1FH8A

Crystal structure of the xylanase cex with xylobiose-derived isofagomine inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords BETA-1,4-XYLANASE
total genus 128
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fh8A00
2WWCA 2CNCA 4J3SA 4BS0A 3WL0A 1V0MA 3CPUA 4ATWA 4CU8A 3ZT6A 4D6IA 3GZAA 4OOUA 9CGTA 4ZENA 2GVYA 1QI0A 4U31A 2VZUA 4UFHA 1V02A 1EHNA 2J7GA 1LJYA 1XCXA 3WQ6A 3AIEA 2X0YA 3HJEA 4J3VA 4CD6A 2WBGA 5CSUA 4H8VA 4GI8A 2EPMX 3WH5A 1OBAA 5C71A 3AIBA 1MVYA 2PBGA 1D2KA 3BAJA 3QOKA 3AHZA 1UWIA 3DECA 3KL5A 2VCBA 2GJPA 1DWFM 1QW8A 1Z32X 3VO0A 2B31A 1R87A 1GOWA 2D3NA 3MO4A 3MKKA 3ZT5A 3VGEA 2CBJA 1PX4A 1XSKA 1QNRA 1MWOA 4XUYA 3FY1A 3WQVA 1PJ9A 1JL8A 1J9YA 3GYCA 1N82A 3GBEA 3QGVA 4JKMA 3O6AA 3AHVA 1E6ZA 2FGZA 2J7EA 4Z2JA 1VAHA 3W6LA 1FFRA 3SIMA 4TX8A 1HVQA 5BRQA 3WKZA 4ZE4A 5CG0A 5M3WA 3ARZA 1M7XA 5CPQA 1VJSA 1PX3A 3VM5A 1WZLA 3OA5A 1UWTA 1XC6A 1HKKA 3WF4A 1CGXA 3AXHA 4N42A 4BCEA 4U3CA 5HDRA 1X6NA 1BG4A 3WNKA 1V3KA 2XGIA 5GQBA 3CH9A 5E0CA 4RL3A 5CPSA 4JIEA 2A3AA 4K68A 2D1ZA 1QNPA 5A6SA 3VMOA 5IFTA 1E56A 3N11A 4DWSA 1BYBA 3WD4A 1BTCA 2XIBA 3NCOA 3ZOAA 1IV8A 1NWUA 4JAWA 4UTFA 4AZCB 1F4HA 3FN9A 2ZX9A 4NF7A 3VX1A 1GJWA 2FGLA 2VRJA 3CZJA 5TD4A 1O7AA 1U30A 2Q8XA 4PMOA 3APGA 3WMBA 5AYBA 1VB9A 2VRKA 3NDZA 4W8AA 2E4TA 4LYQA 4TUFA 2XVKA 4BF7A 1OSEA 3A3HA 4RE3A 1NWRA 2GJRA 3VM7A 2QHAA 3AHXA 1C90A 1QBBA 1U2YA 3PZUA 2CITA 1CEOA 1TVNA 2UY4A 1QHZA 2UY3A 1AQHA 2J7CA 2XGBA 4MJ4A 2GUYA 3FNDA 4LX4A 2EPLX 2WCGA 4CVWA 4MB5A 1GPFA 1S46A 3PZIA 4AD4A 4B16A 3VD4A 1KGXA 5E70A 1QHOA 3LPPA 3ARSA 4C7GA 2VZTA 3WF3A 3B9DA 4HMCA 2D24A 2WMIB 2BHYA 1H5VA 2YBUA 4H7VA 1DWJM 4IM4A 4BQ4A 3VD3A 1X6LA 4M82A 4EKJA 4KRTA 4GI9A 1VBRA 1F4AA 1B3XA 2JALA 3BLPX 2VL4A 5JUVA 4UQDA 1G94A 5M5DA 1BHGA 3DC0A 1UD3A 1C7TA 2XVGA 1GCYA 2J7FA 4A3HA 4ML4A 4URIA 1E70M 2G3MA 1UG6A 1FP9A 4Q7NA 3ARUA 5D9PA 1L8NA 3WMCA 4TXEA 3OGSA 5E0FA 3JUGA 3OB8A 1JZ6A 2OYKA 1W9UA 1JNEA 1NWSA 3L4ZA 3L4WA 1FHLA 4PTXA 3ARVA 4GO9A 3CUFA 4CN1A 2WCSA 4W87A 2VR4A 3AHYA 3VIHA 1CTNA 3GXIA 1UA3A 1UWUA 3A4XA 4W5UA 4TVCA 3AZTA 2VX5A 1V6XA 2YLAA 2DEPA 5D8WA 2ZUMA 3BC9A 1P6WA 2VVNA 1E6XM 3CIVA 5AC5A 1E15A 2X8RA 4AYSA 5CJ5A 4FLQA 4LYRA 3MUIA 3BCFA 3W28A 4J3TA 4J28A 1KB3A 1B1YA 1WCGA 3GXDA 3B9AA 5DEZA 2WZHA 2VURA 1KXHA 3SUVA 4ACYA 3PZMA 2E9MA 5GPRA 2DT2A 1UHVA 1ZBVA 2PC8A 2V5CA 2YJQA 2XVPA 3WDJA 5D9NA 1TG7A 1EH9A 3CBWA 1AQMA 2W4XA 5HNNA 3AS3A 2WYSA 4TVDA 3WNNA 2G3NA 2WSKA 1KQYA 3SEPA 3G6MA 5A95A 4UFKA 1GONA 1CXIA 3TTOA 1JZ5A 1V3MA 2Z1KA 3QOMA 2DIJA 2CPUA 2ZUUA 2OSYA 5JIPA 1E4MM 4AZGA 1BGGA 2VX6A 4HMDA 4TX6A 2YIHA 1RPKA 3U5UA 1VF8A 3AXXA 2G4FA 2J79A 3IJ8A 3UG4A 2X09A 5I23A 5C70A 2ZICA 1E3XA 4J3WA 4KGLA 1V3HA 5IXEA 1MW1A 2ZXBA 4AZ7A 2HVMA 3QHNA 5D8ZA 2YA0A 1XH1A 1QI4A 1J12A 4HTYA 1JYVA 3HN3A 4Z2LA 1QPKA 2CBIA 4UFLA 1GVIA 4ZXLA 2G8ZA 3ZJ7A 4GIAA 5AY7A 1WE5A 2CERA 3VNYA 1Q6CA 1XYFA 2DIEA 3KZSA 4W7VA 2J25A 2ZX7A 3ZM8A 3EMCA 2A3BA 3EDJA 4D6FA 1BQCA 2DH2A 3W27A 1NP0A 4A3YA 1CIUA 4P7NA 1GHSA 2VO5A 3WDHA 3VGDA 3CZKA 3OZOA 1JXJA 1ZBKA 3ZT7A 5A6MA 1E9LA 1XRVA 4JL1A 5E09A 1O6IA 3VINA 1J0JA 1FH7A 5A6JA 4CGTA 3WH6A 1I1WA 4TVUA 4CKQA 2CBVA 3L2MA 3O9NA 6A3HA 3ZO9A 3L2LA 1XHGA 2D22A 3MV11 3BSGA 3NUKA 1I75A 1NOFA 2BY1A 1OM0A 1K9TA 3AIRA 4MAZA 1V0NA 3W25A 5DT5A 3TOPA 4JFUA 4BA0A 2DDXA 5BXSA 3ARTA 4UFJA 3DYOA 1QBAA 4HOZA 3WDRA 4JFVA 5IHSA 1B31A 2XYLA 1GOKA 1EOMA 2OLHA 1XCWA 2PWFA 1WZMA 3EDDA 3T2OA 5BRPA 3T2QA 4QCFA 2WB5A 4CVUA 1UR2A 6CGTA 3G6LA 2YKKA 3FHQA 3PHAA 3WD3A 1UD8A 3VD7A 3MANA 2WBKA 4QP0A 3WNMA 3A47A 4AEEA 2VNCA 3SCWA 2WKGA 1H49A 1UWQA 2DSWA 3EDEA 4W88A 3RILA 4H8HA 2WW5A 4GO8A 2ZX8A 3THDA 1J0IA 5BYWA 4MJ2A 4PRWA 1HJXA 4ATLA 2CCRA 1JXKA 3AYRA 3M7SA 3VIPA 4CD5A 3MSDA 3DHPA 4M80A 1FH8A 1PEZA 3CZGA 1MQQA 2O9OA 1JYNA 2FHBA 1GZJA 5E6ZA 4M56A 1G01A 3WMSA 3CUIA 4X0NA 1WO2A 1QI2A 2XWDA 1UKTA 2EO7A 2W92A 3AHTA 4UQCA 1VEMA 1W2VA 4UOQA 5EFFA 3WH7A 2Y24A 4XZWA 5JBEA 3L4YA 3RJXA 2VCCA 1E4NA 5GNXA 4ATDA 2WK2A 2EJ1A 1KGWA 1VFUA 1TA3A 1EO7A 5A6BA 3VU2A 3WNLA 2J4GA 1QOXA 5A6LA 3CMGA 3FXYA 2AOSA 4AIEA 1G0CA 1MXDA 1HT6A 1UH3A 4FK9A 1HKIA 4GQRA 4U5KA 5FD0A 1RD6A 3ZMRA 1E6PA 2JIWA 1ISWA 4HMEA 4PMRA 4HPHA 3GNRA 3U7BA 4CN4A 5CPTA 1E0WA 2W67A 5LA2A 3WN6A 1JZ7A 1HJVA 2IUZA 1JAKA 5CXPA 4BZYA 3VIJA 5A2AA 1LL6A 6TAAA 5D9OA 4PMQA 5LA0A 1UD6A 1E6RA 1FP8A 2EBNA 3LMYA 2WXDM 1AVAA 1CPUA 4KGJA 4V2XA 4M1RA 1FA2A 1MQRA 2D0GA 1UZ4A 2ESCA 5LA1A 2WNWA 5E9AA 4BQ5A 1DTUA 3AJ7A 1BVZA 1W91A 7A3HA 1K9DA 2AAAA 1GOOA 1E73M 3SUSA 1VFFA 2EQDA 1W9PA 1WZKA 3K8MA 3B8SA 1E0XA 1HJQA 1WDSA 3WF1A 3WNPA 4E4PA 5CQ1A 3AFBA 3TP4A 3CGTA 1QVBA 3SCTA 4U5IA 4PSPA 4D6HA 4S3JA 5A8PA 5CGTA 4HZ7A 3W53A 2JF7A 1LWJA 1KCKA 4CD7A 5A6AA 1WP6A 3D3AA 4PYSA 4D6GA 1TA3B 1E5NA 3CHEA 1SMAA 3EBVA 5A3HA 5A94A 3W4RA 4NSBA 3O2LA 2PWDA 2WVVB 4AZIA 1CLXA 2UWFA 1PX8A 1HJUA 2GDUA 1W32A 2O9RA 3QR3A 1LG1A 3U5YA 1GUVA 1US2A 2PWGA 1VEPA 5FL1A 3VILA 1CDGA 2IXUA 3PZOA 1FFQA 2J74A 1JF6A 3J7HA 2WHJA 5I5RA 1BF2A 2XPKA 4HA4A 1B3VA 2QPUA 3T2PA 3UEQA 2VTFA 2J7HA 3L4XA 3AMDA 5I77A 2D0HA 2BVTA 1XV8A 2WHKA 2VVSA 4DUVA 5AC4A 3WDIA 2J8GA 1W1VA 4FLRA 1CXHA 4AZ5A 1JF5A 1V0KA 3NSXA 4P8WA 4H2CA 3W81A 4AWEA 2WVSA 3WH9A 1HKJA 3IANA 1AMYA 2CEQA 5C8BB 1V6YA 2VZOA 4AD3A 3AOFA 4F79A 2VUYA 7TAAA 1EDGA 4DWSD 1X1NA 1JZ4A 3CMJA 3OLGA 1DHKA 2NT1A 4ACZB 2F2HA 3K8LA 3OIHA 3WUGA 5IFPA 1Q6FA 3T0AA 4PTMA 3WEOA 1NARA 2ZIDA 4FMVA 4HA1A 4JZ5A 4QDMA 2ZXAA 3K46A 1H1NA 4HU0A 2WLYA 4AD0A 2BFGA 1C7SA 3II1A 2X0HA 2JF6A 2D2OA 2WC7A 2BY0A 3N17A 1H3GA 1J0KA 4NZCA 3RM4A 4UQEA 4CCCA 2DPEA 1DEDA 3VIGA 3MSGA 3LPOA 2V3GA 1UD4A 4GQQA 5LYRA 4JKLA 1VJZA 1YQ2A 5BROA 3VTRA 1IT0A 4OBRA 1W1PA 2VT0A 3N15A 1R7AA 3L4VA 1UH2A 1WNOA 1TUXA 4PCSA 2E40A 3W82A 1H09A 3SUWA 3NSMA 2JFEX 3THCA 2CHOA 3AIVA 1ODUA 5E6YA 1MFUA 5BXTA 2GK1A 3ALFA 4F9JA 2VI0A 1J0HA 1D3CA 3UCQA 4JKKA 4E2OA 2QPSA 1OGBA 4AZCA 1CZ1A 3CLWA 5ABGA 3DYPA 3SUUA 4CN6A 3ARXA 3ZJ6A 2Z1SA 3GTNA 4NRSA 3WQ8A 5A1AA 1ZJBA 3MMUA 4B9ZA 3ARWA 1JI2A 1KXQA 2CHNA 4IPNB 2DGAA 3EDFA 2ZOXA 4MB3A 3AS0A 3CTTA 1C3FA 3ZSTA 4ZE5A 1UWRA 1M04A 3QHMA 2VZSA 3VDCA 5DMYA 3UR8A 1UA7A 3FW6A 3T0BA 3GBDA 4W7WA 3SUTA 1NOWA 1CLVA 1M01A 2VMFA 4WJXA 3RPMA 3W29A 1Q6DA 3TTSA 1SFSA 2E0PA 3SCPA 2BVYA 4BQ2A 3ZJ8A 3A6OA 4UZSA 2WMKA 1TFVA 3PTKA 1PZ3A 1MFVA 1JD7A 1VENA 1B90A 4UQBA 1UQZA 4B9YA 1GOQA 3VIIA 4TTGA 4D1IA 2E3ZA 3IAQA 1OT1A 4OUEA 2VR5A 2VZVA 1ZL1A 2W62A 2V3FA 3AIQA 2VC9A 4PTVA 1HVXA 2WM0A 3A4WA 3SCNA 1EXPA 5GNYA 2PWHA 1EIBA 1JZ3A 1E43A 2BS9A 2F8QA 4PUEA 1KXVA 4M81A 3GXMA 1QW9A 4W84A 1CWYA 2VX4A 1V3IA 5M17A 2YA2A 1D7FA 3WD1A 1HKMA 3ZJKA 4P8XA 3EYPA 1CENA 1BYAA 2F61A 4AISA 2A3CA 1UZ1A 2WMGA 4D72A 5I78A 5JBFA 1WKYA 5AYIA 3K4AA 1YHTA 8A3HA 2C8NA 1G5AA 3WSUA 3GNOA 3VGHA 2DQXA 1JYWA 3WL1A 2ZUTA 2XSAA 3GNPA 3FAWA 2C0HA 2WVTA 4P7RA 2GFTA 1I1XA 1KBKA 5DF0A 4W8LA 4P8VA 1WAWA 3UG5A 3K8KA 3AQUA 4M8UA 4BQ3A 1E4LA 4HZ6A 3VD5A 1ZBCA 1US3A 4GPNA 2DT3A 2DSUA 2X1IA 4QLKA 1FHDA 3N12A 3AYSA 5EFDA 5ECUA 4FLOA 5A8NA 1MW0A 3L4TA 4D6CA 1G1YA 1ZBWA 3WFLA 1VEOA 2J78A 3T08A 4JCMA 4YHGA 4GI6A 2ZWZA 4UFIA 4IISA 5A8OA 5EMYA 3WQ5A 3OBAA 1UD5A 1QNOA 3TTQA 1XH2A 1WDRA 3S6TA 1UR1A 4WIWA 4CD8A 3BAIA 2ZX5A 3MU7A 4AXNA 4PMYA 3UR7A 1MQPA 4MTVA 1H0GA 4AW7A 1BAGA 4QAWA 2C7FA 5A6BD 1C8YA 1WDPA 1NOUA 1UH4A 4GZJA 5DO8A 1B2YA 2J8FA 1LLOA 4XZBA 1V0LA 1JFHA 3N18A 4AMCA 4GZEA 2YOCA 1E0VA 3OG2A 5CZKA 4ZXOA 1VIWA 2QMJA 1FH9A 3AMCA 4P7LA 3WUFA 4J7RA 1BG9A 1J18A 2WANA 1JGIA 1BPLB 2OWWA 3UG3A 1Q6EA 3WDPP 1EA9C 1VBUA 5DFAA 1B3WA 1R85A 3FAXA 2EEXA 3VX0A 3VD9A 4OKDA 3W24A 2ZX6A 2TAAA 1FOBA 1G9HA 1PAMA 4J3UA 1KFWA 1GORA 4GINA 4M29A 1OIMA 3GDBA 4JFWA 3WQWA 4OZOA 1E1FA 1E72M 1GOIA 1PPIA 1TR1A 1JI1A 1TCMA 5A6KA 1NWTA 4D6DA 3AS1A 3UETA 4PEEA 1ITCA 4GKLA 1EDTA 1EHAA 4MDPA 5I3DA 1B3ZA 4CU6A 1GQKA 3VIKA 4B3KA 1NQ6A 1XD0A 3GH7A 4DUXA 2J77A 3VDAA 3AXIA 4ACZA 1OD0A 4OIFA 3SCVA 2QF8A 5D9MA 2XG9A 4JL2A 1HP5A 2W5FA 2HISA 3NIYA 4AIUA 1ISZA 2XSBA 1HJSA 1HXJA 2XFRA 2DSVA 5I2UA 3POHA 3PZTA 3AIUA 2Y4SA 2D0FA 3WBEA 5HOSA 1RH9A 3S2CA 3WF0A 1GQJA 3PZNA 2WAGA 3SCRA 3PZVA 1E40A 1LF1A 4YPJA 3MUZ1 4PMNA 1GOMA 4HZ8A 1E55A 2O9TA 2BY3A 1ISXA 2QMKA 1ZU8A 2RGLA 2XHYA 2FHFA 1B30A 3D5HA 5A2CA 2EPOA 3HMCA 1GNXA 2FH6A 3VGFA 2XIIA 4HOXA 1V6VA 2PBOA 1QHPA 3OLEA 3POCA 1PBGA 1CNVA 2WZEA 3MUY1 4HU8A 4W93A 2VOTA 1OT2A 3VDHA 5HPCA 2V3EA 1CGVA 2V5DA 5A8MA 4UR9A 2YL9A 4B15A 3MMWA 1SMDA 3CHCA 1LQ0A 1J11A 2DSZA 4PMZA 4V28A 4YHEA 2WVVA 3BLKA 1NP2A 2DT0A 5ABHA 3AZSA 1H0IA 2PF0A 3BH4A 2QLYA 2OWCA 1RP9A 3U7VA 1BGAA 1W2PA 5A2BA 3RJYA 3VIOA 4PSRA 2GK1B 4E8DA 5BXPA 5BCAA 1W3KA 1R8LA 4N0RA 3CUHA 4MB4A 4WKFA 1GQLA 2XM2A 4UQ9A 4H41A 2G3JA 1OB0A 2UY2A 3AROA 3EDKA 4P8UA 4MADA 4M24A 1KWGA 1LL4A 3N13A 3I3BA 4L4OA 2WC4A 2J62A 1JYXA 3N9KA 3RO8A 4X9YA 1OINA 2D20A 2JIEA 1XSJA 1UD2A 1ODZA 1GJUA 4CCEA 2WLZA 2YL5A 1TE1A 1E5JA 4MAVA 1V02E 3T0DA 3RM8A 2DT1A 3VKKA 3M6DA 1H11A 2O92A 1JZ8A 2Y8VA 3BXWA 3WH8A 3NSNA 2WKLA 4F8XA 1E71M 1TVPA 1CGTA 1WPCA 3F4VA 3CZLA 1OIFA 1CXFA 2IXVA 3BAYA 4HOWA 3ZQ9A 1W9DM 1NM9A 5FL0A 4KH2A 1EQCA 4J27A 4P7OA 2EPKX 2E9LA 3BMWA 3ZR6A 1EDQA 4EE9A 1HL8A 4RE2A 1CYGA 2OSXA 1CGUA 4FLSA 5CLTA 3WUBA 4AD2A 1HJWA 3F5KA 1SYTA 3BMVA 1ZB5A 5GNZA 3PTQA 1CGYA 1CGWA 3KE0A 1JD9A 4Z2KA 1U33A 1AQ0A 1MW3A 3IJ9A 1OWQA 3OLDA 1XD1A 1V6UA 4LYPA 3ZIZA 3OLIA 3W0KA 3SCOA 4HA3A 4ZEPA 1QNSA 1WZAA 2WVUA 1W3HA 4CD4A 5CSYA 3VGGA 4DWSB 1J0ZA 4KRUA 3RMEA 1QNQA 4U3AA 2V38A 4QFUA 2J75A 1W9XA 4DM1A 4J3XA 2EXOA 4CCDA 3CUJA 3MMDA 3AMKA 1UR0A 2VCAA 4KMQA 4R5EA 4WSKA 3TONA 2BV9A 3W37A 3KEHA 4NI3A 4MPKA 1GVYA 1XSIA 4NRRA 2GDVA 4WK9A 5FCZA 2FH8A 3OGRA 1CECA 1GW1A 3TTYA 2FHCA 4LXFA 3ARRA 3WNOA 1Q6GA 1UKQA 5KEZA 5CLWA 4D6EA 3PZGA 1B3YA 4X0VA 1V08A 1UR4A 3DHUA 1HIZA 1BYDA 4TOQA 5DT7A 3M07A 2O9PA 2MANA 2WHLA 3E1F1 5I79A 3WFZA 3AISA 1NH6A 2E8YA 1HL9A 2D23A 1TMQA 2QV4A 4W86A 1H4PA 2DH3A 4V27A 5BWFA 1UR8A 4E8CA 2YDSA 3WDQA 4AIOA 3PN8A 1IZJA 3K1DA 3CHDA 1V03A 1GQIA 1J01A 2CKSA 4DWSC 4MDOA 1DP0A 5EB8A 3RM9A 4MNJA 3TA9A 1TZ7A 1JNDA 4YN5A 2WMFA 3HU7A 1JAEA 2WC3A 1L0PA 4UOZA 4C7DA 4JFSA 3WY1A 1K6AA 2XJ7A 2BHZA 3CHFA 4JHOA 1KGUA 1HNYA 4UQAA 1W3JA 3W38A 1OGGA 3W26A 3K4DA 1ZJAA 2WWDA 4B3LA 4PCTA 3RIKA 7CGTA 1E6NA 3GXFA 3VOCA 3WEZA 1UWSA 3KL0A 2ZUSA 5F7UA 4U2ZA 4EANA 4DM2A 2CXGA 1MW2A 1SR0A 3UESA 2BHUA 1CXKA 5HXMA 1UQYA 1WB0A 4P7QA 4CU7A 1XH0A 5CGMA 4FF5A 1XGZA 2WSPA 2XVNA 1W9VA 1Y7VA 4JCLA 3ARQA 1LG2A 2BNJA 3AIWA 3BCDA 3ARPA 1ECEA 3F5LA 3NYDA 1XYZA 4D6JA 1A47A 3N1AA 4U2YA 2E9BA 2X05A 2OYMA 3FHAA 4W8BA 5I0DA 1C93A 4R27A 4QLJA 4PUDA 1HF6A 4D71A 2GJXB 1IZKA 3VIFA 4ZFMA 2ZUVA 4CUCA 5IDIA 4UOJA 3SCQA 3L4UA 1K9EA 3VMPA 4AZBA 2DSKA 1BSIA 4MNKA 3ALGA 1KCLA 5JBDA 4AD1A 3LPGA 2YLLA 4HPGA 3AMLA 4PN2A 3VVGA 2JE8A 4LQ1A 1E6SM 2CETA 3VDBA 1ISYA 1VFOA 5KZ6A 4LPCA 3DYMA 1EOKA 4WSJA 3BSHA 3UERA 4H04A 2W61A 2W66A 1HX0A 1W3LA 3W6MA 2NW0A 1MYRA 3IK2A 4PMXA 3PZQA 1JFXA 1C91A 4QCEA 1CXEA 1K9FA 3OZPA 2UY5A 1DWHM 2W91A 4MB1A 5I6SA 3I3EA 1CXLA 1GHRA 2OWXA 1RP8A 4GZIA 3VIMA 3IJ7A 3VMNA 3NJ3A 4AZ6A 3MV01 4H8UA 3GM8A 2VQTA 2WMHA 4PTWA 4C7FA 1PIFA 1UKSA 3AMGA 4GXPA 4WKAA 2W63A 1JDCA 2CKRA 1MXGA 4F9DA 1Q4NX 3CZEA 1E6QM 1HN1A 2NT0A 4L4PA 2PI6A 4PMUA 4Z2HA 3GH4A 3SCUA 3EMZA 1DWGM 3WBAA 1PIGA 1EO5A 4AC1X 1V3JA 3M46A 4KWUA 1KBBA 3BAWA 5JIWA 2VQUA 3ARYA 1M53A 3BGAA 4Z2GA 5HBFA 4XV0A 1BFNA 4S3KA 3WENA 5BXRA 1V3LA 8CGTA 2G41A 4XX6A 4JHZA 3PBGA 2WPGA 4OBSA 4OOZA 2PB1A 4W89A 1H2JA 3U57A 2YL8A 5ABEA 1DWIM 3AZRA 5ABFA 2BXYA 2D3LA 2CBUA 3F5JA 5FIPA 1KR0A 2VJXA 4DUWA 1C8XA 1PZ2A 3AICA 1UYQA 4Y7EA 2A3HA 2XTKA 2YL6A 1EQPA 4WKHA 3GH5A 1A3HA 2CYGA 2WMJA 2J7BA 4W7UA 1W1YA 1QI3A 5A69A 2AMGA 2EPNA 4AD5A 3WD0A 3VGBA 1E1EA 4UNIA 2J47A 1EGZA 2ZXDA 2Y2WA 4D1JA 1CBGA 4JFTA 1LL7A 2ZWYA 3PTMA 1W9BM 1HP4A 3NDYA 1BVNP 4PMVA 5D4YA 1KR1A 3SCSA 1JG9A 1E4IA 3CO4A 1KQZA 1JDAA 2V3DA 5FKYA 2XWEA 2X2YA 3VUPA 3QHOA 1B0IA 3WEMA 3OGVA 4F66A 2VRQA 1C8QA 3VNZA 2ZXQA 3ECQA 2Y8KA 5FOOA 2PWEA 1JIBA 4QLLA 4EK7A 3B9EA 4LGXA 1ISVA 3WQ4A 3VPLA 3SURA 3CUGA 2JEQA 4U33A 1DWAM 3I3DA 1WDQA 2XFFA 1H41A 2FDMA 3CZ8A 1E3ZA 3RDKA 4TTUA 2XFYA 4WF7A 4MNMA 3PZ9A 1JDDA 3KWXA 3BAXA 2WZIA 1M03A 2YBTA 1UKPA 3KL3A 4AEFA 2YDRA 3AI0A 3WD2A 1UUQA 1UR9A 5HPOA 5ABFB 4AZHA 2GSJA 4A4AA 2XM1A 1B9ZA 1J10A 1OCQA 2BY2A 4Z2IA 2JEPA 1BLIA 4W5ZA 3ZSSA 1JZ2A 2CIPA 1KWKA 1ZS2A 4IUGA 3EMQA 5IHRA 1ITXA 1UKOA 2NSXA 2ZUNA 2Y5EA 1R86A 2CESA 1QI5A 2XVLA 2WMIA 4PBGA 2A3EA 2E8ZA 4OJYA 1OD8A 1LWHA 2J7DA 1ESWA 1UOKA 3RCNA 4W85A 2OYLA 2G3IA 4UZUA 4PMDA 4UCFA 4IPLA 2YDQA 2BXZA 4EAMA 5M03A 1VRXA 4XB3A 1BYCA 2VX7A 3WIJA 2GJXA 1V6WA 2RGMA 2WHMA 2XUCA 3N04A 4MNLA 1C92A 2BVDA 4UFMA 5EBAA 3T09A 3MUAA 2OSWA 5I24A 1OGSA 3WUEA 4AY1A 5A8QA 2ZUWA 4WLCA 3WF2A 4Q22A 1J0YA 2WCAA 3IAPA 1R7OA 3MS8A 2YA1A 3AS2A 1KXTA 2ZE0A 3WELA 3ZR5A 1W1TA 4HP5A 1VFMA 3BAKA 3LPFA 3A4AA 4RE4A
chains in the Genus database with same CATH superfamily
2WWCA 1V0MA 2PTZA 3CPUA 4ATWA 3VNJA 3O7UA 3QMRA 2FZNA 1XLIA 4NYUA 4UR7A 4UFHA 3TN3A 1LJYA 5AHNA 4WJEA 3L5MA 1BWKA 2ADAA 5CSUA 4IXHA 4M6VA 4J4KA 2EPMX 5F4XA 1OBAA 2C79A 1W1B1 1D2KA 4PTDA 2DVTA 1CLKA 3LU2A 1UWIA 4G9PA 3KL5A 2VCBA 3LRMA 2QZRA 1Z32X 3VO0A 2B31A 1R87A 3VGEA 4FX7A 4XUYA 2J9XA 1G6CA 1J9YA 3GYCA 1PTGA 3LXAA 3QGVA 3I10A 1TJPA 4DI9A 2VDGA 3S46A 4V15A 4FALA 2R82A 2X1RA 2YB1A 1TRIA 4TX8A 3NAVA 5BRQA 3WKZA 1EP3A 1F9CA 5CPQA 3BLDA 3VM5A 3TE9A 1XC6A 3AXHA 2XN2A 1BVWA 1IZCA 3CH9A 3FFSA 5E0CA 1Y0EA 2V5KA 1VH7A 3AWNA 2B7QA 2F6UA 4AHPA 5A6SA 3VMOA 5IFTA 5FEXA 3IVSA 2ZZ3A 2DUAA 3M16A 1BTCA 1KKRA 2V5BA 2XIBA 1GEHA 3NO3A 4JAWA 3NVDA 4AZCB 3BO9A 1F4HA 2ZX9A 4QDWA 3VX1A 1Q45A 2VRJA 3CZJA 2ZADA 5AZ1A 2Q8XA 3WMBA 4BI5A 3UY7A 4IIBA 3UPBA 4HN4A 4QAIA 4GQGA 4BF7A 6ENLA 1DPMA 1OSEA 4RE3A 4DBSA 1NWRA 2HDJA 2PLCA 2QHAA 4I7VA 1CEOA 3F2CA 4O1CA 1EPVA 1XINA 3PUEA 2YCEA 4H9TA 3P7YA 4JTFA 4R33A 2DQWA 4HPNA 2OVLA 3FS2A 1S46A 2PA6A 3PZIA 3BSMA 4H9UA 2VZTA 2DU2A 3FCPA 3TK7A 1H5VA 1LP6A 3WG6A 4H7VA 1PZ1A 2Z00A 1HKWA 4JY8A 4GI9A 2JALA 5TIMA 3W7PA 1UD3A 3I7QA 2XVGA 1XLGA 2J7FA 2XISA 1K8CA 4A3HA 4URIA 4EPBC 4OVXA 3MSYA 5HK4A 2PF8A 4ALDA 3W7RA 3HV8A 4K8EA 1POKA 2CZVA 3OGSA 2X7VA 5E0FA 3L4ZA 4LRTA 4PTXA 1R9YA 3ARVA 3OU8A 3PULA 2V82A 1EKOA 1NU5A 1UWUA 1LROA 4W5UA 5EMMA 4GIYA 3W73A 3ZLGA 3YPIA 1XPGA 5I3KA 1DL3A 3BC9A 2BZNA 4GGBA 1VBJA 2B7PA 3OIXA 3C8FA 1SO5A 5CJ5A 4OU1A 4S2BA 4J3TA 1ONRA 1B1YA 2CLLA 5DEZA 4IGSA 1M1BA 4ACYA 3PZMA 1IR2A 2E9MA 3SQMA 2NWRA 4NIRA 1U1JA 3QPZA 2YJQA 5HNNA 4AX7A 3S1GA 3AS3A 4HNUA 2NVCA 1AH3A 4TVDA 1UPPA 1FCBA 3WNNA 2QULA 1P0DA 2G3NA 4LOCA 2QV5A 1GONA 1CXIA 1JZ5A 2Z1KA 3A23A 5I03A 3QOMA 2DIJA 2CPUA 2ZUUA 5JIPA 1E4MM 3P60A 2PP0A 4H7CA 4J2MA 2VX6A 3WQDA 5HQEA 4ASTA 3B8WA 4NYYA 3EXSA 1R3VA 1RPKA 3FYOA 2C14A 2B81A 4IFKA 1O4UA 2X09A 3GR4A 5HNUA 4C65A 1U5VA 1E3XA 4J3WA 4O8AA 1XLDA 1RLDA 1H62A 2HVMA 2PDIA 3QV7A 1XLCA 1VYSX 1ADSA 5DLCA 3WMLA 4QE5A 1QI4A 1J12A 4WXYA 3ITCA 2EG6A 1TPWA 2VOMA 2PRHA 4GIAA 3GG0A 1WE5A 3VNYA 1CB2A 5I00A 2GQ8A 2DIEA 1M7PA 3KZSA 3PS7A 1MMFA 3T1GA 3NFUA 4AB4A 1H60A 3LRLA 4NG3A 4A3YA 4B3ZA 2BMBA 2ZYFA 3JW7A 1TQJA 2VO5A 1DJIA 4UR8A 3OZOA 2Y7FA 3A5VA 1E9LA 3NGJA 4DN1A 5E09A 2GUBA 3VINA 1QMLA 1L2UA 3I7RA 4MYXA 5J5DA 1KC7A 4CKQA 2CBVA 3PNUA 4L56A 4FOUA 1J8VA 3H24A 5F2IA 3L2LA 1OY0A 4GH1A 5EY5A 1GK8A 1TMHA 3NUKA 2B7NA 3L65A 1OABA 1OM0A 2TODA 5CKSA 4MAZA 5DT5A 3TOPA 5H91A 5BXSA 5FSEC 1FWRA 2Z1VA 4AXKA 3HG2A 4MJMA 3RCMA 1YW1A 1V6TA 2B7OA 2XYLA 2Q8LA 1EOMA 1GKRA 4GFSA 2PPGA 4I9TA 3SGGA 3T2QA 5TQLA 4QCFA 2WB5A 1H61A 3TN6A 1MEIA 1UD8A 4EF8A 4QP0A 4E0CA 4GMEA 2PTWA 4AEEA 3CM4A 1SQ7A 2WKGA 3IJDA 2DSWA 2F9RA 2WW5A 2FJKA 4EXAA 4HCHA 4MJ2A 1XYCA 3SW6A 2J9ZA 2OX1A 1FH8A 2NQLA 3CZGA 3CMFA 1L8PA 1MQQA 1NY1A 3LY0A 2EHHA 1YKWA 1JYNA 2GLKA 1UJQA 1FWIC 1QK0A 3PK7A 3V75A 4A2RA 2NXHA 5H8PA 1J96A 1WO2A 2Y8UA 2XWDA 1VEMA 1W2VA 2DJLA 1JRCA 4RXGA 1JR1A 2C0AA 1UC4A 4XZWA 1UB3A 1SW7A 2NV9A 2X41A 4KESA 2E5BA 3EB3A 4EPEC 3HO8A 3WNLA 3OVRA 1RLCL 4ZFCA 1NDVA 4YXGA 3DFYA 3QBUA 2RJHA 4U5KA 5FD0A 3ZMRA 1E6PA 3CT2A 2IQTA 1K7XA 4HPHA 1FWBC 3ABOA 5CPTA 5IBXA 3IJ6A 3GDRA 4DZAA 2DORA 1JAKA 1HFBA 5A2AA 5AHFA 6TAAA 5LA0A 1M6JA 1UD6A 1FP8A 2I7GA 3CV1A 4V2XA 4S3GA 1BRLA 2D0GA 3VNKA 1ME8A 1MUWA 3LCLA 3KP0A 3PAJA 4JN7A 5D04C 3JR2A 1JCTA 3L7RA 2AAAA 4KFOA 3H2CA 1LORA 1J5TA 1GOOA 3DBNA 5HJYA 3NZPA 1T0OA 3K8MA 4A6GA 3PB2A 1WDSA 3H2FA 4E4PA 4UB9A 4H9MA 1RUSA 3GVRA 4HNLA 1D3GA 3SCTA 3H22A 4QSFA 4U5IA 3ENLA 3N4AA 2PODA 4WXZA 2QUMA 4GX9A 3N3MA 4E2VA 1QOQA 2JF7A 4HJWA 1LWJA 1KCKA 3P0WA 1K7EA 3OQ8A 1T41A 4D6GA 1E5NA 3CHEA 4D8ZA 5A94A 4AIBA 5CPMA 1FWWA 4NSBA 2PWDA 3BDKA 2F38A 4V1YA 1FWNA 2UWFA 4HHPA 1HJUA 1XBZA 4YWIA 1W32A 1XG4A 3QR3A 1UWAA 1LG1A 1TJ2A 5DMNA 1GUVA 5FEWA 2E67A 3VILA 1CDGA 3C2YA 1I0BA 3MHUA 3N25A 2V2DA 3J7HA 1XFBA 2WHJA 2DP3A 1ITQA 1BF2A 2XPKA 2QPUA 1G4EA 3GD6A 3GE7A 3B0VC 1IT8A 1Z42A 5I77A 2BVTA 4QSHA 1AH4A 3P5YA 2VEPA 4DUVA 3R2GA 4HIBA 4LAMA 4RK8A 3B04A 3UA3A 4WCJA 2NX3A 1VQTA 4FLRA 4YYCA 1JF5A 3W81A 2GPTA 1HKJA 2CLIA 4LTSA 5C8BB 3A4JA 1NDWA 2VZOA 1GZGA 4RZ5A 3AOFA 5GJMA 5KZEA 1P0NA 5K9XA 3VDGA 1JZ4A 4Z1YA 2O7QA 4JIIX 1JUBA 1DQUA 4IJRA 2XZ7A 3W7HA 3OIHA 1H1ZA 4PTMA 1XYMA 3AXMA 3BICA 2HEJA 3K46A 1IXQA 1U5HA 2NVAA 3IK4A 3SGUA 2WC7A 3JS3A 4EF9A 4M19A 4K39A 3RM4A 4CCCA 2CLPA 1SZEA 2DPEA 3VABA 3WYZA 5LYRA 5E5CA 4HNCA 4N9BA 1I0DA 1YQ2A 1IE7C 1IT0A 3Q67A 1W1PA 5FF7A 2IW0A 3S5NA 1TUXA 4HK7A 1Q7MA 2PDKA 4NJHA 3MY9A 3AIVA 1SJAA 3LX9A 4F9JA 4TIMA 5I3FA 4LANA 3UCQA 4AZCA 4K2SA 4X61A 5ABGA 3SUUA 4CN6A 3BOXA 3ZJ6A 2Z1SA 1ZFJA 3ITLA 2NX9A 4LNCA 1ONWA 5GJNA 5DBTA 2QJGA 4LV9A 1FUYA 3S6OA 1OZMA 1R47A 1JI2A 3GNNA 5J04A 3EDFA 2ZOXA 3EA2A 4H6KA 3AS0A 3CTTA 3ZSTA 3ISIX 4R9OA 1A5MC 4PH6A 3VDCA 4O1FA 3UR8A 1UA7A 5E9XA 3T0BA 1VZWA 4W7WA 3QW4B 1YTEA 4MF4A 2QCMA 3EWUA 3KUMA 5F2MA 3FXGA 1SFSA 5HWJA 3ZJ8A 2NUXA 3A6OA 5BU6A 1TFVA 3PTKA 1PZ3A 1VHNA 3INPA 4AF0B 2W9MA 2E3ZA 1VD6A 2VR5A 2W62A 4PTVA 3B3DA 3NO5A 1XYAA 3D3FA 3MDUA 2PWHA 3G18A 4KT2A 1PHWA 1V5XA 3N9RA 4F48A 3W2KA 4XISA 5AYZA 1WAUA 3W76A 2YA2A 1TPUA 3WD1A 2RDXA 1HKMA 3R0DA 4N4PA 4O4WA 4L80A 4O14A 2A3CA 1UZ1A 2NZLA 3LYEA 4L4LA 3NA8A 5U4NA 1OHLA 3BANA 1YHTA 2C8NA 1K02A 1LDCA 3GNOA 3M7WA 3TUUA 2DQXA 3EEZA 4P7RA 4BWLA 1I1XA 1KBKA 5DF0A 4W8LA 1RALA 1WAWA 1K4GA 3K8KA 3UG5A 2GZXA 3VZYA 4YVPA 1KW1A 4GHRA 3S5SA 1ZBCA 1PO9A 2QUNA 1FHDA 3UGRA 5EFDA 4FLOA 3L4TA 3D46A 1ZBWA 4G1KA 3UU0A 2DY3A 1XLEA 4WY0F 1X96A 4WGXA 5HQMA 5AOUA 3NEHA 5A8OA 4PC8A 3C2VA 2D69A 4AY8A 4DPPA 1EP1A 5KZDA 4CD8A 1TX2A 4AXNA 3UR7A 4REQA 4AW7A 1BAGA 3R0KA 1REQB 1WDPA 2YCKX 4C1KA 1KFEA 2J8FA 3HG3A 3ICJA 3AYTA 4XZBA 1V0LA 4GIEA 2YOCA 1QO5A 2INFA 4KKXA 4EX4A 3LHUA 4HHHA 2ZRVA 4P7LA 5K4ZA 1F5ZA 1BG9A 3R94A 1I9CB 1XLFA 4AUBA 1JGIA 3QZEA 3BLLA 1GKPA 5DFAA 4ZVJA 1OG6A 3LBOA 3FAXA 3VD9A 3QQWA 3W24A 5EMLA 1B4KA 1KV5A 2Z7KA 2ALDA 1XLHA 1VKFA 2WSRA 1KFWA 1ENUA 4DPQA 3UR5A 3PP7A 4HNTA 4RE0A 1XYLA 4QHRA 4D6DA 4Q8OA 3AS1A 5FACA 1BD0A 3UZ5A 4DJDA 1ITCA 2GQ3A 4LFYA 4E6MA 3R13A 4L7ZA 3M0MA 4CU6A 1KNWA 1GQKA 3VIKA 2ALRA 4B3KA 1NQ6A 1ECQA 2QCHA 4Q4RA 2J77A 4XQ6A 4ZBCA 3PVFA 3AU6A 3CQ0A 4IMCA 2QF8A 2GJNA 2XG9A 4AIUA 5JQ9A 5D2VA 3HA1A 1D8WA 2XSBA 3FKKA 3KOYA 3W71A 3T7VA 3PZTA 5HOSA 3PZNA 4IP7A 4ZOAA 3PZVA 3LV6A 4YPJA 4PMNA 6REQB 4ZQNA 1E55A 1YE4A 3SAZA 2RGLA 3MCNA 4ZTXA 5G1YA 4QG8A 1ML1A 4HCLA 2EPOA 2VYOA 4ZZ9A 4F0RA 1QU4A 4I5XA 3MWCA 4HOXA 1QHPA 3H2AA 3OLEA 2AGTA 3N9SA 1DXIA 5AYXA 2Z2AA 1CNVA 2IPGA 3VDHA 1OT2A 5HPCA 4NJIA 1THFD 1GPWA 4DRSA 4QITA 1Z3NA 3UZZA 3G0UA 5FAJA 1ZSXA 1SMDA 3CQIA 2JGQA 1VCFA 4I9JA 5H8MA 5D37A 1S2UA 1Q3NA 4Y6GA 4GISA 2DT0A 3UD6A 2PF0A 5JVLA 3H55A 3SZ8A 2QLYA 3L5LA 3IUDA 1L9WA 4DYKA 3TYCA 4M5PA 1W3KA 1GOXA 1GQLA 4XBSA 1LBMA 4H41A 1OFEA 3NR0A 1GVRA 4Q4SA 3T4WA 4LAOA 1EUAA 2RUSA 3H12A 5LHFA 1LL4A 3I3BA 1JYXA 3RXZA 4PFHA 2JIEA 1GJUA 3QZAA 3HGSA 2I56A 3VKKA 4HNNA 1PKMA 4S1FA 3SRDA 2FDSA 3BXWA 2V69A 3WH8A 5B7YA 3FGCB 4C6OA 4F8XA 2FB3A 3M0XA 3PPFA 3F4VA 4C6NA 1XFCA 3TR9A 2CWXA 5DY3A 4KPLA 3W86A 3HZ3A 3E74A 3L67A 3W1QA 2PEVA 5FJRA 2NX1A 2O7SA 3ANVA 2E9LA 3DKJA 4EE9A 4O1BA 5CLTA 1S5TA 4AD2A 1SYTA 3EPNA 3OHIA 3MVTA 5I02A 2Y0FA 1JD9A 1MNSA 1TV7A 1SZGA 4MUZA 1MW3A 1Z7AA 3IJ9A 3NQGA 4B5UA 2QS8A 3W1NA 3W0KA 4AH7A 3R1ZA 4JHMA 4AG0A 3W85A 4CD4A 3CAKA 2IQDA 3F03K 2V38A 2J75A 1W9XA 4CCDA 3MMDA 2WOQA 3UQNA 1ZRQA 1UR0A 4UTWC 1K4HA 2IQ0A 1S3HA 4MPKA 3T78A 4IFRA 3URAA 4NRRA 2I5GA 4UTTA 2FH8A 1VCVA 4YLWA 3UWQA 4IH3A 5KEZA 3L0KA 3PZGA 4GNKB 4NZ4A 2WNNA 1F6KA 2GVLA 3GX9A 3H21A 3E1F1 2BDQA 2GYIA 2E8YA 3Q94A 3T9PA 2D23A 1YE6A 1S1PA 1ELSA 2RDUA 4IMFA 1KM3A 4GKTA 2QV4A 1K77A 1UR8A 4E8CA 2CLOA 3TZNA 4XZIA 4XAPA 3PN8A 3CHDA 1V03A 1GQIA 1EX5A 1UIOA 2CKSA 2PRLA 4DWSC 1DP0A 3NQ6A 4GXWA 3TJLA 3ERPA 4KRZA 4MWAE 3PR2A 1L0PA 3QR1A 5AVNA 4C7DA 3WY1A 7REQB 2PGFA 3RCYA 3BG5A 4DJFC 1KGUA 3VCRA 4HTBA 3GR8A 5DQPA 1O12A 1IGSA 1E6NA 1EGMA 2E6FA 3GXFA 3WEZA 4DF1A 3NM3A 3IGSA 4XIMA 3HJZA 5EU9A 3O8AA 1XYBA 3KRUA 1MW2A 3NTYA 1CXKA 5HXMA 4GYPC 4C6MA 1XH0A 1O95A 2XVNA 4KCVA 3G3MA 4JCLA 4XO7A 1TKKA 3F5LA 5BMWA 3MP4A 1KKOA 1XYZA 4MLRA 2VFIA 5K4XA 3V1HA 3TWAA 4A3RA 1TPB1 5DXYA 4S39A 2ACUA 4F0HA 4W8BA 3CL7A 1GG1A 4H6QA 4QLJA 1ONEA 5EGRA 2ZUVA 3SCQA 4UOJA 1NF0A 1R3WA 4WZHA 4U10A 3GTFA 3RK8A 1BSIA 3KBWA 4HU4A 1KCLA 5JBDA 2G37A 3ATYA 3W07A 4PN2A 5D33A 4DHGA 1XX1A 3VVGA 3C2OA 3GDLA 4LQ1A 2CETA 3H2OA 3TA6A 2V6AA 8XIMA 3UXKA 3QH2A 1YXYA 3BSHA 2W61A 1EBGA 3W6MA 4OV9A 2NXIA 4ZOEA 4PMXA 3PZQA 4K1WA 1CXEA 4WDTA 4YTUA 2BOGX 2UY5A 4MB1A 2ASHA 3I3EA 1ZAHA 3RF9A 3ZS4A 3DG6A 4GZIA 3VIMA 4MJZA 3IJ7A 3RGTA 1IEQA 4Q8WA 3BWWA 3P80A 4IX0A 4C7FA 1PIFA 4MZYA 4GXPA 1DBTA 1JDCA 2CKRA 3FSUA 3CZEA 5BOOA 1PIIA 4UTLA 3RR4A 2VFEA 4A8LA 1TCDA 4RKAA 1UP2A 1EO5A 1JCXA 1XP3A 1HO4A 2QVNA 1PZ0A 1V3JA 4QM1A 4KWUA 3M46A 1X7IA 5JIWA 1R9ZA 1M53A 1A5AA 2W6RA 2WSYA 3E38A 3U2ZA 3WENA 1A50A 5BXRA 1V3LA 1HTIA 4FNTA 4PUWA 2G41A 3L21A 1I4NA 2BOEX 4OOZA 3T05A 3KBNA 3U57A 2HZGA 5ABFA 3KLKA 2BXYA 1G67A 3F5JA 3PJTA 5RUBA 2VJXA 9XIAA 5I7GA 1UYQA 4BWLC 4LALA 2VWTA 2Z7GA 2ZZ1A 2OEMA 1W0MA 3WJXA 1A3HA 1V77A 3TNBA 4O19A 1H7XA 4XD4A 5A69A 3VNLA 2INEA 2EPNA 4AD5A 4JICA 3VGBA 3M6YA 4JTUA 3QV9A 1RY8A 1EGZA 3NL2A 1AW2A 2ZXDA 4HCDA 1CBGA 3KS6A 4HA0A 3WLLA 4FR1A 2CWNA 2GQAA 2DZXA 4A35A 3TW6A 4OFCA 4JR5A 1LM1A 3M9YA 2XN0A 1S2VA 2YGYA 3OEXA 4PMVA 5D4YA 1JDAA 3WBYA 5FKYA 3ZR4A 3G24A 2X2YA 3WEMA 4JQ2A 3VNZA 1VYRA 4YVXA 4DLFA 4RPQA 5HMDA 4LGXA 4K8HA 1DWAM 3IV8A 3A9BA 1KLZA 1H41A 2FDMA 3CZ8A 3BLIA 3CB3A 3UNTA 4DJEA 1Q8JA 4IG2B 1YDNA 1JDDA 1B57A 1U1HA 4JYEA 3DESA 1XBYA 5ABFB 3FA5A 4I5RA 1FVPA 1AJ0A 3LTYA 3I65A 1YADA 2XM1A 4O0QA 1OCQA 1XW8A 4HK6A 4W5ZA 1V4YA 2P53A 1YEYA 2QCEA 1EIXA 4IUGA 1QNVA 1ITXA 3N2XA 2ZUNA 1R86A 1QI5A 3DFOA 3TMQA 4LUSB 2XVLA 1SFLA 4PBGA 3UF9A 1WYIA 2E8ZA 3EWCA 4GY7A 5KZMA 4GZ7A 3RRAA 1UOKA 3RCNA 5AHIA 2BOFX 2IPFA 4IPLA 5F4WA 3GFYA 4EAMA 5H1WA 3CH0A 4B92A 4XB3A 1AH0A 3TN4A 1BYCA 1KCZA 2VX7A 4FIRA 3WIJA 3PPHA 2GJXA 1UBSA 2XUCA 4RZ4A 4NAFA 2QGYA 3UVIA 4MNLA 1HQTA 1E1CB 3O06A 1A5KC 3EOOA 5HA7A 4NNAA 2ZRWA 3WUEA 4AY1A 4WHBA 4OUIA 5A8QA 2OB3A 3QY8A 3MS8A 2ABAA 1KXTA 5HNRA 1SSDA 2ZC1A 3ZR5A 3IVTA 2CFFA 3WZ0E 3RFAA 3A4AA 4RE4A 3XIMA 4BS0A 1IR1A 3B0XA 4YWSA 2QCCA 3ZT6A 3GZAA 4RNFA 2GVYA 4R7WA 4U31A 2J7GA 2X0YA 4LC8A 4QJ4B 4H8VA 5G4WA 2V0TA 3IIXA 1F76A 3N6QA 1A0CA 3PJUA 3MO7A 2REQA 1EP2A 1UROA 4EVZA 3QY7A 2BB0A 3MO4A 4Q8TA 3MKKA 2VFHA 3SSZA 1KFJA 1H51A 2AKMA 4WGHA 3GU2A 4ZTYA 1JQVA 4G8TA 3L0GA 4PL2A 4LC6A 1JGMA 2HNEA 4TQTA 5KMYA 3L0NA 1YMYA 2AL1A 3STEA 4US6A 5E0KA 4C6PA 3C6CA 5JXQA 4ZE4A 4C1NA 5M3WA 3E0IA 4H9VA 3R5EA 4MMWA 1FXPA 1VJSA 1WZLA 3MJMA 2G97A 3WF4A 3WLNA 4MLJA 3TAOA 2F2KA 4IP5A 5HDRA 1BG4A 4JX4A 3HOJA 1OX4A 2D1ZA 3LHTA 5H6HA 1E56A 2PLMA 1QATA 4DWSA 1BRLB 1BYBA 1LBFA 4EXQA 4X9SA 4ADTA 3WD4A 1D8CA 4F4RA 3KCJA 3NCOA 3G1YA 2OO0A 3FN9A 3HV9A 3BTNA 1O7AA 3APGA 3EX2A 4UXDA 4C6QA 3N6HA 5CZJA 1Q13A 1JUEA 3A3HA 4MFDA 3NZGA 2R1LA 4ILSA 1C90A 1QBBA 2CU0A 1U2YA 3PZUA 4YCOA 3NQ8A 4UTKA 2CITA 2UY4A 1QHZA 4ENLA 2F7FA 2J7CA 3FNDA 4LX4A 2EPLX 2WCGA 3VNIA 2H6RA 1A5BA 2V2CA 4B16A 4XAZA 3LHWA 1KGXA 3LPPA 4C7GA 1UBPC 4O11A 3C5QA 1MO0A 2E6AA 2WMIB 2BHYA 1YDYA 2BSLA 4PEKA 4DYEA 4QTGA 4CNOA 3TH6A 3PTDA 4Z08A 3VD3A 1X6LA 4M82A 2L5HA 1KTCA 3NO1A 5M5DA 1C7TA 2PC4A 2QEZA 1GCYA 4NL1A 1MRAA 2HQAA 4ML4A 3HGRA 5CPLA 3QW3A 3GG7A 3WMCA 4DELA 2OOGA 3JUGA 4A8IA 5CPNA 4XSMA 1NWSA 3KW3A 3S83A 3NXFA 4QR6A 3CUFA 2OZ3A 4W87A 4GBUA 6TIMA 3VKJA 1ME7A 1CTNA 3A4XA 2Z1WA 1TTIA 4C6DA 4TVCA 1PKNA 1SSGA 3AZTA 3TJXA 1VFHA 1FXQA 3TCSA 7REQA 3CIVA 1E15A 3KDOA 1R0MA 2ONEA 4X63A 4FLQA 3GAYA 4J28A 1KB3A 1LLWA 3ZVHB 4NY2A 2A7PA 2QUVA 3DFQA 4G56A 5GPRA 3H53A 4R9XA 1CT5A 2ZC8A 4B5NA 2VEGA 3V18A 4K7VA 5C0QA 3V0UA 2DZVA 2ZRUA 2WYSA 4LBRA 1GYLA 2NQ9A 2FZ9A 1W8SA 4RDVA 1H1YA 1ZQ5A 2D2JA 4UFKA 5A95A 3TTOA 3WQOA 2NVDA 1KD0A 4I8DA 2OSYA 2VGBA 4AZGA 1A5CA 4HMDA 5AECA 2ZA2A 4TX6A 5CH9A 2CHRA 3B05A 3RMJA 1VF8A 2GGHA 1UCWA 4Z1DA 1NAL1 3LOTA 3FIGA 5I06A 5I23A 3K30A 1A5UA 2Z6JA 1LZOA 3HQ1A 4ZCWA 3JZUA 3N6JA 3TMLA 2YA0A 4Q7IA 1JYVA 2HBXA 3PB0A 1QPKA 4UFLA 4QQUA 3TDFA 5AY7A 3RLVA 2CERA 5XIMA 4O28A 3GDKA 4W7VA 2ZX7A 3NL5A 5CSSA 4Y2WA 3W27A 3GFXA 3SADA 3VGDA 1LWIA 3CZKA 3W70A 1I6NA 1Q2SA 3TSDA 1FH7A 3W02A 5A6JA 2PGRA 1TV3A 5XINA 6A3HA 1LTDA 3BSGA 1SGJA 2R9RA 1ONXA 1I75A 3EOEA 2BY1A 4WY0A 2I5IA 4IZGA 2X30A 4Z0JA 3ARTA 2J6VA 4HNOA 4QISA 3DYOA 4LBUA 1AL7A 6PTDA 3WQCA 4J35A 3QSTA 1LBLA 2OLHA 1XCWA 3WLKX 1H63A 4IMGA 5D2TA 2QUUA 3EOLA 4CVUA 3HFTA 4XZHA 3A13A 4HHLA 3MANA 3WNMA 3A47A 5AHLA 1ALDA 4Y9OA 3BLFA 3SCWA 3IIVA 2I9EA 4L5ZA 4W88A 2OX4A 3PBMA 4B2DD 4FNQA 3THDA 1W31A 2Y7GA 5BYWA 1A80A 4B5WA 2ZVIA 5FSDC 1HJXA 1FX6A 3UP8A 3M7SA 4CD5A 1XDLA 4PUUA 1VS1A 2HRWA 2QF7A 1MSSA 5C6MA 1M7JA 3B8VA 3VOFA 1E0TA 4X0NA 4CLMA 1TRDA 4JPGA 4REQB 3ES7A 2RDWA 5CC6A 3DHFA 5D02A 4UOQA 5EFFA 3WH7A 3LXBA 1F74A 3L4YA 3ONCA 2VCCA 2E7FA 4ATDA 4GUHA 3DOPA 1GQNA 2WPBA 4RV3A 1KGWA 2DZSA 3NQFA 3G0XA 2Q3OA 1EO7A 3M0KA 1OFOA 3VU2A 3QXBA 2J4GA 4A8NA 1QOXA 2XH2A 2Z29A 1QAPA 4E3VA 2OMAA 1HT6A 3KRBA 3EKGA 4FK9A 3LNMA 2ATMA 1P0EA 3TXZA 1BWLA 4CN4A 1E0WA 3RX3A 3WN6A 1HJVA 2IUZA 1KRBC 1BF6A 1ZCOA 1OK4A 1WBHA 1E6RA 1DVJA 2EBNA 4AX6A 3LMYA 4KGJA 3D0CA 3S2LA 3NL6A 3QGAC 2ISWA 4M1RA 3UXIA 5HULA 3F4NA 1MQRA 3ITXA 3N2OA 4I3GA 4FS9A 1RA5A 5IOBA 1QFEA 4BQ5A 1MZHA 3QF0A 4LS0A 1BVZA 7A3HA 1OCBA 1K9DA 1XS2A 4IFOA 1RQBA 4RUBA 1EF3A 3SJNA 4GNJA 2P0OA 1KFCA 2EQDA 3OTRA 3V5FA 4O18A 3U2OA 4QX4A 1WZKA 3B8SA 3WF1A 1W54A 1C8VA 3TP4A 1A5OC 3NZRA 4JXCA 2B0MA 2BWGA 5CGTA 3T44A 1P7TB 4KERA 1L6SA 3W53A 1XBXA 4B5SA 1TR9A 2FFIA 3VC6A 5TBOA 1WP6A 4PYSA 5F1VA 1RV8A 1SMAA 4NAEB 5A3HA 1OC5A 1LCOA 2JGYA 3SRFA 1BQGA 2GDUA 3CIWA 3SQSA 3HPXA 1XI3A 1US2A 3E9AA 3QFEA 3ABSA 2IXUA 3PZOA 1TPFA 1XIDA 1JCJA 2PGWA 1JF6A 3FJ4A 2C1HA 3USZA 3KVJA 3M0LA 2BTMA 3UEQA 2VTFA 2J7HA 2O56A 3AMDA 4XKYB 3BV4A 1XV8A 3OHMB 4NJGA 1I8JA 2GUUA 5AC4A 3BZGA 2FVLA 2J8GA 1W1VA 3A3XA 3H8AA 4AYGA 3PWGA 4A29A 2ODOA 1CXHA 4AZ5A 5D05A 2GWGA 4N02A 4AWEA 2WVSA 2E5DA 3C0QA 3IANA 3NQMA 1AMYA 2Z25A 4RR4A 4AD3A 5I3HA 3LHYA 2VUYA 4H9XA 3DG3A 4HJFA 3LTSA 4DWSD 3N4FA 3T55A 3WQFA 1YXDA 1JCLA 4N7QA 3CMJA 1JDFA 4I6KA 4XUGA 1FCVA 2F2HA 3IJQA 2Y63A 3KXQA 3WUGA 4UCGA 3T0AA 4O52A 1NARA 3HB9A 3QR0A 4JZ5A 3R7MA 1R2TA 2ZXAA 3PPGA 1H1NA 4HU0A 4PR4A 1AW5A 4QXIA 4IIEA 1QR7A 2BFGA 5FJOA 3GHTA 2DUZA 3ITGA 5BU9A 2D2OA 2ISSA 1JQXA 1A4MA 3VCNA 3WBWA 3UZJA 4UQEA 3DAQA 3MSGA 3CYVA 4GYFA 2V3GA 1UD4A 1EJSC 4JKLA 4R85A 1VJZA 4S3EA 3SB0A 3ANUA 3QM3A 2PDJA 3N34A 2PP3A 3VTRA 2FKPA 5M2FX 3N15A 1L6FA 5B80A 1R7AA 2QDHA 3L4VA 1UH2A 1WNOA 1MZRA 3SFWA 3NSMA 3THCA 5FJJA 2CHOA 5MHBA 2GK1A 1FWJC 1J0HA 4JKKA 4B4FA 1OGBA 1CZ1A 3CLWA 1QW7A 2IMRA 3QGKC 2Q71A 3G1XA 5A1AA 3GHSA 4DWDA 3AO0A 2NSOA 3KDNA 1KXQA 1OF8A 2GSEA 2QR6A 1C3FA 2DIKA 4ZE5A 2VZSA 3W23A 1OFPA 2XINA 5DMYA 4OT7A 3BG9A 3FW6A 3Q4DA 3TYDA 4E4UA 2NLIA 1MI3A 1CLVA 1KBJA 3LGGA 1M01A 4XZNX 3GFZA 3TQKA 1Q6DA 1XM3A 2DUXA 3TVAA 4PBFA 3SCPA 4BQ2A 3KCOA 3M4HA 4IGMA 4HYVA 2FMOA 5H2ZA 3OZYA 1UASA 1JJKA 1MFVA 1VENA 1B90A 5CC7A 1UQZA 1GOQA 1OT1A 3GIPA 3NGFA 3NNTA 3WLTA 3JVAA 4CNUA 2V3FA 3FYPA 4DBUA 1HVXA 2WM0A 2G5WA 3MUXA 1HGYA 2Z0IA 4TO8A 1EXPA 2ZRYA 2VUNA 1DIEA 1EIBA 3B9OA 1JZ3A 2QJIA 3DERA 4M81A 3GXMA 2EAWA 2VX4A 2UZ9A 1V3IA 3UG8A 1LUCB 3EYPA 2F61A 3MWAA 4AISA 2FLIA 4GUFA 4D72A 4MY8A 3CAQA 1NSJA 3WLIA 1Q2RA 1MXSA 7ENLA 1MEHA 1ZLPA 1LQ2A 3WSUA 3U48A 3VGHA 3L5AA 4PMJA 1KM4A 3S1XA 1SJDA 1XCFA 1ZUAX 2DZWA 4WX2A 3WL1A 3GNPA 3ABZA 2C0HA 3FKRA 2ZRZA 4P8VA 1V51A 3MVIA 3RUBL 3P93A 4HZ6A 3PFMA 1OFAA 2DT3A 2EKGA 2TMDA 3V0SA 1EJXC 2D2HA 4AVOA 1MW0A 3DX5A 3NL3A 4D6CA 4YTTA 3WFLA 4NAFB 1VEOA 3KOXA 4EAYA 3TEVA 1L6GA 1SZRA 4C5YA 1KM6A 3SN0A 3CU2A 3BURA 1XC4A 4FF7A 1RD5A 1IEWA 1NFGA 3IRDA 3WQGA 4RNJA 5DCEA 1XH2A 1JCYA 3S6TA 4JS3A 1UR1A 2ZX5A 4PMYA 1MQPA 3KM8A 4QAWA 2HVOA 1DJYA 2PZ0A 5A6BD 3MQTA 1UJPA 1NOUA 4HK5A 1UH4A 3PNZA 1PXGA 3OG2A 1FH9A 3MDWA 2BBFA 4E38A 4P61A 4H9ZA 4KIEA 4O12A 3WUFA 2BXVA 4E5TA 4FEZA 4U4MA 3UG3A 3WDPP 4F2TA 1DQXA 4OKDA 3IGHX 3E0WA 3LLXA 4AWTA 1VFSA 3LZ5A 3N14A 1TB3A 2A6NA 1GORA 4JFWA 4Z42C 3WQWA 4UC5A 4F3HA 4OZOA 1E1FA 3N19B 1NWTA 3UETA 3P3BA 2FB2A 4DNMA 3P67A 4L6OA 4Z0SA 4L6DA 1B3ZA 1DE6A 1JPMA 2R1PA 3ZLHA 2R6OA 5HUPA 5A8GA 3N3TA 2Q02A 4A05A 3LSCA 1IGWA 3PUDA 5D30A 1V8EA 3S0CA 5D9MA 1BXBA 2W5FA 3KWSA 4TV5A 2XFWA 1HJSA 3HIJA 2FTYA 2XFRA 4O53A 2Y4SA 4DO4A 1I2QA 3S2CA 3URNA 3WF0A 1TREA 1GQJA 3LCIA 3VOIA 2D73A 4JGDA 2O9TA 3SJ3A 1ISXA 2QMKA 2VDHA 5EBUA 2XHYA 4M7SA 5J5RA 2FHFA 3D5HA 4IJCA 1GNXA 3JZEA 3HM7A 3G3DA 2OKTA 2XIIA 3T4CA 1BTMA 1V6VA 2PBOA 1K1DA 1YRRA 1ZP3A 1OFDA 1PBGA 3W1TA 3DDMA 3B97A 4RDYA 1KTBA 3RPTA 3UWYA 2V5DA 1SZFA 5A8MA 4IMEA 4B15A 3MMWA 1J11A 3GRIA 1VC4A 3BLKA 1NP2A 2FTPA 1OC7A 5ABHA 3M5VA 1H0IA 5CPOA 2EGZA 3BH4A 2C1IA 2OWCA 4LCSA 3U7VA 1W2PA 2AGKA 3H4XA 5C2CA 4PSRA 4DY1A 1S38A 3HBLA 2J13A 2VFGA 2UBPC 3BGJA 5LNWA 1R8LA 4N0RA 4LVBA 2FQIA 4KCWA 2UY2A 3AROA 1JDEA 1S2WA 4MADA 1KWGA 3O05A 2WO5A 3H6OA 2WC4A 2J62A 4UTJA 1ODZA 2J66A 4GGHA 2EF9A 4O1DA 5ECVA 1E5JA 1V02E 2VDIA 3RM8A 2DT1A 3RX4A 3GAKA 3M6DA 1H11A 1XLMA 2WKLA 3G8EA 4GUGA 1E71M 1W5PA 1WPCA 3CZLA 4ROPA 4H1ZA 2IXVA 3CEPA 1OF6A 4IQEA 3BAYA 3GKAA 5DBUA 4HOWA 1W9DM 2VGGA 3XISA 1A5SA 5G4HC 3FK4A 4J27A 4F0SA 4NZ1A 3RR1A 3G8RA 1EFZA 2OSXA 1IEVA 3QYSA 3L23A 1RHCA 4X60A 1HJWA 3GW0A 3F5KA 3M0JA 2RJGA 1ZTVA 3S2MA 2Z1XA 1ZB5A 3GVGA 1U33A 3DFSA 1S2CA 5LXEA 4HHMA 3BQ5A 3QJAA 1XD1A 1S5WA 4ZO8A 5CGQA 3SY8A 2OQYA 1WZAA 3W2MA 4GJJA 3W7CA 2HVNA 1H7NA 3FOKA 1V7AA 2PLJA 4J5NA 4RXFA 4KRUA 3VGGA 5BOFA 1G69A 2Z2UA 3C0LA 3W1LA 4O17A 1FCQA 4R34A 4J3XA 1KFLA 5MF5A 2JK2A 3CUJA 3E3HA 5DRIA 3NQBA 3WFAA 5HWMA 2Z26A 4P5UA 2YXGA 3B8TA 1GVFA 3TONA 1IXPA 1G7VA 3KEHA 4NI3A 2P8CA 2NV2A 2ZZ4A 1GVYA 4IX2A 4NAEA 4WK9A 3QMSA 3GB6A 1CECA 4C1NB 1Z41A 3IVUA 1A4LA 4D6EA 1RSCA 4WDWA 2OEJA 3DHUA 2FZMA 1HIZA 3M5XA 3KBVA 1XKJA 3UA4A 1X7FA 6REQA 3W72A 4LVDA 2MANA 2WHLA 2R1NA 4GLEA 3QY6A 5I79A 4BF9A 3LCHA 4Q8PA 3CAWA 4W86A 2AL2B 4Q8MA 2YDSA 3H26A 3WDQA 4AIOA 1XQKA 3FA4A 4GIRA 4GABA 4CQ9A 4FOJA 4RCXA 4IWWA 2YCIX 5EPDA 1TUFA 3TR2A 1TZ7A 3KVMA 2WMFA 3QC3A 1JAEA 3HPFA 1TPDA 2WC3A 4O15A 3LD5A 4UOZA 1IIHA 2YFOA 1K6AA 2XJ7A 2BHZA 3CHFA 3VNMA 5A5WA 1QO2A 4UQAA 3P81A 4BY3A 3W26A 3K4DA 3RIKA 3OQEA 4IT1A 4Z1BA 4QEEA 2Z28A 3VOCA 4H00A 5F7UA 3E12A 3S3GA 4GQ0A 4EANA 4XWUA 3R4IA 1GJPA 4EWND 2OGYA 1KBLA 4C6KA 1UQYA 3CO8A 4B90A 2POTA 3M41A 4ZB5A 3UXDA 2ZDSA 4N9DA 5KITA 2WSPA 2F6KA 1W9VA 3EB4A 1LG2A 3ARPA 1MEWA 3R0UA 3N2TA 3NYDA 4D6JA 1A47A 3N1AA 1DE5A 5DRCA 2E9BA 2X05A 1EL3A 1Y65A 4IIDA 1TVLA 1V7YA 3R58A 1DJGA 1XLKA 1C93A 4PUDA 1HF6A 2VGIA 4CCZA 2GJXB 3VIFA 4ZFMA 5IDIA 1Z89A 3L4UA 3VMPA 4H6EA 2PAJA 5ENLA 1IXNA 3ALGA 4AD1A 3LPGA 2YLLA 3S6DA 3AMLA 2JE8A 2GSHA 4C6BA 1XDJA 4J1OA 3VDBA 4J2PA 3URBA 4LH8A 1VCGA 5AFDA 4JIHA 4O13A 4GI4A 4QE4A 3UERA 3FEQA 4K7YA 3V4BA 3PBVA 4C60A 4ZQMA 3LM7A 4FXSA 1C91A 3LERA 1DWHM 4D8LA 5I6SA 2HV5A 1CXLA 2OWXA 2VM8A 1RP8A 3GKFA 3VKBA 1O1ZA 3M0VA 3V36A 1WV2A 3NJ3A 3VMNA 1OADA 4NKCA 1NVMA 3GM8A 4WUIA 2PU0A 3PSWA 3GXNA 2ZVRA 3PJXA 4OECA 3R89A 4GRSA 1MNZA 3H7RA 3S5OA 2PZNA 3KOWA 4Z2HA 1V93A 3SCUA 2PDYA 3USBA 1DWGM 3B0UX 3FV9A 1PIGA 3W74A 2ZTKA 3FYYA 3ARYA 3DCPA 3M0ZA 4ORMA 1XPYA 5DXXA 9RUBA 3W7QA 8CGTA 3W75A 3KBMA 4JHZA 2Y88A 3MMTA 2PD9A 4FOKA 5D2WA 1H2JA 4MPQA 4E8GA 1VYPX 3BG3A 2YL8A 4IJBA 5E93A 1DWIM 4PB4A 3UJRA 3VXGA 3AZRA 3QTGA 3PC0A 2CBUA 4JDYA 1FKWA 2OPJA 4QS6A 1AD4A 4Y8EA 1XJBA 4O1AA 3AICA 1XIBA 5G1TA 4Y7EA 2YL6A 1EQPA 4WKHA 4WR3A 3GH5A 3STGA 4H2HA 3TIMA 1X8FA 3V3WA 2QVHA 1W1YA 4XVEA 5CBBA 3IGUA 4E2DA 1E1EA 2J47A 2QAPA 1IEIA 1LL7A 3TYEA 1VFLA 3MW7A 1LT7A 3PTMA 2PMQA 5K9DA 3STCA 5LIXX 3NDYA 3NZQA 2R14A 3SY5A 3CO4A 3OODA 2V3DA 2KZHA 3LK6A 4Q4QA 2XWEA 2VEKA 1RXOB 3VUPA 4YTSA 1U22A 5EYWA 2VRQA 4FNUA 1RK6A 1W3TA 2B4GA 4UMBA 4IFKB 1JIBA 4QLLA 3B9EA 3JU2A 1ISVA 4ERGA 2VD9A 1EX1A 3I3DA 1WDQA 3HURA 4G7FA 1TJ0A 1YNYA 4WF7A 2V2HA 3KWXA 1M03A 2X0SA 3UWZA 3AI0A 4GQBA 4N6EA 2Q6ZA 2BY2A 4GX8A 2Z1BA 1BLIA 3E0FA 2O0TA 1FWEC 1R3YA 1O68A 2X1SA 3HQNA 4ZMGA 3L9CA 3IS4A 1QASA 2Y5EA 3CLMA 3S5ZA 3A22A 5AC6A 3GNXA 4LUSA 1LWHA 1R2SA 2J7DA 3QVQA 1RZMA 4F2BA 4Q6JA 3WQEA 2G3IA 1GEQA 4UZUA 5K7JA 1IWPA 2HE5A 3LCGA 3M0IA 5EA9A 3TC7A 1VRXA 4RNIA 2Z6IA 3IARA 2BLEA 2IKGA 2WJFA 1M3UA 3RLUA 1C92A 2BVDA 3M0YA 3TXVA 2VXNA 3W1PA 3EGJA 1UP3A 1VPXA 2OSWA 8RUCA 4JNMA 3V7PA 1R3SA 4WLCA 4IGHA 4L1WA 1YYAA 3LLDA 5FF2A 4Q22A 3EKZA 3WK0A 3AS2A 2O55A 4Y9PA 3NOEA 4AWSA 1W5OA 1W1TA 1A5LC 3BAKA 3WO8A 4WOQA 4J3SA 4L64A 5D03A 2W0UA 1XR2A 4KF1A 4JX6A 3G1SA 1J79A 3UZYA 4CQCA 1QI0A 2OT0A 1V02A 5HANA 1XCXA 2OELA 4M1BA 1MDRA 1O5RA 1TWZA 3HJEA 4J3VA 2WBGA 4Y9NA 3UVAA 3RAOA 5C71A 1MVYA 2OQHA 3QOKA 4JTJA 1R3QA 1F8IA 2GVGA 3BLOA 3LMZA 1QW8A 1XF0A 3SDOA 4RW3A 1GOWA 2D3NA 3ZT5A 4GCXA 1Q63A 3LG3A 1PX4A 1XSKA 1MWOA 3FY1A 3WQVA 4GY0A 4UTIA 2CLFA 3LS9A 4UMAA 3TROA 3W7MA 5DN1A 3KLLA 3AHVA 1L6WA 1E6ZA 2FGZA 4ZQCA 3MB9A 2J7EA 1VAHA 4XBKA 3SBFA 4JDBA 1HVQA 3E2VA 1FWDC 1XIMA 1AMKA 1UZHA 3ARZA 4ZR8A 1M7XA 1MRQA 3PFRA 1FDJA 3UY8A 1UWTA 3WLRA 4H8NA 1HKKA 1CGXA 4TMBA 4N42A 2TSYA 3REQB 3D6NA 4BCEA 4U3CA 1X6NA 2ATSA 3H4GA 4ERIA 2XGIA 4LAKA 5EMJA 1E9ZB 4HSNA 1K70A 1PWLA 3H2EA 1QNPA 1Y5VA 2XH7A 2VC7A 4ROQA 3N11A 1SR9A 2F6XA 2WZMA 3VOGA 2FPVA 3R25A 9XIMA 4C6JA 5C9UA 4K6AA 1LLZA 2Z24A 1XRFA 3AUOA 1ZJHA 3DUGA 3KX6A 1GJWA 2FGLA 3W22A 3QN3A 3PPCA 3VCCA 3BLEA 1GZ1A 1VB9A 2VRKA 4E2BA 4W8AA 1XIJA 8TIMA 2DZAA 3HPAA 2GJRA 3NPXA 1KBIA 4FAMA 3AHXA 5A6TC 3K5XA 4DLMA 4S2CA 3HQOA 1KRMA 2ZDRA 4A3UA 1AQHA 2PDNA 2IS7A 3CB8A 1XUZA 5CC3A 2E77A 4MB5A 1GPFA 2VR2A 1ITUA 4HT3A 4AD4A 3LXCA 3KTXA 2I57A 1PV8A 5E70A 3F2DA 1QHOA 2DV0A 2G50A 3ARSA 3WF3A 3B9DA 4HMCA 3MTWA 1HO1A 3C2FA 3W7GA 2FZ8A 3S9IA 5AC7A 1JUKA 1N2VA 3M0HA 4EKJA 4MGGA 3BK0A 3OJGA 1VBRA 2E68A 5F2GA 4QS5A 1B3XA 2OCZA 1OX4B 3BLPX 1G94A 5G2WA 5J8LA 2CW6A 2OQLA 1EEPA 5JU6A 2G3MA 3GUWA 1UG6A 3VNDA 1EA0A 3DI0A 3MHFA 1AD1A 1R5YA 3UZWA 2CZFA 4TXEA 2ZFAA 3DGBA 3P0XA 3PAOA 3AJXA 2PDWA 1JNEA 3EPMA 2ANUA 4TU1A 3NZ1A 1RBAA 4RNHA 2Q3RA 5FEZA 1E9YB 1H5YA 5AN7A 2OOFA 3CV6A 3VUSA 3AHYA 4S3CA 3VIHA 3GUGA 4PUJA 2FMNA 4MM1A 3UR2A 5CAHA 4KW2A 3LB0A 2DEPA 2ZUMA 1P6WA 3S9ZA 1E6XM 3W3OA 2XZ9A 2ISVA 5AC5A 1Z48A 4AYSA 2YW4A 3BCFA 3MUIA 3W28A 3GXDA 4L9YA 3G1FA 1KXHA 2ZZ2A 2E6DA 5CCZA 1QOPA 3PUOA 4L6HA 1ZBVA 2PC8A 1QWGA 5D9NA 2Y6ZA 1GVEA 1TG7A 3CBWA 4LVGA 2GVEA 1UC5A 5BZAA 4INFA 3XINA 4KFPA 2Q01A 1KQYA 1AL8A 3SEPA 5FAGA 1V3MA 4ZGYA 4YMZA 2O4MA 4YTRA 4KETA 1BGGA 4QIUA 3WCZA 2FJUB 1QCWA 2YIHA 1RCXB 2PGEA 2WJDA 3U5UA 1M41A 3STPA 1X1OA 3AXXA 1T5AA 3NQDA 2PS2A 2J79A 1SVDA 3IJ8A 3G2GA 3I6TA 2NQHA 4GH3A 1O1HA 4O4VA 5C70A 3R11A 4I9AA 4KGLA 3P8JA 1CCWB 1FY6A 3NPUA 4IUOA 5TAOA 1XIIA 1KM1A 3QHNA 5D8ZA 2FPYA 1BKHA 4LB4A 3C0SA 2DW7A 1VHCA 1XH1A 4HTYA 3S8HA 2ON3A 3HN3A 2OLAA 3UWUA 2QQ6A 2CBIA 2G95A 1O60A 1GVIA 4WY0B 5LIYX 4JBRA 1R6WA 1Q6CA 3CAVA 1TWDA 2J25A 1WBJA 3ZM8A 4D6FA 2DH2A 1P5BA 4P7NA 1GHSA 3WDHA 4X22A 1WDDA 1JXJA 1ZBKA 3ZT7A 5A6MA 4JL1A 1EF2A 1RJQA 1J0JA 4ZB2A 4LUJA 4A21A 2XIOA 4D9PA 4CGTA 1I1WA 4TVUA 3L2MA 4ZL1A 5DELA 3DC8A 1TE6A 5ABTA 3ZO9A 2D22A 1I2NA 3WK3A 2W3ZA 3IACA 3W7OA 4B5TA 2FZBA 2HBVA 3IPWA 4PUMA 2GOKA 6XIMA 4BA0A 3TAKA 4PFMA 3NG3A 2E1WA 3KBSA 2FVKA 4AQLA 3EWXA 3WDRA 5F2LA 2QCLA 5CZTA 2PWFA 4LY8A 1WZMA 3T2OA 2V67A 3O0FA 4YS1A 5G2HA 5BRPA 2QJJA 5LGXA 6CGTA 3W1AA 3FDGA 1OEPA 3WD3A 1F3WA 4GJIA 3VD7A 2WBKA 1U83A 4YCPA 1PUDA 3BOFA 1UWQA 3RILA 4H8HA 4NZJA 2Y5SA 4GO8A 2ZX8A 1J0IA 4WJ8A 2ZA1A 2QCDA 2YXXA 4ATLA 2CCRA 3AYRA 3VIPA 3MSDA 2KAUC 3DHPA 3C8NA 4ZO7A 3ANYA 1K6WA 2O9OA 5CJMA 1DTNA 3PWIA 2FHBA 4M56A 3WMSA 3EWDA 3R8RA 3TYBA 4Y8FA 5LGZA 1SPQA 1UKTA 3DIPA 4QEHA 3AHTA 4UQCA 3UW6A 2Y24A 1TPVA 4WVXA 1YDOA 1OJXA 3ZWTA 1EC8A 4DO7A 2EJ1A 2TRSA 3I68A 2BG5A 4XBJA 1VFUA 1SO3A 4BFAA 3G5EA 3OBEA 5A6LA 1U1UA 1CB7B 4IIGA 2INZA 4DO6A 4AIEA 1A53A 1ADDA 1G0CA 4PRTA 1YX1A 4GQRA 2C3ZA 1RD6A 4B4HA 2JIWA 4JQ4A 1ISWA 3UJFA 4D2JA 4FSAA 4AMAA 3BVJA 5AKQA 3GNRA 3U7BA 4FIQA 2V8ZA 4B5XA 3SGZA 5CXPA 4BZYA 1LL6A 4DB7A 3LM3A 2VEMA 2WXDM 3A9IA 1OFRA 3OP2A 1UZ4A 2ESCA 5LA1A 3N73A 1X98A 4A22A 2WNWA 1DTUA 1ZALA 3MI2A 1IQ8A 1UUMA 3O1NA 3ZXWA 2X7WA 2XSXA 1E73M 1GKQA 3CNYA 3GVWA 1W1ZA 4C6LA 1HJQA 4DIAA 1S5NA 3WNPA 4MWAD 2NXGA 3R79A 3AFBA 1HKVA 3CGTA 4ML9A 1QVBA 2BGNE 3W88A 4S3JA 4HNVA 4HZ7A 2ZQ0A 2WQPA 4CD7A 4ZA0A 3MP5A 2YBVA 3D3AA 1NJJA 2QJMA 4WDXA 1QTWA 3C52A 3CIXA 4QNWA 1GYMA 3IJLA 2PCQA 4NILA 1PX8A 4IOTA 2O9RA 3CK5A 2WJZA 4FB7A 3STFA 2ACRA 4HZMA 4AU0A 1WQ5A 2PWGA 3CUZA 5FJTA 1TYGA 1VEPA 1XXXA 5FL1A 3HMJG 1LQAA 3SFKA 4DZHA 1UUOA 2HXUA 1DJXA 5HQLA 1AK5A 3MZNA 2PFHA 2JKPA 5I5RA 4ADUA 4HA4A 1B3VA 3W9ZA 2P3ZA 4L1XA 1REQA 1E0UA 2VKZG 3W00A 5LNVA 3W7DA 4ZOBA 4UBPC 4JTSA 4FXRA 1QPNA 2VVSA 3EX3A 3P84A 2FZDA 1DOSA 5LXXA 4G6CA 1N55A 1D7KA 2PDFA 4L61A 1V0KA 3NSXA 4H2CA 2MUCA 4NQ1A 3WH9A 2OKOA 3O6CA 3H2MA 4F79A 2CLKA 7TAAA 1EDGA 4HN8A 3C3NA 3SRHA 5AHEA 4OWGA 3FSTA 1X1NA 4DXXA 1AODA 2QAFA 1DHKA 4A2SA 2C71A 4UUIA 4ACZB 4PUNA 4ZOCA 4QJ1A 3APYA 4F2UA 4YVVA 5IFPA 1Q66A 3VK5A 4HB7A 3UFYA 2ZIDA 4K3ZA 3GC4A 4FMVA 4HA1A 1WX0A 1OX5A 3TNOA 2PDXA 1G4PA 1N8IA 2X40A 1WDWA 1AJZA 1ICPA 3PG8A 3PBUA 4AD0A 1C7SA 3II1A 2GGJA 2X0HA 2JF6A 5SWUA 1J0KA 4MY1A 3HTWA 2YCLB 2DVXA 3CV7A 4GQQA 2QIWA 3ELFA 5AHMA 1F05A 4E4FA 4I5UA 2R1KA 1I2RA 1QPQA 3Q58A 2VT0A 1TO3A 3ME3A 3LCXA 4CQDA 1B54A 1S3TC 1AZ1A 2E40A 3W82A 1KV8A 4DJFD 1H09A 1SM9A 3SUWA 1S2AA 3KOZA 2JFEX 3TYUA 5E6YA 1MFUA 5BXTA 3ALFA 2VI0A 2GDQA 3MCMA 4PRRA 1PS9A 4DVOA 4JTRA 4E2OA 2QPSA 3U0HA 4ZQOA 3DYPA 3ARXA 2V5LA 2X1UA 3GTNA 4NRSA 1IWAA 4J40A 3RITA 4IIFA 2OGJA 3A21A 3MMUA 4B9ZA 3L12A 1W5NA 4IHCA 3W2LA 2DGAA 5CZSA 4DBWA 1UWRA 1M04A 3QHMA 3IUHA 1OYBA 2ZTJA 3DEQA 3AWOA 3GBDA 4ERAA 2GVJA 3H54A 2H8XA 3UBPC 1VFTA 4Q4PA 2VMFA 3W29A 4GY1A 3TTSA 7PTDA 1W5QA 3GXTA 3MT1A 4UZSA 1OYCA 2PWUA 2WMKA 3VOHA 2NQJA 1Q65A 4UQBA 3P14A 4IP4A 5IDZA 4B9YA 3VIIA 2OLSA 4TTGA 3LRKA 2VD8A 4OUEA 2VZVA 1Y5XA 4CQAA 4FX8A 3NEVA 4R3UA 2JQXA 4M0XA 4DZIA 3A4WA 2C18A 3SCNA 1E43A 2F8QA 2JKAA 4IL2A 3OZMA 3BW4A 3FVMA 1CWYA 3GYEA 4O0KA 1H7WA 1WXJA 4WQ6A 1XBVA 5M17A 4PE8A 1TSIA 1W1IE 4P8XA 4O16A 1BYAA 2PE4A 4BF5A 2WMGA 1M9HA 4RZ6A 5JBFA 5MKGA 3DGRA 1WKYA 4IQLA 4M6QA 2GGGA 5AYIA 2Y1HA 3K4AA 8A3HA 1G5AA 1PB0A 2NQZA 2BASA 1Z69A 4V1XA 2IKJA 1JYWA 2XSAA 3VC5A 1HZYA 3FAWA 2WVTA 2GFTA 2PU1A 3AQUA 1E4LA 2PTXA 1AQFA 2I16A 3VD5A 1US3A 4GPNA 2X1IA 2DSUA 4V33A 4NJJA 1TTQA 4QLKA 1Y5WA 5C7HA 4HYWA 4R88A 4JIRA 3N12A 3UWVA 1G1YA 1I60A 2J78A 3T08A 4RV8A 4LUTA 1XKYA 2OG9A 4YHGA 1SFJA 4BEQA 4GFIA 2JBMA 2ZWZA 1WKEA 1HL2A 3OBAA 1KM5A 1UD5A 3TTQA 3VFCA 2G4JA 3CC1A 1P6CA 4P2VA 4WIWA 3VKCA 4LU0A 3BAIA 3MU7A 1W5MA 1H0GA 2I5QA 5L9FA 1K03A 1OG0A 2C7FA 2EKCA 3GIQA 4GZJA 2QIIA 1SZNA 3V5OA 4CQBA 5IM51 3GDMA 3UXLA 4O50A 2WQDA 1JVNA 3GR7A 3AMCA 5REQB 3MP3A 1MDLA 5K3VA 1BPLB 1K3UA 4BKNA 1Q6EA 1TPH1 1EA9C 1R85A 2EEXA 1QXLA 1RQEA 1ICSA 4FR6A 5FEPA 3P61A 1TV5A 2ZX6A 4IL0A 2TAAA 1FOBA 2XH0A 1PAMA 2V9DA 1N8FA 4QE1A 4W4QA 4DAFA 1RJRA 1EYWA 1ZAJA 1E72M 1GOIA 4G1NA 1TZZA 5REQA 4Q32A 4MDPA 3M5YA 5I3DA 3KVKA 1WOAA 3T81A 1XICA 1XD0A 3QQ1A 3TKFA 3R43A 4H7ZA 3VDAA 2A0NA 3AXIA 4ACZA 1OD0A 4FXFA 4S3AA 4OIFA 3SCVA 4JL2A 1HP5A 2HISA 1ISZA 2Z2BA 3BARA 4JNYA 3HGOA 1RBOB 3NM1A 1W3NA 3POHA 5T9BG 5C54A 2D0FA 1XLJA 1Q7QA 4S3BA 1S5MA 2FGBA 5LKYA 2WAGA 3RN6A 3SCRA 1E40A 1LF1A 4U28A 3TQPA 4Z17A 3CWNA 3MUZ1 3ABXA 4HZ8A 2RHGA 5L6UA 3EX4A 2HWGA 1B30A 5A2CA 1S2TA 1XL9A 3ID7A 3HMCA 2FH6A 3VGFA 3TV8A 4KEUA 3LV5A 3POCA 1UOZA 3TWBA 3LA4A 2WZEA 3MUY1 4W93A 3M5ZA