3H53A

Crystal structure of human alpha-n-acetylgalactosaminidase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
387
Chain Sequence
b'LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
molecule tags Hydrolase
source organism Homo sapiens
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
total genus 129
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h53A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h53A01
3DAQA 2DZUA 3AXHA 3LCIA 4RZ4A 3W9ZA 1QPOA 3QRHA 1NF0A 1UUOA 5EKYA 1AMKA 3KRSA 2PE4A 3DGRA 5KMYA 3W88A 2PC4A 2QJGA 4JN6A 4GWEA 4RJEA 2ZTJA 3EXRA 3OLGA 1I8JA 4PH6A 1SW3A 1I2NA 5CSSA 3FJLA 4HOZA 2V9DA 1QDSA 3P7YA 2UV8G 4UMAA 3INPA 1TPDA 2F18A 3WNKA 2ZWYA 4DF1A 1LOLA 3VM7A 4C1LA 4ATWA 1A5SA 1KGXA 2YA2A 2EF9A 1PAMA 2ZZ7A 1H51A 1BWKA 4HNNA 5AYZA 3PM6A 1VYSX 2BY1A 4LWWA 2XWDA 1ICPA 3HGSA 2FIQA 4XBKA 3W75A 2PWGA 1OYBA 2GVLA 1W0MA 3JS3A 3P74A 1TRIA 2WJZA 3BO9A 4CKQA 1PCWA 2YPIA 3ABOA 4GUJA 1X1OA 2VFGA 3KAOA 4HN4A 1DL3A 4XTDA 3NDOA 3CWOX 3EDEA 4QSHA 4KFOA 1OX4A 2PRLA 4NNCA 4UFIA 3N9SA 1KCKA 4LS2A 3V1PA 3W83A 2V82A 2C0AA 5G1TA 2QCLA 2OSXA 1SO4A 4LW7A 2WVUA 2C14A 2QAPA 1CW2A 3THAA 3K8LA 4RXFA 1QPQA 2GJLA 2WSKA 2ZTKA 3DKJA 5F4XA 5G4WA 4X2RA 2C19A 2NX3A 3W1MA 3W38A 2QMJA 2A0NA 4UZUA 3NL2A 3Q58A 1D7FA 3CM4A 1KTCA 1WOBA 2F7OA 4GE8A 1SSDA 3M6YA 1TMHA 1BTMA 4LTSA 1MEWA 5KZMA 3WELA 1GPWA 1JXJA 3RLVA 2ZX9A 3VMOA 2G3NA 2ZRXA 1EWEA 4O1BA 1OK4A 3WJYA 3VSTA 2BXVA 2CZ5A 4AXKA 1UD2A 4MLJA 3MW7A 3H53A 4JYFA 4JTHA 4MFDA 4WOQA 1HL8A 3CZGA 3QQ1A 4MY1A 1O4UA 2C7FA 4AIEA 3ZS4A 3P8IA 1CGWA 2A5HA 2WSRA 3KX6A 1RQBA 3VO0A 1YPFA 2X16A 1KTNA 3CZKA 3BLPX 2Y85A 3EX1A 4O57A 2OYMA 2GUYA 4N9EA 3LHTA 4IXHA 5EYWA 3FIGA 4JTIA 5D2VA 3D51A 3TKFA 3VE7A 3NL5A 2CW6A 3EWYA 4DPPA 5KEZA 3EX3A 4GUGA 3VI2A 3PR2A 2VOMA 3PVFA 4GC4A 3M44A 1GOXA 1TTIA 3GNNA 3W2MA 1J4EA 1YYAA 2ZXQA 1B0IA 3ABRA 4JGDA 3GTNA 5C55A 4GO9A 1L6YA 1LP6A 2E8ZA 3VGGA 3GR8A 1G69A 2QCGA 2QUVA 3BAIA 1OGSA 3RILA 4IPIA 3MJYA 3QJAA 3A4AA 3RMJA 3S6DA 1ME7A 3S8HA 3LV5A 3O6DA 1F74A 3EXTA 1JAEA 4AHPA 1YXDA 2O7QA 1OJXA 3WK2A 4JTTA 5DY3A 3MHGA 3WY1A 5HR7A 1JGIA 4WF7A 3NQ2A 2BXYA 3ZWSA 1SW0A 4HHPA 3HMJG 2ZZ6A 3BMWA 2X2GA 2YCEA 4J3SA 3CIWA 1OT1A 4MLRA 2XWEA 3BAWA 1EO7A 3KVJA 1KFEA 1Z42A 2AGKA 3RF9A 4J3XA 4GQQA 1XBZA 2ATSA 3B8DA 4MZYA 3LLFA 2WVVB 1PCKA 5FEXA 1QR7A 4O14A 1W56A 2BHYA 4JTUA 1W1ZA 3G1YA 4CN6A 3QMSA 1EP3A 2R94A 5CXPA 3TC7A 3PBYA 4TMBA 3VE9A 5T26A 2NLIA 1OX4B 3IGSA 6CGTA 2QKFA 2FLIA 1CX9A 4EVZA 4K39A 1DEDA 4FX7A 2ISSA 1A5CA 4W9TA 2PWHA 3NR0A 2DZVA 3EX4A 1QW9A 2GOUA 1QOQA 2HMCA 2YJQA 1TJPA 1PIFA 2WSYA 2ZXAA 3W2LA 2XIIA 3BG9A 1Q3NA 3TJXA 1GWJA 1MFUA 1GZGA 4FIRA 1XBYA 3DI1A 2ZBTA 1SPQA 5C2XA 2QUUA 4UOZA 5A8GA 2XVGA 3BW3A 1CXHA 1HO4A 1IZJA 4KFPA 3NQMA 1QPNA 4TU1A 6TIMA 3NQFA 5AFDA 1JFHA 4QNEA 1UCWA 3L2IA 4S2CA 3KVMA 3IEBA 1FDZA 3I65A 1T96A 4AWTA 3EJUA 3QPZA 2YIHA 3W7OA 5DBUA 3VGBA 3OVRA 1OVDA 1CLVA 1N55A 5BOOA 1WA3A 2ZA1A 3L4ZA 1DV7A 2E6YA 2ZUVA 3HIJA 1WO2A 2DJXA 3BVUA 3IGUA 4MY8A 5CGTA 1P5BA 3GDMA 3EJPA 2V5LA 2ZUTA 3IIOA 2CFFA 3BVWA 1KXQA 3ZOAA 3QSTA 4FEZA 1I2RA 2DZSA 4IOTA 4QQ3A 2DORA 1P6WA 4E2OA 4UTWA 4JCMA 3EDKA 3IIVA 2OW7A 5D09A 4UTKA 2E9BA 2TPSA 4NNBA 1XGZA 1W5QA 4O17A 1V3LA 4I7WA 3SI9A 3LHZA 4FIQA 1LRNA 4R33A 4DO6A 1B4EA 1JF5A 1XV8A 4CNNA 1JVNA 2NXHA 3W7PA 3BPWA 1H7PA 5HUPA 5KINA 1K7FA 4TMCA 1VS1A 3RFAA 2FH8A 3OVQA 1AK5A 3C4UA 3PBWA 1Q6LA 1TV7A 2J9YA 3G0UA 4TVUA 3S2CA 2OYLA 3TXZA 1LDCA 1QWNA 4NT0A 3LHWA 1VCFA 5I5RA 4KFNA 3UYCA 1LWHA 3TTYA 5HXMA 1KFLA 4H6KA 4WXZA 4JY8A 4GJ1A 4TIMA 1KWKA 1VCVA 4ZL1A 3LRLA 3NQ7A 1XL9A 1T0OA 3TJLA 4GNJA 4QNWA 2BY3A 4ORMA 3HB9A 4R53A 1EPXA 1E43A 1QI4A 3BC9A 4UFHA 3LHVA 3CU2A 2EEXA 1WOAA 3NPWA 2H3DA 1FX6A 4L4LA 1NOFA 1KM0A 2WVVA 3FOKA 4OQVA 3FFSA 4B9ZA 2BX7A 3SFKA 2QCCA 4H8UA 3OVPA 3WN6A 3OA3A 3NPXA 4Y6GA 2PWDA 3GR7A 3L21A 4OT7A 1BF2A 1ODUA 1UOKA 2EADA 4UQCA 1JDDA 2WSPA 4NJKA 1EWDA 3G22A 3NZ1A 4OKDA 5TQLA 5FF0A 1M7PA 2W6RA 5CSRA 3G1FA 4CVWA 5HWNA 4XKYB 4JX4A 3G0XA 3PUDA 2R8WA 3EJRA 1XUZA 2V2HA 1RP8A 3W37A 1HVXA 1N7KA 3LCHA 2EAWA 3C56A 2X1RA 1NVMA 3HG4A 1QAPA 4YCPA 3CZNA 1UA7A 2V8ZA 1LOSA 4UQBA 3IVTA 1KM2A 4HPHA 3MO7A 3W7DA 2V81A 4NJIA 2ZX8A 2QR6A 1XH0A 3TQ0A 1JI2A 2YGYA 4EF9A 1QHPA 3FYOA 1OFPA 4GIAA 2YX0A 2ZRYA 4WD0A 1JL8A 5E0KA 3TSDA 1VH7A 4EOUA 2ZDRA 4XKYA 2ALWA 3HOJA 2YDAA 4UQEA 4Y9AA 2E6DA 1MW0A 1CXEA 4HKPA 3SR7A 2VXNA 2CPUA 2B7PA 5LNWA 3LBMA 2Z1BA 4OGZA 1DHPA 3SW6A 3DX2A 4RCXA 1R33A 1EHAA 4H7VA 1A47A 4JD4A 5D38A 3A23A 5U7SA 1RPXA 4TR9A 4UTLA 4IXXA 1XH1A 5HWMA 1FWSA 5EBUA 3ECQA 3STEA 4GQRA 4J7RA 1PIIA 4K37A 3NQDA 5E0FA 8TIMA 1Y0EA 5HWJA 3K8MA 3K1DA 3I7RA 2WNQA 2XVKA 5AC6A 4RX0A 4Z1CA 1H1ZA 1LBFA 4QAIA 3C2RA 2E5BA 2I14A 3DU0A 3YPIA 4AHQA 2DIEA 2VEIA 4IMDA 1GVIA 3T4CA 3EEGA 3R13A 4MKNA 4MB1A 4M6QA 3W1AA 4GFSA 3DFSA 3W23A 1IXNA 2QPSA 1LYXA 3W7EA 4O19A 5TD4A 1XCFA 4J3TA 1R2SA 3B04A 3TSMA 2YFOA 5CLTA 3P62A 4X9YA 2FPTA 2A7RA 4O12A 2WOQA 1TQVA 4X3ZA 3IJ9A 1JD9A 4U2ZA 1TQUA 1H50A 4LS1A 3HO8A 4NI3A 1XDLA 3LCFA 3NQGA 3SIZA 3STGA 1KLZA 4JIQA 1VR6A 2QCMA 4AMAA 2CWNA 3HPZA 3EDJA 3SY5A 2QDGA 2QCEA 2WV8A 3L68A 1KW1A 4OE7A 3PBUA 2E6FA 1YXCA 3UEQA 3W7LA 3NQAA 3P80A 4A2SA 1R2RA 3SECA 4WXYA 4U31A 2QCDA 4G1KA 1LWJA 5FEWA 1QCWA 2OZ0A 3N14A 4ORIA 4S2BA 3ZSSA 2CLIA 1HXKA 2GUUA 2VEMA 2QUTA 3O6YX 1XXXA 3NZRA 1TRDA 3KRZA 3T7VA 3O15A 5CLWA 1A5AA 3CWNA 4CQ8A 5I23A 1R75A 3WMSA 1W54A 4LC8A 4JYDA 2B7OA 5D04C 5D37A 2A21A 4GUIA 3CTTA 3HQ1A 2QPUA 4IMCA 5C5YA 3D4YA 3QH2A 5GVJA 3W1XA 4O28A 3L0NA 4ZQOA 1PJ9A 1E3XA 3BK0A 3N2MA 3N2XA 2Y7FA 4NVTA 1V3JA 1WAUA 1GVQA 4FXRA 3GDKA 3GXDA 4PSRA 1O5KA 3W7QA 4LU0A 1SZEA 1BPLB 1IV8A 4QITA 3O05A 2KZHA 3G1VA 3S1XA 3W1LA 3EWUA 3L5MA 5H91A 3IJ7A 4AH7A 2CLOA 4X0NA 2WKLA 2GJNA 1IIHA 3IIPA 1H7WA 5D2YA 2EQDA 1KB3A 2JKEA 3D4ZA 4J27A 1G4TA 3SGZA 1CYGA 3BSHA 2OT1A 5CKSA 2Y70A 2AAAA 1MO0A 3G1AA 1R46A 4AYSA 3W7HA 3HZ3A 1GVOA 1TV5A 2BZNA 4PCTA 2J9ZA 2PCQA 3W7CA 4U28A 4HNUA 1KFBA 3F1QA 4NXSA 4I7VA 1QMLA 1AVAA 2E1DA 3P67A 2FHCA 3QC3A 3QF0A 2J6XA 2FB3A 4UCGA 4DXVA 4E2BA 1F05A 5EA9A 1JCYA 2OX1A 4JDBA 4UFMA 1SQ7A 2D0FA 2OW6A 4UNKA 1F6KA 3LGEA 2VEPA 1UASA 2Y5EA 4GI8A 4GI6A 2H90A 4JFUA 2YW4A 2A6LA 2NXIA 4XQ6A 2O7SA 2ZFAA 1PZ3A 2DU2A 1EEPA 1OFOA 2ZXDA 5E93A 3A6OA 3DI0A 3LI1A 3E49A 4M6PA 4B9YA 5CPLA 3VM5A 1KLYA 3WY3A 1MW1A 2HSAA 3BARA 1UJPA 3BAJA 3UWVA 4WLCA 4UTTA 1I2PA 2CZEA 5AYXA 3TC6A 3DX0A 3DFTA 4QM1A 4WSKA 3DDGA 2DZWA 4DF0A 5K7JA 3BLBA 3WJSA 4J9JA 4UQDA 3L2LA 2OSYA 3D50A 3Q2DA 2NX1A 4LVDA 1R30A 2G96A 2FQIA 4O53A 3UCQA 1ALDA 3LHYA 3NQEA 5AC8A 2Y2WA 3HJZA 3R5EA 1G4EA 2DH2A 5K9CA 1WXJA 4J28A 4IQLA 1EUNA 1W3IA 5BRQA 3DX3A 1UD3A 3BUIA 1XUUA 5F2GA 4OU1A 1TQSA 3MWAA 1ME9A 3M9YA 3IVUA 4UFLA 4PODA 1SU5A 4I7UA 4PSPA 3GXFA 1M7OA 4UIOA 2F7QA 2NV1A 1JQXA 3FA5A 4LS0A 1VJSA 1GTEA 7TAAA 5FESA 3V75A 3MI6A 4ZMGA 3NL6A 5KTLA 2EAEA 1TPB1 1EIXA 3D52A 3WNOA 5BRPA 3IRDA 2GJRA 4ADUA 1V5XA 1TPVA 3LCWA 2D3NA 3P8JA 2OT0A 2I1OA 3I7SA 2XFWA 1W3NA 4GINA 1G94A 1CGXA 3ABSA 1DJNA 5LSMA 2WPBA 4HNVA 5KZDA 3G1XA 1FWRA 5DO8A 2ATMA 4DEFA 3OLEA 4U33A 1TTQA 2F1AA 1GJPA 4UZSA 4NJGA 3W07A 4OV9A 2OCZA 4O4WA 3NEVA 1OFBA 3DFNA 3DZ1A 3TXVA 3UNDA 4JR5A 3QFEA 3FAWA 4L4MA 3WY4A 3TOPA 2TSYA 3JR2A 3GLCA 3NGJA 3DFOA 3IK2A 3TW7A 4FNPA 3KLKA 2FYVA 1R34A 1JCMP 5I3IA 3F03K 2V2DA 2Y6ZA 4UOQA 1DQXA 3S5NA 1QPKA 1TQTA 1O94A 3R89A 5AHEA 3STCA 4DO5A 5AC7A 1B9BA 3F4NA 1G67A 2YA0A 2VELA 3W85A 2YA1A 3GXPA 3PC0A 3GK0A 1H62A 3N3MA 3VSUA 4O13A 4M19A 1DJQA 1VAHA 4U2YA 3T44A 5F4WA 1I45A 3VSVA 1XD1A 3LV6A 1J5TA 3UG4A 4UR8A 4UFJA 2CLKA 5I3JA 2WC7A 3TV8A 3TE9A 2QCNA 1QI5A 3OEXA 2ZA2A 3EB2A 2GVGA 4FNTA 1DBTA 3C0JA 1GG0A 4HT3A 4UTIA 3NL3A 3TUUA 3O06A 3BVTA 5A2BA 1VFMA 2QCDB 3BSGA 1V7YA 4K6AA 1X1ZA 3EWWA 2WSQA 3EWXA 5LNUA 1GJUA 7CGTA 2X1TA 3MBDA 4YL2A 4JEQA 3U6WA 4UTJA 3STFA 5D05A 3BLIA 4QAWA 4QJ1A 1RR2A 1SO5A 5BNKA 4MYXA 3BH4A 5EMUA 1NM9A 3DBPA 3PS7A 3S0CA 2CZFA 3OLIA 4WX2A 4UNIA 3UZJA 3I6RA 3W73A 2QAFA 4LPCA 1VFOA 4RLIA 5DLCA 3CEUA 2HS6A 2HTMA 2RH9A 1OT2A 3A5VA 4BA0A 4ZQCA 2FGZA 4AVFA 1S46A 4FLSA 1TCMA 3CC1A 1U30A 4RR4A 2XVLA 1E40A 1FCQA 3ZT6A 1KXHA 4M7TA 1HO1A 1W5OA 4LOCA 5AHFA 4UTMA 4H3DA 3G24A 4TX9A 2VRQA 3S5OA 3TNOA 1BWLA 4GO8A 4M6VA 1XBVA 5FEZA 3BVVA 3ATZA 4BWLC 1W9XA 5L9FA 3WEOA 3VX0A 4WY0A 2JGYA 4GI9A 1PS9A 4WQ6A 3WNMA 4RZ5A 1F76A 3CV5A 5HUOA 1ZY9A 3G1DA 3EKZA 1CGTA 3CZSA 3IGXA 4CCDA 2YFNA 4FB7A 3JRKA 2DJLA 1KFJA 1VHCA 1FCVA 3TU9A 2NT0A 1XFBA 4HIBA 1OF6A 1FCUA 1K7XA 1Q6OA 3WFZA 1OK6A 1AW2A 3VFLA 4N6FA 3TA6A 1TQXA 4JCLA 3UWQA 2WCGA 1FDJA 4FO4A 4ZZ9A 5FF4A 4IUOA 4ML9A 5FF2A 2C1HA 3PUEA 3TR2A 4ZQRA 3TH6A 2A1YA 1Q6RA 2VNCA 3L5LA 2Z2UA 2Y89A 1EA9C 1QI3A 3GBDA 1GG1A 2J9XA 2R14A 3WENA 2A4AA 1Z41A 4MVAA 2QEZA 1OABA 3A5FA 3E96A 3W1TA 3AMKA 3WDIA 4ADTA 2X2IA 3N73A 3IIZA 5G2IA 3DXIA 7TIMA 2H8ZA 2CLFA 4U3CA 1QWUA 3M5XA 3WNPA 2WKJA 3MHFA 2ALDA 5TIMA 5A2CA 2NUYA 1WBJA 3P60A 1QO5A 1HTIA 4LUJA 1M53A 4AWUA 1H7XA 1VB9A 3ZR5A 3LRMA 1HTYA 1GCYA 3GKAA 3QW4B 3TONA 1AL7A 5MHBA 2DZXA 1KFCA 3VNZA 1G5AA 2B7NA 3PB0A 3EX6A 1NFBA 2RDWA 2TRSA 3CZLA 3EJQA 2YZRA 1ZCOA 1XD0A 4Z1DA 5G2HA 1TTPA 3VU2A 1VLWA 4IMGA 2YW3A 2Q3RA 2NZLA 4UC5A 4KWUA 3NO5A 1F73A 4A3UA 2FDSA 2P1FA 3TAOA 3PAJA 1K8ZA 3MI2A 2X1UA 3BW2A 2GJPA 1CI1A 1OHLA 3OHIA 4KMQA 3FKKA 1G6CA 2ZXBA 1OYAA 1J2WA 4UCFA 1EUAA 4N9DA 5CZJA 3TX9A 1VHNA 4OWGA 1JCNA 4JDYA 1WX0A 1SR9A 1LLWA 2JBMA 2WVTA 1ONRA 1BAGA 4NQ1A 2VFHA 5FF3A 1ZHAA 1EX5A 2QCFA 2G95A 2V3EA 4FNRA 2WNNA 4AB4A 1HWWA 1BVNP 1L6SA 4J3WA 1Z32X 5BMXA 3W1UA 5AHLA 1HUVA 1EA0A 4KWVA 4XTIA 3QGVA 1MEHA 1BVZA 4Z08A 3MBFA 3PG9A 3HGJA 3GNDA 2JK2A 4CN4A 3FKRA 3GDTA 2FTPA 5D2WA 3BLFA 1F7BA 4UR7A 3AMLA 3W7GA 4DO4A 4UTUA 4LV9A 3UD6A 1AQHA 4N9CA 5A5WA 2C6QA 5D33A 1OFEA 3LERA 1CGVA 1JJKA 3P61A 1NAL1 2XIBA 2PWEA 1JCXA 3CLWA 3PB2A 3K30A 3WDHA 4GRSA 3L65A 3KEHA 3HPXA 1IGSA 3GXMA 4QISA 2FE0A 3NXFA 2ZQ0A 2OMAA 1GVSA 3DENA 3MP4A 4EIVA 1EB3A 5K3VA 3IJ8A 2ZUSA 1T8XA 1AW1A 2GVJA 4MZ8A 3O1NA 3NG3A 3WJXA 1M6JA 1TSIA 2WNZA 4IWWA 2AAMA 4IJBA 4MOZA 5K9DA 3U2OA 1UH2A 4RKAA 3LXAA 4NXKA 1M7XA 3VNYA 3N9RA 5D2TA 2A2IA 1YDNA 4K8EA 3SJ3A 3Q94A 3NPVA 4M8UA 4O15A 4FF7A 4XWUA 3GXIA 3TTSA 4JL2A 1SZNA 4PCFA 4AWSA 1MXSA 1HT6A 1TB3A 2YR1A 3WJWA 3MHUA 1ZAJA 4CQAA 4FHAA 4HA1A 5LNSA 2X1SA 2I9EA 1KGWA 1G4SA 3B4UA 4JNMA 3W7JA 2CXGA 1XI3A 1HL9A 4M5PA 4JICA 1YLVA 1SW7A 3W1RA 3UPBA 3FJ6A 1DTUA 3UERA 2E5DA 2EABA 1XSKA 2G3MA 1Z48A 2Y7EA 3EJTA 4O54A 4PTNA 5K9XA 3L67A 5D03A 2Y7GA 3KRUA 3W2JA 3W74A 4JTJA 3O16A 2BLEA 1ADOA 5IBXC 2ISVA 3ZSTA 2A7NA 3O6CA 4JFSA 1OYCA 3C8FA 1P1XA 2E4TA 1SO6A 1S5TA 3PSWA 1WZKA 5EMYA 2NWSA 3I7QA 1WYIA 4PCSA 2CZDA 2BY2A 4W93A 4UQAA 3KL3A 5CGMA 1TO3A 1G9HA 1LRQA 2NUWA 1HFBA 1BSIA 3ZT7A 4Z0JA 4H8VA 2AQWA 1NEYA 1KCLA 4O8RA 1GTHA 1UKSA 1G4PA 1CDGA 2BHUA 1H7OA 2F2HA 3C6CA 4X9SA 2PWFA 1O95A 4FLQA 1B2YA 1OF8A 1FQ0A 1FXQA 4P61A 2J88A 3DHUA 1ZJIA 3S1UA 3BW4A 3W7KA 3LOTA 2CLMA 1YTEA 2FB2A 4NU7A 2CHNA 1OFAA 5F2MA 2A85A 3FW6A 2QJIA 1AW5A 2Y63A 4MIMA 1SFJA 1ICQA 2C13A 4BWLA 1JCJA 5DCDA 4HOWA 5EL1A 3DFQA 3DDFA 5U4NA 3SSJA 4IX2A 5HNRA 2VENA 4C1KA 3UPWA 4D2JA 4XBSA 3UWWA 3W72A 1KM3A 1QW8A 4TO8A 1PIGA 2FH6A 3GKFA 4PL2A 3M07A 1GQNA 1PZ2A 4Z0SA 4GUFA 3G18A 1UD8A 8CGTA 2C3ZA 3QMTA 1LTDA 3NQ8A 2DZTA 3E02A 4ADSA 4LQ1A 1F2JA 1IZKA 5CG7A 2NSXA 3HPSA 2NXGA 4O1DA 3AJ7A 2CU0A 1X7FA 2LLEA 3HJEA 2ZZ4A 3GVGA 3P5ZA 4K38A 4MJMA 4AAJA 2DH3A 2XN1A 1MXDA 4IPJA 4NZJA 3BLEA 1JCLA 3WEMA 3HF3A 3O8AA 3UZ5A 1JUEA 2DIJA 2V30A 4FX8A 3NQ6A 1VJIA 4PEKA 5A6MA 1C29A 4O1CA 4LY8A 1WPCA 5C6MA 1CGUA 3NVTA 1UKTA 1XH2A 3G3MA 3W2KA 3IVSA 1OX5A 1WZMA 4WSJA 4MAZA 4DELA 4AF0A 1G7VA 1KBJA 1F5ZA 2C16A 2QF7A 3IIXA 4AIOA 3BUDA 3MUXA 1UBSA 1JXKA 4KKXA 2NT1A 3GXNA 1IXPA 3W2NA 4Z1AA 4LVBA 1M5WA 4N6EA 1P4CA 3LTSA 5AN7A 2RDTA 3B05A 5E9AA 4MYAA 1D3CA 1E51A 4S1FA 4XB3A 1BKSA 1O60A 1MVYA 1KXTA 4DF2A 4UTWC 1JF6A 4O4VA 3N34A 3W7RA 5HR6A 3BGGA 1G7UA 2ZUWA 1JIBA 2ZICA 3HGOA 5EPDA 1QO2A 2ZYFA 5EY5A 3B0UX 4UFKA 3WJZA 3W7IA 3GAYA 1SMDA 3CGTA 1ZJAA 1SMAA 2J25A 1N8FA 2W79A 3MMTA 3W71A 4JFWA 3LXCA 2ZE0A 1BG9A 3NYZA 2FFCA 4NX0A 5HJLA 4MFEA 2V5BA 3LTPA 2VT0A 3BMVA 1W8SA 3DHDA 1AL8A 3BLKA 1OFDA 3D0CA 3M16A 1D3HA 2TYSA 3CLMA 2NV2A 1DOSA 5G5IA 4CNPA 4MY9A 3LDVA 3M5VA 2EGZA 4NUWA 5F1VA 4A22A 4LRSA 1DKWA 1TPFA 5KITA 4BI7A 1RQHA 1TTJA 1LBLA 1ML1A 5F4SA 4AMXA 5AYYA 2RHGA 3M5YA 3NPUA 5I3FA 3RNDA 1W5PA 2F61A 1KV8A 1JRBA 2PURA 4LC6A 2CLHA 4BK9A 3UY7A 3B06A 1XSIA 3CPUA 2FHFA 1U33A 3TROA 3NOEA 1KGUA 1MW2A 4BZYA 1MFVA 3DHFA 1UA3A 4O50A 1CXIA 3W87A 3QMRA 4HSOA 2G5WA 3VX1A 1WZLA 5K4ZA 2Q8LA 1TJRA 2Y61A 3LRKA 1D9EA 5AHMA 1U2YA 1VYPX 5E6YA 3RU6A 5IM51 5F2LA 3W3OA 3F4WA 1QX1A 3ABQA 5CZ0A 4RK8A 2J24A 2YKKA 4CLMA 3NM1A 3UG5A 2RDUA 5F7UA 4ZVJA 1GYLA 3KLLA 4ZQMA 3UWZA 3CZEA 1YXYA 1JI1A 1QFEA 4O0KA 1YTKA 3L2MA 2ZRWA 2Y7DA 3T78A 4Z1BA 2FPYA 3M0ZA 2ZX5A 1VFUA 4OBTA 3BAKA 3W6YA 1UD5A 4FNQA 1R2TA 1LROA 2VC6A 3BUQA 5I3HA 4OHQA 1ZAIA 3KXQA 1V3KA 3MP3A 5HDRA 1FWTA 4CCCA 3ELFA 3WK3A 1SUXA 2EPHA 1OB0A 1JULA 3CTLA 4XZ9A 3LCGA 5IBXA 5LZLA 1TYGA 3AXIA 5CGQA 4LVFA 3ZR4A 2DZPA 1H3GA 4WY0B 5C54A 3GYEA 3UG3A 1VPXA 4JFTA 3TW6A 2W0UA 1FWWA 4NZFA 2E5CA 2VFIA 1RP9A 4ONVA 1H7NA 3T55A 4LNYA 4PA8A 1H5YA 2CLLA 2G97A 1UKQA 1QNVA 4ZQPA 1BEUA 1MSSA 4O0ZA 3LCXA 3QW3A 5A6LA 6TAAA 1W5MA 4Y96A 5CPMA 3L4VA 4UTTC 5LNVA 3ATYA 2QCHA 4WZHA 1Y7VA 1FDYA 4FNUA 3CQ0A 2VRKA 1XM3A 4IMEA 4DBEA 2EHHA 4JY9A 2GPTA 1QOPA 1PVNA 2ZX7A 4N02A 3VCRA 3K8KA 3KOFA 3WDJA 5K4XA 1AMYA 4UXDA 3CIXA 4YWIA 1TPC1 5J5RA 1J0JA 1TIMA 3RK8A 1R47A 4CGTA 4JX6A 1CXLA 3W1QA 1J0KA 4JTFA 5L6UA 3RIKA 3QM3A 3CHVA 1KBKA 1MWOA 2ZZ1A 5K2ZA 5I0DA 3KVKA 1LRTA 5D30A 4DBDA 4H8HA 1HNYA 2VEKA 1EO5A 1SFLA 3WK1A 1VQTA 3TCEA 1J0IA 1HG3A 3UXAA 3KL0A 4I9AA 1ZFJA 3BUBA 5I24A 2NUXA 3L9CA 1JDCA 2F7FA 5LHEA 1FWNA 1QWGA 1H1YA 5HINA 3FAXA 1KM6A 1OX6A 4MPQA 4RXGA 1VC4A 1MXGA 4FLOA 1A5BA 1JUKA 3M5ZA 3DX4A 3TFCA 3R12A 5HMSA 4JXCA 4O52A 5DBTA 3LPPA 3BV4A 1V3MA 3G8EA 4N4PA 4HPXA 1C8QA 4UQ9A 4JTLA 4OV4A 2VUYA 5SWUA 3S1WA 4X22A 1FY6A 3UQNA 3LM7A 5CZSA 4AW7A 1O5XA 1THFD 4OJYA 4R7JA 3G0SA 4AYGA 3QEZA 2A6NA 4POCA 1KM1A 1WQ5A 3L0GA 3TMLA 2Y24A 9CGTA 3O63A 4OIFA 1VZWA 4N9BA 5DFAA 5E6ZA 1KA9F 2OJPA 3BVJA 1DQWA 1D3GA 1KBBA 1O7DC 2E77A 2H3BA 3CEPA 1JUBA 2YOCA 4O1AA 1JG9A 4NJJA 2V3FA 3FYPA 3G1HA 5HULA 3WNLA 4MJZA 3W7NA 1I4NA 1PHWA 2QDHA 3BCDA 4RV8A 1QHOA 2IQTA 4Q4KA 2FPVA 4NNAA 3LB0A 2WNWA 3W7MA 3EKLA 3FLUA 4AMWA 3HG5A 1UH4A 1YTDA 3T40A 2ZZ5A 1TQWA 2X2JA 1E3ZA 3BGJA 4A2RA 2GQ9A 1YPIA 2NX9A 1I75A 2D2OA 3PBVA 1U5JA 4U4MA 1MW3A 1JR1A 2BY0A 3M47A 3EWBX 3BVXA 4K7VA 4ZQNA 3DHPA 3HG3A 1KFKA 1ZJBA 2H6RA 1SZFA 1X6UA 2ZX6A 3LI0A 2ZZ3A 3CPRA 2Z0IA 1TPWA 5AHIA 1FUYA 3PY2A 5DCBA 3L4WA 4K7YA 3RLUA 3L5AA 2BSLA 4XUGA 3BAYA 3PUOA 4UUIA 5LGZA 1C9DA 3KE0A 1GEQA 1GVRA 1L2UA 3R2GA 4GKLA 1WP6A 2RKXA 5KSWA 5LGXA 2ZRUA 3TQVA 4UNLA 2OYKA 5I3KA 2VFDA 1JD7A 5E1QA 4JS3A 1GVFA 1K7EA 3R8RA 2D3LA 1KXVA 5CPNA 4LT9A 4O11A 4AHOA 3DX1A 3HGRA 5KZEA 1UD6A 2D73A 2GVYA 1X8FA 3GDRA 4NJHA 1K02A 1KTBA 2PRHA 1PPIA 3EX2A 3EWZA 3L4XA 4O18A 2BWGA 2YSWA 5D02A 1CIUA 3GIYA 4PFMA 1P0NA 4JTSA 3C2EA 3EJSA 1TPH1 3MYOA 3C52A 1TQJA 5LKYA 3PSVA 3UXDA 1WBHA 3MYPA 3H55A 2DP3A 1YDOA 4BR1A 5A2AA 2BTMA 4JIPA 1RD5A 1LCOA 2H8XA 3M41A 2Y4SA 4M7SA 3VMPA 1TREA 1ZAHA 2HS8A 3IV3A 1HX0A 5FF7A 3BG3A 5F2IA 4JX5A 4YMZA 1H60A 2JKPA 4Q33A 3W2UA 4LVAA 2F84A 4GUHA 4EWND 1CXFA 3EDDA 2E09A 3OLDA 3C2FA 3UWYA 1B57A 1IXOA 1ICSA 1I2QA 1H63A 2Q8ZA 3G8RA 2X2HA 1FCBA 3TAKA 5FEPA 3S9YA 4HSNA 1BLIA 5FI8A 2WQPA 2RFGA 4LVGA 2YXGA 2ZCGA 4IX0A 4HPJA 1XSJA 4E38A 2F7RA 1PV8A 4LUIA 1K8XA 1NF7A 4GBUA 1F6PA 4HP5A 5G2WA 3A22A 4R34A 1KM5A 1DVJA 3OIXA 1IF2A 2E6AA 1XCXA 4QIUA 3GB6A 1Q6QA 3O07A 3VMNA 2Z6IA 4O10A 4CN1A 3EDFA 3GAKA 5BRBA 1XDMA 5H2ZA 3A47A 3LCLA 1WV2A 3QPYA 3QYQA 3VNDA 5LHFA 5TBOA 1L0PA 1W3TA 3L0KA 2B4GA 3TDFA 2ZRZA 4N2YA 2VKZG 5DELA 1LOQA 3WK0A 3L4YA 2ISWA 3NQVA 1W31A 2E68A 3LHUA 3S1VA 5AB3A 3BCFA 1CGYA 2VFEA 1S5VA 3KVLA 3OBKA 2QLYA 1GT8A 2A7PA 3LXBA 1QPRA 1SSGA 2ZRVA 4BFAA 2Y88A 1A50A 3C61A 1Z44A 2B7QA 3NM3A 3NQCA 2D0GA 2ABAA 1EP1A 2Z1KA 3OG3A 1Q4NX 1ZS2A 3MP5A 1PS3A 3NA8A 2ZA3A 4J3UA 1KV5A 3CB8A 2C18A 3HG2A 2R91A 1I2OA 3ZT5A 2Q3OA 4Q32A 2YYTA 1DHKA 4NX5A 2JKAA 3PG8A 3VGHA 3NAVA 2AMGA 3CT7A 1K3UA 1EH9A 1RVGA 4MZ1A 4B5NA 1PL9A 1HL2A 4UMBA 3FS2A 1AQMA 4AEOA 5LNRA 4PC8A 5I3GA 2EJ1A 3S5YA 3UY8A 4LXFA 3B0PA 2WCSA 3KFTA 1RV8A 3Q37A 4LV4A 4PL1A 1UD4A 2B0MA 1IXQA 1B3OA 3DC0A 3GZ3A 1LORA 3L66A 3VKJA 4FLRA 1OFQA 1ZENA 4AEEA 3DKLA 3P5YA 1RZMA 3BAXA 2F1BA 1SO3A 1PEZA 2XN0A 3W1PA 4ALDA 2CLEA 3G3DA 1OFRA 3N19B 5HPOA 3B0VC 2PRMA 3P84A 2QMKA 2ABBA 1TPEA 1VRDA 5ABTA 2TMDA 1FXPA 3VGEA 2IGTA 1VLIA 3TQKA 1ME8A 2ZZ2A 4CNOA 4IGHA 1Q45A 1J0HA 3KL5A 1KBIA 1U83A 1LM1A 1W37A 4AF0B 1VCGA 2EKCA 4Y8FA 4E0CA 3C2VA 5DN1A 3BG5A 2BHZA 2WKGA 3PF3A 1H7RA 4WUIA 3GBEA 1LLZA 1H61A 4KWWA 3E0IA 4FNSA 2Y62A 4P2VA 4WY0F 4E2DA 2TAAA 3WNNA 3NNTA 2ZUUA 1WDWA 3UWUA 4UTHA 1OG0A 3ANYA 5DXXA 3LTYA 1S3HA 3W86A 3M1ZA 3DFPA 2QV4A 3MI3A 1VIWA 4GXMA 2ZIDA 3II1A 4HOXA 1GYNA 3WFAA 3SZ8A 2X30A 4AEFA 2J27A 4MUZA 3S5ZA 5D32A 1JDAA 4BI5A 4BI6A 5AOUA 1LBMA 3EXSA 1XC4A 4JTKA 2WVSA 1NSJA 4JTGA 3TIMA 1WZAA 2Z6JA 4FMVA 3QZEA 1EP2A 3ZR6A 1MEIA 3L4TA 5BW6A 3VGFA 3PWAA 4H4IA 4JTEA 3GX9A 1YDVA 4JFVA 3LLDA 5AHNA 4JYEA 2C15A 4EF8A 3TMQA 1ZNNA 4K36A 4M56A 3KHJA 4JL1A 3WY2A 1VYRA 2EO7A 2WANA 2P0OA 3FEMA 3HBLA 3LBCA 5DXYA 1AG1O 4YLWA 2NWRA 3I68A 4ICNA 1KWGA 2FHBA 4A21A 3M7WA 3TSBA 3W22A 3E12A 1L9WA 3A21A 4A29A 1RQEA 1DORA 2V2CA 1B4KA 3DH7A 1PHQA 2WO5A 2QJHA 2EACA 2E8YA 1S5WA 3AO0A 4UMCA 2OSWA 1JRCA 3TFXA 3VGDA 4N4QA 2C8NA 3ZQ9A 1TCDA 5D2XA 3B03A 2ZWZA 3U8GA 1OSEA 3LPOA 2V0TA 1TV8A 2JGQA 3GXTA 5G1YA 1CXKA 3ZO9A 1G1YA 1VGAA 5BMWA 2YYUA 4O16A 2GQAA 5F1UA 1YADA 3SGUA 1UUMA 4BF9A 4YCOA 1TMQA 3W84A 3W70A 3THQA 1JQVA 1UH3A 4DPQA 3QSRA 4FXSA 1LZOA 2E0PA 5CPOA 5E70A 2WPGA 5HQEA 1SZGA 4DQWA 1GJWA 3C3NA 5CZTA 2XN2A 1C8VA 3ZWTA 5DCEA 2VFFA 1KM4A 1XBXA 3P81A 4FX6M 6ALDA 4LRTA 3H54A 1ZALA 4J3VA 3C2OA 1P0KA 3W1NA 1WE5A 4K8HA 2P10A 4CCEA 2D0HA 4CQ9A 2V3DA 1TPUA 1CPUA 1K8YA 1PE1A 4WOZA 1RPKA 4YXGA 3KWXA 3L4UA 3USBA 1UB3A 1K03A 1T99A 1FBAA 4HNTA 4RZ6A 4H2CA 2F7PA 3A24A 3W76A 3TK7A 1MZHA 1L6WA 3PULA 1IIGA 3M43A 1W5NA 3P82A 5G4EA 4WJEA 4Y90A 3S42A 3A9IA 3GDLA 2BXZA 1A53A 4IMFA 2FJKA 3AJXA 4PEEA 5J5DA 2VR5A 1XCWA 3BUPA 3LX9A 3ZFHA 3E9AA 2GQ8A 5DY2A 1XKYA 3QQ0A 3G1SA
chains in the Genus database with same CATH superfamily
3GLAA 3AXHA 4QO1A 3MRKB 2FJGB 1CLXA 4UTAL 1GHRA 1PTGA 1G7IA 3ESPA 3WKPA 1SQ2N 4TN9A 1ZBKA 5I74C 3BW9A 1UGKA 4XN8A 5CPSA 1NWRA 4OUUA 4J3OD 4DPBX 4FXKA 3B1TA 3NIDB 1BFNA 4XP1L 4GW4A 3QIBA 3R8BB 5E5MA 2QDEA 4KDTC 4NKMA 3IS4A 4HCHA 3LNFA 3JV4A 4PTVA 2BLFA 5FLVA 2WXGA 1XIDA 3LPFA 3OLGA 4XPHH 1T89A 3B4NA 4FXKC 4QJ4B 4FXGC 3K2UH 1SW3A 4N2MA 2QADB 2W59A 5EU3A 5AEAA 1XJBA 3RU8H 3FJLA 4A3RA 1LTXA 1SY6A 4OIIH 5EA0L 2UV8G 3JQOB 5BS0D 1ZD6A 2EE3A 3ARDA 3II2A 5DFVD 3WNKA 1ZTVA 4N0CD 4AJWA 1A80A 2X70A 5F96L 4C1LA 4K8GA 5FYJH 4HJIA 4N2EA 4K23L 4QF1B 3BN9D 1ORQA 1X5ZA 2DYPA 2BVQA 2NSMA 3PHQA 5IHBA 4R0LC 2OWXA 3W27A 3OAZH 3ARZA 3UTTA 2EF9A 2IQDA 2DQUL 1TJGH 2IBBA 4M48L 2E7DA 4IU3B 3VFOB 3KOWA 1LJMA 4YYFA 5C8BB 2RCSH 4HNNA 1GR7A 1NLBL 2BIQA 3NCJL 3FQYA 3PS6A 4B9CA 1AZCA 3PM6A 5AYZA 3OZLA 5IBLC 3VWKA 2XWDA 3VCCA 4PRPD 1F4WL 1Q94A 5E2VH 2F5AL 2FIQA 4KMTL 4GP5B 2QIIA 3BDKA 2NLYA 4L3EB 1CFTB 2VLRE 3AREB 3N3EA 4AQAB 2IANB 4YHLL 2D2CC 5JW3H 3V10A 3JS3A 1TRIA 2WJZA 3CU7A 1N5YL 3VYLA 4JVWA 3WLNA 4JIHA 4HW6A 1W6LA 2XN9E 1X5XA 4K0OA 1HAUA 4YVUA 3QXWA 4N2FA 3PHOB 4GG6E 1I0BA 2AQOA 4YTUA 4A8RA 3QEUA 4NRZB 1OX4A 3RWDB 2PRLA 3B8IA 4NNCA 2HWZH 1F58L 2OBGA 3QXAB 1MCLA 1LO0H 2V4LA 2L7JA 3WQ5A 2IAMD 32C2A 1RZFH 3N1MC 3QCTL 4X8CA 4LW7A 1XCQA 1WA2X 3JTSB 4XO5A 2VXQH 3O2VL 5I0XA 3WSQH 2PLCA 2WVUA 4JFXA 4K3JL 5B1CA 4KRZA 3THAA 4GKSA 4H4NA 1YC8A 5DD6B 1ZEAL 2J21A 3WH6A 2J8OA 3WUBA 2OSLA 1W3HA 1ACZA 3O6FD 1UQZA 3ZKMC 5F4XA 2TSBA 3FB7A 2Z93A 4R5TA 3ZVHA 3KYMB 1K72A 2NX3A 3W1MA 2V17L 1A1MB 4ZX5A 2QMJA 3MSRA 3NL2A 3SDDA 1JZGA 5ALBH 1XGYH 2UWEA 4ZMYA 4N90D 3UAJA 2F7OA 3CM4A 3I4KA 3WJYA 5IHUL 3H8NA 3ROOA 4LTSA 2VX4A 1VBHA 3UIYA 1XF4A 3L3JA 5EZIH 5TE6L 2RGSA 5C0FA 1S5MA 3WBWA 1NAKL 4GD0A 4MYPA 4HZ8A 3FN3A 2BB0A 1IT8A 4XCNA 4DPRA 3NJKA 2BXVA 4AKPA 2P5NA 2VM3A 2XUWA 3BICA 4AXKA 2WMFA 1UD2A 4XZMX 2V2TA 4GA8A 4JRYE 5IROC 4UOW1 4WO4C 1Z0MA 3QQ1A 3GI9H 4IGBD 4YU1A 5A69A 1Y6KR 4PJ5B 3ZKQD 2OCCB 4HBCL 1CGWA 1G7IB 3O45B 2WSRA 3H2OA 4N0UA 2X16A 5D72H 5KSVA 1OZQA 2OYMA 2Z8RA 3JU2A 3CSFA 4HU8A 3LHTA 4IXHA 3RITA 3F84A 3S6OA 3TWAA 1EAQA 4JTIA 3MRBA 4G5DA 3VE7A 5JIQA 3OD3A 2G75A 4F1ZA 3Q2CA 2BWDA 1T66C 2CW6A 2BASA 2IALB 4MAUH 3MRRB 3VFPA 2J66A 4OY9A 3KYOB 3BLDA 3KUMA 4OFYD 1JPMA 3B8YA 2E9GA 3V95A 2BHFA 3W2DH 5B39A 3PVFA 2OMXB 3L8QA 1D5ZA 5E2WH 4L4VA 4FQQB 5IBLD 2O4QA 1WF5A 1V8EA 4FR1A 4J5NA 1PZ5A 2VR8A 4HALA 3NIDF 4PI0A 3IJLA 2ZXQA 1WFUA 4CSTA 1R38A 2YZ1A 1Q7QA 4HCLA 3NFSL 4R3SB 5C55A 2FMOA 1AODA 4RCAA 2XRAL 3C60B 1XLDA 4MKVA 3RX8A 5T5NG 5C3IA 2AJZA 2ZWLT 3GUFA 3NQIA 3PIQB 3VB8A 2GI7A 3CXHJ 2P24B 4I2XE 3WKNA 1T7VA 1G69A 2R51A 3B9OA 4H00A 4QXVA 1CE6A 1Q13A 3MPGA 3MVTA 3QNXB 2BNRE 4WGWB 3VI4A 4YLCA 1YEHL 4WW2C 4NRXB 1ME7A 3LV5A 3FU5A 3AUWB 3DMMB 2HN7A 4GGBA 1F74A 4WVXA 3EXTA 1JAEA 3A67L 4G7VL 1L0QA 3ZHLA 1RBLA 1EO8L 3GMLA 1THAA 2HJLA 3KR3H 4LCUB 3GQYA 2PGWA 1ML0A 2WJFA 1BZ8A 1JUFA 4LAUA 4XRCA 4J6IA 3SDAD 5DY3A 4YVXA 5HR7A 5JR1L 3I10A 1KPUB 4AD2A 3VG0L 1XLBA 2DUXA 2HLAA 4HQVA 2XTJE 3MV9A 4GMEA 4PJ5D 3ZWSA 2EYSA 4G7EB 3AT9A 4Q8NA 4DM2A 3HMJG 1J1PL 2X2GA 3LNPA 5GGSY 2XKNA 1WQVT 2DUZA 1KJ3L 3Q01A 4AITA 4AYFA 4B3VA 4IBTA 3MRIA 4XCYB 3NSMA 1RUPH 3ZVIA 1XLFA 4MMYA 2POTA 4LLUB 3TBBA 3BT2H 3ELQA 1HKMA 1KFEA 3KVJA 1A25A 4OSUL 4Z7WE 3ZDZB 3I3DA 2NY5C 1AZBA 4MZ3A 4QYOA 4F2BA 3OB0H 5T1KB 1FPTH 4M1GH 4YDKL 1C9WA 2OZNA 1LILA 1XBZA 2CM6A 2QSVA 3LTVA 1PCKA 3UTTD 1KJMA 5AWNL 4WJ5A 1U4FA 2L7EA 3CC5B 4F15B 5HBFA 2BHYA 3GLEA 1SHWA 2V5CA 3WIIL 1QRNE 3WDPP 4PRPA 4R4ND 5DHVH 1LL1A 2B59B 3O6FB 1KN2L 5PCYA 3TC7A 4DJDD 4AWSA 1GOKA 4ZXBA 4PJ7A 2DT0A 4XNMA 5T26A 5EOTA 3U4BL 4WCYH 4XXDB 2DQCH 2GBVA 3UBXI 3U7AA 1ZT7A 3VUAA 1F07A 4TVPE 5AVUB 4U1LA 1N0XH 1OTTC 4ZMWA 1NUDA 3N5AA 1A4AA 1CX9A 2A3HA 2FK9A 3GC2A 4K39A 4MJ5A 3HPJA 3UXIA 2FT8A 1QNPA 2ISSA 4ZXBD 4ZW8A 3MYJB 2PWHA 4KGLA 4KFZC 4F66A 3GKWH 1IGMH 5DURB 2CBPA 2F6XA 3CS2A 4Z2JA 1AFVL 2XY2A 2HMCA 5E4AA 1LL7A 1ZP3A 5I3DA 1PIFA 4GSXA 5E8NA 3W2LA 2XTKA 4XBGB 5L2JB 6XIAA 2ICEB 1TG8A 4BRJA 1Q3NA 4KTEH 4XXDA 3G77A 5JW4N 4I6KA 1MFUA 1TJ2A 3GO1L 3QAQA 4FIRA 1BW8A 2EYTB 3CWGA 2XISA 2ZBTA 4K38A 2DICA 1T4KB 1P4LB 4IIZA 1UR4A 2XVGA 3BW3A 3V5DA 3GHUA 2B81A 1CXHA 2FZDA 2GWGA 2QFPA 3NQMA 1QPNA 4TU1A 1H6UA 1JPTL 3NQFA 1Z6KA 2Y7OA 1JFHA 1T6BX 1BWWA 4C4UA 5I1IL 1MRQA 3M1BB 3QNZA 3UAJD 3I02A 2EKGA 4C8XA 5GJNA 4S39A 5C0CE 3OG2A 2OP4L 1D5XB 1XGRB 1S9WA 2F5BH 2A5UA 2BIHA 3NH7L 1T96A 4BE5A 3ARFA 4JM4L 3RN6A 4OLWL 4MRBA 4IJTA 3WCYA 3OVRA 3SCPA 1CLVA 1YJDH 3SDCC 43C9B 2ZG2A 2ZA1A 2ZOKB 3SYOA 2LGNA 3T3MF 3QOMA 4PUEA 1XYZA 3CHFA 5H2ZA 2OELA 2N59A 3O11B 4OV5A 1I9IH 2I32A 3HS9A 4XN4A 1JNLH 4Z7UE 2IFFH 4AD5A 1OAQH 3IIOA 2CFFA 3U4EA 2P47B 4MWFA 1AGEA 2YPKB 5EIVA 4P48A 5E00B 1R3LA 2DZSA 3QSTA 4FEZA 4ALAH 1PYWB 3T0BA 5KBDA 2DORA 3C60D 4JCMA 1YE4A 3BO8A 5F7NC 2CLRA 1U3YA 1ZLVH 5BVPH 4YVPA 2ZCHH 3E2RA 1OD8A 4XVDA 3M17A 3N15A 4H0GA 4WFED 3U2IA 1W9PA 4QG8A 5I5JA 1T03L 1LG2A 3T71A 4QQUA 1JWMB 3N12A 1UACL 5DZ9A 1WB0A 4KK9C 3B2PA 3RU8L 4LP5A 4POZC 1IGYB 3W7PA 5T3ZL 3E3QE 3C60A 2CA4A 4LEEA 3SQMA 3RWIB 2C1OA 4U3XA 5HUPA 1KIPA 4BSVA 1E9LA 2ZOXA 2X1QA 1A02N 2VL4A 1JE6A 4JRXE 3DI2B 4G42B 3F62A 3C4UA 5FK9A 3QUMA 4P5MA 4YXKL 2IGFL 1IEBA 1Q6LA 2GJ6A 3CMJA 3ULVL 4ODSL 2VXTH 4TVUA 3MBEB 2HH0L 1S7SB 3TA9A 2OL3L 4KFNA 3TO2B 5JYLA 1P53A 7REQB 2ADFH 3TTYA 4DWHA 5J1AB 1HIZA 4PMJA 1KFLA 4P46D 2H9AA 4JY8A 1KIQA 3ARDC 3WUFA 1AKJB 2OZ4H 4ZAKB 4M4RB 1H3WM 3QWRA 3TX4A 4PWFA 1A3QA 1YHPA 1S9YB 3LRLA 3D08A 5GZOA 4H9ZA 3SCRA 1DQIA 3CDFA 4PJ9A 4ORMA 4ADGA 3HB9A 4QPEA 4FF9A 3FFCB 1OAKH 1A3RL 1E43A 2AQQA 4MQSB 3BC9A 4YEEA 4AGPA 1OCBA 2E46A 3DURB 2BSED 4AVKA 4BS0A 4HX1B 3NUKA 1RZFL 3WFEL 2X6VA 5GZOD 1NOFA 1POJA 2VISA 3T0EA 3PJXA 4XD6A 1A3ZA 1I3GH 3VFWA 5HA7A 3V4PH 3FFSA 3OL2A 1PSKH 4NQCB 4S3AA 3ZVVA 4NO0B 4XI5D 1X7IA 5TK2A 3SFKA 5K9XA 4L56A 1U8OA 1NU5A 1NC2A 1TPXB 3SDDB 1A3LL 2W07B 4GRMA 4H8UA 1NDTA 5FYLE 5D4YA 1RA0A 3NPXA 5KZCD 1IM9B 5LN4A 4Q58C 3BJ91 4KNTA 1BF2A 1ODUA 2Z93B 2O6CA 4PW3A 4GMSH 4UQCA 5DRIA 5KS9F 1QSFD 2EVFA 4OOUA 1JDDA 1R3IL 3N42B 1DQKA 5T1MB 5TDPB 5AG8A 3RIAK 5C8JB 1CVRA 1KM5A 4KCTA 2PETA 4IRJD 4K9JA 3G22A 3IDGA 4PN2A 1OKEA 3PL6A 4BH8B 1PW3A 5HDOA 4Q97A 1LEGA 1NAKH 4YL9A 5JHLA 1M7PA 4MNGB 3SPIA 3BP7A 1E9PB 1ID5I 1MI5A 2HNEA 3G0XA 4P9HH 2EP6A 3EJRA 1XUZA 3RM4A 3W37A 1K1DA 1V0KA 5CC7A 3DBXA 3EJYD 4J4PA 2FATL 3S37X 2VLLB 1GW6A 2YD5A 2VLJB 3F7RA 3OWRA 4YDMA 1NVMA 3QNFA 3CZNA 2VCAA 5KYWA 4YCPA 1LOSA 4EUPH 3WUWB 2EIBA 4UQBA 4OQTA 4HK3J 1TV4A 3MODL 2V81A 4PJCE 1LF1A 2ZX8A 2IMMA 3R7RA 2X6MA 1QHPA 3R10A 3FYOA 1E8YA 2AMXA 5D1XE 1VH7A 4I3RH 5DT5A 4EOUA 4FQPA 4IPNB 3GMMA 2Z7WA 2DKSA 3CD4A 4ODUB 1LJYA 1TZZA 4O4YL 1PKQE 1PD1A 1AXIB 3ABLB 4WO4A 4UANA 1HIMH 4NAFB 2D7TH 1YN6B 2QADD 1J5IA 2E6DA 3WIFB 1EJFA 1U22A 2JSFA 2M1KA 3S6CA 2ALAA 3EO0B 3L1GA 5BPPA 4LRNL 2CNZA 2I9UA 3SR7A 1QA9B 3FSVA 5I6PA 2Y07H 2K7PA 2VXNA 3GHSA 1W2VA 5ENWB 3VW3L 4I88A 4NGHH 2DJ4A 4EVNB 5F9WB 3ARGC 4OGZA 5D71L 4OWGA 1DHPA 3RL2B 1AIZA 3ZL2A 5DWUL 2A73A 3HC4L 4U7MA 4DVRL 5GS2H 4PGCB 3K13A 4C6BA 2X1IA 2V2WB 3A23A 1FNSH 3DV6A 4KUCD 4M5SA 3TO4D 3VFUB 1RPXA 3RFZB 4TR9A 1IQDA 3ABKB 4IRSB 4CA4A 1BZEA 4FFZA 4KI5F 2A3AA 3TLRA 1CFNB 5JUVA 1OLZA 5IBTH 3HUJF 1IGTB 3TCTA 2HT4D 3IDJA 1IKOP 1T66D 2H5UA 4BD4A 1KACB 3PWNA 3T4AC 3NQDA 3E5PA 2A9CA 1IFGA 4UM9D 4ZPTB 2PDQA 2VR2A 1RJRA 1K5NB 5EULV 2GDVA 5AC6A 1WWCA 3T7VA 3CZFB 2E5BA 3C2RA 5EGRA 4WI6A 2ZSWA 4US6A 2DIEA 4HT1L 4HA3A 4QJ5B 1FAIH 3ZZLA 4IGBC 4UM9A 1KCWA 4J8QA 4N20A 3SPHA 1QVOA 5I1GH 4O8RA 3W25A 1PFCA 4MKNA 2P26A 4NAQA 3W1AA 5DR5L 4BUHA 4GFTB 3IJSB 4FI7A 5T33L 3W23A 1E4KA 4XZ4A 1QNSA 1LYXA 1BKHA 3RWFB 3MRMA 3O8XA 4H5SB 5SWSE 4ETQA 5HI5C 2CBIA 5TD4A 2NX5D 1H09A 2FX8H 4J3TA 1R2SA 2NZ9D 4DN4H 3QI9B 3TSMA 1KFGA 1Q38A 5CLTA 5ICZA 3F7YA 4MGXA 4QRTA 2DMHA 4OAWA 3JWOC 3MVSA 4X3ZA 1TQVA 3EGXA 4JFPB 5J6HB 1YHTA 2GK1B 4RZKA 4KZDL 2VDNL 1H50A 1M2VA 2VGIA 4FQJL 3HO8A 4NI3A 4OBSA 4IL0A 3QJZA 4DBSA 3LEYH 3NQGA 3FS9A 3QUYC 1TJHH 1LO2L 4H26B 3H56A 1LK3H 1ZVSA 1BDYA 2VN6A 1N6QH 4XK2A 5D9NA 3VINA 1BVOA 2Y8VA 5D1QA 2WQXA 1LP9B 2QHRL 1AH3A 4J4KA 4BEQA 3MLZH 3HPZA 4XNBA 4GVIA 3UYRH 2YSSA 5CJXA 2BSEA 3ORJA 2QCEA 4G7SB 3GMQB 1CE1H 2WV8A 4IOSA 1NUGA 2J1ZA 4YO0A 2VDGA 3DMMC 4ZFZA 3QR2A 1RZGB 4JFZH 1AFVH 5HDBE 4QXTB 3UEQA 5EF1A 3JUZA 4L8CA 5DUBA 3SECA 1A4KA 4DUXA 2D8KA 4EN3A 5CBEB 5J5EA 1LWJA 3CXFA 4KX9A 4D9QD 4ZFOB 3LCHA 1F6AB 1G0DA 1KCUH 2V7HA 3LKRA 3UTPD 4ES8A 3MNDA 1QCWA 2YUZA 5AAWC 2OZ0A 4S2BA 3MSGA 5FL1A 1HXKA 5DD0L 2XETA 5AZEL 4KNSA 3VDBA 2W63A 2W5FA 2JJUA 4KROC 5GGTL 3T4YA 3LIZH 4CADB 3HMCA 3NZRA 3KPMB 2QSQA 3KRZA 4IT1A 5CLWA 1G7QA 1MFDL 2PYEA 1IWBA 3NCEB 5D1QB 4R9XA 5AAMA 3ORWA 4FFYA 1BD2B 1CQYA 3H9SA 3WMSA 1W54A 4AH2B 1XX1A 2PGEA 2DKMA 3QV7A 5D04C 1K8IA 1UJ3A 2YB4A 1FNFA 1XL6A 1YMHA 2XBZA 2PCYA 1FGNH 4QXGL 5TQ0H 1HP4A 4PRAA 2HNHA 4GUIA 3IU3B 2OJEA 3W1XA 2HMID 3ZRFC 1BMWA 2R0ZL 3CNKA 3P2BA 3PWGA 1A7PL 5GS3A 3V0VA 2FD6L 1NCJA 4ZQOA 3S4SA 2R29H 3EOUA 5BO1L 1L5GA 4DOHB 4Y5XB 2RJHA 5TK4A 3N2XA 4RH4A 4MWAC 1OGAA 2B7DT 5HI5D 1WAUA 2VLKB 3N2JA 4FXRA 1EXGA 5EMJA 1GW1A 1QO3A 1SZEA 2OZ4A 1NKRA 1IV8A 4QITA 4YK4C 1UZ1A 2FO1A 3AU6A 1IC1A 4PJAE 2E74C 3UBGA 3FTGA 4P0DA 1VGEL 1Z9SA 4UINL 2QS8A 1NC4B 3G1VA 3S1XA 1YO4A 5EFIA 5D93C 5H91A 4GLEA 5AOLA 3VNMA 4X0NA 3M64A 1E6PA 2DW6A 4FS9A 1Z9MA 3TA3A 3W39B 1E6QM 1HGYA 4J27A 3U4AA 3SGZA 1OBAA 3MNMA 3OZ9L 2HVMA 2Y70A 1U8CA 3P77B 4JHWH 3G1AA 4YR6A 2DIKA 2A99A 3BXNB 1L9NA 1KTKE 5HDQH 4NSKA 3APTA 4ODWB 1GVOA 2IGFH 4L9XA 1FWCC 2K45A 1AJ7H 2WXRA 3KDMB 4JPKL 2PLTA 4ODSH 4U28A 3E1F1 3F1QA 2CQVA 3D12B 4BYHA 4OUEA 1PFOA 5GS1B 5DMYA 2CDFA 1QMLA 1OPGH 1AVAA 2C9PA 2HT2C 3LKPB 3APDA 5D4HA 3P67A 4NO3B 1RKRA 2WJ5A 5CP3H 3OGRA 4US5A 3QPQC 3MNVA 3QC3A 4PMOA 5AW9B 3V5HB 2G4EA 5DURD 5BUPA 3BN9C 4APXA 3ULVD 3FSUA 4UCGA 5KG9A 4M8VA 4M62L 4XMTA 1F05A 4P5TA 1JFQH 5FAJA 5EA9A 5ACZA 3BIAX 1JCYA 4JDBA 2D0FA 2OW6A 1N19A 2F6UA 1UWGH 1U8QA 2WLIB 4KPHH 4BZ2L 2X4NA 4XVTL 3RVVC 4HCRL 1AZNA 4XO8A 4OJFL 5FWRA 5BS0A 4JFUA 3MLXL 5KVEH 1UUNA 2XZ7A 3CH0A 2XPGB 3SEPA 1JGUL 1LM8V 3T2NH 4QTFA 1P5VA 1FZJB 2DWDA 4FF5A 1N18A 4U1JB 3BOVA 4XMKH 5AVZB 2QDDA 2NY6D 3I75B 5FOJA 2P5WB 1GZJA 1X6NA 3C5ZD 3CSYB 4PRDB 4ZO7A 4OZIA 4RNIA 1M6OB 1WDRA 2AFNA 5DSCA 3GNRA 2AV1B 2ZXDA 3U2SA 5E93A 4CU6A 2CALA 4L37A 3O3RA 1T80A 4M6PA 1NFAA 1E6SM 1O5RA 4OIAA 1ETZB 1KLYA 1UW9A 2Q0ZX 5E2TH 4FFZL 3WY3A 4MS8C 3T9PA 4ZEPA 1A3LH 3BAJA 3MRQB 4N0RA 4QLRA 3OG6B 3EGJA 1EYEA 1OCJA 2YL6A 4UTTA 1NDGB 5FO8B 4RAUB 2CPCA 5C7XL 1EMTL 3TC6A 3DX0A 4IHBA 3BP7B 1ZHNB 3F6JA 1QT1A 5K7JA 1G9MH 3RY6C 2EILB 5LB1A 4HNCA 5D2NC 4AQ8A 3HZYA 4DTGL 4LVDA 3UR7A 3U7YL 3NQEA 5HNTA 1NGYA 3LHYA 2RQ8A 3REWA 1FL3A 3MUZ1 3P54A 2W67A 3R5EA 4K4KA 4PTMA 4NM8H 5D96C 1Q9KA 5FA4B 4J28A 1OWWA 1HHKA 2RB8A 5CSZA 3WFDH 1NFKA 3B9DA 1YYCA 5BRQA 1YYMH 1W3IA 4UUJB 4X6BB 5ERWA 5E24E 5GSRA 5CBAA 1NPNA 4QHUB 4UFLA 3NABH 4U1SB 4LBEB 1OK8A 4W68A 3GXFA 3QS2A 4NUMA 4AVOA 3UABA 2F7QA 1ZWIB 1YRKA 3MODH 3QHZH 3FA5A 4U10A 3PGDA 1GTEA 1X5JA 4WTWA 3RUGB 3KM8A 4L4OA 1LDSA 5E1GA 4OF0A 3V75A 1T21A 4QYAA 2Y06L 1AXTH 3NIFB 4H1ZA 3TBTB 4HGWB 3NL6A 3P0VL 3H2MA 2Z31A 2ADJA 3LQAL 3MUGA 5IW6B 3MPCA 4UT7L 4I77H 2GJRA 1E6XM 1E9ZB 5XIMA 3UR2A 2D3NA 3QRGL 4KZ0A 1E5CA 4KZEL 1FH7A 3WMPA 5DD1H 4H83A 1JNDA 1IBFA 3R1ZA 4CEXC 2YAHA 4BSWB 1W3NA 5EHFA 3KPPB 5AECA 5JNYB 5TAOA 4DXKA 5ITBL 4GHRA 1TSHA 4OH2A 4HFUH 2ATMA 4TNGA 5E4IA 1O6TA 3OMZA 5HGDB 2GI0A 1T8QA 1BXXA 1GJPA 4A8IA 2PPAA 5IQ7L 1HHIA 1MQKL 4UZSA 2OK0H 1HJUA 4NJGA 1OTUC 4WHTA 2V2XB 4FFTA 1N8WA 1OFBA 3FL7A 1BYPA 4OM0L 4P59L 3QFEA 3B3BA 3WY4A 1RBAA 4C56E 4LSPL 4CMHC 4L18A 4AJ0A 3NGJA 3IK2A 3LDBB 4FA8A 3TW7A 1LO4L 5CBBA 2UZXB 3GE7A 2VXSH 5J11C 4FNPA 2PP3A 3CAKA 4XC1H 3RDTC 1JCMP 1BX2A 6REQB 5AD0A 3QDMB 5HHNA 1QFWH 3TIEB 1IAMA 3W82A 2MKLC 4TTDC 4ACTA 1V08A 2V2DA 5I76A 3F03K 3D0VB 3GJFK 3L9BA 2MNRA 2Y6ZA 5A2KH 3MTWA 1RZ7H 1REQB 2QVNA 1QPKA 4XPTH 1EXPA 1TQCB 1O94A 2XDHA 5DHXB 2P88A 3P6LA 3DPBA 2G41A 1B9BA 2QJNA 5E0CA 3F4NA 2APBA 3LBOA 4JE0A 5HATA 1GKRA 3NEEA 3BI9X 1X98A 1PD0A 5LKNA 3GXPA 1KC5H 3NIYA 4LKCA 3T4AA 4B50A 2GY5A 2ISDA 3GK0A 5FJTA 1AGCA 1LK2B 3WQCA 3MFFA 4O13A 4HUVB 3PQYB 3K6SB 2MHAA 1W9BM 2VL5A 2ODOA 1L6PA 3ARDD 3T44A 5JHMA 5D9SA 1I45A 2Z65C 1ZHBA 4UR8A 3F7QA 4U0QB 3TV8A 2ESVD 3I9PA 4PJXA 5CPQA 4RESB 3GMRB 3ABZA 4MDJB 5HI4C 2PBOA 2XYCA 5DZOA 1QI5A 5INCA 4CDGC 3FO1A 1NZRA 1M4KA 3QIWA 4FNTA 1N6QL 2IJ0C 4F58H 3HE6D 5CZVL 4Q0XL 4YIQA 3SUSA 1DQQB 5LCVL 4KKCD 2VWTA 3NL3A 4GNVA 1DANT 5FGSA 2AXFA 4HPOH 3V5DB 3VWKD 5SWZD 3O06A 2QCDB 4KY1H 3D85A 3NPZB 4NFDA 3UAFA 3U46A 4GQPH 4HYWA 4P5UA 2PW1A 4F3HA 1GJUA 3V6ZB 3MBDA 1OZTG 4YL2A 3HMXL 3T2OA 1GGUA 4JFFA 5AL0A 5C9WA 1BZ7B 5JYMA 4YBQD 4FTVD 5C2BL 1QNOA 5BW7A 4RPQA 2E27H 3QEQA 2P52A 4Y1AE 4MMZA 4ELKA 5BXPA 1A2YA 1CFSB 2A6JB 5EU6A 4FI4A 3STFA 3BLIA 2NXYD 4XP6H 5F1NB 5MF5A 1MCCA 1SO5A 1NM9A 3DBPA 5IJKA 3VXSE 3F5WB 2YMXH 4WX2A 2D9CA 4UNIA 1VPYA 3MY9A 5DHYA 3MOBL 1CR9L 3OKNA 3FYYA 4LPCA 2YEZB 4H0LC 5EU6D 3KS5A 1VFOA 3BJLA 2QZ5A 2PSNA 5DLML 4F7MB 4DEPC 2X0SA 3QJSB 1UXWA 2AEPL 1DIKA 1DE4B 1MNUH 4FLSA 2KH2B 2XWBA 2I85A 3AAZA 1N6VA 3FT2A 3O6FA 4FLHA 1OP3K 4M6NH 2BODX 3FDWA 4OQ1A 1NL0L 3ZUCA 5E5RB 3ZT6A 5DMMA 4G2AA 3SDOA 2ITCA 3FTWA 1YPXA 1KXHA 3QORD 4Z1YA 2P5EB 2DEWX 1I31A 1FWIC 4LOCA 4B5TA 1FNHA 1A6TB 5BO1H 5C0BB 3IUHA 5FYKH 1Q2SA 2CIKB 3OQEA 4PP2B 1MPAL 1QSVA 3TNOA 1K6AA 4L1LA 3OKNB 4LASL 3JVFC 5H35A 3IV8A 4Q4QA 4M6VA 2ZWNA 1XBVA 5HDBF 1ZHLA 3BVVA 4UM8B 4ANUA 3S2JA 3VXME 3VX0A 3DO7A 3MJ9A 1W1PA 1PS9A 4KTDH 4OF8A 3AYRA 4RZ5A 3MUHL 5AYBA 4GUPB 1FIEA 2CR3A 4X8JB 1F76A 4KHXL 2ZXGA 1B0RA 3SKOA 1Y1UA 3B3IA 2C7UB 1AYOA 1VBRA 3EKZA 4PGBB 4WKZB 1CGTA 1MEXL 1GOMA 4ILDA 1R3WA 3UTSE 3H2AA 3W6LA 2YFNA 4DZAA 3WGUB 4W84A 1KFJA 2ZWSA 1S39A 3D3AA 3XINA 4LHUA 2VR7A 1JUFB 2K6WA 2NT0A 3RZCA 1OF6A 4I87A 3PZOA 3RTLA 3WFZA 2VMCA 3WYRA 3SKJL 1OK6A 4UV4L 4E42A 3TA6A 5E4OA 4JCLA 3APMA 3UWQA 4FO4A 4B4FA 4QSFA 4ZZ9A 1MAMH 3PFUA 5AZ2L 3NT0A 1FH9A 4PJXB 1NGPL 3RZCD 1VACA 1DLFH 2HISA 4ZQRA 2XPYA 1Q6RA 2VNCA 2X5PA 2A1YA 3HLKA 3L16A 4Q8TA 2Z2UA 3BDXA 3QEHA 1CLZH 1U41A 3RJOA 2Y89A 1QWHA 3MU7A 5D7IA 3PQYA 1GG1A 2J9XA 4DGVH 2AP2A 1DVZA 4EN2A 3O3AA 3HA1A 4AFYA 1EDTA 4PB9H 3A5FA 3RPDA 1OOAA 3G6JF 4ADTA 4ELMA 4L05A 5K9QI 5DRXB 1FWHC 4K2SA 3S8GB 1CB2A 3DXIA 4AD0A 1PZSA 3T4WA 4B9KC 2CLFA 2BNUA 3KHDA 1BGAA 4S23A 4LYKA 2BZDA 3IFNL 3DPBB 5E2UL 1EQPA 3KBEA 1SOQA 5EUKB 1DFBH 5TIMA 2Y7SA 4Z7OE 4R26H 4RIRA 2XFFA 3FK3A 3P60A 2WBGA 3GHPA 4NKDB 4ZCWA 3NA9L 1OP3H 4RWYH 1R24B 5D7HA 4GZEA 3M88A 4DVBB 3WF3A 1DYZA 4LIQE 3BQUB 2PEVA 3ZR5A 5CC5A 1Q6FA 3LRMA 2QV2A 1HTYA 4CKVX 4PJ5A 1K2DB 4ZSOE 1B3JA 4ODXA 3CFCH 2MSPA 3GKAA 4KO7A 1WTLA 5D93B 3CK0H 3TONA 1AL7A 2GSEA 3ZPDA 3QW4B 2B7NA 1EEQA 5GSVB 1KFAL 5ENLA 5DMGC 2YQBA 5C7XH 1OD9A 3EKGA 1CWYA 2LV4A 1A7OH 5IVXF 3SCSA 2DWEA 2TRSA 2R2CA 4Y4HB 3EYOB 3CZLA 3AZRA 2X4RA 2FYMA 4RDZA 3UA3A 5E6SB 4N2CA 4TLKA 4EBQL 2JELL 1TTPA 3FDGA 1YADA 4PB5A 5G2HA 1E7VA 3U7YH 2A74B 3C6EA 4MVBC 2F7IA 4KWUA 1LD9A 4JQXA 5EBAA 3VOIA 1F73A 4EPBC 3TAOA 5CH9A 5AYUL 1A8JH 1AH1A 2J7EA 3GS7A 4ZG1A 1K8ZA 1O7AA 3ZLGA 3DJZA 2X1UA 3TT1L 1CI1A 1VLXA 5HYEA 2WYZA 5I1AA 4MJIB 1ECEA 3HC0B 3NFPA 3VU1A 4MJ4A 4AVNA 3SKNA 2IXQB 4GBXD 1DL7H 5IMMA 5LBSL 5IFJA 2CDEA 2YD9A 1U8KB 1GTNA 4I1NB 4NENA 1OYAA 4NZ4A 2DW7A 5D7SL 5IEHB 3MCOA 5FC9A 4XMVA 3HE6C 1VHNA 3U1SL 5HYJB 35C8L 1XZ0B 2WXNA 1WX0A 3CFMA 1VERA 4NN7B 3E8VA 2WVTA 4TOYH 1LQ0A 1BAGA 1AY1L 4HZAA 4JM2F 4X5QA 3E3QC 4DX3A 3ZDXB 1NEPA 1OTTD 2Y06H 3ECBA 4QRRD 3M7OA 1RHCA 2OMYA 1YSOA 4FOUA 4FA3A 4OCNC 1EJSC 2H7WA 4I77L 3TN0D 4PJ8C 4R7DB 3VG9C 1RVFL 5EDSA 3GNPA 4J3OF 5GNZA 4ODTH 2XYBA 1I8LC 5DC4B 5LIKX 2MNWA 2Y72A 3TVMA 1XLHA 4AEIL 1K4HA 3PP4L 1Z32X 1GIGL 3PPFA 3MOAL 1HOCB 1KT2B 3BISA 5J13B 2JEPA 1R6VA 4KK8D 3NZHL 1BXCA 4Q22A 4K5MA 3UZEC 3GG8A 4XTIA 4FALA 4U6XB 4AY0A 3QFJB 1EBAA 2OK0L 1BVZA 1TXKA 4HB7A 1M05B 4KJWC 2XWJA 2CK2A 1JHLH 2O0TA 2VDKB 1NUFA 2BJML 3GUTB 3FBKA 4M8RA 4CN4A 3QXUA 1OIFA 1SDAB 3BWSA 1OQOA 4JGMA 2HV5A 1QASA 2FIKB 1DBAH 1MLCB 3NIFE 4JO2H 1T6VN 3S4SG 4FFVC 4N8UA 5I1HL 3W7GA 2BFGA 2R4SH 3QDGD 2PDPA 4H88H 3UD6A 4UTUA 2H45A 4YSSA 3OF6D 4I1PA 5JH2A 4IBUA 3LERA 2P5ED 1C5CH 4FQ1H 5DJCA 1CICA 2ZUMA 3TOYA 3ATBA 1NAL1 2P5WA 3EHBD 4XP5L 3T3ME 1SGJA 2PDBA 4LCQA 1JCXA 3NYDA 4XCEB 2VJ8A 3INUL 2UUDH 3QDGA 5BU6A 3BYTA 3OAWA 5T1LD 2J44A 3RVVD 4CC1A 1NFIB 5K1VA 4JHAL 3AT8A 4Y19D 1HXMA 3WFHA 4LAZA 5AZ1A 3WLBA 2J8GA 3AW5A 3NJ3A 2XFYA 4Z7IA 5DEJA 3H4HA 4HUKB 4P4KC 3IJ8A 3BPCA 5LDSA 1EB3A 4TUKL 1WCGA 5A6BD 5LA2A 1AW1A 1ZV2A 3MDJA 1AZZC 4GBXB 5GIRA 1T41A 2GVJA 3NG3A 3O1NA 3WJXA 3ZYZA 5BWAA 3Q8CA 2GJXA 3DVFA 2Y5JA 4P2OB 4BZ2A 4IWWA 2AAMA 3M0YA 2XIJA 5CC3A 1T6MA 1UH2A 5I6NA 4LVNC 4ZMXA 2ERJB 4MA3B 4EMZA 3MT1A 2GJ6D 3KHOA 1LO3L 8PAZA 4YXHL 1GCFA 1XYAA 1FNGB 5JMOC 1DN0A 4W8BA 4TQHA 1TKKA 3B6SA 2E7MA 4AL8H 2UZYA 3KPSE 2IWGA 3B5GA 3FCPA 4FF7A 4O15A 4WDUA 4EX4A 2FGWH 2JQMA 1NGWA 1SZNA 3AWFA 3NDYE 1OCQA 1HT6A 4JFYB 1TB3A 5H94B 3FJNA 4DWSA 3D47A 1ZAJA 1VRXA 1GK8A 5A6KA 1F00I 2X89A 1KGWA 2BP5M 1LO5A 3CDGB 1UURA 2YGNA 1T7XA 3QUYA 2W60B 3E6FB 2MMXA 2Y69B 2CXGA 3NP3A 1NCTA 4P49A 5I6KA 4GCAA 4ZFMA 4JFEB 2W81C 3TZNA 4FXTA 3USZA 1FFPB 3KP1A 2HEJA 1YLVA 4HS3A 2XG5B 3HNVL 1SW7A 4DI9A 4MYWB 4NWTH 4X6FA 4RFEA 1UPMB 2OZTA 5KTEH 3L17A 3QUYD 1AHWC 2GCYB 1E0XA 1CDHA 1XSKA 4WUUB 1KG0A 1JV5A 2WO2B 4QHKI 2Y7EA 2ZYIA 4AUUA 1FUNA 3CUJA 3ANVA 1MJ8L 5LQBH 4O54A 3HI6H 1UR3M 3G6AA 3DUSB 1HILA 4PR4A 3WFCL 1TCRB 4JTJA 4IOSD 2AEPH 3OYZA 1ADOA 3G5VA 2C4FT 2QJDA 4YDVA 4TTGA 4KQ4L 5EN3A 2ISVA 4HYVA 3Q0HA 3RVUD 3TGXA 1W0VA 5IBXC 1OYCA 3FCSA 1F86A 5KOMC 4R4BA 3HE7D 2XH0A 4BJLA 2E4TA 2Y5SA 1SO6A 3ZGIA 1F9CA 5MP6L 3I7QA 3TWCL 3HKFA 2HK1A 2E40A 3CVIL 4PCSA 4H1LH 2CZDA 3MXVL 4WK9A 3NOYA 3SPVA 1EC8A 2XA8H 2NW2A 5KYXA 3BWWA 1AO7A 2V17H 4GLRH 5CGMA 1H1NA 5ISZE 5DMLA 4XCFH 1FLTX 3FRPB 3PDOA 4L3AA 1HFBA 3B8VA 3H42L 2X4OA 3VJ6B 4Z0JA 5FGCB 1MZZA 2AQWA 5GZNA 3CQHA 5ACLA 3ALWA 3ILPA 3VIHA 4LHUG 5DJ6A 4ZFOA 3AQXA 1CL7H 3ZJAA 4UNTA 1RALA 4PJAB 4N8VA 1A4KB 4PMEA 3TJEL 2P3YA 3G9AB 1H7OA 2C1GA 2R24A 3C6CA 4E4PA 3GLZA 1P6AB 4UT6L 1SLWA 2YBRB 4NPYB 4LB4A 1MCDA 4D0CA 4MMZC 3A3XA 5GZND 3AG1B 4Z7QE 1SLUA 4L7ZA 3LOTA 4NZ5A 2Y5TB 1YTEA 3RL1A 2J74A 1GZQA 2DGAA 4LSVH 1OFAA 3G5XA 5CP3A 1FWEC 2X3AA 3B5TA 4UV4H 4FG6C 3UO1H 1ZVSB 3MNZA 2Y63A 1E42A 4H26A 1FFQA 2AJUL 2NVCA 2C13A 4I48B 1MAML 3QUZD 5ESAB 4BWLA 2DT3A 4BRVA 5JQ9A 4LLDB 2VSMB 1JCJA 4IRSD 4WEUD 5EL1A 5JW4R 3DDFA 4PRHA 2FX7H 3SSJA 1EHKB 1P9MC 1IILE 4RGOL 3GD6A 2QELA 1QKZL 3GHEL 4KXZH 1UWYA 2ZF8A 4RGMC 1MFBL 1FYTE 4G43B 1EFZA 3W72A 1KM3A 4IBSA 5I2UA 1QW8A 1AJ0A 2F8IA 3DYOA 4DGYL 1UZ4A 1BGXH 1U8NA 3M07A 4TLSA 5DC0A 2IAAC 2H4EA 3NSXA 3Q6FB 4EE2A 1GQNA 3TO4A 1OGTB 1PLBA 4Z0SA 2NNAB 2W8CA 5DK2B 1N7MH 5FSEC 3NCMA 3GMPB 4X4YA 2IF7A 3PTMA 4XH2A 2K4WA 1TVHB 2FQFA 2XRAH 1CU4L 4MD5B 1OSYA 1AZUA 2VZOA 5I66B 1KJ2L 1H0DA 1ZT4B 1FCCA 5CEZE 3QMTA 2Z35A 5T1LA 3CZFA 3NA9H 2VM4A 1B0GA 1S5HA 2CO7B 3HPSA 1DO5A 3KPQB 2NXGA 4JTAA 2LLEA 5L88L 3MUJA 3GVGA 2A6KB 3P5ZA 2ED6A 2JB5L 2VDPB 4TNVK 5LNEA 3X14A 2DH3A 4NQEA 5JORB 1SR0A 1TU2B 4LBSA 1MXDA 4QWWD 1JEZA 4NZJA 3QUXB 3PWPA 4P5TD 3ULUL 3WEMA 3UZ5A 4LGSB 1A5MC 4JQIH 2V30A 4WWNA 3UC2A 1T1WB 4N2IA 3P11H 4YHZH 3BP6B 1W1B1 5IWLC 3K74B 1WPCA 1I8IB 2LHAA 4OF6A 4ZQKA 4N9GB 3Q1SL 5JIHA 3N18A 2I17A 2HFGH 2E9JA 3NJLA 3V6BR 1XH2A 2A6DB 3HW7A 3N0PB 2NX5A 2RD0A 2IOIA 2VX5A 3EHBB 2ESVB 1OX5A 2XXGA 3CO4A 4GKTA 5DK2A 4WSJA 4MAZA 1PVHA 4G8GD 2WYHA 3BUTA 4YDKH 1F5ZA 1G7VA 1KBJA 1S7WA 3BUDA 2GK2A 1L4IA 1BCIA 3MBXL 4KKXA 1JXKA 1Y0LB 4LB8A 1A4JA 3RNDA 1IXPA 3W2NA 3UACA 2FX9H 3PNRB 5FYLH 4ZA0A 1VIZA 4IP4A 2V5TA 2IPGA 3S2MA 4JG1H 3UL4A 1S7XB 5AN7A 2RDTA 4ZTEA 5E9AA 3VKBA 4W9DC 4XB3A 3SQOH 4QJ3B 5DK0B 1SHSA 3HPLA 1KXTA 4L8BA 4XE5B 2D31B 4DF2A 1RY7B 3CX5J 1XXFC 3N34A 2HLFD 3SOBH 4KO6A 1DP0A 1IBGL 2FJSA 2A77H 3X11A 1G7UA 2CKRA 3TFKD 1XYBA 1YLBB 3BOLA 5KYWB 5EPDA 2ZYFA 1HXYB 4LOUD 1F3JB 1LDPH 2NMSA 5BVJB 4UFKA 4B9JA 3W7IA 2RAMA 4WEBL 3WJZA 1D5IH 4A55A 4IG2B 3EYVB 1FO0L 2J25A 1E28A 1A9EB 2FVNA 3WMQA 1E9QA 4MF4A 4Z76B 1MIML 3NZHH 2B3IA 2BRRH 3PF2A 4JDVA 3KWSA 4NSBA 2ID5A 3HRZA 3W6MA 3WLLA 2A83B 5KBMA 5KVMC 4IS6A 3THML 2FFCA 5CC6A 4C59B 2VLMD 5HHVH 5IB3A 3BP4B 3E2HC 4MASA 4JREC 3QYMA 5HJLA 3AU0A 3IGKA 5CAKA 4P8WA 4Y5VC 4EQ2A 4JQ4A 4LIQH 2X4QA 2AMUA 3WIAA 1C3FA 2TYSA 2MCG1 1Z89A 3CLMA 3B9KA 5BWFA 2DQIH 1FVPA 4CNPA 3QYCA 4H88L 3RJQB 3GTFA 1CZ8H 4GXPA 4NUWA 3NH7H 1G1CA 5ADPH 4A22A 1A9EA 5CMAB 2YJLA 2PO6D 1I7UA 1DKWA 1TPFA 1C5CL 4PVBA 1US3A 4WGHA 2F19H 1ML1A 5E4EB 5I5MA 4AMXA 1MCRA 1E6ZA 2RHGA 4FFWD 1LE9B 3NPUA 4Y2OA 3KBJA 4AENB 3V16A 2F61A 1AQKH 2XM1A 1RCYA 2ZXWB 2AXHA 3FFCA 2CLHA 4P8QA 4L6HA 1RAKA 3B06A 2EH8L 4NN7C 4YE4H 1ZGDA 3UTOA 3CPUA 1U33A 3P02A 3QZLA 2CHZA 2VGLM 1I1WA 1VFSA 3TROA 2PYFA 4WFFD 4NP4H 5I19L 1KYOJ 3PTKA 3BH8A 4MKMA 3GIVB 4PRHD 1TYRA 2BCKA 4U1NB 5LGYA 1E6OH 1S7XA 5HY9B 3MV11 3DHFA 4Y9MA 4O50A 2NPLX 4O02L 4PJ8B 3BKML 1QBLH 2G5WA 3VX1A 5K4ZA 1OD7A 4I6VA 3OKYA 5LIUX 1TJRA 5DO2D 1UXSB 4GG8B 4U3AA 4R6UA 4ZFGH 5T3XE 1AH0A 1D9EA 2B08A 4JFYA 3ES8A 4G82A 1IQWL 5IG7A 5CEZL 3I6LD 4AZCA 3KWVA 4HZ1A 2QBWA 4XNZC 1N5YH 3QCUL 1XIIA 5AW3B 4BUQA 2P9RA 3ABQA 2PWVA 5JQ6H 3ETBJ 4K3EH 1JZ3A 2C1OB 4LESA 2J24A 1CZ1A 4IBYA 3OJGA 1H6EA 3KXFD 3UG5A 4F24A 4GH7B 5A40E 3SCQA 5EWIH 1VACB 3K1GA 3WIHH 2IV9A 2QVFB 4OFIA 5FW6A 1C93A 4KT2A 2GLKA 3CZEA 4XGZA 2DQFA 3VOJA 1PWLA 3OKKB 1KGJA 3W0KA 3IBEA 2VXQL 1YTKA 4Y19B 1P7HL 3L2MA 4UZGA 3NTCL 5AHFA 5GRZA 3WSQL 2XDFA 1U36A 3T78A 4MS6A 1HZHL 1XLAA 3QI9D 3VIMA 3F7VA 1VFUA 4NWTL 3D46A 1CT8B 1JAKA 1BEXA 4OBTA 4LCVA 3WLPA 1TE6A 2WLYA 1UD5A 3KGTA 4FNQA 3PNWB 1M7DB 3DUUA 3MZGB 4ZS7L 8A3HA 5I3HA 4YGVA 4OHQA 3GSNB 1V3KA 1KCXA 4HCDA 4CCCA 25C8H 2DRUA 1OB0A 3ANUA 4NY2A 2HTLC 5E6RB 4X4YB 3LCGA 3ARYA 5LZLA 4TX8A 4M3HA 4LE8A 2WMHA 1U91B 3WL1A 4F2EA 4PR5A 4A67A 1H3GA 2DEXX 3FXGA 2AC0A 3HG1A 4LF2A 3VC5A 5C54A 4G8GA 4JFDA 4AE1A 2R0WL 3AGWA 4W6WB 4JFFD 3QWNA 4JFTA 4Z0XA 3OA5A 2Q8AH 3BE1H 4S3FA 4MNJA 4NZFA 4XTRD 5MP6H 5MEOB 2VFIA 4FG2A 3G5YA 4PV8A 4QTGA 1AHWA 4JN7A 3L23A 3T55A 3KP0A 1TDQA 3AQZA 4MNQD 5C0RH 1H5YA 1N8IA 1FL6A 3WBXA 5A6JA 1R3JA 1SHXA 4P04A