3H53A

Crystal structure of human alpha-n-acetylgalactosaminidase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
387
Chain Sequence
b'LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-N-acetylgalactosaminidase
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 129
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h53A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h53A01
3EX4A 2ZA3A 3HOJA 1JD9A 4RX0A 1B57A 4HPXA 3BMVA 3GKAA 4N9EA 1PZ3A 4CQ9A 4GXMA 3N9RA 2GJNA 1TTIA 4B5NA 4GUFA 4O8RA 2ZICA 1CXIA 3QSRA 4O1BA 2YR1A 4S2BA 1HX0A 3TNOA 2FB3A 3L66A 4UMBA 3KVMA 4QNEA 3NL3A 3GTNA 1QPKA 2DZTA 3BV4A 4JTEA 4UFIA 1L9WA 2ATMA 5E9AA 3WEMA 2HS8A 3A5FA 3I6RA 2RDWA 2A7NA 3PBUA 1TPEA 2IQTA 1D3CA 1MXDA 3NQDA 3N34A 1JXJA 1N8FA 1OGSA 2V3FA 3EWWA 3UG5A 4WOQA 3TC7A 3FFSA 3WK0A 1AL7A 3IIOA 4LWWA 2FH6A 1JDDA 1MFUA 2D2OA 3DDGA 3EDKA 4O12A 2AMGA 3BGGA 4ZQPA 3O1NA 5KITA 1QI5A 2C7FA 3L4VA 1LLWA 4QAIA 4HNNA 2VFDA 5A2AA 1G9HA 4NNCA 2WCGA 4C1LA 1W1ZA 5HNRA 4IJBA 2BLEA 2BHYA 3F4NA 2ZXQA 2WKGA 1SPQA 4UCFA 1K3UA 2TYSA 3WDJA 3W88A 1KTCA 4GO8A 4FXSA 4FX6M 2P1FA 3WK2A 2P0OA 3FS2A 2FYVA 3THQA 1RQBA 1UA7A 4WD0A 5AHIA 3LHVA 2NX3A 4H2CA 1H5YA 1VS1A 4RJEA 4NJJA 3BW2A 1AW2A 1AK5A 5CSRA 4BA0A 2CZ5A 3QGVA 3EJSA 4CN1A 1K8XA 4LNYA 1VFUA 1CXKA 2CFFA 1H1ZA 1GVQA 3ANYA 3WDIA 2R8WA 5ABTA 1XL9A 3EJPA 5IM51 5DCBA 2NX1A 4FB7A 4GUIA 3QM3A 1PIFA 3KE0A 2QCCA 3VGBA 3WMSA 3SGZA 3R5EA 1R75A 5AYZA 3W1LA 3DX0A 3W1AA 4DPPA 3Q2DA 3B4UA 1TQTA 3AXHA 1VHNA 2ZRXA 1OFEA 2NUWA 2ZUVA 4UC5A 5LGXA 1WDWA 3TROA 3RF9A 4GUGA 3BLKA 2J25A 5CZ0A 3OVPA 2DJLA 2Y7FA 2AAAA 1KBJA 3OVQA 3WEOA 3QPZA 2FFCA 2PRHA 2ZZ7A 1J0IA 2ABAA 1WZKA 4K7YA 4W93A 7TAAA 4X3ZA 1UH2A 3DH7A 3EXTA 1X7FA 3UPBA 5HXMA 8TIMA 3PB2A 1YPFA 5CZJA 5LSMA 1F74A 3ELFA 2FHCA 5CGTA 3BC9A 3OLGA 3Q94A 5FESA 3W2NA 2ZXAA 1FWSA 2KZHA 4LRTA 2VRKA 2RHGA 2TRSA 2Y61A 1KFJA 1MW1A 1T8XA 2YGYA 5DXXA 1B0IA 1MSSA 5G2HA 5GVJA 2F1AA 3A21A 1WQ5A 6TAAA 2NZLA 2YJQA 2GJRA 1CPUA 1SZFA 1NSJA 3W70A 3EKZA 5EPDA 4NVTA 1U83A 2B7QA 3CZNA 3S5OA 3N2XA 3AJXA 4ONVA 4LXFA 1ZHAA 1XUZA 4YWIA 3P84A 1TMHA 2Y89A 3JS3A 3BVJA 4AEOA 5CPNA 1YXYA 2FIQA 2J9YA 3CT7A 2VELA 3MBDA 2ZFAA 5U7SA 1LRNA 1W0MA 1XD1A 4JCMA 1W5OA 3P8JA 2PC4A 4AF0A 3GAKA 4OU1A 1V3MA 3G1DA 3WY2A 3BLBA 2A0NA 4JTTA 3VGFA 2YIHA 3BLIA 3W7OA 4TO8A 3GXNA 4I7UA 4FEZA 3C3NA 4UTWA 4KWVA 4WSJA 4Q32A 3TKFA 5LNWA 3T78A 3A23A 2WSQA 3W7KA 1HFBA 3P7YA 3LHWA 2D3NA 2B0MA 1M53A 2JKEA 3LLFA 3BUBA 1GWJA 4MY8A 3P82A 4ORIA 1S5VA 3MO7A 3I7SA 4JY9A 4DO6A 3ZFHA 4UR8A 1LWJA 4HP5A 3W2LA 3C6CA 2DZSA 4OHQA 1EUNA 1RP9A 3ZT6A 1Q6OA 4ZVJA 5LHFA 4O16A 2TMDA 2EF9A 3O15A 3W1RA 2A21A 3N19B 5A5WA 1XM3A 5G5IA 1F5ZA 3BVTA 1SO6A 2BXVA 4LPCA 4TMCA 1S46A 3ABRA 3O05A 4E38A 1W5NA 4JTSA 1ICQA 2NSXA 3WY4A 3P61A 6CGTA 3IIPA 4O17A 4A3UA 1LLZA 1L2UA 1VCGA 3HGSA 4GUJA 4LVGA 3LRLA 1EPXA 2AQWA 3KVKA 3PB0A 1Y0EA 1OYCA 3KAOA 4TIMA 3B0VC 3WNNA 1Q4NX 2QCGA 4IMGA 4U2ZA 1WPCA 4U31A 3GXFA 2EHHA 3NQEA 3S0CA 5G1TA 1GEQA 1W56A 3G1FA 3CIWA 4LUJA 3QEZA 5EBUA 3GB6A 3INPA 2CZFA 4LVBA 3OBKA 1LBFA 1TQJA 4XUGA 3IEBA 1EH9A 4X22A 2OX1A 3P8IA 2F2HA 1KGUA 3D51A 3DI1A 3OIXA 4CQ8A 3EX3A 1Q6RA 3L2LA 1TV7A 4OKDA 1F73A 3CEPA 1FCVA 3M5ZA 1PVNA 1S5WA 3VO0A 4NNBA 2DH3A 1XBVA 2X1UA 3BCFA 3L4UA 3W22A 3CEUA 1EEPA 4QM1A 1JRCA 1SZNA 3DHFA 4NQ1A 2OW6A 3MHUA 4UZSA 2XIIA 3TFXA 3GXDA 1BWLA 3II1A 4FNSA 1TRDA 1JULA 1TTQA 1N55A 4AXKA 1SQ7A 3ZO9A 3I68A 1JI2A 3L2MA 1QMLA 3D4ZA 1VGAA 3ZWTA 4UTJA 3A6OA 1T99A 5DXYA 4O1AA 4ML9A 5DY3A 2V9DA 2ZXDA 3RFAA 3TUUA 3W2JA 1T0OA 1DORA 1PEZA 3P81A 1UBSA 3L9CA 2FLIA 3TSBA 4FO4A 3DBPA 1F7BA 4AIOA 2JGQA 4UNKA 4CNNA 3IVTA 4O14A 2O7QA 3M47A 2F18A 4PEEA 3UERA 3LM7A 1KXQA 2DZPA 1I2RA 1O5XA 3OLEA 1MEWA 2VC6A 1DQWA 4I7WA 5FF7A 4J3TA 3T55A 2OJPA 2BXZA 4MIMA 1JF5A 1XKYA 4LRSA 4I7VA 2FQIA 3KL5A 3VGEA 4IMDA 4FIRA 1ZAHA 4MKNA 3CV5A 3WNKA 3BVXA 3CPUA 2F84A 3BH4A 3NQFA 3FJ6A 4LVDA 1EA0A 2ISWA 4TVUA 2H8ZA 2VEKA 3O16A 3M7WA 1CGTA 3E96A 3NYZA 2F61A 1X6UA 2ZQ0A 5I3JA 2VFEA 2R94A 3BGJA 3W7NA 3LHTA 2JKAA 4FNRA 3VGDA 1TCDA 1A5CA 3GX9A 3PWAA 1B4KA 5TIMA 3HG5A 4UFKA 4LS1A 2VUYA 1QO5A 2XWEA 1W31A 1Q6QA 1GT8A 4FLRA 3I7QA 4JTIA 3SIZA 1EWDA 3EWZA 1G67A 2HS6A 3USBA 1GPWA 3R12A 3OVRA 3WJSA 5BRPA 3IIVA 5CZSA 5BRBA 1E3ZA 1F2JA 1CGYA 1LZOA 2BX7A 2ZUUA 3DZ1A 3YPIA 1SMDA 2GUYA 5K4XA 1TB3A 4JL1A 3NPWA 2VT0A 2NWRA 3DXIA 1KB3A 4UOZA 4PSPA 2ZRWA 4WX2A 1IIGA 1XSJA 3IIXA 2DP3A 2FE0A 3LI1A 3BUIA 4WOZA 2X1RA 3L21A 4N2YA 1XCXA 3CTTA 2CLOA 3WN6A 3RNDA 3IGUA 3W07A 2CW6A 5FF3A 2FDSA 2OZ0A 3ABQA 2WKLA 1G4EA 2H8XA 3L4TA 2OT1A 1SSGA 1KXTA 3MJYA 3M16A 4AW7A 1JDAA 2Y7GA 2YXGA 2NLIA 5KMYA 4O28A 3A47A 3DFSA 4JCLA 3NQVA 2VEIA 4OT7A 3TCEA 1WZMA 1XXXA 2C18A 5DFAA 3G0UA 4Y90A 2Y70A 3G3DA 1CXEA 1R2TA 4K8HA 2D73A 1KCKA 5EMYA 3R13A 4FNQA 2GVGA 2A5HA 3G8EA 3BSHA 5AC8A 1YDVA 3TQKA 3MI3A 1TRIA 1D3HA 5HUPA 4L4MA 4RXGA 1IXPA 1KFBA 4O53A 4M56A 4RZ4A 5E93A 2DIEA 4QAWA 4MOZA 2OCZA 1KLYA 3M5VA 2X1SA 2J6XA 3QW4B 2WSKA 2W79A 4RZ5A 5D2YA 1K7EA 1OFRA 2NUYA 3VM7A 1OB0A 2PWFA 3BVWA 3LCFA 1UD4A 4Z1BA 4O1DA 3KRUA 5DCDA 2WNNA 3UNDA 4NJHA 4IMCA 5D04C 1ZENA 2QKFA 3NNTA 4S2CA 4CN6A 2BY1A 1FWTA 4N6EA 3T40A 1LM1A 4AEEA 4CGTA 4BK9A 2B7NA 3TSMA 4JN6A 4H8HA 3BK0A 3TE9A 5F4XA 2EAEA 4AWUA 1OHLA 3BCDA 1GZGA 1OFBA 3CTLA 3EXRA 4AHPA 7TIMA 1E43A 1C8QA 3O8AA 4PEKA 2I1OA 3ABSA 4UNIA 5G4EA 1O94A 3MMTA 4GBUA 1ZFJA 3SW6A 2UV8G 3WK1A 3PM6A 3A22A 1I2NA 4PCFA 3W1UA 3QC3A 2YA2A 2NXGA 3KWXA 1KFLA 3P67A 4O52A 4OIFA 4J3XA 4K37A 1Q45A 1XFBA 3NVTA 5KZDA 3W74A 4JIQA 1KGWA 1JGIA 1VHCA 3QW3A 4ZL1A 1MEHA 3N9SA 2QLYA 1GTEA 3PUDA 3B8DA 1QCWA 5AHFA 1W37A 3TTYA 2V5LA 2JGYA 1SSDA 1FDJA 4QITA 4EWND 4DELA 5D09A 1LBLA 5TQLA 3LV5A 1R34A 2QJHA 4Q33A 1E51A 2WPGA 3DX4A 2E5DA 4O50A 4MYAA 4P61A 2NX9A 3WENA 2FHBA 2VKZG 4CCDA 2YX0A 2QPSA 2WPBA 4S1FA 3B05A 1D9EA 2G97A 3EWBX 5K7JA 3HPXA 4YXGA 5CG7A 3IVUA 4H8VA 3BAIA 3LPPA 2EABA 4HOXA 2WVUA 3TW7A 3B0UX 3GBDA 3DFOA 3W87A 3NQ7A 2QUVA 3CLWA 3DFQA 2TSYA 2V3EA 3BUDA 3QJAA 3CQ0A 4J27A 5HR7A 1PAMA 2WSPA 5E0FA 3WNPA 2CLKA 3LX9A 2VEMA 1W3IA 2H90A 2CPUA 4BWLC 3HG4A 2E0PA 5FF2A 3C52A 1F6PA 3GBEA 4GRSA 2ZWZA 3W86A 3TU9A 1JQVA 5EY5A 3AMKA 1WBHA 1PHQA 2A6NA 3M5XA 2V5BA 5F7UA 2QAFA 3ZS4A 4O4WA 2BY0A 4CQAA 3KVLA 4HPHA 1G1YA 1G5AA 3WY1A 4JGDA 3EJUA 4NXSA 3NGJA 5H91A 4X9SA 3CB8A 3TXZA 4DBEA 1KM4A 1PV8A 3STGA 3NOEA 1UKTA 4GNJA 2Q3OA 1JCJA 2W6RA 3K8LA 3QFEA 1IGSA 4UQBA 4A2RA 3MW7A 3JRKA 4RCXA 2QJIA 1CGWA 2Y24A 5HQEA 3NQ6A 4H3DA 4MJMA 4Q4KA 3TTSA 5AFDA 3DGRA 1WAUA 4JFTA 1VQTA 4NJKA 1SFLA 3CLMA 3IIZA 4JS3A 2D0FA 3W7IA 5E0KA 5DY2A 1VRDA 3W2UA 1FX6A 1P0KA 2XN0A 4HN4A 1DVJA 1WOAA 3NAVA 4BF9A 1KCLA 1ZALA 3V1PA 2Z6IA 1QOPA 1YYAA 4LY8A 5HJLA 4WJEA 4UFJA 3VX1A 1SFJA 3HGJA 3EWUA 1TPC1 2CLIA 3S8HA 4UMCA 3C56A 3AO0A 4K8EA 3WJWA 4AEFA 3L5LA 1PS9A 1KBIA 4JX6A 3KLKA 1UD6A 1WZAA 4HOZA 1NFBA 1M7PA 1VC4A 2BHUA 3VM5A 2YYTA 1M5WA 2YDAA 4O15A 1HXKA 5BMWA 3UG4A 3NZRA 4GI6A 5EL1A 4N9CA 3KEHA 2J9ZA 4KWWA 5HWJA 4M6PA 1HVXA 4NI3A 4Y9AA 2ISSA 2X16A 1BKSA 2WO5A 3NXFA 3NQ8A 3W7QA 1VH7A 3FYPA 4NJIA 4CNOA 3UY8A 1FDYA 3W9ZA 1A5AA 3PUEA 1ICSA 2BZNA 3OA3A 4DEFA 4YL2A 1CGVA 1ODUA 1DJNA 1H7OA 3HPSA 4HPJA 3TAKA 4H6KA 2E6AA 1U30A 1Z32X 1AW1A 1BVZA 2GPTA 2PWEA 3W72A 3M1ZA 2B7PA 2P10A 4JX4A 3FLUA 3R2GA 3LDVA 4XWUA 2WKJA 3EXSA 4MUZA 1O60A 1GYNA 3VX0A 5K4ZA 1H1YA 1TQWA 4UTMA 5F2GA 3STCA 2Y2WA 2F7FA 5EMUA 3S6DA 3VMNA 4NX0A 3NG3A 1DTUA 5C5YA 1Y7VA 1P5BA 1GJPA 1J0KA 3F1QA 2V30A 3PY2A 1U2YA 3GKFA 2ATSA 4EIVA 4PL1A 5FF0A 4UTLA 4ZMGA 1EA9C 5I3IA 1I8JA 1LCOA 1TPWA 1AQHA 2A6LA 2Y5EA 1BTMA 3DI0A 3ZQ9A 4DF0A 3ZR5A 3KOFA 5G4WA 2YOCA 4UR7A 4Z1CA 4O11A 2ZZ1A 2DIJA 2QUTA 2YW4A 6TIMA 4JDBA 1PCKA 1QI3A 1YTEA 2GVYA 4J3SA 5KZMA 1FUYA 1R2RA 3Q58A 4UTTA 1X8FA 4DF2A 2XVKA 3WY3A 1ML1A 1XUUA 1C8VA 3LERA 1OJXA 1UD8A 2DZUA 1YPIA 2CLEA 5SWUA 1M6JA 1W5MA 1HO4A 4LTSA 3C61A 3ZT7A 3QMRA 2FPTA 3HB9A 3P74A 4XZ9A 2BY2A 1LTDA 1GG0A 1YXDA 1UJPA 1DHPA 2ZXBA 2FHFA 4PTNA 5AN7A 5T26A 4LUIA 1KFCA 2QMJA 1SW0A 4CLMA 1FDZA 3LHUA 4IUOA 3L4XA 1FY6A 1KWKA 3TC6A 3G1YA 2WSRA 3TV8A 1PS3A 2HSAA 2A4AA 3K8KA 4UTUA 2QEZA 3LBCA 2QJGA 3TX9A 3W1MA 2Y6ZA 3TQ0A 1FCQA 3FYOA 2FTPA 3F4WA 3KRSA 1YTKA 1SR9A 5A8GA 2NV1A 3GIYA 1TPDA 3TW6A 5D38A 1JI1A 4U28A 1EP2A 1X1OA 3OHIA 1OT2A 4UZUA 3W75A 4RK8A 3UWVA 1LWHA 3RILA 4H8UA 2PE4A 1NOFA 1JUKA 4FX7A 4HSOA 1LOQA 3L0NA 4GFSA 3W7GA 5FEXA 3QH2A 2OMAA 5FI8A 1WBJA 3ABOA 3KX6A 1RR2A 3WJZA 4ICNA 5D05A 2H6RA 3IGSA 3BVUA 2I14A 3TR2A 1D3GA 4ZQOA 1P0NA 3OLIA 1OX6A 1Z48A 1QW9A 1R47A 3EJQA 4KWUA 2EACA 1HO1A 3W1TA 1VPXA 1S3HA 5HDRA 1K7XA 1O7DC 4KMQA 3RLVA 1TQXA 1BG9A 2RDUA 4WSKA 1KM3A 2V2DA 1QAPA 4NUWA 4OE7A 1OX4B 2CLMA 3QMSA 3RU6A 4DPQA 4JYEA 1XCWA 1PE1A 2XN2A 4KFOA 4MPQA 1GVOA 1OFOA 3LOTA 1TQUA 3VGHA 3M5YA 1A53A 4MAZA 2GUUA 4H4IA 1TMQA 2WSYA 4YMZA 2CLHA 3STEA 2EKCA 5BW6A 4GKLA 2C19A 1XH2A 1XBXA 1XDMA 3W3OA 1KGXA 1R46A 2QPUA 1I2OA 1GVFA 1WYIA 3G0XA 3IGXA 4LVFA 4MJZA 2OW7A 2YZRA 3T4CA 2GJPA 4HA1A 5U4NA 3KL3A 3W83A 1TSIA 2X2IA 4N9DA 5AB3A 4TU1A 2X30A 1HUVA 1KM5A 4QJ1A 2E77A 4GUHA 3S5YA 1TPB1 5CXPA 2OYMA 2W0UA 4C1KA 3CZGA 5CLTA 4FMVA 1UUMA 1I2QA 3HZ3A 4R7JA 3WDHA 3GVGA 3S9YA 1VLWA 3BG9A 4WY0B 3STFA 4O0KA 2WVVA 3LCLA 1KM0A 3W7MA 5D30A 3VE7A 2GOUA 4PH6A 2B7OA 4JY8A 4A29A 4DO5A 1HTIA 2E6FA 1RP8A 3K1DA 1G4SA 3CZEA 4CCEA 2ZX6A 2YFNA 3AJ7A 5BOOA 2YPIA 3WK3A 3BAKA 1OYBA 1BVNP 3LGEA 4ADUA 2O7SA 3S1UA 1YTDA 3TK7A 3VSTA 3SSJA 1QOQA 3EX1A 3IRDA 2V3DA 3S1XA 3SY5A 5A2BA 1JCNA 4MLJA 5E6ZA 2FGZA 3U2OA 4AH7A 2WC7A 3KLLA 3BARA 1RVGA 2D0GA 4NZJA 1XSIA 2E8YA 1DQXA 2Z0IA 3F03K 3T7VA 4KKXA 3GDTA 3L68A 3QRHA 2V0TA 3CWOX 4JTLA 4J7RA 2C6QA 3BG3A 4ADTA 3THAA 4O57A 4JFSA 5C6MA 1G94A 1M7XA 4AYGA 5K2ZA 2YA0A 1K02A 3UYCA 5AHEA 4GI8A 4MZ1A 3TDFA 4Z1DA 4M7TA 1QHPA 2YYUA 1FXPA 1LORA 4FLQA 4B9ZA 4GWEA 2ZYFA 2R14A 1E40A 3HJEA 2GQ8A 7CGTA 3DX3A 4E2OA 3C4UA 3OG3A 2CZDA 3W1PA 3QZEA 4LOCA 3PBYA 3S1VA 1BLIA 4GQQA 5DO8A 1B2YA 3KL0A 1HL2A 3L65A 4FIQA 1I4NA 1YADA 4QIUA 3G1SA 3BLEA 4LC8A 1DOSA 3NEVA 4YLWA 1T96A 4AHQA 1GJWA 3NQGA 2E6DA 2F7OA 3OLDA 3GAYA 4UQ9A 2ZX5A 2OYLA 1HT6A 1LBMA 4DQWA 3FJLA 5HWMA 1WZLA 3MYPA 3M41A 3SI9A 2IGTA 5AHLA 4OV9A 3G1AA 3W7RA 5LNSA 1A5BA 1KWGA 2ALDA 3U6WA 3FIGA 1K8YA 3BAXA 2DZXA 3W73A 2C0AA 3ZSSA 1YDNA 1IXQA 1MW0A 3W7JA 1MO0A 3GR8A 4ALDA 1VIWA 2CLFA 2BY3A 1H7NA 3NO5A 4HOWA 2C8NA 3GDLA 4UMAA 4MFEA 3SR7A 2VFIA 2E09A 1JUEA 2WCSA 1ONRA 1DHKA 1JCLA 1XBYA 1CYGA 3NQCA 4J3WA 4JEQA 2NT0A 1EB3A 1UB3A 2QCDB 2NXHA 2J9XA 1M7OA 1OSEA 2NV2A 4UTHA 3HGOA 5DBTA 2A1YA 1HTYA 5BMXA 4OWGA 2QDGA 1DKWA 4JIPA 3MP3A 3DFTA 4UQDA 1AL8A 1KV8A 2C13A 1TPVA 4O0ZA 1GOXA 2ZRUA 1QPNA 1W5PA 1IV8A 1I2PA 3W23A 1B3OA 3B06A 1UCWA 2WVVB 5DELA 3BLFA 4X0NA 1R30A 1JVNA 1F6KA 1EO7A 3G24A 4A21A 3O6YX 5K3VA 5J5RA 1CGXA 4BZYA 2J24A 1Z41A 4PCSA 2B4GA 1CIUA 2WJZA 4P2VA 4UXDA 1KFKA 1SZEA 4O4VA 4UNLA 3LRKA 3TMLA 4JTGA 1TO3A 1YDOA 3GXIA 4NXKA 4FNPA 1ME7A 2PWGA 1H7RA 4H7VA 1QHOA 2E5BA 2G5WA 5D37A 3TH6A 2PWDA 4J3VA 1CW2A 4U2YA 1JF6A 3BMWA 3LHZA 4IXXA 3TXVA 4O54A 1H7PA 5E1QA 2ZWYA 1TTPA 1GVRA 2DU2A 2F7RA 3BAJA 4JDYA 5D2VA 2NUXA 1HG3A 3FOKA 1DJQA 4HNTA 4M6QA 3M43A 3E9AA 2R91A 2YW3A 3A9IA 5CKSA 1TREA 4AWSA 2QDHA 2VFFA 3PR2A 1L0PA 1A5SA 2XN1A 4JYFA 1TJPA 1IF2A 4O19A 3UWQA 4J28A 1NM9A 1MWOA 5TBOA 1PL9A 1G7UA 1UD5A 3HO8A 2ZRVA 1I75A 5HPOA 2BTMA 3DC0A 1IZKA 3AXIA 3IK2A 4JNMA 1KLZA 3DKJA 2ZZ2A 5AC6A 4MY9A 5HULA 2AGKA 1BSIA 1ZY9A 2ZUSA 1VLIA 2EO7A 1MXGA 2ZZ6A 3ECQA 2EQDA 3BO9A 1GTHA 2ZZ3A 1H61A 3EDDA 3FEMA 3EJRA 3T44A 3PULA 3EX2A 2ZRYA 1BWKA 4R33A 3TSDA 3FW6A 1Q6LA 1DEDA 1UUOA 1JD7A 2A85A 2PRLA 1WA3A 3G22A 3GDMA 5D03A 1VB9A 1UD2A 1FWWA 3D52A 1OT1A 1FWRA 1PZ2A 2ZUWA 3G0SA 3GZ3A 3R8RA 5F2IA 3G1VA 3D50A 4RXFA 1W8SA 4Y8FA 3UZ5A 3L4WA 3VU2A 1ZNNA 3LCIA 4UFMA 5TD4A 1IXOA 2Z1BA 5CPLA 4M5PA 4AWTA 1CGUA 5AC7A 5BRQA 1KXHA 1KM1A 3CZKA 1OF8A 3GNNA 2VOMA 1RQEA 2Z1KA 1MW2A 1F05A 2VFGA 3PVFA 3BSGA 3VNZA 1V7YA 2XVGA 4XB3A 3MWAA 2CU0A 1PIIA 4UTWC 2J27A 1JUBA 5KINA 4CN4A 1WX0A 1J0JA 3NQMA 4UTIA 1JFHA 3L4ZA 3LTSA 1K03A 2WOQA 5D32A 4UCGA 6ALDA 1F76A 4FNUA 3C2RA 2FPYA 4UQCA 4PCTA 1JAEA 3EDFA 3O6DA 4MY1A 5EA9A 3A5VA 4U4MA 4J9JA 2ZA2A 4Y96A 3W2MA 4CCCA 5DN1A 1NAL1 4ZQRA 3V75A 3VCRA 1QPRA 4ZZ9A 3HG3A 4EF9A 3NQAA 1UH3A 4PODA 3LCXA 4O1CA 1V3LA 1EWEA 3QQ1A 3AMLA 1L6WA 2Y85A 2ZZ4A 2F7PA 1CXLA 1FQ0A 4XQ6A 3W84A 1KW1A 1P1XA 4CNPA 1KBKA 1L6YA 1HL8A 3CZSA 1XH0A 3BVVA 4AYSA 2GJLA 2NXIA 5L6UA 3W7HA 3RIKA 1B4EA 8CGTA 2QCEA 4LV9A 2HTMA 5K9DA 1QI4A 2Q8LA 3O06A 4BI7A 1W3TA 4NNAA 3BG5A 1TPUA 2ZZ5A 3WFAA 3NL2A 4HKPA 2DZWA 1JRBA 3C8FA 1MW3A 4WLCA 4IOTA 3EEGA 3HGRA 1XBZA 3RMJA 3K8MA 3LV6A 4GE8A 4POCA 3L4YA 1SO5A 1O4UA 4AMXA 3VNDA 4K6AA 1OK4A 5J5DA 1H60A 2QF7A 4AMWA 4NU7A 5C55A 2PCQA 4PFMA 5D2TA 5I3GA 2EPHA 1O5KA 1SW3A 2Y62A 4AAJA 3UZJA 4E2BA 5AYXA 3SZ8A 2WV8A 2ABBA 2E68A 2Z6JA 1KM6A 2VFHA 4CKQA 5LKYA 1VJSA 3DDFA 3MUXA 3O07A 9CGTA 3L5MA 1JCXA 2FB2A 3IV3A 2OT0A 3VI2A 2QCHA 5F1UA 1XC4A 1UKSA 4IWWA 4XBSA 4KFNA 1MXSA 1FXQA 1FBAA 3P5ZA 2CHNA 1GVIA 1WP6A 4JFVA 4E0CA 4GI9A 4MFDA 4UFLA 2WNZA 1QNVA 3PC0A 4O18A 1G6CA 2ZE0A 3M6YA 3HF3A 1UA3A 1ZCOA 5C2XA 3HQ1A 5I5RA 3OEXA 1N7KA 1L6SA 3W7DA 3TOPA 4M8UA 5LHEA 3G3MA 2RDTA 5H2ZA 1UKQA 2V2CA 1YLVA 4MZYA 3PG8A 4JR5A 3FAXA 4AMAA 1YXCA 4U3CA 2XVLA 1AG1O 1FWNA 3PSWA 2ZRZA 4JXCA 1EIXA 3E49A 4FXRA 3DENA 4FLSA 1QWUA 4J3UA 3NM3A 1RV8A 5D2XA 3CHVA 1I45A 1SUXA 3TFCA 3VMOA 3LRMA 4XKYA 1TQVA 4MB1A 1G7VA 1OX4A 1OVDA 3IVSA 3W6YA 1SW7A 1EUAA 1ALDA 4HHPA 3M0ZA 3LLDA 1R2SA 1ME9A 1XGZA 1JJKA 1ZJIA 4UQEA 2WNQA 3NQ2A 4K36A 2BSLA 1GG1A 1V5XA 2CXGA 1CI1A 3MI2A 1NEYA 1AMYA 3N73A 1G4TA 5LNRA 1BAGA 3C2OA 4DF1A 1VCFA 1C9DA 2JKPA 4BI6A 3G1XA 4WXYA 4TR9A 3NM1A 5K9CA 3ZSTA 3LCHA 2E9BA 1K7FA 3E0IA 3VNYA 1MVYA 3H54A 1GCYA 3JR2A 4NT0A 3C0JA 1FCBA 5MHBA 3UQNA 2QCLA 1EP3A 5IBXC 2E8ZA 3UXDA 1OX5A 1SO4A 4MLRA 3E02A 4FHAA 2EGZA 4QSHA 5FEWA 1QPQA 4L4LA 1S5TA 1TPH1 1NVMA 3SFKA 4WY0A 1JCYA 4W9TA 3HBLA 1LROA 1OK6A 3WJXA 2ZUTA 2A7RA 3M44A 4DO4A 2A7PA 3KVJA 1H62A 3W71A 4ORMA 3BW3A 4X9YA 1NF7A 2F7QA 1JR1A 1Z44A 4MZ8A 2CZEA 4IXHA 3H53A 4IPJA 3NPUA 1X1ZA 3P60A 1XCFA 3Q37A 4AVFA 2X1TA 3S2CA 4EF8A 3PAJA 3NA8A 1W54A 4HIBA 4PC8A 2XWDA 3GDKA 4R34A 4AHOA 3MI6A 4TX9A 1H3GA 1KBBA 3GDRA 1AW5A 5KTLA 4OBTA 2XIBA 3MYOA 1KM2A 5CZTA 1SZGA 2NWSA 1JG9A 2I9EA 3O63A 4BFAA 3EX6A 4LT9A 3VFLA 3RLUA 5I0DA 1QFEA 3KRZA 3CPRA 3PG9A 3EDEA 5CGMA 1VYRA 4RZ6A 2LLEA 1VCVA 4LVAA 1ZAJA 1EO5A 2CWNA 5F2LA 3L2IA 5I3FA 4DXVA 3WNMA 3B04A 4I9AA 3UG3A 3L5AA 4BWLA 1PCWA 1EP1A 2VENA 4M6VA 4N4QA 3ATZA 4XBKA 3ZR6A 5KSWA 4A22A 4OV4A 2ZX9A 2ZX7A 4DBDA 1TIMA 3TA6A 2QCNA 1OFAA 3FAWA 3DFPA 4GINA 1LOLA 2A2IA 5D02A 1XD0A 1QWNA 3VSVA 1BEUA 4ATWA 1CX9A 3KHJA 2ZBTA 4NJGA 2EADA 2ISVA 2C16A 3H55A 1H51A 1C29A 2DZVA 5F4SA 4XKYB 1DBTA 2YKKA 3RK8A 3LTPA 3UEQA 5D2WA 1CLVA 1VFOA 1Z42A 4JTHA 1G69A 4HNUA 1JL8A 4Z08A 4WQ6A 2Y4SA 3I65A 4QISA 1G4PA 4FF7A 5LNUA 1AVAA 4GQRA 2VRQA 3DX1A 2G95A 3NPXA 4PA8A 4IPIA 3ZOAA 4O10A 3UY7A 5EKYA 2QMKA 2OSXA 4N4PA 1H7XA 1WO2A 2D0HA 4EOUA 3HMJG 2BXYA 3NL5A 4G1KA 1ADOA 3MHGA 3BAWA 5G2WA 2VNCA 3R89A 3GXPA 1QX1A 4LS0A 1LYXA 1JXKA 3L0KA 4ADSA 4JL2A 2V2HA 3DU0A 2QCDA 1XI3A 3HG2A 2DORA 2G3MA 3PBVA 5KZEA 1K8ZA 4ZQNA 4TMBA 2ZIDA 4YCOA 5A2CA 1W3NA 5F4WA 2OSYA 4HT3A 4JFWA 3BAYA 2RH9A 4U33A 1A50A 4EVZA 1FCUA 3D0CA 2QCMA 3PSVA 1JIBA 3TQVA 1J0HA 2EAWA 4GJ1A 1XSKA 1JDCA 3M07A 3NR0A 1TV8A 4LQ1A 1QO2A 2FH8A 2OSWA 3KFTA 3ATYA 4ZQMA 5D33A 4AIEA 4LU0A 1MZHA 3CWNA 1DV7A 2H3DA 3PUOA 4K39A 3KXQA 4XTDA 1AQMA 3UD6A 1ZJBA 1B9BA 3PS7A 2C1HA 3WJYA 1TTJA 2V8ZA 4JD4A 3BW4A 2VEPA 4YCPA 1KTNA 2ZDRA 1GJUA 4IMFA 1ZJAA 4JTKA 3DX2A 2Q8ZA 1H7WA 3SJ3A 1PPIA 1OF6A 2PURA 2Y88A 1E3XA 4OJYA 4ZQCA 3MP4A 4AF0B 4WZHA 3B03A 3G1HA 3VMPA 2DH2A 3L67A 3W7CA 4Y6GA 4IQLA 3ZWSA 2EJ1A 1QPOA 4N6FA 1V3KA 3IJ7A 1QWGA 1PJ9A 5KEZA 2TPSA 1JCMP 3S5NA 2PWHA 2HMCA 5DBUA 5K9XA 3A4AA 2FJKA 3W7PA 3CM4A 1IZJA 2GQ9A 4GC4A 3TJLA 1RPKA 2TAAA 1H63A 5CGQA 2ZTJA 1VYPX 3GXMA 4PSRA 4IX2A 3HIJA 3ZR4A 2Z2UA 4MYXA 4R53A 3G8RA 2C3ZA 3DAQA 4M7SA 5DCEA 5HINA 3DFNA 1KFEA 3W2KA 1KXVA 3W37A 3ZT5A 4NZFA 3S42A 4FLOA 1TJRA 1WE5A 1ZAIA 5AOUA 1LRTA 4BI5A 3P80A 5IBXA 2JK2A 3MHFA 4WF7A 2ZCGA 3TMQA 3UXAA 1UASA 4JYDA 3GK0A 1LDCA 5G1YA 5LZLA 3W76A 4AB4A 4RV8A 1DL3A 1KV5A 4WY0F 4UTKA 3GXTA 2JBMA 2QUUA 2CLLA 2WQPA 1HL9A 3M9YA 4N9BA 2AAMA 4LS2A 3LXAA 1OFQA 1V3JA 3GLCA 3L0GA 3GYEA 1IXNA 2C15A 3EDJA 4UQAA 3WELA 1R33A 4MVAA 2YFOA 4IMEA 4IGHA 5E6YA 4PL2A 1W9XA 3TJXA 1XV8A 1IIHA 5CPMA 5EYWA 5CSSA 5HR6A 2E4TA 4HSNA 4JICA 2VR5A 4RKAA 3VKJA 1SO3A 4UUIA 4X2RA 3LPOA 3N2MA 1BPLB 1Q3NA 3W1QA 4LW7A 5F1VA 1P6WA 4FX8A 5A6LA 2C14A 2F1BA 1BF2A 1VJIA 1KTBA 5AYYA 5BNKA 1ME8A 3D4YA 1VR6A 2OYKA 1TCMA 1UOKA 3WNLA 4K38A 3C2VA 1J4EA 5HUOA 1J5TA 5LGZA 3EJTA 2J88A 4GO9A 3CC1A 1CXHA 5E70A 3TIMA 1TPFA 5AHNA 2FPVA 4A2SA 2XFWA 3S1WA 3NZ1A 1LRQA 4KFPA 1CXFA 3BUPA 5G2IA 1TV5A 1WV2A 5CLWA 2BWGA 1RPXA 3LI0A 1VFMA 3EWYA 3W7LA 3EKLA 4D2JA 5I3KA 1CDGA 2NT1A 1AMKA 1VYSX 1QR7A 1MFVA 3WFZA 3HPZA 3SECA 1MEIA 4UOQA 1U5JA 1D7FA 4XTIA 2WANA 3PF3A 3VGGA 3UPWA 2PRMA 3QQ0A 3W7EA 2VXNA 2WVTA 3C2EA 1GYLA 3W1XA 4OGZA 1WOBA 1J2WA 3DHUA 2YA1A 4LV4A 2EEXA 3FKRA 3U8GA 3W85A 1A47A 2V82A 3FA5A 3DHDA 1RD5A 1XDLA 2YCEA 3HJZA 5FEPA 3O6CA 2X2GA 4JTFA 1UH4A 1WXJA 1HNYA 3TONA 1OABA 2RKXA 4WXZA 2X2JA 1W5QA 2YSWA 5HWNA 1RQHA 5A6MA 3LBMA 4GIAA 3QMTA 3GR7A 1PHWA 5L9FA 3S5ZA 4BR1A 5HMSA 5I23A 2D3LA 5I3HA 5AHMA 1XH1A 3CZLA 3BPWA 3N3MA 3WNOA 1EX5A 4Z1AA 3LB0A 1VAHA 1JQXA 3UWUA 4B9YA 4UFHA 3FKKA 3GNDA 3IJ8A 2E1DA 2GQAA 3DHPA 3QF0A 1GQNA 3CIXA 2Y63A 5C54A 1OFPA 4JTJA 3B0PA 3EWXA 3E12A 4UTTC 3LXCA 1EHAA 1SU5A 3G18A 2Y7EA 4WUIA 3C2FA 4QQ3A 3K30A 1THFD 1RZMA 1HWWA 5FF4A 4E2DA 1SMAA 3CU2A 4NX5A 2G3NA 3UWZA 4Z0SA 2E5CA 3I7RA 5FEZA 3LCGA 2QR6A 4Z0JA 2BHZA 3CGTA 2Q3RA 3W38A 3W1NA 1ZS2A 3PBWA 4FNTA 1OFDA 1QDSA 2ZTKA 3BUQA 5F2MA 4M19A 3UWWA 1LOSA 4JTUA 4O13A 3QYQA 2G96A 1TYGA 2QCFA 3DKLA 2QAPA 1P4CA 1VZWA 3NDOA 5DLCA 2ZX8A 5LNVA 3VSUA 3UWYA 2Y7DA 4LC6A 3QPYA 3EB2A 4IX0A 4JX5A 4QNWA 2GVJA 1U33A 3SGUA 3IJ9A 2ZA1A 4K7VA 2ALWA 1H50A 1OG0A 1QW8A 2X2HA 1LP6A 3MP5A 4CVWA 3P62A 4JFUA 3LTYA 3NL6A 3BLPX 1GVSA 5I24A 4UIOA 3VE9A 2H3BA 2DJXA 3A24A 2WVSA 3MBFA 1O95A 3UCQA 4RLIA 4RR4A 1TQSA 2QV4A 3LXBA 3LHYA 4HNVA 1ICPA 2WNWA 1PIGA 2V81A 1OYAA 4OQVA 3P5YA 2GVLA 1UD3A 3QSTA 4N02A 1KA9F 2RFGA 3LCWA 2E6YA 3N14A 5CPOA 1NF0A 3NPVA 3TAOA
chains in the Genus database with same CATH superfamily
4HS6B 4ZQKB 1XIJA 4BJLA 1WWAX 1ZDSA 4N9EA 1IC5H 2TODA 2YR1A 5BVJA 1WH0A 4IRZA 1TWIA 4PREA 5DO2D 3RO6A 4GNVA 3DX7A 4RGNB 3FT4B 3L5WA 4NQDD 4ELMA 4XZMX 4WVXA 3G5WA 2B0SL 3AHZA 5KITA 2G0KA 3FL7A 4RNIA 1HJVA 5HHQA 4FXTA 5C0RH 4OGAD 2ASHA 3TZFA 4JFDD 2JK5A 1SPQA 3PPFA 4FXSA 1CGSL 3PZVA 4D71A 4GCXA 3STPA 5CMAA 4XNYH 1MG2C 5C0EB 1YEFH 5JTWA 1WEJH 1OBAA 1C93A 3AUVA 2AEPL 1AZ1A 2FX9H 2RCSL 5EZLA 3TYGL 3C6LA 3AXHA 1BVLA 2XVPA 2NUWA 2VDKB 1E6NA 1UACH 3BGFC 1GYVA 4Y19D 4C4BA 2XKSA 1TETL 4DEWA 2WBGA 4K7YA 2QDWA 4QRSB 1TWWA 1NCTA 1RAKA 3MRJA 1N7ML 2YGYA 4WK9A 3PV6B 1N5AB 3OVUB 2FGWL 1O6VA 4NVTA 1YECH 4EP8C 2Z64C 2B7QA 1M6OA 2BC4B 2O5YL 2DBLH 3KPQB 2NY6C 1TMHA 5GS3A 4OJFL 1N59A 4HBCL 4X6CB 4MCNA 3B9DA 3PHAA 1E6JL 5AVXB 1N6VA 1LRNA 1W5OA 3VAEA 1V93A 3KJ4B 1WKFA 1NEZG 3PWVA 1BG4A 2R24A 4C60A 2OLSA 4HPYH 3RY6A 4Q6IA 3QV7A 4GQGA 4LCWE 1SGJA 1GWJA 1JPGA 2P24B 3MO7A 2WHVA 2XQYA 3S5LA 3G08A 4LSUL 3VKDA 1B3ZA 3M17A 2MFNA 3QKEA 1G6VK 2XDFA 4GPNA 1ICQA 5AC5A 2PPAA 4O17A 4A3UA 1FAIH 3ESOA 3L5JA 1EPXA 3ZE2F 4Q9QL 1TWDA 3FGCA 3QA3A 3AIEA 1UM6H 1GEQA 1QBLL 3PTKA 5D1ZI 3VOGA 1SGKA 3O4LA 3QUYD 6REQB 4NF7A 5KVDL 3WUFA 1DJHA 1LBFA 4QO1B 5IB2B 2ARJQ 3EO0A 5BMFL 3G5XA 2C9SA 4XVDA 4X6CF 1MRQA 2JF7A 1SOSA 4URTB 2NLYA 3QRGH 2FTYA 1ADQL 1EQWA 3CEUA 2DI8A 1F3DJ 5E9NA 1JULA 2R9RA 2XACC 5HVHB 3JUGA 5LLIC 3ZWTA 2FZNA 1WAWA 2VLKE 5IESH 3MSPA 3GHUA 1TDQA 3EOLA 2ILLA 4WU5A 1MHHB 2OS7A 1PSKH 3NSJA 1E5BA 3KLAA 3MDUA 4GRMA 2JGQA 2R1WA 4PQXA 4RW3A 2DKSA 5MI0B 3S8GB 4AI7A 1MQRA 1U8OB 5E2TH 4W9EC 1YEWA 3QXAA 1AGFA 1UB6B 1KB5B 5LXXA 4R7NA 3E1ZA 4NN7C 4O51B 4JTDA 3IFLH 3GYCA 1ZHKB 1EA0A 3RUGE 5DX7A 1E4XL 5GS1C 3APMA 1X6UA 1TCRA 3DUSA 2ERJC 3IJIA 1VFLA 2HK1A 4FKEA 2VUYA 1Q6QA 4JTIA 1EWDA 2YBGA 5KZCD 1RIVH 2UV3A 2VUNA 4GP5B 3REQA 2EICA 2FE0A 4DSYA 3SBRA 1XZWA 4PJHF 4YHZH 1W0YT 1LEIB 4P5TD 1YMYA 3TJEL 3UESA 1A0QH 4BFNA 3V18A 2WUCL 3A47A 5K9KB 3TR9A 3FO0L 1R2TA 4AEHH 2Y69B 4M0XA 1D9KA 4YQXH 4WNQA 1FLTX 1YQVH 1ZVHA 5DFWH 2RA1A 3LNPA 5EU6B 2OG9A 2OCZA 4PUBL 4MWAC 5D1QC 1LO5B 1OB0A 4CMHC 4D3CL 3UNDA 3SJVD 4IMCA 2UY4A 3CXHK 2VDML 1CN4A 3BK0A 3KTSA 3I9IA 4QPEA 4G42A 4D6IA 1M6UA 1I9CB 1SXCA 4NKMA 3WK1A 3QIWD 3MREB 4YPGA 2Z7YA 3P67A 1QI0A 5JMOC 2J8GA 1LVEA 5DJ0B 5ID1B 3N9SA 4EDXA 4Z9KB 5DQDL 4EWND 2WJ7A 4N26A 3VOFA 1IQWH 4LPYA 3IJHA 1FZMB 5AENA 4B5EA 4DNHA 3LZRA 1JVKA 4TRPH 5FYLD 3BT0A 1EJTC 4HOXA 5DR5H 2F0CA 2NX5E 2MRYA 1Z9NA 2G0WA 4XSLA 5JDSA 4NO3A 5IBLD 4RQQA 4ZMLA 1BFTA 2VLME 4PRBA 3FCTA 2K0RA 5EOCL 2XYCA 5E2UL 3GJFA 3MOBL 3E3QE 3IDIA 4APQD 1KM4A 4C83B 2HEJA 3L81A 1LD9B 1CLKA 4GD0A 3OKDB 3EYSH 5IHRA 1C8XA 3QH3A 3W2UA 2VXUL 3WLSA 2CUHA 1KCLA 4XRCA 2ORBH 1CYXA 2NDFA 4BBWA 3L5LA 1IUZA 5AZEL 5EUOE 2YAQA 5D7JB 3FQNA 3UG4A 2ID5A 2OEJA 1U6AH 3BI9X 3EB4A 4QR6A 1FYTB 1QG3A 3ARFA 1ICSA 3IU3B 3ARDB 5B7EA 1BVZA 4HS8L 2HLAA 3OB0K 4Y1AE 4G9DB 2OSLA 2BCMA 4N6QA 4JRLA 1NWSA 3MNZB 4MUZA 4AGMA 1OZUA 4YYCA 4OZFB 5E5MB 3O9WA 3KPRD 3SUUA 3EJCA 3QG7H 2Z00A 4L1GA 2ATSA 4Z2JA 5FYLH 2R8SH 3N2JA 3ZDYF 4MSWA 3R7QA 3FSZA 2QADB 1A6PA 2XZAL 4YDIL 2VDOL 4J3SA 3BYYA 4U1IB 5H35A 1X8FA 2HVOA 5EUKA 1UCBL 5T1DH 2XFGB 1EZWA 5GGQH 1MJ7L 5DUMH 3G5VA 3PJXA 4MAYD 3FTGB 4NQCA 3RVUD 5AN7A 1FWGC 2G5UA 1QSEE 2YRLA 4IUOA 2VDHA 2YD0A 2GB2A 1G7MA 4FKHA 4UTUA 1ZLUH 1HZLA 3GC4A 3QPKA 5D38A 1A6ZA 1P2CA 1XCTB 5F97E 4RUBA 1PYWA 3RILA 2W65A 2HPMA 4H8UA 4HSOA 1HH9B 2P5NA 2AQ1A 3MCOA 4XBEH 3X17A 4Y5VB 2FYYA 4LT7A 1E7UA 3IGSA 3BVUA 1D3GA 5IUSA 4IM8A 3HAEA 4OZHF 4LP4A 1CCWB 4KMQA 1N19A 1UKPA 5BV7H 5CP7A 2OR9L 4XPAL 4J8RA 4AITA 5GGTL 1GVOA 3NABL 3VU1A 3L2NA 3TZVB 2XFFA 4HVXA 5LBVA 5DCCA 4PIBA 1EANA 2WSYA 1MI3A 1YMMB 4PJDE 2LABA 5BW6A 3WE1A 3KM8A 1O5PA 5GHWL 4K9JA 4AZIA 3IAQA 2JQXA 4BGDA 1NAMH 4JO1H 5CLTA 3QQ9D 5DD1H 3WDHA 1K70A 3RKDD 3CCHB 4I3RL 2E6FA 3A6BH 1PW3A 2DYPD 1O7VA 2XA8H 4NI8A 2UBPC 4JR9L 5IROD 5ALBH 3ZXWA 3EX1A 3AXKA 4LQFL 4NSBA 3TN0A 2Z31A 2FGZA 3KLLA 4OCWH 2EPMX 3C60B 1A4KA 1ZJHA 1NWUA 4HIPA 2I7OA 4TNEA 2Z0IA 3SAZA 2YD4A 2KLSA 1RK1A 4OF5A 4L1BA 1A7PL 5C6MA 1HCZA 3WIHH 3H6AA 3HUJA 4P3DA 4MZ1A 2IQ9H 4HJ0C 1GPOL 4G7YL 5ABDE 3N42F 5FCSH 4JFEA 3SQBB 3QJFB 3EOBA 1YADA 2V4LA 2ZOKB 1U2CA 4MB4A 3IDNA 1JMXA 3NQGA 4P4RA 3OLDA 3GIZL 4DWHA 3CS2A 3MYPA 3EH5B 2OTDA 3TYFB 4C57C 1HZKA 1ZA3A 4U1GB 3SE4A 3IJYB 3HURA 1ZLSH 1BVOA 4NZ4A 2EXTA 3MC0A 3EH3B 1Q85A 3QXTA 2AJYL 3MVIA 1BYDA 4X0NA 2V3GA 3VNLA 3IKCB 4GGBA 5EEXA 5E5CA 2QDVA 2ACUA 4KK5D 4ATDA 5IMKB 4JZNA 1SEBB 2VN4A 2C9UA 5L88H 1YDOA 1F97A 1BQRA 2E5BA 1YY8B 5KYWB 4OCSH 3RM4A 4E9QA 4J3VA 5J56B 1H7PA 3VFPB 4J6RL 5BQ7B 5IEHB 3RVXC 1Q9OA 2IS7A 4HNTA 4ZFQA 1D5XA 2J7FA 4TUFA 3BGMB 3UO8B 3EMQA 2YPKB 5CKSA 4PJ5A 4XWGH 1TREA 2VD9A 2VFFA 1IF2A 3GSQA 1UD5A 4ZFOB 1I75A 2ZRVA 4NRXB 4I5BA 2VDNB 2Q6WB 3SRFA 1ZP4A 3CHPA 3AHYA 4YSRA 3MMEA 5H6HA 3G6DH 4WWNA 3QPQC 3GHTA 4RPPA 2KKQA 3T1GA 1JDFA 3PRZA 2ZNWA 1RZIA 1OT1A 3ZYOA 4NZ1A 3WTYA 3SD2A 4L8DA 4L5FE 3KZPA 1XGYL 5L2JB 3T3MF 3V16A 2Z1KA 1F05A 4B41A 1U8KB 3CMOH 5AC4A 2RACA 2X1WL 4CN4A 3RWCB 2A6JA 4F2ME 2WOQA 1CG9A 4PWHA 4UOW1 1N2RB 4U4MA 4J9JA 4Y96A 2J5WA 1HILB 2XPZA 3VCRA 1PLAA 4M1DL 3Q8CA 2D7TL 5EEYA 3M7SA 2QKIC 3HG1B 1Z5LB 1EC8A 4MGGA 4BQ5A 3PK7A 5TQ0H 1M3JA 1TEGA 5F2FA 4GC3A 5L6UA 2QCEA 2YL9A 4NIYE 2ZZ5A 2EG8A 2DN7A 5D2LE 2A6KB 4PB0H 3DGDA 1ZTVA 3BP6B 4NSKA 4PJGE 2H0PA 1PQZA 4J5VA 1H60A 4XB8A 1A7OH 2FBRA 3SB0A 1MFAL 1I3RA 4JY5H 6XIMA 3LKRA 3HHRB 2E68A 4U3SA 3GSVA 1Y5XA 1JCXA 5J0BA 1XC4A 4DWSC 3W0WD 5CUSH 5I75C 4FQHB 1NGQL 5E99L 5EPMB 1QNRA 4MNQD 1UMYA 4AXWA 2DZEA 4P8UA 4GZIA 3R6IA 1J79A 3OBEA 3QDJE 4MA1C 5ICXB 4E4FA 3DVFA 5HHME 4HIJA 3VD9A 2R2EB 3QLLA 3INUL 5FW8A 2C71A 3FAXA 4U3CA 2XVLA 3O45B 4DGVH 4KITB 3CMGA 3BWUC 3MUHL 4XAWH 5E5RB 3FYYA 3VMOA 3ARPA 1G7VA 3ONBA 1SW7A 5A8OA 4MCYA 4BQ9A 5RUBA 4IYKA 3RJDA 1B2WH 4NO0B 4V33A 3C2OA 5F93C 2OJZL 1DSYA 3GLAA 1NFAA 3CDGB 1ZTXE 3HC3H 1ASQA 5BS0A 5IBXC 4W4NA 4QSHA 5FEWA 4FP8H 4P2OC 5I8OH 5C6TL 2AJUL 5F9AC 3EYOA 4S3BA 3O41B 5CQ1A 1RZKL 2IDQA 3MV9E 1SN5A 3K6FA 5EZIL 4AHOA 2DV6A 3LMZA 4WDIA 3U79A 4M3PA 3LMJL 2RAMA 2IPKA 4PJAF 3WCYA 2CLZB 4NM4H 4IIEA 5DFVC 3FO1B 2BZDA 4J3OD 1U9KA 3SO3B 3AQDA 4TLKA 4R90H 3ZIYA 2O5NA 4HMEA 1H41A 4WWID 3BVNB 4KX8A 1EJRC 1ACYL 3HNTH 1PCWA 4BWLA 3QZMA 5L2KE 3LN3A 4AWJC 2BDNH 4URIA 1PLGH 5GZNA 3DO3A 4RMBA 4RCAA 2WHKA 3T81A 1TNMA 3CQPA 4S2SB 3GVWA 3CSYB 2YEZA 3RK8A 4KJYA 2XJLA 3NZHL 2VRJA 3CWGA 3G2GA 4GJIA 5CD5C 3MWCA 4AYID 4BK5C 4RGNC 3UY7A 3FA3A 3HMJG 2J7LA 2A9NH 2XFRA 4ADSA 3VI4E 1CL7I 4HT3A 4QNPF 2X44D 4WCYH 2H7WA 2J1ZA 1M7IA 2DMBA 3SY1A 1V54B 2KZ1B 1ESWA 2HKHH 4H9VA 1G6RL 5HGAA 5BOPA 1AGDA 1P69B 1FNGA 4WI8A 4YCPA 1YN6B 1GOQA 4PCKA 2ZDRA 2ITEA 1OCWH 2VE6A 4C1NA 2NW2A 1PPIA 5XINA 3ARBA 5LBGA 4N2KA 1CQYA 1UWXH 2Z8WC 5KSVB 3UMTA 4JE0A 2I9UA 1S7XB 3ZR4A 2MTPA 4RZCB 2VDRH 3O3UN 3DAQA 4G6AC 4S1RL 2VX4A 3S42A 3K5SA 4MMXB 3LM3A 5I66A 4FABL 4F2UA 3MHFA 4PJCB 2WLLB 5LCVL 2NQLA 4MA7L 1AJ7H 5G1YA 1DJYA 4AB4A 3EAUA 3BKJL 5MEOB 5K39B 4C6EA 5C08D 2CLLA 4WDUA 5ETUA 1OFQA 3KJ4C 1ZEAL 5D70H 1KDIA 2X0VA 3VW3H 4KI5F 3T0EB 3OQ8A 3ABZA 1OANA 4PJBB 5FA3A 3ARGD 2PF8A 3F7YA 1U3HA 1E5UI 4DTGH 4FX8A 4DHLA 5A6LA 3FO9B 2P88A 2DMKA 5JORA 1TPFA 2HYMA 1TTCA 4UUJB 1KY7A 5CLWA 3SO5A 4F8QA 5ITBH 4KV5E 1QR7A 1GS6X 1GRWA 3NIGE 1FHUA 2XZZA 4NBZB 3PF3A 1RU9H 2BOGX 5I8KH 3CK0L 4DP8X 3BP7A 5F1NA 3RGVA 4RNRB 2DJ4A 4PJCF 3VXTA 5BO1L 5SWZD 2Q71A 4HF5H 1XGQA 3L95A 1Q94A 1BQHB 3SGJA 1GPFA 2G4GA 2QQQA 5DXWA 5HVHC 3B0PA 2FD6H 4FI8A 4KOCA 5EMKA 1DYZA 3MQTA 3I6GA 3IRPX 1ZD6A 4RGOH 5TE4L 3MLXL 4MKTA 1VADB 4I2XE 4XH2A 3CVIL 3D0LA 4KZEL 5MI0C 2W27A 5DLCA 4KTDH 4W89A 4LC6A 1E6QM 4IX0A 4QNWA 1F8TH 3WLQA 4JW3A 3WQOA 1QBMH 1GZQA 1E5JA 3KBFA 5IMLA 5GISL 2NY1B 3BFQG 4AMKH 1K9DA 5F7AA 4ILDA 5HHVL 3SPGA 1KV7A 4ZAKA 5F0PB 1D6EA 3HMWL 2RFGA 1VFTA 3N14A 3N9GL 5CPOA 1QOXA 2F5AH 1KR1A 1DSFH 1B57A 4ZTYA 1C8PA 2CUAA 3O3RA 2ZICA 4PMNA 3QSRA 3N44F 4S2BA 3RVTC 1A3RL 1S2VA 1D3CA 3SE9H 3KCLA 3WK0A 4Q4EA 1JZEA 5I3DA 1B0RB 5DU7A 4JG0H 1QSFA 3O1NA 3L4VA 4I4WA 3RURA 4OR1A 4NENA 4L8CA 5DMKB 4LGPB 2Y9RT 4GH3A 3EW3B 4FQIL 1FGNH 4I3SL 1SBBA 2AEIT 5AHIA 4WD0A 1YEDA 1IC4L 3QDGB 1R0AH 4CL7A 2PNDA 2Y2YA 1AO7E 1SQMA 1AJZA 1GZHA 2I85A 4LNYA 4DZ5A 4K5OA 1E6SM 3SKMB 2CHRA 2JIXD 5FECA 3BKMH 3HLAA 4GVFA 3KWUA 1HHHA 2FFCA 3PDDA 1J0IA 5HYJE 2IEPA 1E28B 1A1NB 1RUKH 1EO8L 3KPPB 3UTQA 5CGTA 5I1GH 5DSCB 1T2QH 1WQ5A 3CQJA 4LHUB 4L7ZA 4TLTA 3OX8A 3TYCA 2CO3A 2YO3A 3P30H 4LXFA 4AEOA 1T0PB 5KG9A 3DGGA 2J9YA 3N85L 3VWKD 5KETA 4D6DA 1ZP3A 3AT8A 3CHOA 3B5HA 4EN2A 4ANKA 4EZJA 3O2DA 3NFNB 2O5XL 3MBXL 5CSGA 1ZCCA 1VGKA 4KQ3H 5FO8B 4NC1C 2GK0B 1CUOA 3APFA 4GJTB 2FB4H 2IANE 3EPMA 4P9HL 2LW3A 4E3TA 3WLBA 1LWJA 4FFVC 1RP9A 4GVIA 5T1LB 2TMDA 3W1RA 4PLKC 4DVRH 5J8LA 4JB9L 5BOFA 3BVTA 3E2SA 3IF1A 4GW1B 3N17A 3W39B 3CV1A 5ACZB 1KCBA 4G80A 3B0VC 1BGXL 3GXFA 1YE4A 3QEZA 1VFHA 4HUUA 1NKGA 1HH6A 4E9SA 1IEWA 1E90A 4PTUB 2Y7LA 3BFWA 3V9FA 1BQLH 3GI9H 5D7JC 1ZVSA 3FT9A 3FUFA 4TN9A 3MXVL 1H6UA 3II1A 2ZCLL 3F58H 5KBKA 3HMXH 5E1AB 4UTJA 3A6OA 2CJSA 3ARDC 4IRJA 1PEZA 3VSQA 3TSBA 3TVMA 5I1IH 2AK4A 4CNNA 2J8UB 1KYDA 2V9TA 3NZQA 3CO4A 2VC6A 3BD4A 3WJMB 3KPLB 1PX8A 1JF5A 3PWJB 1JP5A 2HUHA 3NJ3A 3O3AA 2QADC 3OA5A 4LUTA 3V6FB 4IRZH 3SCMA 3D0AA 4FS9A 5D1XB 5IOPB 2IOOA 4KKLC 3NYDA 3GNXA 4LCCA 5KANG 2XX0A 3I7QA 3N91A 2HS6A 4Z0XA 4LNCA 3WLTA 3OVRA 3OKNA 5TDNA 2CHZA 3VFOA 3EFOB 4IGSA 1SMDA 4PTDA 1OT4A 5C0AB 4PRIB 3HV8A 4TL5A 1NC2A 3WN6A 3IGUA 2W4XA 4LF2A 5EO0A 1T6VN 1WLHA 4R5TA 5D7SL 4B3LA 1EAPA 4KZDH 3NQVA 5I19H 4GQPH 4Y5VC 2DKUA 4IZGA 3GMQA 4RWHA 2PODA 2F54B 4AD5A 5T5FL 4NJ9H 1L6XA 3QFJA 4OD3L 4NP7A 4QAWA 3GZQA 4X0KB 1J9TA 5IHZB 5KYXA 5CF3A 2GWGA 2PDIA 3TZVC 1XG4A 3GRWL 1Z9LA 2XY2A 2CK0H 2QKFA 2KQNA 4XN2A 5L8KB 3T40A 4AEEA 1XLFA 1T04B 1Q1PA 4N1HB 3ID7A 1A9EB 3SDXB 3OQRA 1MHEB 3GBNH 4C5YA 3RZCD 4IS6B 3W1UA 1OB1A 4J4PA 4ZFGH 2WHJA 3W74A 3UGXA 2H2PC 1VHCA 5ISZD 1JZ5A 1B3WA 3B8DA 4QHRA 4IFKB 2KZWA 3V6OA 3QHMA 1RVKA 2E5DA 2APSA 4JFDE 1RCQA 2IH3B 1SEQH 4XD4A 2YX0A 2XWJB 3VIJA 3B05A 2C7UB 2G97A 2FBJH 2GGIA 1ZGLA 2Z91A 5DGQA 5FAAA 4U6YA 3DYOA 1BM7A 1FN4A 3F5WA 1NLDH 4YXLH 4UZGA 3CQ0A 4PJ8A 4BINA 4HJIA 3QRFM 1PYMA 2ZWZA 3QZOA 1UYWH 2V5DA 1F3RB 3E80A 3QS2A 5F96H 1EF2A 3B2XA 4YOKA 1G1YA 2J62A 2J4WL 4XHQA 1T83A 2GJ6A 2JV6A 4DBEA 3H9SE 4HWZA 4R4FH 1LNUA 4G8GB 1D9KD 1GORA 2ICEB 5A43C 2IWKA 4U1GC 3I50L 4Z3GA 2X4QA 4KNTA 3CFKB 3MRKA 1PTAA 2F5BL 3R43A 2J73A 4MS6A 1ACXA 2JCCF 3MLRH 1T1ZA 4DZBA 1UR2A 3NIFF 3BUVA 4F80A 3V10A 2EVHA 3GMNA 4G7EA 1PS9A 2WJEA 2WWMD 4JX6A 1KRAC 2OXGB 1FG9C 5E6IA 3HB3B 2JTYA 2WM1A 4WI2A 5I5MA 5ANMA 3PWIA 2PDMA 1IAKA 1MLBA 2GC4C 3JTSB 4QRRB 5AOKA 2YKLL 4PAZA 4XVOA 1OO2A 3WQ5A 3E74A 2P10A 1I7ZA 5DJ8B 2VDQH 4MAVA 2VGBA 2XVNA 2HH0H 4BKSC 4UTMA 4ZYKA 2DQGL 2HTLD 3AS0A 4XXCA 3NG3A 4DJEC 2GI0A 4EIVA 1TR9A 2JI1A 3KOWA 3Q4DA 4DI9A 1CEOA 3T0BA 3GDBA 3FPXA 1DQUA 5L6YL 4DAIA 3ATAA 4OVUA 4CADA 4OLZH 2VMFA 2XDHA 3IE4A 3U0TB 3DO4A 2QSQA 3KGRA 4X6DB 3CQHA 4M6NH 3NAAH 1FKWA 1UIPA 2LV4A 4CVXA 4DH2A 4NQSB 3GMRA 1CFBA 1R19A 2GC7C 1M04A 2DQFA 2YUXA 4WWKD 2RQ8A 1GAFH 3OKMB 3TQ0A 1MDAA 3P0XA 1LO3L 1JS4A 4U28A 2IH9A 5I17A 1UG6A 3UWVA 1LWHA 2NNRA 2G2RB 3VDGA 3BLDA 1I1XA 4PJ7B 5DQ9B 2VN5A 2XXGA 3ABOA 4LLDB 3BWWA 4QRUB 1VGEH 4KNUA 1CD8A 2I17A 1OX6A 4I7ZC 1QW9A 4KWUA 4BM7A 3HZYB 5K9QG 3RLVA 3HPFA 3BD5A 3KLHC 2WC4A 1JN6B 1QAPA 3RU6A 1PE1A 1YYLL 1OFOA 2BX5A 1E0OB 4H4IA 4IQDA 4U3HA 4KI1A 4QIRA 4QXGH 3WTTA 1BWMA 4GRLB 4LVFA 4M1CD 1UXWB 2CITA 2X6UA 1MZYA 2DM4A 5LGJA 5AB3A 4TU1A 4L0PB 2E77A 4FZEL 4C90A 4C1KA 3KPSA 4EI5B 5JQ6L 3UR8A 1DYSA 3S9YA 4PJXB 4XI5C 1FP9A 3W7MA 3AYTA 3QQ3B 1HTIA 3NA4A 5F1OB 3ORWA 3UCRA 1OYBA 4V2XA 1NEZA 1YTDA 1KLUA 4U4BA 2BS8A 3U2OA 1ITCA 2BMKA 3L3HB 1WNOA 1XTLA 4F4RA 1P7KB 3ZUNC 3CH9A 2YGVA 4RAUA 3GJFH 3RKPA 2DQIH 2PTVA 1LQBC 4MD4B 4QRQB 2NY4B 3CV7A 4HS3B 3EJZC 1VA9A 2ZWNA 2IF7A 2Z4QA 2P0IA 1WFTA 3B7RL 5FAGA 3LEYH 3DX3A 3C4UA 3HNSH 2AQ2A 1YW1A 1SPDA 5DO8A 5HYEA 2I56A 2ZVRA 2N59A 1SYSB 2X7WA 4FULA 1E5ZA 2X12A 4FZIA 2FATH 3DSFH 2E6DA 1NGPL 3SI9A 2OP4L 3BXNB 3U0WH 1HKVA 2VEFA 4LSRL 3W7JA 3R0KA 2BY3A 3NO5A 5CEYB 4MFEA 5J9PA 1R8LA 2I7GA 4L48A 4LYKA 1ONRA 3SO3C 1N67A 4M3HA 2NT0A 5HGHB 1M7OA 4IISA 4UTHA 4CA4A 1OC7A 3S36H 4OZIB 3OZ9H 4QFUA 3IARA 5FFLA 3WUZA 4GY7A 1F6KA 2B0SH 3G24A 2XG5B 1KYFA 2DB8A 3T09A 1KFKA 5JPMB 1RXLA 3VFSB 4HCLA 5AG9A 4ANWA 3T65A 3RHGA 1T2JA 1NCDL 4X5XB 1JF6A 3QY8A 2E7MA 3LZFH 3QEUB 1ZZMA 4XHJC 1TTPA 1Q9WB 4HXAL 2VKXA 4XX1E 2QGCA 3MOAH 1DBMH 3DUUB 1MMFA 3S37H 3CJPA 3FCUB 1XPGA 3JWNE 3T2NH 3OW1A 2QPXA 5HNUA 3DC0A 3AG1B 5H2BA 4YWGH 3LH8A 2AGKA 1ZY9A 2EO7A 3UPCA 2ZZ6A 3EYVB 4NHUB 2QSCL 2FECL 2OL3L 5T5FA 4BKTC 4R33A 1UUOA 4NOFA 3E9TA 3FQ2A 4WJKB 4JFED 1NBZB 3G0SA 3WIJA 3G1VA 2ZWKA 5E0CA 5FXCH 3GRWA 3L4WA 4WK0B 2FGWH 3FU8A 3SD5A 1SJBA 5TD4A 3GPEA 3RUGF 4X4ZA 1CBJA 1OF8A 3GNNA 4XAPA 3FHAA 3HBQA 2O5YH 3BJSA 1D6VL 4NHVA 1FA4A 4O58H 1J0JA 4W7UA 2CA4A 4MJ6A 3HAEH 1P4IH 3FA4A 4JIHA 1F4HA 3P11L 1J0ZA 5ITFB 4MMXC 3NDYA 1EWEA 3CZUB 4Z17A 3BZDA 2R2CA 1CXLA 3EYQC 3B6SA 5BWFA 1AA1B 1E9YB 1EGMA 1QI4A 1W6TA 4YAQB 3NOYA 1W3HA 1SJXA 2OJEA 3S4SB 3FSAA 4BKLB 3IU4L 3O6KL 2N7AA 4GE8A 3XIMA 1OGAD 1QLRB 3T0EC 1SW3A 4GYPC 2Y62A 1FNHA 4Z3IA 3NZPA 4BQBA 3AHVA 3EGXA 5IOBA 2QCHA 5F1UA 1FTXA 1FBAA 1WIPA 4UDUA 4FI7A 2WNZA 3P3TA 3PFQA 3NO3A 3KDMA 3KM1A 1J5SA 3JZ7A 4MZYA 4JREB 1GQLA 4MQ7A 1PZAA 3MLTB 3S8FB 2E46A 3ZE1E 4G59C 4ZEPA 3EZ4A 3BSMA 1NCIA 4L2LA 2WNQA 4NO2B 3DVGA 5HAOA 4JRFA 4XMUA 3UBHA 1NUFA 5FYJH 1AH4A 5DZVA 4V1XA 2INZA 3TA3A 3EJYC 4BFIA 3FUHA 4N8CL 1VPYA 3UBXB 4KS0A 4F8TA 1OC6A 4MLRA 4B3EA 3ZE2B 2X7VA 5C9JA 4P9ML 3EO1A 2A7PA 1YQ2A 4X9YA 4JMNA 4IXHA 5FO9B 4B3KA 2XUWA 3QBTB 1IGFL 2X1TA 3U2EA 1EFXB 3B1TA 1JAKA 2Y22A 3QEGL 2XWDA 1G9EA 3B3IA 3MI6A 2ZKMX 4A3YA 1AHWA 5BVPH 4OI7A 5K9JH 3IRSA 4Y2OB 1UP2A 4W9KC 3APGA 4DJMA 3GI8L 3WIFA 3TU6A 1TVLA 3UMNA 2VC5A 4BSVB 2BOCA 2CWNA 1HINH 2NY1C 3L5AA 4Y4KA 2OR2A 4XNXL 2EDKA 3P3YA 2ZX7A 1TIMA 1H15B 3I3EA 2KDYA 4D1JA 4PVNA 5IV2B 4Q4PA 1NBQA 4IHBA 5DRXA 3FXIC 5D2WA 3E0GA 2WQVA 4OM1H 2JNZA 5EUOF 1TZAA 4MXVE 1WZ1H 4FF7A 4QCFA 5HK4A 1P6AB 2G95A 1NSNH 1BF5A 4G1KA 3AWGA 5DK2A 1LWIA 4G8EB 3AALA 4ZQNA 2W0FB 4L23A 3WLJA 1VFFA 5A2CA 5F0LB 3WL9B 2IH1A 4LBSA 2BIQA 5AOIA 4L4JA 4LRNL 4QXWA 3CMFA 4LKXA 1AXTL 4N87A 3NR0A 3C0LA 3KRBA 4XTDA 3WJYA 1Y8BA 3W11D 1CENA 4JTKA 4PJHB 3DX2A 4QEEA 2JKLA 1QPOA 4ETQA 4ECNA 4XOAA 2PWHA 3GSUA 3W7PA 1IZJA 4H2AA 3PNZA 4XXDA 4X6BA 1YC8A 4M7SA 1TKWB 3QQNA 4O8AA 1KXVA 4DAGL 4WI0B 1K2DB 3ATBA 2AGJL 1UC6A 5HI4D 3RL2A 3MGOB 2QXWA 1U91B 1KENL 4XMLH 3QWOB 1T1WB 5JBDA 2VI0A 3BSZA 1AI1L 1SZRA 1A3WA 3NGBB 2W59A 4UTKA 5EB8A 3TBVB 1WF5A 1S8DB 3AQXA 1PDKB 1R33A 1GGBL 2D31A 5TGBA 2WWDA 4RKAA 3S36X 3G5YA 4X2RA 2V2WB 4QMEA 4JFXB 1X5JA 4HCRA 3N4FA 1A7QH 2W9EL 3BIAX 1XBRA 3FTXA 4IBQA 4QRPA 4XNMA 3VFTB 1J5TA 4FG0A 1F3JB 5DD5H 5I18L 4QGTA 1Z9PA 1XHGA 2QF8A 4PJDF 2XFWA 4U6TA 5A69A 1CXFA 1VEOA 5SX4H 1JWSB 4LSVH 5IEKB 4X4ME 4I9WD 4I0PD 1NCCH 1NDZA 4CW1B 3SN0A 2DQTH 4XTIA 3RVVD 5E8OA 1MJJA 3QQ0A 3S37X 3W1XA 4OGZA 5A6TC 4LV4A 1R3QA 2EXYC 3CV6A 1U8LB 4QHPA 4ZX6A 3MV01 2VLJD 3ARBD 3TONA 2YSWA 2PDLA 5A6MA 3QMTA 4GIAA 5JUEH 3FBKA 3O8XB 2GQAA 3GU1A 4XOCA 4EVNB 1OFPA 4GP8B 4YTUA 3CU2A 2FJFB 2QR6A 4E5XG 2LT9A 2BHZA 1WT5C 4JRYA 3SOBH 3W38A 2QFPA 2VDOH 3QHOA 4MS8C 1GC1L 1KIRB 3GSNA 3MY9A 4WGVB 2KLTA 1MJ7H 3FH5A 4JX5A 3E6HB 4DNLA 4F7PA 1A25A 1MZZA 3KPMA 2UXGA 3P62A 1DIKA 3BLPX 1L6GA 2E7LA 2WP3O 3UCQA 2EILB 2R1PA 3CFUA 1KPUB 3LXBA 2DWSA 3JWDC 5D1XC 1IGJA 1KOAA 4XO5A 4O2FB 5TH2A 5CZXD 4IOFC 4I18A 2PDKA 1EYEA 3NPVA 1DWAM 4G8IA 1PZ3A 4ZMTA 4O02B 4O1BA 2YD2A 3TNOA 2FB3A 5BOZG 4REQB 3A5FA 3ZDYB 2RDWA 3KXFA 1TPEA 2O9TA 2Q09A 1MXDA 4MJ4A 1EVUA 3ZHKA 3HS0B 3IIOA 3WQVA 2FH6A 2R0LL 4XMPL 3MCKA 3CHXA 1M4KA 1JNJA 2CDEB 3CUPA 4OI9A 1BEYL 2ONEA 1MNUL 1C5BL 2Y06H 4V1DB 4QS6A 4YNYA 4IJBA 1ILSA 4UCFA 1A22B 2CKBL 2G3XA 1QYGL 4M7ZB 4R88A 5CSRA 1MUJB 1AK5A 4X7EC 3QI9A 2CZ5A 3LPWA 1NDWA 2QT6A 3WDIA 4PRAA 3WHE0 1CTMA 3O2WH 4P46A 4MKVA 2DDQH 2QUNA 3WMSA 3R5EA 3W1LA 4ODSH 4P2RB 3KS6A 3SYAA 3N6YA 4LQFH 2GJXA 5BU6A 3FFCA 4M48H 1T89A 4XISA 3UPBA 4BRJA 4NFDA 4PN6A 3LZLA 4PGBB 2VGFA 4OZHB 2RHGA 2OZ4H 1KFJA 3K6NA 4XC3L 4N8VB 2K7QA 2G41A 6TAAA 2NZLA 1CPUA 5HYQB 1GY1A 2O56A 1MI5D 1GMEA 1GPOH 1F4YH 1HFUA 2J7GA 5I6PA 2JKTM 2DGAA 1ND0A 4RNHA 4HJWA 1OWRM 3VFUB 3VDCA 2ZFAA 5U7SA 1HHJA 2HX8A 2UZPA 1DBBL 4J5NA 3D69B 3PL6A 3WBDA 3VGFA 4N9OB 3C3NA 1KCRH 2GTZB 3T78A 3ULVD 4JE4B 4XCNA 1CFMA 2EIKB 3P82A 5D2LF 4HP5A 2IJ0C 1J2BA 1QSFD 2XTJD 4C6QA 2K4AA 2H3NA 3UYOD 3BE1H 1BDYA 4D8LA 1F5ZA 2DWXA 2AF2A 1S46A 3WSQL 4DN3H 3BWAB 2J20A 2AJYH 3QXDB 3BFOA 3KVKA 4TIMA 4IEFA 2ICEC 1S6NA 3WBAA 4PJ6A 4U2ZA 4PTXA 3QG6B 1W56A 4LB4A 4IRSD 3EOTH 3KMDA 3GB6A 3N42B 4ZTEA 5B22A 1NCHA 4G2DA 4M00A 4FP1A 4LSQH 1KGUA 3D51A 2XZQH 1FKXA 1BAWA 4IBTA 2FIKA 1JZDC 3S1GA 2IQAA 1QU4A 1OCQA 3HB3C 2KHAA 2EIZB 3UABA 4M5TA 1I8KB 3L8QA 3EH4B 1C16A 1MZRA 3L2MA 3DI3B 2VO5A 3H9HB 5GGSY 3BJTA 3GUGA 4ZXBA 2Q7AA 1UJTA 3DX9B 3W56A 4F2FA 4HWEH 2R23A 1P5VA 2IPTL 1VKFA 4LLVA 1J5HA 2F18A 2WB1A 4CVZA 1E4WL 5T3ZE 1R5IB 2HRWA 1TE6A 1ADQA 3KL5A 2FSEB 1VFBB 3ET9F 2V33A 1BTCA 4WW1A 4KO6A 5B4MC 4P4KB 4QAMB 3W7NA 4F0RA 3ULVH 2WB7A 1EBPA 4UM9D 5TIMA 1BPVA 4H1ZA 2X41A 5DJ2A 4LPVA 3ZKND 2BP3A 1HE7A 4OQTL 3V5CA 4LLQA 3BXWA 4J2QA 3TCTA 4PBVC 5H8PA 4AJVA 3MRMB 1HKFA 2Z93A 4WO4A 1N3NB 4XVUD 4EN3A 3STLB 5CHNB 4R7DB 2YXGA 4FG6D 1A6UH 1U21A 3MX0A 1AKJA 4MNLA 4ML4A 4KJPC 3T3MB 1Y6KR 1AZZC 1XF2B 1IXPA 3LNIA 3OR6A 2Y5QA 4M56A 5E93A 3CBWA 3VI4F 1IB5A 1P0EA 5FWQA 4IRJD 3OMNB 4GI4A 2C5DC 3TVMD 5TFSH 5ES4B 2BVOA 5C09A 2NY2B 2ZCHL 4GRLC 1CFQA 1DVFB 3TE9A 4G6JL 3H9YA 1KSRA 1KIQA 2Z92B 2ATPB 4Y8AA 2PP8A 1DQLH 4C6IA 1YUKB 4AEIH 4IOIA 4EI5C 3S4TA 1BWWA 3W9EA 2AC0A 3E6FB 2PAJA 4HUCA 3WJLC 5MHSD 4GH1A 3O2DH 1JGIA 4I5XA 2Y1YA 5CR8A 2ZOUA 2ESVB 1ZBWA 3SCMD 3C8DA 5D09A 4QKXB 2XH4A 3DX4A 2DTML 3D85A 4JZJB 5I6NA 2EDJA 4AQ1B 3A67L 1CLZL 2BM3A 3P1VA 1WAPA 2SEBA 5KS9E 4PN2A 2MUCA 3NIGB 3UVAA 2RBLA 5DURD 1PZCA 4Q9CA 2NY4C 2QUVA 7XIMA 3FK4A 2TSYA 4PUUA 5I0XA 3WTVA 5EZIH 1EHXA 3C0SA 4IIQA 2WSPA 1BD2A 1G7IA 1V7MH 2H90A 4FSAA 1MOEA 1C3FA 1L9OA 4LEXL 3C52A 5F8RC 3HCVA 4PGJA 1GL4B 2GK1A 1XP3A 5F89B 3L16A 2V5BA 5F7UA 3IPWA 1C08B 1O9VA 3EJUA 5H91A 3IETB 1EZSA 5AW3B 2FEDC 5F1IA 3V0VA 1JCJA 3W57A 1GQIA 3IWUA 4RCXA 3SPIA 2CRYA 3HU7A 1CGWA 5CJOL 3NQ6A 2A6IA 2GFBA 5AFDA 4TV6A 3TBWB 1SFLA 4P2CG 4KO7A 3LKOB 4EI0A 4KXCA 3D18A 3OB0H 4DKTA 1IAMA 4DVBB 4I88A 5KVGE 1YYAA 2MNRA 5HJLA 1YZZA 1TPC1 4KV5F 4INFA 1I1YB 2AOSA 3IFPB 3P54A 3ETBJ 3NIGF 1IMHC 1M7PA 1M5WA 5I6XB 2AEQL 3QZWG 4TVDA 3MV8D 3QLDA 4GOAA 3KBMA 2X16A 5JPMC 2XV3A 3QQDA 3QCUH 1FIGL 1A5AA 1F90L 4PJAB 1AW1A 1YX1A 2ITFA 3FLUA 1LP9E 2J44A 5IQNA 3VXRA 2DWTA 5IB5A 3QYMA 1H1YA 4I87A 3VMNA 3QB7C 3DECA 4XAGA 3KZ8A 2XTSA 4ZS7L 4JS7A 3QZ6A 2QVNA 4XTRD 4UNUA 5IJKC 3ETTA 1OGGA 3KYAA 5TE7L 1A6WL 1ZA6A 3M88A 4G82A 1QI3A 5KZMA 1ORQA 2BFGA 3CDCA 1J88A 4DF2A 2IQDA 3MRRA 3LERA 1OJXA 4DGIH 3SEPA 3CAFA 4MJHA 4E41E 4AD3A 2H1LM 4JO2H 2UUDH 2R1LA 2CUIA 3XISA 4P3WA 2AQTA 5INCA 1XGDA 1YXDA 5FF6B 2ZXBA 3CSFA 2GJ6D 1JPEA 4WHTB 4Y0GA 4CQCA 2EDRA 4IIDA 5JBEA 1RVFH 2JJVA 2H1PL 3TX9A 4EUPG 3AHTA 3HE7A 4OM0L 3ES6B 3ISYA 1FVPA 1NAKH 3VVGA 3GHSA 4JBRA 1GGTA 2X4NA 4ZO9A 2XZCL 1A0CA 4LSTL 1KTLB 3DYPA 1GW9A 4LMQE 1ZBVA 4BSWB 3MJWA 5I8EB 4MNGE 1R47A 1UM4H 2PC8A 4PGCA 3GHBH 4WSKA 4RAVB 5C0NC 1X9LA 1PTGA 2NY7L 1GGOA 2GHZA 2CDFB 1SFDA 2DT2A 3STEA 4KK8C 1X6LA 4QLKA 1U2HA 2ED6A 4NWUL 2V5RA 3FOMA 4JY4A 3CU1A 4QHUA 5BO1H 4R27A 1RALA 2Z6FA 1UUMA 2WO3B 1HSAA 3AREC 3SURA 3O7UA 2BVQA 4KHXH 3E3QC 4JREC 4TUOA 5H94B 2O7SA 1HKKA 3SSJA 4UILL 2FZ9A 5EZOL 5GGTA 1DXIA 1RVGA 3AG3B 2E8YA 3PWLA 1WBYA 2BW4A 5D7KD 1I85A 3GDTA 1CLYL 3BG3A 4ADTA 3CVIH 4H0HB 3QIUA 4YEFA 1CZ1A 3OC8A 2YA0A 1XXFC 3W82A 5KJRH 1E40A 2JKSA 4XNZB 3N6JA 2JELH 4EPDC 3ALXA 2YXMA 3DN5A 3HRZB 3BLEA 1B3XA 2F7OA 2VSDA 5GISH 4F3HA 3FJLA 3R06A 3ULUD 5HJBA 3D2UD 2PYED 4U6XB 3BEWA 2BV9A 3OGCA 5DZJA 1E4LA 3BUYA 4ZW3A 4UMAA 2V37A 2PDNA 5AL0A 1JCLA 3KYNB 3PNRB 1HZYA 1YJDC 2A1YA 5ABFA 1AZCA 1R24A 2BIPA 4OWGA 2PDQA 1GOXA 1ISWA 1YE6A 1FVDB 5KYYA 4ODTL 1SDDA 1BWVA 5TQ2H 4YDVA 2B4GA 1EZ2A 3UXFA 3WJJC 1UP3A 4KTEH 1HKMA 2ARWA 4R7VA 1RA5A 1KBPA 2XPYA 4DZHA 4GBXA 4I3SH 4O54A 1MFDH 5FIPA 2Y25A 1IBDA 5D2VA 3VIIA 2O9PA 1RZJH 2G8ZA 3VDHA 3FT3A 5EOTB 1JGEA 4OFVA 1EC9A 1L0PA 1TJPA 4CNIA 3OMIB 4D8PA 2EDBA 4CU7A 1DQTA 1J8HB 5DC2A 1NGYA 3IK2A 1I1AB 5AC6A 5G55A 2CBVA 4OLWH 5HDOA 1EMTL 5AZ2L 4PCNA 3UL4A 2WSDA 3N44B 4BFBD 4FR1A 3B9AA 4OV5A 1JD7A 5BZAA 3N40F 4YNGA 2PRLA 3AY4A 4D94A 1FWWA 2R9HD 3R8RA 3D50A 4RXFA 3W28A 3WD2A 4AWTA 2IGLA 4HUXB 2VOMA 5GRWA 4PRPB 4ANVA 4YVUA 4XB3A 3ULUH 3WBYA 1PIIA 1KC5H 4N0FB 4ENLA 2IMNA 1Y6MR 4B7IA 4UCGA 2VLRB 4DJFC 1E6PA 3GUTA 3CUHA 1Z3RA 4JVWA 2O5XH 3MBXH 3HZKB 2Q10A 2FTAA 4H20H 5CCHE 3FQWA 4JQVC 5F9OH 1L6WA 3N4EA 2A4CA 1CR9L 2J8TA 3V5OA 2NR6D 2ZAIA 3NGBC 1MW3A 1E70M 3CWHA 2FDBP 1POJA 5FB8B 1SJHB 2DJMA 1BX2A 3LENA 2DIBA 4HIEB 1ACZA 4R7XA 5D2TA 4RWYH 5I30H 1I4FA 1KM6A 1F07A 1VJSA 3FQTA 3U2JA 2C26A 3T4YB 5MEPA 1NPUA 3P5ZA 1HIZA 2IBBA 3BJLA 3QUGA 4ABWA 3W7DA 3TOPA 1VBRA 3U1SH 3WG7B 2V2CA 3F6IA 4UT9H 4ERAA 1R9XA 2ZCLH 1V0LA 5I76A 3LRMA 1WKDA 4C6JA 4TS6A 1ALDA 1UHVA 3F7VB 3NACL 1XGZA 1ZJIA 4GAGL 4BH7A 4QRFA 2E28A 1D5BB 3V9CA 1V5XA 1NU5A 2E27L 4LVOB 3PCYA 5LNRA 4K73A 4JDTH 4IDJH 2DEYX 4WXYA 4FK9A 3B8SA 1OWQA 1ID5I 4I77H 3O8XC 2QDDA 2QCLA 4ZPTA 5I77A 1Z8AA 3SFKA 3WH9A 3HBLA 1QA9A 1SJMA 1OK6A 3UPAA 2IADB 3FO2A 1NF7A 3S2MA 4Z0BL 2OQYA 3FU5A 4X9BA 4NRZA 3VWJA 4ICWA 1MVUB 3GEFA 2YCKX 3KCWA 4IH3A 4NQTA 3PHOB 4QDMA 2XSBA 1IGIL 4CKVX 2HFFB 2Z7ZA 1JG9A 3O6ML 3T8LA 4N3UA 1QFWL 3NCMA 2J88H 3MA9H 4AYBA 3KRZA 3IV8A 4Y9NA 5F2LA 2VN7A 1F11B 4I9AA 1PGRB 1H3PH 4C55A 4KNSA 1HI6A 4QG6A 5D7LA 3D7PA 3ATZA 3QP3A 3ZR6A 3THCA 2X8RA 3DNKA 1CX9A 1IAOA 4IP5A 4JRXB 4PRNA 2NVDA 1IWPA 2P5PA 2PDHA 2EXWC 1GOMA 1R3KA 5I71B 4Z08A 1UVQB 3CJJA 3HS0C 1WO2A 3NIYA 3UJRA 1S39A 1S9WB 1QX1A 4LS0A 4NZTL 1E6RA 3REVA 3C6LD 1K8ZA 2IGFH 4Y4HB 3LQLA 3GRWH 4QYOA 4DGYL 4K68A 1CICB 4EVZA 4NYYA 1CYWA 4M7ZC 5CZVL 2JKIS 3I4KA 3HS8A 4FGMA 3DCPA 1TV8A 3WXVH 3PGFL 5D33A 1AYOA 2XIMA 1KULA 2WYZA 2V8ZA 4D1IA 1E0VA 1JF1A