3H53A

Crystal structure of human alpha-n-acetylgalactosaminidase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 129
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h53A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h53A01
1ZY9A 3QM3A 4EOUA 2A5HA 4R53A 3DXIA 1HFBA 1RQBA 4MLRA 3GXDA 5L6UA 2J6XA 3DX3A 5F4XA 5K3VA 1A5BA 1EIXA 1SW3A 3LHVA 2XVKA 1T0OA 1VHNA 4IPIA 1KBIA 2NXGA 4Q33A 1OYCA 1EA0A 4O11A 5LSMA 4PEKA 1UASA 1TPUA 2YYUA 1ZAIA 1QI4A 4CKQA 2CU0A 4K36A 5IBXC 1Q45A 3NNTA 4CQ9A 3DFSA 3HPSA 4NT0A 2CFFA 1XD0A 3LHWA 3MI2A 2ZZ7A 3SGZA 4IMDA 1TYGA 1CXHA 4IMGA 4WSKA 2V81A 4RXFA 5EPDA 1UD2A 4I7UA 3GXFA 3NPXA 2BXVA 3A23A 4HOWA 3VE9A 4UFMA 4LVGA 3LXCA 1A5SA 1PL9A 1QPRA 2OYMA 1EA9C 1KCLA 2ZXDA 2YZRA 5KSWA 1LRNA 1JL8A 4GC4A 1HWWA 4LS2A 5D30A 3JR2A 1AW5A 1GVQA 1ZAJA 1EWDA 4GQQA 1NVMA 3MMTA 3IVTA 1F74A 3DI1A 2QR6A 2BHZA 1B2YA 4HA1A 1LDCA 5F2MA 3N34A 2D3NA 1V3JA 3CEUA 4O15A 4DQWA 1KM0A 4ZVJA 1F7BA 3LCXA 3FJLA 2ZFAA 1OSEA 1QR7A 3EB2A 2AGKA 5D02A 4U2ZA 2PWFA 2X2JA 2A21A 1V7YA 1TQUA 3NXFA 5KZEA 3WK1A 2VNCA 1VGAA 1EEPA 1Q6RA 4H8UA 3B06A 4R7JA 1QW9A 4O10A 3WFAA 1FCBA 3VM7A 7CGTA 4RR4A 2QUTA 3P7YA 1T96A 1MXSA 5CZSA 3JS3A 1QPNA 2I14A 3G0XA 3W1AA 3G24A 5D2VA 1JDCA 2J9XA 2QAPA 5AYYA 3WFZA 3MBDA 3TTYA 2YFOA 1F2JA 2G5WA 1UCWA 3NQDA 4L4LA 3TC6A 5KTLA 3UWVA 3DFOA 4AIEA 1CGUA 3B0VC 1IGSA 2CLOA 3LDVA 4WF7A 1FCUA 3S42A 3TONA 4MJZA 1GJWA 1JI1A 4H8VA 3AJXA 5H2ZA 5EBUA 1UOKA 4JCMA 8CGTA 1K7XA 4EVZA 1FXPA 4HOXA 3A9IA 5I0DA 1P0NA 3WY1A 4UQDA 1NM9A 5U7SA 4DPQA 3RMJA 1VYPX 4A2RA 2V2HA 3W2LA 3RU6A 4AEFA 4ZQPA 3QFEA 3QYQA 1AMKA 1EP3A 3BUBA 1M7PA 4IXXA 1KBKA 1KXTA 1H7WA 3VMNA 2EAEA 4O1CA 5AN7A 3VCRA 3WNKA 5DCDA 2EO7A 3CHVA 5DCEA 3BW4A 3LCHA 2E68A 3INPA 4ZL1A 3R2GA 1LZOA 4IPJA 4ZQNA 3R8RA 2ZUTA 2I9EA 2R94A 1QNVA 3G0UA 4IOTA 1WO2A 2EKCA 3LOTA 2GOUA 2Z2UA 3FKRA 1PHWA 4HP5A 2PWDA 3WDJA 1H62A 1QPQA 1UB3A 5LNSA 4ALDA 3GZ3A 1OG0A 3L2IA 1Z32X 3FYPA 3C3NA 5DCBA 5FEWA 4O57A 3MWAA 5A8GA 4MFEA 3PULA 3TA6A 1J2WA 1XXXA 2V3EA 2WKGA 2YSWA 1QCWA 2O7QA 3PS7A 3MP4A 4ATWA 3QSTA 4LUIA 1QPOA 3TIMA 1ME7A 5AC6A 1KB3A 1PIIA 3VI2A 5HWMA 2G3MA 2H3DA 5D09A 1SFJA 2D73A 3NA8A 2Y85A 2E6AA 3IVUA 1MXDA 1PHQA 5CG7A 1LWJA 4FLOA 3TOPA 4WX2A 3TSMA 1B9BA 1DEDA 3BO9A 3HGJA 1KFBA 4WY0F 1AVAA 3NQ8A 3P84A 2V3FA 2CHNA 1J5TA 3W23A 3CV5A 5D05A 4O16A 2GPTA 3LCFA 1UKSA 3M5XA 3TJXA 1G7VA 1RV8A 1TQTA 1VJIA 1TMQA 3IEBA 3LV6A 2CPUA 3ZWSA 2FTPA 2Z6IA 2XIBA 3D4YA 3UNDA 2BY2A 2X1UA 4GUGA 2PWEA 4M7TA 1LLWA 3BAYA 9CGTA 4N9DA 5EA9A 2H3BA 2QCCA 4UC5A 3TX9A 2CXGA 3TMLA 4X0NA 2DJXA 3VU2A 5AC7A 3NPUA 4WSJA 1G4PA 1GVSA 3G1SA 1IIGA 2F1BA 2WVVA 3UD6A 2QPSA 1KM4A 4NXKA 4CNOA 1CXEA 5G4WA 4CQ8A 3ZR6A 3L4YA 2YPIA 3N2XA 1WYIA 4BF9A 4FXSA 4GINA 1HO1A 3UWUA 1AQHA 4FLRA 3EWWA 4TMBA 3BAIA 2D0GA 3W7KA 2BY1A 5A2AA 3HF3A 5AHMA 2ZBTA 4FMVA 3BLIA 3CWOX 3RNDA 2H8ZA 1HNYA 4H8HA 3WENA 4CNPA 2QCNA 1X1OA 1UJPA 3KE0A 3GDKA 1GTEA 3TQVA 2EGZA 1OF8A 2VFIA 2YX0A 5E6YA 3LXAA 5C55A 1DQWA 4J28A 4TVUA 4JFSA 4JNMA 4O14A 3IIPA 1OGSA 4C1LA 4XQ6A 3U6WA 1OK6A 4J3UA 1W54A 4JR5A 4MLJA 3QRHA 4MY9A 3PC0A 1UBSA 5HINA 3HG5A 3MYPA 3FEMA 1ME9A 2YCEA 2GJRA 1U2YA 4X2RA 1EUAA 3PVFA 4PCSA 4O4WA 3G8EA 3W7IA 3I65A 5F2GA 3Q94A 2ISWA 4O1BA 1KV8A 4O54A 3L0GA 4QM1A 5AHEA 1W3TA 4GFSA 4KWUA 1JCNA 3LTPA 2QJIA 2QUVA 5KZDA 1CIUA 3HIJA 1NEYA 2A7PA 3I7RA 3Q37A 1JI2A 3LV5A 5LNWA 4LUJA 4D2JA 4RCXA 3W7NA 3TFCA 2YXGA 4MY8A 2ZRXA 2JGYA 4Y90A 1XUZA 4ORMA 1EP2A 3G1FA 3LHYA 5F2LA 3CT7A 3L2LA 4O4VA 4UCGA 5J5DA 3IVSA 1TQVA 4WOZA 3NL3A 1UUOA 1CXKA 3W2KA 3QEZA 2FH8A 3NL2A 3PR2A 3CTLA 4AEOA 2B7QA 1YXYA 5L9FA 3WJSA 3I6RA 4NUWA 3TQKA 2EABA 2NX1A 3UWYA 4NNCA 3G18A 1BVNP 2BHYA 3BUIA 2QCFA 4PSRA 1OFOA 5G2WA 3IJ7A 2WSPA 4J7RA 1JIBA 1KWKA 1I2PA 3GXNA 5LHEA 5KINA 2YGYA 2DU2A 2QMJA 3ABSA 1KLZA 1VQTA 3M6YA 4ONVA 4UTTA 1VCFA 3B4UA 1CGXA 3CZEA 3NQEA 3P5YA 4AXKA 1KA9F 3ELFA 5HDRA 3GKFA 3VGEA 1JQVA 3S1UA 3SR7A 3CU2A 3W7RA 2OW7A 2BY0A 1Q6LA 1K8XA 2J25A 2FFCA 1CW2A 4UIOA 3ZFHA 1OABA 2RFGA 4LV4A 3VNZA 5D32A 2TAAA 2R8WA 1S5WA 1JCJA 1JG9A 2ZA3A 1B57A 3II1A 1QPKA 2DZXA 4EF9A 4GBUA 3DFQA 3S5OA 4TX9A 1FX6A 5D2YA 2ZZ5A 3TKFA 3GK0A 3M5YA 2WVSA 2BXYA 4JFUA 4PEEA 5G1TA 2ZUVA 3GNNA 3FAXA 1K7EA 4ZQMA 1OT2A 1SQ7A 3LHZA 3TNOA 5CXPA 2WVVB 1A47A 3O15A 4J3WA 4GWEA 2E6FA 3NQ2A 1WE5A 4UCFA 2VEKA 3WNPA 1VCVA 3HZ3A 4NNAA 3M43A 2RDUA 1UD4A 4JFWA 4OV4A 2EADA 4JCLA 4TMCA 1TTQA 3GBEA 4MYXA 3W85A 5E1QA 2TYSA 2JKEA 2ABAA 3ABQA 2VRQA 3BG5A 3HJZA 5I5RA 1BTMA 2PC4A 4BI7A 2HMCA 5AOUA 3P60A 2C6QA 3NYZA 4JDBA 3OLEA 1TPVA 3GX9A 5HMSA 4LVBA 1QDSA 1XCXA 2DH2A 4ORIA 3N9RA 4X3ZA 3ABRA 5K2ZA 3A5FA 4JTHA 4KKXA 3TDFA 1MSSA 3RF9A 3L4ZA 4IUOA 1CXLA 4DO5A 3BVUA 3PBWA 3GXIA 2ZXQA 4KFNA 4ZQRA 1I2OA 4QAWA 1BWKA 1JCYA 1JJKA 4FHAA 1WV2A 2C13A 2TRSA 4JL2A 4U2YA 3UPWA 2C1HA 3TXZA 3K1DA 3VFLA 4AHQA 1IZKA 1FDYA 2V30A 3W2JA 2NSXA 3W7LA 2A1YA 5AYZA 2ATMA 4LVDA 4LVAA 2NUWA 2QMKA 2XVGA 2QDGA 1WBJA 1MO0A 1M53A 2D0FA 1Q3NA 2GJPA 3C2OA 3LB0A 1QWUA 3UG5A 3ATZA 2YFNA 2WC7A 3BGGA 1GCYA 2C0AA 3BAWA 1TPH1 3LRLA 3CB8A 2CZEA 1OT1A 2IQTA 2RDWA 3NL5A 2HSAA 2ZRUA 3A24A 1PIGA 5FF0A 1VS1A 4Y6GA 5A2BA 1WZMA 2NLIA 4Z1CA 3C2EA 3ABOA 3PB0A 5DBUA 3G0SA 4M8UA 4Z1BA 1W3NA 5AYXA 4HPHA 3VGGA 2VFGA 2F61A 3A22A 1YTEA 2DH3A 5E70A 2PURA 2P10A 2V0TA 1WXJA 2FQIA 4JTUA 1FWTA 4JD4A 2NX3A 1I8JA 4AWSA 4BFAA 5I23A 4PSPA 3LI0A 1UKQA 4UNLA 2A4AA 4U4MA 3W7JA 3MBFA 2GVYA 3P82A 1JVNA 3KRUA 3FKKA 2ZRYA 1UD6A 5CSRA 1JXKA 3PBYA 4JTFA 3P80A 3TROA 2YW4A 3ZT7A 2WSQA 2X1SA 4U3CA 4OKDA 4GI6A 3CPUA 3VE7A 1SPQA 3OBKA 4RK8A 4JFTA 3W1NA 3NQCA 1X6UA 3S1VA 2E8YA 1MEWA 4A3UA 4FLQA 3TV8A 3G22A 2IGTA 3EJTA 1I2NA 4CCDA 2P0OA 1O94A 3TQ0A 1C8VA 3H54A 2GQAA 3W7QA 4J3VA 4YMZA 3WNLA 2QEZA 4UTLA 3BLFA 1GEQA 3VKJA 1G1YA 4UFIA 3OIXA 1ZHAA 1XUUA 1AG1O 3TH6A 3NZRA 5E93A 4S1FA 2Q3OA 5AB3A 3M44A 1CXFA 1W37A 3L68A 1KM5A 3KAOA 3WY3A 1FWRA 2PWGA 4W93A 5AHIA 1UH2A 1TPB1 4PFMA 3ZT6A 4DF1A 4UTMA 2H90A 3BUPA 3AMLA 2ZCGA 2DIJA 1CGWA 1CX9A 1UH3A 4LQ1A 1OFDA 1N55A 1YPFA 3W07A 3BAJA 4KMQA 1PAMA 3B8DA 3BMVA 3KVLA 2C7FA 1Z41A 1FWSA 3RLVA 2C16A 3W71A 2ISSA 3S5NA 1NSJA 1KFKA 2VFHA 1IV8A 2OZ0A 5BMXA 2W6RA 5LZLA 3WNNA 3S8HA 3NO5A 3O63A 3DGRA 3M16A 2V2DA 1HG3A 2YDAA 1KM2A 4XKYA 1P6WA 3EKLA 1P4CA 2ZUUA 4OBTA 4Z0SA 1YLVA 3W2NA 1UD8A 2ZX7A 5I3KA 2CLMA 3PSWA 1TTIA 3W2MA 3S2CA 1JUEA 1R30A 4Y9AA 1PZ2A 2XN0A 3UZ5A 1W8SA 2XN1A 1LP6A 3E0IA 3W1MA 2F1AA 1BLIA 2FYVA 2A2IA 1GZGA 2F7RA 5IM51 4FO4A 3VX1A 1KTBA 2AQWA 4MVAA 4FNUA 1L6SA 1YTDA 1RQHA 3D4ZA 2ZWYA 5F1VA 5K9CA 1KW1A 3CZSA 1H60A 4GIAA 3E49A 2V3DA 3GR8A 3HG3A 1LTDA 1H50A 3N19B 1GJPA 3DU0A 5HR6A 2P1FA 5TQLA 2E5CA 3IK2A 3ZOAA 3S5ZA 1F76A 2ZTJA 2DORA 4GUFA 3LCWA 1EHAA 2OSYA 3UZJA 1LOLA 3EWUA 3BAKA 1VFOA 1XC4A 2ZZ6A 3NQ7A 3W76A 3W38A 3M07A 4YXGA 1UD3A 2QUUA 5EL1A 1FCVA 3EJQA 1WAUA 5CKSA 2CZ5A 1QO5A 3SIZA 2WVTA 1TPWA 3DHFA 1I2RA 5HXMA 4JL1A 4N9CA 3LLDA 3OVQA 2WNNA 3FLUA 2E8ZA 1H1ZA 1I45A 1KGXA 2QF7A 3PBUA 4MFDA 1RP9A 1JCXA 2E1DA 4H4IA 3EKZA 1CYGA 4UFHA 3O07A 4M5PA 1MXGA 1EP1A 3PM6A 3GTNA 3KL0A 2F18A 4Z1DA 4CNNA 1ZJIA 3AJ7A 3P8JA 1BPLB 1ME8A 2FB3A 1LOQA 5LNRA 1LCOA 2Q8LA 2NX9A 5FF7A 3O8AA 4JEQA 4LV9A 1ZENA 1QWNA 2X2HA 3CTTA 2E4TA 2X2IA 4OIFA 3GKAA 3MO7A 4OT7A 3QMRA 2FHFA 4OE7A 2ZX6A 4N4QA 3FA5A 2G96A 1SW7A 2GQ9A 5TBOA 3MP5A 5AHLA 2NZLA 1DV7A 4BWLA 1TV8A 4DBDA 2Y7DA 3D52A 3GNDA 2VC6A 3IGXA 3PUOA 5BRBA 1QOPA 1XBVA 2QJGA 3Q2DA 4NJJA 4QSHA 4MYAA 4UNIA 4HKPA 3S5YA 1QHPA 4R34A 4RZ6A 4TIMA 1E43A 4O18A 3H55A 3G1DA 1KTCA 4AYGA 3M41A 1P5BA 4ZMGA 4M6VA 2Y7FA 4N9BA 1JF5A 5DXXA 1RPXA 4AEEA 3VGBA 1VLIA 2DJLA 1SSGA 3D50A 1GG1A 1DKWA 4X22A 3W7CA 2GVJA 2WV8A 5LHFA 1IXQA 4P2VA 4A2SA 4PC8A 5K7JA 1L0PA 3MI6A 2D2OA 1O7DC 3NM3A 3HB9A 4AYSA 4O50A 5DELA 1JD9A 1FCQA 2NV1A 3GR7A 1W3IA 1KM3A 1FWNA 3D51A 1N7KA 1OFRA 1TV5A 1YTKA 3BH4A 3L4TA 2XIIA 4NXSA 3IIXA 3N14A 4OWGA 2ZA2A 3BARA 4MUZA 2Y5EA 1W56A 4MKNA 4IX0A 4NU7A 1JRCA 4UTWC 4DF0A 3BAXA 2NWSA 3PG9A 2JKAA 6CGTA 3DHDA 4XKYB 1S3HA 5LNUA 3NQ6A 1NF7A 1PCKA 1TCDA 3KL5A 1HVXA 2EACA 3QSRA 3S0CA 3MUXA 5HULA 3WDHA 1ODUA 3L9CA 1XSJA 2FH6A 1EPXA 1GVRA 4B9ZA 4GI8A 5FI8A 1PIFA 1ZALA 1EO5A 4DO6A 4WY0A 4JIQA 2EHHA 1IF2A 1WA3A 1H7OA 3PG8A 5G4EA 4HPJA 1IIHA 4N9EA 5F4WA 3BMWA 1EUNA 2V82A 3NAVA 1QHOA 1B4EA 5HQEA 3W72A 1TO3A 1TV7A 5FF4A 1B0IA 2GVGA 3BG9A 2BZNA 2RKXA 5KMYA 1YDOA 4RLIA 3A4AA 5DY2A 2NV2A 4GUJA 3UWWA 1D9EA 3BLBA 3G3DA 3GXMA 3WNOA 2VENA 2VFDA 4HSNA 4UMAA 1TQWA 2Q3RA 2A7NA 1HT6A 3UXDA 2KZHA 1HTYA 4FX7A 3HQ1A 2E5BA 1OFQA 3OA3A 3W7PA 5J5RA 2OJPA 2J88A 3QJAA 3KOFA 1BKSA 3TJLA 4W9TA 3L2MA 3BSGA 2YW3A 1HL9A 4M6QA 1M5WA 1XV8A 3KXQA 3W7EA 4OHQA 2YA1A 3NPWA 5DBTA 3N3MA 2EF9A 3EJPA 2CLLA 3HJEA 1O60A 4K8EA 3VNYA 3L0KA 2Z0IA 4AWUA 3M0ZA 1U33A 3NQMA 5DLCA 1K8YA 4RXGA 2C3ZA 5D2WA 2X2GA 4LNYA 4UFLA 4O17A 4ADUA 1YXCA 4RV8A 3L4WA 2DZVA 4LPCA 1W5QA 1DHKA 2WSRA 1N8FA 3DX2A 2Y70A 3L66A 1DHPA 3G1YA 3T4CA 1CGYA 1RPKA 1D3HA 3V1PA 4E2BA 3EX4A 3R89A 3UY7A 1MEHA 4GE8A 4QQ3A 1FY6A 2WSKA 1CGTA 4LW7A 1OX4A 4L4MA 2WNZA 3W75A 1LM1A 1C8QA 2NUXA 3LBCA 4HNTA 4AW7A 1ONRA 3NQGA 3M1ZA 3NG3A 3IIVA 5HWJA 4EIVA 5AC8A 3SECA 2ZYFA 5EYWA 3DHUA 1RD5A 1S46A 1CI1A 2Z1KA 2NT0A 2VEPA 5LNVA 3EDJA 1X1ZA 3NL6A 2DP3A 2WPBA 2NXHA 3P61A 3KLLA 2QV4A 4EWND 3BCDA 1XI3A 3HG2A 3GIYA 4JX6A 1OFEA 3L4UA 1PVNA 3OHIA 4WJEA 3EXRA 1THFD 3LX9A 1YPIA 4GUHA 3WY4A 4TR9A 1SFLA 1T8XA 4QIUA 1BEUA 1VHCA 4HT3A 2B7OA 3DBPA 3K8LA 1W9XA 4LRTA 3ECQA 4DBEA 2B4GA 3FW6A 1F5ZA 4S2CA 1MW3A 3G1AA 5LKYA 3PWAA 4JX4A 4PCTA 2ZXAA 2ZA1A 3W1LA 3N73A 2V8ZA 3KRSA 5DY3A 5KEZA 3BVXA 2WKJA 4BA0A 1OYBA 1WBHA 4B9YA 2HS8A 2GVLA 1O5XA 3FYOA 4NX0A 1H7NA 1JRBA 1PS3A 3WK3A 4CQAA 4LOCA 5K9XA 1F6KA 3C0JA 3T7VA 4IMFA 4ICNA 1YDNA 1TPC1 5H91A 2QLYA 1K02A 4I7WA 4UXDA 2BY3A 5FESA 1PJ9A 1W5OA 3O05A 5TIMA 3TU9A 1GYLA 4OJYA 1GVOA 2YJQA 4XBSA 4IGHA 4G1KA 3DHPA 3RIKA 2ISVA 1J4EA 1VLWA 5BW6A 3PAJA 4HNNA 4QJ1A 1JGIA 5KZMA 1WZLA 1J0HA 4O0ZA 4IXHA 3W7HA 3G1XA 4M7SA 4WXZA 2G3NA 1O4UA 1J0IA 1DTUA 3HG4A 1SUXA 2E6YA 1UUMA 3C2VA 2WOQA 4LS0A 5D03A 3CIXA 4WY0B 4POCA 5K9DA 2VT0A 2F7QA 2H6RA 4WUIA 4A29A 1ZAHA 4AF0A 2WNWA 5CZTA 5DN1A 5I3HA 2ZQ0A 4ML9A 3QPZA 4R33A 5CZJA 4P61A 1KXHA 5FEPA 2OT1A 4FX6M 2WNQA 5FF2A 3TW7A 5IBXA 4HPXA 4PL2A 1TREA 3E9AA 3GXTA 1TSIA 3BSHA 1E3XA 5CGMA 1G7UA 3AXIA 3CZGA 2FB2A 5E9AA 3C2FA 1KFEA 5I3JA 3QF0A 1E3ZA 5HUPA 5D2TA 2QDHA 1BSIA 3AO0A 3UG3A 3W88A 3W73A 1QWGA 1XCWA 3EDEA 5C54A 4UQEA 1JULA 2BWGA 3UG4A 1FQ0A 1BAGA 5CLWA 1G6CA 3WEMA 3DC0A 1KWGA 2FGZA 2O7SA 4UQBA 3F4WA 5EKYA 2Y7EA 4KWVA 4RJEA 3CEPA 4H6KA 4JY9A 3EXSA 2EEXA 5TD4A 7TAAA 1FDJA 1TCMA 4FNQA 1YADA 3W37A 1F73A 3IIOA 4E0CA 4BI5A 1R75A 1VR6A 3EDDA 1FUYA 4O0KA 3KFTA 1GJUA 2Y6ZA 1UKTA 4OU1A 1NFBA 3O6DA 3CC1A 1SO5A 2Q8ZA 3OLGA 1OX4B 4MZ8A 3W2UA 4Z0JA 3CZKA 1QW8A 1DJNA 1DOSA 3F4NA 2GJNA 4UOQA 2JGQA 2VFFA 4MY1A 3LCGA 4JTKA 1HL2A 3VSVA 1IXOA 5EMYA 1QI3A 2DZTA 2QCDA 3N9SA 1LROA 3BUDA 1RVGA 1ZNNA 4KFOA 1OK4A 4GQRA 3BV4A 3BW3A 1OFPA 3GAYA 3N2MA 1XL9A 2PE4A 3UXAA 1JXJA 1SZEA 1VCGA 2F7FA 2EPHA 5CGTA 4HOZA 3LM7A 1FBAA 1XM3A 3AXHA 4FNPA 1LOSA 3EJUA 4JTJA 1DVJA 4NI3A 3GBDA 2OYKA 1BVZA 3DFPA 2WPGA 4UQ9A 4JIPA 3THQA 1A53A 2X16A 3GDLA 3E12A 3EWZA 3W22A 3SI9A 2V5BA 3UPBA 1EB3A 1DL3A 1QFEA 1RP8A 1H7RA 3C56A 4O28A 2GUYA 4X9YA 4RZ4A 3FS2A 3EJRA 4JDYA 3NZ1A 2ZZ2A 4CLMA 2WSYA 2Y24A 1AL7A 3K30A 3VMOA 2ZX8A 1XBZA 1G67A 1SMDA 3WJXA 3CIWA 4HNUA 1HL8A 1R2RA 4UMCA 1QX1A 1RZMA 4M56A 1WP6A 3P8IA 3BGJA 3M9YA 1SZNA 3C2RA 4XB3A 3NEVA 5EMUA 1H1YA 3EXTA 4YCOA 2E0PA 1XSIA 3QZEA 2PRHA 1HO4A 1ICQA 5T26A 2G95A 1TQXA 1QOQA 4JTLA 3NGJA 1OFBA 4DELA 3HGSA 4HHPA 3STEA 1KGUA 3QW3A 1GQNA 1PCWA 2ZRZA 3LRMA 1ZJAA 1XFBA 1CGVA 1JFHA 4FXRA 4OGZA 2V2CA 3FAWA 1VYSX 2TSYA 1K7FA 3EDKA 5E0KA 4JTEA 1J0JA 1AK5A 2CLHA 3LRKA 3S9YA 2YIHA 3BC9A 2E5DA 1VIWA 2BX7A 4AF0B 1XSKA 3P74A 1VPXA 1Z48A 3NR0A 5CPLA 1KXQA 1DORA 1GWJA 1WOBA 3TAOA 2QCHA 1ZFJA 3T78A 3S6DA 3F03K 2FHBA 3P81A 1OF6A 4FX8A 2CLKA 1MW1A 3CLMA 1PS9A 3LHTA 1GG0A 4KFPA 1KBBA 3I7SA 5K4XA 1MFVA 3LBMA 1H7XA 4UTTC 3L5MA 4AHPA 1KGWA 1C9DA 3EEGA 3ZSSA 5HUOA 2A85A 2Z1BA 3TAKA 5FEZA 2Y63A 2C8NA 1WQ5A 1R33A 4GO9A 4NJIA 1OVDA 5FEXA 4JTIA 5DFAA 4JICA 1L9WA 3R12A 5G5IA 1X7FA 1J0KA 1XH0A 4IWWA 2CZFA 3DFNA 3EWXA 4O8RA 3VSUA 4NQ1A 1SO6A 5AHNA 2FLIA 2GJLA 3VO0A 4NJGA 1KFCA 1VYRA 3HMJG 4JYDA 1Q6OA 3H53A 4J3SA 1Y7VA 2B7NA 2FDSA 4Y8FA 1NF0A 3L67A 3MJYA 4WLCA 4J27A 4PL1A 5KITA 1U5JA 1EH9A 3W7OA 1QMLA 4AWTA 1TB3A 3RILA 3MYOA 3OVRA 5A2CA 2OYLA 5D2XA 3TSBA 3MP3A 1VB9A 2WCGA 1LLZA 5CLTA 2EAWA 1TMHA 1SMAA 4GRSA 3W3OA 5BNKA 4CN1A 1K03A 3DENA 3IGUA 2QCDB 3KRZA 4GJ1A 3NDOA 3CZNA 1LRQA 2YA0A 2Y88A 1SZGA 1M7OA 1XDMA 2VFEA 4WD0A 2BLEA 2FPYA 3DZ1A 4DO4A 3LLFA 3THAA 1C29A 1VZWA 3STFA 4DXVA 1CXIA 2WCSA 1MW2A 1L6YA 1AW2A 1KCKA 2QCMA 3DH7A 3WK2A 1V3MA 1KFJA 3OLDA 1NAL1 3VGFA 3IJ9A 4H7VA 3LTSA 2CZDA 3OVPA 3PBVA 1JCMP 4UTUA 6ALDA 4K6AA 4GXMA 3TW6A 1UA3A 3ATYA 3GDRA 1RQEA 2ALDA 4AIOA 3NOEA 1W1ZA 5EY5A 4CVWA 3YPIA 4UFJA 2ZZ4A 2H8XA 3UERA 3W1RA 2NXIA 4UQCA 2QPUA 3DDFA 2C14A 4Q32A 3MHUA 1TPDA 3GXPA 2CLFA 2UV8G 3WEOA 3C52A 4UMBA 2OMAA 4MZ1A 5CSSA 4FNSA 1JR1A 2CLIA 2ZWZA 1SU5A 3A21A 3TK7A 4BR1A 1LBFA 4CN6A 3VGHA 3TXVA 4MZYA 1UD5A 1JUKA 4LXFA 4PODA 2AAMA 4TO8A 3B03A 1SW0A 3JRKA 2LLEA 3RFAA 4NX5A 1H63A 4UTHA 3AMKA 2FPTA 1B3OA 4QITA 1PPIA 3QPYA 1P0KA 4FEZA 4Z1AA 4PA8A 4YWIA 4QNWA 4UFKA 2DZSA 3GDMA 3WK0A 3K8KA 1E51A 4YLWA 2ZX5A 1TPEA 2DZUA 1TTJA 4ZQOA 1M6JA 4BZYA 4LVFA 4S2BA 2R91A 3G1VA 2V9DA 3L0NA 4HIBA 2EJ1A 1VJSA 3PY2A 3IGSA 1AW1A 1DQXA 2ATSA 3BW2A 3UY8A 1R2TA 3EJSA 3CLWA 3HBLA 3W1TA 2Y61A 2G97A 3GYEA 3QQ1A 4JYEA 3QQ0A 1K8ZA 4GUIA 4XZ9A 2W0UA 2ABBA 4U28A 3VNDA 2D3LA 1A5AA 1ZCOA 5SWUA 2FIQA 1O95A 4NZJA 3ANYA 3WDIA 3M7WA 3UCQA 3L5LA 2QAFA 5AFDA 1ML1A 1V3KA 3CWNA 1I2QA 1L6WA 2A7RA 4QNEA 3EX6A 1YXDA 4Y96A 4DF2A 1F05A 3LXBA 1UA7A 3TFXA 1QAPA 1XH2A 3T55A 3PSVA 2AAAA 2VKZG 3BK0A 3TE9A 2Y4SA 1YYAA 1Z42A 5BMWA 1G5AA 1OX5A 4FNRA 3U2OA 3ZSTA 4XUGA 3NM1A 2CW6A 5BRQA 1GOXA 5F7UA 1WPCA 4MPQA 4AMAA 1SZFA 3GDTA 2BHUA 2E09A 1Q4NX 3HPXA 3LTYA 1HX0A 1PV8A 4J3TA 2JK2A 1GPWA 3O6YX 1UH4A 3R13A 3U8GA 2ZZ3A 3HGOA 4O12A 1K3UA 1F6PA 3TUUA 3KX6A 1ZJBA 5C5YA 4J9JA 4OV9A 3WELA 2PRMA 1LORA 5MHBA 4PCFA 3NQAA 5CPNA 4DPPA 4UZUA 3ZR4A 2ALWA 1TIMA 5D37A 1G94A 4HN4A 4ADTA 3P5ZA 4Q4KA 4HSOA 4U33A 3IRDA 4UQAA 1GVIA 4FNTA 4UTKA 3QC3A 1LBLA 2VEIA 3W6YA 1KLYA 4RKAA 2OCZA 5C6MA 1Q6QA 2OSXA 5F4SA 1KTNA 1W5NA 3GVGA 1ICSA 3LI1A 4IMEA 1MVYA 1H7PA 5A6LA 3RK8A 1IXPA 2ZXBA 1EX5A 1OFAA 3B0UX 1QI5A 3IIZA 2J24A 5HPOA 4E2DA 2BXZA 1M7XA 5G1YA 4XTIA 1XGZA 1MW0A 3QW4B 3EX3A 3WY2A 1FDZA 3BLKA 1EWEA 4LC8A 3CQ0A 1KM1A 1G69A 4M6PA 4AAJA 7TIMA 3FOKA 3W83A 3DAQA 1HTIA 1KFLA 4AMWA 4O13A 1Y0EA 3GAKA 5U4NA 3V75A 1VFUA 3QMTA 2ZE0A 3A6OA 3STGA 1SSDA 3DKLA 4E2OA 1TTPA 4J3XA 3M5VA 2V5LA 4LS1A 2PCQA 1LWHA 1VFMA 4N02A 2HS6A 4MJMA 1JQXA 1R47A 4GKLA 2OT0A 2F7PA 2W79A 1X8FA 2VEMA 4O19A 4JS3A 1W31A 3SW6A 4PTNA 3FJ6A 4O1AA 2RHGA 3KVJA 2WJZA 2EQDA 3LPOA 1XKYA 4H3DA 4UUIA 3DDGA 3BPWA 1G4TA 1W0MA 3WJWA 3DFTA 3GB6A 3EWBX 2VUYA 1YDVA 4MAZA 2Y89A 5F2IA 3TC7A 2BTMA 2R14A 3SZ8A 4GI9A 3W74A 2Y2WA 2TPSA 4MIMA 1W5MA 4NJKA 2E77A 4N6EA 3OG3A 3O1NA 2OSWA 1OHLA 4O52A 3TCEA 3BCFA 4IJBA 2GQ8A 5G2HA 3UWQA 1JUBA 4NZFA 4RX0A 3VSTA 3BG3A 1SO4A 2YA2A 5HR7A 5HJLA 3W84A 5LGZA 1GVFA 2DIEA 2WO5A 1ADOA 1S5TA 3KWXA 4A21A 3L4XA 5F1UA 3SY5A 3RLUA 3STCA 1U30A 3E96A 2RH9A 3ZS4A 4E38A 3F1QA 4UNKA 1XH1A 1WDWA 1P1XA 4CCCA 5D04C 3G3MA 1JAEA 3B0PA 3T44A 3L5AA 4JTGA 2ZUWA 2VOMA 3A5VA 2J9ZA 4LRSA 4JN6A 1WOAA 3FIGA 3ZWTA 3NPVA 4FIQA 3SSJA 3KL3A 3ZT5A 3O6CA 2YR1A 4X9SA 4BWLC 2QJHA 1AL8A 1GTHA 3NQVA 2JBMA 4BK9A 3W1UA 2QCGA 3I68A 4NJHA 1D7FA 2ZX9A 3BVTA 3R5EA 3W1PA 3NQFA 4JY8A 4UR8A 5HNRA 4JTTA 1CLVA 1TRIA 4B5NA 2BSLA 3M5ZA 4NNBA 3PB2A 3DX0A 2A0NA 3LCLA 3SFKA 1ALDA 3Q58A 4IX2A 3UQNA 4K7YA 3BLEA 2OW6A 2XFWA 4CCEA 2E6DA 5G2IA 1RR2A 1GT8A 3CM4A 1R46A 4LC6A 4FIRA 3L4VA 5ABTA 5D38A 5I3FA 1H51A 4UZSA 3T40A 2ZTKA 4JTSA 3W70A 3SJ3A 1FXQA 4FF7A 6TAAA 1Z44A 3L21A 4M19A 3C6CA 2CLEA 3D0CA 4JFVA 3QH2A 1CPUA 4YCPA 1AMYA 5GVJA 3WJZA 4WZHA 1WZKA 2XWEA 5DXYA 4LT9A 1OJXA 3DX4A 5K4ZA 4AB4A 3C61A 3LERA 1JDAA 4XBKA 2E9BA 4K7VA 3K8MA 2XWDA 3IJ8A 3VGDA 3ZO9A 3CZLA 3KLKA 1VH7A 4UTJA 1S5VA 3VX0A 3G8RA 3TR2A 2ZICA 3KEHA 2GUUA 2F84A 2XVLA 4LY8A 1W5PA 4XTDA 3C8FA 3W7DA 3HGRA 2DZPA 1JD7A 1DBTA 2NWRA 5CZ0A 2AMGA 2I1OA 3ZQ9A 2X1TA 1TQSA 2NT1A 4UTIA 5FF3A 1VRDA 3B04A 3HO8A 2YKKA 1OYAA 4RZ5A 1PEZA 1V5XA 3DKJA 5HWNA 4ZZ9A 2J27A 1G4EA 1O5KA 3MI3A 3QMSA 3HPZA 1L2UA 1BWLA 4EF8A 1G9HA 4JYFA 2B0MA 4H2CA 4AVFA 3O16A 4IMCA 3KHJA 4Z08A 1TQJA 3B05A 1ZS2A 2NUYA 4YL2A 5CGQA 4A22A 3EWYA 1OX6A 1BF2A 1KV5A 2VELA 4FLSA 3UEQA 1OB0A 1KXVA 1MWOA 1LBMA 2TMDA 1FWWA 1CDGA 2F2HA 1TRDA 3OEXA 1E40A 2YOCA 3NVTA 2QCEA 3FFSA 4U31A 5BOOA 2C15A 4WQ6A 4LWWA 3I7QA 2JKPA 4XWUA 5A5WA 2F7OA 2OX1A 3BVVA 3MW7A 4GNJA 1TJPA 3EX2A 1KBJA 2YYTA 2ZUSA 1GYNA 2X1RA 2ZRWA 4WXYA 1EO7A 1QO2A 4UOZA 1JDDA 4BI6A 4JXCA 1VC4A 3MHGA 4LTSA 2VRKA 3IV3A 2B7PA 1T99A 1R34A 2C18A 3W7GA 3LHUA 1DJQA 4IQLA 3TMQA 2HTMA 1HXKA 2VXNA 1B4KA 3G1HA 4TU1A 1IZJA 4MB1A 4CGTA 1A50A 1G4SA 3CPRA 1LYXA 2PRLA 2ZRVA 2A6LA 3W86A 4AH7A 3DX1A 3OLIA 3LPPA 3QGVA 2ZZ1A 3UYCA 3W87A 3P67A 3VM5A 3SGUA 1V3LA 4K39A 4C1KA 5A6MA 1U83A 1IXNA 3A47A 1H5YA 6TIMA 5D33A 4UR7A 4DEFA 2QCLA 1LRTA 4K38A 4JGDA 1TJRA 3GLCA 3W7MA 2FHCA 3BUQA 1PE1A 3HOJA 4I9AA 5BRPA 5I3GA 8TIMA 5DO8A 1XD1A 2FE0A 1TPFA 4PH6A 3E02A 3KVMA 3PUDA 5CPMA 2Z6JA 4HNVA 4ZQCA 1ICPA 4CN4A 5AHFA 2ZIDA 3KVKA 4N4PA 2DZWA 1JCLA 3TTSA 1A5CA 2ZDRA 4QAIA 3S1WA 5C2XA 4ADSA 4NVTA 3TSDA 1JF6A 3L65A 3CGTA 2WKLA 4I7VA 1KM6A 1AQMA 1XBYA 1XDLA 3C4UA 3USBA 3DI0A 1I4NA 4K37A 4KWWA 3BLPX 4LU0A 4K8HA 4AMXA 4WOQA 1PZ3A 3BVWA 3P62A 4O1DA 1MFUA 1WX0A 3PF3A 2A6NA 4N6FA 1NOFA 2CWNA 1I75A 3WJYA 3LGEA 3O06A 3S1XA 3MHFA 2J9YA 1D3GA 2WQPA 3BVJA 4AHOA 2WANA 5E0FA 3WMSA 4JX5A 5LGXA 3WNMA 1SR9A 2X30A 2C19A 3W1XA 4GO8A 3ZR5A 2QKFA 1R2SA 5I24A 3W9ZA 2RDTA 1WZAA 4UTWA 1XCFA 3LCIA 2PWHA 2XN2A 3M47A 1H61A 3VMPA 2Y7GA 1BG9A 2Y62A 4QISA 1D3CA 2FPVA 2FJKA 4O53A 1HUVA 3PUEA 5I3IA 2D0HA 1MEIA 1MZHA 3W1QA 1VAHA 4MOZA 3EX1A 2VR5A 5CPOA 5E6ZA 4FB7A 3UWZA 1H3GA 3EDFA 2WVUA 4OQVA 3WN6A 4N2YA 1SO3A 1XBXA
chains in the Genus database with same CATH superfamily
1ZY9A 2A5HA 2DF3A 2CIPA 4IPIA 5IMLA 2Y9RT 3KJ6L 1WRFA 1MCFA 3FX4A 3JV4B 1XLJA 4N9GB 2VJ0A 4IMGA 1JPGB 3Q9QA 3IJ6A 1KC5H 1R24B 2B2XH 1UD2A 2FX8L 3TA3D 2KH2B 3BE1L 1W9DM 1KCVL 1QUPA 4PJCB 3JR2A 4N8CL 5IW6B 1NVMA 3IVTA 1R3LA 3CEUA 3RXZA 5DMKA 4PTTA 4G42B 5FGRA 2CU9A 1RV6X 1YY9D 5C0BA 3KOXA 2CXEA 4C6JA 2X6VA 3OWEA 1NL0H 5CP3A 4CVUA 4N20A 1W80A 3SBWA 3B8SA 1V6VA 3G5YB 4XP5L 5AYYA 4IGBD 3KW3A 4JFHD 2Z7GA 4ACYA 4MCZB 2QBWA 1LL7A 4M7LH 4UQDA 4K5NA 1ZVSA 5BXPA 4FL4B 3PHQB 3HC0B 3CVHA 1NFDB 4M8QA 5FCSH 2K0RA 3WLBB 7XIMA 4Y16C 1GJIA 5DT5A 3QC5X 3MGAA 1BIIB 4BDVB 1XDJA 3X1GA 3ZZSA 1WG3A 4AD2A 1RK0A 1RZ8B 4KY1H 1UJ3B 1ECQA 3KP1A 3QUYC 5AYUH 3MP4A 1VKXA 3BH9A 5KYYB 2BNQB 4WX2A 2Q3AA 3DJTA 3WH8A 3GKWL 3RFZC 3O9WD 5GGVL 1SVCP 4TUOB 2VLME 5T9CE 2VP8A 1HJUA 1KZYA 2Q09A 1XRVA 2NXZC 1JERA 2DLFH 2GGIA 2HWZH 3UD6A 1KCRL 1U6AH 4HU4A 1PX3A 2CKBH 1WT5C 5I5JA 1W9UA 3BFWA 4KRUA 2BY1A 4FI4A 3JUGA 2ZBTA 4ZW7A 5GGSB 2W0FA 3QNZB 2EGZA 5K9OB 2G2PA 4GOAA 2KDYA 5G1MA 4JFSA 4NOFA 5I6PA 3MBXH 1OGSA 4XQ6A 3B2UC 3GU1A 5DS8B 4X2RA 4PJDA 1YYCA 1KV8A 2QFRA 1HL4A 3R0DA 4KWUA 2G60H 2DQCL 1KXTB 4J3OC 2QUVA 1M7UA 2LFEA 3DTXB 3B9KA 3O81A 4R7XA 2YXGA 3Q8BA 4MY8A 4GO6B 3C2AL 5EORH 1CEOA 1P9MA 2WBJA 1WC7B 2CIKA 1A2YA 3N9KA 1H0DB 4U3XA 2V5TA 4BY3A 1TZOA 1DBKL 3MRRB 4URIA 3DOPA 1T04A 3Q01A 1NBYA 3BD4A 3O2DA 3ZE1B 3LZ5A 5HPMB 3JWDC 1DUYA 4LY4A 4M51A 1M7DA 3C8KB 3KLAA 2AZAA 4AXKA 3EJYC 4HK6A 4FABL 3S1UA 2VDNH 4Y4FB 3BMXA 1Q6LA 5IT2H 4WVXA 3BQVA 2AQSA 2TAAA 1DWIM 4O4YH 1JG9A 5E8NA 1HGWA 1BHGA 4IGSA 1MFDH 3DFQA 1Q7ZA 1DP0A 1FX6A 5AD0A 3M5YA 3E3QE 1BX2A 2Q3ZA 1ZHKA 3LHZA 4X5LA 5C0CD 5CZXD 1WE5A 1F3EA 3WNPA 3LHPL 5CJQL 5H37A 5DZLA 2D7MA 4TMCA 2GITA 5HGDA 3AABA 2PMQA 4FOJA 1JRHH 1JJUA 1WA1X 3K72A 3WOVA 3P60A 1L5GB 1I3GH 3PN8A 5HDBE 1CFSA 2POZA 3X14A 1Q9KB 4IM8A 2NW0A 1KCSH 4XP1H 2W38A 3G5ZB 2E28A 1HCYA 3GHBH 4RAUA 3KM8A 5H1WA 1X98A 4RRPM 4FFZL 4L8CA 1AXTL 4MMYB 1LTXA 2QMKA 1M53A 4ZQKB 4NSKA 5C2CA 2YFNA 3EF4A 4JR9H 4MWAD 4ETQB 2FAUA 3JTTB 4YDLB 2CO3A 5TTRA 2VDQB 3NCJH 2BP1A 3WQFA 4NBYB 3DYOA 3F6JA 3VXRD 2OO6A 2CD0A 4N6QA 4AZCB 4QHPA 1RUAH 1WAAF 4ZT1A 3P82A 4F57L 1A3XA 4JTFA 3NEXA 2VO5A 4ZUTA 4R8WH 5DZOA 4AD1A 1MZRA 3BDYL 4G8IB 1O94A 1UOVA 2GQAA 3W7QA 4G9DA 5IFPA 4GW1B 4YFDB 3GC3A 5LDUA 2J44A 2IPWA 4YXHL 5F1KC 1NGQH 5IKCB 4W93A 3QDJB 2VSKB 4OT1H 4FSAA 1CF8H 4W7WA 5KVGH 1NELA 3GSVB 4ECNA 1T8QA 2HRWA 1MDLA 1HXMB 2GSHA 3VDGA 2B0SH 3I84A 4WKAA 5ACZA 4XKYA 3ZHLA 3C5QA 4Q4QA 4BJLA 4JIRA 3UYRL 1FF5A 1HZYA 3MRFB 4G8AC 1R38A 5T5FL 2WMHA 3L4CA 5ALCH 3QDMB 4KHTL 4OLYH 4R2GC 3T2NH 3GSWB 2Y1ZA 1L6SA 4H19A 4ZENA 5F1VA 2HEJA 2YBTA 4TNVK 4GIAA 4L4JA 2V3DA 3GR8A 3DUUA 2D7TH 4N0YL 3A3YB 3H9SA 1ADSA 4KI1A 1OWWA 4HXBL 2FTAA 4QJ5B 4P4KB 3PJSB 4GKSA 3NN8A 3OBAA 4MWFB 3FUNA 3GWQA 2DI7A 1MRCL 2XSAA 1PQZB 3GFYA 2ZZ6A 3V4UL 3ARDB 1E28A 4GVGA 1N68A 5C7XL 4OLUL 4N9CA 1TE1A 2XWZA 4RRPA 3ZMNA 2E1DA 4R7WA 1JVLA 4HDIA 4JPKL 4ILSA 4KKAD 3QMRA 2BIIA 4FZEL 4PPTA 4OE7A 4F0MA 3F7QA 4I8DA 1DV7A 4V1YA 1U0QA 4JQVA 5DJCA 2OG9A 1INQB 4L3CA 4HKPA 1EYEA 4AYGA 4TLUA 1GQJA 5IOPA 1KCWA 5CCJA 2DJLA 1CFVL 3PJXA 3PGFH 1QRND 3U48A 4IHOB 2J72A 5D5ME 3C6LA 1NCJA 5BXSA 3OWRA 2WBGA 4HIIA 1FNSL 5DELA 3EMZA 2OR7A 1OARH 2AP2A 3FU7B 3SURA 4MUZA 5BRZA 3EB3A 4C7DA 5DJ8A 3DHDA 1WJ3A 3S0CA 4XWOC 3N18A 1ODUA 2PDFA 1KB5H 5E1GA 5EOCH 4IIQB 2F5AH 2EEAA 2EC8A 4LLVA 2BVTA 2IBZX 4XBGB 3WQ8A 1U8IB 2PYEE 3OZMA 3SSGA 4N2OA 5ANMA 1IEVA 3UAAA 4JREB 1LDPL 4GAGL 4P0DA 2KZHA 4XP6H 2KDGA 4FXGC 3VXUE 3VYPA 1VFAB 1HKKA 2OL3A 5EMMA 2FEEI 2W67A 4KPLA 4LAKA 4QDPA 1O60A 3H7RA 3T0EC 3V0AC 4MHBA 2JCCF 5TF1H 1YXCA 4RV8A 1DHKA 2G5UA 2EDDA 1O7SA 4CW1A 4E2BA 1EZLA 2WSKA 1KF9B 3K6FA 2FZDA 1LM1A 4TTDC 4HNTA 4ZUWB 2X4OB 2MTPA 4YE0A 4N0FA 3ILQD 2Y1YA 1X1ZA 3THML 2NUTB 3BCDA 5ITBH 4XCEB 2D3VA 3GIYA 1OFEA 1SF3A 5AVQB 2FQGA 1THFD 1YPIA 5CGBA 5E5RB 5I19L 3WF3A 3QTGA 2I56A 3NQIA 4JX4A 4XC3H 2ZXAA 3LCYA 3N73A 3KRSA 5MEND 4P5RA 2BZCA 4F91B 4LSUH 4E41E 5C3IA 4U3SB 3FYOA 3EFDH 1A7RH 1JWSA 3LS5H 3WK3A 1F6KA 3FKUS 2BK8A 4ICNA 2FZNA 4ZFFB 2D9QB 2OMBA 1VSCA 1F3XA 4DCQA 3TU9A 2FJGA 2YN3A 3RWEA 1F4AA 1WZLA 2BFVL 3P3BA 2YD5A 4IKNA 3ZL4H 5I1HL 1XEUA 5IEHA 1E4KC 2XQYK 1FRBA 2PWUA 2WNWA 2WXLA 1K8DA 3QPZA 4HNCA 5HATA 3IJYA 3P0YL 4FMFA 4LUYA 4XZMX 4ZTOL 3ONBA 2DQUL 3SZ6A 4HU8A 3D3VD 5E9AA 2WLMA 3C2FA 3HI6L 2GGHA 1FKWA 3F2CA 3WEMA 3DC0A 1U8MA 4XB8A 3TCXA 3BZGA 4OZIE 2HISA 3W37A 3IIOA 2V7HA 2EICA 4PV9B 1DVZA 1P0SE 2HVKB 3L5XL 1E4JA 4GP8B 2UBPC 1XLEA 3CFDA 3F4NA 1JSYA 5I9QC 3BUDA 2VM9A 1JXJA 2EPHA 5BPPA 1X9LA 5BU9A 4S3FA 1LOSA 5DEGA 3QV9A 2WIMA 1I9IH 2BNRA 2BSSB 4INFA 3HA0A 4BWTA 4AGLA 3I85A 1EGVA 3QEGH 3IBOA 3HPAA 4E3TA 3C0LA 2IDTA 3C5ZB 5FJTA 3IK4A 4UMCA 4PHZA 3X12A 3RL1B 3BVDB 5TDOA 1V0LA 4PJIE 4TOYL 1IRAY 4LCSA 2X8RA 4KZDH 3U1QA 3KVQA 3BGFC 2VZUA 3ZQWA 3FB6A 3FN9A 1NWOA 4YL4A 1VYSX 2ADGA 1F3DJ 1TWWA 3PQYD 2OWWA 3MJ8B 1XIIA 4Y1AE 2W9DL 3SDAC 4JN1L 2C3VB 3SDDD 1MFVA 5GS0C 1NDGA 4LVHB 5HDBB 2IH9A 2DWEB 1T22B 2XZCH 2Y63A 3SE3C 5KBDA 4QRRB 1FHDA 5JOPD 1R9YA 1DO6A 2NW2A 1FNEB 2GJLA 3DMMC 2H4EA 1WBXB 4JFQB 4BK5A 4EN3B 1UWEL 3D06A 1IE5A 1NF0A 1EVUA 2VZ1A 4ANWA 1E8XA 2DTML 1TVHA 4MDRA 1MQKH 5D2XA 3CG8A 3MR9B 3K71B 4ELMA 4N2NA 2Q71A 4OZGA 1XR2A 4NKIL 4LMQE 3UJTH 2CESA 3DENA 5JNYA 1E6JL 1UXWB 1BWVA 2FPYA 2AXJA 3BL3A 1I4FA 2O0TA 3A6BL 4JIIX 1EMTH 4PYHA 5AVWB 1JHLL 5D1ZA 3NJFA 2CZDA 2Y7QB 5D70H 3SAZA 3FU5A 5K69A 4M1CD 1I8UA 1RQEA 3PV6B 3VUAA 3LLXA 5EMLA 1GSKA 4K3HA 1X4ZA 4Z5RB 3I75A 1CZ8L 4N22A 3T08A 4V33A 3HCVA 3AT9A 1IT9L 1BQHA 1LO5B 4FI8A 2QPEB 4GRLB 4TO8A 3NA9L 1SW0A 1BD2A 1SRDA 4PA8A 3ID7A 4HWBA 1UROA 5HHPA 1ASQA 3P9LA 4Z7WA 3EJZC 5EPMA 1A4LA 5TQ0L 3L0NA 1TLMA 4YTQA 4H0LC 3UOAB 2Y61A 1T6WA 2ZOXA 1REQA 1B0RB 3WO8A 3FYEB 2I5YH 5I71B 2F15A 4EQ3A 5JHLA 1DVSA 3IDUA 3P4OB 1G7MA 3PYCA 2PGRA 3RY4A 4KI5F 3S37H 3BO8A 4RE3A 4KTDH 1YYAA 4O1EA 4ZFOA 3IXTB 3QVAA 5KANI 3C8NA 3ZXAC 2QDWA 1GOXA 1Q4NX 2A3AA 4X0VA 3VWJD 1BEYL 1OLZA 3N85H 4PJ9C 4AMCA 3OC8A 5KSAC 7PTDA 1EFXA 3PPSA 1BREA 5EC2A 3RWCB 3SCVA 4DPPA 1JV5A 1MHHA 2B15A 4HUKB 5CAYB 4Q9BA 1I7RB 2VD8A 3UTZA 3OMZA 5L9DL 1TZIB 3GD6A 1V6TA 2VH5H 3W24A 4GW5B 1IC7H 3EZJB 1IXPA 3RK8A 4M6AA 4E2DA 1QT1A 3BFOA 4WTXA 4LSVH 1L7TL 1MW0A 4JTAA 3F5WB 3W83A 3DAQA 2PXYD 1KLGA 1NGZA 3KPMA 4UV4H 3QG6B 5FCZA 5LJYH 4Z23A 3WIHH 9XIAA 3LGDA 3UJIH 2WW8A 4WEBH 1B3IA 1AZRA 2HT2D 5A6KA 3BPOB 3P1VA 2GDUA 2F7PA 3BWAB 2DVUA 2ZOWA 5HVHB 4RZCB 3VXSD 4IL2A 4O1AA 1FLRH 4ZBJA 3LPOA 1W0MA 4AL8L 4UR9A 3EYUH 5D5MB 4ZUUA 3VD5A 5AKTA 3S4SB 3DG7A 4HIPA 3L6FA 2LQRA 1N5AB 1M68A 2WO5A 1ADOA 3PWPA 2BSRA 3HE6B 5IFJB 5GHWH 1ZPUA 2QVKA 3T77A 2NSOA 4UNKA 4Y4KD 1NCDL 3IJSA 3VAEA 4LLYB 2KZ1B 2VXVH 3EGXB 3PNWA 5FLUA 4HD9A 1GTHA 3NQVA 4APXA 2PYEB 3PTMA 1CLVA 2MUCA 3MRCA 5IB5B 1QOKA 2RCSH 4X5PA 2XCMC 4LEOA 2KMWA 2XZ9A 3RWDA 4RIRA 3FUJA 2VXUL 5C08E 1FZJB 4ZPVB 4MB3A 1P6CA 1AMYA 3GXUB 3JWNG 1WZKA 5FB8B 3IVKB 4K8RH 5JIDA 3U9PH 1XIGA 1QFWI 1AOHA 4HT1L 3U7YH 3ECVA 4LY8A 4GUPB 3MV01 3QKEA 3DVNA 1AJ0A 3KZSA 3N6QA 1TQSA 4UTIA 4A1RA 1ASPA 3MI3A 4DYEA 1A6TB 1XIFA 4DJED 4A22A 1MJ8H 1KJ2B 4IMLA 4X99B 3MNZB 1ZHNA 3GIVB 2ZADA 3TIDB 4XOBA 1RLDA 2R56L 1HNFA 2ZOOA 1AFVH 3MXVL 4GKOA 3MW7A 4JFDD 3BP4A 2ZRWA 5J11B 3JYCA 4F92B 3ARSA 3WEXA 2BSEA 3ARFC 4RE0A 3OLIA 5I1CL 1TVPA 3ARVA 2ZOUA 2QVHA 5F7YC 4Y9MA 1YQVL 1DLHB 4IRJB 2CLRA 1EHLL 3MX0B 1YX1A 4YFEA 3BUQA 2AQ1A 2WP3O 2YUVA 2ID5A 2XTLA 5I30H 3KXFD 5CBEB 2Z24A 1CR9H 1ICPA 2WK2A 5CC7A 5FUOL 4DBUA 4AI7A 1B2WL 2ZDRA 1CG9A 4JJOA 1BZ7B 3GUWA 5CSUA 1S3TC 5FOOA 2ISFA 3TO2B 1F07A 1GHFH 3VWKC 2DY3A 3ZZ1A 2IDSA 1CD8A 1EDHA 4XOCA 3FJNA 3GMOB 3TVMA 3FQUB 1L9PA 2OMYA 2J9YA 1UM5L 1KYOJ 4OFIA 9RUBA 4IRZL 2OTUA 5AC4A 2HLFD 5L8LB 2O6PA 2XRAH 3IGKA 3VXTB 1IGCL 4OZIB 1DVXA 1G7QA 3O0LA 3FQWA 4PRWA 2X6MA 4AUUA 4EUPB 5CCZA 3UPRA 1Z9MA 1HFBA 4LGRB 1OD8A 4QTIH 5FW7A 1S38A 1Q9OB 4YO0A 1OYCA 4L4VA 4PRDB 2NNAA 2XETA 3N06B 1BM7A 2VDKL 5IBXC 4HB7A 4L9XA 4NT0A 1J10A 2AJUL 4Y1TA 4J1OA 4AW4A 2G41A 5EPDA 1T7XA 5ACMA 3G04B 3R4IA 2OYMA 1EA9C 4HCRH 2YZRA 1ZBCA 2J6EH 3SKNB 1H3WM 3P93A 5BV7L 4FOUA 2G2RA 1LDCA 3ATBA 2Z1VA 5A8QA 2X6BA 5K1JA 4PJIB 5D02A 1OSPL 2X2JA 4EBQL 3O3AB 4AC2A 2CGYA 3L17A 5KZEA 3WK1A 1HKIA 2Z4QB 3I50L 4NILA 4AQZA 2J7HA 1Q6RA 3TBWB 4HHAB 5T9BG 1HOEA 4IFKB 1T7ZA 3RRQA 5T1KB 1SJEB 2Q6WB 3WFZA 4S3BA 3H2WA 4HN8A 3NVDA 5L7XH 4N85A 3UZVA 3WUEA 4H8WL 2JI3A 5TDNA 4F66A 3RMJA 1YDPB 4AEFA 3QFEA 1X4XA 4XNUL 3EGSA 3VCRA 4A6GA 2R39A 4JIEA 3ESPA 3CFQA 3GM8A 3BW4A 2C1OA 1W0VB 2ZUTA 1VACA 2W88A 2PWVA 3FZUD 3KDMA 4ZR8A 3KW7A 2IKIA 1QPQA 5LNSA 1UB3A 3NK4A 3QLLA 4B60A 3UX9B 1O6IA 1XHHA 1MEXL 1EDQA 1E6OH 3H7VA 5HJDA 2H8PA 3MLUL 3NA8A 1DE4B 5J1AB 5D4IA 2E6AA 3IVUA 1XLKA 4LNCA 4IH3A 1MUJA 2VC2B 2V3FA 1WCQA 2FIKB 3MDUA 4PJ7F 3LKNB 1RV8A 1TMQA 2D20A 4HFUL 4ZTPH 2XIQA 3FU9A 3FRPG 2IPJA 1RURL 1TA3A 2ZP0T 5JMOC 4IJ3B 5ILTH 4YXLL 1NEPA 1HHKB 1AYOA 4I3SL 1QKZL 1NUGA 2PZ0A 1G1KA 1HO1A 1ZEAL 5AAPA 4ODTL 2XTJD 6REQA 3EYVB 1JYXA 4NQEA 1X1OA 4PLNC 3LXAA 4NKDB 3KBWA 1DQWA 3AHTA 3WKPA 3RPTA 2GJ6D 4O14A 1TTBA 2NY1D 1NC2B 2J20A 5HJ3B 2EYTA 4KCWA 4F27A 4KXCA 4G56A 4PJAE 5C2GA 5CBAB 5AZ1A 3GSRA 4ZK8A 1S3KH 2R0ZH 5I2IA 5KZDA 2MMXA 4PIBA 1BQCA 1UKPA 2FZ8A 3QFWA 3KWVA 4X4MA 4P49A 3QEZA 3LAFA 5JLZA 3TPUB 5JUEL 2QCFA 5I8OH 1N0XH 5ALBH 1FH7A 4IP5A 3QPXL 2QMJA 4IHCA 1SPDA 1CFTA 1FNHA 2QKIC 4PRPA 2W07A 2BV9A 3XINA 4V2BA 1AZBA 1MJUH 1URZA 2OW7A 4NHCH 4AZ8A 5J6GA 2P5WD 3EA1A 2P5EE 3VNZA 2X0UA 1JZGA 3H42L 3I9GL 1VZIA 3DUSB 1QPKA 3GRWA 3KCWA 2WLHA 4H5SA 2XM1A 3UZXA 3QXAB 2M1KA 1DJIA 5K33A 5EA0H 1OCCB 2BASA 3RCNA 3AIUA 1SHSA 3CQHA 2B4CC 1X5AA 3IETB 2ABAA 3NTCL 4A4AA 4WI6A 3TN0C 5D1XD 5GGRB 3OLEA 2ADAA 5C6PB 3BI9X 4RAHA 1BZDA 4X3ZA 1XQ4A 3QEHB 1EZSA 5LGJB 1TNMA 1IGWA 2A83A 2DQJH 5B1CA 1E0VA 1UR1A 2WM1A 2FX9L 3GXIA 3MSPA 5HD8C 2ACRA 1CTOA 4Y5XB 4YC2C 4XBEH 4HHLA 3EWCA 2C1HA 4BZ2L 5FD0A 2FNBA 2XVBA 5EO1B 3M0XA 1Q3NA 3C2OA 4BKTC 5AALA 2PFHA 4S11A 2CZEA 3KPNA 1GZ1A 4K68A 5AFAA 3P3RA 5FF0A 2JXMA 4RMBA 4PUMA 1F8IA 4CMMB 4JFZL 1YTEA 2P8PA 4OIAA 2PURA 3K0YA 4LBEB 4JTUA 2SEBB 3VQLA 4F7CB 2XGZA 1D5ZB 2GVYA 5C08B 2Y2TA 4NIKB 5BVPH 5LAPA 2W5PA 2IANE 3HNSH 4DAGH 3OBKA 3FJTA 5EO9B 4APQC 4XAFA 2C9AA 1D6VL 4J1UA 1C8VA 2OR9H 2YARA 4KITB 3K5RA 4NL1A 4NZRL 1ZHAA 1AG1O 1FZOA 3GNPA 2BP0A 3NZRA 3AZRA 2Q3OA 1AQFA 4HK7A 1WKEA 1AI1H 4WWKB 1TPB1 4PFMA 3ZT6A 3N50A 4KMQA 4EDWL 4JB9H 3FMGL 4I18C 4UYQA 3KPLB 3OSVA 4JN2A 3S8HA 2V2DA 3LN9A 5JQ6H 2UYLA 4OBTA 1RUML 1DJWA 2CLMA 4YLQT 2XN1A 1P6FA 4HA3A 1FH5H 4J2XA 3G6AA 4YSOA 2GSGB 2FBRA 5HHXH 2KLTA 3RVWD 2ZT9C 4H6QA 2ZG1A 3C9NA 4PS3A 5HR6A 5J12B 2FO4B 2VJXA 1BEXA 4L29B 3AY2A 2EINB 2IG2L 4ZS6C 3N3TA 5FOBA 3S6CA 4YZWA 4CBPA 3PREA 5BWFA 4GGBA 3DJZA 3DHFA 1T1YA 1U8QB 2V2XB 5EU3B 4MFDA 4HISA 1PKNA 4UFHA 5HYSA 3DX9A 3MDWA 3DFHA 1YMHA 1ZT7B 3ZXWA 1LOQA 1XGQA 1BQGA 2HLEB 3GKAA 4AMKH 4NO0A 1XRTA 3WQEA 2EIJB 3GNDA 1YN6B 3W11D 4EIZC 2QJGA 3R1GL 1TSRA 4PRIA 4PUWA 4PJ8D 4TIMA 4WKZA 1IAKA 1ORQB 3GUTA 2ZAGA 3OJDA 2AANA 1YEEH 4AGMA 4N9BA 5TE4H 5DXXA 8PAZA 1OTSD 3NIYA 5FAGA 5LHFA 1PG7X 1TTAA 4AQAA 2YCLB 5JHDB 5C97A 3OKMA 1FWNA 4HWZB 4D2NA 1RZ7L 1YTKA 4F8LA 3P77A 3AREC 2ZJSH 1TE6A 1T89A 2QGDA 1JRCA 4LP8A 2QGBA 1E5UI 2P76A 4V1DD 5KS9F 1F45A 5D4QA 3U0WL 3KPRE 1G6RB 4K1GA 2XN9D 2PS2A 4M81A 12E8H 5L88H 2PN5A 3FQTB 5KMYA 4B7LA 3GXMA 2E27L 3VRJB 2VVSA 4JRLA 4DX3A 1SLUA 1AAJA 1OAYH 1W1VA 4ESKA 4OFDA 5I0YA 3RNQB 4CSZA 3W7EA 4XVEA 5DBTA 4K3GA 5LHDA 4NQDA 4KCUA 5D2WA 1WGOA 4QRAA 3T8LA 4N2MA 1GH7A 2HX8A 3BAEH 2R51A 4MA1C 5B39G 3W75A 3JWNE 5C9KA 3M1ZA 4MJIA 2G8ZA 5EYWA 4DJFA 1W6LA 4CGUB 2Z1KA 4M1GH 2UXGA 4YVUA 1CCWB 2QV4A 4NYUA 1MLCA 5JORA 5DZPA 2VW7A 2WLZA 3SZKC 4MMXA 5EOCJ 1N3NA 4XBPA 3C60A 1F4YL 4JRYA 5JDSA 1L4IA 4F58H 4S2CA 3QHZH 1VKFA 1J1XH 2ZA1A 1FVPA 3RRAA 1CD0A 4BJHA 4CQAA 1OCOB 4QRTB 4Z77A 1GGUA 3SO7A 5REQB 1RAMA 3CH9A 1UADC 2G4FA 1E56A 1GYLA 1PBGA 1T1XB 4BQ2A 1BOGB 1TSHA 4WO4C 3TO4D 7A3HA 4M7SA 4WXZA 1D2KA 4AM0Q 1OP9A 2YHGA 4WUUE 5CZJA 5FYKD 2PA6A 5FF2A 4TPRH 4PL2A 2ZXCA 3PP3H 4ILDA 3RDTC 1TSIA 2APSA 2A74A 2YLKA 2ZOKB 4D0DA 1JTPA 3R19A 2BNUA 1KFEA 5LIWX 4OLXH 1HWHB 4G6KL 5EBWA 3CFJA 3L13A 4AQ1B 4TM9A 4CKVX 3TYGL 2O7SA 1E4LA 4Y5VC 1JNNH 4NKOB 1U42A 3EXSA 4PJAB 1X7TA 2A3BA 5T3XH 4L3EA 1WFTA 2J6WA 3GD1C 2UZIL 1R5IB 4G7QB 1FUYA 4QXUH 1JGDA 1KBVA 3IWPA 1S2TA 2XX0A 2LHAA 3GE7A 3OLGA 4BM7A 4JE0A 4PJCF 3FFCE 1DSYA 3VB9A 1TQBC 3RX3A 1FFTB 2Q86A 1XLFA 1OFPA 3GAYA 1R0AL 2H9GB 1VCGA 5CGTA 3LM7A 1TJIL 1MRAA 2R29H 3THQA 4KKZA 5HGGS 2V68A 4Z95H 4HFWA 4RZ4A 4B3ZA 3NZ1A 2PF6A 3BRGC 3VMOA 2AK4D 2CR3A 4U1HA 4XPHL 2P5EB 1WAAA 3JVGC 1J5IA 4L2YA 3MRJB 5GIRB 1ETZA 1XFBA 1ZJAA 2QPDB 2QQKH 3A3WA 4S3DA 4G1NA 4H20L 1Q7MA 3EDKA 4HZLA 1M05A 2MH4A 5CLZA 1NFDF 4D9QD 1NEUA 5I1GH 1CE6A 1LEKA 3QJQB 1JZFA 1BSLA 2VC7A 3V4VB 2N4IA 2X09A 4R7DB 3ESOA 1OP5K 3LBMA 5AKQA 3FL7A 3SUTA 2X1XR 4Y4HC 3QH3A 1XB8A 2L04A 1K3IA 1QK2A 4P2OB 3MRIB 2XFXB 3DUHA 1T6BX 5HDQH 2VDPL 4F4RA 4KUCD 1TEGA 1X6NA 5BJTB 4Y8FA 1HXYB 3MJYA 4TVPD 1UIPA 3CQPA 3RAJL 1Q1PA 2H0PA 2HH0H 3VD2A 3N04A 3KPSD 2FEJA 2VR2A 3SGDH 3LSCA 3RILA 3MV7B 2GFTA 4S38A 2EAWA 4XO7A 1MAKA 1SMAA 3RO6A 3QORD 5DT7A 3I6KA 1CTNA 3BDKA 3ABZA 3WXWH 4YSEA 4FF5A 4KK9D 5LBSH 1MNUH 4QT5A 1YHPA 4RESB 6ALDA 3N2OA 2JWYA 1JDEA 4GXMA 3GDRA 2Y1AA 4O2CA 2Z35B 4NCC2 1YAZA 1CK0L 3T8MA 4AGOA 2IANB 1U8OA 2XVPA 2YB1A 4A6YL 4UFJA 4C6OA 3UERA 4UQCA 1S9XA 1U8NA 1F13A 4IBYA 1TPDA 1G4RA 3WF1A 5CSSA 1PLGL 3GC4A 3VGHA 1NJ9B 3VA6A 1MI5A 4GBXD 1QSFA 3VD7A 1IFRA 4HKXB 2ZCLH 1US3A 1HCFX 1C5CL 4HS6A 3DBXB 3HRZA 3D18A 2VXQA 4WU5A 3T6VA 3FVDA 3GYEA 5BUAA 2G50A 5C3LD 3VUSA 3MAWA 1CWVA 1IAOB 5IB1A 1A9BB 3GWJA 4G9PA 3QGAC 1JPHA 3LQZA 4Q8PA 3MUZ1 3TBBA 1J93A 2B08A 1ZLVH 3GNMH 2R0LL 3TE9A 2Y4SA 3UR7A 3ZE1F 5BMWA 3B9EA 5CJOH 5LAXB 4C4BA 4IU2B 2ED7A 4ORGB 3LTYA 4I6VA 4XZUB 1ZANL 1VCBC 5C09D 1GPWA 1HEJC 2ILLA 4YHMH 4KK8D 1JXGA 4JM4L 3SGKA 3NACL 4FMKA 4FS9A 3MRKB 3BUYA 5SV3A 4XO3A 2YEVB 3UTTA 5HMDA 2VWSA 3IDNB 1RZGB 3WJLC 1L6FA 2PCYA 3IRDA 3SDYL 5FGBC 4I88A 1Z9NA 4N90E 1KTNA 5IVZA 1MVYA 2CM5A 3IIZA 4M5YL 5KBNC 3E8VA 4F20A 3D39D 1H3PL 4DB7A 1MG3C 5SWSE 4X9FA 1KFLA 4FP1A 4NT6A 3LSOA 5I8CA 1Q72L 4PHXA 3FUKA 1MIEL 4MTVA 1OVZA 1GGCH 1VFMA 1FA2A 3GVQA 5BU6A 2X9ZA 2BIQA 1PF3A 2CGRL 4BUHA 4AY7A 4PTNA 1BVOA 5DZ9A 2JCCA 2WJZA 5C07D 4CJ1A 4M8VA 3BOXA 3UTPD 3IM1A 3GB6A 4RMTA 2Y89A 4MIMA 4NZFA 3SQSA 4U1JB 4YHLH 3T65B 5HI3C 5CJ5A 4QO1A 4L37B 3MUCA 2XSBA 2A9AA 3LSBA 1ZWIA 2WJDA 5HNTA 2JELL 3G3MA 3GG8A 2ZUWA 2J9ZA 4LRSA 2H0JA 5AECA 3RR4A 3AQDA 4A2DA 1JMXA 3KPRB 1KN4L 2CMRL 4MAYA 4LFYA 2QCGA 3RR1A 2VDOB 3OYXA 1FIGH 4TSBH 1HK6A 1CECA 1S2UA 4TNVF 1DQQA 3E9TA 5FF6A 2XFWA 3PY9A 3B2PA 1QBML 3IEAA 2F53E 1A02N 2I07A 4HH8A 1S7XA 5CCGE 3MBEA 4FF7A 3RWHB 4JFVA 5C0NC 1X7SA 4C6CA 2VM3A 1E5JA 4X6BB 4NAFA 4L9LB 4LSTH 5ADOL 2R2HB 1ZLEA 4L1DA 5CZ0A 4Z0BL 4NNXB 1V5XA 1YCSA 3KLHD 1O5KA 5EZIL 3QMSA 1G9HA 1VPOH 5AL8A 4DERA 3LEPA 3NCMA 2PCEA 3L81A 3B7YA 4LCWE 1V7NL 3CXDH 1P43A 4DOHE 3IJIA 1ZBKA 3O6LL 4LWWA 1NSNL 15C8L 2OSLB 3QJZA 4GNJA 5AB1A 1QO2A 4UOZA 1JDDA 2XBDA 3MHGA 1T99A 1KB9J 2W65A 1R34A 1OGGA 2C18A 2DD8H 5E94A 3QHFL 1QA9A 1E0UA 4JAMA 3OB8A 4ZTXA 3SKJL 3OKNA 3VKAA 2WAQA 4WCYH 3CFKA 4JO1L 3A6CL 1AC6A 3W7MA 5EU6A 4XZWA 3TVAA 3SKMA 3VABA 1TPFA 4S39A 3H2FA 2DZWA 1NDYA 2DICA 1KCBA 5I1EL 4WUUB 5C2XA 4TMPA 4ZOBA 3L65A 1S9WA 4UBDD 2WMFA 2YRZA 3PF3A 1OZQA 1CVRA 4P9ML 2ADIA 3U6RB 5CEZD 4WHBA 1DJHA 2G9HA 4WFEE 3PP7A 1DLFL 4FADA 2AFNA 3THCA 3LCIA 1LEGB 4M62L 3ULVH 1VESA 2EIMB 1NBVL 4L6HA 2DBLL 3QXDB 4K9EL 4FYQA 4ZS7H 3EEZA 1W72B 3QI9D 2ZWSA 1P7KB 2YAQA 3HHSA 1YEGH 3VXNB 1RQBA 1U9KA 2J4WH 2ROXA 2Z7KA 2Y23A 3QN3A 1SW3A 4P04A 4M1DL 3CQKA 1PLBA 2A4CA 2QSQA 4XK2A 3LZOA 2J7LA 2IEPA 1M7IB 2FQFA 3NYKA 3KHQA 4PB9L 2Y72A 2PR4H 4UT6L 1L0XA 4UFMA 2AEIT 1TIUA 4YBQC 2W9EH 4FQCH 4AK1A 3FCTA 5EIVA 3BHBB 4KJPC 1F9CA 1GOQA 4NO3A 4OGQC 5GRJH 2AGJL 3NFPA 1J9CT 3MV8D 3D6NA 5LGHL 1EAOA 1SY6H 4RFOH 2A21A 3FCSB 3H4GA 4LCYA 4MLSA 4CEUC 3OBEA 4QCFA 1X4YA 4HBCH 2P8LB 3T4AC 4CC4C 1R7OA 4JFHE 3P7YA 4N6RA 2NY5H 2NY4B 4XSMA 2I14A 1GZQB 3VH8A 5D2VA 3T4YA 4MDOA 1X5IA 2G5WA 4KRPC 4ZE5A 1HWGB 1LNUB 3LUTA 1GYUA 4QHMB 4EVZA 3GHPA 3A9IA 1IGFL 4BEUA 4XN9A 4EJ1C 1EJXC 1JK8A 2OCJA 1H7WA 1ZHLB 3S5SA 1QLFB 3VDHA 1INDL 2CA4A 3EKCA 4BV1A 5IVOA 2OEKA 2V2TB 3R8RA 2EKCA 2VWEC 2FCBA 4GAJH 2FZ3B 3FKRA 2LV4A 4HP5A 4L56A 3CVIL 1FAIH 3C3NA 5FEWA 3QIWA 2AXGB 1V08A 2EDTA 5GGRY 4I9XA 1X6LA 3VW3H 3TBSA 5FJUA 3QJFB 3VI2A 3K80A 3KPTA 3KVDD 5I8EB 1QPXA 3KWSA 1SFJA 5AZUA 1XLGA 1KBWA 4IOFD 1URLA 3TSMA 1SMOA 3VFTA 3GH4A 3NA4A 2GPTA 4XNYH 1JPIA 2CKSA 4PAZA 1ET5A 4XODA 1F3RB 1NCWL 3ZWSA 5HHOE 1SGJA 3ARGC 4X0NA 3NPUA 4H00A 1XIWD 1GVSA 3DOSB 4W9IC 3WHE0 3WU1A 3L4YA 4HPOH 2YPIA 3N2XA 2Q8AL 3RUBL 3GVWA 2M2DA 3WLJA 1TTRA 4KO7A 3U9WA 5LKNA 1LG1A 1ZGDA 2HNHA 1A8JH 3FQ1A 3FRPB 3IJEA 1UJPA 1GTEA 3AY4C 2R4SL 3WG7B 5CUSL 3WH9A 5HNUA 3FHQA 3RLGA 3HZYA 2ACQA 4BWUA 3TJHD 1NM4A 4ISVA 5GGUA 3MYPA 1NBCA 3NJLA 5DHYA 2J7DA 2VX4A 2NY6D 2F19H 3L0GA 1JCNA 4RAVB 2IKHA 3RY6C 4CVXA 4GSDL 1NEYA 3MHZA 3SODB 4U0RB 1W2PA 4AIZB 2QVTA 3SN4A 3RURA 3NL3A 1UUOA 1JAKA 5I73B 3HC4H 2CHOA 4YK4C 2WLJA 3KBSA 4NNCA 1BVNP 3FA4A 1HS6A 1MFBH 1IQWL 5KINA 2MPVA 3MFFB 4OIBA 1MPAL 7REQA 4PUNA 3NQEA 2FLMA 4EP8C 2VD9A 2Y7NA 1V3HA 2BY0A 4I85A 4UIOA 2Y07L 5EN2B 3SGEI 2DVTA 1S5WA 4RDQG 4ZRGA 3EGDA 1GY1A 4TX9A 2AQNA 5D2YA 3MODL 3S98A 2BXYA 4GT0A 3EBGA 2ZUVA 5IROA 5HDBF 1GGIL 1A64A 1IBBA 1A47A 1Z9PA 1ZK5A 4TV3A 4Q22A 2E6FA 5CD5C 1CFQB 1QLEB 4YAQA 3GBEA 2FX7L 3P3YA 3VIHA 4JVPA 3VXMA 2HMCA 4JDBA 2W80C 3UZWA 3J2PA 4PBFA 1Q0XL 2ZSVB 1OCWH 3N9RA 4JTHA 2PLTA 4FGMA 2NQCA 4PP2A 1CXLA 2AV1A 2VXSH 1BWKA 3VIOA 3HFMH 1LMKA 1DN0B 3VXRE 3KEDA 1K4HA 4N3TA 3ATZA 3CDZA 5KW9L 4OUUA 3QYCA 1Q9LA 3Q8FA 2RDWA 4ROPA 1VS1A 4Y6GA 5I74B 2NLIA 4G9FA 3S8GB 1Q94A 3CUPB 1UEYA 5EUKA 1G7PB 4WTZG 2R1PA 2VFGA 4JPGA 4R84A 3VFMB 2CYGA 2F53B 2NX3A 3X2QB 3MACH 5BQ7A 1UD6A 1GK8A 3P80A 2NYYC 2WSQA 4OKDA 1X6UA 3LB6C 3G22A 5BXRA 3RCYA 3C75A 1Y8BA 3WTUA 5FL1A 1UZHA 2QEZA 3BLFA 2D7QA 4QGCA 4RFEB 2ZD0A 2A73A 3FO9B 3EOSA 2GUOA 1AO7E 1UB5B 3L68A 3B4NA 1MJ7H 1W3KA 3AMLA 4OGXL 3WFBL 1CGWA 2EE6A 1OE2A 4Z7OE 4C56A 4DOHB 3PWJB 1QSZA 2PP0A 2C7FA 4P46C 3MJ9A 4DW2H 1AP2A 2M83A 1OM9A 4WW1B 2ISSA 3ULUH 3HBPA 5A2LH 4HMDA 4P2RE 5IUCA 1KM2A 5D7JD 4JFOB 1RIHL 2EE3A 3L1EA 3VFUB 1XGTB 1T0MA 4IMKA 4A7UA 3IGFA 2D23A 1OEPA 4U1NB 4I3RH 4N2AA 3MRBB 3VFVB 4N5EC 1BXBA 4KY2A 4FO4A 3EMCA 4MVAA 1AH1A 4Y2DC 5I0XA 4J5VA 4A8IA 3CSYA 1EL3A 4G7EA 3NQKA 1E72M 2ITEA 3UP1A 2BPBA 4YXGA 1CBVH 2ZC8A 3OODA 4ACTA 1OM0A 3T81A 1MKFA 3N42B 3LIZH 3F4VA 3TESA 1KYFA 3N2JA 4NWTL 4X4KA 5E6IB 5D5MF 5TQ2H 4N86A 3S34H 2NX5E 3QULA 1GW6A 2VABA 2X2UA 4JDTH 2GQ9A 3QCVL 2VDPB 1FVCA 2HV5A 2Y7DA 2I7GA 2H1XA 4U49A 5DVPA 1P1ZA 3AXKA 3ZBMA 2CUAA 3HAEH 3S5YA 4R34A 3FB5A 1OANA 1EO8L 1NKRA 3MRPB 3VGBA 4JFFD 3QT2A 5CSZB 1IM3B 2E47A 1B90A 2AKRB 2IPFA 5T8IA 1JFQL 5K9KA 3BH4A 2A1WH 3L4TA 3SCMB 3LEXA 3NRPA 3FVMA 4OWGA 2C9VA 3MJGX 2L5HA 3MPCA 5F9JB 4QBXA 1BGXH 3IPEA 3MCLH 1XF3B 4KGJA 3N12A 2HG5B 4WHCA 3GSNH 4GI8A 3M7SA 3LKRA 2HBXA 1ZALA 2R83A 3IDXL 5F4WA 4EANA 3MO4A 4PJ7A 4QWWD 1GKEA 3UZQA 5FDYA 1RJLA 3W9DA 2NV2A 5F9OL 4HALA 3NSMA 4YL9A 4HSNA 4IIEA 3MVSA 1H5BA 2HTKC 3KYMB 3B3DA 4B5SA 1OFQA 2F68X 3EAKA 4NQVB 3NPSB 3QIBA 1BKSA 4PRBB 4G80B 2KERA 3ARBC 1ZT1B 3GHEL 4JZOA 2A3EA 2HZGA 2C0HA 5D2NC 2YXWA 2HCVA 2TSAA 2UY7A 2IFFL 5E9DA 2AHIA 4JANB 2XQBH 2X4UA 1E9QA 1WLHA 3DHUA 5MKGA 4EOWH 4TSCL 3RX8A 2NT0A 4P23A 1KENL 3OD3A 5HYEA 2DP3A 4NAEA 5MEQA 5AWNL 3W39B 4MHHG 3SE9H 4AIUA 4HUNB 5MENE 3LX9A 4YFLI 2B7OA 5B39B 3O8XB 3ITYA 1RIUL 4NGHL 5CC3A 4DBEA 2B4GA 3G1AA 4PCTA 3MV9A 3W1LA 5KEZA 1D2PA 2Q0ZX 5DR5L 1OYBA 3UO1H 4OVXA 2WLIA 1TJGL 1Z5LB 3DI2B 1SBSH 4ODHH 4WZ9A 4RWYL 2Z26A 3PF2A 5HHOB 1W5OA 3O05A 4XBSA 4L61A 3HR6A 4IGHA 2ENJA 2P43B 5CBBA 4B3LA 2ZAIA 4ES8A 3PZQA 2TRYA 5CS7A 2E6YA 4X98A 1L2QA 1K6QH 4NPKA 3Q8EA 2COQA 1AGEB 3VXUB 2CBMA 5TE7L 3PIQA 2OT1A 3REQA 3KCPA 4QCIB 4OZIF 5CGMA 3B5TA 3CZGA 1HILA 1UVQA 1U1UA 5I3JA 2Y8KA 4DP8X 3D2UB 1PKQE 3UG3A 4DGVL 1QWGA 1G6CA 1BAGA 2WZTA 4RBPK 4UQBA 4WGHA 5EKYA 2Y7EA 4QLWA 4TL4A 4JEJA 5TD4A 2FQEA 1Z5HA 3H26A 2X89D 2XA3A 1W1TA 1DE6A 1UKTA 4WKHA 2JI2A 1SXZA 1A0EA 1VCAA 4ZMQA 2W81C 1KN2L 4XN4A 3CYJA 4M7ZB 1S7QA 1FNGA 3GMMA 1NFPA 1LILA 2K1MA 2P5PA 4YHOH 4FNPA 3I3DA 2Z7ZA 4E41B 1FFOA 2OYKA 4JTCA 1MHEA 2CUHA 4PJIF 3CO4A 5ID1B 3ECWA 4POZC 3T1FB 3EYPA 3E12A 3QIUB 3ZW3A 2HROA 4LGXA 4IPNB 4ZMZA 3VJ6B 3LKSB 1DL3A 1H7RA 4P3CH 5CEXB 4ERIA 2ZZ2A 3DK0A 2BIOA 3MRLB 3ZGHA 2HVOA 2D2HA 3SD5A 4HNUA 1QX1A 2YBRA 1EJOL 3WKMH 1D5MA 5A95A 2PRHA 3LY6A 4NJAL 2WWKO 4HHGA 3WD5L 2HJKB 3SPVB 3QW3A 5FYLH 3LRGA 3O0FA 1PCWA 3LRMA 4LNVA 4UANA 4ZO6A 3MMEA 3OKLA 1K7FA 1C16B 4H2AA 2VDRL 5IQOA 2HPTA 1SXCA 3KTCA 4AF0B 2UY6A 5CPLA 4MD5B 1FPTL 1F2XK 3VZXA 4GT7A 3QHNA 2X4PA 2O6EA 3LHTA 4Y16D 1OAUL 2VW4A 5JOPE 1XLLA 4RMQA 5JPNC 2BC4A 2X0WA 1WQ5A 4G8GA 1E9LA 4JTIA 3QUYD 3HR5B 2WQUA 5LN8A 2PTYA 2HKHL 1E4WH 3EWXA 4NQ1A 3HZMB 1SO6A 3VO0A 2CBIA 1ICTA 1UJTA 1A1MA 4H9XA 5CG0A 4PL1A 4MBRA 3EOAB 3L08A 2P8BA 1YC7A 2IJ0C 1LLZA 5BNKA 1ET7A 3OF6A 3OC5A 5HANA 1SZGA 2OMXA 3K1GA 3DZ1A 1MW2A 2CDFA 2WO3B 1ZUAX 3IJ9A 2PC8A 4REQA 3WH5A 1CO1A 5FO7A 3V4PA 3QZWA 3VK5A 5D2LE 2YK1H 4K6AA 2JALA 2CPCA 3T2OA 3W02A 5FYJH 4LCCC 2A4EA 3DSNA 1D9KB 5LIKX 2XU9A 2H6UA 4L0PB 4YTTA 4AZBA 4M7JL 5DT1H 4HWUA 3TTEA 4C59B 2NZIA 4CN6A 5DD3L 1F18A 1SEQH 2AAMA 4EX4A 3NGBB 3B2UD 1AO7B 3D30A 4F7TB 4Y1AB 4NZTH 3AMKA 1NZRA 3PZGA 2JKTM 2EYSA 5EO0A 4XVSL 3GBNL 5JR1L 2G5BB 3RWFA 4GVIA 4Z7OB 5KVEL 1E65A 4QDMA 4J3OD 3ECBB 4M7LT 5FXCH 1K8ZA 2CCLA 3CXFA 1T1WA 2YEZB 1H6FA 1WXYA 2YL6A 1O95A 4NZJA 5EC1B 3ANYA 4R27A 1BF6A 1A3LH 3RGVB 2CIIB 4P2RB 1V3KA 4DAIA 3BN9C 2BG5A 1H15B 4GB9A 2XTSA 3WHXA 2OCFD 5HHNA 4HNLA 1UH4A 2ZZ3A 3UJ2A 3EJYD 3TUUA 2XWBA 2V5CA 2BRQA 1L9RA 5KS9A 3QY6A 3CUIA 4J9JA 3WELA 4NQTA 4F3FB 1T6MA 5B21A 5K39A 3AM8A 2N1TE 4K7PL 5GGTH 2K45A 1G94A 1N59A 5IQ7L 2FD6H 2GC4C 1SFSA 3WV0A 1KLYA 3U7AA 1SXNA 3FTXA 3EYOB 5F7DB 3PGDA 3MLYL 1P7QD 4DWSB 2IGLA 1G69A 5C8JB 3WGUB 3CN1A 4PRHD 4L18A 4RFNB 4O13A 3V75A 3VXSE 2ENYA 2NX5B 4LDLB 3TZVA 4E2OA 1NCBH 3OHXC 4R96B 4KMTL 5GS2D 3P9WB 1NGXB 3LV3A 5E8DL 1WH0A