1FH8A

Crystal structure of the xylanase cex with xylobiose-derived isofagomine inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-1,4-XYLANASE
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
total genus 128
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fh8A00
1ZBWA 1UH3A 3L4XA 4JFUA 3CHEA 4M81A 4UFMA 1KBKA 1RH9A 4PMVA 7A3HA 1Y7VA 3WBAA 4ZEPA 5DF0A 3MMUA 3SCTA 2ESCA 3RDKA 1VBUA 1QI2A 4GZJA 2WMHA 1QI4A 5AC4A 2X1IA 2FH6A 3VGEA 3W81A 3BLPX 2QMKA 4W87A 3EDFA 2DQXA 1HN1A 3S2CA 2ZUMA 2Y2WA 1IZKA 3GNPA 3GTNA 3K8KA 3AQUA 1V3LA 5BRPA 3VGHA 1E6SM 3POHA 2D23A 5CGTA 3GM8A 4OBSA 1JZ3A 1QBAA 3AYSA 3W28A 4MTVA 3WNKA 4P8VA 3RJXA 5I2UA 4B16A 1J10A 4AD3A 5HDRA 2E4TA 1HF6A 1UKTA 5FCZA 3U5UA 4J27A 2WVTA 5D4YA 2XVKA 4UOQA 3BAXA 4JFSA 1BYBA 4ATWA 1AQ0A 4D6FA 1X6LA 3CMGA 1HJQA 4GINA 5CLTA 1GZJA 2WNWA 3WF4A 5M3WA 4WJXA 1HKIA 2YA1A 3W6MA 2HVMA 1R86A 3W4RA 4AD5A 4EE9A 4M1RA 2XJ7A 1JI2A 4CCDA 1UR8A 3WD4A 4HPGA 1ISVA 1K9EA 1CBGA 1E0XA 3IAPA 3M46A 4XB3A 2ZUTA 1V02A 3W29A 4P7NA 1TVNA 1J01A 3NUKA 3WKZA 4TX8A 5I78A 1PJ9A 3UR8A 4WKHA 1ZBCA 2W62A 4V28A 1N82A 2OYLA 4WSJA 1E3XA 1HKMA 3CUIA 1W91A 1US2A 4ZE5A 1GNXA 5BWFA 1V6WA 1V0MA 5A2AA 5IHRA 1GVYA 5AC5A 2X8RA 1QW8A 1HJVA 3TTOA 1C8XA 2DIJA 1QBBA 2DT0A 1UWSA 1JNDA 5LYRA 3ARXA 4JHZA 3IANA 2WPGA 2WMGA 2PF0A 4UFHA 3WD2A 4TVDA 2ZX8A 4RE2A 1C8QA 5A1AA 3PHAA 4D6JA 1KGUA 3AFBA 2CESA 1G1YA 1XSKA 3NIYA 3TTQA 4PTXA 5CSUA 5HBFA 4C7GA 1W1VA 8CGTA 5LA0A 4TVUA 4LYQA 2WWCA 3B8SA 2WZEA 3PZQA 1TR1A 1WE5A 2DSKA 3BCDA 2EJ1A 1BVZA 4AZCB 3PTMA 1FH9A 1S46A 1W32A 2Z1KA 4TTGA 1JZ6A 3QOMA 2A3CA 4M80A 3EDJA 1OBAA 2WW5A 1V3MA 4F66A 3PZMA 2XIIA 3AHYA 4AD2A 3KWXA 3GBEA 4WLCA 4Z2LA 5HXMA 1GQIA 4HA4A 2BVDA 3AIEA 4CCEA 4CN6A 2XYLA 4JFVA 1GVIA 1X6NA 2NSXA 3AMLA 3HMCA 1Z32X 2WBKA 5GQBA 4D71A 3I3EA 3UR7A 4H04A 5JIPA 1UR9A 4OBRA 3EDDA 5M5DA 3ZSSA 2O9TA 3VPLA 3GXFA 1RD6A 4AY1A 1NOWA 1NP2A 3VIKA 2PB1A 2XWEA 2JEPA 2VR4A 1UR1A 4DWSD 1TA3B 3SCPA 3NYDA 1XCWA 4JKMA 3OGSA 2NT0A 4PMZA 4F79A 3K8LA 3GXIA 1JXKA 2GDUA 4DUVA 1EA9C 4H7VA 9CGTA 3LPPA 2WVVB 1SMAA 4PMYA 2ZX5A 1JYWA 1ODZA 1J0IA 1QVBA 1JFHA 3KL3A 3BMVA 1UR2A 1UD6A 1J0ZA 3DYOA 1HL8A 2D0GA 3U7VA 3ARTA 5D9MA 2WHJA 1PIFA 5AYBA 1W9PA 2Q8XA 3DYMA 1LQ0A 3GZAA 2E9LA 1EOKA 3F4VA 3F5LA 4Z2HA 1UYQA 1XV8A 2ZUNA 1E1EA 1UZ1A 3VNZA 2WC4A 2ZUWA 4PSRA 1CGXA 2QPUA 4OOZA 3UG3A 3AOFA 1I75A 2Y5EA 1LL4A 3SUSA 4NSBA 4QFUA 3GYCA 4TVCA 1W9BM 1FHLA 1V0KA 1H0IA 3DHUA 5D9OA 1DHKA 3MMWA 1SR0A 3I3DA 3KZSA 1WAWA 1AVAA 3MUZ1 8A3HA 2DPEA 1OD0A 1U2YA 2WB5A 2VZSA 1D2KA 1QI0A 1AQHA 4JFTA 1PIGA 1KCLA 1GW1A 3VVGA 3RPMA 4EKJA 4MB4A 1Q6CA 1NOUA 5D9PA 1CLXA 1UH2A 2XTKA 5A6LA 4GO8A 4U2YA 3WN6A 2EPNA 1HJUA 1HJXA 1E4LA 3CUHA 1JZ8A 4D6IA 2FHBA 1MW2A 3T09A 1QNPA 2JEQA 3WF2A 2J25A 1UKSA 4ZE4A 1LWJA 3AICA 1CGVA 2CHOA 2QHAA 1V6UA 4FLOA 5D8ZA 1VB9A 3OZOA 3AS0A 2V5CA 4YN5A 1ISXA 4JCLA 4B9ZA 3VIGA 1D3CA 2CBJA 3VGBA 2XUCA 4M24A 2BHYA 1GCYA 3OBAA 3ARUA 3ZMRA 3AS1A 4PTMA 2YLAA 4HMDA 4AZ5A 2J7GA 1NM9A 3MUIA 1W9UA 1K9FA 2AMGA 2FGLA 1VEPA 3A4XA 3BAIA 1JDAA 2D0FA 3WUFA 3M7SA 4MNLA 3LPFA 5EFFA 2Z1SA 1KXVA 1JD9A 4MNKA 1ZBVA 2W63A 5EFDA 5A8NA 2XVPA 4TX6A 1LWHA 4D6GA 2D3NA 1MW0A 3AIVA 1VRXA 4BS0A 3WNPA 1JL8A 1YHTA 1ODUA 1E56A 4UQAA 1KB3A 2X0HA 3N04A 4CD8A 2DSZA 4U31A 1KXQA 3AMCA 4J3SA 4Z2KA 1W9XA 1E6XM 1PBGA 3SCWA 3VDCA 1RP9A 1UWUA 3BLKA 1OT2A 5A2CA 2FGZA 1HVXA 4UQBA 1MVYA 5HOSA 3T2PA 4UOJA 4AZBA 2VX4A 4IM4A 4PCTA 3VD9A 1KWGA 1ZS2A 4GI9A 4CGTA 3LPGA 1UKPA 4GIAA 2VR5A 4BA0A 3ARWA 5E0CA 4DUWA 3ARZA 3ARQA 2X2YA 3WMBA 3AZSA 1GJUA 3UG4A 3W26A 3AHVA 1EO7A 2CCRA 5A8QA 5A95A 1G0CA 1SMDA 3CPUA 1I1WA 1G94A 1OM0A 2XHYA 5E0FA 4ACYA 1QNSA 1O7AA 4V27A 4BCEA 3WH6A 4IISA 4JFWA 5EB8A 3SUVA 5E9AA 4B3KA 1J0KA 1CLVA 3U5YA 3RIKA 5CPTA 5I77A 4XX6A 3SUWA 4ATDA 1PZ2A 1DWJM 4E8CA 4J3UA 4MJ4A 2FHCA 2YOCA 2CBIA 3M07A 3IJ9A 2EPLX 3VGGA 1R85A 3CHDA 3SCSA 2GFTA 4WKAA 2YDRA 1L8NA 2WXDM 1JD7A 2PWFA 1KXHA 3JUGA 6A3HA 2E3ZA 2YA0A 1PEZA 3CHFA 5A8PA 1BYCA 2JF7A 1B3ZA 1K9TA 1Q4NX 5A6AA 4M8UA 1WKYA 1E0WA 2PBGA 2VVSA 4P8UA 1LJYA 1NWRA 4H41A 1H09A 2Y8VA 1W9VA 4KH2A 1Q6GA 2GJXB 3DECA 2DEPA 2J62A 2WLZA 4GXPA 1M01A 1W9DM 4W86A 1PX3A 4QCEA 1MYRA 1LG1A 4Y7EA 4J3VA 2GK1A 4XV0A 4B9YA 2VRJA 2XFRA 3FY1A 5A6JA 1WZKA 4HMEA 4ZXOA 1HIZA 2CYGA 2EPOA 3HJEA 5JBDA 3I3BA 2W4XA 1QNOA 2UY5A 2GJXA 3O9NA 4PUDA 4FK9A 4AZ7A 2F61A 2OWXA 4KMQA 3W25A 4A4AA 3W82A 1JDCA 5BXSA 4OKDA 2WK2A 4AD0A 2ZOXA 3WD1A 2XM1A 3OZPA 4GZIA 4J3WA 1U33A 4CU8A 2BXYA 1JDDA 1J11A 1VJZA 4PMXA 3QOKA 2Y24A 2V3FA 4X0NA 3M6DA 1ZU8A 3VD3A 1TZ7A 5ABFB 3WDRA 5I24A 4DWSA 2ZUUA 5IFPA 4HOXA 5FIPA 2PWGA 3A3HA 4UTFA 2BV9A 3AHTA 3N9KA 4D72A 5FL1A 2J7BA 4HMCA 4UFKA 2ZE0A 2YL8A 1VEMA 2UY2A 3VIMA 1M03A 3CHCA 4PBGA 2E8YA 4HA3A 4PTWA 4TOQA 1JXJA 1W3HA 3EMCA 2VRKA 1CIUA 2CKRA 5ABFA 4PMRA 4P7OA 3CZ8A 1CTNA 3OG2A 5FL0A 4KGJA 1E4IA 3FW6A 4W85A 4S3KA 2BY0A 3GH4A 1GOQA 5A94A 4YHGA 3VD5A 3OLIA 1VFUA 1GOWA 1H1NA 1DWFM 1WZAA 4URIA 3OLEA 3WDIA 2A3AA 3FNDA 3UETA 3AXXA 2C8NA 3CH9A 3VGDA 2QPSA 4L4PA 2PWHA 4YHEA 3ALFA 3NJ3A 2VNCA 3SCNA 1WO2A 2CETA 2BHUA 3O2LA 3ARRA 1G5AA 2C0HA 3AXIA 1C91A 4U3CA 3WF0A 4QCFA 1EGZA 1QHZA 1CGTA 1MW1A 3VX1A 2ZXDA 2BS9A 1B3WA 1JYXA 1MXDA 4JIEA 5DFAA 5CSYA 4CU6A 1E6NA 1MW3A 3PBGA 3NSMA 1E5JA 2QV4A 4J28A 2O92A 2MANA 2VMFA 1C3FA 3VDAA 3WQ8A 4RL3A 5IXEA 2QF8A 2J79A 1DWHM 1K9DA 2DT3A 5CPQA 5BRQA 3MO4A 1H41A 1MXGA 4IPNB 1H4PA 4KRTA 2OYMA 3T2OA 4UQ9A 3AMDA 3LMYA 2VX6A 6TAAA 2CERA 1RP8A 2G3NA 5EBAA 1UOKA 5M17A 1OGSA 3PZVA 3OIHA 1L0PA 2YBTA 3N15A 1ECEA 1J0JA 1RPKA 1C92A 5A6KA 4W8AA 1NWSA 2JFEX 4UZUA 4W7UA 3KL5A 4OJYA 3SUTA 2WANA 5C8BB 4AYSA 3AIBA 2VT0A 4WSKA 2BNJA 4JKLA 4JL2A 4P7QA 3L2MA 4UZSA 1XHGA 3W6LA 3AI0A 4UFLA 2YIHA 4QLJA 3WH8A 1WNOA 4GI8A 1ZJAA 4XZWA 3VMOA 3WH9A 2DH2A 1V3IA 1HT6A 4F9DA 3WIJA 4F9JA 2CKSA 1FFQA 1GHSA 4NZCA 4KGLA 2BHZA 1NQ6A 4QLLA 4CU7A 4PMOA 1XYFA 2DT1A 3CZLA 3SCOA 4L4OA 1HX0A 1LL7A 4AZCA 1I1XA 2WM0A 2BY1A 3PN8A 3FAWA 3TP4A 2XIBA 5KEZA 3MSDA 5CJ5A 5FD0A 5A6BD 2DSUA 2WCSA 2QMJA 1VFFA 1PZ3A 2YKKA 1OD8A 2X0YA 4W7WA 2WZIA 5JUVA 2O9RA 2PWDA 3SCVA 1C8YA 3MUAA 3PZGA 4PMNA 4W93A 2FDMA 5GNZA 3ZJ7A 1ZL1A 2ZXBA 3UG5A 5KZ6A 3CZKA 1CGUA 1C93A 1PAMA 4R27A 2CBUA 1B2YA 1UD8A 1VF8A 2PI6A 2UY3A 4TUFA 5FKYA 4DM1A 1CPUA 4UQDA 2V3EA 4QLKA 1MFUA 4GKLA 2ZXAA 2X09A 1PX4A 1EDGA 3WBEA 2VQTA 4K68A 2XGIA 1TA3A 4C7FA 4TXEA 1ITXA 4W5UA 3WUEA 1XYZA 3MV11 1JZ7A 1HKKA 2WAGA 3SCUA 5D9NA 1G01A 2WVVA 2YLLA 1BAGA 2EQDA 4NI3A 1WDPA 3VDHA 2EPKX 3NDZA 2O9OA 3APGA 3T0DA 4M82A 4UFJA 1UG6A 3AHXA 3AJ7A 1VFOA 2GJPA 1B3XA 3WQ5A 2XSBA 1TFVA 3WEZA 1UKOA 2BY2A 3WQWA 2DSWA 1VAHA 2XPKA 2VJXA 2EEXA 2XVGA 1ITCA 4UOZA 1XH0A 4U3AA 3MSGA 5CG0A 2ZUSA 4IPLA 1V3KA 4YPJA 1G9HA 3DHPA 2DGAA 3DC0A 3B9AA 1WZMA 3N18A 3VMPA 2RGMA 1R8LA 3N12A 1LLOA 4AXNA 1CXEA 1A47A 1CXHA 1EDQA 3K1DA 1WDRA 4H8UA 3A6OA 4PMDA 5I6SA 4P7RA 4X0VA 1WP6A 4PN2A 4JL1A 3L4WA 4LPCA 3PZNA 2WCAA 1W3KA 3WEOA 3FXYA 4RE3A 3WQ4A 1GPFA 5I3DA 3L4VA 3BXWA 4FF5A 3WMCA 1CECA 3BH4A 1NH6A 4MDOA 4M56A 1WZLA 3NDYA 1J0YA 1GQKA 3TTYA 3VIHA 3GXDA 2VOTA 5I5RA 4XZBA 4MAVA 4QAWA 3WF3A 1NWUA 3ALGA 3WFZA 3WENA 1XH2A 3CUJA 2CNCA 2G3MA 3THCA 1HP4A 2WSKA 1E5NA 2BVYA 3CUFA 3RO8A 4ATLA 1KGXA 2W61A 1EH9A 2XFYA 1E4NA 2VZTA 4PMQA 1TMQA 1WDQA 3ZSTA 2WWDA 1B1YA 5A6MA 2BXZA 5TD4A 1UD3A 4W5ZA 3B9EA 4MPKA 4LYRA 1ZB5A 3VIFA 1W1YA 2J75A 4PTVA 3VINA 3WQVA 1J0HA 3WL0A 4B15A 3T2QA 2J4GA 4CD4A 5E09A 5ABHA 3AS3A 3WUBA 1WPCA 4AISA 4AMCA 1O6IA 4OUEA 2PWEA 2V38A 1CDGA 1PX8A 4CD7A 1ZBKA 1LL6A 2CHNA 1TE1A 4U2ZA 2YDQA 3WNNA 2G41A 2W66A 1VJSA 3ARYA 3BSGA 3KEHA 1V6XA 1V08A 1XH1A 2DIEA 2IXVA 3AYRA 2VL4A 4AEEA 1NWTA 5JBEA 2V3DA 4F8XA 1GHRA 3G6LA 3WQ6A 2ZX6A 3EDKA 3PZTA 3AMKA 3SCRA 2ZWZA 4EAMA 5IFTA 3VU2A 3SCQA 3K8MA 5BYWA 2VQUA 3VIPA 1OWQA 4JCMA 2WCGA 3L4YA 2J8GA 1B3YA 4N42A 4R5EA 3PZUA 3ZO9A 1HJSA 1R7OA 1CXKA 3VMNA 3BGAA 1B30A 4GI6A 1P6WA 4Z2IA 3EYPA 1CEOA 1JI1A 1B31A 4CUCA 4AWEA 1V0LA 2XWDA 1E1FA 3ZT5A 2EXOA 2OSXA 2ZICA 4LGXA 1CNVA 2ZUVA 1UWRA 1AMYA 2D24A 4E8DA 4ML4A 4W8LA 2WC3A 3MMDA 3IJ8A 3GH5A 1GOMA 5LA1A 3K4DA 2WYSA 4MB1A 1BG4A 1V0NA 5GNXA 3CMJA 5CQ1A 1BFNA 1MFVA 1EOMA 1JZ2A 4Q22A 1BQCA 2EBNA 3UEQA 4QP0A 4CD5A 3OA5A 1E6PA 3BCFA 3TTSA 1GQJA 1FFRA 4GPNA 3OGVA 3QGVA 3TA9A 1QHPA 4FLSA 5BCAA 1GONA 4UNIA 1XSIA 2ZX9A 3VILA 4AC1X 3WNMA 2Y4SA 1UUQA 2WMJA 2WKGA 1H49A 1BSIA 1W3JA 4PSPA 2JIEA 1QHOA 4D6HA 2JIWA 2WC7A 2WMFA 1GOOA 5JBFA 3WDJA 4OOUA 3W0KA 5I0DA 3AXHA 1XD0A 1MQQA 4MAZA 3ZR5A 1UH4A 1UQZA 3VOCA 4KWUA 4W7VA 2WZHA 1FA2A 5LA2A 3DYPA 4JKKA 3RILA 2XVLA 1UR4A 4MNMA 4PYSA 2J77A 5I79A 3PTKA 5CXPA 2VI0A 3VM5A 3OLDA 1GJWA 3S6TA 4GQQA 3CTTA 2E9BA 4UQCA 2BFGA 3PZOA 5CZKA 3E1F1 1QW9A 4J7RA 5A6BA 1C90A 1C7SA 3VIOA 2WHLA 3TOPA 5DMYA 5HPCA 4CCCA 2EPMX 4WKFA 4N0RA 1NP0A 4LX4A 2YBUA 2VX7A 2AOSA 3W27A 4C7DA 2VUYA 4Z2JA 5E6YA 3CBWA 4HOWA 2D3LA 1PPIA 2BY3A 2VZVA 1EDTA 3PTQA 4GZEA 4WF7A 2WHMA 4HZ7A 1H3GA 1EHAA 3WSUA 1F4HA 3EDEA 5I23A 1M53A 2WLYA 4UCFA 4ZXLA 1BGGA 2WKLA 3GDBA 3NSXA 1JZ4A 1E43A 4P8XA 1US3A 3AHZA 3AISA 1V6VA 1E40A 7TAAA 1E0VA 4W89A 1OGBA 4AD4A 1BF2A 4IUGA 3CUGA 4HOZA 2VURA 4E4PA 3ZOAA 1YQ2A 3ZJ8A 2J78A 2OWWA 1QOXA 4BQ4A 1IZJA 1QNQA 5D8WA 3NSNA 1EO5A 2QLYA 2J7HA 3VUPA 1H0GA 3WFLA 3WL1A 1FH7A 1HJWA 3ZJKA 3THDA 5CPSA 4EANA 1DTUA 2ZIDA 3KE0A 1CGYA 1W1TA 2YA2A 1CXLA 3IAQA 2IXUA 1Q6EA 2B31A 4D1IA 4HU8A 4P7LA 4HTYA 3WDQA 1CYGA 1DWIM 5BROA 1UWQA 4X9YA 5DEZA 2YJQA 4JZ5A 3AIRA 4U5KA 2O9PA 4OIFA 3MUY1 5A8OA 1QNRA 2UWFA 2OWCA 1KWKA 3ZQ9A 2E0PA 3UCQA 2W92A 2EO7A 2FH8A 3CGTA 1QPKA 4MADA 5BXPA 3SIMA 3SEPA 1SYTA 3W53A 4HZ8A 1LG2A 1QI3A 5M03A 4BQ3A 2VCCA 1JAKA 7CGTA 5IDIA 3K4AA 1Q6DA 1V03A 3PZIA 1B90A 1MWOA 2DDXA 1E6ZA 1E73M 1IT0A 5GNYA 4BZYA 1UR0A 5ECUA 3MV01 3AIUA 3UERA 2X05A 4RE4A 2J7EA 1KXTA 4PEEA 4OZOA 1XC6A 3A4WA 3VD7A 3ZT6A 1VENA 1U30A 1XD1A 1OIFA 1KQZA 1FP8A 1UWIA 5A8MA 1ISZA 4AIUA 5A69A 3F5KA 4AD1A 1W1PA 4CKQA 3O6AA 4DUXA 5HPOA 3FHQA 2RGLA 1JAEA 4Q7NA 2CXGA 3L4UA 2E9MA 1F4AA 3WY1A 3ZR6A 3IJ7A 2YL5A 5CGMA 3RJYA 4MB3A 3NCOA 4HU0A 1CGWA 1WDSA 2VX5A 3OB8A 2GSJA 3G6MA 1GQLA 3J7HA 4AZHA 2A3HA 2VC9A 3VIJA 1BYDA 1HKJA 3CZJA 1DEDA 1MQPA 4GQRA 5BXRA 4V2XA 3FAXA 3WDPP 4CN4A 1UHVA 3WH7A 4U5IA 4HZ6A 1ESWA 1HXJA 2G3JA 3F5JA 2XM2A 1DWAM 1FH8A 1BYAA 2G4FA 2CBVA 2NT1A 1OCQA 1B3VA 1M04A 3WF1A 2J7FA 3GXMA 2OYKA 4E2OA 4LYPA 1JZ5A 2VO5A 4Z2GA 1E15A 2J8FA 1CXIA 1VEOA 2CEQA 4DM2A 1OT1A 5A2BA 3WH5A 4J3TA 1TCMA 3N1AA 3AROA 3SURA 2GVYA 2ZWYA 2GJRA 1E9LA 4LXFA 3WDHA 3AIQA 1D7FA 3EMQA 5EMYA 3N11A 3VKKA 5A3HA 1JF5A 2VVNA 1OINA 4JHOA 2D22A 3FHAA 4P8WA 1J18A 1TG7A 3ARSA 3BAJA 3AS2A 1E55A 2WMIB 2NW0A 2G3IA 1BLIA 3WUGA 1XCXA 1ZJBA 1C7TA 3KL0A 2D1ZA 3GBDA 1KGWA 2WVSA 3CIVA 1JYVA 3RM9A 4PMUA 4PUEA 3U7BA 1UD4A 2V3GA 1E72M 2AAAA 1H2JA 1OB0A 5AY7A 3T0AA 2D20A 3QHOA 2DH3A 2WMIA 5GPRA 2WBGA 1GUVA 2E8ZA 4NRSA 3VO0A 3VGFA 2VZOA 1TUXA 3QHMA 1DWGM 5DO8A 5HNNA 1SFSA 4CD6A 2CIPA 4AEFA 2A3BA 2JALA 4BQ5A 4WIWA 2D2OA 3BAYA 3IK2A 4ACZB 1LF1A 4HP5A 2TAAA 1E70M 3CZEA 1R87A 5BXTA 3T0BA 5DT5A 1JFXA 1UD2A 1HL9A 2IUZA 2WSPA 3VTRA 2YL9A 3A47A 2W91A 1Q6FA 1XSJA 4MNJA 4PCSA 4W8BA 1E3ZA 4LQ1A 1HVQA 4DWSC 2VRQA 3RM4A 3VIIA 2VCBA 4ACZA 2XSAA 5ABGA 1UA7A 1AQMA 1OIMA 3WD0A 2XGBA 4U33A 2OSYA 1KBBA 1E6QM 3W24A 2ZXQA 3FN9A 3RMEA 1B9ZA 1NARA 3QHNA 1V02E 1UWTA 1JIBA 1V3JA 2A3EA 1GORA 3MS8A 1KFWA 4B3LA 3GNRA 3WNOA 5JIWA 4AIEA 1HNYA 1WB0A 5F7UA 3MANA 1EIBA 1BHGA 4UR9A 3D5HA 2W67A 4KRUA 3D3AA 4FLRA 2JF6A 1VBRA 4D1JA 4UQEA 4PRWA 3BAWA 1OGGA 3W37A 1JG9A 1W2PA 3WELA 3ARVA 5ABEA 5C71A 3QR3A 1FP9A 4XUYA 1UA3A 4H8VA 2XG9A 1BG9A 2DSVA 4BF7A 5IHSA 3OLGA 2WMKA 3WMSA 4A3YA 1UD5A 4S3JA 1DP0A 1QI5A 2C7FA 1BTCA 3N17A 1KR1A 1CWYA 2BVTA 1XGZA 3AIWA 5C70A 1MQRA 1UKQA 2GUYA 3CZGA 3BAKA 1V6YA 2UY4A 4MJ2A 2V5DA 3U57A 3SUUA 4MDPA 4UFIA 4J3XA 2XVNA 3BSHA 3ZJ6A 2J7CA 4A3HA 5E6ZA 4AIOA 4H2CA 2J47A 4D6EA 3GNOA 3EBVA 3VNYA 3II1A 4WK9A 1BVNP 3A4AA 4AZGA 2GDVA 3N13A 2WHKA 1FHDA 4FMVA 2G8ZA 4M29A 1JNEA 1E4MM 4GO9A 4QDMA 3TONA 1E6RA 3WD3A 4ZFMA 2CITA 2W5FA 3BMWA 3L2LA 3L4TA 1CENA 1V3HA 3WEMA 2OSWA 3HN3A 1KCKA 4AZ6A 4D6DA 5DT7A 4D6CA 2CPUA 1CZ1A 2WVUA 2YDSA 3OGRA 1KQYA 3W38A 4HPHA 3HU7A 1A3HA 3RM8A 4W84A 2E40A 3VDBA 4BQ2A 1OSEA 1X1NA 1JF6A 2VZUA 5AYIA 4H8HA 4CVUA 3WNLA 1IV8A 2VCAA 4MB5A 2DT2A 1W3LA 1WCGA 5E70A 1EXPA 3EMZA 2D0HA 5CLWA 1XRVA 1E71M 1BGAA 2Y8KA 4W88A 2YL6A 3VD4A 3GH7A 2PBOA 6CGTA 1J12A 3T08A 1M7XA 1B0IA 2PC8A 1ISYA 1J9YA 1FOBA 3MKKA 4AW7A 3CLWA 1GOIA 1EQCA 1NOFA 2J74A 1VFMA 2GK1B 3VM7A 1ISWA 3CO4A 3UESA 1W2VA 3POCA 4ZENA 1UZ4A 4CVWA 2ZX7A 3AMGA 3RCNA 1R7AA 3ZT7A 1KR0A 4JAWA 3AZTA 3PZ9A 1GOKA 5A6SA 2HISA 2FHFA 1H5VA 1HP5A 4EK7A 2F8QA 3K46A 3ARPA 2J7DA 3BC9A 3MU7A 1JYNA 2JE8A 3VX0A 4FLQA 3L4ZA 1JGIA 3B9DA 1EHNA 5FOOA 4DWSB 4HA1A 1TVPA 4NF7A 3AZRA 2XFFA 4NRRA 1K6AA 1VIWA 1EQPA 2F2HA 4CN1A 3ZIZA 3ECQA 1CXFA 3LPOA 2VTFA 4AZIA 1H11A 3ZM8A 2OLHA 4TTUA 1BPLB 1UQYA
chains in the Genus database with same CATH superfamily
3G1RA 3UCCA 3GTXA 2ZRYA 3CHEA 4JFUA 3LM3A 1KBKA 4PMVA 5E9XA 3LCGA 2RUSA 4JXCA 4MFDA 2JQXA 3RDKA 3BOLA 2CHRA 4NG3A 2WMHA 1IIHA 5AB3A 3DC8A 3H2MA 1R38A 2QMKA 5D05A 3EPNA 3W2MA 2DQXA 1EEXA 3U2EA 3K8KA 2Y2WA 4HN4A 1V3LA 3GIQA 2G5WA 4Y9OA 4OBSA 3URBA 1YADA 1Q6RA 2CLHA 4QE4A 4O0ZA 1F3TA 3SR7A 1WA3A 4HT3A 3WLSA 5FCZA 3UYCA 4FP1A 4Q8TA 4JFSA 2ZDRA 1AQ0A 4GJ1A 2QDHA 4CCZA 4RW3A 4H9YA 2MUCA 2DZTA 9RUBA 3GXPA 1K7FA 3CHVA 3W1TA 2PTXA 5M3WA 4WJXA 3UJSA 1P1XA 2PCEA 3W4RA 1XLHA 3GUGA 1JI2A 4LBUA 1K77A 1UR8A 2DIKA 4U4MA 1AH3A 1O5RA 3IAPA 2ZUTA 5CPLA 3MCOA 3UFYA 2Y70A 2DP3A 3W29A 2NVCA 4CNUA 4MSSA 3R0KA 3V3WA 1EC9A 4V28A 3VZYA 2OYLA 6XIMA 1HKMA 3Q65A 1V0MA 1GVYA 1DJNA 1I2RA 3GC5A 5D09A 3S9ZA 1C8XA 3LA4A 3KTCA 4JHZA 3IANA 4NZFA 4ZQNA 4UFHA 2AL2B 3PNUA 3UWUA 4J40A 3SZ8A 5A1AA 4LBSA 3NIYA 3GNDA 5G2IA 4ZB5A 2OMAA 3O1NA 3A9BA 1XG4A 5HBFA 4LB4A 1W1VA 3EX1A 1YE4A 4C6QA 3URAA 1V8EA 1WE5A 2DSKA 1TMHA 2H3DA 2PP0A 2Z1KA 2XH2A 4M80A 3C6CA 3PZMA 2XIIA 3AHYA 3QXBA 4TR9A 3B0PA 2BVDA 4Q4QA 1QU4A 3TWAA 1KO0A 3T9PA 3A22A 2D2JA 2HS8A 3MC5A 1TV5A 1FKXA 1UR9A 5T9CE 3GXFA 1RD6A 2NX3A 3P82A 5AYZA 2NQ9A 4N4QA 3SECA 1ADOA 1VLIA 1XCWA 4PMZA 4GA8A 3GXIA 5I3IA 3S1VA 4DUOA 2QCDB 4AHPA 3DDMA 1JYWA 1ODZA 2Z24A 1PCKA 3BMVA 1UR2A 4N4PA 4BKNA 1HL8A 3TKFA 3ARTA 4LS1A 1E9IA 2Q8XA 3CM4A 3RUBL 1DJQA 3O05A 2E9LA 3F5LA 1DJYA 4WGXA 1UYQA 1XV8A 2V81A 1UZ1A 4Y96A 3ZVIA 4XO7A 1F6KA 2PCQA 2Y5EA 4QFUA 3TFCA 5E0KA 1W9BM 5D32A 1V0KA 3HG5A 5D9OA 2PUZA 4S23A 1LORA 4ZZ9A 1AVAA 2XGZA 3MUZ1 1ICQA 2NVDA 2IKJA 1Q8JA 3DG3A 3CYVA 3UF9A 2WB5A 3MI6A 2FYMA 1AQHA 3H2AA 1KCLA 3PAJA 2TYSA 1GW1A 3RPMA 1TVLA 3H53A 2Q71A 1FWFC 3UYIA 5D9PA 2ZYFA 2XTKA 5A6LA 5LSMA 2EPNA 1HJUA 1HJXA 1THFD 2BASA 2Q02A 4LVGA 1B4KA 4D6IA 5HQMA 2C1HA 1M7JA 1XPGA 1A3WA 2J25A 3R5EA 2PLKA 3CL8A 2QHAA 3GR4A 1VB9A 3FGCB 3AS0A 2AL1A 4O18A 5C7VA 4YN5A 3W7MA 3T0CA 1Q7MA 4UB9A 2FB2A 4JCLA 5IM51 1QFEA 3STEA 3MI3A 2F6XA 3MWCA 2XUCA 4IJCA 4LH8A 4M24A 4GXWA 3OBAA 4BWLA 2YLAA 4HMDA 4HSHA 2J7GA 1NM9A 3MUIA 4L6HA 1A80A 3UY8A 4GXMA 1TZ9A 3ZS4A 3BZGA 3WUFA 1MUMA 2DUAA 1Q5MA 3D0CA 2DUZA 4UMBA 8TIMA 5EFFA 3TMQA 2Z1SA 5G4EA 4EXQA 1JD9A 4MNKA 1X7IA 1DPMA 4O52A 5ENLA 3FJ6A 3T4CA 1QPOA 2C18A 3B4UA 5HWMA 2D3NA 4ONVA 1PUDA 1PWMA 4PUWA 1NEYA 1ODUA 5FA5A 4CD8A 3ENLA 4U31A 2BODX 3AMCA 4NHVA 1Y65A 2I5GA 4E4FA 5C9ZA 3UCDA 3VDCA 1R3YA 1RP9A 1YXDA 3UXDA 3D47A 2CZVA 1OT2A 4A22A 3LHUA 4JDYA 4C6OA 1F73A 1M3UA 4JTIA 3ZLHA 4AVNA 1SJCA 2A4AA 4PULA 3S0CA 4GI9A 2XFWA 3PTDA 4HYWA 2Q01A 3H26A 1YBQB 4GIAA 5EGRA 5F2IA 2VEIA 3ARZA 3GY1A 4JTQA 3DU0A 4AHQA 4IPIA 4PFMA 3AHVA 1NDYA 2ISFA 4R88A 5A95A 1XWYA 1TIWA 3PUOA 5AC8A 4J2MA 1EWEA 3PC0A 1QAPA 1YEYA 1H51A 2XHYA 4DELA 5E0FA 4FNUA 2B7QA 3RX4A 1IIGA 4NX5A 1O7AA 4V27A 5CC7A 2QT3A 3SUVA 5E9AA 2Z00A 2HSAA 1CCWB 3U5YA 2IKIA 1UW9A 3L67A 2C71A 2NQHA 4PZVA 7PTDA 2CBIA 2EPLX 3SCSA 4ZOAA 4AUBA 3OA3A 2OOFA 1QUMA 3GKAA 3TMLA 4XSMA 4DJDC 4WQ6A 3QRHA 1JD7A 5ABTA 3LK6A 3D3FA 3JUGA 4HU4A 5FF3A 5FJOA 1W3NA 2Y6ZA 8XIAA 1B3ZA 1Q4NX 3STGA 1E0WA 4JICA 1LUCA 2PBGA 2VVSA 4I8DA 4P8UA 1SVDA 1LJYA 2PDGA 4Z1AA 5I3KA 4KH2A 1Q6GA 3DECA 3NWRA 4R7JA 2J62A 2DFAA 4PR4A 1M01A 1W9DM 4W86A 3K1GA 4QCEA 4HSNA 4XG1A 3B4YA 1M1BA 3G22A 4J3VA 2GK1A 4CNOA 4GBDA 1DTNA 2VRJA 1CB2A 1RHCA 1HIZA 5JBDA 3IPWA 1QNOA 2UY5A 2GJXA 5D03A 3O9NA 1L6GA 2F61A 2OWXA 2QJHA 3W73A 5BXSA 9XIAA 4DLFA 3WD1A 3OZPA 3BOFA 4GZIA 4J3WA 2O4QA 1U33A 4CU8A 4UR8A 1HGWA 1J11A 1VJZA 4PMXA 3UR2A 5B7YA 2Y24A 2V3FA 2V0TA 4BY3A 1SU5A 2INEA 1Y5WA 3WDRA 5IFPA 2V2CA 2AQVA 3MP3A 5FIPA 2HE8A 2KZHA 2BV9A 4DO5A 3O3RA 4HMCA 2AMXA 1VEMA 3KHJA 2UY2A 3VIMA 1J4EA 3CHCA 1JXJA 1W3HA 3EMCA 1MDLA 5ABFA 4P7OA 2CZEA 4A3QA 5FL0A 5BRBA 1E4IA 1D8CA 4RZBA 1KFKA 3G1DA 1GOWA 5H8MA 4URIA 3GTFA 3WDIA 3TTEA 4OHQA 3V0UA 4YHEA 3MBFA 1Z3NA 4V33A 4FNSA 1RJRA 2VNCA 1WUFA 3SCNA 1WO2A 4K38A 4F0SA 3CEUA 3LCLA 1C91A 1E9YB 1QHZA 1OC7A 1SFLA 3RR4A 1OYAA 1A5AA 1SO3A 1JYXA 3LZ3A 5DFAA 5CSYA 4CU6A 3T42A 1MW3A 3NSMA 3QZ6A 1R3WA 3EA1A 2O92A 3HQNA 5HINA 2VMFA 3GUWA 2Y63A 5C5YA 2J79A 2DT3A 4BJHA 3ITVA 3MO4A 3NQMA 4HYRA 4PCFA 4LCRA 3OHIA 3T2OA 1LT7A 3PP7A 3LMYA 2P88A 1RP8A 2G3NA 5DCEA 3TN5A 3OIHA 3N15A 4ORMA 2BBFA 2PU1A 1J5SA 4CNPA 4LBRA 5EMMA 5A6KA 5DXYA 4QIUA 3TQPA 1OFBA 4GHRA 3HM7A 3TWBA 3KL5A 1K6WA 3N6HA 3SUTA 2OJPA 3C2FA 2VP8A 4RNIA 3AALA 2BNJA 4L7ZA 1O95A 4JKLA 4JL2A 3PWGA 4UFLA 1X98A 3S5SA 4GI8A 3WH9A 1R3VA 5TQLA 1QT1A 3NVTA 1FFQA 3R25A 1GHSA 4NZCA 3M0IA 3UGVA 3UNTA 3SIZA 3T81A 1NQ6A 1TV8A 1XIEA 1YTKA 1XYFA 2DT1A 1ZUAX 3CZLA 3MYPA 4AZCA 5D38A 2GWNA 5H91A 2ZTJA 3T7VA 1GVEA 3FA4A 4GUIA 2O7QA 4QG6A 5FD0A 3NL2A 3CWOX 4HHPA 2PTZA 2WCSA 5LNUA 1VFFA 1PZ3A 4H9MA 2X0YA 2WZIA 1GKRA 4AAJA 2O9RA 4W93A 1XP3A 1PZ0A 4WCJA 1TUFA 3I68A 3LCFA 4O19A 3DFHA 3G18A 4MIMA 4UTIA 4H9TA 3H4XA 1UOZA 2AGKA 2ZA1A 3CUXA 1VBHA 4UQDA 3F4WA 4EWJA 1KFLA 1EDGA 4J9JA 5DXXA 4K68A 1VYRA 4NAFA 1IWPA 5BU6A 4B4HA 3SCUA 2WAGA 2XH4A 5LIXX 2PTYA 4Z17A 1G01A 1Q85A 3VDHA 3NDZA 1CI1A 3APGA 4M82A 1UG6A 2V67A 3KCOA 3QPEA 1EXBA 1XRFA 3W2LA 2GJPA 2NXGA 3TYAA 1UKOA 3C2EA 2ONEA 2VJXA 2VM8A 2VC6A 4DNHA 1XH0A 4U3AA 1LRQA 5J04A 4S2CA 2PP3A 3DHPA 3E12A 4AVFA 3SAZA 1VCGA 3DC0A 3FS2A 1WZMA 4IFKA 2ISSA 1R8LA 1LLOA 2OR2A 1CXEA 4N2YA 4AEOA 3SBFA 4FNQA 4KWVA 4P7RA 4JL1A 4WEVX 3PZNA 1EP3A 1W3KA 1A5OC 1ITUA 3BLIA 5I3DA 3L4VA 4FNPA 3WMCA 4JYFA 4C6NA 1WZLA 3HFTA 3H70A 3UVAA 5C9RA 1OFPA 4UWMA 1AA1B 3PY2A 4QAWA 1GVOA 4HSOA 1O1HA 3SSJA 2P3EA 1W8GA 3CUJA 1E5NA 4OECA 2INFA 1B1YA 3H12A 3BK0A 4HK7A 3E2SA 4I6KA 1Z41A 3I10A 2YW3A 3EGJA 1GZ1A 3NOEA 1W1YA 2IS7A 4PTVA 3KW3A 1N8FA 3VA8A 4YVXA 3NO5A 2J4GA 3AS3A 4REQA 3WQGA 2I57A 2V38A 5HA7A 3DFNA 4C1LA 5CG7A 3O6CA 1PX8A 1ZBKA 3E5PA 4AX6A 4U2ZA 2HZGA 4DJDD 4KFNA 2G41A 1VJSA 1B4EA 2EAWA 3THUA 3UWZA 1L6SA 4WVXA 4M3PA 2WO5A 2DIEA 3CWHA 2IXVA 3AYRA 3NQ7A 4UTWC 1H7XA 3OG3A 1GHRA 1A4LA 2ZX6A 3DGRA 1PDYA 5LNRA 3IGSA 4PL1A 5BYWA 3VIPA 4Z42C 3HA1A 3EZ4A 1FRBA 4JCMA 2WCGA 2DJXA 4KRZA 3L4YA 3IGHX 4N42A 1F7BA 3QFEA 4HCHA 1JPIA 1QTWA 3PZUA 4EWND 1RBOB 3ZO9A 3VKAA 1HJSA 1VJIA 3VMNA 3WCZA 2B7OA 4ZMGA 1Y8BA 4GRSA 4NAEB 5C55A 4OTKA 5FJIA 3EA3A 1JI1A 1B31A 1R46A 2HNEA 4BF5A 5KETA 2XWDA 2A0NA 1E1FA 3BLDA 2EXOA 1KFBA 4XAZA 5GVJA 3VDGA 3W2NA 4LGXA 1CNVA 4GACA 4M7TA 3N4AA 2BOFX 4QTGA 3H21A 3R0DA 1GOMA 2VWSA 4MB1A 1BG4A 3O63A 5GNXA 3CMJA 1R9YA 3QH2A 3BTNA 4DEFA 1VR6A 2CLPA 1NFGA 1ADSA 4PEKA 3VK5A 4DYEA 3FLUA 3BCFA 3TTSA 4NZ1A 4UC5A 1FWGC 3QQ0A 2XIQA 3WLOA 4DRSA 4OBTA 4JTRA 4AB4A 4DXVA 4UNIA 1XSIA 3KRUA 2ZX9A 1OHLA 4IIEA 4AC1X 1UUQA 2WMJA 4QEHA 4DQWA 1EPXA 4DF2A 2Z1WA 1QHOA 1XICA 4DLMA 3W7OA 2JIWA 3CT2A 2WMFA 3N3TA 3LTSA 5C9XA 5EMKA 6ALDA 3ZR5A 4ZO9A 4DI8A 2WJZA 1UR4A 4JN6A 3PTKA 2PDLA 4O4VA 3ORWA 3FSUA 1GJWA 3CTTA 3OHMB 2BFGA 3G3MA 1LWIA 3QFWA 4G9PA 4J7RA 3SRFA 3GHRA 3TOPA 1LZOA 4CCCA 1R5YA 2EPMX 1ICPA 2VX7A 2CLFA 3IJDA 4C7DA 2BY3A 4MWAB 1EDTA 1QXLA 3WSUA 3EDEA 1R2SA 1M53A 1K4HA 5I00A 4PE8A 2WLYA 4UCFA 4ZXLA 2RDXA 4QBXA 1QK0A 2WKLA 3GDBA 1E43A 1US3A 1E1CA 3GU2A 1TPB1 2IPGA 3KCJA 1E0VA 4W89A 3SO7A 2BXVA 4IUGA 3CUGA 4HOZA 2ZZ3A 2YZ5A 3ZOAA 1ONXA 4HK5A 1J79A 3RX3A 4O57A 2DZWA 1O4UA 1TPDA 3USBA 3V18A 4BQ4A 3VOGA 2ZCGA 3NSNA 4EVZA 2QLYA 2YXGA 4QXIA 1IYXA 3WFLA 3THDA 5CPSA 5CPOA 1QPNA 1CGYA 2ZIDA 3KE0A 2YA2A 1RVGA 1XBXA 3C2YA 1SO5A 1ELSA 3O06A 1GWJA 3VOIA 4D1IA 2IKGA 4HU8A 1PVNA 1DWIM 1EBHA 4X9YA 2P5NA 4B5UA 3IUHA 3AIRA 8XIMA 1VYSX 3L5AA 1BWVA 3MHUA 3MUY1 4GGBA 3TYUA 2UWFA 4WJ8A 2OWCA 3ZQ9A 2E0PA 2W92A 3I7SA 2FH8A 2P0IA 1TSIA 3CGTA 1LRTA 5XINA 3KAOA 5I07A 2Z1VA 4H3DA 1YYAA 2C91A 4DPPA 1QI3A 5D04C 3P80A 2VXNA 2VCCA 4IIGA 4PB3A 5BMXA 1UP3A 4LAMA 4IXXA 4ZOCA 1B90A 3TSBA 1XW8A 3OP2A 4MMWA 2WSYA 1I2NA 1RALA 5GNYA 4BZYA 1UR0A 3NEVA 1KFCA 5F4SA 3SY5A 1Q8AA 1KTNA 4CNTA 2X05A 3GDMA 4PMJA 2J7EA 1KXTA 4RE0A 3O16A 1S38A 4WOQA 1U30A 3C5QA 1XD1A 3VNJA 5A8MA 3R13A 4D9PA 5A69A 4IWWA 3B3DA 4IG2A 3UJ2A 1JAEA 3QF0A 3L4UA 1F4AA 1C9WA 3ZR6A 4H9ZA 3BDKA 2OLAA 2VX5A 3OB8A 2GSJA 4AZHA 4ENLA 1DEDA 4K8HA 4GQRA 3FAXA 1UZDA 3NL6A 2VEKA 4DJDA 4I7WA 5CC5A 4TV5A 1ZZMA 1ZNNA 3DG7A 5GJMA 3CAVA 4FEZA 4ORIA 1A5MC 4HGXA 2O55A 1FH8A 3C61A 4ZO7A 3GG1A 1M04A 4JTJA 4LYPA 5AZ1A 4JQ4A 3W70A 1NDWA 4L6OA 1CXIA 4CLMA 3NQ6A 4X2RA 2ZDSA 1TCMA 1MUWA 3PVFA 3N1AA 4A8LA 3VNKA 1HKWA 2IQDA 2PURA 2GJRA 3L9CA 1MO0A 3PUEA 4K7VA 4OVXA 3S5NA 4JTSA 3QGKC 4GX9A 3HO8A 2VVNA 4JQAA 2D22A 2Z0IA 2PD9A 3TJ4A 4M6QA 1E55A 3HBLA 2G3IA 2XZ9A 4MWAE 3KL0A 3DHFA 3DESA 4GIYA 1C8VA 1RCQA 4PMUA 1XIMA 2ACQA 3U2CA 3U7BA 1G69A 1UD4A 4IX2A 1R6WA 2V3GA 1D7KA 2WZTA 2AQWA 3LSBA 3T0AA 2WMIA 3EA2A 1GUVA 4NRSA 4ADTA 3KLKA 3ISIX 3NM1A 1DWGM 3N6JA 2BGNE 3V5FA 4AEFA 2GPTA 2MNRA 4WIWA 1UZHA 1RXOB 4RPQA 4K36A 4BI6A 4ACZB 1NFPA 5I03A 5XIAA 3QZEA 3SRKA 2TAAA 3T0BA 4LUIA 1O68A 1JFXA 1X38A 4KF1A 1HL9A 4XTDA 2WSPA 4ZBCA 3A47A 1EKOA 1Q6FA 4PCSA 4O13A 5AYYA 4W8BA 3URQA 1Q2RA 4RNFA 3QR1A 1JCMP 4IPPA 4DWSC 1DIDA 2VCBA 4Z1DA 3IUDA 4RPPA 1E51A 2ZXQA 4L5ZA 3TV8A 4O1DA 2FTPA 1UWTA 2FMNA 1JIBA 1V3JA 4HHHA 1DXIA 3A12A 4PCNA 1GORA 3A5VA 1KFWA 3NZ1A 3GNRA 3WNOA 4QJ3B 5FEZA 3WLJA 4AIEA 1HNYA 3CQJA 1P0EA 4UR9A 4UMAA 3M7WA 3GTIA 2JF6A 1JCTA 3NQVA 4D1JA 4UQEA 4XQ6A 3W37A 4GYPC 1RQHA 3PM6A 1JPDX 3Q58A 1BG9A 2DSVA 3OLGA 4PTDA 1TTJA 3CAWA 2INZA 2C19A 3QJAA 2PP1A 5C0QA 1OVDA 2WNZA 3PB0A 3AIWA 3M44A 4GUGA 1ITQA 3BAKA 2UY4A 4K7YA 4MJ2A 1A5SA 4XD5A 2G96A 4H7CA 2CU0A 3IS4A 4J3XA 5EL1A 1XIHA 3ZJ6A 1DQXA 3H4GA 2BVWA 5KZEA 5E6ZA 3JVAA 2GVLA 2NSOA 3RCYA 4O50A 4D6EA 4QDPA 5FESA 5A8GA 5L9FA 4LY8A 5C7HA 4WK9A 3W7IA 3T07A 3N13A 3H8AA 3TN4A 2WHKA 2JBMA 2DVXA 1GPWA 1FHDA 2G8ZA 4M29A 1JNEA 4DZAA 4GH3A 1XYCA 2W5FA 4AXKA 3L4TA 1CENA 1S2CA 4NNBA 1XLAA 1KCKA 2Z7GA 5TIMA 1XDJA 1KQYA 4HPHA 3A64A 2WZMA 3FKRA 3RM8A 1FVPA 2E40A 1OX5A 3A4JA 3VDBA 4C91A 4D2JA 2C14A 1OFDA 1L6FA 1RJPA 3BPWA 1PKLA 1FWTA 4CVUA 1KKRA 1IV8A 3KRSA 4OU1A 2BZNA 3VUSA 3O6YX 1WCGA 3EMZA 2FB3A 2D0HA 1Q3NA 1MSSA 2QVHA 3GR7A 2YL6A 3VD4A 2PBOA 4LJ3A 3ES8A 1LUCB 3LI0A 2PC8A 1J9YA 1NAL1 1SGJA 3GG0A 1FOBA 1XLKA 4EP8C 1GOIA 4Y8EA 1AD1A 4GOAA 5HMDA 1VFSA 2GK1B 3MBDA 4NL1A 8RUCA 4J5NA 3UESA 2GOUA 3W7DA 3POCA 4ZENA 1S5NA 2VGIA 5DMLA 1ZRQA 4KERA 4CVWA 4P61A 3TU9A 2O7SA 3AMGA 1P1MA 3VZXA 3ZT7A 3PNZA 3QKEA 2F38A 2E6DA 5A6SA 4AWUA 1XUUA 1HP5A 1SZFA 2DUXA 4GYFA 4C6BA 3MU7A 1JYNA 4YVVA 4Z1CA 3VX0A 4FLQA 3MT1A 4GVGA 5FOOA 2BWGA 3ZLFA 1TVPA 5DY3A 1K6AA 1VIWA 3WYZA 3LPOA 4S3AA 4YYCA 2OLHA 4C6PA 4JTGA 4U28A 3N4EA 3KVJA 4UFMA 4UUIA 7A3HA 5EBUA 4JPGA 4C6MA 5DF0A 3W02A 5F2LA 3LEPA 3SCTA 4GZJA 1QI2A 5CEWA 3GU1A 2HVOA 3MDWA 2X1IA 3C4UA 3W81A 3BLPX 1V93A 3EDFA 3EX6A 1HN1A 4UTTC 3P67A 1XIBA 3GTNA 3B03A 3DFOA 1UB3A 2P76A 5TF0A 5BRPA 3VGHA 4LUSA 3POHA 4XZ9A 1QBAA 3W28A 1S3TC 5K2ZA 3WNKA 3P5ZA 4P8VA 1MNZA 3W7GA 5I2UA 4O0KA 5CGQA 1TZZA 5HDRA 3RLVA 3DFQA 1HF6A 1UKTA 4HNOA 4FOUA 3U5UA 4J27A 2WVTA 3XIMA 1NSJA 4UOQA 3BAXA 4R53A 1MXSA 5HNRA 2OKOA 3LENA 1X6LA 3CMGA 2VENA 3M0HA 2FVLA 4MKSA 6REQA 4ML9A 2WNWA 1XYMA 4HB7A 3SQSA 4I6VA 2YA1A 2HVMA 2F2KA 3RG6A 4EE9A 1TCDA 4L9XA 1Q65A 1QCWA 3UZZA 1K9EA 1BEUA 1CBGA 4UNKA 1E0XA 1MEHA 3MI2A 4NZ5A 1QASA 3M0VA 1J01A 3ZLGA 4JNMA 3RMJA 1JRCA 4JDBA 4RLIA 3F4DA 4L61A 1YE6A 4HTBA 1N82A 1IEVA 2ZZ4A 3CUIA 1US2A 1GNXA 5CC3A 5BWFA 1V6WA 2DQWA 1RA0A 4R9XA 1GKPA 4RDWA 5U4NA 3STCA 4IP7A 1UWSA 4AYGA 2QYGA 2WPGA 2WMGA 3W7HA 4MPQA 4ERGA 3KS6A 1C8QA 4M6VA 1KTCA 2I56A 1KGUA 2VEPA 4MYXA 2XISA 2Y5JA 1IWBA 2CESA 1G1YA 1NDZA 1XSKA 4IZGA 3UJEA 3QV8A 2NWRA 1OG6A 3R6IA 5CSUA 7REQA 3NM3A 8CGTA 1OFQA 1TR1A 4YXGA 1CW2A 3BL3A 4HD5A 4AZCB 3DBPA 1S46A 1KM4A 3QOMA 3EDJA 4F2UA 2WW5A 1YKWA 1V3MA 2ALRA 1Z48A 5JXQA 3NDOA 4AD2A 3KWXA 1P48A 3GBEA 3RFAA 4CQCA 4HA4A 3LRKA 4CCEA 3PR2A 2XYLA 4JFVA 2NSXA 1Z32X 2I9UA 2WBKA 2NUYA 4IQJA 1W3TA 3I3EA 3UR7A 4H04A 1XKJA 1JDEA 3VKCA 4OBRA 3EDDA 4N6FA 1T7LA 4ZQOA 1FWCC 4LYKA 1NOWA 1NP2A 2PB1A 2XWEA 1S3HA 2PGEA 5KITA 4DWSD 4RW5A 1YXCA 4MKNA 3SCPA 4S39A 3BICA 4NAFB 2NT0A 1F6PA 1IQ8A 4YYFA 3LPPA 4Q4MA 4PMYA 4UBPC 2ZX5A 1U1HA 1QVBA 4L9ZA 1J0ZA 5D9MA 1PIFA 4PODA 5U7SA 4CNSA 1LQ0A 3GZAA 3R89A 4GCAA 3UQNA 3F4VA 2QCDA 1J93A 3R58A 4MJMA 4AWTA 5LHEA 2ZUWA 4RDYA 2NQJA 4PSRA 3T4WA 4OOZA 4IFKB 3EAUA 1I75A 1LL4A 4NSBA 3DHUA 4TIMA 1DHKA 3MMWA 3I3DA 3KZSA 3STPA 2DJLA 4DVOA 4IJRA 1U2YA 1SO4A 1D2KA 1QI0A 2P8CA 4LOCA 4ES4A 4TMBA 3VVGA 3E2VA 1IGSA 4ROPA 1DKWA 4EKJA 2GOKA 1DQUA 1RV8A 1ZAIA 4MB4A 1W54A 4CQDA 1FWWA 1UH2A 1WKEA 4U2YA 3WN6A 4GQGA 3FKKA 4I9AA 4IP5A 4BEUA 4KKXA 3GLCA 2FHBA 3NL3A 5LKYA 4UIOA 3KZPA 4C6LA 1F3XA 1UKSA 4MJZA 4G1NA 3ABQA 4ZE4A 1YMYA 3AICA 2GVEA 2TPSA 5D8ZA 3P8IA 4UTLA 3OZOA 1EEPA 3HV9A 2V5CA 1X97A 3P3BA 3NQFA 4ZTXA 1IT8A 1KCXA 5DQPA 4MWAC 4Q4KA 4C6IA 1HG3A 3H2CA 4TX9A 3UXLA 2CBJA 1OEPA 4F2TA 3IIPA 4LV9A 4REQB 4EACA 3ARUA 3ZMRA 3W85A 3WO8A 3AS1A 3K30A 4PTMA 4RV8A 1W9UA 2FGLA 1KM6A 1JDAA 2OZ0A 1QWGA 3PJTA 4UMCA 3LHWA 3NAVA 1Z7AA 1EP2A 1KXVA 3G0SA 2W63A 3CTLA 4Q6JA 3FYYA 2NLIA 4TX6A 4KBXA 3AIVA 1V5XA 4BS0A 4TU1A 1YHTA 2Y88A 1ZFJA 1E56A 3S2MA 3CC1A 3N04A 2CLIA 1JVNA 3TC3A 1W9XA 2XINA 3PF3A 1YXYA 3G5EA 1POJA 5I7GA 4JS3A 1UWUA 2PDXA 4US6A 3E6EA 2QW5A 1KM0A 1EZWA 2FGZA 3PJWA 1YTEA 2YW4A 4GFIA 4KIRA 2VX4A 4PCTA 1N8WA 1KWGA 1ZS2A 4J35A 3RITA 1AJ2A 2R1LA 4CGTA 4BA0A 2OQLA 2X2YA 3MKCA 4CNNA 2PDCA 4DZ5A 1DIOA 5H6HA 4PBFA 1G94A 1SR9A 2HMCA 4YTUA 2QV5A 1DHPA 1FY6A 4RX0A 3WH6A 1XS2A 4ZFCA 1J0KA 3L0NA 1UUOA 5CPTA 4BEQA 4YS1A 2CLOA 3SUWA 4ATDA 3AYTA 4CEUC 4O1BA 4E8CA 1ZQ5A 1KRMA 2C6QA 1XLGA 4EF8A 1R85A 3AO0A 3C2OA 4IXHA 1X8CA 4IIDA 2B0MA 2PWFA 2VYOA 4B5SA 2YA0A 3CHFA 4DBUA 5A8PA 4O54A 4WXZA 1T5AA 2OOGA 2BGQA 4FX7A 2AQOA 3OVGA 2A79A 5A5WA 4H9VA 3WLQA 1PX3A 4XD4A 5DCBA 1PTGA 4QNWA 3UNDA 1MYRA 4XV0A 4B9YA 5A6JA 4IX0A 4IQEA 2BDQA 1WZKA 4HMEA 2ZZ7A 4M1BA 3I3BA 3BGGA 3SQLA 3W25A 1A53A 3VFLA 1NQKA 1JDCA 2ZOXA 4E2BA 3NQ2A 5EMLA 1D3GA 4DO4A 1YRRA 2P1FA 1AJ0A 1W37A 3EB2A 3W00A 3QOKA 1E1CB 2CWXA 1ZU8A 2UV8G 4HZMA 3EWXA 3EWUA 5I24A 2QVNA 4KS0A 4DWSA 2KX9A 3RLHA 3UZYA 4MY8A 2QCHA 4L6DA 1EF3A 2J7BA 4UFKA 1ZHAA 4ERAA 2VWTA 3TR2A 3UWYA 3M64A 4PBGA 1SW7A 1ZLPA 1PDZA 3M0KA 1ZALA 1OX4A 3TN3A 4FALA 2P10A 5K9DA 1NFBA 4WR3A 4FPSA 4W85A 4S3KA 3GKFA 1LT8A 4YHGA 5DLCA 3Q37A 1RBAA 1XFCA 3NPVA 1DWFM 3CAQA 5IBXC 1OK4A 3NPXA 4GYPA 3CH9A 5F4WA 2PWHA 4RR4A 4H00A 3I7RA 3NJ3A 1O1ZA 2BHUA 3O2LA 4AWSA 2C0HA 3EWCA 3IIOA 4U3CA 3RU8X 3DOPA 2X7WA 4OQVA 2I16A 4FOKA 2AKZA 4V1XA 3FJLA 1MXDA 3GSMA 4JIEA 3G1VA 3NYZA 4MUPA 3MTWA 1JGMA 3PBGA 3RF9A 1RJQA 5A6TC 2JGYA 5G4HC 3WQ8A 4DB7A 1FCUA 4AY8A 4BWLC 2OZTA 2QF8A 1Z8AA 3BG9A 3VKDA 1H41A 1H4PA 4O11A 4OT7A 6TAAA 1L9WA 1ZJHA 1RK6A 4JQ2A 5FF7A 3PZVA 1T40A 4Q8OA 4NASA 4LVDA 3AC0A 5AHFA 2I9EA 4W8AA 3IGXA 3NO1A 5FJUA 3SFWA 2ZZ6A 4MM1A 1EGVA 3LTPA 4F40A 3W6LA 3AI0A 2YIHA 4QLJA 3TE9A 3RO6A 3WH8A 3H4WA 1WNOA 3VMOA 2FPTA 3W22A 4FHAA 4PCPA 5HUOA 1L2QA 2CKSA 4JIIX 1BKSA 1G4SA 4GWEA 2E67A 2XSXA 3SW6A 3CPRA 4K39A 2BY1A 1H7RA 5J5DA 4I7UA 3TP4A 3N9RA 2F84A 4GUFA 1OFRA 4O28A 5JUVA 3MWAA 1OD8A 1XF0A 4W7WA 2PLCA 4N9CA 2PWDA 3SCVA 1KD0A 4PMNA 3BZJA 5GNZA 3ZJ7A 2FTYA 1ZL1A 5KZ6A 3CZKA 1C93A 3RLUA 3EOLA 4MZ1A 1B2YA 1VF8A 4DM1A 5DCDA 3MO7A 1CPUA 1XLLA 5L6UA 3GNXA 1MFUA 3QV7A 1ZJIA 3W87A 2I5IA 3W88A 1PX4A 1W6TA 1HFBA 5E1QA 2I5QA 2VQTA 4E4UA 2XGIA 4Q4PA 4C7FA 4HPXA 4MWAD 1F8MA 1ITXA 2XN0A 3WUEA 1XLIA 4S38A 4JTEA 4LUJA 2H8ZA 2YZRA 2YLLA 5CPMA 1BAGA 3DG6A 2EG7A 2EQDA 3N4FA 4NI3A 4WZHA 3LXCA 3T0DA 3BW2A 4UFJA 5CSRA 3FCPA 1S5MA 3QQ1A 4IMCA 2GDQA 1R2RA 2W6RA 4JTTA 3WQ5A 4WY0A 5F4XA 3HMJG 1I6NA 4WSHA 4MOZA 2EEXA 4HBKA 4IPJA 2ZUSA 4IPLA 3G3DA 3B40A 1F76A 2WJFA 1FBAA 1XRTA 5K3VA 5DELA 4FX8A 1UC4A 1UROA 4YIWA 1WKFA 4UTTA 2RGMA 4JN7A 3N12A 4AXNA 1A47A 2PRLA 3BLLA 3HPAA 3HG2A 4H4IA 3A6OA 5I6SA 4IIBA 4LS2A 4X0VA 1WP6A 4JY8A 4LPCA 2WCAA 4RE3A 3KTSA 1GPFA 4GVHA 2Z28A 4A29A 3BH4A 1NH6A 2HS6A 4MDOA 3DIPA 2A21A 3LV6A 3NDYA 3C0JA 3FYOA 3G1XA 4O53A 3TTYA 3VIHA 1KA9F 2VOTA 4OFCA 5HR7A 5I5RA 1QDSA 2PGFA 4MAVA 4B2DA 1XBYA 3B8WA 3ALGA 1P0DA 1BXNA 1EPVA 5HMSA 3WFZA 7ENLA 1XH2A 2CNCA 3THCA 3DXIA 1HP4A 2WSKA 3RO8A 1REQB 1LOSA 1KGXA 1MEIA 2W61A 1W1ZA 4PMQA 3BURA 3QKZA 3OVQA 1XCFA 4BI5A 4JR5A 4PH6A 2GUUA 3B9EA 4MPKA 2ZC8A 1AZ2A 4LYRA 1TQXA 1ZB5A 1J0HA 1G4EA 3QSTA 4C6KA 4BI7A 2Y0FA 4XBSA 5E09A 2EGZA 1XBVA 4AISA 2HNHA 1NF7A 5AHMA 4IFRA 3PBWA 2PODA 3STFA 1OC5A 4WY0F 3P14A 2ZFAA 1WDDA 1JQXA 4ERIA 4JTAA 3SY8A 3TJXA 5CBBA 3BSGA 3IJQA 3N34A 1Z44A 1TIMA 1V6XA 1XH1A 3UA3A 5HWJA 4MLJA 3N3MA 3S2NA 1UBPC 1NWTA 3R4IA 3SN0A 2V3DA 5CC6A 3WQ6A 2BOGX 4ALDA 3PZTA 2ZWZA 1XBZA 4A05A 3VU2A 5FSDC 5IFTA 2GLKA 4JIPA 3O8AA 2R91A 2X1RA 2PLJA 1DE6A 1R9XA 4H6RA 3QC3A 1B3YA 5DBTA 2V6AA 4IH3A 4HVXA 4R5EA 1DIEA 3V36A 4CEXC 1G4TA 3B8DA 4GI6A 3EYPA 2CLLA 1CEOA 3P84A 4ZB0A 1GZGA 4AWEA 5FSEC 1TPH1 2OSXA 1TJ1A 1UWRA 1AMYA 3TYZA 5FF0A 3BW3A 4ML4A 3O6DA 4X61A 2Q3RA 4J1OA 3UPMA 3K4DA 3IACA 1V0NA 3L0KA 1TWSA 5LNVA 1T6MA 1JZ2A 1R3TA 4Q22A 4A8RA 3UEQA 4QP0A 4CD5A 5KMYA 2PDKA 3OA5A 5C54A 1H7WA 1VHNA 4NYYA 1QNVA 3BWWA 1E6PA 3W7KA 1GQJA 1FFRA 4QSFA 5HANA 1O60A 2NUXA 3AYVA 2SFPA 3QPYA 5BCAA 2PWUA 3DBNA 4XAYA 3VILA 1IR1A 3FA5A 1B3OA 1OX6A 1KM2A 2WKGA 4MF4A 3CO8A 4HNNA 3S9YA 4PUKA 3TA6A 4LCQA 3F4CA 5AVHA 1UCWA 3WDJA 1YDYA 4QJ1A 3GX9A 5I0DA 4MAZA 4US5A 1UQZA 4KWUA 4G1KA 3UU0A 2WZHA 1FA2A 4ZOBA 3DYPA 4JKKA 3RILA 4BK9A 4AF0A 4C6JA 4PYSA 2J77A 4O1EA 3IGUA 5CXPA 2VI0A 1HO4A 1U5HA 3VM5A 4YJ5A 3NR0A 1UWAA 3TUUA 2C16A 3WLPA 4GQQA 3WLNA 4GJIA 2HVNA 3PZOA 3LHVA 4FI4A 2BB0A 4ZOEA 4ZQCA 1LCOA 3TDFA 1A0DA 1PKNA 1GEHA 3CL6A 3WLKX 4LNYA 2WHLA 4KEUA 3PFMA 2PC4A 2A2IA 2Z4GA 4RK8A 3EWBX 1QRQA 2VUYA 1XGEA 4Z2JA 5E6YA 3BJFA 3E38A 1PPIA 1QWKA 3CV2A 3JRKA 4QROA 2WHMA 2DZAA 1H3GA 1EHAA 5I23A 4I7VA 3UZWA 5HMEA 2REQA 4PUUA 3QGAC 1SUXA 1N8IA 3AISA 2QGHA 4LUSB 1FKWA 7TAAA 3GXTA 4MWAA 4AD4A 1NTHA 1D9EA 4DYJA 2RKXA 1RAKA 2Z1BA 1QOXA 3KX6A 1TWDA 3M47A 3EXTA 1IZJA 4JX4A 5AHLA 1FWSA 3HG3A 2J7HA 2NX9A 4Y90A 3WL1A 1HJWA 1ZCCA 1JR1A 3KTXA 3MB9A 1DTUA 5FI8A 2QDGA 3IAQA 3KS5A 2IXUA 1J6PA 3M5YA 1J6OA 1AZ1A 2VFFA 5FAGA 4KCVA 6REQB 1Q6EA 2B31A 4P7LA 4HTYA 2VEFA 5BROA 2OQHA 1YDOA 4Z0JA 4L1WA 2O9PA 1HTIA 2HEJA 5A8OA 1QNRA 2FMOA 3JZEA 2EO7A 4TO8A 1BRLA 4MADA 5BXPA 2WOQA 3B0YA 4EPBC 4R33A 3CQHA 3VNMA 3L21A 2ABAA 2R9RA 1H1YA 3SGGA 3ABSA 4L56A 1P0NA 4HZ8A 5EPDA 4NZ3A 4MYAA 4HCDA 1L8PA 1JAKA 7CGTA 5IDIA 4UCGA 3F2CA 5J5RA 1Q6DA 1EC7A 1IEWA 2DDXA 3VZZA 1AW5A 2VEMA 4ZA0A 3H22A 2YCIX 3TCEA 1S39A 5ECUA 3EWDA 3BE7A 4GC3A 4OZOA 1KV8A 3A4WA 1AJZA 3ITXA 2Z27A 2OT0A 7REQB 4XZLX 5H8UA 3ZZ1A 4AIUA 5E93A 1IT7A 4FS9A 4AD1A 5KZDA 3V16A 2FZ8A 1O94A 1EYWA 2E9MA 1GT8A 4HA0A 2Q8ZA 3WK1A 4RZ4A 4H6EA 1CGWA 1VC4A 4Q4OA 4XZMX 2VC9A 3KBMA 1XLEA 1BYDA 3CZJA 4Q8NA 1MQPA 1H62A 4IIHA 2YX0A 4NKCA 5TNVA 3MUXA 2PDWA 2VFIA 1SW3A 1ESWA 1HXJA 2CWNA 3A21A 2XM2A 3HFYA 2CBVA 1BD0A 1OCQA 1M68A 3W7EA 5JQ9A 3BV4A 2OQYA 3NQ8A 3GXMA 2OYKA 3M41A 2E6AA 1XIGA 2P0OA 1JZ5A 3E3HA 4Z2GA 5FEXA 2J9YA 4Q8MA 4J2PA 3EOUA 1K7EA 2CC0A 3P60A 1LLZA 1OG0A 3H55A 2D73A 1XDLA 1UC5A 1OT1A 4J3TA 5KSWA 4XD6A 3AROA 1S1RA 4LS0A 3UXIA 3M5ZA 4N9EA 4LXFA 1TELA 3QC0A 3CU2A 4KETA 3A9IA 1PCWA 3AIQA 5CZ0A 3TC7A 4IIFA 3EKZA 1GYMA 3QW3A 4P8WA 2QR6A 1TG7A 1JPHA 3ARSA 2YCKX 4ICNA 4KW2A 2DW7A 2HROA 1K7XA 3HQOA 2NW0A 1BLIA 3WUGA 1XCXA 1ZJBA 4QG8A 4KEVA 1VPYA 4GUJA 2D1ZA 3QLLA 3UP8A 4PUEA 3PWAA 4UTHA 4PUNA 1E72M 2AAAA 1V77A 5AY7A 3EXSA 2J88A 1TPC1 3VKBA 3IJIA 4HNLA 5GPRA 5HATA 2WBGA 5I3HA 2E8ZA 1B9BA 3VNDA 2GGHA 3L0GA 3VO0A 3VGFA 3QHMA 1AQFA 1N7KA 1SFSA 2CIPA 1KRBC 4WJEA 2IQTA 2JALA 3NA8A 2FPVA 3BQ5A 1X96A 3IK2A 1W5MA 1LF1A 5IBXA 2E5CA 3CZEA 1Q2SA 3IRDA 1MDRA 5DT5A 1UD2A 3ITOA 3QR0A 3EPOA 3BARA 3VTRA 1U1JA 4N7QA 1XFBA 5G2HA 4LVFA 4O14A 2VELA 3V5CA 2QJGA 4LQ1A 4Y6GA 3RPTA 4ACZA 2XSAA 3WD0A 4F2BA 1R0MA 2NWSA 3VCNA 3LNPA 5G2WA 4KESA 2OSYA 4MGGA 1KBBA 4C1NA 1Z69A 3FN9A 4IICA 4ICCX 4LEQA 2CZFA 1NARA 3QHNA 3N29A 5HNTA 2A3EA 1YDVA 4FXSA 2V9DA 5JIWA 1BVWA 2EF9A 3OU8A 2QQ6A 1RVKA 1OC6A 3ANVA 1VBRA 1OGGA 1DJIA 1AW2A 1W2PA 2QS8A 3E9AA 3WELA 3ARVA 3QR3A 3GVWA 4XIAA 1T0OA 1TB3A 2GYIA 1FQ0A 1I9CB 3PG9A 1UD5A 2V2DA 1LQAA 1DP0A 1QI5A 3RU6A 4Z1BA 2ZRXA 4QS6A 1XINA 1XLFA 2OKTA 1NF0A 3R8RA 4GNKB 5F1VA 2X0SA 1UKQA 2GUYA 4AFYA 3S6OA 4XBKA 1XG3A 2HBXA 2ZADA 3SUUA 1TPEA 4UFIA 4O4WA 1S5TA 2WQPA 1CLKA 4IHCA 3TQKA 2YSWA 3A4AA 3HQPA 3W83A 1JCJA 3PBMA 5CBJA 4FMVA 4GO9A 3MZ2A 3TH6A 3WD3A 1BSLA 1TJ0A 4G8TA 3BMWA 3KBVA 1GOXA 3BLOA 3FSTA 1V3HA 4JOMA 3EX2A 3WEMA 1R9ZA 3L5MA 5T91A 3H23A 1YX1A 5DT7A 2CPUA 1CZ1A 2VDIA 1OFOA 3W38A 2PZ0A 3V1PA 4W84A 2ZRVA 3UJRA 3SY1A 4MY1A 3LCHA 1TPUA 1BXBA 2GSEA 2VZUA 4R3UA 4H8HA 2ALDA 3WG6A 1HO1A 3PAOA 5FACA 3MP5A 1W3LA 5E70A 3LI1A 4M51A 4A8NA 5CLWA 3WQPA 5K4ZA 1E71M 1DJXA 1JQVA 2Y8KA 4W88A 4WD0A 1AMKA 2Z26A 5LIWX 3GH7A 6CGTA 1J12A 4KCTA 1M7XA 3T6CA 3RYSA 3OZMA 2G50A 1SFJA 2OGYA 4WUIA 4DWDA 4RV3A 3C3UA 1PIIA 3SRHA 3MKKA 3ATZA 2Y8UA 3CLWA 2PLMA 1XPYA 4KCUA 4WDTA 2BSLA 4HPJA 4P5UA 3WJXA 3QM3A 1EUNA 3RCNA 2ZZ5A 3L66A 3AU6A 3S4TA 3U4FA 4JTFA 2ON3A 4YWSA 3B97A 2QZRA 2HISA 3MZNA 4B5TA 4EK7A 2F8QA 3K46A 3ARPA 2J7DA 3CV6A 4H6KA 3MHGA 4E2DA 4YCOA 3GD6A 3P0WA 4L4MA 4ADUA 1X1ZA 2E1WA 2WSQA 2NV1A 1JGIA 1R2TA 2RFGA 3PS7A 2P3ZA 4ZCWA 4DWSB 1D3HA 3GDRA 4NF7A 4A8IA 3AZRA 2XFFA 4NRRA 4O8RA 3NPWA 4CN1A 1WBJA 3EKGA 3ECQA 1CXFA 3QW4B 5DBUA 2VTFA 4IGMA 1H11A 3ZM8A 3USZA 1BPLB 1UQYA 2VGFA 3W7CA 5CCZA 3L4XA 3M4HA 3GC4A 2G0WA 1RH9A 1OX4B 3WBAA 4LF1A 1KLZA 4V15A 1UPPA 2QCGA 2XIJA 3RCMA 4HHMA 3V0TA 4GQBA 4Q33A 3HZ3A 5AYXA 4Q8QA 1RPXA 2PPGA 3S2CA 5I3GA 3E02A 1IZKA 3AQUA 4NI8A 2Q8LA 4A3UA 4LNCA 1I45A 5CGTA 3AYSA 4MTVA 3PG8A 3RJXA 4R7OA 4B16A 1J10A 3SI9A 4AD3A 2E4TA 2PRMA 5D4YA 2XVKA 5CPNA 4ATWA 4HQVA 1JDFA 1SJAA 3BO9A 1GZJA 4GGHA 1TTPA 4LV4A 1QW7A 3R79A 4FXFA 3CLMA 1ZSXA 4M1RA 4H6QA 2E1DA 2XJ7A 4CCDA 3TOYA 2O56A 4PGLA 1ISVA 3COTA 3P0XA 3OJGA 3UWQA 3KOXA 1KNWA 3GWQA 3W1UA 1DVJA 4TQTA 3NUKA 2RJHA 3TSDA 5I78A 4NIRA 4GNJA 4X60A 3V5OA 3UR8A 2OT1A 1ZBCA 3RXZA 1HKVA 1W91A 2J9XA 5A2AA 1VHCA 5IHRA 4J3ZA 5GJNA 1PYMA 1QW8A 3TTOA 3Q67A 4JGDA 3JU2A 2DVTA 1JNDA 5LYRA 3ARXA 5KTLA 1JCYA 2PF0A 3WD2A 4TVDA 3CXOA 4B92A 3PPHA 5HQEA 4DX3A 3KOFA 2NXIA 3BG3A 3R1ZA 3EPMA 3TTQA 4PTXA 5FAJA 4C7GA 4G7EB 3NXFA 4LYQA 3RK8A 4HKPA 2WZEA 3DGBA 3B9NA 2EJ1A 1BVZA 1TREA 3QEZA 1XJBA 3OVRA 1VIZA 1K8YA 3C2RA 5MHBA 1FH9A 4S3BA 4TTGA 2OGJA 1JZ6A 3UVIA 1YNQA 4F66A 4EAYA 2RDUA 4EXBA 3OBKA 1IEXA 1GQIA 5LXEA 1X6NA 3HMCA 3NXLA 3GO2A 4D71A 3KFTA 1RLCL 2QKFA 5M5DA 5DY2A 3ZSSA 2O9TA 3VPLA 4KFOA 1J2BA 5HWNA 1S2WA 5FJTA 3W1MA 1B54A 3W1XA 3R43A 4JIHA 2JEPA 1UR1A 5CAKA 3S2LA 3NYDA 3LGDA 5EU9A 3BANA 4F0MA 4F79A 5DX7A 4DO7A 2LLEA 1JXKA 2GDUA 3HGSA 4NX0A 4H7VA 1GVRA 2NV9A 9CGTA 1T8XA 1SMAA 1AG1O 3C0LA 1JFHA 4FZIA 1MRQA 3KL3A 2QJNA 3DYOA 1AODA 4ZQPA 3U7VA 4DNMA 4WY0B 3GIYA 3DYMA 3B8IA 1EOKA 4Z2HA 2V63A 4PC8A 2NQZA 2ZUNA 1E1EA 2Z6JA 3VNZA 2WC4A 2H9AA 4TV6A 2PWVA 1LOQA 2QPUA 3UG3A 3LBMA 3SUSA 1ZP3A 3GYCA 3B0UX 4TVCA 2QULA 3UJFA 3GAKA 1FHLA 1VFHA 3O0KA 3VABA 5JH1A 5AHIA 1H0IA 3UXKA 2VUNA 3MSYA 3CV7A 1WAWA 3WBXA 4POCA 1OD0A 3MVIA 4LALA 4JTUA 3HG4A 4JFTA 1PIGA 4Y8FA 2I1OA 3QN3A 4B90A 4GISA 1YW1A 2GUBA 2GQAA 4KT2A 5FF2A 1Q6CA 2GZXA 1RY8A 1CLXA 1TTIA 4GO8A 3MA8A 1RSCA 4JTCA 3VXGA 1JZ8A 1MZHA 4FSAA 4F0LA 4F0RA 4QAIA 1QNPA 2JEQA 4BHYA 1XL9A 1TKKA 2KAUC 1LWJA 4A2SA 4NZ4A 2CHOA 4FLOA 1ZAJA 4QQ3A 3KP1A 1K8ZA 1ISXA 2FJKA 4B9ZA 3VIGA 6XIAA 4NNAA 1D3CA 3G2GA 3VGBA 1IE7C 4AQLA 3TC6A 2PGRA 1GCYA 3B8TA 3GU9A 3KVLA 4AU0A 1TO3A 4AZ5A 3A5FA 2AMGA 3BAIA 3I7QA 2D0FA 4AVOA 5CKSA 3ANYA 3M7SA 2ACUA 1EJSC 4O12A 3LPFA 4NT0A 4G2DA 1P6CA 4Y9MA 3UD6A 1G67A 1ZBVA 1A5KC 5EFDA 4B5XA 5A8NA 3MVTA 2XVPA 4D6GA 3TIMA 3OTRA 5C2CA 1DJGA 1VRXA 3WLIA 3V7PA 4M5PA 3VNLA 1JL8A 2Y7GA 1OCNA 1YNPA 3PWIA 2DSZA 1KXQA 1GG1A 4Z2KA 5GJPA 3S5OA 3S42A 2POTA 4XKYA 1FUYA 3SCWA 2QJIA 5M2FX 3IK4A 5MKGA 4KPLA 2OVLA 4WDXA 5A2CA 3OYZA 1LP6A 1MVYA 3DHDA 3PJXA 3T2PA 3SQMA 4AZBA 2QCMA 3T44A 3VD9A 4EF9A 2DZUA 3I4EA 4DUWA 3ARWA 5E0CA 3AU2A 3QYSA 1UJQA 5HULA 2C1GA 3W26A 3LGGA 1SZEA 4O16A 1EO7A 1LDCA 2DV0A 2CCRA 3WQEA 5A8QA 1SMDA 2EPHA 4GNVA 3CPUA 1PHQA 1F9CA 4Q4RA 3GYEA 3H6OA 1OM0A 3OZYA 2HV5A 3NQBA 1QNSA 1Z6KA 2J9ZA 3VE7A 1YNYA 2WJEA 3IJ6A 5D37A 3FFSA 3BCJA 2J27A 4IJBA 4BCEA 4D8ZA 3HF3A 4JFWA 5EB8A 4WDUA 2PDUA 4B3KA 1XIIA 3M5VA 1KKOA 4DBWA 3W1RA 1AW1A 3RIKA 2CLKA 2QDDA 2VGBA 5I77A 4GVIA 4ZQRA 3QTPA 1PZ2A 3FXGA 4J3UA 4MJ4A 1L6WA 1FWHC 1WXYA 5D2TA 2YOCA 4PB5A 3VGGA 3DKLA 5BOOA 3CHDA 3KVMA 1AL7A 1ONRA 4WKAA 3FJ4A 6ENLA 3WJWA 1L8NA 5G4WA 1KXHA 1UIOA 2HJPA 2E3ZA 2QCLA 3V35A 2E09A 6A3HA 4AF0B 3OW1A 1K9TA 4PUMA 1IEQA 2ZKMX 3TVAA 1NWRA 1H09A 2Y8VA 1W9VA 5LIYX 3NURA 2DEPA 4NXKA 5HR6A 2WLZA 3L65A 4GXPA 1V4YA 3I6EA 1LG1A 2Y7DA 3IRSA 1A5UA 3FY1A 4ZXOA 2EPOA 2CYGA 4KWWA 2NXHA 3QMRA 2W4XA 2V5JA 2OZ8A 4PUDA 1TTQA 2OB3A 2X40A 4AZ7A 3GK0A 4R34A 1PSCA 4O10A 2ZA3A 4OKDA 2WK2A 4RJEA 1VS1A 2XM1A 1FHVA 3LRLA 1GVFA 4E3VA 3L68A 2REQB 4X22A 2BXYA 1U22A 4MZ8A 4RNHA 4JBRA 4X0NA 3M6DA 1S2VA 1TZ7A 1BKHA 2XH7A 2PDPA 3L12A 3KBSA 1XLMA 4HOXA 1H61A 1TX2A 3REQA 3E2QA 3H7RA 3A3HA 3AHTA 3N9KA 1TYGA 3HPSA 4C6EA 5I06A 1F6YA 1QOPA 2WKJA 2YL8A 2GGEA 3LBCA 2PSNA 3CEPA 3LDVA 4L9YA 3NZQA 2E8YA 3NGFA 4HA3A 4PTWA 4TOQA 1OCJA 4WX2A 2VRKA 1CIUA 5LXXA 2RJGA 1CTNA 2VEGA 2IPJA 3OG2A 1MI3A 2A5HA 4NVTA 1EJTC 4KGJA 4JTDA 3ZVHA 3SRDA 2OU4A 2B7PA 1TV7A 2BP1A 2BY0A 1GOQA 2ATSA 2NV2A 5A94A 3VD5A 1VFUA 3QMSA 4AY7A 1WZAA 2YPIA 3FNDA 3AXXA 4C6FA 2C8NA 3N25A 3WBYA 3VGDA 2QUVA 4L4PA 4QS5A 5G1MA 3DAQA 3ALFA 1M7PA 1CT5A 2CXEA 1BRLB 2AAMA 2HQAA 1POKA 2V5KA 2XH0A 3AXIA 2YXOA 1EGZA 3NQEA 1CGTA 3S9IA 3DERA 2W3ZA 1BF6A 1MRAA 2BS9A 1B3WA 2GQ9A 4NXSA 4YTQA 1OY0A 3NQAA 3OVPA 7ODCA 1E6NA 4DPQA 3LV5A 4XKMA 1E5JA 3C8NA 5T26A 1TJ2A 4J28A 4H9UA 4M19A 2MANA 1T8QA 1C3FA 3VDAA 4UTUA 4RL3A 2QUMA 2POZA 4C6DA 5ECVA 1K9DA 2DZXA 4IPNB 1MXGA 4KRTA 5HAOA 1I8JA 2OYMA 2Z6IA 3S1GA 3AMDA 2OXNA 3R12A 5SWUA 5EBAA 4A35A 1UOKA 5M17A 1OGSA 2ASHA 3Q2DA 1ECEA 3FEQA 1RPKA 4LW7A 1C92A 3A3WA 2HK1A 3QQWA 4DI9A 1NWSA 4UZUA 1VCFA 3QY6A 1T41A 2CW6A 4AYSA 5FEPA 2OELA 2PE4A 3AIBA 2VT0A 1E9ZB 1LBLA 4WSKA 3QMTA 3LHZA 1GVQA 1TQJA 2WM1A 5AC6A 1XHGA 3FV9A 3GG7A 2D69A 4OWGA 4XZWA 1ZJAA 2DH2A 3N2BA 3P2VA 4UXDA 3U4AA 1LROA 3HURA 3KDNA 2A7NA 2QXWA 4KGLA 4IMAA 2BHZA 4QLLA 3SM0A 4P2VA 4CU7A 1DOSA 4L4OA 1LL7A 1I1XA 5LNWA 1AUSL 3PN8A 2XIBA 4IGNA 3MSDA 5KEZA 2PDJA 2YKKA 3E0VA 2FZBA 4JEQA 3NEHA 1TX0A 4IUOA 2ODOA 3KVKA 1C8YA 3UPBA 3G1AA 1G4PA 3ID7A 3PZGA 2FDMA 4R85A 1WOBA 2ZXBA 3UG5A 1HW6A 1CGUA 1PTAA 4X63A 4NQ1A 4QX4A 4R27A 3C3NA 5DMNA 2ZQ0A 4NJHA 3IVUA 3LHTA 4CQAA 4DJEC 4C60A 1M5WA 5MF5A 1XM3A 1EJXC 4QLKA 1GG0A 2ZXAA 2X09A 2QCFA 1QMLA 4FOJA 3W2JA 2FZ9A 4WOZA 3WBEA 4M0XA 1TA3A 3S5ZA 1Q4WA 3FDKA 1XGDA 2DORA 4W5UA 3DEQA 3F03K 4I90A 1XYZA 2YCJA 3RR1A 1HKKA 1R3SA 1ZAHA 3GHTA 2WVVA 4FF7A 1N2VA 1WDPA 2YYUA 2HXUA 3AJ7A 1IEIA 1WOAA 1VFOA 2R1NA 5CZTA 2R14A 3WEZA 2BY2A 3WQWA 1VAHA 1ITCA 4UOZA 1IZCA 1VZWA 2JK2A 2ACSA 2DZVA 3H24A 4YPJA 1G9HA 1OFAA 2QCCA 4RDZA 3I65A 3B9AA 3N18A 3A3XA 1K03A 3VMPA 2ISWA 1GYNA 4FB7A 1DJHA 1CXHA 1EDQA 2ZC1A 3K1DA 4H8UA 3AXKA 2GVGA 1XQKA 1R3RA 3L4WA 5EKYA 3ZWTA 5DMMA 3FXYA 3WQ4A 1PXGA 2QCEA 3M1ZA 3BXWA 4B4FA 1ALDA 4LY4A 4FF5A 1IXNA 2HPIA 4B91A 4C1NB 4M56A 3S1WA 2RH9A 1GQKA 1RA5A 3RX2A 4IP4A 1NWUA 3S3GA 4Q8VA 1UMLA 3WENA 2G3MA 4FNTA 3CUFA 4ATLA 1EH9A 1SSGA 2XFYA 1ECQA 2PDFA 1GQNA 3CB8A 3T78A 5TD4A 3FX4A 2PDBA 4JHMA 1P7TA 1ENUA 4W5ZA 3OQ8A 1A4MA 2J75A 3WQVA 3VINA 4XAGA 3WL0A 4B15A 3T2QA 2R6OA 1A0EA 3OBEA 1REQA 4XBJA 5ABHA 3WUBA 1WPCA 4AMCA 1DXEA 2PWEA 3DFTA 1DIKA 3OYXA 3GW0A 3WQFA 1UP0A 1IHIA 1LL6A 2CHNA 4M6PA 4DBSA 2W66A 4QM1A 3ARYA 2E28A 1TRIA 2TSYA 3C8FA 4GABA 3HGJA 3KEHA 1DORA 3RPDA 5JBEA 3WFAA 3N2CA 4F8XA