4Q33A

Crystal structure of inosine 5'-monophosphate dehydrogenase from clostridium perfringens complexed with imp and a110
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
357
structure length
344
Chain Sequence
b'MARILKTAYTFDDVLLVPNKSEVLPNEVSLKTQLTKKIQLNIPLMSASMDTVTESKMAIAMAREGGIGIIHKNMTIEDQAREVDRVKRSGGLLCGASIGVTNDMMERVDAVVKAKVDVIVLDTAHGHSKGVIEGVKRIKAKYPELQVIAGNIATPEAVRDLAEAGADCVKVGIGPGSICTTRIVAGVGVPQLTAVMDCAEEGKKLGIPVIADGGLKYSGDIVKALAAGACAAMMGSIFAGCEEAPGAIEIYQGRSYKVYRGMGSLGAMAKFVPEGVEGRIAYKGHLADTIYQLIGGIKSGMGYLGAPTLENLYENANFVVQTSAGFRESHPHDINITKEAPNYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase
publication title Crystal Structure of Inosine 5'-monophosphate Dehydrogenase from Clostridium perfringens Complexed with IMP and A110
rcsb
source organism Clostridium perfringens
molecule tags Oxidoreductase
total genus 102
structure length 344
sequence length 357
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4q33A00
3NQ6A 1D3HA 3WK3A 1OG0A 4FHAA 3U6WA 4RZ6A 5LNUA 1VYRA 4UUIA 1TCDA 1P0KA 1LBLA 1XBZA 2B0MA 3EWBX 3QW3A 4O57A 1U5JA 4G1KA 3I7SA 1ML1A 3IIVA 4A2SA 4UTHA 1QO5A 1FCBA 4MY9A 3ANYA 5CPNA 3Q2DA 3LV5A 2RFGA 1VCFA 4RCXA 1TPVA 2J6XA 3UXDA 3GXNA 3N73A 3QC3A 5CZ0A 3C56A 3VFLA 3N3MA 2O7SA 3W2NA 1OX5A 2NX1A 2ATSA 5FEWA 4XBSA 1JQVA 1OFPA 3W2JA 3CIWA 1VS1A 2W79A 2NX9A 3QZEA 1Y0EA 4FB7A 1FBAA 5BMXA 4Z0JA 3VKJA 4IWWA 3NL3A 1JCJA 2X1RA 3HPZA 3NZ1A 4ZVJA 3G1YA 5HJLA 4H3DA 2V5LA 3EX2A 1Z44A 5AHMA 3MYOA 4JD4A 5KZMA 3EX1A 2W6RA 3DFTA 2AGKA 1SU5A 5FEZA 3R13A 3PBYA 3W7DA 1LORA 3DBPA 2UV8G 5IBXA 1N55A 4HNNA 4N6FA 3M7WA 2JK2A 2J9XA 4K8EA 3KVKA 1VRDA 3M16A 4LUIA 1ZJIA 2C16A 3G1VA 1A50A 4UNKA 4S2BA 5HMSA 1FDJA 1AW1A 2X30A 4ZMGA 2E5CA 4XTIA 4GNJA 4JIPA 1GOXA 3NGJA 2Y7EA 5E1QA 2PC4A 4RLIA 3LOTA 3NG3A 3S1UA 4NZJA 4I7UA 4O1BA 3FFSA 4LV9A 3GX9A 1TQJA 2I14A 1OFBA 4EVZA 2YGYA 2VFIA 1SO4A 1R2SA 4Y8FA 3TSMA 4IMFA 2GJLA 2JGQA 4ZL1A 4ADTA 3EWZA 3TNOA 1O5KA 2CW6A 1W1ZA 1XKYA 4JX6A 1GTEA 4AWTA 1MSSA 3W86A 1YDOA 3LRMA 4AAJA 1DQXA 1ZNNA 1KM0A 4RKAA 1ZAJA 2TPSA 1KFCA 1XFBA 4JN6A 1KA9F 2QCCA 2VKZG 4DO5A 3SGZA 1WDWA 3HPXA 3GYEA 3IIPA 4NNAA 3M1ZA 1JUBA 1WYIA 3EKZA 2NWRA 3Q37A 4IPIA 1H7OA 2VFGA 3SZ8A 1VQTA 1NSJA 1WAUA 5K7JA 2GQAA 1K7FA 4AWSA 1N7KA 1VC4A 2QCDB 3TAKA 2QJHA 1JULA 2RHGA 4HHPA 1TV7A 1LOQA 5D2YA 1F2JA 5HUPA 4GE8A 1OFAA 3QQ0A 3M9YA 4QSHA 5LGZA 2CLHA 4UFKA 2A85A 2J24A 4BI7A 3GNNA 5D38A 1K3UA 3JS3A 4FXRA 1SQ7A 1VH7A 3P80A 4N9EA 2V5BA 1LCOA 4QISA 2Z6JA 1FWTA 3TW6A 1XBXA 3W7GA 3G3DA 2DZWA 2G97A 3IVUA 5DY3A 4L4LA 1B4KA 4OGZA 4K7VA 2E68A 3CPRA 3LCWA 1WQ5A 1F05A 1YXDA 3LBCA 2YW3A 4NU7A 2BLEA 2QAFA 4ADUA 2QCNA 5KINA 1H7RA 4UCGA 4GUHA 2OZ0A 2CLEA 1IIGA 1SW7A 3UWVA 1Q6QA 3BW3A 4HKPA 5EY5A 5AC7A 2EPHA 1LBFA 5IM51 1H1YA 1H7WA 3LCFA 3ATYA 1YPFA 5DXXA 2FDSA 2EF9A 2A21A 3PG9A 4MFEA 2TYSA 3E12A 3TE9A 3M5VA 4O4WA 5DXYA 3E96A 1OFOA 3NPXA 3NDOA 2WQPA 1LROA 4UTWA 2HMCA 3I7QA 3TJXA 3S0CA 4IGHA 3HPSA 1PHQA 3C0JA 3BG3A 3KRUA 2QUUA 1RQBA 4JDYA 2QCDA 2YYUA 3B4UA 2HS6A 1YTKA 4MYXA 1XM3A 4CNPA 4N02A 2YW4A 3UQNA 3NYZA 2EGZA 5D2TA 4X3ZA 5K4XA 1F6PA 3O15A 1TQXA 2ISVA 1EWEA 1WOAA 1AG1O 3W3OA 5D32A 2Z1BA 1R46A 1FXQA 2Y7DA 3P84A 1TPDA 2XN2A 2A7NA 1EP1A 5FF2A 1KFKA 1QMLA 3H53A 2WO5A 2Z2UA 5AYYA 5T26A 4MYAA 4LRSA 4YMZA 5CKSA 1GTHA 3HG5A 3AJXA 3PF3A 4Z08A 3A9IA 2JBMA 4MZYA 4M7SA 4PFMA 1HO1A 3P5YA 2ZA3A 3W23A 1FWWA 2J9YA 3QQ1A 3DXIA 4B5NA 4UR8A 2GPTA 3TSDA 1PCKA 3WK2A 3MYPA 5AHNA 3HJZA 3DKJA 1YTEA 1C29A 4BFAA 3MP3A 3LB0A 3PBWA 4UTTA 1TTJA 5LHEA 5G2WA 7TIMA 1JJKA 1TTIA 3P5ZA 4O4VA 1GVQA 2C6QA 2C14A 1ICPA 1QDSA 4GWEA 2FPTA 3W2UA 5DELA 1F73A 3ZFHA 3OEXA 4RXGA 1QR7A 1VJIA 2NV2A 5G2HA 4HT3A 3P74A 3O6DA 1K8XA 4DF0A 3STGA 1KW1A 4IMGA 3GZ3A 1JUEA 4IXHA 3BARA 3L0GA 4OBTA 1DQWA 3G0XA 3UXAA 1G4SA 4CCCA 1D3GA 1ZY9A 1OF8A 4BF9A 1WXJA 3PVFA 1QAPA 2E6YA 1MEHA 5C5YA 1L6WA 2VXNA 4MLRA 4ORIA 3NL5A 5CGQA 4FNPA 3BV4A 3LCGA 5AHFA 4GJ1A 2G95A 4ML9A 1TV5A 1KTNA 2RH9A 4LRTA 1Z48A 2Y85A 4K8HA 3NR0A 4NJKA 3BG5A 4BI6A 1LRTA 2Q8LA 1RZMA 5AYZA 4J9JA 4DPQA 1EUAA 2V81A 4LNYA 4OHQA 5FEXA 2NWSA 5HWMA 3EXTA 1W31A 2RDWA 4FNTA 2DORA 3PSVA 5D09A 1PV8A 1GG0A 3O6CA 5DCBA 4FX8A 4UFIA 3SI9A 1PE1A 4ADSA 1VYPX 3B05A 1P5BA 4CQ9A 2ABBA 5HQEA 3LHVA 2NZLA 4OQVA 2E6DA 4JR5A 1GJPA 5AHIA 5HWNA 3HF3A 1SSGA 4ZQMA 4EF9A 5D2WA 4PEKA 1ME8A 1TPWA 4O10A 4TR9A 1C9DA 4NX5A 3C8FA 3L9CA 1EX5A 1SPQA 4DF1A 4K6AA 4UNLA 3DH7A 3DU0A 1GQNA 3NQAA 1I8JA 3W1XA 1O60A 2CU0A 1X1ZA 3CLMA 3HG3A 1GWJA 4C1LA 3W9ZA 3UNDA 3QEZA 5DBUA 3GR7A 2ZRXA 3S5YA 1GVRA 5KITA 4WD0A 5KTLA 2R8WA 5MHBA 2DZTA 2YX0A 3QM3A 2QCEA 2ZA1A 2E1DA 1GT8A 2ABAA 1EEPA 1GPWA 4GRSA 2WPBA 3G24A 1HG3A 3IIXA 4TMCA 1H7NA 1TO3A 1XXXA 3NQCA 2E6FA 2V30A 4AHPA 5H2ZA 2TSYA 1BKSA 5KMYA 4POCA 5EPDA 1K7XA 1P1XA 3THAA 3TU9A 4UTTC 4UR7A 2I1OA 1X7FA 1W3NA 2ZTJA 4DELA 1W3IA 3UY8A 4AHQA 3C2FA 1OX6A 1QO2A 3NPVA 1V5XA 5LGXA 1ZFJA 1OFDA 4UMBA 1TRDA 2ZZ1A 4KKXA 2LLEA 3L68A 1VHCA 3UD6A 3DKLA 4RR4A 3FIGA 3GAYA 2EKCA 5AC6A 1VZWA 4A3UA 1EP3A 3CQ0A 2C13A 1PHWA 1RQHA 2QEZA 1FXPA 3DI0A 1R2RA 1EB3A 4ZQNA 2P0OA 2WNQA 3LRLA 3P61A 4GUFA 4Q32A 3W6YA 2NUWA 1AK5A 3RMJA 3OVPA 4PCFA 1RPXA 3O8AA 2H8XA 4DPPA 4LT9A 2QCMA 3QFEA 3S1WA 3BPWA 3W1TA 1W3TA 4IPJA 4FIRA 4JICA 3BLFA 4LU0A 3R5EA 3DFNA 3NQMA 4XWUA 1ADOA 3TA6A 2CFFA 2ZDRA 4UXDA 1TPB1 4XZ9A 3OVRA 1BWKA 1KM5A 3SGUA 1ZHAA 5K4ZA 4NZFA 3PSWA 1LOLA 3LERA 5K9CA 4Z0SA 1KFLA 3L5MA 4JTSA 4MLJA 1GYLA 4JGDA 2H90A 3IGXA 3TFXA 1TPC1 1SFLA 1VYSX 4BR1A 4DEFA 2BWGA 1SZEA 4AHOA 5FI8A 1J4EA 2QUVA 1W5OA 4NX0A 3EWUA 2VENA 3NAVA 2GOUA 5CZJA 3MI3A 4QNWA 1IXPA 3NQVA 4WY0B 2C0AA 1YDNA 4QQ3A 2NLIA 3C2EA 3PM6A 3QMTA 2EAWA 1MXSA 3DHDA 4O14A 4RX0A 3NM3A 3QMSA 2BZNA 1SW3A 3QH2A 2JKPA 1GEQA 2BXVA 3UZJA 3W7KA 2Y63A 2OMAA 1KLZA 2AAMA 3H54A 4YL2A 1QPRA 3Q94A 1TV8A 3EWWA 2FFCA 1RR2A 3BLEA 5D05A 1OK6A 4E2BA 1Q6LA 3W7LA 2AQWA 2DZXA 3NQDA 2ZZ3A 1CW2A 3PG8A 5C2XA 4JXCA 3SY5A 3GVGA 3G1DA 4AF0A 4CQ8A 4LS1A 4PODA 1TTQA 3PS7A 3TW7A 3KRSA 3S1XA 4HNTA 1QWGA 3I65A 4IMDA 3WK0A 3M6YA 3M5ZA 4N6EA 5CZTA 1IF2A 3AO0A 1H61A 1HUVA 5KZEA 1I2PA 4RK8A 2QKFA 4A22A 5LNWA 4HN4A 4K36A 3IIOA 1F6KA 2B7PA 4H4IA 4NVTA 4WY0A 1H62A 3QRHA 1V7YA 5DCEA 1LRNA 3GR8A 3TJLA 3LXCA 4LW7A 3TR2A 3HBLA 3GDRA 4FIQA 1AL8A 5EKYA 1JVNA 1PL9A 3L21A 3LCHA 2G96A 1SR9A 1RD5A 5AFDA 3MP5A 1JCNA 3TDFA 4IMCA 1ICSA 4QNEA 1KLYA 3O1NA 3LV6A 4WXZA 3BVJA 3LDVA 3W72A 5HR6A 5F1VA 3UWYA 4MFDA 3OIXA 3GK0A 3LTSA 4M19A 2QCLA 3G1FA 1OHLA 1AL7A 3CIXA 1H50A 1GVOA 5I3FA 3MJYA 3P67A 4M6QA 4N4PA 2H8ZA 1QOPA 2NV1A 1OVDA 2Z6IA 6ALDA 1FUYA 3T44A 1FDZA 3WJWA 4O50A 2ZRZA 1W0MA 3Q58A 4FNRA 4DQWA 1W5NA 1H7PA 2C1HA 2R91A 2V2CA 4MJZA 1FDYA 3N19B 5H91A 5I3HA 3FKKA 1THFD 4CCDA 1MEWA 3A21A 5EMUA 5CG7A 2OT0A 1GYNA 3S8HA 5F4SA 1W54A 4QAIA 1B57A 2DU2A 1E51A 1FX6A 1YADA 1FWSA 2DZPA 3DENA 2Y7FA 2Q3RA 2FTPA 2ZQ0A 1TJRA 3G0SA 1MZHA 1ME7A 3QF0A 2WJZA 4PC8A 3W70A 3W7JA 2TMDA 1JUKA 3QSRA 1UUMA 1KV8A 4DF2A 1H1ZA 4EOUA 1G6CA 3NQ7A 5ABTA 3IRDA 4C1KA 3LTYA 4GC4A 2P10A 4LY8A 4I7VA 3W7PA 3STEA 4AEOA 3EX3A 3B0UX 3IV3A 4N9DA 5TQLA 2J27A 4TMBA 3FLUA 3RFAA 1JCYA 5TIMA 2WKJA 4LOCA 4UFLA 2OJPA 1KBJA 1KM6A 1KTBA 4JYFA 1TPFA 1VGAA 4HPJA 3GDTA 4UIOA 4LS2A 3W2MA 5F4WA 3W73A 3WK1A 4RV8A 1A5CA 1FCUA 3E9AA 3IGSA 4KFOA 3UY7A 1MO0A 3HGRA 2A0NA 1XL9A 2CZDA 2E6AA 1HO4A 3NL2A 2BX7A 3R89A 4IX2A 3TMLA 5FESA 4MKNA 3F03K 1UCWA 3C6CA 2GVJA 3PUEA 3OA3A 2PRLA 3TC6A 1GZGA 3W1UA 1OF6A 1OJXA 3P60A 3L5AA 3TKFA 3U2OA 1YDVA 3EX4A 3PUOA 4CNOA 1LDCA 3ZWTA 2WSQA 2V2HA 3DI1A 2QDGA 1VR6A 3LHWA 5BW6A 3UWQA 3C4UA 3NZRA 3TFCA 3LLFA 1A5SA 2VFDA 4QJ1A 3GDLA 5AHLA 3G1HA 3G1SA 3A5VA 3L0KA 3OG3A 1TJPA 5LSMA 1IIHA 3TQKA 5G5IA 3P8JA 2DP3A 2ZA2A 2EHHA 3MP4A 1YLVA 1O5XA 3RNDA 2YR1A 3FYOA 5CPMA 3MHFA 4RJEA 2A1YA 4D2JA 1JRCA 3S5ZA 4DO6A 4X2RA 2X2GA 3A23A 5CPLA 4FNQA 3ABSA 1PCWA 2E77A 4KFNA 4WQ6A 1OFQA 2GVGA 3LBMA 3STCA 4EWND 1I2OA 4XUGA 5D03A 1G67A 4P2VA 3CT7A 2WOQA 2YZRA 1BEUA 4O0KA 1QNVA 3W88A 3W87A 1H51A 1LLWA 4WY0F 1QPQA 1O95A 3LHYA 2QR6A 1S5TA 3T40A 4WJEA 3VCRA 1G4EA 5A5WA 1OX4B 2BSLA 3FYPA 1HTIA 4Y90A 2WNZA 5LZLA 1H7XA 4X22A 1TB3A 3W1QA 4Z1CA 1UUOA 3BK0A 4O17A 3TXZA 3DFQA 3HB9A 1O4UA 4JY8A 4BWLC 3B0VC 2A5HA 3ELFA 3UPWA 3PB2A 4QIUA 3EEGA 3M0ZA 4WX2A 4S2CA 2A4AA 4M6VA 4Q33A 4YCPA 1D9EA 2H3DA 5FF3A 2ZCGA 4TO8A 3LI1A 1KM4A 5FEPA 4ZQCA 2PE4A 2Y7GA 4GUGA 4W9TA 3LHUA 4N9BA 2PURA 4XKYB 4WXYA 2ZRWA 2DZUA 5LKYA 2FPYA 3USBA 5EA9A 3KVJA 2VC6A 2RKXA 3W85A 3HG4A 1TIMA 1UASA 3N2XA 3W83A 3B0PA 2VEKA 4LVBA 1T8XA 5I3GA 3GAKA 2P1FA 3JRKA 4O1AA 1KFJA 1DOSA 4ALDA 1NEYA 1S5VA 3FOKA 2CLFA 3ATZA 3QPYA 4A21A 3YPIA 1DJNA 3W7IA 1EUNA 3LCXA 2QJIA 1FWNA 3PB0A 4FXSA 4LWWA 1UJPA 2CLLA 1YPIA 4DO4A 4JX5A 1OX4A 2Y88A 1I2NA 1UB3A 1ONRA 2I9EA 3GKAA 1G4PA 4K7YA 1OABA 2A7PA 2VOMA 1J5TA 1SZFA 3PC0A 1W37A 2R14A 4O0ZA 1PS9A 5BRBA 1ZENA 4IQLA 4GUIA 4ZQPA 1XUUA 4EIVA 3TQ0A 4GUJA 3W2KA 1LOSA 4L4MA 5E0KA 1SO6A 1Z41A 3JR2A 1WX0A 3C2OA 4O16A 4U28A 3CWNA 1K8ZA 2NUXA 3IGUA 3VNDA 1FY6A 2NXGA 3SSJA 2O7QA 4O52A 1A5BA 3P81A 4XKYA 2FB2A 3L5LA 3B03A 3ZS4A 3EKLA 5I3JA 2X1SA 1I45A 3FEMA 4P61A 3DGRA 3W7NA 2ZYFA 3UZ5A 2VEPA 2OCZA 3N9SA 2QAPA 2VEMA 4A2RA 1DJQA 2C19A 3WFAA 3TH6A 3G0UA 3FKRA 1SZGA 3E49A 5KSWA 3C2RA 1JCXA 2DZSA 2B7QA 3UPBA 3W7MA 3KAOA 4Z1BA 4Y6GA 5C55A 5K2ZA 3P62A 2F7FA 1P0NA 4R34A 2QJGA 1YYAA 1KBIA 2FLIA 4O1CA 4JYDA 3O07A 3DFPA 3L2IA 3HO8A 4XBKA 5DCDA 5G4WA 3TIMA 2GVLA 4WOQA 3CM4A 3W1NA 5F2GA 1Q6RA 3S6DA 1SZNA 4O18A 1OYCA 2YDAA 4JTGA 4X9SA 3PUDA 3ABOA 4CQAA 3R8RA 3PY2A 4FX7A 2E09A 3FJLA 4Z1AA 1OFRA 5AB3A 4NXSA 1LTDA 1KFBA 3CC1A 3FA5A 4JTJA 2V8ZA 4IMEA 3P82A 1W5PA 2CLMA 3HGSA 4K37A 3W1RA 4NXKA 4LC8A 3B8DA 5I3KA 3W22A 5A8GA 1KM2A 3DHFA 5BOOA 1XBVA 3NXFA 3EWXA 1AW2A 1VCGA 3SIZA 3L67A 4N9CA 3HIJA 4FNUA 3S9YA 8TIMA 4UFMA 4YLWA 5GVJA 4DXVA 4IUOA 5K9XA 2B4GA 4M6PA 2CLIA 5G1TA 4MJMA 3EX6A 3QPZA 3PWAA 4PL1A 3M5XA 4DBDA 3A24A 3CWOX 4FX6M 1PIIA 3LCIA 4HSOA 4O1DA 3EB2A 1W5MA 2ZTKA 3WJZA 4NJIA 1NAL1 1U83A 3BW4A 3W75A 3DZ1A 3QYQA 2B7NA 3RLVA 3INPA 3LXAA 4K38A 3TV8A 2DJXA 3S5OA 1X1OA 2Y70A 2YSWA 1QPNA 3SFKA 3GNDA 4UFHA 2ZRVA 5BMWA 1I2RA 3QSTA 5G4EA 4TU1A 2IQTA 2R94A 5AYXA 3W7RA 1EP2A 2JKAA 1TSIA 2C18A 4QITA 2CWNA 4WOZA 3KRZA 3EXSA 4NQ1A 1WOBA 5DY2A 1J2WA 2WNNA 1XCFA 4JEQA 3KOFA 2OT1A 2QCGA 2WSYA 1TPUA 4LVGA 4UTKA 2OX1A 4O28A 1Q6OA 5D33A 5CSSA 2Y61A 5LNRA 5CSRA 1WBJA 1TREA 4JY9A 4WUIA 1K8YA 3H55A 3TC7A 1NF7A 3T78A 5DBTA 3M41A 3QJAA 4Q4KA 3FJ6A 2XN0A 3WJSA 3KHJA 1B9BA 2ISWA 3O05A 4WZHA 1R30A 5EYWA 1IXQA 2CZFA 3RF9A 2BTMA 3RU6A 2V2DA 1GVSA 1M7OA 1RVGA 5C54A 1K03A 1RV8A 1FCVA 2PCQA 4KWVA 4NT0A 2A6LA 4TIMA 1W8SA 3A22A 4IOTA 3PBVA 1VHNA 1G7VA 3BLIA 4PA8A 5HINA 3OVQA 4UMAA 2JGYA 1BTMA 1SO3A 3MWAA 3W74A 2E5DA 1TMHA 2NUYA 4O8RA 3ABQA 1NVMA 3HMJG 2FIQA 1KFEA 4RZ4A 4AB4A 3MMTA 3G8EA 3I7RA 1SSDA 2NXHA 1M6JA 4Y9AA 3V1PA 3TROA 4M5PA 2NXIA 4MVAA 3STFA 1L9WA 5F1UA 4GBUA 5FF4A 4JTUA 3UWUA 3G22A 2WSRA 1SO5A 1W56A 4FNSA 1QOQA 4ICNA 3W71A 1ZAIA 5CZSA 4AMAA 1A53A 4OV9A 4NUWA 4Y96A 2ZFAA 3TX9A 3GDKA 2C15A 2NX3A 2VEIA 3L66A 1G69A 1L6SA 3ZR4A 5I3IA 4MY8A 5D2VA 1WV2A 3TMQA 1I4NA 3O06A 2CZ5A 2ISSA 3NA8A 3MI6A 3EXRA 4HNUA 1N8FA 1NFBA 4JTEA 1P4CA 3THQA 5BNKA 2V0TA 2ZZ7A 2A6NA 4PH6A 3NNTA 3O63A 4IJBA 4RXFA 5L6UA 1VLIA 3VE7A 3W7OA 3ZWSA 1IGSA 4YXGA 1YTDA 3LHZA 3NM1A 2WV8A 2YCEA 3NO5A 5LHFA 3GKFA 3K30A 2PRMA 3R2GA 4O54A 4LVFA 4BWLA 3TAOA 1H63A 2W0UA 1OYBA 2GQ9A 4JX4A 3ABRA 4YWIA 4UTMA 3C3NA 3CEUA 3S5NA 4JTLA 1H5YA 3W7CA 3NQGA 3WJXA 4MOZA 3N34A 4O15A 3T55A 3G1AA 2ZRUA 4JIQA 4RZ5A 4UTUA 3S1VA 3TK7A 4ZZ9A 1F74A 2V82A 4UTJA 2B7OA 1PVNA 3MBDA 1KM1A 5SWUA 4S1FA 5D04C 3LX9A 5D02A 1ICQA 1F7BA 2D73A 3KXQA 4UMCA 3LCLA 1K7EA 1LP6A 4R33A 1M5WA 3KFTA 1IXOA 5HR7A 3D0CA 3UWZA 5AHEA 2Q3OA 3OHIA 3NL6A 4JYEA 3GLCA 4UC5A 3CHVA 4GFSA 4JTTA 2FQIA 5LNVA 5J5RA 1UBSA 1KTCA 4NNBA 1C8VA 1Q45A 3WJYA 4MPQA 2ZBTA 4UTIA 3LI0A 1WBHA 2C3ZA 4O13A 3MUXA 3NPUA 1XUZA 2Q8ZA 3KX6A 2X1TA 1EA0A 2V9DA 3PAJA 1B4EA 4Z1DA 2TRSA 3I68A 4QM1A 4FO4A 2RDUA 2GUUA 2ALDA 1CI1A 4O11A 6TIMA 1DVJA 4YCOA 4DBEA 5IBXC 3CEPA 3KVMA 5E93A 3RLUA 5D30A 4PL2A 1S5WA 5L9FA 1X6UA 4LTSA 2YFOA 4A29A 1KV5A 3NQEA 3MI2A 1ZAHA 4N2YA 5D37A 1LYXA 2CLKA 1FQ0A 1GVFA 2ZZ2A 3FS2A 3B06A 3A5FA 1TPH1 3W84A 5CPOA 3HGJA 2VFEA 2HSAA 1JR1A 1TYGA 4LV4A 1GG1A 1OYAA 3MW7A 4JTIA 5FF0A 2ZZ4A 3MHGA 3IVTA 1EPXA 2GQ8A 2YXGA 3HGOA 2A2IA 4IXXA 1XDMA 1O94A 3IEBA 3M43A 3W7EA 1L2UA 2YFNA 4O53A 3LHTA 3NQFA 1LLZA 2X16A 3O16A 1QFEA 1LM1A 1XDLA 3BG9A 1HL2A 3F1QA 2VFFA 4JNMA 4PTNA 5TBOA 1T99A 3M47A 1QPOA 1M7PA 1TRIA 3M5YA 1LRQA 3N2MA 4AWUA 4MIMA 1KM3A 3VE9A 2DJLA 3BO9A 5K9DA 1LZOA 4R7JA 2QUTA 3NQ2A 4NJHA 2J88A 3F4WA 4CLMA 4ONVA 1TPEA 3B04A 4ZQOA 1ZCOA 3G8RA 3HOJA 4OV4A 3LRKA 1I2QA 5AOUA 4MUZA 3R12A 1R2TA 4K39A 3TCEA 3SW6A 4LC6A 5F4XA 1VLWA 2FB3A 4HNVA 1FWRA 4N4QA 2Y89A 3W2LA 4O12A 5F2IA 2Z0IA 3U8GA 4JS3A 5G2IA 3CB8A 3LM7A 1G7UA 3QMRA 3M44A 2Y6ZA 4LUJA 3VI2A 1OK4A 3DFOA 4MY1A 5D2XA 4LS0A 1AMKA 1JQXA 1LBMA 3NOEA 3LTPA 4CNNA 3P8IA 3L65A 4BI5A 1DV7A 3C2VA 1IXNA 1XBYA 4AH7A 1WA3A 3CU2A 3SECA 3C52A 4I7WA 2ZZ6A 2HTMA 2XN1A 3TQVA 3IVSA 3UYCA 3TSBA 3P7YA 3G3MA 3NPWA 3O6YX 3PBUA 4LVDA 4KFPA 3EWYA 3W1AA 1B3OA 5U7SA 1DKWA 1NF0A 1JCMP 3UWWA 1DORA 3N9RA 2F84A 4EF8A 4UTWC 3F4NA 3PR2A 4NNCA 2X1UA 2Y62A 4HPXA 1DHPA 1W5QA 1YXYA 2JKEA 5AN7A 3GB6A 3LGEA 3MBFA 4UTLA 4NJJA 1G4TA 5J5DA 1EIXA 2E5BA 4M7TA 2YYTA 1F5ZA 5HULA 4KWWA 1S3HA 1ME9A 5G1YA 1TTPA 1RQEA 5HWJA 1JCLA 2CLOA 1K02A 4OU1A 5EL1A 4LVAA 4JTFA 1YXCA 3BW2A 2HS8A 3T7VA 1T96A 4TX9A 1CX9A 4HIBA 3DAQA 5KZDA 3MHUA 3NVTA 5C6MA 1XC4A 2VELA 4I9AA 3TXVA 3W1PA 3OBKA 1OFEA 4E38A 2J9ZA 1HFBA 3HQ1A 1ZALA 3NQ8A 1L6YA 4JTKA 2H3BA 5HNRA 3DFSA 5LNSA 2QDHA 1H60A 3GIYA 3GXPA 3IIZA 1A5AA 1VCVA 3SR7A 4FEZA 3S42A 3GXTA 5AC8A 2RDTA 1R47A 4AVFA 2QCFA 3V75A 4U4MA 4JDBA 4IX0A 1ALDA 2KZHA 4ZQRA 1T0OA 4OWGA 4UFJA 2PRHA 1AW5A 5DN1A 1FCQA 2QF7A 2CZEA 3W1MA 2ZZ5A 3G18A 5U4NA 3BGGA 3CTLA 1BWLA 1Q3NA 3PULA 3BGJA 1X8FA 1XI3A 2XFWA 5EBUA 3RK8A 3GDMA 4AXKA 4OE7A 1VPXA 1DBTA 2H6RA 2FJKA 4NJGA 3MO7A 1SUXA 4FF7A 4H6KA 1Z42A 3L0NA 5F2LA 3G1XA 5HUOA 5K3VA 3SJ3A 4O19A 3KVLA 2YPIA 1DL3A 4E2DA 3W7HA 4XTDA 3W1LA 4HSNA 4OT7A 4GXMA 3W07A 4CCEA 3TUUA 3LXBA 3HG2A 2QCHA 3W7QA 1EWDA 2GJNA 1QCWA 2ATMA 2ZRYA 4XQ6A 5F2MA 2G5WA 1JRBA 3E02A 3E0IA 4MZ8A 4BK9A 1MEIA 4ORMA 3LLDA 3QW4B 2FPVA 4AF0B 3W76A 3NEVA 1SW0A 1SFJA 3T4CA 4JTHA 4E0CA 2DZVA 2A7RA 3C61A 3I6RA 5FF7A 3N14A 4MZ1A 4R53A 5DLCA 2VFHA 1F76A
chains in the Genus database with same CATH superfamily
1ITUA 3I3EA 1FWGC 3LNPA 2BY0A 4YIWA 2XINA 2FZDA 4L61A 3SUSA 3NSNA 4MKSA 3EDDA 2CHRA 1L8PA 1TE6A 4N0RA 3PJUA 1LBLA 3CASA 1E15A 3LENA 2FGZA 3EWBX 4DJFD 4HBKA 3IIVA 4A2SA 1NARA 1EQPA 1V6YA 4MY9A 2DSWA 1XD0A 3BANA 1DWAM 2YL5A 1XCXA 1VCFA 2JF7A 2I9UA 3N4EA 5HPCA 1W1IE 1RVKA 1E0WA 3IJ6A 3N3MA 4K2SA 3ZT5A 2NX1A 3URNA 4KRZA 3MZ2A 3W2JA 3SCWA 5FAGA 2W79A 3QZEA 1ZQ5A 4W93A 4C1NA 2OYKA 3VKJA 2CHNA 3HPZA 1FP8A 3MSDA 5HA7A 5HJLA 4I9JA 3V0TA 4LXFA 1Z44A 1OT2A 1VAHA 4JD4A 5KZMA 3IACA 4J2PA 3FNDA 1Q6GA 3FSTA 1ODUA 3W7DA 3PZGA 2CBUA 2DT3A 4OUIA 4HNNA 3J7HA 4K8EA 1AH0A 3KVKA 2Q01A 2DW6A 1UP3A 4LUIA 1ZJIA 1A50A 1MW0A 5HMSA 4BF5A 4ZMGA 3WLSA 4GNJA 4JIPA 1GOXA 2XU2A 5E1QA 1XQLA 4AIEA 4DLMA 2JQXA 2WCSA 4NZJA 4I7UA 5CLWA 3R0DA 9CGTA 3WNNA 1OB0A 1OFBA 2YGYA 2VFIA 3VO0A 1QASA 4GOAA 3AHXA 5ABFA 1XKYA 3WELA 4AWTA 4DVOA 5JBFA 3RU8X 4E4FA 2E28A 1DQXA 2Z28A 1KM0A 3K8LA 2TPSA 3A3WA 1KFCA 1W1A1 1XFBA 4JN6A 5FJOA 1KA9F 1OD0A 1W2PA 3LPGA 3HPXA 4XG1A 1EF3A 5EBAA 3LQGA 1JUBA 3TLQA 1PSCA 1SJAA 3SZ8A 2OVLA 1NSJA 4JFSA 1R3WA 2QJHA 2BP1A 4HHPA 3I4KA 1LOQA 1PTAA 3M9YA 1I6NA 3EOUA 2J24A 1BXBA 3EDFA 3EZ4A 4GQQA 1J6OA 1UH4A 3CV1A 1H5VA 4N9EA 4NIRA 4HVXA 1JPKA 4AC7C 1XBXA 2BVTA 4IP4A 5DY3A 1REQB 4OGZA 4K7VA 1R87A 4F0HA 4WJXA 4R9OA 2ZUNA 5JQ9A 3RX3A 4UCGA 3VABA 2OZ0A 1Q65A 4ATWA 4H2CA 1IIGA 3S9IA 2EPHA 1LBFA 4U2ZA 5M5DA 1H1YA 1H7WA 3M0YA 1FOBA 4HA4A 3GHRA 2X41A 3QY6A 2EF9A 3VOGA 3PG9A 2FFIA 4MFEA 2HCVA 3E12A 3M5VA 4O4WA 3E96A 2XM1A 1OFOA 3NDOA 1LROA 1Q7QA 3U7BA 3GTFA 1OIMA 2YCKX 3U7VA 3UQNA 3NYZA 4C91A 1FWJC 1TQXA 2W62A 4JOMA 1AG1O 3OHMB 1E6SM 4CVWA 5CG0A 2OODA 3UW6A 2Y7DA 5B7YA 2XN2A 3AHVA 3SUTA 4HZ6A 5FF2A 4CQCA 3CBWA 1PZ2A 3VGEA 4YMZA 1A5MC 3GTIA 4ROPA 1GTHA 3HG5A 2HXUA 2POZA 1E4IA 2PWEA 1RCOB 2JBMA 3QTGA 4M7SA 1XIEA 4GX9A 4NP7A 1L6FA 1FWWA 3QQ1A 1FHVA 5JIPA 3DXIA 4BQ4A 1I1WA 4CN1A 3MWCA 3ITYA 3N04A 3HJZA 1C29A 4TVCA 5CC3A 6CGTA 4HOWA 1WKEA 3PBWA 5I2UA 5G2WA 4XAZA 1JJKA 1TTIA 1OC5A 1EJ7L 4O4VA 4OBRA 5C70A 4BZYA 3HFYA 1XG4A 4J3WA 5DELA 4RXGA 8RUCA 2OGJA 1Z32X 3P74A 1HVQA 1K8XA 1PKNA 3STGA 4G7FA 4PUJA 3WH6A 4M24A 2X7VA 4HJWA 5LXXA 5DQPA 2YB1A 1QOXA 3D3AA 4KIEA 4OBTA 4C6JA 4S3JA 4LCRA 1ZY9A 1OF8A 4BF9A 1WXJA 2G4JA 2E6YA 4GYPC 4DZAA 4ORIA 3RGTA 2CHOA 2P8BA 5CGQA 4P8XA 4HQVA 2PEVA 4JTRA 4GZIA 1XH2A 2E7FA 2RH9A 3SN1A 2Y85A 1DEDA 4CD8A 2PLCA 4NJKA 5BU6A 3VVGA 5HNNA 5AYZA 1EUAA 4OHQA 2NWSA 1AFSA 4JQ2A 1J0HA 5FCZA 1SJDA 3T0DA 4YTTA 4B5SA 2DORA 5D09A 1PV8A 3VDHA 1EOKA 1C8XA 2PWDA 4CQ9A 3VIKA 2ABBA 2X2YA 1X97A 3LHVA 2EPOA 1J93A 2EG6A 1KGUA 3HZ3A 4OQVA 3TN5A 1SSGA 4ZQMA 4JTAA 5D2WA 4H7CA 1K1DA 5BU9A 4Z2HA 5BXSA 1SYTA 4TR9A 5LIXX 3QLDA 4PMDA 4WEVX 1EX5A 4K6AA 2Q09A 3DU0A 3FGCA 3H12A 1Z9AA 4ZO7A 1MUMA 1I8JA 3W1XA 2CU0A 3VNLA 1X1ZA 4C1LA 2DVUA 3QEZA 1VPQA 2ZRXA 3RMEA 5KITA 4X0NA 5BYWA 4M1BA 1GT8A 2ABAA 1J0YA 2WYSA 5XINA 2Y8UA 4GRSA 3VD5A 1HG3A 1VP5A 2BOGX 4AD1A 4TMCA 1DYSA 1H7NA 1W32A 3NO1A 3KBNA 1TO3A 1XXXA 2IS7A 5C7HA 2DUZA 1BKSA 5KMYA 3UCCA 2INFA 3TU9A 2OWWA 1H3GA 4DELA 1F3TA 3UY8A 2YXXA 4NAFB 1V5XA 5LGXA 1OFDA 4UMBA 1VRXA 2ZZ1A 1A4MA 4J3TA 1ZSXA 2VWSA 2XSBA 5DRIA 5KEZA 3FIGA 2Y5JA 4UCFA 1W1PA 4XIMA 5AC6A 1VZWA 2QGHA 1EP3A 2INEA 3IS4A 1FXPA 3QFWA 2Q02A 1PX8A 1R2RA 1FHUA 1LG2A 4M80A 4DUVA 3LRLA 1E6RA 2O0TA 3OVPA 1ONEA 3O8AA 2PPGA 4HU8A 5EMMA 4DPPA 1QRQA 3BPWA 2DSVA 4JICA 3IARA 3OQ8A 2NW0A 3TYUA 2PCEA 1BWKA 1KM5A 3R10A 3WDQA 4B4HA 3WLNA 4RZBA 1LOLA 4JTSA 1TMLA 2H90A 4ES4A 3KOXA 1EDTA 1SFLA 2BWGA 1BYBA 3UF9A 5ABGA 1J4EA 4YJ5A 3SQSA 3SADA 1W5OA 4NX0A 2J62A 1DIKA 4R5EA 4Z2IA 3NAVA 2PDFA 4CN6A 4IT1A 3MI3A 3NQVA 3IJDA 3T0TA 1YDNA 3H2NA 3C2EA 1RAKA 4QLKA 4L7ZA 5AYIA 4DUOA 8XIMA 3QMSA 3A4XA 2BXVA 1Q13A 1K4GA 3W7KA 2Y63A 2J79A 4GISA 3Q65A 4XISA 4PMZA 4GI4A 5EFFA 4YL2A 3OOQA 3KLLA 1D7FA 1TV8A 3WQDA 2WHMA 4HK5A 3IGHX 2VDIA 4E2BA 1Q6LA 3TYAA 3NQDA 2HWGA 2VTFA 3PG8A 3N18A 3GVGA 4MM1A 5BROA 1UC5A 4LS1A 4PODA 1TTQA 3PS7A 4CQ8A 1LL4A 4A3YA 3TTEA 1PO9A 3NEHA 3CTTA 1V51A 2XGZA 1VF8A 2WZTA 3M5ZA 3GU1A 1DP0A 3PTKA 5KZEA 4DZIA 4KETA 2V5DA 2D2OA 3AXMA 1KNWA 1F6KA 4NVTA 4WY0A 3QRHA 3TJIA 1V7YA 4AG0A 1LRNA 5CC7A 4LW7A 2IKGA 3HBLA 4KQNA 3P93A 3TCSA 5EKYA 4P7LA 2J25A 4MG4A 1PL9A 1FTXA 4GACA 3VIIA 1TWWA 1SR9A 3F4DA 4XZNX 4PE8A 1ITCA 1EXPA 3UYIA 1XC6A 3MP5A 2A3EA 3EMQA 2C0HA 3UWYA 4E8CA 4MFDA 4LBSA 3G5EA 3OIXA 1UR3M 1Q5MA 4QEHA 1MNZA 4H8UA 4IF2A 3GK0A 2QCLA 3G1FA 4D8ZA 4B92A 1AL7A 1TJ2A 1QWKA 1J0KA 3A6OA 4RNIA 4M6QA 4TX6A 4WJ8A 2O4MA 4N4PA 1QOPA 1OVDA 3CZEA 3T44A 4YNGA 1FDZA 1UWQA 4GK8A 3VIJA 1EH9A 4O50A 4JFUA 4XZIA 1AJZA 4DQWA 3ARYA 3GXIA 2C1HA 4MJZA 3CPUA 1V6WA 1DIOA 1XICA 1QNQA 5GNYA 2XGIA 1THFD 3A21A 4JFVA 1J11A 1ZUAX 3PBMA 4AISA 3ZQ9A 1NTHA 1GYNA 5F4SA 4QAIA 3OQEA 1FX6A 5D8ZA 1CXFA 1FWSA 1QI4A 2ZQ0A 1WDDA 5LYRA 4V33A 3WQFA 3QF0A 3WDIA 4XAPA 4DF2A 1TX0A 4EOUA 4S3GA 2VL4A 1G6CA 1ZZMA 5ABTA 3LU2A 3QXBA 4JHMA 3UA3A 1DXFA 1I0DA 3B0UX 5A1AA 3IV3A 3RLHA 3WQ5A 5TQLA 2J27A 4F0MA 1JCYA 1T5AA 4LOCA 4UFLA 4MTVA 1KM6A 1TPFA 2XISA 1VGAA 1IV8A 4AYGA 3GDTA 3NSMA 3FHAA 5F4WA 3RJYA 4RV8A 3H7VA 4GCAA 2WMIA 3B40A 1ONXA 1WDQA 4KFOA 5LA0A 3UY7A 1C93A 4OZOA 5CBBA 2XZ9A 3AMGA 2CZDA 1EZWA 3L4XA 5E9XA 2BX7A 3TMLA 3AS0A 4MKNA 3WBEA 3W00A 4ICMA 2GVJA 3OA3A 2PRLA 2YBTA 3TC6A 1OJXA 2YCJA 3E38A 3BCDA 2FZ8A 4G9PA 2DVXA 1LDCA 1NWUA 4V1YA 5I00A 1F61A 2GSHA 4EKJA 2UY4A 2JIWA 3N4AA 4Z17A 1UD5A 2OWCA 1A5SA 2ZE3A 3GDLA 5AHLA 5HMEA 1DHKA 1PX3A 3UESA 4DWSA 4BQ5A 3OG3A 2BS9A 4P8UA 1WKFA 2PGRA 1REQA 4PTVA 1TVNA 1WZMA 4HA3A 2DIEA 1ZGDA 2XWDA 3MHFA 4KPLA 2V3FA 3NZPA 2A1YA 1UMYA 4C6IA 1VFHA 4DO6A 4XZLX 1ZBVA 4FI4A 1EGVA 5C71A 2PC8A 3LPOA 4HNLA 2R1NA 1Z8AA 2O92A 4KFNA 1KCLA 2GVGA 4EWND 4XUGA 1UWTA 3VINA 2WOQA 1XLGA 1GORA 3RAOA 4PB3A 3W87A 1QPQA 1O95A 1YHTA 3MVTA 3MKKA 1OX4B 1K6AA 1SFTA 3FYPA 4C6KA 2R1MA 2VVSA 1X6LA 5LZLA 1H7XA 4M3PA 1TB3A 1Y5VA 2DEPA 4O17A 2JEPA 4GO9A 4U10A 2BHYA 2VCBA 3DFQA 4WLCA 2WW5A 4MDOA 4BWLC 3O0FA 1P48A 3LA4A 3PB2A 4V27A 4UOZA 4WX2A 4RV3A 3L2MA 5C2CA 3RITA 1C91A 4PEEA 1Y5XA 4ZQCA 1FKXA 3BE7A 3U4FA 1BSLA 3LHUA 1JF5A 1VFOA 2G3NA 3U2ZA 1UA7A 2PURA 3S9ZA 4NILA 2ZRWA 1LLOA 1A5KC 3WLHA 2DZUA 4IIFA 4F0KA 3AZTA 2FPYA 3USBA 5EB8A 1O6IA 2VC6A 3HG4A 3N2XA 2VEKA 2Q8XA 1CZ1A 4G1NA 3SUWA 2QNEA 4O1AA 4HK6A 4AZ6A 3V16A 1VBRA 3PJWA 5E6ZA 4D6DA 4MWAB 1E6QM 4ZE5A 2V67A 4IGSA 4XZMX 5IDZA 4AUBA 5JXQA 1FWNA 4FXSA 4C60A 1P0BA 4LWWA 2CLLA 4IH3A 1NDYA 3XISA 4LCSA 3UERA 1GW1A 1UB3A 3U4AA 2I9EA 2VOMA 1VFMA 1J5TA 1PZ1A 3SIMA 4Z2KA 2Z29A 4GUIA 4O1FA 3EWCA 4ZXOA 3TQ0A 4GUJA 3W2KA 1LOSA 1CXEA 5E0KA 1SO6A 3AALA 3EPOA 1Z41A 3JR2A 3BQ6A 1XGEA 4E5TA 5HMFA 3IGUA 5E6YA 2O7QA 1IZCA 1I1XA 3G6MA 3B03A 4G5DA 1EJUC 5I3JA 3PPCA 1JZ7A 2VEPA 2HV5A 5IDIA 2QPSA 2QAPA 3N9SA 2FVLA 1XYMA 2VEMA 3TYCA 2FTYA 3TH6A 4HHLA 1SZGA 3E49A 1US3A 3VNYA 1JCXA 1PIFA 2WMJA 5HOSA 3P62A 2F7FA 1P0NA 2W91A 4R34A 1YYAA 3VZYA 1E5JA 1MXDA 3WLMA 3HO8A 4MNLA 4XBKA 5DCDA 3HV9A 1QW7A 2GVLA 4DJFC 4WOQA 4L65A 3CM4A 3V3WA 5F2GA 4Y7EA 2PSNA 3MV01 4DY1A 4L9ZA 1OYCA 3CAKA 3AJ7A 4JTGA 4DZ5A 1BYDA 2YL9A 1E9LA 2CBJA 4ZBCA 2E09A 3SCPA 2VGBA 1OFRA 5AB3A 4NXSA 1LTDA 3WMLA 3PWGA 3UZWA 4NXKA 3W1RA 2VZTA 3CAVA 3W22A 1E3ZA 3LNMA 3AZSA 1AW2A 3SIZA 4K8GA 3L67A 3HIJA 3L4VA 4FNUA 4UFMA 4DXVA 3MZNA 3KWXA 1ZTVA 4DXKA 4MJMA 1E3XA 3H26A 3S1GA 4NZ4A 4DBWA 4WHBA 1QUMA 4RDZA 2YCIX 1SJBA 3GZAA 1S2VA 2QHAA 4NJIA 2O9RA 4GCXA 3BW4A 2GGGA 3AYVA 1QBAA 2X0YA 3WN6A 3AWNA 3PJTA 4QDMA 1KRMA 2DZBA 4V15A 4BEQA 5A69A 3LXAA 4C7DA 2DIJA 3WD3A 4HB7A 2HRWA 3APGA 1NFPA 2XH2A 1R3VA 3SFKA 4UFHA 3CAQA 2P76A 4KIRA 2ZRVA 3I6EA 5BMWA 3QSTA 4XD3A 2PTWA 1M04A 2NV9A 2QMKA 4WOZA 2DVTA 4JEQA 1XCFA 1LUCA 2VX4A 2QCGA 3CQJA 2CETA 1TPUA 3KM8A 4LVGA 2INZA 1MQQA 1XLJA 3V4BA 1E55A 2Y61A 5LNRA 1TREA 3O3RA 2VUYA 3GU2A 3LLXA 3DECA 2P53A 3H55A 3OVGA 3TN3A 2D0HA 3FYYA 1KCZA 3T78A 1W9BM 2PDJA 3UZXA 3VGDA 4C6OA 4ZFMA 3KHJA 4WZHA 1AQ0A 5LA1A 3RF9A 2BTMA 1B1YA 1M7OA 5IHRA 2PCQA 4KWVA 1EGZA 2A6LA 3A22A 3K2GA 3SFWA 3WBYA 3BLIA 4PA8A 4DJDA 1VFFA 3MANA 3W27A 2PAJA 2NQHA 1SO3A 1JGIA 2EKGA 3MWAA 3WFLA 3W74A 1TMHA 3WUEA 3ABQA 1NVMA 1KFEA 1Z69A 1NIUA 1M6JA 4JKKA 1XIDA 3B0XA 3V1PA 3TROA 4M5PA 1DXEA 2BGNE 4HOXA 1MUWA 1SO5A 4ICNA 3W71A 1UD4A 4TVUA 2QPXA 5CZSA 4AMAA 1KXQA 4Y8EA 3O0KA 1J96A 3DC8A 4Q7NA 4XD4A 3TX9A 2C15A 2VEIA 1L6SA 3ZVHB 1BTCA 3ARPA 4IJCA 3QKEA 1B3VA 2CZ5A 1OD8A 1V3KA 1CLKA 3MI6A 1XH0A 4HPGA 3PZMA 1EXBA 1JIBA 2FGLA 3THQA 5BNKA 4ZE4A 3TEVA 4QCEA 2OWXA 5TF0A 3TVAA 3CZKA 3VE7A 1IGSA 4YXGA 3NM1A 3LHZA 2WV8A 3T1GA 2YCEA 3NO5A 3USZA 3K30A 4REQB 1H63A 3ABRA 1VPYA 4GIRA 3EKGA 1DTUA 1QI0A 4MOZA 4O15A 4CGTA 2ZRUA 2OX4A 3TK7A 4ZZ9A 1QNOA 2NT1A 3VDBA 4YTSA 3LX9A 1RY0A 3TTQA 4UMCA 3U57A 1LP6A 3SCUA 4R33A 1M5WA 2REQB 1A4LA 4MF4A 2G3JA 2PDUA 3D0CA 3H4XA 1JZ6A 5AHEA 2Q3OA 3NL6A 4C6QA 4ZOBA 3A3XA 3CHVA 3QZAA 4JTTA 2FQIA 2J4GA 5LNVA 3XIMA 4NNBA 5A6SA 1AA1B 4KEZA 1HXJA 1Q45A 3GD6A 3GHTA 1WBHA 4O13A 3WUFA 3UJSA 4YYCA 2OU4A 2V3DA 1XUZA 1CGUA 1YQ2A 3VUSA 3PAJA 1TA3B 3PPGA 1W3LA 2J7BA 1BPLB 1UIOA 2P88A 1CI1A 4O11A 1S2AA 4K3ZA 4YCOA 1EF2A 4QDPA 5E93A 4JIIX 5D30A 3TONA 3QZ6A 4PL2A 1S5WA 3DG3A 2WVTA 2ADAA 2YFOA 3MI2A 4N2YA 3WEMA 1FQ0A 2BFGA 1GVFA 3A5FA 1LG1A 2VEFA 4GNVA 5CH9A 4DB7A 3HGJA 3RRXA 3THCA 1CCWB 1PX4A 4LV4A 3FDKA 1TJ0A 1D8WA 3ZLGA 1U22A 1J0JA 3IVTA 3G6LA 2GQ8A 4PCSA 4WKFA 4MMWA 1XDMA 1B3XA 3RN6A 4JKLA 2FH8A 4Q4QA 1NWSA 1V6VA 1AMYA 1QHOA 1A49A 3V5FA 3LHTA 2GVEA 3NQFA 4RNJA 3UJFA 4GMEA 2X16A 3KZPA 3O16A 4RPQA 3CZJA 3F1QA 4XZBA 4S3BA 1E0XA 3F5LA 2GGEA 1R85A 1WZAA 3RM9A 3FAXA 4PMOA 3BO9A 2QUTA 3NQ2A 4NJHA 2J88A 4TTGA 3ZJKA 4ONVA 1U33A 3LUTA 1TPEA 2X1IA 1BF2A 3CL6A 1ZCOA 3G8RA 4DAIA 3ZYZA 2PDHA 3UJEA 2NT0A 4E3VA 4B4FA 3R12A 4PFHA 1ZU8A 2PU0A 1UIPA 4LC6A 5MKGB 4H9VA 1DPMA 2Z7GA 3G2GA 1FWRA 2XIMA 3DFHA 5FAJA 4N4QA 4GHRA 3EBVA 3RPDA 3W2LA 3EPNA 3NOYA 1NU5A 5F2IA 2Y0FA 4M6UA 3I6TA 3BAYA 3U8GA 4JS3A 5TAOA 2XG9A 4EPBC 1G7UA 3M44A 3VI2A 1QTWA 3LQLA 1OK4A 1HNYA 3DFOA 4MY1A 1AMKA 1JQXA 1VENA 4O1EA 3WQOA 1C9WA 3L65A 1F3WA 1DV7A 4AH7A 3TC3A 3KL3A 1MYRA 3W37A 2HTMA 5GNXA 4I6KA 3G3MA 3O6YX 3W1AA 4GZ7A 1B3OA 5U7SA 1NF0A 3UWWA 1D7KA 1DORA 2E9BA 2CLPA 3GUWA 3MUY1 4EF8A 1GJWA 4W7WA 1DHPA 1YXYA 4XD5A 3GB6A 3IANA 2WLZA 4NJJA 1FHLA 4GXWA 1F5ZA 1R9YA 2CWXA 1K9EA 1XSIA 4H41A 2V5CA 1S3HA 3ICJA 3UXKA 2QIWA 4PRTA 1UZHA 5EL1A 3KOWA 3ZT6A 3GW3A 1T96A 3DAQA 3NVTA 1CDGA 1PTDA 2WZEA 3W1PA 2J9ZA 3NJ3A 2IQ0A 4GI8A 4JTKA 2H3BA 3M7SA 3GXPA 2HBVA 2Y5SA 4ZCWA 5AC8A 2HVOA 3AIVA 1HP5A 4JQ4A 5C8BB 4FXJA 2OSWA 4UZSA 4JBRA 4UFJA 2PRHA 1TVPA 2V5KA 3W02A 5DN1A 1FCQA 3BGGA 3VD4A 2P8CA 1Z7AA 1DXIA 4HNOA 5HPOA 3RK8A 4H04A 1BRLA 3LZ3A 4AXKA 4OE7A 3VC6A 1DBTA 2JALA 2H6RA 2FJKA 4H6KA 5DEZA 1XV8A 3G1XA 2VRJA 5K3VA 4J4KA 3KVLA 4QDWA 3OB8A 1DE6A 3WLTA 1PYFA 4DI8A 1UC4A 4CKQA 1SMDA 3EMZA 4CCEA 3PZUA 1RCQA 4UTFA 2HE5A 2QCHA 1S1RA 4IIDA 4CUCA 2ATMA 1VBUA 3TN6A 1UKOA 3ABZA 3LLDA 1D8CA 4AF0B 2PTXA 2R6OA 3GG8A 2DT0A 1VEMA 2QIIA 3C61A 2WLYA 1W2VA 3R4IA 3H7UA 4V1XA 5DLCA 3ZJ8A 4PUKA 5D8WA 3R94A 1D3HA 3ITGA 1Y5WA 2OLHA 3AROA 3ZIZA 3U6WA 2ZXAA 4QP0A 2ZX7A 3CS2A 5FL1A 4J28A 3SCQA 3MU7A 3VKKA 3SBFA 4FPSA 2B0MA 3QW3A 1U5JA 1QO5A 1EHAA 3ANYA 1A5UA 3LV5A 2RFGA 4RCXA 4D9PA 2NQJA 3MUZ1 3ITVA 3UXDA 3AS2A 3N73A 3QC3A 5CZ0A 4BF7A 5CAHA 3VFLA 2O7SA 3W2NA 4A35A 1L8NA 2J66A 4H8HA 5FEWA 1JQVA 4HGXA 3MMUA 3CIWA 5A6LA 1Y0EA 4FB7A 1KR1A 5BMXA 4IISA 4ASTA 1PTGA 3F7JA 3NL3A 3NZ1A 3CNYA 4ZVJA 1QHPA 2BGQA 4FMVA 3M0KA 4KMQA 3CQHA 1DWHM 2ZUMA 4A8LA 1SU5A 3QHOA 4TVDA 3T6CA 3R13A 3T0CA 1N55A 1YE6A 3EEZA 2J9XA 3E2VA 3ZR6A 3M16A 1XRTA 1JZ3A 3T2PA 3VGHA 4UNKA 4ZODA 3U9IA 1D2KA 1N8WA 2DT1A 2E5CA 4UR9A 2XZ7A 5I07A 3HJEA 3NGJA 2PC4A 2BNJA 3S1UA 4N7QA 2CBVA 1OC6A 2WKGA 2ACRA 4HCLA 3VKBA 3FFSA 1GCYA 1PWLA 4LV9A 4DBUA 3GX9A 4US5A 1E6NA 1NDZA 2QUNA 2I14A 4B15A 4R3UA 1R2SA 2GJLA 4ATDA 4HPHA 4ZL1A 3TNOA 1O5KA 1W1ZA 3R43A 1XIJA 4JX6A 1GTEA 2ZX5A 4RDVA 1MSSA 4GFIA 3ZO9A 3TOPA 1DTNA 5JBDA 4AAJA 4QBXA 1ZNNA 4K68A 2QCCA 3K4AA 4JCMA 1WDWA 1E5NA 3OG2A 2VMFA 1WPCA 3GYEA 4YHEA 4IIGA 4MWAD 1N2VA 3M1ZA 1WYIA 3EKZA 3Q37A 3RXZA 3QY8A 2CESA 1K7FA 4Q7IA 2OSYA 3V36A 1VC4A 1PZ0A 3TAKA 2RHGA 2DDXA 5GJNA 3REQA 1B2YA 1XRSA 2XVKA 4XUYA 2NQ9A 5HUPA 2VGGA 3QQ0A 1TV2A 3FSUA 4UFKA 2G3IA 4PCNA 3VIHA 3GNNA 1K3UA 4FXRA 1JZ4A 1BHGA 4ZFCA 3K4DA 1VD6A 3OLEA 1BGAA 1E9YB 2PD9A 2NVAA 3TQPA 2Z6JA 3UVIA 2OLAA 3G3DA 3V18A 3GO2A 2E68A 4CVUA 1K4HA 1F05A 1YXDA 4ADUA 5KINA 2GQ3A 4AZCB 4UOQA 1SW7A 1Q6QA 5EY5A 3BOLA 2DH2A 4HD5A 3LCFA 3N2CA 3GNOA 4LYRA 1J79A 2A3BA 5T9BG 1UKSA 3TE9A 4ZO6A 3M64A 1HJQA 3I7QA 4LBUA 3HPSA 3BG3A 3KRUA 3RO6A 2ZX6A 2QCDA 2EGZA 5D2TA 3NSXA 5K4XA 4ERGA 3TYBA 3VM5A 1EWEA 4XAGA 2Q6ZA 3W3OA 1BAGA 3RG6A 3LMYA 1FXQA 1HKIA 1EP1A 1O66A 1KFKA 2GJRA 1QMLA 1IEWA 2XJ7A 5T26A 1E9IA 5AYYA 4LRSA 4DIAA 4PMNA 4URIA 4XV0A 4W89A 3U2CA 1RJPA 4UWMA 1W1YA 2QT3A 7CGTA 3A9IA 1HO1A 3P5YA 2BY2A 2HISA 2J9YA 1JAKA 2KAUC 1PXGA 3RHGA 2O9OA 4UQ9A 3ZZ1A 3MYPA 3CT2A 4J3VA 5AHNA 2B81A 1YTEA 3RPTA 4LSBA 1TA3A 3K1DA 4QHRA 1TTJA 1JD9A 3WLJA 5LHEA 7TIMA 5C9WA 1VBJA 1XW8A 4P7NA 1X8CA 3WQWA 3EOEA 3GH7A 4GWEA 3VMNA 4CD4A 2JF6A 4S3EA 1ZLPA 1QR7A 3W25A 2YCLA 2AL1A 4DF0A 2OPJA 4WGXA 1S2WA 1EJXC 4IXHA 1VB9A 1DQWA 1HL9A 4ERAA 1G4SA 2WXDM 1D3GA 3CL7A 3M0VA 5EU9A 3AS3A 3PVFA 1QAPA 4PMJA 1MEHA 4Z42C 4GVGA 1OCNA 3GY1A 3NL5A 3BJTA 3BV4A 3LCGA 2HVMA 4GJ1A 2G95A 2YDRA 2PLKA 3UGVA 4IGNA 4ML9A 3AYTA 3RM8A 3SN4A 4LRTA 1GOKA 4YWSA 3IWPA 4PMXA 3TW9A 2EEXA 3BG5A 4PUUA 4BI6A 1LRTA 4HHMA 2ZUSA 4NG3A 1RHCA 3EXTA 1W31A 2PTDA 3DGBA 1V77A 4FNTA 1GG0A 5DCBA 4FX8A 5DF0A 4HSHA 3VFCA 1IWBA 1E40A 2VZUA 3B05A 3MUCA 5HQEA 2NZLA 2KX9A 2GLKA 5HWNA 3CYJA 4RL3A 3PHAA 4EF9A 2PDMA 4PEKA 4LUTB 5CPTA 3L4ZA 5C7VA 3WNKA 3AXHA 1OWQA 3KCLA 1XLBA 1ISVA 4DWSC 1ZCCA 1GQNA 3UJRA 2YL6A 3HG3A 1OEPA 3W9ZA 4AD3A 3GR7A 4E3TA 1NJJA 5KTLA 2R8WA 2YX0A 4DWDA 2QCEA 2ZA1A 1EEPA 3B8TA 5JVLA 3GUGA 1XX1A 1K7XA 1RA5A 1P1XA 3N11A 5LIYX 1MQPA 1TG7A 1CGTA 2J74A 1X7FA 2ZTJA 1JL8A 5MF5A 3C2FA 1QO2A 3LM3A 4X61A 3NPVA 5LIWX 3BAXA 4GQGA 3W6LA 4IIEA 3L4WA 4KKXA 4TUFA 2QYGA 3L68A 3DKLA 4RR4A 7ODCA 1UKTA 1TUFA 5DMMA 3W28A 3UWEA 2AOSA 3GR4A 1RA0A 2MNRA 3CQ0A 3MCOA 3SAZA 4D1JA 1WXZA 3NURA 1PHWA 1RQHA 2QEZA 3R11A 3DI0A 4MB5A 3CUXA 5I0DA 1ZL1A 3N2BA 4ZQNA 2WNQA 1U30A 3W6YA 2NUWA 4J2MA 4A8IA 4ZB5A 1RPXA 4L56A 1KKOA 1V4YA 1C90A 2QCMA 3S1WA 2CKRA 4FIRA 2OQHA 3R5EA 4CU7A 1ADOA 3A3HA 2CFFA 3DDMA 1ZP3A 3SJNA 3SGUA 1ZHAA 4NZFA 5K9CA 1LQAA 3L5MA 5F7UA 4MLJA 4JGDA 4G7EB 4R27A 4BR1A 4DEFA 1UR1A 2W27A 1JPMA 5REQB 3KS5A 4BQ3A 2C0AA 2NLIA 4LCQA 3QMTA 3HV8A 2RJGA 3DHDA 1DWFM 3NM3A 5EMJA 4Q22A 2BZNA 5FJPA 1DQUA 3QH2A 2JKPA 1GEQA 1LWHA 3OIHA 3MKCA 2AQOA 1GEHA 4M56A 3H2EA 3QKZA 2GUBA 4AZ5A 3MVIA 4ZB2A 4XO7A 3LYEA 4ZR8A 1R8LA 2OEKA 3NIYA 1YPXA 1JPHA 4BHYA 2Q71A 1IGWA 5D05A 1OK6A 3DHPA 3RLGA 2EO7A 3D5HA 2AQWA 4OKDA 2DY3A 3SY5A 3KRBA 3G1DA 4AF0A 3TW7A 4Z2JA 3AMKA 3ES8A 4I9MA 3S1XA 3W53A 1W9UA 4DX3A 3I65A 5D9PA 2OB3A 4PTDA 4KEUA 4N6EA 5A6BA 1EDGA 1H61A 1HUVA 2XTKA 3MUIA 3PJXA 3ZT7A 5LNWA 4HN4A 3RCMA 1YE4A 3HMCA 4PUDA 3N15A 2B7PA 5AC4A 3H2AA 1IYXA 3WMCA 3TJLA 2QZRA 3GDRA 4FIQA 1AL8A 2ACQA 1CT5A 3TYZA 4MSSA 4S39A 3LCHA 2VDGA 1RD6A 2G96A 4HA0A 7PTDA 4GPNA 1AUSL 1G9HA 4MJ2A 1ADDA 2F6KA 3TDFA 1ICSA 2MANA 2G41A 1UOZA 1XWYA 3LV6A 3O1NA 4MHBA 4W4QA 3LDVA 1V93A 3W72A 1FA2A 1BVNP 2OEMA 4OTKA 2V3EA 3ARVA 1XLLA 4BS0A 1EBGA 1Q63A 4M19A 3HQOA 1H50A 1GVOA 5I3FA 2Z6IA 1FUYA 2E4TA 5M17A 3WJWA 2XIBA 1YIXA 3OYXA 2ZRZA 1HIZA 3WH9A 4JIRA 2HVNA 1V6TA 1H7PA 5BRPA 3N19B 2EPKX 5EMUA 3WL0A 5CG7A 4KESA 3R7MA 2PUZA 2XYLA 1FVPA 1W54A 3HTWA 1E51A 2Y1HA 3DENA 1TJRA 3S2LA 1N82A 2WJZA 3MS8A 2TODA 9XIMA 3QSRA 1UUMA 4QG9A 1KV8A 4KEVA 1GKRA 3TR9A 3IRDA 4GC4A 3OZPA 1RBOB 2P10A 3VKDA 3R1ZA 4HMCA 3W7PA 3R0UA 3STEA 1VBGA 3EX3A 5HANA 3MY9A 3XINA 2PDGA 1J12A 1UZDA 2PGFA 1UR8A 1KBJA 3BAWA 4JYFA 4HPJA 1V0MA 3WF4A 1EC8A 3W73A 3W2MA 4JZ5A 1GYMA 3B9DA 1A5CA 3T0AA 3IGSA 3TN4A 3HGRA 2A0NA 3MSGA 1TIWA 1F4HA 4IX2A 5FESA 1UQYA 1BXNA 3VPLA 3BGAA 1GZGA 3THDA 3P60A 3VOIA 3BTNA 3B8WA 3U2OA 1XPGA 3EX4A 3PUOA 4CNOA 1YNYA 5CC6A 2V2HA 3DI1A 1VR6A 2WMKA 3N12A 2FVKA 1Z89A 3RR4A 1B3ZA 1CXIA 4DJDC 2WHJA 4DI9A 3UWQA 3C4UA 3TFCA 3LLFA 4QJ1A 3WQGA 4FZIA 4WDTA 1MNSA 3G1SA 3L0KA 4PMVA 1TJPA 2PP0A 4GYFA 5LSMA 3TQKA 3E0VA 3T2OA 1FH9A 3MP4A 3RNDA 3FYOA 1NELA 1W9PA 1V3MA 3PZOA 1J0ZA 1WDSA 4QCFA 1EQCA 4AZCA 2C1GA 2XFFA 3TTSA 2ACUA 4X2RA 2X2GA 4IG2A 2W5FA 4IZGA 4AXNA 1OFQA 1C8QA 5D03A 1G67A 3K1GA 3CT7A 2YZRA 1JXKA 5HATA 1QNRA 3WF0A 5GQBA 3OA5A 3W88A 1QT1A 2FZBA 4WJEA 4A3QA 5A5WA 2BY1A 1K77A 2BSLA 4I5RA 1GZJA 4MNJA 4AIUA 4PTXA 5BWAA 4X22A 3W1QA 5IFPA 3VNIA 3PTMA 3UJ2A 3PTDA 3B0VC 4QIUA 4U5IA 3M0ZA 1E6ZA 4S2CA 4M6VA 3O7UA 4D8LA 1CB2A 4AU0A 4TO8A 3L12A 2V6AA 1KM4A 5FEPA 2VC9A 1JZ5A 2PE4A 3H22A 3UU0A 1CTNA 4DUXA 3K8KA 4G56A 5EA9A 3PK7A 2RKXA 2BVDA 3FW6A 3B0PA 2D3NA 3WQ6A 8A3HA 1UPMB 2BVYA 3NQBA 4ZOCA 4P7RA 1E4NA 4AZ7A 1GGOA 3FOKA 4FLQA 2VQTA 1J10A 3AHZA 3ATZA 1RP9A 3QPYA 3MV11 4A21A 3YPIA 1DJNA 1EUNA 1R9ZA 3PNUA 1R3SA 1JPDX 4KEMA 4DJED 3PB0A 4A8NA 4DO4A 4HU4A 4JX5A 3KW3A 1BGGA 4DNHA 2IW0A 4J3ZA 3GKAA 1K9DA 1X1NA 3PP7A 4B2DD 4PBGA 2DW7A 4K7YA 3KDNA 3TWAA 1MDLA 2G3MA 1DWGM 4O0ZA 4I5XA 3FK4A 4F0LA 4ZQPA 1XUUA 4EIVA 1TWIA 1OINA 1L0PA 1WX0A 4F48A 3C2OA 4O16A 3WEZA 3QGVA 1K8ZA 4IIHA 2BXZA 3SSJA 1F4AA 4O52A 4D6CA 3P81A 4XKYA 3L5LA 4ERIA 3EKLA 3UG3A 2X1SA 3DGRA 4Z1YA 3ONCA 5CLTA 4E2VA 1EA9C 2F8QA 3KTSA 4C6DA 3S5SA 4A2RA 4R85A 1DJQA 3BLKA 3OPSA 1TWZA 3WFAA 3BCJA 3GG1A 5KSWA 2DZSA 3UPBA 3KAOA 1OY0A 5EFDA 1CNVA 1IEQA 3T2QA 4A3HA 4Q8PA 1CYGA 1KBIA 1KO0A 2FLIA 4O1CA 4Q4PA 4JYDA 3R8GA 3EA2A 5G4WA 4W86A 1W9DM 4OECA 1Q6RA 3S6DA 2XIIA 4O18A 1MFUA 3PUDA 3R8RA 4D6GA 1OQFA 4FX7A 1JDAA 4RW3A 4Z1AA 3WIJA 3PZVA 3CC1A 3FA5A 4JTJA 2V8ZA 6REQB 3HA1A 2OZ3A 3RILA 4K37A 1GQIA 3B8DA 1XR2A 5BOEA 4NHVA 2Y4SA 3LD5A 1A5NC 5A8GA 3WDRA 1JYVA 1KM2A 3DHFA 5BOOA 3ARXA 4JQAA 1XBVA 3EWXA 1DJGA 4AD2A 1SGJA 3I3BA 3VIFA 4YLWA 3BOXA 1AVAA 4C65A 4B9ZA 3MCNA 4LEQA 4M6PA 5G1TA 3QPZA 3M5XA 4JAWA 1GUVA 3A24A 4FX6M 3HU7A 1PIIA 2POTA 4HSOA 1Y8BA 2BOFX 3EB2A 2ZTKA 3WJZA 2AAAA 2E9LA 1MW3A 4J35A 3N2OA 3DZ1A 3GH5A 2GJXB 3HPFA 1L2QA 4Q7BA 4JL2A 4GLEA 4HTBA 5LIUX 5DRCA 4ML4A 3S5OA 2IPFA 1AD4A 1ZJBA 1PKLA 5D9OA 1I2RA 5BOFA 3A4JA 4JTCA 3JW7A 1JYWA 1VFLA 1EP2A 2JKAA 2FHFA 4QITA 2CWNA 4B5TA 3E2RA 4WIWA 1HKMA 1WOBA 5LXEA 1DJIA 3KOFA 1W3JA 4JQ3A 3LZ5A 1LF1A 2SFPA 4LAZA 4WSJA 3PPHA 1JDDA 1G1YA 5CSSA 3CMGA 1ESWA 1V02E 1VFUA 3VMPA 3MMWA 5CSRA 4IJRA 2OYMA 4G7EA 3VOHA 4MWAC 1XYBA 4Q8VA 4H8VA 5HJXA 1VIZA 1NF7A 2ZUWA 1KCXA 3A64A 4Q4KA 1B9BA 2ISWA 5EYWA 3V7PA 3KDOA 5HMDA 3C5QA 3AS1A 2V2DA 4Y2WA 3NGFA 5C54A 1RV8A 1FCVA 2WCGA 5BXPA 1W8SA 4S23A 5AVNA 4LNCA 4IOTA 3PBVA 1VHNA 1G7VA 4ACYA 2EXOA 3OVQA 4MB1A 3JUGA 3ARWA 3KLKA 4JHZA 2NUYA 4O8RA 2W66A 3HMJG 2FIQA 4RZ4A 4AZIA 2Z1XA 3G8EA 1A0DA 3I7RA 4Q8OA 1SSDA 4J1OA 3S2CA 1XINA 3SB0A 4D6FA 3UWUA 4DXXA 2WSRA 1RLDA 4FNSA 1QOQA 5C9XA 3IJQA 3VYLA 3S4TA 3MB9A 4AZBA 3QHMA 4XZHA 4Y96A 2XVGA 1QNPA 3SUUA 4Y9MA 3CUJA 2NX3A 2PDNA 2OKTA 3L66A 5JUVA 5I3IA 5D2VA 1XLHA 4MNMA 1WV2A 4GIEA 1I4NA 1EYWA 2ZXBA 3FEQA 5FSEC 1UWAA 3NA8A 2XSXA 4A6GA 2PWHA 4QJ5B 1NFBA 1DJHA 2J78A 3A4WA 1NP0A 4H83A 1HF6A 2ZZ7A 2AL2A 4LF2A 4PH6A 3NNTA 3O63A 2GDVA 4RXFA 1Q8JA 2Z27A 1VLIA 5FJIA 1AD1A 3AQUA 4ZXLA 5LHFA 3OTRA 4MAVA 3GKFA 3R2GA 4O54A 3PTQA 4LVFA 3V0UA 4FP1A 1VJZA 4KS0A 2R9RA 4YWIA 3ZR5A 3C3NA 4G6CA 3S5NA 5CSUA 4JTLA 4P8VA 5CJNA 1M9HA 3W7CA 3NQGA 3A4AA 4MPKA 3N34A 2PP3A 2DV0A 3P0XA 3G1AA 1W17A 4UTUA 3M0IA 3N6QA 4QS6A 5SWUA 2Z4GA 4S1FA 4XX6A 1ISWA 5D02A 5I5RA 5B80A 1HJSA 4MB4A 1K7EA 2YLAA 1JZ2A 1NFGA 3UWZA 1EZ2A 2J8TA 1XYLA 1A3WA 2W63A 3GLCA 4UC5A 4CNTA 4GFSA 4B9YA 2W61A 1UBSA 1KTCA 3KP0A 1J0IA 5JMUA 4UTIA 3MUXA 3NPUA 4H00A 2DT2A 2Q8ZA 2X1TA 1EGMA 4XIAA 4Z2LA 2RDUA 2GUUA 3H4GA 2ALDA 1UD8A 6TIMA 1DVJA 4KCVA 5L9FA 5A6JA 1VKFA 4LTSA 3NQEA 1ADSA 1WO2A 5D37A 1LYXA 1US2A 1O5RA 1XIIA 1RPKA 4M81A 2ZZ2A 1F3XA 3FS2A 1CBGA 1H4PA 1JCTA 1XIFA 3W84A 5BWFA 4V28A 3II1A 2VX6A 3TZNA 3S2NA 3IRSA 5FKYA 4OVXA 2I17A 2ZZ4A 1KQYA 3HGOA 2A2IA 1AQMA 4ACZB 3WX7A 3B0YA 3C0SA 3M43A 7TAAA 2PWFA 2YFNA 4ZTYA 3NXLA 3QR3A 4H9TA 1LLZA 3LK6A 1HL2A 4L4OA 3AISA 1T99A 3M47A 1CB7B 1QPOA 1M7PA 4S3DA 4WDWA 2O56A 2Z1SA 4MIMA 4E8DA 2UY2A 4KGJA 3VE9A 4GJIA 5K9DA 1LZOA 4CLMA 1WDRA 1WXYA 3B04A 2DQWA 5E5CA 3HOJA 1JYXA 1IWPA 4F66A 1I2QA 3UG5A 4MUZA 3G1RA 1XF0A 1VFSA 2DSZA 4NAEB 4F0SA 3TP4A 2D23A 5I7GA 1NM9A 5F4XA 1FWDC 4F3HA 4PBFA 3KBSA 4IFKB 1A47A 2Y8VA 5JIWA 3ONBA 3CB8A 1IHIA 1QW9A 3CHCA 1MMFA 4A8RA 1LL6A 1EC7A 1IR1A 5D2XA 4NZCA 2J7FA 1LBMA 4GIAA 4CNNA 3B8UA 3P8IA 3RUBL 4BI5A 3QV6A 1IXNA 3PNZA 3CU2A 1H11A 3APTA 3KOZA 3N29A 3SECA 3WDPP 2R1PA 4MDPA 2VQUA 2HPMA 2Z2AA 3TQVA 3U3HA 3BCFA 3IVSA 3UYCA 3TSBA 1S5NA 4LVDA 3GFZA 4W84A 1DKWA 4WKAA 3PZ9A 2F84A 2Z1KA 2VVNA 1QNSA 1XLFA 3F4VA 3T4WA 4NNCA 4B3ZA 3M0JA 1JNDA 4DRSA 1G4TA 2E5BA 2YBVA 1KRAC 5T91A 2HZGA 3WLOA 3OYZA 1WKYA 1XGZA 3IAPA 4IQEA 4YYFA 4OU1A 4JTFA 3BW2A 2HS8A 3K5XA 1CX9A 1AJ2A 4I9AA 3AU2A 1XQKA 3OBKA 3KHDA 1HFBA 1P43A 4UQEA 3NQ8A 1ISXA 2E67A 5LNSA 1H60A 1R5YA 1A5AA 2YKKA 3W81A 4FEZA 3S42A 3GXTA 2RDTA 2Y24A 1E0VA 3BV7A 3H2MA 2D2HA 4F2UA 2KZHA 2VI0A 1HZYA 1RJRA 3VU2A 4GYKA 1AW5A 5I79A 1MQRA 4INFA 3W1MA 3G18A 3BZGA 3CTLA 3HQPA 3L2LA 2YDQA 3PULA 1X8FA 1XI3A 2XFWA 3RM4A 5CBJA 3WH5A 3ARTA 5H1WA 3GDMA 5DT7A 1T6MA 1SUXA 3H4WA 3C86A 3WG6A 5CGMA 1BD0A 2WHKA 5F2LA 4IUGA 2V69A 4O19A 3DHUA 2IPWA 4DHGA 2PDIA 4LPCA 4OT7A 2CZVA 1CECA 3TUUA 3HG2A 3BLDA 1EWDA 5I78A 3LGDA 1QCWA 2ZRYA 4XQ6A 1V3IA 1V6UA 3KE0A 2O9PA 2DSKA 2G0WA 4BK9A 3W82A 4WCJA 4C1NB 3QW4B 3SY8A 1C8YA 2DZVA 2FHBA 3A9BA 3N14A 3NUKA 1FWFC 4MZ1A 2VFHA 1CXLA 2WVUA 1EL3A 2GGIA 3CPGA 1RLCL 3NQ6A 3ZLFA 3WK3A 3WLQA 1OG0A 3AHTA 4FHAA 2PD5A 1YNPA 4RZ6A 4GBDA 1VYRA 1ITXA 1VJSA 1C7SA 1TCDA 3BH4A 2QJMA 1GJUA 1XBZA 3W0KA 2QJJA 4G1KA 3I7SA 1ML1A 1XS2A 3ZXWA 5CPNA 3IUDA 3AXKA 1L6GA 1PZ3A 3H2FA 3Q2DA 1IZKA 3DIPA 3ITTA 2G37A 3ZJ7A 2J6XA 2QVHA 1E43A 3GXNA 2XSAA 3WLLA 2QXWA 2Y8KA 4I5UA 3ZSSA 2ATSA 4XBSA 2IXUA 1V3HA 4IGMA 1TUXA 2IKJA 4Z0JA 3WD2A 4IWWA 5IOBA 5IFTA 2X1RA 2XWEA 3RO8A 1PYMA 2GJXA 4DM1A 2FJUB 1UR0A 3U5UA 1FWEC 3EX2A 5AHMA 1YX1A 3MYOA 1OSEA 2YDSA 2Z2BA 3EX1A 2FVMA 4FS9A 2ON3A 3DFTA 2VO5A 4KWUA 3ARRA 1UW9A 5FEZA 3RYSA 4X9YA 4JL1A 1EHNA 2UV8G 3FVMA 4NY2A 3M7WA 3VM7A 2DPEA 2ZKMX 4H9MA 4NI3A 1F07A 4FA3A 3G1VA 1T41A 3WDJA 1UA3A 4IPNB 4S2BA 1XKJA 4M8UA 1U1HA 2HROA 4XTIA 4AEEA 1A0CA 4DYEA 3V35A 5CBIA 2Y7EA 3BDKA 3LOTA 2BDQA 1TFVA 1P6BA 2PWVA 1AODA 3D46A 4O1BA 3CJPA 1TV4A 3CUIA 3THUA 4HYRA 4LB4A 4LYKA 4Y8FA 3TSMA 2JGQA 4R9XA 1PJ9A 4ADTA 3EWZA 1JZ8A 2CW6A 1ZBKA 3OZMA 5ECVA 3W86A 1YDOA 3FXYA 1MVYA 4EAYA 1MRAA 1Q2SA 8CGTA 4YN5A 4J3XA 2XVNA 3SGZA 3LG3A 5FJUA 2PDQA 1XLCA 4JNZA 4NNAA 4IPIA 1GKQA 1H7OA 1KGXA 1VQTA 1GNXA 5K7JA 1E72M 2GQAA 4AWSA 1E6XM 4GGBA 3UA4A 2D0GA 1CGWA 1TV7A 5D2YA 1HKVA 3CUHA 3F4CA 2HBXA 4L1WA 1K6WA 1OFAA 4QSHA 2A85A 2PLMA 3P0WA 3JS3A 1SQ7A 1KR0A 2FMOA 4F8XA 3B3DA 1LCOA 2WHLA 4QISA 2GVYA 3HPAA 4W8AA 3RPMA 1UYQA 3IVUA 4M51A 3CGTA 2CCRA 3CPRA 3LCWA 1JI1A 2WVVB 2VZOA 4ENLA 3LBCA 1RCXB 2QCNA 1H7RA 4GQBA 2PDLA 1ENUA 3C2YA 3UWVA 2RUSA 3BW3A 4HKPA 5IM51 3SCNA 3ITXA 2CXGA 1J8VA 3PN8A 3ATYA 3KBMA 4MAZA 5DXXA 2FDSA 3AICA 3V1HA 2XDFA 2A21A 4FLRA 2TYSA 3NPXA 4UTWA 2HMCA 4IGHA 4LY4A 5HNTA 2C7FA 9RUBA 1IR2A 1RQBA 2YYUA 3B4UA 1YTKA 4MYXA 1XM3A 4CNPA 4GYJA 1MRQA 1UWIA 4EPDC 3NZGA 1F6PA 2CC0A 4KT2A 3QV9A 3S47A 3SRHA 3ZSTA 2ISVA 1Q2RA 5D32A 1R46A 2NQLA 5DX7A 3F2DA 2OKOA 1UMLA 2V5JA 5BRQA 2WO5A 2Z2UA 4XO6A 4GI6A 5CKSA 1IZJA 1C92A 1QU4A 2Z00A 1LWIA 3PF3A 4Z08A 4XVEA 2ZVRA 4B5NA 3QN3A 5C0QA 5A2AA 1E4MM 4BKNA 4UR8A 3TSDA 1PCKA 4QSFA 1UP0A 3WK2A 2WSKA 6A3HA 3CXOA 2R24A 3DKJA 8XIAA 4CN4A 4G2DA 3VMOA 3LB0A 4HZ7A 5E0CA 1GVQA 2C6QA 3GC5A 4PMYA 3ERPA 2VCCA 2CERA 1HKWA 2C14A 2PU1A 1ICPA 2FPTA 5FL0A 3MSRA 1F73A 2FHCA 2ONEA 3OEXA 1VJIA 2OZTA 2D1ZA 4ECLA 3TTYA 4RDWA 1JPIA 1B9ZA 4IMGA 3EOOA 3R6IA 1W1VA 4ZOAA 2VZVA 3L0GA 4CCCA 3EPMA 2D2GA 3GXFA 4YVXA 1EBHA 1L6WA 2VRKA 2F6XA 4YS1A 2MUCA 1Q6DA 1KD0A 3UR5A 5D9MA 4M0XA 3IUIA 4ACZA 1TV5A 2G3FA 1Z48A 3CV6A 4L6DA 3NR0A 3E3HA 2PGEA 4GNKB 2Q8LA 3FJ4A 5GJPA 5E9AA 1W91A 3VNJA 4JIEA 3F5JA 2WK2A 5FEXA 5CPQA 2O55A 5HWMA 4U3CA 1OGGA 3PSVA 1XYFA 4S3FA 4PBEA 3M0HA 3SI9A 1PE1A 4V2XA 4ADSA 1VYPX 1P5BA 4W7VA 1C7TA 4MJ4A 1S5MA 1GJPA 3AUOA 1VEPA 2A3LA 3UR7A 1X96A 3D47A 3KTXA 3SDOA 1XLKA 3WLPA 1ME8A 4J3SA 2X40A 4O10A 1Q4NX 1PPIA 3NWRA 1C9DA 3C8FA 1S38A 3L9CA 4ILSA 4RW5A 2WWCA 4UNLA 2ZWYA 1O60A 4IFKA 3CLMA 5HQLA 2ZVIA 1GWJA 5CJMA 4M82A 3AOFA 3QM3A 1GPWA 4HPNA 2WPBA 5AY7A 4F2BA 2ANUA 2PDWA 2V30A 4XKMA 5HNUA 1YKWA 2TSYA 4U33A 3H21A 1J2BA 3THAA 1CLXA 4NZ3A 4UTTC 4UR7A 2UY5A 2I1OA 3CH9A 4AHQA 1OX6A 1JG9A 1ZFJA 3MQTA 1UKPA 4XBJA 4TV6A 1TRDA 2ESCA 2LLEA 4YTUA 4FF5A 4CQDA 3MC5A 1S46A 1W9XA 4OJYA 3AIUA 3GAYA 4QE1A 2JEQA 1W6TA 2EKCA 4S3CA 3ISIX 3ITCA 4MUPA 4LX4A 4GQ0A 5AVHA 3P61A 4GUFA 3LPPA 4Q32A 2VJXA 3CUFA 4PCFA 1V0NA 1ECQA 5HQMA 1NDVA 2H8XA 1IT7A 2VURA 3QFEA 3FX4A 1O1ZA 4ZENA 4QG8A 3DFNA 3QGAC 4XWUA 3LGGA 3N3TA 1VEOA 1P6CA 4CU6A 3VD7A 3LERA 1SJCA 4IQDA 1B5TA 1KFLA 1GYLA 5CXPA 1J6PA 1PDZA 1QK0A 1IEIA 1WB0A 3TFXA 1VYSX 4HYWA 3FA4A 1SZEA 4AHOA 4C6PA 2IUZA 4IMAA 2VENA 2F9RA 4NYUA 4NAFA 2WJDA 2GOUA 4H2HA 2D20A 5CZJA 3SUVA 4OUEA 2AGTA 4QNWA 1IXPA 4WY0B 1V0LA 2ZDSA 1H0IA 3PZNA 3G77A 3N2TA 2EG7A 4RX0A 4F79A 1EJRC 1M1BA 2ISFA 1UH2A 2J7EA 3DFYA 3CUZA 3QHNA 2RJHA 3CMFA 3WMBA 3T07A 1V0KA 2AAMA 2WKLA 4M1RA 1V79A 1I9CB 2VWTA 1K70A 2FFCA 2EPNA 3BLEA 3QOKA 3W7LA 5I02A 2DZXA 3AAMA 5TD4A 1GOIA 4JXCA 3KRSA 1JDEA 4IL0A 4EANA 5I03A 4HNTA 4PTMA 1QWGA 2VEGA 3WK0A 1I2PA 1UPPA 1W9VA 4RK8A 4A22A 2PDYA 3ITOA 1U2YA 3IIOA 3R58A 4H4IA 4EE9A 3FXGA 3AWOA 5EGRA 5A2BA 1H62A 5DCEA 3GR8A 3LXCA 3TR2A 2VYOA 1MFVA 1JVNA 1UR4A 2WCAA 1AH4A 2WBGA 5HXMA 4MKVA 4AZGA 1JCNA 1P7TB 4IMCA 1E6PA 1XIBA 4QNEA 3TZFA 2PTZA 3H24A 3IUHA 5F1VA 3UVAA 2CYGA 1UD6A 2YA1A 7A3HA 4GGHA 1OHLA 3ARQA 1M68A 3CIXA 3BC9A 1A80A 1I75A 2NV1A 1K8CA 1CGYA 3S2MA 6ALDA 4AWEA 4PRWA 5DO8A 4L5ZA 1S2CA 1BSIA 3ANVA 2PDPA 2WZIA 3WLIA 1W0MA 3Q58A 4FNRA 4XSMA 1W5NA 4D8AA 1DWJM 2WMIB 5H91A 5I3HA 3FKKA 1PDYA 1MEWA 3BAJA 2OT0A 1EO7A 3OBAA 3S8HA 3MTWA 3Q67A 4QEEA 2DU2A 3C0LA 4WGHA 4GH3A 4DZHA 3B8IA 2DZPA 2Y7FA 1XLDA 2FTPA 1R86A 3G0SA 1MZHA 3W7JA 3W70A 1NY1A 2I16A 3BMWA 2TMDA 1JUKA 4C6MA 3QOMA 3OGSA 1XRVA 1GVEA 4YVVA 4LUYA 3BMXA 3AC0A 4JHOA 3LTYA 1ZPTA 2F6UA 4LY8A 4DWSB 3SCTA 4FLSA 4I7VA 1Z6KA 4AEOA 1ELSA 1K9TA 2EPLX 2GGHA 3PFMA 1WDPA 2ZUUA 5CPSA 3FLUA 3GXDA 3ECQA 2NSXA 5TIMA 2WKJA 3N13A 1BG9A 4GY1A 4BQ2A 4PSPA 2QS8A 3BLPX 4UIOA 2ZOXA 4NKCA 1QVBA 4LS2A 2BHUA 2HDJA 2A3CA 4B5WA 1FCUA 3E9AA 2FMNA 1MO0A 4EACA 3NL2A 5G4HC 4AIBA 2EPMX 4Q4OA 5JH2A 2X0SA 1UCWA 3C6CA 3PUEA