1FH8A

Crystal structure of the xylanase cex with xylobiose-derived isofagomine inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
312
structure length
312
Chain Sequence
b'ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,4-XYLANASE
molecule tags Hydrolase
source organism Cellulomonas fimi
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
total genus 128
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fh8A00
3VMOA 1V0MA 1F4HA 3DYMA 3VDCA 2BY0A 1L0PA 3WQ6A 2NSXA 1JZ7A 3BSGA 1JZ5A 3LPPA 3VD9A 1BLIA 1HVXA 4UOQA 1TVPA 1CGVA 4C7FA 3LMYA 1AQHA 3AXHA 3NSMA 2FH8A 5D9MA 1CXHA 2VI0A 2A3EA 4P7QA 1HJWA 4BA0A 1OSEA 2WK2A 2VZOA 2XIIA 1V3MA 2DT0A 3BH4A 3BAXA 1KR0A 4WSJA 1BSIA 3VILA 2TAAA 3RMEA 2VO5A 5ABFA 1BF2A 1G01A 3AJ7A 3VMNA 3W53A 1HL8A 1UD8A 1Z32X 3AIEA 1E43A 2CEQA 7A3HA 1W9PA 3BLKA 4XX6A 5DO8A 1KGWA 3AQUA 1SMAA 1WDQA 3FXYA 4TVDA 1GQIA 4J3WA 3VIGA 4EANA 1UYQA 2D22A 1QNQA 3WBAA 4JL2A 2XFRA 4J3XA 3BCFA 5D8ZA 1W9VA 1K6AA 1OGBA 2WKGA 1GCYA 1VEPA 1J10A 1CLVA 3EDDA 4CD4A 3QGVA 2E9BA 4Z2LA 5A6MA 2DSKA 3A4WA 2BXYA 3KEHA 1OD0A 3WUGA 2DSUA 4PN2A 2YDRA 2CHNA 4AD1A 5JIPA 4TUFA 4ML4A 4J3UA 4N42A 3BAKA 3SUUA 1Q6FA 2OWXA 4QLJA 1LF1A 1NWTA 2VR4A 2OYMA 1DTUA 1V3HA 3CZJA 2O9RA 3RJYA 5CLWA 1UD4A 2A3AA 3WDHA 3W24A 2WBKA 3QR3A 4W93A 4AIOA 1DEDA 4U2YA 3W81A 1FOBA 1JL8A 1V02E 1WB0A 4GZEA 4BZYA 4JL1A 2WZHA 4PMYA 1NWUA 1H1NA 1CXKA 1JXJA 3UR8A 3WY1A 1KXTA 5A8QA 2YJQA 4PCSA 1V03A 4UFIA 4V27A 2CERA 4JKLA 3AZSA 2J25A 3GXFA 1UD6A 1VJSA 4H8HA 4MJ4A 5A3HA 1SFSA 4ACYA 1V3KA 4P8VA 1J12A 3L4TA 3OZPA 4HMEA 1E55A 4JIEA 3GDBA 1UH3A 2WVVB 3WQ5A 4AZGA 4LYRA 3MKKA 5CXPA 4MB3A 1IZKA 1QI2A 1A3HA 5AC4A 5BROA 5D9NA 1JZ4A 2X2YA 1E5JA 2QLYA 3ZT6A 2WPGA 2XGIA 1OD8A 2CPUA 3U5YA 4UFKA 2FGZA 2J7HA 4F79A 5GNZA 1D3CA 1JYVA 2D2OA 2ZWYA 3VGFA 5FCZA 3AI0A 4HA4A 4MNMA 1B31A 1QI3A 3CUHA 4TXEA 3QHOA 4GQQA 5GPRA 5IXEA 4CUCA 3A4XA 2F2HA 1DWIM 1R87A 4AZIA 1JI2A 1HJXA 1E6RA 5CGMA 3ARSA 1DWGM 4JFSA 3L2MA 1B2YA 2V5DA 4EAMA 2WHJA 2BHZA 2V3DA 4OZOA 3SUSA 2D0GA 2AOSA 1R7OA 3PTQA 1GHSA 3B9DA 3RCNA 1ISVA 3N15A 4U31A 1ZBCA 4HPHA 2OYKA 1W9BM 1J0HA 1BG4A 1H2JA 2E0PA 1E3XA 4NSBA 2GK1B 4OBRA 3WD4A 1XSKA 5M3WA 2V5CA 3PZIA 3S6TA 2VOTA 1ISXA 3PZOA 3CMJA 1OWQA 4W87A 1FA2A 3HN3A 4P8UA 1XRVA 2VL4A 4P7NA 4JHOA 3KZSA 1QNRA 1NOWA 3AYRA 1AMYA 2J75A 1HKJA 1VFOA 3W6LA 1E5NA 1NQ6A 2ZXAA 1JI1A 3WIJA 3UG3A 1GOQA 3THCA 3W25A 4A4AA 4MJ2A 1ODZA 1PAMA 1E0VA 4PEEA 3IAQA 2ZX8A 1JIBA 3FY1A 1M04A 4QLLA 4DM1A 5D9OA 4EE9A 4Z2HA 3GXIA 5BRPA 3AOFA 4AXNA 2J7CA 4QFUA 3AMCA 3RM9A 2OWWA 3AMGA 3NDYA 4U3AA 4W8LA 3GXMA 1UUQA 5EFFA 1WNOA 4EK7A 1B9ZA 1PX3A 4OOZA 1W32A 2G3JA 1UR0A 2UY5A 3VDBA 1E4MM 3VGHA 1B90A 3L2LA 1H0GA 3FW6A 3MMWA 1IV8A 3WH6A 2ZUNA 1SR0A 4HA3A 2QMJA 4J3VA 4QLKA 1WO2A 4XZBA 3FAXA 3WH7A 1JFHA 2DEPA 1CLXA 2E9MA 3TTYA 2J7EA 2MANA 2VT0A 3D3AA 4NI3A 3BAWA 1QI0A 4C7GA 1K9EA 3SUTA 2WWDA 4B9YA 1CXEA 1E70M 1UR2A 4HTYA 4P7RA 1RP9A 4UFLA 2UWFA 4LYQA 4CD7A 2VC9A 1UWUA 3VM5A 2CBVA 1JYXA 3TTQA 5D8WA 3GZAA 1U30A 2CBIA 1CZ1A 1XYZA 2YL9A 2JIWA 7TAAA 1E72M 4U5KA 4M8UA 4UZSA 2WLZA 2QPUA 2WMFA 2XM2A 5EFDA 3WF0A 2VRKA 4B3KA 1PZ3A 5CPTA 2WXDM 1PX4A 1WAWA 2HISA 1EO5A 3SEPA 4ACZA 4D6JA 1M53A 3TA9A 1W1TA 3OB8A 1EO7A 3F4VA 4QDMA 2WVUA 1EHNA 3W28A 4E2OA 3CHEA 5A2CA 3MUY1 1QI5A 1KXQA 2GUYA 1GOWA 1VBUA 3CUFA 1ZBWA 2BVTA 2WYSA 2O9PA 2XSBA 1FH8A 3NDZA 4NRRA 1CEOA 5JBDA 1TMQA 1XV8A 3AIUA 1H11A 5GNXA 1QI4A 4W5ZA 1W2VA 3WKZA 3ZO9A 1B0IA 3CUIA 4J7RA 2ZUVA 4E8CA 4R27A 3TP4A 1E1FA 4AZ5A 4F8XA 1DWFM 1VFMA 3KWXA 1NWRA 3LPFA 3K1DA 4OOUA 1OGSA 4MAZA 4U2ZA 2ZUMA 2QV4A 2VTFA 5FKYA 4CD6A 1TUXA 1FHDA 4GI9A 4OUEA 3ZMRA 2ZX7A 1EDGA 4NF7A 1US2A 2NT1A 4BQ5A 1GNXA 1SYTA 4UQAA 1MQPA 3AYSA 1WZKA 1HIZA 4HU0A 3MUZ1 2FHBA 2CITA 3VDAA 3MMUA 3OBAA 3SCUA 3APGA 2FHCA 3W0KA 2E3ZA 3VIIA 3WNOA 3QOMA 5DT7A 3VIKA 1H3GA 1FFQA 1WPCA 2X05A 4RE4A 4GXPA 2VVSA 1UOKA 1CTNA 8CGTA 4J27A 4L4PA 1Q4NX 3FHQA 2ZWZA 2GVYA 3WD3A 1C90A 1LG2A 3VX1A 1WKYA 2BFGA 1Y7VA 1W2PA 3PZMA 1GHRA 1QHPA 4DWSD 1HT6A 1BTCA 3CZLA 1RD6A 2ZIDA 4LPCA 4S3JA 4W7VA 2Y24A 4U3CA 3GNPA 3WMSA 1R86A 3WNNA 2WC3A 3VIOA 2V3EA 4NRSA 5FIPA 3ARYA 4OKDA 1ESWA 1ZJBA 4HPGA 4KGJA 2WCGA 1KXHA 2UY2A 3VGBA 2XVNA 1GVIA 1E3ZA 5IHRA 2PWFA 1PIGA 3VGEA 5DEZA 2WHKA 4X0VA 4F66A 3N17A 3N11A 3N18A 5E09A 5A6JA 5C70A 1JYWA 3DYPA 3WNKA 1D7FA 4CCCA 4CGTA 5JIWA 4P8XA 4AY1A 3ZSTA 2BVYA 4WLCA 1TR1A 3HMCA 4ZFMA 5I5RA 1BYBA 3M6DA 2G4FA 2YDQA 3BGAA 4UOJA 1B30A 4PMZA 3D5HA 3WDQA 2O9TA 2W91A 4FLQA 2CKRA 1OM0A 3UCQA 2DIJA 1EQCA 1H4PA 4PTMA 1ISYA 1UKOA 1ISZA 2C7FA 3VINA 3GBEA 1DWHM 4MB5A 1E6XM 5LYRA 5IHSA 1J18A 1QNPA 4HZ7A 1VEMA 4WKAA 3AS3A 2JEQA 1UR9A 3SCVA 2WM0A 4M56A 1QOXA 2CIPA 4B3LA 4CN4A 4YHGA 3AHXA 3SCOA 1U2YA 2VZTA 3WEOA 5I79A 4ATLA 5LA0A 2VX4A 4KH2A 5AYBA 5C71A 1DHKA 5AYIA 1G5AA 2A3CA 1X6NA 1J0YA 4UTFA 1JDCA 2PWHA 3MS8A 1EOMA 1C91A 1V3IA 1NH6A 1C7TA 5EB8A 1RPKA 1UWIA 3WF1A 3B9AA 6A3HA 1UKTA 2IXUA 1XD1A 2W92A 3PZGA 2HVMA 1V6XA 4TVUA 1M01A 2XGBA 4K68A 3IANA 1E56A 3W29A 3A47A 2EO7A 4A3YA 4TTGA 1K9TA 1JZ2A 4HMCA 1BGGA 1J9YA 3MSGA 4W8BA 3VMPA 2WNWA 4X0NA 2D0HA 3DYOA 3PZQA 2WMJA 3W4RA 1GONA 1WDSA 4LXFA 3WD0A 2JF7A 2ZICA 2XPKA 3ALGA 4DUWA 4QCFA 3ARPA 3WQVA 5FOOA 4DUXA 2Y4SA 4FF5A 3GNOA 1V6VA 3ARRA 3M46A 4B15A 3AXXA 2CESA 2B31A 1GZJA 1B3YA 4JCLA 3SCSA 5GQBA 3WSUA 4IM4A 6TAAA 3QHMA 3T08A 1QBAA 5CZKA 3ARVA 3FN9A 1BG9A 1BVZA 4J3SA 1F4AA 1YHTA 4Z2KA 2GJRA 3HU7A 2VR5A 4PMOA 3FAWA 3GXDA 3SCTA 1GOOA 2UY3A 1KGUA 1E6QM 1AVAA 2BHUA 2YL6A 2BV9A 4D6FA 3WH9A 1PJ9A 1Q6GA 1OB0A 4KMQA 2F8QA 2VZUA 2Y8VA 3KE0A 4CU7A 1V6YA 3BCDA 5LA1A 3AIRA 2EBNA 2JF6A 1MFUA 2WMKA 2YBTA 1E6SM 4AW7A 2WKLA 4OIFA 4D6HA 3BXWA 1KQYA 4TX6A 2V38A 3A6OA 4JZ5A 1I75A 1KCKA 4W7UA 2G8ZA 2CETA 2DQXA 1VIWA 3VVGA 3MSDA 1MXGA 2UY4A 2ZXDA 3WDRA 2IUZA 1WE5A 1HP5A 2WZIA 2XVKA 4D6IA 5I2UA 2PWGA 1KGXA 2DSWA 5M17A 4ZE4A 3AISA 4H8UA 3K4AA 2X0HA 3S2CA 4TX8A 2C0HA 2CYGA 1QW8A 3WMBA 2Q8XA 1QW9A 1KWGA 2YL8A 1UR1A 4PMUA 1XCWA 1UKQA 1XD0A 4S3KA 2YL5A 4GQRA 4YHEA 5I78A 3NUKA 4WKHA 1G94A 3PBGA 3GYCA 5A2BA 2FDMA 2FGLA 3PZ9A 2VRQA 4BCEA 5BXRA 1VF8A 5LA2A 1H09A 3WELA 3LPOA 2GDVA 3CUJA 1CBGA 5A8NA 8A3HA 1W3KA 3TTSA 1GORA 4TOQA 4BS0A 2PBOA 4CD8A 1S46A 3AS1A 3VIFA 1LL6A 3SCPA 2J62A 4GO8A 3WH8A 3WNMA 2QHAA 1GVYA 3B9EA 3O6AA 2YA2A 2J79A 1ZS2A 1V0KA 3CPUA 5HNNA 1QHOA 1JD9A 2D0FA 4P8WA 2QPSA 4ATDA 2JFEX 1NP0A 3SUWA 3VIPA 4JFTA 4IISA 1W3HA 3ZT5A 1JAEA 1CDGA 2EPLX 1JGIA 1ZBVA 1RH9A 1UH2A 4DWSB 2GDUA 1KB3A 5AY7A 1UWSA 2DT3A 3AS0A 3NJ3A 1EOKA 2AMGA 3VD3A 2XFFA 5BRQA 3OG2A 3ZIZA 3WUBA 2BXZA 3ZJ6A 3L4WA 2VCBA 2G3NA 4H8VA 2A3BA 3VIHA 5HPCA 3T2OA 4GI8A 3AXIA 4PRWA 2FH6A 1LQ0A 2ZUSA 3OLGA 1FP8A 4UQCA 4WIWA 3VD7A 3K8MA 1EIBA 3VD4A 2IXVA 1MYRA 1NM9A 1G1YA 5E0CA 3WF4A 2XTKA 2VUYA 4JAWA 3OLDA 4KRUA 1UWRA 3GBDA 2DH2A 4MNKA 5A8MA 4HOWA 1V6WA 4H2CA 3WEZA 2ZX6A 1KXVA 2GSJA 3TTOA 4W86A 1CGTA 6CGTA 2OSYA 1HVQA 3AICA 3GNRA 2VQTA 1MW2A 2VZSA 3MUIA 3POCA 4UNIA 5IDIA 2J77A 4PYSA 3UG4A 1KQZA 3N12A 4PTVA 3PZUA 1VFUA 3CZ8A 5I23A 3IJ8A 3NSNA 3WNLA 2WW5A 4HOXA 2JALA 1TFVA 3BAIA 5I24A 2G3IA 3L4UA 4AD3A 3AMKA 3AIWA 3F5JA 2O9OA 4CU8A 3WL1A 3N04A 3O9NA 4JFUA 5CSYA 4W84A 3LPGA 2W4XA 3OA5A 4ACZB 1HNYA 4LYPA 2GK1A 4W5UA 3ZT7A 4XZWA 2DSVA 4CCEA 3VDHA 1HKMA 4W85A 2DT2A 2D1ZA 3II1A 4CVUA 2WVSA 2WCAA 3E1F1 1OIFA 3ALFA 5A8PA 1HXJA 3O2LA 3AHZA 5DMYA 1EA9C 4CCDA 2X1IA 1W91A 3ZQ9A 2J7FA 2E8ZA 1E6PA 4GPNA 5GNYA 1ISWA 1WP6A 3ARUA 1J0KA 3MUAA 4GZIA 4Z2JA 2X0YA 3WFZA 1W1PA 4ZXLA 1KBBA 1EHAA 1CYGA 2C8NA 5FD0A 1Q6DA 4AEFA 1CXLA 2JE8A 1ZB5A 4D1JA 4E8DA 1J0ZA 1UA3A 4TTUA 2WB5A 1K9FA 1WCGA 1J0IA 1TVNA 3AHVA 3RIKA 1XGZA 1NARA 1KBKA 3EMCA 4Z2IA 1JAKA 4ZENA 4GKLA 4GIAA 3TOPA 2XHYA 2VMFA 3I3BA 4XV0A 4XUYA 1EH9A 3UERA 5D4YA 1V08A 1U33A 1QNOA 3N13A 1TA3B 2J78A 1EXPA 2ZUTA 1HJVA 4DUVA 1LL4A 3AIBA 4GINA 4F9DA 2ZX5A 5C8BB 1P6WA 1C3FA 4E4PA 4FLSA 1M03A 5A6BD 2VURA 2EPOA 1LLOA 5KZ6A 1GW1A 2VCAA 4W88A 3BMVA 3T0DA 3M7SA 1JZ8A 3EDJA 1ITCA 1VAHA 4F9JA 2OSXA 2WLYA 1D2KA 3WD1A 1XH2A 1V3JA 2WVTA 3ARXA 4CD5A 4IPNB 1G0CA 2VRJA 2VJXA 4BQ2A 1PPIA 1WZLA 1K9DA 5ABEA 5BWFA 1BPLB 5BCAA 2X09A 4AC1X 3I3EA 2F61A 2XIBA 3SCWA 3GH4A 4UFHA 1UD3A 1OINA 1EQPA 4AZ7A 3AIQA 3ZR5A 2ZUUA 4N0RA 3CO4A 2RGMA 3IAPA 4PMNA 4EKJA 4D71A 3AHTA 3NCOA 4CU6A 3SCNA 2YIHA 5ABFB 1CNVA 1E4IA 1UD5A 2EPNA 4AZHA 1V6UA 1TZ7A 3L4VA 4AMCA 1V3LA 1XSJA 1V0LA 1LL7A 1W1VA 2ESCA 1ECEA 4UFMA 4CN1A 1CGYA 1UG6A 1HKKA 1MXDA 3UESA 1QNSA 2W61A 3U5UA 2E9LA 1PZ2A 3AIVA 2XWEA 3B8SA 3F5LA 2WMGA 5M03A 3K46A 3NSXA 3WUEA 3PN8A 2J4GA 2NW0A 3CZKA 4PMXA 4H04A 4UOZA 3RO8A 4DWSA 2XM1A 2EPMX 1UWTA 3WFLA 3WUFA 3W38A 1AQMA 1CPUA 1JNEA 2D23A 2DIEA 2BS9A 4FK9A 1N82A 1MW3A 1UQZA 1TE1A 2XVGA 3ARWA 4CKQA 1E4NA 1XH1A 2CCRA 2AAAA 1FH9A 4HZ8A 3K4DA 4M29A 1FP9A 3GM8A 3CHDA 4W8AA 2EXOA 2GFTA 2CBUA 1ODUA 4M82A 4Q22A 4M1RA 4HU8A 3BC9A 1ZL1A 2O92A 3UEQA 3WQWA 5HBFA 4AD2A 3EYPA 2WSKA 2FHFA 5DF0A 1E6ZA 1MW0A 4RE3A 1OCQA 4UQ9A 1UKPA 1UQYA 4GI6A 2D24A 3MO4A 3RM4A 3SIMA 3OLIA 3RPMA 1KWKA 4W7WA 1VFFA 4PUDA 3VU2A 3WMCA 3U7VA 3N9KA 3EDFA 1HP4A 1GQJA 5EBAA 2PI6A 4MADA 2XUCA 1MFVA 4H41A 1ITXA 4LX4A 1E9LA 4GO9A 4UCFA 2J47A 2BNJA 3UG5A 1H41A 1PIFA 1V02A 1C8QA 1JDAA 5I0DA 1OIMA 3VKKA 2VX6A 4D6EA 2Y2WA 3PTMA 4U5IA 1UH4A 2CNCA 2J7BA 3DC0A 3WNPA 1CGUA 5A6KA 1SMDA 3SURA 3RM8A 5BXSA 4PBGA 2XJ7A 5CG0A 1MW1A 1CXFA 2BHYA 2WC7A 2OLHA 1CENA 4PMQA 1ZJAA 1R85A 5BYWA 3ZJ8A 2A3HA 5I3DA 4YN5A 2WMIB 1JF6A 3EMQA 1XHGA 7CGTA 1B3WA 3EMZA 5HDRA 2WMIA 3VOCA 3PZTA 2PF0A 5A6LA 1JYNA 3VTRA 4B9ZA 1E71M 3T09A 2VCCA 4GZJA 4AD0A 1UHVA 4AD4A 5E0FA 3FNDA 4JKKA 2RGLA 2BY3A 1PX8A 1FH7A 1NOFA 3MV11 1YQ2A 4PCTA 2OYLA 4CVWA 4AIUA 4PMVA 3AMDA 4MB4A 5A95A 2DDXA 1FFRA 4AZCB 2EJ1A 1HJUA 1GQKA 1BHGA 1E4LA 3A3HA 1L8NA 5DT5A 1OBAA 3OZOA 3G6MA 3SCRA 4M24A 4H7VA 2WMHA 1BAGA 1QBBA 5HOSA 1XC6A 3BLPX 4V28A 4URIA 3EDEA 3UETA 2VZVA 1I1WA 2ZUWA 5CPQA 4ZXOA 2YOCA 5A94A 5CGTA 1DWAM 4Z2GA 4JFVA 1FHLA 1X1NA 1JZ6A 1IZJA 1MQRA 1GPFA 2CHOA 2VX5A 1JXKA 1E1EA 3CGTA 2GJXB 5EMYA 5JUVA 1XH0A 1GJUA 4BQ3A 4M81A 2BY1A 3ZJKA 3VD5A 2CXGA 4OBSA 4YPJA 4WK9A 1LG1A 3AZRA 4UZUA 1BVNP 3ZM8A 2PWDA 3F5KA 4DM2A 4IPLA 1MQQA 1BQCA 2WBGA 4HOZA 3T2PA 1UD2A 1DWJM 3N1AA 3ZR6A 4IUGA 2W63A 2E4TA 3K8LA 4V2XA 1E6NA 1W3JA 5D9PA 1GUVA 3THDA 3RILA 1GOIA 1JFXA 2DGAA 3VX0A 1C8XA 1LWHA 1NOUA 3AZTA 2VQUA 2G41A 2PWEA 1CIUA 3GTNA 3VGGA 4MAVA 4A3HA 4FLRA 4PSPA 4D72A 1JF5A 2CKSA 3L4ZA 1EDTA 2Y5EA 1C7SA 4B16A 1G9HA 5JBFA 3OLEA 3CIVA 4AWEA 5JBEA 4KGLA 1EDQA 1XYFA 4KWUA 4Y7EA 3WH5A 2XSAA 2XFYA 1UR4A 1B1YA 3EBVA 3WQ4A 1CGXA 2JIEA 5DFAA 1E40A 1CXIA 3CMGA 4HMDA 4KRTA 2OSWA 5KEZA 1HKIA 1J01A 3KL5A 3MANA 3J7HA 3A4AA 1WZMA 1BYAA 5HPOA 2EQDA 2WHMA 3T2QA 4D6GA 4UQEA 4HP5A 1EGZA 1WDPA 4WKFA 2GJXA 4C7DA 4XB3A 3MU7A 5M5DA 3HJEA 1VRXA 5A8OA 3EDKA 1TCMA 2WWCA 2J7GA 1H5VA 1W1YA 1E15A 1LJYA 3QHNA 1R7AA 3AROA 3RDKA 3VIMA 1HX0A 4LQ1A 1AQ0A 3ARQA 4ZE5A 4PMDA 5BXPA 5E6YA 1TA3A 4X9YA 5A69A 1JNDA 2Y8KA 4M80A 4BF7A 1HF6A 1KFWA 3U7BA 1PEZA 5A2AA 3DECA 1E0XA 3WEMA 4FLOA 4J3TA 5CSUA 3OIHA 4ATWA 1GQLA 1NP2A 4P7LA 2WZEA 1TG7A 3L4XA 1JDDA 4AEEA 2EEXA 3VIJA 3ARZA 3CLWA 4LGXA 2ZOXA 3PTKA 3WDJA 3WDPP 2WANA 3ZSSA 5TD4A 5I6SA 2PBGA 3TONA 2WC4A 2X8RA 1B3ZA 3SUVA 1H49A 1UZ4A 2ZE0A 4AZ6A 1WDRA 3WF3A 1R8LA 3RJXA 2WSPA 1DP0A 3WL0A 4WJXA 3MV01 2YBUA 3CZGA 5ABGA 4BQ4A 1OGGA 2DH3A 1QHZA 3VUPA 2YLAA 5FL1A 2D3LA 4AYSA 4MDOA 3W82A 1LWJA 2NT0A 5A6BA 3WN6A 1GJWA 1VJZA 3BAJA 2W5FA 3W27A 1JZ3A 5IFTA 1A47A 4MNJA 3WENA 4PUEA 3VGDA 2W66A 3DHUA 4PSRA 2GJPA 3JUGA 4D6CA 4RE2A 5I77A 1JG9A 2WAGA 3VPLA 4JCMA 2VVNA 4U33A 3CZEA 1IT0A 4J28A 1CECA 4MNLA 2W62A 1M7XA 4JHZA 3AS2A 1VB9A 1W9UA 9CGTA 2YLLA 3MMDA 1C93A 1E73M 2PC8A 2BY2A 2J74A 1OT2A 4MDPA 4W89A 1BGAA 2CBJA 5BXTA 2QMKA 5CPSA 4Q7NA 2YDSA 5E6ZA 3CBWA 1WZAA 1MVYA 1UA7A 1ZU8A 3OGRA 4PTXA 4R5EA 1J11A 4AIEA 3M07A 4HZ6A 3WF2A 2DT1A 4QAWA 4MB1A 2YA1A 3I3DA 2J7DA 4UR9A 1W3LA 3GH7A 1B3VA 3ECQA 1C92A 1BYDA 3G6LA 2EPKX 1VBRA 3VM7A 3AMLA 2QF8A 1HL9A 3KL3A 4P7OA 3QOKA 4FMVA 5E70A 2V3GA 2DSZA 4CN6A 2D3NA 3OGVA 2JEPA 1QVBA 4MTVA 3PHAA 4WF7A 2PB1A 2E8YA 1PBGA 1BFNA 1KCLA 1VENA 3WD2A 1UR8A 1VEOA 3UR7A 3WDIA 1GOKA 1Q6EA 3IK2A 1H0IA 2VNCA 4PMRA 2DPEA 4AISA 4AD5A 1OT1A 2XVLA 3BAYA 4UFJA 2VX7A 5AC5A 3T0BA 1O7AA 3POHA 2BVDA 1GOMA 3VNZA 1HJQA 4WSKA 4OJYA 1JD7A 4TVCA 5A6SA 5ECUA 3DHPA 4L4OA 1V0NA 2E40A 3VO0A 2W67A 5A6AA 3SCQA 2ZXQA 5IFPA 3CHFA 4PTWA 3IJ7A 3CTTA 1UWQA 4NZCA 2XG9A 3W37A 3CUGA 4RL3A 3T0AA 1HN1A 1B3XA 4D6DA 3NYDA 1US3A 1RP8A 2Z1SA 1O6IA 2Z1KA 2XYLA 3GH5A 1XCXA 1HJSA 5CJ5A 1QPKA 1J0JA 5ABHA 5F7UA 4QP0A 1ZBKA 1C8YA 2XVPA 2YA0A 5CLTA 3VNYA 2WVVA 1UKSA 4HA1A 2XWDA 3KL0A 3OGSA 3AHYA 3W6MA 3K8KA 3CH9A 4AZBA 1Q6CA 1W9XA 3CHCA 1XSIA 1UZ1A 2V3FA 4JKMA 3WBEA 3BSHA 4UQBA 3NIYA 3PZNA 3WQ8A 4JFWA 2G3MA 2WCSA 1BYCA 2ZXBA 4DWSC 3IJ9A 1E0WA 2J8GA 2ZX9A 3PZVA 5CQ1A 1NWSA 3ARTA 1CWYA 5FL0A 2OWCA 3ZJ7A 4D1IA 1W9DM 4UQDA 5HXMA 1KR1A 1MWOA 2WHLA 3ZOAA 3U57A 3BMWA 4ZEPA 4MPKA 2J8FA 3L4YA 5E9AA 1I1XA 1X6LA 1CGWA 3AFBA 2YKKA 3FHAA 5A1AA 4QCEA 2D20A 3W26A 4AZCA
chains in the Genus database with same CATH superfamily
3VMOA 2PAJA 3EAUA 1A5SA 1L0PA 4YJ5A 5K9XA 3DIPA 1JZ5A 3GTIA 4C5YA 4Y8EA 3WLNA 3VD9A 1A5LC 4UOQA 4LJ3A 3WK2A 3LHVA 1DQWA 3BLLA 4XKYB 1AQHA 3NSMA 1CXHA 4GLEA 3E96A 3BLDA 3S5SA 1YXCA 2VZOA 3BH4A 3UY7A 2ZRZA 3BAXA 1KR0A 3R43A 3RMEA 1H62A 4QR6A 4EVZA 5EBUA 1YNQA 3DCPA 1SW3A 3W7PA 1HL8A 1XG4A 4CNNA 4HZMA 1TWZA 4W9TA 1W9PA 3TN6A 4XX6A 3KDOA 3LBCA 3ONBA 5DO8A 3AQUA 3TWAA 1SMAA 3FXYA 3HG3A 2PLKA 4J3WA 3FLUA 1R0MA 4EANA 1B4EA 3DOPA 2QJJA 3BCFA 4M19A 3BZGA 1W9VA 3W2UA 1OGBA 1SJCA 1IWAA 2F6XA 3EDDA 3MCOA 3LA4A 2E9BA 3KEHA 3M0KA 2DSUA 4PN2A 2CHNA 4AD1A 4GVIA 1F3TA 4O1BA 5EMJA 2ZBTA 4J3UA 1H51A 1GTHA 2HEJA 2OZ3A 2Q02A 1AD1A 2OWXA 5HQMA 3P0XA 4KIEA 3OEXA 5FJOA 2GUUA 3WJZA 4QJ4B 2GGHA 3QR3A 3BICA 3VE9A 2NQ5A 1B57A 2ZRWA 4U2YA 3TMLA 1FOBA 3UYIA 3W1PA 1JL8A 4AWUA 1XKJA 1WB0A 4GZEA 4BZYA 1P43A 3TYDA 4JL1A 4CNPA 1NWUA 5C9UA 3QPYA 4AH7A 3G1RA 3AZSA 2G5WA 3AU2A 2FZBA 4YTSA 2XIJA 2NUWA 4JX5A 4PUKA 4O1EA 1T7LA 2H90A 3NA8A 5DANA 1KFEA 3SJ3A 2ISDA 2KZHA 4ACYA 3PAJA 3OZPA 5LIKX 1E55A 3ICJA 3GDBA 1UH3A 4TMCA 3JZUA 5D32A 4KWSA 5CC5A 1P1XA 1A3HA 2PDFA 4R53A 5AC4A 1Y8BA 3I10A 1A0EA 1JZ4A 5AHEA 1E5JA 2XGIA 4YLWA 2CPUA 2FGZA 3NQDA 3EXSA 4F2BA 2ZWYA 1RVGA 3PR2A 1TMLA 4I9MA 4A8NA 4MNMA 3GKFA 4TXEA 3QHOA 4GQQA 5IXEA 4LVBA 5F2LA 3T81A 3MJMA 3QTGA 2P53A 4AZIA 4JFSA 4QM1A 3EWYA 3L2MA 4EAMA 2WHJA 2BHZA 1VLIA 4QNWA 2D0GA 2C79A 1R7OA 3NQ7A 3CV2A 2DZTA 3QEZA 1O5XA 2ZQ0A 3DBNA 1VIZA 4O0ZA 4CNSA 2PDJA 4U31A 1TWDA 3U6WA 3N3MA 4DI9A 4YYCA 2QYGA 4OBRA 2QUVA 3WD4A 1XSKA 3DG3A 3QY7A 2V5CA 5FEXA 2I56A 2VOTA 3PZOA 3C56A 5EMKA 3VI2A 1XRVA 2VL4A 4P7NA 2XISA 1O60A 1QNRA 2CHRA 2HS8A 3BARA 2NVAA 5EKYA 2Y70A 1EP3A 4K1GA 5AZ0A 4FXJA 2ZXAA 1GQNA 4BWLA 1VFHA 2DIKA 1OX4A 2Z1VA 1E0VA 3IAQA 3HM7A 1Q66A 2Z1XA 4ZQNA 4QLLA 4Z08A 4Z2HA 4AXNA 3S5ZA 2J7CA 4O57A 3M0VA 4QFUA 3R11A 1FWFC 3AMGA 4GGBA 5A5WA 1UUQA 5EFFA 4A22A 2HQAA 1HUVA 1WNOA 5K3VA 4TU1A 1PX3A 2V81A 1H7NA 3GE7A 4OVXA 1E4MM 3VGHA 2X41A 1H0GA 1DV7A 1IXNA 1IV8A 2DUAA 4XZBA 3WH7A 2DEPA 2VFDA 4NI3A 3BAWA 4C7GA 1REQB 1RCQA 2X2GA 1CXEA 5HNUA 4PL2A 4UTJA 3MPGA 1RP9A 4CD7A 4HGXA 4ZTXA 3LM7A 4B4FA 2CLEA 2CBVA 3TTQA 4WDWA 3T0TA 2EF9A 4UIOA 3KCOA 2JIWA 1Q3NA 2Y7FA 3BK0A 4U5KA 3QBUA 3FV9A 3VFCA 4QG9A 4UZSA 3CWOX 2B0MA 5D02A 2Q09A 3WLOA 3W2JA 3GXPA 4ZOBA 5AZ1A 4OV4A 3HV8A 1ICPA 3SO7A 4FB7A 2QCHA 3SEPA 3G22A 3TA9A 5FF3A 1Q2RA 3KDNA 4QDMA 2WVUA 2CU0A 3PULA 4M6VA 3LV5A 2RDXA 2BG5A 3N4AA 3CHEA 2J8TA 3NOYA 4ONVA 1QI5A 1KXQA 1GOWA 3CUFA 1ZBWA 2GSEA 3EWBX 3PNUA 3UXIA 3ONCA 2O9PA 2OCZA 2Y88A 3VXGA 4NRRA 1CEOA 5JBDA 3AIUA 1R3WA 2OKOA 4W5ZA 1G4TA 4XVDA 3T0CA 4R27A 4IP4A 4LS1A 4JIPA 4AZ5A 2TSYA 4F8XA 3R79A 4GIEA 1NSJA 4ZFCA 1VFMA 3LPFA 5HNTA 3FFSA 4HYRA 4MAZA 1EF3A 1QR7A 2QV4A 1ZAJA 2VTFA 2PF8A 1FHDA 2PU1A 5CJNA 3WBXA 4F0SA 5DMLA 3LQLA 2YDAA 1KFCA 1US2A 1BQGA 2NT1A 1JCTA 5BWAA 1SYTA 4NZ4A 4MWAC 1WZKA 2J6XA 2CLLA 1Q13A 2FHBA 2CITA 3SCUA 4Y9MA 4H9YA 4ZVJA 2E3ZA 2OOFA 3WNOA 4JNMA 4BEQA 2GWGA 4UMAA 4NJJA 3C2RA 4IQEA 1WPCA 4AIBA 4RE4A 2RFGA 1ADSA 4NU7A 1CTNA 4O1FA 5AYYA 8CGTA 4ZGYA 1XXXA 2GVYA 4D2JA 3WD3A 3PUDA 2PCQA 1C90A 1Y5VA 3PZMA 4RDYA 1DJHA 1GHRA 1AQFA 4DYKA 1Q6LA 4LVFA 3WNNA 2WC3A 1VP5A 3V0TA 4AX7A 5FJUA 1PHQA 4NNCA 2VWSA 3ARYA 4OKDA 1HGWA 3D3FA 1ZJBA 3L65A 4KGJA 3F4CA 4YNGA 5H8PA 2VEMA 5KINA 1GVIA 5U7SA 5IHRA 1FWBC 3F4WA 3VGEA 2BGNE 2IS7A 1XDJA 3N11A 3KBJA 1IXQA 3N18A 2CC0A 5A6JA 1D7FA 4CCCA 4C91A 5JIWA 3H12A 5G4HC 4AY1A 4L5ZA 2OT1A 4DUOA 3CB8A 3M6DA 2NQ9A 3GXNA 7REQA 1B30A 1M7PA 1EF2A 2CKRA 1OM0A 2NUXA 1UKOA 1PTAA 4MLRA 1ISZA 4GJIA 3QPZA 3GBEA 3VINA 4MB5A 5IHSA 2ZRVA 1QNPA 1TPWA 1KRMA 1RLCL 2YXOA 3NOEA 3AS3A 2P5NA 5D33A 4Q7IA 4UWMA 3SCVA 2OT0A 3DFTA 3EX3A 4WDUA 1Q63A 3FYOA 3SCOA 2DZXA 3RX4A 3HGOA 5HANA 2QZRA 3N4FA 4KH2A 4C6NA 1H5YA 4MM1A 3CHVA 2ZADA 3GDLA 1G5AA 2DJXA 1DJNA 1X6NA 1WUEA 1J0YA 1QWGA 2EG6A 1ONXA 1TV2A 3MS8A 1OZQA 4NG3A 5HJYA 2VYOA 3GHTA 2ZC1A 4OWGA 4H6QA 4IGHA 5HATA 1C7TA 1UWIA 1AL7A 3MVIA 4HKPA 2W6RA 3T55A 4EPBC 1V6XA 4FS9A 3CYVA 4L4MA 2PRLA 4C90A 2FZ9A 5LGZA 4A3RA 4K68A 2QCDB 4GFSA 4HU3A 1TR9A 5ABTA 4U10A 3G1SA 3R0DA 4GYFA 3W29A 3A47A 3HPFA 1TPB1 1K9TA 1WBJA 1EUAA 2QKFA 1U1JA 1J9YA 2PWUA 2PDNA 4X63A 3APTA 3NQEA 3VMPA 4DXXA 3GVQA 4GIYA 4ROQA 2JF7A 1ZENA 4ZODA 4WJEA 2XPKA 4NHVA 4I90A 3NEVA 2HK1A 3M1ZA 1RJQA 4HK6A 1BWLA 4C5ZA 3NM3A 4HYWA 3N6HA 2X7WA 4JIIX 4N9DA 3VCNA 1IYXA 2G3FA 2UZ9A 3K2GA 1BVZA 2YBVA 4Z2KA 2GJRA 3QV7A 2QDEA 1FUYA 3HB9A 3LI1A 1RBAA 2VR5A 3FAWA 3T4CA 4D6FA 1VRDA 2BHUA 3R12A 3RHGA 4GQ0A 4IFRA 2F8QA 5FF7A 1SW0A 2JF6A 4HCLA 2YBTA 1E6SM 2WKLA 3ERPA 3PB2A 4FAMA 4TX6A 5E0KA 2X30A 1IT8A 1U1HA 2PRHA 4PUUA 3PY2A 1KCKA 5I7GA 3TJLA 4W7UA 2VHLA 4RNJA 2CETA 2DQXA 4H9XA 1SJDA 3MSDA 4E4UA 4RNIA 4DLFA 2ZXDA 5EGRA 2Y63A 1WE5A 1R6WA 1T8XA 2GDQA 5TBOA 2Y7DA 3MDUA 2C71A 4N7QA 1DJZA 4RZ6A 4TX8A 1L6SA 1EZ2A 4ZO7A 4O16A 4EF9A 4XISA 1F05A 2YL8A 3N4EA 5KITA 1UKQA 4S3KA 2YL5A 1V4YA 4C6BA 1YDYA 4C6CA 3MP5A 4YHEA 4C6FA 2D2GA 1AODA 4RX0A 2DQWA 3OQ8A 3PBGA 5H8UA 4INFA 2FGLA 3TYZA 4NKCA 2VRQA 4Y6GA 1J5TA 5LA2A 3AO0A 1F3WA 3TLLA 3CS2A 3LPOA 2GDVA 2ZZ5A 4C1KA 4RPQA 4BHYA 4BS0A 3FIGA 2PBOA 2HK0A 4CD8A 4S38A 1N55A 3AS1A 4BF5A 3GFXA 3VIFA 4DELA 3SCPA 2J62A 3IACA 4DVOA 2BBFA 3CQ0A 1ONEA 4ZSUA 2OLSA 3CPUA 3P5ZA 3EWWA 3C8FA 4PCNA 4ZB0A 4LAUA 3SUWA 4JFTA 1AL8A 1W3HA 3ANVA 3ZLGA 1LQAA 1CDGA 1FX6A 4EOUA 1RH9A 1UH2A 3SAZA 1HZYA 3AC0A 4L9YA 1KB3A 4C6OA 1Z3NA 3SIZA 3MMTA 1KFBA 3STFA 3M5YA 3OG2A 3ZIZA 1OYBA 5T9BG 2G3NA 1ZAHA 4GI8A 3KBNA 5K9DA 4IGMA 1XDLA 4MSSA 2ZZ1A 3VD4A 5U4NA 2IXVA 3THAA 3F03K 2PCEA 2V8ZA 1G4PA 4JAWA 4KRUA 4FX8A 4MNKA 3C0JA 1V6WA 4HTBA 2ZX6A 1KBLA 1EUNA 3TTOA 3KP1A 4W86A 1CGTA 2OSYA 1GZGA 1HVQA 2YZRA 3H2NA 2QDDA 3NQCA 3MUIA 4M1BA 3DBPA 3POCA 1W5OA 3PPCA 2PMQA 1A53A 4PYSA 3N12A 3WCZA 1KFKA 4WQ6A 2NVDA 3OZYA 3IJ8A 3PWGA 4G7EA 2YW4A 3PM6A 3UXAA 5FSEC 2GVLA 2Y1HA 3C0QA 1BWKA 2IPGA 3L4UA 4AD3A 1WQ5A 3TNBA 4AWSA 4LUSA 2O9OA 3FJ6A 3MI3A 4Q7BA 3N04A 3O9NA 2OZTA 2W4XA 1HNYA 1VYSX 1A3XA 4S3GA 4XZWA 3KW3A 3PANA 2P3ZA 3VZZA 2D1ZA 3II1A 4CVUA 1Y5XA 2WCAA 1OIFA 3O2LA 5DMYA 1EA9C 2D2HA 3M41A 1KCXA 4PH6A 2X40A 2J7FA 1VFTA 1E6PA 2O0TA 4GPNA 3R7MA 4NJGA 5GNYA 1ISWA 1WP6A 4KERA 4DZIA 2FVMA 3PPGA 2X0YA 1KBBA 1BXNA 1WOAA 3UWZA 5I09A 4AEFA 1W56A 1CXLA 1LM1A 5DQPA 1P6CA 4D1JA 2PP0A 1J0ZA 2Y89A 3PWIA 1J0IA 4C60A 1EXBA 4FHAA 4HNOA 2ZDSA 4O4VA 1GOXA 4N4PA 1ONRA 4GKLA 4GIAA 2VMFA 2OZ0A 3EKLA 3MI6A 3UERA 4H2HA 3PG8A 1U33A 3VNIA 3H23A 1YTKA 2BTMA 3BANA 4DQWA 1VGAA 3ATZA 4F9DA 1LLWA 2V67A 4IFKB 1TWSA 2EKCA 4PUWA 4JHMA 4QJ3B 1KLZA 1L8PA 1EBGA 1AD4A 4CCZA 3M7SA 1KRBC 2GOKA 2OSXA 2V5JA 3QW3A 2WVTA 3QV8A 1XW8A 2QQ6A 3QMSA 4M7SA 2XN2A 4IPNB 3CUZA 3BLIA 4BQ2A 3GR8A 1DKWA 1XLIA 5BWFA 1BTMA 2E1WA 1MEHA 1A5OC 3AIQA 1YMYA 2RGMA 4EKJA 4D71A 4K38A 2YIHA 3CL7A 3LB0A 3W9ZA 1PKMA 2EG7A 2NWRA 4AZHA 4GIRA 4AMCA 1XSJA 2QCCA 4G6CA 1W1VA 1ECEA 3KVMA 4UFMA 4WXYA 1CGYA 1UG6A 3GG1A 3UESA 2E9LA 1PZ2A 3F5LA 3K46A 1Q7ZA 3MYOA 3NSXA 4KPLA 4ADUA 4K7VA 2NW0A 3CZKA 4PMXA 4UOZA 2A79A 3RO8A 1IGSA 2XM1A 1I60A 4Z1YA 1K4GA 4HHLA 3W38A 1AZ1A 4CNUA 3ARWA 5DRCA 5CJMA 5LNRA 2XIOA 3GM8A 5AN7A 2CBUA 2QS8A 2VGFA 3THUA 4M1RA 3A21A 5HJLA 4HU8A 4NY2A 3UWVA 3ENLA 3HFTA 1GVQA 3HQ1A 1E6ZA 1UKPA 5AVNA 3SIMA 2Y85A 4RNFA 4Q8VA 3OLIA 1KWKA 4GYJA 1K8XA 1VFFA 1N7KA 1OABA 4YCOA 1I2QA 3KOWA 3N9KA 5C6MA 2A6NA 3CIWA 4LCSA 5EBAA 3NGJA 4GXMA 4PTDA 2XUCA 3NM1A 1MFVA 1PKNA 1ITXA 3HJZA 5KZMA 4JD4A 5C2CA 1E9LA 1PYFA 4UCFA 3W7NA 1ZJIA 2J47A 4GG9A 4D8AA 1X7FA 3LHZA 1C8QA 2DFAA 3OYXA 1JQXA 5I3KA 4U5IA 1UH4A 2J7BA 3S5NA 3BW2A 3B8IA 5C55A 4DJED 5A6KA 3SURA 1VCFA 4JR5A 3QZAA 4WD0A 2D73A 1CXFA 1JCMP 2BHYA 1E9ZB 4F0KA 4IPJA 5BYWA 3DFSA 1BD0A 3CASA 3URAA 2A3HA 4NXSA 2Z6JA 1O12A 3ABQA 3EMQA 3DGRA 5HDRA 3M5VA 3PZTA 6ENLA 1JYNA 4QAIA 3KLKA 3VTRA 4IGSA 3E0IA 4B9ZA 1ZQ5A 2GJLA 3T09A 4GABA 1Q7MA 4C6MA 1TV4A 4GZJA 1J4EA 4AD4A 5E0FA 3FNDA 2F84A 3HGSA 5DCBA 1Z9AA 1FH7A 2GGGA 4BI5A 5IRPA 2F38A 5JH2A 2OYLA 3IJLA 2VKZG 3AMDA 4JQ3A 2JBMA 2DDXA 5E5CA 4C6PA 4DBWA 1GQKA 3A12A 1F07A 4IMAA 3OZOA 3TOYA 3G6MA 2Q8ZA 3QY8A 4M24A 1XC6A 4V28A 3O63A 4AHOA 3NQVA 2ZA2A 3RU8X 1IWBA 1GW9A 2Z24A 2YOCA 3NPXA 5ENLA 1Y5WA 1SSGA 3EZ4A 3RUBL 1ZCCA 1S2VA 4Z2GA 4DJFA 3QKEA 5DN1A 3NPVA 4WGHA 5T9CE 1LQ2A 4PULA 2F7FA 4NL1A 2VX5A 4N9EA 1ICSA 1S2UA 5JUVA 5CGQA 1GJUA 3ZJKA 2CXGA 4OBSA 4QITA 4WK9A 1LG1A 4XQ6A 9RUBA 1XIJA 5DELA 3PAOA 4FNRA 3LS9A 3TZNA 3S6DA 1BVNP 2V2HA 4DM2A 1BQCA 4US5A 3NXLA 3M4HA 2XN1A 3S2NA 3T2PA 2AQWA 3D47A 3PBMA 4E3TA 2R1PA 4J35A 4I7VA 2Z1BA 2E4TA 3K8LA 1UP0A 2A6LA 5D9PA 2R9RA 1GUVA 3THDA 4RDZA 3RILA 1YTDA 1I8JA 1JFXA 1LWHA 1UPPA 2G41A 3I6EA 2REQA 4PSPA 3I6TA 3OP2A 2YSWA 3FA5A 3KBWA 3GYEA 5FEWA 3PG9A 5H91A 4CEUC 1VQTA 2QULA 3GKAA 3KVJA 3WLPA 1DHPA 5JBEA 3C6CA 1EDQA 1MUWA 1W5PA 4KWUA 1GYLA 1KW1A 3W1UA 3P0WA 4MWAE 3EBVA 2XU2A 1CGXA 2JIEA 5DFAA 1E40A 3CMGA 4HMDA 4UNKA 3J7HA 1IR1A 3A4AA 1WZMA 4IZGA 4MYAA 1XFCA 4LC8A 4NI8A 4D6GA 2YFOA 1L6YA 2UBPC 4FP1A 5G5IA 4TO8A 4WKFA 1P48A 2GJXA 3C61A 4WOQA 3HJEA 5D09A 5EA9A 5IM51 1TCMA 2WWCA 2J7GA 1H5VA 3FYYA 4IOTA 1KD0A 3V0SA 4TX9A 1VD6A 1AQ0A 3ARQA 4ZE5A 5E6YA 1K77A 1TJ0A 4ILSA 3MSRA 5A2AA 1SO4A 2ZYFA 4MOZA 1YBQA 3DGBA 4P7LA 3F1QA 1JDDA 2P8BA 1TIMA 1ZP3A 3MVTA 3W2NA 3TYCA 1XFBA 2ZOXA 4DIAA 4IWWA 3JU2A 1R2RA 3ZSSA 2BWGA 2PBGA 4GVHA 2WC4A 2ZRXA 4FXFA 2VEFA 2Z00A 3BV4A 1O66A 1TKKA 2ZE0A 2HS6A 1UPMB 3WF3A 2XH0A 2WSPA 2CZDA 3QRHA 2P3EA 3CZGA 5FL1A 2YLAA 4AYSA 5D2YA 1LWJA 4C1NB 1EGMA 3WN6A 3NWRA 3VZYA 3UJEA 1XX1A 3IV3A 4Q4KA 2OOGA 3HG2A 4PSRA 3CAWA 3JUGA 1XL9A 3S1WA 5LNSA 3SR7A 3CTLA 2WNQA 3GIQA 3IS4A 1A5MC 3WG6A 3F2BA 3QPEA 1VCVA 3U4AA 1EC8A 2A5HA 2VVNA 3C2VA 4AX6A 4UR7A 3GFZA 4J28A 4QROA 1N2VA 1LZOA 4MNLA 1M7XA 1GKRA 3CV7A 3TJXA 4LANA 1QUMA 4WEVX 1CCWB 3MMDA 1FCUA 2J74A 1OT2A 3MQTA 5CPSA 4Q7NA 2YDSA 3CBWA 4JTTA 1WZAA 1XLAA 3OGRA 3UZ5A 5HUPA 1XLBA 3M07A 4QAWA 3GLCA 3S9YA 2YA1A 2J7DA 2OO6A 3EKZA 3NEHA 4QE5A 3Q37A 5BU6A 3G6LA 3TR9A 1F5ZA 1VBRA 2EPKX 3TUUA 1PZ1A 2NX3A 1HL9A 4P7OA 3DFHA 2V3GA 2DSZA 1MI3A 2D3NA 2AL1A 1WV2A 1PCWA 3R0UA 5EMMA 1ELSA 4HSOA 2E8YA 1PBGA 1KCLA 4HD5A 3CQHA 4MZYA 3WD2A 6REQA 5DLCA 1Q6EA 3ISIX 3FYPA 4RDWA 5LGXA 4UFJA 1SO3A 4IUOA 5AC5A 3T0BA 5CZ0A 1LBMA 2E68A 2ASHA 2YCEA 5AYXA 2GUBA 4FOJA 4OJYA 1XYLA 4Q33A 3FS2A 4DYJA 3M0XA 3GU2A 2W67A 1JUBA 3OO2A 3CHFA 1T6MA 1UWQA 3W37A 3CUGA 2ABAA 6XIMA 2BASA 2ZA3A 3LYEA 1YEYA 2JGQA 3OIXA 1B3XA 1XBVA 3GU9A 4X60A 1K6WA 1KO0A 2PP1A 2OMAA 3W7GA 1XCXA 3IWPA 1TWIA 1RCXB 3MWAA 4X2RA 1QPKA 5DBTA 2JQXA 4GUIA 4NILA 4L1XA 1OEPA 1C8YA 2YA0A 1UKSA 1OFAA 3A5FA 3KL0A 3UGVA 2AKMA 4AZBA 4J40A 1QO2A 3MBDA 1Q6CA 2FIQA 1C8VA 1KV5A 3NQ2A 4ZQOA 4EACA 4UQBA 3ABSA 3NIYA 2G50A 2G3MA 2WCSA 3UU0A 4L7ZA 2H8XA 3G1HA 1LBFA 3IJ9A 1W3NA 3ARTA 3H7UA 2E25A 3AYTA 3W6YA 2G96A 4S3BA 1K7FA 4ZEPA 2J8FA 4MPKA 3L4YA 3W7KA 1X6LA 2FVKA 4XG1A 2YKKA 3P67A 4H8NA 3FHAA 1XWYA 4QCEA 3CV1A 4GRSA 3ABOA 3USZA 3W26A 4IXHA 5LNWA 4G2DA 4G1NA 4WRHA 3RPTA 3SZ8A 2TYSA 1YRRA 1JZ7A 3QTPA 4FIQA 3BSGA 2PRMA 4B91A 1AJ0A 1TVPA 1CGVA 5M1TA 4C7FA 4GFIA 4LEFA 3AXHA 3IGXA 2FH8A 5D9MA 1GWJA 1HJWA 1I2RA 1RD5A 2WK2A 4DJDA 1A50A 4QDPA 3QR1A 4O54A 1BVWA 2WNNA 4MZ8A 2TAAA 5I00A 4AVOA 2VO5A 1UWAA 1Q4WA 1UD8A 1Z32X 1E43A 7A3HA 3BLKA 4XZLX 3IJIA 3RITA 3FDGA 1KGWA 1KTNA 4LFYA 3VFLA 1PWMA 1KTCA 1UW9A 2D22A 1QNQA 1Q6QA 3RX3A 3WBAA 1RJRA 2XFRA 1TZZA 4Y2WA 1VPXA 1Q7QA 4H9VA 3EWUA 1GCYA 2HWGA 2DZBA 1J10A 1CLVA 1O5KA 5HULA 3FVDA 3SN1A 3QGVA 4QJ1A 3GRIA 3WLKX 2DSKA 3A4WA 4ZB2A 4JTAA 4TUFA 4IH3A 2ZE3A 2GL5A 3GUGA 3IPWA 2B7QA 3SUUA 3L7RA 3H2AA 3QMTA 2TODA 3N2BA 1NWTA 2Z1WA 2OYMA 1DTUA 3PK7A 1V3HA 3CZJA 4NNBA 3RJYA 1OFOA 1UD4A 3WLSA 3KLLA 3TSMA 2WBKA 3O8AA 4QEHA 3GC2A 1DEDA 3W72A 2YZ5A 1V02E 4R7JA 1CXKA 4GUGA 3G8EA 1KXTA 5A8QA 2QPXA 4XAGA 5A6TC 1UD6A 1VJSA 3P8JA 4H8HA 3UPWA 3MP4A 5A3HA 2YR1A 1AH0A 2ANUA 1W5QA 2IQTA 3W7QA 4NJKA 1V3KA 1J12A 4HMEA 4O15A 2I5IA 4JIEA 2NLYA 4LYRA 3MKKA 4GUFA 2WZTA 1PUDA 4YXGA 1QI2A 2RKXA 3LV6A 4LY4A 4E8GA 3N9RA 1Y0EA 4FIRA 2WPGA 1OD8A 3EWDA 3U5YA 4UFKA 5GNZA 2E67A 3VGFA 2PU0A 5FCZA 2QCLA 3AI0A 2PDLA 1QI3A 3P93A 4CUCA 2PC4A 2F2HA 1R87A 4XBJA 1E6RA 1WKFA 1A5AA 1DWGM 1XF0A 2EHHA 1R9ZA 2P8CA 4QS6A 1ML1A 2I17A 3QZ6A 1HFBA 4GI4A 3SUSA 1FWWA 1GHSA 3DXIA 3B9DA 4MG4A 1MNZA 4MVAA 2Y8UA 3UZWA 3G0XA 4HPHA 1AA1B 1BG4A 2E0PA 4BY3A 3I7QA 4V15A 2E1DA 1NJJA 3Q65A 3ID7A 3K1GA 3SY8A 1ENUA 1WUFA 2O7SA 2NUYA 4DY1A 4LSBA 1OWQA 3QGAC 1EJUC 4W87A 1FA2A 1M7JA 3KZSA 1RZMA 4H9UA 1AMYA 3B06A 1I2NA 3ZVHB 3UQNA 2HXUA 4S39A 3W6LA 1E5NA 3E0VA 1JI1A 3LUTA 1GOQA 3THCA 4I5XA 4MJ2A 1ODZA 1PAMA 3ANYA 3LCFA 2ZX8A 3S5YA 4MJZA 3XIMA 1JIBA 4F40A 4DM1A 3AOFA 4GX9A 4L65A 1XIEA 3W2LA 4OV9A 4PMJA 3IIPA 4HYVA 3UVIA 3T6CA 3W7OA 3GXMA 3I7RA 2X42A 5HR6A 4D9PA 4K8GA 3HQNA 1B90A 1A5UA 3GK0A 1L2UA 1CW2A 2IPJA 3WH6A 2QMJA 3N19B 4WVXA 4Y9NA 1WO2A 4FNSA 2PDMA 3CPGA 4BK9A 2MANA 3D3AA 1ZALA 1QI0A 3DZ1A 4P5UA 1E70M 2NXHA 1UR2A 1TTJA 2UWFA 4DJEA 4PFHA 3UY8A 4AVFA 6TIMA 3O06A 5D8WA 5T8GA 4B5WA 1U30A 2CBIA 1CZ1A 1WDDA 3NXFA 4JTJA 4U4MA 5FJTA 1NELA 2YL9A 4UTWC 7TAAA 3QLDA 1E72M 4M8UA 2CLOA 4GYPC 2QPUA 1TJRA 2WMFA 3V1PA 3WF0A 1Q5MA 4MWAB 8XIMA 3JW7A 1SO5A 4LAZA 4Q3MA 1EIXA 4ACZA 5TF0A 3GTFA 2RDUA 4GVFA 4R7WA 5A8GA 3QKZA 3SRFA 2NZLA 3OB8A 1EO7A 3F4VA 1V79A 4PZVA 3W00A 4G8TA 4A05A 3L23A 5A2CA 2V0TA 3MUY1 3T9PA 1VBUA 2Q6ZA 2POZA 3K4WA 1XLMA 3PC0A 1J79A 4L4LA 3NDZA 3W1RA 4MGGA 1ZJHA 1W2VA 4GNKB 2BOEX 3WKZA 4J7RA 3VNKA 2XZ7A 1DWFM 3CC1A 1AZ2A 2LLEA 5BW6A 3K1DA 2IPFA 4KEVA 4JTDA 2R1MA 4IXXA 4DBSA 3E0FA 4GI9A 3GC4A 3GDRA 3GW3A 3W1NA 3DEQA 3DERA 2VR2A 1EDGA 1R3YA 3TW6A 4XIMA 4UQAA 3EB3A 3QFEA 3AYSA 1BXBA 4HU0A 5LXEA 4C6IA 4IX2A 2Z6IA 3I4KA 3G2GA 1GG0A 1S3HA 1H3GA 1FFQA 1H7XA 2CZEA 1TTIA 4A6GA 1M3UA 2MUCA 4J27A 3W2MA 4L4PA 3OHIA 4QNEA 3ZVIA 1Q4NX 2ZWZA 4XSMA 1F73A 1TPUA 1V93A 5D05A 3VX1A 3HPXA 5CSRA 1Y7VA 3A9IA 2OX4A 1E0TA 1BTCA 1RD6A 4LPCA 4S3JA 4W7VA 4U3CA 3WMSA 4J5NA 3WMLA 5FIPA 3LBOA 1PV8A 4M5PA 1VS1A 3VGBA 3GD6A 3W84A 3M0LA 5KZDA 3KBSA 2Y62A 4JIHA 4XAYA 4F0LA 1PIGA 1KKRA 1XQKA 5DEZA 5L6UA 4YCPA 3N17A 4K1WA 1FCQA 1A80A 2CZ5A 2VC6A 3TYUA 1JYWA 1ITUA 5J5RA 3XINA 3RLUA 1S39A 4WLCA 5FI8A 1TR1A 1WXYA 2G4FA 3UWEA 4PMZA 4IX0A 4FNQA 4GCAA 2O9TA 1RK6A 4YTRA 5BOEA 3LCWA 2C7FA 1PVNA 4HNTA 2GZXA 4QIUA 3MYPA 2VWTA 2H8ZA 4WKAA 3TH6A 2BODX 4M56A 1FRBA 1BKSA 3P62A 4S2BA 2VZTA 3ZWTA 1XIBA 5MKGB 1TQJA 4WR3A 3P6LA 2PDWA 3WEOA 5I79A 4ATLA 4G1KA 4LWWA 2PDUA 4YWIA 3S3GA 1G69A 4Q4RA 1JPIA 1IR2A 7REQB 3QSRA 3A22A 3CQJA 3N2CA 4Q4MA 2PZNA 4O12A 4ZTYA 1UZHA 3JVAA 1GKQA 1C91A 2R1NA 2E6YA 6A3HA 4NX0A 3HG4A 1XD1A 1YNYA 2HVMA 3HZ3A 2TPSA 2XIMA 2BDQA 1YBQB 3RRAA 4LUTA 2AKZA 1F74A 4HU4A 3ABXA 3VA8A 2FPTA 1W1IE 3CWNA 1BGGA 1TJ2A 2OJPA 1H60A 3DYOA 2F6UA 2WMJA 2XGZA 1WDSA 4AWTA 3W86A 1XI3A 3LTSA 2ZICA 4QTGA 1FVPA 3ALGA 5I3IA 4QCFA 3ZR4A 3ARPA 1M9HA 2C16A 5FOOA 2Y4SA 4FF5A 3UWQA 1YE6A 3GNOA 3ITCA 3KM8A 1V6VA 5BMXA 4Q8PA 1W17A 5D38A 2CESA 4JIRA 1YDNA 3SCSA 4KWWA 3T08A 3ARVA 2H9AB 1YHTA 1SFTA 3HU7A 1UJQA 1YXDA 2CZFA 2Q71A 3QSTA 4FI4A 1SJAA 1DVJA 1JULA 1E6QM 5HJXA 3WH9A 2DVTA 4KMQA 2QCDA 4ERIA 2E6DA 3KE0A 4CU7A 1T40A 2EBNA 3AXMA 3QMRA 1MFUA 3WJXA 5C7HA 4D6HA 1KQYA 5TNVA 3T78A 3A6OA 4JZ5A 1I75A 2ZZ2A 3SSZA 1VIWA 3VVGA 2IKHA 5F4XA 2UY4A 1P5BA 4GE8A 5FSDC 5C9RA 4IMCA 2EG8A 4D6IA 5I2UA 4MY9A 1FDJA 3M6YA 1Z8AA 4L61A 1AG1O 1KM2A 4H8UA 4JEJA 4DBEA 3NZ1A 2V5KA 2IKJA 3S2CA 2CYGA 3WMBA 5AC6A 1UR1A 4PMUA 4LV9A 7TIMA 3TJIA 5I78A 3NUKA 4IT1A 1S3TC 2O4QA 1U83A 1H09A 5XIAA 2PDCA 1QOPA 2EJAA 5A8NA 2CLIA 4F2TA 3SJNA 4AY7A 4Q4QA 1W3KA 3HA1A 2AQVA 1LRTA 1RBLA 1LL6A 3QC0A 3W7JA 1S2AA 2PEVA 3DH7A 3WNMA 1L6FA 2QHAA 1UROA 3O6AA 4L64A 1FWRA 3BDKA 4DZ5A 1V0KA 1FWDC 3F2DA 2GWNA 2D0FA 1GGOA 3N2XA 4HA0A 4P8WA 1M41A 1DJWA 3RYSA 4AHQA 4ATDA 2JFEX 1T96A 1OCNA 1NP0A 1ZTVA 3O7UA 3LSCA 4IISA 4O18A 1TPEA 4N02A 2EPLX 1KBJA 4DWSB 1EC9A 3STGA 3NVTA 3LERA 5AY7A 1UWSA 3AS0A 3NJ3A 1NTHA 1EOKA 2AMGA 3VD3A 3NZQA 4ZCWA 2XFFA 5BRQA 1WX0A 3WUBA 3RO6A 2NWSA 4WDXA 4H8VA 1S5MA 3AXIA 4PRWA 2FH6A 4I7UA 4V1XA 3OLGA 2ZUSA 5I03A 1FP8A 4O53A 1N8FA 3ZVHA 3LCGA 1C29A 4C6KA 2R24A 1NM9A 3OPSA 3MT1A 3OLDA 1UWRA 2DH2A 3TROA 3WLHA 2H9AA 1Q6OA 4I9AA 4MZ1A 1KXVA 4KRZA 3LTYA 4IPIA 3GNNA 3TAKA 3AICA 1MW2A 2VZSA 1FKWA 5IDIA 1X8CA 5TAOA 1E9IA 3UG4A 1KQZA 5FAJA 1SQ7A 1FDZA 2A3LA 3PZUA 2RUSA 3CEUA 1JUKA 3NSNA 2WW5A 3GG8A 2FZNA 4KQNA 3AMKA 3F5JA 3B05A 5CSYA 1A3WA 3OA5A 4O28A 4ACZB 2Z26A 4LYPA 1LCOA 3TVAA 1FWJC 4CCEA 3S0CA 1HKMA 1CI1A 2HE8A 4JX4A 3W1XA 1UMYA 2DT2A 2WVSA 1BRLB 3E1F1 4PODA 4LRTA 3AHZA 5FAGA 2X1IA 4XAPA 4HNUA 5GJMA 3TMQA 2FPYA 3I7SA 3ARUA 3S1UA 1XLHA 2WKJA 4A2SA 3W01A 2QDHA 4ZXLA 1S2TA 2C8NA 5DCDA 4GGHA 3W02A 1TMHA 3TX9A 3W7CA 2CLHA 4ERAA 5LZLA 1UA3A 1K9FA 1TVNA 1W8SA 3WLLA 1L2QA 1XIMA 1OX5A 2OEKA 3C86A 3DI1A 4S3CA 4IIFA 1KBKA 3GR7A 4N6EA 3GIYA 4YTQA 3KUMA 3FEMA 1OCBA 4XUYA 1EH9A 5D4YA 4O13A 1W6TA 1O1HA 3N13A 3GAKA 1TA3B 2ZUTA 5HQEA 1HJVA 1JEZA 5C8BB 1GVOA 3DFQA 2XDFA 2E5CA 4E4PA 5JVLA 3HO8A 2ZZ3A 4FLSA 1M03A 1KLYA 5A6BD 4LUJA 4B2DD 5KZ6A 2VCAA 5I3JA 1AW2A 3RMJA 3M0YA 3ME3A 1EKOA 3EDJA 1ITCA 4P61A 3MKCA 1ZPTA 3W88A 3URBA 3WO8A 4NZFA 4ICNA 3P80A 1VC4A 2I5QA 2VJXA 3O16A 1WXZA 1SZFA 1P7TB 2FTWA 2X09A 4AC1X 4S1FA 3TWBA 1DQXA 2F61A 3QJAA 1AW5A 2B7PA 3MJYA 3VAVA 1HQTA 2UV8G 4HIBA 3SCWA 3TFCA 4AZ7A 4DN1A 1D3GA 3ZR5A 2P50A 4ZL1A 4OUIA 1B54A 4PMNA 3NCOA 3IUHA 3CAKA 1XLLA 3E12A 2H6RA 1TTPA 4GMEA 2Z28A 1VCGA 3G1FA 1LL7A 1FHVA 4CN1A 3EA1A 4J9JA 5M03A 2WMGA 1LT8A 2I57A 2I16A 1T8QA 3S6OA 3IIVA 2EPMX 2ON3A 3WFLA 3VKCA 3PVFA 3UXLA 1CPUA 1JNEA 5CZJA 4L80A 2BS9A 2ACSA 1FWHC 4JTSA 5CH9A 1MW3A 2XVGA 1XH1A 1FH9A 3K4DA 3MI2A 1FP9A 4DNMA 4ROPA 3NQMA 2QIIA 4XZIA 2CXEA 1EYWA 3UVAA 2O92A 1PDYA 5HBFA 3JRKA 2Z27A 1U22A 2FHFA 1E1CA 3K13A 4RE3A 3C8NA 4MYXA 3G0UA 4GI6A 1RSCA 2DUZA 5EY5A 1OX6A 4W7WA 2FDSA 1GYMA 2VFHA 4LS0A 2A85A 4CQBA 3WMCA 1NU5A 3LHYA 3U7VA 3NO3A 1BF6A 2FFCA 4FOUA 4H41A 2VFGA 3EOSA 2XZ9A 3WK3A 1JR1A 4JXCA 3EA3A 5AKQA 3R94A 4IMDA 3QC3A 1OK4A 3EWZA 4LAOA 3HPAA 1X8FA 2Y2WA 4R34A 3KTCA 2Q01A 3WNPA 3DAQA 2RAGA 1EJRC 3BURA 1SMDA 1X39A 3RM8A 3HMJG 3RCMA 3G24A 4PBGA 1ZAIA 2AGTA 1K8YA 3V3WA 5C9ZA 3CM4A 5HUOA 4V1YA 3NAVA 4C6QA 3ZJ8A 5KMYA 1XINA 2JKEA 4PR4A 1LTDA 1E71M 1X1OA 4JTRA 4BI6A 5TIMA 1SPQA 1ZNNA 3PNZA 3VK5A 1TJPA 4J2PA 3LNPA 3O3RA 5AHMA 1FY6A 1X96A 2BY3A 1PX8A 1X7IA 3FJ4A 2FTPA 3MV11 3PPFA 3N3TA 1YQ2A 5MKGA 3MW7A 1VKFA 5BNKA 2QF7A 5D2TA 4H1ZA 2V2CA 3W1QA 5LNUA 4XZHA 3R8GA 1L8NA 4DBUA 3F4DA 3SI9A 3IGUA 4JN7A 3N34A 1W1A1 1ME9A 4CQ8A 4H7VA 2WMHA 1BAGA 1QBBA 2POTA 2I7GA 2F6KA 1JPMA 5BRBA 2VZVA 4US6A 4XAFA 5GVJA 2OPJA 5A94A 1G7UA 1YKWA 5CGTA 4RPPA 1X1NA 3T8QA 1MQRA 5CC3A 1E1EA 3CGTA 4PUNA 3DFNA 2OG9A 3H53A 2BY1A 3VD5A 1J2BA 1TV3A 3G8RA 1ZP4A 3UW6A 4UZUA 3UJFA 4IPLA 5HMDA 2YCLA 4Y9PA 1G4EA 1MXSA 4GD0A 3OG3A 1DIOA 4HOZA 4QGCA 3QXBA 1DWJM 3FGCA 3NQFA 5FEPA 1D8CA 4AEOA 3UWWA 9XIMA 1IHIA 2ISWA 1GOIA 5I02A 3TSBA 2C91A 1LYXA 4AAJA 1TRIA 1C8XA 1NOUA 2W3ZA 2Z2UA 2PWEA 4TMBA 1IEQA 3SQLA 1FWTA 3N2MA 5AOUA 4CQCA 4Z1CA 1C7SA 1A4MA 3OLEA 5BOOA 2FFIA 4KGLA 2NSOA 2FJKA 3VOHA 5DY3A 3HFYA 1CX9A 2AL2A 1TYGA 2XSAA 4XSLA 1B1YA 4O8AA 3QW4B 1F6PA 3T7VA 3HF3A 4I3GA 3ZFHA 3MBFA 3VCRA 3D0CA 1TPVA 3KL5A 1KRAC 1TPH1 1NQKA 1S1PA 2VC7A 5T91A 1NF7A 5HPOA 3LLXA 3T2QA 2DZSA 2QW5A 3LHTA 3NQ6A 4UQEA 4HP5A 3B4UA 4FO4A 1WDPA 3FXGA 5M5DA 4WY0F 4IIHA 4DXVA 5A8OA 2RJHA 2PWVA 3EDKA 3W87A 3BW4A 1LJYA 3TQVA 4IIGA 4KFPA 2QJIA 1O5QA 4UMCA 1RVKA 4PMDA 1IE7C 2NQZA 3HIJA 5J5DA 2Y8KA 4M80A 3LZ5A 4BF7A 1HF6A 4L56A 1PEZA 1E0XA 3WEMA 1PYMA 2C1IA 4ATWA 3M44A 1NP2A 1TCDA 4KWOA 3QLLA 1YIXA 1ME7A 1XM3A 3FSTA 2DVXA 3ITXA 1GK8A 4LEQA 5CPMA 3SDOA 4PL1A 4C1NA 1YW1A 1XRFA 3C3NA 4B3ZA 4AZ6A 1WDRA 3V1HA 3BOFA 3P61A 3W85A 1R8LA 3RJXA 1P1MA 3WL0A 4WJXA 4DJFD 2GQ9A 3VUPA 2D3LA 1I2OA 1A4LA 3V36A 1TV5A 4IG2B 2NT0A 1GJWA 1JPKA 4OFCA 3PUGA 3TW7A 3R8RA 1JZ3A 3TCSA 3U4FA 1S2WA 2G37A 1UC4A 4IMEA 2QDGA 3DHUA 4RZ5A 3VC6A 3GTHA 4K36A 4RE2A 3B3DA 4B5XA 1OFDA 2WAGA 3PSWA 3VPLA 3WQCA 4ERGA 3AALA 3KS5A 4EX4A 5AFDA 3CZEA 4JYEA 1IT0A 2W62A 2VELA 2YLLA 3EWXA 3NYZA 4EPDC 3FJNA 2QJHA 5BXTA 1HO1A 3ZS4A 1MVYA 1UA7A 1GG1A 4LW7A 4HZ6A 2DT1A 4MB1A 3I3DA 4B4HA 4XWUA 2HRWA 4WZHA 1B3VA 1XUZA 2KAUC 3ECQA 1EPXA 3UR5A 4L6DA 3AMLA 2QF8A 1QASA 4NUWA 4DEFA 3QOKA 3SY1A 4FMVA 2HVNA 5E70A 4ZQRA 1JJKA 3OGVA 1VBGA 4NZ5A 3PHAA 4WF7A 2PB1A 3KCJA 1PE1A 1GOKA 4HSNA 1H0IA 1UZDA 2DPEA 4AD5A 2KX9A 3BAYA 4IFOA 3STCA 1YPFA 2D2JA 1O7AA 3POHA 4JYFA 2YFNA 4GC3A 3T8LA 4G56A 2C3ZA 3VNZA 1H1YA 2X1UA 4TVCA 5I06A 3VO0A 5A6AA 3SCQA 2ICSA 4PTWA 3BG3A 3CAVA 2XG9A 3CT7A 4RL3A 1KCZA 1XIDA 1ITQA 3NYDA 1US3A 1RP8A 3LXAA 3GH5A 1W5MA 3VOFA 4LB3A 1XYAA 3MTWA 2ISSA 4QP0A 3LRMA 1W3TA 2YXGA 3VNYA 1IT7A 4HA1A 4JTGA 2FJUB 3C3UA 3O6DA 1V7AA 4H7ZA 3R6IA 4N9CA 4A35A 3B03A 5EMUA 1NFPA 2V3FA 4JKMA 3WBEA 3PZNA 5HMFA 4JFWA 1R3TA 3N73A 3S8HA 2ZXBA 4WJ8A 3BUVA 4B5UA 2J8GA 2EGZA 4IIBA 3GR4A 4D1IA 4FZIA 1DE6A 5LHFA 4LC6A 1JCLA 3KRZA 3BMWA 5CPNA 1TQXA 3CQKA 3L5MA 3AFBA 2CWXA 4XO6A 4I9JA 2QJNA 1GVSA 1WKDA 4KESA 1E0UA 1K8CA 4AZCA 3E0WA 1NDZA 4KFOA 4LAMA 1F4HA 3GY1A 3DYMA 1VPQA 3VDCA 2BY0A 4UTLA 5AECA 3RG6A 4XIAA 8TIMA 5J8LA 2NQLA 1BLIA 3GVVA 1HVXA 3MZ2A 1TREA 3S2JA 4WCJA 4JBRA 3LMYA 1OK6A 4GK8A 4TV5A 2VI0A 3B9OA 4IL0A 4P7QA 4BA0A 3VABA 5GJPA 2GLKA 4JICA 1OSEA 3TEVA 1AW1A 2X16A 2XIIA 1V3MA 2HPMA 3GWQA 4HSHA 4ZO9A 1VHCA 4WSJA 3CNYA 3VILA 2QUTA 1F9CA 5ABFA 2VFIA 1BF2A 3TNOA 4NNAA 3VMNA 1PB0A 3AIEA 4FF7A 2CEQA 1R30A 3CIXA 3P8IA 1P0EA 4JTEA 5AHLA 2FGBA 1S5VA 1WDQA 2A7RA 3L0GA 1GQIA 2EPHA 1IF2A 4JYDA 3VIGA 5E93A 1UYQA 2NX9A 1XLFA 1YPXA 4JL2A 4MLJA 1YADA 2GVEA 1UJPA 2WKGA 1VEPA 3L5LA 4J3ZA 4E5TA 4CD4A 3S5OA 3OVQA 5A6MA 2E5DA 2BXYA 2Q3OA 4PC8A 2XIQA 2YDRA 2Z25A 4JTHA 1R47A 5JIPA 4ML4A 5EPDA 3V7PA 4K8HA 1MUCA 4LALA 4O52A 1Q6FA 4QLJA 1TRDA 1LF1A 1X6UA 2ABBA 1NEYA 1MRAA 4KF1A 4H83A 3W24A 1YLVA 1UOZA 3C2EA 3GDKA 2CWNA 3UF9A 2QUUA 4L6OA 2YB1A 7XIMA 3VKBA 5H6HA 1H1NA 2W27A 3L12A 3UR8A 4PGLA 3BJSA 2ZTJA 3UA3A 3W2KA 3C2FA 2CERA 4M3PA 3GXFA 4H6RA 5KTLA 2PTYA 5F1VA 3KHDA 1XQLA 3UPMA 2INEA 5DBUA 1SFSA 3S4TA 2J9XA 4P8VA 1DBTA 3W71A 3WQ5A 1PO9A 4AZGA 5EMLA 5CXPA 3Q2DA 3VOGA 4UTTA 1D7KA 3CQIA 3KAOA 4EPEC 5LIWX 3RRXA 2QLYA 3ITTA 3SQSA 4Z17A 1PIIA 4B2DA 4X9SA 3MKVA 4F79A 5K4ZA 1D3CA 1JYVA 2D2OA 3E2QA 3TJ4A 4HA4A 3BJFA 3C4UA 1B31A 5GPRA 3GHSA 5XIMA 1K1DA 4YIWA 1JI2A 1HJXA 3ARSA 1B2YA 1K8ZA 1XPGA 2V5DA 3UNTA 3PBYA 2V3DA 5AC8A 4JTQA 5RUBA 2AOSA 4HNLA 3GG0A 3PTQA 4BEUA 3G3MA 3GSMA 3RCNA 4H9MA 1ISVA 1RLDA 3T42A 5T26A 3BGGA 1ZBCA 5IBXA 3Q4DA 3T40A 3C52A 1W9BM 1J0HA 1XYCA 4XTIA 2QCMA 3H2OA 1E3XA 3N2OA 4NSBA 1Q8JA 3CXOA 1IEXA 2GK1B 1OFRA 4EXQA 3E0LA 1RALA 1VH7A 1ISXA 3CMJA 3OU8A 1BKHA 4O1CA 4WY0B 3G5EA 3HN3A 5LIUX 4REQA 3XISA 3L2IA 3GVGA 4L1WA 4Z0SA 1NOWA 4E6MA 3AYRA 2J75A 1FWAC 3L66A 2CLFA 1VFOA 5KZEA 1NQ6A 3IJDA 2R6OA 3PSVA 3UG3A 4ADSA 2OQHA 3W25A 4A4AA 4YTTA 4ZA0A 1A5NC 3BL3A 4RV8A 1F6YA 4R88A 2QUMA 2XH2A 1AH3A 3GXIA 3UYCA 3U0HA 4M0XA 3SFWA 3AMCA 3RM9A 2OWWA 3HQPA 4Q6JA 3WQOA 3NDYA 1E51A 3WQFA 4W8LA 1BEUA 1B9ZA 3GG7A 3SGZA 2G3JA 1UR0A 2UY5A 3VDBA 5AVHA 2VM8A 1Z7AA 3ZLFA 3H7RA 3BE7A 4FX6M 1KC7A 5CZTA 2VP8A 1QK0A 4HA3A 1SR0A 3KOZA 2A1YA 4C6DA 2C0AA 2BX7A 2H3BA 2OEJA 4IL2A 1EJXC 1CLXA 3ZWSA 3BSMA 1TV7A 4GY0A 2VT0A 4H4IA 4B5SA 3SUTA 3W7EA 2WWDA 4B9YA 2VGBA 2DW7A 4UFLA 4LYQA 5FJPA 5DXXA 1VFSA 4JTIA 1JYXA 3TLQA 2ADAA 1MEIA 1GT8A 1GVEA 5DMMA 1LDCA 1S5TA 4ZZ9A 3T07A 3S2LA 2XM2A 2RJGA 2A0NA 1VR6A 1MUMA 2R91A 2VRKA 1U1UA 4RZ4A 5CPTA 2WXDM 3H26A 3OOQA 2PDHA 3BJTA 4N6FA 4D6JA 4EPKA 3H8AA 1W1TA 3HGRA 1QMLA 4AUBA 2VEGA 9XIAA 2A4AA 5KETA 2YCKX 5LKYA 4E2OA 1XBXA 3A9BA 1UBSA 4RCXA 2XH7A 2PTXA 2XSBA 1OG0A 4NZJA 1ADDA 3U9IA 1B0IA 3SM0A 3CUIA 3CK5A 4JTFA 2OQLA 1R38A 4LUYA 1LOQA 1ZFJA 3HBLA 4Z0JA 3P5YA 4S23A 4N2YA 4U2ZA 2ZUMA 2OEMA 1Z6KA 1TUXA 1JPHA 2VFFA 3WX7A 4A21A 4OUEA 3W70A 1PS9A 3ZMRA 2ZX7A 4FX7A 4CLMA 1TJ1A 4BQ5A 2YGYA 3MUCA 5AC7A 3B0PA 3QYQA 1MQPA 2PZ0A 1HIZA 1ICQA 3MUZ1 3VDAA 3MMUA 3OBAA 1F3XA 4IG2A 3RCYA 2V82A 3QOMA 5DT7A 1HO4A 3VIKA 4XKMA 4IP5A 1DIDA 3ATYA 3DHDA 3IK4A 2X05A 5SWUA 2VVSA 1UOKA 4AFYA 1GPWA 4H6KA 3VNJA 3FHQA 1XLEA 1JDFA 3UWUA 3V75A 3PB0A 1LG2A 4GOAA 1W2PA 4Z1BA 1QHPA 2BLEA 1HT6A 3CZLA 5CPLA 3ZLHA 3GNPA 1R86A 3FVMA 4NRSA 2FKPA 3IVSA 4PUMA 2OB3A 4GUHA 4A3QA 1FWIC 4MUZA 2WCGA 2UY2A 4L9XA 2IQDA 3VKJA 5B7ZA 3E5PA 4ZBCA 4KFNA 4R85A 3S2MA 3C0SA 3RGTA 2WHKA 4X0VA 3U2OA 4F66A 2RDWA 3NQBA 2ACUA 5E09A 4L6HA 3PJXA 3DYPA 3S1VA 2QV5A 3I4EA 4M7TA 3GAYA 2ZTKA 4O10A 3TC7A 1ZLPA 1UP2A 1K03A 3GNXA 3BGAA 2J66A 2R14A 3GIPA 4WY0A 4JQ2A 3OYZA 2W91A 4FLQA 4RW5A 1Q45A 2DIJA 4PTMA 1ISYA 1MZHA 5LIXX 3EX2A 1AJ2A 3MHUA 4HZ7A 1VEMA 2C18A 1SJBA 5F2IA 2JEQA 1UR9A 5D2VA 2VEKA 3OVGA 1QOXA 4Y90A 3A24A 1GVFA 2VDGA 4YHGA 4KCUA 1K70A 2FMNA 2REQB 1H63A 1P0DA 2VX4A 1EWEA 3MA8A 3ORWA 2NX1A 5AYBA 1DHKA 3R13A 2Z4GA 3B8TA 2E28A 4UXDA 1V3IA 3WF1A 3B9AA 3GB6A 1JCJA 1UKTA 2IXUA 3EA2A 5KSWA 3PZGA 4IIEA 4B90A 3FKKA 4NP7A 4TVUA 3GX9A 1DL3A 3G18A 4O0QA 7ENLA 4HN8A 4AYGA 2FB3A 4LS2A 4J1OA 3GW0A 2EO7A 4A3YA 4ICCX 2WOQA 1JZ2A 1WXJA 3GZ3A 1RPXA 3MSGA 3MWCA 4W8BA 5FEZA 2WNWA 3L0KA 1P7TA 3PZQA 3NL6A 3W4RA 1GONA 4LXFA 3WD0A 2PE4A 4DUWA 4G7EB 2V6AA 3WQVA 2IMRA 4DUXA 3EX6A 3QQ1A 4I5RA 5EYWA 1JCNA 1DIEA 5K9CA 3M46A 3AXXA 4LUTB 2L5HA 1GZJA 3V16A 4JCLA 4DZHA 3EPOA 3QHMA 3TFXA 4KEZA 1RCOB 5CZKA 4IQLA 3FN9A 3TTEA 1D3HA 1BG9A 4J3SA 1BWVA 4H00A 3WJWA 4DO7A 2VC5A 3ZZ1A 4GZ7A 2XH4A 3EOLA 1J6PA 2UY3A 2BV9A 3B97A 2YL6A 4M6QA 1Q6GA 3EOOA 2AAMA 1FXQA 2VZUA 2Y8VA 1PDZA 1V6YA 2P0OA 3A4JA 3BCDA 3BWWA 3H2EA 3AIRA 5LA1A 1D9EA 1ZCOA 2WMKA 2OELA 4OIFA 3IIZA 3BXWA 4GA8A 2V38A 1K7EA 4ZQPA 4CQ9A 2GYIA 3EKGA 2G8ZA 3N2TA 4DO6A 1MXGA 4P2VA 3E5BA 2QT3A 3IRDA 5LHEA 4IJBA 3C0LA 3WDRA 3TA6A 3LN3A 3QM3A 1RAKA 3Q67A 5JU6A 2OVLA 3EB4A 4RW3A 2PWGA 4E2BA 1FHUA 1KGXA 4ECLA 5H2ZA 3LD5A 2DSWA 4LCRA 5M17A 3OW1A 1YYAA 3K4AA 4H7CA 1XRSA 1QW8A 2DY3A 4OT7A 4RV3A 4AB4A 3SY5A 1KWGA 4O14A 1FXPA 4FEZA 1J6OA 4AF0A 3W1TA 3OHMB 4WKHA 1G94A 4R7OA 3GYCA 3GHRA 3PZ9A 3USBA 1VF8A 3WELA 4GNJA 2NXIA 4XD5A 4JQAA 8A3HA 1EJVC 3G1XA 3DU0A 3TTSA 1H61A 1MEWA 5G2WA 4IFKA 4UTTC 1S46A 4GH1A 3C2YA 2Q8LA 4GO8A 3WH8A 3LMZA 4M6PA 1GVYA 3AAMA 4NYUA 3MHFA 3B0VC 1ZS2A 3BQ5A 3S9IA 2PDQA 5HNNA 4Y9AA 1JD9A 1OADA 4PB4A 2PGRA 3MZNA 2GQ3A 2WM1A 3STPA 1V51A 4IPPA 3TK7A 4Q6XA 2EAWA 3ZT5A 2OTDA 1JAEA 4ADTA 4ZOCA 1QWKA 1ZBVA 1OY0A 1JUEA 3U3HA 2Z2BA 3WLQA 1UMLA 3WK1A 2IKIA 5H1WA 1DXFA 3UGRA 4OU1A 1XIGA 2RDTA 3LTPA 4PEKA 2BXZA 3L4WA 3ES7A 3BOXA 2VCBA 3O0FA 4AHPA 1IEVA 3VIHA 1R5YA 5CBJA 4WIWA 2V5BA 3VD7A 1EIBA 3NL3A 1RA5A 4GNVA 5E0CA 2GVJA 1W1ZA 4FOKA 1FQ0A 5A8MA 4HOWA 4H2CA 3WEZA 1EJWC 3K5XA 2GSJA 1QO5A 3CYJA 2HPIA 6CGTA 4XAZA 2VOMA 2V2DA 4DJEC 2HV5A 2VQTA 5CC7A 1M65A 3G1VA 3NL5A 6XIAA 1EB3A 4HCDA 5I23A 1THFD 4LYKA 1OHLA 4UTWA 3WNLA 4HOXA 1TFVA 3BAIA 3P7YA 2G3IA 1OQFA 3N25A 3CLMA 4Y8FA 2B81A 3P3BA 3RU6A 2I5GA 3WL1A 4JFUA 3PBUA 3UD6A 4W84A 2ATMA 1Z42A 4CEXC 2GK1A 4OECA 4W5UA 1EGVA 4UNLA 3ZT7A 2AL2B 3M16A 1VZWA 4GISA 3R1ZA 1SVDA 3E38A 4NASA 4CCDA 1W91A 3A13A 2E8ZA 1XLCA 4O8RA 2VEPA 1XLKA 4QDWA 3MUAA 2WNZA 2NV1A 1EHAA 1CYGA 5FD0A 1Q6DA 1M5WA 4BR1A 4GY7A 3UZZA 1ZB5A 1P0BA 1R3RA 2WB5A 1QPOA 2V30A 5CC6A 3A3XA 4ORIA 4Z2IA 4LBSA 4IP7A 3W3OA 1I4NA 2HNEA 1JAKA 4ZENA 5D03A 2XHYA 1Z89A 1J5SA 3I3BA 4AG0A 3TR2A 3WK0A 1QNOA 1EXPA 2OO0A 3NZRA 4I7WA 4DUVA 1LL4A 2W9MA 4GINA 2ZX5A 5D2WA 1P6WA 3FDKA 1C3FA 1ZGDA 3LXCA 2J13A 3TYAA 3LSBA 2VURA 3S47A 5LNVA 1SO6A 1OZMA 5EU9A 1GW1A 3DKLA 2GGJA 4W88A 3BMVA 3T0DA 3EPMA 1VLWA 1XS2A 1JZ8A 1VAHA 3N6JA 1OYCA 3NTYA 1DORA 1XLJA 4ICMA 4G9PA 3WD1A 4NAEA 1GTEA 1V3JA 3ARXA 1ZHAA