1FH8A

Crystal structure of the xylanase cex with xylobiose-derived isofagomine inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,4-XYLANASE
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 128
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fh8A00
3FHQA 1HJXA 1ITXA 4U33A 1XCWA 3AHYA 4F8XA 4CU7A 1E3ZA 4AZBA 2CCRA 4QP0A 1OIMA 4PCTA 5ABFA 4J3SA 2IXVA 4N0RA 3OGVA 1MQRA 2VURA 2J4GA 1W2PA 4WKHA 3VIHA 1TG7A 4OUEA 1EH9A 3VIOA 2E40A 2WMGA 1C8XA 4AYSA 4BQ3A 1I75A 1JZ6A 1MXGA 1KWGA 1LWHA 5JBDA 2CETA 1BSIA 4J3UA 2WNWA 3LPFA 3VNYA 3CO4A 2JE8A 3CUGA 5BWFA 1H11A 1FP8A 3L2MA 1WKYA 3CH9A 2V5CA 4CCDA 4AD3A 5CQ1A 1EOKA 1JD7A 3WDHA 2ZX7A 2V3DA 4Z2KA 1X6NA 3VIJA 4U5IA 4U5KA 4HA3A 1Q4NX 5M03A 2DIEA 3WFZA 2E8YA 3TA9A 2V3EA 1EDQA 4CD7A 5EMYA 1JXJA 3TP4A 4FLRA 1ZU8A 2JALA 3A4AA 3B9DA 3VPLA 2W67A 2HVMA 1UWRA 2DDXA 1NWRA 5A6AA 5BCAA 2PWFA 1WDSA 3M07A 1BVZA 2EBNA 2VCCA 2XM2A 2DGAA 4AZCB 2D22A 2WLYA 1R8LA 3PZVA 3VD7A 1GUVA 4D71A 3AZRA 1E56A 1JYWA 4V28A 4UQBA 4W85A 5CLWA 1JZ5A 3L4VA 3ZIZA 1I1XA 1QVBA 4W8BA 4M81A 1GOWA 1NH6A 1TUXA 1C3FA 3U7BA 1LLOA 3K8KA 3CMJA 4DWSA 3AIQA 4U31A 3PZMA 1CDGA 3RJYA 1E5NA 5LA1A 1E3XA 1X1NA 4MNLA 3WF0A 2WZEA 3NIYA 1GVIA 3AI0A 1VEPA 1EHNA 4XB3A 1GORA 1WDRA 1HT6A 1KBBA 3WF3A 3WUEA 1AQHA 1FFQA 1E0XA 4W7VA 3RM8A 2XGIA 3U5UA 1G0CA 1KB3A 4UOJA 1WAWA 3AQUA 2CHOA 1WZAA 1UD5A 3OLDA 3I3EA 4HOZA 4ACZA 2VZSA 3T2OA 3CGTA 2G41A 3PHAA 3OB8A 3GTNA 1OINA 2XYLA 2BXYA 3ZT5A 1H41A 3OIHA 1DEDA 1FHDA 4C7GA 3NCOA 2GSJA 4NSBA 3AMKA 4HA4A 6CGTA 5I5RA 1BFNA 1EOMA 3K1DA 1UG6A 1UR8A 1Q6GA 3B9EA 4B9ZA 1UWTA 2QPUA 4MTVA 3THDA 2ZWYA 3DYOA 1XGZA 1NOFA 2VI0A 1UOKA 1HP5A 1VIWA 1XV8A 4CD5A 3WQVA 1QNPA 4GI6A 2WM0A 3AHTA 1CXIA 4BZYA 3GXMA 1VB9A 1JDDA 3T0AA 1Q6DA 3NDZA 5GNYA 3VGGA 5A95A 4B15A 4M82A 1E4MM 2ZUMA 3QR3A 1V3MA 5D9PA 1ODUA 2YL6A 2WVVA 2CIPA 3WDPP 5M3WA 3T09A 1IZJA 4PMRA 3BAYA 1VJSA 3SCSA 3WH5A 5AC4A 2AMGA 1LWJA 1UR4A 3ARPA 4JCLA 2D1ZA 3CUHA 1G01A 4ACYA 4A3YA 2WBKA 3U5YA 4P8WA 1EO5A 4UQ9A 4JFWA 3ARQA 4X0VA 3UR8A 4J3XA 3VX1A 1CENA 1O7AA 2G3JA 2OWWA 3ZJ6A 3SUTA 2W66A 4E4PA 1FOBA 4OKDA 3KZSA 3WFLA 2C8NA 4PMXA 5A2CA 1SR0A 2UWFA 1HKKA 3AIUA 3PTQA 5DFAA 4W5ZA 4QLJA 1J0HA 1QNRA 1GVYA 3FAXA 5E9AA 1OD8A 2VQTA 1CXLA 3FHAA 3VDAA 2PB1A 3THCA 3GZAA 1ISZA 4V2XA 4AEEA 1EO7A 3BCDA 1HL9A 1VFOA 1DWFM 4Z2HA 2WB5A 1H1NA 2MANA 1PX4A 3MSDA 4KMQA 1GOKA 4ACZB 1UHVA 4PTXA 4V27A 1UWIA 4MNJA 2YL9A 2X0HA 1W1VA 1UUQA 2WCSA 1W9XA 1XHGA 3ARXA 1S46A 3ZSTA 2YLLA 3S6TA 3AMLA 2FHFA 1LQ0A 3LPGA 1TVPA 2VR4A 4UZSA 4PRWA 5A2AA 5KZ6A 1GQIA 4DUWA 1H3GA 4TTGA 4GO8A 2W61A 3CUFA 4CD6A 3BXWA 3GYCA 2XIIA 2WMHA 4JL1A 4QAWA 4MB4A 1FHLA 2ZXDA 4E2OA 3J7HA 3BMWA 4R27A 4IPLA 4P7RA 3CHDA 5D4YA 3SCNA 3SUWA 3W25A 4W7WA 3G6MA 2Y5EA 3PZUA 3FY1A 3ZSSA 3GH5A 1JNDA 3ZO9A 1BPLB 2HISA 2WMIA 5BXSA 1LJYA 1ZS2A 1WNOA 3O6AA 4OOZA 3AHZA 1OSEA 2FHBA 2WVVB 4PN2A 3PZGA 1FA2A 1E4LA 1TZ7A 3N04A 3WH6A 2VX5A 3ZR6A 3SUUA 2BVTA 2JEQA 2WBGA 2ZOXA 2QLYA 2YA1A 4FLSA 2WMFA 1DHKA 1AVAA 3L2LA 4NRSA 3I3DA 2DQXA 4J7RA 2EPOA 1UR2A 2GJRA 3WD2A 1VFUA 3D3AA 3TOPA 4CVUA 2A3AA 3EDEA 1IV8A 3BSGA 3MANA 4ZENA 4RL3A 4BF7A 3BAXA 1ZBVA 3VVGA 2XVGA 3EYPA 3RPMA 4W5UA 1UD6A 1XYFA 2OSXA 1CNVA 1WDQA 4C7FA 2WPGA 2OLHA 6A3HA 1JFHA 3HMCA 4D6GA 1W9PA 3EDJA 5DO8A 3DYMA 1FH8A 1DWAM 5HXMA 3APGA 1BGAA 1OWQA 2J8GA 1LL7A 4GIAA 1H2JA 1HKIA 3ZR5A 3ZMRA 1SFSA 3WENA 5E09A 4D6FA 1CLXA 1SMAA 3AFBA 8CGTA 4GZEA 2E0PA 1CPUA 5CPTA 4AWEA 1QBBA 5BXRA 1B3YA 3FAWA 2WHMA 2RGLA 2QMJA 1W9VA 5A6LA 3WDJA 4JFUA 3W29A 4U3CA 3WH7A 2UY4A 2WZIA 3W38A 4UOZA 2CKSA 1C90A 1J0KA 1CECA 2VC9A 2WC7A 2XFFA 2YDSA 5TD4A 3PZNA 2CESA 5A69A 4TX8A 4D6CA 3OZOA 1MFVA 4GO9A 4WKAA 2DT0A 3VNZA 1PZ3A 2RGMA 3MSGA 1UR9A 2VT0A 2VUYA 1CGVA 1F4AA 4U2YA 2ZUTA 5AC5A 2XVKA 1E4NA 2BY2A 1B31A 1B1YA 4W93A 4MAVA 3I3BA 2J62A 1DWGM 2XWEA 3AXXA 1YQ2A 2IXUA 1QHOA 2BS9A 1E1EA 1EXPA 4ZXOA 4W86A 1JF6A 2WZHA 1OGSA 1E72M 1PAMA 2W92A 4UZUA 2B31A 1D3CA 1XSKA 2D0FA 4TVCA 2A3HA 3FXYA 1NOWA 4LX4A 4H8VA 4GQRA 4HOXA 3AHXA 2J7FA 3SCOA 5EBAA 5EFDA 1J01A 1W1TA 2FGLA 3GH4A 2PC8A 4YN5A 1Q6EA 2J25A 3SCTA 4H04A 3VDHA 5A2BA 2OSYA 3AS1A 1CTNA 1G1YA 1HKMA 2GJPA 1E43A 5BROA 1J11A 1TE1A 2Z1SA 1E0WA 2F61A 3VMPA 2BHZA 1HXJA 3DC0A 3OZPA 2QHAA 3FN9A 3WD1A 1VJZA 3AJ7A 4WIWA 5ABHA 3WQ6A 1NM9A 1B2YA 1MWOA 4B9YA 3ARWA 2PBGA 1IT0A 5A8NA 2V3GA 3VM7A 2VX6A 3UG3A 4WK9A 1HP4A 4TVDA 3CUIA 2VVSA 1GJUA 2J8FA 1E1FA 4WF7A 3RMEA 1UD3A 1TFVA 2GK1A 2PWHA 2D20A 4M29A 4P8VA 3AS3A 4CGTA 1HIZA 1JG9A 3RDKA 1RPKA 3CHCA 2BXZA 1BG4A 1MYRA 1JI1A 2YBTA 2Q8XA 3T2PA 3UG4A 4U3AA 2WAGA 3HU7A 4AZ5A 5A94A 3AYRA 3WH8A 1GJWA 3WF1A 4EKJA 3MKKA 1WE5A 2W63A 1V0LA 3UETA 4CU8A 5ABGA 4AISA 3MV11 4ML4A 1C7TA 1L8NA 2CPUA 3GBDA 2VMFA 4RE2A 1VBUA 3EBVA 4E8DA 1E6RA 1C93A 4Q7NA 2C7FA 3K8MA 2D3LA 3W0KA 8A3HA 3W24A 1UA3A 3QHNA 2BY0A 2GJXB 1DWHM 4JFVA 3NSNA 3SCRA 2EO7A 1XH1A 1GOIA 1R7AA 3WMCA 1OGBA 3QOKA 3CZGA 1XD0A 1QI5A 1BTCA 1OB0A 3WY1A 1WCGA 1ISXA 2OYMA 2JFEX 4FK9A 3AMCA 5A6JA 2DSKA 1U30A 1VEMA 4UFLA 4KRUA 1W9DM 3KL0A 1C7SA 3II1A 3VIPA 3EMZA 3CPUA 4W89A 3IK2A 2GVYA 5GNXA 7CGTA 3ZQ9A 4UQDA 4OIFA 2C0HA 4HP5A 4D6JA 3BLPX 1W3KA 4CUCA 2PWEA 2UY2A 2ZXQA 1C8YA 1R85A 3NUKA 3WDRA 1M03A 1V6XA 3MMUA 3ZT6A 3MUIA 2XUCA 3CBWA 1XYZA 4AY1A 3A4WA 2X09A 4XZWA 1KR0A 1E9LA 1K9EA 3WBAA 4BQ4A 4PTVA 3DHUA 1PEZA 4UQEA 3VIGA 3W27A 2XIBA 1HNYA 3CZKA 4M80A 4W88A 4MDPA 1JZ4A 4H41A 1E55A 3S2CA 2ZICA 2DEPA 1WP6A 1OT1A 4MB1A 1V0MA 4IISA 1B30A 2WVTA 1PX8A 4AD0A 3ARSA 4CVWA 4H7VA 1VAHA 3VINA 2J47A 4L4PA 1J9YA 1Q6CA 3ZJ8A 4PSPA 4HPGA 2WC4A 2ZUVA 3WSUA 2G3NA 1HN1A 4AIOA 1K6AA 1UKSA 2GDVA 2IUZA 4LPCA 5JIPA 3PZTA 4HOWA 3LPPA 2NSXA 4MJ4A 3W26A 5ABFB 3VD5A 1NARA 5E6ZA 3CUJA 1R7OA 4QCFA 3TTSA 4MNMA 3VIIA 2Y8VA 2BNJA 3EDFA 2J75A 4PBGA 1U33A 3GNPA 4PMQA 2CBJA 5C71A 1E0VA 1LG2A 4M56A 2J7DA 1V6VA 2ZWZA 5F7UA 4DM1A 5IHSA 2DSUA 3W82A 1KQYA 3W6MA 4UQAA 3KL3A 1JZ3A 2O9RA 1D2KA 4NRRA 1JDAA 3POHA 3CZLA 3WUBA 3SCVA 3PZOA 2Y8KA 5CZKA 4B3KA 1G9HA 1KBKA 3PN8A 2VL4A 4YPJA 1NOUA 4FLQA 1J0ZA 2WXDM 4YHGA 1TCMA 4RE4A 4CD4A 3RIKA 2DSVA 1JAEA 3MV01 2QF8A 4AD2A 3CHEA 4PMVA 4LYQA 3BLKA 5FOOA 2WCAA 1EA9C 1KGXA 2XFYA 2DSWA 4UR9A 5HPCA 3VMOA 4ATLA 1JAKA 1KGWA 1WB0A 3WQ8A 5A8PA 3HN3A 1CWYA 1JYVA 3N12A 1JI2A 1U2YA 1B3XA 1JXKA 2OYKA 4PEEA 1X6LA 1CXHA 4UFKA 4EE9A 3A4XA 3U7VA 1WPCA 5E6YA 3WIJA 1C92A 3VMNA 4DWSB 2W91A 3HJEA 4ZXLA 1ZBCA 2OYLA 2VRKA 3WF2A 2YIHA 4LXFA 4HZ7A 1R86A 1PX3A 1BLIA 1UWQA 4MB5A 2EPMX 3WNPA 4AW7A 2ZIDA 4QCEA 3F5JA 2VZTA 3MUAA 1VENA 5D9OA 3AROA 4CKQA 1XCXA 1W9UA 4LYPA 4M1RA 5CJ5A 5BRQA 5ABEA 1CXKA 1CZ1A 1KXQA 1V0KA 5EFFA 1V3LA 1HJSA 4D1JA 1MW0A 3F4VA 5HOSA 2D2OA 1WZLA 4PUDA 4OBRA 3QGVA 1EQPA 1SYTA 4NZCA 2ZE0A 3K4AA 1JL8A 1MW3A 1VF8A 3ARVA 4YHEA 5GNZA 2D24A 3OBAA 4TVUA 5BXTA 3MUZ1 2V5DA 1XSIA 2VR5A 3ZJ7A 4AC1X 1JZ8A 5EB8A 2PI6A 5LYRA 1V3IA 4ZE5A 1VEOA 5A6BD 4D1IA 4NF7A 4BCEA 1W1PA 1XC6A 1N82A 1CGWA 4H2CA 1OCQA 1XRVA 3WEZA 2JIWA 3AZSA 5LA2A 1UH3A 4KRTA 1E15A 3AXHA 4FF5A 1V6WA 1E71M 1A47A 3ALGA 3VIKA 2DPEA 1DP0A 2BY1A 2G8ZA 3AS2A 3T2QA 2WMKA 3PZQA 1HKJA 1KXTA 1QHPA 1NWSA 4PMZA 4UNIA 1V02A 1FH7A 4JZ5A 3M6DA 1UH4A 4F9JA 4HA1A 3WKZA 2XVPA 3GNRA 2CITA 1KFWA 3DYPA 5I78A 2YA0A 3BH4A 2Y4SA 3AIVA 3U57A 4UFMA 4MB3A 1E6ZA 2GDUA 3AIRA 1BQCA 3G6LA 1JYNA 1KQZA 1HL8A 1M53A 3AISA 1E6QM 1GOOA 3WEOA 2Z1KA 2ZUWA 4P7QA 3WQ4A 5E70A 5IDIA 2ZX5A 5JUVA 3W28A 2XSAA 1E6NA 4HU8A 4OBSA 4FLOA 5DMYA 3WDQA 3KE0A 2YA2A 3RO8A 2BVDA 5I2UA 1OGGA 1E5JA 2O9PA 5FL1A 3W37A 1VRXA 2NT0A 2VQUA 4AZIA 5ECUA 1GPFA 3LPOA 3OLEA 1JNEA 4J3WA 3CZ8A 3W53A 3GH7A 3OA5A 2X8RA 1GQKA 3VGDA 4GINA 2NW0A 4J27A 4HMDA 2BHUA 3L4XA 2XTKA 1K9TA 4WLCA 3N18A 3F5LA 1UZ4A 2FDMA 2CBUA 2JF7A 2WKLA 1SMDA 1FP9A 1H0IA 3SUSA 3WH9A 2VX4A 5LA0A 1V3JA 4Z2IA 1HX0A 3VD4A 1BG9A 3CHFA 4U2ZA 3IANA 4ZEPA 4D72A 1PIGA 2OWXA 1IZKA 2WVUA 3AXIA 4QFUA 4JKKA 2ESCA 4MDOA 3BCFA 3UEQA 3WUGA 1LG1A 3CZJA 4WKFA 4CD8A 3VM5A 1US2A 3GDBA 2WMIB 3WBEA 5D9MA 2BY3A 2XM1A 1XD1A 3AIEA 4Y7EA 9CGTA 3IJ9A 3VILA 1MFUA 2VCAA 2E8ZA 3QHOA 1UR0A 1V3HA 1GZJA 3N11A 2O9OA 2EPNA 3BAIA 5DEZA 4F66A 5I79A 2BHYA 3OGRA 1UKQA 2VX7A 2W4XA 2WC3A 5I24A 5BXPA 2PBOA 2V38A 5BRPA 1B3ZA 2CKRA 3PBGA 5CPQA 4P8XA 1AQMA 3ZM8A 5JBEA 3RJXA 4GQQA 4QLKA 4JCMA 2OSWA 2AAAA 4ATWA 4IM4A 1W3JA 1EDGA 4EANA 1P6WA 3O2LA 1WZKA 5CSYA 1OT2A 1QI2A 4MADA 2J7HA 1RH9A 4DUVA 4JKLA 2YKKA 1W3LA 3VDBA 4DWSD 2A3EA 2VNCA 2EQDA 4B3LA 1J12A 1WZMA 1UD8A 2WK2A 4KWUA 2TAAA 5I3DA 1W91A 1ISWA 1PJ9A 2X05A 3ZT7A 3VD9A 1BYDA 1PIFA 4AZGA 4CCCA 2BV9A 3N1AA 3AMGA 3IJ7A 3UCQA 1UD2A 5GQBA 3NSXA 4GI9A 4AZ6A 1UA7A 2CNCA 1QI3A 2VVNA 3MMDA 2V3FA 4S3KA 4UOQA 1HVXA 1UKOA 4PUEA 5D8WA 1UD4A 3T0DA 3RILA 1OBAA 3WMBA 3BAWA 4D6HA 2CXGA 4K68A 1JZ7A 4BQ5A 4JKMA 4S3JA 1JGIA 3CLWA 4R5EA 4OOUA 3IAPA 2DIJA 1KCKA 1M7XA 1ZL1A 1M04A 1GHRA 2ZUSA 4Q22A 3VX0A 3KL5A 1BGGA 5FCZA 2EEXA 1O6IA 4UFIA 4W8AA 2E9MA 5I23A 2FHCA 1CYGA 4PMYA 1BAGA 2X2YA 2EPKX 3VGBA 1LL6A 1W1YA 4GPNA 2D0GA 3EDKA 4TOQA 1V02E 1QI0A 2X1IA 2Y24A 5AY7A 5GPRA 4JL2A 4E8CA 2D3NA 3WMSA 1ZB5A 4X0NA 4MAZA 1I1WA 1EHAA 3MUY1 4XV0A 3AYSA 1BYCA 3L4YA 3SCUA 1CGUA 1M01A 2DT1A 1Y7VA 1F4HA 3PTMA 4CN4A 1UR1A 4GKLA 3OGSA 2F8QA 3IAQA 5CLTA 2PF0A 1ZJBA 3VTRA 3NYDA 1E6PA 1B3WA 4EK7A 4C7DA 2YBUA 3M46A 4DM2A 3VGFA 1XH2A 2CYGA 1GQJA 1KXVA 4GI8A 4PTWA 1JDCA 1NWUA 3B9AA 2ZX9A 2WHLA 1NWTA 4J3TA 2J7BA 1H4PA 3NSMA 4HZ8A 1VFFA 2VRJA 4UTFA 2XFRA 1EGZA 2CHNA 4QLLA 4PTMA 2GK1B 3AIBA 5JIWA 1TVNA 1GHSA 1GONA 4HMEA 3WL0A 2WCGA 3SCPA 4BQ2A 3CZEA 5DT7A 4CCEA 4D6IA 4MJ2A 1V03A 4PCSA 2AOSA 4J28A 3F5KA 1KWKA 1E6XM 3O9NA 1QNQA 1K9DA 1NP2A 4AD5A 2YL5A 5CXPA 3K4DA 4PMNA 2VZOA 1UH2A 4KGLA 4A3HA 4N42A 3A6OA 2E9LA 5IXEA 4RE3A 1PBGA 1YHTA 4P7OA 2D23A 3NDYA 2O92A 2CEQA 3ARYA 4UFHA 3CTTA 3AHVA 1KCLA 4LYRA 2WANA 4JFSA 3GXDA 3E1F1 1CXEA 1QOXA 1CGXA 3T0BA 1DWIM 4M8UA 5FIPA 1A3HA 3M7SA 3VDCA 2DH2A 2YLAA 4HMCA 4PMUA 1HF6A 3N9KA 4TX6A 2VRQA 5D8ZA 2ZX8A 3WDIA 3ALFA 5CPSA 1MQQA 2DT3A 4AZ7A 3KWXA 2W62A 1JYXA 4GXPA 4ZE4A 4AD1A 1MXDA 3MS8A 3TTOA 2DT2A 1GNXA 3A47A 3L4UA 5FL0A 1UKPA 4AD4A 3WNLA 3VU2A 2WLZA 3MMWA 3SCWA 4Z2LA 1BYAA 1TR1A 2WSPA 3ZJKA 3W6LA 3GXIA 1KR1A 2JF6A 1MW1A 3SIMA 3SEPA 5A1AA 4B16A 3WNOA 1W3HA 3FNDA 1ECEA 3W81A 3FW6A 4F79A 1E6SM 1HJWA 3WNMA 1B90A 5JBFA 1GQLA 3N13A 2VCBA 2J78A 5A6KA 4OZOA 4A4AA 3DHPA 1PZ2A 2XHYA 1V3KA 3L4ZA 3W4RA 1BF2A 3PTKA 3EMQA 4Z2GA 4GZJA 4UCFA 1C91A 1B0IA 4BS0A 3WNKA 2QV4A 1H49A 1UKTA 1MQPA 2WYSA 5CGMA 2WSKA 1E70M 3VOCA 3WELA 3D5HA 5AYBA 3AOFA 2WMJA 3OLGA 5CG0A 3UESA 1OIFA 1JIBA 1CIUA 2O9TA 4URIA 5A6MA 4TXEA 5A8OA 1EQCA 3CMGA 1TA3A 3NJ3A 6TAAA 7A3HA 3GBEA 3WUFA 2EJ1A 2GUYA 4CU6A 3RCNA 3GNOA 5HDRA 3SCQA 5I77A 1UQYA 3ARZA 4M24A 4KH2A 1GCYA 1RD6A 4CN1A 4GZIA 5I6SA 1V08A 2X0YA 1QW9A 4Z2JA 2PWGA 1HJUA 1NQ6A 1QPKA 1ZBKA 2XWDA 3VUPA 3WQWA 5HPOA 3AMDA 3LMYA 4ZFMA 4P7NA 4HTYA 4PSRA 3VIFA 1GOQA 3BMVA 4BA0A 1UWSA 4JIEA 1OD0A 2ZUUA 3WD3A 3BSHA 3TTYA 4L4OA 1V6UA 1FH9A 3OLIA 4UQCA 2OWCA 2FH6A 2EXOA 2VTFA 3GXFA 1GOMA 1FFRA 2CBIA 4JAWA 3BAKA 2JIEA 1CLVA 5HNNA 2W5FA 4H8UA 2VZVA 1J0YA 4F9DA 3IJ8A 4OJYA 4AIUA 2D0HA 5D9NA 1MW2A 4MPKA 5BYWA 2BVYA 2J7EA 3BGAA 1JF5A 5A8MA 5C8BB 2A3BA 3ARRA 3KEHA 2WKGA 3JUGA 3QOMA 1K9FA 4AMCA 5FKYA 4AIEA 1CEOA 3MO4A 4W8LA 3DECA 1J10A 2FGZA 3CIVA 3BC9A 2XVLA 3AS0A 2E9BA 1QBAA 5CGTA 2G3MA 4PYSA 1VBRA 3ZOAA 1DTUA 1HJQA 2J7GA 3N15A 4AEFA 1LF1A 1XH0A 1ODZA 1Q6FA 2WW5A 2BFGA 4HU0A 1V6YA 3SUVA 4EAMA 1EIBA 2G3IA 1CGTA 5C70A 7TAAA 4WJXA 1HVQA 1WDPA 1XSJA 2WHJA 4JHOA 1UZ1A 5A6SA 2E3ZA 1W32A 2XPKA 1RP9A 2VO5A 1PPIA 2E4TA 1OM0A 3L4TA 3PZIA 2XSBA 1TA3B 1JFXA 1L0PA 5HBFA 1DWJM 1QW8A 2CBVA 1H5VA 2QMKA 2CERA 2PWDA 5A3HA 1QI4A 4TUFA 1JZ2A 3TONA 4NI3A 1ITCA 3L4WA 2J74A 1QHZA 4W7UA 3VKKA 3TTQA 2YOCA 3SURA 3AZTA 4H8HA 1EDTA 1LL4A 1RP8A 1Z32X 1B9ZA 1US3A 2A3CA 4X9YA 5M17A 4KGJA 2ZX6A 4UFJA 5IHRA 3VIMA 4AZHA 1CBGA 4LGXA 3ARUA 1TMQA 1ESWA 5IFTA 4HPHA 3UERA 4PMDA 2VOTA 5KEZA 1ISVA 1UQZA 2DSZA 4TTUA 1G94A 1KXHA 4QDMA 1C8QA 5IFPA 4DWSC 3VGEA 3WN6A 3WD0A 2WHKA 1CXFA 2GJXA 2XJ7A 3N17A 3WD4A 4W87A 2YDQA 4AXNA 2VJXA 5A6BA 2XG9A 5E0CA 2XVNA 1QNOA 2J77A 2ZXAA 4ATDA 3WNNA 3RM4A 2YDRA 1CGYA 3WEMA 1V0NA 3WL1A 5A8QA 2VZUA 5DF0A 3QHMA 5AYIA 2J79A 1BVNP 1NP0A 4LQ1A 2UY3A 3POCA 2WWDA 3VO0A 3UR7A 5CSUA 2UY5A 3PZ9A 1J0IA 2DH3A 1G5AA 1ZBWA 2F2HA 2GFTA 2ZUNA 2G4FA 1AQ0A 1HJVA 1ISYA 1E4IA 4D6EA 2ZXBA 1D7FA 3WQ5A 2YL8A 5DT5A 1J18A 4AZCA 4WSKA 2J7CA 1H0GA 3EDDA 4WSJA 3AICA 1WO2A 5FD0A 1R87A 3K46A 1AMYA 1BHGA 2NT1A 3BAJA 1QNSA 4MNKA 4P8UA 2WWCA 1KGUA 4W84A 2WVSA 3GM8A 4IUGA 1UYQA 4CN6A 3RM9A 1W2VA 1J0JA 4P7LA 3EMCA 1H09A 4J3VA 1E40A 2EPLX 2XGBA 4DUXA 4XX6A 3ECQA 1UWUA 3MU7A 5I0DA 2Y2WA 3AIWA 3WF4A 5M5DA 3T08A 4XZBA 4PMOA 4XUYA 1JD9A 4JHZA 3VGHA 3A3HA 1E73M 3ARTA 4FMVA 1MVYA 1BYBA 2QPSA 4HZ6A 3VD3A 3OG2A 3B8SA 2JEPA 1W9BM 5E0FA 1ZJAA 1GW1A 1VFMA 4JFTA 1B3VA 3UG5A 2FH8A 4D6DA 3K8LA 4IPNB 2YJQA
chains in the Genus database with same CATH superfamily
1E1CA 3WLSA 4JQ1A 5FJJA 3VOFA 1V4YA 3KRSA 2Z1XA 5ABFA 3LLDA 2BB0A 3QZAA 4G7EB 4XZIA 3LGDA 2C16A 3ES7A 5FAGA 1U22A 1Z44A 3VIOA 2J9XA 3HPFA 4AYSA 1JZ6A 1MXGA 4FZIA 5JBDA 3TOYA 4MKSA 1PIIA 1VFSA 5D02A 4O53A 3VNYA 1W5PA 2JE8A 2ABAA 3CUGA 1H11A 5K7JA 2D69A 3LM3A 2ZX7A 5FF2A 2PDHA 1A53A 2YCKX 2ZZ4A 3VIJA 3TAKA 4U5IA 1S2CA 1J6PA 3CQIA 3WFZA 3RK8A 3C0JA 1RCQA 3S5NA 4FLRA 2JALA 3B9DA 3VPLA 1I2OA 2PP0A 2W67A 4HU3A 1UWRA 3ZVHB 3FK4A 3N19B 2DDXA 1NWRA 3PJUA 4H4IA 2EBNA 2VCCA 2XM2A 2DGAA 4DJDD 1O5XA 3PZVA 3M0HA 1E56A 4W85A 5CLWA 3L4VA 4S3FA 4INFA 4EF9A 4PR4A 5KZEA 2QDGA 3MW7A 1GOWA 1Q65A 3PVFA 1DV7A 1LLOA 1WKDA 4PL1A 2I14A 3CMJA 1R9ZA 5IBXC 1X1NA 1OFEA 2WZEA 4GYPC 5C54A 1OX6A 1EHNA 2HTMA 4C1KA 1WDRA 3WF3A 2Y61A 4NL1A 3W1XA 1VJIA 5DY3A 4UOJA 3AQUA 5HMDA 3MC5A 4QS6A 4HOZA 4H6RA 4W9TA 3SGZA 3OB8A 1XLCA 1E1CB 3MZNA 3UFYA 1FQ0A 1H41A 3SM0A 2ABBA 4RXGA 2EG8A 3I4EA 1DIEA 4R3UA 4O18A 4HA4A 1MDLA 3K1DA 1UG6A 2R1KA 1ICQA 3BJFA 3REQA 2ZWYA 2CZVA 4H19A 4NJIA 1CB7B 1OFDA 4JIRA 4WX2A 2VI0A 4GVHA 1XV8A 1F74A 4Q8VA 5EPDA 1AD1A 3STEA 4IFOA 1RSCA 4C5ZA 1JDDA 4TR9A 4Q6XA 5GNYA 3GE7A 1WV2A 4JGDA 2RDWA 3E5BA 1KCXA 1RUSA 4B15A 3QR3A 1ODUA 2WVVA 9XIAA 1YW1A 4IL0A 3BAYA 3SCSA 3WH5A 1LWJA 5DX7A 3ZZ1A 2D1ZA 4IJBA 4K6AA 3W87A 4A3YA 3F7JA 2Y70A 1FWBC 4L9ZA 3M5ZA 4JY8A 1SO6A 4X0VA 3SECA 4RV8A 4J3XA 1O7AA 4TMBA 1FOBA 3B0XA 2HRWA 4DF1A 1DJXA 1GOXA 1KM6A 2C8NA 4PMXA 1LYXA 1SR0A 2IPFA 3PB0A 3GXNA 3QTPA 4NAEB 1RV8A 1GVYA 1XLMA 1T0OA 3MHFA 4O52A 3NWRA 2VXNA 3M0JA 3PB2A 3NL3A 1OD8A 2FMOA 2VQTA 4E4FA 2QW5A 1FVPA 1Y5VA 1C8VA 2O4QA 3ABZA 4V2XA 3BCDA 1TB3A 2QDHA 4I5UA 3T0TA 1JR1A 3V5OA 2MANA 3BZJA 4KQNA 2ZDRA 2VFGA 5CBBA 4AVOA 1OG6A 1T6MA 2YL9A 2O7SA 2X0HA 5T9BG 2WCSA 4Y96A 4Q8UA 2H9AA 5LHEA 1W9XA 1S46A 3URBA 3K2GA 5LNSA 1LQ0A 3HJZA 4XKYA 4UZSA 2Y1HA 4PRWA 2BLEA 5A2AA 3L0NA 5KZ6A 3FYOA 4WSHA 4HYVA 3EX4A 5BNKA 4GA8A 3REQB 1S5TA 3CUFA 3W7EA 4E2VA 1JEZA 2HV5A 4TX9A 1PKNA 3F2BA 4EP8C 3GYCA 1K7EA 2NX1A 4MB4A 4YWIA 3BPWA 4MVAA 4R27A 5AYYA 3C2FA 3SCNA 5FJOA 1UROA 2BG5A 4DN1A 3PZUA 4FF7A 2Z26A 4PCPA 3ZSSA 3GH5A 4GNJA 1XQKA 1JNDA 5CZJA 3ZO9A 4UTHA 1LJYA 1UCWA 1WNOA 3O6AA 1NF7A 3LENA 3HPAA 4RW5A 4S1FA 2HBVA 4LAZA 3GU2A 5G5IA 2WVVB 5IM51 3PZGA 3N04A 4Q4QA 2VX5A 4GABA 4IMFA 2JEQA 4YYCA 2QLYA 4YVVA 2WMFA 1LRNA 1A5SA 1H7OA 3I3DA 4WJEA 2ZC8A 3D3AA 2ZYFA 4IGMA 2A3AA 3L21A 1IV8A 3BSGA 2OEKA 3QR1A 3U2OA 1HW6A 3NA8A 4GX8A 1ZBVA 1OC6A 1FWCC 4MZYA 4DLFA 1UD6A 3ANUA 3Q67A 1WDQA 2WPGA 3EX3A 6A3HA 4WGXA 1JFHA 1W9PA 5DO8A 1A5MC 1XG3A 2IKJA 1WXYA 2PE4A 2J8GA 3GHTA 2BGSA 4KT2A 3FSUA 1OYBA 5HWNA 1SFJA 4JQ2A 3OVPA 3PANA 1LP6A 4GIRA 1UPPA 4AWSA 4ERAA 3QR0A 3M64A 4UTKA 4ASTA 1B9BA 1DVJA 1CPUA 4AWEA 1Q7MA 5BXRA 4BEUA 4JIQA 1QPOA 3R6IA 3QKEA 4DXKA 2C0AA 3UG8A 3YPIA 1EYEA 4CQ8A 3W29A 4FALA 3G77A 1XL9A 1EUAA 2WZIA 1OX4A 2H9AB 3AU6A 3LDVA 2PMQA 2CLIA 4IQDA 2L5HA 2VC9A 2WC7A 3PZNA 5REQB 1Q3NA 5DY2A 3P2VA 4XKYB 2Q01A 3STPA 1SW3A 3HIJA 2VUYA 1PCKA 1CGVA 1F4AA 5AC5A 3HMJG 4G1NA 4W93A 4MAVA 3PTDA 1DWGM 3AXXA 1XUZA 5DCEA 1QHOA 1N7KA 1XRFA 3B4YA 3FSTA 2R1PA 1JF6A 4LAUA 4C6FA 1UR3M 4EIVA 2D0FA 4FOJA 1QWGA 4RPPA 3W22A 1NOWA 4GQRA 4HOXA 2ISSA 3SCOA 3NVTA 5EBAA 5EFDA 2ZRXA 3GH4A 2DVTA 2J25A 1FWWA 3VDHA 2Y62A 4GHRA 2OSYA 3Q45A 4GYJA 5K9CA 2CLOA 1E43A 5LNWA 5BROA 1J11A 2Z1SA 1BWLA 3VMPA 3WLQA 5K4ZA 3DC0A 3GZ3A 2NQHA 1TJ0A 2WM1A 2P10A 1BD0A 2CZDA 1MWOA 3I7RA 2FVLA 4LUIA 1VPXA 4CNOA 1DIKA 1US0A 4OECA 1HO4A 2PBGA 3RR1A 3CHVA 2V3GA 1PTAA 3UG3A 4WK9A 4Y8FA 3I65A 2GGGA 4TVDA 2VVSA 2J8FA 3RMEA 4DF0A 2MNRA 2GK1A 3GTHA 2D20A 4HT3A 4M29A 1KRCC 3W1RA 1B4KA 1FKWA 1GTEA 2VEIA 1XDLA 1QRQA 4CGTA 3OVGA 4G5DA 1JG9A 2H3DA 5BOOA 3CHCA 1QPRA 1BG4A 5KETA 1MYRA 3WLKX 3D6NA 1JI1A 3S46A 3UWZA 1FDYA 3T2PA 6PTDA 4AZ5A 5A94A 3WH8A 3EB2A 1KM5A 4EOUA 3E0IA 2REQA 5HANA 1L8NA 2CPUA 3TCEA 4RE2A 3P93A 4E8DA 5LSMA 2PDFA 1C93A 3MP4A 4H6KA 7REQB 4IFRA 5DQPA 1Q7QA 3BQ5A 4FAMA 1XH1A 1EBGA 1EYWA 2XIQA 1GOIA 1ZHAA 3QOKA 3EWDA 3T0CA 1BTCA 4KERA 2RJGA 1OB0A 4N6EA 1MI3A 3WY1A 3SR7A 4FK9A 4AAJA 1HFBA 1A5BA 1VEMA 4KRUA 4UFLA 5GVJA 3AYTA 3KL0A 2V67A 3F2DA 4EWND 3II1A 3EOEA 3VIPA 3LSBA 2QAPA 7CGTA 2CZ5A 3BLPX 3QC3A 2A6LA 4CUCA 2PWEA 2GQ9A 1C8YA 3DX5A 2IKHA 4GC3A 4QJ4B 3T07A 1W37A 4Q4RA 4AY1A 1PKLA 1IT7A 3C8FA 2X09A 1KR0A 3S1XA 1TZZA 2Z2UA 1EJ7L 4BQ4A 4R34A 4PTVA 3ONBA 3WJSA 4UQEA 3CJPA 3W27A 1FWGC 4P61A 3CZKA 4KCTA 4Q7BA 2A7RA 1J5TA 3Q94A 1NVMA 3R0KA 5HMFA 2FKPA 4DZHA 4MB1A 5CH9A 3ZS4A 1OF6A 2PDYA 3GY1A 3R4IA 1PX8A 3WBXA 1Z6KA 2I5IA 3B4UA 3TJXA 3PPGA 2VD8A 3DERA 3EX1A 2TMDA 5JH1A 2WC4A 3SFWA 5EMUA 1QOPA 4B91A 2YXXA 4GYKA 1IXPA 5HJLA 4LTSA 4E2DA 4MJ4A 1JCMP 3MUCA 4JIHA 1NARA 2P0IA 3TTSA 1RQHA 3TYBA 5HNRA 3MCMA 4B2DA 4PB4A 3NYZA 4NX5A 1U33A 3V1HA 3RUBL 5HWMA 1VC4A 3QC0A 3S1UA 4PMQA 3GIPA 1LG2A 4H1ZA 5C6MA 3M41A 5TBOA 2ZWZA 5F7UA 4NKCA 1IE7C 3HGRA 4AHQA 4Q8MA 1KQYA 3WJZA 4UQAA 4XQ6A 1LOLA 1GVRA 2YFNA 1XIDA 3KL3A 2F6KA 3PNZA 3L66A 2O9RA 3NAVA 1A49A 5AN7A 2HJPA 3POHA 4MY9A 3WUBA 3SCVA 2Y8KA 3XINA 1G9HA 4L1XA 4AEOA 4JTDA 1VCGA 1NOUA 2I9UA 1FDZA 4KIEA 1BKHA 3H8AA 4BF5A 3VFCA 1TCMA 4RR4A 4CD4A 4C60A 3BG3A 3G1XA 1JAEA 2QF8A 3M1ZA 2B7PA 3CHEA 3FYPA 3T8LA 3BLKA 2KZHA 4LALA 3DFTA 2XFYA 3ZYZA 4O11A 3VMOA 2OX4A 4DJDA 3KVLA 1CWYA 4XISA 3N12A 1U2YA 1B3XA 2OYKA 4ERGA 1CXHA 3EEZA 1WPCA 1C92A 1RALA 2W91A 1ZBCA 2OYLA 1LRTA 3V18A 1H7PA 2YIHA 1CLKA 4HIBA 2ANUA 2UBPC 4MB5A 3BMXA 2ZIDA 4QCEA 4CKQA 3H22A 4M1RA 4MHBA 3WLTA 4ES4A 2IPGA 3C8NA 3LBCA 1SM9A 1V0KA 2MUCA 1DXFA 2QIIA 2QUNA 1MW0A 5KTLA 4C91A 5HOSA 3CAVA 3HGOA 4S39A 2PURA 3URNA 4PUDA 4OBRA 1J4EA 4GFIA 1LUCB 3QGVA 1SYTA 5HUPA 5IDZA 1X1OA 4HHPA 2D24A 4NYYA 3KFTA 2VR5A 1JZ8A 3B8WA 1X8FA 5A6BD 3N9SA 1ZPTA 1W1PA 3O6DA 1XC6A 2PS2A 1CGWA 4H2CA 3QPEA 3NNTA 1Z9AA 1XF0A 3C0QA 5L9FA 4KRTA 1P6BA 4YTRA 2OZ8A 3AXHA 1FHUA 3I6EA 4Q7IA 2V0TA 1HO1A 4LANA 3TC7A 4JZ5A 3M6DA 4CQ9A 4OGZA 2OR2A 2XVPA 4NZ4A 3NTYA 3GNRA 4MJZA 1EZ2A 3ITOA 1KFWA 4MKNA 3VNIA 5I78A 2YA0A 3BH4A 2WPBA 4UFMA 4IIDA 1E6ZA 3G6LA 1BQCA 3WLIA 1HL8A 1M53A 1FWFC 3E96A 2Q8ZA 3FV9A 5AC8A 2ZUWA 4F40A 3F4WA 1KC7A 4P7QA 1YDYA 3WQ4A 5E70A 3WMLA 3EXTA 4DPPA 5IDIA 2ZX5A 5JUVA 3QQ1A 4AB4A 1E6NA 4HU8A 3VNDA 3WFAA 1JGMA 2A2IA 1PWLA 4O1DA 5DMYA 2ISWA 1EFZA 3MHGA 4IXXA 1GTHA 1ITQA 1KRMA 3RHGA 3M9YA 1XLKA 2YA2A 2BVDA 5I2UA 1F9CA 3WQPA 1WUEA 1XYMA 5FL1A 4XZLX 1GG1A 1GPFA 3VDGA 4LS2A 4O0QA 4J3WA 2IQDA 3GH7A 2X8RA 1GQKA 5FF7A 3DKLA 2PUZA 1YNQA 2NZLA 5XIAA 3U2CA 3ABSA 1VYSX 3DFNA 5AVNA 3N18A 3QXBA 4MY1A 4JTUA 3KVJA 4F0HA 3E5PA 4IGNA 1GYLA 4O0ZA 2CBUA 1QCWA 1J6OA 3FGCA 3SUSA 1Q45A 3WH9A 1Z89A 1XRTA 1UIOA 4DXVA 2ICSA 3VD4A 1BG9A 1F3EA 4YYFA 4UTIA 5HQEA 3HGJA 3S5OA 1IZKA 1VP5A 3U48A 3K13A 3HGSA 5EMJA 3CZJA 3BOLA 3VM5A 1JRBA 2POZA 1X39A 3GDBA 2WMIB 4CNTA 3WBEA 4ADSA 2XM1A 3NQVA 5H8UA 3AIEA 3UNDA 3INPA 3HA1A 3IJQA 3N11A 3LERA 3FJLA 2EPNA 4I9MA 2F9RA 4ICNA 2VX7A 5I24A 3PBGA 4P8XA 2DW6A 5JBEA 1G4SA 4IOTA 2HXUA 4AHOA 2AAAA 4ATWA 4PA8A 4FNQA 1XW8A 5LIYX 1OT2A 4Q8NA 1QI2A 4XSMA 4WZHA 4O57A 1W3LA 1AH0A 4UTTC 3L12A 1J12A 1HL2A 2I1OA 3GXPA 2PLMA 3FA4A 2TAAA 1W91A 1PJ9A 1I2QA 2VP8A 4G1KA 4P2VA 4AZGA 3CL6A 1MSSA 4O15A 4QDWA 4JTSA 3KVKA 4GBUA 5HA7A 2CNCA 3FDKA 1QI3A 2CWXA 4UOQA 1HVXA 1UKOA 3PPFA 2CXEA 4E3VA 1KFEA 3QBUA 4V15A 2PRLA 1OBAA 1TQJA 4K68A 1PKMA 5MF5A 1YE6A 3VE9A 1ITUA 1O1ZA 4ADUA 2GZXA 4R5EA 3IAPA 3A13A 3KOZA 3Q4DA 3JVAA 3TSDA 3EWXA 1X1ZA 1TWZA 3FGCB 3WQGA 4NQ1A 4GLEA 4U10A 4UFIA 2FZMA 3H54A 4DYKA 3KOWA 2FHCA 4PMYA 2X2YA 2QUUA 3DN5A 1LL6A 4GPNA 2D0GA 4H8NA 4MWAD 4Q3MA 2D3NA 3H4GA 3RRAA 2PDPA 5IOBA 3RU6A 1EHAA 3QW3A 1WUFA 3D0CA 4UTLA 2VC6A 4UTWA 3L4YA 2X1TA 3URAA 3P67A 3W1QA 3ZLGA 3H12A 1M01A 2DT1A 1Y7VA 1PWMA 2OEMA 3PTMA 4CN4A 3UGRA 5CLTA 3WLLA 4DPQA 2PF0A 1QMLA 3NYDA 1H51A 1E6PA 3V35A 3KXQA 1R2SA 4X3ZA 4J3ZA 1XH2A 3C0LA 4JTHA 4HSHA 5F4WA 1JDCA 4UTJA 3V36A 3W6YA 5CCZA 4QQ3A 3EOOA 1NWTA 4J3TA 3KX6A 2C18A 3RLHA 2VRJA 4UTFA 3AIBA 3LBOA 5FJTA 1Z69A 4AUBA 2G50A 5I03A 3ABXA 4HMEA 5ABTA 3UXIA 2WCGA 4Q8PA 3C4UA 1POJA 4O4VA 1YIXA 1KWKA 1E6XM 4WDTA 1QNVA 2A79A 1FWSA 1JPMA 1K9DA 4AD5A 1XFCA 2YL5A 3GTIA 2CWNA 4PMNA 3M0LA 1U5HA 3QY8A 1JRCA 3A6OA 5AECA 4RE3A 5I07A 4MG4A 4IJCA 1E9YB 1XICA 1EJXC 1KFCA 1PTGA 3ARYA 3CTTA 5G4HC 3PUDA 4ORMA 1J79A 4HCDA 3E1F1 4AIBA 4WCJA 3PAJA 3VDCA 3M7SA 2DH2A 3M0YA 3N4FA 1A4MA 2RUSA 4TX6A 4L5ZA 2ZX8A 3OYZA 4ZE4A 3M0VA 2G4JA 1VRDA 4XK2A 2GGJA 2J88A 1BKSA 2V63A 5FL0A 4AD4A 3NZQA 2WLZA 3MZ2A 3QGAC 1TR1A 2WSPA 3RX4A 1XIGA 3GXIA 2QCNA 3AALA 3SEPA 2ACRA 3WNOA 1W3HA 3FNDA 3IGUA 3TTEA 5G1TA 4F79A 4RNJA 3A22A 1OCBA 3M0IA 7TIMA 1B90A 5JBFA 2GWGA 3BARA 2O56A 2VGBA 3APYA 2J78A 1Q13A 4G2DA 1XIIA 1PZ2A 2XHYA 5I7GA 1GG0A 3W76A 4L9YA 5D09A 2YW4A 1BF2A 3PTKA 4RZ4A 3PK7A 4Z2GA 5AYZA 4UCFA 1C91A 3NGFA 1NDVA 4LUJA 2QV4A 1ICSA 3AC0A 3HG3A 1SZRA 1CI1A 2WYSA 3IGXA 2HWGA 2ONEA 3S5YA 3VOCA 3D5HA 1KRBC 4NYUA 3A64A 3UYCA 2WMJA 3OLGA 4LEFA 5F4SA 2X40A 4N6FA 1IT8A 3VYLA 1EQCA 3BTNA 1NFPA 3LY0A 3TNOA 2PTYA 4L1GA 4JX6A 3EWYA 3GDLA 3BE7A 3WLHA 2GGIA 4IX2A 1W5OA 3L68A 3QV7A 3UWEA 1NDWA 4BFAA 1V08A 4H9UA 4Z2JA 1W0MA 5FACA 5J8LA 2H90A 1QK2A 1TSIA 4UB9A 5BMXA 3KCOA 1OZQA 3L0KA 4GCXA 3A24A 3VIFA 3PG9A 3PFRA 4JIEA 4EF8A 2NV9A 3WD3A 4ZQPA 3LV5A 4GE8A 4DJEC 1AH3A 3RF9A 5F2MA 2VTFA 3B0VC 3EB4A 1GOMA 1FFRA 3TA6A 2CBIA 4JAWA 3BAKA 1CLVA 2PTDA 4FIQA 2DP3A 3BQ6A 4KKXA 4Z1CA 4EWJA 7ENLA 2YZ5A 4AIUA 2D0HA 1MW2A 2BVYA 3CT2A 3K4WA 4RNHA 1TREA 2VM8A 4UWMA 1GYMA 2WKGA 2INFA 4ZZ9A 4WHBA 2DZSA 3DH7A 3DBPA 5FKYA 5FF0A 3E2VA 3DDMA 4B5TA 1FWAC 3OIXA 3JZEA 3CIVA 3KLKA 2XVLA 4NZ5A 1VBHA 4PYSA 2GSEA 1J96A 2GQAA 3CUZA 1VBRA 3ZOAA 1B3OA 2J7GA 3LXCA 2NQZA 4AEFA 4PL2A 5A8GA 1ODZA 3IIZA 2WNNA 1KV5A 4FIRA 1I9CB 2G3IA 2GVEA 4ZB5A 2NQ5A 2PGWA 1CGTA 1B57A 5C70A 1CT5A 1FWHC 1HVQA 1WDPA 1FTXA 4JHOA 2QCFA 2YCEA 2BXVA 3VFLA 2OCZA 3B06A 2XPKA 2OOGA 2C91A 3IJIA 2XSBA 4J4KA 4WEVX 4ALDA 3URQA 1EJUC 3VOIA 2CERA 3BZGA 3UZYA 4RE0A 4NT0A 4L6HA 2E1DA 1JZ2A 2A7NA 1JQVA 4QQUA 1ITCA 2R82A 3TU9A 3L5AA 3RNDA 3VKKA 3HFTA 3CAKA 4HN8A 3SURA 4CQDA 3IPWA 3S9IA 3GAYA 4B5UA 5KITA 4HTBA 3W2NA 1RP8A 1B9ZA 1I2PA 3CU2A 4S2BA 2ZX6A 4UFJA 4AZHA 4LGXA 1XLAA 3NQDA 4YTUA 4HPHA 4PMDA 1VYRA 2VOTA 1SZNA 3R8GA 1G94A 1C8QA 4DO5A 2X2GA 3W83A 2XH0A 1EP2A 3MVTA 1Q8AA 3NOYA 2V8ZA 4MZ8A 2WHKA 2YGYA 3SGGA 4GJ1A 3IJDA 2GJXA 3ERPA 3GVGA 3WD4A 1AJZA 2Z2BA 1SFLA 5A6BA 5AYXA 3LUTA 5AHIA 1LZOA 1FWTA 2ZXAA 4YS1A 3KOXA 3S8HA 4F0LA 1V0NA 1H61A 3EWBX 4DX3A 4RX0A 2G3FA 2E6DA 3GUWA 1CCWB 1TPWA 2Z1VA 5HK4A 2VENA 3S6DA 4LBUA 2UY3A 3CAWA 3POCA 3W3OA 3B03A 3TZNA 4J40A 4AVFA 2UY5A 3USZA 1T5AA 1SW7A 2ZUNA 1XLHA 1AQ0A 3SB0A 2WV8A 5TAOA 5BMWA 2TSYA 4D6EA 1KFJA 4AZCA 3ITYA 1J2BA 2IW0A 4BY3A 2JK2A 4NJKA 1R87A 4BEQA 4ZFCA 1BHGA 1QNSA 2YB4A 1KGUA 3MB9A 2NXGA 4YL2A 3W1NA 1UJQA 1FBAA 2XGBA 2OT0A 5LIWX 1XIFA 4BKNA 3LQLA 4M19A 3KTCA 3MJYA 4XUYA 3VGHA 1E9IA 3G1VA 3A3HA 3VZXA 2XINA 3AWNA 3H7UA 5FEPA 5AOUA 2JEPA 1W9BM 5E0FA 1GW1A 1VFMA 5EMLA 2OODA 1XBZA 1ITXA 3QKZA 4PUWA 4QRNA 4F8XA 3STCA 1O95A 1QPQA 1KD0A 1TPFA 3RGTA 4J3SA 3VKAA 1XUUA 1QFEA 3OGVA 1XXXA 2VURA 3NM1A 2J4GA 4E2BA 4WKHA 2ZZ1A 3BLLA 1TG7A 3UZXA 1EH9A 4FXSA 1R47A 2E40A 2WMGA 1C8XA 1FWJC 1I75A 1LTDA 2NLYA 4L4MA 4S23A 3U0HA 4F0MA 2PGRA 3LPFA 4GISA 3CO4A 5BWFA 4EPKA 1K77A 4PC8A 1QWKA 3AXMA 3WK2A 2I5QA 1EOKA 1JD7A 3WDHA 2V3DA 3RCMA 1H7NA 3IARA 1KM4A 4HA3A 1GVOA 4GVFA 2YYTA 3TA9A 5I3GA 2V3EA 3OEXA 4HNVA 2ZZ5A 3RXZA 4O1BA 2FVMA 4A8IA 4EACA 4HNCA 4OU1A 3CB8A 5CPLA 3C86A 3SZ8A 3QGKC 4FO4A 5A6TC 4AZCB 1TJPA 2D22A 3PG8A 2WLYA 1R8LA 2HQAA 1GUVA 4D71A 5E9XA 4V28A 1EEXA 1JZ5A 3WBYA 1K7XA 4ZO6A 2PODA 6TIMA 2DZWA 3WLMA 4W8BA 2OG9A 2VHLA 1TUXA 3W1TA 4UNKA 4QE5A 1NF0A 2R24A 3GW0A 1IGWA 3QH2A 4O8RA 5LA1A 3NIYA 1GVIA 1VEPA 1KBBA 3WUEA 1AQHA 4Y9PA 4W7VA 4XG1A 3RM8A 3RPDA 1X96A 3W7MA 2VC7A 2Q6ZA 4JTCA 4LUSA 2I56A 1WAWA 1WZAA 3R2GA 2PLJA 3OLDA 2F6UA 3I3EA 5H2ZA 4LF1A 3LRKA 1VLIA 1DJZA 2R1LA 1G4PA 1DEDA 1FHDA 5DELA 4C7GA 3WYZA 2BOGX 3DUGA 3DI1A 4Z0JA 5I5RA 6CGTA 1BFNA 3TKFA 4LVDA 1Q6GA 4Y9OA 3GVRA 1TZ9A 3CEPA 1VBGA 2OEJA 3THDA 3BLEA 1NOFA 2PDKA 3CPRA 3M7WA 1LBFA 1LDCA 3CS2A 5J5DA 1UOKA 4GI6A 4S3DA 4AVNA 1CXIA 1IWPA 3GXMA 1K6WA 4LV4A 4MWAA 1IQ8A 1OYAA 2G96A 2OZ3A 3MDWA 3CB3A 1Q6LA 3KBVA 3CEUA 4M82A 1E4MM 2ZUMA 2VKZG 2YL6A 1W54A 3V16A 3OJGA 3UD6A 3B9OA 2A5HA 3OP2A 1Q6RA 1UR4A 3MMTA 5E0KA 1TRDA 2QJMA 2AGTA 1FWDC 3CUHA 1G01A 3TYCA 2WBKA 1I2RA 3T05A 5BW6A 1ZCCA 4XBJA 3ONCA 1CENA 2Y7GA 3SUTA 2W66A 1D7KA 2WJFA 4IPPA 2WJDA 4ZODA 3WFLA 1UBSA 1HKKA 3PTQA 3N2CA 2RFGA 2DIKA 1DPMA 2BOFX 4ZQOA 2HCVA 1J0HA 1QNRA 2YCJA 3FAXA 4GUJA 3Q65A 3FHAA 2EGZA 2G0WA 4PULA 4M3PA 3SDOA 1ISZA 1EO7A 3HQOA 1EXBA 1H1NA 3MSDA 4JX4A 2AQWA 1I6NA 1DKWA 3RLVA 3PWAA 4XD4A 2YLLA 4RLIA 1SSDA 1O66A 3UP8A 2TODA 3OA3A 5AHMA 3S6TA 3AMLA 1FHVA 2DZUA 2FHFA 3LPGA 2VR4A 3OZMA 4JTKA 4JYDA 2BTMA 1UWAA 2OZ0A 4DUWA 4TTGA 2QV5A 2H3BA 1QUMA 4DZAA 4YNGA 2WMHA 4E2OA 3J7HA 4P7RA 3SY8A 1G4TA 1XDJA 3CHDA 3SUWA 1P43A 3W25A 3U2ZA 2R9RA 3L9CA 2OU4A 3W73A 3O05A 3FY1A 1YEYA 3GS6A 1ZS2A 4IMAA 5IBXA 1OSEA 2FHBA 2VGIA 4C6BA 4PN2A 4PUUA 4GYPA 1TZ7A 3THQA 1MO0A 4PEKA 4L6DA 4FLSA 2WBGA 4H9YA 4TV5A 4ZQCA 1DHKA 2HS8A 5ECVA 1AVAA 4RW3A 3L2LA 1UR2A 2NV1A 3EA1A 3WD2A 1R9XA 4R7OA 2VELA 4LAKA 4DQWA 1EJWC 1ONWA 1AUSL 1S5MA 3LI1A 4RL3A 4BF7A 3VVGA 2XVGA 4FNRA 3EYPA 3RPTA 4W5UA 3T40A 5FJUA 3ZWSA 4C7FA 2R14A 3HMCA 4JNYA 3ICJA 3JR2A 3NQFA 1OWQA 1R3SA 3R12A 4LC6A 4EXAA 2Z28A 3ZMRA 1KNWA 2AL2B 1S2WA 1SFSA 3EKGA 3WENA 5K3VA 4O50A 3H2MA 2Y5JA 3TFCA 2C1HA 4D6FA 3LBMA 1RBAA 3AFBA 2A21A 3K30A 1QBBA 2CC0A 3QMSA 3O15A 3KZPA 3N2OA 5H8PA 1W9VA 1WKEA 4JFUA 2G37A 2UY4A 4FNTA 3W38A 3D46A 1J0KA 1CECA 1L2QA 5I00A 4B90A 3TZFA 3LHUA 1TWIA 4N7QA 1SSGA 2CZEA 2VDHA 4GO9A 2YFOA 3O07A 1PZ3A 1ZJHA 4YVPA 1UR9A 4B5WA 1XBXA 1E0UA 1O12A 3G1SA 1IXNA 2E68A 4POCA 1J2WA 1KW1A 2QS8A 1IXOA 3KRBA 3I3BA 1J8VA 1F5ZA 2J62A 5C7HA 4E38A 2IXUA 2OPJA 1EXPA 4UXDA 1PDYA 2GJNA 2VFIA 4V1XA 2PP1A 4FHAA 3G0SA 1E72M 2ZVIA 3QW4B 2B31A 4DUOA 4I8DA 1P4CA 1VCFA 4H8VA 4NZ1A 4WVXA 4JY9A 1KFKA 3CT7A 1F8IA 1W1TA 1Q6EA 2VFEA 4Q32A 4H04A 3SCTA 1CTNA 2ON3A 5AVHA 1XIMA 2GPTA 2GVGA 3O0KA 4RPQA 1TE1A 1JCTA 2F61A 2BHZA 1HXJA 3OG3A 4PTNA 4ZTYA 1TCDA 3OZPA 3SQLA 4PCNA 3FN9A 3WD1A 4PRRA 3AJ7A 5A5WA 3WQ6A 1B2YA 2EJAA 1VBJA 4CNPA 3PBWA 1IT0A 2VX6A 1VFLA 3M5VA 1HP4A 3AUOA 3CUIA 1GJUA 4FXJA 4F2TA 1UD3A 4RZ5A 1MRQA 3EKZA 1O5QA 2X41A 5RUBA 1EX5A 3R10A 4P8VA 4Z1YA 3RAOA 4NNAA 1VS1A 1SO5A 3OU8A 5LIUX 3W7LA 2YBTA 9XIMA 1ZP4A 1JCXA 5DRIA 3FOKA 4EKJA 1WE5A 2W63A 4A21A 5ABGA 2GQ8A 2ASHA 3GU9A 3VCNA 3MP3A 1C7TA 2VMFA 2NXHA 3TC6A 1VD6A 3W7HA 5C9WA 3ZR4A 1SJCA 1A4LA 2D3LA 4NAFB 3W24A 1S2VA 1UA3A 2BY0A 4BI7A 4JFVA 4B3ZA 2V82A 3HF3A 4LVBA 1BXNA 3W7QA 1DQWA 1N8WA 1OGBA 3HQNA 4O16A 1XD0A 2CLLA 1QI5A 2INZA 5M2FX 1ALDA 1ZENA 2QUTA 4MOZA 3WK3A 1WCGA 1ISXA 2OYMA 1UZDA 2PGEA 2HK1A 4DLMA 3GG7A 3N2XA 6REQA 4LAMA 3TW7A 4IGSA 1W56A 3N34A 3RU8X 4UQDA 4OIFA 5D2TA 4IG2A 1W3KA 2O0TA 1L6GA 3NUKA 3KBJA 3P14A 3WDRA 4DEFA 4EAYA 3ZT6A 3GNNA 1UOZA 4LS0A 5J5RA 3A4WA 3QM3A 3BURA 4IHCA 2GUBA 4Q4PA 4ERIA 4G7FA 1K9EA 4KCUA 4RUBA 2WSYA 2YCLA 3LRLA 4O28A 2H6RA 4F2UA 1WAUA 1IXQA 4MDPA 1E55A 3ATYA 3V0TA 1WA3A 3Q58A 3FYYA 3UWYA 1OT1A 1K7FA 1DJNA 1V0MA 3C2RA 4IISA 2Z7GA 1IYXA 2WVTA 4OVXA 1YX1A 3QLLA 4L64A 4H7VA 3VINA 2B81A 2FJUB 1A80A 1F3TA 3WLPA 1Q6CA 3S42A 1RQBA 2C6QA 3HFYA 2G3NA 4AIOA 1UKSA 3NXLA 4PH6A 1I4NA 2IUZA 3GHSA 2HNHA 3PZTA 2FGBA 4LU0A 4HOWA 2OO6A 3LPPA 4RNIA 2OQLA 5E6ZA 1R7OA 1XP3A 2Y8VA 1TX0A 2FYMA 1GPWA 1RJQA 1F6PA 4L56A 2J75A 1XLJA 3FVDA 1M68A 1UASA 4DWDA 1ZGDA 4XZMX 2OLSA 1W1A1 4HK5A 1P7TB 3NPWA 4M56A 5IHSA 3PP7A 4K2SA 3LA4A 4PBEA 2DSUA 4BR1A 3V7PA 4D9PA 3VUSA 5CJNA 5HR6A 1MRAA 2HEJA 2NQLA 2YW3A 4OBTA 3NZRA 2ZBTA 4Z1DA 3B8IA 4C1LA 4FLQA 2A0NA 3LQGA 2VGGA 1I8JA 2E6FA 3NQBA 2DSVA 4AD2A 5C9ZA 3T78A 4GUIA 4I8YA 2QCCA 2VYOA 3MHUA 2GOUA 1T99A 1HUVA 2JKAA 4LNCA 1FCQA 2J27A 1JYVA 2I16A 3GUGA 1KKOA 4EE9A 3IGSA 1SJAA 3VMNA 4DWSB 2Z25A 3OYXA 3LD5A 3RITA 2P8BA 2PLKA 3VA8A 3V3WA 2WO5A 1XGDA 2HNEA 1BLIA 3EEGA 4FNPA 2I9EA 4WRHA 4ZMGA 1WDDA 3H2NA 1MEIA 3F5JA 1V79A 2VZTA 3MUAA 4AX6A 2PDBA 2SFPA 1VENA 3EOLA 4G8TA 2V81A 4UMAA 4ZBCA 5ABEA 1PCWA 1KXQA 1KFBA 4GNKB 5CC6A 4NNCA 1TPEA 2J9ZA 5C5YA 3STFA 3LN3A 2VWSA 1NDZA 4ICMA 3TN4A 3SADA 1PXGA 3TMQA 4QSFA 2D2OA 2ZRUA 2PPGA 1PVNA 3DFPA 1SZFA 3H2EA 4N9BA 4S2CA 1EQPA 2XZ7A 2ZE0A 1JDFA 3EWUA 4YHEA 1MW3A 1VF8A 3OODA 5GNZA 1S1RA 4Q4KA 1HTIA 5EB8A 4ZE5A 3GG1A 4MYAA 3WBWA 4NG3A 4CNUA 5B7ZA 4IP4A 1UH3A 1YBQA 2F84A 2GOKA 1EF2A 1OC5A 4FF5A 3GFZA 4Y2WA 2BY1A 3QQ0A 1A50A 2ISDA 3PUGA 4PMZA 3FS2A 3ABQA 1FH7A 3G0UA 5KZMA 3W01A 3SAZA 3GB6A 4BI6A 3ANYA 3A21A 1GVFA 4HHHA 4MKVA 1FWRA 5TNVA 1JUBA 2J8TA 4WR3A 3W84A 1MZHA 3U57A 2XSXA 5D05A 5KSWA 2PTXA 4MB3A 4F48A 3AIRA 1BTMA 3WEOA 3O3RA 1YLVA 2VD9A 5HINA 4DJED 1PDZA 1OFBA 1H63A 3UWQA 1YYAA 4B5XA 4F4RA 3LS9A 1A5OC 4E4UA 2CLKA 4HK6A 1K8CA 3EOSA 3NURA 1QK0A 3BWWA 3KE0A 3H70A 1TR9A 3G24A 4BWLC 4XAFA 5CZSA 3TQKA 1E5JA 3HG2A 3W37A 1VRXA 2NT0A 5ECUA 1JNEA 4REQA 3W53A 4IQEA 2FIQA 4HB7A 3SBFA 4GINA 4J27A 4HMDA 3BW4A 3L4XA 2XTKA 1K9TA 4OE7A 3NQAA 1FRBA 3QY6A 4QAIA 2DY3A 3QMRA 2JF7A 2WKLA 3GTFA 3EOUA 1FP9A 5FEWA 5I06A 1V3JA 1QDSA 4Z2IA 5HJYA 3TN6A 4U2ZA 1P1MA 4AG0A 3IANA 1VCVA 2FZDA 3TEVA 4Y9MA 3CYVA 1ZQ5A 4JKKA 3BCFA 3PPCA 4RDWA 3TDFA 5LKYA 1KM3A 2QPXA 3DEQA 3LOTA 3MCOA 4MFEA 3LG3A 3OVRA 2BY3A 1PZ0A 3W70A 4JIPA 2XU2A 1MFUA 2E8ZA 1GZJA 1ZY9A 4LBRA 3G1HA 3EWWA 2OO0A 1K03A 1MNZA 2W4XA 2POTA 5BXPA 2PBOA 1SPQA 1B3ZA 5CPQA 3DG6A 2ZA3A 4XZHA 2YZRA 1CB2A 1BRLA 3H6OA 1S39A 4LUYA 3ZVHA 4JCMA 4IM4A 1W3JA 1EDGA 4EANA 2F7FA 3O2LA 3KBMA 3K5XA 4GIYA 5CSYA 4MADA 2WKJA 4JQ3A 1RH9A 4A22A 1XX1A 2OJPA 4C6JA 2QAFA 2D2HA 3VDBA 2A3EA 1K4HA 2GYIA 2ZRZA 1UD8A 1P0EA 4XO6A 2X0SA 3U3HA 4X60A 3SSJA 2X05A 2EAWA 1R46A 3BG5A 1BYDA 3W2JA 3S1VA 3N1AA 2AMXA 3PUOA 3UCQA 2R8WA 1EF3A 2A4AA 3NSXA 3MMDA 2V5JA 3VXGA 2VDIA 3HURA 3RN6A 1XKYA 1UD4A 1XDMA 2INEA 2Y5SA 3RILA 3WMBA 4D6HA 3UA3A 1JZ7A 4IPJA 4BQ5A 4JKMA 2PZ0A 2DFAA 4PRTA 4B2DD 4JTEA 1M7XA 5C2CA 3NO1A 1WX0A 1M04A 1GHRA 2ZUSA 4N4PA 4DO7A 1RLDA 1F05A 2ADAA 2XH7A 3H53A 4W8AA 1XPYA 5I23A 1I0BA 2DUXA 1BAGA 4HJWA 3VGBA 3QV6A 3CQHA 1AQFA 4TOQA 1H50A 2OB3A 4Q8TA 2C3ZA 4E8CA 1KBLA 4MAZA 3MUY1 5K9XA 4O17A 1K8ZA 3HQPA 3IGHX 4R85A 3ME3A 3AYSA 3MKVA 3TC3A 4B92A 4GKLA 3IAQA 2IKGA 5LNRA 4GNVA 1BRLB 1ADDA 4DM2A 2E28A 3AXKA 1GQJA 4PTWA 2HPIA 1KTBA 1POKA 2DJLA 4K7VA 1ADOA 3RO6A 1NWUA 5KINA 1RAKA 4KEVA 3B9AA 3VNMA 1XLFA 1P0BA 1H4PA 1ZZMA 1VFFA 4C6CA 4ENLA 4K7YA 2XFRA 4PTMA 3N25A 1GONA 1IF2A 3GW3A 4LVFA 2QZRA 2HPMA 3M44A 4RJEA 5DT7A 4D6IA 4NAEA 4MJ2A 3NR0A 2AOSA 4J28A 5E93A 3O9NA 1QNQA 4GY0A 1Q5MA 4LRSA 4ZOBA 2Z6JA 4M6UA 1UH2A 3QYSA 2H8XA 4EVZA 2E9LA 2C79A 1PBGA 1YHTA 5D37A 2CEQA 1GJPA 3UQNA 1QASA 4RDZA 3TQVA 1KCLA 2WANA 1TPC1 1SJBA 4JFSA 3W9ZA 5I3IA 2YXOA 3WJXA 1CGXA 2QR6A 5C9XA 2I17A 2YLAA 1GYNA 4HMCA 1HF6A 3P0XA 3NQMA 3PPHA 1TPVA 2VRQA 3ELFA 2JGYA 1MQQA 4AZ7A 1O68A 3MS8A 4XD5A 1GNXA 1RA0A 3L4UA 1IEWA 3MMWA 1KKRA 1BYAA 4UTTA 4DO4A 2GDQA 1MW1A 4ZVJA 2DW7A 1K8YA 1ECEA 3B8TA 5D33A 1OY0A 5G2IA 3W88A 1GQLA 2EF9A 1SU5A 3UVAA 4DO6A 3QV9A 2G97A 2VCBA 3TJ4A 5A6KA 3M0MA 5EBUA 1C9DA 4A4AA 3DHPA 3L4ZA 2V5LA 8RUCA 4GZJA 3UCDA 3S1WA 3FDGA 3EWCA 3S4TA 4HMNA 5CGMA 2WSKA 3WELA 4NXKA 4C6NA 4KWSA 1G6CA 3TLLA 3LX9A 4N02A 2ACQA 5DBUA 3UESA 1OIFA 5CG0A 2ATSA 3LCWA 1JIBA 4ZOCA 2O9TA 4AQLA 3P3BA 1JJKA 5A8OA 3CMGA 4YTSA 1TA3A 4HHMA 3AAMA 1EP1A 3GBEA 3QPZA 1ZAJA 2QULA 4PCFA 3RCNA 4CU6A 3GNOA 5HDRA 3ARZA 4IFKA 4KH2A 3H7RA 1WDWA 1GCYA 4GZIA 1XISA 5I6SA 2X0YA 3B04A 2I7GA 1QW9A 1L2UA 2PWGA 3LCHA 3B05A 4DXXA 4RNFA 3AMDA 4EX4A 1AJ0A 4HNLA 4PSRA 1GOQA 5HUOA 5D2WA 3WK0A 4ML9A 2VGFA 5H8MA 2JGQA 3NZGA 3HZ3A 4D8ZA 1V6UA 4XZNX 4I3GA 2B0MA 3HV9A 3OLIA 1ZNNA 3NQEA 5REQA 2JIEA 3STGA 3TQPA 3TYUA 1JCLA 3IJ8A 4KW2A 4LY4A 4OJYA 3ORWA 4HK7A 5D9NA 4KPLA 5BYWA 3BGAA 5A8MA 4M7SA 2XGZA 1GKPA 3XISA 1XJBA 2D73A 4XBSA 3UJRA 1VQTA 4KCVA 1RY0A 4AIEA 1Q7ZA 4JTQA 2F2KA 4NU7A 4MLRA 4W8LA 1E9ZB 2KAUC 3DECA 1J10A 1B4EA 3P82A 3BC9A 3G3DA 1QBAA 4R9OA 5CGTA 1I0DA 2RKXA 2QJHA 3FIGA 3TQ0A 1VR6A 1X8CA 2WW5A 2BFGA 4HU0A 3SUVA 1EIBA 6XIMA 3M47A 2QGYA 1LRQA 3BOFA 3BK0A 2DORA 3TYDA 3KOFA 1PZ1A 7TAAA 3ZVIA 4WJXA 1EJSC 4Z42C 4MZ1A 3CQ0A 3DFHA 2CW6A 2E3ZA 4HNNA 2E4TA 3MYPA 1OM0A 2X7WA 2QUMA 3L4TA 3W2UA 1TA3B 1YXDA 2QIWA 4MIMA 1LROA 1DWJM 2CBVA 3KRZA 2PWDA 3APTA 1OQFA 4UMCA 3GR7A 1UIPA 1YTKA 3TONA 4NI3A 4IFKB 1QHZA 3TCSA 4IICA 3S1GA 4YJ5A 3KRUA 1R2TA 3AZTA 1Z32X 1F8MA 2Q3RA 4X9YA 5IHRA 3TNBA 3RRXA 3KTXA 3ARUA 2PDWA 4H9ZA 1XG4A 1VFHA 4A05A 1ISVA 2DSZA 3PUEA 4QDMA 5TIMA 3NXFA 4J9JA 4IGHA 3QSRA 4DWSC 1A5KC 3WD0A 4PGLA 7REQA 3PM6A 1VHNA 4LS1A 4Z08A 1VFTA 3UXLA 2YDQA 5EMMA 3LMZA 3QQWA 3BO9A 5B80A 4XVEA 1QNOA 2J77A 3USBA 3OQ8A 4R7WA 3OZYA 1DHPA 3WEMA 4JDBA 4X63A 1TE6A 3KS6A 2VZUA 2Y7EA 4LRTA 3UU0A 5J04A 5DF0A 1R3VA 3N4AA 3T4CA 1Q8JA 2J79A 3K1GA 1TPUA 4WY0B 2PAJA 5K4XA 4DI9A 3UR7A 3R25A 5CSUA 3GHUA 1ME8A 3SO7A 1GGOA 3KAOA 1ZBWA 4FR1A 2F2HA 5DBTA 3C5QA 1HJVA 1Q63A 1DL3A 3LI0A 3NOEA 3BSMA 5DT5A 4US6A 3CV6A 1W5MA 1H0GA 3SRHA 1WKFA 4KEZA 4WSJA 4QEEA 3AICA 2Q8LA 3K46A 1AMYA 3BAJA 1ELSA 1Z7AA 1XM3A 4P8UA 4W84A 4GVGA 4DJEA 3CAQA 3GM8A 3SRKA 5T26A 4DJFC 1W2VA 1E40A 2HMCA 1KO0A 5TF0A 4DUXA 2V5KA 4EPDC 4NIRA 1NEYA 3E0LA 1K3UA 1EBHA 1SQ7A 3V0SA 3MU7A 2Y2WA 3AIWA 1HG3A 4JN7A 2ZDSA 4PMOA 2UV8G 1JD9A 4JHZA 5K2ZA 2TYSA 4FMVA 5JVLA 1BYBA 3IACA 4RXFA 3THAA 2LLEA 3UR2A 3OG2A 3B8SA 4G56A 2ZE3A 1TV5A 4JFTA 1B3VA 5JQ9A 2FH8A 2YJQA 3H55A 3G0XA 4LVGA 2FLIA 4CU7A 4AZBA 1LORA 2CCRA 1RZMA 4QP0A 4PCTA 3B8DA 3LHWA 1M9HA 1W6TA 3VIHA 4OUEA 4S3BA 1ZAHA 4KEMA 3TJLA 3N3TA 1NQKA 4BQ3A 5E1QA 1LWHA 2VEFA 2NVCA 3IIVA 3SY1A 3DGRA 5F1VA 1BSIA 3QN3A 3LU2A 1FP8A 3DCPA 3L2MA 2DZPA 3CH9A 4CCDA 4AD3A 2F38A 5CQ1A 4GK8A 3ZWTA 1X6NA 4GY7A 1TELA 3GYEA 3W74A 2E25A 4U5KA 3SRDA 1SZEA 3NQ8A 4BI5A 1EDQA 5EMYA 1JXJA 4CQAA 3MQTA 3E9AA 1ZU8A 3L65A 3MYOA 1FXQA 4JYFA 1X97A 3QZ6A 2D2JA 1X98A 3B0YA 4EXQA 1Q4WA 1MUWA 5BCAA 1WDSA 1BVZA 1DORA 5T91A 3PJWA 3A23A 3AZRA 1JYWA 3U4FA 4UQBA 3ZIZA 3IUHA 1QVBA 1GK8A 1R5YA 1THFD 1NH6A 4M7TA 3N6HA 5DXYA 3U7BA 4JTJA 4XIMA 3AIQA 1YRRA 1KCZA 4U31A 3PZMA 1E5NA 2IQTA 3EKLA 2YSWA 4XB3A 3UWVA 2IS7A 1GORA 3U6WA 1HT6A 3IUDA 3DESA 1LM1A 3CYJA 2XGIA 3M0XA 4HN4A 3U5UA 1G0CA 1KB3A 3G1FA 2NUYA 4ACZA 2VZSA 3CGTA 3QJAA 3PHAA 1YPFA 3GTNA 5FAJA 2XYLA 5H6HA 4WDXA 4QITA 1TJRA 3GK0A 1ZCOA 3NCOA 2GSJA 4NSBA 4KWVA 1FCUA 1UPMB 3O63A 1EOMA 1LUCA 1UR8A 1UW9A 3B9EA 1A5AA 4MTVA 1XGZA 4LVAA 3CLMA 4NX0A 5AHFA 2XISA 3T7VA 4DZIA 1KTCA 1QW7A 1VIWA 4HA0A 4MM1A 1XIHA 3UZWA 1DJQA 2WM0A 4BZYA 1Y8BA 3ATZA 3T44A 1Q6DA 3NDZA 4QBXA 4K8GA 4UCGA 1UP2A 3AO0A 3VGGA 1FWEC 1V8EA 1ZRQA 2AKZA 4RKAA 4R9XA 4PUMA 1EC7A 3FEQA 3UJSA 2XIOA 2CIPA 3WDPP 3T09A 5HJXA 4A2SA 1AL7A 2AMGA 3LZ3A 3UJFA 3ZLHA 4JCLA 2W6RA 3W75A 1BSLA 3C3UA 4ACYA 5EY5A 3PY2A 5G2HA 4IMDA 2OXNA 3U5YA 1S2AA 3CV7A 3ARQA 3GKAA 3UR8A 3VE7A 2G3JA 3LSCA 4E4PA 4GIEA 3JU2A 4OKDA 3KZSA 1FDJA 1E0TA 5A2CA 3NL6A 3AIUA 3PNUA 4W5ZA 3S2NA 1LWIA 4C6OA 3HV8A 4B5SA 3GC2A 3PF3A 5HULA 1H62A 3VDAA 5LNVA 3CASA 1IIHA 1PHWA 3THCA 1IWAA 1EJRC 3GSMA 3GZAA 4AEEA 1H60A 5HWJA 1VFOA 1DWFM 4Z2HA 2WB5A 4JHMA 2C1IA 1PX4A 4M1BA 4ZCWA 1GOKA 1LQ2A 5DMLA 4ACZB 5C9UA 1UWIA 2PA6A 3BDKA 4LCQA 4MNJA 3E0VA 1W1VA 1PL9A 1XHGA 2V9DA 2ZTKA 1WXJA 1XLEA 4ONVA 1TVPA 3G1AA 2X30A 1H3GA 4GO8A 3SY5A 4QJ5B 4CD6A 3BXWA 1S38A 4H2HA 2X1RA 3N2MA 6ENLA 1FHLA 3BMWA 3LHTA 4IPLA 5D4YA 2OLAA 4ZSTA 4W7WA 3G6MA 3PBUA 1OFQA 4U28A 2VWTA 2DU2A 2HISA 2WMIA 5BXSA 4OOZA 1K8XA 1SO4A 4DYEA 4A2RA 1FA2A 2EG7A 1Z3NA 4NJHA 3RLUA 2V69A 3SUUA 2BVTA 2ZOXA 3GDKA 2YA1A 4I6VA 4CCZA 4KBXA 1RK6A 1JPKA 2DQXA 3UF9A 3BV7A 2GJRA 3OHIA 3L23A 3UCCA 4JN6A 4C6LA 1UUMA 1VFUA 3CL7A 1TV8A 3TN3A 3HOJA 1SZGA 3MANA 4ZENA 3CWNA 1R30A 3LHVA 1NJJA 1VIZA 3M16A 3RPMA 1T96A 1GWJA 1XIJA 2OSXA 1W8SA 4D6GA 3V0UA 2W27A 3DYMA 1RXOB 5LZLA 1FH8A 5HXMA 2Q02A 4LCSA 5AHLA 5DMNA 1LL7A 4Y8EA 4GIAA 1H2JA 1HKIA 4LOCA 5EL1A 4JPGA 4A8NA 5G2WA 4YVXA 1W31A 5E09A 3T6CA 3NQ2A 1CLXA 4QNWA 8CGTA 4GZEA 3ABOA 4H9TA 2E0PA 4TV6A 5CPTA 1JCNA 3FAWA 2WHMA 4DAFA 4AY7A 2QMJA 5HATA 5A6LA 3WDJA 3C3NA 1RK5A 4U3CA 3WH7A 1YKWA 4XAZA 2CKSA 5AZ1A 2YDSA 5TD4A 1U1UA 2R94A 2AGKA 4TX8A 3OZOA 1MNSA 4WKAA 3DBNA 1L8PA 2ZZ2A 3PBVA 4IIBA 1VYPX 2FMNA 2JKEA 4U2YA 3AU2A 4B5NA 1E4NA 6XIAA 1D8CA 2A3LA 1B31A 1B1YA 2Z6IA 4J2MA 3OTRA 4BHYA 1RA5A 3N6QA 3TUUA 2BS9A 2Z24A 4W86A 3VKBA 9RUBA 2WZHA 3CIXA 1OGSA 1JULA 4CLMA 2W92A 1L6FA 4TVCA 2A3HA 1JQXA 1Z42A 1R38A 3FXYA 2PGFA 4JTIA 3AHXA 2J7FA 1J01A 1QT1A 2FGLA 2PC8A 1EC8A 5EMKA 1DIDA 3M4HA 1G1YA 3VKDA 2GJPA 4HKPA 3TIMA 1VZWA 3H24A 2E7FA 3W7OA 4WJ8A 2RHGA 4QJ3B 4B4HA 2IKIA 2QHAA 1NFBA 1VJZA 4WIWA 1SO3A 2IMRA 1S3TC 1NM9A 5L6UA 5F2LA 4B9YA 3ARWA 1T7LA 3VM7A 3MWCA 1RHCA 1FUYA 1E1FA 1GVEA 4WF7A 1TFVA 4HCLA 2PWHA 2FFIA 4LC8A 4XSLA 5CPOA 5KMYA 3DENA 1Q6QA 4IF2A 7ODCA 5BOEA 3GFYA 2OQHA 1JPIA 5FJPA 1IR2A 2Q8XA 2C19A 3UG4A 4U3AA 3HU7A 4DBWA 4JTTA 1GJWA 3HTWA 3PWGA 3VNKA 3WF1A 3MKKA 4H6QA 1HQTA 1MUCA 1TWWA 3UETA 4HPJA 4E0CA 4AISA 4ML4A 4WOQA 4GQBA 1ZLPA 2BODX 3C2VA 5T9CE 5AKQA 4BF9A 1VBUA 3EBVA 4UTMA 4K8EA 1A3WA 2C7FA 2Q71A 3K8MA 2C15A 3HBLA 3H23A 1YDVA 3L2IA 1YPXA 1AW1A 3SCRA 2XIMA 1OABA 2EO7A 1TTPA 1SJDA 1H1ZA 3WCZA 3WMCA 3UZ5A 4I7WA 4FR6A 3P81A 3UWUA 3FJ4A 4ROQA 1N8IA 4CNSA 4UBPC 8XIMA 5FEXA 3TXZA 2JFEX 2VFHA 5A6JA 2DSKA 1UJPA 3FCPA 1UUOA 1XI3A 4GX9A 4HD5A 4QEHA 4X9SA 2FB2A 2C0HA 3G5EA 3IRDA 1Z8AA 2UY2A 2IPJA 2ZKMX 1V6XA 3CL8A 5D30A 1TVLA 1WBHA 4N9EA 3MUIA 5AHEA 3CWOX 4JQAA 3CPGA 2Z7KA 4C1NB 2EHHA 3CMFA 5CSSA 5CC5A 3T42A 1EGVA 2Y7FA 1E9LA 4XAPA 2NUWA 4DHGA 3I10A 4Q33A 3DHUA 4E8GA 5CG7A 1UBPC 2EPHA 2ISFA 2XIBA 2A6NA 4M80A 3DFSA 1TYGA 2QEZA 1P5BA 3CNYA 4H41A 3S2CA 3KP1A 1XGEA 3SIZA 3HG4A 2WJEA 1I2NA 2Z0IA 2DEPA 3KLLA 3UNTA 4WDUA 4QG8A 3QLDA 1TJ2A 3ARSA 4CVWA 3GVVA 1VAHA 2QDEA 2GGHA 2J47A 4N2YA 1J9YA 1DE6A 4PSPA 2ZUVA 1K6AA 4ZB2A 3W85A 5JIPA 1VPQA 4FA3A 3VAVA 3W26A 4CNNA 5ABFB 1A0EA 3EXSA 3CUJA 2E5DA 3TSBA 3L5MA 3GLCA 3EDFA 4PBGA 3LTYA 2CBJA 3EX2A 5C71A 4DZ5A 1IR1A 1Y0EA 1E0VA 5EGRA 1NELA 3CTLA 4DM1A 5AFDA 3W82A 1L6SA 2PD5A 4ZO7A 2AQVA 3W6MA 1GKQA 3O6CA 4ZA0A 3XIMA 1A3XA 4QJ1A 1JZ3A 5FF4A 3UPWA 2QVNA 1D2KA 4HPXA 4JD4A 1W3IA 4H3DA 3CZLA 1XBVA 3EZ4A 4TMCA 1OCNA 4LT9A 5LGZA 5AC7A 1KBKA 2BP1A 2VL4A 2J6XA 4YPJA 2YB1A 2O4MA 1J0ZA 3OOQA 4YHGA 3UZJA 2Y0FA 4OWGA 4K1GA 3RIKA 3W71A 1TPH1 2DVUA 3S5ZA 4TQTA 4C65A 1XWYA 1NY1A 3P62A 2E77A 5FOOA 2CLPA 5CC3A 1KGXA 1XLBA 3UBPC 1WOAA 4UR9A 5HPCA 4JBRA 5DRCA 3T81A 3E02A 1WB0A 3WQ8A 3G2GA 1JI2A 1EP3A 3HG5A 2GLKA 3S6OA 3A4XA 4QE4A 1GEHA 5BZAA 5E6YA 3WIJA 4NNBA 3AYVA 4PTDA 3HJEA 4ZXLA 3WF2A 4PB3A 4HZ7A 2EPMX 3KDNA 3WNPA 5G1MA 2PZNA 3DFYA 4B5VA 1OFAA 4NVTA 4XVDA 3AROA 1W9UA 5CJ5A 1CZ1A 2X1UA 4FPSA 2UZ9A 5EFFA 3SI9A 4KESA 3UJEA 4JTLA 4X22A 1HJSA 4D1JA 2Q09A 3F4VA 2Y88A 3GFXA 4IUOA 4Y90A 1WZLA 3UPMA 4L80A 3H2FA 5HAOA 3KHJA 1XBYA 1X7IA 3K4AA 3H26A 3I4KA 1P0KA 3V5CA 1L6WA 4TVUA 3ZJ7A 3W7JA 4J35A 2PI6A 2XFWA 4O0KA 5LYRA 4D1IA 4NF7A 4BCEA 1N55A 1N82A 1F3WA 1SR9A 4C6EA 3PJTA 1XRVA 2JIWA 1HGYA 3AZSA 1SVDA 1E15A 1D3HA 1V6WA 1E71M 1A47A 2WMKA 3PZQA 1HKJA 1KXTA 2RAGA 1AH4A 1KLZA 4UNIA 1TPB1 1LBMA 1V02A 3LTSA 3RG6A 4AU0A 2E67A 1ZUAX 3IVSA 4F9JA 5PTDA 4HA1A 4Q8QA 3RLGA 2QDDA 3PS7A 5DLCA 4QM1A 2CITA 2FZBA 4F3HA 4YTQA 2EKCA 2Y4SA 3AIVA 3DGBA 4FI4A 3CWHA 5M1TA 2GDUA 3N73A 1EKOA 1XYCA 4UIOA 3AISA 1E6QM 1GOOA 2NX9A 3NVDA 4NASA 5BU6A 2Z1KA 1BWVA 1AZ2A 5B7YA 4HQVA 2HK0A 5D2YA 4GXMA 4N4QA 3BL3A 3E12A 3WK1A 5U7SA 4OBSA 3DFOA 1UMYA 1ZALA 4H01A 3C2OA 3W1UA 4RCXA 3GG8A 3MI6A 3S5SA 3FXGA 4WY0F 2VQUA