4Q33A

Crystal structure of inosine 5'-monophosphate dehydrogenase from clostridium perfringens complexed with imp and a110
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
357
structure length
344
Chain Sequence
MARILKTAYTFDDVLLVPNKSEVLPNEVSLKTQLTKKIQLNIPLMSASMDTVTESKMAIAMAREGGIGIIHKNMTIEDQAREVDRVKRSGGLLCGASIGVTNDMMERVDAVVKAKVDVIVLDTAHGHSKGVIEGVKRIKAKYPELQVIAGNIATPEAVRDLAEAGADCVKVGIGPGSICTTRIVAGVGVPQLTAVMDCAEEGKKLGIPVIADGGLKYSGDIVKALAAGACAAMMGSIFAGCEEAPGAIEIYQGRSYKVYRGMGSLGAMAKFVPEGVEGRIAYKGHLADTIYQLIGGIKSGMGYLGAPTLENLYENANFVVQTSAGFRESHPHDINITKEAPNYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase
publication title Crystal Structure of Inosine 5'-monophosphate Dehydrogenase from Clostridium perfringens Complexed with IMP and A110
rcsb
source organism Clostridium perfringens
total genus 102
structure length 344
sequence length 357
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4q33A00
3W2NA 5KINA 2DZSA 2EAWA 3QSRA 1OFEA 3NQ8A 2V2DA 4ADSA 1X7FA 2A6NA 2VC6A 1QOQA 1TPVA 4YXGA 1IIHA 4N9DA 5G2HA 1UASA 5EKYA 1X6UA 4E0CA 3IIVA 5AHNA 2H8ZA 4R34A 2TYSA 1O95A 2DORA 4O13A 4O52A 4XBKA 2V5BA 5D2VA 2FPYA 4IJBA 3NQGA 2ABAA 5D2WA 3PF3A 2JBMA 1IXOA 1JCXA 3NR0A 1YXYA 4AVFA 3OEXA 3BW3A 4HPXA 3UWVA 4FIRA 1FDYA 3DI0A 3S42A 4LS0A 1OJXA 4JTSA 1LCOA 4BK9A 3GZ3A 4YMZA 1B57A 1P0NA 3LCLA 1XFBA 1FDJA 1TQJA 4RZ6A 2W0UA 4GC4A 2J27A 4JTFA 3QC3A 4IMDA 4K7YA 3RNDA 5LNSA 1YYAA 2FQIA 2E77A 4LC6A 2D73A 4O4VA 4NJGA 3P8JA 4WY0A 4QAIA 4LUIA 2HSAA 2LLEA 4UMBA 2WSQA 3GXNA 4LOCA 1ZAHA 5DN1A 1PHWA 1VGAA 2NLIA 3A24A 1PCWA 3MUXA 1VS1A 1H7NA 5AFDA 3FFSA 3I65A 2B4GA 5I3KA 1PS9A 3LTSA 1W5PA 3CLMA 4LVDA 4YCOA 4QSHA 1L6WA 4QISA 5F2GA 1X8FA 1EWEA 1ADOA 3TK7A 1QPNA 1KBIA 1WA3A 1D9EA 4AB4A 2WPBA 3W7PA 3WK0A 4DBEA 3DHDA 2VFHA 2J9XA 2E5CA 3LGEA 4WOQA 1JCJA 4N4PA 1OFDA 2V30A 4ML9A 4JS3A 2E6AA 1H1ZA 2V2HA 3NAVA 3NPVA 2XN2A 1OG0A 2WKJA 3W7QA 4DEFA 1SZNA 4YLWA 5CKSA 2F84A 3G1SA 3C56A 3BW2A 3STCA 3RF9A 2QUVA 3N3MA 1SUXA 1JCLA 3GR8A 4OGZA 4O12A 2FTPA 3TXVA 1EP1A 1FX6A 1DHPA 1R2TA 2B7QA 2O7SA 3EX2A 4FX7A 4EF9A 4MFEA 2CWNA 3PG9A 1F7BA 4HPJA 3CWOX 5FESA 1LRTA 1VCFA 5K4XA 1WV2A 1ICQA 2ZZ6A 3TCEA 4C1KA 1XUZA 4UTMA 1K8YA 3L66A 5K3VA 1KLZA 1TRIA 1GTEA 1KFBA 4RKAA 3KX6A 3W7IA 1TPUA 3GNDA 1TPH1 3GKFA 1K7EA 3P67A 2QCFA 4PCFA 1AK5A 1Q3NA 1OK4A 1OK6A 4L4LA 5EMUA 4ZQMA 2H3BA 4UCGA 5H2ZA 2VFEA 3GVGA 4CNNA 1H60A 3DFTA 1BKSA 3M47A 2TSYA 5CPOA 3TH6A 5FI8A 3R2GA 4ADTA 1OYAA 2FFCA 4ZQPA 3L0GA 3IEBA 3JS3A 3UWZA 4JX4A 2NX9A 4R7JA 1M7OA 3BO9A 1YPFA 4CQ8A 3E9AA 3W2JA 2C18A 3GDRA 1QMLA 1K03A 3TMLA 3FKKA 4GNJA 5K4ZA 4ZQCA 4CNPA 4OHQA 4MKNA 2GUUA 3W7RA 1O5KA 1JVNA 3HOJA 3NNTA 3B0VC 5KZDA 4BWLC 3TDFA 5KMYA 1GEQA 3FLUA 5I3GA 3HIJA 3I7QA 3ZR4A 3EX3A 2P1FA 3CIXA 3P5YA 4LUJA 4YWIA 3LHWA 1DORA 2G95A 1TJRA 1EPXA 3W2MA 1GVFA 3HGRA 1FUYA 4UFJA 5K9XA 2CZFA 3R12A 1H7XA 3S1XA 5BMXA 2DZVA 1OYBA 4IQLA 4H6KA 4DPPA 5D2TA 2QUTA 5HNRA 3CEUA 2XN1A 1KTCA 1SQ7A 3DKJA 4JTLA 3TW7A 1L9WA 6TIMA 3P62A 2B7NA 3FJLA 4N4QA 4O19A 3QQ1A 2Q8ZA 3IGSA 1VRDA 1TJPA 4O0KA 2YW3A 5I3JA 2E5DA 1BTMA 4DO5A 2CLOA 3E02A 3L5MA 5G4WA 3WJZA 1PV8A 1W5OA 3DENA 3G1AA 4Y6GA 4O10A 3OBKA 1LZOA 4UFKA 1PHQA 3BLFA 4J9JA 1DBTA 1KFJA 4RZ4A 3MYOA 4ORMA 1JUKA 4HIBA 5C5YA 1HO4A 3MHFA 2DZXA 3TKFA 2HTMA 2RDWA 4NX0A 4LV9A 3B4UA 1ME9A 1WDWA 3EWYA 1EWDA 1FBAA 5D2YA 4WUIA 8TIMA 4UC5A 4FNRA 3USBA 1OX5A 1A53A 1A5AA 1OX6A 5HUOA 5J5RA 2J88A 3MBDA 3PM6A 4O11A 5HWMA 3S1UA 3U6WA 3BGJA 3W1LA 4ALDA 1SO5A 4JTIA 3IVSA 3ELFA 3LLFA 2VKZG 4NT0A 1FWWA 3R8RA 5EY5A 2EGZA 3MP5A 5TBOA 4N9CA 1XC4A 1K8ZA 5I3IA 1IXNA 5U4NA 3G1HA 3W6YA 1FWTA 1L6SA 1S3HA 1DQWA 1GWJA 1QO5A 2E1DA 3N9SA 1XL9A 3ABSA 5A8GA 3PVFA 3B8DA 3V75A 1Z42A 3P82A 1GYLA 3TX9A 3OA3A 2J6XA 1NAL1 3EX1A 2V82A 4RXFA 3T4CA 3W2UA 2I1OA 1QNVA 4O53A 4NZFA 4UUIA 2OT1A 4AF0A 4GRSA 3O06A 4WX2A 3A5VA 4NJJA 2NX1A 2PRHA 3G0XA 3HG4A 4LVBA 3DKLA 1ZCOA 3W86A 2ZZ1A 4PA8A 5D33A 1QPRA 2J9ZA 1KTNA 2C19A 4AWSA 3W85A 3LV5A 3QYQA 3INPA 2JK2A 1LBMA 3PWAA 3LDVA 5H91A 4NXKA 3H54A 2R91A 3MHUA 2Z2UA 3G18A 2ZZ4A 2V9DA 7TIMA 3EWWA 3SR7A 3GAKA 5HWJA 1W5MA 4BI6A 2BX7A 2JKPA 2O7QA 1VZWA 3QRHA 5HWNA 1I2RA 2XFWA 1TIMA 4MPQA 3W7DA 4GUFA 2QAPA 4LRTA 2BTMA 1NF7A 4PH6A 4JTGA 3BV4A 3THAA 2QUUA 1K7XA 1LLZA 1VHNA 2G97A 3ABRA 1KV8A 1H7PA 2QDGA 3FYOA 3C6CA 4E38A 3NQAA 3Q94A 1AG1O 3QPYA 3TQ0A 1ONRA 1XBVA 1LOLA 1SR9A 3R13A 1VYPX 4BFAA 2ZRXA 2CLFA 1VR6A 1JULA 4CCDA 2QCLA 4NJIA 2QEZA 3SGZA 3F4WA 1BEUA 3DGRA 2W79A 5FF2A 3IIOA 3RFAA 4JTEA 3C2EA 1IXPA 4IXXA 3LCIA 2QCMA 3G1FA 5FEPA 3I7RA 4AHQA 4S2CA 1BWKA 1FQ0A 1XM3A 2VEIA 2Y89A 4CCCA 3M6YA 1K02A 1BWLA 3NQEA 2EPHA 4NUWA 1FWRA 1ZENA 1F6PA 2X2GA 4AEOA 1F5ZA 2NUXA 4FNPA 1Z44A 3U2OA 4X22A 1YTKA 3M0ZA 2GVJA 4KFPA 2Q3OA 5D37A 3OHIA 4EF8A 3QF0A 2YCEA 1HO1A 2C1HA 4HNUA 5LNVA 3QW4B 1UBSA 4MIMA 3TE9A 3DFQA 5F4XA 3QMRA 4TMCA 1X1ZA 4UTWC 1FY6A 1VQTA 1EUAA 2WJZA 3DHFA 3W2KA 3ZS4A 3W23A 1GG0A 1JR1A 3F03K 4QJ1A 1D3GA 3HG5A 4U28A 4CQAA 1PE1A 3JRKA 1N8FA 3TSDA 1TTPA 4O1CA 5HINA 4UNLA 2YSWA 2C16A 3U8GA 2BXVA 4RCXA 2HS8A 4R33A 2FIQA 3W7OA 4M5PA 3AO0A 3FIGA 3LXCA 1LRQA 3RK8A 1TB3A 1TPWA 1VCGA 4RZ5A 3IIXA 1KTBA 4WOZA 2RFGA 2BZNA 4NNCA 1RQBA 2EF9A 1MO0A 1ICPA 1T96A 2OT0A 3B04A 1TTIA 1G4TA 2YDAA 3IV3A 2UV8G 4AXKA 4O16A 4O18A 1QO2A 5AHFA 4U4MA 3P74A 3T44A 2YFOA 3PUOA 2Y7FA 5CPLA 2NX3A 6ALDA 2ZRYA 3Q37A 1G6CA 4I7UA 1O4UA 2WO5A 4LU0A 5BNKA 4P2VA 4AWUA 3L2IA 1TREA 3EXSA 2ZBTA 1H62A 3W1TA 3DAQA 3LRMA 2ZFAA 1P5BA 4X2RA 4C1LA 1ME8A 4UTLA 4TO8A 4N02A 4JR5A 2OMAA 3VKJA 3KRUA 5AN7A 3CU2A 5FEXA 4Y9AA 3LRLA 4UTIA 2A1YA 3NQVA 3VNDA 2W6RA 3LOTA 1C8VA 3NM3A 5K9DA 3S8HA 2Y85A 3N9RA 2X1TA 5D38A 3EWZA 3KVMA 1TTJA 4JNMA 4R53A 5HQEA 2YW4A 4UTTA 3L5LA 5D30A 4OWGA 1W31A 4PEKA 3NZRA 4M6PA 2E09A 2YPIA 3TQKA 1S5VA 4LNYA 2V5LA 3LCFA 1W37A 3HPZA 3W84A 3W73A 4YL2A 1KFEA 3W72A 3UD6A 5F1VA 4WJEA 4B5NA 2HMCA 3NL6A 1I2PA 2H90A 3W7HA 2GVGA 1XBZA 2A6LA 3OVQA 2Y63A 2GJLA 5DCDA 3S5YA 3HBLA 1UJPA 4I7WA 3UXAA 3O63A 2VENA 3G3DA 2VFDA 4MJZA 3GX9A 2RKXA 2Y7EA 2ZTKA 3RU6A 5F4SA 4I7VA 3W7LA 5F1UA 2A5HA 3EWXA 3NG3A 1QWGA 1UUOA 3O6YX 1Z41A 3CQ0A 1H1YA 5C54A 3M1ZA 3NPWA 3HO8A 2KZHA 4CQ9A 3S1WA 3WK1A 3L68A 1YPIA 1RQEA 1OX4B 3N14A 3EX4A 2E6DA 1VPXA 5HMSA 1H7RA 3O6CA 1OYCA 2QAFA 3STGA 5DXYA 3NPXA 3F4NA 5L6UA 4NJKA 3C52A 2ZQ0A 4DQWA 3C3NA 4IX0A 1W8SA 3PSVA 2OZ0A 2DJXA 3MW7A 4KFNA 2WQPA 3G22A 3SFKA 1H5YA 1W5QA 1JCMP 3GYEA 4A29A 2YFNA 4ZL1A 5K7JA 2X1SA 1CI1A 3ANYA 1FWSA 2QR6A 2CZDA 2GQ9A 3IGXA 3ABQA 4A2RA 5IBXA 3KVKA 3HJZA 4UMAA 4LW7A 3OIXA 3IVTA 1A5BA 2ZDRA 3W88A 3TJXA 1EIXA 1ICSA 4Q4KA 1JRCA 1ZAIA 1H63A 3GIYA 5CSRA 4HN4A 5HUPA 3TFXA 2R94A 1KFCA 1PVNA 4ICNA 3BARA 3PBYA 4HKPA 3DXIA 4LVAA 1B4EA 2A7NA 3GNNA 4UIOA 5EYWA 5DY2A 4MZ1A 3T78A 3IIZA 1F73A 3NOEA 1YDVA 2ZCGA 4ZQOA 4K8HA 4AH7A 5CSSA 1L6YA 5E1QA 3N34A 3S6DA 2G5WA 1WOBA 3G1VA 4LY8A 3MWAA 2X30A 4EVZA 1SSGA 2IQTA 3NL2A 2FPVA 3CEPA 3TSBA 2YR1A 4K37A 3LXAA 2FB3A 3OG3A 3SJ3A 4AMAA 3W07A 4O1AA 3ZWSA 1TQXA 1SO3A 1E51A 2ZTJA 4LWWA 1EA0A 2V2CA 1JQXA 4MJMA 3NQDA 3GK0A 3IVUA 4MY9A 2Y62A 3E96A 3O16A 2NXHA 1RPXA 2X1RA 4YCPA 1L2UA 2ZZ3A 4HNNA 3A9IA 5CZJA 2QCDB 4DO4A 5J5DA 1KM0A 2C15A 5E0KA 4Z1BA 1A50A 3G0SA 5G1TA 3W2LA 4NZJA 3HB9A 1KFKA 1JCYA 2CLHA 4UNKA 1WAUA 3G0UA 2EKCA 3P84A 4IUOA 4TU1A 2PURA 3RLVA 4XTDA 3QEZA 2HS6A 2C13A 3LXBA 1XI3A 3KRSA 2NWRA 4IMFA 1JJKA 2E68A 1KBJA 1OHLA 3G3MA 4PFMA 1I2QA 4PC8A 1EB3A 2QJIA 3DFNA 1MSSA 4UR8A 4O8RA 2Q8LA 4ZQRA 4DF0A 4DXVA 5CZSA 3LI1A 3STFA 2CLKA 4MOZA 1SFJA 1VLIA 3QJAA 3T55A 3EKLA 1OABA 3LHVA 1VCVA 4MYXA 4WY0B 4O50A 2BSLA 1A5CA 3PR2A 1DJNA 4D2JA 3GDTA 2Y70A 5DBTA 1RZMA 2DZWA 4H4IA 3HGOA 3UYCA 2DZPA 3LX9A 2ATMA 1G4EA 3UY7A 4LTSA 2VELA 3M43A 3TAKA 3TXZA 5LSMA 4JEQA 1FCBA 1HL2A 1KLYA 3M9YA 4WD0A 3FYPA 2OCZA 1LM1A 2TPSA 2Y61A 4JDYA 1GQNA 3RLUA 4FF7A 2NWSA 5DELA 1QR7A 1F76A 2OJPA 1H7WA 1OF6A 3NPUA 1YXCA 3NZ1A 1GPWA 1MEHA 2BWGA 3TW6A 1Q6LA 5FF0A 3TV8A 2WOQA 4K39A 3PBVA 3W71A 2WNNA 4X3ZA 3C2RA 1QAPA 1Q6RA 3TNOA 3TAOA 3KHJA 4FNSA 3RMJA 2B0MA 1NSJA 4K8EA 1W3NA 1SZFA 4Q32A 2ISWA 3H53A 3P81A 1CW2A 4OV9A 3MHGA 4Z0JA 3O8AA 2NUYA 2V81A 4O54A 3WK3A 5BW6A 3BG3A 3DH7A 4O17A 4WXYA 5AB3A 2B7OA 3CPRA 3TUUA 1KM4A 2Y88A 4H3DA 3N2MA 4XBSA 5KZEA 5I3HA 1XDLA 4JYEA 3W22A 2ZZ7A 3CWNA 1JUEA 3WFAA 1RR2A 4A2SA 1HTIA 4BF9A 1IF2A 3KOFA 3W7EA 4FNUA 2Y7DA 2JKAA 3M7WA 1SO4A 3MO7A 5CG7A 4OBTA 3SW6A 4OE7A 1F05A 4PL1A 3TJLA 3R89A 5E93A 4X9SA 3PY2A 3LRKA 4RLIA 1QPQA 5DLCA 2P10A 1G7UA 1G69A 3NO5A 4BR1A 3TQVA 4L4MA 5HJLA 3TA6A 5I3FA 3G1XA 4TX9A 5AYXA 3W87A 1LOSA 3MI3A 3TC7A 3NDOA 5G5IA 2G96A 4DPQA 1G4SA 4QQ3A 4TMBA 2C6QA 2VOMA 3ZWTA 1R46A 3PC0A 3K30A 1V7YA 3LBMA 3KVJA 1T99A 1SO6A 5DY3A 2PCQA 1AL8A 1O94A 3ATZA 1ZY9A 2CW6A 3NQMA 3KAOA 4DO6A 3S1VA 4LS2A 4IPJA 3TROA 1XXXA 2A2IA 1FCVA 2GJNA 4BI5A 4JTKA 2A21A 1C9DA 3W70A 1OFBA 4NNBA 1WBJA 1YTDA 2ZA2A 3C0JA 5C6MA 3VI2A 3W7MA 2GQ8A 3QMSA 1KM2A 2FLIA 3P61A 1AW5A 3NQCA 4FXRA 1KFLA 4N6FA 1JUBA 3W1NA 2I14A 3N73A 4O4WA 5DCEA 5G4EA 2RDUA 3BGGA 4N2YA 2FJKA 5EA9A 4MY8A 4JYDA 5G1YA 2ZRZA 5BMWA 1WYIA 1OFQA 1XUUA 1Z48A 5EPDA 4HNTA 4HHPA 4JTUA 1SFLA 1OX4A 2GQAA 3KVLA 3M44A 3W7CA 2WSRA 1YTEA 2NV2A 1I2NA 3B03A 1YXDA 1DOSA 3MBFA 5D09A 3MI2A 4EIVA 4NVTA 1D3HA 1SW3A 3QMTA 2CLMA 5LHEA 4EWND 1M7PA 1KM6A 3EXRA 2VFGA 3G8EA 2E6FA 3MI6A 1O60A 4UFHA 4G1KA 2E6YA 2Z1BA 2R8WA 1EP2A 5K9CA 1B9BA 1DQXA 3P7YA 1WOAA 3FOKA 3WK2A 1VYRA 1ZNNA 3L0KA 1EX5A 3SSJA 4K7VA 3Q58A 3NL3A 2QF7A 1GOXA 5CPNA 3KXQA 4S2BA 4BWLA 1LLWA 1LORA 3TSMA 4ADUA 3QM3A 2E5BA 4NNAA 5D05A 1JRBA 1ZALA 3SECA 1I4NA 3I7SA 2PRMA 4RX0A 4Z1AA 3W1PA 5DXXA 1S5WA 3P5ZA 2VEMA 4XQ6A 3VCRA 2ZRWA 5D32A 2A0NA 3DFSA 4N9EA 5KSWA 1YLVA 3S5ZA 4MZ8A 3M16A 4JX6A 4FEZA 1DV7A 1TPDA 3S0CA 3BPWA 5A5WA 2CFFA 2Q3RA 3DFOA 3M41A 4MVAA 5SWUA 1OFAA 3C8FA 3O15A 2NZLA 3W75A 1W54A 1X1OA 3UWWA 3VFLA 1QOPA 3BLEA 3PUDA 1K3UA 3NQFA 1K7FA 2NUWA 2CLEA 1SW7A 1OF8A 3M5XA 3HMJG 4GUHA 3GDKA 1GZGA 4TR9A 3A22A 3SIZA 4JTJA 3G1DA 4S1FA 1P0KA 4KKXA 3W7JA 1NF0A 2FDSA 3QZEA 4OT7A 3NGJA 4JGDA 2ZZ5A 5GVJA 1G4PA 3G8RA 4RK8A 4WXZA 4M19A 1PL9A 1W3TA 3CC1A 3W1QA 3IIPA 1RQHA 4PODA 3AJXA 1IXQA 2QCDA 3SGUA 3CIWA 3GR7A 3HGSA 4RV8A 1LTDA 1B4KA 4K36A 2JGYA 5FEZA 3STEA 2F7FA 4JYFA 2NXIA 3HG2A 4UFIA 1TTQA 1PCKA 3QH2A 1OFRA 2ZYFA 3LCXA 4LVGA 1F2JA 2PE4A 4CCEA 3MJYA 1N55A 5TQLA 3FA5A 1W0MA 5D2XA 2CLLA 1VLWA 3GXTA 1QFEA 3JR2A 2DZUA 4UTKA 1ZFJA 1SZGA 1TYGA 3P8IA 3W76A 1LBLA 2QJGA 3LBCA 3QW3A 3I68A 2VEKA 2WNZA 5LNWA 1VJIA 3QSTA 1NFBA 1EUNA 1J4EA 2Z0IA 5AHMA 4ZMGA 4JIQA 2Y7GA 4M6QA 3FJ6A 4GUIA 4FX6M 4E2DA 5AYYA 4E2BA 4NQ1A 3TFCA 1XBYA 5BOOA 2Y6ZA 3NVTA 2ZA1A 4A22A 3TMQA 5D03A 1EP3A 1LBFA 2VFFA 3LLDA 1G7VA 2ISVA 4UMCA 4JTTA 4JY9A 4JN6A 4O28A 3R5EA 3IRDA 1SW0A 1XDMA 2V0TA 1Q6QA 3BG5A 3I6RA 1EEPA 1QDSA 1THFD 1YDNA 4IPIA 1DJQA 3W3OA 4IWWA 1RV8A 2H6RA 3HF3A 2RHGA 4JIPA 5AC7A 2X16A 4GFSA 5EBUA 4POCA 2I9EA 3UZJA 3UQNA 3VE7A 4TIMA 5LKYA 1QCWA 3WJWA 3H55A 3UWQA 5AC6A 3NXFA 1GG1A 2A85A 4WZHA 1H7OA 5HULA 4OU1A 3TC6A 4JX5A 2VXNA 4MLJA 1MZHA 3E12A 4JTHA 5G2IA 1IIGA 4XKYB 1ZHAA 5D02A 1ZAJA 3OVPA 4XWUA 3MYPA 4O1BA 5F2IA 5CZTA 2Z6JA 4AAJA 1N7KA 4QM1A 3B05A 1ZJIA 1I45A 3FEMA 3P60A 4HSOA 4KWVA 4DBDA 1P4CA 4KWWA 1GJPA 4Y90A 3P80A 2OX1A 2AAMA 1I2OA 3L21A 1OFPA 2GOUA 4DF1A 3CT7A 2DU2A 5AHLA 3WJXA 1AW2A 1TCDA 3CB8A 3GAYA 4LRSA 4W9TA 2Z6IA 1MEIA 4PL2A 3W1RA 1TPC1 1UUMA 2TMDA 3PUEA 5CPMA 3L5AA 3W7KA 4FO4A 4LV4A 4M7TA 1J5TA 3PBWA 2GPTA 2ZRUA 1H50A 4MY1A 3QQ0A 4WY0F 4DELA 3S9YA 3OVRA 4NJHA 4UXDA 2P0OA 1W56A 1T0OA 2YGYA 3DFPA 1KM3A 3B0PA 1FCQA 5D04C 3CTLA 4UTWA 1YDOA 4FIQA 5AOUA 3M5VA 4A3UA 4CLMA 4I9AA 1XBXA 1FXPA 4N6EA 5HR7A 2J24A 1TPEA 4OQVA 2C0AA 2C14A 1TMHA 4GJ1A 3A5FA 3O05A 1PIIA 3LTPA 4JDBA 1NVMA 2CZEA 3CM4A 2A7PA 4Z1CA 5FF7A 3LHTA 4IOTA 2YXGA 4HT3A 2JGQA 3MP4A 3V1PA 1WQ5A 4UTUA 4AWTA 3LI0A 3M5YA 1VHCA 3QPZA 3PBUA 1TV5A 1LROA 1LRNA 1GVQA 3NA8A 1J2WA 2CU0A 4GXMA 2DJLA 1LOQA 4RXGA 3DU0A 3LHUA 2X1UA 4IMGA 4PTNA 1M6JA 2GVLA 4ZVJA 5T26A 3NL5A 1DL3A 3NQ2A 3Q2DA 3PAJA 2QJHA 4QIUA 1WBHA 4UFLA 3GXPA 1KV5A 1TPB1 3EWUA 1GT8A 1T8XA 4AHOA 1F6KA 1DKWA 1OVDA 1H51A 2QCGA 4UTHA 1F74A 3C61A 4O1DA 4MZYA 2QDHA 3N2XA 2WSYA 2FB2A 4UTTC 4JD4A 4FHAA 1QPOA 3DI1A 3UXDA 3ATYA 1LDCA 1V5XA 1U83A 2QCHA 3HPSA 1CX9A 1W5NA 4GE8A 1XCFA 4AHPA 1P1XA 3G1YA 2BLEA 1Q6OA 4XTIA 1K8XA 3W1MA 1FXQA 3F1QA 1LP6A 1KM5A 5TIMA 3HQ1A 1C29A 4K6AA 2YYUA 1SSDA 5ABTA 3MP3A 3DZ1A 3YPIA 1ME7A 4GUGA 4RR4A 3UZ5A 1FCUA 1GVOA 2ZZ2A 3PSWA 3ABOA 4QNEA 3WJYA 2DP3A 3SI9A 2NV1A 4RJEA 3W1UA 1FDZA 3SZ8A 2ATSA 3EEGA 3B06A 1RD5A 2XN0A 5LNRA 3N19B 3GLCA 5MHBA 1TV8A 1R2SA 1JCNA 4O15A 4LS1A 1NEYA 4Z1DA 3IGUA 2PRLA 3LV6A 1IGSA 3LERA 1AW1A 3NQ6A 5G2WA 3GDMA 3S5OA 4FXSA 1SZEA 4O14A 3QFEA 3EX6A 4MFDA 3L67A 2V8ZA 1R47A 1SPQA 4M7SA 4NU7A 4GBUA 2ZA3A 3SY5A 3O1NA 3GB6A 3NQ7A 4HSNA 5CZ0A 2VFIA 4K38A 3E0IA 4LC8A 5IM51 4ONVA 2EHHA 5AHIA 4M6VA 3C4UA 3C2VA 2WV8A 4Z08A 3LCHA 3BK0A 3EKZA 3L65A 3C2FA 3W83A 1KA9F 4XZ9A 3PS7A 1UCWA 3NM1A 3PULA 2DZTA 3LHYA 5LHFA 2JKEA 5LGZA 3T7VA 3D0CA 3PG8A 4IMCA 3G24A 3W1AA 3CHVA 1SU5A 5KTLA 4CNOA 3FKRA 4UTJA 5F2MA 3NYZA 1S5TA 4UR7A 3UWUA 1TRDA 5KITA 4FNTA 3BW4A 3GKAA 5DBUA 1OFOA 3L9CA 1O5XA 3W74A 5AC8A 4JXCA 4LVFA 5IBXC 4IMEA 5HR6A 5F4WA 4ZQNA 3EXTA 4IXHA 3FS2A 1I8JA 2RH9A 4ORIA 2TRSA 2CZ5A 3PB2A 3TU9A 5KZMA 3KFTA 1VH7A 1RVGA 4FNQA 2A4AA 1ML1A 2H8XA 3T40A 3LM7A 5L9FA 3B0UX 5AHEA 2AQWA 2C3ZA 3W9ZA 1HFBA 1TV7A 4KFOA 5F2LA 3LCWA 5AYZA 3W7NA 3O07A 4JICA 1GYNA 3LTYA 1U5JA 3DBPA 2ABBA 3UNDA 5U7SA 5C2XA 2RDTA 3HG3A 4Y8FA 2R14A 3L0NA 4NX5A 3BLIA 3LB0A 3UY8A 1WXJA 1AMKA 1HG3A 3UPBA 1HUVA 3S5NA 1WX0A 5FF4A 4Y96A 4P61A 4Q33A 4ZZ9A 1H61A 2CLIA 2B7PA 4FX8A 4Z0SA 3WJSA 2FPTA 2WNQA 1R2RA 4IGHA 1R30A 3KRZA 1G67A 5LGXA 1GVSA 4FB7A 1GVRA 3TR2A 3PB0A 2H3DA 3NEVA 3BG9A 4UFMA 1B3OA 1XKYA 4QNWA 2ISSA 1JQVA 3ZFHA 5DCBA 1KW1A 4NXSA 4DF2A 3W1XA 1W3IA 3O6DA 2VEPA 5FEWA 2YX0A 2AGKA 4WQ6A 3HPXA 5FF3A 1YADA 5C55A 1A5SA 3UPWA 4BI7A 1AL7A 1FWNA 4OV4A 3TIMA 2QCNA 1DVJA 3THQA 2J9YA 4LT9A 3LCGA 4QITA 1M5WA 3MMTA 1TSIA 1ALDA 4IX2A 3E49A 3BVJA 3A21A 1Q45A 3C2OA 2YYTA 4XKYA 1LYXA 5EL1A 2A7RA 4O57A 2ALDA 4JY8A 3A23A 3EB2A 1GTHA 3M5ZA 1TO3A 3GDLA 1W1ZA 2YZRA 4N9BA 4GWEA 4MLRA 3VE9A 5K2ZA 4O0ZA 3UWYA 1MXSA 4AF0B 1KM1A 1VC4A 1TPFA 3HGJA 4MUZA 4EOUA 1UB3A 2QCEA 2QCCA 5LZLA 3EWBX 4GUJA 4XUGA 3W7GA 5BRBA 1MEWA 4MYAA 1Y0EA 2PC4A 5CGQA 5LNUA 3LHZA 2QKFA 1VYSX 4HNVA 2NXGA 2ZRVA 4A21A
chains in the Genus database with same CATH superfamily
4V27A 3W2NA 2D2HA 3QSRA 3NIYA 3NQ8A 1V3HA 2V2DA 1J6PA 1X7FA 2A6NA 2VC6A 1QOQA 1TPVA 1WKDA 3VILA 3KBMA 3GFYA 4NZCA 4CQBA 2OEKA 3GTIA 3OJGA 1R7OA 1O95A 3RM8A 3LK6A 2GL5A 5E70A 3CZKA 2JBMA 5CCZA 3NR0A 2XYLA 3LEPA 1EJSC 1W2VA 2EPKX 3S42A 1MZRA 4LS0A 1OJXA 1QNQA 4C5YA 3P2VA 4C91A 3E3HA 4L6HA 2W0UA 4GC4A 3BL3A 4K7YA 1S1RA 2G50A 2PU1A 2WBKA 1VAHA 3MMWA 4MJ4A 2Q6ZA 2YA2A 2E77A 1XKJA 3WENA 1M01A 4QAIA 4PEEA 4LUIA 2LLEA 1VBJA 3UJRA 4BS0A 4UMBA 4LOCA 1QBAA 1PCWA 1V0MA 2OB3A 2WVTA 4V28A 3I65A 3LPFA 3LTSA 3CLMA 2BASA 2Y2WA 1UWRA 5F2GA 1UH4A 3QV8A 3RAOA 2WWDA 4W93A 2BOGX 1C91A 1JZ7A 4JAWA 3WX7A 2J9XA 1UD2A 1QW8A 2E5CA 1QNRA 1Z3NA 3TLQA 4HD5A 4JS3A 1EA9C 1E6QM 2X7WA 3NPVA 3BSMA 4EAYA 4J3TA 5AKQA 4YWSA 4YLWA 3C56A 1Q6EA 3STCA 5HNTA 1G0CA 2QUVA 3RF9A 1JI2A 1KD0A 3TXVA 4LNCA 4QQUA 2B7QA 2O7SA 1ZZMA 1V3KA 1WNOA 4Q7NA 4EF9A 2VX6A 4MFEA 2CWNA 2V69A 5H8MA 1CXHA 4WK9A 1FP9A 2DVTA 3DOPA 2D0GA 3TZFA 2YBVA 3VD9A 3RX3A 6XIAA 1DE5A 3RLGA 1KFBA 2XHYA 1TPUA 4GZIA 1TPH1 3WLIA 3P67A 2HBXA 2QCFA 4PCFA 1AK5A 1Q3NA 1OK4A 3PJXA 5C0QA 3SIMA 4L4LA 2CBVA 3AMLA 4EANA 1F07A 5HBFA 4ZQMA 2H3BA 2VFEA 3DFTA 1UD8A 1OYAA 2FFCA 3TYAA 3L0GA 3TN4A 3IEBA 2IPJA 3N17A 3ARYA 2NVDA 4EPDC 4CQ8A 3W2JA 5K4ZA 4CNPA 5EMYA 3WLRA 5A3HA 3A9BA 1F3WA 3ZSSA 1JAKA 1AQMA 4C1NA 9RUBA 3SGGA 3E2SA 4Z2JA 1RLCL 3HIJA 3U2EA 2VDGA 1DORA 1Q6DA 2VCAA 2CZFA 2IQDA 4X2PA 1OYBA 4IQLA 4H6KA 3RCMA 2GJXA 1JDFA 2XN1A 3ITYA 6TIMA 4A4AA 2B7NA 3HQNA 2Q8ZA 1VRDA 1TJPA 4O0KA 2YW3A 1GOIA 4A3RA 5CXPA 5G4WA 4GKTA 5GJMA 1NM9A 3DENA 1V6UA 3OBKA 4US6A 1OZMA 1TUXA 1KFJA 4RZ4A 3MYOA 3E2VA 3AMKA 4PB4A 1HO4A 3TZNA 3MHFA 4LBUA 3PFRA 2HTMA 3ZXWA 2X41A 1NQ6A 4XD6A 3NO3A 4NX0A 1UZ1A 2PWGA 3B4UA 4H9XA 5E6ZA 4XO6A 1EWDA 1EF3A 4FNRA 3USBA 1XD1A 1SVDA 1EXBA 4F0HA 3W6LA 2QMKA 3PM6A 5HWMA 1D8CA 1US2A 2PTDA 4Q8MA 1V08A 5C9WA 5DEZA 1O12A 3KTXA 4ALDA 2VZVA 1PBGA 3IVSA 3ELFA 4I5RA 3N1AA 1FWWA 2DSZA 2FMOA 4N9CA 1K8ZA 1GQLA 4C6PA 1KBBA 3ARVA 1FWTA 1Z6KA 2D69A 2Z2BA 5CPSA 4P5UA 1V3IA 2HPMA 5A8GA 1PTDA 3I6TA 3P82A 4YTSA 1HVQA 1AD1A 2J6XA 1NAL1 4RXFA 1JF5A 1D2KA 4NZFA 4WX2A 4QXIA 2CHNA 3A5VA 4INFA 3E1F1 4UB9A 3G0XA 3QZAA 4LBRA 1NDYA 1V51A 2GSEA 2OSXA 3FJ4A 1E6SM 2INFA 3VCNA 1R8LA 3O0KA 4M51A 4AWSA 4G1NA 3W85A 3WD2A 1PKMA 3LDVA 4KWUA 4ACZB 3MHUA 3KWSA 2V9DA 4XAGA 1UC4A 3CV7A 2XIQA 4ERAA 4IGSA 2BX7A 1AZ2A 3IJ6A 1PZ2A 3QRHA 2XFWA 1O68A 2WM1A 4NY2A 1X6NA 1TR9A 1HKIA 1NF7A 4PH6A 1XLMA 3THAA 4Z2HA 4JNZA 3ABRA 5IFTA 1F3XA 2YOCA 1KV8A 1H7PA 2PWEA 3NQAA 1AG1O 5HDRA 2OSYA 4QDMA 3UG3A 2YBUA 5CBJA 2DFAA 3WDRA 1SR9A 4LBSA 4BFAA 9CGTA 2ZRXA 3VIHA 3V1HA 3WSUA 4NL1A 4ZFMA 4NJIA 3HM7A 2Y5JA 3W81A 3SGZA 4V1XA 3C2EA 4IXXA 4MNLA 2QCMA 3G1FA 3I7RA 4S2CA 4LB3A 3H6OA 4HZ7A 4XZLX 2ZXAA 4GO9A 2EPHA 2R1KA 4S3FA 2X2GA 1WO2A 5C70A 2WSKA 3RG6A 3E0VA 3ABZA 2G4JA 3VCCA 2EEXA 4P7NA 5CC6A 2PFHA 2YCEA 1MVYA 2C1HA 4NI3A 1W1A1 2CNCA 2HZGA 2G4FA 4JQ3A 3DFQA 3HFTA 1VQTA 1EUAA 2ZVIA 2WJZA 4LAZA 1E6NA 4PUDA 1VJSA 4ERGA 5A94A 1E4IA 2WXDM 1WZMA 4O1CA 5FAGA 4AZCB 3M0LA 1V6TA 4GZ7A 2C16A 7REQA 4JKMA 2BXVA 4RCXA 2JEQA 4GX8A 2FIQA 3C0LA 4GQRA 1XRSA 4MDOA 2RJGA 3UVIA 2WZMA 3IIXA 3ICJA 4WOZA 3N4EA 1GUVA 1QI5A 1ICPA 4MB3A 2PLKA 3WUFA 2G3FA 4H8UA 3QV9A 1BFNA 3T44A 2YFOA 3IJ7A 4Q8PA 3KOZA 2ZRYA 3SN1A 3V36A 4DBUA 4LU0A 1XIDA 1TREA 3E0WA 3EXSA 3W1TA 4KF1A 4F8XA 1E0UA 4HVXA 3DFYA 4IHCA 1XIGA 4GQQA 2GDQA 4N02A 2OMAA 3GBDA 1Z89A 1ONWA 2X40A 3NQVA 3VNDA 3FEQA 1Y5WA 2W6RA 3S8HA 3NM3A 3RXZA 3N9RA 4IT1A 4ZOBA 3EWZA 3B4YA 3L5LA 4DUOA 4C60A 4OWGA 1DJWA 4D6HA 3NZRA 4RDYA 1CGUA 4L9XA 4GQ0A 3CHFA 1IE7C 4XAFA 3GHSA 3IAPA 3ZOAA 1SJDA 3LCFA 3W73A 3ZLFA 3W72A 4HYVA 5BYWA 5F1VA 2P53A 1DWFM 2R1PA 3GH4A 3NL6A 4PMZA 2VJXA 1Z69A 3C3UA 2REQA 1LL6A 2A6LA 1CXIA 2HVNA 4LF2A 4KRUA 1JDAA 3QLLA 3S5YA 1H11A 1VBRA 4REQA 3TTOA 3WBXA 2PI6A 3UXAA 3O63A 4IUGA 3SUVA 1A5MC 2PZ0A 2Y7EA 3WNLA 2CEQA 3G5EA 2A5HA 3NG3A 1UUOA 4AD4A 1ZQ5A 3SQLA 3VOCA 1RCQA 1CB2A 2B81A 5C54A 1HJSA 4YVXA 4C6CA 3HO8A 2KZHA 4D8AA 5A6SA 3AUOA 3R11A 2GWGA 4B9ZA 1DWGM 3WK1A 3URBA 3TW9A 3N14A 3EX4A 2ADAA 2A3HA 5M1TA 3B3DA 1ODUA 3STGA 3TYEA 1A0EA 1SYTA 3NPXA 1O5RA 3C52A 2ZQ0A 1MUCA 4IX0A 5BRPA 1LQ0A 4CCZA 2QGYA 2DJXA 3MW7A 4JKKA 4KFNA 3BAXA 3IK4A 3REQA 4IIHA 1A0CA 3SFKA 3AZRA 1JCMP 4US5D 5K7JA 3KTSA 2X1SA 1CI1A 4WCJA 1ESWA 2GQ9A 4LUTA 3ABQA 3EB4A 1W9VA 3VMNA 1K1DA 1V6XA 4M6UA 3CAKA 3DHUA 3OIXA 3NURA 3TWBA 2ZDRA 3TJXA 1W2PA 4Q4KA 3GIYA 3EWDA 1VFUA 4MPKA 4YJ5A 3DXIA 3UR8A 4B3ZA 2FZNA 4IPNB 3O3RA 3NOEA 1XLKA 2ZCGA 2WZHA 4KWSA 3SQMA 5CSSA 2BGNE 2OTDA 3M0XA 1H5VA 3S9ZA 3N34A 2G5WA 1WOBA 3G1VA 3MWAA 4CN4A 4EVZA 3GD6A 3S9IA 2IQTA 2QGHA 3AIVA 1IR2A 4R5EA 3L2MA 2PWDA 3SJ3A 4U33A 3WLPA 3W4RA 1XGDA 1SO3A 4DNMA 5A6AA 2QVNA 3T8LA 1ITCA 4MGGA 3OLEA 4ZOCA 5XINA 3WH8A 3GK0A 2OLHA 2PPGA 2NXHA 1RPXA 4NAEA 4PTVA 3S83A 3A9IA 3WBWA 3WDHA 4PMVA 4X0VA 3E0LA 1A50A 1GZ1A 5D9PA 3CIVA 4MWAE 3FXGA 3FDKA 3AXHA 3HB9A 3ECQA 1PWMA 3H8AA 2EKCA 3BZGA 1WKFA 4IUOA 4TU1A 1K6AA 4EE9A 2HS6A 2C13A 1P43A 4FLOA 4KIRA 2E68A 3ONBA 1S39A 1J0IA 3QC0A 4KBXA 5A6LA 3BOXA 4RE4A 2XG9A 1MSSA 2BBFA 2Q8LA 1YBQA 3PPCA 5A1AA 3STFA 3IAQA 2CLKA 1YRRA 1VLIA 2AQOA 1OABA 2FZ8A 1VCVA 5A8OA 4LQ1A 4WY0B 1PDYA 3TEVA 2INEA 1BD0A 3RYSA 1QHOA 2ZE3A 3PR2A 3GDTA 3MT1A 3SCSA 3NOYA 3ITOA 4LTSA 4J7RA 1JF6A 3M43A 2V67A 1OADA 3KBVA 4ZGYA 3M7SA 1KLYA 4WD0A 1JZ3A 2OCZA 4AY7A 4D1JA 3QVQA 3OQEA 4C6DA 4XO7A 3UWEA 1F76A 3I10A 3F5JA 1YXCA 1ITXA 1YE6A 1JD7A 2WWCA 1HKMA 3FDGA 3ZT7A 2J8FA 4J3UA 4OKDA 4XAYA 4XG1A 3T0TA 3TAOA 2F6UA 4FNSA 2CZVA 4QDPA 4V15A 1NSJA 4K8EA 1LG1A 4MADA 4Q32A 3P81A 1CW2A 4Z0JA 1R3TA 7A3HA 3O8AA 4JIIX 5I77A 1U22A 4AZ7A 2CESA 1E6ZA 3WK3A 3QQWA 5BW6A 2RJHA 1EO5A 3TUUA 1OCNA 4H3DA 1U2YA 5KZEA 3BOLA 5I3HA 1XDLA 2XGIA 4JYEA 3SM0A 1UH2A 4XX6A 1TJ2A 3HTWA 4BF9A 2CETA 1JXKA 3NVDA 4ZODA 4FK9A 3AWNA 2HCVA 3W7EA 3M0VA 4HA0A 2OSWA 3VDHA 3XISA 2Y7DA 2JKAA 3M7WA 1FP8A 3RMEA 4PCNA 4QCEA 4P8UA 4EXAA 4GYKA 3B9EA 3L4TA 3UJSA 1SJBA 4BHYA 1L2QA 3TQVA 5HJLA 3ARPA 3W87A 2J7FA 3MI3A 4ASTA 4W8LA 1J93A 4LCRA 4ATWA 2QPUA 4QQ3A 1DXIA 3SRKA 3USZA 4TMBA 3AU2A 3K30A 1V7YA 3B9NA 3IJDA 2PCQA 3B8WA 1AL8A 3PK7A 2NT0A 3ATZA 1OBAA 4D9PA 4J28A 4C6IA 2VZSA 4DO6A 3S1VA 4LS2A 2NQLA 1UP0A 1B3ZA 2A2IA 3CV1A 3L23A 3BE7A 4HNOA 1D8WA 3CWHA 3PZ9A 1OFBA 2PD5A 2ZA2A 3VI2A 2GQ8A 1AODA 3WLOA 2DIJA 1KM2A 3VNKA 4F0RA 4AW7A 2FLIA 1KFLA 4N6FA 4Q4QA 1XYMA 5EA9A 4EKJA 2ZRZA 5BMWA 4PB5A 2QPSA 1U33A 5EPDA 3CUXA 3VXGA 1ZJAA 4JTUA 1SFLA 1UKOA 1OX4A 3T2QA 2DUXA 4QG6A 1YTEA 4PULA 4TV6A 3WQVA 1YXDA 1DOSA 5AZ0A 3AMGA 4L4PA 4M3PA 4DBSA 5LHEA 3EXRA 2VFGA 2IPGA 4C90A 5I23A 2E6FA 4ZEPA 1H0IA 1QI0A 4G1KA 1ZPTA 3P7YA 3LGGA 4J3VA 4W89A 3CYVA 5FACA 1Q7QA 4LX4A 1B1YA 4B16A 1GOMA 4D6FA 3Q58A 3S6TA 3CPGA 3VPLA 2QF7A 1GOXA 3KXQA 4S2BA 3ZVHA 1IWAA 4W7WA 4BWLA 3DGBA 1LLWA 3TSMA 2E5BA 4K2SA 1GYMA 4D6CA 1T40A 4GGBA 1ZALA 3VIFA 5FOOA 2PRMA 1R3YA 5FJTA 1VIZA 2VEMA 4ZB0A 2ZRWA 3T0AA 2G3JA 3S5ZA 2BOFX 4JX6A 2PDIA 1BF6A 2XINA 4W5ZA 3UG8A 2E8ZA 4FOKA 4NIRA 1U5HA 1W3LA 5HMDA 2UY5A 4BQ5A 3EOSA 4QJ3B 3LPOA 5E5CA 3ZJ8A 1NOFA 1W54A 1QOPA 3BLEA 3K46A 1C8QA 2PWVA 3NQFA 2CLEA 3CV2A 3M5XA 3HMJG 3GDKA 1PKNA 2F6KA 3H2EA 3ZIZA 3MDWA 4ZOEA 3LN3A 4S38A 4H8NA 1CXFA 3FHAA 5ABFA 3W7JA 5I78A 3QZEA 5CAKA 2ZZ5A 5GVJA 3VAVA 3CZ8A 3VTRA 4QJ5B 1ZBCA 5C9UA 4XB3A 9XIMA 1V6WA 4HPNA 4BKNA 3HGSA 2IUZA 1K77A 4K36A 3URAA 1EX1A 2JGYA 3STEA 2F7FA 2NXIA 4RDVA 3VKKA 1Q66A 3QH2A 3LCXA 3PZIA 4CCEA 3MJYA 1N55A 4J3XA 4AISA 1EO7A 1PTGA 5D2XA 1VLWA 1BYDA 2HV5A 4UTKA 1ZFJA 1TYGA 1NOWA 2WNWA 3T2OA 1LBLA 3LBCA 2WNZA 1MUWA 3PJUA 1QNOA 3QSTA 1EUNA 1J4EA 4ZMGA 4L6DA 4NG3A 1A5LC 4KMQA 3FJ6A 3RRAA 2FZ9A 4PUKA 1C8XA 4NQ1A 3TFCA 3HV9A 1IYXA 4JIHA 4TVCA 1P0BA 3L4YA 3OLGA 1G1YA 3R8HA 3PANA 2VFFA 3DG7A 1G7VA 2I56A 1GEHA 4JY9A 3AALA 4OZOA 3VOGA 1Q6QA 3BG5A 3GRIA 3I6RA 1N82A 3VKCA 1Z8AA 1THFD 1DJQA 3F7JA 1PX8A 1I1WA 2WMHA 3GS6A 2RHGA 5AC7A 2X16A 3ARXA 1HNYA 2GK1B 1EYEA 3HV8A 5IOBA 1QCWA 3GH7A 3H55A 3SUSA 1W17A 2PDJA 5FL0A 3ZJ6A 1W9BM 3LD5A 1UYQA 1JI1A 4JX5A 2VXNA 1GVIA 4PGLA 1LWJA 4JTHA 3PJWA 5D02A 3WQ4A 2PMQA 3FVMA 3FY1A 5CPQA 4KW2A 4O1BA 4PMJA 2OLSA 2Z6JA 4AAJA 1N7KA 1BPLB 1XLLA 3R4IA 4H6RA 3V5CA 1I45A 4PUJA 3FEMA 1CDGA 3GTNA 3KS5A 1PDZA 4WDUA 4XZBA 3P80A 2WCGA 2WM0A 3AXMA 2EG7A 4QDWA 5FJPA 1I2OA 2GOUA 1B31A 3CT7A 3MUY1 3OZPA 4F9JA 1TCDA 3CB8A 4W9TA 4S23A 2FHFA 5JH1A 3W1RA 1UUMA 3L5AA 3W7KA 1ITUA 3S5SA 4GPNA 1MQQA 2ZRUA 3RO6A 4KWOA 1UPMB 3UT0A 4NKCA 4NJHA 3MPGA 4RL3A 3SCVA 4A35A 2P0OA 2YGYA 1RJQA 4UTWA 1SZRA 2P76A 2J7DA 4A3UA 3VUPA 1FWIC 1FXPA 1XBXA 2QZRA 1TPEA 4OQVA 2C0AA 2E7FA 2VO5A 2C14A 4GJ1A 2EPNA 4GY0A 5LXXA 4JDBA 1J0KA 3NZQA 1VFHA 2PODA 2ZUNA 3MP4A 1UH3A 4DWDA 4ENLA 3M5YA 5D9NA 4Y9NA 1J79A 3GU1A 4DM2A 2VHLA 3S4TA 4LAUA 3DU0A 1R3WA 2C91A 1WZLA 1M6JA 4YN5A 1V7AA 4PTXA 1YW1A 3WN6A 1VFTA 5D9MA 3PAJA 2QJHA 4QIUA 1ZL1A 1U5VA 3GXPA 1GT8A 4US5A 2VYOA 1XLCA 1KRMA 3UW6A 4PUWA 4O1DA 3ME3A 4MZYA 2FB2A 4C6JA 1B9ZA 1QPOA 4WDXA 2O0TA 3HPSA 3ZQ9A 2DVUA 3WLJA 1JYVA 2VD9A 4XISA 1Q6OA 1K8XA 3W1MA 1FXQA 1LF1A 1YDYA 5TIMA 5BOFA 4PMXA 3HQ1A 4UZSA 1P0EA 1AH0A 3EKGA 3HZ3A 5EFFA 2NLYA 3YPIA 4RR4A 9XIAA 1NIUA 1E3ZA 3ABOA 4GFIA 2OZ3A 3KDNA 3BOFA 4ES4A 3W1UA 3AISA 5LNRA 3UVAA 3WD3A 5AVNA 1FKWA 1VPQA 1XLIA 3GNOA 1AW1A 4ZTYA 3NQ6A 3ARSA 2CC0A 3S5OA 4O14A 3QFEA 2V63A 4U3CA 1W3JA 3EX6A 4HPGA 3L67A 4M7SA 3V35A 1EKOA 3L7RA 3O1NA 3K1DA 1J8VA 3GB6A 3N6QA 3CB3A 1V0NA 2OR2A 3V4BA 5CZ0A 1YNPA 4K38A 4H9VA 3ARRA 3E0IA 4LC8A 2O4MA 2EHHA 5AHIA 4S3BA 3C4UA 4J40A 3C2VA 2BHYA 3BK0A 1U1JA 1EJTC 1IV8A 3A47A 1KA9F 2AQVA 1B3YA 3RDKA 2VC9A 4IIBA 2PA6A 3AU6A 4M1BA 3CHVA 1KR0A 1H0GA 5XIAA 5CC3A 2QLYA 4B3LA 3WQFA 4H7ZA 2ZX5A 5AC8A 3DYMA 4AX7A 4C1NB 1PJ9A 4IMEA 5F4WA 1KXHA 4DJEC 2QYGA 4ORIA 1I8JA 2RH9A 3C86A 5DMNA 2QT3A 1XS2A 3KFTA 7CGTA 1ML1A 3T40A 3LM7A 1FWEC 1LT8A 3QHOA 1HFBA 4KGJA 1TV7A 1J18A 3RCYA 4DHGA 3FGCA 3LCWA 3VOFA 1DIKA 3O9NA 4JICA 2PSNA 3DBPA 2GJXB 2XGBA 5U7SA 3RM4A 4Y8FA 4TXEA 2FVKA 3TWAA 1IZJA 4XZMX 1WXJA 3LGDA 3UPBA 3UESA 1WX0A 5FF4A 4Y96A 4P61A 1CWYA 4ZZ9A 4IGMA 3S2MA 2EPLX 5TNVA 1TE1A 3TYBA 2TODA 4DIAA 2SFPA 2OYMA 4S3AA 4MWAB 3WJSA 3MSRA 5BOEA 3SCWA 2YCIX 1VRXA 1ZB5A 1R2RA 4IGHA 3PZGA 3ARWA 1GVSA 4FB7A 1GVRA 3TR2A 3SUTA 1SMAA 2IS7A 3BG9A 4UFMA 1OIMA 3IRSA 3PHAA 1KW1A 3W1XA 5C9XA 3KOYA 3O6DA 4DO7A 1HN1A 5FEWA 1WUFA 1A5SA 3VK5A 1AL7A 1GW9A 1ZUAX 4PSRA 4YVPA 5EMKA 1A47A 3GG1A 4I6VA 1MFUA 4QITA 4QX4A 4GJJA 3DIPA 3WH7A 1V0KA 3KWXA 1I60A 2A7RA 2CBIA 1MW1A 2X0YA 1K9TA 1JYWA 2CCRA 1BQCA 4HU4A 3EEZA 3K13A 2YIHA 1JAEA 4W4QA 1VC4A 3HGJA 4JOMA 3URNA 4OBSA 2QCEA 2WZEA 4XAPA 2Q02A 3W7GA 5BRBA 4MYAA 1E4NA 4AIEA 3EDDA 3U4AA 4JQ2A 2POTA 4HNVA 3DYPA 2ZRVA 2GGHA 2EAWA 2WVVA 3NEHA 1IIHA 1EYWA 1X6UA 5CSUA 2PP0A 3UZWA 3EPMA 3N2OA 2H8ZA 4AWEA 4TOQA 2DORA 4O13A 4EK7A 5CH9A 4MB5A 3WEZA 3BXWA 3ANUA 3IUDA 3CO8A 4EACA 4YU1A 2Y24A 2WK2A 4IJBA 2ABAA 5DRIA 4QLLA 3PF3A 1IXOA 4GHRA 1YXYA 4AVFA 3WH5A 3ZZ1A 1ZGDA 4ZR8A 1PZ0A 1EHNA 2WJEA 3GNRA 3NZGA 4DXXA 4BK9A 5CSYA 3PP7A 1P0NA 4FOJA 1XFBA 2PDCA 1LWIA 1TQJA 4JTFA 5CC7A 3BAYA 4IMDA 4E2OA 1F8IA 4R9OA 3RNDA 5B7YA 5LNSA 1XWYA 1YYAA 4S3KA 1WDDA 3P8JA 2WSPA 1X7IA 2D3LA 2WSQA 3GXNA 1LUCA 4R7OA 1ZAHA 1PHWA 1M68A 1UIPA 1VGAA 3MUXA 1EFZA 1H7NA 4YHGA 2NQJA 4FLSA 3QPEA 1W5PA 4LVDA 1CLVA 2PGRA 2G3MA 4LEFA 4DJFD 4E6MA 2CERA 3WMCA 1UR2A 5HNUA 3WK0A 2OO6A 3MVTA 2Q09A 1OFDA 3FAXA 1PYMA 5HXMA 2E6AA 2V2HA 3NAVA 2XN2A 1OG0A 1KNWA 2WKJA 4DEFA 4LYPA 5EB8A 4M56A 1DJGA 5AVHA 2F84A 3VINA 7REQB 3NXLA 3N3MA 1SUXA 3GR8A 1M03A 3OLDA 1EL3A 1YQ2A 2FTPA 1FX6A 1DHPA 1H49A 4QP0A 4FX7A 2O9TA 5A6JA 4XZIA 5ENLA 5FESA 1WV2A 1ICQA 1CBGA 2OELA 1G94A 4F3HA 4QROA 1VFMA 1K8YA 1GOQA 1NDWA 1TRIA 4FAMA 4PMNA 4GIRA 4RKAA 5ABHA 4LUYA 3T0DA 2Z1WA 4PMUA 2E1WA 1KBKA 4GYPC 4PSPA 1EJRC 3J7HA 1NJJA 4LFYA 1QI3A 4UCGA 3T09A 2VVSA 3FA3A 1BKSA 3M47A 2TSYA 2VC5A 4P8XA 5HK4A 1KWKA 3UWZA 2NX9A 4FLQA 3R0UA 1MDRA 3OQ8A 4PRRA 4RE0A 1QMLA 1K03A 3SFWA 3VNJA 3WBAA 4MKNA 1CGVA 2I9UA 1IGWA 2BGSA 3TDFA 5KMYA 4D71A 4AXNA 1GEQA 4IIFA 3E6EA 1IHIA 3CIXA 4YWIA 4IP5A 2Q8XA 1TJRA 2BGQA 2GGJA 1DJHA 4FOUA 4UFJA 5K9XA 4FI4A 4GNKB 3R12A 2REQB 2VP8A 2VMFA 5TAOA 2QUTA 5HNRA 1KTCA 4JTLA 3TW7A 1L9WA 1XCWA 2PWHA 4REQB 4P8WA 3CHDA 3QQ1A 1UD5A 4MB1A 1XH1A 3KLKA 4J3SA 3QHNA 3G1AA 1S46A 5EMJA 2OEMA 2HXTA 4PUEA 1WE5A 2RDWA 4HMNA 3GVRA 4LV9A 1YMYA 1ME9A 3WG6A 3VA8A 3K8LA 5D2YA 4CKQA 4WUIA 4UC5A 8CGTA 1OX5A 1ADSA 1OGBA 1A5AA 1OX6A 1Q13A 4FZIA 3CL7A 2UWFA 3SBFA 3MBDA 4CEXC 4O11A 2QULA 1W1B1 3N2BA 3T4WA 3QY7A 4XIAA 3KP1A 3MP5A 1BG4A 5TBOA 3ANVA 3SDOA 3W6YA 4UOQA 5IHSA 4LUTB 4IH3A 2OGYA 1S3HA 5BWFA 2UY3A 4HBKA 4PBGA 2E1DA 1UQYA 3ABSA 4J35A 3PVFA 3B8DA 3V75A 1ECQA 3TX9A 1GYLA 4LUSA 1CIUA 3T4CA 1OB0A 5A8QA 4LANA 3EDEA 4TVUA 1OCJA 4UUIA 3VDBA 4H1ZA 4IFKA 2OT1A 4GRSA 3ITGA 3IANA 3S6OA 3TJIA 4PA8A 5D33A 2J7HA 1ONXA 3LV5A 1ODZA 3PWAA 2ZX9A 5H91A 2PBGA 1DWJM 3H54A 4IGNA 3G18A 4JQAA 7TIMA 3WY1A 2G37A 2VCCA 2R9RA 8A3HA 2JKPA 1ZS2A 2O7QA 1VZWA 4IPLA 5HWNA 4AZHA 1BXBA 4MPQA 2WHJA 4JEJA 4LRTA 3CJPA 2FTWA 3BV4A 2QUUA 2YA0A 3V18A 3VNMA 1O1ZA 4W84A 2HWGA 1CGXA 4PZVA 1XH0A 3AYRA 3QPYA 5BWAA 1LOLA 1VYPX 3GE7A 3AC0A 2DSUA 1ZBKA 1JULA 5MKGA 4KCWA 4YYFA 2QEZA 3U7VA 3DGRA 3RFAA 2QNEA 3BJFA 4JTEA 1WDQA 4N7QA 1IXPA 3WLMA 2D0FA 1Y5XA 2XVGA 3UZZA 1MRAA 2VEIA 3MVIA 3FJNA 2Y5SA 1YBQB 4QSFA 1T6MA 4RNHA 3NQEA 4NUWA 1JZ5A 1ZENA 1F6PA 1F5ZA 2PU0A 3VO0A 4X22A 3M0ZA 1HJWA 5REQA 1KBLA 1KXQA 2Q3OA 5D37A 4GYPA 4EF8A 3ITTA 4HNUA 4H2CA 1W8GA 2NQHA 3QMRA 3MS8A 4TMCA 5DMLA 1XIBA 2FGLA 2UZ9A 1GG0A 3F03K 3K2GA 4QJ1A 1IT8A 4U28A 3JRKA 1TTPA 4XZNX 4DJDC 5HINA 3LA4A 3OZOA 2YSWA 3EA1A 2HS8A 2VD8A 1TZ7A 4M5PA 2HNHA 3FIGA 1QVBA 3RK8A 1TB3A 1TPWA 4PUUA 2VWTA 2BZNA 1J96A 3QGKC 4GQGA 2ZXBA 1T96A 2OT0A 2YDAA 4EPEC 1JDDA 3P74A 1EGMA 5CPLA 2NX3A 6ALDA 1AJ2A 4E3VA 1G6CA 1O4UA 3T07A 2BY2A 2D3NA 5BNKA 4DWSD 4XV0A 2L5HA 4ZXOA 2VRQA 4G8TA 3CMJA 1R7AA 2YDSA 2ZC8A 4GA8A 4JR5A 1JZ6A 4S3EA 3CU2A 5FEXA 2OOGA 1E6PA 5BU9A 5FSEC 3LOTA 5K9DA 4J3ZA 2Y85A 1EEXA 2FDMA 2VX7A 4JNMA 1TTJA 4UTTA 3L2LA 1P6WA 5D30A 3QLDA 3KBNA 1RLDA 2E09A 2YPIA 3SCUA 3CZLA 1TV2A 3K4DA 4Y9PA 2V5LA 5MF5A 3HPZA 1OZQA 2HE8A 1KFEA 3UD6A 2PLCA 3DDMA 2HMCA 4OOUA 2BY3A 1H4PA 3GM8A 1I2PA 3MU7A 2GVGA 3ONCA 2Y63A 2GJLA 4U31A 3GXDA 1O6IA 3ZR6A 1TX2A 1UJPA 4EXBA 1JFHA 3G3DA 1YKWA 2VFDA 1TVLA 3GX9A 1ZTVA 2ZTKA 1E9LA 1J2BA 1CGYA 5F1UA 3O6YX 5CC5A 1V02A 2VUNA 2V38A 1GPFA 3IJ8A 1R87A 3D47A 3IV8A 1H1YA 3PN8A 1CB7B 3F5LA 4NILA 5E0CA 3WNMA 4CQ9A 3S1WA 4BCEA 1YIXA 4IJRA 1YPIA 1OX4B 4HOWA 3GG8A 1F3EA 5HMSA 1GCYA 4WLCA 1UMYA 3O6CA 1OYCA 1NTHA 2JIWA 1AQFA 2WHKA 4Z2KA 4KCVA 3FHQA 3UXIA 4HOXA 3AMCA 4IJCA 1W8SA 2QJJA 1J0ZA 3D5HA 2WQPA 1H5YA 1AFSA 3FNDA 3GYEA 2YFNA 3ANYA 2QR6A 3PZMA 4YTQA 2FVMA 3ZVHB 3PBMA 3ARTA 5IBXA 4AEEA 4I5XA 2XU2A 3HJZA 3ITLA 5FCZA 4UMAA 3W88A 5I06A 1DJZA 1W9XA 3WDIA 2YB1A 3AFBA 1H63A 5CSRA 5HUPA 4A3YA 4XAZA 5B80A 4LVAA 1EDGA 2A7NA 4RUBA 1UQZA 4YTTA 3IIZA 2J66A 3CAQA 4BZYA 2BB0A 1YDVA 4HZ6A 2VEFA 4ZQOA 4IM4A 4K8HA 1XRFA 1L6YA 3S6DA 2ZE0A 1EDTA 5AY7A 1VJZA 3H2CA 3S2JA 2O9OA 4HGXA 1SJCA 1TVNA 2FPVA 2Z1KA 3UBPC 3TP4A 2ZUTA 3P93A 2YR1A 5T9BG 4JFWA 3OG3A 3DEQA 2VGGA 3W07A 1AJ0A 3OP2A 1QBBA 3PTQA 5IDZA 4LAKA 4Q8VA 5ABFB 2DW6A 3PTDA 1UD4A 3MY9A 3NQDA 2WC4A 1KGUA 2G3NA 4JBRA 2GGEA 3LUTA 6XIMA 3KZSA 4GXWA 1L2UA 4ICMA 5CZJA 1FHVA 2A3AA 5J5DA 2C15A 5E0KA 4C6MA 3O0FA 3G0SA 2OODA 1DE6A 3W2LA 4NZJA 2HQAA 1WAUA 4KQNA 1S2WA 2DVXA 2D2JA 3KRSA 4IMFA 4DJFA 4OECA 3LLXA 1US3A 3G3MA 3OOQA 4PC8A 1BF2A 2QJIA 4HB7A 2W5FA 2XVNA 4ZQRA 3OA5A 1FHUA 1I9CB 4DXVA 3VOJA 5CZSA 2Y8VA 3MV01 6ENLA 3QJAA 3T55A 3AXKA 3MCOA 3N29A 5GNYA 3CZEA 1S2AA 1A5CA 3GU2A 5DT7A 3BLKA 3HGOA 4N0RA 3UYCA 3CHEA 1E40A 4ZB2A 4G9PA 3LX9A 3W25A 1CNVA 2ATMA 3TXZA 4JEQA 4EP8C 1AH3A 4QCFA 4JDYA 1GQNA 4URIA 2NWSA 1QR7A 1H7WA 1TA3A 2ZUVA 3QV7A 3NPUA 5A6BD 3NZ1A 4C6BA 5FF0A 4K39A 1WDSA 1QW9A 2WNNA 6PTDA 3WL1A 2PDHA 2OZTA 3TNOA 3ZLGA 1POJA 5CLWA 5BU6A 2B0MA 2FGBA 4OFCA 1FFRA 2ISDA 1W3NA 3H53A 2NUYA 2P3EA 4ML4A 3BG3A 3SUWA 4FLRA 4O17A 1RCXB 2AMXA 1E1CA 3VDAA 3GUGA 4MUPA 3W22A 2CHOA 2ZZ7A 1W91A 3CWNA 1ISYA 1DIEA 1XGZA 3VZYA 3WFAA 4K1GA 1GQJA 4A2SA 3S2NA 1HTIA 3GVVA 3KOFA 5JVLA 3GHUA 2GQ3A 5DFAA 4TUFA 1SO4A 4RDWA 1E5JA 2DUAA 4QAWA 4OE7A 2VQUA 4AZBA 1F05A 3TJLA 2VOTA 3R89A 5E93A 5I0DA 5DRCA 4RLIA 1DWAM 3W26A 1WB0A 3TA6A 5I3FA 3I4KA 3GZAA 3G1XA 2FZMA 2WCAA 3MQTA 3KHDA 4ZOAA 1S5MA 4DPQA 1G4SA 2WMKA 4GXPA 2NT1A 4PCTA 4RW3A 1S38A 1R46A 2IKJA 4NSBA 4ATDA 1T99A 3UG4A 3WDQA 3MTWA 2J6VA 3L4ZA 1ZY9A 3CUHA 3EA3A 3VIOA 1JXJA 5EBAA 3NQMA 3KAOA 4AY1A 2DT3A 3WLKX 2Z7KA 3TROA 1XXXA 2PZNA 4Q4PA 1FCVA 2GJNA 5IFPA 4BI5A 2WJDA 4C6FA 1QHZA 3W27A 4AU0A 1BLIA 1YTDA 3C0JA 5C6MA 1UMLA 3W7MA 4B91A 4LH8A 4CGTA 3QMSA 3W38A 4GD0A 3U57A 2QUNA 1TWWA 2E4TA 3NQCA 1JG9A 1OG6A 3W1NA 3R58A 1RP9A 3N73A 4O4WA 1ISXA 2RDUA 5G4EA 4N2YA 4MY8A 4JYDA 1MMFA 3CT2A 3QY6A 1XUUA 2BNJA 2VC7A 3EDJA 3QY8A 3W7CA 3AIQA 1I2NA 1VBHA 3B03A 4F9DA 2J7CA 5D09A 4HCLA 4RDZA 1M7PA 2DZBA 1KM6A 3G8EA 4W88A 2HRWA 2BG5A 3QZ6A 4M80A 3RX2A 3II1A 1EP2A 3IGHX 1DQXA 3VDCA 4OJYA 2OVLA 2HJPA 1UWIA 3SSJA 4IQDA 2XH0A 2V5CA 1CT5A 1LWHA 1M41A 2ZDSA 4DN1A 4NNAA 2E25A 2PDUA 4UTFA 1JRBA 3RGTA 3SECA 3QFWA 1XSIA 4RX0A 3EBVA 3AIWA 3ZJKA 3NDZA 3P5ZA 4GI6A 2J62A 3S3GA 2YXOA 4GJIA 4F2TA 1YLVA 1SJAA 5FD0A 2E9LA 2KAUC 1F8MA 3NUKA 4MAVA 2BOEX 4D6IA 3S0CA 3BPWA 5A5WA 1ONEA 2D2OA 1OFAA 5LIYX 3LS9A 3C8FA 2NZLA 4W85A 1RY8A 3CBWA 1UR4A 1XJBA 3UWWA 1DJIA 3VDGA 1AJZA 2NUWA 1K7FA 3R7MA 1WZKA 5I2UA 1OF8A 2OYKA 4GUHA 1UWSA 3BMWA 4NHVA 5C8BB 3SIZA 1P0KA 4ZTXA 2FDSA 1TKKA 5H8UA 1Z9AA 3BC9A 3G8RA 4WXZA 1PL9A 1X1NA 4K1WA 4WSKA 3AJXA 1IXQA 2QCDA 3VD5A 3GR7A 4OIFA 1B4KA 4H7VA 2QIWA 3ARZA 4Q4MA 5FEZA 4CN6A 3HG2A 1PCKA 3NYDA 1OFRA 1WAWA 3FGCB 1FH9A 4NAFA 3OGRA 4IIDA 2CLLA 1QFEA 4JTRA 3P8IA 3MMDA 4LYRA 1R9YA 3JU2A 2VEKA 4EX4A 2QJMA 1NFBA 4IPPA 4MNJA 3CUZA 4M8UA 4Q8NA 3XINA 2D24A 2Y7GA 4JIQA 4L1GA 4QEEA 2GZXA 2MNRA 2I5QA 4GUIA 2X42A 4FX6M 1XLEA 5D8ZA 1CLXA 1WXYA 3CUJA 3GTFA 5D03A 1EP3A 1LBFA 3W00A 1GKRA 3LLDA 4I9TA 2ISVA 4O28A 4JN6A 2G0WA 1SW0A 1XDMA 1QDSA 3U0HA 1RV8A 3HF3A 3A3WA 1V0LA 2VRKA 4DY1A 5EBUA 4W5UA 3UQNA 1XICA 2OPJA 1RBAA 1IQ8A 4TIMA 5LKYA 3WJWA 4DWSA 3UWQA 3WBYA 4GCAA 1UZDA 3V3WA 2A85A 5HULA 1VPYA 3TC6A 2XDFA 3T0CA 3E12A 3VMOA 2A3BA 5G2IA 2EG6A 1ZAJA 1EJXC 3NZPA 3ZM8A 2CBUA 1XD0A 5CZTA 3O7UA 3UCQA 4GC3A 4ECLA 2V3DA 3A13A 1QWKA 1ZJIA 2Y5EA 3RO8A 3FYYA 1P4CA 4KWWA 3I3EA 1GJPA 4Y90A 5I03A 2OX1A 4W87A 4X63A 3UP8A 3L21A 1OFPA 4GI8A 3IJQA 1NWSA 2DU2A 4B4FA 3GQYA 2W92A 3EOEA 3GAYA 4PL2A 1TPC1 3JVAA 1VFOA 3PUEA 2PC8A 4LV4A 1J5TA 4P7QA 3PBWA 2P5NA 2WVVB 1ZBWA 2RDXA 2X0SA 4O0QA 5TF0A 3WNNA 4DELA 3OVRA 3WFLA 4UXDA 1S3TC 3A12A 5D04C 1FCQA 4W8BA 2IMRA 1XDJA 3ZR5A 4CLMA 4I9AA 4N6EA 1QK2A 1F4AA 1W32A 4X0NA 1K70A 2AL2A 3WDJA 1N8WA 3A5FA 3KLLA 3EWCA 2CKSA 3QGVA 2HDJA 1NVMA 2O55A 1V77A 4WSJA 1AD4A 4I3GA 3AS1A 4IOTA 4HT3A 4HA4A 4Q7IA 1EC7A 3OIHA 3V1PA 1WQ5A 4L61A 3SJNA 3L4XA 3OPSA 3LI0A 4AWTA 2V3FA 3EDKA 1MI3A 1DJYA 3OG2A 2XH7A 1LROA 3LNMA 3HQOA 3UXLA 3SCRA 1J2WA 1JEZA 4GXMA 4RXGA 4G5DA 1QK0A 2X1UA 1ZJBA 1UBPC 4PTNA 5CJ5A 3NQ2A 1LUCB 1WBHA 2WLZA 4UFLA 3NWRA 3GSMA 1S2TA 4GKLA 1LL4A 1DKWA 4UTHA 3N4FA 2P88A 3GTXA 2BVYA 4Z17A 3N2XA 4PRTA 4JD4A 3CASA 3LBOA 4FHAA 3KUMA 3LQGA 3UXDA 1U83A 2QCHA 1IEVA 3GWQA 1XCFA 1OINA 1P1XA 2JALA 3G1YA 1TWZA 2W66A 4KESA 1KCKA 3PTKA 1J01A 1W1YA 4UQDA 2WZTA 4AZCA 3ZYZA 3P6LA 3BMXA 3VMPA 1KCZA 1SSDA 2XGZA 3MP3A 5E09A 1ME7A 1XSKA 1G5AA 4EWJA 1ISVA 3UERA 3HU7A 1FCUA 3BCFA 3JZEA 2PDPA 1FDZA 3KOWA 1L8PA 2ATSA 3FN9A 5EMMA 3B06A 1RD5A 1A49A 2XN0A 3N19B 1UPPA 2YCKX 3GLCA 1RBLA 5MHBA 1TV8A 1X97A 1UR1A 5GNZA 2PDYA 5E9XA 4O15A 2YB4A 4Z1DA 1V03A 3IGUA 1IGSA 3LERA 1TWIA 4HMEA 5G2WA 3AIUA 4HHHA 1SZEA 4A8RA 1UZ4A 3R94A 4MFDA 4AYGA 4NU7A 4GBUA 2ZA3A 3SY5A 1OWQA 3NQ7A 1ZP4A 1HKWA 1TCMA 7PTDA 4M6VA 4WVXA 3E5BA 5DMMA 3L65A 1TZZA 3L4VA 4FSAA 2OGJA 5LHFA 3WH6A 3OO2A 2JKEA 3MA8A 4CD5A 3CL6A 3T7VA 5LGZA 1X6LA 4IMCA 4W8AA 3W1AA 3UR5A 5KTLA 3FKRA 4UTJA 3LM3A 4Q8OA 1R38A 5B7ZA 3PNZA 4R27A 4UQAA 3H2OA 3GKAA 1DWHM 3L9CA 4JXCA 4LVFA 1BYBA 4ZQNA 3EXTA 3THUA 2TRSA 5KZMA 3M6DA 3EB3A 3MSYA 1RVGA 4FNQA 5GPRA 2A4AA 5L9FA 4GIYA 3B0UX 4AX6A 1IWBA 1Y5VA 2BMBA 2C3ZA 4ROQA 5F2LA 2W63A 3LTYA 1XCXA 3QN3A 4JQ4A 3TC3A 1BXCA 5C2XA 3SY8A 2WMIB 8XIAA 4GVGA 2Q01A 1HG3A 2XSBA 3K8MA 4DZ5A 3S5NA 5CBBA 1PPIA 4Q33A 4Q6JA 1H61A 3AHVA 2CLIA 4QLJA 2B7PA 4FR6A 3AHXA 3NO1A 4GOAA 5A6BA 1RHCA 2YKKA 1EQCA 5DT5A 2BVTA 2POZA 2WNQA 3KRZA 1EH9A 5C2CA 3RN6A 5A2AA 2FH6A 1CYGA 2H3DA 4IFRA 2ISSA 3V0TA 4NXSA 1M65A 4F0SA 3WQOA 4V2XA 2VEPA 4R3UA 2ZWZA 1EC9A 4C6LA 2AGKA 4WQ6A 3AS2A 3HPXA 3N04A 5FF3A 1Q5MA 1TWSA 2VX5A 1IT7A 4BI7A 1R86A 3DC0A 4MSSA 3TIMA 3KCOA 1PKLA 4DB7A 3PJTA 1HP4A 2J9YA 2Z7GA 1MNZA 4K8GA 3DC8A 3MCNA 3WH9A 1TSIA 3O2LA 1ALDA 3AYTA 4IX2A 3TNBA 3VC6A 2GWNA 4JN8A 3C2OA 2YYTA 1LYXA 4LSBA 2ALDA 2JE8A 3THCA 3BJTA 3QV6A 4RE2A 1TO3A 4AC1X 1Q4WA 2E9BA 1XIFA 1W3KA 4LUSB 4GWEA 4B15A 4AZGA 3FAWA 3NCOA 4IFKB 3UU0A 1TPFA 4EOUA 1CXEA 1XRTA 2E28A 2X7VA 2O56A 4GUJA 5T9CE 1MEWA 4HTBA 5HPCA 5CGQA 1KR1A 5LNUA 3LHZA 1MXDA 2Z2AA 1P7TA 2WQDA 4HYRA 2DZSA 2DV0A 2X2YA 1UIOA 1S2UA 4D8ZA 1R85A 3LSBA 1B5TA 4N9DA 1UASA 1FVPA 3BZJA 1G01A 4UQCA 5AHNA 1XISA 3B8IA 1RSCA 2BP1A 4KT2A 2J47A 2V5BA 3ES8A 2FPYA 6REQA 1EJUC 3RILA 5D2WA 1ENUA 4CNTA 1JCXA 2QPXA 3OEXA 1MNSA 1OD0A 4BQ4A 3WNKA 4FIRA 1FDYA 1ITQA 5FJRA 5MKGB 3GZ3A 4YMZA 4EPKA 1PZ1A 1B2YA 2YL5A 2XH2A 4RZ6A 3LZ3A 4I6KA 2J27A 3QC3A 3LSCA 3N13A 1M3UA 2BHUA 3HJEA 1VB9A 4HQVA 2J79A 1W9UA 2FQIA 2VI0A 2FHBA 4LC6A 2D73A 4O4VA 4WY0A 3TA9A 2HSAA 3ID7A 2VNCA 1REQA 2PAJA 2PDMA 5DN1A 3A24A 2NLIA 2ZUMA 4L7ZA 3FSUA 3N12A 3PPFA 5I3KA 4YCOA 4MJ2A 5A6TC 3OB8A 1L6WA 4WJ8A 1X8FA 5REQB 3MUIA 1EWEA 4M1RA 4DAIA 3TK7A 4X60A 2ON3A 1QPNA 1KCLA 1QATA 3B9OA 1L6FA 1D9EA 1W6TA 2WPBA 3W7PA 3VABA 3CUFA 2WMGA 2XISA 3MC5A 4DBEA 1W9PA 4MWAD 4WOQA 1JCJA 4N4PA 2QDEA 1H1ZA 3ZSTA 2FGZA 3D6NA 1RXOB 2C79A 4B90A 1BVZA 1SZNA 1GNXA 1JNDA 3BCDA 3G1SA 4AVOA 3BW2A 1UJQA 1BQGA 2PDNA 1JIBA 4J27A 4NP7A 1JCLA 2A79A 4OGZA 4Z2LA 4O12A 1QT1A 3GVWA 1EP1A 4H2HA 5CJMA 4LAMA 3PG9A 4Q4RA 4AEFA 1XLHA 3AZSA 2ZZ6A 3TCEA 1H1NA 1XUZA 4DYJA 2ZICA 2YJQA 1GTEA 1PX4A 3KX6A 3W7IA 3I4EA 3GNDA 1DIOA 4A8IA 3GKFA 1K7EA 2ZADA 3PUGA 2VR4A 4N42A 3RM9A 2Z24A 1C90A 2JF6A 5HAOA 4GI9A 5H2ZA 4LJ3A 3GVGA 3AYVA 1H60A 3V0SA 3T1GA 5FI8A 1L8NA 2PLJA 3R2GA 4ZQPA 1UWQA 1KRCC 3LMYA 3T9PA 4M82A 3GH5A 2WHMA 3BO9A 5I5RA 4ZSUA 1XLAA 3GDRA 3FKKA 4GNJA 3UZXA 4ZQCA 4OHQA 1OGGA 3Q67A 1O5KA 1XQKA 4IIGA 2PWFA 3B0VC 4BWLC 1Z7AA 1TG7A 4CU8A 1TUFA 3FLUA 3EOLA 3ZR4A 2OG9A 3LHWA 3W2MA 3I3BA 1GVFA 5HQMA 4PN2A 4L9ZA 4WSHA 1IZKA 1H7XA 2YCLA 2Y8UA 4AYSA 2DZVA 4DPPA 3WMLA 1SQ7A 3ITCA 4H9ZA 3P62A 3BMVA 3VUSA 2Z25A 4N4QA 1FWBC 2OLAA 4O19A 3A64A 3IGSA 3DBNA 5FAJA 5I3JA 3DFHA 3F4CA 1W1VA 3L5MA 2Z4GA 1LT7A 1B3WA 1UHVA 2D1ZA 1LZOA 4UFKA 3BLFA 4Z2IA 2PDLA 1DBTA 4J9JA 2PDXA 5DX7A 1P1MA 5A2CA 4GH1A 1UG6A 5C5YA 4H19A 4L1XA 5BROA 2DZXA 2DIKA 1XLFA 3TKFA 5HNNA 4FXFA 5KZ6A 1VP5A 1OD8A 1C3FA 1A3WA 8TIMA 1ELSA 1JZ8A 1Q6FA 2YXXA 3FSTA 1NP2A 2J88A 4H9MA 3VOHA 3QTPA 3HMCA 4DX3A 1SO5A 4JTIA 1PX3A 2VKZG 4NT0A 4IP4A 5EY5A 2EGZA 3W53A 2IQ0A 5H6HA 1Q65A 4MNMA 5I3IA 4ZO7A 3ISIX 1L6SA 4MDPA 1DQWA 4O1EA 1PZ3A 3N9SA 1XV8A 4OUIA 5C9RA 1E9IA 3S2LA 1QI4A 1JZ2A 2QXWA 2I7GA 1VEOA 3MO4A 3W29A 1E0XA 1O66A 1CTNA 4O53A 1J0HA 3MUZ1 2GSJA 3VIIA 3DECA 1RP8A 3LQLA 2NX1A 1PAMA 2PRHA 6CGTA 3DKLA 3W86A 2ZZ1A 1QPRA 3FVDA 2J9ZA 1KTNA 2C19A 3SN0A 2F9RA 4GVFA 3AICA 4HOZA 3QYQA 2J8GA 1UW9A 3INPA 3JUGA 2JK2A 4HMDA 3CNYA 4NXKA 1DXFA 2R91A 2Z2UA 2XIIA 2ZZ4A 3FCPA 4GY7A 3EWWA 2X05A 3OLIA 3VZXA 2WLYA 1W5MA 4BI6A 3RX4A 4E8DA 1I2RA 1TIMA 4X61A 2QAPA 4UOZA 4L6OA 1R3RA 3VZZA 4BF5A 2HROA 2ZX7A 1UKPA 1LLZA 1BWVA 4LGXA 3XIMA 3UCDA 3FYOA 4W7VA 4E38A 3Q94A 4MF4A 3M0YA 1XBVA 1RCOB 3A4WA 4NI8A 1U1UA 1B3VA 3K4WA 4QHRA 2CLFA 2Q71A 2EG8A 4YTRA 1OC5A 3HFYA 4CCDA 2QCLA 4H00A 5PTDA 4DUXA 4LYQA 3F4WA 2VVNA 5FF2A 3U3HA 5HATA 2VQTA 3TTSA 4ATLA 1BHGA 5FEPA 1BWKA 1XM3A 2Y89A 2NVAA 3M6YA 1K02A 4CCCA 1BWLA 4U2YA 1J5SA 2VL4A 1PWLA 1TV3A 4PCPA 3CH0A 4FNPA 1Z44A 1PB0A 3GC4A 3U2OA 4AUBA 5JBFA 1YTKA 2HVOA 2GVJA 3NSMA 1ZBVA 1NU5A 4W7UA 1J6OA 4WGHA 4C6KA 4ZE5A 2J75A 4GH3A 3AI0A 2FMNA 3W0KA 3IACA 3OYZA 3QW4B 3TE9A 1GGOA 1RH9A 3TYZA 3GDBA 1X1ZA 2PS2A 4JFTA 4UTWC 3SCNA 3LENA 1IZCA 2W91A 3DHFA 3ZS4A 2GK1A 3COTA 3W23A 3N11A 1I1XA 1TA3B 3HG5A 5AECA 1CENA 1MXGA 1PE1A 4Z1YA 3TSDA 3EMCA 3U8GA 4R88A 5T91A 3W7OA 1HVXA 4G56A 4JPGA 3AO0A 1MDLA 1LRQA 1FRBA 1VCGA 4RZ5A 1KTBA 5FJJA 4NNCA 1RQBA 1MO0A 3CAWA 4GABA 1G4TA 2UV8G 4E2VA 4O18A 1QO2A 4U4MA 5FJOA 3PUOA 1E1CB 1XGEA 5LIUX 3FXYA 1NDZA 1QW7A 3Q37A 2PLMA 2WO5A 4P2VA 4AWUA 3GFXA 3N15A 4RNFA 1H62A 2AMGA 5DO8A 3LRMA 4AVNA 1P5BA 1ME8A 2CIPA 4TO8A 3WUGA 4U5IA 3KRUA 5AN7A 3LRLA 4CVUA 4UTIA 2A1YA 5HJXA 4GINA 4DYKA 2FYMA 1C8VA 2ZUWA 3MKCA 2FH8A 2X1TA 5D38A 1YNYA 3N18A 3GYCA 4R53A 5HA7A 2YW4A 3TYUA 1W31A 4NYUA 4M6PA 1EZ2A 4JTDA 1E4MM 4Q8WA 3UR2A 3KOXA 3TQKA 2QMJA 4I9JA 3KCLA 4NZ1A 2NV9A 1S2CA 4S3GA 3MZ2A 3FA4A 2DT1A 4HYWA 4I8YA 4JIRA 1O1HA 1YHTA 3KL0A 4WJEA 4LF1A 2QW5A 4B5NA 1B0IA 3P14A 4D6GA 4FXJA 4MTVA 4KS0A 1AQ0A 2H90A 3B0XA 3GO2A 3W7HA 1Z32X 3OVQA 3UJFA 4ZSTA 4QTGA 2W61A 3HBLA 3TN6A 1JYNA 1JNEA 1Q2SA 4MJZA 3AZTA 1EGVA 4L9YA 4I7VA 1A0DA 1QWGA 4BF7A 2ZUSA 1Z41A 3APTA 5CBIA 2RGLA 2P3ZA 2FZDA 3IS4A 3M1ZA 4G2DA 3U4FA 4IQJA 1V4YA 3TTEA 3L68A 1RQEA 2JF7A 2E6DA 1E73M 1GKPA 1VPXA 1GQKA 3AS0A 1WUEA 4KCTA 2QAFA 3VNLA 4B5TA 3F4NA 1B3XA 3AS3A 1GOKA 4C6OA 2IXUA 4HK7A 4TQTA 3G77A 1QU4A 3PSVA 4XVDA 2OZ0A 2OYLA 3QTGA 1Q6GA 1BG9A 3G22A 1YNQA 1W5QA 1SFSA 4A29A 4ZL1A 1FWSA 2W62A 4HNCA 5GJNA 3N2CA 2OQYA 3KVKA 1E71M 5HMEA 4LW7A 3IVTA 5LA0A 2PUZA 1E6XM 3VNYA 3VGGA 2J25A 3EA2A 3TFXA 2W9MA 3APYA 2R94A 1OC7A 3BARA 4HKPA 1B4EA 4PFHA 3GNNA 4UIOA 5DY2A 2WC7A 3T78A 2DDXA 3TOYA 3R1ZA 3B0YA 5E1QA 4C7DA 5JXQA 4LY8A 4ROPA 1SSGA 1K8CA 1UD6A 2DEPA 3SSZA 3CEPA 3TSBA 5FA5A 2DPEA 2XJ7A 3EPNA 2YL6A 4AMAA 4O1AA 3MSDA 3ZWSA 1R9XA 5GQBA 4Q8QA 2ZTJA 1R3SA 4LWWA 1EA0A 2V2CA 3BANA 3EMZA 5BXPA 4MJMA 3UZYA 4LXFA 4NASA 1E56A 4BQ2A 4W86A 3E96A 3PZOA 4TV5A 4AFYA 4DZIA 1E15A 1HJUA 2WC3A 5RUBA 3LZ5A 2ZZ3A 4HNNA 1K4GA 2QCDB 1EBHA 1XX1A 1KM0A 1C8YA 1EHAA 5KEZA 5LA1A 2EBNA 2DSVA 1JCYA 3G0UA 2HISA 1XLGA 1NFPA 1JPDX 4NAFB 4E8GA 3QEZA 1XR2A 3LXBA 4PUNA 3OVGA 4RNJA 1JJKA 3UFYA 1KBJA 1XPYA 4QEHA 3H70A 4ZA0A 1AUSL 3B40A 4XSMA 3DFNA 1P6BA 4CU7A 1FWHC 4MWAA 3BAWA 1HZYA 1HL8A 3WLNA 1I0DA 3CZJA 4DF0A 3LI1A 2H9AA 5ECVA 3EKLA 3LHVA 4MYXA 4O50A 3UGRA 2BSLA 2ZX6A 4DBWA 4FMVA 1KXVA 2PDGA 2NQ9A 3OBAA 2Y70A 1XYBA 1RZMA 2DZWA 4H4IA 3MMUA 2AAAA 2DZPA 3UF9A 5LSMA 4O1FA 3M9YA 1HL2A 2XZ7A 3FYPA 2ZOXA 1FWAC 4WR3A 1DYSA 2Y61A 4QE1A