3FFSA

The crystal structure of cryptosporidium parvum inosine-5'-monophosphate dehydrogenase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
377
structure length
301
Chain Sequence
TKNIGKGLTFEDILLVPNYSEVLPREVSLETKLTKNVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKNMDMESQVNEVLKVKNWIAYSNENLDNKGRLRVGAAIGVNIERAKLLVEAGVDVIVLDSAHGHSLNIIRTLKEIKSKMNIDVIVGNVVTEEATKELIENGADGIKVGIIVAGVGVPQITAIEKCSSVASKFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKELIGDTVYKYRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKKSSYVEITTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Inosine-5-monophosphate dehydrogenase
publication title The structural basis of Cryptosporidium -specific IMP dehydrogenase inhibitor selectivity
pubmed doi rcsb
source organism Cryptosporidium parvum
total genus 82
structure length 301
sequence length 377
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ffsA00
2J24A 2ZZ6A 5D30A 1H60A 5AB3A 3G1YA 5I3IA 1JCNA 1QWGA 2JBMA 5FEPA 4LU0A 1XBZA 3M43A 3R89A 2WO5A 3NQEA 1PL9A 2NX3A 1HG3A 2B7NA 1ZAIA 2OX1A 3UZJA 2QJIA 4JY8A 5TIMA 1B3OA 3F4NA 5ABTA 2ATMA 2EF9A 3DKJA 2ZQ0A 3W85A 3NZ1A 3LXBA 4GNJA 3HPSA 1DBTA 4IOTA 1AK5A 1JUKA 3O05A 2VFDA 3NDOA 3CC1A 2CZDA 3ZWSA 3B04A 3M9YA 3W87A 3WFAA 2LLEA 3BG5A 4FX7A 4LC6A 4S1FA 3QEZA 4H6KA 3CQ0A 3GK0A 1FWTA 3E0IA 1UASA 4MYXA 3A5FA 4BR1A 4I7WA 1KM3A 4FHAA 3E9AA 3PULA 3VI2A 3QW4B 4O15A 2V2DA 2R94A 1GYLA 4N4PA 2RDUA 3G24A 1MO0A 4LWWA 5LSMA 1ZFJA 1GVRA 1R2RA 3HBLA 3UWWA 2E6YA 5AC6A 4XBKA 5U4NA 4YXGA 1TPWA 4Y6GA 3LCLA 3AO0A 3C0JA 3FJLA 1GJPA 1J2WA 1ME8A 1P5BA 4IGHA 4ADUA 2YDAA 4WY0A 3LX9A 2X2GA 4UTUA 1ICSA 1FXPA 3NGJA 2CZ5A 1Z44A 3LLDA 4FIQA 4NU7A 1G69A 4OWGA 2Q8LA 4S2BA 1QPNA 1FCBA 1LROA 2JKAA 3MW7A 3KRZA 2QCHA 3BGJA 4Q33A 3UZ5A 4O54A 1YXYA 1N7KA 4JIPA 5D2TA 3INPA 4X22A 2Y7FA 4PA8A 5EPDA 2P10A 3NQDA 4X2RA 1KV5A 3GAKA 5DBUA 3QMTA 2ISSA 3OBKA 3RMJA 2E5DA 3VE9A 2CLOA 2QCCA 4N9BA 2A7NA 4CNNA 3EX6A 4A3UA 4RLIA 3TX9A 1OG0A 1W5OA 3BK0A 5LGZA 3C2OA 1QCWA 1FDYA 4OHQA 3MHFA 3TSBA 2QCNA 2NXGA 4M5PA 3PBUA 4X9SA 3TFCA 3WK2A 1V7YA 3UWVA 2J27A 3M16A 4NXSA 3SECA 1UUOA 3SGZA 1ZNNA 1QPOA 1KM2A 3UWYA 3LXCA 3TDFA 1X6UA 4DQWA 4OQVA 1RZMA 3G0UA 3GB6A 1KFLA 3QFEA 1M7PA 3GKAA 3P80A 1WA3A 3KVJA 4R34A 2Z1BA 2ZZ2A 4UXDA 5CKSA 2X16A 5D2YA 4MY9A 3LHWA 3S42A 5FF2A 3ZR4A 4MZ1A 3KRSA 2XN0A 3DBPA 3TFXA 4UMCA 4NNCA 2YR1A 3STCA 4MY1A 3HGRA 3IGUA 3IGXA 1K7FA 4A2SA 2ZZ5A 5BMXA 2R8WA 2TSYA 1GG1A 4XKYB 3S0CA 3SI9A 1TV7A 3WJWA 1VC4A 4BWLA 4JICA 4FO4A 5C55A 1RQEA 1SZEA 5EBUA 5G2WA 3IVTA 4QM1A 2PURA 4RZ6A 1QOQA 1E51A 1JULA 4H3DA 4EF8A 1VCVA 1VCGA 2PE4A 4AF0B 4E0CA 1QDSA 4O1AA 3PF3A 5LKYA 3N73A 3DKLA 1JRBA 2X1SA 3NQVA 1TREA 4A29A 3S8HA 4UTJA 4RCXA 3A9IA 2A21A 4IQLA 1F7BA 4LVAA 2ZRVA 4KFOA 5SWUA 1OYCA 4DO6A 3DI1A 4MLJA 4O12A 1GZGA 1PV8A 3G1AA 3NAVA 1XC4A 1XDMA 3S1WA 1EP1A 3QC3A 1I2NA 4Z1BA 1IXQA 5HMSA 4RXGA 4MPQA 3LTYA 1WXJA 1OFPA 3M7WA 2TYSA 2DZPA 3HB9A 3TQVA 4AHPA 2QCDA 5D2XA 3TU9A 2A5HA 2E68A 4LUIA 1SW7A 1H62A 3LDVA 3GXPA 3HGJA 3UY8A 4HHPA 2A0NA 4MVAA 3O63A 3LCGA 1KBIA 2NXHA 3C61A 1G7VA 4LY8A 1JQVA 2WNQA 5HINA 3NEVA 4DPQA 4X3ZA 5HUPA 2H6RA 3T44A 3WK0A 4ALDA 1R2TA 1VJIA 4IMEA 1Q45A 1AL8A 5G4EA 1GVFA 2VEIA 1QNVA 4GRSA 2YW4A 4U4MA 3TXVA 4UFLA 1T99A 1L6YA 1OFOA 3F03K 1M7OA 4UCGA 4FXSA 3DFTA 4O4VA 3W76A 4NVTA 2B7PA 5J5RA 2NX9A 3EXTA 5TQLA 1OJXA 3OVQA 2QJGA 4MOZA 5E93A 4WJEA 4C1KA 1DQWA 1L2UA 1TRIA 3CPRA 1D3GA 1TSIA 4NX0A 5HUOA 3B0VC 3BG9A 3EWUA 1JJKA 3USBA 5LZLA 4LRTA 4O8RA 4HSNA 5BNKA 3W83A 3PC0A 4NNBA 1KBJA 2P1FA 3KRUA 3TR2A 5HR7A 1O95A 5FESA 3GDRA 1TV5A 4JDBA 4JIQA 5G5IA 3SJ3A 3PBWA 2QCMA 3PBYA 5E1QA 5KITA 1KM6A 1ZENA 5F2IA 2Y88A 3P7YA 4O4WA 3TQ0A 4NJJA 1R46A 4MYAA 3EXSA 3HG3A 5CSRA 2ZRYA 3W7HA 1TJRA 3L65A 2DJLA 3W7MA 5G2HA 3IEBA 1ME9A 1AG1O 3IGSA 4JGDA 2H8ZA 3IIXA 4MY8A 4Z08A 1H7RA 4K7YA 3NM3A 3EX3A 3MI6A 2W79A 2PRHA 1KM5A 3CB8A 3O6YX 1VS1A 5AOUA 8TIMA 3UPWA 3G0XA 3OEXA 3KVMA 2VOMA 1LRQA 3EX1A 4IPJA 3G3MA 2GJNA 2CLMA 2G96A 4BI5A 4HNUA 2GQAA 1SPQA 5A8GA 3NPVA 1TRDA 2H90A 4N2YA 2Y89A 2YFOA 3O16A 1HO4A 1TTJA 2BTMA 5L6UA 3LLFA 2I14A 2H8XA 3MYOA 1PVNA 1OFDA 3HMJG 2DORA 5IM51 1GVSA 3DZ1A 3W71A 3KFTA 3PAJA 4LUJA 1JCMP 4IX2A 3M5ZA 1IIHA 3JRKA 4YMZA 5CG7A 3TKFA 1PCWA 1NAL1 1RR2A 5E0KA 3BV4A 1YDVA 5G2IA 4UTIA 1QO5A 2QCGA 1IIGA 1JUBA 3D0CA 4XQ6A 2NUXA 4RXFA 4ADTA 1GVQA 3P84A 3A24A 4HNTA 1VZWA 3PY2A 2J6XA 4UMBA 3R12A 1B4EA 2GJLA 4E2BA 1XXXA 5G1YA 4LVDA 4IMFA 1MEWA 4NZJA 4UUIA 5K9XA 1F5ZA 4JTIA 3I7QA 1VYSX 1WBHA 2UV8G 5CZJA 5I3GA 2Q3RA 4JX4A 2BWGA 4BWLC 4O28A 1WOBA 3NQ2A 3Q58A 1BEUA 1KTNA 3CEPA 3W70A 1IXOA 4OBTA 1TPB1 4JR5A 3SY5A 3W7LA 3U2OA 4I9AA 1EP2A 2ZZ7A 3BGGA 5BOOA 3FS2A 4QSHA 3W73A 1OK6A 4MLRA 2Y61A 3LCFA 5C5YA 4OV4A 4YLWA 4FEZA 3CTLA 3W7QA 3C2RA 3CWNA 3N2MA 1FWSA 3N14A 4FNUA 5LHFA 4RKAA 3VFLA 5K3VA 3UXAA 1P1XA 2ZTKA 1FCVA 4MJZA 3NVTA 3GKFA 1GOXA 4FXRA 4JS3A 3W7OA 5HQEA 1ZCOA 4B5NA 3CLMA 1H63A 4JTSA 1WAUA 3EXRA 4S2CA 5J5DA 1JRCA 5I3KA 1UBSA 4AEOA 1B9BA 5DBTA 1JVNA 3NNTA 3C6CA 2C14A 4DBDA 2Z0IA 3LV6A 3PUEA 1Q6OA 4G1KA 1OFAA 1LOQA 4RZ5A 3KVKA 2YPIA 1RPXA 1H7NA 5CZSA 1SW0A 3EEGA 4GJ1A 3TW6A 2HS6A 2C3ZA 3GNDA 3OVPA 3I7RA 3W7RA 4RR4A 4Y9AA 5CPLA 4NT0A 4TMBA 2C19A 3W88A 5CZ0A 2WNNA 2Y63A 1RVGA 2RDWA 4MUZA 4YWIA 3U6WA 2W0UA 1VH7A 3A21A 3STFA 3SFKA 1SO3A 4IMGA 1G4TA 3MJYA 1KTCA 5D05A 4E38A 1FWWA 3C52A 3MI2A 3HF3A 1W5PA 5LNSA 1OF6A 5D32A 3M44A 1EIXA 1A5BA 7TIMA 2BXVA 1YXCA 2DU2A 1SUXA 3GR7A 3H55A 1KA9F 1G67A 3W75A 2ISWA 3GDMA 4PTNA 4UTTA 2Y6ZA 5AHLA 2WSYA 2WPBA 5T26A 1TTQA 2GVGA 1W54A 1J4EA 1FCUA 1SFJA 2ZYFA 3OIXA 1LLZA 4MFDA 3R13A 2QCEA 2QCLA 3I7SA 5F4SA 2DZUA 5FI8A 1IXNA 3TA6A 5D02A 1LBLA 5D2VA 3DHDA 1Z41A 3LOTA 2A6LA 1W5MA 3W2KA 1LOLA 1FDZA 1PE1A 3NPXA 2CZEA 3UYCA 1W8SA 4O1DA 1LBMA 1GTEA 1SO6A 3B4UA 2R91A 5CGQA 3BLFA 3B06A 4FIRA 4IUOA 3M5VA 3SW6A 2ABBA 2QAPA 1IGSA 2A6NA 4POCA 3TMQA 2QUVA 1O94A 5KZDA 1H7PA 3NQAA 1J5TA 1GQNA 3PSWA 2EHHA 3BARA 5A5WA 3KXQA 2NWSA 5AYZA 4GC4A 1ALDA 4Z1AA 2I9EA 1KM4A 1I2OA 1TV8A 1VR6A 2G95A 1SW3A 4QIUA 2ATSA 4M7SA 3A23A 1N8FA 2V2HA 4H4IA 1TPDA 2BLEA 5F1VA 2ZRXA 2BSLA 3HPZA 4FX8A 4KFNA 2F7FA 4AH7A 3HG5A 3NL5A 1NF0A 3EWXA 3RU6A 5LNRA 3N2XA 1K7EA 3W86A 1EP3A 3NPUA 3WK1A 1QAPA 4FX6M 4UNKA 3R5EA 4LVBA 3FFSA 1EWDA 4QQ3A 2ZFAA 3MWAA 1UB3A 5F2GA 4QITA 4MIMA 3W7IA 3PS7A 1L6WA 3TW7A 2YGYA 2RHGA 1WV2A 4JTEA 4JTLA 1NFBA 4QNEA 3G8RA 4GE8A 4UC5A 1XKYA 1LTDA 1LRNA 4O13A 1S3HA 2VC6A 4DF1A 2DZTA 1TTPA 4ZQMA 4Z1DA 2ALDA 1VGAA 2CLHA 2ISVA 4XUGA 3W7KA 5EMUA 4ORIA 2CW6A 3FJ6A 1GPWA 2GVJA 3O06A 4K37A 4D2JA 2RDTA 3RF9A 1X1ZA 1DHPA 4UTHA 1R30A 1G4PA 3DFNA 3QZEA 1LCOA 2WV8A 4I7VA 3GR8A 4CQAA 1YADA 3BG3A 4RX0A 3WK3A 2OZ0A 1CI1A 3HQ1A 3JS3A 2WJZA 4DXVA 2QR6A 4AAJA 3B05A 3NQ8A 5AHIA 5MHBA 2ZTJA 4WOZA 3NL6A 3ABRA 4O50A 3LHUA 5BW6A 3DFSA 3VKJA 2Q3OA 3G3DA 4TMCA 4AWUA 5D09A 3NL3A 3UY7A 3ANYA 1SZNA 2FPVA 2CWNA 3LRKA 2FQIA 2ZRUA 3NQMA 2NZLA 1WQ5A 1FCQA 2VFEA 3K30A 3W23A 3S1UA 1C29A 1LBFA 3LBMA 4O1CA 2GUUA 1K7XA 1B57A 3W1LA 3UPBA 5DXXA 4JYDA 2EGZA 4NQ1A 4HN4A 4LVGA 4K7VA 4ONVA 2Y7EA 4UFKA 4UFIA 4M6QA 1S5VA 4AF0A 1PIIA 3LGEA 4JTGA 3F4WA 3E96A 4GFSA 3G1VA 4ZQPA 4GUHA 1G4EA 3GDLA 3GVGA 3CM4A 2ZRWA 3VNDA 1XI3A 1DV7A 1W5NA 1XFBA 2YXGA 4DO5A 5KZEA 3MUXA 3P61A 1HO1A 2FJKA 1C9DA 3G22A 1WDWA 4NJKA 4K8HA 1YDNA 1Q6LA 4LW7A 3V75A 3G1DA 3O07A 4P2VA 3P62A 5C2XA 2G97A 1C8VA 2FFCA 4AHOA 3ABQA 1QPQA 2Z6JA 1OFQA 4FB7A 3QMRA 5FF7A 4NXKA 3CEUA 4YL2A 1M5WA 4UTTC 5GVJA 2NX1A 2EKCA 1I45A 1TCDA 3NM1A 3EWBX 4OGZA 1VPXA 3UWZA 3SGUA 1IXPA 1TPEA 3MP5A 1JCXA 2A7RA 2EAWA 4GWEA 3HPXA 3EWZA 3OVRA 3HJZA 2V30A 3LHZA 1IF2A 4BF9A 3EWYA 5G1TA 3NZRA 1G7UA 4RV8A 1WBJA 3TC7A 3QYQA 1QFEA 1LM1A 4QNWA 3MP4A 5I3JA 1P4CA 4PODA 4ADSA 5LGXA 1TPFA 4JTTA 3M41A 4DBEA 1O60A 3TH6A 1PS9A 3PR2A 3P5YA 4K38A 3M5YA 1KLZA 4GUIA 1WX0A 4LC8A 4NJHA 4NJGA 4TO8A 3S6DA 3IIOA 4Q32A 1HTIA 3GX9A 6ALDA 4MJMA 4KWVA 1UUMA 4WUIA 2Z6IA 3THAA 4GUJA 2E1DA 3QMSA 3NPWA 4IXHA 1H5YA 5HJLA 1K8YA 1FBAA 3LI0A 3FEMA 4WX2A 5IBXA 5K4ZA 3EB2A 3NQFA 4Z0JA 4NJIA 1DVJA 4Z1CA 4HSOA 3P5ZA 1SFLA 4C1LA 4Q4KA 3CIXA 2NUYA 5C6MA 1RQBA 3NG3A 1OX4B 5C54A 2NV2A 3TSDA 2WOQA 1YPFA 2H3BA 2FLIA 3DI0A 1G6CA 1KM1A 5EKYA 1ONRA 4PH6A 4O16A 2ZA2A 3SR7A 1FX6A 1VLWA 2BX7A 2VXNA 3ATYA 3TAOA 3B8DA 2VFFA 4JTUA 3E02A 3LM7A 4ZZ9A 3FA5A 3IVSA 2D73A 3I65A 3ELFA 3LI1A 1A50A 1DJNA 4K6AA 2NXIA 4CCEA 3DFOA 3THQA 2I1OA 1YYAA 1XBXA 1LORA 4WQ6A 2P0OA 3LHYA 4LNYA 1XUZA 3BVJA 1F05A 1TQXA 2VEMA 1TJPA 1JUEA 2YW3A 3LCHA 3QQ0A 3GDKA 4LVFA 4JNMA 5FEWA 1YXDA 1ZALA 4AB4A 2Y7GA 1OVDA 3WJXA 1YTKA 4W9TA 3IV3A 3QQ1A 1CX9A 3W7NA 3C4UA 4ORMA 5AHMA 4UTWC 1K8XA 4M7TA 4ZQNA 4XBSA 3L67A 1XM3A 3HG2A 3G0SA 1GG0A 3W1QA 3MI3A 4PL2A 3YPIA 4UTMA 4UNLA 3FYOA 4HKPA 4CQ9A 1W0MA 4AWTA 3P74A 2CZFA 2ZA1A 3GYEA 3P67A 1KLYA 4MKNA 4WXYA 1HUVA 3GXTA 5G4WA 3ZFHA 3W1AA 3O6DA 3WJYA 2WSRA 4OT7A 3RLVA 3W84A 4R53A 4O11A 1UCWA 4LV9A 3ABSA 5CPOA 3RLUA 5KMYA 6TIMA 1ME7A 2VEPA 3L66A 2DZVA 3DU0A 1JCJA 4A22A 3BW3A 2QEZA 1LYXA 3G18A 2QDGA 2VFIA 1W3NA 3PM6A 1UJPA 1JR1A 4TR9A 4GUGA 3L0GA 4RK8A 3BLIA 1LZOA 4QISA 1U83A 3EKZA 4KFPA 5AC7A 3W2MA 3W74A 4JX5A 4PEKA 3NOEA 5EY5A 3SSJA 4WXZA 4O0KA 3UNDA 3S1VA 2V5LA 2C15A 1RD5A 4RJEA 1U5JA 4BI7A 2YX0A 1Q6QA 3KVLA 4JEQA 4ZVJA 3W6YA 2J9XA 5FF3A 1EEPA 3LCWA 3W1NA 3MP3A 1W3IA 1YLVA 3BO9A 2AQWA 1RQHA 3W1TA 2HS8A 5CPMA 4N6EA 4N9CA 3P8JA 1YDOA 4IJBA 3I68A 3LHTA 5FF0A 5D2WA 3LBCA 5I3HA 2OT0A 4TX9A 4UFJA 4EF9A 3W2JA 4HPJA 4J9JA 1OX5A 3CT7A 1XCFA 4L4LA 2F84A 2J9ZA 1G4SA 1BWKA 1TO3A 3W1UA 3W2UA 1BKSA 2NLIA 1H7WA 5D37A 1GVOA 2X30A 1VHNA 2A4AA 5AHNA 3SZ8A 3V1PA 3TK7A 5I3FA 1KFEA 2GPTA 1DQXA 5LNVA 4IMCA 2ZA3A 3MMTA 3TE9A 2QCFA 5DXYA 3A22A 4UMAA 5LNUA 4UTKA 4HIBA 3M6YA 5HWMA 1TPH1 1AW2A 2AGKA 5BRBA 5KZMA 4NNAA 1SSGA 1H1ZA 1OFEA 2C18A 2H3DA 3TMLA 2A2IA 2CLEA 2TMDA 5IBXC 3TNOA 1AW1A 4N02A 3QW3A 1D9EA 4K8EA 2NWRA 4JDYA 5HNRA 3NQCA 4UR8A 1RV8A 1MSSA 3LCIA 4WZHA 3EWWA 1PHQA 2W6RA 5U7SA 4CQ8A 1YTDA 3NA8A 4PFMA 4DO4A 4YCOA 5AN7A 4WOQA 1ICQA 1I8JA 4HNNA 3LRMA 4N9DA 3MBFA 3NR0A 1K03A 3S9YA 4EWND 3DHFA 5DY3A 3C3NA 3P60A 4EOUA 1KV8A 3BPWA 3GAYA 2V81A 4O0ZA 2X1RA 4MZ8A 4P61A 3P8IA 1I2PA 1VQTA 3LB0A 4IPIA 4O14A 2IQTA 3PSVA 3QRHA 3P81A 1VYRA 4XTDA 3CWOX 3LHVA 5F4XA 1T0OA 2FIQA 3PWAA 3PUOA 1JCLA 4UFHA 1I2QA 1P0KA 1R2SA 1SZGA 1XBYA 5F2MA 2NV1A 4UTLA 4YCPA 3C2EA 3W22A 5EYWA 2O7SA 5D03A 4O19A 1OYAA 4BK9A 1Z42A 1GYNA 1TYGA 2JK2A 1SR9A 1VRDA 4WY0B 2CLKA 2A1YA 3BLEA 2G5WA 2A85A 5L9FA 3TC6A 2QUTA 2V9DA 2DP3A 3Q37A 5BMWA 3S5NA 3DXIA 2C0AA 3CU2A 5K2ZA 2OCZA 1NEYA 3M5XA 5F2LA 4HT3A 2E5BA 2OJPA 3MYPA 4U28A 3UD6A 3FKRA 4OU1A 3FYPA 2PC4A 5FEZA 2FB3A 5EA9A 4L4MA 1JCYA 3G1FA 3PVFA 2ZZ1A 2FB2A 3HIJA 1W1ZA 3L0KA 2X1TA 2ZBTA 3KOFA 3OA3A 1WYIA 4UIOA 3T40A 1LOSA 3W7GA 5CSSA 4AWSA 3G1SA 3S1XA 4O18A 1SU5A 5TBOA 3QM3A 3VCRA 2TPSA 3GNNA 2VFGA 3L2IA 4JY9A 5AFDA 4AVFA 3W7CA 3NQ7A 2PCQA 2EPHA 4AMAA 1FWNA 4MZYA 4JD4A 1VCFA 1B4KA 2WNZA 2E77A 4QJ1A 2X1UA 3L21A 1ZY9A 2DZWA 2XFWA 3N9SA 4IWWA 3W1XA 1WOAA 1H7XA 4NX5A 1L9WA 1VLIA 4FNSA 2OMAA 3T55A 1EX5A 3FKKA 4LTSA 3W9ZA 4UTWA 3TV8A 2RH9A 2R14A 4CNOA 1H50A 2PRLA 1TQJA 2V8ZA 3KHJA 3N9RA 4N4QA 4JTKA 3AJXA 2GVLA 3OG3A 2FDSA 3UXDA 3W1MA 1PHWA 1ICPA 3NL2A 4N6FA 1P0NA 3W7DA 1FXQA 4LOCA 3RK8A 3WJZA 4WD0A 1QR7A 3HGOA 3LXAA 3UWQA 4XWUA 3MO7A 4HPXA 2WKJA 1OFRA 4TU1A 4O53A 5FEXA 4NZFA 1ZAJA 3RNDA 2V82A 4XKYA 1SO5A 1F6KA 4JTJA 2CU0A 3DAQA 3TQKA 2QAFA 2TRSA 4HNVA 2Z2UA 2B7QA 1LDCA 3ATZA 2PRMA 1VHCA 3IIVA 3U8GA 3STEA 1X8FA 2C16A 2E5CA 1A5AA 3PB2A 5HULA 3EX2A 4A2RA 1DORA 5DCDA 1NSJA 3W2LA 4PC8A 3NYZA 1XDLA 5K7JA 4FNTA 5KTLA 4LS2A 2Y7DA 5CPNA 1S5TA 3GZ3A 3W1PA 4XZ9A 3CIWA 4O17A 3NXFA 4DELA 1A5SA 1TPVA 1THFD 2JKEA 3ZWTA 4Y8FA 5AYXA 3LERA 3GLCA 4M19A 2CLLA 1OK4A 3PUDA 1ML1A 3Q2DA 4JTHA 2YFNA 3M47A 4LT9A 2OT1A 3FIGA 4LS0A 1XBVA 4O10A 3S5OA 3MBDA 5H2ZA 4FF7A 3QSRA 3N34A 1QO2A 4N9EA 3EKLA 1A5CA 5D04C 3PB0A 3Q94A 3C56A 4AHQA 2QCDB 1DOSA 2ZRZA 1K02A 3KAOA 3TJXA 3EX4A 1OFBA 2QDHA 3NO5A 4R33A 1H1YA 3O15A 4ZQOA 1N55A 1L6SA 2RKXA 3GDTA 4JYFA 4LS1A 1GEQA 1TB3A 3LTPA 1X1OA 2FPTA 3TXZA 3N3MA 1R47A 4ZL1A 4R7JA 1EUAA 1X7FA 1SQ7A 4CCDA 3HG4A 3L68A 3PG9A 3QPYA 3B03A 1T96A 3DFQA 3L5AA 4MFEA 2FPYA 2HMCA 1H51A 1CW2A 5DN1A 1K3UA 4GXMA 1MXSA 1OX6A 3QPZA 1O4UA 2O7QA 1V5XA 5HR6A 1GTHA 5HWNA 1W3TA 1S5WA 4O57A 4JYEA 1DJQA 1XL9A 2YYTA 3W07A 2C1HA 2HSAA 5D33A 5LNWA 1BWLA 2VELA 3G1XA 1KM0A 1H61A 1Q3NA 2B7OA 4RZ4A 1ADOA 1JQXA 2VEKA 3ABOA 3C2FA 1MEIA 3H54A 1AMKA 5AHEA 1Y0EA 3P82A 1H7OA 2B0MA 5AYYA 2YSWA 4FNRA 1NVMA 2A7PA 1KFKA 1OX4A 4A21A 2RFGA 5D38A 1F6PA 1O5XA 2AAMA 2ZZ4A 3B0PA 3T4CA 5FF4A 1EB3A 3MHUA 1EWEA 3GIYA 2ZZ3A 2YZRA 4ICNA 1ZAHA 4E2DA 3DFPA 3O6CA 2QKFA 3IIPA 3F1QA 3A5VA 4K39A 2GOUA 4JXCA 5EL1A 2ZDRA 1KW1A 3DH7A 3M0ZA 3DENA 1I4NA 3E49A 3LV5A 3SIZA 4AXKA 1EA0A 1W31A 1LRTA 2E6AA 1EUNA 3T78A 1MZHA 3W7JA 2B4GA 3TJLA 2NUWA 1GWJA 2J88A 5DLCA 3L5MA 2CLFA 2CFFA 3C8FA 1O5KA 2DZXA 3LCXA 3QSTA 4I7UA 1Q6RA 3I6RA 2JKPA 3FOKA 3CHVA 3O8AA 3W7PA 1Z48A 2E09A 3W3OA 4O52A 4FNPA 4ZQRA 2GQ8A 3RFAA 4O1BA 4PL1A 4M6VA 4DPPA 1TPC1 3R8RA 1OYBA 1AL7A 3ZS4A 4Y90A 1VYPX 1FWRA 1HFBA 3KX6A 3NQ6A 4BI6A 3TROA 1W37A 3TSMA 2V2CA 1SSDA 1GT8A 2E6FA 3N19B 1W5QA 1AW5A 5AC8A 3L5LA 4DEFA 3WJSA 5F4WA 3W1RA 4JTFA 1ZJIA 2WQPA 3BW4A 2E6DA 3QJAA 2GQ9A 4XTIA 4KWWA 1MEHA 1OABA 1QMLA 1F74A 3W72A 3LTSA 3L9CA 4ZQCA 3TCEA 3O1NA 1LLWA 1A53A 4QAIA 4NUWA 3PG8A 1DL3A 2WSQA 2VFHA 4K36A 1BTMA 3PBVA 3IIZA 4CCCA 4IX0A 3TAKA 2QF7A 4UR7A 1OF8A 5F1UA 4EIVA 3M1ZA 5DCEA 5CZTA 4TIMA 2JGYA 4GUFA 1K8ZA 1D3HA 1SZFA 1TMHA 2Y70A 3L0NA 1KFBA 3IRDA 4KKXA 4DF0A 5K4XA 3HO8A 1FUYA 4GBUA 2HTMA 4IXXA 1FQ0A 4FNQA 1PCKA 3B0UX 4CLMA 3BW2A 2XN1A 2BZNA 4IMDA 4WY0F 5KSWA 3W2NA 2Y85A 1KTBA 2C13A 1ZHAA 1SO4A 2CLIA 3LRLA 1XUUA 2YCEA 2VENA 2V0TA 2Q8ZA 2KZHA 3DGRA 3MHGA 3W7EA 2JGQA 1T8XA 5H91A 3HGSA 4EVZA 1YPIA 2V5BA 3TIMA 2VKZG 2C6QA 5DELA 3TUUA 3E12A 5AHFA 4LV4A 5KINA 3H53A 4UFMA 1NF7A 1YTEA 2YYUA 4BFAA 1LP6A 3T7VA 2ABAA 1OHLA 3QF0A 2XN2A 3NQGA 4JN6A 3VE7A 4LRSA 3JR2A 4OV9A 3STGA 2ZCGA 1F73A 5DCBA 3S5ZA 5K9CA 4ZMGA 5DY2A 2FTPA 2QJHA 4Y96A 1FDJA 3R2GA 1TPUA 1HL2A 4JX6A 3FLUA 5LHEA 3OHIA 1M6JA 2DZSA 1W56A 4DF2A 4CNPA 5K9DA 1QPRA 4OE7A 3UQNA 2QUUA 2Y62A 2DJXA 4Z0SA 3GXNA 4PCFA 1FY6A 1F2JA 1EPXA 3UWUA 1F76A 3HOJA 4M6PA 5HWJA 4ML9A 3S5YA 1DKWA 1TIMA 3G8EA 3G1HA 3IVUA 3QH2A 2J9YA 1KFJA 1I2RA 1TTIA 1KFCA 3C2VA 1QOPA
chains in the Genus database with same CATH superfamily
3GSMA 1H60A 2ZX7A 5AB3A 1AQFA 4UQAA 2JIWA 3NQEA 1HG3A 2UY5A 3UZJA 2JFEX 5DF0A 5TIMA 1V3HA 3F4NA 3UT0A 4BCEA 4H83A 2ATMA 2WVTA 3DYMA 4HOWA 3BJFA 4ZCWA 1MUWA 4GNJA 1IT0A 4IOTA 3VX0A 2VO5A 2I5QA 1AK5A 1Q6GA 3PPHA 4AG0A 1CXKA 3CC1A 3B04A 4ATDA 5JBFA 4DZIA 1FFRA 1MQQA 4GXWA 3N4AA 4D72A 1RK5A 3F5LA 3B8IA 4H6KA 3CQ0A 3E0IA 3GXFA 2CXEA 4MMWA 3XISA 3A5FA 4XZWA 3VINA 2ZX8A 4J28A 3VI2A 1S46A 2R94A 5BWAA 1GYLA 1IT7A 3MO4A 1KRCC 1MO0A 1W17A 1YIXA 1R2RA 3UWWA 1QK2A 4MWAA 2E6YA 4L6HA 4XBKA 3WBWA 3GIPA 4Y6GA 3AO0A 3FJLA 1GJPA 4HMCA 3PFRA 1P5BA 4GIEA 2AGTA 4QX4A 3NGJA 3FDGA 1ZCCA 2NVDA 2WJFA 1V0KA 4XSLA 1EOKA 4FIQA 4AZCA 4S3CA 3R7MA 3RG6A 4OWGA 1BKHA 1KKOA 3VD9A 4IH3A 2E8ZA 2QCHA 1XG3A 3AS1A 1GGOA 1UWUA 3L2LA 3BZJA 3UZ5A 2D2HA 3QHMA 3VAVA 2HQAA 3INPA 2E67A 4D1IA 4A8LA 4XIMA 1ONWA 5EPDA 3E2RA 3VIOA 5DBUA 1P1MA 3OBKA 1UR2A 2QCCA 1M3UA 2A7NA 4RLIA 3TX9A 1W5OA 1LQ2A 4C5ZA 1PAMA 3BK0A 5I07A 3WQ8A 5A8MA 4HQVA 1X96A 4X9SA 3TFCA 2ZUVA 3WK2A 1V7YA 3LPGA 4NXSA 3SGZA 3MKVA 1KM2A 4AD2A 8RUCA 5HBFA 4B4FA 3K2GA 1RUSA 3R6IA 3UXKA 1M7PA 3GKAA 1HQTA 5AKQA 2Z1BA 2X16A 2YDSA 3ZR4A 3KRSA 3DBPA 3FJ4A 4UMCA 2FZBA 4IGSA 4H6QA 3E38A 4MY1A 2YCIX 3BOFA 2HJPA 2WBGA 2YXXA 4GXPA 5MKGA 4A2SA 2C79A 3BH4A 5BMXA 2TSYA 2GSEA 1ENUA 1LT7A 3DN5A 4YIWA 1TV7A 3WJWA 4GI4A 1EGVA 4FO4A 5C55A 1RQEA 2PWVA 5EBUA 4QM1A 1E51A 4H3DA 3N6QA 3WYZA 1UBPC 4XAYA 3GVQA 2XIJA 4DVOA 4E0CA 3FA3A 3PZIA 1C8XA 2WJDA 3LNMA 5LKYA 3S83A 1FA2A 1TREA 5C0QA 3S8HA 4ICMA 4OBRA 3QQWA 2XSAA 4RCXA 1M01A 2G3NA 4OECA 1EBHA 3FV9A 3MSYA 4O12A 1UC5A 3H2OA 4QGCA 1XDMA 5DX7A 1EP1A 3ABXA 1VBHA 1CB2A 1ZU8A 2VQTA 2QS8A 4MPQA 1WXJA 1OFPA 2A3HA 5JIPA 2TYSA 2DZPA 2VC5A 1T40A 3DG7A 1C90A 1CGTA 2QCDA 2WVVA 4BQ5A 5D2XA 4GY0A 3T0AA 2QLYA 2AL2A 4GFIA 4CN1A 5T8GA 1M7XA 4LBRA 3UY8A 2WQDA 2XVLA 1UD5A 7XIMA 3KTCA 1WKFA 4NIRA 2P76A 2AKMA 2NXHA 2PTZA 1G7VA 4K1GA 4LY8A 3BLPX 3EMQA 4L7ZA 1YBQB 3QPEA 2E40A 4J35A 3UBPC 4P7NA 1R2TA 4ALDA 2YB1A 1TUXA 2VEIA 2ZC1A 3EDKA 4W7UA 4OJYA 1T99A 1OFOA 3B0YA 1M7OA 2NQZA 2OYKA 1C92A 4E6MA 4JZ5A 3OHMB 4GINA 4O4VA 5J5RA 3EXTA 4OIFA 5TQLA 3AIVA 1PZ2A 1UHVA 1L2UA 1DIDA 1TRIA 2ZUWA 4HNCA 2YDRA 3FHQA 2VVSA 4NX0A 2OSYA 5E0FA 4E8CA 2D3NA 3B0VC 5BZAA 1JZ5A 1JJKA 2CYGA 1OADA 4LRTA 1UZHA 4XKMA 3TTYA 4HSNA 2Z1KA 2BVWA 1FWAC 3W83A 3PC0A 1KBJA 4D1JA 2Z26A 5HR7A 4IHCA 1IT8A 3IV8A 3WLKX 5G5IA 3SJ3A 2QCMA 2WC7A 3DYPA 1B3WA 2V3GA 3PBYA 3VX1A 1JZ3A 1DIOA 1R38A 3JVAA 1UH2A 5M03A 3SJNA 4MYAA 2ZRYA 3H4GA 2O55A 3N17A 2R82A 3L65A 1JPMA 1ZBVA 3IEBA 1ME9A 1Q13A 5DMMA 4MY8A 2OQYA 3NZPA 4W5UA 2QMKA 2BVDA 2PP0A 2PRHA 4NRSA 1HP4A 4WEVX 1FFQA 2PBOA 4GYKA 3WNOA 4C6KA 1TJ0A 1LRQA 3G3MA 2GJNA 3OZMA 1C7SA 2GQAA 4D6CA 3NPVA 3W0KA 1GQKA 3IJQA 2BGNE 5L6UA 1J5SA 4JBRA 3CUHA 2DORA 3GNXA 1GVSA 2HE8A 3ZMRA 3VUPA 2FHFA 2UZ9A 3N15A 2PFHA 3QLLA 2VX6A 2OEMA 4V1YA 2ZX9A 5E0KA 2QPUA 1E9IA 1YDVA 4UTIA 1CEOA 1QO5A 4XQ6A 4RXFA 3MU7A 1M65A 3VD7A 3A24A 4HNTA 4ZSTA 2GJLA 1AJZA 4Q8UA 4KWOA 1HKIA 4EXAA 3GTXA 4QAWA 1DPMA 1WBHA 1XIGA 3PJUA 3Q58A 3MZ2A 1BEUA 5I7GA 3CEPA 1CENA 5CLTA 4LAMA 1QW9A 3SRHA 3SY5A 4QSHA 4PB4A 3LCFA 3WG6A 4AVOA 4FEZA 3W7QA 3TYBA 1PBGA 3C2RA 1FWSA 3BSHA 3GC4A 3WNPA 2MNRA 5C71A 1JF6A 4PFHA 2EG7A 4JS3A 2WSPA 1WUEA 5HQEA 1ZCOA 3N9KA 3CLMA 3SURA 1VF8A 1W2VA 3C86A 4QJ4B 4AEOA 1B9BA 4AD5A 3EDJA 2W9MA 3REQB 2IUZA 4QP0A 3LV6A 1Q6OA 4G1KA 1LOQA 4CD7A 3QGKC 5CZSA 4LX4A 2RGMA 4NAEA 1SW0A 4WR3A 4GJ1A 4AYGA 2DT0A 3G6LA 1UR4A 2W27A 1J01A 3GU1A 2HS6A 4XSMA 1QNSA 3I7RA 2J8TA 5CPLA 3VILA 1V3MA 4EAMA 4FR6A 4GH1A 3DFYA 2O9OA 2QT3A 3WLMA 2BOEX 5CZ0A 2WNNA 3E3HA 4PSPA 2Y63A 2RDWA 4MUZA 4PUDA 3STFA 4LUYA 4ZEPA 4R27A 1XIDA 1ONXA 2IKIA 5D05A 2Z1VA 4MNLA 5FOOA 3PZNA 1W5PA 5LNSA 1OF6A 3EMZA 3M44A 2I5GA 3U57A 1SUXA 1EZ2A 3H55A 5BRPA 1KA9F 1EC7A 1EGMA 3GDMA 1L2QA 4XZBA 5AHLA 3UJSA 1VP5A 1TTQA 2XFRA 4J2MA 1J4EA 1FCUA 4FALA 4LYRA 3U7VA 5FI8A 2BOGX 3TA6A 4WHBA 1Z41A 4KESA 4AZBA 4W8AA 2Y2WA 3WLIA 1W8SA 1GTEA 1SO6A 1FWFC 1W9PA 4JNZA 3BLFA 3B06A 3T07A 4IUOA 3M5VA 2NQJA 3R8HA 1TMLA 2ISDA 2V69A 3Q65A 4HPNA 5C9WA 2ACQA 5GPRA 1O94A 1FWBC 1GVIA 5HK4A 1MW3A 2VM8A 4GMEA 3PSWA 2OLHA 1EC9A 3SCTA 2EHHA 2WK2A 2VR5A 3WQEA 3G5EA 3MUZ1 3RGTA 3KXQA 4ML4A 2NWSA 3AMKA 4GC4A 1I2OA 4M7SA 5H6HA 3QR3A 1UR0A 1TPDA 4TVUA 5F1VA 1HJVA 4C6CA 1UP0A 4H9VA 1QI0A 4DRSA 4HP5A 2F7FA 2XGBA 4AH7A 4DJFC 1QW7A 3EWXA 4GGHA 4PZVA 1UWAA 4RNHA 4GO8A 3UR5A 3WH5A 3W86A 3MS8A 3WK1A 4HTBA 4FX6M 3GW3A 4Z42C 3R5EA 4A6GA 4TX8A 2R1MA 4GIRA 2FZ8A 3KCJA 4QQ3A 2BDQA 1IZJA 3B8TA 3TW7A 2DUZA 2YGYA 3WQWA 2RHGA 2XU2A 3VA8A 4IFRA 4QNEA 3KBNA 4UC5A 1XKYA 1LTDA 4DM1A 1MNZA 4AZIA 4O13A 2W63A 2VC6A 2AAAA 3CO4A 4PTDA 1TTPA 6REQB 1VGAA 3NSMA 2ISVA 4GISA 4XUGA 5EMUA 2XPKA 1GPWA 5LIYX 4KEUA 2RDTA 4TVDA 3WF1A 4BZYA 1X1ZA 4PSRA 1N8IA 3UR7A 4IG2A 2OSWA 3STPA 2D69A 1G4PA 2G4JA 1W1IE 1JGMA 4CQAA 4RX0A 3BSGA 3VDCA 1CI1A 2WJZA 1ZBWA 4LSBA 3CZJA 4TMCA 4IUGA 4S3GA 4D6HA 4EX4A 3VGDA 4PMJA 4KBXA 5BWFA 1YX1A 1WDSA 3NL3A 3UY7A 3ANYA 5A8OA 2FPVA 2A3LA 5FSEC 2CKRA 3C0QA 1E0UA 3NQMA 2E3ZA 1FCQA 3RRXA 3K30A 3S1UA 1LBFA 1JD7A 3LBOA 2XIBA 1K7XA 1I6NA 4JYDA 2PDKA 3THDA 4BA0A 2QNEA 1JDEA 4ONVA 4UFKA 4UFIA 4AF0A 4LYPA 2MANA 3GFYA 4JTGA 1R8LA 3G1VA 4L65A 3H4XA 1FHDA 3JW7A 1CLXA 2CHNA 2ZRWA 1DIKA 3VNDA 3B8SA 1XI3A 4DO5A 1W5NA 2V3EA 2OFJA 1QHOA 2WYSA 1V79A 1HO1A 2FJKA 1C9DA 4LW7A 3O07A 4OKDA 1UP3A 2WCSA 5JBEA 3GDBA 3P62A 1J79A 4AHOA 3ABQA 2Z6JA 1OFQA 4FB7A 3KZSA 1EL3A 3H2AA 4YL2A 1DWIM 1M5WA 5GVJA 4R9XA 2P53A 4HZ8A 3OA5A 4H9YA 4D8LA 1TPEA 2F6XA 2HNHA 3RJYA 2A7RA 3GU9A 4F0SA 1H41A 3VIJA 4FR1A 3WLHA 3EWZA 3HPXA 3OVRA 4M24A 4EXQA 3KOZA 3QBUA 4L1XA 1ISVA 5G1TA 2WAGA 3NZRA 4X61A 1WBJA 4I9MA 4ADSA 5LGXA 1HJXA 3ZVHA 3FVMA 3WDPP 3GY1A 1MQPA 3AMLA 5A1AA 4V1XA 4YWSA 4LC8A 4TO8A 1QATA 3GX9A 4FLSA 1JNEA 4S3AA 5BRQA 4GY1A 3NPWA 1E6SM 3AJ7A 1HW6A 1V51A 3KBWA 4WX2A 4V2XA 2PGEA 2ZUUA 5K4ZA 1P7TB 3NQFA 4EWJA 1EYWA 4HSOA 1SFLA 1EFZA 3KBJA 3CIXA 5C6MA 1XF0A 1RQBA 4JCLA 5C54A 5FIPA 3TSDA 1BTCA 2IS7A 2FLIA 1G6CA 4Z2GA 2FZ9A 1R6WA 2V68A 4F0HA 3USZA 5E9XA 3WMLA 1KR1A 4IIGA 1D7KA 2PCEA 1FX6A 3B8VA 4US5A 2VXNA 2H9AA 4HU8A 2FZNA 4L64A 3M0HA 4GQGA 3LM7A 3UJFA 4IPPA 2KX9A 3LI1A 1A50A 4K6AA 2NXIA 4ECLA 3THQA 3GNOA 2P0OA 4EPDC 4LNYA 2E9MA 3BVJA 2OELA 3GBEA 3AYVA 2X09A 2YW3A 3GDKA 3F4VA 4L9YA 1TZ7A 3UPMA 1F61A 2BS9A 2Y7GA 5TAOA 1YTKA 4W9TA 1S2TA 2OPJA 3U2ZA 1UROA 1J12A 3UXLA 1BYAA 3ITGA 4FXFA 1E6NA 2ZWYA 4GK8A 2J7BA 5A8NA 1B2YA 3RN6A 4HA4A 4UNLA 4HKPA 1F07A 4LXFA 1W0MA 4Q7BA 4AWTA 4PMDA 1PSCA 2HNEA 3VNZA 3UR8A 1T8QA 1E72M 4WXYA 1PX8A 4ERGA 1CNVA 3QY8A 3M0IA 4R53A 1JGIA 2R9RA 4MG4A 5KMYA 1ME7A 3GR4A 3DUGA 2DZVA 1LT8A 5J04A 1RLDA 5BOEA 1PX3A 4H9ZA 4NZ1A 4MB1A 1UJPA 4D8ZA 1WO2A 4V15A 3B8UA 2D3LA 4RK8A 1HVXA 3II1A 2PDXA 3TWBA 2RDXA 3W2MA 3KWXA 3W74A 4JX5A 4PEKA 2FMOA 5EY5A 3UNDA 3IJ8A 4XV0A 5C70A 4ZOCA 1U5JA 1DE5A 4H9UA 1O5RA 2YX0A 4D9PA 4Q22A 5I5RA 2XHYA 3OVGA 4H6EA 3PFMA 5FF3A 1XYZA 4KRZA 3W1NA 5DT7A 5CAHA 3BO9A 1E4MM 2ISFA 2AQWA 1RQHA 3W1TA 1MMFA 3FCPA 4M1RA 3QV7A 4TQTA 3CUZA 4NKCA 1US3A 3KBVA 4DYEA 1YDOA 1GQLA 3N1AA 3BXWA 3AXXA 4C1NA 2J7HA 1O1ZA 2ZKMX 2XSBA 4GNVA 4UFJA 3HPAA 1YNYA 3W2JA 3M4HA 3L7RA 3VNKA 2QJJA 4URIA 3CT7A 1XCFA 4L4LA 1BRLA 1TO3A 3W1UA 1E1EA 2WWCA 1BKSA 4YTTA 4ZO7A 1H7WA 5C7HA 2A4AA 1NELA 1T6MA 3OYZA 3BMWA 1XIEA 3V1PA 3N29A 4MF4A 3TCSA 5LNVA 1JZ8A 1ITUA 1XLLA 3TE9A 1S3TC 5DXYA 1AQMA 4UMAA 2GGGA 4M81A 3M6YA 5HWMA 3EWDA 2YLLA 3CS2A 4P8VA 4ATWA 5FJOA 3TMLA 2R24A 5IBXC 5IHSA 3WDHA 4K8EA 4KPLA 3OODA 4A8IA 1RV8A 2XH7A 3GFXA 4EPBC 1XLMA 3LCIA 4WZHA 3Q4DA 1PHQA 1DWAM 1J9YA 5J8LA 1RJRA 4KWUA 3I4KA 3NA8A 1E5JA 3O0KA 4LPCA 4JFWA 1I8JA 2WCAA 1VEMA 2DY3A 4U31A 3S9YA 4EWND 3DHFA 4QR6A 4QTGA 3B9DA 1CGXA 2EXOA 4F48A 3T09A 2YCLB 3ZLFA 1MRAA 2ZUTA 3MC5A 2DSZA 1VQTA 4CD8A 4IPIA 3ZO9A 5A69A 2RJGA 4Q8TA 1PZ0A 3LHVA 1VBGA 2HV5A 4LCRA 3HFYA 2FIQA 4QXIA 3TLLA 1JCLA 2AQOA 4UFHA 1I2QA 1FWEC 1ZBKA 1LUCB 2UY2A 4MUPA 2XDFA 2NV1A 1V7AA 2C0HA 3QVQA 3L4TA 3GH5A 4UTLA 4YCPA 4A35A 3W22A 2O7SA 3O3RA 4O19A 5RUBA 2OZ3A 4DZ5A 1RA5A 4YHEA 3FDKA 2UWFA 1SR9A 1VRDA 1XLJA 1UIOA 2PDFA 2G5WA 4B92A 5L9FA 2V9DA 1TWDA 4YTSA 1JYWA 4FF5A 1NEYA 2E5BA 1WDQA 1HJWA 5FEZA 1ADDA 5EA9A 3WQOA 1W9BM 4L4MA 1QHZA 3HN3A 2ZZ1A 1R7AA 2FB2A 3IUIA 3WO8A 3I3DA 3L0KA 2I7GA 4KT2A 2PDGA 3OA3A 4IP7A 3WQCA 4AIOA 1UWIA 5CSSA 2FVLA 1XLDA 2ZUSA 1RLCL 1R3RA 3L2IA 4JY9A 5AFDA 6CGTA 2PCQA 4R9OA 1VFOA 3SBFA 3WBAA 1E4LA 4QJ1A 1V93A 1N82A 1ZY9A 2DZWA 2XFWA 2FDMA 3N9SA 2X8RA 3AIRA 1EDQA 1A5OC 1RSCA 4C91A 2XGIA 3A6OA 3FXYA 4LAOA 3O6AA 1R9ZA 1ZP4A 3EKGA 1AMYA 3KHJA 4GYJA 3CYVA 3AJXA 3UXDA 1P0NA 1FXQA 2FGBA 4CKQA 1E0VA 1V02A 4WD0A 1UPPA 4M0XA 4XWUA 4W4QA 3MO7A 4HPXA 4DHGA 4CQCA 2WKJA 5AZ1A 1PIFA 1I75A 4B91A 4C6OA 1HGYA 2CU0A 3TQKA 4MNMA 4HNVA 3T9PA 1KXHA 2B7QA 3IIVA 2WBKA 2GWGA 3U8GA 4DWSC 1X8FA 1CDGA 2E5CA 2WJEA 3CH0A 1IEVA 5ENLA 4MB4A 1HX0A 1JFHA 5HULA 5DCDA 4LCSA 5G4HC 4PC8A 1Q6CA 1GOIA 1GOQA 5HQMA 2VVNA 1XLIA 4CEXC 1LG2A 3DYOA 3CIWA 4GD0A 2JKEA 4NRRA 1P43A 4N0RA 5AYXA 1ISYA 2QVHA 3W24A 4M19A 1F3XA 5I02A 2EPOA 4IT1A 1VFLA 4H8UA 3WUGA 2WZHA 1XKJA 2OT1A 4J2PA 1US0A 4I5UA 4FF7A 5HMFA 3S2LA 1QO2A 2XH2A 2PU0A 1XYMA 5JXQA 1JPKA 3GHTA 4L4OA 2NW0A 4LF1A 5BXSA 4K68A 1CXFA 2PS2A 3NO5A 3CV7A 3T1GA 3A4AA 1GHRA 1P48A 2D2GA 1L6SA 3N25A 3GDTA 3NJ3A 4LS1A 3TYDA 3TXZA 3N3MA 4F0RA 1J6PA 3MMDA 4M80A 4LANA 4R85A 4R7JA 4CCDA 3FA4A 1J0JA 1CTNA 2CC0A 2GGEA 4EAYA 1XIFA 3L4VA 3OZPA 3AMDA 4IFKA 1XQKA 1RJQA 1OX6A 1O4UA 1V5XA 2VDHA 3PZVA 4JYEA 1KC7A 1TR9A 3R58A 5LNWA 5D33A 1H61A 3ABOA 3H54A 2OU4A 4GQBA 2AMGA 1H7OA 2B0MA 3P82A 5AYYA 5C9RA 3MQTA 4L6OA 4FNRA 1MXGA 1NVMA 3W6MA 9CGTA 2GJXB 1HKJA 1O5XA 1EWEA 1FHLA 2ZZ3A 4E2DA 3O6CA 4HCHA 1XLEA 3IIPA 6TAAA 2NVCA 3COTA 4K39A 4BHYA 3S6OA 2GOUA 2YA2A 4JXCA 4JIIX 4H8VA 2ZDRA 3CHEA 3NSNA 5EB8A 5DMYA 1AH3A 1JZ7A 2WHKA 1WNOA 1I4NA 4U10A 1V3LA 2ZUMA 4PEEA 5FAJA 1LRTA 4NYUA 4HHLA 2E6AA 4NAFA 3BAIA 1WZKA 3UESA 1GWJA 2R1NA 2AQVA 2V5JA 3CIVA 2DZXA 3L23A 4XZLX 1DTNA 4DJEA 3O8AA 2E09A 4O52A 2GQ8A 3WNKA 1JPIA 1W1VA 2OZTA 4DPPA 1XR2A 4ICCX 4JFUA 2VGIA 4X60A 2PWUA 3NQ6A 4ILSA 1I60A 3TROA 1CPUA 3WMSA 5AC8A 3QGVA 5CC5A 3WD2A 3W1RA 3BW4A 2VCCA 1H1NA 5JBDA 4KWWA 1MEHA 1F74A 2ZUNA 4ZQCA 4M3PA 1JG9A 1A53A 4QAIA 4NUWA 4E4FA 1DL3A 1BTMA 1J0HA 1KCLA 2ACUA 4CU7A 5F1UA 4UR7A 2ONEA 3M1ZA 3RAOA 1NJJA 3BAYA 4D6JA 4PMYA 3VIPA 3LY0A 2XVKA 2V3DA 1D3HA 1SZFA 1TMHA 3SQSA 5JH2A 3LN3A 1EDTA 1KFBA 1JF5A 5HANA 3IRDA 4QG9A 1FUYA 2HTMA 4W93A 4FNQA 3B0UX 2WMIA 3BW2A 4RPPA 2BZNA 1TV4A 4IMDA 1HVQA 4RW5A 4WY0F 3SCOA 3W2NA 1TJ1A 5KZ6A 4IIHA 2Z2BA 2XIMA 4GQ0A 2Y1HA 3MHGA 4GZEA 1XDJA 2GWNA 5H91A 3HGSA 2VL4A 3E5PA 4NZCA 4B9YA 4CU6A 1UR1A 1NWTA 1J0IA 4LV4A 3M07A 2D2JA 3RXZA 4GIYA 2DIEA 3B9AA 4DJDA 1EEXA 3AUOA 3NQGA 4LRSA 1QPKA 3JR2A 3SCUA 3STGA 4AX7A 1POJA 2GYIA 3WLQA 1VEPA 5D4YA 1FDJA 1Q7QA 1HL2A 2DIJA 2J13A 1AZ2A 3F2CA 2DZSA 2OVLA 1QXLA 4XB3A 3V36A 1JYVA 4CNPA 1FP8A 3WQDA 4Z0SA 2VI0A 1AH0A 4PCFA 4C5YA 4M6PA 4L9XA 1TIMA 3G8EA 3QH2A 4PRRA 2PAJA 4JTDA 2ZZ6A 3G1YA 3CV2A 1JCNA 2JBMA 1W9UA 5FEPA 1A5NC 4F0KA 3GH4A 3R89A 5I09A 3WL1A 2NX3A 5CCZA 2OX1A 3VMPA 5HDRA 4LFYA 2QJIA 1UZ1A 4RDVA 5XIMA 4JY8A 2QPSA 3W53A 4I6KA 1B90A 3DKJA 2ZQ0A 1K70A 4HZ6A 3PUGA 1DBTA 2QZRA 1JUKA 3O05A 2CWXA 3UZYA 3SIMA 4DJFD 2CZDA 1VBJA 3C8NA 2F8QA 4LALA 4V28A 3NZGA 4FX7A 4LC6A 5PTDA 4DYKA 4S1FA 3RYSA 1U2YA 3QEZA 5BU6A 3WLJA 1BG4A 4BKNA 1UASA 2NLYA 4MYXA 4I7WA 5DRIA 3DG3A 3E9AA 2G50A 4JN7A 2D0HA 2V2DA 2OTDA 3R8GA 1WZMA 1GZJA 4KW2A 1PKYA 2HCVA 3FGCB 1W6TA 5LSMA 1GVRA 1E4NA 3DHPA 1G5AA 3W28A 4D6GA 3C0JA 4LUSA 4RV3A 4YN5A 4IGHA 4TTUA 4ADUA 3CUFA 4WY0A 2W4XA 3B3DA 1FXPA 2GK1A 3OGRA 1TUFA 3UERA 3CAQA 4ZE5A 2DT3A 4ENLA 3KRZA 2GUYA 4R7WA 4Q33A 1YXYA 3WLNA 5D2TA 2Y7FA 2YIHA 2PDBA 4L56A 4S3JA 4D6DA 2P10A 2ZOXA 1KV5A 3GAKA 1RBOB 3QMTA 2ISSA 3MA8A 3RMJA 2E5DA 3VE9A 1OY0A 1XGZA 1R3TA 2Q01A 4N9BA 1Y8BA 3EX6A 4YYCA 4A3UA 4WKHA 3B9OA 1PWLA 2VCAA 1OG0A 3WQ4A 1OD0A 1FWIC 2BB0A 2Q6ZA 3PAOA 4HMEA 1FDYA 3VM5A 3QR1A 4OHQA 2YLAA 3VUSA 2NXGA 3BICA 2J27A 1VKFA 3LK6A 3SECA 1ZNNA 3VD3A 1QPOA 2J6VA 1EJWC 1RAKA 4OQVA 4MTVA 5HNTA 3G0UA 4NSBA 3UFYA 1KFLA 3QFEA 3ES7A 3BQ5A 4R34A 4UXDA 2WW5A 2OLAA 4MY9A 1DJYA 3LHWA 5BXPA 3AROA 4CUCA 1JYXA 4XD4A 4M56A 3HGRA 3MDUA 3IGUA 1K6WA 3IGXA 4J3VA 3DESA 3KE0A 3HQOA 3C3UA 1GG1A 4IQJA 1ODZA 4IMAA 3OZOA 3KOWA 1OCBA 3SI9A 1QW8A 1VC4A 4Q6JA 2EG8A 2PBGA 3AAMA 5D9MA 4RZ6A 3UCQA 2PLMA 1J96A 4QDPA 1QI4A 2Y5EA 1QDSA 2XTKA 2J25A 3CQIA 1V08A 4A29A 1HZYA 4FK9A 3AOFA 4GLEA 4HNOA 3IRSA 1RALA 2A21A 1FWDC 2P8BA 5SWUA 4KFOA 3DI1A 1UIPA 4MLJA 1GZGA 1X1NA 1X98A 4UZSA 3D5HA 4LBUA 3G1AA 4V33A 4H8NA 3VZXA 3ARQA 4Z1BA 3KL0A 4KEMA 1GOOA 4RXGA 3W01A 4E8DA 5EMJA 1SMDA 4A4AA 3QC0A 4WGXA 4PMXA 1PXGA 2UY3A 4LUIA 1SW7A 3LDVA 4EPEC 2AL1A 1PB0A 3DG6A 4HHPA 2FGZA 1Y5VA 1E40A 2AOSA 4MVAA 3J7HA 2CBIA 4HHHA 3ALGA 2UBPC 3IK4A 2WKLA 3EGJA 2WNQA 5HINA 4X3ZA 5HUPA 3OYXA 3T44A 3WK0A 4A3QA 3AIBA 1Q45A 1AL8A 1QNVA 2PWGA 3TXVA 5JQ9A 1XYCA 4UCGA 3DFTA 1Q4NX 2B7PA 4NVTA 1FHUA 2NX9A 2WC3A 5A6BA 2W62A 3OVQA 2D20A 2QJGA 3APGA 1VFMA 4DI9A 1DQWA 3CPRA 2VZSA 4M8UA 3EWUA 3WFLA 3GVVA 4P8UA 1KGWA 2PDHA 3TR2A 3UG5A 4HA3A 1W1YA 3NZQA 1EXPA 1O95A 5FESA 1MI3A 5HOSA 1TV5A 4G8TA 4JIQA 5C9ZA 1MUMA 4V27A 4DBWA 5E1QA 4Z2JA 1KM6A 3AI0A 2I56A 2C91A 1GNXA 1ZENA 1MW1A 3KZPA 3HG3A 5E6YA 3BJSA 3I6TA 4FZIA 3CAKA 1E6ZA 3GC2A 4Z08A 3PWGA 4K7YA 4Q4OA 9RUBA 1UYQA 1WKEA 4IZGA 3H2CA 1UC4A 1VS1A 2X7VA 8TIMA 3UPWA 3OEXA 3KVMA 1C8YA 1Q6FA 1G0CA 3CL6A 4BI5A 1GVEA 1TRDA 1OB0A 2Y89A 3O16A 2BTMA 3VABA 5E6ZA 3HMJG 1OCNA 1NDYA 4BEQA 4WLCA 5IM51 4W7WA 4Q4RA 3SRDA 3M5ZA 1IIHA 3VIHA 5CG7A 4AMCA 4Q8MA 3PJWA 3BV4A 3A3WA 1B54A 4HOXA 1W32A 2VD9A 1UOZA 1DTUA 4ZSUA 3P84A 4GZIA 1E5NA 5CGTA 2J6XA 4AZGA 4UMBA 1SVDA 3G1RA 3W38A 1MEWA 3I7QA 1V6YA 4H00A 4RNIA 5CZJA 5B7ZA 2Q3RA 2BWGA 2WM1A 4O28A 4BWLC 2VWTA 1WOBA 1TFVA 3NQ2A 1KTNA 2XINA 1TPB1 3S2JA 1E55A 2WHMA 3W73A 5C5YA 4OV4A 1GCYA 2F6KA 4GQRA 1U1UA 4TX6A 1OWQA 3W4RA 3WNLA 2PMQA 4LQ1A 4Z2IA 1XLCA 3N14A 4FNUA 4RKAA 3VFLA 2VGBA 4AZ5A 1N2VA 1FCVA 1MWOA 3R1ZA 3DC0A 2YDQA 4TOQA 1VD6A 3W7OA 1E1CB 2WB5A 3R4IA 5I6SA 3A9BA 4W86A 4LAZA 2QMJA 2ADAA 2Z25A 1T5AA 1A4MA 3S2MA 3B0XA 5DBTA 3NNTA 3C6CA 1RY0A 3PUEA 1TV2A 1EJVC 3VNLA 1RPXA 1JXKA 3EEGA 3UCCA 1ISXA 1Z9AA 4S39A 3W7RA 4PMOA 1MZRA 3HQNA 3KBMA 2C19A 4HVXA 1E0XA 4F4RA 1O6IA 1K77A 1MFUA 1VH7A 1R86A 3S4TA 3SFKA 1Y65A 3AISA 4IMGA 4ACZA 3IPWA 1S2WA 4E38A 1FWWA 1GYMA 1IEQA 3VKCA 2FH6A 4M6UA 3OTRA 5EMMA 2DPEA 3TQPA 4QDWA 3AS3A 4HK7A 1DE6A 4DNMA 2E25A 2CCRA 4PTNA 2P3EA 4LUTB 1W54A 1JEZA 2ZYFA 4MFDA 2QCEA 4XZIA 1IR2A 3QY6A 3WCZA 1OC7A 1LBLA 2DSUA 1W5MA 1LOLA 1PE1A 1NH6A 3VIIA 2CZEA 3FAXA 4GG9A 4O1DA 5ABFA 7REQA 3ITVA 4FIRA 1EA9C 5C8BB 4DWDA 3SW6A 4QLKA 3VIKA 2QUVA 4JEJA 3UVAA 3FNDA 5KZDA 1J2BA 3NQAA 2PLJA 4W85A 1GQNA 2E28A 1PUDA 3VNJA 3L4WA 1WE5A 5A5WA 2V5KA 3A4WA 5FACA 1E73M 4E2VA 1KM4A 5CC6A 4QIUA 1VR6A 1SW3A 4PB3A 1XRTA 2DSVA 2DVTA 5A8PA 1Q7MA 4H4IA 2BLEA 3AZRA 4ATLA 4B5UA 4PUUA 3I10A 1S1PA 1D8CA 2PUZA 4KFNA 3HG5A 3NL5A 1NF0A 4MJ4A 1M03A 3RU6A 3NGFA 1JL8A 1K7EA 4HBKA 1Q2RA 3NPUA 2DVXA 3O2LA 3Q45A 3ZJKA 1EWDA 1Z6KA 3W7IA 1L6WA 4X9YA 3FN9A 5HA7A 4JTEA 3ZT5A 3G8RA 3OLIA 1ESWA 1KBBA 4HZ7A 3UVIA 1XYAA 1LRNA 1W1B1 2VRKA 2P3ZA 2BG5A 3K1DA 4ZQMA 3RJXA 1WZLA 5HXMA 3AZSA 2CLHA 4DWSD 1LWIA 1TG7A 4ORIA 4MJ2A 2XJ7A 4K37A 5CPSA 4S38A 3L4XA 4KCVA 4UTHA 1R30A 5CG0A 2BVYA 2F6UA 3VOHA 4X0NA 4ZOAA 3QV8A 4JN8A 3HQ1A 3JS3A 4BJHA 2REQB 3JZUA 1CWYA 5MHBA 3ABRA 4C6FA 5BW6A 2OQHA 1S2VA 3IAPA 1C7TA 4G9PA 4AWUA 1SZNA 8CGTA 1TV3A 3LM3A 1J6OA 2FQIA 1WQ5A 3W23A 1A0EA 3LS9A 1XISA 1MQRA 3MVTA 4O1CA 1B57A 3W1LA 4OOZA 3VD4A 4IP4A 2VGGA 2F61A 3AMGA 3VTRA 2Y7EA 1UZDA 1S5VA 4AY7A 3LGEA 2G3JA 1R3YA 3DC8A 4HMDA 3XINA 3GWQA 4GUHA 1QNOA 2PDYA 2CHRA 2PP1A 3GVGA 3CM4A 3AXKA 5CQ1A 1KXTA 4Q7NA 3SCSA 1QNPA 3SRKA 3CTTA 1Z7AA 4WVXA 4K8HA 4JTCA 1KKRA 2VDIA 4XISA 3V75A 2HBXA 1K4GA 2WM0A 4P2VA 4IJCA 5CC3A 3AIUA 4XBJA 5C2XA 2OODA 3NSXA 2FFCA 1QPQA 2V5DA 3QMRA 3CEUA 3QV6A 5M3WA 1QBAA 2NX1A 1I45A 4KETA 2YBVA 2D0FA 1P6CA 1NM9A 3NM1A 2EKGA 3GFZA 1KXVA 3SGUA 3NWRA 3R10A 1RY8A 2XVGA 4HOZA 3WDJA 4RPQA 4Z2HA 3U9IA 4GWEA 3GG0A 3WF0A 1V3KA 2O0TA 2ACSA 3MCMA 4JOMA 1IF2A 4JIEA 4RV8A 4MKSA 4P8WA 3MP4A 1FH7A 4KWSA 2XZ7A 3CLWA 4JTTA 1BYCA 4DBEA 4AW7A 3P5YA 4K38A 3D47A 3EA1A 1JCTA 4JNYA 4QS5A 4PTXA 4NJHA 3S6DA 2DH3A 3IIOA 4Q32A 1HTIA 4TUFA 1CBGA 1DWJM 4WUIA 4IIFA 4L4PA 3THAA 4KIRA 3QMSA 3WH6A 1H5YA 3IK2A 3LI0A 3FEMA 3LLXA 5IBXA 4CN6A 3UGVA 4Z0JA 4UQCA 4G5DA 1XIHA 3QYSA 1CLVA 1OX4B 3L12A 1REQB 3OOQA 2H3BA 5EMYA 1KM1A 5A2AA 1LL6A 5HAOA 3PBMA 4FPSA 4PH6A 1VBUA 3QV9A 2DQXA 4O16A 4W8LA 3RX2A 4LYKA 1D8WA 4J4KA 4WJ8A 4ERIA 1VLWA 1MDLA 1ZRQA 2VFFA 5I24A 1XLHA 1XIBA 2D73A 1NFGA 1HKWA 1DJNA 1YMYA 2EJAA 4CCEA 2Y5JA 3CV6A 4U5KA 2I1OA 2INEA 4AD4A 5AYBA 1V3JA 1ADSA 3QQ0A 1KD0A 1S1RA 2GFTA 7ODCA 5LA2A 1YXDA 4AB4A 4UQ9A 3IV3A 3QQ1A 4B3KA 1CX9A 3W7NA 4LEFA 1K8XA 4XAZA 1XM3A 5REQA 3UJEA 4QSFA 1M53A 4H01A 1QI3A 4AIEA 3HG2A 3G0SA 3W1QA 1A0DA 2D0GA 3CMGA 2IQDA 3P74A 2CZFA 2ZA1A 4LGXA 4QG6A 3P67A 1KLYA 3W37A 1PKLA 1CXHA 2CETA 3RLVA 1TWZA 1FH8A 4O11A 1UCWA 4LV9A 1XPGA 6TIMA 3WELA 3L66A 3DU0A 1TCMA 5CJ5A 4G2DA 2WHJA 1NFPA 3BW3A 2QEZA 2V38A 3G18A 2VFIA 4QE5A 3AS2A 3ZSSA 3NOYA 1AVAA 3VK5A 3LMYA 5A6SA 1DXFA 3L0GA 3RMEA 1J0ZA 1LZOA 1U83A 4KFPA 4HD5A 2WXDM 3C0SA 3NOEA 4O0KA 3R79A 3S1VA 1JNDA 3GH7A 1J0KA 3VKAA 3VFCA 4WGHA 5C7VA 2EO7A 3KVLA 3W6YA 3NO3A 2J9XA 3ZM8A 1YLVA 2HS8A 1M68A 3P8JA 5GNYA 2E4TA 3EOLA 4IJBA 2EPLX 3LHTA 4JQ2A 4XAPA 3CHCA 4S3DA 5D2WA 2VUNA 5DEZA 3VIMA 4DWSB 4TX9A 2Q09A 2IPJA 4EF9A 1LWHA 4R7OA 4QG8A 3ALFA 4HPJA 5FKYA 1L8PA 2J9ZA 1G4SA 1BWKA 3TOPA 3W2UA 2NQHA 1RVKA 1EQCA 1ELSA 1R87A 5D37A 3G77A 5AHNA 1WDRA 1QJWA 1KFEA 1NY1A 2ZA3A 3PTQA 1UR8A 3GBDA 3V18A 5LNUA 4YVVA 4HIBA 2QF8A 1AW2A 4NNAA 3U3HA 4GH3A 1RBLA 1XRFA 2C18A 1XRSA 2CLEA 4GGBA 1R9XA 1JAKA 3MANA 1A5KC 2NQ5A 4UR8A 3KL5A 1LQAA 7A3HA 3HV8A 3EWWA 4JTQA 3UYIA 4EPKA 3AHXA 2W6RA 5U7SA 4CQ8A 4HA1A 1RXOB 1BLIA 3CMFA 4LB3A 3JZEA 4AEEA 4WDTA 5DY3A 3C3NA 3SFWA 1Y7VA 3GHUA 4C6NA 1NTHA 3BPWA 1X6NA 3TTQA 3IJDA 4UWMA 4MZ8A 4WDUA 1HNYA 3BLDA 4O14A 3PSVA 3GE7A 3M0LA 4M29A 2VRJA 3CWOX 3SEPA 3WBEA 4GCXA 5F4XA 4UQDA 1T0OA 2VYOA 4EACA 3PWAA 3UZWA 1P0KA 1SZGA 1OINA 1HJUA 2PDUA 3RIKA 2BY3A 1BD0A 3WNNA 1TX2A 4MWAB 3C2EA 5EYWA 9XIMA 2WVUA 4CD4A 1JDDA 1NQKA 3QTPA 2OYMA 1GYNA 3N6HA 4DJEC 2X0HA 3E2VA 4HU3A 4HMNA 3IWPA 3V0UA 4XO7A 2VR4A 2QUTA 5FSDC 3RCYA 3TNBA 1DJGA 3M5XA 2OJPA 3UD6A 1L0PA 2FB3A 1F3WA 1EIBA 4WSHA 3TJIA 4HJFA 3PVFA 3G1FA 3HURA 3HIJA 3KCLA 1IQ8A 5BXRA 1KQYA 4MNJA 4PBEA 1GONA 1LOSA 3W7GA 4DUOA 4JL1A 2HPMA 3S1XA 4O18A 5TBOA 1FTXA 4H19A 4AMAA 1FWNA 3G2GA 4MZYA 4GX8A 1VBRA 1VCFA 1QUMA 1FVPA 3L21A 4ACYA 2P8CA 3QXBA 1GQIA 3M46A 4P7QA 1GJUA 1XGDA 4LTSA 4UTWA 3NEHA 1GHSA 2J7FA 5DRCA 3OBEA 4CNOA 3WQGA 4N4QA 2FDSA 3W1MA 4EK7A 1PHWA 2B31A 3NL2A 4N6FA 3W7DA 4Q8QA 3TVAA 3BTNA 3U0HA 1W91A 3H4WA 4C6MA 3LD5A 3LXAA 4Q4PA 4TU1A 3WKZA 4O53A 1UMLA 5FEXA 3IS4A 2V82A 3N13A 4DJDC 3V0TA 2YL5A 7ENLA 3WF2A 2TRSA 3GD6A 3TN4A 2ANUA 2Z2UA 4HCDA 5MKGB 4OVXA 5ECUA 3STEA 1Q8AA 2HVNA 3TA9A 1AA1B 1Z3NA 3A47A 3H7UA 3CUGA 1DORA 1ZZMA 3KTXA 1I9CB 1NSJA 4TVCA 4E3TA 3NYZA 1XDLA 5K7JA 4FNTA 5KTLA 2QIWA 2Y7DA 3GM8A 3W1PA 4XZ9A 1GKQA 1BF6A 3GLCA 4IFOA 1R9YA 2PZ0A 3MB9A 2HRWA 3GTFA 1Z69A 1X8CA 3Q2DA 2FVMA 2XGZA 4JTAA 4YU1A 4RNJA 4BEUA 1XBVA 2Q02A 1TMQA 5DMLA 3WL0A 2FH8A 2E1WA 3UU0A 4H7VA 2VMFA 1A5CA 3SY8A 3Q94A 3EA3A 3C56A 5I2UA 2QCDB 1DOSA 2WVVB 2ZRZA 3KAOA 4R33A 1OC6A 2AL2B 1E9LA 3O0FA 1H1YA 5B80A 3O15A 1I1XA 1TJ2A 4ZTYA 1PDYA 2RKXA 2JEQA 2QGYA 3LTPA 2VC9A 3MCOA 5A94A 2GUBA 3OQ8A 1R47A 3WD1A 1B30A 1UUQA 3ARYA 3U4AA 3HG4A 3WLTA 3KTSA 1NOWA 3L5AA 2FPYA 1EJUC 3W25A 3V5CA 3MPGA 1RA0A 1K3UA 4GXMA 2XWEA 3QFWA 1TX0A 1GJWA 1NWUA 4GA8A 3AC0A 1GTHA 1W3TA 1DJQA 1XL9A 2YYTA 3PPFA 2OEJA 2HPIA 2C1HA 1W9DM 3UG8A 1SZRA 1Q3NA 4RZ4A 1ADOA 2VEKA 3SN0A 3CPGA 1Q85A 2VJXA 4UBPC 3EEZA 2OO6A 3KP0A 2YSWA 4GABA 1B3VA 1W3LA 4GO9A 5D38A 1F6PA 2Z1WA 2AAMA 2ZZ4A 4FLQA 3T4CA 1BYDA 4JHZA 3OBAA 1HXJA 3PANA 4OFCA 4ICNA 3DFPA 1L8NA 1WAWA 3VNYA 2YA0A 2WMHA 5FJIA 3C5QA 4JL2A 5EL1A 2EPKX 1EJ7L 1KW1A 2F2HA 4P7RA 3DENA 2QHAA 3GZAA 2G0WA 4UR9A 1W31A 6XIAA 3L4UA 1MZHA 1V77A 1XGEA 2J88A 3W02A 3F4DA 1UR9A 4A8NA 3C8FA 2UY4A 3H70A 1KNWA 2J8FA 2GJPA 2BMBA 4RDYA 1O5QA 3RFAA 1QI5A 1ITXA 2QJNA 4D6FA 3EB3A 3DCPA 3QOMA 3R8RA 1AL7A 3ZS4A 4MB5A 5GQBA 4Y90A 4BI6A 2V2CA 1SSDA 5FD0A 3K1GA 3N19B 1W5QA 4Q4SA 3WJSA 1B5TA 2Y0FA 3FAWA 2GQ9A 3LEPA 4S3KA 3LQGA 1QMLA 3L9CA 5LXEA 2Y8KA 1XLAA 3TCEA 4MAVA 1LLWA 1EKOA 4QLJA 1AQ0A 2WSQA 1MDRA 4I5XA 3ITYA 3KP1A 2DH2A 2PDPA 4BY3A 4CCCA 3EOOA 2QF7A 2W66A 3FSTA 1OIMA 2DZBA 5CZTA 1E6PA 4RE0A 5JVLA 3CWHA 1K8ZA 1ZP3A 3ARZA 4Q4QA 3L0NA 1H0GA 3T08A 5CZKA 2ZWZA 4KKXA 2ZXAA 1KWKA 4GBUA 1SM9A 3TYCA 2Y85A 3MWCA 1F8MA 4PUNA 2CLIA 4XD5A 3WX7A 2KZHA 1J93A 3W7EA 2OZ8A 3BV7A 2I5IA 3TUUA 4Q3MA 3E12A 4G7EA 4HK6A 4G7FA 1YHTA 5AVNA 1NF7A 1YTEA 3CQJA 4BFAA 5FJPA 1CECA 1R0MA 3T7VA 1OHLA 4JN6A 3WMCA 1UD6A 1KBKA 5DCBA 3WQ5A 1DXIA 5DY2A 1ZGDA 2QJHA 3R2GA 2VZOA 3FLUA 1MRQA 4NAEB 1F3EA 4DF2A 5AZ0A 3UQNA 3MUCA 1FY6A 3PBGA 1V02E 3UWUA 2YA1A 4DYJA 3CHFA 1XYLA 5HWJA 4ML9A 3ZOAA 3AS0A 2J9YA 3BAXA 4I8DA 3BAJA 1OSEA 1V6XA 4US5D 1QOPA 3AUJA 4OTKA 5I3IA 4NP7A 3VKKA 1QWGA 4XD6A 1XBZA 3M43A 4LUTA 1PL9A 2RAGA 4N42A 2NV9A 1ZAIA 3CNYA 2Z1SA 1B3OA 4U33A 4QROA 5ABTA 2EF9A 2Y5SA 3WH8A 3ABZA 3LXBA 3TOYA 4AQLA 1NWRA 4PN2A 1SJAA 2VFDA 4TXEA 3NDOA 3H24A 1SMAA 3EOEA 3SCNA 3W87A 4J40A 2LLEA 2VC7A 2AMXA 4I5RA 4DUWA 1FWTA 2CITA 4Y9OA 3BLKA 1PKNA 3CHDA 3LGGA 4IGNA 4BR1A 1RJPA 4F9JA 3TYZA 1TA3A 3PULA 3QW4B 4O15A 5FL1A 4N4PA 3G24A 4GYPA 3VDAA 3HBLA 3L2MA 2FHCA 2IPFA 3TC3A 1EOMA 5U4NA 1TPWA 4OUEA 2X1IA 1E6XM 1J2WA 1ME8A 4W8BA 5E09A 4UTUA 1U1HA 1WP6A 3THUA 1E4IA 4W88A 1PYFA 5AC4A 1VJZA 2CZ5A 1Z44A 3LLDA 7TAAA 2CNCA 2B81A 4IQDA 2GJRA 4NU7A 1QHPA 3IJIA 4S2BA 1QPNA 2BNJA 3U5YA 1F4HA 5H1WA 2JKAA 3GRIA 3MW7A 1V6WA 3F5JA 1UWQA 3BGJA 2PDWA 3WD4A 2IQ0A 3SRFA 2QYGA 4WF7A 1N7KA 1EH9A 3OLDA 3H7VA 4O8AA 4PA8A 2J75A 3H7RA 3NQDA 4X2RA 4JKMA 4S3BA 3F5KA 4HGXA 1XC6A 2CLOA 4CNNA 1YQ2A 3MY9A 3WF3A 3IARA 3C2OA 3PN8A 3MZNA 1QCWA 5EFDA 3TSBA 2QCNA 4LAUA 2ZX6A 1OIFA 4H8HA 4MGGA 3UWVA 1A4LA 4PTMA 3CAWA 3M16A 4B5TA 2FHBA 4Q6XA 4IG2B 1X6UA 4DQWA 4L80A 2VP8A 3P80A 3KVJA 3S5SA 3E74A 4AZHA 4C7DA 5D2YA 1YNPA 4XAGA 2X42A 2PA6A 3TFXA 3IUHA 1RH9A 3I6EA 3SN4A 5EU9A 2PGWA 3ARSA 2P0IA 1C91A 4ZA0A 2CBUA 2ZZ5A 1TE1A 4IICA 1KCXA 1A5UA 4BWLA 4RUBA 5G2WA 2PURA 2HVOA 1JULA 2PGFA 3BJTA 4EF8A 3K4AA 4H9TA 1JI2A 4AF0B 3TWAA 3PF3A 3N12A 1A3XA 2CHOA 3N73A 5MF5A 2YB4A 3FK4A 1JAEA 3ZQ9A 2X1SA 5I77A 3FSUA 1ZPTA 1UMYA 3CJPA 4Y9MA 4ASTA 2A3BA 4ERAA 1G94A 3B9NA 1OYCA 4DO6A 2BY1A 1PV8A 1TIWA 3NAVA 1XC4A 3S1WA 1I2NA 3SSZA 1ECEA 1HKVA 1OZMA 4R3UA 2IKJA 2BHYA 3LTYA 1VIWA 4F66A 3M7WA 3TQVA 3HMCA 4AHPA 3C2YA 1W3HA 3U7BA 3RCNA 3K8MA 5CPQA 3UG3A 2A5HA 3TU9A 1QVBA 2G3IA 1H62A 3HGJA 8A3HA 2QVNA 1EXBA 3PZ9A 1AODA 4ROQA 5A2BA 2EPMX 2A0NA 2X40A 3O63A 1K9TA 1KBIA 1UA7A 1UW9A 2PLKA 3C61A 4WKAA 1BYBA 4F0MA 3NEVA 4DPQA 5I23A 4LAKA 1V03A 4DZAA 4A3HA 2H6RA 1VJIA 5G4EA 2GGIA 1DYSA 3ZVHB 1GVFA 1V6VA 1WXYA 1XG4A 3F03K 4US6A 4M82A 3OLGA 3SM0A 5CAKA 1PTDA 3MUIA 2VCBA 1VPQA 1OJXA 4QE1A 1B31A 4MOZA 3K8LA 4PBGA 1TSIA 1I1WA 1UOKA 5C9XA 5HUOA 3BG9A 3EPOA 1UG6A 1DIEA 5LZLA 4O8RA 3GC5A 1REQA 6A3HA 3RR1A 3RM4A 4C6QA 4PMZA 4YJ5A 4GACA 4CQBA 3GDRA 3SCRA 1AQHA 3PBWA 1VIZA 2Y8UA 5KITA 3E2SA 4K8GA 2Y88A 3P7YA 3TQ0A 1R46A 2A3CA 3EXSA 5CSRA 4IISA 2DGAA 3W7HA 4A8RA 2DJLA 3W7MA 5G2HA 2OO0A 3T8LA 1AG1O 2XFYA 3IGSA 4JGDA 4CU8A 2OR2A 1H7RA 1B3XA 2W3ZA 4XVDA 3NM3A 1XJBA 3CBWA 2W79A 3CB8A 3SUUA 2H9AB 3PJTA 1K9EA 4ZFMA 3BGAA 3GS6A 4JIHA 2OWWA 3VM7A 2VOMA 3EX1A 4IPJA 3UP8A 2DUAA 2CLMA 1H11A 4HNUA 1SPQA 1X97A 2HZGA 5BOFA 1H2JA 3TN6A 2H90A 4WSKA 2QUNA 4AY8A 2YFOA 4KF1A 3WEMA 3LLFA 3NXLA 2I14A 2QXWA 1PVNA 1OFDA 3KHDA 5CEWA 3T42A 4DUXA 3RDKA 1U22A 3KFTA 3OJGA 3PAJA 4JQ4A 2PTXA 5E5CA 1XP3A 3UGRA 3KS6A 1JCMP 4IX2A 3RITA 4PYSA 3JRKA 4Z17A 1WDPA 4YMZA 1PCWA 1NAL1 2O56A 1IR1A 1RR2A 3FYYA 5G2IA 5M2FX 5M1TA 2RGLA 1IIGA 1JUBA 1BHGA 2NUXA 4PMNA 1CB7B 1WUFA 3RR4A 1VZWA 3AU2A 3PY2A 1H4PA 1E70M 2QUMA 6PTDA 1Q7ZA 1B4EA 2TAAA 5G1YA 1XSKA 3U4FA 4HK5A 4LVDA 5K9XA 4UUIA 1ZTVA 2XWDA 4FSAA 2EJ1A 2GLKA 3GG8A 2OX4A 1VYSX 3PZUA 2UV8G 1DWHM 4MDOA 5LYRA 3ARXA 4XK2A 5CH9A 1UPMB 1NARA 4HZMA 4PE8A 4OBTA 4JR5A 3W7LA 4I9AA 1EP2A 2ZZ7A 3BGGA 5BOOA 3FS2A 2C7FA 4MLRA 2Y61A 2NSXA 3CTLA 3TZFA 4HYWA 4DUVA 3QOKA 3N2MA 1NIUA 5K3VA 3UXAA 2ZTKA 3W27A 5DANA 2ZIDA 4MJZA 3JU2A 4NF7A 1GOXA 4FXRA 4B5NA 1H63A 1CGVA 1RPKA 4JTSA 2J78A 3BSMA 1GOWA 4QS6A 3EXRA 5J5DA 1JRCA 5I3KA 1UBSA 1K1DA 2D23A 1JVNA 2VR2A 3ZSTA 2Z0IA 4W7VA 5CBBA 4EE9A 2PZNA 1OFAA 4GKLA 3W29A 5FJRA 2YPIA 1IEWA 4B2DD 4DAIA 1G1YA 4C1NB 1IV8A 1P0DA 2C3ZA 4INFA 4NT0A 4DB7A 5A6AA 1BXNA 4ZO6A 3UW6A 1A47A 1SYTA 3ZR6A 4GVGA 1RVGA 3D46A 4YWIA 2X2YA 1PZ3A 3NYDA 2W0UA 4TV6A 7PTDA 4REQA 1AFSA 2PTDA 3N4FA 3MJYA 3VDGA 1KQZA 1KTCA 3K4DA 1GKRA 3MI2A 2HXTA 3TYAA 3HF3A 3P3BA 2HBVA 4IIEA 4B5XA 7TIMA 4I8YA 2BXVA 2DU2A 4CD6A 2JEPA 4GJIA 4GZJA 3W75A 2ISWA 4U2ZA 2WPBA 5T26A 1POKA 3AWOA 1SFJA 3SAZA 2IW0A 4B90A 1R3VA 4DJED 3R13A 2QCLA 2Z28A 3D3FA 3I7SA 1A3HA 1S2AA 5F4SA 1D2KA 2DZUA 3W82A 1IXNA 3DHDA 3W2KA 3P93A 1FDZA 4LYQA 2ZC8A 4PTVA 5FJTA 3UYCA 3HTWA 1LBMA 2PTYA 3B4UA 1KWGA 2BOFX 2ABBA 2A6NA 1U30A 4AIUA 4POCA 1BXBA 4XAFA 2OGJA 1J5TA 3OGVA 4YYFA 3MKKA 3WLPA 4WK9A 4BS0A 2NQ9A 4QDMA 5IHRA 2O4MA 4Z1AA 2PLCA 1TV8A 3E5BA 4WCJA 3SN1A 2BASA 3A23A 1BVZA 3UZZA 2V2HA 3V4BA 3PTMA 1ISWA 1XSIA 2ZRXA 4XZMX 2BSLA 3HPZA 4IL0A 2PDJA 2BV9A 3WEOA 5LNRA 3N2XA 4LBSA 3AICA 1BWVA 1QAPA 3BOXA 3RLHA 1YNQA 3JUGA 4UNKA 3P6LA 2Z2AA 2YL9A 3FFSA 2YCKX 2ZFAA 3MWAA 2XH0A 1GW9A 5GJPA 5F2GA 5TNVA 4MIMA 4CGTA 5XINA 3VIGA 4U3CA 3TJ4A 4BQ2A 3HA1A 5LIXX 5DQPA 5EGRA 1UD2A 1S3HA 2WMFA 3FXGA 4DJDD 2VTFA 2WLZA 3UA4A 4L1WA 2DZTA 2P88A 3AYRA 4Z1DA 2D22A 2ALDA 2HE5A 4H1ZA 1VEOA 2CW6A 3EZ4A 2GVJA 3P14A 3RF9A 1DHPA 3LA4A 4F3HA 1XPYA 5ABHA 1P6BA 4QJ5B 3GUWA 3QZEA 3BG3A 1WB0A 1W8GA 2QDEA 2WNWA 3WK3A 2DV0A 2D2OA 2BY0A 4DXVA 4AAJA 3B05A 3NQ8A 5AHIA 3ZXWA 3HU7A 3AHTA 2G4FA 2ZTJA 3NL6A 4O50A 2G8ZA 2BGQA 5GNZA 2Q3OA 5G1MA 1EC8A 3G3DA 1JD9A 5D8ZA 2WSKA 2V5CA 4QRNA 5CJMA 5B7YA 5T91A 2VOTA 1WKYA 4GI8A 3EA2A 2NZLA 2A3EA 3AXMA 4PRWA 3TYUA 1V0NA 2GUUA 3VIFA 3UPBA 1Y5WA 5DXXA 2EGZA 4HN4A 2J77A 1E3XA 4BQ4A 4M6QA 3BZGA 1UQZA 3DOPA 3F4WA 3E96A 4ZQPA 4PRTA 1G4EA 3GDLA 3H2NA 5I78A 2E0PA 1DV7A 5AYIA 5KZEA 3P61A 1HIZA 2DVUA 2X0SA 4NJKA 1WDWA 1YDNA 1EHAA 3S1GA 1XYBA 3G1DA 1V0MA 1VFUA 2DW7A 1UKPA 1C8VA 2EEXA 2G97A 3GIQA 4XO6A 3EPMA 5FF7A 4NXKA 4F79A 1PTGA 1GK8A 3NURA 4JPGA 1HN1A