1QOQA

Crystal structure of wild-type tryptophan synthase complexed with indole glycerol phosphate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
268
structure length
254
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal Structure of Wild-Type Tryptophan Synthase Complexed with the Natural Substrate Indole-3-Glycerol Phosphate.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 98
structure length 254
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1999-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1qoqA00
3UZJA 3NVTA 2Q3OA 3KHJA 3VCRA 1YXCA 5AYZA 3E96A 2Q8ZA 4KWWA 4JX5A 1E51A 3CTLA 3L9CA 1PE1A 2CU0A 5AHMA 3DFNA 3CWNA 2BLEA 3A24A 2YYUA 3A23A 5F1VA 4ALDA 4UTJA 1BWLA 1H51A 3C0JA 4JNMA 3UPBA 3CT7A 5BMWA 3TH6A 2OT1A 3BGJA 4FXSA 4Q33A 3G1SA 3MHUA 3PUOA 2Y6ZA 4XKYA 2WQPA 3UXAA 5KZMA 5SWUA 1LLZA 3EX3A 2ZRWA 3S1WA 4O50A 5CKSA 5FESA 2EPHA 4BFAA 1KA9F 1XBXA 5MHBA 4NZFA 4PL1A 2GQ9A 3SSJA 1FY6A 5H91A 3BK0A 5FF7A 1ZFJA 3L65A 4MJMA 4D2JA 1JCJA 3W1XA 3TJXA 4MOZA 4DO4A 3MYPA 3PUEA 3O6YX 4AEOA 2JK2A 1SZGA 3Q58A 4O17A 3BARA 3L21A 5D32A 5G1TA 3DFSA 1F74A 1A50A 4FNTA 3SR7A 3HG2A 2VFIA 3FIGA 2ZQ0A 1GTEA 2DZWA 1MXSA 3PB0A 4MKNA 5T26A 4O4VA 5CZTA 4AWSA 2H3BA 4M7SA 4X22A 4ZQMA 1SO3A 3LXCA 2ZA1A 4UIOA 2DJLA 3RK8A 3GDTA 4O4WA 3EX2A 1AW5A 3KFTA 4BF9A 1PCKA 4GXMA 4MFEA 4MYAA 1QMLA 1UB3A 1M7PA 4ZL1A 3W7JA 3PF3A 1T96A 4UMCA 3O1NA 4QAIA 4YCOA 1DOSA 2X2GA 3GZ3A 2GUUA 5CPNA 2ZRYA 4N6FA 5G2WA 1SZNA 3RF9A 2ATMA 2H8XA 4JTHA 2ZZ2A 4K36A 2KZHA 2NUYA 1OYCA 3NPUA 3LHTA 3CU2A 4DPQA 5AC6A 3LV5A 2YR1A 3FEMA 4NU7A 5FEZA 3GAKA 4WD0A 4U28A 1S3HA 1SSGA 4A29A 3EWYA 4BK9A 4Z0JA 3W76A 2RDTA 1L6WA 1NVMA 2NLIA 2RH9A 3TU9A 1HFBA 4QNWA 3KX6A 2ZZ5A 1LZOA 3P7YA 5F2MA 2WNNA 3BG5A 3NL3A 4MZ8A 5DCBA 2YSWA 5KZEA 4LY8A 4NJJA 3HPZA 5TBOA 5HR6A 1W8SA 3NM1A 1RPXA 1Y0EA 3TFCA 3LHWA 2GOUA 4LRTA 2V2CA 3F4NA 4NXSA 1AW1A 3PWAA 2QCCA 4K38A 1AMKA 4B5NA 2H3DA 1QAPA 2TSYA 3P62A 1XBYA 1JQXA 4JYEA 1L6SA 3TV8A 2NUWA 4Z1AA 4MZYA 3DI0A 4J9JA 4EF8A 3UY7A 2BSLA 3MJYA 3EXTA 4PFMA 3MHFA 4H3DA 1GYLA 1EA0A 2TRSA 4O0KA 3YPIA 4R7JA 2JKPA 3RLVA 1H63A 1IIHA 1W5MA 5D33A 4TX9A 4HT3A 1FWWA 2P1FA 2QF7A 4JTGA 3LCHA 3IIOA 3PSWA 4FNUA 2CLMA 5K9CA 1EX5A 3NL5A 4WXYA 3W7MA 1UCWA 4O0ZA 1IXQA 2V9DA 3GYEA 3P8IA 3QSTA 1FDZA 2E6DA 1LROA 3R8RA 2V5BA 4R53A 3ZS4A 1TPFA 3PUDA 4AF0A 4ICNA 1XKYA 4AWTA 2C16A 3B06A 1H5YA 1KM5A 1GVRA 3LXAA 3HQ1A 4TIMA 1GWJA 1FWNA 3V1PA 2ZZ1A 4UMAA 3VE9A 3ELFA 1F6PA 2C15A 2PC4A 4OHQA 1OFEA 1YLVA 2ZFAA 1QFEA 4UFIA 3QM3A 1F76A 4UTTA 5DELA 1TV7A 3TSBA 1R2SA 2B7NA 4OU1A 1FCBA 4Z1BA 4BWLC 1NEYA 4E2BA 5EL1A 3FJ6A 3G1AA 1J5TA 1IXPA 4JY9A 5D02A 3USBA 2DZTA 5IBXC 1VGAA 3BVJA 4OWGA 1DHPA 3LCGA 4NNAA 1IXNA 4JTKA 1ZHAA 4FXRA 2TYSA 3GXPA 3W22A 3LTSA 2YCEA 4O14A 1SW3A 3S1VA 3THAA 3FJLA 5K7JA 1LBLA 3HGSA 5KZDA 4WXZA 1ZAHA 1KFKA 2ATSA 1G4EA 4LTSA 4GUGA 4IPJA 1MEHA 4UTHA 3G0SA 3GVGA 4JR5A 4ORMA 3TC7A 3KVJA 1MO0A 3UWUA 4N9DA 2R14A 3DKJA 2ZZ7A 3LHYA 2VFEA 4LOCA 2DZXA 3QSRA 4RKAA 1OK6A 3NO5A 3W2MA 1KTCA 4OGZA 5U4NA 3ANYA 1CI1A 3TFXA 4BWLA 1TIMA 2E6YA 4CLMA 2HSAA 3W7QA 3HPXA 3PY2A 2XFWA 1U5JA 1L6YA 3QYQA 2E5CA 1ICSA 3LCIA 5LNSA 3W7OA 5IBXA 4WX2A 2GQAA 4JTUA 5C6MA 2D73A 1OFOA 3T40A 4FX8A 1WBJA 1T0OA 2O7QA 1YDOA 2QCMA 3UQNA 3E0IA 2HTMA 3STCA 4A2RA 4PA8A 5LKYA 2OZ0A 3GR7A 3PM6A 3LERA 5TIMA 5LGZA 3GDKA 3C4UA 3DHDA 2VFGA 2J9ZA 2ISWA 3KAOA 3O16A 4FO4A 4EIVA 3LHZA 3M16A 3NPXA 1EUNA 1DL3A 4BR1A 1ZAIA 2JGYA 4N02A 1HO1A 1F7BA 1ZENA 5CGQA 3B0PA 5D30A 4RV8A 3W7DA 2A2IA 4MFDA 3P67A 2A21A 4RLIA 4KFNA 4WOQA 2UV8G 4M19A 5D2VA 4UTUA 3CC1A 3GIYA 2GVJA 4GUHA 7TIMA 5LHEA 3HF3A 3LRLA 1ALDA 2ZA2A 3ATYA 3G22A 4JEQA 3W2NA 4UCGA 1LCOA 3FFSA 2QAFA 1ME7A 4QIUA 4TR9A 5L9FA 1I2QA 3W7CA 1TMHA 4GBUA 5DY3A 3IGXA 3HB9A 4OV4A 1TPC1 2CLHA 4UTWA 3V75A 1EPXA 3B4UA 1R47A 4Z1CA 3PBWA 3BLIA 4L4MA 4Q32A 3LGEA 1HO4A 1X8FA 1BEUA 1H61A 2H8ZA 2HMCA 3AJXA 2QEZA 1K03A 3HMJG 4ADTA 1U83A 4XTIA 2FTPA 1LOLA 3W1AA 3N34A 2ISVA 3HOJA 1GJPA 2A7RA 1EIXA 5G2HA 4UXDA 2WOQA 3SW6A 3EX4A 2P0OA 4UC5A 5HWMA 3M44A 1F6KA 1TRIA 2QCNA 1X6UA 4K7YA 4NUWA 1RQEA 4IQLA 4O28A 2W6RA 3MBFA 3T44A 2B4GA 1LORA 2FPVA 3WK0A 3PR2A 2V2HA 3S1UA 3CHVA 4HNVA 1O60A 3MUXA 1Z48A 3T78A 1KFBA 3LDVA 3FYPA 1TPUA 4JX4A 4JDBA 3IVSA 2W79A 3BLFA 3PVFA 3INPA 3IV3A 2Y61A 1GQNA 3WK2A 3GB6A 4HIBA 1EP3A 2QJIA 4RJEA 3DXIA 3W1LA 2P10A 5BW6A 2BX7A 2DZUA 1FCVA 2YDAA 3FKRA 1LYXA 4HSNA 3GXTA 4S2CA 1PV8A 1A5AA 2VOMA 2GVLA 1F05A 1TQXA 4FX6M 1SW0A 1TTJA 3OVRA 2V81A 1ZY9A 4H4IA 1SR9A 4MLJA 1H62A 3O07A 2DZSA 2ZYFA 1YTDA 3O15A 3P84A 4CQAA 1BTMA 1J2WA 2FPTA 4I7VA 4LVBA 3QEZA 3GNNA 4IPIA 3LBMA 1OX4A 1RV8A 3VFLA 1H50A 5DXYA 4GJ1A 5HMSA 3LLDA 1OFQA 1JUEA 3W1MA 1EWEA 2YX0A 3QC3A 5DBUA 1UBSA 1EUAA 1G7UA 4MY9A 3HGJA 3W07A 4LS0A 5BOOA 3THQA 3S5ZA 1UUOA 3W7KA 3W9ZA 4OQVA 1LRQA 1B3OA 3MP5A 3UWWA 3GDRA 5D09A 1LBFA 4O1AA 2B7QA 5KITA 1P1XA 4JIPA 4DELA 3W1TA 2QCDB 3P5ZA 4JTLA 3QMTA 3SI9A 4GRSA 1HUVA 3C52A 4FHAA 1H7NA 2I9EA 5BRBA 3QRHA 2QUTA 3QW3A 1NF0A 1SSDA 2LLEA 2OMAA 1VR6A 3R2GA 3HBLA 3CEPA 4I7UA 4HNNA 2NXHA 3S0CA 4JTEA 5EKYA 3DZ1A 4QSHA 4EOUA 4DXVA 3B05A 2NXGA 1R30A 1KM3A 1I2OA 2YPIA 3VI2A 3PG8A 1ICPA 5I3IA 3P74A 1P0NA 3TAOA 1I45A 3DKLA 4PH6A 3W7HA 1EB3A 1W5QA 4HNTA 1I2NA 1GG1A 1SO5A 3LBCA 4KFOA 1I8JA 2GPTA 2DJXA 3Q94A 1THFD 1P4CA 4O11A 2Y7GA 4CNNA 3P60A 4H6KA 3MHGA 5FEXA 4MVAA 3LHUA 2JKEA 3H53A 1JCMP 3NPWA 5I3GA 2CFFA 4K7VA 3MO7A 4PL2A 4O1DA 4PCFA 2CZFA 4O19A 3DU0A 3N73A 3P82A 2VEKA 4XKYB 3BO9A 2FLIA 3ZR4A 3T7VA 5A8GA 3W71A 4RZ5A 1TQJA 1TREA 4LV9A 2V2DA 1UASA 4G1KA 1KW1A 1WBHA 4LC8A 3TXVA 4O15A 2GJNA 3UD6A 4YXGA 5F2LA 2Y7FA 2F7FA 1B4KA 1QDSA 5HJLA 4AB4A 3DFTA 5D2XA 3W2JA 3BPWA 4RZ4A 3G1FA 2OJPA 5CZJA 3O06A 4Y6GA 4WQ6A 3SECA 1PCWA 3M47A 4FNQA 5AN7A 4UNKA 3NNTA 3IEBA 4UFKA 1JRCA 1ME9A 2Y62A 4Y9AA 4DBEA 1DVJA 2FIQA 3G1HA 1B4EA 3U6WA 4IMGA 3L0NA 3UZ5A 3GLCA 2CLKA 5K4ZA 3PBYA 1OF8A 1MEIA 3IRDA 3EXSA 1WXJA 3RU6A 4EWND 1RQHA 4A21A 1TPB1 3DFPA 4WJEA 1YADA 1D3HA 3M41A 3LOTA 4DF2A 2A6NA 4IXXA 5LHFA 3EX1A 1JQVA 4Z1DA 1HG3A 3M9YA 3N14A 2VENA 1AW2A 3DI1A 1W5NA 3W3OA 4Y90A 2X1UA 1QNVA 1KFLA 4M6QA 3RNDA 4O53A 5FF2A 1VH7A 2NZLA 1C29A 5F1UA 3NXFA 1DJNA 4LW7A 3SJ3A 4LS1A 4PEKA 4UTKA 1Z42A 3L0KA 4ZZ9A 1PHQA 1PS9A 2A7PA 2Y85A 3N2MA 5G2IA 5LNRA 2XN2A 1S5WA 5LSMA 1VLIA 2C0AA 3TW6A 2VEMA 4X3ZA 1GT8A 1QOQA 3CEUA 5EA9A 4TO8A 2G95A 1WYIA 3UYCA 1WA3A 1VCVA 2ABBA 2CZ5A 1KTNA 3TSMA 3BW4A 2VELA 3PBUA 4UTTC 1Z44A 2Z6JA 1G4PA 3MP3A 2ZZ3A 3G0UA 3MMTA 3QMSA 3MP4A 3CLMA 1Z41A 4O12A 1K8XA 3G8EA 3NQ7A 1SFLA 1WV2A 3RLUA 1X1OA 4IX0A 3PSVA 3N19B 4ZQOA 3L2IA 1FCUA 3KRZA 2O7SA 2DORA 3IVTA 1W3TA 1EWDA 4XBSA 5HUPA 1PIIA 5D2TA 5K2ZA 1FWTA 4GUIA 4R34A 5HULA 1Q6OA 2NUXA 1W1ZA 3DHFA 3C2EA 3BW2A 3EKZA 3EKLA 3NQ8A 4YMZA 3B8DA 2NXIA 5D04C 4AHOA 3MBDA 1XI3A 1J4EA 1L9WA 2C18A 3C2OA 1DKWA 3U8GA 4BI6A 1TO3A 1GVFA 3M5ZA 5HNRA 3W6YA 3NQEA 4FNPA 2BZNA 1OF6A 2E09A 3IGSA 3EWUA 5CSSA 1QOPA 2NV2A 3GDMA 1T8XA 4N6EA 2J88A 1K7XA 1OX5A 5J5DA 4M5PA 3KRSA 3TQVA 4AF0B 1QR7A 4JTTA 2VFFA 1W54A 1LM1A 3W86A 1JCLA 3TA6A 3PBVA 4UUIA 4UTMA 4LUJA 3NQFA 4DEFA 3TQKA 3NR0A 4TMBA 3I68A 4N4QA 3NQCA 4JYFA 3TK7A 2WNZA 3GKAA 1TRDA 2I1OA 1LRTA 4N9CA 2DZPA 1P5BA 3G1DA 3W2LA 3MWAA 1FCQA 5C54A 3GK0A 3UWQA 3Q37A 3S5NA 1FWRA 3BW3A 3W83A 1Q6LA 4O1BA 3P80A 3NG3A 1W37A 5K9XA 4XBKA 4UMBA 1KBIA 3KXQA 2J6XA 2FPYA 5D2WA 4O8RA 3W73A 1O95A 1V5XA 3O6CA 3W87A 1IXOA 1TB3A 4Q4KA 2ZTJA 4QJ1A 2AAMA 3NQ6A 5I3FA 4IGHA 5GVJA 3DGRA 1QO5A 1WOBA 2GVGA 3ZWSA 1F5ZA 2C14A 4RXFA 4NX0A 3W75A 5D05A 2J27A 1OYBA 2CLLA 3QPYA 1B57A 1UJPA 4WY0A 3LTYA 2Q8LA 4UTWC 2X1RA 4NX5A 2OX1A 2E77A 1VHNA 3TXZA 4ML9A 4DF0A 3C2FA 1OFBA 1ONRA 5E93A 4LVGA 1OFPA 1XUUA 2ZZ6A 4MLRA 3WK1A 5TQLA 5D38A 5J5RA 4QQ3A 3NM3A 2X16A 1NF7A 2Y7EA 3RFAA 3LCXA 4WZHA 1JCXA 4NJHA 4UR8A 4HNUA 3G24A 4NJGA 2QCEA 3OEXA 3W7EA 3FA5A 3LI1A 4OE7A 5F4SA 3FOKA 2QDHA 4S1FA 3TX9A 3CQ0A 1RZMA 2H90A 5D37A 1QWGA 1CW2A 5LNVA 4NJIA 1VC4A 3IIPA 2QCFA 5A5WA 4NXKA 1XM3A 5I3HA 4RK8A 4X2RA 1O5KA 5BNKA 1W31A 3PB2A 3WJSA 2B7OA 2NX3A 4FEZA 3WJZA 1ZJIA 2RFGA 3UPWA 1JR1A 2NX1A 2B7PA 4GE8A 3L66A 3KRUA 2QDGA 4FB7A 3I6RA 1QPNA 2VKZG 4LV4A 1VLWA 3I7RA 3FYOA 3A9IA 5C2XA 1QO2A 1T99A 3TDFA 2Y88A 2OT0A 4I9AA 3HGRA 4Z0SA 2NV1A 2Y70A 2CW6A 2IQTA 1TV5A 2CWNA 3TNOA 3GKFA 2QJHA 4NT0A 4O10A 3W88A 4O52A 1XL9A 2V5LA 1ZALA 5C55A 3NQDA 3NL2A 1V7YA 1A5SA 1D9EA 3QZEA 5AOUA 1H60A 4CQ8A 4LWWA 3BG3A 3G18A 1VYPX 1OX6A 3WFAA 2QCHA 3IVUA 4N9EA 1XCFA 3W7LA 3M5XA 1LDCA 3G1VA 4OBTA 1AL8A 3MW7A 1FBAA 4UTLA 1RVGA 4KWVA 1O4UA 4LT9A 2G5WA 4A2SA 3C56A 3E49A 5D2YA 4JIQA 3OVQA 5LNUA 3LCLA 2RKXA 5EY5A 4QM1A 3UNDA 5FF0A 3GR8A 3GX9A 3WJWA 2FB3A 4DO5A 3CB8A 1G69A 2NWRA 2RDUA 3LRMA 2RHGA 1IF2A 3O8AA 5G4WA 3N9RA 3TCEA 3QFEA 1TJPA 4PC8A 2A7NA 2VEIA 4UFHA 3C2RA 3STGA 1N7KA 2ISSA 3W23A 4JGDA 1B9BA 3H55A 4DBDA 2A1YA 3C6CA 1GVOA 2R8WA 1UUMA 1GVQA 3A5VA 4FNSA 3PS7A 4YLWA 2V8ZA 5CPLA 3O63A 5DXXA 3W7RA 4POCA 2OCZA 4DF1A 1H7WA 3HIJA 2VEPA 3QMRA 4IMDA 4OT7A 5EPDA 1OFDA 3SY5A 5G5IA 4N4PA 3TQ0A 3CIWA 2EF9A 4O57A 2WPBA 4AH7A 3LB0A 1GEQA 2EGZA 4QNEA 3TC6A 1ZCOA 2WSQA 3OVPA 4ZVJA 2TPSA 1C9DA 4IOTA 5AB3A 1OJXA 3LXBA 1XDMA 4C1LA 3EX6A 1KFEA 4JTJA 1KV5A 3FS2A 1TYGA 3G8RA 1YXYA 2AGKA 1BWKA 3M43A 1W5PA 1OX4B 1VPXA 2NX9A 2YW3A 1SQ7A 5EYWA 1IIGA 3JS3A 1FWSA 1FX6A 1VQTA 4CNPA 1OFRA 1PL9A 3PAJA 1YPIA 4MUZA 4XQ6A 5LGXA 2WKJA 3BV4A 1QCWA 1FDJA 1H7RA 2J24A 3LLFA 4CCEA 3P5YA 4GWEA 5HWJA 3PC0A 5E1QA 2Z6IA 2QJGA 3LM7A 4NZJA 3HG4A 4CCDA 1X1ZA 3WJXA 4IWWA 1XFBA 2ZDRA 2J9XA 3STEA 3QF0A 2QUUA 2Z1BA 2JKAA 1YYAA 2I14A 1SFJA 3LX9A 3TKFA 1NFBA 5FI8A 3O05A 1YDNA 1LOQA 1MZHA 1KM2A 2QKFA 4U4MA 1A53A 1G4TA 3CIXA 3P61A 4K6AA 4LS2A 3TAKA 4RZ6A 3Q2DA 4A3UA 3W74A 2YFOA 4LC6A 1O5XA 2ZTKA 2DU2A 1TCDA 2PURA 3EWWA 3QH2A 3R5EA 4E38A 4M6PA 4XUGA 3K30A 3FKKA 4N9BA 2ZRUA 4UR7A 1AK5A 2H6RA 1SW7A 3NEVA 2CZEA 4IXHA 3JR2A 1VCFA 2C13A 4JTFA 2FJKA 1VYSX 2E5BA 4GFSA 4ZQNA 2YGYA 4LRSA 1FXPA 4LNYA 5E0KA 1ME8A 1OHLA 4LVDA 3W1QA 3DENA 3W7PA 1M6JA 5DCEA 5F4WA 5AC7A 2J9YA 3SGZA 1F2JA 2WO5A 3TMQA 1AG1O 4ORIA 4ZQCA 3VNDA 4R33A 3G3DA 1XBZA 4XZ9A 2ALDA 3W7NA 1O94A 1LOSA 3ATZA 3BGGA 1TJRA 4IX2A 5EMUA 4HPJA 1A5BA 4FIRA 1XXXA 1M5WA 3B03A 4JY8A 1N55A 2A4AA 1I2RA 3G1XA 3NDOA 3NOEA 4L4LA 3E9AA 1M7OA 1TV8A 3EEGA 1K3UA 1CX9A 5IM51 3N2XA 2QAPA 4MPQA 1TPEA 1LTDA 3ABSA 4QITA 5DLCA 3U2OA 5DCDA 1F73A 4ADSA 2PCQA 3LRKA 1BKSA 1WAUA 1YTKA 4MJZA 4LU0A 4Y8FA 3OIXA 1VJIA 4AHQA 3M5VA 4AXKA 5AHFA 2WJZA 4XTDA 3S9YA 4NVTA 3NAVA 1R2TA 1N8FA 2YXGA 1TPDA 5FEPA 1G6CA 3DFQA 1G7VA 2JBMA 4JICA 5FF3A 4OV9A 1JCNA 2VC6A 5F4XA 1KM1A 3N3MA 4C1KA 2CLEA 3CPRA 3MI6A 5CPOA 1G67A 1KBJA 1KFCA 4ZQRA 4P2VA 5AC8A 3G0XA 4NJKA 3LCWA 1WOAA 3W72A 4JTSA 5KTLA 1OFAA 1GYNA 3PULA 1KTBA 5CZ0A 3EWXA 1MEWA 3HPSA 1W0MA 2E6FA 3HJZA 1VYRA 1H7PA 2WNQA 3L5AA 3TROA 5D03A 1FUYA 3W85A 2CLIA 4CNOA 4TU1A 1K8YA 2ZBTA 2HS8A 5HUOA 3R12A 2Y89A 1KV8A 5KSWA 3GDLA 4RXGA 1R46A 1QPOA 4UNLA 2ZRXA 3IIXA 2V0TA 3P81A 3HO8A 1SUXA 1I2PA 4MIMA 1JVNA 4GC4A 2W0UA 3QQ0A 2DZVA 2CLOA 2R91A 3L0GA 3M7WA 1D3GA 1JRBA 4WOZA 5LNWA 3MI3A 1S5TA 4S2BA 1W3NA 3IIZA 4IMFA 4EF9A 1Q6RA 3SFKA 2Z2UA 4UFJA 2C3ZA 3QW4B 4ZQPA 3TR2A 2CLFA 3W7GA 5I3JA 1NAL1 2E68A 4K8EA 1RR2A 3ABRA 4O54A 1ICQA 2BXVA 4W9TA 3N9SA 2GQ8A 4IUOA 5K3VA 3TE9A 4FX7A 1KLZA 3F1QA 4M7TA 4X9SA 4DPPA 5K4XA 4HHPA 5FEWA 3KVKA 4GUJA 1TSIA 3QPZA 1OK4A 1LRNA 4NNCA 3HG5A 1YTEA 3C2VA 4I7WA 1VZWA 3W1NA 3W70A 5H2ZA 1KM0A 2WSYA 2C1HA 3OHIA 4JX6A 1SO6A 3W2KA 5F2IA 1FQ0A 3KOFA 4LVAA 5DN1A 2X30A 3NQ2A 4MYXA 4YCPA 3L67A 1JULA 3M5YA 4ADUA 2QUVA 3G1YA 4AHPA 2V30A 2Z0IA 3S42A 1VCGA 4DO6A 3EB2A 4PTNA 4AMAA 1H1YA 3SGUA 3DBPA 3WJYA 3VKJA 1GPWA 2R94A 3R13A 3L5MA 4M6VA 1AL7A 2BTMA 5CZSA 4RR4A 1SZFA 2FFCA 3NPVA 1YPFA 2VXNA 5EBUA 5CG7A 3LV6A 1XC4A 3MI2A 2RDWA 2Y7DA 5HWNA 5FF4A 5U7SA 4CCCA 2V82A 4BI7A 4WY0F 3M0ZA 4KFPA 3DH7A 4K8HA 5KINA 3B04A 2PRHA 1GZGA 5HINA 2TMDA 3M6YA 4RX0A 1K7FA 3W1RA 1FDYA 2ABAA 4JXCA 1W3IA 4JD4A 4N2YA 1HL2A 4YWIA 1JUBA 1WX0A 4NNBA 3NGJA 5DY2A 1JCYA 4Y96A 1XUZA 4GNJA 4JN6A 2QCGA 1GTHA 4K37A 1GVSA 1EP2A 3RMJA 1XDLA 3W1PA 4FNRA 1W56A 3UWVA 1TTQA 4ONVA 1VS1A 2HS6A 1ML1A 4E2DA 5C5YA 4UFLA 3UXDA 3NZRA 4JDYA 3IIVA 3QQ1A 1DBTA 3NQAA 1X7FA 3S6DA 1OYAA 4HKPA 1L2UA 4HPXA 3QJAA 1W5OA 1IGSA 1LLWA 3EXRA 3BG9A 3O6DA 1TTPA 2PRMA 2QR6A 2WSRA 4IMCA 1C8VA 4MY1A 1MSSA 2A6LA 3S5YA 1JUKA 4P61A 2YW4A 3IGUA 1JJKA 1GOXA 2E1DA 1KM4A 4K39A 5AHIA 3KVMA 3JRKA 4NQ1A 1TTIA 5F2GA 3B0UX 4WY0B 1NSJA 2X1TA 1KFJA 3CM4A 1TPH1 3EWBX 3UY8A 3CWOX 1DORA 1HTIA 2DP3A 1KLYA 2QCLA 2A85A 2VFDA 1ZNNA 4FF7A 4O1CA 1TPVA 4Z08A 1H7XA 3W1UA 5AYXA 3OA3A 1VHCA 1RD5A 1WDWA 3HG3A 5AFDA 1ZAJA 4HN4A 3DFOA 2ZRVA 3GXNA 5I3KA 3NL6A 3NZ1A 1S5VA 3AO0A 1FXQA 3C61A 4LUIA 3R89A 2F84A 4RCXA 3S8HA 1QPQA 1OVDA 4KKXA 1LP6A 3TIMA 4IMEA 3LTPA 3A22A 2WV8A 1DV7A 5HQEA 2YYTA 2ZZ4A 3OG3A 4UFMA 2ZRZA 4E0CA 1PHWA 3ABOA 4LVFA 2YFNA 3BLEA 3W7IA 3L68A 3A5FA 4BI5A 3STFA 1EEPA 1SZEA 5LZLA 3TW7A 3TUUA 1K7EA 1RQBA 5G1YA 3NQMA 3L5LA 2JGQA 5AHEA 4O13A 3W2UA 2EKCA 2PE4A 5DBTA 3C3NA 4AVFA 2X1SA 4WUIA 3WK3A 3NQGA 5BMXA 5AHNA 1Q6QA 3ZFHA 3H54A 1OG0A 8TIMA 1K02A 4JYDA 4MY8A 1PVNA 1YDVA 3OBKA 3LCFA 4AAJA 3FLUA 3KVLA 2E5DA 1G4SA 4YL2A 3D0CA 3GNDA 2FQIA 2E6AA 2B0MA 1DJQA 6ALDA 2BWGA 3PG9A 1OABA 1GG0A 2PRLA 1K8ZA 2C6QA 4JTIA 1H7OA 3I7QA 1QPRA 3W84A 3F4WA 5AYYA 3B0VC 3TMLA 3G3MA 2XN0A 3S5OA 1A5CA 1Q45A 1SO4A 4O16A 4MZ1A 1TPWA 5AHLA 3I65A 2XN1A 1VRDA 3LHVA 1Q3NA 3C8FA 2G97A 1DQWA 5HR7A 1SU5A 2G96A 3I7SA 2CZDA 6TIMA 3MYOA 2A0NA 5K9DA 1SPQA 2Q3RA 5ABTA 4O18A 3T4CA 3LI0A 4UTIA 1KM6A 3M1ZA 3GAYA 5CSRA 3EWZA 3UWZA 2FB2A 4JS3A 5CPMA 2YZRA 2EHHA 4XWUA 3ZWTA 4FIQA 3VE7A 4DQWA 3T55A 2QCDA 2A5HA 3HGOA 3SZ8A 4EVZA 4PODA 3NYZA 1WQ5A 3ABQA 2GJLA 3E02A 1ADOA 4A22A 4QISA 3TSDA 3S1XA 1DQXA 4HSOA 2EAWA 1LBMA 3NQVA 2FDSA 4CQ9A 3E12A 3P8JA 1H1ZA 2ZA3A 3NA8A 1I4NA 2Y63A 5L6UA 1R2RA 2NWSA 4IJBA 3UWYA 2AQWA 2VFHA 3SIZA 3DAQA 1EP1A 4ZMGA 3TJLA 1XBVA 1P0KA 2C19A 1YXDA 4AWUA 2ZCGA 4TMCA 3F03K 5G4EA 4GUFA 3A21A 5KMYA
chains in the Genus database with same CATH superfamily
1JF6A 2DSWA 2CC0A 4Z42C 2FTYA 5AYZA 3VKKA 1WNOA 2VGBA 3Q4DA 2ZUMA 2CYGA 4DAIA 2CHRA 1VBJA 3DFNA 4F2UA 1JF5A 3QVQA 3W0KA 4S38A 5F1VA 1R85A 1H51A 4TTUA 4MAVA 5C2GA 3TH6A 4H00A 4FXSA 4Q33A 3AMDA 4WSHA 3CHFA 3BAYA 1E9IA 2Y6ZA 5KZMA 5SWUA 4AZCB 1M53A 3N4FA 3EX3A 4DO7A 2PODA 1NDVA 4WJXA 3S1WA 5CKSA 3V5CA 3A64A 4BFAA 3HQOA 3WF0A 2J62A 1ZP3A 3T0AA 1O1HA 3CAQA 4NZFA 3URNA 4DYKA 1K70A 5H91A 5FF7A 2VX5A 4AISA 4UBPC 1JCJA 3W1XA 4UZUA 1JFXA 5JBDA 4ICMA 4YTRA 3O6YX 1KKOA 2JK2A 4WF7A 2XIBA 5D32A 3ES7A 4L4PA 4C6NA 4HQVA 3HG2A 2I5GA 4IFOA 3FIGA 1KGUA 2PWGA 1CCWB 1JI1A 2PZNA 2ZQ0A 8A3HA 3DESA 1V0NA 3PB0A 3QHNA 4M7SA 1I6NA 1W3LA 3ONBA 4C90A 5AKQA 1RK5A 2DJLA 5D9OA 1Q6CA 3WZ0E 4F66A 4BF9A 4GXMA 5JUVA 4ZL1A 1LF1A 2O9OA 4AZ5A 1MXDA 3IGHX 1BTCA 2QXWA 1T96A 2W91A 2X0SA 4Y9PA 3IAPA 3O1NA 4QAIA 2FZMA 2X2GA 2VQUA 2RJGA 5CPNA 1NFGA 3MVIA 4N6FA 4IFKA 3VOCA 1B1YA 2A3CA 3WQ5A 2D24A 1SZNA 5I2UA 2H8XA 3MDUA 3NPUA 1VFHA 2GGEA 4PB5A 4PULA 5FEZA 4U28A 3EWYA 3ITLA 2VDGA 2NLIA 1TVLA 2RH9A 3KTXA 1QNQA 3AHXA 3E0LA 1UKSA 2X8RA 4QNWA 1LZOA 3P7YA 2CBJA 3BG5A 4PTXA 3SUVA 3NL3A 1VAHA 5DCBA 3VIJA 5KZEA 4C5ZA 3AMCA 1UPMB 3BLOA 4C7DA 3WQPA 1RPXA 1KCXA 2R24A 3LHWA 2OWCA 2GOUA 1G9HA 4ZSTA 3PWAA 4K38A 1J8VA 1AMKA 2CKSA 2TSYA 3QR1A 1JQXA 3M0YA 2FDMA 1UR1A 4H6QA 3PP7A 1UP0A 4Z1AA 4K2SA 1OCNA 3CHCA 3MJYA 2HCVA 3MHFA 4H3DA 1EA0A 2DVTA 3RLVA 4D6JA 4JKKA 1VFUA 4WKHA 4L1GA 2EPNA 1FWWA 1ECQA 3WBEA 4LANA 2PA6A 3LCHA 4W8AA 2ESCA 1KC7A 3U3HA 4FNUA 1PTAA 2CLMA 4WXYA 1H49A 5FOOA 1WDPA 2CESA 3QSTA 3T0DA 1FDZA 4AEFA 1LROA 2I5IA 1JAKA 1TPFA 3S9ZA 4AF0A 1OBAA 3APTA 3OP2A 3D3AA 2V63A 3N13A 1KM5A 3AUOA 3LXAA 3T0BA 3WBWA 3ELFA 1MW0A 3UETA 4OHQA 1YLVA 4KMQA 3ZZ1A 4UFIA 1A49A 1TV7A 1R2SA 4OU1A 1FCBA 1JD9A 3GUGA 3WQGA 3F2CA 5EL1A 1UZ4A 2C91A 1M1BA 3QLLA 2XSBA 1UR8A 1BYBA 3BSMA 1VGAA 3ERPA 2V69A 3LS9A 4OWGA 3WUEA 3IUHA 3LLXA 2ZVIA 1DHPA 3LCGA 1ITXA 1NWUA 3DYMA 4NNAA 1RBOB 3E38A 3P93A 2TYSA 3GXPA 1W1YA 1SW3A 5DQPA 1EJWC 3HGSA 1WUFA 3VYLA 1ZAHA 1S2WA 1AZ1A 4RE2A 5A2CA 1G4EA 4DYEA 1V77A 1EQPA 5A2AA 2ZC1A 3GVGA 4TXEA 2FGZA 4KPLA 3MWCA 3V0SA 3FVMA 4LOCA 3R11A 4RKAA 2X09A 2ZC8A 5A8OA 3GG1A 1TIMA 4CLMA 2WCGA 3W7QA 4GO9A 3QYQA 3FY1A 1X97A 3GC5A 4WX2A 3ITTA 1TWWA 4AIEA 3DFYA 4JTUA 5C9UA 4KEVA 3AHYA 2O7QA 4OFCA 3S6OA 5LKYA 3PM6A 2NVDA 3LERA 1DWGM 5LGZA 3GDKA 4ZXOA 4G9PA 3UA4A 2VGIA 3O16A 3NPXA 1DL3A 4BR1A 4N02A 4GISA 3MSRA 3R94A 4U2ZA 4RV8A 1M3UA 2CXGA 1UYQA 1E0TA 3IWPA 4KFNA 1XF0A 1A3HA 4UOZA 2UV8G 4M19A 5D2VA 5C0QA 3WSUA 1XIMA 3QZAA 3BLKA 3HF3A 3LGGA 3S2LA 1ALDA 5EMJA 1WZKA 3G22A 5B7YA 4XVEA 1LCOA 2V5DA 2QAFA 4GI6A 1W9VA 5L9FA 3W7CA 2PWDA 4QG9A 3E2RA 3CB3A 3IGXA 3V75A 4L4MA 3R79A 1BEUA 2QEZA 3ARYA 1U83A 4B16A 3MB9A 2HJPA 4Y9OA 1ZBVA 1DIKA 3P0WA 3KEHA 2ISVA 3HOJA 1UMLA 1EIXA 4HNLA 3MC5A 2HPMA 3SW6A 3UW6A 3B0YA 3EX4A 4JNYA 1RH9A 2C1GA 4ZODA 3M44A 4PUJA 5XIMA 2BMBA 1TRIA 3MZNA 1X6UA 2FGBA 2W6RA 3T44A 1O5RA 2FPVA 3PR2A 3S1UA 3CHVA 4HNVA 1O60A 3MUXA 3M0JA 2RGMA 4D6CA 1UWSA 4ZOAA 1UJQA 1B3WA 3NGFA 1TPUA 4CU7A 4YNGA 1SYTA 2W79A 3ZJKA 4PR4A 3PVFA 2GUBA 1J6OA 4XIAA 4HIBA 3MDWA 1MDRA 5BW6A 1E6ZA 2AMGA 3HPAA 1UR0A 3FKRA 2CCRA 3CWHA 2WJDA 4PMOA 2HXUA 3EWCA 1F05A 3BQ6A 1GCYA 3ICJA 1TTJA 2V81A 1ZY9A 2A3HA 2QHAA 1Q2RA 1V6XA 3B8VA 2R9RA 4JQAA 1T40A 1SJCA 4H9VA 4CQAA 1J2WA 1MRAA 3AMLA 4IICA 2G4JA 4LAKA 1OX4A 3VFLA 1GEHA 5HDRA 3JZEA 3AIVA 3VNIA 3LLDA 3O9NA 3KL0A 3W1MA 4GYJA 1FH9A 5DBUA 1R0MA 4J3XA 4GIAA 3KZSA 3HGJA 3W07A 4PFHA 1FWDC 4FLRA 1ODZA 4LJ3A 3UWWA 1LBFA 3I10A 1GQIA 4O1AA 5KITA 2EEXA 2EKGA 2QCDB 3P5ZA 4GRSA 1HUVA 3C52A 2I9EA 5BRBA 2QUTA 4JL1A 3QW3A 1NF0A 4FPSA 3NIYA 3WBXA 1TMQA 4LYQA 4HNNA 4JTEA 2WZIA 4XG1A 1EC8A 5E9XA 2J75A 5GNXA 4QSHA 1OIFA 1XLHA 4DXVA 1J12A 3TNBA 1R30A 4MB4A 3VI2A 3CH0A 1ICPA 5I3IA 3WLIA 3W7HA 1EB3A 4CNUA 1BQGA 3M0IA 1UPPA 4GIRA 3WNOA 3TN3A 5FJPA 1I8JA 4YWSA 2HE5A 2GPTA 4PUDA 2OOGA 3CMFA 1Y5VA 3R8HA 3SY1A 4F3HA 1P1MA 1D7FA 3POHA 1TR1A 1B2YA 3NPWA 4TVUA 2C79A 4FLSA 4N42A 5C2CA 4GK8A 4O1DA 1EJUC 4M1RA 3WEOA 3N73A 3UCDA 1J96A 3CNYA 3N29A 4XKYB 4RDYA 3ALFA 4E2VA 3VXGA 1TREA 4GYKA 5BRQA 2WQDA 4Y9MA 2FZNA 1KW1A 2INEA 4MNKA 2GJNA 3NO1A 3ARWA 2F7FA 5I00A 3MU7A 1E1FA 3B40A 1KRBC 3ARZA 1QDSA 5HJLA 3AZSA 4AB4A 5D2XA 1B0IA 4N7QA 3G1FA 1QI5A 1IYXA 1GK8A 3JZUA 4HZ6A 1NTHA 3HV8A 5T8GA 1PCWA 2CITA 3K13A 2D0HA 1OC5A 1JRCA 1ME9A 2CZVA 4Y9AA 2FIQA 3G1HA 3KHDA 2Z4GA 3FAXA 3H2EA 3RLHA 3L0NA 3UZ5A 1LL4A 2ALRA 1XFCA 3GLCA 3F5LA 5HK4A 3CYJA 1OF8A 3RU6A 1RQHA 3PJUA 2QZRA 4B5SA 1YADA 2XH0A 4DF2A 4XZWA 1XSJA 1JQVA 3M9YA 3QYSA 3N14A 2DSKA 2VENA 1AW2A 3DI1A 4KCUA 5CAHA 3B4YA 4AY1A 1PKYA 5CJNA 1EDQA 3ZVIA 2DVUA 4C5YA 1V3MA 3SJ3A 2NSXA 2VRJA 1PEZA 4AZ7A 4LNCA 1PS9A 3N2MA 5LNRA 1GNXA 4R5EA 2P0IA 5LSMA 1FVPA 4L9YA 2C0AA 4LH8A 4IIFA 4JIIX 7ENLA 2PWFA 1XLFA 5BXPA 1VJZA 1W8GA 4PUWA 4W87A 5FJRA 1VCVA 3KOWA 2CZ5A 4BZYA 3BZJA 4JCMA 4MPKA 2VELA 2L5HA 4IGMA 4JHMA 1NP2A 1OM0A 4W86A 5CZKA 4UTTC 5EFFA 1PIFA 5BYWA 3G0UA 2YBUA 1K8XA 1UHVA 1Q7QA 1POJA 2Z27A 2XM1A 3GHRA 3QN3A 1PB0A 5AYBA 1JPIA 1L0PA 4IX0A 1UC5A 1KXQA 4YYCA 4WKAA 1J79A 5FIPA 4B3LA 1IZCA 1EJXC 1W3TA 1VENA 2HRWA 3EMZA 1PIIA 3MKVA 4AW7A 5K2ZA 5FJTA 2RDXA 2F38A 3VKDA 1Q6OA 1YBQB 1QPKA 3DHFA 3AXIA 1RALA 4OIFA 2WVVB 4GJJA 2F61A 4GKLA 4INFA 3RN6A 3U8GA 3VX1A 4BI6A 1XIBA 3WBYA 1EOMA 3M5ZA 3NQEA 4FNPA 3EWUA 2XVNA 2J88A 4FAMA 4NYYA 4OUIA 4FS9A 2VFFA 5EMMA 4M3PA 3WLJA 2BXZA 3W86A 1JCLA 2VC9A 2FJUB 4R7WA 5A6MA 2C71A 1OD8A 2ZXBA 3NQFA 4MM1A 3NR0A 1HKIA 3O0KA 3I68A 4N4QA 3BV7A 4JYFA 2FZBA 4DWSB 3TK7A 2I1OA 1P6BA 3CV7A 3W2LA 2PDNA 4PUEA 1FCQA 3FJNA 3A4AA 1EYWA 1Q6LA 2PDJA 4Q4SA 3H6OA 1TWIA 2OKTA 4FLQA 1FRBA 1NOUA 1O95A 1V5XA 3W87A 3WLNA 4Q4KA 4QJ1A 2E3ZA 4L1XA 2VEFA 3T07A 5GVJA 3ARXA 1GVIA 1QO5A 4CQCA 2C14A 4NY2A 2PU0A 4S3EA 3W75A 1BVWA 2W67A 2J27A 3WD0A 4N0RA 1XINA 4NX5A 4CD8A 4PTWA 2PPGA 4ML9A 5CJ5A 3TEVA 2FTWA 1OFBA 3C2FA 1XUUA 2PF0A 2BY2A 1IV8A 4GXPA 4GY1A 3NM3A 1R3VA 1NF7A 4A05A 1VB9A 3QTPA 2CERA 3I4EA 3LCXA 4WZHA 4NJHA 4Q6JA 1ZBKA 3G24A 4NJGA 1Q5MA 1W9DM 2YDRA 3OEXA 4D1JA 4OE7A 1VBHA 1W9PA 3PK7A 3TX9A 1RZMA 3DG7A 4AD0A 2O92A 4X2PA 2GLKA 4B2DD 1PDYA 1CW2A 5LNVA 2W63A 3IIPA 2QCFA 2VMFA 2MUCA 3GXFA 1U30A 3VINA 2NX3A 1JDEA 4GVIA 2PGFA 4NAEA 2WC7A 1DHKA 4Y8EA 4CD4A 2GK1B 4UQEA 1XV8A 2VKZG 1QO2A 4XSLA 2OT0A 4I9AA 3HGRA 2CW6A 2IQTA 4JKMA 1V08A 3OOQA 3LY0A 4REQA 1UQZA 3W88A 4F0LA 1WKFA 3EYPA 5C55A 1HJXA 1V7YA 1GOQA 1KRAC 1H60A 1CGUA 4CQ8A 3AU2A 3VMNA 4ZB2A 1VYPX 1OX6A 3ZT7A 3SGGA 4UQ9A 3IVUA 4N9EA 1LDCA 1LT8A 3GFZA 3H2CA 2KX9A 4X63A 2QT3A 1PYFA 1G0CA 3IV8A 4AD3A 4XSMA 2ISDA 2RKXA 5EY5A 1J10A 3GR8A 1YHTA 2DUZA 4HJFA 4PUUA 4BY3A 3D46A 3LRMA 2RHGA 3SIMA 5G4WA 3RJXA 1TJPA 4PC8A 4A8LA 1UD3A 5E0CA 3C2RA 3NEHA 2GUYA 2V3DA 2ISSA 4XO7A 3W23A 4JGDA 2QPSA 1B9BA 1QUMA 5GNYA 3C6CA 1AMYA 4MNLA 1IR1A 3HZ3A 3O63A 4JN8A 3W7RA 4E4FA 3K4WA 4Q6XA 1DWFM 1H7WA 4BF5A 3FYYA 1IE7C 1LUCA 1DTUA 4IMDA 1TUFA 2VZSA 1DJHA 5G5IA 1N8WA 2EF9A 3EPNA 4AH7A 4AZHA 3LB0A 1GEQA 2G50A 4QNEA 3TC6A 1IT7A 1UWUA 1FWJC 2TPSA 1C9DA 4IOTA 5I06A 5AB3A 3EBVA 3URQA 1CBGA 1XDMA 3GXIA 1M65A 4JTJA 1TYGA 3G8RA 6REQB 2JE8A 2E1WA 3GD6A 1W5PA 4YU1A 2C1IA 5BOFA 3O3RA 5A8PA 3N2OA 4JFSA 2EJ1A 5EYWA 3JS3A 3CTTA 1OFRA 1PL9A 4XQ6A 2WKJA 4IJRA 1FDJA 4F40A 2WXDM 1B3VA 5HWJA 3OLDA 3DBNA 3GVWA 5E1QA 3SN4A 1JPKA 3LM7A 1QHPA 1CGTA 4EXBA 1K4HA 3S2CA 2ZDRA 2J9XA 3STEA 3LX9A 3TKFA 1YDNA 2E67A 4CNTA 1EHNA 2GQ3A 3P61A 3TAKA 2HVNA 2WM0A 4AZCA 3W74A 2YFOA 1UD8A 1UWAA 4JHOA 4A6GA 4PCSA 1MWOA 1S38A 4E38A 4M6PA 4CD7A 3GTXA 4LUYA 2D2HA 3NEVA 1XQLA 2CZEA 1A5LC 3CPUA 2R6OA 2C13A 4LF1A 2FJKA 4D9PA 1GYMA 1X6NA 2O9RA 2Y8KA 4GFSA 4H9YA 4P5UA 2X1IA 2I17A 1GQLA 4LRSA 4E5TA 3VOFA 3W6MA 4JQ1A 2FGLA 4DUVA 3TMQA 4I9JA 4M0XA 3NYDA 1PUDA 4ZQCA 3VNDA 2FZ9A 4MWAB 3IUIA 4DM1A 4JIHA 1KQZA 4XZ9A 3CV2A 3ATZA 1LOSA 2RUSA 3BGGA 1NOFA 1A5BA 5ABGA 4H8VA 1A5NC 3ANVA 3PPCA 4KETA 3SCTA 4JY8A 1N55A 2A4AA 2POTA 4US6A 1I2RA 5LA0A 4L4LA 2F8QA 4ATDA 3EEGA 1CX9A 3N2XA 4CGTA 3UJRA 1V6UA 1TPEA 4QITA 1BGGA 1NU5A 4CNSA 5TF0A 1V93A 1S2UA 1F73A 2WLYA 4LAMA 4CEUC 3OGRA 4LU0A 4JTAA 2KAUC 3BE7A 2WJZA 4IJCA 1JPHA 3B0XA 4XTDA 5CC7A 3S9YA 4XD5A 4E4PA 3B3DA 1L2QA 3GTNA 4OJYA 2XZ7A 1EZ2A 1G6CA 3RX2A 2FYMA 4XAPA 1ZQ5A 4JICA 3WQ6A 4S3DA 4UCFA 1JCNA 2VC6A 1WKYA 3N3MA 3MI6A 5CPOA 1ONXA 4V1YA 1NFPA 1NH6A 3EB4A 3OIHA 1FHLA 3LZ5A 1TE1A 4BF7A 1OFAA 3K8KA 3PULA 1CXFA 2Z1SA 1E72M 5AC5A 1PX3A 1UD6A 1YDYA 3L23A 1NDYA 4P8WA 1IZKA 4KEZA 1W0MA 1S46A 3BGAA 2XTKA 4XV0A 1FUYA 2CLIA 4AUBA 5A6BA 1AJ2A 1KV8A 4R9OA 1QASA 4PBFA 1GORA 5KSWA 1B3ZA 1R9YA 4M82A 2VDIA 3LMYA 3O7UA 2GDQA 4BEUA 4AVNA 4GCXA 3DGBA 2VURA 3R1ZA 3IIXA 2E4TA 2R1KA 4C6OA 1O1ZA 4MIMA 5CLWA 1O66A 3QQ0A 1FWCC 2CLOA 1EJTC 3L0GA 1K9TA 1DWIM 5BWAA 3WN6A 1KXHA 4MSSA 1W3NA 2HBVA 3IIZA 4ZR8A 4PTVA 3BQ5A 3CUHA 1PZ0A 3DHUA 3W7GA 3BSGA 3RHGA 3VX0A 1XGZA 4QDPA 1RCOB 3FSUA 2GQ8A 3TE9A 3T8LA 3GG7A 1QI4A 3CUGA 3KDOA 1NP0A 3GW3A 5FAJA 2WMIB 4HHPA 2XZ9A 4L6OA 3SUUA 1TSIA 5M1TA 5HPCA 2INFA 2WHLA 3MV11 2OZ8A 2R1LA 3HG5A 1YTEA 5I6SA 4KRTA 4R27A 2WSYA 3OHIA 4H9MA 3VGGA 4YCPA 3K1GA 3W6LA 3M5YA 4ADUA 3WX7A 4ZE4A 3VNZA 1JL8A 3S42A 2P50A 2WVTA 4PTNA 5I77A 3H24A 1H1YA 3VKJA 4DZ5A 2F6UA 3TYCA 4LYKA 2OR2A 1UP2A 2BTMA 5CZSA 4PMZA 8RUCA 2OZ3A 2P88A 3NPVA 3WQEA 3UCCA 7CGTA 3WKZA 3LV6A 5HJXA 3MI2A 1OADA 2G3JA 2XVPA 2YA0A 1ZGDA 3VU2A 4GACA 4BI7A 3PPGA 5C8BB 4HA0A 4DJDC 4RDWA 3T2QA 2HBXA 4TX6A 5HINA 2OQYA 4RX0A 1K7FA 2QUMA 4IFRA 4JAWA 1FDYA 3L4ZA 4QX4A 1W3IA 3A3WA 1B9ZA 2D1ZA 3LQLA 4N2YA 4QQUA 4GBDA 1WX0A 2BASA 5J8LA 2UY4A 1XUZA 4GNJA 4JN6A 3CIVA 1E56A 1MNZA 1XRSA 3RM4A 1EP2A 2XWDA 3W29A 5H8MA 4L9ZA 4UFLA 4HOXA 5E0FA 2CLPA 3IIVA 3QQ1A 4C6EA 1X7FA 3S6DA 3BSHA 1OYAA 2VCCA 3QJAA 2YBVA 1IGSA 2WVSA 1TTPA 1OT1A 3PPFA 5AY7A 1QATA 2A6LA 3S5YA 3EZ4A 2W92A 3K46A 2GGJA 4KS0A 4FALA 2YW4A 2VWTA 3CMGA 3IK4A 4GYFA 1JJKA 3IANA 2AL1A 2PDPA 5I09A 3QY8A 2WHMA 3CL8A 2XUCA 3H21A 1GVYA 5IXEA 1O68A 1SJDA 2JF6A 1L6FA 3VMOA 3EWBX 4NP7A 2BGNE 3LQGA 2V67A 3ISIX 2QCLA 4FF7A 1S2VA 4Z08A 5M17A 1T8QA 1VHCA 4AYGA 3RCYA 1ZAJA 1LWJA 1IEQA 4J5NA 3GXNA 4Q8OA 4E3TA 3AU6A 3M0MA 2XFYA 5DANA 4C6LA 3BJSA 2ADAA 5B80A 1VFFA 4XVDA 4WDXA 1HW6A 3CO4A 4RCXA 3FX4A 5ABFB 3SSZA 3TIMA 1R6WA 2G3MA 3BMVA 2WV8A 5HQEA 1RLCL 3ORWA 3VMPA 1FH8A 2AL2B 2ZRZA 2OLAA 3G5EA 4FK9A 2YFNA 4YS1A 3WQOA 2IKGA 1QI2A 4Q8QA 4IZGA 1XYZA 5A6BD 4BI5A 3DERA 4RW5A 1TCMA 4QAWA 5AHEA 4X0VA 3WK3A 1QBAA 3TA9A 3MUY1 5BMXA 1Q6QA 3ZFHA 8TIMA 1PAMA 2PBOA 3OBKA 4XZIA 4C91A 3FLUA 3U4FA 2PDQA 4UWMA 1DXEA 3B8UA 3R43A 1DJQA 4NAFB 1UA3A 2X41A 1OABA 1QT1A 1HNYA 2PRLA 2MNRA 2C6QA 5LIKX 4KT2A 4D8LA 2BHUA 4CUCA 1QVBA 1BXCA 4I8YA 3F4WA 5FJJA 1M01A 3A47A 2XN0A 1CPUA 1A5CA 4B4FA 4PCPA 3S2NA 1EYEA 5AHLA 3I65A 3UU0A 2G97A 4HA3A 1JDDA 3RPMA 3N1AA 2G96A 1HJQA 6TIMA 9XIMA 3RLGA 5MKGB 2ZX8A 4O18A 3T4CA 4UTIA 4IPNB 4KIEA 2OFJA 3ZXWA 1A5OC 9CGTA 1F07A 4XWUA 1CLVA 2PI6A 1BAGA 3E3HA 2QCDA 2A5HA 4NRRA 3SZ8A 3NYZA 2HWGA 2BDQA 3N17A 3TOPA 2CPUA 4FZIA 3GO2A 4GCAA 4H7VA 1GHSA 4CQ9A 3P8JA 4HPNA 3NA8A 2Y63A 3A9BA 3AUJA 1VP5A 3BDKA 2AQWA 3PZ9A 4WDWA 3SIZA 3WH8A 2G41A 1EP1A 3TJLA 8CGTA 1EC7A 1XBVA 2DW7A 3UZJA 3NVTA 1YXCA 3E96A 2EPLX 3CTLA 2X42A 1XRTA 4NZ3A 5JH2A 4QE4A 4ALDA 4M80A 1BWLA 1RPKA 5T91A 4UQAA 4LBRA 4NRSA 4QCEA 3QHMA 5BMWA 3VIIA 3SN1A 4HYRA 4XKYA 1F8IA 1UWRA 4EK7A 1PPIA 4YTTA 4IL0A 4O50A 4F9DA 5FESA 3FEQA 2QVHA 1RD6A 3N2TA 1R9XA 3SSJA 3AJ7A 3UXKA 1UR4A 1CXIA 3C5QA 2TAAA 3QKEA 3U2ZA 4MJMA 4D2JA 2QNEA 2FHBA 4DO4A 3IJ8A 3MYPA 4AEOA 1UR9A 1H5VA 5HANA 2GSJA 3CS2A 2WHJA 1S1PA 4ASTA 2X0YA 3SR7A 4IIEA 5DRIA 4PUMA 3FN9A 1SFTA 4I5RA 1TG7A 1MXSA 3T81A 5T26A 4O4VA 5CZTA 4AWSA 4ZQMA 1SO3A 3LXCA 4O4WA 4Z2LA 3EX2A 3QV7A 3HPFA 1PCKA 4MFEA 3KL5A 1J0KA 1QMLA 3O0FA 1M7XA 1M7PA 3DC0A 1KGXA 3DC8A 1RBAA 3PF3A 4UMCA 3AROA 4D6HA 4IPPA 1XX1A 2A3EA 3DIPA 3RILA 4QHRA 4U3CA 3GW0A 4EXAA 4QS5A 4BJHA 2ZZ2A 2ZXAA 2KZHA 2NUYA 3E0WA 1OYCA 3CU2A 4DY1A 5AC6A 2YR1A 3IJ9A 3TYAA 4NU7A 2DVXA 2WJEA 4LALA 4A29A 3W76A 2RDTA 4NI3A 3BJTA 1DE6A 3GHTA 1L6GA 1KNWA 5LA2A 4CQBA 1XIFA 3P6LA 4NJJA 2JQXA 5HR6A 3F7JA 1WO2A 2E28A 3CV1A 1FWEC 4ERAA 1E1CB 4PZVA 1GUVA 3MMWA 4LRTA 2V2CA 3F4NA 2Q09A 4HMCA 1QAPA 3B9OA 4S3KA 3WIJA 1OEPA 5D9PA 3W37A 4EE9A 3N6QA 4MZYA 3DI0A 4J9JA 1AH4A 4QEEA 4S23A 1PBGA 2TRSA 4DWSC 3YPIA 1YBQA 2JKPA 1JZ7A 1IIHA 2NT0A 1TX0A 1C8YA 1US3A 4GX8A 4HT3A 1PTDA 2PB1A 2QF7A 5GJNA 2WVVA 3R4IA 3BOFA 4ZTYA 1EBHA 2Z24A 2CEQA 2GL5A 2WLZA 4PMXA 4UQDA 4O0ZA 4EAYA 3P8IA 2PS2A 3ITXA 1JDAA 4G6CA 2E6DA 2OODA 1A47A 2V5BA 4R53A 2WBKA 1CXLA 1FOBA 3B06A 1GVRA 4ZO8A 2ZKMX 1W2PA 3TW9A 2ZZ1A 4HK5A 1F6PA 1X98A 3TTSA 3M0XA 1JZ6A 2WJFA 1OFEA 1B30A 4PMNA 1BQCA 3QM3A 1UKTA 3DOPA 1WKEA 4I6KA 3GH4A 4DWSA 1OGGA 4L6HA 3TTEA 2Z7GA 3N4EA 2X40A 1NEYA 4E2BA 1J5TA 3AC0A 4JY9A 5D02A 1TA3B 3USBA 1JFHA 2EG8A 3OG2A 3WL0A 3L4VA 2J7BA 5CCZA 5IFPA 4FXRA 3KM8A 3LTSA 4EANA 2YCEA 4O14A 1RK6A 1IEVA 3FJLA 5K7JA 2QV4A 1LBLA 3PJXA 4WXZA 1KFKA 2ATSA 3OLIA 5KEZA 4GUGA 4KWSA 3MSDA 3UWUA 3P3BA 4N9DA 4YTUA 3LHYA 3T05A 2VGGA 3W2MA 5U4NA 1V03A 1XH0A 1D7KA 3ANYA 1CI1A 3QKZA 3BCFA 3W01A 2XFWA 2BY1A 4UNIA 1JIBA 5LNSA 1FP8A 4FX8A 3VOHA 1WBJA 4B3ZA 1T0OA 1YDOA 3DG3A 2NVAA 2JEQA 4PA8A 4R3UA 3IJ7A 2D20A 1K9DA 1UMYA 2R82A 5D4YA 3C4UA 1Q6FA 1JXKA 3DHDA 5LA1A 3M16A 3BANA 2PDXA 2JGYA 3I4KA 1ZRQA 3SO7A 4WGXA 1RCXB 3W7DA 4IG2B 2DT1A 3VC5A 4MFDA 2A21A 4RLIA 4H9UA 1Q8AA 1KXTA 1ISZA 1HQTA 4Q7BA 1NJJA 2GK1A 3ZYZA 1Q66A 4X60A 3EDKA 4PEEA 4E3VA 2GVJA 1ZCCA 2X0HA 4I9TA 5FL1A 2WB5A 1UR2A 3L4UA 2P5NA 3FFSA 3LEPA 4TR9A 4GBUA 3SCNA 2DH3A 3KW3A 1W3KA 4FOJA 2WSPA 3XINA 3PNUA 4LCQA 4UTWA 3ALGA 3LK6A 3PBWA 5HQLA 3BLIA 2GZXA 4C6FA 4HU8A 1H61A 5DT7A 1IT8A 2HMCA 1K03A 4TV6A 4DJFC 2FTPA 4GMEA 3GRIA 1PWMA 2A7RA 4B5TA 4WHBA 3ZR5A 5A6JA 4IH3A 3ABZA 5HJYA 2EO7A 5M3WA 2ACRA 4UC5A 5HWMA 3WLRA 2V6AA 3BOLA 3C0SA 3SCVA 4K7YA 1DIDA 3R7MA 3MBFA 4GINA 3IJLA 1LORA 1UUQA 3WK0A 2V2HA 3PN8A 3URAA 1W1IE 3LDVA 3FYPA 4PTMA 1LT7A 1JCTA 2EBNA 3QV8A 4JX4A 3BLFA 1MQPA 3DYOA 3IV3A 2NQLA 3WG6A 1Y5XA 4GPNA 2QIWA 2QJIA 1JEZA 4RJEA 3GYCA 3FGCB 2PTXA 2DZUA 4XAYA 3ZSTA 3QOMA 1LYXA 3L12A 4HSNA 4DJFA 4S2CA 1PV8A 3TTOA 1A5AA 1OIMA 1E9ZB 4QLLA 1KO0A 3SADA 2HROA 4FX6M 4Z2HA 3OVRA 2HZGA 1E1EA 2ZYFA 1QU4A 3ITCA 6REQA 1YTDA 3H8AA 3H2AA 3P84A 4MMWA 4PRWA 5IDIA 2FPTA 4I7VA 4LVBA 3OBEA 3QEZA 2OWWA 1RV8A 4QBXA 2FHCA 3OA5A 1JI2A 5DXYA 3U2CA 2JIEA 4AIUA 3QC3A 3I3EA 5JXQA 1UBSA 2UY5A 4DBUA 1G7UA 4DWSD 4MY9A 1U5VA 4QLKA 3THQA 3UXLA 5JMUA 3OLGA 1CECA 3KP0A 3HM7A 3ITVA 4P7NA 3VCCA 1XICA 4E6MA 4OQVA 5JIWA 3MP5A 1RA5A 1M7JA 3W1TA 3N04A 2FHFA 3SI9A 4QSFA 1H7NA 3KRBA 3OHMB 4KRZA 2FMOA 5MF5A 1KFWA 3PZVA 1PX8A 3R2GA 4GD0A 5A6LA 2NXHA 4OUEA 5EKYA 4NILA 4EOUA 1C7TA 5JBFA 3EA1A 2NXGA 2Z7KA 3BJFA 3CZLA 2YPIA 4A4AA 1E0WA 2VHLA 1SFSA 4FSAA 1P0NA 1W5QA 2ZUVA 2ZUSA 3UEQA 2XVGA 4KFOA 2HE8A 3S5SA 3V16A 4F2TA 2DJXA 4TV5A 3BMWA 4O11A 2Y7GA 3ARQA 4CNNA 5ECVA 3MHGA 3NXLA 5FEXA 4MVAA 3LHUA 3LA4A 5I79A 4MWAA 4K7VA 1EPVA 2XDFA 4UQCA 4U5IA 2E25A 2A3AA 3KCJA 4B5XA 4HMEA 3BO9A 1E6XM 2FLIA 1ONEA 3IK2A 4RDZA 3W71A 4RZ5A 2GVYA 1TQJA 4LV9A 4GVGA 5JU6A 4Q4MA 4U3AA 4F9JA 2BNJA 4F2BA 3OGVA 4O15A 5F2LA 3H2MA 3MKKA 4JTQA 1EGZA 3UESA 3MUIA 4LX4A 4AMCA 1JDCA 3BPWA 2XIOA 1BPLB 2V38A 1BYCA 2ZUTA 2PZ0A 3GR4A 1MUCA 3QFWA 2VGFA 4Q4PA 2F2KA 2PLMA 3WLHA 4Y6GA 3FHQA 4WQ6A 3SECA 4MKVA 1R3TA 4GQ0A 4LEQA 1FKWA 3NNTA 3VABA 4DBEA 5LXEA 3U6WA 4DZIA 1F61A 1CTNA 1UKQA 2PF8A 3L2LA 1SMAA 3PBYA 1IT0A 1L8NA 4EWND 2XIQA 4A21A 1HJVA 4PMQA 3VD4A 1D3HA 4NZ4A 3VZYA 4IXXA 3M7SA 3WDRA 2YKKA 5CGTA 5I3DA 2F2HA 5HNUA 1XLIA 2VC7A 4JFTA 1E3XA 4W4QA 2ZXDA 1VFTA 4XZBA 1AH0A 4HZ7A 1T5AA 1QNVA 4M6QA 3RNDA 2HK1A 1VH7A 1C29A 3FV9A 4ERGA 3GG0A 4H7CA 1F8MA 1RXOB 1Z42A 4CN1A 1IWPA 3AZRA 2YZ5A 2Y85A 5G2IA 4DYJA 2X7VA 2XN2A 1S5WA 1E71M 4TVCA 1F4HA 3TW6A 2VEMA 1KD0A 4I6VA 4DJFD 1F3TA 5EA9A 4GQRA 1XH2A 4H9ZA 1DXIA 2ABBA 5GJPA 3TSMA 3BW4A 2FFIA 1QNRA 1G4PA 2PUZA 3MP3A 4O12A 1Z41A 3UJFA 3G8EA 2J7CA 1SFLA 3TTYA 2HQAA 3WLPA 3WQFA 3RLUA 4BQ4A 4ZQOA 1WXYA 2WMIA 4W88A 4JKLA 3IVTA 3PUGA 4RPPA 4R34A 3EDFA 4GUIA 2HV5A 1PXGA 2XYLA 3C2EA 1VKFA 3EKZA 1HP4A 3EKLA 3NQ8A 1A5MC 4RNHA 5D04C 2EPKX 4AHOA 1Q4NX 2DT0A 3F4DA 4H9TA 1XI3A 1L9WA 1ISXA 2C18A 3KS5A 4F4RA 2J8FA 3GDBA 4XD3A 3W6YA 4GZ7A 3U5UA 4OOUA 4DBWA 5EMYA 2BZNA 1X39A 2E09A 2NV2A 2YXXA 3WLQA 1W1B1 2XGIA 1OX5A 3J7HA 4M5PA 1NIUA 1QR7A 4ZE5A 1DWJM 3EDEA 1NOWA 5I78A 3UZWA 1R87A 2PMQA 2WYSA 4UUIA 4ZSUA 5GQBA 3JW7A 2PDLA 2IUZA 2VUNA 4TMBA 3VGEA 2PLJA 4J40A 4WCJA 1HT6A 2WNZA 3UJSA 1TV2A 4F79A 2DZPA 3WO8A 4A3QA 5C54A 3GK0A 4D71A 3H4WA 3UWQA 2MANA 4LB4A 3BW3A 4MWAD 4O1BA 4S3JA 3NG3A 4UMBA 1KBIA 2XG9A 3KXQA 1TVPA 4O8RA 3EMCA 4RNJA 3IACA 2J8TA 2EPMX 4TX8A 1TB3A 1LWIA 2AAMA 3NQ6A 4IGHA 1H4PA 4K3ZA 3W24A 2QPUA 1WOBA 1Z89A 2IKIA 3WLOA 1WDRA 3FA4A 4RXFA 1QOXA 3VD5A 3NZQA 1N8IA 3EOOA 1E73M 1B57A 1E6PA 1UJPA 1XYMA 3QPYA 4GOAA 4IUGA 3SCPA 4DXKA 1CGVA 1M68A 3RM8A 3OZOA 2FH8A 2POZA 4DF0A 2PWEA 5E93A 4EP8C 3WK1A 5D38A 3WEMA 1RVKA 3QV9A 4QQ3A 2X16A 2VX7A 3CQJA 3UG3A 3RFAA 4XD6A 1JCXA 4UR8A 4HNUA 2QCEA 2XIIA 3W7EA 1J0JA 2G0WA 3FA5A 3LI1A 2QDHA 4JCLA 3CQ0A 1LWHA 3WF1A 1E0VA 4QRNA 1H3GA 3ECQA 3IUDA 3D6NA 4NJIA 3E2SA 5ABFA 1XM3A 2VT0A 3VDCA 2REQB 4MHBA 3HMCA 2G3NA 1O5KA 1W31A 3WJSA 2Y5EA 2AL2A 1ZJIA 2RFGA 1FWHC 2B7PA 4XKMA 3KRUA 2VM8A 1GOMA 4FB7A 1QPNA 2FKPA 4LV4A 1VLWA 3I7RA 4GZIA 1AD4A 2Y88A 4J3UA 2NV1A 2VX4A 2Y70A 1A4LA 2O55A 4GIYA 4NT0A 2DY3A 3AALA 2CBUA 2OU4A 3FDGA 2Y8VA 1GJWA 1XL9A 2V5LA 1E15A 3ANUA 1F3EA 1ONWA 4GNVA 1ZALA 3CHDA 3VM7A 3NQDA 1QHZA 3F2BA 1A5SA 4WSKA 4Q8PA 2QCHA 1VEOA 3G1VA 2IKJA 2VRQA 3IAQA 3MW7A 5A3HA 3KBNA 4KWVA 1O4UA 1PZ1A 1LL6A 4LT9A 3CQHA 1UKPA 1V3JA 3E49A 5D2YA 2NQHA 4NAFA 5EFDA 2OWXA 3RCNA 4WLCA 4QM1A 5FF0A 3WJWA 3WLLA 2FB3A 3QR0A 4A8NA 1Q7MA 1UZ1A 3CB8A 3OO2A 4L9XA 3OQ8A 1MW3A 1IF2A 3N9RA 3UJEA 4JTDA 3QFEA 4QDMA 2UZ9A 4UFHA 4HK7A 4DZHA 3ZM8A 2YL5A 2GJPA 3HURA 2A1YA 3WFLA 3HN3A 1WP6A 1GVQA 4H9XA 4JN7A 3V36A 3VGBA 5MKGA 3PS7A 2V8ZA 5DXXA 4POCA 1FKXA 4PUKA 3FDKA 3WCZA 1XIEA 5A6SA 3QMRA 4OT7A 4JHZA 1OFDA 3SY5A 3R58A 3TQ0A 5DMMA 3CIWA 3K8MA 1R3QA 1RUSA 4O57A 3TN5A 1TX2A 1E6SM 1JYVA 4S3AA 5A69A 2YLAA 2VDHA 4ZVJA 2Z28A 1SR0A 3LXBA 4ACYA 1BHGA 3EX6A 1KFEA 1KV5A 4C6KA 3FS2A 3B8TA 3C0LA 1E9LA 3OB8A 5CEWA 2D3LA 1JAEA 2AGKA 4HA1A 2ZX9A 1BWKA 4QLJA 4G2DA 3BLPX 5FJOA 1VPXA 2YW3A 2HEJA 1IIGA 4KGLA 1FWSA 1VQTA 1S2TA 4MUZA 5LGXA 4OBRA 3E74A 4MTVA 4J28A 1VPYA 4U31A 4GWEA 1O5QA 1U22A 3C2YA 3VIKA 2Y5JA 3UF9A 1VEMA 3ARSA 1ECEA 4PMUA 4NZJA 4CCDA 2ACUA 1HGYA 3WJXA 1XFBA 5BZAA 2PP0A 4MNMA 2GJXB 2Z1BA 2JKAA 3PTDA 3CL6A 4PUNA 3MJMA 1LOQA 1MZHA 1KCKA 1KM2A 2RGLA 1W17A 2XJ7A 4U4MA 1G4TA 4K6AA 1MI3A 4JFUA 4RZ6A 2ZUUA 2VNCA 4LC6A 1H2JA 4HOWA 2BHZA 5HATA 4XUGA 3FKKA 4QJ5B 1GJUA 2D23A 3ARTA 3H7RA 5JIPA 3V4BA 1EC9A 1QHOA 1VYSX 2VCAA 3ZJ7A 4ZQNA 4GIEA 1OHLA 3W7PA 5DCEA 3F4VA 3VPLA 5GJMA 5AC7A 1J18A 1OY0A 1AG1O 4ORIA 1ZZMA 1XBZA 1H41A 2ALDA 4W5UA 3UGRA 3RX3A 4FP1A 5EMUA 4HPJA 4FIRA 3VNYA 1GOWA 1SGJA 1M5WA 3NQBA 1WB0A 3PFRA 4GZEA 1M7OA 1TV8A 1K3UA 4L7ZA 4B5UA 5IM51 3PANA 1XYFA 2QAPA 4MPQA 3M07A 1LTDA 1C9WA 1EXBA 3U2OA 3CZJA 5BU6A 5DCDA 2OB3A 1NQKA 1WAUA 3OTRA 3ZSSA 3OIXA 4AIBA 4AHQA 3GNPA 5AHFA 2ONEA 4J2PA 4HYWA 4MWAE 2PDHA 2OOFA 3FW6A 5HMFA 1N8FA 1BYDA 4LUTA 4M81A 4QG8A 5FEPA 5AC4A 1ZS2A 4AZGA 4O8AA 4Q8WA 2GGGA 3GNXA 1G7VA 4JL2A 3H7UA 4MADA 4L80A 1ELSA 3U7VA 1KM1A 1EDGA 1MNSA 1G67A 1KBJA 1XYCA 1KFCA 4MB1A 2QGYA 2W66A 3APGA 3TN6A 1R86A 1OZQA 3UVAA 4MNJA 3CUJA 4PCNA 3EDDA 1OG6A 3ARVA 1GYNA 3AWNA 2O0TA 5CZ0A 1FHDA 3VIGA 5M03A 1V02A 3ES8A 4C60A 1MEWA 2D2GA 1C90A 1E1CA 2VEGA 3HJZA 2D69A 1H7PA 2WNQA 3B9DA 3WL1A 3M64A 1YIXA 5D03A 3W85A 2J47A 1MYRA 3KBMA 4C6BA 4TU1A 4CNOA 2VTFA 5HUOA 3KLLA 3R12A 1PWLA 4AD1A 1H0IA 4GGBA 4RXGA 3WDHA 1QPOA 4IGNA 6TAAA 6CGTA 4H01A 3RIKA 1TUXA 3MA8A 1I2PA 1UBPC 1IR2A 4GC4A 2DZVA 4RNFA 2QMKA 4QTGA 1D3GA 3V18A 2E8YA 4WOZA 2X7WA 4S2BA 3W00A 4LYPA 1WXZA 2F9RA 4NZ5A 3LYEA 1X96A 2CLFA 2VYOA 1C7SA 3LZ3A 1NAL1 2E68A 4K8EA 1RR2A 4L65A 3N9SA 5C9WA 5K3VA 2OELA 3WD2A 4FX7A 2J4GA 4M7TA 3AIBA 4WDTA 2V68A 2PTYA 3EEZA 5K4XA 1UP3A 5REQB 4H8NA 4OECA 2QVNA 1HN1A 1LRNA 5TAOA 5BU9A 2IPJA 3C2VA 3W1NA 3W70A 1GZJA 3TYDA 1B54A 3S46A 2VD9A 4JX6A 3KOFA 3NQ2A 4MYXA 4GC3A 4IM4A 1OCBA 4EX4A 2HISA 1TA3A 3DCPA 4DO6A 3EB2A 4X9YA 1OCJA 3DBPA 1TVNA 3WJYA 2R94A 2OEMA 3L5MA 3LNPA 4AQLA 4MF4A 4RR4A 1XRVA 4E8GA 2A3LA 1YNPA 2RDWA 5HWNA 5U7SA 3IJIA 2OLSA 3TTQA 4WY0F 4KFPA 3SRHA 4K8HA 5KINA 1V3LA 2BVDA 4B3KA 4V2XA 4JXCA 4JD4A 1BF6A 1J6PA 1XS2A 1W91A 4NNBA 3ME3A 2NLYA 1HKMA 2QCGA 4K37A 3G77A 4H2HA 3W1PA 4FNRA 1W56A 3LBOA 4ONVA 3POCA 1TIWA 3T42A 4JDYA 4J3TA 4V33A 1DBTA 3MPGA 1V7AA 3NQAA 3QPEA 1TZZA 2ZUWA 1L2UA 3L7RA 1I60A 2DZBA 1QNSA 1YMYA 4ATWA 4OKDA 2WSRA 1AQFA 5HPOA 4JEJA 4MY1A 1JUKA 1L8PA 4Z1YA 1PIGA 4P61A 4G8TA 2G8ZA 1GOXA 2FVKA 4JQ3A 4K39A 4IG2A 4G1NA 4NQ1A 2HNHA 2YB4A 3B0UX 3C86A 4WY0B 2X1TA 1TPH1 4LF2A 3CWOX 3IARA 1EDTA 3TC3A 4C7GA 1KLYA 1B90A 2E9MA 3WD3A 2TODA 4QJ3B 4Y7EA 5AYXA 3OA3A 4J3SA 2W4XA 2BXYA 4HP5A 1RLDA 3V5OA 1V51A 1YNQA 3G1RA 3DFOA 2ZRVA 3WYZA 2Q02A 4KW2A 4W5ZA 1V0MA 3AO0A 3CLWA 3RPDA 1J0ZA 3C61A 3KS6A 4LUIA 1KRCC 5C9ZA 2F6KA 1QPQA 1Z9AA 1OVDA 4IMEA 3LTPA 3DX5A 1XGDA 4DVOA 5JQ9A 4E0CA 1PHWA 1AZ2A 3W7IA 1XGEA 3A5FA 3STFA 3COTA 1SZEA 5LZLA 1K7EA 1B3XA 1RQBA 4WSJA 3NQMA 3CHEA 2JGQA 2PE4A 5DBTA 3C3NA 2X1SA 4WUIA 1RSCA 3ZQ9A 3ZOAA 5E6YA 3WUBA 3H54A 1OG0A 1QNOA 1GHRA 4RNIA 1K02A 2A3BA 4KIRA 1POKA 3FGCA 1PVNA 4MY8A 8XIAA 2OGJA 1VBRA 1W9UA 1G4SA 4YL2A 1OGBA 3V3WA 3GNDA 4KEUA 2BWGA 4XAGA 3T2PA 3EB3A 3U0HA 1GG0A 4NYUA 1K8ZA 4ZBCA 3VDGA 2YCKX 3I7QA 3RU8X 3VIMA 5AYYA 2IS7A 3B0VC 1LL7A 1YW1A 3S5OA 1SO4A 3ZMRA 1ZB5A 3R0KA 4O16A 4TVDA 4MZ1A 1VRDA 1Q3NA 3SRDA 1EGMA 1WUEA 1DQWA 2DPEA 3VIPA 1SU5A 3SCSA 3I7SA 2CZDA 4IISA 3UNTA 5EMLA 4QJ4B 2ISFA 1HJUA 2Q3RA 5ABTA 4IF2A 4MB5A 2YDSA 3UWZA 5C71A 3N11A 4JS3A 5CPMA 3T08A 2YZRA 3O2LA 1XLAA 1YKWA 2PWVA 4MDOA 5A6AA 4EVZA 1WQ5A 3E02A 4H19A 1XYAA 5T9CE 3TSDA 1DQXA 4I5UA 2OSYA 2YL8A 2ACQA 2UY2A 3RR1A 1JZ8A 3E12A 1X6LA 5E9AA 5LXXA 1XISA 2ZA3A 4B9ZA 5L6UA 2WWCA 1R2RA 1XLKA 4IJBA 2W5FA 4ILSA 3UWYA 5D8ZA 4H1ZA 2FZDA 1DIOA 5FL0A 1P0KA 4TMCA 3F03K 5KMYA 1TJ0A 3VCRA 1MUWA 1C92A 3HU7A 4PTDA 1E51A 1E43A 2I7GA 3L9CA 3DG6A 2CU0A 4MJ4A 3DDMA 4LSBA 3A24A 2YYUA 3VDHA 1US0A 3NSXA 3LENA 1XJBA 4JNMA 3AICA 4W7WA 3UPBA 3CT7A 3BGJA 3MHUA 1Q65A 3QOKA 2WQPA 4HNCA 2J13A 1BKHA 3EDJA 1D8CA 4M8UA 1MMFA 3AYVA 1GKRA 2EPHA 4RDVA 3AIQA 1XBXA 4LCSA 2YB1A 5H8PA 4S3CA 1EA9C 4PL1A 2GQ9A 5DMYA 1J0HA 1FY6A 3TQPA 3BK0A 3FHAA 3VC6A 5JVLA 5M2FX 4HCHA 1ZFJA 2P3ZA 2I9UA 3TJXA 5DO8A 2BY0A 2G4FA 2PSNA 1QW9A 3A13A 1SZGA 1UG6A 3Q58A 3BARA 5G1TA 1BD0A 2BOEX 1QK2A 4HBKA 4FNTA 4HSHA 2EG7A 2VFIA 3AS2A 4V1XA 1GTEA 2DZWA 3HV9A 3EA2A 4M24A 1PZ3A 2ZA1A 1KB3A 3T8QA 2G3IA 3GDTA 4KCWA 3CUXA 3K5XA 4EXQA 3RYSA 1AW5A 1JPMA 3KFTA 4PRTA 3SRKA 1AODA 4MYAA 3AS0A 3GQYA 2CHNA 5EBAA 3PJTA 3W7JA 3V1HA 4WIWA 1R3YA 1DE5A 1UH4A 1MDLA 4YCOA 3P2VA 2GUUA 2WCSA 4QXIA 2FVLA 4E8DA 1M9HA 1V0LA 4PSPA 3OQEA 1V3IA 1HGWA 3URBA 1G94A 3IS4A 4JTHA 4K36A 3CMJA 4WR3A 2OQLA 1H11A 5H6HA 3LHTA 4DPQA 3SY8A 3FEMA 4FOKA 9XIAA 3GAKA 1T7LA 2WHKA 3WMBA 1ITUA 2VRKA 3TU9A 1R3SA 3BZGA 4DB7A 1HFBA 3ABXA 5F2MA 2WNNA 1YNYA 4MZ8A 2YSWA 4D72A 4P8UA 1KBLA 3HPZA 2YOCA 5TBOA 3NM1A 3OVGA 1Y0EA 1DJXA 3GG8A 3SURA 3EA3A 3EOSA 1KQYA 4NXSA 5J04A 1BG4A 1J11A 2H3DA 3U48A 4HHHA 1XBYA 4JYEA 3TV8A 2NUWA 2BSLA 5I02A 4V15A 4PFMA 4DWDA 1BSIA 2GWNA 4EPKA 3GXDA 1OC6A 4JNZA 1RJPA 4R7JA 2J66A 1H63A 1W5MA 5D33A 3VIFA 3CBWA 1RY0A 1TZ7A 3PSWA 1XPYA 5K9CA 4MUPA 4XISA 1IXQA 3GYEA 3R8RA 3ZS4A 3PUDA 4AWTA 1XKYA 5A8MA 3F5JA 1KKRA 3T6CA 5BRPA 2V3EA 2ASHA 3D47A 3PZIA 1AFSA 3GWQA 4K8GA 3ZVHA 2PC4A 3AFBA 2XPKA 2E40A 4UTTA 3GBDA 5EU9A 2B7NA 2P3EA 3VOGA 1XCWA 4OVXA 3WLMA 4BWLC 2BGSA 2VR5A 3GVRA 2J7GA 2DUXA 4J3ZA 4Q22A 2ZX5A 3B8WA 3ZLHA 3UCQA 4BA0A 4JTKA 1UD5A 3W22A 4O0QA 4IL2A 2H9AB 1RJRA 2JF7A 2VC5A 1HX0A 3S1VA 1MW1A 4F0RA 3W4RA 4W7UA 5KZDA 2JALA 3N2BA 3CQIA 1Z3NA 4QE5A 3G0SA 4JR5A 4L64A 3KVJA 1G1YA 2YJQA 2VFEA 3RAOA 3OU8A 2DZXA 3FA3A 3QSRA 1EKOA 3SAZA 4OGZA 3BLDA 1VRXA 4BWLA 2E6YA 2HSAA 1TKKA 4KRUA 3PY2A 1L6YA 2BP1A 2E5CA 3VAVA 3W7OA 2C7FA 4CVWA 3QY7A 2GQAA 2D73A 4NL1A 4S39A 3UQNA 3E0IA 3VA8A 1MFUA 1WZLA 2HTMA 3TOYA 2OZ0A 3GR7A 4M56A 2ODOA 5TIMA 2HK0A 2WAGA 3A12A 2J9ZA 2PGRA 3GH5A 4HD5A 2ISWA 1SM9A 3KAOA 4FO4A 4M29A 1FA2A 4EIVA 4MB3A 2REQA 2Z29A 5A94A 4JIRA 1HO1A 1F7BA 1ZENA 5CGQA 3B0PA 4C6IA 4QFUA 4WJ8A 2A2IA 2FZ8A 3P67A 4WOQA 1CLXA 1GKQA 2Z2AA 3PWIA 1GOKA 1QTWA 1XLCA 3PBMA 3TYEA 3CO8A 4Q4RA 3UXIA 4F0KA 3CC1A 3MANA 5XIAA 5IHSA 4GUHA 5HMEA 5LHEA 1WE5A 4H7ZA 3ATYA 1QRQA 4JEQA 4LFYA 3VZXA 3W2NA 3KL3A 1ME7A 1TMHA 1WCGA 4H6RA 3H2NA 4B91A 1TPC1 3AYRA 1CEOA 3B4UA 1R47A 4IIGA 4Z1CA 1MFVA 1EF2A 1X8FA 3DECA 2H8ZA 4LCRA 1MXGA 3HMJG 4ADTA 4XTIA 4JQ2A 1QNPA 1P7TB 5EGRA 1TWDA 2OTDA 2AQOA 5G2HA 4UXDA 2QJJA 4U33A 4PRRA 5FCZA 3N3TA 3WD1A 2QCNA 1Y5WA 2NSOA 4IQLA 5DF0A 4O28A 5B7ZA 1S2AA 2B4GA 3KTCA 5D9MA 1Z48A 3T78A 1UA7A 3E2VA 2Y1HA 1BWVA 2VR4A 3F5KA 3IVSA 2WZEA 1RAKA 4R9XA 2GJRA 1P0EA 2Y61A 4I3GA 5F7UA 3WK2A 3GB6A 1EP3A 2VR2A 3A3HA 2ICSA 2CHOA 4ICCX 2BX7A 4GJIA 5IHRA 2XIMA 1M41A 4OBSA 1TZ9A 2VOMA 1S1RA 3GUWA 2PTWA 1SW0A 4IP7A 4Q8MA 4LUSB 4H4IA 1SR9A 1TJ1A 5A6KA 1H62A 2XU2A 2V3GA 3O07A 2ZE3A 3EGJA 3CYVA 3O15A 1BTMA 2G37A 1BRLB 3GNNA 4IPIA 3LBMA 1H50A 3SB0A 4GJ1A 2ZXQA 4D6IA 3OODA 4H83A 1Q85A 4HTBA 1EUAA 2WC4A 2XISA 1E4NA 1PZ2A 5BOOA 1VFSA 3S5ZA 1IQ8A 1VPQA 2QDEA 4HU3A 3UT0A 3W7KA 3W9ZA 3T0TA 5D09A 3GDRA 5LIYX 4JIPA 4DELA 6XIMA 4JTLA 3QMTA 2PGWA 4PMRA 4CCZA 2GJXA 3W53A 3VCNA 3WDJA 2LLEA 5DRCA 1VR6A 3VM5A 4Q3MA 5AVNA 1Y65A 1W2VA 4QDWA 3S0CA 1KWKA 1Q7ZA 2YLLA 4HK6A 1KM3A 1I2OA 2VO5A 1W3JA 4HU4A 3P74A 3GBEA 1I45A 2PWHA 4M6UA 4HNTA 3VFCA 1GG1A 1SO5A 3GU1A 3NSMA 2PTDA 3PZMA 5BOEA 1PTGA 5I7GA 1C91A 3FAWA 5G4HC 1IEXA 4EWJA 2CNCA 3P60A 4H6KA 3GNOA 3LUTA 3UP8A 1JCMP 4P7RA 5I3GA 4GA8A 4Q4OA 3UZYA 3PZQA 4PCFA 4O19A 3P82A 4OTKA 1AQ0A 4GO8A 4RL3A 2ZVRA 3F4CA 2DT2A 1A4MA 5A8GA 3UVIA 1J01A 1E9YB 1H1NA 1ITCA 3TXVA 5CXPA 1WBHA 4LC8A 1PKMA 5C9RA 3UD6A 4YXGA 9RUBA 2ZX7A 2Y7FA 4XUYA 2BVTA 1X7IA 3AIEA 1B4KA 1XLMA 4FOUA 3DFTA 1UOZA 1BGAA 3REQB 2E0PA 4RZ4A 1WKDA 4AD2A 4Y9NA 1QBBA 1DP0A 4BHYA 5TD4A 3GXMA 1BVZA 3RG6A 3UA3A 2OJPA 5CZJA 4C1NB 3S9IA 4HVXA 3M47A 4FNQA 2GSHA 2NW0A 3LPGA 4UNKA 2NVCA 3M0KA 2NT1A 4YVVA 7PTDA 4IMGA 2GSEA 3PHAA 3ZJ8A 4H2CA 3QGVA 1MEIA 3IRDA 1WXJA 3CK5A 1TPB1 5C9XA 4GZJA 3DFPA 3SCQA 4IHCA 1REQB 4WJEA 3M41A 3LOTA 4AG0A 2A6NA 3OW1A 1BG9A 1HG3A 4Z1DA 4GXWA 1ZBCA 4HOZA 1TV3A 3RDKA 1W5NA 3W3OA 5C70A 4GI9A 4GI8A 1KFLA 4MDPA 3SUWA 3CH9A 4O53A 5FF2A 2NZLA 2YCLB 3NXFA 1DJNA 4V27A 1SVDA 1R38A 2PP1A 4LS1A 4K1WA 2CXEA 4UTKA 4RE4A 3SEPA 4KCTA