1FH8A

Crystal structure of the xylanase cex with xylobiose-derived isofagomine inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
312
structure length
312
Chain Sequence
b'ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,4-XYLANASE
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 128
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fh8A00
1PX4A 2J47A 2WHMA 4JCLA 3ARZA 1WDSA 4WIWA 1JZ4A 4AZIA 5CPSA 2RGLA 4KRUA 1UYQA 1C7SA 1TUXA 4MB1A 5HPOA 4AZ6A 9CGTA 4M82A 1GORA 3F5JA 2OYLA 1KBKA 3SCVA 3GNRA 3VDHA 3AZSA 2XM2A 1FH8A 1GQJA 2E9LA 3S6TA 3UR7A 3VIGA 1CZ1A 2ZX9A 2DSVA 5JIPA 3AIBA 2A3HA 1V3HA 1JZ2A 4B15A 2CCRA 2XSBA 3TOPA 3WF0A 1K9DA 4KWUA 1X6LA 2VZOA 1KXQA 4WKHA 2XVGA 4AIEA 2VNCA 4AISA 4GZEA 4OOUA 3ZSSA 2WMFA 1D3CA 1H5VA 2V3FA 3II1A 4B9ZA 4GZJA 5BROA 1UG6A 3L4YA 3WH8A 2AOSA 4JL2A 3QHNA 1MXGA 2CBJA 3ZO9A 4AD5A 3AS3A 4HMEA 3DYMA 4UNIA 3VD7A 1HN1A 1V3KA 2QHAA 1MW2A 1ISWA 1VEOA 1UKQA 5I78A 1XCXA 1TG7A 2W66A 4Z2LA 1WZMA 2J62A 2W62A 2XJ7A 3NDZA 3TP4A 2V5CA 2IXUA 1V02A 5ABFA 2GVYA 4HZ6A 4W93A 2V3EA 3IAPA 1LWHA 2UWFA 5FD0A 3K4AA 4P7QA 2YA0A 4AIOA 1HIZA 2DSKA 2J75A 4ATWA 2VT0A 1UA3A 2J7FA 2J8GA 4KH2A 3ZR6A 4AMCA 1SMDA 1B2YA 1F4AA 2WZIA 3POCA 3VGBA 3K46A 3ARYA 1X6NA 4YPJA 3K8LA 4X9YA 5TD4A 1UR9A 4ACYA 4KRTA 1PZ3A 2XPKA 1E15A 5EB8A 1GJWA 3I3EA 2EJ1A 2WK2A 1ESWA 2YLAA 6TAAA 3PZIA 3PN8A 1DWAM 1CXFA 3MS8A 3OZPA 3WDRA 1BSIA 4FLSA 1HL8A 1BPLB 4CKQA 4FLRA 3B9AA 3VINA 2WB5A 2B31A 3SUSA 1HT6A 1V6YA 4V2XA 4RE3A 1V6VA 1GNXA 3QHMA 4PEEA 4IPNB 1KXTA 5A1AA 2Z1SA 3MO4A 2J7EA 3IANA 1V08A 3WDJA 3AMLA 1VJSA 3PZOA 1XCWA 2VRJA 1EDQA 3MANA 3DHPA 2FH8A 4QAWA 2VO5A 3VD3A 5HBFA 4P8XA 2VCAA 1IZJA 1ISYA 2NW0A 4HOZA 3F5LA 4XUYA 3CZEA 2O9RA 3HN3A 1KXVA 3UERA 5D9PA 5JBFA 3CUHA 1IZKA 2WMKA 1E4NA 3W81A 1B30A 5BYWA 1NARA 3GZAA 5CQ1A 5CGMA 3BAIA 4S3JA 4A4AA 4QDMA 2AMGA 2E9BA 4OZOA 3VOCA 4BQ2A 3BLKA 4BQ3A 5HXMA 3VDAA 2WNWA 3WNLA 1JG9A 1UH4A 1JD7A 3D3AA 2YL6A 3KL5A 2A3EA 4E4PA 1BFNA 3AZRA 3O2LA 2YL8A 1J0YA 5AC5A 1GOIA 2D2OA 4TOQA 4PSPA 4X0VA 4B3KA 3A3HA 2PB1A 3AIVA 3HMCA 1FA2A 3EMCA 1NWUA 3VM5A 5JUVA 2FHFA 4UR9A 3VDBA 3DYPA 5DT5A 3DHUA 2JFEX 4GIAA 3WD1A 4GQRA 4NRRA 3VVGA 1GOWA 1CPUA 3CZJA 1NWRA 3THDA 2DSWA 4DWSC 3N1AA 3W4RA 1CTNA 2JEQA 3IJ9A 1MXDA 3VD5A 1JF5A 2XFYA 3AHXA 3VIIA 1BF2A 1WPCA 4A3HA 3WD4A 4JIEA 1OIFA 2OLHA 3WD3A 4MJ4A 2BXZA 3GNOA 3EMQA 2PBOA 4UFMA 1A47A 3NIYA 3QOKA 5E6ZA 2J79A 3PTKA 4CD7A 4F9DA 1OGGA 3SUUA 2VCBA 4J3XA 2XVKA 1HP4A 2WC7A 3N13A 2GFTA 2RGMA 5I3DA 4ML4A 1MW1A 3BSHA 4ACZA 4AZGA 4OOZA 3WD2A 2EQDA 3BCFA 2X0HA 1NH6A 2CKSA 4IM4A 1PX8A 1E3XA 4OBRA 3RMEA 3GXMA 3WUBA 3T0BA 1C8YA 1EO7A 1FFQA 2VCCA 4PMQA 2WBGA 3TTOA 4W8BA 2DDXA 3AXHA 3AQUA 3EBVA 1GW1A 1CYGA 1CEOA 1BYDA 2ZUVA 2DQXA 1UKOA 4M80A 3RCNA 1UD3A 2Y5EA 3CHEA 1EDGA 4D1IA 2WPGA 2X0YA 4HOWA 3AIUA 1E40A 2BVDA 4W88A 4GI9A 3A6OA 2EPNA 4Z2KA 1IV8A 4UOZA 4GO9A 2OWCA 3OLEA 5A6BD 4PMVA 2YDSA 1C3FA 4UOJA 4UFHA 4DM1A 3WF4A 2BV9A 3CIVA 4CUCA 4AZ5A 1H49A 4W87A 2ZXQA 5GQBA 4J3UA 3BSGA 1MQQA 1JL8A 3WH7A 2Y24A 1K9TA 1ZU8A 3UG5A 3WNNA 4M24A 4UQEA 2PC8A 4F79A 1MFVA 1VF8A 1WP6A 2UY3A 1XH1A 1JXJA 3BAKA 3BCDA 5DT7A 4BZYA 3PTMA 4LYPA 4CN6A 1Q4NX 2D20A 1E4LA 3NUKA 4D6FA 4P7NA 3VO0A 3PTQA 2J7DA 1W1TA 1JYVA 1NWSA 4C7DA 4DWSD 1MYRA 3QHOA 1CLXA 1WZKA 3TA9A 4D6DA 1MVYA 2BY0A 3WEZA 1E0XA 1E4MM 2CIPA 1WDPA 2VURA 3U5YA 5CLWA 1V6XA 1NP2A 2WWCA 5A6KA 4FK9A 1NQ6A 2WMIA 4JKLA 5IDIA 1ISZA 1C8XA 1GOMA 3FY1A 3VM7A 3DC0A 2J74A 1DHKA 1DWIM 1OD0A 2CXGA 3WH6A 1J01A 4J3SA 5M03A 1LLOA 3RDKA 3WUFA 5GNXA 3VMNA 2A3AA 4JAWA 3RM8A 2ZUNA 4RL3A 1QI3A 1KR0A 3L4WA 4UZSA 3W0KA 1UZ4A 2VTFA 3LPFA 3SCUA 1H4PA 2ZUWA 1EDTA 1Z32X 1QI4A 3EDJA 3UG4A 3AZTA 3L4VA 4UQDA 1UHVA 3O9NA 1ISVA 3EDDA 5D9NA 3ARVA 1C90A 1RP9A 3LPPA 2ZE0A 1GZJA 3AIEA 2C7FA 5DF0A 3VIPA 1HNYA 3W37A 1PPIA 3QR3A 2W61A 1L0PA 8A3HA 3ZJ7A 2YL9A 1J9YA 1OSEA 2XVNA 2E4TA 2CEQA 4J3WA 5BXRA 1EOKA 1E6RA 4RE2A 5A6LA 2CNCA 4EK7A 3OG2A 3T08A 5D9OA 3VMPA 1V6UA 1OT2A 1FH9A 4JHZA 2X05A 4BQ4A 4PUDA 2WMGA 3IJ8A 5M17A 2C0HA 1WZLA 2WYSA 3PZGA 1W2VA 2JALA 1WNOA 7CGTA 1AQMA 1QI0A 2J8FA 1UD6A 4F8XA 2W67A 4Z2IA 1JXKA 3A47A 4W86A 5BXPA 1CXLA 1Q6CA 3OLIA 3AMKA 4WKFA 1GVYA 1VB9A 1JZ3A 4D6GA 1QNSA 1JD9A 1U2YA 4QLJA 1E71M 1KBBA 1O6IA 3WBAA 4CU6A 4M81A 1VEPA 2XYLA 1MW0A 7A3HA 1BAGA 2DEPA 2FHCA 4D6CA 5A69A 3AMDA 2CKRA 5GNYA 4HMCA 1R87A 1JGIA 2HVMA 3VPLA 1XD1A 3WF2A 1E5NA 1VFMA 3UETA 1W1PA 5ABFB 3WL0A 2O9OA 4W84A 1BQCA 5CSUA 2NT1A 4UFKA 2DT2A 4AD3A 4FLOA 1JIBA 2VI0A 1QNOA 4CD5A 3ZT6A 3SCSA 2XHYA 4Q22A 3OZOA 3RJYA 4AEEA 1JAEA 1JFHA 5LA2A 1LG2A 2XSAA 5I2UA 2HISA 5A8MA 1UD2A 3I3DA 3KL0A 1H0IA 1W91A 3ARQA 4JKKA 3PZNA 3NSNA 1WB0A 2FGLA 1N82A 1E72M 3ALGA 1QOXA 4P8VA 3LMYA 1KQZA 4ZXOA 3WDPP 1J0HA 1VFOA 1SMAA 2ZIDA 4B9YA 1GPFA 1TMQA 1US2A 2XFFA 1J12A 2YA1A 4OUEA 1GHSA 3B9EA 2YLLA 4H7VA 2VRQA 3ZSTA 4AZCA 1E6SM 1E1EA 1CIUA 3VUPA 1VEMA 2BVYA 2J7GA 1HJSA 2EEXA 3BMWA 1E70M 1V3LA 1E1FA 1X1NA 5AYBA 4PMNA 3OA5A 3AISA 2OWWA 5FOOA 4MB4A 2DIJA 3W28A 2ZOXA 3AHVA 1OINA 2CPUA 5EFDA 2W91A 1B9ZA 2JF6A 2BNJA 4J3TA 4WSJA 3TTQA 3IK2A 3F4VA 1SR0A 3VD4A 3MUY1 1CGTA 3N18A 2GJXA 4MJ2A 4WSKA 1CWYA 4TVCA 1CBGA 4PMRA 1W1YA 1XYFA 1EIBA 1QBBA 1W3JA 3CZKA 4RE4A 3SCTA 1QBAA 4CCDA 2FH6A 1G94A 1TVNA 3L2MA 1FFRA 2BS9A 4AYSA 1BLIA 4PCTA 3D5HA 1TZ7A 3WN6A 4H8HA 3OLGA 1ZBWA 3WQ6A 5DEZA 4L4PA 1M03A 4Y7EA 3WDQA 6CGTA 1V03A 1EQPA 1LL4A 4HPGA 4MPKA 1LL7A 3A4WA 5BRQA 5A8NA 1MQRA 3WL1A 4UCFA 1K6AA 3PZTA 2OYMA 1XV8A 2WWDA 1TE1A 5CG0A 1LL6A 1KR1A 2TAAA 2E8ZA 4CU7A 1US3A 2D0HA 1XHGA 2F8QA 4B16A 2VR4A 1W9XA 1RH9A 2CYGA 2DIEA 3PBGA 2QPUA 4AD0A 3PZUA 2WVTA 2VZUA 4BCEA 3VMOA 2V3GA 5CLTA 4R27A 4BF7A 4JFSA 5F7UA 3LPGA 3VTRA 1XSJA 1QI5A 3MSGA 3A4AA 1GJUA 3WELA 3CHFA 2ZXDA 2W5FA 3UR8A 4CD6A 1C91A 2DPEA 2YIHA 2WHLA 3PHAA 1BHGA 4U33A 2YL5A 3VIJA 1H09A 4AD2A 5A2AA 1CNVA 1W2PA 4WK9A 5ECUA 4HU8A 3VNYA 4NF7A 4ACZB 3AYRA 2D24A 1UQYA 2W4XA 4LPCA 1OT1A 1FHLA 1UD5A 2XWDA 4V27A 2ZUMA 1QNQA 2J78A 2ZWZA 3M6DA 4JKMA 5M5DA 3WDIA 4PYSA 1QHOA 1QNPA 5DO8A 4AEFA 1M53A 3CH9A 1M7XA 4M1RA 4MDOA 2XTKA 4GINA 1WCGA 5ABHA 1EA9C 5JBDA 1KGUA 4JFUA 2WHJA 4MB5A 1ZJAA 3BC9A 1E4IA 4H8UA 1MQPA 1V0KA 3W25A 3JUGA 5LA1A 3VGEA 4ATLA 4V28A 4HMDA 4CU8A 3AIQA 4OIFA 1G01A 5FL1A 1S46A 2WBKA 2QV4A 4FF5A 3IAQA 1B3ZA 1TVPA 4AW7A 2VZVA 1R86A 1LF1A 2ZUUA 1NOWA 5A6JA 1I1XA 1BGGA 3VILA 2CHNA 3VX1A 2E0PA 2XGBA 4PTWA 2BY1A 5CSYA 3BAYA 3WEOA 1C93A 1GQIA 5E0FA 4UQCA 1UZ1A 3ARPA 1MW3A 5A2BA 4BQ5A 2JEPA 5FKYA 1AQ0A 3AS0A 3AXIA 5D8ZA 1R85A 3ZM8A 4IPLA 2IXVA 1UUQA 3RO8A 1H0GA 1E6PA 1WZAA 3CO4A 2G3MA 2O9PA 1E0VA 3KWXA 3BMVA 4YN5A 4J28A 5KEZA 4JHOA 2Y8VA 1E6XM 5CGTA 4JFTA 3WUEA 3L2LA 1UR2A 4AC1X 1JZ5A 4D71A 4PSRA 4D72A 2WMIB 5A6SA 5C71A 1M04A 2Q8XA 1ZBCA 4M56A 2EPOA 2G3NA 5CPTA 1QW8A 3EDKA 2VX6A 4AIUA 4DUWA 1LG1A 1K9FA 3CGTA 1W9BM 3T2QA 4B3LA 1DWFM 2DH3A 4WKAA 4EE9A 3GYCA 4UFIA 1W9VA 2OSWA 1CGXA 3ALFA 4YHGA 4UOQA 4MNKA 1E73M 1H1NA 2CBVA 5A94A 1C7TA 4F66A 4KGJA 2WKGA 3MUAA 4LXFA 1EHAA 2VX5A 1W1VA 4TVUA 3ARWA 4W5ZA 3ZMRA 4H8VA 3J7HA 3PZVA 4HA4A 5EMYA 3FNDA 4MDPA 2ZX8A 2J7HA 4MAZA 1Q6DA 4K68A 1JYXA 2WAGA 5BXTA 2CESA 1HL9A 3O6AA 1BVZA 1Y7VA 3SUVA 3AI0A 1ZBKA 4L4OA 3AFBA 4E8DA 2V3DA 1TA3B 3GH5A 6A3HA 2WC3A 4AD1A 2W63A 3DECA 3CHDA 4N42A 3SEPA 1VFUA 1JDDA 3NSXA 1KXHA 1W3KA 1M01A 4P8UA 2XIBA 4UZUA 4HA3A 4QCFA 2BVTA 4NZCA 3AOFA 2ZUSA 4PMDA 5A95A 3SCNA 3AICA 5CPQA 4LX4A 1VFFA 1ISXA 3WFLA 4MNMA 3VGGA 2VC9A 3WNMA 1UWQA 3MV01 4U2YA 3W29A 2G3JA 4X0NA 4GXPA 1DP0A 1D7FA 2Y4SA 4FMVA 1OGSA 3ARUA 1Q6FA 1HX0A 2UY5A 1XH0A 2YBTA 4FLQA 4C7FA 5LA0A 2G3IA 1BYCA 1EHNA 5FIPA 1GUVA 1BYAA 1HF6A 1J0JA 3SUTA 4OJYA 3AS1A 1RPKA 3OB8A 4AZBA 2ZX7A 1RP8A 2X1IA 1DWGM 1EGZA 1JI2A 3K4DA 1CDGA 1FP9A 1L8NA 4EKJA 4D6IA 4TVDA 1KCKA 4TX6A 1XYZA 1B3WA 2WCAA 1CXKA 3ARRA 4P8WA 4IISA 1R7OA 4PBGA 4AD4A 2PWDA 1I1WA 3WENA 3CLWA 4HU0A 1E5JA 1ZB5A 3POHA 2XVPA 5I77A 1OD8A 4NRSA 4CCEA 3FAXA 2XG9A 4AZ7A 2VUYA 1H3GA 4WLCA 4W5UA 3OLDA 3CUJA 1YQ2A 2PWEA 4IUGA 4PTMA 1GVIA 2XUCA 1JI1A 2GJRA 3TTSA 2VQTA 1AMYA 2EO7A 4D1JA 2WHKA 4XB3A 4J3VA 3SCQA 2WSPA 4AZCB 1HJWA 3WMCA 1TA3A 5A6BA 2CBIA 2WM0A 8CGTA 5JBEA 1EQCA 3GBEA 4U3AA 1PAMA 1YHTA 3CBWA 5EBAA 3U7BA 2YBUA 2BHUA 3NDYA 4MB3A 3NYDA 4ZFMA 1J0KA 3KL3A 2DT1A 1OCQA 3VD9A 1HKIA 1CXEA 1UWIA 3G6LA 3SURA 2GJXB 3THCA 3AHTA 1K9EA 1J10A 2OSYA 2ZUTA 1PJ9A 5CZKA 2DT3A 2OSXA 3WEMA 3U5UA 1JZ7A 2CBUA 3EYPA 1OGBA 4JFWA 1WAWA 4LYQA 5EFFA 1EH9A 3ZJ6A 3TONA 3N17A 3WFZA 3K8KA 1B1YA 1C92A 4W7UA 2BFGA 3SCRA 1U33A 2GUYA 3AJ7A 3WQ5A 4JL1A 3PZMA 3OBAA 4XX6A 2UY4A 1F4HA 1V0NA 3MMUA 1EO5A 2YKKA 3W24A 2VMFA 1A3HA 4PCSA 3VGFA 2E9MA 4UQBA 5E70A 3PZ9A 1BG9A 3SUWA 1JDCA 2BHZA 4CD4A 1G5AA 2VQUA 1SYTA 1GOOA 4HPHA 1JZ6A 3W6MA 3AYSA 1FOBA 4LQ1A 4JFVA 1R7AA 3W27A 5CJ5A 3M07A 1E0WA 4YHEA 4HP5A 4PN2A 4LYRA 1W9PA 1VENA 4AXNA 4HTYA 1AQHA 5IHSA 3FW6A 3GBDA 4W85A 3VIKA 3WBEA 1KGXA 3ARXA 2O92A 1CXIA 3WMBA 3U57A 4QCEA 3VX0A 4HZ8A 4CVWA 1UR1A 4Z2GA 3VKKA 4XZWA 3RJXA 1DTUA 3ARTA 2JIWA 2XGIA 3EMZA 1GHRA 2G8ZA 3AS2A 1V6WA 3VGDA 1GONA 4WJXA 1W32A 3CPUA 2GK1A 3WUGA 4CD8A 1OWQA 2ZWYA 2WANA 4PTVA 4EAMA 4CVUA 3BLPX 4P7LA 1BVNP 1UA7A 1HXJA 3VGHA 3FAWA 1QW9A 1UR8A 4HA1A 1HVQA 4QP0A 1FP8A 3KE0A 4GZIA 1ODZA 2JE8A 1B31A 2J25A 2D0GA 2ZX5A 1QNRA 5I0DA 4XZBA 2BY2A 3GNPA 5D4YA 2FDMA 3ZT7A 4DUVA 2X09A 4JCMA 1V3IA 3SCOA 5D8WA 1OB0A 1J18A 3GTNA 3L4TA 2VVNA 1GQKA 3VU2A 3WDHA 4ZE5A 3IJ7A 5AC4A 1G9HA 2D0FA 1UWRA 3N9KA 1G1YA 3BGAA 1NOUA 1JYNA 3EDFA 3OGSA 3SCWA 3NSMA 2J7BA 1UKSA 3AXXA 4BA0A 2VJXA 3N11A 1PEZA 4CN1A 3HJEA 4TXEA 2WC4A 1B90A 1BGAA 2NT0A 3WNPA 3N04A 4PRWA 2CHOA 2WKLA 3SIMA 3CUFA 4TTUA 2XWEA 2NSXA 1W3LA 3E1F1 4N0RA 3WNKA 1CECA 1JDAA 3WD0A 2DT0A 2XM1A 5AY7A 1CGUA 2WVVA 1XGZA 3F5KA 1VBRA 1ZS2A 1CGWA 1UD8A 1H2JA 2F61A 3W26A 4GQQA 3T0AA 1H41A 4EANA 3UG3A 2Z1KA 5GNZA 1LWJA 2DGAA 1TCMA 3BXWA 2X8RA 3KEHA 3T2PA 4UFLA 3W38A 4AWEA 3W6LA 4GPNA 3EDEA 1CXHA 3ZQ9A 1XH2A 4KMQA 1KWGA 2AAAA 1JAKA 3VIMA 1ECEA 1HKMA 3N15A 1XSKA 1PBGA 2FGZA 4NSBA 3WKZA 3W82A 1J0ZA 3AHZA 2DSUA 1DWHM 4MTVA 1ZJBA 3T09A 1UKPA 2WVSA 3ARSA 1KB3A 3VIHA 1CGYA 4W7WA 3AROA 3SCPA 3WH5A 5A6AA 3BAXA 5A8QA 4QLKA 5A3HA 3T2OA 1ITCA 3GM8A 3VDCA 1UH2A 3BAJA 3FHAA 2A3CA 3OGVA 1TFVA 5HOSA 1VAHA 4QLLA 2VZTA 4UQAA 2VOTA 4TX8A 1UQZA 3WQ4A 1P6WA 2VRKA 5ABEA 3WY1A 5GPRA 5HNNA 1J11A 4D6JA 4PMYA 4PTXA 3CTTA 5IXEA 1XSIA 1JF6A 5LYRA 4D6HA 1NWTA 4PMOA 1JZ8A 1UR0A 3W53A 3FN9A 3WF1A 2CETA 2CITA 5BXSA 3N12A 5I24A 5IFTA 4U3CA 4D6EA 1Q6GA 2QPSA 2WXDM 1TR1A 2E3ZA 1VBUA 1EXPA 2PWGA 2PWHA 1JFXA 2XFRA 2G41A 5DFAA 4MNLA 4ATDA 4Q7NA 2V5DA 5CXPA 2A3BA 1KCLA 3AIRA 3RILA 3FHQA 4TUFA 2D3LA 3G6MA 1MFUA 2G4FA 1DEDA 4H2CA 1HJXA 1XC6A 1UOKA 3GXIA 1EOMA 1E3ZA 1G0CA 3MMDA 5AYIA 1SFSA 5C8BB 4DUXA 4OKDA 4W8AA 2QF8A 3QOMA 5I23A 1VIWA 3GXDA 1QHPA 3HU7A 1GQLA 4HOXA 2WZEA 3I3BA 3GDBA 5E09A 1GOKA 3UCQA 1AVAA 1HP5A 2EBNA 1MWOA 1RD6A 3B9DA 1PZ2A 4NI3A 2QMKA 3WQVA 1PX3A 1QVBA 1WO2A 1W9DM 1B3YA 5D9MA 2C8NA 2VX4A 2GDVA 3WQ8A 3K1DA 5BWFA 3VIFA 3MMWA 1KFWA 2D1ZA 1QPKA 1HVXA 2WVUA 3ZJKA 1V3JA 2PF0A 3GH7A 4MAVA 2FHBA 3K8MA 1R8LA 3MU7A 4A3YA 4R5EA 2PI6A 2XVLA 3APGA 3GH4A 2J77A 3ECQA 3CZ8A 1UWUA 2VL4A 2D3NA 5E0CA 1B3VA 1E43A 4GI6A 4TTGA 3GXFA 5HDRA 3UESA 1Q6EA 1WKYA 3OGRA 2VR5A 2BXYA 1HJQA 2J4GA 2WLYA 4H41A 1U30A 1KWKA 4W8LA 2GDUA 2PBGA 4E8CA 2E8YA 5E6YA 3AMCA 1OM0A 2EPLX 4P7OA 3DYOA 3L4XA 2ZX6A 4DWSB 4DM2A 4PMUA 4E2OA 3B8SA 4KGLA 3ZT5A 2MANA 4M8UA 1V0MA 3CZLA 4GKLA 3WH9A 2ESCA 2X2YA 1O7AA 1QI2A 2EPKX 1W3HA 1KQYA 4WF7A 1HKKA 3CUIA 5BCAA 3ZOAA 4MADA 4Z2HA 1ODUA 5FCZA 2OWXA 1WDQA 3OIHA 5DMYA 4XV0A 3RM4A 4CCCA 4GI8A 3M46A 1NOFA 4Z2JA 5FL0A 1FH7A 3CHCA 5IFPA 2Y8KA 1B0IA 1HKJA 1B3XA 5BRPA 2WCGA 1E9LA 1I75A 3AMGA 3VNZA 3MUIA 5KZ6A 1D2KA 2W92A 3NJ3A 1E6QM 2O9TA 1GCYA 2WZHA 3TTYA 1ZL1A 2YOCA 5E9AA 1QHZA 4J7RA 1E56A 2PWFA 4UTFA 1ITXA 4QFUA 4OBSA 4LGXA 2GJPA 2YJQA 3CMJA 1UKTA 1LJYA 4F9JA 2F2HA 2WLZA 2ZXBA 1BYBA 4PUEA 1XRVA 2OYKA 4S3KA 1C8QA 2WMHA 4W7VA 4AY1A 3MUZ1 3ZR5A 1PIFA 2WSKA 3QGVA 3WQWA 3CUGA 1BG4A 1IT0A 2D22A 3AHYA 5A2CA 4U5IA 4UFJA 1OBAA 1JYWA 1WDRA 4CGTA 1UD4A 2ZXAA 1LQ0A 2XIIA 5M3WA 4ZXLA 4CN4A 4H04A 3BAWA 3ZIZA 2JF7A 2BHYA 4ZEPA 1W9UA 3BH4A 4AZHA 1H11A 2GSJA 2GK1B 4PMZA 4GO8A 1GOQA 2YDQA 2J7CA 5C70A 1J0IA 4U5KA 3VIOA 4J27A 1UR4A 1WE5A 1E6ZA 1JNEA 2DH2A 4U31A 1VJZA 4P7RA 1KGWA 3KZSA 2WMJA 3RIKA 1FHDA 4DWSA 1V3MA 1V0LA 2BY3A 1E6NA 1HJUA 4M29A 3L4ZA 1XD0A 3WMSA 1UH3A 1DWJM 4MNJA 3WIJA 1CGVA 2YA2A 3WSUA 2IUZA 4W89A 1UWSA 1HJVA 3WNOA 3S2CA 3WF3A 4C7GA 2D23A 4HZ7A 5A8OA 5A8PA 3MKKA 1CENA 5JIWA 2EXOA 1PIGA 1V02E 2QMJA 3MV11 3T0DA 3ZJ8A 3RM9A 2VZSA 1CLVA 3UEQA 2EPMX 3CZGA 4U2ZA 1VRXA 3A4XA 2ZICA 2Y2WA 4PMXA 1NP0A 3MSDA 3LPOA 2UY2A 3CMGA 5I5RA 3NCOA 7TAAA 1NM9A 5HPCA 5I79A 3FXYA 5I6SA 5A6MA 2WCSA 2JIEA 4UQ9A 2WW5A 2CERA 3PZQA 3AIWA 4URIA 4BS0A 4ZE4A 5IHRA 2DSZA 2V38A 2VVSA 1BTCA 1OIMA 2WVVB 2VX7A 2E40A 1ZBVA 2YDRA 4JZ5A 3L4UA 1JNDA 4ZENA 3M7SA 2QLYA 5ABGA 3RPMA 1E55A 1UWTA 3U7VA
chains in the Genus database with same CATH superfamily
3HPZA 4QXIA 1L6GA 1PX4A 4DZIA 2J47A 4H6EA 5KSWA 4FX8A 1JZ4A 4X60A 4AZIA 1F05A 5JMUA 3GW3A 1TUXA 1G69A 4R34A 4RLIA 4C6BA 1A0CA 3W1XA 5HPOA 9CGTA 3S9IA 3F5JA 3QKEA 1KBKA 2OYLA 2BVWA 1XYAA 3SCVA 5XIAA 3AZSA 2XM2A 1GQJA 4DY1A 3PBYA 3VIGA 1ZZMA 5JIPA 4F3HA 3ZS4A 1KA9F 3ITVA 2BLEA 4HNNA 2HS8A 2XVGA 1TV3A 1Q4WA 2OB3A 3ZSSA 2WMFA 1H5VA 3CV2A 5BROA 2AOSA 1A5CA 1PSCA 4HMEA 3KBMA 4UNIA 3UCCA 6REQA 3GVVA 1HN1A 1HO4A 3WBYA 3KX6A 4HVXA 1V3KA 2NQHA 3APYA 2CLKA 4XUGA 1XCXA 4HIBA 1K70A 4H9TA 1V51A 4QEEA 5C7VA 1WZMA 1G4SA 1MUWA 3QH2A 3NDZA 3FGCB 1YTDA 1XKYA 3ZLGA 5U7SA 4DO5A 3VUSA 5FD0A 1JCNA 2R82A 1EEXA 1V77A 2X0SA 3K4AA 4AIOA 1Z41A 1M3UA 3R2GA 1XR2A 2G3FA 4B5NA 4KH2A 3UBPC 1SMDA 1SW3A 3GE7A 4K36A 3EA3A 3VGBA 3K46A 1OVDA 3K8LA 4X9YA 2WNQA 3IJQA 4ACYA 2XPKA 1K03A 1E15A 2ACSA 3SGGA 1Q7MA 3BJTA 1K8ZA 3PN8A 4NX5A 4XBKA 1PYMA 3QYSA 4M6PA 3EX2A 2X1RA 3OZPA 5HULA 2PTXA 1BSIA 1GQNA 1JJKA 2B4GA 3W83A 4RK8A 1CT5A 2XFWA 3TQVA 3VINA 3DHFA 2B31A 1HT6A 5BU9A 1XLHA 4IPNB 1GPWA 4A6GA 5A1AA 1YPXA 1DJQA 3UJEA 2W0UA 4PL2A 1A3XA 4S3FA 4AHOA 3W9ZA 4DJDD 4FX6M 2OPJA 3PZOA 1BTMA 1XCWA 2VRJA 4JY8A 4B91A 4A2SA 1MEHA 3DHPA 2FH8A 3UA4A 1XGEA 3CB3A 2PDUA 4P8XA 1Y8BA 4I9TA 1VCVA 2NW0A 3PK7A 1K8YA 4XUYA 2PCEA 4FB7A 3O06A 3HN3A 1UJQA 4JPGA 4JOMA 4LCQA 5D9PA 4EPKA 3PNZA 4JIQA 3BW2A 9XIMA 5CQ1A 4IMDA 3NQ7A 3HPXA 4TU1A 2AMGA 2PS2A 4F0RA 4LNYA 3UZ5A 2GVEA 4IG2A 5HXMA 3VDAA 3G1DA 3PUGA 1FCVA 1JD7A 4NNAA 3G1VA 6XIMA 4MSSA 2HPMA 2H3DA 1KC7A 4A8NA 4A8IA 3R94A 3AZRA 3O2LA 3W7EA 1YTKA 1OCBA 3R6IA 1GOIA 4G8TA 3I10A 4KCTA 3GVGA 3NGFA 2DUZA 3G24A 3ELFA 4O1CA 2ISSA 2XINA 4GQRA 1HTIA 1CPUA 2DSWA 5A8GA 3IVTA 4I8YA 3N1AA 2TRSA 1CTNA 2JEQA 2YCIX 3L0GA 5G4EA 3VD5A 1BF2A 3AWNA 1IEWA 3WD4A 4JIEA 2BXZA 3GNOA 1JPKA 4EXBA 2J79A 3T05A 4PFHA 4ZA0A 1XBVA 3CUZA 2POZA 1KRAC 2Z1BA 2Q8ZA 4MVAA 1HQTA 4IMEA 2HBXA 4GACA 4ACZA 3WD2A 3IGHX 3UP8A 1M7JA 5FACA 3WCZA 4AEOA 4AHPA 1PX8A 3U2CA 3MCOA 1RY0A 1C8YA 4BEUA 2RH9A 3B40A 1XDLA 1QU4A 4W8BA 3BLOA 3CPGA 3LMZA 3AQUA 1P0EA 3RLVA 4FNRA 3BZGA 2YZRA 1CEOA 2ZUVA 3DH7A 4M80A 4IX0A 5REQB 1EDGA 3TUUA 2FDSA 2DZUA 1E40A 2IW0A 3GDRA 4GI9A 1M5WA 1KM1A 1TREA 3QVQA 4Z2KA 5CBBA 4UOZA 1FWCC 1AZ2A 1UIPA 3OLEA 4FXJA 4WHBA 1S5TA 1K7FA 1C3FA 2Y7EA 2CHRA 1IGSA 3QF0A 3LN3A 4Y9AA 2AQOA 1JPIA 3HZ3A 4J3UA 1T40A 4JHMA 5LSMA 3BSGA 1MQQA 3UPWA 3KZPA 2HZGA 1K9TA 3WNNA 4EXQA 4F79A 2CU0A 4I90A 2XZ7A 5EL1A 2REQB 2NQJA 5FF2A 2UY3A 1XH1A 2WQDA 2E6DA 5DT7A 3NQMA 2V68A 3T4WA 3OHMB 4P7NA 3VO0A 5KTLA 4MWAB 1DQUA 1IIGA 3B0PA 1G7UA 1CLXA 3TXVA 1EJWC 4D6DA 4C6QA 4S3DA 3CQJA 3KTXA 4LBSA 2CIPA 1WDPA 5CLWA 1V6XA 4POCA 1NP2A 1LYXA 1OZQA 4OFCA 3BOLA 3VOHA 2WMIA 3CWOX 4GYPC 5IDIA 3VM7A 3DC0A 2FZBA 4L9ZA 1DWIM 3SIZA 1OD0A 3ERPA 3H4GA 3LXCA 3WH6A 4U28A 5M03A 3RDKA 4LY8A 5GNXA 3VMNA 2A3AA 2ZUNA 1SSGA 1TTQA 3SM0A 1KR0A 4GXMA 4CNTA 6ALDA 1H4PA 5G5IA 3YPIA 3W2MA 1TRIA 4OV4A 4BR1A 4H2HA 1RY8A 1ISVA 2J9ZA 4G7FA 1XBYA 3E0FA 3D46A 1UUOA 5REQA 3IRDA 1QO5A 3EAUA 1RP9A 3LPPA 3AIEA 2C7FA 4AF0A 3GG7A 2G97A 3UQNA 5MKGA 1HNYA 4JTIA 3NPXA 2Y62A 1PPIA 2W61A 1EJXC 4EPDC 3ME3A 3ZJ7A 4XAYA 1OFBA 4RPQA 2X7VA 2QCGA 2XVNA 4I5UA 1EOKA 3TN5A 2CNCA 3RPDA 5LGZA 3GYEA 2NLYA 1HFBA 2C1GA 1Z89A 3OG2A 1YBQA 3T08A 3FCPA 3VMPA 5XINA 5M17A 1WZLA 2WYSA 3GB6A 1W2VA 1WNOA 4HHHA 3LZ5A 2CFFA 2REQA 1UD6A 2ACUA 1SGJA 3EWWA 2W67A 3HV8A 3WJZA 3A5FA 1UBSA 3UZJA 3MVIA 3CMFA 1CXLA 1Q6CA 3PSWA 1GVYA 4G6CA 4GYFA 3TJLA 1JZ3A 4D6GA 3KLLA 5H6HA 1JD9A 1U2YA 3W7MA 1E71M 1O6IA 3N2XA 3WBAA 4GY7A 4GUIA 1VCFA 1AA1B 2YW4A 4IWWA 3W76A 5DLCA 1EP2A 2V5LA 4RKAA 4LV9A 4DF1A 2C19A 3R4IA 2Y5JA 1PO9A 1NELA 3OVQA 1F8MA 1EC7A 4S23A 1EL3A 3SAZA 3ATZA 2O9OA 4KS0A 2NT1A 4G2DA 4K39A 4AD3A 1EBHA 2VI0A 1QNOA 1WUFA 4CD5A 4Q22A 3OZOA 2P3EA 1JAEA 1JFHA 2PP3A 5LA2A 2R6OA 1LG2A 2XSAA 5A8MA 2ZRXA 1UD2A 2W3ZA 1KFCA 1H0IA 1W91A 5H91A 1W5NA 2A1YA 3A21A 3NSNA 2FGLA 4PGLA 4JN6A 3O07A 1F3TA 4N9DA 3B0UX 5A6TC 1VFOA 5G2WA 4B9YA 1GPFA 1M7OA 2VM8A 4S39A 4PH6A 3ZVIA 3SRFA 1O5XA 1GHSA 3B9EA 4AZCA 3P61A 2YW3A 1PKLA 4M7TA 2HQAA 3VUPA 2BVYA 4GHRA 3W3OA 1HJSA 1E70M 2G95A 2PRHA 4LCSA 5AYBA 3OA5A 3W86A 3TZFA 3UWWA 5AVHA 2RHGA 4MB4A 1EZWA 4MF4A 3R58A 3TNBA 1ME9A 3SSZA 2W91A 1TV2A 3AYTA 3LGDA 4HQVA 3TFCA 3VC5A 4HPJA 3H2AA 4NU7A 2GGGA 4RE0A 4WSKA 4TVCA 1CWYA 2QCCA 4R85A 4LCRA 4PMRA 3HPFA 3CL7A 4CCDA 2FPYA 4K8HA 4US6A 3TMQA 4KRZA 1ZGDA 5CC6A 1FWTA 4AYSA 4H8HA 4IIEA 3OLGA 3LBCA 3LHVA 4J3ZA 6CGTA 1X97A 1LL4A 1LL7A 1SZNA 4U4MA 3R11A 1K6AA 3F1QA 3TYBA 1G4PA 2OYMA 4LH8A 3LUTA 1LL6A 2CZVA 2A7RA 2E8ZA 2VHLA 4F2TA 3C2FA 4J4KA 1X7IA 2D0HA 3N4AA 2F8QA 1LRNA 4JTQA 4B16A 3IJLA 5EMUA 1XIDA 4L6DA 1J5SA 1AH3A 1V7YA 1DJYA 2CYGA 4NUWA 3KVKA 4AD0A 2WVTA 3S1WA 5CLTA 2O7SA 2R1LA 4UMBA 2F6UA 3V7PA 3MB9A 3C6CA 3P93A 4OQVA 3VTRA 2PDHA 2P5NA 4E2BA 4FEZA 4PZVA 4V1YA 2EG8A 3AU6A 3K2GA 1GJUA 3WELA 2XIJA 2W5FA 1RVGA 3UR8A 1C91A 4LUYA 1BHGA 4MLRA 1BD0A 4DJEA 4XTDA 3VIJA 5BOFA 5TAOA 1H09A 1J4EA 3SO7A 4WK9A 5ECUA 4ZQPA 5ENLA 3FVMA 4ICMA 3FYPA 3MYPA 1OT1A 1FHLA 5H8PA 4WDUA 2ZUMA 2J78A 1EJTC 3M6DA 4IL0A 1S3HA 4HGXA 3B8TA 4JKMA 4Z1DA 4EF8A 3WDIA 4PYSA 5DO8A 2RUSA 3B06A 4AEFA 9XIAA 4Q32A 2GYIA 4MDOA 4JTKA 1WCGA 5HK4A 5JBDA 3LXAA 3NZQA 4H4IA 2WHJA 4MB5A 2PDGA 4LFYA 4PB3A 3BC9A 1JCJA 3W7RA 1MUCA 1XC4A 2PFHA 1MQPA 2VFFA 1V93A 5TNVA 3VGEA 4Q4SA 4V28A 4DNHA 4CU8A 3AIQA 1WKFA 1AD1A 1G01A 4A8RA 5FL1A 1S46A 1Q6QA 2R94A 3M0YA 2WBKA 3VOJA 4Q6JA 2PDQA 4GUHA 3P0WA 3HURA 5CKSA 4HNUA 5IDZA 1KW1A 3VCCA 5F2LA 3BQ6A 4KWVA 3MYOA 4UIOA 3MA8A 1XDMA 1I1XA 4Y9PA 4KBXA 4GNJA 2WO5A 1VS1A 3VX1A 3VABA 2E0PA 4MIMA 1RK6A 1JPHA 5CSYA 3BAYA 2Y7DA 3WEOA 5E0FA 4BQ5A 3QV8A 5FKYA 3IPWA 1AQ0A 3AS0A 1W1IE 3ZM8A 2Q01A 1KM6A 1R3RA 1XG3A 2Z6JA 3O05A 2CLHA 3QEZA 2ZRYA 4WY0A 4AUBA 4E3VA 1XG4A 3KWXA 3TTEA 4ZO6A 4J28A 5C9RA 2Y8VA 2P3ZA 1E6XM 2BBFA 2FFIA 2Y63A 3WUEA 4XZIA 2NQLA 3CYVA 4D72A 1I2RA 2Q8XA 2Y1HA 3TYCA 5LXEA 4N9EA 2EPOA 2OGYA 1QW8A 5E5CA 2R14A 4HU3A 1EFZA 4QSHA 1LG1A 3MI2A 1W9BM 1V6TA 1A5AA 4ZTXA 4B3LA 4HNVA 4XZNX 4WKAA 2YXGA 5EBUA 4S38A 3GYCA 2QDGA 1ZAIA 4TIMA 1FXQA 1WBJA 1CGXA 2VFDA 4YHGA 3ENLA 5A94A 3IVUA 1MDLA 1ZAJA 3DKJA 2BG5A 2BOEX 2WKGA 3OW1A 4I7VA 2PZ0A 4LUSB 2VX5A 3NXLA 3PJUA 2YYUA 3T8QA 4HA4A 4MDPA 3IV8A 1ZJHA 1W54A 5HR6A 3P7YA 4N9BA 3STGA 4RR4A 1OFOA 1Q63A 1ZBKA 5D2TA 4L4OA 4E8DA 4QR6A 4RW5A 2WC3A 3NQBA 3TMLA 2BGQA 2VXNA 4IP7A 4FALA 4FHAA 2Y85A 3NSXA 1D8CA 3REQB 1P0KA 4P8UA 1ONEA 3EOSA 4HA3A 2YCKX 4NZCA 2ZUSA 1LRQA 5A95A 4NXSA 3WFLA 4LX4A 3LQGA 3CYJA 3WNMA 2OZ3A 2VGBA 3C86A 4GXPA 3SBFA 1HX0A 3MW7A 3IIPA 2G3IA 5FIPA 3LERA 2HWGA 3OB8A 4AZBA 2ZX7A 5G1YA 3A3WA 1GVRA 1RQHA 2C14A 4A2RA 2V6AA 4WCJA 1KRCC 3K4DA 2WZTA 2VDGA 4I9AA 1E51A 4O54A 1F6PA 3CQHA 2HROA 1RQEA 4D6IA 5T9BG 2GWNA 4QISA 1B3WA 4JBRA 1I2PA 3WLSA 2WCAA 1CXKA 3R8GA 4L6HA 4K2SA 3MJMA 4PBGA 4C6NA 2XIQA 4MLJA 1I1WA 2HXTA 3POHA 2PDPA 4HHMA 4MOZA 2ZRUA 4CCEA 3FAXA 4AZ7A 3BG3A 4WLCA 3W74A 4LF1A 4W5UA 3EWYA 4JEQA 4KKXA 1YQ2A 2PWEA 4MKNA 4JTGA 4JIIX 1GVIA 2GJRA 3TTSA 3AUJA 2QJJA 4L9XA 3SRDA 3R1ZA 1SW7A 2FIQA 4J3VA 4B5VA 4E4FA 1K02A 8CGTA 4YNGA 4NJKA 4RXGA 5T8GA 3TH6A 4U3AA 1PAMA 3PJTA 3U7BA 5D38A 2BODX 4A3RA 3CL6A 3KL3A 2QIWA 2NVCA 4QE1A 5I03A 2E1WA 2QJHA 1HKIA 4KWWA 3N14A 3GX9A 2GJXB 3TROA 1PS9A 3E38A 1K9EA 4PRTA 1TSIA 2OSYA 2ZUTA 1OX5A 3WEMA 3M0HA 4H1ZA 1JRBA 3GVQA 1M65A 5HMDA 1EH9A 3N17A 3WFZA 1B1YA 3RK8A 3TLLA 2JGQA 3H21A 5J04A 4PUMA 4M19A 3PZMA 3QGAC 2UY4A 5CZ0A 1F4HA 2F6XA 3SB0A 3MMUA 1YTEA 3W24A 4DYJA 1RA0A 1A3HA 4PCSA 3VGFA 4NNCA 1M6JA 3MC5A 1OK6A 5FSEC 1BG9A 4F48A 2BHZA 4IQEA 2PLMA 3UWQA 4UTLA 5B7YA 2DZBA 4BY3A 1JZ6A 1FOBA 1JVNA 3M47A 3JW7A 3NM3A 4C6PA 4PN2A 5FEWA 1V8EA 2O92A 3WMBA 2O0TA 3KW3A 3H2MA 5AZ0A 4X22A 3E0LA 1UR1A 4Z2GA 1I9CB 4BK9A 3UWVA 1DJZA 1H7PA 2V67A 1S2CA 3EMZA 1GHRA 5B80A 4KETA 2G37A 2E7FA 1J93A 3L9CA 1FXPA 1GONA 2EF9A 5D02A 1W32A 1J79A 1IIHA 3KBSA 1L6FA 3OBEA 4IFOA 2VD9A 2ZWYA 4J40A 4PTVA 3CUXA 4XBSA 4P7LA 3FAWA 3NGJA 2ALDA 4AXKA 1HVQA 4Z1BA 1FP8A 3V4BA 2J13A 1B31A 6ENLA 1RLCL 2D0GA 3IIOA 4DUVA 3T4CA 3ZT7A 2X09A 4DI8A 5BOEA 4HNOA 3H70A 4DBUA 3VNKA 3L4TA 4ZE5A 3FLUA 3A22A 4ZO9A 4GVGA 3DFOA 4JDBA 5AC4A 3N9KA 2PWUA 1R3VA 3BGAA 4IIDA 3M0XA 3WQDA 1JYNA 3A5VA 3PG8A 3QMTA 3MJYA 3OQ8A 1UKSA 4IQJA 4C6IA 3LY0A 5EYWA 4MGGA 2V5BA 3R0UA 5LXXA 3E9AA 2Q8LA 2OFJA 3UY7A 2GQ9A 3G1HA 3P80A 1W3LA 4N0RA 1K8CA 4HCDA 3BURA 3A4JA 1VBRA 2GJNA 4HN4A 1QDSA 4LBUA 3CIXA 2GGHA 3VFLA 1FX6A 5D09A 1GEQA 2Z25A 2DGAA 4LNCA 2QVHA 3KEHA 4PFMA 2DZVA 3DX5A 3O15A 3TV8A 3G3DA 4RJEA 3EDEA 2R1MA 3W70A 1A5BA 1WOBA 2ISDA 4KMQA 2ATMA 1J2WA 3LSBA 2AAAA 4GC3A 5I00A 3DFNA 1FWRA 5AFDA 4NSBA 2DSUA 1XIEA 1L2QA 3OZMA 1ZJBA 1UKPA 2WVSA 2QUMA 4KEVA 1KKOA 3EX1A 5A3HA 4MYAA 3T2OA 4BI6A 4O14A 1ITCA 4Q4QA 3G5EA 4IZGA 1UH2A 1VP5A 3HG4A 1A50A 3OGVA 2GJLA 4N4QA 5FJOA 1KRMA 4K38A 5HMFA 3S1VA 1VAHA 3DFTA 1Z3NA 1P6WA 5J8LA 5CAKA 2VRKA 1SM9A 4Q4KA 2J66A 1J11A 2PDNA 2GUUA 4D6JA 4PMYA 1XSIA 1UR0A 3W53A 4WR3A 3CASA 5CPNA 4D6EA 2QPSA 4GK8A 1I45A 1VBUA 3VOIA 3EWBX 3N73A 1D9EA 2PWGA 3NQGA 1RCQA 2G41A 2V81A 1H51A 5DFAA 2A2IA 1EUAA 4H6QA 3WJYA 3GTHA 4TUFA 3GZ3A 1JDFA 4KF1A 1JUKA 2G4FA 4ML9A 4UWMA 5AKQA 3W1NA 1HJXA 3KBWA 4PEKA 3C4UA 3ITXA 4ADSA 3PWGA 3NOEA 4IOTA 2QF8A 3AC0A 5I23A 1VIWA 1QHPA 2OOFA 2E67A 1VFSA 3COTA 1UWAA 3CTLA 2EBNA 3UNTA 2PGRA 3B9DA 4DF2A 1PX3A 1QVBA 3KFTA 1B3YA 1D7KA 1OC5A 3H8AA 1DXIA 4LAMA 4M6QA 3VZZA 4JTJA 2NV2A 2HRWA 4JYDA 1VPYA 3S8HA 3LCGA 3C2YA 2DW6A 3N4EA 2D1ZA 2GOUA 2DZXA 8RUCA 1G4TA 1R8LA 1CCWB 4A3YA 2XVLA 2PDKA 4NAFA 3ECQA 3V5FA 5BZAA 2VGIA 2VL4A 3M0VA 1E43A 3AXKA 5HDRA 3UESA 1Q6EA 3LK6A 3GHUA 1QMLA 2TMDA 3LXBA 2BXYA 2ATSA 1HJQA 1ELSA 1EF3A 4W8LA 3T78A 3W7CA 4JEJA 3DENA 4KWOA 3AMCA 5IM51 1W5PA 3ITLA 3WQFA 4DB7A 1NF7A 2GSEA 2ZX6A 5C7HA 3QZ6A 3BJFA 5FAJA 4DRSA 1V0MA 3CZLA 1W3HA 4ZZ9A 4WF7A 3CUIA 5IOBA 5BOOA 4I5RA 4PULA 3SN0A 5DMYA 4IMFA 3RM4A 1PZ0A 4GI8A 3K5XA 1J6OA 5CG7A 4JTAA 3CHCA 4AB4A 2H9AB 2KX9A 3TLQA 1SQ7A 1HKJA 5DN1A 4NJGA 1QK2A 3GR8A 3P0XA 3AMGA 1D2KA 1QTWA 2W92A 3XISA 2FLIA 3VCNA 1BWVA 3DI0A 1NFBA 3UVIA 5E9AA 1QHZA 4J7RA 1E56A 2PWFA 3TW6A 1ZQ5A 4LGXA 2GJPA 2YJQA 3CMJA 2F2HA 2ZXBA 4UB9A 3URAA 1HG3A 3CEUA 3ICJA 4H8NA 3HQPA 3ZR5A 2BOGX 3W7NA 1PIFA 3WQWA 2PUZA 3XIMA 2XSXA 2Q71A 4U5IA 3P5YA 4PA8A 4UFJA 5AC6A 2C6QA 3O16A 4IJRA 3I6TA 5M3WA 4CN4A 3MZ2A 4TV6A 4ALDA 3ZIZA 5DXYA 4ZQOA 5C70A 4U5KA 3VIOA 4DWDA 1JNEA 3LGEA 4C6MA 1I2NA 1JGMA 1R9XA 3KOYA 3OO2A 1TWIA 1GVOA 5LGXA 4I9JA 1B4KA 1R6WA 4M29A 1BXBA 3P60A 2FVLA 3ES8A 3WIJA 4C6CA 1CGVA 3Q94A 3DZ1A 1UWSA 3WF3A 5A8OA 1H62A 3HQNA 3M43A 3MKKA 3QQWA 1PIGA 2QMJA 3B03A 7TIMA 1AJ0A 4YVVA 4XD4A 3RM9A 2VZSA 3UEQA 2H9AA 2EPMX 4JN7A 3CZGA 3LHWA 1W3TA 4EWJA 2Y2WA 2I17A 4EPBC 4L5ZA 4ZB5A 2FZ9A 4UNLA 2Z2AA 3FXYA 1PDYA 2D2JA 2WCSA 2JIEA 2CERA 3TX9A 3PZQA 4K7YA 4LSBA 4NZ1A 3OU8A 5IHRA 2V38A 2V69A 1QPNA 1JNDA 1KV5A 4ZENA 3RPMA 1E55A 2PLCA 3U7VA 3S1GA 4S3GA 3ARZA 3O1NA 4WIWA 3QFWA 1PV8A 3RO6A 1I8JA 1R9ZA 4NX0A 3GLCA 3MDUA 4ERAA 3VDHA 1FH8A 2E9LA 4DJED 4US5A 4AX6A 1XP3A 2ZX9A 2E5DA 3AIBA 1I2QA 1V3HA 2PAJA 4KWUA 1X6LA 2X1SA 4WKHA 1SR9A 4AIEA 2ABAA 4Q7IA 4XD3A 2B7NA 2DZTA 3H2FA 1UG6A 4IMCA 3WH8A 1RJQA 3QTGA 4JL2A 3ZVHA 4H19A 5G2HA 3BW4A 1OYBA 4H6KA 3L0KA 3TYAA 4IQDA 1AL8A 4GZ7A 1MW2A 1VEOA 3QYQA 1W31A 2IQDA 5I3JA 1E1CB 2NQ5A 1NDZA 3C61A 2W66A 4Z2LA 4WDWA 2XJ7A 5DRIA 3TP4A 1N8WA 2IXUA 3QPYA 5ABFA 4ZOCA 5LIKX 1I0DA 4BWLA 2UWFA 3TC3A 3WLTA 2PDYA 1FHVA 2GL5A 2YA0A 1XGDA 3BWWA 1HIZA 1US0A 2DSKA 2J75A 3UJRA 1T6MA 4LUTB 4ATWA 1RCXB 1UA3A 2J8GA 4QSFA 4K3ZA 3ZR6A 4AMCA 1XICA 1ME7A 1MNSA 5DCEA 1W5QA 3HGSA 4JQ2A 3USBA 1X6NA 4GJJA 3W1PA 4YPJA 1Z6KA 1UZHA 3EOEA 1U83A 3JZEA 1X8FA 2ADAA 4LVAA 5EB8A 1GJWA 2EJ1A 1ESWA 6TAAA 1DWAM 1CXFA 2A7PA 2PU0A 1LUCA 4CKQA 1HL8A 3WBWA 3B9AA 2P50A 2IPWA 3SUSA 4FNQA 4V2XA 4F0MA 4HYWA 3A12A 3KVMA 3G22A 2AQVA 3QHMA 4ZMGA 1YE4A 4WUIA 1TPWA 5FF4A 3MO4A 2A79A 1O66A 3VNDA 2E1DA 3U2EA 1R3YA 3S2NA 2RJHA 3HQ1A 3WLOA 3RR1A 3AO0A 1X1ZA 3U3HA 3E74A 2ZC1A 1C8VA 1GG1A 2AMXA 3KHJA 3WLHA 3C0SA 4X61A 3CUHA 3SJ3A 1IZKA 1E4NA 2WKJA 1B30A 5BYWA 3GZAA 5CGMA 1BSLA 3NEHA 4MZ1A 2VC6A 2YCLB 3TYUA 1EEPA 4A4AA 4ERIA 3SRKA 3UR2A 1ZLPA 4Q8OA 2WNWA 1OFQA 1J8VA 1UH4A 3D3AA 3W1TA 1DJWA 4NJIA 1EF2A 4MY9A 1Q6RA 3BQ5A 1BFNA 3KS5A 3PBWA 1A4MA 1PCKA 1J0YA 4LUTA 2G4JA 3WJWA 3T9PA 5LNSA 4NZFA 1P1MA 5HJYA 4ZSUA 2HE5A 3VAVA 3EMCA 3VM5A 3L7RA 1IZCA 1DE6A 3KAOA 4UR9A 3GFXA 4GUFA 3DYPA 4JQ3A 3DHUA 4LU0A 1EGVA 2BX7A 4PB5A 1W17A 4NRRA 2HVNA 2X40A 3CZJA 1NWRA 3THDA 4DWSC 2UV8G 3QFEA 4O18A 1MXDA 3AHXA 3P81A 3B97A 4F0SA 3BK0A 4E38A 4R33A 4DI9A 1MZHA 1A47A 1TMLA 4B2DA 1FKWA 4F9DA 4XWUA 2DVTA 4HSOA 3GXNA 1M1BA 1S5VA 3BSHA 1TJ1A 1SVDA 3BCFA 4IM4A 2PDWA 4IF2A 3UXDA 2Z4GA 1FKXA 1EO7A 2CZEA 2VCCA 4LVFA 2RDWA 4PMQA 4QJ3B 3TTOA 4C6FA 3VKBA 3W1AA 4ICNA 1ZCOA 3P3BA 1TWZA 1XISA 2DQXA 2YCLA 4PBEA 3O8AA 3RCNA 3W71A 2Y5EA 3IARA 3CHEA 3RU8X 2WPGA 4HOWA 1YPIA 3BVJA 3AIUA 2BVDA 4W88A 4QE5A 1IEXA 4HK7A 1IV8A 1U5VA 2ZA1A 1OY0A 2VOMA 4GO9A 4ONVA 3MI3A 4UTWA 3SR7A 1XL9A 4PMVA 2W79A 3CJPA 4UFHA 2ZBTA 1H49A 3O0FA 5GQBA 4F2UA 3WH7A 2Y24A 3UG5A 5HNRA 4M24A 2PC8A 3DERA 3LX9A 4IP5A 4G1NA 3STCA 3V16A 1TV8A 3DCPA 4DQWA 1VF8A 1WP6A 1JXJA 3BMXA 3PTMA 4LYPA 1VBJA 3F2BA 3CLMA 3EXRA 1Q13A 1JYVA 4DWSD 4H6RA 3QHOA 4ROQA 1WZKA 4O17A 4Z1CA 3WEZA 2WJDA 3W07A 3PPGA 3GWQA 5A6KA 4FK9A 1GTEA 1G6CA 1NQ6A 2BGNE 4ASTA 4JKLA 1ISZA 1GOMA 3OVGA 2J74A 1T8XA 3QMRA 2XH7A 1TV4A 2GVLA 1LQAA 4J3SA 3INPA 5D30A 5J5RA 1F6KA 3L4WA 1VD6A 1H7XA 4UZSA 1PTGA 2VTFA 1JCMP 1EDTA 5AHIA 1L6SA 3D6NA 3L4VA 2OKOA 1UHVA 4ZOEA 3EDDA 3ARVA 1A5KC 2QDEA 3FIGA 1NIUA 1AFSA 1GZJA 2QDDA 3VIPA 5G1TA 3W37A 3HGOA 1OSEA 3HA1A 1ZY9A 4DBSA 1F76A 3NVDA 5FJIA 2E4TA 2QYGA 4CQ8A 1E6RA 3LG3A 3E02A 5HNTA 3BV7A 1FH9A 4J1OA 4JHZA 4BQ4A 1FWEC 2WMGA 3NQAA 3S46A 7CGTA 5FEPA 1AQMA 2PDMA 2PTWA 2J8FA 2HCVA 1JXKA 3QLLA 4KCVA 4W86A 1E0TA 5BXPA 3H22A 4WOZA 3AMKA 1DE5A 4MG4A 1Z7AA 3SRHA 1VEPA 5F4WA 3STFA 6TIMA 3KBNA 1Q7ZA 2IPJA 1BAGA 3PF3A 2VC7A 3GXPA 3AMDA 1JGIA 1VPXA 3WF2A 1W1PA 3W7LA 3RX4A 5CC5A 4B4FA 1IXNA 3GO2A 2OZTA 3PPHA 1NFGA 3HTWA 4KCUA 3MHFA 4XZHA 4UFKA 3KVJA 5RUBA 5ABTA 3ZT6A 2D2HA 2YFNA 4EXAA 4QROA 4XIAA 2V5KA 4AH7A 5I2UA 3LLXA 3V0SA 3KL0A 2OKTA 4YVPA 1BXCA 1E72M 1N82A 4P8VA 2BSLA 1KQZA 4L1XA 4KT2A 4ZXOA 5AYZA 5DY2A 5IBXA 4JR5A 2AL1A 1XX1A 1SMAA 2ZIDA 3OEXA 3T0CA 2DZWA 4QJ5B 3TDFA 3FYYA 4WRHA 4OUEA 5KMYA 5TF0A 2MNRA 3M5YA 3QQ0A 4S2BA 1E6SM 1VEMA 3N29A 1DXFA 2OR2A 1MEWA 2EEXA 2GVGA 1Q85A 4IQLA 1IXPA 4PMNA 3K4WA 3R43A 1CI1A 2OWWA 1HZYA 5FOOA 3H55A 2DIJA 3O6YX 3W28A 2RFGA 4TQTA 3S42A 3SN4A 1OINA 1OABA 4NHVA 1B9ZA 4WSJA 2BNJA 3TTQA 2AQWA 1GOXA 5CZJA 3W85A 3MDWA 3MUY1 1XLAA 1EB3A 5DY3A 5BU6A 3LCIA 4LVDA 4OU1A 1CBGA 2E5CA 1MNZA 4M5PA 1QBBA 2QS8A 3M0KA 4RE4A 1QBAA 3LNMA 1TVNA 1FWHC 1FFRA 3WN6A 3D5HA 4XO6A 2VEPA 4QQUA 4Y7EA 4HPGA 3EPNA 4MPKA 4PC8A 5A8NA 1MQRA 2PLKA 1XKJA 3SQLA 3WLJA 4HPNA 1TE1A 1TR9A 1KR1A 3IUDA 2QUTA 4WEVX 2DJXA 4XZLX 1GK8A 4B5SA 2I5IA 3M0LA 1W9XA 5C9WA 2BOFX 1P7TA 4O0KA 4IXHA 2SFPA 2P10A 1Z69A 2DIEA 3PBGA 3W2NA 4C1NB 3VMOA 2V3GA 3SY8A 3ISIX 1VC4A 1LM1A 4AVFA 4YTSA 4BF7A 1RPXA 3LPGA 1K8XA 1QI5A 1ALDA 3MSGA 3E5PA 4JIRA 4CD6A 2DPEA 2YIHA 3S5NA 2ZZ4A 1MRAA 4ORMA 1XI3A 1F7BA 3FS2A 4AD2A 4C60A 5A2AA 1CNVA 1W2PA 2GGIA 4ZBCA 4B5XA 4HU8A 1HKVA 3VKAA 4NG3A 1DIKA 1SZRA 4LPCA 3TSDA 1UD5A 1QNQA 4LY4A 4H3DA 2ZWZA 4C5YA 1FWFC 4HNLA 5HATA 1M53A 1OCJA 4DXKA 5C2CA 4GINA 1L8PA 3N6HA 1MDRA 1AH0A 4DLFA 1KGUA 2HNHA 2JK2A 1QCWA 2ZADA 1HKWA 2JKAA 2GSHA 1RV8A 2EPHA 5EKYA 1NFPA 4ATLA 4HMDA 2Z2UA 1WDDA 5EU9A 1SO3A 2IPGA 3V1PA 4FNUA 2QV4A 4E0CA 2HTMA 2QAPA 1B3ZA 3A9BA 4PUWA 1FDJA 1A53A 2OODA 2Z26A 3ABZA 3M0MA 2ZUUA 4LANA 3S2MA 4GIYA 2QCHA 2OX4A 3UVAA 2VEMA 4PB4A 4PTWA 4BF9A 5F2IA 4C1NA 3F4DA 4UQCA 2GQAA 3ARPA 4IIFA 5A2BA 4MPQA 5HJXA 2VGGA 1ZTVA 4XZMX 4PCPA 4Q8WA 4KIEA 1TPH1 3DU0A 5CPLA 4FAMA 3RO8A 2RDTA 1H0GA 1E6PA 1WZAA 3CO4A 1E0VA 2HSAA 5CGTA 1Q65A 4JFTA 3ZZ1A 1UR2A 2B7OA 5CJMA 1M04A 1I6NA 1ZBCA 1IWAA 1L6WA 2OJPA 1KLZA 3EDKA 4AIUA 2CLEA 1H50A 1UBPC 4DUWA 1XS2A 4GIRA 3FXGA 3AAMA 2VUNA 3BL3A 3EKZA 2CLLA 4EE9A 4FZIA 1SJAA 1O95A 2VWSA 4K8GA 3FA3A 5G4WA 3GU2A 2FJUB 2HE8A 2AL2B 4MNKA 3WO8A 2CBVA 2NX9A 3OA3A 4QTGA 4RX0A 3ABRA 4LXFA 2VYOA 1W1VA 3MSYA 3NQ6A 1VHNA 3J7HA 5T9CE 2E68A 3PZVA 1LQ2A 3NQ2A 3FNDA 2J7HA 1Q6DA 4PUUA 4LW7A 1JYXA 1HL9A 3O6AA 1MUMA 3S9YA 2WZMA 3THUA 3MKCA 3SUVA 3AI0A 4NY2A 5T26A 2V3DA 6A3HA 4AD1A 1TZ9A 1FWBC 3HGRA 3QW3A 3TJXA 3DECA 1TPVA 1WKEA 3PS7A 4CLMA 2NWSA 4RZBA 3SEPA 4PR4A 3MO7A 4UTHA 4F0HA 3QY6A 2P76A 2XIBA 1PTAA 4QCFA 2BVTA 5FJUA 3G0XA 3HOJA 3G1XA 1O68A 4Z17A 2ZZ1A 1MI3A 4MNMA 1KD0A 3H4WA 1Q3NA 2QCDB 5EY5A 4F2BA 4Q4MA 1DP0A 1D7FA 1F07A 2NV1A 2Y4SA 3GTIA 1KM3A 1Q6FA 2UY5A 2XN2A 3ES7A 5LA0A 1VHCA 3UXKA 3DFQA 1EC8A 1EHNA 2OX1A 5C2XA 2VC5A 3QLDA 4G7EA 3KOFA 2DVXA 3S2LA 2OEJA 1FWNA 3NQDA 3GD6A 2QJGA 1JI2A 3CHVA 2C1IA 3DDMA 3IIVA 2JKPA 3QY7A 4TVDA 1KCKA 2BMBA 5C6MA 4KQNA 3PVFA 3TIMA 3WFAA 3M7WA 5BW6A 4HU0A 1YNYA 3HG5A 1XUUA 1R30A 3HBLA 4DO4A 3OLDA 4B5WA 1XIBA 4IUGA 2XUCA 1JI1A 1XIMA 1JCLA 3I7SA 3RXZA 3H26A 2WM0A 4ROPA 3L5MA 1XIGA 1Z8AA 3DESA 1GYMA 5DQPA 4YYFA 1HW6A 1K77A 3E2RA 4GWEA 1CB7B 4ZQMA 3EWUA 3B8UA 3NPUA 4US5D 2BHUA 4FXSA 4DXXA 3GFZA 3ATYA 2HXUA 2PDFA 4ZFMA 3GNDA 2DT1A 4AX7A 4KCWA 4BHYA 2QCDA 3TJIA 4C6JA 1UWIA 3G6LA 3THCA 5HANA 4R7OA 3LV5A 3IEBA 1PE1A 1XRTA 3KCOA 2OSXA 4RNJA 2OEMA 1RUSA 2CBUA 5DCDA 1KO0A 4DYKA 1OGBA 3D0CA 1WAWA 1R9YA 3TONA 4C6LA 3NNTA 2P0OA 1C92A 3CQ0A 3P67A 1U33A 3AJ7A 3WQ5A 2PTZA 1OFEA 4JL1A 2OQYA 3OBAA 4XD6A 3CB8A 3F4CA 4JD4A 3Q65A 2I56A 4HTBA 5CBJA 3H53A 4Y9MA 2ISVA 2E9MA 5E70A 1S1PA 4ORIA 4A05A 3STEA 2Q3RA 4CD4A 3UWEA 1O5KA 3W6MA 3AYSA 4JFVA 4LS2A 4FXFA 3NOYA 1E0WA 2XH0A 1XPGA 5HWJA 3R13A 4RDYA 1W9PA 1VENA 4MY1A 4AXNA 5IHSA 3VIKA 1KGXA 3ARXA 4O4WA 3C2RA 1OG6A 2ZZ2A 3U57A 1O12A 4GBUA 1JPMA 4HZ8A 3W2LA 3R0KA 5AECA 1W6TA 3HFTA 3VKKA 3RJXA 2IKJA 3NDOA 1DTUA 4HPXA 1F5ZA 4QS5A 4UXDA 2PTDA 2XGIA 2G8ZA 3MUXA 1NDWA 1OYAA 2GQ8A 1S2VA 2NV9A 1JUBA 3BO9A 2TSYA 4L1GA 2I5QA 3QM3A 1EX5A 3GQYA 3KP0A 1VIZA 3B05A 1OC6A 3T1GA 1RD5A 1TV5A 1OX6A 3KTSA 2INEA 3WUGA 4CD8A 4CQCA 3TQ0A 4EAMA 1P6BA 4DJDC 5LNUA 3PUOA 1UR8A 1WDWA 4HA1A 3N3MA 1BWKA 1ODZA 3PNUA 2J25A 3U0HA 4NKCA 2ZX5A 2E6FA 5I0DA 4KEUA 4XZBA 2BY2A 5AZ1A 3GNPA 3LCLA 3LNPA 5AC7A 1W0MA 2VFIA 1V3IA 3FYOA 4PUJA 3SCOA 2POTA 5D8WA 4Q33A 2BB0A 2VVNA 4J5NA 3NG3A 3WDHA 7REQA 3BARA 4IH3A 4P61A 3LTPA 2D0FA 2QUNA 2BGSA 3OGSA 4OVXA 2Z28A 3RITA 3NZPA 1ONWA 4QJ1A 3W22A 2PP1A 2J7BA 5CSRA 1TB3A 3U2OA 2PU1A 3HJEA 1JDEA 3QR0A 2ZRWA 3CT2A 4F0LA 4O1DA 4XAFA 3MSRA 4PRWA 3V0TA 2Z1XA 3UYIA 3K1GA 3SIMA 1PWMA 3QY8A 3VFCA 3E1F1 1IEQA 1IGWA 2QW5A 4K6AA 3G1SA 2DT0A 2FTYA 1E9IA 2XM1A 2WVVA 3C2OA 4LC6A 1GYLA 1XGZA 1CGWA 1ME8A 1UD8A 1H2JA 2F61A 5CEWA 1H41A 1TJPA 1K3UA 3I7RA 3F2DA 3LGGA 1LWJA 3W2KA 1B57A 3PANA 2X8RA 3T2PA 4IFKB 5GJPA 3STPA 2PRMA 3P8JA 2OT0A 4JNZA 3QV7A 2OTDA 3ZQ9A 1XH2A 1AMKA 2YB1A 2BP1A 1KWGA 2W9MA 1KKRA 3VIMA 1HKMA 4C6OA 3N15A 2ZRVA 3AHZA 2NX3A 2NWRA 2QCEA 2VFGA 1H7WA 3T09A 3MHGA 1XPYA 3VIHA 4W7WA 3PBMA 3C5QA 4JIHA 3WLRA 2QPXA 4B5UA 3TFXA 1AJZA 3BGJA 3VNJA 1TFVA 3LHZA 2Q09A 3UPBA 4LALA 1TMHA 4TX8A 1UQZA 1K7EA 2E5BA 4QQ3A 4GX8A 5ABEA 3TN4A 3WY1A 4FOKA 5GPRA 4KW2A 5FSDC 1FWJC 3CTTA 4ZCWA 5LYRA 4D6HA 4PMOA 3FGCA 4O0QA 3EX6A 3WF1A 2CETA 2CITA 5BXSA 1RAKA 4MKSA 5IFTA 5AHLA 2WXDM 1XDJA 3Q67A 1JCTA 3QV9A 2V82A 3SFKA 1F9CA 2CWXA 3OQEA 3EKGA 1EXPA 4EP8C 4K1WA 3EWCA 4O1AA 3DG3A 3SGUA 1VYRA 2OLAA 4GY1A 1X38A 5AN7A 4Q4PA 2VEGA 3GC5A 5CXPA 3M64A 4A8LA 3FHQA 1GEHA 3MT1A 5LZLA 1BRLB 3BG9A 4IFKA 2VELA 1DIEA 1VFHA 1XC6A 3W6YA 1UOKA 4G1KA 1G0CA 1AZ1A 4LUIA 4OWGA 5FF0A 3EB2A 3KCJA 4OKDA 2QXWA 3QOMA 1H5YA 4I5XA 2GDQA 1GOKA 5TIMA 1MWOA 1TPUA 4OECA 2QMKA 4K37A 3NZRA 2YX0A 4OT7A 4OBTA 4MY8A 4HT3A 1R46A 1LTDA 2OOGA 2LLEA 5D9MA 2E25A 4AY8A 2Q02A 3IJIA 3UWZA 3K1DA 4ZVJA 5LIYX 1KFWA 1PL9A 4WZHA 3GDMA 3ZWTA 1X98A 3GH7A 2NUWA 4Q8MA 2FHBA 3K8MA 4R5EA 3NZGA 2AKMA 3E6EA 1XYMA 5AHFA 3PSVA 1ZFJA 3UPMA 2D3NA 2J24A 1NSJA 1B3VA 2PCQA 3G3MA 4TTGA 4C65A 3H2CA 3B9NA 1SJDA 1XLMA 4HK5A 1X39A 3OGRA 2R9RA 2C1HA 1GWJA 2WLYA 4UR8A 4GISA 3MZNA 1XLBA 1FQ0A 1KWKA 2OVLA 4E8CA 4TMBA 4G5DA 2E8YA 1K4GA 2EPLX 4AMAA 3DYOA 3L4XA 1BRLA 3BE7A 5TQLA 4EX4A 2Z7GA 4D8LA 4P2VA 1YYAA 2ESCA 1TZZA 4FI4A 3RHGA 3ZOAA 4Z2HA 4NILA 3R0DA 1PIIA 4TV5A 5FCZA 1WDQA 1RXOB 3OIHA 3E5BA 4IMAA 5FF7A 4CCCA 3M46A 4UC5A 4Z2JA 1REQB 3PTDA 4ES4A 3GHTA 1FTXA 1B0IA 1OX4B 2EGZA 4DJFA 4WD0A 5BRPA 2WCGA 5HAOA 1E9LA 4IT1A 1I75A 1I4NA 5C5YA 2G0WA 3N2MA 1XLGA 2QT3A 3TN6A 3VNZA 5XIMA 3GUGA 1E9YB 1VLIA 3WJXA 1E6QM 2DORA 3MY9A 1YPFA 3FFSA 3RAOA 4J2PA 3T0TA 3TTYA 1ZL1A 4IGHA 1F3XA 1LJYA 4F9JA 2WLZA 2CXEA 1BYBA 1DKWA 1LCOA 3MCMA 1XRVA 2OYKA 2QKFA 2H6RA 4EF9A 1NQKA 1UC5A 4QHRA 3ITOA 2QULA 2I1OA 1BG4A 1W37A 5F2GA 3W73A 2D22A 5A2CA 4DBDA 1JYWA 5AB3A 4LBRA 1Q8AA 4CGTA 1UD4A 1DJGA 3W7PA 1LQ0A 2XIIA 5FF3A 3CC1A 2F84A 3BH4A 4D9PA 3L21A 3IJ6A 1H11A 2GSJA 4JTEA 2GK1B 4B5TA 3B9OA 4PMZA 1W5MA 1GOQA 2J7CA 1J0IA 1JCYA 4J27A 1SU5A 3CWHA 3QC3A 1XYBA 1KGWA 3ZLHA 2WMJA 3RIKA 3KP1A 1FHDA 2NXHA 5KETA 4X2PA 1AW5A 1V0LA 4GH3A 3LYEA 1E6NA 5DRCA 3W72A 4NZ3A 4ZO7A 3JZUA 4M6VA 1XD0A 3WMSA 1DWJM 5KZEA 3NL5A 4MWAA 2WV8A 1POKA 1P43A 4O1BA 4W89A 2QV5A 3OG3A 4HZ7A 3E2SA 3EXTA 2EXOA 2VENA 1V02E 3MV11 4LJ3A 3T0DA 3WQCA 3ZJ8A 1CLVA 7PTDA 1OX4A 2PGEA 2WJFA 2DQWA 3A4XA 2ZICA 5I3GA 4PMXA 3MP5A 1NP0A 3LPOA 4O15A 1CX9A 1GVEA 3CMGA 5I5RA 7TAAA 1N8FA 4O1EA 1NM9A 5I79A 3DBPA 2I14A 1OYCA 4U10A 1O1HA 4UMCA 1LWIA 4JTFA 3AIWA 1LORA 2R1PA 1BTCA 1ZBVA 1TYGA 1RJRA 2EG7A 4JZ5A 4M1BA 3L66A 1EJSC 1SW0A 2I9EA 3OPSA 5D2WA 3B8VA 3DOPA 1NDVA 4JCLA 1WDSA 2ZZ5A 4BJHA 5CPSA 2RGLA 1NTHA 4KRUA 4XIMA 4F40A 1RLDA 4MB1A 3CS2A 4UTTC 3EOOA 4QG9A 4ZB0A 3A13A 4AZ6A 4M82A 3SY1A 4UBPC 3GNRA 1TWWA 3TWBA 4HZMA 1RHCA 2WNNA 3BTNA 3UR7A 3MBFA 2DSVA 1QNVA 3B04A 4GFSA 4JQ4A 2CCRA 3OODA 2XSBA 1PXGA 2Z6IA 3TOPA 2QJIA 1K9DA 3FSTA 3ANVA 1KXQA 2NXGA 2VNCA 4GZEA 4MHBA 4Q4OA 4NJHA 4L56A 4R9OA 2V3FA 4Z1YA 4GZJA 1R2SA 1IWPA 5HMEA 1A5UA 2XZ9A 1XLFA 3N6JA 3QHNA 2VEIA 4GBDA 3G8RA 3IGXA 1N2VA 3ZO9A 3DYMA 3FJLA 4NVTA 1DIDA 4QDPA 4GYPA 3UXLA 3CU2A 1ISWA 1UKQA 2ZVRA 3QC0A 4B90A 1GT8A 1TUFA 4JIPA 3LHTA 3AU2A 3LTSA 4XG1A 2PODA 2J62A 1NEYA 4C6KA 3QRHA 3SW6A 3L12A 2GVYA 4S3AA 3DI1A 2V3EA 3IAPA 1LWHA 1O60A 3ITTA 1VH7A 3USZA 3OP2A 2O55A 1OJXA 4WDXA 2VT0A 3NPVA 2J7FA 4JXCA 3PFRA 4LB3A 2ZVIA 3IACA 3POCA 1R47A 3ARYA 2IPFA 3MBDA 4FF7A 5I3HA 4JNYA 1KBJA 2BDQA 1UR9A 4XAGA 4KRTA 2FVMA 1T8QA 2OMAA 2WK2A 3RYSA 3B4YA 3PZIA 2IKIA 5AVNA 3AXMA 3URNA 5L6UA 5F4SA 3WDRA 4FLRA 1P1XA 2WB5A 1B5TA 1V6YA 1TELA 4RE3A 1JR1A 1V6VA 3T81A 1GNXA 5JH2A 4PEEA 1FHUA 3PPFA 1KXTA 1ADDA 3Q58A 5I3IA 3NO3A 2Z1SA 3SECA 4LEQA 1V08A 3H2NA 3AMLA 1VJSA 2P88A 3CM4A 1O94A 1EDQA 2CLMA 1SJBA 1TX2A 4QAWA 2VO5A 4QG8A 1A5MC 4O50A 4JTHA 2VCAA 1R2RA 1IZJA 3GHSA 1KXVA 3UERA 2ODOA 3EXSA 4N6FA 5K7JA 3QMSA 5JBFA 2E6AA 1BVWA 3KXQA 1U22A 4F4RA 1X6UA 2WMKA 3GTXA 1SZGA 3W81A 4E2VA 3C56A 4HJWA 3HJZA 3WK2A 1Z42A 3U4AA 4QDMA 1XIJA 3VOCA 3LBMA 2Y70A 3P14A 3DN5A 4BQ3A 1RVKA 2ZZ3A 3VE9A 3WNLA 5FJTA 4QITA 2YL6A 3KL5A 3NAVA 1PWLA 1PKMA 5C2GA 3AWOA 3UJSA 4MUZA 1EJRC 3RN6A 1FWWA 2FMOA 2D2OA 4TOQA 5BMXA 4N9CA 4NYYA 4B3KA 1DXEA 3DAQA 1S2UA 2FPTA 2PB1A 3AIVA 4WOQA 3RPTA 2RDUA 1NWUA 1TCDA 2FHFA 3O3RA 1JRCA 1A5NC 5DT5A 2JFEX 3DC8A 4LUJA 5G1MA 1SO4A 3VVGA 1QWGA 3HB9A 2QCLA 4GA8A 2OELA 1PHQA 2HJPA 3IJ9A 1A80A 3FOKA 5GJNA 2R1KA 3VIIA 1WPCA 2PWVA 4A3HA 2Z27A 1OC7A 3WQGA 2HMCA 4LAZA 1YLVA 4GXWA 3MUCA 4MJ4A 5F1VA 3EMQA 2PBOA 4HYRA 3LCHA 2EJAA 3QOKA 5E6ZA 1JULA 3PTKA 4DYEA 2Y7FA 3MHUA 4FS9A 1R3WA 3BICA 1AW1A 4J3XA 4DHGA 1HP4A 2GFTA 4A35A 5I3DA 1C29A 4WJEA 2AGTA 2FGBA 4ZOAA 1N7KA 4C1LA 3KRZA 1E3XA 3GXMA 3T0BA 1X8CA 3GW0A 4LVBA 4W9TA 3AUOA 2FVKA 1DJXA 2DDXA 3S5SA 2Q6ZA 5HA7A 2I57A 1A4LA 3M4HA 3F03K 1FWDC 2GOKA 3FJNA 4X63A 1UKOA 2ZRZA 1UD3A 3SQSA 2FZMA 4FP1A 3LBOA 5H8UA 4L4LA 2X0YA 2ANUA 1UMLA 2QEZA 2XISA 3BZJA 1EYWA 2PEVA 4QX4A 3EWXA 4J9JA 1HO1A 4GOAA 5DX7A 3WF4A 2BV9A 4A3UA 1E0UA 4W87A 1EGMA 3B8IA 1XXXA 4RPPA 1FWIC 2D2GA 2Z2BA 4JX4A 5C9XA 3VKCA 4DF0A 2YXXA 3KUMA 4NXKA 4O13A 1YXDA 5HJLA 2VP8A 3DKLA 4BZYA 3UU0A 2P53A 1DTNA 4IIBA 2D20A 1E4LA 4D6FA 2J9YA 3PTQA 2J7DA 3PWAA 1W1TA 1NWSA 1MYRA 5DMMA 3TA9A 1MVYA 2BY0A 2VURA 4KPLA 4IGSA 3GAYA 3TYDA 2VFHA 2WSRA 3BLEA 3CV7A 5I07A 3K30A 3EOUA 1XCFA 2PGWA 4L80A 3FY1A 4YL2A 3RUBL 3CK5A 5D37A 4DX3A 4YTQA 2UZ9A 1D3GA 3UW6A 2CXGA 1V4YA 1J01A 1LOLA 3WUFA 3G8EA 4JAWA 3RM8A 5LKYA 1FWGC 1TX0A 4ZGYA 3ZXWA 1DJIA 3W0KA 3SCUA 4A21A 2ZUWA 1Z32X 1QI4A 3EDJA 5AHMA 2VDHA 2W27A 3UG4A 3AZTA 3NL3A 2VEKA 4XKYB 1THFD 3O9NA 2PMQA 3LD5A 1UPMB 5D9NA 3S1UA 1C90A 2ZE0A 4JQAA 3W1LA 3EOLA 4LUSA 1MSSA 5CZTA 3TYZA 4C90A 3QR3A 3FJ4A 4MZYA 8A3HA 3JS3A 1J9YA 4N7QA 4Z42C 4PODA 2WPBA 5H2ZA 4JN8A 2CEQA 1YADA 4NAEB 5BXRA 4RE2A 1R0MA 5CPOA 4Z08A 4UTUA 1SZFA 3OJGA 3GIQA 1V6UA 4GYKA 2X05A 2QGHA 4PUDA 3M0JA 2C0HA 4ZL1A 2JALA 1XLIA 3DEQA 3REQA 1QI0A 4YCPA 5FEXA 3WZ0E 4HKPA 4F8XA 1S2AA 5AC8A 4AYGA 1TTPA 3A47A 5I3FA 3THQA 5HUPA 3OLIA 4WKFA 5DANA 3S1XA 1VB9A 3DFHA 4TX9A 1QNSA 4QLJA 4Q7BA 2A3LA 1PUDA 3NURA 3GY1A 4CU6A 4M81A 2OXNA 3WG6A 7A3HA 3VZYA 4GVFA 4JNMA 4D6CA 4GFIA 5A69A 2BTMA 5GNYA 2CLOA 4HMCA 1R87A 2HVMA 1R2TA 1LBFA 1XD1A 4DNMA 1YE6A 3UETA 2XH4A 2FZDA 1G4EA 1WBHA 2E28A 4W84A 3G2GA 2Q3OA 5CSUA 4Q8NA 3IGUA 4FLOA 2MUCA 1ZPTA 4IICA 2A7NA 2XHYA 1PKYA 3RJYA 4ZO8A 1KCZA 3JR2A 2HISA 4G9PA 2Z24A 4XKYA 3B0YA 3I3DA 3LDVA 4FR6A 3ARQA 4JKKA 3PZNA 3DXIA 1WB0A 3RCMA 3N2OA 3OVRA 3FDKA 4GVIA 1ICQA 1BKSA 4W4QA 1AD4A 1EP3A 1PVNA 2OEKA 4GQ0A 3HMJG 4P5UA 1TMQA 1US2A 2XFFA 1J12A 2YA1A 4NAEA 1Q2SA 2HPIA 3ZSTA 3KRSA 3RCYA 5CBIA 4H83A 4LRSA 2J7GA 4DXVA 3BMWA 4CQDA 1V3LA 1E1FA 2GGEA 2XGZA 4N6EA 3AISA 4GNKB 4JYEA 1TPFA 5G4HC 4GH1A 5EFDA 2C18A 3AALA 3SY5A 2YYTA 3UJFA 3F4VA 3U2ZA 3I6RA 1SR0A 3FK4A 3VD4A 2GJXA 2QCMA 1YEYA 1W1YA 1EIBA 1OF8A 3CZKA 2H8ZA 3SCTA 4DUOA 2FH6A 1YXCA 2BS9A 5CH9A 1BLIA 2ZDRA 4LT9A 3L65A 3LSCA 4PCNA 1TJRA 1BF6A 5DEZA 1M03A 4IG2B 3A4WA 5BRQA 4QS6A 1FY6A 3PZTA 5I06A 4RZ6A 1QT1A 3FDGA 2WWDA 1RJPA 5CG0A 4NL1A 4FSAA 4NP7A 6PTDA 3C0QA 1DYSA 2BXVA 1DQWA 1XHGA 3TKFA 2VR4A 1T5AA 1GKPA 1GVSA 4Q8VA 3DFSA 4EVZA 2YZ5A 2QGYA 3G18A 2ZCGA 3A9IA 1QWKA 2QPUA 1POJA 3NQ8A 2WJZA 2VZUA 8TIMA 1Z9AA 2HBVA 2OGJA 3WX7A 4JFSA 3UJ2A 3N9RA 1XSJA 1KTBA 2P1FA 4B4HA 1C9WA 4DEFA 3GG8A 3CHFA 3PPCA 4ZTYA 4HBKA 2WHLA 1XM3A 1FCUA 3EPOA 3KBJA 5K4ZA 4CNNA 2YL5A 1WQ5A 3D47A 1AW2A 5K3VA 4AVOA 4GNVA 1RZMA 3O6DA 3I68A 3EA2A 3OOQA 4LAKA 3VNYA 5LIWX 4ACZB 3AYRA 4DJFC 1IT7A 1KTCA 3IIXA 1WYIA 4V27A 2GVJA 3PAJA 3L5AA 2PPGA 1IR1A 4QIUA 3BGGA 5M5DA 4GG9A 1KFLA 2ISFA 1QHOA 1TPDA 1QFEA 1QNPA 3ONBA 5E0KA 2XN0A 2J8TA 4S3EA 2XDFA 3CH9A 1M7XA 2O4QA 5ABHA 1EA9C 3NPWA 4JFUA 1ZJAA 3GIYA 4H8UA 3TJ4A 3GVRA 4CQ9A 1PCWA 3W25A 5LA1A 3VI2A 1A0EA 2PDXA 4FF5A 2ZKMX 3IAQA 3DFPA 2IMRA 3SJNA 4AW7A 1SFJA 4O1FA 2VZVA 3G1YA 1SJCA 1R86A 3KBVA 1NOWA 3VILA 3NFUA 1B4EA 3GK0A 5L9FA 2CHNA 2XGBA 1XWYA 2GPTA 1S3TC 1GQIA 3HQOA 4LS0A 1DV7A 3SDOA 1SO5A 3UZZA 2NSOA 2DZAA 2INFA 3BANA 2F2KA 5LIUX 3AXIA 5D8ZA 4H9VA 3L23A 4IPLA 2IXVA 1UUQA 4GQGA 3W00A 2G3MA 2O9PA 4O16A 4MWAC 4YN5A 1WV2A 2OO0A 9RUBA 3TA6A 2YBVA 1W8SA 1EZ2A 2A4AA 1UPPA 3E0IA 4AC1X 1JZ5A 2PDCA 3O0KA 5JQ9A 2WMIB 3C0JA 3T42A 2X41A 2FTWA 1M9HA 4IUOA 2G3NA 5CPTA 3NQFA 3S4TA 2VX6A 3HF3A 1OEPA 2C71A 3L5LA 3CV1A 4OHQA 1K9FA 3CGTA 5LNWA 1F6YA 2JKEA 2G5WA 3T2QA 4DJFD 4FNTA 1DWFM 3S9ZA 2DH3A 3ITCA 4REQB 1KLYA 1QPQA 2GWGA 3ONCA 4UOQA 3EKLA 4KWSA 1E73M 1GTHA 3C0LA 4F66A 4KERA 3MUAA 2YCJA 4DO6A 4AF0B 1Y5WA 3QQ1A 3TK7A 2G96A 5MKGB 3VE7A 4TVUA