1QOQA

Crystal structure of wild-type tryptophan synthase complexed with indole glycerol phosphate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
268
structure length
254
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal Structure of Wild-Type Tryptophan Synthase Complexed with the Natural Substrate Indole-3-Glycerol Phosphate.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 98
structure length 254
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 1999-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1qoqA00
2C3ZA 1G4SA 3G1FA 1JCLA 4JTKA 4WUIA 4XKYB 1DKWA 1R47A 4FNPA 4DF2A 5HWNA 1VYSX 2YZRA 4K36A 2QCNA 2X1TA 3WJWA 5D37A 3UWWA 2VEMA 2CZEA 3TK7A 2QEZA 3EWWA 4LVAA 4EWND 3P5YA 1TTJA 2ZFAA 1SO6A 3S9YA 3NQVA 3NQDA 3PM6A 4BWLA 3TXZA 1H50A 5TQLA 4BI5A 4PTNA 2Y7FA 3GKFA 1NAL1 2ZCGA 5AFDA 4N9BA 4ORMA 2CLKA 3KXQA 3GDKA 2PCQA 3PBWA 3GB6A 2O7QA 4HSOA 4FNQA 4BR1A 3M9YA 4O0ZA 2A85A 2ZBTA 2BXVA 1LRTA 4LS1A 1MEIA 1MSSA 1A5BA 3EX2A 1HUVA 4JTIA 1ME7A 1LM1A 2YX0A 5EYWA 4AB4A 2HTMA 3KVLA 5IBXC 2JKEA 1THFD 3NQ8A 1WV2A 2BX7A 2TMDA 4ZZ9A 2IQTA 3LCFA 3HO8A 2GVJA 3GDTA 2GVLA 3NPXA 3G1YA 5BOOA 1XBYA 3GYEA 1XXXA 3BPWA 3W2MA 3QMTA 3BLIA 3I7QA 4O53A 3Q2DA 2H8ZA 3TA6A 2WNNA 4HN4A 1Q6LA 4ADUA 2TYSA 1L6SA 1N7KA 1OABA 4WY0A 3AJXA 2ISVA 1TREA 3P8JA 4ZQCA 4OV4A 1EWDA 3L67A 3MYOA 3M0ZA 4E38A 4WQ6A 1SZNA 3N19B 1J4EA 2NUXA 3USBA 5HUOA 2VENA 1FCUA 3CT7A 1FX6A 5G2HA 1GTEA 3NVTA 4O28A 1GG1A 3G8RA 5CSRA 2B7NA 2BLEA 3LCLA 4KFPA 1EP3A 3W1NA 1N8FA 1NF0A 3QW4B 3W1RA 1UB3A 2QCDB 3UYCA 5F2GA 2LLEA 3H53A 3W7OA 2FDSA 5F1VA 2DZVA 2C14A 3W76A 4YCOA 2OZ0A 2CW6A 3MI6A 4K8EA 4MY8A 3LHZA 4N9EA 5D38A 2ZA3A 4UMAA 1HO1A 3L66A 5I3IA 3EWZA 3JS3A 4Q33A 5EKYA 1W5OA 3ATYA 3W86A 2Q3RA 1DJQA 2FPVA 3G3DA 1TTPA 3STGA 1GVRA 3I68A 1L9WA 3GDMA 3PAJA 4DO5A 2A7PA 2XN0A 4E2BA 2VELA 2V9DA 1Q6OA 2FFCA 3W2KA 3A23A 4YMZA 3OBKA 4U4MA 4POCA 4O10A 1PVNA 2EPHA 1IF2A 1VQTA 1D3GA 1XUUA 4RV8A 3THAA 5CPOA 3HG5A 3NPWA 3PR2A 5FF3A 4JTLA 2ZRYA 3VFLA 4UR7A 1F05A 4WXZA 3YPIA 1TTIA 2G97A 5D2XA 3OIXA 1JCMP 1LROA 4NZJA 3L5MA 3TSDA 2QCHA 4FF7A 4RLIA 1A5SA 4A22A 2QCLA 2DZTA 3W2JA 1M7OA 2YFNA 1FDYA 3GXNA 1FCBA 2I9EA 1YDVA 3QJAA 3E96A 5LHEA 3MMTA 3QYQA 1VLWA 3NQCA 4LRTA 2NUWA 4S1FA 5C6MA 2Z6IA 5FF2A 3QQ1A 1H1YA 1R2RA 3ABQA 4DO4A 3LRLA 1GVQA 3ZR4A 2X2GA 2E6FA 4AWTA 1AK5A 1FWTA 3STCA 3NNTA 3EXTA 3GNDA 5C54A 4Y90A 1KFCA 5DBTA 3SZ8A 4ZQPA 5AHLA 4RZ5A 1LOQA 2QCFA 5D03A 3C52A 3V1PA 3FKKA 1L6WA 3S5OA 3IIPA 1RZMA 3CC1A 4IOTA 3SFKA 4UFIA 1ZY9A 4IGHA 1FQ0A 3LM7A 2DJLA 3O8AA 4A21A 1TPVA 4QM1A 5J5DA 3PG9A 3O63A 1LZOA 4P61A 1A5AA 4JDBA 4UTHA 3KFTA 2QUTA 4DBEA 3G3MA 1YXYA 2PURA 2R94A 3Q94A 4LC8A 3NGJA 4MJZA 5K9CA 1LBFA 2V2HA 4JTFA 1VJIA 1LBLA 1TQJA 3DKLA 3SGUA 1SW7A 1VPXA 5AC7A 1AMKA 3I65A 4JN6A 4WXYA 1B3OA 1K7XA 3STFA 1PCWA 2BZNA 5TIMA 1AW1A 3C2EA 5K7JA 3LHTA 1GZGA 3HGRA 1XM3A 4LVBA 4AH7A 3CEUA 2D73A 1TRDA 3T40A 4JNMA 1R46A 1P0KA 3U6WA 2RFGA 4JICA 4RZ6A 3TC6A 4CCDA 3FA5A 4Y8FA 1J2WA 1YPFA 2H3BA 2WQPA 3QW3A 3DENA 2A4AA 4LS2A 1F5ZA 3QQ0A 3W2LA 3W7EA 2GOUA 4W9TA 3KRUA 3E02A 1OFPA 2Y6ZA 4XZ9A 2RKXA 3W7KA 4LOCA 3G0UA 1W31A 3UWQA 1KA9F 3NXFA 4ML9A 2GJLA 3UZ5A 4K39A 3UY8A 5LNUA 3G0SA 2A7RA 1W3NA 4DELA 1SFLA 4EVZA 3NM3A 2OX1A 4KKXA 3FEMA 3PWAA 3PULA 5AB3A 1KTNA 1FUYA 2PRLA 4M5PA 1AL8A 1ZALA 2J6XA 3M44A 2FTPA 3ABOA 1TO3A 3BW2A 4HIBA 3O15A 4JYDA 3W70A 3TIMA 1JUKA 4O1BA 4UFLA 3W2NA 5I3HA 3NAVA 5CSSA 3GR8A 2WPBA 3T4CA 4JTSA 4M7SA 3EEGA 3M5XA 1SPQA 2G96A 2YSWA 4NZFA 4ZVJA 4UTTC 4S2CA 1RV8A 2V82A 3DFNA 3A24A 3PVFA 4K37A 4X22A 1TSIA 4Y96A 3VCRA 1QO2A 3L0GA 4IMFA 1W5NA 4XWUA 1GQNA 2ABBA 3QMSA 2ZDRA 3LHWA 3IIVA 3NQEA 2W79A 1LRQA 3DKJA 4IX0A 1O5KA 3WK2A 4CLMA 5L9FA 4UTWC 3MO7A 3LI0A 1JR1A 3MW7A 3W71A 4O1CA 5C2XA 3NYZA 3BG9A 4A2RA 3G18A 1TTQA 3B0UX 3NL2A 4HNUA 1E51A 2P1FA 2QCDA 1PCKA 2EAWA 4P2VA 2V2DA 3W7PA 2WOQA 4NJGA 1TJPA 1CX9A 1EEPA 3QPYA 3NQGA 1LLZA 1I2OA 2Y85A 1FDJA 5G4WA 1RPXA 1SW0A 2A0NA 1LLWA 3LX9A 3C0JA 3L2IA 1K3UA 1ZJIA 4LS0A 2X1SA 4UTUA 4FNTA 4O1AA 2VEPA 3PUDA 3NDOA 1LOLA 3TAKA 1C8VA 4QITA 3JR2A 4RZ4A 3EX4A 4LW7A 1EUAA 3V75A 2H6RA 2Y61A 1T96A 4O0KA 1TB3A 3W22A 4A2SA 3KOFA 4IPJA 1W5PA 2EHHA 1VYPX 3ZS4A 8TIMA 1FWRA 2HSAA 1ZNNA 3UWYA 3EB2A 4O13A 5LNVA 5F4SA 3O1NA 4E0CA 3A21A 5EY5A 1XKYA 4OT7A 1EWEA 2G5WA 3LCXA 2QF7A 3RK8A 4HHPA 1EIXA 5FF0A 5CZ0A 2YFOA 3W72A 3HG3A 1VS1A 3S1WA 3NA8A 3UZJA 1XBZA 2NV1A 4Q32A 2B7OA 1OFOA 3NL5A 3N73A 1VCFA 5GVJA 3HG4A 2E5BA 4TMCA 2QCEA 1ME9A 1GT8A 4MZ8A 2KZHA 3BVJA 1DJNA 3FIGA 4TIMA 3DXIA 3G8EA 4DPQA 3R13A 1XCFA 3IVUA 4DF0A 1QPQA 3C8FA 3L65A 2WNZA 1Z41A 4Z0JA 1Q6RA 3L5LA 1J5TA 2Y7GA 3CWNA 4ZMGA 3G22A 3HB9A 4GC4A 3IIXA 5F2IA 3KHJA 4HSNA 2NZLA 3LGEA 1V7YA 3MI2A 3Q58A 3S0CA 1H7XA 3LERA 1YXDA 1OVDA 1K8ZA 4OHQA 4FNUA 3OHIA 5CZJA 1O94A 5CPLA 3TQKA 3EXRA 1Q3NA 1DORA 1P1XA 2Y7EA 1LRNA 1S3HA 2DORA 1ALDA 4OV9A 4LVGA 3MBFA 4OE7A 4DBDA 3DHFA 3P82A 1HO4A 4C1KA 2E77A 3RNDA 1WDWA 1PHWA 1GPWA 1I45A 3QSRA 1B4EA 2P10A 3HOJA 2R14A 3LHYA 1KM5A 4GFSA 2CWNA 3Q37A 1TYGA 1HTIA 1TPUA 2NUYA 3E49A 4JYEA 2B7PA 1F6PA 1W3IA 5HR6A 1QPRA 1UUMA 3CQ0A 3MHFA 3IV3A 5CGQA 1GYNA 2NX3A 1V5XA 3HQ1A 3U8GA 2ZTJA 4ORIA 4FIQA 1GOXA 5LNWA 3TROA 4UIOA 2V2CA 4N9CA 2YGYA 5MHBA 2W0UA 2QJHA 1OF8A 2C19A 3TFCA 4LWWA 1DOSA 1GTHA 2JK2A 2XFWA 1OJXA 1M5WA 4IUOA 3BARA 3CLMA 2OJPA 4JIQA 2Z2UA 2Y88A 5K3VA 5F2LA 1KLYA 4O17A 2AAMA 3RMJA 4UMBA 3KRZA 3HPSA 4HPXA 1UUOA 5LSMA 4MPQA 1ML1A 3W07A 3W7JA 4NU7A 1TRIA 4UNLA 3PSWA 4O54A 3BO9A 3CU2A 4IJBA 4WX2A 5BMWA 2YDAA 3UXDA 3TE9A 4AAJA 2V8ZA 1JRBA 4JTUA 5D2VA 5L6UA 2QCMA 2X1RA 3VKJA 3RU6A 1W56A 4N4PA 5D33A 3KAOA 3M41A 2J9ZA 4O4VA 4UFHA 4PL2A 1R30A 2I14A 3SGZA 1AW5A 3R2GA 3W7QA 3TU9A 1JULA 1TPWA 3LRMA 2FPYA 5T26A 1XC4A 3LV6A 4XBKA 1QMLA 3P80A 3ZFHA 1RQHA 1TV8A 3W1TA 2EGZA 1G4PA 5AHIA 3UWZA 2YR1A 3O06A 4PEKA 3R89A 1TV7A 3A22A 5D30A 3ZWSA 1OF6A 3W7MA 1VCVA 1IGSA 4UMCA 3F03K 3QPZA 1BWKA 1DL3A 3IIOA 1O4UA 2H3DA 4JTTA 2X30A 4OBTA 3BW4A 2CU0A 1KM3A 4GNJA 3PB2A 5KSWA 4WJEA 3SY5A 2YYUA 3IRDA 1OFRA 4PCFA 3SW6A 2QCCA 1VHNA 4JDYA 4GUFA 1IIGA 4UC5A 1PS9A 3QZEA 4TO8A 4NQ1A 3P67A 5KITA 2JGYA 4M6VA 1SUXA 3GXPA 4ZQNA 3OVPA 3DBPA 1DV7A 4HNNA 3DI0A 3FLUA 3PSVA 1JVNA 5DXYA 1YTEA 3TH6A 1JQVA 2VKZG 5D32A 1KTBA 3W3OA 4NX0A 2FLIA 2FB2A 3WK0A 1K7EA 3W87A 3G1HA 1KM2A 5BW6A 4EF8A 4GUHA 2ZRZA 3GIYA 1VHCA 4CCEA 2ATSA 2C13A 3C2RA 4UCGA 1L2UA 3NQMA 4MKNA 1B9BA 4X2RA 1K8XA 1OX4B 1K02A 3G24A 1X8FA 3D0CA 3TX9A 4AVFA 3CIWA 5EA9A 1S5VA 1F76A 3NL6A 3M43A 1IXPA 2ZZ1A 2A5HA 4QISA 3B05A 3LI1A 1Z48A 2ZRWA 3I6RA 3W7RA 1G4EA 4NT0A 3LCGA 1ZAHA 1G6CA 2ISWA 3CPRA 3MHGA 4N6EA 1OFQA 1I2RA 1XI3A 4UNKA 4B5NA 3C4UA 5LKYA 4LUJA 3UNDA 4MY1A 2F7FA 5LNSA 4CQ9A 1P0NA 2NWRA 4J9JA 3W75A 5K2ZA 4JX5A 1SU5A 2ISSA 5CZTA 5HWJA 5KTLA 4HPJA 5D05A 3VE9A 4QAIA 4AMAA 3W23A 3W7GA 3FJLA 5G1TA 5I3JA 1FWSA 1HFBA 2NWSA 4KFNA 1X1OA 1OFAA 1FBAA 1H63A 3B8DA 3UPWA 1WAUA 2ZRVA 3DAQA 3UWVA 1DQXA 1WBHA 4Z1DA 3TC7A 2JBMA 5LGZA 2WO5A 1YTDA 5EL1A 3DHDA 3O07A 3WK3A 4RKAA 3DFTA 1ME8A 5DBUA 4Z1AA 5IM51 4HNVA 4NX5A 2WSRA 5CPMA 3FFSA 3LDVA 4MJMA 2PRHA 1Q45A 4HNTA 2RDTA 5FEPA 1JUEA 3QFEA 5G2WA 3S1UA 3LXBA 1XDMA 3S5ZA 1ADOA 4LVFA 5HINA 5CG7A 4MZYA 1VLIA 4BWLC 3W7CA 3EKZA 1W8SA 4L4LA 3EWXA 4S2BA 4IMDA 3TJXA 2UV8G 3TR2A 1FDZA 2GVGA 5DN1A 5D02A 3KVJA 4WY0F 1OYCA 1LTDA 5AOUA 2CLHA 4JX4A 4NNBA 1YYAA 4UFJA 5J5RA 4MLJA 3B0VC 3T78A 5HQEA 3MWAA 4O19A 3EX6A 4N02A 1JQXA 3H55A 1XBXA 2G95A 2GJNA 3INPA 3S5NA 1GVSA 2Q3OA 5AHFA 1O95A 3W73A 1L6YA 3T44A 3TMQA 3S42A 4MY9A 6TIMA 5D2YA 5A8GA 4X9SA 3DI1A 4FNRA 4UFKA 4Z1BA 4I9AA 2DZXA 3L21A 1QR7A 3N34A 4I7VA 4JD4A 4O57A 3MP3A 3JRKA 1F74A 4RK8A 4GRSA 4FXRA 2RHGA 3PBUA 4NUWA 4GXMA 3DFQA 2Y70A 4NNCA 3N9SA 2H8XA 3NPUA 1WA3A 3S5YA 4GBUA 4O12A 1LP6A 1ICQA 2ATMA 3MBDA 1Z44A 3EX1A 3LXAA 3QF0A 4QQ3A 1AG1O 2CFFA 5TBOA 4OWGA 4IMEA 2WJZA 5G4EA 3HBLA 4Y9AA 4FEZA 5AN7A 4RXFA 4M6QA 4RR4A 5CKSA 5CPNA 4UTMA 1PE1A 2NLIA 3OVQA 3M1ZA 1GJPA 4K38A 4JEQA 1TPC1 4CNNA 4WOZA 3RF9A 4BI6A 3C56A 1OK6A 4QIUA 4OQVA 5KZMA 1H60A 1F73A 3GNNA 4FX7A 4JTEA 1EB3A 2Y62A 5AC6A 4YLWA 3I7SA 2W6RA 3P60A 1H7PA 1P4CA 3TW6A 3H54A 3TJLA 5KMYA 7TIMA 5D2WA 1XL9A 4Y6GA 4MYAA 3W7NA 4ZL1A 1X6UA 2Q8ZA 5BNKA 3W85A 5LZLA 5K4ZA 2E09A 1FCQA 4N2YA 3NG3A 3A9IA 4MVAA 3M5YA 4O1DA 4R7JA 4FO4A 2Q8LA 1XFBA 5C55A 3MP4A 3T7VA 3QC3A 4ONVA 1ZENA 1BKSA 3DZ1A 4JTHA 3GDRA 5BRBA 3B04A 3IVSA 4NXKA 4FIRA 1KLZA 1NF7A 3FYOA 1VC4A 1VH7A 5HULA 3CWOX 2ZRXA 3ABSA 3W7IA 3NZRA 3SI9A 1P5BA 1ZAIA 1WQ5A 3HGSA 5EMUA 2CZDA 4K6AA 3CTLA 3G1DA 4AHPA 1HG3A 4O16A 1BTMA 1KTCA 1SZEA 3LTYA 2CLFA 1OX4A 3A5FA 5FEZA 3W1LA 1W3TA 3BV4A 4ADSA 2CLEA 2V5BA 4IWWA 2OT0A 4JY8A 1KV8A 3FJ6A 4DXVA 4A29A 3SECA 3MHUA 1QDSA 1VZWA 4ADTA 3OA3A 1W37A 1LBMA 5I3KA 4RX0A 1OK4A 2DP3A 4N6FA 3P8IA 4WOQA 3P81A 1A53A 4EOUA 3L0NA 1X7FA 1IXOA 1IXNA 2E68A 2V30A 1WOAA 5SWUA 4FX6M 3M5ZA 1FCVA 2NXGA 5H91A 4JGDA 4NJJA 4WZHA 4LC6A 3LBCA 3LHUA 3GK0A 2R8WA 2VFGA 4O18A 3WFAA 1B57A 1H5YA 2NX1A 4ZQOA 1G7VA 2DZWA 1C29A 5HNRA 4LY8A 5F4XA 4JIPA 4QJ1A 3VE7A 1KBJA 1TPEA 1TJRA 5FEWA 4AHOA 2E6AA 5FI8A 4YCPA 3RLVA 2FB3A 1PHQA 2ZZ7A 1JCXA 2DZPA 3EWUA 1YDOA 2A6LA 2XN1A 5ABTA 4M6PA 3EWYA 3P62A 4YXGA 1EA0A 1FWNA 4DF1A 1WOBA 3W1QA 3MYPA 5K4XA 1ICPA 1QFEA 2BTMA 1H51A 1SFJA 3HMJG 1GG0A 3P5ZA 4AXKA 4MLRA 5DY3A 1OFEA 3PUOA 5AYZA 2PRMA 3E12A 4IQLA 2A6NA 1WYIA 3ELFA 4LT9A 2X16A 2HS6A 4JX6A 1WBJA 5DY2A 1Y0EA 2B4GA 4UFMA 3E0IA 1VCGA 3S8HA 4CNOA 2YW4A 1OFBA 4H4IA 5LHFA 3EX3A 5U7SA 1O5XA 2J27A 2AGKA 2NV2A 4EIVA 3QH2A 1EPXA 3BK0A 3DFSA 3LLDA 5G2IA 4DO6A 3T55A 1QCWA 3QSTA 4NXSA 3TNOA 3UD6A 4O52A 4GUGA 4O11A 4FX8A 1G69A 5DCDA 3S1VA 2CLLA 3R12A 3U2OA 3UWUA 1SSGA 3IIZA 3W9ZA 1FXQA 4PC8A 5D04C 2BSLA 3O05A 5EBUA 3DFPA 5A5WA 1PV8A 1SZFA 4Z0SA 1KM1A 3G0XA 5I3FA 5E1QA 1JCNA 4MFDA 2VOMA 3CHVA 3GR7A 1SO5A 4UTJA 3R5EA 3W1MA 4FB7A 3LCWA 1H62A 1M7PA 2VFIA 1B4KA 5H2ZA 2EKCA 2VFFA 3NPVA 1CW2A 3QM3A 3PY2A 3TAOA 4OU1A 3KVKA 3C3NA 3FOKA 2A21A 1JJKA 1HL2A 2CLIA 4PL1A 5C5YA 1KBIA 1OX5A 3RLUA 1I2QA 3O16A 4AF0B 2CLOA 3SSJA 1PL9A 5AYYA 3S1XA 1H7OA 3PS7A 3WJXA 4OGZA 3LBMA 3OG3A 4GUIA 2J9XA 4DEFA 4PFMA 4I7UA 4ZQRA 3O6CA 3KX6A 1KFEA 2CZFA 3PBYA 4EF9A 1BWLA 3RFAA 3HIJA 4UTTA 1T99A 4WD0A 2OMAA 1OYBA 5E93A 3C6CA 4Z1CA 1KM0A 1NEYA 1VYRA 5KINA 4K7VA 3W2UA 4NJIA 5KZDA 3W7LA 3M16A 3CB8A 2DJXA 4YWIA 1LDCA 3PBVA 3TUUA 3BW3A 4KWWA 1FY6A 4UTWA 1R2TA 3LRKA 3M6YA 1DBTA 1D3HA 1JCJA 1F7BA 4LVDA 3W74A 2ZA1A 2HMCA 4H3DA 5F4WA 3GAYA 3G1VA 3W1XA 2E5CA 1OX6A 4O14A 4TMBA 1I8JA 4M19A 1OYAA 4NVTA 3TCEA 3R8RA 3O6YX 4JXCA 3E9AA 1TMHA 3DGRA 4BF9A 1BEUA 3EXSA 5I3GA 4L4MA 4IX2A 4UTIA 1I2NA 1H7WA 3PG8A 5F1UA 3G1SA 3LB0A 2NXIA 4PH6A 3B4UA 2A2IA 3G1AA 3KVMA 2QJGA 2Y63A 1H1ZA 2C1HA 3GLCA 4RCXA 1YXCA 1TPDA 6ALDA 4A3UA 3PF3A 3BG5A 3G1XA 4ZQMA 4MZ1A 1A5CA 3CEPA 3W7DA 3THQA 3EWBX 1I4NA 1UCWA 3BLFA 3STEA 1DHPA 3PB0A 3W1UA 4R34A 1QOQA 5U4NA 1ZCOA 1EX5A 1RD5A 3HGOA 5LGXA 1TCDA 2YCEA 2Z0IA 2QR6A 5G1YA 3WJSA 3FYPA 4M7TA 5K9XA 1UJPA 2C0AA 3P7YA 2C6QA 1UBSA 1SQ7A 3DH7A 1U83A 3TW7A 1ZFJA 2R91A 1R2SA 1W54A 1SSDA 1LCOA 1QOPA 4CNPA 1Z42A 3GDLA 5D09A 3C2VA 3L5AA 2RDUA 1YADA 1CI1A 2NXHA 1DVJA 1TIMA 1MEHA 1TPH1 3SR7A 4H6KA 3LTPA 2OCZA 3F1QA 3HJZA 1GYLA 4QNWA 2CLMA 4UXDA 1KFBA 3SJ3A 3BGGA 1W0MA 4QSHA 3P61A 4UTLA 1UASA 2WKJA 3LCHA 2GUUA 3UXAA 3FS2A 3VI2A 5DXXA 5HR7A 2XN2A 2V5LA 2NX9A 1KFKA 4LUIA 4PA8A 4MOZA 4TX9A 1G7UA 3DU0A 3M7WA 3HGJA 2ZZ5A 3CM4A 4G1KA 4KFOA 2YXGA 3B0PA 1T8XA 2E1DA 4AHQA 2VFEA 3TXVA 3P84A 2GQ9A 3NZ1A 1MO0A 2ZRUA 5AC8A 2TSYA 3MI3A 1XBVA 5DELA 4YL2A 1U5JA 5CZSA 2J88A 1LOSA 2GQ8A 3NQ7A 3LOTA 4MFEA 4I7WA 2P0OA 5DCBA 1QPOA 1X1ZA 1QAPA 2ZA2A 5HUPA 4UUIA 1OFDA 3BG3A 1MXSA 1K03A 3NR0A 4IMGA 3WK1A 3L9CA 4JTGA 1VRDA 5DLCA 2VEKA 2EF9A 1I2PA 1S5TA 3GVGA 4TR9A 5KZEA 3A5VA 2HS8A 3CIXA 4XUGA 4O4WA 3WJYA 3LCIA 2O7SA 4K7YA 4XKYA 2GQAA 3IGUA 4NNAA 3PC0A 4BFAA 3LHVA 1FXPA 3UY7A 2F84A 3UQNA 3NL3A 3PUEA 3N2XA 4Z08A 1QO5A 2ALDA 2CZ5A 3W1AA 3TV8A 4PODA 3S6DA 4GWEA 1H7RA 1LORA 3TKFA 4D2JA 3QEZA 1RVGA 3N14A 2AQWA 1RR2A 1YLVA 4AWUA 1YTKA 3K30A 4RXGA 4NJKA 1JUBA 3ABRA 1W5QA 1MZHA 3F4WA 3W84A 3LLFA 3TQ0A 2RDWA 4FNSA 5D2TA 2RH9A 1NVMA 4LNYA 4GJ1A 1K7FA 1KFJA 3W88A 3GAKA 3KRSA 3GKAA 4LU0A 5AHEA 3TQVA 2QDHA 1XUZA 2QAPA 1EP2A 5F2MA 3IGXA 1KM6A 5FF7A 3VNDA 2FPTA 4IXHA 5HWMA 1TV5A 2JGQA 3B06A 4R33A 5AYXA 2Y89A 4U28A 2C18A 4CQ8A 4CCCA 3LXCA 5IBXA 1GVFA 3C61A 5BMXA 1QPNA 1FWWA 3MUXA 4UTKA 2QDGA 3IVTA 1K8YA 2E5DA 5AHMA 4BI7A 4AF0A 1M6JA 3TMLA 3IGSA 3N3MA 2E6DA 4DQWA 2JKPA 3C2FA 2ZZ3A 2WNQA 1Q6QA 4ICNA 3NEVA 2A1YA 2ZTKA 2VEIA 4N9DA 3M47A 3P74A 1KW1A 3L68A 2TPSA 3IEBA 4O50A 4E2DA 2H90A 2Y7DA 5AHNA 4IMCA 4WY0B 3TDFA 2QJIA 2DU2A 2VC6A 1RQEA 4Q4KA 2JKAA 4K8HA 2C15A 3L0KA 2FJKA 1SR9A 3ZWTA 4ALDA 2FIQA 1OG0A 3ATZA 4LRSA 5FF4A 3OEXA 1VGAA 1AW2A 3WJZA 2A7NA 1W5MA 2VXNA 3HPZA 1PIIA 1XDLA 4JYFA 1WX0A 4FXSA 1SO4A 3HF3A 1JRCA 1YDNA 2I1OA 3M5VA 4JR5A 1SO3A 2BWGA 3MJYA 1G67A 1C9DA 4FHAA 1AL7A 2QKFA 1LYXA 2TRSA 1JCYA 3LTSA 3N9RA 3I7RA 4LV4A 1DQWA 1F2JA 2V81A 3W1PA 4JS3A 2ZYFA 5HJLA 3DFOA 1IIHA 3W83A 1O60A 4AEOA 2ZZ2A 3NQ2A 4JY9A 3GXTA 2PC4A 3NQ6A 2GPTA 4QNEA 5FEXA 3NM1A 2J24A 1QWGA 4GE8A 4O8RA 1MEWA 1D9EA 3EKLA 5K9DA 4KWVA 1H7NA 3NOEA 1GVOA 3OVRA 1N55A 4XQ6A 5G5IA 4XBSA 3TSMA 1VR6A 1YPIA 3BGJA 2QAFA 5E0KA 1A50A 4XTIA 4DPPA 2Z6JA 3NQAA 3QRHA 1G4TA 1IXQA 3FKRA 2ZZ4A 3BLEA 4IXXA 2OT1A 3LV5A 1EUNA 3AO0A 3GX9A 4RJEA 5LNRA 1SW3A 2QCGA 4HKPA 3HPXA 1OHLA 4GUJA 1S5WA 3F4NA 2E6YA 4MUZA 1GWJA 3W6YA 3TFXA 3NQFA 2QUVA 3C2OA 2FQIA 2PE4A 2B7QA 3W7HA 3NO5A 3O6DA 1SZGA 1TQXA 3N2MA 4X3ZA 1KV5A 1NFBA 1EP1A 4HT3A 1RQBA 2X1UA 2C16A 4JTJA 4XTDA 4NJHA 4N4QA 2ZZ6A 1NSJA 1GEQA 2J9YA 2QUUA 3ANYA 3QMRA 2DZUA 1TPFA 2YW3A 3SIZA 2VFDA 4CQAA 4LV9A 2WSQA 4UR8A 1ICSA 4O15A 1ZHAA 1H61A 4R53A 2YPIA 2ABAA 5FESA 2B0MA 4BK9A 4MYXA 4AWSA 5EPDA 5DCEA 1ONRA 3GZ3A 4C1LA 4IPIA 4MIMA 2V0TA 3B03A 1F6KA 2YYTA 1TPB1 1W1ZA 1KM4A 2WSYA 2DZSA 2Z1BA 5HMSA 4LTSA 2VFHA 2WV8A 3MP5A 1T0OA 1QNVA 1ZAJA 2ZQ0A 4TU1A 3UPBA 1KFLA 3HG2A 3TSBA 1WXJA
chains in the Genus database with same CATH superfamily
4FS9A 2AAAA 1R47A 1Z6KA 2E3ZA 2QCNA 3WJWA 3DEQA 2QULA 2QEZA 1DP0A 4J2PA 3FDGA 1J01A 3S9YA 2XVPA 1IEQA 5I77A 3UA3A 5TQLA 4J3UA 4PTNA 2VGBA 8RUCA 1NAL1 1QW9A 4ORMA 1VBHA 3M0HA 4JQAA 5B7ZA 5EFDA 3OVGA 3GB6A 3GDBA 3LMYA 1RHCA 2J4GA 2A85A 2ZBTA 4ZTYA 1E43A 5IXEA 2J7CA 4GJJA 4ACZB 1A5BA 2D23A 4JTIA 1ME7A 3DFYA 1NQKA 1M03A 2HTMA 3BC9A 1THFD 3NQ8A 3T42A 1ISVA 3C5QA 4PRWA 3A6OA 2TMDA 2FVKA 3ZLGA 4ZZ9A 2IQTA 1W3LA 1MDRA 3NPXA 1LL7A 5BOOA 1XBYA 2Z1XA 1CLXA 3BPWA 2PSNA 3W2MA 4KEMA 3BLIA 3I7QA 3THCA 4DZIA 2W91A 1YDYA 1FWDC 2H8ZA 3TA6A 1Q6LA 5BOFA 1XYAA 1IT0A 1ISZA 4GXWA 1EWDA 3REQB 1N82A 3MMDA 1J4EA 1W3KA 2NUXA 5HUOA 3CPGA 2YCJA 1QW8A 3CT7A 2IXUA 4GFIA 2R1MA 1GTEA 3NVTA 2AL1A 3OZPA 3KUMA 1I60A 3W1NA 1N8FA 3GXFA 2OO6A 1JYVA 3W1RA 2VRKA 4K8GA 3G2GA 2FDSA 1VIZA 3W76A 4GGHA 2WMKA 3JZUA 5FSDC 4N9EA 4W5UA 1C8QA 4B16A 1Z32X 1Q7ZA 4GH1A 3JS3A 4Q33A 4W5ZA 5EKYA 4DXKA 7ENLA 1W5OA 2Q3RA 1DJQA 3G3DA 5E6ZA 4WDWA 1N8WA 2FMNA 2AOSA 3PAJA 2FVMA 4WHBA 1O5QA 4E2BA 4XBJA 4MB4A 4POCA 1KFWA 1PVNA 2PD9A 3BSMA 1JZ2A 1OGGA 3GTHA 1XUUA 1SJDA 5CPOA 3F2DA 1PTAA 1XGDA 3CV7A 4WXZA 5DEZA 3VIOA 5D2XA 1JCMP 3L5MA 3MV11 1B9ZA 5DX7A 4L5ZA 4FF7A 1V6TA 1CGXA 3G6MA 3RPTA 1POKA 4A22A 4Y2WA 2CERA 3W2JA 4IT1A 1POJA 1QNQA 2XIIA 2I9EA 3TW9A 5GPRA 4GKLA 3MMTA 5JUVA 3D6NA 3V0UA 5C6MA 1WKFA 3M0KA 1H1YA 2HNEA 3LRLA 3SFWA 2XGZA 2VEFA 2X2GA 5MKGA 3MANA 1JPMA 3WMBA 1FWTA 3RRXA 3S9IA 1TV2A 1KFCA 2QUMA 3BUVA 3T9PA 4C1NB 1IEXA 3C52A 3WDPP 3IIPA 4AQLA 2D20A 5HANA 4S3BA 1V93A 2WMIA 2JF7A 4BA0A 4C6KA 2DJLA 4DZ5A 3GO2A 3O63A 1ZBWA 3RHGA 4AZHA 3KFTA 2E8YA 1HZYA 3PNUA 4WSHA 3BQ5A 3OZYA 5C2GA 3FV9A 4PUWA 4AZCA 5M17A 1VJIA 4S3EA 4LY4A 1SW7A 5AC7A 1FRBA 1A47A 3T0AA 3KDOA 1PCWA 2PU0A 3LHTA 1GZGA 3F5JA 4BQ2A 2D73A 3WLQA 4PUDA 2OZ3A 2GFTA 4GQ0A 1EDGA 3BICA 4GK8A 3U6WA 3TC6A 2GK1B 2BXZA 4Y8FA 1YPFA 2H3BA 3QW3A 2BDQA 1O1HA 4GNKB 1VP5A 4PULA 3CL7A 3E02A 1U1JA 5D4YA 3R25A 3K4DA 4D6HA 4XKMA 1ZCCA 2FDMA 4DVOA 2QPUA 2I57A 3VDAA 1QNRA 2HBXA 3UY8A 4D6FA 5LNUA 2A7RA 4EVZA 4YVVA 2CKSA 3GQYA 4DWSD 1S2UA 2GLKA 3KZPA 4G8TA 4M5PA 1HW6A 5XIMA 1ZALA 2PGRA 3O15A 2NSXA 4O1BA 3W2NA 5I3HA 3KLLA 2WPBA 2X2YA 2HV5A 3EEGA 2G96A 2YSWA 2OZ8A 2JEQA 1RV8A 3RCYA 4AY7A 4K37A 3PVFA 1TSIA 4Y96A 5LA1A 3T81A 1BGGA 1W5NA 3HPFA 1CTNA 4XB3A 2ZDRA 3NQEA 2W79A 1ONWA 3MMUA 4E2OA 2DW6A 1DE6A 5L9FA 4MF4A 3VOFA 1UZ1A 1JR1A 3V0SA 3MW7A 2AL2B 4F0RA 1ODUA 4HNUA 4DWSB 2QCDA 5TF0A 4HNCA 2IQDA 2WK2A 4E8CA 3NQGA 1FDJA 1HL8A 1IT8A 3L4VA 3C0JA 3L2IA 1PEZA 2CCRA 3TNBA 1G01A 4UTUA 3FEQA 3GFYA 1TIWA 1U1UA 3FHAA 2V3FA 2W62A 1TJ0A 3TAKA 1C8VA 2O9RA 1OC5A 2G3FA 3L4XA 1W3JA 3NJ3A 1E73M 1OZQA 2R1PA 1T96A 2POZA 1TB3A 4A2SA 1XGEA 1GZJA 3NSXA 5J8LA 3SM0A 8TIMA 5AZ0A 2HSAA 5CC6A 5LNVA 3HM7A 4H7VA 1XLKA 3O1NA 4WLCA 3A21A 4GKTA 3W81A 4B4HA 2G5WA 1GW1A 3LCXA 4HHPA 2O92A 5CZ0A 1XIJA 3NA8A 4GXPA 1XBZA 4H9VA 1V02E 1NU5A 2XIQA 1OFOA 3NL5A 3WDHA 3N73A 3HG4A 2E5BA 1ME9A 3LM3A 1DJNA 4E8GA 1ZRQA 4JQ3A 2MANA 3FIGA 4MAVA 4XD5A 2GGGA 7TAAA 3IVUA 1F8MA 1X96A 1QPQA 5HA7A 3GH4A 3L65A 3F4VA 3CL8A 1UWSA 3L5LA 2Y7GA 3FW6A 4Z42C 1XIFA 4AC7C 1DEDA 4GZIA 4PRTA 3PHAA 2O4MA 1Z8AA 1BVWA 3B8WA 2GWNA 1OVDA 3OHIA 3FXYA 4H04A 2IUZA 1YMYA 3TQKA 3EXRA 4RNIA 1P1XA 2Q8XA 4C6LA 2HVNA 4OV9A 3IK2A 4XZWA 4K68A 5E9AA 4PTMA 3IACA 5A69A 2BV9A 4C1KA 3SY1A 3QY7A 1HKKA 1PHWA 1I45A 3RX3A 4FA3A 3RN6A 1UIOA 1NP0A 4NL1A 4NG3A 4QDMA 2I9UA 2JEPA 4M6UA 4OJYA 1B0IA 3TYDA 4QS6A 2NUYA 3E49A 2B7PA 5J04A 4W7WA 4LJ3A 4C7GA 1QPRA 1UUMA 3CQ0A 3H2OA 2OSWA 3SRKA 5CGQA 1IWBA 2NX3A 3HQ1A 4ASTA 3U8GA 2ZTJA 4PMJA 4ORIA 1GOXA 5LNWA 1QWKA 4LYRA 3ORWA 1OF8A 5D8ZA 2C19A 3TFCA 1RA0A 4LWWA 2WCAA 2XFWA 2FH6A 1V3IA 3CLMA 2PODA 3CO4A 2WZEA 5K3VA 2HK0A 3RMJA 1P0DA 2DH3A 4UMBA 4GIRA 3EOUA 5BRPA 3MZ2A 5M1TA 2XWDA 4W86A 3GNRA 1UUOA 5LSMA 4U5IA 3IV8A 2PLKA 4FR6A 3WQ5A 4ERIA 3KOYA 4IJBA 1UBPC 1TUFA 3UW6A 3TE9A 4JNZA 3WLJA 3ZT5A 4AAJA 2BY0A 4F66A 3VDCA 5EMJA 3B97A 3MDWA 2X1RA 4N4PA 1QI2A 5CGTA 3EDEA 4QE4A 3M41A 1Q63A 4O4VA 3LU2A 3KBJA 4NSBA 1R30A 2I14A 4RL3A 3B3DA 4JL2A 3R2GA 1JULA 1T6MA 1UHVA 3OQ8A 3ZFHA 4R7WA 1G4PA 1MW0A 4IUGA 5D30A 3ZWSA 3W7MA 4O1FA 3WX7A 5HK4A 1TZ9A 4UMCA 1BWKA 1UIPA 1R3SA 3IUIA 3BW4A 4P8XA 4MWAA 4GNJA 3FJ4A 5KSWA 2YYUA 2QCCA 1R3WA 3QZAA 2VWTA 2WM1A 1IIGA 4UC5A 3QVQA 4TO8A 5HNTA 3VIHA 3CMGA 2IKGA 4GO9A 4J3SA 3HA1A 3VD9A 4GMEA 2HVOA 3VD4A 4HNNA 2ESCA 3BLLA 1YTEA 2VKZG 2FLIA 3BOFA 4ERAA 1Q6FA 4EX4A 3AS3A 1KM2A 4AVOA 2O55A 2YCLB 2QMKA 3NOYA 1IWAA 3WLTA 3SQMA 3DFHA 1A3HA 5EGRA 3NO1A 4BKNA 1R9XA 2BOFX 4AVFA 3GU1A 3UG5A 4EAMA 1F76A 1C7SA 1AMYA 4QISA 3I6RA 4NT0A 3LCGA 3K1DA 1G6CA 3CPRA 5I3DA 1KD0A 1WZAA 1XI3A 4AD2A 4UNKA 3QQWA 4NAFB 4B5NA 4LUJA 1JF5A 5LNSA 1P0NA 2G3MA 5ABHA 4J9JA 1OCNA 3W75A 3OLDA 4I5UA 3N6JA 5HWJA 5KTLA 4HPJA 5D05A 1EDQA 3V1HA 4C6FA 2I16A 2V5KA 1V3KA 1W91A 5G1TA 5E70A 1HFBA 1A0DA 1FBAA 3UPMA 2OG9A 2RGMA 2DY3A 1WAUA 3QC0A 4UQ9A 4MUPA 3T07A 1TVNA 4CEXC 3WDJA 1A4LA 3O07A 4RKAA 5IM51 4XD4A 3AXIA 2WSRA 1CXIA 1EHAA 3M07A 4CQBA 5CPMA 1CECA 4MJMA 2PRHA 1Q45A 4HNTA 2G41A 3ITVA 3PK7A 5G2WA 2DT0A 3U2CA 2D2OA 4HYRA 3ZR6A 3W82A 3FXGA 3S5ZA 1ADOA 3U2EA 2OGYA 4HGXA 1H0IA 5CG7A 4W7UA 3U3HA 4BWLC 3W7CA 2ODOA 1MNSA 3EWXA 3GRIA 3QR3A 5A8OA 4IMDA 5D02A 5DN1A 2PU1A 4WY0F 4XZBA 1OYCA 1BXCA 1H5VA 1W6TA 3E0VA 5CAHA 2CLHA 3AYSA 3T78A 5CPQA 2QGYA 4O19A 2WLYA 3QLLA 4N02A 2EKGA 1AH4A 3IUDA 3OLEA 3TMQA 5D2YA 4DJDD 4Z1BA 3AIRA 3I6TA 2ZUMA 4JD4A 4O57A 2FTWA 3MP3A 1W9PA 2X1IA 4LAZA 4Q6JA 2ZUTA 1M65A 1F74A 4GC3A 5ECUA 3S1GA 3UGRA 1CXEA 4L9XA 4PE8A 2F2KA 2ZXBA 1RD6A 1VFTA 1YBQB 4GXMA 3N2OA 4LB4A 2H8XA 3CYJA 5A6JA 1WA3A 3OP2A 1LP6A 2ATMA 3TWAA 1DJXA 1NELA 4RDZA 1SZRA 4IMEA 1JGIA 5A6AA 5G4EA 1ZBVA 1Q2RA 3NDZA 4ZENA 4FEZA 2CBUA 4M6QA 1CNVA 2UY4A 5IFPA 5IHSA 5CPNA 1REQB 4GIAA 3RLGA 2D3LA 1ECEA 4ZB0A 5HXMA 3GG1A 4JEQA 4P7QA 4WOZA 1PZ0A 4BI6A 1OINA 1QI0A 3VIMA 4DWSC 3AAMA 1EIBA 3AS0A 1PWLA 5C7HA 4FX7A 1B3VA 4JTEA 5AC6A 5EMKA 3I7SA 1UG6A 4NILA 1H7PA 1P4CA 3H54A 4C6PA 3VD3A 3OGRA 5FJOA 4MYAA 2Z2BA 4XK2A 5BNKA 5FA5A 4PUJA 4M3PA 1R0MA 3OB8A 3M5YA 4O1DA 2WVTA 1JEZA 1RP9A 2P8BA 2GYIA 2XH0A 3T7VA 2A3AA 1TE1A 4XISA 1ZENA 1BKSA 3GDRA 4Q8VA 4H2HA 3IVSA 1A0EA 2OODA 3RG6A 2A79A 4HMDA 5HULA 3CWOX 2ZRXA 1XG4A 3NZPA 2Q6ZA 3CJPA 2ZDSA 3W7IA 1BWVA 5I09A 1P5BA 1ZAIA 1WQ5A 3HGSA 5FIPA 4JAWA 2CZDA 4K6AA 3G1DA 5A3HA 3LTYA 1OX4A 2BS9A 3A5FA 1Q4NX 1M04A 4OKDA 4D9PA 3BV4A 2V5BA 1P43A 2OT0A 4RDYA 2G3JA 4DXVA 1LT7A 3SECA 1VIWA 3MHUA 1QDSA 2PC8A 1W37A 4IGMA 5JIPA 4N6FA 2ZXAA 1CENA 1AQMA 3P8IA 3UF9A 4E4UA 3CK5A 4GOAA 3EB3A 4KEVA 1V4YA 3SCTA 4FX6M 1JL8A 3ITTA 4GVGA 4KT2A 1MI3A 1MXDA 1F3TA 1CXKA 1SFSA 2R9RA 4O18A 1YEYA 3CZ8A 3ZLFA 2NX1A 1W1B1 1Q85A 2DZWA 1C29A 5HNRA 4GYPC 3PZGA 4JIPA 2RJHA 3VE7A 2VI0A 4UOQA 3H4GA 5FI8A 2FB3A 1PHQA 3TYUA 2A6LA 1GOIA 4M6PA 1ZP4A 1FP8A 4FLRA 3P62A 4NF7A 4TX8A 2PDHA 3KBWA 2XISA 3UG8A 1TG7A 1ZZMA 4QROA 4H6RA 3GXDA 3P5ZA 4AXKA 1HP4A 3PANA 4H8VA 1WYIA 3ELFA 4DBSA 4LT9A 2HS6A 1VJZA 1WBJA 1GW9A 2PDYA 3U57A 3MVIA 1TKKA 2YW4A 1OFBA 2J27A 1DXEA 1H41A 5G2IA 5FL0A 1QCWA 3QSTA 3K46A 4O52A 1E9YB 1BLIA 4O11A 5DCDA 3M0LA 4KRUA 3S1VA 1UR0A 2R1KA 3U2OA 1MUWA 1WUFA 4GQGA 3C0QA 1GK8A 3I6EA 4W88A 3D3FA 5BYWA 5CLWA 3RDKA 1WZMA 1PV8A 3OGVA 3PZTA 5E1QA 1FWJC 1AD4A 5A6KA 3CHVA 4ZXLA 1JDDA 4FB7A 1H62A 4Y9NA 3GG0A 2ONEA 5H2ZA 2VFFA 2PTDA 3KVKA 5FJJA 4F9DA 5C5YA 4J3WA 3ITOA 4D72A 1OX5A 1I2QA 3O16A 1FH9A 3A3HA 2CLOA 4A3RA 1PL9A 2YA0A 4ZOBA 5AYYA 1EZWA 1H7OA 3ARYA 4OGZA 3LBMA 4GUIA 4DEFA 2WM0A 1BG4A 3U2ZA 4ZQRA 1RJRA 4Z2IA 3W01A 3O6CA 4WJXA 3IANA 2OTDA 1M1BA 3ZOAA 1OIFA 4CD7A 1KRCC 4JCLA 1OYBA 1FFRA 4MJ4A 4Z1CA 3WQVA 1EC8A 1XG3A 4I5XA 1P1MA 2DJXA 1LLOA 4AIUA 4HP5A 4YWIA 4IZGA 4OVXA 4KWWA 1OCJA 3M6YA 3SGGA 1IZCA 2HMCA 4L9ZA 2R82A 3GAYA 4MDOA 1K9TA 3W1XA 4HK6A 1XRVA 2ACRA 1YE6A 3IJIA 2E5CA 3E1F1 1XF0A 4LCSA 4HNOA 4QSFA 1NIUA 1QASA 1OYAA 5ENLA 3E9AA 1BEUA 1KGXA 2IS7A 4FF5A 2DVUA 5I3GA 4V2XA 2J13A 4UTIA 4AD5A 2PGEA 3IUHA 4V33A 2A2IA 3IARA 4U3AA 1YXCA 4Q8UA 2AMXA 3D5HA 3UR5A 3BG5A 1DTNA 3W7DA 3THQA 3OQEA 3RX4A 3H12A 3OA5A 3ARSA 1K9FA 4PMOA 3IJDA 1V8EA 3STEA 1W9BM 1S5NA 3KBNA 4RDWA 2XDFA 1XQKA 4R34A 3MY9A 5U4NA 1XIMA 2I17A 2QR6A 1LL4A 5G1YA 3FYPA 1VD6A 4JTCA 2GJRA 4BHYA 1UJPA 3SCPA 1UWIA 1E72M 1UZ4A 1ZFJA 1UQYA 4W8LA 3ANVA 4J2MA 4HCHA 3AZRA 4XSMA 2OQYA 1QOPA 1LT8A 1HKJA 1R9YA 4B3KA 2RDUA 1XPGA 4HMEA 1YADA 2GDVA 1DVJA 1TPH1 3SR7A 1UPMB 3UR7A 3LTPA 1FHUA 4F4RA 2O0TA 2WHKA 4QNWA 4UXDA 1KFBA 4JFVA 1BF6A 4QSHA 1R9ZA 1L2QA 2GUUA 5AECA 2DDXA 2NX9A 1QJWA 2PP3A 4PA8A 3H2MA 6ENLA 4MOZA 3M7WA 3HGJA 2V3EA 1XRFA 2ZZ5A 4G1KA 2YXGA 5C9ZA 3CS2A 3V4BA 2EPLX 3D3AA 1MO0A 2ZRUA 2TSYA 4XO7A 2VO5A 3MI3A 1XBVA 1IR2A 2GQ8A 1V6UA 3LOTA 3LGDA 3CUIA 2PWDA 3VUSA 3AROA 3BG3A 1EA9C 3L9CA 6A3HA 3WEMA 2EF9A 1S5TA 2J6VA 3EOSA 2ZUUA 1XSJA 3R4IA 4C7DA 1FHLA 3WQ6A 3B8TA 1JI1A 3CV2A 4ZE4A 3LCIA 3HTWA 3P14A 3IGUA 3EPNA 2VJXA 3UQNA 3S3GA 2A3CA 3TV8A 1KXQA 2X0SA 3S6DA 4YIWA 3QGAC 4ML4A 3TKFA 3ZJ8A 1QNSA 1J10A 3N14A 2AQWA 1O5RA 4AEFA 2E9MA 1JUBA 4NJKA 1QRQA 3H8AA 5LIWX 3E0LA 4N7QA 2QJJA 2R24A 1KFJA 4A8IA 2WPGA 4Z2LA 1I1XA 3CAWA 3MV01 2Y89A 2DVXA 1VBJA 5I24A 3LXCA 5IBXA 4HU3A 4ACYA 5EB8A 5BMXA 1QPNA 1YRRA 4UTKA 2QDGA 3WQ4A 4BI7A 2XM2A 1XRSA 1M6JA 3TMLA 1CGUA 3R0UA 1RH9A 2OWWA 1Q6QA 3VDGA 2VEIA 4A8LA 1EYWA 3WL0A 4O50A 4E2DA 2V5DA 5HJYA 2GGEA 3SBFA 3DESA 1DJGA 3DERA 1Q13A 2QJIA 2VC6A 2YXOA 5HMFA 2JKAA 2FZ8A 3L0KA 3NSMA 3CHCA 2FJKA 4ALDA 3ZWTA 4DJDC 4PMZA 1W1YA 1FTXA 1ISWA 4HTYA 1AW2A 4RUBA 2A7NA 1W5MA 2DEPA 3W26A 3AHXA 1B54A 4FXSA 1J18A 3BXWA 1SO4A 3RCNA 4F0HA 3HF3A 1JPHA 1RBOB 3H2AA 3EPMA 2I1OA 2WKGA 2BWGA 2WHLA 2PDPA 4B3ZA 1VEMA 2QKFA 1EL3A 1LYXA 2BOGX 1U33A 3WZ0E 3ARTA 3W83A 4AEOA 2OQHA 4M0XA 1WDDA 4C6IA 1NWUA 3ZM8A 5BXSA 4O8RA 4L9YA 4KWVA 1GVOA 2ZE3A 1A0CA 3I3DA 3TSMA 2QAFA 5CC3A 5I06A 2OEJA 3IRSA 1A50A 1WDRA 4DPPA 2Z6JA 3T1GA 3THDA 1FWBC 3Q4DA 2VR5A 1HF6A 9CGTA 3N29A 2CNCA 3AO0A 4RJEA 5LNRA 1SW3A 1UOZA 4FAMA 3VZXA 1S5WA 3F4NA 2E6YA 2DSVA 1Q66A 4E6MA 4PR4A 1JNDA 2B7QA 3W7HA 2CWXA 4B90A 3AIBA 4I3GA 5A8MA 3TN6A 4X3ZA 2WMJA 4GZ7A 5EMMA 3CLWA 1EP1A 4JTJA 5CJ5A 1FH8A 1NSJA 4RV3A 4H41A 1FH7A 1NWSA 2DZUA 2RDXA 1BG9A 4X2PA 4CQAA 5MKGB 1EJSC 1ZHAA 2ABAA 4C6OA 2B0MA 1LQ2A 2QW5A 5DMNA 3ZYZA 1QHZA 1XRTA 3TZFA 4EPBC 1ONRA 2V0TA 1EQCA 1CPUA 1F6KA 2YYTA 2WMIB 4X61A 2FFIA 3BZGA 1KM4A 3IJLA 2Z1BA 1T0OA 3DBNA 2FZMA 2OQLA 4B92A 2ZQ0A 3PTKA 4NI8A 2PLJA 3FY1A 3FDKA 2C3ZA 1JCLA 2VDGA 4I90A 4YYCA 4F2BA 4FNPA 2NQJA 3N04A 4AFYA 4U5KA 4AZCB 3EWWA 4LVAA 2VL4A 3P5YA 1TTJA 1NDYA 3NQVA 3VNYA 3NQDA 1XSKA 1KXVA 3NCOA 3PM6A 3RJYA 3WBXA 1K6WA 3W28A 4BWLA 3TXZA 1GEHA 1B5TA 4JIIX 7ODCA 4L1XA 3O3RA 3DG3A 4H9YA 2Y7FA 3GKFA 3AHZA 3KXQA 3GDKA 2PCQA 4KERA 4QLJA 4W93A 2GK1A 1HXJA 4HSOA 4JIHA 4FNQA 5GNYA 1LRTA 3HV9A 2BY2A 4HZMA 1UOKA 4H9ZA 1WKDA 5H8PA 4UTFA 1LM1A 1MXGA 4C6JA 1XYBA 4YU1A 1E56A 4NZCA 3VM5A 1UD3A 2GVJA 4EPEC 1CGVA 3GIPA 2GVLA 5C2CA 2WWDA 1JZ7A 4GY7A 1E3XA 4B9YA 2TYSA 1L6SA 3AJXA 2ISVA 2JFEX 1E6RA 1PX4A 2J79A 4JQ4A 3L67A 1RY8A 5GNZA 1XP3A 3L4TA 3AMKA 3TN4A 3USBA 4PBGA 1FCUA 2XZ7A 4OBRA 3SURA 3AU2A 2YBTA 2B7NA 2BLEA 1M01A 3UA4A 2QCDB 4F0KA 4KS0A 2LLEA 3H53A 2YBVA 3BCFA 2RJGA 3RU8X 3VIJA 2OZ0A 4MKSA 1BD0A 3BJFA 4LYKA 4K8EA 1KKOA 4PTWA 3LHZA 3TTSA 4UMAA 1G0CA 1HO1A 4KPLA 4KQNA 2PWUA 4CU8A 1GQJA 1TJ2A 3UZWA 1O66A 1YNQA 3R94A 3E6EA 3W86A 2FPVA 1TTPA 4AZBA 1XGZA 3AXXA 2RAGA 1GVRA 1TUXA 1BTCA 3GSMA 3GDMA 3WLMA 5C9RA 2XN0A 4MNJA 2VELA 2V9DA 1Q6OA 3A23A 3SCNA 3IPWA 4MDPA 3BJSA 4JTQA 2D2JA 3WF3A 3CHEA 4RV8A 3HG5A 3GXIA 5FF3A 3ENLA 4X9YA 2ZRYA 3VFLA 4UR7A 1F8IA 3GXMA 4IHCA 3AIVA 2OO0A 2PAJA 3BMWA 4UQDA 3S2NA 4I5RA 5AYBA 4NRRA 4HNLA 1ITUA 2NV9A 2Z1KA 2W4XA 1DE5A 3MSRA 3WH8A 3VMPA 1US2A 1M7OA 1V77A 2ZX9A 3H24A 3M46A 1G9HA 1FDYA 1FCBA 1YDVA 2OEKA 4BY3A 1V6WA 3E96A 4GCXA 4EXAA 2CETA 1VLWA 3H6OA 2UY5A 4S1FA 4PCPA 3WNNA 2CZVA 4XG1A 5EBAA 3S6TA 4DO4A 1SFTA 1GVQA 3UETA 4XIMA 3ARZA 5BXPA 1QHPA 3ZR4A 2E6FA 1TR1A 1AK5A 3EXTA 4I6KA 5HNUA 5DBTA 3SZ8A 4ZQPA 5AVHA 4RZ5A 5HBFA 4A8RA 4FALA 3GYCA 3W0KA 1RZMA 3CC1A 3UJFA 1ZY9A 3O6AA 3CTTA 4B5VA 9XIMA 3LM7A 3N4EA 3TTQA 3O8AA 4FPSA 2OX4A 4QM1A 1LZOA 1JPIA 2A3BA 1GKRA 4JDBA 4UTHA 3UJSA 4DHGA 4NHVA 3C2YA 3WUGA 1GNXA 3ZVHA 3G3MA 1YXYA 1V3MA 3BLKA 4H9MA 3NXLA 2PURA 4LC8A 2ZXDA 4MJZA 5K9CA 2V2HA 3H2CA 2D0HA 1OG6A 4JTFA 1PTDA 3DKLA 3SGUA 8A3HA 1AMKA 1OT2A 4JN6A 3STFA 5IDIA 1S2AA 3MVTA 2WMHA 4AW7A 2OLSA 2BZNA 2W63A 5TIMA 3GD6A 1W2VA 4E3VA 3KHDA 2X7WA 2VCAA 4AH7A 3CEUA 1LG2A 3T40A 1F61A 1RCXB 1E1FA 4DO7A 1E4IA 2KAUC 2RFGA 3WQCA 1J2WA 2WQPA 3ZSSA 3Q45A 3IAQA 3W7EA 2GOUA 1OFPA 4XZ9A 4LOCA 5DRIA 1J0KA 1CIUA 1A5KC 1W31A 2UWFA 2VUYA 5REQA 1JPDX 1B90A 3EA2A 3TN3A 1V0KA 3M6DA 5M5DA 3NXFA 3VGFA 3PNZA 4ML9A 3OYZA 4J7RA 4K39A 4M1BA 1GKPA 1W3NA 4DELA 1X6NA 4RW5A 1HJSA 4GCAA 2XYLA 2NVCA 3PWAA 4KRZA 3PULA 5AB3A 3N13A 1U2YA 1GJUA 2PRLA 1AL8A 2J6XA 2FTPA 2HNHA 1TO3A 4QEEA 1K1DA 4HIBA 4KETA 3UVIA 3W70A 3U4AA 5CEWA 1UR8A 3TIMA 1RCOB 2FHBA 2YCKX 4M7SA 1XICA 4MWAD 1E4LA 1SPQA 4NZFA 4UTTC 4S2CA 2C0HA 2A3LA 4AYSA 1ZBKA 3A24A 3VCRA 4IP7A 4KW2A 3LZ3A 2ABBA 3ARRA 2WC3A 3QMSA 4DBWA 2CXEA 4Z17A 3DKJA 2Y8VA 4IX0A 5C71A 1O5KA 3WK2A 5CC5A 4CLMA 4UTWC 1UR1A 2YIHA 1UC4A 3MO7A 4RZBA 5I02A 1DTUA 1UC5A 1QU4A 2HRWA 3WUEA 3BG9A 2D24A 4J4KA 3W37A 4LSBA 1E51A 3ZJ7A 3B0YA 4P2VA 4XAGA 4NJGA 1TJPA 3QPYA 1I2OA 2Y85A 2VR2A 3BURA 1UP2A 3AXMA 4FLQA 1C91A 1LLWA 3H70A 4G1NA 4PUKA 3SO7A 4G6CA 2X1SA 1GQLA 3DHUA 3WLKX 2G3NA 4C91A 1J12A 3PUDA 1UD4A 1LOLA 1SMDA 3KRBA 4QITA 4IPPA 4YTUA 3JR2A 4RZ4A 3EX4A 1EUAA 3WEOA 3KS5A 4WCJA 1A49A 3KP0A 2Y61A 1QTWA 4IPJA 3GC5A 1VYPX 2VQUA 3ZS4A 3VMOA 3QV8A 3VA8A 1FWRA 3EB2A 4HSHA 4BF5A 5ABGA 1F07A 5EY5A 1PZ2A 2YCLA 3QR0A 3WENA 3W25A 2JF6A 1VPQA 3CWHA 5FF0A 2RGLA 3S1WA 4WJ8A 3LQLA 3T0BA 4Q32A 2B7OA 4DRSA 5I7GA 3VOCA 5AZ1A 1RALA 1R7OA 5FCZA 2GJXA 1VCFA 5JVLA 1CLVA 2QCEA 1GT8A 3MCMA 2KZHA 3BVJA 1EPVA 4GPNA 4AU0A 3ARPA 3CXOA 4TIMA 3T8QA 4DPQA 4F3HA 3STPA 3UFYA 1XCFA 4DF0A 2E9LA 2WNZA 4ZXOA 3BCDA 1W8GA 3G22A 4D8AA 4Z2JA 3H7VA 4RNFA 1V7YA 3U48A 3MI2A 3S0CA 1EGVA 1OB0A 1H7XA 2WZHA 4Q4QA 4FNUA 3S2LA 1Q3NA 1DORA 2VT0A 4WF7A 1R3YA 1IZJA 1LRNA 4PMDA 5D9OA 2FGLA 1MYRA 1WPCA 5B7YA 4LVGA 3VIIA 4OE7A 1EXBA 4DBDA 1GQIA 4ZO6A 1OGBA 3QSRA 1B4EA 2R14A 4S3CA 4Z2GA 6PTDA 4GFSA 1QBAA 1TYGA 3CZEA 3TP4A 2X7VA 4JYEA 3ES7A 1YX1A 3WUFA 2DZAA 4MJ2A 3MKVA 4MHBA 3GHTA 5BWFA 3MO4A 1VFFA 1GYNA 5I78A 4DB7A 1VBUA 1K9EA 1EO7A 2V2CA 4N9CA 1JZ3A 1DOSA 4JTDA 1RP8A 4IUOA 2OJPA 3BOLA 4JIQA 2F61A 2Y88A 4JBRA 1QUMA 4EP8C 3WF0A 5F2LA 2VZSA 1ZQ5A 1HJVA 3NYDA 3KRZA 3THUA 3AU6A 1VEOA 3UZYA 2HPMA 2Z7KA 3CU2A 1GOKA 3UXDA 1GJWA 4S39A 2MUCA 1U22A 2V8ZA 3PN8A 2RUSA 3PFRA 5D2VA 1UD8A 5L6UA 3H23A 2D1ZA 1DWGM 3VKJA 5HPCA 1I1WA 4KEZA 4HCLA 1L8PA 3UESA 3R1ZA 3VZYA 3LSBA 1Q7MA 3EAUA 2I56A 4CD5A 4AISA 3H7UA 4QX4A 3BLOA 1MQQA 3GVWA 3MCNA 4S3AA 1RJQA 5T26A 3P80A 2PGWA 1RQHA 3K13A 1TV8A 4IP5A 2EGZA 5AHIA 1LQAA 3QYSA 3WL1A 3UWZA 4NASA 4PEKA 3R89A 5H6HA 3VD7A 1OF6A 1YKWA 3QR1A 1VCVA 3F03K 1DL3A 1CLKA 2PDNA 3E2SA 1OSEA 3IIOA 2H3DA 1OD0A 4HZ7A 1KM3A 3PB2A 1XCXA 3VCNA 4PCFA 3S4TA 3SW6A 3IJ7A 4GUFA 4LX4A 3XISA 3QZEA 3B9AA 3R0DA 3VINA 1WO2A 4NQ1A 3P67A 2ZOXA 4XAZA 5KITA 3EOOA 4IH3A 1SUXA 2G4FA 4HOXA 3OVPA 3D47A 3DBPA 2W92A 3C3UA 4PRRA 2TAAA 4J1OA 4HJWA 3PSVA 4A35A 3MDUA 3OG2A 5I79A 5D32A 1KTBA 1BAGA 4NX0A 4PB5A 3W3OA 2CIPA 2FB2A 1B3XA 4DUXA 4W4QA 2YDQA 1VHCA 4PMYA 3B4YA 3BLDA 3C2RA 4GG9A 1UA7A 1E0WA 4BJHA 1OX4B 1K02A 3G24A 4LYQA 1X8FA 2WSKA 1KNWA 4M56A 1K4HA 4GQBA 2ISDA 3VPLA 3NL6A 1DHKA 1IXPA 2ZZ1A 3KOZA 3WY1A 3B05A 3LI1A 1Z48A 3IK4A 3W7RA 4XZMX 4DYJA 2ISWA 3MHGA 4N6EA 2FKPA 2FYMA 1XYZA 1I2RA 2HJPA 2FZDA 5K2ZA 1FWIC 5CZTA 3NUKA 3VE9A 4QAIA 4AMAA 4GIYA 2WMGA 4QDWA 2XSXA 4HMCA 4IQDA 2XM1A 2PDGA 5I3JA 2BG5A 3VKKA 2NWSA 5A6MA 4S23A 4ATWA 1H63A 1EZ2A 2HROA 3UPWA 2QYGA 1E1CA 3DAQA 4ZB2A 1EHNA 2VX7A 4HHMA 2QV5A 3TC7A 2HE8A 2NW0A 5LGZA 2PB1A 4CD4A 1E6SM 2WO5A 1YTDA 5EL1A 4MB3A 3WK3A 1AVAA 4Z1AA 5DMYA 2BP1A 4QP0A 3PBGA 3EDDA 2V67A 3FFSA 3GE7A 5C7VA 4TX6A 2WC7A 2RDTA 2PDWA 2PLMA 4Z2KA 3QFEA 3PZOA 2OPJA 1BXBA 3APTA 1CZ1A 5MF5A 4DN1A 1EJVC 2GUBA 1R3RA 5HINA 3UJEA 1C8YA 4MZYA 1VLIA 1BRLA 2YB1A 3KTSA 3EKZA 1W8SA 4S2BA 1BYDA 1RUSA 2INFA 2UV8G 1FDZA 2OWCA 5I5RA 1X1NA 1LTDA 3CZJA 4W87A 3T2PA 1YPXA 4JHZA 3B0VC 3PUGA 1HL9A 1ZB5A 2WZMA 3WO8A 5HATA 3NO3A 3VGEA 2VC9A 1R3QA 3UXKA 4GQRA 1JQXA 3H55A 1XBXA 1AH0A 2G95A 3INPA 2WBGA 2Q3OA 3OU8A 1VFMA 2FHFA 3S42A 1Q6CA 4MY9A 1KGUA 3ONBA 4UFKA 4I9AA 2WZTA 2VVSA 3N34A 1WKEA 2YLLA 3JRKA 3EKGA 3CQHA 4AD1A 3AJ7A 2RHGA 4RW3A 2CESA 3QHMA 3DECA 3U7VA 3UVAA 4AUBA 4NUWA 3R10A 4X63A 3DFQA 1BKHA 1G1YA 3RLHA 2Y70A 4NNCA 2OELA 1AQHA 1VFHA 4GBUA 1Y8BA 3CL6A 4O12A 2JE8A 4HA3A 4ATDA 2QJMA 1Z44A 1H4PA 1J0JA 4KCWA 4OWGA 5TBOA 4ZFCA 3AIEA 4Y9AA 5AN7A 4EANA 1XIDA 2GSHA 3M7SA 1XCWA 4RR4A 4UTMA 2PA6A 2NLIA 3RM4A 4Q8TA 1IEWA 1GJPA 4CNNA 4AXNA 3KDNA 1XLCA 3TOPA 3RF9A 1PYFA 4Q8QA 3WBYA 1PO9A 1V08A 4QIUA 1R86A 5CXPA 3PZMA 1H60A 1CWYA 4RPQA 2Y62A 3P60A 1WNOA 5FD0A 5ECVA 3I4KA 4ZSTA 1W1TA 4H9TA 4ZL1A 4GJIA 1X6UA 4KGLA 4PCTA 2NQZA 4AX7A 3T6CA 5K4ZA 1V0MA 4NKCA 4FO4A 2PDIA 1XFBA 5C55A 2QDEA 1D8CA 4LUYA 1R87A 3WD0A 3MC5A 3W4RA 1PYMA 1W9XA 2VR4A 1JXJA 5BRBA 1UPPA 4NXKA 1B3WA 1NF7A 3FYOA 4CEUC 2IPFA 1C8XA 4GY0A 3SI9A 5EMUA 3NTYA 2OVLA 4PMUA 1D7FA 1M41A 3W6LA 2HK1A 4DXXA 1KTCA 5LXXA 4AG0A 3S2CA 4J3TA 4U33A 2CLEA 1A5OC 1M53A 1U30A 1L6GA 2WC4A 1KV8A 2QHAA 3FJ6A 3UJRA 3KEHA 4A29A 4JPGA 4FOKA 1VZWA 4ADTA 3KE0A 3OA3A 3ALFA 4HN8A 2DP3A 3MSYA 1MZRA 3P81A 3AMDA 4B2DA 3AI0A 3L4YA 5A6SA 4JEJA 4AC1X 3L0NA 1NARA 3HV8A 3M5ZA 1DWJM 2E28A 3N12A 1FCVA 3S2MA 4AD4A 5H91A 3LBCA 1XLAA 5D9MA 3XIMA 3CHFA 4A05A 1KQYA 1G7VA 4MNMA 3C86A 5C70A 4AHOA 4FSAA 4GX9A 4QDPA 4JTAA 4YCPA 4I9JA 1IT7A 1ZL1A 2DZPA 1EEXA 2XN1A 4KH2A 4YXGA 4LEFA 1FWNA 3V3WA 4DF1A 3W1QA 1JD9A 1HQTA 3MTWA 3N15A 5K4XA 4Q8MA 1SFJA 3HMJG 5DY3A 1DXIA 1E1EA 2PRMA 3XINA 4DY1A 1ITXA 3LG3A 3BMXA 3VNJA 1X7IA 3RM9A 3S8HA 4DM2A 5LHFA 2PD5A 4U10A 2HISA 2Q09A 1E4NA 3QH2A 4P7OA 3LLDA 1XYFA 3LPFA 4DO6A 3ZZ1A 3FK4A 4FX8A 1G69A 3AZSA 3GZAA 1SSGA 3IIZA 1AJ0A 3G77A 2PP1A 4O1EA 3DFPA 5A5WA 4KWOA 1JCNA 4MFDA 2VOMA 3APYA 2ZWYA 4UTJA 3R5EA 4P7RA 3BZJA 4FR1A 1GQKA 4S38A 1M7PA 3M0YA 1B4KA 3AXKA 4RE0A 4GVFA 1UKOA 4OU1A 3FOKA 4IFKA 2XVLA 1JJKA 2V69A 1JDEA 2CITA 4GZJA 3K2GA 3O7UA 3KCLA 1JG9A 4D8ZA 4Q7IA 4G7FA 3OG3A 1UROA 2DVTA 3KX6A 3PBYA 4EF9A 5A1AA 1BWLA 3RFAA 4UTTA 3GVQA 3EZ4A 2OMAA 3C6CA 1KM0A 1K70A 2X40A 4K7VA 4PCSA 3T0CA 4NJIA 3A4AA 5KZDA 3VNKA 3CB8A 3AMLA 5T9BG 3N9KA 3IJ9A 1V51A 3BW3A 4LEQA 4UTWA 1R2TA 5C0QA 3DDMA 1TCMA 1JCJA 4LVDA 1FWAC 3AYVA 2FTYA 4F8XA 5E09A 3SRHA 3VYLA 1YQ2A 3O9NA 4XAPA 2ZICA 1VPYA 5JBEA 3O6YX 4JXCA 3E5BA 1TMHA 3DGRA 4ZOEA 3ANUA 1I2NA 3VUPA 2IXVA 3LQGA 3FN9A 5F1UA 3G1SA 1JF6A 4GA8A 2XHYA 2P0IA 2Y63A 1H1ZA 4RCXA 3ABZA 2VMFA 4AYGA 2Y1HA 4A3UA 3PF3A 3WG6A 4Q8OA 4WKAA 3AMCA 4MZ1A 2BVWA 1A5CA 3OLGA 3OODA 1I4NA 3VKCA 7PTDA 1UCWA 1EJ7L 3URBA 2QGHA 4RPPA 5XINA 1TA3A 1QOQA 5LGXA 2C71A 1MWOA 3WJSA 2C0AA 3C8NA 2J7HA 1SQ7A 3TW7A 2PWGA 2R91A 4DUOA 1R2SA 5DT7A 3GNPA 3UXIA 1SSDA 1A80A 1Z42A 1XD0A 2DUAA 3VK5A 3ZVIA 4G56A 3OO2A 2AQVA 2IW0A 1XLMA 1MEHA 1LG1A 1QI5A 4AY8A 3O0FA 4H6KA 2EEXA 4LCRA 1GYLA 2DT3A 3ITCA 3CUFA 3BV7A 2XVKA 3P61A 3TEVA 4DZHA 2V5LA 4QCFA 1XH1A 3AZTA 2EO7A 3CM4A 3VNIA 3B0PA 1T8XA 2E1DA 4AHQA 3TXVA 3DGBA 4NP7A 3P84A 2GQ9A 4Q3MA 3V5CA 3NZ1A 3RUBL 5DELA 4YL2A 4FI4A 4R9XA 4J27A 5KETA 3VKAA 3T0DA 4RDVA 4I7WA 2P0OA 3C0SA 1OFDA 3ZLHA 1MXSA 3NR0A 4IMGA 3WK1A 3WQEA 3ZT6A 3URNA 5BRQA 2VEKA 2UY2A 1C3FA 2HDJA 2YL8A 4TR9A 1J6OA 2HS8A 3CIXA 3UYIA 4J28A 1VENA 2O7SA 4K7YA 4A3YA 5CGMA 3URQA 2GQAA 2EPNA 1NQ6A 2CBJA 4BFAA 1FXPA 2G4JA 2BHZA 3AHTA 3NL3A 3N2XA 2PFHA 4Z08A 1QO5A 2ALDA 2VX5A 3NVDA 1E6PA 4JFTA 2D0GA 1LWHA 4HD5A 4GWEA 1LORA 2XFRA 1GYMA 3QEZA 1P6WA 3CH9A 1QATA 2PCEA 1UMYA 1YTKA 3K30A 4RXGA 4C6NA 3VNZA 2P76A 4L7ZA 3B9OA 1UR9A 1W5QA 1MZHA 3F4WA 1X39A 2RDWA 1KRBC 2RH9A 4LNYA 4GINA 4GJ1A 1XLHA 3GAKA 1EF3A 4JKKA 1XUZA 2QAPA 5F2MA 3IGXA 1KM6A 5FF7A 3HJEA 2FPTA 4A3HA 4US5A 4U28A 1ZGDA 4BS0A 4CQ8A 4CCZA 6CGTA 5B80A 1GVFA 4W7VA 5JXQA 3MUXA 5IRPA 2QT3A 4UOJA 2C91A 1TELA 1GONA 4AF0A 1JD7A 2YL5A 5CSUA 5DT5A 2REQA 3AICA 3KBSA 2ZZ3A 1US0A 2ASHA 2WNQA 4ICNA 3NEVA 4DJEA 1FVPA 2A1YA 2WKLA 4EXQA 4XIAA 4N9DA 3M47A 3P74A 5CQ1A 5GJPA 4Y9MA 3VCCA 3ARUA 3AUJA 2O9OA 4ZOCA 1DWHM 1P48A 2JIEA 5AHNA 4IL0A 4W8BA 2IPWA 1BF2A 1L6FA 1P0BA 1OG0A 2OKOA 4MB5A 4AIOA 1VGAA 4A6GA 2OSYA 4IFRA 1PIIA 2ZIDA 3E5PA 2F8QA 3WLPA 3WQ8A 3RJXA 3RO8A 4F40A 4JR5A 4KBXA 1SO3A 3BAIA 1BXNA 1UWQA 1CB2A 1KR1A 3AXHA 3N9RA 1UZHA 4LV4A 1DQWA 2VURA 1WP6A 1DPMA 2YDSA 3GXTA 2XZ9A 2Y5JA 2GPTA 1WXZA 2NT0A 1WDQA 3NM1A 1NFGA 5AC4A 1QWGA 4GE8A 3VAVA 5HMEA 3GG7A 2ZUSA 4KCTA 1H7NA 2NQHA 4Q8NA 2YJQA 3FSUA 4XBSA 3BGJA 5E0KA 3WIJA 1PDZA 4GI9A 4PEEA 4M1RA 4QE1A 3M0VA 2A3HA 4XTIA 3QRHA 1E0UA 3FKRA 1X98A 3QV6A 3BLEA 3EMZA 5FJUA 2V63A 3OIHA 2PWVA 2Z27A 4AMCA 3BH4A 4JTRA 5C8BB 1OCBA 5A6BA 2ZUVA 4GUJA 4GYJA 1S39A 2UBPC 1GWJA 2QUVA 3C2OA 3U0HA 2V5CA 2FQIA 3G5EA 1XYMA 4C5ZA 4ZTXA 4C6BA 3EA1A 3NO5A 1A5NC 2VCBA 1TQXA 3P93A 3N2MA 2CKRA 3RGTA 4H83A 1NFBA 4IIFA 1LL6A 3OHMB 1J0ZA 1EGZA 3GUWA 4XZLX 2ZZ6A 4QG9A 4LCQA 1GEQA 4PBFA 2QUUA 3ANYA 4K1GA 5LA2A 3QMRA 1XPYA 3HQOA 3SIZA 3PPHA 4UR8A 4J3VA 1ICSA 4O15A 4R53A 3KL0A 4E4PA 2AGTA 1AJ2A 3GHUA 4MYXA 5EPDA 5DCEA 2ALRA 2X41A 1UH4A 4IPIA 3P2VA 1K8CA 4QXIA 3SRFA 4E8DA 2P3EA 1TPB1 1W1ZA 2YB4A 2MNRA 2Y0FA 2P88A 5HMSA 2VFHA 3MP5A 3D46A 2J74A 4M51A 4MNLA 5TNVA 1Y7VA 1NOWA 3TSBA 1Y5VA 2BVTA 1G4SA 3G1FA 3ZVHB 2ZADA 4JTKA 1AUSL 3H26A 2WHJA 3H2FA 3L2LA 4DF2A 1HP5A 5HWNA 2YZRA 4TVDA 5FJPA 2X1TA 3WD1A 4WDUA 5D37A 3GFZA 3VFCA 4QJ5B 5A95A 4EWND 2VOTA 1VBRA 1SO6A 2ZFAA 3AS2A 4BI5A 2OEMA 4UQAA 2ZCGA 4N9BA 1PKNA 1WDSA 4C6CA 5M03A 1JFXA 3PBWA 3C0LA 2BHYA 4TUFA 2O7QA 4OZOA 3M9YA 4O0ZA 3NWRA 2BXVA 4LNCA 9RUBA 4UZSA 2ACUA 1MSSA 4C6MA 3CV6A 1HUVA 2VUNA 3AYTA 2ZX6A 4HU0A 5REQB 3NDYA 4AB4A 3KVLA 5IBXC 2JKEA 1UD5A 1WV2A 2WBKA 2BX7A 3I10A 4F79A 2ZXQA 5A8PA 2HE5A 3BTNA 1JZ8A 1TMLA 3HO8A 3KWSA 3GDTA 4RNHA 1V3LA 4Q4SA 3G1YA 1B2YA 1XXXA 2GDQA 3TVAA 4D1IA 1TZ7A 3LPPA 1D7KA 2D69A 4ADUA 7A3HA 1N7KA 1OABA 4WY0A 1TREA 3P8JA 3UJ2A 3PAOA 4E38A 2QF8A 4GYKA 1SZNA 3N19B 4DYKA 5DRCA 2NVAA 4PUMA 3EOEA 1S2WA 4Q22A 1GORA 1Y5XA 2VENA 2WW5A 5G2HA 4CQCA 3L4UA 1GG1A 3G8RA 4ZSUA 5CSRA 4LANA 3LCLA 4KFPA 1EP3A 2J62A 1UB3A 1NWRA 3MQTA 5JQ9A 3K4WA 1Z9AA 3TJ4A 2DZVA 2C14A 2AMGA 2EQDA 4YCOA 2YL6A 4L1WA 3MI6A 4MY8A 4LUSA 2ZA3A 4YTSA 3EOLA 3QKZA 1DIOA 3L66A 3DX5A 4JFSA 4AD0A 1M3UA 4AZ7A 3WDRA 5GQBA 3STGA 3GR4A 1OQFA 2VGIA 6XIAA 4DO5A 2HXUA 1TX2A 1TWWA 3WF1A 3BGAA 3IAPA 2EPHA 5D9PA 2DIEA 1IF2A 1D3GA 1UKTA 4JN7A 4NZ4A 1VFSA 1XIHA 4P8UA 3THAA 3W00A 3WLIA 3WH6A 5CLTA 4JTLA 4FXJA 3AMGA 2XJ7A 1LROA 2XPKA 4NZJA 3BQ6A 4ES4A 1CDGA 3HFTA 4QJ4B 5JIWA 2UY3A 2QCHA 2PPGA 1A5SA 3QOMA 5HOSA 1EFZA 2DZTA 5ABFB 2DSKA 5H8UA 2GJXB 3NQBA 4HMNA 3PTQA 3U4FA 4LRTA 2L5HA 1HT6A 2NUWA 2Z6IA 3QQ1A 2P50A 4URIA 2VD8A 1R2RA 2PZNA 3ABQA 4N42A 2WNWA 4OECA 3LEPA 5DF0A 1L0PA 2QV4A 1J2BA 3NNTA 1NDWA 2IQ0A 3GNDA 4Y90A 5C9WA 5AHLA 4PYSA 1LOQA 3LK6A 5D03A 4A4AA 4CNUA 3ZR5A 4O8AA 4IOTA 3WNKA 4L4OA 1CGTA 2F38A 1ONEA 1WZLA 1SM9A 1V3JA 1TPVA 4P61A 1KRAC 1A5AA 4UR9A 4NYUA 2C7FA 1XC6A 1Q8AA 2VM8A 3R11A 2DPEA 2R94A 3NGJA 3KL5A 2XWEA 1LBFA 1VB9A 2G3IA 3DG7A 3E0FA 1LBLA 1M68A 1TQJA 1CYGA 3I65A 2I7GA 4WXYA 3A3WA 1W9DM 2OLHA 4LFYA 1AW1A 3C2EA 5HQLA 3SN0A 1IYXA 4F48A 4LVBA 3RIKA 1P0KA 4JICA 4CCDA 5CPSA 2BHUA 3DENA 2A4AA 2G37A 1XFCA 3W2LA 4W9TA 2PS2A 3VC5A 3GVRA 2D22A 1GOQA 2RKXA 4D6IA 5GJNA 2EPMX 5DQPA 3G0UA 1I6NA 3A9BA 3KBMA 1SMAA 4GO8A 3IJ6A 3UZ5A 1XLIA 5HAOA 3G0SA 1KWKA 3W24A 1KCXA 2BY3A 4KKXA 3FEMA 5EFFA 1TVPA 3M0IA 3Q65A 3FSTA 3H4WA 1F4HA 1RA5A 2QIIA 3ABOA 3H21A 3BW2A 1BQCA 4DJFC 1WUEA 4CVUA 1JUKA 4UFLA 3VTRA 3DYPA 1XINA 4JTSA 2VGGA 4C6QA 1T40A 1XLLA 2DH2A 4ZVJA 1F9CA 2JQXA 4LXFA 2ZVRA 1QO2A 3W27A 3L0GA 3N6QA 4IMFA 1K4GA 1GQNA 2WHMA 4EPKA 1W9VA 2DIJA 4C65A 3I4EA 4UNIA 1E3ZA 1T41A 4O1CA 1VRXA 3G18A 3B0UX 3QGKC 1DQUA 1PTGA 1HKWA 2P1FA 1PCKA 2EAWA 2V2DA 3W7PA 2X8RA 1D2KA 2WOQA 1J6PA 1EC9A 1EEPA 5FL1A 1U5VA 2Z26A 5I23A 1RPXA 3WD4A 5G4HC 1SW0A 5CCZA 4D71A 2A0NA 4WKHA 4IMAA 3CB3A 2DT2A 3EMCA 5I6SA 1K3UA 3QZ6A 1JPKA 1WKYA 4ROPA 1ONXA 3AUOA 2XVGA 1Q2SA 4WGHA 3NDOA 1NTHA 3B0XA 2DIKA 4F0LA 1PX3A 1GOMA 5A2CA 3V75A 1QVBA 2H6RA 4O0KA 3W22A 1GHRA 6TAAA 2VZVA 4TVCA 4GZEA 2I5IA 1RK5A 1ZNNA 4G5DA 4O13A 3CPUA 5F4SA 1E0TA 2EPOA 4OT7A 2DW7A 3HN3A 4AX6A 4S3KA 1EWEA 3W6MA 4ICMA 2QF7A 3RK8A 1W1A1 2YFOA 4DZAA 3HG3A 1VS1A 2FZNA 4LBUA 1SVDA 4IJRA 1BGAA 4HU8A 1FA2A 4H01A 3COTA 5GVJA 4TMCA 4MZ8A 3V0TA 4H8UA 4FK9A 1MRAA 1R7AA 4RE3A 1JXKA 1IEIA 3DXIA 3G8EA 3R13A 4S3GA 5LXEA 2JIWA 4M8UA 4YTTA 1Z41A 4Z0JA 5JMUA 1J5TA 3CWNA 4ZMGA 3IJ8A 5F2IA 3AIWA 4HSNA 3LGEA 3Q58A 3SIMA 1K8ZA 2WYSA 5CZJA 1E1CB 1O94A 2ZX5A 3CIVA 4GGBA 3SCRA 1ALDA 2WVVB 2OB3A 3WKZA 2HXTA 3DHFA 3RNDA 1Z89A 4L1GA 4LALA 1EOKA 3SAZA 3FA4A 1KCKA 2CHRA 3S6OA 3LYEA 5GJMA 1GVYA 1UWTA 2CWNA 3Q37A 4W85A 1HTIA 1TPUA 3GM8A 3VIPA 3L12A 1F6PA 1W3IA 5HR6A 4KGJA 1BRLB 4WVXA 4XD6A 3MHFA 3WDIA 3L2MA 3TYEA 3UG3A 1V5XA 4PSPA 1N8IA 1ADDA 4FIQA 3VIFA 2W0UA 2QJHA 1GTHA 1E5JA 1OJXA 4L56A 1PIGA 2WLZA 3BARA 3WQDA 2PBOA 2Z2UA 2QVHA 1F3WA 1XV8A 1KLYA 2QJNA 4O17A 2AAMA 2HQAA 1AD1A 3S2JA 1AA1B 3HPSA 2V3GA 4HPXA 1UD2A 1ML1A 3W07A 7CGTA 3SCQA 3VX0A 1TRIA 3N4AA 4UNLA 4O54A 4X0VA 3BCJA 2J78A 4DI8A 3UEQA 1UR2A 1H0GA 2YDAA 2YL9A 1R3TA 3GVVA 3ZQ9A 4D1JA 2F2HA 1FWHC 5A94A 1JYXA 2QCMA 4MB1A 3RR4A 1W56A 2HWGA 5D33A 3KAOA 2J9ZA 3URAA 2GL5A 4UFHA 4PMQA 4OOUA 3NURA 2DSUA 1XIBA 4MAZA 3CQJA 4B5XA 2CHOA 1AW5A 3BAWA 3TU9A 2VRQA 1R6WA 2PWHA 4EKJA 3B8VA 2FPYA 1XC4A 3WFZA 3LV6A 4XBKA 1QMLA 1XIIA 3W1TA 4YN5A 4JQ2A 3WLNA 1OBAA 1C92A 1BYBA 1MMFA 4ILSA 3A22A 3VZZA 2F6XA 4UQBA 2VGFA 3GHSA 1MDLA 3QPZA 3LZ5A 1ZP3A 4TTGA 3WF2A 1KR0A 2X30A 4ZO7A 3PP7A 2CU0A 1ZTVA 4F2UA 8XIAA 2YXXA 3SY5A 2QXWA 5A2BA 5DFAA 1OFRA 3F5LA 1PZ3A 2GGHA 4JDYA 3RCMA 4XZHA 1JYWA 4QGCA 3TYCA 2JGYA 2VWSA 3SUWA 5FAJA 2GGIA 2WCSA 4ZQNA 4B2DD 3ITYA 4LAKA 3FLUA 3KCOA 3S5SA 1JVNA 3F4CA 1P6CA 3TH6A 1JQVA 4HOWA 3LUTA 3WK0A 1K7EA 2EG8A 4FP1A 5BW6A 3GIYA 1RAKA 2ATSA 1JFHA 3SQSA 2IMRA 1JI2A 4NYYA 4UCGA 1L2UA 4HZ8A 1PZ1A 1KXHA 3D0CA 3TX9A 4NZ3A 3CIWA 5EA9A 1TMQA 1S5VA 2VZOA 4JNYA 5AVNA 2NVDA 2A5HA 3ZJ6A 4LAMA 2ZRWA 5JH2A 1G4EA 4HA0A 1ZAHA 1QNPA 2X0HA 4K2SA 5E9XA 5LKYA 3UNDA 4MY1A 1S2CA 3QTGA 4IGSA 2NWRA 1S1RA 1IR1A 1HKVA 4P7LA 4XZIA 1SU5A 2ISSA 3OTRA 3P6LA 3SDOA 3GH5A 4GX8A 3W23A 3W7GA 3FJLA 2PF0A 3WLLA 5CBIA 3GWQA 5EMYA 4IG2A 3WD2A 1X1OA 2XU2A 3N2BA 1ELSA 1SR0A 3SB0A 2ZRVA 3JU2A 3UWVA 1DQXA 4G2DA 3Q67A 1AZ2A 4Z1DA 1JGMA 4EXBA 3KTCA 3B8IA 1UKQA 5GNXA