3FFSA

The crystal structure of cryptosporidium parvum inosine-5'-monophosphate dehydrogenase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
377
structure length
301
Chain Sequence
b'TKNIGKGLTFEDILLVPNYSEVLPREVSLETKLTKNVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKNMDMESQVNEVLKVKNWIAYSNENLDNKGRLRVGAAIGVNIERAKLLVEAGVDVIVLDSAHGHSLNIIRTLKEIKSKMNIDVIVGNVVTEEATKELIENGADGIKVGIIVAGVGVPQITAIEKCSSVASKFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKELIGDTVYKYRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKKSSYVEITTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5-monophosphate dehydrogenase
publication title The structural basis of Cryptosporidium -specific IMP dehydrogenase inhibitor selectivity
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Oxidoreductase
total genus 82
structure length 301
sequence length 377
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ffsA00
5CSRA 2BXVA 1FDJA 3TSBA 2GVLA 1TPH1 4MZ8A 3TC7A 4DXVA 3T40A 4DF0A 2CLFA 1VGAA 1VRDA 3KRSA 2FJKA 1H7NA 2QJIA 4N4QA 3F03K 2JKEA 4Z08A 3W86A 3FA5A 5G1YA 2QR6A 1N8FA 3MI3A 4UFMA 2Y89A 3MHFA 2QCGA 2YGYA 3C3NA 1ZFJA 3G1AA 4Y8FA 3FYPA 5DLCA 3UWYA 1YXCA 3S1UA 4NVTA 1Z48A 3LHTA 4WUIA 3W1LA 4LVBA 1I2OA 3W23A 3OVQA 5EKYA 4I9AA 2Z6IA 4JGDA 3G1VA 4RK8A 4RKAA 3UPWA 3DH7A 4GUJA 3TK7A 5C5YA 4BWLC 5F2GA 2P0OA 1C8VA 3EXRA 3EXTA 3NL2A 4GNJA 1G7VA 3P80A 5DXYA 1S5WA 1IXOA 2Z0IA 4GBUA 3RNDA 2NXGA 2RHGA 3AO0A 3O63A 1KTCA 5D2TA 1PV8A 1PCKA 1KLZA 4JX4A 1NF0A 4DF1A 3NPVA 4RXGA 5HQEA 3LRKA 4HSNA 4RV8A 4WQ6A 1KTNA 1JCMP 3OBKA 3C8FA 2P10A 3TJLA 4JR5A 1AMKA 3G8RA 1OK4A 4LTSA 3NVTA 1R2TA 2ZRZA 1G4EA 3TQ0A 4LVDA 3UQNA 2FB2A 1EUAA 1OFEA 3S1WA 4FB7A 3I6RA 3M5YA 2ZDRA 4FXSA 4JY8A 3KHJA 1H7PA 3K30A 3LX9A 3GDMA 3ANYA 2VC6A 2E1DA 3W7IA 3M5XA 1QNVA 1T8XA 3VNDA 1OG0A 1AK5A 3NEVA 3NPUA 2J6XA 1KBJA 4M6QA 4QIUA 4AHPA 3W72A 3DKJA 3W1RA 1JR1A 4R53A 2E6YA 4JTUA 2WSQA 4IPJA 1NFBA 1TPWA 1OHLA 4AEOA 4O28A 4PL2A 2QCMA 4UTMA 3CTLA 1UCWA 3E96A 3O07A 3TV8A 2A2IA 4U4MA 2ISWA 3IIZA 4HHPA 2QCEA 4UIOA 5G2IA 5CZSA 1LTDA 2FQIA 3P60A 3KFTA 4XKYA 4N6EA 4K6AA 4UCGA 3G1SA 3PBVA 3T4CA 3HG4A 1NEYA 2CFFA 2ZTJA 1TPVA 2ZCGA 4LUIA 1AL8A 1Z44A 2C13A 4E2BA 4GUHA 3G24A 4RZ4A 3W7PA 4CQ9A 3CB8A 4MY9A 3TH6A 3VFLA 4X2RA 4AF0B 5LHEA 3W88A 4NZFA 3PB0A 1K02A 3E02A 4TIMA 1JRCA 3HIJA 3ATYA 3HOJA 1YTEA 1F5ZA 3QJAA 3DGRA 4UFIA 3U2OA 5AC8A 3CHVA 5AHNA 1Q6LA 4CCDA 2ZRVA 3S6DA 1G4PA 3MHGA 4J9JA 1GG1A 3GZ3A 3HJZA 3W71A 5I3KA 1EPXA 3BPWA 1P4CA 1JCYA 4UXDA 1PE1A 1QOQA 3M43A 1LBMA 1MEHA 1WAUA 3E9AA 1WOAA 5BOOA 5EL1A 1FCQA 4QITA 2OCZA 5A8GA 1I4NA 1N55A 1DQWA 4O1DA 2VEMA 4QJ1A 3FJ6A 4JTEA 2WOQA 3SIZA 1DVJA 5KINA 3NQ7A 1UJPA 5FEXA 3UD6A 1LCOA 4AMAA 2BLEA 4AWSA 3DFQA 1D3GA 4NNAA 2A7RA 3MBFA 2EKCA 4PEKA 3DFPA 1W3TA 3RF9A 2GUUA 1LLWA 1O95A 3IIXA 5K7JA 2E68A 4R33A 4HNNA 1FWSA 3W3OA 5BW6A 3HG5A 3LBCA 1QR7A 2CZEA 1TTIA 4M7TA 2TMDA 4DPQA 2X1RA 3F1QA 8TIMA 3QZEA 3W1AA 5AFDA 1OYBA 4N6FA 4DBEA 3W87A 4OWGA 3M6YA 5HJLA 1L2UA 3GNDA 1L6YA 3HGJA 3W1TA 1EB3A 4DEFA 4O18A 4LV9A 3C56A 1GPWA 3DFNA 4QQ3A 1KM0A 2CLOA 4UR7A 4PTNA 3IIPA 1XBYA 5D32A 1LORA 2QAFA 4ZVJA 2C6QA 3FKKA 1ML1A 2YSWA 1FXPA 1QWGA 1H5YA 4DBDA 3TMQA 4KFOA 2YCEA 4H4IA 4KFNA 1IIHA 1F7BA 3WJYA 3LCWA 2VENA 4UTTC 3SY5A 3W1PA 3M44A 3MBDA 1TPDA 2JKPA 3WK3A 4QSHA 2E5CA 1RV8A 3LV5A 1KM6A 4UMCA 3N9RA 5IBXC 3CPRA 3CIXA 1DV7A 2XFWA 1CI1A 2Y7EA 3I65A 1UUMA 4HKPA 3MP5A 2VEPA 4CNPA 5AHMA 4CQAA 1VHNA 3MYPA 3LBMA 1ME9A 5LKYA 4LVFA 1Q3NA 1SW3A 4WD0A 4XTDA 1W3NA 3GKFA 4UTIA 1A50A 3LCIA 3QFEA 4XTIA 4ZQMA 1TV7A 2AGKA 4Z1DA 3EX2A 4UTUA 1KFBA 3H55A 2NXIA 3QQ1A 5HNRA 5TIMA 3M1ZA 5HULA 5F4SA 1F2JA 1FCBA 2DORA 2ZA3A 4JX5A 4ZL1A 4Z0JA 1ME8A 1KM5A 1KFLA 2H6RA 3PAJA 4P61A 3W7OA 4Q33A 4OBTA 3NQFA 4JD4A 5D09A 3GAKA 5AHFA 3KRUA 1GVQA 1HUVA 4EF9A 2OT1A 4MIMA 5F2MA 4TX9A 3STFA 1GVOA 4TR9A 1YDNA 4WZHA 2DZSA 3NGJA 5G1TA 3PBWA 1OFAA 2OMAA 3ELFA 3JRKA 2ATMA 4PA8A 2WNNA 3G1YA 3W74A 4K8EA 3L65A 1ZENA 5DCBA 4FXRA 3CT7A 3S0CA 3P7YA 3P74A 3DFOA 2A7NA 3L66A 1SR9A 3I7QA 3FYOA 1F73A 3PUDA 1XKYA 5A5WA 5U7SA 1I45A 2GQAA 3B4UA 2ZZ7A 3S1VA 3THAA 3W83A 1WOBA 1XFBA 4BK9A 4YCOA 4NT0A 2OX1A 2C0AA 1FCVA 2G96A 2H8XA 3UZ5A 2A7PA 7TIMA 1QFEA 2C3ZA 2HS6A 2QCHA 3D0CA 3S5OA 1S5TA 3NQMA 4B5NA 1SZEA 1S5VA 5AOUA 3T44A 2FTPA 3R2GA 2TPSA 1CX9A 4O16A 2LLEA 3TX9A 1ZY9A 3T78A 3P8JA 4HNTA 3TIMA 4ONVA 4ORMA 2EF9A 4LNYA 1K7EA 1W8SA 3C0JA 1I2RA 1JQXA 4E38A 5G4WA 3A22A 1FBAA 2YW4A 1LBLA 4GUFA 2PE4A 4NJJA 1QPQA 1W56A 3MUXA 4LY8A 5D2XA 3NA8A 3JS3A 3WK1A 3WJZA 2V81A 1ZAHA 3E12A 4A2RA 1B9BA 4HPXA 3VI2A 3S42A 2NWRA 1R30A 3DU0A 4FO4A 2FIQA 3NO5A 3EWBX 4ZQCA 4RXFA 3IV3A 4UC5A 4I7UA 3DXIA 5F2LA 3EWWA 3QM3A 3R89A 4WXZA 1BEUA 3N3MA 1DBTA 2ISVA 4IGHA 4CNOA 2UV8G 1HL2A 4QAIA 3R13A 4NJKA 3W9ZA 3OHIA 2CLIA 2NV1A 3DAQA 3B0VC 3O05A 1X7FA 4LC6A 3LXAA 3QW3A 2NZLA 2BTMA 1TMHA 2YDAA 3OA3A 4JYDA 2FPYA 2X30A 4LWWA 3ZWTA 3DFSA 1XXXA 1XDMA 1S3HA 1FWRA 2ZQ0A 4AHOA 5KMYA 5BMXA 2OJPA 4PL1A 1TV5A 1ZCOA 1B3OA 3HPZA 3NAVA 2ZZ3A 1SFLA 1V5XA 3W70A 4GUGA 3KX6A 3PB2A 4NNBA 5L6UA 3IEBA 3B05A 1QO5A 3CLMA 4BI6A 1J4EA 3O06A 1RPXA 4OV4A 1H7XA 5I3GA 2V2DA 2HMCA 2JGYA 3NQ6A 2CLEA 5I3IA 2B7OA 3ZR4A 2C15A 5LNVA 2EPHA 5H91A 2Q3OA 4GUIA 4MOZA 3TW7A 1FDYA 1FY6A 1FWNA 1ZALA 2WNQA 2Y7GA 4O8RA 3IGUA 4XZ9A 1RD5A 5F1VA 1OF6A 5E93A 3DI1A 3BW4A 2VFDA 1L9WA 1H1ZA 3MWAA 4FNQA 2HTMA 2QAPA 1MSSA 1TJRA 4H3DA 5EMUA 1KFKA 4QNWA 1GYNA 2VOMA 1LZOA 1EEPA 3ABOA 4PODA 3S9YA 2R91A 2V2CA 2E09A 4K8HA 3W7CA 2NUWA 1OFPA 3TA6A 4JTLA 1W5OA 2VKZG 3PULA 1WV2A 2WNZA 4JTGA 3OG3A 1OX5A 5E0KA 4HIBA 5AHLA 1DJNA 4JIQA 2Q3RA 2PCQA 1GTEA 1NVMA 3P81A 2H3DA 4JTHA 2E6AA 1KM1A 3R12A 4UFJA 2P1FA 2YZRA 3HGOA 2FLIA 4HPJA 4A29A 4R7JA 1ZJIA 1VYRA 4CNNA 4OE7A 3TE9A 3I68A 1M7OA 3LCGA 3W7MA 1WBJA 3G18A 1YDVA 2Y88A 3GDKA 5EA9A 2H3BA 1T0OA 3FFSA 4PH6A 1OFQA 2AQWA 2E5DA 3KVJA 2OZ0A 2VFHA 1JUEA 3M16A 4OHQA 1OJXA 5AC6A 3W7RA 1IXQA 4IUOA 3TR2A 1IF2A 2IQTA 1P0KA 4TMBA 5K9XA 3PG9A 3QW4B 4QNEA 2ZZ6A 2ZBTA 4Z1BA 4P2VA 2QEZA 1K8YA 1H7OA 3OVPA 2DZWA 5DCEA 2J9XA 2AAMA 3QH2A 1LP6A 2YXGA 5DY2A 4K39A 4FX6M 4I7WA 1GT8A 5ABTA 1A5SA 2RDUA 4Y90A 3SGZA 3W2MA 3HG2A 1IGSA 5D04C 2WPBA 1G4SA 4KFPA 3W1XA 2NUYA 1Q6OA 4LT9A 3W7DA 3GAYA 1M7PA 3O6CA 3P84A 5TBOA 3LHYA 4JYEA 5HWJA 4EF8A 1A5AA 3L5MA 5J5RA 1XM3A 3LTPA 4O52A 3STCA 1OYAA 2WV8A 6TIMA 2VFGA 1YADA 2WJZA 2GJLA 1VJIA 4GFSA 2Y61A 3W2KA 5I3FA 1O94A 4NU7A 1TPUA 3WJSA 4IX0A 2ZRWA 5FF0A 4A22A 1B4KA 3HO8A 3AJXA 1N7KA 2J9ZA 4L4MA 3GXNA 1W0MA 2JBMA 5HR6A 5FF7A 3TSMA 4HNVA 1OX4B 4U28A 1BTMA 4XQ6A 5F4XA 3GVGA 1L6SA 1Q45A 2I9EA 3BVJA 2R8WA 4ML9A 1SZGA 2FDSA 1TREA 1YLVA 5K2ZA 3V1PA 2ZZ1A 4O12A 3LB0A 4NXSA 4RX0A 1I2QA 3U8GA 3UPBA 3HBLA 1XBZA 3IVUA 1VHCA 5K9CA 1HO4A 2DZUA 4LVGA 2QCFA 1W37A 4HT3A 4E2DA 4OU1A 3CEPA 4EVZA 1ZNNA 2QUUA 2GQ9A 3B8DA 4XWUA 4IXXA 3UY8A 2NWSA 4UTLA 4IJBA 3FEMA 3Q37A 4S2CA 2Y6ZA 3HMJG 3B0UX 1TPEA 3SI9A 4HN4A 1EIXA 1YDOA 3W85A 3TROA 1PL9A 1VCFA 3TMLA 2Y7DA 5CSSA 1VR6A 4PCFA 2J88A 3A5VA 5EPDA 3FJLA 1E51A 3BK0A 3BV4A 5MHBA 3PY2A 2E6DA 4M6PA 1O5KA 1TCDA 1SQ7A 1YTDA 1UB3A 4JTTA 3KRZA 3W2JA 2H8ZA 2NX1A 3NR0A 4GE8A 5K9DA 3OIXA 1F76A 3N2XA 3P61A 1D3HA 4CQ8A 3KVLA 3NXFA 3CC1A 3HB9A 4DQWA 4JNMA 3LM7A 1LLZA 3TU9A 2V8ZA 2ZA1A 1GVFA 3UWZA 1H63A 4O1CA 2BWGA 5HUOA 4WY0B 3LV6A 2ZYFA 1K7FA 2HS8A 4MZ1A 1OFBA 4WY0F 1TTQA 2CZFA 4TU1A 5CZJA 3NQEA 3GR8A 3S5NA 4N2YA 4TO8A 3THQA 3L0GA 3TXVA 2WSYA 1TO3A 4UFHA 3NQAA 5KZDA 3C2VA 2EHHA 2DZTA 4PC8A 2RFGA 3G0SA 3LRMA 4K38A 3LXCA 4LS1A 4N9CA 4NQ1A 3TFCA 4ZQPA 1JCNA 3LHVA 3Q94A 3W76A 4DO5A 1VQTA 4O53A 3HG3A 3KAOA 2PRMA 2QF7A 3W7QA 1LRTA 1H51A 5I3JA 2NUXA 3NQGA 1TIMA 1FXQA 2C18A 1SO3A 2PRHA 3UY7A 2Q8LA 2ABBA 4JS3A 1UUOA 3G1DA 2C16A 5LNRA 3A21A 2E5BA 2VFEA 3B03A 4NJHA 1GQNA 4QISA 1EWEA 3BO9A 2DZVA 2R94A 1TSIA 1ONRA 3LHUA 3USBA 2QCDB 1GZGA 3LDVA 4UTWA 3KXQA 2ZRUA 2O7SA 3LHWA 2JGQA 2BZNA 4IMGA 3LLFA 4FEZA 1YXDA 3NQCA 4ADUA 3C52A 3I7SA 1LRNA 5AC7A 1SFJA 3G8EA 5LHFA 4I7VA 1QDSA 5G2HA 3SZ8A 3W7GA 4JTKA 1ME7A 4ADSA 5HWMA 1G4TA 2QJGA 2ZZ5A 5K3VA 1W5NA 4EIVA 3EX4A 1R46A 2X2GA 3GXPA 3P67A 1K8ZA 3NL3A 2V0TA 3W1QA 3QMSA 4UFLA 5AYZA 5H2ZA 4IX2A 4WOZA 4M5PA 3ZWSA 4IOTA 3ABQA 3BLEA 2RH9A 5I3HA 3VE7A 1QPNA 4LS0A 5BNKA 1FX6A 5IM51 1RVGA 2FPVA 3LCFA 3W84A 4EOUA 3EWZA 4DF2A 4FX8A 3H53A 1GEQA 3IVTA 3O1NA 3PF3A 3P8IA 4UTHA 5KZEA 5FF2A 5DN1A 1MEWA 4G1KA 3R5EA 3L0KA 3GDTA 1Z41A 4GXMA 4KWWA 3EKLA 4XUGA 2G95A 3ZFHA 1LRQA 3UWUA 3TQVA 1MEIA 2PRLA 2YFNA 1P1XA 3OEXA 4XBKA 2PC4A 4DO4A 1DKWA 3TXZA 3VKJA 5HWNA 1YXYA 2WKJA 5C55A 2YW3A 2NLIA 1A53A 1MO0A 3EX1A 4IWWA 3MJYA 1SZNA 3NQ2A 1HTIA 3TJXA 3S1XA 5EBUA 2E77A 2CWNA 1JUKA 4UTKA 1JCLA 1VCVA 3EXSA 2F7FA 2CW6A 4S2BA 4GJ1A 3IGXA 5AN7A 3LI0A 1P0NA 4ZQRA 3UWVA 3W75A 3PR2A 1M5WA 1SW0A 5FEPA 3MW7A 1EP2A 3NM3A 1B57A 1SO4A 3R8RA 3KOFA 4ZMGA 4NUWA 4Q4KA 1J5TA 3A5FA 3N9SA 5CZ0A 2YX0A 3PVFA 6ALDA 3WK0A 1D9EA 1PVNA 2ABAA 2F84A 1H62A 3BG5A 4AB4A 3TCEA 1TJPA 2Y62A 3HF3A 2VFIA 4MY8A 3UNDA 1EUNA 3BG3A 1YPIA 4N9BA 1VZWA 2NV2A 4X3ZA 4QM1A 2V82A 1O4UA 4K7VA 2WSRA 3MHUA 4LV4A 1GG0A 5TQLA 1DORA 1R2RA 1H1YA 3ABRA 5DXXA 3M9YA 4O4WA 1ZAIA 5AHEA 2QDGA 2Z2UA 1KA9F 3GLCA 1T99A 1DOSA 5DELA 1EWDA 1TPC1 1SZFA 2CLKA 3NL6A 3FOKA 2W79A 4L4LA 4A21A 1JQVA 1HG3A 1K8XA 1MXSA 1KM3A 2VELA 3NQVA 3LHZA 2RDWA 4O13A 4M6VA 1UASA 3PM6A 4ZQNA 5G5IA 3MO7A 4Z0SA 3EX6A 2JK2A 5KTLA 1TRDA 1THFD 3LERA 3TC6A 4YLWA 1QPOA 4N9EA 1BWLA 3EKZA 5C6MA 3DENA 1WDWA 1F05A 1TQXA 3V75A 3UZJA 4JTSA 3NDOA 4D2JA 3NM1A 3C61A 2GQ8A 3NL5A 3W2UA 5CPLA 1JCJA 4MPQA 3T7VA 4A2SA 3Q58A 4LRTA 3QF0A 4RCXA 1JRBA 4FF7A 3C4UA 3TW6A 1WX0A 5CZTA 1QCWA 2V2HA 1PS9A 2FFCA 3RK8A 1GTHA 5DBTA 5U4NA 3S5ZA 4JTFA 1NSJA 1OFRA 4YL2A 4HSOA 3M41A 3SFKA 1TPB1 4NZJA 1H60A 3O6DA 3P62A 5LNWA 1NF7A 1W5QA 3CU2A 4IQLA 2DZXA 4XBSA 3EWUA 5DCDA 2GVJA 3C2EA 2EAWA 4JN6A 3WK2A 1VLIA 3S8HA 4MLRA 5L9FA 5HINA 1ZHAA 1XUUA 3W2NA 2QDHA 1X8FA 3DHFA 1VPXA 2NX3A 1OX4A 1FQ0A 5LZLA 2YR1A 1Q6QA 3TKFA 4KKXA 1F6KA 2ISSA 1JUBA 4JDBA 1VYPX 3STGA 4UFKA 1H50A 5FEZA 1XI3A 3RU6A 4O14A 4WXYA 4AWTA 1W5MA 3P5ZA 1UBSA 5LNSA 2QKFA 2G97A 3CEUA 2XN2A 3P82A 3LGEA 5E1QA 4JDYA 1ICQA 1T96A 3PBYA 5G4EA 3QSTA 2RDTA 5CG7A 4O11A 4AF0A 4RR4A 1XCFA 2CLLA 1SW7A 2GPTA 1R47A 5D2YA 3L9CA 4NJGA 4OGZA 1WXJA 4CLMA 3INPA 3C2FA 4DPPA 5J5DA 5HUPA 5T26A 3QSRA 5D2VA 3NPWA 3TAOA 2X1TA 1KV5A 3G1HA 3TSDA 2W0UA 4JTIA 3EWXA 4NJIA 3MP4A 4UR8A 2CLHA 1H7RA 3GNNA 5DBUA 5EY5A 5KSWA 2B0MA 3SSJA 4Z1AA 4BF9A 4EWND 1K3UA 4FNRA 3STEA 3HGSA 4H6KA 4K7YA 1OK6A 5CPOA 2Y85A 4A3UA 3B06A 4Q32A 3CQ0A 3UWWA 4KWVA 1AG1O 3GDLA 1IIGA 2ALDA 4BI7A 1W1ZA 2VEKA 4BR1A 4MJZA 1KLYA 3LTYA 4NX0A 4AVFA 4X9SA 2W6RA 1SU5A 3G3DA 5G2WA 2CZ5A 3HPSA 1W3IA 3A24A 3L68A 2V5BA 5LGXA 5KITA 1YYAA 2FB3A 1GYLA 1WA3A 4WY0A 5EYWA 2A0NA 1PIIA 3PS7A 1X1OA 3G3MA 1WYIA 5BRBA 1JVNA 2EGZA 3BW3A 1G7UA 2B7PA 3QQ0A 4DELA 1OVDA 3ATZA 3C6CA 1XDLA 3ZS4A 4N02A 3VCRA 4X22A 3RLUA 1TB3A 2GJNA 3NPXA 1Z42A 5CPNA 1F74A 3E0IA 1R2SA 3VE9A 1W54A 3GK0A 1RQEA 3LCHA 4GC4A 4O1AA 2DP3A 1OX6A 1GVSA 3C2OA 4IXHA 5SWUA 1ADOA 3CIWA 3CWOX 1JULA 2DJXA 2TSYA 3WFAA 1XC4A 2ZRYA 5FEWA 3DI0A 5CPMA 3W7LA 2V5LA 3IIOA 3QRHA 3SECA 1FUYA 3TAKA 1H61A 1JCXA 4MZYA 3BARA 1QO2A 1BWKA 3LTSA 4MKNA 1HFBA 4MUZA 3QPZA 3PUOA 3WJWA 1RQHA 1SPQA 3UWQA 3BW2A 4Y9AA 5C54A 3FS2A 1VYSX 1XBVA 2QCDA 1H7WA 3C2RA 4UTJA 4LW7A 3G1FA 2ZRXA 3GXTA 3HQ1A 4BWLA 4N9DA 4FIQA 4O1BA 3JR2A 3N73A 4UTWC 4O15A 3A9IA 4O57A 4OT7A 4UMBA 3QYQA 4Y96A 2YYTA 4MFDA 4IMEA 1LM1A 2CLMA 1C29A 1LOQA 1LBFA 2C19A 3MI6A 2VFFA 1QAPA 4M19A 4LUJA 1I8JA 1W31A 2B4GA 2DZPA 2TYSA 3M7WA 4LS2A 4MFEA 1IXNA 2V9DA 3YPIA 5D02A 1KFEA 2C1HA 2DU2A 5AYYA 1KFJA 4AHQA 4YWIA 4O54A 1M6JA 2A6NA 3Q2DA 4E0CA 1C9DA 4IPIA 4AWUA 3W7EA 3M0ZA 2I1OA 1XUZA 5LNUA 3IRDA 3GKAA 3M47A 1KV8A 3W7NA 3NZRA 4MY1A 4W9TA 3MMTA 1OYCA 1TTJA 3PSVA 2A1YA 3UXAA 3FKRA 2X16A 3IVSA 2ZFAA 3F4NA 2XN1A 3BLIA 3SJ3A 1L6WA 2D73A 1Y0EA 1EP1A 2Y63A 4LVAA 1WBHA 3DBPA 2V30A 3F4WA 4O19A 5FI8A 2QJHA 2QUTA 3E49A 3TUUA 3O6YX 2CU0A 2X1SA 1YTKA 2J9YA 2I14A 4OQVA 5F1UA 2YPIA 4XKYB 5C2XA 1Q6RA 4JY9A 4O10A 2TRSA 3EWYA 4JX6A 1MZHA 4JIPA 3UYCA 3PC0A 2GVGA 5BMWA 1AW2A 3EX3A 1XL9A 5D38A 1GVRA 3CWNA 2H90A 4JTJA 4ZQOA 4DO6A 1YPFA 1NAL1 1O5XA 2G5WA 3B04A 4PFMA 3A23A 3TQKA 1EA0A 1KFCA 1KM2A 3P5YA 3PBUA 4YMZA 1SUXA 4JICA 1J2WA 1G67A 3N19B 1PHWA 4TMCA 3L0NA 3LOTA 1G6CA 2Z1BA 5F2IA 1VLWA 4AAJA 3DHDA 1TYGA 1KM4A 1OFOA 2DJLA 3QEZA 3RLVA 1SSDA 3RMJA 2A4AA 3O8AA 4M7SA 3NNTA 1VCGA 4WJEA 5KZMA 1X1ZA 3MYOA 3W73A 2WO5A 1FWWA 3W1MA 2BX7A 1LOSA 4JEQA 4LU0A 3I7RA 2FPTA 2B7NA 2B7QA 3W1UA 3NG3A 1OABA 3G1XA 5K4XA 4AXKA 5D37A 1FCUA 1V7YA 2A5HA 3PSWA 1JJKA 4RJEA 1K03A 4YCPA 4LOCA 3QC3A 4BFAA 1ZAJA 1HO1A 3WJXA 3DZ1A 3NYZA 2YYUA 1FWTA 2YFOA 4JXCA 1LYXA 1KW1A 3N14A 1RR2A 4RZ6A 1GWJA 1P5BA 3RFAA 1ICPA 1TTPA 3GR7A 1TPFA 4MYAA 2HSAA 5CGQA 3MI2A 4K36A 3L21A 4WX2A 4UMAA 3G0UA 5D33A 3LLDA 2VEIA 4MVAA 1DJQA 3HPXA 3LXBA 4O4VA 3TNOA 3O16A 1VC4A 3QMTA 4FX7A 3M5VA 4RLIA 2XN0A 4NX5A 4O0KA 2QCLA 3LCXA 4UUIA 3HGRA 4O50A 4LC8A 1TQJA 1VS1A 3BGJA 3MP3A 4NNCA 3FIGA 2A21A 1AW1A 3W6YA 3GYEA 1DL3A 2A85A 3GX9A 1SSGA 3L5AA 4Y6GA 4OV9A 1GJPA 4K37A 3M5ZA 5D2WA 3W22A 3H54A 4AH7A 3O15A 2VXNA 4Z1CA 4ALDA 4UTTA 4IMDA 5HR7A 2PURA 1A5BA 4O17A 2ZTKA 2ZZ4A 4MJMA 4C1LA 1TRIA 4UNKA 5LGZA 1O60A 5IBXA 3IGSA 2CZDA 3DKLA 3L67A 3N34A 5K4ZA 1U83A 1SO5A 1DQXA 3BG9A 4O0ZA 4ZZ9A 4FNPA 4IMCA 5LSMA 3NQDA 4ADTA 3TFXA 3LCLA 4FIRA 4ORIA 5CKSA 3W7KA 2GOUA 1KBIA 2NX9A 5F4WA 2KZHA 1QOPA 3QMRA 3QPYA 3G22A 4UNLA 1PHQA 5AB3A 4S1FA 3N2MA 3DFTA 1FDZA 3IIVA 1QMLA 4FNUA 3TDFA 3LRLA 3EEGA 3UXDA 3GIYA 4BI5A 1QPRA 4RZ5A 3W2LA 3L5LA 5FF4A 3T55A 1SO6A 2WQPA 2BSLA 4FNSA 3SW6A 5D05A 3BGGA 2J27A 2Z6JA 4NXKA 2JKAA 2C14A 3W1NA 1EP3A 3W7JA 1ALDA 3EB2A 3KVMA 2NXHA 2O7QA 3PWAA 5HMSA 2E6FA 1LOLA 1G69A 1K7XA 5DY3A 1IXPA 1LDCA 4R34A 2QCCA 5D30A 4FNTA 3FLUA 1RZMA 3PG8A 1OFDA 3G0XA 5AYXA 1DHPA 4CCEA 2ZA2A 4GRSA 3LI1A 2RKXA 2OT0A 3U6WA 4YXGA 4MYXA 3SGUA 4IMFA 4WOQA 1ICSA 1EX5A 5FF3A 2QCNA 5D03A 2R14A 1LROA 3S5YA 4N4PA 4C1KA 1RQBA 1XBXA 1I2NA 1B4EA 5GVJA 2A6LA 3GB6A 1X6UA 3B0PA 4JYFA 1CW2A 2X1UA 3BLFA 2J24A 4CCCA 1U5JA 4HNUA 2ATSA 3KVKA 5AHIA 3PUEA 1KTBA 1VH7A 3W07A 3CM4A 2Y7FA 3GDRA 3NZ1A 3W7HA 1OF8A 1WQ5A 1I2PA 1AL7A 5FESA 3ABSA 4MLJA 3OVRA 2Q8ZA 1BKSA 1AW5A 4LRSA 1TV8A 1GOXA 2Y70A 1F6PA 4GWEA 3L2IA 2QUVA 4FHAA 1PCWA 3SR7A 4POCA 3NOEA 3NQ8A 4ICNA 1W5PA 1A5CA 2ZZ2A
chains in the Genus database with same CATH superfamily
5CSRA 3SQSA 1WUEA 3TSBA 1TPH1 4MZ8A 3M0VA 2QJMA 4BA0A 3K1GA 4EK7A 3HM7A 2XJ7A 2GJXB 3KRSA 1BKHA 3TZFA 2DPEA 1CWYA 5A95A 3CYJA 1E6QM 4Z08A 3FA5A 3MI3A 3O9NA 1TWSA 3L4TA 4G6CA 5DLCA 2PDCA 2BNJA 1R0MA 2W92A 4WLCA 3W23A 1PKMA 1J0ZA 4CQDA 1CENA 2BG5A 3VMPA 4GABA 4RK8A 3GQYA 1PX8A 2G3FA 4MPKA 1B0IA 3G77A 3TK7A 5C5YA 2E3ZA 3IK2A 4DYKA 2P0OA 1BG9A 3EXTA 3R6IA 1PX4A 4BQ4A 3VDAA 1W32A 1W3HA 4GNJA 2VWTA 2VJXA 1AH0A 2Z0IA 2NXGA 1KTCA 1PCKA 4IICA 1NF0A 3KBSA 3GTIA 1WPCA 2OO0A 1XIDA 5HQEA 4JCLA 3CAKA 1E9IA 3H26A 4WQ6A 4KEVA 3A13A 3NVTA 3ORWA 2ZRZA 3UR8A 2CHRA 3GXFA 2WHKA 1EUAA 5LIKX 3I6RA 3M5YA 3KHJA 2VX4A 1H7PA 4EANA 3CL8A 5E70A 3OHMB 4GI9A 2YXXA 2F38A 2VC6A 2E1DA 3E74A 3M5XA 1KXVA 4QLLA 3VNDA 1AK5A 1ITUA 3WLIA 4AHPA 1D3CA 1JR1A 2KAUC 4Q4RA 1J0YA 5FA5A 1NFBA 3UXKA 3R11A 1KNWA 4IFKB 3VX1A 3W37A 1UCWA 2A79A 3TV8A 4LSBA 3IIZA 4J3ZA 2QCEA 2Q02A 3UJRA 1PKNA 3P60A 2IW0A 3AIVA 3HMCA 1T6MA 3POCA 4RZBA 3PBVA 1P0EA 1XYLA 1TPVA 3AYVA 3HV8A 3AMLA 1TKKA 4LUIA 4F4RA 1VAHA 2C13A 3WQ8A 3G24A 4RZ4A 1JAKA 1SZRA 2ALRA 1UWSA 7REQB 1PJ9A 5LHEA 4PN2A 1RUSA 4W86A 3ARSA 4ZO7A 1G1YA 4AY1A 4UFIA 2OZ3A 4GYPC 3GD6A 5HXMA 4DNHA 2YCJA 5ENLA 2ZRVA 3S6DA 4NRSA 4GVHA 1NP2A 3AIBA 1UD5A 3MHGA 2BGSA 1R3TA 3HJZA 2V69A 1GW9A 2VMFA 5I3KA 3W71A 4WGHA 1P4CA 1TG7A 4MKVA 1H2JA 1KCXA 1RCXB 1LBMA 1WOAA 5EL1A 4QITA 5A8GA 3KCOA 3LZ3A 4MB4A 2VEMA 3FJ6A 4JTEA 4E6MA 4DJFA 3T08A 1DVJA 3NQ7A 1UJPA 3CV6A 2GJPA 4WK9A 2PWFA 2A7RA 3MBFA 3EWDA 4XZWA 1W3TA 2GUUA 3IIXA 4XD5A 2E68A 4R33A 3AHZA 4I9JA 1FWSA 1JPHA 3W3OA 1W3KA 2D1ZA 1SGJA 1DJHA 2XTKA 1HJWA 1GJWA 4C7DA 2YKKA 4DVOA 1ZU8A 4DPQA 3LMYA 3MSGA 4BHYA 1EX1A 5PTDA 3BAIA 1A4MA 1HKVA 5HJLA 1AJZA 1OM0A 3RYSA 3FAWA 5XINA 1SM9A 3CPUA 4EACA 3CQHA 1OIMA 2AAAA 1KM0A 3RMEA 3IIPA 3A9BA 2D2HA 1ELSA 4UQAA 1LORA 1C92A 1QI3A 2C6QA 5A2BA 3FKKA 1ML1A 5C9ZA 4AW7A 3W24A 2Z2BA 4KFOA 1CECA 4H4IA 2DW6A 4TXEA 1DEDA 1IIHA 3WJYA 4TTGA 3LCWA 3QV7A 3VNZA 2D0HA 3MBDA 2Z28A 3VZZA 1B90A 4EXQA 3R43A 3CPRA 3CIXA 4L4OA 5DF0A 2Y7EA 1UUMA 4HKPA 4WDXA 4F9DA 4CQAA 2EXOA 3LBMA 4M8UA 1Q3NA 3T2QA 4B4HA 1K70A 3FSUA 1U22A 1KFBA 3QQ1A 3W53A 1UKPA 4PUJA 1F2JA 1FCBA 4ZL1A 1ME8A 2VC7A 4Q33A 4P8XA 4OBTA 2W9MA 4OFCA 2PA6A 1GORA 2OT1A 4MIMA 1QW9A 3STFA 1WKYA 2C79A 1YDNA 4WZHA 5G1TA 3ICJA 3SRFA 3NZQA 2ATMA 5T9CE 3M07A 4K8EA 2BASA 4WVXA 1R7AA 1A3HA 1ISVA 3S0CA 3OOQA 3B0YA 3OLEA 3P74A 1BXNA 3DFOA 3L66A 1OCQA 3CL7A 3DIPA 1I45A 3S1VA 3THAA 3W83A 4F40A 4BK9A 2J79A 2H8XA 7TIMA 3TW9A 2QCHA 1EL3A 1PZ1A 3S5OA 3NQMA 4JHOA 4B5NA 1SZEA 2TPSA 5DEZA 4O16A 3UXIA 3WLPA 4HOXA 4F2UA 3VFCA 4ONVA 2EF9A 1K7EA 4D8LA 3BQ5A 3A22A 4Z2HA 1XRVA 3L4ZA 1LBLA 3NA8A 4ZO8A 2VP8A 2DY3A 3WJZA 4S3DA 1E5JA 4EWJA 4FO4A 1HGYA 2FIQA 2C1IA 2RJHA 1DJWA 4RXFA 1V0LA 3DXIA 1W9XA 5E09A 3R89A 4WXZA 1CGYA 5MKGA 3ZOAA 1BEUA 4M80A 1SFTA 4IGHA 2BVWA 3VGBA 1B3YA 2UV8G 1OY0A 1TA3B 3W9ZA 3K5XA 3OHIA 3DAQA 3OZMA 1XLMA 3CASA 3GNOA 3EMQA 4UQBA 2YDAA 3OA3A 4Y8EA 2FPYA 1G5AA 1SFSA 4Q8NA 4FXJA 4C60A 1XDMA 4AIBA 3SAZA 4IFRA 3B8UA 4AHOA 3H22A 2ZUWA 2G41A 1DYSA 4V1YA 2ACQA 1SVDA 4Y9PA 3NAVA 5T91A 3W70A 2UBPC 3REQB 1BXBA 4Z2LA 1QO5A 5HK4A 4C5YA 4D6FA 3O06A 4OV4A 1B2YA 2X40A 5I3GA 2V2DA 3RR1A 4KERA 1XINA 2BDQA 3NQ6A 2E8ZA 2B7OA 3E5BA 5JMUA 1QW7A 3TW7A 4DJFD 1WZKA 4G7EA 2PZ0A 2XH4A 1RY8A 3MSYA 1YKWA 4GA8A 4O1EA 2Z7GA 3GBEA 3VOJA 1L9WA 4DBWA 1RLDA 4XZLX 4NAFB 2QAPA 5HNTA 5ABEA 1TJRA 1CXEA 1KFKA 2XG9A 4HGXA 2IKHA 4W5ZA 3ABOA 5E6ZA 5HAOA 3N13A 1FWAC 3S9YA 2DGAA 2RAGA 1UR9A 4GKTA 2VM8A 8XIAA 2V2CA 4UQDA 3TA9A 2NUWA 4MB1A 1YIXA 2XIMA 1WV2A 2WNZA 3VZXA 3ZO9A 2E6AA 2P1FA 3HGOA 4A3QA 3D47A 1L8NA 1YE4A 4HPJA 4DIAA 1N8WA 2GFTA 1VYRA 4GY0A 4CN6A 4OE7A 3AOFA 4PR4A 3O0KA 1DXIA 1RBOB 4YTTA 4IJRA 3D46A 1I1XA 1IEQA 4HA3A 5HMDA 1T0OA 1Q5MA 4X2PA 2AKZA 3A47A 3IJ7A 4AC1X 1BG4A 2HK1A 4BQ2A 3TTEA 3IPWA 1ZTVA 2E5DA 2QS8A 1B54A 1FWEC 2A3AA 2OZ0A 2BB0A 2VFHA 3M16A 4N0RA 2V38A 1OJXA 2VRKA 1WP6A 3QN3A 5IHRA 1P0KA 2YJQA 1FWBC 1UH2A 5K9XA 3PG9A 4ZODA 2HWGA 4MHBA 4Y9NA 4P2VA 2QEZA 3OVPA 2DZWA 5EMLA 4I9TA 2J9XA 5FAJA 3QH2A 2YXGA 4K39A 4DAIA 1GT8A 4OECA 5JIWA 2DUAA 4EPDC 3R8HA 2WK2A 3SGZA 4L5ZA 3HG2A 1EHNA 3CZLA 5IRPA 1G94A 2J4GA 1KD0A 2DSWA 1M7PA 5EFFA 2J7GA 1T41A 3BSMA 2WCGA 1L0PA 3L5MA 1ODZA 1XM3A 6TIMA 1OYAA 1KKOA 2VFGA 1YADA 5I3FA 3WJSA 4A6GA 3TP4A 2Z24A 2XUCA 1B4KA 1XKJA 1VFLA 1W0MA 1UA7A 3ITTA 2V5JA 1ZUAX 2PDWA 4B5WA 2VC9A 1PO9A 5F4XA 3QOKA 1Q45A 2GWNA 2FDSA 4XIMA 3R94A 1Z32X 4L1WA 1R38A 4PCSA 3ZVIA 4RE4A 1R8LA 1XHGA 3QHNA 3PZQA 1XV8A 4MNMA 1XP3A 1ZNNA 3VK5A 2FKPA 2GQ9A 2OKTA 3UY8A 1A0DA 4IJBA 2FGBA 2XSBA 1X1NA 2NQ5A 3W4RA 3SI9A 4JFVA 3VOCA 1EIXA 1HVQA 3W85A 3UWEA 4JEJA 1VCFA 4GCXA 4D71A 1Q8JA 2ZWZA 4KW2A 4UB9A 1PTDA 3PNZA 1ZSXA 2WM1A 3UA4A 4UNIA 3DUGA 4M6PA 5GJPA 4H8HA 4LUYA 4GACA 2VD9A 4AUBA 3VMNA 1UB3A 4K2SA 3W2JA 4LALA 3DGBA 4NI8A 3CB3A 3ITLA 5AYBA 5K9DA 1TZ7A 3N2XA 1D3HA 3FHAA 3KVLA 3CC1A 3NXFA 2DZBA 3HB9A 3P0WA 1ZZMA 4GC3A 3TU9A 3WBYA 4NAEA 1GVFA 3UWZA 5AKQA 1UC4A 5HUOA 5DANA 1MFVA 4GH3A 4KCTA 3S5SA 2WNWA 4KQNA 2ZYFA 1K7FA 1OFBA 1TTQA 4TU1A 2W3ZA 4N2YA 3H23A 5CBBA 4V2XA 4YTSA 1HXJA 3LUTA 3TONA 3NQAA 3AICA 2XSXA 3LXCA 2YL5A 4NQ1A 4MADA 1JCNA 3LHVA 3Q94A 1MZRA 3KAOA 3TN3A 1PUDA 3QYSA 1OGGA 5I3JA 1LRTA 1JXJA 3BLPX 3HV9A 1OB0A 3GHUA 3UZXA 5A3HA 1FXQA 3II1A 1SO3A 1HJSA 1PB0A 2Q8LA 3MKVA 2ABBA 1RXOB 2C16A 4RDZA 5CGTA 4C6OA 3FK4A 2VFEA 2PWVA 4ACZA 3B03A 2IPGA 4NJHA 1GQNA 1QTWA 1CNVA 4A3HA 5B7ZA 4JN7A 3VKCA 4A8RA 2BZNA 4FOUA 1YXDA 4CD8A 4ECLA 1EA9C 2XFFA 4LB4A 4LYPA 3EOUA 3BJFA 3IJ8A 6ENLA 5G2HA 4JTKA 2ZZ5A 5K3VA 3UXLA 4EIVA 3SSZA 3I4EA 3GXPA 4D6HA 4W5UA 3LM3A 1JYXA 4UFLA 5AYZA 5H2ZA 2HK0A 4IX2A 4M5PA 2JF7A 3KBVA 1W1PA 1Y7VA 4LFYA 1HJUA 3ABQA 1FWGC 4LS0A 4HPGA 3ZVHA 3MDUA 3LCFA 3EWZA 3GFYA 1GEQA 3P8IA 4UTHA 2YIHA 1L6FA 3SBFA 2UY4A 5FF2A 5DN1A 1MEWA 5DMNA 1MNSA 4C7FA 1QBAA 2FDMA 2VYOA 5A8OA 3ZFHA 1LRQA 3EOOA 3UVAA 2YFNA 2Z1WA 3OEXA 3W00A 1CB2A 1XLCA 4XBKA 2PC4A 2X8RA 2FZDA 3VKJA 1RLCL 2WKJA 3QTPA 1W2PA 2YW3A 1A53A 3SADA 2PD5A 3EX1A 1PZ0A 1Z7AA 4IWWA 4UQCA 3AYTA 4JFWA 1ESWA 1KRCC 1PZ3A 3VU2A 2AMXA 1JUKA 3U0HA 2CCRA 1JCLA 1VCVA 2OO6A 1EXBA 4O8AA 4S2BA 3ARZA 2VZVA 1WXYA 1P0NA 2VL4A 4FALA 3W75A 3PR2A 2WMIA 1P7TB 1UR0A 4W8BA 2ZE0A 3BSGA 3PJWA 1SO4A 3KOFA 3RM9A 1J12A 4DZAA 3MDWA 4DI9A 2NW0A 5A2AA 1O66A 3PUGA 3A5FA 1GZJA 5FOOA 5CZ0A 2YX0A 3PVFA 4Q7IA 2GJXA 1D9EA 2F84A 3BAKA 3PFRA 3V0SA 3TCEA 4NL1A 3HF3A 1W1TA 1JIBA 1N2VA 1CB7B 3VKDA 2OG9A 2HJPA 1I0BA 3WBAA 4HHLA 3IV8A 3UERA 3B97A 4QM1A 1Q7QA 4XAZA 2WSRA 1ZBVA 1GG0A 4Y7EA 3TC3A 4F0SA 2OQHA 3M9YA 5CPTA 1OCJA 3WDIA 5HBFA 4PZVA 4AZ7A 4ZOBA 1DOSA 4P5UA 1HQTA 3NL6A 3KZSA 4B3ZA 1HG3A 3FGCA 2VELA 1ZCCA 2OWXA 2EPLX 3UPMA 2QUMA 3QC0A 2I5IA 3MO7A 2QT3A 3EX6A 5KTLA 1THFD 1V3LA 4N9EA 1V08A 3QY6A 1F05A 1TQXA 1O5QA 2V67A 2VQUA 2V3DA 4JTSA 3V16A 3NDOA 1IGWA 1XLAA 3ZT5A 3C61A 4IF2A 4AX7A 1JYVA 4URIA 5CPLA 1EIBA 3UU0A 2YOCA 4A2SA 3Q58A 1RA5A 1JRBA 4AY8A 3AYSA 3E0LA 1M7XA 1O1HA 3L4VA 1QI5A 1QCWA 4KRUA 4JAWA 3IJQA 2F2KA 2VCCA 1BQGA 2QYGA 4PE8A 4HSOA 3M41A 3SFKA 1GHSA 4MWAB 1VRXA 1H60A 3ENLA 5BRQA 2HQAA 1ZBWA 3E0FA 4EAMA 4IQLA 4XBSA 4CVWA 1E6RA 5DCDA 3MANA 3WK2A 3S8HA 4IFKA 5HINA 4JKLA 1ZHAA 2BGQA 1X8FA 4MGGA 3QHMA 2W66A 1QK2A 1OX4A 1BF6A 3B8TA 1R86A 1Q6QA 1J79A 4KKXA 4C6MA 3VD7A 2OLSA 1VYPX 2YDRA 3STGA 1UD3A 3EPMA 4AWTA 8CGTA 1UBSA 5BWAA 1E70M 4DUWA 3C5QA 4IZGA 2JIEA 3TTSA 3QSTA 4GZEA 2XDFA 3P6LA 5CG7A 7REQA 2GPTA 1UKSA 2EPOA 3LBOA 5REQB 2UZ9A 2X42A 3L9CA 4CLMA 1WXJA 3TYBA 4IISA 3AYRA 2E1WA 5ABHA 4DPPA 4IIHA 4XO7A 2V68A 2XYLA 1RA0A 2JF6A 1IZCA 4KBXA 3NWRA 4JTIA 2HV5A 3MCMA 5EY5A 2WZMA 4EWND 2VUYA 1K3UA 5FJPA 2WANA 4LUTB 1V51A 3HGSA 4H6KA 4K7YA 3VO0A 3B06A 4G7FA 1MDRA 3T2OA 4Q8TA 1IT7A 3UWWA 5FJRA 4JQ3A 1M3UA 4GVFA 4Q4MA 4L6DA 2O9PA 1IIGA 4YHGA 2BP1A 4GY1A 3LTYA 1I60A 1OQFA 1UP0A 4L7ZA 3CIVA 4MMWA 5DT5A 1J10A 3OLDA 1BTCA 5EYWA 3N4FA 2A0NA 4HP5A 5HQLA 4X60A 1PIIA 2POZA 1JVNA 2EGZA 1G7UA 4DELA 1Q2SA 3C6CA 5AY7A 1UD8A 3VCRA 1XSIA 2GUYA 1F74A 3E0IA 3KZPA 3L4UA 4MWAE 3GK0A 4GC4A 4IXHA 2BV9A 5SWUA 5C70A 2WWCA 2TSYA 1DJZA 1GVIA 2O9TA 3IAQA 5I5RA 2Y5SA 3IIOA 1E1CA 3WQVA 1FUYA 2J6VA 3TAKA 3VPLA 1HKJA 3LTSA 4RNFA 4QR6A 1CLVA 1RQHA 3UWQA 5C54A 2QCDA 1XX1A 4L61A 3GXTA 2INEA 4UOZA 3JR2A 2WC3A 3V5CA 1XLGA 4UTWC 4O15A 3A9IA 4OT7A 4HCDA 1XG3A 4MFDA 4QSFA 2J77A 4J3UA 3SCVA 2WW5A 1LM1A 2CLMA 3KTSA 4YYFA 5CBIA 3MI6A 3W01A 3A4JA 5M3WA 4DUXA 1EQCA 5A8QA 3M7WA 3H4XA 1IXNA 4AFYA 5C9RA 1A3WA 1KCZA 3KTXA 5AYYA 2DDXA 2E9MA 4A3YA 3S6OA 4HZ7A 4KEMA 2ZVRA 1J6OA 4DYEA 3FJNA 3QV6A 3VGDA 2I1OA 1K9EA 1WZMA 3GKAA 3M47A 3GXIA 3A3HA 4MY1A 2WVUA 1OYCA 3FKRA 1FHUA 2IKJA 4QRNA 3I3EA 2VTFA 2R82A 1ZQ5A 4LEFA 3TJ4A 2XSAA 3HQNA 3UJ2A 2DVUA 1L6WA 5D8WA 3V36A 2V5CA 1WBHA 6REQB 3WNPA 3AZTA 1FTXA 4LAZA 2CESA 4REQB 1YE6A 3H12A 3OW1A 4B5UA 1J11A 3FY1A 1LL6A 1YEYA 3CXOA 3O6YX 2CU0A 2F6KA 2X1SA 4D6CA 1YTKA 5F1UA 2I14A 2YPIA 4C1NB 5C2XA 3T8QA 4JY9A 2TRSA 3E1F1 4MJ4A 3AUOA 4J3TA 2BY2A 2GVGA 5BMWA 3VNKA 3G2GA 1GEHA 1NAL1 3WNMA 4PFMA 1EA0A 3H4WA 1SJCA 5JH1A 1K9FA 1J01A 4YMZA 1SUXA 5TD4A 1Q66A 1TELA 3LOTA 1G6CA 5F2IA 1VLWA 3CH0A 3DHDA 2DJLA 3CWHA 1EZWA 1GCYA 1SSDA 4M6UA 3WDRA 4J7RA 2A4AA 3COTA 1X1ZA 3MYOA 5HJYA 3W1MA 4GG9A 1D2KA 4PUMA 3WDJA 4WSJA 3NG3A 1OABA 1VB9A 1GPFA 4DWSA 2WLZA 5D37A 4TVCA 2VD8A 3CHDA 2A5HA 3PSWA 4IPNB 4YCPA 3ARWA 1V79A 3QC3A 4ZFMA 3OIHA 1ZAJA 1GKQA 2PU0A 2Z27A 3NYZA 5CBJA 5JIPA 4RZ6A 3WLSA 1ICPA 3MJMA 5DO8A 4B9ZA 4TVDA 1XD1A 1TPFA 4JFTA 4AD1A 5CEWA 4DYJA 2VNCA 3MI2A 2X1IA 5B7YA 4AYSA 2D20A 1UBPC 3L21A 3LLDA 2VEIA 3UCQA 3LXBA 3TNOA 1EKOA 3VNIA 2P53A 1V6XA 4S3GA 5F7UA 1VC4A 3QMTA 3M5VA 4S3FA 2XN0A 3NSMA 4GINA 1JPDX 2QCLA 3OJGA 2WVTA 1JDAA 3ARPA 2ZX7A 3N18A 2VQTA 4B91A 2ISDA 2NQ9A 4QDWA 1V02A 2G4FA 4NAFA 3GX9A 3URNA 1GJPA 4JFUA 3M5ZA 2PGWA 4AH7A 4ZFCA 2Y24A 5G4HC 5EFDA 5E6YA 5HR7A 3F5LA 2PURA 4O17A 4GQGA 1GJUA 1QRQA 1JZ5A 1TRIA 2J75A 2OX4A 1FHDA 5IBXA 2Z4GA 4QTGA 3EPOA 3N34A 2CETA 1U83A 3CJPA 4H8NA 4PCTA 3TFXA 4DX3A 3LCLA 3W7KA 5CKSA 2GOUA 1KBIA 1S1RA 2P3ZA 5F4WA 2DSUA 3QPYA 4EKJA 3T81A 3DFTA 3CS2A 1C8XA 1KRMA 3TDFA 1H5VA 3W27A 3EEGA 1SJDA 3WH7A 4BI5A 2P5NA 2XU2A 3CBWA 4RZ5A 3W2LA 1RSCA 1QI4A 3H2FA 2QPXA 3NXLA 2WQPA 1Z69A 1JFHA 1W3LA 4P8UA 3SW6A 1VFFA 2J7EA 3FDGA 3BGGA 4NXKA 2JKAA 2C14A 1MUMA 3W1NA 4XSLA 1E73M 1ALDA 2PB1A 2WBKA 2NXHA 2PGRA 4YVVA 3SCUA 2E6FA 3LPFA 1IXPA 1O12A 3N1AA 3EA1A 2QCCA 5D30A 3FLUA 3G0XA 4LBSA 2ZA2A 3LI1A 1AUSL 2OT0A 3SUTA 4IG2A 4GO9A 5A6MA 3V5OA 1GOIA 2XFRA 2Q01A 4DJDA 5FF3A 1F6YA 5D03A 4F0HA 1F3EA 1S2CA 2HVMA 4N4PA 3B9EA 3H2NA 1RQBA 1XBXA 1I2NA 4AC7C 5GVJA 4CCCA 1U5JA 4Q3MA 1JDCA 2ATSA 3ARXA 3GTNA 3KVKA 4DZHA 3CM4A 1FWJC 3DG3A 1OF8A 5B80A 5FESA 3ABSA 2Q8ZA 4M3PA 1AW5A 5M17A 4CD5A 1UIOA 1F3XA 1F6PA 4GWEA 3A3WA 5BZAA 3TTQA 5BXSA 2BXVA 1FDJA 3H70A 4DXVA 2X09A 4DF0A 2FJKA 2QJIA 1HW6A 2ZUMA 2JKEA 3DX5A 5G1YA 2QR6A 1N8FA 3ZR5A 4UFMA 2QCGA 3G1AA 4Y8FA 4AZCB 3S1UA 3LHTA 2YB1A 4WUIA 3UR7A 3W1LA 1I2OA 3PBGA 2VHLA 5AZ0A 5EKYA 4JHMA 2Z6IA 4XZMX 2EG7A 4JGDA 3B8WA 4CCZA 3ME3A 3F2BA 5CXPA 1QNRA 4GUJA 3PZNA 3EXRA 1QHOA 1XIBA 4QDPA 4JIHA 3NL2A 1G7VA 4A8NA 4PRWA 3TCSA 3AO0A 2BHZA 1JZ7A 1PV8A 4JX4A 1FWDC 3U7VA 4B2DA 3RG6A 4RXGA 3KBWA 2YA0A 1PAMA 3LRKA 2IXVA 3PPHA 5FJIA 3BLOA 1YPXA 4C90A 1IWPA 4JR5A 3A4AA 4J40A 4GQBA 3VVGA 4LVDA 1HKMA 1OFEA 3S1WA 4M81A 1S2WA 4H6QA 2ZDRA 3CMGA 4JY8A 5H8UA 1UWAA 2GL5A 3ANYA 3SEPA 1Z9AA 1T8XA 1OG0A 3T0CA 3NEVA 2C8NA 4HMEA 1J9YA 1JGMA 2DV0A 2PDGA 3GHRA 4WDTA 3M0XA 1KBJA 4M6QA 3BMXA 4DN1A 3W1RA 2YL8A 3W0KA 3K1DA 5JBDA 4R53A 4YWSA 4S3AA 3RN6A 3WDPP 1OHLA 4AEOA 4HMCA 3CUZA 4Q8UA 2CBJA 3CTLA 3E96A 3O07A 5FD0A 3O6AA 4U4MA 4U5IA 3M6DA 4HHPA 5CZSA 1VFTA 2FQIA 3SCTA 1ZB5A 4XKYA 4L56A 1UZHA 4H9VA 3NCOA 3CO4A 1J8VA 1J0HA 3BANA 4YIWA 3SUVA 4U2YA 4GUHA 4CQ9A 1R9YA 4X2RA 2Y8UA 3CV1A 4TIMA 3TLQA 3VIFA 2A3CA 3VDCA 1JRCA 3HIJA 3ATYA 3HOJA 1F5ZA 3U2OA 5AC8A 3CHVA 4WJXA 4PSPA 3U5YA 2UWFA 4PMOA 4GI6A 4DXKA 5H8MA 3NIYA 2GDQA 4J9JA 1EPXA 1CT5A 5FJUA 1JCYA 3AIWA 1M65A 1LUCB 3IK4A 3FA3A 2OCZA 1W1VA 5KZ6A 3THCA 3CUHA 2G3NA 1DQWA 4O1DA 3WSUA 4J2MA 5KINA 1UKQA 5FEXA 3UD6A 4W7UA 4NASA 1D3GA 4NNAA 1SJBA 4M29A 3D6NA 3DFPA 3ARQA 2ISFA 1LLWA 5K7JA 4HNNA 3MUAA 4G2DA 4IP7A 5BW6A 3HG5A 1GOQA 3KBJA 1TTIA 2QVNA 4QCEA 5C9UA 2TMDA 5DRIA 4S39A 3W82A 4DJDD 3BMVA 2WAGA 5FSDC 3U57A 2GGIA 3M6YA 2OEMA 2HDJA 2V6AA 1FKWA 2XPKA 3HGJA 4GO8A 1FWCC 1EOKA 4O18A 1GNXA 1GPWA 4L9YA 2PLKA 2CLOA 4OOUA 2QAFA 4NSBA 4ZVJA 2IS7A 1FXPA 1QWGA 3TMQA 5CC3A 1E1FA 4DM2A 4R3UA 4MWAC 2VENA 1VD6A 3VIPA 4LJ3A 2FZ9A 5T8GA 3FCPA 4QSHA 3LV5A 1KM6A 1CGUA 3WD1A 3QXBA 3KP0A 4B4FA 1QXLA 2VEPA 3CHEA 3U2EA 3MYPA 1PSCA 4ZO6A 1SW3A 3H2CA 4XTDA 3PPFA 4US5D 2F61A 3GKFA 1A50A 2PD9A 3TVAA 4P7OA 1TV7A 1W1YA 1JF6A 3NQBA 2AL1A 3IUIA 3M1ZA 3SCQA 2XIJA 4DJEA 2J13A 1CCWB 5F4SA 2FTWA 4B5SA 1OGBA 2PMQA 1KM5A 5I03A 1A49A 4JD4A 4PRRA 1V3HA 1HUVA 1S3TC 2PPGA 4EF9A 5F2MA 1UWRA 4JQAA 3W28A 1OFAA 4J35A 3ELFA 2D3LA 2WNNA 3G1YA 2OQLA 1ZENA 4J5NA 4FXRA 4AZIA 4PUWA 5CAKA 5EMKA 4IIFA 1CGXA 4NI3A 4AQLA 3I7QA 3FYOA 1T7LA 1GKRA 4JN8A 4GXWA 1XFBA 4G9PA 1XRFA 5KEZA 3GG8A 3T2PA 1YNPA 1K8CA 3WNLA 2ACRA 1E6NA 1NY1A 1XYCA 2G96A 4KEUA 1C91A 3UZ5A 1KRAC 3WFZA 2VX5A 1S5TA 4GX8A 1S5VA 2FTPA 3R2GA 2CXGA 3PTMA 4OBRA 2WHLA 3TX9A 1BYDA 1UUQA 4KEZA 1J96A 4ZEPA 2R1NA 2QW5A 1GK8A 3N6JA 2DSKA 4ORMA 3NJ3A 1CBGA 1Y5VA 2FZMA 3KHDA 2PWEA 1FBAA 2BY1A 3SCSA 1TMLA 3BLLA 4GUFA 4NJJA 3BCFA 3MUXA 3LGGA 4LY8A 3VMOA 1CDGA 1ZAHA 3E12A 2OELA 4HPXA 1IEWA 1JZ8A 2NWRA 2Z2AA 2WLYA 3N6HA 2RDXA 3S2NA 4ZQCA 3I6TA 5F2LA 2DVTA 3EWWA 3CQJA 5REQA 3GYCA 1HL2A 4QAIA 4NJKA 3WF3A 3M4HA 3B0VC 4RUBA 4KPLA 4LC6A 3TTOA 2GGJA 2BTMA 4QBXA 2CBIA 4LWWA 3GBDA 2Y5EA 2DT2A 3WNNA 1S3HA 1E4MM 1FWRA 2ZQ0A 4PL1A 3W26A 1EZ2A 2F2HA 3ZJ8A 4RPPA 2YDQA 3WNOA 4F3HA 3ONBA 1ECQA 2ZZ3A 1V5XA 3O3RA 1AD1A 2J78A 4GUGA 3ID7A 1YNYA 3OLGA 5L6UA 1XQLA 1T5AA 3UR5A 4BI6A 1DIOA 2NQLA 5JH2A 3SCOA 2ZC8A 2ZX5A 1LWJA 2HMCA 4S38A 2CLEA 3OB8A 3USZA 2D23A 4GUIA 1GZ1A 5HMEA 1FDYA 2HNHA 2PFHA 4O8RA 1JPIA 3IGUA 3N2CA 4XZ9A 5F1VA 2QJJA 3DI1A 4Q8OA 3QGAC 1XS2A 1TV2A 1GUVA 3LNPA 2BY3A 2VFDA 1HJVA 1H1ZA 2PDJA 4IT1A 2HTMA 1MSSA 4WHBA 5I24A 2D22A 3OBAA 3TYCA 3VIKA 4BJHA 4H3DA 3LENA 1AFSA 1AJ2A 5M03A 1QPKA 3MB9A 1HX0A 5A6AA 4QJ3B 2ZX8A 1V0NA 4K8HA 3W7CA 1EJVC 3PZMA 1NDVA 2YA2A 1TWIA 4F48A 3IGHX 2DUZA 4G5DA 3TA6A 5A8MA 3VM5A 1W5OA 4GYFA 3EEZA 1WAWA 3RCNA 3L4XA 4BQ3A 1OX5A 5E0KA 5AHLA 4RE0A 2BMBA 4KRTA 2Q3RA 1GTEA 2REQB 3GDBA 4JQ1A 1KM1A 2PP1A 4UFJA 1IWBA 3KBMA 3BE7A 2NQJA 4FI4A 4R7JA 1A3XA 4JOMA 3TE9A 1F8IA 1LWHA 3LCGA 2FJUB 3W7MA 2ZE3A 5EA9A 4RE3A 3GE7A 3V7PA 3FFSA 2JEPA 1E6XM 1PDZA 4OJYA 3KVJA 2PAJA 3WF0A 1HZYA 3CT2A 1HJXA 2A3EA 4MSSA 5AC6A 5GNYA 1IXQA 4IUOA 2GUBA 1PPIA 3QW4B 1BRLB 2E9BA 2ZZ6A 1OZMA 5DCEA 3SUSA 4B5VA 2AAMA 5DY2A 4D6GA 4F66A 2WSPA 3ARYA 2ICSA 5ABTA 5I00A 1A5SA 3JZEA 3PN8A 4Y90A 4FP1A 3ANVA 1G4SA 3W1XA 2NUYA 3FN9A 4LT9A 1XICA 3BAWA 3O6CA 3RGTA 3P84A 5AECA 4UZSA 2GWGA 4EF8A 1A5AA 5A6JA 4HK6A 4Z2JA 4O52A 1EEXA 2CXEA 2GYIA 4FF5A 1E6PA 1A47A 5C7HA 1CZ1A 4H7ZA 3W2KA 4NU7A 2HE8A 2E9LA 1OINA 1MQQA 1XPYA 4REQA 4A22A 1KFWA 1Q2RA 4L4MA 3TSMA 4AYGA 2YBTA 4PTMA 1R3SA 2XINA 3ZIZA 4C6CA 3BVJA 4JIEA 3DEQA 1YLVA 3IARA 5K2ZA 4MM1A 3V1PA 2ZZ1A 3GHSA 4MWAD 2VEFA 2WZIA 5K9CA 3FAXA 5RUBA 3WENA 2QCFA 3LPPA 1GOWA 3DG7A 1W1B1 1P0BA 3CEPA 4C6KA 4EVZA 1XRTA 3T09A 2QUUA 4GLEA 4XWUA 1ZP4A 4IXXA 2NWSA 1VPYA 3W81A 4M24A 4ENLA 2Y6ZA 3HMJG 3B0UX 3URQA 3VZYA 1TPEA 3G1RA 2XIIA 3RITA 3TMLA 2Y7DA 3UG8A 2ON3A 3GWQA 4G8TA 4PB4A 2VRJA 2P0IA 3E3HA 3BV4A 3MSRA 4CD6A 1YTDA 3KRZA 1O5RA 2ZIDA 1KWKA 3UZZA 2WVVB 4MG4A 4OTKA 5HPOA 3WQPA 3CZJA 4DBSA 1R6WA 1O6IA 4JKMA 2Q71A 3ECQA 2KX9A 4D6EA 1H3GA 3UFYA 1BLIA 4JNYA 2AMGA 1IT0A 4G56A 4JIRA 2ZA1A 4IL2A 4GQRA 4O1CA 3WL1A 2BWGA 4WY0B 1LQ0A 2H9AA 3LN3A 3E2SA 4XIAA 3VABA 3VNJA 2VGFA 4WY0F 4J3WA 4GVGA 4TO8A 2I7GA 2WSYA 2DQWA 1LL4A 1NH6A 4UFHA 5KZDA 1V4YA 2EHHA 3P93A 2DZTA 4PC8A 3VNMA 5FSEC 4HTBA 3W76A 3PAOA 5FJOA 4H8VA 4C91A 2QF7A 1H51A 2J47A 3NQGA 2A3BA 2OLAA 2PS2A 4JPGA 2PRHA 1WKFA 4GX9A 1PZ2A 2WVSA 1IQ8A 4AZGA 2PSNA 2D0FA 1K1DA 1TSIA 1S39A 3USBA 4GQ0A 3KXQA 2ZRUA 2O7SA 4QLJA 1XYMA 4FEZA 2F9RA 3IRSA 4ADUA 3C52A 1W6TA 2J62A 4NZCA 2O55A 1XLEA 1X39A 4XAGA 1QDSA 3W7GA 4HOZA 1RH9A 2VZUA 3WLHA 1W5NA 4X0NA 3C2YA 1DPMA 3MCOA 4YTQA 4MTVA 4AIUA 1QNOA 1GOOA 3G6MA 3TN4A 1R87A 3ZWSA 4IOTA 4WEVX 2RH9A 1UYQA 1X38A 1Q4WA 1A4LA 3D5HA 5IM51 1MRQA 3GFXA 4EOUA 1AA1B 1JAEA 4U5KA 5KZEA 2VZSA 3EMZA 3I4KA 3SJNA 4G1KA 3R5EA 2PUZA 3GDTA 4GXMA 1XIGA 3WD4A 4XUGA 3UWUA 2PRLA 1UKTA 2WMGA 3CHFA 4WRHA 1DKWA 3W02A 4WDWA 1J2BA 1YXYA 1RP8A 3FJ4A 4W89A 1MO0A 1VBGA 2WZTA 3MJYA 1SZNA 4F0KA 1MQPA 1UWTA 7CGTA 8A3HA 4GYJA 4W87A 2WZHA 1RCQA 1UZ4A 1LT8A 2E77A 3WCZA 4C6LA 2F7FA 1E72M 3MUIA 3VGFA 3WN6A 2W5FA 3E0WA 3DHPA 4ZQRA 3B9NA 3CHCA 3T6CA 3JW7A 4P7LA 4QXIA 2AL2B 3NEHA 5FEPA 3OZOA 3M0YA 3L23A 3SIMA 2PC8A 3R8RA 2ZUNA 3N4EA 1A80A 3OYXA 2P3EA 4W88A 4GIEA 4Q4KA 3IJIA 4KWSA 4LEQA 3N9SA 6ALDA 1KC7A 3DERA 2ABAA 4YPJA 3WD0A 1H62A 4TV6A 4AB4A 1E0UA 4GPNA 3SCNA 2FVMA 1DXFA 2VFIA 3AALA 3ITOA 3HQPA 1RBAA 4HPNA 3R0KA 4MY8A 3UNDA 4PCPA 3BG3A 1VFSA 1YPIA 2VX7A 3MT1A 5FIPA 3WQWA 1VZWA 4X3ZA 3MY9A 3APTA 4I5RA 4LV4A 5TQLA 2E67A 1H1YA 3ABRA 5FL1A 3U2ZA 3NURA 4H6EA 1XSKA 1T99A 5DELA 1F07A 4AISA 1PTAA 3CZGA 3FOKA 2W79A 1PIFA 2OPJA 3F2DA 1K8XA 2RDWA 4M6VA 4XZBA 3ONCA 2XGBA 4E3TA 3WO8A 1ZJHA 3DYOA 3WMSA 3I6EA 4YLWA 3TC6A 1QPOA 1BWLA 1WKDA 1I0DA 2I56A 5GNZA 4C6EA 3TYDA 3V75A 3HURA 5H6HA 4ROQA 4ZSUA 3NUKA 5E9AA 1JCJA 3S9IA 4MPQA 3T7VA 4RE2A 4ICMA 3QF0A 1YBQB 1WX0A 3VUPA 1QUMA 2O9RA 1PS9A 2FFCA 3RK8A 1E0WA 1E3XA 3N2TA 4HK5A 4KCVA 1OFRA 4YTRA 3AISA 7ENLA 5BWFA 4RNHA 4NZJA 4F0LA 5LNWA 1W5QA 3VUSA 2Z1VA 2DZXA 2PDFA 1VLIA 4LQ1A 1XUUA 3W2NA 2VZOA 2P76A 2IUZA 3TKFA 1US3A 3KOYA 5ABGA 3K8LA 3VM7A 4UFKA 5FEZA 1W5MA 1K9DA 1DJXA 4GVIA 5LNSA 2QKFA 3NVDA 2G97A 5E1QA 3LGEA 4JDYA 4UCFA 2X2YA 5G4EA 4O11A 2R9RA 3A3XA 2CLLA 1SW7A 5C8BB 3KWSA 4ASTA 5I78A 3C2FA 1K77A 1BYBA 1F61A 5J5DA 3WQEA 4LAMA 3ZM8A 5T26A 3ZR6A 3GTFA 5D2VA 3TAOA 3NPWA 2VWSA 2X1TA 3FXGA 1KV5A 1MVYA 4EXBA 2W0UA 4GJIA 4NJIA 3RCMA 3GNNA 5KSWA 2B0MA 3SSJA 4ERAA 4PB5A 4ZB0A 1S2TA 3NO3A 3STEA 4KS0A 1LUCA 3BLKA 3OZYA 3IJDA 4LBRA 5CPOA 1OK6A 2HVNA 4KGJA 4UQEA 4Q32A 2O9OA 5T9BG 3VIIA 2FMNA 2ACUA 4KWVA 4FK9A 3WF2A 3WUFA 3GDLA 2ALDA 3PTDA 4MJ2A 1LLOA 4WCJA 1W1ZA 1XLLA 1E4IA 1ADSA 4EP8C 3RXZA 3KEHA 4AVFA 3H8AA 2W6RA 1SU5A 4IHCA 5LGXA 3H24A 3C3UA 3ARRA 3PS7A 3M46A 3G3MA 2B7PA 3IS4A 1OVDA 3ATZA 1XDLA 2FZ8A 3JU2A 3ZS4A 1TB3A 1XLDA 2G0WA 1NOFA 1Z42A 5CPNA 1V8EA 3EGJA 4HSHA 1IYXA 3EBVA 4M1RA 5FJTA 1RQEA 2WHJA 3KE0A 3LCHA 3FYYA 4O1AA 2DP3A 1GVSA 4KWUA 1ADOA 3CIWA 1JULA 3WFAA 7ODCA 4W7VA 1XC4A 1V7AA 4GMEA 2Z25A 3AROA 5HANA 3DI0A 4GGHA 4L1XA 5CPMA 2NV9A 3QRHA 3RO8A 4D72A 4MZYA 3BARA 4CQCA 1Q85A 4RPQA 2OWCA 1HFBA 4MUZA 4K8GA 1TIWA 4EPKA 3QPZA 4ZTYA 4B3KA 3FW6A 3OBEA 3BW2A 4Y9AA 3RX3A 1VIWA 1DJIA 3FS2A 3U9IA 5AVHA 1H7WA 2ZXAA 4QE1A 4UTJA 4LW7A 3QZ6A 3QKEA 4ZB5A 5J04A 3K4WA 3T9PA 3BUVA 1B31A 1IE7C 4YU1A 2DQXA 3HA1A 3VCCA 4MUPA 2VOTA 4Q7NA 2JIWA 4LAKA 5ECVA 1C29A 2G37A 1LOQA 4DZIA 3C8NA 2C19A 3BOLA 2VZTA 4LCSA 5I07A 2PTXA 5FCZA 3CAWA 5EMMA 2B4GA 4LUSA 2V9DA 3MKCA 2FMOA 2DU2A 1M6JA 2A6NA 4GOAA 1C9DA 2ZC1A 1SJAA 3W7EA 2YBVA 4ML4A 2W62A 5LNUA 3FVMA 1KWGA 1KV8A 1WUFA 4GJJA 3NZRA 3PSVA 3UXAA 1JNEA 3AIUA 2QQ6A 4AZBA 4C6JA 4E5TA 1R3WA 3F4NA 1A0EA 5E9XA 2OEJA 1Y0EA 3NOYA 3AUJA 2PTWA 1U2YA 1M1BA 3O7UA 4AEEA 2V30A 4UR9A 5FI8A 2QUTA 3OGVA 4L64A 4A05A 2DEPA 2EPMX 3VDBA 1FFRA 3TR9A 2DZAA 2V3EA 3F4DA 5HNUA 2J9YA 4OQVA 5LXEA 3AI0A 3GVVA 2PTYA 1O1ZA 2QLYA 1Q6RA 2Z29A 4NY2A 2WCAA 1OCNA 3GNRA 3EWYA 4JX6A 1MZHA 4JIPA 4DUVA 2Y2WA 1DWFM 3EX3A 1XL9A 1A5LC 1DIDA 2H90A 3AQUA 4JTJA 3KOZA 3WKZA 1O5XA 8RUCA 3A23A 1KM2A 4GYPA 1POJA 1IEXA 1JL8A 4CU8A 2A3LA 1G67A 1BSIA 1ISXA 4HD5A 4ATLA 2I17A 3ERPA 1HL8A 5DMMA 4CQBA 2O92A 2NVAA 1VF8A 1T8QA 5A69A 3NNTA 1VCGA 2XM1A 1FWWA 1ODUA 2BX7A 1KXQA 2PWHA 2GOKA 1PDYA 4HNLA 3G1XA 4AXKA 1V7YA 1JJKA 1K03A 3PWIA 4LOCA 3PJTA 1ITXA 3LNMA 4D8ZA 3SUUA 2YYUA 2YFOA 1E71M 1KW1A 3N14A 4DXXA 1A5UA 2XWEA 4MNJA 1Q13A 4E8DA 1ITQA 4ERIA 2W63A 4H9MA 4UMAA 3G0UA 5D33A 4CD7A 4MVAA 4P7RA 3HPXA 5IFTA 4KWOA 4O4VA 3O16A 1CTNA 1JZ2A 1UP3A 4RLIA 3CO8A 4O0KA 4RV3A 1RVKA 4PBGA 1Q8AA 4O50A 5BROA 3BGJA 4C7GA 3MP3A 3W6LA 1B3WA 2A21A 3FIGA 1W9PA 4FLQA 4D1JA 3N29A 3GYEA 2A85A 3C0SA 5CSUA 2MUCA 1KR0A 4Y6GA 1ISYA 2DT3A 2FFIA 2VI0A 4NF7A 2VXNA 1XPGA 2BVDA 2DSZA 4RNJA 1A5BA 2PLCA 4XAPA 3ALGA 1UOZA 3ZSSA 4XV0A 1QW8A 3CQIA 2Q09A 3IGSA 3DKLA 3L67A 2EJAA 2W4XA 4PMDA 1TZZA 3OYZA 1SO5A 4FNPA 5LSMA 3NQDA 4ICCX 2HNEA 2VDHA 4FIRA 3CUJA 2RUSA 3CYVA 2KZHA 1Q65A 2V63A 4L9ZA 3QZAA 5CGMA 4S1FA 4HMNA 3IIVA 2PBGA 4NP7A 3RRAA 1PKYA 3LRLA 1HT6A 4HU4A 1UPMB 4D6JA 3L5LA 5FF4A 3T55A 1SO6A 3QQWA 2BSLA 3S2LA 4FNSA 1MQRA 3TOPA 4KCUA 4NYYA 2DVXA 3WG6A 2P8CA 2J27A 3CZKA 2R1LA 3MO4A 3W7JA 4OUIA 3QR1A 3EB2A 4B3LA 2FGLA 1LL7A 1EJSC 2O7QA 1UR4A 2DH3A 1BRLA 4PMVA 3WBEA 1CEOA 5DY3A 3T0DA 4H2CA 4R34A 4U3AA 4FNTA 3PG8A 1KCKA 3MWCA 1E43A 4GRSA 2G8ZA 3U6WA 4QHRA 3T8LA 4I5XA 2E40A 1UROA 4WOQA 1NWSA 1BGGA 4IUGA 4J4KA 3S5YA 2WYSA 2QULA 2EG8A 1JF5A 1IEIA 1K9TA 1IHIA 1CW2A 2X1UA 5IDZA 4IIDA 2J24A 3N9KA 2WC7A 3MUCA 2J7HA 3LA4A 5AHIA 1BYCA 3PUEA 1VH7A 4HA0A 3IAPA 2Y7FA 3GDRA 3NZ1A 1FFQA 2UY5A 1QI2A 1NJJA 1AL7A 4MLJA 3EDDA 3OVRA 4LYKA 3QFWA 8XIMA 1M68A 1BKSA 4LRSA 5LIYX 2CBUA 1FP9A 1GOXA 2Y70A 4ZR8A 2Y1HA 1REQA 1N8IA 2TAAA 2QUVA 4J28A 3SR7A 1XISA 3F4VA 2ZZ2A 3C0LA 2W27A 4HN8A 3AZRA 2GVLA 3TC7A 4EPBC 4L6HA 1VGAA 2IQ0A 4IP5A 4PULA 2NT0A 1H7NA 2VR2A 4WKFA 5C0QA 4N4QA 3EKGA 4B90A 1GQKA 3THUA 3CGTA 1R9ZA 2PEVA 2Y89A 3MHFA 1TUXA 2YGYA 4C6IA 1ZFJA 3FYPA 5E0FA 3UWYA 1YXCA 4NZ4A 4NVTA 2HE5A 3WNKA 4LVBA 1V0KA 1QI0A 1EJ7L 3E2VA 3G1VA 4RKAA 2WJDA 1JZ6A 3UPWA 3DH7A 4PB3A 4BWLC 5F2GA 3WEOA 1C8VA 2FVLA 5I02A 4ZTXA 1VEOA 4M0XA 4QS5A 3V4BA 2INZA 3CQKA 1Y5WA 2QVHA 3RNDA 3OGSA 5LA0A 2RHGA 3VX0A 1M53A 2VX6A 1QT1A 3B4YA 1QOXA 2WVVA 5CLWA 1W1IE 1RALA 3OVGA 1KTNA 4FSAA 3OBKA 1NWUA 3C8FA 4Y2WA 4G7EB 2P10A 1X6LA 3AWOA 3G8RA 3C0QA 1R2TA 1RPKA 3K4DA 3UQNA 2FB2A 3I3BA 4AIEA 4WSHA 4FB7A 5FL0A 4TOQA 4FXSA 1JCTA 3KDOA 4JBRA 3K30A 3LX9A 4AEFA 3VA8A 3AMKA 3W7IA 3UYIA 3NPUA 2J6XA 3QV8A 2W91A 4BQ5A 4S23A 3W72A 3DKJA 3AFBA 4IQJA 1B3ZA 3A6OA 4JTUA 4V15A 1TPWA 1FOBA 4O28A 4PL2A 2QCMA 4UTMA 2X05A 4A35A 3PANA 2A2IA 2BVTA 2ISWA 3OA5A 3JVAA 2CIPA 1I1WA 4UIOA 5G2IA 1L6GA 1LTDA 1ECEA 4CGTA 4RL3A 3KFTA 4IM4A 5M1TA 4N42A 4K6AA 3DFYA 3L12A 3QTGA 5TF0A 3MMWA 3RLGA 2IKIA 5AVNA 2CFFA 2ZTJA 4NRRA 2ZCGA 1R3YA 4IPPA 4FZIA 2PGEA 1MNZA 1UZ1A 1NOWA 1IR1A 4E2BA 3W7PA 3CB8A 1UR8A 3VFLA 5TAOA 3B8VA 3B8SA 4NZFA 3PB0A 2QV5A 3AS1A 3MMUA 4NILA 3T0AA 3WMLA 1VBJA 3K46A 3DGRA 2PDLA 4C6PA 3ANUA 3T0BA 4ZE4A 3GW3A 1G4PA 2C71A 1GG1A 2CC0A 3GZ3A 3EB4A 1PE1A 1UA3A 1U1HA 1WCGA 4Z2IA 1I4NA 1N55A 4V1XA 4QJ1A 4CEXC 2WOQA 1DWHM 3B8IA 4AMAA 3HN3A 3R10A 2QGHA 2BLEA 4AWSA 5BXTA 2I5QA 4GBDA 4E8GA 3EDJA 1WNOA 2EKCA 4PEKA 3SM0A 2POTA 4LX4A 4KIEA 1XRSA 3POHA 7XIMA 3KBNA 2DW7A 2EPNA 1DQUA 1YW1A 4WIWA 2GQ3A 3PPCA 4C6FA 1UMLA 2D2OA 4LF2A 2CITA 3F1QA 1XLHA 1JDDA 2VGBA 8TIMA 3W1AA 2OOFA 3EA2A 4N6FA 4D6DA 1QNQA 2E0PA 4OWGA 4I5UA 3WQ5A 3EMCA 4GI4A 3GNDA 4NHVA 3LPGA 2VR5A 3W1TA 1EB3A 4QFUA 1E9ZB 1UH4A 4NKCA 2OLHA 4H7VA 3C56A 4UR7A 1JFXA 4PTNA 4EX4A 4P7NA 4AD2A 1NP0A 3RJXA 3NDYA 3S47A 1D8CA 1KRBC 1H5YA 2NLYA 4QJ5B 2B81A 3A4XA 3CPGA 1PTGA 2VVSA 2BOGX 2YCEA 3WQ6A 4BY3A 4KFNA 1F7BA 1ZL1A 4B92A 1JD9A 5C2CA 4UTTC 4GHRA 3M44A 3TYUA 1TPDA 4UTFA 1N82A 3WK3A 2Q6ZA 2WC4A 4UMCA 2RGMA 1DV7A 1ONEA 2XFWA 1CI1A 3RU8X 5AHMA 2C7FA 5LKYA 4LVFA 3MA8A 3U4AA 1Z8AA 4E8CA 4WD0A 1W3NA 2Y0FA 2P8BA 1AODA 4UTIA 3QFEA 4I6KA 2AGKA 4Z1DA 2OEKA 3KP1A 1V3JA 4UTUA 2NXIA 1EF2A 1TX2A 5HNRA 5HULA 1PYFA 2DORA 2ZA3A 2ZADA 2QPUA 4Z0JA 4P61A 5D09A 3NQFA 2PF0A 5AHFA 3KRUA 3UJEA 3QPEA 4JTRA 1V77A 1YQ2A 4TR9A 1G9HA 3WLJA 2DZSA 3NGJA 3PTQA 1LWIA 3DC0A 2OMAA 4PA8A 3L65A 1JPMA 1GKPA 5DCBA 3CT7A 5AYIA 1G01A 3DESA 1OT2A 3P7YA 4PMRA 1K6WA 4ES4A 4S3EA 4MF4A 3VOFA 3UETA 1HNYA 1F73A 3PUDA 1XKYA 5A5WA 1YBQA 2ZZ7A 3B4UA 1F8MA 1US2A 3EPNA 2V3FA 1WOBA 4Q8PA 1P1MA 5JBEA 2OX1A 4LBUA 2C0AA 2WZEA 1UMYA 1CYGA 1FCVA 1EF3A 2A7PA 2C3ZA 5XIMA 1MFUA 3MKKA 4AG0A 2I9UA 3LGDA 1J5SA 2XVGA 2UY2A 2WMKA 2V3GA 2LLEA 1ZY9A 1T40A 3Q45A 3P8JA 4JIIX 4H01A 4IGSA 3URBA 1GOMA 3V3WA 1W8SA 1I2RA 3ARVA 5G4WA 4D9PA 2NVDA 4XVDA 1F9CA 2VGGA 1EFZA 1QPQA 4H83A 1W56A 4PUNA 3WK1A 2V81A 2D0GA 2E8YA 3BL3A 1OSEA 3TJIA 1R30A 3DU0A 3D3AA 3CLWA 2C91A 3NO5A 3EWBX 4CEUC 1V3IA 1OADA 1AZ1A 2DUXA 4H9UA 4I7UA 2AOSA 3WLRA 3N3MA 1DBTA 4E2OA 1UG6A 3L7RA 3R13A 2NV1A 1K6AA 1JYWA 3O05A 1X7FA 2PDHA 2PDQA 3QW3A 3LXAA 3ZXWA 3ZWTA 4CD4A 1XXXA 2OZTA 3BGAA 1CXIA 4H04A 3ZVHB 5KMYA 1B1YA 2OJPA 3K8MA 3UR2A 4AVNA 2O0TA 4ZGYA 2O56A 1ZCOA 1QNSA 1B3OA 4YVXA 1NIUA 4MNLA 3PB2A 1XIHA 3OQ8A 3VKBA 1S5MA 3IEBA 3UG5A 3B05A 1E9YB 4YNGA 3KL5A 1RPXA 3WLKX 1LJYA 1H7XA 1ZS2A 1C93A 3HTWA 4OVXA 3UNTA 5I3IA 1E4LA 2C15A 5LNVA 2EPHA 3CV7A 5H91A 4MOZA 1VFHA 1FY6A 1ZALA 3TN5A 1E15A 1ZP3A 4MAVA 1BXCA 1OF6A 5E93A 3BW4A 2WM0A 4W4QA 4HCHA 3W6MA 2JEQA 1W91A 4PSRA 4AD5A 4RNIA 4E4PA 1UQYA 4J3SA 5HATA 1GYNA 2CHOA 2VOMA 3ZT7A 1LZOA 2WMIB 1AMYA 4PODA 4BEQA 2FHFA 1WDPA 4Q8MA 2R91A 2PCEA 1YMYA 2CEQA 4CNSA 1CGVA 3DHUA 1NTHA 1OFPA 3APGA 2YBUA 4TX8A 5BU6A 4E4UA 3PULA 1MXGA 4ZBCA 4FAMA 4JIQA 2XH7A 1NVMA 3SN4A 3P81A 2H3DA 1RJQA 2ZXBA 4HHHA 3P3BA 3WIJA 4GIAA 2YZRA 1H0IA 1XGEA 2ASHA 5GQBA 3WQGA 2F6UA 3N11A 5I6SA 1ZJIA 4LAOA 6TAAA 4JTCA 4CNNA 3NFUA 3I68A 2CWXA 2R1MA 2ZXDA 4GK8A 1YDVA 2Y88A 1EO5A 2H3BA 4Z42C 5HMFA 5EU9A 2XVNA 1P0DA 3ES7A 4DM1A 1OFQA 3FGCB 3SB0A 4X63A 3W7RA 3TR2A 2IQTA 4W85A 2PDUA 4O1FA 2WKLA 1Z89A 3VKAA 3AHVA 4QNEA 4H41A 2ZBTA 4Z1BA 2PI6A 4CN4A 1LP6A 5JBFA 2I57A 4I7WA 4MKSA 1R85A 4PRTA 1M9HA 2FTYA 4R27A 4W84A 4ZENA 1OC5A 3FV9A 2ZX9A 4PFHA 3W2MA 5D04C 1NFGA 3BLDA 1XLIA 5GJNA 1DJGA 3GS6A 3W7DA 3GAYA 4A4AA 2OGYA 2VCAA 1FH8A 4DJFC 2Z26A 1OT1A 5TBOA 3LHYA 5HWJA 1YX1A 2G50A 2WV8A 1ITCA 4HCLA 2WJZA 2GJLA 1VJIA 1PX3A 4GFSA 2Y61A 5CCZA 1O94A 1TPUA 3IANA 4IX0A 1NWTA 1TJ0A 2ZRWA 3TWAA 5FF0A 2Z00A 3AJXA 1N7KA 2J9ZA 3GXNA 3WMCA 5HR6A 4HNVA 1OX4B 1KO0A 1QU4A 2R1KA 2XIBA 1BTMA 3KUMA 2PZNA 1XCXA 1UKOA 2I9EA 2OYKA 2SFPA 2R8WA 2WBGA 4UWMA 4K68A 1S2UA 3LB0A 3RM4A 4NXSA 3WH9A 3UPBA 4QGCA 3HBLA 1VHCA 1X97A 3AMGA 1HO4A 2EKGA 4GY7A 4IGNA 4LVGA 4E2DA 4OU1A 1L2QA 1K4HA 1NOUA 4L1GA 6A3HA 3ITVA 4AD3A 1QHPA 2OXNA 4PUKA 1PIGA 2WB5A 3B8DA 2XIOA 1F3TA 2IMRA 3Q37A 3VC6A 3TZNA 4LPCA 1U33A 2G3JA 1C90A 1PKLA 3VGHA 4HQVA 4YS1A 3UBPC 5CSSA 2GVYA 2NQZA 1E51A 4IIBA 4N7QA 2IPFA 3KCJA 3PY2A 2E6DA 1TCDA 4Q22A 1SQ7A 2RGLA 4I9MA 2H8ZA 1A5MC 3OTRA 2D69A 2NX1A