3FFSA

The crystal structure of cryptosporidium parvum inosine-5'-monophosphate dehydrogenase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
377
structure length
301
Chain Sequence
TKNIGKGLTFEDILLVPNYSEVLPREVSLETKLTKNVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKNMDMESQVNEVLKVKNWIAYSNENLDNKGRLRVGAAIGVNIERAKLLVEAGVDVIVLDSAHGHSLNIIRTLKEIKSKMNIDVIVGNVVTEEATKELIENGADGIKVGIIVAGVGVPQITAIEKCSSVASKFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKELIGDTVYKYRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKKSSYVEITTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of Cryptosporidium -specific IMP dehydrogenase inhibitor selectivity
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Oxidoreductase
molecule keywords Inosine-5-monophosphate dehydrogenase
total genus 82
structure length 301
sequence length 377
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ffsA00
2OT0A 1UB3A 2A1YA 4TIMA 3PC0A 4KFPA 1TV7A 1F6KA 2DZSA 3TAKA 3LTYA 5K3VA 4WY0F 2VXNA 5AN7A 3B06A 3C3NA 5DCEA 3BLEA 1GVRA 1LBFA 3QF0A 2X1RA 1IIGA 4O4WA 4FNTA 3SSJA 1KM3A 3BK0A 1VRDA 2CZFA 3F4WA 2HS6A 5DLCA 4RXFA 1T96A 3QC3A 1JUEA 3C8FA 3N2MA 3MBFA 4TO8A 4PFMA 1KM2A 3CC1A 1PIIA 5CZTA 2Z6JA 2NV1A 4PL1A 1GZGA 3W7PA 2R8WA 1TPDA 2ISWA 4IPIA 2BTMA 3N19B 3UWUA 1R46A 3INPA 4NJHA 1KFLA 1F73A 2QUTA 4GC4A 5CKSA 5DELA 5C2XA 4JYDA 3M44A 3YPIA 3PF3A 1VHCA 4IWWA 3BO9A 3KRUA 4LOCA 1JVNA 2RKXA 5D33A 3S1UA 1KW1A 3V75A 1QPQA 3NL3A 4O17A 5DCBA 3RNDA 2C15A 3EKZA 2V0TA 1LORA 3QPZA 4LW7A 1OFEA 3EX1A 4Y96A 3UWZA 2BX7A 4QIUA 4CNPA 3P7YA 4FX8A 1X7FA 2AGKA 3S8HA 3DFNA 4YMZA 5HR6A 1H62A 4BI5A 4DO6A 3STGA 1AW5A 3WJYA 3NOEA 4KFOA 1ME9A 4RK8A 4NT0A 4PEKA 4LS0A 2B7QA 2Y89A 4QISA 3VE7A 3NPVA 5A5WA 2FPYA 3GNNA 4GUFA 2Z2UA 5HULA 3LTPA 4JTIA 2C13A 2YFOA 1SZEA 4N4PA 5CPOA 3QMSA 2Q3OA 4HIBA 3QPYA 1H51A 4UMBA 4OU1A 3LCWA 2ZRYA 2DZUA 4QNWA 1P5BA 4XKYA 2QJGA 3P81A 2H3BA 3C2FA 3LCXA 5EPDA 4HHPA 2C16A 1LM1A 3O06A 4YCPA 2C18A 3NO5A 1HFBA 4UTTA 3FLUA 3DZ1A 1ZNNA 4HT3A 1F76A 2QUVA 1JCJA 3W88A 2ZA3A 3UWQA 1MXSA 1OJXA 3MP4A 1M7OA 1F74A 3QEZA 3IVTA 1JQVA 1SO5A 3S0CA 3CEPA 1F7BA 1L6WA 5D2WA 3QM3A 4LU0A 3KVMA 1P1XA 4GRSA 5DCDA 3FKKA 3L9CA 3CEUA 1Q6QA 3HG3A 4ALDA 3CWNA 3I65A 2A6LA 1OG0A 2J9YA 2A0NA 5LZLA 3PB0A 2DU2A 3DU0A 1JUBA 2X30A 4GUGA 1H7PA 2OX1A 3FYPA 1H60A 4NX0A 3PG9A 2B0MA 1LOSA 3M9YA 4O52A 2ZA1A 5AHFA 2XN1A 1V7YA 3P8IA 3NM3A 4LRTA 4BF9A 4BWLA 2WJZA 1LDCA 3C0JA 3QMRA 4JX4A 3TSDA 1DJQA 2XN2A 3NR0A 3W83A 3R13A 5G5IA 4O0ZA 5LNSA 5I3HA 4CNNA 1QFEA 4RZ6A 3O16A 1ZHAA 4MZ8A 5HUOA 1S5WA 3L5MA 4X22A 3M7WA 1T0OA 1W3IA 1FCVA 3LI1A 1MEHA 3HGOA 1I2NA 3RU6A 1VYPX 3IIXA 1KM0A 2FTPA 3P61A 3PWAA 4JY8A 2RDTA 1KFCA 3F1QA 3QMTA 1FY6A 4ZQRA 4MJZA 4S2CA 3A23A 1XUZA 3B8DA 2RH9A 5AC6A 3EWZA 1ZY9A 1W8SA 1JCNA 1SU5A 1G67A 4PA8A 4FXRA 4UFIA 1G7UA 3LHZA 3GDTA 3N34A 4RZ4A 3W07A 5C55A 4N9BA 5FEZA 1TTJA 3BV4A 4M6QA 2NV2A 3HG4A 3C6CA 2AQWA 3MHFA 4K7YA 4Y90A 5J5RA 4UC5A 1KM1A 1SO3A 1TMHA 3BW4A 1VQTA 4DXVA 1OYCA 4IOTA 3TW6A 4FEZA 1KFKA 2YXGA 5D32A 1WYIA 1WAUA 1L2UA 3WJSA 4XTDA 3PBVA 2CLFA 2FQIA 3SFKA 2Y70A 3OHIA 2QCMA 2ZZ1A 1SZNA 4RX0A 3HO8A 1IXPA 3NEVA 3EX4A 3MW7A 1I2OA 5LSMA 3NYZA 3IIPA 1LRQA 2G96A 3W2MA 1PHWA 2WSRA 3MHGA 2VEMA 2E6AA 4RKAA 1FWRA 1K7FA 1SW7A 2NWSA 1U83A 2Q3RA 3GX9A 3LCIA 4JXCA 4O13A 3FA5A 1JULA 2YGYA 4POCA 1EP3A 2J9ZA 5F2IA 2RFGA 3E12A 2Y88A 2WQPA 3G8EA 4LV4A 4MJMA 4S2BA 4DF2A 1QO2A 1TCDA 1XUUA 2W6RA 5T26A 4OBTA 1DL3A 6ALDA 4K7VA 2E68A 4ZQMA 4Z0SA 2PE4A 5D2VA 1SO6A 3GDLA 4MY1A 3UWWA 3O8AA 3W7LA 1DQXA 1JQXA 2YYUA 1JCLA 1XBXA 1WOBA 2CLKA 4O14A 3A5VA 3KRSA 2DJXA 1L6SA 3FJ6A 5BOOA 4IXXA 5AHIA 2YSWA 3BVJA 4EOUA 2X16A 1K7XA 3DFPA 2NXHA 3NQGA 1HO4A 1LTDA 3NG3A 2CWNA 5LHFA 3HGJA 3PBWA 2F7FA 4N6EA 3W7NA 3R8RA 3DHDA 4I7WA 1O95A 4LWWA 3B0VC 3TX9A 3TQVA 4JTFA 3UWYA 3GB6A 4PH6A 1QR7A 2QUUA 3P80A 5DXXA 3WJXA 3HPZA 3ZWTA 3S1XA 4IMCA 3CLMA 5G1YA 3C2OA 1VYRA 4UXDA 4WQ6A 1OABA 3VCRA 3W7QA 1MSSA 1TREA 3TC6A 2YW3A 4KKXA 3W1AA 5G4WA 3B4UA 4FX7A 3STEA 5LGXA 4ML9A 2GQAA 1KV8A 1XFBA 3T40A 2QCFA 1EPXA 4RJEA 2ZRXA 1JRBA 2VFEA 1GWJA 1TPH1 1H5YA 1I45A 1XC4A 3ZWSA 3EXTA 1JR1A 3M5XA 1BTMA 2Z1BA 1R2SA 1K8XA 1OF6A 1SSDA 5K9CA 5DY3A 4WZHA 4DBDA 3Q94A 1N7KA 1HUVA 1KM5A 3HJZA 2AAMA 1GTEA 4O1DA 2C1HA 2ZRWA 3W7JA 1EB3A 2ZZ7A 1NF0A 1QO5A 5IM51 2HTMA 2J88A 3S5OA 3NDOA 1I8JA 1ZAJA 3N9SA 3UYCA 2P0OA 3C2EA 3NZRA 2B7PA 4XUGA 2Y85A 4K39A 2CLLA 3EWWA 3KXQA 1OFAA 1EIXA 3A9IA 2A4AA 3S6DA 1EX5A 5CGQA 3UY7A 3L0GA 2TPSA 2DZTA 1D3HA 1OFQA 1TJPA 1KTNA 3W7CA 1FQ0A 1K7EA 3LDVA 4ZQNA 4NNBA 1TPC1 3DFSA 5CPNA 5E93A 1G6CA 3B0UX 4DEFA 3STCA 4NJGA 2EAWA 1GPWA 1UJPA 2QDHA 2DZVA 1R2TA 2E5DA 3R2GA 1ONRA 4GJ1A 3DBPA 4GWEA 3ATZA 2V9DA 4NNCA 3MYPA 4NUWA 2F84A 2NXGA 1AW2A 3TFCA 4LVFA 4O15A 5D38A 2H6RA 3UXAA 3I68A 4AEOA 3LXCA 1DBTA 1XCFA 3UNDA 3MHUA 3ABOA 1VC4A 4FNPA 2CW6A 1TQJA 3M1ZA 2CLHA 5U4NA 1ZAHA 2PRHA 1O60A 3E96A 4O54A 2JBMA 4UTKA 4O18A 4UFKA 3DFQA 3U2OA 3KFTA 4CLMA 1TB3A 5HUPA 2NUXA 2Y6ZA 2V30A 4WOQA 3EKLA 4NX5A 3CU2A 3S5ZA 2TRSA 1PCWA 1O4UA 4JYFA 4HNVA 5LNVA 4UIOA 5EBUA 2YX0A 3TSBA 3GXPA 3IEBA 3O07A 5AHEA 3ATYA 4M7TA 3ABRA 5DBUA 3QZEA 4O12A 1O94A 5KZMA 1OX4A 2DZXA 4AH7A 2QCCA 1X8FA 3G1AA 3FKRA 4KWWA 3BGJA 3TW7A 3L0NA 5KITA 3PUEA 3LCLA 1UASA 4BK9A 3N9RA 1B3OA 4XWUA 3CIWA 2ZDRA 1LBMA 1SSGA 1GVFA 1NEYA 1FCBA 5I3IA 1TTQA 3G3MA 3LX9A 3PAJA 4ZQPA 1TPWA 1OHLA 2GPTA 3G1VA 2FFCA 1SUXA 3NL5A 1H7RA 5HQEA 3W7RA 4A29A 4H3DA 4QITA 4O19A 4Q4KA 4JN6A 4UTMA 5TBOA 1KTCA 2ZZ6A 3F4NA 5FEWA 3S1WA 3L65A 2GQ8A 4UTLA 2WNZA 4FNQA 3LLDA 2BXVA 2ATMA 4HN4A 1T99A 3TR2A 2JKPA 5F4XA 5I3JA 4AB4A 5K9DA 4NJJA 4E0CA 4N9EA 3AO0A 1EP1A 3GKFA 1AL7A 4NZFA 2Z0IA 2QCHA 4NVTA 5HINA 3W1PA 2TSYA 5L9FA 3JS3A 4N9DA 2Q8LA 3VKJA 2VEPA 3IVSA 1TSIA 4MZ1A 4Y6GA 3LI0A 4UTWA 2NX9A 2H8ZA 1G4TA 2Y7EA 2RHGA 4JR5A 4Z08A 3FOKA 2OMAA 5KZEA 3GDRA 4HNNA 5FF0A 3SECA 4M6VA 3BG9A 2E6DA 1GVQA 4MZYA 5C54A 1UCWA 2CZEA 1RR2A 3B04A 1YPFA 3EXRA 1LCOA 4JX5A 3JRKA 3GXNA 3M16A 1JJKA 3NPXA 4XQ6A 1ZALA 4I9AA 3PUOA 4A2RA 3VFLA 3KRZA 2V2CA 5DBTA 3A24A 1OK6A 3ABSA 3W1LA 4IGHA 4DELA 1FWSA 2BSLA 4YCOA 1NSJA 3P5ZA 2V81A 1TV8A 1B4EA 4EWND 1W5PA 4JX6A 1HL2A 1VS1A 4IX2A 4LT9A 4AHOA 3NL6A 3H55A 4L4MA 3I7RA 3L5AA 3QRHA 3W74A 3W1UA 3SGUA 4O0KA 3QQ1A 4FHAA 1VZWA 4N2YA 3I7SA 1F6PA 3E9AA 2GJNA 3STFA 1IXQA 4Y8FA 3HBLA 4CQ9A 3N2XA 4DF1A 3EB2A 1X1ZA 2A7RA 4UTHA 2E6YA 4I7UA 4N4QA 4NXKA 3NGJA 6TIMA 3P84A 3RMJA 4OGZA 3CQ0A 1Q3NA 1TQXA 1WBJA 1OFDA 4MY8A 3G0SA 3DAQA 4O1AA 5E1QA 5K7JA 4JS3A 3QSTA 3FS2A 5IBXA 1VH7A 4M7SA 3HOJA 4OQVA 2WO5A 1YADA 3LRMA 1MO0A 3LCHA 3IGSA 4ZMGA 2ATSA 3V1PA 1VYSX 2ZA2A 1E51A 1J2WA 3FJLA 5CPLA 4HSNA 3O05A 4JTEA 3M5YA 5EYWA 1QDSA 5CZJA 4DQWA 5F4WA 3HG2A 3TIMA 3N73A 1K03A 4Z1CA 1L9WA 7TIMA 2E5CA 1MEIA 2KZHA 2PRLA 3GIYA 1XDMA 4UMAA 3DFTA 2QF7A 4TR9A 3BLFA 3W1MA 1THFD 4LUJA 1TPUA 1VCGA 2P1FA 3CHVA 4UTJA 1TPEA 2V5LA 3HG5A 2Y61A 5EMUA 2NUYA 3Q2DA 3W84A 3BGGA 4OV9A 1VJIA 2GVJA 1YXYA 1R47A 3PBYA 3LHTA 2ZZ4A 3E49A 2J9XA 5MHBA 5D30A 2A5HA 3N3MA 5DN1A 4BI7A 1O5KA 1YDNA 1PVNA 2O7SA 3W23A 3G1XA 4LVDA 3O6CA 5TQLA 4I7VA 1HG3A 2A21A 2I1OA 4GE8A 4AAJA 2J24A 4WUIA 4QSHA 3DI0A 2IQTA 3CWOX 3WK2A 1FDJA 4R7JA 4RZ5A 3OVPA 1PCKA 3NAVA 3TXVA 3OIXA 4GFSA 1DJNA 1TO3A 3GR8A 3WK1A 3W7OA 1J4EA 4MVAA 1VCVA 2RDWA 4J9JA 5D2YA 3W7EA 2BLEA 3ZS4A 2UV8G 3KVLA 4AHQA 1OFOA 3TAOA 4EVZA 4K38A 1W3NA 3EX3A 1KM4A 1I4NA 3HB9A 3DGRA 4O53A 1XKYA 1LLZA 4K8HA 3GZ3A 4GUHA 4X3ZA 4AF0A 1PL9A 4Z1BA 2YDAA 1OYAA 5BRBA 4IX0A 3W7GA 1LYXA 3U8GA 5FF4A 4R34A 3QYQA 1W5NA 1VCFA 3M5ZA 1L6YA 2R14A 4FIQA 1YXDA 2CZDA 2XN0A 4JD4A 2Y63A 4LUIA 5BNKA 2H3DA 2QAFA 2E6FA 3LOTA 1H50A 5G2HA 3C61A 3MMTA 3NPWA 2GQ9A 2V2DA 3G0XA 4JTGA 3MP5A 3UXDA 4Z0JA 1A5SA 2FJKA 2O7QA 4K8EA 2QR6A 1TPFA 5K4XA 2W79A 1D9EA 3UWVA 2EHHA 4IJBA 2H90A 3NL2A 5SWUA 1D3GA 1QPNA 4N6FA 2WSQA 3H53A 3PSVA 1ZFJA 1DORA 3G8RA 1QPOA 5AFDA 1AG1O 1NVMA 3LBMA 3C2VA 1KV5A 5F1UA 3UQNA 4UUIA 5AHLA 4JTTA 3KOFA 4HNUA 1RPXA 5KSWA 2VOMA 3QSRA 2WNQA 2G97A 1U5JA 2TMDA 4FNUA 5J5DA 3W6YA 1X6UA 1W5MA 1OF8A 3WFAA 1CW2A 4M6PA 3W70A 1XBVA 3PM6A 3LGEA 1MZHA 3HGSA 1G7VA 5FF7A 4JDYA 4WXYA 1B9BA 4LRSA 2G95A 2PURA 3BARA 5AYZA 3GXTA 1UUOA 1WV2A 3MP3A 4O28A 3E0IA 4JTJA 3LHUA 3MUXA 4A2SA 3HIJA 1PV8A 2FLIA 4XTIA 3LXBA 2E09A 1XI3A 4ZQOA 4XKYB 3W1NA 2B7NA 4A21A 4IUOA 4JTHA 2FDSA 1AL8A 1G4SA 5EY5A 5LNWA 2QJHA 2ZQ0A 3W85A 2WPBA 4RLIA 1EWDA 1LRNA 5DXYA 2C3ZA 1OVDA 1ALDA 3I7QA 5K4ZA 4PTNA 3SJ3A 3QW4B 1OFBA 4UCGA 1FXPA 4HKPA 4AWUA 1UBSA 1SZFA 2C14A 1IXOA 3LLFA 1A53A 4KFNA 1SW3A 2NLIA 4RR4A 1KBJA 4O10A 4DO4A 2VFHA 4LNYA 3IRDA 5EL1A 4TU1A 2EGZA 2ZTKA 3G18A 2JGYA 2X2GA 4AXKA 3CB8A 1N55A 5F2LA 3SGZA 4MLJA 3ANYA 3R89A 1Z42A 5G4EA 4GXMA 2QCNA 4LC6A 1WQ5A 1H7NA 4IPJA 1A5CA 3HPSA 1P4CA 4O4VA 1WBHA 3R12A 1P0NA 4GNJA 1TYGA 3BW2A 4LS1A 4AWSA 4KWVA 5AHMA 3GDMA 4WY0B 5FF2A 5G1TA 3LBCA 5AHNA 1EEPA 3TCEA 3C2RA 3W1QA 2Q8ZA 1HTIA 2QAPA 4O50A 4MUZA 1F05A 2VELA 1GQNA 3W9ZA 4WD0A 5EKYA 4LVGA 3NQ8A 1WX0A 3QFEA 4LTSA 2CZ5A 3PS7A 3W22A 2ZTJA 3G1HA 1KFBA 1ME7A 3GK0A 3RFAA 5LGZA 1PS9A 2G5WA 3MO7A 4EIVA 4AHPA 1YLVA 5HR7A 3E02A 4M19A 3KHJA 2Z6IA 3H54A 4P61A 3TQ0A 1BEUA 5KMYA 5F2MA 3UPWA 2OZ0A 3LB0A 5HWJA 4NZJA 2GOUA 2QCGA 3TROA 3Q37A 2R94A 3HGRA 2W0UA 3LV6A 4CCDA 1KLYA 4JEQA 4IQLA 4LVBA 4TX9A 3NNTA 4BFAA 1YTEA 1M5WA 3DHFA 1VPXA 4ONVA 3IGUA 1V5XA 2HSAA 2QCLA 2ZRVA 4O1BA 1VR6A 4N9CA 3W2UA 3BLIA 2HMCA 1R30A 3NQ6A 1LRTA 1W37A 4FO4A 1Q6LA 3DXIA 1H63A 4JGDA 3G1SA 3PB2A 1F5ZA 1TTPA 3QJAA 4ORIA 1XBZA 2Y7DA 5K2ZA 2ZYFA 1LROA 2WV8A 4MIMA 3B03A 3TMLA 3W7HA 1G4PA 2YPIA 1IIHA 1QAPA 3HPXA 3W86A 1YPIA 2OCZA 3S5YA 4TMCA 3BPWA 3RK8A 3IIVA 2VFGA 3NVTA 1X1OA 3QQ0A 2QCDB 1J5TA 1SZGA 4YLWA 1DVJA 5KINA 2FIQA 3IGXA 4JDBA 3G3DA 1XDLA 2PRMA 3EWXA 3NQMA 2A6NA 2PCQA 4IXHA 2VKZG 4UFJA 5D2XA 1DKWA 3W71A 2JKAA 3G1DA 2DORA 4RV8A 1R2RA 3IVUA 2X1TA 3LXAA 1AMKA 1IXNA 3G24A 3T44A 4O8RA 3TJLA 1H7WA 2QCEA 4C1LA 4BI6A 2JGQA 1W5QA 3DI1A 1FCUA 1GYNA 3MJYA 4LVAA 4MKNA 2VFIA 3BG3A 2QCDA 1JRCA 1H1ZA 1A5BA 2DZWA 3NQDA 2EF9A 3IV3A 4MLRA 1UUMA 3NZ1A 2R91A 1W54A 1NAL1 4CNOA 5G2WA 3M5VA 4FX6M 5EA9A 4IMEA 5FI8A 3DENA 3EX6A 1PHQA 1Q6RA 3W87A 3FYOA 3OA3A 4PCFA 3UY8A 5D03A 4A22A 3TKFA 3M41A 4TMBA 4EF9A 5I3KA 1MEWA 2GUUA 2NWRA 2JK2A 2VENA 1T8XA 1LZOA 4ZZ9A 1I2QA 5G2IA 2WNNA 2I9EA 4NQ1A 3EWUA 4YL2A 3S1VA 1QOQA 2ZZ2A 3P67A 4OE7A 1GEQA 5D04C 2EPHA 3OVRA 1SQ7A 3Q58A 3W76A 2V5BA 2FPTA 3SW6A 2GVLA 4CCCA 2TYSA 3DH7A 3CIXA 4WOZA 1S5VA 2FB2A 1IF2A 2DJLA 4UFHA 2VEIA 5I3FA 3CPRA 1FX6A 3AJXA 4UTTC 1FWNA 4IMGA 3NXFA 3CM4A 1QOPA 2WOQA 2BWGA 4QAIA 3SR7A 4LC8A 5AYXA 3TJXA 1WDWA 5AYYA 3LCFA 1SFJA 3TXZA 3TH6A 1GT8A 3G22A 1GYLA 3GVGA 4YWIA 3PY2A 3S9YA 4E2DA 3F03K 1A5AA 4E2BA 5FF3A 3GLCA 3VE9A 3NQCA 5I3GA 5DY2A 1RZMA 1QPRA 4HNTA 5HWMA 3RLVA 4O16A 4XBKA 3WK3A 4O11A 3L0KA 4GBUA 2CLIA 1FCQA 3THQA 3B0PA 3NQ7A 4UTIA 5CPMA 1VLIA 4H4IA 2FB3A 1EWEA 1XM3A 2PC4A 3IIZA 3M0ZA 5F1VA 1CI1A 1KA9F 3TA6A 1CX9A 3G0UA 3GR7A 5IBXC 5HWNA 4RXGA 3KVKA 3CT7A 2GJLA 1GG1A 1SO4A 4AMAA 1VLWA 1LBLA 3W7IA 2ZZ3A 3TV8A 3A5FA 5LKYA 1C8VA 2VFFA 3UZJA 1N8FA 2FPVA 2ISSA 1JUKA 2NX1A 4AWTA 5LNRA 4D2JA 5E0KA 3OBKA 3TDFA 4FNRA 3NQ2A 1C29A 1W3TA 5L6UA 1OX6A 3P82A 2E5BA 3UPBA 4PL2A 3TC7A 1YTKA 4XBSA 1OYBA 3P5YA 3HQ1A 4U28A 1K8YA 3RF9A 5H2ZA 4NU7A 3S5NA 1YDOA 2H8XA 2YW4A 4JTLA 1M7PA 4AVFA 3MBDA 3NM1A 2ALDA 4PC8A 4MY9A 3C56A 3G1YA 3O6DA 1FXQA 4UMCA 4X2RA 3W73A 3I6RA 3PULA 4XZ9A 1PE1A 2C0AA 2DP3A 1TIMA 3NQFA 2NUWA 2ZFAA 2YR1A 1FWWA 2GVGA 3BW3A 4LV9A 4MFEA 1B4KA 3GAYA 4R53A 4CQ8A 5AB3A 3WK0A 3W7KA 3ZR4A 1DHPA 1H7XA 1JCYA 3P74A 5F4SA 2NX3A 4Q32A 1LLWA 2B7OA 5CZSA 3USBA 4WJEA 3VI2A 4DF0A 3L2IA 3SZ8A 4FXSA 1K02A 3GKAA 3TK7A 5K9XA 4DPQA 4NJKA 1OX5A 3U6WA 5F2GA 4FB7A 4OV4A 5LHEA 1XXXA 4N02A 3TNOA 4JYEA 5H91A 1W1ZA 4UTUA 1TJRA 1RVGA 3TQKA 1WA3A 4B5NA 1SPQA 1TRDA 4QM1A 2VFDA 1WXJA 1SFLA 2I14A 1KTBA 1KFEA 1KBIA 5HJLA 3W7MA 4AF0B 1VHNA 1NF7A 3LRKA 3A21A 1XBYA 3W1XA 1Y0EA 4QJ1A 4IMDA 1ZENA 4OWGA 3FIGA 3DFOA 2P10A 4ADTA 1Z41A 1H1YA 1KM6A 4S1FA 2J6XA 4E38A 2ZBTA 3O6YX 1DOSA 2D73A 3LRLA 4IMFA 3MI2A 4UFMA 3TMQA 4GUIA 1ADOA 1TRIA 3NQEA 3GDKA 5AC7A 3W1RA 3D0CA 3SY5A 3WJZA 2NZLA 4WXZA 5C6MA 4LS2A 2E1DA 1DV7A 3PUDA 4CCEA 2V2HA 4Y9AA 2A7PA 2YYTA 1OFPA 2V8ZA 1ICSA 2ZRZA 3UD6A 1OFRA 3M43A 5D37A 4JY9A 1W5OA 3UZ5A 3R5EA 1GJPA 1H61A 3LTSA 3O1NA 3BG5A 3HF3A 2Y7GA 2C6QA 4K6AA 1GG0A 4EF8A 3GYEA 2QEZA 2ABAA 1ICQA 5CSRA 1I2PA 3LHWA 3ELFA 3GAKA 3DKJA 4BR1A 3M6YA 1YTDA 3PVFA 3PSWA 1F2JA 1YXCA 2EKCA 4YXGA 1S3HA 3PG8A 2WKJA 4RCXA 1S5TA 4MYXA 4Z1AA 3K30A 3MWAA 4MOZA 3O15A 3EEGA 4JTUA 1A50A 5TIMA 2RDUA 5LNUA 4K37A 4X9SA 4NNAA 1HO1A 1H7OA 1TV5A 2LLEA 4GUJA 1FUYA 1FBAA 2X1UA 4JIPA 1GOXA 1JCMP 2ZRUA 3P60A 1Z48A 2OT1A 5BMWA 4U4MA 4JIQA 5ABTA 4DBEA 2ABBA 1EP2A 2WSYA 3EWYA 2J27A 3EX2A 3OG3A 5HNRA 2VC6A 1ML1A 3T55A 1OK4A 1P0KA 1Q45A 5BMXA 4MYAA 4HPXA 5AOUA 1RV8A 4O1CA 2V82A 1WOAA 2A85A 4NJIA 1W31A 5A8GA 1BKSA 4FNSA 3OVQA 2OJPA 1EA0A 1GVOA 4NXSA 2CU0A 3LHVA 2B4GA 3W1TA 2BZNA 2QDGA 4ZL1A 4QNEA 4HSOA 3LCGA 3W7DA 1K8ZA 3C4UA 4M5PA 4JTKA 1JCXA 3EXSA 3RLUA 1QNVA 4Z1DA 3GNDA 4MFDA 5FESA 4JICA 1LP6A 4H6KA 3L5LA 3W72A 3OEXA 1TPVA 3W2NA 5D05A 1Q6OA 1I2RA 4FIRA 3MI6A 1LOLA 3L21A 3ZFHA 1QMLA 3SI9A 3IIOA 2C19A 4MPQA 1KFJA 3L67A 4ICNA 3NPUA 3TU9A 5D2TA 3G1FA 3P8JA 1RQEA 1ZAIA 4C1KA 4JTSA 1QCWA 4UR8A 5U7SA 5D09A 4DPPA 2CLOA 4QQ3A 3W2JA 4PODA 2XFWA 2YFNA 3HMJG 4ADUA 4Q33A 1ME8A 1FDZA 1M6JA 3PR2A 3KVJA 1FWTA 1K3UA 5FEXA 5HMSA 2QJIA 2CLEA 1C9DA 3QW3A 3W3OA 3LV5A 4CQAA 1SW0A 1W0MA 3T4CA 5KZDA 1VGAA 1ZCOA 4LY8A 2QKFA 2YCEA 1LOQA 3JR2A 3T7VA 2A7NA 2DZPA 3SIZA 1GTHA 4WX2A 1OX4B 1AK5A 1IGSA 3CTLA 4UNKA 4FF7A 4UFLA 4OT7A 3NQVA 4ADSA 1ICPA 3NQAA 3L66A 4HPJA 4W9TA 4ORMA 3TUUA 3A22A 3FEMA 5CSSA 3WJWA 1G4EA 3EWBX 5FEPA 1QWGA 2CFFA 4G1KA 4ZVJA 1RD5A 3KX6A 2Y62A 3LERA 3QH2A 3LHYA 3P62A 3W2LA 1BWKA 3N14A 1ZJIA 1XL9A 1RQBA 2YZRA 3W2KA 2VEKA 4UTWC 5D02A 2CLMA 2E77A 4JNMA 2JKEA 4A3UA 1TTIA 2ISVA 1W56A 3VNDA 3DKLA 3S42A 3THAA 4OHQA 3PBUA 2HS8A 3M47A 3NA8A 1KLZA 3LM7A 3O63A 4UNLA 1NFBA 3TE9A 1EUAA 2ZZ5A 5GVJA 1YYAA 1BWLA 5CZ0A 3T78A 4O57A 3TFXA 4BWLC 3FFSA 1B57A 1GVSA 1RQHA 1Z44A 2X1SA 2Y7FA 5CG7A 5C5YA 1SR9A 5AC8A 3KAOA 4L4LA 1FDYA 1EUNA 2A2IA 4R33A 5BW6A 5KTLA 1O5XA 3MYOA 4DO5A 2NXIA 3L68A 4K36A 1YDVA 3B05A 3W75A 3TSMA 2ZCGA 1DQWA 3C52A 3MI3A 1G69A 1TPB1 4P2VA 4UR7A 8TIMA 4ZQCA 1AW1A 4WY0A 3ABQA
chains in the Genus database with same CATH superfamily
3H2AA 1UPPA 4HNLA 1UB3A 5T9CE 4AMCA 4M81A 2A1YA 4KFPA 3R7MA 2DZSA 2PGEA 3VABA 4WY0F 3C3NA 2DH3A 1H0GA 4QDWA 1IIGA 1AMYA 1KM3A 1I1XA 3BK0A 2BOGX 4RXFA 3ALGA 2C0HA 4FOKA 1JUEA 4DBUA 4XAZA 3MBFA 2E28A 3PHAA 4PFMA 1PIIA 2R8WA 4I3GA 3EPOA 1QVBA 3N19B 1V6VA 3VUPA 2VWTA 3UWUA 1R46A 1DWGM 4NJHA 3QGAC 3UR7A 2QUTA 3UCDA 1B54A 1REQB 3WH7A 3C0LA 4IWWA 4IFOA 1G0CA 1ONEA 2PGRA 2ZC8A 3LG3A 2I5IA 5E6ZA 3NL3A 3QN3A 2GK1A 4AD2A 3RNDA 5DCBA 2C15A 2V0TA 1LORA 4UQ9A 4QGCA 1F61A 3W27A 4CNPA 2Z7GA 3Q45A 4IG2A 5C71A 4BI5A 4GO8A 4L6DA 3STGA 3WFZA 3KW3A 4LSBA 4KFOA 5GNXA 4RK8A 1EA9C 3KZSA 2DVUA 3WLIA 1DE5A 4PEKA 3F2CA 2VGBA 4XAGA 2B7QA 2Y89A 3NPVA 4KWUA 5A5WA 1XLCA 2Z2UA 3LTPA 1LJYA 3RCMA 4RDWA 1SZEA 4N4PA 5CLWA 2PDNA 3LGGA 2Q3OA 1H51A 2DZUA 1P5BA 3BQ6A 2QHAA 2C16A 3ZO9A 1GOIA 4UTTA 1CZ1A 4HT3A 1JCJA 3E2QA 3W88A 2QV5A 2ZA3A 3UWQA 1M7OA 4RZBA 4J3WA 1JQVA 4D6HA 3RN6A 4G7FA 3H2MA 5D2WA 2NVDA 3PWIA 1PZ1A 3H7RA 2MNRA 3I4KA 3BL3A 3FV9A 3EPMA 2A6LA 3P6LA 1B3YA 3PB0A 4GXPA 3WEOA 5J8LA 1JG9A 5DRCA 3GO2A 4WGXA 2OX1A 4TUFA 2HZGA 3FYPA 4W8LA 4Z2LA 3M0HA 1KRBC 3HQNA 2B0MA 1NDVA 1LOSA 4RDYA 5EFDA 3T08A 4QFUA 4BF9A 3C0JA 2XN2A 3WBWA 3NR0A 4CU6A 1ZHAA 3L5MA 4X22A 4W7WA 3T2QA 3O3RA 1W3JA 3OODA 1FCVA 1SZRA 3M0MA 1I2NA 1JNEA 1VYPX 3S2LA 2OXNA 3OW1A 3I3DA 5C70A 2RDTA 1KFCA 3F1QA 3LZ3A 1VKFA 1IZJA 5BWFA 1J0IA 3B40A 1XFCA 5EMKA 2GJRA 4FXRA 3W07A 1OCBA 1TTJA 4M6QA 3C6CA 3VD7A 4Y90A 5J5RA 3GU1A 1KM1A 1OZMA 1VQTA 4DXVA 4IOTA 4FEZA 1KFKA 4LUTB 3CHFA 5D32A 2W92A 1WYIA 2G0WA 1WAUA 4XAFA 4XTDA 2WMJA 3UA3A 3ITOA 1U5VA 4QG9A 4LAUA 4DLMA 2ZZ1A 1LT7A 4RX0A 3HO8A 1RA5A 3NEVA 4Z2IA 1C8QA 3TYDA 3UCCA 4QS6A 3VC5A 1XKJA 3W2MA 4Q8NA 5BXTA 4AZ7A 2IQ0A 2VEMA 2E6AA 2YBVA 2HPMA 4I9TA 5HXMA 4OBRA 4O13A 3FA5A 4EX4A 4C6DA 4QJ5B 1HX0A 2GVEA 5F2IA 2RFGA 4GK8A 3BOFA 1TCDA 1XUUA 4OIFA 1B9ZA 3IAPA 1DL3A 5DRIA 4HMEA 4K7VA 1CLVA 4QEEA 5FCZA 4ZQMA 4PCTA 5CGMA 2PWVA 4MY1A 3O8AA 4Y9PA 3ZJ7A 3ARYA 2QYGA 2HVMA 1MUMA 1KXTA 2QV4A 3NSMA 1E15A 3JZUA 4GXWA 3KEHA 3KRSA 1L6SA 4CD5A 1CPUA 1XLEA 4IXXA 2YSWA 3BVJA 5AHIA 4EOUA 2X16A 1K7XA 3P0WA 3ES7A 5ECVA 3NQGA 2CPUA 2FGZA 4Y9NA 1GKPA 3WDPP 3PBWA 1A5NC 2C8NA 3TOPA 3PNUA 4I7WA 1QK2A 4LWWA 1V03A 3BJSA 1VPYA 1UZDA 3GS6A 4ICCX 4XZMX 1KBLA 1AJ0A 4J28A 4BF7A 4IMCA 5G1YA 3C2OA 1VYRA 3W7QA 3TR9A 2CHNA 3W1AA 2F6XA 2VDIA 2PEVA 3B4UA 4GY1A 3STEA 4P7OA 1XFBA 3T40A 2QCFA 1EPXA 4H6RA 4S39A 3H70A 1SMDA 1J8VA 2ASHA 3MY9A 4PULA 3USZA 1E1CB 1R2SA 2IS7A 1XW8A 1D8WA 5DY3A 1NM9A 5ENLA 2OWCA 2CERA 2HK1A 3HJZA 1O1ZA 3CZ8A 1K9EA 2J8FA 4D8LA 1A5KC 2C1HA 2ZRWA 1TA3B 2EPOA 1EB3A 1HJUA 2ZZ7A 3T0CA 4DO7A 3UXLA 1A49A 2J88A 3S5OA 3PBGA 4C90A 5HJYA 1RAKA 3C2EA 3VKDA 2B7PA 5CPSA 4QLJA 3ZSTA 3NEHA 3EWWA 1WDSA 4YTSA 2XH4A 7REQA 1W2VA 5DANA 1EX5A 4IIEA 3QR3A 1TJPA 5XIMA 1CLXA 1K7EA 2VZTA 4F9DA 1DXFA 3V4BA 3DFSA 5CPNA 2XDFA 3H4GA 1XYZA 4MJ4A 1GPWA 1UJPA 5I7GA 1R2TA 2VUYA 4GJ1A 3RPMA 3DBPA 3NVDA 4MNMA 1DQUA 3MYPA 3AS0A 2ACQA 4LVFA 1A3WA 1IEWA 2H6RA 3NO3A 3PPGA 1JFXA 2PP3A 1DIDA 4GO9A 1IT8A 3QXBA 2CW6A 3M1ZA 4PMDA 2EPLX 1ZAHA 3E96A 1O60A 4D6GA 2JBMA 4S3DA 4UTKA 4O18A 4DY1A 1YHTA 3DFQA 1TB3A 3SO7A 3TWBA 3DHUA 2NUXA 2Y6ZA 4F0MA 4F4RA 4WOQA 3EKLA 1E4MM 5LXEA 1PTAA 4PSPA 1W9UA 4UCFA 1MW3A 3F2BA 5LNVA 1R7OA 2AMXA 2YX0A 3IEBA 5D9NA 1IEIA 3ATYA 1UR2A 1OG6A 3IJDA 3QZEA 3E0LA 2ZWZA 5D9OA 1L8NA 2XIOA 4LQ1A 4Q8UA 2QCCA 3M07A 4FPSA 3SURA 3FKRA 4KWWA 5A2BA 2NQHA 3BWWA 4FOUA 4KGLA 3H2CA 3PUEA 4H8UA 3DYOA 4XWUA 1EC9A 3CIWA 3GFXA 1NEYA 3WG6A 4C1NB 1TTQA 3CZJA 4AQLA 4AZHA 3L4WA 3AI0A 3GD6A 1XLLA 1BXBA 4CKQA 2E7FA 4LFYA 4GI4A 5HNNA 4GY0A 3OOQA 4C6OA 4H3DA 1OD0A 4QITA 1KB3A 3ORWA 1KCZA 2EXOA 4B3KA 1QHZA 4UTMA 4E2VA 3MVTA 3AXXA 3L65A 3RLGA 2GQ8A 2WNZA 3CMGA 4FNQA 3PJWA 2BXVA 2ATMA 2PGWA 4E0CA 1EP1A 1AL7A 3W1PA 1BPLB 2D24A 5L9FA 3JS3A 3O2LA 3WQPA 4N9DA 2Q8LA 2RJGA 3VKJA 3ZJKA 4JIHA 4RV3A 1VBGA 4MZ1A 3U2CA 1ITXA 2ACSA 3LI0A 4KETA 1G4TA 2Y7EA 3CLWA 2PD5A 4JR5A 5E0FA 3LD5A 5GJPA 2OMAA 1FVPA 2QS8A 5FOOA 5CSUA 3CGTA 4WIWA 1R87A 4MNJA 3L12A 1JL8A 4NAFA 5IHSA 1CXEA 3JRKA 3CMJA 4NG3A 1JJKA 1LQAA 3K2GA 3UXIA 4A2RA 3KRZA 5FJRA 5T9BG 3ABSA 1YPXA 3SY8A 3W1LA 4ILSA 4YN5A 4DELA 1I0BA 4FSAA 4GIAA 1RJRA 2WCGA 3F2DA 3R25A 1XC6A 4EAYA 3WH9A 1PSCA 3IAQA 2V81A 5AVHA 4HBKA 2HCVA 4QE5A 1HL2A 1CB7B 3VDGA 1ZGDA 3W1UA 4O0KA 3QQ1A 1B3WA 3WQWA 3I7SA 1UD8A 2WSPA 4AEEA 2C79A 4Q4QA 2GJNA 1BKHA 1VFHA 4HCLA 1IXQA 3CWHA 1LLOA 4LGXA 4UTHA 2E6YA 4I7UA 4ROQA 1IT7A 4NXKA 1QK0A 4IF2A 1PZ3A 1A0CA 1GKQA 5A2CA 5BWAA 1WBJA 1V3JA 2DSZA 4H9YA 1RBLA 2A3EA 4O1AA 4A3YA 1DJIA 3KBJA 3H6OA 5D9MA 3WDJA 1HKWA 4GKLA 3V18A 7REQB 3HOJA 3WLHA 1XP3A 4HMNA 1PKNA 2WO5A 3N17A 1ZLPA 1S1PA 1CIUA 2DFAA 2BMBA 2XVGA 4JIIX 4PB4A 2FH8A 1PDYA 1V7AA 3V1PA 3LENA 1VYSX 4A3RA 5FJUA 4EWJA 1E3XA 1J2WA 4KEVA 3FJLA 4E3TA 2VMFA 4JTEA 3VIIA 4PMJA 3VIGA 1EJ7L 1VFOA 2KZHA 5I00A 3VA8A 3EWDA 4G2DA 4M8UA 3BLFA 4NYYA 3U48A 3DCPA 4YYCA 4B2DA 4QAWA 3APTA 2CHOA 3HG5A 2AGTA 3REQA 2BGQA 1EL3A 2CXEA 3BGGA 4OV9A 3WH8A 5DN1A 4LYPA 3UZYA 3N11A 4MWAC 1TJ2A 4LVDA 4QE4A 4C7FA 5TQLA 1M9HA 3MCMA 1XIDA 1H3GA 2Y5JA 1Q8AA 1GOQA 2J79A 3HTWA 4QSHA 2IQTA 2GGIA 4FMVA 1FDJA 3NAVA 2ADAA 1IEVA 2VHLA 1OIFA 2O9TA 3GR8A 1J4EA 5CXPA 1XLKA 1E0WA 2BLEA 2HE5A 4REQB 3WDIA 2UV8G 2VR2A 3SCQA 4AHQA 2ESCA 4QQUA 4KRZA 2YCLB 3DGRA 4DAFA 1XKYA 1LLZA 3QR1A 4K8HA 4DYEA 4UTFA 3CNYA 3BUVA 1NQKA 2D2JA 3J7HA 3MC5A 4D6EA 4L6HA 4ZGYA 4UZUA 5BRBA 4IX0A 3L4VA 1GPFA 1T6MA 4AZBA 4HQVA 4J3TA 5FF4A 3LA4A 2J4GA 1YXDA 2CZDA 1IR2A 1RJQA 3RHGA 2VEFA 3QBUA 1GHSA 3ZT6A 1KRMA 1P7TB 2V2DA 4C91A 2XIIA 2VR5A 2VRJA 4KRUA 3MP5A 2WMGA 4Z0JA 3CUGA 2QR6A 3LZ5A 2W79A 3L4ZA 2EHHA 3PZ9A 7A3HA 3QQWA 5T8GA 4XX6A 3NL2A 4Q4MA 5SWUA 1JZ6A 4UQCA 1J0KA 2QZRA 3H53A 1ZFJA 3IGHX 4PEEA 3G8RA 1QPOA 3AHTA 3LBMA 3N18A 1W1VA 4GYPC 5H1WA 2ZOXA 4HNUA 4GMEA 3BGAA 1QHOA 5AVNA 3QSRA 3S46A 2WNQA 1VBUA 4JFVA 1X6UA 1V0NA 4ZO6A 1CW2A 1KC7A 3LGEA 4U31A 3WEMA 2PMQA 5I03A 3FAWA 4KCUA 4XBJA 1YNPA 4LF1A 3S83A 5AYZA 2G95A 2PURA 3VTRA 2TAAA 1R3WA 2DDXA 3MP3A 2UY5A 1XYCA 4JHOA 3MUXA 3RX3A 2DIJA 3VCCA 2ONEA 2BODX 3LXBA 1BGGA 3R4IA 4A21A 2VWSA 4IUOA 1S5NA 2PDHA 2CKSA 3FHQA 2C3ZA 1OVDA 5K4ZA 4PTNA 1LG2A 4HMCA 2ZC1A 3AXKA 3PBMA 1Q7MA 3VILA 2C14A 1A3XA 4KFNA 1TWZA 1V8EA 2PA6A 1TJ0A 2VFHA 3CH9A 6A3HA 2BOEX 1MRAA 3AWNA 4Q6JA 1L6FA 1ADSA 3MTWA 3SAZA 4HZ8A 4H8VA 2AQOA 1US2A 1E6ZA 3CB8A 5F2LA 2YDRA 4R9OA 4AW7A 3EA2A 3ANYA 3NCOA 3N6JA 4GJJA 4LC6A 4AX6A 3BH4A 1KCXA 3BV7A 4L65A 1H5VA 1KR0A 4DBSA 4ZFCA 3R12A 3PZGA 2ZUTA 1YE4A 2XUCA 1VBHA 4Q6XA 1KD0A 3QLLA 4D6JA 2GZXA 3C2RA 5EFFA 2ZX7A 4HPGA 2EBNA 2QAPA 1F05A 1GQNA 1BRLB 4MSSA 4LVGA 1HJQA 3ITGA 1PBGA 3W22A 3FEQA 2DGAA 4PTVA 1KFBA 1TJ1A 3FNDA 1S38A 1Y7VA 5LGZA 5PTDA 3C5QA 2OOFA 3E02A 4C65A 3NUKA 4P61A 4XAPA 3DYPA 5KMYA 5F2MA 1K77A 4FI4A 4X0NA 2ZVRA 3ANVA 2YB1A 5HWJA 4MM1A 4HU0A 4NZJA 3FSTA 4EPDC 3H2NA 2W0UA 4F0LA 4MKVA 3T0DA 4EPEC 2F9RA 3UJFA 3H26A 1BLIA 4LBSA 1VR6A 3W2UA 5CC6A 2JIWA 3C0QA 2PDKA 1AH4A 1XBZA 1JNDA 3IARA 3PZUA 1AD4A 2R1NA 3BCDA 4MIMA 4KWSA 2VR4A 1KWKA 3QV6A 3HPXA 4CD7A 3S5YA 2POZA 4GD0A 3BPWA 5FJOA 3IIVA 4PMOA 4B90A 4PTXA 1P0EA 1J5TA 1SZGA 3G3DA 3TNBA 2PRMA 3NQMA 3P0XA 3UG3A 2A6NA 3RAOA 1V6YA 2PP1A 2VKZG 1FH7A 1FWDC 3LXAA 1IV8A 1PJ9A 1JFHA 4AEFA 3BLOA 3LK6A 3CUZA 4Z1YA 3CL6A 3U5UA 4IJCA 1A0DA 3DI1A 1GYNA 2UY4A 4LVAA 1BYAA 3OGVA 3S1GA 1HL9A 1H1ZA 5MF5A 2DZWA 4MLRA 3F7JA 1R9YA 1UUMA 3NZ1A 1W54A 2WHKA 1EGMA 4HU3A 2X1IA 5FI8A 3LYEA 3R58A 3DENA 3EX6A 1Q6RA 2PAJA 2PDYA 3QOKA 5TD4A 1AA1B 1V93A 5M3WA 1WZLA 3TYZA 3VINA 3TKFA 3M41A 4H01A 4IQDA 4W7UA 3PJUA 3FA3A 1LZOA 4ZZ9A 3GC5A 3UR2A 4J3XA 3K1DA 1TA3A 2ANUA 4N0RA 3TN4A 2ZZ2A 5E5CA 4OE7A 3OVRA 3RMEA 1SQ7A 5BXRA 1E40A 2P0IA 4G7EA 1Z89A 2GVLA 4CCCA 2OQYA 1N8IA 2TYSA 3AROA 1IF2A 2DJLA 3R10A 4DYKA 2VEIA 1V6UA 1VEMA 1FX6A 3GH4A 1XGEA 1EO5A 2ZUUA 2P3ZA 4S3JA 3LSBA 5LIYX 4H00A 3AHVA 2VURA 4IIFA 5AYYA 3TH6A 2WJDA 1VAHA 4NIRA 4WKFA 1FTXA 4QROA 2FMOA 1A47A 3E38A 3HURA 3S9YA 2C1GA 3V7PA 4GQ0A 3GLCA 3VE9A 2AL2A 1CNVA 3NDYA 4Q8PA 5I3GA 1RZMA 4HNTA 4ERIA 4PBFA 3AMDA 2D3NA 2CLIA 1FCQA 3CL7A 2DY3A 3FA4A 4H4IA 2ZXDA 1VENA 2J78A 4LBUA 2QF8A 1BWVA 1GQIA 1OM0A 1CX9A 4H9MA 4O1EA 3VX0A 2G3IA 5HWNA 2GSEA 3N6HA 1VLWA 3RM9A 1LBLA 3A5FA 3QGKC 1TIWA 4F0KA 5F7UA 2FPVA 1P0DA 4W84A 2P76A 4PUWA 4D2JA 4ACZB 3OBKA 2KX9A 3GFYA 4NZ3A 2NQ5A 3P82A 3TC7A 2XIMA 4M56A 3CYVA 3WF4A 3SCPA 2BDQA 3PNZA 3K8LA 1GZJA 4AVFA 4MY9A 2X8RA 3O6DA 5DO8A 2PS2A 4OUIA 3AYSA 2DP3A 4F0RA 4KEMA 2NUWA 2ZFAA 4XSMA 1KRAC 1JD7A 2YR1A 3VMNA 1B4KA 3GAYA 3WK0A 3ZR4A 1HQTA 1OY0A 1H7XA 4GZ7A 1K9DA 4AD4A 5F4SA 4GX9A 1LLWA 2B7OA 3PTKA 1CLKA 2WXDM 2ZX5A 3T42A 1K02A 2AKMA 4FXSA 2PBGA 2GOKA 3W28A 5K9XA 4DPQA 1OX5A 3U6WA 5HNUA 5LA2A 4N02A 3TNOA 2P88A 4DB7A 1W1ZA 3EOEA 4UTUA 2ZX6A 3CJPA 2CHRA 4D8AA 4Z2JA 3LU2A 3FYYA 1XJBA 2IPJA 4JKMA 2I14A 4ZFMA 2DZAA 1ZBWA 2ZICA 4RL3A 4AF0B 3VOJA 1NF7A 1ZUAX 3LRKA 3VM7A 1XBYA 5IDZA 3IWPA 1XLGA 5B80A 2PSNA 2P10A 4ADTA 2GYIA 3BQ5A 4S1FA 2J6XA 3F4VA 5MKGB 2FJUB 1DOSA 1DWJM 3TMQA 4UFMA 1ADOA 3TN5A 2ZE3A 1U22A 3D0CA 2NT0A 2NZLA 2V3EA 4GQRA 4LS2A 2E1DA 2Z00A 4CCEA 2YYTA 3EB4A 5C2GA 5FJJA 4D71A 1TELA 1S2VA 3RILA 1OFRA 3RXZA 5M1TA 3PP7A 1GCYA 3W6LA 1GJPA 4QBXA 3ZIZA 3A47A 3GUWA 2BHZA 5CAHA 1DWFM 3RITA 1GG0A 4EF8A 3RU8X 1JCTA 2WVUA 5CSRA 3BTNA 1JYXA 3QOMA 4IFRA 3AHYA 4BR1A 1YTDA 1YXCA 4YXGA 6XIMA 3K30A 1WDQA 1W1YA 3O15A 4F2BA 4GX8A 2HXTA 1UKTA 2ZIDA 4AYGA 3MPGA 5TIMA 2IKJA 1TE6A 4K37A 4C6IA 5HPOA 3MZ2A 1H7OA 1E0UA 3WQOA 1FUYA 4GUJA 3B3DA 1FBAA 4JL2A 1WKDA 1UR0A 2DIKA 3A4XA 4Q8MA 5BMWA 4U4MA 4DUWA 5HOSA 3N15A 4DBEA 2ABBA 2WSYA 4I9MA 3EWYA 2J7CA 5M03A 3CIVA 3AWOA 1MI3A 2D22A 5HNRA 3FAXA 1P0KA 4MYAA 4D6FA 5HPCA 5AOUA 1A5MC 3GE7A 1TVPA 3MDUA 4NJIA 1W31A 3WBAA 2OEKA 4CVWA 3WLKX 4AIUA 3U57A 3NDZA 2PWGA 4QNEA 4HSOA 2PWEA 2VT0A 4AD1A 1XIJA 4HZ6A 2ODOA 1QNVA 3N12A 4Z1DA 3GNDA 3CQHA 4JICA 3REQB 2NW0A 1LP6A 3W72A 4AZCA 1JF5A 2XG9A 3PZVA 3URBA 4NP7A 1K6AA 3IIOA 1IT0A 1KFJA 1G01A 3L67A 1S5MA 2Z4GA 3LPFA 4C1KA 2C1IA 4UR8A 4ZOEA 3AUOA 1WZMA 4QQ3A 2Z24A 5D9PA 1ME8A 1W9VA 1M6JA 1S3TC 1QNPA 2VX5A 3LLXA 1UKSA 8XIAA 1KCLA 4CQAA 2Q09A 4DLFA 3D3FA 1EC8A 4PB5A 1W0MA 2VX4A 4LY8A 3W37A 2QKFA 1LOQA 4S3GA 1GTHA 2F8QA 2PWFA 1ZJAA 2WLZA 3KWXA 3CTLA 1UR3M 3D6NA 4HPJA 4ORMA 3FEMA 1TKKA 5FEPA 5ABFA 4G1KA 1RD5A 3PPFA 3LHYA 5CBIA 5XINA 5JQ9A 3GDBA 4DIAA 4DBWA 1RQBA 3GYCA 4UTWC 2GGGA 4ZB0A 1W3HA 1R9XA 3DKLA 3VNJA 1IZCA 3THAA 5EB8A 3M47A 4C6NA 4E8DA 4XZWA 3QKZA 3G5EA 2WMHA 3TE9A 1EUAA 1CENA 5GVJA 1YYAA 1ITUA 2PWUA 3TFXA 2A3HA 2XWDA 1DPMA 2X1SA 5C5YA 3GVQA 3I6EA 2R6OA 3B8UA 1E3ZA 1X6NA 3VNKA 4OJYA 4LALA 1EUNA 3PJTA 2D20A 2V69A 3R0KA 1KXVA 3W75A 1SMAA 1RCQA 3QKEA 3C52A 1EZ2A 2OB3A 1G69A 1G94A 2OOGA 4UR7A 8TIMA 4ZQCA 3ZT7A 3V0TA 3N2OA 3PC0A 5A94A 3S5SA 4CD8A 4J35A 3W0KA 4J3UA 4HA1A 1E71M 2XVKA 3BLEA 1SJCA 3QF0A 4DVOA 2BGSA 1E6RA 1QRQA 3VIOA 1FHUA 3ZVIA 4PR4A 3C8FA 1F4HA 4TO8A 3PUGA 4W5UA 2XYLA 1KM2A 3CC1A 4DI9A 2POTA 3W7PA 3GXDA 2XZ9A 1TPDA 4M82A 3U4AA 2JFEX 1KFLA 2ZXAA 4JYDA 3WIJA 3BCJA 3W01A 4LOCA 1JVNA 2RKXA 2GGHA 3S1UA 3AC0A 2PZNA 2FFIA 2GSHA 1XX1A 3WD3A 3EKZA 3MMDA 3QPZA 3EX1A 4Y96A 3WQEA 3QYSA 2QDDA 4FX8A 3TZFA 3S8HA 3ONBA 2EKGA 1XRSA 1W6TA 4NT0A 1S2CA 3M6DA 3BSMA 2D1ZA 4IQEA 4LNCA 4V15A 2ZX8A 4CVUA 4REQA 4QISA 3VE7A 5BU9A 3GNNA 4M1BA 1KQYA 4GUFA 2D69A 4LAMA 4JTIA 4MB1A 2HBXA 5A8QA 1XPYA 4DJDD 3LCWA 2X2YA 2ZUMA 4XKYA 1B5TA 5D8WA 2QJGA 3KHDA 3P81A 5DT7A 2H3BA 3PZNA 5LXXA 5JXQA 1EYWA 3O06A 3GG7A 1U2YA 1RCOB 1T41A 3FLUA 1IWAA 4OTKA 1OJXA 3MP4A 4GISA 3IVTA 1SO5A 2EPMX 1J0HA 1S2WA 1XCWA 4PYSA 4LU0A 3KVMA 1P1XA 5DCDA 2W91A 3V35A 3L9CA 3CEUA 3HG3A 2GGEA 4UQDA 3I65A 3OTRA 4UQBA 4W7VA 2DU2A 2EG6A 1TWWA 1S2UA 2X30A 1PKMA 4FR1A 1AH0A 3WL0A 1XV8A 3M9YA 4O52A 3NO1A 5AHFA 1M03A 1V7YA 4ZA0A 4AXNA 4G6CA 2PLCA 2WJZA 3QMRA 3TSDA 1MDLA 3W83A 1LWHA 5G5IA 5LNSA 1V6XA 1U5HA 3O16A 1S5WA 4G9PA 1MEHA 3HGOA 4WCJA 5C8BB 3RU6A 3OGRA 3IIXA 2V38A 4J4KA 3W38A 4JY8A 4S2CA 3A23A 1ZY9A 1W8SA 3QHOA 3B8SA 1JCNA 1QWKA 1G67A 3EMCA 1JPHA 1G7UA 3LHZA 3N34A 1C8YA 4IP4A 2X7WA 4N9BA 5FEZA 3HG4A 1FWFC 2AQWA 1B0IA 2O9OA 1SO3A 1TMHA 3BW4A 3H12A 1W3LA 3CV1A 3MS8A 3TW6A 1X39A 1ZBKA 3SCVA 1WZAA 2IPWA 1K4GA 3WJSA 3GUGA 3PBVA 1GK8A 3SFKA 3FGCB 1MRQA 3OHIA 2QCMA 1SZNA 4AG0A 1IXPA 3EX4A 3MW7A 2REQA 1JEZA 3IIPA 3VDHA 3K8MA 2G96A 1Z6KA 1UUQA 1PHWA 4XO6A 3GTFA 3BOLA 3WLTA 3CASA 1SW7A 3LCIA 4JXCA 4EXAA 1EP3A 3F4CA 2FKPA 3CHCA 2J9ZA 2FTWA 4EXBA 2PDGA 3E12A 2Y88A 4MJMA 4DF2A 2PI6A 4NZ5A 1KWGA 1PIFA 3M64A 5JBDA 5HANA 1HXJA 1J5SA 4YPJA 5FSEC 3AIQA 4JFSA 1RK6A 1XBXA 3SRDA 4O14A 3TWAA 4Z2HA 4D6CA 2CBVA 1J01A 3FJ6A 4X60A 3QHMA 3VNYA 3DFPA 4H7VA 1WXYA 3GQYA 2QGHA 2E67A 1LTDA 3NG3A 2YDSA 2CWNA 5LHFA 3A9BA 4I8DA 1TZ9A 3DHDA 2XISA 4U3CA 4JTFA 1AD1A 2QUUA 3P80A 3WJXA 4HHHA 2OG9A 3P2VA 2WCSA 1QBAA 5ABEA 4RW5A 3S1XA 1BVWA 3CLMA 4S3BA 3VZXA 4UXDA 4WQ6A 1LUCB 1OABA 2DVTA 3PN8A 1MSSA 3HQOA 2DSVA 3G77A 1XYLA 4KKXA 4C6JA 5LGXA 1Q2SA 1UR9A 3A13A 4RJEA 3MV01 2ZRXA 2WSKA 3E2SA 4LAZA 1H5YA 1JR1A 3M5XA 1SSDA 4FS9A 2QW5A 3AMKA 3ID7A 4DBDA 1R3SA 3ZT5A 3Q94A 1N7KA 2XIJA 1MWOA 2DVXA 4JN8A 4L56A 1E6NA 4O1DA 4HTYA 3W25A 1P7TA 1NF0A 4OVXA 2V68A 1DWAM 5I2UA 1UD3A 2BBFA 1P6WA 3NZRA 4XUGA 2Y85A 4K39A 4ACZA 4J27A 1OFAA 1RALA 3AXMA 3S6DA 3CPUA 2WC3A 3UY7A 4RE0A 2FGBA 2TPSA 2DZTA 1D3HA 1MMFA 1IQ8A 1FQ0A 3KBMA 3LDVA 3ZXWA 1TPC1 5E93A 3STCA 4NZCA 4G8TA 2A3LA 1DJWA 2QDHA 1ONRA 3KUMA 2PDFA 4NNCA 3A6OA 2F84A 2YDQA 1AW2A 3GNRA 4V1XA 3PZTA 1TE1A 5D38A 3WNMA 4XD6A 3UXAA 4K3ZA 4AEOA 3UNDA 3ARWA 4U2YA 3O7UA 3ABOA 3AS2A 2CLHA 5U4NA 1V6TA 4O54A 1ZRQA 3POCA 1FHDA 1T7LA 3BMVA 4UFKA 5A6KA 3EPNA 3U2OA 3UZZA 4CLMA 3GU2A 3G2GA 1HKMA 2ZADA 3AMGA 2TRSA 5I3DA 1C92A 1EC7A 1R85A 1M53A 3AS3A 4HNVA 4UIOA 5EBUA 3GXPA 3KL5A 5AHEA 4DWDA 3BURA 4A8NA 2QJNA 5A95A 1LWJA 1OX4A 4AZ5A 5I77A 2DZXA 4AH7A 1E6PA 1X8FA 1QNQA 3S3GA 3SJNA 4HP5A 3TW7A 5ABHA 3L0NA 2Q01A 3N9RA 1B30A 1SSGA 1XSJA 4GYKA 1W1PA 3VKKA 1W1TA 4ZQPA 1QI5A 3PAJA 3M0YA 3DN5A 3UVIA 3PZQA 4HB7A 1WAWA 2PWHA 3NL5A 3GIQA 2WBGA 2PPGA 3M0JA 3BLDA 3KP1A 4EK7A 3M0IA 1MW0A 3QZAA 9XIMA 5TBOA 2ZZ6A 3S1WA 4DUXA 4UTLA 1J0JA 4ASTA 1JZ4A 3CT2A 1UA7A 5CBBA 4HN4A 1T99A 1HKVA 5F4XA 1FWGC 4E6MA 3W00A 3N9KA 3WQFA 3NQBA 4N9EA 2V3FA 1JZ5A 4NZFA 5A8NA 2Z0IA 2PDWA 2CCRA 4HPNA 3LNMA 3EWCA 1HF6A 3IVSA 4WR3A 4E8GA 2J6VA 1TSIA 3VDAA 2BY1A 2W27A 1HGWA 4LCSA 2NX9A 2H8ZA 4NSBA 3SUSA 4Z08A 3FOKA 3RPDA 4KEUA 3THDA 2P8BA 1UKQA 4M6VA 3BJTA 4KPLA 5GNZA 3EXRA 2DIEA 2Z28A 3RUBL 3PTMA 2OFJA 3SB0A 1Z7AA 3A64A 4U2ZA 4Z2GA 2WMFA 4XD3A 1CB2A 2YLLA 4DNMA 5DBTA 4H6EA 1OK6A 3B8VA 2PDCA 4IGHA 3VVGA 3C2YA 1FWSA 4I6VA 2BSLA 1NSJA 5KETA 3UP8A 4EE9A 2DT1A 2NV9A 3H4XA 3T0AA 2UY3A 1TV8A 1M1BA 5CJMA 4JX6A 4LYQA 4L4MA 1BAGA 3I7RA 4HOZA 3W74A 1HVQA 4FHAA 4N2YA 1F6PA 3E9AA 1C3FA 2P5NA 4WK9A 1IR1A 2R82A 4ZCWA 4CQ9A 3HBLA 1OT2A 3N2XA 1U1HA 3EB2A 4S3CA 2WHLA 4UNIA 4HHMA 4PTWA 1HW6A 3NGJA 6TIMA 3P84A 4PB3A 3RMJA 2HK0A 1NIUA 3MKKA 2HV5A 3GRIA 5AYBA 5D4YA 3ES8A 1AVAA 1I1WA 5K7JA 3RRAA 3FS2A 2FH6A 5IBXA 3WH5A 4PUJA 4B9YA 5GPRA 2F61A 4CU8A 4OQVA 2NSOA 1YADA 3AYRA 2INEA 3LCHA 2ZVIA 4HOXA 3IGSA 4ERGA 3W4RA 1UZ4A 1YDYA 1EJRC 3TYEA 2ATSA 1YKWA 3VFCA 1L2QA 3TLLA 3SCUA 2ZA2A 1UWIA 4TV5A 1E51A 1DYSA 2CETA 3O05A 3M5YA 5EYWA 3ZLFA 3FXYA 2HJPA 3HG2A 1V51A 1FH8A 3TIMA 1K03A 4Z1CA 3SN4A 1L9WA 7TIMA 3OHMB 4C6FA 1XRTA 4S23A 2QF7A 4TR9A 3W1MA 1THFD 1TPUA 1BYCA 4W5ZA 4UTJA 3MJMA 1PPIA 1NOWA 3QLDA 5HMDA 4IL2A 3FW6A 2Y61A 5D8ZA 1P6BA 2QXWA 2UBPC 5GJNA 3EB3A 3ITVA 2FZMA 1R38A 1VJIA 3HU7A 2XH2A 1P0BA 4C6QA 5H8PA 2WVTA 2A5HA 1DXIA 3W02A 4PCNA 5BROA 3VYLA 3ME3A 3BC9A 3G1XA 4DAIA 3WD1A 2VGIA 1HG3A 1I0DA 5CZKA 1NDZA 2BFGA 2JEQA 2GK1B 3DI0A 3ITYA 1RJPA 3CWOX 3WK2A 4V27A 4R7JA 5LA1A 1YX1A 3OVPA 7PTDA 3WLQA 1TO3A 4P8VA 2BGNE 4GCAA 4MVAA 3V0UA 1Z32X 1WXZA 4IL0A 4C6LA 3W7EA 3H8AA 3ZS4A 4JIRA 4FA3A 1A5UA 1OFOA 3KBVA 4GGHA 5A69A 3EX3A 3HB9A 4O53A 1DWHM 3WZ0E 3BZJA 4GUHA 1U1UA 5IFPA 4X3ZA 7TAAA 1PL9A 4Z1BA 2YDAA 3H2FA 3UGVA 4MB5A 2VQUA 1LYXA 3A3HA 3U8GA 5GNYA 1T5AA 1L6YA 1JYVA 1HT6A 2NQLA 5AZ0A 4FIQA 1LF1A 2Y1HA 3LOTA 3FY1A 2YA2A 3MZNA 4Y9OA 2YL9A 4ZO7A 4Q4SA 4DZHA 2E25A 1A5SA 2FJKA 1JZ7A 3OU8A 4IT1A 5K4XA 1D9EA 3UWVA 4IJBA 3SN0A 3DEQA 1BD0A 4GIYA 2WSQA 1OGGA 2HROA 4GYFA 5AFDA 3C2VA 3DUGA 3OQ8A 2O55A 1R7AA 5AHLA 4JTTA 4PRWA 3WUBA 3SUTA 3NIYA 2VCCA 4CNTA 1CWYA 2G97A 3AYTA 3W6YA 1W5MA 3WFAA 2D0GA 3W70A 1A3HA 3PM6A 3RX2A 2OZ3A 4IIBA 1P48A 4JDYA 4WXYA 3V0SA 1O66A 3DG7A 2P50A 3CQKA 1O12A 3GXTA 3DDMA 3MB9A 4O28A 4FF5A 5C9ZA 4A3HA 3HQPA 2A3BA 5A8OA 4XKYB 3L2MA 1JDDA 3BZGA 3O0KA 5LNWA 2ZQ0A 2YA1A 1LRNA 1WCGA 4Q8TA 3NXLA 5C7VA 3SJ3A 5HMEA 3QW4B 1OFBA 4QDPA 5FA5A 1N82A 2OSYA 4UCGA 1AQFA 2WWDA 1UBSA 1YRRA 4OOZA 1SZFA 2O9PA 1VPQA 1A53A 1SW3A 1GVIA 2NLIA 4O10A 1O6IA 4LNYA 3DFYA 3IRDA 5EL1A 4TU1A 4UOQA 3CPGA 4XB3A 1ISZA 1ITQA 4AXKA 4XKMA 4LXFA 4MLJA 3BAIA 3R89A 1V0LA 1W91A 1PUDA 2VDGA 2GSJA 4UQEA 1US0A 1BYBA 1JDFA 3T09A 1CYGA 1WBHA 4FALA 4GNJA 1TYGA 1JPDX 1JGMA 1B31A 4NZ1A 3GDMA 4WY0B 3E5PA 5AHNA 2H9AB 1EEPA 5CQ1A 3W1QA 1UIPA 2MUCA 4BS0A 1S2AA 1PWLA 1T40A 4DJEA 3PS7A 4H9ZA 4IJRA 3R1ZA 4HJWA 1J0ZA 1W1IE 3BAJA 2BVYA 2G5WA 1LWIA 3IV8A 3MO7A 1OBAA 4QCEA 4A8LA 2BS9A 2QQ6A 3GHTA 1W9PA 2Z6IA 3QZ6A 2YL6A 5C9RA 4CQCA 3GFZA 3TQ0A 1BEUA 2E3ZA 1J96A 3IJQA 3UPWA 2OZ0A 1UBPC 3V36A 4GI8A 4TVCA 1J6OA 2QCGA 3CUIA 3Q37A 2R94A 3HGRA 4CCDA 1W17A 4LVBA 4OOUA 2P3EA 4ONVA 3IGUA 1V5XA 2R1MA 4C7DA 3GM8A 2ZRVA 3KOWA 4ZTXA 1R30A 4FP1A 5REQA 4WDWA 2FVMA 3DXIA 3F5LA 1ECEA 1PDZA 3G1SA 2X41A 2Y7DA 5K2ZA 1ZPTA 2ZYFA 2WV8A 3B03A 3TMLA 2OEJA 3W7HA 3CXOA 1O68A 2YPIA 2WJFA 4BY3A 4ERAA 3L2LA 1GOWA 2OCZA 2YL8A 3B9DA 2J62A 1EO7A 2VFGA 3E0FA 1UH2A 1MDRA 3QQ0A 1GZ1A 4YLWA 4ZEPA 4DXXA 3W53A 5KINA 3IJIA 3STPA 3LBOA 4JDBA 1XDLA 1ISXA 4PCSA 2GVYA 3UJEA 2YKKA 2PCQA 2VI0A 4IXHA 4UFJA 1DKWA 2PDMA 4RV8A 1UIOA 1R2RA 3TLQA 1PKLA 1RY0A 1GGOA 1HKKA 4KQNA 3WUEA 5JIPA 5IRPA 4C5ZA 3APYA 3T44A 1OD8A 3EBVA 1J2BA 2OGYA 4BI6A 2JGQA 3RO8A 4YIWA 1FCUA 2GJXA 3MJYA 2J7FA 2G4FA 4H41A 1JRCA 4V2XA 3URNA 3NQDA 1BSLA 2PCEA 4LANA 4WJXA 3GU9A 4AIBA 1NAL1 2YJQA 4CNOA 1JZ2A 2Y5SA 4FX6M 5EA9A 3H2OA 5CPQA 4IMEA 2XSXA 3RCYA 1PHQA 1SFTA 2Z1SA 3W87A 1UQZA 3OA3A 1XF0A 1F3TA 2R1LA 3ZQ9A 4JCLA 3OB8A 1NDWA 2D0HA 4TMBA 3I3BA 1ISWA 2I9EA 1JPIA 1S2TA 4NQ1A 1Y5XA 3EWUA 5IHRA 2ACUA 2YCLA 1E9IA 3S1VA 4H6QA 1CXLA 3VZZA 2EPKX 2V5BA 3UPMA 1MQPA 1BQCA 1GQLA 3LSCA 5A6BA 3UF9A 2NT1A 2WPGA 1S5VA 3A3XA 3PFRA 1ZQ5A 3CO4A 1E9LA 5I3FA 3CPRA 1FWNA 3ARSA 1PTGA 1QOPA 3ZZ1A 4PMUA 1N8WA 3BDKA 2CZVA 1ODUA 2YZ5A 1SFJA 3S47A 3PANA 3TONA 4DM2A 1F4AA 1CTNA 3LMYA 1L0PA 3GVGA 4Q3MA 3TOYA 3GXIA 2PUZA 3B8IA 4E2DA 1A5OC 1EHNA 4IP5A 3NQCA 5CLTA 3SCOA 5DMMA 1UHVA 4ZOBA 4M3PA 4O16A 5A6MA 3QV7A 3THQA 4UTIA 5CPMA 2JF7A 2J7DA 1EWEA 3LN3A 4B3LA 1CI1A 2OYMA 2O56A 3WL1A 4DJDC 2GJLA 1GG1A 3PJXA 4JFTA 3RM8A 4JTCA 2V5DA 1CGWA 2H9AA 2X0HA 1ZCCA 2ZX9A 2FZDA 3QVQA 5LKYA 1C8VA 2W9MA 2VFFA 3UZJA 1N8FA 3R6IA 1Q6DA 5CC3A 5LNRA 3FDKA 4JTAA 5T91A 3TDFA 3H4WA 3N2TA 1C29A 1W3TA 1OX6A 1K9TA 4PL2A 1YBQB 1KGUA 3P5YA 1U30A 1K8YA 1Q85A 4NU7A 3VOCA 1JDCA 3R8GA 4XO7A 3MBDA 5A8PA 4R27A 1WKFA 3C56A 1VBJA 1FXQA 5E9XA 4XZ9A 1IHIA 1FWWA 3BW3A 4MFEA 1VIWA 3MUY1 1GW9A 5REQB 2NX3A 1QPKA 3VD9A 3UG5A 3USBA 1V3IA 1JD9A 4DF0A 1C7TA 1MNSA 2I9UA 3GKAA 3MO4A 4NJKA 1Q6FA 5F2GA 5LHEA 1XXXA 3PPCA 3TYCA 4BEUA 5H91A 1SJAA 1RVGA 2IQDA 2I5QA 4IPPA 1SPQA 1YQ2A 4QM1A 2VFDA 2Z25A 3BJFA 3W7MA 4IICA 3HPFA 5BYWA 3ARZA 1VHNA 1RPKA 4QJ1A 4LX4A 1ZENA 4OWGA 4HCDA 4URIA 1Z41A 1H1YA 1KM6A 2ZBTA 1OEPA 3M4HA 3V16A 4QJ4B 2F2HA 2Q8XA 1TRIA 1A80A 3W1RA 2HQAA 4ZXLA 4WXZA 4V33A 5C6MA 1EDTA 2PU1A 2V8ZA 1BXCA 5D37A 4E2OA 2WM0A 1JI2A 2EG7A 4Q8QA 1XG3A 1H61A 3O1NA 3BG5A 3BXWA 3OGSA 4XZHA 4HU4A 1I2PA 3ELFA 3PVFA 2VL4A 1F2JA 2YLAA 3SADA 3BICA 3CO8A 4RCXA 3GR4A 1I6NA 1A50A 2XU2A 1XGZA 2RDUA 5LNUA 3UW6A 4X9SA 3VNIA 4NNAA 1HO1A 1UZ1A 3UJSA 3VU2A 4MHBA 2W66A 3DESA 2GDVA 4H7CA 4GH3A 2ZRUA 2WAGA 1J18A 2CITA 3MU7A 1EP2A 1RHCA 3OYZA 3U2EA 1PEZA 3WN6A 2WHMA 2G3NA 3EX2A 1FP8A 1OK4A 1UQYA 1Q45A 5BMXA 4PFHA 4ICMA 4BHYA 4P8UA 2PODA 1H2JA 4O1CA 3DX5A 3EDKA 4JOMA 4NASA 4JIEA 4BJHA 1EPVA 4PUMA 1MYRA 2CU0A 3E5BA 2B4GA 4MMWA 4Y2WA 3ARRA 3TN6A 3ISIX 4EANA 3L4YA 3WBXA 1ITCA 3W7DA 1K8ZA 3C4UA 4M5PA 3W29A 4KH2A 3EXSA 1E9YB 3RLUA 2XPKA 4MFDA 3MKVA 4J2PA 1TPVA 3W2NA 5MKGA 2WQDA 4FIRA 3MI6A 5JMUA 4DX3A 1QMLA 1EQPA 2C19A 4YHEA 4ICNA 3E1F1 3OLIA 5D2TA 3LEPA 5JH2A 2X0YA 3P8JA 1Y5VA 1RQEA 3EOLA 4PRRA 5E9AA 1NARA 5D09A 4DPPA 3DC8A 2CLOA 3W2JA 3AOFA 4H2HA 3HMJG 3HV8A 1BRLA 3SUVA 2P8CA 1FWTA 5HMSA 1QXLA 4S3KA 3GWQA 4RE3A 2ZXQA 3LNPA 1EGZA 8A3HA 3LV5A 3PTQA 3IRSA 2GFTA 4RW3A 4TV6A 3K5XA 5KZDA 1EHAA 2OZTA 5DFAA 4TTGA 1VGAA 1ZCOA 3IJ7A 3JR2A 3S9IA 1C91A 2A7NA 4J5NA 1FKXA 1DTUA 1JI1A 4HYRA 2AAAA 2WZIA 4B15A 3MUAA 4UFLA 4NAEA 1ICPA 2EO7A 3NQAA 4W9TA 1R5YA 3A22A 5CSSA 3WJWA 3ARUA 4PMNA 1M41A 1OCNA 5FIPA 2CFFA 4ZXOA 4X0VA 3DFHA 2YXOA 3Q65A 3LERA 5A6SA 2O92A 2J8GA 3P62A 3W2LA 3BSGA 3N14A 3PZIA 1XL9A 1N2VA 2VEKA 5D02A 2CLMA 4JNMA 3EGJA 1W56A 3VNDA 2OR2A 3ARPA 5BOFA 3PBUA 2HS8A 3GG1A 3WKZA 1YIXA 6ENLA 2HXUA 3NA8A 4ZB5A 4DJED 1XH1A 2WZTA 3O63A 6REQB 1OCQA 1NFBA 5EMLA 4O57A 2OVLA 4JHMA 2Z2BA 4BWLC 1RQHA 2RGMA 2CKRA 3WNPA 3K4WA 1BVNP 3XISA 3K8KA 1BF2A 4L4LA 1J9YA 5I02A 4ES4A 2PBOA 2W67A 5BW6A 5BOEA 5KTLA 1O5XA 4DO5A 3WQ6A 1E1EA 4K36A 1XLMA 5BU6A 3WQ4A 1NFPA 3I6TA 2OLAA 2CEQA 2VDHA 3VD3A 2FGLA 3H21A 3DG6A 1EF2A 1DQWA 3MI3A 1SJDA 4P2VA 3OA5A 1CCWB 4GQGA 3IJLA 2ZKMX 2IW0A 4GACA 1JXKA 2J77A 3TAKA 1E0XA 1HP4A 3LTYA 4OUEA 1KXHA 5K3VA 2NVAA 2VXNA 3B06A 4Q4OA 1GVRA 6CGTA 2V3GA 1LQ0A 2HS6A 5DLCA 1VFLA 1T96A 4A6GA 3NZPA 1WO2A 2ZUNA 2YBUA 4ZOAA 3SDOA 4Q4RA 2A79A 2NV1A 2XIQA 2ISWA 1K4HA 3VNMA 5I23A 4XSLA 3AZTA 2XVLA 3B97A 1OT1A 3PF3A 1VHCA 4MADA 3KRUA 5D33A 1NY1A 3V75A 4B3ZA 1QPQA 1RP8A 3OZPA 3W82A 2G3JA 4O17A 2WWCA 4C60A 1OFEA 4G7EB 3UWZA 2BX7A 4QIUA 3P7YA 1ISVA 1X7FA 3AXIA 2AGKA 1XIGA 3LUTA 4YMZA 3MA8A 4DO6A 3U9IA 3WJYA 3NOEA 2V5JA 5H8UA 2OELA 3RX4A 4LS0A 4AD5A 2Y24A 4IIDA 4L80A 3BAWA 5AYIA 2YFOA 4O0QA 5CPOA 3CV2A 4HIBA 3QPYA 4OU1A 4TX6A 3S2JA 1JXJA 3LCXA 5EPDA 3AU6A 1BF6A 1X6LA 2AMGA 4IG2B 3DHPA 4W93A 3UZWA 1HP5A 2C18A 2CC0A 3NO5A 1HFBA 3DZ1A 1F76A 2QUVA 5M17A 1MXSA 3QEZA 4CGTA 3GHSA 3S0CA 1Q5MA 1L6WA 3B9OA 3QM3A 3QTPA 1W9BM 3FKKA 1M04A 2F38A 4PUUA 3V5CA 3PZOA 1Q6QA 4ALDA 2VZUA 3CWNA 1UROA 1OG0A 2J9YA 5HJXA 1UWTA 3DU0A 3GTHA 1JUBA 1M01A 4GUGA 3P3BA 1R6WA 1H60A 2PTXA 3ZJ8A 1RBOB 1HKIA 4NX0A 3PG9A 4JBRA 1RP9A 2ZA1A 2PDQA 2XN1A 3VD5A 3B9NA 4CUCA 3NM3A 4JX4A 4BA0A 1DJQA 3MVIA 4B4FA 1A4LA 4O0ZA 5I3HA 4CNNA 1QFEA 3S2CA 4MZ8A 2VD8A 4QE1A 3MSYA 1T0OA 3T81A 1W3IA 3E74A 3BLLA 4JEJA 3LPPA 3SQSA 3AZRA 3FDGA 5FJTA 1TV2A 1KM0A 3W26A 1GOMA 4HOWA 1I60A 4H2CA 3PWAA 3QMTA 1X96A 1F3XA 4ZQRA 2G3MA 2RH9A 3BSHA 1HZYA 4DYJA 4KF1A 1SU5A 4JQ1A 4PA8A 1R3TA 2VRQA 4UFIA 4ZO8A 3GDTA 4PUEA 2NV2A 3IACA 4K7YA 2WNWA 2I56A 4PMZA 5JU6A 1XRFA 3D46A 1OYCA 4IFKB 4LH8A 3A4JA 2CBIA 2YXGA 3KE0A 4H9UA 1V02A 2OKTA 2G4JA 3TA9A 2CLFA 2FQIA 4E4PA 1TFVA 4YTTA 3AIBA 4NRSA 2BY3A 1I2OA 1KBBA 3I3EA 1LRQA 5LYRA 3VKCA 2WSRA 1KXQA 4HNOA 3UU0A 1FWRA 1K7FA 3VIKA 2NWSA 2Q3RA 4JTRA 3TN3A 3VM5A 1JULA 2YGYA 4I5XA 2XVNA 1AH3A 4XD4A 3GVRA 4TTUA 3CZGA 1E9ZB 4LV4A 2W6RA 3WQ5A 5C2CA 2J47A 4U10A 3HPAA 2E68A 1TX0A 2PE4A 3M7SA 4R9XA 3WLMA 1DQXA 4GCXA 2YYUA 1JCLA 2UWFA 1XIHA 2L5HA 1UWUA 2DJXA 4K1WA 4WF7A 3T1GA 7ENLA 4L1XA 1UC4A 3L4TA 1UOKA 2NXHA 1HO4A 4QLLA 1FWAC 1D7FA 1SFSA 3HGJA 4EPBC 2W62A 1O95A 4GZJA 3EOSA 4QS5A 3TQVA 3GB6A 4PH6A 4QG6A 1J11A 1QR7A 1ZP4A 3UGRA 1UP3A 5DXXA 1BHGA 3ZWTA 1MW2A 2BXYA 5C9UA 1QASA 1T8QA 3ZR5A 4IZGA 3VCRA 1XYAA 4AC1X 3VUSA 1TREA 1W2PA 1V08A 4S3FA 5G4WA 4FX7A 2EJAA 1QUMA 2VNCA 2GQAA 4BQ2A 1EFZA 4H19A 2PD9A 4DJDA 2PP0A 1JRBA 4JTQA 1DJHA 1XC4A 3EXTA 3T2OA 3NFUA 1K8XA 3IJ8A 1JGIA 2BY2A 4WZHA 1ONWA 2BY0A 1HUVA 1KM5A 2AAMA 2ZUSA 2QLYA 1TWSA 2Z1KA 2QJJA 3IK4A 3SBFA 4P5UA 1QO5A 1Q6CA 5IM51 2HRWA 2XGIA 4EACA 2HTMA 3NDOA 2QMKA 1ZAJA 3CB3A 3KS6A 5DQPA 4ROPA 1UMYA 4B9ZA 5AY7A 2P0OA 3UYCA 3MMUA 2QVNA 4ZTYA 2CLLA 2X0SA 3H7UA 5HMFA 2A4AA 5CGQA 3W24A 3FN9A 1U1JA 1OFQA 4KRTA 1NP2A 1MVYA 4F9JA 3W6MA 4I90A 2OLHA 4DEFA 3B0UX 4MB3A 4NJGA 2EAWA 1CT5A 3FJNA 5DT5A 3S6OA 3JZEA 1GORA 3R2GA 4MTVA 2DH2A 2VO5A 1EYEA 4QHRA 4GWEA 2V9DA 2NXGA 1D8CA 1HN1A 2ISFA 3GG8A 2XM2A 4O15A 1QBBA 2C71A 4DUVA 3LXCA 1EJWC 3QY8A 3SCRA 1OIMA 1DBTA 1XCFA 4I5RA 1A5LC 4XIMA 3MHUA 2KAUC 3WQGA 1TQJA 4ECLA 3ABXA 2PRHA 3KWSA 1R3RA 4HA3A 3KFTA 1GOOA 1LQ2A 1UR4A 4H8NA 1UR8A 3OG2A 4NX5A 3CU2A 3VK5A 1O4UA 5I6SA 4GQBA 1F9CA 2PLKA 1NDYA 3TSBA 1ENUA 3ABRA 4PRTA 5DBUA 4O12A 3VGBA 1O94A 3NGFA 2JF6A 3CZEA 1EX1A 1XIEA 4HJFA 3EZ4A 4GABA 5IOBA 1AQHA 1GYMA 4AX7A 2PF0A 3BGJA 3SQLA 2CBUA 3VIFA 5KITA 3LCLA 1B3OA 4XZLX 4D6IA 3KLKA 2ZDRA 1ZZMA 3OLEA 1GVFA 3WNKA 1J79A 5I3IA 3G3MA 1WKYA 3LX9A 3VOGA 1OHLA 2GPTA 1SUXA 3T9PA 2VUNA 1PTDA 1H7RA 5FD0A 2X09A 2J8TA 3WBEA 3W7RA 3GH7A 1UOZA 4O19A 4Q4KA 4JN6A 1QJWA 1OC7A 1PX8A 2F6UA 1E1FA 5FEWA 3T05A 3TTQA 2RUSA 2WBKA 4QDMA 3SQMA 1KO0A 5AC5A 1ADDA 3EDFA 5I3JA 3HA1A 5K9DA 2BOFX 2DUZA 3AO0A 1TZZA 3GKFA 5HINA 2TSYA 4U3AA 4L6OA 5HNTA 3URAA 5C7HA 1E4LA 3CAWA 4MWAD 3AUJA 4Y6GA 4B5TA 4JKLA 4UTWA 1E6XM 1V3LA 1QW9A 3ZVHA 3TYBA 1VFSA 3GDRA 3FCPA 3BG9A 2E6DA 4MZYA 3EOUA 1RR2A 2C91A 2SFPA 4FZIA 1TVNA 1YPFA 4HN8A 4JX5A 4GC3A 1VRXA 3GXNA 3XINA 3M16A 3NPXA 4XQ6A 4H7ZA 4NHVA 5DX7A 3CTTA 4D1JA 4YCOA 4XZBA 3ZVHB 4PE8A 3KBSA 1FHLA 2Y2WA 1PO9A 3ZLGA 2FHBA 1JPMA 3PZMA 1V79A 3SIMA 1Q7QA 3UZXA 4ZENA 2IPFA 1DTNA 4IX2A 4PUDA 4LT9A 3VXGA 3H55A 4H9VA 3L5AA 3WMBA 3QRHA 2ON3A 1NU5A 1VZWA 2PTYA 2WM1A 1D7KA 1VFFA 4I9JA 3AALA 5A6TC 1O5QA 1NWSA 1X1ZA 3UCQA 1EJSC 2WMIB 3JUGA 4K8GA 3EDEA 4MNKA 3IUIA 1Q3NA 4B5VA 2HNHA 2IUZA 3DAQA 4PN2A 4GZEA 4CN4A 4JS3A 4CNUA 3ZJ6A 3WLPA 4W4QA 2O0TA 4P8WA 4Z17A 1C9WA 1FWBC 4R7WA 3VGGA 2ISDA 5C9WA 3N25A 3OZMA 4ZMGA 1C90A 3MANA 2G41A 4IM4A 3OVGA 4J1OA 3VPLA 4LCQA 2WMIA 4YWSA 4QP0A 4KCVA 4FLOA 2X05A 4KW2A 2OZ8A 3KS5A 5CPLA 2XVPA 2XZ7A 3F5JA 3ARQA 1Y8BA 5CZJA 2REQB 4GA8A 1WZKA 4DM1A 1XINA 2E9BA 4C7GA 2WZHA 3UG8A 2PRLA 1MEIA 3VC6A 1XDMA 3DFTA 4X2PA 4LUJA 1EXBA 1VCGA 3Q67A 3CHVA 3U7BA 1TPEA 2AKZA 3R43A 1XWYA 1EOMA 3C0SA 3Q2DA 5FAJA 3W84A 2CNCA 1XH0A 2WYSA 1R47A 3LHTA 3E49A 4GKTA 3KBWA 5D30A 3N3MA 2NQ9A 2IPGA 3IJ9A 4BI7A 1O5KA 1YDNA 2V5KA 1OCJA 1PVNA 2A3CA 2O7SA 3W23A 2A21A 4GE8A 5LIWX 1FWHC 4ZB2A 4AAJA 2J24A 1RY8A 1TVLA 4GIEA 2HEJA 1MQQA 3TJ4A 1ZSXA 3MSDA 4AZGA 1PCKA 1TMLA 3TXVA 4GI6A 4S38A 1K8CA 1DJNA 4B5WA 3NWRA 3W7OA 1GJUA 2RDWA 2VZOA 3GHRA 5LA0A 1WP6A 4UQAA 2FZBA 3KVLA 2BG5A 3MMWA 3TAOA 4PMYA 4K38A 3OO2A 1PXGA 4G1NA 1KM4A 3TVAA 2BVWA 5BCAA 5AZ1A 2W5FA 3FGCA 3GZ3A 2IXVA 3C8NA 1RVKA 4JN7A 4J3SA 1OYAA 1XS2A 4IMAA 3GH5A 2IMR