3FFSA

The crystal structure of cryptosporidium parvum inosine-5'-monophosphate dehydrogenase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
377
structure length
301
Chain Sequence
b'TKNIGKGLTFEDILLVPNYSEVLPREVSLETKLTKNVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKNMDMESQVNEVLKVKNWIAYSNENLDNKGRLRVGAAIGVNIERAKLLVEAGVDVIVLDSAHGHSLNIIRTLKEIKSKMNIDVIVGNVVTEEATKELIENGADGIKVGIIVAGVGVPQITAIEKCSSVASKFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKELIGDTVYKYRVKYKGEMEGVVYQLVGGLRSCMGYLGSASIEELWKKSSYVEITTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5-monophosphate dehydrogenase
molecule tags Oxidoreductase
source organism Cryptosporidium parvum
publication title The structural basis of Cryptosporidium -specific IMP dehydrogenase inhibitor selectivity
pubmed doi rcsb
total genus 82
structure length 301
sequence length 377
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ffsA00
2CZ5A 3EX2A 3WJYA 2NX9A 1S3HA 3C2EA 3GVGA 4DBDA 4XBSA 2H8XA 2CLIA 2CLLA 3CM4A 1Q3NA 3W1MA 5BW6A 5T26A 5AHLA 3MJYA 1XI3A 4N4QA 3PR2A 3RMJA 3G1VA 4EVZA 4IPIA 3LXBA 3W2KA 1JCYA 5FEWA 1JVNA 2QJGA 3L68A 5BOOA 3O15A 3UZJA 3EWYA 1IXPA 2GUUA 5E0KA 4MJZA 5K9DA 1H62A 1KM5A 3I7RA 4QISA 2V2HA 3G1HA 3AJXA 1OX6A 2HTMA 1PL9A 3DZ1A 5FESA 3N3MA 3W7PA 3E02A 2V2DA 5G4WA 3U6WA 4A3UA 5U7SA 3LTSA 3PS7A 3FOKA 1ICPA 1EWEA 3HG2A 4LU0A 1DJQA 3CLMA 2Q3OA 2E77A 4OQVA 4N2YA 2FB2A 2PURA 1PIIA 2GJLA 3LCFA 2I1OA 2PRMA 4IPJA 3NL3A 2QCEA 2ZZ7A 3NYZA 3S5OA 3BG5A 2QCGA 3U2OA 5AHEA 1VC4A 4MJMA 4GUIA 1FX6A 1VCGA 3FYOA 4MY9A 4Y96A 4JTTA 3ZWSA 3G0UA 1EP2A 5CZ0A 4K39A 5LZLA 1LOSA 1XM3A 2YX0A 4WX2A 5HWNA 3LHUA 4A2RA 3UWZA 5LHEA 1GG1A 2AAMA 4P61A 1LBFA 3MMTA 5DELA 2YR1A 3PUEA 2Z1BA 3P7YA 3W1TA 4DPQA 3TXVA 3GXNA 3NNTA 3BW3A 1FBAA 4R34A 5C2XA 1THFD 1KLYA 3O8AA 2ATMA 3TUUA 3USBA 1DQXA 4OT7A 4NU7A 4O19A 3CU2A 3SZ8A 2A1YA 1NSJA 1TPWA 4NXSA 3JRKA 2WOQA 4O17A 2X1TA 3PF3A 2QCMA 1KFEA 3W6YA 3EXSA 4FO4A 4H3DA 3CEUA 1LRNA 1P4CA 4AMAA 4NNCA 1FDJA 5EA9A 1RQHA 3BO9A 3NPUA 3A5FA 5A5WA 4UTWC 1GJPA 1C8VA 1JR1A 2FFCA 1X8FA 5FF7A 3BVJA 2ISSA 2H90A 5BRBA 4FF7A 1O5KA 4KWWA 4O8RA 4PFMA 3L2IA 4LV9A 2WQPA 1FCBA 5F4XA 3P5YA 4QJ1A 1VH7A 5I3HA 2V81A 4M6PA 3YPIA 1RZMA 1XC4A 3C2OA 3LCWA 1YDVA 3EEGA 1TO3A 1TJRA 2FLIA 1T99A 3A9IA 2YGYA 1W37A 4AHOA 4GE8A 5D37A 4JR5A 3CWNA 3NQ6A 4Q32A 2C13A 3PM6A 1GVFA 1YTDA 3HG4A 5EBUA 5LNVA 5AC7A 1ME7A 4BFAA 5EMUA 2E6DA 1N8FA 3DENA 3E96A 1H7RA 1MEWA 1RR2A 1ZAHA 1KTBA 3GAKA 2Z2UA 1QNVA 5KZDA 1TQJA 5G1YA 1A5CA 1YPFA 4CCEA 1WAUA 4ONVA 3GR8A 4BWLA 4K8HA 2ATSA 3CQ0A 3HGJA 4DELA 3BPWA 3BGGA 2OT0A 4FEZA 5I3GA 2C16A 4UFLA 3WK0A 1FQ0A 3QW4B 5AB3A 1OG0A 4JX4A 3TR2A 3M9YA 2VOMA 5C6MA 3DBPA 1P1XA 4O50A 3QW3A 3GDKA 1QWGA 3SIZA 5CSRA 1SFLA 1LLZA 3DAQA 4ADTA 2BTMA 3NPXA 3RNDA 3G24A 2Z0IA 3N2XA 1VCVA 2E6FA 3W75A 3TNOA 1OYAA 1GQNA 5AHNA 3C56A 3OBKA 1OHLA 4N9EA 5F2MA 3MO7A 1W8SA 4JS3A 2NLIA 3R2GA 5I3FA 1EB3A 5CG7A 4JX5A 3P81A 3P8JA 3A24A 4XUGA 1DORA 3CWOX 3G22A 4HKPA 4I7UA 2NX1A 3U8GA 4EF8A 1UUOA 1LRQA 4OBTA 5D04C 3FS2A 1VQTA 3EWBX 3Q58A 1VYPX 5G1TA 1OX4B 3HPZA 5KZEA 3PUDA 3LTYA 5KMYA 3L21A 1WXJA 1SW7A 3C6CA 4E0CA 4LRTA 4O4VA 1EP1A 3SECA 1K03A 3M47A 3G1XA 4O12A 3W07A 1OYBA 4UMAA 3TMQA 4UUIA 4GWEA 2G95A 1H60A 3FLUA 1K8ZA 2Y89A 4DEFA 3W7OA 4FNSA 4X22A 1W31A 3W71A 1JCNA 4IMDA 1MSSA 1TV8A 5DCDA 1LORA 4MPQA 5AC8A 4DF1A 4IX2A 4C1KA 4O0KA 2QCLA 3NM1A 1GZGA 3C3NA 2OJPA 5LNRA 4LC6A 3W7LA 4LVGA 2CU0A 1M7OA 1SUXA 1OABA 3QJAA 4LV4A 4H6KA 1OFPA 3P8IA 3ATZA 4PEKA 3I65A 3G1AA 2FIQA 3M16A 2J27A 4BI5A 1P0NA 4EF9A 2QF7A 3QRHA 1GWJA 2W79A 4M6VA 3IEBA 1PCKA 2D73A 1TCDA 4O15A 2QCFA 3W1LA 3GX9A 2QDHA 4AAJA 2CFFA 2ZDRA 3UWVA 1VLWA 1VHCA 2J9YA 3UPBA 2RH9A 3UQNA 1B4EA 4AF0B 3LLDA 1Q6LA 2Z6IA 4ICNA 1TREA 1NFBA 4JTGA 2EAWA 4DO5A 3TV8A 2WO5A 4QITA 1S5VA 1VHNA 4PL2A 4RX0A 3D0CA 4UTLA 1PV8A 1JQVA 3B03A 4LUIA 2VEMA 1H7WA 3NXFA 3NO5A 2JKEA 4QM1A 3S5ZA 3WJZA 1AL8A 2NUWA 3W86A 1I2RA 1ICSA 5G2HA 1P0KA 4ZVJA 4OWGA 1LZOA 2QAFA 1SSGA 3F03K 1DL3A 4HNTA 3QEZA 1F76A 4N9CA 8TIMA 1DJNA 2I9EA 5D03A 2WSQA 2DP3A 4D2JA 1FDZA 3SW6A 1KTNA 1JCJA 3WJWA 2QKFA 2A4AA 1SO3A 4JYDA 3Q94A 5HJLA 1YPIA 3QH2A 1R30A 4LTSA 1FWSA 2ZZ2A 1F05A 4M6QA 1YXCA 2OZ0A 3NZRA 4XBKA 4UTMA 1PS9A 1OK4A 3NPVA 4GXMA 2G97A 3T7VA 1QPNA 3O16A 4L4MA 4AXKA 1UB3A 4UC5A 4JXCA 4OE7A 4GUFA 2XN1A 3LCXA 2O7QA 3UYCA 3PB0A 1FCVA 3UY8A 3BV4A 3QF0A 4HNNA 5F4WA 2J9ZA 1XCFA 2VEKA 1OFBA 2X16A 4IMEA 4DPPA 2VFEA 4CNPA 1G4PA 2F7FA 3GYEA 1WV2A 5BNKA 4O28A 3TDFA 3GDTA 4UTTA 1UASA 4HHPA 4IQLA 1M7PA 4W9TA 1R46A 2A0NA 2E5DA 4QAIA 5I3KA 4FX6M 2UV8G 1W5NA 1KFBA 3HGRA 5F2GA 1TSIA 5HINA 1DQWA 2P10A 3TMLA 1QMLA 5HWMA 2ZRUA 2OMAA 1HTIA 1MEHA 3PSVA 4PH6A 4HSOA 4UTJA 4JTJA 2J9XA 2C18A 1DBTA 1QOPA 5CPNA 3O07A 5CPLA 1KBJA 3AO0A 1TTPA 3UPWA 1LDCA 1KM3A 4PC8A 1TPDA 4JD4A 4JNMA 5CZSA 4JGDA 4WD0A 4UMBA 4X9SA 5LSMA 4RKAA 3QSTA 1WDWA 5H91A 4NJIA 1GVOA 2CWNA 3GDLA 3TFCA 2R14A 1SU5A 1A5AA 1KLZA 5KTLA 5AHMA 4QSHA 2A2IA 3BLEA 1Y0EA 2J88A 3L67A 2NUYA 3NQCA 1I2OA 1W5OA 4JY8A 4PODA 2GVJA 2ZA1A 2A6LA 4GRSA 4R33A 1G7UA 1SSDA 4LUJA 1UBSA 3MHFA 4AHQA 4JICA 2YFNA 1YDNA 2XFWA 1ALDA 1RD5A 3CC1A 1QAPA 2YW3A 5EL1A 3TCEA 4AEOA 1KFLA 3TX9A 4YWIA 5L6UA 1PE1A 1K8YA 4JTUA 2A6NA 4KFPA 3KVMA 4QNEA 3UXAA 5DN1A 4UFKA 2GOUA 3EB2A 2Y88A 4MZ8A 4XWUA 3V75A 5C5YA 1Q6OA 1FCQA 3STFA 1J2WA 4RV8A 4OU1A 1JCXA 5LKYA 5FI8A 3LCLA 4FIQA 1I4NA 1VYSX 2G96A 4UTHA 1H63A 2DZTA 2FDSA 3E12A 4ZQMA 4RXFA 2JGQA 4JYFA 4KFOA 4TMCA 2VKZG 2A21A 3LCIA 4UR8A 2WSYA 3QQ1A 3N34A 2R91A 4KWVA 3VCRA 3B05A 3GZ3A 5KITA 1M6JA 2H6RA 1ZCOA 1YTEA 5BMXA 3QFEA 2WNNA 5D38A 4TO8A 6ALDA 3KRSA 5IM51 3STCA 3W7GA 4R53A 4GNJA 3TJXA 1V5XA 4BI7A 3TSMA 3W7EA 4O1CA 3W72A 3KVKA 3STGA 2E1DA 3F1QA 3NL6A 4XTDA 2ZRXA 2YDAA 1F6KA 3P82A 6TIMA 2O7SA 3PB2A 1H1ZA 1N7KA 3WK2A 4PL1A 4BWLC 3SSJA 1KFCA 2KZHA 4HSNA 4IMFA 3GKFA 1KV5A 1LOLA 4Z0JA 3P61A 1WOAA 1B9BA 3O6YX 4Y8FA 1UJPA 2CLMA 1EWDA 3TW7A 5K4XA 1OYCA 4KFNA 5G5IA 1B4KA 3H53A 4WXZA 3FKRA 1L6WA 5E1QA 1FWNA 1AW5A 5EY5A 4ADSA 3UNDA 5J5RA 1R2SA 4J9JA 5TIMA 5FF4A 3FYPA 3KVLA 3UWYA 1B3OA 1GVRA 4G1KA 3IIXA 1TB3A 3HF3A 1D3GA 5FF3A 1GPWA 3DU0A 2H8ZA 5DCBA 1SQ7A 1QCWA 3DH7A 5LHFA 2NZLA 3N9SA 4ZQCA 1KM2A 1O4UA 1JUEA 3B06A 4MZ1A 1WQ5A 4MFDA 3FA5A 4UFHA 4NUWA 3RLVA 4MY8A 1HO4A 4ZQNA 5C55A 2C19A 1SR9A 2Y70A 1ADOA 3LRKA 3ELFA 1AMKA 7TIMA 4O52A 3EX1A 2G5WA 4Z1AA 4IOTA 3ZWTA 2TPSA 4WOZA 4UCGA 4A21A 4UXDA 1GVQA 3TXZA 1LLWA 1R2TA 4JEQA 3W76A 3S1WA 2ZA3A 3MHUA 5FEZA 5HUOA 4K6AA 2VFDA 2H3BA 2PC4A 1DVJA 1KBIA 1Q45A 3IGXA 5HWJA 3ABSA 1Z44A 5D09A 4O0ZA 1KM1A 1TPB1 2A7RA 1L6SA 3W83A 1U83A 1P5BA 4QQ3A 5AYXA 5K9XA 1YADA 4OV9A 4ZQPA 1AW2A 3EWUA 3IV3A 1KTCA 1W56A 3IIPA 3UY7A 4A29A 3F4NA 2GVGA 1KV8A 1BKSA 3TQ0A 4IXXA 3Q2DA 3H54A 3I7SA 5GVJA 3C52A 3W7NA 2NV1A 5CZTA 4OV4A 1UUMA 1IXOA 3IGSA 3W1NA 1SPQA 3G3DA 4MYAA 4ML9A 5DCEA 1UCWA 3QMRA 4FB7A 3W7CA 3ATYA 4DF2A 3N19B 3W2JA 1F2JA 3H55A 4RLIA 1XUUA 3W7HA 5SWUA 4YCPA 1HUVA 3NR0A 3UWWA 3LHTA 4ZQRA 5AN7A 2CZEA 4FNPA 2I14A 3W88A 3HOJA 1OVDA 2ZRYA 1WX0A 4M7SA 4LS0A 3IGUA 1XFBA 3CEPA 1SFJA 2QCNA 4YLWA 5DLCA 1K7XA 4PCFA 3N73A 1IIHA 1H5YA 5H2ZA 1JJKA 2CLEA 2Z6JA 3LBCA 3NOEA 1NF0A 4HNVA 3ZFHA 3NL5A 4IWWA 1GTEA 3FFSA 3G8EA 3INPA 3R5EA 3M1ZA 1GEQA 1VR6A 3W1PA 2QCCA 4TU1A 2B7OA 4RZ6A 3W85A 2VXNA 3CPRA 3TH6A 3GXPA 2HS6A 3VE7A 1DKWA 3CHVA 3DFTA 5LNWA 3LCHA 4O54A 3N14A 3TFXA 5HNRA 2Q8ZA 3NM3A 4UNKA 5HQEA 5MHBA 3L0KA 1BEUA 1RQEA 1DHPA 3N9RA 3UD6A 2RDUA 3P5ZA 5FF0A 3MI2A 2DZVA 2E68A 3M5YA 4MYXA 3OVPA 4AWTA 1LP6A 5TBOA 2ZRVA 1A50A 3M7WA 5F2IA 1ME8A 3LM7A 3UWUA 1E51A 3W7MA 1O5XA 3LXAA 3DXIA 1OX4A 2R8WA 1EUNA 3L0NA 3EX3A 1SW0A 1SZFA 3GLCA 1J4EA 3GR7A 5FF2A 2A7PA 4LT9A 4ZMGA 1FXPA 3ANYA 4JTHA 4B5NA 2NWSA 1AW1A 3NG3A 3NQFA 3I6RA 5D32A 2V2CA 3PC0A 4O10A 1OFEA 2CW6A 3A22A 3TE9A 1JCLA 2ZYFA 3I7QA 4JTFA 1A5SA 1SZNA 3WFAA 1DOSA 3PSWA 4UR7A 3LHYA 2GJNA 3LGEA 3PY2A 4MKNA 5AC6A 2XN0A 3E9AA 4I9AA 3TROA 1H7PA 1LCOA 2QEZA 1O60A 5DXYA 3QC3A 2ZRWA 3A5VA 3C2RA 3R12A 1DV7A 5BMWA 2BZNA 2V30A 2VFFA 4YCOA 3PWAA 5L9FA 4O57A 1CX9A 4CQ9A 3FJLA 3THAA 1PCWA 2AGKA 5F1UA 1VJIA 2DORA 1TYGA 1GYNA 3LX9A 3W7JA 4WOQA 3BK0A 4DXVA 1HO1A 2CZFA 4IMCA 3T78A 4N4PA 3HBLA 1JRCA 3NEVA 3PBYA 3DFNA 2Q3RA 2ZZ1A 3G18A 5KSWA 3EWWA 4FXSA 4GBUA 4NQ1A 2JK2A 3TA6A 1ZHAA 5DXXA 1TRDA 4LOCA 3BG9A 3NQGA 3LV5A 4O1BA 1LBMA 5CGQA 2ABAA 4N9DA 1QFEA 5A8GA 1BTMA 3W7KA 4NJGA 3L9CA 3WK3A 4JDYA 3LB0A 1I8JA 1TPEA 1XDMA 4MIMA 3CIXA 1TV7A 4A22A 1H61A 3E49A 4LS1A 4NXKA 3TC7A 2IQTA 1EX5A 2WSRA 1L6YA 1XBZA 2FTPA 4S2BA 3B0UX 1TTIA 4NZJA 5D05A 4NJKA 3EXRA 2LLEA 3P62A 4N6EA 4K37A 2ALDA 1VLIA 2PRLA 3PBUA 4HPJA 3S0CA 4UFMA 3TSDA 4GJ1A 3L5AA 3OEXA 4S2CA 1WYIA 3SGUA 4JDBA 1LBLA 1F73A 3LBMA 1XUZA 2FJKA 2ZZ4A 4AWUA 3L66A 3KAOA 1CW2A 1R2RA 3G1DA 1G7VA 3DFSA 2RFGA 1WBJA 1TMHA 1QPQA 3EX4A 3W1QA 4U28A 5D33A 1I2NA 1U5JA 3HPXA 3BLIA 4K8EA 4WXYA 1W5MA 3PVFA 2YW4A 3E0IA 2C14A 2EGZA 3O06A 3KVJA 4O13A 4A2SA 4NX0A 3P84A 1M5WA 2ZZ5A 4WY0F 5LGXA 4XKYB 1XDLA 2P0OA 2Q8LA 3PAJA 3IVTA 4CQ8A 1SO4A 4EIVA 2Y7GA 4CLMA 1KM0A 3TQVA 3IIOA 2JKPA 5LNUA 1ONRA 3DHDA 1TJPA 2ZQ0A 4EOUA 4YXGA 3BW4A 3L5MA 3OA3A 4QIUA 4ZZ9A 1HFBA 3DI1A 4RXGA 2WKJA 2PE4A 4XTIA 4M5PA 1JULA 2DZSA 3RK8A 4UTUA 2J6XA 5HMSA 2OCZA 3RLUA 4RK8A 3B4UA 3OG3A 1XBYA 1KM6A 5AYYA 1W5PA 3LHVA 1IIGA 2XN2A 3NGJA 3MBFA 4ORIA 4MY1A 4JIPA 3MP3A 2YYTA 1TTJA 1ICQA 1RVGA 4JY9A 4O53A 2QAPA 1VS1A 3R89A 2NXIA 3S5YA 2FPYA 1LM1A 3GDRA 4ADUA 3O6DA 1L2UA 3W84A 1NAL1 4H4IA 3P74A 2EHHA 1QR7A 2R94A 2NXHA 1Z48A 4UTKA 1FWTA 3MYPA 2V8ZA 3CB8A 5LGZA 2B7NA 1V7YA 2QR6A 3G8RA 1TPC1 3NVTA 3DI0A 3PULA 4CNNA 2CLHA 3MW7A 3DGRA 3WJXA 4O4WA 1G6CA 1FWWA 4HN4A 3W1AA 3LRMA 3M5XA 3V1PA 1NF7A 3VNDA 3C4UA 1WBHA 4LVFA 1X1ZA 1TPUA 4R7JA 2C15A 3TSBA 2J24A 1TTQA 4UNLA 4UFJA 5DBUA 3EX6A 4NNAA 3NL2A 1YLVA 3NDOA 1ZJIA 3VKJA 4WY0A 3W3OA 4LWWA 4MLJA 5CSSA 2GVLA 4O1DA 3OHIA 4CCCA 1AG1O 5I3JA 2RHGA 3IIVA 3QM3A 3BLFA 3GK0A 4PA8A 2AQWA 4FNUA 1GT8A 1SO6A 4YL2A 1I2PA 3HO8A 3W2MA 1YXYA 3G3MA 4LVAA 2V5LA 1W1ZA 2JBMA 1NEYA 4NJHA 3W9ZA 2HMCA 2JKAA 5K9CA 4NVTA 3LHZA 2WV8A 2YZRA 3UZ5A 4UTIA 3KRUA 3DKLA 1R47A 2NX3A 1JCMP 3CIWA 3B0VC 3TW6A 3HG5A 3P60A 1AL7A 2VFIA 2FQIA 1XBVA 1KFJA 3N2MA 5AHFA 5D02A 2ZZ6A 1BWLA 3WK1A 2E6YA 1GVSA 4XQ6A 3W1UA 4Z0SA 3HGSA 3LRLA 2Y61A 3HMJG 2X1SA 1O94A 4O11A 3FIGA 4I7WA 3NQ8A 4I7VA 2W6RA 4RJEA 4TX9A 4QNWA 5D2VA 3W1XA 4N6FA 4RCXA 3MWAA 1RPXA 1OFAA 3LTPA 1TPH1 3W74A 2Y7FA 3KFTA 4K7VA 4UTWA 1JRBA 3TIMA 1K02A 2VEPA 2DU2A 3LCGA 1Q6RA 3R13A 4GUHA 3ABRA 3BARA 3O05A 4DF0A 1VRDA 1W3NA 3SJ3A 1A53A 1MZHA 3DHFA 3TC6A 4CNOA 3LLFA 4Y6GA 1W3IA 2HSAA 1J5TA 1MEIA 4GUJA 1FWRA 3NQVA 2A7NA 3I68A 2VFGA 2F84A 4TMBA 5E93A 4JTLA 3NA8A 2NV2A 3KXQA 4LC8A 2EF9A 3QYQA 4LS2A 3NQAA 1TPFA 1VGAA 4C1LA 1IGSA 2QDGA 4IUOA 4AB4A 4TR9A 1OFQA 4GC4A 2NXGA 1FDYA 1QDSA 2TSYA 1K7FA 3IVUA 2Y62A 2DZXA 4K36A 2Y85A 2QCDB 4O1AA 1A5BA 1EUAA 4Z1DA 3M0ZA 4WQ6A 2ZRZA 4PTNA 3QZEA 2V9DA 3NQEA 4UFIA 3W2NA 1G4TA 3CTLA 3CT7A 1EIXA 1OF6A 3W2UA 3GIYA 3O1NA 2ZFAA 3L5LA 3S1UA 3UXDA 3BW2A 2C0AA 5D30A 3STEA 5U4NA 1XXXA 2OX1A 4FNRA 1H7XA 1JUKA 3IRDA 3TAKA 3HG3A 1OK6A 4JN6A 5CZJA 3S6DA 4CQAA 4Q33A 3F4WA 2ZTJA 5AFDA 2BSLA 3PG9A 1VZWA 3C0JA 5IBXA 2BX7A 3B04A 4L4LA 3M44A 1BWKA 3LV6A 3HJZA 1H51A 3QMTA 1ZAIA 2ZBTA 3Q37A 5F2LA 2GQ8A 2WNQA 3SGZA 3TQKA 1H7OA 5DY2A 3THQA 3QPZA 4Z08A 1RV8A 3S9YA 3L65A 2BWGA 4KKXA 3HGOA 3NQDA 1XKYA 1ZENA 3BGJA 4AWSA 3LDVA 1VYRA 2FPVA 3NZ1A 5DBTA 1EP3A 3ZR4A 1YXDA 4FNTA 4IXHA 4E2DA 5I3IA 4WZHA 2C1HA 4NNBA 3S1XA 1GYLA 3GNNA 1IF2A 4BR1A 2V0TA 3KOFA 2YSWA 2ISVA 5FEPA 4JTKA 3MUXA 1X7FA 1F74A 3GB6A 3S42A 2GQ9A 4LVBA 5F1VA 3EKLA 2DJLA 2V5BA 5LNSA 4ORMA 4NJJA 5EKYA 1SO5A 4Y90A 4DBEA 5DY3A 2BXVA 2EKCA 4NT0A 3T44A 4M7TA 3T55A 1TQXA 1FY6A 4MLRA 3FEMA 5EYWA 2GPTA 1H50A 1G67A 5C54A 4ZL1A 1X6UA 2YFOA 5G4EA 4JX6A 2OT1A 3QMSA 4Z1CA 3NAVA 3HB9A 1JQXA 3HIJA 5EPDA 4IJBA 3SFKA 3C8FA 4UMCA 2YCEA 4AVFA 3RF9A 4BK9A 1B57A 4MOZA 4LW7A 4K7YA 2RDWA 4RZ5A 2TMDA 1XBXA 1QPOA 1Z42A 1S5TA 2CLKA 4DO4A 1TPVA 3LOTA 1XL9A 3NQ7A 4AHPA 4DQWA 2X30A 1D3HA 1ZY9A 3W23A 4RZ4A 1LYXA 1ME9A 3LXCA 1LTDA 3TKFA 3IVSA 2E5BA 4JYEA 1HL2A 1T8XA 2E5CA 2GQAA 2QUUA 4Q4KA 3NQMA 2NWRA 2PCQA 1F5ZA 2ZZ3A 4M19A 3P67A 3UWQA 3T40A 2RKXA 3G1FA 3T4CA 1L9WA 1K3UA 3KX6A 5K2ZA 4IGHA 2DZWA 2H3DA 3W7IA 3MHGA 4MZYA 1G4SA 3LERA 2X2GA 1OFOA 1W5QA 3W1RA 5K4ZA 2QCDA 1W0MA 3GDMA 3W70A 2FPTA 1F7BA 1LRTA 1TRIA 1YTKA 3MI6A 1ZALA 1MO0A 2PRHA 1IXQA 3EXTA 1NVMA 3VFLA 2ISWA 3M43A 1CI1A 1Q6QA 3MI3A 1X1OA 5AOUA 3MP4A 3OVQA 4UIOA 1TIMA 2NUXA 4FHAA 3C2FA 4DO6A 1OF8A 2EPHA 2HS8A 3O6CA 4HIBA 3VI2A 1C9DA 4K38A 4Z1BA 2Y6ZA 4MUZA 5J5DA 2E6AA 2QCHA 1WOBA 4N02A 5F4SA 4AF0A 4CCDA 2JGYA 2B4GA 5AYZA 3NQ2A 3RFAA 2B7PA 2YPIA 1ZNNA 3G1SA 4LY8A 1SZGA 1T96A 2DZUA 3DFOA 3M6YA 4NZFA 1QO5A 3EWXA 5KINA 1KW1A 3ABQA 1W3TA 2P1FA 2Y63A 3BG3A 4WUIA 2ABBA 2YXGA 5G2WA 3W22A 3KRZA 1W54A 3VE9A 1KA9F 2CLOA 3GNDA 4GFSA 1PHQA 5D2YA 3C61A 1T0OA 1H1YA 1WA3A 3B0PA 2VENA 5D2WA 2A85A 3NPWA 1PVNA 4LNYA 1GG0A 3A23A 1K7EA 1OFDA 3PG8A 5HR6A 3O63A 5K3VA 5TQLA 2DJXA 1MXSA 3DFPA 3M5VA 3QQ0A 3R8RA 3S1VA 4E38A 3WJSA 4FX8A 2TRSA 1KFKA 3W87A 4WJEA 1FUYA 4TIMA 1LROA 5CPOA 3OVRA 3LHWA 1RQBA 4MVAA 4IMGA 2CZDA 3QSRA 4UTTC 5K7JA 2B0MA 1PHWA 1ML1A 3P80A 1F6PA 1VPXA 1D9EA 2E09A 2QJHA 3W73A 2QJIA 4FXRA 2VFHA 1H7NA 3PBWA 3SI9A 2Y7DA 4O14A 4BF9A 1ZFJA 1YYAA 3C2VA 4E2BA 2YYUA 4HPXA 1N55A 3SR7A 4IX0A 3TK7A 3MP5A 2VEIA 3TAOA 4HT3A 3M5ZA 3TU9A 3S5NA 1S5WA 5ABTA 3GXTA 3IIZA 5HULA 3G0XA 5HR7A 3W7QA 2WJZA 1JUBA 4XKYA 3TJLA 1IXNA 4LVDA 1FCUA 1GOXA 4ZQOA 3FKKA 3JS3A 4X3ZA 5D2TA 2Y7EA 4JIQA 2X1RA 4EWND 1EPXA 3K30A 1GTHA 1LOQA 1VCFA 2ZCGA 3GAYA 4JTEA 1SW3A 4ALDA 4JTSA 3GKAA 4RR4A 4OGZA 3JR2A 3LI0A 1G4EA 2ZA2A 4FX7A 3A21A 3W7DA 1TV5A 1ZAJA 2QUVA 1OX5A 3ABOA 2DZPA 4FIRA 1C29A 5AHIA 3MBDA 4Y9AA 3KHJA 3QPYA 4MFEA 3LI1A 1QO2A 3MYOA 4XZ9A 5KZMA 2WPBA 1FXQA 2A5HA 1SZEA 5CPMA 3EWZA 5G2IA 2FB3A 4AH7A 4LRSA 4X2RA 5CKSA 1KM4A 1O95A 3G1YA 4HNUA 1QOQA 1YDOA 2V82A 2C6QA 2ZTKA 2QUTA 1I2QA 3RU6A 1K8XA 3PBVA 2CLFA 1EA0A 1HG3A 3OIXA 2RDTA 2TYSA 2C3ZA 3PUOA 3EKZA 4N9BA 5D2XA 2BLEA 3W7RA 3DFQA 4NX5A 1QPRA 4P2VA 3HPSA 2W0UA 4U4MA 3W2LA 3SY5A 5IBXC 5FEXA 4FNQA 4JTIA 4BI6A 3ZS4A 1OJXA 4GUGA 2VELA 1AK5A 2B7QA 4O18A 1EEPA 4OHQA 5HUPA 1Z41A 3DKJA 1I45A 4O16A 3FJ6A 4WY0B 2X1UA 3L0GA 3S8HA 1G69A 4S1FA 2VC6A 2WNZA 3B8DA 4YMZA 1OFRA 3HQ1A 3G0SA 4POCA 3M41A
chains in the Genus database with same CATH superfamily
1EPVA 3WJYA 1WUEA 1S3HA 4XUYA 3GVGA 3WQGA 3LPPA 1Q3NA 4KBXA 5T26A 3VKBA 3MMUA 4DUVA 3THUA 4C6CA 3PR2A 5LA0A 4D6GA 4DVOA 2WZIA 4IPIA 2PWUA 1MNSA 3WEMA 1TFVA 4B16A 3ARZA 3OG2A 4UCFA 5BOOA 4D9PA 1CIUA 1V8EA 4I90A 2GUUA 5K9DA 2QS8A 2VCAA 3CV6A 1B31A 4PMUA 3KBSA 4PTWA 5I0DA 2D2HA 3AJXA 4RE4A 1PL9A 2BXZA 3WF1A 2V2DA 4D6HA 1OC6A 4TV5A 4GC3A 2PLMA 3PS7A 1RPKA 3HG2A 1O66A 3E5BA 2E77A 4DJFA 2EO7A 4N2YA 1W1A1 1UKPA 1PIIA 4PZVA 2I1OA 4IPJA 2WVVA 1QNOA 2YLLA 3RLGA 2HDJA 3EPOA 3ZJ7A 3WIJA 1I1XA 5AHEA 2Q09A 1FX6A 1VCGA 3FYOA 2PLJA 4Y96A 3ONCA 3BL3A 2GJXA 1XM3A 2YX0A 1LUCA 3LHUA 3U3HA 4A2RA 5LHEA 4IQJA 4FLOA 1MNZA 3BLLA 1E5NA 1GZ1A 4HCHA 4KGLA 3P7YA 1Q85A 4IIEA 4R34A 4WGHA 1V03A 3B9DA 3NVDA 1UPMB 2E9BA 1E3XA 3HTWA 3U2ZA 4O19A 4NXSA 1V02E 3HURA 3PF3A 1LRNA 3G5EA 4AMAA 1UZDA 4NNCA 5DRCA 3GYCA 2FFCA 1X8FA 3WO8A 3HFYA 3LQGA 2OEMA 1XD0A 1O5KA 1ENUA 4CVUA 4IP7A 3L2IA 4MB4A 2Q02A 4QJ1A 1VH7A 1DEDA 2V81A 4M6PA 3C2OA 3NDZA 4NYYA 5JU6A 1GOMA 1ZCCA 1UR8A 1TJRA 4YIWA 2YGYA 3TYDA 3WELA 1Q6EA 4Q32A 1R6WA 2C13A 4A3QA 5M2FX 4DJDD 1YTDA 1QUMA 2X7WA 1NQ6A 1NFPA 5EBUA 3WLOA 5LNVA 3EOUA 1VJSA 5A3HA 1YQ2A 2CZVA 3M0YA 3RXZA 1XHGA 3E96A 1H7RA 1MEWA 2AL1A 4HNOA 2POZA 3I6TA 3CZJA 2Z2UA 2J7GA 4GYJA 4LUSB 5G1YA 3THDA 3VIHA 1UC5A 1WAUA 4ONVA 4ZO7A 3OYZA 4K8HA 3CQ0A 4F2UA 4DELA 3MUCA 3BOLA 2FGZA 4GHRA 4QLLA 4FEZA 1MVYA 1VBHA 1M03A 3QV9A 3NWRA 7REQA 1OG0A 1JPHA 4FLSA 3TR2A 2PGFA 4NZ5A 3PBMA 1QBBA 3GDKA 4S3GA 1SFLA 2OGJA 3UPMA 3LK6A 1WDRA 3DAQA 3WQWA 4QJ3B 3QGVA 4KH2A 3JUGA 1VCVA 3BMWA 3W75A 4LYKA 3L4UA 3PZMA 3F2BA 3OBKA 2Y8KA 5EFFA 1OHLA 3U48A 4TTGA 4N9EA 4QG9A 3WFLA 4EANA 4JS3A 5I3FA 1EB3A 2HXTA 5CG7A 1HKMA 2GFTA 4XUGA 3QYSA 3WLSA 3KBMA 4LEFA 3W26A 3TWAA 4OBTA 3GUWA 3WLIA 4C6QA 5G1TA 1NM9A 5D8ZA 1OX4B 4IMAA 1S2TA 5KZEA 5KMYA 3L21A 2OR2A 4KCVA 1SW7A 4XZLX 4LRTA 1I9CB 3SECA 3G1XA 1OYBA 4UUIA 3H70A 3QN3A 1K8ZA 3W7OA 2I5QA 5M03A 1W31A 1FWCC 4IMDA 3OBEA 1TV8A 1LWHA 1LORA 1UOZA 2HE5A 1D8WA 4HOWA 4O0KA 3NM1A 4FS9A 5LNRA 4LVGA 1M7JA 2PEVA 1ZL1A 4QS5A 2W61A 4DAFA 6XIMA 1OFPA 2A3AA 3W6LA 2I56A 3P0XA 1P0NA 4NAFA 2QF7A 4AY8A 2WZTA 1S3TC 3OGSA 2SFPA 2W79A 1JZ4A 3FNDA 3IEBA 1PCKA 4O15A 4F0SA 2QCFA 1K9TA 1BVNP 4EXQA 4AAJA 2Y5JA 1HL9A 1FKWA 2VUYA 4LH8A 1J6OA 4AF0B 1RY8A 4DO5A 4QITA 4PL2A 4E8CA 2JQXA 3COTA 1JQVA 3SCTA 4DWDA 3EOLA 2WLZA 3VCCA 3NO5A 1X6LA 4XD3A 1VD6A 3S5ZA 4CQCA 1AFSA 3VK5A 3W38A 4C7GA 1ICSA 4H19A 2WB5A 1CT5A 1MFVA 3F03K 2BV9A 4PFHA 2WHKA 4DWSC 1BYCA 2DP3A 3RX2A 3ITCA 2OEJA 3GY1A 1JCJA 1RH9A 3VVGA 5E6ZA 2D69A 2QKFA 2A4AA 4FALA 3Q94A 1GPFA 3WLLA 1C8YA 3T9PA 1FWSA 4AY1A 2FTWA 1X38A 4Q8MA 1YXCA 4UBPC 2VRJA 2OZ0A 3NZRA 3BLDA 3VGGA 4GXMA 3EDKA 4L4MA 2DVUA 1HW6A 3BAWA 1T8QA 3FEQA 3ITGA 3URAA 1A4MA 1J10A 3O0KA 1TX2A 3KLKA 2QZRA 4MJ4A 3LCXA 3AMLA 1XLMA 3WBXA 1VFLA 5F4WA 3DYPA 2VEKA 1OFBA 4ZO8A 3RO8A 4QDPA 4PCNA 4IMEA 4CNPA 1G4PA 2OKOA 1YDYA 2PWHA 3VOJA 1WV2A 3GS6A 1IEWA 3PWIA 1XWYA 4AZ6A 2J62A 4MPKA 5EFDA 4HTYA 3GHUA 1PJ9A 5JQ9A 2WYSA 2WC7A 4QAIA 3PZQA 1ONEA 1BD0A 5I3KA 2UV8G 1YKWA 2GL5A 3EGJA 4CD5A 3WDIA 3TMLA 4DX3A 3R79A 1CLVA 5HWMA 4WSKA 1QPKA 1MEHA 4RNHA 1TWSA 1E9YB 2DW7A 4XD6A 3ZT5A 2EPNA 5FACA 3LU2A 4J3WA 4CQDA 1DBTA 2E9LA 1GKRA 1KBJA 1KKOA 4PC8A 1J5SA 1TPDA 2VWTA 4HA4A 4FMVA 4RKAA 3QSTA 1WDWA 2PGRA 4BQ5A 5A8QA 2P53A 4X61A 3F5LA 1KLZA 5KTLA 1IWBA 4YYCA 5BOEA 2BY2A 3N04A 3SQLA 2GVJA 4GRSA 4AHQA 4MWAC 1E6RA 3M0VA 2XFWA 3URQA 5EL1A 3GW0A 5L6UA 2O56A 1PE1A 6CGTA 1DIEA 1K8YA 1TMQA 3PPGA 2F6KA 4LFYA 3UXAA 2XVPA 4YPJA 2P88A 3CHDA 1QVBA 4PULA 4GXPA 3ONBA 1JFHA 3LCLA 4DUWA 1I4NA 2DZTA 2FDSA 3MUIA 4ROPA 4HU0A 2JGQA 1V93A 2WSYA 3QQ1A 3VCRA 3U2EA 1PB0A 3GZ3A 3H2NA 4BY3A 2H6RA 6ALDA 3UU0A 4TO8A 5IM51 3KRSA 4BI7A 4IL2A 3TSMA 3W7EA 1EOMA 4OJYA 3STGA 1A5KC 2E1DA 5DF0A 4ZA0A 4H6RA 2YDAA 2PSNA 4ATDA 2O7SA 6TIMA 4IIDA 2VGBA 1B9ZA 3PNUA 5HNTA 4ATWA 4BWLC 4KERA 2ZIDA 1AMYA 4MDPA 1I1WA 4JFVA 4AZCA 4IMFA 3AIUA 3GZAA 3GKFA 1NY1A 3O6YX 1MW1A 2VZTA 1EDGA 1OYCA 3VOHA 4KFNA 4DN1A 3E2VA 1RCXB 1EXPA 4HQVA 4P8UA 1VFSA 1FWNA 3AIWA 1AW5A 3UNDA 3R25A 5TIMA 2WWDA 5DT5A 3FYPA 1ZGDA 3P14A 1E4NA 2VRQA 2W27A 2PDCA 4ZXOA 1UPPA 1YMYA 1JUEA 4JQ2A 4HJWA 1WKYA 1BSIA 2ISDA 5G4HC 2XTKA 2VZOA 1SR9A 4DO7A 2Y70A 3SCWA 3LRKA 4YU1A 2P0IA 2DZBA 7TIMA 1HJSA 4ZB5A 2EJAA 3EX1A 2J77A 4OUEA 1OWQA 4HOZA 4GNVA 4JEQA 4I5UA 1UD5A 2NQZA 5FEZA 2R1PA 3BCFA 2VFDA 5A2AA 5HWJA 3ABSA 5D09A 4RE3A 4KRZA 2A7RA 1UG6A 5AYXA 4ZBCA 1UD8A 2YZ5A 1VFFA 3IV3A 5AVNA 4PTVA 1S38A 1QI0A 3KW3A 2GVEA 1TA3B 2XVKA 4QTGA 3QY8A 4RUBA 4G7EA 2NV1A 3FDGA 3CUZA 5C0QA 1ADSA 1RCQA 1IXOA 2CCRA 3W1NA 3H4WA 4ML9A 4AZGA 4FB7A 3V5CA 3CL7A 4JN7A 2BY1A 3WX7A 1F2JA 1FFRA 1UIPA 2PA6A 1HUVA 3NR0A 1I75A 3LHTA 4PUWA 1Q8JA 2I14A 4ZE4A 2DVXA 4WLCA 4HNLA 5FA5A 2QCNA 1XYAA 2WZHA 4YLWA 1K7XA 3N6JA 4YVVA 3N73A 4GIYA 3V3WA 3IK2A 2Z6JA 1ZBVA 4PTXA 1Y8BA 3G8EA 4NI3A 4IWWA 3INPA 1V0NA 3R5EA 1VR6A 3BOXA 4TU1A 4RZ6A 2WHMA 3W85A 3WLJA 2VXNA 4TUFA 2HS6A 2ZDSA 3C0QA 4UWMA 3IK4A 3VE7A 4KCUA 5LNWA 1ZZMA 1AH3A 3N14A 3TFXA 4BEUA 5A6BD 4YTQA 3N2OA 2G3JA 3BH4A 2TODA 4M29A 2PBGA 3GTIA 4FP1A 2YL8A 2DZVA 2FTYA 4MYXA 3OVPA 1LP6A 4GVIA 3CZLA 1A50A 3AWOA 2ODOA 2OB3A 1GNXA 4QHRA 3DXIA 2R8WA 3PZVA 2ZUWA 4AG0A 2BHUA 4GIAA 1SW0A 2QHAA 4C1NB 4D1JA 3GFZA 3MUY1 3SCNA 3CQHA 4Q7BA 3HMCA 1QK2A 4AC7C 4B5NA 2NWSA 3CMGA 3LNMA 3NG3A 3NQFA 4L6HA 1GQJA 2R1NA 5EMKA 2F61A 3B97A 5BRPA 2CW6A 3A22A 4ZE5A 3TE9A 1JCLA 4QP0A 1PEZA 1SZNA 3D47A 3DFHA 5I02A 3PSWA 3LHYA 3CTTA 1Z8AA 3PY2A 1EJSC 2GSEA 1H7PA 3GSMA 1CB7B 3A5VA 3HU7A 8XIAA 1E3ZA 4TV6A 2BZNA 4FOJA 5ECUA 3VD7A 2VFFA 3PWAA 2ZE3A 1E6PA 1V6VA 1GYNA 4DXVA 2YDSA 1P1MA 4IMCA 2PDYA 3T78A 4B5VA 1GHRA 4YWSA 1IEXA 2PTXA 3QR3A 1L8PA 1LL4A 4XSMA 2J47A 3NEVA 3VUSA 3PBYA 2Q3RA 4L1GA 3VD9A 1VEPA 1D2KA 4GBUA 3M0KA 4M3PA 3LPOA 3CH9A 1I0BA 1Y5WA 1ZHAA 2ZX6A 3WDHA 3BG9A 1R9XA 5CC6A 5HMEA 4KCWA 3GTNA 4N9DA 1QBAA 3N15A 1J9YA 4NJGA 1QW8A 4H01A 4XZIA 1F07A 4AWEA 1I8JA 1XDMA 1EF3A 3CIXA 4MIMA 1YIXA 1KFWA 4S38A 1B2YA 3RX3A 4Z2LA 4LS1A 1UR9A 3SBFA 1MDRA 2W9MA 2WSRA 2ZKMX 1HKIA 1EQPA 4XZWA 4G8TA 1FWEC 1ZPTA 3P62A 4LCRA 3W00A 4K37A 1VLIA 2YKKA 4UFMA 3TSDA 3L5AA 4PCSA 2VGFA 2RJGA 3FX4A 4ECLA 1XISA 1F73A 3LBMA 4AWUA 1Q6DA 1V7AA 3EKGA 1ELSA 2RFGA 1WBJA 1QPQA 1Y65A 5D33A 3HPXA 1CXFA 3PVFA 2J8GA 2PDGA 3TWBA 1XJBA 4WY0F 4RW5A 3GR4A 2NW0A 3TOPA 1SO4A 2OEKA 4EIVA 2Y7GA 4CLMA 5BZAA 3IIOA 1KXTA 4L4OA 1P7TA 1KQZA 3WNOA 3UJRA 3AC0A 1MUCA 1F3TA 4IZGA 1OT1A 2G8ZA 4EK7A 3FCPA 3AYVA 3DX5A 1XLIA 1RK6A 3OTRA 3M6DA 4JNYA 4UTUA 2J6XA 5HMSA 4HYWA 3VIFA 3B4UA 3OG3A 2RGMA 1KM6A 5AYYA 4WR3A 5HMFA 5A6KA 2XN2A 1TG7A 3NGJA 3MBFA 4FPSA 4V1YA 3WQ5A 1UD3A 3MP3A 1ICQA 1J6PA 2P3ZA 3R89A 4U3CA 1LM1A 4ADUA 3FHQA 4C6PA 2VUNA 4LYPA 5ECVA 1JCTA 3P74A 2R94A 2NXHA 4Z2JA 1XLGA 3NO1A 1UR0A 3ARUA 2R1MA 3S6TA 3QVQA 2XGIA 2HJPA 3CB8A 2B7NA 4F0MA 2OTDA 4C6FA 1R9ZA 3PJXA 4O4WA 4R9XA 2WMKA 3S2JA 3VYLA 2YCLA 3M5XA 4QLJA 3PAOA 1WBHA 4LVFA 4JOMA 1X1ZA 4J3SA 3TSBA 2D3LA 3AS0A 1UHVA 2JE8A 2J24A 3GXMA 1VFUA 4EE9A 4UFJA 2WVTA 4NNAA 3WL0A 1YLVA 3VKJA 1JIBA 3S46A 3ITLA 2GVLA 1V3JA 3VUPA 4CCCA 2O4QA 3BLFA 3GK0A 4PA8A 2AQWA 1SO6A 2D3NA 2FZ8A 3M46A 2PDMA 3E0FA 3OLGA 2V5LA 2JBMA 4GQBA 4XZBA 4FAMA 4NVTA 1TR9A 2WV8A 3UXIA 5GNYA 2WZMA 1JCMP 3NZQA 2JF6A 5BU6A 4ASTA 5TAOA 3NZGA 3SUSA 1DIOA 1V6UA 7XIMA 3E5PA 5D02A 5AHFA 1BWLA 1XH2A 1XV8A 4P7LA 2E6YA 4XQ6A 3LRLA 1LWIA 3V18A 2EJ1A 2X1SA 1K77A 3W81A 5FJTA 1J11A 4XO7A 4NI8A 4IFOA 2XVGA 3W1XA 4XD5A 3W74A 3KFTA 1JRBA 6REQA 1K02A 2VEGA 4CD4A 4YTSA 1AUSL 3CL8A 4DF0A 1VRDA 2WMFA 5CGMA 4UOJA 3TC6A 1AH0A 1K9DA 4Y6GA 2J8FA 2NV2A 3PP7A 4LC8A 3QYQA 2VTFA 4Q4PA 1VGAA 1DWAM 1FHLA 3RUBL 3AOFA 4ES4A 1MXDA 1PZ0A 4HN8A 4KWOA 1QDSA 4QG8A 1GORA 2DZXA 3FGCA 2WJEA 1R85A 2BGQA 2ZC8A 2ZRZA 1IT7A 4PTNA 3QZEA 1E9ZB 1XYFA 3AAMA 3W2NA 2ZVRA 2DH3A 3E74A 1OF6A 3GIYA 3ES7A 1DIKA 3L5LA 3S1UA 3UXDA 2C0AA 4IJCA 4EACA 4B3KA 4IHCA 4A8RA 3HG3A 3H6OA 1PKNA 3WBYA 1XC6A 3F4WA 3GXFA 2BSLA 3KBJA 4NZCA 3IJDA 3PG9A 5IBXA 4DNHA 2HBVA 4QCFA 4ACZA 3QLDA 3GG0A 1TR1A 3QMTA 3AALA 3Q37A 5F2LA 3ARSA 1W2PA 2WNQA 3SGZA 5DY2A 2E25A 4L64A 1KBLA 1RV8A 2BWGA 3UYIA 1E40A 1E4IA 3CHFA 4H04A 5IXEA 2PDIA 1EP3A 3ZR4A 1PUDA 1YXDA 4FNTA 4E2DA 4NNBA 2QGYA 3ZO9A 3CZEA 3KOFA 4LXFA 2GWGA 4HYVA 4DRSA 5FEPA 2ZICA 3FY1A 5JIWA 1A5OC 1XIDA 4KIRA 3SDOA 3GC2A 2FJUB 4EPDC 4MB3A 1PX4A 1EGZA 4IGMA 2BXVA 3A9BA 4XAGA 2EKCA 1TUXA 4NT0A 4M7TA 3T55A 5CAHA 1KCLA 3CUXA 1H50A 5C54A 2OGYA 4ZL1A 4ZSTA 5G4EA 4Z1CA 3QMSA 4Q4QA 4EPKA 3HB9A 1Z6KA 1UH4A 3HIJA 3NSNA 5EPDA 4UMCA 5D9MA 4AVFA 3RF9A 2QYGA 4MOZA 3SN4A 1XBXA 1QI5A 2CLKA 2WLYA 3LOTA 1HNYA 1QASA 4AHPA 4DQWA 4L1XA 1D3HA 4AIBA 3RRXA 3W6MA 1ME9A 2Z4GA 1LTDA 2CBUA 2E5BA 5CSUA 1T8XA 3W37A 3NQMA 3BJTA 3AIBA 1LL6A 1TZ9A 1XCWA 2ZZ3A 3Q67A 3WH8A 1UC4A 4IFKB 2J75A 2VDHA 2V3FA 1ITXA 3GG1A 3IJ6A 1AZ1A 3BANA 1K3UA 2F6XA 1EDQA 4M1BA 1CGVA 3W7IA 4Z1YA 2I16A 1X98A 3ITTA 4Q8OA 3TYCA 3TN6A 4ZXLA 1IQ8A 3GDMA 1YTKA 4J2PA 1IXQA 5FJIA 2AL2A 1TVLA 5CH9A 2ISWA 5FJUA 2YB1A 2PDLA 5AOUA 2PTZA 1SGJA 4OBRA 2IPGA 3LENA 2D22A 4Q8UA 2HS8A 2NQ5A 1OCBA 1KWGA 3T09A 3M0JA 2NLYA 3CNYA 4B92A 2JGYA 3C2YA 3FDKA 4E5TA 4XK2A 3RFAA 1BG4A 2B7PA 2HROA 3L2MA 4FZIA 2ZXAA 1B30A 1CNVA 1T96A 2DZUA 1W3HA 3DFOA 1BYBA 1WKDA 4MM1A 4FR1A 3ABQA 3WLNA 2P1FA 3BG3A 1MQRA 2OX4A 3SCQA 2DIKA 3VE9A 3GNDA 4L56A 1PHQA 4IF2A 1KB3A 2G3MA 3WMBA 1WA3A 4D71A 1ODUA 1XINA 1YEYA 4JCLA 1F3EA 3SUVA 3A23A 3VOGA 2DPEA 1MXSA 3DFPA 1SJBA 3QQ0A 3WH5A 5EGRA 3R8RA 3ALFA 3S1VA 3WJSA 3VM5A 1KFKA 3PJWA 5H8PA 3HQPA 1UP2A 3PZNA 4TIMA 3OVRA 1DJZA 5A8MA 4HBKA 1EJVC 2IPJA 5K7JA 1EZWA 4J40A 4WJXA 3AMGA 3T6CA 1EJTC 2Z7GA 2E09A 2A3HA 4L9YA 3W73A 2QJIA 1OBAA 3REQB 3SI9A 2Y7DA 4JTQA 4BF9A 4RPPA 4NL1A 1IE7C 2PZNA 4BQ4A 4HPXA 4H2CA 3TK7A 3TAOA 3UG8A 4HT3A 3S5NA 5ABTA 3GXTA 3G0XA 3CL6A 1GVEA 2WJZA 2CERA 2HXUA 4IFRA 3A13A 3OVGA 3TJLA 1PPIA 1IHIA 3KTSA 4UTFA 1GOXA 3AS3A 4C91A 4X3ZA 3GG8A 1U5HA 5AY7A 2Y7EA 3EOOA 5AECA 3FVMA 1HX0A 2DVTA 2VHLA 1OT2A 2VEFA 3GFXA 4JTEA 1FRBA 3LI0A 4IJRA 3KS5A 2NQ9A 2ZA2A 3URBA 3T8QA 3A21A 4E2VA 1TV5A 5REQB 4RE2A 2NT0A 5CPSA 2HPMA 5ABHA 1TUFA 4P8XA 5AHIA 1C29A 1I60A 2QNEA 3MBDA 5A2CA 1VBJA 1J12A 1PTAA 3EPNA 2WPBA 3BZJA 1XIBA 1GUVA 4C6OA 2QUMA 3OZOA 1MUMA 4CU7A 1E5JA 4PMZA 2CETA 3EWZA 5G2IA 3GVVA 1ZJHA 4C5ZA 4LRSA 4X2RA 1O95A 3G1YA 4GI6A 2BVWA 4JFSA 4HNUA 3MV01 4D6EA 1X97A 3B8WA 3RU6A 4PBFA 2CLFA 3PWGA 2C3ZA 3PUOA 3OHMB 4N9BA 1XLFA 3K13A 4NX5A 4L80A 4P2VA 3VIMA 2VWSA 1S2CA 3U0HA 1UBPC 5IBXC 3NSMA 1RALA 5FEXA 4JTIA 4BI6A 5CC7A 4BF7A 2ZUUA 1AK5A 3WDPP 3WLHA 3UJEA 5C9XA 3AMCA 1XIGA 4DIAA 4IICA 2PDFA 5HUPA 2OQHA 3DKJA 3BCJA 3FJ6A 1FTXA 3APTA 2PDKA 3L0GA 4DBSA 3QZAA 1JEZA 3ZZ1A 1D7FA 2WNZA 3B8DA 5M3WA 3BICA 2QV4A 4POCA 2Y5EA 3M41A 3CXOA 5A6TC 2CZ5A 2Z27A 4DBDA 2NX9A 5C7VA 3C2EA 4I5XA 4J27A 3TLQA 2PLCA 4AZ7A 4LUSA 3CM4A 3M0XA 4DY1A 4YN5A 3MJYA 2WVSA 3E0LA 2NVAA 1B3YA 2J7DA 3G1VA 3GFYA 4KRUA 4IPNB 3ZLGA 4F0RA 1JGMA 1O12A 2I5GA 4G7FA 3OU8A 3MB9A 4ZSUA 1RBOB 4MJZA 1H62A 3AS2A 3I7RA 3MS8A 2V2HA 1OSEA 3RGTA 3G1HA 3UJFA 3WNLA 1T40A 4GX8A 4C6IA 1A4LA 1HT6A 2V3EA 4Q8TA 5FESA 2GGHA 1Q4NX 1BFNA 1KXHA 4YHGA 3U6WA 3MKVA 4A3UA 5U7SA 3LTSA 1S5MA 1ICPA 1DJQA 3CLMA 2Q3OA 3LS9A 3TYZA 4HTBA 1KQYA 3F5JA 3LCFA 1UWAA 2TAAA 4MNMA 4HP5A 3GXDA 2ZUVA 2DT2A 3B9OA 1P43A 3S5OA 1EO7A 2QCGA 2QJJA 3U2OA 1QNSA 4MJMA 2HVOA 1B54A 1RY0A 3ZWSA 5AC5A 5HK4A 1LOSA 4DAIA 1GG1A 2IXVA 1LBFA 4XIAA 3M64A 3FGCB 3WNMA 4M80A 3W1TA 4DPQA 1SM9A 2WMJA 1CCWB 3WD0A 1S1RA 3GXNA 4CEUC 3GO2A 2WM0A 3BW3A 3B0XA 5C2XA 3UZZA 3TUUA 1XFCA 5GQBA 4NU7A 1T7LA 3TTYA 4PE8A 4W4QA 3ZVIA 1KFEA 3W6YA 3EXSA 4H3DA 2JALA 1P4CA 1TE6A 3MU7A 1A3HA 3NPUA 1LQAA 4GYPC 1H09A 3LM3A 1GJPA 5BXSA 1JR1A 4B90A 4KWWA 4IM4A 4O8RA 4LV9A 3KWXA 5AC4A 1XKJA 4Z17A 2BXYA 3YPIA 1RZMA 1U30A 1TO3A 3I4EA 3U7BA 2XGBA 3KHDA 1W37A 4AHOA 1IEQA 1QTWA 1J0IA 3CWNA 3NQ6A 2NQLA 2JF7A 4GOAA 5AZ1A 5FJPA 3AIVA 3LLXA 5BYWA 3HG4A 4K1GA 3C8NA 5LIWX 5AC7A 5EMUA 1QI3A 1UWQA 2E6DA 1N8FA 3EWCA 3VD3A 2KX9A 4U5KA 1RR2A 1ZAHA 1KTBA 1GCYA 2YL9A 1O1HA 1TQJA 4GINA 1QHPA 4GMEA 4CCEA 1YPFA 4J5NA 4BWLA 3HGJA 3BPWA 3BGGA 2OQYA 3VGEA 5CEWA 4LCSA 2C16A 4UFLA 1FQ0A 1YNQA 3QW4B 5AB3A 2PWVA 3DBPA 1P1XA 4O50A 4IGSA 3KP1A 4HPNA 1QWGA 2FYMA 1UW9A 2AMGA 1NP0A 1E70M 1DWFM 4ADTA 1UA7A 2ZXDA 2Z0IA 4EPBC 6XIAA 3SAZA 1H5VA 3WBAA 2W4XA 3WH7A 4FOUA 1GQNA 5AHNA 5HANA 4F0KA 4MDOA 1UKTA 2GLKA 1JPDX 4XG1A 4QQUA 3MO7A 2NLIA 3R2GA 4DLFA 3KOZA 5ABFA 4JX5A 3VO0A 3P81A 3KE0A 3MDWA 1DORA 3CWOX 3G22A 4HKPA 2X05A 2NX1A 3U8GA 3WF0A 4HB7A 1K6WA 4XVDA 3HPZA 3LTYA 1NTHA 4X0VA 1WXJA 3PN8A 4GX9A 1EP1A 2RDXA 4YS1A 2VZSA 1EA9C 1KO0A 3M47A 4UMAA 3RG6A 3TMQA 1GOQA 3FLUA 1H60A 4GY7A 2QMJA 4J3UA 4KEMA 3MMDA 4FNSA 3M0MA 3D6NA 3W71A 3QLLA 4IX2A 1S1PA 4C6DA 4C1KA 3VOFA 1GZGA 1R87A 3UR7A 2PBOA 4JHZA 2P3EA 2WSKA 2OJPA 4LC6A 1RJRA 3W7LA 1DQUA 2ZX7A 3KUMA 4C6LA 1U2YA 2XIQA 2VD9A 2AL2B 2J27A 3P0WA 4Y9PA 1GWJA 2PDBA 3LA4A 4KMQA 5DFAA 2D73A 3AXIA 3U9IA 1XGDA 2CFFA 1TWWA 1VHCA 3UPBA 3T0AA 4IGNA 3LLDA 4K68A 3SRHA 3CBWA 3QFWA 4H9UA 4YJ5A 2EAWA 2WO5A 4RX0A 3D0CA 1IGWA 2VYOA 2XVNA 1PV8A 3DDMA 2ZUSA 2WSPA 1CPUA 1P0BA 1W9VA 3NXFA 2JKEA 4ZO9A 1AL8A 2NUWA 5KEZA 1VAHA 3W86A 1OM0A 1I2RA 4LQ1A 5G2HA 1V02A 1LZOA 1SSGA 1DL3A 3SRDA 4N9CA 5D03A 5A8NA 3SW6A 3AHZA 3AHXA 3Q65A 1KTNA 2XU2A 4MB5A 3TEVA 3I3EA 4AISA 1TX0A 3QH2A 1R30A 4LTSA 1V4YA 4LB4A 4M6QA 1UH3A 3SCOA 3L12A 3R94A 4KF1A 1OK4A 2G97A 1GJUA 1GK8A 1QPNA 4XAPA 1JI1A 4CD6A 2ACUA 5KZ6A 1E4MM 4AXKA 1UB3A 4UC5A 1GQIA 4OE7A 3WG6A 2E3ZA 3VD5A 3REQA 1VP5A 2O7QA 4PN2A 3WD1A 2J7CA 1YNYA 2V3GA 4DM2A 4RW3A 2R6OA 1FCVA 3VIJA 3SCVA 5F7UA 2XH0A 3UY8A 3QF0A 1O1ZA 4PMJA 1JZ3A 1OB0A 4H00A 4I6VA 3MSYA 3VIGA 1X96A 2WMIB 3BURA 1PSCA 4IQLA 3S47A 4J28A 3PANA 1R46A 1XIFA 2A0NA 3WH9A 2WHLA 5D8WA 4FX6M 4GXWA 4INFA 4IT1A 3CO4A 5HINA 1DQWA 2P10A 1VJZA 3G6LA 4GD0A 3HPFA 4PB4A 4HVXA 4PMXA 1C93A 3AYRA 3FXYA 3PSVA 2FZDA 3LMYA 3CJPA 2XYLA 4UTJA 1E71M 3QOKA 4URIA 1QOPA 4RZBA 5CPNA 1QHZA 5CPLA 3VMPA 1JG9A 3UPWA 1BAGA 1SJDA 3T2OA 2CC0A 2A3EA 3GHSA 5CZSA 2GQ3A 3DCPA 1R3TA 2G4JA 2ACSA 4NJIA 1OIMA 1GVOA 4MTVA 3BJSA 3GDLA 2WPGA 3OODA 5IRPA 3TTQA 2E67A 3QV6A 1ISYA 1ITQA 1E6QM 4QSHA 4RNJA 1V3MA 4DI8A 1Y0EA 2NUYA 1W5OA 3GIPA 3L2LA 3E1F1 3OPSA 3KS6A 4LUJA 3MHFA 2E1WA 1V6XA 3CAKA 2PDXA 3W01A 3H2AA 1QI2A 5HMDA 1QAPA 3TCEA 4WIWA 1DIDA 1DXEA 3UG5A 2A6NA 4GVHA 4P8WA 5A6MA 5DN1A 2GOUA 3RPTA 5C5YA 2Y24A 1FCQA 3STFA 1J2WA 4TX6A 3HZ3A 5LKYA 4U3AA 1VYSX 3HQOA 4UTHA 3NURA 4J3TA 3K8MA 1Q2RA 2A21A 3LCIA 3PTMA 2WJFA 4I3GA 3N34A 2R91A 1F6YA 2V69A 1M6JA 4HMDA 3QQWA 1YTEA 1ZU8A 3WMSA 2Y4SA 3ZSSA 4GNJA 3TJXA 2GDVA 3VAVA 1TELA 4O1CA 2XHYA 3W72A 3PZOA 2OFJA 4L65A 2C91A 5BXRA 2OXNA 3NL6A 3P82A 3FXGA 4I9MA 4Y2WA 2L5HA 4DUOA 3N2CA 1DTNA 3WK2A 3N2BA 4PL1A 3AIEA 3ZVHA 4RV3A 5TNVA 2KZHA 1UOKA 4HSNA 4X63A 1ZS2A 1FH9A 4YTUA 1KV5A 4D8ZA 1LOLA 1WOAA 3V36A 4V27A 4Y8FA 1UJPA 3WUGA 3WLTA 5CJMA 2OOFA 1RJQA 5DMMA 3WQFA 4WXZA 2V5CA 1L6WA 1B3ZA 3AS1A 1R2SA 4P7QA 2Z2BA 5FF4A 3VNJA 2EKGA 2BASA 4G1KA 3IIXA 1TB3A 2OZ3A 3WQEA 1ZUAX 5DCBA 3DH7A 5LXXA 4EPEC 3N9SA 4ZQCA 3QGKC 1O4UA 2WC3A 2GUYA 4MZ1A 4Q8QA 3UWEA 3MUZ1 4UFHA 4NUWA 5DRIA 4MB1A 3RLVA 1JYXA 4W8AA 4HU8A 3KZSA 4WJ8A 2J6VA 2C1GA 3BWWA 1B3VA 4GQ0A 5BXTA 1GVQA 5DO8A 1LLWA 2UY4A 1R2TA 3S1WA 5BWFA 3MHUA 2PDPA 1E15A 1QI4A 4BQ3A 1UKQA 5HUOA 1XYCA 1KBIA 3U5UA 3QV7A 4O0ZA 1KM1A 3CV7A 5D9OA 3TN4A 1L6SA 2OSYA 3W83A 1W3JA 5JUVA 3PTQA 1J0JA 1YADA 4NYUA 4OV9A 1AW2A 1W56A 3SEPA 3UY7A 3UA4A 5HDRA 3OBAA 4ICMA 3TQ0A 3N17A 1BLIA 3Q2DA 2PDHA 3VX0A 4JIHA 3G3DA 4MYAA 5DCEA 3MCMA 1UCWA 4GI4A 3R4IA 3NEHA 3WD3A 3N19B 1NOFA 3W7HA 2RGLA 3MPGA 3UR5A 3N4FA 3ZIZA 3L4YA 4ZQRA 1PXGA 1DJWA 3VFCA 4LS0A 1E9IA 3CEPA 1SFJA 2I5IA 4HCDA 1X6NA 4PCFA 5DLCA 3TN3A 3UJ2A 1CWYA 2OSXA 3NOEA 5H2ZA 1IZKA 1HQTA 1L0PA 1F9CA 3M1ZA 2ASHA 1GEQA 4PBEA 3TC3A 1A5LC 1XRTA 1UWUA 1E55A 3DFTA 1TZ7A 4UNIA 3AJ7A 2P5NA 1PDYA 2OODA 2Q8ZA 2IQDA 3NM3A 2A3CA 5MHBA 1W3KA 3P5ZA 1GQLA 5FF0A 4DWSD 4Y9MA 3MI2A 1P7TB 3OGVA 3M5YA 1RSCA 4AWTA 5TBOA 1ITUA 1HGWA 1KXQA 3ZVHB 5GJPA 2ZRVA 1ME8A 4GISA 1UWSA 3VIIA 1E72M 1HN1A 1O5XA 3WNNA 4QEEA 4AW7A 3T0CA 3MY9A 4QRNA 1EUNA 2J79A 1XSIA 5FF2A 1V51A 4M51A 3CWHA 4ZMGA 1FXPA 3GVWA 4GKLA 4I5RA 3CZGA 2YXXA 1KWKA 1ZBKA 1AW1A 3VC6A 1W1VA 2INFA 2OQLA 1XQKA 4XZMX 4A8IA 3PC0A 3G2GA 3KM8A 3F5KA 2ZYFA 3I7QA 1DJHA 2WJDA 4JTFA 1F8MA 4R5EA 1A5SA 3KCJA 3R0KA 3WFAA 1DOSA 1VIZA 4UR7A 4DHGA 3LN3A 1Z3NA 5HQMA 4DZ5A 1LCOA 2VMFA 5C9WA 2QEZA 1O60A 5DXYA 1HKVA 3QC3A 1AJZA 3C2RA 3FHAA 1XLKA 3CUGA 4R3UA 2C8NA 2V30A 4MADA 4O57A 1CX9A 4B91A 1XH1A 4OIFA 4CQ9A 3THAA 3CYJA 2AGKA 5F1UA 2DORA 3LX9A 3W7JA 4H9XA 5I77A 1HO1A 2CZFA 1QHOA 3ARXA 4MNJA 2Y1HA 2YA2A 2QXWA 2I7GA 3HBLA 3LG3A 3TW9A 3EWWA 1ONXA 4NQ1A 2JK2A 3VGFA 5DXXA 1H4PA 4LOCA 3IWPA 3CAWA 3PBGA 3BV7A 4B5WA 3VDGA 3EDFA 1C3FA 2ABAA 1QFEA 1BTMA 4V2XA 2W92A 3L9CA 2MNRA 3WENA 4AEEA 3LB0A 3GTHA 2Y5SA 3WH6A 3UEQA 1XCXA 3VZXA 1XLCA 1H61A 3VM7A 2XISA 2PC8A 4DJED 5CC3A 4DNMA 1Q63A 5M17A 4H6EA 4GYKA 3TC7A 2X0HA 1EX5A 3CGTA 3CZKA 1L6YA 1XBZA 2FTPA 2XWEA 1W1TA 4NZJA 3TONA 4A8LA 1FP8A 2FZMA 4N6EA 3EDDA 1SJAA 2PRLA 3PBUA 4PB3A 3SURA 4JEJA 3A64A 3TZNA 3OEXA 1WYIA 1KRCC 1XIEA 4CN6A 1LBLA 2FJKA 4GIEA 3A12A 1CW2A 1R2RA 3G1DA 4ATLA 1NOWA 4QJ5B 2J7EA 3OIHA 2UY5A 4U28A 1U5JA 4DBUA 4K8EA 5JMUA 4NKCA 4WXYA 1W5MA 2C14A 3R1ZA 2EGZA 1UMLA 1RA5A 3KVJA 4O13A 1FWJC 2AQOA 3P84A 2QV5A 1MUWA 1VBUA 3PAJA 4HCLA 3E0VA 1ONRA 2ZADA 2ICSA 1MW0A 4YXGA 4A6GA 1UQZA 3W82A 3BW4A 3L5MA 3A3WA 4RXGA 1OADA 4GQQA 4KW2A 1NH6A 4CU6A 1VFTA 4KCTA 4LAUA 1JULA 1CB2A 4AZ5A 5CC5A 3EDJA 4RK8A 3EYPA 4XISA 1W5PA 3R8GA 3L4XA 4DWSA 4E3TA 4ORIA 4JIPA 3PZUA 2YYTA 1TTJA 4O53A 5AYBA 3QOMA 2XDFA 1SR0A 2NXIA 3FK4A 3S5YA 4WKHA 1L2UA 3W84A 2CYGA 5PTDA 1F8IA 4GVGA 3H7UA 1R8LA 1V7YA 3RCYA 1TPC1 2FZBA 3K4DA 3NVTA 4DZAA 3WZ0E 3DGRA 2Q01A 3WJXA 3JVAA 3W1AA 2D20A 3LRMA 4ZGYA 3LYEA 2NQJA 2DIJA 3V1PA 3VNDA 2C15A 1O5RA 9XIMA 5DANA 4KS0A 3DC8A 3NDOA 5HNNA 4HJFA 3W3OA 5BXPA 1FFQA 3GHTA 1ESWA 3VMOA 4IH3A 4PMDA 1VFHA 1UA3A 4ML4A 4MNKA 4FNUA 4YL2A 8XIMA 4GZIA 1J0HA 3HO8A 1YXYA 3G3MA 5FL1A 4LVAA 1JD9A 5CLWA 3KEHA 3GNOA 4GG9A 4AX7A 3IAPA 4L4PA 3LHZA 2YZRA 4WF7A 3UCDA 1GYMA 1UR3M 3TW6A 3HG5A 1NDZA 3NJ3A 5J04A 3P60A 5G1MA 1AJ2A 1AL7A 3DYOA 1MDLA 1B3XA 1WKFA 1XBVA 5A95A 1E4LA 1KFJA 3N2MA 3WK1A 2PDJA 2V68A 1XYZA 4RL3A 1PO9A 4JPGA 1X39A 3HGSA 1JZ7A 3HMJG 1O94A 3LZ3A 1DPMA 3NQ8A 4XKMA 5D2VA 3MZ2A 4WDUA 4NZ3A 2QGHA 5H8MA 1M01A 1HKKA 2XJ7A 5AZ0A 4LEQA 1Z9AA 4UOQA 1B1YA 3RHGA 2CBIA 3APGA 2Z29A 1MZHA 2X42A 1US0A 4M6UA 4RDVA 1W3IA 1MEIA 1FWRA 3NQVA 2A7NA 2VFGA 4TMBA 5E93A 3KXQA 4I8DA 2EF9A 4LS2A 1KGXA 4C1LA 1R5YA 2QDGA 3SN1A 1M7XA 1OFQA 2QPSA 3GU9A 3V5FA 1FDYA 2Y62A 1KGWA 5E70A 2EBNA 4O1AA 1A5BA 2QLYA 3E0WA 1VPQA 4Z1DA 3M0ZA 5E5CA 2HISA 1QK0A 3NQEA 4IL0A 4GI8A 3EEZA 3W2UA 4GH3A 2ZFAA 4S3FA 3APYA 3STEA 5EB8A 4H2HA 2PU0A 3L4ZA 1PKLA 5CZKA 1XXXA 1V3LA 2EG7A 1ZQ5A 1H7XA 5HJYA 1OK6A 1KRBC 2FMOA 2IUZA 1XS2A 3GH4A 4N7QA 1JFXA 4UQEA 2BX7A 3LV6A 3BAYA 4AD1A 1PYFA 4Y9OA 4LNCA 4DUXA 2PD9A 2CXGA 1GOIA 1V6WA 2GK1B 1QNRA 2GQ8A 2V5JA 4AYGA 2G4FA 2VD8A 3QPZA 2GZXA 4FXJA 1ZJAA 1LL7A 2XM2A 3L65A 2EXOA 2XPKA 3NQDA 4H8HA 1GOKA 1ZENA 3BGJA 4AZIA 3OJGA 4ZFMA 1YX1A 1BGGA 3LDVA 2WKLA 3GQYA 1RP8A 3KP0A 3LSCA 5RUBA 3T42A 5I3IA 5I7GA 4WZHA 3S1XA 1EHNA 3UERA 1GYLA 1TVNA 4OBSA 4WRHA 1UR4A 1Q7ZA 2OSWA 4JTKA 3RR1A 1X7FA 2FVKA 3SSZA 1J79A 1F74A 4C90A 4IQEA 4RE0A 3TYEA 3IJ7A 2ADAA 4KGJA 5F1VA 5A94A 3VD4A 2DJLA 4PUMA 2V5BA 2Z24A 1A3WA 3IGHX 3CYVA 4LAZA 3OZMA 3FEMA 3EB3A 1LT7A 1X6UA 2YFOA 4JX6A 4IJBA 3SFKA 4NP7A 2DSUA 3G1RA 4TTUA 4MSSA 4BK9A 1B57A 2BGNE 3S3GA 4K7YA 3B9NA 5CJNA 2J74A 1CGWA 3RCMA 1Z42A 3CLWA 3FSTA 1EGMA 1XL9A 3NQ7A 1XYBA 2VO5A 3H4XA 2CHNA 1ZY9A 3W23A 3GW3A 4QE1A 2OYLA 4JFWA 3LXCA 1JZ6A 5HA7A 1JZ2A 4AQLA 5MF5A 4JYEA 4Y8EA 1HL2A 1YBQA 1A47A 4H7VA 4QFUA 1TIWA 1GW9A 4L7ZA 4CUCA 4CNUA 2ON3A 4HYRA 2FFIA 5EMLA 2BOEX 1XLEA 5IFTA 2DSWA 2JEQA 1UQYA 5EBAA 4CNSA 2DZWA 1CEOA 1W9XA 1G4SA 2VR5A 3EWDA 4CEXC 2X2GA 3W1RA 3WQCA 4CD7A 2QCDA 2FHCA 1W0MA 3WQDA 5A6BA 2F8QA 1A5MC 2GUBA 4G6CA 3MI6A 1MO0A 3DBNA 4KRTA 2PRHA 3EXTA 1NVMA 1NWSA 1A0EA 4L61A 4XZHA 3OW1A 1CI1A 1HP5A 1Q6QA 1YE4A 1X1OA 3SJNA 3OVQA 1TIMA 2WCGA 2FMNA 3B9AA 3C2FA 1QW7A 4F0HA 1ZP4A 5IHRA 3VDBA 4IQDA 2RAGA 4K38A 3RX4A 4MUZA 2E6AA 1G01A 4D1IA 4IG2B 1WOBA 1NDVA 4AF0A 1KR1A 1OG6A 1CXIA 2B4GA 1F4HA 1EO5A 2Y0FA 3H23A 2PODA 4D8LA 2WQDA 3EWXA 5KINA 4QEHA 4AD0A 2INEA 2ABBA 1KR0A 3KRZA 1W54A 4DI9A 5BOFA 2CLOA 5D2YA 3C61A 2VDIA 1H1YA 1XLJA 1IZJA 4J4KA 1EF2A 1WNOA 4BS0A 5HPCA 2ZVIA 1FH7A 5HNUA 3NPWA 3POCA 3WQ8A 1K7EA 1OFDA 2WNWA 2C71A 4H9YA 1FA2A 1RLCL 2WMHA 2XSAA 4KETA 3VKAA 3WLKX 1C7TA 2ANUA 4FX8A 1MXGA 2IKJA 3DC0A 4GO9A 1LROA 2CIPA 2G41A 3G6MA 1ISWA 3QBUA 4HZ7A 1RJPA 3LHWA 2CZDA 3HV9A 1US2A 1XLBA 3N29A 1CZ1A 1MYRA 1ML1A 2XVLA 1A0CA 4YHEA 2DQWA 1BQCA 2E0PA 2FHFA 4E4UA 2QJHA 1EXBA 1E6XM 3T8LA 4B5SA 2VFHA 4TXEA 3PBWA 1IR2A 4B9YA 2PLKA 1YYAA 1JD7A 1Z89A 4E2BA 1WUFA 1D7KA 2PPGA 1N55A 4IX0A 4W89A 3MP5A 2VEIA 3M5ZA 1P0DA 2VZVA 1S5WA 3CK5A 5HULA 5I2UA 1PIFA 3W4RA 2EQDA 5EMMA 2GOKA 4ICCX 1QATA 4GKTA 2X1RA 2BDQA 1A0DA 1GTHA 1CDGA 3DN5A 1VCFA 3GAYA 4PSRA 3GKAA 2W67A 4OGZA 3QPEA 5FIPA 4US5A 4FX7A 3FSUA 4R7OA 1BPLB 1RK5A 2X7VA 1PZ1A 2PZ0A 2Z26A 1P48A 2OG9A 1OX5A 3KCOA 3ABOA 4Q7IA 4Y9AA 2DZAA 3LI1A 3PPFA 3MYOA 3AHYA 2NVDA 4B5XA 3MSGA 3WUFA 1FXQA 4W84A 1PZ3A 4UZSA 1QOQA 4IP4A 1JNDA 2XFFA 3AHTA 4GGHA 2O0TA 2ZTKA 3TQPA 4Z42C 2QUTA 6A3HA 1EA0A 2J7FA 3AMKA 1TJ2A 3V35A 4F8XA 2TYSA 3BC9A 1J01A 5D2XA 5DMLA 5FD0A 3W7RA 3DFQA 1PKMA 1NELA 3R7MA 3AIQA 4N42A 2W0UA 4ERIA 3W2LA 1E56A 3EOSA 1TV2A 1BXCA 1M3UA 1FHDA 2WMGA 4WHBA 4GUGA 1Q13A 2ZWYA 1DJGA 2PUZA 1RCOB 3VIKA 2NQHA 1EEPA 1Q6GA 4J3VA 4AEFA 4JKKA 3L4TA 4FI4A 5EMJA 4H6QA 4S1FA 1WB0A 4JIEA 2VC6A 3WDRA 2BVTA 3G0SA 4V28A 2D24A 4GVFA 2NVCA 3T05A 3WSUA 1GOWA 2H8XA 2CLIA 5BW6A 2GJPA 3CUJA 5AHLA 1ZRQA 5GJMA 3ARQA 1XI3A 3T0BA 4LPCA 1O6IA 4A05A 2XZ9A 3SRFA 3WNKA 4EVZA 4CVWA 3LXBA 3W2KA 5FEWA 1DWHM 1L6GA 2QJGA 1CGXA 3HV8A 3L68A 3ZR5A 3GVRA 3UZJA 1FWHC 3EWYA 3BAIA 2FZNA 5E0KA 5JXQA 2X0SA 1KM5A 1Y5XA 2DDXA 2OZ8A 1W8GA 1Q65A 2HTMA 4WEVX 3DZ1A 1E43A 4QCEA 3N3MA 3W7PA 3E02A 4XBJA 1UP0A 4GGBA 1VEOA 4JCMA 4QGCA 4OUIA 5ABFB 5BRQA 3WBWA 1EWEA 3ABZA 4LU0A 4JQ4A 3VX1A 4QROA 2GJLA 5HXMA 1W17A 2PRMA 4PEEA 2VR4A 2W63A 1IZCA 4DJDA 2DUXA 2C79A 1IEIA 3NL3A 2QVHA 5BROA 3M07A 2ZZ7A 3RN6A 3E3HA 1DE6A 4JTTA 1EP2A 4LY4A 5LZLA 2YJQA 3UG4A 3N3TA 4HMEA 5CXPA 4BHYA 3C86A 3UWZA 4D6JA 1B0IA 1DHKA 2AAMA 4P61A 2W3ZA 3MMTA 3H2FA 1H2JA 5DELA 2YR1A 3QKZA 5REQA 3QR1A 2MANA 3TXVA 4S3JA 4NF7A 5FJOA 1THFD 2VI0A 3O8AA 4CD8A 1XIIA 4OT7A 4ZENA 4WSJA 2E7FA 3SZ8A 2A1YA 3MKCA 1TPWA 5CJ5A 4FO4A 3CEUA 2O9OA 4GZEA 2KAUC 1FDJA 5EA9A 2PWDA 3UGVA 3BO9A 4KQNA 1K9EA 3A5FA 1C8VA 3S2MA 1MI3A 4Z2IA 5FF7A 3TR9A 3BVJA 2OWWA 1X7IA 2H90A 4FF7A 3ORWA 1Q5MA 2VX6A 5F4XA 3P5YA 4GO8A 5I3HA 2JIEA 1QRQA 1TA3A 1DYSA 5FJJA 1XICA 2CEQA 4GE8A 5D37A 5B80A 2F6UA 5C9RA 3HM7A 1JAEA 1WZMA 4HSHA 4Q4OA 4BFAA 1CLKA 3DENA 1HJVA 2IXUA 1QNVA 5KZDA 3RDKA 1FWAC 4D6DA 4DXKA 1G5AA 3WF2A 4MWAA 1J93A 1H11A 2XSXA 4PMQA 3F2CA 2ATSA 1DXFA 3EOEA 5I3GA 3PFRA 3IAQA 4JX4A 3WEOA 4DBWA 3AXXA 3M9YA 5LIYX 2VOMA 1VENA 4FSAA 4PGLA 4C7FA 3SIZA 5CSRA 1LLZA 3PNZA 1R38A 2GSHA 3VU2A 3RNDA 3RM8A 1XDJA 2PF0A 3GVQA 2GSJA 2E6FA 3TNOA 3C56A 1A80A 1J0YA 3UFYA 3L4WA 4MAZA 5F2MA 3UR2A 4FR6A 4HD5A 2QVNA 3KDOA 3P8JA 4I7UA 4L9ZA 4EF8A 3DEQA 4GA8A 1UUOA 5LA1A 3SCRA 5CBBA 3FS2A 1H1NA 2EPKX 3Q58A 1OGSA 3PUDA 3SIMA 3EMQA 4ROQA 4E0CA 2DY3A 1BSLA 5C71A 1WZKA 4ILSA 4GWEA 1EYEA 4L6OA 3QV8A 4IPLA 4DEFA 4X22A 1J8VA 5I07A 3EA3A 3BDKA 4GZJA 4LAOA 5DCDA 4MPQA 3ZT7A 4DF1A 5DMYA 2GVYA 1OCQA 3B9EA 2Z1VA 2REQB 1M7OA 1SUXA 2QDDA 1OABA 1JI2A 4H6KA 1XF0A 1UROA 3W53A 3I65A 3P2VA 3UETA 1NP2A 4AIUA 4QE4A 4BI5A 4EF9A 2J8TA 3A47A 5AYIA 3AZRA 1ZP3A 2OO6A 2YB4A 4GZ7A 4M6VA 1TCDA 1FWFC 2IKIA 4JQAA 4IIFA 3N6QA 3GX9A 5MKGA 3L7RA 1VLWA 4IG2A 3ANUA 2VGIA 3LPFA 3DG3A 1B4EA 5JBFA 2Z6IA 1MWOA 1MW2A 1NFBA 1K4HA 4JTGA 3SY8A 1V0KA 1VHNA 2Z7KA 3ARRA 3GM8A 4UTLA 1VF8A 2YBTA 4CNTA 2VEMA 1H7WA 4QM1A 3WJZA 1GGOA 3BE7A 4QX4A 4NHVA 1ZBCA 1W9BM 2ZWZA 4OWGA 2QAFA 4HNTA 3QR0A 3QEZA 1DJNA 2I9EA 2WSQA 5M1TA 3DFYA 3K8KA 4D2JA 1A5NC 3H12A 5B7YA 3FN9A 4JYDA 3T07A 4J2MA 2XIMA 5LIKX 2ZZ2A 1F05A 5CG0A 4QDWA 4XBKA 4UTMA 2DUZA 2V5KA 3NPVA 3VCNA 3T7VA 3LD5A 4C6KA 3FJNA 3MQTA 1R3YA 1MW3A 4XSLA 5I00A 1EEXA 4JXCA 2R1KA 3WD2A 4G9PA 4AVOA 1OINA 3BUVA 3UYCA 3PB0A 1JDAA 3BV4A 3DIPA 2J9ZA 1BVZA 3RM4A 3B0YA 4U31A 3WQPA 4K3ZA 3IV8A 3CPUA 3GYEA 3B8UA 5HAOA 1EOKA 2OPJA 4PUJA 2BP1A 3M0LA 5JBDA 4UTTA 1S2WA 4HHPA 3UESA 3GHRA 5D4YA 1M7PA 2FDMA 2WM1A 4W7VA 3UCCA 3K8LA 2I57A 1RXOB 3AU2A 2XH4A 1VPYA 1BKHA 3BSHA 1S46A 3AICA 2IMRA 5LA2A 1ZJBA 4QG6A 1QMLA 2ZRUA 1V79A 2INZA 3RILA 4PH6A 3RM9A 2R82A 5A6JA 3TVAA 5CSYA 4JTJA 2J9XA 4PMYA 3WUEA 4HPHA 3UCQA 3UVIA 3O07A 4X2PA 3D3AA 1OGBA 1XRFA 3AO0A 2CITA 2H9AA 4JGDA 1PAMA 1CXLA 3WDQA 2CWNA 2BHZA 2EPLX 3TFCA 5BU9A 1A5AA 2A2IA 3TYAA 2J88A 3NQCA 4S3AA 1C7SA 1I2OA 4JY8A 3U4AA 4R33A 1UD4A 1UBSA 4JKMA 4JICA 2YFNA 4Q8WA 1YDNA 4B5UA 3B8TA 4H9TA 1RD5A 2OWXA 3BMXA 1XH0A 1KFLA 3SO7A 3TX9A 2B31A 3AUOA 1BWVA 2PCEA 1B5TA 2BHYA 4JN8A 4JTUA 4KFPA 4REQB 4QNEA 3AQUA 3NDYA 4MUPA 4Y7EA 4RDWA 5E6YA 4UFKA 4MZ8A 3GC4A 3T0DA 1DJIA 4H8NA 3W24A 4OU1A 3THCA 1XQLA 2G96A 3VXGA 6PTDA 3E12A 4RXFA 2QJMA 2EG6A 1BRLB 3UGRA 4NSBA 2VKZG 4UR8A 2GJRA 4AY7A 5DQPA 2ZX8A 4KWVA 1UKSA 3LPGA 3B05A 5KITA 2WBGA 4V15A 3QFEA 5D38A 1HIZA 5FSEC 4PTMA 1X8CA 3W7GA 4R53A 2ZOXA 6REQB 1JZ8A 1XX1A 2WW5A 1WZAA 1CTNA 4EAMA 1V08A 3EB4A 3GBDA 1V3HA 4DXXA 1U1JA 3QGAC 1F6KA 1JF6A 1K8CA 2W91A 3PB2A 4FOKA 3MZNA 7A3HA 1K4GA 1DJXA 2BOGX 3WQ6A 3SSJA 1KFCA 1DWJM 4A3RA 4ACYA 1XIMA 2RUSA 3GNXA 4IP5A 3P61A 1B9BA 3UZYA 2CLMA 1EWDA 4MWAE 1ZTVA 5G5IA 4LANA 3UNTA 3FKRA 1WDSA 1EX1A 3UBPC 5ENLA 5J5RA 4LF1A 1GVRA 3H2OA 3P3BA 3D46A 2OO0A 3HF3A 2BOFX 1D3GA 5FF3A 1GPWA 4V33A 1SQ7A 1EFZA 2NZLA 2HRWA 1E1CA 3B06A 1R7AA 3ECQA 1WQ5A 4MFDA 3IS4A 5A6AA 4ZOAA 3V16A 4MY8A 1HO4A 5C55A 1CGUA 1P6WA 4EP8C 1ADOA 3O9NA 3ELFA 3ZMRA 1AMKA 4UQDA 2YBVA 4D72A 4Z1AA 1GVYA 4AU0A 1E6NA 2GK1A 4WOZA 5IOBA 4Q3MA 5XIAA 4D6FA 2ZA3A 3JZEA 4P7OA 4S3BA 1DVJA 3IGXA 4CN4A 1Z44A 2XWDA 4QQ3A 5K9XA 3O0FA 4WKAA 3VMNA 1JDEA 2CBVA 5TF0A 3F4NA 2GVGA 1KV8A 2G0WA 4AZHA 1BKSA 4IXXA 2A79A 3H54A 3VILA 3I7SA 5GVJA 3C52A 3W7NA 5CZTA 4OV4A 1UUMA 1SPQA 2FH6A 3SQMA 4L5ZA 3V5OA 3ATYA 3W2JA 1V0LA 4B4FA 1WXYA 4GNKB 1C90A 5CBIA 5T8GA 2CZEA 2P8CA 4FNPA 3W88A 3HOJA 2ZRYA 1WX0A 4M7SA 5XINA 4H83A 1XFBA 4Q7NA 2JFEX 1H5YA 1JJKA 1UYQA 1BRLA 3EAUA 3LBCA 3FA3A 3ZFHA 3NL5A 3FFSA 1GTEA 4IIGA 4ERGA 3W1PA 2QCCA 4ZR8A 3TZFA 3NQBA 3CPRA 3TH6A 4JKLA 2OKTA 1DKWA 1C8XA 3CHVA 5HOSA