMCA 4FIQA 1RCXB 3DFNA 4AWTA 4Z2JA 3T44A 3VMNA 3GDLA 4TTGA 1W8SA 2PUZA 5KEZA 1AMYA 1XFBA 2QUUA 2VR5A 4EIVA 4YTRA 4NT0A 4LCRA 4CU7A 4PRTA 5KTLA 2VENA 1K8ZA 1E71M 4CQCA 4GY7A 1YNYA 3VILA 2D3NA 5D02A 5IRPA 4HNTA 4YVVA 2DQXA 4HT3A 4XTDA 1EYEA 3L4XA 3UR5A 1FH9A 4NYYA 2JFEX 2V5JA 3VCRA 1KKRA 1W5MA 6REQB 1E4IA 3VOHA 3RAOA 3S4TA 1S1RA 1JCLA 4HOWA 1AFSA 3KHJA 4HZ8A 1JI1A 1MZRA 3B4UA 2D69A 1W56A 5I6SA 4K2SA 3D6NA 1IGWA 3MUIA 3W6LA 3EGJA 3LCIA 3KW3A 5EY5A 6TIMA 3SJNA 3RM9A 1DE6A 1V6YA 4UTWC 1FCBA 3HG4A 1XBXA 1GOMA 1SZNA 3GIQA 2INZA 1UKTA 1YXCA 1O5RA 1KW1A 4K8GA 2FDMA 2FVKA 2E09A 1TR9A 4WSHA 3WF4A 1VRXA 4DM2A 3EAUA 4L9ZA 4KEUA 5A8GA 1X97A 3OQEA 1GVEA 1TMLA 2D2JA 2VDGA 1J18A 1XLHA 4LFYA 4AISA 4AVNA 2XYLA 3MKVA 3CQKA 4GI9A 1M6JA 1JQVA 5K9XA 1IE7C 1AD1A 3VK5A 3ZIZA 1BSLA 1ZRQA 3CAQA 3DUGA 2YW4A 3QRHA 1J96A 4X63A 2OQYA 4QROA 2XFWA 3GM8A 3QPYA 1R87A 3M43A 3AIWA 3PG9A 4GO9A 1FRBA 1C29A 3EMQA 4LVFA 3H2FA 4LAKA 1FDJA 4P8XA 1QATA 2VUYA 3N6HA 3GTNA 3QF0A 3ATYA 4Q3MA 2NQJA 3LHVA 5CSSA 3TZFA 5DT5A 4C7GA 1M5WA 1BTMA 4DVOA 1PAMA 3L12A 2GSHA 3B97A 2GVYA 1EBHA 3RITA 1OGSA 3APYA 1ISXA 2WWCA 3SCNA 1TJ0A 4GG9A 4AYGA 3G1FA 1WV2A 3PZQA 4FX7A 1D7FA 4AEFA 2Z7KA 3WLHA 2A3BA 3I3EA 1HJQA 3H2MA 3S5SA 1V6VA 3TC6A 4Q7NA 1Y8BA 1WKFA 3WSUA 5A8QA 2P5NA 2P0IA 2FMOA 3KTSA 2XPKA 3WEMA 2VDHA 4MB5A 5KZDA 3NO1A 4RK8A 2Q6ZA 3G1AA 4KCTA 5AC6A 3ALFA 2P8CA 1LDCA 3W6YA 1XH0A 5I7GA 4QXIA 3O6DA 1JL8A 2QIWA 3TNBA 3DG7A 2AKMA 3BLEA 4XIMA 1V7AA 2ZVRA 1J11A 1GHSA 3CT2A 1R3TA 1FWWA 1SJAA 3OA5A 3UFYA 4ATDA 1V6WA 1OM0A 1L6GA 3KFTA 3P62A 3HU7A 1UZ1A 3S42A 4DPPA 1CCWB 1EF3A 1UUQA 2GGGA 4LVDA 3LCFA 5JVLA 2G37A 1XYMA 1VCGA 1QK2A 4O16A 3DKJA 3O0FA 3SUTA 1IXOA 1EA0A 1XIGA 3U4AA 1Q66A 1L0PA 3B04A 3OVRA 2PCEA 3UZWA 3WEZA 2PWEA 3HIJA 4WR3A 1E6RA 1OK4A 1DXFA 1A80A 4WKFA 2NXIA 3H70A 3LHUA 3PM6A 1YLVA 3O9NA 1LWIA 4GXPA 4HMDA 4C6NA 1DKWA 5REQB 5A2CA 4EXAA 3LN3A 2BZNA 3NCOA 2R9RA 1K03A 1V3JA 2WMKA 4KGLA 8XIMA 1T7LA 1CWYA 2HE5A 5A6LA 1WXYA 4B3KA 4AD0A 3AZRA 3STEA 3M1ZA 1W9DM 1SM9A 2J9XA 2VVSA 1YEYA 3W1TA 3SFWA 1M68A 3PVFA 1G4PA 3TJIA 2DT1A 3H4GA 1R3WA 2WSQA 3C2VA 4JIHA 3PZVA 1M01A 5CPTA 5IFTA 3ARQA 1G7UA 2B7PA 4AZ6A 4XKMA 2G95A 2XVNA 5BU9A 1EEPA 3REQB 3OQ8A 4RDYA 4WDUA 4H6RA 1BFNA 3VYLA 4BQ3A 3HJZA 2ISVA 1GJWA 4AH7A 4WXYA 2C1GA 5HNRA 4H83A 4C5ZA 1UP2A 2JE8A 5F4WA 4J5NA 4QJ1A 4W5ZA 1ZFJA 1YX1A 2VFGA 4NL1A 3BAXA 4J3TA 2OFJA 2BODX 3B9NA 2ZX8A 1GOKA 2EQDA 1RQHA 2QPSA 5I07A 2CNCA 5D4YA 1VPYA 4F2BA 3ZFHA 1LRNA 1I1XA 2O4MA 2B0MA 2HBXA 3N2CA 3NG3A 5A8NA 2ZUVA 3MKKA 1E4MM 2J7FA 4LAZA 2C1HA 5FACA 3W1XA 4NZ5A 3NL5A 3ENLA 1JULA 3RPTA 3TQVA 4C7FA 2XU2A 1MUCA 2YFNA 2V8ZA 2ZUSA 1P7TA 1JZ2A 1XINA 5A6BD 3IWPA 1ISWA 1GQNA 4DZHA 1E1CB 4HKPA 5CPOA 2XH4A 1UBPC 3OW1A 3LB0A 4WLCA 2GQAA 2Y61A 3ANYA 4M29A 4UNKA 2Z26A 4PUKA 1IEWA 2HS8A 4PH6A 1BG4A 3AYTA 4JTDA 5CBJA 3FHQA 3BG3A 3VNMA 2Z6JA 1OBAA 1PDYA 2WKJA 1TSIA 4DNMA 4ORIA 1EPXA 3OGVA 4UUIA 1LP6A 3HG3A 3O07A 3Q37A 4IP5A 4Q6XA 3O6CA 4DJDC 4EE9A 3TW7A 3W02A 2AGTA 2WPGA 4LRSA 4PTXA 4KWWA 1LQ0A 4EF8A 1QMLA 1Z48A 1EB3A 4G8TA 3NQDA 2J9ZA 5G2HA 2OYMA 4F3HA 3ABXA 2VGGA 1S46A 3PTKA 4B9ZA 1VJZA 2VTFA 1GWJA 1RPXA 2A6LA 3POHA 4U4MA 4B5UA 4Q7BA 4B5WA 1E70M 1DBTA 4OBSA 4XAFA 1DE5A 4AVFA 3MANA 2WCSA 3QMTA 3UXIA 5AVHA 4DJED 2FH8A 2NT1A 1SO6A 1PTDA 3O6YX 3F4DA 3V75A 5J04A 2AOSA 2JF7A 2X0SA 5BOEA 4AD4A 4GCXA 5I79A 1TWWA 1N8WA 3W9ZA 3P67A 4NI3A 3GC5A 3TWBA 3FXGA 1H5VA 2NQZA 1A5OC 5HMDA 3NO5A 3QH2A 3UXAA 2WAGA 1XLMA 1P6BA 3UA4A 3OVGA 1H1YA 4H8UA 3HTWA 3THCA 2NVDA 3LMZA 4DF2A 1XRFA 2WVUA 3VKKA 3U3HA 4PEKA 3AIVA 3M0YA 3GDBA 3B06A 2A3EA 3MO7A 3BQ5A 2F84A 3I4EA 1TV2A 3TXVA 4EXQA 2INFA 2QUTA 3F1QA 3RK8A 3PZGA 1FP8A 4JCMA 4F66A 2EEXA 1DEDA 3VD9A 3GXNA 1UR3M 2WBKA 3QBUA 3VINA 2BGSA 3DAQA 3MYOA 4IICA 4Q33A 4IFKA 2VX6A 1O94A 1J01A 5LIKX 1MRAA 3M0XA 4MG4A 1TPUA 1F74A 3W1MA 4MWAA 3HB9A 1QW9A 4AC7C 4LNYA 2CLKA 5A8PA 3AU2A 2YCLB 2BVTA 5E09A 3TH6A 3A47A 1EKOA 2ZRYA 3FXYA 1GVYA 1Z69A 1CI1A 3TONA 1XCFA 4DBDA 2I1OA 4O12A 1O12A 1Y65A 2W66A 3N6QA 1SO5A 2POTA 1RXOB 3G3DA 2HQAA 5DLCA 4I7VA 3GNOA 5C5YA 1OFDA 3VMOA 5I3FA 4L56A 2IXUA 3MMTA 4NSBA 3BG5A 1DWHM 1W91A 1WZMA 3BPWA 1EO5A 3AYRA 3U0HA 4HN8A 3SUUA 3BL3A 3R8GA 5ECUA 1P0KA 1JJKA 4YTSA 5LNRA 3VVGA 3ZXWA 2PWUA 5C2CA 1F3WA 1E0VA 3CO8A 3VGGA 1AH3A 3P8IA 1XBYA 3L0NA 4IIEA 3SCVA 4H04A 4H6EA 2VOMA 4CEUC 3BLKA 4HD5A 5I3KA 2DJXA 4UFMA 4JTEA 2J6VA 3OYZA 1F7BA 3T78A 3P80A 2QDEA 1OX5A 5DY2A 3N04A 3WQOA 3AOFA 1O5QA 4QCFA 3IIPA 5LNSA 1Z6KA 3KRSA 2ALRA 4ZQMA 3SRDA 1B3VA 3VIOA 4MY9A 5HWNA 5GNZA 1XKJA 4DJEA 3P60A 2QV4A 1UJQA 3PUDA 3CK5A 3GVWA 1ZCCA 3UPBA 3SCRA 1V6XA 2IUZA 2NVAA 4O1DA 3LCWA 2ZC1A 4KRZA 1P43A 1Q6LA 4EAMA 3A22A 6XIAA 1A5BA 5HQLA 3GXFA 1RH9A 3BJSA 5TBOA 4LUSB 1BF2A 2CZVA 4XZIA 3TCEA 2AAMA 4D1JA 2Q8ZA 1DIEA 3UWYA 2WMGA 5EFDA 3DZ1A 5HXMA 1I9CB 2VZSA 3EOSA 1JAEA 4F0MA 4BS0A 5CG7A 4GLEA 2QEZA 3VIIA 4LX4A 4KEVA 5AY7A 1KCZA 4IQJA 5I24A 4HPGA 4J7RA 3ZOAA 4INFA 1W1VA 1OFPA 3D47A 2PDFA 3BZJA 4ADUA 3QQWA 3C0QA 4N6EA 1DXIA 2FHBA 5ABFB 3UA3A 1VPXA 4KESA 1WXZA 2WNZA 3W27A 2NV9A 3OLGA 4KF1A 3W7OA 3KL5A 5ENLA 3IJ7A 1J5TA 2HISA 4ADTA 2AAAA 3QGVA 4JN6A 2CLHA 5JH1A 1NM9A 1S5VA 3C2OA 3EYPA 2QCDA 4YYCA 3V35A 1IXPA 2I57A 5TNVA 4S3KA 1W1PA 3P74A 4MLRA 2NVCA 1HP4A 4K39A 1TQJA 2OPJA 4EAYA 1E56A 4R9XA 1CYGA 5AHIA 1US2A 3DG3A 4CQAA 3AU6A 3ZVIA 2NSXA 3TJXA 1W5PA 4PGLA 3E0LA 4XZNX 3N6JA 2A6NA 1HG3A 1ODUA 1U5VA 3FCPA 3LNPA 2CWNA 5A6JA 4HU0A 2GDVA 1GT8A 3LPPA 4N9BA 4UZSA 2VP8A 3H12A 3FGCB 4K7VA 3TA9A 1VZWA 4BI5A 2E3ZA 4Z0JA 3OVPA 3GTFA 4B3LA 3GW3A 1CLVA 3KCJA 4JFTA 5DXXA 1H09A 1F6YA 1MRQA 3G8EA 3KZSA 4M5PA 2GDUA 1FA2A 3DBNA 4HMNA 4U33A 1Q63A 4GVGA 3KVLA 1T5AA 3RCNA 1V3KA 1UOZA 2Y2WA 4ROQA 2OT1A 4LVGA 4Y9NA 1V79A 1OVDA 4MNKA 1UQZA 5IOBA 3XINA 3B0VC 3PF3A 1CXHA 1JFXA 4FHAA 1LL7A 3HGSA 4MNLA 4O1CA 1KR1A 3S9ZA 1HXJA 1V0KA 4HPNA 4J40A 4ZOCA 2Y7FA 1IXNA 1EWEA 2FZDA 3M5XA 3EB3A 1VBRA 1UKOA 2FZMA 3L4UA 3G2GA 4GNVA 4WZHA 1Z7AA 3BCFA 2G4FA 3WJWA 2VQUA 4AD5A 4XV0A 3DOPA 4B4HA 3EDKA 4U31A 5JUVA 3Q67A 4XISA 3VUSA 3GVVA 5CC6A 1XBZA 3ANVA 4PULA 3UXDA 3GE7A 2ACUA 3TYBA 1QASA 2XN1A 1N82A 2HEJA 4CNOA 1KGUA 1WDWA 2GWNA 4LUJA 1NDVA 4DHGA 2UBPC 2BVWA 3SY5A 2Y7GA 2FZNA 1EEXA 3GR8A 4JHMA 3EWZA 3WNOA 4OBRA 1GQLA 3GNRA 2YBVA 3WFAA 1I4NA 3E2QA 3M5VA 3VGBA 3WQ6A 2EHHA 2PPGA 3LLXA 3USBA 1B30A 1IWPA 1XIEA 3OO2A 2QCHA 1HUVA 1UH4A 4DF0A 4UTKA 1YW1A 3C3UA 2OEKA 3R0KA 2Z1VA 3QV8A 4DPQA 3F5LA 4ZL1A 3IAQA 5HMFA 3SUVA 2XUCA 1E72M 3P61A 4XWUA 3T0TA 2JKAA 2Y24A 4KBXA 3WCZA 1E5NA 3C5QA 3KDNA 3FJLA 3M6DA 4J3WA 4ZFCA 4L4LA 3HQ1A 3K8MA 1M65A 4WSJA 4LWWA 1UUMA 3RO8A 3V5OA 3IGHX 3QSRA 4IL2A 3S3GA 2ZKMX 2PGRA 3GH7A 1WDRA 2D73A 3RU8X 1W3TA 2A79A 1WDSA 4N2YA 4RDVA 1OFQA 5ABGA 1GUVA 1JUBA 3R4IA 2EF9A 4N7QA 2OZ8A 4MPQA 4M6UA 4F0LA 1CGTA 4HU8A 2ZUNA 4IX2A 3S2JA 2W6RA 4HNCA 4MIMA 3F2BA 1UR0A 2IKGA 4MB1A 4D6DA 3ZLHA 2BVDA 1A5NC 3GZ3A 3WMBA 3BSGA 3UZZA 3WLKX 1G4SA 4GJ1A 3KOZA 4O18A 1LL6A 3GIYA 1EGVA 3WK2A 3B40A 4DYJA 1XPYA 2A3AA 3GIPA 2WVSA 4Y8FA 1XH2A 5KINA 2GSJA 1K1DA 1FHLA 4DB7A 1MFVA 3HBLA 3LZ3A 1OYCA 4F9DA 2NWSA 3DFHA 4LB3A 3G6MA 1E1FA 4XSMA 3DDMA 2PA6A 2QAFA 3WDPP 1KXHA 3BOLA 1XG3A 4LV9A 1UC4A 4IG2A 1Q8JA 3S1UA 3F4CA 1X6NA 3J7HA 1G0CA 1TWSA 2W9MA 3W3OA 3V5FA 3A64A 3N29A 5EMUA 3VNJA 3W53A 4DBSA 3TC7A 1XICA 3KAOA 3MDUA 4MNMA 2L5HA 2DSKA 1KM0A 4IGSA 3LTSA 1PE1A 3IK2A 1OGBA 1K6AA 1XIBA 3C8NA 3LXBA 3UERA 2OWWA 3FYOA 3MI2A 3N2MA 3WIJA 3PPFA 2A7RA 2E67A 4O8RA 1GONA 3UGVA 1A49A 2W27A 3BE7A 5ECVA 3M0LA 4ZGYA 1J79A 1VHCA 4IJRA 5BCAA 1TJPA 2NQ9A 2Y4SA 2HROA 3ZS4A 2GDQA 3EA2A 1ICPA 3KL0A 1Q7ZA 1EC7A 4H7VA 3HFTA 2NSOA 1RALA 3W87A 3EBVA 1PYFA 4HA0A 1M7XA 1XSKA 4O54A 3ZVHB 1Q6OA 3RM4A 3SN0A 4A8NA 4RZ6A 2GQ8A 1A50A 4PUEA 1PIFA 3FJNA 5HJYA 3RPDA 2YDAA 1JZ4A 4BA0A 2WJEA 1R47A 1IIHA 1MW3A 5LA2A 4YPJA 4W7WA 3MDWA 5D04C 4PUUA 4GC4A 1MEHA 4HYVA 3QVQA 1ADSA 4PMQA 4R5EA 2ISDA 3V16A 4A3YA 1F6KA 1H61A 1X7IA 3L0KA 5D05A 1S2TA 1UKSA 3G0SA 4UTLA 2WJDA 2PZNA 2Y88A 1QO2A 5E0FA 1KFCA 5HJXA 2RKXA 3NA8A 7TIMA 2WZTA 4A2SA 4C7DA 4XIAA 1KTBA 4LYQA 5HK4A 4LJ3A 3SDOA 1QPKA 4GC3A 1GTHA 4EWJA 5DCEA 2D2OA 1MXSA 2B7OA 2NUXA 1S3HA 5AYXA 2WMIA 1LLOA 1XD1A 4TVDA 3W1PA 3PUEA 3M64A 3RO6A 4UIOA 2WNQA 5FSDC 1ZENA 4M7TA 2DSUA 3MMUA 2ZUTA 1NFPA 2NWRA 3GXMA 5CZ0A 3BW3A 2WJFA 4XBJA 4LAMA 3KE0A 4J3VA 4Z2HA 1UD2A 4JZ5A 3WBXA 2DT0A 4MTVA 1LBFA 4R7OA 1YXDA 3VE7A 1GQJA 1Z3NA 3PNUA 3MP5A 3QTPA 3IGUA 1A0EA 1RVGA 2PMQA 2EAWA 2PWVA 4CKQA 1TZ7A 4H9XA 4JEQA 4D8AA 1DTUA 3D5HA 1XLLA 1FOBA 3PWAA 1UMLA 3W71A 4B3ZA 2VCAA 3VNKA 4U3AA 1FHDA 2PRMA 3VKCA 2ZRWA 1V51A 1TB3A 3KWXA 5FAJA 4Z2LA 4PB5A 3VKDA 2HK1A 4IUOA 1XYBA 3M0ZA 3PWIA 3DECA 3AZSA 1BXBA 3S1XA 3AI0A 4GIAA 1SMAA 1YPXA 4IIGA 2W4XA 3FVMA 1CXEA 2J13A 1RPKA 2Q09A 3HV9A 1OIFA 1ONRA 2E8ZA 1PZ3A 2ZZ6A 4GO8A 1JDAA 1J10A 3GUGA 2XIJA 3SRFA 3ZR6A 4XAYA 4DWDA 3QLLA 3EKLA 3GKAA 1K8XA 1YPFA 3W7JA 1LRTA 5CJMA 3I10A 4A6GA 4TX8A 1IF2A 4DJFC 3CPRA 4CNTA 1HJUA 1V8EA 3UZJA 4GVFA 2YOCA 5F2GA 2XDFA 3XISA 1SZFA 1RVKA 4JKKA 3IJLA 3H6OA 4I7WA 3IUHA 4DI8A 1L6WA 4BWLC 1FCUA 2PE4A 4KETA 3DFPA 2UV8G 4L61A 1NY1A 1WYIA 3LU2A 1JPMA 2Z29A 2DT2A 2DY3A 4IFOA 2X16A 2ZRZA 5HQEA 2ZC8A 3T81A 1FWEC 3UXKA 3GH5A 5CSRA 4Z1DA 2WKLA 3W2MA 2OO0A 3TN4A 1XD0A 3SCPA 3VUPA 3WLLA 3MSRA 1N7KA 3ITTA 5CGQA 4HJWA 4NJKA 4TV6A 4LXFA 5CGMA 4TV5A 3QGKC 1D9EA 1C8QA 3E96A 3PJWA 4O1AA 2WXDM 1JI2A 3FYYA 3MI3A 4W5UA 4OFCA 4DLFA 4RLIA 4I9AA 4NILA 1UROA 2X2GA 1Q3NA 2J8GA 1C7TA 3B0XA 2CLFA 1NIUA 4EPDC 2YL6A 3C2RA 1GCYA 5E93A 4XKYA 1FWIC 3SUWA 1YE6A 1KCLA 3CV2A 1TA3A 2IQTA 1ZP3A 1EJVC 4DF1A 3W88A 3NZRA 4KS0A 1GVIA 1E5JA 3H2OA 1G4EA 3UG5A 1RUSA 4MKSA 1CTNA 2A3CA 2PC8A 5AC4A 1FXQA 1UG6A 2ISSA 4UCGA 3GXPA 2X1IA 2OWXA 4UTFA 2CERA 1F3TA 3I7SA 5B7YA 2VRJA 4C6EA 3AISA 3BMXA 3WD3A 3O0KA 1PPIA 4CNUA 3ITGA 3GBDA 3CGTA 3ARUA 3KVKA 4AD2A 1FWJC 4Y90A 4PBGA 1KFEA 4ASTA 1B31A 3EKZA 3WMLA 1E4NA 3PBWA 3RCMA 1KQZA 3LRLA 3TP4A 5HNNA 2BV9A 3GXDA 3S6TA 1TPC1 4MGGA 4R53A 5K2ZA 2WW5A 1P1XA 1CXIA 4Y8EA 1AODA 3DHPA 5GJNA 5HULA 5G5IA 2PRHA 3QZEA 3UVIA 4IX0A 1K7FA 3TV8A 2XIBA 3H2NA 3JU2A 2QJNA 1EJUC 3A21A 5SWUA 1ZBVA 2RFGA 4IQDA 4GCAA 2DGAA 1ISZA 3NPUA 4XQ6A 3R58A 2V5LA 4RJEA 2YZ5A 2CFFA 3R5EA 3H22A 4H9YA 3TK7A 1PZ1A 2G8ZA 3BLFA 5A2BA 3M0JA 3LZ5A 4IJBA 5AC8A 3H7UA 4B5SA 3BARA 3R1ZA 2OJPA 3RUBL 3AO0A 3EX6A 4HA3A 4HNLA 3WMSA 1CPUA 3UGRA 4CCEA 3HPSA 3OP2A 4W7UA 1PSCA 1UH3A 4Z1CA 1YHTA 1I45A 2ZUMA 1AJ2A 2JQXA 4R7WA 2O9OA 4QS5A 3LM7A 1B3ZA 2BXZA 4Z1BA 3THAA 2B4GA 1HFBA 3TTQA 2YA1A 5DY3A 4UWMA 4ERGA 3SJ3A 3W7MA 1K77A 4PB4A 1JCMP 2PDBA 2ABAA 4MJ2A 3W86A 4B92A 5I00A 1G4TA 3NEHA 2R6OA 4X2PA 3G0XA 2WCGA 1XLEA 1PZ0A 1MMFA 3KLKA 4LF1A 5CGTA 2TYSA 1UUOA 2VEIA 4QGCA 1H62A 4DBWA 5B80A 2VO5A 5M03A 1TREA 4E4FA 3USZA 1E6PA 1GPFA 2IPWA 4ZQPA 1W5OA 1UH2A 3DC8A 1R2RA 3DI0A 4MWAE 1DYSA 2NUWA 4ICMA 2YB4A 3WH6A 1QW7A 2E6AA 2QMKA 3PANA 2E25A 1XLFA 5EGRA 5FEZA 5DMMA 3JRKA 5KITA 1F9CA 2ZUUA 4TXEA 3A4XA 1XLJA 3NIYA 4BHYA 3W75A 3WF3A 2J66A 3QQ1A 4OE7A 3WBYA 4PODA 4Y96A 2ZFAA 4XVDA 2DSVA 4J3SA 1AUSL 5BZAA 5G4HC 3DX5A 4M51A 3MUY1 2WO5A 3BCDA 1ZY9A 1A5LC 3HZ3A 3R11A 2PDJA 5TQLA 3TTSA 3G18A 3DYOA 4HSOA 4E3VA 4YWSA 3DFQA 4L5ZA 1AQHA 4CN4A 2RHGA 1BKSA 3N17A 1Q6RA 3AMKA 1LG2A 3H55A 1TCDA 3S0CA 4BY3A 2ZADA 1I60A 4ZB2A 2GJXB 2A7NA 1SO4A 2ZXDA 3HPAA 2TODA 2VRQA 1KM1A 2P3ZA 2AL1A 4LC8A 5H8UA 3DFTA 1CW2A 2R8WA 2W61A 1UWIA 4MHBA 2FIQA 5HOSA 3WQ4A 4TX6A 4HPJA 3NZPA 3O63A 3LBMA 1K70A 2D1ZA 1UWAA 2CLLA 3M0KA 2D24A 1S2AA 2YXOA 5HR6A 1ISVA 1FWTA 2XWDA 3C2EA 3HURA 1UWUA 4W84A 2FMNA 4JHOA 1KBLA 3TSBA 2O7QA 4O8AA 3C3NA 4GH3A 5EMJA 3KOXA 2IPJA 3SCQA 2WHLA 2DV0A 1CIUA 3WH7A 2JBMA 4E8DA 3QZAA 1E73M 3P3BA 1KM6A 3MSDA 1ITCA 1IYXA 3IUDA 5DBUA 4LV4A 3WQFA 3WQCA 5I09A 5AZ0A 3SBFA 2XM2A 5CLTA 2PGWA 3SGUA 1VFHA 3VXGA 2NX9A 4W87A 1QI2A 1UD8A 5DBTA 2Z2UA 4LF2A 5GVJA 1DL3A 2G3NA 2ZZ2A 3G1VA 5FJIA 3U5YA 5AYBA 5GNYA 4PMXA 4F2UA 3O7UA 2QUMA 1PIGA 3I7RA 1PCWA 1TO3A 1YE4A 1U5HA 1WUFA 1VFFA 3CIXA 4AY1A 2X05A 4AZCB 3IANA 4OKDA 4GWEA 3FW6A 4DWSB 4XO6A 3N9KA 3QHOA 2PDCA 1XUZA 2QQ6A 3E0VA 3MC5A 4HZ6A 1OD0A 5DT7A 1ME7A 1E9ZB 1GVFA 3RMJA 4XTIA 4DUVA 2C91A 3TDFA 3IJ8A 2V69A 3MI6A 4XX6A 5HUOA 4WDWA 1WDDA 1QNPA 2YFOA 1UD3A 3DFYA 4HA1A 4C6QA 3TQ0A 2XFYA 4P8VA 4MY8A 4DM1A 1ITXA 1NWUA 2XM1A 1AJZA 2HVMA 1H7XA 2J6XA 2ZWZA 1QAPA 3MSYA 1SZRA 3E2SA 5LXEA 1SSGA 3V3WA 4CU6A 4EWND 4I5XA 1K7EA 2PDPA 1AQMA 1EO7A 2OELA 2VGBA 5A6MA 1EXPA 4BQ4A 1XHGA 1KM2A 2PTWA 4K8EA 4GQGA 3A4WA 1TKKA 4JTIA 5G4EA 3WNNA 1L6FA 3T2QA 3JZUA 4GE8A 3CHCA 1IXQA 4C6KA 3CJPA 2JGYA 4H8NA 1LLWA 1SZGA 3QV9A 5CC3A 4PCTA 1O60A 4UTTA 5CZTA 3RGTA 2PTDA 1FWHC 2ZYFA 4N9CA 4P7RA 2BG5A 3SFKA 2YL9A 4U3CA 1H1NA 2A7PA 3BICA 3TYEA 4FA3A 3LGEA 5C0QA 3QTGA 4MWAC 5F7UA 3E6EA 5E1QA 2V82A 5J8LA 4BK9A 4RE4A 4QEHA 3EXRA 5AHLA 4KWUA 1RD5A 1JCTA 1KRAC 4R33A 3AHXA 4DO6A 1E1EA 3W1LA 1JRCA 3W0KA 1W9BM 4NAFB 2V2CA 2PLKA 1FCQA 4H01A 1RP9A 2GJLA 9XIMA 1JYNA 3ICJA 8RUCA 1JR1A 4NZJA 3MB9A 4OV4A 1QRQA 4KEZA 4ZFMA 1JNDA 3HA1A 5DN1A 1VEPA 2HXUA 3GR4A 1JXJA 1QNOA 5C9UA 1GOXA 3TR9A 1OINA 3L4TA 1CDGA 4A8IA 4UOQA 3ONBA 4IPIA 1XIFA 2OR2A 4LEFA 3KRZA 4FO4A 4KPLA 2WCAA 3A9IA 3ARVA 1W2VA 2WHJA 1I2QA 3WBEA 1MEIA 4P7OA 1CBGA 4WGHA 3O06A 1S5MA 2FZ8A 3AS3A 4MYXA 1DJNA 2OX4A 3K8KA 3VDGA 3H4WA 3GTHA 4ATLA 2BY3A 4FX6M 4GQBA 3OG2A 4AZBA 1MFUA 4RXGA 2GSEA 3GW0A 2WC7A 3E0FA 4XZBA 2DZBA 1L6SA 1CXKA 4DJEC 3OEXA 3ES8A 3LV6A 2XGBA 4DZIA 2E68A 3DENA 3MHUA 4HU4A 2INEA 3CM4A 4G6CA 1W6TA 4QJ3B 3NYDA 1XIHA 1BGAA 3RLUA 3UY8A 3QOMA 4AIEA 3A9BA 2Y7DA 5JXQA 5I78A 3CQHA 4GVIA 4PMUA 4FXJA 3H7RA 1JD9A 5HA7A 5I06A 4D2JA 2PDLA 4FAMA 5C70A 4GA8A 3S1GA 1P4CA 4IUGA 3BLIA 3QY8A 4IIHA 5AVNA 2UWFA 4KFOA 3URNA 4IIDA 3OG3A 4LYKA 4KCUA 4NXKA 3Q58A 1W3JA 3GY1A 1ZALA 3ZMRA 2I7GA 2CXGA 3K8LA 4UOZA 1A5UA 1XISA 1YNQA 3BDKA 4A05A 2CCRA 3M16A 2PDIA 3B9DA 4I6VA 2AQWA 5M3WA 2F38A 1KGXA 3WQVA 3WMCA 1TVPA 5DX7A 1XC4A 4X60A 2DZVA 1OSEA 2EGZA 2B7NA 4MDOA 3UJRA 2QJMA 4NQ1A 1Z42A 3S83A 1GKQA 4EVZA 4FALA 4L9XA 3B9AA 3BV4A 1Q65A 4IMAA 3E2VA 4C6BA 1WKYA 3M5ZA 1KV8A 4L6OA 4V15A 3V4BA 3W2NA 5LGXA 2WOQA 4DWSD 4HVXA 1XX1A 1PEZA 1ADOA 1RK5A 4R85A 1QPOA 1E0WA 1S3TC 2RJGA 3O15A 3U7BA 1VP5A 2YJQA 1E9IA 4PA8A 1ZHAA 3JVAA 2VZVA 1C3FA 5D9MA 6PTDA 3GDRA 1B90A 4LBSA 4X22A 1U30A 1YBQA 4GI4A 5CZKA 3W7LA 1OABA 2OOGA 1SJBA 2RGLA 4O11A 2ZICA 4S38A 4NUWA 3HFYA 3ATZA 1ZJIA 3VKAA 3EWDA 3FAXA 5MKGB 3NPWA 4QDPA 4ERAA 1J9YA 4JY9A 3PBUA 4NG3A 3H26A 4NVTA 4BQ2A 4BKNA 4HCLA 4US6A 2BSLA 3MZ2A 1V3LA 2QAPA 2FVLA 3G77A 1GYLA 3URBA 4FLOA 3M44A 4NF7A 4WDXA 2PBGA 2VURA 5FJJA 1H49A 4GJIA 4DZAA 5M2FX 2QLYA 3ARWA 5CXPA 1A5CA 1NFBA 2FTYA 1T99A 2QIIA 2JALA 2E0PA 1Q7MA 1T96A 3BMWA 2EBNA 4OUEA 4XB3A 2CITA 2YCEA 4S3CA 1H3GA 1NWTA 3M4HA 3PPGA 4QS6A 5D8ZA 3TROA 3V0SA 1TV5A 3R89A 1I75A 2X0HA 3SZ8A 4WRHA 5E9AA 2O55A 3N25A 5C54A 1C8YA 1EX1A 2GWGA 4PFHA 4DY1A 3K4WA 3O3RA 3RPMA 3T8QA 3SIMA 1KFWA 3FJ4A 4M19A 3SN1A 2O9TA 4WQ6A 4CD7A 2NV2A 4JN8A 3R43A 2JIWA 4XK2A 5AZ1A 3UWEA 3T8LA 3T6CA 3W7IA 3L4WA 1EQPA 3TTYA 1NQKA 3WF1A 4NJGA 1KXTA 3T9PA 1PS9A 2QJIA 4P7NA 4JFSA 3W00A 1JG9A 2NT0A 1FP9A 1NOUA 4K38A 5I3DA 4NKCA 1O5KA 3BTNA 1TPFA 5EA9A 5D32A 3PJTA 4S1FA 1DHKA 4BR1A 4TVCA 1DJYA 4Q4MA 5FJUA 4E2BA 5CPQA 4E2VA 5CC7A 2V5DA 1EJ7L 4QE5A 1TMQA 1YADA 1US3A 3PN8A 1D3GA 2KZHA 1NOFA 1MZHA 4F8XA 3CV6A 3P5ZA 2ZRVA 3CBWA 1NELA 4POCA 4MVAA 4UQAA 3ARZA 3CL8A 4ZOAA 3T05A 5BROA 3S9YA 5DMNA 3CZJA 1LRQA 3QZ6A 4NI8A 5DXYA 1O1HA 3BVJA 4IQEA 2EKCA 4LB4A 3CHEA 2R1PA 2QULA 3G24A 4BI6A 2D2GA 4PMJA 3V1HA 1F73A 1EUAA 1VYSX 4QITA 2GL5A 3B0UX 2OKOA 3AJ7A 3TX9A 3PWGA 2XH2A 1KD0A 1VR6A 4KQNA 2X8RA 1RCQA 2CHNA 4Z2IA 1KTNA 3ABQA 2C18A 3MCMA 2CBUA 2C13A 4CQDA 2X7VA 3NO3A 3V0TA 5F2MA 5E9XA 3OBKA 3OZPA 3SW6A 4KIRA 2YCIX 1A3HA 1IT8A 1XYLA 2J62A 2V0TA 3H21A 4CU8A 4JX5A 1DHPA 2ONEA 3TC3A 1J8VA 4ICCX 3GDMA 3QW4B 4PBEA 2JF6A 5D8WA 1ZJBA 1TZ9A 3QYQA 5D2WA 1MXGA 3GDTA 1H7PA 3NQBA 4LAOA 4Z2KA 1MUWA 1UJPA 1OCQA 2PB1A 3WL0A 3LXCA 1FFRA 2VT0A 1H11A 2E6FA 2W79A 4H8HA 2GYIA 2QNEA 1BQCA 5AC7A 3CMFA 3UYCA 4PCPA 3QSTA 1TV4A 4GH1A 4JDYA 1LUCB 4KIEA 2ZE0A 3EPNA 3NM1A 3WQPA 3EOEA 3PUGA 1QFEA 1EJTC 1RBOB 3ZR4A 1LOLA 3CT7A 3VC5A 4CUCA 3F5KA 3PTDA 1M53A 4L4MA 2P8BA 3KBMA 1YTKA 3JR2A 3WDRA 1ALDA 1ZBKA 4UR9A 1J0YA 2O4QA 3UWZA 1WOAA 3FSTA 4GACA 4NZFA 4D1IA 3TYDA 1UWQA 3N4FA 5FCZA 4NRSA 3WQDA 1BGGA 3W7NA 5G1MA 4IPNB 2NXHA 2FKPA 3OTRA 3VIFA 2FZBA 1TYGA 3THUA 5D9NA 1GVQA 2REQA 1AQ0A 4WOZA 1JZ8A 3UPMA 3SN4A 4ACZB 4L4OA 1N55A 2Z24A 1MW2A 2VEMA 4UBPC 3OLIA 3QFEA 4MF4A<