4Q33A

Crystal structure of inosine 5'-monophosphate dehydrogenase from clostridium perfringens complexed with imp and a110
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
357
structure length
344
Chain Sequence
MARILKTAYTFDDVLLVPNKSEVLPNEVSLKTQLTKKIQLNIPLMSASMDTVTESKMAIAMAREGGIGIIHKNMTIEDQAREVDRVKRSGGLLCGASIGVTNDMMERVDAVVKAKVDVIVLDTAHGHSKGVIEGVKRIKAKYPELQVIAGNIATPEAVRDLAEAGADCVKVGIGPGSICTTRIVAGVGVPQLTAVMDCAEEGKKLGIPVIADGGLKYSGDIVKALAAGACAAMMGSIFAGCEEAPGAIEIYQGRSYKVYRGMGSLGAMAKFVPEGVEGRIAYKGHLADTIYQLIGGIKSGMGYLGAPTLENLYENANFVVQTSAGFRESHPHDINITKEAPNYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase
publication title Crystal Structure of Inosine 5'-monophosphate Dehydrogenase from Clostridium perfringens Complexed with IMP and A110
rcsb
source organism Clostridium perfringens
molecule tags Oxidoreductase
total genus 102
structure length 344
sequence length 357
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4q33A00
2G97A 2HMCA 3UY8A 1WYIA 2Y85A 4JY9A 3BLIA 5F2LA 2Z6JA 2WKJA 2AQWA 1F76A 3NPXA 3E96A 1JULA 3USBA 5HNRA 2CLOA 1LROA 1YPFA 2C19A 3MYPA 4P61A 4O1BA 3DKLA 2DZPA 2G96A 1OF8A 3FA5A 2PRHA 3IIOA 1Q6LA 5G2WA 1XCFA 2ZZ4A 1W3NA 1W5QA 1I2RA 4Z1CA 5T26A 1FY6A 1KFBA 4JXCA 2CW6A 3NL3A 5AYZA 3L5AA 4AWTA 4WUIA 3THAA 1OX4A 3W7DA 2FLIA 1TPDA 1ML1A 2EPHA 2CLEA 4MY8A 4TMBA 1Z44A 4PFMA 4O4WA 3TJXA 3P8JA 3G1XA 4WY0A 4MZ8A 3GXTA 2Z2UA 3DI0A 5D03A 1W54A 2VEKA 1EWEA 3NAVA 2NX3A 1WA3A 4IPJA 5FF4A 3NOEA 1F73A 1QPQA 3LTPA 1SUXA 3FIGA 1J5TA 3S42A 3TK7A 2QCLA 5H2ZA 1KFLA 5CKSA 4JDBA 2GVLA 3P5YA 1OX4B 2OX1A 1XI3A 5FI8A 1FBAA 4DXVA 2QJGA 4JTGA 1OHLA 1OX5A 4POCA 5AHLA 3OG3A 4K8HA 3MMTA 4AXKA 3W74A 1H7NA 3B04A 3UWZA 1TPC1 1SR9A 2Y6ZA 3C2EA 1K8ZA 3OIXA 4A22A 3G3DA 3MHFA 3W7RA 1TYGA 3PUDA 3O63A 4TX9A 4H4IA 4CQ8A 3S1XA 2Y61A 4MKNA 2Q3RA 2NX1A 4LC6A 3H54A 4UFLA 1L6SA 4N9DA 3HO8A 1I2OA 1X1ZA 3UXDA 2NXHA 3KX6A 2GOUA 1KFJA 5D2WA 4M6PA 3P60A 2V30A 3L2IA 1K7FA 2RDUA 3HG3A 1UBSA 3DH7A 1OFQA 5FF0A 3GKFA 1A53A 4GUIA 2J9XA 3BARA 5KTLA 2XFWA 4YWIA 4O0ZA 1OFDA 4JNMA 4FIRA 4MPQA 1Q6RA 5D05A 3TROA 2VELA 3W7EA 4LS2A 4LVDA 4JDYA 3TXVA 3VNDA 4BI7A 4FX7A 1L2UA 2OMAA 5HR6A 3C56A 1C29A 1B4KA 1H1ZA 1Q6OA 2D73A 3L68A 4N9BA 5L9FA 4UTUA 3A24A 3N9SA 2J88A 3OEXA 4HNTA 1A5CA 3PSVA 1OJXA 3KXQA 4N2YA 2QDHA 4PTNA 2P10A 3G1YA 3C52A 3EWZA 1G69A 3IIPA 2QCGA 1R46A 4I9AA 1Q6QA 3S6DA 2E6FA 1SW3A 2Y63A 3IGXA 1YTKA 4FNPA 3W22A 2QCEA 4AAJA 3P80A 1ONRA 5DBUA 4M5PA 1KFEA 3LDVA 4RLIA 1TMHA 3A23A 3GIYA 3W3OA 2PC4A 2WSQA 1NSJA 2CLHA 3F1QA 2E6YA 3SGUA 4EOUA 3LV5A 4MIMA 3CWNA 1IIHA 4IOTA 1NVMA 3HGRA 2H8XA 1VPXA 1ME7A 1YDNA 2ZTJA 3DI1A 1WBJA 1UJPA 1I2PA 1G7VA 1FCBA 4RCXA 1LZOA 3D0CA 1K8XA 1C8VA 1UASA 2FQIA 1JCYA 3B0VC 3GB6A 4WZHA 2CU0A 2CZ5A 4O1CA 3WJYA 3DHDA 4IMCA 1WX0A 2BX7A 1PV8A 3O07A 4K38A 4JICA 1Z42A 1A50A 3C2RA 1GJPA 1DHPA 3EWUA 4XTIA 5LZLA 4LT9A 3GNDA 5KZMA 1ZAIA 5K9CA 1VC4A 4Z0SA 4IMEA 2NV2A 3IV3A 4AWUA 3NQAA 3SFKA 2QEZA 5A5WA 3GX9A 2Z6IA 1KLZA 5KSWA 5HR7A 1EB3A 3NPWA 2FDSA 5C2XA 2VFGA 3ANYA 4OE7A 2WJZA 1T8XA 4R33A 4RKAA 2BTMA 1XBZA 1E51A 1LP6A 4UNKA 4Z08A 1AW2A 3KVLA 3QEZA 4M7SA 3CIWA 2EHHA 1W31A 5IBXC 2PURA 4O8RA 4QAIA 1T99A 3OBKA 2RDTA 3G0UA 1JRCA 1QPNA 1YXYA 3YPIA 3F4WA 3NQ6A 3M5ZA 4HSNA 3GXPA 3P74A 4G1KA 1R47A 2A2IA 4PODA 1OK4A 4QIUA 1NAL1 3LCWA 4K7VA 3M0ZA 1GPWA 3W1NA 1EA0A 1QPOA 1W5OA 4IMFA 4IMDA 4UCGA 5FESA 4JTUA 1TPEA 1XUZA 1JCMP 1FX6A 2HSAA 3LCIA 2ZRXA 5L6UA 1YDVA 4FNUA 5KMYA 2W79A 3W6YA 4WJEA 4HNUA 4HT3A 4HNNA 4ICNA 3RLUA 1K03A 3WFAA 2YW3A 1M6JA 2ZQ0A 1ICQA 4O19A 3UPWA 1TO3A 1TV7A 2ATSA 3KRSA 4NZJA 2Y7FA 1QWGA 1HL2A 3ABRA 1OG0A 2O7SA 5HUOA 3LXCA 3MI2A 3HOJA 2H90A 3BPWA 1IXOA 3MHUA 1ADOA 3UWWA 3G1DA 5E1QA 5AHFA 1F05A 3PS7A 3TNOA 2V2CA 1LRNA 5K2ZA 3N9RA 1ZALA 3EB2A 3LGEA 4FIQA 2P1FA 2VFEA 3KRUA 4J9JA 3P8IA 1RQHA 2QCDA 1VS1A 2Y7DA 3H55A 4NJJA 4O57A 3QRHA 3BG5A 2V82A 2ZRYA 3N2XA 4HPXA 4ADSA 3O6YX 3L9CA 2AGKA 5H91A 2Y70A 1PIIA 3DHFA 5BNKA 3FJ6A 3S5YA 1L6YA 1F6KA 2CZDA 3IIVA 4ZQNA 5CZ0A 2QCDB 1IXNA 1EIXA 1LBLA 3VE7A 2TSYA 3RU6A 3EXSA 3TQKA 3PAJA 1IXPA 3IGSA 4RXGA 3LRLA 4XUGA 1F74A 4YCOA 1S5VA 3NVTA 5TQLA 3HPZA 4LVGA 4QITA 4TMCA 4AVFA 4O52A 4I7UA 4H3DA 2RKXA 3GAYA 4BK9A 3L21A 4NX5A 2DU2A 5TIMA 3QF0A 3LI1A 4M19A 3PG9A 3G1HA 5DY3A 3TAOA 1NEYA 2E5CA 4TO8A 1VRDA 1QOQA 5LNSA 3QPZA 3LRMA 2VOMA 4CNOA 5G4EA 5DBTA 3EWBX 1G4SA 4W9TA 2QCHA 2DP3A 4N6EA 4AHPA 3TMQA 4C1LA 4OHQA 2CLFA 1YTDA 1I45A 1VZWA 3HQ1A 3P7YA 2CZFA 4O4VA 4PH6A 4BWLC 5EL1A 3B06A 1TSIA 2QJIA 1H51A 3KVJA 5IBXA 2R94A 4IXXA 3B05A 4O1AA 3BGGA 3GKAA 3UZ5A 1GOXA 3GDLA 4EVZA 4UMBA 2EF9A 1SO3A 5DELA 2XN2A 3W84A 1FQ0A 3FYPA 4JR5A 2VENA 3LM7A 5LHEA 2YX0A 3I6RA 1AW5A 5HINA 3SIZA 1KM3A 4FEZA 3BK0A 2YYTA 5LNWA 1W8SA 3G1VA 3NQGA 3TIMA 2BWGA 1THFD 3PWAA 4O54A 5HULA 1QCWA 3CWOX 3WJXA 3NL6A 1KTCA 3TMLA 4UFKA 5BMXA 4NNCA 1KA9F 3CEUA 1ZY9A 4GXMA 3EWWA 4IUOA 1CW2A 3GR8A 1C9DA 2X30A 3W7PA 1EP3A 1TPFA 3DZ1A 2A4AA 1MZHA 1W5PA 1TQXA 5K4ZA 3EWYA 2H3DA 4L4LA 3DAQA 3DFOA 1TTPA 3UQNA 4MZ1A 4WY0F 1SPQA 3EX6A 2Q8ZA 2QUVA 3UWYA 2BXVA 2W0UA 5EA9A 1JCJA 2DJLA 3TQVA 4UTTC 1SO6A 3QM3A 4MOZA 4RZ5A 1QMLA 2GPTA 2RFGA 3BV4A 5DCDA 5HWNA 3THQA 3VFLA 4LU0A 4WD0A 3W7CA 4GE8A 2Y88A 3NR0A 3NQVA 3FS2A 3EX4A 4ONVA 5E93A 4DO4A 3UNDA 3HG5A 1TRIA 4O15A 1ZNNA 4X2RA 3TC7A 1G7UA 4JTTA 2OT0A 3LB0A 4HIBA 3ZFHA 2TYSA 1KTBA 1W1ZA 3E9AA 4JTEA 4UTMA 3QSRA 1XBYA 3C0JA 3PBVA 1A5SA 2WNQA 3NZRA 5DCBA 3LCFA 3QW4B 3W2NA 3P61A 1VGAA 3EKZA 2UV8G 3HIJA 1JRBA 3FEMA 2X2GA 3IVTA 4IMGA 2WSRA 4YL2A 4O13A 2YCEA 3TU9A 3L67A 4E38A 1Z41A 3R2GA 4NXKA 3C6CA 4NJGA 5LKYA 3W87A 1BWLA 3DFQA 1FCVA 1EX5A 2WQPA 5CPNA 3U2OA 4RV8A 1FWNA 1ZJIA 1WQ5A 2GJLA 3S1VA 3BW4A 1A5BA 1GVFA 4O18A 3NQMA 3C61A 3HGJA 1YYAA 1KM0A 3O15A 5BMWA 3STEA 3DGRA 1ZCOA 4OGZA 1K3UA 4MJZA 4LV4A 4UFIA 3MI6A 2G95A 2WPBA 1OFOA 4O53A 4KFNA 5EYWA 1W3IA 4WQ6A 1SZEA 1KM4A 3SR7A 1B4EA 3AO0A 1GT8A 2YSWA 3OVQA 4RK8A 5K9DA 3PB2A 1VCVA 4BWLA 2I9EA 2C16A 1DQWA 4CNPA 1IGSA 4LRTA 4AH7A 3HG4A 5AN7A 3HPSA 1F7BA 4JTJA 2E77A 4PA8A 4JIQA 1P0KA 2ZBTA 5K4XA 1RR2A 2YGYA 4FO4A 1N55A 3BW2A 5HUPA 3TCEA 4WY0B 5G1YA 4DBDA 4DEFA 1MXSA 2FTPA 5CPOA 3RF9A 4O10A 4CQ9A 3IEBA 4WOQA 4RZ6A 2EKCA 3W75A 1D3HA 2JBMA 4AHQA 1KFCA 2OJPA 1OFRA 1H7RA 2JKPA 1I2NA 3ABOA 4ML9A 1G6CA 2C0AA 4XBKA 2F84A 2PRLA 1VYPX 3NEVA 5EY5A 2V5LA 2FB2A 2QAPA 1WOBA 3NPVA 2Z1BA 3S9YA 4R7JA 3P67A 2FJKA 1OVDA 1TREA 2WNNA 3NXFA 2R91A 1XDLA 3GNNA 4FF7A 1OFBA 3LHTA 3NQ7A 2V2HA 1YDOA 2QCMA 2OCZA 1H7WA 2B7PA 4YLWA 4YXGA 1LRTA 1DKWA 2DORA 4UTHA 5C5YA 2B7QA 3JS3A 1AK5A 1JCXA 1M7OA 1IF2A 1W5NA 2PCQA 3EKLA 4NZFA 3M9YA 2DZUA 4UTTA 4CQAA 1FWTA 2C18A 3P62A 3LRKA 5C6MA 4RX0A 2ZZ1A 3M44A 5GVJA 3ATZA 4C1KA 3Q37A 3NL2A 5D2XA 4P2VA 3W7QA 1ZENA 1GYNA 3QYQA 2E5DA 2WOQA 4KWVA 3W7OA 1LBMA 4RR4A 5HJLA 3NA8A 3ATYA 4ADUA 1MEHA 3P5ZA 3HGOA 2WV8A 3NQDA 2VXNA 4GUHA 2VEMA 1JQXA 5SWUA 3W2MA 1P5BA 3O05A 3A21A 3TW7A 2ZA1A 5BW6A 2PE4A 3GDRA 3Q94A 1LOSA 1ZAHA 3LCXA 1H62A 1KTNA 4DO5A 3MO7A 3W72A 1UUOA 1XDMA 1X8FA 5D33A 1SFLA 4MLRA 4FNSA 2NV1A 3G24A 5G5IA 1U5JA 5K7JA 1W0MA 3L0NA 4KWWA 1ME8A 1JCNA 1SQ7A 1VCGA 1YXCA 1CI1A 3OHIA 2HS6A 3W07A 2A7NA 6TIMA 3TA6A 3ZWTA 2BSLA 5D30A 1KM1A 1WDWA 1DJQA 4AF0A 4BF9A 2FPVA 3LCHA 1FWWA 3CEPA 2NWRA 3W7MA 2FB3A 4EF8A 1TCDA 3W1XA 5CZTA 1O95A 4YCPA 4WOZA 3WJSA 3NQEA 1SSGA 2F7FA 4PC8A 1TB3A 2PRMA 2C1HA 1A5AA 1RQBA 3ABQA 2A21A 1QOPA 3TE9A 2YFNA 2ZRZA 4RJEA 3I68A 1OABA 2EAWA 4N9EA 4E2DA 3L0GA 4IXHA 4R34A 4FHAA 4Q33A 4FXSA 2C15A 3BGJA 2VKZG 3CHVA 4JX6A 1AW1A 4AWSA 2E1DA 3M5VA 4OU1A 3R5EA 1F2JA 3C2FA 2YDAA 1FWSA 3CU2A 4JYFA 1G4PA 1OYCA 3P84A 4QSHA 4GJ1A 3TW6A 2GUUA 3MUXA 2ABBA 3TJLA 4NNAA 3G0XA 1M7PA 2DZSA 3T55A 1OYBA 4O14A 3HF3A 3QFEA 4FX6M 4TU1A 3TQ0A 4A2SA 4TIMA 3IIZA 1DJNA 3QPYA 3W1TA 3GZ3A 5KINA 1IIGA 1Z48A 3Q58A 2V8ZA 2WO5A 1VHNA 2CFFA 2YPIA 3G1SA 1EEPA 3R8RA 4CLMA 1O94A 3A22A 3S8HA 1YPIA 3LBCA 4MY1A 3PBUA 2KZHA 3I7RA 1K02A 4MZYA 2QUUA 1QO2A 3QMRA 1Q45A 5AHMA 2W6RA 3NPUA 2NUWA 1GG0A 3PR2A 3LV6A 3RMJA 2J27A 2J24A 3BLFA 3DENA 4NT0A 5F2GA 4D2JA 4NUWA 5DCEA 3PM6A 1O5KA 1JJKA 3M47A 4Z1BA 1LOLA 2ZZ2A 5F2MA 4Z0JA 1BEUA 1FXPA 1GVOA 3C2VA 4X22A 3OA3A 3BG3A 2ZDRA 2YW4A 3SY5A 1YXDA 4MLJA 1N8FA 3PULA 3W85A 4XTDA 4ZQRA 1FXQA 3GDMA 3N2MA 3O06A 2B0MA 2GVJA 4PL1A 4KFOA 5F1UA 3JR2A 3MP5A 5AHEA 1WAUA 3WJWA 3TSDA 2GJNA 4LV9A 1HG3A 3PF3A 3SSJA 4OV9A 2J9YA 5BRBA 2QF7A 3FOKA 4O0KA 4CCDA 3BW3A 4LNYA 1VLIA 4N02A 2HTMA 1R2SA 2ZYFA 1GQNA 3N19B 1B9BA 2GQ8A 4DQWA 1TPH1 2JGQA 1TPVA 1VQTA 5I3JA 5A8GA 3SGZA 3MBDA 3O6CA 2VFDA 2J6XA 2VFFA 4UTKA 1ZHAA 3MYOA 4ORMA 3IGUA 1JQVA 3NYZA 3NM3A 3W73A 3KFTA 3R89A 2H6RA 1ME9A 1DL3A 1QPRA 1RPXA 2FIQA 4LUJA 4NX0A 3LBMA 3G1AA 1K8YA 4JTIA 4FNRA 2R14A 1RD5A 2I14A 1PCKA 1EWDA 4DPQA 4LRSA 4NU7A 5I3FA 3B4UA 3M7WA 4ZQMA 3C2OA 2YXGA 1KFKA 4K39A 3UY7A 1W5MA 1YTEA 4XBSA 1JVNA 1W3TA 4HPJA 3WK3A 2DZWA 3W7LA 4QNEA 3NM1A 1SFJA 4IGHA 4LVBA 4OV4A 3W2LA 1F5ZA 1QFEA 4ZMGA 3G22A 5F2IA 1QAPA 3T4CA 4JTFA 3A5FA 3C8FA 4MYAA 3TXZA 4EWND 3NZ1A 5FEPA 5BOOA 4LS0A 3TKFA 4LWWA 3S5OA 1TIMA 5D2TA 1FCQA 4UFJA 3L5MA 3W86A 1UB3A 3O16A 1VH7A 5MHBA 5HWJA 4JTHA 3I7SA 4IX0A 4MVAA 4NJHA 3TFCA 1R2TA 2VFHA 1GVSA 4PL2A 2VC6A 5HWMA 1XBVA 3UYCA 3PG8A 3GAKA 3GK0A 2NZLA 4IWWA 4MJMA 4Z1AA 5G2HA 1DV7A 4CCCA 4U28A 3F4NA 3FYOA 3CM4A 2ZZ3A 2Y89A 3SW6A 1S5WA 1L6WA 1LLZA 3DXIA 1KLYA 3W1MA 1ALDA 2Q3OA 4O50A 1GVQA 4HNVA 4UXDA 3LTSA 4K6AA 3NQFA 3PC0A 4WXYA 4GUJA 5HMSA 2ZZ7A 3A5VA 1TPUA 3H53A 4M7TA 3STCA 2NUYA 4JD4A 3IRDA 2OZ0A 1SW7A 1RQEA 3QC3A 2JGYA 4O16A 2C14A 2Y7EA 2B7NA 1H1YA 3N73A 5AOUA 4I7VA 1GG1A 1O5XA 1SZFA 3W1LA 1SO5A 1O4UA 1S5TA 3DFSA 5AHNA 5EBUA 2B4GA 4Q4KA 2CLKA 4O28A 4LVAA 4K36A 2V9DA 2WNZA 3BO9A 1PVNA 4JN6A 1W56A 4K7YA 3W7HA 5K3VA 1QR7A 1IXQA 1HUVA 1VR6A 5I3HA 3E12A 1PE1A 4XQ6A 3RLVA 1H50A 3EXTA 2Y7GA 3FFSA 2C3ZA 3BG9A 2H3BA 4UTJA 1QO5A 4ZQOA 3MP3A 5KZEA 2ZRUA 3LHVA 3MHGA 3DBPA 3TFXA 4LS1A 4DBEA 3G8RA 3LTYA 1LDCA 1AG1O 1X1OA 3STGA 2QJHA 3KVMA 4XZ9A 2QUTA 4Z1DA 5ABTA 5D38A 5CPMA 4LVFA 3W2UA 3UPBA 5D02A 1FDYA 2ISSA 3M41A 5LGZA 4I7WA 3OVRA 1YADA 3PUOA 3RNDA 2RDWA 4A3UA 4JS3A 4JTSA 3M6YA 3R13A 2ISWA 5CG7A 1OFAA 2NLIA 5LSMA 5D2VA 1BWKA 3ELFA 3CPRA 1Q3NA 3SECA 5DXXA 4U4MA 4CNNA 1PHQA 3GR7A 3IVSA 4MY9A 1GVRA 1D3GA 4UC5A 5EKYA 1TPWA 1P4CA 4KKXA 5G2IA 3U6WA 1X7FA 5AYYA 2R8WA 4JYDA 5FF3A 1FDZA 5I3IA 1QDSA 3W70A 4FNQA 2VEPA 1LYXA 2B7OA 1RV8A 3LLFA 3CQ0A 1DOSA 3IVUA 1YLVA 3LXBA 2A5HA 1H7XA 4UFHA 3M5XA 1VYRA 4A29A 5KZDA 2X1TA 2JKAA 2QR6A 2QKFA 2A85A 3S1WA 3KVKA 1OK6A 4GWEA 2V5BA 3A9IA 1BTMA 4Y6GA 5CZJA 3DKJA 3HJZA 8TIMA 1R30A 1WXJA 4A2RA 3FJLA 2EGZA 5F4SA 3QQ0A 5D09A 5I3KA 3LHWA 4UR8A 4UNLA 5CSRA 1FDJA 1SZNA 2FFCA 2YZRA 3RFAA 3S5ZA 3CT7A 2V81A 4IPIA 3GLCA 4O11A 4FX8A 1LRQA 4KFPA 4Y9AA 3U8GA 3CLMA 4OT7A 5I3GA 1HO4A 4EF9A 4X3ZA 3L0KA 5LNRA 3ZS4A 3KOFA 3DFPA 3F03K 3GDTA 3EX1A 1OFPA 1XUUA 3QW3A 4GRSA 2QAFA 1F6PA 3MI3A 4FXRA 2GQAA 1V5XA 1GYLA 4GNJA 5AC7A 3N14A 5FEXA 1MO0A 3SI9A 3NQ8A 2BLEA 3W1RA 5LGXA 2ATMA 3W1AA 3BVJA 3NO5A 1S3HA 4FNTA 2DZVA 5AHIA 2E68A 4MYXA 3ZR4A 4B5NA 3LHZA 4DF1A 3WK0A 4BR1A 2HS8A 3G8EA 4RXFA 5C55A 5F1VA 1CX9A 3CIXA 1LBFA 1KM6A 3TSMA 4JY8A 1XC4A 4LOCA 1TQJA 1U83A 2J9ZA 1LM1A 1GEQA 2FPTA 2NWSA 3K30A 3V1PA 5DN1A 3W1UA 1KV5A 5CZSA 3NNTA 1JR1A 1OF6A 3M1ZA 4Y8FA 3PY2A 3G1FA 3W9ZA 3BLEA 1L9WA 4MUZA 4UTIA 4HN4A 4MFDA 3LCLA 1TTQA 1G67A 3B8DA 2O7QA 3IIXA 4XKYA 2ZCGA 3NG3A 3Q2DA 5CPLA 5K9XA 1K7XA 2X1SA 4JTKA 4GBUA 3P81A 3I65A 2QCNA 3LERA 4N6FA 2XN1A 4HKPA 3W7JA 1EUNA 1R2RA 2ZA3A 3W88A 2CLLA 5D37A 1EP2A 1JUEA 4GC4A 4NJKA 3O1NA 1WV2A 3T44A 3EWXA 1PL9A 3ABSA 4XKYB 3W2JA 4UMCA 1KM2A 5AB3A 4QJ1A 1WOAA 2ALDA 1PHWA 3O8AA 3GVGA 4IX2A 1GWJA 2G5WA 3NGJA 3L66A 2QCFA 2C13A 2QCCA 2RHGA 3DU0A 2QDGA 2YR1A 4XWUA 3TSBA 2TMDA 3QQ1A 2V0TA 3INPA 3QJAA 3S5NA 4JTLA 4E0CA 5DXYA 1GZGA 5DY2A 3CTLA 3E49A 5IM51 1H60A 4AF0B 3W2KA 1H61A 2ZTKA 3HG2A 1EP1A 4CCEA 3L65A 3C3NA 3QMTA 1WBHA 4O17A 3G0SA 4HSOA 3W7GA 4LY8A 1DQXA 1I2QA 2P0OA 1KBJA 3S0CA 1NF7A 2E09A 2ABAA 1I4NA 4JGDA 3LLDA 1VLWA 2NX9A 3GYEA 5LNVA 3W71A 1AMKA 4OBTA 4PEKA 1HTIA 2Q8LA 4UFMA 3PUEA 1AL7A 3TAKA 4LUIA 1TRDA 3W23A 4TR9A 1LLWA 5EPDA 4UTWC 1G4EA 2Y62A 3OVPA 3NQCA 2Z0IA 4DF0A 2JK2A 4LTSA 5TBOA 3T78A 4ZZ9A 1O60A 3LOTA 4GUFA 1VHCA 4FB7A 1J2WA 4N4PA 4BI5A 3TX9A 1UCWA 3QSTA 1EPXA 1B3OA 2ZRVA 2ZRWA 3TR2A 4N4QA 5AC8A 3VKJA 4ADTA 3KHJA 3O6DA 3RK8A 3CB8A 1FWRA 3UWQA 3MJYA 3W7NA 1TJPA 1HO1A 4Y96A 2ZA2A 2BZNA 1H5YA 1OYAA 3KAOA 2CLIA 1P1XA 3DFTA 1D9EA 4NVTA 1LCOA 3C4UA 1MEIA 3E02A 3G18A 1QNVA 4L4MA 4LW7A 3FKKA 5F4WA 3PB0A 4O1DA 4DPPA 1VCFA 2A7RA 1DORA 1SSDA 3I7QA 3V75A 1KBIA 4JX4A 1LTDA 3R12A 2YYUA 1ZAJA 4X9SA 1AL8A 4NNBA 1RVGA 1JCLA 5C54A 2A6NA 4S2CA 4ZQCA 3HPXA 4ZQPA 1I8JA 3QZEA 5D2YA 3EXRA 3W76A 3NL5A 4JX5A 1SZGA 5U7SA 3TDFA 2VEIA 6ALDA 1XM3A 3LCGA 2C6QA 5CSSA 3LHYA 1XFBA 2A0NA 3LXAA 5E0KA 1K7EA 1NFBA 4AB4A 5AFDA 5FEWA 2TRSA 1ICPA 4WXZA 4BFAA 4EIVA 5U4NA 1SW0A 4IQLA 1ICSA 4NQ1A 5AYXA 1G4TA 3QMSA 3UWVA 1T96A 1UUMA 3EEGA 5DLCA 1DVJA 1TTIA 1V7YA 2AAMA 2WSYA 3TV8A 1EUAA 4UIOA 5KITA 2CWNA 3T7VA 3AJXA 1MSSA 4O12A 4GUGA 1W37A 4OQVA 2LLEA 2A7PA 4HHPA 1N7KA 3M16A 3SZ8A 2CLMA 2IQTA 3W1PA 1TV5A 4M6VA 3W7KA 5EMUA 4QM1A 3MW7A 3N34A 4AMAA 2X1UA 4NJIA 3M5YA 1TJRA 4NXSA 3MWAA 3UWUA 2OT1A 1TPB1 2ZZ5A 3DFNA 4H6KA 3WJZA 3UD6A 4UMAA 1H63A 2ZFAA 4RZ4A 4OWGA 2GQ9A 5FEZA 4JIPA 3WK2A 3FLUA 3PBYA 3M43A 3VE9A 4AHOA 1BKSA 4R53A 3HMJG 1X6UA 3E0IA 7TIMA 2CZEA 4AEOA 4BI6A 5LHFA 4ALDA 3FKRA 3PSWA 1KM5A 4PCFA 1NF0A 2GVGA 3LX9A 2E6DA 3PBWA 4UTWA 3L5LA 4JEQA 3G3MA 3W7IA 1VJIA 4A21A 3JRKA 1B57A 5G4WA 5FF7A 1GTEA 4DELA 4N9CA 4S2BA 1KW1A 1TV8A 1P0NA 3N3MA 1FCUA 1OFEA 1ZFJA 2H8ZA 3ZWSA 5CGQA 3UXAA 3P82A 3S1UA 3VCRA 3W83A 1JUBA 2A1YA 2X16A 4E2BA 2TPSA 2DZXA 3LHUA 4JYEA 3UZJA 3PVFA 3NQ2A 3LI0A 5D32A 1T0OA 1GTHA 4QQ3A 4QISA 2ISVA 3CC1A 4S1FA 1XXXA 3STFA 4MFEA 1TTJA 4M6QA 3W1QA 3TH6A 3QH2A 3NDOA 1RZMA 2DZTA 5LNUA 1M5WA 2RH9A 3HB9A 1J4EA 1XKYA 3TUUA 2ZZ6A 2JKEA 5J5RA 4WX2A 3KRZA 2NXGA 1LORA 1H7OA 5FF2A 4K8EA 2E6AA 3VI2A 2E5BA 3HBLA 1HFBA 3B03A 4K37A 3GXNA 4UTLA 1FUYA 4ZVJA 2V2DA 2XN0A 1JUKA 5J5DA 2DJXA 3EX2A 4LC8A 3TC6A 2NUXA 2I1OA 4QNWA 1MEWA 1OX6A 5G1TA 1LOQA 1XL9A 3B0PA 3B0UX 1SU5A 4GFSA 5F4XA 4DF2A 4IJBA 5AC6A 3SJ3A 2YFOA 4Q32A 1SO4A 2A6LA 3MP4A 3MBFA 1H7PA 5HQEA 4UUIA 1VYSX 3WK1A 2NXIA 1PS9A 1Y0EA 3T40A 4Y90A 3EX3A 5D04C 4ORIA 1PCWA 4UR7A 4DO6A 3HGSA 3GDKA 2X1RA 1XBXA 4YMZA 1DBTA 2FPYA 4ZL1A 2VFIA 1KV8A
chains in the Genus database with same CATH superfamily
5B7ZA 5C9XA 1ZBWA 1IT8A 4JY9A 3WLPA 1W8GA 1MW1A 4MB4A 2ZICA 6PTDA 2Z6JA 2AQWA 3NPXA 3E96A 2CLOA 2C19A 4P61A 4O1BA 3PP7A 3N18A 2BNJA 4IP4A 5G2WA 4K1WA 4QGCA 3NO3A 5T26A 1FY6A 3HFTA 1NOWA 1CGXA 3L5AA 4AWTA 2WSKA 5A2CA 4MY8A 2CLEA 4B5WA 1Z44A 4PFMA 3GR4A 4O4WA 3VNZA 5D03A 2ONEA 4GJJA 3NAVA 3WQDA 1WA3A 2H9AA 3AXMA 5FF4A 1BYDA 1F3XA 3LTPA 3GNOA 4GQGA 4LB3A 4H2HA 5I79A 1KBKA 2QCLA 2GVLA 3P5YA 2Z26A 2DDXA 1XI3A 2QJGA 3H4GA 1PYMA 3FXGA 5HNUA 3UJ2A 1DXIA 1E9IA 1H7NA 1TPC1 5LA1A 3RITA 3SCWA 3C2EA 3AXHA 4PBEA 3G3DA 3MHFA 2XVNA 3O63A 4PRTA 2DT1A 2Y61A 2Q3RA 3ITCA 4P8XA 2QLYA 4LC6A 3H54A 1L6SA 3HO8A 1MUMA 2XUCA 3AU2A 3GNRA 3WELA 4HU8A 4ZTXA 2CLPA 2QPUA 3UXDA 1EH9A 1X1NA 2X2YA 2SFPA 1LWHA 2E67A 3L2IA 2RDUA 3OU8A 2ALRA 1UBSA 4C1NB 4H8VA 2YB1A 4ZA0A 5XIMA 2PODA 1JDAA 1A53A 3ZR6A 3BARA 2AMGA 1EDGA 4O0ZA 1OFDA 4C6JA 4MPQA 2OB3A 1Q6RA 4LS2A 4ZGYA 3GTHA 4IIEA 3I10A 4PB5A 2O9OA 3F4CA 2YZ5A 3R1ZA 2EPOA 3RX2A 3F7JA 1CPUA 2OMAA 3AZTA 2WWDA 3VYLA 5HR6A 1C29A 4W86A 5ABEA 5I09A 4N9BA 3UG4A 4JHOA 1C8YA 4NAFB 3WBAA 1A5CA 2O4MA 5A94A 2QDHA 1XYZA 1TV3A 3K4AA 2DSUA 2VQTA 1IT7A 1UD3A 2WVSA 3S6DA 4D6GA 2E6FA 2DH2A 1RK5A 4FR1A 4LH8A 1SW3A 1V6TA 3W22A 1ONRA 4MB5A 1EOKA 4M5PA 3WQCA 1KFEA 5HK4A 4ZB0A 4KETA 4RLIA 3A23A 4WEVX 3W3OA 4MIMA 4IOTA 1I1WA 1NVMA 1XLBA 3HGRA 4HA4A 4GCXA 1GZJA 3T4WA 1KCLA 3CUFA 1UJPA 3EWDA 1PO9A 4C6EA 1YEYA 1G7VA 1B3VA 1W9BM 1W1B1 3D0CA 1GNXA 1TCMA 4ECLA 2V3EA 1UASA 1PWLA 5CQ1A 3GB6A 4WZHA 2EEXA 4OTKA 1XINA 4O0QA 4IMCA 1EBHA 1PV8A 5C9UA 2YCKX 3C2RA 4J3UA 2X41A 3RHGA 1GJPA 3PZNA 5LZLA 1R3RA 2UY4A 1F8IA 3GNDA 4QJ4B 1E6QM 2JQXA 4Z0SA 2NV2A 2P8CA 4AWUA 3SFKA 5A5WA 5A8OA 3WBWA 3EOEA 4US6A 1KLZA 2VUYA 3MUY1 1KC7A 3W01A 1XCXA 2XIBA 1EB3A 3U5UA 5C2XA 4R33A 2GZXA 1ONXA 2D20A 2BTMA 2PLCA 1E51A 3BL3A 5D9PA 4UNKA 4Z08A 3KVLA 2V69A 1L8NA 5IBXC 2DGAA 4O8RA 3WLJA 1T99A 3OBKA 2A3HA 3G0UA 1UZ4A 1YXYA 3YPIA 4G7EB 5FJIA 3GXPA 2XH4A 2VD9A 1QPOA 2EXOA 4HNLA 4LCQA 4IMFA 4IMDA 5FESA 4W93A 4ZB2A 3NJ3A 4H6EA 1XUZA 3E1F1 1Z8AA 4L80A 4IICA 1GQLA 3FGCB 4FNUA 4RNHA 3BICA 2W79A 3W6YA 4WHBA 2F38A 4ICNA 4HD5A 3GZAA 3WLTA 2DIJA 3K8KA 1QI4A 3UPWA 3NSMA 4GI9A 3KRSA 1VRXA 1WP6A 1N2VA 4XAYA 1HL2A 3ABRA 5HQMA 3MI2A 2BY3A 5FJPA 1IXOA 2VVNA 3MSYA 4LAUA 3VK5A 3G1DA 2DPEA 1OG6A 3PS7A 3TNOA 3F5LA 4F79A 3EB2A 4YPJA 3UYIA 2CITA 4D72A 1FFRA 2VZUA 3B97A 2OFJA 3P8IA 3GVQA 1RQHA 3QR1A 4LPCA 4HNOA 4PMQA 3NGFA 3IJIA 4NJJA 2ZC8A 3K5XA 1BKHA 2ZRYA 5CAKA 2HXTA 1N82A 3M0YA 3O6YX 4TX6A 5T9BG 1YNPA 1ONWA 1RBLA 5BNKA 1TMQA 4M1BA 3U7VA 2XH2A 4C5YA 1JDFA 2CZDA 3IIVA 1KFWA 5GNXA 3RU6A 3WFLA 3PAJA 2Y0FA 4ZO8A 1CLKA 2POTA 3MWCA 3MKCA 1UWRA 1H0IA 1XPYA 4YCOA 1SMAA 2GGHA 5IHSA 2PDFA 1S5VA 1W32A 4C6FA 4LVGA 4TMCA 2Z28A 4I7UA 3VNLA 4EWJA 4XD4A 2DU2A 5TIMA 3QF0A 4M19A 3T0BA 1W9XA 5BU9A 4XV0A 2E5CA 4TO8A 3QGAC 3LRMA 2VOMA 4S3JA 3RGTA 3EWBX 4ERGA 1H09A 1W17A 1XH2A 3BOLA 1UKPA 3AICA 3LPOA 1XYBA 3BAJA 4PTVA 3N2BA 2BHZA 4XZLX 3GHUA 3HQ1A 4PH6A 1CXIA 3WYZA 4L1XA 4MM1A 5FA5A 4YTRA 4XD6A 1H51A 3URQA 3VKKA 5IBXA 3B05A 4O1AA 1T5AA 1L0PA 3QHNA 4EVZA 2EF9A 1V08A 4F9DA 1NU5A 1NJJA 1U1HA 1DIKA 1NARA 1V3LA 3W84A 4Q4PA 1E43A 2YX0A 3I6RA 3PBMA 3SIZA 3GBEA 3U0HA 2YA1A 1WB0A 1ZQ5A 3BDKA 3AIEA 1PTAA 2OZTA 2J8GA 1KTCA 5BMXA 2X0SA 1KA9F 3CEUA 3T08A 1ZY9A 4GXMA 3EWWA 2V67A 3OP2A 3WH5A 1C9DA 4HZMA 3WLSA 3DZ1A 1FRBA 1BSLA 1HGWA 5K4ZA 2H3DA 3LA4A 4L4LA 3DAQA 3OPSA 1JZ3A 1SPQA 2Q8ZA 2QUVA 1XLMA 4IIDA 5EA9A 3TQVA 4UTTC 3CV1A 3PPGA 4MOZA 5DCDA 3CBWA 1EGVA 3WBEA 1KRBC 5C9ZA 5EMLA 3II1A 3VFLA 4LU0A 4WD0A 3ZIZA 3PFRA 1MNSA 3N9KA 3NQVA 2VZVA 3UR7A 5E93A 3UNDA 3HG5A 3LUTA 3WEMA 3KCJA 1KRCC 4X2RA 3WDPP 4F40A 1JPKA 3H70A 3KL5A 3R79A 4LAMA 3ZFHA 1KTBA 3E9AA 1VBHA 1XH1A 4WCJA 5DCBA 3LCFA 3QW4B 5CGMA 3O7UA 1VGAA 3H2CA 4JKMA 1K6AA 4PUKA 2X2GA 4LNCA 2YBVA 1QUMA 3W28A 1VEOA 4O13A 2YCEA 2BGNE 3L67A 1OC6A 2QVNA 3A9BA 1BWLA 4EX4A 5H8MA 3OIHA 5CPNA 4HTBA 1DWAM 5CAHA 1HKKA 4GVGA 4S3BA 5EMKA 4C5ZA 1A5BA 4O18A 3NQMA 2CBVA 3EB3A 1KM0A 5D8ZA 4JTQA 3R8GA 3RCMA 1ZCOA 3SUWA 4L6HA 4UFIA 9XIAA 3AUJA 5M5DA 4ZB5A 4UWMA 1KWGA 4EPDC 5LIYX 3AO0A 3WNNA 5K9DA 4TVDA 4J3TA 3CUGA 2C16A 3MY9A 5AN7A 3UESA 4JTJA 2E77A 1A5LC 3BLLA 1RR2A 2YGYA 1ZP4A 5HUPA 1MXSA 5CPOA 1XISA 1DIOA 4JPGA 4P7RA 3W75A 3WF0A 4QCEA 2JBMA 3UP8A 2WVTA 3QV7A 1KFCA 2OJPA 4JQ3A 3F2BA 1NDVA 2J7DA 4AX6A 3L4ZA 4QEHA 4ML9A 3FCPA 1XYMA 4XBKA 2HPIA 5EFDA 3ZT5A 1EJ7L 3W25A 2QAPA 1TWDA 1DWHM 1WOBA 2Z1BA 4R7JA 3P67A 2WNNA 4C6OA 3NXFA 1UR0A 2OWWA 3N15A 3N6JA 3N25A 2HPMA 4EK7A 4XO7A 3N6HA 3RM8A 4UTTA 2J47A 2NQZA 2C18A 3P62A 4CD6A 3QFWA 1RAKA 4MWAC 3TN6A 1UR9A 4RPPA 4RX0A 1EXPA 3M44A 1EF3A 1GYNA 5B7YA 5AYIA 3W7OA 3MZNA 5HJLA 4XK2A 3AISA 4ADUA 1MEHA 3KL3A 3IJQA 3NQDA 2ZE0A 2VXNA 4GUHA 3W2MA 1GOKA 2XU2A 1F3WA 3UU0A 5FJTA 5BW6A 2PE4A 3Q94A 4G5DA 3U7BA 1LOSA 1JZ4A 2D2OA 4H2CA 1H62A 4JIHA 3MO7A 3W00A 2FGZA 5D33A 2WJDA 4FNSA 3V7PA 3BWWA 4OOZA 1U5JA 1DYSA 3W26A 2GK1A 2UY2A 3P0XA 3MPGA 1CI1A 3OHIA 1Z32X 1E5JA 3ZWTA 2QUNA 3W27A 5BXPA 1E0XA 1UA7A 4X61A 1FWWA 5E70A 3CEPA 2WM0A 3FYYA 1TCDA 3W1XA 2W63A 1ISZA 1Q65A 2PTYA 4RPQA 1TB3A 1K9TA 2C1HA 1ZSXA 1A5AA 5C2GA 3GG8A 1HQTA 1E9ZB 1E3XA 3QOMA 2EAWA 1M01A 2PP3A 4MKVA 1H1NA 4E2DA 3IANA 1KXHA 3CQIA 2C15A 4KCWA 4JX6A 4GI4A 3RO8A 4MGGA 1F2JA 1XIMA 3C2FA 2YDAA 4JYFA 1G4PA 4H9UA 3GE7A 1RVKA 1C7TA 7TAAA 2CKSA 4GJ1A 2GWGA 2X0YA 2PU1A 3GTFA 3E74A 3L4TA 4W7VA 1V3JA 3T55A 1OYBA 1MWOA 3QFEA 2HZGA 2BMBA 4FX6M 1PDYA 4A2SA 1Q7QA 1DJNA 1LG1A 2J7CA 3AUOA 1IIGA 4PUJA 4FXJA 1DJHA 3GC4A 2L5HA 1TX0A 1B3XA 2YPIA 3G1SA 3R8RA 2GWNA 1O94A 1EDQA 3M0VA 4YN5A 5FJRA 1YPIA 2CBUA 3LBCA 1VPYA 2R1MA 2KZHA 2NQHA 1K02A 2PDIA 4PMOA 5C7VA 1QO2A 4M0XA 3QMRA 1Q45A 1GG0A 1Q2SA 3KLKA 3UXLA 2J27A 1CLVA 1UR8A 3EOUA 4IJRA 4C60A 3OO2A 4YNGA 3PM6A 4MWAA 1EC8A 3VOCA 2VZOA 3OJGA 2YDSA 4DM1A 2ZZ2A 1Q7MA 3KTCA 1GVOA 3C2VA 3SY5A 1W1PA 3PULA 3W85A 4ZQRA 4M24A 1MW3A 1E9LA 4KEMA 4GJIA 2B0MA 1IZCA 3JR2A 3MP5A 4AFYA 1YE4A 3HTWA 4C6CA 3BLDA 3A3HA 3DG6A 4QG9A 3SRDA 1HKMA 2HISA 4OV9A 5BRBA 3FSUA 2QZRA 4LNYA 2D3LA 3COTA 1DXEA 1L2QA 1E6PA 1O7AA 1B9BA 2GQ8A 1TPH1 1V8EA 1US0A 2ZADA 1TPVA 3HMCA 5A8GA 2F2KA 4PEEA 4MB3A 2J6XA 4UTKA 1ZHAA 4X63A 3MYOA 4UZSA 1RJRA 1EYWA 3CT2A 4IQDA 1S2VA 1RPXA 4NZ4A 4DNMA 4ZODA 3H4WA 5D9OA 4JTIA 3OQ8A 3L12A 4DO7A 2I14A 3WMSA 2YL6A 4OFCA 3IUHA 9XIMA 2J75A 3L4UA 3HPAA 4ZQMA 3STPA 2VNCA 1UQYA 5DFAA 1A4MA 4NI3A 4MJ4A 1W3TA 2DQWA 3CASA 2E1WA 4XD3A 4IGHA 1J6PA 1V77A 3W2LA 1VKFA 3RYSA 3NFUA 2FZBA 1QAPA 3BJFA 3CHEA 3KBJA 4KGJA 3TTYA 1K9EA 2WJEA 3VDAA 3VAVA 2GDVA 3MU7A 1PKNA 3WH7A 3VIKA 2BVYA 2BGSA 3GU2A 3E6EA 4GABA 4QCFA 5HWJA 1QT1A 3I7SA 4MVAA 1UMLA 4PL2A 5IDZA 1XBVA 1AMYA 2IPFA 3MV01 3UYCA 1R3YA 3GAKA 3GK0A 3RPTA 4YIWA 4MJMA 2ZX6A 1VFFA 1DV7A 3APTA 3TTQA 2Y89A 4AD1A 1NELA 1AD1A 1L6WA 4JHZA 1LLZA 3DXIA 1XLIA 3URAA 4HNVA 3PC0A 4XG1A 1ODZA 5HMSA 1X39A 4XKMA 2NUYA 3QYSA 3WLOA 3IRDA 4Q8PA 3TYBA 1RQEA 3O0FA 1K9FA 2C14A 3PZGA 2WHJA 4AZ7A 1VIWA 1XIBA 3W1LA 4WDWA 1MZRA 2VJXA 3SADA 4ACZB 1KRAC 3M0KA 2C8NA 3BO9A 1XIIA 4JN6A 3C86A 4HYVA 2XH0A 4U33A 1JF6A 4IM4A 3FFSA 1SMDA 3IJDA 4UOJA 2PGWA 2H3BA 3RU8X 1XGZA 3MP3A 2QNEA 5KZEA 2ZRUA 1WZLA 3DBPA 4GNVA 4H9XA 4QDWA 4H8HA 4DBEA 2NLYA 3LTYA 2QJHA 4XZ9A 2QUTA 4NL1A 5D38A 1GKRA 4KIEA 3SUSA 2PWVA 1RP8A 4CNUA 1AQFA 3UPBA 1FDYA 1OSEA 4FOJA 2JEQA 4BA0A 3SCRA 4E4PA 2QPXA 2VRJA 3WSUA 5CG7A 1VF8A 3KP1A 1OFAA 4PB4A 5M03A 3UG3A 5LSMA 2D69A 3ELFA 2VWSA 4DAFA 2C1IA 4B5TA 2EO7A 2X05A 5A6KA 4P7OA 4B5UA 2WSPA 4JYDA 1FDZA 4LAZA 1QDSA 2E3ZA 1ONEA 2BS9A 1S1RA 5IHRA 4AU0A 3IVUA 4UFHA 3LXBA 3EMZA 1R3QA 1VYRA 1MI3A 4A29A 1JG9A 2QR6A 3SN1A 2A85A 2PDJA 1JAEA 3T09A 3VD5A 4FPSA 1X6LA 2Z29A 2V5BA 3I3DA 2FKPA 4DWSB 5CZJA 3E0VA 2G50A 1BYBA 2EGZA 2Y5JA 5D09A 1A80A 1SZNA 5A2BA 2CC0A 3RFAA 3CT7A 4OECA 4IPIA 2PDQA 3GLCA 4RE0A 5M1TA 4PULA 5I3GA 1U5VA 1UG6A 3WEOA 2J78A 1HO4A 1R38A 3DFPA 1EO7A 1QATA 3VC6A 2VGFA 3F03K 1AJ2A 3MI3A 4FXRA 4JIRA 1V5XA 1GYLA 1I0DA 2HVMA 5AC7A 3IJLA 3LPFA 3SI9A 1XW8A 2HVOA 2BLEA 3W1RA 3XIMA 4PMUA 1TV4A 1IEXA 1S3HA 2YCJA 2DZVA 4PRWA 4O1EA 1XDJA 4B15A 2XGZA 3ZR4A 1ZTVA 3LHZA 2HJPA 4DF1A 3MKVA 1O6IA 4BR1A 1UIOA 3F5KA 3G8EA 2IPJA 2G3MA 1CX9A 1LBFA 4PSPA 3VIPA 3WQ8A 1RHCA 4LOCA 1LWIA 1U83A 2J9ZA 1LM1A 3ANUA 3V1HA 3QHOA 5DT5A 3W1UA 1E40A 3NNTA 4HMEA 1PX3A 3G1FA 1OZMA 2DSKA 3E2VA 2BGQA 3UERA 3B8VA 3LCLA 3MVTA 3TNBA 2XG9A 4JKKA 4XKYA 2ZCGA 3Q2DA 4WDXA 2INEA 5CPLA 1DIEA 1K7XA 4GBUA 3G6MA 3ABXA 3CZ8A 4HKPA 3W7JA 1EUNA 1PAMA 3H7RA 4CNTA 1OB0A 3DYMA 5D37A 2HQAA 4JOMA 2B81A 4AIUA 2C79A 4GXPA 3MDWA 1WV2A 4GCAA 5A6MA 5KEZA 4UMCA 3UJRA 2VMFA 3FK4A 4AMCA 4IGNA 2AL2A 4DYKA 3EDDA 8XIAA 4NRRA 4HMCA 3L66A 2QCCA 4AVOA 3WLKX 2X09A 3TP4A 2PFHA 2EPKX 3KCOA 2OOGA 1A3XA 5E6YA 5A3HA 2TMDA 1NWUA 3EOSA 4GPNA 3QJAA 3CTLA 3CMJA 5DRIA 5IM51 4HYWA 4AF0B 2NQ9A 2D0GA 4PUUA 3W2KA 2HK1A 2ZTKA 1BGAA 1EP1A 1EL3A 4Q4OA 5EFFA 3VM7A 3RJYA 3G0SA 3NZPA 1DQXA 1TR9A 1KBJA 2ZX7A 3AZRA 2E09A 2ABAA 5LIKX 4JGDA 1V7AA 3GYEA 1AMKA 3PJUA 4OBTA 2BDQA 2VCCA 3WQWA 1AL7A 2PTXA 5BU6A 3W23A 2NSOA 3GIPA 2E7FA 2PSNA 2Z0IA 4V2XA 1QVBA 2W91A 1ZPTA 5D9NA 2JK2A 4LTSA 2OO6A 5TBOA 4HCLA 1M9HA 2YOCA 3LOTA 3BCDA 2QT3A 2XJ7A 1IE7C 4BI5A 2HROA 4X9YA 2PZNA 2ZRVA 3TR2A 4NYUA 5AC8A 3OLIA 2VEGA 3RXZA 2Y5SA 4L4PA 3UWQA 1TJPA 2P88A 4GACA 1ZJHA 2DZAA 1ADDA 1NDZA 2AQVA 5C7HA 4Y96A 4AIBA 2ZA2A 2VYOA 4I5XA 2BZNA 1Q8AA 5HMFA 5REQB 1JD7A 1H5YA 3WD2A 3KAOA 2VC5A 4E8CA 3GSMA 1Q7ZA 4M3PA 4IGMA 3MV11 3PZQA 3SEPA 4REQB 4O1DA 1VCFA 4XZBA 2X7VA 4PTDA 3EBVA 2ZUUA 4E4FA 3R12A 3O0KA 1V02A 1E0TA 3JW7A 3HPXA 5I0DA 5D2YA 3UZYA 4ATWA 3NL5A 1SZGA 5U7SA 2VEIA 6ALDA 4LAKA 3AS2A 5CSSA 1XFBA 3LXAA 4RZBA 1WZKA 4AB4A 5AFDA 1DJGA 2E25A 4WXZA 3ARSA 5GNZA 5CEWA 4NQ1A 1G4TA 1V51A 3BZJA 1UUMA 5DLCA 1GOQA 3VKDA 3M6DA 1TTIA 3M07A 2P5NA 3TV8A 1EUAA 3AIBA 1W3KA 3ARZA 3KDOA 2D0HA 3ARQA 1EXBA 4OQVA 2A7PA 1IR2A 4UQCA 1YNQA 3GXIA 2CLMA 3VVGA 1CB2A 1UROA 4KT2A 2PTZA 4A3QA 4HB7A 4E4UA 4JNYA 1JPMA 3W7KA 4RNIA 4QM1A 3DX5A 4NJIA 1X6NA 2VQUA 2OT1A 3I6TA 4LSBA 2FH8A 4H6KA 4BQ3A 1FP8A 3VNKA 1W1VA 1H63A 2GQ9A 2O0TA 1ZJAA 1TE6A 3GRIA 3WK2A 2YB4A 3SUTA 4AHOA 7TIMA 3AXIA 1NWSA 4BI6A 3CUXA 5LHFA 1ITUA 1VB9A 3LGGA 3LX9A 3C3UA 4JEQA 3G3MA 1Z9AA 4A21A 1ZBVA 3EGJA 2YL5A 4N9CA 1TV8A 1ZFJA 1P43A 3TN4A 4CD8A 3S1UA 3VCRA 2G3JA 3SN0A 3H2AA 3V0TA 2TPSA 1O5QA 4L4OA 4AEEA 3UZJA 1GEHA 3NQ2A 4LYPA 1PZ1A 3KOXA 4L56A 4QISA 2ISVA 4CU6A 2J8TA 2EPLX 2O9TA 3BMWA 4PMXA 3CC1A 3DYPA 4J3ZA 4ZXLA 4M6QA 1R3SA 2WMIA 3QH2A 3CZEA 3NDOA 3ITOA 1J4EA 1JPIA 2VR4A 2NXGA 2FVMA 2G37A 2XFYA 3ID7A 3NOYA 3HBLA 1Q85A 1HFBA 3NUKA 4J2MA 4JFVA 1R8LA 3KL0A 4WKFA 3GU9A 3TC6A 1E6ZA 3ZT6A 3B0UX 1SU5A 2DSZA 4IFKA 2WZEA 4GFSA 2J62A 4IJBA 5AC6A 4EXAA 3BURA 4H00A 1OGBA 4ZO6A 3D3AA 3AXKA 1H7PA 3QR3A 5BRPA 4PCTA 1WUFA 3SCOA 1FP9A 4HK5A 2D24A 3UJSA 5LXEA 2BY0A 1A49A 4ORIA 3S2NA 1EGMA 1DBTA 2YL9A 2R1PA 4W7UA 3UZWA 1US3A 2HMCA 1JDCA 2VCBA 4WK9A 1RPKA 5F2LA 1BRLA 5H8PA 4DBUA 1OD0A 2QXWA 3S9ZA 3USBA 4DZIA 3PZUA 1XYAA 3Q67A 2DUAA 2DZPA 4FXFA 2G96A 1CENA 3AXXA 3AYTA 2PRHA 3IIOA 1GOIA 3AC0A 1E72M 5HNNA 2ZZ4A 3VOIA 2ADAA 4QSFA 4QJ3B 3RLGA 3GHRA 3BZGA 2PBOA 4HZ8A 5AYZA 1MW2A 1XS2A 2Q09A 5I03A 1TPDA 1ML1A 2EPHA 4FZIA 4KBXA 5D4YA 4TMBA 4C90A 3ZLHA 1DE6A 3AMCA 3G1XA 4RW3A 4MZ8A 3DI0A 1LJYA 3E3HA 4UQBA 1BSIA 2ANUA 2FZNA 4IPJA 4DZAA 4QR6A 3V16A 3NOEA 3WLRA 1TFVA 1QW9A 1TWZA 3DDMA 4URIA 2OX1A 5IFPA 1FBAA 4UR9A 1OX5A 4POCA 4A8NA 3OG3A 3FA4A 5BXTA 3MMTA 2BP1A 3W74A 4H9VA 3UWZA 4IP5A 4QFUA 1XGEA 4MWAE 2RDXA 3LG3A 3W7RA 2PLJA 3HV8A 3PUDA 4N0RA 3KZSA 2AAAA 4TX9A 4H4IA 4IQJA 3S1XA 5ABFB 1QNPA 2MNRA 1TJ2A 4V27A 8XIMA 3SQLA 2BODX 2KX9A 1MQPA 1TA3B 1ITXA 3WNPA 2ZKMX 5D2WA 2OEJA 7CGTA 5I02A 2PWFA 4M6PA 1EHNA 3TA9A 4LX4A 1K7FA 4FS9A 1PDZA 3HG3A 3DH7A 3QN3A 1OFQA 4XZNX 2PLKA 4KS0A 4IPLA 3KRBA 1BPLB 5D05A 3TYZA 3GXDA 3TROA 3RCYA 5JU6A 1BWVA 1YX1A 3UJFA 4JCMA 1IWPA 2XSAA 2ZUVA 5ECUA 2GOKA 4FX7A 2R82A 1L2UA 4W5ZA 3C56A 2XHYA 4AD2A 1H1ZA 3DEQA 3VA8A 1PPIA 4F3HA 3U57A 3A24A 2J88A 3OEXA 4HNTA 4GH1A 3PWGA 1UD6A 3PSVA 2J13A 1E4IA 3P2VA 4GIRA 3GG7A 4PTNA 3MUIA 4QJ5B 1XQKA 4IT1A 2QCGA 4I9AA 1Q6QA 3TLLA 2ACQA 2Y63A 4QRNA 1AZ1A 3VUSA 4GY0A 4PCNA 1TMHA 2ZOXA 2AKZA 3EZ4A 1Y5WA 5CZKA 2CLHA 2E6YA 4EOUA 3IJ7A 4HHMA 3B8IA 3B3DA 3CWNA 1XP3A 3UCQA 2XTKA 3U2ZA 1JAKA 4C65A 2CIPA 1VPXA 1UWAA 3VKAA 4Y8EA 5HOSA 1ME7A 1YDNA 3ZJ6A 5BXSA 1WBJA 1W9UA 3VIFA 2WC4A 3IAQA 3CPGA 1C8VA 1XD0A 3SBFA 3PZTA 1JCYA 5BWAA 2CZ5A 1JGIA 3WJYA 2RUSA 3AIWA 1WX0A 2BX7A 4DZHA 2E0PA 3O07A 4K38A 4YTUA 1DTNA 3S47A 3H7UA 2DSWA 4XTIA 4LT9A 2VD8A 5KZMA 5K9CA 1VC4A 2YIHA 1Q66A 2IKJA 3IV3A 3BE7A 1ITQA 2D0FA 3GX9A 5I3DA 3EYPA 4NP7A 3TN5A 3NPWA 2FDSA 2VFGA 2PAJA 4WKHA 5CBIA 3HJEA 4NIRA 2EHHA 1QPKA 3QV9A 2PURA 4QAIA 1NH6A 1NOUA 3FGCA 3CO4A 3M5ZA 4HSNA 4GXWA 3JU2A 1OK4A 4ZOCA 1NAL1 4K7VA 3QXBA 3W1NA 1EA0A 3MSRA 1FHDA 3DHPA 3WG6A 4IIFA 1FX6A 2REQA 1JD9A 1YDVA 1BYAA 5AC5A 1FH7A 4WJEA 4HNUA 4HT3A 1M3UA 4NAEB 4L64A 5T9CE 3TJ4A 4CGTA 3WFAA 2YW3A 3SO7A 2ZQ0A 4PUMA 5BOEA 3WN6A 1BHGA 3H21A 4UOZA 1OG0A 3DHUA 4H19A 2O7SA 5HUOA 3LXCA 4I9MA 2QV5A 4GFIA 1E4NA 3FSTA 3S2LA 5CC7A 3MHUA 1L6FA 1WPCA 3GW3A 1J2BA 3PPFA 1ADOA 1ISXA 4BQ4A 1F05A 4X2PA 1WDPA 1ZALA 3LGEA 3N9RA 4FIQA 2XVLA 4JN7A 4KRZA 3R8HA 2Y7DA 1QNQA 3RG6A 2VX4A 3B8TA 3W6MA 3EWCA 4KESA 2D2GA 2PDWA 3BG5A 3ZM8A 1G0CA 4PBGA 3N2XA 1IEWA 3L9CA 2FZ9A 5H91A 1PIIA 2OTDA 1PX8A 2PI6A 3CAVA 2P3EA 2ISDA 2WNWA 3GH4A 1L6YA 4ZQNA 2QCDB 2ZWYA 1IXNA 1LBLA 3VE7A 3TQKA 3I4EA 1QOXA 1V3MA 2CXEA 4XO6A 1IXPA 2R9RA 1ZUAX 3IGSA 3LRLA 4DUWA 2OODA 1C90A 1B90A 3T05A 1F74A 3VIIA 5TQLA 3HPZA 7REQA 1CGVA 3JZUA 4KMQA 4H3DA 2OXNA 3L21A 4IISA 4UB9A 3VDCA 3B40A 1RA0A 4DWSD 3PG9A 3MC5A 8A3HA 1SZRA 4LEQA 1E6RA 3TAOA 4GH3A 4J2PA 1JFXA 5TF0A 1XSKA 3QPZA 2E4TA 1QHOA 5DBTA 4LY4A 3Q65A 1A0EA 4AHPA 2BOFX 4N6EA 3TMQA 4C1LA 2WAGA 2F8QA 1VZWA 3P7YA 3WCZA 4BWLC 3CL7A 3W38A 3EMQA 4DLMA 1XJBA 3TVAA 3GKAA 1GOXA 1GYMA 2OX4A 3RIKA 4U2YA 4NHVA 3VDBA 3MO4A 3CXOA 3NCOA 1FQ0A 4S3GA 4H6QA 4GQBA 1GORA 5LHEA 2WCAA 4HCDA 1AW5A 5HINA 4JFUA 1C91A 2QJNA 4GY1A 4BF7A 5CJNA 1XICA 2YYTA 5LNWA 4NRSA 1THFD 5HULA 2VL4A 3PWIA 3SCUA 1UKSA 1W91A 3R0DA 3M0LA 2JEPA 1CW2A 1FH8A 3DCPA 2F6XA 1TPFA 2HEJA 1HL9A 1XRSA 4J40A 3CL8A 3EWYA 5T91A 2VCAA 3BCJA 4PCPA 3ZJKA 3LQGA 1NQ6A 3UWYA 4S39A 1J18A 4Q7BA 2PDCA 2VP8A 1SO6A 3THDA 4RZ5A 1QMLA 2GPTA 2RFGA 3UG5A 3EDEA 3THQA 1VENA 2VC9A 4EP8C 3OQEA 3W7CA 5DX7A 4GE8A 1VFTA 2C91A 2JALA 1PTGA 3FS2A 1GVEA 3NZQA 3EX4A 4DO4A 1S2UA 3AOFA 1TRIA 3SCPA 3TC7A 4KQNA 2YL8A 1G7UA 4J1OA 1T8QA 3CO8A 3LB0A 4HIBA 4JTEA 2ZXAA 4UTMA 2CYGA 2WVVB 3C0JA 3PBVA 4J4KA 3RRAA 3NZRA 1K4GA 1OCJA 1KNWA 3P61A 1T6MA 3EKZA 1XWYA 3HIJA 2UV8G 3FEMA 4Q4SA 4KERA 1AQHA 3IVTA 4K8GA 1AD4A 2X7WA 4E38A 1Z41A 4L5ZA 4C6QA 4KCUA 1E0UA 1E1CB 3DFQA 1EX5A 4A6GA 2WQPA 2VT0A 2XSXA 3OHMB 1FWNA 3M46A 1EJUC 4Y9PA 2GJLA 3S1VA 4YWSA 1H3GA 3BW4A 1GVFA 2E9BA 3UW6A 4W4QA 4EAMA 3O15A 2BHUA 1FFQA 5E0CA 3STEA 3CUZA 1V0KA 3QQWA 4FK9A 1CECA 1TWIA 3CZGA 4MJZA 3TOYA 2Z2AA 1CLXA 1OFOA 2PDYA 3H12A 1W3IA 2PGEA 4LF2A 1B4EA 3OVQA 1RXOB 2E9MA 3CJPA 3NDZA 1VCVA 4BWLA 4JAWA 4XVDA 4X0NA 2A79A 4CNPA 3RCNA 3UVIA 3N1AA 3LLXA 1XYLA 5A6BD 1M7XA 2ZUWA 9RUBA 5K4XA 3N4EA 4FO4A 4R7WA 1N55A 4MG4A 3TTSA 4AIEA 2FTPA 3OYZA 3Q4DA 3UZXA 2OYKA 1IR1A 2HBVA 2H9AB 3T2OA 2EKCA 4AG0A 2GVYA 1MRQA 4Q4MA 4H04A 3VD7A 2ZIDA 5DANA 1J0HA 3VMNA 1OFRA 1H7RA 1Z89A 5C8BB 1C92A 1RLDA 1G6CA 2F84A 3RO6A 5KZ6A 3GD6A 4BKNA 2XPKA 3RX3A 3S3GA 1V02E 1DJIA 3HV9A 1OVDA 4HHLA 4BEQA 1PKLA 4FF7A 1OFBA 3LHTA 1U5HA 4LANA 1G5AA 2QCMA 2HE8A 4YXGA 1Q8JA 2ACRA 2PWUA 1JYNA 1AK5A 1JCXA 4L61A 2HNHA 1IF2A 3AALA 1W5NA 2PCQA 3EKLA 3M0XA 1W9VA 3N12A 1SR0A 5A8QA 4CQAA 1KKOA 2VGBA 2IQ0A 1M04A 2QF8A 1S39A 2GLKA 4AZ6A 4NZ5A 4WDTA 2EPMX 4C1KA 3AYRA 4TUFA 3WDQA 3ZXWA 4ACYA 1LBMA 4AWEA 3SDOA 3ATYA 4J3SA 4ROPA 3WQGA 2WMGA 3P5ZA 2AMXA 2WV8A 4JIIX 1JQXA 5SWUA 1P5BA 3BCFA 3O05A 3A21A 3TW7A 2ZA1A 1W9DM 3LD5A 1KCKA 1ZAHA 1DJZA 3LCXA 4D6EA 5M17A 2VDIA 1OWQA 1UUOA 3H6OA 1X8FA 1DPMA 5DO8A 4MLRA 2BV9A 4DJDA 2POZA 4KWWA 1SQ7A 4GX9A 1S2WA 2PUZA 3MMDA 3VFCA 1CDGA 2A7NA 3TA6A 2BSLA 5D30A 1OGGA 3ZYZA 4BF9A 4F0MA 4HOZA 3LCHA 4I6VA 3W82A 2F9RA 2FB3A 4EF8A 3VKCA 5FL1A 3AHVA 4WOZA 3WJSA 1SSGA 4PC8A 2PRMA 1J6OA 1RQBA 1GZ1A 1XIDA 1U1JA 2A21A 3VIMA 3BAIA 2QJJA 2YFNA 3VPLA 1OABA 4N9EA 4B91A 3GY1A 3ARWA 4XZIA 4ZEPA 3T6CA 3BGJA 3FJ4A 2AGTA 4AWSA 4D8ZA 2G0WA 5FOOA 1VIZA 2OZ3A 2E8ZA 3WEZA 3AYSA 3SGGA 1ZRQA 3IAPA 1W1A1 1WZMA 3MUXA 3TC3A 4MTVA 3TJLA 3G0XA 3ISIX 3QKEA 4BQ2A 3V0UA 4UQEA 5LA2A 2DZSA 5BXRA 1NTHA 4O14A 3SUVA 3VNIA 2VR5A 1J0IA 1ESWA 2GSHA 4LBRA 5CPTA 1HVQA 2WMFA 3QPYA 2W27A 3GZ3A 4GQQA 3UXIA 4D6CA 2Y8KA 4I6KA 2QDDA 3OZOA 3A22A 3WH8A 4NY2A 3RM4A 3S8HA 4PCSA 2YCLA 3PBUA 4TOQA 3W53A 5BYWA 5AHMA 4P7QA 3LNPA 5EMMA 1KBLA 3PR2A 3ZVHA 1PEZA 3RMJA 5I06A 2FHCA 4EKJA 2I17A 2J24A 1KBBA 5F2GA 1IV8A 3E2RA 2DVXA 4LYRA 1EJWC 5MKGB 4JL2A 4PMYA 4DJEC 3M47A 4Z1BA 1LOLA 1BGGA 1BEUA 4X22A 3BG3A 3WDJA 1MQRA 3WNOA 4MLJA 3WL0A 3T07A 4X0VA 1FXQA 3GDMA 5ABGA 4HA1A 2GVJA 4PL1A 4RNFA 5LIUX 5AHEA 2I9UA 2YLLA 1EHAA 1WAUA 3WJWA 2DW6A 1VFUA 4LV9A 1HG3A 1E6XM 5B80A 2WXDM 1DHKA 3SSJA 2J9YA 2QF7A 3FOKA 4CCDA 2PDGA 1J8VA 4GMEA 4B2DD 2JGQA 4W5UA 2QIIA 5AYBA 3T8LA 3SGZA 3TLQA 3MBDA 3O6CA 3UPMA 5MF5A 4W88A 4Z2HA 4DB7A 4ORMA 4WKAA 1MDRA 2WMHA 1JQVA 3NYZA 3NM3A 1UP0A 4JQ1A 3W73A 2IPGA 2H6RA 1ME9A 1QPRA 2FIQA 2YA2A 4IG2B 3AJ7A 1KXTA 2GFTA 1CB7B 3G1AA 4FNRA 4ZOBA 4EANA 4DPQA 3B4UA 4DWSC 1XIHA 3C2OA 4K39A 3H23A 4PZVA 3WENA 3MUCA 3BANA 3CYVA 2HDJA 1DQUA 1EJRC 4I8DA 4HPJA 3POHA 3W7LA 3SJNA 2JIEA 2DIKA 3NM1A 1P1MA 3EB4A 4MNJA 3MDUA 4KCTA 4MYAA 2J7BA 4GZJA 1RLCL 3IUDA 4F0HA 4ENLA 4U10A 5D2TA 1FCQA 3L5MA 4DBSA 1UB3A 2PBGA 4IX0A 4NF7A 1OEPA 5A6SA 2VFHA 1QNRA 1JXKA 1K77A 1N8WA 3OTRA 4IWWA 4Z1AA 3CS2A 1MRAA 3ECQA 4U28A 2GSJA 3CM4A 3T42A 1UJQA 2ZZ3A 4G1NA 3NQBA 3VMOA 3PHAA 1QNOA 1KLYA 3ARPA 1GVQA 4UXDA 3LSBA 3CWHA 1RJQA 4WXYA 4OIFA 2HBXA 4GUJA 2ZZ7A 4YJ5A 2XH7A 4DJEA 1G94A 4O16A 3AS3A 2B7NA 3FAXA 4C6LA 3IGHX 4I7VA 1GG1A 4CN1A 4ERAA 1O5XA 1SZFA 2D3NA 1S5TA 2B4GA 5GJMA 2FZ8A 1RJPA 4O28A 4LVAA 4K36A 4IZGA 1A3WA 1E6NA 1IGWA 4K7YA 3W7HA 6TAAA 2QMKA 3RMEA 1VR6A 5I3HA 3OA5A 3E12A 4N42A 3BG9A 4UTJA 4ZQOA 3MHGA 3G8RA 1CXLA 1HJXA 1LDCA 3STGA 3KVMA 5I24A 2WHLA 3PZMA 7PTDA 1NFGA 2D1ZA 3QTPA 4KW2A 3DGBA 4YHGA 5CPMA 3APGA 3W2UA 4W89A 4L1GA 2I5IA 2ISSA 4I7WA 3RNDA 1KRMA 2OLHA 2BASA 2QW5A 4K3ZA 3M6YA 3R13A 3GG1A 1Q6GA 1A5UA 3WX7A 1BWKA 2O4QA 3CPRA 3GVRA 1Q3NA 4GGBA 5DXXA 3GR7A 4GQRA 4PTXA 3GFYA 5ENLA 3QY7A 5EKYA 2BXZA 3U3HA 3U6WA 4XAPA 2XIMA 1V3IA 4FNQA 3ZJ7A 2VEPA 1LYXA 2B7OA 3AHTA 2OU4A 1YLVA 3WUGA 2A5HA 1EQCA 2OWXA 5C9RA 1F3TA 3UGVA 2INFA 4CNSA 1O1ZA 3WUBA 3S1WA 1EF2A 3KVKA 2WM1A 3WLNA 1W2VA 5AY7A 3H4XA 1T40A 4A2RA 3CZJA 3QQ0A 1AVAA 3U48A 4JFTA 3LHWA 4UR8A 5HNTA 3KZPA 2YZRA 3SFWA 4MSSA 2VURA 3MCOA 4TTUA 4O11A 1LRQA 4YTSA 2O92A 3U8GA 4BCEA 1E73M 3E2QA 1Q6EA 4IMAA 1NP0A 1RALA 2PWEA 5A6AA 1P0BA 4EF9A 4I9TA 3ZS4A 1YRRA 1H11A 1OFPA 1PTDA 4GRSA 1F6PA 3GUWA 4ATLA 1OINA 2EKGA 2R24A 3WMLA 3OLDA 1X97A 1QW8A 3WD3A 2W66A 3BVJA 3NO5A 2XIQA 5A2AA 4IFOA 4AZGA 3GVWA 3U5YA 4EACA 4L9XA 4MYXA 2A3CA 4F48A 1WE5A 5I07A 2ON3A 1OM0A 2HS8A 2CNCA 1XC6A 3CIXA 3N3TA 3TSMA 3O6AA 4Z2LA 1PXGA 1Y65A 2FPTA 4DJFC 3V1PA 2GUBA 5DN1A 3AIVA 5CZSA 3M1ZA 4Y8FA 3PY2A 4LUYA 3BLEA 3WLLA 3MS8A 1TTQA 1G67A 5EBAA 4R27A 2PP0A 2O7QA 2J79A 1HP4A 3IIXA 3PJXA 1WUEA 4H7VA 1VP5A 3I65A 1PWMA 5HPOA 3H2OA 3W88A 2CLLA 4LUTB 1EO5A 2X1IA 1S46A 5IFTA 5EGRA 2BVTA 2HV5A 2J25A 4QAWA 4GC4A 3GH7A 1YMYA 3EWXA 4GY7A 1EEXA 5E0FA 1XH0A 5AB3A 4QJ1A 2GJXA 1XLFA 2RAGA 1J79A 1PHWA 2OGYA 3GVGA 4IX2A 2OSWA 2ZX8A 4FALA 3NGJA 4IPPA 2HWGA 5CLTA 4XWUA 3F4DA 3ZSSA 4GGHA 5A6LA 3S5NA 1J0YA 2C71A 1GZGA 1UWSA 4L1WA 2GUYA 3EKGA 1VEPA 3Q45A 3VZZA 3WF1A 1WO2A 3VZXA 1XFCA 3F2DA 2PB1A 1F4AA 2VUNA 2YKKA 4YTQA 1QI2A 4KGLA 4CCEA 3L65A 3ITGA 3C3NA 1R9XA 3VGBA 2X42A 3I6EA 5CSUA 2VX6A 4R5EA 4R85A 2ZUTA 4LY8A 3QOKA 3L2MA 1I2QA 1P0DA 3S0CA 1NQKA 4M29A 4PBFA 1VLWA 4XSLA 4TV6A 2FFIA 4OUIA 4ZE4A 1HTIA 2Q8LA 4UFMA 2OGJA 4H83A 3TAKA 4LUIA 1D2KA 3FHQA 1G4EA 4P8WA 3PUGA 3W4RA 3R0KA 4AXNA 4QEEA 1GKQA 3CQHA 1O60A 3THUA 1DEDA 3LS9A 4FB7A 1J2WA 4N4PA 1LUCA 4GINA 4H1ZA 5BROA 1RA5A 3DN5A 3QSTA 3PBGA 4ADTA 2WC7A 3MMWA 1UH2A 3RK8A 3CB8A 3EOOA 1HVXA 2QVHA 1JEZA 1UPMB 1MMFA 4CQDA 4W8BA 3SCVA 1OYAA 1H0GA 4DJFA 3ERPA 4NVTA 2ZX9A 3C4UA 3E02A 4L4MA 4H9YA 1DORA 1XX1A 3V75A 3VNMA 4MWAB 4JX4A 1LTDA 2XIOA 5CH9A 1MUWA 5JQ9A 4ZQCA 4ICCX 5JMUA 3WLMA 4US5A 1RCXB 3W76A 4JX5A 1AA1B 4GD0A 2UBPC 3LCGA 4GIYA 3SY8A 5E0KA 1K7EA 3M64A 2G4JA 2TRSA 1GPFA 4BFAA 4EIVA 5U4NA 3BH4A 1Q4WA 4AIOA 3VNJA 5I6SA 4Q4RA 2OZ8A 5AZ0A 3UWVA 1T96A 4BQ5A 1B54A 3EEGA 3SCNA 1HJSA 2G8ZA 4G6CA 5E9AA 2WSYA 2JF7A 4UIOA 2CWNA 2WLZA 1MSSA 1CGUA 4GUGA 1W37A 2LLEA 3KS5A 3AROA 1N7KA 4CN4A 3SRHA 3M16A 3OOQA 1XLJA 3CV2A 3B0XA 2IQTA 4TQTA 4G56A 1TV5A 1KGUA 3N34A 1DWIM 2X1UA 1LLOA 4NXSA 3UWUA 2CXGA 4DZ5A 1BVZA 3S6TA 3WJZA 3ITLA 4RZ4A 1A4LA 1FWFC 4OWGA 3PBYA 3M43A 3QV6A 1AJ0A 4MPKA 4R53A 3HMJG 5CXPA 1X6UA 2WVUA 3E0IA 1OT2A 2CZEA 4AEOA 3CPUA 4QDPA 4ALDA 5CG0A 1NF0A 4AVNA 5D8WA 1VAHA 2E6DA 4J7RA 1GUVA 4NZ1A 1BD0A 3JRKA 4HTYA 2ACSA 3RUBL 5G4WA 4S2BA 3KDNA 1FCUA 1OFEA 2CEQA 5CGQA 3UXAA 3P82A 5DMMA 2CWXA 1JUBA 3PTQA 4HHHA 2OQYA 2J4GA 3LHUA 1E1FA 3LI0A 4QQ3A 1YQ2A 3V35A 1XYFA 4S1FA 3R11A 3STFA 1KR1A 3EPOA 2FZDA 3FDGA 2DZTA 5F7UA 4J28A 1G01A 2F2HA 4LQ1A 3TUUA 1B1YA 2JKEA 2XM1A 4WX2A 1R9YA 4S3CA 3KRZA 5I00A 1LORA 4JNZA 1H7OA 3KM8A 4K8EA 3TQPA 3A3XA 3MA8A 3B03A 1I0BA 2PS2A 4JN8A 2XN0A 1Q13A 1W9PA 5J5DA 1KD0A 2FTYA 2DJXA 3NSNA 4LC8A 2NUXA 2I1OA 4QNWA 3C8NA 1SJDA 5G1TA 1LOQA 4F66A 3ITYA 4GKTA 1EJSC 5F4XA 3VXGA 2PDKA 3MP4A 3MBFA 1YDYA 7XIMA 1VYSX 4EPKA 1H49A 5M2FX 4ES4A 3NURA 1PCWA 4KH2A 4UR7A 4WGXA 3HGSA 3GDKA 1OIMA 2X1RA 1XBXA 4YMZA 4ATDA 1KV8A 2G97A 1JZ7A 1EYEA 2Y85A 2YBUA 1Y5VA 3BLIA 3LGDA 4K2SA 4C7FA 5LA0A 1F76A 1QJWA 3OLGA 4W7WA 1JULA 2PDLA 5HNRA 4Z17A 1POKA 1FWEC 1VPQA 3BQ5A 3MYPA 1Q5MA 2V5KA 3MCMA 1Q6LA 2E28A 4XIMA 4QS6A 1W3NA 1CT5A 1R3VA 3THCA 3NL3A 2OKTA 3W7DA 4GYJA 3TJXA 3P8JA 4WY0A 3ANVA 5LIWX 3GXTA 1W54A 2VEKA 1EWEA 2NX3A 4D6FA 2PD5A 4P8VA 1SUXA 1J5TA 3S42A 5I7GA 3A12A 1UP3A 5H2ZA 1KFLA 1OX4B 5A69A 2HK0A 5AHLA 4FMVA 1REQA 1P48A 2Z1WA 1TA3A 4U2ZA 3TTOA 2G41A 1PIGA 4KEUA 1SR9A 1S5MA 2Y6ZA 2DQXA 1CTNA 3OIXA 1VEMA 4A22A 3T0CA 3POCA 2Y8UA 4Q8MA 4RV3A 1TYGA 2OYMA 3T81A 1FWBC 3WLHA 4MKNA 3RJXA 4JHMA 3BLOA 3O9NA 4C6DA 1UWUA 3H22A 4YVVA 2VX7A 4ZE5A 1OQFA 1AODA 1X1ZA 2NXHA 3KX6A 1KFJA 1ZGDA 2ZVIA 3BLPX 4IFRA 4Y2WA 2V30A 3WZ0E 1XG3A 4C6KA 1JPDX 3UETA 4DXKA 5FF0A 1FVPA 1HF6A 5KTLA 4JNMA 4DN1A 4DWDA 4FIRA 4G8TA 2W4XA 4GOAA 1O5RA 2VELA 3LN3A 1GJUA 2XYLA 1B3YA 3CAWA 4AYSA 3KLLA 4BI7A 3TYEA 4QG6A 1BXBA 3FAWA 2D73A 2PGFA 3L68A 5L9FA 3CQKA 4NZ3A 3N9SA 4C6MA 5I77A 4H8NA 3SSZA 3KXQA 4N2YA 2PTWA 2P10A 1Y5XA 3G1YA 4Q3MA 4JBRA 5C2CA 3EWZA 3QLLA 2J7FA 1B9ZA 3RPMA 4XAFA 3IGXA 4FNPA 5IDIA 4AAJA 3P80A 5DBUA 3ZZ1A 3S4TA 3VX1A 1VJSA 3LDVA 4MNKA 3AQUA 2WSQA 1NSJA 3F1QA 3LBOA 2Y4SA 3LV5A 1XF0A 1D7KA 3PAOA 3K1GA 1IIHA 1LF1A 2Z4GA 1XRTA 1UPPA 3UWEA 3EPMA 3DI1A 1MW0A 3WD1A 1BLIA 1LZOA 1OC7A 3P14A 4D9PA 2A3BA 1CBGA 3B0VC 1NFPA 3IK4A 2CU0A 2VEFA 3V3WA 4O1CA 2OEMA 2FMOA 2AL2B 4UCFA 4EXQA 4JICA 1JPHA 1FOBA 3EWUA 3SN4A 3QZ6A 4W84A 1ZAIA 3NQAA 2VOTA 1DJWA 2QEZA 3VCCA 2Z6IA 5LYRA 2XINA 2NV9A 1W3LA 5KSWA 5HR7A 3B0YA 3QTGA 3KOWA 2WANA 4OE7A 1TVLA 1XGDA 1AW2A 3QEZA 4M7SA 3CIWA 1W3JA 4HOXA 2BY2A 1L8PA 1W31A 3APYA 1ISWA 2RDTA 1XIFA 4FR6A 3CAKA 4EXBA 4PTWA 4NAEA 1R47A 4AISA 3LCWA 3WMBA 4Q8VA 2GDUA 1Z69A 2WBGA 1W5OA 4UCGA 1V0MA 4LUSB 3NVDA 1WCGA 1TPEA 4LAOA 1EBGA 4E6MA 7ODCA 3LCIA 4ZO9A 1A3HA 2W3ZA 2TAAA 4BF5A 1V6XA 3E5BA 3CHCA 1R0MA 4EE9A 4HNNA 5FJOA 1R7AA 1K03A 1PYFA 2J8FA 4WLCA 4O19A 3K8MA 1TV7A 4HOWA 3WUFA 3XISA 4NZJA 3GC5A 4DVOA 2Y7FA 4DM2A 3W29A 3A4JA 3VKBA 5JH2A 3EPNA 4PTMA 2H90A 2IKGA 4RDYA 1PX4A 3RRXA 4WSHA 1EJTC 4RDVA 3TWAA 4LCSA 5JIPA 5AHFA 3FHAA 2V2CA 3VD3A 1RSCA 1LRNA 4H9MA 5K2ZA 2VFEA 1M1BA 4HSHA 4J9JA 2HXUA 4Q8QA 4RNJA 2V5JA 2QCDA 4H41A 1VS1A 1WNOA 5LXXA 5JBDA 2O9RA 4O57A 4U31A 3QRHA 1LWJA 2V82A 4HPXA 5EU9A 1W1TA 3FY1A 3DOPA 4LCRA 3MSDA 1FKXA 2Y70A 3NXLA 1B31A 3DHFA 2PEVA 4B5SA 3S5YA 1F6KA 2I56A 5CZ0A 2PU0A 5FJUA 1F9CA 2GDQA 2TSYA 3EXSA 3CQJA 4A8IA 1XRFA 3GC2A 1OT1A 5I78A 4M56A 3SAZA 1CWYA 5M3WA 1YNYA 3C0QA 5AECA 4AVFA 3H8AA 4M82A 3DUGA 2GGGA 2RKXA 3GAYA 4BK9A 2GYIA 3LI1A 1NDYA 4D6IA 3ZOAA 3OBEA 5DY3A 1NEYA 4YYFA 2G3NA 4ML4A 1VRDA 3E38A 4D8AA 3G6LA 5LNSA 2NQJA 5G4EA 1G4SA 1QTWA 2QCHA 4W9TA 9CGTA 2DP3A 4OHQA 3S9IA 1I45A 1U1UA 2CZFA 4O4VA 5EL1A 3B06A 4WJXA 1TSIA 1XPGA 2ZE3A 1RCOB 5JUVA 5CC6A 2BOGX 2CETA 3WIJA 3BGGA 3EA2A 3GBDA 3GTIA 3GDLA 1SO3A 5DELA 3LMYA 4XB3A 2XN2A 1MQQA 3BSMA 2P8BA 3P93A 3U2CA 1JXJA 4GZ7A 1J0ZA 3FYPA 1CNVA 4JR5A 2BVDA 2VENA 3LM7A 3RR1A 4DUOA 3AMGA 3PPHA 4MNMA 4H6RA 4GISA 6REQA 1GQIA 1KM3A 2DZBA 4FEZA 3BK0A 6CGTA 1U30A 3BAKA 3H2FA 3G1VA 1MYRA 2QV4A 3N4AA 4DI8A 4O54A 4ZBCA 2PCEA 3CWOX 2WPGA 3GTXA 1WKDA 2OG9A 3WJXA 2E8YA 2IUZA 1E71M 4NNCA 4F9JA 1ZZMA 5E9XA 4M81A 2J6VA 3F5JA 4IUOA 3KOYA 2X30A 3W7PA 2A4AA 3WH6A 4D1IA 1X7IA 3RM9A 3GQYA 2PDPA 4CD4A 4D6DA 3W6LA 3H2MA 4MZ1A 1OADA 3FN9A 2WMIB 4WY0F 4BY3A 3EX6A 4M8UA 3EEZA 4CN6A 1JCJA 2DJLA 1HIZA 1JDDA 1F8MA 3KWXA 3FVDA 3ZQ9A 2OQLA 4P7NA 2WVVA 3B8UA 5HWNA 3ARRA 4LBSA 2XWEA 5IRPA 3HURA 2XFRA 2Y88A 3FA3A 1KCZA 2CHNA 4ONVA 4KIRA 3FVMA 1FHLA 4S3AA 4O15A 1ZNNA 2G3IA 4JTTA 1XCWA 2KAUC 4GX8A 2TYSA 1W1ZA 3NWRA 3PFMA 4B5XA 1E1CA 3FV9A 1XBYA 4QE1A 2WNQA 3MKKA 1HT6A 4HN8A 1IT0A 1US2A 1MDLA 1R3TA 1FWDC 5G1MA 4NXKA 3VGEA 4NJGA 1RY8A 3W87A 4FLOA 4J3WA 1XIEA 4RV8A 1ZJIA 1WQ5A 2DT2A 4QP0A 3WLIA 2WWCA 2NT0A 4KEZA 3K8LA 1BRLB 3C61A 3HGJA 1C7SA 1NP2A 5BMWA 4D8LA 1FWGC 3OGRA 1EDTA 4OGZA 1K3UA 5FACA 4LV4A 3SCSA 2OKOA 2UY3A 2G95A 1O66A 2DW7A 4WQ6A 3SR7A 1GT8A 4RK8A 1KGWA 4CEUC 1DQWA 5IOBA 3BSHA 2QPSA 4LRTA 4DRSA 1F7BA 1J96A 1X8CA 4D1JA 1V0NA 4GO8A 3BW2A 4DEFA 2ZXQA 4O10A 4CQ9A 4CU7A 1QHZA 3IEBA 4WOQA 3MVIA 1F6YA 1D3HA 1B5TA 1KB3A 1JZ8A 3PJTA 3VC5A 4YVPA 2X8RA 4AYGA 4GYFA 2VR2A 3ENLA 1I2NA 3M0HA 4Q4QA 5J04A 2VHLA 2C0AA 2NVAA 1VYPX 3B9DA 1XIGA 4DY1A 3HPFA 1TUFA 2R91A 1XDLA 3GNNA 3S5SA 3NQ7A 3MUZ1 2V2HA 3BAYA 1YDOA 4KF1A 3D5HA 2I16A 2YLAA 1LQAA 4MWAD 1XLDA 1A5NC 4PUNA 1A47A 5C5YA 3UR5A 2B7QA 3JS3A 4J27A 2YBTA 3M9YA 4PYSA 5XIAA 4NI8A 4QXIA 2YXXA 1XSIA 3LRKA 3KBNA 5I23A 1HGYA 1TE1A 5GVJA 3ATZA 3NL2A 2BB0A 3W7QA 7ENLA 2GL5A 5FL0A 3QYQA 1E4MM 3TOPA 1L6GA 2E5DA 2Q71A 1V6UA 4Z2JA 4RR4A 3E0FA 1ZB5A 5GJPA 2P50A 4KCVA 4V15A 3K13A 5AC4A 2VEMA 4Z2KA 2YDQA 1N8IA 3RILA 4JTAA 1KTNA 4DO5A 2Z25A 3W72A 1ODUA 1X38A 3B8SA 1SFLA 1WDDA 4X60A 3G24A 4Q6XA 3SUUA 2P0IA 3L4YA 7A3HA 1ZBKA 5K7JA 3BLKA 1W0MA