3H53A

Crystal structure of human alpha-n-acetylgalactosaminidase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
387
Chain Sequence
LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVQYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.9 a structure of human alpha-N-acetylgalactosaminidase: The molecular basis of Schindler and Kanzaki diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-N-acetylgalactosaminidase
total genus 129
structure length 387
sequence length 387
chains with identical sequence B
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3h53A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3h53A01
1OYBA 4G1KA 3P80A 1QDSA 1ONRA 2B7QA 1S5TA 3ATZA 1TPVA 1JDDA 1EH9A 2YR1A 4KMQA 1SMDA 1YLVA 4FX7A 3GTNA 5LNRA 1CXEA 1YXCA 1GYLA 4HPXA 2QUTA 4I7WA 4LU0A 5EKYA 5BNKA 3A21A 5BRBA 2GJPA 2VUYA 1NAL1 1QFEA 2YPIA 4XKYB 3ZWTA 1ALDA 3BLKA 1W1ZA 4Q4KA 5HQEA 3VNDA 2DZSA 1KFBA 2Y7FA 4JX5A 3STCA 4LVAA 1H60A 4NU7A 3NDOA 1EP3A 1S5WA 2ZUVA 3CLWA 3LCHA 1OFEA 3TJLA 3IIOA 3HJZA 1G4EA 4LV9A 1IZJA 2F84A 1SW7A 3NQGA 1HX0A 2NXHA 2PRHA 4MUZA 1MXSA 5EYWA 4K8EA 3BAKA 1KFJA 4HOXA 1PS9A 1UD2A 3QMTA 3KRSA 3WDHA 1AW2A 1H7NA 3NQFA 5I3GA 3TOPA 3PY2A 3R8RA 1WBJA 3EJSA 1RPKA 4IXXA 1UKSA 3GXFA 3K30A 2ZQ0A 3DGRA 1KCLA 1H1YA 2OT0A 2F7PA 3AJ7A 4J3UA 2FE0A 4H2CA 4M6VA 5K2ZA 4AHPA 4O13A 3STGA 2NV1A 1M53A 4UTIA 2XVKA 2DJXA 3UERA 3UG3A 1EEPA 1ZJIA 1HO1A 2F7FA 5BRPA 4IPJA 3MHFA 3WJSA 3BGGA 3CWOX 3T44A 3RK8A 4NQ1A 2A5HA 1XUUA 1LLZA 1AMYA 3BW3A 4RZ6A 4UTTC 3M1ZA 1XSKA 1H7PA 5G2HA 1YTDA 4HPHA 4RXGA 5K9CA 2B7NA 3GKAA 1W31A 1FWRA 5E6ZA 3UCQA 4J27A 2CFFA 4XBSA 1W54A 4M8UA 3HPSA 5I23A 3QPYA 4GRSA 4A2SA 4XKYA 2OYMA 1NSJA 1VHCA 2E0PA 3KVKA 3EDEA 5EMYA 1W37A 4AHQA 1OK6A 5I5RA 3G1XA 3TW6A 1MW1A 1PJ9A 4LVGA 3EWBX 4M5PA 3TSBA 2BHZA 1R33A 1HNYA 1ZJBA 4HSNA 2Y5EA 1K3UA 1RQEA 4I7UA 2CZDA 5E6YA 3PULA 3V75A 1RVGA 2YA1A 1UB3A 2JK2A 4HOZA 4OIFA 1XUZA 4MJZA 1VJIA 1VFOA 1L9WA 3C2OA 4BI6A 3W37A 5AOUA 4JTEA 3U6WA 3W87A 2NX9A 4JN6A 2A85A 2OCZA 5BOOA 1THFD 3LTYA 1XD0A 2PCQA 1YPFA 2EACA 4IQLA 5HXMA 4O57A 1CDGA 4Y90A 1B2YA 2FPTA 4MKNA 1J5TA 3FAXA 4WSJA 5I24A 3P60A 2X1TA 2C7FA 5CZJA 1TQJA 5CPLA 3VE9A 2RDTA 3G8RA 5F2LA 4MB1A 5T26A 1VIWA 1QI3A 2F18A 2BY0A 5HUPA 5BW6A 5D32A 3DHPA 1QOPA 4S2CA 3QF0A 2R91A 1T99A 3GNDA 5E9AA 1CGYA 2D3LA 3KFTA 1H3GA 1ME7A 3W76A 3WJWA 3SGZA 5K3VA 3IIZA 1LP6A 1OYAA 4ICNA 3BMWA 5HMSA 5CGMA 2V9DA 4JYDA 2Y7EA 4GIAA 1EHAA 2GPTA 1Z42A 1P6WA 2D2OA 3AJXA 4RZ5A 4K37A 1ZY9A 3C4UA 3HZ3A 4LRTA 3TC7A 5CSRA 1QW9A 1OABA 4UTWC 2YCEA 3L4WA 3LHZA 2E6FA 1SO4A 4YL2A 3BG5A 1Q6OA 1HTYA 3K1DA 3P62A 3DFOA 2VRKA 3IJ7A 1IGSA 2NWSA 3LRLA 2ABAA 3W07A 2WKLA 1TREA 3IRDA 1S46A 4UOQA 4PC8A 5CG7A 1DQXA 1W3TA 1O95A 5E0FA 3VO0A 4JX6A 1DQWA 3EX4A 3GVGA 3A5VA 3DDFA 1E51A 1YPIA 1ME8A 3GBDA 2XN1A 2P0OA 2YDAA 2QCEA 1Y0EA 3BO9A 3NOEA 3R5EA 3L21A 3RNDA 1EP2A 2GJRA 2CU0A 5DLCA 3WK0A 3CTTA 3BGJA 2CPUA 1BWLA 3CQ0A 1CW2A 3W72A 2ZFAA 2ZTJA 2QJHA 3TXZA 1I8JA 5HR6A 2I1OA 3WJXA 1LRQA 4IUOA 2ZUTA 1KM1A 2VEIA 4UMAA 2YYUA 1B57A 1UH2A 3EJPA 5ABTA 3BK0A 1QHPA 3QRHA 1QI4A 3LLDA 1PEZA 2J88A 4AXKA 3FKKA 3I7RA 5I0DA 5G1TA 1Q6QA 5CGQA 4TO8A 1XKYA 3RF9A 1FDJA 4MY1A 2QUVA 3LTSA 1KFEA 3KAOA 2OSWA 4XWUA 1GTHA 1A50A 1SSDA 1NM9A 1JD7A 2O7SA 1M7XA 2WNNA 4JFUA 2UV8G 4O54A 3OLGA 5CPMA 5G2IA 1EA9C 1UOKA 3BUDA 3UD6A 5LNWA 4Q33A 1CXKA 5G2WA 5K9XA 2QLYA 1LCOA 3CEUA 3W1XA 2BZNA 3S1UA 3VFLA 1GT8A 3LHTA 5L9FA 1F6PA 3M9YA 1VAHA 1HWWA 3B03A 4NXKA 1T96A 2XVLA 3KVLA 2X2GA 4LUJA 2C1HA 1K7XA 5CKSA 3WNKA 1FBAA 1W0MA 3PSVA 3OA3A 1G4SA 1XFBA 3WJZA 3HF3A 2A4AA 4MAZA 3LGEA 2QCHA 2G3MA 1PPIA 2QMKA 3WY2A 1QWNA 3P84A 4CN1A 3ZT6A 3EB2A 3UG5A 2XN2A 1RD5A 2DORA 3L5LA 4POCA 2ZWZA 2Y61A 3L67A 2FHFA 4Q32A 3LI0A 2V8ZA 2C19A 4MLJA 1GZGA 2TMDA 3IGXA 1C8VA 1OGSA 2Y4SA 1JG9A 3HQ1A 3QM3A 2ZRZA 2OYLA 3CIWA 2KZHA 3NPXA 3PVFA 5BMWA 2E8YA 1UKQA 4MY9A 3QZEA 4O0ZA 5F2GA 3W1NA 1JXJA 1PHQA 3EWXA 2WV8A 2EADA 3RIKA 3EWZA 5K7JA 5D04C 4JTJA 3EEGA 2BHYA 1V3JA 5U4NA 2Y7GA 4AF0A 1R30A 4FLQA 1TJPA 2NXIA 1Z44A 3TNOA 3G1YA 1XM3A 3C61A 3P81A 1H7XA 2PWEA 4PFMA 3SZ8A 1VPXA 2X2HA 2ZZ3A 1KB3A 1KFLA 3NQ6A 3LBCA 4HHPA 2DP3A 1JAEA 2GVJA 3ZFHA 1ZENA 4HKPA 3UWWA 3O05A 5CLTA 1S3HA 2C0AA 2PWFA 1TPWA 1AQMA 5GVJA 2YA0A 3WMSA 3L4VA 5LZLA 2X2JA 3NL5A 1BTMA 1R2RA 4M6QA 4B9ZA 1P0NA 2XFWA 3GXNA 3THQA 3EWYA 3ECQA 1NOFA 9CGTA 2ZBTA 4CQ8A 1Z41A 3O8AA 1I2PA 3VU2A 1JCYA 1MFVA 2BHUA 3TA6A 1G7UA 3R12A 1IIGA 1L2UA 4FNSA 1XXXA 3W1MA 2P1FA 1TTJA 4IMCA 3DU0A 5G1YA 4GUHA 4HIBA 4HN4A 3TAKA 1QPRA 4J3XA 1L6WA 1SUXA 4K7YA 4OKDA 4AW7A 3WEMA 3M41A 4NNAA 3TROA 4UTTA 4A29A 4UC5A 4GQQA 3DI1A 1KM3A 1JIBA 1WPCA 3TC6A 5KITA 2YW3A 1YDOA 3WJYA 1KCKA 3W9ZA 4HSOA 4H8HA 2W79A 3P8JA 3NZRA 1WP6A 4JY9A 2NUWA 2O7QA 4X9YA 4RXFA 1LDCA 3NO5A 1FWTA 1J0KA 1GVFA 4MFEA 4AAJA 1M5WA 4FNRA 4JR5A 4NUWA 3BLFA 4H8VA 3GXPA 4Y96A 1I45A 4AEEA 2V3DA 2B4GA 1UA7A 1D3CA 5D2XA 3S9YA 3P74A 4GXMA 5AHNA 3PUDA 3W7HA 3UQNA 1XGZA 5HWJA 3GDRA 5I3HA 4GI9A 2VRQA 4E2BA 1TQXA 3L66A 1KBJA 4WZHA 1K7FA 1O5KA 2C6QA 4RK8A 4O4WA 5L6UA 4CNPA 2JKPA 1B9BA 2QCDA 3HO8A 2VFFA 1F05A 4UQDA 3PAJA 4AYSA 1GEQA 2QAFA 2X1SA 1QMLA 1B3OA 2ZRWA 3D0CA 1TTPA 4O50A 1ZFJA 1SZGA 2QCDB 4K7VA 3O15A 2ABBA 4UTMA 4D2JA 1IZKA 3S5OA 4NX0A 1CYGA 1HXKA 4AYGA 2RHGA 3LXCA 3BVUA 5AN7A 3W84A 4UOZA 1HT6A 4K8HA 2WKGA 3NGJA 4YMZA 3LXBA 4WOZA 1V7YA 3SGUA 1MXGA 4UCFA 1U2YA 1U33A 3K8MA 5HWNA 1KFKA 3NM3A 2CZEA 3PB0A 3W6YA 1Q6RA 5KSWA 2C15A 4DF0A 3R13A 4QNEA 4ZQPA 4R53A 3UWUA 1JI1A 1V3KA 4AIEA 1WX0A 5CXPA 1VGAA 3WFZA 1K03A 4ZQMA 4MJMA 3F1QA 1RZMA 2J25A 1L6SA 3WDJA 2XN0A 4GO8A 1OSEA 1BKSA 4OGZA 3TQKA 4DO5A 2ZA1A 4LRSA 2BXZA 1XBVA 1DL3A 4O0KA 1DORA 2XWDA 3RU6A 3FJ6A 2F1BA 4MZYA 4M56A 2Y24A 4JIPA 2DH3A 1TB3A 6CGTA 3BW2A 4O17A 2ZXAA 1SU5A 2J6XA 1AG1O 3IVSA 5G5IA 3SIZA 2ZX6A 5AYZA 3EDFA 4M7TA 2EABA 3PG8A 4CN4A 5I3FA 2ZX8A 1QCWA 1E3XA 3ABOA 1IXOA 5D2VA 3WNMA 3I6RA 2X1RA 3BARA 1UD3A 1W5OA 1BWKA 3CZNA 4DF2A 2TAAA 3MP3A 1G94A 1OJXA 3VSTA 2FQIA 3FLUA 4DELA 4FB7A 3NQEA 3EDDA 4JL1A 2A6NA 2FTPA 1E43A 4JTIA 4PL1A 3TXVA 5KEZA 1OVDA 2ALWA 3L65A 4FIQA 1TCMA 2Q3OA 1D3GA 1M7OA 1GVRA 4O15A 2AAMA 3G1FA 1MW3A 2WSQA 2FHCA 3LTPA 4AIOA 3O1NA 2OX1A 4ZVJA 5BMXA 1TMHA 4GBUA 2E5DA 2ZUWA 3JRKA 5DY3A 1VS1A 2WJZA 4LXFA 1QWUA 4IOTA 1JCNA 3LB0A 1WYIA 2YJQA 3LRKA 3CWNA 4WSKA 1A5SA 4H8UA 4Z1AA 3MHGA 1CGWA 3F4WA 3E9AA 4C1LA 2CLLA 3GDLA 5AHLA 4O14A 4XB3A 3BAYA 3BAWA 1AW5A 3L5AA 1PIFA 3GR7A 4BK9A 3LCXA 3TFCA 4UFMA 1XDMA 3S5NA 3NNTA 4Y8FA 4UNIA 3ZT7A 1EWDA 1FDYA 1JL8A 3S8HA 3BVJA 1O60A 2YW4A 1EP1A 2E6AA 4CCDA 2D3NA 3NM1A 3SY5A 3RMJA 5IBXC 3AMKA 3PBVA 4K6AA 4WF7A 2DJLA 2JGQA 3CPRA 5KMYA 1GQNA 2B0MA 2QCCA 1F74A 4JTHA 1KBKA 2OSYA 2OW6A 5DBTA 4OE7A 3FW6A 3NG3A 4R34A 5I3JA 3OLDA 3PC0A 3MO7A 3UWZA 3PBYA 5C55A 3NPVA 1Q6LA 2E09A 3OLEA 2GOUA 2FLIA 3W2NA 1DV7A 2VFEA 4BR1A 1XBZA 4A2RA 4A21A 2QV4A 3DDGA 2ZXQA 1QPQA 3OLIA 4FIRA 1EO7A 1J2WA 2CLEA 4TIMA 4TU1A 5F4WA 1FXPA 3W2KA 2NV2A 1XD1A 3IJ8A 3MI3A 1D7FA 3QSRA 1WZMA 4CQ9A 1DKWA 5FESA 1EB3A 4J7RA 3C2RA 3DKJA 2R8WA 3L0NA 3KVJA 4O12A 3HB9A 3PG9A 1JDAA 4Z1CA 2FHBA 3OIXA 1TQTA 4U4MA 2QPUA 4QIUA 3LOTA 2Z0IA 1PCKA 1MO0A 5KZMA 2A7NA 1XSIA 3O6YX 1JQXA 2G95A 3GLCA 1XCWA 1XBYA 4AEOA 1MEWA 3W2LA 4UNLA 2E9BA 5H91A 4AWSA 1JJKA 1E3ZA 3L0GA 4UTJA 3NXFA 3KL5A 1SW0A 4QITA 1Q3NA 4JTGA 1EO5A 1FDZA 1FY6A 3JS3A 2GVLA 1Q45A 2CLOA 3ELFA 1QPNA 1JI2A 3QW3A 4WY0B 4RV8A 3L4XA 3W7DA 3GKFA 1O7DC 1EPXA 1KA9F 2ALDA 4PL2A 2ZDRA 1LM1A 3MYPA 1OF8A 3LCLA 2CLHA 2V30A 2DZUA 1HFBA 3TU9A 3GK0A 3CZKA 4P61A 1QHOA 1DJQA 3I65A 2OZ0A 4PA8A 1H63A 1GG1A 2CLKA 4XUGA 2VKZG 3HG4A 1EWEA 4A22A 4LT9A 2G3NA 4PCSA 2TPSA 3GXIA 2OSXA 1ICQA 2ZRVA 4GUFA 1TPDA 3LCIA 3TW7A 3HGJA 2VEKA 1H50A 4LS0A 3SSJA 3FOKA 1D9EA 3QPZA 3KWXA 5EY5A 3B0VC 3N9RA 4OJYA 4UUIA 4ZZ9A 1ODUA 1OX5A 4LQ1A 3HPXA 1HL2A 3WNOA 3VGFA 2HS8A 1ICPA 4CLMA 3OBKA 3TTYA 1L6YA 3S1XA 4Z0SA 3VNZA 4MZ1A 2BY1A 2WVVA 2G5WA 3R89A 4PSRA 1WBHA 4CQAA 3U2OA 1TV5A 5C54A 1I2OA 1OFBA 3VSVA 1AW1A 3S1VA 5D2YA 3M5YA 1UA3A 3G3MA 3SECA 1L0PA 1TRDA 3N14A 4LTSA 4N9EA 3W7LA 4RX0A 3DI0A 3HGSA 2A2IA 2V82A 1LRTA 3L4YA 1YDVA 1UJPA 3LRMA 2X1UA 5AYYA 1HL9A 3GNNA 3UEQA 4IMDA 4RKAA 5FEWA 1AQHA 5HWMA 4CNNA 3S2CA 4X0NA 5EPDA 1I2RA 3LV5A 2E77A 3TR2A 1F5ZA 1GJUA 4UR8A 1G67A 4U3CA 3B05A 3NA8A 1RR2A 1VC4A 4R33A 2EPHA 3E96A 1OB0A 2ZRYA 4IMGA 4PODA 3GR8A 5EMUA 1JXKA 4O8RA 1CXHA 2TSYA 2G96A 1P0KA 2NWRA 1H7RA 3WDIA 4N2YA 4O10A 1HVXA 2D0GA 1GCYA 3DX1A 2GQAA 2ZZ5A 1VYRA 2WNQA 1O4UA 4GJ1A 3NAVA 1GG0A 8TIMA 1SW3A 3MI2A 1KGUA 3IJ9A 4LC8A 2NT1A 5AHFA 1R47A 4EOUA 1NEYA 3I68A 3MP4A 3SJ3A 4WXZA 4GNJA 4KKXA 2I14A 3EJTA 3TMQA 1X6UA 3KOFA 3CZSA 2WVVB 1PIGA 1G4PA 4O1DA 1UUOA 3CZEA 1B4KA 4N6FA 2BX7A 3G1SA 4JEQA 1JVNA 3B0PA 4KWWA 1VYPX 2CLIA 2ISVA 4MYAA 3TKFA 1GVIA 2QCLA 1TPB1 2VFDA 2J9ZA 2ZZ6A 3PBUA 4XTIA 2D0HA 2ZRXA 3C8FA 3CT7A 4UFIA 5HUOA 3NQ7A 3P7YA 3F4NA 1LWHA 4K39A 4JX4A 3NEVA 4FLRA 1A5BA 2YX0A 1OF6A 3DFTA 4MVAA 3B8DA 1GYNA 2QEZA 3A47A 1GOXA 4NXSA 3UPWA 5HJLA 5E1QA 4NJHA 1KXTA 4AH7A 2V2HA 3NQ2A 4MPQA 4UCGA 4U2ZA 3DC0A 4FNPA 4W9TA 1SMAA 3N19B 2ZA2A 4UTWA 2FGZA 1ZALA 4NJKA 3FKRA 3GXTA 3IIPA 4K36A 1TIMA 1VZWA 1J0IA 4O16A 3N9SA 1WXJA 5E70A 1RQHA 4OHQA 1TYGA 3W22A 3BUQA 3OEXA 3M0ZA 4UFHA 5DN1A 1KWGA 3Q94A 1BG9A 1A47A 3GAYA 3F03K 1BVZA 1UH4A 4PEKA 1LZOA 3EXTA 2I9EA 2Y88A 4Y6GA 1ZAJA 4DPQA 5F1VA 1MW2A 4LNYA 3VGBA 3LLFA 4UFJA 1PV8A 5CSSA 1CIUA 1MWOA 3D51A 3E12A 1VCFA 5FF2A 3W73A 4Z0JA 2E5CA 4NJIA 4ZL1A 2Y2WA 5AC6A 3GZ3A 5AHIA 2R14A 4GUJA 5FEPA 4MFDA 1KXQA 3UZJA 4JDBA 5SWUA 3CHVA 4IWWA 3M47A 2TRSA 4ORMA 3L2LA 1BVNP 3DENA 4DO4A 3GXDA 1RV8A 3TQVA 3ABQA 4TMCA 3CGTA 4CKQA 4JY8A 3BCFA 2EKCA 3ZS4A 5F1UA 1X1ZA 3G3DA 1N55A 5TBOA 3TSMA 4FLOA 4E2OA 1K7EA 2H3DA 5KTLA 3O6DA 1A5CA 5FF4A 4O11A 1PHWA 3LHVA 1SSGA 3Q58A 1R46A 1Z48A 1PZ2A 1EA0A 3LDVA 1ME9A 2AQWA 1CPUA 1MVYA 4IJBA 2A21A 1TQWA 3LXAA 3T40A 1SZEA 2WNWA 1XCFA 1LBFA 1PIIA 3N2XA 2CZ5A 3NR0A 4WY0F 4JYEA 2WOQA 4GI6A 3MHUA 2X30A 4FXRA 1F7BA 4GUGA 1OX4B 2VFGA 4LW7A 4PCFA 4BWLA 3N2MA 1V3LA 4JGDA 1J4EA 4N02A 5LNSA 3EJUA 4QJ1A 2RFGA 2Y6ZA 2OYKA 1OT2A 5I3KA 3FEMA 2YZRA 3QC3A 1U5JA 2F2HA 2HS6A 1ZCOA 3W75A 1H7WA 4M6PA 2VFIA 3GDMA 1KM6A 1CXFA 4JFTA 4AMXA 1JGIA 3HG3A 3KHJA 5CPNA 3E02A 1CGUA 3KL3A 3TTSA 4NVTA 4JXCA 3DX3A 3WY4A 1FX6A 1TRIA 3E0IA 5HNRA 2RKXA 1OT1A 4N9BA 4LUIA 1ZS2A 2OT1A 4QISA 4U31A 2YFOA 3NZ1A 4ADTA 1FWWA 1PZ3A 2QDGA 1JCJA 3FS2A 3LCWA 4CVWA 3KLKA 1F73A 4U2YA 3LHUA 3LERA 3PB2A 2C16A 3PS7A 2BWGA 1JR1A 4CN6A 4IMFA 1G6CA 1TPC1 4N6EA 4BI7A 1KTBA 1O94A 1DOSA 4KFOA 3ZO9A 2A1YA 2Y89A 3EDKA 1JULA 2NXGA 2CZFA 1IIHA 2V3EA 1K02A 4UFKA 2E4TA 4GINA 4ATWA 3KVMA 4ZQNA 2IQTA 1G69A 4EF9A 1IV8A 3VGEA 1I4NA 2VT0A 1PCWA 3TUUA 2WO5A 2NX3A 3NQVA 4QAIA 5D02A 1UASA 4YCPA 4WJEA 1WZKA 3UG4A 3CZGA 2DZWA 2H8ZA 2YFNA 4OWGA 5AFDA 3T55A 3DHDA 2YOCA 3W7CA 1Y7VA 1XSJA 3K8KA 3NQAA 1MW0A 3JR2A 3L4TA 5EL1A 3B06A 4LWWA 3CEPA 2DZXA 3L9CA 3NL6A 1TPEA 3B4UA 4LS2A 4BI5A 3TFXA 1QX1A 5AHMA 2W6RA 4E0CA 4NZFA 3EJQA 4H6KA 3HMJG 1KV8A 2QCMA 3QW4B 5FF7A 2Q8ZA 2OW7A 3W3OA 4KWVA 2LLEA 2FH6A 2XWEA 3TAOA 5KZDA 4N4QA 1H5YA 5FEZA 4AWUA 3M5VA 1FCVA 4GI8A 2DU2A 4TVUA 3WK3A 2F61A 4CCEA 4CCCA 4AVFA 1A5AA 1DHKA 1UD4A 1JUBA 3G1HA 1T8XA 1QW8A 4AWTA 2DZVA 1TQVA 3G8EA 4MYXA 4X9SA 3W7OA 1MFUA 5EA9A 5A5WA 3THAA 4HNUA 1NF0A 1GJWA 1KM5A 3IV3A 3VMNA 2QKFA 4JTTA 3WNPA 5K4ZA 1KLZA 2V5LA 3QEZA 3GDTA 4X22A 3NQ8A 1ICSA 2HTMA 3C0JA 3UYCA 1JCMP 1EX5A 3LCFA 4LS1A 5DCBA 5F4SA 2F7QA 1OX6A 2FJKA 1IF2A 4IX2A 5HPOA 4PH6A 2X2IA 4X2RA 3W83A 2FYVA 3BLPX 3N34A 3BLBA 4RLIA 3TK7A 1RPXA 4O1BA 3BVWA 4ONVA 1TPH1 2PWGA 4CGTA 3DKLA 5DCDA 2XIBA 3DXIA 4DBEA 2QMJA 3VM5A 2ZTKA 3S6DA 2EHHA 3CB8A 2FFCA 4UMCA 1JUEA 4DBDA 1Z32X 1GWJA 1TV8A 2ZX9A 2BXVA 2BXYA 1S5VA 4FEZA 3PBWA 1JF5A 3YPIA 5LSMA 3L68A 1CX9A 1JCLA 3FAWA 2IGTA 5KINA 3N73A 1VCGA 4JD4A 3W7MA 3KRUA 1VCVA 3D50A 5K4XA 3LCGA 3P5ZA 3HOJA 2WSYA 4UTLA 4TX9A 3W1AA 3H53A 1BEUA 1KWKA 1R2SA 1KGWA 2Y70A 1B4EA 3BCDA 4YXGA 3I7SA 3W88A 1KFCA 3CIXA 1RP9A 2ZZ7A 1GTEA 1GVOA 4K38A 3W7GA 1TQSA 2H90A 1UH3A 5CLWA 4QSHA 1VFUA 2AMGA 3GAKA 2QDHA 4UR7A 5A6MA 1JFHA 2Y7DA 4HNVA 1HUVA 4UTHA 3WENA 3UY7A 3W86A 3TDFA 1I75A 4ADSA 4QNWA 1N8FA 3M6YA 5G4WA 3W23A 3QMSA 3RILA 3W1UA 1VB9A 2CWNA 1WZLA 1VLWA 3DX2A 4HNTA 4LPCA 3LV6A 4FX8A 6ALDA 4UIOA 5AYXA 3EKLA 3AXIA 3TMLA 2VXNA 2PRMA 1MEIA 4FF7A 5AHEA 4AMWA 1K8ZA 2OMAA 5MHBA 1CGXA 1BSIA 3EX3A 3W7KA 3QQ1A 2EO7A 3A4AA 1KM2A 3DFQA 1AL8A 2XIIA 2Z6IA 1G9HA 3UY8A 1FCBA 2BY3A 4MIMA 1H61A 1VFMA 3AO0A 1QPKA 4L4MA 5LGXA 1TJRA 2AAAA 3VGHA 3GYEA 3EWWA 5DXXA 4OU1A 3L5MA 1P1XA 3VM7A 1R2TA 4J3SA 4RJEA 1LOLA 2YXGA 3BLEA 1HTIA 3BSGA 3H54A 3W1TA 1UD8A 3G18A 5D38A 1KXVA 2VFHA 4AF0B 3EXSA 3IEBA 4WXYA 3BMVA 3M5ZA 3WY1A 4UXDA 5D33A 3K8LA 1WQ5A 4L4LA 3TSDA 5LKYA 2QR6A 2ZX7A 1E40A 4ZQOA 2WVUA 4HP5A 2FIQA 2PRLA 3C6CA 3EDJA 4X3ZA 3EX2A 4FNQA 2VNCA 3LHYA 1OX4A 1QAPA 3CU2A 2RDWA 1DTUA 3W1LA 4FLSA 4JCMA 4H3DA 2PURA 3EX6A 6TIMA 5LNUA 4KFPA 1I2QA 5LHFA 5F7UA 1SFLA 3WNLA 3H55A 1UCWA 3FIGA 4PSPA 2J27A 1CXLA 1KTNA 2CXGA 2RDUA 1KM0A 1BLIA 1TQUA 5J5DA 1SZNA 1ZAIA 3ABSA 3IK2A 2W0UA 3TCEA 3DX0A 3VNYA 3VMPA 1D3HA 1TPUA 4UNKA 3LI1A 5LHEA 1GPWA 5A2AA 1TV7A 2Z1BA 3NL2A 1R75A 3WFAA 4I9AA 1WZAA 4J3WA 5A2CA 4CNOA 3IVTA 2GVYA 5D30A 3KLLA 3BV4A 4WOQA 1LYXA 5D2WA 1JD9A 1HL8A 4JIQA 1NFBA 5FF3A 4LVBA 2FB3A 1KBBA 2Z2UA 4O4VA 1SFJA 4UTUA 2J9XA 3KX6A 1JF6A 4B9YA 3L4UA 4OBTA 3M7WA 3SFKA 1SPQA 1C9DA 3GXMA 3DBPA 3OVRA 5FI8A 1DEDA 3VX0A 1LROA 4U28A 5C2XA 1IXQA 3W7PA 3HGRA 1LWJA 2VOMA 2QUUA 2E6YA 4LVFA 1H62A 3NQMA 1FCUA 4O1CA 5HDRA 4BFAA 4U33A 1QWGA 2EQDA 4TMBA 1YDNA 3BAXA 1W5NA 3IVUA 3IGUA 3G1VA 3VGDA 3TIMA 4Z08A 4N4PA 2Q8LA 2NUYA 4UQEA 3C2VA 3DFSA 1F2JA 1X7FA 2DIEA 4PTNA 1XBXA 1KW1A 2GUYA 3NQDA 1BPLB 3R2GA 3T4CA 4NX5A 3L2IA 4IX0A 3W7NA 4A3UA 2ZXBA 3L4ZA 1N7KA 2C18A 5CPOA 2D73A 5H2ZA 4WD0A 2A7PA 2ZZ2A 3Q37A 3KEHA 3STEA 4S2BA 3S5YA 3IIXA 3ZSTA 2V3FA 3A23A 2DH2A 3TV8A 4JTLA 2HSAA 3QMRA 3BUBA 2J9YA 4J3TA 4JS3A 1CGTA 4JTSA 2V81A 2ATSA 4GC4A 3TJXA 3KXQA 3ZR5A 1OG0A 1PVNA 5CZ0A 1DVJA 1TMQA 3M44A 3W7JA 7TIMA 3L2MA 4M7SA 4GWEA 4LOCA 2ATMA 1LORA 3PF3A 1MXDA 2YKKA 3EX1A 4JFWA 1OYCA 2Y63A 1V5XA 2WC7A 5D2TA 3C52A 3S0CA 5C5YA 2ZCGA 4NJJA 5AB3A 1RQBA 1KV5A 3B04A 3WK1A 2QCNA 2WSPA 3VCRA 4NI3A 3NPWA 1KXHA 2WPGA 3RFAA 1BF2A 3SR7A 3UWYA 3HG5A 2YSWA 3UNDA 3BVTA 1RP8A 2NSXA 1OFDA 3BAJA 4ZQRA 3VMOA 2AGKA 5DO8A 1OK4A 2E1DA 4M19A 3MW7A 3WK2A 3DFPA 2A0NA 4I7VA 1V3MA 2H8XA 1LRNA 4FHAA 4FO4A 5AC8A 5C6MA 5BRQA 3BW4A 4Z1DA 1C8QA 2PE4A 3W7EA 1IXPA 3II1A 4JTKA 3BVXA 4FNUA 4DF1A 2WQPA 3CC1A 3RLVA 2P10A 1PL9A 1XH2A 5F2MA 1U30A 5FF0A 1ZNNA 3A22A 3PR2A 3S1WA 4KWUA 1GJPA 1BAGA 5F2IA 4O28A 1OFOA 2ZA3A 4IPIA 4C1KA 4HNNA 5K9DA 1QPOA 2E5BA 1TTQA 4LV4A 4H4IA 3P8IA 1TSIA 4RZ4A 4YCOA 5KZEA 1FWNA 2JKEA 2ZZ4A 4AMAA 2E68A 4LY8A 2QPSA 4GQRA 3CV5A 4EIVA 3BUIA 5HULA 2PWHA 3G0XA 2CLMA 3M16A 3CPUA 1C29A 1G1YA 3MJYA 4MY8A 1GVQA 2ISWA 2QJGA 2WCSA 3NQCA 3A9IA 5D09A 4JTUA 1SO5A 2WVSA 1T0OA 3DHUA 2F7OA 1SZFA 2ZZ1A 3Q2DA 3QYQA 3CM4A 2BTMA 5A6LA 5A8GA 2ISSA 4EVZA 3NL3A 3BH4A 4O19A 3GBEA 1ADOA 1B0IA 1YTKA 5DXYA 2C8NA 4BF9A 1PAMA 4WX2A 2F1AA 2WNZA 2NX1A 2GJNA 6TAAA 2E8ZA 3I7QA 4GKLA 1X1OA 3STFA 2XVGA 3ZR4A 2V0TA 5D03A 3UXDA 5I3IA 2WANA 4R7JA 5CZTA 2OJPA 4WQ6A 2ZX5A 1LBLA 2VEPA 4AHOA 2BY2A 3INPA 3G1AA 1QO2A 1TO3A 3EWUA 4GUIA 4XBKA 5F4XA 3QJAA 4S1FA 2C3ZA 2H3BA 2EAEA 3DHFA 1YYAA 1FWSA 1LLWA 5D37A 3FFSA 1VLIA 4YLWA 1CLVA 1UBSA 1JRCA 3GDKA 3W2MA 4XZ9A 2V2CA 2NT0A 1W3NA 3C56A 4GFSA 4MLRA 2VC6A 4ALDA 3LPOA 1LTDA 1G7VA 2HMCA 2YYTA 4EF8A 1XDLA 3OVQA 1J0JA 3BUPA 2A6LA 4N9CA 2GVGA 2PC4A 2GJLA 1ZAHA 3M07A 1QOQA 1TCDA 3HBLA 5A2BA 3WN6A 4Z1BA 2TYSA 3ZT5A 1CI1A 3IIVA 2WSKA 2VENA 4DPPA 1WOAA 1AVAA 4GO9A 2JGYA 4JYFA 2GQ8A 4WUIA 3ANYA 1XH0A 3NVTA 2YA2A 2RH9A 2CW6A 5G4EA 1FQ0A 1H1ZA 1TTIA 4BA0A 1NVMA 3KL0A 4W93A 2J24A 3LHWA 5HR7A 1A53A 3ZWSA 3N3MA 1KBIA 1YADA 1ZHAA 2FPYA 2EGZA 2EF9A 1F6KA 1SO3A 3RLUA 4RR4A 4PEEA 1W8SA 5IBXA 1OFAA 1VH7A 4NJGA 1JRBA 2QCFA 3DZ1A 4OT7A 2DZTA 3FJLA 3W1QA 2ZXDA 3AXHA 1XL9A 4BWLC 1VQTA 3OVPA 4NT0A 1DBTA 5J5RA 3BPWA 5DCEA 1XV8A 2E6DA 3G0SA 1CGVA 1W56A 3HPZA 1WAUA 3QQ0A 3CTLA 4HT3A 3C3NA 3W71A 4UZUA 4IXHA 3UZ5A 3VKJA 2H6RA 4UQBA 3VGGA 4J3VA 3HJEA 3ZR6A 3KE0A 3OG3A 1LOSA 7CGTA 2VEMA 1OFRA 4MZ8A 4H7VA 3EXRA 4O18A 7TAAA 4O53A 1UUMA 4DEFA 4Y9AA 4J28A 2B7PA 3BAIA 3AMLA 1EIXA 1DJNA 2VELA 3FA5A 3P5YA 3WELA 1MSSA 2ZYFA 3O16A 3BVVA 2ZWYA 1M6JA 4AEFA 3GIYA 1AL7A 3MUXA 2DZPA 4WLCA 3WEOA 2WVTA 4RCXA 4JICA 1IXNA 2Y85A 3WY3A 3UWVA 2GUUA 5LNVA 2WKJA 5EBUA 1Q4NX 3O63A 4FMVA 1H51A 5HINA 1NF7A 4DO6A 3MMTA 3DX4A 1AK5A 4ORIA 3VX1A 1ML1A 3TONA 5D05A 1W5QA 2ZRUA 1WV2A 1OFPA 3MWAA 2YGYA 1K8XA 1PS3A 3WNNA 4ML9A 4XTDA 4UMBA 4ADUA 5DELA 2ZE0A 1AMKA 2EJ1A 3TX9A 1QR7A 2V2DA 3LX9A 3LBMA 2ZICA 3HGOA 1JCXA 3KRZA 3SW6A 3B0UX 2C14A 3PM6A 2FH8A 1YTEA 4HOWA 5U7SA 4E2DA 1FXQA 4QM1A 1UKTA 4XQ6A 3UWQA 4EWND 3W7IA 4AB4A 3V1PA 4ZQCA 3PUEA 3QH2A 2F7RA 3PWAA 4HA1A 3L0KA 2WPBA 2Y62A 4UQAA 3DH7A 3P61A 4UFLA 4E38A 1R34A 1XCXA 4O1AA 1W5MA 3M43A 5IM51 3W1PA 1P5BA 2EEXA 2ZUSA 3NPUA 1OFQA 4DXVA 4LC6A 3ATYA 4J9JA 3C2EA 1HG3A 4UTKA 1JDCA 3CLMA 1YXDA 2BSLA 2QAPA 3QSTA 1EUAA 1H7OA 3G24A 4FX6M 1JUKA 3W7QA 1WA3A 4NNCA 3MBDA 3G1DA 2WCGA 3W2JA 4JFVA 1OHLA 1VR6A 2G97A 3ABRA 2FPVA 2DIJA 3QGVA 1MZHA 2B7OA 1ZJAA 4UZSA 2FDSA 1KGXA 3ZQ9A 4UQ9A 2A7RA 3FYOA 3G22A 3P82A 3S5ZA 1XH1A 1KM4A 3UPBA 2Q3RA 5AC7A 2QF7A 1F76A 3VI2A 1P4CA 2QCGA 2NLIA 4KFNA 2D0FA 5E0KA 3W7RA 1K8YA 3NYZA 3G0UA 1VJSA 3LM7A 5LGZA 3C2FA 1YXYA 5DY2A 4MOZA 5FEXA 3TH6A 1CXIA 1KTCA 1VYSX 3HG2A 1QNVA 3S42A 3USBA 3VSUA 3A6OA 2Z6JA 4JL2A 1I2NA 4JDYA 4NZJA 1SO6A 3TQ0A 3GX9A 1HO4A 4BZYA 3D52A 3P67A 4OQVA 4HPJA 1G5AA 3ZSSA 4IMEA 4UQCA 3BLIA 1PE1A 2CLFA 4N9DA 1QI5A 3DAQA 3EKZA 3M5XA 3TE9A 1VRDA 3O07A 4QQ3A 2NUXA 4NNBA 5TQLA 3VE7A 3O6CA 2WSRA 1W9XA 3T78A 1WDWA 1UD6A 1WOBA 4IGHA 3D4YA 4B5NA 3BG3A 4FXSA 2BLEA 5CGTA 2CHNA 4TR9A 1WE5A 5E93A 1TPFA 2EAWA 3MP5A 3LPPA 2GQ9A 3FYPA 4PCTA 1XI3A 3MBFA 2VR5A 1SQ7A 1KLYA 3IGSA 4FNTA 1JQVA 3U8GA 1O5XA 5DBUA 3HIJA 3W38A 3UXAA 4QAWA 4DQWA 4JTFA 1GVSA 1U83A 4P2VA 3T7VA 3W74A 3MYOA 2ZIDA 2PWDA 2V5BA 4OV9A 3A5FA 1W3IA 3E49A 2YIHA 2Z1KA 4JCLA 3BC9A 4JFSA 1X8FA 1W5PA 2ZUUA 1G4TA 5DFAA 2JKAA 4LVDA 4ZMGA 1MEHA 1VHNA 1LBMA 1DHPA 2NZLA 4WY0A 5TIMA 3W2UA 2QJIA 1WO2A 3OHIA 4O52A 3BG9A 1QO5A 1FCQA 3D4ZA 1FUYA 3MI6A 1XC4A 3PSWA 4OV4A 3SI9A 3W1RA 3O06A 4JNMA 4YWIA 3DFNA 2X16A 3BSHA 2FB2A 1J0HA 3GB6A 1M7PA 3ZOAA 1EUNA 2R94A 2C13A 3A24A 3PUOA 4GE8A 5CZSA 5TD4A 2JBMA 3W85A 1UD5A 8CGTA 3EJRA 3CZLA 3W70A 1SR9A 3QFEA 1LOQA
chains in the Genus database with same CATH superfamily
4PBVC 5MERB 4HKJA 2Z8RA 4TSAL 2XTLA 2W59A 4N9OB 4XNUH 2J7GA 1YNTA 3SCMA 2NV1A 3STPA 3GO1H 2B7QA 1M42A 1JDDA 4JQIL 4R7OA 1KIUB 1XIBA 1HH9B 3KXFD 4OLYH 2ITDA 1IGJA 3GTNA 5LAPA 4L6OA 1A0EA 3EYSL 4J3ZA 5G55A 3AIEA 4YHYC 1QSEE 1ZA3B 4W1TA 5IT2H 2CXKA 4LLVA 4XMTA 1TTUA 2YPIA 1FIGH 3PJLA 5C0CE 5LCVH 1W1ZA 2HFGH 3QUMB 1IBYA 2P5WA 1HKKA 3IAGC 3JZYA 1HL4A 1KBWA 4NQSA 2VDMH 4RISH 4V1YA 1E0XA 1XLGA 4NZCA 2WXIA 5FGCB 2MKLC 1S5WA 4PUMA 5I6KA 3WOVA 1G4EA 1IZJA 4WGHA 3HFMH 5DZNA 5A2LH 1H5VA 4IG2A 3N85H 5CIPB 1SDYA 3R25A 1Z69A 4MUZA 1MXSA 1J1OL 1BXXA 3II3A 4HOXA 3UTSA 1UD2A 3BT0A 4WV1C 3S3DB 1S2UA 3ZTJH 4KRNA 1AW2A 1L9PA 1EEQA 1OL0A 2OULB 2Y36H 3PV6A 5DRZB 3ITCA 2ESVD 3QTPA 1XL6A 1R19A 2J8OA 2ZNWA 4OFCA 4KQ3L 4PMDA 2CBOA 1QZ1A 5DXWA 2OXNA 5J6SA 3EJSA 1RPKA 3O3UN 1IBDA 5DC4B 4IXXA 1UKSA 2N0KA 4IIDA 4MVBC 1HU8A 2L7EA 3GXFA 1XCQA 3K30A 4MVBD 2ZQ0A 1SNRA 1KCLA 1H1YA 2Z0UA 5FFOA 4LRIC 4HYWA 3IEAA 5I8CA 1JRHH 2ICWI 2PXYC 1KCSH 1Y6NR 2I85A 2F7PA 4JY6A 4QJ3B 5K39A 4H2CA 4AHPA 4KROB 4HBCH 3QPKA 5FFLA 4O13A 3WJJA 3MJ7A 1CJYA 2PLKA 5H4ZA 3PWPD 2XVKA 1MPAL 1SJVA 1R3VA 1ZVYA 4OJFL 4GBDA 3GBML 5EUOE 3STBA 4C58B 3V4UH 3VFWB 4Z7QB 5E1AA 1UKOA 2VWSA 4PREB 4X7TA 2NYYD 3CV1A 4P06A 3FF8A 2NCEA 3NABL 4A6GA 1XUUA 3TBWA 3B9DA 3VXRA 3BW3A 4P7QA 3QIBD 4FTVE 1Y1UA 1IGML 2QZ5A 1ZBWA 1FNGA 3SYAA 1J18A 3FQUB 3NJKA 4NDMA 3RDTA 5M95B 3M1ZA 3S35L 4NO5B 1H7PA 5F1NA 4L5ZA 4B7IA 5DFWH 5TFSL 4AZ8B 4QRNA 4R90H 5K9KA 3GKAA 1QVOA 1W31A 4U6HA 3FUMA 3WL9A 3BE7A 5HHVH 4IRJD 1W54A 4PGDA 1H3XA 1MWAB 4ZYKA 5D02A 3C5JB 1SM9A 3CLEH 2F5AH 4XKYA 5AVHA 3F58H 4I5RA 3SCTA 3W01A 3UBXI 2J8UA 4FKHA 2LW3A 2HFEB 3MJ9A 1FVCB 2OR7A 3KVKA 4NILA 3N2TA 3QDHA 2CM5A 2F54A 1ICTA 3V4PH 4WDTA 4WTQA 4ZYKB 3QEQE 4UBDC 1OK6A 3G1XA 3BSZL 4Y4HD 4JRWA 1UPPA 1PJ9A 4R9HA 1EKOA 1PF3A 3FU3A 4PJIF 1KPRB 1NBYA 1R33A 4FKKA 4KCWA 4HSNA 4P59L 2Y5EA 5F7DB 2Y06H 1UWQA 2UY4A 2NUPA 5FA3A 2WB1A 1ES0A 1E1EA 3SKJH 1IBGH 2VR9A 3PZNA 1F13A 3RL1A 5E6YA 1DWGM 2CZDA 2PW1B 1WWAX 1BXCA 5IMMB 3MNWA 1NGZB 5IJVB 3AU2A 3AXXA 4Q4PA 5KYWB 1GOQA 2BW5A 2IADB 1N82A 4E4FA 3CVBA 1UB3A 3GHSA 4MJZA 2BNQD 5H37G 1AIFB 3JV4A 4HOZA 3ANUA 5D2LB 4UNVA 1VJIA 4R5EA 3PTKA 3F5LA 1NARA 1VFOA 4MWFA 3U2EA 5C07A 3P2DA 1I8IB 2AGTA 4OZFA 1QEWB 2VXUH 4XVOA 2HFFA 4F9LA 3H9HA 5C08A 4YXHH 1U58A 2E28A 3CT2A 1SN0A 5AOUA 4X7EC 2X42A 3H2AA 3D8MA 1HDMB 3QXVA 4JDVA 2WLJA 2YSSA 4N7QA 4OJCA 2WLIA 4BFEA 1AZ1A 3MBEA 3R19A 3RU8X 3SCVA 3ABKB 2PR9A 1XD0A 4B2DA 3IGAA 5K39B 2PCQA 1FNSH 4YLQT 2F74A 3ILDA 4GY7A 2DYPB 5HXMA 4KZEH 4HHMA 4O57A 2GLKA 1B2YA 3RG6A 2CBJA 3C3UA 2CIKA 4MKNA 1KBVA 1SF5A 1XW8A 3EYSH 3GMOB 1J5TA 4UM8A 1N8OE 3AG4B 2G75B 1G7PA 4IOIB 5LHDA 2X1TA 4NLAA 2C7FA 1SLVA 1CFVL 2YSSB 1IQWL 5HHPB 1OHQA 5HJ3B 5C3LD 3WTWA 5IF0B 2Y2YA 2NY4D 4HV8B 2B1HL 3S3CB 1VP5A 3VE9A 5F2LA 1A6PA 3WJMB 3T2QA 1VIWA 4Z1YA 5L2KD 5F3BA 4LASL 1R5WB 3UTZB 5D2LA 1MI5B 1ADQH 5EA0L 3Q67A 4PRNB 3QF0A 2Y7QB 4S2CA 4BHYA 2ZYIA 4OI8A 4I5BA 1HS6A 1D5MA 1YN6B 4OZIB 3GNDA 3L2NA 1A5FH 2QJDA 5I1LB 5FO7B 4LGRB 1X38A 1XP3A 1ME7A 3D85D 1FNFA 5MKGA 3WXWH 4R8WL 5IIEA 2V9DA 1A4JB 1TQCC 3GSRB 3CFTA 4HKBB 4GG6F 3MFFB 3WD2A 5I73B 1YNLH 4OZGF 3B9EA 5SX4I 4AG0A 3ZZ1A 4LP4A 4C1NB 2R15A 2VZUA 4JZJB 1DXFA 2HJPA 5CZ0A 2X9YA 2XINA 3QPQD 1EMTH 1VACA 5MENE 3AJXA 2ARJB 2ALAA 3C4UA 4LRTA 5F44A 3TC7A 4GQGA 3QFGA 1OABA 3EWCA 4WKAA 3E1ZA 4L3EE 4PFEA 1MFCH 1HP4A 1UENA 4JG1H 1AH4A 3TZNA 4B5TA 1F5WA 3QULA 2MOGA 1Q38A 3NESA 1O7SA 2IPUK 2VZVA 2P49B 5DEGA 1SO4A 3VIPA 4G5ZH 1A4AA 2EEAA 4XO7A 2R24A 3P62A 5ID0B 5FIPA 2GEEA 3NURA 4MD4A 3QLDA 5FYLH 1A6UH 5I16A 4MDIA 3FSUA 3DX7A 4GS7C 2VITB 1IGSA 4POZC 3W07A 4H6QA 2ZADA 3IRDA 1TREA 4I9WD 1WXYA 4QWWD 3K6DA 4KTDH 1IGYB 5TE7H 5CG7A 2QHRL 4IRZL 5FO9B 4KPHH 5EMJA 1FN4A 4KRZA 3DSNB 2VSKB 3X1GA 1JGEA 2DQCH 2BODX 2O4QA 3QR3A 4JX6A 3ZVIA 3IFPA 4GKZA 3EFOB 2BGNE 1R85A 3ZE0F 1DJHA 3DDFA 3W24A 1IILE 3T6QC 3F2BA 1FNEA 4JCWA 1ME8A 1V51A 4JRYD 5FWRA 3AWOA 3RR4A 2BIQA 2P0OA 2YBRB 4LHJB 3BO9A 1V6UA 1FP9A 1MHPH 3L21A 4LEFA 2ZC1A 3GMQB 2F8QA 1P1ZA 3R94A 1IC5H 3OP2A 4L3EB 2VISB 3LZ5A 3QUYA 3UA3A 2G0LA 2QVMA 3KVPA 5EEYA 2HT3C 2PXYA 3H42L 1A6ZB 5D8ZA 4IOFD 3RTLA 1ENUA 4TQIA 4US6A 1Q2RA 5B7FA 4U3AA 4ZO6A 3INUH 5GS0L 2JSFA 1E4MM 1I8JA 4R26L 3FONA 4U1MB 1PNDA 3CH9A 4NUGH 1WFMA 3RDKA 3ITLA 1SJMA 5D7JC 4IUOA 1KM1A 5M3WA 4P49A 4O02A 4YHLH 1OCWL 2ADAA 1UM6H 2WK2A 3N9GH 2O93L 4HT1H 4ZOCA 1BEYH 1X5GA 1CDHA 3P0YH 1QHPA 5JDSA 5FF6A 2YB1A 3BK0A 3QFWA 2DW5A 3SUVA 4A39A 3X11B 2J8UF 3STLA 1N6QH 1QI4A 3FRPB 3PL6C 5GZOC 2VL5A 4ZB0A 3TLRA 4OZHA 3REWB 4QRBA 1K9DA 3FKKA 1TSRA 2WLLB 4MTVA 3LQAL 4RL3A 4ROQA 3X3FH 5G1TA 4WUUD 2QUVA 4WO4B 4Y5XC 5GRYA 3LNEA 4WJKB 2PYEE 2EYSA 4ODSH 2OSWA 2UYLB 3KXFA 3QORA 4Z76B 5IMLA 3RWDA 4BQ6A 3WS3A 3FCSA 4A7UA 2WNNA 2YHGA 4M8QB 4GQ9H 2Y1HA 5C9XA 4JFUA 1XIEA 4WRLA 4N0YH 4PJFF 3GBLA 5CPMA 5SWSA 2MSPA 1GONA 4TOYH 4Z7OF 3IXTA 5F7NC 5K9XA 5SWZE 3T9WA 3X13A 4DJFD 1XGRA 1G7QA 3LEVL 5IQMA 3PZGA 3EH3B 1PG7L 3S1UA 3W1XA 4AZCA 3LHTA 3ZLQC 2QZRA 4JPKH 2OZTA 5KVFL 2PFHA 3V0VA 1HK6A 1T96A 2XVLA 3IBEA 2Y0FA 2BVDA 4KJQD 1EC7A 4LUJA 3NAAH 5HVGB 4X5RA 1F4WL 3FSZA 3WNKA 1FBAA 1FL3A 3NEEA 3WFCH 4MA3A 1G4SA 3CQHA 3F2CA 3HQNA 4F7TB 5TQ2L 3TN0D 3HF3A 4FOJA 1GZQA 3QEGL 5C70A 3TNMB 2ZYSA 4Z0XB 2HPMA 2X4QA 3ZIZA 5EOCH 5FYLE 4Q14A 3WTTA 1CQYA 2Z34A 4BDVA 2C3WA 5C7ZA 4K71C 3WY2A 1IEIA 2E5EA 4XBEL 1MFBH 3BUYB 4X8GA 5HJYA 2XT1B 4HOMA 4FI4A 1GIGL 3MV7B 1AGCA 2H2PC 3QZMA 5L4MA 1B3YA 4RZKA 3JUGA 4NF7A 1NCCL 1W72H 2BNUB 2ACSA 4UT6H 2AK4A 3N4FA 3I9GL 1GY1A 2XN2A 4GJTB 4XMWA 1MNUH 5D4HA 3UG5A 4ZMYA 4F27A 2ZE3A 4PHZA 2ZWZA 4HC1H 1O5DT 1OWQA 1DL7L 2X7VA 4U10A 3ARBA 3L7FB 1KCUL 1YX1A 3NO3A 2E27H 4BK4A 3KNBB 4GG9A 4CEUC 2FBJH 2IPTL 2TMDA 1INQA 4MKVA 2Y4SA 1JG9A 3S0PA 3D18B 2JQZA 5L9DL 3X1NA 3CIWA 5CHNA 3KPRD 5JIWA 2EVFA 4DERA 5K1NA 1BKHA 4MNKA 2GDQA 2NW3B 5F2GA 4JPGA 2OTWB 4XAPA 3VNMA 5IESL 2IPKB 4NKDA 4MD5B 2FT8A 5BRZA 1US3A 3GUGA 3QY6A 3H56A 5EUOF 3QEQD 1BQRA 3WKMH 5D04C 1PSCA 4O2EB 4GP4B 5A40E 1R17A 2BHYA 1V08A 4FTVB 1V3JA 2F38A 1BZ8A 1NJJA 1R30A 3R8GA 4AUBA 4PU2A 1TJPA 4FQJH 2XRAH 5D7JA 1Z44A 3TNOA 5E2JA 3C61A 3FSAA 1G7IB 2P8CA 2ZP0T 4AZIA 3L81A 2DWDB 1DIEA 1FFOB 3QZPA 5F6HJ 1YNKL 3PNZA 1C1EH 4LSVH 1NOLA 3DN5A 4YSSA 4M4RA 4Q8OA 1YNKH 2Y1VA 3MU3A 4KO6A 2CO6B 3ARSA 3DETC 3KHQA 5ECGA 4F37K 1SJBA 4U5IA 4HHPA 5H6HA 2Z65C 3IJEB 5ICZB 4B53A 3SPJA 1SQ2N 1A6WL 1ZENA 4Y1AB 2F2KA 4DJFC 3B9KD 3DESA 2QNEA 2OP4L 5GNXA 2RMNA 1YNQA 3UWWA 2X1IA 4GXVH 1TELA 3O05A 1ZQ5A 2CIIA 1BVKB 4K7PL 4B92A 2YARA 4P5TD 4L1SA 3QG6A 1QFHA 2HWZL 1XX1A 2BPBA 3NO1A 3WMSA 5GVJA 3GMMB 3G9VA 3L4VA 4S3CA 4M03A 3TNBA 3OHXC 2X2JA 3C12A 3WUGA 2AXJA 3T3MB 4WW1B 4AYDC 3DWTA 1G9NC 2H3NA 3FTUA 3GMNB 2NZIA 4B9ZA 3ARVA 3D4CA 4EDXB 1TKKA 4PJGA 2R8WA 3EWYA 4LSRL 3VKAA 1KCWA 1OCRB 1NOFA 2WWKT 1EOKA 3SJVD 5K5YA 3DV4B 1LO4H 1U8CB 1NCOA 3ZBMA 1I2PA 1TJ2A 1SDAB 2TRYA 3JVFC 3R1GH 3PJSA 2YO3A 4OM0H 5EWIL 2QKSA 4WV1A 5CCKL 3FTXA 5DURB 3CVIL 3WAKA 4CMHC 2VDPL 2AV7B 3NCMA 4KXZH 4N0FA 4NQEB 4V2BA 2KX9A 2QPXA 4M6NL 1YEJL 5EU4A 4FNSA 3UYRL 1IIGA 2DQTH 1W1PA 2CXEA 1I4FA 1TTJA 4IMCA 3DU0A 1FL5A 4HIBA 3K13A 4HN4A 3TAKA 4BFBD 4S1RH 4NNYA 1NGPL 1TKWA 2V68A 4GLEA 4EUPA 4AD3A 2VZSA 3RGVD 4PJGF 1PZ5B 4G6AD 4A1RA 4DPBX 3I3EA 1E15A 1XO8A 4MMXB 1K6QL 1XCTB 1UT1A 3PQYA 4GQQA 1GKOA 2ITFA 4P2OB 4PS8A 1KM3A 1YDOA 4OCXL 1FGVH 1KCKA 3BQUB 2N3JA 3MODL 3LGGA 4ZO9A 1GQJA 5FJUA 4F7EB 3NZRA 1WP6A 2VUKA 2VDKL 4GRMB 4NJAL 1GVEA 1M1SA 4P3CL 2VQUA 5KSUA 3NA9L 3CD4A 1PLBA 3AM8C 5C3IA 4X9YA 2D24A 4M80A 1EZVY 3M1OA 2HRPL 3FQ2A 3MLUL 4ZSOE 3NO5A 1FWTA 3JWOC 5C2UB 1E6OH 43CAB 3BJTA 1UWAA 3KJ6L 4JR5A 2WZIA 4NUWA 3BLFA 4H8VA 3GXPA 1YY9C 3O4LA 1EGJL 4NQTA 4Y96A 3VCCA 1I45A 2UXGA 2WMKA 2OL3A 3T65A 3B4YA 3V0UA 3W39B 4F2TA 5BUGA 5AVUB 2GK0B 3GVRA 5D2XA 4DJED 2W60A 1ZIBA 4XPFL 1N8IA 1O6SB 1TEYA 3B8IA 2J6EL 3ARWA 3P74A 4R3SA 4YSPA 4NAFA 3UQNA 1KN4L 4UDUA 1F58H 4OZ4A 1HJCA 4AG4H 4KEZA 4WZHA 3S1GA 1T7YA 2VDKB 3SPVB 2ZCZA 4FI8A 5IB3B 2GTWA 3UIZA 3CUPA 1ACZA 2W95A 1ZUAX 2Y07H 2P53A 3NZUA 3RFZA 2O6CA 3I3BA 2EDLA 4BFIA 2VLJD 2XQYG 3V4VL 2ZG1A 1G1KA 4RWHA 1Q6CA 2NQ9A 1J9CT 4B5ZA 3MNMA 4FL4C 4N0CD 2I07B 3MRQB 2P24B 4PJHE 1BJ1H 5CEYA 2OVLA 1QMLA 3GJEA 4YTRA 4AY8A 1L8PA 3VXTA 3IJHB 2KYIA 4LBSA 4L8BB 1F4XH 1JZFA 5DZLA 1RAKA 2NNXA 4JG9A 4RFNB 4PJFB 3M0KA 2PLMA 4D2JA 3LCYA 4GX9A 3DURA 3S5OA 4AJYV 5TQ0H 1XB3A 3CVHA 1GZHA 5KYYA 4GW4B 3REQB 4YQXL 1S7TB 1GORA 1KGCD 3R8BB 3VABA 2YKLL 4L9LC 5C0BB 3KWVA 4UOZA 1HT6A 3EEZA 4RIRB 3NOYA 3NWRA 3NGJA 2DYRB 4ETQA 1OAKL 4YMZA 1UXWB 1EL3A 2H9GA 1JPTL 5I1KL 3SGUA 5KSAD 1V55B 4L29B 4ZBJA 3FO9A 3EYUL 5JDJA 1Q66A 3CQJA 4AEHH 3P11H 2FNBA 4NZ1A 2OMVA 2A9MH 2FQFA 4A38A 3P2VA 4Z7VE 5GGTA 5I28A 4XP1L 2QQKL 3W6YA 1Q6RA 5CFAA 6A3HA 3UZVB 1BYNA 1A6AA 4LF2A 4JFYB 4QNEA 1EFXB 3IF1A 3UWUA 4PJ8B 2HLFD 4XB8A 1JI1A 1FGVL 1SXCA 4EQ3A 4FA6A 3N1AA 3TJIA 1JERA 4NSKA 4X4XB 1WX0A 4CQBA 3WFZA 4LSTL 2DJUA 2FLBT 3IYLW 3FSOA 4JZOA 4R97B 5TE6L 2R2HB 5L2KA 3FOLA 2J25A 4J1UA 4N5EC 3ZKSD 2CWXA 3RGBA 3QUZD 5BXTA 3O4OC 4FULA 3TQKA 3CUZA 2V17L 3M8OH 4F7CA 1DL3A 1YECH 2I27N 3C8KA 1QA9A 3UPRB 1TZHA 4GAYB 2F1BA 4Z7IA 3FJ6A 1ZXQA 4N86A 5DMMA 1RERA 5EOCJ 1CLCA 4O17A 6CGTA 1HKJA 3ZTEA 3C6LD 5HYJD 2L4OA 1EMTL 1SU5A 4FALA 5C0GB 3EPNA 2ZX6A 5EOQL 5CCKH 1P6FA 4CC4A 5D6DA 1HKFA 3EDFA 3FT2B 4XCEA 1L6FA 3WQDA 4XO8A 2EABA 4D9LH 1GYAA 4KCUA 3Q9PA 3B3IA 2XTJB 2AC0A 1DEEA 1M05A 4G80A 4Q0XH 3VD1A 3WNMA 4IPNB 4H7ZA 1QUNA 2AJ3A 4Z7OB 1S1PA 4ENEC 1UCBL 3HMWL 4WO4D 2CSPA 3PWIA 1ZVHA 3SOBH 3X14B 2GSHA 3KPQA 2FQIA 2QVKA 1JNLH 5LCVA 5K59F 4OGXL 4QHUA 2YEZA 1BFOB 3HIZA 4P99A 3VE0B 1OG6A 4JFDB 4JQXC 5IHUL 5KEZA 4JTIA 4AC1X 2ALWA 1E50A 4KO7A 1FFPA 4MXVE 3K2MC 5GRJH 3X3GL 2XWBB 3PWVB 3F7YA 4WI4A 2ZKXA 5IK3B 4Z3JA 2ODIA 3K0WA 1JZ7A 2NUTB 3Q8CA 2XTJD 2QT6A 1DYZA 1CLYH 3ARRA 3N44F 4AIOA 1U1JA 3IFOA 1W16A 4ENLA 4NGHL 4G1EB 2OX1A 3UCDA 4YBQD 4OUOA 1FWJC 4ZVJA 5BMXA 1G9MC 3HC4L 4FYRA 2XZ9A 4MTMA 3U82B 4GBUA 2Z93A 5IP4A 2YRZA 2YCIX 3HMCA 2VDQH 3SD2A 1TTFA 2X0UA 4Y2DD 4CMMB 1I8KB 5KSBA 1A3QA 1E4IA 3OW1A 4IOTA 4HS8L 4P2RB 1DN0B 3IDJB 4H8UA 3D85B 2QT3A 4E8DA 1D9KA 2YUVA 2ISDA 4QGCA 3E9AA 5D9PA 1ZSXA 1HKLL 2CLLA 5AHLA 4O14A 4NNPL 4A68A 1L0YA 2H8PA 5CP7B 5E95B 5GRVK 4OIAA 4F33B 1PIFA 1HQRA 4BD4A 2R2BB 1JGDA 3LCXA 1KLGA 4L5FE 5A16A 5EF3A 2D03L 4K5PA 4WENB 1XDMA 3S5NA 1E5YA 4LE8A 1TQCB 1JS4A 1A4KA 2VIRA 4LGSB 4U7SA 4AL8H 4C56E 5BZDB 1D6EA 1JL8A 2CK0H 3QHZL 5H37H 3BVJA 3GTFA 2YW4A 4B4HA 1S3KH 2B14A 3CFBB 4N8VG 4TQEH 3LZPA 3SDCD 4KESA 4D6CA 2D3NA 5LXEA 3KPSE 2R4RH 1NA8A 3QQ4B 5EUOB 4JHAH 5EUKA 1XYMA 3NM1A 3MRHB 4YIWA 3P73A 1NIFA 3PBVA 4UT6L 4LARH 3R06A 1XXFC 2NR6C 1P4UA 2QCCA 4JTHA 1NGQL 3C2SA 3CWGA 1GIGH 4ONFL 3DX9A 4OE7A 7XIMA 4P46B 4ELKA 1B4TA 3PC0A 4HWBH 4MJIA 4PD4J 2F7IA 2X7LB 2WZPD 3PBYA 5C55A 3ZE2E 5KYXB 1OPGL 1Q6LA 4NENA 4LB4A 2PD9A 1PG7X 4WI7A 3OLEA 1RURL 2GOUA 4NN5B 4FXKC 4Y5XA 2MCAA 3IJYA 5DJ6B 5D6CB 1M2VA 3NACH 5EF0A 2L5HA 3WF3A 1YJDL 1RZFH 3MTWA 3Q6GL 1L5GB 1VPYA 3GG7A 1CK0L 3FQXB 2K0RA 3I6GB 4QHKJ 2Z91B 3E2HB 2FT6A 1U4EA 2WMJA 4L37A 4XNYH 4UTAH 1SHXA 4QT5A 2HA1A 4TVSa 1DJWA 1Q4WA 4LFHG 1INDH 4UUJB 3I6EA 4X98B 1QKZL 1XD1A 3EYVA 3GNPA 3D3VD 1M4KA 4LEOA 3WDQA 2ENPA 3VNIA 3BZEA 3S4SA 1AFSA 3QSRA 5CSGA 1MQRA 2LU3A 4HLJA 1W80A 2CLZB 3ILQC 3NG5A 4K94L 3VAEA 4Z3TA 3T3ME 2XFXA 3ALPA 4J7RA 2Z3FA 2A1WH 4AMKH 3LNIA 4JKNA 3RCYA 5EC2B 3ITGA 2GTZA 2VN6A 2XQBL 3PG9A 4S1DC 1OAQH 1JDAA 1S39A 2J5LB 2M1KA 3DUSB 1KBPA 4YR6A 3CO8A 3OIXA 1S5IH 2CBMA 4WUKL 1LE9B 4BRVA 1JWSB 1CYWA 4U3SB 4GZEA 4MNMA 4QIUA 3VYLA 1KLUB 2IWFA 4AK2A 4UMSA 2VL4A 4NUPA 3ROLB 3QR2A 1PCKA 3V4PA 1UR2A 3DKHA 2PETA 3IAQA 1HHJB 4G8FB 4M9PA 1BD0A 4R27A 4QX4A 3TZFA 3BEWB 2BBFA 3VRLF 3SO7A 1BGXH 1KENL 3GLCA 3RIFK 1XCWA 3PGFL 2YL5A 4MAVA 4GW1A 4WI9A 2E25A 3HHSA 3QDGB 1A7OH 3CHRA 1CUOA 4ZXBA 1DBAL 2EYTA 3HN3A 3M6DA 4HETA 4LPXA 3UAJD 1M3UA 1J1OH 4PVMA 4R7WA 4EQ2A 1JJKA 4Q8VA 1E3ZA 3L0GA 4IIHA 3T07A 1D9KC 1E5AA 3RIFF 3WO4C 5BVJB 2B5IB 4JTGA 3RLHA 1EO5A 5I6OA 1FY6A 2E9LA 1FH7A 3MLVL 1ZBVA 5I15H 4TXEA 4AMCA 3L12A 4WHTA 1HQ4B 3VCLA 3ELFA 2BP8A 4LLQA 5CKAA 1Z5YD 5EOCL 3WMLA 4RV8A 1ZJHA 3UZXA 4BK8A 4JBSA 3GKFA 4OFVA 1O7DC 3BWAB 2OJZH 2BNQB 4JN1H 5FCUH 3ROOA 5EEVA 4KEMA 1KA9F 4PL2A 2VLJE 3NVQA 4W4OC 4W68A 3MYPA 5GGVH 1OF8A 1LT7A 1XMWA 1C8XA 3LCLA 4EAEA 1V6XA 2HLAA 1E73M 2E3VA 3EA3A 3V1HA 3TU9A 1SJHB 2X2YA 5CZXC 5AOIA 4P61A 1DJQA 2CK2A 3ARDD 3QWRA 5IRPA 2CE6A 4P46D 2IW0A 1WKDA 3O3BA 3UJJL 1B90A 3I65A 3U1SH 2OZ0A 4PA8A 2WQ8A 4OW6A 4DQOH 2CLKA 2VKZG 3WNJA 3PHQA 4F5CA 2W27A 3O81A 4TOYL 5TAOA 5HHOB 4Z17A 1RZ7L 2QQNH 5DJDA 2F53B 1MQKH 2TPSA 2DT3A 1BM3L 2J2ZB 3CZ8A 1QG3A 3LNPA 3KLHD 3ZGIA 4XCYA 4HKXB 4IHCA 4FE9A 4MZ2A 3SSGA 1D9EA 4F24A 3QPZA 1BZOA 3EMCA 3TT1L 3SYCA 4LHUG 2IWKA 3N9RA 4DKEL 1URLA 2X87A 1ZRQA 4S0HA 4XPHH 1O12A 3RPKA 4LQ1A 2VHLA 1HL2A 4PLKD 4DVRH 2AKZA 3IDMA 2HS8A 5ANME 2OL3L 3K5RA 3O6MH 3L5XH 3CZFA 5EC2A 3GRIA 3IB4A 4CLMA 1J9YA 4Z0SA 2NUTA 1AP2B 2UVFA 1G6VK 1AGFA 5JMUA 1IKFL 2YZ8A 2WVVA 3O2DH 4PWFA 1CICA 2G5WA 4DWSB 3CU1A 2J7BA 3URBA 4JB9H 4XWGH 3BZEB 3WN5B 3O6KL 3U2OA 5C0FA 2RFXB 3V4VH 5H8UA 4KHTH 4TMPA 1UVQB 3TN4A 3S1VA 2K6YA 1BFOA 3T2NL 2LLNA 5D2YA 3QXBA 4JFHE 3M5YA 4MFHA 1FDLH 4AJ0A 1O6IA 1TRDA 1KG0A 2WAQA 3MLTA 4LTSA 1U8PB 2PPEA 3G08A 4RX0A 2X4NA 3CG8A 1AGEB 3AM8A 2BX5A 3L1EA 1F11A 4GRLB 4YDKH 1RUAL 1H6EA 4M61B 4PBDA 1IEBB 2MNWA 2PLTA 4QUOA 4X6FA 1YDVA 4LHUB 4IMFA 4RFEB 4X4KA 3VIGA 3UEQA 3V5KB 5LA0A 3GWQA 4NENB 3N29A 1AD4A 3EUDA 4CSPA 1TJXA 4P9HL 4R85A 1AQHA 4CNNA 3WYZA 1Y6KR 3I75B 4QRPD 2CBQA 3LS5H 5LVEA 3KMDA 4LU5L 4DKFL 1EO8H 4B5WA 1Q0YH 2EDYA 2Z1PA 5B1CA 1F5ZA 4LIQE 2CUIA 2E7FA 3ZE2B 4U3CA 3N1PC 1TYJA 4YLCA 5JXAH 3MRHA 4XO4A 1G7JB 3FSVA 1VC4A 3H21A 4OKVB 3CHPA 3F6LA 5DWPA 3AHVA 2X28A 3ZL4H 1DQQA 4CAGA 4QSFA 4FR6A 3RX2A 5F8QC 1BZEA 4HJSA 4P46C 5LXGL 3AHYA 3QW9A 4M7LH 4X5XA 3GR8A 1RHFA 3GMPA 4Y1TA 4AE0A 1TVLA 3EH5B 2IF7A 2ZF8A 4JQ4A 5CEWA 4HJGA 2FJSA 4C6FA 3GS0A 1N59A 3NSJA 2CHDA 3TJEH 4GQBA 4N2YA 4FEMA 2PEVA 2A7BA 1GCYA 2D0GA 1TG7A 5I1CH 2GQAA 2X0YA 2ZZ5A 5B1BB 4C56B 1EXGA 3LJ3A 4NYUA 2PP8A 1O4UA 3QC0A 4ZUUA 2X89D 4LCWE 1MQKL 4PJAF 4ZMAT 1GG0A 4GJ1A 2XYCA 5DLLA 1GRWA 4ZO8A 1FG9C 4QLRA 5C9RA 1KGUA 1KJ2A 1NKOA 3FXYA 1OAZH 1UWXH 2NY3C 2OR2A 2BDNH 1I8KA 1ZANH 2J72A 2JMRA 1FV1A 2X5PA 4XO5A 3RE0A 3TA3C 3TA3D 2WINB 3T4AB 5JZ7C 4X2PA 1ZHNA 2IANE 4OCRL 2Z93B 5BU6A 4HCLA 3O41A 3D2UA 3M46A 1A7PH 3LKRB 4BIKA 3EA2A 4NT6A 4AH2B 4A2LA 4YZFE 2VLME 4NZ8A 3IM1A 5IWLA 1LP9E 3VPLA 2VDHA 2G3ZA 5JPMB 3MV8D 2G41A 5LNEA 3FXGA 3KOFA 4GKTA 2WVVB 1G4PA 2V0AA 4KI5E 5EU3A 2XWBA 1I7TB 2A3HA 5T8IA 4FTDA 4RMRA 3SDXE 3MRLB 1XLMA 3EOSA 3RB7A 2BX7A 1OC5A 5K59E 5B4MC 3W7OA 4JEQA 1JVNA 3B0PA 4KWWA 5LWYL 3IS1X 4FOMA 1VYPX 2ENSA 2JB6B 2O6DA 3KTCA 3MLVH 2CHOA 5J12B 4S3AA 4IQJA 5KBPA 2LLLA 3DECA 5IB4B 1TPB1 3QJFA 3BQVA 1R6WA 1QLRA 2C9AA 3C8FA 5LIXX 5HUOA 3NQ7A 1C5DB 4M1RA 4QGYA 4ETYA 4P48A 4JX4A 4FLRA 4TS6A 3IANA 3WQ4A 3LY6A 1A5BA 3SCQA 3QRLA 1UM4H 5E2WL 3MX0B 4L0YA 1TWWA 2YL6A 2DLEA 1WISA 4MVAA 3B8DA 1OAYL 3EO9L 2D22A 3D2UB 1CO1A 1HILB 2K3HA 1GOXA 2PLCA 4RE4A 1IEQA 4YXKL 5I78A 4LYQA 5HJLA 4ZAKB 4NKIL 1A0QH 3GW3A 1I85C 3HU7A 2A0LC 5GJPA 3E0LA 1EJVC 4I90A 4LEBA 2AABH 4WUKH 3WH8A 4FNPA 1M9WA 4W9TA 3S3JA 2H32H 1SMOA 2WBJB 1NTHA 2APVA 3B2DC 3OA5A 4HH8A 4NJKA 4DUVA 2HLAB 3GXTA 3AREA 3LRGA 1E1CA 5C6WH 1UR4A 1J1XL 3B8WA 3IIPA 4KBXA 2QIWA 4QRFA 3WIHL 2QF8A 2P5EE 3EGSA 2AJXH 3HMXA 4O16A 4G6FB 3N9SA 4ODTH 4XWOC 4OCMC 1RQHA 3W02A 5KAQF 4Z7WF 4HJGB 2G4JA 4PJXE 4RA0C 3W22A 1EYEA 4I9TA 4L4TB 3HE7B 2TSBA 4GEIA 5HYSG 3WLLA 1RJCA 2J1ZA 1BG9A 3EOOA 1A47A 1QU4A 2PDUA 3I50H 5CJBA 2O6PA 3F03K 3VFGL 2NW2B 4PEKA 1YG9A 4PS4L 1C90A 2VGFA 3LIZL 3MTXA 4U1HB 5FGRA 3AU0A 1BXUA 3MRKA 1A3LL 3V4PL 5HJBA 3L5WB 4KH9A 4POZD 4KWOA 2AJVL 4OLXH 1XICA 3R7MA 1DQLL 1GZPB 2XZQH 1A9VA 4J8QA 1K6WA 5G4HC 4G3YH 3RUGA 3TYGH 3VGBA 1H1NA 2OKOA 3LLFA 3CDGA 5AZ0A 4YLBA 5IHUH 5DVMA 3ZHKA 5CSSA 1TTAA 2ICSA 1MWOA 4LZKA 3NDZA 4EE9A 4JO1L 2Y2WA 1WAAA 5A1AA 1ETB1 1OTTD 1S7TA 1V7ML 3GZ3A 4L1XA 2DQJH 5FEPA 5IUSA 2FT7A 1KXQA 5IBLD 5SWUA 3FEQA 3IN2A 4PB9L 3GKWL 3QHNA 2TRSA 4HLZG 1W3JA 3MLSH 1JHKL 5KVFH 1BVNP 2GFTA 3DENA 5HGBB 3CU7A 1X97A 4MD0A 1RV8A 4TMCA 4WW1A 3KCLA 3CFKA 1LEKB 4X9HA 4XXCA 4JY8A 1L6PA 4TNFA 3DBXB 2OCCB 1XTMA 5DYOA 4RDBA 4AUUA 2W07B 1CLZH 3GK8L 5AL8A 1H8OA 3G3DA 5TBOA 1K7EA 3TSMA 3ARGC 2LFEA 2PTTB 3EMZA 1CGSH 2M2DA 4X5WA 5ISZB 1FP8A 4JPQA 4RSVA 4N2HA 1DVTA 5IVXB 3U46A 4WCJA 3LHVA 4HVBA 3SKOB 2KQMA 1UGKA 4P2AA 1I6NA 1SSGA 2MKWA 3SPIA 3LOWA 5ABAA 1KLFA 4XOCA 1N5YH 4YC2C 1EA0A 3LDVA 3US9A 1A66A 5DYFA 3SB0A 3OKLA 4B95C 1MHEB 4JDEA 5C86A 5CEZE 3COTA 3WD3A 1TA3A 5EH1A 2WZHA 1JNEA 3MGOA 5AKTA 3T40A 4HF5L 3BRFA 2H0FA 1SZEA 1XCFA 2BMKA 2EDQA 2Q8XA 1LBFA 1O7DE 3HNVH 1CFQB 3KHOA 2Q8AL 3EOTH 2PDXA 3WFEL 3R4DA 1NGYA 5KYXA 4ZBCA 2DWEB 5CM1A 1NZRA 2WOQA 2HVBA 4JYEA 5D7JB 1RH8A 4AIZB 4CW1B 5BVPL 2E59A 1EJSC 2X30A 2IFGA 4Z2LA 3TO4A 1OX4B 2Z91A 2VFGA 3Q5YA 4PCFA 2IQ0A 4BWLA 3N2MA 3DARA 1BIIB 5BZZA 2VR2A 4IIFA 4N02A 2N4IA 1MFAH 2BNQA 4FQ2H 2OYKA 2OTWA 3ROOB 4N8VA 3WKPA 3TEWA 2GL5A 3K1KC 1XLCA 2J8GA 1KN2H 5FXCH 1G01A 4K8RL 1SVCP 3W75A 3C8HA 4ZX3A 4WJ5A 4PLJC 1R3IH 1HHIB 1H7WA 4UB0H 4Z7QE 4ZZKA 2HKHL 2R29A 1QNSA 1JEZA 4KROD 2VFIA 4H9MA 3QORC 4AMXA 3A4FA 2QVTA 1NOWA 2EXWD 2X6BA 1BYPA 2X6UA 3E38A 1PDYA 2BG5A 3KHJA 5CPNA 1CGUA 1XGPB 4YX2L 5ADPL 4NAJA 3OWRA 1EFXD 3WY4A 1TRIA 4B97A 3OYZA 1LE5A 3T0EE 3B7YA 1O7AA 1FG2A 4QHMA 4LUIA 1DE4B 1MHHA 4U31A 1AGCB 2X8RA 1YEHL 3QZNA 3NZ1A 4IP5A 1YEGH 1JPEA 3OKKB 4KQNA 2O5ZL 2PW2A 1GZ1A 1ODAA 3QS2A 4PJAA 3FS2A 2XWTB 3SUUA 4CVWA 1A2YB 3E8VA 5ICXB 4I9JA 5B1JC 3LHUA 4WOZA 2FX8H 5IHBA 2HJFB 2C16A 4BZ2A 4FNLL 4IKJA 4QKTA 4Z0XA 4WKHA 1MJ8H 1MCDA 5ABZA 2CA3A 1WNOA 4BI7A 1A1OB 1PLAA 3MN8A 3NH7H 1TU2A 3ZE0E 3EDKA 4WUUB 3WTYA 1B3JA 3BP7A 3QFDA 4L65A 1H3WM 4Q4RA 3H8AA 1EANA 4N0UA 5I8OH 1DN0A 4WFEE 3GMMA 2DSWA 5J6HB 5ITFA 3PWVA 2P76A 1E5UI 3GIZL 1KLUA 4KITB 3QN3A 8FABA 2PCFA 1NBVH 1ASPA 4XVSL 5HPMB 5AB2A 3B0XA 1IYXA 4MAUH 3ITTA 1EQWA 4HJWA 4YR6B 1I8MB 1QI0A 2DLHA 3PHSA 4HPGA 1PZ1A 1KYFA 1G69A 1QFUL 4QLKA 4UBPC 4A2MA 1RQ5A 3D39B 2K8MA 1RUKH 3OMAB 3OBAA 2WBGA 5C0EA 2VT0A 3OMIB 1PCWA 3AYRA 4DESA 4ELMF 2NNCA 3UZZA 4KNSA 1F90H 3VG0H 3CPLA 2D31A 3B3DA 4EXKA 4PCPA 2A9ML 2FIKA 3CZGA 1R3HB 1CFNB 3D33A 3H23A 1DEEB 5FJTA 3T55A 4U3XA 5AFDA 1BFTA 2YOCA 3ESOA 4XAWH 5C08D 1Y7VA 3RVXC 3FX4A 4K7FB 3CFEA 3DMMB 1H09A 3L4TA 4OZHE 4GBXD 4PM1A 2YD3A 1VGEH 4GG6B 2MNJB 3MR9B 3PWPE 3X14A 2NZ1A 1RZKH 4DOHB 2XIJA 1T83A 1B6UA 1N5YL 3F04A 4AGLA 3FRPA 2JK5B 3O7UA 1NC2B 3QR0A 1COBA 4BI5A 5T5FA 4S1RL 5D7LA 4N2LA 2NNFA 3TH3T 1QNRA 4W4OA 4BFGA 3B3IB 3QIBC 3KPSD 3DPDA 2ZSVA 4H6KA 3LH9A 4PLJD 4OD2A 2IDCA 1E4XH 4PJDE 4ZOBA 4ZQKB 2OQHA 2A9NH 3W3OA 4C90A 4KWVA 1MLBB 2FH6A 4F2UA 3BYTA 4Q9QL 2NQLA 2WM1A 5KZDA 4P46A 4ELKB 1KGJA 1UQZA 1CLOH 1QR4A 4LBAA 3QIUC 4G43A 4JRYA 4APQA 3TN3A 2PPCA 4XTRD 1A6AB 2AJUL 2R39A 3ECBA 2VVNA 4TVUA 3WK3A 4BWUA 1QUMA 4NO2B 3QCTL 3GU2A 1P84K 2FJFB 3COOA 3QOMA 1UD4A 3L3KA 3AMGA 3G1HA 3LLXA 4Y4HC 2I5IA 4TL4A 1SVDA 1TUFA 1QFOA 4TL5A 1TDQA 4NQXA 4BDVB 1ADQL 1HKLH 1NKRA 4IMKA 1XTLA 5F7WC 3APNA 1AC0A 5D7EA 9PCYA 5JNYA 2HNEA 1KCBA 2JF1A 1AI1L 1GJWA 1NF0A 4YTSA 1GZQB 4M81A 1UJ3A 2QKFA 1FN4B 4JTTA 4F7TA 1KZQA 1TE6A 4M0XA 3QEZA 4NCC2 2AK4E 2EE6A 5D72H 2Z1SA 3VFGH 2MQGA 4G7VH 3L16A 3QIWA 4H40A 5D93C 2HE5A 3LCFA 2H6PB 2PGWA 4Q56A 1C1EL 3RA7L 5DVKA 1CD8A 5DCBA 5LXXA 3Q1EA 2WXMA 2BSBA 1OM9A 1BGXL 1KENH 2EH8H 5FO8A 4QISA 1RJLB 1EZVX 2YWYA 1E6ZA 2G5BB 3F7KA 3J07A 2OGYA 4D6IA 2OSLA 3I9IA 2OELA 1YQ2A 2XJLA 4RZCA 3MUCA 4OVXA 1NGXA 4GFXA 4RGMB 2VLKE 3D4GA 4O1BA 4Y5VB 3GGWA 1I7TA 1AZVA 3VQ1C 3OR6A 2VQTA 4NN7C 4CGTA 1TPH1 3DKLA 3UTQA 7REQA 3CH1B 1MDTA 3ELQA 3OGOE 4JFFB 4PS7A 3KGUA 2UWEA 4JLRB 5IHZA 1IEWA 2VUOA 4PJ9A 4H0HB 4LL9A 4X9FA 5TE4H 5TFSH 3OC8A 3MREB 4D0BA 2YBVA 2ZTKA 2FFCA 3CB8A 2VWEE 3SPCA 5B3JE 4QMEA 1BD2A 4OZHB 3REWA 5I73C 5DJXA 5GSVB 2EUZA 2J4GA 1S5VA 1B4JH 5DF0A 5HGHA 2A3EA 2EC9U 3W39A 3L68A 5F6HI 1SY6A 2XZZA 5EFDA 5KINA 2WQUA 3ZQXA 1ZLEA 1CDCA 2BP5M 2D7OA 1JGUL 3KYOB 3D50A 4N2OA 4FCAA 4YFDB 3I6TA 5DEFA 2NZ9C 4DK3A 4Q22A 4EO5A 5IFHH 3P5ZA 4HJFA 1HKMA 4WGXA 1WCQA 4H83A 3MRNB 1WBXA 1D5IH 3H53A 3QFJD 1KWKA 1R2SA 1Q5MA 2LAAA 1SXBA 5BWAA 1ZV2A 1A0DA 3BWWA 4QHPA 4HC1A 3S5LG 4Y9EA 4GLRH 5E94B 2CJUH 3PWGA 1OPGH 1P4LA 4OLWL 4B3KA 2Q8BL 2ORBH 3ZMEA 4ZXLA 1RP9A 4XMKH 3WAJA 2XA3A 1G9MH 3LB6C 3QNYA 4K0OA 2OZ4A 2L7UA 3KVDD 3U7YH 4DHGA 4V1DE 5IB2B 4QCFA 3DV6B 2BWDA 3NJLA 3N2BA 1DLHA 1P9MC 4G8IB 1OSYA 4NRYB 2Z4QB 1ZT7A 4ZGYA 3SJVB 4Q9CA 4L29A 1F18A 4UTHA 4JG0L 3FUKA 3LEVH 3TDFA 1L9SA 2NVCA 1HDMA 3RJYA 1REQA 3PZVA 3QISA 3AXMA 2GDUA 4QNWA 3SDOA 1AR2A 3BGFC 4MB4A 4PRPD 1KIQA 4ZUSA 2XRAL 4N1CA 5D7KE 1WZLA 1XDLA 1T03H 5HOSA 4GYBA 1ETA1 3PP3H 4DZHA 1PD6A 3OXRB 3NTYA 3EKLA 4H8QA 2VDOL 5KW9L 4RAUB 1MEIA 1JGVL 1J1PH 2P1YA 4GB9A 4L9LB 2OMAA 3AFBA 3GHPA 3ZLHA 5HGAB 3GJEB 3LSOA 4FF5A 1S7UA 2EDBA 3EX3A 2AGJH 2DSZA 2GIXA 4ZMPA 1IM3D 1I53A 2Y69B 5J1AA 2HLFC 1AL8A 1V79A 3CDYA 1FCBA 3CMGA 4BHUA 2BY3A 1D5BB 3CFNA 3CZJA 2VGIA 3SY0B 5I0YA 3QYNA 2W63A 1H61A 1VFMA 1SBSL 2Z0BA 3DV4A 1I31A 3LQZA 4G9FE 2VABB 1UWUA 1RV6X 3HN8A 3ZHNA 4J2PA 1MNUL 4IZGA 5F88B 2H1PL 3DVNA 3G5ZA 2ITEA 2ZQKA 3EHBC 3GYEA 3OZOA 4LU5H 3RITA 1WKEA 5BXFA 2GFBA 3RBSA 1KYUA 4OM1L 4CDHA 1XLFA 3N6JA 3NJFA 4IOFC 4WU5B 1MMFA 4NAEB 3TVAA 1HCFX 2DQGH 1LOLA 5MKGB 3JWDC 4BQBA 2BS9A 2YXGA 4G6KL 3BLEA 1EIBA 4NEHB 5AW6B 1HTIA 3DUHA 3FQUA 3C2AH 4DP5X 1EDTA 4N2NA 3E2VA 3QEGH 2CDGB 3ZJ7A 1KELH 1R3LB 2VX4A 1LG1A 1ODZA 2VFHA 2LQRA 4YWSA 2F53A 5CBEB 1XFCA 1T8QA 2XYLA 2K45A 2XV3A 4U4BA 3BMVA 3WY1A 2W9EH 2VC2H 3QI9B 1WQ5A 3TSDA 3PHQB 3FTGB 5LKYA 2HH0L 5T91A 1O6SA 2VEGA 5HI3D 4AGMA 1XJBA 4M7JL 3O3BB 3EDJA 2GGHA 1AO7E 1Q9WB 3D18A 4DI9A 2J7FA 3F5WB 5E4EC 4HK3J 4DB7A 2RDWA 2KL6A 1DTUA 2X88A 2IOIA 4KTDL 1NDWA 3LENA 3QIUA 3W1LA 4LLDB 2DM2A 1BBJA 6TIMA 5LNUA 5CMAB 4KFPA 5CJMA 4HK0A 5FUZH 5KS9E 1NELA 1I2QA 3I02A 1DUZB 5LHFA 5FA4B 3UZEC 4TSBH 1OAJA 2J57A 1M57B 5KBKA 3LVEA 2Y7OA 1DPMA 4ES9A 3FIGA 3VD3A 3D5OF 1CXLA 1HXJA 2N7SA 2VC7A 1TOXA 3MQIA 4G6CA 3V9CA 1G6RL 2HNHA 1ZAIA 1A7QL 3MRDB 3P77B