5BMWA

Crystal structure of t75v mutant of triosephosphate isomerase from plasmodium falciparum
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYVGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Probing the role of highly conserved residues in triosephosphate isomerase - analysis of site specific mutants at positions 64 and 75 in the Plasmodial enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 99
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5bmwA00
2X30A 3SGUA 3N9RA 4LOCA 1VJIA 2RDTA 2QJGA 3MP3A 1AW1A 1EX5A 1K8YA 3O6YX 4IMCA 5EPDA 1ZAJA 3BARA 4OV4A 2ALDA 2R94A 3M5ZA 4OV9A 1ICQA 4Y9AA 2H3BA 3LM7A 1T8XA 3LBMA 3F03K 4MLJA 1H7NA 2ZRYA 4CLMA 2A7NA 1DBTA 2CWNA 3STCA 3W7EA 3BW3A 2TRSA 3CLMA 3TR2A 3O1NA 1VH7A 1VRDA 4XTIA 3VE9A 3P67A 1B3OA 4JTJA 2Z2UA 2NX1A 5AOUA 2H3DA 2Y7DA 1YXCA 1W0MA 3ABSA 3THAA 3C2RA 1IF2A 3G1HA 3LCIA 4NJGA 4UNKA 3OA3A 1G4EA 5FF0A 3G3DA 3S1UA 2EAWA 4O28A 1ADOA 2TPSA 4K36A 3O05A 3KFTA 1KM0A 1G67A 4UTJA 3EEGA 3I68A 4JTTA 5D05A 1WOAA 2B7QA 3CEUA 2CLIA 2J9YA 4MZYA 5BRBA 5K2ZA 1SO4A 2QUVA 4MZ1A 5K9CA 2QAFA 2QCMA 2R14A 3W71A 3HG2A 2QKFA 4O1DA 3W7DA 3YPIA 1RV8A 4QQ3A 3NQEA 2J27A 2W79A 3LV6A 3EWBX 1B57A 1J2WA 1EP2A 1A5BA 4JX5A 2Y88A 2QEZA 4L4LA 3KVKA 1YADA 1V5XA 1EUAA 3GAKA 3NQVA 3CPRA 4ZQRA 3TCEA 2PCQA 2GVJA 3BG9A 3DHFA 5FI8A 1YDNA 1C29A 2O7SA 4WOQA 1AW5A 2JGYA 2VFIA 5EL1A 3W7PA 4TIMA 4UMCA 1OX4A 1SR9A 3E0IA 5LKYA 3WK2A 3PSVA 3INPA 5AYYA 2B7NA 3UWYA 5BMWA 4PODA 2J9ZA 4O18A 1SO5A 4Z1CA 4D2JA 2ZRUA 5HWNA 1OK4A 4AF0B 2Y62A 3IIZA 1LRNA 4K39A 4XKYA 1MO0A 3P80A 1ZAIA 4U28A 4FX7A 3L5LA 4N4PA 4QITA 4IJBA 4YXGA 3I7RA 2J6XA 4GE8A 4LTSA 4R33A 3RNDA 5I3GA 3OVRA 3S8HA 2QCFA 1OABA 1YPFA 4NNBA 3W7KA 5FEXA 4YCPA 1QPQA 2ZA1A 5HUOA 2DZSA 3ANYA 3EWYA 3CC1A 1R46A 1PE1A 1FWSA 2DZUA 3M43A 3HB9A 2ZRVA 1GTEA 3G1FA 4MJZA 5C5YA 4IQLA 3N19B 4AXKA 4UTMA 3QMSA 1H60A 2Q8LA 3IIXA 3S1XA 4RK8A 1F74A 4WY0A 4O1BA 2Q3OA 4NU7A 1P0KA 1VCFA 1I2PA 4RLIA 4WX2A 3GYEA 2Y7FA 2NXGA 3FEMA 3BVJA 3MHUA 3MUXA 4HNTA 1SZGA 2D73A 2FTPA 3ZR4A 1M6JA 3W3OA 1P5BA 1FDYA 1W31A 1XXXA 5T26A 2OT1A 3RMJA 3W1TA 1TRDA 3N14A 2JKPA 3G24A 1I4NA 5G2WA 5G4EA 1LDCA 5BNKA 1KFLA 1OFRA 1WBHA 1RPXA 3W1NA 2Q8ZA 4JTLA 3UWQA 5HUPA 1H5YA 4A2RA 1JUEA 3KVMA 5F1VA 2C6QA 1SQ7A 2VELA 4IMEA 4Y6GA 1B9BA 2W0UA 3R2GA 2NX3A 1M5WA 5F2GA 4MYAA 2PE4A 3RU6A 1H7PA 2C3ZA 1R47A 2BZNA 1W3IA 3GVGA 5AHEA 1Y0EA 1RQEA 2ZDRA 1PCWA 1TPH1 3CIXA 5L6UA 3UWUA 3P5ZA 3W7HA 4A29A 1CI1A 2OX1A 3N3MA 1TREA 3DFSA 3UD6A 3A9IA 3W87A 3TFCA 2DZPA 4XTDA 5HQEA 2H6RA 4RZ4A 4E0CA 3V75A 4JX4A 5CZJA 5DN1A 3M16A 1TJPA 3MI2A 4BI5A 3W7IA 3NDOA 5D02A 3KRUA 2QR6A 3QF0A 4PC8A 3IRDA 1J4EA 5HWJA 3IGUA 4FNUA 3LCWA 1O94A 4I7UA 2DZTA 4PA8A 5AB3A 4YMZA 4I7VA 2ZRXA 4DO5A 2O7QA 4UTTA 1W54A 3GK0A 4NNCA 2ZQ0A 2YFOA 3EKLA 2OZ0A 2I9EA 3SFKA 4O12A 4AWSA 5CZSA 3NL2A 5FF2A 3DH7A 4WY0F 4IOTA 3T55A 3RK8A 2VC6A 3LTSA 3WJXA 1K7FA 1SO3A 1W56A 1KTBA 2YYUA 3QQ1A 1G7UA 3TQVA 3NAVA 4OBTA 4ONVA 3G22A 3NQCA 5KSWA 3TXVA 1TTIA 4JTSA 3EWWA 3T7VA 3O63A 5HMSA 1I2QA 3G1XA 1JULA 3DBPA 1RQHA 1TV7A 4FXRA 2A1YA 1KBIA 2G96A 5LNUA 3E9AA 3ABRA 4E2DA 1HO1A 3STEA 4MKNA 1X7FA 1FCQA 5CSRA 1A53A 1U83A 5G1TA 1G69A 1TSIA 3HJZA 3BW4A 1EIXA 2F84A 1WOBA 3TV8A 1FXPA 3QQ0A 1F7BA 5AYXA 3IGXA 4K8HA 3W74A 4HNVA 5K9DA 1NF0A 3SJ3A 3KHJA 2PRLA 3LTYA 3IIPA 3GDMA 5K7JA 4R53A 4DPQA 4JDBA 5G1YA 4NZFA 3TSBA 1ME7A 4O8RA 3UY8A 5K4XA 1JRBA 4LS0A 1MEWA 3JR2A 3EWUA 3P61A 1IGSA 4Z08A 3G0UA 3VCRA 4AHOA 2VENA 4ZVJA 4EVZA 3HIJA 1OHLA 2A5HA 3LLFA 2NUWA 1H7OA 3P84A 3NNTA 4JDYA 1YXYA 2ISWA 1ZFJA 1OX5A 5CPLA 1TCDA 3W22A 4O1AA 2GVGA 3P5YA 3UZ5A 2X1SA 4FIRA 5IM51 1SPQA 3EX3A 4IGHA 1O60A 3UY7A 4FHAA 4M7TA 1LRTA 1S5TA 4C1KA 3MW7A 3N2XA 1OF6A 2XN0A 1H7XA 3P7YA 4KFNA 1QPOA 1TTPA 3NL5A 5AHIA 1JJKA 3VKJA 1AL8A 4HKPA 2HSAA 1AMKA 3S5NA 3W76A 2QCDA 4BK9A 1BTMA 1IIGA 4JR5A 3G1SA 1R2TA 1OX4B 2GPTA 3TNOA 5EYWA 2BWGA 5CPNA 2PRHA 1AK5A 4H4IA 3TJXA 3D0CA 1QR7A 4MZ8A 2GQAA 4J9JA 2RKXA 2QCGA 3NZRA 1G4SA 2AQWA 2ZZ2A 4N4QA 2NZLA 1OFBA 3B8DA 1CX9A 2WNZA 4UFLA 4HPJA 3BLIA 3A23A 4X9SA 3TC6A 1ML1A 4XKYB 2ZZ4A 3NR0A 3DI0A 1TPWA 1D3HA 3L5AA 1H50A 3ATYA 1VPXA 1S3HA 4GFSA 3FJ6A 2A7RA 4LVGA 3OBKA 2V81A 4GWEA 1P4CA 5HR7A 1H7RA 4GNJA 4NZJA 4N6EA 2GJNA 3S1VA 5LGXA 5D2WA 4LWWA 3DXIA 2V5BA 4BI7A 2Z6IA 4O0KA 1QFEA 3PULA 5KZDA 1GYLA 4UTIA 1G4PA 3W88A 3STFA 1L6SA 2EGZA 3BW2A 4WY0B 3SECA 3NQ6A 2A0NA 5KMYA 3STGA 2C16A 2VEKA 4O16A 4R34A 3NQGA 4TO8A 3THQA 2TSYA 3CWNA 2OT0A 3NPXA 3CU2A 4O54A 2V9DA 3LRLA 1TRIA 3NPVA 2NWSA 1AG1O 2G97A 2NXIA 5CSSA 2DZWA 2HS8A 3EX4A 1OYAA 3O6DA 1W5OA 5KZMA 4AEOA 1QCWA 2CLFA 3EWZA 1LP6A 5K3VA 1YTDA 1F73A 1F6KA 2QJIA 3PR2A 3I7SA 4Z0JA 2BXVA 4JY9A 1XBXA 2Y85A 1I8JA 2E6DA 3NEVA 2ATMA 3WK1A 1DQXA 2B7OA 2C1HA 2E6YA 4UUIA 3IEBA 4CQ8A 4TX9A 2E5CA 4E38A 3LV5A 3LCHA 1F5ZA 3W7NA 3RFAA 2H8XA 3AJXA 1FWWA 2ZZ5A 3R89A 1QPRA 3PWAA 1F2JA 2VFEA 3H54A 4KKXA 3G8RA 3LCLA 3MYOA 4GUIA 3P8IA 4PL1A 3DFQA 4Y96A 5E93A 5LNRA 1DJQA 1VQTA 2UV8G 4IX2A 3AO0A 3M5YA 3FA5A 2CLLA 3CEPA 3NXFA 4AB4A 1TV8A 5I3FA 2CLMA 5F4SA 5DCBA 5F4WA 2VFGA 5DCEA 2BSLA 4FNTA 1MXSA 5A5WA 1SFLA 1KLZA 4N2YA 4O17A 3TQKA 1UB3A 3EXTA 2YDAA 2E68A 4BF9A 3TIMA 2RDWA 5D2XA 1DV7A 4RCXA 4QSHA 1ME9A 4IPJA 1KFCA 3W7CA 2QJHA 3G1DA 2YW3A 3W7GA 1W5QA 1VYSX 2WSRA 4JNMA 3L66A 1K3UA 3GDKA 3PG9A 5DY3A 1ZNNA 1LBLA 4JTFA 3W7MA 3DKLA 5C55A 1TYGA 3H55A 4UTUA 4FNPA 4LW7A 2EPHA 5HWMA 4NJJA 1L2UA 4ZQPA 1LLWA 3PF3A 2QUUA 1MEIA 4N6FA 1QO5A 5TQLA 1VHNA 1XBVA 1ONRA 1SSGA 3W2MA 3W1LA 1KM6A 4MIMA 3GKAA 1VZWA 1GG1A 3TU9A 4HN4A 4UMBA 3LRMA 1K8ZA 3DGRA 4K7VA 1TPFA 1JUBA 2VEPA 3QW3A 3TKFA 3SSJA 4ZQMA 5H91A 3OIXA 3LLDA 4FF7A 3W2KA 1JCLA 3QMRA 1C9DA 5C54A 1UUOA 3G8EA 4QAIA 1O5KA 1B4EA 4UFHA 2ZA2A 3E02A 1U5JA 2FDSA 1Q6QA 3EXRA 5D2YA 1DJNA 4CQ9A 4MY8A 2GVLA 2VEMA 4ZL1A 5FEPA 5KTLA 5ABTA 4JYDA 1LLZA 3OHIA 3OVPA 5BMXA 2BX7A 3L0NA 2Y7EA 1N55A 3FJLA 5D03A 3KVLA 1KFEA 3JRKA 4LS2A 4LUIA 1L6YA 2E09A 3SY5A 5LNSA 3W72A 1GVFA 4HPXA 4OWGA 3GXNA 4O15A 1KTCA 3W1UA 1WX0A 1FUYA 4XUGA 3W2LA 2C0AA 5F4XA 5I3IA 2PRMA 5LHFA 1GVOA 4TMCA 3BK0A 3B04A 1N7KA 4K38A 4Z1DA 1WA3A 5LGZA 2RFGA 4IXHA 3BLFA 4LVBA 1N8FA 4BI6A 1FCUA 3GXTA 5DLCA 3C2OA 5J5RA 4WOZA 3W7RA 4HSNA 3SR7A 3NQMA 3PBUA 4IWWA 2BLEA 3W75A 2Y7GA 3MHFA 1L9WA 1VCGA 2YW4A 3I6RA 3B0PA 3S9YA 1HTIA 2QCDB 4RV8A 5I3KA 1JVNA 1NVMA 3LHZA 3TH6A 4GUFA 4M19A 1TIMA 3M9YA 4CCCA 1T0OA 3O07A 1GT8A 5LZLA 1WQ5A 4O11A 4BFAA 4HNUA 3TE9A 2HTMA 3BLEA 2FJKA 3QSTA 3GZ3A 2GOUA 3G1VA 3TK7A 1OFQA 3E49A 4A22A 1JCJA 1UJPA 3C6CA 4Q32A 1K02A 3NO5A 5KINA 3UXAA 3WJZA 2CZDA 1TQJA 1Q6LA 1ME8A 1WBJA 4IXXA 1FQ0A 2QCEA 1W1ZA 4RZ5A 1XBZA 4FNRA 1XDLA 1KV5A 4AWUA 2AGKA 1R2SA 1VC4A 3FIGA 4XZ9A 3TW7A 4O50A 1GJPA 3RF9A 3DU0A 4FNQA 1BEUA 4UIOA 3GDTA 2X16A 3B06A 3QYQA 1ZHAA 4K37A 2J24A 1EUNA 1D9EA 3P74A 4BWLC 4ZQNA 3F1QA 2R91A 3MYPA 3W85A 3EB2A 4JX6A 1G7VA 1JUKA 3PSWA 2OCZA 3T44A 2FQIA 5FF4A 3Q58A 4NVTA 1PCKA 4Z1AA 4Q4KA 1XDMA 3MJYA 1JCYA 3UWVA 1EWDA 2Y63A 4G1KA 4EF8A 4P2VA 1W8SA 3NA8A 3PY2A 3A21A 3S5ZA 1XFBA 4GUHA 3FOKA 3QPZA 4LVFA 1H61A 5TBOA 2I14A 2VOMA 5FF7A 3ABQA 4UMAA 3DFOA 4MLRA 4H6KA 5F2LA 4WZHA 3M5XA 3EKZA 5LSMA 1KFBA 3TSMA 5DELA 3W86A 1J5TA 3HPXA 4OT7A 4LT9A 4PEKA 1SU5A 3DFNA 2GJLA 3R13A 1XI3A 2QF7A 4NJIA 1PL9A 4K7YA 3L21A 1RVGA 1XKYA 4JIQA 4N9DA 1JCXA 4GUGA 2YZRA 3L67A 5DY2A 2WOQA 1TJRA 3P82A 3QW4B 3HPSA 3LBCA 3VFLA 3C2VA 1QMLA 3C3NA 1GVQA 3QRHA 1VGAA 3GR8A 4MFEA 3OEXA 5IBXC 1XUUA 7TIMA 2CFFA 2TMDA 3NOEA 1A5AA 2QDGA 6ALDA 4CCDA 3KX6A 1C8VA 1OX6A 1GYNA 2QDHA 3QPYA 1VR6A 2EHHA 2E77A 4XBKA 1KW1A 5A8GA 3G0XA 4LVAA 4FX6M 1ZALA 2P1FA 3C0JA 1JQXA 4Q33A 1Z42A 5AHNA 4FX8A 3C4UA 4UTWC 1FWNA 5J5DA 4AAJA 1W3NA 4JICA 4K6AA 5DBTA 3QMTA 1LROA 4UTKA 1EP3A 2Y6ZA 4WUIA 4GC4A 5K4ZA 1SZNA 3NG3A 4DF2A 1W5NA 3A5VA 3M6YA 2DJLA 1ALDA 1K7EA 2B0MA 2IQTA 3HGRA 4OE7A 1I2RA 2E5BA 1TPB1 3I7QA 2E5DA 5AHFA 3PG8A 1GWJA 3MHGA 3UNDA 1LOQA 2XN2A 1LTDA 3SW6A 1I2OA 4GRSA 3NQFA 3M1ZA 3GR7A 5DXXA 4IX0A 4P61A 1P0NA 3L0GA 5D09A 3USBA 2CZ5A 1OYBA 4S2BA 3FS2A 4AF0A 1O4UA 3HGJA 2VKZG 2WNNA 4IMDA 5D33A 3LHUA 3A5FA 1LOLA 2QAPA 4FEZA 3NL6A 3W1AA 2NX9A 4KFPA 3PB2A 1Q45A 2V2DA 2H90A 3HG3A 2V2CA 4O10A 3TFXA 3DZ1A 3W1MA 3O8AA 1ICSA 5BOOA 4AMAA 4IMFA 3GAYA 2H8ZA 4DO4A 4RX0A 3VI2A 2X2GA 1Z41A 3ABOA 1GG0A 3RLVA 1R2RA 1AW2A 5FESA 4NJHA 1EWEA 4AHQA 1BWKA 2OJPA 2XN1A 4LRTA 5EA9A 3LRKA 1WXJA 4UFMA 1PHWA 1NSJA 2Y61A 4FIQA 3A24A 3T40A 3F4NA 3W2UA 1X1ZA 1NF7A 5KITA 5F2MA 3MMTA 2GUUA 3M5VA 4TU1A 5GVJA 1VS1A 1HG3A 3L5MA 1MZHA 4ADUA 3VNDA 3SI9A 3Q37A 2P0OA 3WJWA 5CPMA 3GDLA 1TMHA 4MVAA 1KFJA 3B03A 3BGGA 4ADSA 4MYXA 5HINA 4LVDA 1DOSA 3KVJA 4Y90A 3PBWA 4JYEA 4OHQA 1K7XA 1HUVA 4EWND 4ALDA 2DZVA 3NPWA 2RHGA 3IIVA 2WQPA 3KRZA 3KOFA 3S5YA 4FB7A 3P60A 4OGZA 3ZS4A 2Y70A 3G18A 2ZFAA 3PAJA 4JGDA 5AHMA 3W70A 3NQ2A 1CW2A 4CCEA 3L0KA 3NL3A 3QFEA 1QDSA 5I3HA 2QCLA 4O0ZA 4X3ZA 1H1YA 1I45A 3WFAA 4N02A 3IV3A 4AVFA 4M7SA 1W5MA 2DU2A 4LV9A 2QCHA 4DQWA 1QPNA 3FKRA 4X2RA 3C61A 3P62A 4IMGA 5U7SA 1DORA 3W2NA 4Z0SA 1EP1A 3ATZA 4DEFA 2CLKA 4LUJA 2JKAA 1WV2A 2FB3A 1EPXA 4CNPA 1ZENA 1XC4A 4N9EA 3QSRA 5D32A 2CZEA 4Z1BA 2A85A 1YXDA 4A21A 1PHQA 2JBMA 2QUTA 4O4VA 8TIMA 4K8EA 5AC7A 3DENA 3LHVA 3JS3A 2ZA3A 3R5EA 1LCOA 1Z44A 4RKAA 3DHDA 5D37A 1F05A 1TPUA 4MUZA 2C19A 2ZYFA 4S1FA 2YSWA 3TSDA 3MP4A 4JTIA 2VEIA 1BWLA 3TQ0A 3FLUA 1QOPA 4S2CA 2NV1A 1IXQA 3WJSA 3C2EA 3IVSA 5E1QA 4CNNA 3UXDA 2NUXA 5C6MA 4O52A 4O13A 3B0UX 1RR2A 3TAOA 5D38A 2ZCGA 4FXSA 5FEZA 2ZBTA 5EBUA 3C8FA 1Q6RA 2EF9A 2AAMA 3PUOA 4O1CA 5EMUA 1SW0A 3P81A 3HO8A 3QH2A 5CZ0A 5AHLA 3N2MA 4E2BA 1FBAA 4IPIA 1H1ZA 4KFOA 5EKYA 2ISVA 3LTPA 1VYRA 2FFCA 2YGYA 4NJKA 1ZJIA 1LZOA 2DZXA 3NQDA 1H51A 4N9CA 3LCFA 1YDOA 1NAL1 3C2FA 2X1RA 2WSYA 3PB0A 3PS7A 3PM6A 1W5PA 3DAQA 4DBDA 4QIUA 2JK2A 2V30A 3DFTA 3TUUA 1KM5A 4NNAA 1OFPA 1KA9F 2WJZA 4UTHA 3FFSA 2I1OA 3ZFHA 3TA6A 3NYZA 5F2IA 3RLUA 3P8JA 4DO6A 1LOSA 4M5PA 1FY6A 3WK0A 2EKCA 3G0SA 3V1PA 1M7OA 1DKWA 3GLCA 4WQ6A 3QC3A 2G5WA 4PH6A 1D3GA 4LV4A 1MEHA 4PCFA 1YPIA 1VHCA 3LXAA 3PC0A 4M6QA 5AC8A 3LCXA 3BV4A 3I65A 4LS1A 3IVTA 2V8ZA 3NM1A 3TC7A 2RDUA 3FYOA 3CHVA 1UBSA 5D2TA 4B5NA 3NQAA 3M41A 1ZY9A 3KRSA 1FWTA 5AN7A 3S5OA 5F1UA 1LM1A 1OYCA 1H62A 3M47A 5FEWA 1GZGA 1G6CA 3ELFA 1TTJA 2FB2A 1UUMA 3TAKA 1YYAA 3BO9A 3NZ1A 2WNQA 2CZFA 1H63A 2FPYA 3MI6A 1JCNA 2ZZ7A 4MJMA 4O53A 4JS3A 3N34A 3GX9A 4WXZA 1TB3A 3CWOX 4U4MA 3W6YA 1RQBA 1KM4A 1GVSA 3GIYA 4UTTC 4JEQA 3ZWTA 1QWGA 4UXDA 1TV5A 1OFOA 1UASA 2ZZ6A 1R30A 4HT3A 1WDWA 2PC4A 3LERA 3QEZA 5CGQA 1XUZA 1LBFA 1SZFA 1SW7A 3LGEA 3OVQA 4JTHA 1KM1A 5L9FA 4FO4A 5CKSA 1LBMA 3O6CA 1XM3A 5BW6A 3WK3A 2LLEA 3T4CA 4O57A 3L2IA 3HMJG 3W23A 3LI1A 2ABAA 4GXMA 3MWAA 3T78A 2DJXA 3PUDA 1OVDA 5AFDA 4O4WA 4HNNA 3N73A 5KZEA 1EB3A 3QZEA 5G5IA 1RZMA 1WAUA 3CB8A 2B4GA 2Y89A 1LORA 2WPBA 1FDJA 1K8XA 3PVFA 4DELA 3TMLA 1RD5A 1T96A 1KV8A 1SUXA 4WJEA 1A50A 1E51A 2OMAA 5G2HA 1ZAHA 1B4KA 4TMBA 1F76A 2R8WA 3HGSA 4EOUA 3O06A 5G4WA 5TIMA 4ZQCA 3BGJA 3UYCA 2X1TA 4JTGA 3HOJA 3IGSA 5G2IA 3M44A 3CQ0A 4PL2A 3OG3A 1IIHA 1KLYA 1NEYA 1G4TA 2ISSA 2XFWA 3E12A 1XCFA 3W1RA 3HPZA 1HO4A 4RJEA 2KZHA 1YLVA 3BPWA 1DVJA 3W84A 4PFMA 4CQAA 3NPUA 2YCEA 3HG5A 4XQ6A 2V82A 3Q94A 4JIPA 5DXYA 5U4NA 4C1LA 2V2HA 3UQNA 2QCCA 3W07A 1KM3A 2YXGA 3O16A 4A3UA 3B4UA 5HR6A 4OU1A 3DFPA 2VFDA 1QAPA 4QISA 3QM3A 1PV8A 1TO3A 1GQNA 1M7PA 2ZZ3A 2VFFA 3HG4A 4NXSA 1O5XA 2A2IA 4O14A 2Z6JA 1GTHA 4QJ1A 4LNYA 2V0TA 3NQ7A 2ZRWA 1SZEA 1QNVA 3M7WA 1PIIA 3UPBA 1H7WA 2E6FA 3KXQA 3B0VC 4NQ1A 1X6UA 4JYFA 5CZTA 1YDVA 1OF8A 1KFKA 3GXPA 4I9AA 3BG3A 3NGJA 1YTEA 3LHWA 5EY5A 3W7QA 4ZZ9A 5MHBA 4WD0A 4ADTA 2P10A 2WV8A 1HL2A 3FKKA 2A4AA 4LY8A 1S5WA 4MOZA 1O95A 4EIVA 2GQ8A 1Z48A 2YYTA 4JN6A 5D2VA 4HIBA 4FNSA 3W1XA 5LNVA 1XL9A 3NQ8A 1GEQA 1W37A 2ABBA 2YFNA 4HSOA 5K9XA 1LRQA 1SO6A 3CTLA 4GBUA 1XBYA 1UCWA 4ZQOA 2NWRA 1SFJA 2WSQA 3W83A 4LC6A 3TW6A 1I2NA 2DP3A 4NX0A 1AL7A 3LXBA 5C2XA 4ML9A 4YL2A 4NUWA 3SZ8A 1F6PA 1BKSA 4JTEA 3S0CA 2X1UA 4UTLA 3WJYA 5D30A 4DPPA 1DQWA 3LI0A 4KWVA 4ORIA 3S6DA 3UZJA 4UC5A 2V5LA 4TR9A 1JRCA 2FPTA 2F7FA 3UPWA 3TXZA 2FIQA 2NLIA 3G1AA 5E0KA 3MBDA 1IXPA 3U2OA 4RR4A 3TMQA 2VFHA 1FCVA 4L4MA 3BG5A 1SW3A 1OJXA 3MO7A 4RXFA 4NT0A 1OFAA 3LHTA 4DXVA 3TJLA 3G1YA 3K30A 1T99A 2PURA 3ZWSA 2ZZ1A 2CLHA 2JKEA 2BTMA 1ZCOA 4UR8A 3TDFA 3W73A 4IUOA 3C56A 1VYPX 4YCOA 4YLWA 1VLWA 2W6RA 1PS9A 1EA0A 3LB0A 2E6AA 1GPWA 1OFDA 3GNNA 3TROA 2CU0A 1IXNA 3HGOA 3W9ZA 1HFBA 3VE7A 1FWRA 5DCDA 1FXQA 2A7PA 3DI1A 2J9XA 4JD4A 1V7YA 3EX1A 1W3TA 4QM1A 3U6WA 2G95A 1X8FA 2JGQA 1JQVA 4MY9A 5HJLA 4YWIA 3U8GA 1VLIA 2YX0A 1PVNA 4MY1A 1P1XA 1L6WA 2VXNA 1VCVA 1K03A 3CIWA 1OFEA 2J88A 2CLOA 1Q6OA 3HF3A 5H2ZA 3GKFA 4MFDA 1GVRA 2A6LA 3NM3A 3NVTA 4EF9A 4POCA 3Q2DA 4CNOA 3EX6A 4M6VA 4RXGA 4MPQA 3M0ZA 1NFBA 2HMCA 2FPVA 2E1DA 3G3MA 4DF1A 3PUEA 1YTKA 4XBSA 4AHPA 1GOXA 4M6PA 4PTNA 4BWLA 1TQXA 2Q3RA 1TTQA 4W9TA 3UWWA 3LCGA 1FCBA 2B7PA 3UWZA 4Y8FA 2NUYA 3MP5A 4H3DA 3W7OA 5LHEA 1OK6A 1WYIA 1X1OA 3IIOA 3R8RA 2C14A 2ATSA 4UFKA 1QO2A 3N9SA 3W7LA 4AWTA 3QJAA 3LDVA 4GJ1A 3L65A 3LX9A 3KAOA 3PBVA 3O15A 2ZRZA 5FF3A 1ICPA 1DL3A 3IVUA 5D04C 3F4WA 5I3JA 3R12A 4LU0A 1JCMP 2CLEA 4O19A 4HHPA 4UNLA 5SWUA 3LHYA 2NXHA 2ZTKA 1TPVA 4UFJA 3GB6A 2RH9A 3CT7A 4OQVA 4A2SA 3SIZA 1QOQA 2YPIA 3B05A 1TPEA 4GUJA 2A21A 3EX2A 3L9CA 4DF0A 1S5VA 2Z0IA 4ORMA 1KBJA 1EEPA 3EWXA 4R7JA 4X22A 3EXSA 4RZ6A 1MSSA 4JTKA 5IBXA 3A22A 5AC6A 3C52A 1TPC1 5HULA 2C15A 2TYSA 6TIMA 2C13A 4I7WA 4ZMGA 5CPOA 3L68A 1KM2A 4LRSA 3PBYA 3LOTA 2ZTJA 4WXYA 1THFD 4UTWA 2C18A 3W2JA 1SSDA 3E96A 2QCNA 2Z1BA 5DBUA 1DHPA 3S42A 2FLIA 4N9BA 4BR1A 3DKJA 1FDZA 2YR1A 4NXKA 3SGZA 4AH7A 2NV2A 4LC8A 1IXOA 4QNWA 1A5CA 3MBFA 1LYXA 3S1WA 2GQ9A 2CW6A 3GNDA 5AYZA 4QNEA 2A6NA 1Q3NA 1A5SA 3W7JA 3CM4A 2HS6A 2WO5A 3FYPA 2DORA 5LNWA 5HNRA 5CG7A 1OG0A 3HQ1A 3LXCA 4JY8A 3TX9A 3HBLA 1FX6A 1TPDA 4DBEA 4UCGA 4NX5A 3MI3A 4XWUA 3GDRA 2WKJA 4KWWA 4UFIA 4UR7A 3H53A 4JXCA 4JTUA 4ICNA 3W1PA 1KTNA 1JR1A 3W1QA
chains in the Genus database with same CATH superfamily
1EF2A 2EG6A 1MNZA 3I4KA 4FR1A 1X7IA 2QDEA 2INFA 4IIBA 2RDTA 3MP3A 2NLYA 4HNCA 1K8YA 1Q6FA 3FJNA 3M5ZA 1T6MA 4Y9AA 3W6MA 2H3BA 3LM7A 5B7ZA 3LBMA 2VC9A 3F03K 1HNYA 1NELA 2KX9A 2ZRYA 2W27A 2CLPA 1DBTA 3PJXA 1I0DA 5H8PA 3W7EA 3O1NA 4XTIA 3R7MA 1ELSA 5AOUA 1YXCA 2DSWA 4L6OA 2F61A 4ZSUA 4UNKA 3H2MA 3OA3A 3A12A 1G4EA 1HN1A 5FF0A 3P93A 4CU6A 2BBFA 3S1UA 4JQ3A 1ADOA 1UD3A 4HMNA 3N4AA 3O05A 5GJNA 2PU1A 3UJSA 1EC9A 3EEGA 2ZUUA 5C9WA 3N6HA 4IGMA 2CLIA 5BRBA 5K2ZA 5ECUA 1A5KC 3PTKA 1PTGA 1MUCA 2QAFA 2CPUA 2QCMA 4UB9A 2WVUA 2PD5A 1F8MA 4JIIX 3U2EA 3E2SA 3GYCA 4DVOA 1UC5A 2BY0A 3SCOA 3GW0A 4QEEA 1M1BA 3WLPA 1J2WA 2VZUA 2QEZA 3GG1A 4KETA 3KVKA 1LWHA 1FOBA 3GAKA 1ITCA 3M64A 3PZGA 3Q4DA 2PCQA 1E4IA 2FGZA 2Y24A 4PMUA 4F8XA 3AICA 4EXBA 3DIPA 1WE5A 4TUFA 2O7SA 1EKOA 3N6JA 1BVWA 3N3TA 5EL1A 1OX4A 2EO7A 3WK2A 4GYPA 2VVSA 5AYYA 4HP5A 1XC6A 2B7NA 1PB0A 2J9ZA 4O18A 1L0PA 4Z1CA 5T91A 1S1RA 4JQ4A 2ODOA 1U2YA 2IPFA 2D2HA 2J8TA 2Y62A 1LQ2A 3RG6A 1DXFA 4X2PA 1KC7A 4NZCA 1EHAA 4QITA 4PCPA 4IFOA 1R87A 1F6YA 2XM1A 4DXXA 1XYMA 3GBEA 1ZQ5A 4OOZA 1UC4A 4A3YA 1UD4A 2GUYA 3B97A 1KQZA 4Q4QA 3EOSA 2WB5A 3EWYA 4L65A 4D1JA 2Q8XA 2DZUA 4Q7IA 4A8LA 1E1EA 5CBBA 3S2JA 2OG9A 3PPFA 4WCJA 3UNTA 4UTMA 3QMSA 1H60A 2Q8LA 3S1XA 4RK8A 4JPGA 4O1BA 1KRCC 1P0KA 3RM4A 1XLIA 5CSYA 4CQDA 4QLJA 4HPGA 2WVVA 4RLIA 4WX2A 4DI8A 1DTUA 4AFYA 2Y7FA 3KCJA 4MAZA 3MUXA 2D73A 2VEFA 2XH4A 4U10A 2E8YA 5T26A 3RMJA 3VOHA 1ISYA 3N14A 2JKPA 3G24A 3AAMA 3EPNA 5FJJA 3ALFA 1OFRA 3W1NA 4AZCA 4JTLA 3H23A 4A2RA 1M7JA 1OADA 5E0FA 2EJ1A 2VELA 2RGMA 4Y6GA 1B9BA 4GD0A 3VNLA 2NVDA 3MMUA 2OWWA 3KBJA 1K4GA 4PE8A 4L56A 4MNKA 4TXEA 2XSXA 2BDQA 1H7PA 2C3ZA 2WPGA 1R47A 3F7JA 1U1HA 2BZNA 1W3IA 3WLOA 1HL9A 1K9DA 4H8NA 3CIXA 3URQA 2GYIA 3FDKA 1QNPA 4L9ZA 1QWKA 2I16A 1TREA 2FDMA 3UD6A 1B5TA 3W87A 1FWAC 3WLHA 3PPGA 5JH2A 4E0CA 1E6XM 5CZJA 4US5D 5FSEC 1TJPA 1CB7B 2PTDA 4MAVA 3MCNA 3W7IA 1UR4A 5D02A 3PPCA 3VINA 3IRDA 3K46A 1J4EA 2ISFA 5HWJA 1GPFA 2XZ9A 3UCQA 1AH4A 4Y8EA 2BOFX 3CS2A 1V93A 4TX8A 4YMZA 1ADSA 3E3HA 3WH6A 2ZRXA 4DO5A 4IQJA 5CBJA 4NNCA 8RUCA 5A6BD 1T41A 1FWBC 2YFOA 4V15A 1J6OA 9XIAA 4O12A 4AWSA 5BXTA 1PSCA 4V1YA 1Y5VA 2QT3A 3VCCA 5CZSA 1DJGA 3DG3A 3DH7A 4CUCA 4Q8VA 2P8CA 4HZMA 3LTSA 1SO3A 3O7UA 3S3GA 4PR4A 5HOSA 1FH8A 3R4IA 3MT1A 1TIWA 2P76A 3NQCA 5AYIA 3TXVA 3BCJA 5I2UA 2CKSA 2GDUA 1TV7A 2YLLA 1XLFA 4YTRA 1CXHA 1R3TA 1FCQA 4XD6A 2VGFA 2PZNA 4EXQA 4DUVA 1G69A 3HJZA 3WZ0E 3BW4A 3AWOA 3AXMA 3WQ8A 3QQ0A 1ISWA 1BSLA 4F3HA 4K8HA 1IQ8A 3W74A 1TR1A 4PUEA 5HPCA 3DFYA 5G1YA 3KL3A 4O8RA 5K4XA 5DX7A 3VZYA 2NT0A 1X6LA 3D46A 3WMBA 1IGSA 3M4HA 1LG1A 1CDGA 2PWGA 1NWSA 2VENA 4GNKB 3GHUA 1FTXA 3H7UA 2QF8A 2D22A 1YXYA 2ISWA 8CGTA 5CPLA 4O1AA 4FIRA 1SPQA 4IGHA 3UY7A 5CLTA 1LWIA 1S5TA 2GVYA 1OF6A 3V36A 3AZTA 1FWDC 3QTGA 3CIVA 4YYCA 3KTCA 1XCWA 1QPOA 3LPFA 4L4OA 4NAFA 2XH7A 3NL5A 4AIBA 4NIRA 2GDVA 1AMKA 5J8LA 1XG4A 4BK9A 1BTMA 2WXDM 4F0SA 3B9AA 2HK1A 1XGDA 4Q4PA 1OX4B 2GPTA 2GWNA 1E9LA 2VTFA 4V33A 3LG3A 3LGDA 4QEHA 1GVYA 5HJYA 3I4EA 1F4HA 1Q6CA 1YRRA 3NZRA 4F2UA 5DMLA 3DC8A 2ZZ2A 3RLGA 1CX9A 4Z2HA 3WH5A 4UFLA 3LPGA 3TC6A 4Q7NA 5CSUA 1ML1A 3SSZA 2G0WA 1A3XA 2VMFA 2TODA 4E8GA 4J28A 2EG8A 3DI0A 1D3HA 5XIAA 1H50A 3PBGA 5FKYA 2GFTA 3ATYA 1VPXA 4H6EA 1S3HA 4LJ3A 2IPWA 2XIOA 4GI9A 3FJ6A 2ZX9A 3DG6A 2FZ9A 4LVGA 3KEHA 5EGRA 3CAQA 1P4CA 2PLMA 4DIAA 1BD0A 1DWAM 1OZMA 4GH1A 3N11A 1V3KA 1PKNA 2GJNA 1HKMA 4LWWA 1XLLA 3WG6A 3DXIA 2V5BA 4BI7A 4GYKA 4GO9A 1QFEA 1XIHA 3PULA 5KZDA 1GYLA 4UTIA 4LUYA 3R0KA 2EGZA 3SECA 2DH2A 1RSCA 2I7GA 1S39A 1U30A 2AAAA 2WVVB 3NQGA 1NWUA 3THQA 3FAXA 4TVDA 3F4CA 2ZE3A 1CXKA 2BASA 1LQ0A 3HTWA 3BLDA 1R7AA 4FS9A 2GJPA 2NXIA 3AMLA 3AU2A 3ANVA 3E0VA 3M0IA 1W5OA 4AZCB 5K3VA 1ZBWA 2QJIA 2FHBA 5HPOA 3FXYA 3KWSA 1OY0A 2Y85A 1I8JA 2E6DA 1KGWA 2EPOA 3KBMA 4CQ8A 4HK5A 3LV5A 1J0KA 3OG2A 1GQLA 3H8AA 1F5ZA 3W7NA 3WNPA 1F9CA 2PDQA 3RFAA 1K6AA 1J5SA 1QPRA 4KCVA 5HQLA 4KKXA 3G8RA 4F0RA 4MADA 1ZB5A 3P8IA 4W5ZA 2OXNA 4FOUA 1VQTA 2UV8G 4MWAD 3M5YA 3FA5A 2PFHA 3NYDA 4HU3A 3NXFA 1TV8A 1IEXA 1HJVA 4JQAA 3SURA 1E3XA 1E0VA 1GUVA 1K9TA 4KERA 3D47A 2OZ8A 1QUMA 3N9KA 3W6LA 1UR3M 1KLZA 4O17A 3TQKA 1O5RA 1U5HA 5FL0A 2YDAA 1X1NA 4BF9A 2Y4SA 4JBRA 4C1NA 3VA8A 4RCXA 2OODA 1FHVA 1ME9A 1MUMA 4IPJA 3W7CA 2QJHA 2CBUA 3W7GA 4MM1A 4XISA 2A79A 3U5YA 2QMKA 3PG9A 3WNOA 3GHRA 3W7MA 3DKLA 3WDIA 3CK5A 4FA3A 4FNPA 3E38A 2PI6A 3CO4A 3TQPA 1IT0A 2PWFA 1DYSA 1OCNA 2Z1SA 3PF3A 3FA4A 3SUSA 4NHVA 3BANA 2WQDA 4B5TA 2CIPA 1XG3A 3W25A 1CXLA 3E1F1 2BODX 1XRFA 1JYVA 3UERA 2VZVA 2QJJA 1VZWA 1GG1A 3POHA 4L4PA 3BSGA 1K8ZA 3DGRA 1QXLA 1SJDA 3F2BA 3LQLA 3MZ2A 3SSJA 4PUMA 1S2TA 4J27A 3LLDA 4FF7A 1Q65A 3SCNA 3PHAA 1C9DA 1E55A 2G8ZA 4DZHA 1XGZA 2UY4A 1ITXA 3MO4A 4QAIA 4C7GA 3E02A 2FDSA 7PTDA 1Q6QA 3EXRA 4L6DA 5A6AA 1FP9A 5EFDA 2HVMA 2GVLA 1CYGA 1JF5A 3GFXA 1Q6EA 5FEPA 1QI0A 1LJYA 1IWBA 1LLZA 3OHIA 1XYZA 3OVPA 3L0NA 3LPPA 3FJLA 4IIFA 4F40A 1LUCA 1KFEA 4BEUA 1J11A 1KXHA 3GH7A 4LS2A 3SY5A 4BQ2A 1ESWA 1GVFA 4GZEA 3E0FA 4HPXA 3W4RA 2WMIA 1KTCA 3W1UA 4XUGA 3F5JA 1A5OC 3W2LA 5I3IA 3UXLA 3RX2A 3U57A 3BK0A 1N7KA 4Z1DA 3IWPA 2WJDA 3BLFA 1ISXA 3GXTA 1YX1A 1FRBA 5AC4A 1MFUA 2O0TA 4OTKA 4NAFB 3I10A 2O55A 4ZOBA 2YW4A 2UY5A 1R7OA 3ES8A 2E25A 1NVMA 4XD3A 1KCKA 3NUKA 1Q7ZA 4YTSA 1OCBA 1Q8JA 3QLDA 1HL8A 1TCMA 1W9UA 2PTYA 4KWSA 1GT8A 5LZLA 4C6JA 1WQ5A 4O11A 4HNUA 2Z28A 1XIMA 4PUNA 3C3UA 2HTMA 3CUGA 3BLEA 3N2CA 4PTDA 3QSTA 2GOUA 1T7LA 4AVNA 1H0GA 3MUY1 1Y65A 1K4HA 1TQJA 2XWEA 1YPXA 1WBJA 4IXXA 3V0UA 1FQ0A 1W1ZA 4RZ5A 5D9PA 1XDLA 3TW7A 4DJDC 4Q3MA 4LUSA 4UIOA 4IPPA 3DX5A 3QYQA 1OCQA 5I07A 1D9EA 2V3DA 4GPNA 3CZ8A 2R91A 1JUKA 4XZHA 2XJ7A 2OCZA 4PCNA 3F2CA 3T44A 4M1BA 2Z1XA 1H11A 3BLKA 2HZGA 4Z1AA 3IK2A 4Q4KA 2I17A 1UWAA 1XDMA 3M0MA 1EWDA 3MQTA 4EF8A 4EX4A 1W8SA 2XZ7A 3R43A 1XFBA 2I56A 1H61A 1MW0A 1TWIA 3EOUA 3IANA 5FF7A 4EP8C 4MLRA 3QR0A 5CAHA 5LSMA 2J7HA 3TSMA 5DELA 1J5TA 3SCSA 3DFNA 2QYGA 2QF7A 5CH9A 2MUCA 4GXWA 4C6DA 1PL9A 2WZIA 4U3CA 2OEKA 3MS8A 1XKYA 1NM9A 2FVLA 3VVGA 3WD1A 3CMFA 2YZRA 3P82A 3C3NA 3QRHA 1AVAA 4P5UA 4MFEA 1XUUA 1UW9A 3NOEA 2TMDA 2F2KA 4Q4MA 3D5HA 1VR6A 2EHHA 4KIEA 4OUIA 4MSSA 1KW1A 4HK6A 3VPLA 1DE6A 1WDQA 1R3YA 5A6LA 5C7HA 3UBPC 3O0FA 1WNOA 5DBTA 4S3EA 4UTKA 1VF8A 4GC4A 4PMQA 4RV3A 3NG3A 3DYOA 2DSZA 1K7EA 4FAMA 4MKVA 4C1NB 3ITTA 1LOQA 3SW6A 3ZSTA 1I2OA 4GYJA 4GRSA 5CAKA 3NQFA 1TV2A 3M1ZA 3PJTA 6CGTA 3GR7A 3JZUA 4XZBA 5DXXA 4P61A 2B81A 1OYBA 3AFBA 1W9DM 4AF0A 1NOFA 1S46A 4PBGA 3DDMA 2ZIDA 5M17A 4RDYA 2CESA 4R7WA 3BMVA 4QE1A 3TONA 2Q09A 3NL6A 1G01A 2V2DA 5FD0A 4O10A 3GD6A 1FA2A 3ZSSA 4K3ZA 3ABOA 3VOCA 3L4XA 3CL6A 3O9NA 4Q4RA 4WKFA 1RCOB 1S5NA 4DHGA 2Y61A 4C7FA 3CUFA 1QASA 1NF7A 4ML4A 4XD5A 1X6NA 1ITUA 4BCEA 2GUUA 4TU1A 5GVJA 4QAWA 4WIWA 4ZB5A 3VNDA 3SI9A 2O9RA 3RGTA 2G3IA 5CPMA 5DT7A 1HJXA 1TMHA 1O5QA 4JL1A 3B03A 5HINA 3OZMA 2HVOA 3MMDA 1J12A 4LX4A 3KVJA 1LUCB 4OHQA 4JYEA 1XFCA 1GCYA 3GHTA 3KS5A 4P8WA 4EWND 4KEZA 4ALDA 4CD5A 3U0HA 1CGVA 4GNVA 3IIVA 2WQPA 2WMIB 3KCLA 3P60A 3THUA 3V4BA 1D7KA 3UZWA 4XZIA 5FSDC 1R86A 3EGJA 1QK2A 1H1YA 1I45A 1WKFA 1MUWA 2PDPA 2VURA 3TYZA 4AVFA 1HX0A 2BXYA 2DU2A 2QCHA 3CHFA 4HA4A 3C61A 5A6TC 3NZQA 1DPMA 2Y5JA 1QNRA 3TTYA 1WZMA 3ATZA 4JQ2A 1I9CB 1WKDA 2VDHA 1GHSA 2WAGA 3H4GA 4UQDA 1P7TA 3TLLA 1OG6A 1HJSA 1XC4A 3GO2A 1EQCA 4AQLA 4GYPC 3FEQA 3CBWA 3MDWA 3RRXA 4K8EA 5AC7A 2XWDA 1Q13A 4TTGA 3JS3A 3NJ3A 3GXMA 1LCOA 2PP3A 4XBJA 3ARUA 3BDKA 4S1FA 4KW2A 1BWLA 1C91A 1IXQA 3WJSA 3QBUA 3SRKA 4CD4A 2HNHA 1JDAA 4RDVA 1BXCA 1NP0A 1PDZA 7XIMA 4J3VA 5EBUA 3C8FA 4LUSB 2EF9A 1JPMA 3EOEA 4QDMA 1W2VA 3QH2A 5CZ0A 1KGXA 4E2BA 4XZNX 2ISVA 4KRTA 2ZX6A 2GGIA 4NJKA 1ZJIA 1D2KA 1UD8A 4ACYA 2IS7A 3ZVIA 1TE6A 7TAAA 3C2FA 4QGCA 1UD6A 1W5PA 2VQUA 3DAQA 2JK2A 2V30A 1KA9F 1PZ0A 2WJZA 2WJFA 1QNSA 3ARSA 3FFSA 2I1OA 1FY6A 3G0SA 2W61A 3V35A 3LM3A 4XSMA 1WDSA 3LY0A 1K1DA 2WZEA 4GYFA 4M6QA 1VFLA 4MB4A 4HYVA 4EWJA 2I9UA 5TF0A 3I65A 1LF1A 1ZP4A 4LS1A 3IVTA 1RK6A 3NM1A 2RDUA 1CGTA 2VCAA 3CHVA 4XAPA 3SCTA 4DWDA 1UBSA 4B5NA 2ZXQA 3QGKC 2DQXA 3M41A 4LYQA 3QN3A 1EFZA 3KS6A 3NDYA 1LM1A 1H62A 3AIEA 3PTDA 1W1VA 3WYZA 2R1NA 4S3CA 2X05A 1AUSL 2FB2A 1DXIA 1X97A 1R8LA 2GVEA 3TLQA 2WNQA 3EMZA 3RX3A 3IJLA 3IAPA 2ZZ7A 4ROQA 1B0IA 4DI9A 3MB9A 3GX9A 3H2CA 4Q8PA 3CWOX 4R27A 4U4MA 3GNRA 1KM4A 3GIYA 1DWHM 2PDBA 5BWFA 4JEQA 3ZWTA 1BFNA 5JMUA 1OFOA 3S6OA 3FW6A 1GOIA 4D6DA 5AC5A 3GNOA 1CLXA 1EZ2A 2PC4A 2ZX8A 3AYTA 3B3DA 5CGQA 1M01A 1XUZA 3LGEA 2OKTA 3BZJA 3PTQA 1GOKA 2YA2A 5CKSA 1LBMA 3WLJA 1T8QA 2Z7KA 2LLEA 3HMJG 2PEVA 4B3LA 3QZ6A 3PUDA 1OVDA 2G4FA 3KUMA 3BAIA 1EB3A 2Q01A 1WAUA 2B4GA 2WPBA 4KS0A 2VVNA 1K8XA 3T0BA 3PVFA 1TA3A 1T96A 1KV8A 1MW2A 1B3XA 2DW7A 1EHNA 1A50A 4JFWA 4L1WA 1B4KA 3QGAC 3EYPA 1PEZA 3BZGA 3GHSA 5G4WA 4ZQCA 2QJMA 4AZGA 3WO8A 3TYDA 8A3HA 3UYCA 1PTDA 4H6RA 1C93A 3AYSA 1QTWA 1ZRQA 3BLLA 1W9PA 1XLEA 3OG3A 1IIHA 1KLYA 1F3TA 1G4TA 2ISSA 4Z17A 1DJZA 2XFWA 1RLDA 2KZHA 1YLVA 4PFMA 3NPUA 2YCEA 4QSFA 4AC7C 1RLCL 4C1LA 5U4NA 2V2HA 2QCCA 4AD1A 3UR2A 3W07A 3ZJ8A 2YXGA 2IPGA 5HR6A 3DFPA 3CPGA 1BG9A 1NIUA 4UOJA 3VX1A 3VNIA 3OYZA 2ZZ3A 2VFFA 3WQEA 4NXSA 1O5XA 1TZ9A 1GTHA 2JIWA 3N12A 2CHRA 1JNEA 3NQ7A 2R1MA 1PIIA 1N82A 2OLAA 1JFXA 4NQ1A 3WEZA 2FZMA 5CZTA 4OKDA 1KFKA 3LQGA 1R3RA 2ZVRA 3BUVA 4NI8A 1QI5A 1DP0A 1C90A 4ZZ9A 4DNMA 1KCXA 1ZTVA 1AMYA 4LALA 4ADTA 4G7EA 4X63A 2VR5A 5G1MA 3TW9A 1P7TB 4U33A 4N0RA 5D2VA 3W1XA 1XL9A 3ZOAA 3JUGA 2YFNA 4ZGYA 2YBUA 4I5UA 4J1OA 4GBUA 1XBYA 3SIMA 4ZQOA 4H7CA 3QQWA 4Z2JA 2WC7A 5BRPA 2J78A 1AL7A 1QVBA 4ZE4A 3LLXA 4YL2A 1J2BA 3S46A 3WJYA 1TZZA 1W91A 2NSXA 1Q7QA 3AXKA 3MSGA 2V5LA 2G41A 3WUFA 1C8QA 2PC8A 1O7AA 5HXMA 2C7FA 1BXBA 2BS9A 3WD2A 2DV0A 4HTYA 2HE8A 1XH0A 3BLPX 2DIJA 1AA1B 3T0TA 5MKGB 4RNJA 1O1HA 4RXFA 4NT0A 1ZU8A 2R1PA 4HA1A 3PAOA 3CZJA 1EYEA 4WDTA 2JKEA 2V38A 3AIRA 4JFSA 4IUOA 3BL3A 4RPQA 5BXPA 3RHGA 4C6PA 1EBHA 1GPWA 2VUNA 3GNNA 4DYJA 2CU0A 3AHYA 3MUIA 3LBOA 5CBIA 1NJJA 1FWRA 1UD2A 2A7PA 2PLCA 3EX1A 1W3TA 4WLCA 4R9OA 2VX5A 3NOYA 4H04A 2G95A 2JGQA 1JQVA 5HJLA 3PTMA 4H7VA 1NOWA 3OQ8A 1L6WA 4DUOA 4XO6A 2IPJA 1EX1A 4PMVA 5T8GA 3HF3A 4ENLA 4RPPA 3VIKA 4MFDA 3UZYA 2Z1VA 3SCRA 2EKGA 4POCA 3Q2DA 2E8ZA 1PWLA 2Y8UA 4NZ4A 4AZ6A 3AIWA 2YB1A 2FPVA 2E1DA 2FKPA 3S6TA 3T2OA 4DF1A 5ENLA 3NDZA 3WF4A 3RDKA 1I75A 4W9TA 3UWWA 2NW0A 3ZXWA 5TNVA 2VOTA 2B7PA 3UWZA 4L9YA 4JN8A 1S38A 3CHEA 3RIKA 1B1YA 2NUYA 4P7LA 3W7OA 2D24A 5LHEA 1OK6A 1X1OA 3IIOA 3R8RA 1RJRA 3GTNA 4UFKA 4AWTA 1G1YA 2ZUTA 4DBSA 4HYWA 3UYIA 3ZT5A 3C5QA 1ICPA 1DL3A 1XLMA 2Z00A 5I3JA 3VD7A 2CLEA 2DUAA 1C9WA 1DJHA 3CUIA 3ARRA 1TJ2A 3R10A 3CUHA 1QOQA 5CPQA 5M2FX 1GNXA 3IACA 2EG7A 4IF2A 1GKPA 3EWXA 1N2VA 3CH9A 3KZSA 3A22A 4X60A 4OJYA 1TA3B 2CERA 2PDFA 4DY1A 1KM2A 4LRSA 4KRUA 3NEHA 2VEGA 5CC7A 2Y2WA 4UTWA 3W2JA 3VKKA 3H2OA 3E96A 1DHPA 2DVTA 3UVIA 1DXEA 2FLIA 4N9BA 2DIKA 3DKJA 5A6JA 1O66A 2YR1A 4AH7A 2NV2A 4Q4SA 3VGBA 5DMYA 4IIGA 3MBFA 3S1WA 4DLMA 2GQ9A 3LUTA 3GNDA 4P7QA 1Q3NA 2WO5A 3EMQA 4J3UA 3TYEA 1OG0A 4LAKA 4JY8A 5E5CA 9CGTA 4GIRA 1ZSXA 2UWFA 4QJ5B 4PULA 4NX5A 4TVCA 1RBLA 3W1PA 4BF5A 1UYQA 3AMKA 3ZJKA 1AJ2A 3ITOA 4GX8A 1MQPA 3N9RA 4DJEA 4PCSA 3VOGA 2XVLA 4D1IA 1AW1A 1EX5A 8XIAA 4OV4A 2ALDA 2B31A 3WNKA 1T8XA 4MLJA 4G7EB 5HK4A 2E28A 3STCA 3U4FA 3CLMA 3TR2A 5A95A 3KM8A 7ENLA 3P67A 3G6MA 2NX1A 2H3DA 1XLKA 2Y7DA 3C2RA 3G1HA 2P5NA 2OSXA 4MPKA 4NJGA 2PP0A 2WCAA 3BOLA 4QE5A 1BYAA 2C1GA 1IT7A 3G3DA 4O28A 2TPSA 2HVNA 2EQDA 4H83A 5JUVA 1LT8A 2XH0A 1G67A 1OQFA 2D23A 5D05A 4Q7BA 1PBGA 3CEUA 2XM2A 2J9YA 2QUVA 5K9CA 3SCVA 2XYLA 4J4KA 1JAKA 4ZE5A 2QKFA 4PTVA 4YTUA 4QQ3A 4M1RA 3WDQA 1V51A 2W79A 3LV6A 5TAOA 3EWBX 3MUAA 1PYMA 1HF6A 4JTAA 3LS9A 4IH3A 1Y7VA 3WMCA 2PWVA 5LIUX 2G3JA 3VIMA 1EUAA 3CPRA 3U2CA 3DHFA 1MI3A 5FI8A 3FAWA 1C29A 1CXEA 4PRRA 4HA3A 2DVUA 1EA9C 1HQTA 1W1TA 1SR9A 3AHTA 2FJUB 3CUXA 4H8VA 5I3DA 4Q6XA 4AYGA 3UWYA 2AQVA 1SO5A 2OPJA 1PZ3A 4XKYA 3P80A 3EWDA 4S3FA 4FX7A 2POZA 3T0AA 1XLHA 4YXGA 3I7RA 1KFWA 1VRXA 4FI4A 1QBBA 3RNDA 5I3GA 3OVRA 1OABA 1YPFA 2BMBA 2YL5A 4HU8A 1EJVC 2FYMA 5FEXA 3VIGA 2FMNA 4PMOA 4TQTA 5HUOA 2ZA1A 2DZSA 4LCRA 3KLKA 2PLKA 3M43A 4ERAA 2ZRVA 5A3HA 1GTEA 1GW9A 5B80A 4AXKA 2XPKA 2VNCA 2XVPA 4WY0A 5AECA 1I0BA 1M04A 4O1FA 1VCFA 1I2PA 4N42A 5BWAA 4ZXLA 3GYEA 3HMCA 2GSEA 1H09A 2R1KA 4G6CA 1X38A 1SZGA 2FTPA 3ZR4A 1P0EA 1P5BA 1W31A 1TRDA 1I4NA 1LDCA 3KOWA 4LAOA 4D6JA 1VJSA 5C7VA 4DB7A 1H5YA 3KVMA 4C6CA 1OB0A 2W0UA 4QX4A 4MNLA 1M5WA 1B3WA 5D8WA 5H6HA 5DMNA 3RU6A 3CHDA 1XWYA 3GVGA 4ZB2A 3VIFA 3K8KA 5AHEA 4K68A 1VBRA 4HYRA 1MYRA 3FNDA 2BY2A 1HIZA 5L6UA 1LLOA 4J2PA 3UWUA 3N3MA 4D8ZA 3H2NA 2WC4A 3A9IA 2YKKA 2DZPA 1LL4A 1UOZA 5A2AA 3HPFA 4ES4A 1YE6A 1HT6A 3R1ZA 1UD5A 4DJDD 3MI2A 1XIGA 3ALGA 4IM4A 7REQA 2DW6A 2Z2BA 4AD2A 4YVXA 4IP5A 3DESA 3A9BA 3QF0A 4PC8A 3S2CA 3EMCA 2VZSA 3IGUA 2D2OA 3VKDA 1LL7A 4I7UA 5DF0A 5EBAA 2C91A 2DZTA 4QRNA 4PA8A 3RJYA 1XIBA 1JD9A 4I7VA 3LGGA 2QVNA 1BPLB 2EEXA 4FXJA 1F3WA 4ZSTA 4CD8A 1WO2A 4R7OA 2OZ0A 5GNZA 4DUWA 1OSEA 1Z9AA 1E9YB 2I9EA 4Z2GA 3MKCA 3SFKA 1W3LA 1E4LA 5FF2A 3D3AA 4G2DA 2VC6A 4DJFA 4A8IA 1GONA 3F2DA 4PZVA 4CEXC 3WJXA 4F0KA 3VYLA 4DX3A 3QQ1A 1G7UA 4CU8A 2VC7A 2D3LA 3FVMA 3G22A 2DZAA 5KSWA 3O63A 5HMSA 1A0CA 3QHMA 1I2QA 3G1XA 4Q8WA 4XZLX 4EAMA 4JN7A 1JULA 4JTCA 2A1YA 3W82A 1KBIA 2G96A 3E5BA 5LNUA 3E9AA 3ABRA 3STEA 4MKNA 1X7FA 2YL9A 1BQCA 1EIXA 2NSOA 2F84A 3H2FA 1V6WA 5AYXA 1GJUA 1C7SA 4LBSA 7CGTA 5K9DA 3SJ3A 3QPEA 1YQ2A 4CD6A 5K7JA 4JDBA 2UY3A 5A8PA 3WL1A 4W4QA 1M65A 3T2PA 4PRTA 1M03A 4L7ZA 1MEWA 1JDFA 2DQWA 4BQ4A 2IQDA 2WMKA 1C8YA 3N6QA 3H2AA 3KWXA 3SDOA 1TUXA 1TZ7A 3LLFA 1H7OA 1WZLA 1ZFJA 4BS0A 1UR1A 4RW5A 1KKRA 1KB3A 1MDLA 4WDUA 1O60A 4JIRA 4KIRA 3LD5A 4C1KA 3ZZ1A 2XGIA 1IEIA 1OBAA 1XYCA 1H7XA 2XH2A 4KFNA 5EMKA 1GZJA 1NDVA 1YKWA 1JJKA 2WMGA 3VKJA 1AL8A 4E3TA 1SVDA 2HSAA 3W76A 5IDZA 2QCDA 1XRTA 3MKKA 4JR5A 1R2TA 2BWGA 1AK5A 2RDXA 3D0CA 4J9JA 2RKXA 9XIMA 2QCGA 5LIKX 2NZLA 3B8DA 2WNZA 3BLIA 3HU7A 2GQ3A 4X9SA 4XKYB 2ZZ4A 2VGGA 3NR0A 3POCA 3WELA 1TPWA 3NVDA 1E1CA 1DWFM 1ECQA 3T07A 2A7RA 5DT5A 3OBKA 1Q6DA 5HR7A 1H7RA 3KP1A 4GNJA 3L4YA 4PGLA 4NZJA 4N6EA 2PDYA 1WAWA 3WQCA 4F4RA 4LB3A 3EPOA 4B2DA 4O0KA 1TJ0A 1G4PA 3STFA 3BW2A 4WY0B 2A0NA 4GJJA 2VEKA 4R34A 4TO8A 5JU6A 3MUZ1 1V6TA 4Q8NA 2TSYA 1SMDA 2VX6A 2V5CA 3NPXA 2PDKA 3CU2A 3LRLA 1RK5A 6TAAA 3OA5A 3NPVA 4DBUA 3KOYA 1B31A 1TX2A 2ASHA 4Q8UA 1Z32X 3TC3A 4Y9OA 3EX4A 4TX6A 3DOPA 1QCWA 2CLFA 3K1GA 1UBPC 3I7SA 4JY9A 4QG9A 2PGRA 2B7OA 2C1HA 2C71A 1XLBA 3IEBA 4E38A 1ZBKA 2H8XA 1J10A 2ZZ5A 2YL6A 3R89A 1BSIA 2J7CA 3G6LA 3DFQA 4Y96A 1F8IA 5LIXX 1DJQA 4LQ1A 4IX2A 3AO0A 2CLLA 5ABHA 4E2VA 3ITGA 3W29A 3JVAA 7REQB 5F4SA 2HDJA 4PTMA 5F4WA 2BSLA 4FNTA 3NSXA 1MXSA 2Z25A 3CH0A 3AU6A 3TWAA 2YBVA 1UWQA 1JZ5A 2VZTA 1UB3A 2VD8A 3EXTA 3GU9A 3TIMA 2NT1A 3GE7A 3E2RA 1QI3A 2YW3A 3PNUA 3CZEA 1LWJA 4JNMA 3L66A 1K3UA 3GDKA 4I8YA 2PD9A 5DY3A 2CHNA 1ZNNA 1AQMA 2Z2AA 1FH7A 4Z1YA 3V0TA 3BMWA 4XB3A 3H55A 2FZBA 3NWRA 1JGMA 4W5UA 4ASTA 4Z2IA 3U3HA 1XV8A 4AIOA 1PX8A 4A4AA 1VHNA 1ONRA 4WSHA 3WEOA 5XIMA 3VM5A 3W1LA 3GKAA 4RDZA 4UMBA 3LRMA 4K7VA 2MNRA 1JUBA 1YEYA 2DT3A 4WKHA 4KEMA 4MWAE 5D8ZA 3N4EA 5LA2A 1B30A 3SJNA 3M0JA 2BNJA 4YTTA 1KGUA 1A4LA 3RCYA 1JCLA 1E56A 2WHJA 1NH6A 5C54A 1B4EA 4UFHA 2FVMA 3WY1A 1U5JA 2VX4A 2JQXA 1A49A 4M3PA 1DJNA 1BTCA 1NWTA 3M0KA 3QHNA 1MWOA 1VD6A 4H00A 3EA1A 1UA3A 1GVEA 1XJBA 3HURA 3KVLA 3SAZA 3HQPA 3WMLA 1XYAA 1QK0A 3H4XA 4UOZA 2WKGA 2QLYA 3GIQA 1WXYA 1OIMA 2Z1KA 2XDFA 2J7EA 3OGSA 2C0AA 2PRMA 1UP0A 4TMCA 3H2EA 5EB8A 3B04A 4K38A 3ANUA 1WA3A 2W62A 5LGZA 2Z7GA 3CZGA 4I9TA 1W3HA 4LVBA 1N8FA 4BI6A 2WVTA 5M3WA 4BF7A 3W7RA 4HSNA 3SR7A 4IWWA 3AZRA 1SGJA 1IZJA 3TZNA 1VCGA 1EC8A 3I6RA 3SBFA 3B0PA 1C3FA 1HTIA 1IWAA 2QCDB 2ZX5A 4GK8A 4CCCA 4ZB0A 1JI2A 2GOKA 3ZLFA 3RM9A 4X0NA 1T0OA 3BE7A 1XH2A 3QOMA 2V3EA 2FTWA 3AS1A 1ZCCA 2P53A 4M0XA 1DJIA 2CWXA 3G1VA 3M7SA 3KDNA 1JEZA 3OZOA 1E1CB 3UXAA 2CZDA 5I03A 1RVKA 3SRFA 3KW3A 3IV8A 5CLWA 1UWTA 1HKWA 1ME8A 2R1LA 4KBXA 1MNSA 4XVEA 4D6GA 3I3EA 1R5YA 1XIDA 1RCQA 2WSPA 1KV5A 4AWUA 5JH1A 4I5XA 3FIGA 3VD4A 4MMWA 1FHLA 3RF9A 3DU0A 2OKOA 1BEUA 3DERA 3AXIA 4H19A 1H3GA 2WMFA 3GNPA 2XTKA 2F6UA 1EUNA 2VGBA 3F1QA 1LT7A 2VL4A 3W85A 4JX6A 1G7VA 1GOWA 2OO0A 3AIUA 4MTVA 3LNMA 2FQIA 2V68A 3Q58A 4NVTA 1PCKA 2OEJA 4D6HA 4EE9A 1PKLA 1JCYA 1QPKA 1OZQA 5J04A 4NZ5A 2Z4GA 4G1KA 1K8CA 1Y5XA 2HXTA 1MVYA 1EGZA 2C0HA 1BWVA 2HV5A 3GC5A 3WLTA 1QRQA 1Q4WA 4C60A 1DWJM 1DJWA 4GUHA 4XUYA 2PTWA 3RX4A 1J01A 3APYA 3KHDA 3FOKA 1E0XA 4NYYA 4FZIA 3ABQA 4ROPA 3ARZA 3DFOA 2J7GA 5F2LA 3EKZA 1KFBA 1YDYA 1XRVA 4OT7A 1SU5A 3DN5A 4DWSC 1XI3A 4NJIA 1V3MA 2OYMA 4N9DA 4W86A 5HNNA 4GUGA 1TJRA 5I00A 1V3HA 3C2VA 1QMLA 1Q7MA 4M8UA 1GVQA 3GR8A 4A3HA 3KX6A 1I1XA 4XBKA 4LY4A 4PRWA 4MHBA 4FX6M 1ZALA 3VDBA 3C0JA 2BGQA 4Q33A 5AHNA 4GISA 4UTWC 5J5DA 1SM9A 2OYKA 4K6AA 2PB1A 4KCWA 1U33A 1SZNA 4QQUA 1ZP3A 3FX4A 2D0GA 3S2LA 3M6YA 2DJLA 1ALDA 2B0MA 3HGRA 4OE7A 3I7QA 1KXQA 2R9RA 2E5DA 1BVZA 3UNDA 2XN2A 4JTRA 1EJWC 1GK8A 1Q4NX 4IX0A 5D09A 2CZ5A 2XFFA 3UU0A 4S2BA 3FS2A 2J75A 2VKZG 5FACA 3ARYA 2WNNA 5D33A 2OTDA 4D71A 1UPMB 5HMFA 1LOLA 2O56A 4FEZA 1V3JA 3S9IA 2NX9A 2DSUA 4QLKA 2HXUA 3TFXA 4DJEC 1M7XA 1ICSA 4AMAA 4IMFA 1SFTA 3EWCA 3MCOA 1US0A 2H8ZA 4RX0A 3VI2A 5AZ0A 4NILA 1WCGA 3AJ7A 1NDYA 3BJFA 3IJDA 3ID7A 2BFGA 1Q6GA 5FESA 4NJHA 4AHQA 1QW7A 5BU9A 5EA9A 3NTYA 3CV1A 3G5EA 4UFMA 4RL3A 4KQNA 1OD8A 4OOUA 4FIQA 2VC5A 3F4NA 3W2UA 3FK4A 5KITA 3CQJA 3F5LA 3M5VA 3D6NA 3U48A 1BGAA 1HG3A 3W81A 1PIGA 1TVNA 3M07A 2V3GA 3B9OA 2P0OA 1RALA 2VCCA 1QNOA 3VUSA 4JIEA 1S3TC 4AY1A 4GQBA 2PDWA 1S1PA 4J5NA 3HA1A 3WLSA 4LVDA 1DOSA 1E6SM 1K7XA 4BZYA 2DZVA 3JZEA 3WBXA 4ATDA 4GCXA 2CZVA 3KOFA 3S5YA 1JZ4A 4OGZA 3G18A 3WH9A 2ZFAA 2PDNA 5A8NA 2PP1A 6ENLA 3L0KA 5I3HA 3WFAA 3IV3A 4M7SA 3VIJA 3WF2A 3SY1A 1EJ7L 1F3EA 3WLNA 3W2NA 2VP8A 4AD4A 1EP1A 1RH9A 4DEFA 2CLKA 1KO0A 4F0MA 3WLRA 2JKAA 3VGFA 1WUFA 1J8VA 1SZRA 1EPXA 3HQOA 4CNPA 1ZENA 3L2MA 4Q4OA 1A0EA 4N9EA 5D32A 1JAEA 4NSBA 2A85A 2JBMA 4MKSA 8TIMA 3LHVA 1EC7A 4AIUA 2ZA3A 3KZPA 1B3ZA 3CQHA 3GIPA 4RKAA 3DHDA 5DO8A 5LA0A 2YB4A 1F05A 4JIHA 4A3RA 4MUZA 5AVNA 3VU2A 2ZYFA 2ZUVA 3FLUA 3OOQA 1VFUA 4C6BA 1QOPA 1A4MA 2DVXA 3EDJA 4KGJA 4GZJA 5C6MA 2XISA 3VILA 3M0HA 3TAOA 5BROA 2CXEA 2ZCGA 5FEZA 5IXEA 4AEFA 2ZBTA 1JDCA 1PZ1A 4GACA 2ISDA 1Q6RA 1SW0A 5I23A 5C2CA 2J13A 2I5IA 5AHLA 1KRBC 2CXGA 4G7FA 5A8OA 1FBAA 1H1ZA 3LTPA 1VYRA 1HKJA 4M81A 4U5IA 4F2BA 4FP1A 1H51A 2J74A 3I3DA 4N9CA 1VP5A 3LCFA 1NAL1 4B4HA 4AY8A 2PDUA 4X61A 3KDOA 4RW3A 4DBDA 1EOKA 4D72A 1UMLA 3PZIA 4TOQA 4V2XA 1VPYA 2YCLA 2XGBA 1H0IA 3CXOA 4UTHA 4YJ5A 3TA9A 4C6NA 1NFGA 3RLUA 3RRAA 3WK0A 4XZMX 2J4GA 1M7OA 1KBBA 3BOFA 4J3ZA 4WQ6A 3QC3A 2ADAA 4GO8A 1MEHA 4PCFA 1YPIA 1J0ZA 2HCVA 5A2CA 1VFMA 4QG8A 1VKFA 3FYOA 4PMXA 2W5FA 1CXFA 1ZY9A 1FWTA 2HPIA 2XIBA 2BHZA 1ODZA 3QOKA 1QI4A 1UA7A 1GZGA 3PNZA 1XQLA 3TAKA 4IGSA 2P0IA 5DANA 4RE4A 3CQKA 5I06A 2CZFA 3MI6A 1IYXA 1UMYA 3KLLA 4O53A 1VFOA 3VD9A 3L12A 3N34A 2IW0A 1AD1A 3W6YA 2Z1WA 1GVSA 5JBDA 1UP3A 1TV5A 1UASA 4CN4A 1TWSA 1WDWA 3LERA 5CC6A 3I3BA 2CETA 3OVQA 4JTHA 4IZGA 4DZ5A 2Z29A 3O6CA 4JKMA 4ILSA 1E0UA 5BW6A 1JZ8A 2VRJA 3EDFA 1VENA 4DJFC 5BZAA 3A3XA 1W1B1 3MWAA 2FH8A 3T78A 1EF3A 3WD0A 4HNNA 1R9ZA 1KXTA 2JIEA 2XVNA 1UR2A 2F38A 4C5YA 1XPGA 3B40A 1KWGA 4DELA 1RD5A 2ZADA 3HV9A 4IPNB 1BQGA 5G2HA 3VKCA 1CGUA 4W84A 1FFRA 1UJQA 3HGSA 4EOUA 3O06A 4V28A 3BGJA 5IFPA 3P2VA 4QE4A 2VHLA 1LQAA 4PL2A 1B3YA 5ECVA 4KCUA 3W1RA 4QS6A 4UOQA 3HPZA 4W85A 1HO4A 4RJEA 1XS2A 3BPWA 1DVJA 2OO6A 2ZKMX 4MF4A 3HG5A 1PX4A 1WDDA 4XQ6A 3Q94A 5DXYA 1V0MA 3UQNA 3U4AA 1KM3A 1OINA 2GSHA 4A3UA 4JAWA 4LPCA 1PZ2A 2ALRA 1TO3A 1W6TA 4ZO6A 3ZLGA 2E4TA 4O14A 3VX0A 2V0TA 3AXXA 1BGGA 5BRQA 4CNUA 3IUDA 3UPBA 2E7FA 1PPIA 3KXQA 2QUNA 2A3AA 1Z8AA 3AXHA 2CITA 2OQHA 3NGJA 4TV6A 5LXXA 4E8DA 4UNIA 3C86A 4QFUA 5MHBA 2XSAA 2Y8VA 3QFWA 4NP7A 2UZ9A 4IQDA 5FJIA 4IJCA 1O95A 2Y5SA 2FGBA 1NP2A 2YYTA 2YZ5A 3WMSA 4FNSA 5LNVA 5JIWA 1K77A 3NQ8A 3EA3A 1W37A 5HAOA 5JQ9A 2V5KA 1LRQA 4LEQA 1SO6A 1RCXB 4HD5A 1UCWA 2WMJA 1SFJA 2DGAA 3E74A 4FLOA 5C0QA 1I2NA 3LXBA 1WKEA 5C2XA 1R6WA 1UIPA 3N17A 2FZNA 4NUWA 4GKTA 1R3WA 4FMVA 4DAFA 2NQ5A 5A6MA 5D30A 3N25A 2BVDA 3NXLA 1VEOA 4KWVA 4WR3A 2X0HA 2PSNA 3ABZA 2V6AA 4XAYA 3N4FA 3UPWA 3AI0A 2FIQA 1E6RA 1JI1A 3THCA 3MBDA 4ICCX 3U2OA 1SJAA 1KR1A 3Q45A 3OJGA 1OJXA 4IUGA 3CAKA 3CMJA 4I5RA 3VOJA 3AS2A 3LHTA 5IDIA 1HP4A 2ZZ1A 1Z3NA 2CLHA 3DCPA 4DRSA 3MCMA 4UR8A 2PWEA 3WH7A 4YCOA 1PJ9A 3CAWA 2W6RA 1GOMA 1PS9A 2W91A 4V1XA 1NDWA 1QI2A 1CECA 1ZUAX 1OFDA 3STPA 4HA0A 2PDMA 2CKRA 2YCLB 3UZZA 5D9NA 3W9ZA 4IFRA 1HFBA 3VE7A 3ZVHA 4CD7A 3DI1A 2J9XA 1RXOB 1SR0A 1IE7C 4B5UA 3U6WA 1WZKA 1AH3A 1TG7A 3EB3A 4J40A 3AC0A 4MY9A 4GBDA 3U8GA 1VLIA 3EOLA 4PB3A 4MY1A 2VXNA 1K03A 4B5WA 1HGYA 1W9XA 1LL6A 1E6PA 4Z2LA 1VEPA 1EDTA 1Q6OA 3BTNA 3CV2A 1MQQA 5H2ZA 3GKFA 3GS6A 3NM3A 3RITA 4EF9A 4GJIA 1HKIA 4CQCA 4RXGA 3QV9A 4FK9A 1IV8A 3T0DA 4QCEA 2MANA 4A6GA 4M6PA 4YNGA 4Y9PA 3QY8A 4MB5A 2Q3RA 2WYSA 4NKCA 3FJ4A 3BQ5A 3UFYA 4Y8FA 4D6FA 2ACSA 4K2SA 2G3MA 1RJPA 1WYIA 1EDGA 2VO5A 2C14A 1QW9A 6REQA 2G3NA 3C0LA 1QO2A 3N9SA 5FA5A 3W7LA 4E4PA 1FP8A 2GZXA 2ZXBA 4FXFA 3VDGA 4XD4A 3GBDA 5FF3A 3IVUA 5ABEA 1GW1A 3N2TA 1Q5MA 3R12A 3S47A 1HJUA 4UNLA 3LHYA 3CT7A 1FVPA 5KEZA 3VIIA 5F7UA 3MZNA 2YPIA 1J0IA 3B05A 4BEQA 1TPEA 3KBVA 1S5VA 4DF0A 2Z0IA 4AMCA 1DIKA 1CGWA 1NY1A 1XYBA 4X22A 3EXSA 4Y7EA 5AKQA 1MSSA 1JD7A 1TV4A 5IBXA 1UG6A 5I5RA 5AC6A 3C52A 1JPIA 2X0SA 2QUMA 2QULA 4ZTXA 1IWPA 2TYSA 6TIMA 4AW7A 2XINA 4ZMGA 5CPOA 4HZ7A 4C6EA 4J7RA 3EDDA 2ZTJA 1Q63A 4WXYA 2PDXA 1C8XA 3OB8A 4PEEA 3USZA 2XVGA 3VNZA 2QCNA 2Z1BA 1B3VA 2EXOA 2PBGA 2GK1A 1D3CA 4KPLA 3BOXA 2I5GA 2FMOA 1FDZA 3SGZA 4OVXA 1IXOA 3TYAA 1LYXA 1ODUA 3T08A 1XW8A 3UG3A 2A6NA 2E9LA 1QOXA 2ZUSA 2HS6A 3V5CA 3A13A 3FYYA 3VNYA 3RJXA 2W66A 3E6EA 2A3BA 3BAKA 5HNRA 5CG7A 3HQ1A 3HBLA 4H1ZA 2ZUNA 1TPDA 1UH3A 3MANA 4DBEA 3MI3A 3GDRA 4KWWA 4UR7A 3H53A 4NYUA 2ACUA 1FKXA 4ICNA 1JR1A 4H01A 1TJ1A 2J62A 3SGUA 1VJIA 1Y8BA 2QJGA 1UKOA 4PBEA 5CPTA 5CGMA 3H7VA 4XG1A 3VKAA 2A3LA 4CEUC 3SCPA 3CV6A 4IMCA 4W88A 5EPDA 2A3EA 4M51A 3BARA 1AJZA 4OV9A 2HNEA 1H7NA 4HMEA 3WKZA 4MDOA 2NV9A 4CLMA 6XIAA 4ZO8A 2YA1A 1A5LC 1VRDA 1FWFC 1P6CA 3VE9A 1B3OA 4FPSA 4NRSA 2Z2UA 2PDIA 1W0MA 2Y8KA 2WK2A 3ABSA 1IF2A 3I6EA 4AZHA 3V7PA 4LNCA 1S2CA 3AS0A 3B8IA 1GJWA 1UPPA 4K36A 1ZBVA 3KFTA 4IGNA 1KM0A 4JTTA 1WOAA 4PMZA 4MZYA 1SO4A 4HTBA 4MZ1A 3AZSA 1GHRA 3WBAA 3LMYA 3CYVA 3DECA 4GY0A 3ABXA 3W71A 4B5VA 1HW6A 4U2ZA 3YPIA 3CASA 1L8PA 8XIMA 1KXVA 3NQEA 3B8TA 4BQ3A 2J27A 4DNHA 1MFVA 2PCEA 3S9ZA 1B57A 1W32A 3C2YA 1EP2A 1A5BA 4FR6A 2PAJA 4L4LA 1V5XA 3NQVA 4ZQRA 1MRQA 4LFYA 4XAFA 2ACQA 1VBJA 3BG9A 5EU9A 3UW6A 1YDNA 3GTXA 3UF9A 4PUJA 3WIJA 1PXGA 4WOQA 3W7PA 1Y5WA 4TIMA 4UMCA 3E0IA 4YIWA 4C90A 3PSVA 2PUZA 4X9YA 3VABA 1JZ3A 4W93A 3ZVHB 2FHCA 3BICA 4AD3A 1V7AA 5I6SA 3BCDA 3NO3A 2BY1A 4IIHA 1TWDA 3IIZA 1LRNA 1MO0A 1OC7A 3RPDA 3NURA 1D8WA 1UH2A 2VDGA 3L5LA 4N4PA 4IJBA 1VFTA 2J6XA 4LTSA 3GXFA 4R33A 1X8CA 1JL8A 3MMWA 2QCFA 1S2AA 2WCSA 3FGCA 3DC0A 3BXWA 3HFTA 3JU2A 4UZUA 3DUGA 3AHXA 1GKRA 3ANYA 3CC1A 1PE1A 2WBKA 1IEQA 3HB9A 3G1FA 4MJZA 5C5YA 3N19B 3T81A 2P3ZA 1PUDA 4HQVA 2Q3OA 4QBXA 3CV7A 2RGLA 4NU7A 1PKYA 4QDWA 1V8EA 2F2HA 1XIIA 2OQYA 2E3ZA 1IGWA 3FEMA 5FJOA 6REQB 4HNTA 3VGGA 3S2NA 3R6IA 1FDYA 1F4AA 3BQ6A 1XXXA 2OGJA 2OT1A 5I0DA 3W1TA 1F3XA 4GCAA 3REQA 5HA7A 3CHCA 5G4EA 5CJMA 5I09A 3R11A 2WM0A 1W8GA 2AGTA 5F1VA 2C6QA 1ISZA 4AY7A 4KWOA 4MYAA 2PE4A 4HCLA 5C70A 3SQMA 1Y0EA 2NQ9A 2ZDRA 1PCWA 1TPH1 1BF2A 3P5ZA 3W7HA 4ATWA 4F48A 4UZSA 1TVPA 5HQEA 3W27A 4FF5A 2PF0A 4HCHA 4S3DA 2F6KA 4BI5A 4JFVA 3NDOA 3V16A 3KRUA 2QR6A 2GK1B 2X41A 1ZJHA 4PB4A 2HQAA 4FNUA 3TOPA 4CNSA 1GVIA 3P6LA 1TKKA 2CYGA 3DYMA 5GJPA 2O7QA 2CHOA 1W54A 3GK0A 3AIVA 2J79A 1D8CA 3GUWA 2QIIA 5CC5A 4DUXA 3ES7A 2X7VA 1TMQA 1V02E 4IOTA 1BYBA 3T55A 3RK8A 5REQA 4WVXA 2OSYA 1K7FA 1W56A 4DWSD 2YYUA 3TQVA 3NAVA 4OBTA 4ONVA 3BAXA 4M82A 2BOEX 3MVIA 3KOXA 1TTIA 4JTSA 3EWWA 3T7VA 3WL0A 3VZXA 3PFMA 3U5UA 3DBPA 1YHTA 3UA3A 4HOWA 3GG0A 4E2DA 1HO1A 5CSRA 3SM0A 3U7VA 1A53A 2POTA 1U83A 1Q2SA 3PJUA 3K4WA 1OGGA 1FXPA 1S5MA 4E3VA 3IGXA 1A47A 1HKVA 2HRWA 3II1A 1V02A 4GQQA 4CQBA 4HNVA 4PYSA 4RDWA 5T9BG 4QG6A 3KHJA 3LTYA 3IIPA 1P0DA 4R53A 1YBQA 3E0LA 4GC3A 3TSBA 1ME7A 3WCZA 1JRBA 3DYPA 3JR2A 2FFIA 1A5NC 4Z08A 3G0UA 3CT2A 4AHOA 4ZVJA 4EVZA 3HIJA 4ERGA 2CBIA 4AXNA 2NUWA 1R9YA 3CUZA 4AEEA 3KBNA 1TCDA 3W22A 3AISA 1G94A 2GVGA 3K8LA 3P5YA 3UZ5A 1KRAC 2X1SA 5IM51 1BLIA 3EX3A 1UQYA 4FHAA 4GQRA 4M7TA 1LRTA 1CZ1A 4OZOA 2G4JA 3MW7A 4M29A 4LSBA 1X96A 3FHAA 4GGHA 3TZFA 1TV3A 3QY6A 1TTPA 3ORWA 3PZ9A 4J2MA 5CXPA 3GUGA 5GJMA 4HNOA 4XZWA 5CQ1A 4YYFA 3L23A 3TEVA 1IIGA 4O0QA 3G1SA 3TNOA 2WM1A 2O9OA 3UETA 3VK5A 1X39A 5ABFA 3OPSA 3TJXA 4C6LA 2GQAA 1R9XA 1G4SA 5C9RA 4WDWA 2AQWA 2PDCA 4N4QA 5HNTA 3A23A 3GY1A 3CO8A 4L64A 2QPXA 1OD0A 3L5AA 3IJQA 2BOGX 2VM8A 1Z69A 4GFSA 2HBXA 3FGCB 1H41A 1UKSA 4GWEA 3VIOA 3CZLA 4QJ3B 3ITXA 3A4XA 1B2YA 3S1VA 5LGXA 1V3LA 5D2WA 2DFAA 3H70A 4GY1A 2FZ8A 5HNUA 3QV7A 3FVDA 3W88A 4D6IA 3MVTA 1L6SA 1V6VA 5KMYA 3STGA 2ZDSA 4O16A 3WFLA 4MNJA 1PDYA 1EGMA 3KBWA 4B5XA 2INEA 4LAZA 3M0LA 1AG1O 1F61A 3REQB 2VI0A 2G97A 5CSSA 3B0YA 3V5OA 3E0WA 4I6VA 2YDQA 3EWZA 1LP6A 1YTDA 2W67A 1F73A 1F6KA 3V18A 4Z0JA 2BXVA 1XBXA 3NEVA 1ONXA 3WK1A 2E6YA 2IKGA 4H8UA 4TX9A 2OOGA 1XP3A 1QJWA 1XRSA 4E8CA 3PWIA 2VQTA 4NF7A 3PWAA 1F2JA 2VFEA 3H54A 3LCLA 4GUIA 3TTOA 1V08A 4PL1A 5E93A 4C65A 4HPNA 5LNRA 2YBTA 5MKGA 1GYMA 3G77A 3CEPA 1E6NA 3TYBA 3WQGA 1ZS2A 4AB4A 1CBGA 5I3FA 2CLMA 2WWCA 4EPDC 5DCBA 3M46A 1RHCA 3GVVA 2VFGA 1QHPA 5DCEA 4C91A 1U5VA 1XHGA 4IL0A 2O4MA 3VZZA 2XHYA 4H9XA 2XFYA 1SFLA 4N2YA 3WQDA 3PJWA 1Q85A 4QR6A 3ZR5A 3FDGA 2E68A 4NG3A 4OBRA 4H9VA 5D2XA 4QSHA 3F5KA 3COTA 3HM7A 3BAWA 4AD5A 2ANUA 2PDJA 4FOKA 2OR2A 3VOIA 4I9MA 1OCJA 3GSMA 4D6CA 3UG5A 1XGEA 3OW1A 5REQB 4LAUA 3A6OA 4UTUA 3N29A 4AG0A 2BP1A 5HWMA 4NJJA 2EPLX 4H2CA 4ATLA 2Q71A 3BURA 1FWJC 2PTXA 3DBNA 3LPOA 3ME3A 1QO5A 3NSMA 5TQLA 3T9PA 3HPAA 1SSGA 4MIMA 2KAUC 4JOMA 1JPHA 3TU9A 1DIOA 1TPFA 4HGXA 2VEPA 3QW3A 3OIXA 5C71A 2YLAA 1BG4A 4GINA 1HVQA 2C79A 1UUOA 3CNYA 3G8EA 1O5KA 2ZA2A 2RJGA 1YBQB 1UWRA 5JBEA 2WJEA 4ZL1A 3ZMRA 2PDGA 5LXEA 2DEPA 4INFA 5A8MA 2BX7A 2Y7EA 5D03A 4KEVA 3JRKA 4W8AA 2Y0FA 1I60A 1L6YA 2EPKX 4R88A 4HK7A 4W8LA 1HXJA 4OWGA 1PKMA 3GXNA 1WX0A 1FUYA 2QS8A 2D2JA 1OT2A 2OVLA 3RN6A 3R8HA 5KETA 5E70A 4DJFD 4ZOAA 4GQ0A 3R25A 3RPTA 3QGVA 2VUYA 4BA0A 4XO7A 4C6IA 3CJPA 1XSIA 4WOZA 4HJFA 5G4HC 3PBUA 2BLEA 3W75A 2Y7GA 1Z7AA 3MHFA 1XLDA 3T2QA 4HVXA 4RV8A 3ZT6A 5I3KA 2HK0A 3LHZA 1FWEC 3TH6A 3KCOA 4GUFA 3M9YA 4NI3A 5ABFB 3CPUA 3O07A 4S3GA 4CGTA 1VB9A 2ONEA 1WXZA 3VOFA 4BFAA 1F07A 3TN6A 2AK