1CZ1A

Exo-b-(1,3)-glucanase from candida albicans at 1.85 a resolution
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the exo-beta-(1,3)-glucanase from Candida albicans in native and bound forms: relationship between a pocket and groove in family 5 glycosyl hydrolases.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
molecule keywords PROTEIN (EXO-B-(1,3)-GLUCANASE)
total genus 152
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cz1A00
4QAWA 8A3HA 5D9NA 3A4WA 5HBFA 2DT0A 2J8GA 2G3NA 2YDQA 5I23A 3F5LA 1Z32X 2J7CA 1EQCA 3GXFA 4PMRA 1H3GA 4JHZA 2VZUA 2ZUTA 4CN6A 1JYNA 2VZOA 2YDRA 2FH6A 4MADA 3VNYA 1W91A 4HU8A 5ABFA 1EHAA 2BY0A 3FW6A 4AZ7A 3TTOA 1PZ3A 1R85A 1UHVA 2VVNA 4XUYA 1QI3A 5ABHA 1VIWA 3AIBA 3TTYA 4TTGA 2J7GA 1JI1A 1KB3A 3AROA 3N1AA 1ZBWA 3WELA 2DSZA 4MB1A 4V28A 3AS3A 2WWDA 4HMEA 1E3ZA 2YDSA 2Y2WA 1P6WA 2V3DA 4Z2JA 3ZSTA 4TOQA 3WF2A 1U2YA 3QOMA 4WLCA 3PZTA 1GJWA 5LYRA 3ECQA 4JKKA 2V5CA 1UH4A 3TTSA 1M01A 1J0YA 1CLXA 4AD2A 1UOKA 5BRPA 3FXYA 1Q6CA 1H4PA 4AZHA 5E0FA 1OBAA 2VX5A 1AQMA 1BVNP 1DWAM 3WDRA 1KBKA 5AC5A 4PMQA 3ZO9A 1H09A 3ZT6A 3SCQA 4EKJA 1VFFA 4E4PA 4PMZA 5CPTA 1KWGA 1MW2A 4W87A 3PZMA 4HMDA 4NI3A 3N11A 1B9ZA 2XWEA 3WQ5A 1JYWA 2EXOA 2UY3A 2OSYA 4GZIA 1TZ7A 5DT7A 1C7SA 1GOMA 4ZE5A 1FH8A 3I3DA 3WDJA 5I3DA 1CYGA 1V6YA 3SCWA 3PHAA 4LPCA 3BLPX 1UWTA 2CIPA 4M80A 3MANA 2QLYA 1Q6EA 1UWUA 5JIWA 3L4UA 1VFOA 3WBEA 1JI2A 2DPEA 1V08A 2XIIA 9CGTA 2V38A 1XC6A 5CGMA 2EBNA 3DHPA 3WF1A 4P8WA 3PZQA 4RE3A 4BCEA 2VZTA 1ZS2A 4F79A 1JXJA 4GO9A 4E2OA 3ARPA 1UD6A 2VL4A 5AYBA 5I77A 3HJEA 4ZEPA 4U2YA 4UFIA 1KGUA 4OBRA 2WPGA 3T2QA 2XVNA 2XTKA 1LQ0A 2Y8VA 1B3WA 3BAIA 4PMVA 3MMUA 4UQEA 1TA3A 4D6DA 3CLWA 1CNVA 4C7FA 3WEMA 3FHAA 1PX8A 3CZJA 2CCRA 1C93A 1WDQA 3NJ3A 4JCMA 2D22A 1R86A 2YL5A 2A3EA 1NQ6A 1V02E 4KH2A 3OLEA 3ARYA 1OCQA 2JALA 4M56A 2XJ7A 2DIJA 4LXFA 4P7OA 1G1YA 1H2JA 3WH9A 3POHA 3GXDA 1JGIA 1US2A 1V3IA 2ZOXA 1CECA 3WMCA 3WUGA 2JIWA 4GI9A 2Y5EA 3T2PA 4W7WA 2QV4A 1ESWA 4JKLA 3RO8A 4HMCA 1V3HA 3K8KA 3VINA 3WNOA 2G3MA 4M8UA 1XH2A 4EK7A 3SUUA 2X0YA 1NWSA 4UFLA 2W62A 1J0JA 3SCVA 1B1YA 1BSIA 1CTNA 2VO5A 1JYVA 5JUVA 1XH1A 1VBUA 4M81A 3CH9A 3PZUA 2YBTA 2FHBA 3SUWA 1JDCA 4AD1A 4P7RA 2CBJA 3FAWA 1KR1A 1WKYA 1CGXA 3L4TA 3N13A 4TVDA 4D6CA 5A8QA 1BPLB 1RP9A 2D0GA 4GI6A 2WCAA 3SCOA 3PZOA 2OLHA 5IHRA 4CCDA 1B3XA 1VRXA 3UG4A 3M46A 3W53A 3A4XA 3BAWA 3WQVA 4Z2HA 4FLOA 1J01A 1OB0A 1OINA 3OZPA 3WENA 1HL8A 1X6NA 3T2OA 5D8WA 2E8ZA 2B31A 3DYPA 3N04A 4WF7A 4PN2A 1KGWA 1B30A 2YOCA 4UQAA 5A8MA 2OSWA 4TVCA 2OYKA 1E6QM 3WUBA 1VENA 2ZUSA 1GOQA 2GJXA 1E6XM 1U33A 4GIAA 3VDCA 4ACZA 1QI2A 3K8MA 4BF7A 1UR1A 2J4GA 1GQKA 3AIVA 3VIKA 1J10A 1I75A 5E0CA 3N12A 5EB8A 1BYCA 3AYRA 4W86A 3UETA 3B9EA 1JZ5A 3WEOA 2PWEA 2A3AA 2J62A 3TOPA 4W5UA 1OIFA 2EQDA 2DT3A 1NP2A 4D6FA 5JBFA 2IXUA 1DHKA 1ISVA 1OT1A 5E6ZA 4J28A 1E4NA 1K9FA 3IJ8A 4YN5A 3QHMA 5CG0A 4ATWA 4KWUA 3BAYA 1W2VA 1NWTA 1K6AA 3UR7A 5CLTA 5D4YA 5LA2A 2WMGA 4EE9A 2UY2A 1GNXA 3ZR5A 4U3AA 2ZX6A 1IV8A 3RM9A 1C91A 2ZUMA 3O6AA 2WHMA 2W67A 5CGTA 1GQLA 3U5UA 4OOZA 1SYTA 1CEOA 1JZ6A 3F5KA 1VJZA 1XCWA 2VI0A 1L8NA 4MDOA 3VIHA 2NT1A 3ZQ9A 3E1F1 3D5HA 3GH7A 3NSMA 2PB1A 4ZFMA 3VMPA 1B3VA 3QHNA 1QW8A 3MV11 1MW0A 1W32A 4HOZA 4BS0A 4AMCA 2E0PA 2XGIA 3W28A 3GZAA 1SMAA 2ZX5A 3WD1A 3POCA 4TUFA 5JBEA 1W3LA 3BXWA 2O9RA 2ZX8A 5A6BD 4HPGA 5A2BA 1V6XA 1JD9A 5EMYA 3AISA 3THDA 3WD4A 1E5NA 1E0XA 2ZXDA 5I79A 2G4FA 3KL3A 2YBUA 1QHOA 1V3JA 1VBRA 2V3GA 5HXMA 1CXKA 2UY4A 3IANA 1JNEA 4U2ZA 2BS9A 2HISA 3QHOA 3SCSA 3AI0A 3OBAA 1WP6A 1H11A 3AICA 2DSVA 1SMDA 2BHZA 3PZNA 1UKPA 3VUPA 2J74A 3QOKA 4PMXA 3WH7A 4N42A 3KL5A 1H41A 1E56A 1VEPA 3W27A 4R5EA 2NW0A 2ZICA 4DWSA 1JZ4A 5FD0A 1OM0A 5EFDA 1MXDA 3OG2A 1KQYA 3APGA 5A6MA 2BY2A 3CUIA 2JFEX 1HX0A 1RH9A 5IFTA 4UFJA 3LPOA 1WE5A 4X9YA 1HVXA 3NUKA 3BAXA 3K8LA 2VCBA 1BFNA 7TAAA 5A8PA 4PMNA 1MVYA 5HOSA 3FN9A 3A4AA 3GYCA 1WDPA 4W84A 3ARSA 4PTVA 4D6EA 1AMYA 2GJPA 2VT0A 2IUZA 1B31A 1W9PA 1XH0A 3OGSA 3FY1A 4UQBA 3SCUA 1K9TA 4JHOA 8CGTA 1HJXA 5CPQA 1TVPA 2PBOA 3W0KA 3OLGA 3WQ6A 1Q6DA 2QMKA 2WYSA 4FLQA 4J3WA 3BH4A 4ACYA 2CYGA 1NWUA 4D1JA 1KBBA 4UOQA 1WPCA 4AIOA 4PEEA 2JF7A 3EDKA 1LL6A 2A3CA 4F9DA 2UWFA 1HJUA 1CXFA 1HL9A 2WK2A 5DF0A 3WL1A 2DT1A 5HNNA 3ZSSA 1I1WA 2WBKA 2YL8A 3WNPA 5LA0A 4D6JA 4UCFA 3RDKA 3NIYA 3A47A 1JL8A 2XFYA 3NDZA 1IZJA 2VCCA 2VVSA 4UR9A 1FFRA 2YA1A 2WC4A 4D71A 2D3LA 5M5DA 1CXEA 1UWIA 1E6NA 3BMWA 4J3XA 3AHZA 1WDRA 2O9TA 4DWSB 1R7AA 4B15A 4H2CA 3ZR6A 4W7UA 4PSPA 2UY5A 4MDPA 4DM1A 3WF4A 4KRUA 3VGFA 4Z2KA 4MNMA 3EBVA 5I24A 2EPNA 4PUEA 1W3HA 2DH3A 4FK9A 4JFWA 2GFTA 2WXDM 2DEPA 3VDHA 3SEPA 4HA4A 2ZUNA 4MB3A 4P8XA 5BROA 4YPJA 2WHJA 1FFQA 4MB4A 4CD7A 1H0GA 1QBAA 3VM7A 5I78A 2XYLA 1E5JA 3AQUA 4CCEA 2WC7A 1J11A 3UG3A 1JFXA 3WN6A 3ARQA 4BQ5A 1BHGA 1ZBVA 2V3FA 4M24A 5M3WA 1PIGA 1K9EA 3F4VA 1V02A 2CESA 4W89A 1OD8A 4B3KA 1XRVA 1MWOA 3DHUA 1V6WA 1QNOA 3CO4A 3TONA 4LQ1A 3CZGA 2Y4SA 1WB0A 1RP8A 4PMOA 1FP9A 1GVIA 3EMCA 4HZ8A 1CXHA 4IISA 4BZYA 5A6SA 4DWSC 3RILA 1UR8A 3VGHA 2ZXQA 4OZOA 4HZ6A 1PIFA 3WDPP 4AISA 5I6SA 1XGZA 2DGAA 2GDUA 4D6IA 1VEOA 3CHCA 2WANA 1KFWA 3WL0A 4TX8A 1VB9A 1E40A 4AXNA 3AIQA 4HA3A 2J7EA 1VF8A 4D72A 3UCQA 4Z2IA 3EDJA 1GHRA 1US3A 1JZ7A 5KZ6A 1WZMA 4NRRA 3VO0A 4AD0A 2YIHA 3RJXA 3OA5A 4LGXA 1VAHA 3G6MA 2X05A 5A6KA 2YA2A 4GXPA 4JIEA 4HP5A 4XZBA 1GZJA 2VURA 3I3EA 2WHKA 4F8XA 1UR4A 5EBAA 4AZGA 4BQ2A 4W8LA 2J7HA 1OT2A 4PCTA 1TG7A 2YKKA 5DFAA 4M82A 1BQCA 1E9LA 5FIPA 3KWXA 4IPLA 2GSJA 1QNRA 4L4OA 4PMUA 2WBGA 3LPFA 2YLLA 2CHOA 3NSNA 3L4VA 3UR8A 3NCOA 1PX4A 2C8NA 2XVLA 5DT5A 3M7SA 3AJ7A 3L4ZA 5BXTA 1GUVA 3AMKA 4PYSA 4WSJA 1XSJA 3VIPA 1UR0A 3QGVA 1UD4A 3FHQA 4KGLA 1Q4NX 3W81A 2PI6A 4QFUA 1JIBA 4CCCA 4U3CA 4LYPA 1M04A 3O2LA 3VX0A 2CPUA 1IT0A 2D3NA 3B8SA 3OB8A 5GNYA 3EDEA 1V0MA 3RJYA 3CUGA 1CWYA 5BRQA 2EPMX 4AWEA 1EDTA 4ATLA 4ATDA 1R7OA 5I2UA 3MUZ1 1UWQA 3WUEA 3ARTA 4AIUA 3FNDA 2ZXAA 2XIBA 1HT6A 1W9UA 4LYRA 2VQTA 1LG1A 1OGGA 3VGBA 2WMFA 1DTUA 1UKSA 3VIIA 2CKSA 4MPKA 2QF8A 2EEXA 3ZJ8A 4E8CA 2VX7A 3GXIA 1HKIA 2GDVA 4Y7EA 3CZ8A 4X0NA 1S46A 4BQ3A 3T09A 4GKLA 5JBDA 3MUIA 2WVVB 3ALGA 1PJ9A 3N17A 4U33A 3MU7A 4QCFA 2DSKA 3UESA 5FL0A 5C70A 2VX4A 1J9YA 3DYMA 3WF0A 4DUXA 3GM8A 4LYQA 1ZJBA 2GJXB 4AZIA 1NOUA 2YA0A 3BCDA 2NT0A 1JF6A 2YL9A 3HMCA 1W9VA 1J0IA 1GOWA 4MNLA 3VU2A 4TXEA 1J0KA 1CIUA 4WKHA 3VDAA 2D0HA 3AS0A 1PBGA 2AOSA 1KXVA 3TP4A 2CBUA 4E8DA 2J7BA 3W37A 3A3HA 2O92A 2C0HA 1G9HA 2X1IA 4CD6A 3AMCA 3ZJ7A 3W25A 1UQYA 2WZHA 4JFVA 3WUFA 3M6DA 5GQBA 3UEQA 3AFBA 1G94A 2VRJA 2BNJA 1D7FA 1HJSA 4QLLA 2VMFA 3AIRA 1D2KA 3SUVA 1QPKA 3IJ9A 4FLSA 1BYAA 4WSKA 5KEZA 1BGAA 4CVUA 4HOXA 1A3HA 4UNIA 2FHCA 3GNRA 1BYBA 2IXVA 2GK1A 5AY7A 1ZBKA 2VR5A 1LWJA 1E70M 5CPSA 4GO8A 5CLWA 1C92A 1F4HA 1CXLA 1E72M 3PZGA 4ZXOA 2J79A 3CHFA 1N82A 1E6SM 1DEDA 7A3HA 3THCA 3WQ8A 7CGTA 3ARVA 4GI8A 5C71A 1KXQA 2XVGA 4GQQA 2PBGA 1FHLA 4DUWA 1QOXA 3IJ7A 3QR3A 3VNZA 1LLOA 1LL7A 4H8VA 2EO7A 4J27A 1PPIA 3VD5A 3AHVA 1BYDA 5ABGA 5HPCA 3CHEA 4GQRA 1HN1A 1E4IA 4NZCA 1ITXA 2BV9A 3DECA 1ZB5A 1UR2A 2FGZA 3VIMA 1MQQA 1E0VA 4UZSA 1O7AA 2CXGA 1KQZA 4JKMA 5F7UA 1BLIA 3AMDA 2CETA 1JZ2A 3N18A 2GK1B 5GNZA 4CVWA 2Y24A 2D2OA 5BXRA 1MXGA 2ESCA 2D24A 4CU7A 4UFKA 3VD9A 1OSEA 1KWKA 3SURA 1HKJA 1CGYA 1DWIM 4AEFA 3VVGA 3PTQA 4LX4A 4WKFA 2BVYA 1DP0A 3W29A 1QNSA 1TCMA 2WVSA 4UQ9A 5E09A 5GNXA 2TAAA 4HTYA 1C90A 1V3KA 1JDAA 1VJSA 1NM9A 2WMHA 4OUEA 2D1ZA 4CN4A 2EJ1A 1GPFA 4HA1A 2ZWYA 3VD4A 2WVUA 4J3UA 4ZXLA 1MYRA 3NYDA 1ECEA 2DDXA 3BC9A 1FP8A 1WO2A 2AMGA 3KE0A 1GOKA 4KMQA 5D9PA 1OWQA 4A3HA 2ZUUA 3RM8A 2O9PA 2W91A 4FLRA 1V0KA 1DWGM 2V5DA 3VIFA 2VUYA 2WSPA 3ARZA 1MFUA 2DSUA 3VPLA 5M03A 4B9ZA 3BAKA 3GTNA 5A2CA 4PTWA 1QI4A 1EIBA 3GBEA 1VFUA 2F2HA 3PTKA 5IXEA 4MJ2A 2HVMA 1TFVA 4MJ4A 2EPOA 2G3IA 1R87A 3WFZA 5ECUA 4AYSA 2QPSA 4AW7A 4RE4A 2DH2A 1UWRA 2J8FA 3B9DA 4AZ6A 1BTCA 5D9MA 1UWSA 4JZ5A 4KGJA 2XVKA 4TTUA 1Q6GA 3OGVA 2YJQA 4J3TA 3D3AA 1M53A 2BHYA 2VRQA 5BXSA 1E1FA 2CBVA 4F9JA 3MSGA 4D1IA 3KEHA 4X0VA 2YL6A 3MO4A 3OGRA 5ABFB 5EFFA 1HJWA 4S3KA 2XGBA 3T0DA 1K9DA 4RL3A 4AC1X 4CN1A 2OYLA 1GHSA 2JIEA 3MMDA 2OWXA 3RIKA 1M7XA 4NSBA 3U57A 4BA0A 3MS8A 5FL1A 3WMBA 3N15A 3ZJ6A 1HP5A 3B9AA 4JL1A 4UQDA 1EO5A 2CNCA 3BSGA 4H04A 3ALFA 3ARUA 1LF1A 3VILA 3IAPA 3CBWA 3A6OA 3WQ4A 2BXYA 3AHYA 2CERA 1JD7A 1B3ZA 1KGXA 4HU0A 1ITCA 1UZ1A 4FMVA 3S6TA 2BHUA 5LA1A 4CU8A 1QBBA 3WQWA 4B9YA 3AIUA 4AIEA 1UD3A 2BVTA 4J3VA 2WLZA 1FH9A 1F4AA 5M17A 5A2AA 1HJVA 1GVYA 1KCKA 1V6UA 1H5VA 4Z2GA 3CZLA 3CMGA 3MKKA 2ZE0A 1V6VA 1UG6A 3BCFA 5GPRA 1MQPA 4CD5A 1YQ2A 1CGVA 3KZSA 2JF6A 1XYZA 1C8XA 2PWFA 1XD1A 5FCZA 2WVTA 3TA9A 1LG2A 1TVNA 3WKZA 4CGTA 4XB3A 3CTTA 4HOWA 2W5FA 5A3HA 4AZCB 2OSXA 1HF6A 1I1XA 2ZX9A 3VGEA 2XWDA 3WD3A 2WMIA 1KXHA 2W66A 4DM2A 1G01A 2ZX7A 2RGMA 2E3ZA 1O6IA 1WZAA 4AD5A 3AXXA 1FOBA 3EDDA 1WCGA 4AY1A 2F61A 4YHGA 1H0IA 1QI5A 2WKLA 2X0HA 2DIEA 3W4RA 3GXMA 1BG9A 1CXIA 1ISYA 3WEZA 5I0DA 4DWSD 1UZ4A 2E9BA 2WZEA 1HKMA 1E6RA 2VX6A 1GONA 4FF5A 1LJYA 3PZ9A 1E3XA 1XSKA 3LPGA 1W1TA 3CUJA 3CIVA 2PWHA 3BAJA 3CHDA 4W85A 1EA9C 2GVYA 2C7FA 4XX6A 1QNQA 2XHYA 5CSUA 1W1VA 2VQUA 2XFRA 3GH5A 3L4WA 4AEEA 3OZOA 1J12A 2CHNA 3L4YA 1EHNA 4MNKA 2YLAA 3OLIA 2WMIB 4UOZA 2E9MA 2X09A 1W1PA 1L0PA 2WSKA 4QDMA 1D3CA 3AXIA 4P7NA 5TD4A 4QCEA 4PCSA 2XFFA 2OWCA 1C7TA 1BGGA 2ZXBA 1C8YA 5A69A 5A6LA 5A8OA 1TR1A 1LWHA 1W3KA 2E40A 3UERA 2E9LA 5BWFA 2E8YA 3SIMA 1KCLA 3MV01 1MW1A 1BAGA 1E43A 4PTXA 3VMNA 1NOWA 2WB5A 1E1EA 4JFTA 4JAWA 1FH7A 1QHZA 2D23A 2WZIA 2XSAA 3VTRA 3JUGA 2XVPA 4WIWA 2D20A 5IFPA 1JG9A 3WH8A 1E4MM 1KR0A 1IZKA 3J7HA 2W61A 4JL2A 1KXTA 1E6PA 2MANA 5A94A 5A6BA 1C8QA 2J47A 1JZ8A 4JCLA 5E6YA 3K4AA 3WDHA 1ZBCA 3VX1A 4QLKA 3WFLA 1HNYA 4OIFA 1HIZA 1BG4A 1JZ3A 1ODZA 1E4LA 1CGWA 1W1YA 2QHAA 4GINA 3ARWA 1EXPA 1NOFA 3L4XA 4W7VA 1AVAA 3AYSA 1E15A 4OJYA 1MW3A 2WVVA 4MB5A 4OOUA 2Y8KA 4H41A 3BLKA 3WD0A 5A1AA 3NDYA 3VM5A 4AD4A 4YHEA 3BSHA 1TA3B 5I5RA 2BXZA 1UKQA 5BXPA 3OLDA 5FKYA 4PRWA 6TAAA 2PF0A 4XZWA 5FOOA 2WCSA 1GOIA 1R8LA 3MUAA 3BGAA 4MTVA 4W88A 1UR9A 1WDSA 4IM4A 1XD0A 1HVQA 1XSIA 5CSYA 2BFGA 1UA7A 4Z2LA 2VZSA 1J0HA 3AHTA 2VNCA 3SCNA 3AMGA 3GH4A 5BYWA 1GW1A 4J7RA 2DT2A 2J77A 4QP0A 5AYIA 3VIGA 1J0ZA 4UOJA 1Q6FA 2WNWA 4P7LA 2ZUVA 4M29A 1YHTA 3AIWA 3IAQA 3CUFA 4PUDA 4P8VA 2VR4A 1JYXA 4UFHA 3ZT5A 4H8UA 2BY3A 5JIPA 3HN3A 4UTFA 1SFSA 3GBDA 4HPHA 1FHDA 5A8NA 1TUXA 4H8HA 3AS2A 3WIJA 2CBIA 2CEQA 4PBGA 3GNOA 2OYMA 3O9NA 1HXJA 2WHLA 1V3MA 1W9XA 2FH8A 5E70A 4B16A 3II1A 1JDDA 4CD8A 2W92A 4AZBA 3M07A 4ZENA 1OIMA 2BY1A 2VZVA 3ZOAA 4C7GA 2ZIDA 3CZEA 1XV8A 2WM0A 1CDGA 4CUCA 3W24A 3IK2A 1ZL1A 3CPUA 4U5IA 1OGSA 3CGTA 3FAXA 3ZJKA 2VRKA 1TE1A 3SUSA 1E0WA 3U7VA 2XG9A 1E71M 3ZT7A 1GCYA 2QPUA 2J25A 5E9AA 4V27A 4ZE4A 1XHGA 3VDBA 3EDFA 1CLVA 2ZUWA 5ABEA 1GQIA 4EAMA 3W82A 5C8BB 4XV0A 2CKRA 4WKAA 2XSBA 2J78A 3AIEA 2WLYA 2W63A 1JAEA 1UD2A 4PMYA 4D6HA 5A6JA 4UZUA 1HKKA 2VJXA 4JFUA 1V0LA 1QI0A 3L2LA 2VTFA 1EOMA 3CMJA 1CBGA 4L4PA 2OWWA 2A3HA 3EMZA 1JNDA 1TMQA 3PN8A 4BQ4A 1B0IA 1VFMA 4M1RA 3WD2A 1A47A 4A4AA 2JEQA 4NF7A 4AZ5A 1BVZA 2X2YA 4K68A 1EQPA 1ODUA 2EPKX 1ISWA 5CXPA 1V0NA 2XPKA 3F5JA 1X1NA 1E73M 3VOCA 3VD7A 1FA2A 1B90A 1WAWA 1RD6A 2Q8XA 1HP4A 1MFVA 4OKDA 3GNPA 4W8AA 3T0BA 2PWDA 1GORA 1DWFM 1WZLA 2G41A 3WNMA 2QMJA 5DMYA 3MSDA 4RE2A 5CZKA 3U7BA 1GQJA 4Q22A 3G6LA 3W38A 2J75A 1U30A 1EDQA 3KL0A 4WJXA 4HZ7A 3EYPA 3PZVA 4KRTA 1E6ZA 2G3JA 4B3LA 2Z1KA 3WH5A 4ML4A 3CUHA 3ZIZA 3MMWA 1NWRA 1Y7VA 3SCTA 5BCAA 2O9OA 3ARXA 5A95A 4MAVA 1W2PA 3RCNA 1EGZA 4MNJA 3WMSA 1UUQA 1ISZA 4N0RA 1EDGA 3SCRA 4P8UA 1V3LA 3VMOA 3BMVA 4CU6A 1CGUA 3GDBA 4NRSA 3WNKA 1GJUA 1AQHA 1W3JA 1JF5A 2G8ZA 1UKOA 4R27A 2FHFA 2D0FA 2RGLA 1VEMA 5DEZA 3VGDA 2WAGA 1JAKA 2GUYA 4S3JA 2JE8A 4UFMA 1B2YA 4GZJA 4MAZA 3AHXA 5CQ1A 4QLJA 5HPOA 1H49A 2XM2A 1EOKA 4A3YA 2WMJA 3W26A 2GJRA 4DUVA 3I3BA 3K46A 2JEPA 1WZKA 1H1NA 2XM1A 3PTMA 6A3HA 4W8BA 3U5YA 3PBGA 1LL4A 1CZ1A 1HJQA 3K4DA 2Z1SA 3SUTA 1UQZA 2WKGA 2J7DA 4GZEA 3WBAA 1ZU8A 2FDMA 1MQRA 3PZIA 4GPNA 2NSXA 5DO8A 3WF3A 1E55A 3AZTA 1DWJM 3MUY1 3VKKA 5HDRA 3SCPA 2DSWA 3T08A 5IDIA 1QHPA 4AD3A 1DWHM 4JFSA 4D6GA 1V03A 3AOFA 1NARA 3L2MA 2WWCA 1PZ2A 1WNOA 1XYFA 1OD0A 1NH6A 4IUGA 2PWGA 5D9OA 3ARRA 2CITA 2VC9A 2VOTA 3WSUA 1RPKA 3HU7A 1G5AA 1UH2A 2WMKA 3UG5A 1UYQA 2EPLX 3T0AA 3RM4A 3TTQA 2V3EA 4H7VA 1PAMA 4AZCA 1G0CA 6CGTA 3EMQA 4W5ZA 1UD8A 3AMLA 1EH9A 3WDIA 3ZMRA 1BF2A 4UQCA 5IHSA 4P7QA 1J18A 4F66A 4J3SA 1XCXA 3N9KA 3W6LA 1QW9A 4W93A 3WY1A 1UH3A 4PTMA 1CPUA 1X6LA 3W6MA 4V2XA 1OGBA 1EO7A 3DC0A 3LMYA 4U31A 2BVDA 4CD4A 3WDQA 4EANA 1UA3A 1UD5A 1C3FA 2DQXA 4TX6A 3VIOA 1QNPA 2FGLA 3WH6A 1CENA 3S2CA 1UKTA 2PC8A 1M03A 2E4TA 3AS1A 1ZJAA 3RPMA 1AQ0A 3VD3A 4URIA 4ACZB 1JFHA 1PX3A 1GOOA 3NSXA 1JXKA 3AZSA 2J7FA 2ZWZA 2VCAA 3LPPA 1QVBA 1SR0A 5AC4A 5A6AA 1CGTA 2WC3A 3DYOA 1W9BM 2AAAA 3VGGA 4C7DA 2WW5A 4OBSA 2X8RA 2WCGA 3AZRA 3RMEA 4WK9A 3K1DA 4TVUA 2F8QA 4IPNB 3WNNA 3ZM8A 2XUCA 4PSRA 4CKQA 1B3YA 5CJ5A 2A3BA 5D8ZA 3CZKA 3OIHA 1PEZA 1ISXA 4U5KA 4PMDA 3VIJA 3WNLA 3AXHA 4Q7NA 1W9DM 2W4XA 1NP0A
chains in the Genus database with same CATH superfamily
4QAWA 4HBKA 1XQKA 4JEQA 4H9TA 1OABA 1EQCA 1U5VA 3DKJA 3KBWA 1JYNA 3AUJA 2B7NA 3GE7A 3AO0A 4DF0A 4JDBA 3IRSA 1YDYA 1W91A 4HU8A 3NQCA 2ZZ5A 1GG0A 2IPFA 3RG6A 4QITA 2WNNA 1PTDA 2HJPA 4ICCX 3TTEA 4WRHA 5HR7A 1MMFA 2CLFA 1ZBWA 2DSZA 3ELFA 3IUIA 4C1NB 4JQ1A 4QQUA 2VP8A 3ZSTA 3IIVA 1U2YA 4WLCA 1P0DA 3NURA 5LYRA 3ECQA 3GDKA 2V5CA 1TB3A 3B3DA 1UH4A 3LYEA 3S2JA 1ZQ5A 4ZB2A 4QJ3B 3IACA 2ZC8A 3FXYA 1H4PA 3MC5A 1IXOA 4US5D 3S5SA 5LNRA 4OE7A 5AC5A 2EKCA 3ZO9A 1H09A 4FHAA 1DJGA 1XLHA 3KDNA 3BW4A 3MCOA 4WOZA 3PZMA 1XBXA 3MJMA 1B9ZA 3VUSA 4HNCA 4LEQA 2NUWA 2RH9A 1TZ7A 5DT7A 1J93A 1UWAA 3R6IA 3TV8A 4F0RA 2WSQA 1UPPA 4LU0A 3PG9A 3N2MA 4PRRA 3I3DA 5I3DA 2X0SA 4EWND 4BJHA 1DHPA 3SCWA 4IPPA 3NXFA 1BRLB 2CIPA 1KLZA 1Q6EA 1W5QA 1UWUA 3KWSA 5JIWA 4FXRA 1OCNA 1VFOA 2CZ5A 4GUGA 1TV3A 2EBNA 1M7JA 5JVLA 3PZQA 4V1XA 1ZS2A 4IJRA 2VOMA 2UZ9A 1UD6A 2VL4A 1EC9A 4UFIA 2PTYA 3T2QA 3SBFA 2CLKA 1VFSA 2XTKA 1B3WA 4FIQA 1A5OC 4Q8QA 1TA3A 2YCKX 4JTQA 2W79A 3F2BA 1PX8A 5BW6A 4CEXC 3T0CA 2C0AA 4DJDD 1C93A 1KFEA 1WDQA 4BWLC 3PB2A 3QW4B 1NF0A 4KRZA 3LHYA 1DQWA 3OLEA 4DBWA 2IPWA 4Y8EA 3WH9A 3POHA 3WMCA 3NQ8A 3P2VA 3IJLA 1YXYA 5DBUA 1NAL1 3T2PA 3ZWTA 2Z28A 4ZBCA 1NEYA 1YE6A 2QV4A 2Q8LA 1ESWA 3BK0A 1NELA 3AYTA 4XZMX 4FB7A 2QAFA 5LHFA 3OOQA 3WNOA 2I1OA 4EK7A 2X0YA 1NWSA 2P10A 4H6KA 3M7WA 4IUOA 2W62A 1R3VA 1OG6A 3LDVA 1BSIA 1JYVA 3CH9A 3PZUA 4EPKA 3SUWA 3KAOA 1CGXA 3L4TA 2GSHA 3W1MA 4TVDA 3FYOA 4IOTA 1RP9A 4GI6A 3I7RA 4GHRA 4ROQA 3LGGA 3NZPA 3UG4A 1DV7A 2PGWA 3BAWA 3M0JA 3IIPA 3QYQA 3V0UA 2PTXA 3DFHA 4PUKA 3A3WA 3OZPA 2XGZA 1HL8A 1X6NA 1AJ0A 6ENLA 1TMHA 2CLEA 3KX6A 3W85A 5AZ1A 5B7ZA 4XIMA 4M5PA 1ECQA 4UQAA 5U7SA 2OQLA 4GJ1A 4L1XA 3EA2A 2OYKA 4IP5A 2NQLA 3WUBA 1VENA 2FTYA 1OX4A 4LAOA 3EWZA 2AGKA 3PPHA 1GQKA 4DZHA 1ONEA 1EJTC 4MPQA 4UIOA 1I75A 2CZEA 3N12A 1MUMA 3UF9A 3AYRA 3B9EA 2PWEA 3HQ1A 1H1ZA 3EKZA 2Q02A 3TOPA 3UWQA 4W5UA 1OIFA 4XAFA 2QYGA 4O19A 4Q4KA 2WJEA 2QQ6A 2ZRVA 2IXUA 5B7YA 1ISVA 5E6ZA 2VFFA 4MJZA 4BEQA 1JPDX 2RJHA 2TRSA 4AY7A 1K6AA 2A6NA 2Z2BA 2WMGA 1GNXA 3N4EA 4PMJA 4U3AA 3MCNA 3ENLA 2ZUMA 2W67A 3PWAA 5DN1A 1VGAA 2Z00A 1GQLA 1K4HA 1OX6A 2VM8A 5C7VA 1K1DA 4QE4A 2J27A 5C9XA 1JZ6A 2VGBA 4S2CA 3E1F1 4YTQA 3TJLA 5LNWA 4P5UA 3VMPA 2DV0A 1DJQA 3BGGA 1UASA 3MV11 2HQAA 1P1XA 3HGJA 4AMCA 4B91A 1RHCA 2E0PA 3P5YA 1SMAA 4DPQA 5EMKA 3POCA 4TUFA 4DJDA 4GJJA 2WSRA 5A6BD 4HPGA 3DCPA 4L9ZA 4DPPA 6XIAA 3UPMA 1YDVA 5FEPA 4DZAA 1XR2A 3AISA 2VC7A 3B4UA 1EGVA 3KL3A 1QHOA 1V3JA 5K9CA 2YXXA 2GL5A 1LLWA 1C9DA 1CXKA 1PUDA 3EX3A 3A13A 1VBGA 2HISA 1QK2A 3I7QA 4QDWA 2DSVA 1SMDA 1VYRA 2VELA 1PKYA 2ALDA 3HA1A 4RZ4A 5G4HC 4HJFA 4WXYA 3AXKA 3R11A 3W27A 1H7WA 2GOUA 4R5EA 4B2DA 2XIOA 2ZA2A 1Q6LA 5FD0A 3GHRA 3M5ZA 5EFDA 1MXDA 3APGA 2DZUA 3LY0A 2JFEX 1MO0A 3UBPC 4LBRA 3PBUA 3CJPA 3LPOA 4UFJA 1LCOA 1WE5A 4X9YA 1HVXA 1YKWA 1SUXA 5AZ0A 3BAXA 1Q8AA 3DI0A 4R7OA 1XLKA 5HOSA 2HNHA 1FRBA 4D6EA 1AMYA 3P0WA 1B31A 1W9PA 3P7YA 1K9TA 1OK4A 1Q3NA 1XWYA 2GVLA 2P3EA 5BWAA 1HJXA 4IMFA 2ZA1A 4NNCA 1XRTA 3BLOA 1JCTA 5F2IA 3UVAA 3BH4A 1JQXA 4L80A 4J3ZA 3P8JA 2X1UA 4FI4A 2ABAA 4AIOA 1XM3A 3EDKA 5HINA 3E96A 4LF2A 3G0SA 3SN4A 3VI2A 4C91A 1JDFA 2XFYA 3N19B 3GWQA 4UR9A 3G1HA 3CAVA 4GC4A 1FFRA 2WC4A 2D3LA 3GW0A 4A2RA 1CXEA 3SJ3A 1E6NA 4J3XA 4QGCA 1WDRA 3S5YA 4H9VA 4B15A 4GG9A 3DENA 2J66A 2Y8UA 4LBUA 4PSPA 4R33A 3W2LA 1US0A 4IX0A 4WXZA 1GPWA 6PTDA 2CU0A 1V8EA 5IDZA 2XH4A 4PUEA 1ZUAX 5T26A 2OR2A 2BSLA 1S1RA 1DPMA 4JFWA 1YNYA 2DEPA 3SEPA 4HA4A 1LYXA 2ZUNA 1KBJA 3DFNA 4XBJA 1REQB 2CWXA 2WHJA 1FFQA 2QCDA 3BZJA 4CD7A 1QBAA 2PUZA 1R3RA 3QPZA 2XYLA 1XLBA 1D7KA 3AQUA 3O15A 4CCEA 1JFXA 1SO3A 2UV8G 3DFOA 2DFAA 1KA9F 2PDXA 2R9RA 1LUCA 2V3FA 1VBHA 5M3WA 1K9EA 1V02A 4JD4A 4W89A 3H24A 5DRCA 4A21A 3KBJA 3SIZA 4IZGA 2PDLA 1OD8A 5K2ZA 1XRVA 1I2OA 3HFYA 5AYZA 3ZXWA 1QNOA 3CO4A 3TONA 4LQ1A 3CZGA 3LTYA 2FVMA 2W27A 1WB0A 1RP8A 4PMOA 1FP9A 1GVIA 4GACA 2FPTA 1UR8A 3VGHA 3KFTA 4FR1A 1GEHA 2EF9A 3N2XA 2DGAA 3H55A 3SW6A 1UW9A 3WL0A 3LXCA 1E40A 2I57A 3AIQA 4HA3A 1BEUA 4IIDA 3EDJA 3W7IA 3GNXA 3Q65A 2AL2A 5KZ6A 1W5PA 3P6LA 2ISSA 2CLMA 1FWBC 2NXIA 3G3DA 2OGYA 1VQTA 3WJSA 4HNNA 3A5FA 3W1UA 4A35A 4UTJA 3EPMA 4HP5A 4KWVA 4GMEA 2TODA 4ADTA 4W8LA 4PCTA 1O4UA 1TG7A 1MZRA 2IKIA 5K3VA 4M82A 1TQXA 1FBAA 3KWXA 3UR5A 4L5ZA 2GSJA 1QNRA 4PMUA 3LPFA 5DCEA 3MY9A 3M7SA 3AJ7A 1GUVA 4PYSA 4UTLA 4LANA 1B54A 3QGVA 1GQNA 3CAQA 2HZGA 4KGLA 4UUIA 3FKKA 1A5LC 1JIBA 4LOCA 1O5KA 3V36A 4LYPA 1XICA 2QUMA 2VGFA 4MY1A 3TC6A 3OBKA 3B8SA 3NFUA 3KTSA 3EDEA 1UP0A 3CUGA 3ZZ1A 4GYKA 3LCWA 4ATLA 4ATDA 3PBMA 1H5YA 3FNDA 3Q67A 3DESA 2VQTA 3R25A 3VKAA 1TWIA 4IMGA 3UY8A 3ITCA 1R3SA 3LLXA 1M65A 4GYJA 3ITTA 3PBWA 3G5EA 3GKFA 4JPGA 4GKLA 1SFTA 4U33A 2DSKA 3UESA 1J9YA 3WF0A 3GM8A 3LRLA 3LZ3A 3AALA 2ZKMX 1AW5A 1NOUA 2YA0A 5REQB 1JF6A 5XIAA 1J0IA 1XIJA 1XLDA 3VU2A 4HPJA 4TXEA 4UWMA 1PBGA 3RPTA 5MKGA 1JULA 1X96A 4GUHA 5E0KA 3M9YA 1UROA 2ALRA 3ZJ7A 5CZ0A 2JKEA 1UQYA 4C6QA 5HA7A 4FIRA 2F38A 2HRWA 3S6OA 4E5TA 1EYWA 2A7NA 1HJSA 3FYYA 5G4WA 1KM4A 1QPKA 3IJ9A 2ISVA 3OU8A 1LT8A 3SADA 1TWSA 1A3HA 5I03A 1A5NC 3B8TA 5HUOA 3LGDA 1OCBA 3QV9A 2OQYA 3MP3A 3MQTA 1W17A 1PHQA 2NXGA 3V7PA 3M41A 1ZBKA 4K37A 3TC3A 3RYSA 4IL2A 4H9YA 3PZGA 5M2FX 3B04A 4HHMA 2WPBA 3B0YA 4XD4A 4JIHA 1ZLPA 7CGTA 4KWOA 4GQQA 2Y61A 4REQA 1FHLA 3GC5A 2MNRA 3KP0A 4H8VA 4O4WA 3P74A 4LJ3A 1BYDA 1A5SA 3GW3A 1E4IA 4FXSA 3P3BA 2BV9A 4Q8MA 5DXYA 3B0XA 1E0VA 2CZFA 3QBUA 3QMSA 1O7AA 1QJWA 3TZFA 3GS6A 1UCWA 3URNA 1I2NA 4H4IA 3DHFA 2ESCA 3C8FA 4NL1A 3VOJA 2HS6A 3VKDA 3SURA 3RGTA 2FPVA 2FPYA 1DWIM 4F0LA 1YDNA 4S3BA 1HQTA 2BVYA 3MBFA 1DP0A 1WUFA 3CV2A 1QNSA 3ATZA 2QULA 1C90A 1V3KA 2QS8A 3JW7A 2WMHA 5DX7A 2D1ZA 4CN4A 1GPFA 5XIMA 5HMEA 4EF8A 4PTNA 2AQWA 4US6A 1BSLA 4J3UA 1RCXB 1MYRA 2ZRWA 4H8NA 2Y5SA 1P5BA 4Q8PA 1TV5A 2DZAA 4KQNA 5FJUA 3ZYZA 3VIFA 1DORA 1LROA 3VPLA 5M03A 4BEUA 2VGIA 4O1EA 4A8IA 2FTPA 4PTWA 1I8JA 3FS2A 1EIBA 3TN3A 1VFUA 2X42A 1XFCA 3PTKA 4NJIA 2DUXA 4A3RA 3C2EA 1I2QA 1TFVA 2PEVA 3WFZA 2G5WA 5ECUA 2E28A 4AYSA 1LQ2A 4AW7A 3G2GA 2BOEX 1RVKA 3B9DA 1BTCA 5D9MA 1Q45A 4JZ5A 3ITGA 2O4QA 2XVKA 4KGJA 3GHTA 1VHCA 4S1FA 2YJQA 4J3TA 2PCEA 1M53A 3ZFHA 2CBVA 2R1KA 4F9JA 5DQPA 3CQIA 3HPXA 4GQ0A 5ABFB 1I60A 4S3KA 4YWIA 3T0DA 4RL3A 3SY1A 4IPIA 2OYLA 3R2GA 4XKMA 3NGJA 3RIKA 3VXGA 1XKJA 3FDGA 3VOIA 5M1TA 4FXFA 3PJTA 1HP5A 3UYIA 1LOSA 3P5ZA 1FDYA 4GGHA 3P80A 3ALFA 3UD6A 1Y5VA 2O56A 1LF1A 4B3ZA 1EF3A 3CBWA 2BXYA 3L65A 3AHYA 5EYWA 2E6FA 3HFTA 4GCXA 1B3ZA 4HU0A 4LS1A 3EWCA 1RBOB 4CU8A 1KFCA 2GLKA 3AIUA 1UD3A 4KCWA 4J3VA 4A6GA 1QO5A 1YXCA 2GUBA 3MKVA 2HBXA 4IHCA 1GVYA 4I5XA 3MKKA 4UR8A 1V6VA 1UG6A 3VOHA 4Z1YA 2DJLA 4CD5A 1CLKA 2QJGA 3SZ8A 5CC6A 1CGVA 3WLPA 1JPIA 5G2IA 2PWFA 3C8NA 3W7RA 2WVTA 4QM1A 3CQJA 1TVNA 3E2QA 3CTTA 1F5ZA 4NZFA 1A3WA 4AZCB 1HF6A 1Z42A 3LV6A 1GT8A 2ZX9A 3QVQA 8XIMA 1FCVA 4PCNA 1KXHA 1VS1A 2P1FA 4DM2A 2DORA 2FKPA 2E3ZA 2VFGA 1O6IA 1UBPC 3BV7A 3GD6A 3EDDA 3OQEA 3TR9A 1WCGA 4AY1A 2F61A 1QPNA 2H6RA 3QPYA 4GNVA 4IP4A 3G77A 1BG9A 2XZ9A 4Y8FA 2VUNA 5I0DA 4KW2A 4DWSD 2GGJA 1UZ4A 1NTHA 1GONA 4FF5A 1LJYA 1UPMB 1XSKA 1W1TA 3GXNA 1IEWA 2EKGA 2PWHA 3W9ZA 3W7OA 1S2WA 4F4RA 2WOQA 5CZTA 1HO1A 5LNSA 4AEEA 2A6LA 3LA4A 1W6TA 3C5QA 4HNLA 2X09A 1MEHA 1P48A 3AXIA 1PSCA 5F2GA 5I06A 2R82A 5CJNA 1GVFA 5LNUA 3V5FA 5A69A 3JRKA 1LWHA 5HMFA 3KBSA 3UERA 1OZMA 5HWMA 2E9LA 1AW1A 1RVGA 4KFNA 4DF2A 4EXQA 1OX5A 1BAGA 3GTXA 4PTXA 3VMNA 4JFTA 2I9EA 2Y7FA 4JAWA 1FH7A 2WZIA 1SW7A 2XSAA 1KM2A 3A5VA 3KLLA 3LX9A 2XDFA 4QNWA 2CLOA 3WH8A 1LWIA 1GYMA 3HOJA 3J7HA 5A94A 2E68A 5A6BA 2DJXA 1EGMA 5HAOA 3GSMA 4JNYA 1BG4A 4XKYA 1W1YA 2QHAA 3ARWA 3NQ6A 1DBTA 3H2NA 2QPXA 5AECA 3GDRA 3W1NA 2VENA 4MY9A 4QTGA 2ZDRA 3QZAA 3YPIA 3EXTA 5A1AA 3LQLA 3VM5A 4UTTC 4YHEA 1TA3B 4H01A 3OLDA 5FKYA 5J04A 1RQHA 2PF0A 1QAPA 2WCSA 1R8LA 3MUAA 3WQCA 3PJXA 3GUWA 3S1UA 1HVQA 5CSYA 1XSIA 2HMCA 4Z2LA 3HJZA 2YYUA 3R94A 3A3XA 3M0XA 5HMSA 4ZL1A 3EA1A 1YNPA 3SCNA 1YNQA 1NDZA 4DB7A 3QSTA 1O66A 3IVSA 4O54A 2WNQA 4J7RA 3P67A 4ZB0A 4FOKA 3STCA 4QP0A 5AYIA 2C13A 4M29A 3WQOA 3AIWA 2P0IA 3INPA 3IAQA 2FZ8A 1GW9A 2VR4A 3RU8X 4E2VA 3FEMA 1FDJA 2GUUA 5JIPA 4S3EA 3HN3A 4PC8A 4N9CA 2PF8A 3LI1A 4LUJA 4HPHA 5A8NA 3DFQA 4H8HA 3M1ZA 4UTHA 4N6EA 3ABXA 4HHHA 1QOQA 4IXXA 4B5NA 4LVAA 3K5XA 3G1DA 4B16A 1WXYA 5GJMA 1JRBA 2PDGA 2HROA 1KCXA 1L2UA 1OIMA 1LUCB 2ZIDA 1VH7A 2H9AA 4HJWA 3CZEA 2QR6A 3FLUA 4K8HA 1CDGA 4WJ8A 1ZL1A 4GUIA 4FNSA 2GGGA 2A5HA 2VRKA 4FOJA 3U7VA 2XG9A 1E71M 4MFDA 4IIGA 1EJUC 2QPUA 5A6TC 1Y8BA 1T5AA 1XHGA 1RUSA 3VDBA 3EDFA 1CLVA 4S23A 4EAMA 1TE6A 1YDOA 2JGQA 2GQAA 2R1MA 2F6KA 3MWCA 4NAEA 2Z1WA 5CH9A 1EOMA 1ZTVA 4HGXA 3EMZA 3GTFA 1JNDA 1TMQA 3OVGA 4BQ4A 1VFMA 4HTBA 1A47A 3URQA 4A4AA 4L65A 4V15A 2JEQA 4UCGA 3CEUA 2X2YA 4K68A 5E1QA 1DJNA 2XPKA 3FA3A 1VP5A 1H7OA 1FA2A 1WX0A 3QMRA 3QTPA 4I6KA 3S5NA 4OKDA 4IL0A 3BZGA 2XIQA 1TPDA 1LRQA 2E25A 3GNPA 1HGYA 3FV9A 1J5TA 4LY4A 5I7GA 1WOBA 2DU2A 1GORA 2G41A 3MSDA 5CZKA 1S3HA 5EPDA 1XL9A 2REQA 2R6OA 1MSSA 4HZ7A 3EYPA 4KIEA 3L0KA 1PKNA 4LC8A 3ABSA 2G3JA 5GJNA 3WH5A 5HATA 3CUHA 4Q8VA 4GIRA 3UR2A 2I5IA 4O8RA 4QG6A 3RCNA 3FYPA 3OG3A 2VYOA 4JTGA 1EDGA 3AJXA 3LN3A 3QXBA 3RLHA 3VMOA 4Q7IA 1ZALA 1CGUA 1VIZA 4NRSA 3MA8A 1AQHA 5FACA 1UKOA 5FJIA 1IR2A 1SZGA 2FJKA 1DXFA 1VEMA 1X1ZA 3USBA 3S46A 4OWGA 4UFMA 2GWGA 1J96A 3N4AA 2HBVA 5HPOA 1XJBA 4AVFA 4RE0A 3FXGA 2DW6A 2GJRA 2B7QA 5DELA 2NQZA 2J8TA 1WZKA 2J24A 6A3HA 3ZS4A 1XLJA 1CZ1A 1HJQA 3TQ0A 3Q94A 3SUTA 3MZ2A 4XO6A 2FDMA 3OVPA 4C5ZA 5DO8A 4RX0A 1RV8A 2NX3A 2TPSA 1KRCC 4MWAB 3TC7A 4O8AA 3HB9A 5F4XA 1QHPA 4AD3A 3VC5A 3NL5A 3G1RA 2WWCA 3E0FA 1PZ2A 3S0CA 2C1HA 2Q3RA 1NH6A 4FF7A 2VD8A 4AIBA 3LHWA 5D9OA 3MZNA 3LNMA 5FJRA 4H00A 3CXOA 3W7LA 2VC9A 2ADAA 1RAKA 7ODCA 3MHFA 3H2EA 4QE5A 2WMKA 4JDYA 4DJEA 4QS5A 1XX1A 1TJRA 2V3EA 3R89A 2YFOA 4DBSA 3O06A 2POTA 3GZ3A 1LM1A 3AMLA 3NL6A 4NU7A 5DY2A 3RMJA 2OU4A 3REQB 3O1NA 4WDUA 4NX5A 1FWFC 3WY1A 4C6LA 3H4XA 4V2XA 1VPXA 2Z2AA 3DC0A 1OFPA 2QVHA 3GVWA 4I3GA 5LZLA 3QY7A 2BVDA 5C54A 5KZMA 3WDQA 3GG7A 1GTEA 1UD5A 2DQXA 5HR6A 1DE6A 4R3UA 3WH6A 5LIYX 1CENA 1UKTA 1M03A 1A5KC 2HTMA 3AS1A 4K8EA 4ACZB 2FMNA 5CEWA 1PX3A 2OPJA 2Q8ZA 1EZ2A 1C9WA 4MYAA 2YSWA 4LCRA 5J5RA 4XZNX 3DYOA 2V0TA 3HURA 3G1XA 3AZRA 4Q4SA 3V18A 4TVUA 1YPFA 4IPNB 3WNNA 4Q33A 1T7LA 4CKQA 1B3YA 4LY8A 3O07A 4LV4A 5BZAA 3N2CA 3OIHA 3NQEA 1XLLA 3CASA 4FX8A 4XVEA 3Q45A 4PMDA 1OFQA 2OJPA 4GIYA 4WGHA 3BLFA 5TNVA 3U9IA 4Q7NA 1W9DM 2W4XA 1YTKA 4Q6JA 1WV2A 2ZYFA 4ZR8A 3QZ6A 3C2FA 5HBFA 2DT0A 5LXXA 4TU1A 1Z32X 2J7CA 4DJDC 3LB0A 4PMRA 3TEVA 4JHZA 1FWJC 4B4HA 4MADA 1ME8A 1AZ1A 9RUBA 1NSJA 1KFBA 4BI6A 2YCLA 2BY0A 1V51A 4J40A 3TTOA 4XUYA 3TYAA 1J2BA 1W1B1 2G37A 1JI1A 3N1AA 1CB7B 4MB1A 3NNTA 3G8EA 2Y2WA 1P6WA 2Z25A 4TOQA 3WF2A 3QOMA 3ABQA 3NQ7A 1GJWA 3EEZA 1EPXA 1QPQA 4Q4QA 5DCDA 3CAKA 4JIIX 3STPA 1EL3A 3DXIA 4EF9A 5BRPA 1X97A 3R8GA 5CZSA 1BVNP 3K30A 3IGHX 2Z26A 3LI0A 2PE4A 4PMQA 3H2OA 4DNMA 3QPEA 3SCQA 1MXSA 2BZNA 3P8IA 4E4PA 3REQA 2QCDB 1MW2A 1MUCA 2IKJA 4YVVA 4HMDA 1YRRA 2Z1BA 3DN5A 2A21A 3N11A 2XWEA 3TH6A 4C90A 3WQ5A 1MRAA 4AWSA 1Q6QA 5D04C 3SN0A 1H7PA 3VKBA 1C7SA 1GOMA 1FH8A 3WDJA 2H3BA 4O53A 4MJMA 3VNLA 3XINA 4EP8C 1BVWA 3RR1A 3TKFA 4WDTA 3QY8A 1YLVA 4PUMA 2ACSA 4M80A 3RCMA 5LGZA 7ENLA 4YIWA 4N9DA 3KLKA 3NAVA 1VYPX 2XIIA 5F2MA 2V38A 5CGMA 1NDWA 5BOFA 1FX6A 4RE3A 3BG9A 5HMDA 5H8PA 4KFOA 4IIHA 5BOEA 4F79A 1JXJA 4GO9A 4E2OA 4UMCA 3FEQA 2P50A 1KGUA 1VYSX 4OBRA 2XVNA 3BV4A 3UZYA 4PMVA 2QXWA 1NDYA 1KFJA 3CLWA 2PDYA 4JIQA 3FHAA 1QRQA 1L6SA 3SB0A 1VKFA 3NJ3A 4JCMA 1QK0A 1NQ6A 3W7KA 3GYEA 2JALA 4EACA 2V6AA 3Q37A 3CQKA 4NJHA 1G1YA 1H2JA 3K4WA 1JGIA 1US2A 5JXQA 3RUBL 1CECA 3LCXA 2B0MA 3RO6A 5U4NA 1P0KA 2FLIA 1V79A 1KKOA 3W74A 3JVAA 1V6TA 2ZVRA 5E5CA 1D3GA 1SU5A 3UZXA 2G3MA 4JQ3A 2BTMA 1SO4A 3ZLHA 4M19A 1I4NA 1PIIA 1H51A 1XH1A 1PYMA 4DXXA 1VBUA 3W00A 1XQLA 1XC4A 3LQGA 4G1NA 4S2BA 1K8CA 2CBJA 1WKYA 1NVMA 1OYBA 4IQDA 5KZDA 4H9MA 3KCJA 5CPNA 1BPLB 4NJGA 2D0GA 4TV6A 4ZODA 2OLHA 3E2RA 4J2PA 4ICNA 1B3XA 1VRXA 1AZ2A 3M46A 3BURA 4Z0SA 1X8CA 4JTLA 1SJCA 3LZ5A 3AAMA 5D2WA 1J01A 1GVOA 3L68A 3E0LA 3PC0A 2QF7A 3PAOA 4ZO9A 2B31A 2I56A 4O1FA 3EWUA 4WF7A 1B30A 2X16A 4YYCA 3M0HA 1G7VA 2YOCA 1GZGA 3C3UA 2FMOA 2OSWA 3E5BA 1S38A 2G95A 5K9DA 4M3PA 1E6QM 2W0UA 3S83A 2ZCGA 3TWAA 2PZ0A 3QYSA 1QI2A 1WXZA 3DGRA 2J4GA 4L61A 1IT8A 1FCUA 3IVUA 1UUMA 2AMXA 3UETA 3HPFA 2A3AA 2L5HA 4XVDA 1XYLA 4X2RA 1W37A 2DT3A 1E4NA 3G1SA 3T4CA 5CG0A 3UVIA 4LFYA 2V5KA 2HE5A 3CB3A 5CLTA 5D4YA 5LA2A 1GWJA 5CJMA 2VDHA 3UA4A 2ZX6A 1IV8A 1FWSA 4GY0A 3RM9A 1C91A 2Z1XA 1A5CA 1QPOA 3O6AA 3DEQA 4AHQA 3IVTA 2EG7A 4JXCA 1E1CA 3U5UA 1IIGA 3TN6A 4MSSA 4MWAC 1XIEA 1O5QA 4B5UA 4PUUA 1VJZA 2VI0A 4MWAD 3OPSA 1R46A 3D5HA 5DY3A 1PL9A 4GLEA 2ZTKA 3NSMA 4HPNA 4ZFMA 5C55A 3QHNA 3FA5A 3STEA 1QW8A 3NL3A 4NZ1A 3CV1A 3G8RA 4HOZA 3BOFA 3GZAA 4GNKB 3TW9A 1I2PA 1W3LA 1T96A 4MGGA 5GVJA 1YIXA 1P7TA 1GKRA 5EMYA 3WD4A 4QROA 4Y6GA 1P1MA 1O95A 1FWRA 4XQ6A 3N6HA 3CM4A 2NVAA 4C6IA 5HXMA 5G2WA 1JNEA 2ZRXA 3QHOA 2VEMA 2R1NA 4A05A 1U5JA 1K3UA 2OG9A 2Z27A 1WP6A 1XLAA 3AICA 2FFIA 3PZNA 3W86A 1ZP3A 2J74A 3WH7A 4N42A 4F3HA 2OO6A 1H41A 3N9RA 1E56A 4BI7A 1BD0A 4JN7A 4ZO8A 4AU0A 3MJYA 3C56A 1JZ4A 1TPVA 1XLGA 4PRTA 3CTLA 5JH1A 2C3ZA 1OM0A 5AVNA 4NZ4A 2PMQA 3T4WA 5DANA 5ECVA 4EOUA 3MBDA 1HX0A 3ITVA 4L1GA 1RH9A 3F4WA 3W84A 4PUWA 4IIBA 3NUKA 3K8LA 1BF6A 2CC0A 1IEQA 2W6RA 2VCBA 3LTPA 5D02A 3G0UA 4XWUA 3A4AA 1WDPA 4LNCA 3WQPA 2OO0A 4BY3A 2WZTA 4M51A 5F4SA 1G4PA 1XH0A 3UJRA 3FY1A 1PZ0A 4UQBA 2OKOA 3NVDA 5CPQA 4ZVJA 2PBOA 2PA6A 3OLGA 4B5TA 1Q6DA 2QMKA 2WYSA 3SY8A 4ACYA 2ZA3A 4Z1DA 2VFDA 4D1JA 2G4JA 4TMCA 4UMAA 1LL6A 5EA9A 2WM1A 2F84A 3NZRA 2WK2A 5DF0A 3WL1A 5LA0A 2WBKA 3RXZA 3TCSA 1U83A 4XZHA 1TRIA 4CEUC 3BOXA 4ZB5A 1A53A 4JTCA 3PUEA 1EIXA 3MMTA 3DERA 4D71A 4F2TA 2X1RA 4ZSTA 1ZHAA 4ZA0A 1EZWA 3TJIA 1WKDA 4E6MA 4FX6M 1XYCA 3W7EA 3KXQA 2BOFX 2GQ8A 2UY5A 3T0TA 3W1RA 4DM1A 4GJIA 4F0HA 4MNMA 1RJQA 4OHQA 1AH3A 3P81A 1X8FA 4C6NA 1F7BA 2V5LA 3HQNA 1OYCA 1AFSA 2FZ9A 4Q7BA 2VFHA 4FP1A 3BJFA 1ICPA 1JDEA 4ZQPA 1GYNA 6REQB 3V4BA 3VM7A 1PTGA 4K39A 1BWLA 1E5JA 1ITUA 2PDIA 1ZP4A 4QJ4B 2WC7A 3WN6A 5CCZA 3CO8A 4HQVA 4NKCA 3ARQA 3NQAA 4BQ5A 3FJ4A 1BHGA 1ZBVA 4M24A 1ZZMA 3F4VA 2CESA 2RDXA 4K1GA 2QNEA 3LMZA 2F6XA 1F6KA 2PLMA 3DHUA 1V6WA 5DMMA 4K8GA 3T05A 3S2LA 4CQ8A 2AKMA 3EMCA 1PZ1A 1CXHA 3E0VA 5BU9A 1F3EA 4DWSC 1WQ5A 1PIFA 3U8GA 3IIXA 4AISA 1R0MA 5I6SA 2QJIA 1XGZA 2E1WA 2GWNA 2GDUA 3C0SA 2PURA 1IYXA 3KW3A 1KFWA 1L6WA 1VB9A 4AXNA 3U2OA 3BARA 2WJDA 2J6XA 5FF2A 4D72A 1FUYA 1GHRA 1US3A 1OFOA 5D05A 2GPTA 3OA5A 1IEVA 4LGXA 4TIMA 3SM0A 5LHEA 4XKYB 4IQLA 4K38A 4GXPA 4JYDA 3NOYA 4XZBA 3O0FA 3QTGA 3OA3A 4BQ2A 1JJKA 2PDWA 4XZLX 1OT2A 5G5IA 4IG2A 4RV3A 2YKKA 2NX1A 2OXNA 3PY2A 5FIPA 3LS9A 1J4EA 4LUTB 4L4OA 4O0KA 2QDGA 2Z6JA 3UNDA 3SRKA 2YLLA 2VC6A 2CHOA 3G18A 1IGSA 3NCOA 3UJFA 2XVLA 2PS2A 3L4ZA 3PWIA 4JYEA 4KEVA 4Z1BA 1WKEA 3GNNA 1J8VA 4ZGYA 4L4MA 2G50A 2TMDA 1H50A 1R38A 2PI6A 4QNEA 3THAA 4XG1A 1F3TA 1P43A 3VX0A 3O2LA 4HKPA 1Q2RA 4R9OA 4KCTA 3BO9A 1U1HA 4G7FA 3F7JA 1EDTA 3RCYA 1R7OA 1SGJA 5I2UA 1K77A 3MUZ1 1L9WA 1UWQA 1CI1A 3WUEA 3ARTA 1GJPA 5ABTA 2IS7A 2ZXAA 1HT6A 4IGMA 2NQ9A 4GX8A 6ALDA 2IKGA 3M5YA 1JR1A 2WMFA 3QQ0A 1UKSA 4NZ3A 1TPC1 4WR3A 3VIIA 3B8UA 2CKSA 4HA0A 4R85A 2MUCA 3GXIA 1GKPA 1HKIA 2H90A 5FEXA 4A8LA 4L9YA 2GDVA 3EWWA 3CZ8A 4RDWA 2DZPA 1S46A 1I6NA 3MUIA 3R7MA 2X2GA 1NFPA 3ALGA 4CNTA 4AF0A 4O10A 1IQ8A 5I3IA 1PWLA 4R7WA 1SJAA 5BMWA 4M7TA 2CLLA 1UUOA 2YL9A 1K8YA 3W70A 2FYMA 4LUTA 1F9CA 1L2QA 4H3DA 4N7QA 4HSHA 1CIUA 1FWAC 3VA8A 2D0HA 3AS0A 4XUGA 2AOSA 4WOQA 3TP4A 3R43A 3W37A 2O92A 4PEKA 4WY0B 1G9HA 3AMCA 3WUFA 3LBCA 3H12A 2E7FA 3M6DA 1DIDA 4DI8A 3LM3A 1W8GA 4DAFA 2R8WA 4JNZA 3L0GA 4KIRA 1R2SA 2ACRA 2OEMA 3OHIA 1RJPA 1DIKA 3U2ZA 3T1GA 3TNOA 4UNIA 1YPXA 3EX4A 1P6CA 1X1OA 4DIAA 1XBZA 4RXGA 2GK1A 1FWCC 5AY7A 2WSYA 5D37A 3IJDA 3GIPA 3CHFA 1AD1A 3I7SA 1N82A 1YTEA 3PULA 1DEDA 2REQB 1RZMA 4C1KA 4ROPA 2D69A 2XVGA 3VZYA 1TTQA 4C6OA 2PBGA 2OOGA 2ZDSA 1A4LA 1LLOA 1PPIA 3ES7A 4JQAA 3AHVA 1HN1A 4QQ3A 2V67A 1ITXA 1TQJA 1MNSA 3GFZA 1W5NA 2NWSA 2V8ZA 1KQZA 4JKMA 4AC7C 1BLIA 2CETA 5MHBA 1EJ7L 5D38A 1TREA 2I14A 3P93A 3L0NA 3TWBA 5GNZA 2D2OA 1S2AA 1O94A 5J8LA 2ON3A 2Y1HA 4CU7A 4XTIA 4MUZA 3RF9A 2P0OA 1OSEA 4QJ5B 2C1GA 1HKJA 2XFWA 5FF0A 3GHSA 2ZE3A 3I4EA 3EOOA 1KCZA 1S5WA 3T44A 3TR2A 3MO7A 2WVSA 4J9JA 5IBXA 1IXPA 2V69A 2Y7GA 3B0VC 4O14A 1VJSA 2PD5A 3M0LA 4Z0JA 1S5VA 1Z7AA 2EJ1A 3IARA 4PGLA 3NYDA 4JR5A 3BC9A 1WO2A 3B9OA 4DO5A 1VCVA 4OGZA 3W1PA 2CZDA 4KMQA 4FXJA 5D9PA 1OWQA 3RU6A 2ZUUA 4INFA 2O9PA 2W91A 1LOLA 4FNTA 1DWGM 3CWOX 3ARZA 2INZA 1QTWA 3GTNA 2I9UA 1GVSA 5A2CA 1EJRC 4DO7A 2DZTA 2F2HA 5IXEA 3L66A 4MJ2A 3H4WA 2G3IA 2IPJA 3EGJA 3QRHA 3S6DA 4HNVA 4RE4A 2DH2A 2QDDA 2QDHA 1N8IA 2J8FA 1R3TA 2ODOA 3D6NA 4DO4A 3D3AA 2VRQA 5BXSA 1GTHA 3K13A 4NQ1A 5CG7A 4YVXA 3KOFA 3MSGA 3KEHA 3URBA 4X0VA 3MO4A 2PWVA 4US5A 2XGBA 1JPKA 3M0YA 2PD9A 4HSOA 4CN1A 2J9YA 4IIFA 4JTFA 3P62A 4NSBA 4DZ5A 4MHBA 5FL1A 4GIEA 3UXIA 1K6WA 1HKWA 4L7ZA 3ZJ6A 3B9AA 3UXAA 2CNCA 4NIRA 2A3LA 4DF1A 2XISA 2NV1A 4GGBA 3VILA 2BGNE 1R3WA 3LCHA 3AWNA 3A6OA 7REQB 1JD7A 4LAUA 1ITCA 1Q4WA 1UZ1A 4FMVA 2BHUA 2PPGA 4AIEA 2BVTA 1ME7A 2WLZA 5M17A 3UFYA 4PE8A 2Q09A 1JEZA 1H5VA 2I5GA 4Q8NA 3AWOA 4LT9A 3GIYA 3UXKA 4Z2GA 3CZLA 3CMGA 4DJFD 4Z1CA 2X41A 2WZMA 5GPRA 1TZZA 1QASA 4HHLA 3W73A 1YQ2A 4HZMA 3CYJA 1SO6A 1I2RA 2Z7GA 5FCZA 1LG2A 3WKZA 4C6MA 2Q01A 2E6AA 1XIFA 3HGSA 1I1XA 5AFDA 1EXBA 3VGEA 2V5BA 2WMIA 3MYOA 3W7PA 1THFD 4JEJA 1HZYA 2ZX7A 1WZAA 3M0ZA 4HK5A 4BF5A 4QHRA 1QI5A 2WKLA 4NASA 4Z08A 2X0HA 5H2ZA 1XGEA 3U4FA 4Q8OA 1EX5A 4NXKA 1CXIA 1ISYA 2YCEA 4DLMA 4IFKA 1J6OA 4H19A 2GGEA 4JIRA 1E6RA 2VX6A 1C29A 3GNDA 4O0QA 4NVTA 1YXDA 2YZ5A 3LPGA 3N34A 3CYVA 3UNTA 4PR4A 3CIVA 3VZXA 4Z17A 1T41A 2KZHA 4W85A 1EA9C 2XHYA 3QR1A 5CSUA 2VQUA 4HB7A 2XFRA 1XLIA 3LD5A 3OZOA 2CHNA 3L4YA 2YLAA 4MNKA 5K9XA 2PDNA 2WSKA 3GG1A 3NOEA 4DRSA 4QCEA 1F05A 2OWCA 1C7TA 2NVDA 1BGGA 1I9CB 2INFA 3CIWA 4EPBC 4B5VA 4WY0F 3LCLA 1W3KA 1OQFA 1EUNA 4C5YA 3QMTA 5BWFA 3UP8A 2E8YA 1FXPA 2PP0A 3LCFA 1D9EA 1B4EA 1KCLA 2CXEA 4J1OA 2CFFA 1MW1A 1E1EA 3H7RA 3LHTA 3PWGA 4N4PA 1P0BA 3VTRA 1W1ZA 1XYBA 3HMJG 4WIWA 2D20A 1V7YA 5SWUA 4C6PA 1W54A 3UGVA 1KR0A 5T9BG 3UG8A 1WA3A 1E6PA 3M5XA 5TBOA 2HVNA 4RDZA 2J47A 1ITQA 3WFLA 4QLKA 2O7QA 1HNYA 4KETA 4QXIA 1TX2A 1JZ3A 1JQVA 1ZNNA 4EIVA 1CGWA 2OZ8A 4GINA 1JRCA 5CAKA 1EXPA 1R3YA 1GYLA 3KOXA 2BGQA 3T81A 3L4XA 4A3UA 1AVAA 1J79A 1E15A 3U4AA 3MWAA 4MB5A 3UT0A 4H41A 3BLKA 3NDYA 4AD4A 3L5MA 2IQDA 4DHGA 4PRWA 4XZWA 1QNVA 5FOOA 1GOIA 4MTVA 3E6EA 4DUOA 4W88A 2E6DA 1M9HA 1XD0A 1MDRA 3H54A 3MSYA 2J88A 4HHPA 1KLYA 2AL1A 2IMRA 3RLUA 2D2GA 1KFLA 3EB3A 2VNCA 4AVOA 1K8ZA 3VNDA 4X63A 3VCCA 5AHMA 1FQ0A 5LIWX 3AMGA 3S2MA 1E9YB 4R88A 4KBXA 4AYGA 3PSVA 1WBHA 4KEZA 3VIGA 4S3FA 2ZUVA 3CMFA 4WGXA 3KRBA 2WQPA 1OCJA 3MDWA 4P8VA 3ZT5A 3ERPA 4H8UA 4QBXA 4XAGA 4JQ2A 5IM51 3PPCA 1FHDA 3WBXA 3VAVA 4A22A 1HXJA 2WHLA 2FH8A 5E70A 1JDDA 1L6YA 3E49A 3USZA 4O17A 1A4MA 4AZBA 2VFEA 3SY5A 4TQTA 5F4WA 2VZVA 4HPXA 2ZZ4A 3ZOAA 5HWJA 2WM0A 2FVKA 3ZWSA 3W24A 2YB4A 2R91A 3UGRA 3IK2A 1OFRA 3G1FA 1PCKA 1GEQA 3LBMA 4U5IA 3FIGA 1A80A 3EX2A 2E1DA 3TSBA 1ONWA 4Y9PA 5E9AA 4GVIA 4LVFA 3SQLA 4YCOA 1O68A 5ABEA 4C6KA 5C8BB 2OTDA 4YNGA 3O0KA 2CKRA 1XIIA 2XSBA 3H22A 3TFXA 3MDUA 4ZTYA 4EPEC 2W63A 1UD2A 4D6HA 3CC1A 4UZUA 1WYIA 2OT0A 2VJXA 1S2TA 3FA4A 1SSGA 4H6EA 3L2LA 2VTFA 3H6OA 3CMJA 4O18A 2A3HA 3FJ6A 2IQ0A 3PN8A 3OO2A 1B0IA 3N6QA 3WK0A 4WZHA 4Q4PA 1TYGA 3R12A 1ODUA 2EPKX 1ISWA 5CXPA 3V5OA 3F5JA 3TW7A 3VOCA 2VC5A 1MEWA 4LAKA 3TLLA 1HP4A 4CNPA 2PWDA 3TMLA 2J9ZA 1IEIA 1WZLA 4C1LA 5DMYA 4DJEC 3F4NA 1GQJA 2Y7EA 4Q22A 4ENLA 1U30A 4WJXA 4NI8A 4ERAA 1QPRA 4B3LA 2Z1KA 4ML4A 4LSBA 3ZIZA 3SCTA 1NWRA 5BCAA 3ARXA 4NP7A 4GABA 2PZNA 4QG9A 1V7AA 1EP2A 1UUQA 3WMSA 1ISZA 4ZQOA 5L6UA 4OV9A 1NFBA 4P8UA 1M41A 5H91A 3TYUA 3FK4A 3WK2A 2HK1A 2G96A 3WNKA 5IRPA 1GJUA 2G8ZA 3UZJA 2FHFA 3WYZA 3FCPA 2D0FA 2RGLA 2OT1A 2VDGA 4CNNA 4MLRA 1LZOA 2B81A 1BXBA 1Z44A 2OVLA 2X30A 1TTJA 4MAZA 5CQ1A 4LS0A 4QRNA 1H49A 2XM2A 1EOKA 4A3YA 4Y9OA 3F4DA 3QLDA 4HK6A 5FSEC 5TIMA 3UPWA 4DUVA 3I3BA 3K46A 4GH1A 1EX1A 4MOZA 3N3MA 3S1WA 9XIMA 1SSDA 4W8BA 3PBGA 3UWVA 2PWUA 2Z1SA 1VFTA 2J7DA 3WBAA 4IF2A 3ES8A 3H26A 3MUXA 1DQUA 1MQRA 3PZIA 4GPNA 4DN1A 3RX3A 4RW5A 3TSDA 2PDQA 2V2CA 1K4GA 3MUY1 3VKKA 3C2VA 3SCPA 2DSWA 1UP2A 1PWMA 2LLEA 1YBQB 3LHZA 3SRHA 4G1KA 2ZQ0A 3AOFA 1TO3A 1FKWA 1UJQA 4DELA 1XYFA 3E74A 4IUGA 2PWGA 3E12A 1DXIA 4G6CA 3B8WA 1SZEA 2PTDA 4GE8A 1XDMA 3BLLA 1RPKA 1V4YA 5FJOA 2V82A 3OYZA 1UYQA 4FR6A 2WO5A 5I3KA 4OQVA 3IK4A 1MRQA 1AUSL 2ZZ1A 3RM4A 1PAMA 3HPAA 4ZTXA 3SFWA 6CGTA 2WV8A 4ZMGA 3M16A 4W5ZA 1BF2A 4UQCA 4RZ5A 3ZVHB 1J18A 4F66A 3THUA 2V30A 3W6LA 1QW9A 2PTWA 3DX5A 1CPUA 1X6LA 4DXKA 2O4MA 3C0QA 1EO7A 1KV8A 3GXTA 3NXLA 1PHWA 1IZCA 3OEXA 2BODX 1QNPA 3G1VA 3WJWA 3S2CA 1T8XA 3COTA 2E4TA 2INEA 3RPMA 1AQ0A 4URIA 5D2TA 3GU9A 3DU0A 2ZTJA 1KW1A 5KZEA 2ZWZA 5CZJA 3LGEA 4AQLA 2D2HA 3JZUA 2VCAA 3FKRA 1QVBA 1XIGA 5AC4A 5A6AA 1CGTA 4PH6A 3PTDA 3QKEA 3VNIA 2DY3A 4ZQCA 2AAAA 2XIMA 2ISFA 4OBSA 4UXDA 5DMLA 2RHGA 2WCGA 4KCUA 3JU2A 5HJYA 1LORA 2F8QA 1D8WA 1YW1A 4AY8A 2XIJA 4PSRA 3NG3A 3U3HA 1RQBA 1X7IA 1GVEA 3MHGA 5AB3A 1D8CA 1VPYA 2WJFA 3VIJA 3AUOA 2W3ZA 4JTAA 1UBSA 1OYAA 1EA0A 1NP0A 3QLLA 8A3HA 1FWIC 3A4WA 1K70A 5D9NA 5H6HA 3F5LA 1S2UA 2O55A 2AL2B 3GXFA 1H3GA 1IGWA 2VZUA 4XTDA 3CT7A 4CN6A 2YDRA 2FH6A 1JCJA 2XN0A 3DG6A 3M4HA 2H8ZA 3FDKA 1PZ3A 1UHVA 2VVNA 2H9AB 4F0MA 5ABHA 1VIWA 2PDJA 3U6WA 3SRDA 2VFIA 4D8ZA 3TTYA 2ZBTA 4DVOA 3BJTA 4TTGA 2J7GA 1M7OA 3AROA 1SW3A 3WELA 3AS3A 2HVOA 2WWDA 4HMEA 3TYBA 1Z48A 2YDSA 4MZ1A 1WBJA 3HGOA 3P84A 2V3DA 5H8MA 2QDEA 4AAJA 3C2OA 3GVRA 3DHDA 1KRBC 2YCLB 5FA5A 2GQ3A 3TTSA 1Q2SA 1TV7A 4GVFA 1J0YA 2EGZA 1ZCOA 3IIZA 4AD2A 4L6HA 2RKXA 2J9XA 3UWEA 1UOKA 1O5RA 1XG4A 4GUFA 4X9SA 4RXFA 1C8VA 3PM6A 1KBKA 3TNBA 3KS6A 4H9ZA 1NIUA 1IHIA 3ZT6A 4EKJA 1VFFA 5CPTA 1FCBA 5AC6A 4C65A 3MUCA 2PDCA 3EX6A 3WQGA 3E5PA 1JYWA 2OSYA 2PAJA 4QEEA 1VPQA 4ZE5A 3KCLA 2PDBA 1CYGA 2FB3A 3PHAA 4XD5A 2FZMA 4EPDC 3QR0A 2NVCA 3AC0A 4WD0A 3BLPX 4QX4A 1UWTA 3B40A 2QLYA 2FGBA 2QJJA 3L4UA 3TQKA 1EUAA 3WBEA 1JI2A 2DPEA 4K2SA 1DVJA 1XC6A 3HIJA 4MVAA 3W01A 3WF1A 3H2CA 4BCEA 2V9DA 2BB0A 2VZTA 4CQ9A 3H2FA 3VOFA 1ONRA 5AYBA 4TO8A 4U2YA 2WPGA 3N6JA 1TR9A 4ZOBA 3I10A 3N25A 3LXBA 5I09A 2Y8VA 2C71A 4X61A 3BAIA 1M6JA 1LOQA 3UU0A 1XLFA 4D6DA 2OZ0A 1TIWA 5ENLA 3F2DA 4ZZ9A 4MM1A 4Y9MA 1JPHA 2YL5A 2OEJA 1V02E 2BDQA 4HVXA 1SPQA 3I68A 4LXFA 4BHYA 1W5OA 1V3IA 2ZOXA 4IG2B 2Y5EA 3ITXA 1PB0A 4W7WA 4WDXA 3SGZA 1AW2A 4X2PA 4YMZA 4HYWA 3RO8A 3W1QA 3K8KA 4M8UA 4JTDA 2OQHA 5AHFA 3RLGA 3SUUA 4YCPA 2ZFAA 2VXNA 3BE7A 1VCGA 1VCFA 1B1YA 2OX1A 4N9BA 2VO5A 5JUVA 4F40A 2OELA 3BW3A 4M81A 7TIMA 1EEXA 3PBVA 2YBTA 1R5YA 2FHBA 1JDCA 3L5LA 4AD1A 1IXQA 1KBIA 3SRFA 1KR1A 4RZ6A 4H6QA 1KTNA 3SGGA 4D6CA 3APYA 3I6RA 5A8QA 2X7VA 4Q4OA 5GJPA 2WCAA 3SCOA 3PZOA 3ZLFA 3WBYA 1OK6A 3GR7A 2QKFA 1AH0A 3W53A 3WQVA 3FVMA 4FNPA 2I5QA 5F1UA 4RW3A 1S2CA 3WMLA 2NQ5A 5B80A 1OB0A 3PF3A 4HU3A 1SFLA 3NQGA 3S2NA 1P0NA 3WENA 4R34A 5D8WA 1U22A 1S39A 3DYPA 1ZAIA 3N04A 2DW7A 3MI6A 4PN2A 3VDGA 1KGWA 1RQEA 4JTJA 4ONVA 3BDKA 4Y2WA 1OC5A 3K1GA 1DJWA 5A8MA 1UZDA 3JS3A 4LUSA 5D2YA 1EBGA 1YTDA 2GQ9A 4P61A 4ADSA 1GOQA 2GJXA 1Y5XA 4GIAA 3VDCA 4IWWA 4ILSA 2JBMA 4BF7A 2FZBA 1KBLA 1K03A 3OBEA 4RDYA 4UTUA 1QCWA 4W86A 3O16A 2C79A 3QV7A 2J62A 2DUZA 4JS3A 2DVTA 2DVXA 2EQDA 2NX9A 1UOZA 1DHKA 1OT1A 2VEFA 4J28A 1OG0A 1K9FA 4I9MA 4YN5A 3QHMA 4ATWA 1Q5MA 3EXSA 1T8QA 2NWRA 2YXOA 3ZVIA 4M1BA 3OTRA 3ZR5A 4RNHA 4P2VA 4B4FA 2QUTA 1POKA 1TELA 4CQBA 4K7YA 4OOZA 1SYTA 2QJHA 1W3IA 4EAYA 8XIAA 5AHLA 1HW6A 3F5KA 1H7RA 3VIHA 2NT1A 4N2YA 5RUBA 3PANA 3IRDA 4PFHA 1B3VA 3C2RA 4GQBA 2RDTA 1W32A 4LF1A 1ZFJA 4BS0A 1DE5A 2ZX5A 3WD1A 3OZMA 3H70A 4IFRA 3SAZA 2O9RA 1FWNA 2YR1A 4AH7A 4JY9A 5A2BA 3DKLA 3SSJA 1F07A 1V6XA 3S9ZA 5C6MA 4HNUA 1E5NA 1E0XA 3LCIA 5I79A 3V0TA 3W87A 4NT0A 2V3GA 2YBVA 3PP7A 3WCZA 3M43A 3IANA 3HG2A 1AH4A 4MG4A 2BS9A 4D2JA 4DEFA 1Z8AA 3S9YA 2GDQA 2XSXA 3OBAA 4U28A 1H11A 2WJZA 4I8YA 4YTRA 2QCHA 3VUPA 4PMXA 4GKTA 3LUTA 3TXVA 1NU5A 4HK7A 3U2CA 3SGUA 1VEPA 3S5OA 3BW2A 5D2VA 3TQPA 1FHUA 3GXPA 4DWSA 4YLWA 4EXAA 4AX6A 5A6MA 4KPLA 3R13A 4MKSA 3P14A 1O5XA 4FNRA 4RV8A 5IFTA 3NPVA 2NLIA 3TSMA 1N55A 3TJ4A 1BFNA 4FX7A 7TAAA 4PMNA 3W7JA 3LHVA 1SM9A 3ARSA 2VT0A 3AYVA 4NX0A 3BPWA 8CGTA 2YB1A 3NPWA 4ECLA 3V35A 3GRIA 3WQ6A 4J3WA 1EB3A 1B3OA 1AJZA 1AMKA 3LG3A 1UB3A 2C6QA 3QC3A 3TYCA 4PEEA 5EMMA 1QWKA 2A3CA 1IWPA 5AVHA 4F9DA 2FVLA 2OFJA 2CW6A 3S4TA 5EKYA 2HS8A 1DTNA 3E2VA 3ZSSA 5CPOA 2YL8A 1GK8A 4DJFA 1JUKA 1TTPA 4UCFA 3NIYA 3B06A 1JL8A 4AF0B 4B5WA 4LUSB 1IZJA 1JCXA 2P5NA 4Z42C 2VCCA 4GC3A 3M6YA 5BOOA 1T40A 3PFRA 3PFMA 2YA1A 4GWEA 1RSCA 5M5DA 2ATMA 2NSOA 3IUDA 1UWIA 3N9SA 3AHZA 2O9TA 4DWSB 1R7AA 3ZR6A 5JU6A 4KFPA 4MDPA 4HMNA 3WF4A 2PLKA 4KRUA 3VGFA 5I24A 2NUYA 4GVHA 2GGIA 4GCAA 1W3HA 2DH3A 4B92A 4FK9A 3SFKA 2GFTA 4RKAA 8RUCA 2WXDM 3VDHA 4R7JA 2V5JA 3MYPA 3TAKA 4P8XA 3O6CA 4LS2A 5BROA 4YPJA 4ZCWA 5L9FA 3WLTA 1H0GA 3IJ6A 1Q85A 4ORIA 4JTSA 1QWGA 2HEJA 3OIXA 3ORWA 4GNJA 5JMUA 1FY6A 1J11A 1PE1A 1FHVA 4KT2A 1IXNA 1ZY9A 3LEPA 3H8AA 1ML1A 1K8XA 5BRBA 1PIGA 2CZVA 2PRHA 3CWNA 4B3KA 1MWOA 3CUXA 1FXQA 1XIHA 5MF5A 2ANUA 2GJLA 1MI3A 1VLIA 4HZ8A 2WQDA 4BZYA 5A6SA 4RDVA 1DKWA 2RFGA 4B90A 2ZXQA 4OZOA 4HZ6A 2QGHA 1AD4A 3WDPP 3TOYA 4GVGA 4D6IA 3CHCA 1XPYA 2WANA 4LAZA 3IUHA 2FDSA 3HPSA 4Z2IA 4DWDA 3RK8A 4ML9A 4FA3A 2J13A 1JZ7A 5T9CE 5LSMA 3VO0A 3RJXA 4BK9A 3S1XA 4JIEA 2G97A 4S3GA 4QJ1A 2VURA 3I3EA 3B8DA 1DYSA 3VC6A 1UR4A 1LTDA 3MP5A 5EBAA 3GUGA 1ADDA 3TDFA 4JHMA 2C1IA 4AZGA 2J7HA 3UJSA 4DYKA 4CQAA 4FNQA 4XIAA 1RXOB 2ONEA 5C7HA 3M47A 3THQA 5DFAA 4G2DA 1BQCA 3ONBA 3L23A 4IPLA 2WBGA 3OJGA 3R0KA 3L4VA 2Z24A 2A79A 5DT5A 3BOLA 5AC7A 5BXTA 1M7PA 1IEXA 4WSJA 3DOPA 2AKZA 5H1WA 1Q4NX 1LRNA 4QFUA 3BANA 4DNHA 2BASA 3EWDA 1J5SA 4D8AA 5LIXX 8TIMA 3RJYA 4XISA 4N4QA 1CWYA 5BRQA 4AWEA 4LCSA 4RJEA 2P8BA 1QO2A 3XISA 3HO8A 4UTIA 1OFBA 3TN4A 4NZJA 1RJRA 2GJNA 2NQJA 3URAA 2Z0IA 5G1YA 3B0PA 2XIBA 1W9UA 5CC7A 3I6EA 1LG1A 1P7TB 3VGBA 2PDPA 3ZJ8A 4E8CA 2VX7A 3N3TA 1BQGA 4B2DD 4JOMA 3GVGA 1VD6A 1K7XA 4BQ3A 5HJXA 2WVVB 1F76A 1X98A 3NQDA 1PCWA 3N17A 3MU7A 4QCFA 5FL0A 3GDMA 5C70A 4DUXA 1SR9A 2GGHA 2DZSA 4LYQA 4LNYA 4I90A 4UNLA 4AZIA 2VWTA 3BCDA 3PUDA 1W56A 2PU1A 3VK5A 1MEIA 2CLIA 2QIWA 3A9BA 3VDAA 3EWXA 2FFCA 1KXVA 4E8DA 2CBUA 1DIEA 1EJXC 3A3HA 3IIOA 2AQVA 2C0HA 1IWBA 3GG8A 4NUWA 2ACQA 4LVBA 4DI9A 1XRFA 3W25A 2WZHA 4JX4A 1I0BA 4PTDA 3W02A 1M3UA 1SJDA 5AC8A 3TW6A 2OKTA 2VRJA 2BNJA 1D7FA 3BLEA 3AIRA 4NG3A 3SUVA 5IOBA 4S3DA 3WLQA 4FLSA 1BYAA 1TV2A 3H2MA 2XH7A 3G24A 2I16A 1BGAA 3TYEA 1POJA 1EJSC 1ZENA 4HOXA 5I02A 1EFZA 3S8HA 2GYIA 3S3GA 4I5RA 3VABA 3H2AA 3BLDA 2Y88A 4J35A 1BTMA 4LVDA 2VR5A 3NZGA 5BMXA 1E70M 2PGRA 4GO8A 5CLWA 3G0XA 1CXLA 1Z69A 2QCLA 3MW7A 2Z6IA 4XK2A 2J79A 1ADOA 1SZNA 2Q71A 3I6TA 3NVTA 3WQ8A 5KETA 3ARVA 4GI8A 4O1CA 4TMBA 3NM1A 5K7JA 1BXNA 3U2EA 4OU1A 2SFPA 2HPMA 4J27A 1IF2A 4DQWA 4O13A 4CNUA 3CHEA 3CNYA 1UMYA 1TCDA 1DJHA 1ZB5A 2GOKA 3VIMA 1XYMA 5CKSA 2EHHA 3C0JA 4UZSA 2CXGA 3C52A 3GR4A 1VRDA 2XH0A 4JN6A 1JZ2A 4O1BA 3VE7A 1LBFA 3N18A 3OVRA 2Y24A 2TYSA 3VFCA 2P76A 2X40A 1MXGA 1ADSA 3VD9A 4KWWA 1KWKA 4XO7A 2A2IA 5I07A 2NV9A 3EPNA 4OTKA 4FZIA 4AEFA 2NZLA 4FSAA 1EJWC 4YL2A 2A0NA 4FS9A 1KV5A 3W29A 3QSRA 3QZEA 3N29A 4UQ9A 5GNXA 3E3HA 5F1VA 1JDAA 3QJAA 5HQEA 4OUEA 3KUMA 4W9TA 1YBQA 3PAJA 4HA1A 1XIBA 3VD4A 2VEKA 5FI8A 1F6YA 4DBDA 4BWLA 5FF3A 1ECEA