3H53A

Crystal structure of human alpha-n-acetylgalactosaminidase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-N-acetylgalactosaminidase
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
total genus 129
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h53A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h53A01
3BVUA 1TJPA 3G1FA 5BOOA 1ZNNA 2DH3A 3S6DA 1O94A 1QFEA 1LRQA 2J9ZA 3OA3A 1RQEA 1HX0A 1VJSA 1G7VA 3G0UA 5F1VA 4O53A 3EJQA 1CIUA 1MSSA 1D9EA 3NQ8A 3W7QA 3OHIA 3W1UA 1PZ2A 1XUUA 4L4LA 2X1UA 4WZHA 3BH4A 1WYIA 3TMQA 1ADOA 2G5WA 2DZPA 3M41A 4NT0A 3NYZA 1RVGA 2J6XA 3NQMA 1XCXA 2BY2A 1PIIA 5U7SA 4DO4A 1TPUA 5HQEA 3MP4A 1TPDA 3DFPA 3SZ8A 2I14A 3L4WA 1U2YA 4AEOA 3NQCA 3DKLA 1THFD 8TIMA 3G0SA 2QEZA 1TQVA 2GJPA 3GZ3A 2F7RA 2JKPA 5F2MA 3SW6A 3VU2A 4IQLA 5HMSA 2DU2A 2FQIA 3IVUA 4NX0A 3M5ZA 3OVPA 3HOJA 3O6YX 4EIVA 3LHUA 3U6WA 1C29A 4J3WA 3TROA 3STFA 3OVQA 2ZE0A 2WSYA 4IMGA 4DF2A 2A7NA 1KCKA 5G2IA 4TIMA 1BLIA 3WNOA 2WCGA 4UIOA 3MUXA 4XBSA 1LBMA 2G3NA 4ALDA 4LRTA 1XFBA 3DFQA 2VFIA 1PIFA 4UFMA 1VS1A 2WKGA 4N9DA 4HOWA 3KHJA 2WJZA 2ZZ3A 3EJSA 1VJIA 1EA0A 1WQ5A 4FLSA 1H1ZA 1K03A 4G1KA 1K8YA 3G1AA 1H7OA 3T55A 1JFHA 1J0JA 1ZHAA 1X1ZA 2F7FA 3EJPA 3ZR6A 5EA9A 5CSRA 3STEA 4OBTA 1HT6A 2Y7GA 3W84A 2ZFAA 3P62A 1JXKA 2WVVA 2C19A 1VRDA 3L67A 2ZUVA 3LI0A 5LNRA 1SSGA 3INPA 1EO7A 2FFCA 3QW3A 4O15A 4GQRA 3T44A 2R8WA 4MY8A 1Q6LA 3L5AA 2OT1A 3HG2A 4MYAA 3PC0A 3W1PA 1W5QA 4Q32A 3KVJA 1XL9A 1YDNA 1GEQA 2WO5A 1OFOA 2OYKA 4H6KA 3M0ZA 1KFLA 3DFSA 4A22A 2D3LA 2YKKA 3DU0A 1MW1A 1DJNA 3ZSTA 3DENA 1W37A 3P61A 4JIQA 3WK3A 5I23A 5KEZA 3LTSA 5F2GA 4K7VA 4U4MA 3JR2A 5G1YA 5DY2A 5E6YA 1W3TA 4WX2A 1W8SA 3WDJA 1FWWA 1KM3A 4R53A 1JGIA 3W7RA 3FJ6A 4OJYA 1OX6A 3EX4A 3MYOA 3QM3A 2YDAA 3W7NA 1ME7A 4UQ9A 1YYAA 3QMSA 1H3GA 3BAYA 3W1RA 4FNSA 5FF2A 1FUYA 3CIXA 3CTTA 2WVSA 1EWDA 3LV6A 1GJPA 5CKSA 3UYCA 2DJLA 2VRQA 4RLIA 3BLEA 1YLVA 4H7VA 1MEHA 3G8RA 3NQAA 3S42A 3TSDA 1G1YA 3A5VA 3CZEA 5CGMA 1RP9A 3DI0A 2QCDB 2PURA 1P0NA 4JGDA 1W5NA 3TONA 1YDOA 1JDCA 3CLMA 4PCTA 3QGVA 4JCMA 3LBMA 1H7PA 3R2GA 3VNZA 1GWJA 2BX7A 2EGZA 3M6YA 3MO7A 4IUOA 3QYQA 4JYEA 3WENA 3UZJA 2ZYFA 2B7QA 3QW4B 1U33A 1XD0A 2O7SA 3SFKA 1W31A 3GDRA 3F4NA 5FEXA 3P8JA 4PSRA 4RKAA 3WJZA 4N9CA 4GKLA 4QAIA 3C56A 3IIXA 1KM2A 3CHVA 1UA7A 3HB9A 5FF0A 4OGZA 2C18A 3BARA 3FS2A 2R91A 4KFNA 1CGVA 2I1OA 4XTIA 3PY2A 3QPYA 1SU5A 1A50A 1R2SA 1T8XA 2ZA3A 3KVKA 3C52A 1A5CA 1IXQA 4CVWA 2OCZA 5FF7A 3W7HA 5L6UA 1PV8A 2Y63A 2B7OA 3S0CA 5A8GA 2KZHA 2Z0IA 3AMLA 4Y8FA 2Y24A 5HJLA 3VE7A 3W37A 1GYNA 4MFDA 3MI3A 4JXCA 3NQFA 2CZDA 3CV5A 5LNWA 2ZZ5A 1AMKA 3BAWA 3NG3A 1F73A 4DO6A 2ATSA 3HQ1A 1A5AA 3KXQA 3U2OA 2F7QA 1DVJA 3G22A 3VSVA 1QI3A 4MFEA 3TC6A 4MY1A 3GDLA 3PBVA 3A22A 4PCSA 3USBA 3NDOA 2G96A 3TV8A 2QMJA 3EKLA 3P84A 4Z08A 3TSMA 3EDFA 1SSDA 1R34A 3P7YA 4MJMA 3L4TA 2V0TA 3S1VA 3MHGA 2F61A 2GJRA 5DFAA 3VMOA 2WNWA 1I45A 3VKJA 3CB8A 3RNDA 3QMRA 1R46A 2X2HA 4WSKA 1XBZA 5C2XA 2NV1A 3UQNA 3M47A 2A6LA 2DZSA 1TQUA 4JCLA 5F4WA 1G4SA 3ZQ9A 1FCVA 2C1HA 2JKAA 2YW4A 4ZQNA 3IJ7A 3GVGA 3BVXA 3F1QA 4AF0B 2XN0A 2JBMA 4PEEA 4GXMA 1FBAA 4CN4A 3E96A 1GVFA 2BXVA 2ZX5A 1VCFA 3WK2A 1IF2A 1JDAA 1N7KA 3WDIA 4R34A 4JDYA 4JL2A 1SW3A 2BSLA 3PSVA 4GI9A 2Z6IA 4JD4A 3NPVA 2ZRYA 2YSWA 1BTMA 4PEKA 4X9YA 3W6YA 4BWLA 2WSRA 4JY8A 1KCLA 4N02A 3QSTA 1L9WA 2VEIA 4RXFA 5HR6A 3OBKA 5LGZA 4N6FA 3NEVA 3KX6A 2VFGA 3G1XA 3A23A 5A2CA 4M7SA 3THQA 4GJ1A 4MAZA 2OYMA 3EWWA 4UTUA 1CGWA 2QCFA 1TQJA 1V5XA 3E9AA 2ZUSA 5CXPA 1GCYA 3II1A 4E38A 4NI3A 5LHEA 3SECA 2HS6A 3CPRA 2GUUA 4UMCA 3NQ2A 3PWAA 2ZXDA 1VYRA 3NQDA 1LDCA 5EL1A 5L9FA 1UCWA 3FOKA 4K36A 3TUUA 3LHWA 2VRKA 2TRSA 4JIPA 1UD5A 3GKFA 2A21A 3L0GA 5AHEA 1SPQA 4UFIA 2P0OA 3BAXA 2ZCGA 3TH6A 4EWND 4UQBA 2ZUTA 1L6YA 1YTEA 4HIBA 4NU7A 4X2RA 1LLWA 3IV3A 4MUZA 3IJ8A 1JRCA 1A47A 4U33A 1I4NA 3W2LA 2H6RA 5EMYA 3EJTA 1LROA 1OVDA 3GDTA 3MBFA 3BAIA 4IMEA 4I9AA 2FJKA 1LP6A 3DFTA 1SZEA 3VM5A 1RV8A 1KXVA 2FHFA 4Y9AA 4BK9A 1F5ZA 1SR9A 2RFGA 1LOQA 1YTKA 3MHFA 1IIGA 2VFHA 3VMPA 4ONVA 4DXVA 1I2QA 1VFMA 2CHNA 3TW6A 2LLEA 3OLIA 1W3IA 3BLPX 1VCGA 1XCWA 5CPMA 3W7JA 3F4WA 1V3KA 2ATMA 2PWDA 1C9DA 1PVNA 4M8UA 1H62A 3PB0A 1YXDA 1OK6A 1A5BA 3GIYA 4EF9A 2R14A 3WJWA 2NX1A 3BK0A 2BXZA 1P5BA 3GX9A 3S8HA 3C6CA 5FEPA 1HO4A 3WFZA 1M6JA 1Q6OA 1MW0A 2ZZ6A 3MP3A 5CPNA 3WDHA 3BUIA 1B9BA 1OX5A 3SIZA 3WELA 1MWOA 4E2BA 4MVAA 1JD9A 2QDGA 4L4MA 1IZJA 4NQ1A 1JQVA 3N2MA 2E9BA 4JR5A 4UZSA 1A53A 1HG3A 4W93A 5AHIA 3W7PA 3LBCA 3EDDA 3KVLA 2Z1KA 4QJ1A 5LNSA 4UFKA 3DX1A 5CPOA 1BSIA 3D4YA 3L4VA 3VSUA 3RILA 5I3KA 3NPWA 5FF4A 3UWQA 1E43A 2OT0A 1JXJA 3DDFA 1KXTA 1TYGA 2E5BA 4MZ1A 1R75A 3ZT6A 4O1DA 1F74A 4M6QA 2DZUA 2OMAA 4H8HA 3M5YA 1OB0A 5A6LA 4BWLC 3BAKA 3W7GA 2GQ9A 3TIMA 3L0KA 6TIMA 3T78A 2OJPA 4NVTA 5E0FA 1SZGA 4J3TA 3HBLA 3GBEA 3BW2A 1ZFJA 5KMYA 2A2IA 2CU0A 3N2XA 3VI2A 3NQ7A 1GTEA 2AQWA 3S5NA 1KBIA 5LNVA 4AHPA 2VFDA 2Y4SA 1VLWA 3EDJA 2Y7DA 3W74A 1QPRA 2CLHA 2HMCA 3NQVA 4GUJA 2ISWA 3HMJG 2ZWYA 3C2OA 3JS3A 5LSMA 2QCMA 5DCEA 2EQDA 1ONRA 2VR5A 4O8RA 3KLKA 2WV8A 4M7TA 2WKJA 1H7NA 2OSXA 3BUBA 3VNDA 1KFCA 3PG8A 5KZMA 3DZ1A 5EY5A 1GPWA 4YXGA 3DHUA 5AYZA 2WPBA 2XFWA 3W7MA 2V3DA 3L0NA 3O06A 4WQ6A 3BUDA 2PCQA 4O4WA 3B4UA 2YA1A 5GVJA 5D32A 5KITA 3KFTA 2TYSA 1SMDA 4O0KA 1XUZA 5K7JA 3WMSA 5F7UA 3HGSA 3IVSA 2NT1A 4AEFA 3EDKA 1SZFA 3G0XA 3RMJA 4TU1A 2WNZA 4E2OA 3I7RA 1XSKA 3MMTA 3VCRA 1C8QA 1LTDA 3M07A 2ZRZA 2VFFA 3BCFA 4JL1A 1TQSA 3LXBA 2GVYA 3DXIA 1XV8A 1XI3A 1MVYA 3BW3A 2NX9A 5BMXA 3SI9A 3KAOA 1KBJA 3H53A 1B57A 4K6AA 4P2VA 2EF9A 4O14A 4ZMGA 4U31A 1SMAA 5CLWA 2PRLA 2ZBTA 5I3JA 3BLKA 2QUUA 1TMQA 1MZHA 2J9XA 2FH8A 3O63A 3STCA 4KFPA 1G6CA 3UEQA 1H7RA 3Q58A 1YTDA 3DH7A 4POCA 1UH2A 3WY2A 1TPH1 4LC8A 4WD0A 1ML1A 1NAL1 1NF0A 5CZJA 1I8JA 2HSAA 5KSWA 1KBBA 3TX9A 3YPIA 1ZAIA 2FPTA 4U3CA 4GUHA 4RV8A 2ZQ0A 1GYLA 3BG9A 1XH1A 3CPUA 1NF7A 3D50A 3DHDA 4BR1A 5HNRA 3WNLA 1HL8A 3TNOA 3ZFHA 1QPQA 5BRBA 5F1UA 3NPXA 3KRSA 2XVKA 5E0KA 5BRPA 2YR1A 2CLFA 2QAPA 2YFOA 4N6EA 1HVXA 3WEMA 3FJLA 1UOKA 2IQTA 4CLMA 1SZNA 1Q45A 4IMCA 4N4QA 3QMTA 1I2NA 4JEQA 5LGXA 4S1FA 3IK2A 3RLUA 3HPZA 4CQ9A 4KMQA 2FHBA 5DCDA 3W1NA 2ZUUA 1M7PA 3ZSSA 3QQ1A 1E3XA 2C0AA 4JFWA 2H8XA 3L9CA 2F84A 5EYWA 1P1XA 4UR8A 2DIJA 4QNWA 3IGUA 1UKQA 2WNNA 1W1ZA 2NZLA 4N9BA 2Y7FA 4H8VA 4EF8A 4NJGA 1J2WA 4UZUA 1VGAA 2FH6A 4JX6A 2X2GA 5HWJA 1HTIA 2C16A 3BLFA 4MJZA 2XWDA 4JTUA 4Q4KA 2E6AA 2XN1A 4OT7A 1Z44A 1TV8A 1K02A 2D3NA 1SFLA 3LHVA 3DGRA 1JL8A 3Q94A 4MIMA 3B0PA 5J5RA 4D2JA 4LU0A 3W72A 1OYAA 3GXNA 3ZS4A 3GTNA 1PJ9A 2EAEA 1LZOA 1QAPA 5ABTA 3L4XA 1DQWA 3LTPA 1YDVA 1SO6A 4S2CA 3W85A 1VFUA 1OG0A 3QFEA 4BZYA 1WPCA 5I3FA 2ZA2A 5I3GA 4GINA 1DJQA 5A6MA 1PZ3A 3GDMA 2WVTA 3EB2A 4JTTA 3DC0A 4LWWA 3HF3A 2CW6A 3O07A 1K8ZA 4IX2A 4WXYA 1W5PA 4PSPA 4O18A 4GWEA 3D0CA 1TCMA 1XC4A 2X1SA 2OSYA 4UFJA 1KM4A 3MI2A 5LHFA 3R8RA 4RX0A 1KWKA 2CZEA 2WSPA 3AO0A 3EWZA 1FCQA 3BG3A 2BHZA 2VEKA 2A7RA 2R94A 2QF7A 1B2YA 1MW3A 5AC6A 1LWHA 1SW0A 5DLCA 1AL7A 4LV9A 4NJJA 5HPOA 3A5FA 1JRBA 2J9YA 1K7FA 1EH9A 1TB3A 2FB2A 2Z6JA 1DTUA 4JTJA 4DEFA 3WN6A 1JUEA 1MFUA 2Q3OA 1UD8A 4TMCA 4JYFA 3CM4A 1M53A 3LI1A 4GUIA 2ZXBA 1H61A 2YJQA 4H2CA 2NWSA 2NUWA 3HJEA 1S46A 2ZX9A 3W7KA 1JCJA 3N14A 1XCFA 3EDEA 1QNVA 4GE8A 3S5ZA 3L4ZA 3W23A 2C3ZA 1VR6A 3FKRA 2D0GA 3KL3A 2UV8G 3F03K 2F7PA 3EXSA 2CLIA 3QPZA 4LV4A 1LM1A 3ZR4A 1GG1A 3NL6A 2D2OA 3UPWA 1UUOA 3I6RA 4O17A 3V1PA 3ZWSA 1KTCA 4JNMA 1D3CA 1FDYA 2DZXA 4CCDA 1SO5A 1H1YA 4JTEA 3WY4A 3BO9A 3VGDA 1JDDA 2ZXAA 3ABQA 3FA5A 4MZYA 1LOLA 3O1NA 1KWGA 3W3OA 1W9XA 2RDUA 6CGTA 4RR4A 3VGFA 1BPLB 1DV7A 4AIOA 4LNYA 4QITA 4O4VA 4LVAA 2PRMA 1JF5A 5D02A 1GT8A 3OIXA 1X1OA 2ISSA 1ZCOA 1BG9A 2QCGA 2NLIA 4ZQCA 2FTPA 1JQXA 5G4WA 4OE7A 3JRKA 3LRLA 4IJBA 1MO0A 1OF8A 1OX4B 1WAUA 4IMDA 3MW7A 5AFDA 4O16A 4O54A 2V30A 4NZJA 1YPFA 3CWOX 3RLVA 1TRDA 1X8FA 3B06A 2V2HA 5SWUA 2P10A 3IEBA 1V3JA 1HO1A 3HGJA 3ZWTA 1G4PA 2VELA 5HR7A 4ADTA 5C54A 1PIGA 1RP8A 3MBDA 2Z2UA 5IBXA 1DKWA 1HUVA 4A29A 3LDVA 1QPNA 1D3GA 4O11A 3DBPA 4QQ3A 4NJIA 1WO2A 4IGHA 4O57A 1JIBA 4XQ6A 3NA8A 4MZ8A 3W07A 3I65A 3KEHA 4Y96A 5DBUA 3W7LA 2BHYA 5HXMA 2E5DA 4JTKA 3W1MA 4XWUA 4UXDA 4UQAA 1B4KA 1DL3A 5D2WA 2B7PA 3B05A 3L65A 1IIHA 3PUDA 2Q8LA 3ECQA 3PUOA 1ICSA 1QX1A 3L2MA 5EPDA 2ZZ7A 2BXYA 4QISA 4W9TA 4O28A 3O16A 4UOQA 2AMGA 3UPBA 3NM3A 5CZSA 1ZAJA 3GAKA 2GQ8A 2ZX6A 5HUOA 3QZEA 1EHAA 4KWWA 4UCGA 5AHLA 3NGJA 1KLZA 5K4XA 5AC8A 1OFBA 5D04C 1CYGA 4KFOA 4M56A 3W38A 2ZRVA 3LM7A 1KV8A 1DHPA 4WLCA 1OYBA 4FEZA 4IWWA 4J9JA 2Y85A 2XIBA 4DO5A 2Q8ZA 1U30A 2FDSA 2ZRWA 1BVNP 1F76A 4RK8A 4U2YA 2BZNA 3IVTA 2ZXQA 3ZR5A 3EXRA 2XWEA 1RD5A 3BSHA 1UUMA 5DXYA 5BW6A 4IMFA 2NXHA 3NL3A 2PRHA 3T40A 2NXIA 1W5MA 4LS0A 2YYTA 4M6VA 3LCXA 1UD6A 3HG3A 3FKKA 2PC4A 5CZTA 4UTMA 1YXYA 4LTSA 3WK1A 2GJNA 3UD6A 4ORIA 1CI1A 2D0FA 4R7JA 2YA0A 1ZAHA 1WZMA 4WXZA 3P81A 1TV5A 2ALWA 4HKPA 2F7OA 3C2VA 3HPSA 5G5IA 3GXIA 4B9ZA 3W1TA 4UTTA 1RR2A 3TE9A 3NQ6A 1BEUA 1FXQA 4ML9A 3ZT5A 1Z42A 4LVGA 3HIJA 4J28A 4AYGA 1O60A 5H91A 3UWUA 4B9YA 2ZRXA 4YLWA 2Y6ZA 1OHLA 1N8FA 2AGKA 1TO3A 4AHOA 4JDBA 3PB2A 5DXXA 1GVRA 2G3MA 4KKXA 2YYUA 1HL9A 2GOUA 4O19A 1BKSA 1R33A 3P67A 4XB3A 2QCDA 4HOZA 4YWIA 4OKDA 1F7BA 3G8EA 4HNVA 1F6PA 2FE0A 2X1TA 3DI1A 3PSWA 3G1DA 1KV5A 1SW7A 5CZ0A 1QCWA 1EB3A 1WZLA 1D3HA 3PAJA 3FFSA 1UD3A 4XKYB 3NXFA 5IBXC 3N19B 4HT3A 1XSIA 1KXQA 1OGSA 4LUIA 1G7UA 3TW7A 5CGTA 1VC4A 5D2YA 3U8GA 1DBTA 1CXLA 1JR1A 3CZLA 1ZY9A 4JN6A 3UERA 4GIAA 1LBFA 3T4CA 4BA0A 3RU6A 4WF7A 2E77A 5MHBA 1C8VA 1AG1O 1F2JA 3BLIA 3LLDA 1KTBA 3VGGA 4M19A 2A5HA 3DHFA 3DDGA 1CW2A 2GQAA 4LVBA 3W1AA 3PF3A 1W54A 5LZLA 4HSOA 2ZTJA 1HNYA 1CXFA 1EA9C 3L68A 2QPSA 1VAHA 3EWYA 4JYDA 3O05A 3LGEA 4WY0B 1SO3A 3GYEA 4HPXA 3LOTA 1GZGA 4WJEA 2CXGA 5G1TA 3W87A 3CTLA 2Y88A 1KM6A 1BF2A 4AH7A 2Y5EA 3GDKA 1PHQA 3C4UA 3P5YA 5FEWA 2FPVA 1CX9A 5G4EA 1S5VA 1QO5A 4UQCA 4K39A 3LX9A 2X2JA 2QMKA 3E49A 1KGWA 3HZ3A 4PH6A 5U4NA 5DN1A 3BC9A 1N55A 1S3HA 4CNNA 4HPHA 1F6KA 3UG3A 3LCIA 2QJHA 4IXHA 4ZVJA 2J25A 2WC7A 1OFQA 3PUEA 3W2KA 4O50A 3NAVA 5DO8A 3QC3A 1TV7A 3TXVA 4FMVA 2YPIA 4GNJA 5K4ZA 4X22A 2JGQA 2E0PA 4AMAA 1CDGA 1AW2A 1S5TA 4ATWA 3S5YA 3FAWA 2NV2A 4A2RA 1KBKA 5KZDA 4IOTA 3KWXA 2ZUWA 1G4EA 2ISVA 4LVFA 5H2ZA 2DZVA 1M7XA 2CLOA 1WBHA 3O15A 3WEOA 2QCHA 2I9EA 2PE4A 2V81A 1F05A 2H8ZA 1W5OA 3M9YA 2AAMA 4MY9A 4UTTC 4PTNA 4BI6A 1JJKA 1AQHA 2C6QA 4ZL1A 4AF0A 1MFVA 2DZWA 3KVMA 4GUFA 4CNPA 3VM7A 2E5CA 3WJSA 4Y90A 2Y2WA 3P60A 1KGXA 2NUYA 5DBTA 1UB3A 1BWKA 3UWYA 3W70A 1UA3A 5FESA 4H8UA 4UTLA 1QWUA 3PULA 2YGYA 1W56A 1TQWA 3PBWA 4UMAA 2FYVA 4MLJA 1IXPA 4BFAA 5K3VA 4HP5A 4TMBA 2XVGA 3NZRA 6TAAA 1OFPA 5T26A 1KFEA 2ZIDA 3FLUA 5K9CA 2TAAA 2W6RA 4ZQMA 3VGBA 1WOAA 4PCFA 1S5WA 5D05A 4CN1A 1AMYA 2WVUA 1E51A 3EWUA 4YMZA 2VFEA 5I3HA 2EABA 5E1QA 1L6SA 4N4PA 4FNTA 1G67A 4X9SA 3C2EA 2E09A 2YXGA 3A6OA 4YCOA 4BI7A 1KA9F 3EX1A 3IIPA 3WNKA 4HNTA 1B3OA 1SO4A 2QJIA 1EP3A 4PL2A 1T96A 4UTIA 5DY3A 1KXHA 1SFJA 2EO7A 2VEPA 3OG3A 5AHFA 5IM51 3GLCA 1KTNA 3V75A 3B8DA 3LRKA 5TQLA 3RFAA 3G1VA 2WNQA 1O7DC 4AAJA 1JULA 2BY3A 3NQGA 4FNPA 1ZJIA 2BHUA 4AW7A 4QNEA 3HGOA 4WOZA 4YL2A 5F2LA 5D38A 2XN2A 7TAAA 5CLTA 1QWNA 1GTHA 1XBYA 4GRSA 3LLFA 1HL2A 3SR7A 3GBDA 1JG9A 5K2ZA 2P1FA 3DFOA 1QMLA 3G3MA 1KM0A 1QI5A 3W9ZA 1JCMP 4X0NA 1U5JA 1M7OA 5I24A 1H7XA 2VXNA 3MWAA 1AL8A 2CFFA 4NXSA 3QJAA 4DF0A 3P8IA 4O10A 1CGXA 2F18A 3LPOA 1ZENA 4M5PA 4AWTA 1J5TA 1KM5A 3GXDA 4FHAA 2QCEA 3KE0A 2FLIA 1LYXA 2WVVB 1QW9A 1AK5A 2Y89A 1V3MA 3TTYA 1P0KA 1GJWA 4H3DA 2QJGA 2IGTA 2E6DA 1W0MA 2B0MA 5C5YA 3EX3A 3IRDA 4Z1DA 2FPYA 3AXIA 2A6NA 4J3XA 3K8KA 1T99A 2X2IA 4PL1A 1GVSA 3T7VA 1T0OA 2V5LA 1QWGA 3LV5A 3NQEA 5I0DA 3PR2A 5A2AA 1PE1A 4FF7A 2PWFA 3S2CA 5CGQA 4PC8A 3UCQA 3FEMA 4JFSA 2C15A 2QPUA 1OFEA 4C1LA 1JF6A 2VNCA 1ALDA 1U83A 4I7WA 5E93A 5E70A 4GFSA 1IGSA 3B0UX 2PWEA 2V5BA 1FX6A 3KRZA 3C0JA 2OSWA 3AXHA 3QH2A 3BVVA 3M7WA 3R13A 3GKAA 4Y6GA 4B5NA 3KOFA 1OJXA 3C8FA 1XBXA 1OT2A 2EPHA 5FI8A 4CCEA 3EKZA 1XH2A 1JUBA 3W71A 4OV4A 1RQBA 4DPQA 1G94A 1I75A 2GVGA 4UC5A 1Q6QA 4JICA 3IIZA 1XH0A 1TPWA 2ABAA 4DBEA 3D52A 1J4EA 3B03A 3E0IA 1M5WA 1IXOA 2CPUA 1IV8A 2RKXA 3M43A 2C8NA 4XBKA 4LT9A 3MP5A 3VFLA 1FWSA 3AJ7A 5TBOA 1UKSA 2G97A 4ORMA 2A1YA 1FWTA 3NL5A 1EWEA 4O1CA 3I68A 1UBSA 3BUPA 1TPFA 5I5RA 3S5OA 2JGYA 5KTLA 1Y0EA 3G24A 2H3BA 4E0CA 2RDWA 3EX6A 3FIGA 3W7EA 1CXEA 1UASA 7CGTA 1QW8A 3VX1A 1Y7VA 2PWHA 2Y70A 4RJEA 1DOSA 4I7UA 4Z1AA 4UR7A 1H60A 1ME9A 3K8MA 2EADA 1HWWA 1R2RA 1EX5A 4FX7A 4Z0SA 3VE9A 1VYPX 1OFAA 1DQXA 2VOMA 3TC7A 5EMUA 1QDSA 3W73A 3CWNA 4JTGA 4LQ1A 3SGUA 1FXPA 3THAA 3TMLA 1XGZA 3H55A 3N3MA 2WOQA 1LWJA 2ZZ2A 3CU2A 3PS7A 4JX4A 1BVZA 1OSEA 3TQKA 1NSJA 1LBLA 2ZZ4A 2G95A 1NOFA 4KWVA 3SGZA 3C2RA 4UMBA 2E8YA 4IX0A 3NL2A 3I7SA 1MEWA 3OLGA 3TU9A 2V3FA 3PG9A 4XZ9A 4UTWA 3KLLA 4DBDA 4CNOA 3TFXA 2Q3RA 1ODUA 2B7NA 1QI4A 4JTSA 3MHUA 4TVUA 3UG4A 1W3NA 3NOEA 2J27A 3HGRA 5D2VA 3WJYA 2GPTA 3TSBA 2E1DA 1QHPA 4DELA 3LHYA 5LNUA 1PHWA 1JCYA 4FLOA 3LCHA 3LB0A 3ATZA 3R89A 1TTIA 2ZX8A 4QAWA 3ZO9A 1ICQA 3EJRA 1B0IA 3W2MA 1H50A 4S2BA 3P82A 4CQAA 3N73A 2ZICA 1Q3NA 3B04A 5AOUA 2CWNA 3LCWA 3VX0A 2CLKA 1YPIA 2JKEA 2EACA 2YOCA 4TR9A 1ZJAA 3B0VC 2E6FA 1WOBA 2XVLA 5CSSA 3WK0A 4HSNA 5AYXA 2E68A 1KFBA 3G3DA 3O6CA 1P4CA 2EJ1A 3CZSA 1CPUA 4AEEA 4HNNA 1Q4NX 3GB6A 1WZAA 3W2JA 4K8HA 5HDRA 3QF0A 3PM6A 4JFTA 1R2TA 3OLDA 3BVWA 2CLLA 4AWSA 2A85A 2B4GA 2FIQA 4IXXA 3WFAA 4U28A 1CGUA 3LXCA 4Z0JA 1K7XA 2ZA1A 1P6WA 3GXFA 3LXAA 3EEGA 1GG0A 4NJHA 1PCWA 1VYSX 2CZ5A 5C55A 1WP6A 3DKJA 4HPJA 4CGTA 3TR2A 2DZTA 2H3DA 4A2SA 3WY3A 1DHKA 4RZ6A 4FNQA 3DX3A 1TRIA 4HOXA 3FYOA 3BUQA 4LXFA 4HN4A 4A21A 1X7FA 4LPCA 4ZQRA 4GO9A 5BRQA 2FB3A 1TPVA 3EX2A 3WJXA 4EVZA 2V3EA 2QCLA 4UCFA 4PODA 4HA1A 1QOQA 1DORA 1FWNA 3M1ZA 3W22A 1TIMA 3AJXA 1WZKA 3W2UA 1EO5A 3WNMA 2NX3A 3D4ZA 5A5WA 5D2TA 1UJPA 3K8LA 1VB9A 1VCVA 3UWVA 3VO0A 4FO4A 3CIWA 1I2OA 2HS8A 4MLRA 4RZ4A 3A24A 1IZKA 1ZALA 3BG5A 3R12A 2GJLA 3D51A 2NWRA 4AHQA 2GVJA 2QLYA 1TJRA 4X3ZA 5HULA 1K3UA 3M16A 1TPEA 1CXHA 4J3SA 3DHPA 1FDZA 3BGJA 4CCCA 1O4UA 1L0PA 2O7QA 3HJZA 1O5XA 1PS9A 3TAOA 2WQPA 4GI8A 3MI6A 2VT0A 3L21A 3BCDA 4O0ZA 3UWWA 2W0UA 1R30A 1FCUA 4UTWC 4QM1A 2Y61A 3BVJA 1J0KA 2OW7A 4AVFA 3UZ5A 1CGYA 2ALDA 1Q6RA 2CLEA 1XDMA 3TJXA 1YADA 3BMVA 4AMXA 3W7CA 2V82A 4MPQA 3EJUA 4FLQA 2OZ0A 2V8ZA 3DAQA 5D09A 2E6YA 1FWRA 1JUKA 2V9DA 2VKZG 2ZTKA 3NVTA 3Q2DA 1OT1A 4UOZA 5KZEA 3NR0A 3LCFA 5LKYA 3S1WA 1XKYA 1LRNA 4LUJA 3W83A 3RK8A 4LS2A 4K38A 2F2HA 4UNIA 3L2IA 3FW6A 4HHPA 4NJKA 4JFVA 2YX0A 1PCKA 3VGHA 1RPKA 4UFHA 1Z48A 3PBUA 1VZWA 4FXRA 1Z32X 3CQ0A 3BW4A 1LORA 5TIMA 3GR8A 4AIEA 1R47A 1CXKA 4WOQA 4GO8A 2DJXA 3HG4A 4GBUA 3K1DA 6ALDA 3W76A 1MEIA 3IGSA 5G2HA 2ZDRA 1KW1A 2DP3A 1V3LA 9CGTA 4N2YA 1H51A 1DEDA 3CZKA 1PL9A 1GQNA 2QUTA 4LS1A 4XUGA 4GQQA 3LERA 1PS3A 3UNDA 1VHNA 2X30A 1SUXA 2QAFA 1UD4A 3CT7A 1JCLA 4AMWA 4AWUA 3VSTA 2TSYA 4WSJA 2V2CA 5D03A 3E12A 1K7EA 5I3IA 1G4TA 4KWUA 3K30A 4FIRA 4K8EA 4FB7A 3C61A 1EP2A 4ZQOA 1WV2A 1JCXA 5AN7A 4O1AA 3N34A 4YCPA 2OW6A 2D73A 1OABA 1WE5A 1OF6A 3L2LA 4IPIA 2TMDA 1X6UA 5D37A 2GUYA 1QOPA 3IGXA 1KB3A 2BTMA 1O95A 4UQEA 1XDLA 4FXSA 2DH2A 4JS3A 5C6MA 1TTQA 4FLRA 3ABSA 3ZOAA 1QPOA 4ICNA 5AHNA 3UWZA 3W1QA 2DORA 2ZWZA 2W79A 4LOCA 5E9AA 5F4SA 4PA8A 1OX4A 1Z41A 1NEYA 4NX5A 3IJ9A 3TOPA 3CZNA 4CN6A 1FQ0A 1WX0A 4K37A 4O12A 1AQMA 4TO8A 1AW1A 3OVRA 3RIKA 3OLEA 3G1SA 4AB4A 1E40A 1B4EA 4WY0F 3W86A 1EP1A 3LCGA 3UXDA 3M5VA 4CQ8A 1XSJA 2NSXA 3G18A 1V7YA 1G9HA 5E6ZA 3IIOA 3W1XA 2BWGA 4GI6A 2A7PA 3EWXA 2AAAA 4TX9A 1WDWA 2EHHA 2CZFA 3TQVA 4H4IA 1D7FA 3STGA 2VC6A 2WCSA 2QUVA 4O13A 4M6PA 2WSQA 4LVDA 4K7YA 4UQDA 3P5ZA 4MB1A 1LRTA 3FYPA 3GXMA 2FHCA 5A2BA 2YFNA 1TPC1 3NM1A 3DX0A 1VLIA 2OYLA 4FNRA 3QQ0A 1WBJA 1XD1A 7TIMA 3UG5A 1RZMA 2QR6A 2Y62A 4RCXA 2XIIA 1AW5A 3L5MA 1BAGA 4LC6A 4J7RA 1TQXA 1VQTA 2VENA 4ADUA 3AMKA 3VGEA 4UNKA 3TK7A 1NVMA 1TSIA 3TCEA 1EUAA 3BPWA 3A21A 5D2XA 3DX4A 1K8XA 1HXKA 3VMNA 4BI5A 2GVLA 3BV4A 1TQTA 1EPXA 5HUPA 3GR7A 3GNNA 3LRMA 3GK0A 1L2UA 2D0HA 1QO2A 2YA2A 2BY1A 4CKQA 5BNKA 2PWGA 1TMHA 3HG5A 3TXZA 2WPGA 1NM9A 4FX8A 1ZJBA 4LRSA 5KINA 2X1RA 4JTIA 4QIUA 1FY6A 1YXCA 3DFNA 2YZRA 1CLVA 3WY1A 1XBVA 4JX5A 1MXGA 2F1AA 3ATYA 4WUIA 3BLBA 3CZGA 4LY8A 4OU1A 4OQVA 4E2DA 1JAEA 3ABRA 2NXGA 3UY8A 3BAJA 3O6DA 2X16A 2VEMA 5G2WA 3LPPA 1HFBA 4O1BA 2QCCA 3PVFA 3ZT7A 1TPB1 4UTJA 4A3UA 1KLYA 3LCLA 2YIHA 3A9IA 1VH7A 4FIQA 3Q37A 1PPIA 3GAYA 3NNTA 1LOSA 8CGTA 3R5EA 1JVNA 3L4UA 4R33A 4ADSA 1GJUA 2OX1A 3A47A 3CEPA 3W7OA 3L5LA 1J0IA 3WNPA 1MXDA 4HNUA 4O52A 4XTDA 5F4XA 3ELFA 4I7VA 1FDJA 1OFRA 4JTHA 4RXGA 2A0NA 4OHQA 2RH9A 3W7DA 3W88A 4ZZ9A 4JFUA 1L6WA 3KRUA 1BWLA 1RQHA 3S1UA 4U2ZA 3NPUA 3SSJA 2E8ZA 1GOXA 3WNNA 1VPXA 5K9XA 2YCEA 4EOUA 2RDTA 1E3ZA 3BMWA 3QSRA 5AYYA 4NXKA 2V2DA 4GUGA 1EUNA 2QCNA 2Z1BA 1OFDA 4OIFA 4RZ5A 2DIEA 3EXTA 2F1BA 1HTYA 1H63A 4NNCA 1PAMA 3GXTA 2QDHA 4JTLA 2QKFA 3W75A 4JTFA 4XKYA 4DF1A 2HTMA 3DX2A 3C3NA 4OV9A 3CC1A 3W1LA 3TAKA 5D30A 5DCBA 1FCBA 4LW7A 4NNBA 3S9YA 2NT0A 4P61A 5K9DA 1I2RA 4UFLA 2EKCA 3IIVA 4DQWA 4Q33A 3L66A 4UTHA 2YW3A 3KL0A 3G1YA 3ABOA 5DELA 1ZS2A 3M5XA 1KM1A 1UD2A 1G5AA 1GVQA 4Z1BA 5BMWA 4IPJA 5HWMA 3MYPA 1UH3A 4J3UA 3UXAA 2WSKA 1TTJA 1KFKA 3E02A 3NO5A 4NNAA 5AC7A 1XXXA 5D33A 4JY9A 1H5YA 3LHTA 4WY0A 4C1KA 3OEXA 1LLZA 3TFCA 3ANYA 4MKNA 1TREA 1GVOA 3SJ3A 3TTSA 4Z1CA 4UUIA 5FEZA 2FGZA 4J27A 3W2NA 3PBYA 2ABBA 3S1XA 3TJLA 4J3VA 1WA3A 3VNYA 3CEUA 2EEXA 3TDFA 3FAXA 1TTPA 4DPPA 4OWGA 1JI1A 5HWNA 4QSHA 1O5KA 2WKLA 5EBUA 1KGUA 5TD4A 3LTYA 1WXJA 1VFOA 3CGTA 1CGTA 3P74A 3GXPA 1IXNA 3H54A 3M44A 1TCDA 2C7FA 1RPXA 3KL5A 1JI2A 1KFJA 2ZZ1A 5CPLA 5EKYA 1AVAA 1H7WA 3MJYA 5CG7A 3RF9A 3BSGA 2BY0A 3G1HA 3HO8A 1G69A 3N9SA 1A5SA 2H90A 4FX6M 2C13A 3BVTA 2WANA 3A4AA 3L4YA 5F2IA 3C2FA 4UTKA 1PEZA 4MOZA 3N9RA 1XM3A 1OK4A 2C14A 2ZRUA 5AHMA 3QEZA 2QV4A 4GC4A 3O8AA 5FF3A 1EEPA 2VUYA 5AB3A 1MXSA 1ICPA 2EAWA 1JD7A 1VIWA 2J24A 3BGGA 4ZQPA 3TA6A 4PFMA 3P80A 1QR7A 1I2PA 4MYXA 1QHOA 1GVIA 3CLWA 4FNUA 1ME8A 3QRHA 5HINA 2JK2A 3UY7A 3TQ0A 4NZFA 4AYSA 1VHCA 1NFBA 1JCNA 1QPKA 2E4TA 1UKTA 1EIXA 2TPSA 4N9EA 1CXIA 5J5DA 3TKFA 1SQ7A 4BF9A 3LHZA 2ZX7A 3SY5A 4UNLA 2BLEA 4AXKA 2A4AA 1J0HA 1UH4A 2RHGA 3GNDA 2CLMA 3EWBX 3HPXA 3I7QA 1LCOA 1MW2A 2NUXA 2Y7EA 4NUWA 3W7IA 3NZ1A 1OYCA 2J88A
chains in the Genus database with same CATH superfamily
1TJPA 1ZNNA 4A1RA 3S6DA 1L6PA 5F9AC 1T80A 2J9ZA 3VIPA 3INUH 3NQ8A 1ZA3B 1WCBA 5C0FA 3WE6B 1JMXA 1JPSL 3OQ3B 1F5WA 1RVGA 1XCXA 5EU7C 4DVRL 2WBXA 2H26B 4OBSA 5ERWA 4G5ZH 1TQVA 4R4FL 3EGXB 4AVHA 3CSPA 2NW2A 3AHVA 3IU3B 1LTXA 4Q6IB 1DJWA 3LJ3A 3D8MA 1Z5LA 5CSYA 4Z0BL 1E6XM 4Z8FL 1OCRB 5E94A 1ND0B 4DWDA 2WKGA 1I1AA 1OE3A 1ICTA 1NQ6A 2VCOA 1PFOA 2F7FA 2UXTA 3WFDH 3ZVHA 2V38A 3C5ZD 5RUBA 3KW8A 2LGNA 3CLFH 12E8L 5FO7A 2VWSA 4KEZA 4O15A 1F13A 3LZLA 3B9KB 4MQXC 3JXAA 3W1PA 1W5QA 2DPEA 1YDNA 2GJXA 1BXUA 1OFOA 3MBWA 1SXSA 3DU0A 3V5KB 4A6YA 3P61A 4D6JA 1D6EB 4ODTL 2HKHL 4K7VA 3I2CH 4X4KA 3BOXA 1R7OA 1KJ2B 2NMSA 4AXWA 4P4KB 5MI0C 2YD9A 3FA4A 3TN0A 1SUJA 4OJYA 1LO5A 1LEKB 2B1HH 1HYSD 1H3GA 1T0NA 5KYWA 1GJPA 4H7VA 1MEHA 3HC4L 5DRZA 3A5VA 2H6UA 4E9SA 1RP9A 4KX9A 1GOQA 3ISWA 2HRPL 3LSCA 1GC1L 5LAPA 2QDEA 4HUCA 3V95A 4FP1A 4JHUA 1ZLDA 3WE6A 4PSRA 3I50L 3QIWD 3FONB 1UA7A 3HB9A 4GZ7A 2YLHA 5DU7A 2B15A 2H26A 1BEXA 2WAGA 3QIUB 1E9PB 2R91A 4W85A 1CK0H 2WZTA 3PY2A 1NP0A 3EGXA 2QXWA 3HNTL 3L1FA 2NY0D 3SBFA 1IXQA 5FF7A 4ZPVB 5L6UA 4Q6IA 2ENSA 5IK3B 2Y24A 2HT2D 4BQCA 2CZDA 1X1NA 1ND0A 1Q7MA 3S36L 5K59E 2OZ4L 1ZXQA 2XWBB 4QXTB 1JPMA 4XNAA 4F2UA 4W9GC 2PTWA 1S1RA 4UTAA 3GJFH 3KWUA 1RALA 1FVEB 3P93A 4XNXH 2ZCHH 4YZFF 4QTFA 3B9KA 3MRJA 2EE0A 4PJFF 4KCTA 1WVZA 1D6EA 3PPHA 3H3KA 1RULL 2P28B 3T04D 2X1XR 3HE6C 1KJ2A 1JV5A 4JL2A 2ZOKA 4NUQA 1GYMA 1HILB 1LEKA 1KCLA 1R17A 5I8OH 3O6LH 3RJYA 5LGZA 2WIIB 3B2PA 1E28B 3PAVA 3V4UL 3A23A 4XXCC 3W28A 1KSRA 4EAYA 2HTKD 5DZVA 3NSCA 4NI3A 4P2OD 4CQDA 5LHEA 1XIEA 2GSJA 1N8ZB 3A4WA 3TESA 3NQ2A 4QTIH 4U1GB 4JN1H 5MP6H 3RWJA 3FONA 1DQUA 5FUCC 5HGHB 2BNQD 1E9PA 1NKOA 2V63A 2OQHA 3PZMA 1OOWA 2J75A 3VM5A 4ZPVA 2FHFA 5EF1A 3CQQA 1MAML 4V1DA 1PO9A 2Z0BA 2ATMA 2OEMA 4KVCH 4EVNB 2IPGA 1WBZB 4GKTA 4D8OA 3LB6D 3L9RB 2ZOUA 2OTWA 2XWBA 2CKBL 1OX5A 3I6EA 1MWOA 1EVTC 1URZA 2X1QA 1OXYA 4WV1C 3ROLB 3MODL 1FVEA 3ROOA 4BWWA 1F00I 4MS8C 5DS8A 3HFMH 4BQ8A 2X05A 2OT0A 1J1PH 4H8HA 2D9QB 4IU2A 2DEPA 1J87A 1BEYL 43C9B 5JOEA 5AOIA 4ORZC 3EYOB 3NQBA 3TYEA 1HILA 1MFBH 3SPVA 4OH2A 3BIAX 4PE8A 4HUMB 5CEYB 3KH3A 4A7VA 2WIIA 2F5BH 3F84A 4FA6A 3WXVH 5AC4A 4ZAKC 4Y19E 3C2OA 4EXQA 4PRPB 4ONHA 1ONRA 4QCIB 5D7SH 1N8ZA 3DZ1A 5C07B 3DHUA 5AYZA 1IC7H 1AR1B 3WO4C 4R97C 2XTLA 1DBAH 3QI9C 1EAJA 4XGZB 4JJOA 2VDKL 3GC5A 3F2LA 4N0YH 3JVFC 3O41B 2E4FA 3KAOA 1KBJA 2YB4A 5I0VA 4ZMGA 1QPXA 3SZ6A 1T40A 3GRWA 4TQIA 5JIHA 2BNUB 4EVNA 4ZXBB 4QP0A 1WBZA 1H7RA 2E7DA 1TPH1 4YEFA 5ISZE 4HHMA 4AC7C 3IDNB 1KIPB 4F2MB 3ROLA 4KRMB 5KJRL 3WNLA 5GZNC 5BRBA 5EC1B 1LE5B 4RGNB 4C4KT 4QHRA 5AVRB 3FT2B 3RGBA 1L9TA 4JZJB 3ZDZE 4S1FA 5J11B 2AEQL 4GYPA 2J62A 2YPVH 2WXPA 4WI6A 4XMWA 3IGUA 3CPLB 1SFDA 4QOKE 3H24A 1J2WA 4JX6A 3EYOA 4AISA 2E9JA 2C16A 3THDA 4H5SB 4MXQC 3HG1D 3AGWA 1L0YA 1E4KC 4XCYB 2WO4A 2PTUA 1LZOA 1FHUA 2YD1A 2JQZA 4KKNA 4PRPA 2VI0A 4JFXA 4QCIA 1A0QL 4WW2B 1A9EA 1ZANH 1P43A 1SJHA 5EFFA 3P1VA 3QJFB 4I9JA 2LVCA 5F6HI 3U0TB 4PSPA 1I8MA 1W72H 1TWDA 1XC4A 1MN4A 1KWKA 4LU5L 2F0CA 3AXKA 1F6AB 2HEJA 4XGZA 1AL7A 2OTUB 3F7LA 2COVD 3ARRA 3O41A 1J1OL 2PAJA 3D48R 2YGVA 2ZXBA 4ZFZB 5BUGA 3D47A 1XCFA 4P5TC 4HWEL 1VR6A 3TJPA 4J2PA 4WEMB 5DFWH 1AY1L 4GEIA 1BYNA 1BQ5A 3L5HA 5I73B 4M1BA 2AJZA 3IDNA 4CCDA 1KIPA 2YAPA 1GQJA 4F2MA 1JDDA 4C56B 4A8LA 1QTYT 4PYHA 3A3XA 1G1CA 1TV2A 3IPWA 3GH7A 4N3TA 2RDUA 3GHBL 5IMMB 5BMFL 4NCDA 3DMMD 4ETYA 5JW4Q 3SEPA 5J89A 2O61B 3LKOB 5JNYB 3K6DA 3C60D 3A0OA 4I3RH 4OE7A 1A3RH 3R11A 2PBOA 2NR6D 3CPLA 3OJGA 4KQNA 4R90H 1LO0L 5MENA 3RLVA 4OQ1A 2W95A 3BT2H 3D08A 2H7WA 4H5SA 2DUZA 3D9AH 4A29A 1D3GA 3DBPA 4R2GB 5AW5B 3DERA 1GK8A 4QQ3A 2D31A 4KI5F 3QRLA 4XCYA 3I65A 2XM2A 5IW6A 5EULV 4L2LA 4OBRA 4AZCB 3RBGA 1QX1A 3QZAA 5HMEA 2WXKA 2DSUA 4W9TA 5M7QA 5HUOA 5B7MA 3H2AA 3QJFA 2ZKYA 2ZE3A 3NGJA 4L2YA 3DBXA 3QUYB 2KHAA 1V08A 1AJ7L 5CC6A 4GRLC 1WDRA 1XIWC 1IC5L 1V55B 2B5IC 4G9DB 3KM1A 1XEDA 2OTUA 5B7EA 3LD8B 4L4TB 5PCYA 4UILH 4M3PA 1UD6A 3NA4A 2BOEX 2JALA 1VPOL 3WK1A 2Z1SA 4JRXE 1KB5L 4NC2B 4HKPA 3VZXA 3A4EA 3GXIA 2P80A 4NM4L 1IQWL 4U3SB 4YL9A 4D71A 1XT5A 4HZAA 4QRPE 4YFEA 4FFZL 4WKHA 3NZ8A 4LMQI 2GOUA 2DV0A 5IMMA 3UFYA 2X0SA 4BJLA 5MKGA 3Q2CA 2YRBA 4L4JA 1FH8A 3DOHA 3O2DL 3STBA 5LGHH 4W9EC 1Q72H 3V6ZB 5T1KB 5MHBA 2VO8A 4HK6A 1FH5L 4Y2DD 1VFAA 2CETA 2BNRA 3TBWB 3IJYB 2ATAA 3TJEL 3QYMA 1W3HA 5FUOL 5C7VA 2Y36H 1QA9A 1TYJA 1WGVA 3VJ6B 4M48H 3QJQB 5ICZB 4KZ0A 4AZCA 5D9SA 2XIOA 1BPVA 1N70A 5HQMA 4JHWL 2DPKA 2XKSA 4X7FC 3RL2B 3EOTH 3EBAA 4O50A 3GZKA 5E9XA 4LRIA 4RCAA 1CDGA 1AW2A 4ATWA 1WDPA 2NV2A 4IOTA 3KWXA 4OT1H 5EOTA 2ISVA 4YC2B 4G9DA 2F8IA 4QEEA 4P3CL 4Y5XC 4RZKA 4L4TA 2I9EA 3M9YA 4AG0A 3KPTA 3WXWH 4XISA 1MFVA 2D22A 4CNPA 2HN7A 2Y2WA 2NUYA 1XG3A 3W70A 3IWVA 1HIML 3JW7A 2FYVA 5E99L 2JJUA 4TMBA 3PNZA 1OFPA 4U3SA 4PCFA 5FCZA 5CP3A 3DPBA 5E1QA 4A2EA 1PYFA 5KANG 3PWVA 4DZIA 1L7TL 3TCLB 5E4OA 5TQLA 3DTUB 2BY3A 4W6YB 3KXFB 2FZNA 1QNRA 4XT1C 4X9BA 3W9ZA 2O6DA 3UGUA 3IJYA 4OTXH 3QJHA 1A5MC 4B15A 3IV8A 1LT8A 2CITA 1X4YA 5BU9A 4M5PA 2CE6A 5EU3A 3VJ6A 3MLSL 2IXUA 1FNGB 5ICZA 5F3HA 4GZJA 4ZW5A 1F4XH 5GJTH 3ZVIA 5GRWA 3K8KA 4PL1A 1T0OA 1SDYA 4O4YH 2V5RA 4FC3E 3H8NA 3RL2A 1KYOK 1HESA 2YCLB 1U83A 2PWEA 3DOPA 4TX8A 5E4EB 1Z3RA 5FCUL 4JFFE 2F58H 1QKZH 3DXAD 3QY6A 4NKMA 4I0PA 1MFDH 4PTDA 3HMWL 3HE6B 3IB4A 5LAXB 3QEUA 1UKSA 1CFMA 3NDZA 1UBSA 4FQJH 3K4AA 2YQBA 3IDYC 2RH0A 3QHZH 2ARWA 2RDWA 2YAHA 4YHPB 3CAKA 3VX1A 4TV6A 4X8XA 4HJJL 4I7UA 1NSNL 3IJHB 4AYDC 4WWNA 4FX7A 1VYPX 4PJ8B 4DKFL 4ZB5A 4M1CD 5EMUA 5I1AA 1FO0A 1KB9J 4XXDB 2ZZ2A 3LNPA 4NZ8A 3TCLA 1NDGB 4NUGL 3WIHL 4ADJA 4FRWA 2PPGA 2R56H 5C2BH 3KXFA 1YNTB 5HHNB 3KBJA 1ZTXL 5EOCJ 2VM9A 3T09A 3H8AA 5I03A 5HI5D 2NY2B 3HGRA 4NGHL 2EVJA 1YZZA 3V0TA 2X10A 3LHYA 1X5JA 4K71C 3ZK0A 1G7MB 3HB3B 3N73A 4Y9EA 4LVEA 1MRCL 2MQGA 4Z7WE 2NQJA 2YCLA 1OAJA 5EIQA 4L9ZA 3QSKB 3EGDB 2JCWA 2G0WA 1NFPA 4TULH 1FVDB 5JYMA 2B4GA 1S7TA 3WFAA 3ZO0A 3M0HA 3H12A 4ODVL 1PCWA 4XAKD 3HRZC 3ULUF 1KF9B 1DBML 3RVWD 2XINA 1DZBA 5KYXA 2QHRH 1MFCL 1XFPA 4YHPA 2C1IA 5D2NE 4LANA 4CD4A 3EB3A 4ZAKB 2V5TA 1EZUA 3BG5A 4DZ5A 4EJ1C 1EERB 2JVUA 4PJ8A 2YUWA 4U1MB 1WWCA 2VP8A 5H4YA 3KGTA 3UWWA 1F0LA 4XXDA 5E08L 3BEVB 1VCBC 1CGYA 2PGFA 5I8EA 4GH3A 3DIVA 5HHNA 4B16A 5SWSD 1AQDB 1HVQA 1FWCC 4W7VA 1XBRA 2FGBA 3LCFA 4IK7A 1LRNA 5JW4M 2C9XA 2GG1A 4HJTA 2BZ7A 3HC3L 5HTSA 1G7MA 4P46D 4MWFB 2ZVRA 1R6VA 1GQNA 3V0AC 3K2IA 3ATFA 1U4EA 3BZEB 1K6WA 4FP8H 1SUXA 1UD4A 2EECA 4IJTA 3CT7A 3SDCC 3H26A 4M00A 2X4PB 2EKSB 2V2CA 3E12A 3MRNA 5C2GA 3C61A 3OKLB 5K93A 1EP2A 2OMZB 4ELKB 1FVDA 4O1AA 2EIKB 3KYNB 1S7VA 4MCNA 3BE7A 2YL8A 4M5SA 4YHYB 1ZA6B 4CC0A 2VDIA 3O3DB 4MMZB 3V4PH 3MV11 1QO3B 5IOKA 4HIEA 3PL6D 3T0EB 1GOKA 4PA8A 1NIBA 4QRQA 4CN6A 1ACZA 1YNKH 3OVRA 3QCUL 1B4EA 3PF2A 1EP1A 4E8CA 4IBUA 1QSVA 2HK1A 1IFRA 2WZIA 1ZDQA 3FNKA 2XVNA 2PP3A 5HA7A 3TQVA 1FGNH 3U48A 4H4IA 2Q7AA 4U1MA 3Q2LA 1O5DT 3GXMA 4PUJA 1MDAA 1P0SE 3DX0A 2OYLA 4S23A 2MCG1 3BEVA 4HXBL 3TYDA 3GTIA 1X6NA 3GO2A 3BPWA 1AQDA 5JZ7C 1UQZA 1FYTD 4A6GA 4YIQB 2W5FA 4OIAA 5FWQA 1KN2L 2BLFA 2OK0L 3UTSD 35C8H 3FTSA 2DQCH 3BL3A 4WFGD 1Y1DA 1BQLL 1SN2A 4P5TB 4YSOA 4F0SA 1DWGM 1BZ7B 4ODBD 1DBKL 2BW5A 4QDGA 4DQOH 1NUFA 4XZ4A 5I9QB 2FYYB 4RFOH 4O1BA 1X5HA 4A3UA 3A9IA 3BZEA 2VLJB 1JZ7A 5I0XA 3MRDA 4K5NA 2WO2B 2X4PA 4XP5L 3WNPA 43CAB 4I7VA 1BXAA 3OKLA 4ELKA 5B1JC 4L65A 1RQHA 3AMDA 3KYNA 3LEVH 2F6KA 4FL4C 4XD6A 4BQBA 2V2DA 3TWYA 3ZM8A 1ZA6A 5EU5A 2OB3A 3O3DA 4MMZA 1IL1B 3HAEB 1F11A 5D30A 3T0EA 3IIVA 5DLMH 1I85C 4Q4RA 2CO7A 3CIAA 2YW3A 2GC4C 2REQB 2XJKA 5I1LB 3T6WA 3ILPB 3D3FA 2WSKA 1LO3L 5DMYA 2VSMB 4P2QD 4NAFB 2O56A 4UNVA 4LF1A 3W2NA 4K7PY 4L1GA 1TTPA 5HWNA 3TF7C 1O5KA 4JRYB 4BZ2L 1VFOA 5IFJB 1M68A 3CGTA 1R3SA 2X4RA 3M44A 1KFJA 1M3IA 2YPLA 4LLVA 1KJ3L 5EZOL 2DQFB 4FFVC 2H90A 3AGVA 1NWOA 3MLRH 5JBEA 4RL3A 1IM9D 3AT0A 4XAGA 4UTFA 1UT1A 2EAWA 1VIWA 4QRBA 3TXAA 2OZ3A 4GSUA 3D05A 4XO7A 1EZSA 1JCNA 3ATAA 4HJGB 1CZ1A 4URKA 1BBDL 5FYJH 1UH4A 3HPXA 3F6LA 5SX5K 3W7IA 4LQFL 3B8SA 4GVGA 2J73A 4OU3A 1U3HC 1O94A 2VLJA 2ESVD 2HVKB 5ECVA 1HF6A 4Y1SA 2X1UA 4QGYA 1DQML 5F7WC 4JLRB 2RGLA 2DZPA 2EYSB 3NQMA 4E9TA 3T6ZA 2ITFA 5ACZB 4GCAA 1U2YA 3CMOH 2JQXA 1RVFL 2LABA 2CXKA 3IVUA 5FJUA 2CGRL 4KUCD 2RAMA 3DHMA 3SPIA 1R0AH 4P23B 5AVWB 2HKFL 1PWLA 4FXTA 1B9KA 5ABEA 2ZCZA 1RZKL 4BSVA 2AJVL 3WLLA 3V4LA 4H4NA 3P2DA 3ILPA 3GM0A 1VJIA 4YHKH 1S5HB 1YY8B 1E0WA 1DFBL 4XC3H 4YIWA 4NAFA 3STEA 1HJBC 2J6EH 2VC5A 3R06B 2P3ZA 2FFCA 3OSKA 3QW3A 1A1MB 4JRYA 4NQDB 2OT1A 1GXEA 2HUHA 1WZ1H 3VWJB 5IFJA 4W86A 4I77L 3HM7A 3D18A 4H6KA 2QHAA 2ZSVB 2D3LA 2YKKA 3Q3GA 1LK2B 2J21A 3ES7A 2DQFA 1B3WA 2ZUNA 1AQ8A 1FTXA 4AVIA 4L9XA 2EE9A 3EBHA 1FSKB 4NKIH 1FWWA 1U6AH 2YRPA 2AXHA 2VDNB 1AXIB 3HZYB 3NQAA 2DSWA 4CD8A 2G9HB 3FFDB 5CEZH 4JIEA 1N7MH 5KVDL 4JGDA 1W5NA 3H4XA 2K8MA 2YPKB 4TVPL 3QQWA 2PF6A 3OKKB 2QPXA 3FPXA 3RZWA 2VTFA 4P8VA 1E9ZB 2Q2EB 1MCOL 4JLRA 5JO5B 2PETA 3ABLB 5DRWB 4GKLA 4OZ4A 3IXAB 3ULVE 3RTQA 1V77A 1ZCCA 3WTWA 1BZQK 1P7TA 3OTRA 1Z3GL 4TUUA 1MNNA 3JWDC 3Q05A 1PV8A 4TMPA 1GEHA 3S0CA 3SY1A 4P23A 4JPGA 1GOMA 4LESA 1RURH 3WLWC 4N68A 3AM8A 1I8KB 1A5AA 5EZIH 2UXGA 4HD9A 4HGXA 4A68A 4IG2B 1S5HA 1QFOA 4GKZB 5CGBA 4WEEA 3HLAB 3R06A 1HJVA 3CPGA 1SVBA 1R46A 1A1MA 4US6A 4NQDA 1KFWA 1I7ZB 3VWJA 2DKUA 3K2KA 4PGJA 3F5LA 1DQIA 4NPYB 5C8JB 3ZYZA 4ELDA 2ZPKH 2ZSVA 3TN0C 4KAQL 1U1UA 4PEEA 1QRND 1UTDA 4Y89A 2E28A 3E96A 1NBCA 1CLKA 3KBPA 1SGJA 4F93B 3ZDYE 2WTPA 3VQ2C 4GA8A 5BXSA 2BSLA 2PZ0A 3HG1E 4HUXB 4X9YA 4OLUH 1INEL 2PP1A 3HZYA 1UCBL 3OBKA 3IDYB 1UM5L 1J8HB 3OIHA 2G9HA 2PPFA 3OBAA 1YYML 3BQUD 2IFFL 1OAQH 3IE9A 4PJXE 2YPKA 4PTUB 5D5ME 1YKWA 3AACA 2JKXA 4PCPA 4ZFFB 3NEOA 2FWSA 3TUUA 4MGXA 5JO5A 3ZJAA 1QRKA 2W07B 2A21A 3ANVA 3TH6A 2PDCA 1XYMA 4Q6IC 3GHSA 4TUKH 1CF1A 2A6DA 1XR9B 5FHBL 1NOWA 5FGSA 4I9AA 1J48A 2WHMA 1F5ZA 4B92A 1GYCA 2J77A 1ZTMA 5DVNA 2DQJL 2NNXA 4KZDL 3PB0A 3QULA 3UABA 1I8KA 4K71B 3AFBA 4PJDB 1A5BA 1DVFB 2OWWA 2MEJB 4N90E 3BK0A 3WEZA 1QZ1A 1MW0A 5EC2A 3B9KC 4GKZA 2FBOJ 4TX6A 4HK5A 2KH2B 5TDPB 2CJUL 1VENA 4JR5A 5KBNC 3HMXH 1I7ZA 4N85A 5I3KA 2Y8KA 4NPYA 5C8JA 1XF1A 1I60A 3LZ5A 5I1HL 1U1HA 1IEHA 2FSDA 1QR1A 2EC9U 3EUDA 4YBHA 2PLTA 3HRZB 2XH7A 1CZ8L 5I82A 3EA1A 1UZ6E 1OGBA 4TQPA 3M4HA 3FJTA 3G2GA 3RWFB 4LNCA 3QNZA 1ZPLA 3S8GB 2XGIA 2QFPA 1L3WA 4CSTA 3FN0L 2Y06L 3GSXB 5DCEA 1BQCA 4C6NA 4N6QA 1M3UA 4YXGA 3W7MA 4ZFFA 3W39B 4UZGA 4WQ6A 4OOZA 1R5VA 15C8L 4D7BA 3W2DL 3WD1A 2CU9A 2VLRD 3G0XA 3B6SB 5KSVB 2XTJD 3I7RA 4IRZA 4WJ8A 4H0LC 1YYCA 4K6AA 4OM1H 2EF9A 4AIUA 1Q9KB 3VFVB 4FMKA 4UM9A 5EUKA 1QP1A 2H8PB 4PJDA 1DVFA 3QP3A 3FDGA 1Z1WA 4F1ZA 3YPIA 4U3CA 1GYAA 4ANKA 4H25B 5C6PB 4XKMA 1W8EA 2WXIA 4OCXH 1R85A 2EDMA 3KPSB 3VFPB 1UP2A 3KWTA 3O11A 2XUCA 3TFBA 3FJLA 2XWRA 4KMTH 3BP6B 4N4QA 1A3QA 4GXPA 3GIZH 4W70A 5IFAL 4PJIB 4KVPA 2F84A 1LDPL 2HH0H 3JTSB 4N9BA 2Y7FA 3PIQB 1UP3A 5K39B 1X9UA 4OT7A 3RWFA 4J40A 1WFTA 2D3NA 2WQSA 5ANMB 3II2A 1JK8B 1PZUB 5J5RA 1ACXA 3RWCA 2CM5A 3DIFA 2WZMA 2EDOA 2VR9A 3GSXA 1G43A 4U1GC 4ZOCA 1C93A 3EBGA 3S9IA 2C3XA 3DC0A 5HHME 3GQFA 4DZ8A 3B5TA 5E9NA 3W39A 4YPGB 3BJ91 3MUGB 4EPDC 3THCA 3HTWA 2WSPA 3BG3A 3ZHKA 2VWEE 4MJ4A 3CVDA 4DN3L 4HISA 4LV9A 5HPOA 3B6SA 3EFDH 3A5FA 1OLLA 1K7FA 1QNQA 2O9OA 1J5SA 2Y5TB 1H61A 4H2CA 3PNUA 5DMLA 5TH2B 4N0RA 1Q9KA 3VFVA 3N14A 3S8WA 4XVJL 4DUXA 2NY4B 3QJTB 1B4RA 1UKPA 2H8PA 2UV8G 3QPZA 3MJWA 5DD1H 1JYVA 3NL6A 3DVFA 1B6DA 3KEDA 2DSZA 4H9UA 2ORBH 1CBVH 4H25A 3R8BB 3VFPA 3CFTA 2W5PA 4GYPC 3D2TA 1W9XA 3H1ZA 4D3CH 2GIYA 5IHUH 3BD3A 2O6FA 2J7EA 4Q6XA 3PBGA 3WHE0 1HNGA 3FU9A 2F54B 3RGVB 1AS6A 2X9YA 3JTSA 4LEOA 3ZUNC 1F4HA 5ES4B 3TT1L 4CW1B 4GXWA 2PDYA 5GNYA 1X8FA 5DUBB 3RM9A 4KZCA 3PIQA 3AROA 5K39A 1HL4A 3D2UB 4BXSV 2Z92A 4XBEH 2XGZA 1S38A 1MI5A 4Y96A 1ID2A 1XIDA 4N26A 1RD6A 2BFGA 5A8MA 4QGCA 2JKNA 3MRFA 1VERA 5GRYA 4YHIB 1ICSA 5EPDA 4O28A 3QUGA 3GAKA 5E6SB 2FVNA 2WGXA 5GGTA 4UM8B 5AHLA 2P52A 1ZHBB 2J78A 4GFXA 2ZRVA 3LM7A 3MUGA 5CC7A 1OYBA 4IWWA 2Q8ZA 3H2OA 3P73B 4A4AA 4LAZA 1C1EL 1XMWA 4QJ5B 3CC5B 4LS0A 4ZS6D 2HT4C 2PC4A 4HUVB 4W9ZA 4LTSA 1KIRA 4O2EB 2OODA 1ZAHA 2XWCA 2ALWA 1UACL 2AJ3B 3NZSA 2LU4A 5FGCE 3R0KA 2PLCA 3HIJA 4RGNC 1UWFA 1WITA 5D7JA 3H9SE 4Q6YA 2V5YA 4NOFA 4F37K 1NC2D 3U4FA 4DGWC 1N8FA 3RDJA 5J11C 1S3RA 1UWXK 2JJTA 2O26U 4PWEA 1T7ZA 4K5MA 3RFRA 1F7BA 4KKPA 3PSWA 1ZMYA 3W4RA 1D3HA 2F54A 3RGVA 3PGCA 1H0IA 2DQUH 3TW7A 4PRTA 1EZVX 5IOBA 3MMWA 1R3KB 4MAUH 3LS4L 4EQ3A 3VXRD 5JHDD 3D2UA 1TR9A 1CE6B 1VEPA 3WS3B 5KSUA 5EU4B 4YHIA 1OD8A 4QEGA 3GYCA 1QO5A 2PN5A 1YUHB 4ZUUA 1ZHBA 3QPQD 2QJHA 3W2KA 1JNHB 5IHRA 1NAMH 3ITTA 2C34A 2E0PA 3SKJH 4Z2LA 3FAWA 5KZDA 3CUZA 2R1XA 1RUKL 2CLOA 3SCMA 4AUUA 1NKGA 4L5FL 4D0DA 1W5OA 4KK6D 1F42A 1AQHA 2Y2YA 4IW4C 2DZWA 3TBTB 3S97C 3KPRD 1EX1A 2Q8AH 3JBG7 4OJFL 3RJOA 3CV7A 3P60A 5JIWA 1KGXA 2JF6A 2YGYA 1LO2H 5IVNA 2X87A 4UMAA 4BFAA 2Z65C 2RTTA 1DLHB 4UT6H 5T26A 1KBVA 2NXZC 3QHFH 1X5FA 1WCBB 4N2OA 2HXUA 1CDIA 2BVPB 4LKCB 3SY6A 3LN3A 25C8H 3OAUH 1YN6A 5HI4C 5AB9A 4F2TA 2WQRA 1L9RA 1B4JL 1T96A 3MV9D 1K4HA 5A8NA 1QQDA 5E51A 1JV2A 1UYWH 1Y6NR 5CLTA 1R3KA 1QWNA 5CCKL 3QV6A 2Q7NA 4JTRA 3DFOA 3PZ9A 5E94B 5D2LB 3EJYC 2CKRA 4TYUA 3TV3H 1CE6A 3WS3A 1KM5A 2D2GA 5B8CA 4EI6B 1YE4A 3BGFC 3AHZA 4YDJB 5EU4A 5FO7B 4G80A 4LRIC 1VA9A 3ILQD 3NESA 1B1YA 2AP2A 3MBWB 5FYLH 4PWIA 2AJXH 2VNCA 3FUJA 1D5IL 4A6YB 3LD8C 2CZVA 2IXVA 4HSHA 2DBLH 3B0UX 4PW9A 3KRZA 3BZJA 3TJIA 4AXWB 3K0WA 1RQBA 2KQNA 2GVGA 4HJEA 3B0YA 3B03A 2UZPA 4NNPL 5KYWB 4QXUL 3TBTA 2Q9OA 4ORMA 1CFVH 1WDDA 1KT2B 4Z7UF 2IBZY 1TZ7A 2HVJB 3ZE1E 4GAGL 1DLHA 3EH5B 1W6WA 4RW5A 2ACSA 3SDDA 1HINH 5CJXA 2BVPA 4LKCA 1CECA 3DJRA 3QG6A 4FQLL 4AQLA 3HZKB 2J4WL 4L3CB 2YXWA 5DD0H 5ALCL 1UZHA 4FJZA 3I7SA 3TU9A 4AIXA 4RA0C 3BYTA 1KJMA 1JZGA 5D70H 3DX9A 5D2LA 4XG1A 2A9ML 4BIKA 4DELA 2Q20A 4HNCA 4KHTH 3AVEA 1RBOB 3R89A 4EI6A 5E2VH 2ZX8A 4N8UA 4IIHA 4YDJA 1XYLA 4IGMA 3MLYL 3U4BL 2H3NB 4ML4A 4HCIA 5E9DD 3EWCA 2FEEL 3MRJB 3FCBA 4PUBL 2HT3D 4MD5B 2JKEA 4YC2C 4H8QA 5E8EA 5AYXA 4PMUA 3G3DA 4PVMA 3D5HA 7FABH 5LXGH 4AT6A 4I0PC 3W2JA 1F45A 1TIUA 3KVPA 1JV5B 3AHXA 2ZOKB 4NS0A 1BXNA 2IWGA 1RPUA 4LSRH 1TFPA 1XB8A 1RIVH 1PF3A 5CBBA 1M7IA 1GL4B 4UOJA 1KT2A 5T1LD 2HVJA 3FQ2A 1KZYA 3AJXA 1DANU 1QLRB 5F0JB 1A6AA 4PYGA 2APVA 4XAZA 2K6WA 1YCSA 3A67H 4D1JA 1AZVA 1WEJL 5AOZA 3GNOA 4Z7UA 4GUQA 3RWJB 2ZQKA 4HYTB 5AKTA 2O7QA 4DJFA 5JW3L 4B91A 1ROWA 1E5CA 3HZKA 2X0UA 4L3CA 2Y61A 2MPAH 4M62H 3UTOA 3H9YA 2HVMA 4V1DB 4AMXA 4XPTL 5D09A 1ZIAA 4WR3A 4RNFA 3Q4DA 2D7QA 5D72H 3LY6A 1JYNA 2OTWB 4JFVA 4YLQT 1Z48A 4MHHI 3GSQA 5TIMA 3ROOB 3JZ7A 3LPFA 2H3NA 2PCFB 3MGAA 3IGSA 4AEHH 5DS8B 4XX5A 1PL9A 4AITA 4XUGA 4M9OA 3TX4A 1R87A 2ESVE 4MD5A 5E4EC 3G6DH 1YEFL 1MDRA 3WF2A 4E9LA 4IU2B 3TLRA 4K3GA 4A8RA 5FA3B 1AO7A 4PJFB 1UR2A 3N34A 2ZVIA 1AIFA 3SPVB 2X3AA 1WAWA 5CC3A 2DH2A 4PMOA 1BQKA 3RX5A 3ZOAA 2YLLA 2DORA 4LOCA 2XFFA 4ONHB 4TO8A 1SZRA 1QLRA 4AB4A 4PJ8C 2ZAIA 4RRPM 3U7VA 5HHOD 1Q9OB 2J12B 3RLSA 5IHSA 4FG2A 1I1CA 3ZN6A 2QUVA 3C0QA 5CJBA 4H00A 2FEDC 2PLJA 1M2VA 2MKWA 4FQCH 2XZQL 1X4ZA 1EGVA 1WCQA 4ZMQA 1I53A 3I9GL 2NY2C 3VGEA 4GAYA 5AENA 4RSVA 3BV4A 4U7KA 3LCYA 3W01A 4QS5A 4AM0Q 3TA9A 4FR6A 1IEXA 4O5LL 3HB3C 4GW5B 4PJHF 3MQIA 4KROD 5B39A 5D71H 4JFEA 3UY8A 4X8GA 2PCFA 2VX4A 4PWFA 4PJHB 3LPPA 5E8DH 1A6VL 1Z69A 2RGSA 5MEPB 1IAIH 4O51B 3L5LA 1D5XB 5F4XA 2VN6A 2Z9TA 4RXGA 5FA3A 5LG1A 1LM8V 4PJFA 5C0BD 4IRJD 3MRHA 4I0KA 1NBVH 1M71B 4EOUA 4US5D 4GUGA 3ULUC 2V17H 4RRPA 2OJZL 4B5XA 5DHDA 4XKYA 4ONGL 3D30A 4FSAA 1I2RA 4JFXB 4C59B 5H4ZA 1A9EB 3VOFA 5DELA 2P8MA 1G5AA 1SJHB 1Q8MA 4KX8A 4IPJA 5I1EL 1I8MB 3G6AA 3TVMD 1Q9OA 2AK4D 4C1KA 4WO4A 3TFCA 3ANYA 1TELA 3PWGA 4FALA 4JFHD 3PAZA 3ZPDA 1BKHA 3A4XA 1NQKA 1EJVC 2BRQA 1SJAA 4E36A 1YC8A 2VZSA 4WCYL 3LHPH 3RDTB 1A64A 3GBLA 4ZOEA 2JIWA 1QVOA 1J9TA 4TQEL 2WUBH 3MRMB 4GW5A 4E4UA 3U9WA 1SJCA 2AJZB 2E4TA 2EDHA 1KV7A 2JIEA 1QFUH 2L7EA 4UNLA 3V7AE 1J0HA 2YZ8A 3C5JB 4HJ1A 3MOAH 4PJHA 5JHMA 2HLAB 4XOCA 4N3UA 5SWZD 1ZJHA 4WTXA 1A6UH 5C9XA 4MGGA 4QFUA 2P7TB 4JUSA 4KQ3L 5MEPA 4O51A 3U7YH 3BH4A 4YHYC 1D5XA 3MUCA 4N22A 5MENB 4MMZC 1AC6A 4PLOB 2CWXA 5GS2H 1M71A 3T0EC 4EXBA 2D31B 4IQLA 2FQIA 3KCLA 4NX0A 3O6YX 5IW6B 3RR1A 2IVFC 3TROA 3NGBB 1K77A 2OLSA 5F8QC 5BUAA 4OD3L 4P04A 4UIOA 3MUXA 1DJIA 4APQA 3AYRA 1VS1A 3NA9L 3DBXB 1I9RH 1IT8A 1J0JA 4MX7B 3ARYA 4Q9BA 2ZFAA 5C9RA 3WD5H 1CBJA 4MVBD 4HCRL 5DWPA 5CGYC 4WEBH 2X4TB 4QR6A 1XL9A 4NZ3A 4WHTA 2BIQA 3VABA 1BVKA 1MW1A 2GTZA 4X9FA 4EEEA 1OGAA 3RDTA 4WSGA 3JR2A 5G1YA 5DY2A 1TVBA 1W8SA 4JG9A 4ZBJA 4D94A 4P59H 3MRMA 5I9QC 4XMPH 2JH2A 1V79A 1YYAA 1I0BA 2WVSA 2BPBA 1H5BB 2V67A 4RLIA 5DGRA 3BLEA 4G9FD 4FHBD 3NZ8B 3C5JA 2NXZB 3FQTB 1THAA 4Y9CA 5F6IB 1GONA 4G1EB 4NQCE 1DJHA 2WXDM 2HLAA 5MKGB 1DL7L 3CUJA 3GU1A 3QN3A 1IKFH 3JYBA 2P7TA 2D03L 2QFRA 3LBOA 3QR0A 3IGKA 1VFAB 3OF6A 2BNRB 4IGSA 3FCUB 3WIIH 2CD0A 4V2XA 2PGWA 1LHZA 1R2SA 2IANB 2F5AL 3WCZA 5IT2L 1QA9B 3FB6B 1S2WA 5D1ZB 1KDJA 5D9SB 5HJLA 3EEZA 2WZ5A 4L8BA 2ZZ5A 4HZ8A 3KXQA 3PPFA 3TEXA 3BGFB 3L1OH 5AVUB 2QMJA 3TSMA 1KTDB 1Y6MR 4MX7A 1L3NA 4WNJA 5IESL 2VLLA 5EOTB 3RNDA 2WUCH 1XBZA 1FKWA 1XLIA 4KUZH 2X4TA 4G7VH 1E9LA 1A7PL 4J4PA 3VFGH 4DKTA 2KAUC 4E2VA 3IJ7A 3GVGA 2VX5A 4W9IC 5BZAA 3UPAA 2HN7B 3W9DA 3FUEA 4MZ2A 1GVFA 1U4FA 4TTDD 3COOA 2D24A 1AR2A 4TXVB 4JDYA 1SW3A 4HKJA 4QRFA 3U6XS 1PMYA 3DPBB 1QBMH 1H5BA 4ANVA 5I02A 4PJGF 7PTDA 3CIQA 4MHBA 3PWVB 3K5SA 4M7SA 3FQTA 1T1WB 4MAZA 4G1EA 1HHIB 4PJGB 3RTQC 4UMCA 4XPHL 3UAJA 4AMKL 1TWZA 4GXVL 4XX6A 3QDGD 5GRVK 4QS6A 4Y9MA 4RVBA 3BAXA 4F8TA 3H21A 1LEIA 2ZUTA 5D1XB 1Q38A 4P23C 2GWGA 3QJHB 1JRCA 4XZBA 4IKIA 1LL7A 1CB7B 1O5PA 1P5VA 2IANA 1OOAA 4QROA 4NJAH 3AM8C 5I28A 2M26A 1RUQL 5EU3B 2IG2L 3FB6A 3MMUA 5D1ZA 1A4AA 3HI6L 5F3HB 5KZCB 4ONVA 1D7BA 2LLEA 3VFOA 3V4BA 3EYSH 5F44A 2ZXGA 2YO3A 3PJNA 3H7LA 2L3BA 1UFGA 2R29L 4DEWA 3NIFF 4QWWD 3DV4B 4Z77A 1AANA 1KTDA 3JZEA 1B9BA 3VWJC 4OLYL 3EJZD 4L4MA 1Z2KA 2A4EA 3SKOB 5A3HA 1BHGA 3S3CB 3DBNA 4EPBC 3RILA 4O02B 3M64A 4NKMB 3BIKA 4I0PB 1MCPH 3ZDXE 5JMRA 1FSKC 2Q8BL 4MZ1A 3QEUB 2GWNA 2OTPA 3M86A 4M5TA 1P69B 3W7GA 3RUGF 4LRNL 1B88A 2A73A 4FQQB 4PUNA 1QUNA 1GUVA 4NKCA 2CU0A 1SMOA 2LAGB 3VXSD 3PP7A 1ZUAX 4G2AA 5BS0A 1J8RA 1T1WA 2HVBA 1DXFA 3TTOA 5I1AB 1FO0B 1HHIA 5LXVA 2XY2A 4PJGA 3BOFA 4UB0L 3OZPA 1W1B1 4NZUH 4WI4A 2PCQA 2YRZA 4ERAA 7REQA 5DYOB 5KITA 1DP0A 2FX7L 1XR2A 4TV5A 2X41A 4XVTH 2F53D 5D1XA 1V6UA 4LIQL 2ZCKH 4E2OA 3MMTA 4KMLB 4ELME 4OD1L 4PLJC 3UVIA 1XI3A 3TTEA 1CLOH 4F9LA 4XI5D 1T7XA 3M6DA 4WJKB 3F64A 3CFBB 3O2WL 3ZE2F 3PQYD 1E1EA 1AXSB 2NYYC 5BOFA 3LNMA 4MNQD 4WKZB 1QSFE 4Q8BA 5B39G 3DV4A 2I85A 3CMGA 1KUMA 1YG9A 2X2UA 2O5NA 1SDDB 1W3KA 3NPXA 3SKOA 4Z7OE 1S7TB 4HAGA 2J8FA 4ZTXA 2VCAA 4N6EA 3KCWA 4O02A 4OFQA 4AX6A 4FZIA 3L8QA 5TK2A 5MHSE 2DIJA 4KY1H 1XIIA 4KV5F 5KYXB 2GGGA 5FM4A 2NZLA 2X2GA 4FQQA 2VGLM 4RRPG 2PP9A 5I6NA 3RUGA 2FRGP 2IW0A 2Z24A 4U0RC 1OYAA 3FFCB 2ZP8A 1DQWA 1XX1A 1VIZA 3TLQA 2VXVL 5I3FA 1SOQA 4B7IA 5A6MA 1JNEA 3V4VL 5FWRA 2WVTA 4JTTA 3AT8A 3FCTB 5I8EB 4RMWA 2WLKA 1GOGA 3AQZA 3CLEH 2OPCA 5DYOA 2OS7A 1URLA 2OMWB 1EGJA 1Q4WA 4XCNB 4XE5B 3WN6A 1N5AA 3QISA 1FC2D 1DVFC 3F6JA 3LQAL 1E4NA 1AI1L 3MA9L 3CFBA 5L4MA 4J2MA 3F83A 1QNVA 3VG0L 1AXSA 5HDQL 2D0GA 3W56A 2GB2A 4WKZA 3J07A 1Z89A 1UROA 1JPGB 4BHYA 1D3CA 4A66A 2EH7L 4S1SH 3MRNB 4GB9A 1SDDA 4ZX4A 1S7VB 3T4YA 1YQVH 3MVSA 3ZKMC 1BPLB 5LIKX 1Z9AA 2FJFB 3C2SA 3MJ7B 2HFEB 5FM8A 4HIEB 4OGAC 2BRRL 4Y4KD 4QRQB 4UU9A 1BCIA 3HGJA 5SX4H 1TZ8A 4BFJA 1J93A 3FPYA 1WO2A 5IBUG 5FJJA 4PJCF 2ODHA 4NZRL 5DBUA 4GLRI 5JIKA 3FFCA 4XWUA 5IXEA 1RLBA 3L65A 3L2MA 1E6PA 2GQ8A 4BFOA 2PF0A 4C6EA 3FCTA 4DKEH 3BD4A 1Q8AA 2O4MA 4AIZB 4WLCA 4PP1C 4CC1A 4Z3IA 1MRAA 1BIIA 2K6ZA 3BKCL 4OSUL 1R9YA 1UUMA 5DVKA 2X28A 4YK4C 3INOA 3T40A 3SO7A 2OMWA 4OLXH 4XCNA 5FLVA 4DWSD 5G4NA 2VR3A 3A4DA 2VMCA 4XCFL 4UV7H 2HLFD 4ORIA 4TSAL 3TWCH 2D0FA 4X50A 2DQGH 5C3LD 2P76A 1J7VR 1UC4A 1U8HB 1AZ1A 3VQMA 1FXQA 3P40A 1NCWL 3MRDB 2G4EA 1JPGA 4LB8A 1BKSA 3MLZL 1HCYA 5F0MB 1TYEB 3STPA 1K1DA 4ROPA 3LNDA 1IARB 5EU5B 2FJFA 4ZW3A 1UG6A 4DN4H 2E7HA 3MJ7A 1AQKL 1OLZA 2HFEA 1F11B 2QF8A 5CSZB 5D2YA 4PRAB 4JN6A 1C8VA 2CO7B 4DQAA 3VGGA 3SDXF 4PZVA 4LSVH 2I07A 3HV9A 2OGYA 1S5MA 4DETA 1SM3H 1SUHA 2PU1A 2MOQA 3NXLA 3O05A 1FBIL 3SDXB 1OARL 1EV2E 4GQ9L 4XV0A 1BF2A 2NOYA 2IPJA 1XXFC 1R5WB 4PJ9D 5A6BA 4PJCA 1M4KA 4YUEL 3CVBA 5M5DA 2X4RB 3E49A 1N55A 2BIIA 2YPLB 4LLVB 4AIZA 3MPGA 1R86A 1TV7A 3LENA 3QY8A 4AMAA 4JNYA 4UYPA 2HUEA 2AJYH 3RKPA 5HPCA 1Q6FA 3BDKA 2NY4C 2AAMA 4L3FA 3UPRB 4HWBH 3X3FH 3OZ9L 3NABL 4YJZL 1A5KC 5D7JC 2R0LL 5FESA 3FGCB 3SN6N 1F2QA 1U8HA 3OYXA 2JJTC 3C5SA 4CN1A 1AMYA 3IM1A 1H6UA 3F85A 4XIMA 1TOXA 4FYQA 4WFHD 5KBLA 3H2MA 3L54A 3RGVC 2BBFA 5I18H 2E6QA 1A6WH 3AAMA 4BEUA 3WYZA 2PDWA 3V5HB 4UQ3A 4AY8A 3IU4H 1KTNA 4DESA 1KFAL 4ZO7A 2AZAA 4OCNC 5CSZA 3HGOA 4PRAA 3UETA 3H2NA 2OL3H 5CAKA 1T89A 4BSVB 3U2IA 1M7OA 2AJSL 4EE2A 2YXXA 4NXSA 1DIOA 1MDLA 3LPOA 1FH2A 5D1QA 1E0TA 3SDXA 2EINB 3NFSH 1AK5A 3V79C 4FFTA 4QRRB 3FUNA 3GMLB 1R5WA 4Z1DA 3O9WD 3QCTL 2K9UA 5IW1B 1EQPA 4J3XA 1V0KA 2V5LA 1H5VA 4P8QA 3AWGA 1HWGB 3PR2A 3D18B 1KD0A 3CV2A 3Q3GB 3IFLH 3SCMC 4MCMA 3I6SA 3H85A 4J5VA 4AVNA 2X9ZA 4FQIL 4A2FA 2ZKHH 1I75A 2J6WA 2VRAA 3W11D 3L4CA 2N3JA 3UPRA 2C8NA 4YXLH 1TJIH 5TBOA 5I8KL 4R7WA 3RZCD 1CG9B 4M5YH 3OWEA 3FGCA 3K13A 1AGFA 4H8WL 1AXTL 2XZ9A 4CVXA 4E0CA 3QORD 5SWQB 1TU2A 1O68A 2N1KA 5AWNL 3FUKA 5JHLL 5DF0A 2E7LA 2BNQE 4OZ4B 2EILB 3RTQB 2VOMA 2HLEB 4KZEL 1XLMA 2F6AA 5C09D 4JTGA 4XO5A 3UTTB 1P7TB 3V5HA 1LWJA 3PS7A 3GTVA 1OSEA 2G95A 3IDXL 2DGAA 4GKSB 4G8FB 1TJ2A 1QOXA 1VGKA 3GJFA 5B8CC 1E9IA 2NVDA 4NC1E 5EMLA 2NUTB 4OCRL 3SRHA 1YHTA 3NZPA 3W6LA 4QRRA 3GMLA 1B0IA 3OJ2C 5JHBA 5IW1A 3OG6B 4AZIA 1E8YA 2EACA 3B0VC 5CSSA 4ZOAA 3NEXA 1RZ8B 4K2UL 4R26H 4KDVA 1XWYA 4OD2B 2CLLA 3FEQA 3GTXA 4XAPA 1YQ2A 1HH9B 1A4LA 1S78D 4N5ED 4LSBA 3GXFA 5C55A 2PB1A 3IRSA 3BZDA 3CIVA 2ZKXA 1DQQA 2V3EA 3SDDC 1CG9A 2ADAA 5CJXC 2FTWA 5LBSA 5A16A 2HG5B 3SJVD 1JPDX 4QIRA 4P05A 3TN6A 1MNUL 5DJ8B 5SWQA 3U0WL 2NX5B 3UPMA 2DMHA 4H19A 2AMUA 2GVJA 1VD6A 4NN6B 4XTRC 1G9MH 1CXHA 1PX3A 3CUXA 2GABA 3DI2B 4GI8A 3TPUB 3BCDA 3UTTA 2VDPH 2A6DB 5TF1H 1J0KA 3LH2H 2ALDA 4GKSA 4NZ5A 4G8FA 1KPUA 2K7PA 4Q4EA 3W7CA 1IJ9A 2R82A