5BMWA

Crystal structure of t75v mutant of triosephosphate isomerase from plasmodium falciparum
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYVGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Probing the role of highly conserved residues in triosephosphate isomerase - analysis of site specific mutants at positions 64 and 75 in the Plasmodial enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 99
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5bmwA00
1SO5A 5AC8A 4CNPA 3ABRA 1PL9A 1X1ZA 2CLEA 2VFHA 3S5YA 4WY0A 3O15A 3TSMA 1W56A 3UWUA 4QISA 2JKEA 2NX3A 1F6PA 1I4NA 2NV2A 3ZFHA 4JICA 2ZA2A 4PCFA 5DCEA 3CPRA 5CGQA 2OZ0A 5F4XA 4TMCA 1X6UA 1EX5A 5G1YA 1ICQA 3USBA 3W1XA 2P10A 1W3IA 3BG9A 4Z0JA 1DKWA 1MO0A 4LC8A 2H90A 4OWGA 3PR2A 2C6QA 1ZAIA 3S6DA 1TSIA 3VE7A 2R91A 3STEA 2A6LA 3G1FA 4WXZA 4IMFA 2QUUA 4UFJA 3NR0A 3D0CA 4PA8A 1H62A 3GYEA 2YX0A 4LV9A 1FDZA 1S3HA 1EEPA 1LRTA 4GE8A 5K4ZA 4Y90A 1VZWA 4UFLA 4O19A 4LWWA 3UQNA 2V2HA 4LW7A 3RFAA 1JCJA 5D2VA 4FO4A 4CCDA 2EPHA 2YW3A 3L65A 3W74A 1VC4A 1OHLA 2GJLA 1JUBA 2CZEA 3LTYA 3KHJA 1A50A 5G4WA 2A7RA 4MZYA 3CIWA 5LNWA 1YPIA 3DZ1A 1QNVA 5E1QA 4IX0A 3C0JA 3BGJA 3NM1A 5C54A 4GUGA 3A21A 2ZA1A 5HR6A 1QPRA 3C8FA 3IIOA 1XM3A 3QW4B 3IV3A 2ZRUA 3QF0A 1JRCA 3A24A 3DU0A 4LY8A 3CWNA 1VPXA 4UTMA 1THFD 1KTBA 1PVNA 2J9YA 3G8EA 2XN0A 5D04C 3W1MA 5FF4A 5GVJA 3NDOA 5HNRA 2J9XA 3O6CA 1TTQA 4XZ9A 1VRDA 4IQLA 3KVKA 3N3MA 2J24A 3CEUA 3LRMA 5HQEA 1H7RA 3TX9A 1OFDA 1LROA 1G69A 2YZRA 4GFSA 3HG4A 1WYIA 1TPWA 4UTWC 4IMCA 4QNEA 2HSAA 1W5QA 4U28A 2C13A 4S2BA 3LXCA 2X1UA 3IRDA 5G2WA 3QZEA 4WD0A 5D33A 3KVJA 3EB2A 3NQ2A 4Z1CA 2QCLA 3SZ8A 4QJ1A 4NZJA 2Z1BA 2BSLA 1G4TA 1YXDA 2DORA 4JY9A 2QCFA 3BLEA 2ZZ6A 4EF8A 1FWSA 1NVMA 1KV8A 1Q3NA 4NX0A 2CZFA 3GXNA 1OFEA 2OT0A 2X1RA 1ZAHA 3VNDA 2H3DA 3B8DA 2X2GA 4ONVA 4QQ3A 5FF0A 3BGGA 4LRTA 4NX5A 5HWNA 2CLKA 4LVAA 1Z44A 2WJZA 1VCFA 3SFKA 1KFEA 4Y6GA 1N8FA 3MBDA 1GVSA 4CQ8A 1LDCA 5FI8A 3L5LA 5F2MA 3TE9A 5CPNA 4ALDA 1XXXA 3W88A 4NZFA 3W2NA 1TV8A 3GKAA 3L66A 3CTLA 3UY7A 4ZMGA 5CPMA 1ZJIA 4WXYA 3STGA 5FESA 2GQAA 2ATSA 3B0PA 4NQ1A 4XTDA 5AHFA 3W23A 3NL2A 3PWAA 4NT0A 2E77A 3PM6A 4O13A 4WY0B 2DU2A 3NQ8A 3NG3A 5I3FA 2DZPA 2NXGA 1EP1A 1YTEA 4IPJA 2C19A 3G18A 4Q4KA 4ADSA 3KRZA 1H63A 3LCFA 1A5BA 4O1DA 3A5VA 1PV8A 5D02A 2PRMA 3UNDA 4Y9AA 1KFLA 4AHQA 5E93A 4ORMA 2J6XA 1K8XA 1DHPA 2WNZA 3FOKA 1F73A 3QW3A 3BVJA 3RNDA 4UR7A 4IXXA 3W84A 5EMUA 3IVSA 4ZQPA 4L4LA 3JS3A 4UMBA 4FNQA 3SECA 3P61A 1I2QA 5DELA 1W8SA 2CU0A 4JTTA 3EX1A 4LUJA 4JTSA 4JTLA 2YFNA 3P84A 1R47A 3G22A 3NQCA 2ZZ3A 2Y88A 4POCA 4Q32A 4HHPA 4RZ5A 3L2IA 3EX4A 5K9CA 4ZQMA 3P62A 2ZZ2A 2DZUA 4HSNA 1SPQA 1J5TA 2WQPA 3TH6A 1Z48A 2EF9A 2VFGA 1VJIA 4O17A 1QOPA 1H5YA 3TSDA 5HULA 4KFPA 1BEUA 1SZGA 2QUVA 3MI6A 3G3DA 3I68A 2R8WA 3QC3A 3DFNA 3NVTA 4A22A 4YWIA 2B4GA 1YDNA 2YFOA 4UC5A 2ISSA 4TIMA 3FS2A 4JTUA 4S2CA 4AMAA 2GQ9A 4BK9A 3GVGA 1A5SA 4UTWA 3H55A 5C5YA 2Z6IA 4FF7A 3NPUA 3NPXA 3T7VA 5DBTA 2Y7EA 5K9DA 2CLOA 4E2DA 3E0IA 2EAWA 4BF9A 2G5WA 1GQNA 3INPA 4PH6A 3WFAA 4FHAA 4O1BA 4EF9A 3DFPA 3SIZA 5LZLA 3G3MA 3PUEA 5C55A 3O6DA 5HUOA 3RLVA 1OX4B 1VYPX 3LLFA 4Z0SA 4X9SA 1H1YA 1F7BA 2AAMA 1KM4A 1F74A 3FKKA 2FB2A 1PCWA 1TV5A 4MLRA 3HGRA 3TC6A 4LUIA 3B06A 4NJIA 2W79A 1AW5A 4UUIA 1ICPA 4IPIA 3DBPA 1YADA 3Q37A 5G5IA 4O54A 3C56A 3L21A 4CCCA 3FIGA 3ZS4A 5MHBA 4S1FA 1HFBA 2TPSA 2V81A 2VELA 4K36A 1AW2A 3B05A 4JTKA 5KZDA 2A6NA 3U6WA 3L0KA 1W37A 2Y85A 1IXQA 3IIXA 1L6SA 4P2VA 1WQ5A 3WJYA 4GUFA 1CI1A 4MJMA 4I7UA 3DKLA 4CQAA 4ADTA 5I3HA 1EB3A 3GXTA 4OHQA 3HOJA 5AYYA 3A5FA 3IVUA 5DCBA 5I3GA 4N9BA 1FXPA 3W2MA 4DO6A 3BW3A 1OFPA 1Y0EA 2RDUA 1J2WA 3I7QA 1GVQA 1HO1A 3DENA 3LI0A 3PB0A 3FYPA 3UPWA 4HPJA 5SWUA 4ORIA 1EUAA 5F2IA 3F1QA 3NYZA 5D37A 3QJAA 1VLIA 3HQ1A 4GUHA 3HPSA 5F2LA 4K8EA 1DV7A 1Q6RA 1TPC1 2W6RA 2Y61A 3VE9A 2OX1A 3GB6A 3O1NA 2NV1A 4Y96A 4NXSA 3HGJA 1SQ7A 1JRBA 5EY5A 2WPBA 4O0ZA 3FJ6A 3T44A 5FEXA 5G2IA 1Q6OA 3OVRA 3SY5A 2YCEA 4OV4A 4DO4A 2FTPA 1A5AA 3ABOA 3LHYA 3MMTA 1LTDA 4FB7A 3HB9A 5CZ0A 2Z2UA 3HG3A 5DBUA 4PC8A 5AN7A 2C18A 3LCLA 3W9ZA 2V2DA 4M6VA 4O11A 5I3JA 4HNVA 3NQAA 2FPYA 1OABA 4AWSA 2PRHA 2BTMA 4FEZA 4N4QA 1TPEA 1TCDA 4DQWA 4O18A 4NJGA 1HG3A 3TFCA 2E09A 3M5XA 2NWSA 4MIMA 2VFDA 4EVZA 5EL1A 5DCDA 1TO3A 4BWLC 4LTSA 4DELA 2OMAA 1IXPA 3LOTA 4ZQRA 4YXGA 3W2KA 3MP3A 5LGZA 4LVDA 3S5ZA 3B03A 3W75A 3KRUA 3NM3A 2IQTA 4JX6A 1P0KA 3W7KA 1NSJA 3TJXA 1HO4A 1VLWA 3H54A 1VGAA 4WX2A 5DLCA 2B0MA 1R2TA 4AVFA 3S8HA 1GG0A 3P60A 2ZFAA 3L5AA 3AJXA 3DHFA 4MPQA 1OK4A 5CSRA 2A7NA 1L6YA 2DZXA 2C3ZA 1TRIA 3BV4A 1W5OA 3N19B 4O16A 2TSYA 3C2VA 4FIRA 4XTIA 4OE7A 1H61A 5K4XA 4N9DA 1GVFA 1I2OA 1UJPA 4O52A 3LHVA 2DZTA 3E12A 2E6YA 4GJ1A 3GDLA 1GOXA 2W0UA 3O8AA 3NL6A 5C2XA 4ICNA 4NU7A 1EPXA 2DJXA 2CWNA 3MUXA 3NQFA 3NAVA 5TBOA 1JCXA 4WUIA 3LTPA 3SGUA 1W31A 1ICSA 3JRKA 3W1LA 1KLYA 1UCWA 1P0NA 5KTLA 1RQHA 3F4WA 4CCEA 2P0OA 2ZRVA 3PS7A 4ZQCA 1UASA 3PULA 3S1VA 3GLCA 3W7PA 4YCOA 3BW2A 3EXSA 4O1CA 4AH7A 5EYWA 3M44A 4RZ4A 3RLUA 1LP6A 1ME9A 3C3NA 4UTIA 3M43A 1VHNA 5HJLA 1UBSA 1K8ZA 3THQA 3LCIA 3V75A 4MYAA 3E9AA 1KM5A 3A22A 2HS6A 4JX5A 1CX9A 1M7OA 2Y89A 3UWVA 1JULA 1WOAA 4PFMA 1RQEA 2NXIA 2E6DA 4N6FA 3R2GA 3W22A 3TXZA 4O15A 4AAJA 1BWKA 3NQ7A 2X30A 3L0GA 3S1XA 3EWXA 4EIVA 3MJYA 1P1XA 4K37A 2BWGA 4LC6A 5T26A 4MZ1A 1RV8A 3IGSA 2B7NA 3B0UX 2CLLA 1TIMA 3TDFA 1TQJA 3S1WA 4NXKA 2TRSA 1JCNA 3LM7A 2CFFA 5LNSA 1KW1A 1EP2A 3G24A 4Q33A 3A9IA 4BI5A 1AW1A 2GJNA 3MP4A 1EUNA 3QPYA 2AGKA 3T55A 1ME7A 3PB2A 3GDRA 4AXKA 3G1SA 1Z41A 3OG3A 4NJKA 3ABSA 1R2RA 4FNRA 1OYAA 1TJRA 3TKFA 1WX0A 2ZBTA 4DPPA 3C6CA 3LCXA 4O4VA 5HWJA 1FBAA 1LRNA 1EWDA 3W2JA 1OFAA 4BWLA 1KV5A 1B4EA 3M16A 3SI9A 3LXAA 1G4PA 1OX4A 5IM51 5CKSA 1H7OA 3DFSA 5F4SA 1EA0A 4XUGA 3W86A 3BARA 1U83A 2RDWA 3EXRA 1JUKA 2J27A 2QEZA 3O05A 4O10A 1ZHAA 1R30A 4TMBA 1LORA 1JCYA 1LBMA 3IIPA 3FKRA 5LGXA 1PHQA 3DXIA 1PHWA 3Q2DA 4P61A 3LCHA 3LV6A 2UV8G 2YSWA 3M5VA 3O6YX 4WOQA 3W7RA 1I2RA 2FB3A 2ZQ0A 4QIUA 1F2JA 4KFOA 4MVAA 2HTMA 4N6EA 1I2PA 1R46A 1SO4A 3TIMA 1HL2A 1IGSA 3G0SA 1JCLA 5J5RA 1AL8A 3HGOA 1H7PA 4O0KA 1B57A 3CEPA 3PG8A 3UWWA 1VQTA 3B0VC 1QOQA 5CZTA 4ZVJA 4UFIA 3AO0A 1J4EA 2CZDA 2E5CA 3NPVA 1GYLA 3QQ0A 3UZJA 5FF2A 3U8GA 4WJEA 4MOZA 1FCVA 1Q6QA 3HG2A 1V5XA 4H6KA 4Y8FA 1FWRA 4PL1A 3BK0A 2NWRA 3P74A 4KKXA 2O7SA 3P8JA 2RHGA 4GUIA 4RXGA 1SW3A 3STFA 3TMQA 3MO7A 5KMYA 4M7SA 4DBDA 4DO5A 2ATMA 5FEWA 2BZNA 2Y6ZA 1UUMA 3PBUA 3QSTA 3KAOA 1KTNA 3R5EA 4GWEA 3W1RA 1GTHA 2QDHA 2B7OA 1XFBA 1D3GA 3DI1A 3WK1A 3KRSA 5HINA 1KM6A 3LCGA 3LBMA 3W7GA 2G96A 1RD5A 3T78A 4MY8A 2OCZA 1F05A 1M5WA 1OF6A 3W85A 3THAA 2RKXA 2G95A 2R14A 3GK0A 3NQDA 1MEIA 3W71A 4O53A 3I65A 4BI6A 3TC7A 1TRDA 4HNUA 1OFQA 1H50A 1T96A 5L6UA 4CNOA 4DF2A 5EA9A 1LZOA 1A5CA 2A2IA 4JS3A 4UTHA 4M5PA 5I3IA 2V2CA 2E6FA 1E51A 3S5NA 1KM1A 1BWLA 3MHGA 2RH9A 1XDLA 2Y62A 4FX7A 1XUZA 1OYBA 3W7IA 2V8ZA 3WK3A 1VYSX 1RVGA 2XN2A 4O50A 4GUJA 2JGYA 4GXMA 4MUZA 4BR1A 1WDWA 3NZ1A 2ZTJA 2V0TA 4JTFA 3HPZA 3PF3A 3NL3A 1JVNA 2XN1A 3C2OA 1X7FA 3SSJA 1JCMP 4ML9A 4UFKA 2FFCA 4YLWA 3C52A 2J9ZA 4N4PA 3T4CA 2LLEA 3UY8A 3R89A 3ABQA 3W7HA 3I7RA 4UMCA 2WOQA 1QPNA 1A53A 1GTEA 2QCEA 2CW6A 2YGYA 2PE4A 3BO9A 3LRKA 2FPTA 1D9EA 1G7VA 1O5XA 4Z1BA 3QEZA 3LHTA 4X2RA 3OVPA 1OFBA 3NQVA 4JTGA 2QCDA 1TJPA 4IX2A 5BNKA 5FEZA 4OT7A 3QM3A 2ZZ4A 3CC1A 1OK6A 1W54A 3WK2A 3TNOA 2QCMA 1EIXA 5D38A 1QPOA 4JIQA 3EWYA 5DY3A 2C14A 2CLHA 4JTIA 1SW0A 1FWWA 3G1DA 3LV5A 4LS0A 4GRSA 4JN6A 2GVJA 1ME8A 2DZSA 2Q3OA 4ZL1A 2CZ5A 3Q94A 1SSDA 1SZEA 4N9EA 3G1HA 1FCBA 3O16A 2VEPA 3W7OA 4MYXA 1O94A 3G1AA 3NEVA 4GNJA 2DZVA 4UCGA 6ALDA 4UNLA 3G1XA 1H7XA 3F4NA 2C15A 3LB0A 3N2XA 4FX6M 5HMSA 2VFEA 2HS8A 3DFQA 1VYRA 2Y63A 2V82A 1YXYA 3OIXA 4AWUA 2CLIA 1ZCOA 5HUPA 1QAPA 3FJLA 5CG7A 4RXFA 4HPXA 2PCQA 1JR1A 4LVBA 2FIQA 4MZ8A 3BPWA 3W1NA 4W9TA 4I7WA 1ZAJA 2VENA 2PURA 2QF7A 1TPUA 4LRSA 2OT1A 4AWTA 3GAYA 5D2WA 1SO6A 4AEOA 3IGXA 1YDVA 3CLMA 3PC0A 3S9YA 3W2LA 4YMZA 5D2TA 2A5HA 5FF7A 1SW7A 1Z42A 2QAPA 3O63A 3ZWSA 1GG1A 4XBSA 5AHIA 3TMLA 5ABTA 1VCVA 1T8XA 1M7PA 3C61A 4RV8A 1TPFA 3MI2A 4DPQA 3MHUA 4JYFA 1YXCA 3TV8A 3W7NA 1W5MA 3TQKA 3NPWA 5AOUA 3EX2A 3L5MA 1LRQA 3L68A 5AYXA 2EHHA 3E96A 4MY1A 5J5DA 2ALDA 2WSRA 5E0KA 2YPIA 4K7VA 4R7JA 1C9DA 5AHMA 3WJSA 5LNUA 1IIHA 3QH2A 4OQVA 4A2RA 1C29A 1LOSA 4CQ9A 2H6RA 3TAOA 3HF3A 2XFWA 3TU9A 5KINA 4IMDA 3GKFA 3W72A 4Z08A 2PRLA 4WY0F 3TA6A 4CLMA 5D30A 1GJPA 1B9BA 1XBYA 2VC6A 4HNNA 1QPQA 2Q8LA 3W7JA 1FDJA 3EEGA 1K8YA 2GUUA 3C4UA 3W7MA 4R53A 4FIQA 4QNWA 4RX0A 3LI1A 1MEHA 1ZENA 1L9WA 1SU5A 3LERA 3N73A 3PSVA 2WNQA 1FCUA 1F6KA 3DAQA 2ZCGA 1BKSA 3W6YA 5CPOA 5FEPA 1W3TA 3PY2A 4WOZA 1SFLA 1WV2A 2QJHA 3S5OA 1WXJA 1FCQA 3IVTA 2Q8ZA 4QAIA 1G4EA 5KITA 1ADOA 1X8FA 4FNSA 1Q6LA 2QCGA 4R34A 3VFLA 1DJQA 3TUUA 4O12A 4N2YA 3K30A 1QO5A 3ZWTA 5LSMA 5H2ZA 1ALDA 3HG5A 3N9RA 3G8RA 4XQ6A 1T99A 2EKCA 4LU0A 3PG9A 1GEQA 5A8GA 3QMSA 2X1SA 4HN4A 4E2BA 3F03K 3NQ6A 3WJZA 3NNTA 2O7QA 3QRHA 4O4WA 3N9SA 4Z1DA 3WJXA 2GPTA 1VHCA 2ABBA 3WJWA 1NFBA 2ZDRA 4JD4A 2QCDB 2B7PA 2H3BA 2QCHA 4HNTA 3CIXA 1KM0A 5BW6A 5CPLA 4E38A 4YL2A 3P8IA 2QJGA 3CB8A 4K8HA 3CHVA 3P7YA 4FX8A 3DFTA 1MEWA 2BXVA 1I8JA 4O57A 5K3VA 3TSBA 3CT7A 1WBJA 4LS2A 1W5PA 1ML1A 3W1QA 2NXHA 5F2GA 1VS1A 4M7TA 3LHUA 1I45A 3JR2A 1GT8A 2QAFA 3O06A 1NF7A 1SSGA 3W70A 3RU6A 2H8XA 2A7PA 1IXOA 2QCCA 3LHZA 4K7YA 3DI0A 2C1HA 3KVLA 4OGZA 1KBJA 2Z0IA 1QO2A 3VI2A 3TQ0A 1QDSA 6TIMA 3BW4A 2FLIA 1K03A 2VXNA 3W7EA 2ZRWA 4U4MA 1JJKA 2YXGA 2TYSA 3TROA 3W7CA 2QUTA 2WSQA 4FXRA 3MI3A 1LOLA 1O5KA 2A1YA 3EX6A 1S5WA 1ZY9A 1WOBA 5AHNA 1FX6A 4CNNA 3N14A 1QFEA 3L67A 3NQMA 3SJ3A 1XBVA 4FXSA 5LHEA 5LNRA 2A21A 4MY9A 3PSWA 1F5ZA 1YYAA 2G97A 2A85A 1L2UA 2NLIA 1FWTA 5DY2A 2A0NA 3CU2A 4NVTA 3VCRA 3WK0A 4FNPA 4UFHA 5D2YA 4ADUA 1ONRA 5H91A 1DQXA 4WQ6A 1JQVA 1PS9A 1OFOA 1QWGA 3M6YA 3ATYA 4UMAA 3A23A 3FFSA 1R2SA 3LLDA 1K02A 3UYCA 5LKYA 3PVFA 4LS1A 4UTLA 2WV8A 1DVJA 3MP5A 4YCPA 4EOUA 3IEBA 5FF3A 3LX9A 3RF9A 3W1UA 4E0CA 1V7YA 3UWQA 3DHDA 3KXQA 3FA5A 1X1OA 5DXXA 3L0NA 3LTSA 5HR7A 5KZEA 4PL2A 4PTNA 5C6MA 1DOSA 4QSHA 3GR7A 4UTJA 4NJHA 2Y7GA 1TMHA 1N7KA 2RFGA 3CQ0A 3EKLA 1LOQA 3OA3A 3PBVA 4JTJA 5BMWA 4MJZA 3QFEA 1MZHA 3C2FA 3M7WA 4AHOA 1XI3A 4ZQOA 1B3OA 1IF2A 3TW7A 5K2ZA 4K38A 2RDTA 1HUVA 1LBFA 3BLFA 2CLFA 1TREA 4LNYA 1UUOA 4AF0A 3W2UA 4FNTA 4JTHA 2DJLA 2E6AA 3MYOA 3W7QA 1LCOA 4PEKA 2F7FA 1H7NA 3QQ1A 2E5BA 2QJIA 3P82A 1DJNA 3NQEA 4FNUA 4IXHA 1D3HA 3CWOX 3W3OA 4A2SA 1GVOA 3I7SA 4KWVA 2YYUA 5BMXA 2VOMA 4IWWA 2FQIA 4I9AA 4O28A 4IOTA 1IIGA 1FY6A 1N55A 3MHFA 3STCA 2GQ8A 3V1PA 3W1PA 4N02A 5KSWA 1MXSA 3Q58A 1G6CA 1KFJA 4J9JA 3EKZA 2ZZ7A 1KM3A 3GDTA 3R12A 4IUOA 3GDKA 4M19A 1I2NA 4ZQNA 5CSSA 4NNBA 1TPH1 3ZR4A 3MWAA 5AHLA 3W83A 2ZRYA 1VH7A 5U4NA 3OEXA 4JY8A 3TJLA 3NGJA 3NL5A 1W1ZA 1OX6A 2I9EA 3L9CA 3LDVA 5G1TA 4DF1A 1U5JA 3UXDA 1O95A 2Y7DA 5KZMA 4K6AA 2X1TA 4R33A 3W73A 4M6QA 1WA3A 2C0AA 5EKYA 5F1VA 3OBKA 2CLMA 1XC4A 3HJZA 1P5BA 1GYNA 2E5DA 4ZZ9A 3M1ZA 3W7DA 2YDAA 4OV9A 2JGQA 4D2JA 2ZZ1A 2ZTKA 1W5NA 1KBIA 3PBWA 3QMRA 1JUEA 2PC4A 1QR7A 4XBKA 1B4KA 1ZALA 2GVLA 2NX9A 1HTIA 1Q45A 1DBTA 1OFRA 3KVMA 1G7UA 1TPB1 3W7LA 2JBMA 2JKPA 4IGHA 2NX1A 2QR6A 2QKFA 4JIPA 4QITA 2QCNA 1YPFA 4UIOA 4RR4A 1OF8A 1K7XA 3W1TA 1DL3A 4MFEA 1WBHA 2BLEA 4A29A 1OJXA 3SR7A 2A4AA 5AC6A 4XKYA 3LGEA 3RK8A 1VR6A 1YTDA 3LRLA 3W87A 1L6WA 3TQVA 4OU1A 3NZRA 4DXVA 1LYXA 1FUYA 4LVFA 3LBCA 3R8RA 3GX9A 4RK8A 4JX4A 3GXPA 3ELFA 3IGUA 3PBYA 4QM1A 3UXAA 3GDMA 5A5WA 3G0XA 2P1FA 3QSRA 2YYTA 4OBTA 5AFDA 1RZMA 2ZRXA 4X22A 5IBXC 4TR9A 1TB3A 7TIMA 4RZ6A 1FQ0A 3BG3A 1H7WA 4G1KA 4C1LA 2YW4A 1DQWA 4DEFA 1H1ZA 1O60A 3HIJA 1RR2A 1TTJA 1KM2A 4M6PA 5AYZA 1FDYA 3DKJA 3C2RA 3TR2A 3BLIA 4UR8A 3P5ZA 4JGDA 4LT9A 3I6RA 4A21A 1UB3A 2WO5A 1QMLA 4TO8A 3P81A 5G4EA 3P5YA 4NUWA 4Z1AA 3EX3A 2ZYFA 4KWWA 3QMTA 3QYQA 1OYCA 1SFJA 2Q3RA 2B7QA 3ANYA 2VEMA 3W1AA 5G2HA 3P67A 2C16A 1DORA 3EWWA 3OVQA 5K7JA 1YLVA 3GIYA 1RQBA 3FLUA 3PUOA 3HBLA 3LCWA 4AF0B 4LVGA 1K7FA 1KFKA 2V9DA 3UPBA 2J88A 4XWUA 5CZJA 1PE1A 3R13A 4B5NA 3U2OA 4UTTC 3NA8A 1MSSA 1QCWA 3M47A 2FPVA 1AK5A 4C1KA 2NZLA 2E68A 8TIMA 3CM4A 3GR8A 1LLZA 5BOOA 5K9XA 1OG0A 3T40A 2DP3A 3B04A 4JNMA 2HMCA 4UTUA 3HPXA 3HO8A 1W3NA 4MFDA 4IJBA 1PIIA 3MYPA 2JKAA 1O4UA 4GC4A 4BFAA 5L9FA 1ZNNA 5EPDA 3S42A 3RMJA 3UZ5A 2TMDA 1M6JA 3E49A 1P4CA 4TU1A 2VEKA 5AB3A 2AQWA 1SUXA 4JTEA 3G1YA 4H4IA 2ZA3A 4GBUA 5D03A 4X3ZA 3N34A 1WAUA 4RKAA 4JXCA 1BTMA 1PCKA 2FDSA 3SGZA 3M0ZA 4O8RA 1SO3A 1XUUA 3W76A 4HT3A 1TPVA 1LLWA 1T0OA 2E1DA 3GNDA 3MBFA 2NUXA 1XBXA 4K39A 2WKJA 4TX9A 5F1UA 3G1VA 4O1AA 1AL7A 3TW6A 2GVGA 5DN1A 1OX5A 1EP3A 2D73A 3B4UA 4RJEA 2ISWA 4O14A 5D09A 2R94A 3SW6A 3DFOA 4UFMA 5EBUA 3M5YA 4BI7A 3LHWA 1SZNA 2VFFA 2ZRZA 3IIZA 4UNKA 3H53A 3M9YA 1TV7A 3C2EA 1XCFA 4DF0A 3NO5A 4I7VA 2QDGA 4N9CA 1KTCA 4WZHA 2WNNA 4JDYA 3VKJA 2ISVA 4JDBA 3KFTA 2Y7FA 1NAL1 2BX7A 3NQGA 1TQXA 4HKPA 4NJJA 5TQLA 3S0CA 3HMJG 4AHPA 4PODA 5AC7A 3PUDA 3G0UA 2V30A 2JK2A 5AHEA 2NUWA 3FEMA 4AB4A 2VKZG 3EWUA 5LHFA 2KZHA 1S5VA 4LOCA 5IBXA 3FYOA 4XKYB 2V5BA 4DBEA 1GVRA 3HGSA 1AMKA 3LXBA 3UWZA 3EWZA 4NNCA 1GPWA 5I3KA 1JQXA 5LNVA 3P80A 4IMGA 4HIBA 1KFCA 5U7SA 3M5ZA 1EWEA 3GNNA 3TCEA 2DZWA 1W0MA 1TTPA 3M41A 1XL9A 1KLZA 3S1UA 1H51A 2Z6JA 1CW2A 4RLIA 1K3UA 2X16A 3QPZA 1SZFA 3ATZA 2ABAA 4MKNA 4RCXA 5TIMA 4IMEA 4HSOA 1S5TA 1F76A 5DXYA 1AG1O 3E02A 2F84A 1OVDA 2YR1A 3MW7A 3EWBX 4H3DA 5D32A 2VEIA 1NF0A 2Y70A 3N2MA 3PAJA 4JR5A 3KX6A 3UWYA 3YPIA 3W07A 1YDOA 3GAKA 5BRBA 1TPDA 3NOEA 4LV4A 4NNAA 3TFXA 1G4SA 3DGRA 1TYGA 1XBZA 5HWMA 4UTTA 2WSYA 2GOUA 2H8ZA 1LM1A 1K7EA 4MLJA 3OHIA 3KOFA 1FXQA 3GZ3A 1LBLA 1KA9F 1H60A 1GZGA 5D2XA 4UXDA 2OJPA 1IXNA 4JYDA 4A3UA 2VFIA 1XKYA 2V5LA 1NEYA 1VCGA 4JEQA 3TAKA 2FJKA 1RPXA 3TXVA 3TK7A 3O07A 2ZZ5A 3IIVA 2I14A 4JYEA 3DH7A 3NXFA 4L4MA 1KFBA 5F4WA 5CZSA 2I1OA 2EGZA 3UD6A 3EXTA 5D05A 1ZFJA 1SR9A 1XDMA 4EWND 1TTIA 3BG5A 4UTKA 1GWJA 1G67A 4KFNA 2NUYA 1FWNA 1YTKA 1C8VA
chains in the Genus database with same CATH superfamily
1SO5A 3OBEA 2PDIA 1UH3A 3RIKA 1E6NA 1JL8A 1X1ZA 4WY0A 3FK4A 4RNIA 3ZIZA 2GUBA 5CBBA 2OFJA 1OGGA 5E09A 1B9ZA 1S2CA 2OZ0A 1SZRA 3VZYA 1X6UA 1EX5A 5DMYA 1A0CA 3WLNA 3AIBA 1AZ1A 4DXXA 3MVTA 3OPSA 3BG9A 4Z0JA 1MO0A 2H90A 4OWGA 2I57A 3KDNA 3S6DA 1PO9A 3VE7A 3QZAA 4WXZA 3NR0A 3D0CA 3QN3A 6REQB 2WJDA 2DH2A 2DIJA 1FDZA 3WNMA 1LRTA 4GE8A 4CD8A 5AYBA 4LWWA 3UQNA 3BICA 3BOFA 3QOMA 4FO4A 3L65A 3W74A 1VC4A 2WHMA 1ZP3A 1B54A 2GJLA 3MJMA 4OFCA 4D8LA 1UWSA 3SQLA 3PJTA 4IL0A 3CIWA 4XK2A 1QNVA 2PWEA 3B40A 3IJ7A 4GUGA 2OO6A 3EDJA 3QF0A 3A24A 1THFD 1KTBA 4JFUA 4M1RA 5GJPA 5TAOA 4PUKA 5FF4A 3B9NA 4F40A 3LPOA 2CBUA 1TUFA 4LYRA 1JPDX 5HNRA 3WENA 4XZ9A 3H24A 4GQ0A 4XZWA 4IQLA 3G6LA 3WLTA 3T09A 1KBBA 3CHFA 3BXWA 4LBRA 3Q4DA 5DMLA 1G69A 4JQ2A 5CSYA 5KZ6A 1TPWA 4UTWC 4Q4PA 4IMCA 3E74A 2J78A 3WEMA 1W5QA 1EO7A 1XG4A 3KRBA 5FJJA 5FJOA 1JGMA 4L1WA 4GVFA 3KVJA 3EB2A 2X2YA 3NQ2A 4Z1CA 2E8ZA 4QJ1A 4JN7A 3FGCB 2BSLA 1EXBA 3LPFA 3MCNA 5T9BG 3QLDA 1NVMA 4KRUA 4NX0A 2D0GA 1OFEA 2W3ZA 1ZAHA 5BCAA 3U7VA 4IPPA 2X2GA 3UJSA 1J9YA 4IP7A 2OX4A 2ZX6A 3CMGA 4HOXA 1Z44A 2WJZA 1VCFA 2A3BA 3JUGA 4L9XA 1N8FA 3MBDA 4CQ8A 3WQ6A 1LDCA 2INFA 2R6OA 2JALA 4QRNA 5FJTA 1DJYA 5BZAA 1E73M 1W1TA 1W8GA 4PRWA 3W2NA 1V0MA 5C9UA 3UY7A 4GHRA 2YL6A 3W6MA 5FESA 2BFGA 3B0PA 5AHFA 4RZBA 1DIDA 1BF2A 1CLVA 3ARWA 3NL2A 2VC7A 2YDRA 2P88A 2PCEA 4NT0A 3TYAA 2V5KA 4O13A 4WY0B 3HPFA 3M0YA 3NG3A 2BGSA 3NSNA 4LGXA 1EL3A 4K3ZA 3G18A 1UMYA 2F6KA 3FAWA 4C7FA 1U5HA 2R1NA 4ADSA 3KRZA 1NDYA 1A5BA 2Y5EA 4O1DA 1PV8A 2NSOA 1DIEA 3TONA 3UW6A 5E93A 1DE5A 3G2GA 3GBDA 1K8XA 5BOEA 2OQHA 3VNIA 1F73A 3SSZA 1BYCA 5EFFA 3BCJA 3IVSA 3OQEA 1BHGA 2JF6A 2YDSA 4JTTA 2P3EA 2QVHA 1H2JA 3WH7A 1AQFA 3T1GA 4DWSA 4PTDA 4OTKA 4Q32A 4RDWA 2C7FA 5CAKA 4ZQMA 5HPCA 2WWCA 1BXCA 1SPQA 2WQPA 3LEPA 3F4CA 2EF9A 1VF8A 4CCZA 4O17A 4FS9A 1TUXA 2QUVA 3MI6A 3G3DA 3URQA 5DQPA 4EACA 4UOJA 4AZBA 2R8WA 3CZGA 2V69A 2B4GA 2F8QA 1E9IA 1B3XA 4JTAA 2YFOA 4KETA 2PTWA 2ISSA 1VRXA 3SQMA 2EEXA 1XFCA 2QIWA 2HROA 3GYCA 1C91A 2UBPC 2VRKA 1C7SA 2EAWA 4KF1A 2G5WA 2VUYA 2XH0A 4IIHA 1ISZA 3A64A 3SIZA 2ZX7A 1J93A 1KBKA 3OQ8A 3WG6A 4D6FA 3UZWA 3ORWA 5C55A 1NARA 3RLVA 1RP8A 1OX4B 1VYPX 4IGNA 5A8OA 3F5LA 3LY0A 2DY3A 3KOYA 4W7UA 5BYWA 1F74A 3FKKA 2HK0A 4D1IA 3GNXA 4JIRA 3EA2A 1D8WA 3S83A 3I4KA 2WPGA 4GI4A 4IPIA 1XRTA 4MJ2A 3Q37A 4QJ3B 2DUAA 1JEZA 4C7GA 1JPMA 3WZ0E 5I6SA 2O9TA 4ZE4A 3IPWA 1RVKA 5MHBA 2DT3A 4S1FA 1HFBA 1NTHA 5CPSA 2TPSA 3N13A 5KZDA 2HJPA 4G9PA 4JTCA 1WQ5A 3KBVA 1EH9A 2V3DA 5A3HA 3KWSA 1XP3A 2VCCA 4CQAA 3DKLA 3GC4A 5AVNA 1T40A 1YX1A 1YEYA 4MKVA 4N9BA 4DO6A 3PZIA 3BW3A 3VO0A 2MUCA 2O9PA 3I7QA 3R0UA 4YNGA 3L4WA 4HPJA 3W24A 2Z2AA 5F2IA 2BHUA 2WYSA 1WZKA 1XYMA 5FJUA 5GPRA 3QFWA 4IP5A 4GUHA 3HQ1A 1XPYA 2A3HA 4K8EA 3KDOA 1Q6RA 1V51A 4Z2LA 4XZHA 1AVAA 1UD2A 5CBJA 1W1PA 2NV1A 4NXSA 2EPNA 4XD3A 4JFSA 2O56A 2PDCA 3OVRA 1GW9A 3AIEA 3H2EA 1AJ0A 3SY5A 2YCEA 1PIFA 4CVUA 1E5NA 4QP0A 4ICMA 5JBFA 1NIUA 4PBEA 3BE7A 4PCPA 3PPCA 4QDPA 3HG3A 3L4VA 5A8MA 4NKCA 3SJNA 2YKKA 2V2DA 5J8LA 4DWSB 3IANA 4GO9A 3NQAA 1SFSA 4Q8VA 1OABA 4PMQA 2BGQA 4US5A 3KEHA 1GOKA 3OW1A 3L2LA 1KCXA 1WDDA 1KKRA 3T8LA 2VR4A 4DQWA 4O18A 2FMNA 2QYGA 3TN5A 3CT2A 2NWSA 1TWWA 1X39A 4MIMA 2VFDA 1GJWA 5CXPA 3UR2A 5DCDA 5DMMA 4C5ZA 2OMAA 3AMKA 4B91A 2E0PA 4GYPA 1VJSA 2VGBA 4LVDA 3WH5A 4NZ1A 3L4XA 3W0KA 3NM3A 2IQ0A 2MANA 3KLLA 2IQTA 2VDGA 4JX6A 2JF7A 3TJXA 1S46A 1HO4A 1ZSXA 4HA4A 3ABZA 3IK2A 1QUMA 3BAYA 1VFFA 1VGAA 3F7JA 4WX2A 3UA3A 1QW9A 2B0MA 2PTYA 4AVFA 2QMKA 4QEEA 1GG0A 3G1RA 4MPQA 3B9AA 1OK4A 5CSRA 3CXOA 3NJ3A 1MW3A 4UQDA 1W5OA 3N19B 3S2LA 3FW6A 1UC5A 4FIRA 1H61A 1I2OA 3LHVA 1XIFA 3E12A 6PTDA 2GJPA 1GOXA 4AD4A 4F9JA 4CUCA 3ZJKA 4NU7A 3DIPA 1EPXA 2CWNA 3MUXA 3N2BA 1OCQA 2XFFA 4WUIA 2F6UA 3JRKA 3NGFA 3CZLA 5H8PA 1P0NA 2PI6A 3F4WA 2B81A 1AQMA 3APTA 1UASA 2J66A 3GLCA 3EXSA 1OC5A 4LBSA 4F8XA 3M44A 1B30A 4NZ4A 4AIBA 2V3FA 8XIMA 3C3NA 1QHPA 1TWDA 4C7DA 4PB5A 2AKZA 3V75A 3S47A 3A22A 3WSUA 4H8UA 1CTNA 1EC9A 3CQJA 1WO2A 1WOAA 2BODX 3H7RA 2QJMA 2X30A 4J3ZA 2VQTA 1TV4A 1TG7A 3ITLA 1P1XA 4H9YA 4LC6A 4MZ1A 4YJ5A 2B7NA 1UYQA 3B0UX 3RUBL 2HNHA 3KWXA 4DYJA 3W53A 1D7FA 1EYEA 1MRQA 3LPGA 1EYWA 1FHDA 2EBNA 2WSPA 5LNSA 1ZGDA 3VKBA 3POCA 4AX6A 3S2NA 1XLJA 2D2OA 2GJNA 1EUNA 2AGKA 4HPNA 1QK0A 3UZYA 3PB2A 2VWTA 4TX6A 3WQFA 2PDFA 2QNEA 4FNRA 1BVWA 2VX7A 1WZLA 3LZ3A 1HJVA 1TE6A 2XIBA 4DPPA 6CGTA 3RX4A 3BLOA 3W25A 3C6CA 3AHVA 4HCLA 1X96A 1B4EA 2X7VA 4DX3A 1IYXA 1VBGA 4N0RA 5CKSA 1W9XA 3RMEA 3BARA 4M56A 4Q4SA 1E1CB 1U83A 3EXRA 4KMQA 4BQ4A 1UIPA 5LIWX 1ZHAA 2ZICA 4TMBA 4AFYA 1R87A 3GH4A 3IIPA 1ISWA 5LGXA 1PHQA 4J28A 2CC0A 4V33A 1PHWA 4AZ6A 3BZJA 4ZFCA 3NO3A 1UD6A 2YSWA 3TOPA 3O6YX 3W7RA 1I2RA 1B0IA 1PX3A 2FB3A 2ZQ0A 3W02A 4MVAA 3EOEA 1SO4A 1NJJA 1W9VA 4A8NA 4KCVA 4AX7A 2WMGA 1JZ5A 4L7ZA 2P5NA 4MTVA 3TLLA 2PDJA 1J4EA 3E2VA 3QQ0A 3PTMA 3UZJA 3HG2A 3P14A 4Y8FA 3BK0A 1PJ9A 3WQPA 2ZX8A 4GUIA 4GG9A 2ZUSA 2VTFA 1GVEA 1WDRA 4HCDA 3STFA 3SN0A 3MPGA 4QCEA 4DBDA 2ATMA 2QQ6A 5A95A 1G94A 4Q4QA 3PBUA 1FWFC 3GTHA 3R5EA 3QY8A 3W1RA 1XIEA 2B7OA 3MY9A 1XFBA 1D3GA 3DI1A 2VZSA 1KM6A 1MQQA 1HQTA 4N42A 2G96A 1HGWA 3EA3A 2OCZA 4KEUA 3CMJA 3ZQ9A 4H41A 2G95A 1TIWA 2QF8A 3NQDA 2PLJA 1EJRC 5JH2A 1UH2A 1FWAC 4GX9A 2PC8A 5EA9A 2IPJA 4LPCA 4I9TA 2A2IA 5I79A 4JS3A 1W1IE 3RM8A 1JCTA 1FH9A 2QULA 4ZB5A 3N17A 3GXDA 1BLIA 1UWRA 3N9KA 2RH9A 3CAWA 4CN4A 5A8QA 3W7IA 3IK4A 4RE3A 1RVGA 4GX8A 2XN2A 2JGYA 5EB8A 4JIHA 3VDHA 3HPZA 5BWAA 3DDMA 2W63A 4KEVA 3PPFA 4QS5A 3CH0A 1NWSA 4YLWA 2PP1A 3V0TA 2LLEA 4H7ZA 2GZXA 1HW6A 3MDWA 3UU0A 2GFTA 3R89A 3VD5A 3I7RA 1XH2A 2DDXA 2QUNA 1A53A 4U2ZA 2YGYA 2CW6A 3BO9A 1TWZA 2FPTA 1D9EA 1G7VA 3QEZA 4X2RA 3OVPA 3BLPX 4LH8A 4IX2A 2WHJA 1I0DA 1W54A 3WK2A 5HATA 1QPOA 3T2OA 2CXGA 1JD9A 1U1HA 1BXNA 2VVSA 4LS0A 4GRSA 2GVJA 1ME8A 3IUIA 5CSUA 3WQGA 2G8ZA 2Q3OA 1LT7A 3GG0A 5ENLA 4O1EA 3Q94A 3PP7A 1XIDA 3H2AA 1EGZA 3GG7A 5FCZA 4IJRA 4UBPC 4MYXA 3G1AA 4UNLA 5FAGA 2VR5A 3SUUA 1H7XA 1FWJC 1XIHA 2E9BA 4CD5A 2C15A 3PZVA 2X0SA 4GA8A 2YBTA 1IEWA 3DFQA 3OP2A 3K8MA 2V82A 1D7KA 5CGTA 3PJWA 5FJPA 3OIXA 3GTFA 2DVUA 3RJXA 5CG7A 2PCQA 4MDOA 4LVBA 2FIQA 4JEJA 1DEDA 3BPWA 4LUSB 1E6RA 1Y5VA 4S3JA 4ZOBA 1E4MM 3OO2A 3N25A 1SO6A 4PFHA 2WKGA 2ZADA 3SRDA 3S9YA 2A5HA 2QAPA 3PBGA 1GG1A 5D8WA 4H00A 2YCJA 1M7PA 5HNUA 2ISDA 5MF5A 4DPQA 1XGEA 3MHUA 4PMXA 2QW5A 5EMLA 3VFCA 1J0IA 2C8NA 1L8NA 3TQKA 5JIPA 5AOUA 4OECA 3SCSA 4DWSD 5AYXA 4MY1A 5J5DA 2WSRA 4GMEA 2YPIA 4R7JA 3IJ9A 4IP4A 3QH2A 3SUVA 4JKMA 1GHRA 4CQ9A 4C6BA 3UNTA 2GJRA 1PKYA 4IMDA 4WY0F 1FWDC 3URAA 3TA6A 4CLMA 1GJPA 1XBYA 3EYPA 4JKKA 2Q8LA 3EEGA 3HV9A 3N6JA 4FIQA 4RX0A 3LI1A 3N73A 1JI1A 4Y9PA 3DAQA 2ZCGA 3WX7A 1XYAA 5FEPA 4WOZA 1P7TA 1SFLA 3S5OA 3MV01 1CXLA 4QAIA 1FKWA 4CN1A 5KITA 1ADOA 1VBUA 1DJQA 3T0DA 3VDCA 3TUUA 4FF5A 3BAXA 1XWYA 3DC0A 4PCTA 1QO5A 2GGEA 3B9EA 4S3AA 1TMLA 1U1UA 4FXJA 2EKCA 4LU0A 3CUIA 3RU8X 4PSRA 1GEQA 3AROA 2OTDA 2J75A 4S3CA 3ZJ8A 3XISA 3CMFA 1LG2A 3MB9A 4LALA 3QRHA 3WNLA 1RK6A 5C9ZA 2ABBA 5HQMA 3WJWA 2ZDRA 4HNTA 3K4DA 4QROA 1W32A 5CPLA 3VOIA 3XIMA 3WLSA 3CB8A 4K8HA 3BH4A 1MEWA 2BXVA 4O57A 4Z42C 4ZTYA 1ZBCA 2NXHA 3BAJA 1VS1A 4M7TA 3LHUA 1CBGA 4JOMA 4I3GA 4MAVA 3ZR5A 4ERGA 1SSGA 3CV7A 3IWPA 2H8XA 1W2VA 1XRFA 1EZWA 2HQAA 1AMYA 4K7YA 3SCTA 4QQUA 2Z0IA 3PUGA 3VI2A 4QXIA 2UWFA 5HQLA 3CUXA 4HU0A 2FLIA 3WQOA 2AGTA 4G8TA 2TYSA 3TROA 1JZ4A 4PN2A 3TYBA 2H9AA 1GOWA 2WSQA 1HJSA 1LOLA 1VENA 2A1YA 2YB1A 1S5WA 2GSHA 3ITOA 1SMDA 2YDQA 4DAFA 3GU9A 1PXGA 1XBVA 5LHEA 5LNRA 3UZXA 1IZKA 3WNNA 1WZAA 2G97A 2A3AA 2A85A 1L2UA 3VOCA 1S2WA 5DY2A 1CEOA 3CU2A 3TC3A 3VCRA 4ADUA 1VFLA 3M6YA 1OFOA 2GK1B 2W91A 5FACA 2PWGA 1UG6A 4XVDA 4NZCA 1QI0A 4Q4OA 1X38A 4UMAA 2NQLA 3MSDA 4J2PA 4RNFA 1XLMA 3DEQA 4HU4A 3UXLA 5H8UA 4AMCA 1R2SA 3UYCA 3PVFA 4LS1A 2WV8A 1DVJA 3B8IA 1OWQA 2D0HA 3LX9A 1E3ZA 3AXHA 2VT0A 3KXQA 2CPUA 3FA5A 3UG4A 4QE4A 1GOQA 2BXYA 3L0NA 4US5D 3V1HA 1UC4A 3LTSA 5HR7A 3FDKA 4CU6A 2PWDA 4PL2A 5C6MA 5LA2A 2Y7GA 2QXWA 3OA3A 3PBVA 4JTJA 4PBGA 1JPHA 1MZHA 4DJDA 3M7WA 4KCTA 3V36A 3MANA 2RDTA 4HTYA 3TOYA 3ES8A 4EPBC 2O9OA 3ARVA 3QHMA 1TREA 3P93A 1P48A 4LNYA 4TX8A 1V3MA 3IUHA 2D0FA 3IAPA 5ECVA 1XW8A 4FNTA 3WBEA 1LCOA 4PEKA 4Q8QA 2X42A 5EMYA 1P7TB 3QQ1A 2CKSA 3VCCA 2QJIA 5M3WA 3VK5A 3W3OA 4I6VA 1UR9A 1K6WA 2VOMA 3ARQA 4L1GA 1L0PA 4O28A 1VBRA 1IIGA 4B5TA 1B3ZA 3W1PA 2J7EA 4N02A 3ZZ1A 1H0GA 1G6CA 3EKZA 1JFHA 1OIMA 4ZQNA 5IDZA 1W1VA 2WBGA 3MWAA 3ZR4A 3ZO9A 3I4EA 1C8YA 2VZOA 5HA7A 1VH7A 4HTBA 5U4NA 1FHLA 4HHHA 1W9UA 1VIWA 1DWHM 4UCFA 1XSIA 1CPUA 4C6LA 4DF1A 1U5JA 4DAIA 4FMVA 5E0CA 4DO7A 2X1TA 4R33A 3UYIA 1WA3A 2C0AA 3CUFA 2DW7A 2P53A 3B0YA 3FY1A 4WEVX 5JVLA 1R9XA 1B1YA 3W7DA 4WF7A 1JAKA 1NY1A 4DVOA 4BQ5A 3KOXA 3QMRA 1OSEA 1I60A 1JUEA 2PC4A 3V5CA 2NX9A 3BQ6A 4XZNX 1DBTA 1TV3A 4HZ7A 3ZJ7A 2Z24A 3T07A 1ODUA 4AD0A 2H9AB 1CGWA 4QITA 3RLHA 3RRAA 3ARXA 2IS7A 4R5EA 3C5QA 2NQJA 4OJYA 3W1TA 4AEFA 1AQ0A 1W1B1 2BLEA 4A29A 1OJXA 3SR7A 5AC6A 2D24A 4XKYA 1ITXA 3LGEA 1WE5A 3LRLA 1GKRA 1L6WA 1Q7QA 4ZGYA 3PZUA 4GZEA 1I0BA 3LBCA 3R8RA 3CB3A 3GXPA 3IGUA 4IL2A 4OBRA 1XIJA 4DBWA 2CEQA 2YYTA 5AFDA 2B31A 1RZMA 2ZRXA 4X22A 4Z2IA 5JU6A 4IF2A 3WH6A 7TIMA 1M41A 2GWNA 2YW4A 1CGVA 1EA9C 1H1ZA 3HIJA 1A47A 1TTJA 5G1MA 3L4TA 3NOYA 4A05A 4UR8A 4JGDA 2PDKA 1JXJA 4TO8A 1SJBA 3U4AA 3UG3A 4NUWA 3STPA 3VA8A 3GIPA 1VP5A 3EX3A 3WUBA 3QMTA 4MG4A 3QYQA 1SFJA 2V5CA 2B7QA 2RUSA 3GUWA 3RO8A 3P67A 2WBKA 4ZO6A 2J8TA 4PUNA 1YLVA 4QE1A 3FLUA 3GW0A 2V5JA 2YCKX 3AQUA 4RV3A 4XWUA 5FAJA 1LL6A 3AAMA 1PE1A 3R13A 1S5NA 1BWVA 2O4MA 2NZLA 4N7QA 5K9XA 4DB7A 4HP5A 4C60A 3GNRA 3HPXA 2VX4A 4BFAA 1E4IA 4C6QA 1ZNNA 3HV8A 3TN4A 2P0IA 2VGFA 3E49A 1Z89A 2AQWA 3G1YA 3N34A 4J3WA 4LUTA 4XD6A 3KOWA 1PCKA 5H1WA 2R9RA 3A6OA 1FWEC 4WDUA 1AZ2A 4C6IA 2PDPA 1JZ7A 1ITQA 1K1DA 4AD3A 1XLKA 3TW6A 4AYSA 4HNOA 1EP3A 5D09A 1IT7A 2R94A 3SW6A 4V15A 4MB3A 2WZEA 2V63A 2ZRZA 3WMLA 3AJ7A 3NYDA 4MWAA 3M9YA 4NF7A 4NY2A 1GJUA 2W67A 4JFVA 3CLWA 2WNNA 3VKJA 2ISVA 4AZGA 1A3WA 2BX7A 3TQPA 3CZJA 3ZLGA 4B9YA 5HNNA 1SM9A 1HZYA 2FKPA 1X98A 1Q85A 2NUWA 4ZOEA 4AB4A 3Q45A 1O5RA 1JNEA 5LHFA 4HA0A 2XINA 5A8PA 1K9DA 3TLQA 4PMNA 1S5VA 4LOCA 2NQ9A 4H9VA 3FYOA 1F9CA 3HZ3A 4XKYB 1PAMA 4R3UA 1EF3A 1AMKA 3EWZA 4NNCA 4PRRA 1GPWA 5LNVA 3P80A 1SVDA 4DZAA 3M5ZA 4WDTA 1CWYA 4C90A 1NELA 1XL9A 4ZE5A 2Z6JA 1CW2A 4CNUA 4CEXC 1XQLA 1XH1A 2J7DA 3COTA 5A6BA 1K9EA 2DVTA 1RSCA 4L6DA 4RCXA 4IMEA 4GIEA 1XLCA 1KXVA 2F84A 2KX9A 3UJ2A 5D32A 1NF0A 3GHRA 2MNRA 3KX6A 1E6SM 3YPIA 2VVNA 4P5UA 2DQXA 3GAKA 3ZVHA 1SGJA 4NZ5A 4K2SA 1G4SA 1U5VA 4WSKA 1J2BA 2GLKA 3VINA 2V5DA 3OHIA 3M0XA 3AICA 1NQ6A 1Q5MA 4QDMA 4AY7A 3TTQA 5D2XA 8A3HA 4MNKA 1IXNA 4JYDA 1RD6A 2V5LA 3OODA 1ITUA 3ITVA 4UNIA 3UXIA 3SCVA 3EMQA 4C6CA 3IIVA 2PZNA 2EGZA 4QJ5B 3WUEA 2FVKA 3B3DA 3PZTA 3NZQA 3M07A 1E0UA 4HMDA 3TYZA 1PZ0A 4EWND 3AS2A 1J6OA 3SN1A 1KQYA 2NUYA 1C8VA 4H2HA 2OOFA 4Q8NA 5BU6A 4CNPA 2FZBA 1OGSA 1PL9A 4UOZA 2CNCA 2CLEA 2VFHA 4D6JA 3VGHA 3OLIA 3TSMA 4J2MA 4JL2A 2ZE0A 2XSXA 1XD0A 2JKEA 2NX3A 1F6PA 3APYA 4GIYA 1UZDA 1I4NA 1GW1A 3DYMA 2ZA2A 3CPRA 5CGQA 1KFWA 5F4XA 4AWEA 3FAXA 4WLCA 2OOGA 5G1YA 1ICQA 3AI0A 3V4BA 1O66A 3WQ8A 2XVPA 1BXBA 3GG8A 4LC8A 1MW0A 4LJ3A 3PJUA 2C6QA 3VABA 1UP3A 1TSIA 4MWAB 2J7CA 3WDQA 3G1FA 2F6XA 1BGGA 2VC5A 3E2QA 2O55A 4AIOA 1XLDA 5A6AA 3DYPA 3GYEA 4LV9A 4B5XA 2DT0A 1RBLA 2JFEX 4UZSA 4UFLA 2DSVA 1ZLPA 1UR1A 3APGA 5D2VA 2FH6A 4ACZA 1EIBA 1A50A 1ZU8A 2UY2A 1PZ2A 2WVVA 2BBFA 3MDUA 4QG9A 2JIEA 1B3VA 3BGJA 3DBNA 4S3EA 3A21A 4GGBA 5HR6A 4QLKA 1QPRA 3C8FA 5C9WA 3AZRA 2PD9A 3QW4B 2WC3A 3L23A 1JRCA 2BY0A 4H01A 3WQVA 4LY8A 2J74A 4DJFA 1VPXA 4UTMA 3AMDA 1PVNA 1XG3A 3G8EA 2XN0A 3W6LA 3W1MA 3RLGA 5GVJA 3KS6A 1XPGA 1LUCB 2YLLA 1POJA 3N3MA 2J24A 3LRMA 1S3TC 1R8LA 1LG1A 4ZEPA 1H7RA 1DWJM 3M0HA 3ZMRA 1LROA 3WF4A 4CD4A 3HG4A 1H49A 1N82A 1ZS2A 1Y5WA 4WIWA 3TEVA 4U28A 5GNYA 2C13A 4WGXA 1REQA 3DUGA 3QZEA 4Y7EA 2WZHA 4WD0A 4GXWA 3DHPA 3S2CA 1M01A 1L2QA 2Z1BA 2VM8A 1YXDA 3UERA 4JY9A 3SEPA 4EF8A 1KV8A 3VD7A 1Q3NA 4BHYA 3QZ6A 3VNDA 2H3DA 1V6XA 3K5XA 3U48A 3OBAA 4NX5A 3HFYA 1Q2RA 4YYCA 4YTRA 1V02A 4I9MA 5CLTA 5FI8A 3L5LA 4G7FA 3VUSA 5B7ZA 1XXXA 1RCXB 3GKAA 1C7TA 4RUBA 1XS2A 3R8GA 3SUTA 4ZMGA 3THCA 3VOJA 4WXYA 2ZUNA 4NAEA 2PAJA 1VPQA 1IZCA 1DXIA 4Z2GA 4NQ1A 3W23A 3TVAA 3PWAA 2E77A 4WKHA 2DU2A 1J18A 4KH2A 2BB0A 2OEKA 5I3FA 2DZPA 1R9YA 1OZMA 2C19A 5HK4A 1JDCA 4LAKA 1OD8A 2IPWA 2Y2WA 2PRMA 2OYLA 3UNDA 4Y9AA 5D4YA 4AHQA 3FOKA 3QW3A 3BVJA 2YL9A 4LF2A 4I5XA 3W84A 2YL8A 4ZQPA 5I03A 3SFWA 3EDKA 4PTXA 3PJXA 5BU9A 4UMBA 4F79A 4FNQA 1ONWA 1I2QA 5A94A 1W8SA 2CU0A 1MW2A 5KETA 4NI3A 2YFNA 5M17A 3KBNA 3NQCA 2VCBA 3I6EA 3TTSA 4B16A 4ZR8A 4ACZB 2ZXDA 3BCDA 4GY7A 3P62A 3WD3A 2W5FA 2DZUA 4PB3A 1CZ1A 1S2AA 2UZ9A 2BG5A 4Q8UA 5HMDA 3AXMA 1H5YA 3LK6A 4KFPA 5I24A 3QC3A 2VZVA 4R9XA 4YWIA 1GK8A 1JXKA 1YPXA 3UJEA 1ISVA 4JTUA 1XKJA 4S2CA 3PZNA 2Z26A 1UPPA 4UTWA 5C5YA 4M82A 2Z6IA 1GQIA 4C6KA 3T7VA 1UWIA 5DBTA 2CLOA 2PD5A 1A0EA 3INPA 4FHAA 1QBBA 3V5FA 4TQTA 4EF9A 5EBAA 2WZTA 1F61A 3U5UA 1REQB 2IUZA 3AU2A 1RCQA 1OIFA 4GO8A 3GNPA 2Z1WA 4IZGA 2WM0A 2ALRA 2A79A 2FB2A 4EXQA 4U2YA 1ODZA 1TV5A 2OEMA 2PB1A 4MLRA 4D6DA 4FAMA 2FTYA 3KL5A 4QBXA 4LUIA 3B06A 1TVLA 1ICPA 3DBPA 4JHOA 1QU4A 1S2VA 5G5IA 4JIIX 4B4HA 3L12A 3B8SA 3L21A 4BEUA 1S5MA 3OB8A 3KE0A 2V81A 2VELA 1R6WA 1AW2A 4KEMA 4W5ZA 3GNOA 3V18A 2Y85A 1IXQA 3NVDA 4IH3A 3WJYA 4OZOA 2GDUA 4URIA 4PTVA 4I7UA 4H6EA 4F3HA 4ADTA 3UPMA 1EB3A 3H22A 4KS0A 3HA1A 3HOJA 5AYYA 5I3GA 5DCBA 1O7AA 2JEPA 3W2MA 4V1YA 2RDUA 1U1JA 2FZMA 1ZRQA 2OODA 1GVQA 2PTXA 3CPGA 3DENA 4KGLA 2QZRA 1MQPA 3LI0A 3BCFA 3PB0A 3FYPA 1MVYA 2ZC1A 1TA3B 3RILA 2HISA 3GVVA 5D37A 5A6LA 4C6OA 3HPSA 5F2LA 3HQOA 4YVVA 3VE9A 1XR2A 3REQA 4DUVA 3PNUA 1SQ7A 4GI6A 1YBQB 1MWOA 5JMUA 1XINA 3GH5A 3T44A 5G2IA 2RJGA 2XIOA 4OV4A 4LB3A 1LTDA 4QS6A 3MMDA 5BWFA 3HB9A 4A3HA 5CZ0A 2Z2UA 4DZHA 4PC8A 3WMBA 1OGBA 1NM9A 3W9ZA 3EMCA 3BSMA 2FPYA 4ES4A 2NVCA 1AQHA 2PRHA 2OGJA 3GVWA 4N4QA 1JF6A 1TPEA 5CCZA 1TCDA 3AYVA 4HPHA 4PULA 3CGTA 4IQJA 3M5XA 3ITTA 2RAGA 3VD3A 5EL1A 4EAYA 1TO3A 3TR9A 5BXSA 2BV9A 1IXPA 1E56A 4ZQRA 5FL1A 3RX2A 3N6HA 3MP3A 4E3VA 1DP0A 1Q65A 3VD4A 3MUIA 3S5ZA 3W75A 4C6FA 3KRUA 3RM9A 3ZT6A 1EJXC 1P0KA 1W9PA 2VQUA 4HK6A 3W7KA 4J27A 4GNKB 3S2MA 2XG9A 3LMYA 2OVLA 1VLWA 3H54A 1UKOA 4H7VA 1HT6A 3CV2A 3OJGA 3H4XA 4TTGA 2ZFAA 3L5AA 3O3RA 2X8RA 1WDPA 1RHCA 3B8TA 4XSLA 2A7NA 3IRSA 1UD4A 3ANUA 2GL5A 1TRIA 5MKGA 3EGJA 1XLLA 1F07A 4O16A 5FJRA 4MWAD 3UGRA 1GVFA 4O52A 2XVKA 3CZKA 3ITGA 2DZTA 3AUJA 3EKGA 1XHGA 1ELSA 2OQLA 3NL6A 5C2XA 6TAAA 2PEVA 4UQ9A 1J8VA 5A69A 1DJXA 3NQFA 5TBOA 1JCXA 1AJZA 3SGUA 3PWGA 4P7NA 4NRSA 3PS7A 4J3TA 4ZQCA 2VHLA 3VIGA 2REQA 3BW2A 4O1CA 1JYWA 3M0KA 1K77A 3ID7A 4DY1A 2G3JA 4MNLA 3RLUA 4C6DA 4UTIA 4EXAA 2HDJA 3CJPA 5HJLA 1EQPA 1XYCA 1XH0A 1K8ZA 2I5IA 4MYAA 3E9AA 2HS6A 1CX9A 4DUXA 4XB3A 4PFMA 1DWFM 1RQEA 2F38A 3W22A 1XGZA 3TXZA 4AAJA 2CHRA 4I9JA 1BWKA 1E4NA 3MJYA 4GJJA 3TW9A 4CGTA 2BWGA 3MC5A 3LS9A 5A6BD 3BSHA 4Q4MA 2PWUA 1PUDA 3IGSA 2CLLA 3VGGA 1TIMA 1EGVA 2DPEA 3VIHA 3SY8A 4GCAA 1TQJA 1X1NA 3RYSA 4WKAA 3BJFA 3S1WA 4NXKA 3SBFA 3VIPA 2EJAA 4FXFA 4AW7A 1JCNA 3LM7A 3ARSA 4L9ZA 1SJAA 2PDLA 1EP2A 1X6NA 3G24A 4CU8A 4DI8A 4BI5A 3VOHA 1F8IA 2NVDA 3V0UA 3VIMA 3OGRA 2ZVRA 4BJHA 3G1SA 3MKKA 3OG3A 1S2TA 3DHUA 3ABSA 2Q6ZA 1K4GA 1HX0A 1MZRA 1AD4A 1HJWA 2XFYA 4LYQA 1WX0A 4DNHA 3MWCA 3LCXA 1EZ2A 3BMXA 5HWJA 1W91A 1LRNA 1EWDA 3RXZA 1OFAA 2OKTA 3UCQA 5LXEA 3SI9A 4UB9A 1G4PA 5I07A 1JUKA 2QEZA 2QGYA 3O05A 4O10A 2DSWA 1LORA 1LBMA 3FSTA 3DXIA 4P61A 2WXDM 1VFSA 4WOQA 3SCQA 3GY1A 4KFOA 3GH7A 4N6EA 4XIMA 3AXIA 1R46A 1JCLA 2FVLA 2FYMA 1ZB5A 1EEXA 1H7PA 4M24A 1JYXA 2R82A 1LWHA 1VQTA 4ERIA 1A5KC 2G4JA 3UG8A 1H41A 2XGBA 2OSXA 3MU7A 2CZDA 4MWAE 2ZUWA 4GBDA 3U8GA 2WK2A 4MOZA 4C5YA 1NU5A 1UOZA 1TX2A 1V5XA 4H6KA 1FWRA 4PL1A 2NWRA 5AY7A 4AEEA 1QK2A 3FNDA 1DHKA 3CZ8A 4I5RA 1SW3A 5MKGB 4V1XA 4D71A 3TMQA 4MPKA 1O1ZA 1XIIA 1JYVA 3ARTA 1EOMA 2EG7A 1U30A 3QSTA 4HU3A 1KTNA 4GWEA 3VIJA 1GTHA 2QDHA 1V6TA 4MF4A 3KRSA 1TZ7A 3LCGA 3VNZA 3H7UA 4MY8A 5DF0A 3W85A 2Z1SA 3NUKA 2RKXA 2REQB 4GY0A 1TRDA 3AS1A 1H50A 5L6UA 4XISA 4CNOA 4DF2A 3MSGA 1E0XA 2A3EA 1EBGA 3W01A 3GS6A 9RUBA 3FXGA 3RCMA 4DJFD 2AMXA 1AUSL 1TJ2A 3UCDA 1KBLA 3S5NA 1JZ3A 1KM1A 2BXZA 3NEHA 4IPNB 3WLLA 1OYBA 3CAKA 3P2VA 3BTNA 3UP8A 3GXIA 4PMJA 3W37A 2BOGX 4O50A 2XM2A 1R86A 4ZENA 4GXMA 4FSAA 1PKLA 1ESWA 2V0TA 3PNZA 4LCQA 3NL3A 7TAAA 2OWWA 2XN1A 1X7FA 1OY0A 3SSJA 1BKHA 4FLQA 2AKMA 3H2OA 1JCMP 4ML9A 2J9ZA 2BMBA 3ALFA 4U5IA 3W7HA 2GDVA 3R79A 4CKQA 3VIFA 3LRKA 4EAMA 4A35A 1DJHA 1UP2A 4E8DA 1LQ0A 5BNKA 2IMRA 5FEZA 4OT7A 1S2UA 3LZ5A 1OK6A 3ZYZA 2YBVA 1B2YA 3EWYA 5DY3A 1J0HA 2TODA 1FWWA 5AZ0A 1PBGA 4WJ8A 4BKNA 2DZSA 4NL1A 3NZPA 3AXKA 2CZ5A 4IIBA 1SSDA 1IR2A 5CLWA 1SZEA 3G1HA 4F0MA 2NT0A 4YN5A 6ALDA 4GNJA 2G3MA 2PU1A 3F4NA 2ACUA 1ZQ5A 3N2XA 2C91A 2FHFA 3VZZA 2HS8A 5A2AA 1YXYA 2GVYA 4GZJA 2V6AA 4WSHA 1IE7C 4L65A 1QAPA 3I3DA 4QCFA 1JR1A 4ZB0A 2Z27A 4I5UA 1P6BA 4W9TA 1ZAJA 2QF7A 2J7BA 3WYZA 2OT1A 4AWTA 1DTNA 3M0VA 4B3LA 1BF6A 4AEOA 2XVNA 3SRKA 3PC0A 3OGVA 1SW7A 2DW6A 3O63A 4XBSA 5AHIA 3TMLA 1VCVA 2PDYA 4RV8A 4H9UA 1QI4A 3TV8A 3KTXA 1VFTA 5LIUX 2E3ZA 3A12A 4DNMA 1W5MA 3A9BA 2HXUA 2FGLA 2WLZA 3QR1A 3NPWA 3EX2A 4EK7A 1LRQA 2EHHA 7PTDA 1GGOA 2ALDA 4K7VA 1NWUA 3WJSA 1GVYA 1IIHA 3GSMA 3FDGA 3BAKA 4A2RA 4YTSA 1C29A 2XVGA 1HP4A 1LOSA 2VRJA 3OTRA 2F2HA 3TU9A 3GKFA 2PRLA 4E4PA 4XZBA 2PLCA 1JDFA 4JL1A 5D30A 3VNYA 3UJFA 3R0KA 3W7JA 3PANA 6ENLA 3TN6A 2EKGA 2GUUA 3C4UA 4R53A 1V0LA 1DQUA 1MEHA 1HJXA 3WH9A 3LERA 3PSVA 4LEFA 2QVNA 3M6DA 1FCUA 1F6KA 2PBGA 3QV7A 1BKSA 1UKQA 3SDOA 1G01A 1W3TA 2XZ7A 4P8XA 4EP8C 4MB1A 2DFAA 1WV2A 5BROA 1HKWA 2Q8ZA 2FGZA 1G4EA 2PDNA 8RUCA 3JW7A 1UH4A 2QCGA 4R34A 3WNKA 3CO8A 1C9WA 3LNMA 4HQVA 3WLRA 3K13A 5LSMA 1FTXA 3N9RA 2I16A 4R7WA 4ZO8A 5I3DA 3PG9A 5A8GA 3VX0A 3WL0A 2X1SA 1F4AA 4E2BA 2GDQA 4RE4A 1M7JA 2XH2A 2DEPA 4AZIA 4O4WA 5IOBA 1M1BA 1M3UA 5I0DA 2B7PA 3CIXA 1KM0A 1XJBA 4E38A 1UA3A 3P8IA 3LSBA 2QJGA 5HMFA 1V02E 2WSKA 3P0WA 3DFTA 3P7YA 3N2TA 5T91A 1QI2A 5K3VA 1MMFA 4FPSA 1ML1A 3VIOA 3W1QA 1A4MA 3SB0A 1J79A 4E8CA 2PTZA 4NSBA 4CQDA 1MYRA 4M1BA 1R3SA 2QAFA 3VD9A 5E9AA 4UOQA 3SO7A 3WLJA 1PWLA 2A7PA 3POHA 2ICSA 3DI0A 2C1HA 1J96A 3NURA 1QDSA 6TIMA 2HPMA 1T7LA 1E72M 1K03A 4IQEA 2YXGA 4YVPA 1MUMA 1JD7A 2QUTA 2DT2A 5D9PA 3EX6A 4Z2HA 4PE8A 4LB4A 3G6MA 4CNNA 3NQMA 3SJ3A 4XZLX 2WC7A 2G50A 1XV8A 1JAEA 1UWUA 5M03A 1JIBA 1FWTA 4D6EA 3EEZA 4S38A 3DX5A 3XINA 4FNPA 1QNSA 1BQGA 1QWGA 5TNVA 2FFIA 1J6PA 2J13A 4GPNA 3KS5A 1E9YB 1E0WA 4KEZA 3LLDA 4UTLA 5CC3A 3LU2A 3IEBA 3RF9A 4E0CA 1V7YA 3WBYA 2DQWA 3RGTA 3CTTA 1ZTVA 1ZUAX 4XO6A 2XU2A 1N7KA 2RFGA 3EKLA 3K8LA 1MUWA 5BMWA 4AIEA 3C2FA 1YNPA 3EB4A 1J0ZA 3VDGA 4QJ4B 1LBFA 2OB3A 3L7RA 3BLFA 1UUOA 3VMOA 4JCLA 2DJLA 3MYOA 3VMNA 3RHGA 3QR0A 3CUGA 4JTQA 3P82A 4IGMA 1DJNA 3ZOAA 5JQ9A 4KWVA 3I7SA 4KBXA 3RR4A 2VR2A 3IV8A 3F2BA 1Q7ZA 3EDFA 1FY6A 1ZBVA 3MHFA 1ADSA 4HYVA 4AC7C 1MXSA 2W27A 1UUQA 4IUOA 1KM3A 4M19A 2IKHA 1HGYA 1GKQA 3TYDA 4KIRA 5AHLA 4MB5A 3W83A 4HN8A 4RDZA 2PLKA 2J7FA 1W1ZA 5IFPA 3A3HA 4F9DA 1Z3NA 2TAAA 1NP0A 3WLOA 1O95A 2CHNA 5KZMA 2OO0A 3D3FA 3N4EA 5E9XA 1DE6A 4M6QA 2BY2A 1TJ0A 2CLMA 1MXGA 4JIEA 3IGHX 1TWIA 2EPOA 4RPPA 1GYNA 4MADA 2E5DA 4ZZ9A 1EHAA 2C71A 4QG6A 4OV9A 3UXKA 3EAUA 3U0HA 2ZZ1A 2GJXA 1BGAA 1W5NA 1KXQA 4WKFA 3OVGA 1ZALA 3BDKA 3EOLA 1RCOB 1EJUC 1Q45A 1OFRA 2PF0A 2NV9A 3W7LA 4HNLA 5BRPA 3F5JA 4WCJA 4Z17A 2WQDA 1EJSC 2ZDSA 1NOWA 2QKFA 1FHUA 3M0IA 4JIPA 2QCNA 3PHAA 4UIOA 4LYKA 3KL3A 2WM1A 3PZ9A 4IJCA 1U2YA 4KT2A 4QLLA 4ZSTA 1WBHA 1VBJA 5M5DA 1EFZA 2OEJA 2Z2BA 1XYLA 1O12A 4JZ5A 1YTDA 1HKIA 2DH3A 5BOFA 4H8HA 5CZKA 1LYXA 1FUYA 3W00A 1SR0A 4F2UA 3ELFA 3PBYA 1A3XA 4GLEA 1J0JA 1EJWC 5C0QA 1KNWA 1PX4A 5IBXC 4TR9A 1R5YA 4CU7A 2OZ3A 1XSJA 3A3WA 4XG1A 1WKFA 5BXPA 5IRPA 2DZBA 4KCWA 1FDYA 3DKJA 3TR2A 3USZA 4J35A 3I6RA 4LAMA 3EOSA 4A21A 4NZ3A 1QMLA 2HXTA 4XAPA 1E4LA 3GE7A 3VNMA 4KW2A 3C2YA 1WXZA 2XIMA 2BDQA 1RY0A 2Z1XA 1G5AA 3ANYA 3AC0A 3GD6A 3W1AA 1FWBC 1V77A 1DORA 3EWWA 1DJWA 4C1NA 1KGWA 3PUOA 4QR6A 4AD5A 4PUEA 4CNSA 4LAUA 1CECA 3VUPA 4LVGA 1B5TA 1K7FA 2V9DA 4GQRA 2J88A 5CZJA 2AMGA 3M47A 4E6MA 3E1F1 3CM4A 1LLZA 2PLMA 1OG0A 2DP3A 3B04A 4GGHA 1DYSA 5E0FA 4MFDA 5HDRA 3VKCA 2Y5JA 3MYPA 4GC4A 3IJQA 1UD8A 3S42A 4HA1A 1P4CA 4TU1A 3J7HA 2VEKA 1SUXA 1CCWB 4H4IA 3R6IA 3Q67A 1WZMA 5DMNA 3M0ZA 4O8RA 4P8WA 4CQBA 1EC8A 3GNDA 3MBFA 4K39A 3PFMA 2CZVA 4F2TA 2XTKA 3CL7A 1AL7A 4PTMA 1FFRA 2QJNA 4HCHA 4W87A 2ISWA 5C7VA 3SRFA 5HPOA 3N1AA 3DFOA 4HMEA 3LHWA 4GI8A 2OKOA 1ENUA 1ZP4A 1YMYA 4F0HA 2WAGA 5JBEA 2BY1A 3DOPA 2GJXB 1XCFA 3NO5A 4B5WA 3FHAA 1VEMA 3IUDA 1QNQA 4KRTA 1GNXA 1EDTA 4JDBA 5EGRA 1H4PA 2WZIA 3GXMA 3S0CA 4AVOA 1F3WA 4AHPA 4PODA 3G0UA 4GIRA 4B5UA 4Y9OA 4W93A 4GCXA 1WP6A 4LBUA 3EWUA 1UJQA 2A3LA 5D8ZA 3KCOA 4E2OA 1XC6A 2V5BA 3MZ2A 4BZYA 3UWZA 1VB9A 5REQA 4PMDA 4RNHA 4UQEA 4ACYA 2CBJA 3GNNA 3AYSA 3TCEA 5H8MA 4FA3A 1CGUA 4RLIA 4K1WA 4XD5A 3IS4A 4Z2KA 2GQ3A 3CYVA 4HSOA 1XYBA 2ACQA 3E02A 4F0KA 5C2GA 2JEQA 1IQ8A 2JE8A 3EDEA 3GDBA 2WMIA 3WD0A 3R94A 1UZ4A 3WQEA 1R3VA 1XBZA 3LNPA 5HWMA 3UETA 5A2BA 4AYGA 4G7EA 2WZMA 1LM1A 4DZ5A 2X0YA 4ECLA 1H3GA 3UJRA 3AIQA 4CD7A 3QGAC 3QKEA 2BHYA 3LPPA 1H60A 3LM3A 1FH8A 4U10A 1KWKA 2VFIA 1XLEA 3P3BA 3CH9A 5CC7A 1SJCA 2FJKA 1RPXA 4M81A 3T9PA 3TK7A 3AYRA 2ZZ5A 4JYEA 2ZWZA 1KFBA 5CZSA 1P6WA 3UD6A 1AD1A 1TWSA 4HZMA 1TR1A 1SR9A 3MSRA 3ANVA 3UVIA 4XIAA 1L6FA 1GWJA 1ZCCA 2FGBA 3A4WA 1G67A 4J4KA 4KFNA 1FWNA 3BGAA 3OLDA 2FHCA 3ICJA 3ABRA 4JHMA 4W8AA 5XINA 3S5YA 3O15A 1W56A 2P76A 3UWUA 1BD0A 1Z6KA 4LYPA 3IJLA 4JHZA 1KB3A 1MQRA 2W61A 4XZIA 4A8RA 3L4YA 2BY3A 3TTYA 4PCFA 3O0KA 2EG8A 4AIUA 5LXXA 4FZIA 2XGIA 1P0EA 1I6NA 4YTUA 2P10A 3WQWA 4LCSA 3VKKA 1DKWA 2OWCA 1OBAA 2ZC8A 4GK8A 3ALGA 2A6LA 2E40A 3D46A 3S9ZA 3H7VA 2INZA 4JFTA 3LQLA 2YX0A 3ES7A 1S3HA 1EEPA 1GQKA 2BP1A 5K4ZA 7XIMA 5GJMA 1VZWA 4R88A 1VFMA 1XCWA 4QX4A 1H1NA 3SM0A 2V2HA 3RFAA 1JCJA 3WIJA 2YW3A 3WF0A 4R85A 1OHLA 2W92A 1JUBA 2CZEA 3LTYA 1Q7MA 3DG3A 1MI3A 2A7RA 4MZYA 1GYMA 2RJHA 5LNWA 2OSWA 1YPIA 3DZ1A 5E1QA 4IX0A 5AVHA 4GIAA 3NM1A 5C54A 4PTWA 4W89A 1XM3A 3CK5A 5DFAA 3DU0A 3MVIA 2ACSA 1QVBA 1UR0A 3QC0A 3GZAA 1FP9A 3UR8A 1NDZA 1DJGA 4EPEC 2J9YA 1X8CA 5D04C 1XISA 1ZJBA 4Y9NA 2YIHA 3KP0A 3RITA 1RPKA 2QDEA 1MDLA 3KLKA 2J9XA 3O6CA 2VYOA 3GFYA 3KVKA 3CEUA 4H9XA 3TX9A 4B4FA 1S1RA 4L1XA 2EPMX 2OG9A 1WYIA 4R27A 4QGCA 4MNJA 4LF1A 2HSAA 1NP2A 4DI9A 4S2BA 1JYNA 3LXCA 2X1UA 3IRDA 2XGZA 2WMIB 3GC2A 4FLRA 5D33A 3H26A 3DGBA 2G3FA 4AD1A 4JQAA 4G7EB 3N11A 2QCLA 1PDZA 3SZ8A 1V3IA 2E9MA 3SUSA 2DORA 3BLEA 4ENLA 2CZFA 4G56A 2X1RA 3B8DA 3TP4A 4X0NA 4TVDA 5FF0A 3W28A 4PUUA 4XBJA 5HWNA 2CLKA 3AHXA 4Y6GA 3GTIA 3KTCA 2QLYA 2VCAA 3PZOA 3WLHA 3CAVA 4NZFA 3WFZA 5J04A 1TV8A 2CBVA 2WVSA 2ASHA 3CTLA 1NFPA 3DYOA 3AMLA 2W62A 2CITA 3E2SA 3STGA 4GABA 2FZDA 4ATDA 1E40A 3IJIA 4XSMA 1I1XA 2ATSA 4Q7BA 1XLGA 3NQ8A 5E6ZA 4ATWA 5IHSA 2NXGA 1PKNA 1YTEA 4IPJA 4MM1A 4Q4KA 5I23A 4DM1A 2E25A 3LCFA 3A5VA 5D02A 5M2FX 1KFLA 2Q71A 4ORMA 3II1A 1CXKA 1IEXA 2WNZA 4J40A 3U7BA 3VC6A 4QTGA 3FYYA 3K4AA 4L4LA 4Q8WA 3N18A 4AZ5A 3SECA 2CESA 5DELA 3ISIX 1BSIA 4LUJA 4JTSA 4JTLA 4Z2JA 3P84A 3FVMA 1R47A 3AIWA 2ZZ3A 3MKCA 2Y88A 3UWEA 1BAGA 4GZ7A 1M03A 4D8ZA 3AHYA 2ZZ2A 4HSNA 4DLMA 3TH6A 1A80A 2Z25A 1I75A 1BEUA 1C3FA 4HA3A 2VURA 2OSYA 2OWXA 5KEZA 1R38A 1XQKA 3NWRA 1V3JA 3S1GA 3NVTA 3TZFA 4TIMA 3FS2A 1WPCA 4AMAA 2GQ9A 2I5GA 4DJEC 1A5SA 2DIEA 2ZVIA 3H55A 2IPFA 5CG0A 1RLCL 3NPUA 3NPXA 1HKKA 1EO5A 3S6TA 5K9DA 3I3EA 2SFPA 1PZ3A 2PWHA 4AISA 1GQNA 3KBJA 4O1BA 4BQ3A 4B3KA 3G3MA 4UWMA 1JZ6A 3OLEA 5HAOA 5HJYA 1Y5XA 2YB4A 3SUWA 1QRQA 4JFWA 1ECEA 2QMJA 2I7GA 2VGGA 1H1YA 1F7BA 5A6SA 2AAMA 1OB0A 3C0QA 4GXPA 3WD4A 3E0FA 3LBOA 1PCWA 2ONEA 1E6ZA 1TVNA 3TC6A 4QDWA 2W79A 1AW5A 3GO2A 4UUIA 1L6GA 1MFVA 1YADA 3TYUA 4CQCA 4HNCA 4HGXA 3C56A 4HVXA 1FH7A 3HFTA 4ZCWA 3FIGA 4CCCA 3AS3A 1O5QA 3K46A 1E1EA 4K36A 1GVIA 4JTKA 1RBOB 3U6WA 1NFGA 1W37A 4LUYA 4MHBA 4F0RA 3IIXA 4P2VA 4GUFA 4KRZA 1DJZA 5FSEC 1TFVA 2XWDA 1YKWA 3VYLA 1JDAA 2GSJA 3GXTA 3VILA 4YIWA 4OHQA 1ITCA 4R9OA 2QDDA 3IVUA 3HU7A 1FXPA 4Q8TA 3HQNA 1OFPA 3KP1A 1Y0EA 3H6OA 1J2WA 2ESCA 4Q8OA 1FWGC 4WRHA 4GINA 5FOOA 1PTGA 3WMCA 1HO1A 1Q4WA 3H23A 4ZA0A 5SWUA 1EUAA 9CGTA 1A5UA 3VVGA 3GHUA 3HTWA 4E8GA 2XIIA 1VLIA 3QJAA 3LG3A 2YA2A 4JBRA 1TPC1 2Y61A 1S1PA 4TVUA 2OX1A 1HIZA 3GB6A 3O1NA 1IZJA 4Y96A 3VC5A 4I6KA 3HGJA 3WELA 1KRCC 2WPBA 3FJ6A 5FEXA 1Q6OA 3T8QA 2DIKA 3MQTA 3T42A 1A5AA 3ABOA 2D20A 1EKOA 3LHYA 3MMTA 3GFZA 4KWUA 4UQCA 3KL0A 3WDRA 2VP8A 2ZE3A 5I02A 1Q6EA 4AWSA 1Z7AA 4Z1YA 3S4TA 2DT1A 3DCPA 4NJGA 3TFCA 2E09A 1Y65A 3WLIA 4AZCA 1WCGA 1IV8A 4IIDA 1XIMA 4PB4A 3T08A 4BWLC 2ZIDA 4LTSA 3LOTA 4PUMA 1VEPA 4YXGA 3W2KA 1E15A 5LGZA 4XD4A 3KZPA 3C3UA 1FWCC 1WB0A 2WLYA 4UQAA 1QASA 1JZ8A 4PCSA 2FJUB 4ILSA 1A5NC 2Z4GA 1K9FA 3LENA 4PMOA 4G5DA 1R2TA 4LEQA 3S8HA 1US3A 3QV8A 3DHFA 1AH3A 4FLOA 3GHSA 2DSZA 1L6YA 1LQAA 2C3ZA 2CHOA 3B0XA 5I5RA 3BV4A 4R7OA 2TSYA 1UZ1A 4O0QA 1CB2A 1UJPA 2NVAA 3AS0A 3ZM8A 4DUOA 2RGMA 3GRIA 3HN3A 4X63A 2E6YA 2PU0A 4YVXA 3RJYA 3O8AA 2XVLA 4ICNA 4A4AA 4I8YA 2DJXA 4WR3A 4IFKA 1E6QM 4MSSA 1RALA 3LTPA 4FALA 2ODOA 1ICSA 3W1LA 2IKIA 1UCWA 1RQHA 2P0OA 1OT2A 2J47A 4NYYA 3PULA 4YCOA 3W7PA 2D2GA 2YCLA 5EYWA 5ABFA 5EMJA 5IFTA 2WMFA 1LP6A 4P7QA 1ME9A 1F3TA 3GM8A 3QHOA 1V6UA 3M43A 1VHNA 4KQNA 3VAVA 3C0SA 3ZLFA 3RPTA 3H21A 1UBSA 3I3BA 9XIMA 3THQA 3LCIA 1LWIA 2OLSA 1LLOA 4H04A 4J3SA 1Q2SA 1M7OA 2Y89A 3UWVA 1G9HA 1JULA 2R1MA 2I9UA 2E6DA 2ACRA 3R2GA 4O15A 3WDHA 4C6JA 4KGJA 3L0GA 3EWXA 4EIVA 3H2FA 1CXIA 1ZZMA 3B97A 3GVQA 4K37A 3VNKA 3E3HA 5T26A 1RV8A 3EA1A 4Q8MA 1KKOA 3NDZA 2CIPA 5CH9A 1E3XA 3R8HA 4GACA 4YHEA 2CFFA 1KW1A 2QPSA 1IWPA 2VC9A 2E4TA 3WBAA 4Q33A 3A9IA 4L4PA 4GYFA 1AW1A 4HU8A 3CV6A 1YIXA 4MUPA 3T55A 1ME7A 3GDRA 1A5OC 3BLKA 3BLDA 4J5NA 2IKGA 2QT3A 1R2RA 4WJXA 3TTOA 1PTDA 1TJRA 1DPMA 3M64A 3W2JA 1JDEA 1GOIA 3M16A 1RK5A 3LXAA 1OX4A 5IM51 4W88A 5TF0A 1H7OA 5AECA 3K1DA 1EA0A 3K2GA 4AZCB 2J27A 5JBDA 1R30A 1JCYA 1LWJA 2ISFA 5B80A 4ZXLA 5CGMA 4Q6JA 3ECQA 3LCHA 2NLYA 2UV8G 3M5VA 2ZX5A 2AL2A 1F2JA 4U33A 4B90A 3DESA 3TIMA 1HL2A 3G0SA 1XLFA 1PDYA 5J5RA 1EPVA 3VKDA 3R58A 2XFRA 1R7OA 3H12A 1RY8A 5LIYX 3CEPA 1POKA 2XWEA 3PG8A 5CPTA 5AYIA 3VGFA 1CENA 1QOQA 5CZTA 1EQCA 2Y8KA 3AO0A 2XJ7A 3NPVA 5FF2A 1FCVA 4Q3MA 2XYLA 3N3TA 3P74A 2O7SA 3P8JA 2RHGA 4RXGA 1W9BM 1K4HA 1UR3M 4S3BA 5I00A 2FZ9A 3MO7A 4LSBA 4M7SA 1KD0A 4U5KA 1UUMA 2C1IA 3KAOA 2P8BA 3WK1A 4IFKB 2X05A 2R24A 3LBMA 4GOAA 3GUGA 4IQDA 8XIAA 1OF6A 1M5WA 3OU8A 3THAA 2XM1A 2R14A 1QHOA 3LLXA 3ABXA 1MEIA 2YCLB 5ABFB 3I65A 4BI6A 1EDQA 3TC7A 4DZIA 4RL3A 3DG6A 1RH9A 3AALA 3KUMA 1US2A 4DWDA 3GQYA 4HB7A 4EX