4Q33A

Crystal structure of inosine 5'-monophosphate dehydrogenase from clostridium perfringens complexed with imp and a110
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
357
structure length
344
Chain Sequence
MARILKTAYTFDDVLLVPNKSEVLPNEVSLKTQLTKKIQLNIPLMSASMDTVTESKMAIAMAREGGIGIIHKNMTIEDQAREVDRVKRSGGLLCGASIGVTNDMMERVDAVVKAKVDVIVLDTAHGHSKGVIEGVKRIKAKYPELQVIAGNIATPEAVRDLAEAGADCVKVGIGPGSICTTRIVAGVGVPQLTAVMDCAEEGKKLGIPVIADGGLKYSGDIVKALAAGACAAMMGSIFAGCEEAPGAIEIYQGRSYKVYRGMGSLGAMAKFVPEGVEGRIAYKGHLADTIYQLIGGIKSGMGYLGAPTLENLYENANFVVQTSAGFRESHPHDINITKEAPNYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Inosine 5'-monophosphate Dehydrogenase from Clostridium perfringens Complexed with IMP and A110
rcsb
source organism Clostridium perfringens
molecule tags Oxidoreductase
molecule keywords Inosine-5'-monophosphate dehydrogenase
total genus 102
structure length 344
sequence length 357
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4q33A00
1K8ZA 2CZ5A 4DBDA 4EWND 1OFRA 1JCNA 3NQ7A 3RFAA 3TX9A 1H7RA 3PG8A 2GOUA 3M16A 3NPVA 5K2ZA 4E0CA 1LLZA 1YDOA 1I2OA 4IPIA 2Z6IA 4NZJA 3QF0A 4AB4A 1OABA 2Y70A 3LRLA 4HSOA 2R94A 1KFCA 3DGRA 3N34A 5CG7A 2X1RA 4O50A 4PL2A 2C14A 5EY5A 3W71A 1PIIA 4MYXA 3Q2DA 3W1AA 1XDMA 3R2GA 4C1KA 1H1YA 3W74A 3S5NA 1K3UA 3EXTA 4GUIA 2OCZA 1YXDA 3LTPA 1FX6A 3MP5A 3FLUA 3M0ZA 1RD5A 3NEVA 4AHPA 1DHPA 4HNNA 4A2SA 1FCUA 2ZA2A 2X1SA 1T99A 1TTIA 4O12A 2J9XA 4IMDA 1QOPA 3HPZA 5E0KA 5K9XA 2QF7A 3BW3A 1KM1A 1TV8A 2RHGA 3DFPA 5D2VA 2V2HA 3IIPA 4XQ6A 2VEPA 1A5BA 3UPBA 2QCFA 2UV8G 1GYLA 1W5MA 1NAL1 3ELFA 3HGOA 1YYAA 4K37A 4IUOA 2P0OA 3KRUA 3CEPA 1SQ7A 3OBKA 2H3BA 4DO6A 3M1ZA 1I2PA 4CNNA 5LZLA 5I3IA 3H53A 4UMCA 1AW5A 2NUXA 3EWUA 3VE7A 3GKFA 3SGUA 3FYOA 3MYOA 4K7VA 2I1OA 2XN1A 3OA3A 2O7QA 3P8JA 1Q45A 1U5JA 2ISVA 3KRSA 1I4NA 2XN2A 4LS0A 1GG1A 3W88A 4NJHA 4N02A 2ZYFA 4K7YA 5F2GA 5D2WA 5KSWA 3W83A 3NR0A 1IXQA 4MJZA 3M44A 1WBJA 1WV2A 5LHFA 3P84A 4WJEA 2PRLA 1VPXA 1PV8A 1ML1A 3UD6A 4O1CA 3TXZA 2ZRVA 3WJZA 3W7QA 1JQXA 2YW3A 4LS1A 5LSMA 4DXVA 4IMGA 2RH9A 4AMAA 3GXTA 1JCJA 1GVFA 1QPOA 4Y6GA 1N7KA 5FI8A 1XBXA 1EP3A 2JKAA 3IIOA 4FX8A 3ABSA 3DHFA 3QMTA 2V2CA 1RQHA 3PM6A 3T55A 2FPTA 4H4IA 5DY3A 4WX2A 3W1UA 2QCNA 5CKSA 4QSHA 1H7XA 1O5XA 4IJBA 3TUUA 1JCXA 3NL5A 3NPXA 4MUZA 2E1DA 4JYEA 4FNUA 1OFPA 1OX5A 4LT9A 1GOXA 3GYEA 3L2IA 2PRHA 1AL8A 3TC6A 4GC4A 3VNDA 5A8GA 2DP3A 3N19B 5C6MA 4RJEA 3W7EA 1ICPA 4LC6A 1TJPA 2CZEA 3O06A 3GDKA 1H61A 2Y6ZA 2Q8LA 3CPRA 1OJXA 3ABQA 3S5ZA 3SR7A 1W54A 2ZTJA 3BO9A 2GVJA 3P61A 3TR2A 4ZZ9A 3E0IA 1Z44A 1OFEA 1TV7A 3E96A 5G2IA 1X1OA 2V5BA 1H5YA 3TQ0A 4YCPA 4TR9A 3NXFA 5SWUA 1MSSA 1DQWA 4WZHA 2DZXA 1NF7A 4LW7A 5D09A 1XBYA 2J24A 3H55A 5F4WA 4R53A 3TK7A 4QIUA 3G1XA 2WV8A 3NZRA 4MJMA 4JTJA 2C15A 3WJWA 3TROA 1G4EA 1KFEA 4HIBA 2AAMA 1OFBA 3TE9A 2V30A 4MZYA 4O11A 3WK0A 3MI6A 3ABOA 4CCCA 4O4VA 2DORA 3B0PA 3UWZA 2OX1A 8TIMA 5E93A 5AN7A 2GVLA 3NL6A 2EKCA 2VENA 3G24A 1J2WA 4JTLA 4MFDA 4JTEA 2TRSA 2YXGA 5C2XA 4ML9A 1TREA 4JICA 2A7PA 3HPSA 5HUOA 4LUJA 4IXHA 4PA8A 4LC8A 2KZHA 4LRSA 1W8SA 5CPNA 1PE1A 2FPYA 3NQVA 1C9DA 1PHWA 1ZNNA 3S1WA 4ZQCA 1VLWA 5TIMA 5GVJA 1H60A 2ZZ2A 3DFQA 3G0SA 3LTYA 4NX0A 2DZPA 2C1HA 2YR1A 1Q6QA 1RQEA 3W2NA 1S5VA 3CM4A 2EPHA 5MHBA 1KTBA 3FKKA 1GVQA 2E6FA 3M43A 4DO5A 3FJLA 3PF3A 2ATSA 3IVSA 3N2XA 3G0XA 3LHUA 2GQ9A 1D3HA 4O4WA 4AWUA 4LY8A 3V1PA 3DI0A 4NQ1A 2ZZ3A 5DN1A 3M5VA 1EPXA 2ZDRA 1KFLA 1Z42A 3NQ6A 1TTJA 4JN6A 3S8HA 1JJKA 4PCFA 1TPUA 2ZRWA 5EPDA 5U7SA 3KX6A 3BLIA 1F76A 4JTUA 3VFLA 3WK3A 2E09A 1I2QA 4RXGA 1YDVA 3EXRA 1SW7A 5G2WA 2A85A 4DF1A 3UYCA 1G67A 3THAA 4HHPA 2NX1A 3B04A 1SZEA 1I2RA 4LV9A 2FIQA 3G8EA 2DU2A 1O5KA 4O52A 1NVMA 1OF6A 3LCLA 1LYXA 3RF9A 3INPA 3DFOA 3TSBA 1IIHA 3LOTA 1SSGA 3LBMA 3PUEA 3UWYA 2A1YA 1EWEA 4PFMA 2BSLA 2RDUA 3O1NA 2Y61A 1LBMA 1VH7A 4ADTA 4UUIA 4Z08A 2HMCA 3CB8A 5DLCA 3BARA 3LX9A 4M6QA 5AC6A 3EEGA 1FCQA 5AHLA 2RDWA 3W7DA 3QM3A 1MEHA 5FEZA 2C13A 3GZ3A 3SY5A 1QMLA 2R14A 3KVLA 1QCWA 1WQ5A 1F5ZA 1H62A 3HMJG 2V8ZA 3C56A 3W22A 2ATMA 1S5TA 1PHQA 1JR1A 1ME7A 3LHZA 4MYAA 2OT0A 1KFJA 1XBZA 3CLMA 3GIYA 3O07A 3NNTA 4GUHA 3EKZA 4GUGA 3PC0A 4IMCA 1B3OA 3NQ2A 4JIQA 4JDBA 5F1UA 3DENA 3TW7A 3U6WA 2HSAA 1VQTA 1Z48A 4LTSA 1YXCA 4KWVA 4Y96A 3MHFA 5KMYA 1TQXA 3G18A 3DKLA 4O54A 1T96A 3EX6A 5LGXA 4HKPA 5DBUA 5H91A 3WK1A 4UXDA 1HTIA 1F2JA 2VOMA 2ZA1A 3W84A 6TIMA 1YTEA 3C2RA 3UWWA 3FOKA 4MIMA 1YTDA 4IX2A 1O95A 4FNSA 1A50A 1GVRA 3N3MA 1GQNA 4YLWA 3NQFA 4FXRA 2D73A 3LCHA 4RCXA 4NNCA 5K4ZA 4FHAA 4K8EA 2V82A 1ZY9A 3DAQA 1K7FA 3A5FA 4K8HA 4MZ1A 4LRTA 1EP2A 3CTLA 2V2DA 1PCKA 3NVTA 1SSDA 4JTSA 2Y63A 1B9BA 4NT0A 4DO4A 3SI9A 4XZ9A 1VYPX 5BW6A 1JCMP 3N2MA 2Z6JA 3LCFA 3NQDA 1ZAIA 2ALDA 3U8GA 3QSTA 1VGAA 4X22A 4O0ZA 2WSYA 2WO5A 3C4UA 3TXVA 1XFBA 2ZTKA 4TU1A 4TO8A 5AC8A 5TQLA 3MBDA 1JUKA 1EWDA 3NG3A 3BGJA 4MVAA 4N6FA 5G5IA 3U2OA 1BWKA 4GXMA 3O6YX 3W7CA 2J6XA 1SW0A 3W7OA 4DF2A 3O6DA 1TPB1 3W1NA 1V5XA 2GVGA 1V7YA 4RLIA 1W5QA 4O1AA 2QDHA 1DKWA 4NX5A 1CW2A 4IPJA 1SO4A 1VYRA 1ZHAA 4QITA 2Z1BA 3VCRA 5AHIA 5KZMA 3G0UA 3OHIA 3STCA 4TX9A 3CWOX 3MJYA 4I9AA 1M7OA 3NOEA 2ZFAA 5D37A 5LNVA 4JYFA 3B0UX 2X16A 1SW3A 1KLZA 3PULA 4UR8A 2A7NA 3QFEA 2BLEA 4FNTA 3W3OA 1JCLA 3HQ1A 3QH2A 3F4NA 4GFSA 1DJNA 3W7NA 4H6KA 1CI1A 4NNAA 1FY6A 2Y7FA 3B8DA 1S3HA 3G1FA 3LXAA 5CPLA 5FEXA 1ADOA 4IMEA 3ATYA 3DXIA 2QJGA 5KZEA 2FFCA 4D2JA 1TPEA 3I68A 5AHEA 5D32A 1P0KA 1VCFA 5HQEA 4EVZA 2CLLA 2CLOA 3IVUA 2BXVA 3FJ6A 4O53A 4MY9A 3UY7A 3HO8A 5F2LA 4N9BA 4O14A 2F7FA 1GT8A 1G4SA 1YPIA 3G22A 2JK2A 4HSNA 1QPNA 1NEYA 5AYZA 4Z1DA 5K4XA 3IIXA 3WJYA 1XC4A 1VLIA 1JUEA 3L5LA 3OEXA 4JS3A 1IXNA 1TRIA 4E2BA 3E12A 3LLFA 4QQ3A 4NNBA 5I3GA 2QCHA 3F1QA 4JD4A 2VKZG 4UFIA 5KTLA 2OMAA 3PY2A 1LRTA 4UTUA 3OG3A 4O18A 2YW4A 3IIVA 2WQPA 3GVGA 5DCBA 3GKAA 4UC5A 3F4WA 4UFHA 1TQJA 1KM0A 3BV4A 3KVKA 2C19A 1EP1A 5F4XA 3BLFA 3R12A 4UFKA 2BWGA 1YXYA 2LLEA 1G7UA 2ZZ4A 1SZNA 2ZZ6A 2VEIA 1IIGA 3RU6A 2FDSA 3A24A 7TIMA 3V75A 5G2HA 3P80A 1UUOA 4WY0F 3MHUA 1EEPA 4NJJA 1HUVA 4I7UA 1GJPA 2P10A 3LDVA 1W1ZA 1WBHA 1WX0A 4O57A 1KM5A 4DPQA 4OHQA 2R91A 2DJXA 1JRCA 1IXOA 4JYDA 4UFJA 1KLYA 1TPDA 3G1YA 3NDOA 2Y88A 3NAVA 3GB6A 3CQ0A 3LRMA 2HTMA 1F05A 4ICNA 5FF0A 4O1BA 4XWUA 5I3JA 5CSSA 2H8ZA 4HPXA 3GK0A 1YPFA 5I3FA 1G4PA 2YGYA 3BVJA 1LRQA 1Q6OA 5CZSA 3TSDA 3NQMA 3EKLA 4P2VA 6ALDA 3QC3A 4N6EA 4GRSA 1TMHA 3W1PA 3GNNA 3PUOA 3W07A 4XKYB 5AFDA 3BK0A 1FXPA 2JBMA 1HO4A 4UTIA 3CC1A 3C3NA 2TPSA 4UNKA 1W0MA 4Y9AA 1QWGA 5IM51 1W3NA 3IVTA 3N9RA 4ORIA 2A6NA 1A5AA 2QAPA 3MW7A 3NM3A 4S1FA 5G4EA 3S0CA 4R7JA 1YADA 3MHGA 5FF7A 5HUPA 3QMSA 5AYYA 4JTGA 2E5BA 4OGZA 1RPXA 2PCQA 1LOLA 4ZVJA 3W2UA 2FB3A 4G1KA 4K6AA 5I3KA 3TSMA 2CZDA 1ZENA 3B06A 4O19A 2ZZ1A 3GXNA 1QPQA 5CZTA 2R8WA 3KHJA 1W5PA 1VC4A 1BKSA 2NXGA 2QR6A 5HULA 4Q4KA 4FNQA 2QJIA 3KVJA 1F6KA 1M5WA 4EOUA 3LB0A 3AO0A 1TJRA 1FDJA 1OFDA 3W72A 1TSIA 4OV9A 4AAJA 3CU2A 4UR7A 1R2TA 1W37A 3Q58A 3MUXA 4JTHA 4NJGA 5L6UA 5LGZA 1KV8A 1C29A 4EF9A 3DKJA 1QPRA 3HJZA 3HPXA 4DF0A 1G7VA 3W23A 1R2SA 2YFNA 5FESA 4OBTA 3R89A 3RMJA 4L4LA 2B7OA 1Q6LA 1GYNA 5DY2A 3T78A 5KZDA 3P62A 2YPIA 3W76A 5D04C 4CQ8A 1P0NA 4UMBA 5FEPA 4OT7A 4IOTA 2B0MA 3ZFHA 3LHWA 3LI1A 1R2RA 4IGHA 4HPJA 4LWWA 3M41A 2GQ8A 3MBFA 4O17A 3ZWTA 1PL9A 4HNUA 3GNDA 2VC6A 1H63A 3W7HA 1ONRA 2QCDB 3A21A 4LV4A 3LCGA 4JDYA 4UNLA 4JTKA 3UQNA 3IGSA 1QR7A 2C0AA 1OG0A 3HIJA 3DHDA 1L6YA 2W79A 2B7PA 2TYSA 3NQAA 1Q6RA 2V0TA 3EWWA 4Y90A 2J27A 2NXIA 2DZSA 1KM6A 3W1MA 1X8FA 1FCVA 1EIXA 3G8RA 3GX9A 1L2UA 2J9YA 4CCEA 4UTWC 4ONVA 1AW1A 1DVJA 4MY1A 3DFNA 3W75A 1KV5A 3LERA 5DELA 2GPTA 3FA5A 2W0UA 2IQTA 2I9EA 4DPPA 3GDTA 1VJIA 3KFTA 1ZALA 1H7WA 2WKJA 2CLMA 2Y7GA 4R33A 2EF9A 2VXNA 1FUYA 5BMWA 4ZQOA 1LORA 1UCWA 1GVOA 3W7RA 3GR8A 5AYXA 2RKXA 4E2DA 1S5WA 3G1SA 4N9EA 1SU5A 4AHQA 4BWLC 5K9CA 2B7NA 2XN0A 1QO2A 4MKNA 3B0VC 4IMFA 3E9AA 4NJKA 2FTPA 1M6JA 1K7EA 3GDRA 1LZOA 5I3HA 4YL2A 2Q8ZA 1RZMA 3S1UA 2ZZ5A 3W1QA 2QEZA 2WPBA 3TQVA 1DOSA 4UTMA 2QJHA 2QCDA 5BMXA 3S9YA 4N9DA 1H7NA 1EUNA 4A29A 3HG4A 3KVMA 3VE9A 4M7TA 2FQIA 1D9EA 1F7BA 4NUWA 2YZRA 3TJXA 1C8VA 3HBLA 1TPWA 2X2GA 3LCWA 3M47A 1W56A 1G4TA 3THQA 1DBTA 3C2FA 3I7SA 2CWNA 1KFBA 1FWTA 4LNYA 1TPH1 3GXPA 3P74A 3W2LA 4PTNA 4WUIA 3HF3A 1FCBA 5D30A 2QCMA 2YCEA 2ZQ0A 3UZJA 5LNUA 5HR6A 3DBPA 1XI3A 1B4EA 3LHTA 2A4AA 3M5ZA 3NPWA 1TTQA 2B7QA 5C55A 4RX0A 4CNPA 4JXCA 1OF8A 1ALDA 4I7WA 1J4EA 1GZGA 4P61A 5KINA 1G69A 2ZRYA 3ABRA 1A53A 3BPWA 2DZVA 4IXXA 4JTFA 4NJIA 2CLIA 3C6CA 4IX0A 3STEA 1KM4A 3EX3A 1SZFA 3LV5A 1LLWA 1IGSA 3MYPA 4NZFA 1OK6A 3EWXA 1B4KA 1QFEA 4J9JA 1DORA 1WAUA 5F4SA 3W9ZA 3UPWA 2WNQA 3NPUA 4A3UA 3T7VA 1O4UA 5G1YA 3W7LA 1Y0EA 1OK4A 4IWWA 4O1DA 3W7PA 3N73A 2ABBA 2FJKA 1D3GA 5FF3A 3MWAA 3P82A 4IQLA 1I2NA 4RR4A 5IBXA 5FEWA 5AHFA 3WJXA 3ZS4A 3TQKA 2TSYA 5BOOA 1M7PA 1YDNA 2QUTA 1X6UA 3FS2A 2NWRA 3NGJA 4FO4A 3BG9A 1K8XA 3BLEA 2W6RA 1TPVA 4NVTA 4GUFA 2NWSA 1IXPA 1TRDA 1EB3A 1BTMA 1GVSA 1BEUA 3GAYA 4ORMA 1N55A 4UTJA 3LCXA 4MZ8A 4LU0A 3SSJA 4AWSA 3TMQA 4FNRA 4KFOA 3A23A 2DZTA 4EIVA 1F73A 4CQAA 3HGJA 4Z1CA 1NSJA 1T8XA 1TCDA 2B4GA 3LTSA 4CCDA 4M6VA 2V5LA 3LXBA 2C18A 1UJPA 3D0CA 3BGGA 4C1LA 4DQWA 1GG0A 1QNVA 3W7JA 1JVNA 3O16A 1OVDA 1RVGA 2E6AA 1A5SA 2CFFA 3DFSA 4MY8A 2AGKA 5CGQA 4TMCA 3O8AA 2YX0A 3IIZA 4WXZA 3SECA 4QNEA 3HG3A 4RK8A 1ICSA 1FQ0A 3NQ8A 4ZMGA 4RKAA 3O6CA 4BI5A 4GWEA 4KWWA 1TTPA 5LNSA 4PEKA 3FEMA 3QJAA 3PVFA 4JGDA 1G6CA 2TMDA 2QKFA 2V9DA 5D05A 3VI2A 3I7RA 5HWJA 3DFTA 3L5MA 4GUJA 1W31A 1RQBA 4LS2A 3S5OA 3TFXA 1TPC1 1EUAA 1ZFJA 4BI7A 1LOSA 5K9DA 3SJ3A 3HB9A 3BW4A 3TAOA 3W7IA 4UTKA 1JCYA 1MZHA 2DZUA 3NQCA 4ZQRA 2VFDA 1TPFA 3QW3A 2VFGA 3W1XA 1VR6A 2VEKA 4JY8A 4X3ZA 4ZQNA 2EGZA 1TIMA 4JTIA 1AMKA 4XTIA 3EB2A 3W1TA 4QAIA 3PG9A 3I6RA 2Y7EA 2ZA3A 4JR5A 2EAWA 3W70A 5CZJA 1RR2A 2CLFA 1THFD 2FB2A 3A9IA 2VEMA 4BR1A 3LXCA 3T44A 2QUUA 2Y85A 1LROA 5J5DA 3TMLA 5K7JA 1QAPA 4POCA 4MLJA 4XKYA 4N4QA 3TC7A 3UWUA 2JKEA 4M7SA 1I45A 3MI2A 3QQ1A 5C5YA 2QUVA 3USBA 3C0JA 1GEQA 3OVQA 3L0GA 5HWMA 1EX5A 4MFEA 2BTMA 3R5EA 1B57A 1UBSA 1WA3A 3QYQA 4JNMA 1VCGA 3KAOA 1GWJA 2DZWA 3TNOA 4AF0A 5DBTA 3K30A 1MEWA 1KA9F 4XBSA 4B5NA 4FB7A 4UFMA 4L4MA 3QPYA 5EL1A 4Z0SA 3CEUA 5AC7A 1LM1A 4NU7A 2E5CA 3UXAA 1QO5A 1XUUA 3TDFA 3TAKA 3QW4B 4UFLA 1KTNA 3W7GA 3OIXA 4HNTA 4A21A 4AWTA 3CIWA 3ZR4A 4JX6A 4QISA 1NF0A 3QQ0A 3YPIA 1P4CA 2G96A 3E49A 1F6PA 2FLIA 4WQ6A 3CHVA 3TIMA 3NA8A 2H90A 2CU0A 5F2MA 3I65A 3IRDA 3O15A 1VS1A 4XBKA 1LDCA 4XUGA 1KFKA 3L65A 2CW6A 3NZ1A 5CSRA 1XUZA 4RZ5A 4HT3A 1LTDA 2JGQA 3P5ZA 3W6YA 1WYIA 3TCEA 3C2OA 5AHMA 4UTTA 3PAJA 1XCFA 3VKJA 2AQWA 4KFNA 4MPQA 2OT1A 3SGZA 1X1ZA 3NL3A 1VCVA 5DXXA 2PRMA 3CIXA 2NX3A 2VFHA 4RZ4A 3LBCA 3I7QA 5EKYA 1GPWA 2O7SA 4O10A 1MO0A 3GAKA 1PCWA 3JRKA 1DJQA 2XFWA 2GJLA 3QMRA 4GBUA 4ADUA 2G97A 4JX4A 5U4NA 3A5VA 4UIOA 1AL7A 1H51A 3TA6A 3P67A 3W87A 2Z0IA 2Y7DA 1HO1A 1SUXA 3NYZA 5DCEA 2P1FA 1ZAJA 5LHEA 2G95A 2WNZA 2PE4A 3G1DA 5IBXC 1WOBA 1XKYA 4RXFA 3FFSA 1YTKA 1NFBA 1ZCOA 1ME8A 2H8XA 4RZ6A 1GTHA 4U28A 4GE8A 1OX4B 1SFLA 3NL2A 4FF7A 2E6YA 2A0NA 4U4MA 4WY0B 3A22A 2J9ZA 2BX7A 4K39A 1OFQA 3WFAA 2I14A 3DI1A 2C3ZA 4AH7A 1X7FA 1TYGA 1R47A 1OYBA 5D38A 1DV7A 5G4WA 5D02A 4RV8A 4JEQA 4HNVA 4QNWA 3WK2A 2E5DA 2QDGA 4WD0A 4UTLA 1UUMA 1H1ZA 4OWGA 3UY8A 1W3TA 3GR7A 1T0OA 3MP4A 3LGEA 1AK5A 2GQAA 3LCIA 1PS9A 1K8YA 3PSWA 1A5CA 1HFBA 1W3IA 4Q32A 3S1VA 4N2YA 2C6QA 2QCLA 4JTTA 5LNRA 1FWWA 3JS3A 3LHYA 2GJNA 3EXSA 3PUDA 4I7VA 4Z0JA 1XBVA 3SW6A 2JGYA 3C8FA 2Y62A 5TBOA 2CZFA 1XXXA 1SZGA 1KTCA 1Q3NA 3AJXA 4M6PA 2EHHA 4BF9A 3KRZA 3SZ8A 1O60A 1H50A 4GJ1A 4ZQMA 3G1VA 4FXSA 1OX6A 3P81A 1SO5A 3TW6A 3B03A 1OX4A 1WOAA 4OV4A 3PBVA 3W86A 5LNWA 2YSWA 3S1XA 3NO5A 4WOQA 2NX9A 3PBYA 1MXSA 2E77A 4KKXA 2WNNA 1E51A 2H6RA 2NV1A 1JQVA 5EA9A 4YWIA 3W2MA 2JKPA 3S5YA 1VHNA 4WXYA 4JY9A 1JULA 3WJSA 3LLDA 2QCEA 5F1VA 4X9SA 3UWVA 4AEOA 4UTTC 4R34A 4AXKA 4K38A 1TB3A 1KBIA 3LRKA 1Z41A 3HGSA 4O28A 1U83A 3MP3A 3L9CA 3IGXA 2CLEA 5HNRA 3M5YA 4BFAA 4DELA 4LVBA 2VFIA 2RDTA 1XL9A 1L6SA 3G3DA 4K36A 2ZRUA 2H3DA 4LVAA 1CX9A 4TIMA 4QJ1A 1WXJA 3W1LA 3GDLA 2Y89A 2WSQA 3ANYA 4CQ9A 4KFPA 2A5HA 4EF8A 3TH6A 4YMZA 2A21A 2NV2A 3EX1A 3STGA 2A7RA 4ZQPA 3W85A 3PBWA 3OVPA 1DQXA 4OE7A 1W5NA 4O0KA 1FXQA 1YLVA 4UTWA 3FIGA 2YYUA 3B4UA 3M5XA 5BRBA 1VZWA 3M7WA 3UWQA 5T26A 4W9TA 2GUUA 4OU1A 5E1QA 5CPMA 1HL2A 4TMBA 1FBAA 1P1XA 4WOZA 1EA0A 2ZRZA 4UCGA 4FIQA 4A2RA 3OVRA 5EBUA 1FWSA 4Z1BA 1J5TA 4LVGA 2E68A 3W7KA 4XTDA 1LRNA 3T4CA 4DBEA 3W1RA 2RFGA 3SIZA 3TJLA 5LKYA 3S6DA 1OHLA 3H54A 3BW2A 3QZEA 2V81A 2ISWA 5D03A 1TO3A 2NXHA 5HR7A 1ZAHA 3TV8A 2FPVA 4ADSA 3SFKA 4PL1A 4Y8FA 5F2IA 1KM3A 1DL3A 4LUIA 2OZ0A 2NZLA 3M6YA 2E6DA 5K3VA 3W7MA 2J88A 1SPQA 3MI3A 3QRHA 4FNPA 4JIPA 4LVFA 3LHVA 5HMSA 4PH6A 3L67A 1QDSA 4NXKA 2WJZA 5DCDA 3TU9A 5AB3A 4X2RA 3EWBX 1LCOA 3W73A 1SO6A 3P8IA 1UB3A 3LM7A 3FYPA 3IGUA 2DJLA 2ZRXA 5BNKA 3S42A 4LVDA 1L6WA 5D2XA 2ZZ7A 5D33A 3MO7A 4FIRA 1UASA 3NQGA 3IV3A 3L66A 1VRDA 3L0NA 2C16A 4WY0A 3G3MA 1H7PA 4CLMA 4YXGA 3C2EA 5H2ZA 1FDYA 3DZ1A 4A22A 2NLIA 1P5BA 3ZWSA 1K03A 2A6LA 3T40A 3Q94A 3UXDA 4OQVA 1KW1A 1XM3A 2WOQA 1ZJIA 3PBUA 1BWLA 1K7XA 3G1HA 3NQEA 1R30A 1VYSX 2HS8A 3L21A 2NUWA 1MEIA 4FX7A 5ABTA 4YCOA 5EMUA 2Z2UA 3GDMA 2VFEA 3PR2A 4E38A 2ABAA 3O05A 5FF2A 3L68A 4CNOA 4UTHA 1VHCA 1LBFA 2VFFA 3KOFA 4AF0B 4H3DA 1N8FA 3M9YA 3MMTA 5HINA 4NXSA 5J5RA 5EYWA 3G1AA 3P7YA 1JRBA 4ALDA 3E02A 2X30A 3DU0A 4MLRA 3STFA 2X1TA 1OFAA 2OJPA 3P5YA 4ZL1A 4HN4A 3EX4A 3B05A 3NM1A 4M19A 4BWLA 3Q37A 3PS7A 5D2TA 3HG2A 3CT7A 4MOZA 2CLKA 3HGRA 1SO3A 3W2JA 3O63A 4N9CA 3JR2A 3BG5A 3RK8A 5KITA 2G5WA 3DH7A 1L9WA 4FX6M 2PURA 3PWAA 3QSRA 3C61A 4O13A 4M5PA 3EWYA 1ME9A 3RLVA 1K02A 2NUYA 2ZBTA 5A5WA 4Q33A 1O94A 1SR9A 4O8RA 1AW2A 4FEZA 3UNDA 2F84A 5AOUA 3TKFA 3EX2A 3C2VA 1LP6A 3HG5A 3ATZA 5AHNA 2YFOA 1KBJA 3GLCA 4S2CA 4BK9A 2VELA 3N14A 5L9FA 1OYCA 1FWRA 1FDZA 1IF2A 4Z1AA 1TV5A 3BG3A 2BZNA 1WDWA 3QEZA 3LI0A 4LOCA 3W2KA 2A2IA 3R13A 2ZCGA 3PB2A 4AHOA 1XDLA 3KXQA 3LV6A 1ICQA 2X1UA 2YDAA 3IEBA 4N4PA 1AG1O 5DXYA 1FWNA 3R8RA 2QCCA 1JUBA 1W5OA 4AVFA 3HOJA 2Q3RA 4GNJA 1RV8A 3P60A 5CPOA 4UMAA 1OFOA 3CWNA 3FKRA 4PODA 3F03K 2PC4A 2WSRA 3PSVA 3N9SA 2YYTA 2ISSA 2CLHA 4O15A 5HWNA 1LBLA 1GTEA 1HG3A 1QOQA 1SFJA 4BI6A 5C54A 1LOQA 1OYAA 3EWZA 5CZ0A 4PC8A 3L5AA 1F74A 3PB0A 4S2BA 4O16A 3TFCA 5FF4A 3RLUA 3QPZA 1I8JA 1KM2A 1R46A 3L0KA 3RNDA 2QAFA 3UZ5A 2HS6A 5G1TA 4JX5A 4QM1A 3C52A 5D2YA 1H7OA 2QCGA 5HJLA 2Q3OA 4DEFA 1PVNA
chains in the Genus database with same CATH superfamily
4L1GA 3AYTA 3FDGA 1GGOA 4EANA 3RFAA 3TX9A 2FVMA 4QG9A 2PDPA 3F2CA 4XZIA 4G7FA 3PG8A 2GOUA 3VXGA 4DZIA 3NPVA 2PDQA 4E0CA 1AFSA 2E4TA 1J0JA 4FOKA 3Q65A 3VIOA 2QLYA 5GNXA 4NZJA 4L6OA 3WNNA 3KS5A 8RUCA 4JQ1A 4HNLA 1KFCA 3ENLA 3N34A 1NH6A 1W3HA 3WZ0E 4C1KA 3OYZA 3W74A 5GJPA 3VM5A 3EXTA 3PJUA 4GUIA 1E6NA 2OCZA 1FX6A 2V6AA 5ABFA 2WZMA 1B30A 3WENA 4Z2IA 3BMXA 2F6XA 2OZ3A 1DWAM 1FCUA 3CL8A 3MCMA 3F2BA 2ZA2A 2XDFA 2X1SA 2V3GA 2OSXA 1V7AA 1JXJA 1UH4A 4RDZA 4WHBA 1PEZA 2VJXA 1VIWA 1FVPA 3T2PA 3OZYA 4GX9A 2V2HA 3VNYA 1TV2A 2PWDA 3GNRA 3T8QA 2QCFA 4GYFA 2BXZA 2HNHA 2UV8G 4YPJA 1W5MA 1B3YA 4K37A 1XPGA 3OBKA 1QASA 3IUHA 1G0CA 1XG3A 4HOXA 1X6NA 2CNCA 2E0PA 4CNNA 3VGHA 4UMCA 3H2OA 3GKFA 3N12A 3D3AA 3CV7A 2O7QA 5HNUA 4JN7A 2OYLA 3L4YA 1O7AA 2ZYFA 4K7YA 1OQFA 2DEPA 4WLCA 3NR0A 1JYXA 3AALA 1W1YA 4KETA 4WJEA 3OBEA 4Z2JA 3VKCA 4OBSA 1ML1A 3KL3A 2XH2A 2PLMA 3UD6A 1XYBA 2DW7A 4O1CA 3W7QA 1NP2A 1S3TC 2YW3A 4AMAA 1JCJA 2WZHA 4L4OA 4Y6GA 5FI8A 1HP5A 4FX8A 5C70A 2G37A 3ABSA 3QMTA 2R82A 4DWDA 4E6MA 1RQHA 2PDHA 2FPTA 4MNMA 4H4IA 5DY3A 3TONA 4LB3A 4H7VA 1HL9A 4PMNA 4PYSA 1EA9C 3WLTA 3UR7A 4HJFA 3WLIA 5RUBA 4R7OA 4PULA 4U3AA 1SJDA 3U7BA 4RJEA 4DWSB 3W7EA 4LC6A 1TJPA 5EMMA 1WKEA 1X8CA 1A0CA 4WGHA 3CIVA 3CPRA 3H21A 3SR7A 2ZTJA 3KBVA 1Z44A 3UYIA 4AY1A 3VIJA 3E96A 3TQ0A 3FK4A 4Z2LA 4JHOA 3NXFA 4DJFC 2EEXA 1CGVA 3VO0A 1R8LA 2UY4A 1UZHA 5D09A 2J24A 4ZE5A 4R7WA 4R53A 5F4WA 5CGTA 1YRRA 2WV8A 4MJMA 4WVXA 1F8MA 1Q6CA 1V6WA 3WK0A 1XX1A 1KXHA 5AZ1A 4H6RA 3KBWA 4CNTA 2XFRA 5A8PA 2CETA 2EKCA 4P8VA 3NWRA 4HA3A 4BJHA 1S2TA 4F0HA 2P76A 1M3UA 1PWLA 5BOFA 1CWYA 1W8SA 2A3HA 3ONBA 1C9DA 1KRBC 1MXGA 1PHWA 4J3ZA 1IZKA 3S1WA 2J66A 1VLWA 3OO2A 5TIMA 2GSEA 5GVJA 1H60A 3QGVA 1RD6A 2XFYA 3UF9A 3WH7A 1Q65A 2DZPA 3DEQA 3HN3A 1S1PA 1UKQA 4GJJA 1NOWA 3AWNA 1HKMA 4OZOA 4JFTA 1UR3M 4KMQA 3W2NA 1US3A 3WNKA 3WQWA 4XB3A 2EPHA 1XSJA 3MZ2A 3FKKA 3M43A 2BHZA 1V8EA 2E8YA 3G0XA 1W17A 3VMOA 2GQ9A 1D3HA 4O4WA 4AWUA 4H9UA 1AQ0A 3NO3A 3DI0A 4NQ1A 1PWMA 4V1XA 1V02E 2P3ZA 2SFPA 4LJ3A 1E43A 2ZDRA 3NQ6A 1MW2A 2DQXA 3S8HA 5DMNA 5EPDA 4F4RA 5U7SA 1R38A 5GNZA 3S9IA 1Y5XA 4ATWA 3OQ8A 1I2QA 5EMJA 1RP8A 4XD5A 2A85A 4H00A 1B54A 2NX1A 3B04A 3D47A 2I5GA 4LV9A 1YQ2A 3FX4A 5HPOA 4DYJA 1Q7MA 3DFOA 5CQ1A 4WDXA 3LOTA 1TWSA 3RUBL 2HV5A 1VH7A 1J79A 3C0QA 4Z08A 2OLAA 5DLCA 3BARA 4PMZA 4YYCA 6ENLA 1E70M 2BOGX 1LWJA 3QTGA 3LYEA 3SY5A 1P48A 4O1FA 2R14A 1BRLB 3KLKA 2P8BA 1WQ5A 1F5ZA 2CLPA 3VD7A 3G5EA 2ZX5A 2V69A 2BV9A 2XVPA 1PHQA 3WO8A 1JR1A 1JCTA 4MYAA 2Q71A 1XBZA 3AISA 3O07A 3W82A 3PC0A 3UGVA 4IMCA 5C9RA 1MQQA 3PPCA 4JDBA 5F1UA 2ZUSA 3GVRA 3CL7A 1Z48A 4LTSA 1YXCA 4KWVA 2E9BA 4HMCA 1GKRA 4JPGA 1ONEA 2WNWA 2AMXA 1T96A 5LGXA 4NI3A 5DBUA 1HXJA 3WK1A 1C7SA 1HTIA 5T9CE 4B2DA 4DI9A 1VPQA 3W84A 3AUOA 1XIEA 4D1IA 3SFWA 1YTEA 4YTQA 1JNEA 4E8DA 4S3EA 3IJIA 3N3MA 3RPMA 4XAZA 4D1JA 5FJIA 4FXRA 3VVGA 2XISA 2VOTA 4CN6A 2WKGA 4AZGA 1ZY9A 1K7FA 1E4NA 4GG9A 1VAHA 1QK0A 4HK7A 4IFRA 2WMJA 4PTXA 1EP2A 3CTLA 1WDDA 4R9XA 3NVTA 3QY6A 1B9BA 4Q8UA 2CERA 2X0HA 2Q8XA 3V35A 4JFUA 4C90A 1Z7AA 2AMGA 3MDUA 2DQWA 1JCMP 1DXEA 3TQPA 5I78A 4RDWA 3VDAA 3SRHA 1EC9A 1NOUA 2WO5A 1XFBA 2OOFA 4NI8A 4HN8A 1DEDA 1ZP3A 2ZUNA 2ZUMA 3WH6A 4NZCA 4ZO6A 4CN1A 4XUYA 1EWDA 3VKBA 3BGJA 4GABA 4GYPC 4MVAA 3SEPA 3LPPA 3WBAA 5G5IA 1GQLA 3U2OA 3OOQA 3WYZA 3O6YX 1SW0A 3O6DA 5JBDA 3CZJA 2E7FA 2DSKA 4X2PA 2VZUA 1CGXA 2GVGA 1V7YA 4DNMA 3AU2A 1R3SA 1CW2A 1DXIA 3K4WA 3W01A 5HJXA 9XIMA 2WC4A 2QIIA 4XZLX 5KZMA 3OHIA 1KCZA 4I9AA 5LA1A 2ZFAA 5D37A 3APTA 3VNKA 1Y8BA 4UR8A 3CAQA 3GYCA 2BLEA 3TW9A 3KHDA 3HQ1A 2HE8A 1LLOA 3W7NA 2Z28A 4NNAA 4EXAA 2Y7FA 3B8DA 3PUGA 1Q13A 2DGAA 1XDJA 3RG6A 4IMEA 1JZ8A 4FOJA 4D2JA 1OD0A 4U2ZA 4L61A 1H09A 5HQEA 2DH3A 2CCRA 3E5BA 1Z32X 2VR4A 3MQTA 3FJ6A 4AXNA 3CGTA 1EGVA 4AIEA 3UY7A 4ZTXA 2IKIA 1YPIA 4HHMA 3VD4A 4HSNA 3DX5A 4U31A 5AYZA 4IP4A 1A4LA 1XLAA 4QLKA 3IIXA 1B3XA 1XC4A 1VLIA 2ANUA 3ORWA 4H6QA 4E2BA 3WLJA 2XFFA 1Z6KA 3LLFA 5AZ0A 4WJ8A 3WNLA 5I3GA 2VUYA 3F1QA 4GLEA 2OMAA 4FSAA 1LRTA 1WDQA 1E6QM 3LG3A 1WB0A 2WQPA 4HA1A 4UFHA 3BLFA 3R12A 4UFKA 1KWKA 1AZ1A 4PTMA 1G7UA 2ZZ4A 2XTKA 2ZZ6A 3AZSA 1DIEA 4FLQA 2CKSA 4J3TA 5EGRA 1Q66A 1XRFA 2QPXA 4J5NA 4PCNA 1WBHA 3GQYA 3V5CA 1HKWA 2R91A 4BS0A 5JBFA 1W2VA 3FJNA 1KLYA 3G1YA 4HBKA 3NAVA 1UZ1A 2POZA 1VJZA 3D3FA 1F05A 5FF0A 4O1BA 1JPKA 2J13A 4XWUA 3WDHA 3AJ7A 2I5IA 3SCRA 2YGYA 3EDFA 1H3GA 1Q6OA 2AQOA 3TSDA 1IZCA 1J0IA 3WLRA 4GGBA 4GX8A 3W1PA 3PUOA 2FHCA 3W07A 4PUUA 5AFDA 3BK0A 1FXPA 1UR0A 4UNKA 4CUCA 1BYBA 4UZSA 4FLOA 3N9RA 3HM7A 4EWJA 2CXEA 2PBGA 2QAPA 2R6OA 4HPGA 5HUPA 2JIWA 4PGLA 5XIAA 5AYYA 4WGXA 4OGZA 3U7VA 1LOLA 3W2UA 1TVLA 2FB3A 3B06A 4LAZA 4O19A 4Q6XA 3I6TA 4F48A 3NYDA 1PZ3A 3W53A 4IGMA 1KKOA 3E2VA 4GYKA 3U9IA 4RPPA 4BCEA 4Q4KA 4CU6A 4FNQA 3KVJA 1F6KA 2G3NA 1UWRA 3SB0A 3LB0A 3AO0A 1S2CA 1OFDA 1W9UA 4OV9A 3AMGA 3CU2A 2J7BA 4D6EA 1W37A 2BXYA 2WCGA 3MUXA 3R8GA 3WLKX 3M4HA 4EF9A 2QJMA 4MWAE 4RNHA 2X40A 1G7VA 1HKJA 4FZIA 1RBAA 3H7RA 3FVMA 5FESA 1ZB5A 3R89A 2B7OA 5DY2A 3VTRA 5KZDA 1ZZMA 2QW5A 3W76A 3M0KA 3NEHA 5FEPA 4DB7A 4ATLA 4OT7A 4IOTA 4GZIA 1QW7A 3MV01 4JHZA 2FZNA 4ATDA 2G3FA 4EPEC 5H6HA 3V7PA 2AL1A 3A21A 4NAEA 1UHVA 4JDYA 4KT2A 2RUSA 1J6OA 3EWDA 5LXXA 3W4RA 1LL6A 2YLLA 4QEHA 4A8NA 3N1AA 3EWWA 3E74A 2Y8KA 2NXIA 1P6WA 1KM6A 3RJXA 3WMCA 2ACUA 2VDIA 2WZTA 4CU8A 1L2UA 3BZJA 4UTWC 3DFNA 3W75A 4LYPA 2GPTA 1RJQA 3K1GA 2PTWA 5D9NA 2W0UA 1WZAA 4A3QA 4WKAA 1GZJA 3VK5A 4OTKA 4ZEPA 3VD9A 2VXNA 2GJXA 3NJ3A 3GR8A 1OGSA 4UQCA 1NIUA 3CUFA 1XLHA 4AHQA 4C6KA 2XN0A 2QF8A 3B0VC 4IMFA 1R3QA 1S5NA 1K7EA 1FWEC 3GDRA 3H2EA 5I5RA 3PTMA 4YL2A 4DAIA 1RZMA 3PZIA 4NP7A 3RIKA 1TA3B 2PLCA 3S5SA 5BMXA 3S9YA 4N9DA 1H7NA 1EUNA 2PWHA 2BHUA 1QU4A 3ARUA 4M7TA 1F7BA 4NUWA 3HBLA 5J04A 2X1IA 3WBEA 3AS1A 4BF7A 1G4TA 3THQA 3ZLFA 4D8LA 2GGEA 2CWNA 1UP2A 1KFBA 3BSMA 3WDRA 5GJNA 1O6IA 4CQCA 3SCOA 2DPEA 2QCMA 4C6FA 2A4AA 4Z2HA 3M5ZA 3NPWA 1TTQA 2B7QA 4RX0A 4JXCA 3CHFA 2OFJA 4I7WA 1MI3A 1V4YA 4P61A 2BFGA 1XR2A 3KCLA 3BPWA 3ZVHB 1FHLA 1VBJA 3C6CA 4HTYA 3N18A 3WF3A 3KTXA 3W37A 3R0KA 1LLWA 1IGSA 3IUIA 3MYPA 1CGTA 1GYMA 1B4KA 1EC8A 1WAUA 3TZFA 3W9ZA 2CBVA 4GO8A 3T7VA 2MANA 3M46A 3M0YA 3W7PA 4HMEA 4NZ4A 2FJKA 4A05A 5FF3A 3P82A 1ISVA 5AHFA 3WJXA 1M7PA 2QUTA 1X6UA 4LYQA 2XH4A 2OQYA 1US0A 3F5JA 1TPVA 2NWSA 1IXPA 3A6OA 3DBNA 2Z24A 2PDXA 1N55A 2BDQA 3SSJA 4KFOA 3WLQA 4YYFA 1F73A 3ISIX 1K9TA 2B4GA 4M6VA 5M17A 4M82A 3W6LA 2HZGA 4ERGA 2PGFA 4HCHA 1UJPA 3SJNA 4C1LA 4DQWA 1QNVA 5HPCA 1NQ6A 3VIHA 1CXIA 1JVNA 1XWYA 3K1DA 1A5SA 3DFSA 5BRQA 2W66A 5A8MA 4ZSTA 4WXZA 4QNEA 1H1NA 2WMIA 1AA1B 3BMWA 3TTOA 1FQ0A 1IT0A 4F8XA 4QS5A 5BU9A 3GD6A 4B90A 2QV4A 3SY8A 1J0YA 3A13A 4KCUA 1VF8A 4FA3A 3QJAA 4L9XA 4M80A 4JGDA 1MUWA 1R3WA 4IISA 2TMDA 3GIQA 5D05A 3DFTA 4GUJA 1W31A 2ZDSA 3S5OA 1TPC1 2ISDA 1EUAA 3E2RA 5M1TA 4HZ6A 4GJIA 3HB9A 4LSBA 3BAYA 2DZUA 4ZQRA 4IH3A 2Q02A 1TPFA 1YKWA 3KW3A 1QATA 4JY8A 4ZQNA 3OA5A 4DJEC 3AYRA 2V63A 3B8WA 5I02A 3W1TA 4QAIA 2Y7EA 1RR2A 3UZXA 4AC1X 4L4PA 2ZE0A 1V6XA 2QUUA 4GI6A 1KCXA 3RDKA 1I1XA 2CPUA 5XINA 4G8TA 1HIZA 5J5DA 5K7JA 1QAPA 3VPLA 1UP0A 4N4QA 1S46A 2FZ8A 3UWUA 1ZJBA 2XIOA 4M7SA 2IPFA 3QQ1A 4IG2A 1E9LA 2QUVA 3RLHA 3C0JA 4L80A 4ZTYA 4G6CA 4LAMA 1BGGA 3R5EA 1HT6A 3KAOA 2Y24A 1H41A 1H4PA 3EKGA 1ZLPA 4XBSA 1GQIA 2VQTA 4UFMA 4NIRA 3QPYA 4Z0SA 1LM1A 1V3MA 3UXAA 1XUUA 3TDFA 4ROPA 4W7VA 1BSLA 2A3BA 3TTYA 3C8NA 2P8CA 3CIWA 3ZR4A 2J77A 4UTFA 3S83A 2VR5A 4JQAA 4Q8NA 2HXTA 1XD0A 2OODA 2FLIA 3CHVA 2QVNA 3SCVA 2WCSA 3IRDA 3SQLA 4GIAA 1VS1A 4XBKA 5CH9A 3VCCA 1TX2A 2YB1A 2CW6A 3WELA 3NZ1A 3TEVA 3B0XA 4C65A 2NT1A 3K2GA 4B91A 2JGQA 3KCJA 3W6YA 2BGSA 1EZ2A 2ZX9A 5AHMA 3WH5A 3URNA 5E9XA 2VURA 1C7TA 3V36A 2VFHA 4IP5A 4RZ4A 3K8MA 2Q09A 1SR0A 1ESWA 4O10A 3ZOAA 1E6SM 3S2JA 3VD5A 3JRKA 2WCAA 3QMRA 3MC5A 4GBUA 4RE4A 3O2LA 4L5ZA 5DX7A 3DG3A 3WQFA 1PZ1A 3DESA 3I3BA 4ADUA 4JX4A 2Q01A 1AL7A 4K1WA 3I4EA 3P67A 1E6PA 2YB4A 1HO1A 3NYZA 1ZAJA 2BODX 2WNZA 5IBXC 1R0MA 1WOBA 1XKYA 1XSKA 1NFBA 1ME8A 2AOSA 4U28A 3Q45A 1R7AA 1OX4B 4NASA 1SFLA 3K13A 5C8BB 3NL2A 2ZUVA 4FF7A 2EQDA 4TX6A 2J9ZA 4MHBA 3C0SA 3WFAA 3WD2A 3U48A 2WHMA 2X7WA 3PAOA 1HQTA 5D38A 4HNOA 4DWSD 3TN6A 3N4AA 3CV1A 3NGFA 4XD4A 5G4WA 2WWCA 3ITGA 4JEQA 1N8WA 1C90A 2QNEA 1FHUA 3MP4A 3AXIA 2GQAA 3W27A 3EOOA 2QPSA 1VENA 2OPJA 3QV8A 2C6QA 3UCQA 2PTDA 2HROA 1FWWA 3BAKA 4GINA 3LHYA 3MV11 3PUDA 4Z0JA 1X1NA 4DNHA 2IW0A 5CLWA 3GS6A 5I06A 2VRJA 1T41A 5TBOA 3ZIZA 3SM0A 1Q3NA 4FR1A 4E4FA 3BLKA 2XH0A 5AVHA 3KRZA 4P7NA 1OG6A 3UG4A 1XG4A 4GJ1A 4ZQMA 1OX6A 3BMVA 3TW6A 1WOAA 2PD5A 4WOQA 4GH1A 2NX9A 1F3TA 3EPMA 3VNZA 5A6BA 3AI0A 4XSMA 1FP9A 2V5DA 1E51A 4H41A 1JQVA 1R6WA 4RUBA 3W2MA 4Q4QA 4PE8A 2PWGA 1YW1A 3WJSA 1IWAA 5CBIA 4TVDA 4BKNA 2Z7GA 1UWUA 3UWVA 3ARYA 4D8ZA 1K6AA 1OIFA 1Q8AA 2ESCA 4F2TA 4W4QA 1Z41A 1FH7A 4L9YA 3L9CA 1TWZA 4LVBA 2VFIA 4L6DA 4P8WA 1XL9A 1V0KA 2OEKA 3A4AA 3VGDA 4QJ1A 1WXJA 4Z2KA 3W1LA 4DZHA 1MFUA 2Y89A 2NW0A 3KCOA 2FHBA 5EMYA 3RJYA 4LUTA 4JL2A 3LPFA 4M51A 4IL0A 3PBWA 3OVPA 4GI4A 4O0KA 2C0HA 4JZ5A 3HFYA 3PZVA 2VC7A 4UTWA 3B4UA 1IEIA 1OC6A 4W9TA 3GG1A 1F8IA 5CPMA 1ZS2A 1HL2A 4O8AA 3NDZA 2POTA 4A8LA 1J5TA 3WLSA 4XTDA 2VL4A 3VC6A 3GG8A 3BSGA 2D0GA 5LIKX 4OKDA 3QZEA 2V81A 3CHDA 3RHGA 2NXHA 3N2TA 2HVOA 3ZJKA 4TV6A 4Y8FA 4R9OA 1EJUC 1WXZA 1B2YA 3O9NA 3UWEA 9XIAA 3IJ6A 3MTWA 5FACA 4AC7C 2J88A 5FJOA 4FNPA 4PH6A 4L9ZA 2Y2WA 3L67A 1QDSA 3UJFA 3WUEA 3BOXA 4NXKA 5AB3A 1KFWA 1LCOA 3LY0A 4AEEA 1TUXA 7A3HA 3AYVA 5BNKA 3S42A 4LVDA 1EJTC 4NZ1A 2ZZ7A 1BWVA 3MO7A 4FIRA 1O1ZA 3NQGA 1TJ0A 3L66A 1VRDA 4HK6A 1YX1A 1QT1A 4B9YA 5H2ZA 2WHLA 1OY0A 1E71M 4QQUA 3N3TA 3Q94A 4ZXLA 1GVEA 1KW1A 1W91A 4ES4A 3WQ6A 2VX7A 2UY2A 3T08A 3WX7A 3OLGA 4Q4RA 4QP0A 1DXFA 3G1HA 3NQEA 1VYSX 2HS8A 2RJGA 1P43A 1RJPA 3KBJA 1A5KC 2NUWA 1MEIA 4YCOA 1YNPA 1QBBA 5I03A 1W3JA 1CEOA 3FEQA 1DWHM 2PDGA 3L68A 3GRIA 4AF0B 3M0VA 2OYKA 1SVDA 4PMYA 2WQDA 1EJVC 4Y9OA 3E02A 4CU7A 3U3HA 3DU0A 4MLRA 2OJPA 3PZMA 3NSMA 1HJWA 2G4JA 3TLQA 5CAKA 3NM1A 4G56A 4GIEA 4BWLA 1GUVA 4KS0A 4ZGYA 1A5UA 1PB0A 2FH8A 4KWOA 3WMSA 4REQB 1J8VA 5DT5A 3FVDA 3JR2A 2WB5A 5E70A 4ZCWA 3GZAA 3FA4A 3ITOA 1E56A 4HA0A 5A95A 1AH3A 4S3KA 4MADA 4KEVA 2F6KA 2HQAA 3NSXA 2NUYA 2HVNA 1C8YA 4K2SA 5HQLA 1AW2A 1XH1A 4UQEA 3TKFA 1BLIA 3EX2A 3C2VA 3IAPA 4WDWA 4H6EA 1UR9A 2WVTA 1JYVA 4BK9A 4HYVA 3S2MA 3N14A 5L9FA 4AQLA 3RPTA 2QPUA 2OYMA 1FDZA 2FMNA 3OLDA 2J7FA 3BG3A 4DXKA 3QEZA 1CBGA 1JDAA 4LOCA 1QHPA 3MPGA 1J0HA 1MUCA 1XDLA 3OJGA 3KXQA 4QJ4B 3I4KA 4RNIA 4L6HA 2X1UA 1CLXA 1AG1O 1FWNA 4LF1A 5I0DA 2QCCA 3TNBA 1ITQA 3SCPA 1M9HA 4ZSUA 2BY0A 1W5OA 5BXTA 1E5NA 4AVFA 3GTIA 3LLXA 1OFOA 3CWNA 3FKRA 3F03K 2ISSA 2CLHA 3JVAA 3N2CA 1LBLA 3P3BA 3QTPA 1QOQA 1SFJA 2D2JA 3B40A 4OVXA 5C54A 1GOKA 3EWZA 1TZ7A 5C7VA 4QSFA 1F74A 3CPGA 1YBQA 3MY9A 3PB0A 4O16A 1P0DA 5FF4A 1CLVA 4HU8A 3MCNA 3RNDA 1UD3A 1Q8JA 3UZ5A 4ACZB 4Y2WA 3CHCA 3C52A 5D2YA 4JIIX 2QCGA 2Q3OA 6REQB 1MQRA 1AD1A 3APGA 2OTDA 1K8ZA 1OFRA 3NQ7A 1LL4A 3UP8A 3W24A 4XIAA 2HPMA 3QZ6A 4KH2A 5FAGA 1X7IA 3OG2A 1LLZA 4EKJA 4DHGA 5A6JA 3WF1A 4JFSA 1H0IA 4AB4A 4WF7A 3BLDA 2Y70A 2D3NA 3WLPA 2F38A 4MWAC 3DGRA 1CECA 1C3FA 4JN8A 4PL2A 4GVIA 4EPBC 2C14A 5EY5A 1VEMA 4Q8PA 4XK2A 1FWFC 1PIIA 4MYXA 2BS9A 3VKKA 2ACSA 2XIMA 1VBUA 3S5NA 1FWBC 4GMEA 1OT2A 1S39A 1XLCA 3MP5A 2VO5A 3M0ZA 3O0KA 3OIHA 1XLMA 2PP1A 1T6MA 2A3AA 5IDIA 3A47A 1JGMA 4FOUA 4U10A 1T99A 4NYYA 1BQGA 1TTIA 4O12A 1QOPA 3ZLHA 3H23A 5FJRA 2BASA 1F3EA 3BW3A 1UJQA 1TV8A 3MUZ1 2RHGA 3WY1A 4H9YA 3IIPA 3TWAA 1A5BA 4E8GA 1TR9A 1GYLA 1PBGA 2DIEA 7REQA 1YYAA 3CEPA 1SQ7A 4GIYA 2D2GA 1CYGA 1M03A 1U22A 5LZLA 1MDLA 3CUXA 5I3IA 3AAMA 2GUYA 3VE7A 2HDJA 3ZO9A 3FYOA 4IP7A 2XN1A 3OA3A 1S1RA 1U5JA 3GHRA 4PN2A 2XN2A 4N02A 3URQA 3KBMA 5D2WA 3RCMA 3M44A 1VKFA 1WBJA 1WV2A 4E5TA 1PDYA 3DERA 1EGZA 1JIBA 1M53A 1P1MA 1JQXA 5LSMA 3XISA 1NDWA 4DXVA 2RH9A 1GVFA 5B80A 2Z4GA 1N7KA 2JKAA 3IIOA 1FP8A 3DHFA 3PM6A 2RDXA 3T55A 2OU4A 4E2VA 3WQPA 5CKSA 4QSHA 3TUUA 3NL5A 4MUZA 2ZVRA 1QW8A 3PPFA 4FNUA 4PB4A 2PDLA 4WJXA 4LBSA 4UOJA 4J3VA 2ZX8A 2BVYA 3VNDA 4G2DA 5A8GA 4TVCA 3GDKA 3VFCA 4GISA 3T07A 1H61A 2GQ3A 3L4VA 3R94A 3S5ZA 3EOLA 2GVJA 2ZX7A 1TWIA 1O12A 3FDKA 3VNLA 1OFEA 4DUXA 3XINA 1X1OA 4YCPA 5CJMA 3A4XA 3N11A 4D6DA 3NO1A 1DQWA 1B1YA 3CUGA 3TYEA 4QIUA 1VRXA 3BJTA 2UWFA 3NZRA 5DT7A 1OFBA 1PUDA 3WQ5A 4KEZA 2V30A 4O11A 4INFA 2QGYA 1UA7A 3MI6A 4CCCA 1EL3A 2HK0A 3B0PA 1LUCA 5C7HA 2PD9A 1A5NC 2OX1A 8TIMA 5E93A 1UROA 1PKLA 1G9HA 3NL6A 1HZYA 2FDMA 1FWDC 4JTLA 1JZ6A 4JTEA 5DF0A 4ML9A 4C6BA 1TREA 2A7PA 4DY1A 4PA8A 1R3RA 4LRSA 1OWQA 3N4FA 4UQDA 1PE1A 3NQVA 3QHNA 1S5MA 2Z26A 4DN1A 2OSYA 3G0SA 3E5PA 1QHZA 1JPIA 3NTYA 4XAYA 3T81A 1RPKA 2C1HA 1LG2A 3H24A 4GH3A 6TAAA 2YR1A 1Q6QA 1RQEA 5LIWX 3R1ZA 4LF2A 4HD5A 1OT1A 1XSIA 3REQA 3N2XA 2XM1A 3EA2A 1A4MA 1Y5WA 1LF1A 4P7QA 4LY8A 5AC4A 5DN1A 3USZA 1EPXA 3UA4A 1TTJA 4UNIA 1JJKA 1FKXA 2Z29A 4PCFA 2XINA 1TPUA 4WCJA 1EZWA 1MXDA 3ARQA 3VOCA 4JTUA 4FK9A 3WK3A 2E09A 2PC8A 5G2WA 4DF1A 4GVFA 1TKKA 4AIUA 1SZEA 2FIQA 1WP6A 2EJ1A 3CUHA 3RF9A 1FWCC 4OOUA 4M0XA 3PJWA 1GOIA 3PFMA 1IIHA 2VNCA 4E2OA 4US6A 2A1YA 4D6CA 1XIGA 1P0EA 2Y61A 3ZXWA 1OIMA 4KWSA 3GU9A 5A6SA 4M6QA 1BXBA 4BEQA 4W5ZA 2XG9A 1XISA 2NQ9A 3W7DA 3QM3A 5GNYA 1BXNA 2ZXQA 4HMNA 4RW3A 1QMLA 1XLEA 4XZNX 3HMJG 2WJEA 2XGZA 2V8ZA 3C56A 3RO6A 3CWHA 1OM0A 2BY2A 3R8HA 4AVOA 4X0VA 3U0HA 3CLMA 3SCTA 4B9ZA 4HCLA 1VBGA 4JIQA 2V5JA 3TW7A 1EHAA 3W25A 3MHFA 2OQHA 4O54A 3V1HA 1LWIA 5H91A 4X60A 4UXDA 3GBDA 3H4GA 2VOMA 3H2FA 2WLYA 1FH8A 4F9JA 2IKHA 3UWWA 3FOKA 4LCQA 4MIMA 4IX2A 3CMFA 5FSDC 1DE6A 3MVTA 4HHHA 1OADA 4CEUC 4FMVA 3EMCA 4C6EA 3NQFA 5K4ZA 3IWPA 4K8HA 4QG8A 3UVAA 4C6CA 1ZTVA 1EKOA 5HANA 4D8AA 2V2DA 4B4HA 2WM0A 4D6JA 1E15A 4LCSA 3ARSA 2PU1A 2INFA 2PU0A 3OHMB 2C1GA 3SI9A 2VZTA 4AD1A 4XZ9A 3FSTA 5BW6A 3MO4A 2Z6JA 4W5UA 4IIEA 3QSTA 1YDYA 3QKZA 2WMKA 2WSYA 1RUSA 3ZJ8A 2YLAA 4MAZA 4DJEA 2ZADA 3TYAA 2PDKA 4ML4A 4TU1A 4TO8A 5AC8A 5A6LA 2OWXA 5A3HA 5FL1A 1CZ1A 5KZ6A 1UD8A 4DJFA 5CJNA 2QYGA 4W89A 3AIVA 2J6XA 3W7OA 4V1YA 2PEVA 3ALFA 4ERIA 1TPB1 2HNEA 3GC2A 5E6YA 4O1AA 3GG0A 4X0NA 2QDHA 4NX5A 4R5EA 4IPJA 1SO4A 1VYRA 4QITA 2Z1BA 4MG4A 3NIYA 4C5ZA 5D4YA 3STCA 3E2SA 2VGBA 3REQB 4JYFA 4YNGA 1WE5A 1KXVA 2ZWYA 3RRXA 3QFEA 3W3OA 1JCLA 3QH2A 3F4NA 4MM1A 5CGMA 5ABGA 4R85A 1CI1A 3AQUA 3EAUA 4BQ2A 2WW5A 1X38A 5FEXA 1ADOA 3ATYA 2QJGA 3I68A 5D32A 5AHEA 1P0KA 1VCFA 3AHZA 3WDIA 4C1NB 1BVZA 2BXVA 2VHLA 4N0RA 3N6JA 2UZ9A 1V3LA 2EPKX 4O53A 1Z9AA 2PLJA 3HO8A 3WQDA 1BPLB 3U5UA 1BYAA 3FXYA 5F2LA 4X61A 4O14A 2B81A 5E6ZA 2NVCA 3WFLA 5K4XA 3WJYA 4J3SA 3WD0A 4JS3A 2HJPA 3VMNA 1K9FA 2X05A 3E12A 3IJLA 3CASA 2IXVA 4PFHA 4OUEA 2QCHA 4W8LA 2VKZG 5REQA 3H7UA 3OG3A 3L4UA 3VDGA 1PZ0A 2YW4A 5DCBA 3GKAA 4UC5A 3SQMA 1TQJA 4HZMA 3B8TA 3BV4A 3VKDA 2J47A 2QMKA 4WSKA 4H83A 1XIHA 1YXYA 1OCQA 1GK8A 1SZNA 3CB3A 1IIGA 3ZM8A 3WDPP 7TIMA 5T91A 3UG5A 2Y8UA 3EEZA 4YHEA 1EEPA 3HA1A 3RR1A 2C8NA 1T40A 1GJPA 2P10A 3PFRA 1JZ2A 1KM5A 4DPQA 2R24A 4Q8VA 4OHQA 3AS3A 3MKCA 2DJXA 2ZXAA 2VX5A 3C0LA 4RW5A 1Y7VA 3AZTA 4JYDA 4UFJA 1E1CB 2Y88A 2GK1B 3CAKA 3GB6A 2C79A 3UESA 2HTMA 1W9BM 2JEQA 2ZIDA 5I3JA 4CNUA 1UWSA 3UJ2A 1PTGA 3GK0A 1R3TA 3ITCA 4AX7A 3MMDA 2PGEA 1WKDA 2YA2A 5CZSA 3EKLA 4N7QA 4PMXA 5BZAA 4N6EA 4QE4A 1J11A 3BV7A 4AYSA 1HO4A 3CC1A 3C3NA 1UP3A 2TPSA 2OZ8A 2NQ5A 4B15A 2WPGA 5IM51 4BY3A 3UT0A 2A6NA 4KRZA 3MW7A 5DMMA 2XVLA 4R7JA 3QMSA 4ZOCA 1UMLA 1BAGA 3GU2A 5CBBA 1L8NA 3TSMA 3EDKA 2ZZ1A 3GXNA 1QPQA 3H26A 7ENLA 2R8WA 2C91A 4WR3A 3KHJA 4IPNB 2QR6A 2NXGA 3B9DA 2YCIX 4J27A 4RDYA 3WQ4A 3T2QA 1VP5A 3BLOA 1W1IE 4AZCA 4HK5A 4UR7A 4GZEA 3Q58A 4DLFA 5L6UA 4KBXA 4REQA 1QPRA 3CQJA 4DF0A 3W23A 4LYRA 2OG9A 4OBTA 2DSVA 2Z7KA 4EX4A 2NVDA 4L4LA 1OD8A 1Q6LA 1EDQA 2VVSA 4C6IA 2Z1WA 3UCDA 1P0NA 4UMBA 4I8YA 3GW0A 1LL7A 3BAXA 2DZBA 3MSGA 2GQ8A 3AU6A 1JAKA 4HNUA 3GNDA 3NDYA 2CHNA 2VC6A 4LV4A 2QCDB 4QDMA 3LCGA 2WWDA 1XW8A 1IR2A 4JTKA 3M0LA 3IGSA 3GNXA 4KPLA 5JMUA 3DHDA 2TYSA 1HKIA 3NQAA 1Q6RA 2J27A 4YIWA 3BOLA 4F0RA 1X8FA 3GU1A 4B3LA 3PP7A 3URAA 1V77A 2J9YA 4CCEA 3K8LA 3L4XA 4DO7A 4E3VA 2IQTA 2NQZA 4XO6A 1VJIA 3EB4A 4ZOAA 4DJFD 2WKJA 2CLMA 1E3ZA 4AISA 3VNMA 4DIAA 1FUYA 4ZQOA 1LORA 3QLLA 2O55A 3W7RA 4CD6A 1QNRA 2UBPC 4D71A 3ALGA 4K68A 2PWEA 5REQB 5K9CA 4ZXOA 3QBUA 1QO2A 3R11A 5BXSA 3CAVA 3E9AA 1JDEA 1M6JA 1SJCA 3S1GA 3VC5A 1M41A 3B4YA 1IE7C 2CWXA 4GZJA 4U5KA 3W1QA 2QEZA 2YXOA 3AZRA 1FTXA 2OX4A 4Y9PA 1V0LA 3HG4A 2FQIA 1D9EA 1MZRA 3THUA 4UQBA 5AYIA 1KGWA 1REQA 4HJWA 1XYMA 4HZ8A 3LCWA 3CAWA 1LQAA 3M47A 3ZLGA 1EJXC 1UQZA 1W56A 1DBTA 3C2FA 3GXPA 1YMYA 3P74A 3QY8A 1FFRA 4PTNA 3CXOA 4WUIA 2GK1A 2DIKA 1Q6GA 1SJAA 1UKPA 2ZQ0A 5HR6A 3DBPA 4IM4A 1XI3A 1B4EA 3LHTA 1F9CA 4DWSA 1PDZA 2FYMA 6CGTA 2WJDA 2PDBA 1A0EA 4OIFA 1ZL1A 2PDIA 2DZVA 5JVLA 3A3WA 3PBGA 2CLIA 3STEA 2Y0FA 1OGGA 3UFYA 4LX4A 4M1BA 3EWXA 1QFEA 1DORA 3SCWA 4A3UA 4W88A 3NFUA 3GWQA 1F61A 4O1DA 4U3CA 2X09A 7ODCA 1D3GA 4IQLA 5IBXA 5FEWA 4FI4A 3ZS4A 2TSYA 5BOOA 1F4HA 4M56A 4LUTB 4F0SA 4QCEA 2NWRA 3PPGA 5KETA 1E3XA 4NVTA 4GUFA 4NZ5A 4MB5A 1V3JA 3RX4A 1AUSL 4KRTA 4BHYA 1BEUA 4IUGA 1GW9A 3B8IA 4UTJA 4XVEA 4MDOA 2DZTA 2E1WA 4CQAA 4XD3A 1X96A 3QOKA 2V5LA 3H22A 2VCBA 1E40A 3KOZA 3LXBA 2VEGA 4H01A 4W84A 1UD6A 2QV5A 3T4WA 3W7JA 1SMAA 3O16A 4ZFMA 1RVGA 1C9WA 2CFFA 3VZXA 4NAEB 3U5YA 3JZUA 4QBXA 3SECA 3HG3A 3QV9A 1ITUA 3O6CA 4BI5A 4GWEA 4KWWA 4PTWA 2NQJA 3FEMA 3V16A 1V6TA 3CHEA 2AKMA 3EZ4A 3WD3A 3AROA 5HAOA 1LOSA 4BI7A 2Z1XA 1GVIA 1GKPA 3W7IA 2W3ZA 1JCYA 1MZHA 4UTKA 1DWJM 1UZDA 3W1XA 3AIWA 1VR6A 1EJ7L 2EGZA 3PNUA 1TIMA 1W1TA 4IICA 1F6YA 3KTCA 3EMZA 4QX4A 4A3YA 4JR5A 3ERPA 3M0JA 5CZJA 1TG7A 4U33A 4GNKB 1ISWA 4C6MA 1T5AA 1ISZA 1EJWC 3ABXA 4ZB0A 2NQHA 3T44A 1YHTA 2Y85A 3T0CA 1VFSA 4POCA 1BRLA 3CLWA 4HQVA 3PTQA 2JKEA 3RXZA 1A5OC 1P0BA 3ARXA 2G50A 1GEQA 3ME3A 5HWMA 1EX5A 1N82A 3SQSA 3OGSA 1VCGA 2DZWA 4AF0A 4HOWA 1JXKA 2E28A 3N29A 4XD6A 1KA9F 2ACQA 4FB7A 1UKTA 3CEUA 4NU7A 2E5CA 1QO5A 1EGMA 2XUCA 3TAKA 1QPKA 1KTNA 4HNTA 2BG5A 5BXPA 1HNYA 2HCVA 2QQ6A 3AXXA 3WBXA 1QNQA 3TA9A 3CZ8A 2YJQA 1P4CA 2B31A 2G96A 3E49A 3WQGA 2GDUA 4WQ6A 4DM1A 1B90A 2WVUA 1JI1A 2H90A 1XYLA 5F2MA 3I65A 3N4EA 3GXIA 1NJJA 4UBPC 2NSOA 3O15A 4MTVA 5CSRA 5IFTA 4RZ5A 4HT3A 1JF5A 1LTDA 4Q8TA 2QZRA 1BVNP 1JD9A 1KB3A 5C9UA 1GOOA 1XCFA 4AU0A 4QE1A 1X1ZA 3NL3A 1TWWA 5DXXA 2PRMA 3CIXA 1W2PA 3OBAA 3R7MA 3QLDA 4EXBA 4V28A 4I5RA 4I8DA 1C8QA 1NDZA 2D0HA 3UA3A 1R7OA 3WL1A 3V5FA 1PCWA 1DJQA 3RYSA 2GJLA 1G1YA 4FLRA 4WKFA 4XIMA 3FJ4A 3W00A 1JGIA 3A5VA 4L1XA 4UIOA 4M29A 1IHIA 3ICJA 3ZSSA 8XIAA 1KGUA 2Z0IA 4DJED 2QJJA 3STPA 1EXBA 1SUXA 3TYUA 2P1FA 1K4HA 1OZQA 4HCDA 4RXFA 1VFOA 3WSUA 1DJWA 4WY0B 3A22A 4RDVA 1QRQA 4K39A 3TYCA 1XIMA 1X7FA 2HK1A 3E6EA 2OB3A 1OYBA 4QTGA 5D02A 1CXHA 4HNVA 4LALA 2E5DA 3DYMA 3TP4A 2WMIB 4TUFA 1UUMA 1XRSA 3K8KA 1H1ZA 4ZENA 1OEPA 4OWGA 5TF0A 3UEQA 1PS9A 1XH2A 1K8YA 4HGXA 1A5CA 4W7WA 1V6YA 1M01A 3OPSA 1W3IA 4Q3MA 4Q32A 3S1VA 5HBFA 2QCLA 3CS2A 4C91A 5LNRA 3BJFA 2F8QA 4IHCA 4I7VA 2FH6A 4PTDA 1XH0A 5I00A 1UWTA 5EB8A 3N6HA 4Q8WA 1A3XA 5HNTA 1JPMA 2IQDA 4M6PA 1WDRA 3KWSA 3ES8A 1VJSA 4PUNA 2VCAA 2WMGA 5BU6A 4FXSA 2XSBA 3P81A 4QAWA 3ARVA 1BHGA 3B03A 5BXRA 3ITTA 1CGUA 3W86A 3NVDA 4W87A 3ARZA 3PBYA 3TTSA 2WNNA 4J28A 3EA1A 2H6RA 4YWIA 2NV1A 5EA9A 2OWCA 4NKCA 1QXLA 2JKPA 1VHNA 4WXYA 3SCQA 1JDDA 3AIUA 1W1B1 4UTTC 4R34A 1RA0A 2Z1KA 1KBIA 3LENA 3LRKA 5GJMA 3HGSA 4YVPA 4O28A 1U83A 3MP3A 3EOUA 2G3JA 2CLEA 5HNRA 4DELA 3MU7A 3N15A 5J8LA 4ZB2A 4GI8A 1JYWA 2X8RA 1CTNA 2J75A 3G3DA 5C0QA 4Q4OA 4LVAA 2DW6A 4TIMA 1H5VA 2GVYA 4ZOEA 3WEOA 3EMQA 4EF8A 3TH6A 2E9MA 1E0UA 4B5VA 2NV2A 3EX1A 3STGA 1E1FA 2V67A 3ITVA 2A7RA 4ZQPA 3W85A 1L6FA 1DQXA 2YCLB 1FXQA 3ABZA 4QRNA 2J25A 3HPFA 2BY1A 3M7WA 5T26A 3AMDA 4IQJA 1MRAA 2GUUA 1AJZA 1XV8A 3AUJA 1SYTA 4PUWA 4TMBA 3P2VA 3QR1A 1EA0A 1Y5VA 4FIQA 3OVRA 5EBUA 1FWSA 3S3GA 3W7KA 1VBHA 4Y9NA 4H8VA 3T4CA 3GIPA 5M03A 3SIZA 1PX3A 5DMLA 4MB3A 3UR5A 3PK7A 3U2CA 1QK2A 2GWNA 1DYSA 3WQEA 3BSHA 1VEPA 5F2IA 4C7FA 4EK7A 3GW3A 1XYZA 4P7LA 3PJTA 3TOYA 5K3VA 1OCJA 3LHVA 5HMSA 3W28A 1QHOA 4JNZA 5I09A 4B3KA 3JW7A 3EWBX 1WAWA 4LFYA 1SO6A 3GC5A 1BF6A 2O9RA 4C6NA 1V0MA 3DHUA 3FYPA 2ZRXA 4DVOA 1Z89A 1PKYA 5D2XA 4V27A 1UASA 3DYOA 1KQZA 1XRVA 3IV3A 5JUVA 3HV8A 3L0NA 4E4PA 1E72M 2PZNA 4WY0A 1HKVA 4CLMA 4YXGA 2VD9A 3KZSA 1EHNA 4LEFA 4NRRA 2NLIA 2YBTA 3ZWSA 2A6LA 3T40A 4US5D 3UXDA 2ZXBA 4ZA0A 2YDSA 1BWLA 1K7XA 4QLLA 5I2UA 2F6UA 3OZOA 4G7EA 5ABTA 5DQPA 5EMUA 1M7JA 2Z2UA 2ZE3A 2TAAA 2Z1SA 4I9JA 4E38A 1VFFA 1CXFA 1N8FA 3MMTA 2VC9A 1VB9A 3J7HA 1JRBA 1VD6A 2X30A 4S3FA 3STFA 1K8CA 4Y7EA 4NF7A 1OFAA 3P5YA 1YNQA 4K1GA 3B05A 4MGGA 1UKOA 1GQKA 4MWAA 2Y8VA 5BOEA 4NY2A 3N9KA 2YA0A 4I9MA 1LG1A 2R1PA 3FAXA 3OVGA 3DIPA 5HA7A 3LK6A 3W2JA 1PIFA 3O63A 2Z25A 3RK8A 5KITA 4H8NA 3ZSTA 2CHOA 4FX6M 5CPQA 2DY3A 3QSRA 3C61A 4M5PA 3EWYA 5A6KA 1KR0A 1B5TA 1U30A 4Z42C 4J40A 3PZ9A 3RLVA 5ABEA 2ZBTA 4W93A 2XGIA 5A5WA 1O94A 1SR9A 2NSXA 4BQ3A 1XLDA 1FWAC 2F84A 5AOUA 3ATZA 2YFOA 1XPYA 3GLCA 4GQQA 4WDTA 3IJ8A 1UWAA 4C6JA 2V3DA 1DWFM 4KERA 5FD0A 3MSDA 1B3WA 4RE0A 3KOYA 2FGZA 4ICCX 4J35A 2BZNA 3BCFA 5D9OA 3HQNA 2V5CA 4KF1A 4TQTA 3VIFA 2VGFA 3I3DA 3GHUA 1JD7A 4AZ5A 3W2KA 2ZCGA 3PB2A 4OOZA 4AHOA 4C6LA 4JKKA 3WBYA 3LV6A 1EF3A 2W62A 3VINA 1ICQA 3AHVA 1OCNA 2YDAA 4LY4A 3BWWA 1L8PA 4GO9A 1RA5A 1W32A 3NXLA 1PX4A 5E0CA 4AD5A 3PZTA 2Q3RA 3CUJA 1DIKA 3QZAA 3LPGA 4M8UA 1KWGA 1IYXA 1XIDA 2ZUUA 3V0UA 1ZBWA 2PC4A 2WSRA 5CAHA 2YYTA 4J3UA 2EXOA 1Q6EA 3ARWA 3UR8A 2ZXDA 3L7RA 1KD0A 1XS2A 1QWKA 1LOQA 1OYAA 1V51A 3TCSA 3RU8X 5FCZA 4TTGA 4NL1A 2D20A 4S2BA 3FAWA 2QDEA 2OZTA 3OZPA 2CIPA 4P8UA 3Q67A 1I8JA 3L0KA 1R46A 2ZICA 4JQ3A 4JFVA 1E4IA 5G1TA 4JX5A 5HJLA 5MKGA 2ACRA 1TUFA 1KBBA 2YL5A 4IIBA 4DEFA 4Q22A 4IIFA 5TAOA 5CXPA 3HU7A 1XYAA 3GC4A 2J7CA 2KX9A 4DBDA 4EWND 1Q2RA 2XHYA 2VP8A 1KRCC 3M16A 2EJAA 3CUZA 5K2ZA 2HXUA 1NM9A 1GHRA 2YL9A 3GXMA 1XIIA 3LRLA 4HSOA 3BC9A 2X1RA 3WF4A 2DUZA 4IZGA 1GZ1A 5HJYA 3T0AA 1XDMA 3R2GA 4S3GA 3WDQA 3WH8A 2NLYA 3LTPA 3NEVA 2BBFA 1XLBA 3U2ZA 1DHPA 1OGBA 1EQPA 2WVVB 4MUPA 4HNNA 2G3IA 2YL6A 4MDPA 2BB0A 1UR4A 2J9XA 4JTCA 6A3HA 3HPZA 2GZXA 2GL5A 2QF7A 3DFYA 1ADSA 2VDGA 2VZVA 1KM1A 4ZE4A 3GFYA 4JCMA 5D2VA 2XGBA 4XQ6A 2VEPA 3UPBA 3GH4A 1MW3A 2WMFA 1IT8A 2PP3A 4IUOA 1H49A 2P0OA 3KRUA 3W26A 4JAWA 1FWGC 2H3BA 3S2LA 1I2PA 4V33A 3H7VA 3H53A 1AW5A 3VDHA 3UG8A 3SGUA 3R58A 4K7VA 1NWSA 1UR8A 4YU1A 3P8JA 4BA0A 1Q45A 4MB4A 1I4NA 1BYCA 4LS0A 1GG1A 4CQDA 1KCKA 3V0SA 5G4HC 5ABFB 1EH9A 3P84A 5LHFA 4IG2B 1N2VA 1VPXA 5C9WA 1ZP4A 1PV8A 1NWTA 4MKSA 3TXZA 1EC7A 2QIWA 4LS1A 1NWRA 4IMGA 1E0VA 3OGRA 1OC7A 4AZ7A 4Y9MA 2DT2A 4AFYA 3U4FA 4IJBA 1O5XA 1TV3A 3EOEA 4ZB5A 1E9IA 3TTEA 1JCXA 2PP0A 4GIRA 2JALA 4E3TA 3IJ9A 1V3KA 4LT9A 3MSRA 3GUWA 4DUVA 1KXQA 4JHMA 3UNTA 4CVWA 1AL8A 4GC4A 5D8WA 2DP3A 4C6QA 2CZEA 1D8CA 1PJ9A 2Q8LA 1OJXA 1ADDA 1NFPA 3E0WA 3BO9A 1E0XA 3T9PA 3TR2A 1EYWA 4ZZ9A 5G2IA 1KNWA 2V5BA 1IEXA 4V15A 2DT1A 4TR9A 5FJTA 4ACYA 2OELA 3RPDA 4WZHA 1NF7A 2FVLA 1UIPA 3SBFA 1XBYA 3WUBA 5D9PA 3H55A 3GTXA 4UCFA 3TK7A 4JTJA 2C15A 1G4EA 1KFEA 4HIBA 2AAMA 1W1VA 3KZPA 3FGCA 1JEZA 4O4VA 3E0LA 2GVLA 2VENA 5CCZA 4MFDA 2YXGA 5C2XA 4JICA 5HUOA 1E5JA 2DZAA 3HPSA 4KCWA 4LUJA 4IXHA 4LC8A 2KZHA 3WLNA 3L12A 1ZNNA 4AIOA 4QCFA 3CH0A 1E6ZA 1D2KA 1QTWA 2WC3A 3KP0A 2ZZ2A 4HSHA 2VI0A 1PTDA 3UR2A 2GYIA 1SGJA 5CSYA 1CB2A 1S5VA 1XJBA 3B8SA 3CM4A 3HTWA 1KTBA 1JZ7A 2E6FA 1PXGA 4FF5A 2FGLA 4DO5A 2ATSA 3IVSA 2D24A 2PWVA 4CN4A 3S2NA 3LHUA 3CMGA 4PCPA 3QY7A 4ZODA 1AH4A 1UR2A 3M5VA 4GI9A 1XLLA 1MDRA 1Z42A 4OBRA 3WQCA 2VMFA 4JN6A 4AY8A 4C5YA 5AECA 2V68A 2GFTA 4HHLA 3BLIA 1F76A 3VFLA 2VGIA 1UYQA 4HVXA 3BAJA 2YL8A 4XG1A 7REQB 3THAA 4HHPA 2WYSA 1I2RA 1U33A 4ERAA 4FXFA 2DU2A 4PMVA 4O52A 4XAPA 2W61A 1OF6A 3R0UA 5HK4A 1QJWA 2CITA 1TJ1A 1W3LA 3LBMA 3GVWA 3KL5A 2BSLA 2ODOA 4AD4A 4EXQA 1LBMA 4B92A 4ADTA 3SSZA 4HPNA 4MNLA 3MDWA 3SUVA 2IKJA 2HMCA 5C2GA 4IIHA 3QR3A 3LX9A 2BOFX 5AC6A 3EEGA 4W85A 5AHLA 2RDWA 3TLLA 5FJUA 1MEHA 3B0YA 5FEZA 3ZVHA 1MNSA 2BP1A 3OODA 2GGIA 2Y4SA 3KVLA 1QCWA 5AYBA 1H62A 1A5MC 3W22A 5DRIA 2ATMA 4JL1A 1S5TA 1XLKA 1Z69A 3VGFA 3LHZA 2OT0A 3L4ZA 4ROQA 1ITXA 3RX2A 4CD8A 3ITLA 4GUGA 3TYZA 1HJUA 3CV6A 3KDOA 3QHOA 3U6WA 2HSAA 1LT8A 1B31A 2AL2A 1Q4WA 4Y96A 4YTSA 1TQXA 2CXGA 5LA0A 3DKLA 2XJ7A 2CBIA 3N2OA 1WCGA 4AZHA 1F2JA 2ZA1A 1EBGA 3FSUA 6TIMA 2RAGA 3F4CA 3C2RA 1YTDA 2VC5A 1JZ4A 4FNSA 1NQKA 3VIMA 1GVRA 1GQNA 4YLWA 3IS4A 3LCHA 5AKQA 2QJNA 5FKYA 3G1RA 4QLJA 2J6VA 3MUY1 1TE1A 4RCXA 1P6BA 2V82A 4BF5A 3DAQA 3VCNA 4F2BA 4MZ1A 4LRTA 3B9AA 4RPQA 3CQKA 1XQKA 1PCKA 2GUBA 1XFCA 4BEUA 3H2NA 3HJEA 4GOAA 2J7GA 4DO4A 4FP1A 1TE6A 3GNOA 3N2MA 5XIMA 3NQDA 1WDSA 5I24A 2ALDA 3BH4A 3U8GA 4IJRA 3DC8A 1REQB 3C4UA 3TXVA 2EG6A 3JUGA 3VX0A 1JL8A 1HGWA 2W63A 5TQLA 2XM2A 4ZFCA 4Q4MA 1ZJAA 1BWKA 1FHVA 4ZO7A 2J8GA 4FAMA 4DF2A 2XIBA 2V3FA 1FHDA 5GQBA 1DJYA 5LA2A 3W1NA 4QJ5B 1W5QA 1UH3A 1WKYA 2MNRA 2GJPA 1ZHAA 2PZ0A 5AHIA 3G0UA 4TX9A 3P6LA 1M7OA 4FALA 1NU5A 3A3XA 3HQOA 4WRHA 3B0UX 1SW3A 1V6UA 1KLZA 3OGVA 1HX0A 3P0WA 3PULA 4RE2A 4GYPA 1Q6FA 4JOMA 5T8GA 4FNTA 4XVDA 2YDQA 3CTTA 2VRQA 1GQJA 5IHSA 7CGTA 1J93A 2HPIA 4IQDA 4NYUA 3WH9A 3P0XA 3LXAA 2J8TA 1HL8A 4GZ7A 3U2EA 3CUIA 3WF0A 5KZEA 2YKKA 4AYGA 4J3XA 1O5RA 1RK6A 3WEMA 4OFCA 4EVZA 3IV8A 3ES7A 3IVUA 3GH5A 1XHGA 1Z3NA 3VIPA 1YE4A 4IIDA 4N9BA 3G22A 2JK2A 3IANA 1NEYA 3AXMA 5ECVA 4S3JA 3M0HA 4Z1DA 2ZUWA 3BICA 4MPKA 1JUEA 3L5LA 3OEXA 2GWGA 1QUMA 1JF6A 3WQOA 1HJQA 2RGMA 5C71A 1IWPA 3GTHA 1W9XA 1ZUAX 4XV0A 4GGHA 3A12A 4GQ0A 4QQ3A 4IMAA 1AODA 3W29A 1E9YB 4JD4A 4UFIA 4CGTA 5KTLA 7TAAA 4UTUA 3V18A 4O18A 5A6TC 1BVWA 3GFXA 3IIVA 3FN9A 2C19A 1EP1A 5F4XA 4IF2A 1UQYA 3OB8A 1GJWA 4GQBA 2ON3A 3RU6A 2FDSA 5AY7A 3POHA 3V75A 5G2HA 5BWFA 4WY0F 3SN4A 4NJJA 4PR4A 4UOQA 3LDVA 1ZRQA 1XRTA 2PDYA 3BCJA 1JRCA 4Q7IA 1XINA 1IXOA 1DTUA 3BANA 4JQ4A 3WLOA 1QNSA 3DDMA 3CQ0A 3LRMA 4QJ3B 1E9ZB 5FOOA 2D22A 2MUCA 5CSSA 2H8ZA 1YPFA 3BVJA 1LRQA 3HURA 3TN4A 4RNFA 5IDZA 1I0BA 3QC3A 4QDWA 3U4AA 4GRSA 2OO0A 2VQUA 4B5XA 3BZGA 3VD3A 4UTIA 3NZGA 4Y9AA 5G1MA 4PB3A 2OWWA 1QWGA 1W3NA 3IVTA 4XZHA 4ORIA 4W8AA 2IUZA 5ENLA 2DSZA 5FF7A 3MHGA 1UWQA 4JTGA 2E5BA 3BURA 1RSCA 4ZVJA 1XYCA 4K6AA 5I3KA 2CZDA 1ZENA 3TVAA 4JTDA 4PSRA 4DRSA 1QI2A 1BKSA 1PSCA 2J62A 4WKHA 3JZEA 4GCXA 4JTQA 5E0FA 1M5WA 2I17A 4EOUA 3P14A 4RV3A 4AAJA 2UY3A 1M65A 4JTHA 5LGZA 1E4MM 2F2HA 3DKJA 3HJZA 4NHVA 3MWCA 1UD4A 3HQPA 3RMJA 2WZEA 1UZ4A 2V5KA 1NTHA 5H8UA 3P62A 2DUXA 2JF7A 3TR9A 4DJDA 3AXKA 3L23A 3TWBA 2B0MA 3ZFHA 3LI1A 1R2RA 4IGHA 4HPJA 4GXWA 4JNYA 1VFMA 2DSWA 1IGWA 3MBFA 2F61A 3ZWTA 3V5OA 2YOCA 4EPDC 2OLHA 3IJ7A 5CC7A 3OLIA 3UQNA 1K70A 1OG0A 1XGDA 2HISA 3TTQA 3NZQA 3HIJA 4J4KA 4P5UA 2GOKA 2EPLX 2DZSA 1KRAC 3OZMA 1XLJA 1RJRA 4RNJA 4JIEA 4D6IA 1M1BA