3FFSA

The crystal structure of cryptosporidium parvum inosine-5'-monophosphate dehydrogenase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
377
structure length
301
Chain Sequence
TKNIGKGLTFEDILLVPNYSEVLPREVSLETKLTKNVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKNMDMESQVNEVLKVKNWIAYSNENLDNKGRLRVGAAIGVNIERAKLLVEAGVDVIVLDSAHGHSLNIIRTLKEIKSKMNIDVIVGNVVTEEATKELIENGADGIKVGIIVAGVGVPQITAIEKCSSVASKFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKELIGDTVYKYRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKKSSYVEITTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5-monophosphate dehydrogenase
publication title The structural basis of Cryptosporidium -specific IMP dehydrogenase inhibitor selectivity
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Oxidoreductase
total genus 82
structure length 301
sequence length 377
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ffsA00
3ZFHA 4QITA 2RDTA 2YZRA 4DO6A 1LLZA 1KA9F 3P5ZA 4YCOA 2VFGA 1YDNA 5J5DA 3W84A 4GUFA 4O54A 1QR7A 1ZNNA 2NUXA 3QW4B 3DBPA 1LBMA 1O4UA 5HWNA 3W07A 3NQMA 4E0CA 1WYIA 1XM3A 1ZENA 1SFLA 5HNRA 3OG3A 4UFHA 3LI1A 3W7RA 5AHFA 2GVJA 3UPBA 4LS1A 4DO5A 2E6YA 1QOPA 1LROA 2YW4A 3SGZA 3IIPA 3PB0A 4HSNA 3NYZA 2ABBA 3GYEA 3NEVA 2CLMA 3EX1A 3MMTA 4LVDA 3V75A 1ZJIA 3BO9A 3W2KA 1W8SA 1ICSA 3S5ZA 4KWWA 3C4UA 4LW7A 1VYSX 3LRMA 4MYXA 2WNZA 5K9XA 4AWSA 1TRIA 3HMJG 2QUTA 3DGRA 3QEZA 2B0MA 3TQKA 5AOUA 1Q3NA 4O16A 1LTDA 3NDOA 4KKXA 2ISVA 3KVKA 4B5NA 3GXNA 3PBYA 4K8HA 5FF7A 2QAPA 4GE8A 4K7YA 4R7JA 1ZALA 2V5LA 1T0OA 4JTEA 3UWZA 3WJWA 1TPEA 4CNPA 4AEOA 2PC4A 2VFDA 3E49A 3LV6A 3L66A 3LTPA 1HG3A 4EVZA 3ELFA 2VFHA 3TQVA 2A7RA 2R91A 1ME9A 1S5WA 2NXHA 1VYRA 3C2OA 3MP5A 2ZRXA 3GVGA 4IMDA 3BV4A 2I14A 4HN4A 3PSWA 3W1MA 4IXHA 5K3VA 3FJLA 2HSAA 4K38A 3P81A 4HNNA 3G1SA 3G1AA 3M5YA 1OABA 3O6CA 3W1TA 3CU2A 2J6XA 1S5VA 3NVTA 4IMCA 4MY8A 1Y0EA 4O28A 3PBWA 4Z08A 3SSJA 3CC1A 2G97A 1A5CA 2V8ZA 3UPWA 2C16A 3EWWA 4JX6A 5EL1A 4TU1A 2YFNA 1DBTA 4NJJA 1FCUA 4NZJA 3QH2A 2V5BA 4WY0A 2GOUA 5DN1A 3W88A 1ZAIA 3L67A 3LV5A 3I7RA 4C1LA 5U7SA 1PCKA 1UBSA 4IGHA 2QCFA 2WV8A 3HGJA 2FIQA 3EEGA 3CEPA 3S1XA 2Y7EA 1KTNA 1G7UA 1HUVA 2G96A 3A5VA 3FEMA 1RVGA 2O7QA 3F4NA 4AHOA 2V81A 1O5XA 1F73A 1OFRA 2GJLA 5K4ZA 2FB2A 1KFLA 5AHNA 1KFCA 4PL1A 3QC3A 5E93A 4LOCA 1WAUA 5E0KA 4JTKA 2A6NA 2ZA3A 2QCGA 1SZFA 3CHVA 4MJZA 5EBUA 1R47A 4UTWC 1G4PA 1P0NA 3TC6A 3TJLA 4PA8A 5BW6A 4UTTA 1J2WA 4OV9A 3C2VA 5CG7A 3SZ8A 3W7MA 3GR8A 4ADTA 3AO0A 2VOMA 2YSWA 2W6RA 1JQVA 1GWJA 3HB9A 3W23A 3W71A 3NXFA 2WKJA 3P8JA 1T99A 1KM4A 3LTYA 3O16A 2VXNA 3TXZA 3W2NA 1SQ7A 3HF3A 4PC8A 1KFKA 5AC8A 1PIIA 2CZ5A 1H7RA 3DFNA 2BSLA 5I3KA 3IIVA 3N73A 1GTHA 1B57A 4LTSA 4CNNA 3QPYA 1FXQA 3QJAA 3NZRA 1GVFA 1GG0A 4U28A 4FF7A 1P4CA 1R46A 4UTMA 4HKPA 3IEBA 3TR2A 1DKWA 3S1VA 1K8ZA 3QPZA 4I7VA 3KOFA 2QCLA 4IX2A 1SO6A 3S1WA 1H7WA 1I2OA 3LCWA 3TFCA 3TU9A 3W2UA 1N8FA 1UJPA 2RHGA 1VGAA 1FUYA 2VFIA 3ABRA 3KXQA 3RFAA 1QFEA 4W9TA 4UXDA 1KLZA 2H90A 2Q8LA 4JS3A 4RK8A 1TIMA 3W7CA 3SECA 2ZZ6A 1TPH1 3MP3A 3SR7A 3ZWSA 3NA8A 1QMLA 4TO8A 3TV8A 4GUHA 2HS8A 2E68A 2XN1A 2X30A 2BXVA 3W7EA 3IIXA 1B4EA 1A50A 1R30A 3T7VA 3HO8A 4RZ5A 3W7OA 2GVGA 3TW7A 3L68A 2H8ZA 3ABSA 3S5YA 5C54A 1H61A 3QQ1A 5KSWA 2RH9A 4QNWA 5LKYA 1KTCA 4N6FA 3I7QA 2FDSA 3P80A 2FJKA 1RZMA 3LCGA 1X8FA 3NO5A 4RV8A 2RKXA 3P7YA 5LGZA 1AL7A 4M7SA 1WX0A 3E02A 3NPVA 1FY6A 3LM7A 4IWWA 5K4XA 3BLFA 1JCXA 2GQ9A 3P61A 1IXNA 2TMDA 1IXOA 4Z1CA 4NNCA 3LLFA 3IVUA 1GPWA 4CCDA 4HNVA 1FDZA 1YPFA 4FX8A 4MIMA 1NSJA 4GBUA 3M5XA 2I9EA 1W5PA 3MBFA 4UMBA 3NQAA 2CWNA 1H7XA 1SFJA 1EPXA 3PAJA 3HG2A 1KW1A 3GDRA 1NFBA 1LRQA 4JDYA 3NM1A 3VCRA 1Z48A 3LTSA 1TTIA 3HGOA 1DVJA 2J24A 3QMRA 4QQ3A 1UASA 2UV8G 1LOQA 1IGSA 3MWAA 1H60A 3DKJA 1QAPA 1GQNA 1TRDA 4LRSA 5D32A 3R5EA 2ZZ5A 4N4QA 5AYYA 2E09A 1ZAHA 2AAMA 4WUIA 1M7PA 3HOJA 1X6UA 3L0KA 3Q94A 4ADUA 4GFSA 1R2RA 5FF3A 2Y88A 4BI6A 2QCNA 3RK8A 3HG4A 3N14A 2OT1A 2Y7GA 4I9AA 4JICA 1GVSA 1GZGA 4LNYA 3TJXA 4P2VA 4FNSA 2TPSA 5HR6A 3NQ6A 2Y61A 5K9CA 3PUDA 1WOAA 2A6LA 2NLIA 4UTKA 1I2PA 3THAA 1OFDA 3L0NA 2D73A 2QCHA 5D04C 4D2JA 1YPIA 5HMSA 3WJXA 3S8HA 2OCZA 3UWWA 3G1VA 1OF6A 1BKSA 3CIXA 4FIQA 5TBOA 3C0JA 4UMCA 1VRDA 2E5BA 3DENA 1EIXA 1KTBA 1TPB1 3PF3A 1KBJA 1XKYA 2FPVA 1P0KA 3PBUA 3HJZA 3G18A 3WK2A 3WJZA 5LNRA 3H55A 3NAVA 1F6KA 5D37A 3S0CA 3WJSA 2GJNA 3HIJA 5TIMA 3UWUA 1KM2A 1UCWA 2VC6A 2DZXA 4PODA 1I4NA 1DORA 1QWGA 2ATSA 2JKPA 2ZRVA 1TPUA 1QO2A 1OFAA 1WBJA 1W3NA 1RQEA 3NM3A 3RNDA 3IGUA 1TV7A 3PWAA 3UWQA 3IGSA 4RJEA 3PC0A 1H7NA 1KBIA 2F84A 4EF9A 1TQJA 1H5YA 1QNVA 3STEA 4NNBA 3TH6A 4RCXA 4L4LA 4NXKA 3MHGA 3WFAA 4JTTA 1LBFA 5D2VA 1OG0A 3I7SA 3G1DA 4O4WA 4XQ6A 1Q6QA 2X1RA 5D2TA 1LLWA 2OJPA 3GDMA 4X2RA 3GB6A 2ZRYA 1IXPA 3QSTA 5L6UA 4FXRA 3JR2A 2ZDRA 4IX0A 1TYGA 1X7FA 4DF0A 5D2YA 1JCJA 1RQHA 1SR9A 1QCWA 4GUIA 2FPYA 3GAYA 4UFLA 3LOTA 3TIMA 3G1YA 1W3TA 3A24A 3E9AA 1TPDA 2NV1A 4N6EA 1WXJA 1LZOA 1F5ZA 1EB3A 1X1OA 1NAL1 3HPZA 3KVMA 3U2OA 3QFEA 4NX5A 2ZCGA 1RR2A 3A9IA 3NPWA 3G1XA 3QYQA 4TX9A 3O6DA 2QKFA 5CPLA 4MOZA 3W1QA 1GYNA 4HT3A 5CPOA 1BTMA 3UZJA 2JK2A 1FWWA 4J9JA 3ANYA 4M7TA 4YMZA 2HTMA 3GIYA 2AGKA 1PL9A 1B9BA 4ORIA 4EWND 5G2WA 3OHIA 2XFWA 2A7PA 4XKYB 4WOZA 5DCEA 5CZSA 1F7BA 2CU0A 2DZPA 5CZ0A 3DKLA 2DU2A 2C15A 1TQXA 1OFPA 3G24A 2FB3A 1TSIA 2G95A 4Z1DA 1FCQA 3N2MA 4A21A 2NWRA 3TE9A 4AB4A 5J5RA 3W7GA 5DBUA 3MW7A 4QNEA 1V7YA 2C6QA 4WY0F 1WQ5A 2YYUA 3W7IA 5CPMA 3L5LA 3VI2A 4FNPA 3T78A 4CNOA 1GVOA 4C1KA 5ABTA 1K7FA 4DBEA 2QJHA 3V1PA 1RD5A 1SO3A 3UD6A 1GYLA 1UUOA 3PG9A 3LCFA 2WPBA 1PE1A 2TRSA 3O1NA 3B03A 2GPTA 2G5WA 3M47A 4FX7A 4Y90A 5KZMA 3SW6A 1K02A 4UC5A 2XN0A 5LSMA 3JRKA 2J27A 4AWTA 3W7LA 1SW7A 2VEIA 1IF2A 3ABOA 3TX9A 1LCOA 1QPOA 4NNAA 1DOSA 4ICNA 1Z44A 2ZBTA 3D0CA 1F74A 4DQWA 4M6PA 3CLMA 5BOOA 4Q32A 3M0ZA 1FCBA 1VS1A 4DXVA 3S42A 4UFKA 3BG5A 4O10A 3IVTA 2BX7A 2QAFA 3A22A 4KWVA 3CQ0A 4O8RA 2ZQ0A 3SY5A 3GK0A 4H4IA 4MJMA 1I8JA 5DY3A 1LRTA 2Y7FA 1VC4A 1TPVA 1IIGA 3CB8A 4CCCA 2ZTKA 3MHUA 1OX4A 3EB2A 2B7PA 1XI3A 4TMBA 2QUUA 5HINA 2PRHA 4PL2A 3B0UX 2QCDB 2CW6A 1KFJA 4NT0A 3N2XA 4LV4A 4O57A 1H7OA 3DI1A 1F6PA 3E12A 5LHFA 5KITA 1DQWA 3UYCA 1C8VA 3VNDA 1KM0A 3O63A 4AF0A 1XCFA 1KM6A 5D03A 1VZWA 4DO4A 3NQDA 5F2GA 1U5JA 4UTHA 1BWKA 3B06A 3MJYA 1JRBA 3UNDA 2XN2A 4PTNA 4Z1BA 3UZ5A 3TXVA 1JQXA 3G22A 3S9YA 3EKZA 4Q33A 2V2CA 4AXKA 4ML9A 1XFBA 3CWNA 4GXMA 3U8GA 4GNJA 1N7KA 2OX1A 3LBMA 1XUUA 1LM1A 2YW3A 4IOTA 2ZYFA 1EUAA 4XTDA 5G4WA 1AW5A 3L0GA 1G69A 2NX1A 2B7QA 3BARA 3NR0A 3LERA 4QIUA 3PR2A 1H62A 1SW3A 5TQLA 1G7VA 3P74A 1QPNA 3QRHA 5C2XA 3OA3A 3W2JA 1AMKA 4O17A 2VEKA 4DPPA 1TPFA 4KFPA 3LCLA 2X1SA 1H1ZA 3FJ6A 5F1VA 4M19A 2YDAA 4IJBA 4RXGA 3W7KA 3JS3A 1W5MA 5EYWA 1B3OA 5E1QA 3EXRA 3P82A 1XDLA 3W1PA 2C18A 2A21A 3P5YA 2RFGA 4NQ1A 3UWYA 3VE9A 3MP4A 5HWMA 3C61A 5DXXA 1EUNA 4HSOA 3NZ1A 3L21A 3NGJA 1RV8A 4UR7A 1JVNA 5D30A 1GVRA 2EF9A 4CQAA 1K8YA 2OMAA 1Q6LA 5FEXA 3IV3A 2ZRUA 4NJGA 1ZAJA 2RDUA 3TC7A 3M41A 3L2IA 3KAOA 4OGZA 1KFEA 1ONRA 1VLIA 1OFBA 2DP3A 4MY1A 3BLEA 3W87A 2ZTJA 4DF2A 3OVQA 4NU7A 2YPIA 4DPQA 3NQ2A 3FKKA 1QPQA 6TIMA 3T40A 2EKCA 3I6RA 2VEPA 1GEQA 3HPXA 1F76A 2R14A 4LV9A 3TKFA 1TPC1 5I3HA 5LNSA 3FOKA 2GQAA 1J4EA 1CI1A 3HQ1A 1JJKA 2WO5A 4IQLA 3STFA 4WOQA 1LORA 4IPIA 4N9BA 5AHEA 1EX5A 1W5OA 5D02A 3BGJA 4R53A 4XBSA 1OK6A 1OYBA 4E38A 3TCEA 4EF8A 4XWUA 3NOEA 3HGSA 5CZTA 2WSQA 4DELA 3EWUA 3LCHA 1EP2A 4CQ8A 3ABQA 2QDHA 1K8XA 1OYCA 1TB3A 4Y9AA 4RXFA 4JGDA 4AAJA 4RZ4A 2PE4A 2VFFA 2QCEA 3CM4A 3UXAA 4ZL1A 1EP1A 3NNTA 2Z6IA 1VQTA 3NQGA 1TCDA 2ZFAA 2NWSA 4LVFA 1YYAA 3LXBA 3GKAA 4FHAA 4RZ6A 1ME7A 3EKLA 1SPQA 4Z0JA 4FNQA 2J88A 3F1QA 1IXQA 2V9DA 4O1CA 1H50A 1TJPA 3MI2A 4UTUA 2AQWA 2NXIA 2C3ZA 2CLFA 3W86A 2P1FA 3UY8A 4JXCA 3TK7A 4NUWA 2V82A 3S6DA 2CLEA 1FX6A 3TW6A 3O07A 1PHWA 2V2DA 5F2MA 3W83A 5D09A 1TPWA 5F4SA 1LDCA 1R2SA 3PSVA 1FWNA 3UXDA 4BF9A 3BW2A 3CT7A 2C13A 3NPXA 4QAIA 4IMEA 3F03K 4RLIA 3UWVA 1OX6A 3NL2A 3OIXA 5BNKA 1JUEA 1HTIA 2WSYA 3GDLA 3W2LA 3LRLA 1XDMA 4DBDA 2ZA1A 5HUOA 2QCCA 1JULA 4JY9A 2GUUA 2NUWA 3G0XA 4UR8A 3BGGA 4AHQA 3HG3A 3NPUA 1C29A 4I7WA 3CTLA 4UTJA 1ZCOA 1L2UA 5HULA 3P62A 4UFIA 1K03A 2X1UA 3W76A 4CLMA 5H91A 3L65A 1T96A 4MPQA 1JCYA 3PVFA 2VELA 1LRNA 1VJIA 3MO7A 1VHNA 4O4VA 5EKYA 3BK0A 2CLLA 1OFQA 4ZQCA 4PCFA 5KZDA 2ZZ7A 4Z1AA 3WJYA 1YXYA 4M6VA 1TV8A 2J9ZA 4LWWA 4G1KA 3TDFA 1FXPA 1UUMA 3AJXA 4ALDA 4IUOA 3M7WA 2H6RA 1KM5A 2NX9A 3LGEA 4BFAA 4IMGA 2V2HA 4MLJA 4MZYA 4K37A 4WJEA 3PM6A 2DZUA 5LNUA 3LHUA 2QDGA 4FEZA 4JTFA 2Y6ZA 4A2SA 4ORMA 1XBYA 3O8AA 3W1RA 3M1ZA 5A5WA 3L5MA 4LVAA 4O53A 3UY7A 3G8EA 4OWGA 1TTJA 2YX0A 2ISSA 3BW4A 3H53A 1L6YA 3NQCA 2NXGA 3O05A 1VHCA 1JCMP 4LC6A 3G1HA 2OZ0A 3EWBX 3RLVA 1XUZA 1W0MA 1JR1A 2FPTA 3LBCA 3STCA 1A5BA 2CFFA 4P61A 1JCNA 1TREA 4AH7A 5AHMA 1H51A 2IQTA 5BMXA 5AB3A 3RMJA 3KX6A 5HQEA 5CZJA 4N9CA 3TNOA 1MSSA 1FDYA 1VCFA 3C2RA 3W1LA 3USBA 3TMQA 2QCDA 1K3UA 4O12A 2JGYA 3P60A 2P10A 3E96A 4EOUA 5BMWA 1P1XA 1EWDA 3G1FA 1TV5A 4WQ6A 4FNTA 1IIHA 3IGXA 4UNKA 3NL3A 1S3HA 1SUXA 2TSYA 5CSRA 2LLEA 5MHBA 1LP6A 2YFOA 2PRMA 4O0ZA 1NF7A 4NJHA 5D05A 1ZY9A 4N02A 5AHIA 5FEZA 1Q45A 3DH7A 1T8XA 3A23A 1B4KA 5F4XA 1A5SA 3UQNA 6ALDA 3PG8A 4HNTA 4UTWA 1RPXA 2A2IA 1JUBA 3TROA 4K6AA 2QUVA 5AFDA 3LHTA 3S5NA 1CX9A 1F05A 3G0UA 3M44A 4JNMA 3EWYA 1XBZA 4NZFA 1DV7A 4JIPA 2C19A 1QOQA 2Z1BA 4BI7A 4MLRA 2ZZ4A 1SU5A 4LT9A 3TA6A 1YDOA 1TTQA 1WBHA 2V0TA 4BWLC 4E2BA 1J5TA 2RDWA 4AVFA 1FCVA 3R12A 2X2GA 2R94A 2CLKA 3DFSA 2W0UA 1OF8A 1QDSA 3KVLA 4JTLA 4MYAA 1A5AA 1OFEA 1CW2A 5AYXA 1D9EA 5I3FA 1XL9A 3R8RA 3TAOA 3VKJA 1AW2A 1JRCA 4R34A 3GZ3A 2H3BA 3NL6A 3NQEA 1MZHA 3K30A 2JBMA 4A29A 5AHLA 1H1YA 2QCMA 4A3UA 5K2ZA 4ZQOA 4AWUA 3H54A 1TTPA 4UNLA 3SJ3A 2JKAA 3PULA 1Z42A 4H3DA 1V5XA 3GKFA 4CQ9A 4TR9A 3W22A 5DCDA 3FKRA 5D2XA 3BG3A 4NJIA 5HJLA 3TAKA 1YTEA 1L6WA 1EWEA 4O19A 3HPSA 3LCIA 4LUJA 2B7NA 2OT0A 3KVJA 3M5ZA 2JGQA 4WX2A 1QO5A 3LXAA 4JTSA 1EP3A 1GTEA 1W3IA 2FQIA 2Q3OA 3BLIA 2VENA 2P0OA 1H7PA 1W5QA 1I2NA 5AC6A 3FYPA 2FTPA 2O7SA 1XBXA 4IPJA 4LVBA 1OJXA 5DCBA 4JN6A 2I1OA 1D3HA 1FQ0A 3RF9A 3PUEA 4LUIA 5HR7A 4LVGA 3RLUA 1WOBA 2DORA 5DBTA 4JDBA 3FLUA 3WK1A 2A85A 5C5YA 4Y96A 3LRKA 1FBAA 4XTIA 5D2WA 2CLIA 1TMHA 3KRZA 4WXYA 4XZ9A 4O13A 4YXGA 4BI5A 3ATYA 1ADOA 1ALDA 1VH7A 2DZVA 1DHPA 5LNWA 3MUXA 3SIZA 3W9ZA 3PBVA 1OK4A 1FDJA 3S1UA 2X1TA 4LC8A 1R2TA 5FEPA 4POCA 5EMUA 2DJXA 3M9YA 1WV2A 3O15A 4H6KA 2QJIA 5SWUA 2ABAA 1Q6RA 3QQ0A 4O18A 4FIRA 4HPJA 2A5HA 2CZFA 2E6AA 4LU0A 1OYAA 4LS0A 2WJZA 3C3NA 1ME8A 2A7NA 3C2FA 1NVMA 1YXCA 1THFD 2CZDA 4JD4A 5HWJA 2QF7A 4NX0A 3SFKA 4IMFA 1G67A 1DQXA 3EXSA 3HG5A 4JTIA 1MEWA 4YWIA 4TMCA 1HO1A 3A21A 2GQ8A 4DF1A 2ZZ3A 3FFSA 2YXGA 4K36A 3R2GA 4PEKA 4JIQA 1FWRA 2GVLA 3DFTA 2B7OA 1D3GA 2Z0IA 4JYFA 5F1UA 5D33A 3C2EA 3W1UA 1F2JA 5GVJA 4M5PA 1GOXA 1G4EA 2NX3A 5LNVA 4JY8A 3Q58A 4O15A 4ONVA 5IBXC 2DZTA 1ML1A 1YADA 4S1FA 5EA9A 2CZEA 3TSMA 5G1TA 3SI9A 3Q2DA 1GVQA 3ATZA 3BVJA 3DZ1A 4O0KA 2CLOA 5LZLA 2J9YA 4RKAA 1EEPA 3L5AA 4HIBA 1K7XA 2YCEA 4ZVJA 5U4NA 3EX6A 3G3MA 4PFMA 2YYTA 4JTGA 1G6CA 4HPXA 5CKSA 3NG3A 1WDWA 3PS7A 3O06A 4K7VA 4HNUA 2EPHA 1YTDA 2J9XA 2CLHA 1XC4A 2Q3RA 4DEFA 4MZ8A 4UCGA 4X3ZA 5C55A 3EXTA 1YLVA 4ZMGA 2WNQA 4UMAA 4MKNA 3G3DA 2FFCA 1ZFJA 4CCEA 5F4WA 3N9SA 4I7UA 4MVAA 4Y8FA 2VKZG 1O95A 4O11A 3GDKA 2ZZ1A 3W3OA 2F7FA 5G1YA 2QJGA 4GC4A 4GJ1A 4O1BA 3FYOA 4JR5A 1LOLA 3P67A 4X22A 5HUPA 3EWXA 2W79A 5LHEA 3NQ7A 1LOSA 4ZQRA 4YL2A 4FNUA 2ZRWA 4XUGA 5T26A 1VLWA 3LI0A 3MBDA 1TJRA 2BZNA 3M6YA 1LBLA 1P5BA 1KFBA 3G8RA 1SW0A 5L9FA 3R89A 3WK0A 4OHQA 4BK9A 1SO5A 3G0SA 1HO4A 7TIMA 4BWLA 2E5DA 3CWOX 3KFTA 3M5VA 3DU0A 5K9DA 4N9EA 1OFOA 1Q6OA 1FWTA 3LXCA 1PS9A 1MEHA 5D38A 3CIWA 3I68A 4JTUA 1SZEA 3S5OA 5IM51 3TFXA 3VE7A 1H63A 4FX6M 5H2ZA 5KMYA 4ZQNA 2ZA2A 2Z6JA 3N9RA 2VEMA 3DAQA 3YPIA 3QMSA 2KZHA 3QF0A 1VCVA 3O6YX 3MI3A 2QR6A 2PRLA 1JUKA 2ZZ2A 5FF4A 1OX4B 3FS2A 5I3GA 3GLCA 3QM3A 1G4TA 1XXXA 3MI6A 1ZHAA 4FO4A 3DFQA 3B05A 4ADSA 3VFLA 2Y70A 5AN7A 1YTKA 2HS6A 2VFEA 3W1NA 1M6JA 3N3MA 3IIOA 2V30A 4E2DA 3DI0A 4AF0B 1AL8A 1VCGA 3T44A 4OBTA 5I3JA 3W7JA 3NQFA 3HGRA 3LHYA 1WA3A 3T4CA 2NUYA 2Q8ZA 4NJKA 4WZHA 4WXZA 3Q37A 3MYOA 5FF2A 5AC7A 1L9WA 4QSHA 5F2LA 4O1DA 3W73A 5KTLA 4A2RA 1SO4A 4UTLA 3LLDA 4QJ1A 4KFNA 3C56A 4XKYA 2WNNA 3W1AA 3E0IA 4S2CA 4UUIA 4KFOA 3W7HA 4XBKA 3LHWA 4O1AA 4YLWA 3GX9A 1KLYA 1SZGA 3C8FA 3T55A 3W70A 2JKEA 3LB0A 2BTMA 1YXDA 3I65A 4JYDA 3BW3A 2EAWA 3TSBA 3W6YA 4AHPA 2ATMA 4K39A 1UB3A 1SSDA 2PURA 4GUJA 3EX3A 5BRBA 4WY0B 3EX4A 4LY8A 2NV2A 1BEUA 2E77A 3PUOA 4MZ1A 3W72A 3QSRA 3GDTA 4ZQMA 3PB2A 4EIVA 4PH6A 4OU1A 2DJLA 3LX9A 3ZWTA 4U4MA 1C9DA 1NEYA 1SZNA 4UFMA 1MEIA 5FEWA 4OE7A 4OQVA 4WD0A 3W75A 4MFEA 4O14A 2NZLA 2H8XA 3ZS4A 1AK5A 1AW1A 5A8GA 2Y89A 4QM1A 3LHZA 1G4SA 3KHJA 2Z2UA 1XBVA 1Z41A 2EHHA 2C1HA 3WK3A 1QPRA 5G2IA 5FI8A 5DY2A 1W1ZA 5DELA 2Y7DA 4GWEA 1O94A 1OX5A 1KV8A 4TIMA 4NXSA 2E6FA 3LCXA 4K8EA 5FESA 3W2MA 2WQPA 4FNRA 5C6MA 1ICQA 8TIMA 3MYPA 2EGZA 5G5IA 1NF0A 3DFPA 3LHVA 1OVDA 1LYXA 1I45A 1RQBA 3N19B 4N9DA 5G2HA 3CEUA 3GAKA 3KRUA 4N2YA 5IBXA 1DJQA 1FWSA 2E1DA 5DLCA 1KM1A 4AMAA 3CPRA 3B0PA 4JTJA 5KZEA 2BWGA 1ICPA 1W37A 1HL2A 3OEXA 4JTHA 5I3IA 2E5CA 3PY2A 2WSRA 4MFDA 1GJPA 3NQVA 4L4MA 1KV5A 1KM3A 1TO3A 2H3DA 4GUGA 2C14A 4ZZ9A 3M16A 1SSGA 2YGYA 2DZSA 3L9CA 4QISA 3GXTA 4RX0A 3P8IA 2ISWA 4O50A 4MUZA 3TMLA 2X16A 2Y63A 3W7QA 5EY5A 2A0NA 1S5TA 4X9SA 4JYEA 1M5WA 3STGA 1U83A 1W54A 4R33A 3A5FA 3W74A 4UTTC 4UIOA 1K7EA 2HMCA 1I2RA 4UTIA 4FB7A 2DZWA 3DXIA 3W85A 3IRDA 2PCQA 1M7OA 4N4PA 4Z0SA 3EX2A 1W5NA 3LDVA 1VPXA 1OHLA 3M43A 4IXXA 3DHDA 4O52A 2TYSA 1PCWA 3FA5A 3QMTA 3OVPA 1X1ZA 3ZR4A 4JX5A 1PHQA 2A4AA 1E51A 4Y6GA 3C6CA 5EPDA 2R8WA 3DFOA 4OV4A 1AG1O 5CGQA 3QZEA 5DXYA 1W31A 3B8DA 4GRSA 1GG1A 3HBLA 3NQ8A 2FLIA 1O60A 5G4EA 2QEZA 2B4GA 3R13A 1VR6A 2ZRZA 1A53A 4JEQA 3TQ0A 3TSDA 3GNNA 3BPWA 1JCLA 3F4WA 3B04A 1EA0A 1L6SA 4HHPA 3U6WA 3FIGA 1N55A 5LGXA 2Y62A 1DL3A 4MY9A 4UFJA 3OVRA 1GT8A 4A22A 3DHFA 2Y85A 3GNDA 3N34A 3SGUA 4BR1A 5KINA 2A1YA 3W1XA 2C0AA 3IIZA 5AYZA 3W7DA 3MHFA 3C52A 3W7PA 4JX4A 2BLEA 5K7JA 1HFBA 4RR4A 1DJNA 2ALDA 3INPA 3OBKA 5CSSA 5CPNA 5FF0A 3GXPA 3NL5A 3RU6A 4M6QA 1BWLA 3B4UA 3B0VC 5F2IA 1MXSA 3W7NA 4LS2A 3QW3A 4Q4KA 1PVNA 3KRSA 3BG9A 3TUUA 3GR7A 1YDVA 3EWZA 1VYPX 3THQA 4FXSA 4NVTA 4YCPA 1MO0A 1I2QA 4LRTA 2YR1A 2WOQA 4S2BA 3P84A 4OT7A 1W56A 1PV8A 4ZQPA 1O5KA 2E6DA 3IVSA
chains in the Genus database with same CATH superfamily
2WKGA 3UPMA 3T4WA 2OX4A 4YWSA 2ZX5A 4YCOA 4HMNA 1J79A 1IE7C 5J5DA 8XIMA 4C5YA 2HWGA 2NUXA 1LBMA 3WQ5A 3EDJA 4JFVA 5LIKX 5HNRA 5C7HA 2DY3A 1A3HA 3LI1A 3U9IA 3UP8A 2E6YA 1KO0A 3URNA 2YW4A 3DDMA 3IIPA 4HSNA 2CLPA 1C7SA 3NEVA 2CLMA 1UZ4A 4LVDA 1ZJIA 4QHRA 1VYSX 3NOYA 1A3XA 1D8CA 4E4UA 5K9XA 2ZXAA 3BJTA 4ZO8A 4U10A 4AWSA 2YBUA 2Q09A 3MUIA 2B0MA 2FZNA 5AOUA 1OINA 2ZADA 3WMCA 3MMUA 3KVKA 4GKLA 5LXEA 1JYXA 3KUMA 1OM0A 4MUPA 3V35A 2V5LA 1TPEA 3WF3A 4CNPA 1QRQA 3MSDA 3E49A 3LV6A 1MXDA 4F2UA 3ELFA 3UXIA 5LIUX 1YNYA 3T0BA 2EEXA 2A7RA 1HKWA 2R91A 2UZ9A 1JZ7A 3P2VA 2J74A 1VYRA 3K8LA 2I14A 3DX5A 3PSWA 2HSAA 3G1AA 1LT8A 1E6PA 3O6CA 4OOUA 3DESA 3PBWA 4Z08A 1A5CA 4IFKA 3UPWA 1XD1A 3GS6A 4FOUA 3GVVA 3UG4A 2CWXA 1U30A 4NJJA 3ARRA 3OGSA 3QH2A 2V5BA 3I10A 2GOUA 2OYKA 3R10A 3MUY1 3ZVIA 3OG2A 1E4IA 5FSDC 1PCKA 2EPLX 4KWUA 4U5KA 4HYRA 4PUKA 1C7TA 3WDHA 2QCFA 2WV8A 3HGJA 5JIWA 5HJYA 3SN0A 3AICA 4CCZA 4DNHA 3F4NA 3F5KA 1HJVA 1O5XA 1F73A 1OFRA 1GOIA 2IKIA 1KFLA 3M0JA 4DAIA 4YTTA 1ZSXA 4NYYA 3U4FA 3L23A 1GOKA 5E0KA 1G0CA 4Q4MA 4XZWA 2GGEA 4ROPA 3O9NA 2Y5EA 1B3ZA 3TC6A 3TJLA 3FY1A 4ZO9A 3PZ9A 4HJWA 5CG7A 1K77A 3PNZA 3AHVA 1YQ2A 2AMXA 1TUXA 2CZVA 3RM8A 2DW7A 5T9CE 2PF0A 2W6RA 3VM5A 3W71A 1OD8A 5IDZA 1UWAA 3GH5A 2WKJA 3P8JA 5AKQA 2YB1A 3U57A 2VGBA 1KM4A 2OPJA 4FALA 4E3VA 3VMPA 2PWGA 3ES8A 4GGBA 4ZENA 5AC4A 3IIVA 4RDWA 1XIMA 2WC4A 3UJEA 1GTHA 4PSRA 1FXQA 1V7AA 3QJAA 4A05A 4MHBA 4FF7A 3NDYA 4ASTA 1R46A 3S1VA 3H4XA 4I7VA 2QCLA 1H7WA 1I2OA 3TU9A 1CLXA 3GVQA 3W2UA 1N8FA 1VGAA 3KXQA 1E9YB 4IHCA 3EBVA 4JS3A 4RK8A 1XGZA 4QJ5B 3A6OA 3VKBA 4MWAC 3UGVA 3MCMA 2PDNA 3PTKA 1YE4A 2XN1A 2BXVA 4F9DA 1BSLA 3W7EA 1B4EA 1O66A 3VC5A 3T7VA 4EACA 1YRRA 2VDHA 4S3BA 4HU8A 5C54A 5KSWA 2IKJA 4Q3MA 1KTCA 4N6FA 3I7QA 3N1AA 3PPCA 2PB1A 1V0MA 3WBYA 1DWIM 1Z8AA 1IR1A 3LCGA 2YL6A 1X8FA 3NO5A 4RV8A 3P7YA 1PKMA 3OJGA 1R3YA 4M7SA 3E02A 3NPVA 2Y8KA 4XK2A 1JCXA 2GQ9A 1H41A 4JOMA 2Z25A 2ZXDA 4NNCA 3BJFA 2DVUA 4EAMA 1V8EA 1YPFA 4MIMA 3R94A 2FGZA 3M5XA 3QFWA 4IQJA 2DIJA 3SM0A 2QDEA 1SFJA 3PAJA 1DIKA 5FJUA 1YBQB 3SDOA 3EMQA 3AJ7A 3HQPA 1EPVA 3V7PA 4WSKA 3VCRA 4I3GA 1EGZA 3LTSA 5IDIA 2UV8G 2VI0A 3W25A 2ZVIA 1H60A 4B9YA 4Q8UA 1H11A 1GQNA 2ODOA 4LRSA 5D32A 6ENLA 1F8MA 1E0VA 2E09A 4XD5A 1TKKA 3TN5A 4PUWA 3L0KA 1R9XA 4EXBA 1BPLB 4ADUA 1R3QA 3TR9A 4DUWA 3RK8A 3N14A 3AZTA 1GVSA 3B8UA 4P2VA 3E74A 3MVTA 4FNSA 5HNUA 1WOAA 2A6LA 3CZJA 3M0IA 4UTKA 4W7WA 1I2PA 4M29A 4P7LA 3EDDA 1E70M 2D73A 2QF8A 3SURA 2QCHA 1YPIA 2QULA 3UWWA 4KRZA 3GY1A 4B5XA 3CV2A 1KRCC 2XH7A 4UMCA 4IISA 3MV01 4KERA 1KTBA 3PF3A 3GE7A 2VVSA 4D6FA 1TZZA 1P0KA 2FPVA 1R7OA 3H2CA 3CPUA 4GZ7A 4GNKB 1F6KA 3S0CA 2WJFA 1U1UA 4ML4A 1FKXA 3UWUA 5ECVA 2DZXA 3I4EA 1I4NA 2WJDA 4M24A 1POKA 3UETA 4CU6A 3PNUA 2VVNA 2W3ZA 1QO2A 1OFAA 3WLKX 2HVNA 2Y2WA 3IGUA 3RNDA 1TV7A 3KL5A 4Z2JA 1KBIA 4Q7IA 4PTVA 3AYTA 3FW6A 4L7ZA 1VFTA 1H5YA 1QNVA 2WMIA 3VKKA 1DTNA 3TH6A 3WEZA 5EFDA 1IEQA 3MTWA 4QQUA 5D2VA 3ZIZA 4GACA 3I7SA 2IMRA 3KE0A 1Q6QA 3LZ5A 5D2TA 1XSKA 4B4FA 5T8GA 1IXPA 3QSTA 3JR2A 4IX0A 1TYGA 1VEPA 3SUWA 2XTKA 1SR9A 3SN4A 3H2OA 1W3TA 4DWSD 4E3TA 1F5ZA 4WJ8A 4XISA 2XHYA 3SO7A 4NX5A 2ZCGA 3UVAA 3A9IA 3G1XA 5CPLA 3B3DA 3B8VA 2V68A 4LXFA 2XUCA 2G50A 1JYNA 1KCZA 4EWND 3K8KA 5G2WA 1IZJA 2XFWA 1UUQA 3P14A 4XKYB 2CU0A 2DZPA 5CZ0A 1FHVA 2DU2A 4JTAA 1K6AA 4DLMA 1TQXA 1NDYA 3G24A 1KXHA 4HA4A 1FCQA 1F3WA 3DHUA 3IJQA 3W7GA 2DH3A 5DBUA 4LBSA 1V7YA 4QNEA 1LWJA 1WQ5A 2YYUA 4RE4A 4G56A 8RUCA 3TC3A 4CNOA 1JCTA 2QDDA 4DBEA 1SO3A 1KCKA 3W02A 2ZUVA 2TRSA 2GPTA 5KZMA 1K02A 3SUVA 5LSMA 3JRKA 3QHNA 1TWZA 2QJMA 1Q7ZA 3ABOA 3TX9A 1LCOA 1NWUA 4HK7A 1DOSA 2ZBTA 4REQB 2OG9A 4DQWA 3B9DA 3CLMA 4Q32A 3CUZA 3M0ZA 8A3HA 2PDHA 2VOTA 5BXRA 4S38A 2DT0A 3IVTA 3A22A 4DWSA 2D0GA 5C8BB 3MMWA 3SY5A 5JUVA 3LENA 3BH4A 2XIJA 2NSOA 2YZ5A 3WDQA 3AMCA 3MHUA 3OIHA 4ZOBA 1OX4A 1IHIA 1ZL1A 2B7PA 2IPFA 1XISA 5MKGA 1GUVA 4HTBA 3WH9A 3B0UX 2CW6A 1OGGA 4NT0A 3VIOA 3WQVA 4O57A 1H7OA 3DI1A 4WLCA 1F6PA 3E12A 3VIFA 3O3RA 1C8VA 5I79A 3VNDA 3O63A 2DH2A 3BANA 4EX4A 3IJDA 2XN2A 2PGWA 3CMGA 4PMYA 1UKTA 1W3LA 4AD0A 4AW7A 4H7ZA 2ISDA 2V2CA 4ML9A 2NLYA 3CWNA 3KOXA 1KC7A 2OX1A 2PDIA 1GQJA 3NUKA 2OGYA 1CENA 5G4WA 3L0GA 1XPYA 3BARA 5BZAA 4RPQA 1XFCA 3WDRA 4AD5A 3LERA 4QIUA 1H62A 1XH0A 3P74A 2AQOA 3DYOA 3IV8A 2GUYA 2VO5A 2XGZA 2OXNA 2BDQA 1V6TA 3NZGA 1SJBA 2X1SA 3B8WA 4J7RA 1XDLA 3TYZA 1A0DA 4AC7C 4WSJA 2REQA 2WNWA 4QX4A 4XAYA 3VE9A 5CGMA 5HWMA 4HQVA 3VNMA 1DJIA 3NGJA 5D30A 1X7IA 4GX9A 2OMAA 2WMFA 5FEXA 4QDMA 4ATDA 1DJWA 1JL8A 2VD9A 4TXEA 1PB0A 1UQYA 4GYFA 2RDUA 4I5XA 4R3UA 4OGZA 5CAKA 2AL2B 4MY1A 3BLEA 1ZCCA 3EB4A 2GJXB 1A0EA 1A5MC 2YLAA 3N29A 1Y5WA 3I6RA 4AX7A 1Q6GA 3N17A 1UR8A 4B2DD 3HPXA 2X09A 4JKKA 2CIPA 3WL0A 1ESWA 4W5ZA 1Q6FA 5I3HA 4QSFA 5LNSA 3KLLA 3FOKA 4DJED 3WMSA 1YKWA 4IQLA 3STFA 3ZVHA 1LORA 3R79A 4N9BA 2HEJA 4R53A 3OLEA 4KT2A 3HGSA 1JI2A 2WSQA 4DELA 3EWUA 1EP2A 3ABQA 4FLRA 1K8XA 4Y9AA 2PDXA 2FVMA 4JGDA 4RZ4A 1S38A 2PE4A 4GINA 4ZL1A 4FS9A 4HNOA 1TCDA 4PTMA 3FK4A 3FDKA 4WJXA 4KQNA 4Q7BA 3H8AA 4H1ZA 4I5RA 3QKZA 4KMQA 3RX4A 3EKLA 1SPQA 3KP1A 3S3GA 2DPEA 1M68A 1TJPA 4PMXA 2E0PA 3MI2A 4UTUA 3QLDA 2NXIA 1FFRA 2X2YA 3WELA 2BNJA 3S6DA 1O7AA 2ADAA 4J1OA 9RUBA 3W83A 3E5PA 1TPWA 1XP3A 3P0WA 1JPIA 2DIKA 3PSVA 4BF9A 4KGLA 3BW2A 2G4FA 2C13A 4GY1A 3NPXA 3UW6A 3VZYA 1JDAA 1I0BA 4OTKA 2WMJA 5A6LA 3T0CA 1H4PA 4B2DA 4RDVA 4RLIA 3UWVA 3F7JA 5CPSA 1EH9A 2PDMA 4PCPA 5BNKA 2WBGA 2VD8A 1KXVA 3VDHA 1DWAM 3ARYA 3UU0A 3SRKA 2QCCA 3L7RA 3S1GA 3G0XA 4DJEA 1YIXA 1ECEA 2FHBA 4UR8A 2MUCA 3RPDA 4G7EA 3PZMA 3NPUA 1C29A 4L65A 2YOCA 4CD8A 1J11A 1C3FA 4UFIA 5F7UA 1K03A 2RGLA 2WPGA 3WH6A 1E0XA 2J62A 4PMJA 3MO7A 1PXGA 4BY3A 4DYEA 3TW9A 5EKYA 3BK0A 3UF9A 4ZE4A 2CLLA 4DYJA 4E8DA 4GXPA 4Z1AA 2ZZ7A 4Z2KA 2PCEA 4FZIA 4GYPC 1R9YA 4LCRA 3TDFA 4G1KA 4F2BA 3CV1A 3IWPA 1EO5A 3R0KA 3ZR5A 3AMGA 4ALDA 4C1NA 4JHOA 2DDXA 3M7WA 1KM5A 4BFAA 3FAWA 4MLJA 5LNUA 1DE6A 4JTFA 4LAZA 4U2ZA 4ORMA 1XBYA 3W1RA 3UG5A 3NIYA 3G8EA 4OWGA 1EJSC 1TTJA 1E55A 2ISSA 1CB2A 3H53A 3NQCA 2NXGA 3NZPA 4NG3A 1BYAA 3G1HA 1YNQA 1ZP4A 1X8CA 3WUFA 4GQ0A 2OWWA 1JR1A 2FPTA 4LSBA 1NWTA 3CNYA 1UR3M 1UPPA 3BMVA 1A5BA 2Y0FA 2YLLA 5BXTA 1TREA 2Z28A 4L61A 4AH7A 2BHZA 1H51A 1PZ2A 6REQB 5AB3A 2ZUNA 3RMJA 1V3LA 5HQEA 1RAKA 3TNOA 2ANUA 3WUEA 2HRWA 4KWOA 3SBFA 1OWQA 3M0XA 1K3UA 4QGCA 1E43A 1BYBA 3LD5A 4O12A 2JGYA 2CCRA 3P60A 1NFPA 2P10A 2QIIA 1GZJA 4EOUA 5BMWA 3G1FA 3BWWA 1TV5A 4WQ6A 2EO7A 1Q66A 4UNKA 1S3HA 2TSYA 2GJPA 3CZEA 1LP6A 2L5HA 1F07A 3PJUA 1F61A 1TE1A 1Q45A 1B4KA 3LEPA 1LQ0A 1B3YA 4W4QA 3UQNA 3REQB 5BXSA 2BHUA 2PZ0A 3ZM8A 5I5RA 4S3KA 4NHVA 2CERA 3UR2A 1D3CA 2EPNA 1JUBA 1OY0A 4K6AA 2QUVA 5I7GA 4KRUA 3WX7A 4J40A 2BGQA 2BMBA 4HVXA 4E4FA 4KIEA 1XX1A 4MLRA 1E9ZB 2ZZ4A 3CBWA 1SU5A 3TA6A 1YDOA 4O1EA 3LS9A 4E2BA 1J5TA 2OKOA 2GDQA 2RDWA 5AVNA 4B4HA 3CQHA 1EX1A 2W0UA 3IACA 1OF8A 1U33A 3FN9A 4JTLA 1SFSA 4JHMA 1A5AA 4LH8A 1OFEA 5AYXA 1D9EA 5I3FA 3IUIA 4C6NA 2WWDA 3VKJA 1ADDA 2PDBA 3K1DA 5HK4A 1DJHA 3NL6A 1DQUA 3RUBL 2JBMA 2IUZA 4HOXA 4X0NA 4F40A 3H54A 3RLHA 1TTPA 1RUSA 3SJ3A 3GKFA 3GNPA 3TAKA 3RPMA 1L6WA 1EWEA 2AL1A 4O19A 2E4TA 1S46A 3ARXA 4LUJA 2P88A 2B7NA 3U4AA 3RM4A 2GSHA 1AODA 4WX2A 4XZLX 2IPJA 4JTSA 1EP3A 1GTEA 2Q3OA 3BLIA 1GGOA 1H7PA 5PTDA 3UG3A 4AIEA 2FTPA 2Q8XA 5LA1A 4LVBA 4PRRA 3H2MA 2I1OA 1FQ0A 4KEZA 4WVXA 3PUEA 3F5LA 1UMLA 4LUIA 4LVGA 3RLUA 1QPKA 1PZ0A 4FLOA 1SJCA 1UD4A 5DBTA 1ZB5A 2V3FA 4UQDA 2A85A 4E6MA 3BSHA 4XO7A 3WBWA 5GJNA 3POHA 1BAGA 3E0LA 1AZ1A 2PDWA 2DZVA 4JAWA 4ES4A 1FH8A 1XS2A 1F9CA 4TX6A 3WEOA 2VQTA 2PU0A 3M9YA 1XG4A 3UZYA 2YA0A 2KAUC 3TYDA 4G9PA 4HZ7A 5JVLA 3GFZA 1TCMA 2W9MA 3WCZA 4MSSA 3QQ0A 1E3XA 3PPHA 3IJIA 2XH4A 1BF6A 4HPJA 1OYAA 4LS0A 4Z2IA 1AFSA 2WJZA 4GQQA 1WXYA 1FA2A 4PUUA 2Z29A 1GJUA 2Z27A 5HWJA 3WDIA 2ACRA 3RX3A 5I78A 2C7FA 4JTIA 3KWSA 4DF1A 5HAOA 1XGDA 1B54A 3WQ8A 2I16A 3KEHA 3AXKA 3CZGA 1E5NA 3AFBA 1WP6A 2B7OA 4M5PA 4E2VA 2BS9A 4R9XA 4Z17A 1W9VA 3MPGA 2FFIA 3FA4A 5IBXC 2DZTA 1ML1A 1YADA 4H00A 3SCOA 2CZEA 3L2LA 1PX8A 5IXEA 1YBQA 2FZ9A 3WD1A 3ATZA 1R85A 3BVJA 3FDGA 5LZLA 4RKAA 4ZE5A 4QR6A 4ZVJA 5U4NA 3G3MA 4PFMA 1UP2A 1CXLA 2DFAA 3L4XA 4F0MA 3N2BA 2O4QA 4I6KA 5I3DA 4D72A 4Y2WA 2J9XA 3EGJA 2Q3RA 3KBVA 3B97A 1LQ2A 3PK7A 2PI6A 4J4KA 4X3ZA 2WZTA 1YLVA 4TVUA 1Q8JA 4MKNA 1ZFJA 3CH0A 4LX4A 4CCEA 5HANA 3N9SA 4I7UA 4UB9A 3XIMA 4MVAA 2VKZG 1XIGA 4HYWA 1FHUA 1JDCA 4HA0A 5E9AA 5G1YA 3MSYA 1CT5A 4F8XA 5HUPA 2W79A 3H2AA 3E2VA 3VIIA 5AECA 3AHYA 3U5UA 1FTXA 4FNUA 2NQZA 1C92A 4X60A 4HA3A 4IL0A 4AFYA 4KEVA 3CL6A 1CXEA 3OB8A 4Z1YA 1SW0A 5CC7A 3S2NA 3MCNA 4BK9A 1SO5A 3AHTA 8CGTA 1Q7QA 1W2PA 3G0SA 1AZ2A 2YKKA 3KOZA 1ZTVA 3O7UA 3GTXA 3A9BA 3A13A 3CT2A 3RX2A 4CEXC 5D38A 1X98A 3IANA 3UEQA 3AXIA 1VFOA 1SZEA 4KBXA 2ASHA 1MQRA 4CGTA 5KMYA 4ZQNA 2VGFA 1QW8A 1GW1A 1QI3A 3N9RA 3DAQA 5FJOA 4KCVA 3QF0A 1SGJA 5B7ZA 2HK0A 4YTRA 3FS2A 5I3GA 3CHDA 2QZRA 4TX8A 3QM3A 1ZHAA 3K46A 3CK5A 3W1NA 5BCAA 1M6JA 3MS8A 4V15A 1UBPC 3T44A 3ZLGA 5EMKA 1WZMA 4HBKA 3HGRA 2NUYA 4P8XA 1G9HA 3Q45A 5DMNA 4WXZA 3QY7A 3GHRA 1IWPA 5A6AA 1WZKA 3DC0A 2X41A 4XKYA 3S5SA 3E0IA 4S2CA 4GQBA 4KFOA 1W17A 7PTDA 4XBKA 3LHWA 2DQWA 3GX9A 1KLYA 1SZGA 3T55A 3AUJA 3I65A 1VFSA 4JYDA 3BW3A 2EAWA 2E28A 1VIZA 3W38A 5FJJA 1XIEA 5BRBA 3A47A 4MZ1A 1HN1A 4OU1A 3DOPA 3E2RA 4LNCA 3ISIX 1C8XA 1E72M 1P0BA 4HJFA 3FSTA 4UQEA 1MEIA 1MWOA 2OGJA 4OE7A 1IGWA 2FHCA 3CV6A 3W75A 4GGHA 2XG9A 1M3UA 4J27A 3VCCA 2H8XA 1F3TA 1AK5A 1CIUA 1EJUC 2J4GA 3S9IA 1G4SA 3THDA 3PZIA 3KTSA 2WHLA 2C1HA 4UQAA 3WK3A 1JZ2A 4US5D 2ACQA 3HQOA 4GKTA 5FI8A 4REQA 4MB1A 5FKYA 4OBRA 1ZBVA 4GWEA 1OCJA 4D6EA 4FSAA 1PKLA 5FESA 3PTMA 4DJFD 2WQPA 3MYPA 4A8LA 5G5IA 3EOEA 3DFPA 3TJIA 1I45A 1Q6CA 3VIGA 1V6XA 3CEUA 3CO8A 3GAKA 2WCGA 4BQ5A 2OQLA 4QS6A 5IOBA 1GOQA 2E1DA 3CPRA 3IARA 4PRWA 3T81A 1HL2A 5I3IA 5A8OA 5B7YA 1A3WA 3NQVA 3UR5A 4YPJA 4GUGA 2C14A 1TWIA 5AYIA 3TJ4A 1GQLA 2YGYA 3I3BA 3GXTA 2D2GA 1EIBA 1TMQA 4RPPA 5CBIA 5EY5A 2A0NA 3PP7A 6XIMA 4TUFA 1W54A 4UIOA 1XINA 2HMCA 4DUVA 1I2RA 4YHGA 3PANA 2DZWA 1RBOB 4NAFB 3I4KA 6TAAA 1PKYA 4CU7A 4QTGA 4BF7A 1EZ2A 3CIVA 1S2AA 2HVOA 3E2QA 4S3AA 4EPKA 4F0RA 4IXXA 2TYSA 3FA5A 3KOYA 4U33A 2FZ8A 1O68A 2OEMA 1E51A 1XGEA 2R8WA 5D8ZA 3ONBA 3VD3A 3NQ8A 3SN1A 1YW1A 4AU0A 5G4EA 2PSNA 4ZBCA 3QVQA 5LIXX 1UWUA 3WNLA 3W81A 2MNRA 1NWSA 3MWCA 1JEZA 3F4WA 3T9PA 3U6WA 2Y62A 4UFJA 3OVRA 4A22A 1QASA 4RNHA 3GNDA 3N34A 2IPGA 2NQHA 1E73M 1TR9A 2AL2A 1RP9A 4IUGA 1VIWA 2I17A 4IIDA 4Y9NA 3C52A 2JALA 5K7JA 2GJXA 4W7VA 1HFBA 3WQ6A 1DJNA 4NYUA 3BL3A 4RE0A 5FF0A 3GXPA 2VUYA 1BWLA 3B4UA 4GMEA 5F2IA 3L4WA 1GPFA 3QOKA 4Q4KA 5FSEC 3CJPA 5C0QA 3BG9A 3TUUA 2WCSA 1YDVA 1VYPX 4Y7EA 1XQKA 1GK8A 1MO0A 2WOQA 3ABZA 1WKEA 3WF1A 1J0HA 2E6DA 3BJSA 3W29A 1FWGC 3R25A 4DIAA 3LMZA 3ZFHA 1SYTA 2YZRA 3SCVA 3WLPA 4GVFA 3SB0A 3ENLA 2OO0A 2OLSA 1AJ0A 2VFGA 3PJTA 5A69A 5HNNA 4J5NA 1UG6A 2EG7A 3DUGA 4NASA 3MUAA 4DLFA 4GUFA 4FMVA 1ZNNA 5I77A 1O4UA 5HWNA 3W07A 1WYIA 1XM3A 1SFLA 3OG3A 2QGYA 1WO2A 4DHGA 1RLDA 4LS1A 2A3CA 5EBAA 1LROA 4JHZA 4HZ6A 4HN8A 1SZRA 4D6GA 1XD0A 3PB0A 4HGXA 3NYZA 2ABBA 3EX1A 3MMTA 3IGHX 3V75A 4GK8A 2CHOA 5JU6A 2C1IA 3S5ZA 4KWWA 3S2LA 3LRMA 1TRIA 3TN6A 2FH8A 3CQKA 4E2OA 1IT7A 1BQCA 4TV6A 2FVKA 1W9BM 3AMLA 3PBYA 5FF7A 2QAPA 4R7JA 4K7YA 3OBEA 2J75A 2PC4A 1J6OA 2XINA 2DT1A 5I23A 4JPGA 2VFHA 4YTSA 2W27A 4FOJA 3OZYA 3RILA 1QUMA 2J7FA 7XIMA 3LBOA 1N2VA 3C2OA 2ZRXA 4MF4A 4GI8A 4RV3A 3W1MA 1OABA 4PUMA 2PWVA 1S5VA 3NVTA 5CZKA 2HPIA 1FRBA 3RRXA 1XLKA 2PDPA 4JX6A 1TWDA 1KQYA 4UWMA 2V6AA 4WKAA 2YFNA 1DBTA 1FCUA 3IJ7A 4WY0A 4EPBC 2E8YA 3WQCA 5M1TA 4AZGA 2INZA 2WVVA 2FJUB 5U7SA 4CD7A 1YHTA 1ZS2A 2VYOA 4EKJA 4GYJA 2Y7EA 1KTNA 1NTHA 1G7UA 5HNTA 1HUVA 2G96A 3C5QA 1VFFA 3RCYA 1PEZA 4AXNA 4EK7A 1RVGA 4AHOA 2V81A 1IT0A 1EYWA 1I6NA 4F2TA 1R38A 4LOCA 2VWTA 3EPOA 3W0KA 3CHVA 1NQ6A 5EBUA 1R47A 4GC3A 3ZOAA 4EPEC 2BVTA 3VU2A 2VGIA 3C2VA 3H21A 1WDPA 3WQOA 2UY3A 3H7VA 4QP0A 2ON3A 3S2CA 2PZNA 1JQVA 2Y4SA 5LYRA 3WUGA 6REQA 1FWBC 5KEZA 2W66A 1XRTA 3RPTA 4NAEB 4S23A 3WLHA 4F79A 2P5NA 5H8PA 1KFKA 2CZ5A 2BBFA 3GIPA 4LTSA 3USZA 4CNNA 3QPYA 2WMKA 1GVFA 3SSZA 1GG0A 1J01A 2GVEA 3TR2A 1DKWA 5H1WA 1K8ZA 2EJ1A 4S3GA 4IX2A 1CGVA 3S1WA 1A47A 4C7FA 2HXUA 1TIWA 4LB4A 3QC0A 5CLWA 2VFIA 3RFAA 1QFEA 4W9TA 3REQA 3F2CA 1FVPA 1QATA 1TPH1 4GO8A 3MP3A 1B3VA 1KRBC 3CMFA 1I9CB 1ISWA 5LXXA 3TV8A 4GUHA 2OLAA 3TLQA 3AQUA 4GVHA 2X7VA 3WLOA 1R30A 2OSWA 2XJ7A 2XIMA 3SFWA 2H8ZA 3L68A 3S5YA 4QNWA 5A6BD 1V51A 1EC8A 2FJKA 2Y8VA 1EQCA 1CXKA 2W4XA 2RKXA 1M04A 3LPGA 2ZX6A 3TQPA 1WX0A 3V0SA 4F48A 1A5UA 1DXFA 1T7LA 1I0DA 3CHEA 3M07A 1FY6A 1PSCA 3LM7A 4IWWA 2ZKMX 3T0DA 4CD6A 1IXNA 2TMDA 4H83A 4AD2A 1IXOA 1DHKA 2CHRA 3IVUA 1O6IA 4WSHA 1L6FA 2C91A 1FDZA 1JPDX 1XV8A 4JCLA 3WNOA 3KW3A 2J8GA 3BE7A 3ITCA 3MBFA 2EPKX 2J7HA 1KB3A 4WKFA 2CWNA 1UD3A 3V36A 1G1YA 3T2PA 3HG2A 1LUCB 3GDRA 1UP3A 2BY2A 5BU6A 1E6ZA 4M1RA 3OZMA 2D2JA 1UR0A 1Z48A 3DIPA 1W1B1 4LF1A 4DM2A 4JFTA 1P43A 3VD4A 4H7CA 2FGBA 4S3CA 1V77A 4GVIA 1FWFC 7ODCA 3GYCA 3I6EA 2J25A 4N4QA 1ADSA 2JF7A 1ZAHA 2F6UA 2QMKA 2PWUA 1X6UA 5EMJA 5DO8A 5I2UA 5IRPA 3TVAA 3UR7A 4DZHA 2Y5JA 1R2RA 5DRIA 2Y88A 3VC6A 2QCNA 3GD6A 3HG4A 2BY3A 1EL3A 2OT1A 1WUEA 3VOFA 3DBNA 3H22A 4I5UA 3CO4A 3KHDA 3LA4A 5EMLA 2FZBA 1LG1A 4AZIA 5A6BA 3WLNA 3FJNA 1QT1A 3UT0A 5HMSA 3M0YA 1BKSA 4FIQA 3C0JA 1KNWA 4KWSA 4WKHA 3DENA 3VK5A 2DT2A 1EIXA 3QY6A 1TPB1 4YHEA 1K4GA 3VGGA 5EU9A 1XKYA 4Z2GA 2PA6A 3CZKA 4JQ4A 2F2KA 3PBUA 3HJZA 3G18A 4XZHA 1IEVA 3NAVA 2I5IA 3A4JA 3WJSA 3HIJA 1KM2A 3UERA 3GZAA 1QNOA 5A6KA 2CXGA 5HBFA 2E40A 1EOKA 1QWGA 2J8FA 2ATSA 2JIEA 1S2UA 1C90A 1XW8A 1WBJA 1DJZA 1CYGA 3AMDA 3URBA 3UWQA 3PC0A 3N11A 4NL1A 1NDZA 1TQJA 1VB9A 4C6MA 4RCXA 4L4LA 4D6DA 3PZQA 4NXKA 1GOMA 1QJWA 4LUTB 1OG0A 1UROA 2BVWA 4RDYA 2JQXA 3G1DA 4O4WA 4XQ6A 1LLWA 2OJPA 3GDMA 2WZMA 5L6UA 4IH3A 4FXRA 2OKTA 5DRCA 2ZDRA 1E1EA 2PWDA 4E5TA 5D2YA 1JCJA 4UFLA 3GAYA 1XJBA 2XZ9A 4A8RA 2ZVRA 4NF7A 2V5JA 1TPDA 2NV1A 3UZWA 1LZOA 3WFZA 3F4CA 1EB3A 3V3WA 1LJYA 3HPZA 1NAL1 3KVMA 2WBKA 3W01A 4TX9A 4LYPA 4MOZA 3QR1A 4HT3A 5CPOA 3UA4A 2NSXA 3UZJA 1V3JA 2JK2A 4B5TA 3ANYA 1TUFA 4YMZA 1UD6A 4RNIA 1US0A 4C65A 2OB3A 3TEVA 2GDUA 4LUSB 5CZSA 2ZWYA 1NH6A 1R9ZA 1XSIA 1PWMA 3DKLA 2JFEX 3ID7A 2FZMA 2C15A 3JZEA 4OKDA 5DX7A 1W2VA 2IQDA 9CGTA 3N2MA 4A21A 1RCXB 2NWRA 3TE9A 5J5RA 4JIRA 3MW7A 2C6QA 4WY0F 3W7IA 3L5LA 3CV7A 1WDSA 4J2MA 1HKMA 3RHGA 1MNZA 3T78A 4JIIX 4C1KA 4H41A 3BAWA 1HW6A 3O0FA 2CETA 2GGIA 3HV9A 4QDWA 4KEMA 1GYLA 3WZ0E 3PG9A 2WPBA 3EA2A 2G5WA 1E1FA 3J7HA 3SW6A 2IQ0A 9XIMA 3HV8A 1RA5A 1EXBA 4XG1A 2GWGA 3CQIA 3CS2A 2VUNA 1DIDA 1KRAC 1QPOA 4NNAA 4ICNA 1Q2RA 4DJEC 4C6KA 4UQ9A 3MDWA 1XLEA 1TA3B 4M6PA 5BOOA 2B31A 5HJXA 1FCBA 1A0CA 2DUZA 4DXVA 1Q8AA 2WAGA 2WCAA 4O10A 2BX7A 2QAFA 3CQ0A 4PE8A 3HA1A 2ZQ0A 4Q8TA 2VNCA 1XQLA 2OWCA 1VBGA 1LRTA 1XICA 2Y7FA 1TPVA 1IIGA 2ZTKA 5E6ZA 3FJ4A 1FP9A 3UZZA 1XI3A 3GH7A 1Z6KA 3AZSA 3S2JA 3TA9A 1PIGA 5HQLA 1REQB 1VFLA 3G77A 4WHBA 4LV4A 3LG3A 5KITA 1EO7A 4L6OA 4JNZA 3DECA 1KM6A 4NZ3A 1MQQA 5F2GA 2J7GA 3B06A 5A6MA 1AQMA 1JRBA 3NDZA 1ONXA 4ZFCA 3UZ5A 3TXVA 1IV8A 4PMVA 1JQXA 1PIFA 4GHRA 3EKZA 4AXKA 2DZBA 1RALA 4B9ZA 3U8GA 1K1DA 1XUUA 2O92A 1RJRA 1G69A 3CAQA 3NR0A 3E0WA 3VKCA 4AZ5A 3PR2A 1JDFA 1SW3A 5TQLA 3IUDA 1QPNA 3FVDA 4ZR8A 5C2GA 3W2JA 1AMKA 4O17A 2VEKA 1E4MM 4BF5A 4QG8A 4KFPA 4ZFMA 3SQSA 1H1ZA 1CZ1A 4MAVA 4DBUA 4M19A 2YDAA 3BAIA 4IJBA 1GJWA 3G6LA 3JS3A 5E1QA 1XLDA 1XDJA 2OOGA 3M7SA 3P5YA 2Q6ZA 4D1IA 3NXLA 1TVNA 5DXXA 1BG4A 1ENUA 3L21A 2FZDA 4QCFA 3BURA 3QTGA 1RV8A 1JVNA 3TYUA 1J12A 1BG9A 1K8YA 2Z1SA 2BVDA 1ECQA 3IV3A 1XF0A 3EA1A 3HFYA 3M41A 3E6EA 1KFEA 2DP3A 3W87A 2ZTJA 4NU7A 3BQ6A 3FKKA 2C71A 2C79A 3VOJA 2OEJA 1GEQA 2BOGX 1UA7A 3AI0A 1W3JA 3MZNA 4N0RA 4LV9A 4Y8EA 1XLGA 4IG2A 1TPC1 3VZZA 4MM1A 3NEHA 3MC5A 1J4EA 3HQ1A 2YDRA 1UWTA 3LUTA 2BY1A 1EX5A 3EOOA 4KS0A 4P7OA 3BGJA 4V1XA 4E38A 5D02A 1OYBA 3AIEA 4J28A 1XIHA 3NOEA 3QYSA 3BXWA 1DYSA 1TX2A 3LCHA 4CQ8A 2JE8A 4MNJA 3SUSA 2QDHA 1OYCA 4A6GA 1TB3A 4LYKA 1KGWA 2QUNA 3CM4A 4PTDA 1VQTA 3LNPA 3NQGA 4H9VA 4FI4A 2ZFAA 1YYAA 4QLKA 1LL7A 4RZ6A 1ME7A 1UIPA 1V6WA 2WHKA 4GZEA 4NAFA 4RW5A 4Z0JA 2Y8UA 1E6RA 4O1CA 2ALRA 2R1PA 4FLQA 3T05A 3PWGA 2C3ZA 3T2QA 3W86A 2P1FA 2UY4A 3WD3A 2BOEX 3TK7A 4F9JA 3AROA 3B0XA 1W3KA 3BZJA 1FX6A 3GW3A 4PULA 1J9YA 4HMEA 2V2DA 3VAVA 3BMWA 1R87A 1LDCA 1GZ1A 3VNIA 3UXDA 5CLTA 4QAIA 2ICSA 1TE6A 3QHOA 3WKZA 3OIXA 3KRBA 1CGUA 1JUEA 1RHCA 4U5IA 1TVPA 5REQB 3SY1A 4DBDA 4YIWA 4Q4OA 5EB8A 5E0CA 3BLLA 3NJ3A 4FLSA 4HNLA 5HOSA 3B9OA 3BOFA 3TOPA 2VTFA 1KXTA 1PTDA 4AHQA 1CCWB 4M3PA 3CTLA 2OSXA 1ZCOA 1L2UA 3P62A 3FSUA 4ATLA 2X1UA 3AS2A 4GY7A 3W76A 5H91A 1TR1A 1AH3A 2E1WA 3E2SA 1JCYA 3OTRA 1FWJC 3PVFA 1LRNA 3TYBA 3CUGA 1VHNA 1I75A 4XO6A 4O4VA 1PKNA 1GVEA 5GNZA 4ZB5A 3R0DA 4CKQA 1EDQA 4ZQCA 1QTWA 2YL5A 4QLJA 2ZXBA 1YXYA 2WWCA 3PBGA 3GU2A 3R1ZA 4M6VA 2J9ZA 3W00A 4CNUA 4WDUA 2BOFX 2NX9A 4KESA 2HISA 4L9YA 3LHUA 1WUFA 4RNJA 3OGRA 2OWXA 3N13A 1KKRA 3WF2A 1GKQA 4KCWA 4O53A 3C0SA 4FA3A 4L6DA 3BW4A 3VOHA 4IIHA 3OLGA 3VIMA 3OYZA 1EHAA 1VBHA 4CUCA 4AEEA 2D23A 4GCAA 2BGNE 3EWBX 3M6DA 1S2VA 1XUZA 1P0EA 2TODA 4UOZA 4XKMA 3URQA 4LGXA 4LQ1A 3DFHA 2CFFA 3ABXA 4GJJA 2ZICA 2XIBA 3QGKC 3SUTA 3FNDA 3L12A 1F4HA 3OQ8A 3T08A 1FDYA 4F3HA 1M9HA 4TTUA 3W1LA 3IK2A 4WDXA 2QCDA 1XLHA 1JI1A 1E15A 2WC7A 5HQMA 3E96A 4CN4A 1MW2A 3CZLA 3KZPA 1EWDA 4FNTA 1IIHA 1RK6A 3IGXA 2O9OA 1EBGA 5MHBA 2A3AA 1NF7A 4PMNA 5D05A 3DH7A 1T8XA 1MRAA 1A5SA 3RDKA 3IS4A 2VR2A 9XIAA 2OTDA 6ALDA 2DV0A 3PG8A 1Q2SA 3TLLA 4PUJA 5M5DA 2ZUWA 4HNTA 2QJJA 2DGAA 2A2IA 1OC5A 3R8GA 1QWKA 1Q4WA 1ZGDA 1J8VA 5J8LA 3TROA 2PGEA 4DO7A 2PFHA 3VIJA 3LHTA 3S5NA 4PMRA 5MF5A 1QI2A 1B30A 3H4WA 5BRQA 3RLGA 2WJEA 1RVKA 3BAKA 4NZFA 1DV7A 4C6JA 1QOQA 2Z1BA 3JZUA 5FAGA 3GXFA 2PTWA 3KS6A 1WBHA 3A3XA 4H9TA 1W1PA 2C1GA 4AVFA 1A4MA 2R94A 3CL8A 4PRTA 5DMYA 5I24A 4H19A 4NRRA 3H7RA 4MYAA 1M65A 1CW2A 3IJ6A 2DQXA 3POCA 4H9XA 3QV7A 3GZ3A 5I02A 3NQEA 4H6EA 5AHLA 5DT5A 4ENLA 4GLEA 5HMEA 5K2ZA 2VX7A 5AVHA 4AWUA 4UNLA 4H3DA 4CQ9A 3W22A 5DCDA 1AD4A 1GHSA 4NJIA 1NDWA 5HJLA 1YTEA 2FKPA 3WDPP 4PUEA 2E8ZA 3M5ZA 4NAEA 5C9ZA 1QO5A 1HVXA 3NZQA 3GG7A 5I00A 2P0OA 5AC6A 2O7SA 3L4ZA 2BB0A 3T0AA 4IPJA 1MVYA 3QZAA 1CWYA 3W53A 1EDGA 1D3HA 1XRSA 1SVDA 1POJA 4C6LA 1WOBA 4JDBA 5JMUA 4Q8NA 3WN6A 5D2WA 3RITA 3D6NA 3KRZA 4WXYA 4XZ9A 2UY2A 3WNNA 1ADOA 2Z1WA 1VH7A 2SFPA 1DHPA 4C5ZA 4J3ZA 1FDJA 4QFUA 4OZOA 3S1UA 2PDKA 2X1TA 4LC8A 3EB3A 4M56A 1R2TA 1FWAC 4MB5A 3ZZ1A 4AVNA 2W62A 1SR0A 1VJZA 1TX0A 1LF1A 4H04A 3O15A 2QJIA 2FVLA 5SWUA 1CNVA 1JXJA 3T07A 2A5HA 2CZFA 2E6AA 3WMBA 3DG7A 3C3NA 4XB3A 4NX0A 4MB3A 4IMFA 1DQXA 3EXSA 3HG5A 4YWIA 3DG3A 3WY1A 4TMCA 1HO1A 3H2NA 4DZAA 2GQ8A 1TJ1A 1W9DM 4K36A 3AIWA 4X2PA 3R2GA 3UNTA 4PEKA 1D8WA 4JIQA 2D1ZA 3U2ZA 1E40A 2GVLA 3TTYA 4JYFA 3GTHA 5F1UA 1G94A 5D33A 3N2OA 3W1UA 1F2JA 1UOZA 3Q58A 4S3FA 4O15A 3WBXA 4W8BA 5EA9A 2CBIA 3MO4A 1LUCA 3SEPA 1Q63A 3PBMA 4PTXA 1ELSA 2VCBA 4MPKA 2CXEA 3MU7A 1K9FA 1XYBA 3UGRA 3ZSSA 2J9YA 5HPOA 5A6JA 1K7XA 4OBSA 2PDJA 2GDVA 2YXXA 3MKCA 3H23A 3WH7A 4JTGA 2PWFA 5CKSA 3B8SA 3BSGA 2I9UA 4AZ7A 2BVYA 2I5QA 3GFXA 1YTDA 2G4JA 3QR3A 4JL1A 2PDGA 3BLKA 2BXZA 2Z7GA 4MZ8A 4WEVX 2RUSA 3D47A 3EXTA 4ZMGA 4UMAA 3V1HA 3NQBA 5H8UA 4RUBA 5F4WA 1B31A 3GVWA 1O95A 4LYQA 3GDKA 3WF4A 2WYSA 4RDZA 4O1BA 3RIKA 3BLPX 4HOZA 3P67A 3TTQA 4BQ3A 3CUHA 2OEKA 2WZIA 4WR3A 3NQ7A 1LOSA 3LPPA 3OZOA 2HE8A 1VD6A 4YL2A 4ZA0A 4HZMA 2VZTA 1VLWA 4LAUA 2BZNA 3F4DA 1JGMA 4GA8A 3G8RA 5L9FA 3R89A 3WK0A 3UFYA 4OHQA 1KD0A 1UH2A 3KBSA 2G37A 1HO4A 3VX1A 2R6OA 3MV11 5A95A 2PTXA 1K6WA 2A3HA 1FWEC 1GOWA 3CWOX 3M5VA 1D7KA 4AVOA 5K9DA 4N9EA 3WLQA 3JVAA 3LXCA 4YVXA 3F2BA 2F38A 4HMDA 1H5VA 3ALGA 3I68A 4JTUA 3OU8A 5LA2A 2FGLA 4M8UA 1H0GA 5IM51 3OODA 1S3TC 2G3MA 5A6SA 1LT7A 2Z6JA 4QRNA 1XC6A 1FWCC 3QMSA 4C6IA 4LUTA 4GH1A 3MI3A 3OBAA 3CUIA 1XYCA 4LANA 4I6VA 1PO9A 4U3AA 3LY0A 4I8YA 2J7BA 4IGSA 3GBDA 3DFQA 5AN7A 1YTKA 4FXFA 4D6JA 3I3EA 3IIOA 4E2DA 1A5OC 3BTNA 3DI0A 1BQGA 4AF0B 2GWNA 1ZZMA 3RRAA 4HOWA 4HPHA 1XLFA 5I3JA 1IYXA 1GQIA 2Z2BA 4Z2LA 3H6OA 3RN6A 2D69A 3BSMA 2CKSA 4WZHA 5FF2A 5AC7A 4FOKA 1KBBA 3W73A 4B5WA 4A2RA 4CN6A 4UTLA 2O9PA 4QJ1A 1NOWA 4LUSA 3W1AA 1JPHA 1W1YA 4UUIA 4NZ1A 4YLWA 1BVWA 1FP8A 3QV8A 2JKEA 5A94A 2Z1XA 3LB0A 2BTMA 1Q85A 3OP2A 2QS8A 1Z89A 3TSBA 3OZPA 4OUEA 4MB4A 3KBMA 5I06A 1DPMA 2ATMA 1UB3A 2XPKA 3K4AA 3NVDA 3EX4A 3GU9A 3TWBA 3PUOA 4ZQMA 1G5AA 4IPNB 3B9AA 3ZWTA 3BCJA 3DERA 3GTNA 1A4LA 3UBPC 1QHOA 1NEYA 4UFMA 4ZO6A 3N6HA 2BP1A 4WD0A 4MFEA 3QBUA 2R1NA 2QV5A 4O14A 1R0MA 3SCPA 3WNMA 3P0XA 2NZLA 1U1HA 4LPCA 3FVMA 5A8GA 4QM1A 1DTUA 6CGTA 3N25A 1JPMA 5DY2A 4H6QA 5ECUA 3RJXA 2VCAA 1HJXA 1O94A 1TA3A 1OX5A 3O0KA 3HFTA 4D8AA 5HMFA 3L4YA 3NGFA 3XINA 4K8EA 1ZUAX 4HK5A 5C6MA 1ICQA 1NJJA 2EGZA 4XZMX 1XWYA 3LHVA 1RQBA 3AWNA 5FIPA 4N9DA 4UZSA 3UA3A 1SMDA 1WZAA 3KRUA 4N2YA 2QJNA 4BJHA 1FWSA 5DLCA 3CPGA 1UP0A 5KZEA 1REQA 4M51A 1ICPA 4GH3A 1W37A 3OEXA 2H9AB 1E6XM 2O9TA 2WSRA 4MFDA 4AD4A 1JDEA 3ARUA 1GJPA 3HU7A 1KV5A 4L4MA 1J0KA 1TO3A 5CC3A 1RBAA 3AYVA 2DZSA 1DJYA 4RX0A 3PUGA 2ISWA 4MUZA 1ONEA 1KKOA 2E3ZA 2Y63A 3W7QA 2OVLA 2D2OA 3DYPA 1MUMA 3KL3A 4M0XA 4PBFA 5XIAA 4XIMA 4DY1A 4IGNA 4FB7A 3DXIA 3VM7A 4GJIA 4N4PA 3WQ4A 2RAGA 3EX2A 3AYRA 1OIFA 1W5NA 3LDVA 4UZUA 3WL1A 2ZDSA 3PZTA 4LAOA 4IQDA 2V3DA 1WB0A 3SQLA 3V5FA 3VGBA 2R1MA 3ZR4A 3ECQA 1PHQA 2A4AA 4Y6GA 3C6CA 4L5ZA 2WSKA 1DWJM 1OT1A 4IZGA 1RSCA 4PMOA 1FFQA 4AIBA 1O60A 2QEZA 4CVWA 1HJSA 3SRHA 1BWVA 1A53A 4JZ5A 1J18A 4DXXA 5JXQA 3WIJA 3BPWA 1V6VA 3GG1A 1JCLA 4B5UA 1L6SA 3U0HA 3FIGA 3NTYA 2QV4A 4MY9A 2PS2A 3VMOA 3GH4A 4J3XA 3FX4A 4BR1A 1E6QM 2GGJA 5KINA 8XIAA 4NZ4A 3W1XA 5EGRA 3APGA 2VDGA 1XIIA 2C0AA 3IIZA 5AYZA 2NV9A 3W7PA 1NARA 2HVMA 4LFYA 4JX4A 3LMYA 4RR4A 4M6QA 1DWHM 1MXGA 4DXKA 5A8MA 1R5YA 1KWGA 1MXSA 3W7NA 3QW3A 3MSGA 1DJGA 2CBVA 3TONA 2CC0A 2UY5A 4WCJA 2ZC1A 2VMFA 3ALFA 3EWZA 3THQA 4C6DA 1VAHA 2O55A 1CGTA 4AY8A 4YCPA 3VOGA 3N12A 4OT7A 5CBJA 4ZQPA 1O5KA 2I7GA 1LLOA 3IVSA 4W84A 2FMOA 3AS0A 4ZB2A 2OOFA 1VEMA 4QITA 4DO6A 3HN3A 1LLZA 4MWAE 3P5ZA 3U7VA 2VURA 1PBGA 1YDNA 4G6CA 1EJRC 3FA3A 4HK6A 3W84A 1QR7A 4IP5A 3QW4B 4M1BA 3DBPA 2XZ7A 1UC5A 4TQTA 3NQMA 4E0CA 1ZENA 2DSWA 1DWGM 1H2JA 1PYMA 5AHFA 4DO5A 4QE5A 4UQBA 4GY0A 4PEEA 3SGZA 1MZRA 3VD5A 3GYEA 1S5NA 3F2DA 1JZ5A 2IKHA 1DE5A 2PC8A 1W8SA 1ICSA 1GVYA 3EAUA 3C4UA 2MANA 4MYXA 2WNZA 4EE9A 3GU1A 1HJQA 3HMJG 3QEZA 4AMCA 2C0HA 2NQ9A 1Q3NA 3N04A 1LTDA 4HCDA 3VX0A 4KKXA 5ENLA 2XGBA 1V0NA 4K8HA 4GE8A 4JTEA 1T0OA 3UWZA 3WJWA 4QEEA 2VFDA 4XSMA 2ESCA 3LTPA 4EVZA 4JEJA 4PTWA 5J04A 3TQVA 2CHNA 5REQA 1ME9A 2NXHA 3GVGA 5FA5A 4HN4A 2QIWA 5K3VA 3FJLA 3P81A 1XG3A 3M5YA 3K8MA 4JQ1A 1TVLA 3TN4A 3IAPA 2EXOA 3CU2A 1Q6EA 2J6XA 4MY8A 1Y0EA 4O28A 4FPSA 4F0LA 3CC1A 2ZUSA 3RR4A 3KBJA 2EG6A 5AC5A 5EL1A 4X63A 3EWCA 4ZOEA 4Y9PA 3U2CA 4L1WA 2X0YA 3DC8A 5DN1A 3LV5A 3AWOA 4C1LA 2WZHA 1IEIA 1AJZA 1O5QA 4IGHA 2ZOXA 3L4VA 1W9XA 1XIJA 4AQLA 3A5VA 2XGIA 3B0YA 2O7QA 3TZNA 1VBUA 3SGGA 4K3ZA 2GJLA 5AHNA 4JTDA 1O5RA 4PL1A 3QC3A 5E93A 3EZ4A 2J78A 1WAUA 3DCPA 1AQFA 4DVOA 1XIDA 2A6NA 1CLVA 3KOWA 5KETA 1UWSA 1MW3A 4C60A 1BYDA 4UTWC 1G4PA 4PA8A 1UZHA 4DX3A 1C91A 5BW6A 1J10A 3GWQA 1J2WA 4UTTA 2E7FA 3AOFA 4OV9A 1NY1A 3SZ8A 3GR8A 4GD0A 4JCMA 3ZSTA 3EPNA 1GNXA 3AO0A 2VOMA 3ZJ7A 2YSWA 1ISXA 3SRFA 1GWJA 3HB9A 3W23A 1VKFA 3LTYA 3O16A 2VXNA 1DEDA 1QNPA 4ZOCA 4B91A 5AC8A 4QG9A 1B0IA 4DWDA 1UD5A 3ITXA 1H7RA 3ARVA 2BSLA 5I3KA 3N73A 3W26A 2WW5A 2XM1A 3GUWA 2BV9A 4C6EA 4U28A 1H3GA 3CYVA 4J3SA 1P4CA 4JTQA 4UTMA 3IEBA 1V3MA 3QPZA 3FEQA 2DZAA 3KOFA 4PB5A 3TFCA 3TP4A 1UJPA 3AS1A 4JBRA 5H6HA 3ABRA 3G5EA 3CZ8A 3N18A 4UXDA 2H90A 2Q8LA 5ABFB 1TIMA 2WLZA 5FACA 3W7CA 3SECA 2ZZ6A 4R88A 3VUSA 3WDJA 4EANA 1GYMA 1KGUA 3SR7A 3ZWSA 3NA8A 4TO8A 3SCSA 1AH4A 3HURA 2P3EA 3A12A 2HS8A 2E68A 3SCTA 2X30A 3CAKA 5MKGB 3V5OA 4RE3A 1A50A 3HQNA 4LEQA 5D8WA 3CHFA 4E8CA 3WH5A 2ZE3A 3W7OA 1MYRA 3SCNA 4O8AA 3HPFA 1RP8A 1CDGA 1H61A 2XVPA 3LM3A 3OYXA 2XSBA 4QS5A 2XH0A 3P80A 4UOJA 3MVIA 1C8QA 4DZIA 1VPQA 3QY8A 1UD2A 4MDOA 2PBGA 1AL7A 1T41A 1TV2A 1U2YA 3MDUA 1YE6A 4DJDD 3BLFA 4TVDA 1R6WA 3P61A 3V5CA 1UWRA 3C8NA 1BGAA 3LLFA 2HJPA 4HNVA 2OO6A 2D24A 5EMMA 1S2WA 5AY7A 2WZEA 5CQ1A 3ARZA 4MNMA 4M82A 4GBUA 2I9EA 1W5PA 4UMBA 1EGVA 4UOQA 2VRJA 1JD9A 1H7XA 1EPXA 4CD4A 4WIWA 2AMGA 1YNPA 1KW1A 1PX3A 2E9BA 4W93A 2DEPA 4DUXA 1S2TA 1TTIA 3HGOA 3A3HA 1QBAA 1UASA 1LOQA 1IGSA 3MWAA 1TELA 3WLJA 1QAPA 2DSKA 4JFUA 4HHLA 5HDRA 1YX1A 4YNGA 1BVZA 3BAXA 1W32A 1M7PA 1RJPA 2G0WA 2CITA 3HOJA 5GJMA 1K9DA 3W28A 1CXIA 2PPGA 1MUCA 5FF3A 1KR1A 4JICA 1DIOA 4LNYA 3TJXA 3R43A 1YDYA 2TPSA 1Y5VA 1EJXC 3NQ6A 2Y61A 5K9CA 3PUDA 3NCOA 5D4YA 1QK2A 3R7MA 2NLIA 2VGGA 4BCEA 1PYFA 3WJXA 3S8HA 2OCZA 3G1VA 1OF6A 3NURA 4PB3A 4LY4A 1VRDA 3W27A 2Z7KA 2V5KA 4DJDA 3WSUA 1KBJA 1V3IA 2Z1VA 2YB4A 4IM4A 1SFTA 1UMYA 2ZE0A 2GJNA 5TIMA 1UCWA 2DVXA 2WB5A 2J7EA 2HPMA 2VC6A 4PODA 4B3ZA 3V16A 1DORA 2JKPA 1JIBA 5CAHA 1RQEA 5FJTA 3NM3A 4J3VA 2G3JA 1CXHA 1P1MA 4RJEA 5G4HC 1H7NA 1HKVA 1L6GA 3STEA 4IFOA 2WANA 2Z4GA 5FL0A 3QV9A 3K13A 1LBFA 4GQGA 1MFVA 3WQEA 3GB6A 4W87A 2ZRYA 1UZ1A 5CSYA 2OQHA 4QAWA 2ZUUA 1RQHA 4GUIA 1QCWA 3G1YA 4IIEA 3A24A 4N6EA 5FJIA 4DAFA 3C86A 2YCLB 2GQ3A 1PUDA 5I0DA 1X1OA 4HTYA 3QFEA 3FHQA 3TN3A 2WVTA 5E9XA 1WAWA 3QYQA 1IWBA 3W1QA 4YTQA 2A3LA 1BTMA 3QHMA 1IQ8A 1FWWA 2HTMA 1Q5MA 2AGKA 1PL9A 3W6LA 2W67A 4ZSUA 4JTRA 1E9IA 2OZ8A 1HKKA 1SM9A 2PAJA 4W88A 3ONCA 2A3BA 4RNFA 2G95A 3PZOA 4K1GA 3D3AA 1HZYA 4AB4A 1EGMA 4H7VA 4WK9A 4GX8A 4PUNA 2NW0A 3VI2A 3AXMA 4A3QA 5LA0A 4FNPA 1GVOA 1K7FA 4ERGA 2QJHA 3UD6A 4LF2A 3GC5A 1PE1A 1VFUA 3M47A 4Y90A 4JQAA 1E5JA 4XIAA 3COTA 4AWTA 3W7LA 3VDAA 2VEIA 4QCEA 4UNIA 3RU8X 3GTIA 4Q6XA 3D0CA 2GUBA 3QGVA 4KPLA 2AOSA 1VS1A 1VF8A 3SAZA 3S42A 3WLRA 3VD7A 2XFYA 3GK0A 2GYIA 3KP0A 3TYAA 2Z24A 5DY3A 3KDNA 3WD0A 1MFUA 1VC4A 3UVIA 5LIWX 1Z69A 4KETA 3EB2A 4AZBA 2QUUA 4R7OA 5HINA 2PRHA 4PL2A 1J5SA 1KFJA 4OOZA 4RW3A 3H7UA 2CYGA 3EDFA 1NELA 2GVYA 1JFHA 4H9ZA 5LHFA 4AF0A 3ZYZA 4CVUA 1VZWA 2FTYA 2PDCA 3NQDA 3MKVA 2PGFA 3AZRA 4GIRA 1NP0A 1BWKA 2ZIDA 4Z1BA 2IPWA 1N82A 1TG7A 1YPXA 3G22A 3S9YA 2PODA 1LL4A 4Q33A 1XFBA 4GXMA 3NO1A 4GNJA 3LBMA 5A2CA 1HJUA 3UJ2A 5DT7A 2YW3A 1LM1A 1NWRA 4IOTA 3PZGA 5FJPA 3G1RA 4XTDA 3MANA 1AW5A 3OVGA 2NX1A 3SRDA 1W6TA 3G6MA 1WE5A 3E0FA 1G7VA 1V0KA 1WDQA 4AZ6A 1F3EA 4YJ5A 3KBWA 2WVSA 5F1VA 3GR4A 1VRXA 1B3OA 4BKNA 2R9RA 3P82A 4S39A 3IUHA 2PP1A 2A21A 4NQ1A 3UWYA 3MP4A 3VFCA 1BKHA 3C61A 3IJ9A 4YYFA 1EUNA 4HSOA 4C6CA 2HNHA 3BLDA 2DIEA 7REQB 4N7QA 1RK5A 1IEWA 3WD2A 2PU1A 1Q6LA 4F4RA 3II1A 3TZFA 4IJRA 2J7CA 2ZRUA 1UZDA 4GIYA 2I57A 1V79A 3KAOA 3E1F1 1HF6A 1VLIA 1OFBA 3H2FA 3QN3A 3R4IA 4FXJA 1MRQA 2G41A 3NQ2A 4QROA 2NVCA 2INFA