4I8YA

Structure of the unliganded n254y/h258y mutant of the phosphatidylinositol-specific phospholipase c from s. aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
303
structure length
303
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYYYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title The cation-pi box is a specific phosphatidylcholine membrane targeting motif.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 114
structure length 303
sequence length 303
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4i8yA00
5T9CE 1DJWA 3EA2A 3V1HA 3QR0A 1QASA 2F9RA 1V8EA 4I9JA 2PZ0A 4F2UA 1AODA 2OTDA 4GNKB 2OOGA 2OR2A 3CH0A 6PTDA 4S3GA 4QJ5B 1DJXA 3QVQA 4F2BA 3EA1A 1DJGA 5T9BG 1GYMA 5T91A 2PTDA 1QATA 4F2TA 3V16A 3NO3A 7PTDA 3KS5A 1DJHA 3L12A 4I8YA 2ISDA 1VD6A 4I90A 4R7OA 4RW5A 1O1ZA 1PTGA 3MZ2A 3PTDA 3RLGA 4I9TA 3QR1A 1XX1A 1DJZA 4I9MA 3I10A 1DJYA 1T8QA 1T6MA 1PTDA 4QJ4B 4QJ3B 1YDYA 3H4WA 4OECA 3V18A 4PTDA 2FJUB 2P76A 3OHMB 5PTDA 3RLHA 3EA3A 4RV3A 3KS6A 3H4XA 1DJIA 4Q6XA 2ZKMX 1ZCCA 4RW3A 2PLCA 2O55A
chains in the Genus database with same CATH superfamily
3QC0A 5HXMA 2PP0A 4FO4A 1O66A 2QCDA 5EKYA 4GUGA 3W7NA 4MWAD 4L1GA 1U1UA 4PMDA 1GOOA 3IJ9A 2SFPA 1W3HA 4BEQA 2YZ5A 1WX0A 4ATDA 3L65A 4JIIX 2HRWA 4A6GA 4C6QA 5FKYA 4MNMA 1U5JA 2A7NA 2XGIA 4HTYA 3QVQA 4UTFA 5T9BG 2P3ZA 3FKRA 1QPQA 3KE0A 3W7MA 1NAL1 1XBYA 2UBPC 3E2SA 3WMLA 3CUFA 1A5KC 3G0UA 3LM7A 4C6EA 4OGZA 7TAAA 4FNUA 3GG7A 3E0FA 3PBWA 3GYCA 3TEVA 3LHVA 1V03A 3G1DA 1E9IA 2QDHA 1KM2A 2NZLA 3WUFA 2QGYA 1BYBA 5GJMA 5BZAA 2TRSA 4CCZA 4U31A 5AZ0A 4IJCA 1OC5A 4C6DA 2FZMA 4WF7A 3T05A 1YE4A 3EX4A 1HF6A 1ZALA 4H7VA 2HJPA 5D9OA 3LXCA 5E0FA 3FSTA 1A5UA 1HKMA 4B92A 5FF7A 3WD3A 1A3WA 4ZL1A 1I2RA 5EL1A 3P5ZA 4NZJA 1PKLA 4HYWA 4AYSA 1XYMA 4QAIA 3IIOA 1LOSA 1GHSA 2ZUWA 1Z44A 5FSEC 3CYVA 4K1WA 2NV1A 3AIEA 1EP3A 1W0MA 3BMVA 4LX4A 5I78A 1OF6A 4PRTA 1XW8A 2BY2A 5CZ0A 3KOXA 2XVNA 4HA0A 2PI6A 3QM3A 4LRSA 5BOOA 1FXPA 5CBIA 5DN1A 2G4FA 3QR3A 4N9DA 3GD6A 1AQ0A 3VD3A 4JFTA 5A6TC 3W1RA 2HPIA 1LF1A 4ZGYA 3ALFA 3R0KA 1QT1A 1UWRA 3WQCA 3KTXA 4V33A 5AC8A 3VOHA 1ONEA 4O1DA 3E96A 2DDXA 3F03K 4J28A 1R3SA 5AC4A 2YX0A 4S3JA 1SO6A 5DANA 3W82A 1R30A 2I1OA 3LPOA 2IKGA 2ZZ7A 3MMUA 1EC9A 3H70A 1X8CA 3THAA 1TA3A 4AD1A 3ZJ7A 5DLCA 2BXVA 2DW6A 3UR2A 1A5OC 5ABEA 3LTPA 5FJJA 3M43A 4MHBA 1ZCCA 1AQMA 1V0NA 3DFPA 3S1XA 4NJKA 5CJMA 3FIGA 5I3GA 4ZQCA 3BUVA 3HPXA 3M7SA 3BH4A 4PCTA 4X22A 1GJUA 2EPLX 4GY1A 5I3HA 2OR2A 3FDKA 1RALA 1OQFA 3B8SA 1YQ2A 1JZ7A 1AMKA 3LRKA 5C71A 1OHLA 3WD4A 3TUUA 1KV8A 1OFDA 3OBAA 1R2SA 3MSDA 2V5BA 4PTWA 3SY5A 2INEA 4CVWA 1JZ6A 1ZBWA 4PGLA 3WFAA 4A8NA 1SSDA 2R1LA 3CV7A 4TTUA 5K9CA 1W5PA 4R9OA 4CNPA 1O1ZA 3UR8A 3PPHA 2C0AA 4I3GA 3G5EA 4S3FA 5I24A 1JRBA 1J12A 3EOUA 3NGFA 5CPLA 1B0IA 1KWGA 1XUZA 1TX0A 3WK2A 3W7IA 2MANA 1VEOA 1WXYA 4WGHA 4KETA 1FHVA 4OV9A 3UYIA 4B5TA 3V1PA 3IIXA 2BGQA 3ABQA 3Q4DA 4LU0A 1NDVA 1KQYA 3MCMA 3CXOA 1DBTA 2WCAA 1OK4A 1PEZA 2OT1A 3GVQA 4RW3A 3N1AA 1PZ0A 1TE1A 3K1DA 5A2AA 2BVTA 3PZOA 3WDRA 2W0UA 4AU0A 4UFIA 4J35A 3BV4A 1OFEA 2UY4A 1CXLA 1XPYA 2O9TA 4GBUA 4C65A 3S1GA 2I17A 4WRHA 3R0UA 3C8NA 3RR4A 3CIXA 1YMYA 4I6KA 4QR6A 3WQ4A 3UXLA 4S3EA 1GQJA 3VKBA 3H2NA 1JDEA 3F5KA 4PZVA 3HBLA 3GB6A 1QMLA 3GNPA 3W7LA 1XLAA 1XCXA 2RDUA 2YYTA 2YDQA 1I1WA 5D9PA 3TN6A 1FVPA 2X0YA 3D6NA 2WC4A 2Z2BA 1UQZA 3BOXA 4Y8FA 4MOZA 4MY9A 4HN4A 1C92A 1KXHA 2CHNA 3VE9A 8CGTA 1RP9A 4E4FA 5HWJA 2OKTA 2QPXA 5DMMA 4GZEA 3WK0A 2NSOA 4XZHA 3PPCA 3EKZA 4NILA 3SGGA 4E2BA 4IIHA 1YPFA 5E6ZA 1A4MA 1XLIA 2XWEA 3CMGA 3RPMA 1E55A 2OB3A 3AHZA 2Z1XA 4XD4A 2XFRA 3HM7A 4MWAA 1KM5A 1Q6LA 3UZZA 4FK9A 3W38A 2BOGX 4RK8A 2FKPA 3UJ2A 5DCBA 3WLQA 3RJYA 4HHHA 3OYXA 4LJ3A 2CFFA 4MB1A 1HKJA 4KGJA 3FFSA 2D20A 3HFTA 3SJ3A 4ZB5A 3R12A 1BVZA 4IMEA 4HN8A 3VOFA 2FHFA 1K6WA 4FPSA 1P0DA 1TREA 3HPFA 4ZQMA 4QEEA 1KBKA 2YR1A 2ISDA 1NF0A 4CQ9A 3SSJA 3T4CA 3W1UA 3T42A 1MMFA 1XIFA 1SQ7A 3WSUA 1LORA 3A23A 3RILA 4XB3A 1H4PA 1L6FA 3H2CA 1VYSX 1Y7VA 4M24A 1BXCA 1H51A 3SFWA 3AYRA 4FOJA 3OVGA 3TC6A 3UXDA 1Q66A 1A49A 4NX5A 4D6GA 3BG3A 2PWDA 1FWJC 4UTTA 2BNJA 3GDKA 3M5ZA 1EUAA 1WOBA 3D5HA 3L4ZA 3QV8A 2HE5A 4N6EA 1R38A 5MHBA 3EYPA 1POKA 2J77A 4WXYA 3TDFA 4L1XA 2ZUTA 4WR3A 4ALDA 4FSAA 1H7NA 4V15A 1XRSA 5BMXA 4HZ6A 2GVJA 2XJ7A 1Q6EA 1WBJA 3ABXA 2HPMA 3LCIA 5HMEA 2E6YA 3QV7A 1A5AA 2Z7GA 1EYEA 2H6RA 2V82A 5HULA 4AVFA 3N04A 3GC4A 3OQ8A 2CZ5A 3Q2DA 1KRCC 4NZ4A 3ITXA 5BXTA 2ZTKA 1KCLA 5DFAA 3M0KA 1AL7A 4W9TA 4P8XA 4H3DA 3IEBA 5F1UA 2YKKA 4L80A 2D24A 3A3XA 1R3RA 4XAGA 2YFOA 3CEPA 3EZ4A 1MW3A 3POHA 4CQDA 4ZOCA 2NXHA 1GGOA 3GNNA 1AVAA 1U33A 3W1XA 2B7QA 3TNOA 1F4HA 1TELA 2TAAA 4O52A 1PJ9A 2PGWA 3VGGA 5G2WA 4QRNA 3VZXA 1MXGA 2OT0A 3KHDA 3NXFA 1KXTA 1WAWA 5F7UA 1Q6RA 1U83A 4FIRA 2ASHA 5D37A 4TMCA 1FH8A 1DJQA 4L6HA 4J3WA 2NX1A 1X6UA 3PB0A 5TF0A 2E1DA 4NJGA 4JX4A 2GQAA 4WOQA 4DIAA 4QXIA 4CD8A 1JCJA 1QNPA 5BU6A 3ZMRA 1XGZA 4K8GA 3TXVA 4C6FA 3REQA 3MO4A 3LEPA 4NI3A 3SCSA 3CNYA 3SY8A 2NXIA 3W1PA 1BF2A 1HP4A 2J9ZA 3GUGA 5I06A 3UG3A 1A5NC 4H2HA 2ACQA 1EDTA 1ESWA 1H1YA 4L56A 3EGJA 3WLIA 3KTSA 2WNWA 1G69A 1UWTA 2Z25A 3VIMA 2Z29A 3A24A 2Y88A 3Q58A 1SSGA 5A3HA 1FTXA 2XSXA 4PUEA 5DQPA 2A3LA 1TMHA 3BOLA 3M07A 1MZHA 2Y85A 3I7SA 4I6VA 4JFVA 1GJWA 2DU2A 1KFBA 4A35A 1FHUA 3U4FA 3W76A 1JULA 3BLLA 3L9CA 5JXQA 1EF2A 3M41A 3G1AA 4LAUA 4ILSA 2PAJA 4GIEA 1E43A 3HU7A 3AC0A 4L9XA 4HMCA 1KQZA 1TPB1 3PUOA 5I02A 3WO8A 3N29A 3CH9A 2VC5A 3CC1A 4YHGA 2VRQA 2GQ3A 1HP5A 1NP0A 2EPMX 1SGJA 1DWGM 4HNOA 3D0CA 4IMAA 3W29A 5CGMA 3KLLA 2GDUA 1JI2A 2C13A 2W6RA 2QVNA 3VIIA 4DWSB 4LXFA 3FXYA 3IJ8A 4MFDA 4G2DA 4H01A 4DBEA 2HWGA 3LBOA 3GTHA 1XBVA 1ODUA 3GM8A 1OBAA 2FYMA 1Q63A 1Q85A 2NV2A 4F4RA 1PTAA 2D22A 3G1VA 4G1KA 4G9PA 2WCGA 2B31A 1IV8A 3K1GA 3J7HA 9XIAA 2DEPA 1IIHA 2ZUSA 1W1A1 2ZTJA 1D3GA 1LLOA 3OG3A 3R7MA 3W1QA 3L21A 4TR9A 3AXHA 3R6IA 4LVBA 1C8XA 4N2YA 4WCJA 3V4BA 3WQWA 3K30A 3YPIA 1WKEA 1TVNA 4LUTB 2V3FA 1QPNA 1EA0A 2QDEA 2J7DA 5IBXC 2AGKA 1JYVA 4PSRA 3SM0A 1QI3A 3APGA 3SGZA 4DHGA 3BTNA 2XM1A 1P6WA 1RV8A 2G41A 2IMRA 1GPWA 2VRKA 4W85A 4MB4A 4YVVA 5LNUA 4H9XA 3AHYA 1S1PA 1UC4A 5KITA 3P93A 3A4JA 3PZMA 3T78A 3N3TA 4Q4MA 1NDWA 4NP7A 1R2TA 4NF7A 4K1GA 4KKXA 2DUZA 5FF3A 1ITXA 2Q8XA 4J2PA 3KHJA 2DZSA 3DYMA 3CHFA 1WUEA 3N4FA 2EKCA 3B97A 4NT0A 3LHWA 1DXIA 4C1KA 1X8FA 4MIMA 1MFVA 4PH6A 4BQ3A 3ZS4A 3PTMA 4JN8A 4WKFA 1RP8A 1VC4A 1I45A 2NUWA 3STFA 1UJQA 1XINA 3HFYA 2GSHA 3NA8A 3L4UA 3MUAA 1A0DA 4FF5A 2YL5A 4NZ1A 3SIZA 9CGTA 4JTQA 1KR1A 2FPYA 2E1WA 2VOTA 3W3OA 2PP1A 1JZ3A 3C2VA 4TU1A 1R87A 4HCDA 4XZ9A 4UQEA 4M80A 1F2JA 1CTNA 1EGZA 4LYPA 4R27A 2YJQA 3WF0A 5FJRA 5IHSA 4DJED 3MCNA 4IUOA 1W17A 3WH6A 1ISWA 1G94A 1XG4A 1R5YA 4BR1A 4S39A 5AHEA 2OX4A 3E0LA 4RE4A 4LS0A 2DVUA 4K8EA 4W86A 1KO0A 2A6NA 4M19A 3RO8A 3A6OA 4WVXA 3VX1A 2DW7A 3T09A 2HVOA 2ZYFA 3ICJA 2JKEA 4QROA 4UCFA 3ZM8A 2ZZ3A 3U5UA 4HMEA 3AXKA 5F2IA 3S2CA 1V3IA 2DZTA 1UD5A 2CZFA 3KS6A 4AH7A 4MLJA 2BXYA 4EPBC 2ZZ5A 2H9AB 2BXZA 2IS7A 3T07A 5JBEA 1OGBA 1GPFA 3B04A 2OFJA 2EJAA 3S83A 5BYWA 2EAWA 3V5CA 2HNHA 3UZXA 1XLJA 4K39A 4JTEA 1FQ0A 1K6AA 1TQJA 1FDYA 2IKHA 2W62A 1V77A 3WDPP 3TAKA 4L4OA 4J3SA 2ZA1A 4K37A 2VR5A 3MSGA 4DZ5A 2PFHA 5I07A 4PMUA 4C1NB 4MUZA 4UTWA 2WSRA 2HXUA 3U7VA 3W28A 3AYSA 2BFGA 3PUEA 3VD9A 4OT7A 3UJFA 4EAMA 5CQ1A 3T2PA 5EPDA 1HKKA 4CNSA 3DGBA 3TR2A 1K1DA 4M1BA 3CMFA 2GUYA 4CNNA 3H2AA 3VGFA 3F4DA 3ZSSA 5LHEA 4URIA 1E73M 2ZDSA 4MB5A 4ZMGA 4ZFCA 2Y6ZA 4FXRA 2CYGA 2A0NA 3F4WA 4I5XA 4LBSA 1TRDA 2F61A 5KTLA 1O7AA 5J04A 3GDMA 4D6CA 1YXYA 3S46A 1MQQA 2FJUB 3VYLA 1OYCA 1M1BA 1NFPA 3NQGA 3NQDA 4GCAA 3UETA 3WIJA 2A21A 1TWSA 1E6XM 2VQUA 3ITLA 4RV3A 2VCCA 2DIKA 3MKKA 1WOAA 1J6PA 1UPPA 3VGHA 1UR9A 1XQLA 3T9PA 6REQB 1WB0A 3SUSA 3T55A 3VC6A 3BL3A 4DJDC 3A22A 3QHNA 1HL8A 3PZ9A 3M4HA 4PFHA 5D9MA 4K68A 1IT7A 2R14A 1V8EA 3WUGA 1TWWA 3TTYA 4A8RA 4MY8A 1SJAA 1UBPC 4JZ5A 3EKGA 1W6TA 1G4TA 4M51A 3AZSA 3VDBA 2QF7A 5LSMA 4GNJA 3W74A 3MZNA 4MM1A 2QCNA 1O5QA 2VEGA 3HOJA 2GVGA 3POCA 3EDJA 5HNTA 3DG7A 4HMNA 3VM5A 1K8CA 3FAWA 2DIEA 3KL0A 2WW5A 1MW0A 3P80A 4N42A 5C55A 5E9AA 1ISYA 3N4EA 2CXEA 3TLLA 1QBBA 2X05A 4KEMA 5A6BD 2ACSA 2YSWA 4XD6A 3UJRA 1QXLA 5REQA 3UD6A 1JRCA 1XRVA 4PB5A 3VCNA 4HSNA 1R9YA 1M7PA 1UD4A 1JD9A 4QJ4B 2V81A 3AIWA 2FJKA 1CENA 2TODA 3LB0A 1HQTA 1CPUA 3GHTA 3WH9A 2HVNA 1ITUA 5KMYA 2D23A 4RE3A 5FOOA 3FNDA 3CV2A 4H7CA 1P4CA 4XO7A 2XN2A 4HPXA 4R7JA 2WZMA 5I0DA 1S5TA 1K8YA 1OGGA 3V75A 1NSJA 3EX6A 3BVJA 1EJTC 4L6OA 3LU2A 4D6DA 3A9BA 4PL1A 1HGYA 3E1F1 3NL3A 3UWVA 4YN5A 2V5LA 3BG9A 4GXMA 2HROA 3VVGA 4GYJA 2ZUMA 1XLFA 1XYCA 4GNKB 4E38A 5B7YA 4IICA 4JTCA 4MJZA 4S3GA 2CLEA 2WZEA 1GWJA 4DUWA 1VJSA 1XIJA 1UOZA 3M0LA 4W84A 1OEPA 4G7EA 2I16A 1YE6A 4X9SA 3GVGA 1BWVA 4HYRA 4ZA0A 2ZDRA 4XZWA 3QN3A 3UZ5A 3BDKA 3MP5A 1V3LA 1F5ZA 1EZ2A 4JN6A 3CUZA 4XWUA 2JF7A 2XIQA 2WK2A 1EX1A 4FEZA 3IUDA 1QO5A 2X1SA 2WJFA 3CAWA 5D2YA 4QLJA 2NQJA 1FCQA 1ZUAX 4XSLA 1WXJA 3Q65A 1E9YB 4E2DA 1OIMA 4Z1BA 4KIRA 1G1YA 4NUWA 1TE6A 3VGEA 3VXGA 4Q8OA 5IHRA 3W7QA 5DRCA 3SAZA 3WELA 2R1KA 3EB4A 3B05A 1IE7C 2DV0A 3OZYA 4JTUA 3U3HA 3UR7A 3LBCA 1UUQA 1QW7A 3WBAA 3OZMA 2BHZA 2E6AA 3IRSA 4W5UA 4JNMA 5LA2A 1W1ZA 2QEZA 3UERA 1B90A 3DDMA 2Y7GA 2XH0A 3LN3A 2Y5EA 1U5VA 3KP0A 2XUCA 4I8DA 3MKVA 1F61A 2VP8A 4KERA 4G1NA 2ZWZA 4AZBA 5CSRA 5I3FA 2PZ0A 3JUGA 3W2MA 3B8VA 3IK2A 5A5WA 1NTHA 3M5XA 3O6YX 3EDEA 2NWRA 5LXEA 3CTLA 2PDPA 1QHPA 2GSJA 1XIMA 3BANA 3AU2A 4Q8QA 1X7FA 4A3HA 1QHOA 5H2ZA 4Q8PA 1V7YA 4I90A 2ZZ2A 4ZXLA 3FAXA 1E6PA 1DE6A 4IHCA 1X96A 2EG6A 3MQTA 5G1YA 2AKMA 1FH9A 4TQTA 1CXFA 3V0TA 1FDZA 1HL9A 1ZPTA 3TYBA 1JPKA 1ZSXA 2BX7A 1CLVA 2NT0A 4Z1AA 2ZADA 7XIMA 3BLOA 3UJEA 3UNDA 2IKJA 3O2LA 1X39A 3WEOA 1QW8A 4XZNX 3W7OA 4NSBA 4JGDA 4Q33A 2GL5A 3IVUA 3S3GA 4PRWA 4GVIA 3TONA 3V0UA 3MSYA 1K4HA 4NU7A 1P5BA 4GNVA 3USBA 3I6RA 3HGJA 1KCZA 1X97A 3VUPA 3WYZA 3EDDA 1FWGC 2E4TA 2IW0A 4CU8A 1C8QA 1J11A 1N7KA 3HGRA 4ICNA 1PKNA 4GISA 4IQJA 3PBMA 1EEXA 3LCWA 5FA5A 1GNXA 1V02A 1VQTA 5CKSA 3RM8A 1W5OA 1QNQA 1VH7A 2WMGA 2IKIA 4H6QA 2G95A 4ZO9A 1US0A 2VEKA 5A8NA 4RX0A 2WNNA 4K36A 3SY1A 4F3HA 2NVCA 5JBDA 3AWOA 3SRDA 1Z6KA 1OT1A 1YTKA 3GG1A 5CC5A 4AFYA 4L7ZA 4IUGA 1HJWA 3H7RA 2X16A 1Q2SA 2OU4A 3PTQA 1SO4A 3PS7A 3UCQA 1LG1A 1D7KA 5DO8A 1TUFA 3A5FA 1KLYA 2E3ZA 1U1HA 2EQDA 2BGSA 1GKRA 3LCXA 3JZEA 3ZYZA 4LAZA 1GVQA 3SFKA 2PDIA 3HGSA 3UFYA 4C5ZA 4I7UA 5KINA 1D2KA 2DZXA 2V2CA 3EPOA 1FXQA 3PVFA 4JICA 3F4CA 3PN8A 1NQ6A 3VNDA 1GOQA 1FDJA 2PEVA 2FH8A 3RHGA 3W7EA 1UH3A 5D38A 3MYOA 4Y9OA 4RV8A 5T9CE 5JH2A 4QG9A 1UR3M 4YWSA 1FCVA 4RKAA 4PTVA 5A2CA 1CDGA 1V6WA 4J2MA 1UCWA 4OQVA 3TSBA 1XP3A 1GG0A 1XD0A 3D46A 3BLFA 2XSAA 4WKAA 1JAKA 1Q7MA 3K13A 3RCYA 3BSMA 2JIWA 3WG6A 3VDCA 3GWQA 5C2CA 4GH3A 3VNJA 1KBBA 2YDAA 3RO6A 4R5EA 5ABFB 3NO3A 5F2LA 1BHGA 1F3TA 2DQXA 1K3UA 4YJ5A 2WXDM 3F4VA 1XKJA 2PWUA 3KBJA 2PLJA 3GXDA 3P82A 3T81A 1F74A 1BWLA 1VEMA 4IIFA 1BVWA 4LBRA 6ENLA 3ABRA 2A6LA 3OODA 5J8LA 2BZNA 1PWMA 1MRAA 4FX7A 4REQB 3BCFA 3FS2A 4HPHA 1JPHA 4H9ZA 3LI1A 2ZX5A 3VNLA 4PYSA 4AX7A 5BRQA 4UQ9A 4HA4A 2OKOA 4O53A 3VTRA 2V8ZA 4JBRA 3MHUA 4A4AA 3CLWA 2AL2A 1UBSA 1XV8A 1UOKA 4GYPA 2FZBA 1OFAA 4D1IA 4F0RA 4LS2A 4WSKA 2ISWA 4JYDA 1TTJA 1GVEA 1T7LA 2QW5A 5CGQA 4EWND 3ITGA 2DT0A 3WLRA 1ONXA 1DV7A 2I5IA 2VTFA 1EB3A 3FLUA 4KEVA 2WNZA 1J93A 2NLYA 2Y24A 3GZ3A 1L6YA 4UNLA 4YVPA 1V3KA 5E0CA 2CLIA 3WZ0E 4UXDA 3B4YA 4HHLA 2AQVA 3E3HA 3LUTA 2V0TA 2VUYA 4UR8A 3PNUA 3II1A 2YW3A 1TO3A 2B4GA 3DN5A 4M1RA 3GLCA 2CBJA 2P0IA 1S1RA 1TFVA 3TVAA 2F2KA 2VDHA 3KBVA 5AECA 2WSQA 3G1HA 1B54A 4JIPA 3UPMA 4ROQA 3GU9A 1IZKA 3NQAA 3W2JA 4AXKA 4IFOA 3UXAA 2W4XA 5D30A 4N9CA 1LBFA 1GORA 5D03A 4C91A 4WY0B 1HVQA 4JQ2A 1E6RA 2L5HA 3F2DA 4H19A 3PBUA 2XPKA 3UA3A 2CZDA 4O1BA 3H23A 1EQPA 3KW3A 5BOFA 4AZCA 3M44A 2H8XA 4YS1A 2QYGA 3FKKA 3OA5A 4FNQA 1Q2RA 4AF0A 3S5OA 4H4IA 1R6WA 1OVDA 2PMQA 2CU0A 3S5NA 4U5KA 1JZ8A 1LROA 1QWGA 3FGCB 4PCFA 4AZ7A 1QAPA 4ZSTA 4LB3A 1OFQA 2ZICA 4F0KA 4Z2HA 1V08A 5LGZA 2BMBA 3KBNA 4MMWA 5I23A 4PB3A 4LUSA 4OBSA 3PBYA 4FHAA 4B4FA 3DYPA 3DFTA 2D73A 3O8AA 4HNCA 4KFOA 1CB2A 4AY8A 6TAAA 1H7PA 1KM0A 1R0MA 3UWUA 3KEHA 3MPGA 1OD0A 5CAKA 4ZBCA 4S3AA 1U2YA 3JW7A 1MXDA 3UT0A 3VPLA 3VCRA 1M01A 1NWRA 1YNYA 1XLLA 2WLYA 4C6LA 1D9EA 4ATLA 4MWAC 4JCMA 3WBEA 2DIJA 1OX6A 3HQNA 4ZFMA 4JNZA 3WK3A 2XH2A 4IPIA 1TPFA 4P5UA 4GVFA 2AQWA 1IGSA 3W01A 4DLFA 3QFEA 1N82A 1TTQA 1JI1A 1LJYA 4WIWA 1E9ZB 1FH7A 2ZBTA 4GYKA 3TH6A 2HEJA 3BAWA 1ZB5A 3TN4A 2O9OA 1T6MA 4HKPA 1J0HA 2GVLA 2J75A 2QCDB 2IQDA 2F84A 5HOSA 4D6JA 3CLMA 4Z08A 4PTDA 1DXFA 2E0PA 2OYKA 5A6AA 2QT3A 4NNCA 1E1CB 1FP8A 4PULA 4B2DD 1OFRA 3THDA 4C6OA 4US6A 1JF6A 1NFGA 3DHFA 4F0HA 3WFZA 4DB7A 2JF6A 3GHUA 1E15A 4BF5A 4K8HA 1C93A 4EF9A 3H24A 4GHRA 4PA8A 3G2GA 1E4IA 5DXYA 3IJQA 2E7FA 4ADUA 3NZGA 1UWUA 5HR7A 2HS8A 3WY1A 4JIEA 4FIQA 4GIYA 3TYDA 1QOPA 2GUBA 4XKMA 4X0VA 1GQNA 3MW7A 7ODCA 2YFNA 3B0PA 1ISVA 1P7TA 4E6MA 1AJ0A 3N6QA 4DN1A 2Y2WA 1TV2A 3GVRA 1IR2A 4A2SA 1A4LA 3A3WA 1T8XA 2CLKA 3S47A 3MBFA 1BWKA 4AG0A 4Q6JA 1GVFA 4JTHA 1I0BA 4MVAA 3U2EA 1I75A 4PODA 4RNHA 5CPQA 3WDIA 4B5NA 3IGXA 4LALA 1LWHA 1G67A 3S6TA 3PZGA 5F2GA 4AMCA 4L9ZA 1DE5A 1M7OA 3CQHA 3EAUA 2FFCA 4LNCA 2RDTA 4B3LA 4M56A 1TUXA 2GZXA 3B03A 1RY0A 2Z2UA 3HQ1A 2V67A 5XIMA 1JXKA 1DIDA 4OIFA 2CWXA 2WBGA 2DH2A 3UNTA 5CZTA 3N25A 3CZJA 3MV11 3SRFA 1BQCA 1X1OA 1K7XA 4XUGA 3BWWA 3ARUA 1YDNA 5AYBA 2FMOA 4LT9A 5D2TA 2HISA 1W9VA 4GJIA 3UWZA 2J8FA 5E6YA 5I7GA 3BJTA 1IEIA 3FJNA 3ZWTA 1FWRA 2A3CA 1VB9A 1ZGDA 1GOWA 3B8IA 1PVNA 1O94A 3WL0A 4HP5A 4LRTA 1XLCA 1VBHA 4I5RA 1CBGA 4DUVA 4F79A 4OU1A 5HMFA 1F76A 3VKAA 3TJXA 3LLXA 2NT1A 3K8KA 5A1AA 4JKLA 4ZQNA 1DQWA 4Q4RA 2ANUA 2NX9A 3H2FA 4ATWA 3WENA 3LDVA 2FGLA 1QU4A 3CZ8A 1E0TA 1HVXA 4IFKA 1ZTVA 4NASA 4IQEA 1UWAA 4B16A 4GO9A 1G7UA 2PLMA 2VR4A 2O7SA 2WBKA 2JBMA 3GR4A 1OK6A 1I4NA 2ESCA 1RY8A 4IGSA 1DL3A 4MNKA 3WD2A 1TA3B 3NPVA 1W9DM 1UZ1A 4CQBA 2X7VA 2VEFA 2GPTA 3LG3A 1H1ZA 3IUIA 1E6NA 2YA1A 4GI4A 3DFQA 2UWFA 1SZEA 4P61A 3NOYA 1OC7A 1PXGA 6A3HA 4DXXA 4O14A 1YBQB 4ZE5A 2J66A 3ENLA 2WMJA 4IG2A 2J8GA 2V6AA 2FZNA 4YNGA 1CNVA 3QZAA 5M2FX 2CLOA 1EEPA 1L8NA 2R94A 2WHLA 3GXMA 3QY7A 2VCBA 3LCHA 1W56A 2PLCA 1DJNA 3AFBA 4HPJA 3BMWA 4MPQA 3L4YA 3N9RA 1N8FA 3P61A 5GVJA 1W2PA 5DXXA 4QDPA 4J4KA 1Z42A 1GOKA 1GKPA 4HK6A 3TQ0A 4YTSA 1S3TC 4G7FA 4AB4A 5H6HA 4LUIA 4PMJA 2A79A 4RPQA 1UIPA 4FLRA 3EWZA 3R79A 3PR2A 4WKHA 5D2WA 4LV9A 2ZZ1A 4AIUA 2OEMA 2VL4A 1DJHA 3IJ7A 1LQAA 4BHYA 3LLFA 1G4SA 4JDYA 3CQ0A 2O56A 2RFGA 1B3VA 1Q6CA 4Q8WA 1UR8A 3GNXA 3HJZA 4YHEA 1O12A 1TB3A 3PTDA 4ZOBA 3PSVA 4W5ZA 4N02A 1IZJA 3LS9A 4OKDA 1J2WA 1DJZA 1PHQA 3WLKX 5HUOA 2DSUA 1G5AA 3UGVA 3EWYA 4LS1A 1HZYA 3E5BA 1D3CA 4JTJA 1A0CA 4FA3A 1JGIA 2J7BA 2QKFA 2ONEA 2A5HA 3G8RA 5DF0A 1IIGA 4YTRA 2PWGA 4DF0A 3VNMA 3FA5A 3URQA 3PP7A 1JFHA 3BAXA 4MZ1A 1JR1A 2BDQA 2QCGA 4XG1A 1PKMA 3GNDA 4J27A 5A6LA 1W5MA 2QUNA 5AYXA 3E2VA 3VZZA 4A29A 1KFCA 3DFHA 3PG9A 3UXIA 1ME7A 1WZLA 4AHPA 5C7VA 5MF5A 4MJMA 1DWAM 1K9TA 3O6DA 1AUSL 4S2CA 5BNKA 4PTNA 3BCJA 1JYNA 1YW1A 1VS1A 2INFA 3OGRA 3QPZA 9XIMA 3GKFA 3P8JA 2ZRWA 2X8RA 5FEPA 3P5YA 1CLXA 1BYAA 3KRBA 3L4WA 1VFUA 5GNXA 1E0UA 4KBXA 4XTIA 3HZ3A 1KM6A 3RK8A 1MUMA 4JTKA 5D4YA 1Q65A 1WAUA 5I6SA 1W9UA 4MSSA 4PMRA 2VFIA 4IX0A 1YDYA 3WD0A 3W72A 3TQKA 2A2IA 3BC9A 1Y65A 3VOCA 3QMTA 5C70A 2JEQA 1VJIA 1J8VA 2V3DA 5C9XA 3PULA 2QMKA 2H3BA 1NQKA 1E5JA 3T44A 3EA3A 3MMDA 2NQ9A 2QIWA 3M0JA 2BASA 1UWIA 4GZ7A 4QDWA 1VLWA 3L5MA 1TPUA 3G0SA 3FA3A 5A6JA 3XISA 3U2OA 3KX6A 1JCXA 5D09A 3QYSA 2G5WA 4XD3A 2XU2A 1PO9A 3W85A 1ZJHA 4XVDA 1UIOA 3HG5A 2PODA 5HQLA 1AG1O 2GGHA 3CHEA 1HJQA 1JAEA 4QE5A 3MU7A 3NL6A 1E3XA 2PPGA 1V6UA 5DBUA 3GSMA 3NQVA 2CEQA 4IXHA 5D05A 2PBOA 4O0ZA 2PWVA 4WDWA 1HTIA 3SB0A 5LZLA 3DBPA 3EOLA 3S4TA 4LC6A 1XIGA 4AD4A 3MS8A 3AROA 1EBHA 4YCPA 4NXSA 3V7PA 3A4WA 5CPOA 1RVGA 1XIHA 1WNOA 1UHVA 3EX3A 3CV1A 3W23A 3SR7A 2FFIA 3PBVA 3CUGA 2PGEA 1JPIA 3PTKA 5HMDA 3M1ZA 4JTGA 4PBEA 4OTKA 1QK2A 1V5XA 2ZUNA 1AFSA 3PZVA 3CTTA 4O15A 3MUXA 3MJMA 1W3KA 3NDYA 4AZIA 1WXZA 3WFLA 3UXKA 1TWIA 5IBXA 4A3UA 3R8RA 1CECA 3AZTA 5H1WA 4E8CA 3PAJA 2IPWA 1C8VA 4AVOA 3RMEA 2PS2A 2X09A 3VM7A 4GKLA 4RXFA 3RLUA 4LYRA 1RPKA 4H8VA 1M65A 4CNUA 4HA3A 8A3HA 3W1NA 1XF0A 3CL7A 4H6RA 3VI2A 2J7FA 3G1SA 3VMNA 3BXWA 1T0OA 4ERIA 1J2BA 1HJSA 1TJRA 4V1XA 2VZVA 3AICA 1OIFA 2NQ5A 4M6PA 5CPTA 2W91A 1MEIA 1H62A 2QJHA 1C3FA 1QBAA 2VGBA 3LCGA 1HW6A 4S3DA 4JN7A 1ZAHA 3R0DA 3BAKA 1LG2A 4PMOA 4U4MA 3EMZA 5LYRA 2B7PA 3ZIZA 1YPIA 3ELFA 3KXQA 4IP4A 4ACYA 4Z2GA 4GQBA 4O18A 2J13A 3W1MA 4BF9A 2B7NA 1TTPA 3NZPA 1W1PA 1ZL1A 2QCCA 1NF7A 3WD1A 4EF8A 3VOIA 5K9DA 1PWLA 2HE8A 5HAOA 2IUZA 4JEJA 3IUHA 5AOUA 1H49A 4DO6A 3LRLA 2PDWA 2VFEA 3AU6A 4AY7A 3CUHA 4DUXA 2WJEA 3FJ6A 4V2XA 3B9OA 4UFHA 3BQ6A 4P2VA 2C18A 1XYLA 3DZ1A 3V5OA 1M5WA 2XVPA 3DI1A 2ZXAA 5MKGA 1PCKA 2B7OA 3GZAA 4B4HA 1FWHC 2XHYA 3UESA 5GNYA 3WQPA 2BHYA 1J10A 3M7WA 3ZLHA 1LT8A 2ZUUA 3LGDA 8TIMA 1ZU8A 4FX6M 5CXPA 3AXIA 3NDZA 2C91A 1O5RA 3SN4A 2QULA 3TFCA 4CEUC 2XIJA 3EXTA 2J7HA 1QNSA 1KBIA 5IFPA 5CPMA 4BWLC 4KS0A 3FVMA 1LM1A 4NZ3A 4CD4A 2PWFA 2PDFA 3WQDA 3QYQA 2ZXBA 1PIFA 1VHCA 1NFBA 1R3VA 3U0HA 2ACUA 4DYKA 5LA1A 5RUBA 4PBGA 5M17A 1DHPA 4MFEA 3KAOA 4DWSD 3MVIA 4LVAA 3GX9A 3CK5A 1DQXA 3KTCA 3RX3A 3BSGA 1O68A 2OLHA 1XX1A 4I9MA 3GXIA 1YTEA 3W7PA 1OINA 4OOUA 2C79A 4UNIA 4QQ3A 4AW7A 2VZTA 4HOWA 1NELA 3IGHX 1UR2A 1PHWA 1H11A 2JALA 1FHLA 1UKTA 3CHCA 2OJPA 4CNOA 3R11A 3H4XA 3L5LA 4EXQA 2G96A 2QDDA 4Q6XA 5A69A 1KM3A 3N73A 3DAQA 1D8CA 2VNCA 4XAPA 2VEIA 3ECQA 1GEHA 1UKQA 2CIPA 7CGTA 1QNVA 2Z4GA 4AD5A 3U7BA 4QP0A 4MG4A 2I57A 2WMKA 1EHNA 4W8LA 1VENA 3IRDA 1S2UA 4IJRA 1PKYA 1W5QA 1CIUA 3PB2A 5H8MA 2WHKA 3R89A 4N6FA 3E02A 4DZHA 1KRMA 3WN6A 3ARVA 3NGJA 3W83A 2E77A 3ARQA 3VE7A 4F0MA 4ML9A 3CM4A 4DJDA 2NQLA 4R85A 2VX7A 1VR6A 5AHMA 1UH4A 3KFTA 3GTFA 4INFA 1H41A 4FX8A 3ZVIA 2YDRA 4JTTA 1GEQA 2RHGA 2A3EA 2ABBA 2W66A 4H00A 4QE4A 2VQTA 2YPIA 1KKRA 4YU1A 2QJJA 3RXZA 2XWDA 3OU8A 2W27A 1JUBA 2QPUA 2QXWA 3CPGA 2QNEA 1QPKA 4US5D 5A2BA 5BWAA 4DJEC 2WJZA 3G22A 4ES4A 3CO8A 1T99A 4ACZA 4R33A 3Q67A 1YDOA 1FWNA 2HVMA 4CQCA 6ALDA 4HPGA 4ZO6A 2OWXA 4J3ZA 3NIYA 1H09A 2FLIA 3HPSA 4G8TA 1SR9A 3MCOA 2ZRYA 4FLQA 2WVTA 4EAYA 1TZ9A 4WLCA 4AIBA 1UG6A 1SPQA 3A47A 3OPSA 2G0WA 1DWJM 4F66A 3FA4A 1LQ0A 4PCPA 3WK1A 2F6UA 4IQLA 4KGLA 1B2YA 2WM1A 3HG3A 4EPKA 2VM8A 2ISFA 3M0MA 3QSTA 3LNMA 3W1LA 3E74A 2ALRA 3GR8A 2V38A 5BWFA 3ABSA 3NQMA 4BS0A 3BG5A 3PBGA 1MQRA 3W07A 1XIBA 4G5DA 1XSIA 4HU3A 4FB7A 3FOKA 4QIUA 4JR5A 4GH1A 3N19B 4UNKA 1CXIA 4AYGA 5EMJA 2PDQA 1XYFA 3A5VA 4LOCA 2YOCA 3LI0A 5KZMA 1UH2A 1UD8A 3E2QA 1LRQA 3PG8A 3W7KA 3M0YA 3LLDA 4Y9PA 1P6CA 1P6BA 1EDGA 3OJGA 3MV01 3OLDA 4O28A 3CQJA 1VRDA 3AI0A 2DJXA 4KWWA 1W1B1 1LTDA 2Y0FA 4CLMA 3AS1A 3AIVA 1AW5A 3JRKA 3O06A 5DY3A 3RAOA 4IT1A 4JFWA 3N15A 1V79A 2UY5A 1B57A 3VGDA 2I9UA 4DF2A 4UQBA 3TN5A 3PUDA 3OQEA 4ZCWA 3QQ0A 1QNOA 3KBWA 3C6CA 4TX8A 4BK9A 4NNBA 2OLAA 1VYPX 1DYSA 2OO0A 2WKJA 4O1AA 4NQ1A 3WQ5A 3CV6A 4GY0A 1XD1A 4O50A 2YCLA 3ALGA 1R3YA 2VI0A 3FDGA 1D8WA 1GVYA 1S5NA 1GVIA 3N12A 3C0QA 1KGUA 1VGAA 1K70A 2G97A 1AH0A 1FUYA 1ZY9A 2ICSA 3N2TA 2F8QA 3ITYA 1PX4A 1YRRA 3IJLA 4TMBA 4H83A 2QV4A 1X7IA 3UBPC 3TMQA 4RR4A 2ZX9A 1WV2A 1T40A 2WM0A 2XSBA 4HNLA 1VJZA 3NG3A 3WF1A 2AGTA 2P8CA 2G3JA 3CPRA 1DKWA 1F6PA 5FESA 3GYEA 1LZOA 4IISA 2GGGA 2IQ0A 4YYFA 3TTQA 1FWBC 1GTHA 3H55A 4DRSA 3GK0A 1Z3NA 2WWDA 3CB3A 2WWCA 3ARZA 4OOZA 3AS2A 5D02A 1XC6A 3B8DA 5F4WA 4WOZA 2XIOA 1ZZMA 2OX1A 4KQNA 3WQEA 4KRTA 1BVNP 1RCOB 4GZIA 4E8GA 3TROA 4GYPC 3WDQA 2W79A 4D6IA 4DEFA 3N2CA 3K46A 4D8AA 5F2MA 3VOJA 4FXJA 1EQCA 1MNZA 3KOYA 3BJFA 1KNWA 2VZSA 5U7SA 3SUWA 3KVJA 3C4UA 1EUNA 4WJ8A 3CT2A 1R2RA 1KV5A 2EPNA 3ABOA 1FWAC 1W31A 4ENLA 5IDIA 1E40A 1KTBA 2CITA 2QLYA 5CG0A 4ZXOA 3BW2A 4EE9A 4EKJA 1MUCA 1PDYA 3R1ZA 4DQWA 1RR2A 4LQ1A 2OLSA 1VFHA 1UR0A 3OIHA 1WCGA 3GS6A 1IZCA 1E4LA 1SFJA 2HV5A 3M6YA 4JX6A 3N2OA 4KCWA 1SZNA 2XGZA 1TCMA 1R9XA 3M9YA 3QFWA 2O4QA 4A21A 2OYMA 3TC7A 4I7VA 1RK6A 3WLPA 4KRZA 3ATYA 3HV8A 4MTVA 1UMYA 4Y8EA 4RNIA 4LUTA 1UPMB 1DEDA 1WKYA 1F3XA 2G4JA 3WBXA 1F07A 3F2CA 2G3MA 4PUMA 1FWTA 3W88A 4O0KA 3DUGA 1GHRA 3PJTA 2VD9A 1A5BA 1W91A 2D69A 3ZVHB 3W0KA 1EC8A 1BQGA 2ACRA 1WBHA 3SUVA 3WQFA 5C9WA 2JEPA 3VOGA 3AUOA 5IM51 3GTNA 3TN3A 1FWDC 1MVYA 4Q8VA 4GD0A 5HINA 4C6CA 4MKNA 5JUVA 2GGJA 1E0WA 3IANA 4UOQA 4IMCA 1UA3A 3V5FA 2O9RA 4B5SA 1LWIA 3T6CA 3WX7A 2CHOA 3KOWA 4EP8C 4FNSA 1NM9A 2HS6A 3MDWA 3TYAA 4YCOA 2PB1A 1EZWA 4AY1A 2FMNA 4HVXA 1GQKA 3I10A 7ENLA 1YXDA 4K7YA 2XTKA 3CASA 3MI6A 1XKYA 4KEZA 3O6CA 2GOUA 3VNKA 2OZ3A 5C54A 2PD9A 4FR1A 4E4PA 4O16A 3TKFA 4JQ3A 1SO5A 4YPJA 5TBOA 2FDSA 5D2XA 4CQAA 1NOUA 3CIWA 3ARPA 4S3KA 3IVSA 4LVFA 2CZEA 2YGYA 3CZEA 1E71M 4D71A 2GJLA 2VXNA 3ARWA 1G4EA 1NH6A 4FNRA 1SUXA 1US3A 3JZUA 3GY1A 1AJ2A 2C1GA 1RXOB 2VVNA 3C52A 3E0VA 2HDJA 4DWDA 2XIIA 3K8LA 5FAJA 2KZHA 3TLQA 1LOLA 1GT8A 1OF8A 3HO8A 7TIMA 2A3HA 1PAMA 4ZO8A 5T8GA 3N6JA 3AOFA 1I60A 5E93A 4HNVA 3UG5A 3W27A 1VZWA 1YNPA 1S2CA 3NZQA 2ABAA 1IYXA 3BLPX 4DJFD 1DHKA 3GU1A 1A5MC 5T26A 2WMIB 3NQ7A 5XIAA 5G4EA 4PUJA 5HNNA 4PFMA 1XR2A 3M0ZA 3FEMA 3EPNA 5ECVA 2WMFA 5D2VA 1EOMA 1GOXA 3EB2A 1WZAA 3VMOA 1EHAA 3CUIA 4M6VA 4C1NA 5HR6A 2J7EA 1OCBA 1UZ4A 3M0XA 3SRKA 2IPGA 1F05A 3U48A 3PC0A 2GSEA 3RMJA 2CETA 3RCMA 4QFUA 3T2QA 3QGAC 3VDAA 3MUIA 3UWEA 4U33A 5FJOA 2I56A 1BEUA 5GNZA 3N2BA 1GZ1A 2R1PA 2QGHA 3V1HA 4MPKA 3OVPA 2QAFA 3C2OA 3GDTA 2Z7KA 3Q94A 5DCEA 3B40A 1Q5MA 3ES7A 4XAYA 1KWKA 4JKMA 3R8GA 2F6XA 1MW2A 1XJBA 4A2RA 1PUDA 1HGWA 2POTA 3CIVA 1XXXA 4ZQOA 4Q8NA 1GZJA 1L6GA 3H21A 4QLKA 1HL2A 4YMZA 3AZRA 2VHLA 4DAIA 4CVUA 4Q32A 3DFOA 2OYLA 2J78A 3AQUA 2XYLA 1YXCA 3HPAA 1DORA 2PU1A 1W3LA 2UZ9A 3LHUA 2QJMA 4HK5A 1CB7B 3CPUA 4YTTA 5FL0A 1R3WA 3I3DA 1QI5A 3G3DA 5G4HC 5CSUA 4F8XA 4UOZA 4PN2A 4I5UA 5FCZA 1ZJIA 4GQRA 3DOPA 3SQMA 3NEVA 5BMWA 1UKSA 5IDZA 1E72M 4AEEA 4HPNA 4MWAE 4B5VA 3HMCA 2C19A 2R8WA 3O07A 3VNZA 4JIHA 3MWAA 1K9DA 5J5DA 4M3PA 3QLDA 4H9UA 4GKTA 4UQDA 2MUCA 3LK6A 3WJWA 4LF1A 2PTZA 4PRRA 3KZPA 5CZKA 2C16A 4GUJA 3QR0A 1QASA 3VIFA 1XIEA 4LUYA 2OEJA 3D3AA 3IV3A 3LPPA 4RDWA 1LUCB 3L23A 1YIXA 3W7GA 3SRHA 4FP1A 1AH3A 1BRLB 3GVVA 4TVCA 1ZJAA 1GVRA 3PJXA 3NFUA 1VCGA 4CCEA 1R7OA 4ZTYA 1UKPA 2ZZ6A 1I6NA 3VA8A 1QATA 1LQ2A 4UZUA 5E0KA 5AYIA 5IFTA 1XLEA 4QG6A 1E9LA 1P0NA 4IWWA 3PZTA 4YTUA 3LY0A 3RDKA 4RW5A 3WNNA 3H8AA 1H61A 1W1VA 5D9NA 1M7JA 3BV7A 5CH9A 3QZEA 4XKYB 2ATSA 5EU9A 1N2VA 4GXWA 3G1XA 1EXBA 1VBGA 3PWIA 3AIRA 2OGJA 2PU0A 4HTBA 3QW3A 4V1YA 2HMCA 4P7LA 1AMYA 4NAEB 4DF1A 4MNLA 3RLVA 3UZJA 4Q7BA 3EBVA 4XBSA 5TAOA 2GJPA 5A8QA 4YWIA 1EC7A 3KBSA 4QLLA 1VCVA 1LWJA 1TJ2A 3IS4A 2O0TA 3W6LA 3M16A 2NQZA 4BQ4A 1FKXA 1XH2A 3SIMA 2HK1A 3CJPA 1NJJA 4HU8A 4U3CA 4AC1X 2OTDA 3SN1A 1O6IA 5I00A 1SZFA 3PY2A 4JY9A 1A3XA 1KFWA 1NIUA 5CPSA 2VC7A 5CZJA 7REQB 1DWFM 3A64A 3O7UA 3QSRA 2W3ZA 2O92A 3WLNA 3GE7A 1EL3A 1CW2A 2BV9A 4HZ7A 3P6LA 2V3EA 4L5ZA 3F7JA 3EDFA 3VDGA 1UROA 1DIEA 4TV5A 1PB0A 1JG9A 2PLKA 3KOFA 1S2AA 3ZZ1A 1S2WA 2Y8KA 3M0HA 3AS3A 4ZEPA 2VZOA 1TWZA 2FGZA 2VX6A 4ONVA 2FZ8A 4L9YA 5C9ZA 3L0GA 1F73A 2YCJA 2YL9A 1XM3A 3PPFA 3BGJA 2YBTA 1XCWA 2DT1A 3V18A 3VIHA 1N55A 3QGKC 4YTQA 2YL8A 4CN1A 3OLIA 4AD2A 4QAWA 4KESA 4Q8MA 1B3XA 5FJIA 4QNWA 4HMDA 1VIWA 3TCEA 3DG6A 2I14A 2EPOA 2XH7A 4U3AA 2ADAA 3NYZA 2FHBA 1S2TA 1GONA 4M5PA 5LNRA 4F0LA 1B1YA 1H50A 1H60A 1R85A 1B30A 4L4PA 2TPSA 2XN1A 1VBJA 4I9JA 1QW9A 2XIMA 3NQBA 4UR9A 3TX9A 3UWQA 2V5CA 2OXNA 4P8UA 4DPQA 3N3MA 3FJ4A 4QJ1A 3CAVA 2WC3A 3H7VA 1Y5VA 1W1YA 3OZOA 3SW6A 3XINA 3NSNA 4UUIA 1ZP4A 3FW6A 4PUWA 5E70A 1ZAIA 2J8TA 1J18A 3NEHA 4MYXA 4D6EA 3QMRA 4FS9A 3SADA 5TIMA 4LPCA 4Z2LA 4U10A 1J5SA 3BMXA 4QEHA 3B9NA 2R1NA 2WVVB 3SCRA 4LTSA 1ALDA 1ODZA 1BLIA 5D33A 3V0SA 2TSYA 4KIEA 1TSIA 1XI3A 1RPXA 2O7QA 1M53A 3RX4A 3H22A 3E49A 3TYCA 2BWGA 2V5KA 3W86A 2OOFA 3MBDA 1EF3A 4QGCA 3RIKA 4O13A 2WV8A 1P7TB 1ONWA 4P8VA 1TV7A 2FHCA 4D9PA 3BE7A 3N9KA 2VMFA 4KF1A 4GK8A 5KZ6A 1X6NA 4C6JA 4W8AA 1EJUC 4JYFA 1BKHA 4H9VA 2REQA 1WQ5A 2XH4A 3GH5A 4O54A 1W3IA 2C0HA 4M8UA 3MO7A 2YBUA 3GXTA 4XQ6A 1EFZA 4IGHA 4K7VA 5KZEA 2GYIA 1ITCA 3S1WA 5G1MA 1WZKA 3L67A 3EWWA 2CWNA 4DLMA 1BAGA 3QKEA 3TTSA 1J5TA 3KS5A 4C1LA 1H7RA 1TPVA 4JHMA 1QI0A 3WEZA 3VKJA 2FZDA 5HJXA 4ZOEA 4LSBA 1KFEA 1XCFA 3ARXA 3LOTA 2BSLA 3BO9A 4H1ZA 8XIAA 1P43A 2E9BA 5H8PA 3SDOA 4IMFA 1OFBA 3SECA 5HMSA 5LXXA 3IJIA 3AIUA 3TK7A 4Z2IA 1PIIA 3AMLA 2QUMA 3W6MA 2C8NA 1MO0A 3I65A 1E3ZA 3W2NA 1A47A 3STPA 2D2OA 3C0JA 4EXAA 4H8UA 2ZCGA 3RNDA 4N9BA 3MTWA 1JNDA 3UJSA 1EJ7L 3TW9A 2PTXA 4OWGA 3ZXWA 3RR1A 3EMCA 5FJUA 2E5CA 1EA9C 3RFAA 4NY2A 4HSHA 4RJEA 3RM4A 2UY2A 3C2RA 4KWUA 4J40A 3VIOA 3VMPA 3QJAA 5G2HA 3ANVA 4N7QA 3LERA 1VKFA 2A3AA 1G4PA 1RHCA 4L1WA 4DYJA 1F4AA 4IGNA 3INPA 2WHJA 5TNVA 3HIJA 1E56A 1UASA 3SSZA 4REQA 4L4MA 3QXBA 4A8LA 3UG4A 5LNSA 1VFMA 4W7WA 4XX6A 3S0CA 3NO1A 3N9SA 5DELA 4IFRA 4W88A 3MUY1 3O16A 3GH7A 3GQYA 3H12A 4EXBA 3GU2A 1W1IE 3SCOA 3OLGA 4LNYA 4TTGA 3BGGA 1E70M 2D0FA 4B5XA 1NARA 1W1TA 1KCKA 3A3HA 4AZ6A 3WCZA 3HG4A 1TV4A 1TJ0A 3LA4A 4AIOA 4ZE4A 1SU5A 4HGXA 4FLOA 4LYQA 4LUJA 3G3MA 1BSIA 1CGTA 4XTDA 3EEZA 2F6KA 4BKNA 3CT7A 4JTFA 4W8BA 3WUBA 4BI7A 2YBVA 2YLLA 4AZGA 1JPMA 1Q4NX 2JQXA 2BBFA 1C29A 5ABGA 4D72A 4FZIA 2WAGA 2GFTA 4LYKA 1J9YA 4UTLA 3UCCA 5A8OA 5FEWA 4LF2A 4POCA 2V68A 2GWNA 3SO7A 4R53A 2YXGA 3LZ3A 4XISA 3EWDA 1UUMA 1REQA 3BLIA 5M03A 3BPWA 4UCGA 2BLEA 4HHMA 1XH1A 4IXXA 5JU6A 4GX8A 3B9AA 4X63A 3CWNA 3RU6A 1A3HA 3NPUA 2Y7DA 1AW1A 4DI8A 5F4XA 4E3VA 3A21A 1CXKA 3GR7A 1S5VA 3EB3A 3QV6A 1YX1A 1LRNA 4PR4A 1AW2A 3V35A 3E5PA 3MDUA 1UJPA 2J25A 1Z7AA 1AZ1A 3NTYA 2P1FA 2FB3A 5BU9A 2OEKA 2H8ZA 4LH8A 3VIKA 1VPYA 2ZC1A 1KRBC 4DO4A 1SW0A 4IIEA 3THCA 1OZQA 4B3ZA 2FPVA 1OG6A 1KR0A 3HTWA 5AB3A 1I9CB 5EMUA 3QR1A 3FGCA 4Z2JA 1PBGA 1XDLA 4GLEA 4K3ZA 4IGMA 1DJYA 4XIMA 5KETA 3OP2A 1R8LA 4MAVA 3KVLA 1CZ1A 4D8ZA 4JTLA 4LBUA 2FTWA 3OVRA 1PPIA 4DBWA 3WLMA 2PDGA 2Q71A 2PTWA 1ZBKA 1GOMA 3LPGA 3UW6A 4MY1A 3DEQA 2NVDA 4C6PA 2W63A 3EX2A 1KCXA 3QC3A 1OT2A 2V69A 2Q8LA 4JAWA 2O55A 3JS3A 3P8IA 4TV6A 3VD5A 3BQ5A 4DO5A 3ZT7A 4AZ5A 1VIZA 3OEXA 2QJIA 4AWUA 5A95A 2W61A 2YL6A 3OYZA 1JDCA 1RCXB 2DUXA 3A4AA 5G2IA 4DAFA 1DQUA 1AODA 3VU2A 3KCOA 2YW4A 4GPNA 1X98A 3PUGA 3M5VA 1EJWC 3LV6A 4QSFA 3CU2A 6XIMA 1W32A 5JVLA 3G1YA 1I2NA 2NXGA 3PJUA 1ZNNA 2D2JA 2OVLA 3B0UX 3EDKA 1E1CA 3QF0A 1OY0A 1VD6A 4UBPC 4KW2A 5FL1A 4EANA 2YDSA 4RE2A 4LC8A 5GJNA 3AMKA 2PWEA 4GIAA 3GAKA 2VFDA 1UQYA 3TFXA 1FCUA 3O63A 1VCFA 2CKRA 4BWLA 3VAVA 4EACA 4AVNA 3GFXA 2X42A 2RDWA 4JS3A 5A6MA 3BARA 4GGBA 1XDJA 4AHOA 3DHDA 1PV8A 1DWHM 1K9FA 1GK8A 5E9XA 4GG9A 2AOSA 4XV0A 2VC6A 4JX5A 1EXPA 2PDKA 2DGAA 1HIZA 2Y61A 4G6CA 2XZ7A 4O17A 1UMLA 2V30A 3CWOX 2PF8A 3B9EA 2DZAA 3GRIA 1Z69A 1N8WA 1UWSA 1R46A 2J7GA 4KPLA 2E8YA 4W7UA 1OFOA 3S5YA 2YB4A 2DP3A 2GDVA 3W7CA 1UR1A 1A80A 4RLIA 2QAPA 5C5YA 1MQPA 3S6OA 1PE1A 1E0XA 4MUPA 5JH1A 5H91A 3H26A 4LB4A 4IL0A 3WNLA 1Z8AA 4AEFA 2ZRXA 4CKQA 4YXGA 2R91A 1IWBA 2WLZA 1JQXA 3ITVA 2X41A 2ZX8A 4MZYA 2XM2A 1MW1A 1XPGA 2DSWA 1FOBA 4PMQA 2LLEA 1XL9A 2WVSA 1AA1B 1C7TA 1XYZA 2G3IA 3WF4A 3PZIA 3NSMA 3OIXA 4N0RA 3W81A 2C14A 1C8YA 5BRPA 3UP8A 5BOEA 2NQHA 3NXLA 3STEA 5G1TA 2YA0A 1F3EA 1M41A 2GGIA 4UFLA 2GJXB 4ECLA 3W7DA 4HHPA 2P76A 3OHMB 1EPVA 2GGEA 5LIWX 1KBLA 1KD0A 2J6VA 4AHQA 1VBUA 1KXQA 3SCUA 2J79A 2CLPA 4HCLA 5LIXX 3TXZA 1Q4WA 3G18A 4XSMA 3WJZA 3KOZA 4WHBA 1SFSA 4UMCA 5CPNA 3DKJA 2VELA 2BY3A 1HXJA 1TV5A 4Q4QA 2DZVA 1EH9A 4GBDA 4K6AA 9RUBA 3LSBA 4O10A 4AMAA 3PM6A 1MDRA 3R10A 3NZ1A 5FEXA 5HQEA 1W5NA 1FWSA 3SI9A 4DJEA 3W53A 1VHNA 4NAFA 5AN7A 2POZA 3LRMA 2UV8G 1F8IA 1VFFA 2PCEA 1YBQA 1M04A 2DZBA 3LMYA 5DEZA 1VF8A 2RDXA 1ICPA 2CBVA 4EK7A 3LXAA 1JZ4A 4QSHA 1TQXA 5EBAA 4H9YA 3VD7A 3QY8A 1ML1A 4RCXA 4L4LA 1HKIA 2HBXA 3LHZA 2CXGA 2RJHA 5MKGB 3C2EA 1H0IA 1VFOA 3NQ2A 1H3GA 1XGEA 2Z00A 3S2JA 2PTYA 1MSSA 5K2ZA 3EXRA 1W37A 3ZFHA 2VURA 2RAGA 3H4WA 5GJPA 4B91A 1N8IA 4X3ZA 5GQBA 3BZJA 4ORMA 2B81A 3A4XA 1WKDA 2OWWA 2R24A 2QJNA 4LY4A 4NRRA 5AC5A 2FTPA 4DWSC 4JD4A 3UG8A 5FIPA 4H2CA 1V3MA 4MKSA 4I7WA 5G4WA 1BG9A 1PYMA 2E6DA 3TMLA 5A6KA 1IT8A 4FXFA 4GQ0A 1LBLA 5EMYA 3TJIA 2VEMA 3W7HA 1V02E 2ZUVA 5CGTA 6CGTA 4MF4A 4JTAA 3GXFA 1YHTA 1C9WA 1AJZA 3TR9A 1XH0A 4NIRA 3N11A 2HK0A 1M9HA 2PRLA 3TZFA 4Y2WA 5C0QA 4AQLA 1X1ZA 3CHVA 4R88A 2P8BA 1UZDA 4NRSA 2VEPA 3E2RA 8RUCA 1Q45A 4LAMA 1EP2A 4IOTA 2NUYA 3O9NA 4Y6GA 5FAGA 2C1HA 1WKFA 1CT5A 4O19A 1NVMA 4KH2A 3EWXA 3M64A 1QJWA 1OGSA 3IAPA 2OELA 1EWDA 5M1TA 2Z1SA 3QMSA 2Q3OA 4WSHA 5LNVA 3RRAA 2JGYA 1EIXA 2GOKA 3BSHA 3UGRA 1HKVA 3MUZ1 2VD8A 2X1IA 1FA2A 1S39A 4P7RA 3PNZA 5EMMA 3I3EA 4EOUA 3L68A 1F6YA 4ZTXA 4W89A 3VD4A 1SO3A 1EP1A 4GC4A 4I9AA 3DCPA 4O1FA 5HUPA 4GJ1A 3QY6A 4E4UA 3RRXA 1GW1A 4JCLA 2V2DA 1XC4A 2XVGA 5EY5A 4GOAA 4XBJA 4GI9A 2QR6A 3NL5A 4UQAA 4RDZA 4GCXA 3H2OA 5FSDC 3PFRA 2QIIA 3PF3A 4X2PA 5I03A 3LQLA 1AH4A 2PDYA 2DSKA 3T0TA 3FK4A 1YTDA 3HGOA 3IGUA 3EPMA 1TV8A 1EWEA 1A0EA 3MHFA 1RJRA 2WOQA 5A6BA 3WL1A 3QEZA 3CZGA 1BGGA 2BVYA 3BW4A 5AY7A 4PMVA 4J3UA 5T91A 1R3TA 2NSXA 3MI3A 4GWEA 3HV9A 4O11A 3VGBA 3D3FA 3TWBA 1RCQA 2WZIA 1SW3A 5C8BB 1Z48A 3ISIX 1E6SM 2Q01A 3LTSA 1KC7A 4ZVJA 3APYA 2OQHA 3A12A 1V0LA 2J62A 5L6UA 1KTNA 1XBXA 4LEQA 4ACZB 5JIPA 1TIWA 3MT1A 4GACA 3H6OA 2EPHA 3KZSA 2D2HA 4PMXA 2ZXDA 4UFJA 4UB9A 1XLDA 4ML4A 1MUWA 3V3WA 4OHQA 2FH6A 2Y63A 2PDHA 3NQFA 3URBA 5CBBA 3WH5A 4X2RA 1RA0A 4AWTA 1VFLA 3G1RA 1SFLA 4RNFA 3NSXA 3DFNA 4U5IA 4NVTA 3MANA 4O0QA 1RQHA 3DC0A 4D6HA 3NO5A 4CN6A 5EMLA 1J0JA 4H41A 4RZ6A 3WJYA 1H7OA 4E8DA 3K4WA 4F2UA 3WLTA 4O8AA 3CMJA 4UTMA 2WYSA 2CBIA 1XLMA 2ALDA 3HB9A 4L61A 1SZRA 3THUA 4EX4A 3CUJA 3QTPA 2WZTA 3ZLFA 1QO2A 2DORA 1ME8A 1TRIA 5BXSA 2FGBA 1KXVA 1OM0A 2AMGA 3R58A 4M7SA 3URAA 4QS5A 1MEHA 1ZBVA 2I5QA 2VJXA 1Z89A 1IGWA 5LA0A 2XFWA 3CBWA 5B80A 3UPBA 5FI8A 3D47A 5CSYA 3O15A 3GIPA 1W3NA 2RJGA 3ITOA 2VOMA 1KKOA 3RPDA 3ONBA 1SZGA 3VILA 4G56A 1E51A 3LHYA 7A3HA 3I3BA 1ZS2A 3FYPA 1EIBA 1L9WA 4AAJA 2HQAA 2VRJA 3W87A 4W93A 1UP0A 3IVTA 2X30A 3S9ZA 4OUIA 1XYAA 3ABZA 4K2SA 4V28A 2QDGA 3HJEA 1Q6GA 2E6FA 3W02A 4GC3A 1Q3NA 4GJJA 4AXNA 1HJXA 1ENUA 4J9JA 2X7WA 3OG2A 3SUTA 1FCBA 3GHRA 3O0KA 3TSMA 3GXNA 4DO7A 2YCLB 1XLKA 4CEXC 5TD4A 3TW6A 4LVGA 4PUNA 2VFFA 4JXCA 1CXEA 4Y9AA 3BZGA 1FRBA 5A8GA 1OSEA 1P1XA 4RDVA 2A4AA 2E68A 1E6ZA 4H9MA 2EEXA 3B8WA 1HNYA 3V36A 2BVDA 3ZOAA 3G77A 3AYVA 5IRPA 2W5FA 1Y5XA 5CSSA 2XDFA 7PTDA 1GVSA 1TIMA 4JY8A 3S2LA 2KX9A 4XIAA 2JE8A 1QWKA 5DT5A 3DGRA 4E5TA 3OA3A 3ITCA 3RITA 2WCSA 2PP3A 3K2GA 4HCHA 1HKWA 5A94A 1UD2A 3P0XA 3P60A 5CBJA 1DPMA 1B3OA 4HJWA 3GFYA 4O1CA 3S5ZA 1JCYA 1GVOA 1AQFA 4QJ3B 3RM9A 4B3KA 4H8NA 3NM1A 1O5KA 1J0IA 4P8WA 4O12A 5HANA 1TZ7A 3LD5A 3MSRA 1QVBA 4QITA 3B8TA 3O3RA 4CGTA 1B31A 4AWEA 2GK1A 4RE0A 4J1OA 1ZENA 1Q6DA 4NJIA 1DJIA 3NUKA 3T1GA 1KGWA 3DIPA 4GMEA 1XICA 1RK5A 5U4NA 3P84A 3P74A 1IXPA 2ZX6A 4JQAA 1K7FA 3W70A 1C9DA 5K7JA 2PCQA 5DX7A 2ZOXA 1FBAA 4X0NA 1U1JA 2G8ZA 3U5YA 2EGZA 1SMDA 5HPCA 1OX4A 4S3BA 1LYXA 3TOPA 2Q09A 1F9CA 4M0XA 3H2EA 4BJHA 4Z17A 1QPOA 1EJRC 4OE7A 2VYOA 1WDWA 1XYBA 2PC8A 4MADA 3UWYA 3FHAA 1JZ2A 3C86A 3OHIA 4UTIA 3UWWA 3IV8A 2J27A 1W9XA 1BKSA 1P1MA 3GIYA 4Y96A 3ANUA 5BXRA 1KM4A 5LHFA 4OJYA 1M68A 3IJ6A 3KUMA 3DBNA 1JFXA 1VAHA 5FJPA 3ARTA 1TX2A 5HNUA 4S1FA 3ZJ6A 3DX5A 1KGXA 4FNTA 3L4TA 1LL7A 4QNEA 2Y62A 3ITTA 1HT6A 1JYWA 1NWSA 3AJXA 2RKXA 3B0XA 1LDCA 2QHAA 2XISA 3T0AA 1LL4A 4GXPA 3SUUA 2V5DA 1XUUA 3OGVA 2Z2AA 4QCFA 1ICSA 1DVJA 3HQOA 1K9EA 3RN6A 4DPPA 1NY1A 3OGSA 3TW7A 2OZ8A 3VIJA 3GUWA 3LGEA 1Z41A 4X61A 2Y5JA 4XUYA 3TCSA 4JQ4A 3ZQ9A 4AIEA 1WE5A 5KZDA 3B4UA 4HJFA 3SQSA 4B5UA 3T7VA 3QQWA 3H53A 3UCDA 1PZ1A 2OWCA 1TMQA 4Q8TA 3GW0A 1A5SA 5FF0A 3H4GA 1U5HA 5HJYA 1TR1A 1DP0A 2E5BA 5LIKX 1ISZA 2YA2A 2C71A 2KAUC 4TUFA 1BTMA 3AHXA 1B3ZA 3NPWA 2PDCA 3OOQA 3GXPA 5ABHA 4TVUA 1J96A 4AZHA 1JDAA 4PSPA 1LCOA 2ZRZA 2E9MA 4MZ8A 3URNA 4BI6A 1ZLPA 1PX3A 4QE1A 2CZVA 4DUOA 4R3UA 4YLWA 1MWOA 3IPWA 4UOJA 3IAQA 5CLWA 5A8PA 1K02A 2J7CA 4GX9A 2P5NA 1J79A 5HK4A 1V3JA 1IWPA 1WDQA 4ZB0A 1H0GA 1AZ2A 5CAHA 5JIWA 4DJFC 3S6DA 3FJLA 2PDUA 5C2XA 2BY0A 2PDNA 5I79A 2Y5SA 2WPBA 1WUFA 4WDUA 5CJ5A 1H7WA 2NV9A 1PDZA 1IEWA 3C8FA 4F9DA 2EXOA 1RLDA 3WMBA 1GUVA 4JIQA 1PSCA 4FOKA 1SMAA 3B0YA 1XGDA 4NXKA 5D04C 1L8PA 2V2HA 4U2ZA 1EJVC 2ZA3A 1O95A 4QISA 3XIMA 2Y8VA 2F7FA 1VYRA 3CHDA 3KCLA 1FWEC 2J74A 3TV8A 3C3NA 1E5NA 1S5MA 6PTDA 1WDSA 3CZKA 1NWUA 4DVOA 3S9IA 1ITQA 4BQ5A 1GYMA 1ZRQA 3C0SA 3NL2A 1JF5A 3UVAA 3PZQA 1XFBA 3GIQA 1EKOA 2TYSA 3AYTA 3GH4A 1XRTA 2C1IA 3SJNA 1G6CA 4R7OA 4DBDA 4GUFA 1HX0A 3QBUA 2H3DA 4F40A 2EG8A 3NQEA 3DH7A 3QRHA 2QCHA 5I3KA 5SWUA 1YEYA 2W9MA 2X40A 1QUMA 2PDLA 4QX4A 3IGSA 4BF7A 1XHGA 5M5DA 2OSWA 3SQLA 4X9YA 1LT7A 5FJTA 4ADTA 2WNQA 2FIQA 2ZZ4A 2J47A 3O0FA 3RGTA 4KWVA 5HA7A 2HXTA 2V63A 2GVEA 3LNPA 1NU5A 4N4PA 3BAIA 4QDMA 3TTOA 8XIMA 3C2YA 2IPJA 2X1UA 5HJLA 1K8ZA 3FXGA 2Y89A 2E09A 4MNJA 5CC6A 1IEXA 1WDDA 2Y7EA 1AQHA 3T2OA 1QRQA 1IXNA 2Y4SA 4WUIA 4K38A 3BCDA 2EHHA 4Z1DA 3ZO9A 2ZC8A 2QF8A 3M46A 5FACA 1OABA 2I5GA 3AXMA 5JBFA 3QOKA 5CC7A 2HBVA 4IH3A 4PCNA 3EWUA 4F2BA 3G6LA 3RG6A 4TXEA 5DCDA 4Q7NA 5F4SA 4S3CA 3CYJA 1W2VA 2QV5A 2CC0A 2Z26A 2DJLA 4WDTA 5AYZA 3L4XA 5C9RA 2PA6A 3VINA 3M6DA 4UQCA 4IPNB 4M29A 1Q6OA 2JFEX 4MWAB 1H1NA 1QI2A 1T96A 1P0KA 3LM3A 2PF0A 4MAZA 4U28A 1L0PA 4B2DA 2Z6JA 3DERA 3ES8A 1GJPA 3U57A 1PIGA 4P7NA 3SBFA 2YCIX 3F1QA 1R3QA 1QOXA 1V3HA 5D8ZA 4KCVA 3MVTA 4LY8A 1KFLA 1NOWA 5I3JA 2RGLA 2W67A 1EO5A 1V0KA 3WBYA 1CGXA 2X1RA 1TPEA 4PMYA 5EGRA 1CI1A 2YCKX 2XINA 2Z1KA 4JPGA 1EYWA 3SCQA 1TR9A 4NG3A 1QOQA 3W1AA 3GDRA 2E5DA 1V51A 4XAZA 3GVWA 1BPLB 4JFUA 1JEZA 4QQUA 3W22A 1IT0A 2IQTA 5AFDA 4PUKA 4DXKA 2OOGA 1LBMA 5BXPA 3CZLA 1R47A 3OB8A 4HB7A 4NNAA 6XIAA 4BA0A 1DJGA 2EO7A 3G6MA 1EDQA 2HSAA 4JTDA 4AWSA 5AVNA 1XS2A 2PC4A 3EX1A 3KRUA 1UB3A 1GOIA 5LNWA 1ZCOA 2DVXA 3DESA 3ATZA 4Q4PA 3T0DA 4KWSA 4LEFA 2Z24A 2Q02A 4IM4A 2OSYA 4HYVA 4OBRA 1CGWA 1ONRA 3T8LA 3R94A 3TQVA 1S2VA 2DT3A 2E67A 5D8WA 2Z28A 3RCNA 3VCCA 1W9BM 1UP2A 2ZE3A 3UY8A 2VX4A 3TJ4A 1T8QA 4LFYA 3GNOA 4UWMA 3ZJ8A 1ZFJA 4HBKA 3E6EA 4F48A 2ISSA 3GG8A 1JCNA 3MP3A 4R9XA 1CGVA 2OZ0A 1ICQA 3ZVHA 5I3IA 1DTUA 3N14A 1QHZA 4LWWA 1ECQA 5AC6A 3NQ6A 4M81A 1CGUA 2QCLA 3PK7A 1TZZA 2TMDA 3ZR6A 2AMXA 3WQ8A 3HN3A 1QPRA 4YL2A 3AWNA 3WNPA 1ZP3A 1HJVA 2WMHA 4O57A 2XGBA 3LMZA 3W1TA 3UA4A 4HT3A 3GO2A 1YYAA 1TPH1 1MXSA 4KRUA 2DZPA 3W37A 5G5IA 5AHLA 2QJGA 4RNJA 3F2BA 4DNHA 1W8SA 3AMGA 1WA3A 4Z0JA 4CN4A 3WLOA 1L2QA 3T0BA 4ZQPA 5L9FA 5C6MA 2CNCA 1DIKA 4A05A 3WQ6A 1VFTA 1OD8A 3SN0A 3REQB 1XSJA 1XIDA 1XWYA 2JKAA 2WC7A 4H7ZA 4ICCX 3K8MA 4IMGA 1EOKA 3L12A 4UR7A 1OCNA 3VFLA 3QH2A 4JEQA 3O6AA 2CHRA 2A3BA 5JQ9A 3WH8A 1XDMA 3P62A 2VT0A 2ZRUA 4J5NA 2WQDA 3P67A 4LCQA 1VBRA 1GYNA 3Q37A 5K3VA 3LCLA 3MI2A 4Z1CA 3M0IA 3VABA 2XFYA 3I6TA 4KT2A 1KRAC 2GQ9A 4L64A 3WQOA 2VDGA 1RVKA 1VRXA 1AK5A 3R8HA 1PZ2A 5LGXA 3NVDA 1DTNA 4A3RA 2J4GA 1F7BA 1I2PA 3W2LA 5CLTA 4NZ5A 3ZR4A 3A9IA 3I7QA 1TG7A 4ROPA 3E38A 2BOEX 1SM9A 1B5TA 4GY7A 3UR5A 3T40A 2D3LA 5PTDA 4EIVA 3WH7A 1XQKA 2G3FA 2P50A 1JXJA 4GZJA 4IP7A 1A5CA 5BCAA 4A3QA 3N17A 3N13A 3WNKA 1US2A 4DM2A 1AL8A 3E9AA 4D6FA 2WMIA 3VKKA 2F9RA 4IZGA 4C6KA 3BICA 3DENA 3TWAA 4BEUA 3L7RA 3LX9A 5EA9A 4U2YA 4DI9A 2PSNA 2OODA 3WLSA 1JUKA 3AS0A 1JNEA 3NURA 1SYTA 1O1HA 1XLGA 3APTA 3TOYA 1RJPA 2AAAA 5BROA 4Z1YA 2IXUA 4L65A 5HWMA 1LOQA 1OADA 3GC2A 3NVTA 4S23A 2J9YA 3ZJKA 5AHFA 3FVDA 1TJPA 3WBWA 3G0XA 3T08A 3WJXA 4L6DA 3SCVA 3RLGA 4IPJA 3LENA 1IEVA 3VNIA 3AMCA 2IPFA 2WANA 4PC8A 4B9ZA 2GWGA 4LANA 3NZRA 3QLLA 4H6EA 2OQYA 3BOFA 4D8LA 2REQB 4Q4SA 1A5LC 3GTXA 4OECA 3S42A 3QTGA 3W2UA 1UD3A 3VKCA 2PDXA 2Y70A 3MMTA 4HOZA 3STCA 2ATMA 4ERGA 3WDHA 4H9TA 3PWAA 4C60A 3OZPA 4OZOA 1FHDA 3SEPA 3TYUA 3TYEA 2FVLA 2V3GA 3QZ6A 2DQWA 1K7EA 1K4GA 1X1NA 1BXNA 1GTEA 1RBAA 3ARSA 2P3EA 1B4KA 4MB3A 2FTYA 1AD4A 3N6HA 3L4VA 4PEKA 3I4KA 3TTEA 1W3TA 2VWSA 2X1TA 2AL1A 4NZCA 3MC5A 1X6LA 5XINA 2QUTA 3UU0A 3PSWA 2PDJA 4YYCA 3NAVA 2ZRVA 4WJEA 1RAKA 1L2UA 3W7JA 2X0HA 1J0YA 1DXEA 1V6XA 3W9ZA 1O5XA 3CAQA 4LCSA 1FKWA 3L66A 4ZR8A 4N9EA 5ENLA 1E1EA 2RGMA 4O8RA 3VZYA 4H04A 1Y8BA 1KBJA 5CZSA 4CNTA 3RYSA 3U2ZA 1X38A 4HOXA 2BB0A 3IARA 4IIGA 4WZHA 3CUXA 1VEPA 4DXVA 1Q6QA 4OV4A 5I2UA 1E0VA 4ZZ9A 3I68A 4GQQA 2E8ZA 1FWFC 4D2JA 3TA9A 2V5JA 1CYGA 3VX0A 3MMWA 3PAOA 1LUCA 2WB5A 4GA8A 4TIMA 4RXGA 5I3DA 4HNTA 2VKZG 1BRLA 3DC8A 1V93A 2QMJA 4NYYA 2BOFX 3IIPA 2XZ9A 1ZAJA 1M03A 3WF3A 1S3HA 2X2YA 1OX5A 2A7PA 4XAFA 5AZ1A 3PANA 4LCRA 1JCMP 3QKZA 3EOSA 4XVEA 2Y1HA 5AKQA 1WDRA 2OZTA 2B0MA 4QTGA 2GUUA 3CL8A 1RLCL 1UWQA 1ADDA 3UZYA 2VZUA 4XK2A 4GI6A 4XKYA 4PB4A 2FZ9A 2VX5A 2WHMA 2NW0A 1QK0A 1XBZA 4PCSA 1YLVA 2F2HA 3V16A 3NJ3A 3I7RA 4NAEA 1KA9F 4XD5A 4UFMA 3R4IA 5LIYX 3NOEA 1JD7A 5J5RA 3LSCA 2YYUA 1Q13A 3DHUA 1VP5A 3B8UA 5F1VA 1JZ5A 4W87A 3RF9A 1E4MM 4XBKA 4ZOAA 3HURA 1Z9AA 1E1FA 2I9EA 1HUVA 1RQEA 3E0WA 4LGXA 5LIUX 3W73A 3ZLGA 1REQB 1OC6A 1MDLA 2Q6ZA 7REQA 2CW6A 3JR2A 2P0OA 1CX9A 1QNRA 4GYFA 1JVNA 1ZBCA 3WDJA 4OFCA 1M6JA 4HNUA 4IPLA 5E09A 3EXSA 2PURA 4TVDA 3P14A 3UPWA 1YKWA 2WSYA 1L6SA 1H7XA 4NHVA 1GKQA 4B9YA 5HBFA 1POJA 3PHAA 4IL2A 1RJQA 4J3XA 1LP6A 1B3WA 2WQPA 3HPZA 3QV9A 1WP6A 2QCMA 4PUUA 4DZIA 2CESA 1ZHAA 3HA1A 4HZ8A 2DZWA 4XZIA 2QVHA 4TX9A 2UY3A 3SCPA 4E3TA 1I0DA 3SCTA 1BGAA 2I7GA 2OGYA 1G01A 3U2CA 3N4AA 1R7AA 5CEWA 3OLEA 1V6TA 1HJUA 4IX2A 4KMQA 1D7FA 4WEVX 2ODOA 4S2BA 3LCFA 1PX8A 2D0HA 2OO6A 2R6OA 3WQVA 1C91A 4V27A 4PMNA 4X60A 4P7QA 4WX2A 3CL6A 5CC3A 2P10A 3AIQA 1SVDA 1OYAA 2IXVA 2EKGA 3L2IA 4NX0A 3FSUA 3LQGA 4AEOA 1QCWA 1ELSA 3VC5A 5K4ZA 5ECUA 3DU0A 3GBEA 4IMDA 4UMAA 3LV5A 3L0NA 4JDBA 3PFMA 4KFPA 3EWCA 2PWHA 5BRBA 4F0SA 4HD5A 4QM1A 1UP3A 3MB9A 4GVGA 1TMLA 5REQB 1FWIC 3R13A 3UYCA 5I77A 2E9LA 3TAOA 4GQGA 1MNSA 2E28A 3I6EA 2PZNA 1YADA 2H90A 3W6YA 4ADSA 1THFD 2NLIA 3U8GA 4WDXA 2WVVA 4WD0A 4DWSA 4DBUA 2HNEA 1B4EA 5HNRA 2WVUA 4LAKA 4XZBA 1UD6A 2W92A 3TZNA 5CJNA 1TYGA 3F5JA 1V0MA 3RU8X 3B0VC 4IIDA 2OMAA 1WZMA 4AD0A 4WK9A 1KLZA 4UTTC 3N2MA 2Z1VA 3BK0A 3KDNA 3IWPA 4Z42C 3EOOA 1HO1A 3FEQA 4QG8A 1XG3A 1KFKA 2G3NA 2J88A 3TQPA 2EPKX 1A53A 1PTGA 1FWWA 3MKCA 1F8MA 3OVQA 3B9DA 4CQ8A 1EBGA 2ZXQA 2CPUA 4F9JA 3L2MA 4G7EB 3DKLA 4CU6A 3GBDA 2D2GA 1OWQA 2AAMA 5K4XA 4JYEA 3EMQA 3IIZA 3M0VA 4MDPA 3GDBA 3LPFA 1VPXA 1M7XA 1T5AA 2VFGA 2GDQA 3P7YA 4NKCA 3KWXA 4GE8A 1GYLA 4RZ5A 2ZX7A 1ISXA 2VGGA 1NWTA 4HU4A 4LVDA 2CKSA 1FFQA 3AIBA 3NDOA 1V7AA 1BSLA 3W25A 4FLSA 1CWYA 3B06A 1NEYA 1EPXA 1E4NA 1WDPA 1NOFA 1FY6A 2CERA 1XLBA 1AD1A 4WJXA 3LZ5A 4ZODA 5KEZA 3FV9A 2ZE0A 3BGAA 4DELA 2PD5A 2QCFA 1WO2A 2EJ1A 3GAYA 3KDOA 3LHTA 3QHOA 4XZMX 2BP1A 2HZGA 4DNMA 4WGXA 1S46A 5DRIA 4Y9MA 1HFBA 3GG0A 2GLKA 1ADSA 3W26A 3NYDA 2C6QA 1KTCA 2BS9A 3AHTA 3BURA 1E6QM 1C7SA 2QUUA 4C6NA 2DVTA 2VR2A 5TQLA 2RUSA 2ISVA 4I9TA 2X0SA 5M3WA 3NPXA 1RH9A 1KW1A 2ZA2A 4US5A 3ORWA 4EWJA 2O9PA 1IWAA 3K4AA 4JTRA 3GC5A 2NUXA 2CLFA 4LV4A 4C7DA 4UMBA 4NZFA 3W00A 4UIOA 5FF4A 4JFSA 3TIMA 4A22A 4NJJA 3QPYA 1J0ZA 2PBGA 4GUIA 5AVHA 3GNRA 3P0WA 4W4QA 3AXXA 3OW1A 1BTCA 1CLKA 3ZSTA 2BG5A 2PE4A 4MLRA 1EGVA 1UUOA 4NAFB 1W54A 2ZFAA 1QDSA 1P48A 1BD0A 4HU0A 3STGA 1DJWA 3W2KA 1O4UA 1PYFA 4PEEA 3VIGA 4E2VA 1UW9A 1XFCA 5C2GA 2DY3A 3NQ8A 4E2OA 3C56A 3OO2A 1JGMA 3U9IA 4QBXA 1NDZA 1R9ZA 4AISA 3CH0A 5DBTA 1OB0A 2H9AA 2FPTA 4AC7C 3CQKA 4ERAA 3PZNA 5CCZA 3P81A 4DM1A 4Q3MA 4PTMA 1Q7ZA 4IF2A 4DY1A 3S1VA 1YDVA 1EJSC 1JIBA 2BTMA 1QTWA 1HO4A 3COTA 2DSVA 3TP4A 1Q8JA 4CCDA 1IR1A 1JYXA 4MJ2A 2PGRA 1Q8AA 4P7OA 2JK2A 3DFSA 4KCTA 1LL6A 4CCCA 5EBUA 4UC5A 4HNNA 2JKPA 2WJDA 1GZGA 3WQGA 4UTUA 1ZJBA 2FB2A 2XIBA 3AAMA 1TWDA 3NWRA 4NYUA 1DIOA 1TPWA 3FYOA 3SZ8A 3A13A 5DY2A 3CO4A 5FEZA 4OVXA 2VUNA 5AC7A 2VVSA 4RDYA 1UA7A 2A1YA 1XRFA 5A6SA 4JKKA 2P53A 4JQ1A 1OJXA 1FWCC 4ZB2A 4YVXA 2OCZA 5IOBA 3L0KA 3DHPA 4FMVA 4KCUA 4CD6A 2VO5A 1OYBA 1J01A 2JGQA 1RZMA 1EO7A 4TO8A 3LGGA 4C6IA 3QGVA 1CXHA 4C5YA 4Q22A 2A85A 6REQA 3VDHA 2Z0IA 5HQMA 3O05A 2E40A 2GVYA 2ZWYA 4AUBA 2XN0A 3M5YA 2VDIA 4DZAA 3M47A 4RZ4A 4F2TA 3U6WA 3DI0A 4BFAA 1RBLA 3ZT6A 3RPTA 2DZUA 1RQBA 4O1EA 3LYEA 2J6XA 3PWGA 4GABA 2XVKA 5DT7A 3MHGA 3GKAA 1FP9A 1ECEA 1IEQA 4FXSA 2E25A 3OTRA 4MKVA 4DJDD 3H2MA 4ZO7A 3CAKA 5E1QA 4FALA 1QR7A 3NR0A 4QHRA 3H54A 4YIWA 3PJWA 2MNRA 3R5EA 1F3WA 1K03A 2YXXA 1BYDA 3R2GA 2GQ8A 1JDDA 3LTYA 3FYYA 4GIRA 3MP4A 1EX5A 4MDOA 5DMLA 4O4WA 4UZSA 4HK7A 4HSOA 3TU9A 3ERPA 2DPEA 4ZENA 2GJRA 1I2QA 1IQ8A 4FR6A 1PCWA 2DSZA 2X2GA 4J7RA 5EFDA 3S2NA 3F4NA 3TSDA 3QW4B 1T41A 1OFPA 3KRZA 1PL9A 3NCOA 2QPSA 3DXIA 1FX6A 3WLLA 4W7VA 4GRSA 3AISA 1TV3A 3C0LA 3VFCA 1YNQA 4PMZA 4PL2A 2AL2B 1XLHA 4Q4KA 4J3VA 3UEQA 3BLKA 2CLLA 2PDBA 3T0CA 1DWIM 3FCPA 5JMUA 1LLZA 2VFHA 2WZHA 4EVZA 4GUHA 1B9BA 5HDRA 4KEUA 2PRHA 1JPDX 4Q7IA 2ZVRA 1GW9A 2QQ6A 3LBMA 2XG9A 3AO0A 3AUJA 4IP5A 3K5XA 4NJHA 2WSPA 3AHVA 3TJLA 1U22A 4UTJA 2A7RA 4C6MA 1JL8A 4IJBA 3TC3