4I8YA

Structure of the unliganded n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
303
structure length
303
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase, lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
total genus 114
structure length 303
sequence length 303
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i8yA00
3QR1A 1AODA 3V18A 3KS6A 1DJIA 4RW3A 3V1HA 2OOGA 4I90A 1DJXA 4GNKB 1DJZA 1VD6A 4S3GA 4F2TA 1T6MA 1PTGA 2OTDA 3I10A 1V8EA 4QJ3B 1GYMA 1QATA 3NO3A 4RW5A 2OR2A 1XX1A 1PTDA 3KS5A 4RV3A 3H4XA 7PTDA 3EA3A 1T8QA 3CH0A 2O55A 4I9TA 4I8YA 3H4WA 4R7OA 5T9CE 2ISDA 4Q6XA 3V16A 1ZCCA 4F2UA 4I9JA 2ZKMX 2PTDA 3RLHA 1QASA 2F9RA 1DJWA 1DJYA 2P76A 2PZ0A 3EA1A 5T91A 2FJUB 3EA2A 3MZ2A 3OHMB 4I9MA 4OECA 3L12A 1O1ZA 4PTDA 5T9BG 3RLGA 5PTDA 1DJHA 2PLCA 4QJ5B 3QVQA 1YDYA 4F2BA 4QJ4B 6PTDA 1DJGA 3QR0A 3PTDA
chains in the Genus database with same CATH superfamily
4EXAA 4WKHA 3VYLA 3MKKA 3G1VA 4MWAA 4O13A 4GUJA 5JUVA 7PTDA 3P3BA 2RAGA 1IQ8A 3M0IA 5EMMA 3PF3A 3AHTA 4GOAA 3OEXA 2POZA 4IPNB 1VZWA 2YB1A 1E72M 1KM6A 1VGAA 3AU6A 3RRAA 1HUVA 2OFJA 4LX4A 4LYRA 1DQWA 1MMFA 2WHMA 3TOYA 4NNAA 1XH0A 3Q67A 1Y5VA 3W00A 4EOUA 3WN6A 1R3SA 4QCEA 1Q4NX 1QDSA 1OCJA 1KLYA 2F7FA 1FFRA 1DXFA 2WKJA 5REQA 4H00A 1UZDA 2HNEA 4FLRA 3HPSA 3RMEA 5A6TC 1B3OA 1I8JA 5IHSA 4FNRA 3DG3A 1LL6A 5HXMA 2ZX5A 7TIMA 3DIPA 2WNZA 3GH4A 3OOQA 5BOOA 4E4PA 4ZOAA 5LZLA 3G6MA 3B0PA 5E0KA 3SCOA 3ZR5A 1LJYA 1F9CA 4QDPA 1ADOA 4O12A 4UQAA 3GXIA 3UF9A 1R30A 1DBTA 4A2RA 2CLMA 3CV6A 3LBOA 1K9FA 1W17A 2DZVA 1OF6A 4KCUA 3WF0A 3NPWA 3VUSA 1E6SM 1EJ7L 3E3HA 1JNEA 3JVAA 2B7QA 3PZQA 4MJMA 2V3GA 1J93A 3VO0A 3WD3A 5CC7A 2WMIA 4LANA 3NSXA 3VIOA 4GBUA 3DCPA 1UPPA 1XLJA 2WANA 3B8DA 1OFPA 3HQ1A 5CPMA 2D22A 3M5ZA 1GOOA 1WPCA 7CGTA 1TTIA 4H8NA 3VIFA 3EKGA 3H2FA 1WXYA 4Q8OA 3SM0A 2OOGA 1IXPA 4L9YA 1G67A 2F61A 4JTIA 1XQLA 4KWUA 1G9HA 2YJQA 4XX6A 3GNDA 1AQFA 1H60A 4AAJA 1Z8AA 4YHGA 1OCBA 3GWQA 1U1UA 5AC4A 5D38A 4N9DA 1X7IA 1XLEA 1YDYA 2YW4A 1XM3A 1LROA 1VIZA 4ROQA 2HK0A 2P50A 4DNMA 2OEJA 3STEA 2G95A 4N4QA 4PMQA 1I2PA 2DSVA 1PIGA 3W7IA 1M9HA 1FH8A 1WP6A 1UB3A 1JZ6A 3QHOA 2F84A 3MMWA 2OZTA 4JYDA 4KIEA 3OO2A 4GCXA 1NDWA 2VR5A 4PCNA 1VFTA 3D46A 2GL5A 1FWJC 3W02A 1WAUA 2IXUA 4WSJA 1EWDA 2ZZ4A 3WQDA 4I6VA 2WMJA 3WELA 3DZ1A 4B5NA 4L4MA 1BSLA 3S9YA 3TJIA 3QY7A 3TEVA 1W3HA 4F48A 4DUOA 3SFKA 2A3AA 3KE0A 1XICA 2FTPA 2X41A 3AYVA 3WL1A 1C7SA 1ZJIA 3FAXA 2WHJA 1NTHA 1OYCA 5MKGA 2IPWA 4M6QA 3VA8A 3DGRA 5G4EA 4J3SA 4HPXA 3E38A 1YPFA 1NWSA 3UYIA 5IFPA 3W29A 1VEOA 1F61A 3SCNA 1L8NA 5SWUA 4QE1A 1XD1A 3W83A 3ARPA 4YS1A 3A9BA 4P7QA 5AYXA 2BFGA 1UWUA 3WF4A 4Z2GA 2QIIA 3BJFA 3LRMA 3JZEA 5JBDA 3K4AA 2JF7A 1UWSA 2XSBA 4NF7A 1JIBA 4MJ2A 1A5BA 4L9ZA 1J2WA 4TQTA 3WMLA 1F6PA 4WY0B 4AX6A 2VUYA 1A4LA 1MQPA 5IOBA 3VXGA 2QUUA 4CN4A 5D2YA 1Z41A 4B2DD 4R7WA 1A0CA 3BW3A 1MZHA 3V4BA 3QFWA 4B92A 2DU2A 1WBJA 3FSUA 4F0RA 1GT8A 2HPIA 1C8YA 4O50A 3W87A 2J7BA 4AU0A 8TIMA 3RCYA 3CEUA 4ZSUA 4QR6A 3S9ZA 4NNBA 3MUY1 5AVHA 1D3GA 5TF0A 4MWAC 1BPLB 4JTLA 2J47A 3LGDA 4HA3A 2XYLA 5DXYA 3F2DA 5LSMA 1POJA 1JGIA 3LOTA 2PWEA 2X2YA 4Q7IA 2BGSA 1KTBA 2OZ8A 1EXPA 1TV8A 3QV8A 3BTNA 3L0NA 3PZVA 1AMKA 2OLHA 3WYZA 4R5EA 2Z25A 3S2CA 3TIMA 5CEWA 4H9VA 1MSSA 4AD0A 3VD4A 5A6MA 3LSBA 3TMLA 4RUBA 2FVKA 1BXNA 3DYOA 2ZX8A 3CIXA 5DY2A 4M1BA 2E4TA 3DKJA 4NJHA 2BY1A 2CXGA 2VWTA 4QNWA 2DQXA 4V28A 2VEFA 1U1JA 4K1WA 1VCGA 5HJLA 5BOEA 1O12A 1LRTA 1J0KA 1ZP3A 2JIWA 1G01A 3WF1A 1RY8A 2NSOA 3BG3A 3PJWA 4CQBA 4DI8A 3ATZA 2O9RA 1YIXA 3STCA 1QWKA 5BXTA 4WDWA 2ZUVA 3R8RA 3OW1A 3SDOA 2DH3A 4U4MA 4U5KA 1A0EA 1FY6A 3EWXA 1G6CA 1FDYA 4L6DA 3LCLA 4XKYA 1O5QA 1KFBA 5I02A 2EG6A 5G4WA 3S2JA 1I2QA 4WJ8A 4BKNA 2R6OA 1ISWA 4JTDA 1RK6A 3ZT6A 3OG3A 3P2VA 4MDOA 5I3HA 2XZ9A 1XS2A 4B5SA 1QPOA 3IJQA 2F6KA 1BD0A 3QVQA 5KZEA 3MI6A 3FGCB 2ALRA 2Y62A 2YBTA 2EF9A 2QGYA 4AF0A 4LJ3A 4B91A 3T2PA 3VKBA 3GSMA 1UWTA 4J27A 3AFBA 4XBKA 3HJZA 6A3HA 4E8DA 5XIAA 3RLVA 3BOXA 1UW9A 2FZ8A 1V7AA 5EYWA 3R89A 3DFQA 4ZO7A 3UWZA 3LRKA 4AQLA 2E9LA 2AOSA 2GUUA 3QV6A 1BXCA 2I9EA 4QITA 1DXEA 2E5DA 4NNCA 1FVPA 2CBIA 1PTAA 1D2KA 4CNUA 3GU2A 3IIVA 3MMUA 2ESCA 4FPSA 4WLCA 4H9TA 1THFD 3L7RA 5FL1A 3KDNA 1QXLA 1EOMA 3L2LA 5D9OA 3W1NA 4M80A 3RM8A 4YJ5A 3RO6A 1W5PA 1DJYA 1LWIA 3FKRA 3VGFA 2XM1A 3UXLA 1W1A1 5MKGB 4GIYA 1M1BA 2W79A 4K37A 2R82A 1H7NA 4UQBA 4EVZA 3II1A 3PB2A 1T99A 3B9AA 5D37A 4J7RA 4P2VA 4KKXA 1JZ7A 2ALDA 3GKFA 4PMUA 2A6NA 1J96A 4QQ3A 2GUYA 1CGTA 4LAOA 2BV9A 3OVGA 2YCIX 4HZ6A 4U2ZA 2HS8A 5FESA 4E8CA 5HMFA 1SW7A 4P8XA 5FEZA 2IQTA 4YNGA 4S3AA 1YTEA 1ICQA 3BLOA 3F03K 4FSAA 3INPA 3C61A 2VDGA 4PMNA 1VJSA 4UMBA 1QI0A 1OFQA 4AMCA 1QOPA 3M5YA 4B9ZA 3CQ0A 2OOFA 4PB5A 4XB3A 3HPAA 4HVXA 2XHYA 1J0HA 3WL0A 2WPGA 2PTXA 3IEBA 1F8IA 3AC0A 5AHEA 1OY0A 1ZS2A 3FS2A 4NI3A 2YPIA 2OZ0A 1A5LC 3GTXA 2W61A 2WBKA 3GZ3A 4UMAA 1VRXA 2ATSA 5I3GA 4I6KA 4NXSA 4QNEA 1FKWA 2FGLA 3GTNA 1EO7A 4XZMX 2A3HA 2QCLA 4DZ5A 3ZQ9A 4XBSA 3VCCA 1UP0A 2PURA 2AKZA 2WNNA 4JTKA 2UWFA 5DBUA 3W2NA 2QAPA 4PUMA 3U4AA 1H51A 3CTLA 3G3MA 4FR1A 3AZSA 1EIBA 3LTYA 1GVQA 1QNVA 1WXJA 2G41A 3CPRA 4FS9A 3BCDA 1GW9A 1XIGA 3GUWA 2GJPA 4IIGA 1EDQA 3ELFA 2DORA 5D02A 3V7PA 4DBSA 4LW7A 4EPDC 1JFHA 1IHIA 3IWPA 2VVSA 3PBGA 1L6SA 1AMYA 1LYXA 3FX4A 3BQ5A 2WSKA 1Q6QA 3KOZA 5HQEA 1GGOA 1A4MA 4AZCA 4XD5A 2VR2A 5T9BG 3AXHA 4Y9MA 3PSWA 4Z17A 3ARXA 3BANA 5ABFA 1DWJM 3EZ4A 2NUWA 4IP5A 2P0OA 4XIAA 4IWWA 2JQXA 1OFBA 2XH0A 5J5DA 2PDQA 3R10A 4QE5A 4JFSA 1J01A 3QW3A 1EJTC 2D2HA 2X0HA 1OSEA 3G18A 2GDUA 3FKKA 3KL0A 4YVVA 3CIWA 1NOFA 4B3LA 2Y4SA 4FX8A 1V6UA 2XVPA 5F2MA 3W74A 2KAUC 5C2XA 1UH4A 1EDTA 3TNBA 3PZTA 3TKFA 4AHOA 2V3DA 5KZMA 1TJPA 1W9VA 4BWLA 4NAEA 1N8FA 1YDNA 4L56A 1FWRA 3PTKA 3GR8A 1GVYA 1XLMA 2CZ5A 3KW3A 2IQ0A 2MANA 4AZCB 1TYGA 1WO2A 4OGZA 3WLSA 3ABQA 1SO3A 1XHGA 3P0XA 1DE5A 3HB9A 1LOSA 1WA3A 1NQ6A 2Q09A 2Z7GA 1MNSA 3URBA 4JNYA 5LXXA 2QZRA 2PDKA 4EWND 4IFKB 2NQ9A 5T26A 2VC7A 1PKLA 3TYCA 4CD6A 5BU9A 3BJTA 4RXGA 4H6EA 4MADA 5CKSA 2YW3A 4O53A 1VCFA 1R3TA 1KO0A 2BY0A 3AXIA 2W63A 2YOCA 2GLKA 3MPGA 4LALA 1TCDA 4A8IA 3VOHA 3JS3A 2V5LA 4AWEA 1W2PA 4OE7A 4HPGA 5HWMA 2FJUB 3UG4A 1W9DM 1KCKA 4BQ2A 3MA8A 5CSRA 3VNDA 4A3QA 1V6TA 3EAUA 3WLHA 3NG3A 4JTUA 4JTAA 2BZNA 5BRBA 4LYPA 1EPXA 3MTWA 4MB4A 4GQQA 3KOXA 1FWSA 1UP3A 4GPNA 1XBZA 1H3GA 3WSUA 1TR9A 3FLUA 2INZA 2X16A 4AD4A 2NQZA 4NJIA 1W0MA 1C29A 1XGEA 4L4OA 2NQ5A 3F5JA 3MUIA 1NELA 1QUMA 1F3TA 4GI8A 2J78A 4IUGA 1I4NA 1UKOA 3FA4A 1HJXA 3R13A 4IIBA 3SQMA 1M01A 2AL2B 2XH7A 2CHOA 2VGFA 3NQGA 1IEXA 1Q6GA 3LLDA 1DOSA 2E5CA 4NZ4A 1W91A 2CLPA 3MSYA 1MW2A 3T81A 6TAAA 4RR4A 4NX5A 1JDCA 2ZADA 1YDVA 1M68A 3WJSA 1KM0A 1VB9A 1UA7A 1J0IA 2HK1A 2VTFA 3LPGA 2RJGA 3K46A 3EOUA 1H0GA 3OGRA 1UWAA 2ACUA 4RZ6A 3GVRA 3QV7A 1SFJA 5LHFA 3NDOA 4GI4A 2FPYA 3WH8A 2R24A 3O6YX 1SW0A 3PB0A 1ITUA 3QGAC 1V6WA 3WLPA 5IFTA 1W1B1 4H1ZA 3M0KA 5F1UA 1HJVA 5HANA 3W22A 4HD5A 1RQHA 3M07A 1D9EA 3BG5A 4TTUA 5CJ5A 3ABOA 3AROA 4PUJA 1XYMA 3SIMA 2QXWA 4JCMA 3LY0A 2A6LA 2LLEA 1JZ3A 3GTFA 1FWEC 1LORA 1OGSA 3PPCA 1RSCA 4PTNA 1XWYA 1EX5A 3WQGA 2Y88A 4RKAA 1TIMA 1BWKA 3CTTA 2YA0A 2X09A 4YPJA 4E0CA 1VFFA 3RX2A 4BWLC 2A79A 3I65A 4MNJA 4DWSB 3E02A 3ZJ6A 1TJ2A 5F7UA 1TVNA 1WXZA 1YPXA 5GVJA 1Q8AA 4WSKA 2R1KA 1BVWA 2PWDA 1GEQA 3KRSA 4Y6GA 1QBAA 4IGSA 1G1YA 4FXRA 3AQUA 2JFEX 3P8JA 4OV4A 4Y8EA 1J0ZA 4J2MA 1AH4A 3BAKA 2HWGA 3T7VA 2ZKMX 3GFYA 4LAUA 1CXHA 3RLHA 1KC7A 4C6KA 1R2TA 5GJMA 3S1XA 2DEPA 5E9AA 2NQLA 3H2AA 3UBPC 2PLMA 1G4EA 4GCAA 4Y9OA 4CKQA 4GO9A 3WMSA 5H8PA 5HMDA 1PWMA 4MIMA 3AIBA 3TQVA 1E0XA 3RXZA 2QPXA 3ITTA 3UR8A 1RY0A 1A0DA 2R1PA 4FXJA 1XIHA 4JEJA 1JJKA 4O1DA 1VHCA 4KRUA 3UJSA 3WDHA 3GM8A 3WY1A 3V1PA 2DP3A 1XSKA 4G5DA 4H9XA 5GNXA 4H6RA 2I7GA 4KRZA 1EBHA 4JDBA 2D0GA 1B3ZA 3CL7A 2ACRA 3U2OA 1ADSA 3QYQA 2L5HA 5GJPA 3AZTA 4IX2A 2Q8ZA 3NOEA 3VGGA 3LNPA 4BI7A 1VP5A 3WCZA 5A6AA 3HFYA 2X40A 3GDLA 3MZNA 4GNJA 4ZFCA 4DPQA 5FCZA 4WY0A 1SZGA 3WBXA 3W1RA 2WMIB 3C3NA 3MVIA 1Q2SA 3GBEA 2WOQA 3RJXA 3AHVA 2HS6A 1NDZA 2NX3A 3E0FA 4Z0SA 4QJ5B 2KZHA 5AZ0A 3M46A 2ZRUA 1AQMA 3NZRA 4Z1YA 4N4PA 3NYZA 5HQLA 2RKXA 1SSGA 4IFKA 1E6QM 3AZRA 4O0ZA 3UWEA 3CB8A 1QNPA 3TU9A 2DZUA 3HJEA 1AODA 4W5ZA 2DZSA 3N11A 2YCLB 1TUFA 4C1KA 1HO1A 4GI9A 4YVPA 3RRXA 3U0HA 3QHMA 1YX1A 1XLFA 2VCCA 3A23A 3RK8A 2FTYA 3B8TA 3BOFA 3CT7A 4F66A 1GYLA 2AL1A 3LXCA 4PMDA 1L9WA 3HQOA 1E4MM 4HU0A 1W1PA 1GG0A 1C93A 2VGIA 3KL3A 3HV9A 4Q22A 4WOQA 3FY1A 3P81A 4HA0A 4JTRA 2VEKA 3WQWA 3ZSTA 1QFEA 3VGBA 4IHCA 3AYSA 1Z48A 5HNTA 2A1YA 5FACA 3FCPA 5C2CA 1XG3A 4ROPA 2XFWA 1QI5A 3GS6A 3T0TA 1E6NA 3N9KA 4WHBA 4E4FA 1VC4A 1PTDA 3S47A 2F6UA 3BV7A 3NVTA 4NU7A 4DEFA 2OPJA 3THAA 3TQKA 2QCNA 4UQDA 5CGQA 1EH9A 3WQ4A 4I90A 1NIUA 2OT1A 1G7VA 1GHSA 5FJRA 4FO4A 4NASA 4UR8A 1JQVA 4HHLA 2ICSA 2XU2A 3N73A 1OINA 3SQLA 4CQ8A 1NEYA 1JD7A 1DORA 2Z1KA 2UY3A 1IF2A 4GBDA 3ES8A 3E12A 2XISA 1ZBWA 2ISFA 1GOMA 3NQ7A 5I3DA 3V5CA 1WOBA 2RJHA 3T42A 4F9DA 2VRJA 2WKLA 5FJUA 2XGIA 1TSIA 1ZB5A 3W71A 3W1MA 2FZNA 1IIGA 3LZ5A 5FF7A 4H01A 1NU5A 3GKAA 2QV5A 3I10A 3PZNA 4WKAA 2VX5A 1ZAIA 3KOWA 2ZDSA 1AD1A 3TWBA 1H49A 4GE8A 3A3WA 1KM3A 4B5VA 1EJSC 4OOUA 1ME9A 4NZCA 5HJYA 3FJLA 4PMVA 1KD0A 1LLWA 1WB0A 3TZNA 1W1TA 3T8QA 5L6UA 2A3EA 3HGJA 5HUOA 1GTEA 2O55A 4H8VA 3NSMA 1SO4A 3T78A 4L65A 4GXPA 4NZFA 3VABA 4I9MA 1XLCA 2VT0A 1GTHA 5FOOA 3G1RA 2B7NA 3TSBA 4NRSA 1MEWA 2FHCA 3FYYA 1JUEA 4PUUA 3THQA 2Q8LA 2CCRA 4DQWA 4ERGA 3QZ6A 1GWJA 4H6QA 2F2HA 4HK6A 1W2VA 4H7ZA 1E0WA 1X38A 2HISA 1ONRA 3W7RA 4FEZA 4W7VA 5C54A 1E3XA 1SUXA 4H8UA 3WNPA 4M8UA 4WCJA 5G2IA 4MM1A 2I5QA 2IXVA 4G8TA 3QQ1A 2QVHA 3IJ7A 2DJLA 4LF1A 4OU1A 3K8MA 1CXLA 4B9YA 2YL9A 4J35A 1RXOB 1FWBC 4UR7A 3AS0A 1YPIA 3NO3A 1UH3A 1LZOA 2FZMA 3WLTA 3MUCA 5FJOA 3ABZA 4HA1A 4O0KA 1I60A 4D6EA 4PUNA 1P1XA 3LHVA 4O18A 1AUSL 2XN1A 5IRPA 3MU7A 3PJXA 1GJPA 1H1ZA 2EPMX 1AQ0A 1F4HA 3HV8A 4QLKA 1PVNA 4U2YA 4JFTA 4HP5A 4A22A 1JDAA 1RALA 4CNTA 5GQBA 3BK0A 1C90A 1RUSA 4JQ4A 1Q65A 1DKWA 2ZDRA 3S6DA 1Q6OA 3P0WA 3Q2DA 4L1WA 3W3OA 2JBMA 4DJDD 1VF8A 3ARUA 1PUDA 4TU1A 2YDRA 3GRIA 3YPIA 1OFDA 2X1IA 5DO8A 4MYAA 4JYEA 2PF0A 5H1WA 3R5EA 4HOXA 2OQYA 4IZGA 4LVGA 3ONBA 3IS4A 1H0IA 3CXOA 4GYJA 1OIFA 1CX9A 3A9IA 3D5HA 2B4GA 1WDRA 3GVWA 1ONWA 2V82A 3M0MA 1ECQA 5KINA 3WIJA 3A4XA 1XIBA 4Q4RA 2R1LA 1TMHA 4U3AA 1JDFA 3RUBL 3HG3A 3FDKA 2INFA 4UQEA 1UBSA 4HSHA 1R7AA 3QXBA 4I5XA 1FFQA 1XC6A 3DH7A 2OTDA 1TJ0A 5G2HA 4HGXA 4D72A 4A4AA 1YE4A 7ODCA 1J0YA 1LOQA 1N8IA 3T44A 1F7BA 3WD2A 4GVHA 2QMJA 3EX3A 1DJWA 3PZ9A 5HR6A 5AOUA 5EMUA 3WLJA 3TP4A 5G1MA 1BKSA 2O92A 1GKPA 2QJIA 4G56A 4HOZA 4O1AA 1ZBVA 2NSXA 2VFFA 2PP1A 3FSTA 3PBMA 4X63A 4PB3A 3IK4A 1ZQ5A 4P7LA 5TQLA 1GW1A 3LCGA 1S5NA 5H8UA 5A8NA 3GAKA 1H50A 4HKPA 1OWQA 4L1GA 5BWFA 3PTDA 4GZJA 4IFOA 3DYMA 4IP7A 3STPA 4Q8QA 1XSIA 2OR2A 1YNPA 1ICSA 1MI3A 5CSSA 2J88A 3G1SA 4GRSA 2PU1A 3WQVA 3BARA 4L6OA 2D20A 3NL6A 4UWMA 1GVOA 3VU2A 1I6NA 3EEGA 4D6CA 2QT3A 2FTWA 3KTCA 4M7TA 1A5NC 1Q6FA 1JZ4A 3NZQA 1X98A 3SURA 4GX8A 1OFRA 3EGJA 1D3CA 2ABAA 4MB1A 5U7SA 4MKNA 2NUYA 3T09A 2OYLA 4WXYA 4W86A 3W2KA 4X2RA 4RZBA 4BHYA 3HBLA 2J66A 2QS8A 3P74A 1SR9A 3EMCA 4IQEA 3MJMA 2VJXA 1SSDA 3PPHA 3W1LA 5AN7A 4WVXA 2ZOXA 3SCRA 3MW7A 3FJNA 3NQFA 3O9NA 1KWKA 3DX5A 2YYUA 2XPKA 4HIBA 3N15A 4DWSC 3BAXA 1K4GA 1W5MA 2OU4A 3GU9A 1B9BA 4PR4A 1P43A 2NW0A 2WYSA 4H9YA 2Q8XA 4JKLA 3VINA 2ZZ2A 1XYBA 2FPTA 3H7UA 1US0A 4JTQA 2NZLA 3MUAA 4DM1A 1JI1A 4QJ4B 1W56A 4OKDA 3SBFA 4FX6M 3REQA 4YLWA 4HYRA 1VJZA 1KFCA 3OP2A 1F3WA 1HKWA 2RH9A 4MJ4A 1EBGA 2PDBA 3B9EA 2OB3A 1LTDA 1R87A 4EAYA 2YLLA 3MYPA 2W6RA 3N3TA 2J8TA 3CBWA 1JULA 2I1OA 4AY7A 3TN5A 1W1YA 4IQLA 5FJJA 4ZBCA 3SFWA 4TO8A 4OIFA 2XJ7A 5JVLA 3C8NA 2F2KA 1BVNP 4XAYA 1P0NA 2X1TA 3P61A 1E51A 1MO0A 1UR8A 3D47A 1VPQA 3EOEA 3UG8A 5JH2A 1K3UA 3OHMB 3LUTA 3UERA 3MJYA 2CLLA 3CQHA 3DFHA 3B8SA 2ZTJA 2D3LA 3S83A 4UFKA 2HVNA 2I5GA 2ZWZA 3GHTA 1Y8BA 2DDXA 3QMSA 3MUZ1 1UWIA 1E3ZA 3ZOAA 3KLKA 2CNCA 4JTTA 4HK5A 4A05A 3MI2A 2UV8G 1ISYA 2DW6A 4AEFA 3VKDA 2JALA 1OX4B 4QHRA 4LEQA 4E6MA 4ZQRA 1A3XA 3B4UA 3CWNA 1J10A 4X0VA 3WFLA 3AI0A 3B0UX 1TWZA 4ZXOA 4AZIA 4AYGA 5BROA 5I78A 4HCHA 2UBPC 2DPEA 4JX5A 2YYTA 4LVAA 1UC5A 2RDWA 4EPBC 4L80A 3M0HA 1OFOA 1LBMA 3NSNA 4AY8A 1R9YA 4BF7A 1EGZA 1AL8A 4M7SA 2CITA 2QCCA 1MQQA 5EKYA 3HGOA 3T2QA 3E0WA 1K7XA 1VJIA 4JNZA 1UPMB 4RPQA 4XSLA 1TO3A 2IKJA 1A50A 4NL1A 2QR6A 1VYSX 4IGHA 1KCLA 3IJLA 3BW2A 4GHRA 4JZ5A 3FXGA 1V08A 1Q7ZA 2RFGA 3BICA 3KZSA 3W7PA 3VMNA 4O8RA 5TAOA 1AW5A 3ZSSA 4C6IA 3ZLGA 1TQXA 2OKOA 3PUEA 3M7SA 4MJZA 2XFYA 1HW6A 4IXXA 1FWFC 2ON3A 3DEQA 2YB4A 3S1UA 4FLQA 4PC8A 1O7AA 4ZL1A 3O8AA 3DFYA 4UXDA 3OVRA 5CH9A 5I3KA 3O06A 2Q6ZA 2FZ9A 1C9WA 3FXYA 2PDNA 4W8BA 1UUMA 1UA3A 1XRSA 3IJIA 4KFPA 2CZFA 3W73A 4QFUA 5M2FX 2EBNA 1XIIA 2BP1A 3MS8A 1R47A 2NLIA 3R25A 4CCDA 5D8WA 3IGXA 4GABA 4XAFA 4I7VA 5M17A 1J6PA 1M3UA 3PN8A 3RR1A 1SM9A 3NDZA 3H70A 4AZBA 1QATA 4ADSA 3BJSA 1NWUA 4YTUA 5D04C 5C55A 4MTVA 2X1RA 3HG2A 3HOJA 2D0HA 2PF8A 1JD9A 3NQ6A 3LQGA 3QM3A 3LZ3A 4RNHA 4JY8A 5EMYA 1EZWA 4MNKA 3DGBA 4L6HA 1S2AA 1W9PA 1WQ5A 3TYEA 1DIKA 1ME8A 3TV8A 1QW9A 1O94A 1IEVA 3STFA 3B4YA 1RBOB 4GIEA 2CHNA 1PYFA 3B03A 3BGJA 3W7OA 5EA9A 3P7YA 3MKCA 2BVTA 3AS2A 1LCOA 2YXOA 4DN1A 3K4WA 1VYPX 1VD6A 3TLLA 3WMBA 1EJWC 4U3CA 2XSAA 4KS0A 3V0TA 3RLUA 4EAMA 5CPNA 3S2MA 4PN2A 2P76A 4AVFA 3W75A 4AVNA 1M6JA 3M1ZA 1K1DA 4LBSA 5A8QA 1UD2A 4Z1BA 2NLYA 3TJXA 4JN8A 5HOSA 1TA3A 4C6BA 1BGAA 4QGCA 3E5PA 1GCYA 3UWWA 4GQBA 2YKKA 1S3TC 3KEHA 3P6LA 3MMDA 3WMCA 1GKRA 1T5AA 1K77A 2FB2A 2VP8A 1ZBCA 4V27A 5HA7A 5E1QA 4U31A 3RCNA 4GJJA 1FX6A 2ISWA 2EKGA 3KVKA 4HSOA 5C71A 3SCTA 4OBRA 1DJNA 4RZ5A 2ZRVA 2OXNA 2PTWA 2DVXA 1PCWA 4XD4A 4RNJA 2EQDA 4O16A 3ZJ8A 1HL8A 2G3JA 3VGDA 2G37A 4QCFA 1F6KA 1OX4A 4Z2KA 3KFTA 4LT9A 4AY1A 4I9JA 5HR7A 1HKMA 3OVQA 2A0NA 3E49A 1XR2A 3UJFA 4Q4QA 3W82A 1OFEA 1E5NA 5I03A 2HE8A 3AS1A 2ZX9A 3CUGA 1OT2A 2TAAA 1XLBA 3ZT7A 4EIVA 2BHYA 1EHAA 4DJFA 4W93A 4L1XA 4PEEA 2J6VA 4JR5A 4ADUA 5HWJA 3CH9A 1G94A 2VEGA 3CO8A 4C6LA 2V9DA 1C92A 4KEZA 1KXTA 4JIRA 4V1XA 4CD5A 3F2CA 1RJQA 3H2CA 1PWLA 3LHYA 3R94A 3THUA 4RL3A 2BTMA 1KNWA 5FKYA 3SGUA 4D9PA 1UR1A 1FBAA 3B06A 5DCEA 1RVGA 1U5VA 1GVFA 3R11A 4KEMA 1HJWA 1N55A 2EPNA 1BTMA 3L5MA 4QJ3B 1K03A 1XX1A 1QOQA 4GMEA 3HF3A 1V0LA 3E2RA 4BI5A 1TZ9A 3ALFA 4INFA 4XKYB 1EOKA 2QUVA 2V3EA 1OZMA 4XVDA 2E1DA 5D05A 1Z42A 2DW7A 3B9OA 4OECA 1M04A 5D2VA 1EA0A 3N9SA 5CPSA 1OX6A 1X1NA 1FXQA 3JU2A 1D3HA 4DBWA 1NOUA 4JX6A 2Y63A 1CIUA 4GINA 2A3BA 1J2BA 4S2BA 3ABRA 2AGKA 3EPOA 4A35A 4GUHA 3WJZA 1PAMA 2WJFA 3H12A 2A3LA 2NV2A 1EL3A 5HNRA 2Z00A 2BODX 1XYAA 2V2HA 4O1EA 3WLQA 5CC6A 2Y89A 5HMEA 2DFAA 1P0EA 2PWFA 1CT5A 3NZPA 2NQHA 2WCSA 4ZR8A 4XD3A 4JYFA 4WKFA 4PYSA 3SUSA 1WOAA 3RU8X 6ALDA 2CU0A 1MRQA 1ISVA 2BY3A 2GDQA 2V3FA 3IV3A 2F6XA 1DTUA 3IACA 1U5HA 4DO5A 3NQ2A 1GKQA 2ZE3A 1KKRA 1OK6A 5I7GA 2A3CA 3OJGA 2QCHA 3I68A 2PI6A 4UR9A 2Z28A 4QSHA 4RDYA 4B4HA 2ZUNA 3WF3A 2PB1A 2ZA3A 1ODUA 3MO7A 3L5LA 1CCWB 3AMDA 2OCZA 2VCBA 3B0VC 4ZTYA 5CSYA 3W1PA 4NQ1A 4L9XA 1X8CA 2BGNE 1WZAA 4C6MA 3L2MA 2VEMA 4FMVA 2C7FA 3M0LA 4XAPA 1MWOA 3W7EA 1UD6A 1XINA 3K30A 4XG1A 2V81A 3VK5A 4Q8PA 1R7OA 3NCOA 2VEPA 3N2CA 4JCLA 2XM2A 3C8FA 1WE5A 3A64A 4ZFMA 1GOIA 3PULA 4HHHA 1XC4A 4R3UA 2VL4A 1VFSA 7REQA 4AZ5A 1LT8A 3IJ9A 2CLKA 4IICA 3N14A 3GHUA 1V02A 4YN5A 6CGTA 5I5RA 1K70A 1FUYA 2HMCA 1WUFA 2C18A 2H3BA 2Y24A 3ISIX 3UR2A 4GJIA 4ML4A 3CZLA 3EX4A 1OM0A 3QSTA 4E3TA 3L4WA 5AC6A 2B31A 1SGJA 4LB3A 2DH2A 3W26A 2Z24A 3U9IA 3MANA 4ZB0A 4JHOA 5FSDC 5CAHA 1GORA 3N4EA 1J5SA 1E73M 4FR6A 1XYZA 2PA6A 3RLGA 1HN1A 2I5IA 2O7SA 2J13A 3F5LA 1OC6A 4Q3MA 5C2GA 5K9CA 1TIWA 4TVCA 3SO7A 1GVSA 4KCWA 3C2YA 1KBJA 2PLKA 2G5WA 1B0IA 1N7KA 2VI0A 5K7JA 2J7EA 3UR5A 4IGMA 1XLDA 4QAIA 1X6LA 1NF7A 5BWAA 2WMHA 4L4LA 3LN3A 3B8UA 3M6YA 1UG6A 3ZYZA 3VKAA 4LBRA 2OEKA 4H83A 2E6YA 5A8GA 1KBKA 3HMCA 4H41A 2YR1A 3QMTA 3QZEA 1BSIA 1FHDA 3VKCA 5C5YA 4DJEC 4G9PA 4JIIX 1A5MC 1IT7A 1RA0A 4RX0A 5ECUA 3GDTA 1LDCA 3C2FA 3S9IA 2V63A 3B05A 3ALGA 1HT6A 3BXWA 4IH3A 1KBIA 1PS9A 1S2WA 2WNQA 4S3DA 4YU1A 1MVYA 2GVYA 1XIEA 1KGUA 3SI9A 5C9UA 3G6LA 3KS6A 2GGJA 3DXIA 1AJ0A 1J5TA 3RR4A 2WK2A 3SY1A 4YVXA 4RW5A 1YXDA 4YYCA 3V35A 5CC3A 3FJ6A 4Q8VA 3VD3A 4UOZA 2J8GA 2PRLA 4PGLA 3TJ4A 2D1ZA 2ASHA 1E9IA 4KWSA 4JFVA 1TWDA 1DQUA 2E68A 2IQDA 1NP0A 4JGDA 3U57A 2A7RA 4NKCA 1SZNA 4M6UA 2HPMA 3PJTA 5EFDA 2X0YA 1BGGA 4HNNA 4CN6A 1LOLA 5A6JA 2PDUA 5A2CA 1PKNA 2PWUA 1TREA 2E6AA 3L65A 5HUPA 2VC6A 4JIQA 3WENA 1CW2A 1RD5A 5H8MA 5A6SA 2OLSA 1TWIA 5CBBA 5FJIA 1PSCA 4W85A 4P8VA 2AGTA 4YIWA 2C13A 1R3RA 1O1HA 3MKVA 2WJDA 1Q6RA 2HBVA 4JTEA 3USZA 4WK9A 3N04A 3VZYA 3O6AA 3WLLA 4Q32A 2BASA 1VS1A 4QG8A 1W6TA 2WJZA 3QLLA 2YXGA 3VVGA 4AHPA 4BQ4A 3H4XA 1QNQA 3W7JA 3F7JA 3KBWA 5CZ0A 2PDIA 1NOWA 4K6AA 1ALDA 4DJEA 5DY3A 4A3HA 1DJGA 4K3ZA 1L2QA 4YHEA 3VOCA 1QJWA 2GJLA 2JKEA 3GG1A 3ONCA 1SMDA 4PCTA 4D71A 3SB0A 3W1QA 2C19A 4V33A 2C1IA 5IDIA 1EZ2A 4LRSA 2Z27A 4H9MA 1B4KA 2CETA 1DWFM 1SR0A 4LGXA 3NPUA 1PIFA 4KFNA 2CESA 2GK1B 3B8WA 3T07A 3G24A 3MUXA 3UCDA 2QJJA 3HGSA 4IGNA 1JPDX 1KB3A 4ZQPA 2WMFA 3QQWA 3ITGA 3VFLA 1Q3NA 3L4YA 4FNTA 4MY8A 3PG9A 1B30A 4MHBA 2PCQA 2NV1A 2CXEA 1FDJA 3RM9A 4NSBA 3TROA 4GWEA 4C5YA 3WFZA 1GEHA 2J7DA 3GIYA 3BG9A 1B2YA 3UQNA 1E5JA 4AD2A 3O7UA 1HIZA 1QI4A 2GSHA 1IR2A 3CZKA 4WX2A 4PCSA 2B7PA 4FIRA 3SW6A 3CMJA 4JFUA 3UA4A 1JCXA 4J28A 2ZZ5A 1F76A 2CYGA 4KT2A 1YHTA 3GXDA 1SW3A 3C0QA 2PDXA 1FWTA 3Q4DA 1KM5A 1R0MA 4A2SA 3DHPA 1OCQA 4UTTA 3UVAA 4WRHA 3KVJA 1O66A 4HSNA 4PMOA 3ZWTA 3TFXA 3LXAA 3W01A 3WK2A 3IRDA 4AC7C 4PTDA 5DFAA 4YWIA 5JIWA 2X7WA 2OQHA 1VQTA 4S3FA 4CQDA 2V69A 5F2LA 3W84A 4V15A 1I45A 4AD5A 4LYKA 4RK8A 4MWAE 2FZBA 2Q3OA 3VOIA 2GDVA 2WAGA 1MUMA 4MUZA 2C1HA 3AUJA 3HGRA 4G1NA 3AXXA 3KTSA 1PE1A 1Z9AA 3E2VA 2D2OA 3GVQA 4ZQOA 2HQAA 1AFSA 3BLIA 2OX1A 1IIHA 1SJBA 3ZO9A 4KH2A 1UD3A 3NURA 2KX9A 3VNZA 4JTFA 4MZ8A 3T1GA 4PEKA 2CFFA 4D6IA 4IMEA 3QV9A 4XZNX 3L12A 2V5JA 3Q94A 4Q7BA 1DJIA 4PFHA 1FWGC 5I2UA 4YWSA 1T96A 4NP7A 1UH2A 2QF7A 1DWIM 1A5SA 2PLJA 3C5QA 2GSJA 1HG3A 1HKIA 1OG0A 4RXFA 4N7QA 2W0UA 3UY7A 1KRBC 3TYBA 2ZA2A 5IXEA 2PLCA 2O0TA 4PE8A 3MC5A 4R27A 2X2GA 4Z2IA 4GVIA 4LVDA 1KV8A 3W72A 4B5UA 3ICJA 4C6FA 3MSDA 4JL1A 4MY1A 3CMGA 1JGMA 3TA9A 2OYMA 1JG9A 5G1TA 3C2EA 4LSBA 1E55A 1FHVA 1WCGA 4OVXA 4M6VA 4O28A 3V5OA 4UMCA 4GKLA 3CAVA 3LPOA 4M5PA 1GQNA 1KLZA 3Q58A 3A13A 3WQOA 1SO5A 3H21A 3F4NA 1HTIA 4MOZA 2OQLA 3VDCA 1U33A 1AA1B 2H8XA 1A5AA 1P0BA 1PL9A 3WEMA 2VC9A 2NVDA 2GOUA 3LLXA 4MLJA 2J8FA 4O57A 3VNLA 3WUEA 1XBXA 3AXMA 3TX9A 1PKYA 4M56A 4X9SA 3G1XA 3F1QA 1QBBA 1YKWA 3FV9A 3QBUA 3SIZA 1V7YA 4MY9A 2QMKA 3NR0A 3VAVA 1XH2A 2GGEA 4FOKA 2FHFA 1BWLA 3DG6A 4NJGA 1S39A 4ATDA 2WW5A 4B5WA 3AHZA 1JI2A 1S1PA 3QY8A 4QDWA 4UTMA 1PZ2A 1VFUA 2OO6A 3ITYA 2Q01A 4TIMA 4YYFA 4ZOEA 3GVVA 4F2TA 4ZB5A 3W7KA 2BVWA 5KETA 1HJQA 3HTWA 1YDOA 2TPSA 3LCXA 2OWCA 4ICCX 1KBBA 2CLFA 5ABEA 3M9YA 4LTSA 1AJ2A 5DT7A 3K1DA 1M41A 1J12A 1EEPA 1JCYA 1HL9A 3NGFA 4EPEC 1AZ1A 2C91A 4LFYA 1WZMA 3UPWA 3ARRA 3LGEA 5ENLA 4UQ9A 2UY5A 4US6A 4PTXA 3MY9A 3H2NA 5K4XA 3MP3A 1YBQA 1MXSA 3W6YA 2XH4A 1V93A 1UC4A 1FRBA 4NYUA 5LGZA 1V4YA 3W9ZA 1OQFA 4QS6A 1TTJA 3EWCA 5I09A 3QKEA 3KCJA 1GPWA 5T8GA 4DELA 5AC7A 2B0MA 2Z7KA 2FDSA 3S5YA 3N2OA 3VNYA 2HTMA 3DHDA 1U30A 2EKCA 1EQPA 3BC9A 3S5SA 4IX0A 3I7SA 1CWYA 2VYOA 1XKJA 4N9CA 1PHQA 3V0UA 3EEZA 4LS1A 2WCAA 1GOQA 1QHOA 1XP3A 3I4EA 3W07A 1O5XA 1X97A 3EDEA 3SECA 1REQB 1SFSA 5HULA 1FDZA 3OVPA 3BMXA 3NL2A 4G2DA 1UR4A 1DP0A 1H7OA 2Q71A 5D2WA 4KEUA 1K9EA 1XIFA 4O11A 4XTIA 2C6QA 3TC6A 5T9CE 5I06A 3QPZA 2YL5A 3CZEA 4P5UA 1RJRA 4LV9A 2QJHA 5MHBA 1VLIA 2WCGA 2PAJA 3LG3A 3ARWA 3WZ0E 3NGJA 3P5YA 4AIUA 2O4MA 3P93A 2XGZA 1UOKA 3VIMA 1JPMA 4FF5A 3WNMA 4C6CA 4O17A 3HA1A 1FWHC 2PGEA 1U2YA 1WKYA 4R85A 2QCEA 3AYRA 3QOMA 1L6YA 4EE9A 3B40A 2RGLA 4XZ9A 3ZVIA 2ATMA 4HB7A 4I9TA 2W3ZA 1S38A 3R6IA 4IF2A 2VZSA 2ZUTA 2IMRA 1TJRA 4UZUA 4JQ3A 5A69A 1XRTA 1OADA 4NUWA 2ZUWA 3CS2A 4N9BA 2Z6JA 4UIOA 1H62A 4AX7A 3IGHX 2HE5A 4I7UA 2CLHA 5TNVA 3UJ2A 3I3BA 1P0DA 3H6OA 3QSRA 5FF3A 2YCLA 3ZR4A 4M51A 4ZGYA 4YMZA 3C2VA 4IP4A 3T05A 1VKFA 3S6OA 4CVUA 3AHYA 4MSSA 1XFCA 3O0FA 4CD8A 1KFKA 2O56A 2Y7GA 2CKRA 1FWWA 3NQ8A 2VZVA 2DUXA 1QI3A 1KGWA 2ISSA 4UCGA 3WK0A 3B9NA 4ZO8A 2WXDM 3FHAA 1CI1A 1FWNA 5FEWA 8CGTA 4GUFA 2VQTA 5C0QA 3V18A 1S46A 1TX0A 4PODA 2XN0A 2WWDA 3W70A 3CAQA 5FEXA 3H2MA 4FK9A 4DM2A 3VC6A 3LDVA 1JF5A 2D2GA 1HFBA 1B5TA 4WDUA 3N25A 1RHCA 2GQ9A 4HU8A 4OOZA 3R8GA 3PPGA 2C3ZA 4AWSA 4JKKA 1VEPA 4S38A 3NQMA 3UPMA 2I9UA 4JAWA 2GK1A 1VFLA 3QZAA 1O60A 3CAKA 2YGYA 1PIIA 4QTGA 3RO8A 4BS0A 3LMYA 1V3HA 2AQVA 2VHLA 2CHRA 1CENA 3FEMA 3SSZA 1NFPA 4GO8A 3J7HA 1UQZA 5AECA 3QMRA 3B3DA 3N12A 4RE4A 1P48A 3THCA 1T6MA 2DT0A 1FCVA 2ZCGA 5CXPA 4KBXA 2DVUA 3KS5A 5HDRA 3S8HA 2VFIA 3WJXA 1QI2A 1ZZMA 1YRRA 1Q6CA 4AD1A 4UTWA 1F07A 3W6MA 2VX7A 4DYEA 1U83A 3LPPA 4PCPA 3VIPA 4WDTA 3WG6A 4XZIA 2CBUA 2FH8A 4UTTC 4E5TA 2PDPA 3KTXA 2VFDA 3LHZA 1HL2A 1TTPA 3AWNA 4HTBA 3UG5A 1X96A 1ONXA 2BXYA 3WF2A 2HROA 1R2RA 4H2CA 1KTCA 3A4JA 2DQWA 3KHDA 3VDHA 4JTCA 3VPLA 4GLEA 3NL3A 4YTSA 1UR3M 4X22A 1OG6A 1V51A 1TV3A 4IFRA 1R46A 1O6IA 5AB3A 3IGSA 3LS9A 1FH9A 4MGGA 1YMYA 3MDUA 3H55A 4XKMA 1BQGA 3LM7A 1B90A 4PB4A 3DFTA 3W1TA 1XDJA 2A85A 2YL8A 1TV4A 4PUKA 2VC5A 2HRWA 1XLGA 1E4IA 4B16A 4FZIA 1E1EA 1MXGA 4LY8A 1ML1A 3BPWA 4AIBA 3W7CA 2FZDA 3M4HA 2NX9A 1GVRA 3UZXA 1UZ1A 2E1WA 5CCZA 3FK4A 3N2BA 3I7QA 3PUDA 3EDDA 3VNMA 3RPMA 4HMNA 3B8VA 1IV8A 2ACSA 3U3HA 4LC8A 3S5ZA 2PTDA 5HPCA 5AYZA 1W54A 4IUOA 4CLMA 4AYSA 2A2IA 2VO5A 1TPH1 4OBTA 1R8LA 4ML9A 5H2ZA 3BW4A 4WY0F 3L0KA 4DY1A 1WAWA 1ME7A 3QEZA 4RV3A 1JCLA 4WD0A 1NWRA 3L23A 3R0KA 1E0VA 3VTRA 3RILA 2XIJA 1I0DA 4F0KA 4TOQA 2VMFA 3W7MA 5FAGA 4GX9A 3WEOA 3UESA 4GZ7A 3LBMA 2NV9A 3VCNA 2E28A 3OHIA 1YEYA 3HQPA 1L0PA 4D6FA 3TAKA 4ERAA 1ZAHA 3QGVA 4AMAA 4O1FA 1TG7A 2XFRA 2GQAA 4LNCA 2ACQA 3KVLA 4QEEA 1EIXA 2QEZA 1SZFA 1EXBA 1JZ8A 1DWGM 1VENA 5REQB 2WMKA 5U4NA 4LRTA 1V0KA 2H9AB 1SFLA 4IPLA 2CWXA 3O1NA 3W7NA 4GYPC 4I7WA 4AZHA 1W1VA 5EY5A 1ZHAA 4U10A 1KBLA 2AQOA 1LWJA 2J24A 3HG4A 5ECVA 4OJYA 1E4NA 1W37A 4O52A 3W2LA 4ZQMA 3KBVA 2PDHA 3TXVA 4EX4A 2GGGA 3AJXA 3VX0A 4W8LA 4OWGA 3L5AA 4XZBA 3NQDA 4LBUA 2HJPA 3ZJ7A 4ZB2A 2PFHA 1H41A 1T41A 3L66A 4ADTA 2INEA 3VE9A 2VNCA 2ZZ1A 5HBFA 3LPFA 4TX6A 2QULA 3OLGA 3W4RA 5A2BA 3FEQA 3AIVA 1V0MA 4DLMA 4DYJA 1HZYA 3A4WA 1BTCA 2DZTA 4HMCA 3MBDA 2NT0A 3UGVA 5BW6A 4JBRA 5AKQA 2VX6A 1DWHM 5H6HA 1XKYA 2CLIA 3NEHA 4X2PA 5G5IA 1LG2A 2VZOA 5EBAA 3TZFA 1NVMA 3C52A 4UC5A 2BX7A 4AEEA 1FHUA 3UWUA 5E6YA 3VD5A 4GH1A 3A3XA 3V0SA 4HT3A 5B80A 1RCQA 3HO8A 2GPTA 1A5CA 2GUBA 3UGRA 1OD8A 2XH2A 3GB6A 3K8KA 4W88A 4C6EA 1CB2A 1E1CB 5IM51 4DIAA 1Y0EA 1UASA 4TVDA 3M0JA 2XG9A 3OU8A 4XAGA 1VBGA 4EP8C 3LD5A 4O19A 2X05A 1RBLA 2PBOA 4DAIA 2VQUA 1FWDC 1X7FA 5F4XA 1J79A 2GGIA 4DWDA 9XIMA 4LCQA 3SQSA 1T40A 3SJNA 4J3UA 1AG1O 3CUFA 1V6XA 1Q7QA 4S23A 4WGXA 1PO9A 2PTZA 4BJHA 1W5QA 1MDLA 1Q7MA 2FH6A 5T91A 4D2JA 1YLVA 3EBVA 1AQHA 4BK9A 4UTWC 3N9RA 4UCFA 3RGTA 2E67A 2Z29A 3VI2A 4MF4A 3BLFA 4NI8A 1DTNA 3S3GA 3M0VA 3U4FA 2XIMA 3BV4A 4XO6A 5FF4A 4MLRA 3PM6A 3SRFA 1XUZA 3E6EA 3JR2A 3PUGA 3DOPA 4WQ6A 3WH9A 4I8DA 4Q8NA 5E9XA 3U5UA 3V1HA 3PZUA 3G1HA 1IGSA 3S2LA 4ZTXA 2W5FA 2E8ZA 1BRLA 3S1GA 1EDGA 3C2OA 4TX9A 2P10A 2P0IA 3N2MA 4K39A 3WDPP 4HMEA 3BH4A 5AYYA 3LNMA 1S5WA 3N2TA 1TPDA 4I5UA 1IEWA 3FA3A 2PP3A 1DJXA 4XO7A 3CV1A 3PJUA 3EOLA 2ZX6A 4ONVA 1L6GA 3P80A 5BZAA 2WSQA 2V8ZA 2G3MA 3CT2A 1K8XA 2VURA 1BLIA 1TPUA 4NJKA 4LAMA 4LPCA 5CLTA 4N6EA 1BWVA 4MNLA 4AISA 5I79A 2ZZ3A 1DIDA 1VPXA 3OLIA 3SY8A 4XVEA 3N29A 2XWDA 3CH0A 4D1JA 2ZXDA 1C9DA 2J9YA 5AHIA 2E5BA 3RF9A 4O0QA 4D8ZA 4PBEA 3MHUA 3OIXA 1UD4A 3CQIA 4H9ZA 2GGHA 1DVJA 3GQYA 1RK5A 1RP8A 5BYWA 3IUHA 1OZQA 3QPEA 3VUPA 1CB7B 4LVBA 1F6YA 5AHFA 1P5BA 1F05A 3TR9A 1XYCA 3ES7A 4CQ9A 2FPVA 4DZIA 3GO2A 3GBDA 3UZZA 3N3MA 3AJ7A 3WDIA 2Z2BA 3PBVA 2WSPA 4UOQA 1DJHA 3RU6A 1E9YB 3TCSA 3WNOA 4AZ6A 5HJXA 1A47A 2QJMA 1TKKA 3PAOA 1UD5A 2HSAA 1R6WA 3T0DA 4NG3A 3OQ8A 2PDFA 3HN3A 4FNSA 3V16A 3MWCA 3FVDA 1SZRA 3PPFA 5EPDA 3BVJA 1TMLA 3UZWA 5BXSA 2YCKX 4Y8FA 4ZCWA 3JUGA 3WLRA 6REQA 4JN6A 1ZLPA 2NT1A 2W9MA 4K8EA 2FDMA 3BSGA 3GXPA 4DAFA 2WPBA 1A3WA 4O4WA 1PZ0A 4J3VA 3ME3A 4C65A 1HKVA 1MEIA 2FGBA 1ZUAX 2VD8A 2OSXA 3AMCA 2V5KA 3IIPA 4NILA 4D6DA 3H24A 4QSFA 1M53A 3LM3A 7REQB 4XBJA 2VFGA 2V67A 3DFPA 4DF1A 3H7VA 1P4CA 2WNWA 4J1OA 4L4PA 2PWGA 4S3BA 3SRHA 1PB0A 2ZVRA 4WZHA 3EA2A 1O1ZA 5M1TA 4RZ4A 3S5NA 1EA9C 3PBUA 4UFJA 3U48A 3WJWA 4GQRA 1UHVA 3R8HA 1KCZA 2J7FA 1M5WA 9XIAA 2NVCA 4XQ6A 5I23A 4AXNA 3GIPA 1CXFA 1EUNA 1UKPA 3BMWA 2G4FA 5BOFA 4DJFC 3H8AA 3M5XA 4PA8A 5DELA 1XF0A 1VBHA 4WUIA 3VMPA 5EB8A 2P8CA 1A3HA 1OHLA 3CUIA 2Z1SA 4Z2HA 1JAKA 2GVGA 3M7WA 3KHJA 2BGQA 3WBYA 4REQA 4L61A 4K2SA 2CZEA 4TV6A 3A5FA 1QHPA 3UXAA 3EMQA 4DB7A 4UTIA 1NFBA 4I9AA 1P1MA 1U5JA 1LLZA 3IJ6A 1XRVA 2Z26A 1Y5WA 1XDMA 2ZXBA 1RLDA 2PDJA 2PRMA 3IGUA 4H6KA 1WZLA 4NYYA 2SFPA 4JY9A 5C7VA 1JYNA 5A1AA 5A5WA 1OGBA 1W9XA 1QHZA 3CGTA 1UKSA 1V6VA 2WQDA 3UJRA 1Q8JA 3FAWA 3ITCA 3WNNA 2WM1A 4C60A 3H53A 2E3ZA 1YADA 2PE4A 4S3KA 1CXKA 4XISA 9RUBA 1ITCA 3MP4A 2AMGA 1LRQA 2E9MA 1SVDA 1V03A 2R9RA 3UR7A 2R94A 3LB0A 1K4HA 2WZMA 9CGTA 1WKDA 3LENA 3KBMA 1GJUA 4DJFD 2EJ1A 4CCEA 1TVLA 1X6UA 4ZENA 3PHAA 4HJWA 3TK7A 4FXFA 2EEXA 1JPKA 2XVLA 1W3IA 3FDGA 5BMWA 2EAWA 3OA3A 1BYBA 2XGBA 4G1KA 2Z1WA 2AKMA 3ARZA 3Q45A 2VFEA 4LF2A 2EGZA 5KTLA 5G1YA 2DZPA 5KZDA 1EKOA 1F3EA 1RPXA 3ZLFA 3LCHA 1UOZA 1YXCA 4A3UA 1RQBA 3NQEA 1HNYA 1RVKA 1QWGA 4WF7A 8XIAA 4JTGA 1CLXA 3HPZA 4LB4A 2EPOA 3MSGA 6PTDA 3NM1A 3RX4A 1VBRA 3PWGA 5DMNA 5JH1A 3GG8A 2YZ5A 1WKEA 4YCPA 1SJDA 4P7RA 3WQPA 2GZXA 2WMGA 1MYRA 2YZRA 2WLYA 3APTA 3TE9A 3OA5A 2GYIA 1PCKA 5HNUA 2IPFA 4W7WA 2Y61A 3GYEA 1WX0A 4PTMA 4UNLA 1SFTA 4UTLA 3A22A 2I14A 5EMLA 3R0DA 4TXEA 3O6CA 1ENUA 3BLDA 4HNUA 2NQJA 4KWVA 1GQKA 1KV5A 2AAMA 2TMDA 3PZMA 5E6ZA 4GVFA 4FP1A 1V5XA 2WZHA 2TRSA 1RAKA 4FOJA 4FXSA 1KRMA 4UB9A 3JRKA 3LGGA 3CIVA 3IJDA 2NXGA 5ABFB 3W7DA 2GOKA 3APYA 3SCVA 1JCMP 3S2NA 4LEFA 2ZZ6A 4FAMA 2XTKA 4DVOA 3SRDA 2E0PA 1S5TA 4URIA 3DBPA 3MYOA 4QLJA 2PP0A 3S42A 3MDWA 2J9XA 1H5VA 3ERPA 3E96A 3L4TA 2G3IA 3QYSA 1LBFA 3QJAA 2ZFAA 4E2DA 1RBAA 5I3JA 4QLLA 4P7NA 1FXPA 3T4WA 4IQDA 2DZAA 1QMLA 4AH7A 4ECLA 3A3HA 4ICNA 1MXDA 1QAPA 4LWWA 1O5KA 3R2GA 4IPJA 3ARTA 1PKMA 1Z44A 2X0SA 3PBWA 1MW3A 3EX2A 2DJXA 3LBCA 3N2XA 1JYXA 2HDJA 1IZJA 2WSRA 3I3EA 3MWAA 4I3GA 2XUCA 2QAFA 1GPFA 4DJED 2YFOA 1UZ4A 2AAAA 4CN1A 4RE2A 2G96A 2Z1VA 3UXDA 2O9TA 4GH3A 3MCOA 1Q85A 3VDAA 1XLAA 3JW7A 3LCFA 3TWAA 3UEQA 1GUVA 1C8QA 3TW6A 3WJYA 4UUIA 3ECQA 5BRPA 1E9ZB 4Q6JA 1QTWA 1PHWA 4GUIA 4HPNA 4JHZA 3GXNA 3NYDA 2YLAA 3AS3A 3L4UA 4JQ1A 4A6GA 4WJEA 1QNRA 4HN4A 3RFAA 1QK0A 3TH6A 1ISXA 1PEZA 3CK5A 5GNZA 1XG4A 5A8OA 3EXTA 2F8QA 1FTXA 1VEMA 5ABTA 1ZFJA 4W87A 3EMZA 2DGAA 4J2PA 2B81A 3P67A 3BDKA 1MEHA 1HP5A 4O4VA 5LA1A 2PWVA 2ZYFA 4X60A 3VIKA 3NXFA 2BHUA 2FKPA 4PH6A 3L2IA 1R86A 3TQPA 5EBUA 4GUGA 1F3XA 2OLAA 3PY2A 1EC9A 4A3RA 5KEZA 3BAIA 4KMQA 4RDZA 2X1UA 4QISA 4GQGA 1IXNA 1VHNA 3UNDA 4Z2JA 3WLMA 2H9AA 1KXHA 4IXHA 2W91A 4UNIA 1WDPA 1V79A 1I9CB 1H61A 4FHAA 4NT0A 1E70M 3L4XA 4ZVJA 3O6DA 1F2JA 2WHLA 4YL2A 1C8VA 2JGQA 3VGEA 2P3ZA 3VKKA 3NL5A 4JS3A 3B04A 4AZGA 4JPGA 1V8EA 1R3WA 1TWWA 2HVOA 2C15A 5DMMA 5CGMA 3W24A 4NHVA 2YSWA 1KXVA 1BYDA 3WH7A 2J27A 2V5DA 4DO6A 2Y2WA 3VIIA 3PSVA 1TPVA 3QR0A 5HWNA 2VELA 3SJ3A 1FWCC 5L9FA 2QCMA 5C8BB 3C0SA 1I75A 1NWTA 3U7BA 3PNUA 3BQ6A 2TODA 2YDAA 5A8MA 1NF0A 1PV8A 1QO2A 2O4QA 5CSUA 1XFBA 3WBEA 2ZIDA 3JZUA 5C7HA 3CC1A 1EJXC 1X1ZA 2VWSA 2PDWA 5D09A 1FH7A 3CO4A 3UW6A 3TN4A 1NY1A 4OUIA 3Q37A 3GDMA 4QM1A 1JYVA 1UKQA 3DG7A 3B9DA 6XIAA 3MCMA 2OX4A 3NEVA 2V5BA 4NAFA 3RMJA 3UT0A 1F5ZA 3NTYA 3LERA 1XBYA 3EX6A 3A47A 3TAOA 1EC8A 3BZGA 3M5VA 2P88A 4IIHA 1TV7A 3R58A 3BE7A 3O63A 1EEXA 2XVNA 3CL8A 1K7FA 4R88A 5DMLA 3SY5A 3CUXA 1MUCA 1DQXA 3D3FA 3G1YA 3ABSA 1E1FA 3VDGA 3VZXA 1XCFA 5I3IA 1CXEA 1B57A 3RCMA 3KBJA 5HNNA 1R5YA 4B4FA 2QKFA 1Q4WA 4PFMA 4K7VA 1LF1A 3EKZA 3O2LA 2PPGA 3TTYA 3EXRA 3DDMA 2BBFA 4GFIA 1OC7A 5BU6A 4X9YA 3W2JA 1IYXA 3I6EA 3FYOA 1UZHA 2GVLA 1V3KA 3THDA 1TPWA 3O16A 1XPGA 1LT7A 1XCXA 3RNDA 2GFTA 3TMQA 2ISDA 2X1SA 3VX1A 3NWRA 2CZVA 2PZ0A 2OG9A 1OCNA 3DU0A 1R9ZA 3I3DA 3QR1A 3CEPA 3SUVA 5F1VA 3KBNA 2PGFA 1E6ZA 1QNSA 1TX2A 1XYFA 2TYSA 3RPTA 1ZJAA 2OELA 2WVTA 4H9UA 2BVYA 2H6RA 3PWAA 1JCNA 4UTUA 4NZ5A 3M6DA 1MUWA 1XYLA 4XWUA 1QPQA 1Y5XA 1KR0A 3MB9A 3A5VA 2XIOA 4KGJA 4ERIA 3V75A 3TTQA 3ZZ1A 3E2QA 2V5CA 3C6CA 3WDJA 1GYNA 1A5KC 1X8FA 5LNSA 4O1CA 2Q02A 2MUCA 2V2DA 1HXJA 3EX1A 4G7EB 3AXKA 3IUIA 8XIMA 5AHLA 1NM9A 4C6PA 2EPLX 2DT1A 3VILA 4GY0A 1K8ZA 1Q45A 3R12A 4R7JA 1GNXA 2QDHA 2P53A 5CG0A 3SUWA 3TVAA 3HPXA 4HU3A 4Q8UA 1JPHA 4TV5A 4GIAA 4PMRA 5F4SA 3HFTA 4ATLA 2CERA 2ZRYA 3BAJA 1CGVA 2CBJA 1OIMA 5CPOA 3W7LA 4S3EA 1O68A 2ZC1A 3CUHA 2GJXB 2WVVA 1PZ3A 3IIZA 4DJDA 4JXCA 5B7ZA 5XIMA 4YTRA 1ZPTA 4PL2A 1UYQA 2NX1A 3G0UA 3OG2A 4DZHA 8RUCA 1PZ1A 3LHUA 1W9BM 2BMBA 2BS9A 1TV2A 3GFXA 3TUUA 4JQ2A 1GQJA 1UWQA 3CLWA 4P61A 2WHKA 4JIPA 3EDKA 1W8SA 4RCXA 4QQUA 2CLOA 1BAGA 4I8YA 1D8WA 3V5FA 2Y0FA 3L9CA 4H2HA 1HX0A 3REQB 4H8HA 1LM1A 2XIBA 2E9BA 2WBGA 1E4LA 3GNXA 3FOKA 4W8AA 1J4EA 3H54A 1Q6EA 1Z3NA 3BGGA 3RG6A 2G97A 1T0OA 4ACZB 3OBAA 1OEPA 4CU6A 5I07A 3PTMA 4U33A 3VKJA 3A12A 4OBSA 2WV8A 3K1GA 3C86A 2XVGA 3OB8A 1Z89A 4K8HA 3FN9A 4C6JA 4MAZA 2H3DA 2QPUA 2HZGA 4S1FA 4RW3A 3AOFA 4OZOA 3UETA 3W2MA 3GAYA 3DAQA 1RR2A 2E6FA 4W7UA 3IAQA 1WDDA 2J7CA 3LCIA 1JVNA 3N18A 4OHQA 1ZCCA 3VM5A 3DERA 3CASA 3NQAA 3VIHA 4A21A 2FQIA 2RDTA 2ZRXA 3N6HA 3CHVA 2PSNA 3PFMA 3F2BA 5JQ9A 3WFAA 3DKLA 2BVDA 1KQZA 1EFZA 2IPJA 4MZ1A 5C70A 1EQCA 4BQ3A 1WNOA 2NXHA 5TD4A 1TV5A 2F38A 5DMYA 2XVKA 1CTNA 3C56A 2ZTKA 3ARQA 3EB2A 2QGHA 3N17A 3AYTA 3MQTA 4HN8A 1SJCA 3RYSA 3GYCA 1K8CA 4RE0A 1EX1A 1W3KA 3R4IA 2P1FA 3RPDA 4EWJA 1WDSA 1KM2A 1BXBA 3TYDA 1W1IE 2B7OA 4LUTA 3LHWA 3GLCA 2JF6A 5JBFA 1LUCA 1EJUC 4DXKA 3EYPA 4IMDA 1US2A 2V6AA 1IGWA 3ITVA 1BF6A 3VMOA 1JRBA 4S3CA 2OSWA 1TUXA 3PR2A 4UTKA 1R3YA 5D8ZA 5EU9A 1MDRA 5I6SA 1OVDA 4FX7A 3T8LA 4EPKA 2DIEA 2EG8A 3OZOA 1QNOA 1H1YA 2D2JA 2VRKA 2NWSA 3M0YA 4OTKA 1H7WA 1QT1A 3LEPA 3SR7A 2QJNA 1FKXA 4H04A 3W38A 2BB0A 2J79A 2PMQA 5GNYA 3MV11 4C90A 1IR1A 1N82A 4F2BA 5CJNA 4JTHA 1V0NA 3GDKA 4MYXA 4DI9A 2XSXA 3KL5A 1TQJA 2E40A 3WK3A 3GR7A 3EPMA 4U28A 1TB3A 3RHGA 3XIMA 4F0MA 5D03A 3M44A 1NJJA 2QCDB 2E77A 4GA8A 2QCFA 5J04A 4CNSA 1W3LA 1SMAA 3DECA 4NJJA 4P8WA 3QHNA 2G50A 3CHFA 2WC4A 4QXIA 2AMXA 2QPSA 2YFNA 3M16A 4LH8A 2ABBA 2J25A 1H7PA 1ESWA 4R7OA 2OJPA 3OYXA 3RDKA 5LA0A 5DBTA 1YNYA 2OEMA 1IWAA 2BY2A 3ZM8A 1CYGA 5AYIA 2Y8UA 4LQ1A 2RDXA 3CWOX 1AH3A 3MV01 2NXIA 3NQCA 1DXIA 3U5YA 3EWUA 3SN4A 2I56A 4UZSA 4WDXA 1WDWA 3G77A 4IG2A 5ABHA 4R34A 3O07A 2VOMA 2X8RA 1W3TA 2D73A 3W81A 2DT2A 4IPIA 2PGRA 4MFEA 3BSHA 3SRKA 3OIHA 4MWAB 3QR3A 1V6YA 1S2VA 1OB0A 3PUOA 2W67A 3A21A 3NZGA 1H5YA 1X6NA 4D1IA 1GK8A 4F9JA 3SCUA 4JTSA 1YW1A 3G3DA 2ZICA 2IKHA 1RP9A 1W3JA 3ANUA 1JYWA 4HNLA 3ANYA 5KZ6A 1UKTA 3TJLA 4ACYA 3GHRA 3UCQA 4G6CA 1GJWA 4JOMA 2EHHA 3EA1A 3CZGA 5GPRA 3G1DA 2BNJA 4M81A 1HO4A 3BOLA 4B90A 1U1HA 4MG4A 4ZE5A 3PP7A 1QRQA 3GXMA 1R9XA 4EF9A 3U2ZA 4DWSA 5EFFA 4PRWA 3W6LA 3LV6A 5CPTA 2J7HA 5HMSA 2WLZA 3M0ZA 3F4CA 3DFNA 5DXXA 1SQ7A 5AHNA 1EB3A 4ALDA 5AZ1A 5FA5A 1JCJA 1E6XM 3SUTA 4HYWA 1ZP4A 2PDGA 4ZO9A 4EANA 4NZ3A 1S1RA 3UXKA 3BLLA 1IE7C 2C16A 4GXWA 2VUNA 2Y8KA 2BHZA 1AH0A 4C1NB 4DUVA 2V68A 4GACA 4X0NA 1AJZA 1I2NA 2A7PA 1TVPA 3T4CA 5E5CA 1RD6A 4D6GA 5F4WA 3NPVA 1XCWA 3EXSA 3OLEA 4CD4A 3K2GA 1H4PA 3G22A 5RUBA 3WLKX 5LIYX 4FLSA 1EC7A 1W9UA 3BAYA 2PC8A 3DENA 4UTJA 2BDQA 4W9TA 3LCWA 3TDFA 3W0KA 3UXIA 1I1WA 2VD9A 3EB3A 4Z08A 4M6PA 1LQAA 3UWQA 4ES4A 1UMLA 1QPRA 3NFUA 5G2WA 3M41A 3ZWSA 3VNJA 1LRNA 1XI3A 4FNQA 3VD7A 1L2UA 2Z0IA 1VYRA 3T6CA 1TMQA 4F0SA 1ZTVA 3NNTA 2CKSA 1V3JA 3BWWA 2W62A 1IZCA 3IRSA 1LL4A 4LAZA 4AFYA 4US5D 3G1AA 3WX7A 3AMLA 2BOFX 4P8UA 4IQJA 3G1FA 5I77A 4IJBA 1JAEA 2JKAA 3CZJA 4XZLX 2CEQA 2CPUA 4Q33A 2R91A 2QW5A 3KWXA 2I17A 1JXKA 1MFVA 1ODZA 2DUZA 2ZRWA 1F74A 1QW8A 5CPLA 3PZGA 2FJKA 2JGYA 2FFCA 3HM7A 3HZ3A 3R1ZA 2YCEA 1POKA 3GX9A 1EP1A 1DIEA 1JDDA 1AL7A 4QP0A 1VIWA 5I0DA 1Z7AA 3GW0A 4ZE4A 5AC8A 4ZXLA 4KRTA 4RLIA 4Y9AA 4REQB 4PBGA 4ILSA 4O10A 4Q6XA 2Y5EA 1TPFA 5C6MA 2WVSA 1XSJA 3QKZA 1ONEA 1BG4A 3K4DA 4IJRA 3GTHA 4JTJA 1KFLA 5EMJA 2VXNA 3FYPA 1R3QA 1EYEA 3E0IA 4DBEA 3V36A 1J9YA 3G0XA 3WNKA 2OWWA 3WQ5A 3WQEA 2YL6A 3VNIA 4N42A 3WBAA 2GJRA 3A4AA 3NUKA 4HTYA 4BQ5A 1TR1A 1ZY9A 3KX6A 2C14A 2DZWA 2Z2AA 3TC7A 1REQA 3FVMA 1GQIA 4HCLA 5JXQA 2J74A 3IJ8A 3WQ6A 1TCMA 3BZJA 4AVOA 2ZUUA 1YQ2A 4ZZ9A 4BZYA 3LI1A 3QC0A 4PMXA 4Q4SA 1HKJA 1XGZA 1EYWA 3BGAA 2IKIA 4YXGA 5FF0A 3P62A 4WOZA 2HXUA 5FIPA 4H19A 4IIEA 3S0CA 2E8YA 2WO5A 3GNRA 3SUUA 2ZZ7A 1B31A 3PZIA 3U7VA 3FFSA 4DPPA 4Q8WA 1TJ1A 4MB5A 3WH6A 2DSKA 4TMBA 2BXZA 3U2EA 1ELSA 4GG9A 1UMYA 1T8QA 3GY1A 2WQPA 3GD6A 1HGYA 4BCEA 2WB5A 3AAMA 3KP0A 3EDFA 2OSYA 4ZO6A 3WUFA 1FCQA 5M5DA 3BCJA 3W37A 4IIDA 2DIKA 4QX4A 3E74A 3AU2A 2EJAA 3BURA 4S2CA 3QGKC 1H1NA 3W1AA 1VFMA 2DSZA 5CZTA 1HVXA 2VEIA 4XAZA 2H90A 3DHUA 6REQB 3EKLA 3LYEA 4TMCA 1TA3B 2J9ZA 2ZX7A 4HMDA 1IT8A 4KWWA 1UBPC 5C9WA 2ZXAA 2GVJA 3CAWA 3RJYA 4D8LA 4DNHA 4FIQA 1M7XA 3QC3A 1HJSA 1KXQA 4Y96A 4ATWA 4N2YA 3KRZA 3POHA 5D30A 1IEIA 4HNVA 3FA5A 4KETA 2BG5A 4H7VA 1YTKA 3DN5A 1E6PA 4XSMA 2FVMA 1EPVA 1NQKA 5EGRA 1MNZA 4HHPA 2ZC8A 4C7DA 2XINA 3BLPX 4NRRA 4AC1X 1Q2RA 3BUVA 5CZJA 4C7FA 4QIUA 2XZ7A 5A2AA 1GQLA 1KFWA 1G0CA 1UQYA 1CECA 2DUAA 1CGUA 3W88A 1DWAM 3CPGA 1EJVC 1JZ5A 5AHMA 2JE8A 1TZZA 3ZR6A 4AF0B 3O15A 4Q4OA 3QW4B 2A4AA 5BCAA 1UJQA 4PUWA 6TIMA 4AUBA 2HCVA 5A95A 3D3AA 4R9XA 3CM4A 1VBJA 4ZODA 4KERA 1XBVA 1KM4A 4GGHA 2PC4A 1AW2A 1PDZA 1JUKA 2E25A 3B0XA 1HKKA 1P7TA 3ARSA 1GONA 1KFJA 4IL2A 4AG0A 3W28A 1GZJA 3G2GA 4CQAA 4Z2LA 5BRQA 3VDBA 4MKVA 1W31A 3WKZA 4GYPA 1V3LA 1UWRA 3NJ3A 1XH1A 4TUFA 5C9RA 3AIQA 2D0FA 2VDHA 2FMNA 3GNPA 4GZEA 4MZYA 4JHMA 4XV0A 2WM0A 4AHQA 1MRAA 4LV4A 3IK2A 2W92A 2HXTA 3TLQA 2NWRA 3DFSA 4PL1A 3C0LA 3M47A 3MVTA 3LRLA 4GYFA 2BOEX 3ZVHA 1IZKA 1FQ0A 1P6WA 3KCLA 2FMOA 3VE7A 4CU7A 4NAFB 1H2JA 1CDGA 5CC5A 3DYPA 6XIMA 2ZUSA 2OYKA 3DHFA 4K36A 3M64A 1JFXA 5LKYA 5E93A 1JF6A 1VFOA 4DF2A 3EPNA 1TE6A 3ZT5A 2J62A 3OPSA 3TYZA 1QW7A 1G4TA 3EWZA 4MAVA 1OFAA 4UQCA 3W1UA 4Z42C 4GQ0A 4LS2A 4POCA 2QJGA 1XIDA 5A8PA 1TRIA 4N6FA 3ABXA 4LY4A 3KP1A 4WSHA 4CVWA 1YYAA 4UTHA 2ZXQA 2QHAA 2VDIA 1WUEA 4LUIA 1LL7A 2Z6IA 3N19B 2QYGA 2CW6A 2CIPA 3KWSA 3LXBA 3MBFA 1N8WA 4J3WA 3S1WA 4FI4A 4UFIA 3O05A 4E3VA 1UIPA 4S39A 3KVMA 1AW1A 2J77A 4S3GA 4PSRA 1ZSXA 3TYAA 4RDWA 5A3HA 3ITLA 5LXEA 2FIQA 1ZU8A 1EUAA 1BYCA 2PWHA 5XINA 4FA3A 2NUXA 3AHXA 2YA1A 3FW6A 4NX0A 4JX4A 2JKPA 4GISA 3U8GA 3VOJA 4UTFA 4J5NA 4LUJA 1VCVA 4IMFA 1Y65A 3XISA 1FWAC 4QE4A 3NZ1A 3KRBA 4ZMGA 5IDZA 3KDOA 4YTTA 3FJ4A 4PCFA 3OQEA 1OBAA 4GNVA 1VH7A 1R85A 3BAWA 1NARA 3BO9A 4O1BA 3LV5A 1X1OA 2GQ3A 3S46A 2P3EA 3WD4A 1QOXA 2E6DA 2YXXA 3FIGA 1HP4A 1JR1A 2C0AA 3WD0A 1RJPA 4JICA 1EGMA 3UA3A 2OO0A 1JZ2A 4DO7A 4HNCA 4JKMA 4LS0A 3URAA 3GUGA 1L6WA 1V02E 1ICPA 5FJPA 5HPOA 1IEQA 4Q7NA 2R8WA 4QS5A 3NAVA 1LP6A 3WH5A 3V3WA 1LQ0A 3WLIA 3R0UA 3G8EA 5DQPA 1MZRA 4HZ7A 4R53A 5KSWA 4O8AA 5CBIA 2QDGA 1QPNA 4UOJA 5E0CA 3UFYA 1QCWA 3GC2A 1WBHA 1H63A 4M0XA 1S3HA 4C6DA 3SN0A 2VCAA 3QTGA 1L6FA 2GJNA 4OQVA 5LNWA 1GOKA 4GXMA 4F3HA 3AUOA 2GQ8A 5DRIA 3GW3A 4GY1A 3LI0A 3L67A 3P60A 4DF0A 3KLLA 3CJPA 4QROA 1SZEA 4PTVA 3G0SA 1Q5MA 3H7RA 2W66A 3MHGA 3L0GA 4QRNA 4BA0A 3AIEA 4F2UA 3TONA 4ICMA 4GI6A 3MZ2A 3NVDA 2ADAA 3WO8A 2ISVA 3UWVA 1BYAA 2VGBA 4WIWA 3GG7A 1XQKA 2P8BA 1H09A 3TR2A 2GSEA 3NO5A 3UY8A 4AWTA 4AZ7A 1PTGA 1LUCB 4TR9A 3KM8A 4V1YA 4FB7A 4KEVA 5K9DA 1B3XA 5HAOA 4KIRA 4MVAA 5DN1A 4E2BA 3H23A 4NXKA 2FYMA 2XFFA 2C79A 2Y1HA 2XWEA 3ITXA 4IG2B 3HPFA 3U6WA 3GFZA 1NDYA 3OZYA 2OODA 3MP5A 1XLKA 1I2OA 4ORIA 4F4RA 3T0AA 1I1XA 2YBUA 4LC6A 4JFWA 4JEQA 2UZ9A 2C1GA 3K8LA 5FI8A 1P6BA 3WLOA 1KA9F 3AMKA 1BQCA 4A29A 4B2DA 2O9PA 4YCOA 2R1NA 4PZVA 2WZTA 4BY3A 3R43A 4QG6A 2WJEA 3EOSA 4XIMA 2CLEA 4PRTA 2Z1BA 2J4GA 3PK7A 5FD0A 3SZ8A 3LK6A 3DUGA 3WQFA 4WEVX 1E9LA 4HA4A 2E09A 3OGSA 5C9XA 4PMJA 3ID7A 5D9NA 1R3VA 4C6NA 1ZJBA 2DSUA 2OT0A 3IARA 4LXFA 3T08A 3IUDA 1RZMA 3TCEA 2Y85A 5BMXA 4L5ZA 4HYVA 2REQA 2CBVA 2Y5JA 4LUTB 5FSEC 1UJPA 1EO5A 1S5MA 2XN2A 7A3HA 1XUUA 4F0HA 3IIXA 3ZVHB 3GE7A 1QASA 4EK7A 4D6HA 3UU0A 1XRFA 1A53A 3HMJG 4QDMA 4H7CA 4J3XA 2OKTA 3HG5A 1VRDA 3W25A 1WDQA 2CZDA 3OBKA 4Y9NA 1E43A 2OGYA 5A6LA 4LUSB 4F8XA 3WBWA 3PFRA 5BNKA 3OTRA 2PDYA 4LUYA 1PBGA 2R14A 3ARVA 3CLMA 1SU5A 4DBUA 1NSJA 2WWCA 3IVTA 3F4WA 3D0CA 1J0JA 3IAPA 1E0UA 3WNLA 1V3IA 4C6OA 1DJQA 3MSRA 3E5BA 1FA2A 2UY2A 1KRCC 1ADDA 3W1XA 1B3WA 3P82A 2BOGX 1EP2A 3C0JA 4TX8A 2V38A 5HATA 1TELA 4HPHA 4IISA 3SEPA 1A5UA 3QRHA 3ANVA 2VFHA 2IUZA 3N1AA 4LNYA 4IMGA 4UFLA 5DCBA 4KW2A 4M1RA 3QH2A 1OF8A 1Q66A 4JNMA 3STGA 5HQMA 5H91A 5I3FA 3N6JA 4KWOA 3WK1A 1HJUA 1ZENA 4AIEA 4KPLA 2JIEA 3VIJA 3W27A 3TTOA 1N2VA 4KGLA 1MQRA 1E1CA 3N13A 4MPQA 1PX3A 1S2CA 2HBXA 2WZIA 1J11A 3NO1A 1OC5A 1XLIA 2PBGA 3CPUA 3S6TA 1LLOA 1F8MA 3OGVA 2GWGA 1JPIA 1HQTA 3LSCA 4E8GA 3EWWA 4UBPC 1ECEA 3BCFA 3LU2A 4F40A 1CXIA 2OWXA 4H3DA 1JDEA 4JD4A 4EXBA 1ZJHA 2VM8A 4R33A 1XJBA 1KWGA 4ZOCA 4LCRA 2JEQA 3WQ8A 3QY6A 3GXFA 1GVIA 1O4UA 4XZWA 1EF3A 3H4GA 4AD3A 2DT3A 1AK5A 2VZUA 5C9ZA 2PUZA 2ZRZA 1KM1A 2VRQA 1VPYA 1BKHA 4MB3A 3KRUA 3T0BA 4DXVA 4FLOA 3CQJA 2VGGA 3AIUA 2A5HA 4W5UA 5AY7A 5AYBA 4JL2A 4L64A 4H4IA 3GHSA 2ZWYA 4D8AA 1FP8A 1B3VA 2AQWA 1J6OA 4BEUA 1OABA 3H2EA 2G0WA 3BMVA 3OBEA 1ZL1A 4I5RA 3IPWA 4ZOBA 2W4XA 4US5A 4IT1A 4RNIA 1S5VA 4K38A 1OYBA 3KBSA 2QV4A 1UUQA 5TBOA 3P5ZA 5FAJA 2EG7A 3MHFA 4RDVA 4DJDC 1VLWA 1O5RA 4CCZA 1DPMA 5IHRA 1O95A 1ZALA 4M19A 5LNVA 2X7VA 3KOYA 4HU4A 4M3PA 4Z1DA 4GVGA 4X61A 2Y70A 1TPEA 1I0BA 5DANA 1AVAA 3EWDA 3W23A 3UWYA 4J3ZA 4IMCA 4RE3A 1F73A 1XLLA 3KAOA 1W32A 4GD0A 2WVUA 4G7FA 3W85A 1HVQA 2PDLA 5CZSA 4GC4A 4JDYA 4HCDA 5LA2A 2EO7A 3G5EA 4MWAD 3DFOA 4GKTA 3GDBA 2FGZA 1T7LA 3P14A 3SADA 4N0RA 3QPYA 3NDYA 1B1YA 1K6WA 1CGYA 2D69A 3QN3A 4W4QA 4M82A 1LQ2A 2ANUA 3N6QA 4GFSA 2ONEA 2HEJA 3SCPA 4MPKA 1L8PA 1RQEA 2G4JA 3VOFA 2ZA1A 1UR9A 4JIHA 4MMWA 3T55A 4K8GA 3HU7A 1Q6LA 3CV7A 4DUWA 4LUSA 3AMGA 2RGMA 4OV9A 1CLVA 1R2SA 2G3NA 3LTPA 4CNOA 2VX4A 2PCEA 3CYJA 2XIQA 4DWSD 2HVMA 3W7HA 3DBNA 2D23A 1G69A 5CLWA 4NVTA 3WUGA 1UCWA 2VVNA 4P7OA 4QJ1A 4LU0A 3URQA 4EACA 3COTA 4CD7A 3TC3A 1K9DA 2X42A 4E38A 4AIOA 4RPPA 4S3JA 3VZZA 3QTPA 2Q3RA 3RX3A 1ZRQA 4HJFA 3H4WA 2DZBA 1MW0A 3AWOA 1EP3A 3CQKA 3GNOA 1J8VA 4Q4MA 2RHGA 4GGBA 4QBXA 4C6QA 4DO4A 3Q65A 3S4TA 1YXYA 4GYKA 3GVGA 3SN1A 4PMYA 4GNKB 4Y9PA 1V3MA 4GIRA 2REQB 4E2VA 1J18A 1BFNA 2XDFA 3L4VA 5IBXA 4RNFA 2O9OA 3PAJA 5CJMA 4Q8MA 3TSDA 4QEHA 3TTSA 1SPQA 3C3UA 1TFVA 2FVLA 3VCRA 4A8LA 2OVLA 1P7TB 4MFDA 1G4PA 3PS7A 3UZJA 2FLIA 1JNDA 3SCQA 1CBGA 1RA5A 2PD5A 3NOYA 5A6BA 2BXVA 1RPKA 3C2RA 5D2XA 4ENLA 1R38A 3CUZA 3UCCA 2HV5A 3LX9A 3PBYA 4V2XA 5E0FA 1FCUA 5JU6A 3HQNA 1FP9A 1YNQA 4IL0A 4J3TA 2VR4A 2HNHA 1OJXA 2QUTA 3B8IA 3LA4A 1US3A 5DEZA 3CNYA 2BLEA 4JIEA 3ZMRA 4GC3A 3A24A 2WVVB 1JXJA 1ZCOA 3WD1A 1ZAJA 3OYZA 3GR4A 3APGA 3CHDA 1DV7A 3MI3A 2EPKX 2FHBA 1VR6A 1KRAC 4WXZA 5FJTA 1FCBA 1XISA 4C7GA 2XIIA 2QCGA 1RCXB 3CV2A 4LYQA 1M7PA 3RM4A 1KGXA 1A80A 3TW9A 1RCOB 2QIWA 2Y7DA 4IJCA 2OZ3A 3NPXA 3AO0A 3HURA 4GY7A 4IIFA 4KESA 1P6CA 1PYMA 4DLFA 1T8XA 4AEOA 3VFCA 5K4ZA 1OGGA 4AW7A 4CNNA 5E70A 4RJEA 2PODA 4CCCA 1PDYA 5FF2A 4LCSA 1W5OA 1Z6KA 2PRHA 2IKGA 2YIHA 1W3NA 4LVFA 1GOXA 4HZ8A 1AD4A 5DLCA 3EWYA 4FNPA 1GOWA 1B9ZA 1Q63A 1K6AA 4BI6A 3CUJA 3T0CA 5D4YA 2POTA 2QVNA 4A3YA 1E6RA 5I00A 1BF2A 4WJXA 5DX7A 4AB4A 2IS7A 4PUEA 1MFUA 2WZEA 4K68A 3U2CA 4XZHA 7ENLA 3H2OA 2Y5SA 1WKFA 3W86A 2FFIA 5CZKA 1W5NA 4CQCA 4KCVA 1XXXA 2PZNA 3BLEA 3QLDA 2E7FA 2F9RA 3BLKA 5K9XA 2J75A 3G8RA 1DHKA 4XTDA 4IPPA 1PJ9A 5LGXA 4ZA0A 1BHGA 4U5IA 4B15A 4TTGA 4D6JA 3GNNA 5CG7A 4CEUC 1GHRA 2YX0A 2YA2A 1LWHA 4PRRA 2UY4A 1VAHA 3CWHA 3LHTA 4CEXC 1U22A 2C0HA 5F2GA 3IVSA 4O54A 3TNOA 5AC5A 3AIWA 1WV2A 2EXOA 4N02A 4NY2A 4FNUA 1GZGA 8A3HA 2QUMA 3WEZA 1ISZA 3W7QA 3PZOA 1I2RA 5D9MA 5DRCA 3N4AA 3SCSA 4DYKA 1JRCA 2C8NA 4FF7A 1C8XA 2G3FA 3VC5A 1X39A 3WLNA 2Z2UA 3KZPA 3UP8A 1PXGA 4IM4A 2VZTA 2QNEA 2PEVA 3I4KA 4B5XA 4OFCA 1EHNA 3CU2A 2I16A 5GJNA 5JBEA 3GH5A 1BEUA 3E2SA 4NZ1A 1GZ1A 3TQ0A 5FEPA 1KFEA 3PG8A 3UNTA 4G7EA 1XD0A 3UVIA 1G7UA 2V0TA 4C1NA 2RUSA 3TOPA 1RLCL 5A6KA 1B4EA 3KCOA 5HINA 1KW1A 4W89A 3R7MA 1XIJA 5A94A 3SCWA 1B54A 4AWUA 4XK2A 4KF1A 2DVTA 1XDLA 4WR3A 2Y8VA 4MDPA 2WC7A 3WUBA 2JEPA 1CPUA 3CMFA 3E0LA 5MF5A 1NH6A 1QVBA 3TN6A