1CZ1A

Exo-b-(1,3)-glucanase from candida albicans at 1.85 a resolution
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (EXO-B-(1,3)-GLUCANASE)
publication title The structure of the exo-beta-(1,3)-glucanase from Candida albicans in native and bound forms: relationship between a pocket and groove in family 5 glycosyl hydrolases.
pubmed doi rcsb
source organism Candida albicans
total genus 152
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 1999-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cz1A00
4F8XA 2A3EA 4HU0A 1TVNA 4J28A 2XPKA 5JBFA 3ZMRA 4JCMA 2X0HA 4D6HA 1XSKA 2VRQA 2WBKA 3L4WA 4DWSA 3K8KA 3SCOA 5HOSA 1UH2A 2G41A 1IZJA 5LYRA 4TTUA 1UH3A 1UR2A 4AWEA 2D2OA 4M56A 4M81A 3BAXA 5HDRA 3HN3A 5D9MA 3AOFA 2BVDA 2VZUA 4AZHA 6CGTA 3PZ9A 4MB5A 3OLGA 2ZE0A 4URIA 1LWHA 3SCPA 1HL8A 2OLHA 3L4UA 4UR9A 1E4MM 1V6WA 2X1IA 2VQUA 1JXJA 3W0KA 4CVWA 4DUXA 2X2YA 4QCFA 5D9NA 5CSUA 8A3HA 2Y8VA 3ECQA 3MMWA 4P7NA 1Q6DA 1QI4A 5A6AA 1PBGA 4TX6A 5JIPA 3NDZA 2DT1A 3PBGA 3KL0A 3QOKA 1E4IA 5BROA 5A2CA 3OIHA 3IK2A 5C8BB 1JAEA 1BPLB 1P6WA 4ACYA 3SCUA 6TAAA 4MB4A 3RPMA 1G94A 4FK9A 1BYDA 3VD5A 3WIJA 3CHDA 2PI6A 2XTKA 2NSXA 3MMUA 1QPKA 3FAXA 2XSAA 2BFGA 3CMGA 4MDOA 5I2UA 3RM9A 4DUVA 1O6IA 1UKSA 1BVZA 3AFBA 5I77A 3M7SA 4TVDA 5FKYA 4AD3A 4JHZA 1JIBA 3AISA 2YL5A 2W62A 3KZSA 3TA9A 4L4PA 3LPPA 2BHZA 5C71A 1WDSA 4HZ8A 1V03A 2CBUA 4MTVA 4AYSA 1KXTA 2WHJA 3VDAA 1VFUA 5I24A 3SEPA 2W4XA 3BCFA 4ZXOA 1UR9A 4P7OA 2G8ZA 2J7DA 5FOOA 2XSBA 1UWRA 3AZSA 1CWYA 1XYZA 1YQ2A 2BY3A 4D72A 3ZO9A 4KMQA 3KEHA 1TG7A 3O2LA 3QR3A 1QNPA 3VIMA 5BWFA 4BS0A 2V3DA 2C8NA 2D0HA 1TA3A 1C91A 1C8QA 5CJ5A 4LX4A 1BYAA 1OGBA 3CGTA 1J0IA 4GI8A 3BCDA 1JNDA 1IZKA 3A6OA 1WZMA 4GXPA 1H09A 1ZL1A 4HMEA 4PUEA 3EMZA 2CITA 2WZEA 2WVTA 1KGXA 3IJ9A 1CGXA 2OSYA 3TP4A 3A47A 4IUGA 1GHSA 3WD2A 3WNNA 1KQYA 4MNJA 4MNKA 3CHEA 4JAWA 3N04A 2ZX6A 4ML4A 1LF1A 4DM2A 3WEOA 4HTYA 2BHYA 4M80A 3U5YA 3VMOA 1CGWA 1GHRA 3UEQA 1J12A 3UG3A 1W1PA 3DHPA 3T0BA 5A8MA 4BQ2A 4PMQA 4CGTA 4PTWA 4ATLA 3VVGA 2WVVB 1UWTA 3F4VA 4HMDA 3AMLA 2D22A 1E15A 3LPFA 1GJWA 1VEOA 1C7TA 1WZLA 3RM8A 1W2PA 4GZJA 2WBGA 4ZFMA 2O9OA 3OB8A 4XZBA 5A6MA 5A8QA 1QHZA 1R7AA 1WPCA 1CENA 3WD4A 3N17A 2AMGA 1M7XA 2WNWA 4RE4A 1FP9A 2EPLX 4OZOA 3W81A 3WUFA 2JFEX 2CCRA 2E4TA 1BTCA 1DWJM 3TTYA 3VNZA 2W66A 3OGSA 4PMDA 4CN1A 1MFVA 3GDBA 1LL7A 3NYDA 1N82A 1SYTA 2DDXA 3VUPA 1SMAA 4Z2KA 4V28A 2UY3A 4W84A 4A4AA 1M01A 4H2CA 1GZJA 3VD7A 3ZT6A 5D8ZA 1CGYA 2C0HA 1V3IA 2YJQA 1B0IA 5EFFA 5A6JA 2J7EA 2E8ZA 1MVYA 2J62A 3CIVA 3PZMA 3T09A 1DTUA 2F2HA 1L0PA 4JFWA 4HA1A 2O9PA 4EE9A 1E1EA 1M03A 4WKHA 4E4PA 2DQXA 3GH7A 1JYVA 2E9MA 1OSEA 1V0KA 4CCEA 3PZQA 4FMVA 1E5JA 1CYGA 5DT7A 4UTFA 4Y7EA 4C7FA 3AIWA 1QW8A 1EIBA 3K4DA 4U5KA 1EOMA 1KWKA 3POCA 4N42A 3CUJA 3WQ5A 2UY5A 3U7VA 3AMDA 4GQQA 2JE8A 1AQMA 1ISWA 5CPSA 2ZIDA 2GJXA 1VF8A 4DM1A 3NSXA 1LLOA 3AS0A 1XV8A 3GNPA 4PMNA 2GDUA 3AIBA 1GOKA 5A6KA 2ZX9A 4AZCA 4J3XA 3AXIA 4BA0A 5A8NA 5E6YA 3ZJ7A 4JIEA 4PBGA 4WSKA 1EXPA 4W5ZA 3PZVA 4A3HA 3NCOA 1GONA 1W3LA 4MAVA 1E3ZA 2YA2A 4HMCA 4WLCA 5AYIA 5A6LA 3B8SA 3SUTA 1E55A 3VGEA 2WZIA 1US2A 4U3AA 5A2BA 4ZXLA 5E6ZA 3BLKA 5IHSA 2XG9A 2WMHA 2XIBA 3L4TA 4CCDA 4AZ7A 2GUYA 3OGVA 3W28A 3WNKA 1Q6CA 1UR4A 4ZENA 5ABHA 3VNYA 1J0ZA 1I1WA 4P8WA 5IFPA 2V3GA 4GZEA 3K4AA 1WNOA 3RILA 3SCSA 1YHTA 4GI6A 1VFOA 4IPLA 5JIWA 1ZBKA 1BFNA 1HJUA 3SCRA 3EDDA 5AC4A 1XGZA 1UQZA 2OWXA 3DYOA 2QLYA 4TXEA 3WN6A 5EMYA 3WFLA 1W1VA 1NM9A 2E0PA 4AZIA 5BRQA 4DWSD 5JBEA 4PSRA 3BAJA 3ZT7A 1R8LA 3DYMA 4OKDA 1C8YA 3ZQ9A 1ODUA 4NF7A 4TVCA 5I6SA 2WVUA 3BMVA 1HKJA 3OLDA 1FP8A 3AMCA 3CMJA 1CTNA 3F5LA 1UOKA 1R7OA 4D6EA 3N12A 2CNCA 2DSVA 4GPNA 3M46A 3NIYA 1H5VA 4R5EA 3RO8A 2XVGA 4AIEA 4FLOA 1JFXA 2D23A 2O9RA 3PTMA 2VI0A 4AC1X 2D3LA 5GNYA 3WDJA 3U7BA 1BHGA 1FHDA 3BC9A 3F5KA 1FH8A 2FHFA 2GVYA 2XJ7A 1C7SA 1JD9A 1GW1A 3WMCA 4UOZA 1CXHA 3D5HA 1I75A 3ARUA 3HMCA 1KB3A 2W5FA 2CBJA 2J75A 4P8XA 3QHOA 3VIPA 4BQ3A 2VQTA 1Q6GA 3DYPA 4W86A 4OJYA 1NOUA 1QOXA 4UNIA 4LPCA 3WD1A 2CEQA 1JAKA 3DECA 1AQ0A 1CBGA 1E3XA 5E0CA 1B90A 1E1FA 1KXHA 2FH8A 3I3BA 4UOJA 1H0IA 1V3LA 2RGLA 4JZ5A 4X0NA 4D6IA 1AVAA 2V3FA 1QBAA 1QI5A 3K8LA 4W88A 1AQHA 2RGMA 1G9HA 2EQDA 3GXMA 3VD9A 5HXMA 1QVBA 3B9DA 2YDSA 2ZUWA 1LL6A 1E70M 2GFTA 3WD0A 3QHNA 2OYLA 2ZICA 1OD8A 5CGTA 3SUWA 1EO5A 1MQPA 5IHRA 1Q4NX 3VGFA 1E6PA 3VX0A 1U33A 2IUZA 1MW1A 2VT0A 2E3ZA 5CPQA 3L4YA 1J0HA 1GQJA 1JYXA 3ZM8A 1CECA 1HT6A 5I23A 2AOSA 5HNNA 1KGUA 1NOWA 2DSWA 4AMCA 1K9DA 1TR1A 1PIGA 4LYRA 4U2ZA 1KXVA 4FLRA 4PRWA 2G3JA 2JEPA 1J9YA 3T08A 1E43A 1UR8A 5E70A 5GNZA 4MNLA 1OT2A 1W9UA 2VRKA 1D7FA 2XVKA 2WK2A 2WMIB 3VMNA 5BXSA 1B1YA 5CPTA 2ZX8A 4MPKA 4Z2GA 2ZUVA 1OD0A 4QFUA 2WMJA 1EOKA 4UFIA 1E71M 5ABFA 1LL4A 1JDDA 2ZUTA 5HBFA 3VMPA 4FLQA 4Z2HA 1WDQA 3WF1A 1ZBCA 3VIIA 1KR0A 2D0GA 3T2QA 3AROA 3ZR5A 2Y2WA 4D71A 1D3CA 2VTFA 2Y8KA 1ITCA 5FL1A 1Q6EA 3AS3A 4E8DA 1SFSA 2EXOA 1KWGA 3CTTA 3EMCA 4UQAA 1CXKA 1JZ6A 5F7UA 1D2KA 3AQUA 3ZJ6A 2XVLA 3BMWA 1LQ0A 3MMDA 3VDHA 1E0VA 3AHTA 2VR4A 1H11A 2G4FA 2JF7A 1V0MA 3WENA 3ZJKA 4D1JA 4D6CA 2CKSA 3AYSA 1GORA 1UQYA 3TTSA 2CKRA 1GOWA 1EDQA 3PZUA 3W24A 4D6JA 3GBEA 1MXGA 3A4AA 1BQCA 5FCZA 2J7BA 2WPGA 1G1YA 4Z2JA 1TVPA 3AJ7A 5A8OA 2VX6A 3WDRA 1NWUA 1BVNP 4WK9A 4J3UA 2J78A 4AZGA 3EMQA 3W38A 1QNRA 3RJXA 3U57A 1CDGA 1H4PA 4RE3A 3UCQA 1WE5A 4WKFA 1BGGA 4LQ1A 1BAGA 2Y4SA 4MDPA 4A3YA 3ARQA 1EQCA 1ZJAA 1EA9C 1W32A 2WC3A 3GYCA 2EPMX 4IISA 5D8WA 1B30A 3CH9A 4U2YA 1VEPA 2NW0A 2PWGA 2ZWZA 3ARWA 4U31A 2WCSA 3ARTA 3OZOA 2WANA 1UD6A 3VOCA 3WL1A 1WP6A 1CPUA 1EHAA 2J47A 3WUEA 1HJQA 4CD7A 2D20A 2J8FA 4PMOA 4J27A 2WSPA 1F4HA 2XM2A 3CHFA 5C70A 2D0FA 3D3AA 1MW2A 1J10A 1UG6A 1WCGA 4J7RA 2E40A 4XZWA 4BCEA 3DC0A 3KE0A 3CO4A 4J3WA 1QHOA 1GOOA 2WMFA 1HF6A 2A3CA 3VILA 4IPNB 4M1RA 1QI3A 2CPUA 4GINA 1EO7A 1PX4A 1VBUA 1SMDA 4PMXA 1HX0A 3FAWA 2JIWA 2WM0A 4AD4A 3ARXA 4U5IA 4ACZB 5I78A 2F8QA 5IDIA 1V6VA 1UWUA 2E9BA 2ESCA 5LA0A 4QLKA 5CG0A 4E8CA 3T0AA 1H3GA 1CXLA 3WUBA 1CLVA 1TUXA 1PZ3A 1XD1A 3CHCA 1VFMA 1V6UA 2VZSA 3WQVA 3WH9A 1EHNA 1GOQA 1F4AA 2DH2A 2CXGA 4W7VA 3WQ6A 4TUFA 3AXHA 2W61A 1V3MA 1OWQA 4OBSA 2WHLA 4X0VA 1RP8A 5BXRA 2GSJA 1UD3A 2PF0A 1VJZA 1V0LA 2BY0A 5BRPA 2XUCA 3NDYA 4W8AA 1NQ6A 4EAMA 4H7VA 2Y5EA 1ZU8A 2CBIA 4FLSA 3KL3A 2PWEA 1QNQA 1W3HA 3N11A 2ZXDA 1U30A 1E6XM 4PMYA 3IAPA 4AD0A 2O92A 4OOUA 1NH6A 1C90A 1ECEA 2G3MA 4TTGA 1DWHM 1XC6A 3WNLA 2J4GA 1PEZA 3U5UA 4J3SA 4KRTA 4GO8A 2DEPA 5KEZA 4AZ6A 1W9DM 5JUVA 5KZ6A 4JL2A 2JALA 1RD6A 5DO8A 5BXTA 2BXZA 1LG2A 1HN1A 1EDTA 2WZHA 5JBDA 2CERA 1ESWA 3UG5A 5IFTA 1GQLA 2OYMA 1RH9A 4AW7A 3G6MA 3WMSA 2CHNA 2DIJA 1ISVA 1KBBA 4P8UA 1JFHA 1GQKA 2J77A 3L4XA 2FGZA 2WMKA 4AD2A 3IAQA 1ITXA 1UHVA 4Z2LA 4LYQA 3ARVA 4RL3A 3SUSA 5A95A 4MJ2A 2PBOA 1ISXA 2J7CA 1TE1A 3MO4A 3VO0A 1UWIA 3OG2A 4K68A 1E4LA 1RPKA 3VDBA 2G3IA 1CLXA 2VCCA 1VBRA 4PMRA 4JFVA 1E6NA 5ECUA 3WY1A 2OSXA 2PWHA 1MYRA 2WKLA 3BGAA 4CKQA 2JF6A 3IJ7A 4JKMA 2FHBA 6A3HA 1KBKA 2VMFA 2D3NA 3L2MA 2GJPA 5E09A 1OGGA 3WDQA 4ATDA 3WH8A 5I3DA 2V5CA 1UKOA 1HJSA 4BZYA 4CCCA 5GNXA 3WSUA 3OLIA 1HJXA 3VM5A 3W37A 5GPRA 1HVQA 2NT0A 4DWSC 2XWDA 1G01A 1JZ4A 1J11A 2FDMA 2CBVA 1V6YA 4N0RA 2WLYA 1CEOA 1PIFA 1WDRA 3O6AA 2PWFA 1G5AA 2QPUA 3T2OA 1J0JA 4D6GA 1K9FA 4AD1A 2Y24A 2E8YA 3ZT5A 4UQBA 4JFUA 2XVPA 3BAWA 3WUGA 3RJYA 5A6BD 4PCTA 1PZ2A 2WKGA 4GQRA 3WQWA 2ZUUA 1U2YA 4EKJA 3CZKA 4CD6A 1OINA 4OUEA 1MXDA 4UFJA 1E0WA 1KGWA 3VU2A 1OIMA 4NRSA 3WEMA 3AMKA 5DMYA 3J7HA 2ZX5A 2EEXA 3EDJA 2GK1B 4AEFA 2WVVA 2Q8XA 4HA4A 2DPEA 2OSWA 3GNOA 3W82A 1OM0A 4H41A 4PUDA 3ALFA 1UR1A 4AY1A 1BG4A 3CZGA 2PWDA 3II1A 1UWSA 4GZIA 3W6MA 5I5RA 4D6DA 2X09A 1VIWA 2NT1A 4WIWA 4PTMA 2ZUNA 2J7FA 1UA7A 2OWWA 3TTQA 4DWSB 1XSIA 1GNXA 2DT0A 3K46A 1UR0A 1JI2A 4UFKA 4B9YA 3B9EA 1Y7VA 1J18A 1CZ1A 4CU7A 3MV01 2YKKA 3WKZA 2XHYA 3M07A 4P7RA 4TVUA 1EH9A 3QGVA 3SURA 2YL9A 2EJ1A 4HA3A 1JF6A 1CGTA 3AHZA 3FN9A 4D1IA 4H8UA 2WMGA 3RDKA 2DSKA 3AS2A 4B3LA 1PJ9A 5EB8A 1FH7A 2YA0A 3BAIA 4HP5A 4MB3A 1UA3A 3WBAA 2QV4A 2XGBA 3OA5A 4W8LA 1JYWA 3PHAA 1JD7A 3GZAA 2EPOA 1JZ3A 1MW0A 4F9JA 2EPKX 3BSGA 4GIAA 1BYBA 5M5DA 1CNVA 1OIFA 3AIUA 1GQIA 2YLAA 3B9AA 2BHUA 4QDMA 2VUYA 1W9VA 3O9NA 3UERA 1B3XA 3AYRA 4YN5A 2X8RA 3VKKA 1XSJA 3W53A 3OLEA 2BVYA 4P7LA 1QHPA 2E9LA 1TCMA 3CUHA 5I0DA 3TOPA 3SCTA 1DHKA 5CXPA 1J0KA 1JDAA 1XRVA 3SIMA 4TOQA 3WBEA 4W89A 1ISZA 3QOMA 2HVMA 3M6DA 1UD2A 4M8UA 1W3KA 1JDCA 2O9TA 1VB9A 1GOMA 3AS1A 3FHAA 3NSMA 2V3EA 3MANA 4HPHA 2VX5A 3GH4A 1HJVA 3WF4A 4UFLA 1JZ7A 1CXFA 4R27A 4JL1A 1OBAA 1V3HA 1JGIA 1JNEA 1V0NA 3F5JA 3BXWA 3LPGA 4B9ZA 1IV8A 1W9XA 1E73M 2W91A 3CPUA 4WJXA 4W7UA 4BF7A 2J7HA 1CGVA 3EDEA 1EDGA 4HU8A 5TD4A 4UZUA 2ZXBA 5D9PA 4OIFA 2GJRA 5E0FA 3N9KA 3ZIZA 4LYPA 3THCA 2J74A 3GXIA 2VVSA 5AYBA 1A47A 1BYCA 2IXUA 3WQ8A 4L4OA 5A6BA 3GBDA 3APGA 3PN8A 1TA3B 5M17A 3GTNA 3FY1A 2YBTA 1FH9A 3VDCA 3FHQA 2ZOXA 3N1AA 5EBAA 1DWFM 1GVIA 1QW9A 1LWJA 1WKYA 5E9AA 1XCXA 1X1NA 3IANA 3WQ4A 3AZRA 4MADA 1WB0A 3VGGA 4WF7A 3PZNA 4ZE5A 5HPOA 4MB1A 1ZJBA 4X9YA 1UKQA 2A3HA 5A8PA 4Z2IA 1H2JA 2VX7A 2VZOA 2WWCA 2UY4A 2WWDA 3VIKA 2FHCA 2ZUMA 2UWFA 4M24A 1MW3A 1VRXA 3UESA 3BAYA 1NP2A 1V3JA 1X6LA 3MSGA 1BF2A 1UZ4A 4XX6A 3UR7A 5EFDA 4C7GA 4B16A 3ARYA 4AIOA 1JZ2A 2Z1SA 1NWTA 1XD0A 2BY2A 4TX8A 4CN4A 1FA2A 1L8NA 1BSIA 3N18A 1MWOA 5HPCA 3FNDA 3FW6A 1GCYA 3VX1A 1UKPA 3LPOA 2VCBA 1ZBWA 3VGBA 2CHOA 3E1F1 5CSYA 3WL0A 1GPFA 2IXVA 3VIFA 4PN2A 2WC4A 1B3VA 1E6QM 5DT5A 3I3EA 4BQ5A 3LMYA 1DP0A 3ZR6A 1HKMA 1QNSA 3MV11 1HKIA 2BS9A 3OZPA 3CZLA 4H04A 5A94A 5DEZA 3ZSSA 7A3HA 1TMQA 4OOZA 5BCAA 5LA1A 1W9BM 2VO5A 3W25A 4EK7A 1CXEA 2WW5A 4J3VA 5D4YA 2BXYA 3MKKA 2PBGA 1HXJA 3WDPP 5D9OA 2YDQA 3KWXA 2QPSA 1I1XA 2W67A 1HKKA 4GO9A 9CGTA 1W3JA 2HISA 1JYNA 3G6LA 2D24A 1V08A 4KGJA 7CGTA 3BLPX 3WNPA 1Z32X 1EQPA 3GNRA 3BH4A 3PZTA 3VPLA 4CD8A 3S2CA 2XFRA 3MSDA 1ISYA 3PTKA 1JL8A 1OT1A 1TZ7A 2XGIA 2FGLA 1C3FA 4S3JA 1UD5A 2WB5A 4JFSA 1DWIM 2WSKA 2W92A 1R87A 1PX3A 1QBBA 3JUGA 4KRUA 5I79A 3WH7A 4WSJA 3CBWA 1KCKA 2DT3A 2CETA 2VRJA 3WF0A 4U33A 1B2YA 2GJXB 4AEEA 2ZXQA 2W63A 4UFHA 2A3BA 1HIZA 1W91A 1CIUA 3AHVA 1X6NA 3HJEA 1KFWA 3T2PA 2WCGA 1CGUA 1NWSA 3AIVA 4MAZA 2WMIA 4AZCB 1PX8A 4YHEA 1GOIA 3W26A 1VEMA 1NWRA 3DHUA 5LA2A 4EANA 5M03A 1VFFA 1QNOA 1UKTA 3WDHA 3POHA 1H49A 1WDPA 3OBAA 5BYWA 5CGMA 1B31A 3SUVA 3WNMA 5A6SA 4JKLA 4XUYA 4J3TA 4B15A 2DGAA 3GXDA 1QI0A 1VENA 2ZX7A 3SCVA 3VIHA 4W85A 5AC5A 4QLLA 4F66A 4AISA 4CU6A 4BQ4A 4MJ4A 1C8XA 2DSZA 4NZCA 3SCQA 4F79A 3A4WA 4PMZA 3CUIA 2VZVA 1XH1A 4JCLA 3PZIA 3WNOA 2VC9A 1H0GA 1M53A 4H8HA 4AD5A 5CLWA 4KGLA 3BAKA 4NSBA 2YL6A 4W7WA 2FH6A 1C93A 1MFUA 2F61A 3EYPA 2VURA 2J7GA 5CLTA 1VJSA 3MS8A 4QCEA 5AY7A 1BGAA 3UETA 4UFMA 1OGSA 3VTRA 1JF5A 3TTOA 3QHMA 1K9TA 2GDVA 3MUAA 2WLZA 1WZKA 2XWEA 2QMJA 1JXKA 3IJ8A 4PTVA 4C7DA 1RP9A 4W93A 1NOFA 3A4XA 1UD4A 1SR0A 3WD3A 4UQDA 3W29A 3EDKA 2BY1A 3VD3A 2XM1A 1US3A 2BVTA 3MU7A 1E0XA 3THDA 2XIIA 2AAAA 1R85A 5A1AA 3ZSTA 1PAMA 3AICA 4PSPA 2V5DA 3VM7A 4YHGA 2ZWYA 3WELA 2QHAA 5ABEA 3K1DA 1E5NA 4DUWA 2YDRA 4ZE4A 2EBNA 1KQZA 3WFZA 4PMUA 1DWGM 1E6RA 1E4NA 2WVSA 3BSHA 1O7AA 1E6SM 3K8MA 2VCAA 2WAGA 3VD4A 4B3KA 2WC7A 1DWAM 3NSNA 2D1ZA 1XCWA 2DIEA 4UOQA 1GJUA 2X05A 3WH5A 4W87A 1FHLA 2X0YA 1OB0A 2BNJA 3CUFA 2XFYA 2VJXA 1HVXA 2G3NA 1W1YA 3ZOAA 1KXQA 4UZSA 1WAWA 4ZEPA 1E6ZA 4NRRA 4U3CA 4LXFA 4M82A 3AIQA 3AHXA 1ODZA 4JKKA 1VAHA 3MUZ1 2J8GA 5A69A 2VX4A 2PC8A 3TONA 2J25A 1UH4A 1E40A 2CYGA 3WEZA 2OYKA 1E56A 3VIOA 3CZJA 1J0YA 1IT0A 8CGTA 2DH3A 4CD5A 4ACZA 4QP0A 4CN6A 3SCWA 3L2LA 3PTQA 4Q7NA 1WZAA 2CESA 1MQRA 1JI1A 3RM4A 1XYFA 1B3WA 2XYLA 4PMVA 3SCNA 1UYQA 4F9DA 1E9LA 3FXYA 1K9EA 1HL9A 1UZ1A 4P8VA 2EO7A 1KR1A 1ZBVA 4UQ9A 4V27A 1UUQA 1FFQA 1S46A 1WO2A 1V02A 4YPJA 3W6LA 1OCQA 2WHMA 1QI2A 4CU8A 4FF5A 1G0CA 4HZ7A 4CVUA 3EBVA 1NARA 3NJ3A 4AIUA 2XFFA 1V6XA 2B31A 3AXXA 4S3KA 2VZTA 4NI3A 2C7FA 2WCAA 2YBUA 1BLIA 2WXDM 2JEQA 5ABFB 3VIJA 4UQCA 4CUCA 4RE2A 3RCNA 4WKAA 3MUY1 3AIEA 4HOWA 1JG9A 1HJWA 3CZEA 4HZ6A 3VGDA 1V02E 4QAWA 3UR8A 4GKLA 1C92A 2XVNA 1BG9A 4MNMA 5CZKA 2A3AA 2QMKA 5DF0A 3ARZA 1FOBA 1EGZA 1V3KA 3I3DA 2J79A 3NUKA 5BXPA 2YA1A 1R86A 2MANA 1AMYA 3HU7A 4PYSA 3ALGA 1M04A 5A2AA 3N13A 3AMGA 4XV0A 3AZTA 3UG4A 3VIGA 2YOCA 3WF2A 1LJYA 3S6TA 3AHYA 3RIKA 2VVNA 3WF3A 2JIEA 4P7QA 2V38A 4CD4A 7TAAA 1W1TA 5GQBA 4JFTA 1HNYA 4PTXA 3CUGA 1FFRA 3SUUA 3VINA 3ZJ8A 3T0DA 1XH2A 2TAAA 2QF8A 3EDFA 2Z1KA 2ZXAA 2WYSA 1XHGA 3CZ8A 2CIPA 3GH5A 1W2VA 2YL8A 4XB3A 1B3YA 2BV9A 2VR5A 2UY2A 4H8VA 4HPGA 3RMEA 1UD8A 1CXIA 2YIHA 3MUIA 2DT2A 3WH6A 4W5UA 1ZS2A 1B9ZA 5DFAA 5FL0A 3L4ZA 4LGXA 2PB1A 3VGHA 3L4VA 1ZB5A 3AI0A 1Q6FA 3N15A 5ABGA 5A3HA 4UCFA 4OBRA 3OGRA 1KCLA 1TFVA 4V2XA 4AZ5A 1HP4A 4HOZA 4M29A 4PEEA 1JZ8A 4E2OA 2VNCA 3GXFA 3CLWA 4KH2A 2YLLA 1GVYA 1H41A 1NP0A 4QLJA 1JZ5A 4JHOA 4Q22A 3ARRA 3PZOA 4KWUA 1J01A 1LG1A 4AXNA 4GI9A 4HOXA 1E72M 1MQQA 3W27A 1XH0A 3AIRA 2VOTA 3PZGA 5FIPA 4ATWA 2ZUSA 1H1NA 3A3HA 5IXEA 1HP5A 3ARPA 1GUVA 2OWCA 1W9PA 3ARSA 1UWQA 2VL4A 2EPNA 3KL5A 4D6FA 2WHKA 3WMBA 4PCSA 4UQEA 2GK1A 5FD0A 4AZBA 3WDIA 1B3ZA 5CQ1A 1A3HA 3GM8A 1PPIA 1K6AA 1DEDA 2DSUA 4W8BA 5M3WA 4IM4A 3W4RA
chains in the Genus database with same CATH superfamily
6REQA 2A3EA 4FS9A 4HU0A 4J28A 4QS6A 3V0SA 2XPKA 3A4JA 3A5VA 3GAKA 4H83A 1IE7C 3PPCA 2PCQA 2VRQA 3L4WA 3LNPA 3O6CA 4Q33A 3SCOA 2RKXA 3DFYA 4S23A 3A9IA 4BI5A 2G41A 4QBXA 5LYRA 2R9RA 2V8ZA 4QE5A 4TTUA 1UH3A 4ZGYA 4AWEA 3TR2A 4HNNA 4M81A 3HN3A 4ZA0A 2VZUA 4AZHA 1N8FA 3PZ9A 4IP5A 2ZE0A 3P7YA 3GHSA 4URIA 3SCPA 1HL8A 2PDGA 1V6WA 4OQVA 4ECLA 4K38A 4DJEA 4DUXA 4CNTA 3E49A 1EBGA 8TIMA 4KBXA 2YDAA 3ECQA 3V4BA 1RXOB 1R46A 3ONCA 4JD4A 1EXBA 2P53A 1PBGA 4TX6A 2ISWA 3GVRA 2HNEA 5JIPA 1DYSA 3QOKA 3PBGA 1SW3A 5BROA 1XIFA 2HDJA 2X7VA 3OIHA 2X30A 1BPLB 1P6WA 1A0DA 4WD0A 3RPMA 1L6WA 5RUBA 4M7TA 1Q6RA 1G94A 3PSWA 4FK9A 4IGNA 3CUZA 2NX3A 1EKOA 1KRAC 3U48A 2BBFA 3LZ5A 4B4HA 2NSXA 2BZNA 3WK0A 1R2RA 3RM9A 4DUVA 4QE1A 3RK8A 3QZAA 4JTIA 3AFBA 4TVDA 4AD3A 4QE4A 4JHZA 1TV3A 3AISA 4JTEA 1W5PA 3MHGA 4QS5A 2EF9A 3FGCB 3QMTA 1UP3A 4MTVA 4C6IA 3WLOA 4AYSA 3P93A 3URBA 3OIXA 4LBSA 3I6EA 3MP5A 2PGFA 2W4XA 1XUUA 3BCFA 4ZXOA 2I1OA 4E0CA 4P7OA 2G8ZA 2J7DA 4MY1A 1Q65A 2PZ0A 1A5AA 1YQ2A 3ZO9A 3IVTA 3O05A 1A5NC 1QNPA 1YDYA 1FKWA 1XDJA 5BWFA 2V3DA 3UPBA 2QCCA 1C91A 3QW4B 4KESA 2PDYA 3QBUA 2Z1XA 4WDTA 4BI6A 1EP1A 4C6BA 3G8RA 3A6OA 1GKRA 5D04C 3P62A 2FVLA 4DLMA 1Z42A 1A5SA 1SZRA 2Y7FA 3RX2A 1KGXA 1TWWA 3PK7A 3IJ9A 3W3OA 1XPGA 3TP4A 2BB0A 4N7QA 5EY5A 3S46A 4IUGA 3VUSA 3IJDA 3WD2A 3SFWA 3OTRA 2GLKA 5G2WA 4MNKA 2HQAA 3CHEA 1LF1A 3WEOA 4HTYA 3UFYA 4FX6M 2OT1A 3U5YA 1CGWA 1NDZA 1MZHA 1V77A 3UG3A 3UYCA 3TC3A 3DHPA 4PMQA 1FWBC 2C18A 4ATLA 3VVGA 3GFYA 3G1AA 1OY0A 1ZTVA 5AZ0A 2GPTA 4HYWA 3LBOA 1SO5A 4GNVA 1BRLB 3LXAA 4DJDD 3LB0A 2VFFA 2PLCA 1R7AA 4ILSA 1XRTA 1BTMA 2OKOA 5B7ZA 2DVTA 3N17A 2AMGA 4AB4A 2KX9A 3O0KA 3WUFA 4O0QA 1MI3A 2CCRA 2E4TA 4LVGA 5DELA 3COTA 4MLJA 3WQGA 4CN1A 4NAFA 2DW7A 3N29A 3R0DA 4JTDA 1SYTA 4V28A 2UY3A 4H2CA 1GZJA 1FHUA 4H8NA 4NP7A 4KEZA 2YJQA 4RNFA 4H4IA 1S2CA 4PBFA 2FGBA 1Z69A 4GCXA 1DPMA 5A6JA 3LGGA 2AKMA 2E8ZA 1MVYA 2J62A 1GEHA 3OVRA 1GG1A 1DTUA 4R85A 1E1EA 4E4PA 4GC4A 3MDWA 1WXYA 1JYVA 3S3GA 4ZB2A 2P8BA 3M0MA 4Y7EA 4C7FA 2PD9A 4IL2A 1KWKA 1EOMA 4K37A 2NQLA 4PUWA 1IEIA 3CUJA 5D32A 3L2IA 4EACA 2JK2A 3PUGA 4AHQA 3GDTA 2NVDA 2PWVA 1Z48A 1ISWA 1H7NA 1VF8A 5K9CA 3NM3A 3NSXA 1LLOA 2HBXA 1XV8A 4AVNA 2TMDA 2ZBTA 4PMNA 3AIBA 5A6KA 4D9PA 4C6MA 5A8NA 3DHDA 4JIEA 3PZVA 5LNUA 3GAYA 3VAVA 3NCOA 1GONA 3STEA 1E3ZA 2YA2A 3HOJA 1EPXA 3B8SA 3G1YA 1WAUA 1QNVA 2WZIA 4IL0A 1G4EA 1F05A 4AX7A 5E6ZA 2XG9A 1GZ1A 4C6EA 3GW3A 3IIOA 3L4TA 3K1GA 4CCDA 2F6KA 2W79A 4FX8A 4F0MA 3OGVA 3BVJA 3UJSA 1J0ZA 1I1WA 1I45A 4H9VA 3SY8A 2VDGA 3B0XA 4S2BA 2J9YA 3E5PA 2QUNA 3H2OA 1C9DA 1ZBKA 1BFNA 3MVTA 1HJUA 2E5BA 1UQZA 3DYOA 4M6PA 2QLYA 1Z6KA 2AQWA 3VFCA 3ISIX 3E6EA 4IIEA 1NM9A 4DJFD 4LWWA 4QR6A 5C9UA 3B97A 1C8YA 3ZQ9A 3TQKA 3QEZA 4Q4KA 1FP8A 1WYIA 3CMJA 3P5ZA 1XYAA 3FA3A 4B5WA 1KCXA 4C5ZA 4FA3A 4CNOA 3DHFA 4GX8A 1KTBA 4O14A 2XVGA 3TC6A 4HZMA 1SW7A 4FLOA 1IWAA 2O9RA 2D3LA 3WDJA 1FHDA 3BC9A 4HNOA 3CWNA 3UF9A 3E0VA 4DQWA 2HJPA 1JD9A 3HPAA 3CV2A 4B3ZA 3LGDA 2H8ZA 4Q4PA 1KB3A 2J75A 3QHOA 4IIFA 3NPUA 4MGGA 1SM9A 4DNMA 1Q6GA 2C71A 3NQMA 4UNIA 2Z2BA 3DECA 3IPWA 1VZWA 4K1GA 1B90A 1QR7A 2ISDA 1OQFA 1JJKA 3MI2A 4IMCA 4UOJA 1H0IA 2EGZA 4YMZA 2RGLA 4JZ5A 4ZB0A 4FNSA 1QBAA 3K8LA 4KCVA 1G9HA 1WUFA 4QXIA 3CAQA 4E4UA 3EOSA 5BU6A 5HXMA 1B3OA 3W75A 3OBKA 3MI3A 4GNKB 4O8AA 1E70M 4H6QA 5J04A 2WM1A 2PPGA 4OFCA 1EPVA 2GVEA 3CQKA 1MEIA 3TKFA 4GVGA 3M9YA 1R9XA 1MQPA 4CNUA 3TNBA 3VGFA 1IXOA 2IUZA 2GQ9A 1GEQA 2VHLA 3L4YA 4JTHA 4UTMA 4O1BA 3BE7A 3TVAA 2OX4A 2AOSA 2QDDA 5LHFA 1SU5A 1DIEA 4FIQA 4RZBA 4IG2B 2CLEA 1IWPA 4HHLA 3WG6A 1KFJA 2G3JA 1CB2A 2JEPA 1NFGA 1NELA 2Z00A 4K39A 1J9YA 1E43A 1K70A 1XFBA 1D7FA 5IBXA 1YYAA 2WK2A 4ZQCA 4GYFA 3FEQA 3LBMA 1B1YA 3LA4A 3F7JA 4HNCA 3KTCA 4E8GA 2AL2A 1RBAA 2ZUVA 5FEZA 1L2QA 1SSDA 3TN3A 5ABFA 4GKTA 3VMPA 2VR2A 1XX1A 4RXGA 3ZVIA 3WF1A 1M6JA 3AROA 3ZR5A 4D71A 3TLLA 1D3CA 5DCDA 3HTWA 3STFA 1OCJA 2A7PA 2Y5JA 3WLNA 5CZSA 3GU1A 1OX6A 3AS3A 1I0DA 3UZJA 1I2RA 3NOEA 4L64A 4R7WA 2PFHA 3CTTA 5JMUA 3ANYA 1CXKA 1X97A 3PJUA 1O66A 1FCQA 3BMWA 1LQ0A 3MMDA 3CHVA 3HO8A 1ME8A 3I7RA 5HQEA 1M65A 2PTDA 1EX5A 1AJ0A 2QGHA 3ZJKA 4D1JA 4D6CA 1C29A 2E67A 3BW4A 3TTSA 3W1RA 1GOWA 2CZ5A 3EXRA 3VCCA 2Z25A 4MWAE 3PZUA 3HF3A 4A3RA 3DKJA 2G97A 4XSLA 1MXGA 2P8CA 3V36A 5FCZA 1IIHA 3AJ7A 5A8OA 3G0SA 3W7KA 2VX6A 2AKZA 1NWUA 4J9JA 4JNMA 3PS7A 3ITLA 2YYUA 3U57A 3N14A 1EJRC 2Y0FA 3TMQA 2CZFA 4HCDA 3R8GA 3UCQA 5KTLA 2PUZA 1KV8A 1E0TA 1WE5A 4WKFA 1Z89A 3VC6A 1TUFA 2Y4SA 1F6PA 1EA9C 1VD6A 3F2DA 3AWNA 4US5A 4O1EA 3DAQA 2EPMX 7PTDA 4LUTB 1YDVA 5ABTA 2QUTA 1B30A 3G1XA 4OBTA 1Y8BA 4I5RA 1XLCA 4HKPA 3WUEA 2OODA 4CD7A 4OUIA 3R7MA 3UCCA 1L6GA 2J8FA 4PMOA 2DV0A 3CHFA 1F4HA 2I56A 4JIQA 4CNSA 1UG6A 1WCGA 4GVIA 2E40A 1IEXA 4IGHA 1BKHA 2CWNA 5HMEA 4J3WA 3CB8A 2DFAA 4GCAA 4M1RA 1QI3A 4GINA 4XIMA 4PTNA 2YCKX 4FX7A 4Z1YA 1VBUA 5U7SA 1EJTC 1XINA 1HTIA 3IIXA 3KLKA 3VE7A 5KETA 3M5VA 3P74A 3RR1A 4M6VA 1V6VA 1FWRA 5B7YA 1DE6A 1R30A 3E9AA 1PZ3A 1XD1A 1OADA 4LB3A 3TV8A 1V6UA 2VZSA 1WDDA 3WH9A 1US0A 5FF7A 2FFCA 4UMCA 1IEQA 4W7VA 2W61A 4G6CA 4OBSA 3W7RA 3RAOA 2X2GA 1EF3A 4KPLA 2H90A 2BY0A 3RGTA 3WYZA 1PHWA 2NZLA 1Q63A 1KM2A 4W8AA 4O1AA 2CBIA 2PWEA 1QNQA 1W3HA 4EOUA 3N11A 3MPGA 1J93A 3IAPA 4GYPA 4KF1A 3EA3A 1C90A 5EL1A 4EF8A 4TTGA 3BLDA 4MVAA 4DI9A 4FNUA 4JBRA 3HURA 2GOKA 4H01A 3G1VA 4IXHA 2PDMA 4KRTA 4AZ6A 4O0ZA 1TPUA 5JUVA 4GYKA 3SRHA 5KZ6A 4PUNA 2DZVA 1R5YA 2JALA 3TZFA 4B4FA 1ESWA 3IK4A 2OYMA 4XD4A 4AW7A 3NAVA 3WMSA 4G7EB 4GRSA 4GBDA 5FEPA 4HPXA 3L4XA 2YFOA 2FGZA 4KW2A 1ITXA 5E93A 1A5MC 1XIEA 1LTDA 4Z2LA 5BZAA 4LYQA 3C0SA 4RK8A 4RNHA 1Z44A 1W0MA 3PBVA 2R14A 5LZLA 1GVEA 1J2WA 1UWIA 3UWEA 4NQ1A 3URQA 4F2BA 1E4LA 3FGCA 3VDBA 5AYYA 2VUNA 2VCCA 1GG0A 4HJFA 4JFVA 1E6NA 1F3TA 2PWHA 2WKLA 3S5YA 4JKMA 2FHBA 4AXKA 1S1PA 3GD6A 3OVQA 3ITOA 4ZMGA 3BQ5A 3WDQA 4C1KA 5I3DA 4ZO9A 1TV5A 2ACUA 3OLIA 1P1XA 4FHAA 3QQWA 2HVOA 1HVQA 2NT0A 3P5YA 5FJRA 1GW9A 2XWDA 1G01A 2FB2A 3M0HA 2EG7A 2PGEA 1MUCA 1D9EA 1RJRA 4ADSA 2I14A 4V1XA 3H2FA 1K8ZA 1PIFA 5G1TA 2DZXA 5HK4A 5H2ZA 4PRRA 4CQDA 3W1QA 1RK6A 1J0JA 3ZT5A 1HW6A 3H2CA 3WUGA 5C9WA 4A3QA 1PZ2A 4ZQNA 2ZUUA 3CMFA 1H51A 3MY9A 4YL2A 3W1NA 1W5MA 4F0SA 1V79A 3GNDA 1LQAA 4I7UA 4GVHA 1E1CB 2BGQA 3GNNA 2FTPA 4ALDA 3BWWA 3WEMA 4UMAA 1WOBA 3AMKA 4PUMA 1LOSA 3EDJA 3GZ3A 4MPQA 4AEFA 4HA4A 2H9AB 3IVSA 3TK7A 4H41A 2ZZ2A 4L9ZA 3VFLA 3CZGA 2PWDA 4JIPA 1BRLA 3TUUA 2P0IA 4XO6A 1G6CA 2I7GA 2BX7A 1EC8A 4PUJA 2ZRXA 4ZTXA 1EJUC 5HANA 4R33A 2A0NA 4UWMA 3KOXA 5D2TA 2V5LA 5DANA 2D2HA 1Y7VA 3CU2A 2YKKA 2XHYA 3MUXA 3HJZA 1IZCA 1MEHA 4NHVA 1L6SA 4HA3A 3NQGA 3FN9A 3EWZA 3C61A 3MSYA 5EB8A 2XZ9A 3D0CA 4HP5A 4GE8A 4MB3A 5DY2A 4NUWA 6ALDA 3IGXA 1O95A 5LIKX 3OBEA 2ALDA 1LRTA 4H9TA 1JD7A 2EPOA 4F9JA 4A6GA 4GIAA 4BY3A 1P0BA 1DHPA 1CNVA 2YLAA 3OU8A 1W9VA 4YS1A 4KCWA 3O9NA 1B3XA 4H9YA 2X8RA 4P7LA 1QHPA 2TODA 2VELA 3BLEA 3CUHA 5I0DA 2BOEX 3F4NA 1W31A 1S2AA 4RW3A 1PTDA 3C2YA 2HVMA 3OJGA 4I9TA 2ISSA 1YKWA 4L4MA 4LEQA 2CWXA 1THFD 4Q32A 3LOTA 4EPEC 1OG6A 2BASA 1H61A 1KM6A 3VOHA 3GH4A 3WF4A 1JZ7A 3W7QA 4ZQPA 1BXCA 1JNEA 1V0NA 4B9ZA 1ICQA 4DPQA 3TYEA 4NZFA 4W7UA 4BF7A 1CGVA 2HROA 3EDEA 1YX1A 1EDGA 4RR4A 4C1NB 1JQXA 2ZXBA 4OIFA 2GJRA 1D7KA 3ZIZA 4IGMA 4LYPA 2DVUA 4XZHA 3S5ZA 3GXIA 2FZNA 1F6KA 3A23A 2IXUA 4DX3A 3KM8A 3GTNA 4HNTA 5LKYA 2XH7A 1B4KA 1IXNA 2VEKA 4GUIA 3HV9A 2ZOXA 1DWFM 3GG7A 1C8VA 2A6LA 5D30A 3S5NA 3GG8A 2PDKA 3IANA 4MADA 3KVJA 3VGGA 3PZNA 5HPOA 1UKQA 3UWYA 3M44A 5A8PA 5SWUA 4Z2IA 1OF6A 2VX7A 2UY4A 3VKCA 4XZLX 3GQYA 3VIKA 3AWOA 4YLWA 4US6A 2VOMA 2HV5A 3V18A 2OQLA 4NILA 1LBLA 1WV2A 5AC6A 1OF8A 1XIGA 3UR7A 2CLPA 2Y62A 5EFDA 1XKYA 3A12A 4TX9A 2HVNA 5TNVA 2GJLA 3FYPA 3PSVA 4DYKA 3GIYA 3N18A 3WQOA 4V1YA 5HPCA 1EYWA 3BG5A 3K4WA 4YCOA 1RPXA 3FW6A 3HB9A 2HPMA 5HJXA 4WXYA 5I3GA 2CHOA 5CSYA 4HNVA 1GPFA 4YTUA 2IXVA 3VIFA 4PN2A 1B3VA 1E6QM 4RNJA 2HK1A 1QNSA 4WHBA 1SO3A 3PG9A 3ZSSA 2WSRA 3S6DA 2VO5A 3A3XA 1DIKA 4OU1A 4S2CA 3MKKA 3KCLA 3A21A 2DJXA 4O1CA 2QPSA 2XIJA 2HTMA 1PE1A 1W3JA 3D6NA 2HISA 1OYAA 3U2EA 2R24A 4S1FA 5F4XA 4DEFA 4ZFCA 3WNPA 1Z32X 2O55A 4GOAA 1RQBA 4D8LA 2ICSA 2GDQA 1CCWB 5FJPA 1OT1A 1ZFJA 4LOCA 1ITUA 1VGAA 4LSBA 4IG2A 4MIMA 3H4WA 3SAZA 4JFSA 1LZOA 4QJ1A 4ZTYA 4LALA 5I79A 4WSJA 2DT3A 4U33A 5E9XA 4AEEA 4UFHA 5HJYA 1W91A 1CIUA 3HJEA 1KFWA 3T2PA 3RHGA 2UZ9A 3AIVA 1OC5A 4NJGA 1GOIA 4PA8A 3FV9A 1VFFA 1LBFA 3WDHA 3CAVA 3POHA 3KCJA 3ANUA 3HPXA 3GG0A 1B31A 3SUVA 4GXWA 4XUYA 1MNSA 3W22A 2DGAA 1PXGA 4KT2A 3GXDA 2AMXA 3SCVA 3TROA 5AC5A 2V68A 4CU6A 4HIBA 4NZCA 1RJPA 1QAPA 3KHDA 4S3AA 4PMZA 3V16A 4XSMA 3EXTA 1TO3A 4JCLA 3PZIA 3WNOA 1P6CA 3BLFA 1M53A 4O19A 3EWWA 4Y9MA 1RV8A 4AD5A 2FH6A 1C93A 2ZZ1A 3RCYA 1UIPA 4O0KA 2FZ9A 4F48A 2VURA 3M0LA 2YFNA 2J7GA 1X8FA 5CBIA 1VJSA 3BL3A 4QCEA 5AY7A 3G5EA 3FJLA 2DZSA 2JQXA 2WLZA 3UA3A 4DVOA 1JXKA 3LMZA 4PTVA 4WR3A 1RP9A 1PSCA 4W93A 3R94A 4ICMA 3SY1A 1UD4A 2F9RA 1UMLA 2IPGA 1SZFA 2R94A 3VD3A 3VZZA 3HV8A 3MU7A 5AHNA 2DZTA 2OZ3A 5AHEA 3THDA 2XIIA 3M0VA 4GJIA 1YNPA 1RA0A 4PSPA 3STPA 4O54A 2V5DA 4DHGA 4FNTA 4AH7A 5HNRA 4YHGA 4EAYA 3HG2A 4ZE4A 1JCNA 4DO7A 1DWGM 3UWVA 3H4XA 2WVSA 1KFKA 5CAKA 4LUTA 1E6SM 1R38A 3K8MA 2FPYA 4HT3A 3A24A 5IBXC 1H50A 4W87A 3PWAA 3CUFA 3GIPA 3B3DA 1TWSA 1DV7A 1HVXA 4Q4SA 3NZ1A 1W1YA 4KQNA 3AJXA 3OHMB 1WAWA 2FLIA 4HYVA 3PPGA 4AVOA 3BGJA 3GLCA 4LAUA 2QS8A 4M82A 2VM8A 3AIQA 4K8GA 4JKKA 4HN8A 3UZXA 3SRFA 3CUXA 3MYPA 1RCXB 2J8GA 1SZNA 3LCHA 1JGMA 3TONA 1UH4A 3CIWA 1KTCA 4KCUA 3W2NA 4L65A 2Y89A 2OYKA 1GVSA 3CZJA 2GZXA 4DF1A 3TNOA 3TW9A 3L2LA 1K8XA 3PTQA 3DZ1A 5EMMA 2C1HA 4BI7A 3S5SA 3R43A 2WNZA 3SR7A 1NQKA 5C55A 1UZ1A 1XLJA 2EO7A 3NZPA 3ATYA 1XL9A 1ZBVA 4RPQA 1UUQA 5CCZA 4FXFA 1PKYA 1TJ0A 1G0CA 4CVUA 3EBVA 1I8JA 4GK8A 4WJEA 1NARA 3CT2A 4LC6A 3OHIA 4ZB5A 5BOEA 2XFFA 1E0UA 2B31A 3AXXA 5U4NA 4A8NA 4NI3A 3W7CA 4RDYA 2C7FA 5AHIA 1BLIA 3JVAA 2WXDM 3R13A 3VIJA 3RCNA 4HOWA 4RV3A 1HJWA 8XIAA 2EG8A 1YRRA 4TO8A 3ORWA 4B5VA 1C92A 3RPDA 4MHBA 2QMKA 1TZZA 5DF0A 4O4WA 1FOBA 3QF0A 2YA1A 2R82A 1R86A 3M1ZA 1TRDA 3GFZA 2ZZ6A 2QCEA 4PYSA 3UT0A 3VNJA 1A4MA 3VIGA 2YOCA 3WF2A 3GTFA 4G7EA 5F4WA 2C79A 3FDGA 4O8RA 2XN1A 4CD4A 4XVEA 3S2LA 1XI3A 1BXBA 5F2MA 4NNAA 4JY8A 2PDHA 5K7JA 5FF2A 2PZNA 2ZC8A 4CLMA 3T0DA 3E02A 3OEXA 3PP7A 3DBNA 3R89A 3KW3A 4NZ3A 1JQVA 8RUCA 5FJJA 3EDFA 3GTXA 1OFBA 3KBMA 4J2MA 2V81A 1FWWA 2Z1KA 3N19B 2CIPA 1XDLA 4IF2A 1FUYA 1UROA 1VLIA 2EG6A 4XB3A 1OK4A 2VR5A 4O13A 3IUIA 3MZ2A 1H63A 1UBPC 3R12A 3A9BA 1KRMA 3WH6A 1POJA 1ZS2A 3WLRA 4OHQA 4PH6A 4FR6A 4H3DA 6XIMA 3LI0A 3H7RA 3P6LA 1TJ1A 4UCFA 4OBRA 1UWAA 3PFMA 3CAKA 3CT7A 2F2KA 3CS2A 3SFKA 2DY3A 3E2SA 1HP4A 4HOZA 2JBMA 2OQHA 4E2OA 1GVYA 1G69A 1JZ5A 1TTQA 3QJAA 1AZ1A 4JGDA 3IUDA 1E9ZB 4ROQA 4L9YA 3N2BA 4GYPC 5FIPA 3A3HA 4G7FA 1FWNA 2VL4A 3KL5A 1KRBC 1MMFA 3P61A 4IT1A 3WDIA 3W7NA 1RK5A 2WKJA 2H9AA 3R8HA 4IXXA 3GM8A 1YDOA 5AKQA 4I9AA 2DSUA 2RDXA 4GIEA 4IM4A 7XIMA 4Q6XA 4F8XA 1DJIA 2PF8A 4O53A 1TVNA 2X0SA 6PTDA 1KRCC 3V5OA 3ZMRA 5EPDA 3TMLA 3CV6A 1H5YA 4JCMA 3UQNA 5J5RA 5DBTA 3QW3A 4JS3A 1QMLA 3H4GA 4WDXA 5JH1A 1IZJA 1X1ZA 3TSBA 5XINA 3LHVA 1A5KC 5HDRA 1TTPA 3I4EA 2BVDA 5KSWA 1B4EA 4MB5A 1LWHA 2OLHA 3WLTA 4CVWA 1GJPA 5D9NA 4GGBA 5CSUA 2Y8VA 5CSRA 2XIQA 4KIEA 3BPWA 4DO5A 3W73A 4P7NA 4XTIA 2B7OA 1CLKA 4C6JA 5H8MA 3STCA 5A6AA 2PTWA 3RU8X 4NZJA 1VPYA 4X9SA 5CZJA 3T55A 1F73A 5A2CA 4J3ZA 3IK2A 1GKQA 1VCGA 3KX6A 1SQ7A 3NQ7A 4NAEB 4MB4A 2GGJA 2GUBA 1YXYA 1PB0A 3WIJA 2VD9A 5CC7A 2PI6A 3C3NA 3EZ4A 3QH2A 2O7QA 3NVDA 1LRNA 2EPHA 3LK6A 3MMUA 4ZO7A 4FF7A 5I2UA 4PB5A 2R1MA 2FPTA 1AG1O 4Y90A 2A85A 3UXDA 2FZMA 3WQDA 2YL5A 1IR2A 1H7RA 2FVMA 4O11A 1WDSA 4HZ8A 2YW3A 4F2TA 2WJFA 4Q8WA 4ORMA 4PE8A 2WHJA 1VFUA 3SEPA 1XM3A 3APTA 1RVKA 4JXCA 1UR9A 4C1NA 3EB2A 4JTJA 2QDGA 1UWRA 3AZSA 1KFBA 3PJWA 1X6UA 2EKGA 4GUHA 4KMQA 1ENUA 3NM1A 3KEHA 3O2LA 2G50A 3QR3A 3R1ZA 4BS0A 4KS0A 1JUKA 3KRBA 1K7XA 9RUBA 1R6WA 5CJ5A 2C6QA 4LX4A 3I7QA 5CJNA 3S9ZA 1GYLA 4NYUA 3CC1A 1S5TA 1SUXA 3W1PA 2R8WA 2B7NA 4GXPA 1JVNA 3SI9A 1QTWA 2QZRA 4PUEA 3EMZA 2CITA 4NU7A 1TWIA 5HMFA 2WVTA 4PODA 1CGXA 1A80A 4QITA 3C8FA 5LHEA 1VYSX 1QK0A 3ZLGA 4JAWA 2Z2AA 3N04A 3QRHA 1GVOA 3REQB 4JICA 5MF5A 2Z24A 4M80A 1GHRA 2ZZ4A 4TMCA 5A8MA 4BQ2A 4CGTA 4PTWA 2WVVB 2TPSA 1NIUA 3F4VA 2WNNA 5C7HA 2D22A 2XU2A 3LPFA 3RM8A 5EMKA 1W2PA 4PFHA 1UUOA 3MHUA 4GZJA 3OB8A 4XZBA 1TQXA 3OYXA 2X7WA 3DH7A 3S1UA 3MP4A 1M7XA 1FP9A 4TQTA 3EKZA 4REQB 1TV8A 1W37A 2W66A 1D8CA 1TSIA 4GUJA 1MFVA 3GDBA 3FIGA 3PJTA 3NYDA 3N73A 5B80A 3AXMA 3UR2A 2Y8UA 2PRMA 1SMAA 2NQJA 1HGYA 2VEFA 3SGGA 3S8HA 4P2VA 1CGYA 3AYTA 2C0HA 3IGSA 1UPMB 1VKFA 4IP7A 5EFFA 2J7EA 3PZMA 2O7SA 4GVFA 4DYJA 4HA1A 2O9PA 3BLLA 1M03A 3LBCA 1PV8A 4WKHA 2DQXA 2BSLA 3GH7A 5HWNA 4BEUA 1RUSA 1V0KA 5AHLA 4FMVA 4XUGA 3MT1A 1CYGA 1SZEA 3AIWA 3PF3A 1EIBA 4U5KA 3WQ5A 3C2EA 4RKAA 2V2CA 5CKSA 4GQQA 2VFEA 1A4LA 3C0LA 3KOZA 1RSCA 4IMAA 3JZUA 3QY6A 3UJ2A 1DORA 2ZIDA 3TCEA 1WQ5A 4DM1A 4NJKA 4C6OA 3TFXA 3DFPA 1RY0A 1DIDA 3E2VA 2NQHA 4HU4A 4XBKA 2GDUA 4NJIA 2DQWA 3C3UA 4BA0A 1RQEA 3WQPA 4HTBA 5E6YA 2ZRYA 3ZJ7A 5C2GA 3NNTA 4HVXA 2VXNA 4YIWA 3GB6A 3MKCA 2A21A 4E3TA 4MAVA 4GYJA 5AYIA 4WLCA 5A6LA 4JDBA 3RO6A 4ZVJA 3SUTA 2CLFA 3W01A 5A2BA 4ZXLA 2NVCA 2IQTA 2Y61A 5IHSA 4JIHA 3W1LA 5HR6A 2XIBA 4LCSA 1W1A1 4AZ7A 1M68A 1Q6CA 3W1TA 3VNYA 4P8WA 2VGGA 3NPVA 5IFPA 4GZEA 1SJBA 3FS2A 4L6OA 3SCSA 4GI6A 2ZRZA 1I2OA 2G37A 3SCRA 1RBOB 5AC4A 2QCDB 3KS5A 5EMYA 4Y9NA 4AAJA 2PLKA 4DWSD 5JBEA 1VQTA 1AL7A 5EMLA 3ZT7A 1ONWA 1W56A 4QNEA 3WBWA 1XIDA 4NF7A 1QT1A 1PKMA 5I6SA 4MWAD 1J8VA 1R9YA 1CTNA 1FCBA 3GUGA 2PDUA 3M46A 4AIEA 3A3WA 1MXSA 4ENLA 5DMMA 4V33A 4Z1AA 1IGSA 3PTMA 3N6QA 4AC1X 5GNYA 3U7BA 5HMSA 3NO5A 1BHGA 3GU2A 2E6FA 5DY3A 1SR9A 3KVKA 1C7SA 1GW1A 4UOZA 1CXHA 1T41A 3UWWA 1Q7QA 3LD5A 3ARUA 3DGBA 4P8XA 1XUZA 2V82A 3VIPA 1OFDA 4BQ3A 2PDFA 4OJYA 1NOUA 1F8MA 5I3HA 4LPCA 1K3UA 4O1DA 1I2PA 1E1FA 1KXHA 3P80A 3GC5A 5FEXA 1SO6A 3G1DA 1VHCA 3K13A 1QI5A 2OJPA 3G3MA 1AQHA 1F76A 3VI2A 3GXMA 3VD9A 3CAWA 1TRIA 1R3RA 1TTJA 3B9DA 2CFFA 4LY8A 1TREA 3FYOA 4OTKA 1LL6A 2HE5A 3TQPA 3UJRA 3E0FA 3DU0A 5CPMA 4HSNA 2OYLA 1VHNA 5CGTA 2OEJA 3SUWA 3NQCA 5HUOA 1TQJA 4QSFA 3VX0A 1O1ZA 1LDCA 1GQJA 1MNZA 3TE9A 3ZM8A 1CECA 4JPGA 1IXQA 1F7BA 4RDZA 3EB3A 4AMCA 1XWYA 4DRSA 4I9MA 4KFPA 4PRWA 4M6UA 1ADSA 5DMLA 1LWIA 4IPPA 1VPXA 1KW1A 3UCDA 1R9ZA 3PC0A 5GNZA 3LU2A 3Q2DA 1FWSA 2YCJA 4XK2A 2ABBA 1E9YB 3NZQA 2RFGA 3U4FA 3VMNA 3LERA 5CPTA 4MPKA 3GVQA 3H70A 3W2MA 3BV7A 4UFIA 1E71M 3URAA 1UB3A 5HBFA 3LS9A 3C2VA 2F6XA 1J6OA 1V6TA 4ZO6A 4FLQA 1HL2A 1WDQA 1WKDA 3CEUA 2PLMA 4ZL1A 3T2QA 2VEMA 1RCOB 2Y2WA 3KLLA 5DQPA 4N9CA 1CI1A 2VTFA 2Y8KA 1ITCA 1AZ2A 1XLBA 5FL1A 3MB9A 3M43A 4E8DA 3NQ6A 1SFSA 1T6MA 3P81A 4MFDA 2DORA 3EMCA 1YTDA 4UQAA 5F7UA 3RLUA 1D2KA 3EWDA 5BMXA 3ZJ6A 2V2DA 4WSHA 3B8VA 4DNHA 1H11A 2G4FA 2JF7A 3H2MA 4W9TA 2OG9A 3WENA 4UUIA 2CKSA 3AYSA 1QO5A 2CKRA 3BW2A 3MYOA 4WDUA 4JTLA 3W24A 4GC3A 3WQCA 2J7BA 2WPGA 1XLEA 4A8IA 3MVIA 4UTWA 1AL8A 1OABA 4Y8FA 1ZQ5A 3KZPA 1J79A 5L6UA 3LSBA 4WK9A 4J3UA 1F3WA 1O68A 3LCWA 1R3TA 4GXMA 5C5YA 1H4PA 3DI1A 2ZDRA 1L6FA 5I3KA 5CH9A 4JTSA 3D47A 4LQ1A 3N9RA 4B5XA 1LYXA 2WC3A 1EUAA 4BJHA 3RU6A 5A8GA 4A22A 3GYCA 4EPKA 3VNIA 1TPVA 1H1YA 3LHTA 1VEPA 4FR1A 3ARWA 2H3DA 4A21A 3W6YA 2PDXA 4U31A 2WCSA 1FWEC 5K9DA 2OELA 2J47A 4YTSA 4A29A 4HSOA 3R25A 3L21A 4B91A 2V5BA 3R10A 1VP5A 2D0FA 3D3AA 1MW2A 1J10A 3M16A 4TV5A 2BXVA 1FWJC 3QY7A 3NTYA 4BCEA 3DC0A 3FX4A 2PD5A 1QHOA 1S39A 3VKAA 1WA3A 3LCIA 1PDYA 2CPUA 2XN2A 3TR9A 1U1UA 1EO7A 3M41A 2ZADA 3HPSA 4MYXA 4M51A 1F3XA 4PMXA 1KFLA 1NF7A 3AYVA 3INPA 4ASTA 4BF5A 3PBMA 4JN8A 2WM0A 4L1GA 3ARXA 5IDIA 5AC8A 5KZEA 3KBNA 3UXIA 4S3CA 4Z1CA 3W7EA 3T0AA 4FEZA 3PM6A 1CLVA 1TUXA 3ZLFA 5LXXA 3GC2A 1VFMA 2H6RA 1UC5A 1XGDA 3FJ4A 2NQ9A 1L2UA 3JW7A 3QV6A 3V75A 2DH2A 2V63A 4I5XA 4LCQA 5BXRA 2GSJA 4MJMA 4IZGA 2ISFA 1XR2A 2NXHA 5JH2A 1NQ6A 3OQ8A 2Y5EA 3HQOA 4FLSA 4AYGA 3KL3A 4ZOAA 2X42A 2QUUA 2ZXDA 1E6XM 4PMYA 1RAKA 4N6FA 3EX6A 4OOUA 4MUPA 1ECEA 3W86A 5C6MA 3QLLA 3SQLA 1DWHM 3GUWA 1EF2A 1PYFA 1PEZA 1A50A 3UPWA 1FX6A 1YPXA 3U5UA 3PUEA 4GO8A 4NAEA 4AC7C 1MRAA 5H8PA 3IV3A 5DO8A 5DN1A 1LG2A 1EDTA 1LLZA 1F07A 4ORIA 1FKXA 1RH9A 3LENA 3G6MA 3SW6A 1KFCA 1XBVA 2BG5A 4AHOA 1KBBA 4P8UA 1JFHA 5LIXX 4QTGA 1JPHA 3IAQA 1UHVA 3SUSA 4NZ1A 4CQ9A 4IIDA 1U1HA 1SW0A 1TE1A 1H7WA 3MO4A 3BW3A 1RPKA 1ME7A 4GJJA 2JGYA 3F2BA 3ZR4A 2G3IA 3W2UA 3WY1A 3CYJA 3BGAA 3U2CA 3FOKA 2JF6A 5FF3A 4WOQA 1EP2A 1M7JA 3ENLA 4LS1A 3NVTA 3WH8A 2V5CA 3GTIA 2P50A 3MCMA 4BZYA 4CCCA 5CEWA 3UYIA 3GFXA 3HQPA 4IGSA 2ON3A 1Q8JA 3CL8A 4L7ZA 2VENA 2NX9A 5M1TA 3ZZ1A 1VRDA 4UTTA 8XIMA 5CZTA 4RJEA 5AVNA 1KM3A 2AQOA 2FYMA 5TIMA 1IEWA 4AD1A 4EP8C 2P5NA 4UQBA 2XVPA 3BAWA 3KWSA 1I60A 3RJYA 3T8LA 3G8EA 5A6BD 2OU4A 2XN0A 3TYAA 2ANUA 1W17A 3I7SA 4XD5A 1GVFA 1G4TA 1RQHA 5HINA 4LNCA 1PZ0A 3NDOA 1K7FA 3NL5A 1YPIA 3J7HA 1DIOA 4IFKB 4N02A 2WVVA 3GNOA 3C2FA 3R5EA 1MEWA 3BK0A 2ZZ7A 3UVIA 5E0KA 5KZMA 3PAJA 2RUSA 5I5RA 4QGCA 4GWEA 4AHPA 4UTJA 2NT1A 3LCFA 4KRZA 3P60A 2NV2A 1IIGA 3HG5A 4REQA 1K77A 3VKDA 4DELA 1XSIA 1ZENA 3K46A 1Q3NA 3UXLA 1UR0A 1JI2A 4UFKA 4B9YA 4MOZA 2IW0A 1J18A 1KFEA 4CU7A 3MV01 1XCFA 4IJRA 4TVUA 1EH9A 2YL9A 1W1ZA 4XG1A 4QDPA 3AHZA 4D1IA 2WMGA 3RDKA 2DSKA 3AS2A 1PJ9A 2ZYFA 1FH7A 1XP3A 2UBPC 3BAIA 4LVAA 1UA3A 2P3ZA 4W8LA 3PWIA 4GGHA 2PDIA 3GZAA 1JZ3A 4ZODA 3QSTA 1T7LA 4JQ2A 2AQVA 3FEMA 3KBVA 3HPFA 1F74A 5AOUA 2C14A 3AIUA 3B9AA 3BZGA 2IQDA 5C9RA 3AYRA 1GWJA 3VKKA 1XSJA 3NR0A 3OLEA 2BVYA 4X2PA 2E9LA 1M41A 4Q4OA 5D2VA 1K6WA 2YR1A 1ZUAX 3VC5A 3UY7A 4MYAA 2BWGA 4LH8A 3EPNA 1A5OC 1JDAA 3FSTA 3WBEA 4XBSA 3M6DA 2W27A 2O9TA 4O57A 1P6BA 1K8CA 3AS1A 3O0FA 3IJLA 1HQTA 3IEBA 5C7VA 1XYBA 7ENLA 1KLYA 2V3EA 3MANA 3F4WA 2VX5A 3O6YX 1XRFA 4CQCA 2VFDA 3KVMA 4HD5A 4JL1A 3SB0A 3BXWA 4MMWA 1E73M 2W91A 1OX5A 1IGWA 5REQB 3R4IA 4NXSA 2RDWA 4WGHA 2J7HA 3W7GA 4NX0A 4MJZA 1R47A 2J66A 4UZUA 2Z28A 1PL9A 1QJWA 3CH0A 3LLFA 2NUXA 3THCA 5K2ZA 2J74A 3LM7A 1A47A 1BYCA 2QCDA 5A6BA 3KOFA 3ZXWA 3B9OA 3GU9A 2OPJA 5D2XA 1H7PA 1TA3B 3F4CA 3HQNA 1TZ9A 3WLLA 3FY1A 4QG6A 1O94A 3VDCA 1IF2A 4RPPA 1GVIA 3UXKA 1WKYA 5E9AA 2GGHA 3T7VA 2CZDA 3FJNA 3WJXA 1X1NA 1VBJA 2XIMA 4WF7A 4UXDA 2OCZA 4HCLA 2E6DA 4ZE5A 1ZJBA 3S0CA 2BLEA 3H2NA 5KINA 4JX5A 2WWDA 1K02A 1EC9A 2FHCA 2ZUMA 1MW3A 4S3EA 5BWAA 1A5UA 1X6LA 1LP6A 1EWEA 3WLJA 1BF2A 1I2NA 4XX6A 1JUBA 5DLCA 1TWDA 3RF9A 1Q8AA 4G1KA 2OOGA 4K8HA 9XIMA 3N6HA 2Z1SA 5LNSA 4TX8A 4CN4A 1FA2A 1BSIA 2IMRA 1M7OA 2A1YA 1GCYA 2VCBA 4O4VA 4AQLA 3E1F1 3I65A 3WL0A 2CLKA 3PB2A 2WC4A 2Z6IA 4YWSA 1AH3A 4X22A 3NXFA 3VKJA 3W76A 3S47A 2OX1A 5A94A 1X38A 3H24A 3ITTA 7A3HA 1TMQA 4OOZA 5LXEA 2V6AA 1W9BM 2WW5A 4J3VA 5D4YA 5J5DA 4X60A 2BXYA 4A3UA 1HXJA 3WDPP 2W67A 3KS6A 3EWBX 3WBXA 9CGTA 4B5UA 1FHVA 3TIMA 2C13A 1V08A 4KGJA 3BLPX 1MUWA 2QV5A 3BH4A 2NSOA 3PZTA 3VPLA 2QUVA 3LYEA 1TZ7A 3FKRA 2RHGA 1C3FA 5FACA 4S3JA 1S1RA 2B4GA 1DWIM 2WSKA 3CIXA 2IPWA 2W92A 3W1UA 1R87A 1QBBA 4K36A 1P0DA 1PIIA 3QPYA 3EX4A 3CBWA 3L0NA 2VRJA 2BP1A 1ZPTA 3VCNA 1QWGA 1YEYA 5K4ZA 3AHVA 3T44A 3O8AA 2WCGA 1CGUA 1NWSA 1OFRA 3RMJA 4AZCB 1PX8A 3W26A 1NTHA 1UCWA 1VEMA 5M03A 1KBLA 3TJIA 1UKTA 2FZBA 1RHCA 1QPOA 1UBSA 3QQ1A 3OBAA 3WLIA 3TAKA 3U0HA 4J3TA 3S83A 5CAHA 3MJYA 3CL6A 4WVXA 1VS1A 3KDOA 3W7OA 3WFAA 4F66A 4AISA 4B2DD 4BQ4A 4MJ4A 3TYZA 1C8XA 3SCQA 2P3EA 3FXGA 3UNTA 4Y8EA 4D2JA 3CUIA 4QQUA 3D46A 4UCGA 2ZRUA 2Y7EA 3GXPA 1H0GA 2PRLA 5A6TC 3H2EA 5CLWA 4JQAA 3KFTA 1UJQA 3BAKA 4H9UA 2YL6A 3KCOA 1MFUA 3EYPA 1AA1B 4P5UA 3GR8A 1XBYA 3HG4A 1XLDA 2FMNA 2O0TA 1JF5A 3QHMA 2WJEA 4X3ZA 2QAFA 2GDVA 3MUAA 4EXBA 2QUMA 1T99A 1NOFA 3BLOA 1T96A 3A4XA 1JRCA 4LJ3A 5I06A 3EDKA 3S1WA 2V30A 2XM1A 1A53A 2BVTA 1XLMA 1R85A 1JDFA 1YXDA 3DFTA 1PAMA 3TXZA 3VM7A 3MKVA 2QHAA 2CLIA 4EIVA 3E0LA 4Q8QA 5G2HA 4DUWA 1QXLA 4FZIA 1O12A 3R58A 4PMUA 1O7AA 1ONEA 3R6IA 4HPNA 3B0VC 1AD4A 2Q8ZA 1AUSL 2ZA2A 3W74A 4B3KA 3QVQA 1S2UA 4G8TA 3NSNA 3V5CA 5G4WA 3OG3A 2D1ZA 2WO5A 1MUMA 2Y5SA 1TR9A 1FWHC 4UOQA 1GJUA 1OB0A 2BNJA 2XFYA 1BD0A 4IUOA 3BLIA 4L1WA 4QHRA 4GZ7A 5GJNA 4UZSA 2VGBA 4K6AA 4I8DA 1U5HA 4NRRA 4U3CA 4YWIA 1U5JA 1XYCA 2HPIA 2FDSA 4ROPA 1S5WA 3MWCA 4EF9A 2EHHA 2VEGA 2ZA1A 3O6DA 1X98A 4QG8A 3S9IA 2CYGA 3GVGA 4GY0A 2OFJA 1E56A 4O10A 1J0YA 1IT0A 5I02A 3THQA 4CD5A 1GVRA 1LT7A 3W07A 4CN6A 1W8SA 2QW5A 4IOTA 3CTLA 4GQBA 4YVPA 3D3FA 1Q2RA 2Y1HA 2XYLA 4N9BA 3SCNA 4CQAA 1T8XA 1UYQA 1W3IA 1E9LA 4FO4A 2DZPA 5K3VA 5E1QA 5IDZA 5T91A 1G4SA 3TEVA 1YPFA 4WDWA 4V27A 3H21A 1FFQA 3HFYA 5T8GA 4UTWC 2WHMA 4DLFA 4G2DA 3SN0A 4CU8A 3IVUA 4FF5A 1EJ7L 3MP3A 2PTZA 4MFEA 4ZOCA 5PTDA 3NJ3A 2ABAA 3OQEA 3RYSA 1VBHA 3WLPA 1N7KA 2POTA 2WCAA 2C0AA 1W3TA 5GJMA 4C6LA 2PU0A 3BUVA 3VK5A 1JG9A 1Z3NA 3XINA 4LBRA 4N9DA 1DOSA 1QRQA 3IWPA 3VGDA 1V02E 3GYEA 4OV4A 2XVNA 4MNMA 5CZKA 5HUPA 4BF9A 1TMHA 1V3KA 4H2HA 4JTGA 2J79A 4UTIA 3HFTA 5BXPA 4LB4A 3PUDA 4OV9A 4DJDA 3NQVA 3HU7A 3ONBA 3EWXA 4DAIA 1M04A 3ZS4A 3AMGA 3KBWA 1PTGA 3K30A 1LQ2A 2X41A 3OP2A 4RLIA 4WY0B 2BGSA 2OR2A 1RJQA 2V38A 7TAAA 1W1TA 5GQBA 4I7VA 2H8XA 1Q6OA 4HU3A 4IICA 1FFRA 4Z1DA 4LS0A 5GVJA 4I5UA 3ZJ8A 4ONVA 2VDIA 1XH2A 4HSHA 1HFBA 2P10A 1X39A 1WBJA 4Q6JA 4LUJA 3EKLA 3Q37A 1XHGA 3CZ8A 5AN7A 2E1WA 4CEUC 1XDMA 3B8IA 3MI6A 1B3YA 4FALA 2GUUA 4MF4A 5EBUA 4H8VA 3RMEA 7ODCA 1UD8A 3B4UA 1NAL1 4ZBCA 3DX5A 4W5UA 3EOUA 3FVDA 3MA8A 1OCNA 4DZAA 5FL0A 1BF6A 4LRTA 4C6CA 2C19A 4H9XA 4WXZA 1IEVA 3N15A 3NA8A 5A3HA 3EOOA 4UTUA 3OGRA 2FIQA 4Q3MA 4V2XA 2I16A 3TQ0A 2J6VA 4AZ5A 1J2BA 2QEZA 4M29A 1JZ8A 3GXFA 3CLWA 3TN4A 2YLLA 3QKEA 1TYGA 1DJWA 1ADOA 1UJPA 1XLFA 1MQQA 3W27A 1XH0A 4R7OA 2RH9A 3AIRA 2VOTA 3PZGA 5L9FA 3P67A 5IXEA 1I0BA 3ARPA 1GUVA 3ARSA 1EWDA 4B90A 3LLXA 4IFKA 3M0YA 3TCSA 4AZBA 1B3ZA 5CQ1A 1PPIA 1NDYA 4FNRA 1Q4WA 1R3VA 2QJJA 2ZFAA 3V5FA 4L6DA 1F9CA 3HGRA 1DVJA 3NOYA 1OZMA 3RX3A 1A5LC 5JBFA 3NXLA 1P0EA 4AUBA 4RZ5A 1GTHA 4DJFA 4GMEA 2WBKA 3K8KA 3DBPA 5HOSA 1F5ZA 4YVXA 2VFIA 3KTSA 3HG3A 1WXJA 4AX6A 1UR2A 4KKXA 4M56A 3BAXA 3R0KA 3KRSA 6CGTA 3G1FA 3RCMA 1TPB1 3C0JA 3L4UA 4UR9A 1LM1A 3U6WA 3IGHX 1UW9A 2X1IA 2VQUA 5DRIA 1JXJA 3ABXA 2X2YA 4WUIA 2OT0A 2IKIA 3E96A 5FF0A 8A3HA 1YNYA 3L9CA 1FVPA 3U4AA 5FEWA 2PGWA 3MMWA 2YPIA 3STGA 1W1B1 1QI4A 5MKGB 5I3FA 1V93A 3MZNA 3TU9A 3NDZA 1R0MA 4PGLA 3ELFA 3CYVA 4UTTC 5C8BB 1JAEA 4MSSA 2H3BA 4ACYA 3DFHA 3WJWA 6TAAA 1K03A 1SGJA 1R2SA 2ZE3A 3F1QA 1BYDA 3VD5A 1JCJA 3CHDA 4POCA 2ZVRA 2XTKA 2KZHA 1TX2A 3T4CA 2E1DA 2XSAA 3F2CA 1SVDA 1M3UA 2BFGA 3CMGA 4MZ8A 4MDOA 4O28A 2PC4A 1O6IA 2PP3A 1BVZA 4Y6GA 3M7SA 1NEYA 3T0CA 3A5FA 3ITYA 2W62A 3LPPA 2BHZA 5C71A 1PWLA 2B7QA 1XYLA 4LFYA 4UNLA 3M5ZA 5AC7A 1KXTA 5REQA 3VABA 1IQ8A 1PYMA 4HCHA 2ATSA 5FOOA 2XSBA 1NJJA 2BY3A 1VFTA 2GSHA 3O16A 1SSGA 1DL3A 2V5JA 1TJ2A 2DW6A 2C8NA 4LVFA 2D0HA 1TA3A 4S39A 1BYAA 1OGBA 3CGTA 1QK2A 4H00A 4GI8A 2O4MA 2Z27A 3BCDA 1FXPA 4XZIA 4HMEA 4M0XA 1XLAA 5D2YA 2OSYA 2OLAA 2ZZ3A 4PTDA 1GHSA 1Z7AA 3U3HA 3SRKA 3NWRA 3KOWA 1KQYA 3N9SA 2ZX6A 4ML4A 3SY5A 3LX9A 3T1GA 4DM2A 3DFNA 4GIYA 3WLHA 1J12A 1W1PA 1DQXA 3T0BA 1ZJHA 1D3GA 1OYCA 3CV1A 1LORA 1UWTA 1BQGA 2I9EA 3AMLA 5I07A 1E15A 1V5XA 4XZMX 1UP2A 1VEOA 1C7TA 1WZLA 4UR7A 2FKPA 3U8GA 1W6TA 2OXNA 2WBGA 2O9OA 1QHZA 5HJLA 1WPCA 4Q8NA 1CENA 4F2UA 2PS2A 2ISVA 1WUEA 5EA9A 4RE4A 2EPLX 4OZOA 4HNLA 1ONXA 4MM1A 4O52A 2JFEX 3V3WA 1U1JA 4IJCA 4NT0A 1MDRA 1ML1A 1DWJM 3SN1A 3TTYA 3OGSA 4PMDA 1DXEA 3EWUA 1F2JA 1LL7A 1N82A 2OGJA 4C6QA 3KRZA 3BOLA 2DDXA 2RDUA 3AUOA 4A4AA 3ZT6A 1A5CA 4Q8UA 5D8ZA 1ZP3A 3I10A 3CIVA 3CK5A 4JQ3A 3T09A 4FI4A 2NQZA 1L0PA 4C6FA 4E3VA 2G4JA 4EXAA 3GO2A 1J5SA 3WJZA 1E5JA 3B0UX 4UTFA 3O15A 1H7XA 2I9UA 4N42A 5DXXA 2UY5A 3U7VA 3AMDA 1TELA 1PKNA 3THUA 1LOQA 1EUNA 1REQB 1P1MA 1AQMA 1GGOA 3R0UA 4QEHA 1QW7A 3GR4A 1P7TB 3AO0A 1P5BA 2QCHA 4PC8A 4JQ4A 4C5YA 4AZCA 2VYOA 5FI8A 1OCBA 4PBGA 4Q4RA 4XAZA 4W5ZA 3UZ5A 3DESA 4DUOA 5CG7A 2QCMA 4YYCA 1W3LA 1E55A 1YE6A 3TJLA 1S2WA 1BKSA 3W84A 1ONRA 1POKA 2YYTA 3W28A 3WNKA 1UR4A 1TJRA 4ZENA 3SECA 2NXGA 4MZYA 1KC7A 3K4AA 1WNOA 3RILA 5LNVA 4DJEC 1YHTA 2PWUA 1VFOA 2Q02A 1ZAJA 3EDDA 4YXGA 1XGZA 2Z26A 1ZAHA 5XIMA 1Z41A 1IWBA 3WFLA 1W1VA 2GGEA 1DJHA 1Y65A 3BAJA 2IS7A 3DYMA 2J9ZA 4JTAA 3QYQA 2XDFA 4TVCA 5C54A 1HKJA 2DJLA 3OLDA 3AMCA 5AFDA 4F3HA 3N12A 2QCLA 2DSVA 4GPNA 2G95A 3N25A 1H5VA 4R5EA 4LTSA 5FAJA 1TX0A 4GHRA 2D23A 3LHWA 3G3DA 4WJ8A 4PZVA 4A2SA 5M2FX 4JR5A 1FH8A 3G0XA 2NLYA 3MWAA 3D5HA 3TN5A 1FXQA 2CBJA 3B0PA 3M5YA 4PMJA 3SSZA 4KEVA 4FXRA 3QFEA 3DYPA 2OEKA 1QOXA 3M0XA 2CEQA 1XIMA 4QRNA 5DCEA 1AQ0A 1CBGA 1TTIA 3I3BA 1V3LA 4IX0A 4X0NA 4D6IA 5C0QA 1AVAA 5AHMA 3VOGA 2CLOA 1TPH1 4BKNA 2RGMA 2IQ0A 2GYIA 3AAMA 2Z0IA 1XLIA 1QVBA 2YDSA 1OEPA 2ZUWA 3N4EA 4KWVA 3H54A 1I6NA 1BVWA 3LI1A 4AF0B 1GZGA 1OD8A 1Y5XA 3N3TA 3T81A 1EO5A 4XAFA 1QPRA 1VYRA 1E6PA 3AU6A 1U33A 1MW1A 2VT0A 3K5XA 3EX2A 5CPQA 3W83A 5I23A 3QYSA 3WLSA 5HNNA 3ITCA 9XIAA 2HEJA 5G2IA 4F0LA 4GQ0A 2DSWA 1NOWA 3PUOA 1K9DA 4W4QA 3M5XA 1DJXA 1CB7B 4RDWA 3B4YA 5HATA 1XBZA 4U2ZA 2NX1A 4N4QA 2CLHA 4RW5A 5G5IA 2VGFA 2JKEA 3HMJG 4NZ5A 1UR8A 3VZYA 3EOEA 2OVLA 3HZ3A 3Q65A 4MNLA 1W9UA 2VRKA 1H1ZA 1DXIA 5BU9A 3EWYA 2XVKA 1V7YA 3P3BA 2VFHA 5BXSA 2X1TA 1S5MA 3KHJA 4XISA 5CPNA 2ZRVA 1OD0A 4QFUA 2BTMA 2WMJA 3QFWA 1LL4A 4L5ZA 4AWTA 4LW7A 2AL1A 3VIIA 3BTNA 1XIIA 4UBPC 2GOUA 4KWOA 3BV4A 3TC7A 2OZTA 3CWHA 3ABQA 4JYFA 2MUCA 3UR5A 2EXOA 1EGVA 3GC4A 5T9CE 2PDJA 1JZ6A 2YCLB 4HNUA 3AQUA 2XVLA 1VFSA 3VDHA 1E0VA 2GWGA 1V0MA 3QMRA 4WY0A 4JNZA 4F40A 4Y9AA 1UQYA 1YXCA 4D6JA 4LY4A 3GBEA 3A4AA 1BQCA 1FRBA 4Z2JA 3P0XA 4ES4A 2PP1A 1TVPA 2GGIA 3LY0A 3AC0A 5HQMA 1BVNP 3NQEA 4AZGA 3EMQA 3W38A 3DKLA 4KWWA 2Q3OA 1QNRA 3RJXA 1CDGA 4NIRA 5DXYA 4RE3A 2O56A 1BGGA 1OFEA 2XIOA 2ZTJA 5I00A 4JTQA 4MDPA 4A3YA 1EQCA 1W32A 5C9ZA 3QSRA 4IISA 2NUYA 4F0RA 3N34A 2NWRA 4LBUA 5H8UA 4U2YA 3CQJA 3PG8A 2NW0A 4UTKA 2ZWZA 3E12A 4XIAA 2WANA 1WP6A 3GHUA 3RRAA 4M1BA 4ERAA 1EHAA 1HJQA 4ZCWA 3FDKA 4DN1A 4O17A 5BMWA 2WSPA 3FFSA 1AK5A 1MDLA 4J7RA 4LS2A 5HULA 3WMLA 3T4WA 1S3TC 4XZWA 3CO4A 4GABA 1GOOA 2X1RA 1R3YA 1RD5A 4PCNA 1M1BA 3HGJA 4DY1A 3T07A 3S2NA 1IYXA 1XISA 1PX4A 4NNBA 4BHYA 5EMJA 4QISA 1HX0A 2JIWA 3PPHA 4AD4A 2I5IA 1O1HA 3ABRA 3NQFA 4AFYA 4DJDC 4ZSUA 2E5CA 1GKPA 4NX5A 1UWUA 1K8YA 2E9BA 2PCEA 3W7JA 1XQLA 2HS6A 3RRXA 2ESCA 3G1SA 5CG0A 4E8CA 1H3GA 3WUBA 3CHCA 4R7JA 1XXXA 3DGRA 4YNGA 1F6YA 1VFHA 4N4PA 3OW1A 2DIKA 1EHNA 3ITVA 1GOQA 2I57A 4ZOEA 1EZ2A 3E38A 2CXGA 3WQ6A 4TUFA 1OWQA 1QFEA 2PEVA 2WHLA 4X0VA 1RP8A 1UD3A 2A4AA 1SO4A 2PF0A 2IPFA 1V0LA 4JTFA 2XUCA 3NDYA 1SFLA 2YZRA 4GIRA 4EAMA 2HMCA 4H7VA 2E7FA 2QIIA 1U30A 4B5SA 2O92A 1NH6A 1ADDA 2L5HA 2G3MA 4JN6A 5MKGA 2J4GA 2HWGA 1VLWA 2C1IA 4DF0A 2GWNA 3DIPA 5HQLA 3A13A 4J3SA 5CPOA 1DE5A 5KEZA 4PR4A 5JVLA 4IH3A 3W1AA 5I3IA 2QDHA 4JL2A 1TV2A 4FNPA 5BXTA 2BXZA 4XZNX 1HN1A 1NF0A 5JBDA 2CERA 3UG5A 5IFTA 5KZDA 3LV6A 1OC6A 2CHNA 2DIJA 3ANVA 1ISVA 1GQKA 2J77A 4AD2A 3M0KA 3ARVA 1TWZA 4Q8PA 3GW0A 3M7WA 2PBOA 1GVQA 4A8LA 3T05A 1TPC1 4Q8TA 3OG2A 4K68A 2E25A 7REQB 1KCZA 1MYRA 3W7IA 4CKQA 4B5NA 1AH4A 6A3HA 3SADA 3NQ2A 3ZYZA 2D73A 2GJNA 2PDPA 3O07A 4ATDA 1MSSA 1UKOA 1HJSA 1R3SA 5GNXA 3W71A 3SQSA 3VM5A 2DZBA 1UMYA 4RUBA 3QKZA 4DJFC 2YBVA 5DMNA 4HK6A 1U22A 4GACA 2FDMA 1ZJIA 2P1FA 3GDRA 2R1LA 3PULA 1HKWA 4LVBA 1WDRA 3O6AA 2PWFA 1FY6A 5CBJA 3GKFA 2QGYA 2QPUA 3T2OA 4D6GA 2Y24A 2E8YA 1AJ2A 2BDQA 3RPTA 3GVWA 2YW4A 4PCTA 2WKGA 1IT7A 4E2VA 2SFPA 3F03K 4NY2A 4EKJA 1BWLA 2VEIA 3CZKA 4CD6A 3ABZA 1OINA 3W85A 3DERA 1MXDA 4UFJA 1E0WA 2OTDA 3VU2A 4NRSA 5EMUA 3S6OA 3T8QA 3VOJA 2ZX5A 2ZA3A 1DJGA 4HQVA 2Y85A 1JCTA 3VYLA 4XTDA 1OM0A 4JYEA 4JY9A 2OO0A 3QZEA 3ALFA 4IWWA 4RZ4A 3UWQA 3LNMA 1VYPX 1UR3M 2QJNA 4D6DA 4PFMA 2X09A