3H53A

Crystal structure of human alpha-n-acetylgalactosaminidase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 129
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h53A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h53A01
4AYGA 5EBUA 4WSKA 2FLIA 2VR5A 1YDVA 1LYXA 1LLZA 4FNPA 3EDFA 3M07A 1F76A 4X22A 1H60A 4HN4A 2B7QA 1UJPA 2QPSA 1JUEA 1R33A 2F2HA 2YXGA 2QPUA 3A5VA 3W72A 5C2XA 1VC4A 5D03A 1F6PA 5EMUA 4NJGA 2YFOA 4DF0A 4Q4KA 3WNOA 3DH7A 1EA9C 4Z1DA 2XIBA 3KL3A 2HS6A 3BGJA 1W3NA 1YTKA 5DCBA 4Z1AA 5D32A 2VXNA 5DY3A 1FCBA 3WNNA 3LHYA 3VI2A 1XGZA 1HXKA 3M5ZA 3AMKA 1H7XA 1JI1A 2ZUWA 4IQLA 2Q3RA 1WPCA 1JCXA 1IXPA 3SGZA 5H2ZA 4Z0JA 2OSXA 3QZEA 2ZX8A 3ZT7A 1O4UA 3UXDA 3VGEA 1TQXA 1T96A 1G6CA 1BVNP 4QM1A 3WY4A 2F1BA 2A4AA 1HX0A 2QCDB 4LY8A 1NAL1 3LRLA 1K8XA 2R8WA 3L67A 4K7YA 3MUXA 5EKYA 3KL5A 1NM9A 2FPYA 4WUIA 1QMLA 3DDGA 3GZ3A 3WJYA 1C8VA 1SSDA 2ZYFA 3FYPA 1CYGA 4M6VA 1AMKA 4FLSA 1XCFA 4GUHA 1B4EA 3DX0A 1DV7A 3CWOX 1WOBA 3W87A 1AL7A 2PRMA 5F2IA 2W6RA 3MP5A 3KVKA 3C8FA 1TPVA 1KTNA 2VENA 2ZRUA 4JTEA 4LQ1A 1QCWA 5CZJA 3EJQA 2Y7DA 3SJ3A 4GNJA 1B3OA 1NEYA 3PSWA 1CGYA 4FB7A 1DHPA 4FX7A 3I68A 4IX2A 4GUGA 1TQVA 2YA1A 1SZFA 2PC4A 4HPXA 1MFVA 3W86A 2CLEA 1EPXA 3W2JA 1T8XA 3MI3A 2V2CA 4ONVA 5LNUA 1PS9A 2EGZA 1IXOA 1XDLA 1TQSA 1X7FA 4WX2A 3WY1A 5DN1A 1TRDA 4AXKA 5D2TA 3VGGA 4AF0A 5DCDA 3ZS4A 4EWND 2AGKA 1XM3A 2RFGA 4LWWA 3USBA 3TE9A 4EVZA 3EX3A 3EXTA 3I65A 1GVIA 4MJZA 3OHIA 4Z0SA 1KGUA 3LM7A 4UQ9A 4JYFA 3ZR4A 1KM1A 1O95A 5FF2A 5TD4A 1WQ5A 1TYGA 1Q6LA 2Y88A 5BMWA 4NJKA 3IIPA 1OT1A 1ZY9A 1LROA 2X30A 3JS3A 2ZX5A 2BY1A 3P8IA 2YFNA 3G22A 3P84A 3HPSA 2ZIDA 1V3LA 1I2NA 3TW7A 3BVUA 4JFUA 3BLIA 1J0KA 4UFMA 1P4CA 5HWNA 1QW9A 3A5FA 3KLLA 3B06A 5J5RA 5AC8A 3KLKA 5G1YA 1CGWA 1AG1O 3NR0A 4PL1A 3ZSSA 1Q4NX 4X3ZA 2BY3A 3VSTA 3ZO9A 4N02A 4JFSA 3DFQA 1UD5A 4QISA 3QQ1A 1V3KA 1ALDA 4Z1BA 1R30A 1XBYA 2PCQA 1PZ3A 4ZL1A 1KCLA 1CX9A 3D4ZA 1Z44A 1CGUA 1MZHA 4RXGA 1AW2A 3LOTA 4NT0A 5E93A 5DXXA 5AOUA 3BVWA 2ZBTA 3W23A 4XTDA 1UD6A 1W37A 2PRHA 3BAYA 3WDHA 3W1NA 4AWUA 5CPLA 2Z6IA 3WELA 4AHOA 3DX1A 1QPNA 1R2SA 2EKCA 1A53A 2NUYA 2A7NA 2H3BA 1XI3A 2NWSA 1K8ZA 3V1PA 4TIMA 2QUTA 4DPPA 4GKLA 2WVVA 1J2WA 3R12A 5C55A 1FWWA 1KTCA 3HMJG 2WCSA 1A50A 1G5AA 2A1YA 3BG3A 2CLOA 5AB3A 4WY0A 1N8FA 3PR2A 3CEPA 4CVWA 3CPUA 3WJZA 3D51A 2CLHA 3BUBA 2C18A 2G95A 4O19A 3BAXA 2CLIA 3NQ6A 1MW3A 4A22A 1SPQA 4UC5A 5HDRA 5F2GA 2JBMA 4ZQRA 3FLUA 2WSYA 3BMVA 1TPFA 1CXEA 1WAUA 1D3GA 1DHKA 3A9IA 4UTMA 3OEXA 1HVXA 4N9DA 1LTDA 3LRMA 2CZEA 3F1QA 2WQPA 1TSIA 4DO6A 3LXBA 3FJLA 1JJKA 4H2CA 3SFKA 2DZVA 1XCWA 3TJXA 1VJSA 2WSPA 3QW4B 3CLMA 2NSXA 2ZXAA 4KKXA 1W56A 5HR7A 4CQ9A 1PPIA 4WOZA 3TR2A 5DELA 1TCMA 5E1QA 2ZE0A 3C52A 4TU1A 1EH9A 3W7KA 5HXMA 1CXLA 3GK0A 1E43A 3LB0A 2EAEA 1K3UA 1C29A 2RH9A 2BWGA 1FBAA 4CGTA 3W70A 5MHBA 3W2LA 4C1KA 1RQHA 3QSRA 4MY9A 2RKXA 4GINA 3C4UA 1DJQA 2C16A 3NL6A 4OWGA 3S1VA 3A6OA 3O6DA 3WK1A 3G0SA 1QOQA 2BXYA 5I3GA 4IMFA 4A29A 1PZ2A 2VRKA 3EDJA 1S5VA 3HG2A 3BUIA 4MFDA 4ZZ9A 3M16A 1GG1A 1HFBA 4ZQCA 3NQFA 1WDWA 1CDGA 3CTLA 2V3EA 1JCYA 1KV8A 1HG3A 3P5YA 1IXNA 2FYVA 3NG3A 4I7VA 2NUXA 3P81A 2GUUA 2V2DA 1RP8A 4JXCA 1EO7A 2WVSA 1MEWA 3FAWA 3NQ8A 4ZVJA 2NXIA 3WN6A 1NF7A 4C1LA 3KE0A 2X1UA 3TROA 2E6DA 3EWYA 3S5ZA 3O05A 1BVZA 4MIMA 5SWUA 2PWFA 4NQ1A 1KM2A 3UPWA 4X9YA 3G1FA 3DGRA 1EHAA 1OK6A 2ZQ0A 3SR7A 4O14A 4MLRA 3LHVA 5FEPA 5D05A 3W75A 1WP6A 2VUYA 2I9EA 3DHDA 5KSWA 5D33A 1SQ7A 2Y61A 1F5ZA 4UTWA 1GVQA 1XD0A 3QH2A 1I8JA 1K03A 2F7QA 1UCWA 3B4UA 1OYCA 3QSTA 2NWRA 4ZQPA 5H91A 2NXGA 1OFEA 4R34A 3BW4A 1W9XA 2YPIA 4OHQA 3DX3A 5EL1A 3G1VA 1IV8A 3BW2A 2DJXA 3BVXA 3EDDA 3KVMA 3M44A 4UFKA 2NV2A 2I1OA 2W79A 2OW6A 1H62A 2ZA2A 1KV5A 4P2VA 1UB3A 1ZHAA 1JDCA 4K39A 3L2IA 1R2TA 3PC0A 3WY2A 3W1UA 4ORIA 1LORA 4IMGA 4AMWA 3GDLA 2VT0A 4YCOA 5F1VA 3EWXA 3G3DA 3EKLA 4GC4A 3N73A 1XH1A 1J4EA 4LPCA 5DLCA 1OFOA 1JULA 1KWKA 3ZSTA 3TX9A 4JY8A 1JDDA 5I0DA 4PCFA 2C0AA 3GKFA 4GXMA 4LUJA 2E8YA 3ABOA 5EY5A 2V9DA 5K9DA 3MP3A 1JUBA 4L4LA 3TC7A 1YTEA 2F7FA 3HBLA 3FKRA 4U2YA 2FH6A 2G3MA 2CFFA 1H51A 2P10A 5KZDA 2IGTA 1KCKA 3C56A 4FIQA 4LVDA 3LCXA 2EABA 3Q94A 4AAJA 4NI3A 4CLMA 3DFPA 4I7WA 4NNBA 4A3UA 2Z6JA 1D3HA 1EX5A 2AAMA 1PAMA 4JS3A 5BRPA 3TXVA 3W2KA 1Q3NA 1OABA 3IJ9A 4UQCA 1SZNA 4CQ8A 1KFEA 4O8RA 1L2UA 2FPTA 1KM6A 3IJ8A 1P0KA 1BAGA 4O1CA 2ISSA 1TQJA 1JQVA 3BAWA 1D3CA 3ECQA 3NQEA 1KXQA 1KLZA 4BFAA 2GUYA 3CZLA 3B05A 1KFJA 4KMQA 3CPRA 3G1SA 3TUUA 1JCLA 3TA6A 3G1HA 4S2CA 3MI6A 3L4WA 2NX1A 1HL2A 3EX4A 5C6MA 1V3JA 4FXRA 2V5LA 3OVRA 2V82A 4GJ1A 2E5CA 1AW1A 1CLVA 1VFOA 4JR5A 4UFIA 5DBUA 1O7DC 2D2OA 4J28A 1H7WA 1Z32X 1ZALA 3LLFA 3QEZA 4BI6A 3HB9A 4ZQOA 1EUNA 2TPSA 3PY2A 2BY2A 2X1RA 1G4TA 4XZ9A 1W54A 2FJKA 1KXVA 1OX4B 5DBTA 3DKLA 4JX4A 1G9HA 3G1DA 4O28A 2BX7A 1B4KA 1UKTA 1RQBA 2RDUA 1NVMA 4N2YA 2YR1A 3W7DA 3IGXA 4U2ZA 2X1SA 1SZEA 1ZJBA 3W85A 2WVVB 2VOMA 3L4VA 1OHLA 3G1XA 2ATSA 2V30A 1BPLB 2OYKA 3RIKA 5E6ZA 3G1YA 2ZICA 1U83A 4QITA 2R14A 1T0OA 4UMCA 2DJLA 4GI8A 4POCA 1YPIA 3NVTA 1LBLA 3W1MA 3W1RA 4TO8A 1HT6A 1Z41A 2YW3A 3L68A 3PSVA 1KB3A 3TONA 1G4PA 2FPVA 1SU5A 2R91A 3GVGA 1GOXA 3L5AA 1WZAA 1XDMA 2QV4A 3S1UA 1OJXA 4JCMA 1X1ZA 4FNSA 3HO8A 3NQVA 3QMTA 4LOCA 3TJLA 3L5LA 4QNEA 1YADA 5G5IA 3NQ7A 2XN1A 3GB6A 5D04C 1F73A 4OU1A 4UR8A 2XWDA 3W07A 3EX2A 2C19A 2GVLA 4J3SA 4HOWA 1VRDA 3NQ2A 3UQNA 4P61A 1SZGA 2IQTA 1OFPA 3QQ0A 4PFMA 4HNUA 1XH0A 1QX1A 1TTPA 1F2JA 3LX9A 3DBPA 5D2XA 2BXZA 3K8KA 4UQEA 2CW6A 2ZZ1A 1DORA 2NV1A 2VEMA 1LDCA 2QAFA 1SO3A 4NX0A 4TX9A 4W93A 3INPA 3NQGA 3CT7A 5FI8A 3GXMA 2A5HA 2OYMA 3LHZA 3BG5A 3UPBA 2ZZ3A 3UG3A 1ZNNA 4O15A 3E0IA 1W5NA 3CEUA 4AEEA 5I23A 4MOZA 5AYZA 4JTUA 2ZXBA 4O10A 3E49A 3QFEA 5AHIA 4NXKA 2B7NA 3G1AA 4OT7A 2FFCA 2B7PA 2QMKA 8CGTA 3VGDA 3QM3A 5CSRA 4O16A 5E6YA 3MMTA 4IXXA 3VSVA 5C5YA 4FNQA 3BARA 5L9FA 3BVJA 3O07A 1GVOA 1TPC1 3UERA 1OX5A 3EB2A 4Z1CA 1EP3A 4G1KA 3UWZA 3R13A 1TCDA 3W9ZA 2WNNA 4PL2A 3HG4A 2C7FA 4IMCA 1GPWA 5IBXC 4HA1A 2FB2A 1BWLA 1E3XA 4I7UA 2WSQA 2WANA 3IK2A 2OW7A 2FIQA 4O1BA 4LVBA 1R46A 1UUMA 3CU2A 1IIHA 3C2EA 3ZFHA 2BXVA 4GI6A 1SW3A 3WEOA 2EACA 1EP2A 2EQDA 4LS2A 1A5CA 1P5BA 1KM5A 1FCUA 1JRCA 4LV9A 3UY7A 1AQMA 2OJPA 3DXIA 4M19A 2VKZG 1N55A 1L6SA 2OMAA 3D4YA 1UD8A 3BUDA 4KFPA 3W7NA 2I14A 2X1TA 3BCFA 3MYPA 1LWHA 3LHWA 3DDFA 1TPUA 3TQ0A 1CGTA 1U5JA 3B8DA 3MJYA 3NPXA 5FEZA 3WK3A 2FHCA 3W7EA 3VX1A 1TV7A 3BUQA 4CKQA 1GJPA 3W7PA 1UH2A 3WNMA 4HOZA 3LERA 2DIJA 2ZX6A 1K8YA 1I75A 4EIVA 3NQDA 1HTYA 2ZZ5A 3PWAA 4CCDA 3R2GA 1OFDA 2D3NA 3LRKA 4OV9A 4GQQA 5LSMA 3W7OA 5LNVA 1KXTA 3O06A 1UA7A 5U7SA 1SFJA 1QWGA 4RKAA 3Q37A 4RLIA 3LTSA 3PVFA 1XUUA 1B57A 1W5OA 1Q45A 2ZUTA 4A21A 5G2HA 4FLRA 1KBJA 3FEMA 3P60A 5I5RA 4LVAA 4ZMGA 3S42A 1FQ0A 1UASA 3IRDA 5HULA 2ZDRA 5K7JA 3K8LA 2Q8LA 3BCDA 1YDOA 3SIZA 1LOLA 2X2GA 2D0FA 3KWXA 5AYXA 2E5DA 4IPJA 3GXFA 3RF9A 2E68A 5A2AA 1U2YA 3NM3A 4O4VA 4UXDA 4O0ZA 1VZWA 1JDAA 3L5MA 4JGDA 3QJAA 5A5WA 3ABRA 4JTLA 3W38A 1V3MA 4S1FA 3ZR5A 1QI3A 2Y6ZA 3NEVA 4WQ6A 3GAYA 3UD6A 1FDZA 3GDRA 3UY8A 3II1A 4DBEA 5FESA 3L4XA 3THAA 2WSRA 4XKYB 3GAKA 1KM0A 4O11A 1MXGA 3ZWSA 1G4EA 4U3CA 4HPHA 3P61A 1UH3A 5K3VA 5HQEA 5LHFA 3TSMA 4WOQA 2QKFA 2CLLA 1LLWA 1XSJA 1O5KA 1AVAA 4AWSA 5I3HA 3TTSA 5CXPA 2VFFA 2J6XA 4J3WA 4GBUA 3Q58A 1TTIA 3RFAA 5GVJA 1HO4A 1NOFA 4FXSA 1OGSA 3AXHA 1QOPA 1JI2A 1ICPA 4CN6A 1OB0A 3PUEA 5KITA 5A2BA 1PHWA 2XN0A 3AXIA 1TREA 2VFDA 2X2HA 3O6YX 3U6WA 1WO2A 1RD5A 3M47A 3TNOA 2OT1A 3MBDA 3CM4A 5D02A 1CGVA 1JCMP 4O13A 2C8NA 3BLPX 1Z42A 1J5TA 4FNRA 2DZSA 2Y7GA 3MWAA 4J3UA 4IOTA 4PODA 2EADA 4FNUA 4IPIA 3HZ3A 1OSEA 3W1LA 4E2BA 2F1AA 2E6FA 1EO5A 3W37A 1DVJA 2CU0A 1KBKA 3LTYA 4BWLC 2CHNA 2CZFA 3NPUA 4WF7A 2YW4A 3L65A 3L4ZA 1QNVA 2GQ8A 2Z2UA 3TFCA 4B5NA 1TB3A 4UUIA 2DH3A 1XKYA 3GNNA 4AWTA 4Y96A 4WD0A 3UWUA 1I2PA 3B0VC 1KGXA 1GVRA 2YYUA 1KLYA 2ZUSA 2G97A 2YCEA 5IM51 1FWRA 3UEQA 3N9SA 3WJSA 1H7NA 2XVLA 5F7UA 4H4IA 4OJYA 1T99A 4M56A 2A0NA 5D2YA 4JL2A 4JL1A 2OCZA 4NZFA 3NQMA 1W8SA 1RPXA 1QR7A 3DC0A 3W3OA 1NFBA 3W1XA 1HL8A 2F84A 3LV6A 4IGHA 1VCVA 4QAIA 2EF9A 4ML9A 3SI9A 4A2SA 5A6MA 3VFLA 3WFAA 2FDSA 4MZ1A 3VE7A 2YA0A 2CLFA 1NSJA 1ML1A 4JD4A 2X2JA 5CSSA 3SZ8A 2F7RA 2GJNA 3KX6A 3DFNA 3WENA 4I9AA 3CIWA 3TH6A 4MZ8A 4HP5A 3LXCA 5T26A 1W3IA 3DX4A 4YL2A 1YLVA 3PB2A 3CHVA 2CWNA 1WXJA 3ZR6A 3M6YA 3NL2A 5F4XA 3NGJA 3KVJA 1AMYA 4AIOA 1FDYA 5AHLA 3BAIA 4UTTA 1KTBA 4CN1A 3F4NA 4RV8A 2JGQA 4L4MA 5F2LA 5E70A 3BLFA 3M1ZA 1JXJA 3DX2A 1A5SA 1B2YA 3WDJA 1ZS2A 1XBZA 4LNYA 3FAXA 3VMPA 5I3IA 2ZZ7A 3KRUA 4NJJA 1VIWA 3W74A 2NX9A 3W1TA 3S8HA 5G1TA 1IGSA 1UA3A 1QDSA 2FTPA 5EYWA 3UWVA 5F2MA 2F61A 1U33A 5TQLA 1AW5A 3BG9A 2OSYA 4DXVA 1VLIA 2P0OA 1WBHA 3ABSA 5F4SA 3S0CA 3UWQA 2WNQA 1JF5A 2E8ZA 3LDVA 3BMWA 5DXYA 5HPOA 1VYSX 1RQEA 3G24A 4JNMA 3SY5A 2YIHA 4UCFA 3EWBX 4K7VA 3PBYA 5HUOA 5BRQA 2NX3A 4OV4A 3W71A 1OX4A 2YGYA 1TV8A 1JG9A 2J24A 1DQXA 1JAEA 1Y0EA 2YKKA 3A21A 5F4WA 4UTIA 7TAAA 4K8EA 1TQTA 2QCEA 3LHUA 1FY6A 4MJMA 2V0TA 4M5PA 3PUDA 1FWSA 3EX1A 1VHNA 1F7BA 2D0GA 3CQ0A 1PIIA 3QC3A 3W7RA 4ADUA 4JTIA 3RLUA 1KXHA 1I45A 1P6WA 1LBMA 4NXSA 5I3FA 5KMYA 3LCLA 4XWUA 5D2VA 2AMGA 4GQRA 2Q8ZA 5AN7A 1N7KA 1ZENA 2QCDA 4JTJA 2VFHA 2VC6A 3OVQA 2H90A 4PEKA 1W1ZA 4UFJA 3T44A 4AVFA 4TMCA 1LRQA 7TIMA 1PL9A 3EXSA 3VX0A 3BLKA 1DBTA 2EPHA 4RX0A 4Z08A 2FE0A 1S5TA 4OIFA 2DZXA 1CXKA 2QCMA 3B04A 1ADOA 4FMVA 3WEMA 2H6RA 3GKAA 1TTQA 5ABTA 1UOKA 4E38A 3E02A 4UNLA 4H3DA 2A7RA 2O7QA 2O7SA 1XL9A 4HKPA 2WPBA 3GR7A 2X2IA 4Q32A 3GXTA 4IJBA 2ISVA 3KAOA 1J0IA 4AYSA 4N4QA 3OBKA 3A22A 2PWHA 1XCXA 1QHOA 3K8MA 3YPIA 3QPYA 3QGVA 4RZ4A 5G2IA 4NNCA 2KZHA 1SMAA 1KA9F 1EA0A 1TQWA 3PS7A 2DZWA 5DFAA 2VRQA 4HPJA 1VFMA 3O6CA 4UQAA 4CQAA 4HHPA 3L66A 4QNWA 1PJ9A 4MUZA 2ZX7A 2BTMA 4DEFA 4RXFA 4D2JA 3A4AA 4UOZA 4X2RA 5DO8A 2QCHA 5AFDA 2VFIA 5LNRA 2ZRWA 2V2HA 2JKPA 1IF2A 1KFCA 4AW7A 1DEDA 4PC8A 1D7FA 2XN2A 5F1UA 3N34A 3TSBA 3GR8A 3HJZA 5A8GA 3W7GA 3S1XA 2QR6A 4JY9A 4AH7A 3GIYA 1GWJA 1MWOA 2D3LA 2ZUUA 1G4SA 3D52A 3KOFA 1FXQA 4MLJA 3IVSA 4K8HA 2JKAA 5G4WA 3ELFA 3GXPA 1YYAA 2YA2A 3HQ1A 3SSJA 1QO5A 2A6LA 3K1DA 5LNSA 2Z1KA 2XWEA 3VKJA 1PCKA 5HMSA 1OF8A 4AHQA 4J3VA 3UWWA 1JQXA 5EA9A 5FEWA 3U8GA 4RCXA 1OYAA 4CN4A 2QJIA 4LVFA 4OQVA 1E51A 3W22A 1OFAA 4B9YA 4N6EA 1R47A 1GTHA 1QPQA 4FHAA 4JYEA 1GT8A 3AJ7A 3CC1A 1I4NA 3HOJA 3PM6A 1BEUA 3OG3A 4WLCA 3NA8A 4MVAA 2H8XA 4CNNA 4O1DA 3DI0A 2VFGA 2YZRA 3L0KA 4X0NA 1F6KA 4FLOA 1TTJA 4S2BA 3CIXA 2ZRXA 1KGWA 2EEXA 4XBKA 3E9AA 1L0PA 4JCLA 4UCGA 1EUAA 1XBVA 4JIQA 3CWNA 5K4XA 4U33A 3WJXA 2QCLA 3B03A 3OVPA 3PB0A 2DH2A 3T7VA 4H7VA 3DHUA 1HUVA 5LNWA 2B0MA 1CXFA 1AQHA 1XSKA 3BC9A 1QWNA 4YMZA 1G67A 1U30A 4QSHA 4AMXA 2J9XA 3HJEA 3L4YA 1HTIA 3FFSA 1TRIA 4GUJA 3M9YA 1VFUA 5I24A 3TTYA 2P1FA 2H8ZA 3PULA 2C13A 4AF0B 1KFKA 1TJRA 2BHZA 4DO4A 2A2IA 4O1AA 3ABQA 2WKLA 1VHCA 1GG0A 3C2OA 3FJ6A 3PG8A 1OFBA 3C3NA 4HNTA 5CPMA 1C8QA 4GUFA 1PIGA 4MKNA 2B7OA 1M53A 3C6CA 4GIAA 2E09A 4UTUA 4DF2A 2C1HA 1TIMA 1QI4A 3GXIA 3AMLA 1QFEA 3N19B 3S1WA 2ZTJA 1GTEA 3O63A 4UIOA 5E9AA 3DI1A 1HNYA 1XBXA 3I7RA 5BNKA 4R7JA 2EO7A 3E96A 3G0XA 4RZ5A 4HNVA 3MBFA 1VAHA 4ICNA 4ALDA 4GFSA 4UR7A 4GRSA 4M6QA 5D2WA 5LKYA 5A2CA 5KEZA 4WXYA 3OA3A 5IBXA 3TSDA 2TMDA 2UV8G 1JRBA 1JL8A 4LXFA 2AQWA 3KHJA 2PE4A 4E2DA 1JD9A 2BSLA 3UZJA 4H6KA 3PAJA 4YXGA 1Q6OA 3CZKA 4M7SA 2ALWA 1VS1A 2FH8A 4M8UA 4KFNA 4JYDA 4O17A 3KRZA 1SO6A 2GOUA 1J0JA 1XD1A 4BI7A 5EPDA 3UYCA 1ZAIA 1MEHA 3BUPA 2PRLA 1H1ZA 4GWEA 1LBFA 4LW7A 4NZJA 2QAPA 4RK8A 2Y85A 1MW1A 1H63A 1MXDA 5CLWA 3HPXA 3GBEA 1GZGA 2NT0A 1HWWA 2TAAA 1H7OA 1WYIA 1XV8A 3EJRA 4UOQA 3GX9A 2Y7EA 1TQUA 6TAAA 1QWUA 3TMQA 1H1YA 2OX1A 1ODUA 1CI1A 2ZCGA 2VEKA 3FOKA 1GYLA 4W9TA 3NO5A 3AO0A 2WNZA 3ZOAA 3HIJA 5LHEA 1G7UA 1X1OA 4FX8A 1SW0A 4FO4A 1CW2A 4M7TA 3BAJA 4LRTA 4PSPA 3VM5A 2VEIA 5U4NA 3TK7A 2WO5A 1ZJAA 1RR2A 4H8UA 3DFSA 2EAWA 4GO8A 1C9DA 2Y62A 3BV4A 1EWEA 3VCRA 4U4MA 1TV5A 1GEQA 4FF7A 5CLTA 4JEQA 4AB4A 2E1DA 1G69A 3IIVA 2A6NA 4DO5A 4KWWA 4E2OA 4JTTA 4MYAA 3LLDA 1YXCA 3QMSA 5D30A 2ABAA 2DZPA 2CZDA 4E0CA 4IXHA 5C54A 3QRHA 2YJQA 4XKYA 3OLDA 1WZLA 2BHUA 3DKJA 3RLVA 2Y7FA 3TW6A 1R75A 1PS3A 5D37A 1ME9A 4IX0A 3SGUA 2FQIA 1BG9A 1VQTA 3DFOA 4J9JA 3NAVA 3DU0A 3L4UA 4O4WA 5HR6A 4MPQA 2OYLA 2HSAA 2WNWA 1B0IA 1YPFA 1LP6A 3BSHA 2GJRA 1MFUA 5LGZA 1NF0A 1M5WA 1VR6A 3M41A 3HGOA 4GO9A 2ZXQA 1LZOA 4N9EA 2ZWYA 4LT9A 2GJLA 2FB3A 3ATYA 3UG5A 4XB3A 1W31A 3LGEA 4OE7A 1ZCOA 1XFBA 3UZ5A 3NOEA 2V81A 3L21A 4JTGA 3BPWA 3TXZA 1L9WA 3B0UX 1SSGA 1UKSA 5CGMA 1SO5A 1CGXA 1RZMA 1WOAA 3MI2A 4PH6A 1DL3A 3MHUA 1H61A 1KM4A 1IZKA 1YDNA 2QCFA 4EF8A 2GPTA 4UNIA 3ZWTA 4LC6A 5G4EA 3SW6A 1EEPA 3UCQA 3PUOA 1FX6A 1E40A 3F03K 5BMXA 3W7MA 2ISWA 5HINA 4UQBA 1H50A 1K7FA 2WV8A 4TVUA 2ZA1A 2J25A 4QIUA 4R33A 3S5NA 1UBSA 1VCFA 1YTDA 1GYNA 3NL3A 1TPDA 4QAWA 1L6WA 3TAOA 4PCTA 1QPOA 5FF3A 1KM3A 2QDHA 4MB1A 1JCJA 3GDTA 5CG7A 3KL0A 3P5ZA 4HOXA 1ICQA 3QW3A 3IGSA 5HWMA 4MFEA 3L0NA 3WNPA 3VGFA 5CZTA 3HGRA 3VMNA 4YCPA 4PA8A 2CZ5A 2G96A 1TPWA 3EDKA 3DHPA 1EB3A 1FUYA 3IIOA 3H55A 1WX0A 1TJPA 4NJIA 1OG0A 3G8EA 1OFQA 4K6AA 2AAAA 1YXYA 4HNNA 3M43A 4WXZA 2QMJA 3AJXA 4FEZA 1EWDA 2NXHA 3S5OA 2PURA 5D09A 1XH2A 3MO7A 2YOCA 1F74A 1X6UA 3BLEA 5DY2A 4J3TA 3KFTA 1EP1A 3LHTA 4FNTA 5K2ZA 3DZ1A 1OK4A 4TMBA 3P74A 3UNDA 4MY8A 4UTHA 3DAQA 5CGQA 4KWUA 4JX6A 2GVJA 1PVNA 3RK8A 2WVTA 1D9EA 3WK0A 1IXQA 4HT3A 3C2RA 2DU2A 1KWGA 4CCEA 4WSJA 4JDBA 4ZQNA 5AC7A 3W2UA 3CZGA 5KZMA 1VPXA 3EKZA 3TOPA 4B9ZA 2ZRVA 3CZSA 1M7OA 1K02A 1MVYA 1MXSA 2XVKA 3QMRA 3NYZA 4BK9A 3TFXA 4WJEA 3STEA 1S3HA 3VO0A 3W76A 2F18A 1JGIA 2J27A 2VELA 3VU2A 2WC7A 3HPZA 6CGTA 1V5XA 5DCEA 4UMBA 1ME8A 1KBIA 3KRSA 1ZAHA 1FWNA 3S6DA 1WBJA 4UFHA 4DPQA 3VSUA 2TYSA 3EXRA 1A5AA 2CPUA 5D38A 3VGHA 3P80A 4JX5A 1R2RA 2E6YA 4XQ6A 3L9CA 4AMAA 2A7PA 5AHNA 1XSIA 3LCWA 3W7CA 2E6AA 1TMQA 2Z1BA 3BO9A 3GDKA 3A24A 3FKKA 2ZZ6A 3WY3A 1OX6A 2ALDA 1JUKA 2PWDA 2GQAA 2QEZA 5K9XA 1VCGA 3MP4A 2V8ZA 5AC6A 2QLYA 4UZSA 3GLCA 4UZUA 3QF0A 4JDYA 1I2RA 5HWJA 4MZYA 2Y4SA 3P82A 1BSIA 1UD2A 4WY0F 3EWZA 3G18A 3CTTA 1WV2A 4IMEA 5BRBA 1S46A 2ZWZA 4J7RA 2HTMA 2J88A 2WKGA 2ZRZA 5AHMA 1LRNA 2DZTA 2ZTKA 4LRSA 2DP3A 4N9BA 1WZMA 3W7HA 9CGTA 3H53A 1M7XA 2RDWA 4NU7A 1GJUA 1O94A 3M5YA 2F7PA 1M6JA 1CXHA 4AHPA 2ZFAA 1B9BA 4LTSA 3BH4A 1OYBA 3W7LA 3QPZA 2QCGA 1CXIA 1Z48A 5KINA 3EJPA 3GBDA 3ANYA 2QCCA 2DIEA 3EJSA 5AHFA 3NZRA 2OSWA 3P7YA 2F7OA 1BWKA 1R34A 1KW1A 6TIMA 2XFWA 1DOSA 1XXXA 5I3JA 3UG4A 2WOQA 3IV3A 3LCFA 2FHFA 4FLQA 5KTLA 1UD3A 4M6PA 3IVUA 4Y8FA 2JK2A 2WSKA 3BLBA 2GJPA 5I3KA 3CV5A 4ZQMA 3NNTA 3STFA 2TSYA 3BVTA 4UMAA 3NPVA 4QQ3A 3IVTA 1UH4A 1PE1A 2QDGA 4RJEA 1JCNA 3JRKA 1JR1A 2ATMA 4RR4A 2ZZ2A 1DQWA 1RP9A 2H3DA 1PHQA 4N6FA 4YLWA 3H54A 1VYPX 1BLIA 4Q33A 3I7SA 2X16A 1RPKA 3LXAA 4BA0A 4NNAA 3LV5A 3TMLA 1QI5A 1DJNA 1OFRA 4QJ1A 3TC6A 3UWYA 1WZKA 2V3FA 3MYOA 3W83A 4GI9A 3QYQA 2XVGA 3W84A 3Q2DA 1GJWA 3VM7A 1GVSA 3TAKA 1SFLA 4XUGA 3HGSA 4HSOA 3PBUA 3NM1A 1LM1A 3CGTA 3IJ7A 3DFTA 3LBCA 5BW6A 4ADSA 5EMYA 4KWVA 3ZT5A 1PEZA 4J27A 4NX5A 4J3XA 2GVYA 3MW7A 3A47A 1OVDA 4PEEA 2E0PA 3HG5A 4O52A 2YDAA 1TO3A 4UNKA 1P0NA 1RV8A 5CZ0A 3LI0A 2W0UA 3EJUA 2VEPA 3VE9A 4UQDA 4K36A 3WNKA 3LCHA 3GNDA 1I2OA 4DQWA 1UUOA 2YSWA 3D50A 5CZSA 2QCNA 3GXNA 4HSNA 3STCA 2QJGA 2ZZ4A 3O16A 1Y7VA 3TDFA 1G7VA 3U2OA 4IMDA 4AIEA 1QAPA 1ME7A 4FIRA 4BI5A 3OLIA 1X8FA 2WJZA 5TBOA 4DELA 2A21A 3F4WA 1VB9A 2J9YA 2Y70A 4LS0A 1SMDA 3GXDA 3IGUA 5A6LA 1JIBA 1MO0A 5FF4A 2B4GA 1MW0A 3LPPA 1PV8A 3STGA 4JTKA 2WCGA 3PF3A 4K37A 3PBWA 1O5XA 4PCSA 4LUIA 2Q3OA 2QUVA 3T4CA 3EX6A 3LBMA 5K9CA 4O18A 3W2NA 2JGYA 3N14A 1DKWA 2NUWA 3B0PA 3JR2A 1QHPA 2CXGA 1IZJA 2LLEA 1SW7A 4XBSA 3L0GA 2ABBA 5KZEA 2C3ZA 2ZRYA 3L4TA 3WDIA 1K7EA 3TQVA 3LTPA 2ZX9A 3T78A 1W5PA 1W5MA 3WFZA 1IIGA 3VNYA 3W1QA 1YXDA 1HL9A 5FEXA 1VLWA 2YX0A 1G94A 2EHHA 1W0MA 3N9RA 4JTFA 2RDTA 3W7JA 3O1NA 3W1PA 1F05A 3TU9A 4UTLA 2HMCA 3CZNA 4U31A 1LOQA 3BGGA 4JFTA 1KFLA 3N2MA 4O54A 1KFBA 3W7IA 1J0HA 1H7PA 4WZHA 1W5QA 4KFOA 3NQAA 2DORA 2WVUA 3K30A 1Q6RA 2OT0A 1UD4A 4HIBA 1H3GA 3HGJA 2FHBA 4GE8A 3RU6A 3W2MA 3KVLA 3KEHA 3CB8A 1PCWA 3NZ1A 3DENA 4UTJA 3MHGA 3O8AA 3EWWA 3MHFA 4AEOA 3NDOA 2Z0IA 1ZJIA 5FF0A 1Q6QA 3VMOA 3LCIA 2Y63A 1W3TA 1JFHA 2ZA3A 1QPKA 4K38A 4YWIA 4Y90A 3V75A 4JIPA 1FCVA 2JKEA 5K4ZA 4NJHA 1V7YA 4LVGA 2E77A 1FCQA 4JN6A 2PWGA 4UTTC 4LV4A 1QW8A 3I7QA 3CLWA 3WNLA 3OIXA 4JTHA 3RILA 4O0KA 1AK5A 3S2CA 1L6YA 1MSSA 3IIXA 4LC8A 2VFEA 3A23A 3TQKA 3NXFA 3DHFA 2DZUA 1I2QA 3HG3A 1VH7A 3FIGA 4CNOA 3S5YA 4ORMA 3TIMA 1LWJA 3EWUA 3FA5A 3S9YA 2WKJA 3EJTA 4EF9A 3R89A 2Y5EA 3VNZA 4JFWA 3PG9A 2NT1A 1JVNA 5CKSA 2E4TA 2NLIA 3HF3A 2V3DA 5BOOA 3GDMA 3L2MA 4O53A 1VGAA 3LPOA 3EEGA 3ZT6A 1HO1A 3UXAA 4MY1A 3RMJA 3BSGA 4Y9AA 4JTSA 2WPGA 1AL8A 1K7XA 5L6UA 3D0CA 4X9SA 1FXPA 1M7PA 2OZ0A 1LCOA 1TPH1 8TIMA 4BWLA 2QUUA 4U28A 1H5YA 1CIUA 4CCCA 4MAZA 3T40A 3WK2A 2A85A 4ADTA 4DBDA 2VNCA 1GQNA 1SR9A 2J9ZA 2GVGA 1TMHA 4RZ6A 1JF6A 1BF2A 5E0KA 1ZFJA 3NL5A 2FGZA 2BY0A 2ZUVA 5E0FA 3R5EA 3ATZA 7CGTA 4O50A 2BLEA 1DTUA 5CPOA 1H7RA 2G5WA 2XIIA 2EJ1A 1ICSA 1SUXA 1JD7A 1MW2A 1WE5A 1SO4A 3IIZA 4TR9A 4Y6GA 4WY0B 1TPB1 1LOSA 2Y2WA 3OLEA 3NPWA 5HUPA 3BAKA 1RVGA 3OLGA 3P8JA 4ATWA 1QPRA 3FW6A 1XUZA 4UTKA 2E5BA 1THFD 3CZEA 3LCGA 4IUOA 4LU0A 5AHEA 3KXQA 1MEIA 3I6RA 5LZLA 5HJLA 3C0JA 4OBTA 1A5BA 3THQA 4JICA 1XC4A 3W6YA 3BW3A 3TV8A 2CLKA 1G1YA 1FDJA 1P1XA 5J5DA 3G8RA 3BVVA 2BHYA 1CPUA 2GQ9A 1KBBA 3WMSA 3TCEA 3WJWA 2QJHA 3GTNA 1EIXA 3N2XA 3VNDA 4H8HA 1QO2A 1PIFA 2C6QA 2CLMA 2HS8A 2C14A 4FX6M 3P67A 4OGZA 3ZQ9A 3E12A 4PTNA 3R8RA 1OT2A 1BKSA 3M7WA 3IEBA 2D73A 3VGBA 4R53A 4GUIA 3GYEA 3M0ZA 3PBVA 4BF9A 3C61A 5AYYA 1UKQA 5TIMA 4NVTA 2QF7A 3W7QA 3M5XA 2Y89A 3M5VA 2Y24A 2RHGA 3RNDA 4O12A 4BR1A 6ALDA 3LI1A 2YYTA 4XTIA 4O57A 1ONRA 3FS2A 3G3MA 2D0HA 3NQCA 1GVFA 3T55A 1S5WA 3EDEA 1FWTA 3P62A 5HNRA 2PWEA 4JFVA 4DF1A 4N9CA 5LGXA 3C2FA 4BZYA 3W1AA 1JXKA 4LS1A 4N4PA 2TRSA 5FF7A 3C2VA 1BTMA 1OF6A 4AEFA 3W73A 1A47A 3SECA 3TKFA 1VJIA 5CPNA 2NZLA 1VYRA 3FYOA 5CGTA 3N3MA 4NUWA 5G2WA 4PSRA 3G0UA 4UFLA 3W88A 4A2RA 2R94A 2ZXDA 3L2LA 1LRTA 2E9BA 4IWWA 4OKDA 1E3ZA 1O60A 2C15A 3BK0A 2G3NA 2BZNA 4CNPA 1WA3A 4UTWC 1GCYA 2V5BA 4MYXA 1TPEA 1ZAJA 3O15A 4H8VA 4EOUA
chains in the Genus database with same CATH superfamily
4OZHE 2XTJC 1ZTVA 4C6OA 2BFGA 3TNMB 4G70B 1JN6B 2MPVA 1OAZH 4HU2A 4HS3A 1LYXA 3NGBB 2HH0H 4PB9L 3MUIA 2QPSA 1NJJA 3QH3B 3WUBA 2NY0D 3G5YA 2QPUA 2XXMB 4FXFA 1CE6A 3CE1A 1QASA 3RWJB 3KYNB 5EMUA 2VUKA 4N2NA 4DPCX 7REQB 3QRFM 1WTLA 1OAKH 4FKHA 3UROR 3DYPA 2OFJA 4DF0A 3UXKA 4H1ZA 2QR0A 1L5GA 2BC4B 3FCTB 4YMPA 1FYTD 1F45A 1QEXA 5EG6C 2HS6A 3ORWA 4Z1AA 4P2RE 4ZO9A 5LAXA 4TQTA 2VXNA 3QUXB 5DY3A 2PTZA 5MEPB 3DUUB 5FLVA 3LHYA 3HN5A 3VI2A 2XZAL 1J8HB 1PZSA 2CKBH 2V8LA 5GGTH 1ZLUH 1ACCA 1NL0L 3AMKA 3W27A 1I1YB 3L3HB 4BEQA 5IQ9A 1WUNT 2PTTA 3B8YA 1HKVA 2Q3RA 2OTUB 4FFVD 5EUOB 3QR3A 1ZS8A 3KNBB 4JVPA 3SCSA 3UBXG 3CFKA 4YN5A 1IE4A 2QPEB 2QADD 3WUEA 3T8XB 4XX6A 2UZIL 2OSXA 5DD5H 4G9DB 4WEMB 5TDPA 3WY4A 5IHUH 4IRJB 5AOLA 1HX0A 5H94A 3V6ZA 4G6JL 4CADA 2PDIA 2CM6A 4AW4A 3PJXA 3SDXB 1K8XA 2R8WA 3L67A 2VDQH 1NQKA 3MUXA 1IBDA 4DJDC 2OL3L 5SV4A 2JJTA 1H3TA 1QMLA 4UB0L 3N55A 1TIWA 2VGBA 5C09A 3UXLA 4C56B 2WJ5A 2X5PA 2DLTA 4OZ4B 4PJEA 4WWOA 4CRPA 1C8VA 2ZYFA 5CP7A 4ZDHB 3BGMB 4BK5A 5DMJB 2DMHA 3LNDA 1T03H 1XF0A 1QT1A 5ACZA 5J6GA 3R18A 3N06B 4G80B 4OZFB 3QO1A 4G7QB 3LU2A 4GUHA 3DX0A 1DV7A 1WOBA 2R2BB 3DJTA 5CD3A 1N8WA 2PRMA 1A2YB 4ZAKC 5T5NG 1NSNL 1BX2B 4UF7C 1JGLL 4AMKH 3KDOA 3QG7L 1NOLA 3RGVC 4JTEA 1QCWA 3P69A 5CZJA 2LU4A 1DWIM 1DQKA 2X4TB 2DQDH 3CSBA 3LNMA 1VSCA 3CDZA 1EJFA 4J23A 5KOMC 2X1WL 1C16B 1BCIA 1FE8L 1TQVA 5F70A 3RWJA 1NDTA 3PHOB 3VI3E 4F7KA 5K1NA 4JFXB 4MA3B 1A3QA 4S3CA 2CLEA 2RDXA 1RBAA 3W2JA 1IAIL 4K7FA 5I2IA 4X6DE 1NCWL 2XSXA 3KLAA 2K9UA 3NCYP 3BQ5A 3ZE1B 4Q2ZA 2G0KA 4LF2A 4GK8A 3WY1A 4BWTA 5J1TC 1RJQA 4IIEA 5DCDA 1AKJB 2X42A 4KI5E 4C7FA 2G2RA 3O0RL 1MCIA 2ZOKA 3USBA 1J8HA 2L7UA 2NY4B 5IT2H 4M80A 1R3LA 3EX3A 3UNTA 3WQ8A 3FFDA 1FNFA 4YE4H 1ADDA 1ED3A 2DQFA 2BIIA 1KGUA 5AVZB 4BV1A 1HKKA 3RUGE 4YK4B 2DV6A 1FH5H 2NCMA 4NN6B 1ZHBB 1RJRA 1ZTMA 1TYGA 4EX4A 1KPUB 3TFKD 2Y88A 3RM8A 3THUA 2LLNA 1BD0A 4HTBA 5BMWA 2XVBA 1XKJA 4NJKA 5I1LB 1BXBA 1W91A 1A64A 4P4RB 3U2SA 3VRLE 4DWSC 2AQRA 4PYSA 1ZY9A 1F11A 4RNRB 3JS3A 2D22A 5KSBE 5EN2A 5ANMB 5J9PB 5DZVA 5I8CB 1RZQA 3UDWA 1EHLL 3CL7A 3P8IA 1BGXH 4F2FA 3P84A 1FYTA 4Y4KD 4PCKA 1QFWI 1D9KA 3GRGA 5CU9A 1EDQA 1YEKL 4ZQKB 5F71A 2XU2A 3OB0H 1FDLL 5TAOA 2YRLA 3K5SA 1KOAA 5CQ1A 2F58H 3WQ4A 3EO9H 3GE7A 1TETL 4YHPA 2F08A 5I8KH 4W4QA 5FKPB 5AC8A 4GCXA 1QEWA 2OB3A 1G5GA 5J5RA 2VDML 5CD3B 4Q6JA 4YU1A 4X3ZA 1DEEB 4NWTL 3CAWA 3WQCA 1D5IH 1L9NA 4KQ3L 4D1JA 2PMQA 1GKEA 5GHWH 3VSTA 4JX0A 4MCMA 1MCLA 3WMPA 1P7HL 3AAMA 3DFQA 2DPKA 1UD5A 4OGYH 1NL0H 4R26H 2YAQA 3D6NA 3G6MA 2DB8A 2I07B 2Y0SA 3MMEA 4JRXD 2VC5A 1VACB 2SFPA 4Z1BA 4NFBA 1G84A 3WD0A 3WGVB 3HPFA 1D5XB 1KCLA 1CX9A 1QD0A 3ZDZB 4BD4A 5BVPH 2WTRB 5T1KD 4NT0A 3RWGA 5E93A 3DK0A 1AJ2A 2OZ4A 3Q05A 2DQWA 4ODTL 1KCVH 1UD6A 1PTGA 1FWXA 1W37A 3BAYA 2BGQA 3AS1A 3FQWB 3WDHA 1QG3A 5EOQL 1K1DA 1F86A 2P3EA 4WEBH 3LZFH 4PRHD 2FT6A 3WELA 2W9EH 5LQBL 1LQ0A 1QPNA 2EKCA 2AJUL 2IQ0A 2AI0L 4N24A 3MRFB 5LWYL 3V52L 3D5HA 3Q65A 4OCSH 3AT9A 4EJ1C 3EPNA 3G04A 4HEPG 1QBMH 1SLWA 2ZSWA 3GBML 2D2CC 2AC0A 1RZIA 1S4IA 5C7VA 2E7LC 4JIRA 1MQKL 3SCVA 3NPZB 3B7YA 4DPPA 2WVVA 3HE6D 5D6DA 3QC0A 4U3HA 5HGBA 2CHXA 4IMAA 2IH3B 3WBEA 4KO6A 2NSQA 5GGSY 1ZGLM 4HS8L 4MXQD 5MEQB 5HQLA 1FWWA 5F9OH 4DGYH 3BH8B 3RIAF 1TZZA 3W11C 3MGOA 1ISVA 1A50A 2GWNA 3GNPA 1I1CA 2VDLB 4MMXA 4S1QL 3NMEA 1RUMH 2A1YA 3UGVA 4YGVB 2CLOA 2GFBB 5AB3A 3T0CA 4WY0A 1N8FA 2FCBA 5E4OA 1AIFB 3IJIA 2TSAA 1EJTC 2NZIA 2O4EA 5B39G 3L3OA 1X7TA 3CEPA 2X3AA 2X3BA 1MCOL 2XHNA 3D51A 2NX5A 4JMXA 2JCCA 2BDQA 1K6AA 4F79A 2OMYB 2C18A 1JUFB 1PFOA 2VXQA 4HAKA 4K3GA 4HSAC 5K1VA 5JXAL 1UT2A 3NQ6A 4A22A 2P8PB 4UC5A 3PXHA 5ABGA 5HDRA 3RAJH 3Q37A 1WLHA 4GIPD 2P7TB 3WXVL 5DS8A 4EDXB 2VLJA 1WH0A 3M1CA 5CHNA 3ULUC 4XAGA 6A3HA 1H8LA 3D12B 3BGFB 5D7SH 4W5UA 1NGYB 3LRMA 4JTCA 1KLFB 3S98A 4ELKA 2GITA 4G42B 1XYCA 4Y4HD 1TSIA 3EKGA 1ZVNA 3QDGD 1F1GA 3X17A 4TSCH 2QDDA 4D94A 4QRPA 4IPNB 3TJXA 3TJIA 3KUMA 1B6DA 2WSPA 1ZDQA 3FQXB 3IXAA 4WFFE 5DUPH 4OV6F 5FM5M 2PDCA 5AB0A 4KRLB 1BZEA 2ZXAA 4F66A 3OB8A 4NLAA 3WEAA 2ZD0A 1W56A 3F05A 2VHLA 2W62A 4L8DB 3T77B 4UTAA 4K2UH 5CAYB 8A3HA 4Q8QA 4L6DA 4JPGA 4PJEF 1QP1A 5DELA 1TCMA 4NENB 1O9VA 2BVQB 1UQSB 2W60B 3A4XA 4BFIA 2F58L 4AJWA 3DMMC 4YLBA 2EAEA 2QQ6A 4JRYA 1Q8JA 2BWGA 1FBAA 2DAVA 3DDMA 5MHBA 1SN0A 3MLVH 2FZ3B 2PTUA 3C4UA 3ALXA 3CVHB 1FKWA 2P76A 3S1VA 3H56A 1ZCCA 1DUYA 5D7EA 3CO8A 3C6LD 3O45B 3G0SA 5HQMA 3FK3A 1QOQA 2AGTA 1EV2E 2BXYA 2IG2L 5I76A 3O41A 3SGKC 5I3GA 1BVLB 4H26A 4YGVA 3ZRSA 1PZ2A 1V6YA 2VRKA 1YEEH 4PJFF 5IFAH 4QKXB 3MQTA 4FR6A 4ZZ9A 3AADB 3NQFA 4QNPF 3HAEH 2X2UA 1WDWA 1EVUA 3M8OH 3TPUA 1CDGA 5F9JA 3CTLA 3R79A 4IKLA 2VDQL 4YVUA 2B1OA 5GRVK 4I9WD 2B14A 1IXNA 3NG3A 4PJGB 4K7PX 4MJ5A 2GUUA 3QEQE 4YHML 4XSLA 3VE0B 2V2DA 1JPGA 1G7HB 1OO2A 4N2LA 1Q7MA 1RZ7H 4WI6A 1VHPA 5CHNB 4BFNA 4X9HA 3K71B 1I1AA 1SVCP 3CMFA 2G5UA 3QNXB 1N7ML 2V6AA 3GUGA 2VDRB 1NF7A 1HAUA 2DQEH 1OE3A 5DHMC 3BRDA 2PLKA 2X1UA 3TROA 4DZ5A 4UTFA 3EWYA 5BU9A 2F53A 3LSOB 1BVZA 3S5ZA 1XH3A 2PWFA 4S1RL 3QPXH 1G6VK 3VQLA 4MIMA 4N25A 1YEDB 3PPGA 3RBSA 3VFSB 4X9BA 1ELSA 1XAUA 2RIKA 4KKRA 4KXAA 2IBBA 2AQPA 3ZDWA 2HLAA 4PMFA 1O6VA 1ETZB 4LIQE 4YE0A 4G71B 2G3IA 4K8RL 3SR7A 1GYCA 2R1NA 3W75A 3F7PC 4PJXB 4WUUD 3AU1A 5C08D 1OAKL 1WP6A 2PABA 4JIIX 2I9EA 1E4XL 3Q7JA 3DHDA 5I19L 4F2ME 1YKWA 5D33A 1CFNB 1T7ZA 2P28B 3MNWB 4NO2B 3EYOB 5GS0D 3A64A 1MCQA 2Y7QA 3QH2A 1V7ML 4UWQB 4ORZC 4XNMA 3LS9A 3T4AB 3BSZA 2NWRA 4O2FB 3AZSA 1BXAA 5JORB 2PCYA 4IP5A 1K8DA 3U7BA 1QLRA 3EO1B 4R34A 2OL3H 4AD0A 1W9XA 5CEYA 4OHQA 5SWZB 3DV4A 2ZF8A 4N0UA 3M44A 4LKCA 3GZPA 4JFDA 1E90A 3AMGA 1I8UA 3E1F1 3JWNE 1OBAA 4KRZA 1EYEA 4HKPA 2Y72A 1F6AB 2VDPB 5CMAA 2OMZA 4A2HA 4BDVB 1Z9SA 1JDCA 3TWAA 2WINA 3L2IA 3V16A 3EO0B 3KWSA 4QOKE 3C6LB 5EOCH 3Q01A 4CKVX 4JZJA 3EFOB 4NN6C 5A16B 4AIZA 2DT3A 1SJHA 2FTAA 2YAFA 3DV6B 3GDLA 1JE6A 2VT0A 4MJ5B 3AXKA 3IRSA 1QFWM 5C2BL 1S2TA 3TO4C 3MREB 1E6XM 3SO3C 3H4HA 2OLHA 4Z7WB 3G3DA 4U3AA 1U1HA 1XH1A 4LPCA 1UXLA 3H9HB 1OFOA 4QXUL 1KWKA 1JULA 3TX9A 1QFHA 3RFZC 4R90L 4M61B 3TZVA 4KFZC 1IC1A 3X12B 2DEXX 1FDLH 4ZODA 3VXUD 1X5IA 3DA0A 1NFAA 3SYOA 4TVPD 4JE0A 3BD4A 3G6AB 3QJQB 4OFPA 3TC7A 2B16A 1V05A 1G9NC 2ZKMX 5DEGB 1RXOB 2F7FA 3FKRA 1ET5A 1M71B 2G3MA 2QQLL 4OCLC 3CHXA 3GS4A 4UM9D 2IGTA 4WWKA 1ETZA 2A4CA 3LCXA 2WXJA 3CSYA 3G5ZB 2EABA 4KTGA 2YSSA 4RDWA 7A3HA 4IT1A 4W4NA 4PUNA 1T0MB 2DWSA 3TYAA 4L8SA 4AYBA 2ALRA 1O7SA 3DFPA 3C2SA 3QQXA 4I7WA 4A3UA 1C08A 3VIOA 4FG4A 2BVEA 4NO2A 1D3HA 1FH8A 2J47A 4NI8A 4D72A 3AREB 1MI5A 1LE9B 3TXVA 4U1MB 3JWOC 3RWEA 4ZGYA 4RAUA 1OABA 3IJ9A 4UQCA 3TJHC 2GSIA 4CQ8A 1KFEA 1M3JA 4O02H 5C0FB 1PZBA 1T7VA 5I1HL 1DWFM 3VOFA 1WDQA 1ORQA 2HN7B 1J8SA 2BS9A 2Q3XA 2V2XB 3HE7B 4XXDA 3P0VL 4APQC 4AKOA 1E4XI 4GBXB 5I6MA 1P0KA 3I4KA 1TQBB 3QQ4B 3TVMB 4XD5A 4OCNC 4IJ3C 5C0ND 3BHBA 3T0DA 3T04D 3WQGA 3ECQA 1CZ8H 4IDLA 4YQXH 5TDOA 2DZBA 1XIFA 3GSXB 1CLCA 2E47A 4WV1C 2XPYA 4EANA 1QSEA 3PNZA 3CPRA 1M9HA 5IVZB 3ULUF 4XWOD 2FYYA 3L3IB 3NAAH 2NQLA 2ICSA 3TA6A 4DBWA 1NBZA 5LIXX 3S36X 4Y9BA 3QQDB 5KZCD 3E3HA 3O2VH 4FKKA 1L8NA 2ADAA 3P4MB 3HJ0A 4F57L 4XVOA 2E27L 1ERNA 3EH2A 1V3JA 4MNQE 4P06A 3D3VE 4XPBH 4OECA 4YVVA 3WBXA 7ENLA 1ZLWK 3OVRA 4UV7L 5CWSA 4LOEA 2ZADA 1IQWL 4DVRL 4GJ1A 4DJED 1CLVA 1P4BH 4GW1B 1Q6CA 2ACSA 4UFIA 3IRCA 2D2OA 1OV8A 1H7WA 1N6QH 1IEAA 3AM8C 5CBAA 4PM1A 1NGQL 4AZ7A 4K8RC 1JVLA 3OWEA 3TZVB 4YUEL 2XNAB 3J07A 5E8DH 4LU5H 4DP1X 3LPFA 1EUNA 2BY2A 2X2YA 3F64A 4LLQA 5K9KA 4GRWH 1OALA 3PY2A 3PZIA 1OGTB 5I1EH 3KP1A 1INQB 5JHAA 2W0FB 4JQXA 3VNKA 1MPAH 3NZPA 4C59B 4O28A 1I3RA 1THAA 4E3VA 5F7AA 5GS2D 1NVMA 3NZ8A 2RDUA 5TK2A 4DGUA 4LO9A 5DQ9B 3EEZA 3QJXA 4QTHA 4B5TA 2GC4C 1KB5B 4F9PA 5EOTB 2F5AH 3TT1H 4QXTB 3IGXA 2K8QA 1LVEA 4RIRB 1VFLA 2XBZA 4NC2B 1XGYH 2J7HA 1HHKB 1SZEA 3WL0A 3L3GB 4LCYA 1GOQA 1NP2A 3FKUS 3FTGA 3JWDH 3QIBA 2VLRE 3W0KA 2DFAA 5DYOB 2ATSA 1ZVSA 2V30A 2OYKA 2H9GB 1A7NH 3RIKA 2VZOA 3RY6C 4I5XA 2JKLA 4KUCD 5D1QA 2XG9A 2WYSA 4LGSB 2APXA 2FL5B 3W9EA 2G2NA 1U83A 4Q8OA 1IKFL 4TKWA 3ITVA 5I16B 2R14A 1T0OA 4JN1L 2CKBA 2BP3A 2WBXA 5IOBA 1LMKA 2QT6A 3ARWA 4URTB 3V8OA 4C7GA 3NIFE 4HSQA 4LCRA 4POCA 3UYRL 1YPIA 6ENLA 4ZTYA 3SFWA 1PKOA 1WBZA 1LBLA 3NVTA 1FVCA 3OU8A 3FZUD 2FD6L 2H2PC 4LFHD 3UCDA 2FYYB 3AIEA 3WHE1 1FWCC 1HT6A 1HNFA 5PCYA 1ESOA 1Z41A 2B8OT 2IPGA 4PAZA 3VXPA 3MLTA 3L68A 5GS2H 4QF1A 1H6EA 2R1WA 3PSVA 4F48A 1M2OA 3QC6X 2KX9A 3C5JB 5D2LF 2OTUA 3LIZH 2FPVA 3L5AA 5IK3A 4DW2H 1GOXA 3FX4A 4IHOB 3IDUA 4DJDD 2KPNA 1K3IA 1B3ZA 1MUMA 4FS9A 4ZTXA 3QG6B 2QUMA 5AL8A 2WLLB 2ICEA 1OJXA 3LA4A 4AD5A 3VVWA 4LEXH 4FNSA 1A9VA 5HATA 5JNYA 1T22A 3FO9A 5JA9A 1Y5VA 4DGWC 1EL3A 5JH1A 3TJLA 4HW6A 4MJIE 4WKXA 3H42L 4Q8TA 5IIEB 1T1ZA 1MWAH 3GB6A 1TU2A 3I9IA 1F73A 1ECYA 3FQYA 2XWDA 3W07A 1EVTC 3USZA 2GVLA 2W9DH 1OGPA 3IKCB 2Z1VA 3HNSH 4LT7A 3S37L 1ZTXE 3ZE0F 3FB8A 4N7QA 3PGFH 1AR1B 4XBMA 1M65A 4PUWA 1IM9A 4B92A 3MRQA 2P26A 3V4PL 3UQNA 3BTNA 2WMHA 5J3HD 4IMKA 4AVIA 5J6GB 3QQ0A 1SJBA 3D0AA 4U0RB 4UV4H 3H7RA 4PP1C 3N41F 1NARA 1TTPA 2WOBA 5JXEA 3P11L 1P7TA 5D2XA 3K8KA 1SHWA 4WU7A 4Z3GA 1WGOA 2QKIA 2ZZ1A 2NV1A 1TZ7A 1KPVB 4B9KC 4QRRB 1SO3A 3UFYA 4W93A 3D48R 3N3EA 3TA3B 3IDMA 1F97A 4ONGL 4IF2A 5F1SA 4C6EA 3GXMA 4D6JA 1FO0B 1MJ7H 3UPBA 3JSSA 4DVRH 4WUKL 4DXKA 1U8HA 5EZJB 4ORGA 4R4ND 1GC1L 2ZP9A 1W5NA 3CEUA 5DRWB 2F74B 3FRPB 2NY4C 3WYRA 2O6FA 4GXVL 1W2KT 3ZRCC 1ES0A 4MOZA 4YDVA 4PGEA 1J1XL 5JXEC 1D5IL 4KQ3H 3RR4A 3AUJA 2I69A 3K7UA 2ZXBA 4RQQA 3MNMA 3MSPA 3VXPB 3D2TA 4L1LA 4NXKA 3SDAC 2CKRA 1ZPTA 4TUFA 3G1AA 1AE6H 5IHSA 2EXYD 3MUGA 1XG3A 5KYUB 8CGTA 3QM3A 4FQIL 1T6VN 4WK0B 1ZGLA 2YRPA 3RZCC 2XG4B 3N6HA 2J8UA 3OXSA 1BP3B 5FUZL 3BARA 4K9EH 5CJMA 2ACRA 4EI5D 1BHGA 2CLVA 2O6DA 3EW3B 1GVOA 3O07A 2Z4GA 1OP4A 1THCA 3QEGL 3RG1C 2A73B 2MH4A 3Q2NA 4GAAA 2N3JA 5DYFA 5FUOH 5HDQL 1VBJA 4S10A 4XXCA 5DFTA 3UVAA 2K9FB 4B41A 1KG0A 4JO1H 1J8HD 2RB8A 1H41A 4JIEA 4KWVA 2FEDC 3X11A 4W9ZA 1IWAA 4YH6A 3OGRA 3SDOA 5DD3H 1U91B 4OLZL 1NQ6A 4ZFGL 4X4XB 1KJVA 4HJ0C 4DCQA 2B2XH 4WDIA 4M1DL 1HEZA 1NCJA 3N0PB 4Z7OB 1UZ8B 1HAWA 1HKIA 4ICWA 3ASNB 2J56A 2K6WA 4YIQB 1X98A 2WSQA 3CBWA 3DX9A 3CH8A 3IK2A 2AJSH 2C1IA 1WVZA 2X6UA 2DL9A 4PY7B 3LSBA 1R46A 3F3HA 1H8SA 1E4KC 2B4CH 3IDJA 3WV0A 2VIRB 3CU2A 4A67A 1TCRA 4R5VA 2DVTA 4F7CB 4QWWC 1RU9L 5J11B 2ZYHA 3ZFHA 3U0PB 4GI6A 2AXFA 5LCVL 1E0XA 2ZCLH 2ADGB 3LKRB 3WEOA 5KVEE 1F8TL 4UT9L 1EP2A 3SQRA 4NC1E 2EQDA 1KELL 5FYLL 3SGDI 3ARGB 1OTSC 3ECWA 1NMAH 2NNAB 3GIVB 4TRPL 4IMGA 5BVPL 1CS6A 4LV9A 1AQMA 3H6AA 1RUQH 4YSCA 1F56A 4AYFB 1YNLH 4Z7NF 3AHYA 1JYVA 5J57B 3NGJA 1F3DJ 2JALA 1L6PA 3REQA 2VL5A 1UD8A 3QXAA 3JVGC 1XDJA 1HHJB 2BX5A 1I8LA 1V93A 1AFVH 4XP5H 2X1TA 6PCYA 1FC2D 1AR2A 1IT8A 4U7MA 3OKNB 1AOZA 3I75B 3GMMA 1T04B 3K3QA 5E5RB 4JM2C 4HULB 1R86A 4GSXA 4Y2DD 2ZYSA 3HRZB 1CGTA 1XGPA 3P2TA 4WNSA 3VFVA 1U5JA 1FF5A 5FEZA 5FYJL 5BXPA 5AVQB 4XPAL 2PPAA 3OG6B 4YL4A 5T5FA 3W7EA 1PG7X 4MA7H 1TV7A 5BXSA 4PMJA 4EMZA 1UH2A 3KYKL 2BODX 4PMNA 3EYFA 4M1BA 1JZ7A 5BQDA 1FYTE 4ZW3A 3LERA 3BH8A 3HC3H 2VWEC 4QQUA 1UXSB 3CUPB 5KYNA 5IJKA 3F7VB 2YLKA 4EIVA 3APTA 5EZIH 3L5WB 5JW4N 5HSFA 4AZBA 2ACUA 1J88A 2D3NA 4HDIB 3PNUA 2UY6B 4ZG1A 2FZ8A 5E6IB 5LNVA 2FB2A 3EOSA 3U9UA 5U7SA 2OMXB 4JREB 1A4AA 1FFOA 2GTWB 3QUZD 4M7JL 2HLEB 4JKPL 1J18A 4QHMA 1IC7H 4MHHG 1MHEA 1TZIB 2HT2C 1A02N 1E0TA 1XUUA 3TC3A 1R0AH 3UOAB 1Q45A 1H15B 3N17A 3ETTA 4ICXA 1KBJA 5G2HA 1DQDL 3VQMA 5I5RA 4QHUA 1MCDA 1FQ0A 1UASA 3K1KC 1RZ8B 5A6BD 4N86A 3O0RH 1HZLA 1KIPA 4WFGD 1WHOA 4HU0A 5D7IF 4AZUA 1EZ2A 3DOPA 2CNYA 2WWCA 3LZ3A 3QKEA 4WHCA 4KKLD 1YMYA 1ASPA 1KRBC 2A9ML 2V5TA 1HESA 4J8RB 2E7LA 1V3HA 4YPJA 3FTZA 3MOBL 4WW1B 4ZTOL 2E5DA 1VBGA 3RF9A 1B88A 1N8OE 3LY0A 3S34L 1GZPB 7FABL 1JDAA 1XGRA 1N26A 4KK8C 4PUKA 3TEVA 4U6YB 2EIJB 4MSWA 1CZ1A 4QRSB 1RH9A 3VNIA 4JTLA 4S1FA 5ENWB 4CW1B 3ZR5A 1QI3A 1FUNA 2Y0FA 3TO2A 1WBYA 3GDRA 1RZPA 4HA3A 3L4XA 3T77A 1UYWL 3E8VA 1U93B 3KG5A 4GY1A 1U3YA 3V0IA 3H24A 2OOFA 5LDUA 3LMZA 3THAA 4KCWA 3S2JA 2F6AA 2OMUB 2RR3A 3H0TA 4JNXA 4P5RA 3H2EA 1U8LB 4L4TE 5C0NC 4P2RD 2ADYA 1IEQA 2LVEA 3BN9D 1ZHNA 2C1GA 4O11A 3RM4A 1ADQA 3V18A 1IM3B 4JN1H 2V5JA 1P53A 2AV1B 3LNEA 2K3HA 4W9EC 5D72L 1UH3A 5EU5B 4ZW5A 1I9IL 4K71B 4LANA 5HQEA 1MUWA 1X9RA 3MV01 4DJDA 4FP1A 4AJYV 5FJOA 4NI6A 4ZW6A 2BOFX 3C6SA 3LKOA 2OJEA 2P42B 2WMKA 1E8ZA 1DBJH 3RFRA 2WHJA 1G4RA 1S1RA 4GG6A 1RBLA 4UILL 5JW4R 5CJXC 5CXPA 4IQDA 1S7XA 5F9WB 1G9NL 3P02A 3RX9A 2FFIA 2J6XA 5G4HC 4L29B 4GBUA 3Q58A 4ADGA 3B7UX 1U42A 3H3BC 3B0XA 5C0RH 2UVEA 5JYMA 4E6MA 1ICPA 4MD5B 3BISA 4XP5L 5A2BA 1IAOB 3ARBA 1W2VA 2XN0A 2F38A 3WLRA 3DJRA 1OGAA 2WO4A 5F7KC 3O6YX 3MNDA 4OB5L 3AM8A 2NYZA 4RRPM 4G5DA 4QEEA 4WDUA 4YNYA 2PS2A 2ARWA 1N67A 3QNZB 5DVKA 5F3BA 3MBDA 3BWZA 4WDTA 4YHEA 4HN8A 1N7MH 1MFCL 1JCMP 1KACB 2M1KA 1QNZH 1B3IA 3BLPX 1M9SA 2LU7A 3OR6B 1IC0A 3PGDB 4MJHA 3RDTC 1J5TA 5B22A 5MENA 4PVNA 2WXQA 1XMWA 4FNUA 3MRLA 4JY5H 4R4BB 3PJSA 4IPIA 5HHOB 1VZIA 5DHDA 5JW4M 2F1AA 4E2BA 1EO5A 4TSBH 3W37A 1E42A 2CU0A 3LTYA 4MSWB 3S35L 3UYRH 1AZVA 4O9HH 5IQOA 5DVMA 3FS9A 5IFJA 2CZFA 1AS6A 1NBVL 1KTLB 2GQ8A 3HS9A 3KJ4C 2AL1A 3L65A 3WLSA 5LB1A 4FA7B 2NQ3A 2YBRA 1QTSA 1TB3A 3E2VA 3GNNA 4KWSA 2DMCA 2FO8A 4PRTA 4AE1A 3RPMA 4AWTA 1TJIH 3UWUA 1A7PH 1DN0A 5B3JF 1GVRA 4MAVA 2BJML 1RVFL 2YPVL 4EN2A 4HIJB 2FQGA 3FUHA 3MRCB 3W2DH 3UEQA 2G97A 5LGHL 3D46A 3ME0A 4U6VH 1KSRA 3F58L 2XVLA 3WJSA 2CDFB 3IARA 1TG7A 1EXPA 1DIDA 4M56A 4XZ4A 4D9QD 1N59B 1BQLL 3QZWG 4XN1A 4HNOA 3WLOA 2OCZA 1OAQH 1QACA 2Y5TA 3IAPA 4DEPC 2YD0A 1HP5A 2XSAA 3NQMA 2JIWA 1IGJB 5J89A 2O26U 2WXMA 3ABMB 3U4KA 2WMPA 3T6CA 2PP0A 1KJ3H 3I3BA 5TDNB 2NZ9C 5IVXA 4BK4A 1HJQA 3W3OA 2OJEB 1HL8A 3LV6A 1T2QH 4FQIH 1RZKL 3B4NA 2W9DL 1UOVA 3HFFA 1R5WA 1E4NA 3UY7A 5AW4B 1LLOA 2DDXA 1Q0YH 3V4PA 2YA0A 5KYYA 3AB0B 2CR6A 4L5ZA 2CLFA 3GK8L 1CLZL 4KKCC 2PZ0A 1S9VA 1DVQA 3T8VA 3RB5A 5CSSA 1KIUA 3P73B 4DJFA 1UOWA 2F7RA 5I1JH 2NY3D 4X4KA 5DMIH 1I3GH 2BCKB 3WENA 4I9AA 3CIWA 1Y0LA 3TH6A 4MZ8A 3LXCA 3OYZA 1G6RA 4BKSC 4Z2LA 3ATDA 3S8FB 3DX4A 4YL2A 2V5KA 3HI1A 3CHVA 2HXAA 3QNZA 4AKQA 2CWNA 5ANME 3M6YA 1A21A 3UJJL 2VLKA 2VMDA 3F7YA 3RWFB 1FLRH 5KSBB 4E4FA 4I0PA 3ZE0B 2RGMA 3RCYA 3N2OA 1UPMB 1NC4B 1KTBA 4CN1A 3F4NA 4RV8A 2FLBT 4QXUH 4L4MA 1AD0B 2VC2L 4IJTA 1SJDA 1JXJA 3NAAL 5HHOA 4L3EE 3BE1L 3CPLB 1OTUC 1XBZA 2NLJA 5I0YA 4GFXA 3FAXA 4EZKA 4GYFA 2RUSA 2FVKA 3MSDA 3KRUA 4NJJA 1F4WL 4JN2A 3QZWB 4D8AA 4YPGB 4APQD 2WO2B 3W74A 4JBSA 2XQYG 5CPQA 1QDSA 4ZUWA 2BP8B 5J11C 5F2MA 3AB0C 3QQNA 1EJ8A 3FO0H 1M7JA 2IGFL 2OWXA 1U33A 4JM4H 3ESUF 4K3EH 3F62A 4H8WH 4RAHA 3ZE1F 1W32A 3DX6B 4ZO8A 1PBGA 4Z0XB 2QDEA 3MT1A 3CHRA 2P0OA 2HRWA 3ABSA 4FI8A 3TLRA 2G5BA 2E8ZA 1L9SA 3S88L 3BMWA 1RIHH 1RLBA 2OXGB 4FEMA 1UATA 1MAMH 3QHZH 3PPCA 1IAII 4Y8EA 2WXOA 5E8EA 2CA3A 4MTVA 3O4LD 2FBOJ 3BIKA 1RA0A 1EZVY 3MODL 4LHUG 2XN9A 5A1AA 5JOFA 5I15L 3CUHA 1Q0YL 1P2CB 4GABA 5DMLA 1W9DM 4NLHA 3BP7A 4JM2B 4OV4A 2G60L 3OKLA 2HT4C 3RA7L 1YMMA 3E0LA 4PJ9D 1NTHA 3SBQA 1NCHA 4XNDA 5C0JB 1F6FB 2WZAA 4PJDB 1R9YA 1Y0EA 4GY7A 5AWNL 5F4WA 1MWAA 5ICZB 3QOMA 5FJPA 5FYLD 2B5IB 2N56A 5BS0D 1IGCL 4FZEL 3RNQB 3LQLA 3CBRA 2BNQA 3EIFA 3SCTA 3PUDA 1IQWH 4L61A 1OP5H 3L9RB 1AYRA 3W7RA 1K70A 2HZGA 3MB9A 4JTIA 3RLUA 1KXHA 2VE6B 2H9AB 1CLYH 1I45A 3H7VA 1LBMA 1A7PL 4H9MA 4IGBB 4NJAH 3IB4A 1J1PH 4JTQA 1AHWA 1JGUL 1R24B 2G4GA 5HYIA 4XWUA 2RALA 4GQRA 1OARH 5GIRB 2WUCH 4WSHA 2EDFA 1BZ9A 2V2WB 3TO4B 5CEZD 2QCDA 4HZ8A 1UMLA 1JV5A 4JTJA 3CU1A 3B2DC 1TNNA 2QGCA 5EGRA 4X42A 5JMOC 4OY9A 3RWHA 3LH8A 6REQA 3RG6A 1JPST 2VDPH 4FQ2H 4LCWB 4Z0BL 5BV7B 4LGRB 1RLDA 1ISXA 1BFVL 4ZTEA 5DT7A 5IF0A 3MROB 1U6AL 2VKWA 2Z91A 3EPMA 3D3AA 3RPIB 2FE0A 3R8HA 1CJYA 3UJIL 3U9WA 2QQKH 2DZXA 1CXKA 4LSRH 1XLBA 2HLFD 1UZHA 3B04A 4J3OH 2YZ5A 3QIWD 3WEMA 1S7RB 5AOIA 3ZHDA 1UOKA 3LS5H 3SCPA 1L4IA 4H3DA 3QY7A 4HZAA 1S7QB 2CUHA 3HZKB 1QSEE 3PABB 4BHUA 5B3SB 1XL9A 2CGRH 4FCAA 3PAVA 2WPBA 2QHAA 3AUOA 3VCCA 2H9GA 3MLXH 2OXGA 1U5VA 4IJBA 3OW1A 3E0WA 5FPIA 4TPRL 5IB4B 4AYSA 5D1QB 2PWHA 3FB5B 1AKPA 3CC5B 4R6UA 5E51A 1QHOA 4X99A 2A3CA 3AQUA 3N1PC 1U3HA 1Y1UA 3MJ9L 1F4YH 4LKXA 4O5LL 1N0LB 4NNCA 4LCCB 4YR6A 2P50A 4JG9A 1TQWA 1ODAA 3WN5B 3PS7A 1C9SA 1F3JA 2ATKB 3ESVF 2VRQA 4LZKA 4P23D 2GVGA 3FGCB 3O6LH 4HPJA 3VOJA 1VDGA 3BPCB 4XP1L 3CLFH 5HHNB 4FQLH 3AQZA 5DMGC 5MEOA 2Q6ZA 1X5HA 3N18A 4CQAA 1HSBA 1LEGB 4DEFA 5D5MF 3SDYH 3UAFA 3ZKNC 1TJ2A 5I30H 3PFUA 2DSWA 4DWHA 5I1DB 4OCXH 1U8QA 3WH5A 2YEZA 3CV7A 3NCBB 4OFYA 1VRSA 4OCMC 3WJJA 4PJBA 5GRUL 5FHAH 2Q8BH 2V2HA 5CCGE 1UB5A 3F7QA 1KFCA 5DJ8B 4AW7A 5IMKA 2MPAL 4PC8A 2PDFA 3FOLA 3TFCA 4UAOB 1CVSC 3GR8A 3HJZA 1GZQB 3QK0A 4JY4A 3W7GA 3QISA 2J7DA 2Z28A 1WIUA 1P7QD 4PW9A 4Q58C 5C8JA 2JCCF 1FWFC 1KNWA 3H2CA 2XG5B 1CGSL 1M41A 1MWOA 3IKCA 4IOIB 5DJDA 4NKMA 1G7JB 1EJOH 3AZTA 3ARQA 4IBSA 3MZTA 4JG1L 2EYSA 4YXKL 1QRNA 2MQCA 3KWWB 3ZGIA 4K8HA 4IJCA 5IB5A 1BD2A 3V0HA 5BRZB 4ONOA 1MMFA 3K2KA 1UIPA 5G4WA 4KFMA 4DJEC 3SSJA 3VABA 2JK5B 2ZNXA 1WT5C 3H9SE 3KPOA 1URIA 5FUOL 5L9DL 2GZXA 4XNXL 2O4QA 4PN6A 2AJXL 1A5FL 2YWZA 2W27A 3JVAA 3VKJA 4AY7A 2PR4L 4OJFL 4Z3JA 2Z8VC 1OCCB 4G83A 2DL2A 4YSSA 1OF8A 1R7OA 4AX3A 3FTWA 3RPDA 43CAA 3UWWA 4KNSA 2JKWA 1KLGB 2N1TE 4TNVK 5K1JA 3SM0A 4CU8A 2BRRL 4BUHA 5FEWA 1XIHA 1ZT7A 3OZYA 4OQVA 2PF6A 4CN4A 3IAQA 4EXKA 3EOOA 3FB5A 4N6EA 5DJ6A 3MNZB 5FM4A 3SE4A 1RVFH 2PDJA 3H8NA 1DZ0A 3MRMB 3ULVL 5I06A 4XCYB 4HLEA 1XGTB 4XR8C 2EZ0D 1GT8A 4JYEA 3PM6A 4QS5A 2BVDA 4LKXB 1HWHB 2EEFA 4WLCA 4Z76A 1IEHA 2H8XA 4MVAA 1SXBA 1BGAA 1WJ3A 3PHAA 4GKZB 5F7MC 4ZX3A 5IBLD 2OCCB 4LBUA 2EECA 3L0KA 1XQ4A 1F6KA 1T1XB 4FLOA 1F8TH 4UT9H 4HJ0D 5MEOB 5KJRL 1ZA6A 3RZCB 4BE5A 1EBAA 3TESA 5HI5D 4S2BA 1CFVH 1KGWA 4EP8C 4GVHA 3FT4A 1OY0A 1BYDA 1BYAA 3VFRB 3NH7L 4JCLA 4XVJH 2J75A 5HMDA 1N64H 4AGPA 1CFSB 4JIQA 3BZDA 5CILH 2R82A 4PJEE 3DYMA 2VITB 4NQDA 4WFGE 3UAAA 4MCZA 3B03A 3WJXA 1SDDB 3VJ6A 1OXYA 4TQEL 4UDUA 2WXDM 3I02A 4H7VA 1JXFA 2DWYA 2WZ6A 3CH1B 3DHUA 1HUVA 1O5QA 3SKMB 4EBQH 1EANA 3WLTA 1CXFA 1BOYA 5JIKA 5D7LD 1GZHC 4F9LC 1AQHA 1ONEA 2XV6B 2IH9A 1AC6A 1GRWA 1FZJB 2IV8A 3OKKB 4TUOB 5IHZA 1HGYA 3FFSA 5C09B 5DMGD 4MADA 1RUKH 1VFUA 1SQ2N 1LHZA 4LVNC 4H9VA 2P1FA 5AZ2H 1JWMB 4AF0B 5KVFL 3F7RA 2H3NA 2A2IA 4PGDB 3R7QA 5TF1L 4OAWA 5LDSA 1M3IA 5DWUH 4G5AA 3GU9A 3QJFA 5FO9B 4AU0A 1MRCL 2JJSA 4TULH 2N1KA 4XVDA 2DM7A 2XQYA 3OJDB 4HNTA 1F3RB 4RNIA 3UP6A 1DQQB 1M4KA 4Z7QE 1CU4H 3U7VA 3ARDC 1MFAH 2OQJA 3SDAA 5KS9E 1I4FA 4GRLC 5KETA 2OYPA 2AKRB 1KLGA 1L0QA 4AOFA 1TIMA 5GJMA 1KGIA 1POJA 3S1WA 1ZV9A 3AMLA 2ICWA 5E2UL 1GTEA 4KEUA 3MOAH 4XIMA 4XZIA 4N28A 3FCTA 3DESA 1N6UA 4PJ5A 3RE0A 4E0RA 3DI1A 3I7RA 4XCYA 5JR1H 2MJWA 4UI2A 4WO4B 1EEXA 1X39A 3G0XA 4FI7A 3TVAA 4BWWA 4RZ5A 5C0DA 3FHEA 4M7KL 1WTGT 3CYJA 4WSGA 3T0EB 3C75A 4AQ1B 2YGYA 4UR7A 4ZW7A 1T5WB 4M6QA 3FB6B 4GP4B 5A2CA 5KEZA 4J3OD 1I82A 1PFCA 1V8HA 1CFTB 2F8IA 2ZOOA 3FUDA 4XMPL 2V69A 3OA3A 1R3LB 3L5XL 4IBZA 5IMMA 2J5LC 2UV8G 4B9GA 5C0IA 4BZ1L 1JRBA 3W5NA 3VTRA 2HJPA 2YLAA 2AQWA 1M7IB 1SYSA 1E9QB 3KHJA 4RPPA 1NPUA 4OFIA 5DCCA 4CJ1A 3QEQA 4P46C 1OSYA 3EGSA 4E41D 1XIDA 3WFLA 1A4KB 4L3AA 4CVUA 2BSLA 1ASQA 3D8MA 1UXSA 3CN4A 4NQDB 4NZ1A 3EO9L 3Q3GB 4YXGA 3O2DH 2XTJB 4WRLA 4WDWA 5FJUA 2DQJH 3UT0A 1ZLDA 2BCMA 2FH8A 2R9HD 1DQLL 3HAEA 5DU7A 1VS1A 2BV9A 1F11B 4RL3A 3DPDA 4UTCA 3KRZA 2CCWA 2NXZC 3N13A 2GOUA 1IC7L 3O0LA 5HGAB 1XD1A 2YMXL 2Y2YA 4PVLA 1BZ7B 2CO6A 3CXDL 3MLPA 1V6XA 5ICXB 1XYFA 2AQVA 5EPDA 5GGQL 1TVLA 2VDLH 4MWFA 5HJ3A 3NQIA 3QUMB 1BBDH 4D71A 2R2BA 3ARGD 3G9AB 4ZJ9A 1LBFA 2HFFB 3F01A 1MW1A 1H63A 4DT2A 2WO3B 3HPXA 1Z3NA 1IEBA 4PWEA 3S9IA 5D71L 1FWDC 2P45B 4MJ2A 2NT0A 3P0YL 1I31A 2TAAA 3E74A 1OK8A 2AVGA 4OD1L 1P0BA 1WYIA 3LQZA 4HFWB 5TPWH 3RJOA 4KU1A 4OCSL 4EI6B 1IVLA 2R83A 3T9PA 3VC6A 2YAMA 4FOKA 3MXWH 2NR6D 2P5EA 4NO3B 4V1DA 4EN3C 5E00B 4UTAH 1JZ3A 1GGCH 1MDAA 4MX7B 1QWUA 3U2ZA 4O0QA 5EB9A 3SEPA 4KZDH 2GOKA 1H1YA 5L8JB 2V63A 3H2AA 4PRPB 2AMUA 1MCWM 3NO5A 32C2B 2ENPA 4M1CD 4PJDF 3T0EA 4I18B 1FSKB 1NCTA 1A3HA 1V4YA 2ZG2A 4EWJA 1DVXA 3Q2CA 4XAFA 3VDAA 1G7UA 1NMCC 4X7TB 3VB9A 1T0NB 3DBXA 3ETBJ 4F37K 4B27A 4A3RA 2XOTA 4FO4A 4EI5B 1OAUL 2JIXB 3BP6B 4KZEH 4DKAA 4U3SB 4LRTA 3TTEA 4HCRL 3NDYA 1HHGA 2XTJD 3KXFA 1KIQB 3VM5A 1SOKA 3EF7A 5GRXG 4PTXA 5AVNA 4C83B 2DSKA 3WD3A 3MA9L 5IB3B 1A6UL 2E9JA 3QUKB 4H8UA 4P4KB 3DFSA 1L6GA 3V0DA 3GEWB 3PK7A 2X70B 1D7BA 4HUXA 4E41B 2HBVA 3MU3A 2AABL 4A7GA 3EXJA 2APTA 3MVSA 1UZDA 4U4MA 5ACMA 1TV5A 1IL1B 4C6LA 3MDJA 5CD5C 1AO7A 4FS0A 2GFBA 3NFSL 3WF2A 1MFAL 3QR1A 3QDMB 4FKEA 4AB4A 1I9RL 3L9EA 5LBVA 3SJVA 4JTTA 3U46A 4LJ3A 4XBEL 5M7QA 3LLDA 3R0UA 1CT8A 1I9EA 2OMYA 4MMYB 3WFBH 4YUEH 2CZDA 4MWFB 5EFFA 4OZGE 4XWOC 4YHPB 5FYJE 1QFUL 2C3HA 4XKYA 3BESR 3NK4A 3BJFA 2MUCA 4JHBA 1UEYA 1EEYB 1Q9OB 1BIIB 1YJDC 1TSRA 2Y7FA 3HBZA 3GMRA 3NJ3A 1CT5A 4JO2H 1BYCA 1FTXA 1R75A 2WYHA 3PIQB 3BOLA 4LP8A 3VIHA 1PS3A 3SB0A 4PGCB 1T21B 5JQ9A 4BXVA 2O61A 1C9WA 4GG9A 4QTGA 2IADA 1P84K 3DIVA 2IAND 2HLFC 3WKQA 4H0HB 5D37A 3H9ZA 2D2GA 3SGUA 3K81A 1BG9A 4P2OB 1MJJB 3MLUH 1VQTA 3CUXA 4AXWB 3DU0A 3QARA 3L4UA 1US0A 1IX2A 4MPQA 1OTSD 1SOSA 3HB3B 4XWGL 2WNWA 4L3CB 4X98B 5KTEL 4GLRI 4V1DB 3S35X 5FJJA 2VR9A 2HT3D 2XV3A 1AR1D 1MFUA 3THDA 3VXRE 2MFNA 2V17H 1M5WA 1VR6A 3M41A 4HYWA 2CCVA 1AHKA 5JW4Q 1FAIL 1IAKA 2MEJB 2ZXQA 2WSDA 3BUTA 5GXBB 4S38A 3MRFA 2NYYD 3MRJB 3PY9A 4F92B 1LZOA 4GMTH 3REWA 1DN0B 2OI9B 4FXKB 5LNDA 4XB3A 3TX4A 3IACA 2CG9X 4NENA 1W31A 1BQHA 3L08A 4OE7A 4FD0A 4OFDA 5D93B 5AUMB 3FMGL 2MNRA 1E5CA 4QLRA 1K4CA 2F1EA 3CVHH 3NOEA 2WYTA 2EKGA 3TXZA 2X7LA 5AVXB 1L9WA 3N1FC 2KH2B 3KPMA 3DIFA 3N43F 3U9PL 2XWJA 1RY0A 4WKAA 4XVSL 4QLLA 3DETC 1GVYA 3W53A 1S2WA 1UM4H 4D3CH 5DHXB 4MXVE 4MRCA 4L1HA 3NZHH 2EVFA 3MHUA 2H3KA 3RIFK 1H61A 1ZIAA 2XFYA 3V4PB 1EKOA 4LRIC 4K07A 5E94A 4EF8A 1WZ1H 2BHFA 4TVPH 3P2DA 1X9QA 4KPHL 4UNIA 4LC6A 3PTDA 2FX9H 4RA0C 4GBDA 3F2DA 3E9UA 3GIZL 1E40A 1TJ1A 3F03K 1A6PA 3SUTA 3VG9B 3AWEA 4Z8FL 4ZBJA 5IV2A 4K5NA 1MWAL 3UAJD 1A6AB 4ZS7L 2DQGH 3BDYL 5HGDB 2J25A 2Z8WC 4HJGB 4NP9A 5E6RB 3GD6A 4G7VH 3S5NA 1XP3A 1VCFA 1YNTF 3UW6A 4BM7A 3KPNA 3DARA 4QISA 3UH8A 2EH7L 3K4WA 1GGTA 2IADB 2PLJA 5JO5B 3VAVA 2A83A 1YEIH 3QQWA 1YG9A 1IFRA 3QXDB 4TVPE 1PY4A 2Q3AA 1AD4A 3PGCB 4NHUA 6FABH 1FRBA 4RNJA 4PBDA 1DSYA 5I82A