5BMWA

Crystal structure of t75v mutant of triosephosphate isomerase from plasmodium falciparum
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYVGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the role of highly conserved residues in triosephosphate isomerase - analysis of site specific mutants at positions 64 and 75 in the Plasmodial enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 99
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5bmwA00
2GVLA 5LHFA 3FJ6A 1FCVA 4N9CA 5BOOA 3O06A 1QPOA 4UNKA 3ZWSA 2V81A 1MSSA 3LBMA 3PB0A 3W1XA 5K9DA 4S2CA 1FDJA 1JULA 4NJJA 4AHQA 3MHGA 4TO8A 5KITA 4O52A 1TRDA 2G95A 2C15A 1K03A 3TXZA 3W1TA 1UUOA 1XXXA 2FB3A 2BX7A 5G4WA 3A24A 1K3UA 2ISVA 1VYRA 1ZENA 4MY9A 1F2JA 1PVNA 3QQ0A 3M5VA 1AW5A 1JCXA 1SFJA 1MO0A 2ABAA 5LNRA 3IIOA 4HNVA 1YYAA 4RCXA 1GT8A 3DI0A 5CPMA 1PCWA 3STCA 4DBEA 1ZAHA 3IV3A 1VCFA 2RH9A 1KBIA 1FBAA 4NJHA 1XDMA 1ZALA 3PG9A 4EWND 1PHWA 3I7RA 1QFEA 3GNNA 1FWSA 2CLIA 1OFQA 5CSRA 4QISA 1G4TA 1A53A 1LLWA 1DVJA 3IGSA 1UCWA 2ZZ2A 4DF1A 4BI6A 5AHLA 1H5YA 3NOEA 1R47A 3O6YX 4TMBA 1F05A 4YL2A 4UTKA 3PS7A 1EX5A 3G8EA 3DFQA 3UWYA 5H91A 2KZHA 2RFGA 2C0AA 4MVAA 1A50A 1K7XA 4NJKA 3IGUA 3FKRA 2HMCA 4MJMA 3I7SA 2DZPA 1A5AA 3M6YA 4JTUA 4NNBA 1H50A 2B0MA 1PCKA 2C1HA 4GE8A 1P0NA 4FHAA 3RNDA 1EP1A 3W84A 6ALDA 5C54A 2DJXA 3P82A 1OJXA 1DJNA 1KFCA 4UTTA 4R34A 4MLRA 4CLMA 4O1CA 3ZS4A 4JTIA 2VEIA 1Q45A 3GDTA 3SW6A 3WJWA 1WDWA 4OU1A 3L9CA 3L5LA 3RU6A 5LKYA 1TJRA 2JK2A 2YSWA 1YXCA 1HO4A 5C2XA 5L9FA 5FF2A 5LNVA 3AO0A 4LU0A 3G3MA 4IJBA 4O12A 3P7YA 4A22A 3W87A 3NL6A 4UTUA 3AJXA 5F1VA 4ADUA 1CX9A 5HWNA 2ZQ0A 3LCIA 2Y63A 2QJHA 4KWWA 4BR1A 1O5XA 3NA8A 3B04A 4AWSA 4FXSA 3W7MA 1XKYA 2DZSA 3STEA 1M7PA 5F1UA 1GG1A 1W5PA 3T44A 5F2GA 1ZCOA 1TPDA 2H3DA 3QMTA 4JTJA 5DXYA 4WQ6A 4LS1A 5AC7A 2Y7DA 5BMWA 1ME9A 1QOQA 5SWUA 2YYTA 1OX4A 3RMJA 1I45A 2WOQA 2X1TA 3HF3A 3PC0A 3GYEA 4MFEA 3LI0A 1RVGA 3EWWA 3NZ1A 3UQNA 1K8YA 1Y0EA 2E6AA 4HIBA 4WXYA 4O17A 2WSRA 1F6PA 4O19A 3FKKA 2RDUA 1WAUA 3FOKA 3LERA 4CQ9A 3LLDA 3PM6A 3TR2A 2G96A 3LHZA 3W07A 2H8XA 4OT7A 4LVDA 1H7WA 1KW1A 3M5YA 4I9AA 4ZQPA 3W9ZA 2I9EA 3OVRA 3L68A 3R8RA 2Q8LA 1GQNA 1KFBA 2GJNA 2DJLA 4PODA 4Z1BA 4RLIA 3F03K 2OZ0A 4P2VA 5I3HA 1YTKA 2C16A 1G6CA 3CB8A 3LRMA 2C6QA 2JGQA 4Z0SA 1PE1A 1VC4A 5IBXC 5D2YA 1H7RA 1ONRA 4AEOA 2BLEA 1SUXA 5CPLA 5IM51 1ZAJA 1N55A 1SO4A 3E49A 1W5QA 1RPXA 1F76A 3G1VA 4IMCA 3TMQA 2EF9A 4POCA 4UFLA 3KAOA 3PF3A 3MO7A 3MI6A 3QJAA 1NVMA 2ABBA 3O15A 4M7TA 4NT0A 3W71A 1DQWA 3W7LA 4RZ4A 1TJPA 4O8RA 3WK0A 3GR8A 1NSJA 4HNTA 3CTLA 4JTFA 5A8GA 5K4ZA 2H8ZA 4FNRA 3DFOA 4Y6GA 3NQAA 3A5FA 3TSMA 3W2KA 1D9EA 1VCGA 1KM4A 1M6JA 2A21A 3GXNA 1WX0A 3HG5A 3UWZA 3U8GA 2DORA 1C8VA 4X9SA 4O15A 5D37A 3DFPA 3R5EA 3IEBA 1B9BA 3DBPA 2NUYA 3M7WA 3WJSA 2NLIA 3F4WA 3SSJA 2FQIA 4OE7A 4IMGA 2GQ8A 3CU2A 3BV4A 4GRSA 1SZEA 3UY7A 3DI1A 3LHUA 2WQPA 4UFHA 1JCNA 3LB0A 1SZGA 3WK3A 3LX9A 4J9JA 3W85A 2QCDB 1NEYA 4A2RA 1FUYA 1PL9A 4M7SA 3W23A 1O4UA 3CQ0A 2AGKA 2GPTA 5CPOA 5CG7A 5BRBA 4FXRA 2HS8A 2CLFA 2O7SA 1XDLA 2V82A 3KVLA 3HOJA 3O6DA 1B57A 3BPWA 3KFTA 3HBLA 5KINA 4B5NA 3H54A 4NVTA 3GR7A 2Q3RA 3W22A 2A0NA 3W1AA 3UZ5A 4FF7A 4AH7A 2Y6ZA 4L4LA 2CLLA 3G3DA 4CNPA 1OF8A 5KMYA 4DPQA 1YDOA 4LRSA 1QCWA 5D33A 1LRQA 3N73A 3T4CA 4DEFA 3RFAA 4ZQCA 3N9RA 1WBJA 4O13A 2CW6A 4RV8A 3EXSA 5AHNA 5AHEA 3TJXA 1RV8A 1L2UA 3LXBA 1YPFA 1C29A 3CM4A 4JTGA 1F74A 5EKYA 1H51A 1XCFA 4JYEA 3NQCA 5HMSA 3GDLA 1IF2A 3N2XA 2DZUA 1J5TA 3M47A 1BTMA 4JIQA 2E1DA 3C4UA 2QF7A 1XBXA 2V2CA 2NV1A 1MEHA 4JXCA 3WJYA 1YADA 3MJYA 2J9ZA 1G7VA 3HJZA 1SO5A 5KZMA 3IIXA 3OG3A 3L67A 1WBHA 3KVMA 1A5CA 3L2IA 3GAKA 1KM0A 1SO6A 4IXXA 2E77A 4UNLA 3MI2A 3P60A 1TCDA 3C2EA 2Y62A 5K9CA 3PWAA 5BNKA 1EEPA 3DZ1A 1DOSA 2QCLA 3LTSA 4UFJA 1SFLA 1TMHA 4MY1A 1VGAA 5D04C 3NPXA 1TV8A 1HO1A 1LTDA 3PSVA 3C8FA 3T78A 1TTPA 3I6RA 4I7UA 3SECA 4C1KA 2QCHA 3OVQA 1AW1A 1GWJA 2E5DA 5CSSA 3LXAA 3P8IA 3SJ3A 3DGRA 1FWTA 1JUBA 1DKWA 3M41A 3EXTA 3T55A 1BKSA 2HSAA 1ZHAA 3A21A 1XC4A 3DHFA 2YGYA 3I68A 4NNCA 2OT1A 1H60A 4O57A 2V30A 3NQ2A 4CQ8A 1N7KA 2A2IA 1SSDA 2XFWA 4R53A 3CIWA 2RHGA 3DKLA 3B03A 4RK8A 1R2RA 1LORA 2QCGA 3M5ZA 2ZCGA 4IMFA 4JYFA 1IXPA 3TAOA 1K7EA 1TTQA 3F4NA 2FPVA 3E9AA 4N4QA 3EX2A 2QCMA 4BWLC 1BWKA 2NXIA 3HG3A 4WJEA 3VE7A 4LUJA 1T96A 3S42A 2V0TA 1PIIA 1W8SA 4N02A 4CCCA 1TQXA 3IVSA 4M5PA 3TH6A 4BWLA 4ZQRA 3W6YA 5FI8A 2EHHA 3W7DA 2E68A 4QNWA 2ATSA 3TQ0A 1LZOA 2V5LA 5D2XA 4K6AA 5HNRA 4TU1A 2OMAA 5FESA 3LDVA 2ZZ7A 4GUHA 2EKCA 3OBKA 5DLCA 1LBFA 1NF7A 1OHLA 1AG1O 1SZFA 4AWUA 4UTWC 1XFBA 2JGYA 1JQVA 3QW3A 4UTTC 4M6VA 5I3IA 3FYOA 3E02A 1GVRA 3LTYA 5CZJA 5E1QA 2ZA1A 4XKYB 1OX5A 5EBUA 4HKPA 4LRTA 3NVTA 2JKEA 4MJZA 2YCEA 4Y9AA 2QUUA 4MOZA 5DXXA 3U6WA 1F7BA 1LYXA 2BSLA 3W72A 1L6SA 2DU2A 3KRUA 4NZFA 1JQXA 4K7YA 1WOAA 1EP2A 1O5KA 3ABRA 1SW3A 4O28A 5G2WA 4NJIA 3QFEA 2P0OA 4RZ6A 5I3KA 4UMCA 1LRNA 1LM1A 2X2GA 3W7CA 1TO3A 3S1XA 4XTIA 1ALDA 2ZBTA 1O95A 5CGQA 3W7RA 2B7PA 3C56A 1VJIA 5K9XA 5D2WA 1TPEA 3EB2A 3WFAA 4JICA 1Q3NA 4O0KA 3W2UA 5J5DA 3G0UA 3B0UX 2VXNA 4R7JA 4DBDA 5DCDA 3W1NA 3G0SA 4UFMA 3S0CA 2WKJA 1H7NA 2YW3A 5DN1A 1KLYA 4BF9A 3IGXA 1W5MA 3OHIA 1I2OA 3HG4A 3MUXA 3W7NA 1HG3A 1KFKA 4FEZA 5CZTA 1RQBA 2TRSA 4WD0A 3NDOA 1U83A 3Q58A 2J27A 3SR7A 3FFSA 1LROA 4O11A 4LNYA 3IIPA 1MXSA 3P62A 1I8JA 5I3JA 1I2PA 3W7QA 3NL2A 4LTSA 4MYXA 1TTJA 4WY0B 3C2RA 4AHPA 3BW4A 4N6EA 2E6FA 4ZVJA 3UPBA 1O94A 3DU0A 4GBUA 1TPUA 3OA3A 1G4EA 1KLZA 1LOSA 5E0KA 4LT9A 3W7JA 2Q8ZA 3LI1A 2NWSA 3E0IA 1T0OA 5J5RA 3EWBX 2E5BA 2ISSA 3CIXA 4Z1CA 3HGJA 1SSGA 3H53A 3ZFHA 5HR6A 4JY9A 1YXDA 3LV6A 3L65A 1CI1A 5AYZA 4YCPA 2DZXA 4NXSA 3VFLA 1H1YA 3EWYA 5TBOA 4Q33A 1RD5A 2A4AA 2QKFA 4R33A 5KSWA 2VOMA 5D30A 3S1WA 3W1UA 2RKXA 1TV7A 2WNQA 1OX6A 5ABTA 5MHBA 1ICSA 5FEZA 4JEQA 1YXYA 3QSRA 3C61A 2NUWA 4EF9A 4YMZA 4GFSA 3GZ3A 2YDAA 4JYDA 2PRMA 4RZ5A 3TE9A 2A85A 1IXOA 1HL2A 1YLVA 2E6DA 1X7FA 3LCHA 3LGEA 3FS2A 1H7XA 1GVQA 1Q6OA 2FB2A 2AAMA 3GLCA 1GVFA 2G5WA 4BI5A 3B06A 4FIRA 2ZDRA 2YYUA 4UTLA 1YTEA 4UTIA 2VFGA 3O16A 3TW7A 4N9EA 4E2DA 3STGA 3HMJG 4FX8A 4YCOA 4JX6A 1TQJA 3INPA 1VR6A 2X1UA 2CU0A 2BXVA 3FLUA 3A23A 4QJ1A 4O10A 3JR2A 3QYQA 3NM1A 3EWUA 1VYPX 2H6RA 4WZHA 2ZRZA 3HPXA 3L0GA 3O63A 4PC8A 3SZ8A 1S5WA 2A5HA 3CHVA 3LTPA 4JY8A 4JX5A 4CCDA 3EKZA 1OFDA 3LCFA 1ICPA 1LBLA 5F2LA 5G2IA 1G4PA 3QQ1A 1QPRA 2DZTA 1GVSA 5BMXA 5TIMA 5HWJA 2Y7GA 2CLHA 3BVJA 4IX0A 3LRLA 3G1SA 1KV8A 1XBZA 1OFRA 3NQGA 1KM5A 1KBJA 3S8HA 1VPXA 3E12A 3DH7A 1XBYA 4TR9A 4PL1A 2EAWA 1GVOA 5EY5A 4LS0A 3QEZA 3O6CA 4QNEA 4DO4A 1NFBA 5DCBA 1PS9A 2X16A 2QEZA 1VRDA 1K8XA 2P10A 2PRHA 3D0CA 4GUFA 2NV2A 4YWIA 1KFLA 2J9XA 3IIVA 3IIZA 1VS1A 3S5OA 1WA3A 4YLWA 4K39A 3TDFA 2OCZA 2Z2UA 3TK7A 5HUPA 3GXTA 1SW7A 2R14A 1SO3A 1VLWA 4N2YA 1OFPA 3W73A 2BWGA 2NWRA 4LV9A 1GZGA 4GUIA 1ZY9A 4XQ6A 4NJGA 4JTHA 5FF3A 3NPVA 1K7FA 1QPNA 3DKJA 3SGUA 3THAA 3W7HA 1ME8A 1ZNNA 3NQ6A 1YDNA 2WNZA 4GJ1A 5HINA 4MIMA 4JTSA 4QIUA 4AB4A 3WJZA 5G2HA 1FY6A 2QR6A 5E93A 5CKSA 4LVAA 4I7WA 3LCGA 7TIMA 1JUKA 1BEUA 5EMUA 2NX1A 3BGJA 3G0XA 4OV9A 5LGZA 1UASA 4PH6A 4S2BA 4EIVA 1S3HA 3CEPA 4H6KA 2YFOA 5D32A 5A5WA 2VFDA 4PFMA 2D73A 1QAPA 2JBMA 4QITA 4H3DA 4JGDA 3A22A 3G1HA 3HPSA 3VE9A 3KVJA 3W1LA 2BZNA 2YW4A 3MI3A 1VHNA 1OFEA 2PRLA 2GVJA 4S1FA 2XN1A 3ABSA 2NX3A 1FXPA 1VCVA 3NR0A 3KOFA 3B4UA 3EX4A 3G1YA 1KFEA 2QDGA 1OFOA 5DBUA 2HS6A 3LHYA 4EOUA 3HQ1A 2PE4A 3LRKA 1U5JA 2QCFA 2Y7EA 2XN2A 3VCRA 1HTIA 1W31A 1IIHA 4YXGA 3UPWA 5FEPA 4LVGA 5DELA 1X8FA 2ATMA 4TX9A 2V8ZA 3S1UA 3TNOA 3ATYA 2F7FA 3HGOA 3KRSA 4HPXA 2Z1BA 3N9SA 3BLEA 2CZ5A 5G1YA 1ICQA 1LDCA 4GC4A 1L6YA 5D05A 1PHQA 2OJPA 2ZFAA 3BARA 4NU7A 5AHFA 1IIGA 2E5CA 4UCGA 3UY8A 1DHPA 1CW2A 1UB3A 3MHUA 3NAVA 5FEXA 2CLMA 4UTHA 1RQHA 3UNDA 2QJGA 1F73A 3LHWA 4N6FA 5AB3A 3C0JA 5TQLA 3EXRA 4FX6M 1TPWA 4UUIA 2E09A 5G5IA 2F84A 1GOXA 2WO5A 4O1AA 4WXZA 4UMBA 3MBDA 4FIQA 3PG8A 3NPUA 1KM6A 1JVNA 4JTKA 2IQTA 4CNOA 4G1KA 2DZWA 1SR9A 3PSWA 2YXGA 1OK4A 2X1SA 4FX7A 4OHQA 1H1ZA 3N19B 4UR7A 4HHPA 1WV2A 3LOTA 1K02A 3B05A 2CLEA 3C6CA 3QMSA 3IRDA 1TB3A 2Y89A 2VC6A 3CT7A 1H62A 3W7IA 4N9BA 1R2SA 1UBSA 3PR2A 4JTTA 3PULA 2J9YA 4NXKA 3TQVA 3W2JA 3W1QA 2QDHA 4A2SA 3Q2DA 3TSBA 3VKJA 4DO5A 3NQVA 4ALDA 1VYSX 2VEMA 3JRKA 4NUWA 3P8JA 2JKAA 3NQEA 4O1DA 4P61A 1H63A 4DF2A 5H2ZA 4X22A 1A5BA 4UFIA 3CPRA 1Z41A 1OYCA 5AC6A 3UYCA 3DAQA 3K30A 3BW2A 2ZRYA 2RDTA 2OT0A 4MFDA 1B4KA 4JTEA 4GUGA 3KX6A 4ADTA 5F4WA 3A9IA 3JS3A 2A6NA 4RJEA 1W5NA 5DCEA 3T7VA 6TIMA 3TSDA 3HGSA 4AF0B 3O07A 3LHTA 2DP3A 1FWWA 2QCDA 2R94A 4PCFA 2YPIA 3FEMA 4IUOA 1QOPA 4MPQA 1S5VA 1FCUA 2YX0A 4UFKA 4K36A 2Y7FA 4LUIA 3L21A 3O8AA 3P61A 3FYPA 4JS3A 4LS2A 1TPVA 4QSHA 1A5SA 2PURA 3G22A 3V75A 1FWRA 1XM3A 4AVFA 1R30A 1AK5A 4O4VA 1M7OA 1LP6A 3GIYA 3ABQA 3UWWA 4GWEA 1DQXA 2R8WA 3W7PA 2V5BA 3P74A 3QPYA 2ZTJA 1AL8A 2YR1A 3N3MA 1T8XA 4M6QA 5HR7A 1VLIA 5EL1A 3T40A 4BI7A 1GTHA 4TIMA 2Q3OA 3HPZA 3M5XA 3GDRA 4Y96A 3RK8A 3NL3A 1J4EA 5HQEA 4MZ8A 3MYPA 1JJKA 2GJLA 1XUZA 4X3ZA 4WY0F 1JCLA 4C1LA 3NQ8A 3KRZA 5D38A 4LW7A 1LOLA 5HJLA 3FIGA 1DV7A 5HULA 1ME7A 2QCCA 4MLJA 3S5NA 4M6PA 3S6DA 4Q32A 3EEGA 5F2MA 3RLVA 3BG3A 4DXVA 3LHVA 4NX0A 4LVBA 4UIOA 2TMDA 4M19A 2EGZA 3G8RA 5K4XA 3TUUA 1K8ZA 4MUZA 4E2BA 4HNNA 3TKFA 4AAJA 3M43A 1W0MA 2Z6IA 1GYNA 4FNSA 2YFNA 4IWWA 3LXCA 2VENA 4ADSA 3O1NA 3MWAA 1W54A 4UTWA 1FXQA 3V1PA 5C6MA 4HPJA 3UXAA 3P67A 2V2HA 2VELA 4LOCA 4JD4A 4N9DA 1M5WA 3KHJA 1O60A 3S1VA 1MZHA 2ISWA 2TYSA 5AOUA 3L5AA 1N8FA 2AQWA 4O1BA 4IMDA 3MP5A 4XUGA 1OYBA 4ZQNA 2C19A 3W83A 3OEXA 3L0KA 3ZR4A 3UD6A 1RZMA 4KFNA 1OFAA 2TSYA 4DELA 8TIMA 4IXHA 3SY5A 2A7NA 1TPFA 4WX2A 4WUIA 2C14A 4JX4A 3TC6A 5KTLA 2A1YA 1EUAA 3WK2A 5G4EA 3B8DA 3FJLA 1TPC1 3NG3A 3QW4B 4U28A 3UXDA 4MKNA 1X6UA 3W86A 3QZEA 3MYOA 1KM2A 3W88A 3UZJA 3BK0A 2B4GA 1T99A 3W70A 2ZZ5A 1GTEA 1XI3A 3UWVA 3GVGA 3QC3A 1X1ZA 2ZZ3A 2H90A 2BTMA 3P5YA 4ZL1A 5U7SA 4TMCA 3VI2A 3N2MA 1SQ7A 5EYWA 5DY2A 1ZFJA 1EB3A 2NUXA 3IVTA 3QSTA 2C3ZA 3TW6A 2FDSA 2YZRA 3NXFA 3NL5A 3A5VA 4Z1AA 3P5ZA 4QAIA 4IPIA 4AF0A 1TSIA 1RR2A 1X1OA 1AW2A 4U4MA 3N34A 1OFBA 4NZJA 2V9DA 1KV5A 3F1QA 1NAL1 1SU5A 4K38A 1KFJA 5LNSA 5AYYA 1MEIA 3M0ZA 3R2GA 4KFPA 1WXJA 1SZNA 4K8EA 4OQVA 3R89A 4XBKA 4XWUA 1NF0A 3THQA 1LBMA 3W2MA 3MP4A 1VQTA 3W7GA 1FWNA 3MW7A 4JR5A 2ZRXA 4XKYA 1XUUA 3C2FA 3NQMA 2NXGA 3VNDA 3C3NA 1HUVA 3GNDA 3BG9A 3GAYA 3G24A 2ZZ1A 4A21A 4QM1A 3TXVA 3M16A 3HG2A 5U4NA 1JRBA 2FFCA 5FF4A 3S9YA 3SI9A 1FDYA 2OX1A 3LM7A 3W1PA 4Y8FA 4Z0JA 2WV8A 5K3VA 3MP3A 3EX6A 1EA0A 4GNJA 3P80A 3G1DA 1Q6RA 2QCEA 1FCBA 4IMEA 1OK6A 4UC5A 3QMRA 1TPH1 1R2TA 4O16A 2DZVA 3I65A 2VFHA 4O18A 1KTCA 3C2OA 1OYAA 2ZTKA 3USBA 3G1AA 3QH2A 2X1RA 4GXMA 1I2NA 3PY2A 3WJXA 3L5MA 1IXNA 4FNQA 4JDBA 1ZAIA 4ONVA 1VZWA 3C2VA 4ORMA 1D3GA 3WK1A 1DL3A 3L0NA 3TX9A 4MZYA 5K2ZA 4LY8A 3MBFA 3M44A 3P84A 3GB6A 1EIXA 5AHIA 2E6YA 5D03A 2WPBA 1Z44A 1KTBA 4FNUA 2J88A 3HIJA 4UTMA 1AL7A 2QUTA 2CWNA 5F4XA 3ANYA 4RXFA 3MHFA 1BWLA 3GXPA 4FO4A 3R12A 3TMLA 2W0UA 2GUUA 4PL2A 3E96A 2CLKA 4NX5A 4ORIA 5D2VA 5LNWA 1J2WA 2WJZA 1TYGA 2ZRVA 3EX3A 1WOBA 3OIXA 5D09A 4N4PA 1G69A 3PAJA 2GOUA 4IPJA 1ML1A 5EA9A 2FIQA 2NZLA 2WSQA 5IBXA 3NYZA 2ZA2A 4CNNA 5KZEA 1G7UA 3BLIA 4O53A 1P5BA 1EP3A 2GQ9A 1P1XA 1GPWA 2VEKA 1E51A 2VEPA 5K7JA 2H3BA 2Z6JA 1OF6A 5LSMA 3ATZA 4JTLA 3CLMA 3YPIA 1G4SA 2XN0A 3B0VC 2ZZ6A 1D3HA 3GKAA 1JR1A 2CZDA 3KVKA 3W2LA 4PA8A 4PEKA 1F5ZA 3W1MA 5HWMA 3KXQA 5I3GA 1Q6LA 2VFIA 3C52A 4DQWA 3DFNA 3LCLA 3NO5A 1GEQA 1W56A 4XTDA 1VHCA 4MZ1A 4I7VA 2ZA3A 3W75A 2B7OA 3BG5A 3LLFA 4LV4A 3NM3A 1DBTA 1DORA 5G1TA 4NQ1A 1JRCA 2PC4A 4OWGA 2B7QA 2FLIA 3GDMA 1FCQA 1THFD 4KKXA 4CQAA 1W3NA 2JKPA 1TIMA 2CZFA 3W2NA 1V7YA 2A7RA 1C9DA 1OG0A 2QUVA 4WY0A 3DFTA 1GJPA 1LCOA 4IQLA 5F2IA 1UUMA 1QMLA 1SPQA 3LV5A 3W7KA 2GQAA 2VFEA 1ZJIA 4ML9A 3DXIA 4O14A 5CZ0A 2Y85A 1XBVA 1TV5A 4K7VA 5I3FA 1QWGA 1ADOA 1YDVA 3TFXA 4OV4A 2QAFA 4BK9A 4EVZA 4OGZA 2NX9A 1QO2A 3LBCA 1L6WA 3TQKA 5LHEA 1EPXA 4H4IA 1KM1A 3TFCA 1DJQA 2ZRWA 4Z1DA 3DHDA 3FA5A 3O05A 2VFFA 5EPDA 1XL9A 3PUDA 4LC6A 1G67A 3M1ZA 3QF0A 3OVPA 3CEUA 3QPZA 1W3TA 4AHOA 3NNTA 5AN7A 2A6LA 1TPB1 2W6RA 1FQ0A 4UXDA 3TV8A 5LGXA 3S5YA 3EX1A 3NPWA 4RKAA 3UWQA 1OVDA 3RF9A 4DO6A 2VKZG 2A7PA 5DY3A 1TRIA 1QR7A 3SFKA 4DPPA 2J24A 2CZEA 4Q4KA 4FB7A 4LC8A 3PUOA 4HN4A 2FJKA 2QCNA 1QO5A 4K8HA 3N14A 3CWOX 3ABOA 2QJIA 4K37A 4JNMA 3BLFA 1MEWA 2RDWA 1YTDA 3Q94A 2WSYA 4IGHA 4JDYA 5AHMA 4UR8A 2TPSA 4A29A 4JN6A 1GG0A 1WQ5A 1LLZA 4A3UA 3CC1A 5FF0A 3S5ZA 5T26A 3NQDA 3P81A 3LCWA 4LVFA 1KM3A 4W9TA 3TCEA 2ZRUA 3U2OA 5LNUA 1I2RA 4GUJA 5D2TA 1EUNA 4Z08A 2W79A 1EWDA 3W1RA 3NQFA 5FEWA 2FPYA 4HNUA 1I2QA 1H61A 3W7OA 2X30A 2Y61A 4NNAA 1LRTA 4ZQOA 1I4NA 3W3OA 3MMTA 1F6KA 1JUEA 4ZQMA 3PVFA 4IX2A 2LLEA 1IGSA 4CCEA 3TIMA 1EWEA 3EKLA 1R46A 5AFDA 5C55A 4XZ9A 1P4CA 3L66A 3NQ7A 1W1ZA 3ZWTA 3LCXA 3HO8A 1PV8A 2J6XA 1V5XA 4KWVA 3H55A 1SW0A 5KZDA 3DENA 1IXQA 2P1FA 2R91A 4AMAA 2Y88A 4KFOA 1OX4B 5GVJA 1QDSA 4WOZA 1B4EA 2ZYFA 4L4MA 2G97A 3W76A 1VH7A 4UMAA 3NZRA 1TREA 4XBSA 1H7OA 3I7QA 3BO9A 1Q6QA 3EWXA 2UV8G 4O0ZA 1JCYA 5CPNA 3W74A 3TROA 3B0PA 4JIPA 1UJPA 1LOQA 1KA9F 2FTPA 3Q37A 3SIZA 1W37A 4ZMGA 4WOQA 1FX6A 3TC7A 3PBVA 1AMKA 4MY8A 3TU9A 4BFAA 3GK0A 4O54A 4QQ3A 2V2DA 1H7PA 3GX9A 3DFSA 2I1OA 5BW6A 2CFFA 2FPTA 1W5OA 3R13A 1YPIA 2O7QA 3PBUA 3RLUA 1Z48A 2B7NA 2C13A 4AWTA 1P0KA 4OBTA 3NEVA 2I14A 1JCJA 1OABA 3QRHA 4HSNA 2EPHA 2ALDA 4RR4A 2HTMA 5C5YA 4RX0A 2C18A 4RXGA 3W7EA 1S5TA 4HT3A 3TJLA 1GYLA 3GKFA 4DF0A 2ZZ4A 2QAPA 4MYAA 1L9WA 4FNPA 1WYIA 5AYXA 1QNVA 2WNNA 4ICNA 5HUOA 3BW3A 3CWNA 4Y90A 1Z42A 5DBTA 1TTIA 3BGGA 2NXHA 5LZLA 4E0CA 3TAKA 3HB9A 3PUEA 3PB2A 3QM3A 4E38A 1QPQA 4ZZ9A 3GDKA 5FF7A 2Y70A 4X2RA 3G18A 5CZSA 3IVUA 2GVGA 1JCMP 3TA6A 4UTJA 5D02A 1FDZA 4IOTA 3G1XA 4FNTA 4EF8A 1W3IA 5F4SA 4AXKA 3PBWA 4O4WA 3M9YA 2Z0IA 1B3OA 3ELFA 3SGZA 4D2JA 3HGRA 4HSOA 4LWWA 5AC8A 3STFA 3NGJA 1HFBA 4O50A 4PTNA 3UWUA 1KTNA 3EWZA 1RQEA 2PCQA 2CLOA 5L6UA 3G1FA 3PBYA
chains in the Genus database with same CATH superfamily
4YIWA 1HZYA 3FJ6A 1FCVA 3POCA 2EPLX 1MSSA 4G5DA 3PB0A 4TTGA 2G50A 5K9DA 4S2CA 4PCTA 2PF0A 4B2DA 1OD0A 4PUUA 4HCDA 3D46A 4LJ3A 4GZ7A 4JNZA 3BURA 4O52A 1TRDA 3S9IA 5G1MA 1K03A 3WELA 4QLJA 3AJ7A 3V5FA 4ZOBA 4MY9A 1PVNA 1F2JA 3QQ0A 3M5VA 1AW5A 1SFJA 3URNA 3H2NA 1UWTA 3PZGA 2D0HA 4KCTA 4GX8A 3LUTA 3E2RA 2BHZA 2NQLA 2PDQA 1RA0A 2Z25A 3DOPA 4H9ZA 5D8ZA 4XD3A 1UMLA 4G9PA 1RSCA 1PX8A 3TYUA 2HE8A 4HTBA 1FVPA 1PHWA 3PUGA 2J25A 4HTYA 1IR2A 3ZVIA 1X98A 1G4TA 5IDIA 1A53A 1LLWA 4UQAA 2PDMA 2P3EA 4DF1A 4BI6A 1R47A 1EYEA 4UTKA 1EX5A 3G8EA 3OP2A 2KZHA 3ANVA 1A50A 1LUCA 1UQYA 3FKRA 2HMCA 1I0BA 1PKNA 1ISYA 2EBNA 2OO6A 3UR2A 4HK7A 3M6YA 4PTDA 4NNBA 4DN1A 1AZ1A 1XIBA 2P76A 1P0NA 1RJRA 3M0MA 4HMEA 4W8LA 3W84A 1E0UA 3GIPA 1QTWA 3P82A 3QOKA 2QJMA 4O1CA 1OC5A 2UWFA 4AEEA 1Q45A 1LWJA 3O6AA 1EJTC 5JBEA 4YNGA 3L5LA 1DXEA 3MO4A 1AQFA 1K70A 1VAHA 2PUZA 1XIGA 2YSWA 2HNEA 3SURA 2C79A 2AKZA 4O12A 4QRNA 3N2CA 3P6LA 3NL6A 4MB4A 4UTUA 4FK9A 3AJXA 4XG1A 4HU3A 4XZMX 5HWNA 3LCIA 4L65A 4U2YA 2CCRA 4KWWA 1Q2SA 3B04A 4AWSA 1U22A 1XKYA 3A12A 3ARTA 1KCKA 1M7PA 2VOTA 1KXQA 1GG1A 1MW1A 1S2AA 2J62A 4GYFA 2XH2A 3TLQA 3PFRA 3ITLA 1ZCOA 1TPDA 2H3DA 3QMTA 5DXYA 4X0NA 1PWMA 2Y7DA 2WANA 5BMWA 1QOQA 2JEPA 1I45A 3HF3A 1UKQA 3STPA 3WQFA 1O12A 4DAIA 4HIBA 3ME3A 3ZVHA 3ALGA 4M24A 3GW3A 1F6PA 1J6PA 3MCNA 2RDUA 2XFRA 4QR6A 5E70A 2Y24A 2PDIA 3TR2A 2H8XA 4LVDA 1KW1A 1NDVA 3NURA 3M5YA 2P3ZA 5CJMA 2EO7A 2BHUA 3N6JA 2I9EA 3K5XA 2GOKA 2BGSA 1HL9A 4ZB5A 4K1WA 3R8RA 2Q8LA 4IQJA 1NOUA 2WXDM 1XSIA 3SQMA 2GGIA 4RLIA 4IJRA 2OZ0A 5C9UA 2C16A 3M7SA 3VD9A 3CB8A 1NM9A 2JGQA 4Z0SA 2D3NA 5GPRA 5JU6A 4H9UA 4HK5A 1PE1A 3H2FA 5FIPA 2XWDA 3RMEA 5IBXC 1EF3A 1H7RA 3KL3A 4IL0A 4AEOA 2BLEA 1CECA 2E0PA 6ENLA 5IM51 4W7VA 4DXKA 5A2BA 3E49A 1W5QA 3G1VA 4LYPA 4IMCA 4ZGYA 4HOXA 4UFLA 4CCZA 1M68A 4RE3A 3O15A 4NT0A 1TV2A 1TJPA 3KW3A 3GR8A 3CTLA 4W87A 2XJ7A 2CESA 2H8ZA 3A5FA 1KM4A 1Q2RA 2A21A 1WX0A 3O7UA 2ZX6A 4P7LA 4F0LA 3VUSA 3TYEA 2V67A 3TYBA 3S2JA 8RUCA 4JHMA 1A5LC 1ISZA 3SN4A 1GPFA 3DBPA 3TONA 1PTGA 1PZ3A 3T0DA 2NLIA 2BY0A 3F4WA 9CGTA 3AUOA 4WGHA 3WQVA 4ROQA 2VZUA 3N11A 1BGAA 3R0UA 1JCNA 1IYXA 4AD3A 1CLXA 2BDQA 3EDJA 3GR4A 3WLSA 3GVVA 3V18A 1NEYA 4A2RA 2WBGA 1PL9A 2G4JA 3DDMA 5EMJA 3W23A 1O4UA 4DNMA 2EPKX 1CIUA 2CLFA 2O7SA 3EGJA 1XDLA 2J7FA 2V82A 3N18A 3BPWA 3APGA 3WLKX 3N2BA 4JKKA 1QK2A 3T05A 1ZJAA 2A0NA 3UZ5A 4TV5A 2Y6ZA 2YDRA 1WUEA 6A3HA 3G3DA 3Q67A 5F7UA 1QCWA 4DEFA 1A5MC 3N9RA 3S5SA 1UA7A 2GGJA 1JZ6A 1IQ8A 4RV8A 3E0LA 5AHEA 1FTXA 3CM4A 1F74A 5EKYA 4JYEA 5HMSA 4C6FA 3NO3A 3EOOA 1E0TA 3C4UA 2QF7A 3KCOA 3OTRA 5FAGA 1MEHA 1YADA 4ZA0A 1G7VA 3VABA 1ZU8A 4LAZA 3KVMA 1KM0A 4IXXA 4C6BA 3P60A 1TCDA 4HA0A 2NVAA 4R3UA 1XINA 2D20A 1DOSA 4DWSA 4A8LA 4C6QA 3PTDA 4YTTA 2RAGA 4LY4A 2RGMA 1TZZA 4KCWA 3WDRA 1ISWA 4WF7A 2WPGA 2WZTA 3ABXA 4A3RA 5IRPA 4NZCA 4E2VA 1NH6A 1FH7A 1GNXA 3I6RA 3TC3A 4MWAB 2Y5EA 2QCHA 3OVQA 4H9XA 4HMCA 2VZTA 3SJ3A 3DGRA 1JUBA 2QDDA 1DJXA 2DUZA 3M41A 2IKHA 4DJEC 3EXTA 4L6HA 3T55A 1BKSA 2A3EA 1XC4A 2R24A 2P0IA 4PE8A 1H60A 6PTDA 2V30A 3EA3A 4CQ8A 4FOKA 3R4IA 4YVVA 2WC3A 3UT0A 3CIWA 3C0SA 3B03A 3F4CA 3M5ZA 2ZCGA 4L9XA 4QS6A 2OQLA 1POKA 1XX1A 1RK6A 5HBFA 3UG8A 3KCLA 3WLJA 2QCMA 3QKEA 1BWKA 3HG3A 1T96A 3S42A 1W8SA 4N02A 3TH6A 4ZQRA 3W6YA 3AZSA 5FI8A 3KP0A 1EA9C 2OZTA 1I9CB 2ATSA 4MJ2A 2V3FA 1GORA 1W6TA 3TQ0A 5D2XA 4PMUA 1RP9A 4V1YA 3M0YA 2EKCA 3BZGA 1F6YA 3VOHA 3UESA 1AG1O 1G5AA 3OZPA 4UTWC 1UP2A 1XFBA 1WE5A 1XH2A 4F0SA 3U4AA 2YDSA 4NSBA 1K9FA 5E1QA 4F40A 1XPGA 2C8NA 2AQOA 3ZLHA 3CL8A 4MOZA 3RJYA 3U6WA 1MFUA 3VZXA 4NZFA 2VGIA 1K9DA 1BXBA 3UCQA 2VQUA 3GNRA 1SW3A 3DYPA 4JCMA 5G2WA 3WL1A 3WNPA 3QFEA 4RZ6A 3SY8A 1LRNA 2X2GA 5RUBA 1TO3A 3SBFA 1HKJA 3S1XA 4XTIA 1O95A 3B0XA 5CGQA 4WIWA 3W37A 2ZC8A 2BBFA 3VKKA 3W2UA 3IWPA 3RPDA 3VVGA 3PTKA 3VNLA 3WLQA 3LN3A 2AAAA 2J7DA 1BSIA 3B0UX 3IGHX 4DJDD 1ZJHA 3EBVA 1H7NA 2B31A 2BGQA 4JFSA 4BF9A 1W5MA 3OHIA 1HG3A 5HNTA 4HMNA 1RALA 4FEZA 4GNVA 1VJSA 3FSUA 5T9CE 2J27A 4E3TA 4XZNX 1LROA 4WDUA 4NY2A 3RM4A 1E4LA 1XLIA 4HZ6A 4PMQA 3WDPP 1UR4A 4AHPA 3GU2A 4N6EA 5A95A 1O94A 1G4EA 1WXZA 1ECQA 2HBVA 4J5NA 4LT9A 5I78A 3CUXA 2PD5A 4PMOA 2NWSA 3E0IA 3TEVA 5J5RA 3SDOA 3EWBX 3MT1A 4FLOA 1JYVA 2D23A 1H4PA 2Z1WA 1RD5A 2A4AA 4HPNA 3VK5A 1JAEA 1E3XA 3F5KA 4ZB2A 2XGZA 5KSWA 3W26A 1XSJA 3UG3A 3VMNA 4WKHA 3K1GA 1TV7A 5ABTA 1AMYA 3RIKA 3C61A 1K9EA 3ARQA 5AC4A 4M6UA 4GFSA 2VX7A 2PRMA 2E6DA 4WSKA 3LGEA 3CUIA 4W86A 4A8IA 1Q6OA 1GVFA 1FHLA 2G5WA 2KAUC 1SFTA 3B06A 4FIRA 3B3DA 4UTLA 3PZVA 4UTIA 3TW7A 3H22A 1QNQA 3LSCA 4PUMA 2J75A 1TQJA 3INPA 1F07A 1XW8A 2X1UA 3S46A 3AHXA 3BH4A 3MUIA 4QJ1A 2XUCA 3HJEA 2WMHA 3NM1A 1J10A 3EWUA 1KKRA 4WZHA 1P43A 4PC8A 2A5HA 2IPWA 3LTPA 4NRSA 2G3MA 3RXZA 3NSXA 3LCFA 1G4PA 3S2CA 4H8HA 5IDZA 5TIMA 1KRBC 4A35A 2VM8A 3LRLA 3AYRA 1XBZA 1OFRA 4GKTA 1MVYA 2J7CA 3E12A 1GJUA 1S5MA 1KGXA 4TR9A 3VKCA 3QEZA 2OQHA 1NFBA 2QEZA 1VRDA 3S9ZA 1UBPC 2P10A 2PRHA 4JQ1A 3AICA 2NV2A 4YWIA 2VQTA 1VS1A 3CH0A 2IXVA 2Z2UA 5HUPA 1BLIA 2R14A 1SO3A 1VLWA 3AFBA 2NWRA 4LV9A 3M0XA 4UB9A 1GJWA 3XISA 3FW6A 3O2LA 2BHYA 3W7HA 1LQ2A 1YDNA 4OJYA 2HV5A 1QOXA 4S3AA 1FY6A 4RV3A 2FH6A 1JGMA 3MV01 1XIHA 2BVYA 1B54A 5CKSA 5C9ZA 1WXYA 4LVAA 4I7WA 1JUKA 4JN7A 4CU8A 1RA5A 2E8ZA 1V03A 3BGJA 2Z7KA 2VGBA 3G0XA 2ALRA 1L6GA 4WSHA 4S2BA 3NZGA 1S3HA 2GVEA 2GGGA 1ZSXA 4HJWA 6XIAA 2VFDA 4PFMA 4C6PA 5REQB 4PRTA 1SJDA 1XYAA 2V5JA 3EB3A 5C7HA 3S6TA 1LT8A 2ON3A 4XAYA 2PRLA 3B9DA 3VMPA 7ENLA 4Q8VA 2JQXA 2QDGA 1OFOA 2XIIA 4HMDA 2P5NA 2HS6A 3EEZA 4EOUA 4AIOA 2PE4A 2TODA 2WVVB 2XN2A 1HTIA 1KRCC 2V8ZA 3TNOA 1EDTA 1SMDA 3KRSA 2Z1BA 5LXEA 1XP3A 4WRHA 4FOJA 4GC4A 1ESWA 1I60A 1L6YA 4U33A 4C1NA 2QUMA 1L2QA 5EGRA 3CWHA 3OJGA 2OJPA 5AHFA 5CQ1A 4UCGA 1CW2A 3NAVA 1MQPA 3WENA 2CLMA 3HURA 4BCEA 3WQ4A 3F4VA 2CLPA 2GZXA 2W27A 4IP7A 2PWHA 1EDGA 3EXRA 4FX6M 5E9AA 4UQBA 1TPWA 4H2HA 3H7UA 1AUSL 5G5IA 2DQXA 1U1JA 5MKGA 1LF1A 4WXZA 4N42A 1JVNA 2AOSA 3GVWA 1V6YA 1TELA 1ZS2A 2X0SA 1XSKA 1TJ2A 3QGAC 4FX7A 4OHQA 4H9MA 4L1WA 3N19B 4C65A 4HHPA 4BQ5A 3MB9A 4CD4A 2QXWA 1GYMA 4U3AA 2Y89A 2VC6A 2WCSA 2X7WA 3NZQA 3QHMA 4WCJA 4KW2A 3W7IA 1XWYA 4N9BA 3WH5A 3BAJA 3PULA 1PBGA 3BAWA 3CYJA 4I5UA 5JUVA 3Q2DA 1AVAA 3TSBA 4DO5A 2GGHA 3WLLA 1EXBA 1KO0A 2VEMA 4L61A 3NQEA 4DF2A 5H2ZA 4E4PA 2C0HA 2DV0A 5CLWA 3UJ2A 3JU2A 3DAQA 3FSTA 1WP6A 2OT0A 4Y9PA 3CK5A 1B4KA 3PZQA 3KX6A 2OLHA 3A9IA 3VM7A 5DCEA 4L1XA 5BZAA 3HGSA 4AF0B 2C71A 4JFVA 3LHTA 2R94A 4YTUA 1B3VA 1QOPA 2XPKA 3H2CA 4DZHA 3TR9A 1FCUA 2YX0A 3GTNA 1V77A 3CYVA 2Y7FA 4LUIA 3O8AA 4JS3A 3P61A 4QSHA 3RM9A 3V75A 4Q8QA 3K4AA 4HBKA 1JZ4A 2X40A 1M7OA 1K8CA 1LP6A 3JVAA 3VIOA 3B8WA 4GWEA 3FVMA 4EANA 5DF0A 2XU2A 4CD7A 4GD0A 3COTA 4AY8A 1T8XA 1Y5WA 1VLIA 5EL1A 1NJJA 5FJPA 4IISA 4TIMA 2Q3OA 4JTCA 3SCTA 4IGNA 3GDRA 5I09A 2VCCA 3KRZA 5D38A 4KEMA 1ISVA 4LW7A 5HJLA 3FIGA 4NYUA 4AZIA 3IJ7A 1ME7A 3NJ3A 1WDRA 2OKOA 3EEGA 3BG3A 4PB5A 3OBEA 3ZVHB 1S3TC 4M19A 4Q8OA 1BHGA 2FZMA 3QZ6A 1K8ZA 4MUZA 3FA3A 4AX6A 4F0RA 1GKRA 3MC5A 1UZDA 3LXCA 1UR1A 3T1GA 2GJRA 3ITCA 4ADSA 3O1NA 3MWAA 1W54A 1FXQA 3NOYA 5FJJA 3V1PA 5C6MA 2XSBA 2V2HA 2VELA 3AXHA 3KBVA 3CXOA 1MZHA 3MP5A 3W83A 3VD4A 3L0KA 3H4GA 5CAHA 4MF4A 3KOYA 1OZQA 4B91A 5H8MA 2BOFX 1XV8A 3AS1A 4ZO7A 5KTLA 2XYLA 3WK2A 4D6HA 1KGWA 2F6KA 3NG3A 4BS0A 1AQ0A 4U28A 2E8YA 1BVWA 4TOQA 2YXXA 1GONA 3MYOA 3QZEA 4ZO6A 3BAXA 1QI0A 2B4GA 2EKGA 4PYSA 4D9PA 3LMYA 4GACA 2IKIA 2ZZ5A 2VO5A 1JF5A 5AY7A 1VB9A 3A3WA 1XI3A 3UWVA 1KBBA 1J0ZA 1PWLA 3QC3A 2FTWA 2H90A 1FWEC 1FKWA 5U7SA 3WD1A 4CQCA 3WUGA 1XQLA 3VI2A 2AL1A 2HCVA 1EB3A 1GUVA 3TW6A 4AYGA 2D0GA 2YZRA 3EPOA 4IPIA 2I56A 4QGCA 1TSIA 1EJWC 4AC7C 4IFKB 5TNVA 2REQB 4QROA 1OFBA 1KV5A 2WW5A 3UJSA 4WGXA 1B31A 5DFAA 4GBDA 1HIZA 3M0ZA 4D8LA 2ZX7A 2O4QA 2OB3A 1WXJA 4GLEA 3APYA 2QUNA 1R7AA 1M1BA 3KDOA 2V5DA 4XBKA 1NWRA 1JAKA 3BWWA 3EA1A 1R7OA 3G77A 1XD0A 3MW7A 2PGEA 1XUUA 1UWRA 3CJPA 1MXDA 3LNPA 1JPKA 1V79A 3F2DA 3C3NA 5CC6A 2BODX 1XRVA 2W9MA 3GAYA 5I3DA 3KCJA 2VRQA 1VEOA 2ZZ1A 1E0WA 3WQOA 4TXEA 1ZGDA 4QM1A 3TXVA 3HG2A 3WEOA 2FFCA 4XD4A 3S9YA 3SI9A 5MF5A 2V5KA 1HXJA 3W1PA 3H4WA 4Y8FA 3DEQA 3DC0A 4Z0JA 2WV8A 5HMEA 1EA0A 3P80A 3DIPA 3G1DA 3HN3A 2QCEA 2OWXA 4W4QA 1FCBA 1BYCA 1R2TA 3CUZA 2Y0FA 3T09A 3CHEA 3RJXA 2BOEX 4J3XA 2JEQA 4HNOA 3W38A 5ABHA 5M1TA 1UROA 2Z1SA 3BANA 1VZWA 2YCLB 4B3ZA 3KL0A 2VD9A 3N4EA 3HV8A 1A4MA 4MZYA 3WF1A 1JZ3A 1NELA 4ZTXA 3GB6A 4DWSD 3QY7A 5AHIA 1EIXA 3ZJKA 3SJNA 2WPBA 4H6QA 3VTRA 3HIJA 4GI6A 2QUTA 2YL5A 1DWJM 4R9OA 3C5QA 3NIYA 4AUBA 3AZTA 3GXPA 4DYJA 3CPUA 3E96A 4RDWA 5ABFB 1RH9A 2DW7A 3QY6A 2WB5A 5XIAA 2PTXA 3RUBL 1G69A 1TWSA 2WSQA 1C8QA 2ZA2A 5KZEA 4EX4A 1T5AA 1XIFA 4OFCA 4US5A 1P1XA 3LPOA 4P8WA 4DJDC 4OIFA 2Z6JA 1C8XA 4JTLA 2PTWA 3B0VC 4MG4A 1FWAC 3PPCA 3KVKA 4PA8A 5GJPA 2X0HA 4LFYA 3KXQA 1BRLB 5T8GA 3UJEA 1DJWA 2VFIA 5CC7A 1E1CB 2P8CA 4DQWA 4I7VA 1MQQA 3VXGA 4LNCA 3H2MA 4LV4A 1DBTA 4JNYA 3RITA 4DZAA 1OM0A 5I02A 2CHRA 1THFD 4CQAA 4S3CA 3AMKA 3KL5A 3PHAA 2XVPA 5CC3A 2A7RA 2PB1A 4NF7A 4WY0A 2WK2A 3DFTA 4I3GA 4IQLA 4X2PA 5F2IA 4ERGA 1SPQA 4ZXOA 1UIOA 3DXIA 4FOUA 1C8YA 3PZUA 4RW3A 2DGAA 2NLYA 5BXRA 2VDGA 4KQNA 2I5QA 1TV4A 4BK9A 1IT7A 4OGZA 3TQKA 1S5NA 2PGWA 1J11A 1NDWA 4H4IA 3AQUA 3D3AA 5E0CA 4Z1DA 1XIJA 1R3VA 3FA5A 4GYPA 3QV6A 2WMJA 1W8GA 5EPDA 4NASA 4L7ZA 4LC6A 2WZMA 1G67A 2VDIA 2CERA 3GQYA 3T0CA 2WYSA 5M3WA 2I7GA 2I16A 3NPWA 3K8LA 3RF9A 2XIOA 4DWSC 4JQ3A 1QWKA 3RU8X 1NWSA 2J24A 1PX4A 4Z42C 3PUOA 2QCNA 3PANA 2DH2A 1N2VA 3IJ6A 4XD5A 8A3HA 2HE5A 4IGHA 4PUKA 4QS5A 5FAJA 2PWUA 5T91A 3OQEA 5C9XA 3UG5A 1FWIC 3G2GA 4JN6A 1LLZA 4GIEA 2QPUA 3NQDA 2PWEA 2CZVA 1R85A 4OTKA 1VFTA 3TCEA 1V3JA 3U2OA 1I2RA 1EUNA 2PDLA 2W79A 1EWDA 3UFYA 4A3QA 3TTQA 1H61A 2X30A 4ZFCA 3I3BA 3RCYA 3W3OA 1F6KA 2ZVRA 4IPLA 1TFVA 1IGSA 3WQ8A 3NDZA 1UZ1A 4W8BA 2VC9A 1UJQA 1GOQA 5AFDA 1XLFA 3NQ7A 1H0IA 3LCXA 4ATWA 1PV8A 1V5XA 3W24A 5EFFA 1XR2A 3D6NA 1IXQA 2P1FA 2R91A 1S2CA 5GVJA 4WOZA 1B4EA 2XIQA 3NFUA 5EMKA 1VH7A 4UMAA 2XG9A 2WVUA 1V3MA 4NAFA 2EG6A 8XIAA 1ENUA 1B90A 1Z32X 1F8IA 4CQDA 1HQTA 4NHVA 1JCYA 3TROA 1TMQA 3O3RA 3NSNA 3LSBA 3VM5A 1MDRA 4EPBC 3T8QA 3TC7A 3K2GA 4MY8A 4BFAA 4IFKA 1V0NA 3GK0A 4RNHA 2V2DA 3VPLA 1H7PA 5E6ZA 4NKCA 1E43A 3R13A 1YPIA 1N82A 2O7QA 2VCBA 4Q8WA 4AWTA 1YDYA 4C7FA 2PA6A 3NEVA 1V02A 3VMOA 3QRHA 1ITQA 4HD5A 3WY1A 2QVNA 1S5TA 3AOFA 4HT3A 1IZJA 1WUFA 1TUXA 5AYXA 3BW3A 3ITVA 1Z42A 4Q4OA 3OYXA 4WKAA 1PYMA 2WWDA 1EJXC 3QM3A 3IJQA 4E38A 2J6VA 5FF7A 3I4EA 1XF0A 2Q09A 3G18A 3IVUA 1RP8A 1DJHA 1V3LA 4IG2A 2P50A 5A6JA 3B9NA 4UTJA 4C5ZA 3AAMA 5HPCA 1S1RA 3GFZA 4CNSA 2PP3A 1B9ZA 4O4WA 1B3OA 3ELFA 5CSYA 4LWWA 4V27A 1YE4A 2HVNA 3WCZA 4PMXA 4GVHA 4B15A 1UMYA 2Z1KA 1QHOA 2PCQA 2XDFA 1PJ9A 3UEQA 5M17A 1UH4A 3CZKA 2PCEA 4RE2A 1QNSA 3L4UA 2D2JA 3QGKC 4QTGA 1KWGA 4AHQA 3MHGA 4FR6A 5KITA 4ZOEA 2G95A 1OSEA 3ZMRA 3UVIA 1UUOA 1VFLA 1XXXA 4XK2A 2BX7A 1K3UA 1VYRA 4JKLA 3VYLA 2QLYA 3CAKA 3PJTA 5HAOA 1XG3A 1F3TA 1TX0A 1ZAHA 4YPJA 4RE4A 2RH9A 1KBIA 1XDMA 2GLKA 3N1AA 3I7RA 4S3FA 2OOGA 3GNNA 5CSRA 2CLIA 2WSPA 4YHGA 4OUIA 1KXHA 2PZNA 2C91A 1B3XA 1H5YA 3NOEA 3AYTA 5JMUA 3PP7A 4YL2A 4IPNB 3UWYA 3NQBA 4AZCB 2DUAA 2RFGA 4MVAA 3IGUA 1EL3A 4PTVA 4FALA 1E6ZA 3RX2A 2DZPA 4QLKA 3VZYA 1H50A 1SYTA 2C1HA 4FLSA 4FHAA 4AIUA 2MANA 5LA2A 3IUIA 4QBXA 2BG5A 4Q4RA 2DJXA 1OJXA 1DJNA 1KFCA 4J40A 1UIPA 4MLRA 2VYOA 1VBGA 4GCAA 1JDAA 2VEIA 3VD5A 3WJWA 2XGBA 4AD2A 3C8NA 1ODUA 1TJRA 4DWSB 1WZLA 3U4FA 5LNVA 1CZ1A 1BAGA 3GFYA 2JE8A 2C1GA 4MNMA 4Q7IA 4C6MA 3AMCA 3VX0A 4D6EA 3OLEA 5F1VA 4ADUA 1WDSA 2O9PA 4ZE5A 2Y63A 4BR1A 1O66A 1MQRA 1O5XA 3NA8A 1Z3NA 3W7MA 1XISA 3STEA 2D69A 1SJCA 5H8UA 3W6LA 3DFYA 3LM3A 5AC7A 1OY0A 4DIAA 3PC0A 3GYEA 4HVXA 1JPIA 3EWWA 2E6AA 5G4HC 2FZBA 4Z2LA 1YBQA 2CHNA 4O17A 5FJOA 4F0KA 1Z6KA 2VZVA 4O19A 3M0IA 3KBSA 3BOFA 3FOKA 3LERA 4I90A 4CQ9A 3RPMA 1CGYA 3ZSSA 1W1B1 4C7GA 3C86A 4OT7A 1H7WA 3BLPX 5ENLA 3W9ZA 3MSGA 2UY2A 1J5SA 3OVRA 2BVTA 3L68A 3GD6A 5C2GA 2GJNA 4PODA 3I6EA 5IXEA 3F03K 1G6CA 3LRMA 1BPLB 1J0JA 3B9AA 4GJIA 1Q5MA 3C3UA 1OC7A 1LUCB 1SUXA 5CPLA 1ZAJA 1N55A 2VUNA 2WAGA 3TMQA 3KAOA 4F79A 3ZXWA 1NVMA 3QJAA 2NW0A 2EPOA 1WZKA 3W71A 1DQWA 3E2SA 4ZCWA 4XBJA 2PDGA 4JTFA 5K4ZA 3SN0A 3EB4A 4FNRA 3DFOA 4Y6GA 3NQAA 3TSMA 4LAKA 3W2KA 1VCGA 4M3PA 1M6JA 3GXNA 1E56A 1UOZA 3TYDA 2QIWA 3PJUA 3HG5A 1C8VA 4AZHA 4O15A 5D37A 3LGGA 3Q45A 1AQHA 4LX4A 1CWYA 4DJFD 1JGIA 1XCWA 4MADA 3M7WA 1J0YA 3WDJA 2FQIA 3OHMB 3V0TA 2WJDA 4QDMA 3QYSA 1SZEA 2I5GA 3PNUA 3UY7A 1EBHA 4HA1A 4NZ4A 4HQVA 1XYBA 4NL1A 4X63A 4M0XA 5I23A 3LB0A 1EC7A 1W3KA 3AISA 2YLLA 4GZIA 4AW7A 5JH2A 2QIIA 3VILA 2QCDB 2ZXBA 4M7SA 3MQTA 2NQ5A 2AGKA 2GPTA 5HXMA 1W2VA 5BRBA 3KVLA 2WJEA 3O6DA 3UF9A 4B5NA 1XYMA 4BA0A 2Q3RA 2CBVA 3PZ9A 1SMAA 3PN8A 4A3YA 4CD5A 5BCAA 2AL2B 5KMYA 3GC5A 5CJNA 3T4CA 4I9MA 2A3HA 3SB0A 2G3JA 4R9XA 5DRIA 5AHNA 4HP5A 2V5CA 4XO6A 1L2UA 1YPFA 4MUPA 2FGLA 1EOMA 1H51A 1XCFA 4XSLA 3NQCA 2G3IA 4I8DA 3N2XA 3FGCB 2DZUA 3M47A 4JIQA 4BHYA 2E1DA 2CBIA 2YCIX 3DX5A 1T8QA 3B9OA 4F0HA 4DJFC 3QTGA 3BCJA 1SZRA 1IEXA 2ZXQA 3L67A 1WBHA 4AD1A 2W92A 2O0TA 1UYQA 3GAKA 4DYEA 3BAYA 1TWDA 3D3FA 3WDHA 1JNEA 2OG9A 3A4AA 3W82A 3QR1A 3PWAA 3PZNA 2DT1A 1JIBA 5BNKA 7PTDA 1A0DA 1XLCA 1E9ZB 2QCLA 4QEHA 3T08A 4RE0A 1Q65A 3GM8A 1VGAA 3EA2A 1TV8A 2PTZA 1B2YA 1KGUA 4EAYA 1JG9A 2PLKA 4CVUA 8XIMA 1TTPA 4C1KA 3DN5A 2E5DA 3LXAA 2R1KA 3P8IA 3KOZA 3EDDA 1FWTA 3VDBA 4KEUA 4W5UA 2HSAA 1UKTA 4IIHA 3DHFA 3T8LA 2YA1A 1WDDA 5B7ZA 4D72A 4F9JA 2Z27A 4MTVA 2WHMA 2PDNA 3NQ2A 4PTMA 2BVWA 2G0WA 2A2IA 3B8UA 2RDXA 2D2HA 2RHGA 1OZMA 1D8CA 1R2RA 2QCGA 1IXPA 3D5HA 1K7EA 3F4NA 2FPVA 3E9AA 4N4QA 2GK1A 3S6OA 3EX2A 2IMRA 2NXIA 4LUJA 4B90A 1PIIA 3L4TA 1E15A 4CCCA 3IVSA 4M5PA 3WO8A 2WC7A 3ARUA 5LIXX 2E68A 1G94A 1RCQA 4TUFA 2V5LA 1XIEA 3N04A 1M01A 4A3HA 2ZZ7A 2I9UA 4GUHA 4GY1A 1BSLA 2EJAA 1LBFA 2PPGA 3M6DA 1A3HA 1NF7A 1P0EA 1SZFA 4CEUC 4G1NA 1W1YA 2PTYA 1HJQA 3ONBA 2JGYA 2R6OA 3QQWA 4UTTC 3TVAA 4M6VA 4HJFA 1VP5A 2XZ7A 3FYOA 4J2PA 3E02A 4OKDA 3WDQA 3R6IA 1G0CA 1QJWA 3WQDA 5EBUA 1VIWA 1UG6A 2JKEA 4Y9AA 2QUUA 3BOXA 4B5WA 1NU5A 3T81A 1ECEA 3GU9A 1L6SA 4B5XA 5BYWA 3KBWA 4E8DA 4DB7A 4AD5A 1O5KA 3ABRA 4KGLA 2PD9A 3SRDA 2P0OA 5I3KA 3WNNA 4UMCA 1VJZA 4BKNA 1BF6A 5D9NA 1ALDA 2W61A 3M64A 3W7RA 4QDPA 2B7PA 1QVBA 3FVDA 3MZ2A 4KERA 4ES4A 1P48A 2Z24A 5A6MA 5MKGB 1VFFA 3EMQA 1Q3NA 5J5DA 3JZEA 5E9XA 3FXGA 1O5QA 3CZJA 1JPDX 5LA0A 3W1NA 3WFLA 2GSEA 4UFMA 3VKDA 2WM0A 2CEQA 2QS8A 5DN1A 3SCQA 4GGHA 2OEJA 4QJ4B 5CZTA 2NQHA 3O0KA 1MXGA 2TRSA 3Q58A 1S2WA 3PAOA 1EEXA 4O11A 3WBYA 1JPHA 1A5KC 1I8JA 5I3JA 3EPMA 3TWBA 3W7QA 7REQB 3C2RA 2G4FA 3N17A 2CYGA 2E6FA 1JZ2A 3RX4A 4MSSA 4LCSA 4CVWA 3DU0A 1LOSA 1R3SA 5E0KA 4FLRA 2D24A 1OGSA 1IZCA 4L9ZA 1VFUA 2OU4A 3HQNA 1V51A 2HVOA 1UH2A 1T0OA 2ISSA 4I5RA 3CIXA 3HGJA 4UNIA 1IWAA 1SSGA 3H7RA 3QY8A 4P5UA 3OIHA 3H53A 2PDUA 2VJXA 4TQTA 4S3BA 4HZMA 4YCPA 4AZ6A 1H1YA 5TBOA 1IWPA 4ICMA 4Q33A 1E6SM 3U7BA 4BF7A 1E6RA 3BXWA 5ABGA 4IP5A 1RY0A 4KESA 4HHMA 3W02A 3EPNA 3S1WA 3SIMA 5MHBA 1X96A 5FEZA 1YXYA 4C7DA 3H70A 3SFWA 2NUWA 4IFOA 4GY0A 2Y8KA 2WCGA 2YDAA 1AH3A 3TOPA 3TE9A 2Y1HA 3W00A 1YLVA 1X7FA 3LCHA 1H7XA 4AIEA 3E0VA 3GLCA 3IUHA 4KETA 4IIGA 3WQGA 2E40A 1B0IA 3MVTA 3DC8A 2VFGA 4H19A 4MAZA 5I2UA 4Y9MA 3GWQA 3V35A 3STGA 4XVDA 4FX8A 4Z2IA 1VR6A 2CU0A 1GOOA 2BXVA 1KNWA 2ZDSA 3SUSA 1MMFA 3OA5A 4O10A 4GVFA 1EHNA 3T2PA 2FGZA 3AIBA 3LBOA 7XIMA 3HPXA 3L0GA 4GIYA 3BJTA 5XINA 4J3SA 3EKZA 3GG8A 5F2LA 2PODA 2DZTA 3JW7A 2HVMA 1GVSA 3FXYA 2Y7GA 1B5TA 1EOKA 3E3HA 4KCVA 1XKJA 2PDBA 2ZX5A 5M03A 1P6BA 3JUGA 3S8HA 1EGVA 1KBJA 1VPXA 1XRFA 4AZCA 4XV0A 4Q4SA 1HGWA 3ZO9A 4KF1A 1FH9A 4HA4A 4NZ5A 3SSZA 2J9XA 3IIZA 3ORWA 4US6A 4K39A 3ARVA 3FNDA 6CGTA 2OCZA 2OGYA 3UZYA 2QVHA 2W62A 2YL8A 3R79A 4N2YA 1KBLA 1EIBA 3CV1A 1WKFA 5C9RA 2EJ1A 3SQLA 1GZGA 2V6AA 1ZY9A 4XQ6A 3MPGA 2JF7A 3SGUA 3RGTA 5I24A 2R1LA 1ME8A 4BZYA 4PR4A 4UQCA 1ZNNA 1XLEA 2WNZA 1YPXA 5HINA 4MIMA 4JTSA 4QIUA 3VGBA 4AB4A 2WZIA 1UHVA 3NWRA 4DM1A 1Y7VA 5G2HA 3TTYA 2QR6A 5E93A 4E8GA 4E8CA 3MJMA 1IEQA 3BJSA 2E25A 2Q01A 3WX7A 1AA1B 4KEZA 3RR1A 4OV9A 3CLWA 2Z29A 5LGZA 1CXIA 2YFOA 3AIWA 4JEJA 2VVSA 1H2JA 5ABFA 1P7TB 2JBMA 4QITA 4A4AA 3G1HA 3HPSA 3W6MA 1G01A 2YW4A 3MI3A 2W3ZA 4US5D 1GQIA 4REQA 2W4XA 1ZTVA 2GVJA 3BLLA 1HT6A 2XN1A 4IG2B 3ABSA 2NX3A 1FXPA 2VRJA 3DG7A 3KOFA 3B4UA 4NG3A 1EQCA 3EX4A 4HPGA 3GXFA 1OT1A 4U5KA 4E4FA 4LCRA 3LHYA 3HA1A 3HQ1A 1D3CA 3WD2A 2QCFA 4AZGA 3VNIA 3VCRA 4I6VA 3UPWA 1NDYA 3K46A 5FEPA 4LVGA 3SQSA 1PKYA 5DELA 1US3A 1TJ1A 3NCOA 3M4HA 2X09A 4RDYA 3U3HA 2CBUA 3LQGA 4J4KA 2J7GA 5HMFA 2VR4A 3PPHA 1PHQA 3AWOA 3WDIA 4LALA 3UGVA 3WG6A 1IIGA 1TVLA 3UY8A 3MHUA 2QJGA 3A47A 3CPGA 1I1XA 1WO2A 4N6FA 1LL7A 4LUSA 3C0JA 3CO4A 4QDWA 1DPMA 4GZJA 2JIWA 4UUIA 1CDGA 4MB3A 3UVAA 1GOXA 4CGTA 3NPUA 1KM6A 4CNOA 2QV5A 1GOKA 1PKLA 1SR9A 4FA3A 4K68A 1OK4A 2XM1A 4UCFA 1H1ZA 5HJYA 1JD9A 1VD6A 4W85A 4S38A 2XINA 2CLEA 3QMSA 3IRDA 1TB3A 4ERAA 2VZOA 2ISFA 3GC4A 4GVGA 4DY1A 3IS4A 1R2SA 4OVXA 1UBSA 3CQKA 1LWHA 2VRKA 3E5BA 2J9YA 4NXKA 3W1QA 4FS9A 2DSUA 4A2SA 5ABEA 2GJPA 1P0DA 4NUWA 2JKAA 1H63A 4X22A 2Y8UA 2E28A 4W89A 3GC2A 4JHOA 1C91A 1GVIA 3W4RA 5AC6A 3G1RA 3THDA 4JIRA 3K30A 4HK6A 5A6LA 1GW1A 2UBPC 5A6KA 1UR2A 2DY3A 4WSJA 3I3DA 1E6XM 1QW8A 2ZUUA 4GUGA 2WHLA 4ADTA 4R7WA 1TWZA 1DE6A 1W91A 2UY3A 1ITCA 3JS3A 4RJEA 3TW9A 5D9OA 4HPHA 3T7VA 6TIMA 3TSDA 4OBRA 1QI4A 2YBUA 4EWJA 2DP3A 2QCDA 4BQ4A 3FEMA 2X8RA 1J2BA 1V93A 4K36A 4DI9A 3FYPA 4FI4A 3WLIA 1XM3A 1R30A 3WKZA 4ZEPA 4O1EA 2AMXA 2YBVA 3P74A 5CEWA 2QGYA 1P1MA 3TA9A 4M6QA 1X1NA 4IIBA 4BI7A 1GTHA 3GUWA 2Z00A 3HPZA 4ROPA 4EAMA 2GJXB 3Q65A 1US0A 2P53A 4B2DD 3NL3A 2Z2BA 5HQEA 1Z9AA 4X3ZA 4WY0F 1UP0A 4C1LA 3LY0A 1WNOA 3HFTA 2V69A 4MLJA 4ZBCA 3UCCA 3S6DA 4D6JA 3V7PA 5FOOA 1NDZA 1BWVA 8CGTA 2IUZA 1M65A 3NYDA 1RVKA 4Q8PA 1B3YA 4EXBA 1AQMA 3G8RA 2VP8A 1E71M 2DSWA 4HNNA 3SCUA 2YFNA 5JH1A 4PSPA 1T7LA 3A4XA 2VENA 3M0KA 1HP4A 2NVCA 1BQCA 3PJWA 1HVXA 3QLDA 1M5WA 1KCZA 4C6EA 1O60A 1IT8A 3S1VA 2ISWA 3A64A 3O9NA 3L5AA 4XX6A 4O1BA 1C90A 2AQVA 1IEWA 3WIJA 2RUSA 3OEXA 4NAEB 3ZR4A 1RZMA 2HK0A 2QHAA 3KWSA 4IXHA 1BF2A 1TPFA 3GXIA 4WX2A 4JX4A 3TC6A 2A1YA 2W67A 2VVNA 5G4EA 3B8DA 1UWUA 1TPC1 3P0WA 4GX9A 3M07A 3ARPA 2NQJA 3GNXA 4MKNA 1EZ2A 1X6UA 3VZZA 3W86A 2WMIA 4AC1X 1KM2A 3W88A 1HKMA 1AH0A 1WKDA 1T99A 3T2OA 3W70A 2CETA 3EAUA 4Y2WA 3N13A 3EWDA 1W9VA 2ZZ3A 4F0MA 4TMCA 3RRAA 5AC5A 3N2MA 1SQ7A 5EYWA 5DY2A 1PEZA 3QXBA 1RBLA 4HA3A 4U31A 3QKZA 2WLZA 4Z1AA 3P5ZA 2PS2A 4R7OA 4AF0A 1AW2A 1REQA 1Y5XA 4U4MA 3N34A 1R6WA 4GC3A 4GQRA 1SU5A 1KFJA 1D8WA 4IGMA 4KFPA 4B5UA 1SZNA 1V7AA 3AZRA 2J78A 4GQ0A 4OQVA 3R1ZA 4V2XA 3R89A 3THQA 3UA4A 3CUFA 4QG9A 2ZRXA 3OYZA 2IW0A 1TX2A 4XKYA 3M0JA 3NVDA 2OWWA 1BD0A 2NXGA 4Y8EA 1SJAA 4JHZA 1JXKA 3E1F1 2PAJA 3BG9A 1EGZA 4PCPA 2WBKA 4YVXA 4UQEA 2NQZA 4DBSA 3CQHA 1TR1A 4A21A 2FVKA 5CH9A 1DIOA 3MCOA 3WQ6A 3T9PA 4KH2A 1E9YB 1EJVC 4AD4A 1CENA 2XVKA 4PTWA 3OODA 1D2KA 4MB1A 4G56A 2Z1XA 1AODA 4FR1A 5K3VA 2QPXA 3MUAA 3MP3A 4JQ4A 4QE5A 1Q6RA 2J77A 4O1FA 1WDQA 5A6AA 1TPH1 4MHBA 3I65A 5EMYA 2BMBA 1U30A 2DT3A 4H8NA 1KTCA 4KRTA 1JL8A 1S38A 3G1AA 4JZ5A 2DFAA 3QH2A 4J2MA 4GXMA 2PGRA 1XJBA 5A69A 3WJXA 4JDBA 3BQ6A 3SUUA 3C2VA 4ORMA 3ABZA 4LY8A 1E0XA 3TYAA 3BZJA 2ASHA 4BJHA 3P84A 4JTAA 3ZSTA 2PMQA 5CAKA 1L6FA 2HEJA 1PTAA 3U7VA 3W28A 1DIKA 1AL7A 2QW5A 3MHFA 1LQAA 3WLRA 1TKKA 4FO4A 3TMLA 1V3KA 4NX5A 1EO5A 4ENLA 2KX9A 1J2WA 2JFEX 2WJZA 1H09A 2IPJA 3N25A 5D09A 4N4PA 2Z1VA 2W5FA 2R1MA 1ML1A 5EA9A 3Q4DA 2NZLA 1Q13A 2MNRA 3NYZA 4CNNA 4H41A 3BLIA 1F4HA 4O53A 1CXHA 3VOJA 2XH4A 1EP3A 2PSNA 2VEKA 2WQDA 3U0HA 3ZM8A 3HV9A 3V0UA 2H3BA 1A4LA 1GKQA 4DNHA 3N2OA 3F2BA 1E73M 4LYKA 5HK4A 1ZBCA 1D3HA 1JR1A 3SUWA 1VKFA 2EG7A 3CAWA 2CZDA 3W2LA 4W84A 3W1MA 3OG2A 5I3GA 1FWGC 1Q6LA 2YCLA 3DFNA 3NO5A 1GEQA 1QW9A 1VHCA 4J28A 4MZ1A 5AKQA 1A80A 3BG5A 1NTHA 3NM3A 4INFA 4XZHA 3GG1A 1JRCA 2PC4A 1AFSA 3A6OA 2B7QA 2XVLA 3GDMA 3MZNA 4EACA 1FCQA 1W3NA 4DZ5A 1E1CA 4ACZA 1YIXA 1XIDA 3QFWA 3AMLA 2FFIA 3UERA 3WUFA 1LCOA 2PBGA 2VGGA 3U5YA 4Z2GA 2VFEA 3A4WA 5HANA 5C7VA 3WBXA 1O1ZA 2Q6ZA 3A9BA 4F2BA 2OYKA 4QLLA 4DZIA 1KWKA 1ADOA 1H11A 3TFXA 2QAFA 3VA8A 1CLVA 3LBCA 4FP1A 4GQGA 3UETA 2DSVA 2PDJA 4GKLA 2NT1A 3TFCA 2ZRWA 4Q3MA 4IQDA 9XIAA 3BAIA 2VFFA 3FYYA 1DWAM 4PBGA 1JDEA 3MKKA 3L7RA 3QF0A 3QPZA 3NNTA 4S39A 4TV6A 5AN7A 4PBFA 1TPB1 4OUEA 2YJQA 3TV8A 3S5YA 3EX1A 1UP3A 4RKAA 2VKZG 2BASA 4IIEA 1QR7A 3SFKA 2CZEA 4Q4KA 4NZ3A 4FB7A 4CUCA 4H7VA 3CWOX 1MI3A 2NQ9A 4AQLA 4KIRA 1DTNA 1PAMA 2H9AA 1LT7A 1A5UA 4JDYA 2TPSA 3OPSA 3WQPA 4GOAA 1GG0A 1WQ5A 5FF0A 3VNMA 1HF6A 4Q4PA 3NQFA 2YZ5A 1OGGA 4HNUA 3W7OA 1R3WA 2Y61A 4NNAA 1LRTA 1KRAC 1X97A 3PTMA 1JUEA 2L5HA 5DMMA 3PVFA 3VKBA 2LLEA 1MUMA 3VNJA 1HJUA 1JEZA 3IPWA 4Y7EA 4Y9OA 3UWEA 3SCVA 1FWFC 5C55A 3CL7A 4XZ9A 3L66A 1RCOB 3SRFA 3QR3A 2E7FA 4Q8MA 1IT0A 1JNDA 2ZXDA 2BXYA 3H55A 5KZDA 3AU2A 1FHVA 1OX4B 2XTKA 4KMQA 1QDSA 3CAVA 5BRPA 2AL2A 2XSXA 2AGTA 2G97A 4OECA 3W76A 4HHLA 3WLMA 4F2UA 1W9PA 3MMWA 3USZA 3S4TA 4W7UA 3AXKA 1ZJBA 3TTOA 2FZ8A 3CB3A 1UJPA 3E38A 5EBAA 5DQPA 1GHRA 1ONWA 2AKMA 3WUBA 4D8ZA 1EZWA 1QI2A 3BJFA 2DZBA 4WOQA 4DHGA 3PBVA 1KXTA 5FJUA 1DYSA 5A8NA 4RDVA 1AJ0A 1X39A 3SAZA 3R0KA 3GX9A 4AU0A 3CZLA 3N15A 4W7WA 2CFFA 2FPTA 1CXFA 1C92A 2ZUTA 3RLUA 1Z48A 2B7NA 3RYSA 4RW5A 5DRCA 1P0KA 2B81A 6TAAA 3WBWA 1JCJA 1OABA 5DO8A 4RR4A 3QLLA 1QUMA 2ZWZA 3UZZA 4RXGA 3W7EA 3TJLA 1XRTA 4NI3A 3IJLA 2QAPA 4MYAA 3EDKA 1RUSA 5HUOA 3CWNA 4Y90A 5DBTA 1TTIA 1JZ5A 2OR2A 3FDGA 3PB2A 4IQEA 1CGTA 1QPQA 4X2RA 4XIMA 2Y5JA 5A2AA 3QN3A 3OLIA 4Y9NA 3GYCA 1JCMP 3G6MA 3RCMA 1FDZA 2OWCA 2X42A 1W3IA 5C2CA 3PBWA 3M9YA 2Z0IA 3ZOAA 3SGZA 1ONEA 4D2JA 5JBFA 5HQMA 4ATLA 1KTNA 3TLLA 1RQEA 4JPGA 4LXFA 1GQKA 5L6UA 3G1FA 1ZQ5A 4K3ZA 4MKSA 4M56A 4UNKA 1S46A 1BFNA 4C60A 3ZWSA 2V81A 1PKMA 1OEPA 3LBMA 5D9PA 2BGNE 4HSHA 4JL2A 4JL1A 4E4UA 3W1XA 4L4PA 4V1XA 3SUTA 1GGOA 3AI0A 4HCLA 1RAKA 5JIPA 2OODA 4GABA 4G2DA 4IIDA 1JULA 3B8SA 1E6PA 2VHLA 4NJJA 3PFMA 3BMWA 4WEVX 3U2ZA 2C15A 3TXZA 1EH9A 3W1TA 4Q8NA 2YA2A 4UZUA 1H41A 2Z28A 1EXPA 2FYMA 3GFXA 1PZ1A 2CNCA 4DRSA 2YL9A 1MO0A 4IICA 1E4IA 4Q22A 1PCWA 3TOYA 3STCA 3B0YA 4DBEA 1VCFA 4J27A 4NJHA 1ZALA 2J7EA 3PG9A 3FAWA 3DHUA 1CCWB 1QFEA 1OFQA 1E4NA 1CXLA 1TVPA 2G3FA 3IGSA 1V0LA 1R3RA 1UQZA 1GVEA 1F05A 4RNJA 3DFQA 2VC5A 3ITYA 5H91A 2C0AA 2FZNA 4LYRA 5GNZA 4MJMA 3KHDA 1E0VA 3SCOA 1A5AA 4X60A 2B0MA 4R27A 2OOFA 5ECUA 2PU0A 1JFXA 4V33A 1Z8AA 1U5HA 2A3BA 1EP1A 1K9TA 5C54A 3FY1A 4CLMA 2ODOA 3ZS4A 1A5OC 2PLJA 1CEOA 4JTIA 4OOUA 4H83A 3GDTA 3SW6A 1Z7AA 1WDWA 1HKVA 4OU1A 2HROA 4JQAA 1RXOB 4GQBA 3L9CA 4JQ2A 1WPCA 2Q02A 3FEQA 1XLJA 5LKYA 2VTFA 1HO4A 5L9FA 4QEEA 3VGFA 3AO0A 4LU0A 4CN6A 3G3MA 3P7YA 4A22A 5BXSA 4KS0A 4HYRA 3W87A 4Q8TA 3XIMA 1X8CA 3L12A 2ZQ0A 3SRKA 3CHCA 2HQAA 1L0PA 4L1GA 2DZSA 2VMFA 2QNEA 3R7MA 3G5EA 4D6IA 4N7QA 2PDCA 2DT2A 3WF0A 5A6TC 2PWFA 2FH8A 3S2LA 3CT2A 1W5PA 3T44A 1PDZA 1TE1A 1LG1A 4J7RA 1XG4A 2HDJA 4MNJA 1ME9A 4AIBA 5SWUA 5FKYA 2YYTA 1O1HA 1OX4A 3RMJA 5DT7A 3BLKA 1FWCC 3LI0A 1RVGA 1K77A 1Y0EA 3WMCA 1RJPA 4WXYA 1Q63A 1XFCA 3ARWA 4XKMA 4GCXA 4ZB0A 3B8TA 1FOBA 1J8VA 3LLDA 5CZKA 3EWCA 4ZO9A 3PM6A 2G96A 4BQ2A 4S3GA 3W07A 2PP1A 3CUHA 4ZQPA 3N29A 3RDKA 1EQPA 1FHDA 1GQNA 2BP1A 1KFBA 3T6CA 2DJLA 4YTRA 1YTKA 1XLBA 2QV4A 2AMGA 1V6VA 4DBWA 1UA3A 1ONRA 1P0BA 3EOLA 1OWQA 2O9TA 1SO4A 3UR5A 1RPXA 2OTDA 2X7VA 2YCJA 2EF9A 3GU1A 1QNOA 4POCA 1UD8A 4U10A 5E0FA 3MI6A 4AISA 2DDXA 4M7TA 3W7LA 4GXPA 2WVSA 5GQBA 3ITTA 3WK0A 1NSJA 4HNTA 1NY1A 5A8GA 2ZE0A 2XVGA 1S1PA 2PLCA 4MB5A 5CC5A 3SCPA 3MMDA 1J0HA 2EXOA 1MRAA 3U8GA 3UWZA 4X9SA 4GA8A 3DFPA 3TCSA 4Q6XA 1RCXB 1CTNA 4H9TA 3CH9A 3R5EA 4H04A 1B9BA 5HATA 4LAOA 2INEA 1BYAA 1AD1A 3BE7A 4DBUA 2QT3A 3PZOA 4IMGA 4JFTA 4Z17A 4GRSA 4OOZA 1Q7QA 4H1ZA 3ALFA 3LHUA 2WQPA 1GOWA 1R8LA 2V68A 1R86A 3I6TA 1XGDA 3QPEA 1YKWA 1YQ2A 2HXUA 3LX9A 2VD8A 4B4HA 1EGMA 2DSZA 5EFDA 2GSJA 3BICA 3CQ0A 3VGGA 3VNZA 5CG7A 1E72M 3R8HA 3HOJA 1B57A 3OZMA 4D6DA 3HBLA 3WNLA 5KINA 4NVTA 3GR7A 3WH6A 4UTFA 3PJXA 4AH7A 4IM4A 4L4LA 5IFTA 4PEEA 4CNPA 4WDTA 1OF8A 4LUSB 5D33A 1LRQA 3N73A 4RPPA 3RFAA 4ZQCA 3RX3A 3B4YA 3GS6A 1H5VA 3NXLA 2CW6A 2DVXA 4J35A 3EXSA 3CMJA 3VX1A 1RV8A 5JXQA 1T6MA 2VNCA 3GDLA 3LPGA 5CSUA 1UD6A 2ZWYA 1Q66A 1J5TA 3ID7A 1HN1A 3UBPC 2NV1A 3AIEA 1VBJA 3ZZ1A 4JXCA 1UD4A 3MJYA 4F66A 1SO5A 5KZMA 1EJRC 4GQQA 3OG3A 5BROA 1A5CA 2F9RA 3L2IA 1SO6A 5EU9A 3MI2A 2QPSA 3MSYA 4X61A 3C2EA 2YXOA 3RLHA 1WKYA 1EEPA 2WCAA 2DW6A 3DZ1A 5IHSA 4L5ZA 4R88A 3LTSA 4UFJA 4YN5A 1W32A 2A3AA 4MY1A 5D04C 2Y8VA 3CHFA 1LTDA 3C8FA 4QCFA 1TA3B 3BLOA 3SECA 1GWJA 4MDOA 4KWUA 2DZAA 4JIEA 2PDPA 1DKWA 3WEMA 4Z2KA 1V6WA 1ZHAA 3A21A 2WMFA 2QF8A 3VOCA 1EO7A 1O7AA 4C6NA 4O57A 3EMZA 3ZR5A 1GKPA 1JFHA 1N7KA 3SUVA 4R53A 3THCA 3DKLA 4RK8A 1K6WA 1CXKA 3TAOA 5AVNA 3WLPA 4WJEA 1E5NA 3VE7A 4YYFA 3E74A 1D7FA 1P7TA 3W7DA 1UC4A 4QNWA 4LUYA 3BCFA 1R3TA 4K6AA 2OMAA 5FESA 1ZUAX 4WR3A 3KTCA 3OBKA 5DLCA 4GISA 2Q71A 1OHLA 4M8UA 5A8MA 5FSDC 3UGRA 1UPMB 5I3IA 4LQ1A 3RILA 2IQ0A 3LTYA 2ANUA 4DI8A 3VOFA 3OU8A 1V0KA 1ZP3A 4HKPA 4C6IA 4LRTA 3WF4A 4MJZA 2YCEA 1UWIA 1F7BA 2BSLA 4ZENA 1EJUC 3W72A 3OLGA 3AXXA 3KRUA 3VCNA 1CGUA 4K7YA 5FJRA 1EP2A 1HJWA 4F8XA 1JI2A 4NZ1A 1FKXA 5AZ1A 4QFUA 3BV7A 5LIUX 1E1FA 1VJIA 1ADSA 5D2WA 2ZUVA 1TPEA 1EYWA 3WFAA 4JICA 4O0KA 3GBDA 3B8IA 4BEQA 2G8ZA 4F4RA 3FK4A 4PCSA 2VXNA 3E2QA 5DCDA 3G0SA 3S0CA 1C9WA 3GH4A 1T41A 4H7CA 3IGXA 1I2OA 1B3WA 3ITXA 3HFYA 3MUXA 1KFKA 4F48A 2ACSA 3AWNA 1U83A 3DG6A 4AX7A 3ZJ8A 4LNYA 3IIPA 1MXSA 4GI4A 5AECA 2OZ8A 1I2PA 3NL2A 4MYXA 1TTJA 3BW4A 3ARXA 4ZVJA 3AIVA 3UPBA 1TPUA 3GHTA 3OA3A 1UH3A 3W7JA 4JIIX 3BL3A 1TUFA 2Q8XA 4M51A 1GQLA 4Z1CA 1J6OA 1NQKA 1EPVA 2D1ZA 1JD7A 4XD6A 4XB3A 1Q6DA 2GL5A 1YXDA 4B3KA 3KBJA 3R43A 1QI3A 2GWNA 2DUXA 3LQLA 5AYZA 2DZXA 4L56A 4LPCA 4NXSA 5A94A 4WDXA 1FP8A 1IEVA 4DJED 4RDZA 3ZYZA 2QKFA 1EF2A 3FA4A 4R33A 2VOMA 3WLNA 4D1IA 5D30A 4FPSA 3ZT6A 1DIEA 3W1UA 1BYDA 5H1WA 2X41A 3QSRA 4EF9A 4YMZA 1PO9A 4JYDA 1IWBA 4W93A 2BOGX 2A85A 1IXOA 1HL2A 2PTDA 1GVQA 2FB2A 2YB1A 5I00A 5XIMA 2ZDRA 5EMLA 2YYUA 1YTEA 3CMGA 3O16A 1MNZA 3VAVA 1X6LA 4YCOA 4JX6A 4JKMA 3ZIZA 1KCXA 3HPFA 1UKSA 4WKFA 3UXIA 4QG8A 2XM2A 1XD1A 2RJHA 1VYPX 3POHA 4DVOA 2ZRZA 3SZ8A 1S5WA 4JFWA 1ZL1A 3H21A 3QC0A 4JY8A 4JX5A 3FN9A 4CCDA 4DUXA 2IXUA 1ICPA 1LBLA 5G2IA 3QQ1A 5BMXA 5HWJA 3OQ8A 4GHRA 1UR9A 4IX0A 3APTA 3N4AA 1KV8A 3LU2A 4XAPA 3NQGA 3CMFA 4M81A 4PL1A 2EAWA 5EY5A 4LS0A 3RO8A 3O6CA 5C8BB 4QNEA 4DO4A 3OBAA 1V6TA 1K8XA 1QNPA 3L4XA 3D0CA 4GUFA 5HDRA 4AZ5A 1KFLA 3IIVA 4S3EA 1WA3A 1GW9A 5I6SA 3TDFA 1P6WA 3MWCA 2ACQA 3GXTA 1DJIA 4HYVA 1SW7A 1HKIA 4PMDA 1OFPA 3W73A 4GO8A 1XLDA 3I3EA 4NJGA 1K7FA 2QMKA 3THAA 1XDJA 4JBRA 4PB3A 2E9MA 4GJ1A 4H6EA 4MWAA 4ICCX 3VIMA 4HOWA 4RNIA 3DECA 4EK7A 4WVXA <