4I8YA

Structure of the unliganded n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
303
structure length
303
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
total genus 114
structure length 303
sequence length 303
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i8yA00
4RW5A 3OHMB 4QJ5B 4PTDA 3V18A 2PLCA 4I9JA 3V16A 3KS5A 1DJIA 1AODA 3H4XA 1DJYA 1O1ZA 3RLGA 4QJ4B 5PTDA 1ZCCA 1DJWA 4GNKB 3V1HA 4F2UA 3QR0A 4OECA 3RLHA 2F9RA 4I9MA 1QATA 1VD6A 2OOGA 5T9BG 2P76A 6PTDA 4I9TA 5T9CE 1XX1A 2O55A 4RW3A 2PTDA 1V8EA 3I10A 3L12A 3PTDA 4I8YA 2PZ0A 4QJ3B 4S3GA 5T91A 1YDYA 7PTDA 3EA1A 4I90A 2ISDA 2ZKMX 3EA2A 4R7OA 4F2TA 1PTDA 2OTDA 1DJXA 4F2BA 1T6MA 1DJHA 4Q6XA 3QVQA 3H4WA 4RV3A 1DJZA 1T8QA 3NO3A 3KS6A 3EA3A 1QASA 1GYMA 2OR2A 1DJGA 2FJUB 3CH0A 3MZ2A 1PTGA 3QR1A
chains in the Genus database with same CATH superfamily
3ES7A 2WMIB 3E5PA 1AW1A 1SPQA 3PAJA 4JAWA 1BXNA 1EJSC 3IJ8A 4R7JA 1QNSA 3CUJA 2QVNA 1MUCA 3IRSA 2HPMA 2CW6A 1JDEA 4PTMA 4LF2A 3DAQA 4D71A 2BY2A 1B31A 2ACQA 3HQOA 2DVUA 4IL2A 1EKOA 1KLYA 2PLCA 5C6MA 2PGRA 1H49A 1I1XA 1M03A 3EMZA 5RUBA 1QW7A 4EPKA 3GZ3A 4AIEA 1QI3A 1G9HA 2VI0A 5EL1A 1J96A 1K1DA 1J79A 1F7BA 4ZOCA 1ZTVA 2XISA 3OHMB 2QV4A 5DRIA 1S1RA 2V67A 2YJQA 4E6MA 2C15A 4R9XA 5FAJA 4DBWA 1ZJAA 2PURA 4HNCA 5MF5A 3R8HA 4GYPA 3DKLA 3OO2A 2VXNA 2X1UA 1D9EA 4GK8A 4ROQA 6ENLA 3W1LA 1H7PA 3ZOAA 1A49A 2WC4A 4XAGA 5C5YA 4D8LA 2YB1A 1ZHAA 1KA9F 4C6QA 3V5OA 2WQPA 2WHKA 3GFYA 2ISWA 1TPUA 5SWUA 1PL9A 2B7OA 3VDBA 3WJZA 3MZ2A 4TV6A 1S38A 1AL7A 1H7NA 1JUEA 5AY7A 3TTSA 4LSBA 1CEOA 3MWCA 1XIMA 4F0SA 2WNWA 1ICPA 4UR7A 3URBA 1EP3A 4IH3A 4WLCA 1I0BA 1QJWA 2WNQA 3DUGA 4NJKA 3NQFA 2REQB 5FL1A 2AGKA 2V63A 3LI1A 3R8RA 2D3NA 4KWUA 4LV4A 1BYBA 1MDRA 1IWBA 1XUZA 1JCMP 2O9RA 3E12A 2J4GA 2HCVA 3WLTA 4G7EB 1E1CA 4AW7A 2VL4A 4L1GA 4LPCA 4C6FA 4MNKA 3V0SA 4NRRA 2X30A 3REQB 4GH1A 3FOKA 1ONWA 3RLGA 5C71A 2P1FA 3E2VA 3DENA 3FAXA 3LXAA 1N8IA 3RDKA 2J88A 2V5KA 3W7PA 4R33A 1GVEA 1RK5A 4D6HA 3H54A 3NOYA 2PDWA 2PCEA 3A5VA 4CVWA 4WDWA 4M29A 1XYBA 3B8IA 4ATWA 5A6BA 1QOQA 1JPDX 3DFOA 4M80A 3S1GA 2WVVB 2J9YA 1MW3A 3E6EA 4HN8A 2PP1A 3H23A 1Q4WA 2BSLA 1JPMA 4MWAA 1P0BA 4LUTB 1VF8A 1XH2A 5BXSA 1OFDA 2V8ZA 3MV11 1R3WA 3TOPA 3M0HA 1X96A 3G3MA 3COTA 4IL0A 3NWRA 1W32A 1PTAA 3RLVA 5A6AA 4N9CA 1DWAM 2GGGA 1XLFA 3C2YA 1W8GA 3OZPA 4B9ZA 4OVXA 3DX5A 4MYXA 1FHLA 2OZ0A 3K30A 3OVRA 1GQKA 3MP4A 4MB5A 4W7WA 3WJXA 1YXCA 3TR2A 3UJRA 4X0NA 4KEUA 2MANA 2PDMA 1XDMA 4L65A 1Q65A 3HG4A 3G77A 3DHFA 1MFUA 4J3WA 1RV8A 4N9EA 1E6SM 2AMXA 5BROA 4XAPA 4UXDA 2Y7GA 1ITUA 3CEPA 3N11A 2C3ZA 5I78A 2X0HA 4DM1A 1ITXA 3QR1A 1D8CA 1JG9A 3I4EA 3RMJA 5I03A 3OG3A 3WNKA 5G4EA 4W7UA 1V3JA 1UCWA 3F5LA 3CEUA 2EG7A 4YWIA 3CT7A 3V5FA 4GCAA 3LXBA 5JBEA 3ALFA 2BZNA 1UUQA 4XTDA 5EMMA 2DZUA 5IFPA 3A4XA 3THUA 4J3UA 3QV9A 3NTYA 2GVEA 4BY3A 1I4NA 4ZSTA 4CUCA 3BXWA 4XZMX 2HE5A 2GVGA 1UR1A 2A6LA 3SN4A 3W23A 2WPGA 2ZXDA 5EYWA 4HSNA 4HA1A 4KMQA 2ZADA 3S5SA 5AHEA 1VCFA 2E9LA 1DPMA 3UD6A 1BSIA 1DJZA 3OB8A 1UBSA 3H7UA 3DECA 1H0GA 3KOWA 2AQWA 3KWXA 4D6EA 1QO2A 1IXPA 2DQWA 2D2OA 3ICJA 6PTDA 5FEPA 3TQKA 5I3JA 3P60A 4QG6A 1R7AA 3CUZA 1KCKA 4D72A 1E6PA 2RGLA 4DF0A 3VIOA 4CQ8A 3RJXA 3VCNA 4W88A 5CSYA 2GJLA 2PWFA 1Y5VA 2XU2A 4EX4A 3UWWA 1D3GA 1NIUA 1ZRQA 4H9YA 5I3KA 5C9RA 4IPJA 3TLLA 3P93A 4C65A 3GS6A 3GQYA 3LLXA 1SFLA 3QY8A 3R6IA 4MAVA 4JQ1A 1T6MA 4ZBCA 1OD0A 2GK1A 2QEZA 3NEVA 4ZFMA 1EEPA 3RM8A 3DN5A 4I9JA 2IKHA 4JQ2A 4YN5A 1YBQB 4JZ5A 3UR5A 1BVWA 3HGJA 1PIGA 4FOKA 4M5PA 2PLJA 3GVVA 4FEZA 3UXIA 3MDWA 3R0UA 3E2SA 2QV5A 2TSYA 2Z7GA 1KFLA 3VNIA 1SZNA 3MSYA 5AHMA 4YVPA 4MZ8A 5ABEA 3ORWA 3UVAA 2IPWA 1V3IA 1SW7A 4W89A 3BK0A 5G1TA 2F84A 2DH3A 4Q22A 3M07A 4PMYA 3VCRA 4RNJA 3N2XA 3VD9A 4NZ5A 4KH2A 4KIEA 4HOZA 4P7OA 4KF1A 4BJHA 5CLTA 3GR8A 1J2BA 2WLYA 8CGTA 2YBVA 3TW9A 1YADA 1VC4A 3LDVA 3FGCA 1KRAC 5EGRA 1E6XM 1UMYA 1W37A 4M24A 4C7GA 2F6XA 1WQ5A 3O05A 4DYKA 1EO5A 3LCWA 4QROA 4EXAA 4Y9PA 1JFHA 3W83A 1Q8AA 2PRHA 4ICNA 3IUDA 2G3MA 1KW1A 3NM3A 3KUMA 3NGJA 2ZZ7A 1V3MA 2E6FA 2WZHA 3W85A 3FAWA 1X1NA 2DSZA 2QXWA 3R0KA 1FOBA 3A3WA 5GJNA 4MGGA 1FHDA 1POJA 2XIMA 3P62A 3H53A 1AZ2A 3KBNA 4GQRA 4O0QA 2B7NA 3O6YX 4G7EA 2V5LA 1SW0A 5MHBA 5AHLA 5CZSA 3T0CA 1XUUA 2FDSA 3QV6A 5FA5A 2CZFA 4JIHA 1MXDA 4QQUA 3RM4A 4B92A 4NAEA 1KR1A 2POZA 2A0NA 2X0YA 4RW3A 1RZMA 3CYVA 2O9TA 3BO9A 2PDJA 2CZEA 2XGZA 1SO4A 1A5AA 4OUEA 3OVGA 5XIMA 5CAKA 4CN4A 1HO1A 4YVXA 5FF4A 4CEXC 4TX6A 1JXKA 3ATZA 3WQFA 3CTLA 3WEMA 4I8DA 4I7WA 2DDXA 2GJNA 2CHRA 3A3XA 4D6IA 5REQA 4NXKA 3I3DA 3MP5A 4UNKA 2C14A 4WKFA 3S6DA 4B16A 2G96A 1ITQA 2E25A 1WA3A 3S4TA 3AQUA 1B9ZA 4IQJA 3ZZ1A 1XRTA 1Z3NA 1JRBA 1O68A 3S8HA 1FHUA 3NQBA 2ZZ2A 3P0WA 2PDCA 5JXQA 1QW8A 1PKMA 3T44A 3GKFA 4KERA 3O06A 2Y70A 4X2PA 4AC7C 1Q66A 3VKKA 2R91A 4KBXA 1MO0A 3GNRA 4H6EA 1RD5A 3P0XA 1XKYA 2X1TA 3CUHA 1LORA 1FWDC 2A7PA 4UOJA 3I6RA 1KV5A 1ICSA 5BYWA 1G7VA 2QCGA 2BOGX 1K8ZA 3C2OA 3EX3A 4LNYA 1QVBA 5HUPA 5LIKX 3L0NA 2EPHA 2TYSA 3EDDA 3H24A 3KEHA 3UJFA 3FFSA 2C13A 3N2TA 2J24A 2IKGA 3RILA 4ERAA 3VO0A 4ERIA 3VZXA 4HTBA 2WANA 3QVQA 1H41A 4N4QA 3AYRA 5JH2A 3BV4A 5D02A 4A3YA 3A24A 4X0VA 1KFJA 2HWGA 3IGSA 1LWJA 3BW4A 4M19A 2I5IA 4TVDA 1NFPA 3HPXA 4WCJA 1XYFA 5D9NA 1L6SA 2HEJA 3AUJA 3CQKA 4I9AA 3UZJA 4F8XA 3H4GA 2R9RA 5CJNA 3HG5A 2DZPA 4RPPA 3A22A 4XZIA 3N6QA 1WZMA 2V38A 1NM9A 1CGXA 3MVIA 1TMQA 2V6AA 1NEYA 1J0HA 4A3UA 3CWNA 1BRLB 5IHRA 2J74A 4IFKB 3QHNA 2NXHA 1HVXA 1Z69A 3GUGA 1ZU8A 1XIJA 2R1MA 2ZRZA 3H2EA 1B30A 3C6CA 3VVGA 2XN2A 1TTJA 3M41A 3UR7A 4GINA 2DGAA 3V0UA 2O7QA 1J6OA 3MJMA 3LHZA 1GWJA 3N6HA 4Y9MA 1Y8BA 5HMEA 2Q8LA 4J3XA 4XG1A 1UD3A 5BRBA 4D9PA 1Z9AA 3PY2A 2PLMA 4A4AA 4PCTA 3UVIA 1RR2A 3BAWA 4DJEC 1QWGA 1FWAC 7PTDA 2QPXA 3WH6A 3RR4A 4PUUA 1XGZA 2YB4A 4WR3A 3G3DA 1DORA 1EUAA 3ARYA 3L68A 5XIAA 4UMCA 2NSOA 1S5NA 3S47A 5ENLA 3M0IA 2Q3OA 4JIEA 2CLEA 8TIMA 1QHOA 2VENA 1KXTA 5CH9A 1Z41A 1EDQA 3ONBA 1JQVA 3IAPA 4YCPA 4NSBA 2ISDA 2V0TA 1FCUA 3FY1A 3NXFA 3IACA 5HWMA 3E5BA 3DFYA 2WVSA 1US2A 5A3HA 5AZ0A 2QQ6A 2PWHA 2Q8XA 5E93A 1EJUC 3WO8A 2ALDA 3BARA 3LCLA 4ZTXA 1XQKA 3CJPA 5HR6A 3NJ3A 1KC7A 2DZWA 3LHYA 2GVYA 2E9MA 3BZJA 1TREA 1RY0A 3ZLGA 2X40A 4XD5A 1TR9A 3JW7A 3PBMA 1PWMA 3AICA 2HXUA 5CSRA 2CLHA 3CT2A 3IARA 1BGGA 2ZE0A 1TCMA 3THCA 3OBEA 3I6TA 4QLLA 2E68A 4K1GA 5TIMA 5E6ZA 3TSDA 1JL8A 2PWEA 1JPHA 2DP3A 4NZFA 1VJIA 3TYBA 1YPIA 3WDQA 4EAYA 4BI7A 4NVTA 4OWGA 1A0EA 5A6KA 2GGEA 4NJHA 2C71A 3TQPA 4ZQNA 1PWLA 3RX3A 1QU4A 4QBXA 1PXGA 2F6KA 1V6VA 1JDCA 2PDYA 3KHDA 4L7ZA 1C3FA 3L4TA 4K36A 4MUPA 3QM3A 3C56A 3P81A 3R58A 1VPYA 1X38A 2QMJA 3U2ZA 2BMBA 3PZUA 3RGTA 4N0RA 5IFTA 3TN3A 2C79A 3HMJG 3C3NA 2WKJA 4NXSA 3GBDA 2V2CA 1K9TA 4TTGA 2A79A 3OGSA 2QDEA 3WK2A 5I07A 3TCEA 1XC6A 3T2QA 1DQXA 3LUTA 1GOKA 3DOPA 2ISVA 1TRDA 5EY5A 4PMXA 1ONRA 3VFCA 1N2VA 2QGHA 4HN4A 1TJPA 1O5QA 5D9OA 1AJZA 4GFIA 3UU0A 4EACA 1KD0A 4MWAD 3VIGA 3M9YA 3HURA 2H8ZA 4QAIA 1EJ7L 1WDDA 3WYZA 3H2NA 4B5NA 4REQA 3BAIA 3EEZA 2DUXA 1T7LA 1VD6A 2NLIA 1OFOA 1S3HA 3CO4A 2XVKA 1G94A 2YKKA 1W9XA 3TTOA 3NQ7A 3WQDA 4JS3A 4AVNA 1KGWA 5CPSA 1OG6A 4MKSA 4A8NA 3E9AA 3LHWA 4O10A 2Z1KA 4O0ZA 4V2XA 3MHUA 4HK6A 1M7JA 3U2EA 1HVQA 2WO5A 1WUFA 5FKYA 5DN1A 1MRAA 3HG3A 3EPMA 1GQJA 1O5XA 4V1XA 4DQWA 4HPHA 2Q02A 1Q2SA 2C7FA 3BQ5A 3DFSA 3MCNA 1TFVA 4IUOA 2YA0A 3M7SA 4X3ZA 4LCSA 5GNYA 2VEKA 4EP8C 1FWJC 4JY9A 5JIWA 4IHCA 3MW7A 1XPYA 1CXIA 2J47A 4DLMA 1XIFA 4IIHA 1NAL1 4DI9A 1WE5A 3E0IA 5D09A 3BG9A 5CPOA 3KX6A 3LMZA 4N9DA 1VLIA 2E6YA 1F6PA 4U5IA 5CGTA 5BWFA 3H21A 2O4MA 3WD0A 5CLWA 4ZEPA 1UQYA 1O6IA 2XYLA 2YW4A 3HPZA 2PA6A 1V7AA 4XV0A 5AN7A 1JGMA 1KFCA 2R8WA 5I5RA 2XH2A 2VMFA 1IV8A 4M3PA 2FLIA 3A12A 5DXYA 1B3WA 1VFSA 3SQMA 1JZ8A 3LPFA 3QN3A 3HPFA 4GUIA 4UQBA 3ANYA 2ZXBA 2VVNA 1E0XA 4NZ4A 2PZNA 3ZT7A 4O17A 1XW8A 1E9LA 3W1MA 1FCQA 2DW7A 1NP0A 1ZJBA 2FGZA 4UFLA 4E0CA 1I8JA 5E9AA 1S2VA 2XINA 3H2OA 1D7FA 1KGUA 4BHYA 3RNDA 3T07A 3LTYA 2NX9A 2Y8VA 3SAZA 1BLIA 1E1FA 2XVGA 1NQKA 3DI1A 1W2PA 4JQAA 4XB3A 2PTYA 3PPGA 3W1TA 1X6UA 3CHCA 4RNIA 1UWIA 3PJUA 4MDPA 2QUTA 1E73M 1ZB5A 4FI4A 1JUBA 1EYEA 3JZEA 3SGGA 3GH4A 3KLLA 1ISZA 1OT2A 4LBRA 1TV5A 4NRSA 4E38A 4DZIA 4EKJA 4QITA 1E1EA 1ZCCA 2E77A 2XSBA 1NFBA 4FALA 1KQYA 1V0KA 3PP7A 1OYBA 3VKBA 4ZL1A 1OFEA 3PZNA 3OEXA 2ZRWA 5A69A 1QOXA 1FY6A 1ZBKA 3DH7A 3KP1A 4MB1A 3OVQA 2JGYA 3ZJKA 4Z08A 4GVGA 1BEUA 2PS2A 5ABGA 4Q7BA 4PYSA 3WELA 1WXYA 2CESA 1A0DA 3ZLFA 4GC4A 1VFUA 4MJ4A 2QF7A 1RVKA 3VOGA 1GKPA 2DSKA 3TC3A 2ZZ1A 4JN6A 3KDNA 4O54A 4H9XA 2PPGA 2WHJA 2PDGA 5A2BA 5FCZA 4XBJA 2Z00A 5JVLA 3DEQA 4AUBA 2RDXA 3FJ6A 3B9OA 1SZFA 1XLAA 2ZA2A 3O16A 3SCVA 1U83A 2WNNA 3H2MA 2FPTA 1FDJA 2BXVA 1MNSA 3G1RA 4B9YA 3OP2A 5TQLA 4NZ3A 1IF2A 3GE7A 1QPQA 2XJ7A 4EK7A 3H55A 5C2GA 1PTGA 4ACZB 1LBFA 4BF9A 2QCFA 3VDHA 4AX7A 1H61A 1MW2A 2OWCA 3TW6A 3WH7A 3B9DA 1I2QA 1ME8A 2CNCA 1IZJA 1SO3A 1LRTA 1SMAA 3QZAA 3ARUA 3TXVA 4JTSA 1DIKA 3FYOA 2ZC8A 4DJED 1L2QA 1W9PA 4WDXA 1KFBA 2A1YA 3WBXA 3MI6A 2QKFA 4QCEA 1OT1A 3ONCA 3HQ1A 1I60A 2G97A 1W0MA 1SJAA 1B90A 3BJTA 1LL7A 3A5FA 4NI3A 2BOFX 3W07A 3LERA 4Y90A 2PF8A 3I3BA 2Q3RA 1TWDA 3LGEA 3TJLA 1OINA 4LUYA 4J4KA 3W86A 2ZX7A 2A7RA 2YBUA 4LAKA 3RO8A 2BWGA 2FB3A 1U30A 1IZCA 3DFPA 4AEEA 2FPYA 4DPQA 3MSDA 3LSBA 1NQ6A 3RPDA 1HG3A 1O60A 3CWOX 5LA2A 4MNMA 1FH9A 3FYYA 5D9MA 3DHDA 3DI0A 2BTMA 4Z2IA 1CXKA 3CZ8A 3V7PA 1P5BA 1B4EA 4AISA 4H9VA 4NILA 4GIRA 3GYCA 4WX2A 2D24A 3QV8A 3BGAA 1QTWA 1M9HA 4DJFC 4FLSA 1W1IE 4XKYB 1UP3A 3IVUA 1FWSA 4RKAA 4C1NB 2DPEA 2W92A 1OB0A 1OGGA 4U4MA 3URQA 1T0OA 2BY0A 5C9WA 1JXJA 4QCFA 2J8FA 4HP5A 3G0UA 2QJIA 4F66A 3B9AA 3QJAA 2OPJA 5KTLA 3G8EA 4D2JA 3G1YA 2FHBA 3GKAA 3S5NA 3WLMA 1GZJA 3VILA 1O1HA 4NQ1A 3QR3A 1IGSA 1VEPA 3OIXA 4Q8TA 1IWAA 1KM2A 3AYSA 5H8UA 1H51A 1W3JA 4A2RA 3KCOA 5CPQA 3VCCA 3GD6A 3T40A 4LBUA 2ISFA 3AO0A 1T8QA 1S5MA 3HV8A 4R9OA 1H4PA 2QNEA 4CD7A 5LNWA 3TVAA 3FIGA 4NAFA 1KKRA 1DWIM 2HJPA 3ITXA 3UWYA 4Z1AA 1VFHA 1W56A 3NQAA 4M6QA 2ZZ5A 3VKDA 2YL8A 1XIGA 3WFAA 3GU1A 2VQUA 3WY1A 1Y5WA 1ME9A 2J7BA 3GHRA 4CQ9A 3LGDA 1C8VA 1O95A 3R89A 2GFTA 1ZAHA 4S1FA 4C1LA 4XBSA 4JCLA 3VKAA 1RCQA 4M1BA 3BICA 3GR7A 3LNPA 5LGXA 2BGNE 3C0LA 4A35A 3THAA 1NFGA 4TMCA 1JYVA 1H50A 2H9AB 2NV2A 1HL9A 3M16A 2Y7EA 3HTWA 5AHIA 2NVCA 4P61A 3FXGA 4IP5A 4J28A 3PZ9A 4AZBA 1VCGA 5D37A 2VWSA 2QCDA 2JQXA 1B3VA 3L5MA 1EIXA 1RSCA 3ZMRA 4A8IA 2XGIA 2IQTA 1TPC1 1W3IA 3CUIA 2PD5A 2ZX6A 1YXYA 3OGRA 3QBUA 2WZTA 3O7UA 3BLKA 2GQAA 1V77A 3MUZ1 1QAPA 1YTKA 5J5RA 1MMFA 3PBGA 2VFGA 4MKNA 3R25A 3BW3A 2OSYA 2PB1A 4PUJA 1NTHA 4ROPA 1ZAJA 4O1EA 2X0SA 4KCVA 5I23A 5DY2A 1EA9C 2WB5A 3N2MA 1EP1A 4CGTA 1Q6GA 2FH8A 3A9BA 3P82A 1G0CA 1W17A 2VFHA 4A3QA 3MUIA 4AWUA 4EXQA 3PJWA 4I6KA 3WLJA 1MQQA 3GWQA 2V81A 1E56A 2OKTA 4H6RA 3TWAA 4LF1A 3WSUA 2PTXA 3W71A 3FKKA 3EMQA 2QPUA 1FCBA 1MWOA 1NDZA 3CL6A 3OYXA 2PRLA 2J6XA 2POTA 4KIRA 1SW3A 4KEZA 2ZUMA 4W5UA 4J9JA 4XTIA 2VC7A 5KETA 4MLJA 3AISA 4JHMA 2G8ZA 1OWQA 1UR0A 1XDLA 3PHAA 4W5ZA 2L5HA 1A53A 1DJQA 1RCOB 3FS2A 2HPIA 1JZ7A 2D0HA 3B06A 2VDHA 3D0CA 1UYQA 3ITOA 4L4PA 1V3HA 4AEFA 2FJKA 3AMGA 3N18A 2OLSA 1BVZA 4IIGA 2WSRA 4FAMA 2SFPA 3ZFHA 1OQFA 3NQCA 3ZSSA 2UV8G 3PZMA 4ATDA 1P0DA 2X2GA 1JDDA 2DIKA 3GXNA 4HHPA 2FTYA 1G4SA 3AMKA 2BHUA 4NZCA 1LDCA 2R24A 4MB3A 4ML4A 3LCIA 1XCXA 3S5ZA 4X2RA 4DYEA 3FW6A 3FA3A 4GY7A 2YFOA 5AKQA 1NF7A 4X60A 4EWND 3QZ6A 4UOQA 5T26A 4JQ4A 4AD2A 3EWDA 3L12A 3RMEA 3E2RA 4C7DA 4DBUA 3PTQA 1GYNA 1SQ7A 1CB7B 5E5CA 1VR6A 3IIOA 4O12A 3STCA 3P80A 4BFAA 4AXKA 2CZDA 2QJHA 3UZYA 3A23A 3EX4A 1OZMA 1CECA 3WUBA 1EGZA 1XYMA 4KETA 5CC7A 1B57A 3VINA 1E3ZA 4J40A 5D2XA 3KRBA 1YEYA 3YPIA 5LYRA 2ZICA 5JIPA 2WOQA 1J12A 3CYJA 1KNWA 4GC3A 4JR5A 3KWSA 2OWWA 3V4BA 3W81A 3GH7A 1EYWA 1C7SA 3GU2A 4TOQA 3C0SA 4IQLA 1WP6A 4A6GA 3QQ0A 2TPSA 1W1B1 1NJJA 2NXIA 5BXPA 4B4FA 5DELA 1WZKA 5F2MA 1PX4A 1AD1A 1Q7MA 1E4MM 2DIEA 1D3CA 3MTWA 2GWGA 4O8RA 3AAMA 5CZTA 1QPKA 3R5EA 4IOTA 1TTPA 2J78A 1C92A 4PUEA 2VCAA 4KS0A 1EXPA 3LCXA 5BU6A 3H8AA 4DIAA 4JTEA 4GQ0A 5CQ1A 3CHDA 1S1PA 1ZENA 2Y8UA 1E3XA 5FJUA 1VLWA 4I5UA 4FNUA 5M03A 2O56A 2NWSA 3WQVA 2Y7DA 2PDQA 4BI5A 4DNHA 1I2NA 2EKGA 3S1WA 3W2JA 1FH8A 3KL5A 4JD4A 5D8WA 2PMQA 1GEQA 4X22A 3W29A 1CZ1A 3LS9A 1VBHA 4DRSA 1DWGM 1O5RA 4HPNA 3EX6A 1BWVA 4FOJA 4IGMA 4RCXA 4N9BA 1NOUA 2VEMA 1EXBA 4FNPA 1MEIA 3POCA 3KTXA 3ARZA 4S3GA 4GOAA 4PRWA 1LT8A 2R14A 3VUPA 1LTDA 1OYAA 4AIBA 1QASA 4OQVA 4E8DA 1P0NA 2D2GA 1AH0A 3B4UA 2W9MA 3FKRA 2FVKA 3ELFA 1XIHA 3HPAA 1VAHA 1QNRA 4OECA 2RHGA 1SJBA 7A3HA 1HKMA 1HN1A 4GZIA 5CSUA 2YYUA 4BQ4A 2AAAA 1VYPX 1JNEA 1WNOA 2JEPA 1BQGA 4NYYA 1K7EA 1UBPC 5KINA 1GQIA 3USBA 1KXVA 2OX1A 2YZRA 3HV9A 4ADSA 3L5LA 1C90A 3EXRA 4P8XA 4W8LA 4IXHA 4C6DA 2B31A 1E55A 1E6QM 2OJPA 3MCOA 1EL3A 3WLNA 3VGEA 1GOOA 2VR2A 4FMVA 4XZWA 3R94A 4JTAA 1L2UA 1R7OA 1KXHA 5DY3A 3IUHA 4JNYA 1G5AA 1PV8A 1J0IA 3IIVA 1W1YA 3WMBA 1UKTA 4MZYA 5CJMA 1X1ZA 2CXEA 5HJYA 1UJPA 4LALA 1XRFA 5C8BB 2WSQA 4GBUA 4S3FA 2FB2A 1PHWA 1VENA 4DEFA 1OD8A 3CK5A 1ISXA 2BVDA 2WMKA 4JY8A 5D2TA 1YKWA 4NUWA 2MUCA 3VGFA 4P7QA 2V3DA 4MLRA 2YBTA 1EJVC 4Q33A 3WLOA 1G4PA 3GXIA 4HA4A 2PODA 4TUFA 1U5VA 1J9YA 1G6CA 4DBDA 3WD1A 2V5JA 2QGYA 4M81A 2NZLA 3W28A 4JTIA 3VMOA 4C6JA 5IBXC 1GYMA 1PZ1A 3WQ8A 1G01A 4H00A 4HKPA 4UTUA 1GVSA 2DZTA 4GXWA 3BPWA 1I9CB 5E09A 5K9CA 4IMEA 5D03A 2XIOA 3S5OA 2XN1A 2DZBA 1TPEA 1G67A 3TDFA 7XIMA 3W1UA 2MNRA 1BKHA 2GJRA 3TZFA 3O0KA 2BG5A 1CB2A 1JAEA 1A3HA 4Y6GA 4ZTYA 2OODA 5J8LA 3U0HA 2CU0A 1XLLA 2GWNA 4INFA 2Y62A 1NWSA 3NYZA 3PM6A 4GYFA 5JBDA 1R2RA 4JTTA 5HR7A 4Y2WA 1HUVA 3WH5A 4MG4A 1QR7A 3P5YA 2HSAA 3BV7A 5I79A 3AMCA 1TA3B 3VDGA 5DFAA 5FJRA 1UD5A 5LKYA 5E0KA 5C54A 3CMGA 5FACA 3WLPA 1JIBA 5BRQA 1GTEA 1UD4A 5I06A 1NDYA 1GVYA 1EOKA 3D3FA 5AHFA 3C2VA 3S2NA 4YMZA 3V3WA 1GOWA 3SIMA 4GZ7A 3B9EA 1RUSA 4QJ3B 2JALA 5H91A 4LXFA 1GJWA 2C91A 3IJ7A 4HA0A 4KW2A 1FUYA 1V3LA 3VX0A 3I65A 4ZFCA 4D6GA 3DG3A 1QNQA 2H3BA 4ML9A 1UWAA 5GNZA 4UBPC 2P10A 1FWTA 2DEPA 2IXUA 3CU2A 3R4IA 4AZHA 4GCXA 2AOSA 4GG9A 4NZ1A 2OSXA 3EWXA 3WF0A 1IT7A 4AZCA 4DJEA 4C6CA 3T0TA 4U5KA 1WOBA 3D6NA 3GHTA 5BNKA 4E8CA 3RPMA 1GOMA 3CLMA 4OTKA 1XH0A 3IUIA 4AD1A 4OV9A 4PMRA 1VZWA 2OYKA 3KE0A 5LHFA 4WY0F 1R9XA 1GOXA 2ZE3A 5G4HC 2ZRVA 5LGZA 1V4YA 3TLQA 3FSUA 2G3FA 5I09A 3BLDA 1WYIA 1RBAA 2ZBTA 4GUGA 4IMGA 4EE9A 4BI6A 1CGWA 3IANA 1LJYA 3QQ1A 1UZ4A 1FBAA 3CPRA 1SZRA 2CHOA 1E5JA 2V2DA 1RJPA 4Q8UA 3QEZA 5I77A 3MMDA 1QK2A 3HG2A 1ZPTA 4LCRA 4JTCA 4GXMA 3PULA 3CQIA 3I7RA 1OX4A 2WSYA 2FTWA 5E9XA 4UZSA 4RDVA 3ARXA 3NQEA 1XFBA 1OZQA 2J79A 4CNSA 3IV3A 1CXHA 3GW0A 2O0TA 2D73A 5FJTA 3KVJA 2VWTA 4UTKA 3VC6A 4QDWA 4DWSA 3NDZA 5EFFA 5K4ZA 4JTFA 3KDOA 1Q3NA 4AWSA 4I90A 2HMCA 4MNLA 3TMLA 2VOTA 3CBWA 3L4VA 2DH2A 3RRXA 4EIVA 1E4IA 4HZ7A 4X9SA 4PSPA 3PSWA 1WDQA 4PTWA 5BOOA 1XJBA 3K4DA 2YA1A 1UA3A 3VD7A 1R2SA 3ATYA 5FJJA 4ZENA 4KFOA 2ZTJA 2WKGA 1TPH1 4HVXA 1PE1A 6CGTA 1F8MA 3FNDA 4HCDA 2I9UA 4XVEA 5H2ZA 5CXPA 4O15A 3I7QA 1SSDA 3NR0A 1FXQA 2F7FA 3BTNA 1FDYA 3EZ4A 2VD8A 1UQZA 5FESA 4AIOA 1PYMA 1LRNA 3O07A 2EPLX 1GT8A 1TPFA 3EA1A 3F5KA 1HL2A 1L8NA 4IQEA 5AHNA 1S2UA 3OLDA 1PDYA 2W5FA 3NVDA 1OF6A 3HMCA 2IXVA 1GVOA 2WJZA 2Y7FA 1D3HA 2QJNA 4B3ZA 2VZSA 1JZ5A 2VNCA 1GORA 1O94A 1U5HA 3MHFA 4A8RA 3RX4A 2PTZA 3MI3A 1C29A 2JK2A 1LL6A 3BMXA 3N04A 2ZYFA 3PG8A 1XICA 2PUZA 3LHTA 3RAOA 1JYWA 2YCLA 5BRPA 4MUZA 4XISA 1KB3A 3E1F1 2Q09A 3LMYA 4JYEA 4QM1A 1YDOA 2E5CA 1LP6A 2BB0A 4GFSA 1A5SA 3WDRA 3QOMA 3PUDA 1VYSX 1H2JA 3REQA 3BAXA 3Q37A 3MYPA 1Q8JA 2FVMA 2ACUA 2BS9A 3BQ6A 2OT1A 2INEA 4L64A 3AJXA 4E3VA 2W3ZA 3P3BA 4D6DA 1JAKA 4GY1A 3THDA 3WBEA 3TYCA 1XIEA 3M0YA 3QLLA 3AIQA 3GH5A 1EA0A 1OY0A 1X8FA 1WAWA 3S2CA 4P7LA 1IR2A 1GW9A 3WQWA 1E0VA 3WG6A 3I10A 3CMFA 4MKVA 3M1ZA 2REQA 2E28A 1QWKA 3A4JA 3W88A 4LUSA 3GDKA 1FFRA 3SR7A 4K3ZA 4ILSA 1KM0A 1KGXA 4REQB 3ZWTA 1ZQ5A 3OBAA 2EPNA 1YXDA 2Y1HA 2Y88A 3AUOA 2GUYA 3H4WA 1MUMA 1GJUA 2FZNA 4JICA 1J8VA 5A6BD 4AHQA 4FNTA 3PBUA 3NL6A 3CS2A 4RL3A 1W9VA 3W9ZA 3PB2A 3DDMA 3P84A 1E71M 3AMDA 3TYZA 3UWQA 4FIRA 4Q4SA 3T8QA 3NL2A 3N29A 5H8PA 4DWSD 1I6NA 3KCJA 1ML1A 4JYDA 1VIWA 4IJCA 3KM8A 5EPDA 4GNJA 1UIOA 1XX1A 3N9SA 4L5ZA 3WLLA 1DTUA 3VPLA 4DAFA 4J3ZA 1FKXA 3EWUA 4PMVA 3QPEA 3R7MA 5ABFA 4WGHA 4I7VA 3SCOA 1JI1A 4LVAA 4C6LA 1QHZA 4A29A 3UYIA 3FLUA 3BWWA 4RJEA 4O16A 3L21A 4LU0A 2PGEA 4XWUA 1H3GA 1AG1O 2HVOA 4KWWA 1RA0A 2IPGA 4N6EA 2YCIX 4LAOA 4Z2GA 1PX3A 1OX5A 5HJLA 2BY3A 3F2CA 3MVTA 4ZXLA 1F61A 2QCDB 3QHOA 3UCDA 1Q6DA 1L9WA 1VBUA 1ZBVA 5FF0A 1A80A 1W1PA 4H3DA 5IOBA 1WCGA 3LG3A 1K4GA 1B3YA 2J27A 4OBTA 3O6CA 4V1YA 2XVLA 2D3LA 1XLMA 3VD5A 3SRHA 3W70A 1W6TA 3W0KA 3WNNA 3CZEA 1UOZA 3D5HA 3DBNA 1H1NA 4W4QA 3M6DA 3U8GA 3CUXA 4P8VA 4RDWA 5CPMA 3SCWA 3B9NA 4L80A 3WH9A 1B0IA 4NIRA 3VOJA 2D2HA 4G6CA 4QNEA 3DYOA 1OEPA 1T96A 4O11A 3HA1A 4B3KA 3TYEA 1YMYA 2W66A 2J7CA 3BC9A 4S39A 5EKYA 3VDAA 4U10A 2NT1A 3WNMA 4J1OA 4XKYA 3DG7A 4GBDA 2OKOA 4Q8WA 3W7QA 1M3UA 1BWLA 4NP7A 4C6MA 3M0ZA 3I7SA 1BQCA 2BNJA 1A47A 2CC0A 3QKZA 3A9IA 2BHZA 2ZDRA 2FTPA 4E2BA 3FJLA 3QW4B 5A2CA 3WH8A 4ZODA 3GVWA 3W38A 4UIOA 3VIIA 4XIMA 5I3HA 1QNPA 2GZXA 4JGDA 2KX9A 1GGOA 2QUMA 4UQAA 1Q45A 4QQ3A 2HROA 3TYUA 5A6JA 1TIMA 1AODA 4E4PA 1DHPA 4NT0A 1KBJA 2PDIA 2VX7A 4BEUA 4MM1A 2DZAA 4D8ZA 1JZ2A 3O6DA 3SO7A 3VABA 3B0PA 3PR2A 3N19B 3UPBA 3XISA 4GIAA 1BYAA 4E2DA 4FIQA 4Q4MA 1DVJA 2DSUA 1F74A 3LZ3A 1DIOA 3EBVA 5CC5A 1DWHM 4YIWA 3V0TA 5I00A 3WD3A 3I3EA 4MF4A 5AYZA 2AL2B 3M0VA 3TP4A 3KOXA 1TVLA 1QBBA 1XWYA 5HOSA 2V9DA 4K6AA 1GVIA 3HBLA 2HE8A 1XQLA 2XZ7A 3BZGA 1BSLA 4RLIA 4GE8A 4MVAA 3OQ8A 3SCSA 4US6A 3W37A 1UD2A 2I16A 3FA5A 2OG9A 2A3LA 1F3WA 3ARWA 5HA7A 3UJSA 3W7LA 1P1MA 1XISA 3BG5A 1M1BA 3JZUA 2FGLA 4QSHA 5HANA 3QTPA 4G7FA 3E38A 2OO6A 1P48A 2VFIA 4I3GA 4A3HA 2Y63A 4Q32A 2YDAA 3WL0A 3CZJA 2FFCA 2X16A 4PMQA 3AS1A 4ERGA 3WK1A 3OPSA 4IIBA 1W1ZA 4D1IA 2E40A 3SGZA 1YNQA 4BF7A 4LFYA 2XH4A 4F9JA 3G0SA 4PTXA 3EAUA 2A4AA 2FZ9A 1XV8A 2OT0A 3QZEA 4JN7A 4U28A 1VGAA 3SN1A 3RN6A 3BMVA 1P0KA 1OABA 2NSXA 5D33A 2ZZ3A 1TUXA 4F2BA 1IEWA 3PC0A 4H41A 2VO5A 4O13A 3PZGA 4C1NA 2Q71A 1IXOA 3AOFA 3HQNA 3NL5A 4Y7EA 3CAWA 3ECQA 3BLIA 4KCTA 4HNUA 3ARTA 3N17A 3SN0A 1Z7AA 4W9TA 4WRHA 3MUAA 5J5DA 2EBNA 2FHFA 3EA2A 1R0MA 1US3A 2OZ8A 5EA9A 1ZUAX 5FJPA 4GPNA 2EPKX 3TW7A 2XFWA 4EANA 2KZHA 3ANUA 3IJDA 4QJ5B 2VEFA 3NO5A 1F6KA 4QFUA 5AZ1A 2V30A 4B5WA 1BKSA 4CU7A 3NPUA 4RZBA 3ZLHA 2HDJA 4MB4A 2QR6A 3CLWA 3KL0A 3MWAA 1DJXA 3CXOA 4K37A 4PUWA 3EA3A 2UWFA 4F0LA 1W31A 4ADUA 2ZQ0A 2YSWA 3W1RA 2VGIA 4DWSC 3K8KA 2X09A 4JXCA 4PRTA 4IPLA 3BUVA 1V0MA 1IHIA 2IPFA 4YS1A 3M7WA 1UC4A 5C9XA 4TQTA 2JEQA 1DTNA 3T8LA 3UG3A 4Q6JA 4IMFA 3IIZA 5IHSA 1ZALA 3WK0A 4GX8A 2WCGA 5CGQA 4PODA 4ZQMA 3GHSA 3FHQA 3TK7A 1F3XA 4LW7A 1EIBA 3VX1A 1SR9A 3ENLA 5AC7A 3EKZA 4OIFA 2PBOA 2V5CA 1VFTA 4OGZA 2BGSA 4Q8QA 2ACSA 1P7TA 4EPEC 3CB3A 3DFHA 3L4XA 5FF7A 1E0WA 2PEVA 1F07A 3C2RA 3NDYA 2YIHA 3MA8A 1C8QA 2Q8ZA 4B5SA 5GPRA 2O92A 2GL5A 2VR4A 1R30A 1W9DM 1IZKA 2JKEA 3BSHA 1RY8A 3S9ZA 3LHVA 3G22A 3GHUA 3KP0A 1X6NA 1MDLA 3G6MA 1D7KA 1KFKA 3VIFA 1K6AA 1E15A 3S0CA 2H90A 3RLHA 1DE6A 2UY2A 3WQEA 1UKQA 2BASA 3U9IA 2R1PA 4A3RA 1EDGA 2YDRA 2PDNA 2I7GA 2YCEA 1V3KA 3QPYA 3W6LA 1WPCA 2ZCGA 1GQNA 4L4LA 1RP9A 1Q6CA 4CCEA 1OG0A 1TB3A 1CPUA 4DJDD 3RF9A 3LRMA 4NYUA 3WJSA 1OX4B 2G4FA 3U5YA 2QZRA 3VZYA 3BE7A 5IRPA 1OGSA 4CN1A 2D1ZA 3BCFA 1H09A 2FGBA 4KPLA 3T0AA 2EQDA 3CHEA 4N02A 4U3AA 5CBIA 4Q8OA 1OFRA 3CUFA 3CO8A 1Z48A 3R79A 3TXZA 5CAHA 1KRCC 1TWZA 3W74A 1K7XA 1V03A 1LOQA 3UNTA 4AQLA 2C0AA 1MW0A 1R86A 3R43A 1DXIA 3FCPA 4RE2A 3MJYA 3NM1A 3OLEA 1LQ2A 4D8AA 2PBGA 4WVXA 1K8YA 3WEOA 4LC6A 4YL2A 2ZC1A 4BEQA 5FL0A 1X1OA 4QHRA 4BKNA 2QUNA 8XIAA 1YE6A 3J7HA 5HWNA 3QTGA 3WK3A 3W7KA 1V6TA 4HIBA 3PZQA 3LPOA 2C18A 2TMDA 2QCEA 1MXGA 4LTSA 4FXRA 5AECA 2C0HA 3GDMA 3HU7A 4S3JA 2PDKA 3EB2A 2NVDA 4J3TA 5G1YA 1J0KA 2RGMA 3CV2A 5JU6A 1LUCA 4JX6A 4XD3A 1S2WA 3FDGA 3SUUA 4C90A 3GU9A 3WLHA 3WF2A 3TEVA 1QBAA 1QRQA 3VNMA 3L23A 2IUZA 1BTMA 3UR2A 3W76A 4YTTA 2YXXA 3AZTA 3RG6A 4UTMA 5BU9A 3WX7A 4FLQA 3OZMA 4EVZA 4GQQA 1YPFA 4TV5A 3HGOA 3PWAA 2FZBA 4DF2A 3C4UA 4GI6A 3SCTA 3N2BA 2P5NA 3W00A 2JIEA 1J11A 4ZOAA 4IFOA 1EGVA 1ZLPA 3W7DA 1BAGA 1XDJA 4IX0A 4ENLA 4Q4OA 4S38A 1VP5A 2W4XA 1ALDA 4IJBA 3PPCA 1F76A 3F4CA 4K68A 3LI0A 1O5KA 5DT7A 2FDMA 4QE5A 4HNVA 1HFBA 5GJPA 4HU8A 1XD1A 3F7JA 4JDBA 1I2OA 4MJ2A 2NQHA 4B5TA 1XLBA 4BCEA 3SDOA 2NUYA 1OYCA 3TIMA 2FMOA 2E8YA 4BR1A 4O1DA 1B3XA 2CXGA 2VT0A 5KMYA 3U7VA 3WUGA 1QXLA 3QR0A 3BOXA 2V68A 2OVLA 1ONXA 4NASA 3U2CA 4FNSA 3V75A 1JF6A 3TNOA 1UA7A 2OFJA 1IGWA 1X97A 3B40A 3A47A 4NKCA 4TU1A 1PUDA 3MUXA 3W02A 1XBVA 1O12A 4PFMA 3FJNA 5D9PA 3KVKA 1QO5A 1WV2A 4AFYA 3O6AA 3RCYA 3JVAA 5JUVA 4PCPA 4HHLA 5KITA 1LQ0A 2GGIA 3K46A 3L4ZA 3PPHA 5D30A 4DXVA 3W7OA 4OZOA 1W9BM 2WQDA 2QIIA 6REQB 2I9EA 1A5OC 3V1HA 2J7HA 3WDIA 4XIAA 2HBVA 4ALDA 4UNIA 5FF3A 1XLHA 2YCLB 2CBIA 2DJXA 4GYJA 3ZM8A 2OEJA 4Q8VA 4TVUA 1YDVA 3MKCA 1MZHA 3B8DA 2Y24A 3NO3A 5A8GA 1TKKA 3ME3A 4P8WA 1TA3A 2A21A 1TRIA 5EU9A 4ZMGA 3U48A 4IGNA 2WLZA 1FP9A 3O1NA 4YPJA 3SBFA 1J93A 6TAAA 2J77A 4XAFA 5BXTA 1ISYA 2NQ5A 4GH3A 4JTJA 3S83A 1W5QA 3OG2A 2CBVA 4F40A 1XSIA 5K4XA 3MBFA 4E2VA 2P8CA 1JD9A 2VFEA 5FI8A 4DUXA 3AWNA 3WMLA 3IGXA 4IJRA 1ISWA 4HT3A 2XSXA 4LS2A 3K4WA 3GZAA 3LCHA 4Q8PA 1E1CB 4ZB0A 1DOSA 3MANA 4PCNA 1RAKA 4LAZA 4XZHA 5DF0A 1V6XA 3EX1A 4HB7A 4WZHA 5AYBA 3U5UA 2VEPA 3FN9A 3VXGA 2QMKA 2ZA1A 1TZ7A 5T9CE 2FIQA 3LD5A 3AHTA 2P53A 1YX1A 2TRSA 2EG8A 3AXXA 3WLKX 1UP0A 1XIIA 4Y8EA 3OA3A 2VHLA 4LS0A 2FVLA 4Q7NA 4C6KA 1TV3A 4GACA 4GRSA 4O4VA 1G69A 3LX9A 1QNVA 2NQ9A 3QW3A 2HRWA 4GXPA 4YLWA 5FEZA 1XI3A 1HGYA 5CGMA 1JCJA 1U2YA 1CGUA 5HNTA 3FVMA 2EJAA 3H7RA 3NEHA 1GNXA 4ACYA 3ES8A 3WDJA 5CSSA 4WJ8A 1VFOA 1VRDA 4LCQA 4YTRA 3UXAA 5AC4A 3NPXA 2PGFA 1FP8A 3T09A 3GG0A 1FWBC 3SUSA 3TCSA 1DXFA 4POCA 1T5AA 5I6SA 3WMSA 1A4LA 5K9DA 1XLIA 3DYPA 3TOYA 1I75A 1VPXA 2PTDA 2JGQA 3TX9A 3NQDA 3E02A 3VIKA 4LUTA 3HN3A 5EMJA 1FCVA 3PBVA 1ZL1A 4AD4A 2NVAA 3WNLA 2WPBA 2GQ9A 2R1NA 4QE4A 2UY5A 3IJLA 4QLKA 3NG3A 3SFKA 4KGJA 5EFDA 4DJDA 4OE7A 2ZRYA 1KTNA 3HF3A 4Z2HA 1EWDA 3DC0A 2XWDA 3PZIA 3QXBA 3T05A 3TJ4A 4JCMA 1GONA 4U2ZA 5BOFA 4MADA 3B8UA 4PFHA 5TF0A 3NQ8A 4W84A 3L65A 2W62A 3AWOA 1YYAA 5A1AA 3GXFA 4TTUA 2GSEA 4WDUA 4IICA 3T4WA 4GVFA 1OCNA 1SM9A 4IFKA 5U4NA 4KQNA 3BLOA 3ZJ7A 1TCDA 3G6LA 3KLKA 3E0FA 2H9AA 1YW1A 1T41A 5A2AA 2C19A 2WM1A 4LRTA 2BY1A 4I5XA 3ZT5A 1ODUA 4OOZA 1R6WA 3RPTA 1W3NA 1NDWA 1W1A1 3KAOA 9XIMA 4R7WA 3S2LA 2Y61A 1GVRA 1PEZA 4IISA 1TYGA 1S2TA 1KRBC 1TWWA 4PRRA 4NJJA 1WBHA 1E6RA 2H3DA 1M04A 1KBIA 3RRAA 1LLOA 1XINA 3H70A 1SFSA 4K1WA 1A3XA 2ZTKA 1M53A 1J5TA 5A6MA 2Y5SA 2OSWA 2O7SA 3BDKA 3NOEA 4HD5A 5ECUA 2F38A 1WZAA 1RCXB 2NQJA 1FWGC 1NDVA 1W54A 2VR5A 2WBGA 4DXXA 1GK8A 2J9ZA 3QYSA 3MZNA 4A2SA 5CCZA 1WDRA 1XYZA 3H7VA 3G1HA 4GVHA 4LYPA 4C6BA 1L8PA 4AHOA 1NOFA 4MY8A 4LNCA 3WLRA 1ITCA 4HU3A 2NUWA 4GKLA 5DRCA 1IEIA 2PDFA 3P8JA 2QAFA 3AC0A 3Q45A 2QCHA 1TIWA 3PUOA 4M7SA 3A13A 3GO2A 3IIPA 3GXPA 5G1MA 2IQDA 2ABAA 1I45A 4YTQA 4GYKA 2WJDA 3AHVA 1H0IA 2HVMA 2DY3A 3WQ4A 3M0MA 2PE4A 3URAA 1KLZA 2QCCA 3GR4A 4H7VA 1A5UA 5DMLA 4D6JA 2QIWA 4QS6A 2HK0A 3E74A 1R3SA 4DO4A 5AB3A 4KWVA 4O14A 1OF8A 3GC4A 3G1DA 4BK9A 1IXNA 2Z6JA 5F1VA 4XZ9A 2WSKA 4Z17A 1OCBA 3H26A 2OEKA 4HYWA 3SUTA 3VMNA 1XF0A 3KBSA 3UG5A 2W6RA 2XIIA 2INFA 3ABOA 3W75A 3CAVA 3KZPA 3GVQA 1MRQA 4F48A 3IRDA 4Z1CA 4KRUA 3EWWA 4YCOA 3WD2A 1K6WA 1F5ZA 2ZWZA 3L9CA 1UD6A 1DIEA 3RCNA 4I9TA 1UZDA 1SZGA 2YPIA 4XZBA 4HK7A 2XIJA 3L2LA 3HOJA 3PFMA 4RZ4A 3NZ1A 1FWHC 5ABTA 4UFMA 1SZEA 2VC9A 1E9ZB 1HZYA 2ZXAA 3VDCA 2DVTA 1NF0A 4IWWA 1BXBA 4HU0A 2FZMA 5IDIA 3B03A 2I5QA 4XQ6A 2X1RA 2X1IA 1R85A 2J62A 1TJRA 1UHVA 5LNSA 1JCLA 3MKKA 1Q85A 4TXEA 3URNA 1P6CA 1NVMA 3TQ0A 1TUFA 3EDEA 5JMUA 2YXGA 3TONA 3WLSA 1JEZA 1I0DA 1L6FA 3HB9A 4QIUA 1VIZA 5A5WA 4QJ4B 4RUBA 1XYLA 4G5DA 3M0KA 2PLKA 2AMGA 4MJZA 4AU0A 3IJIA 5HDRA 4RR4A 3UJEA 4M56A 2W79A 3UBPC 2VP8A 1UH4A 3S5YA 4QNWA 5LNVA 1CXEA 1AQFA 2G3JA 3UWVA 1H60A 2HS8A 1SMDA 1E5NA 2PGWA 4ZB5A 3VNDA 3WL1A 2RFGA 3KZSA 2HK1A 2JF6A 1OFQA 1W3LA 3PNZA 4PEKA 3PB0A 2PC8A 3AIBA 4IPIA 1RXOB 1LF1A 4N42A 3QMTA 4AVFA 4PEEA 4KRTA 1BTCA 2WWCA 4V33A 3OJGA 3S3GA 3KCLA 1CYGA 4PC8A 4LUSB 4IUGA 3ARQA 5LIXX 3WENA 4B90A 2ZUSA 1RJQA 4IMDA 3N2CA 5DLCA 4FZIA 4WD0A 4O52A 5M5DA 5DCBA 4NY2A 3EXSA 4WEVX 3WLQA 4DYJA 5FF2A 4RDZA 4EF8A 1OC6A 1EP2A 4AAJA 5E1QA 1WB0A 1QCWA 2XFYA 4DJDC 1Q7ZA 4FX6M 4L56A 4LX4A 1IYXA 4MPQA 3XIMA 2PFHA 3G1SA 3UG8A 1REQA 1AQ0A 3BMWA 2X05A 1GOIA 3UY8A 3AIVA 3VMPA 1RQHA 4GJIA 2JE8A 3WFLA 1FH7A 4J3VA 3EB3A 4JOMA 5DCEA 3MMWA 3E2QA 1E9IA 1DKWA 4RE0A 3FEQA 4LGXA 3NA8A 3GW3A 3SCQA 1LUCB 4ZE5A 1P6BA 1QUMA 1WDPA 4NL1A 2VC5A 5HATA 1EEXA 3N4EA 1BYDA 3B0UX 3DGRA 4H9TA 1JQXA 3L5AA 1R3TA 4S3DA 3GXMA 2ATSA 4DXKA 2VURA 1ME7A 2YYTA 1XG3A 3GNPA 3S1UA 1VFFA 5T8GA 1V8EA 2VQTA 1W3TA 1YTEA 3QLDA 5D8ZA 2P88A 3CGTA 1BVNP 3NSXA 1M7PA 4GKTA 3IK4A 3QY7A 1JULA 2JKAA 2J7GA 3RHGA 3SURA 4IQDA 1SJCA 3F03K 3CB8A 4RNFA 4GD0A 1R46A 3C8NA 2ZZ4A 3H2AA 3L4UA 3NQMA 1HJXA 3GYEA 7REQA 3EWZA 1GKRA 1JCTA 3UZZA 3W1XA 1TZ9A 2OOGA 4W86A 3RU8X 3QV7A 3NURA 3G2GA 1HO4A 4GI4A 1WXJA 4GISA 3G0XA 1PZ2A 3V36A 3NQGA 4AHPA 5I2UA 3LRKA 2CITA 3U57A 4BF5A 2ADAA 2EKCA 1V0NA 5HQLA 3G24A 1ZP4A 1UKSA 4O18A 2VFFA 5G2WA 4ZQPA 4UR9A 1EBGA 1F4HA 2I56A 2E8ZA 3SRKA 4WF7A 3MUCA 4AMAA 2BVWA 3CZGA 2VDIA 3LCGA 1MI3A 3CV1A 5B80A 4C91A 4U33A 3MMTA 3K4AA 3OTRA 1GEHA 3AU6A 4O28A 5KZEA 3UFYA 4WQ6A 3DYMA 4ICMA 1P6WA 2E6DA 2ISSA 4J35A 4NJGA 3W73A 3IVTA 1ISVA 3EDKA 4IMCA 4S3AA 2V3GA 4GY0A 2WMIA 3N1AA 1Q6FA 4H7CA 3EPNA 4H1ZA 3TYAA 4IIFA 3F2BA 4S3KA 4B91A 3I68A 2DZXA 1JCNA 2PU0A 1MEHA 1UH3A 4EXBA 3PUGA 2AKZA 4JIPA 4XUYA 1CTNA 3ITLA 1VFMA 4Q3MA 1KQZA 1IEQA 3NQVA 3APYA 2G4JA 3K1GA 1HXJA 2E09A 4K2SA 2A5HA 3EX2A 4WOQA 4MFDA 3NO1A 1EH9A 4ZE4A 5HQEA 2Q6ZA 5CZKA 3MPGA 3U4FA 3WQCA 1TPDA 4QRNA 1JZ6A 4WKAA 5CZ0A 3N2OA 3CWHA 3W3OA 1MNZA 2EJ1A 4UTLA 4PCFA 3HM7A 1FA2A 3KS6A 3GDTA 3VIJA 3C61A 4C1KA 4FF5A 4MFEA 2VKZG 4YHGA 1FWEC 4GQGA 4J2MA 1AMKA 1FQ0A 1D2KA 1GG0A 3GTHA 2PDXA 3NYDA 3KXQA 1SSGA 4GUHA 4QP0A 3LZ5A 3NZQA 3GDBA 2DT0A 1NSJA 1VKFA 1AFSA 2CCRA 3P8IA 3M0LA 4DF1A 2AAMA 1OK4A 5D05A 1UWRA 1IT8A 5F7UA 5HINA 3SM0A 2OX4A 1UIPA 2CHNA 3VTRA 3VD3A 5IM51 1XYAA 3VE7A 5DBTA 4C6IA 1QI2A 3R11A 5PTDA 2Z1XA 1JDAA 1CIUA 2F9RA 4J3SA 1QHPA 5FIPA 1S2AA 2ASHA 1UPMB 2ZOXA 1LL4A 4JNMA 4I8YA 4UTWC 1ZY9A 3GIQA 3BLFA 3IVSA 1AH4A 3WJWA 3LGGA 1V93A 1TWSA 5AVNA 3S2JA 2YL6A 4GI8A 1UWUA 4N7QA 9CGTA 1QW9A 4OFCA 1ODZA 4RE4A 1UKPA 3M44A 3EMCA 3PTDA 1PCKA 5DO8A 1Q4NX 3SY1A 3PAOA 4AWTA 1JGIA 1Q13A 6REQA 2WHMA 2NXGA 4KFNA 5C2XA 3RUBL 3AHZA 1R87A 1F4AA 3PFRA 1XHGA 1GHRA 4O1BA 2GPTA 1T99A 4JX5A 1H11A 2WJFA 3C86A 3UETA 1FWNA 2DORA 3W7RA 4PA8A 2OCZA 3MSRA 3STPA 3TH6A 3ANVA 4TMBA 1Q6EA 4ACZA 3TNBA 3IGUA 4BS0A 4OU1A 3L4WA 2YLLA 3S2MA 2Z0IA 3UGRA 5A8NA 3GG8A 3B05A 3CZLA 4YXGA 1L6YA 3TTYA 2C6QA 2GDUA 3S1VA 2VVSA 3MV01 3T78A 2NX1A 3K2GA 4ZOEA 2GUUA 1SR0A 2I1OA 3UESA 3V18A 2EO7A 4DZ5A 1TQJA 2J66A 1TV7A 1RA5A 1RD6A 4JTUA 4K7YA 3VOFA 1Y5XA 3ARSA 1M65A 4MWAC 4PSRA 3MT1A 3D3AA 4LEQA 3AFBA 4Z0JA 2ZVIA 4PUNA 4ZO7A 1VPQA 4HOWA 3VYLA 4KGLA 1YDNA 5AYIA 1A3WA 3NUKA 4GWEA 1RP8A 4YHEA 1RVGA 4PR4A 2B0MA 4DO6A 3CASA 2OLHA 1VJZA 1NELA 1YTDA 5IXEA 3JU2A 4HYVA 2RKXA 3OIHA 3FA4A 3G8RA 5G2IA 2X42A 4JFVA 3C2EA 1XFCA 2GYIA 4AY7A 1R8LA 3C52A 2Z28A 3NAVA 1XLCA 4UR8A 5A8MA 2QCNA 1OCQA 3TC6A 1B1YA 1IXQA 3L2IA 2F61A 2DW6A 3EOLA 1TTIA 4DUVA 5KZDA 1TV2A 2X41A 1K77A 3K1DA 1JPIA 2CLIA 3DERA 4HMEA 4S3EA 4ONVA 4TX8A 3UXKA 3W24A 3NCOA 2XPKA 4ADTA 1JYXA 3W4RA 1CGYA 2P8BA 1RJRA 4AZ5A 3SRDA 4B5XA 2GQ3A 1UB3A 7ENLA 2DFAA 4HCLA 1LG2A 2EPOA 2V82A 2NQLA 4N4PA 4GGBA 1F6YA 1YNYA 3UR8A 3LXCA 1LRQA 2PZ0A 2G37A 3WFZA 3W27A 4H2CA 4DM2A 5F4XA 4HNTA 3LB0A 1XS2A 3ISIX 1MZRA 4ZCWA 4PB4A 3OQEA 2DUZA 2HS6A 2J6VA 5I02A 1QMLA 3LV5A 3G5EA 3UPWA 1EC7A 2G3NA 4O57A 3PZOA 4JTHA 4CQAA 1TJ2A 1ADDA 4IF2A 3U4AA 3L0KA 5EBAA 1ADSA 3PPFA 2WZMA 2YA2A 1V02E 2E6AA 5AVHA 3AZRA 3T0DA 1HL8A 4DWSB 3KW3A 1AMYA 2H8XA 4ZB2A 1E0TA 4DO7A 2XWEA 2WKLA 3UXLA 1X7FA 2BHYA 1GJPA 3BOFA 4M8UA 2W67A 3W22A 5FSEC 3PG9A 3UP8A 4R88A 1ZS2A 1YLVA 4Y8FA 3A6OA 3CL8A 3SW6A 3WZ0E 3ALGA 4W85A 3UY7A 1Z44A 4PB3A 2V5DA 2Z7KA 3DHPA 3BGGA 1VEOA 5DANA 3V35A 1SFTA 4JX4A 3K8LA 3OW1A 5F2IA 1P4CA 1XP3A 4FX8A 3N3TA 2E5BA 3BANA 3ITGA 1J6PA 4BWLA 3GXTA 1WAUA 2F6UA 4EPBC 4WXYA 1VFLA 2XDFA 1NU5A 1Q6RA 4L6DA 1NOWA 4LEFA 2OXNA 4Q8MA 2ZVRA 1DJGA 1Z89A 3T9PA 1VCVA 1KCZA 1DIDA 4K8GA 1HT6A 3BJFA 1H5YA 5C2CA 5LA0A 3E3HA 4E2OA 3OODA 2C1GA 1HX0A 1YDYA 5I0DA 1KBKA 4UFHA 2VZTA 4ZGYA 5HMDA 2BDQA 3EOOA 5LNRA 2NT0A 1V08A 5CPLA 3ZXWA 2G3IA 1AD4A 3AXKA 4WSJA 1XIBA 4F4RA 4ZO6A 2CLFA 3W7MA 1VH7A 4CVUA 4ZO9A 3BCJA 1EHAA 4GUFA 4F9DA 3L66A 4TVCA 3NVTA 2WAGA 3SADA 3N9RA 3LV6A 2YDSA 4Z1DA 1RBOB 1UR4A 1ZGDA 1FWRA 1UPPA 3WNPA 3WBWA 2IQ0A 3BG3A 1TMHA 1BWKA 2LLEA 2YW3A 2VZVA 5BOEA 2Z1BA 1HJUA 1LLWA 4GO8A 1FWWA 4H8NA 4G1NA 1EJXC 5E70A 3M5YA 4YTSA 3M6YA 4H8UA 2HNHA 1YIXA 1U22A 3TQVA 1Z32X 2GGJA 3WF1A 1PHQA 3ITTA 4FNQA 4HZ6A 3SQSA 3U3HA 4JN8A 5LXXA 3DESA 4UTJA 4PTNA 1XLDA 4ZA0A 4ZSUA 3SFWA 4Z1YA 1XBYA 3B97A 3HFYA 5FEWA 3RITA 3K13A 2VCCA 4M6PA 3W7JA 1UUMA 2PWVA 5EMLA 2DZSA 4LYKA 3M43A 5GVJA 1E72M 3GFZA 4UCGA 2DSWA 3KBVA 4GQBA 4AF0A 4AX6A 4CQDA 1UROA 1EPVA 3PNUA 4DUOA 3V5CA 1NY1A 3S9IA 4GNVA 3L67A 3GB6A 1SUXA 1VRXA 5A8PA 4PUKA 1A5BA 4JHZA 5CPNA 1V79A 3HQPA 1G4EA 3QHMA 4O1CA 4LRSA 3Q58A 2X7WA 1FFQA 1W1VA 3VNYA 1CXFA 3THQA 2VUNA 4QJ1A 4XSMA 2A3AA 2ZUTA 3SGUA 1N55A 5D2WA 2YX0A 1OFBA 1H5VA 4QLJA 1KKOA 5H8MA 3FJ4A 4FP1A 1GUVA 5HPOA 3GRIA 2GOUA 1FRBA 1UR9A 2GSJA 2VOMA 3O15A 4OUIA 3ABRA 4ASTA 3KL3A 1KTCA 4KWOA 3APTA 1FDZA 1H1YA 4KT2A 1NWRA 3IEBA 1K02A 5GNXA 3MHGA 3B8VA 2R94A 4DY1A 1NH6A 3R13A 1IEVA 4U3CA 4UB9A 3MI2A 4DNMA 4P2VA 3U7BA 4LS1A 1KBBA 1R3VA 5EBUA 1AUSL 4V28A 5ECVA 3KBJA 1BYCA 4F0HA 3E96A 2IS7A 5TBOA 3PANA 1Q7QA 3F4WA 3WUFA 1B3ZA 1PIIA 4D1JA 1M6JA 4H9UA 5F4WA 3T0BA 1CXLA 3II1A 2BVTA 4H4IA 3UWUA 3FXYA 1UWTA 1S2CA 4DBSA 3AROA 2OU4A 3NL3A 1MEWA 4O1AA 1REQB 4JIIX 4DAIA 1EJRC 3VK5A 4IGSA 3GBEA 4W93A 3B0XA 1EQCA 3ZIZA 3SIZA 4G9PA 2VGGA 3F5JA 1WKEA 3SJ3A 1K8CA 4Z1BA 4JKMA 2RH9A 3GVRA 3HO8A 4UTHA 5U7SA 4RPQA 4Q8NA 4JL2A 3DFNA 1Q6OA 2ICSA 4C60A 3C0JA 4H8VA 5BZAA 1QFEA 2VELA 3TUUA 1UH2A 2BBFA 2BVYA 4HPXA 3EB4A 1M68A 1E0UA 1PSCA 2WCSA 1CT5A 1S39A 1XSKA 4UTTA 1A5MC 3MO4A 2ZUUA 1H1ZA 2PDBA 3VGDA 6XIAA 1EUNA 1RH9A 1KCXA 3TSBA 4KCWA 1KBLA 4L4OA 1UC5A 5K2ZA 3R12A 1LOSA 2NLYA 3K5XA 4X61A 3CUGA 4ZQOA 4UFIA 7CGTA 1E43A 4WJEA 4AVOA 4F0RA 1EJWC 1ENUA 1PAMA 1CWYA 3GC5A 4K7VA 3W2UA 4LUJA 5HQMA 4CCCA 4GYPC 2NQZA 1J10A 4O0KA 1TMLA 2PRMA 3KBMA 3IS4A 3TKFA 4K38A 4C6PA 4LH8A 4O4WA 4BWLC 3SI9A 3UWZA 2OQHA 1M5WA 2P3ZA 2Z2AA 5ABHA 4L6HA 2QCMA 3GTNA 3TZNA 4FS9A 2ZRUA 4BZYA 3TAOA 1C8XA 3LPGA 1XCWA 3TR9A 4CNOA 1TPB1 4PMUA 2J25A 4LV9A 1CDGA 2ZXQA 2WVTA 5AC5A 3IJ6A 2DSVA 3EXTA 4BQ2A 2W61A 3RLUA 1PTDA 1GCYA 1W8SA 1W3HA 4PMNA 2Y5EA 1OX6A 4HMNA 2AQOA 3P7YA 1OIMA 2WHLA 2VZOA 1HF6A 3BAYA 4AC1X 4UNLA 5DT5A 2OMAA 1KM6A 2XSAA 4DZHA 4HK5A 1V02A 3P6LA 1JZ3A 3AXIA 4O19A 2B4GA 3E0LA 3NZPA 4HHHA 1RLDA 3STGA 1A4MA 1JPKA 3ITVA 1X39A 2QJMA 3W2LA 4GMEA 2O4QA 4QEEA 4ZOBA 3DG6A 3QSTA 4LJ3A 1TWIA 5HULA 3DFTA 3LYEA 4UZUA 1U33A 1R47A 3C8FA 4H7ZA 3GC2A 1TX0A 3WJYA 3GTXA 4V15A 5DBUA 2V69A 3A4WA 2Z1SA 2D69A 3GNOA 1XRSA 4JFUA 2Z1VA 3QGKC 4CU8A 2G50A 2CLLA 2WSPA 4PMZA 3PBYA 1RPXA 4HA3A 3LLFA 1KM5A 4WY0A 2TODA 3T2OA 1WZLA 1ESWA 1KFEA 1K9DA 4FXJA 1OADA 4O8AA 3UA4A 4CNNA 1AL8A 3E0VA 4GI9A 4IPPA 3GG7A 3LBCA 1ZJIA 2X8RA 1C93A 2EPMX 2ZKMX 1TPWA 1W5NA 3TSMA 2RAGA 3SCRA 3MC5A 4MNJA 4UWMA 3UZXA 1CNVA 3UCCA 1HP4A 3UGVA 4H6KA 3OOQA 5AC6A 1IWPA 4B4HA 4PMOA 2CLKA 1DL3A 2Z4GA 3P61A 4MWAE 3LA4A 4WY0B 1PZ3A 2PSNA 2Q01A 1C9DA 4GA8A 3FYPA 3D47A 3LBMA 2UY4A 1OC5A 4D6CA 5LIYX 2QVHA 4E5TA 1MYRA 1CLVA 2CERA 4W7VA 4QXIA 5IBXA 4A21A 5I3FA 4QG9A 2EHHA 1LM1A 4U31A 4GJ1A 1HKVA 1TX2A 5E0CA 3SRFA 3GNXA 1XYCA 1PX8A 1J0ZA 1FWFC 3NZGA 1GOQA 3W7GA 5I7GA 3PBWA 2Z6IA 4NF7A 3C5QA 2XIBA 4FPSA 4AD5A 1PIFA 3HFTA 5HNUA 1LLZA 3FEMA 3CNYA 5FJIA 1ZNNA 4PULA 5B7ZA 2QT3A 3ABSA 3KVMA 8RUCA 1HJWA 5LZLA 1YRRA 2CPUA 1P7TB 3N4AA 3OZOA 3B0VC 2ANUA 3TJXA 4C6EA 2RDTA 3MS8A 3E49A 4CQBA 2V2HA 2GDVA 3VA8A 3XINA 3N12A 3OVPA 4C7FA 4IP7A 4OBRA 1TG7A 4QDPA 1S46A 1UR2A 2CBUA 2VX4A 1QI5A 1LROA 3R0DA 4J2PA 3UA3A 3W2MA 4HHMA 2NWRA 3O3RA 1WDWA 1DWJM 2XM2A 3OLGA 3WCZA 4HNOA 3HJEA 3OA5A 4YU1A 3K8MA 1EF3A 1US0A 2W63A 3VZZA 4MMWA 4AB4A 4W8BA 4UC5A 5JQ9A 3UPMA 1Y7VA 2E7FA 5CBBA 4ZO8A 3GUWA 4MPKA 2P50A 4NNBA 3AMLA 1V6YA 2A7NA 1HKWA 3W1AA 3GSMA 1SYTA 4X9YA 4UQ9A 2B81A 3AIUA 1GZ1A 3S42A 3GY1A 4P8UA 4Q4RA 5CKSA 4Z2LA 1QT1A 3TE9A 1PVNA 1OBAA 3WDHA 4MWAB 1OK6A 2WMGA 4M51A 4GZEA 4L9YA 2YL5A 3AS2A 4G56A 2GGHA 3VNLA 1HW6A 2JBMA 1KM3A 2WWDA 3N3MA 2CWXA 5EMUA 4JL1A 3QMSA 4UQCA 4AZ6A 2CLOA 2JIWA 4L9XA 3H22A 4RX0A 4J5NA 3VI2A 5L6UA 3W1QA 3O0FA 3P67A 4AD3A 5CBJA 1NP2A 2WW5A 3CIVA 1K8XA 1DJIA 1VYRA 3O2LA 5BXRA 2OB3A 3EOUA 1V7YA 4IFRA 3TAKA 1LYXA 3ZO9A 3ZR4A 2VUYA 4FB7A 4WIWA 2CEQA 1MVYA 4IXXA 3SZ8A 1SVDA 2D20A 2G5WA 3W6YA 1XC4A 5CC6A 3CIWA 5DMNA 1K4HA 3F4VA 4CCZA 2JF7A 9XIAA 1WKYA 2OGYA 3EPOA 3ZJ6A 4Q4PA 3MO7A 3NNTA 3PK7A 4BQ3A 3BLLA 2P0IA 3LOTA 3RR1A 5MKGB 4HBKA 1GPFA 3UF9A 3SY8A 3G1AA 1EB3A 3FVDA 1HGWA 1N8FA 3NGFA 3GAKA 3WQGA 4B2DA 4S2BA 1UJQA 1GHSA 4B3LA 5C9ZA 2OGJA 1OIFA 2QDGA 4OBSA 5LNUA 1F8IA 3T55A 3LQLA 1VS1A 2F2KA 3W72A 1MW1A 1JCYA 5MKGA 4DVOA 2XN0A 2FMNA 4M6UA 3LEPA 3LPPA 1OCJA 4ZQRA 4JBRA 1K7FA 1LBMA 4GIYA 1CBGA 5F1UA 4DI8A 2VRQA 2E9BA 4DO5A 2QYGA 2ACRA 2XUCA 2AL2A 2DUAA 1B5TA 1HP5A 1ECEA 4J7RA 4XX6A 1X8CA 2VZUA 3T81A 4R53A 2FKPA 1TVPA 2PDUA 1DQUA 1XPGA 3LTPA 5AYXA 4L1WA 5DMYA 4DJFD 4Y9AA 1E4NA 2VC6A 1C91A 1T40A 3VOHA 1DJHA 1AQHA 3KRUA 3P5ZA 4ZVJA 2CKRA 2OR2A 3LK6A 3EDFA 4RW5A 4AZ7A 1YHTA 2GJPA 3VNJA 4MHBA 4H9ZA 3UQNA 4H04A 2PP0A 1ZBCA 4UOZA 3AS0A 4RXFA 2BXYA 4L1XA 3UCQA 1QK0A 3WDPP 1LQAA 4MAZA 1IIHA 3A21A 2GOKA 4IMAA 3CQHA 1U5JA 4PB5A 4MYAA 3Q4DA 5K3VA 5BMXA 3GTIA 4GZJA 4YVVA 3AS3A 3VNZA 4LVBA 1E70M 1GTHA 1G4TA 5HXMA 2DVXA 4KRZA 1EJTC 3OHIA 4ORMA 2A3HA 1BGAA 3H12A 1CLXA 4UCFA 1WBJA 2C8NA 1X6LA 4LWWA 1TVNA 3WF3A 3M5XA 3ID7A 3GIPA 4LY4A 1J4EA 8A3HA 2VX6A 4MOZA 4UTIA 4CD4A 3W7HA 1VBRA 5D2VA 1V5XA 3P14A 4QDMA 1CGTA 3MQTA 2NV1A 3BCDA 2WMHA 4HSHA 2PU1A 1YQ2A 3CTTA 1C8YA 1G7UA 4V27A 4LYRA 2VDGA 4R85A 3WQPA 1LOLA 1PDZA 1DJNA 4XBKA 2XZ9A 1L6WA 3L0GA 3ZS4A 2G95A 4Z42C 2UY3A 3S46A 4LYQA 1WKDA 2OTDA 4KESA 3VIHA 3APGA 1UZHA 3ZR6A 4EF9A 1TSIA 2WCAA 5I24A 1M7OA 2OO0A 1R5YA 4NAEB 1UR3M 2D22A 5KZMA 5CEWA 4ES4A 2DZVA 3UZWA 3UJ2A 3TFXA 1R38A 3QYQA 1Q5MA 3NZRA 5A6SA 2YFNA 4WUIA 2IMRA 4C6NA 1BPLB 3B8TA 1XLKA 3GNDA 3WKZA 2VD9A 3G1FA 1VEMA 1HJQA 1W2VA 1BG4A 1W5PA 3DKJA 1O7AA 3NIYA 3NPVA 4B5VA 3VIMA 8XIMA 4S23A 4PGLA 3TYDA 4UUIA 4W87A 4B2DD 4AYGA 2ZIDA 3GDRA 2QHAA 4RXGA 1DQWA 2Y85A 2CZVA 4R7OA 3T6CA 2RDWA 4HZ8A 4AWEA 4LANA 1E6NA 1GW1A 3OLIA 5I3DA 3AXMA 3LM7A 3CHFA 3NSMA 3QMRA 2GK1B 3ABXA 3W7EA 3W1NA 3MY9A 1H63A 1FHVA 3DBPA 1TE1A 2DIJA 4QTGA 4F2TA 3W2NA 4E3TA 4H9MA 3VGGA 3RJYA 2XFRA 3PZVA 2OOFA 2QPSA 1H7RA 1O1ZA 5JH1A 4F2UA 2OZ3A 3WD4A 2XH7A 5M2FX 4Z2KA 2V3FA 5CG7A 4Q4QA 3TFCA 3BLPX 3VIPA 4AXNA 3Q65A 3KBWA 5FEXA 4P7NA 4A05A 4KEMA 2W91A 4NX5A 1TQXA 4IM4A 4XAYA 3BLEA 1QDSA 1I1WA 2DT1A 2WM0A 1IE7C 2E4TA 3QH2A 1FWCC 2VX5A 3CPGA 5F2LA 5A8OA 2R1KA 2VFDA 1YNPA 3C0QA 4FA3A 2QF8A 1J5SA 1FKWA 3BW2A 4JTKA 3W7IA 2CWNA 4S3BA 4XSLA 3I4KA 2JFEX 4QE1A 2QCLA 1B9BA 2IW0A 4XZNX 4HCHA 4UFKA 4MSSA 2E3ZA 4X63A 3U2OA 5HPCA 3O9NA 4TO8A 2WYSA 2X7VA 1V6UA 4OJYA 4JTLA 1EWEA 3MB9A 2RJGA 1A5NC 1WOAA 3QFWA 4RZ6A 4LQ1A 2R82A 3LENA 3HJZA 1UWSA 2PWUA 1SGJA 3SB0A 5D2YA 2NX3A 1EC8A 4XVDA 4F79A 3CQJA 5HUOA 5KEZA 2GJXB 1WO2A 5KSWA 2QS8A 4CNUA 4LC8A 3PUEA 2D2JA 3QQWA 3LQGA 4I5RA 3KTCA 3WMCA 3SEPA 3UNDA 3T4CA 4AZGA 4ECLA 4MIMA 3T1GA 1MXSA 2FJUB 2EG6A 3G1XA 3O8AA 4HOXA 3KRZA 2YL9A 1HTIA 5E0FA 1DE5A 2I57A 2P0OA 1ICQA 4RDYA 3FK4A 1N7KA 3TA9A 2GVJA 4HJFA 3L4YA 2PCQA 2ZFAA 1MSSA 3AIEA 2QDDA 4JKLA 4LY8A 1OGBA 4MY1A 1HQTA 1CGVA 3BOLA 2ZDSA 3C3UA 2UBPC 3DXIA 3CAKA 4MZ1A 4DPPA 3Q2DA 2ZZ6A 4PL1A 4UTTC 2YOCA 2OWXA 1JNDA 1E51A 5AC8A 1QPOA 2OYLA 3BSMA 4CKQA 1P0EA 1TZZA 6A3HA 3B8WA 4M6VA 5HMSA 2XG9A 4FLRA 4R34A 4WGXA 3UERA 1OFPA 1UW9A 4PBGA 4UMAA 1UG6A 4JFSA 1EDTA 5DQPA 4GX9A 3S9YA 1PKLA 2FYMA 4TR9A 3KTSA 1KV8A 2CKSA 1PPIA 4RK8A 3S1XA 4PUMA 5HNRA 1W5OA 4F0KA 1KM1A 3B8SA 4ORIA 3F2DA 2WXDM 2NUXA 2HV5A 4HQVA 2QAPA 2WV8A 3SECA 1JRCA 2BLEA 3VUSA 3EOSA 1XBZA 1HIZA 4P5UA 1U1JA 5JBFA 3M64A 1VHCA 4QAWA 5T9BG 2XFFA 4UMBA 4HNLA 3JR2A 1VHNA 3BVJA 1GG1A 4GABA 4GJJA 3WQOA 5HBFA 3WIJA 3ERPA 2PF0A 3AJ7A 1EC9A 4Y9OA 2HNEA 4H83A 4JDYA 3DFQA 3USZA 1K70A 3W53A 2VJXA 1EX1A 5IDZA 1J0YA 2GVLA 2WVUA 4HPJA 3CH9A 2Y2WA 3AYVA 5REQB 3NFUA 1B3OA 3JRKA 2A85A 1BXCA 1LZOA 3UWEA 5T91A 4JTDA 4CU6A 3LN3A 1BG9A 2J7DA 1DV7A 3INPA 3CAQA 4IX2A 4A8LA 1JJKA 3QGAC 4WSKA 4PTDA 3TJIA 3N34A 4Q7IA 4I9MA 2B7PA 4O1FA 3WQ6A 4Z2JA 5LA1A 2VM8A 2ZUNA 4FNRA 1ZJHA 3T7VA 1VB9A 2DT2A 3CQ0A 3LU2A 5C9UA 4OT7A 4OOUA 4KKXA 2Y4SA 4LBSA 4TX9A 1UKOA 2FHCA 2D0GA 4G1KA 5J04A 3HZ3A 1IIGA 1U1UA 1BF2A 4WJXA 3PVFA 5C0QA 1SO5A 3POHA 1HKIA 1Q6QA 4AY1A 1AZ1A 2Z2UA 3KVLA 5HWJA 1ZP3A 1UMLA 2YR1A 3DZ1A 1RPKA 4PN2A 4DX3A 1J2WA 2HTMA 1KFWA 1DWFM 4HPGA 1XIDA 1A50A 5HNNA 2DJLA 4PBEA 3RK8A 2ZRXA 4YWSA 1A5CA 2J7FA 3NQ2A 5FOOA 3WN6A 1S3TC 4RZ5A 4CN6A 4EWJA 4US5D 3T42A 3TU9A 1K9EA 1S5TA 1PJ9A 4AZIA 4AF0B 1CI1A 4OHQA 1R9ZA 4QGCA 1GPWA 1EFZA 4JNZA 7ODCA 1LG1A 2HZGA 1EHNA 2PWGA 1ZZMA 1N82A 4FR6A 5EB8A 1L0PA 2XVPA 2AL1A 4QEHA 2ZWYA 4JKKA 3W82A 4DJFA 1AK5A 3PTKA 2J13A 2B7QA 4P7RA 1AVAA 5D32A 2ZUWA 3ARVA 2EXOA 3W26A 2ATMA 1HNYA 5D04C 2NV9A 4L9ZA 1IR1A 3EWYA 2CFFA 4F0MA 1DEDA 5KZ6A 5BW6A 7TAAA 4K39A 1SFJA 1PKYA 3FV9A 5XINA 3BAJA 4CNTA 4PTVA 1V51A 1JCXA 4KWSA 2GSHA 4FSAA 4Q4KA 1DHKA 1PZ0A 5DX7A 4UQDA 4LB4A 3SCPA 4PCSA 3M5VA 3BSGA 4ZZ9A 1XKJA 4DWDA 3WUEA 2RDUA 3KS5A 2HXTA 5CZJA 3WEZA 2J8GA 5A6TC 1F73A 3M46A 2AKMA 1QI0A 5DCDA 3QC3A 4JQ3A 3C2FA 3P2VA 1GVQA 1JD7A 1DBTA 1O4UA 4NZJA 3VM5A 3ZYZA 3VD4A 1HKKA 1Z42A 4FXSA 4ZQCA 2WVVA 1M01A 3ZWSA 2WMFA 2YCKX 3LM3A 4PMDA 1R2TA 2BOEX 4NJIA 3HGRA 4W8AA 3M47A 4GIEA 4O53A 3TV8A 4CD5A 3SQLA 1RALA 4CCDA 1S5VA 3IPWA 2H6RA 5G4WA 1YBQA 3N73A 2DQXA 3LTSA 2ZUVA 3RX2A 1T8XA 4LT9A 1W1TA 2O55A 2F8QA 4UTWA 3IV8A 4QISA 4UFJA 4F3HA 1TJ0A 4JEJA 1ECQA 3RXZA 1J18A 3BH4A 5CJ5A 4XO7A 2PTWA 2I14A 2CETA 2I17A 2INZA 1OJXA 4DLFA 4MJMA 1B2YA 5HAOA 3AIWA 2AQVA 1PB0A 3QPZA 3VKJA 3M0JA 3M5ZA 2VTFA 1CX9A 4L61A 4UTFA 4R27A 3FGCB 1Y65A 3H2CA 1LCOA 5AOUA 1F05A 2ON3A 1OSEA 1EX5A 2FH6A 1JFXA 4JTQA 3IJQA 5K7JA 1E40A 5C7HA 4LB3A 2WC3A 4JTRA 3W01A 1XLGA 3T08A 3JS3A 4HYRA 1DXEA 4FK9A 5AFDA 1R9YA 1RBLA 4H19A 3M4HA 1UUOA 1WX0A 3KOFA 4EPDC 4J27A 1OVDA 4GGHA 2D0FA 1KO0A 1AJ2A 3QF0A 3WBYA 3ABQA 1IQ8A 1RK6A 4PBFA 1N8WA 3G1VA 1TTQA 1TELA 1WUEA 4U2YA 2PAJA 1DJYA 3H4XA 3RYSA 2F2HA 2J8TA 4WSHA 2A2IA 3GVGA 4FLOA 1KRMA 3BL3A 1VBGA 2BX7A 4HZMA 1NWTA 1P43A 3V1PA 5LIUX 1AJ0A 4MY9A 1R3YA 5CPTA 1THFD 4GVIA 2E1DA 4JYFA 2NW0A 1KXQA 2A3CA 3E0WA 3KFTA 4Z0SA 3R1ZA 3AHYA 1B4KA 4GNKB 2R6OA 1LBLA 1CW2A 1VBJA 3GK0A 1PCWA 1C7TA 4LVFA 2G41A 2Z26A 4NU7A 3PZTA 4Q6XA 4YJ5A 1TE6A 3QC0A 4EAMA 4MDOA 5C70A 2WMJA 1XLJA 1E6ZA 3NPWA 1IT0A 6XIMA 4R3UA 5DMMA 3CPUA 2OZTA 1F3EA 1HJVA 1XL9A 3CIXA 4L6OA 3W6MA 3LBOA 3UZ5A 2J7EA 2WBKA 3R2GA 1WDSA 3B4YA 4NX0A 4IG2B 2CLPA 1W5MA 4Y9NA 4PUDA 2OQYA 5M3WA 2WZEA 4YTUA 4K8EA 5I3IA 1A5LC 1S5WA 3ARPA 3W7CA 4IZGA 2EAWA 4AIUA 3VGHA 4XUGA 2WZIA 1M41A 3UG4A 1CCWB 2Z1WA 4XK2A 2CZ5A 4H8HA 3SUWA 3CH0A 1Y0EA 4D6FA 1OHLA 1SO6A 6TIMA 1SU5A 1ELSA 3S6TA 4DUWA 3U6WA 5L9FA 3MSGA 3GG1A 4FOUA 2VCBA 2Y0FA 3G18A 3IAQA 3RO6A 5BCAA 2Z29A 4CLMA 1Z6KA 1LWIA 5ABFB 1P1XA 3TN6A 2FZDA 2Z25A 2Y89A 2YZ5A 4S3CA 4OV4A 3ZT6A 1AW5A 1XGEA 2YDQA 3W87A 3W25A 3PN8A 1RLCL 2EEXA 2D23A 4YYCA 2E5DA 1EPXA 1PBGA 4CNPA 3QY6A 4JPGA 1PS9A 2FFIA 4QSFA 3ZVIA 3ABZA 3H2FA 1POKA 5HK4A 5LIWX 3FDKA 4RNHA 3F4DA 3GNNA 5TAOA 5LSMA 3DU0A 1ZBWA 4PZVA 3WLIA 1XBXA 1PYFA 2Y6ZA 5E6YA 4B5UA 1XH1A 2Z2BA 5G2HA 3CMJA 5TD4A 1BF6A 3RM9A 5TNVA 4DB7A 3QRHA 3VNKA 5C7VA 4RV8A 1XGDA 4RE3A 2PWDA 2HISA 4KCUA 3RFAA 4JFWA 2ESCA 4US5A 2BGQA 1LT7A 1UZ1A 3A3HA 4E8GA 5I3GA 4WHBA 1JYNA 2GUBA 1AH3A 2GDQA 4NNAA 4XD4A 3OGVA 3EOEA 2PP3A 3SUVA 2DT3A 1HKJA 2OELA 4M1RA 2YXOA 1TV8A 2J9XA 2A3EA 4XD6A 2Y8KA 4G2DA 3B04A 4HU4A 3BURA 3R8GA 1JR1A 2E0PA 2JKPA 2XIQA 1H62A 1OC7A 2R1LA 4UQEA 1WXZA 1JI2A 5EMYA 2CLMA 5D4YA 3ZSTA 5A94A 2VYOA 3KHJA 4MTVA 4E4FA 3L2MA 4WXZA 2X1SA 2QDHA 2DV0A 1KTBA 3VU2A 1K03A 4WDTA 4CD6A 1JZ4A 5GJMA 5DXXA