1FH8A

Crystal structure of the xylanase cex with xylobiose-derived isofagomine inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed structural analysis of glycosidase/inhibitor interactions: complexes of Cex from Cellulomonas fimi with xylobiose-derived aza-sugars.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords BETA-1,4-XYLANASE
total genus 128
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fh8A00
3F5JA 3N13A 4PTWA 2PI6A 2YBTA 2DH2A 1E4MM 1UQZA 3KL0A 1ZBKA 2DT0A 4W8LA 3WDHA 1M03A 2EPLX 2HISA 1ISVA 2E9LA 3QOKA 1E4LA 4AYSA 1ISWA 2E4TA 3RMEA 4ZFMA 3WD3A 1E3ZA 1DWIM 3CUJA 3HU7A 1C8YA 4E2OA 4AD1A 1WNOA 3KEHA 4JFWA 5A8MA 4H2CA 2XHYA 3W25A 4YHGA 1DEDA 1NP2A 1MWOA 5AYBA 2FDMA 3MUIA 3N04A 2C7FA 3PZNA 1H5VA 4MB1A 5CQ1A 3SCRA 1C8QA 3L4YA 2VVSA 2XFFA 4P7OA 5IDIA 1FP8A 4AY1A 1QOXA 4ZENA 1H0GA 4YPJA 3ZM8A 3WH5A 1TA3B 3KE0A 3WQ4A 4UQCA 5AC5A 3MV01 3CMJA 2VOTA 4CU7A 1IZJA 4AD2A 3GBEA 3ARUA 4WSKA 4AEEA 2A3HA 2GJXA 4P7QA 4IPLA 4PUEA 4UQ9A 3AI0A 4WK9A 3VGEA 3EDEA 1B3XA 5CLWA 5EBAA 1QHZA 2CERA 1HKKA 4WKHA 4HMCA 1FP9A 1HL8A 1UR9A 1P6WA 2WANA 3ZO9A 3WH7A 5GNZA 1V02A 4KMQA 3U5YA 2VNCA 5DEZA 1CLVA 2J7FA 4S3JA 1OCQA 5CSUA 2ZXQA 3MMWA 2AAAA 4CCEA 2VRQA 2PWFA 1UR4A 1QNOA 3AHVA 3W53A 1B31A 2W4XA 1PX4A 4AD4A 1SMAA 3VD7A 1GJUA 2RGLA 4QDMA 5ECUA 1TVPA 1XYFA 2PBGA 3I3BA 2OSXA 2QLYA 2BHZA 2ZXAA 3OGRA 1UWUA 4PMVA 4D6JA 3N9KA 2F2HA 3WD0A 1UUQA 4J27A 4AZ6A 4H8VA 3WD1A 3HJEA 4F79A 2BXYA 3NDYA 4QFUA 1Q6DA 2A3EA 5D8WA 3F5KA 1NP0A 3VKKA 2ZUUA 3PZUA 1OSEA 3W6LA 5I77A 3T09A 2ESCA 3A6OA 2CYGA 4U2ZA 3VU2A 4WKAA 1NWTA 3AIWA 2OYMA 4TUFA 4TX6A 4AZIA 4LPCA 3U5UA 3CHCA 2CBJA 2ZICA 2BNJA 2ZX8A 2YBUA 4MNJA 1CXFA 1UWTA 3M07A 3TTSA 3WELA 5HPOA 1E1FA 1M04A 2DIJA 1EDTA 3CZKA 3I3EA 1C91A 4GIAA 1U2YA 4QCFA 3AMLA 2D3NA 2CXGA 3SCPA 1JZ7A 5CJ5A 3AXIA 4PTVA 1GOOA 1W32A 1SFSA 1CGVA 5BWFA 2BVDA 4W5ZA 1JAEA 3WIJA 2PWDA 5D9NA 3ZOAA 3GXDA 1HX0A 1WZAA 2J77A 3VUPA 3AIUA 2J79A 4B16A 1GONA 4GPNA 1PBGA 3OB8A 3FY1A 1HNYA 3PHAA 2YOCA 1VF8A 1BYCA 1ODUA 4WSJA 4TVCA 3OGSA 1K9TA 1UYQA 2UY2A 2J75A 2XFRA 1K9DA 3BAWA 5I79A 1UWIA 4NZCA 6A3HA 7TAAA 1OT1A 3LPOA 2GJXB 2WB5A 2FHCA 1UD8A 2W91A 1MW0A 2V3EA 1QNQA 4J7RA 4GQRA 2BY0A 2Y4SA 2WHJA 4W5UA 1GOWA 1CGXA 2VR4A 4JIEA 1J0HA 1BFNA 4CGTA 1IT0A 5M17A 4HU8A 4B3KA 2XVLA 2EQDA 3SURA 3CIVA 1MQPA 4UQBA 4FLRA 3QR3A 1KXVA 5IHRA 5IXEA 2WK2A 5D9OA 3WQ5A 2DSUA 2VQUA 3CZGA 3WF3A 1W1TA 2V3FA 1VIWA 4JAWA 1E6XM 3AHZA 1J10A 2YA2A 4JCMA 3CUHA 1TCMA 1KBKA 1EXPA 4Z2GA 2VZVA 1OT2A 2G8ZA 3M6DA 1LG1A 4WLCA 3POCA 2XM2A 4UOQA 1UZ4A 2RGMA 1B3ZA 1NOFA 3U7BA 1TFVA 1KWKA 4HZ8A 3BLKA 3OLDA 3B9AA 1TUXA 3AS2A 3N12A 3WBAA 3A3HA 1R87A 1BHGA 2WLZA 2VQTA 1WDSA 1BF2A 2J62A 1JI1A 5M03A 1JXJA 1BAGA 1WKYA 2OWWA 4DUVA 1RPKA 1WZKA 1FA2A 2BVTA 2E9MA 3AYSA 3OG2A 1LL6A 1W9BM 2XGBA 1HKIA 1CDGA 1OBAA 1KGUA 3NSXA 1EHNA 4W88A 1KR1A 3AIBA 1YHTA 5E6YA 3GH4A 3CZ8A 1DP0A 4PUDA 4M82A 1KXQA 2XYLA 4HZ7A 5A8NA 2MANA 3WL1A 2J7HA 4F66A 5JIPA 1EDGA 3ZT5A 5CXPA 1UWQA 5A8QA 1C90A 2WKLA 2WYSA 1ZB5A 3AS0A 4UFHA 4AISA 1GHRA 1JZ8A 3W28A 3VGBA 1VFFA 2VZSA 4Y7EA 1OWQA 2FHBA 3RCNA 2VZTA 1KWGA 4N42A 5I24A 3VDBA 1HP5A 1RH9A 4CD4A 3SCUA 1GQLA 2WHKA 5I78A 1CGWA 4U33A 1J01A 1N82A 3TP4A 1W9XA 2E40A 5TD4A 4QLLA 2BV9A 3K8MA 4MB5A 4KWUA 1K9EA 3GM8A 2J7BA 4V2XA 4FLOA 5AYIA 4X0NA 2WVUA 3GNPA 1E56A 1M53A 3W24A 4DM1A 1UD3A 1VBUA 5FKYA 1HJUA 2X09A 3UCQA 3T2OA 2E8YA 2WNWA 3JUGA 4IISA 2QPUA 2WAGA 4AIEA 2VC9A 2J74A 2DT2A 3B9EA 2Z1SA 4P8UA 5LA1A 5D9PA 3ARZA 1JNEA 4D6FA 3POHA 3DHPA 4PBGA 4W85A 3W81A 4ATDA 2YA0A 4J3TA 5DT5A 4NF7A 1ESWA 2ZUWA 1VJZA 1LWJA 1ISZA 3WMBA 1UD5A 4UOJA 2WC3A 2PBOA 2WVVB 3GBDA 5A2CA 3WQ8A 4XUYA 2JE8A 2ZXBA 3BSHA 1H09A 3GZAA 4BZYA 3MANA 3EMZA 1OD0A 1JZ6A 1IZKA 2NSXA 1TZ7A 4U5IA 4A3HA 4OZOA 5CLTA 4FF5A 3M7SA 3VIOA 1NWSA 2J8FA 5FOOA 1FH8A 1V0NA 1CXEA 1UA7A 4D71A 5A2AA 1V6XA 2IUZA 4MJ2A 4D6DA 1CXIA 1DWJM 1E0XA 1E0WA 2J78A 3WMCA 3ZMRA 5LA2A 1C93A 5GPRA 3WUGA 1QHOA 1DHKA 1ITCA 3VIHA 1JYWA 3DYOA 5FL0A 2X8RA 3CGTA 4M29A 1AVAA 1QHPA 4GZIA 4U31A 4M24A 1E6QM 5I5RA 1XH2A 3WFZA 2CEQA 3SIMA 2EPOA 1GOMA 2WKGA 3AMKA 3NDZA 4HPHA 3WD4A 1UR0A 4X9YA 1FHLA 1UR2A 1R86A 1V03A 2DSKA 2YA1A 4H41A 4K68A 2YDSA 3OZOA 2EXOA 8A3HA 3NJ3A 1B3VA 1QBBA 5E6ZA 1JAKA 2D22A 5LA0A 4LXFA 4MTVA 1W9VA 2PWHA 2EPNA 1HL9A 4W7VA 1CGTA 3AS3A 3K8KA 3TA9A 1QBAA 1VEMA 4MB4A 1KR0A 1YQ2A 2DH3A 2Y5EA 3NSMA 4J28A 1W9DM 2CCRA 1QNRA 2VZUA 4J3VA 1V02E 1V6WA 2WXDM 4ZXLA 3BAXA 4W86A 2F8QA 5LYRA 3NIYA 4H04A 3IK2A 4P8WA 3WDIA 5F7UA 2FGZA 4CN4A 1QNSA 3DC0A 4XZBA 3CPUA 2OSWA 5E09A 1UG6A 2VVNA 1UR1A 2YDQA 5A6MA 1GZJA 2WC4A 3KL5A 1OIMA 4DWSC 4W7UA 2QF8A 1JDCA 4C7DA 5C71A 4UZSA 3J7HA 1NQ6A 4URIA 3U57A 3PZQA 2UWFA 4NI3A 4TTUA 3NCOA 5HXMA 2QHAA 3LPGA 1V3HA 3AQUA 2TAAA 4TOQA 1KXTA 3WF1A 3W82A 3ZR5A 1IV8A 2JF7A 3WNLA 4XZWA 3K8LA 1BQCA 1V3KA 3IANA 2WCSA 5C70A 1VFMA 1MFVA 3GXIA 2J8GA 4CD8A 2YL5A 2VX4A 3WH8A 1TA3A 5CPSA 3CHDA 2E3ZA 5HPCA 2QV4A 1GQJA 1VFUA 1A47A 1G9HA 3CTTA 5GNXA 2PB1A 4UCFA 4P8XA 4CN6A 4CCDA 2D0FA 1E0VA 3VMPA 1L0PA 3CH9A 4YHEA 4WIWA 2WZHA 1XH0A 5DO8A 1ISXA 1OGGA 2GVYA 1O7AA 3ZJ7A 4W84A 1DWGM 1RD6A 5HBFA 1DWAM 3QGVA 4AZ7A 4U5KA 5EB8A 2ZE0A 2DQXA 1W3KA 1H11A 5CPQA 3WF4A 3WUBA 4GO8A 1LL4A 3SUTA 1JL8A 3WH9A 4C7GA 3EDJA 1BPLB 2BHYA 2XPKA 2VRJA 4AZHA 3VD4A 1JGIA 2G3JA 2VUYA 2DSZA 4CKQA 4PRWA 3LPPA 4JKMA 1OM0A 1WO2A 1GJWA 1C3FA 2WHMA 2XGIA 2WMJA 3W29A 1E5JA 1R85A 4PEEA 1UA3A 3SEPA 3PZVA 2WSKA 1H41A 2WZEA 1EH9A 1PAMA 1B30A 2J4GA 4OOUA 1U33A 3FW6A 3AIVA 3EBVA 4BQ5A 4F8XA 4MNKA 2J25A 1UD4A 1KXHA 2WHLA 4GI6A 3SCSA 6CGTA 3K4AA 1JD9A 5JUVA 4PTMA 4EKJA 3RM9A 3T2QA 4ML4A 3CUFA 5GQBA 2WMIA 4DM2A 1Q6GA 4AD0A 1JDDA 3WDRA 1PX3A 1UKPA 1VENA 1BTCA 1HVXA 3RM8A 1CECA 4IUGA 4D6HA 4MJ4A 4D1IA 2X2YA 4EANA 1H1NA 1R7AA 3A4XA 4GQQA 5A6SA 1JI2A 4GO9A 1ZS2A 3VVGA 2DPEA 2VT0A 3DHUA 3G6LA 4XX6A 3NUKA 4BS0A 4M1RA 4CUCA 1VB9A 1XCWA 6TAAA 3QOMA 4AZGA 5GNYA 5A6BA 4HTYA 4PMOA 1CXHA 2XJ7A 2VR5A 4V28A 3VDCA 1GW1A 3WKZA 1PZ3A 3WSUA 1GNXA 2CBVA 4BQ2A 2YLLA 4KRTA 1GOIA 1B9ZA 1PEZA 2VX5A 1ZL1A 1VEPA 1AQHA 5JBFA 4MAZA 1HT6A 2DT1A 3BCFA 5DT7A 4PMNA 2VURA 4FK9A 2V38A 4D6GA 2JF6A 1LJYA 1QI5A 3AIRA 1ZU8A 5I23A 4IM4A 3BAYA 3WEMA 1UKSA 5EFFA 2ZUSA 3GXFA 4TVUA 2D23A 4J3WA 4NSBA 5BRPA 1WB0A 2XSBA 3WF0A 3VD3A 2PC8A 4B9ZA 4H8UA 3VDAA 1J0ZA 1E4IA 1CTNA 1S46A 3ALFA 3T0DA 3FAWA 5ABEA 2VJXA 5FIPA 4JFSA 2G41A 4MNMA 2E8ZA 7CGTA 1VEOA 3O6AA 1H4PA 3WN6A 5A6KA 5IFTA 1NOUA 3ZJ6A 1K9FA 2J47A 3MS8A 3AMCA 4HA1A 3ALGA 1GOQA 3UR8A 2W62A 3GNOA 3PN8A 3WNNA 3AOFA 5CGMA 1HP4A 3QHNA 1E55A 1BYAA 4HP5A 3T08A 3TOPA 3VX0A 3VNZA 3FHQA 2ZWYA 3II1A 5CGTA 1NARA 3GDBA 5BXRA 2DEPA 2CPUA 2JFEX 1V3JA 3L4WA 1TR1A 2BS9A 2D0GA 1SMDA 1EA9C 3AZSA 1E71M 5BRQA 3DYPA 3K46A 3UG3A 1E6NA 1B3WA 1XSJA 2V5CA 4A4AA 1Q6FA 1BLIA 4W8BA 1XHGA 2FH8A 1GVYA 5IHSA 1JZ3A 2XVPA 4MPKA 5I3DA 1KQYA 3A47A 2Y8VA 3AHTA 4PMRA 1AQ0A 1J11A 1KCLA 1PPIA 4TX8A 3WFLA 4HA4A 3SUWA 4UFMA 3FN9A 3D3AA 1MW2A 1CXKA 2IXUA 3AS1A 1E40A 2OYKA 4MADA 2X0YA 3RM4A 1CGYA 4DWSA 3MMUA 3PTQA 1HN1A 1WPCA 1NWUA 1TE1A 2WPGA 1MXDA 1XH1A 3WH6A 3IJ8A 3WNMA 1PIFA 1I1WA 3WD2A 4M81A 3VTRA 1HJVA 1V08A 1M7XA 4JL1A 2GJPA 3EMCA 3VIIA 2VX6A 1OB0A 1LF1A 2E0PA 4Q7NA 2QPSA 2OWCA 4W89A 1J9YA 2YKKA 1GUVA 3AYRA 2WWCA 1DWFM 4HOWA 3PZ9A 8CGTA 2O9OA 3O9NA 4AZ5A 2PWGA 4N0RA 4ATWA 1C92A 1CWYA 1X6LA 1WDRA 1JF6A 4GZEA 4EE9A 1E70M 5A3HA 1Q4NX 2X0HA 1ZBCA 1H2JA 3VIPA 1JZ5A 2VCBA 4UFKA 1W1YA 3VIJA 2XVKA 4UFJA 1B2YA 1JYNA 4TTGA 4PYSA 5A2BA 2VL4A 2Y24A 3FHAA 4B9YA 5DFAA 4L4PA 1G01A 1XV8A 4B15A 2XTKA 4QLJA 1E1EA 1QI3A 2VO5A 1TVNA 1XGZA 2EO7A 4S3KA 4BQ4A 2W67A 4TVDA 3A4WA 1W1VA 4AZBA 1JIBA 5A6JA 1HF6A 4JKLA 2G3MA 2CBIA 1U30A 1VRXA 3ZSSA 1LQ0A 2YDRA 5D4YA 1W1PA 4U2YA 3S2CA 1J18A 3WBEA 2YL9A 3WQ6A 5I0DA 1ZJAA 1BGGA 1QI4A 1SR0A 1US2A 5A8OA 1K6AA 4QLKA 4V27A 3WNPA 1PZ2A 1L8NA 2W92A 2DSWA 1D2KA 1QPKA 1CLXA 3VGHA 3VIGA 2J7GA 2VI0A 2WVSA 2XVNA 4UOZA 3KZSA 1OD8A 4GINA 5CZKA 1CIUA 3RJYA 1B3YA 1GCYA 4FLSA 3THDA 5CPTA 3UG5A 3EYPA 1EOMA 3MSDA 4UNIA 1R7OA 3GNRA 4MAVA 3RDKA 4RE2A 4W7WA 1E43A 1XD1A 3AZRA 3F4VA 4Z2LA 1GQIA 1CZ1A 2CHNA 4ACZB 4DWSB 4P7NA 3B9DA 1XC6A 3WMSA 4J3XA 3VIMA 3THCA 3VPLA 3W37A 4LYPA 1BG4A 1G94A 4CVUA 3BAKA 2JEQA 2Q8XA 3PZGA 3WL0A 1J12A 2G3NA 1WCGA 3DECA 4B3LA 2BXZA 3W0KA 4P8VA 2W61A 1ODZA 2VRKA 1UD6A 3PZIA 2EBNA 4CU8A 2JIEA 2ZUVA 3MU7A 1EDQA 1B0IA 5BXPA 2GK1A 3OGVA 1W2VA 4PSRA 4OOZA 2B31A 2O9TA 2GUYA 1CEOA 2BY3A 2XSAA 5E0FA 3CUGA 1UR8A 3AMDA 1WDQA 4JZ5A 2J7CA 2WCGA 3VO0A 4ZXOA 4PMZA 1V3MA 2XG9A 2A3CA 2FGLA 2WCAA 4FLQA 3VIFA 3W27A 2NT0A 3MUZ1 1J0JA 1HJWA 3CO4A 1FFRA 2WMHA 5D9MA 1E3XA 1GVIA 2CBUA 1E6ZA 3N1AA 4QP0A 2C0HA 2CKSA 4AIUA 4NRRA 3OLGA 3OZPA 2VZOA 3O2LA 2YLAA 2ZWZA 4HOXA 3BSGA 4PCSA 1HKJA 3RILA 1W91A 2WLYA 3WNOA 1CBGA 1HJXA 1EQCA 2QMKA 2WZIA 4EAMA 1WE5A 1EGZA 1BYBA 3OLEA 4BA0A 1EO5A 1I75A 3VDHA 3K4DA 1E15A 2GJRA 2CESA 1UZ1A 1TMQA 1MW1A 3KL3A 1E6SM 4PCTA 5FD0A 3GH5A 3WEZA 5FL1A 1AQMA 2OSYA 1V6VA 2BHUA 1H3GA 3MV11 4LYRA 5A94A 1Q6EA 3AZTA 1ITXA 4HZ6A 4GXPA 2WW5A 4AW7A 3WNKA 4WF7A 2NT1A 4D72A 1E9LA 4UR9A 1H0IA 4Z2HA 1G0CA 2EEXA 4QCEA 2D3LA 1VJSA 5D8ZA 3IAPA 5M3WA 4AD3A 1G1YA 3WDJA 3VX1A 1JFHA 1UKQA 2NW0A 3BGAA 1HKMA 4BCEA 4Z2IA 4OJYA 4ZE5A 3RO8A 3SCOA 1E6PA 1UD2A 1JZ2A 2DSVA 1NWRA 2PF0A 1D7FA 1MQRA 1FH7A 2WBKA 3L4XA 1Y7VA 3OBAA 2ZX7A 4UFLA 4Z2JA 2WVVA 1GHSA 1UWRA 1HVQA 2WMFA 2UY4A 2WMIB 3EDFA 2CETA 3VMOA 4CVWA 1JFXA 2DIEA 2O9RA 5HDRA 1KBBA 2OYLA 2GDVA 2Y2WA 4CD5A 1TG7A 3N11A 1Q6CA 3EDDA 2ZX5A 1PX8A 3FXYA 3WQVA 4OIFA 4KGLA 2WWDA 4NRSA 1JNDA 1O6IA 3CZJA 1NOWA 3NYDA 4RE4A 3G6MA 3AJ7A 4FMVA 3PTMA 4L4OA 1UWSA 3OLIA 4UQAA 1QW9A 1JD7A 1HJSA 1JYXA 1B90A 4WKFA 1EIBA 5JBEA 4CN1A 2GFTA 3CUIA 3ZR6A 4BQ3A 1KQZA 3ARXA 2G4FA 2W66A 5BROA 2WSPA 1RP9A 5EMYA 2E9BA 3UETA 3BXWA 5A8PA 4UTFA 1GORA 1NH6A 1ISYA 1BYDA 3GYCA 2W63A 1SYTA 1UH2A 3ARQA 3EDKA 4CD7A 3PZMA 3U7VA 3EMQA 1BVZA 5A69A 4DWSD 1X1NA 3N17A 3VNYA 2QMJA 3LMYA 3M46A 4D6IA 1KGWA 3CZEA 3W38A 4M8UA 5BXTA 4JKKA 4MB3A 3TTQA 2FHFA 4ZE4A 1V3IA 1H49A 5ABHA 1BSIA 3L4UA 1XSIA 1ZBWA 1MVYA 4LGXA 3IJ7A 1F4AA 1W9PA 1J0IA 1G5AA 1UOKA 3T0BA 4AEFA 1B1YA 4UZUA 2YL8A 2Z1KA 2XWEA 2ZOXA 5HNNA 4GKLA 3VMNA 4P7LA 2BY1A 2AMGA 2JEPA 2CITA 2CIPA 4E4PA 3ARPA 4M80A 1WAWA 2G3IA 4HOZA 1D3CA 4ACYA 2V3DA 4QAWA 3VILA 3E1F1 3MMDA 1EO7A 3BLPX 4LYQA 2YJQA 3CBWA 2YIHA 1QI2A 1MYRA 2DDXA 4DUXA 1KGXA 2V3GA 3BMWA 2J7EA 4PTXA 2XWDA 2AOSA 1QVBA 4U3CA 1JXKA 4OBSA 3FAXA 3WDQA 2D1ZA 4E8DA 4AD5A 3VGDA 7A3HA 3VM7A 3SUUA 1BG9A 4AXNA 1FHDA 1CENA 4MNLA 5KZ6A 3AROA 2CNCA 3TTOA 3WUEA 2VCCA 3L4TA 4LX4A 3W6MA 4W93A 5BCAA 2CKRA 2FH6A 5I2UA 3RPMA 3MKKA 1MXGA 3CLWA 4PSPA 1V6UA 5A1AA 5ABFA 5AC4A 3CHFA 3CMGA 5ABGA 5KEZA 2XVGA 2XM1A 3FNDA 4A3YA 2O9PA 3ARRA 3AIEA 4JHOA 3ZT7A 4AC1X 3WY1A 3AHXA 1XRVA 1V0KA 3ARSA 3QHOA 4WJXA 4AMCA 3IJ9A 1UKOA 3UEQA 3SCTA 2J7DA 1C8XA 2A3AA 4Q22A 4KGJA 2YL6A 5A6BD 5HOSA 1FFQA 1M01A 2EJ1A 4RL3A 3AISA 4GZJA 3SUVA 4ACZA 4CD6A 2EPKX 5A6AA 3IAQA 4MDOA 1XD0A 3OA5A 4OKDA 1GPFA 3S6TA 2X05A 1BGAA 4UFIA 2ZUNA 1Z32X 4MDPA 3BH4A 1E5NA 3W4RA 3W26A 3L4VA 1MQQA 4CU6A 2IXVA 3DYMA 3PZOA 1E73M 4GI8A 4ATLA 1XYZA 1V6YA 3VD5A 4AZCA 4TXEA 5FCZA 4LQ1A 3PTKA 4YN5A 1F4HA 2GK1B 3BMVA 4XV0A 3K1DA 3L2LA 1RP8A 5CSYA 1EQPA 2WM0A 4HU0A 1I1XA 3APGA 1V3LA 2O92A 2VTFA 3CZLA 1W3HA 1C7TA 3WDPP 3WQWA 3MO4A 1JYVA 1A3HA 1C7SA 4EK7A 2CHOA 5I6SA 2ZUMA 4R5EA 1W3JA 1CGUA 1KFWA 3NSNA 3ARYA 1UH4A 3TONA 5IFPA 2WMKA 1FOBA 3ZQ9A 1BVNP 4PN2A 1GOKA 3UESA 4HPGA 4DUWA 3VD9A 1ZBVA 4W8AA 1WDPA 1CNVA 1W3LA 1R8LA 4PMDA 1EOKA 3GTNA 5A95A 3LPFA 4F9JA 1AMYA 4OUEA 4JFTA 4U3AA 2D24A 3ZT6A 4D1JA 4BF7A 3AHYA 1CXLA 3N18A 2Y8KA 3WENA 1JF5A 2UY3A 3GXMA 3BC9A 3AXHA 2XUCA 3MUAA 3ECQA 1NM9A 2X1IA 1QI0A 2VCAA 1ZJBA 3ZIZA 4PMQA 2ZIDA 1JZ4A 2D20A 4H7VA 2WC7A 3L4ZA 4UQDA 3WEOA 5ABFB 9CGTA 1US3A 2C8NA 1XCXA 3SUSA 1LWHA 3TTYA 1E72M 1JG9A 2GSJA 1LG2A 3VGFA 1HXJA 3SCWA 2DT3A 3ARWA 5DMYA 4J3UA 2JALA 1WZLA 4UQEA 4AZCB 1GQKA 1QW8A 3OIHA 4GI9A 2XFYA 3GH7A 4H8HA 4HMDA 1VFOA 1EHAA 3VIKA 3PZTA 4JHZA 5BYWA 3ARVA 2OWXA 3BAIA 5AY7A 1UKTA 1XSKA 4CCCA 4AWEA 5C8BB 3ARTA 4JFVA 2XIBA 3I3DA 2DGAA 2F61A 4ZEPA 5M5DA 2D0HA 4C7FA 1LLOA 2W5FA 2VX7A 4D6EA 3VM5A 3UG4A 3UR7A 1DWHM 5CG0A 1MW3A 2JIWA 4RE3A 4M56A 3B8SA 1DTUA 5JIWA 2XIIA 4X0VA 4R27A 3T2PA 1HJQA 5A6LA 4JFUA 1WZMA 1CPUA 2BVYA 3N15A 2PWEA 3D5HA 4KH2A 5DF0A 4HA3A 5E0CA 2UY5A 4E8CA 3HMCA 3UERA 3F5LA 3WF2A 2VMFA 3ZJKA 1UQYA 3QHMA 5JBDA 3AIQA 2WBGA 4J3SA 1PIGA 1J0YA 3SCQA 4XB3A 2ZX9A 4AIOA 3VINA 1J0KA 1VBRA 1X6NA 4JL2A 1FH9A 3KWXA 3VOCA 3AFBA 3MSGA 1ECEA 1KB3A 2BFGA 3CHEA 1OGBA 4F9DA 2ZX6A 3ZJ8A 2WMGA 3BCDA 1UHVA 1UH3A 4Z2KA 3RJXA 4HMEA 3AMGA 4OBRA 5EFDA 4KRUA 1KCKA 1V0MA 1OGSA 5E70A 3SCVA 3AICA 2ZUTA 2HVMA 3BAJA 1CYGA 1E4NA 4PMXA 3VGGA 3MUY1 4D6CA 1LL7A 3RIKA 3L2MA 3A4AA 3WUFA 1V0LA 3T0AA 1OIFA 3HN3A 1OINA 1PJ9A 4PMUA 3PBGA 4PMYA 4JCLA 2A3BA 4P7RA 5BXSA 2GDUA 1HIZA 5E9AA 1QNPA 1JDAA 3AXXA 3SCNA 1E6RA 2OLHA 2WVTA 1WP6A 3ZSTA 2ZXDA 2V5DA 4IPNB 1MFUA 1W9UA 4W87A 2EPMX 1VAHA 1W2PA 2D2OA 2BY2A
chains in the Genus database with same CATH superfamily
3UXIA 1DXIA 2OZTA 1JUEA 1UQZA 1XLDA 4Y8FA 5AYZA 4GQGA 2J9YA 2DT0A 3WDHA 2HISA 1GKRA 2EPHA 1ME9A 3RMEA 1H7NA 3WD3A 2BWGA 2X40A 3CUJA 4HGXA 1VP5A 1SVDA 1BF6A 3EX1A 2CZEA 1DEDA 1NP2A 5AYBA 4C5YA 3BLOA 3PZNA 2C7FA 2Y1HA 1C8QA 2VVSA 3RCMA 4Q4KA 5HJYA 5IDIA 5LIYX 2X41A 1H0GA 1WUFA 4MYAA 3XIMA 3BOLA 4X63A 3MV01 3P0XA 2TYSA 3I65A 4AD2A 3G1VA 1PHQA 3NQBA 4GYFA 3TR9A 5JVLA 1O5XA 4IPLA 1A5SA 3A3WA 3CTLA 1SW7A 3VGEA 2DJLA 5CLWA 2HEJA 1EWDA 1QHZA 4WKHA 1KFLA 1UR9A 3ZO9A 1XBVA 3U5YA 2VNCA 1CLVA 1TUFA 2C1IA 4S3JA 3SQMA 5CSUA 4LEFA 2ZXQA 3MMWA 4Q8UA 2YSWA 4YWSA 2CHRA 3VD7A 1OFEA 2RGLA 4QDMA 1K02A 4NYUA 1FVPA 4EWJA 3GHRA 3UNTA 2PZ0A 2PDCA 4PMVA 3URQA 2WNQA 2I56A 4C65A 2QVNA 4JTUA 2F2HA 1UUQA 1ONEA 1Q8JA 4A05A 4AZ6A 1RQHA 5BMXA 4JTSA 3TJ4A 1TRDA 3F5KA 2ZUUA 5T8GA 3W9ZA 1OSEA 5I77A 3A64A 2BXVA 2E6YA 2ESCA 2ACUA 4M3PA 3VU2A 3ZVHB 2PRLA 4LU0A 1S2VA 2ZX8A 4RDZA 2WPBA 1Q8AA 1VRDA 3TTSA 4LBUA 3M0JA 1M04A 2DIJA 1EDTA 4XSMA 4GIYA 4GIAA 4FALA 1Q2SA 3UW6A 3AMLA 3EB4A 3THUA 2CXGA 1WBJA 1EC7A 4PC8A 3AXIA 3E5PA 4GD0A 1GOOA 5BWFA 1XQLA 1TIWA 3WIJA 1AFSA 2YCJA 1OFOA 4UBPC 3GXDA 3N2TA 4EWND 2OB3A 3TQVA 4B16A 1JQVA 4GPNA 1YXCA 1PBGA 3OB8A 3TSDA 2QDEA 5L9FA 2X42A 1ODUA 1GTEA 2IKJA 4JTQA 1K9TA 3WX7A 1UYQA 2UY2A 4NZCA 4IP5A 2XSXA 4Q32A 4GX9A 3LCWA 2GJXB 3C2OA 1UP2A 1UUOA 3TYZA 3S0CA 2BY0A 1OFPA 2WHJA 4W5UA 5EBUA 3W7MA 2IQTA 2Q71A 1F3EA 1TZ9A 1DOSA 3S8HA 1O5QA 2BGSA 3CIVA 4FOUA 4ADUA 3QR0A 3HBLA 4LB3A 4C5ZA 5IXEA 3WQ5A 3UJSA 2PCQA 4DJFA 2VQUA 5ABTA 3CZGA 1W1TA 3LLFA 3C2VA 1E6XM 1RSCA 1SSDA 4L65A 4S3DA 3EA3A 2X1TA 1TZZA 4H00A 4GE8A 4J2MA 5AHFA 3GRIA 4Z2GA 3PANA 3NQEA 2GUUA 4MFDA 4A8IA 5ECVA 3H2OA 3G1XA 1B4EA 1TTIA 3CWOX 3BLKA 3OLDA 1OX6A 1PO9A 4D2JA 1TUXA 4YL2A 2B7QA 4JXCA 2YX0A 3GTHA 1R87A 3DG6A 4DQWA 3PG9A 1WDSA 1BF2A 2J62A 4NG3A 5M03A 1JXJA 3DX5A 1BAGA 3RLVA 4O1EA 3BK0A 1WZKA 2FZBA 2BVTA 3AYSA 1LL6A 1W9BM 3FOKA 2QCCA 1CDGA 1PCWA 4LH8A 1OBAA 2WKJA 2P1FA 3AIBA 5GJMA 3GH4A 1L2QA 3FDKA 3E02A 3DFPA 1KXQA 3GFZA 4LUTA 3WL1A 5C5YA 1EDGA 1POJA 1T40A 4UTKA 1DXFA 2EG8A 3GNXA 1LORA 3BOFA 1QDSA 1GHRA 4Z0SA 3LLXA 1JZ8A 4H6KA 5D03A 1VFFA 4Y7EA 4QQ3A 3CNYA 3T42A 3RMJA 1KD0A 1E0TA 1PKLA 1QFEA 2Q8ZA 2PD5A 4CD4A 1GQLA 4KEVA 4GJJA 3WBXA 4DXXA 1GTHA 1W9XA 5TD4A 4QNWA 2CW6A 4FLOA 1IIGA 1RLDA 2QAFA 1FCQA 3GNPA 1E56A 3JVAA 3WFAA 1EYEA 3L5AA 3T2OA 3E0LA 2E8YA 3JUGA 1AJ0A 4AIEA 4ROQA 4GCXA 2VC9A 1U5JA 3B9EA 3ANYA 1LBLA 3TN5A 2Z1SA 3KOYA 5LA1A 4ATDA 2YA0A 4J3TA 3OPSA 5DT5A 1ESWA 2NQHA 1TWIA 2WC3A 3O06A 5AHLA 1M41A 2WVVB 6TIMA 3BJSA 3HPZA 4I9TA 3WQ8A 4QBXA 4XUYA 1W54A 4ZO7A 4CNNA 4BZYA 3PAJA 3MANA 1IXPA 3W71A 4N2YA 2PP1A 1IZKA 3TW7A 4ZGYA 3IS4A 4U5IA 4A3HA 5HMSA 3FYYA 3QZAA 3F2BA 1GVSA 1N8WA 1AW1A 2IUZA 3BCJA 4D6DA 1FUYA 3ZMRA 3N6HA 5GPRA 2PDLA 1QMLA 1SFTA 3EOSA 1XGEA 3CGTA 4Q4RA 7ENLA 4GZIA 3G77A 1E6QM 1VIZA 4FR6A 3W7JA 2EPOA 4Y9MA 2HNEA 3IJDA 1VQTA 4AWSA 1Q13A 3H2MA 1UR2A 4YYCA 5EY5A 1V03A 4GQ0A 4MWAB 4IIGA 2R94A 3PNZA 3OZOA 3N73A 1PWMA 1B3VA 1JAKA 5LA0A 4X61A 3ORWA 1OFRA 4LXFA 4N9EA 2VKZG 1HL9A 4P61A 3ISIX 2TSYA 3K8KA 3TA9A 1LT7A 3M0IA 2DH3A 3QTGA 3SQSA 1IGWA 4J3VA 1V02E 4RKAA 2WXDM 4WQ6A 3HGSA 3BAXA 4W86A 5LYRA 1GWJA 3PTDA 2H90A 5BOOA 2FGZA 3DC0A 4XSLA 3CPUA 1UC5A 1XIEA 1K7EA 2WC4A 2E28A 4DWSC 1K6WA 2QV5A 3QTPA 1ZP3A 1YPIA 3ITYA 5E0KA 5D37A 2QHAA 1V3HA 1BWVA 4YCPA 3IJIA 3W82A 3ZR5A 4C1LA 3PM6A 3MQTA 4QE5A 1S1PA 4QISA 3TR2A 4P5UA 4IUOA 1M65A 1NDWA 1VFMA 3GXIA 3PJTA 3IACA 2J8GA 3ABOA 1V4YA 3W22A 4CD8A 4I9MA 1VFUA 4QS6A 4UCFA 2V69A 4O1BA 3CH9A 4GYJA 4WIWA 1ISXA 3KBNA 3CB8A 3BANA 3ZJ7A 3N2CA 1DWGM 1DWAM 4N9BA 4Q8PA 3WG6A 2H8XA 4DLFA 4U5KA 2DU2A 3I4EA 1OC5A 4G7EB 1XC4A 4HD5A 4C7GA 2BHYA 4RZ5A 2XPKA 4ZO9A 1JGIA 5LXEA 4ICCX 1EJUC 2MNRA 3EEZA 4LNYA 1FHUA 1D8WA 3LV5A 3LPPA 4XAGA 3V75A 2P3ZA 4RXGA 1C3FA 3GIPA 2WHMA 3CQ0A 2WJEA 3LI0A 1UA3A 4JIIX 4DJDC 4HA0A 3PZVA 1B9BA 1MDRA 2J4GA 1VJIA 3CQJA 1O12A 2Y0FA 3EBVA 3H24A 4Q4MA 4BQ5A 1PZ0A 3CO8A 1YPXA 1PHWA 2NX1A 3LGEA 3R13A 1JD9A 4EKJA 3NYZA 3T2QA 4H19A 2Q3OA 3GIQA 1J6OA 4NU7A 3L2IA 2VFIA 2VFEA 1ELSA 1NU5A 4DM2A 4Z1YA 5FEPA 3W00A 2XH2A 1PX3A 3CMFA 1BTCA 3UA3A 3M5VA 4IUGA 4KRZA 4MJ4A 2X2YA 4XUGA 1NQKA 3A4XA 2QNEA 4XBKA 5A6SA 4K1WA 1J2BA 3FS2A 3P80A 2DPEA 3NUKA 4ORIA 1ICPA 2XZ9A 2Z25A 5GNYA 4GBDA 1XRFA 5A6BA 2Z7KA 3SJNA 4DYKA 3WSUA 3UJEA 4KRTA 1ZHAA 4IX0A 1QRQA 3CJPA 3THQA 4DPPA 2PSNA 1KBLA 1ZL1A 4GVHA 1AQHA 4S3AA 1SJAA 4PMNA 4FK9A 3TEVA 5AHMA 2DVUA 3LRLA 4IM4A 2ZUSA 2D23A 3OYZA 4NSBA 4H9MA 1ZP4A 2G96A 3WF0A 3VD3A 2PC8A 2F6XA 3HFYA 1F73A 4B9ZA 3CB3A 2A3LA 4KEUA 2CLPA 4DJEA 3QSTA 5D04C 5CSRA 3I7RA 4RJEA 2J13A 4AF0B 1JPIA 3T0DA 1GVQA 4ZSTA 2NQ9A 4ML9A 4I6KA 4IGNA 1HKVA 4GCAA 4O1CA 5TBOA 3VKCA 3MUXA 5IFTA 4LW7A 2GJNA 1WXJA 3ZJ6A 3WQDA 2J47A 2Q09A 3A5FA 3ALGA 3G24A 3KW3A 1GOQA 1OY0A 3CC1A 4L1WA 3WNNA 3QHNA 3CT7A 1BYAA 3T08A 5CEWA 3TOPA 3VX0A 3B03A 4JIQA 3H26A 3FEQA 3S5YA 3CV1A 3OTRA 4OU1A 3VNIA 4Y8EA 1EKOA 4S1FA 1R2RA 4DBUA 3GDBA 3N4AA 2PGRA 1T41A 2PCEA 1M68A 2JFEX 3EX4A 4Q6XA 1IWPA 4JTFA 3QQWA 4IP4A 1VBJA 1GEHA 2C6QA 2H3DA 2PE4A 2V5CA 1KV5A 1XHGA 3DOPA 3HPXA 4N6FA 1GVYA 4GGBA 4HNUA 2R14A 1HW6A 4PMRA 2V0TA 4N9DA 5FEXA 3LM7A 3SUWA 3FN9A 1TJRA 2IXUA 3AS1A 1E40A 1YTKA 2X0YA 3VKAA 2ZFAA 1WPCA 4B2DA 2H6RA 1TE1A 2WJFA 3PAOA 3K2GA 5AHNA 4ES4A 1X8FA 3NQ2A 1PIFA 3UZWA 4CQCA 1AQFA 2GJPA 1WOBA 4XAFA 4UTJA 4W89A 2OJPA 3GDTA 3RHGA 5CKSA 2SFPA 1RLCL 6REQB 8CGTA 4AZ5A 3C56A 5H8MA 1F8IA 1KRCC 1C92A 4RW3A 1X6LA 1IHIA 1JF6A 4GZEA 2LLEA 1LROA 5A3HA 4O13A 3DFOA 1TPVA 1JZ5A 3NPUA 4NP7A 2V2HA 4S2CA 4OE7A 4HYWA 4NJKA 2HV5A 4TTGA 3CQIA 4ENLA 4GUIA 2I16A 4B5XA 3FHAA 4B9YA 2H9AA 4B15A 3C2EA 1E1EA 4RCXA 3PUGA 4IPJA 4J40A 4S3KA 4BQ4A 2DUAA 3OW1A 3EGJA 3G22A 1IXNA 5F4XA 3WLHA 1GOXA 2VFFA 5A6JA 1RK6A 2PUZA 2AGKA 1L9WA 1XW8A 2PTYA 1XYAA 4IMGA 2YDRA 5D4YA 2P5NA 1VCVA 1WDWA 3S2CA 1J18A 2CLKA 1R5YA 2G4JA 3WBEA 2YL9A 2OR2A 1UIOA 1TTQA 4QLKA 3WNPA 1XQKA 3GWQA 1SU5A 4MYXA 1QWGA 1TV4A 4XZIA 2HDJA 2VD9A 2XVNA 3VC6A 4F40A 4GINA 3W2JA 1OYBA 3RU8X 7PTDA 1GCYA 2A6NA 5KINA 4XAYA 1X39A 1XF0A 3L0GA 4MAVA 4F0HA 3RDKA 1ZZMA 1X6UA 4S2BA 1EUNA 3JU2A 4Z0JA 4DPQA 1YPFA 3N19B 4O28A 1ZJIA 1GQIA 1LCOA 3A24A 1CZ1A 3PR2A 2CHNA 2GGGA 4ACZB 2VWTA 1IEIA 3AXKA 4EPBC 1XC6A 3THCA 3HG4A 1I9CB 4Y9AA 2Q8XA 3WL0A 4RV3A 4HQVA 5IBXC 3PFRA 2G3NA 4QHRA 1WCGA 4B3LA 3RNDA 1UD6A 3C8FA 1K8CA 3LX9A 4JD4A 4WZHA 3C52A 5FJIA 3BQ6A 4CU8A 2DUXA 4DN1A 3H2CA 3MU7A 1EDQA 4PMJA 3VOGA 3SR7A 1QPNA 5EYWA 5BXPA 3PUEA 3I6TA 4UNLA 4OV9A 4QJ1A 4DJFC 2OQLA 1ADOA 3BPWA 3O1NA 4AVOA 3T0TA 4XD3A 1RHCA 3S2MA 1OEPA 2BY3A 2FIQA 3ZWSA 2FB2A 3AMDA 4LFYA 2WCGA 4PUKA 4WOZA 4XIAA 3W70A 4IFKB 2YBVA 1V3MA 6PTDA 3JZEA 2WCAA 3VIFA 3W27A 2NT0A 3MUZ1 1X97A 3CO4A 3PSVA 2EF9A 5D9MA 1A5AA 3SIZA 1D3GA 3SDOA 2CBUA 1E6ZA 1PKMA 3BG9A 2CKSA 4LVDA 3N3TA 3TQKA 2NVDA 4AIUA 5FJPA 3BW3A 3IWPA 1G7UA 1EL3A 2ZWZA 1MO0A 2VUNA 3F1QA 3RILA 2WLYA 2Y5SA 2GGHA 5E93A 4RPPA 1BYBA 4HCDA 4A3QA 3B8DA 4LAOA 1DJZA 3V7PA 1UZ1A 1TMQA 4BI7A 1MW1A 3HGRA 3QQ1A 4GNVA 4EX4A 3KL3A 2FTYA 1C9DA 1E6SM 4PCTA 5FD0A 3QRHA 2OSYA 1CB2A 3GXTA 4LYRA 3AZTA 1ITXA 2WW5A 4AW7A 1IR2A 1QK2A 2J66A 1H61A 3ZR4A 4QCEA 2A2IA 4UTUA 5D8ZA 4C6IA 3SRFA 3IAPA 5M3WA 1ZSXA 4LUYA 4WDUA 1PSCA 1UKQA 4GFIA 1HKMA 3GDKA 4BCEA 4GZ7A 3SCOA 3RLHA 1JZ2A 3V1PA 3U2EA 2VR2A 1YYAA 2JBMA 3L4XA 5HUPA 1XLMA 3OBAA 5XIMA 1G4EA 2WVVA 1GHSA 1KM6A 1W1B1 2UY4A 3H55A 1XINA 3PBWA 4UMCA 5GVJA 3CIWA 3NPXA 3RO6A 3O16A 1KBBA 1QNVA 1NY1A 4CD5A 1TG7A 1Q6CA 3EDDA 1FCUA 2ZX5A 3LM3A 3OIXA 2ZZ5A 5D2XA 2WWDA 4NRSA 2HVOA 1O6IA 3CZJA 3TA6A 4I5XA 4RE4A 3G6MA 3PTMA 1UWSA 4ZMGA 3UYCA 3E0VA 4UQAA 1TCDA 4DNMA 1JD7A 4WKFA 5JBEA 4CN1A 2GFTA 5LIXX 1KQZA 3LQGA 3MPGA 3O63A 1U5VA 2G4FA 4JX5A 4Q8VA 4IG2B 3O05A 5KZDA 4PZVA 3BXWA 5A8PA 1PTDA 1GORA 1NH6A 1THFD 5H8UA 5G1TA 4CD7A 3SGGA 4ADSA 3NL2A 5A69A 1X1NA 3RXZA 2ONEA 2Y8UA 2QMJA 3S2LA 3M46A 1TPWA 3OHMB 3LSCA 3W38A 1KM1A 5C7HA 1JCMP 4FSAA 4M6VA 1AK5A 1BSIA 1XSIA 1ZBWA 1MVYA 4YVPA 4LS0A 3CM4A 2P8CA 3FYOA 3H2NA 3HIJA 2ABBA 4M19A 4UZUA 2Z1KA 2ZOXA 3SFWA 4GKLA 3VMNA 4C6DA 2JEPA 3MVIA 3P93A 4XZHA 1U5HA 1YNPA 3PSWA 4H9YA 4HOZA 1D3CA 3Q94A 2ZZ2A 1EEPA 3E1F1 2OKTA 1DQXA 3ICJA 4H6QA 1EO7A 2YJQA 4R34A 2POZA 2ZZ7A 1AA1B 3UVAA 3NOYA 4A3UA 2HS6A 5BW6A 1F07A 2AQOA 4IIBA 3BMWA 2RDWA 2J7EA 1QVBA 4U3CA 4V1XA 3FAXA 3WDQA 5D2VA 4LEQA 1RK5A 1EPXA 1WA3A 2IPFA 5FA5A 3SB0A 3VM7A 4B5NA 3SUUA 4AXNA 4POCA 4F2BA 4MNLA 4NKCA 3JZUA 2VCCA 5HA7A 3URAA 1IQ8A 3CHFA 3DAQA 3SADA 5ABGA 3E0WA 3Q67A 4ZSUA 2XVGA 3AIEA 3W2UA 4AC1X 3WY1A 3AHXA 2DFAA 3MHUA 2CLHA 5K9XA 3QHOA 2NWSA 4GIEA 1NSJA 3UEQA 4JTKA 1VFTA 4Q22A 2YL6A 5A6BD 2V5LA 1P5BA 2OCZA 3AAMA 1EZ2A 1SO4A 2I14A 2X16A 2CU0A 1W5PA 3DZ1A 2RHGA 5G5IA 3SUVA 5BU6A 1MEWA 2E6AA 1L2UA 1IIHA 2EPKX 4KQNA 3QR1A 2QKFA 4UCGA 1G4PA 4OKDA 5FAGA 3INPA 1GPFA 1BGAA 2POTA 1PZ1A 4LUSB 1XIHA 5MKGB 1XYCA 1E5NA 5LNVA 3W4RA 1K8XA 2CLIA 2QZRA 3DYMA 3H8AA 2ACSA 3AUOA 2ZRZA 2C1HA 4K38A 3L68A 4AZCA 2Y85A 2NLIA 1EZWA 3R2GA 2XIMA 4TXEA 4LQ1A 2GK1B 3RGTA 3TC6A 3BMVA 4LWWA 4MWAE 2ANUA 4DXKA 3K1DA 2RH9A 5CSYA 1EQPA 3LCXA 4UUIA 4WGXA 2WM0A 1I1XA 1V3LA 5G2IA 1K7FA 3U2ZA 4LAZA 3CAQA 4C6KA 1QJWA 3M41A 4TMCA 5I6SA 4F0LA 3ARYA 4E3VA 3RITA 4B91A 5T91A 4JN7A 4PUNA 3E2RA 1ENUA 1FCBA 2Z2BA 4HPGA 3B8UA 2DZWA 1EB3A 3LUTA 1LDCA 1REQB 3I6RA 4PMDA 4FP1A 3LPFA 1GYLA 1W3TA 1YXDA 4OQVA 3DI0A 3GR8A 4OUEA 3RRAA 4XISA 3CYVA 1UMYA 3NWRA 4DZ5A 1VKFA 3WQOA 2Y8KA 2R24A 2XUCA 3MB9A 3BGJA 5HNRA 1QI0A 1ZJBA 1GG1A 4WJEA 4QGCA 1XIMA 2D20A 4H7VA 3L4ZA 3RN6A 3AU6A 1XCXA 4IPIA 3SUSA 3RRXA 2VEFA 1KFBA 3TTYA 4DI8A 2GSJA 1HXJA 3FCPA 3PF3A 2JALA 2ATMA 3MI6A 3GH7A 4GH1A 3VIKA 1S2UA 1WKDA 2CZDA 3PZTA 2VFGA 1HQTA 3L5LA 1DL3A 4QROA 5AY7A 3BAIA 1UKTA 3GX9A 4AWEA 5C8BB 4JFVA 2XIBA 1MUWA 2BGNE 3WK1A 2D0HA 3TJIA 3ABZA 4WXYA 4LOCA 1GQNA 2JIWA 4M56A 3B8SA 1FWDC 4YTUA 4R27A 4DO6A 4JFUA 2C13A 2PWEA 3D5HA 3T0CA 4EXBA 5E0CA 3UERA 3FGCB 1YBQA 1ICSA 4B5TA 3QHMA 2Z1VA 1F6PA 1KFEA 2YFOA 3BJTA 3N3MA 3QPYA 4J3SA 3SY8A 1F8MA 1QPQA 5HNTA 3PUOA 2W6RA 2ZX9A 4R88A 1Q6QA 1LZOA 1J0KA 1O5RA 1TX0A 1X6NA 3NZGA 1FH9A 4DAFA 3HV8A 2FVKA 4LAKA 3L65A 1OGBA 1R30A 1JR1A 4U10A 1UH3A 2F38A 2OMAA 5I3JA 3GYEA 3RJXA 1XG3A 4KRUA 1V0MA 3WLPA 1A5BA 3SCVA 3LQLA 4F48A 1E4NA 3REQA 2GUBA 5IOBA 2VM8A 2Z6IA 5FJRA 3MCOA 4GUGA 2PS2A 3CV7A 5C2GA 4O52A 2ACRA 2OT1A 3WUFA 4PFHA 4PMUA 1JEZA 4JCLA 4P7RA 3LHYA 4LT9A 1ONRA 4HN4A 5HR6A 1QNPA 3SCNA 2B0MA 2OLHA 1FWFC 1EF3A 1SR9A 1W9UA 1VAHA 3L21A 3NZQA 3VE9A 2C0AA 3F5JA 1QTWA 1FWRA 4PTWA 2YBTA 3LZ3A 3DGRA 3OO2A 4NJHA 3TW9A 3E6EA 2OLAA 4W8LA 3KLLA 1M03A 2E9LA 3QOKA 2GVGA 3BLIA 1E4LA 1ISWA 3KTSA 2E4TA 4ZFMA 2YB1A 5T9CE 1E3ZA 1DWIM 4TMBA 1JRBA 3LHTA 4BHYA 3UZXA 4AD1A 3MP4A 4Y2WA 3VKBA 2X30A 3KEHA 3LBCA 1MWOA 2ON3A 4ERGA 4IICA 4E38A 4MB1A 5CQ1A 3NL3A 3PNUA 2XFFA 4IXXA 4NJGA 3B40A 4ZO6A 4CNTA 2YB4A 1V77A 3QV6A 1PTAA 2FLIA 3MMTA 4YPJA 3WH5A 3KE0A 3WQ4A 5AC5A 4GMEA 2OELA 1SW3A 3CMJA 4GYPA 8XIAA 2VOTA 1J5SA 4XKMA 2A3HA 4P7QA 3DU0A 5CPNA 1Z3NA 4FNUA 3AI0A 3QGAC 4WK9A 3EDEA 1B3XA 2CERA 1OX4B 1FP9A 1P6WA 3WH7A 5GNZA 3WCZA 2J7FA 1P6BA 3BOXA 4M6UA 4EPKA 3W87A 1Y5VA 3N34A 2AAAA 3RCYA 3E3HA 4E4UA 4C6QA 4LJ3A 3FFSA 2E5BA 2INFA 3W53A 1XGDA 1YE6A 2DZSA 1F6YA 1SO3A 2R82A 5ECUA 1E51A 2PBGA 1TJ1A 1XKJA 4H9UA 3DFSA 3I3BA 3TYUA 1SZNA 3N9KA 1LLWA 3WD1A 5E1QA 3B8WA 3MI2A 4QFUA 3KX6A 4LBRA 5D8WA 2IPGA 1NP0A 1XFCA 4IJRA 3PULA 1RCOB 2OGJA 4LC6A 2V30A 5PTDA 1XKYA 2R1LA 4I90A 3W01A 2CYGA 3VK5A 2ODOA 8TIMA 4REQB 1WBHA 4TUFA 4TX6A 5D33A 3L7RA 3U5UA 1KFCA 3W76A 2BNJA 4MNJA 3O6CA 4NUWA 2Z24A 1GPWA 4QR6A 4O0QA 3M07A 4Q8NA 5K4XA 3I3EA 1QO2A 3TIMA 3U0HA 2J9XA 3AWOA 5CJ5A 2AGTA 2FFIA 3TFXA 1XLJA 3U9IA 1W32A 1CGVA 5CG7A 4W5ZA 2PWDA 2QXWA 1BRLA 1XG4A 1NDVA 3UR2A 1IWBA 3ZOAA 1UOZA 4B90A 5AC8A 4O57A 2J77A 3VUPA 2PDBA 2J79A 2ZYFA 4HVXA 4KCVA 2R1PA 3IV8A 5K2ZA 3KVMA 1BYCA 1BKSA 3EXTA 5F2GA 1K9DA 4PA8A 6A3HA 3S9ZA 1OT1A 4D8LA 3DI1A 3WK2A 1UD8A 2W91A 5J04A 1EJWC 4G56A 4GQRA 3P8JA 2Y4SA 4EPEC 1NJJA 3BTNA 2DVTA 4WHBA 1TTJA 4HU8A 4XD5A 3GVWA 2XVLA 3M4HA 1MQPA 2PZNA 4NVTA 2WK2A 2AQVA 3WLQA 2DSUA 3WF3A 2BX7A 4JAWA 3UXAA 4ZQPA 3AHZA 2YA2A 2NSOA 2ZKMX 3MBDA 3CUHA 5HULA 5AHEA 4C6JA 2DW6A 4MIMA 1DQUA 3M6DA 2PLJA 3T6CA 3LCLA 3CL7A 2XM2A 1UZ4A 1ITQA 5K9CA 3KDOA 3DKJA 4CEUC 1B3ZA 1NOFA 1TFVA 4KWVA 3W7CA 5DLCA 3MO7A 1XFBA 4LYKA 1MUCA 3V35A 1XISA 5G2HA 3A3HA 4OFCA 4LB4A 1TV2A 1BHGA 2YCLA 1JI1A 3S4TA 2WM1A 3S47A 1WKYA 2OWWA 3M0YA 1RPKA 1BWLA 2E9MA 1SZRA 3H4XA 4RE0A 3R1ZA 2A0NA 5KMYA 5CC6A 1Z42A 3DKLA 1YLVA 4H8NA 3DN5A 1EHNA 4MKSA 4W88A 1YHTA 5CC5A 5E6YA 2QJMA 3CZ8A 4JICA 2V2CA 3GDMA 5LSMA 2XYLA 1QOQA 1O5KA 4LY4A 3VYLA 4NI8A 1A5UA 3TQ0A 4DO7A 4F0MA 5JIPA 4N4PA 1C90A 3UWQA 2WYSA 3MI3A 2QCDB 4L9XA 1FWIC 3AS0A 4XWUA 5FAJA 2ALDA 3L0KA 3W28A 2WQDA 3RCNA 3CEUA 3EB2A 5I24A 3VDBA 4H2HA 1HP5A 3DERA 2WHKA 4LY8A 1IZCA 4YU1A 3KBSA 4B5UA 2E40A 3TFCA 1EYWA 2BV9A 1H60A 3G8RA 1K9EA 5EL1A 4A8RA 3W1RA 4ROPA 4X0NA 2NVCA 2EKGA 5LNUA 4JQ2A 4DM1A 1HJUA 3BURA 5D30A 3WO8A 4ZQOA 1ML1A 2X09A 3G1YA 4IISA 2QPUA 2WAGA 3D6NA 1QT1A 2OPJA 3TSBA 1HO1A 4R9XA 3POHA 3T1GA 1IT8A 1W1IE 4L1GA 1R3SA 4NF7A 5AOUA 2BP1A 4B92A 3NR0A 3LBOA 1ISZA 3UNDA 4KCWA 3F03K 3IEBA 1F3XA 4ZO8A 1TMLA 3UA4A 1BKHA 3GFXA 3F7JA 4J2PA 1BWKA 2XH4A 5I3IA 3HO8A 1G6CA 1OD0A 1EP1A 4PRRA 1LT8A 4O1DA 3CPRA 1YIXA 1M5WA 2NSXA 3L66A 2PODA 4XD4A 5CLTA 4FF5A 1REQA 3M9YA 2J8FA 2PFHA 2X1UA 1FH8A 4A3RA 5F2MA 3E49A 2BBFA 4MJ2A 4PCPA 3EZ4A 1CXIA 2QCFA 3BSMA 1XLFA 3VC5A 1Q65A 3EX3A 1AUSL 5M2FX 3N14A 3WUGA 1TWDA 3O15A 2VEGA 2YYTA 1ITCA 1JYWA 1I2QA 3TXZA 3WFZA 1RBOB 2XINA 3SIMA 1GOMA 4LVBA 1R0MA 2WKGA 3AMKA 3CK5A 2X7VA 3WD4A 4C90A 4NASA 4DO4A 4HHLA 2YA1A 4IGHA 1GZGA 3C2YA 2EXOA 5I3HA 1QBBA 5E6ZA 4J3ZA 3VABA 4MTVA 1S3TC 1W9VA 2PWHA 3HOJA 4DZIA 4MZ8A 5H91A 4GRSA 1LTDA 3AS3A 4N7QA 3Q45A 1QBAA 3GHUA 4MB4A 4BWLC 1KR0A 3GG0A 1D7KA 3UD6A 1JDEA 2PDXA 3NSMA 2RKXA 2CCRA 4RDYA 1QNRA 1OHLA 1A5KC 4A6GA 2G0WA 5I3KA 3TAOA 1IE7C 4H04A 4G7EA 3V4BA 4HPXA 1LLZA 4PH6A 4CN4A 1QNSA 1W37A 3WLRA 3BLDA 1KM5A 5LHEA 7TIMA 3LCFA 3CL8A 2I57A 4BKNA 3FJNA 2QF8A 4C7DA 2XU2A 3EX6A 1XLBA 3U57A 3PZQA 2UWFA 3NCOA 2RAGA 3ONBA 5MF5A 5HK4A 1IV8A 2NXHA 4JQAA 4XZWA 1XXXA 2EAWA 2WCSA 3FJLA 5C70A 1MFVA 4ZB2A 1JDFA 4GUFA 3QBUA 4O10A 2C19A 2VX4A 4JNZA 3PBUA 2GVJA 1TSIA 1TA3A 3B97A 3CHDA 5HPCA 4FXRA 1GQJA 4Q4QA 1A47A 1SSGA 4UMAA 1ONXA 2PB1A 2QEZA 1XBXA 3W02A 4WVXA 3TN4A 3AO0A 4CN6A 4MGGA 5AZ0A 3VMPA 1GGOA 4YHEA 3R94A 2CWNA 3B8TA 2WZHA 4E4FA 2VC5A 1YW1A 2WOQA 1OGGA 2GVYA 1O7AA 3W7LA 2IS7A 3GDLA 4L5ZA 3SRHA 3AUJA 4O54A 3A5VA 4AZ7A 4UTWC 3PWGA 3LZ5A 1QK0A 2ZE0A 1RCXB 1W3KA 4S38A 3C86A 4HKPA 5KZMA 4XO6A 4IIEA 2PTXA 3I7QA 3WUBA 1LL4A 4LCRA 4GI4A 3SUTA 1JL8A 3B9NA 3EDJA 2CLOA 2VRJA 2NZLA 4H9XA 4WGHA 4E2BA 1EBHA 2OZ8A 4PRWA 1YDYA 4LTSA 2WSYA 1CW2A 5F4WA 3R8HA 3W29A 1E5JA 1R85A 3C3UA 4PEEA 2WSKA 3RX3A 1H41A 4E8GA 1EH9A 3UU0A 4OOUA 4WY0F 1U33A 1W5MA 4FPSA 3M44A 3WLTA 2J25A 1UD4A 1A3WA 1KXHA 3WJSA 3SCSA 3IVSA 4O8RA 3QJAA 3G1FA 4ML4A 2J9ZA 3CUFA 1FHVA 3NQAA 3WBYA 1XUUA 1WQ5A 3LHWA 1UKPA 1VENA 1PWLA 3LN3A 4D6HA 3KLKA 4GQQA 4OT7A 3P3BA 4GO9A 3VVGA 4IL0A 2VT0A 3DHUA 4LS2A 4LAMA 3N2OA 1ZAJA 4C1NA 1LP6A 1J6PA 4AZGA 1I4NA 4M7SA 4PMOA 4HBKA 1FQ0A 1ZLPA 2XJ7A 1AD4A 5KITA 3VDCA 3P81A 5G4EA 1PZ3A 2CBVA 4Z1AA 2YLLA 3V36A 4YLWA 4MAZA 1HT6A 4OVXA 3NGJA 2ZTKA 2REQA 3SGUA 3EWZA 1R3RA 1PYFA 1FWGC 4D6GA 1P0BA 5F4SA 1RBLA 5I23A 1IWAA 3BAYA 5EFFA 3GXFA 1DJWA 2C3ZA 1TE6A 4DJED 3PB2A 1BXBA 1WB0A 2XSBA 1VCFA 2ZADA 4H8UA 4JDYA 3VDAA 1J0ZA 1KC7A 3W1TA 3AALA 3B8VA 1S46A 2BMBA 4BI5A 1TV8A 4C6EA 2YW4A 3FAWA 2OO6A 2Z26A 2G41A 3KRZA 2E8ZA 5KTLA 3QM3A 2YFNA 1TJPA 3GC4A 3DIPA 1RJQA 2E6DA 1H4PA 5A6KA 2QS8A 1A0CA 4EAYA 1NOUA 1K9FA 4JPGA 3AMCA 3FEMA 3U8GA 2HJPA 4JTIA 1HP4A 4HK6A 2A21A 3GNNA 2FB3A 3II1A 5CGTA 1Z69A 3B04A 4FX7A 3PPGA 1C8VA 2ZDRA 1YTDA 3L4WA 4WD0A 2BS9A 1XICA 1R3QA 4GNJA 3DYPA 1F76A 2L5HA 2O0TA 5AB3A 3F2DA 3ZZ1A 1Q6FA 4W8BA 3TNOA 3LGDA 1X38A 4OECA 1JZ3A 1UUMA 2OZ0A 3H7RA 4V15A 4QRNA 2GGEA 3JR2A 5I3DA 1BSLA 3WLIA 2NQJA 2Y8VA 3AHTA 1M7OA 1J11A 2X2GA 2B7OA 4TX8A 3TC7A 1IR1A 1DKWA 3KHJA 2B81A 1MW2A 2WO5A 3DG3A 4DYEA 3LSBA 1T7LA 3RF9A 3VKDA 1SZFA 1VS1A 3A9IA 3PTQA 4WUIA 3KVJA 1NWUA 3EWBX 4B5WA 1MXDA 2HZGA 2Y70A 3M64A 1HL2A 3IJ8A 3WD2A 1I1WA 4M81A 4H9ZA 1V08A 2QUVA 4JL1A 1A3XA 4E2VA 4PL2A 3VIIA 2VX6A 1N2VA 2EGZA 1YDVA 1DQWA 1J4EA 1J9YA 2YKKA 1FWSA 1GUVA 3V3WA 4HN8A 1RQBA 2PWGA 1LOLA 4GYKA 1CB7B 4EE9A 3RR4A 4XK2A 4AY7A 3TYBA 1Q4NX 3QFWA 1ZBCA 2VCBA 4QE4A 1W1YA 4LVAA 1EPVA 1TQJA 2ZTJA 2FVLA 2HCVA 2HS8A 5A2BA 1NAL1 3DBPA 3B0XA 5I02A 1DPMA 1XV8A 4LS1A 3TCSA 3DUGA 3BVJA 1AD1A 2VO5A 1TVNA 1XGZA 2EO7A 3C0JA 1LBFA 1NVMA 2W67A 2V5KA 3DXIA 3PP7A 1JUBA 4TVDA 4X9SA 1OK6A 4AZBA 3IJLA 1FXPA 3GU1A 3RR1A 4JKLA 3TCEA 2CBIA 2VC7A 3L5MA 1PS9A 1S1RA 5EMUA 4IIHA 1B3OA 4UIOA 1O66A 3W1NA 1QI4A 1US2A 2GSHA 4PTDA 1GJPA 5A8OA 2PRMA 3LOTA 5AVHA 1PZ2A 1L8NA 2DSWA 1D2KA 4QDPA 4C6CA 2JKEA 3GZ3A 3VIGA 2J7GA 1QO5A 2VI0A 4IX2A 3HMJG 1W8SA 1OD8A 1DJHA 2VEPA 3LLDA 5CZKA 3RJYA 3TDFA 3BZJA 4GHRA 2QAPA 5D2YA 5REQB 3EXSA 4PUUA 2W0UA 4RE2A 3R6IA 4YCOA 4W7WA 3NA8A 3SN1A 3EPOA 1XD1A 1MEIA 4ZCWA 1F7BA 4K8HA 3EKGA 4Z2LA 5AC7A 4DWSB 1RUSA 1OZQA 4QM1A 3GVQA 1KBIA 3WMSA 3VIMA 5CCZA 3I10A 4PEKA 1CCWB 1TB3A 4MY1A 4K8GA 3WBWA 3W37A 2IKHA 2KX9A 1XYLA 4LYPA 3BAKA 4B4HA 2F7FA 1VHNA 1K4GA 2BXZA 2VRKA 3PPFA 4G6CA 3LNPA 3MSRA 3VUSA 1VPYA 2ZUVA 3C3NA 1SZEA 2FPVA 2GK1A 3GG7A 3T78A 4MVAA 2O9TA 3NL5A 1Y0EA 4DAIA 1UP3A 4YTSA 4FOJA 4QIUA 3IRSA 1XIDA 4JIHA 4Q4PA 5E0FA 2P3EA 2V6AA 3CUGA 2VP8A 2J7CA 3EWUA 2XG9A 5DCDA 1PL9A 2FGLA 3M0XA 3C5QA 4EPDC 2PTZA 2WMHA 1E3XA 3P14A 3RX2A 4O4WA 5A5WA 3GW0A 4GLEA 3GTXA 2Z2UA 1OADA 4MWAD 1W1A1 4NRRA 1FWHC 1UB3A 3Q4DA 2YLAA 1F6KA 1W0MA 4HOXA 3U6WA 1W91A 1EF2A 1N8FA 2QMKA 4BA0A 1EO5A 1QOPA 1G4SA 2QCEA 3VDHA 3K4DA 3VKJA 2QJNA 2CESA 1QR7A 4D9PA 4H7ZA 2OX1A 5FF0A 1D8CA 1CT5A 3WLLA 3GH5A 3WEZA 3H23A 4ZOAA 3L12A 4HSNA 3QW3A 3OBEA 1LOSA 5I06A 3TV8A 3NQDA 4DF1A 3MV11 4AX7A 5A94A 4HZ6A 4GXPA 1KLYA 1VBHA 4WF7A 2NT1A 3IGUA 4AEOA 4UR9A 3UWWA 1QASA 5J5RA 2D3LA 4LUJA 3QY8A 1XM3A 1G1YA 4KS0A 4KIEA 3WDJA 5DN1A 4GJ1A 1H50A 5HANA 3BGAA 3NO3A 4OJYA 2NWRA 1FDJA 4NNAA 2DUZA 1V79A 3LHVA 1KNWA 4AB4A 3D46A 3TK7A 3NQ7A 3MCMA 3NEVA 4MM1A 1VFSA 1UWRA 3USZA 4DBWA 2ZZ1A 2PDHA 1OF6A 2JK2A 4CVWA 1KCZA 3FA4A 4RX0A 5HDRA 1R46A 5K7JA 2Y2WA 3SRDA 1TR9A 2A79A 4FNTA 5CSSA 3UZYA 3V16A 3FXYA 4OIFA 4KGLA 1JNDA 1YKWA 4DIAA 4Y6GA 1TMHA 1QW9A 2C16A 1HJSA 1SJDA 2PDKA 1EIBA 5BMWA 3CUIA 4FR1A 2J24A 3LY0A 5BROA 3WQFA 7REQB 3VA8A 1RP9A 4LCQA 3GFYA 4DBSA 3NO1A 4JTEA 2GGJA 3GG8A 3C0SA 2ZRUA 1FBAA 1ISYA 1BYDA 2W63A 1VCGA 2F84A 3FKRA 3PZMA 1KA9F 1O68A 3N17A 1IXQA 3VNYA 3LMYA 4TR9A 1DIOA 5FESA 4M8UA 4WXZA 5BXTA 2FHFA 3SRKA 4HHHA 4AWTA 3IJ7A 4RZ4A 4JX4A 3T0BA 1S5TA 1B4KA 3VCCA 3GKAA 4NZFA 2OEKA 5HNNA 4G7FA 2HBVA 2BY1A 2AMGA 5CZTA 4GY7A 2CITA 2CIPA 3ARPA 4CQ8A 2ZA2A 3TQPA 4IL2A 3DCPA 2V3DA 3LNMA 4JTRA 4X2PA 3VILA 1P7TB 2E77A 3BW2A 5CJNA 3W84A 1UCWA 3A3XA 4RXFA 3G0SA 3UT0A 4Y9OA 4DUXA 1KGXA 2FYMA 3NOEA 1NF7A 4GY0A 1ZRQA 5I7GA 4AMAA 2ZA3A 4AD5A 3VGDA 7A3HA 1CENA 5KZ6A 1ZCOA 1XBZA 1JRCA 3QKEA 4LX4A 5IM51 4AYGA 4JS3A 1A0DA 3RPMA 4US6A 3JRKA 2QUNA 3QQ0A 5A1AA 3CHVA 3UR5A 3PWIA 1RJRA 5DCBA 3ARRA 1DXEA 2FJUB 4JHOA 1RD5A 3ZT7A 1XRVA 5HMDA 3ARSA 4WJXA 3IJ9A 3XINA 1DHPA 1Q63A 2ZRWA 5LNWA 3SCTA 4K1GA 2J7DA 1G4TA 2A3AA 2R1KA 1UPMB 4WRHA 4PE8A 4G8TA 5DMNA 2EJ1A 1WXYA 4RL3A 5FF4A 4S3BA 3TVAA 3AISA 4ACZA 3CV2A 3MBFA 4MUZA 4MDOA 1GZ1A 2PDUA 1P6CA 1LRQA 2ZUNA 1R9XA 1Z32X 4QE1A 3E5BA 3L4VA 4H01A 3GSMA 4CU6A 4QJ4B 2IXVA 5C9ZA 3LV6A 5BWAA 3SSZA 5D2TA 1DYSA 3N29A 4ATLA 1HO4A 1QW7A 3GD6A 4R3UA 4O53A 3GU9A 3WJYA 3W85A 5FCZA 3K30A 4IFOA 1LYXA 2BASA 3T9PA 4WCJA 4XV0A 4ZTYA 3P0WA 3URNA 3H6OA 1SJCA 4XVEA 4WY0B 3EWCA 2VTFA 1W3HA 1C7TA 1U1HA 1XLAA 3M0KA 3N4FA 1JCYA 3WQWA 1S5VA 1WXZA 1JYVA 3CAKA 1MRAA 3BQ5A 4Z1DA 2CHOA 2VELA 3GXPA 5EMKA 4EK7A 4DBDA 3EEGA 1W3JA 5FF2A 3NSNA 1XL9A 1Y8BA 2WMKA 2PDIA 1BVNP 3S1GA 1ZCCA 3TROA 1GOKA 3UESA 4QAIA 4DUWA 5A6TC 1OF8A 5J8LA 1ZBVA 1XPGA 2DQWA 4GNKB 4W8AA 4ZR8A 1WDPA 1YBQB 4GH3A 3EOOA 3PVFA 2H3BA 1M6JA 2DV0A 4F9JA 3SZ8A 3PUDA 1EJTC 2D24A 1KRAC 4BF7A 1CXLA 3AHYA 3WENA 1H63A 3SGZA 3ITVA 3CLMA 3KTCA 1FWTA 2AMXA 3KOZA 5HQMA 2FZ8A 3LCGA 1XJBA 3VOFA 1W6TA 3NXFA 2QW5A 3I6EA 4UQDA 3WEOA 5ABFB 1HUVA 4M1BA 4MWAA 1RV8A 1A4MA 3T05A 1NTHA 3VGFA 2DT3A 3ZXWA 1TPC1 3C0LA 1SGJA 4MLJA 1JCXA 4H8HA 2QCMA 4F3HA 1JPKA 1QAPA 1VFOA 3B4UA 3TKFA 4BF9A 2VFHA 4MY8A 5BYWA 1PUDA 5HQLA 4AHPA 3ARVA 2YR1A 1DORA 1AJ2A 1XSKA 3R4IA 1Z7AA 2FTPA 3PWAA 3ARTA 3D47A 4IMEA 2F61A 2RDXA 2W5FA 3IUDA 4D6EA 2CZVA 3VM5A 3VZYA 3UG4A 3UR7A 3CYJA 3TU9A 1MW3A 2PGWA 3DFNA 1DTUA 1X1ZA 5JIWA 3C0QA 1O1ZA 1I0DA 3ITLA 4X0VA 1HJQA 1VHCA 3ITXA 5DY2A 1WZMA 1CPUA 1AH0A 1PDZA 4HA3A 4XKYA 2GJLA 3HMCA 3TZNA 1W56A 5JU6A 2OLSA 2E7FA 3WF2A 3ZJKA 5F2IA 3KDNA 4BK9A 3R0DA 3D0CA 3AIQA 1J0YA 3UGVA 4AC7C 4I8YA 4AIOA 1VBRA 4JL2A 1YNYA 4DVOA 3VOCA 2D2JA 3UWUA 3MSGA 1ECEA 3P7YA 3CHEA 3GKFA 3TWAA 3BCDA 3PBMA 5TAOA 2YPIA 1SO5A 2C91A 4G1KA 4HMEA 3S5ZA 3AMGA 1A50A 3GY1A 4OBRA 5I03A 1OGSA 1PCKA 3QXBA 1IEWA 3M43A 4AHQA 4JTLA 3G1AA 3H12A 4I9AA 4O14A 4PCNA 4LVFA 3MUY1 1ALDA 2HE5A 2PRHA 4HK5A 1A0EA 4O1AA 3RIKA 1OK4A 4O15A 3L2MA 1Z41A 3A4AA 3W73A 4K37A 4NXSA 3HN3A 3UZ5A 2A3BA 4PMYA 5BXSA 1H7RA 5E9AA 4JDBA 3BLEA 4NZ1A 3HQOA 4AH7A 2F6UA 5EPDA 2B4GA 4IPNB 4HNNA 4W87A 2EPMX 3BV7A 4FX6M 2YXGA 2PI6A 1EUAA 2DH2A 3GU2A 3M0MA 4IGMA 1Q2RA 4O8AA 3UPBA 1WKEA 1ZBKA 4FHAA 3LA4A 4RW5A 1S5MA 1XDLA 3E0FA 2G50A 2QCGA 1Z6KA 3HU7A 1GEQA 3L23A 3LRMA 1U22A 3KP1A 5JQ9A 4E2OA 1WNOA 3HZ3A 2IW0A 5A8MA 4H2CA 3W25A 1G67A 4XBJA 4YHGA 3QSRA 4PRTA 2FDMA 4LUIA 1RY8A 4D8AA 3N04A 1H5VA 3L4YA 2NXGA 1YMYA 4P7OA 1XLGA 1FP8A 1QOXA 3IIVA 1XLCA 1O4UA 1S38A 4RDWA 4ALDA 1RR2A 2OTDA 3E0IA 3TLQA 4IOTA 5HJLA 3ZM8A 3M47A 1TA3B 2Q01A 4UQCA 4IH3A 1PKNA 1XLLA 2E1DA 3GBEA 4WSKA 4YVVA 2GJXA 4PUEA 3GVGA 4UQ9A 2XZ7A 3HF3A 3S2JA 2ZDSA 3H54A 4GX8A 4YXGA 3ZLFA 4PB4A 3ZWTA 4ASTA 1HL8A 2QJJA 5BOEA 5DEZA 5ENLA 4CCEA 1SFLA 2VRQA 1PE1A 3W7EA 4US5A 3KBJA 1UR4A 1QNOA 3CAVA 4QSHA 4XTDA 1SMAA 4KERA 3W1PA 3OBKA 2PDQA 3I7SA 2C15A 4QITA 1YXYA 5D32A 3MWAA 1Q6RA 4WEVX 2QLYA 4NX5A 5CZJA 2HSAA 1QUMA 2QULA 4FOKA 1EJRC 4H8VA 1SFJA 4F79A 2BXYA 4DJDD 1EXBA 1Q6DA 2FZDA 1S5WA 2QVHA 2A3EA 3NDOA 3VKKA 3W7PA 2ZZ3A 4TU1A 3W6LA 3H4GA 3QGKC 3BG3A 3N25A 4ZOEA 4U2ZA 1LBMA 3TLLA 4FS9A 2VDHA 3AIWA 1OX5A 4AZIA 4HHPA 2A5HA 2ZICA 2BOEX 3IGHX 1CXFA 1NFBA 1QPRA 1GW9A 5HPOA 1E1FA 2OZ3A 4QCFA 1OQFA 3N9SA 1FWAC 2D3NA 5H1WA 2F9RA 3SCPA 1QPOA 2P0IA 5MHBA 2ZQ0A 1OABA 3MP5A 1OX4A 1ZTVA 4ZVJA 1WZAA 3AIUA 4LC8A 3MZNA 1GONA 4YIWA 3PK7A 1UPPA 5T9BG 3C8NA 4H1ZA 3FY1A 1HNYA 3IIXA 1TIMA 3PHAA 1W1ZA 2YOCA 1VF8A 2QJIA 4GACA 2A7NA 3G0UA 4TVCA 5DANA 3OGSA 1S2TA 3GO2A 4C91A 2RDTA 2J75A 4M6PA 1XP3A 2XFRA 2WNNA 5I79A 7TAAA 1UWIA 3URBA 3SFKA 4JTDA 3LPOA 1R47A 1G69A 2V3EA 1QNQA 3K4WA 2RJGA 2OOGA 1W31A 3DBNA 4IPPA 1GOWA 3O6DA 2VR4A 4JHMA 4JIEA 1IT0A 4AUBA 3W75A 4B3KA 1IT7A 2OEJA 3A9BA 5EGRA 1SW0A 2EQDA 4IWWA 3SURA 2J8TA 3G1RA 3OVRA 3STFA 4KEZA 4KFPA 4UNKA 8RUCA 3UGRA 1U1JA 4OBTA 5D9OA 5TF0A 6ALDA 3OJGA 4WDXA 4YMZA 2V3FA 5CZSA 1VIWA 3UWYA 4JCMA 2XISA 4XZMX 1TCMA 1Y5XA 4PUMA 1EXPA 4GK8A 3QC0A 1OT2A 2G8ZA 3BMXA 1LG1A 4WLCA 3POCA 2A1YA 2RGMA 4L61A 3U7BA 4HZ8A 3WLOA 4LALA 2E6FA 3AS2A 1NFGA 1LQ2A 3A13A 5C9XA 3WBAA 5FJUA 4KFOA 3NVDA 2WLZA 1AG1O 2VQTA 2W27A 1Z8AA 4O19A 1MSSA 4DUVA 5F1VA 1XS2A 4KWSA 5JXQA 2XIOA 2C14A 1DE6A 3MP3A 4LANA 1DP0A 1GVRA 4AQLA 4M82A 4FXSA 3QMRA 3ZFHA 5A8NA 5LZLA 2MANA 2J7HA 3E2QA 4F66A 3ZT5A 2WKLA 3U48A 1EEXA 1L6WA 1ZB5A 4AISA 4UTTA 3DH7A 3VFLA 3VGBA 1R3TA 2Y7GA 3N4EA 2VZTA 3LB0A 1KWGA 3EOLA 1DBTA 1KKRA 4OGZA 4J1OA 4N42A 2FZNA 3CL6A 1RH9A 1XIJA 2PD9A 4MZ1A 3MY9A 6XIAA 1M9HA 2XN1A 3Q37A 3ZS4A 3B4YA 2DORA 2J7BA 3GM8A 4V2XA 5AYIA 1KO0A 3NZPA 1OCBA 3T44A 5HATA 3MC5A 1M53A 2BODX 1UD3A 5FKYA 2RUSA 2WNWA 4MKVA 4QEEA 2J74A 4GY1A 4P8UA 4RDVA 3NQVA 3SBFA 4D6FA 3W7IA 3P84A 3DHPA 4W85A 3W81A 2QGYA 4L80A 4KKXA 4I3GA 2ZUWA 1VJZA 1LWJA 3LERA 3BUVA 3WMBA 4B4FA 4UOJA 4QNEA 3DFYA 3PJXA 1RVGA 3I68A 3GW3A 2VD8A 1VLIA 4JYDA 3WLJA 1A5CA 3RUBL 4UR8A 3GZAA 3R0UA 3ANUA 1JZ6A 1E9YB 3QKZA 3VXGA 4JBRA 3SO7A 3M7SA 3VIOA 1NWSA 1NELA 3R8GA 1CXEA 1UA7A 4D71A 3IARA 5A2AA 5I3FA 2OQHA 1DWJM 2J78A 1E0WA 1ADDA 4NAFA 5LA2A 3CIXA 4AVNA 4KBXA 1DHKA 2BOFX 3VIHA 1TJ2A 2X8RA 1ZAHA 1VFLA 4M29A 3CV6A 2PURA 1RXOB 4U31A 4MHBA 5I5RA 3W1QA 1XH2A 3HB9A 2CEQA 2Y6ZA 4N6EA 5C6MA 4X9YA 1FHLA 3REQB 3MZ2A 3UFYA 1R86A 4HNOA 2DSKA 4K68A 8A3HA 4KW2A 3OZMA 2VEMA 2EPNA 4W7VA 1CGTA 2QDHA 3S1XA 4DZAA 1A80A 3GR7A 2QF7A 1VEMA 1YQ2A 2B7NA 1WX0A 3BJFA 1W5OA 1V6WA 4KCTA 4O0ZA 3QV8A 4ZXLA 2Y63A 2QCLA 4ZOBA 2F8QA 1H7WA 5I09A 3IK2A 5CZ0A 4Y9PA 3WDIA 4L4MA 3W1MA 4XZBA 2I7GA 1UG6A 2VVNA 3BO9A 3KFTA 1OIMA 3T8QA 4YJ5A 1LQAA 1JDCA 4HT3A 5C71A 3J7HA 1NQ6A 4URIA 4GISA 4TTUA 5HXMA 3IIZA 4UB9A 3EPMA 3AQUA 5DMLA 2TAAA 1J8VA 3L67A 1JJKA 1TPUA 3T40A 4GGHA 2GQAA 2PDPA 3OHIA 2JF7A 5CAKA 3WNLA 4HU4A 3P8IA 3IANA 3GVRA 3R43A 1P48A 4XKYB 3W23A 2VHLA 2YL5A 3QMSA 4MLRA 2QV4A 5LGXA 3VOHA 1G9HA 3CTTA 1I0BA 4FIQA 3G8EA 3D3FA 1UZHA 4JQ4A 5AZ1A 3IGSA 3PJUA 2D0FA 2GQ9A 2CWXA 3S9YA 1QATA 1HGYA 1NIUA 1Q7ZA 5DO8A 3SY1A 3AYVA 3MDWA 1RVKA 3TX9A 5HBFA 1RCQA 3QGVA 3R8RA 5EB8A 2HWGA 1H11A 3IK4A 5CPQA 3KWSA 4JEQA 3MJYA 2A6LA 1F2JA 4UTWA 3UXDA 1BPLB 4UR7A 4AZHA 2G3JA 1GVOA 5C9WA 3QW4B 3FKKA 3TYAA 2NUYA 2DSZA 4IMFA 3TN6A 3IUIA 3HPSA 3NQMA 4HNTA 4HU3A 1OM0A 1EGMA 5I00A 4LF2A 2WMJA 1PXGA 3SEPA 2WZEA 1PAMA 1L6GA 1B30A 4F2TA 3FSUA 3FW6A 4GIRA 5JMUA 3UPWA 4F8XA 4MNKA 3L0NA 4K39A 6CGTA 3K4AA 3CEPA 1J2WA 3H2FA 2AL2A 3STCA 2Z1BA 5GQBA 2WMIA 4TV6A 1Q6GA 1JDDA 1XWYA 2XDFA 3WDRA 3RM8A 1CECA 4EXAA 3FX4A 5TIMA 4D1IA 2A85A 2E68A 1UMLA 1H1NA 4IQJA 1V6TA 2DP3A 4JX6A 2XIJA 4Q7BA 1FKXA 3W83A 4MWAC 4IGSA 4XX6A 1R2TA 4M1RA 4CUCA 4UC5A 1RPXA 4Q8MA 1VB9A 6TAAA 3QOMA 4PB3A 2QCDA 4HTYA 1CXHA 4V28A 3WKZA 2ATSA 1GNXA 3W72A 1B57A 1GOIA 2D73A 3S3GA 2VX5A 4HJFA 3LK6A 2GYIA 5JBFA 2DT1A 3BCFA 3SQLA 2GGIA 2VURA 3QEZA 4IFRA 3RYSA 3Q58A 4XZNX 1ZFJA 1LJYA 1QI5A 3AIRA 4TX9A 2O56A 3OVGA 3NL6A 4UMBA 4L4LA 1UKSA 4NJIA 3VNKA 3FDGA 4GYPC 5DBTA 3OP2A 3IGXA 4UTMA 3GQYA 4JQ3A 3ALFA 4S3GA 2Q6ZA 4YYFA 5ABEA 2XN0A 4WX2A 4NY2A 2R1NA 3FJ4A 1UC4A 4HSHA 4ZA0A 4DF2A 3O6AA 3O6YX 3ZVHA 4RR4A 1IF2A 4DRSA 6ENLA 2E5DA 3QYSA 3MS8A 4GC4A 3UPMA 3PC0A 3VNMA 3U4FA 4DJDA 3UR8A 3GNOA 3PJWA 3LTPA 3AOFA 4Q8QA 2TODA 1E55A 3FGCA 2QCNA 5C2XA 3FHQA 3GVVA 2Q3RA 2ZRVA 3C2RA 1T99A 3KS6A 2INZA 3OVPA 5HMFA 1K03A 5J5DA 4CQDA 4NQ1A 5DMMA 1V3JA 4ZQRA 3THAA 2QUTA 2D0GA 1SMDA 1XR2A 2GL5A 1EA9C 1E71M 1FKWA 2NX9A 2ZVIA 3K46A 2V68A 1E6NA 4ZZ9A 3LS9A 1B3WA 4AWUA 1XSJA 3QN3A 3QF0A 4A4AA 1BLIA 2QT3A 5IHSA 3M5XA 3TUUA 2BOGX 1KQYA 4L1XA 4IQLA 2Z29A 1UROA 3C4UA 1AQ0A 4NILA 4WR3A 4G5DA 4UFMA 3NQFA 3D3AA 3O0KA 2OYKA 4MADA 3RM4A 1R3WA 3MMUA 1ITUA 2WJZA 4PCFA 1EP3A 4E3TA 5HINA 1XH1A 1PTGA 3FA3A 4LNCA 3WNMA 3KUMA 4RV8A 3VTRA 1HJVA 1OB0A 3BW4A 9RUBA 1LF1A 4LCSA 2E0PA 4LSBA 4QDWA 2QPSA 1TELA 2OWCA 3PB0A 3H2EA 2WWCA 1V5XA 2P88A 3PPHA 3TSMA 4HOWA 3PZ9A 4W9TA 4HCHA 4ATWA 2BTMA 2PDMA 3ES7A 3EPNA 1ZENA 2V81A 1E70M 1FCVA 4UTIA 3G5EA 3QZEA 2X0HA 2V63A 3VIPA 1H2JA 3PPCA 4UFKA 3S1WA 1WKFA 1RQEA 4EF9A 2PDJA 2XVKA 4I5RA 4Q8OA 3N6JA 4JN6A 4Y9NA 1B2YA 4PYSA 2PTWA 3W86A 2VL4A 4OV4A 4L4PA 3R12A 1G01A 5DELA 2XTKA 3MJMA 1HGWA 1P7TA 1UZDA 1QI3A 1TYGA 2HXUA 2PWVA 4K7VA 2AKZA 4S3CA 3A4WA 3UF9A 1W1VA 4HPJA 4Q4SA 3OQ8A 3ES8A 4GC3A 5HAOA 1HF6A 4ERIA 3KBWA 3TNBA 3QH2A 3CH0A 1U30A 4ILSA 2NUWA 1XX1A 2C18A 4U2YA 1BXNA 5LIKX 2CLFA 6XIMA 1R3VA 3V0TA 3ELFA