5BMWA

Crystal structure of t75v mutant of triosephosphate isomerase from plasmodium falciparum
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
246
structure length
246
Chain Sequence
RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYVGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Probing the role of highly conserved residues in triosephosphate isomerase - analysis of site specific mutants at positions 64 and 75 in the Plasmodial enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 99
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5bmwA00
5AYZA 4O14A 3DBPA 3E9AA 3MJYA 1OF8A 3P67A 1L6SA 1I2RA 1XFBA 3BPWA 3PB0A 3S6DA 1OYBA 1FWWA 3BK0A 3QMSA 5D2TA 3ANYA 4NX5A 4UFMA 3GYEA 4O1DA 3CU2A 1DJNA 3HGJA 2DP3A 3ABQA 4YMZA 1Q3NA 1H50A 5BW6A 4H3DA 1JUBA 3T7VA 4JYDA 1KFJA 1ZAHA 1Z48A 4FEZA 3TH6A 3LX9A 3G1SA 2V8ZA 4RR4A 1HO1A 8TIMA 3USBA 4PFMA 3FKRA 4QNEA 5HUOA 3JRKA 1SW7A 1YDOA 1TTIA 2VFGA 1LRTA 3TW7A 4HHPA 3S5NA 1C29A 1WBHA 2IQTA 3G0XA 1YPIA 3DXIA 1VHCA 1JRCA 4FNSA 2G5WA 3PG9A 1LTDA 3NDOA 1IXNA 4GJ1A 5I3GA 4MZYA 3OVQA 4JX6A 2YXGA 2JKAA 2A1YA 4ALDA 4N9CA 4HIBA 1F76A 3JR2A 3FFSA 3LTPA 4Z1DA 3LCFA 4DXVA 4BI5A 2VEMA 3GK0A 5K9CA 4O15A 2A21A 1JUKA 5DN1A 1O5KA 3GR8A 5EL1A 3HGSA 3H54A 4O1CA 1NF0A 3EWWA 1U83A 1Y0EA 1GG1A 4NJGA 1V7YA 4O12A 2O7SA 1TV7A 1OJXA 3LLDA 3W84A 4MZ8A 1OFQA 4ADSA 1W56A 3I6RA 4NUWA 1DORA 3DAQA 3M44A 1H61A 1JJKA 5AN7A 1YTDA 4IXHA 1OFAA 4MY1A 4LVDA 3V1PA 2VEPA 1VCFA 4UTTC 2H90A 1EWEA 4KFPA 5J5RA 3PUDA 4FNPA 2QAPA 1QFEA 1S3HA 1DVJA 2W79A 4Z1AA 2EF9A 4OV4A 1SR9A 3C6CA 5G2WA 1GQNA 1I4NA 3S1WA 1XUZA 2DORA 2CZ5A 4RV8A 4K39A 1TYGA 4UXDA 1LOSA 4POCA 2Z6JA 1KFKA 2FPYA 4H4IA 3P5YA 1VZWA 1ZALA 1EPXA 3CWOX 3O6YX 2YFOA 1YLVA 4DO4A 2WSYA 1W3TA 2X30A 3O15A 2YGYA 1F2JA 2CZFA 2Y85A 4UTMA 1S5TA 3S5YA 4FB7A 5AOUA 2YPIA 1H1YA 3CTLA 4MKNA 2I14A 1OK4A 4K36A 4NNBA 4GUIA 4P2VA 1TPDA 3ABRA 4DF2A 3QZEA 2HTMA 1JULA 3A23A 3W7NA 1SZGA 3LLFA 1HFBA 3CLMA 1W31A 3GB6A 4M6QA 1OVDA 1PV8A 3PULA 2GQ9A 1TB3A 3ATYA 3YPIA 4GRSA 1LBLA 2PC4A 4B5NA 2V82A 2QCNA 1LOQA 1F6KA 1R2RA 3NOEA 4NJIA 4UNLA 5DXYA 3IIPA 3OVRA 3UPBA 2TRSA 3T40A 3LERA 1TCDA 1D3HA 5AHNA 4PL1A 1AW2A 3TCEA 4LC6A 2FFCA 3WK1A 3NZ1A 1WAUA 2Y89A 2ZZ5A 4UIOA 4OV9A 1TV8A 2DZUA 1VQTA 4GUGA 1WOAA 3KVKA 4O52A 1TPUA 1HO4A 3BLIA 1OFDA 1L9WA 1Z44A 1VYSX 5FF2A 3M9YA 4MZ1A 1TPB1 2OX1A 3W85A 1G4TA 5LHFA 3GDMA 1QO2A 1X6UA 3P62A 5DXXA 5SWUA 4UTWA 5LNWA 4DPPA 1ZY9A 3S0CA 4O13A 3W7LA 3LV6A 3SGUA 4JYFA 4JGDA 2PE4A 2NXGA 3IIXA 1XL9A 1HUVA 3G1FA 1JUEA 4LNYA 3DFPA 4CNOA 3R5EA 4KWWA 1EUAA 1YXDA 3EWXA 3MP5A 4DBDA 2YR1A 2XN0A 3DH7A 3G24A 2Z0IA 2J9ZA 4IPIA 2QUVA 3THAA 4EOUA 4M7TA 1R2TA 3DFTA 1P5BA 3EX6A 3QW4B 5H91A 5FEWA 4O53A 5AC6A 3VCRA 1RQBA 5EY5A 3C0JA 3M6YA 2OT1A 3C4UA 2G95A 4YL2A 4AEOA 1KLYA 3GAYA 3W9ZA 2CLLA 2B7PA 2FDSA 2VENA 1LYXA 2DU2A 4M7SA 1WOBA 4NT0A 2H3BA 3HQ1A 4R7JA 2NV1A 1DL3A 3WFAA 3E0IA 4WY0B 3VE9A 1YXCA 2QDGA 4LUIA 2NXHA 3P60A 1FWNA 5KMYA 4KFNA 3O63A 1WQ5A 1AK5A 3ATZA 5K9DA 1AMKA 3O1NA 3VKJA 1KFBA 4D2JA 5LNRA 5LSMA 1PCKA 4QNWA 1XC4A 3B0PA 1GOXA 4K7YA 4O0KA 3P84A 3S9YA 5BRBA 2JGQA 3PUOA 3IVSA 2XFWA 1NF7A 1XBZA 4UTWC 1JQXA 4ONVA 3WJWA 2C15A 4K38A 3UWUA 4ICNA 2E6YA 3DENA 3TKFA 4K8EA 2BX7A 4IMGA 1XUUA 3M16A 5CZTA 4FNTA 3W70A 5J5DA 1KW1A 1QO5A 3MHUA 4FX8A 1IIHA 2QUTA 3QYQA 4UFLA 2RDWA 1TPWA 2ATMA 1KM6A 1SO4A 5D30A 2YCEA 2C1HA 1KM1A 3KXQA 2Y7GA 4MY8A 4HNUA 3GZ3A 3LXAA 3Q37A 3BVJA 1TV5A 1VHNA 4RKAA 3TJLA 2A2IA 3WK3A 3MUXA 4UTHA 1OFOA 2VEIA 3HGOA 4ORIA 5HWNA 2JBMA 2ZDRA 3KRUA 4R34A 1KFCA 1FDZA 1TTQA 2OT0A 3E49A 3HG3A 1CX9A 3IV3A 2NXIA 3PBYA 3PS7A 5FF7A 1W5QA 2CZEA 3TU9A 2ZTJA 2FB3A 4JNMA 2P1FA 1XDLA 2ZRXA 5ABTA 4FXSA 2A85A 2RDUA 3A5FA 4MIMA 5F2MA 2EHHA 3NAVA 4FNUA 1GVQA 5AHEA 3CB8A 3W7MA 2JKPA 3DFNA 3TR2A 1L6YA 3T44A 3OIXA 4BR1A 1E51A 4NVTA 3CC1A 4FNRA 3SR7A 2C13A 2R94A 1SW3A 2V0TA 4XZ9A 1TTPA 2PURA 1A53A 1PIIA 2GJNA 3ZFHA 1S5WA 2WO5A 5HWMA 2VKZG 2V2DA 1KLZA 1TPC1 1SPQA 2O7QA 2WKJA 3BLFA 4CCEA 4JTTA 4ZQRA 5LGZA 4ZZ9A 2CZDA 3QF0A 1I45A 3A21A 3NVTA 1BWKA 4K37A 3W7RA 5F1VA 3W1UA 3TE9A 1SQ7A 3NGJA 3N9RA 1UUOA 4NZJA 3UPWA 2PRHA 1OYCA 3IVUA 3NQFA 1UCWA 5K2ZA 1SW0A 3C56A 3N14A 2BWGA 2V30A 3W7QA 3W1RA 2Y7FA 4LS1A 4UMCA 4CQAA 3U2OA 5D32A 1G7VA 2Y6ZA 4N2YA 3EKLA 4J9JA 3RMJA 4M6VA 1VGAA 1SO6A 4AF0B 4X9SA 3EXTA 2R8WA 3LBMA 3NZRA 2WV8A 1PE1A 3GDTA 3GDLA 3LCGA 3NQ8A 3PR2A 1GJPA 4GNJA 1JCLA 3EWBX 3HPXA 3BW4A 3L66A 4ADUA 2X2GA 1NVMA 2CLHA 2J9XA 2XN2A 4IMCA 2Q3OA 3S1UA 1YXYA 1X7FA 1TIMA 5BNKA 4CCDA 2RFGA 3MYOA 2Y61A 1OFBA 1H7NA 3GXNA 3W1AA 3EKZA 3D0CA 2DJXA 3NQMA 4M5PA 1FBAA 3N2MA 5CZJA 3UXAA 3SECA 1GVSA 2GPTA 3LCWA 2ABAA 5HWJA 4FO4A 1WDWA 3DFQA 1XBYA 1FCQA 2Y88A 4O11A 4QM1A 4UC5A 2DZWA 5CKSA 3W1NA 1FUYA 5GVJA 3UY8A 2NX3A 5KTLA 1KM0A 3RK8A 1K3UA 1HTIA 3STCA 5LNUA 3LB0A 2E6DA 3OHIA 5D37A 1MSSA 4DF1A 4XBKA 1TPH1 3G3DA 3TC7A 3EXRA 1KV5A 4AHPA 4WXYA 5C54A 1OABA 2ZZ1A 1N7KA 1FDYA 2QJHA 1AG1O 3R2GA 5I3KA 3O6DA 3UWVA 4FF7A 2H6RA 1F6PA 2ISWA 2A7RA 4UFIA 4EF9A 1RPXA 2V5LA 3I65A 1TJPA 2CW6A 4O4VA 3P7YA 4IMFA 4AH7A 4OE7A 5KZDA 2WSRA 2ZRYA 2ZZ7A 3BV4A 2H8ZA 2GVLA 3QPYA 1FX6A 3LI0A 2Y7DA 1TREA 2GUUA 4UTTA 1TSIA 1G4SA 1LROA 2CLKA 3SZ8A 4NJJA 2WNNA 3LTYA 3NNTA 5C55A 4UTKA 4PA8A 1OFPA 3INPA 2FJKA 3NQCA 3UZJA 3W83A 3KVMA 5CPNA 3TSBA 5L9FA 1H5YA 4DEFA 3RLUA 4LV9A 4N9BA 4O18A 1JVNA 3B0UX 2W6RA 4RZ4A 3SSJA 4LV4A 4LOCA 2RH9A 4PEKA 2DZTA 3KHJA 3L21A 1AL7A 4JY8A 2TSYA 4M19A 5C5YA 4JTJA 4LS0A 4I7WA 3NPXA 1I2OA 3TC6A 3QM3A 1FDJA 1GTEA 1D9EA 1K8YA 3BGJA 3VNDA 2BZNA 3MBDA 3DHFA 5F4SA 3G1YA 4OU1A 2X1SA 3S1VA 1OX4A 4OHQA 1IXPA 3L5MA 1IF2A 1LZOA 3LHYA 2X1TA 4OGZA 2A7PA 2NUXA 1BWLA 2B4GA 4MLJA 5KINA 5DBUA 1LRNA 4ZQCA 1H62A 2VXNA 3QQ0A 1QOPA 4UTIA 3A22A 3EXSA 3W2JA 4MLRA 2XN1A 4LWWA 2FLIA 4LRTA 5F2LA 2OJPA 4ZQPA 1H1ZA 2C6QA 5K9XA 1GVFA 2ZA1A 1FWTA 3SJ3A 1W5PA 4HT3A 2ZZ6A 2J27A 3W7EA 1YADA 4AHOA 3M0ZA 4JX5A 2G96A 1LBMA 1MEHA 3GVGA 1ZENA 4CLMA 5CZ0A 3UWZA 3WK2A 3NQDA 3C2VA 1P1XA 4GUJA 3QC3A 3EX2A 5D2VA 4A2SA 5D2WA 5C6MA 4FIQA 4IQLA 3W7CA 4EF8A 5A5WA 4U4MA 3W2UA 4H6KA 3P81A 4BI6A 3GKAA 1BKSA 1RVGA 2P10A 1QPNA 4WD0A 2A6LA 5HR6A 4TMBA 4TU1A 3GNNA 3BW2A 3L65A 4Z1CA 1UJPA 3EWYA 4BK9A 1EP2A 2ZRUA 1VR6A 1KM3A 2WSQA 1ME8A 4S1FA 4O16A 5F4WA 5FESA 3AO0A 3M5YA 3QRHA 4JTFA 3L68A 4Q32A 1SSDA 3EX3A 4XKYA 3TMQA 1DOSA 1KTNA 1LOLA 5G4WA 5FF4A 3LHTA 3CWNA 3FKKA 4GUFA 3NXFA 2E09A 2QCMA 4GC4A 3B0VC 2V81A 3HOJA 2A6NA 5BMWA 5LKYA 2B7QA 3W1TA 1LLZA 3G3MA 5D2YA 4NQ1A 5DLCA 3TJXA 4EVZA 2GJLA 1WXJA 2Z6IA 1BTMA 1VYRA 2UV8G 3LRMA 3LOTA 2A7NA 4UR7A 6TIMA 1SZNA 3L5AA 5AHIA 5TIMA 4MOZA 2ZA3A 5TBOA 3M43A 5DELA 3BLEA 2HSAA 3HJZA 3NL6A 2RDTA 4NNAA 5K3VA 1QDSA 5IBXA 1FQ0A 3A9IA 2ZRVA 1GYLA 1F74A 1EP1A 4LC8A 4UCGA 3N34A 2WNQA 3ABOA 4MY9A 4DELA 1RZMA 1O5XA 3P74A 1PHWA 4WQ6A 1LRQA 7TIMA 1FY6A 4JX4A 5CGQA 3TMLA 5DCBA 4O19A 1IXQA 2NWSA 3VE7A 1QMLA 3IIOA 4O8RA 3HG4A 3W2LA 3N73A 1VLIA 1KFLA 2QKFA 3MHGA 1VCGA 3TDFA 4DPQA 2C14A 2DZPA 2AGKA 1TQJA 1EEPA 1W5OA 4AWTA 5AFDA 3BO9A 3UD6A 4WOQA 4E2DA 4IPJA 1T96A 4LVFA 4YLWA 1K7FA 1TRDA 4O1AA 3RLVA 3BG3A 2JK2A 3LGEA 1GYNA 3GX9A 2QJGA 5KSWA 3IEBA 3W87A 3CHVA 2QCGA 4K6AA 3S5OA 3MI3A 4DO5A 5G5IA 3RNDA 1L6WA 3W75A 4JTHA 3A5VA 4C1KA 1XXXA 2ALDA 2ISSA 5FEPA 3DFOA 3HPZA 1EIXA 2CLEA 5IBXC 3SI9A 4YCPA 3NQGA 2YYUA 4JDBA 4HSOA 4JIPA 3VFLA 3T78A 3NPUA 2RKXA 1Q6RA 3MMTA 1B4KA 3G1HA 1VYPX 1SZFA 3UQNA 3W07A 3CIXA 1YPFA 3B05A 5DY2A 5CPMA 3GKFA 1DHPA 1TPFA 1IIGA 1FCVA 2YW3A 3IVTA 3M5ZA 3BGGA 3HMJG 3TXVA 5CG7A 5G1YA 3MP4A 4O10A 3GLCA 2PRLA 4A29A 3TA6A 4LRSA 5CPLA 3CQ0A 4I7VA 2EGZA 3Q94A 1KM2A 4XTDA 1G6CA 4AMAA 3BG5A 1QPRA 4Y96A 2R91A 1YYAA 2X1RA 4GFSA 5DY3A 3L2IA 2GQAA 4IXXA 1ADOA 1Q6OA 2V5BA 3FIGA 4N4PA 1VC4A 2QCDA 2GQ8A 4OBTA 3TQVA 2W0UA 3A24A 3EB2A 3W1MA 4IOTA 1SFJA 3NM1A 1FCUA 1UUMA 3W3OA 4U28A 2QCFA 3TNOA 2QCCA 4Z08A 4AWSA 4FX6M 1VRDA 3T55A 3MP3A 2FIQA 2YYTA 4ZL1A 5AHFA 2E5DA 2BXVA 5G1TA 3CT7A 4LT9A 4QQ3A 1LP6A 4WXZA 3Q58A 3OVPA 2GOUA 4FX7A 2B0MA 6ALDA 3B04A 1H63A 2C19A 3B4UA 1JCYA 4UTJA 2A4AA 4LY8A 3MI6A 1XCFA 3DFSA 4Z0SA 1XDMA 1ZCOA 3KX6A 4IGHA 3N19B 1JCXA 5FI8A 1GZGA 3TK7A 4NU7A 1ICSA 2GVJA 1PHQA 1FWSA 2QCLA 3QMTA 3W1XA 3E12A 1TPEA 4N02A 5I3IA 1P4CA 2OCZA 4I7UA 3W1QA 3NR0A 3LHUA 5HINA 3MO7A 1RV8A 4AB4A 5AYXA 3F4WA 5BMXA 1K7EA 2WOQA 3FS2A 3TXZA 1FCBA 2QEZA 3ZWSA 1JCJA 4WY0F 4O57A 1T8XA 4JXCA 3L0GA 5D04C 3M41A 5U4NA 4MFDA 1LLWA 2BLEA 3G1AA 1M7PA 3LCIA 3PBWA 4NJHA 3UYCA 4JYEA 3NL5A 5HUPA 4AVFA 3DKLA 3HO8A 1LM1A 2QUUA 4JTEA 2CU0A 5K7JA 5KZEA 2J24A 3MHFA 4Z0JA 3V75A 1WYIA 4A21A 3QSTA 4I9AA 3UWQA 4PH6A 4KFOA 1KM5A 3PBVA 3LV5A 3NQVA 2ZRZA 1RQHA 1Q45A 3THQA 1EWDA 3LXCA 1SU5A 1ZNNA 4RX0A 2JGYA 3PBUA 2OMAA 4TX9A 4WJEA 5LGXA 3G8RA 1NSJA 1YTKA 3PM6A 3PC0A 5HJLA 3W71A 1R2SA 1PL9A 4DQWA 3G18A 4N9DA 3F4NA 1A5BA 3R12A 2DZVA 4A3UA 1O60A 5AC7A 4JTGA 4IMDA 2FB2A 4AAJA 5AHLA 3RU6A 2DZSA 2Y70A 4ZQNA 1LORA 1FWRA 1EUNA 1FXQA 4WX2A 3TUUA 3ABSA 3HPSA 4LVAA 5BOOA 2HS6A 1A5AA 1FXPA 2ATSA 1ME7A 3NPVA 3C2FA 5LHEA 4JN6A 5A8GA 3NQ7A 1TJRA 1PS9A 2B7OA 3QW3A 2QCEA 1UB3A 4LVGA 1J5TA 4MJZA 4Z1BA 1B4EA 1K03A 1SUXA 1LBFA 3W76A 3EX4A 5EPDA 1GT8A 1ZFJA 4MPQA 4MVAA 3C2OA 3FLUA 2C3ZA 3SY5A 1LCOA 1MO0A 3R89A 4JY9A 4Q4KA 2Z2UA 4N4QA 1GVRA 5HMSA 5D05A 1OX4B 4MYAA 1MEIA 4QAIA 1TPVA 2Q8ZA 3EWUA 1ME9A 1A5SA 5EKYA 1ICQA 2G97A 1LDCA 3I7QA 4MUZA 4KKXA 2GVGA 3CEUA 4UR8A 1IXOA 5U7SA 2AAMA 4IMEA 1F05A 3WK0A 1XBVA 1GPWA 2PRMA 2NX9A 3HG2A 5AC8A 4CNNA 4MFEA 5KITA 3L9CA 1W1ZA 3B06A 2Y63A 4YXGA 1X1OA 3KFTA 4N9EA 5D2XA 3SIZA 1W5MA 3QSRA 3NQ6A 5I3JA 3W7GA 2TMDA 1K02A 4O0ZA 3IGSA 3TQKA 4EWND 2Q3RA 3NEVA 2EKCA 1OK6A 3AJXA 3W1PA 3F1QA 3IIVA 1QOQA 1SO3A 1R46A 3UZ5A 2VFEA 3PY2A 1W3NA 2H8XA 4JTLA 1VH7A 4JTKA 1OX5A 2NWRA 4O4WA 4WUIA 2A5HA 5HNRA 3JS3A 3KVLA 3PWAA 2ZRWA 3W7HA 5AB3A 1I2QA 1RQEA 1X8FA 3LBCA 3FYOA 4GUHA 4BF9A 4BWLA 1GVOA 1OG0A 3G1VA 4UNKA 3IIZA 3KOFA 1OF6A 1OFRA 4LS2A 2CLMA 3W7JA 3DZ1A 1Z41A 3F03K 2NV2A 4QIUA 4L4MA 3E02A 5EMUA 4HPJA 1T99A 3VI2A 1UASA 2LLEA 4Q33A 1N55A 4XKYB 1TO3A 1SZEA 4G1KA 3EX1A 5LZLA 1AL8A 3MWAA 2VC6A 4IUOA 4UFKA 2WPBA 3G8EA 1Z42A 3DHDA 1KV8A 1M7OA 3W7IA 4M6PA 3GR7A 1ZJIA 5F2GA 1JQVA 3W1LA 3L0NA 5IM51 3FYPA 3HB9A 4GXMA 4UFJA 3S5ZA 5T26A 4UTLA 5CPOA 3TV8A 1W54A 4R33A 4IX0A 4NX0A 1XM3A 3KAOA 4ZQMA 3OEXA 3GXTA 1I2NA 1QNVA 4HKPA 1ZHAA 2YW4A 2NX1A 4UTUA 1OFEA 2YSWA 1K7XA 1AW5A 2WQPA 3PSWA 1TTJA 2CFFA 4HPXA 1VJIA 2J9YA 1DBTA 2X1UA 4XQ6A 5DBTA 4TMCA 3HG5A 3NG3A 4RZ5A 4GWEA 5G4EA 4E0CA 1K8XA 3CPRA 5D02A 3M7WA 3I7RA 1DJQA 3TIMA 2A0NA 4Y90A 3WJSA 5EYWA 4PCFA 1WBJA 4X3ZA 3DI1A 2D73A 4LTSA 3H53A 3TW6A 1SO5A 2NZLA 5FF0A 4BWLC 3C52A 3HIJA 4A22A 4AWUA 2Z1BA 1HG3A 2ZQ0A 4LUJA 3GAKA 1IGSA 2VEKA 4Y9AA 2OZ0A 4XWUA 4RLIA 4JD4A 3O07A 5EA9A 3WJXA 3GXPA 1JCMP 3M5VA 2ZZ4A 3P80A 2FQIA 3N2XA 2E77A 2C18A 1VS1A 4MYXA 5G2HA 4HNTA 4DO6A 3DKJA 3UY7A 3O8AA 3TSDA 3BG9A 1KTBA 4A2RA 3B8DA 2V2HA 2QF7A 3QEZA 3MBFA 1R47A 3LHZA 3LCHA 4P61A 2CLIA 1GG0A 5EBUA 4XTIA 4JEQA 2FTPA 1QWGA 1F7BA 4OT7A 5D38A 5D33A 5I3HA 3CEPA 3G0UA 4MJMA 3C61A 1C8VA 4JIQA 3OBKA 2ABBA 1KBIA 3P8IA 1MZHA 1NFBA 1YDNA 2CLFA 3NL3A 3EWZA 2V9DA 2KZHA 3LCXA 1L2UA 3L67A 4JTUA 3FA5A 1RD5A 3I7SA 1Q6LA 3S1XA 4YCOA 2QAFA 4O17A 4FIRA 1W5NA 4JTIA 3K30A 4JTSA 3QFEA 2VELA 3G0SA 3O16A 3GIYA 4HNVA 4RK8A 3KRSA 4KWVA 4Y8FA 2ZBTA 3TAOA 1VPXA 4E2BA 4RXGA 3BW3A 1AW1A 3W6YA 1ML1A 3W88A 2F84A 2I1OA 4K7VA 1QCWA 4CQ9A 3IGUA 3DI0A 4LW7A 2TPSA 3LDVA 1TMHA 5DCEA 3CM4A 1ICPA 3QPZA 4FNQA 4W9TA 3NPWA 2CLOA 3PUEA 1O4UA 4XBSA 1KTCA 4AXKA 4WZHA 2HMCA 3G22A 3N3MA 3WJYA 4E38A 4K8HA 3FOKA 3N9SA 1T0OA 1YDVA 3U8GA 2ZFAA 4TIMA 1DKWA 4YWIA 1VCVA 2F7FA 2FPTA 1ONRA 2NLIA 1P0NA 3ELFA 4ML9A 1H7RA 4N6EA 4IX2A 1G67A 5HR7A 4XUGA 2I9EA 3W86A 5LNVA 2E5BA 2QCDB 5C2XA 3STFA 5CZSA 2P0OA 4FXRA 1WA3A 1QPOA 4QJ1A 5D03A 1X1ZA 1CW2A 1OYAA 3NO5A 1K8ZA 3R13A 3LHVA 3R8RA 2VFHA 5F1UA 1QR7A 1GWJA 1DQXA 1O95A 3LHWA 3MW7A 2RHGA 3LI1A 3LTSA 2E6AA 1EP3A 4ZMGA 3TFCA 4PTNA 1O94A 3C8FA 4NZFA 3STGA 5D09A 2YDAA 3P61A 1ALDA 4X2RA 1MXSA 5MHBA 3FJLA 3W73A 1GTHA 4UFHA 3TAKA 4Y6GA 5DCDA 2AQWA 4RZ6A 5FEZA 1WV2A 3E96A 3QJAA 4GE8A 1H51A 1N8FA 3NL2A 2PCQA 5TQLA 3TSMA 4R53A 5K4ZA 2TYSA 2WNZA 1KFEA 3G1DA 2QR6A 2J88A 5G2IA 4JS3A 4PODA 1H7WA 1PCWA 2B7NA 1F5ZA 3RFAA 3TFXA 4OQVA 3LCLA 5F4XA 1M6JA 2X16A 2VFIA 1RR2A 2H3DA 3PG8A 1V5XA 1G4EA 4GBUA 3M47A 2EAWA 3W23A 3W7PA 4ORMA 3IGXA 3OA3A 2E68A 3M1ZA 1XKYA 4O1BA 3NQ2A 4X22A 3O6CA 4WOZA 2VFFA 3M5XA 4OWGA 4QSHA 4PC8A 1JRBA 2YX0A 4S2CA 3I68A 3C3NA 1G69A 3SGZA 4NXSA 1R30A 3Q2DA 1F73A 4HN4A 2Y62A 3TX9A 3U6WA 2QCHA 4C1LA 1NEYA 3ZS4A 2E6FA 3S42A 2J6XA 4ZQOA 3QMRA 1C9DA 2CWNA 4WY0A 2E5CA 3W2NA 3KVJA 2ISVA 1H60A 1DQWA 5KZMA 3L5LA 3NQEA 2Q8LA 3DGRA 3PAJA 3LRLA 1W0MA 4NXKA 2QDHA 2QJIA 3HF3A 1Q6QA 1M5WA 1S5VA 3W22A 3W7KA 1OX6A 1G4PA 1JCNA 4CCCA 1ZAIA 3PVFA 3W74A 3BARA 1D3GA 4LU0A 4HSNA 1P0KA 5I3FA 4NJKA 3LM7A 1GEQA 4RJEA 4N6FA 3SW6A 1QAPA 3OG3A 2BSLA 1I8JA 1BEUA 4BI7A 2VOMA 2EPHA 4LVBA 5K4XA 1H7PA 3KRZA 4QISA 3PB2A 2DZXA 3ZR4A 1A50A 3MI2A 4O54A 3CIWA 1H7OA 3P8JA 2HS8A 1EX5A 3G1XA 3SFKA 5LNSA 3W7DA 4ZVJA 3HBLA 1ZAJA 2ZZ3A 4TR9A 4QITA 3TROA 1QPQA 3NM3A 3GNDA 4UUIA 3C2RA 3UWYA 3RF9A 5FF3A 5L6UA 5FEXA 2C0AA 3NQAA 4IJBA 1HL2A 1DV7A 1XBXA 4JR5A 2ZCGA 1A5CA 1W8SA 4FHAA 4L4LA 4S2BA 2BTMA 4ADTA 4IWWA 4UMBA 3ZWTA 2NUYA 3W2KA 5CSSA 3UNDA 2YZRA 1JR1A 4CNPA 3UXDA 1J4EA 1OHLA 4PL2A 1TRIA 3H55A 5E93A 2Y7EA 3HGRA 3P82A 1SSGA 1CI1A 3W7OA 4JICA 4O50A 2DJLA 1KA9F 3PF3A 3O06A 5CSRA 3QH2A 3NA8A 1SFLA 1KBJA 4HNNA 1EA0A 3LRKA 3QQ1A 5E0KA 1B3OA 4RCXA 3S8HA 3LXBA 1VLWA 2ZTKA 3FJ6A 4EIVA 3NYZA 1YTEA 2JKEA 5F2IA 5E1QA 5AHMA 4BFAA 2R14A 2ZA2A 2E1DA 3C2EA 3W72A 1NAL1 1TQXA 3FEMA 1WX0A 3UWWA 4JDYA 2YFNA 3L0KA 4O28A 3GDKA 3P5ZA 4CQ8A 1J2WA 3T4CA 5HULA 1G7UA 1PVNA 3GDRA 5HQEA 3B03A 3IRDA 4TO8A 3DU0A 1XI3A 4UMAA 3WJZA 1W3IA 1B9BA 2WJZA 1MEWA 3W2MA 4AHQA 2V2CA 1H7XA 3TQ0A 1U5JA 2C16A 2VFDA 4NNCA 2FPVA 4DF0A 1EB3A 4RXFA 1W37A 3PSVA 2NUWA 4DBEA 4AF0A 2ZZ2A 1KM4A 3STEA 3EEGA 3MYPA 5H2ZA 2ZYFA 1THFD 3O05A 1I2PA 1B57A 1UBSA 5AYYA
chains in the Genus database with same CATH superfamily
5AYZA 1OF8A 3BANA 3WQPA 3LNMA 3BPWA 1ONXA 3PB0A 3VILA 1X8CA 3DG3A 5GNXA 2OO6A 1DJNA 2SFPA 2DP3A 3S2NA 1UR1A 2XIQA 1H50A 3E2RA 1KRAC 3T7VA 1Z48A 5I02A 1E0WA 1U1HA 3G1SA 2REQB 2PGEA 5C9WA 1PUDA 2IQDA 4GQQA 3U4FA 2HVNA 2PP0A 4PFMA 4FR1A 3WF3A 3JU2A 4QNEA 1KBLA 1I1XA 3DERA 1FWIC 5HUOA 3JRKA 1V3IA 3NIYA 3TW7A 3S5NA 1RBLA 1E6SM 3SCWA 3DXIA 3PG9A 2PDYA 3F5KA 1IXNA 2DDXA 3H12A 2PDFA 1KQZA 3OVQA 2WVUA 2YXGA 3JR2A 4Z1DA 4XD6A 2J7GA 5K9CA 3VD7A 4E8GA 1BVNP 1O5KA 4PRTA 1EJUC 5EL1A 3HGSA 1AQHA 1MNZA 4O1CA 3AS1A 1U83A 1V7YA 4QHRA 4O12A 2PBOA 1P7TA 1VJZA 1TV7A 1OJXA 3LLDA 4F0SA 4JTAA 4C7GA 4HYRA 4AMCA 1RPKA 3I6RA 1PSCA 3CV6A 2YA2A 3GVVA 5AN7A 4HNCA 4IXHA 4DYJA 3TZFA 4DXKA 4RL3A 2C1IA 4UTTC 3UJEA 1DP0A 3COTA 4JKMA 2VRQA 4AD5A 1J01A 4B5VA 3CAKA 1E6XM 2DSVA 4ERGA 3QV9A 4Z1AA 3UXLA 3EDEA 3M0HA 2BVDA 1IEXA 1F8MA 2NVAA 2DORA 4K39A 1B30A 4D71A 4POCA 1KFKA 4LUTB 1XPGA 1E3ZA 3IV8A 3CZGA 4JBRA 3O6YX 2OGYA 1K9FA 1YLVA 2PDNA 2YGYA 5HJXA 1F2JA 2CZFA 5AOUA 4J5NA 1H1YA 1RJQA 2I14A 4HA1A 1KKOA 4LCQA 2Y1HA 2VD8A 3VIMA 1V4YA 4PB5A 3B97A 2ACQA 3VMOA 3B8VA 1Z6KA 3IUDA 4DF2A 1ZZMA 1QATA 3A23A 2O92A 3CLMA 3K8KA 3GB6A 1LQAA 2XWDA 1TB3A 4IPNB 3AICA 4NJIA 1PKLA 5A6KA 5DXYA 3UNTA 3VC5A 4KBXA 1ZP4A 3B9OA 2CITA 1WXZA 3RO6A 1AW2A 1V3JA 3TCEA 3WK1A 1DWGM 3BAYA 3AZRA 1VQTA 3E5BA 4GUGA 1YIXA 4PCSA 3ZJKA 3UXKA 3PK7A 3L12A 3IACA 3IAQA 2Z7KA 3TN5A 2DPEA 4DWDA 4HK7A 1UWRA 1DWHM 2EPOA 3W26A 4B4HA 3W85A 4LJ3A 2QS8A 5FJTA 3B0YA 1G4TA 3ERPA 4Y2WA 2CYGA 1QO2A 1UZHA 1X6UA 3P62A 5DXXA 4H6QA 4ZOCA 4O13A 3SGUA 1TZZA 4HA4A 4Q8WA 4FP1A 2FKPA 4CNOA 3R5EA 4KWWA 1YXDA 2YR1A 2FHBA 2DQXA 4TTGA 3QZAA 2Z0IA 2J9ZA 3THAA 4C7DA 1R87A 4GX9A 4M7TA 3DFTA 2TAAA 1P5BA 3QFWA 4J3ZA 2DW7A 3BCJA 3WLTA 3VGEA 3LPGA 4TQTA 3EPMA 2J7BA 3M6YA 2OT1A 3MSYA 4YL2A 3W38A 1BGAA 4PGLA 3GAYA 2YA0A 3W9ZA 2B7PA 2VENA 2TODA 4PR4A 3CNYA 4Q8QA 1JPIA 4NT0A 2NV1A 1DL3A 1YXCA 1Q66A 2QDGA 4LUIA 1L6FA 3E0VA 4GO8A 2WANA 5FSDC 1JXJA 1C3FA 2R24A 2FH6A 3UFYA 3G77A 4C6LA 2P0IA 3O1NA 1XLDA 4D2JA 3G5EA 3ANUA 1PCKA 3I10A 2PDXA 1IEQA 2GYIA 4XIMA 1FH7A 4Q6XA 2XFWA 4MWAB 1FWFC 3TTQA 4PBGA 3TKFA 4K8EA 3TYDA 3R58A 5REQB 3MHUA 4UFLA 4D6JA 3KXQA 1DQUA 3BVJA 1TV5A 3WK3A 1OFOA 1W9UA 1QOXA 3KRUA 2BHZA 1FDZA 2VI0A 3E49A 1CX9A 4XKMA 4HOZA 4GLEA 2NXIA 1E0TA 2FZ8A 3FXYA 2CZEA 3O0FA 2FB3A 4JNMA 4PUJA 4Q4RA 1XDLA 2ZRXA 5ABTA 4FXSA 3WD0A 1O68A 4MIMA 1W6TA 2EHHA 3WH8A 4FNUA 1GVQA 2OKTA 3TYUA 3BC9A 3DFNA 3RUBL 4BR1A 3CC1A 3KL5A 1I6NA 1GOKA 4TX6A 3ZLGA 1A4LA 1EGMA 2VKZG 1KLZA 2WKJA 4NZCA 2I17A 1K9TA 4ZQRA 2HQAA 2G3NA 1Y8BA 1W1PA 1C9WA 1RHCA 3A21A 3T09A 3UG8A 4QE1A 4K37A 4X2PA 4BS0A 5F1VA 1RP8A 3W1UA 1DJYA 5DX7A 4XD3A 1OYCA 1Y7VA 1SW0A 1NQ6A 2CHRA 4LAOA 1CGXA 1YPXA 3GW3A 5BZAA 1GOWA 1A0CA 2YJQA 3U2OA 1G7VA 1MRQA 2Y6ZA 1EHAA 3EKLA 4XZBA 4M6VA 2VR2A 4FMVA 1FHUA 5BOEA 4I9TA 3I6EA 2WHMA 4X9SA 4BQ3A 4H9TA 4OBSA 3LCGA 1V3LA 1GJPA 4PCPA 4RDWA 3S3GA 4H6EA 3TYEA 4GINA 4EXBA 4GVIA 4L4PA 1JF5A 1NVMA 3I6TA 1UP3A 1AJ0A 3LENA 4IMCA 1YXYA 1F8IA 2WYSA 1X7FA 4PZVA 1EQPA 1EF3A 2XVPA 1BF2A 3H26A 3UXAA 1ADDA 2GPTA 3VNZA 2IPGA 3VNIA 1WDWA 1XBYA 4O11A 4UC5A 5FJIA 1KCKA 1NDWA 2A3HA 2DZWA 3B8IA 1VEOA 4JFTA 5CKSA 1RJPA 2NX3A 5KTLA 2C0HA 4S3GA 3MUAA 4I3GA 4Q4MA 1K3UA 3STCA 4GNVA 1UKPA 1TCMA 4DF1A 1S2UA 1TPH1 5HBFA 3BLLA 1E4NA 3EXRA 5BRPA 1ODUA 3MVIA 5C54A 1OABA 5TAOA 4OIFA 1FDYA 2QJHA 1NJJA 4JCLA 1XPYA 3RLGA 4IIBA 3EDDA 5I3KA 1V77A 3O6DA 2VR4A 1RPXA 5MKGA 3VYLA 4IMFA 2WSRA 2CNCA 2ZZ7A 2DSUA 3QPYA 1D7KA 1FX6A 4TOQA 3PTQA 1F9CA 1NELA 1G4SA 1LROA 3SZ8A 1P7TB 4QRNA 2J8GA 4CD8A 5C55A 4QEEA 2G4FA 2J8TA 3ZJ8A 3VIGA 1Q6FA 4DEFA 1DWFM 5BU6A 4QDPA 4JIRA 4JFSA 3F5JA 2OX4A 4LOCA 2RH9A 4PMNA 1O6IA 3L21A 4JY8A 1M01A 4JTJA 1FWEC 2W62A 2VZSA 3GO2A 1I2OA 3WF0A 1QI3A 1K8YA 3VNDA 2BZNA 1HJXA 3QOKA 3U48A 3DHFA 4OU1A 3SGGA 1US3A 4OHQA 4GK8A 5J8LA 1D8CA 2VX7A 1OM0A 3OZPA 1UR9A 2B4GA 1TX0A 5KINA 5ABEA 2WAGA 2YXXA 5HNTA 2GWGA 1BSIA 3QQ0A 1PIFA 1VFLA 4UTIA 1UD8A 3AALA 4MWAD 1E5JA 4ZQPA 1JGMA 4WRHA 2YCLA 1QWKA 3S83A 3SJ3A 3W6MA 1W5PA 3ZR5A 3W7EA 2DVTA 4NASA 1OSEA 1MW3A 4MJ2A 4JX5A 3LLXA 3CTTA 3WLHA 2DIJA 1HL8A 3WLJA 1G94A 4U10A 4CLMA 2WVVA 5CZ0A 3WK2A 1NDZA 3GC5A 4GUJA 3QC3A 1E0UA 1O1ZA 2OSWA 2DSKA 1JGIA 4EF8A 1SJCA 3SY1A 3SQSA 3N13A 4BI6A 3S46A 2P10A 4KRZA 2ASHA 1TJ1A 2A6LA 2Z1VA 1IEIA 4PUWA 5HR6A 5M1TA 4TU1A 3BW2A 4KS0A 4KT2A 3KRBA 4GXPA 4JQ4A 4MNJA 4DI9A 1KCXA 4JCMA 3DYMA 3QY7A 1BPLB 3D3AA 4NY2A 1GONA 1KM3A 1ME8A 1TWZA 4S1FA 1J10A 1B2YA 3GBEA 4JTFA 1PO9A 3L68A 3TMQA 1DOSA 2OZ3A 3VKBA 3L4TA 1X98A 1LOLA 4PEEA 5EMKA 2IKHA 2E09A 2PLJA 1S2WA 2DUAA 1AA1B 1QUMA 4AX7A 1QBAA 2B7QA 1QI2A 2V5KA 4DUXA 5D2YA 4NQ1A 2PSNA 5BXTA 2Z6IA 2VMFA 2DT1A 3LOTA 2R82A 4UR7A 2XZ9A 3PZQA 4MPKA 4MOZA 5TBOA 4ZOAA 3W27A 2V3FA 5DELA 4LH8A 4AWEA 2HSAA 3MMWA 2ZRVA 1GYLA 2OB3A 5IDZA 1W2PA 3TYBA 1YDYA 5DO8A 2BASA 1J0IA 4J35A 4ZO7A 5CC7A 1UUQA 1TE1A 3HPAA 4O1EA 3WG6A 3VFCA 5CPQA 5CGQA 4O19A 1M04A 2Y4SA 2RGLA 1R3VA 4O8RA 3HG4A 3EDKA 2YLLA 2F2KA 5LIYX 2QKFA 1VCGA 2DZPA 2QGHA 2AGKA 4IISA 5HXMA 3WUEA 4E2DA 4LVFA 4DJDC 2H9AA 4YLWA 3ARSA 1RALA 3LGEA 7ODCA 4ZGYA 4B3KA 2QIIA 1D7FA 3CHVA 4LYKA 1FKWA 4K6AA 3SRKA 4Q8VA 2Q02A 3A5VA 4C1KA 1WZLA 3DFOA 2BB0A 3WF1A 4YCPA 4JDBA 4HSOA 4JIPA 1QNRA 3NPUA 2CBUA 1WZKA 3MMTA 1PKMA 3W07A 2DIKA 1YPFA 1DHPA 1TPFA 1PZ1A 3RLHA 3ITOA 2QV4A 1FCVA 2YW3A 4A05A 1O7AA 2G37A 5CG7A 1CGWA 2D24A 2OEMA 4UQAA 1TWDA 1L8PA 4I7VA 2EGZA 3Q94A 1KM2A 4XTDA 4FI4A 1UIOA 3KS6A 4AMAA 3VGBA 1V0LA 1YYAA 4GFSA 5DY3A 3UG4A 3QGKC 3UESA 1ADOA 2V5BA 4N7QA 2IPFA 2QCDA 4KQNA 3VOHA 3W1MA 1XQKA 3W6LA 5T91A 1JZ6A 1E3XA 3H2CA 2QCCA 2Z4GA 2EPKX 1HP4A 2O55A 4RW5A 4Z08A 4FX6M 1EYWA 2BVWA 4KCUA 1BXBA 4S3CA 4RZBA 1B3VA 3Q65A 2FIQA 2ONEA 4ZL1A 2VM8A 4LT9A 4GG9A 3Q58A 3OVPA 3UZXA 3W24A 2EPLX 1H63A 2C19A 3NZQA 4AIBA 2VC7A 4S3JA 5DMMA 4HU3A 3CZEA 4QP0A 1V6UA 1DTNA 4C60A 4IGHA 4H7ZA 3ARZA 5FI8A 1GZGA 2V5JA 3TK7A 4NU7A 1I60A 4N02A 1TPEA 4AVOA 3W1QA 3NR0A 3LHUA 1NFGA 4CN1A 1RV8A 4Q8UA 4AB4A 2HXUA 2WOQA 3CYVA 3FS2A 4LUSA 2QEZA 4GGBA 4DYKA 1J12A 4U3CA 4GQRA 4FLOA 3IK2A 4MFDA 4W89A 1LLWA 3V5FA 3PBWA 3PAOA 3T2OA 4NJHA 5T9BG 3GUWA 4AVFA 1LM1A 2QUUA 4JTEA 2CU0A 2OSYA 3V7PA 4QR6A 5K7JA 1KBBA 1MDRA 1V0NA 3MHFA 3V75A 1D8WA 2WZTA 1WNOA 1WYIA 4A21A 3CL8A 1X38A 1JFXA 5IHSA 3PBVA 1Q13A 1J18A 2D2JA 3LV5A 3NQVA 3LXCA 3FSTA 3A4XA 3OU8A 4TX9A 4WJEA 5LGXA 1W1IE 1JNEA 2YLAA 5MKGB 1HKKA 3GDBA 4U31A 5E9AA 2WLZA 3QHNA 3G18A 1E71M 2PLMA 4N9DA 1PIGA 3R12A 5GJNA 3CV1A 2DZVA 3BXWA 4IGMA 4ZENA 1O60A 3WDHA 4GY1A 5IOBA 5AC7A 4JTGA 1VF8A 2NVDA 3VAVA 1FXQA 4WX2A 4AXNA 1PWMA 2ATSA 3DX5A 3NPVA 4DJEA 2Q09A 5A8GA 1XH2A 3S1GA 4MWAC 1UB3A 2F61A 3RYSA 3WQVA 4Q4SA 4GY7A 4FALA 2OU4A 3WO8A 4MPQA 3QR0A 4MVAA 3OQEA 3FLUA 1MO0A 3R89A 3W01A 4N4QA 1K1DA 4ZBCA 3CMJA 1CLXA 1C7TA 4WDXA 2Q8ZA 3SUTA 5B7ZA 1ME9A 4JIIX 2E3ZA 1MQQA 1LWHA 2G97A 1LDCA 4J1OA 4AY8A 2Z27A 3I7QA 5IXEA 2PF8A 4KKXA 3CEUA 1SZRA 4HJWA 2FVMA 1F05A 3WK0A 1GPWA 3WY1A 2PRMA 1J93A 3NQBA 3N2BA 1QNOA 4UCFA 1HX0A 5AC8A 1GZJA 1W1ZA 2NQHA 1GPFA 1NOWA 2YCLB 3SIZA 1ENUA 1DE5A 2VDGA 3OIHA 4M80A 2HEJA 3ITLA 4AD4A 2BHYA 3VABA 1US0A 1V3MA 1JPMA 4WK9A 2WVVB 4EWND 1E1EA 3NEVA 2EKCA 1OK6A 3PZGA 3W1PA 1XKJA 1QOQA 3MB9A 2E1WA 1SO3A 3W28A 4L65A 3P0XA 1GKRA 3PY2A 1RH9A 1H2JA 1J0HA 4AIEA 2QV5A 2GSEA 3OP2A 2R1LA 2NWRA 4O4WA 4HA3A 1HNYA 4D6EA 5HNRA 4WGXA 5FKYA 3PWAA 3N6QA 5AB3A 3EYPA 4GUHA 4W8BA 4DHGA 4BF9A 4J3VA 4F48A 1H0IA 1JZ8A 1OF6A 1K8CA 1RSCA 1R3TA 3W7JA 2BHUA 3DZ1A 1Z41A 1TKKA 2NV2A 7ENLA 3E02A 1RLCL 4M82A 1PDYA 4IFKB 2ISDA 3V1HA 4Q33A 4M0XA 3TTOA 4RW3A 4G1KA 4R9XA 3EX1A 3S2LA 3MWAA 1HF6A 3VOIA 4UFKA 1CYGA 1XLMA 2GGIA 2CPUA 4KRUA 1U5HA 1ZJIA 4B90A 1PZ3A 3L0NA 5IM51 3ITXA 2GZXA 3GIPA 4GXMA 3TNBA 1PTAA 8XIMA 3U5YA 4NX0A 1XM3A 4ZQMA 3OEXA 4W7WA 3GXTA 1I2NA 1QNVA 4HKPA 1O5RA 1HZYA 2DQWA 3PNZA 4CEXC 3IS4A 2VRJA 2O56A 3AWOA 2WQPA 1TTJA 5D4YA 3L4VA 4RZ5A 5D02A 3M7WA 4Y90A 4H6RA 1UOZA 4GVHA 4X3ZA 4GX8A 1BXNA 3WQWA 5JBDA 2Z26A 1GZ1A 1SO5A 2NZLA 3T1GA 4BWLC 3HIJA 3GS6A 1HG3A 1KRMA 5M3WA 2ZQ0A 5JQ9A 1IGSA 1PTGA 2VEKA 4XWUA 1TV2A 2W4XA 3NSMA 1XLGA 1GJUA 4DNHA 2ZZ4A 3QV8A 2FQIA 4MYXA 5G2HA 4KCTA 4HNTA 3AIVA 1N2VA 3ORWA 3TSDA 3TTSA 3V35A 2QF7A 1TWIA 3VIOA 1GQKA 2I5QA 3LHZA 7REQA 3AHXA 2WBGA 2OR2A 5XIAA 4O0QA 4OT7A 2H9AB 5D38A 1CXHA 2NSOA 4S3AA 3M0YA 3C61A 1F3XA 2ABBA 3BTNA 2CLFA 3R43A 1W9PA 1V7AA 2V9DA 4ZA0A 5JH2A 1BFNA 5DMNA 4ACYA 3I7SA 1Q6LA 5E6ZA 3S1XA 4JIHA 2QAFA 4YCOA 3U9IA 2XVKA 2VX6A 3DN5A 1W5NA 1PZ0A 1LWIA 3QFEA 1LL7A 2CBVA 2CKRA 2Z24A 3G0SA 3VDCA 1Z32X 4HNVA 2RDXA 4JPGA 4US5A 3ECQA 1XICA 4RXGA 1AW1A 2F84A 2I1OA 4CQ9A 3VA8A 2EG8A 3GY1A 4K1GA 4GBDA 1ICPA 1UQZA 3QPZA 5CXPA 4K1WA 3LY0A 1GQJA 3WJYA 3I3BA 1VEPA 3FOKA 3NXLA 4TIMA 3V0TA 2DGAA 2D23A 2G41A 3KE0A 1P0NA 4ML9A 5KZ6A 4IX2A 1G67A 1TZ9A 4DI8A 5LNVA 4JN7A 2QCDB 3OYXA 5C2XA 2P0OA 1RBAA 4FXRA 1VFHA 1V6YA 2AMXA 1CW2A 3B9DA 1K8ZA 3H24A 4XZMX 3TC3A 2VFHA 5F1UA 1QR7A 1GWJA 3TVAA 3LHWA 3MW7A 4LFYA 3LI1A 1JYWA 4PTNA 4B91A 1O94A 1KCZA 4IHCA 4JQAA 3STGA 4X2RA 3WBAA 1XCWA 1DE6A 2UBPC 4FXFA 5MHBA 3W73A 3AXHA 1GTHA 2OVLA 4Y6GA 3BAJA 5FEZA 3QJAA 4KCWA 4MM1A 2D3NA 4TVUA 1ISZA 1XIBA 3A4JA 2TYSA 2WNZA 3GE7A 1EQCA 1G5AA 1OCBA 4PUKA 3FEQA 2J88A 3AZSA 3ZSTA 4JS3A 3VO0A 3KWXA 1F5ZA 3RFAA 3TFXA 4OQVA 5F4XA 1EGZA 2VD9A 1B3YA 3IJ7A 4U3AA 4LUSB 1JI2A 2H3DA 3PG8A 4UZUA 2OKOA 3W7PA 2E68A 2Z7GA 2OQYA 1NP0A 3VK5A 3VINA 4B2DD 1G0CA 3KEHA 4WOZA 2VFFA 4M3PA 4PC8A 1JRBA 4EWJA 1F61A 2PWFA 5I2UA 4NXSA 3KOZA 3BUVA 3Q2DA 1OCNA 2Z25A 2Y62A 2WHKA 3SUVA 4LBSA 2ACRA 1WKFA 2E6FA 2J6XA 4Q22A 1HL9A 3GXMA 2CWNA 4WY0A 2PDWA 2QIWA 3DGRA 5TNVA 5E9XA 4NXKA 1KGXA 3CUJA 3ZSSA 3WNPA 2RJGA 4EPEC 1OX6A 3W74A 3BARA 4P7LA 5I3FA 3ZOAA 3OYZA 1CZ1A 3FHAA 3ZVHA 1G01A 3MUY1 1DWAM 3IPWA 2VOMA 4FZIA 1POKA 3KRZA 4KPLA 3ZR4A 2DZXA 3MI2A 3W4RA 4O54A 3VNMA 2D2OA 2VTFA 1GOOA 2XPKA 3DFYA 3R1ZA 2DVUA 4A8IA 4TR9A 3E38A 3TR9A 3TROA 4F66A 2OG9A 4KEVA 1K6AA 2I5GA 2A3AA 3RF9A 1FP9A 1U33A 3BLPX 5CBBA 1HKVA 1ZBKA 2O9PA 4Q4PA 1A5CA 1W8SA 5GPRA 4S2BA 2BTMA 3KDNA 4G5DA 4IWWA 3ZWTA 3VKDA 2NUYA 3W2KA 5CSSA 1JR1A 4CNPA 3FJ4A 1OHLA 3H55A 5E93A 4PUUA 3RG6A 2J75A 3VM5A 3VZYA 1V6XA 3BJSA 4O50A 4GZIA 3EDJA 3NA8A 1SFLA 1EC8A 1ZLPA 5ECUA 4RCXA 3IJQA 1UWTA 3BSHA 4QE4A 1Q6DA 1UP2A 4GH3A 5CSYA 5AHMA 2ZA2A 1V51A 4L56A 1OD0A 3GDKA 3HTWA 3P5ZA 3T4CA 4LYQA 2G0WA 1HGWA 3T2QA 2YL8A 3LA4A 3R79A 5HQEA 1M3UA 4TO8A 3ZJ7A 3WJZA 3RM9A 3E0WA 4AHQA 2V2CA 1UPMB 3TONA 4J3TA 2Z2AA 2VFDA 1E9ZB 1ZRQA 4D8LA 4NZ5A 1W37A 4AF0A 3STEA 3EEGA 3MYPA 5H2ZA 1I2PA 2YBUA 1UBSA 1BD0A 3VDHA 1TVPA 2XFRA 5BXPA 3E9AA 3P67A 4PRWA 3FCPA 2HE8A 1FWWA 3PZIA 3WMCA 5LIXX 2D0FA 3HGJA 2POTA 3ABQA 2VC5A 4WJ8A 1JUBA 4C6KA 1KFJA 3BOLA 4FEZA 4RR4A 2QJJA 8TIMA 1WXYA 4PN2A 2DT3A 4PTDA 1CNVA 3FKRA 2XISA 1WE5A 1SW7A 3EA2A 3TOYA 2VFGA 3H2FA 3NEHA 3J7HA 3UEQA 1WBHA 3RPTA 3QLLA 5LA1A 3R10A 8A3HA 2F6KA 1EDTA 3LBOA 2PTXA 2ZX8A 4AD1A 5I3GA 4MZYA 2A1YA 4N9CA 1QASA 3FFSA 4BQ2A 5CAHA 3MMUA 5BRQA 3ARVA 4DXVA 3BMVA 3GK0A 1JUKA 3GR8A 3IJ9A 2BS9A 1NF0A 5I06A 3EWWA 1AMYA 3AXKA 1MW2A 1CDGA 1Y0EA 1GG1A 3S6OA 4NJGA 5CEWA 3W84A 3UR8A 1ZTVA 4MZ8A 2ZWYA 3BZGA 4AEEA 5HPOA 4ADSA 5C70A 3CUGA 4S23A 4E8CA 4B5TA 1W56A 7REQB 4NUWA 3DAQA 4GA8A 4XK2A 1EGVA 2V3DA 4GIRA 2XGBA 4MY1A 2VEPA 1VCFA 2HDJA 3PUDA 3V4BA 3EDFA 3WF4A 2QAPA 3QV7A 5CPSA 3LS9A 4OV4A 1Q63A 5BROA 1SR9A 3HPFA 2E4TA 2PU1A 3OZOA 4JKLA 3S1WA 3VD4A 1M53A 4H9VA 4PMJA 1XUZA 4NAEA 1ONEA 1QNSA 2CZ5A 3B8UA 1LOSA 1BF6A 2FPYA 4GYPA 4H4IA 3P5YA 3B0XA 1EPXA 3CWOX 3PJWA 4ENLA 4H8NA 2YFOA 3F4DA 4IPLA 4HTYA 1TMLA 1W3TA 1K4HA 1Z7AA 3SCPA 2Y85A 1S5TA 2HNEA 4PYSA 2J7FA 4K36A 2I16A 4DUOA 3EWDA 4GUIA 1YW1A 4P2VA 1TPDA 3QQWA 1PZ2A 1SZGA 2P5NA 3LLFA 1W31A 4M6QA 4QS6A 1BWVA 3PFMA 5GQBA 3ATYA 4GRSA 3AXIA 1KR1A 4B5NA 3CAWA 1F6KA 3VD3A 3NOEA 1UBPC 2VZOA 5I0DA 4UNLA 2FVKA 3IIPA 3UPBA 1VBHA 2ESCA 2E7FA 1KR0A 3NYDA 3LERA 1TCDA 1D3HA 4PL1A 4LALA 4UNIA 3NZ1A 5HNUA 4MADA 1UH2A 3SM0A 1E0XA 1P6WA 4OV9A 1CXLA 2XHYA 3SADA 4DYEA 1JXKA 1TJ0A 2XFFA 4HMNA 4RNHA 1J2BA 1L9WA 1Z44A 2J7HA 1VYSX 4RPPA 2EO7A 2X0HA 1KRCC 4MZ1A 1TPB1 2I5IA 3I4EA 1J0ZA 2WWCA 4U33A 5I79A 3GIQA 2R1KA 3KZSA 4HHMA 5SWUA 1XIFA 1EDQA 5LNWA 1H11A 1ZY9A 4XUYA 5I07A 3W7LA 2VO5A 3LV6A 3S0CA 4MB3A 3GZAA 2GFTA 2XVNA 3IIXA 3GW0A 1HUVA 4Q8MA 4DZAA 2V69A 1JUEA 4LNYA 2BOGX 2NVCA 2VEGA 3EWXA 1AODA 2P50A 1R7OA 1Q6GA 1H4PA 1N82A 2XN0A 3DH7A 3G24A 2GUBA 5ECVA 4W5UA 3PPHA 2EJ1A 1T40A 5H91A 5E09A 5AC6A 1RQBA 1TR1A 4WSJA 3NUKA 4J3WA 3C0JA 1XIMA 2G95A 1HJUA 4AEOA 3T0TA 4LUYA 1R8LA 5A8OA 2WW5A 3MZNA 1HJWA 1LYXA 4L9ZA 1EKOA 3KBNA 3HQ1A 1HKMA 1B3ZA 3E0IA 4WY0B 1NDVA 3W02A 3ITVA 3P0WA 3P60A 3DUGA 1FWNA 3MKKA 3LGGA 1TV3A 3SURA 3SCVA 4P8VA 5A6MA 1AMKA 1KFBA 5LNRA 4PUMA 1XC4A 1GOXA 2J62A 2Y5SA 4GYKA 3CZLA 3P84A 1YX1A 3ZVHB 2BGQA 1A47A 5I00A 4ONVA 3WJWA 2ZOXA 4ICNA 1BTCA 1W2VA 1XUUA 5CZTA 5EMJA 2VOTA 3RX2A 3W70A 2JQXA 3P6LA 1MW0A 2YB4A 4BJHA 1UH3A 2OXNA 2C1HA 1KM1A 2YCEA 3VKAA 3Q37A 5BWFA 3MUXA 2JBMA 2ZDRA 3T0CA 3DFHA 2PEVA 3IV3A 3S47A 4KWSA 3M0LA 2HPMA 2Q8XA 4XZIA 1T41A 1X96A 2P1FA 1DXIA 3NAVA 5AHEA 2BVTA 3M46A 3CB8A 1NM9A 1NARA 3W7MA 2JKPA 3TR2A 1L6YA 3T44A 3II1A 1UIPA 3OIXA 1E51A 3NZGA 1VKFA 4FNRA 5EMMA 3DIPA 3UYIA 1DIEA 1SW3A 3RJYA 1ITQA 1PIIA 1S5WA 5HWMA 4NIRA 4AW7A 2O7QA 3BLFA 4JTTA 4ZZ9A 2CZDA 2BBFA 2PZNA 3QF0A 1E15A 3UU0A 2L5HA 3QGAC 1BWKA 1XIHA 2BODX 1LWJA 1Q2SA 1SQ7A 5H8UA 1R9ZA 4EACA 3GR4A 3MCOA 5AVNA 3UPWA 4PBFA 3IVUA 1Y5WA 1UCWA 4XBJA 4HBKA 4Z2KA 2BWGA 3VVGA 2V30A 3PPGA 4G1NA 1DEDA 2FGBA 3W1RA 2DSWA 2ZKMX 1XW8A 4CU8A 2BNJA 6A3HA 3C5QA 4G2DA 1WPCA 5AC4A 4AF0B 3EXTA 1BRLA 3R94A 3CGTA 1E4MM 3WMBA 2WMKA 1PE1A 2PDUA 5H8PA 1AVAA 1NWTA 2Q01A 3HPXA 4RNJA 4GKLA 3UW6A 1DIKA 1E1FA 2J9XA 1QW7A 2XM2A 3MT1A 2Q3OA 2XGIA 3S1UA 3ITTA 4GI9A 3F2BA 3GXNA 3W1AA 1YNPA 1FBAA 4UWMA 5D9NA 5BYWA 7PTDA 1GVSA 3TYZA 3EOEA 2HRWA 3LCWA 2ABAA 5HWJA 3OGVA 4ROQA 1FCQA 3M6DA 3A3WA 1YNQA 2O9RA 2J4GA 5GVJA 2QPXA 3UY8A 3UETA 2ODOA 3HFYA 4DM1A 2Y2WA 1EXBA 1EA9C 3GHSA 1C93A 4B15A 1QW8A 2E6DA 2WM1A 5EBAA 4D1JA 4BQ5A 3HV8A 4XBKA 3FJNA 3G3DA 3EMZA 4A8RA 3OQ8A 2XG9A 4AHPA 1LJYA 2PCEA 2Z00A 1CENA 4HVXA 5PTDA 1DWIM 2XVGA 3R2GA 3W81A 4F40A 2NSXA 3UWVA 3E0FA 2J7EA 2ISWA 4EF9A 4V1XA 2V5LA 3B4YA 2CW6A 5AY7A 4AH7A 4GOAA 2FTYA 3WD4A 3QHOA 2IPWA 2E9MA 4GQBA 2GUUA 1TSIA 2CLKA 3ARTA 3NNTA 1A4MA 1E6NA 4UTKA 4PA8A 2X7WA 3INPA 2FJKA 4IF2A 3UZJA 5CPNA 4GABA 4DXXA 2WPGA 1XSJA 1S2AA 3TSBA 4EX4A 1H5YA 3E5PA 1XQLA 5MF5A 3RLUA 1WZAA 4F4RA 3MANA 1EJXC 3SSJA 2CLPA 1EPVA 4AY1A 2DZTA 3KHJA 5M5DA 4UZSA 4LS0A 3NCOA 3AYRA 4I7WA 5EFDA 1H5VA 3TC6A 3TJ4A 3QM3A 4DJEC 4GIAA 1D9EA 1DJZA 4NAEB 3IAPA 2MANA 4MSSA 3MBDA 3NDYA 1BG4A 2X1SA 1V8EA 1OX4A 4J3UA 4LAMA 1AD1A 1IF2A 1LZOA 2ZX5A 1V6VA 5DT7A 2FHCA 4OGZA 1R3YA 2NUXA 4MLJA 5DBUA 2WMJA 4ZQCA 1MQRA 2VXNA 3A22A 4IPPA 4AX6A 3W2JA 4EPDC 1FH8A 1H0GA 4LRTA 2PTYA 4OBRA 7A3HA 5F2LA 4H04A 1H1ZA 2C6QA 1UZ1A 1W1YA 4P5UA 5K9XA 3S9IA 1GVFA 2GQ3A 2FMOA 4Y7EA 4LAUA 2V5CA 4DAFA 3DYPA 6TAAA 4D6CA 3JUGA 5M03A 4NKCA 1NFPA 1Y5XA 4YHGA 2VNCA 1JCTA 1MEHA 3UGVA 1A5NC 3UWZA 3SUUA 1GYMA 1P1XA 3EX2A 5D2VA 4A2SA 5C6MA 2WSKA 3HV9A 4IJRA 4HQVA 5A5WA 3MS8A 5A8MA 2DH3A 4H6KA 3GWQA 1BKSA 1QPNA 3CYJA 4WD0A 4TMBA 4GI6A 3BQ5A 1XR2A 2O0TA 4Z2JA 4M56A 2DEPA 3EKGA 1Q2RA 5JXQA 2A3LA 3WH6A 3WBXA 3ABXA 4NZ4A 4BK9A 4ZEPA 3IARA 1Q7ZA 3ONCA 1NOFA 4O16A 5F4WA 5FESA 3M5YA 3QRHA 4Q32A 2HJPA 2J7CA 2CBIA 6REQA 2XH4A 5G4WA 3LHTA 4QTGA 3AYTA 1IHIA 1GVYA 2ADAA 4GPNA 3HOJA 5A69A 5LKYA 1M03A 1K9EA 1SFTA 1NTHA 3ZMRA 4ZFMA 2A3EA 2GJLA 3UERA 4KCVA 1BTMA 1VYRA 2UV8G 2HPIA 2A7NA 4GJIA 4L6OA 3L5AA 5AHIA 2ZA3A 2VQUA 3VM7A 3ZT7A 1E9IA 1QJWA 4I5UA 5HPCA 3NL6A 1HJQA 1YE6A 2BY2A 4NNAA 3A9IA 4UQDA 5E5CA 2XIMA 1F74A 4LF1A 3AIQA 5BXRA 4UCGA 1NWSA 2CXGA 3N11A 2ACSA 4Y9OA 1EBGA 5DMYA 1VJSA 3PNUA 1VAHA 2HK0A 1O5XA 1W3KA 1JDAA 2WVSA 4CUCA 1FY6A 3IWPA 5LIWX 4IMAA 2XUCA 2JFEX 2NWSA 2Y8KA 3E6EA 2DY3A 3GVWA 4XD5A 1IT7A 1MZRA 4JOMA 1A3HA 1VLIA 1L2QA 4OFCA 4U2YA 4LAKA 3MHGA 4DPQA 4MDOA 1E0VA 1VBUA 1EEPA 4AWTA 2PDHA 3ALGA 3UD6A 4GQ0A 3VD5A 3LYEA 4IPJA 5AECA 3LZ3A 2X42A 3RLVA 3WLQA 4IGNA 2I57A 1XYAA 1GYNA 3GX9A 3WBWA 1WUFA 3IEBA 4IFRA 5FSEC 4DN1A 4JTCA 2QCGA 1GQLA 3AI0A 4CN6A 3ZJ6A 3MI3A 3NGFA 3RNDA 5A6AA 4C6FA 1EIXA 2PP1A 5HMDA 3SI9A 3NQGA 2YYUA 2W9MA 3RM8A 3MMDA 4JQ2A 2HXTA 2P88A 4IL2A 3TLLA 3DECA 3N9KA 4DIAA 3F4CA 1EC7A 5I7GA 3B05A 3FHQA 1DJXA 3GKFA 3IVTA 1P48A 1HN1A 3SAZA 3MP4A 4R5EA 2BFGA 3MC5A 2PRLA 3TA6A 3E1F1 5CPLA 3VCNA 4HCHA 4Y96A 2WZEA 3FIGA 2XSXA 4M8UA 1R3WA 4FS9A 4G9PA 4WF7A 2W0UA 5G1MA 4IOTA 3NO1A 3OBEA 1FCUA 1FWBC 4YYFA 4AQLA 4R7WA 2C91A 4AZIA 4AWSA 2X1IA 5LXXA 3T55A 1AUSL 3CHCA 1M41A 3OA5A 5AHFA 5FJPA 2E5DA 5G1TA 4MB1A 1BRLB 4QQ3A 1LP6A 4WXZA 3W37A 2P8BA 4E3TA 3ALFA 2GOUA 1HQTA 2B0MA 3B04A 4WVXA 8RUCA 1JCYA 4JFUA 1B3WA 2A4AA 4RUBA 4LY8A 3ITGA 3MI6A 4RNIA 3WNLA 4J27A 1KWGA 3K13A 4HCDA 4LYRA 2J13A 5I77A 2GVJA 3BAKA 4PMYA 1QTWA 1IEWA 2QCLA 4UOQA 3CLWA 5HINA 1ZBWA 1W3HA 3F4WA 5HJYA 2UY4A 4MWAA 1C8YA 1T8XA 3EB4A 3G1AA 5IRPA 3LCIA 3UYCA 3R0KA 3AISA 5HUPA 4HGXA 3HO8A 1TELA 2D0HA 3RILA 4EPBC 1UKQA 5KZEA 2J24A 1BQGA 1KRBC 1JG9A 4ATDA 5JVLA 5E0CA 1UYQA 2W63A 2ZRZA 3CHEA 1EWDA 4BF7A 1ZNNA 4RX0A 4FR6A 3STPA 2YKKA 3PC0A 1LL4A 1XYLA 3VCCA 1ZJAA 1PL9A 4AZCA 1DIDA 2DV0A 1A5BA 3QY8A 3VNYA 1EJSC 2VZUA 4A3UA 2FZDA 3PZMA 4J2MA 1FRBA 2Y5EA 4AAJA 4BKNA 5FJJA 5AHLA 2Y70A 4Y9NA 1FWRA 1R9XA 4ROPA 3ABSA 3HPSA 1ECQA 5G4HC 2J6VA 4IH3A 1AQMA 1FXPA 5IDIA 3N2TA 3C2FA 5LHEA 3NQ7A 4TV5A 3VNJA 2PDLA 4Z17A 2HBVA 3QW3A 3A3HA 4F0LA 1GORA 4GKTA 4J2PA 1JYNA 1LBFA 3W76A 4NI3A 1GT8A 3CPUA 3FDGA 4DJFD 4J40A 2IS7A 3SY5A 3NSNA 4GVGA 1LCOA 4JY9A 1EJ7L 1GVRA 4HOXA 5D05A 1OX4B 1KBKA 4WSKA 4DZ5A 3WUBA 5D9PA 4ZR8A 4IM4A 4QJ4B 3QLDA 3O2LA 4MUZA 3PWIA 2GVGA 1VFUA 1W1TA 1IXOA 2EEXA 5FIPA 2AAMA 5U7SA 4H01A 1E4IA 5GNYA 4LY4A 3Q45A 4PMZA 3L7RA 1LLOA 2DVXA 3GH7A 5IFTA 4MFEA 1RCOB 3WH7A 1X1OA 5CZKA 2ACUA 3GQYA 1HW6A 4IP7A 4C6OA 2C7FA 4GH1A 3VMPA 3CUXA 4CD7A 1VIWA 1VBJA 2HNHA 3SSZA 3W7GA 2TMDA 4W84A 1KNWA 1UD2A 3TQKA 2AL1A 4H8UA 4IG2A 1JDEA 2DT2A 3W53A 3N6HA 1VH7A 1OX5A 1XINA 3T0AA 4RNFA 1BSLA 3VIPA 2C8NA 4Q8OA 4YIWA 2ZRWA 6XIAA 5I09A 1P0DA 1QNPA 1X8FA 3AUJA 4C6CA 2A3BA 4BWLA 1GVOA 1GGOA 4M81A 3G1VA 1VFOA 3IIZA 3KBJA 3PJXA 3KOFA 5FACA 2WZHA 2PDKA 1OFRA 4L4MA 5EMUA 4HPJA 1T99A 2WKLA 3VI2A 5XIMA 1UASA 2WJEA 5CGMA 1TO3A 4H83A 1DXFA 6REQB 2ZADA 3OBAA 2VC6A 4IUOA 2QUNA 1Z42A 3VDBA 2EJAA 2FFIA 1M7OA 1KB3A 3W7IA 3H2AA 2XSAA 3RCMA 1DXEA 4UOZA 4JFVA 2KX9A 3HB9A 4XO6A 4M6UA 2J47A 4ASTA 3HZ3A 5T26A 3S5ZA 2OZ8A 4UTLA 5CQ1A 1E73M 3TV8A 1W54A 3WQ5A 4R33A 3RO8A 4EP8C 5BOFA 1KQYA 2YSWA 3VNLA 1V02A 1AW5A 2AQOA 1FKXA 1OB0A 3OHMB 4JN8A 4DAIA 2J9YA 1V0KA 2X1UA 4XQ6A 4QG9A 4HSHA 2BY1A 4A4AA 3WLMA 1B1YA 3CPRA 4C6BA 3I7RA 1DJQA 4Q7NA 3WJSA 1Z9AA 5ENLA 5EYWA 1AFSA 2D73A 3T4WA 3H7VA 3SQMA 3ITYA 3TW6A 1BQCA 3KBVA 3C52A 4WDWA 4AWUA 4ZB2A 4F0RA 4LUJA 3LG3A 2XH7A 2G3IA 3V36A 4LEFA 1LG1A 3M5VA 3UJFA 3ZT5A 1MFVA 1EBHA 2C18A 4DO6A 2XH2A 3F2DA 2ZXBA 3UY7A 2XVLA 1CECA 3MBFA 1SYTA 3LCHA 2CLIA 1V79A 5EBUA 4XTIA 2FTPA 1F7BA 3MWCA 2DW6A 1U22A 5I3HA 3CEPA 4K2SA 4MJMA 3AMKA 4JIQA 4S3FA 3P8IA 1YDNA 3DHUA 4P7QA 3BAWA 1JAKA 1UMYA 1XV8A 4C6MA 4R9OA 4YN5A 3L67A 4JTUA 3FA5A 1Q8JA 2WSPA 4B9ZA 4O17A 4CNTA 3NO3A 1AQFA 1AH3A 4C90A 4C91A 4JTSA 4JZ5A 5AYIA 4QS5A 1VPXA 1UZ4A 4ZXLA 3W6YA 4GD0A 4GYPC 9XIMA 1QCWA 1RBOB 3DI0A 2TPSA 3LDVA 1TMHA 3VIIA 3CXOA 1XLBA 1F3TA 1O4UA 2PB1A 5LIUX 4AXKA 2AKMA 3BLDA 3N3MA 4H00A 1P1MA 3ZIZA 4EAMA 1DKWA 3GG0A 1VCVA 3SIMA 1VP5A 2NLIA 3ELFA 1S5NA 4HK5A 1CXEA 5CZSA 1UHVA 3AMDA 1X1ZA 5FL1A 3CMGA 1KC7A 4M1BA 1P43A 2FHFA 2RHGA 3LTSA 4GYJA 2E6AA 4PBEA 4KESA 4ZMGA 2J77A 4NZFA 2YDAA 3R11A 4F0MA 4JKKA 2G50A 3N4EA 3GHRA 3NSXA 3SUSA 5DCDA 2VUNA 3C86A 1WV2A 1YMYA 3E96A 1E1CB 3G2GA 3R8GA 2PLKA 3GG7A 5I24A 2QR6A 3N2CA 5HOSA 5G2IA 3CPGA 4L5ZA 3LCLA 4L7ZA 2X16A 3DC8A 1RR2A 1REQA 3B40A 1S39A 4AFYA 3W23A 4L64A 5D9OA 1JZ3A 3M1ZA 4NZ1A 4W85A 2GJRA 1Q6EA 4IFOA 3O6CA 4UQ9A 1QK2A 4OWGA 3HQPA 4S2CA 4IICA 3GNRA 5B7YA 3ZLHA 3SGZA 3WMSA 1F73A 4HN4A 2PDBA 3KLLA 1XX1A 1NEYA 5A8NA 2CERA 3A6OA 2FJUB 2VCBA 1C9DA 3UG5A 1TX2A 3KVJA 1F4HA 1KXQA 2ISVA 1DQWA 3NQEA 2Q8LA 4XX6A 1QNQA 2W61A 1J96A 3PAJA 3LRLA 3HF3A 4NP7A 2BXZA 3WENA 1Q6QA 1M5WA 1S5VA 4OZOA 3W22A 1JCNA 4CCCA 4AZCB 2P53A 4DJFC 1FH9A 2PUZA 5A8QA 4LU0A 4HSNA 5H6HA 4GC3A 1GEQA 4RJEA 4N6FA 4QEHA 7CGTA 4OOZA 1UPPA 4LVBA 5K4XA 2OOGA 3PB2A 1CGVA 1H7OA 3P8JA 3PZVA 3SRHA 3A3XA 3HBLA 1ZAJA 1QPQA 3C2RA 3UWYA 1A5MC 1DYSA 5L6UA 1F07A 1HL2A 1X1NA 1DV7A 2AOSA 2ZCGA 3THCA 2QDDA 4FHAA 2O4MA 4L4LA 4ADTA 4YTQA 5C8BB 2NLYA 3SB0A 2YZRA 3QR3A 1Y5VA 1ZCCA 4WR3A 3OODA 3UXDA 4DLMA 3A47A 3FSUA 4YNGA 2XTKA 2V6AA 3W7OA 2VX4A 4MWAE 2DJLA 4DBWA 3HM7A 3RCNA 3QH2A 3ARRA 3CASA 4HZ8A 4JNYA 3QTGA 1VLWA 4TX8A 2VZTA 1XF0A 3CQKA 4EIVA 1YTEA 3W82A 3BL3A 2WXDM 1F4AA 3VOGA 1NIUA 3MO4A 3LMZA 3KP0A 2E1DA 3C2EA 4IIDA 4B5WA 3GFYA 4JAWA 1E55A 4TVCA 1QVBA 3SY8A 3AXMA 2CKSA 3L0KA 4PTXA 4H8VA 1I1WA 3KOXA 3SN1A 3MSRA 4JTDA 4IG2B 1LT8A 1V6TA 1HJVA 1M65A 3KCOA 1OADA 3CL6A 1W3IA 2WZIA 3N17A 1ISXA 2WJDA 4GZJA 3OJGA 1E6QM 2VZVA 4HN8A 3VKCA 1XG3A 3C2YA 4DBSA 2YXOA 2C16A 2F2HA 4AZBA 4DF0A 1EB3A 3R4IA 4DBEA 2W67A 3MA8A 5JMUA 2ZYFA 1THFD 2X05A 1VFSA 3R0DA 1F3EA 4Y8EA 1ZP3A 4WKAA 4B5UA 2ZUMA 2XU2A 1L6SA 3RX4A 1I2RA 1CEOA 1XFBA 1B0IA 3S6DA 5I3DA 4FXJA 1Q4WA 1VB9A 3BK0A 1OC5A 2XWEA 2J78A 4ILSA 5D2TA 1UKOA 1FHLA 1W9DM 3AXXA 3WBEA 3CU2A 4NI8A 3EPOA 4XVDA 3GXIA 4YMZA 1Q7MA 4W88A 1ZAHA 2JALA 3M64A 2BMBA 3TH6A 4MAVA 4X0NA 4KEZA 3USBA 1TA3A 3ZT6A 2PS2A 4XISA 3T8QA 3VKKA 1YDOA 1TTIA 4HHPA 4AC1X 1VHCA 4QG8A 4CN4A 4FNSA 2G5WA 1MDLA 2INZA 4MB5A 3NDOA 4PUDA 4JX6A 4HIBA 1F76A 4WKFA 2NQLA 4D9PA 3LCFA 4PB4A 5CJMA 3GFZA 2VEMA 4O15A 1UMLA 3FV9A 3MQTA 2DT0A 2EG7A 1CIUA 3WNKA 2IPJA 3BICA 5DN1A 3AMCA 3H54A 4AZHA 4CNUA 2GLKA 3CQJA 3BMXA 3LD5A 1OT2A 3UR5A 5JH1A 2O7SA 2G3MA 1A3XA 3SCSA 1RK5A 1OGBA 1O1HA 5HAOA 4WDUA 1DORA 1JJKA 1YTDA 3WLLA 1OFAA 4UQCA 4LVDA 3WD2A 2H90A 1EWEA 4LB4A 3FX4A 4FNPA 1QFEA 1E6RA 2W79A 3C0SA 1X97A 3H70A 2VX5A 3C6CA 1KD0A 3G6LA 5G2WA 1UJQA 4IIFA 4B2DA 4AZGA 1TYGA 3W29A 4WDTA 1AQ0A 4HK6A 5CCZA 1VZWA 2QPUA 3WQ4A 1ZALA 3KTSA 4HZMA 1RY0A 3FW6A 3MJMA 3AS0A 1EZ2A 4DO4A 3GU9A 1A5LC 2X30A 3O15A 1JFHA 4FB7A 1XH1A 4D8AA 1J79A 1PYMA 3CTLA 4MKNA 2OYLA 4QCEA 1OK4A 1VD6A 3UVAA 3PPCA 4Z2LA 1IR2A 3M0JA 4IFKA 4D6GA 4HP5A 5A2BA 3ABRA 4JTQA 2CWXA 1WCGA 4NF7A 1HFBA 4KH2A 1S2VA 3ZM8A 2QQ6A 1OVDA 1HT6A 1PV8A 1V02E 3F4VA 4MAZA 3VGHA 2GQ9A 4L6DA 3YPIA 1HJSA 1LBLA 2X41A 1WDRA 2V82A 2QCNA 1LOQA 4JIEA 3TZNA 1ZSXA 2ICSA 3OVRA 1ITCA 1R7AA 2TRSA 3A12A 2Y24A 1ISVA 4QLKA 1TIWA 5AHNA 2P76A 1MI3A 1RY8A 2FFCA 1E9LA 3GC4A 1WAUA 2ZZ5A 1G9HA 4UIOA 3UJ2A 5JU6A 3TTEA 3S2MA 1TV8A 2DZUA 1EDGA 4U5IA 1WOAA 3KVKA 1TPUA 3FY1A 1CLVA 3OZYA 4ZB5A 1OFDA 3WELA 4CCZA 3V3WA 1JD9A 2PMQA 4RPQA 1UWIA 2X0SA 1EL3A 3AHYA 2OX1A 4BQ4A 3DG7A 1TE6A 3S5SA 1TR9A 3GDMA 3PWGA 5IHRA 5I03A 2CCRA 1C7SA 4D6FA 3WQCA 4JYFA 3KW3A 4JGDA 4GNKB 2PE4A 2NXGA 4FLSA 3AFBA 1XL9A 4JL2A 2X0YA 1US2A 4O8AA 3DFPA 1EUAA 1REQB 3AU2A 5D8WA 4FLQA 4IPIA 1JI1A 2QUVA 3EX6A 1GOQA 2D22A 3IGHX 3QW4B 5FEWA 4O53A 3VCRA 1VENA 3D47A 4IJCA 3C4UA 4QDMA 1MQPA 1Q85A 3ABZA 3HJEA 3E3HA 4EPKA 2CLLA 3AWNA 1NWRA 2PPGA 1VFTA 2AL2A 2FGZA 5FAGA 4M7SA 5DT5A 2H3BA 3LK6A 1W9VA 1D2KA 1X39A 2IXVA 1UA3A 4V27A 5KMYA 3EOUA 4KFNA 3O63A 1AK5A 3ATZA 3QXBA 1Q5MA 3OGSA 5K9DA 3WQGA 3KHDA 3CHFA 1R38A 3WL0A 5LSMA 2ZXDA 2ANUA 4V2XA 1DJGA 1FP8A 5DQPA 4F0KA 4QNWA 3CWHA 3TN3A 3VOJA 2OWCA 3TWAA 3S9YA 1B9ZA 2JGQA 3IVSA 2NW0A 3WUGA 3U57A 1NF7A 1XBZA 3CJPA 4UTWC 4E5TA 1JQXA 2C15A 4K38A 4Q4OA 2OQLA 3TOPA 2BX7A 2CHNA 4A8LA 4IMGA 3M16A 3U7BA 3AU6A 4FNTA 2EPNA 5J5DA 4RDZA 1KW1A 1QO5A 2ZC1A 2W66A 4FX8A 2V5DA 1TPWA 4EXAA 2EG6A 5D30A 3BH4A 4ERIA 3SRFA 1TV4A 2QMJA 1Q7QA 3ES8A 2OWXA 1HGYA 1VHNA 3H6OA 3NWRA 4RKAA 3TJLA 3WFLA 4AD0A 4ORIA 4AIOA 1KFCA 1TTQA 2OT0A 1FTXA 3CUZA 4W7VA 5LA2A 3FN9A 1CXFA 3AYSA 4PMQA 2X40A 3PS7A 1W5QA 3WLNA 2VYOA 2ZTJA 2D0GA 4B92A 1R9YA 1WKYA 2OZTA 3KCLA 4L1GA 1WKEA 5F2MA 3ITCA 1FWHC 3MSGA 2PWHA 2QYGA 4XD4A 4B5SA 4V15A 2XIOA 4NVTA 3VOCA 1E4LA 1J11A 3AAMA 3SR7A 2C13A 2R94A 2PWVA 4IQEA 2V0TA 4YTSA 4XZ9A 1TTPA 1A53A 2V3EA 2OWWA 2WO5A 5EMLA 2V2DA 3M0VA 1SPQA 4AZ6A 2J74A 4CCEA 5LGZA 3U0HA 2ZUSA 1IT8A 3VOFA 3E2SA 1FFQA 3B8WA 3NGJA 5E6YA 4E2OA 4NZJA 2PRHA 5CLWA 4KWUA 3WSUA 5K2ZA 3RRAA 3V16A 2PAJA 3C56A 3N14A 3SJNA 2BXYA 1WAWA 1H41A 2Y7FA 3GM8A 3R25A 5I5RA 1PPIA 4LS1A 3A64A 4UMCA 3LSBA 4CQAA 5D32A 4H19A 1CGUA 3GTXA 4X60A 3RMJA 1VGAA 1W3JA 3MSDA 1KWKA 1MMFA 1SO6A 1MUCA 2WK2A 2PGWA 3DC0A 2R8WA 2Z1KA 3LBMA 3NZRA 2WV8A 3PR2A 3GDLA 4G7FA 1KXTA 2PDQA 1JZ2A 2ZE0A 3EWBX 2X2YA 1UWAA 3BW4A 4ADUA 4PMXA 4WJXA 1EJWC 3HQNA 4CD4A 1J0KA 1R3QA 3VUPA 1TIMA 4LGXA 4CCDA 2RFGA 3KTXA 1H7NA 3LN3A 3EKZA 4QX4A 2GSJA 4L6HA 1XRFA 3CUIA 1EJTC 5H1WA 2OYKA 3D3FA 4CVUA 1CB2A 3K5XA 3PJUA 3REQA 4FO4A 3MTWA 4OECA 2Y88A 4U2ZA 1VRXA 1M1BA 1TA3B 4WLCA 2PGFA 3W1NA 1FUYA 1XWYA 4YYCA 4HJFA 1KM0A 3WQFA 5LNUA 5DRCA 3WH9A 1E9YB 5D37A 3U4AA 4CVWA 5C2CA 2IW0A 1CT5A 2F38A 4CEUC 1ZPTA 4WXYA 1ZL1A 3A13A 1VBGA 2WM0A 3N18A 4IQDA 3W00A 1OBAA 1AG1O 4A3RA 1OG6A 3N15A 2ZXAA 1JYVA 1E70M 4Z1YA 3UCQA 3CH9A 4UFIA 3MY9A 1TJPA 3PJTA 4O4VA 3DGBA 5KZDA 2OFJA 2ALRA 5FA5A 2GVLA 3G6MA 3LI0A 2Y7DA 1TREA 5CGTA 2NQJA 1QI4A 1E72M 4QLJA 3CO4A 2WNNA 4NJJA 5LIKX 4I9JA 4FK9A 1UW9A 5C9RA 3W83A 3KVMA 3D6NA 2J66A 5L9FA 3BCFA 1P6BA 1GK8A 1EJVC 1JDCA 4LV9A 4LV4A 3B8TA 4FOJA 1HVQA 3ICJA 4PEKA 4TXEA 1XSIA 2TSYA 3RPMA 4A3YA 3NPXA 2BY0A 3TN6A 1B3XA 3WDJA 4R27A 3LU2A 4LPCA 2XJ7A 3BE7A 5F4SA 3M07A 1XLKA 1IXPA 3MKCA 2GVYA 2X1TA 2A7PA 1RA0A 1BWLA 4XSLA 1EX1A 1S3TC 3WQ6A 1H62A 5FJRA 5FOOA 3VGDA 4ACZA 5A3HA 1IWAA 4QJ3B 4HYWA 1TJ2A 4MLRA 2XN1A 4LWWA 2FLIA 1ZGDA 3FYYA 4IP4A 4XZHA 2ZA1A 5CAKA 4HT3A 2ZZ6A 3RXZA 1YHTA 3PN8A 1YADA 1GCYA 4AHOA 3M0ZA 1TFVA 1LBMA 3GVGA 1ZENA 4RV3A 3WL1A 2W27A 2EBNA 5I23A 4C5YA 4US6A 4EAYA 1F6YA 3WIJA 3N6JA 1QRQA 4B3LA 4FIQA 5FCZA 4IQLA 3BDKA 3W7CA 1V03A 1UC5A 4U4MA 3AS2A 4FOUA 1RVKA 3W2UA 4M24A 5CC3A 3P81A 3UA3A 1DTUA 3GKAA 3NZPA 1RVGA 4AYGA 4PFHA 2YL6A 2WKGA 3S2CA 2GL5A 3ZZ1A 4IP5A 2GUYA 4ECLA 2VL4A 1Z89A 7XIMA 1B54A 3GSMA 4Z1CA 1UJPA 2BVYA 4L1WA 1EP2A 2ZRUA 1VR6A 2WSQA 2CZVA 1JPDX 1XGDA 3EX3A 1KTNA 4LQ1A 3H23A 3KL3A 3PTDA 3ARUA 4GUFA 4WCJA 1BVWA 4GC4A 2V81A 2G4JA 3U3HA 3WQEA 1V08A 2A6NA 2B31A 5CC5A 3W1TA 2VURA 1LLZA 1M9HA 2E28A 5DLCA 1AJ2A 1XGZA 4EVZA 3M0IA 1SMDA 1LT7A 1WXJA 3ENLA 2ZIDA 2DUXA 6CGTA 6TIMA 2X7VA 1UOKA 1OC7A 2ZDSA 3NURA 2GSHA 3A9BA 3WQ8A 3M43A 3WLKX 3WNMA 4ZCWA 1QK0A 4GMEA 3HJZA 1QT1A 4H9UA 3KUMA 3VZXA 4Q8NA 2RDTA 3S2JA 2AL2B 1UD5A 1L0PA 4C5ZA 1FQ0A 5C0QA 4ZE5A 4LC8A 1S5MA 3EMQA 3XIMA 2QULA 4DWSD 2WNQA 3ABOA