1CZ1A

Exo-b-(1,3)-glucanase from candida albicans at 1.85 a resolution
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EXO-B-(1,3)-GLUCANASE)
publication title The structure of the exo-beta-(1,3)-glucanase from Candida albicans in native and bound forms: relationship between a pocket and groove in family 5 glycosyl hydrolases.
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 152
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cz1A00
4C7FA 1GOKA 3FNDA 1G94A 4HPGA 4QAWA 1XGZA 3VU2A 2ZUVA 4W86A 4EANA 4JHZA 4AEEA 2VQTA 2WWDA 1QNQA 1W9BM 2QHAA 3CO4A 2WBGA 4PYSA 3AIQA 5E0FA 3OLEA 1J0JA 3DHUA 4HTYA 1JZ6A 4TVCA 2DT0A 2FGLA 1HJSA 1EQCA 3B9EA 3ARZA 3RJYA 5HOSA 3PZ9A 4W84A 3L4ZA 1HL9A 3MU7A 4WK9A 5C71A 3LPOA 4D6JA 4BQ4A 1UD2A 4W7VA 3KEHA 1KBKA 4HU0A 1WKYA 2G41A 1K9EA 1W9UA 1VEPA 3AXXA 2ZICA 3OZPA 1C7SA 2J7CA 2J7GA 2CXGA 5BRQA 3WH6A 4CCEA 4ATWA 1WDPA 4MAZA 5A2CA 2OWWA 3PTQA 4J3SA 3A47A 1K9TA 5CSUA 3TP4A 4JCLA 1OGGA 1OGSA 4TXEA 4MNKA 1WO2A 3D5HA 3OZOA 2A3AA 3AMKA 4FK9A 4ACZA 1MQPA 2DSWA 3AISA 3WH9A 1XCWA 3OLGA 3DYPA 4D71A 4W87A 4WSKA 3FW6A 3CIVA 2OYKA 5FL0A 2YKKA 2JE8A 2ZUWA 4JKLA 4OBSA 3WEZA 1UA3A 2YLLA 3OA5A 3AYSA 5A69A 2OWXA 4GI6A 1ITCA 1J11A 4IPNB 5FIPA 2DT2A 1UOKA 4HPHA 2E3ZA 1KBBA 5DF0A 2J7EA 5KZ6A 3WNNA 2PWDA 1EA9C 1JL8A 4X9YA 2WB5A 4AMCA 2CCRA 1UA7A 2IUZA 2VO5A 1NOWA 1BFNA 1CBGA 2F8QA 4E2OA 2XWEA 1J0ZA 2WMHA 4OOUA 3L4VA 2J8GA 4WF7A 3WF4A 5LA1A 3NUKA 3AS0A 2G3IA 5DMYA 1H49A 2E8ZA 3WF3A 4H8VA 2BY1A 3GNOA 4PEEA 2VCAA 1JXJA 1E9LA 3SCVA 1E6ZA 2AOSA 1Q6CA 2WCGA 3ARWA 1QI2A 2WLYA 2GJXB 3M07A 4JFTA 1JGIA 1UR2A 2CBUA 1CGYA 3WL0A 1NH6A 1C8YA 1UWQA 3PZQA 1VFMA 3SUSA 4CU7A 1M04A 2QMKA 1J0YA 4E8DA 2J78A 2VCBA 2XFYA 3K4AA 1VB9A 2BVYA 1E55A 1HF6A 4HMDA 3RILA 3L4TA 1OT1A 3F5JA 3WF2A 4AZBA 2BS9A 2ZX9A 4KGLA 3ALFA 1C90A 2CBVA 2YIHA 4HZ6A 2VVNA 4KRUA 1MFUA 1B3VA 1V08A 4A3HA 3SUVA 1UH3A 3I3BA 3ZO9A 1NWSA 2CHOA 1VF8A 5CPTA 1XSKA 2PF0A 3VD9A 1FP8A 1ZU8A 2XYLA 1E4LA 2VOTA 5C8BB 1XRVA 1PX3A 1UZ4A 4OKDA 3WD2A 4CU8A 3ARSA 2ZXQA 1U33A 2XSBA 3T2PA 4Q22A 4D6CA 1J12A 3W26A 4QFUA 4XUYA 3ARRA 2VX7A 4PRWA 1CGXA 3MMWA 4UZSA 3IJ8A 4JKMA 2JF7A 2XIBA 4MPKA 1Q6FA 5JIWA 2DH2A 2W61A 5D9OA 1XD0A 1OB0A 1V6WA 1PBGA 3N13A 4M80A 1QI0A 2WVVA 1HJUA 3VX1A 2G3JA 3VDAA 3GBEA 3BGAA 1LG1A 1UKOA 2ZX7A 5EFFA 2NW0A 3QR3A 4UFLA 3W28A 2XVKA 1W2PA 3AZRA 4AYSA 4AIEA 3KL0A 1AMYA 3AIEA 1BYDA 1GJUA 1B31A 1VAHA 2DSKA 4HZ7A 4CUCA 3UR7A 5A8OA 4HOZA 4U5IA 3VILA 3CUFA 4ZXLA 4IUGA 2J7HA 1U2YA 2E9LA 4BCEA 2O9TA 4UTFA 4PSRA 3PZUA 1JDCA 3BLPX 4PMUA 2J7FA 1R87A 1W1PA 3PZVA 5CSYA 2V5DA 3WH7A 2X05A 5I77A 3QOKA 2CKRA 3L2LA 2OSXA 4PMXA 4F79A 3WENA 4U2YA 2ZXBA 4KGJA 5CJ5A 2J8FA 1DWHM 1CLXA 3VX0A 2XHYA 4AW7A 4AZCB 3RM4A 5I0DA 1U30A 4JHOA 2XFFA 1MVYA 3MUIA 3CHCA 4PTWA 3SCQA 3WDHA 2ZE0A 4YHEA 3S6TA 1Y7VA 3U5UA 3UERA 1W3JA 1RP9A 3EMQA 2V3EA 4PN2A 2XWDA 3TTYA 4AZHA 2WW5A 3RPMA 1BGGA 3GDBA 3WQ6A 4NRSA 4ZE5A 3AZSA 1V0LA 1E3XA 2VX6A 1BVNP 2YDSA 4GKLA 2X1IA 2ZX5A 3VO0A 2WHMA 2XPKA 2A3HA 5BYWA 1ISVA 2BY0A 5D9NA 3IJ7A 2XUCA 4P8UA 1B2YA 1R85A 1E56A 3UESA 4KMQA 1OD0A 4RE2A 2DIEA 1JNEA 3L4UA 5D8WA 1UR4A 1TA3A 1I1XA 3CUGA 5BCAA 1GQLA 7CGTA 2JIWA 3W25A 1B30A 1JDDA 2UWFA 3E1F1 5A1AA 2VC9A 3PZNA 4WLCA 4P7OA 2CYGA 3LPGA 1FOBA 5DT5A 2CBJA 3GZAA 5M3WA 2Y5EA 5EFDA 1BGAA 2UY3A 3U7BA 1UWSA 4U3CA 3AYRA 2VVSA 5BXRA 4D6HA 3BCFA 2VZSA 4XZWA 1ODUA 1VJZA 2JIEA 5DFAA 3UEQA 4NF7A 2OYLA 3MMDA 4MDOA 2YBTA 2IXVA 2GDVA 3N12A 4TOQA 1PEZA 4MJ2A 2GVYA 2WKGA 4ZENA 3MKKA 4UFIA 4ACYA 4AD5A 4RL3A 4V27A 3SCUA 4AD1A 1R8LA 3VUPA 1QVBA 1OSEA 1UUQA 3SUTA 4H8HA 4W8LA 1JYNA 2WM0A 2DQXA 1WZAA 2ZX8A 3IJ9A 2QPSA 3BAWA 5A6MA 5D4YA 2VUYA 4CVUA 1GHRA 2D22A 2DH3A 2Y4SA 1C93A 3HN3A 3WD1A 1MQQA 4HU8A 6CGTA 1JFHA 5D8ZA 4J28A 4RE3A 5A6BA 2PWHA 1BYAA 1B3WA 1TVPA 3RJXA 3VGGA 3WIJA 1C3FA 2QMJA 3EDEA 3WUFA 3VIJA 5BXPA 3O2LA 2EPLX 3UG5A 2VURA 4ZE4A 1F4AA 4QCFA 4H04A 1CXKA 1OWQA 1AQMA 1VBUA 2YBUA 1FFRA 3MO4A 4F9DA 1EHAA 2WXDM 3HU7A 5E6ZA 3BAKA 1ODZA 5GNZA 2J25A 5TD4A 5A6BD 5I5RA 3ZSSA 3WD3A 2VRKA 3OGRA 4HOXA 1V0KA 1QHPA 1LQ0A 1WP6A 2EJ1A 2E9BA 5LA2A 5A3HA 3NCOA 1UQZA 3A4XA 5JBFA 1EGZA 4JCMA 3LPPA 2WLZA 1E3ZA 4EK7A 5A6SA 1CGVA 1O6IA 3ARYA 1TCMA 1B1YA 1CLVA 3CZJA 3N18A 3ZMRA 2YOCA 3NSNA 5DEZA 2X2YA 5I3DA 4JZ5A 1CGUA 1H09A 1KQYA 3NYDA 1CXLA 4M82A 4HMEA 1EOMA 5LYRA 2BNJA 2CEQA 4ZEPA 3VDBA 1DWJM 1IZKA 2WANA 4J3XA 4C7DA 1C92A 1G1YA 4V2XA 4KH2A 3VIKA 1E6SM 1V6YA 4WIWA 4AIOA 2ZWZA 1PIFA 4K68A 3FN9A 1CTNA 1E5NA 2F2HA 3WNOA 1QBAA 2VR4A 5GNYA 5BROA 1G5AA 2JALA 2WSKA 4AY1A 3O6AA 5GNXA 1H1NA 1RPKA 2PI6A 1BF2A 2ZIDA 1HJQA 3LPFA 3WQ8A 2EEXA 4CN6A 3W24A 1H2JA 1KCKA 3FXYA 5A6JA 1NOUA 3ZQ9A 3OBAA 4MAVA 3GM8A 1JZ5A 4MJ4A 4GZIA 1ZBWA 3N04A 3WEMA 4B3KA 1GQJA 5ECUA 1GOIA 1QI3A 1PX8A 1PAMA 4S3KA 3WFLA 4ATDA 2W92A 4PMDA 3EDKA 3WF0A 4XZBA 3SCWA 7A3HA 1RH9A 2FDMA 3KL5A 1VRXA 3BAJA 4YHGA 5JBDA 3F4VA 5M17A 1JZ2A 4UR9A 1US2A 1HJWA 1NOFA 5AYBA 9CGTA 1CZ1A 3SCTA 1W9PA 3NIYA 1JZ8A 1WDQA 5CGMA 1JYXA 5A95A 1GCYA 1UHVA 1DHKA 4JL2A 3VGBA 4PTXA 4DUXA 3DHPA 1KGUA 4D1IA 1K6AA 4PMOA 2ZUMA 4XV0A 1BG4A 2VT0A 3WDIA 4OZOA 5IFPA 2FH8A 3ZJ6A 4W85A 4UQCA 1YQ2A 3VOCA 2JEPA 3PBGA 1TE1A 3G6MA 3WSUA 2XFRA 3IK2A 2J47A 2DSUA 1VFOA 2WZEA 2XM1A 3VDHA 2WVUA 2XVGA 2DSVA 1HIZA 4HA4A 1EIBA 1ISXA 1HP5A 4GZEA 4BF7A 4TVUA 4W5ZA 1VEMA 4B9YA 2X0HA 3M6DA 4L4OA 3WD0A 2XVPA 4B3LA 2DT3A 3A6OA 2OSWA 1BYBA 3SIMA 1LF1A 3IANA 1ZBVA 4FLRA 1OBAA 5AC4A 2WMIB 3BAXA 4X0NA 4B15A 1GQIA 1EO7A 1EHNA 1M7XA 3WMBA 1HXJA 5IHSA 4D6GA 1WZLA 1UYQA 5EMYA 2JFEX 2GSJA 1V6UA 3VD7A 1WCGA 1A47A 2Z1KA 3EDFA 4M24A 5D9PA 4CKQA 1PJ9A 1TG7A 2DGAA 4MB5A 3RDKA 1GQKA 5BXSA 1KGWA 2CNCA 3PZTA 2D0HA 4R27A 3EBVA 1J10A 1XYZA 2YL5A 2X09A 4Z2GA 2VX4A 1ISZA 4BS0A 1E4NA 5CPSA 3SCPA 1NWUA 1E6NA 4NSBA 4CGTA 3ZJ7A 3APGA 3DC0A 1HKMA 3SUWA 2Q8XA 2VCCA 1PX4A 2VR5A 1UKTA 1BHGA 4QCEA 3F5LA 2HVMA 4OJYA 1JI2A 1CGTA 4ZFMA 5CZKA 1J18A 5A6LA 1OCQA 3MSGA 3NDYA 3QHOA 1R86A 1JI1A 3FAXA 4R5EA 4D72A 2BVTA 2YDQA 4NZCA 4AZCA 1FHDA 3VINA 1HJXA 1UWTA 4GQRA 2MANA 1D3CA 5E0CA 1W1TA 4N0RA 1JZ4A 4MB1A 5I79A 3U57A 4PCTA 4DWSA 2NT1A 1OIMA 1LG2A 3EDJA 1G0CA 3VNYA 3VIOA 3VIMA 4E8CA 2EPNA 2J7BA 4J3WA 3GXIA 1H3GA 4MDPA 1EO5A 1MXDA 2ZUNA 3K1DA 3CMGA 1HT6A 3ZR6A 3T08A 5E9AA 3T09A 1AQ0A 1CDGA 4Z2IA 1LWHA 3TONA 4HMCA 3VMPA 1Z32X 5F7UA 5D9MA 2D0GA 3AIWA 4MNJA 3RO8A 1GOQA 4AC1X 4MB4A 1AVAA 4QLKA 2WMGA 1GOMA 4DWSD 3ARTA 3CH9A 4UFHA 2NT0A 3MV01 3VVGA 1E6RA 4M8UA 1JIBA 1XHGA 1R7AA 1UKSA 1JDAA 3BMVA 1D2KA 2Z1SA 1QW8A 2D1ZA 2WC7A 1ZL1A 2O9OA 1R7OA 4WKFA 3AROA 1W3HA 1GOOA 4PSPA 4CVWA 2CBIA 3WFZA 2E4TA 2WBKA 3RM8A 1V3JA 3UETA 1W9VA 1EXPA 3JUGA 3WY1A 1E6PA 3VDCA 5M5DA 1M03A 3NJ3A 1OM0A 4ZXOA 5ABHA 4RE4A 3SCSA 1TMQA 4UOZA 5I6SA 5A94A 3AMDA 4XB3A 3K4DA 1N82A 3MMUA 4Z2JA 4MADA 4AD3A 1ITXA 2O9PA 3CHFA 1UKPA 1EH9A 4S3JA 1UR8A 2J7DA 1FH7A 1QI5A 1QNPA 3SUUA 3VIPA 2BFGA 4JFUA 4M56A 1UD4A 3FHQA 6A3HA 2VZOA 4M1RA 3A4AA 3CHEA 4QDMA 1HVQA 3FY1A 4UQ9A 2VTFA 1EDTA 2Y8KA 4GPNA 4P7RA 2GJPA 1NQ6A 4H2CA 4D6DA 3PHAA 2DIJA 2BVDA 4A4AA 4U5KA 1NARA 1E70M 3VMNA 1CGWA 3G6LA 4L4PA 5FKYA 3ARVA 4CCDA 2CITA 5HBFA 3CTTA 4WJXA 2WHJA 3WUBA 4OOZA 3FAWA 3RIKA 1JD7A 2WZHA 5I2UA 5CQ1A 2YL8A 3WQ5A 3CZLA 3ZT6A 2BY2A 4AD0A 2Y8VA 3VGDA 1W3LA 5LA0A 1E6QM 3AFBA 4X0VA 3CHDA 3VKKA 4LXFA 3BSGA 3DYMA 1DWIM 2ZXDA 5KEZA 2D23A 1E40A 1UR0A 2CESA 1ECEA 2VZUA 1LL7A 3MSDA 3WN6A 1JD9A 1UR1A 1ZS2A 4UQAA 3WKZA 5JBEA 4PUDA 3CGTA 1QOXA 4CD6A 3FHAA 1V3MA 3T0BA 2XIIA 2WVVB 4CU6A 4FLSA 4C7GA 4A3YA 3CZ8A 3T0AA 3GXDA 1QPKA 4Q7NA 2YDRA 3BAYA 3I3DA 3IAPA 2FGZA 1MW3A 2QLYA 1CNVA 1V03A 4J7RA 2DSZA 3WQWA 2YJQA 2PWGA 2WHLA 3F5KA 4JFWA 4AWEA 2OWCA 1VENA 1CXFA 1Q6EA 3SCRA 1RP8A 3AJ7A 3B9DA 1E71M 1J0IA 1BAGA 2XJ7A 2W91A 1BPLB 4XX6A 4D6IA 3EYPA 3AS2A 3PTKA 5CLTA 3VD4A 5E70A 3QOMA 1QNSA 1V0MA 1M53A 3VIIA 2YL6A 1BVZA 2WMKA 1ZB5A 5EB8A 3ZM8A 4FLOA 1ZJAA 4YN5A 3GXMA 5FD0A 3N1AA 2WSPA 3WEOA 2CERA 4J3VA 5IXEA 1UD6A 2E8YA 3PZOA 5ABFA 5CLWA 4OBRA 3VD3A 5BXTA 3AZTA 4CN1A 1HKKA 2CETA 3VIHA 1H41A 5EBAA 1LL4A 2ZXAA 4AXNA 1JAKA 2E9MA 3CPUA 2PC8A 3S2CA 5FL1A 3AIVA 3MV11 4AZ6A 1JYVA 2A3CA 2E40A 2UY4A 4LYPA 5HPOA 4PMVA 1QI4A 1JZ3A 1CENA 1B3YA 2C7FA 2CPUA 3W29A 1JF6A 4H8UA 5HDRA 1B0IA 2WKLA 1VEOA 1MW0A 1HX0A 3AMCA 3HMCA 3UR8A 5GPRA 3RMEA 4H41A 2EPKX 3WQVA 8CGTA 3BAIA 4IM4A 3B8SA 1C91A 1BQCA 4HOWA 1TZ7A 4P7QA 3A3HA 3AHYA 3CLWA 1X1NA 1GZJA 4JFSA 3AXIA 5GQBA 1KXVA 1TA3B 3GNRA 1WDSA 2AMGA 3CZKA 5C70A 3L4YA 3EDDA 2YA1A 3TTOA 1E73M 2J75A 3WUEA 1W9DM 1EDGA 2J77A 2XG9A 3SCOA 2XVLA 3VM7A 2BHUA 1GOWA 3N17A 1CXEA 1JZ7A 3BSHA 4TTGA 1H4PA 2OYMA 2ZOXA 1WE5A 4BQ2A 1B3XA 2WCSA 3VIFA 2OLHA 5I23A 1GORA 3KWXA 5BWFA 2QV4A 3EMCA 2GJRA 3CUIA 1CECA 1V6VA 3WELA 3VGFA 3SCNA 1E1FA 4V28A 2BV9A 1L8NA 2QPUA 2PWFA 8A3HA 2VI0A 4E4PA 3AHTA 4U2ZA 4AZGA 3WD4A 1VIWA 3OLIA 1GJWA 1ISYA 1QNOA 2GDUA 1E5JA 2V38A 1H0GA 4AD4A 4JAWA 4PMRA 4J27A 3TTSA 1GVYA 1PPIA 1HKIA 5CPQA 3I3EA 5A2BA 2W62A 4MNMA 3L2MA 2WMIA 3WNKA 1X6LA 5ABEA 2FHBA 3ALGA 2ZUTA 1IV8A 4LYRA 2RGMA 1C8QA 1V0NA 1WAWA 3CUJA 4W7UA 3GXFA 1NM9A 1JF5A 3N9KA 3GH7A 2VRQA 1CYGA 3WL1A 1H0IA 3CZGA 4U33A 4BQ5A 2O92A 1HN1A 1MYRA 1E1EA 3NSXA 4GIAA 4UOQA 1CXIA 3AMGA 3ZIZA 1JAEA 1Q6DA 3VGEA 1XH1A 2GJXA 1HVXA 2YA2A 1Q6GA 3GBDA 3T2OA 1BSIA 1TVNA 2FH6A 5A8NA 2DDXA 3MUY1 4HA1A 4M81A 4YPJA 4EE9A 2UY5A 3QHNA 1X6NA 3OIHA 1E0WA 2GFTA 4AIUA 2ZWYA 1JXKA 4TX6A 1UWRA 2CIPA 4Z2HA 4N42A 1YHTA 1G9HA 2Y24A 5E6YA 3CBWA 3PZIA 1W1YA 3QGVA 3AI0A 4PMNA 5FOOA 3VM5A 3HJEA 1UD8A 3AQUA 3PZGA 3AIUA 1DWGM 2EXOA 3MANA 1UKQA 3AXHA 2FHFA 3UG4A 4DUWA 2G4FA 1XCXA 2VX5A 4J3TA 3AOFA 5BRPA 1V3HA 1E43A 3BC9A 1V3LA 4W5UA 5HPCA 5AC5A 1QBBA 3AMLA 2WVTA 1CIUA 1ISWA 1SR0A 1UG6A 1WNOA 1P6WA 2DT1A 3OG2A 2VNCA 3W4RA 2A3EA 2XTKA 3MUZ1 3WNPA 2WMJA 3D3AA 4BZYA 2BHZA 2BXYA 3A4WA 2GK1B 1I1WA 3WQ4A 3OLDA 2VJXA 2XGBA 2VMFA 1KGXA 2X0YA 4F9JA 1J01A 2D0FA 2WWCA 2YL9A 1NP0A 1SMDA 3L4WA 4D6FA 3WDQA 3GH5A 3AS1A 4UQDA 5I24A 1M01A 2G3MA 3L4XA 4NRRA 1UWUA 2C0HA 1K9FA 4GQQA 1DWFM 2VRJA 2WC3A 1US3A 1UZ1A 3ECQA 3ZJ8A 1DEDA 1HNYA 4W93A 3DECA 3MUAA 1H5VA 3THCA 5IDIA 1V6XA 3OGVA 3PN8A 1CPUA 3ARUA 3AHXA 2GUYA 1KQZA 1QHZA 1KCLA 3N11A 4HZ8A 2F61A 5E09A 2ESCA 1E6XM 2Y2WA 2E0PA 2VQUA 4UOJA 1BG9A 4Z2LA 2D3NA 3DYOA 3ARPA 1EDQA 2V3FA 1KWKA 4OIFA 2VZTA 3BXWA 1WB0A 1IZJA 5IHRA 4D1JA 1JFXA 3QHMA 4JKKA 4UNIA 3K46A 1E0VA 2DPEA 1MFVA 4CD5A 5IFTA 1UH2A 3WDJA 3WNMA 1E72M 3AHZA 3KE0A 3BH4A 3W0KA 3IAQA 2WCAA 1MWOA 4BA0A 2J79A 2XGIA 3WDPP 1XV8A 1SMAA 4PBGA 3K8LA 1OIFA 2WC4A 1VFUA 2V3DA 3POCA 2NSXA 3UCQA 1XSJA 2WYSA 2JEQA 1K9DA 3K8KA 1GONA 4MNLA 2VL4A 3W6LA 3ARXA 3GH4A 4TVDA 1CEOA 4ACZB 4U3AA 4JFVA 1WDRA 4UZUA 1J9YA 4F66A 1UD3A 1CWYA 1I75A 3SEPA 3VTRA 3M7SA 5CGTA 1DWAM 3CMJA 4UFKA 4GXPA 3TTQA 1MW2A 4P8WA 1S46A 1IT0A 2XSAA 5CXPA 1KXTA 3AICA 1LJYA 5JIPA 1EOKA 4D6EA 1TFVA 1W32A 3MS8A 4NI3A 5ABGA 4FLQA 2PBGA 1HL8A 3GYCA 2BXZA 3ZSTA 4LGXA 3OB8A 1RD6A 1NWRA 1XYFA 1TUXA 4UFMA 3PZMA 1HJVA 4FMVA 1E4MM 1LWJA 2WMFA 4B9ZA 1VFFA 1SYTA 4Y7EA 1WZKA 2W5FA 5A6KA 1V3IA 4UQBA 1DTUA 1OT2A 1Q4NX 4PMYA 2EBNA 3LMYA 3ZOAA 3RCNA 1XSIA 4HP5A 1GW1A 1PIGA 4CD7A 2PWEA 1QHOA 4GINA 2AAAA 5HNNA 3UG3A 4J3UA 1FH8A 4DUVA 1V02E 3J7HA 3BLKA 4DM2A 4W8AA 3WDRA 3ZT7A 1FA2A 1VJSA 4GI9A 6TAAA 3WF1A 1D7FA 2PB1A 3CUHA 4PMQA 3WMSA 3GTNA 1FHLA 3ARQA 3T2QA 3THDA 2JF6A 4P7LA 1F4HA 1MXGA 1CXHA 1GVIA 3K8MA 4PTMA 1BTCA 4MB3A 3VMOA 2IXUA 1JNDA 7TAAA 2D2OA 1O7AA 2A3BA 1V02A 1UH4A 3ZR5A 4DWSB 5A8PA 1PZ2A 5A2AA 1NWTA 1XC6A 2D3LA 3AS3A 1UQYA 2EPOA 1B3ZA 4AZ7A 4HA3A 1LL6A 1C7TA 2J74A 3U5YA 1UWIA 2J62A 1HKJA 3WNLA 5A8MA 3TA9A 4LQ1A 3N15A 3W6MA 4AISA 4IISA 4AEFA 2WPGA 4CN4A 3NDZA 4LPCA 3AHVA 3T0DA 4ATLA 4QLJA 4W89A 1L0PA 5AYIA 2ZUSA 1E4IA 5DO8A 3POHA 2W67A 2W63A 1XD1A 3BCDA 1W9XA 3CZEA 4CCCA 1WZMA 5JUVA 1DP0A 2C8NA 3AIRA 1GUVA 2EQDA 1KXHA 4FF5A 4PMZA 3WH5A 1GNXA 1KB3A 2D24A 4DWSC 2B31A 2YLAA 4TX8A 1AQHA 1JYWA 3W37A 3EMZA 1MW1A 2CHNA 2OSYA 1UR9A 1ZJBA 1QW9A 1TR1A 1EQPA 4TTUA 2W4XA 1W1VA 3O9NA 2FHCA 4P7NA 4KRTA 1W3KA 2XVNA 5CG0A 2G8ZA 2YA0A 3NSMA 2VZVA 2G3NA 4GZJA 3VD5A 4LX4A 1GHSA 4H7VA 1ZBKA 2TAAA 4MTVA 3W27A 1KFWA 4JL1A 4BQ3A 1NP2A 4ML4A 1OINA 1WPCA 1SFSA 3BMWA 3KZSA 1E0XA 2WK2A 2J4GA 1ESWA 1J0KA 4AD2A 1KWGA 4EKJA 3B9AA 1B9ZA 2EO7A 1OD8A 2V3GA 4QP0A 3ZJKA 5AY7A 1H11A 1KXQA 4WKAA 2BHYA 1V3KA 1W91A 3WUGA 4TUFA 1OGBA 2UY2A 2WAGA 4W7WA 1KR0A 4UCFA 4P8VA 1C8XA 2WHKA 2D20A 1QNRA 3VIGA 3VPLA 3M46A 2DEPA 4QLLA 3VGHA 1VBRA 1FFQA 3W53A 1MQRA 2RGLA 3TOPA 4PCSA 4EAMA 1E15A 4B16A 3GNPA 4GO9A 1BLIA 4UQEA 1XH0A 1JG9A 4Z2KA 4IPLA 4LYQA 4PTVA 4GI8A 4W8BA 1G01A 3OGSA 4GO8A 5A6AA 4DM1A 3PTMA 5FCZA 4W88A 5M03A 3II1A 2EPMX 4JIEA 1FH9A 4P8XA 2O9RA 5A8QA 3VNZA 1BYCA 5DT7A 3ZT5A 4WSJA 3SURA 2ZUUA 1A3HA 2XM2A 1UD5A 2HISA 4URIA 5I78A 4AZ5A 1W2VA 4OUEA 3W38A 4CD8A 3W82A 4M29A 1GPFA 2PBOA 3U7VA 3W81A 4KWUA 4WKHA 2CKSA 2W66A 1KR1A 4U31A 2WZIA 4AZIA 5ABFB 2WVSA 2V5CA 2GK1A 1FP9A 4PUEA 1XH2A 3WBEA 5HXMA 1PZ3A 4CD4A 3WMCA 3RM9A 3WH8A 1LLOA 4F8XA 4UFJA 3WBAA 1HP4A 3KL3A 2QF8A 1J0HA 2ZX6A 3AIBA 2WNWA 2BY3A 1ZBCA 2X8RA 1B90A
chains in the Genus database with same CATH superfamily
2QJJA 1US0A 4R3UA 3UR5A 3R94A 3D3FA 4Z0JA 2ZUVA 3WK2A 1Q63A 1AD4A 4JHZA 3D6NA 4MKVA 3CO4A 4QQUA 5E0FA 3OLEA 2FPYA 5CG7A 2DUZA 4JYFA 4HYWA 1HJSA 4QE5A 4DJEC 3SM0A 2ZTKA 4GKTA 3RJYA 1TVLA 3I68A 5HOSA 3PZ9A 4W84A 3L4ZA 5C7VA 5C71A 3KBVA 4W7VA 2ZA2A 4GMEA 3KRSA 3FLUA 4NILA 1K9EA 1C7SA 3NR0A 2ODOA 3H2NA 3KM8A 5REQB 3GHTA 3WG6A 2ACUA 3QN3A 3R25A 4J3SA 1OHLA 3NGFA 1FKXA 4UTWA 5PTDA 3TP4A 3E5PA 1Y5WA 2PE4A 3OZOA 2A3AA 4FK9A 5AHIA 3M0YA 1XCWA 3OLGA 2PRHA 3T40A 1R38A 5EGRA 1SZGA 4WSKA 3RCYA 4OBSA 1LQ2A 3OA5A 4BR1A 5A69A 3TSMA 3DOPA 3EXSA 2DT2A 4HPHA 4GG9A 3GHRA 2E3ZA 1L6WA 2HPMA 2FTPA 5CSRA 4PL2A 4AWSA 1EA9C 5U7SA 1O5QA 2VM8A 4AMCA 2CCRA 2VO5A 1CBGA 3GD6A 3SQSA 2J8GA 3WQCA 3OODA 3SN1A 3QSTA 1A4LA 4LVDA 1S39A 4IWWA 3W9ZA 5B80A 4RPQA 3TMLA 1IWPA 3NZ1A 3MO7A 5GJMA 3UPWA 3UNDA 2AOSA 6TIMA 2WCGA 3ARWA 1LORA 4HSHA 1IXNA 4JFTA 3NQGA 2I57A 5DX7A 4CQBA 3F4CA 1W31A 3WL0A 2G97A 1C8YA 4ZOBA 3SUSA 1M04A 1J0YA 4E8DA 2AL1A 4WEVX 3S47A 2NQJA 1KC7A 3BSMA 2ZFAA 4LBUA 3WF2A 3BDKA 1A5CA 5AFDA 3KOZA 1C90A 1BEUA 4C5ZA 2QCEA 3W7IA 4X63A 3EWWA 3GDTA 3G3DA 4QEEA 1V08A 2C1GA 3W6YA 4RX0A 4A3HA 5C2CA 3T81A 3ZO9A 4J5NA 2OKTA 1QUMA 1YXYA 2XYLA 1EX1A 1RVKA 1YDVA 4TU1A 1IXQA 5KTLA 3ARSA 5T8GA 3K4WA 3TIMA 1DQUA 2XSBA 4YTSA 2F6KA 4D6CA 1JGMA 3P8JA 4XUYA 1ZFJA 1CGXA 3IJ8A 2JF7A 4MPKA 1Q6FA 2W61A 5D9OA 1XD0A 3GDKA 5FJPA 1V6WA 3H4WA 4WDWA 4KEMA 1QI0A 1EJ7L 1LLWA 1HJUA 4KWVA 3DENA 1P0DA 4H9YA 2ZX7A 3VNJA 4UFLA 1V51A 3AZRA 4WDXA 3C8FA 1UP3A 1OFBA 3KL0A 3DKLA 4KEUA 4FR6A 1VAHA 2DSKA 4CUCA 2DZVA 4U5IA 3VILA 2J6XA 4IUGA 2O9TA 4LNYA 1JDCA 2J7FA 1R87A 4FX8A 4R53A 5CSYA 2V5DA 3O3RA 1IXOA 4Q8OA 1UUMA 3QOKA 4GABA 2NUYA 3V36A 2CLMA 3WENA 4U2YA 1JQVA 2C0AA 4WUIA 5CJ5A 2VFFA 3NWRA 4NJKA 5DCEA 2CLOA 1E1CB 3HPXA 5I7GA 1U30A 1RJPA 2HK0A 1MVYA 4PTWA 2CZ5A 2ZE0A 1RA0A 4GVFA 2P53A 4FXRA 4PN2A 3TTYA 6REQB 2WW5A 3RPMA 2PEVA 1BGGA 3WQ6A 3NZRA 3I7QA 1E3XA 5G2HA 1BVNP 3C6CA 2YDSA 3GG1A 2X1IA 2ZX5A 2WHMA 2ATSA 1MI3A 4NHVA 2A3HA 1IR2A 5EMKA 2G37A 3KBSA 1VLIA 3LHTA 1IXPA 4LCSA 1B2YA 3G1VA 1PZ0A 3B8VA 1XCFA 4RE2A 2GL5A 5D8WA 2VC5A 3WBYA 1UR4A 1UMLA 1SJDA 1WV2A 3CUGA 1GQLA 3W25A 4N4QA 1B30A 2BOGX 4IT1A 4C1NA 1KO0A 3E1F1 3LPGA 3G1AA 1KV8A 3U7BA 3UA4A 3IJ6A 5D2WA 1IEQA 3PJWA 3A3WA 4GXWA 1QPOA 1ODUA 1VJZA 5DFAA 1J6OA 5CZ0A 1MXSA 2YBTA 2IXVA 1NVMA 2GDVA 4TOQA 3UGRA 1AW1A 1HG3A 3QF0A 1H60A 3G0SA 1ZP3A 4V27A 3SCUA 1TPC1 1R8LA 1OSEA 3W1XA 9RUBA 4KERA 4H8HA 1JYNA 2HK1A 3OZYA 2PP3A 3H54A 3BAWA 5A6MA 2TRSA 1IE7C 3Q4DA 5A8GA 1I0DA 5K9DA 3V1HA 5I3FA 3EWBX 1OCNA 1MQQA 4C6QA 6CGTA 1JFHA 1OY0A 4L65A 1GZ1A 4NZFA 4C6OA 5CBJA 3NTYA 1TVPA 3RJXA 1SW0A 3LD5A 3W02A 5FESA 4LUTB 3EDEA 3ANVA 3VIJA 4WR3A 5IOBA 3E49A 3O2LA 4MWAA 3UG5A 4ZE4A 4DYKA 1CXKA 1TJ1A 1G69A 2FVMA 1FFRA 4F9DA 2DUXA 5BOOA 4KCVA 2J13A 3HU7A 3BAKA 4LT9A 3MDWA 2J25A 5I5RA 2VRKA 4FIQA 3C0QA 1W0MA 1XLJA 2WQDA 3S9YA 4FPSA 2EJ1A 5LXEA 3T55A 1QT1A 5A3HA 1F8MA 1UQZA 3HGJA 4MWAD 4DVOA 5JBFA 1EPVA 1E3ZA 3S1XA 4IX2A 4EK7A 5A6SA 1O6IA 5BZAA 1KM6A 3TYBA 5MHBA 1FWSA 1VC4A 2Z0IA 3SB0A 2QCDB 2X2YA 1YEYA 8XIAA 4M3PA 4OTKA 5I3DA 3GK0A 1Q7MA 1H09A 4DRSA 5LYRA 2IKGA 4O54A 2V2HA 2WANA 1TWIA 3PJUA 4LVFA 1SO5A 3VIKA 2I16A 3RU8X 4A29A 1NFPA 1LM1A 4LNCA 1UZHA 1E5NA 1YDOA 2F2HA 5BROA 3T4CA 1PE1A 2WSKA 3WJSA 3GO2A 3AU2A 1RPKA 4TV6A 3DKJA 2V2DA 4QDPA 4Q4PA 1H7NA 1PWMA 2BSLA 2BLEA 4XIAA 3HPSA 5A6JA 4TO8A 4WHBA 3DAQA 3OBAA 3ZVHB 1JZ5A 4KIEA 4GZIA 4B3KA 1M65A 1GQJA 4DJFA 3KLLA 4IMDA 1P7TB 3FK4A 3KW3A 1PAMA 1M6JA 2ZDSA 3OYXA 3OU8A 3ES8A 4N6EA 2BGQA 3SQLA 3FA5A 4QGCA 2ZADA 4YHGA 4MJZA 4WOZA 1BWLA 4N7QA 1NOFA 5F1VA 3HGOA 4INFA 4C6FA 2WNNA 5FA5A 1W9PA 1Q6QA 3NIYA 4DJFD 1GCYA 1RXOB 5CPOA 3VGBA 4FR1A 1KGUA 1K6AA 4JTLA 5AHMA 3B8TA 2E09A 4HIBA 3WDIA 2BOEX 5IFPA 3TYAA 2QPXA 2OXNA 4LSBA 1N8FA 1XRTA 3IS4A 1YQ2A 3VOCA 3GRIA 3B8IA 3TR9A 1PS9A 5FJIA 1VFOA 3GY1A 3OOQA 2AAMA 4H9ZA 3DG6A 2XDFA 4HA4A 2HRWA 1ISXA 4C6NA 4QHRA 2G95A 4IQEA 4BF7A 2J9XA 4W5ZA 1VEMA 4P61A 1R3RA 4LUJA 4L4OA 3W84A 1TPWA 2OSWA 3UG8A 5I07A 2A4AA 5T9CE 3SIMA 2HVOA 3IANA 3FS2A 3URNA 1SW7A 5C6MA 4FLRA 2E25A 3T8QA 5AC4A 3BAXA 3CJPA 4B15A 1EO7A 1K7XA 1XJBA 3DFTA 5EKYA 3QGKC 1EHNA 1M7XA 5DY3A 3JVAA 1UYQA 3OA3A 2GSJA 1V6UA 2PGFA 2ZVRA 4B2DA 3VD7A 3GVVA 2Z1KA 4M24A 5D9PA 1TG7A 3RDKA 1OC6A 4O14A 3U2EA 2CNCA 1ONRA 4R27A 4LOCA 3B8WA 4Z2GA 5JXQA 3NO1A 4ZB5A 5CPSA 3LENA 1NWUA 1K8CA 3APYA 1FHVA 4H83A 2RJGA 4CGTA 5K3VA 1FBAA 1VHCA 4YVVA 3SW6A 3VUSA 4XO7A 2R8WA 3QQ1A 4HD5A 3F5LA 2RDWA 4OJYA 1U1HA 1G7VA 3TWBA 3S5ZA 4B2DD 4ZFMA 2D73A 5CZKA 1YRRA 3RAOA 3MSGA 3NDYA 3MHFA 3QHOA 5BMWA 2YDQA 4NZCA 4XO6A 2TSYA 1NEYA 1E1CA 1OYAA 1POJA 3CK5A 4GQRA 3TC3A 5LNUA 2OCZA 3O6DA 4QS5A 2PDBA 5I79A 5D2XA 1OIMA 3ITTA 6REQA 3VIMA 3LXCA 1H3GA 3MBDA 4S23A 2QJIA 1RQHA 3TMQA 1K03A 3T09A 1AQ0A 1CDGA 1TV8A 1LWHA 2G96A 1YXCA 4AIBA 3N29A 1TJRA 2GYIA 5D9MA 3BURA 3AIWA 3RO8A 4AC1X 4Y8EA 3RN6A 4JOMA 2XGZA 1TWSA 3VOGA 4EACA 1XHGA 1R7AA 3LB0A 1UKSA 5HATA 1EUNA 5K2ZA 1JDFA 1D2KA 2XIMA 5LNVA 1R7OA 3AROA 4GI4A 3ZLFA 1XUZA 2HTMA 2E4TA 2PU0A 1H63A 1V3JA 3T6CA 1W9VA 3UETA 1EXPA 3NA8A 3WY1A 3I6TA 5M5DA 3DG3A 4WCJA 2I5QA 5ABHA 3BLFA 1WX0A 5A94A 4FEZA 4E8GA 3RCMA 2E5DA 1GG0A 3V7PA 2GZXA 2GSHA 4QM1A 1DTNA 2BFGA 1JULA 1XIHA 3SJ3A 3UXIA 5DMMA 4HHMA 3A4AA 5FF7A 4R33A 4R85A 3GAKA 3E0FA 4NNCA 2VTFA 4TV5A 1EDTA 5J5DA 2SFPA 2NVAA 4P7RA 2GJPA 6XIAA 4D6DA 1UMYA 3E0LA 3PHAA 4EVZA 2NQZA 1TRIA 1R2TA 1NARA 1SR9A 3VMNA 3TJ4A 3AYTA 2YYTA 4L4PA 3ARVA 1DXFA 3CTTA 2Y7DA 4K8EA 1IYXA 1T41A 3BL3A 3G8EA 1REQB 3K1GA 4L7ZA 2H90A 2YL8A 3DI0A 3H12A 3CAWA 3VKKA 2ALRA 3UY7A 3SO7A 4E5TA 3R43A 1XYAA 5KEZA 2D23A 1YTEA 3IACA 3WJWA 5G4WA 3PUOA 1K4HA 5DELA 5FF0A 1QOXA 2PDXA 3FHAA 1DE6A 1V3MA 1UCWA 1U22A 3B40A 1AZ1A 1P0EA 5GJNA 1FKWA 4A3YA 2ISDA 5HQEA 4O52A 4Q7NA 3M0VA 3IAPA 2W9MA 2PAJA 4JQ1A 2QLYA 1XIBA 2DSZA 3WQWA 2WHLA 4JFWA 3W01A 3BG3A 2DORA 1XICA 3B9DA 3AJ7A 1E71M 4AC7C 3U48A 3DXIA 3KCJA 4D8LA 1BPLB 2PWVA 1DE5A 3FDGA 3DG7A 2QCDA 3AS2A 3PTKA 5CLTA 3VD4A 4H4IA 2OU4A 2OODA 5E70A 4YCPA 2AMXA 1V0MA 1XLGA 1FDYA 2NLIA 5DN1A 4L56A 3UZWA 3N1AA 2PP1A 3N6HA 1UD6A 1PTDA 3PZOA 2OEMA 4L1GA 1OFEA 3DFPA 1ALDA 4GFSA 1EWDA 3AZTA 4CN1A 1V77A 2CETA 4IFKA 2ZXAA 3KWSA 4IGSA 5I3HA 1TO3A 2R6OA 4QRNA 3IJLA 4AZ6A 2A3CA 3EOOA 4Q8PA 1PWLA 1CENA 5G2IA 5AHNA 4QR6A 3G1SA 4KCWA 3W29A 3FEQA 5HDRA 2QDGA 1B0IA 3SZ8A 2GPTA 3HMCA 1P7TA 3UR8A 4NKCA 4DYEA 2YCIX 2P5NA 1R9YA 5LIUX 3WQVA 1Q6OA 3P6LA 3SGZA 4IM4A 4HOWA 1TZ7A 3EAUA 3HB9A 3I65A 4JFSA 1X1NA 1GZJA 1RPXA 3LXAA 3B3DA 4NNBA 1TA3B 2BGNE 5C70A 4ASTA 4MUPA 1E73M 1F9CA 2J75A 4Z08A 2C79A 4G9PA 2XG9A 3KVKA 3TAKA 1ZALA 1XWYA 3KS5A 3W1NA 4LH8A 3N17A 5LIXX 1H4PA 4DJDC 4BQ2A 1B3XA 2F84A 3VIFA 4F48A 4DPQA 1TPFA 2GGGA 2VWTA 1RSCA 1K4GA 1W5PA 4ZO6A 5G1TA 4NXSA 1DQXA 1EP3A 5U4NA 4B5UA 2QR6A 2PWFA 1BVWA 4NXKA 1FWJC 1VIWA 2P8BA 1ISYA 3CEUA 2V38A 3HPZA 1H0GA 3H7VA 3WLJA 4JAWA 5HWNA 4WX2A 5DCBA 1GVYA 2W79A 4I9MA 1FWNA 5KETA 2X7VA 1PHWA 1X6LA 5ABEA 3LM7A 3PM6A 3SN0A 1NSJA 4GVHA 1OZMA 3U2CA 4PUMA 4Q6JA 1SJBA 2RGMA 1WAWA 3GXFA 1ZHAA 1UOZA 4IIGA 1JF5A 2VRQA 1CYGA 1OX4A 1WDDA 3WL1A 4U33A 4XZ9A 1MYRA 2PC4A 4GIAA 3AMGA 3ZIZA 1JAEA 2CFFA 3EOLA 2YA2A 3KTSA 3GBDA 3OYZA 1XFBA 1BSIA 1SSGA 2FH6A 5A8NA 2DDXA 4M81A 4I9TA 4ICMA 3W83A 3OHMB 3TW7A 4AIUA 3NQ2A 5HQLA 4M19A 1JVNA 3GB6A 3VFCA 4DELA 3AI0A 4N4PA 5FOOA 4Y9AA 4IIBA 1UD8A 5CJNA 3AQUA 2DP3A 2EXOA 2XN1A 4DO4A 1UKQA 4DUWA 1XCXA 3URQA 3AOFA 2J9YA 2RDXA 1Q6LA 1QW7A 3ABXA 2Q71A 3W1LA 1V3LA 2PMQA 3PUDA 3MP5A 3OTRA 4I5XA 1TTQA 1PDYA 4L6DA 3UBPC 3W4RA 3BJFA 3PANA 2A85A 5B7YA 2WMJA 3D3AA 3GAYA 2BXYA 3L66A 4IMFA 2PWUA 2VJXA 3OLDA 3WQ4A 2VMFA 4D8ZA 1KGXA 3B03A 2X0YA 4KPLA 1YKWA 5D30A 2E68A 3FDKA 3R0KA 1WAUA 1KM2A 3L4WA 3AS1A 2P88A 5I24A 1M01A 1SO3A 3PF3A 5E0KA 3U9IA 2G3MA 5TBOA 5IBXC 1JUBA 3M64A 1RQEA 3R0DA 4S2BA 4Q4QA 3QR0A 3VNKA 5DMNA 1WKFA 3ECQA 3ZJ8A 4W93A 3DECA 4JTRA 3THCA 1V6XA 3ENLA 4LAUA 4X2PA 5C54A 4NU7A 1XUUA 5HMEA 5E09A 5C9XA 4UOJA 3H23A 3EX3A 1XYBA 5KMYA 2V3FA 2VZTA 2DVXA 5IHRA 3V4BA 4D1JA 1VRDA 1TREA 1JFXA 4JKKA 1LZOA 4UNIA 3QY6A 1E0VA 4NAEB 4HNOA 3TQVA 1UH2A 1B9BA 3KE0A 4O53A 1SGJA 1DJZA 1MWOA 1O12A 1TE6A 4N9EA 4BEUA 2XGIA 1X7IA 1C9DA 1XPGA 2Z7GA 3OVQA 4CNOA 4O1CA 1OIFA 4H3DA 2V3DA 2NSXA 3UCQA 1AH0A 3WQGA 3P5ZA 3TCEA 3W6LA 3ARXA 3PFRA 4ACZB 2GVJA 3GDMA 2PZNA 1J9YA 4F66A 3S4TA 1QWKA 5AOUA 3M7SA 4U10A 5F2MA 3N6QA 1UZDA 3CMFA 4UFKA 4RW5A 2A6LA 5DXXA 2Q02A 3L9CA 3G1HA 4HCDA 5CC3A 1EJRC 4GJJA 3SRHA 1CB2A 1X1ZA 3ITGA 8TIMA 5JIPA 2VC7A 1TFVA 1AW2A 4UC5A 3MCOA 2NWRA 1PV8A 2PBGA 4MY1A 3C2EA 3ZSTA 1A5LC 4LGXA 3OB8A 1XYFA 1TUXA 4IGHA 4UFMA 3U4AA 1HJVA 4FMVA 4B9ZA 4Y7EA 1QAPA 3H2AA 2O7QA 1MO0A 2PDWA 4JIRA 1V3IA 2ZBTA 4UQBA 3KRUA 3FVMA 3LMYA 2B0MA 4I90A 3ZOAA 1OCJA 4CEUC 2HSAA 1GW1A 1WYIA 3CU2A 1RY8A 3GS6A 4DUVA 3WK0A 2E28A 4HK7A 3STEA 4DBDA 3BLKA 3WDRA 3VOFA 4BEQA 4AUBA 4PMQA 3N34A 3WMSA 2TYSA 3ARQA 3U6WA 1JRBA 3RLHA 2JGYA 5BMXA 5MKGB 3V3WA 4J4KA 1CXHA 4LVBA 1GVIA 3K8MA 3PSWA 2IXUA 1JNDA 2D2OA 1O7AA 3M5VA 3S3GA 3ZR5A 7ENLA 2Z29A 1KBJA 1XBYA 1S5WA 1WXJA 4I3GA 4UTTC 4DWSB 1KFKA 3NXLA 4Q7BA 4LAKA 1XC6A 4F2TA 2D3LA 1VBGA 1AQFA 1XF0A 4IIEA 1UQYA 2YB1A 3DEQA 3KX6A 1Z44A 1LL6A 1C7TA 3GU1A 1E9IA 1E51A 3BQ5A 3OPSA 2FMNA 3GC4A 3WNLA 2GQ9A 4RUBA 5A8MA 4ZQMA 3K2GA 3R6IA 4ERAA 4C1KA 3CC1A 3FFSA 2ABAA 3U2ZA 1SZEA 1YW1A 4AX7A 3POHA 2JQXA 4N9DA 4LS0A 3KFTA 5JVLA 5JUVA 2C8NA 1LBLA 4XBJA 3AIRA 4HGXA 1CI1A 1SFLA 1KD0A 4PMZA 2XH4A 1VFHA 4LALA 3BTNA 3GIPA 1GNXA 1RALA 3EA1A 1M3UA 3W37A 2Q09A 3EMZA 1QPRA 2PGEA 3OVRA 4FXFA 1RK6A 3LRKA 1Q3NA 1VPQA 3MBFA 4JIIX 1J93A 4JQ3A 2DV0A 3RO6A 4GE8A 4XVDA 3B8UA 1DJHA 3DN5A 4KFPA 4BI5A 3LQLA 1X96A 3AJXA 1W3KA 1HUVA 5CG0A 3RFAA 2MUCA 2VZVA 4MY9A 2QCNA 3SBFA 3VD5A 4H7VA 4MTVA 2TAAA 5FEZA 1NP2A 1X97A 4A35A 1E0XA 3SI9A 1ESWA 1L8PA 4IJRA 3LUTA 3Q58A 4NJIA 2ISFA 1B9ZA 1OD8A 2R24A 1EIXA 1XL9A 5CPLA 3IGHX 4JX5A 1GYNA 3CL8A 2P50A 2BHYA 1DJNA 4V15A 4K37A 3TZFA 1X98A 4NZ5A 1KR0A 1C8XA 1Q66A 3N14A 3BV4A 2OFJA 3WLTA 2PD9A 3LBMA 3NQVA 4IOTA 4HHHA 1LUCB 1MQRA 2HVNA 4AVFA 1TELA 4K38A 4RDZA 3PFMA 4WDTA 3QMRA 4W8BA 3OGSA 3SSJA 2FFCA 4JTGA 1TYGA 1W54A 1I60A 1O60A 4L61A 2C91A 2BVWA 4JN7A 1Y8BA 3VNZA 3KBMA 3QMTA 1T7LA 3ZT5A 5F2LA 2ZUUA 1A3HA 1XDJA 4AZ5A 1W2VA 1T96A 4OUEA 4CD8A 3B0PA 1B57A 3GNXA 4WKHA 2VWSA 2W66A 2DQWA 5CSSA 3GTHA 4AZIA 3VYLA 3BLLA 4Y6GA 1I2PA 2PDPA 1FP9A 4XAYA 2ZE3A 4QAIA 1XH2A 4XUGA 4F8XA 4FOUA 1BRLA 2OB3A 3EZ4A 3NG3A 1B90A 1GOKA 3FNDA 1LP6A 4ZQNA 1E0UA 3NYZA 4QAWA 1XGZA 1FDZA 4W86A 5EMLA 4EANA 4TX9A 2PDQA 2VQTA 2O0TA 3AIQA 3DHUA 3TROA 4X3ZA 2V8ZA 9XIMA 2FGLA 4O28A 1AL8A 4GHRA 1OFPA 2HXUA 3ARZA 3CIWA 4XBKA 3TJIA 2PS2A 3O06A 3RMJA 1FCQA 1KBKA 1LLZA 4UMCA 4M0XA 4HK5A 1RCOB 2G41A 3USBA 5AKQA 1N2VA 4L80A 1MEIA 1YLVA 1O95A 2CXGA 2BMBA 3H21A 5LHFA 4MAZA 2PLJA 2NV2A 2OWWA 1XP3A 3PTQA 4KFOA 2PURA 3D47A 3A47A 4MGGA 3IJIA 1YIXA 4TXEA 1X8CA 1WO2A 4MNKA 1XGEA 4C6PA 3HMJG 4ACZA 1HTIA 4W9TA 3AISA 3HJZA 3GE7A 5AC7A 4IHCA 5AECA 3DYPA 4I9AA 4EXBA 3CIVA 5FL0A 2ZUWA 4JKLA 3GR4A 3NEHA 2OWXA 4LEQA 5FIPA 1UOKA 2A7NA 1KBBA 5DF0A 3KHJA 4LAOA 3B0VC 3AXKA 1MZRA 1JL8A 1OX6A 2QXWA 2EAWA 1QOQA 3OVPA 3JS3A 3PY2A 4QDWA 3SGUA 1NOWA 1BFNA 3RPTA 2F8QA 4E2OA 3URBA 4FALA 3L4VA 4WF7A 2Y7FA 5LA1A 4HT3A 1A53A 3N9SA 1Z41A 3NUKA 1F2JA 4GX8A 2G3IA 3ISIX 5DMYA 2WNQA 1UB3A 2BY1A 3P67A 4C6KA 3UZJA 3MI2A 1E9LA 3WJXA 2QGYA 4BHYA 2R1MA 3UWQA 7PTDA 3PS7A 1Q6CA 1G7UA 3ITLA 1QI2A 3HQNA 2WLYA 2GJXB 1KFCA 1S2WA 2Y1HA 3G1XA 4MF4A 4UTIA 1UR2A 1CGYA 1GQNA 1VPYA 1A0EA 2WO5A 1NH6A 3PZQA 2WZTA 1A5OC 2VCBA 4QROA 2ACSA 1XM3A 2BVYA 1E55A 4FXSA 3RILA 1XLEA 1XINA 3L4TA 4AZBA 3F5JA 2BS9A 2ZX9A 3MVTA 3ABOA 2V69A 4FNPA 3REQB 4HZ6A 2VVNA 1NY1A 2PTWA 5MKGA 3NQBA 1OG6A 2D2HA 3I3BA 3F03K 3M7WA 4DZIA 4N9BA 4H9VA 3VI2A 3QFEA 5CPTA 1XSKA 2FJUB 1ZU8A 3TLQA 5DXYA 1E4LA 3LCXA 1K6WA 2VOTA 4QXIA 1T8QA 3W70A 2GUBA 2XH0A 1UZ4A 2Z2BA 2ZXQA 1U33A 1UROA 2V67A 3GFYA 3RNDA 4Z1YA 2C15A 1TKKA 1W56A 2PDKA 3S2NA 4PRRA 2VX7A 3DIPA 1SO4A 4IL0A 3MMWA 1ADDA 1G4TA 4QITA 1BF6A 2DH2A 4BWLA 4REQA 3ZWSA 3S1UA 1MRAA 4M80A 2OR2A 3W2NA 3VX1A 2G3JA 3VDAA 3LNMA 4DPPA 4A05A 2ZRZA 3GBEA 3TE9A 1XXXA 1SJAA 4EXAA 1WXZA 4GK8A 4RXFA 3V18A 2FB3A 3BJTA 1HFBA 5CZTA 5LIKX 4C6MA 3LV5A 1GJUA 3KP0A 4RZ5A 3QGAC 4GQ0A 5A8OA 1W6TA 2DUAA 4ZXLA 4HNNA 1U2YA 3B9OA 2J24A 3PZUA 3BLPX 1ICSA 3MP4A 2X41A 3H2OA 3A9IA 5I77A 1SU5A 1GJPA 3I4KA 2CKRA 3L2LA 3P82A 4F79A 3OVGA 1DWHM 2X30A 3NDOA 3IJQA 2PTZA 4TMCA 2GUUA 4AZCB 3N2OA 3L5AA 2FIQA 2FZNA 2GGEA 3RM4A 2FYMA 2XFFA 3S6OA 3BQ6A 4IICA 4K36A 2Y5JA 3S6TA 3VK5A 2C19A 3KDNA 3COTA 1RP9A 3EMQA 4GUJA 4AZHA 3GDBA 4Y8FA 2QEZA 4ZE5A 1V0LA 3EX1A 3IWPA 1S1PA 3F2CA 2C13A 2XPKA 4MJMA 3DHFA 5EPDA 3HGRA 4EOUA 4IXXA 4K1GA 1GVOA 4PA8A 4DLMA 1R85A 4RE0A 1ZAJA 2GWNA 4H6EA 3HURA 3TXZA 3L4UA 2E1DA 3EPOA 3R8RA 3FYYA 4M51A 2CLLA 2Z7KA 3EKGA 2BG5A 1M7PA 4UTHA 3R10A 2OX1A 3VC5A 1LUCA 2JIWA 4CQ9A 4UTLA 4GFIA 2OPJA 3AWNA 5C7HA 1N55A 2BOFX 4NNAA 3B9NA 3W1RA 1FOBA 4YJ5A 5DT5A 2JKAA 1X38A 3TDFA 5TNVA 1H7XA 2HMCA 4U3CA 5HR6A 3FSUA 5HNTA 2DY3A 4D6HA 3BCFA 2VZSA 4DBEA 3VE7A 2G50A 4M7TA 2QDDA 3IIVA 4NF7A 3HV8A 2HPIA 3H26A 3MMDA 4M1BA 1I45A 2V5BA 1PEZA 1KA9F 4MJ2A 2WKGA 4UBPC 3H6OA 3MKKA 1P5BA 4NZ1A 4ACYA 3DZ1A 4DJEA 4AD1A 3N73A 3VUPA 5LNRA 3SUTA 4B5NA 3BK0A 4W8LA 3VDGA 3THAA 5AVHA 1D9EA 3QBUA 3FJLA 1WZAA 2YW4A 2H6RA 5FEWA 3IJ9A 1JJKA 5D4YA 2VUYA 1KM4A 1AUSL 2P0OA 2JKEA 3T07A 3M0ZA 3NXFA 3CAKA 3TXVA 2DH3A 1C93A 4J9JA 3UWVA 5FI8A 3HN3A 4HU8A 2QAFA 1SZNA 3DESA 4CQ8A 4J28A 1JPKA 5FF2A 4DJED 5A6BA 2RHGA 3VGGA 2OLAA 2QMJA 2HJPA 3OQ8A 3WUFA 1EZ2A 1ITUA 3B97A 5DY2A 5K9XA 2VURA 3AWOA 1F4AA 4Z1CA 3HQOA 1OWQA 1XDLA 4O4WA 2AGTA 1OK6A 3WLIA 1EHAA 3RRXA 1ODZA 5GNZA 5TD4A 4ILSA 5A6BD 3ZSSA 3WD3A 3OGRA 1CB7B 3GTIA 2Z00A 2GGIA 1DQWA 4AQLA 2CW6A 1XBXA 4RDYA 5FJOA 2ANUA 1EGZA 4JCMA 2WLZA 3LTSA 3ID7A 5FACA 1ENUA 3N2BA 2IS7A 1W5NA 4A21A 3SIZA 2HROA 5DEZA 2XZ7A 1GYLA 2VFGA 1EC7A 1NF7A 3N6JA 3P62A 1CXLA 4C6JA 1B4EA 4HMEA 4TMBA 5HANA 3LI1A 2NXIA 1F6PA 1XIEA 1C92A 3TSDA 4KH2A 1TPB1 3ZVIA 4NT0A 1KM0A 3MKCA 3SR7A 4B5WA 1YE6A 4Y9PA 4DBUA 1PIFA 3FN9A 1CTNA 2ZVIA 3WLMA 1ADSA 1QBAA 1XYMA 3W7HA 3ICJA 1G5AA 2JALA 4AY1A 3LY0A 2VXNA 2E6FA 1K3UA 4JYDA 2PI6A 2ZIDA 2EEXA 4CN6A 1PDZA 3W24A 1YXDA 2O56A 3ZLHA 3KCLA 1NOUA 4MJ4A 3N04A 4LYKA 5B7ZA 5ECUA 1GOIA 1PX8A 3ME3A 1ELSA 3W1AA 4KEZA 3OEXA 3E12A 2W92A 3SCWA 4GNKB 3UZZA 2FDMA 1M7OA 2QQ6A 4H7CA 1VJIA 5M17A 2WKJA 5CCZA 1RA5A 1TV7A 1JZ2A 4UR9A 1US2A 4LS2A 2ATMA 4KWOA 4ZO7A 3SCTA 3EGJA 4JTEA 5TIMA 3T42A 1UP2A 3A5FA 1JZ8A 1WDQA 5CGMA 3WK1A 4JTHA 4AX6A 2C3ZA 2V2CA 2WJEA 4LV4A 1BG4A 3ES7A 1W3IA 4IFOA 2HCVA 2QUTA 4YYCA 4W85A 4UQCA 4UCGA 1DVJA 5TAOA 3TLLA 1TE1A 1TQXA 1AH3A 2J47A 3IK2A 3QZ6A 3VDHA 1I2NA 3PUGA 3TSBA 4NP7A 2EF9A 4Y96A 5TF0A 3AU6A 3S1WA 5H2ZA 4HNVA 1O1HA 1PTAA 4YU1A 2X1TA 1A50A 1LRTA 3M6DA 3M0IA 2DT3A 2YCLB 3A6OA 3HPAA 3KVMA 3WK3A 4JTIA 1LF1A 3QZEA 2HBXA 2Y0FA 1OBAA 4NAFB 4C90A 1Z42A 3TH6A 3NPWA 4XG1A 3WMBA 2A79A 1HXJA 5IHSA 1WZLA 4GUGA 4ZSTA 3UD6A 4IMEA 4WVXA 2JFEX 4DF1A 2VFDA 1DORA 1OZQA 4ECLA 3EDFA 2NQHA 2YFOA 1GQKA 1VYPX 4U28A 3RHGA 2AQWA 5M2FX 1J10A 2X09A 4MZ1A 4JDYA 2QUMA 2OG9A 1A5MC 4IMAA 1E4NA 3W2MA 4RNFA 3APGA 4LEFA 4LUYA 3V5OA 1WKEA 3JU2A 3SUWA 1UKTA 4QCEA 2PPGA 2TODA 3CWHA 1CGTA 5G4HC 3PVFA 1OF6A 3CV2A 1EEXA 2DW7A 5A6LA 3EWYA 1F6YA 4CNNA 3L0NA 1R86A 4D72A 1EC8A 4AZCA 2B81A 1FHDA 2DIKA 1HJXA 1QATA 3C2FA 3BV7A 2C1HA 1UWTA 4YCOA 1YBQB 1SO6A 2Z2AA 1D3CA 5E0CA 4NJJA 1XIIA 2MNRA 5SWUA 4H9TA 3KDOA 4PCTA 2ISSA 3UJEA 4ZQPA 3VIOA 3NPVA 3O6YX 4GCXA 3FCPA 2HE8A 2ZUNA 4NG3A 3LGDA 5FEPA 3K1DA 3CMGA 1GW9A 3BOXA 1W5MA 3TONA 3W7RA 3PBMA 1Z32X 2HDJA 3RPDA 5FAGA 2VFEA 3GW3A 4QLKA 1GOMA 3NO3A 4AY8A 2O7SA 1B5TA 4AY7A 1JIBA 2YXXA 4O0KA 3BMVA 3Q94A 1J2WA 4NASA 4WKFA 5HWMA 3HZ3A 3O07A 4AHPA 3R7MA 4E4FA 3CV1A 1EBGA 3BW4A 3RM8A 3R11A 4H00A 3H2MA 3W71A 4FOKA 3O0FA 2ZDRA 1YNQA 1OM0A 3A24A 3CQ0A 3CWNA 4O17A 4KWSA 1AFSA 2GOUA 2Q6ZA 3L0KA 1TMQA 5I6SA 4K6AA 4F0HA 1YTDA 3AMDA 2GVGA 4Z2JA 2ABBA 1AK5A 1ITXA 2O9PA 4NYUA 3CHFA 1XDMA 2QVNA 2VR2A 5TQLA 3P0XA 1UR8A 2J7DA 4NYYA 5L6UA 4PC8A 5D05A 1FH7A 4YTTA 5FJUA 1ZCOA 4ZFCA 5CH9A 4Z42C 2RKXA 4JFUA 1KFEA 6A3HA 2VZOA 3QYQA 3GNDA 4QDMA 3LMZA 4LBSA 3S1VA 3EB2A 4UQ9A 4I6KA 3BLDA 2Y8KA 1NQ6A 4H2CA 5C9ZA 4A4AA 1XFCA 4U5KA 1CGWA 1PL9A 5HULA 5HBFA 3VOHA 3WUBA 1I4NA 3FAWA 1ICPA 3C86A 2F2KA 4GYKA 1DJQA 2YFNA 5XIAA 4S3CA 1G6CA 3CZLA 4AD0A 2Y8VA 3PK7A 2PRMA 5LA0A 4GQGA 5JU6A 1O4UA 3V0SA 3BSGA 3UQNA 3DYMA 4KIRA 2R91A 1XC4A 2CESA 1ECEA 2VZUA 1RBOB 4W4QA 1ZS2A 4QG6A 1MDLA 3WKZA 5JBEA 4PUDA 4OBTA 1JCNA 1F61A 2XIIA 4CU6A 4M6QA 4Q8UA 3CZ8A 3E9AA 3IEBA 3T0AA 2CZDA 1ZJIA 3R13A 1VFTA 3BAYA 4CNTA 1CNVA 1IEIA 1V03A 1DIEA 4O57A 4J7RA 5EA9A 5C9UA 3F5KA 1VENA 2X0SA 1RP8A 3OZMA 1J0IA 2AQOA 3P84A 4WXYA 3SRFA 3G1FA 5HNRA 3MZ2A 1HKVA 1OX5A 4GIEA 2I9EA 4UMBA 3VIIA 5I00A 1F76A 5EB8A 3ZM8A 4FLOA 1P0BA 3GXMA 2PTXA 5FD0A 3W23A 3VKCA 4J3VA 2ZCGA 1X6UA 2E8YA 3ABQA 5ABFA 1J6PA 4GIRA 4GRSA 3EPMA 5CLWA 2I9UA 2IKHA 4OBRA 3PPFA 2Z2UA 4JR5A 3LRMA 3P7YA 1H41A 4AXNA 1LL4A 1VCVA 4K3ZA 4JBRA 3PJTA 3NQ8A 4DI8A 5FL1A 3PG8A 4RZ4A 5HPOA 4WGXA 4F2BA 2ZC8A 1JZ3A 4FSAA 4GYJA 1HX0A 4X60A 3RMEA 2QDHA 2EPKX 1OABA 4KFNA 3B8SA 1C91A 1BQCA 3O16A 4HA0A 4P7QA 3AHYA 3CLWA 3AXIA 5GQBA 4FI4A 4AVOA 1EP1A 3LERA 1WDSA 4WXZA 3B4UA 3YPIA 1DOSA 1V5XA 2YA1A 1TZZA 1PTGA 2J77A 3ITVA 3GG0A 3SCOA 3NFUA 4YYFA 1J8VA 2BHUA 4AG0A 1CXEA 1JZ7A 3BSHA 2E6DA 4IPIA 4BI7A 3GKFA 2XH7A 2WCSA 4XTIA 2OLHA 5BWFA 2HNEA 3EMCA 1VBJA 2V6AA 2F38A 1V6VA 1XLKA 3QLLA 3WELA 4UXDA 1MUMA 1EFZA 1C8VA 2QPUA 4ICNA 1TV5A 3MPGA 1GJWA 1E5JA 1TV4A 4AD4A 2YCLA 4PMRA 1S2AA 3OBEA 4OQVA 1PPIA 1HKIA 3MJYA 5CPQA 4FA3A 5A2BA 1TZ9A 4MNMA 3L2MA 3WNKA 2QIIA 1VYSX 1HQTA 3GC2A 1NJJA 2J66A 3APTA 3ALGA 2ZUTA 2WSRA 4LYRA 1C8QA 1QK0A 2ISWA 4PTNA 3N9KA 5RUBA 3GH7A 4IL2A 3W1MA 3KTXA 1IR1A 2OEKA 4BF9A 3GYEA 5BOEA 2IQDA 4O15A 3LHWA 3GXPA 4UOQA 5KINA 1HL2A 1S2CA 1NDYA 2PDNA 5H1WA 3MW7A 3VGEA 1T40A 3V5CA 1XH1A 4EF8A 4MWAB 3WJZA 5D02A 1M9HA 1H7RA 1Q6GA 2QT3A 2Y7EA 4JHMA 5AYYA 4HA1A 3MY9A 1VZWA 4YPJA 2FB2A 3LRLA 1X6NA 3OIHA 1E0WA 4DF2A 1R0MA 1ONWA 4NQ1A 4TX6A 1W3TA 4Z2HA 4Q8TA 4ZTYA 2Y24A 5E6YA 3PZIA 1W1YA 3MC5A 4PMNA 3VM5A 1QO5A 4IGNA 3HJEA 3NURA 5D2VA 3U8GA 1TMLA 2X16A 2WM1A 3UG4A 2G4FA 1YBQA 2VX5A 1FWTA 1J96A 2QZRA 3WZ0E 5HPCA 1QBBA 5G2WA 1EJWC 1CIUA 1ISWA 1P0KA 4XKMA 5GJPA 3W73A 2I7GA 3P80A 1IGWA 2HBVA 1JPDX 3WJYA 2A3EA 4AWTA 4G7FA 3P60A 2BHZA 1LCOA 3A4WA 3SQMA 2XGBA 4MKSA 1FWCC 1ZJHA 2FDSA 2DJXA 5H8PA 1JPHA 4ZOAA 1GGOA 3WLLA 3UVIA 3LS9A 4NVTA 1SMDA 3C3NA 3VKBA 3O0KA 4M6PA 4RKAA 3CS2A 1MNZA 4J2MA 2VDGA 1BWKA 3CYVA 1UWUA 4I6VA 3VOJA 4Q7IA 1QASA 1US3A 1EBHA 2WSQA 1DEDA 1HNYA 4F2UA 3MUAA 1H5VA 2Z6IA 3XISA 4IQLA 9XIAA 2F61A 4H6KA 3ORWA 2ESCA 3GR7A 2Y2WA 2E0PA 1S5MA 1X39A 1HGYA 2VQUA 4EF9A 3F4DA 1BG9A 4Z2LA 1G67A 3ARPA 1EDQA 3GHSA 1WB0A 4O1DA 2WSYA 2OQYA 3K46A 3MYOA 2ZRXA 3GR8A 4Q4KA 4MHBA 2BGSA 2QCCA 2QNEA 3ONBA 4Q4RA 3UJ2A 1E72M 3LTYA 3VKDA 1TTIA 4GBDA 5CEWA 1MZHA 4E38A 3IJDA 3WDPP 1KLYA 4US5A 1A5SA 3LGGA 2WYSA 3E2SA 3P2VA 3QTGA 4HVXA 3GH4A 2E1WA 5C55A 1VKFA 2VFHA 4AVNA 1W8GA 2CU0A 1R3WA 4UZUA 3RK8A 3T78A 1EGMA 1CWYA 1FUYA 1I75A 3PJXA 2EKCA 4F0SA 3H4GA 4JQ2A 4A2SA 1DWAM 4JQAA 1H62A 5KSWA 3O7UA 4JEJA 4US5D 2AKZA 3G77A 3TTQA 1MW2A 1E9YB 4LJ3A 5CXPA 1LJYA 3M9YA 1TPVA 3W7PA 3HPFA 4D6EA 3QLDA 5ABGA 3C0JA 4B91A 1B3OA 3LYEA 4MMWA 3GYCA 4ZOCA 5HMSA 3LCIA 3F2BA 2FPVA 3KTCA 3LQGA 4LAMA 4UTKA 1WOAA 1LWJA 4FS9A 4H1ZA 1SYTA 1F07A 4PB5A 1Z69A 1Q4NX 5AVNA 3IIZA 3H7UA 1XSIA 4CD7A 4DBSA 4J3UA 3RU6A 2ZZ2A 3UJRA 1V02E 3QEZA 1KTNA 2REQB 3J7HA 4ZVJA 2B7OA 1FA2A 1H50A 3EWDA 6TAAA 1D7FA 5T26A 3CUHA 3FA3A 1FHLA 1GG1A 3C2OA 3T2QA 3THDA 4ADUA 4MOZA 4MG4A 2JF6A 4P7LA 3T4WA 1F3WA 3EB4A 4GY7A 3M0HA 4Q8VA 4MB3A 3VMOA 5J8LA 5BU6A 4JX4A 1L9WA 4GXMA 1SSDA 4WRHA 5LNSA 1GKQA 3KZPA 1UH4A 3LHUA 3L12A 3L0GA 4DJDA 4ZCWA 3LEPA 1V7YA 3FJNA 2ZKMX 2O4MA 3W87A 3L2IA 1W17A 3NL3A 1UWIA 1RY0A 5E1QA 4PUNA 1Z6KA 3WQOA 4RNIA 1I2OA 4UNKA 3W6MA 4UWMA 4AISA 2I14A 1D8CA 3EB3A 4ROQA 4AEFA 2WPGA 4H8NA 3S6DA 4DJDD 4LPCA 1ZPTA 3AHVA 4ATLA 4QLJA 1ECQA 4W89A 1L0PA 1E4IA 2GQ3A 1T5AA 3QPZA 4A3RA 1N8IA 2R94A 2EQDA 4LV9A 2WJDA 3MWCA 4C6EA 4PB3A 1KBLA 1MMFA 1AQHA 4GC3A 4M6UA 1LBMA 1T0OA 2V9DA 1FWHC 4Y9OA 4UTMA 1Q4WA 1UR9A 1ZJBA 1O68A 1TR1A 3N2XA 4V1XA 3I7SA 2W4XA 1FTXA 1Q7QA 2VENA 4CEXC 3W1PA 3G1YA 3F4WA 3M5ZA 1JCTA 1G4PA 2Y7GA 4KRTA 3NSMA 2YA0A 5K7JA 1DPMA 4GZJA 2GGJA 4LX4A 1LROA 1THFD 3H22A 3W27A 1IZCA 4JTTA 3QFWA 4BQ3A 4IP7A 1K7FA 3RLGA 4ML4A 1OINA 1J0KA 3O15A 4AD2A 1KWGA 4EKJA 3A9BA 3V1PA 3ZJKA 4QP0A 5BOFA 3CV6A 1WQ5A 3LN3A 5AC6A 3TWAA 1L2UA 4IMCA 1V3KA 2H8ZA 3WUGA 1OGBA 3MB9A 4UR8A 4W7WA 3SRDA 4UCFA 2QJHA 3MZNA 3TC7A 4FNUA 4HTBA 3C61A 1TJPA 3INPA 3VIGA 5K4ZA 3M46A 2DEPA 3WLPA 2C16A 1VBRA 2XIQA 1FFQA 2BDQA 2RGLA 1RQBA 1I2RA 1E15A 2AGKA 4UQEA 1XH0A 4RPPA 2ZZ5A 3DGBA 4ZTXA 3A64A 2VEFA 5C5YA 4WGHA 1DBTA 3FKKA 3LA4A 5IBXA 1U1JA 1R3QA 4JTDA 5FCZA 2NV1A 1YE4A 2X2GA 5HJLA 2KAUC 2NQLA 3II1A 1PZ1A 4KEVA 4RCXA 3VAVA 4P8XA 4NZJA 1BYCA 5KZMA 1LWIA 5DT7A 4WSJA 4WQ6A 3SURA 3LSCA 4MVAA 4QG9A 1RBLA 4PCFA 3P74A 2HZGA 2E67A 3W38A 1GPFA 8XIMA 2INFA 3W81A 4QNWA 4JNMA 1KR1A 4U31A 2ZYFA 3PPCA 2PDCA 3PWIA 3IUHA 1LRQA 2GGHA 1KRCC 4ICCX 1HW6A 1UASA 4B5TA 3E2VA 4PUEA 1EKOA 2G5WA 3ITOA 4CD4A 4IFKB 3RM9A 1XBZA 2Z25A 1V79A 3WBAA 2H3DA 4XZIA 2OGJA 1J0HA 6ENLA 2UV8G 3ANYA 2PTYA 1G94A 4S3DA 4HPGA 3IRDA 4AEOA 1A49A 2EKGA 1SZFA 2OGYA 2FZ8A 3VU2A 4Q8MA 3WBWA 2WWDA 3VA8A 4AB4A 2QHAA 4H9UA 2WBGA 4PYSA 4AHOA 3OG3A 3UP8A 4RDWA 1JZ6A 4ML9A 4TVCA 3ITCA 2DT0A 3NEVA 1HKWA 1EQCA 3W85A 1Q2RA 3B9EA 4NZ4A 3JZUA 1HL9A 3MU7A 4WK9A 4D6JA 3CLMA 3FOKA 3ATYA 2AL2A 1KKOA 3KEHA 4PCNA 1W3NA 4JTJA 2FZDA 2IQTA 3H2CA 4L1XA 5DQPA 1WKYA 2FMOA 1W9UA 3WLHA 3AXXA 2ZICA 3OZPA 3C2VA 2J7CA 5BRQA 2X1RA 3WH6A 1WDPA 1NDVA 3XINA 1TR9A 1OG0A 4RV8A 5A2CA 4GNVA 4ZMGA 4ZOEA 3C3UA 3XIMA 3AC0A 4JCLA 1OGGA 3CL6A 3AMKA 4GVGA 1GVQA 2DSWA 3WH9A 1OFQA 2ZZ1A 3V75A 4D71A 3FW6A 4HNUA 3WEZA 1UA3A 3R89A 3TW9A 3NL5A 1EXBA 4GI6A 3SADA 3NQMA 3W7JA 5KZ6A 3UWUA 1L2QA 4HJFA 4X9YA 2PDFA 3PC0A 5LXXA 4S39A 2YZRA 1UA7A 2IUZA 1QR7A 2NX1A 4HHPA 1XIFA 1RVGA 2F6XA 3P8IA 1OX4B 4UTTA 3ATZA 2PSNA 4H8VA 1BTMA 1IF2A 5CAHA 3RX2A 4DNHA 3GNOA 1UIOA 1GEHA 3BO9A 4L9YA 4MFDA 4KBXA 3G5EA 4AH7A 3M07A 1TJ0A 2CHRA 1JGIA 2CBUA 4IP4A 2XN0A 1BXCA 3QJAA 4LTSA 2NV9A 4CU7A 2QMKA 4TQTA 2J78A 2XFYA 2REQA 3K4AA 1VB9A 1UJPA 1HF6A 1OT1A 4KGLA 1GT8A 1RCXB 1RLDA 4TR9A 4PUKA 2CBVA 4KRUA 1EB3A 1MFUA 3EKZA 3GZ3A 4ZQCA 4L9XA 3AYVA 3SUVA 3PBYA 1VCGA 5AHFA 3LX9A 3PBVA 3TQKA 4H7ZA 3EWXA 1RV8A 3LBCA 4Q6XA 4XD6A 3VKAA 4LVAA 1XRVA 1PX3A 4WJ8A 2PF8A 3T2PA 5EBUA 4C6BA 4CNSA 4Q22A 4ZO8A 1J12A 3W26A 3ARRA 3SSZA 4HKPA 1R3TA 4UZSA 2XIBA 1U83A 2E5BA 5JIWA 4GISA 1PBGA 3N13A 1XLBA 4C91A 4I8YA 4HPJA 2WVVA 4YWIA 3BOFA 4XZHA 3L23A 2CLKA 5D03A 3DFOA 5HUOA 2CC0A 1UKOA 1W1IE 3MCMA 2NW0A 3D46A 4O12A 4AYSA 1ZLPA 4AIEA 3GU2A 1BYDA 1B31A 4HZ7A 3TYEA 3UR7A 5HA7A 3S0CA 3CUFA 4RDVA 5CAKA 5I3GA 4UTFA 4PSRA 4I5RA 4Z1AA 1PKYA 4L64A 3PZVA 4IQJA 4K7YA 2X05A 2X42A 4PCPA 3A23A 4LY8A 2HV5A 4PMXA 4KGJA 1A5KC 2R1KA 3PNUA 5EY5A 3PBUA 3TK7A 4HYRA 2L5HA 3ZLGA 1BWVA 3CH0A 4J1OA 1CLXA 1EX5A 4RZ6A 3LSBA 4AW7A 1VGAA 1S2VA 2I1OA 2DZWA 2Q3RA 4F0MA 4JHOA 3MUIA 3CHCA 4WJEA 4GJ1A 3SCQA 1Y65A 1RHCA 5LIYX 2V3EA 2XWDA 1JUKA 3PNZA 3O6CA 3N2MA 2QUUA 1LDCA 4A8RA 5AZ0A 2NVDA 1YPXA 4NRSA 2Z26A 1ZRQA 3AZSA 3CV7A 3UU0A 2VX6A 4YLWA 4GKLA 1EC9A 4L6OA 3HQPA 3HV9A 2DW6A 1KRAC 1ONXA 5BYWA 1ISVA 5DRIA 3IJ7A 2P3EA 2YSWA 4DB7A 1E56A 1OD0A 1XISA 4C5YA 1JNEA 3CHVA 5MF5A 5BCAA 7CGTA 2A1YA 3CUZA 1JDDA 1R3SA 2UWFA 3W1QA 3H2FA 4FAMA 1Q45A 3CEPA 3PZNA 2CYGA 3VXGA 3CQHA 3BPWA 1JPMA 5EFDA 1BGAA 1DJIA 2UY3A 3AYRA 1VFLA 2VVSA 3UYCA 4HSNA 3Q37A 3UWYA 4B5VA 5BXRA 2OVLA 1OCBA 2A21A 7TIMA 3G8RA 5FF4A 2JIEA 4GJIA 1FY6A 5FJRA 3SY5A 2OYLA 2ZZ7A 4MDOA 2B7NA 4DAIA 3N12A 1KW1A 2EG8A 1U5HA 2UZ9A 4ZENA 1SVDA 4AD5A 4RL3A 4LFYA 1QVBA 1UUQA 2DFAA 1Z7AA 4GQBA 4HNTA 4MWAE 3KOWA 2DQXA 2NQ5A 2ZX8A 2FTWA 5L9FA 4IZGA 3CM4A 3MUCA 3WD1A 1WUFA 4RE3A 2PWHA 1B3WA 2OQLA 4B92A 3W2UA 4O8RA 1C3FA 1YPIA 2J6VA 2BASA 5BXPA 4PFMA 2EPLX 4XZMX 2Y8UA 5T9BG 1EF2A 3LG3A 1PKMA 3TOYA 2INZA 3MO4A 1RK5A 2ZA1A 3NPXA 4QJ4B 2D2JA 5E6ZA 3FX4A 3WLOA 2OLSA 4C6CA 3M16A 4HOXA 6XIMA 1QHPA 1WP6A 1Z89A 5LA2A 3NCOA 4Q8QA 1RJQA 2IKJA 3LPPA 1S3TC 3MT1A 3W22A 1JCMP 1A5BA 4E2DA 3DDMA 3ARYA 1TCMA 3P14A 1B1YA 1CLVA 3CZJA 2HE5A 3RYSA 4FX6M 4LAZA 3DBPA 3N3TA 4D8AA 1NFBA 2PDGA 4RXGA 5CPNA 2FTYA 3QH2A 1CGUA 1KQYA 1LT7A 1O94A 3NQDA 3NPUA 1EOMA 2BNJA 3SY1A 3TU9A 2CEQA 3GU9A 3VDBA 1QK2A 1DWJM 4J3XA 1XRSA 4NZ3A 4V2XA 1KM5A 1PYMA 2FGBA 4PODA 3GXNA 1V6YA 4AIOA 2ZWZA 1JCJA 3WNOA 1ICQA 3N2CA 3B4YA 1MUWA 5GNXA 1H1NA 4GYPA 4O1EA 1BF2A 3WQ8A 3TYDA 1H2JA 3A13A 5KITA 1W1B1 3FXYA 3BGGA 4K8HA 2VELA 3S5SA 4MAVA 3GM8A 1FWBC 3W7QA 1S1RA 1ZBWA 1TX0A 4JQ4A 4KKXA 3WFLA 4DZ5A 4ATDA 4WSHA 4PMDA 3WF0A 2I5GA 7A3HA 1RH9A 1VP5A 3BAJA 2C14A 1R5YA 3TEVA 3F4VA 4LB4A 5A6TC 7REQB 2QCGA 5AYBA 2XIJA 9CGTA 3TN5A 1CZ1A 1PO9A 3MJMA 1J5SA 4IQDA 4E2BA 4H19A 1UHVA 3ZS4A 4JL2A 4OT7A 1A0DA 3Q45A 3WBXA 1BSLA 3W07A 4PMOA 2ZUMA 4XV0A 2VT0A 1H1ZA 3QM3A 4OZOA 4S3FA 3TV8A 1KBIA 1YDYA 4JIHA 2DU2A 1F05A 2XFRA 2DSUA 2XM1A 2WVUA 2XVGA 3S5YA 2QAPA 2DSVA 1HIZA 4G7EA 3URAA 1EIBA 3BW3A 2QW5A 3W2JA 3PWAA 2X7WA 4N2YA 1Y0EA 5D33A 4TVUA 2X0HA 1F3XA 1OVDA 5XIMA 2CLHA 2XVPA 4B3LA 3LM3A 2PDLA 3O63A 4NL1A 1BYBA 5GVJA 4DBWA 3M0LA 2UBPC 4OV4A 2WOQA 3CT2A 3MUXA 4RJEA 2FVLA 5HMFA 1GQIA 4GH3A 4JY9A 1GVSA 4XAGA 3LLFA 4A3UA 4LUSA 5CC6A 4D6GA 1BRLB 4QISA 2R1NA 2XU2A 3RGTA 1WCGA 1EJVC 1PJ9A 4MB5A 2XINA 5BXSA 1KGWA 5H8MA 4GZ7A 4XSLA 2D0HA 2YDAA 2YL5A 4CCZA 2VX4A 1ISZA 4BS0A 3SCPA 2DZUA 1E6NA 1TUFA 1FX6A 1HKMA 4P2VA 3BLIA 4UR7A 2VCCA 4C1LA 2V68A 3A22A 2HVMA 3DFQA 2PLKA 1JI2A 1IIGA 4FNRA 3G22A 1RJRA 3LZ3A 4MPQA 3EKLA 1LTDA 3FAXA 2BVTA 1DIDA 1MEWA 3B05A 3VINA 2PODA 2A5HA 4PULA 4YTRA 2MANA 3E0VA 4QSHA 1XYLA 3FJ4A 4DNMA 1XLFA 3MSYA 4OVXA 3T44A 4PB4A 4MB1A 3QSRA 3U57A 3QR1A 2YBVA 1RAKA 3SY8A 3BOLA 3EDJA 1XKJA 3HFTA 2EPNA 1XG3A 2J7BA 2IPGA 2F9RA 3GXIA 4C6IA 1KCZA 1EO5A 4LF1A 4MDPA 2J27A 3ABSA 1HT6A 1TIWA 4E3VA 4MUZA 4O10A 4OFCA 2Q8ZA 3BVJA 3V5FA 2D0GA 1DJWA 4QQ3A 2NUWA 4IG2B 3IIXA 2C71A 4F3HA 1GOQA 2YZ5A 4MB4A 1AVAA 4DLFA 3ARTA 1ZP4A 3CH9A 4K1WA 4C6DA 2YCKX 3MV01 3VVGA 1E6RA 4M8UA 2CZVA 3EX6A 1R2SA 2V81A 4S3GA 2Z1SA 1QW8A 1ME7A 3KS6A 2WC7A 1ZL1A 2O9OA 3V0UA 4K39A 4O1BA 1W3HA 1GOOA 1Q85A 3QC0A 1B54A 4PH6A 4PSPA 1QDSA 4CVWA 2CBIA 3VKJA 3UZ5A 3WFZA 3HGSA 4BKNA 2WBKA 5LNWA 1E6PA 2NX3A 4RNJA 5LZLA 3W86A 3NJ3A 2J9ZA 4ZXOA 3VCCA 4RE4A 1P1XA 2CXEA 1CCWB 4KCUA 3NAVA 4GY1A 4XB3A 3K4DA 1N82A 3UPMA 3FKRA 4MADA 4AD3A 1LYXA 2Q8LA 2V82A 4EPDC 4DN1A 4KRZA 3TQPA 5EL1A 1OFRA 1QI5A 4UIOA 3SUUA 1RUSA 4M56A 2A2IA 4HSOA 2NXGA 1A5AA 4M1RA 1VLWA 3CHEA 2Y63A 1YPFA 4BF5A 4YTUA 3FY1A 1PB0A 1ZAIA 4N6FA 1S5TA 2W27A 4GNJA 4KETA 2BVDA 2F7FA 3VNDA 4LRTA 3G6LA 2HS8A 4CCDA 4WJXA 1NAL1 3RIKA 1JD7A 2WZHA 3CQIA 3ZFHA 1GTHA 4L9ZA 1XW8A 3ZT6A 3HG3A 3VGDA 4JDBA 1W3LA 1E6QM 5D38A 4X0VA 4XZNX 5JQ9A 1DWIM 2PA6A 1Z3NA 1E40A 4ZQOA 3A3XA 2ZTJA 1JD9A 4REQB 3KRZA 3P93A 4LC6A 3QKZA 3CGTA 3DHDA 2OJPA 5EMMA 1QPKA 4R34A 1LOLA 3K13A 3UCCA 5EMJA 3CAVA 3I3DA 3C52A 2FGZA 3TN3A 3S1GA 2WV8A 2PWGA 2OO0A 4AWEA 3W2KA 1FWGC 3SCRA 1BAGA 2B7QA 2W91A 2XJ7A 3GNNA 3BJSA 4XX6A 3SECA 1K8ZA 2VKZG 2Y70A 4D6IA 3QVQA 3EYPA 2Y6ZA 3G24A 5HAOA 3T7VA 1S5VA 2QCMA 1A0CA 3VCNA 2WMKA 1RZMA 4B90A 1NELA 1AJ0A 1ZJAA 4YN5A 2Y89A 2WSPA 3WEOA 1G4EA 3EPNA 1VR6A 1EJSC 4PRTA 1IGSA 5DMLA 1MUCA 3TA6A 3VD3A 4Q33A 5BXTA 3KBJA 1Q5MA