4I8YA

Structure of the unliganded n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
303
structure length
303
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
total genus 114
structure length 303
sequence length 303
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i8yA00
4F2TA 4F2UA 1PTDA 1AODA 3EA2A 3RLHA 2ZKMX 1DJXA 1ZCCA 2FJUB 2OR2A 5T9CE 1YDYA 1PTGA 2PLCA 4PTDA 3QVQA 3OHMB 4R7OA 1QATA 4I90A 1V8EA 1T8QA 3EA3A 3RLGA 2ISDA 1QASA 3H4WA 1DJWA 4S3GA 2P76A 7PTDA 3V1HA 4Q6XA 3QR1A 1XX1A 3I10A 3H4XA 3QR0A 4F2BA 3NO3A 3KS5A 3EA1A 4I9MA 1VD6A 2OTDA 4RW5A 2PTDA 4I9JA 4QJ5B 3PTDA 1DJHA 4GNKB 2O55A 1O1ZA 6PTDA 1DJYA 5T91A 4RV3A 1DJIA 2OOGA 1T6MA 5T9BG 3V16A 3MZ2A 3CH0A 3V18A 4OECA 4QJ3B 3L12A 4QJ4B 4RW3A 5PTDA 1GYMA 2F9RA 2PZ0A 1DJGA 3KS6A 4I9TA 4I8YA 1DJZA
chains in the Genus database with same CATH superfamily
2C13A 1LOLA 4LCQA 2GOKA 2YXXA 4X22A 3VYLA 1B3OA 3ANUA 3G1VA 4L4MA 3CQKA 1TTJA 3GB6A 3OBKA 2XM1A 3NQGA 1G0CA 4AUBA 4BA0A 2A7RA 2NXHA 3F4VA 1VRXA 2VYOA 1OD8A 5J04A 5REQA 5D2VA 5E9AA 3V5FA 2OWCA 3OHMB 4OQVA 3EDDA 1V6TA 2Y7EA 4GNVA 1FFQA 2P0OA 3CIWA 3PTMA 3RFAA 3AUOA 5HINA 1R85A 4JOMA 3H4WA 2B7PA 1OC6A 3T07A 3FHQA 6TIMA 1R30A 1Z3NA 4WY0B 4IUOA 4FR1A 1BVWA 4W7UA 3UA4A 2Q3OA 1XIHA 1T8XA 1JQXA 2FKPA 1E1EA 1BKSA 5HA7A 1XINA 1D7KA 4FS9A 2WKLA 4XBKA 2DUXA 4Z2LA 3CLWA 3RLVA 4Q4SA 2E5DA 3GDLA 3WLIA 1B0IA 5DY2A 1QR7A 1V0MA 4V1YA 2XJ7A 3P80A 3TTOA 2XIJA 1AQHA 4ZSTA 4C6IA 1M04A 3E5PA 3VNDA 2J7HA 4JTQA 3I4KA 2DGAA 1UA3A 4JEJA 4E8CA 3MMWA 4H19A 4FLSA 2X1SA 5LA2A 2VC5A 1UMLA 1OT2A 1J93A 1KXQA 1K9DA 2Y88A 6CGTA 4GACA 2HJPA 4M1BA 1W5MA 3RLHA 3W88A 2FIQA 5FJUA 2A6LA 3IUDA 2WZTA 1AH0A 4Z2JA 3ZVHA 2BZNA 1GQLA 2C3ZA 2ZWZA 1EX1A 1E40A 3TMQA 4Y9PA 2Y8VA 3DH7A 5D37A 1M01A 3NQAA 1TPWA 5AHNA 2XTKA 1J96A 5A1AA 2OZ8A 3MUXA 1QUMA 1G67A 5GNXA 3VGGA 3WDHA 4IIBA 5CJMA 4GVFA 4CCEA 5AHMA 3OGSA 4UQCA 1JPKA 3I65A 1QDSA 1N8FA 2WSQA 3EMZA 4GQQA 1XS2A 1UR1A 3A12A 1TUFA 4QXIA 1F74A 1DJHA 4CD6A 4DUVA 2ATSA 4DZAA 4BFAA 1DJIA 4KCWA 5FA5A 2P10A 3QBUA 3RR1A 1H7PA 3SN0A 3GFYA 4GZJA 4ZQRA 4HA4A 4UTWC 1SW3A 2DH2A 4DELA 4U31A 3G22A 4UNLA 4WEVX 4FB7A 3JS3A 2PWEA 3WNOA 5FF3A 4IQJA 4JHMA 3GXMA 3ISIX 1W3TA 1B1YA 3QW4B 4H9XA 1S5VA 4E3VA 2YA1A 1EPVA 1S39A 3EA2A 1OB0A 2HISA 4WVXA 3KTSA 1NWUA 1W1VA 4GABA 2W91A 3CAKA 4LCSA 2O4QA 3HG5A 2ZVRA 2E6DA 4FF5A 4KWUA 1WZMA 3AIVA 4J3VA 5M5DA 1E5JA 3LMYA 3NQCA 1VRDA 2Y1HA 1L6WA 4O4WA 3DCPA 4PBEA 4UUIA 2FVLA 4LF1A 2CZVA 2BHYA 2ABAA 3G0XA 3W7JA 5A6JA 1OFOA 3WH9A 2O56A 3DENA 4IG2B 3LNMA 1AW2A 4EK7A 3QV6A 3MTWA 3WIJA 4LU0A 1Q5MA 3FHAA 3PF3A 4MLJA 4MNLA 3AHTA 2GJXA 2GVGA 4DM2A 3N13A 3EWDA 4YWIA 4C6BA 2DZPA 4H6QA 4F0RA 3G0SA 4MNJA 3CEUA 5TNVA 1AQFA 5B7ZA 2PB1A 3OBAA 4FX8A 4RNHA 1ZB5A 4W7VA 4LFYA 4FOJA 3UY8A 1S5WA 3BVJA 3DYOA 1JFHA 3WH5A 2G96A 3VCNA 4MM1A 1W1YA 4MYXA 1C7TA 1WDDA 2WYSA 1KM0A 3HV8A 4K3ZA 1S2WA 1XLDA 2TYSA 1FWJC 3W01A 1EDGA 1V7AA 2DH3A 1MXSA 2QVNA 5EMYA 3TLQA 5HJYA 3OB8A 5E9XA 1TZZA 4PTDA 4X9SA 5CPSA 1RR2A 1K4GA 4FAMA 4I8DA 1TQJA 3D0CA 2OEMA 1DTUA 2PLKA 1EGVA 2DVUA 1Q66A 3AXHA 4LVDA 2GGGA 4OOZA 1AL8A 4DWDA 2W62A 5CSYA 1QW8A 4PMDA 4WR3A 3WUBA 4PMYA 1QNSA 1EJ7L 3AIWA 3QMTA 1KXVA 5I07A 4KIEA 5HANA 1FCUA 4H8HA 3CZ8A 3EX4A 4CN1A 3N2MA 3PTDA 4U2ZA 4HHHA 1QU4A 8XIMA 2CWNA 1CLKA 1S3TC 4UZUA 1VBHA 3O0KA 2ZRVA 3ARSA 3M47A 4DWSA 2VEMA 2PF0A 3D5HA 1M9HA 4Q22A 2O4MA 1LQ0A 5BOOA 4F48A 2RH9A 3Q65A 4E8GA 5EPDA 3B9DA 2CLHA 4JFVA 1MMFA 5DX7A 2ZZ5A 4HD5A 4LV9A 3W4RA 3IACA 1XF0A 4UQEA 2ZRWA 2ZUVA 3V5OA 1BRLA 1TPEA 1DXEA 4FNRA 4GIYA 4IH3A 4J7RA 2VEIA 1F3TA 2EJ1A 1NFPA 3XISA 3ZR5A 1JCXA 2WNQA 3O05A 1F8MA 1FRBA 1I6NA 1UOKA 4JTAA 3MQTA 5HR7A 3R0DA 1U2YA 4KW2A 1JRBA 1HJWA 5D9NA 1VCFA 2MANA 2YCJA 4WOQA 4BEUA 5GPRA 3PANA 4UMCA 4O19A 1CENA 4PMUA 3T81A 3H26A 1C9WA 3CAWA 3BSHA 2FZNA 1SJCA 3D46A 2PZNA 1SUXA 1HP5A 4UTMA 1UZ4A 4JX6A 5DRIA 3WQWA 1H7RA 1QO5A 4S2BA 3STCA 4G5DA 3ZXWA 1ADOA 3PJXA 2POTA 3EWZA 1CXFA 1HL9A 4GBDA 4ZQOA 4S3EA 3KP0A 1GZJA 3U57A 4AHOA 2WPGA 1LRTA 2J79A 3KZSA 4GUGA 3AC0A 4GCAA 4CN6A 2X8RA 1TCMA 5ABFA 2CHNA 2QF7A 4GC3A 3CV6A 3G77A 1B2YA 4CCZA 1M6JA 2D2GA 5D02A 1VP5A 1IEQA 2J9XA 5CPQA 3AYSA 3HGJA 1RQBA 3S1UA 2YBUA 1LORA 3C0SA 4KCUA 2Z1BA 2QYGA 2WSYA 3FDKA 1V08A 3EPOA 3KDNA 2CFFA 2AMXA 4KBXA 1IWBA 2R94A 4H9MA 1XYFA 2WJDA 4ZVJA 5HPCA 3I3EA 2PODA 2G37A 4GVIA 3SSZA 3GK0A 3FXYA 4GXMA 3B8TA 2ZX5A 4NASA 1Q3NA 4GUJA 3M41A 1S2UA 4IIHA 3H7RA 1UBSA 1XSKA 1DXIA 2BX7A 1XD1A 4U5KA 4MG4A 3NPVA 4PSRA 4WY0A 1OEPA 1J2WA 1XLAA 2WVVA 4B5NA 5CC5A 1D9EA 2ODOA 3NUKA 1LWIA 1TMQA 2Z4GA 4H6RA 3WH7A 4D6JA 4C1LA 4AZ7A 1TPC1 4IPLA 4R3UA 4D6EA 3TV8A 4AHQA 1R3TA 1KFLA 2E1WA 3GVRA 3A23A 5E0KA 1FWWA 3HG2A 3WDPP 1KBLA 2HZGA 4J3XA 3AZSA 3M4HA 2WCAA 5CPTA 2VZTA 3T4WA 2DEPA 3N9RA 5BOFA 3GVQA 3WF4A 3WBXA 1R3SA 1CGXA 1XH1A 1E4NA 3T08A 1EYEA 1KM6A 4XD5A 4X60A 1RAKA 4P7QA 5LA1A 5C71A 1B54A 4C6NA 2GJLA 4FIQA 1S5TA 4DZ5A 4MZ8A 4F3HA 2O7QA 1LBFA 4AEOA 3LRMA 2F6XA 2FB3A 4ZFMA 3QKZA 3AZTA 3EX2A 1SO6A 2ZTJA 4N9EA 1N7KA 1W5NA 1QPNA 2Y6ZA 3O3RA 4M7SA 5CGTA 3TTEA 5MHBA 3KBWA 5A69A 4L4LA 1VEMA 2JIEA 1OWQA 1QI2A 2OFJA 1ZAIA 4OBTA 1VIWA 4PMZA 1DE6A 4PL1A 4ZXLA 2CZFA 2Y8KA 3SQSA 1QJWA 1OG6A 3QZ6A 4Z2HA 4HGXA 1QOPA 4JKKA 1FKXA 5LZLA 2W63A 3WMSA 3G18A 1ZTVA 4AQLA 1I2QA 5EFFA 4EX4A 4IGNA 1V6YA 2JFEX 1OK4A 1R0MA 3WDJA 3UG4A 3SRDA 4A4AA 2G3NA 2V82A 1LUCA 1PYFA 4DI8A 3KRUA 3EWUA 1OFAA 5C6MA 1VPYA 1TA3A 2UBPC 4P8WA 4DYEA 3W38A 4GXPA 1E6XM 3T09A 3GUGA 2VX4A 3WMCA 3CL8A 3LI1A 4S1FA 2CLFA 4HIBA 5EA9A 3LHVA 5GJPA 4FF7A 1UASA 3H2AA 1QASA 4IFKA 4J3UA 1XBZA 1K8XA 4LEQA 2FHCA 4M1RA 2OYMA 1AVAA 2F7FA 3VC5A 3GHUA 3E3HA 3GFZA 1H50A 3W7MA 1KBBA 3LX9A 4MSSA 2FDMA 2Z1XA 1GJUA 4A22A 3VILA 2RDUA 3IWPA 3WJZA 2J4GA 3KOWA 1GJPA 3NZGA 3L5LA 1SR0A 2GVEA 4Y9MA 4O28A 3WNNA 5DT7A 4JTHA 4N02A 1W9UA 3R0KA 1JUKA 4KWSA 1GTEA 3R79A 3N4FA 1KRBC 3KS6A 3HQ1A 2YCKX 2YB4A 3FX4A 3ZO9A 3BAKA 4PMXA 4S39A 3HG3A 1F8IA 4C6CA 1BVZA 4M81A 1UD5A 3GD6A 2VOMA 2ZKMX 1RPKA 1OY0A 2Z7KA 5L9FA 1RSCA 1SJAA 4NJHA 2QV4A 1NF7A 4A8IA 1YX1A 5DY3A 1XYBA 3OBEA 1IHIA 3ABXA 3DDMA 3E2SA 3MUY1 1UG6A 2IKHA 1EPXA 4GKTA 1P0BA 3W7DA 3DG7A 3AYRA 4DPQA 4JICA 3B06A 1FWCC 1RJQA 1LL4A 2BOGX 3EX3A 1G4TA 3MP4A 3QR1A 3CB8A 3E0VA 3LSBA 4NRRA 5FF0A 4KIRA 2AL2B 1G01A 4FXFA 4HNOA 5ENLA 1CTNA 1WPCA 3HURA 3FLUA 1OGBA 5A8GA 1CB7B 3BW4A 1LQAA 4G1NA 3GNXA 1I75A 5FI8A 3BV4A 2IPGA 2Z6IA 3BLIA 3MHGA 4QG8A 3SGGA 4E6MA 2ZDSA 3PUDA 4LYRA 5CSSA 4TMBA 1Q8AA 1OQFA 4PUDA 1ZJIA 4Q8PA 2W0UA 4AY8A 3IVSA 3XINA 4PMRA 1BSLA 3M0YA 2YYUA 2BP1A 2J9ZA 2FZMA 3NQVA 3MDUA 2C0AA 3T2QA 5C2XA 1OYCA 4C6OA 3HJEA 3VNJA 4OTKA 3GHRA 5I5RA 3BLKA 4XKYB 4NZFA 3GR8A 3WY1A 3DFHA 4JN7A 4A3HA 7TAAA 3WQ6A 4H7ZA 4N6FA 4TX6A 1AMYA 4XD6A 5CJ5A 1W32A 1GQNA 3IJ8A 4CEXC 1ONWA 1TUXA 4J3WA 3LK6A 3IV3A 3ZLHA 1D3CA 1NP0A 2EKGA 4H9ZA 2PWFA 3QN3A 1L6SA 4Z2IA 3V5CA 1E6QM 1RJRA 3E96A 3S2CA 4QLJA 3TR2A 2WCGA 1ZBVA 2G0WA 3JRKA 1SM9A 2QAPA 3CAQA 1EXPA 4BQ4A 1UKTA 4YJ5A 3RAOA 2Y5EA 1JCMP 3PPFA 5M03A 1ZLPA 4PSPA 3OZPA 4KMQA 3VGFA 3M6YA 3QTGA 3L65A 3WG6A 1TWIA 2JE8A 5A8NA 2VM8A 3DHPA 4IIDA 3M5VA 1PE1A 1SW0A 1XFCA 2PDJA 5C2GA 5MKGB 1HL2A 4Q6JA 3TN5A 1R6WA 3GU2A 3W84A 1XL9A 2B7NA 3DC0A 5DFAA 3O06A 4WJXA 1FCBA 1O7AA 3M0XA 4Z17A 3K30A 3HM7A 3RG6A 3EOEA 4NT0A 3IIXA 1VFSA 1UMYA 2WMKA 1E6ZA 2XINA 1M7JA 1NVMA 3ID7A 4O13A 3SW6A 4O54A 3B03A 4J4KA 1NOWA 4JFSA 2ISDA 3VOJA 3DI0A 5BWFA 1LLOA 5D9MA 2G41A 3M43A 4RE2A 1WCGA 3C6CA 3VABA 3BAIA 5LA0A 1VFUA 3K5XA 3PJWA 4C6DA 3ZIZA 1NH6A 1X6UA 1AZ1A 4KWWA 4NAFB 3EWXA 2WVUA 3SUWA 3TYDA 2JKPA 1JCLA 3KCLA 4ZODA 2UY5A 5CGMA 2Z1SA 2IKIA 3FCPA 4C6KA 2OQYA 1B3YA 3WK1A 3JZUA 1O6IA 1LBLA 4QJ4B 4QX4A 1L6FA 4QE5A 4REQB 4AZ5A 4S3CA 4GC4A 4KERA 2ATMA 2Y70A 1JGIA 2A7NA 4RV8A 3GXNA 1QXLA 1WKYA 5HWMA 2ZWYA 3H70A 3LPFA 2PDWA 1BVNP 3SEPA 3KBSA 5D04C 1SO3A 2ADAA 5BWAA 3KLKA 1YKWA 3JVAA 3QGAC 5LIKX 3VM5A 1QBAA 4YN5A 2PI6A 2CNCA 3GU1A 4PUKA 1UIPA 4M51A 3H53A 4JEQA 4MB3A 5FAJA 1S2AA 4ZO9A 5FJRA 1QNPA 2VDIA 1Y5XA 4UNKA 1HXJA 4MLRA 2PWDA 1HKWA 5HNNA 3W7NA 3H7VA 3C2EA 4TVDA 2PGEA 1L2QA 3DBNA 3K8KA 2GK1B 2QCCA 4N9BA 3LM7A 1EDTA 1EOKA 2TSYA 1RA5A 1JVNA 2QT3A 3CAVA 1O4UA 5HQEA 4UTIA 1OSEA 1UJQA 1ISVA 1K9TA 1NTHA 3LBMA 4MPQA 1MSSA 4DVOA 5HQLA 1PWMA 2X09A 2D3NA 3WD2A 4X2PA 5FJTA 4C1NA 3WQPA 8A3HA 3T05A 4ZL1A 4NNAA 4W85A 1EA0A 4CQCA 1JZ2A 1POJA 1A4LA 1BLIA 1REQA 2QPUA 3N14A 1VF8A 2YCEA 2BVDA 1OT1A 1OIFA 3GBDA 1TVLA 1EWDA 2GOUA 1W1B1 2QGYA 4I3GA 5DMMA 4ORMA 2CWXA 3W2LA 5TAOA 2G3JA 1XYCA 1NY1A 1ZCCA 4HSOA 3PY2A 5IHSA 3LY0A 4MJZA 1TKKA 1DJNA 1XIEA 3WD4A 4LVBA 3QLDA 1M03A 1Z42A 4EF8A 2XVKA 5LIWX 1V4YA 2BDQA 4B90A 3EYPA 3E0LA 3B0XA 1EP3A 4Y9AA 3WNPA 3M64A 4F66A 4ATWA 2GSEA 3RO6A 4PRTA 3T8LA 2UV8G 3ES7A 1IE7C 3DYMA 5DMNA 1RY8A 3MKVA 5FSDC 3WLMA 5G1YA 4W86A 1ISYA 2D2HA 2FZ9A 1UBPC 5FACA 1H5VA 3UA3A 3WCZA 4C91A 5FJPA 1WOBA 1ZUAX 3DXIA 4WKAA 1IEVA 3ZWSA 1VKFA 4M6PA 3RITA 1YMYA 2VXNA 2CITA 3PAOA 3LCXA 3UXIA 4IIEA 4EXBA 2PUZA 2GDQA 1Q6CA 4L6OA 3G1RA 3QOKA 4GA8A 1U22A 1TTPA 3ITCA 2NV1A 4FHAA 1JXKA 2PDIA 1LZOA 1O66A 5CJNA 5FIPA 4GYPC 5EL1A 1WXJA 4BQ3A 2J8FA 3HU7A 3AI0A 3VIKA 1XBXA 5JMUA 1DPMA 3VZYA 4H2CA 2RGMA 3F03K 2CESA 5GJNA 2DQWA 4NKCA 3CHDA 4FX7A 2NV2A 1JDDA 3RM9A 1FX6A 1JF5A 5AYZA 1QW9A 3H23A 3O8AA 3QQ1A 4YYCA 1E0WA 2FTPA 3LXBA 4S3KA 1XRVA 3I6RA 3ARQA 2VWTA 3CB3A 2V5DA 4LNYA 3S2NA 2KX9A 4FX6M 3S2JA 1PVNA 4J3TA 3ZFHA 3RLUA 1R3QA 1UWAA 3U6WA 1B9ZA 2DDXA 3RX2A 4KWVA 2BHZA 2E8ZA 2PD9A 2R1MA 2R14A 4UFIA 2ZIDA 5FEXA 2HNHA 1EHNA 4H9UA 3I6TA 3S1VA 3CH9A 1ADDA 2PCEA 5I09A 3BLOA 4XZWA 1UWIA 2PDGA 1B3WA 3OEXA 2Z1WA 1W31A 3RDKA 4HNNA 2DSKA 2OZ0A 2V0TA 3H2EA 4H04A 4TUFA 4KETA 3U3HA 4J27A 2HXTA 3P5YA 3CUJA 4ZB2A 5AB3A 1I2OA 1YRRA 4ORIA 3TR9A 5CBJA 3UZ5A 4GUFA 2OYKA 3S9ZA 4MUZA 1VAHA 3NXLA 4JIIX 4LUTB 1P7TA 4DBDA 4IPJA 2J6XA 3PPHA 3VM7A 3L4VA 4LC8A 2D1ZA 3TTYA 2XFWA 2A1YA 1RLCL 4GI9A 3QV7A 1SVDA 1J8VA 2XVPA 3UGVA 3UCQA 2XPKA 1HJUA 4UFJA 1VHCA 1PPIA 3WO8A 4RKAA 1UZDA 3BG5A 4GPNA 3CUXA 4QIUA 3GE7A 4JTFA 4O1EA 2VVNA 3WJXA 4O1AA 4QE4A 1ZCOA 2WPBA 4HMCA 3UETA 4WF7A 1D3GA 2NSXA 2VL4A 3IAQA 3WQCA 4GJIA 3STEA 3H2FA 1FTXA 4GX8A 3CEPA 4X3ZA 4A29A 2OKOA 3ARUA 2P76A 4UTLA 4HMEA 1SO5A 1K8YA 1E9YB 4AG0A 4GFSA 4N42A 2PTXA 1TIWA 3RIKA 3CYVA 1ITUA 1NOUA 1VGAA 4PCSA 3GDTA 1YTKA 4U4MA 2CLIA 2KZHA 4ADTA 3C2YA 1OCJA 3UY7A 3AICA 1Q13A 2RDWA 2XN2A 4O14A 3W1UA 1EDQA 1TWDA 2VELA 2G4JA 3HBLA 1TR9A 2DW6A 4LWWA 4DXKA 1VH7A 2IPWA 3LCFA 3HPFA 3GR7A 3VDGA 1CI1A 1F6PA 2XDFA 1VQTA 1VLWA 2ACSA 5CZ0A 2BGSA 3EKLA 3S3GA 2A3HA 3BXWA 3O15A 5I00A 3KWXA 2C1GA 4ZO8A 4A35A 1XG4A 5J5RA 1XIFA 1W2VA 1JAEA 3MHFA 3RRAA 1P6WA 1AH3A 1J0KA 2Z1VA 2RFGA 3EX6A 3UXDA 3C5QA 3AIRA 1O5RA 3SCRA 2ALDA 1YDYA 4BCEA 3VDCA 2VQUA 5K9DA 2WVSA 4LW7A 4NP7A 1V79A 1XWYA 3SN1A 4I6VA 1KBIA 3ITXA 2CBUA 2X16A 4UTTC 3VIPA 4IP7A 2GYIA 2YDSA 3EPNA 4JQAA 3NURA 4Q8NA 2WC4A 3PG9A 3FAWA 1A53A 1YYAA 3GW0A 4WXYA 4HOWA 1O12A 4RLIA 3AQUA 3EXRA 1W1ZA 2E0PA 2Z25A 2ZUUA 3VNIA 5A8QA 4WLCA 2WHJA 4Q8VA 2VGFA 3URNA 3UWZA 1CX9A 4F0KA 1YDOA 4R5EA 2WZHA 3W73A 3TYEA 2EGZA 3VE7A 3Q2DA 2E6YA 4O53A 1F73A 1LCOA 3W71A 4B2DD 3K13A 4O57A 1ZQ5A 5DBUA 5F4XA 3AWOA 1XLLA 1OFQA 1X96A 1A47A 2DZAA 2WMJA 3E2VA 2YOCA 2OX1A 2WNWA 4DI9A 4GK8A 3DGBA 1HKJA 4GUHA 3U7VA 3E12A 4ZMGA 3ZT7A 5I77A 1W9VA 2X0SA 4FI4A 1EJRC 3MP3A 3VTRA 2PGFA 4YMZA 2ZUNA 4H9YA 1A5SA 3VDHA 2J75A 1SZEA 1GZ1A 4M7TA 3NZ1A 1GVQA 5A2CA 1K1DA 4A21A 1M1BA 3GIYA 3THCA 3HA1A 1E1FA 4NZ5A 4DXXA 3CLMA 3TXVA 3KBJA 4UTJA 4US5A 2FTWA 1DYSA 4PRRA 4KGLA 1JPIA 3FNDA 3N2CA 3UNDA 3SGUA 1Y5WA 4NF7A 4DNMA 3M44A 5DANA 2YZ5A 4E38A 4TU1A 4PCPA 7XIMA 3U5UA 5HDRA 4RZ4A 4J2MA 3DGRA 2D0FA 4JBRA 5XINA 1K7EA 3CHFA 3QJAA 5A5WA 4NYYA 4WOZA 3WLJA 3T0CA 3IRSA 3EDFA 1EXBA 2Y8UA 2YSWA 4CQ8A 5G4EA 3TH6A 4F0HA 4LC6A 2VP8A 1JYNA 3ZOAA 2W79A 1B57A 1UR9A 3J7HA 1GQKA 4G9PA 2V6AA 1RBAA 3UGRA 2BG5A 2V5LA 1TMLA 2YW4A 5I24A 1BAGA 5BRQA 3UG5A 2PDKA 3B0VC 2GUYA 3VX1A 2WOQA 4DJDD 1C91A 3INPA 4OBSA 3MBDA 2QDHA 3FKRA 4RE4A 5LNVA 2NUWA 5RUBA 3TONA 3G0UA 4C6LA 4JHOA 1S5MA 1KGXA 3IJ7A 1IQ8A 3M5ZA 4Z42C 2R1KA 1DWGM 3ELFA 5BROA 3RJXA 5CBIA 2WC7A 3GDBA 5XIAA 2NQJA 4GWEA 3DIPA 1XKYA 4DWSD 3QPEA 3HIJA 1KM2A 1UD4A 1PZ1A 3GDMA 4M24A 3W86A 1TJ0A 2XN1A 3R2GA 3N3MA 1W5PA 1UWSA 4JTLA 1QPQA 1GT8A 2QJHA 4GXWA 4S3BA 1CGUA 1UROA 4UC5A 1RPXA 4V33A 3AXIA 1PIIA 1CEOA 3BGJA 1UP0A 2UY2A 2BASA 1JD9A 1B5TA 5DXXA 1FWNA 2J74A 3KVJA 7REQB 2NVDA 4DJFC 2E6AA 5KTLA 2I5GA 3TJXA 1EEXA 3G1DA 3THAA 3VUPA 3VDAA 4OV4A 1C9DA 3L7RA 1PO9A 1JULA 4RW3A 3WEMA 4ADUA 3BMWA 4JTDA 1HIZA 4YPJA 3U2ZA 3KOZA 4QSHA 4DF2A 3VD9A 4K36A 5HOSA 8XIAA 5BU6A 2V67A 2V2HA 1XDMA 3PNZA 3UXAA 3ZVIA 4UOZA 4J5NA 4M8UA 1QOXA 2E40A 4IGMA 3IJ9A 2J66A 2QLYA 1ODZA 2VCBA 4XZNX 2F84A 2KAUC 2NX3A 4DRSA 1IXQA 2CEQA 2R1PA 5LHFA 4HCDA 1PDZA 3QVQA 2BY0A 3I7RA 5DCEA 2VEFA 4NL1A 5DMLA 5HXMA 4CCDA 3RF9A 3CU2A 5BU9A 2PU1A 3EOUA 4WJ8A 1XQKA 2C71A 2ZA3A 2VEPA 3CK5A 2ON3A 4LBSA 3KBMA 3QZAA 3U9IA 2XGZA 2EHHA 3PVFA 4ZGYA 1U1HA 2Q8ZA 2ZRUA 3T0BA 1EA9C 2I5IA 1OHLA 1Z69A 1Q6EA 4BHYA 3WLKX 3FA4A 1GYLA 2X7WA 3ZQ9A 1GTHA 1H7WA 1H49A 2OO6A 5TIMA 4AIBA 2QUNA 3BMVA 1XICA 2C1IA 4FEZA 3CZEA 4QDWA 4HNCA 1MW1A 4HYVA 5G2HA 1JZ6A 1OF8A 2PDMA 2YFOA 1W3JA 3CPGA 3CMJA 1OGGA 3RRXA 4MNKA 4Q8OA 1MEHA 3PJTA 3TJLA 4K2SA 2GUBA 4P7OA 3CJPA 3H4GA 4BJHA 2WK2A 1WXZA 5TBOA 3KZPA 3MV01 3VIJA 1GYNA 9XIMA 4JKMA 5D32A 4FXSA 3T42A 1ML1A 3VVGA 2Y89A 3E0IA 2VR2A 3F4CA 4HHLA 3T55A 4LUTA 3W1AA 5A3HA 3WX7A 1JNDA 4DHGA 2W67A 2PTZA 1MFVA 2ZTKA 3VKBA 4AC7C 3VOFA 2WNNA 3PP7A 3WLHA 4RNFA 4CNPA 5LXEA 4XVDA 5F2GA 1XBVA 4MB1A 5J8LA 1KM1A 3L68A 2IQDA 2WJFA 4TV5A 2D22A 1ICQA 1OC5A 2BVWA 4KEVA 5A6BD 4OUEA 3TP4A 1J10A 2A5HA 2A3LA 4P7NA 1T8QA 2CCRA 1TG7A 1DE5A 3UERA 3B3DA 2NUYA 3G1SA 3S9IA 2VZUA 3REQA 1NIUA 4WDUA 1UD6A 3WFAA 3AXKA 2FB2A 4GLEA 4LYKA 3VMNA 5KZDA 3TLLA 3B9EA 3QYSA 4I9MA 1F07A 3IUIA 1D2KA 4O1DA 4RW5A 3N4AA 2ZRYA 1RUSA 4N9CA 1W9PA 1G5AA 5C55A 5IFPA 1TELA 3BANA 1VYSX 1UYQA 4KS0A 4UWMA 1X6LA 2NWSA 4KPLA 4PMJA 3OU8A 2A3BA 5AOUA 4OECA 1KTNA 4IX2A 3QV9A 4Q8WA 1WKFA 2A3EA 2F8QA 3Q4DA 2VMFA 3WD3A 3T1GA 3BUVA 5EU9A 3P61A 3KL5A 3TEVA 3KCJA 4GQ0A 4Z2GA 1WUFA 3JUGA 4UCFA 1GPWA 3R6IA 1YW1A 4B5WA 3SURA 3H2MA 3PB2A 3N6HA 4FXRA 3DG3A 3L5AA 3HG4A 3W72A 4L1WA 1O5KA 2OB3A 2FHBA 1ZY9A 4YYFA 4QE1A 3LZ5A 1PKLA 4CQ9A 3VNLA 2ZZ1A 2PP0A 4OKDA 1A0EA 4RXGA 1X97A 1NDVA 3GNRA 3LENA 2Y5JA 1OX6A 1Q7ZA 4TTGA 3H8AA 2D69A 1NEYA 2V5JA 2CPUA 3M16A 4DBUA 5CCZA 4HBKA 5F2LA 1FBAA 3FN9A 2VHLA 1W54A 3UVAA 2VFEA 1AFSA 1JZ4A 5FF2A 1XDLA 3V0SA 2IUZA 1V3KA 3LHUA 1T99A 4GYKA 1J5TA 4Q8QA 3GC2A 4QAIA 4O8AA 1VPXA 2NWRA 3ITOA 1YLVA 1RP9A 3DU0A 1CGYA 1J0JA 4TR9A 2HRWA 1I2RA 4LAKA 3NCOA 2Z24A 4AD4A 2XVNA 1U5JA 5T9BG 1O94A 3SCSA 3KXQA 3EZ4A 1G94A 3ABQA 4ICNA 4RE3A 1JCTA 1DIKA 4MY8A 3AU2A 2B0MA 4BWLC 1RD5A 3WLSA 3W25A 4RPQA 4HA1A 1X1ZA 2NX9A 3TSMA 2QMJA 1PAMA 1T41A 3LYEA 4URIA 3W7PA 2IPJA 4YNGA 4D6HA 4Q8UA 5F4WA 1U1JA 4C6QA 1GK8A 3Q58A 4TV6A 5IFTA 2V5CA 1DHKA 3WFLA 2A79A 3MT1A 2QCDA 2WKJA 3G1FA 1FWGC 3N19B 4LUSB 3M0LA 3BAJA 1Q8JA 5DCDA 2G50A 1US3A 3GG8A 3TSDA 1VBRA 2QR6A 5LGZA 1XPGA 5E70A 1V02A 4W5UA 1QRQA 4NUWA 5AHIA 3N2BA 1QOQA 5AECA 2HCVA 2VEGA 1WKEA 4QG9A 4DF0A 1KGUA 5BMWA 2QPXA 3M5XA 1MNSA 5JUVA 2HSAA 3NAVA 3BH4A 3ZT6A 4HU4A 2J27A 3DAQA 1IEXA 1E9LA 1UKSA 1EC8A 3B05A 3WLPA 3VKCA 1IT7A 4XD3A 2ZXQA 4Q8TA 1R86A 3WK3A 4BI6A 1DHPA 1K8CA 1BWKA 1H11A 3LUTA 1GOQA 1JCJA 3GY1A 1IF2A 1HL8A 1B30A 3D3FA 5LIUX 2NUXA 5T91A 3HQNA 1JI1A 4XQ6A 1TV7A 3M0HA 1G69A 3ME3A 3LCLA 3NM3A 2A3AA 3NA8A 1NF0A 1BWVA 3TN4A 1YE6A 4IQEA 3A9IA 2D73A 4RUBA 2HBXA 3THUA 2AL1A 1K9EA 3F4WA 3EMCA 3PZ9A 3OLEA 4MMWA 4FLQA 3VGEA 3ONCA 4D71A 2R9RA 3R89A 4IXXA 4Y96A 4EPKA 4TQTA 3AZRA 1R9XA 3BGAA 3FGCA 3WJYA 2ZFAA 4US6A 3RU6A 2WHMA 2C8NA 2DZBA 2QUUA 3LN3A 2RDXA 4W5ZA 4LS0A 5J5DA 2ZC8A 4ZEPA 1R3WA 1ISWA 5D33A 2E9LA 1G9HA 1V6XA 4PTVA 1YEYA 3RK8A 4AF0A 1CIUA 1HVQA 1UA7A 2TPSA 1X8CA 1A5MC 1EC7A 3H7UA 3N15A 2EBNA 4WDTA 1AQ0A 3AXMA 3QTPA 4KRTA 2I1OA 1H51A 3R5EA 1KLZA 3N17A 1K4HA 4LUYA 4ALDA 4Q8MA 1EJWC 2DP3A 1QI4A 1THFD 3BICA 1XUZA 1UP2A 3ARRA 1FUYA 3TDFA 3UZYA 2PGRA 2X2YA 4BQ5A 4XAGA 1ZS2A 2BB0A 1E9ZB 4NI3A 5CEWA 3N2OA 4C6PA 1C8XA 8CGTA 2GVYA 4Q7NA 5M1TA 4LVAA 4HNUA 4PUUA 1EX5A 1VC4A 2EPMX 1K7XA 2P53A 2VKZG 1C8QA 1H2JA 1NWSA 4HHPA 1F4AA 1KBJA 4RL3A 1G4PA 4ZOEA 4LVFA 4JFWA 1MNZA 3RM4A 4UTHA 1SPQA 3K4DA 3TYBA 5TQLA 4X0NA 2ASHA 2VCAA 4LY4A 3UR5A 4ZFCA 1A5BA 1SYTA 2WKGA 5D30A 1TO3A 1PDYA 3N6JA 1KM5A 4UMBA 3NNTA 3PPGA 4I7WA 1F76A 1W5QA 4FPSA 3AJ7A 2VC9A 1VFFA 1VFTA 4INFA 5I3KA 2PPGA 3RLGA 4NHVA 3COTA 1NDZA 3MW7A 5E5CA 2B7OA 1B4KA 4E2VA 4ZTYA 1ITXA 4HYRA 1ZSXA 1ZZMA 1K7FA 5FEPA 4HA3A 3H4XA 3PM6A 4HPNA 4IOTA 2R1LA 3U2CA 3BAXA 3ALGA 3TROA 3C8NA 4E4UA 1JZ3A 1DWFM 4Y7EA 1HKVA 1H62A 2RDTA 3LNPA 4ZTXA 1I45A 3NJ3A 1LWHA 2MNRA 4S3AA 3LCWA 3L67A 3R94A 4B9ZA 5IDZA 2G5WA 1MRAA 3BL3A 1LTDA 1W9BM 5HNTA 2XZ7A 3UYIA 1XG3A 1KKOA 1TYGA 1FP8A 4S2CA 2IKJA 1AH4A 2A0NA 4GQBA 1XLEA 2HROA 1YNYA 4R27A 1CDGA 5EMUA 2FFIA 1WBHA 3EDEA 2CBJA 3TKFA 2HK1A 5H8PA 3UFYA 3QEZA 4JTSA 4J3SA 5I3HA 3UWVA 3LHTA 5CC3A 2R1NA 1JXJA 3N6QA 4U33A 2E9BA 2V68A 3WLLA 3TW6A 2QCMA 3UZWA 3ABOA 3W75A 5AYYA 5CPLA 3WH6A 3GTXA 5I78A 2DSZA 4JL1A 2HBVA 4HN4A 3SRHA 4AD0A 1XGZA 2V5BA 1NM9A 4U3CA 1XX1A 2XH2A 2XWEA 5AN7A 2YR1A 3UT0A 1FWRA 1E73M 1QWKA 2RHGA 4HT3A 3B0UX 5HUOA 3MVIA 5BW6A 3OVPA 2BXYA 4IJCA 3C52A 4PMQA 3T4CA 3WD1A 3TC3A 2DZUA 3C2RA 1VIZA 2OT0A 4DO6A 1JJKA 3AUJA 3QHMA 1J12A 4DBEA 5ECVA 4P7RA 4XAPA 3P2VA 1PL9A 3H22A 4ZBCA 2BY2A 3E2QA 2VZOA 3VMPA 1XYAA 2W92A 3OVQA 4LSBA 3C0QA 4KQNA 1E4IA 3E0WA 5GNYA 4BI7A 1TVPA 2PBOA 3PTQA 4QCEA 2VVSA 3WF0A 4NNBA 2BXVA 1UH2A 2EAWA 3VX0A 3TAKA 4U3AA 4DAFA 1V0KA 1QW7A 2VTFA 2AKZA 1R3VA 3O1NA 3DHFA 4MAZA 2GWGA 3ARZA 1UWRA 2JGQA 5L6UA 4CKQA 2XWDA 2QMKA 1EQPA 1YPFA 3CZKA 4MWAD 3EB4A 3FA5A 5C0QA 1RVKA 5GQBA 4OU1A 1XC6A 3VGBA 4BF9A 3L4TA 4HZMA 2VRKA 1XLMA 3LV6A 2Z2UA 3G1AA 4JQ3A 3TAOA 2OOFA 1WDWA 3VNKA 3MMUA 4D6DA 3LB0A 3BSMA 3MUCA 4PMOA 4YVPA 1H1ZA 5EYWA 1VBJA 1H1NA 5K4ZA 3VFLA 1J01A 3UJSA 3C56A 3BWWA 2J7CA 2PA6A 4M0XA 2PAJA 2YKKA 3UG8A 4B5UA 3PZGA 3CQJA 3WDIA 2FZBA 4HPGA 4D6CA 4F40A 2V30A 1MO0A 3RCMA 1P0EA 2E67A 3N4EA 2WLYA 4P8XA 4QG6A 1YADA 2BV9A 1AK5A 4L7ZA 1EL3A 5AYBA 2GUUA 3QXBA 4YVXA 4M6QA 4ZE5A 5D38A 2OSYA 2WBKA 3UJEA 5LIYX 3GUWA 4HN8A 2CLEA 1PTGA 2OWXA 1H1YA 3AS2A 3W00A 3P0WA 3EOLA 5JVLA 3GW3A 3KLLA 3T8QA 5IM51 3NPUA 3URBA 3N73A 1L9WA 1QATA 3AOFA 3OQEA 1QK2A 3S46A 2O9RA 4CNUA 2XFYA 1OZMA 2WQDA 1QAPA 2XH4A 4PBGA 3LEPA 4MWAE 4OOUA 1JZ7A 2WJEA 1R7OA 2GGHA 3TTQA 3K4AA 3PBWA 4PFHA 5JIWA 1ONRA 4NZ1A 5K2ZA 4KEZA 3W29A 1VBGA 3PBYA 2QVHA 4NX5A 4CVUA 2VQTA 2WMIB 5K9CA 3WNLA 3NWRA 4HPXA 4DJEA 4L4PA 3PUOA 3MI6A 3UESA 2WXDM 3UJFA 5AYXA 5HUPA 3AIQA 3RUBL 1S46A 2OCZA 3FS2A 1G1YA 3DKJA 1QHOA 2HXUA 4QDMA 3VZXA 4MB4A 3EEZA 3P8IA 1KFEA 2EPLX 3TZNA 1E72M 3EX1A 5F2MA 1JG9A 4LAMA 2NQZA 2YZRA 2ZUMA 2P3EA 1JDCA 5DXYA 1L2UA 3S2LA 3BOFA 2DZSA 3URQA 1NU5A 3MWCA 4QJ1A 5IBXC 1MWOA 3SCQA 2X0YA 3DFOA 3ITVA 3VIFA 3LZ3A 3LMZA 3MO7A 1U30A 4NAEA 2QCGA 4Y9OA 1Q6GA 3II1A 5CQ1A 3S9YA 1UUQA 1UOZA 3R12A 1P1XA 3TQ0A 3LCHA 1LT7A 1HX0A 2ZUWA 1HG3A 4W87A 4AIEA 5JH2A 1J18A 4QAWA 1XDJA 2GJNA 1VR6A 1XSIA 1TE1A 1IT8A 4YVVA 1KM3A 3CUZA 3I10A 1OD0A 4PA8A 1BXCA 2VDHA 2Z2BA 2P3ZA 3RHGA 4QISA 1AL7A 5E09A 4AAJA 1QVBA 2QUTA 1BKHA 2INZA 1WZKA 1UKOA 5H2ZA 2PTDA 3OYXA 5JIPA 4O12A 3GU9A 4N4PA 3DFTA 4AX6A 2FGLA 3CIXA 3UR2A 3FXGA 1AW1A 3LG3A 4MGGA 3W7LA 4HHMA 3WENA 2ACUA 3BLLA 2QHAA 4V27A 2C16A 1CXLA 3A4WA 2VFHA 2BSLA 2Y7GA 1UP3A 2Z29A 3VNYA 3STFA 2CETA 4CD5A 4PMVA 4UB9A 4Y90A 5A2BA 4RCXA 1YXYA 2Z7GA 5I6SA 4HJWA 3KVLA 2REQB 3DUGA 4OUIA 3TE9A 1CLXA 3GC4A 3Q67A 2AQVA 5G2WA 1GUVA 3EMQA 1IIGA 3UWEA 3GO2A 4QEHA 1J11A 3BZGA 4HNVA 4MHBA 4OWGA 6REQB 9CGTA 1PKYA 1NP2A 2JKAA 4UBPC 1HFBA 1E0XA 3LPOA 3QY8A 2O92A 3BAYA 3Q94A 1H7NA 4JTTA 1JEZA 4GIRA 3CZJA 3GXPA 3ZMRA 4R53A 3S1XA 1CW2A 2WHKA 2ZE3A 3T44A 4AZIA 3NO3A 4H83A 2AAAA 3SUSA 1IEWA 3GXTA 5D05A 2PURA 1RZMA 1R2SA 3A5VA 4LXFA 4JNMA 3UBPC 3C8FA 4C6JA 3R0UA 2BBFA 2C91A 2F6UA 2OXNA 2X0HA 1J0ZA 1KWGA 5HMEA 2I7GA 4NYUA 2PZ0A 3B9AA 3IAPA 3QQ0A 3IARA 1AUSL 4H00A 3O16A 4GKLA 1Q6DA 4IPIA 4GVGA 3VOGA 4GZEA 3V35A 2X30A 1R8LA 2DUAA 4IP5A 2IKGA 3E38A 3LOTA 3LPGA 4LCRA 3N3TA 1HJVA 2OLSA 4JCMA 2JKEA 2JQXA 3VGHA 4C7FA 4LUIA 3HMJG 4N4QA 3MSDA 4JYFA 1OF6A 1F4HA 4AD3A 3HQPA 2GGEA 3F2DA 2PBGA 4JTKA 1US2A 4Q33A 2ZXBA 4D9PA 4O0QA 1BWLA 3AIBA 2QW5A 4GZIA 5CG7A 1YBQA 3L9CA 4B3KA 5LNWA 1VYPX 4EANA 4JTRA 4MNMA 4AY1A 3ES8A 3CWHA 4S3JA 5CC7A 4OBRA 4N2YA 4LJ3A 2OZTA 4MZ1A 3FK4A 1QI5A 3TQVA 3NQ8A 3UXLA 4AZCB 4PZVA 5C9WA 1F61A 2YL9A 1GVFA 4FR6A 3ECQA 4US5D 1JCYA 4K7VA 3DOPA 1BEUA 3VMOA 3GDRA 2YCLB 3NQFA 5HPOA 1PUDA 1GOKA 5C7VA 2QS8A 3FVMA 1H63A 3SI9A 4L1XA 2ABBA 1KRMA 4R33A 3E0FA 1SFTA 4KEUA 3G3DA 5EMKA 2XYLA 1DKWA 2ZYFA 1PYMA 2PD5A 1O5QA 1PZ3A 4ES4A 2OZ3A 2J25A 3ABZA 2OO0A 4I8YA 3GXFA 1W3IA 1C8VA 4XIMA 2G8ZA 2SFPA 3QPZA 3UNTA 3PWGA 3PAJA 1JZ5A 4F79A 5EKYA 4EWJA 1IZCA 3W2JA 3K2GA 4JY8A 2RJGA 3CMFA 4PCNA 3SB0A 4WIWA 1TRIA 3GQYA 3DN5A 2QPSA 2V3EA 4ZOAA 3WL1A 9XIAA 1W8SA 3IUHA 5CAHA 4IICA 4BY3A 3IPWA 1EJVC 2QV5A 3BG9A 2WWDA 4NZCA 2DZWA 1PWLA 3RILA 2GQ8A 1RCXB 4G56A 4WDXA 1Q7MA 3DFPA 1V3MA 2GZXA 1VEPA 2WZIA 3THDA 4B5XA 2Q02A 1EHAA 1WXYA 2VEKA 1MFUA 4DZHA 3VAVA 2GJPA 4ZO7A 5AHEA 3C0JA 1WB0A 2WC3A 2ZE0A 4CNSA 1H3GA 4ZENA 4LOCA 4DNHA 1HJSA 3BAWA 2FTYA 2FHFA 5CGQA 4O16A 1JCNA 3QKEA 1ME8A 1IEIA 3M7SA 1E70M 2OWWA 3QR3A 4LYPA 2E68A 2HVMA 1C90A 4NX0A 3KWSA 5DO8A 2L5HA 1IGWA 4D8ZA 2Y63A 5LXXA 1EFZA 3HOJA 5SWUA 2PS2A 2VGGA 4EF9A 4Y6GA 1Q7QA 3CQ0A 2POZA 4H8VA 5E0FA 4B4FA 1MVYA 2ISFA 2NT1A 2B4GA 1XM3A 4HMDA 2PDLA 3KRZA 1GEQA 2JEQA 3WYZA 7ODCA 1EH9A 1WZLA 4F0SA 3SSJA 4JTCA 2NQ5A 1XYZA 3R1ZA 5FD0A 1H5YA 5I3JA 1XLIA 2V2CA 3O2LA 1JPMA 1FWHC 3HGOA 2ZA2A 2YB1A 1JUEA 3F1QA 5FJIA 4XUYA 1QI0A 3M6DA 1G7UA 1RY0A 3K1GA 1FWTA 3TC7A 5FCZA 3SDOA 3RMEA 3GM8A 2QZRA 4FZIA 1ALDA 2Y0FA 3OOQA 4TVUA 3QH2A 1SFJA 3S5NA 4O0ZA 3MJMA 1X7IA 1X1OA 4H9VA 3KBNA 3RMJA 1M7PA 1VJZA 3IVTA 3ABSA 3B8SA 3ZLGA 1MXGA 4YU1A 2UWFA 2W6RA 2OQHA 3EKZA 3WNKA 3MDWA 4HU0A 4BR1A 3SCVA 2ZXDA 1NARA 4H7VA 3FJNA 2PDBA 2P88A 1GVRA 2NQLA 4UTWA 1EP1A 4HZ7A 1W3LA 3GRIA 3L2LA 2E77A 3MCOA 3NO1A 4NJGA 3OPSA 3VNZA 4A2SA 4LS2A 1TV4A 1AJ0A 4LUJA 2H9AB 1OK6A 1VS1A 3MKKA 5CPMA 1EEPA 4GHRA 2ZX7A 4PTMA 1UR3M 3EXSA 2CXEA 3DI1A 4G6CA 3S47A 1MUWA 2BGQA 1E1CB 2J24A 1ONXA 2X1RA 2E09A 1TFVA 2ZZ6A 3CWNA 3V36A 1V51A 4N7QA 5DQPA 4IX0A 3GR4A 1HO4A 3UWWA 3FSUA 4GUIA 4H3DA 2QNEA 4JIHA 5BMXA 1I8JA 1PIFA 2JGYA 3QC3A 4G2DA 4MY9A 1UZHA 1BTCA 2PLCA 5KETA 3IGSA 1IXNA 1GORA 3TIMA 1EWEA 3I3DA 2EXOA 1H7XA 2O9PA 3ATYA 2VC6A 3QV8A 2V2DA 4MKSA 1A5UA 5REQB 1TWWA 2WMFA 2C6QA 4F0MA 4H8UA 1Q4WA 1EKOA 2E25A 4ZE4A 3RJYA 4EAYA 2V81A 4ECLA 1XSJA 3OIHA 4JGDA 1S5NA 3R25A 3AISA 3N29A 3SECA 3SCUA 3GVVA 1VPQA 5FOOA 4RNIA 1Q6OA 3R10A 1A49A 2OLHA 4YXGA 3L5MA 1O1ZA 4LVGA 1V6UA 2DY3A 3VIHA 2VRJA 2INFA 1TPUA 2WBGA 2QXWA 1DEDA 4I7UA 4MYAA 1W5OA 1ITQA 5G4WA 1CCWB 7CGTA 5H1WA 3KVMA 2DIKA 3CV1A 3EB3A 4GH1A 3O6YX 2FYMA 1PTAA 3OGRA 1YNQA 2VGIA 2NXGA 3GTNA 1W1PA 5A8OA 4LEFA 5F2IA 4AYSA 3M0KA 3OHIA 3VD5A 4FNQA 4EOUA 3IEBA 3AWNA 2J7EA 2VFFA 4MADA 1AODA 3L2IA 5I23A 4J1OA 4P61A 4JNYA 3NPWA 3W76A 4JYEA 3LLXA 3TC6A 2MUCA 4AIUA 3BURA 3OGVA 1JAKA 5IOBA 1CBGA 4L9YA 3TVAA 4IWWA 2J7DA 5A6KA 1J0YA 3WLRA 4DF1A 4Q4PA 4YCOA 1LL6A 4J9JA 3KM8A 3MCMA 3LA4A 3ZVHB 2PDFA 4K7YA 1XIBA 4GIEA 2DQXA 3QHNA 3U2EA 3F4DA 4FP1A 1K6AA 3VPLA 4E3TA 4Y8EA 4M82A 3WDQA 3AALA 1BQCA 2JBMA 4RZ6A 4ZOBA 3E6EA 3S5SA 1EUAA 2BNJA 3P6LA 2WQPA 3HB9A 2VUYA 4BEQA 3AMGA 3CTTA 4NIRA 4XD4A 2TODA 3AYVA 4PRWA 3TN6A 2IS7A 3KW3A 4RZ5A 3GH4A 3NYZA 3EPMA 3CO4A 5HK4A 4W89A 3R11A 2QCNA 3UZJA 4MJ4A 4NILA 5HMDA 2WCSA 4H6KA 1PZ2A 5A6SA 3CIVA 1LJYA 1AQMA 1AG1O 4AD5A 2VI0A 3DFQA 3G3MA 3LTYA 2D2OA 4Q4QA 4TVCA 3BPWA 1W3HA 5FL0A 1UD8A 3FOKA 5JQ9A 1WDPA 3E02A 5T9CE 2BMBA 1FDZA 4JIRA 1XYLA 3NQEA 2F6KA 1BYCA 2X42A 2YL5A 1CXEA 4PR4A 4H7CA 5F1UA 2F38A 2R82A 3M0VA 3P3BA 4XZBA 4IG2A 3H12A 3PB0A 1CZ1A 3TTSA 2V69A 4R7JA 4GO8A 1C93A 1RHCA 4A05A 2XIOA 4IL2A 3V1HA 1TB3A 1P6BA 3W7OA 1BQGA 2I9EA 2ZZ4A 3BQ6A 1HTIA 3W6LA 1SGJA 4HA0A 1DL3A 3VC6A 1TE6A 1Q4NX 3N34A 2VGBA 4CVWA 3UCDA 3UYCA 2E28A 1TV8A 4A8LA 3QW3A 4BZYA 3W1QA 2P1FA 4QJ5B 2GJXB 3IJ6A 4GNKB 2DVXA 1JL8A 4FALA 2A2IA 1WDRA 4HQVA 2NVAA 2WWCA 1KFKA 2OJPA 4IMAA 3LU2A 1X1NA 4F8XA 1QK0A 4D8LA 4XX6A 2OKTA 2YCLA 1BG4A 2J7BA 4IIGA 1EIXA 3I4EA 2BLEA 2NQ9A 4S23A 1UWTA 3GG7A 2VOTA 5I2UA 3S5OA 1H60A 3C2FA 3TWBA 1ZJBA 1WUEA 3F2BA 2PSNA 4FLOA 4PB4A 3ABRA 2DSVA 2GJRA 3SCTA 3DHDA 1KQYA 1B9BA 1KFCA 3VIIA 3NO5A 3FJ4A 1NWTA 1KRAC 1OFRA 4K8HA 2QDDA 1GG0A 3GZAA 1XJBA 3ITTA 2FVMA 1U83A 3SCPA 3L0NA 1JD7A 1SZGA 3FEMA 2Q3RA 1U5VA 1N8IA 1DVJA 2H90A 1VYRA 1OZQA 2D2JA 1A50A 4KKXA 1EBHA 3G6MA 3N25A 1XQLA 3WQ8A 3L4ZA 4ZZ9A 3OZMA 1YIXA 2YBTA 3WJWA 1XGDA 4AEFA 1FWEC 4UTFA 2FGBA 3DFNA 1ITCA 1DTNA 3LD5A 1D7FA 4PGLA 1Q2RA 1F3EA 1N82A 1ZBWA 4RV3A 2F2HA 1US0A 4CD4A 4GFIA 3W1PA 4BS0A 4L6HA 3AU6A 2E3ZA 1AJZA 3WMLA 1V02E 1EBGA 5BOEA 1P1MA 2GGJA 1Q65A 3NZRA 3V0UA 4C5YA 4EAMA 4Q7IA 4R88A 1JDFA 4DWSB 3U8GA 4D1JA 1CNVA 3A9BA 5DN1A 2Y61A 3CXOA 4AHPA 2D20A 1SZNA 3SRFA 2PLJA 2DUZA 4K8EA 1XCFA 4DUXA 3CASA 3TW9A 5AZ1A 4F9DA 1Z32X 3RU8X 1LF1A 2B7QA 3IGXA 1KTCA 3P81A 4OJYA 2H3DA 1ECQA 1BRLB 4PUWA 3NL2A 4LNCA 3TYCA 1E51A 2INEA 2V5KA 3EWCA 3USBA 5A94A 3GSMA 2HDJA 3U48A 4QFUA 3LGGA 3GG1A 2P8BA 4HU3A 4WD0A 4WDWA 1GOMA 2V3GA 2DPEA 4GGHA 2CW6A 6A3HA 4GX9A 3NL3A 1YHTA 2A21A 4JS3A 1RP8A 4IGHA 3EAUA 3MS8A 1IZJA 1L8PA 3B8IA 2G3IA 4AW7A 4MZYA 3NDOA 3W02A 1J0IA 4JAWA 1F6KA 3YPIA 3P8JA 4C7DA 5LIXX 3R4IA 1BGGA 2YXOA 1C3FA 1X98A 5ECUA 4FSAA 3VKDA 1HKKA 1R46A 2QUVA 1IWAA 1E3XA 1QNRA 1W9DM 4GJJA 1KXTA 1QO2A 3AMDA 2YW3A 1DJGA 4ZR8A 2QULA 1Z6KA 4DBSA 1UH4A 2Y4SA 1CT5A 3O0FA 3L21A 3NYDA 2OVLA 1V3JA 4JDYA 4GI8A 5AHLA 1EGZA 4O1CA 5FL1A 2BXZA 4XTIA 5ABFB 1YXCA 3MUZ1 2VC7A 5AC5A 3PHAA 1OX5A 4EPEC 3P14A 3PBVA 3N11A 4WRHA 4D6IA 2WHLA 1W91A 4DAIA 3DESA 4HP5A 1UKQA 3FFSA 4WK9A 1H61A 1H0IA 3B9OA 2HMCA 2Q6ZA 1CXIA 4LGXA 1L6YA 2PC4A 4DJDC 1DJQA 2VO5A 3G8RA 4HVXA 3OA3A 1XC4A 3FYYA 1E6NA 4M6VA 2D24A 2ONEA 4PTXA 3NOEA 5HMSA 3HPSA 2QDGA 1G6CA 2XIQA 4PUMA 2VX7A 5C5YA 3W28A 3APTA 4LTSA 2PLMA 5I02A 1R9ZA 1I1XA 4DWSC 1QI3A 2WVVB 1TREA 1RD6A 2PDYA 3L4YA 1HN1A 4HSNA 3W23A 3HFYA 4MVAA 3WN6A 4JHZA 4Q3MA 4FLRA 2J47A 4UIOA 1CB2A 5BCAA 3LHWA 4KCTA 2AQOA 1VFOA 1IGSA 1KM4A 3MYOA 1DBTA 3H2CA 3W1TA 1EO5A 4E5TA 3UVIA 2IMRA 4WUIA 3QM3A 2VURA 2QIIA 3KUMA 5CPOA 5CPNA 4AWSA 3W7HA 2OEJA 4HNTA 5A6AA 4LPCA 3VI2A 1ESWA 1KB3A 2OMAA 1W9XA 4UR7A 1MZHA 1TWSA 2IW0A 4B3LA 2BY3A 3K4WA 3HPAA 4ZB0A 4HJFA 1EZWA 4IMGA 3TOPA 1WA3A 3VOIA 3LQGA 4S3GA 2GDVA 3AYTA 3MO4A 4PC8A 4R7WA 5MF5A 2PDXA 2HWGA 3KX6A 3G1YA 3BV7A 3T2OA 3EDJA 1TPDA 4G7FA 3NZPA 2WVTA 1V0NA 5HWJA 3VDBA 4HK6A 4FNUA 2AOSA 4PN2A 1IXOA 3GBEA 1YPIA 3UCCA 3BJSA 3WQFA 2A4AA 3U2OA 1TX0A 5A8MA 3OA5A 5KZMA 1XHGA 2W61A 1EQCA 1YE4A 2O9TA 1ISZA 1GYMA 1CLVA 5KINA 1QHZA 3K8MA 1GVEA 3NG3A 3AHZA 1A5AA 3TCSA 2YX0A 4F2TA 1F3XA 5T8GA 1GGOA 3TJ4A 3BSGA 3GDKA 3TA9A 4N9DA 1FWIC 3I68A 1PBGA 3M0ZA 2R24A 1UD2A 4RDVA 1K02A 2PEVA 2GSHA 4FMVA 3UWUA 3UPMA 1QCWA 3IJLA 2YL6A 1LUCB 4Z0JA 4YWSA 3KP1A 4Y2WA 1P4CA 3EXTA 1F6YA 3W0KA 4DQWA 2BTMA 2YDAA 3SCWA 1TA3B 2QAFA 3EDKA 5DRCA 2DJLA 1VFMA 2BS9A 2XN0A 3CQIA 4CNTA 1WDSA 2ESCA 1A5CA 2OGYA 3WQDA 5KITA 5D4YA 3QRHA 2DFAA 2QGHA 3SJ3A 4JX4A 5BRPA 1GJWA 3WF3A 1IT0A 4QLLA 3LHYA 4EPBC 4DN1A 3STPA 4IFKB 1HVXA 2C79A 2YIHA 1PS9A 4DX3A 7TIMA 4D72A 4B2DA 4QGCA 2DT1A 4B9YA 3LDVA 4CQBA 2Q01A 4H4IA 1P0KA 1UUOA 4F0LA 3NDZA 2E5BA 3V16A 3CTLA 3MZNA 2ZC1A 1TPB1 4GOAA 4EACA 1H41A 1V5XA 4WY0F 3L23A 5CSUA 1XP3A 1GOWA 1SJDA 1JGMA 3MWAA 1QBBA 4S38A 3TMLA 4Y9NA 3PZVA 4KF1A 3ITYA 2CLPA 3L0GA 4KWOA 4UFLA 5A2AA 1W1TA 4AZ6A 2AQWA 2J62A 1BTMA 4AVOA 2ZUTA 4DJED 3WUFA 1D3HA 2VUNA 2ZX9A 2CZDA 3MA8A 2FZ8A 4C7GA 2JEPA 3GS6A 3SFKA 1V3LA 2FPTA 4FNSA 3UWQA 4CU6A 5AHFA 3TYAA 2AL2A 5JH1A 2XIMA 3CUHA 5M17A 3THQA 2HVOA 3OG2A 4MKNA 4RDYA 4JQ1A 4QQ3A 5FSEC 4AIOA 5DBTA 1DQXA 1J5SA 1XFBA 2YLLA 1KR1A 1E0VA 2PWGA 1UUMA 4BF5A 4CD8A 4UQAA 1MQPA 4DJDA 4D6FA 1XIGA 1HKIA 1GVSA 3KOYA 3ICJA 4XZMX 3B8DA 2YYTA 1GVYA 1UZ1A 1XV8A 3MSGA 1DWAM 1UQZA 2WM1A 2PE4A 1XLGA 3CPRA 2E1DA 2C1HA 1JNEA 4J40A 4K38A 3UG3A 2ALRA 3G8EA 1I4NA 3HTWA 3KE0A 2RGLA 4PUJA 3APYA 3L4UA 4XKYA 2YDQA 1HW6A 2VR5A 2ZZ2A 5C9XA 3ORWA 3SZ8A 1KO0A 3SQLA 1AJ2A 1UWQA 2QUMA 3QGKC 4DIAA 1OCNA 1MW3A 1CYGA 3VCCA 4EXAA 1AZ2A 4AVNA 3N1AA 2Y24A 2O9OA 3R7MA 4EVZA 1PEZA 3GC5A 3BO9A 2Q8LA 4RK8A 2GVLA 4AFYA 3HQOA 3TQPA 4EIVA 6TAAA 3VO0A 1PHWA 5B80A 5AVNA 3KEHA 1RXOB 2W66A 2GSJA 5LKYA 1XYMA 2EPOA 4L65A 4CN4A 3CL6A 3NSMA 3LBOA 4MDPA 2GFTA 4DYJA 3O6DA 3PC0A 4UR8A 1BFNA 1FXQA 3BE7A 3MUIA 2DT3A 3WEZA 2CYGA 4WGHA 2XSAA 3WUGA 1W8GA 5A6MA 5M2FX 4JN6A 1CPUA 4ILSA 5I06A 4S3FA 3POHA 1RBOB 5HQMA 1K3UA 1IIHA 3SN4A 2VX5A 1OINA 4PB5A 4I7VA 4HCHA 3UR8A 5MKGA 1BF2A 1LROA 5HBFA 2UY4A 4W88A 1WE5A 1TQXA 3KDOA 1PJ9A 3IVUA 4O11A 3TOYA 5LSMA 5FESA 2QKFA 4Q4RA 2BVTA 4LAOA 2WANA 3HGSA 3LPPA 1VBUA 3URAA 4I5RA 1KKRA 3A5FA 2XISA 4LAUA 1DQUA 2IXUA 1X8FA 1TIMA 3VNMA 1E4MM 3M46A 2CKSA 4ML4A 2PRHA 4H41A 3ITGA 4B92A 2DZXA 1BYAA 2NLYA 3V3WA 4QM1A 3VZZA 5IRPA 2NXIA 1WOAA 4L9ZA 5C9ZA 5TD4A 4NAFA 5AYIA 4KT2A 4IF2A 1ONEA 1YTDA 2PTYA 3AIUA 4XG1A 2WSRA 3P84A 1TV5A 1M68A 2DORA 4X61A 3VGDA 3QMSA 3B8WA 3E9AA 5DCBA 1B31A 1RLDA 1TVNA 3ZR4A 3FYPA 4ZQPA 4M29A 4REQA 3RXZA 3VK5A 3TX9A 4K6AA 1XW8A 1OC7A 2CXGA 4WXZA 3AHYA 2V63A 2VFGA 3WH8A 3V0TA 1BHGA 1J79A 4TO8A 4C65A 2Q09A 4HMNA 1WYIA 2QJJA 4GNJA 4P5UA 2C18A 5C8BB 5GNZA 5A6TC 3GHSA 3OP2A 3BK0A 4YTRA 4Q4OA 4GYPA 2VD9A 3MI2A 3PN8A 2ZX6A 5I3GA 3LGEA 1CWYA 1EF2A 3PZQA 4QS6A 1FH9A 1XKJA 5A6BA 3NIYA 1XLCA 3I7SA 4C5ZA 1GKQA 1Q85A 4R7OA 3VCRA 1K77A 2DV0A 1A3WA 2ACQA 1BYDA 3AMKA 4JDBA 4BF7A 1X38A 3P82A 3CUGA 2GK1A 2PDUA 3DX5A 1UB3A 4XBJA 4CNOA 4UMAA 1J6OA 2YBVA 3SFWA 3R43A 1EP2A 1ZENA 1N55A 4ERAA 3AROA 1K70A 2YLAA 1E3ZA 1BXBA 3VIMA 1Z89A 3MU7A 5EMLA 1M41A 3TXZA 3AFBA 2A6NA 4NVTA 1ZAJA 2G4FA 4GGBA 3UWYA 3S6OA 1GONA 1UPMB 2VFIA 4M5PA 2YCIX 4X0VA 3S4TA 4BQ2A 3AMCA 2ZVIA 3H21A 4XO7A 3W6YA 3CBWA 2H8ZA 2ZBTA 4AWEA 3WLTA 1IYXA 4WGXA 4XAFA 4N0RA 3W7KA 4O1FA 3WZ0E 4CQDA 4QNWA 1XLHA 2C0HA 3FKKA 3L0KA 1FCQA 1E0UA 1PKMA 4I9TA 4Q7BA 2R6OA 4C1NB 1AW5A 5F1VA 3EEGA 3CUIA 1E6SM 2PGWA 4OVXA 2J8GA 4MWAB 1E6RA 1ZBKA 2GVJA 3PUEA 1VLIA 1REQB 4CEUC 2OX4A 1LBMA 3B9NA 4J2PA 4DO5A 3NQ2A 3GNOA 1IV8A 4A8RA 5AKQA 1OM0A 1XH0A 1OVDA 1XLFA 4NJIA 2RJHA 1MQQA 4PB3A 3WNMA 2V8ZA 4QRNA 4AXKA 1Q63A 1YTEA 2LLEA 2FGZA 1Y0EA 4LALA 1YDNA 5CZTA 1HGWA 3SIMA 5K3VA 2X05A 2P0IA 2XH0A 4Q32A 1R2TA 3C3NA 5FJJA 3GVWA 4NJJA 2OG9A 3WD0A 2CZ5A 3W1XA 2J78A 5XIMA 2I56A 1U5HA 4QEEA 2E5CA 4ATDA 1V77A 4HU8A 2PC8A 3BJTA 4PCFA 3Q37A 4AH7A 4L6DA 1S1PA 1HKMA 3UU0A 2CERA 3QGVA 4MOZA 4O8RA 4OV9A 3M0JA 4GD0A 5CZSA 1MW2A 3KRSA 2PU0A 4AWTA 3A4AA 3NSXA 4TTUA 1WNOA 2BOFX 2VJXA 3B4YA 3ZT5A 3NFUA 4WCJA 5JBDA 4W84A 3H55A 1M7OA 2XVGA 2J7GA 4L61A 4Z1BA 5KZEA 3A47A 4XZ9A 1ICPA 1LG2A 4WJEA 2OEKA 4RR4A 2VNCA 3LV5A 4Z2KA 4O52A 3MBFA 3FJLA 2NZLA 2YL8A 1MUCA 4E0CA 3T40A 1PX4A 1JF6A 5AVHA 1XLBA 4IMEA 1W2PA 1HP4A 2OSXA 1WAUA 3P67A 4I9AA 1R47A 2G3FA 3QQWA 3WELA 1UW9A 4UTTA 3OLDA 3T78A 4FO4A 1N8WA 3EA3A 4H6EA 2WNZA 3OVRA 1E71M 3MC5A 4L4OA 1NWRA 3JU2A 4AZHA 1F05A 3GVGA 1CGWA 4J28A 3QPYA 3AHXA 1LRNA 2PFHA 1NELA 4DUOA 3A3XA 3BCDA 2PF8A 3GIPA 5JBEA 4C6EA 3T7VA 3W87A 5GVJA 3R8GA 3WLNA 3PFMA 5D9OA 3L66A 1Z44A 3W07A 2W27A 4ICCX 3W7GA 1NQKA 3T6CA 4GQRA 3GNNA 1OBAA 4MY1A 4QR6A 1JYXA 3SCNA 3MKCA 4LH8A 4MWAC 1A5OC 2WM0A 1VEOA 3H54A 2ZRXA 3IJDA 4MIMA 4KCVA 5F4SA 1P7TB 2YFNA 2FJKA 4GQGA 3NQBA 4XSLA 1TTQA 2AMGA 3GTHA 1Q2SA 4MJMA 1I60A 3LS9A 3PJUA 2PCQA 3AXXA 4DO4A 1J9YA 4JR5A 4GY7A 3CHEA 4XAYA 4RE0A 5K9XA 4CUCA 3FA3A 2XU2A 2DJXA 3RPDA 3VU2A 2ZOXA 1SFSA 3W24A 4CGTA 1XD0A 3SIZA 3UPWA 3B8VA 3W81A 3WQGA 2WO5A 3F5JA 3QZEA 2Y62A 1A3HA 2CIPA 3QFWA 3ONBA 5G4HC 4ERGA 3WF1A 1FDYA 3RX3A 2XFFA 2Z00A 3UXKA 1EYWA 4UXDA 1W1IE 1KCZA 2BWGA 4W9TA 1S1RA 2BFGA 2OLAA 2X1IA 2Y2WA 1DXFA 1YXDA 1BSIA 1W37A 3NZQA 4JYDA 3FJ6A 4R9XA 2GQAA 2H6RA 4D2JA 2ZCGA 4B16A 4W8AA 4QSFA 2J8TA 4LB4A 4A3QA 4LS1A 4QLKA 2R8WA 4JTGA 4NXSA 4PEEA 2VR4A 3EOOA 1B90A 4ZB5A 2HTMA 2YA2A 4V28A 1LDCA 3GAKA 8TIMA 2PDNA 3CHVA 1GEHA 2NVCA 2WMHA 5I03A 1FH8A 3QHOA 3V75A 4AX7A 4F2UA 1ZP4A 3W6MA 3DG6A 3GYEA 4IZGA 4LYQA 3LSCA 3O6CA 4JIPA 3ZWTA 3KHJA 3DEQA 4B15A 4LRTA 4RDWA 3A3WA 2HEJA 1R2RA 3DZ1A 2WW5A 3K8LA 4JTIA 4Y8FA 3W26A 3CWOX 4JNZA 5D09A 1A80A 4L1GA 1DWIM 5C9UA 4HZ6A 1DQWA 4LQ1A 5FEWA 4U2YA 1P6CA 1KV8A 1WDQA 3M7WA 3UJ2A 3G5EA 3VXGA 3QSTA 1R87A 1PX8A 4JFUA 4QCFA 4DLFA 2NT0A 1RK6A 4ZQMA 3NGFA 2EG8A 1WAWA 3CNYA 4ROQA 2J13A 4Z1YA 4ML9A 3IGUA 1CECA 3SY5A 3L4XA 4XKMA 4WSJA 3R8RA 4NZ4A 4IGSA 4IT1A 2J7FA 3W53A 4TXEA 3WK2A 4MPKA 5EFDA 4DJFA 3ARYA 3M9YA 1OG0A 1OYAA 3PNUA 5GJMA 4EP8C 3O7UA 3W2UA 3HO8A 2OOGA 1S2CA 3EOSA 4MTVA 4JKLA 1GVOA 3JW7A 4YCPA 4L5ZA 3RPTA 4L80A 5T26A 4D8AA 3ARXA 4PCTA 3WDRA 1TCDA 4ENLA 3TYUA 3FAXA 3FIGA 3NVTA 2QQ6A 3S5YA 1Y7VA 2A85A 3U4AA 3P5ZA 1JUBA 1QNQA 4EWND 2FH6A 3E49A 1P0NA 3OW1A 2J77A 2ZQ0A 1XRTA 5E1QA 1F3WA 4JIQA 4NRSA 4LT9A 5FF7A 4A8NA 1Z48A 3AAMA 4XK2A 2AGTA 3WSUA 3PBMA 3LXCA 1PB0A 1KCLA 2OR2A 1PZ0A 4DB7A 4MDOA 3W22A 1J2BA 4HB7A 1JI2A 3EWBX 4FXJA 1FHUA 2PWVA 1DOSA 2X1UA 3D47A 4HPHA 3OTRA 2FDSA 3NVDA 3A4JA 3W2KA 1DV7A 3BLFA 4JPGA 4XBSA 4NSBA 3ALFA 3APGA 3OO2A 1V03A 1UCWA 1GW1A 7PTDA 3W7QA 3Q45A 1SSDA 3KFTA 2CLLA 3MYPA 2DU2A 3W7RA 3BMXA 1KFJA 3W27A 5I3IA 2XGIA 3OIXA 1FWAC 1Q45A 4FA3A 4L9XA 5KZ6A 5LGXA 4JTUA 2Y5SA 1K8ZA 1FKWA 3OYZA 3I6EA 4AD2A 7ENLA 3ARWA 4C6MA 3VIOA 2OPJA 5KMYA 2DSWA 2EF9A 1GHSA 4DPPA 2HV5A 3ITLA 4V1XA 2FZDA 3L12A 3S42A 1TV2A 4C6FA 4AYGA 5PTDA 3ANVA 1LOSA 3N2XA 5CXPA 2PDPA 3WUEA 3GZ3A 2JALA 4IXHA 3F2CA 4E2DA 1E4LA 3MCNA 1KV5A 4RPPA 3OLGA 2XGBA 3EWYA 4B5VA 3S1WA 1UKPA 4F9JA 4GIAA 3UR7A 1TPVA 4TX9A 5A6LA 2ZADA 4JQ2A 2D3LA 1Z8AA 2QJGA 2ACRA 4MWAA 4K8GA 3LCIA 3SUUA 4AMAA 3LLFA 3EKGA 3HF3A 1RQEA 5D2WA 1UIOA 3SO7A 1V6VA 2X2GA 2YDRA 2BODX 3S1GA 1XCWA 2W5FA 4LBRA 1SR9A 3CM4A 1HUVA 2ZXAA 2GWNA 2QF8A 3F5LA 5HNRA 5LNRA 3H6OA 3MSYA 3L2MA 3M0IA 3UEQA 7REQA 3XIMA 1P0DA 4WQ6A 1DIDA 1U33A 2CKRA 2UZ9A 4DXVA 4MB5A 3LGDA 1LOQA 3UZXA 2QDEA 3LI0A 3BGGA 2G97A 3VFCA 3N04A 1L8NA 3QFEA 1DWJM 1I1WA 4KRZA 2HVNA 3HPXA 3NQ7A 2PRLA 2XIIA 4PH6A 5F7UA 4FNPA 5EMMA 3UZZA 3SAZA 1FWDC 4UR9A 2QJMA 1N2VA 4J35A 3RO8A 5LNSA 2VRQA 4DUWA 1Y8BA 1WX0A 2E9MA 3OG3A 1SSGA 1ODUA 2PP3A 4TMCA 3IK4A 2BGNE 1R3RA 3IIVA 3W3OA 1TRDA 1VFLA 4YL2A 1C7SA 1Q6QA 4H9TA 3CPUA 2PDCA 4N6EA 4YIWA 5EBAA 1GNXA 3CYJA 1X7FA 1GWJA 3AJXA 2B31A 1NDWA 3SUVA 4OIFA 2RKXA 1EOMA 4HYWA 1V8EA 1ISXA 1MQRA 5G1MA 2OYLA 4PFMA 5D9PA 1IR1A 1FHDA 1FQ0A 4LX4A 1F5ZA 1EJUC 5I3DA 1SU5A 1WQ5A 1TZ9A 3C2OA 3WQEA 1J4EA 3D3AA 3ZJKA 2QCLA 1JPHA 4AXNA 2QJIA 3BCFA 1HJXA 1TZ7A 3SM0A 2OSWA 1KNWA 4TX8A 3L4WA 2WSPA 4JXCA 4A3RA 4JN8A 1MYRA 5EY5A 5DELA 2JF7A 3HFTA 1MZRA 4W8LA 4H1ZA 4EXQA 1OFDA 1VFHA 3SGZA 9RUBA 3IS4A 1XRSA 3CT2A 4DZIA 3H2OA 3KBVA 4KFOA 3IIPA 2EG7A 3PBUA 4CU7A 2PRMA 1C92A 4BWLA 5BYWA 3UP8A 1U1UA 1OADA 1LLZA 2QCFA 4ONVA 3A24A 3GTFA 1Y65A 3VKAA 4RX0A 2RAGA 4WX2A 2QJNA 4P7LA 1RH9A 3SBFA 1X6NA 1XR2A 1MEIA 4O50A 2VWSA 2HQAA 5HR6A 1ZRQA 3P62A 1SMAA 3N9KA 1YDVA 4OGZA 4P8UA 1GPFA 4U28A 4UTKA 2Z1KA 3G1XA 3GWQA 1I0DA 3HJZA 2PTWA 3TYZA 5H8UA 2J6VA 1NSJA 3K1DA 1QPOA 1QNVA 1S2TA 1DJWA 5BXTA 4UNIA 3EWWA 3ZR6A 1GW9A 3BCJA 1VHNA 1RCQA 2YGYA 4IISA 3H24A 2WSKA 1SFLA 3VD4A 2JK2A 3F7JA 2FQIA 1S38A 3WLOA 3WLQA 1RJPA 3C2VA 3REQB 2OTDA 4XZLX 1B3ZA 2C7FA 4G7EB 3MJYA 3PR2A 3W85A 1GOOA 1V3HA 1KTBA 2FVKA 2O55A 3NXFA 4K1GA 1FA2A 1B3XA 4DM1A 1OX4B 1GHRA 1I2NA 4OHQA 2Z28A 1RA0A 5HMFA 1TR1A 4X2RA 4GCXA 2RUSA 3TWAA 1YQ2A 3QF0A 4O15A 2Z2AA 2NX1A 4W8BA 5D03A 1ZHAA 2R91A 3NQMA 5A95A 1ZJAA 3DBPA 2HPIA 1ECEA 4QDPA 2EPHA 3VIGA 2VENA 4CU8A 3UF9A 2OODA 5G5IA 3MI3A 2C14A 2V38A 4OE7A 1POKA 4RJEA 3QSRA 1BYBA 3LHZA 4AWUA 4IHCA 1IXPA 4AZBA 2W9MA 4GYJA 4R34A 1RVGA 4OT7A 1ZU8A 1BD0A 4F4RA 1GKPA 4GO9A 1XI3A 3OQ8A 3IANA 4GMEA 2G3MA 4IJBA 2GLKA 3O9NA 4X9YA 3W74A 4NI8A 4WSKA 3VINA 5FAGA 3W2NA 1KW1A 1KRCC 2OQLA 1QPKA 3RYSA 1XIMA 5EB8A 3B04A 1LLWA 4HSHA 2PDHA 2BY1A 1XLKA 2OELA 2Z0IA 1EB3A 1KR0A 2Y85A 2B81A 3BW3A 1F2JA 2FMNA 3TW7A 5BXPA 4XVEA 5AY7A 2GQ9A 3EGJA 4HK7A 3C86A 2TRSA 5K7JA 1MEWA 5KEZA 4C1KA 3WEOA 1OABA 3LERA 1XLJA 1AD4A 4XISA 4DBWA 1EIBA 3GLCA 1QHPA 1ZPTA 2H8XA 5C7HA 1JYVA 1A4MA 1LM1A 4LUSA 3E74A 1QTWA 2UY3A 4GG9A 3SR7A 1ZJHA 3M5YA 5E6YA 3CV2A 4NXKA 3V1PA 3MP5A 4UOJA 4XTDA 5CZKA 3TJIA 1HF6A 2VFDA 2WAGA 1MDLA 5ABTA 3M1ZA 4B3ZA 2QCDB 3M0MA 3MPGA 3C61A 2ANUA 2X7VA 1FOBA 3ZJ8A 1R5YA 1JDAA 5BZAA 2XSXA 1EO7A 2F61A 4K68A 1KLYA 1F7BA 3S5ZA 5CAKA 3AS0A 1W0MA 3PK7A 2H3BA 2DZTA 1ADSA 1XH2A 1YPXA 1FCVA 2P5NA 3TZFA 3O6AA 4XUGA 5HAOA 4AY7A 4NJKA 1HZYA 4QBXA 2Q8XA 4XZIA 1D8CA 1JPDX 5CLTA 2DT0A 1E5NA 2WB5A 1T6MA 5ABHA 3MZ2A 4ZO6A 1A3XA 1ENUA 3O07A 5E93A 3ARPA 3UW6A 5U7SA 4LRSA 3SY1A 3RGTA 1ZL1A 2ICSA 2ZICA 3EB2A 3LQLA 1GOIA 4GI4A 4MFDA 3JR2A 1DP0A 4JL2A 3FSTA 5CLWA 3BARA 1M65A 4ICMA 5I3FA 1GQJA 1XIJA 4HPJA 1FVPA 4PUNA 1A5NC 1KBKA 4IMDA 1XXXA 4GI6A 3TUUA 3FGCB 3BZJA 3MANA 4ATLA 2ZRZA 1MXDA 3KAOA 2CC0A 1M3UA 3MUAA 3POCA 1MUMA 3WK0A 1WV2A 4IPNB 4BKNA 3NR0A 2D0GA 2EPKX 2PMQA 3MV11 5I79A 4YTTA 3G24A 4LF2A 4AF0B 2I16A 3TNBA 4XAZA 4O18A 1R38A 4Q6XA 4GVHA 1AD1A 1TV3A 5CG0A 3S8HA 2JIWA 3R58A 1E43A 2BVYA 3U5YA 1UQYA 1M53A 3KCOA 4PEKA 4U5IA 1UHVA 4FOUA 1XUUA 3LBCA 1LT8A 4YTSA 1CXKA 2V9DA 5BNKA 1D8WA 2X41A 3A3HA 5C2CA 3OZOA 5H6HA 2WZEA 3CT7A 4QHRA 4RZBA 4CCCA 3B0YA 3AHVA 3OODA 2F9RA 4GINA 1RQHA 4PTWA 1KFWA 3W1LA 1TJPA 5ABEA 2P50A 1QWGA 3WMBA 2I9UA 3DC8A 2IQTA 5H8MA 3VOCA 4YTQA 5I0DA 5K4XA 4ZXOA 3DERA 3ENLA 5IHRA 4HK5A 1OJXA 2ZUSA 5E6ZA 1KCKA 1H09A 5AC6A 4NQ1A 1EJTC 1E15A 1FWSA 4GBUA 5E0CA 3ZJ7A 1KCXA 1XPYA 1LYXA 1GQIA 3ERPA 1JZ8A 3C0LA 2XHYA 4M19A 5AC7A 4HOZA 3NQDA 4OZOA 2WJZA 3TQKA 3W82A 3CO8A 3MMTA 5CZJA 4C60A 1A5KC 4CQAA 1T0OA 1UR4A 2FLIA 3I3BA 1EZ2A 1O1HA 2VZSA 3OZYA 2DZVA 4AB4A 5KSWA 5LYRA 2FPVA 5G1TA 4NU7A 1ICSA 1XCXA 1V7YA 2J9YA 4XIAA 5H91A 4HTYA 3CGTA 4RXFA 3CZLA 1FP9A 4JQ4A 3P0XA 1UJPA 4HTBA 4IIFA 4LANA 4Q4MA 3FV9A 1G7VA 4OFCA 1PXGA 1VZWA 1V0LA 5BXSA 2OU4A 4JIEA 3CHCA 4NNCA 4UQDA 3R13A 3P60A 1HQTA 2WLZA 3B40A 1JR1A 3A13A 1JIBA 4AVFA 1PHQA 4ADSA 4Z1CA 2EEXA 4JCLA 3WBAA 3CC1A 4R85A 1Q6RA 3OLIA 1NAL1 3FDGA 3V4BA 1SO4A 1OGSA 6XIAA 2TAAA 2BOEX 4A3YA 2Y7DA 1PTDA 4IQDA 4NZ3A 1NOFA 3O63A 1E55A 3QOMA 1K03A 3T2PA 3W9ZA 1TTIA 3QLLA 2Q71A 1I0BA 5IDIA 2HPMA 3HN3A 1EJXC 5LHEA 1FWBC 1E9IA 2ZZ7A 4I5UA 4GH3A 3WFZA 3A64A 1F9CA 4B5SA 4XZHA 2BHUA 2NW0A 3ZLFA 2Y7FA 4R9OA 3A22A 1JFXA 4GISA 3WJSA 1SZRA 1W17A 4JZ5A 4UFMA 1I9CB 1BF6A 1E56A 5HATA 3QR0A 3ARTA 3GIQA 4B5TA 1W3NA 1PCWA 3T0TA 5HWNA 1GZGA 4KGJA 1KA9F 4I9JA 2E6FA 2F2KA 4MF4A 6ENLA 1S2VA 1TMHA 3IGHX 2CU0A 4G7EA 1ME9A 4A2RA 3P93A 1WKDA 1QMLA 1OYBA 4MJ2A 1SMDA 1OX4A 4M3PA 5D8ZA 3A4XA 1IZKA 4TOQA 4MAVA 1GVIA 1GG1A 4IFOA 2GGIA 4QP0A 3LCGA 3TA6A 1XGEA 4PYSA 1A0CA 2E4TA 5FJOA 4ROPA 4W93A 1UR0A 2YXGA 3JZEA 4V2XA 3W1NA 1DIEA 6XIMA 3U4FA 1P43A 3LRKA 1TX2A 3WBWA 2DIEA 2FJUB 2C15A 4L56A 2A7PA 4LV4A 4YLWA 3BOXA 4W4QA 2AAMA 3E5BA 5IBXA 4H01A 3T0DA 3N9SA 3F4NA 1SZFA 3FW6A 1ZAHA 1Q6FA 1QPRA 3LM3A 3S0CA 5C70A 1A0DA 4J3ZA 3TFXA 2X40A 2YJQA 3NDYA 1UWUA 3MVTA 1TJ2A 2PWUA 3ZYZA 1CGTA 3ZSSA 1OCBA 2GPTA 3CMGA 4JTEA 3S6DA 4M6UA 4JD4A 4PE8A 1VJSA 1WBJA 5JU6A 3PUGA 1J6PA 3LTPA 4DEFA 3RN6A 1HT6A 4WZHA 4UFKA 5D2TA 3F5KA 4K1WA 1KGWA 2EG6A 1NQ6A 2GL5A 2XG9A 4QJ3B 1DIOA 5AC4A 2XH7A 3D6NA 4NZJA 4XSMA 1O95A 1VCGA 3TSBA 3ZZ1A 4M80A 4ACZB 3B0PA 1ZNNA 1ELSA 2ZA1A 5CBBA 3VKJA 4RDZA 4MUPA 4HCLA 3N2TA 1E6PA 1PSCA 5B7YA 5U4NA 4QTGA 2I14A 4QS5A 1H0GA 5HJLA 2XVLA 3SJNA 1I2PA 5ABGA 4D1IA 5LNUA 4LBUA 3TK7A 5DMYA 1L6GA 4KESA 4BK9A 4Z08A 2ISWA 1XISA 4JTJA 2CHRA 4WKHA 4IFRA 5DT5A 1TPFA 1MRQA 2WMGA 1HNYA 5FF4A 1GOXA 3KL3A 1LG1A 2VDGA 4CLMA 4E2OA 4H2HA 4I90A 1FY6A 3SCOA 3CS2A 3M07A 4EKJA 1JDEA 3FY1A 4AEEA 4X63A 3CZGA 5IXEA 1OCQA 2ISVA 2GQ3A 2HNEA 5C54A 3NTYA 4JFTA 2VCCA 3W7EA 2IXVA 1KFBA 1WO2A 1Q6LA 3PZTA 1Z7AA 5JBFA 1R7AA 1T96A 2CLKA 2WMIA 4GE8A 2QIWA 1C29A 3I7QA 1RV8A 3EBVA 6PTDA 3NOYA 3GAYA 4ZCWA 3PPCA 1KD0A 1AMKA 5A8PA 2V3DA 2C19A 3DFSA 1H4PA 3ZSTA 3SY8A 3CH0A 1K6WA 4H8NA 4YHEA 3OJGA 5HULA 2FPYA 1JYWA 2WV8A 4PTNA 1LQ2A 3C3UA 1DJZA 3IK2A 2EPNA 2ZZ3A 3DHUA 1R3YA 3TN3A 2EQDA 1OFEA 4UTUA 3CQHA 4PL2A 3KHDA 1UPPA 2DVTA 1ZGDA 1J0HA 3PBGA 1RBLA 3GNPA 4P8VA 4IL0A