3I7SA

Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIREATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
publication title How essential is the 'essential' active-site lysine in dihydrodipicolinate synthase?
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 107
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3i7sA00
4DPPA 3L68A 4O54A 2CLHA 3WJXA 1VC4A 2YXGA 3S5ZA 4Z1AA 1L2UA 3SGUA 3D0CA 1A5SA 5HUPA 1PE1A 1TPC1 1G4TA 2WPBA 3BGJA 4JN6A 4Y9AA 3NPUA 4OQVA 3NNTA 2Z2UA 3FLUA 3BW3A 3MYPA 3MMTA 4QQ3A 4ORIA 2GPTA 3G1SA 1SFJA 4I9AA 2OZ0A 4NT0A 4JXCA 3NPVA 1XDLA 1IIHA 5AB3A 3C2EA 1C29A 3BLEA 4YXGA 5GVJA 2R91A 4OV4A 3GAYA 1JJKA 1RVGA 2YPIA 4Q32A 3L5AA 3W7JA 4R34A 3QYQA 5AFDA 1QPRA 4I7UA 4JD4A 1PCWA 1XBZA 2H3DA 1W3NA 3CHVA 4RZ4A 3L0KA 2ZTKA 3HB9A 1GG0A 3OIXA 3IEBA 1S5WA 1GG1A 3E9AA 5EY5A 4CQ8A 4IOTA 4O57A 1OX6A 1MEWA 2E6AA 4WY0F 3A5VA 1TPUA 4UTHA 3B0VC 1WXJA 3M6YA 1TPH1 1VS1A 3G1YA 5U7SA 3B03A 3S5YA 4CNOA 1FWSA 3ANYA 2YFNA 1VCVA 2FPTA 3A21A 3NQVA 3NQ6A 1GPWA 4PCFA 1JQVA 4GBUA 3FJLA 1ML1A 3O1NA 4S2CA 3W75A 1JUEA 2X30A 1OX4B 3RU6A 1SZEA 4X9SA 3USBA 1NVMA 1THFD 3GDRA 2FB3A 2ZA3A 4N02A 4LW7A 4B5NA 3THQA 2O7SA 3GYEA 4CCEA 1O95A 2V0TA 3DU0A 4CQAA 2G95A 3UWYA 2DJXA 3P8IA 2ZFAA 3BPWA 3Q37A 2WSQA 1ZY9A 3M44A 5KZDA 2VEMA 4O18A 1OK4A 3THAA 4RK8A 1LM1A 3GZ3A 3QSTA 1OFPA 2PRLA 1F7BA 3QMSA 1VCGA 3SY5A 3HG4A 4HNVA 3CEUA 3NA8A 1W8SA 4O1AA 3CM4A 2QDGA 3W74A 3HPXA 1SSGA 2EF9A 2X1RA 1H62A 4JX6A 3RMJA 3W1TA 1G7UA 2Q3RA 4UTIA 3PAJA 4C1LA 1SW7A 3PULA 3FA5A 5CPOA 3PUDA 4O52A 3HQ1A 3NG3A 1G67A 5FF7A 1AK5A 5EBUA 4BI7A 5L6UA 2VFIA 2AQWA 3ZS4A 4NXSA 4MY8A 2A6NA 3LERA 2GVLA 5D03A 1QOPA 1RQBA 4GUHA 2DORA 4QNWA 2ZRYA 4IQLA 3P74A 2P0OA 2V81A 1XBXA 1IF2A 4M6QA 3HOJA 5FEXA 1L6WA 3BK0A 4AEOA 5HQEA 5C2XA 1SO4A 3M47A 3N14A 2JKEA 3PG9A 3O16A 5KTLA 1L6SA 1A53A 1TPWA 3W87A 4HNUA 3PSVA 2DP3A 3NAVA 5CZJA 1AG1O 3LRLA 1SUXA 3CQ0A 3M0ZA 3GAKA 4QM1A 5LNUA 3W7LA 4KKXA 1JULA 4DF2A 1QO5A 3KVJA 4K38A 3TJXA 2TSYA 1AL7A 3DFTA 3JR2A 2Q8ZA 2NX3A 5CSRA 2XN0A 3STFA 1TPEA 2V30A 4WY0A 3TK7A 1IIGA 4WUIA 1M7PA 3O06A 3W1NA 1LRTA 5ABTA 1D3GA 2V2DA 5C5YA 3PM6A 1VZWA 1X1OA 2Y62A 2NV1A 5FF0A 1VCFA 2QUVA 1ZJIA 1GZGA 1UB3A 1VYPX 3FKKA 5D2XA 1TRIA 5HR7A 4BF9A 1TJPA 4NJIA 1NF7A 5I3JA 4E38A 4WOZA 2Q8LA 5K2ZA 1YXCA 4O1CA 3GX9A 5AHFA 1KLYA 1ZHAA 5I3HA 4UTWC 2BSLA 3LLFA 3WJSA 5DCDA 1TSIA 3ABQA 4GWEA 3PBYA 2QCEA 2JKAA 2Y61A 3CIXA 1I2RA 2WSYA 5HNRA 3VE7A 1J2WA 1RD5A 2ZRVA 1QPOA 1AMKA 4E0CA 4O4WA 3TE9A 1H1ZA 5DN1A 3DHDA 1SQ7A 1WBJA 1JCJA 3G22A 1YPIA 3NR0A 3EXTA 2R14A 3NQMA 3P67A 1AW2A 1UCWA 3P81A 4WJEA 5L9FA 4HNNA 2J24A 3NGJA 4I7VA 3W2NA 2J6XA 5I3FA 3HPSA 1EP1A 1VJIA 3LI1A 4C1KA 3C0JA 1F6PA 5U4NA 3WK0A 2PRMA 1OK6A 3OG3A 1OF6A 2YGYA 2F84A 1K7FA 3N9SA 5CPMA 3UQNA 3M5VA 1B9BA 4NJHA 1OABA 3WK3A 1GEQA 1SR9A 4JNMA 4FHAA 4DO4A 1NEYA 3C3NA 1RZMA 1XC4A 4XUGA 5AOUA 3P62A 1JCYA 4JYDA 3PY2A 3TXVA 3NQEA 3A24A 1JUBA 2QUTA 3G8EA 3CB8A 5DXXA 3T55A 3HIJA 5E93A 4N9DA 3KFTA 3KX6A 1LBMA 1A5CA 4CCDA 2GQAA 5TQLA 4R7JA 4YCOA 5D05A 4WQ6A 1ZCOA 2CLKA 3SECA 1OJXA 5BW6A 4FIQA 2VFGA 1G69A 3LRMA 2V2CA 3IV3A 3BVJA 3PS7A 1OFRA 2ZZ6A 4A3UA 3EX2A 1EUNA 3MHFA 3UXAA 3W1QA 2NUWA 4JTGA 3C2VA 3LDVA 3W88A 1O4UA 2WO5A 4JTLA 1YTKA 1VHCA 1LLWA 4CNNA 1T8XA 1DVJA 2C13A 4WD0A 1OFEA 1OG0A 5D02A 4RXFA 1W37A 2TRSA 2QJHA 4UIOA 4PL1A 3QQ1A 3BLFA 1W54A 3TCEA 2C15A 3GB6A 4UTTC 2GQ8A 2A85A 2JGYA 2NUYA 5DBUA 3G1DA 4FXRA 4LS1A 3TFCA 2QCCA 4K8EA 3W7QA 4M5PA 3UPBA 3S5NA 3W85A 4UTUA 1I2QA 4IMCA 3S1XA 3CEPA 5DCBA 4N2YA 5BOOA 2QCFA 2W6RA 1WYIA 4ZQCA 3NL5A 4FB7A 4JEQA 3FYOA 2ZRUA 1TPB1 3G1XA 3NL3A 1ZFJA 2DZVA 3P7YA 3YPIA 1SU5A 1VPXA 3S9YA 2H6RA 3EX1A 2WOQA 4ADUA 3GLCA 4AWTA 5DY3A 3T78A 1RR2A 4JTKA 4PA8A 4JTEA 1YTDA 8TIMA 1QPNA 1EWDA 3MI3A 4KFOA 3NQ8A 5D33A 4FNQA 1QFEA 2ABBA 3IVTA 4JTUA 1IXQA 3NQGA 1SW3A 3NXFA 4X22A 5LGZA 3NZRA 4S2BA 1HO4A 2FLIA 2ZRWA 4AHOA 3W2MA 1Y0EA 2HS6A 4XQ6A 1VGAA 3EWXA 1NSJA 5D32A 1YDOA 4JTFA 5FI8A 1X6UA 3MBFA 3L5LA 3TSBA 4O14A 2GUUA 4E2BA 1F5ZA 1K3UA 1LTDA 1W5QA 4K36A 5D2TA 1TTQA 2NWSA 3KRZA 3STGA 3UZ5A 2WNQA 4O8RA 5I3KA 1R47A 1PVNA 2A7PA 4S1FA 1LRNA 4I7WA 1SO6A 2ZRZA 5FF4A 3M9YA 4R33A 4LS0A 3TXZA 1LOSA 2F7FA 1DJQA 2VFHA 3CWOX 4MFEA 4N4QA 4MZ1A 1R2SA 3DGRA 3M1ZA 2CU0A 4LUIA 5E0KA 4JS3A 3F4NA 4BWLC 4IGHA 4JYFA 1LYXA 3S42A 1K8XA 4HSOA 3BGGA 3V1PA 4NVTA 3F1QA 3I65A 2ABAA 2FTPA 1ZENA 4Z0JA 4JY9A 2A0NA 2QCNA 4PC8A 4A29A 3TAKA 5D04C 1H61A 3TROA 2VFEA 5DCEA 2O7QA 1GVFA 4O15A 4HPJA 1O60A 1KM4A 4O16A 4UC5A 1LORA 1C9DA 2W0UA 2WJZA 1JCLA 4QAIA 3EWBX 2V5BA 4MLRA 1HL2A 5F2IA 3B0UX 1FDYA 1IXOA 1K02A 1T99A 1WQ5A 3W22A 3QSRA 3N3MA 3W2LA 4O50A 4ORMA 3WJZA 3MO7A 3HPZA 4XTIA 1KBJA 2YDAA 3TH6A 5I3GA 5C54A 1H63A 4Z1CA 4QITA 2QAFA 1I45A 3GNNA 2BX7A 1LBFA 2NV2A 3E49A 3FJ6A 3OVRA 1TCDA 4K6AA 3O63A 2CZ5A 1KFJA 3NQ2A 2VENA 3MP5A 2B7OA 3W7EA 1MZHA 1QO2A 2X2GA 4ONVA 3EX4A 3FYPA 3PWAA 3TW7A 4HSNA 2BXVA 2QCHA 4UFHA 1B57A 4GUGA 5J5RA 4TIMA 4RCXA 3JS3A 4LVFA 2CW6A 4GRSA 3KVLA 3C2FA 4JTSA 4LWWA 4AF0A 3ABRA 3F4WA 2C14A 3I7QA 4U4MA 5HUOA 5FF3A 2FDSA 4FX7A 2EGZA 4O17A 4AVFA 1FWWA 4PEKA 4NU7A 4RJEA 5CSSA 4BK9A 2RKXA 2Y6ZA 3O6DA 3W07A 5D30A 3VKJA 2OCZA 5CZ0A 2Y7DA 4TMCA 2HTMA 4HNTA 1I2NA 2VKZG 3L2IA 4MJMA 3ZFHA 1OX5A 4Y6GA 3QW3A 4NQ1A 4UFLA 1ADOA 1MEIA 2H8XA 3TW6A 1PIIA 2VC6A 4LU0A 3WFAA 5F2MA 5G2IA 3EX6A 4X2RA 4GC4A 5DXYA 4N6EA 1KM3A 1F76A 3W7DA 5IM51 4A22A 3MJYA 2YCEA 1PCKA 2NX1A 4IPIA 3OBKA 4H6KA 1A5BA 5F2LA 1TQJA 2GJNA 2R8WA 4HN4A 3OVQA 1FWTA 2YZRA 1CI1A 1KBIA 2C0AA 3OEXA 4FO4A 1QPQA 1LROA 3L65A 4MFDA 1YDNA 3QRHA 2RFGA 1BKSA 1R2TA 1ME8A 4AB4A 1XFBA 4PODA 4DO5A 1FUYA 4H3DA 1OFDA 4IJBA 5K4XA 2B4GA 3BG5A 3UY8A 2JK2A 1GVSA 3C61A 1LOLA 3N73A 1RQHA 3WJYA 2V5LA 2QCGA 1TIMA 1R46A 1KFEA 3TSDA 1EA0A 3B0PA 3C2RA 3W1UA 2WNNA 1W1ZA 2YX0A 2E6FA 2ZZ7A 2FPVA 1O94A 1LLZA 1TV5A 2Q3OA 4R53A 4ZMGA 1K7XA 4JDYA 1H7XA 1TRDA 4Q4KA 4CLMA 1G7VA 2R94A 3W1XA 3W72A 2BZNA 3W3OA 3RNDA 1H7RA 2H8ZA 4NJJA 5F1VA 3JRKA 5F2GA 3Q2DA 2VXNA 4AXKA 2CLLA 3PC0A 3FEMA 3S6DA 4DO6A 3TA6A 2GOUA 3P61A 4AWUA 1VH7A 2TYSA 1Q45A 1GYLA 2BLEA 3FFSA 4BI5A 1I4NA 1B4EA 1Z48A 4LT9A 4AH7A 2YR1A 3RK8A 2A6LA 4NUWA 3PR2A 4NZJA 1H5YA 3IIPA 4DBDA 3EKZA 4NNBA 1SO5A 1P1XA 3LHZA 4IUOA 4NZFA 1GYNA 2PRHA 2C19A 5CZSA 2Y7EA 3QPZA 3H53A 2ZA2A 1VHNA 3Q94A 1ME9A 1H7PA 2ZZ1A 3G0SA 4WXZA 2QCDA 4MYAA 1YTEA 1R2RA 4ICNA 3W7MA 4IMGA 5AN7A 1JRCA 3BW4A 1EB3A 5G4EA 4AF0B 1WV2A 3PB2A 1OFOA 3QEZA 5HR6A 1HG3A 4M7SA 3MHGA 3MI6A 2C6QA 1A5AA 1BWKA 4UR7A 3WK2A 1N8FA 4WZHA 4KWWA 1TTIA 1KM6A 3W1MA 3U2OA 3W83A 5AYXA 3NVTA 3W2UA 3LB0A 3G1VA 3M41A 1OFBA 1WAUA 1MSSA 3C56A 3G0XA 1Q6OA 1SFLA 3NQCA 3UWQA 5FEZA 5J5DA 3RFAA 1WX0A 2LLEA 2Y89A 2Y70A 4ZL1A 3AJXA 3G1HA 5HWNA 5E1QA 3R5EA 2TPSA 1BTMA 3PSWA 5T26A 3IVUA 3QM3A 3W1LA 3LCWA 4MLJA 2CLEA 2RH9A 4A21A 3W84A 1EP2A 3G0UA 2ISWA 5D2VA 1KM0A 4GUJA 1KV8A 2WKJA 1W56A 3UWUA 1HFBA 4XZ9A 3W7CA 1X7FA 1LRQA 3QFEA 3GDLA 6TIMA 4M19A 2ZDRA 3LBMA 4ZQMA 1DOSA 3EWUA 1QNVA 3NDOA 3QW4B 3LV6A 2J9ZA 5D37A 3DI0A 4O53A 3S1VA 1EWEA 4WX2A 3LBCA 5EL1A 2HMCA 4FX8A 4NXKA 1KA9F 3LXCA 3MP3A 1X1ZA 4Y96A 4EF9A 1CX9A 3EX3A 2NUXA 4JGDA 5KZMA 3C2OA 1W3TA 1S5VA 1Q6RA 2FB2A 3TC7A 3N2XA 2YSWA 4M6VA 5K7JA 2QCLA 4TMBA 5K9XA 4GUIA 1IXNA 3GDKA 4U28A 4UTWA 3PVFA 5AYYA 3M7WA 1I2OA 4QJ1A 3LX9A 2QCMA 2G97A 1B4KA 3T40A 3GXTA 3G3MA 3UWVA 1LBLA 3H55A 3PBUA 4OT7A 1EX5A 3I7SA 1YYAA 3LXAA 4Y8FA 5AHEA 3TX9A 3WK1A 3KVKA 2ZBTA 3L66A 3MW7A 3SR7A 1K7EA 2OT1A 3LLDA 4NJGA 1CW2A 1LDCA 3I68A 3CTLA 3DFPA 4MIMA 3VNDA 2A4AA 4GJ1A 2QDHA 4M6PA 3MWAA 3NOEA 3B06A 1H7OA 1VR6A 3NQ7A 2NWRA 2CFFA 5HJLA 5BMXA 2A1YA 3K30A 3GNDA 3R89A 1P4CA 1EIXA 5CKSA 2G5WA 5AHLA 4MY1A 4MOZA 2QCDB 3A9IA 4N6FA 3DFSA 3KAOA 1E51A 3LV5A 4NX5A 1J5TA 1D9EA 4ZQPA 2B7QA 4HIBA 2E68A 3W86A 1GQNA 1ZAIA 4ZQRA 1YADA 2W79A 4ADTA 3RLVA 5F1UA 1IXPA 3HG5A 4YLWA 3V75A 5AC7A 3W7HA 5EA9A 1SSDA 4RR4A 2RHGA 4WY0B 5LSMA 3EWYA 1T96A 3W2JA 3W7RA 1U83A 1EP3A 2B7NA 1TTJA 3TDFA 1XUZA 1TB3A 1Z44A 1XDMA 3VE9A 1JCXA 2WNZA 5TBOA 4HHPA 5LHEA 1EUAA 2CLOA 1S5TA 5C6MA 4O1DA 3LOTA 3ATZA 1OFQA 1F2JA 4K8HA 4M7TA 4CCCA 3UY7A 4XKYA 3TAOA 3SI9A 2ZYFA 3SJ3A 5LZLA 2G96A 2VELA 1QWGA 3QMRA 1WBHA 4UTTA 3KXQA 3DFOA 2JGQA 4OWGA 3BV4A 2DZXA 4MZ8A 4DQWA 3G24A 1PL9A 2VEKA 3QQ0A 3TMLA 1TV8A 5G4WA 1DV7A 4JX4A 5IBXC 4ZZ9A 1QR7A 5CGQA 5FEPA 1GOXA 3EEGA 3HJZA 2QAPA 2X1UA 2JKPA 4LC6A 3BW2A 1ZAJA 3GR7A 3CWNA 4YCPA 4QIUA 2A7NA 3AO0A 4IX2A 2NXHA 4LTSA 3CLMA 2ZZ4A 3S5OA 2ZA1A 1M7OA 5BNKA 3T44A 3TUUA 4LVGA 5KZEA 3NO5A 3IGXA 4OBTA 4DF1A 2P10A 3DBPA 1UUMA 5EPDA 1P0KA 1TPFA 3TV8A 2FFCA 4N9CA 3S8HA 3LTPA 4MUZA 3QC3A 5CPNA 3HGRA 1BWLA 1ICQA 4O0KA 3LGEA 2PCQA 1KW1A 1A50A 4UXDA 1XL9A 5EYWA 4NNCA 1Q6QA 4UTJA 1W5PA 2D73A 3LCGA 1TPDA 1TREA 1QMLA 3B04A 4WOQA 1WOAA 3C4UA 2P1FA 3INPA 1VLIA 2E5CA 3TMQA 3E02A 2NX9A 3M43A 2C16A 1OYBA 4O10A 5CPLA 2UV8G 1RV8A 2VOMA 3P5YA 3NM1A 2VFDA 1H1YA 4N9BA 5FEWA 1DL3A 2V82A 3LI0A 1SZNA 2Z1BA 1XBVA 3UWZA 3G8RA 4YMZA 3HG3A 4K39A 4EF8A 1N7KA 3NL2A 3STEA 4FX6M 5CZTA 4W9TA 3W1AA 5A5WA 1XI3A 1V7YA 4BWLA 4JR5A 3UNDA 1JQXA 4LV4A 3E0IA 5DELA 1LP6A 1PHWA 3LHVA 5KMYA 1R30A 2Z6JA 4MKNA 2I1OA 5KSWA 1ONRA 2A7RA 4O1BA 4LUJA 1FDZA 4L4LA 1NF0A 1H50A 1W5MA 3M5ZA 1ICPA 3GKAA 5LNRA 1ICSA 3DI1A 4EVZA 3NEVA 2CZDA 4PL2A 3SW6A 4RXGA 2WSRA 1W0MA 3G1FA 4E2DA 3MUXA 3L5MA 3DHFA 4UFIA 2Y85A 2YW3A 5AHIA 4UMCA 1L6YA 2QR6A 3E96A 3TQ0A 1PS9A 3A22A 2X1SA 1DKWA 3M16A 2PURA 2QF7A 4YWIA 5HULA 4AWSA 1VLWA 3P60A 3KRUA 4UUIA 3M5YA 4DBEA 3O07A 3ZWTA 3L0NA 4XKYB 1YLVA 2ZZ5A 3C52A 4EOUA 3DH7A 4POCA 2V8ZA 1HO1A 4Z0SA 2XFWA 5F4XA 4JTTA 1ZAHA 3ABOA 1W5NA 2DZTA 3DKLA 1WOBA 4JY8A 1XBYA 1WDWA 2IQTA 3EB2A 2CLMA 2B0MA 4RKAA 1FCQA 4Z1DA 3DZ1A 4AMAA 3CC1A 3L67A 4K7YA 2V9DA 5D2YA 3OA3A 5D38A 4G1KA 1H7WA 1K8YA 2X16A 1WA3A 4YL2A 3NPXA 3ATYA 1EEPA 1LOQA 3ELFA 5G1YA 5H91A 5BRBA 3G3DA 2EKCA 3C6CA 3HG2A 3T7VA 1LZOA 4DF0A 1MO0A 3NQDA 1FCBA 3N9RA 2AGKA 2E09A 2VEPA 3W7PA 4L4MA 3SSJA 2YFOA 4TR9A 3R12A 1W5OA 2QJGA 5HWMA 1O5KA 3PF3A 3LHUA 4O13A 2H3BA 3TJLA 2Z0IA 3RLUA 4RLIA 2GVJA 5LGXA 1TTPA 3W23A 3CT7A 3T4CA 1TPVA 3NQFA 4JIQA 2HS8A 2ZZ3A 1GWJA 1TO3A 3LCFA 4FEZA 4ALDA 1G6CA 4LVAA 4IPJA 2GVGA 3LTSA 2ZCGA 2FQIA 4K7VA 3R8RA 3HGJA 4OE7A 1YPFA 5I3IA 2RDUA 4NJKA 3HBLA 3W7GA 4GXMA 1FCVA 4X3ZA 3O6YX 5EKYA 2V2HA 1XXXA 5D2WA 1DHPA 1TQXA 3IGUA 1DJNA 3G1AA 2YW4A 1VRDA 4CNPA 3GXPA 3LHWA 3LCIA 2TMDA 4HT3A 3GDMA 2ATSA 2DJLA 5DBTA 4FNRA 4P61A 3S1WA 4RZ6A 3DAQA 2E6YA 5G5IA 5AYZA 1AL8A 1H7NA 5CG7A 1KFBA 3IRDA 1UJPA 3GVGA 4XTDA 2RDWA 1JCNA 1KFLA 1DQWA 2NXIA 2J27A 3W76A 4QISA 3RF9A 2CLIA 3OVPA 4O12A 2FJKA 4LS2A 5K3VA 3TC6A 1VYSX 1KLZA 3M5XA 5G2WA 1DBTA 4ADSA 2WV8A 3H54A 3PB0A 3N19B 3P5ZA 5KINA 4IMEA 3MP4A 4J9JA 3W7KA 1GTHA 4MJZA 1IGSA 2X1TA 3LCHA 4LVDA 5F4WA 3TIMA 4MVAA 4GE8A 4MYXA 3MI2A 1ZALA 2CZFA 3SZ8A 3ZWSA 3HGSA 2ZQ0A 3TNOA 3DXIA 5HMSA 4IXHA 4D2JA 3KRSA 2XN1A 1GJPA 2OMAA 3BLIA 1MXSA 4JTHA 4UFKA 1QCWA 1OF8A 1FXQA 1F74A 4FXSA 5LNVA 3L9CA 4ZQOA 4FNUA 4DELA 3U6WA 4JTIA 3BO9A 3TKFA 1YXYA 3W73A 4EIVA 4LY8A 5A8GA 1SZGA 2ZTJA 3TU9A 3I6RA 4A2SA 2EAWA 5DY2A 2PE4A 3A23A 4HKPA 3W7IA 1TV7A 2QUUA 2ZRXA 3A5FA 3R13A 1O5XA 5LNWA 4PTNA 2OX1A 3EXRA 4FF7A 2NXGA 1YXDA 4JDBA 3S0CA 1HUVA 1XCFA 3VI2A 2NLIA 3IIXA 4MY9A 3IIZA 2Y88A 1I8JA 3FKRA 1KM2A 4XWUA 4H4IA 1JR1A 3W1RA 3C8FA 3NPWA 2CWNA 3B8DA 4N9EA 4A2RA 1Q6LA 3LCXA 1OYCA 2ISSA 3LCLA 2VEIA 2DZSA 4HPXA 4LRSA 2I14A 1SO3A 1OHLA 2EPHA 3IGSA 1RQEA 3B05A 5K9DA 3TFXA 3W6YA 3LXBA 1FWNA 3O8AA 4UCGA 1M6JA 3UPWA 1KTBA 3KVMA 1GVQA 3CU2A 4LNYA 4LRTA 2E5DA 4ML9A 2Y7FA 1X8FA 1DQXA 4KFNA 3KOFA 3VFLA 2FIQA 3P8JA 3SGZA 3N34A 4OU1A 2C1HA 2JBMA 2Y63A 1W3IA 4OV9A 2BTMA 3IIOA 3OHIA 4LOCA 1P0NA 3STCA 1G4SA 1XM3A 1SZFA 3PUOA 3DENA 3EWWA 5H2ZA 4TO8A 4IMFA 2E1DA 2E77A 4NX0A 4ZQNA 1G4EA 4RX0A 1T0OA 3FOKA 3QH2A 5AHMA 4UTKA 1BEUA 4AHQA 4IXXA 3DFNA 3W7NA 2XN2A 4FNPA 3QPYA 1TJRA 1ALDA 3LRKA 3W71A 4JYEA 3LTYA 2CLFA 1FWRA 1VQTA 1F05A 1K03A 3GK0A 4UFMA 1QDSA 1FQ0A 2QKFA 3G18A 4GFSA 1H51A 4BR1A 3W70A 4MZYA 4Q33A 3O05A 1KTNA 2CZEA 1EPXA 4JTJA 1GVOA 3CPRA 1S3HA 1UBSA 4RV8A 3P80A 4GUFA 3TSMA 5C55A 2Z6IA 3GR8A 4UMAA 5EMUA 4BI6A 3EXSA 2QEZA 2RDTA 4OGZA 4JIPA 3DKJA 5K9CA 1W31A 1GVRA 2ISVA 4O4VA 3TQKA 4FNSA 4LV9A 2J9YA 3FS2A 2I9EA 1PHQA 2KZHA 5FESA 3S1UA 1FBAA 3UXDA 1KFKA 4FNTA 1JCMP 3PBVA 4JICA 4FIRA 1GT8A 4O11A 1KM5A 2HSAA 1KV5A 4PH6A 4IX0A 1FCUA 3W7OA 1OVDA 1JUKA 3TQVA 5DLCA 2A2IA 4PFMA 1L9WA 1P5BA 4LVBA 1GTEA 3GDTA 5KITA 1FDJA 1TYGA 3L0GA 3SFKA 1U5JA 4DEFA 3EWZA 2GQ9A 1G4PA 1SW0A 3ZR4A 1V5XA 4O19A 2C18A 4CQ9A 5LKYA 4UTMA 3UZJA 1AW1A 1C8VA 3QF0A 4OHQA 1FY6A 5MHBA 1ZNNA 1TMHA 1QAPA 4UR8A 2DZUA 1D3HA 1DORA 2B7PA 4JX5A 2DU2A 3PBWA 4K37A 1K8ZA 4BFAA 1KM1A 3UWWA 1NFBA 2E6DA 2A5HA 3UYCA 4KFPA 1SPQA 2AAMA 4UNKA 4XBSA 1AW5A 4DPQA 5LHFA 3R2GA 2ZZ2A 4DXVA 3NZ1A 5HINA 4UMBA 3NQAA 2WQPA 2J88A 2DZPA 3F03K 4IWWA 3P84A 1OFAA 3MHUA 1N55A 2VFFA 3BARA 3IIVA 3EKLA 2E5BA 5LNSA 2ALDA 4Z08A 3HF3A 1H60A 5G1TA 1FXPA 4O28A 1B3OA 3I7RA 1KTCA 2A21A 2GJLA 1KFCA 2YYUA 1F73A 1PV8A 4AAJA 4AHPA 3GKFA 1YDVA 3NM3A 1QOQA 3NL6A 3MBDA 5IBXA 3B4UA 2FPYA 3BG3A 2EHHA 4EWND 2H90A 2Y7GA 3SIZA 5AC6A 4N4PA 3KHJA 1ME7A 3CIWA 3W1PA 3W2KA 2C3ZA 3W9ZA 4XBKA 5HWJA 3BG9A 1OYAA 3HGOA 3HMJG 3Q58A 3LHYA 4QNEA 4O0ZA 1Q3NA 1M5WA 1Z42A 2PC4A 4QSHA 4WXYA 1XUUA 6ALDA 3DFQA 2NZLA 1LCOA 1JRBA 3E12A 2J9XA 3TR2A 4IMDA 1NAL1 1J4EA 4TX9A 4UFJA 3VCRA 4RZ5A 2BWGA 3QJAA 3N2MA 7TIMA 1FX6A 1Z41A 1OX4A 3LM7A 4GNJA 2YYTA 4UTLA 3UD6A 5D09A 4NNAA 1I2PA 3U8GA 5TIMA 5AC8A 1MEHA 1HTIA 5G2HA 4ZVJA 3PG8A 4Z1BA 5SWUA 2OJPA 2QJIA 1VYRA 3QZEA 4P2VA 4LC8A 4Y90A 2ATMA 5FF2A 1UASA 3GXNA 3P82A 3WJWA 3FIGA 4MPQA 1RPXA 3IVSA 3O15A 5K4ZA 4KWVA 3GIYA 5BMWA 4UNLA 3QMTA 3LHTA 1UUOA 3L21A 1JVNA 3MYOA 4TU1A 2OT0A 1F6KA 5F4SA 3NYZA 3PUEA 3O6CA 3ABSA 3HO8A 5AHNA 2DZWA 1XKYA
chains in the Genus database with same CATH superfamily
5JH1A 4L65A 4MNMA 3UJSA 3EKGA 2V5KA 2EQDA 1SFTA 3MKKA 2YXGA 3WNPA 3SCRA 3IJ9A 1A5SA 1TPC1 2WPBA 3BGJA 4JN6A 1XIGA 1Z3NA 2WMIB 2Z2UA 1KXVA 3BW3A 4UOJA 3MYPA 4QQ3A 4ORIA 4I9AA 2OZ0A 2R24A 4S39A 1C29A 1XJBA 3AS3A 4PMOA 3VIHA 5GVJA 1YPXA 1RVGA 2P0IA 1CDGA 4CQBA 4D1IA 3C86A 3R10A 3QYQA 5IXEA 1MQQA 3APGA 5A8QA 2VM8A 3TZFA 5AVNA 4XAGA 4DNHA 1JZ8A 1GG0A 3VIKA 4IM4A 3V7PA 1Q6EA 4O57A 1MEWA 3A5VA 1P43A 2XSAA 4UTHA 2PDBA 4S3CA 1NQ6A 3N2CA 5U7SA 1ZJAA 3S5YA 3IAPA 3FW6A 1BRLA 2FPTA 1MDLA 3A21A 4E5TA 2ZDSA 3PJUA 3AC0A 4GBUA 3EDDA 4S2CA 1TA3A 2UY3A 2GGHA 3EDJA 3OQEA 2X30A 3D3FA 1OX4B 4D6HA 3R0KA 3USBA 3CHCA 2FB3A 2YJQA 1TWWA 2NLYA 4IP7A 1L8NA 3ARVA 4F0SA 1KCKA 4PEEA 2OPJA 1Z89A 2OG9A 4CCEA 2ZVIA 4BQ4A 2A3AA 3Q37A 2WSQA 5KZDA 1Q7ZA 2VEMA 2R9RA 3HQNA 2DZBA 1E43A 3B8WA 3GZ3A 3THCA 3CHDA 2HNHA 2AKMA 3HG4A 1DJWA 3WDHA 3M0KA 4O1AA 3CM4A 3W74A 1JF6A 1KXTA 1Q63A 1CB2A 3RMJA 1CXLA 4I9TA 4DWSD 4P8VA 1X97A 4NRSA 2VHLA 1ZSXA 2HWGA 4O52A 3HQ1A 3NG3A 4C6BA 4JHOA 4LNCA 2X41A 5L6UA 4BI7A 2VFIA 2AQWA 1XG3A 4NYUA 1QOPA 4ML4A 4B5SA 4G8TA 1W8GA 4ASTA 1OCBA 2P0OA 2OQHA 3HOJA 5FEXA 4AEOA 2WM1A 1QVBA 3LY0A 5KTLA 1A53A 3W87A 2WMJA 2DP3A 2P50A 2R82A 2WB5A 5CZJA 3AUOA 1Q6CA 2QS8A 3N2TA 3GAKA 4QM1A 3WD2A 2AMXA 4IJRA 5C0QA 3KVJA 3QY6A 3VMOA 3PNUA 4LF2A 2PDHA 3FGCA 1A4LA 2V30A 1ECEA 5FJIA 3UZXA 1IIGA 4WUIA 1M7PA 4B9ZA 1CTNA 1D3GA 1G01A 4YYFA 1X1OA 2QUVA 2A3EA 1ZJIA 4KGLA 3AMCA 3KBWA 4ZXLA 2Q02A 5D2XA 1TRIA 4NJIA 1EX1A 3W01A 2V69A 1RSCA 4E38A 4KCVA 4WOZA 1P0DA 1EBHA 4AFYA 4NAFB 3UCCA 1WDSA 3B8VA 2DIKA 1UWTA 2Y0FA 3MANA 3QBUA 3V18A 3OYZA 2JKAA 2XVNA 2VDGA 1J2WA 5C2CA 1RD5A 1QPOA 3P14A 4O4WA 4W8BA 5DN1A 1SQ7A 4BCEA 1XRTA 3SQSA 1UP3A 3OGVA 3NQMA 3GNPA 3UBPC 1UCWA 4RDWA 1TUFA 3P81A 5REQA 2Z7GA 5C7HA 4WJEA 2J24A 1S1RA 1JCTA 1AZ2A 3HFYA 1NQKA 1HGYA 3ONCA 3VMPA 2YGYA 3GXFA 4EKJA 2G8ZA 5CPMA 3UQNA 1XFCA 2GUYA 3WK3A 2NVDA 3D47A 4JNMA 1V51A 4DIAA 1XC4A 1V0NA 3CUFA 1OY0A 4PMVA 2YA1A 1JUBA 2PTXA 2EPMX 3CB8A 3WQPA 3KFTA 3KX6A 5TQLA 5LXXA 5D05A 1ZCOA 3ERPA 3SECA 3C8NA 4FIQA 3PANA 4CD7A 2V2CA 2DUXA 5CGTA 2IUZA 4H8VA 1ODUA 3EX2A 1EUNA 2A3CA 2CHRA 4E2OA 2I7GA 2GJXA 3SURA 4XX6A 3BSGA 1YTKA 1VHCA 2E8YA 1PX3A 2D0HA 4FXJA 3SRDA 3TN4A 3NFUA 4C1NB 3GFZA 1U1HA 2CCRA 1VB9A 4F0MA 3BLFA 1EBGA 3TN6A 2C15A 3VA8A 2W66A 4UTTC 2GQ8A 2JGYA 2NUYA 1IWBA 5DBUA 3G1DA 3TFCA 4PMRA 2QCCA 3W7QA 1P6BA 3RCYA 3CEPA 4B4FA 3LZ5A 4ZO9A 2QCFA 4UTFA 4JEQA 3NYDA 1RLCL 4KCUA 2O9PA 3G1XA 2DZVA 3P7YA 5C7VA 2EEXA 1W3LA 2ONEA 4ADUA 1R3SA 3T78A 1RR2A 4JTEA 1WKDA 4IMAA 4JCMA 4DZAA 2X09A 3NQ8A 5I77A 5I2UA 2ABBA 4JTUA 1IXQA 4BZYA 3NXFA 4X22A 2D0FA 4S2BA 4WHBA 2ZRWA 1Y0EA 2HS6A 1FH7A 4XQ6A 1VGAA 4AC1X 1UR2A 1NSJA 2BB0A 3IJIA 5D32A 3TOPA 4JTFA 5AYBA 1IWAA 3MBFA 3ZVHB 1LTDA 1W5QA 1YNQA 2ICSA 2ISFA 4GO9A 4OKDA 4Y2WA 2NWSA 3STGA 4H2CA 1V7AA 2G3JA 3MDWA 4AVOA 3PFMA 4OJYA 5I3KA 1R47A 1GQJA 3F7JA 2ZRZA 3L4ZA 4I9JA 4XD3A 3NUKA 1LOSA 1QNSA 1XH1A 3CWOX 4N4QA 3WLOA 2W4XA 3Q65A 1DE6A 3DGRA 2CU0A 3WQ6A 4ZODA 3MUAA 5E0KA 1MXGA 3AMKA 3IS4A 2DH3A 2ACSA 2PP0A 1LYXA 3VD5A 3V1PA 3KOXA 4B91A 2FTPA 1ZENA 3RX2A 4JY9A 1S2UA 5FA5A 1ZGDA 5D04C 4CU6A 4HNOA 2O7QA 4REQB 1TR1A 3B40A 2C79A 4IIHA 1C9DA 2WJZA 4KWOA 1B9ZA 1JCLA 1FDYA 1E0TA 4CQDA 4A8IA 5DF0A 3N3MA 4KEUA 4TVDA 1DJGA 3W2LA 2HPMA 1Q7QA 2NSOA 3MO7A 2BP1A 2YDAA 5JMUA 4L7ZA 2QAFA 1BTCA 1NU5A 2ALRA 4MKVA 1I45A 4JBRA 3SCTA 2E9BA 3A13A 1LBFA 2NV2A 2BVTA 2CZ5A 1HKVA 3FXYA 2VENA 3G1RA 3MP5A 3ICJA 2DQWA 4CD5A 3W7EA 1BSLA 3FYPA 1NOUA 2QCHA 3UA4A 1B57A 4LGXA 5PTDA 2XIOA 4AIBA 4CCZA 3ITOA 4JL2A 4EE9A 2BMBA 4TTUA 4KF1A 3WBAA 3KVLA 4JTSA 2JQXA 3SSZA 5BOEA 3I7QA 4GI4A 3R0UA 5FF3A 2FDSA 4FX7A 4O17A 1FWWA 5A95A 2AL2A 4AG0A 1H41A 2RKXA 5D30A 1EQCA 2Y7DA 4YU1A 3N11A 2HTMA 3BAYA 3RCMA 1E6XM 1I2NA 4ZOEA 3N2BA 2PLCA 5LIYX 1D8WA 1WZAA 3CAKA 3TYZA 2OSWA 1QOXA 1ADOA 3WDQA 3KP0A 2VC6A 5EMKA 3KL0A 3VILA 4GC4A 2ZXBA 1KM3A 3N04A 4E3TA 5TAOA 3BOFA 3W7DA 1Q2RA 3TC3A 2VTFA 4A22A 4HN4A 4DN1A 1JZ2A 2C0AA 3OEXA 5LXEA 3AIUA 4FO4A 1QPQA 3NSMA 3FA3A 4MFDA 1HKKA 1BKSA 1CXHA 3R6IA 4L5ZA 4ERAA 1XFBA 1FUYA 1OFDA 3MB9A 5K4XA 2B4GA 3UY8A 2JK2A 1GVSA 5DFAA 3C61A 1LOLA 3N73A 1RQHA 3WJYA 1AQHA 4U2YA 3M4HA 3F2CA 3TSDA 3WX7A 2E6FA 3RPDA 3K1DA 1LLZA 4JQ2A 4DJFA 1K7XA 1WUFA 3GM8A 1H7XA 4XZBA 2CZVA 2PZ0A 1D7KA 1DWJM 1HN1A 4NJJA 1CGWA 4G7FA 3PC0A 3FEMA 2VURA 3CMGA 4AWUA 2TYSA 2AQOA 1Q45A 1QI3A 2BY2A 1GYLA 3J7HA 5TNVA 3T2OA 1V77A 1UQYA 1GORA 4K8GA 5A6KA 1JNEA 1ECQA 2A6LA 4ZB5A 5AZ1A 2WQDA 1QNRA 2UZ9A 2FH8A 3IIPA 3LHZA 5AVHA 2QXWA 1J12A 3LBOA 1FKWA 5DQPA 1GYNA 4TVCA 2C19A 3JZUA 5CZSA 3CUHA 2ZA2A 1T5AA 1H7PA 2ZE0A 5G4HC 2F6UA 1YTEA 1R2RA 4IMGA 4J2MA 3TEVA 1F8MA 4AF0B 2VX4A 1WV2A 3PB2A 1US0A 4UBPC 2GSHA 3QEZA 1I60A 2PBOA 5LA2A 1A5AA 1BWKA 5CJNA 3DECA 1N8FA 1VBHA 1UIOA 4WZHA 4PUNA 1UD5A 1E6RA 3U2OA 1J0IA 2GSEA 3AROA 2YCIX 3G1VA 1WAUA 1E15A 3BLLA 1MSSA 3D5HA 3C56A 3LG3A 3G0XA 3NQCA 3T08A 4HA4A 5FEZA 1JYVA 2Y70A 5JU6A 3AJXA 3G1HA 2A79A 4B92A 1IYXA 1GGOA 3ZMRA 3PSWA 2XISA 1HJVA 3ZJ6A 4MLJA 2P5NA 3S2LA 2CLEA 3W84A 2EBNA 3FA4A 1CIUA 1YW1A 3DG3A 1OC7A 1KV8A 3N17A 3UWUA 4XZ9A 1LRQA 3QFEA 3GDLA 4AX6A 3URBA 3T8LA 2P88A 1DOSA 3CMJA 3R7MA 4JTDA 3LV6A 3GE7A 3S1VA 3KWXA 5GNYA 4LAOA 4X60A 5EL1A 4NZ4A 3RM9A 1CCWB 1KA9F 1RALA 3BQ6A 3IARA 1X1ZA 1CX9A 4HCDA 5KETA 3AHTA 2ZKMX 3N2XA 4M6VA 2DVTA 4QBXA 4GUIA 3PVFA 3W27A 4QJ1A 3VIFA 2G97A 3H21A 4IG2A 1LBLA 4WGHA 1PKMA 3I7SA 1YYAA 5A3HA 4R7OA 4BY3A 5G1MA 4MPKA 2ZBTA 1ISVA 3REQA 1OT2A 2HZGA 1LDCA 4ACYA 3CTLA 3DFPA 2A4AA 1LL4A 1GW9A 3U5YA 4GACA 3FSUA 3NOEA 3B06A 1H7OA 4Y9NA 2CFFA 5HJLA 3WCZA 2CBJA 3GNDA 1XDJA 3EOSA 2CERA 2FGBA 3B8IA 4PBEA 4QCFA 5C9ZA 2J7BA 2NQ5A 4W84A 1X7IA 2QCDB 4N6FA 3TYDA 3KAOA 3WDRA 2GYIA 1CB7B 4NX5A 2PDFA 4J3TA 2B7QA 1W9DM 4MB1A 4HIBA 5B7YA 3WDPP 1ZRQA 2E68A 2GDUA 4ZQRA 1YADA 3CLWA 1SJBA 1UPMB 3D3AA 1OC6A 2ON3A 3MSRA 3HG5A 5AC7A 2ACRA 2W27A 4S3AA 3I4EA 1SSDA 5BU6A 1ESWA 5LSMA 3EWYA 2VQUA 1AODA 2V5DA 3K4DA 1EP3A 2B7NA 4GO8A 2VOTA 4DB7A 1JCXA 2PC8A 4JNYA 2WVVA 5C6MA 1OZMA 2ZX8A 3LOTA 2KX9A 1W1B1 3ATZA 1F2JA 4CCCA 3B97A 4KS0A 3RAOA 4U10A 2EPNA 2G96A 2QVNA 5CLWA 1QWGA 3MQTA 5A94A 1N8WA 2PDWA 3OO2A 2VCBA 2CBVA 5CJ5A 1CGXA 1EXBA 2VC5A 3TMLA 4LAUA 1TV8A 1TUXA 1XIMA 5IBXC 1M7XA 1V3LA 5CGQA 3JU2A 4ATLA 1GOXA 2QMJA 2QAPA 1GVYA 1N82A 3CWNA 3Q4DA 3FV9A 4QIUA 2A7NA 1BXCA 4IX2A 4LTSA 2ZE3A 2INEA 1QPKA 1XYZA 1M7OA 4LBUA 5BNKA 3TUUA 4LVGA 3NO5A 3IGXA 3GH7A 2P10A 4XSLA 1TPFA 5CG0A 3HM7A 3S8HA 3LTPA 5CCZA 4HHLA 1BSIA 2QJNA 1Q4NX 1S5NA 4D6IA 1A50A 2XGBA 3BH4A 4DAIA 4NNCA 1Q6QA 3HJEA 2IPWA 3OVGA 2F6KA 4FXFA 3MUZ1 3WFZA 3OW1A 3XINA 3SUSA 3S5SA 5GNXA 4MGGA 2EG8A 3OODA 1W1IE 1PAMA 3C4UA 4ZA0A 4W7UA 1VLIA 3TMQA 1A5MC 3M43A 4INFA 3CAVA 5HPCA 1H1YA 2Y4SA 1DL3A 2V82A 4D8LA 1SZNA 4DLFA 1XBVA 4YMZA 2D0GA 2PDKA 1N7KA 4NAEA 3H7RA 1D2KA 4C6QA 3QLDA 4HCHA 3QHOA 1LWIA 4OOZA 1EEXA 4BF5A 4LPCA 2BNJA 3RN6A 4LCSA 5A5WA 1PHWA 2RGMA 5KMYA 4H6QA 1WCGA 3VDCA 3BXWA 1P7TA 2A7RA 4IL2A 3LENA 4LUJA 1NF0A 1XKJA 2PS2A 3M5ZA 1I1XA 4EVZA 4AW7A 3RHGA 3DFYA 1J0ZA 2WSRA 1V93A 1ENUA 1XW8A 1VBJA 4UFIA 2WKGA 3EMCA 3II1A 1I9CB 6CGTA 3N9KA 4UMCA 2W3ZA 4AD5A 3POCA 3TR9A 4G2DA 1F4HA 2AQVA 1NDWA 4UR9A 2VEFA 3M16A 2ASHA 5HULA 1VLWA 4YIWA 2PWFA 4TX8A 3GW3A 3BSMA 1FWCC 1GOKA 3L0NA 3UJRA 4B3LA 1QATA 2ZZ5A 1TVLA 2V8ZA 3WF2A 1DJXA 4F9JA 4JTTA 1WE5A 1ZAHA 4H6EA 4ZSTA 2PDQA 3WBYA 2DZTA 2OWXA 2A3BA 5EMJA 1AH3A 2B0MA 1J96A 1WDPA 3CC1A 4K7YA 2V9DA 3OA3A 1D7FA 4G1KA 3IWPA 5HMDA 3CQKA 1EJVC 1EA9C 4YL2A 3W00A 3NPXA 2PP1A 1R3YA 5ABHA 3V0TA 2EPOA 5BRBA 3RPMA 4OBRA 3C6CA 5A8MA 1RAKA 4DF0A 1MO0A 1PYMA 1FCBA 3N9RA 5I06A 3MSDA 5AZ0A 1JZ6A 4HD5A 3AMDA 1DWFM 4TR9A 2H3BA 1UW9A 1QW7A 4JIIX 5TD4A 3RLUA 3VNYA 1TMQA 1TTPA 4YTQA 1TPVA 3NQFA 3GH4A 4HTBA 4MNKA 4NZ5A 3IJLA 1GWJA 4FEZA 1PIFA 2IQDA 3VNMA 4C6CA 4L4OA 2VEGA 2ZCGA 2FQIA 4K7VA 4OE7A 3CTTA 1KR1A 4FOKA 1YPFA 1UA7A 4NJKA 5F7UA 1B3VA 2PODA 4YVVA 3OU8A 4AUBA 3O6YX 2V2HA 4XSMA 1ZTVA 1TQXA 1RP8A 2GK1A 3G1AA 4BEUA 4PTXA 1AMYA 4HMEA 4JHZA 1TX0A 4HU0A 1TJ0A 4FNRA 4P61A 2WLYA 4RZ6A 1US3A 5IDZA 2E6YA 3BJFA 5AYZA 5CBIA 5CXPA 4J3ZA 4GD0A 2YCLB 1DQWA 4GZIA 4QISA 4GYFA 4QS5A 3KS6A 4LS2A 1VPQA 4ZCWA 5C9WA 4CUCA 4RE2A 3M5XA 2WCGA 1WKYA 4HA3A 2PGFA 4ADSA 4PTMA 3UNTA 3BCJA 2REQA 3K2GA 1MRAA 3FJNA 5F4WA 3RLGA 3CNYA 3RPTA 4GY7A 2CZFA 4F4RA 3MMDA 3EGJA 3ZWSA 1RBLA 3HGSA 3TNOA 1NP0A 2OMAA 2XH0A 3MZ2A 1B90A 1MXSA 4JTHA 4UFKA 4C7DA 1F74A 1KGXA 4ZQOA 4LUYA 1E0UA 1F3WA 2H9AB 1KXHA 2CWXA 4LY8A 4HPHA 3AYVA 4XZLX 3TU9A 3I6RA 5DY2A 2PE4A 3W7IA 4ZXOA 3NO1A 4OBSA 1O5XA 2OU4A 3EXRA 4FF7A 4LSBA 2NXGA 1BQGA 3WBXA 5CPSA 2VX5A 1OZQA 3AMLA 2NLIA 4XUYA 4MY9A 1SMDA 4H4IA 2YBTA 1Q6LA 2PDMA 3LCXA 1TFVA 4QLKA 1R3RA 2ISSA 3B8UA 1QI4A 3MKVA 3WELA 1RJRA 5M17A 4QHRA 3PPGA 1Q6DA 3CZKA 4IFOA 3B05A 2NQLA 4CU8A 1CXEA 3LXBA 4N7QA 1FWNA 3O8AA 3FVMA 5XINA 3MTWA 4LRTA 4O1FA 4Q8PA 3P2VA 3WDIA 4BQ5A 1IV8A 2NQZA 2R6OA 1X8FA 3IUHA 4QE5A 1SMAA 3MUIA 2VDIA 1SJDA 1V3IA 1RBAA 2G3IA 3SGZA 3A4AA 2OEMA 4CD6A 3ZLHA 4OV9A 3OHIA 1FRBA 3RMEA 1FWBC 3STCA 4DRSA 1P0EA 1G4SA 3PUOA 3DENA 1XD1A 4IIFA 1RY8A 4ZQNA 5EBAA 5I03A 4UTKA 4IXXA 4FNPA 2PTZA 1WZLA 4PZVA 1E72M 1A0EA 3CZEA 3LTYA 1XCWA 1VQTA 1F05A 1K03A 3GK0A 4WDTA 4GOAA 4UFMA 1QDSA 3G18A 3T09A 3W70A 4QAWA 4AXNA 3AALA 4KMQA 4AD3A 3AICA 3WF1A 1EPXA 4JTJA 1GVOA 4JTAA 1UBSA 4RV8A 2QJJA 2DSKA 5EMUA 4OGZA 2PGWA 3V0UA 3DKJA 4GLEA 2ISVA 4O4VA 3TQKA 4FNSA 2ZUNA 3LMYA 4S3KA 2J9YA 3CUIA 4FOJA 3UXDA 4RPPA 3ZQ9A 1X96A 4WLCA 1EGZA 2PDIA 3IJQA 2PTYA 4JQAA 4O11A 4FPSA 3BLPX 4GKTA 3RITA 4JZ5A 4EWJA 1KV5A 4PUWA 1ZQ5A 1KCLA 4PH6A 3FHAA 2X0YA 3W7OA 1JUKA 2A3LA 1KD0A 1UP2A 4ROQA 2VI0A 3ZM8A 1GTEA 1Q2SA 3VUSA 2R1NA 1U5JA 1GVEA 1G4PA 2D3LA 5D9NA 3CZJA 3ZR4A 3SRFA 2C18A 1VBRA 1DWHM 1UH4A 4J4KA 3QF0A 3SN4A 4RW3A 2OYMA 4OHQA 2WZIA 5AYIA 1LUCB 3FVDA 2VRJA 1ISZA 3D6NA 1DORA 2DU2A 3PBWA 1K8ZA 1KM1A 3UWWA 3UYCA 4I6KA 1CGYA 3FSTA 3JZEA 1UR0A 1AW5A 1HL8A 3CO8A 5LHFA 4XAYA 1UKPA 3GC4A 5C9UA 3NZ1A 3WD0A 3NQAA 3WQOA 2PD9A 1OFAA 1REQB 1W9PA 4KESA 3VYLA 1E0VA 3BJTA 2ALDA 5DRCA 2BOFX 3CL8A 4TV5A 1KTCA 1IZCA 2CEQA 4PB3A 5CAKA 4AAJA 6XIAA 1OCQA 1YDVA 3W4RA 1QOQA 3MBDA 1XGEA 1JXKA 3B4UA 2FPYA 3BG3A 4EWND 2H90A 4PRRA 2YOCA 3L4VA 2I5QA 4HK7A 4GA8A 2J25A 7A3HA 2C3ZA 3VIJA 4AZHA 2J7FA 3HGOA 1M03A 3AHVA 3Q58A 3LUTA 3GTHA 4XIMA 1M5WA 2PD5A 2WNWA 4WXYA 4DJFD 3VO0A 3DFQA 2Y5JA 1LCOA 3E12A 4W86A 1ZUAX 4PMDA 2PCEA 3IJDA 4TX9A 1OG6A 4UFJA 1K4GA 4RZ5A 3F2BA 4Q4MA 1U33A 1XYMA 1XLIA 3AYTA 2GDQA 1OX4A 2YYTA 3ZIZA 4B5WA 4DI8A 4NNAA 4KW2A 3U8GA 5AC8A 1JAEA 5G2HA 1WDRA 2OZ3A 4Q6JA 2OJPA 1YIXA 1YRRA 4W7WA 4O0QA 4NASA 3TYCA 1RD6A 3EA1A 3GTNA 1EH9A 4BF7A 3FIGA 4QE1A 5C70A 1RPXA 4KWVA 6A3HA 4LUTB 3GIYA 4NL1A 1WP6A 2PDGA 3VOHA 3QMTA 1KCZA 5CSUA 3L21A 4DUVA 4AY1A 5HBFA 3RJXA 1JVNA 2J62A 1M7JA 1SGJA 4TOQA 4GJIA 1DTNA 5I00A 1F6KA 5F4SA 4Z2LA 4Q6XA 3EPMA 4PYSA 3BSHA 1YQ2A 4D6JA 4PSPA 4GX9A 3WJXA 3S5ZA 1UZ4A 3SGUA 3D0CA 1KQZA 1G4TA 4Y9AA 1I0BA 3NPUA 1JI1A 3NNTA 3UR8A 3FLUA 4V28A 1HKJA 3PWGA 3G1SA 2QW5A 1UC4A 1SFJA 2J7DA 3SFWA 1OBAA 4Y9OA 3C2EA 4EP8C 4G6CA 4FZIA 3CK5A 1KKRA 4ZE5A 2R91A 7PTDA 5I5RA 2XUCA 3L5AA 2J7GA 5C9XA 5AFDA 1A80A 1QPRA 1MW2A 3CUZA 4JKMA 1EDGA 2H3DA 1W3NA 2YIHA 3CHVA 3L0KA 2ZX6A 2ZUUA 1E1EA 4ERGA 3H2OA 3HB9A 1V6WA 3GVQA 2PP3A 1GG1A 2XG9A 2OGYA 4IOTA 4W5ZA 1QI5A 4MHBA 3EZ4A 2E6AA 4WY0F 4UQ9A 1TPUA 5JIPA 3WH7A 3ZZ1A 2WC7A 1WKFA 3ANYA 3AIVA 2TODA 1KBKA 3MCNA 1JQVA 4NAFA 2GDVA 2POTA 1CBGA 1CZ1A 3BOLA 3RU6A 4W7VA 4WCJA 1SZEA 4X9SA 4YHEA 2G4JA 1NVMA 1THFD 1U1JA 2ZA3A 3AXXA 1Q8AA 1FP9A 4LW7A 1WZKA 1ZU8A 1NWUA 2O7SA 1AD1A 3KRBA 3GYEA 3DU0A 3FX4A 2G95A 4CQAA 2DSWA 4CQCA 2DJXA 4LF1A 4PB5A 1ZY9A 3M44A 4O18A 3ITCA 4DBUA 3THAA 4RK8A 2EPKX 1F3XA 2PRLA 4ZEPA 1C91A 2QIIA 1G1YA 1VCGA 3SY5A 4HNVA 1IEWA 4GG9A 3GY1A 1W8SA 3ARPA 2HRWA 3EYPA 2QDGA 2EF9A 4F2UA 2HBXA 4IH3A 2Q3RA 3N12A 1SW7A 4LCQA 3T42A 2WVSA 2EG7A 2ZIDA 1AK5A 1PIGA 2JIEA 3CAWA 5XIAA 4ZOCA 3ZS4A 4LUSA 3I10A 3VKDA 2DORA 3BAIA 2ZRYA 1JDCA 2E4TA 2QF8A 2G37A 5IFPA 5FOOA 1SJAA 1OC5A 5E70A 1E71M 2FHBA 3VOIA 1AG1O 2C7FA 2I9UA 3RG6A 4KKXA 4N42A 3DFTA 3JR2A 2Q8ZA 5CSRA 1XIFA 4U5IA 3STFA 1TPEA 4L6DA 3EB3A 2IPGA 2QUNA 3O06A 4DAFA 1M68A 5ABTA 1UG6A 3TZNA 5BXSA 1HGWA 1VZWA 3LNPA 3WQVA 2Y62A 2NV1A 5FF0A 1VCFA 4HZ6A 1IE7C 3WUEA 3TYAA 1UB3A 1KO0A 1PZ0A 5HR7A 1TJPA 1ZCCA 3ZT6A 1E56A 4FMVA 3M0LA 1QW8A 5D9MA 2HROA 3S2NA 5I3HA 4UTWC 2FGZA 3LLFA 4MAZA 1XQKA 3PBYA 4FALA 2P53A 1DJYA 4FK9A 1RUSA 4AISA 2OQYA 4M51A 2ZRVA 4GQBA 4E0CA 4GYPA 2JALA 1JYXA 3NR0A 3EXTA 2R14A 3P67A 3VC6A 4Z17A 4B15A 4B3KA 4GPNA 1CT5A 1NWTA 1BPLB 5A2CA 3WLSA 3W2NA 2J6XA 1EP1A 1P48A 4IIGA 5LIXX 3WK0A 3BCFA 1VP5A 3KBMA 3OG3A 5E0FA 1UD6A 5HMFA 3GG1A 1K7FA 3M5VA 1IT8A 1B9BA 4NJHA 1NARA 1SR9A 3THDA 3NSNA 2DUAA 4XUGA 5AOUA 3P62A 2PEVA 3TXVA 4IQJA 2Y24A 3A24A 2Z1XA 3G8EA 5LA0A 3HIJA 2Z25A 4N9DA 3SUVA 1LBMA 1A5CA 2GQAA 2XYLA 2VRQA 4R7JA 4WQ6A 1IEXA 2CLKA 1OJXA 1Q4WA 1YMYA 3VOFA 3LM3A 4FF5A 1XYAA 3LRMA 4M56A 2BY3A 4REQA 1UKOA 2ZZ6A 2O9TA 3NOYA 3W1QA 1VJSA 2NUWA 3R11A 3LDVA 2C0HA 4DWSA 4CU7A 2WO5A 5C2GA 4QFUA 1V0KA 1LLWA 3PZNA 1KRAC 3WZ0E 5HPOA 1EIBA 2YLLA 3RX3A 5D02A 4RXFA 2PF0A 3TCEA 3GB6A 3T8QA 2E0PA 5EMYA 3LQGA 5CPTA 5DMNA 4H8UA 4K8EA 4M5PA 3TLLA 2G50A 1RCXB 3W85A 5AECA 3VABA 4UTUA 1I2QA 2VZVA 1S2CA 3VNLA 4IF2A 5EFDA 4FB7A 3NL5A 3K13A 3ORWA 4DVOA 2QDEA 4MNLA 5I7GA 2XWDA 3JVAA 1ZFJA 4DHGA 3NJ3A 1SU5A 3W02A 3ZT5A 5EGRA 2WOQA 2PLJA 3WF4A 3GLCA 4IZGA 3RO6A 2PI6A 1E0XA 2YL9A 3P93A 2B81A 3SY1A 4CGTA 1EWDA 3MI3A 1NFGA 4KFOA 2IKIA 3L23A 3VGDA 1W3KA 3E38A 3IVTA 4WRHA 3TTOA 3NQGA 1H09A 2WC4A 1BG9A 1E1FA 1W1PA 2ZXQA 2FLIA 4KCWA 3W2MA 4MWAB 4PCTA 3W81A 3EWXA 5M5DA 2F2KA 4JIRA 1HQTA 1HL9A 1NFPA 4O14A 4B90A 1XCXA 2GUUA 4D8ZA 1DTUA 2D69A 3SM0A 1YDYA 3ITLA 1QW9A 3EOOA 3UZ5A 1W1YA 2ZXAA 1KRBC 4F0LA 5CBJA 1W9VA 5FF4A 4M1RA 4R33A 1E9IA 5GJNA 4PCPA 4Q8TA 4MZ1A 4HBKA 1QASA 1UWSA 4BHYA 1AJ0A 4BWLC 4JYFA 5A2AA 3H2EA 1XR2A 4HU8A 3BGGA 1SZRA 4E8CA 1QT1A 4PMYA 3I65A 2ABAA 4Z0JA 1E1CA 4XKMA 3KW3A 2QCNA 4KIEA 5BRPA 3TOYA 3QLLA 3CPGA 4FLQA 1H61A 3BAKA 3TROA 2VFEA 1GVFA 3H4XA 3HA1A 2X7WA 4YNGA 4Q8VA 4IJCA 4GY0A 3P6LA 3KOWA 3P0XA 3EWBX 1HL2A 1BWVA 5F2IA 1UMYA 1RK6A 3QSRA 2WANA 3EEZA 4HU4A 3S9IA 3OPSA 4ORMA 3HPZA 5I3GA 3V16A 1H63A 4Z1CA 4QITA 4EPKA 3VNJA 1OINA 3GNNA 2BX7A 4CEUC 3E49A 4GKLA 3FDKA 3O63A 1ITQA 4UQEA 4AZCA 4NRRA 3BAJA 3NQ2A 1YHTA 2OSYA 1E3ZA 1R3VA 2X2GA 3EX4A 4LBRA 1PJ9A 1XF0A 4C6LA 7XIMA 1JD7A 3S1GA 4W8LA 4IFKB 4GUGA 4TIMA 1IEIA 3F4CA 3VINA 5M2FX 4I9MA 4LVFA 3SCOA 4MJ2A 4S3GA 1RK5A 4AF0A 1ZJHA 3ABRA 1OEPA 4MNJA 3CZLA 3COTA 3AWOA 4PEKA 4NU7A 3HPFA 4NZ3A 1VJZA 3IGHX 3ITTA 5CSSA 4X2PA 3CO4A 4D6DA 4BK9A 3MC5A 2Y6ZA 3VNIA 3IAQA 3VKJA 1LL7A 2D23A 1XS2A 1L6GA 3OIHA 4H6RA 4Y6GA 5A6TC 3QW3A 1VFHA 1MEIA 3M0MA 2H8XA 3VNKA 4WIWA 4LU0A 2D3NA 4XZWA 5DXYA 3IUIA 4N6EA 4C6JA 4QJ5B 2WZMA 3GNXA 1XLCA 3M0XA 2YCEA 3RUBL 3VD3A 4IPIA 5F2LA 2YZRA 1CI1A 1KBIA 1OGBA 4E2VA 1YDNA 3UG4A 1WKEA 5CC3A 4AB4A 3MY9A 4RDYA 4DO5A 4H7ZA 3RCNA 4CVWA 3AYSA 3BQ5A 4FSAA 3BG5A 4GNKB 2E40A 4NZCA 4PMNA 1BAGA 2V5LA 2VZSA 1PX8A 2QCGA 3QGVA 5I24A 1KFEA 1AQFA 5J8LA 3TTYA 3C2RA 2WNNA 4I8YA 4S3JA 2YX0A 1C90A 4PMQA 1LWJA 3RM8A 2FPVA 4JQ1A 3T2QA 1O94A 1TV5A 3ANUA 4UQAA 4ZMGA 1KC7A 2XVKA 4JDYA 2GVYA 1TRDA 1HIZA 2R94A 3LS9A 2V3GA 2BZNA 3W3OA 4DNMA 1H7RA 4LYKA 2OGJA 2VXNA 2O9OA 2CLLA 3S6DA 3TA6A 2GOUA 1W32A 3P61A 1E6ZA 3AIEA 4LYRA 1VH7A 2R1LA 2DDXA 3TONA 3KCJA 1EGMA 4ZO7A 1VEMA 2YR1A 1DJHA 4YTUA 3RDKA 4NZJA 4OUIA 4I5XA 1DJIA 4B5TA 1P1XA 2PRHA 1VAHA 1K1DA 1CENA 3QPZA 4HZ7A 4XZHA 3VD7A 3ZSSA 1VHNA 4P7QA 2ZADA 2QCDA 5HNNA 4ICNA 1PWLA 1RPKA 5AN7A 3BW4A 4QP0A 2ZX5A 4DXXA 1FWHC 3CZGA 4ZGYA 1RXOB 3MHGA 1ITUA 2C6QA 3MI6A 1JDFA 4E4FA 2IMRA 4QJ3B 3R79A 4P5UA 5FAGA 3VGEA 2JF7A 2MUCA 4OECA 3V35A 1HKWA 3NVTA 2DVUA 3W2UA 3LB0A 4JQ4A 4E4UA 3M41A 4D1JA 4AMCA 4HNCA 3SUTA 1Q6OA 1H49A 4YN5A 1C92A 5J5DA 3H7VA 1OM0A 3GXIA 4AZBA 4ZL1A 3UR5A 2CBUA 5E1QA 2ZC1A 5DEZA 1VFUA 2TPSA 5T26A 3IVUA 4OVXA 3O9NA 2P3ZA 5D2VA 2V3FA 1EZWA 4GUJA 1W56A 4GYPC 3R8HA 5I3DA 4GI9A 1J11A 2QVHA 1QI0A 3O2LA 2ZDRA 2X40A 2QPUA 2FMOA 4GBDA 3BUVA 4QGCA 4DBWA 3QW4B 4C91A 8XIAA 4XO7A 3DI0A 4O53A 4IFRA 4AD0A 5JBEA 4QSFA 4EK7A 3LXCA 3MP3A 4HA1A 2MNRA 4Y96A 4EF9A 5A8NA 3EX3A 2NUXA 3PZVA 1W3TA 1UC5A 4A8RA 1S5VA 2FB2A 2YSWA 1AUSL 1PPIA 3OYXA 1EJWC 1K6AA 4DYJA 2MANA 2Z1SA 4M29A 3GDKA 1C9WA 2G0WA 1NWSA 4LYPA 2DV0A 2OWWA 2QCMA 1I0DA 1AH4A 7ODCA 4IHCA 4GYJA 3H55A 3PBUA 1JPDX 4Y8FA 3PK7A 2VQTA 3TX9A 3EB4A 4FS9A 4H19A 3QR1A 4JKKA 1K7EA 2OT1A 2XH4A 4I6VA 1QTWA 5CLTA 9RUBA 4GZ7A 2OLSA 1F8IA 3UR2A 4E8GA 3MWAA 2Z00A 3PZIA 2A1YA 3K30A 5CC5A 3TYEA 1P4CA 2I17A 3LN3A 3AUJA 1EIXA 4PR4A 4MY1A 4MOZA 3GXDA 1XWYA 1J79A 3UJEA 1GW1A 4W4QA 3GYCA 4Y8EA 3DFSA 3DX5A 4E6MA 3E2QA 5LA1A 3N3TA 1HVXA 1D9EA 3ZT7A 4ZQPA 4GI8A 1T41A 2C71A 2CITA 2CLPA 2ACQA 1GQNA 1ZAIA 2W79A 2VUYA 3RLVA 2Q01A 1VFLA 3H26A 4ZFMA 4FOUA 4LBSA 3GHRA 1ISXA 3GVVA 2EPLX 4M0XA 4I5UA 3W7RA 4RDVA 1TTJA 1XUZA 3DC8A 2P8BA 4L6HA 4H9VA 4PMXA 5DMLA 2NQJA 4HHPA 1EUAA 6REQA 2CLOA 2VD9A 4ICMA 4O1DA 2AGTA 4MMWA 3N6QA 4K8HA 3UY7A 3W24A 2OZTA 3TAOA 1SJCA 2YB4A 4B5XA 1Y5VA 2WJDA 2BDQA 4UTTA 2FZBA 3QV6A 3DFOA 3EDFA 2JGQA 7TAAA 1E6QM 2DZXA 3NSXA 4GIEA 4DQWA 1K4HA 1PL9A 2JF6A 1TZ7A 5G4WA 1DV7A 3MV11 3QHNA 2D2GA 1U5VA 4V1YA 5FEPA 3EEGA 4J3WA 3HJZA 3GR7A 4YCPA 5HJYA 3AO0A 1S39A 3CLMA 1KNWA 2ZA1A 4Q4QA 3GU9A 3UF9A 4DF1A 4WDXA 6PTDA 3T0TA 4J5NA 3H2AA 3R0DA 1UUMA 3TV8A 1F61A 1UWUA 4MUZA 3HGRA 2IPJA 4IISA 1UA3A 2DSUA 3A4JA 1JEZA 3EBVA 1KW1A 1XL9A 4M6UA 2PDPA 2CKSA 1B2YA 5M3WA 4UTJA 2D73A 1WOAA 1J01A 2P1FA 2HNEA 2E5CA 3E02A 2VGIA 1RP9A 3BE7A 1OYBA 2DFAA 3S2CA 3B8SA 3B9DA 3PPFA 3TA9A 3VDHA 4K39A 3STEA 4FX6M 4GXPA 3BGAA 2PBGA 5CZTA 1HX0A 4W9TA 4IGNA 1ZB5A 3W1AA 2HVNA 3MZNA 1Y5XA 4Q8WA 4JR5A 3UNDA 1JQXA 4LV4A 5DELA 2YCLA 3L4YA 1MW3A 2Z6JA 5KSWA 1ONRA 5CGMA 3BLDA 1ICPA 9XIAA 3DI1A 3SW6A 3G1FA 4E2DA 3DHFA 5AHIA 4MDOA 4P7NA 2OOFA 2BY0A 2QR6A 3E96A 1UWQA 5ECUA 1JGMA 1PWMA 3TQ0A 1PS9A 2X1SA 2BXYA 2Q6ZA 4B2DA 2OX4A 4YWIA 2DSVA 3P60A 3WEZA 4FLOA 4UUIA 4H9YA 4FAMA 3ZWTA 1UMLA 4XKYB 1YLVA 1VFMA 4POCA 1HO1A 4KWSA 4GZJA 3ABOA 2H9AA 2C1IA 4F79A 5E6ZA 1O7AA 3UXIA 1WOBA 4YYCA 1GJUA 2IQTA 3VXGA 1FCQA 3DCPA 3GHUA 1ZBVA 1EHNA 5J04A 1TE1A 3PBMA 4WJ8A 4MKSA 4KGJA 5D38A 2FZNA 3GRIA 4Q7BA 1H7WA 1R85A 2YXOA 1PO9A 2YDRA 1TWDA 4PUKA 3ELFA 3PFRA 5G1YA 3A6OA 5H91A 1P6WA 2G41A 4GYKA 2AGKA 5CH9A 4HP5A 4UNIA 3W7PA 4L4MA 3SSJA 1SYTA 1TV4A 3QV9A 1JAKA 5HWMA 3PF3A 3LHUA 4O13A 3I3DA 1SFSA 4QEHA 4GZEA 3UGVA 1XYBA 1UQZA 1GOOA 3T4CA 2DY3A 4KWUA 3O3RA 3W0KA 1GYMA 1G6CA 1LT7A 3OP2A 4IPJA 5HJXA 3LTSA 5HNUA 3HGJA 2GGGA 2EG6A 3GSMA 4ES4A 3HBLA 4MJ4A 2P8CA 4X3ZA 5EKYA 5DRIA 5D2WA 1MFVA 2WWDA 3MJMA 3IGUA 2PWUA 1IEVA 1VRDA 4CNPA 1TX2A 3K1GA 2TMDA 3IPWA 4MG4A 1JPIA 2ATSA 1ZZMA 4JTCA 1H3GA 1J5SA 2HBVA 5G5IA 1J9YA 5A6JA 4UQCA 5CG7A 3WEOA 1LT8A 4XTDA 4U3AA 1EO5A 3RF9A 3OVPA 2BG5A 4O12A 3TC6A 1VYSX 2INZA 3L4WA 1R9ZA 3T4WA 5GQBA 1KGUA 3MP4A 1M53A 4TV6A 4JIHA 3W7KA 4MJZA 1GOMA 2UY4A 3TIMA 3E2RA 4GE8A 2PTWA 1P0BA 1RBOB 3KL5A 4HSHA 4QLLA 3AZSA 2ZUMA 1U2YA 2ZQ0A 5HMSA 4D2JA 1GJPA 3WQ5A 1JZ5A 4EANA 3BLIA 2DEPA 3BCDA 5JVLA 3W29A 1JZ4A 4FXSA 5LNVA 1UR9A 4ACZB 4FNUA 1Z6KA 2FHCA 1A5LC 4ZO6A 3ES8A 3CQIA 1FHLA 3W73A 4H9ZA 1OGSA 1SZGA 3A3XA 1FA2A 2AL2B 3PZUA 3MV01 1N8IA 3G6MA 3VX1A 3R13A 4PMJA 2GWNA 4PTNA 5E9XA 2IKGA 1GZ1A 3ZJKA 1HP4A 1YXDA 3S0CA 1XSKA 1XCFA 1RVKA 1IGWA 3VI2A 2F61A 2DGAA 4EAYA 3ABZA 1JR1A 3W1RA 2VT0A 3NPWA 4A2RA 4U5KA 1OYCA 3CV7A 3GUWA 4XAFA 2VEIA 3DBNA 3KBVA 4HPXA 1QK0A 3DYOA 1RA5A 1OHLA 2F8QA 5HA7A 4BKNA 5HQLA 4LY4A 1XIDA 5K9DA 2FVKA 1B31A 1NDYA 4FA3A 4B5VA 4UCGA 1OIMA 4S3BA 1M6JA 3H70A 3UPWA 4DM2A 1KTBA 2ZX7A 2DUZA 2Z26A 3ZLFA 1GVQA 3ARWA 1H0GA 2Y7FA 1DQXA 3L7RA 4KFNA 3KOFA 1H1NA 2FIQA 4OZOA 4H41A 3AS0A 2C1HA 2JBMA 4OU1A 1ZL1A 4I5RA 2BTMA 1P0NA 3UERA 1REQA 1XM3A 1HJQA 1EJUC 3EWWA 5IDIA 3R1ZA 2HK1A 4IPPA 4IPNB 1E3XA 1U30A 1ODZA 4TO8A 3CQHA 4IMFA 4A8LA 4E4PA 1T0OA 3NVDA 3GFYA 1X98A 3QH2A 1RJPA 1L0PA 3ISIX 4GQGA 1K77A 2XN2A 3UU0A 3QPYA 4S3FA 4ATWA 1TJRA 1ALDA 1CLVA 3W71A 4JYEA 1NTHA 1FWRA 3GVWA 2OXNA 5FACA 1E55A 1PKNA 1TR9A 4NP7A 3UCDA 2QKFA 4GFSA 1H51A 1TWSA 2XFRA 4CVUA 2XPKA 1VEOA 1TIWA 1XLKA 3NTYA 2WSKA 1EL3A 3VTRA 4Y9PA 2W63A 3ZJ7A 4AY7A 3P80A 3TSMA 4AZGA 4GVHA 3GR8A 3TTQA 2BS9A 2QEZA 4PULA 2Y8KA 4JIPA 2WMKA 1W31A 3KTXA 1O6IA 4PBGA 4ENLA 4HYRA 2NVCA 2AAAA 5BROA 1FBAA 1DXFA 1O5QA 3CWHA 3KZPA 1Z9AA 4CD4A 2HE5A 1ZJBA 2HSAA 5M03A 3AIWA 2WWCA 3CJPA 4IX0A 4BQ2A 2PDCA 4ZBCA 2XINA 2Y5SA 4C6KA 4LUTA 4HMCA 2NSXA 3KE0A 3L0GA 3ZR6A 2I16A 1XH0A 1XYCA 1SW0A 2XIBA 3PTMA 2ZUTA 1HT6A 4CQ9A 1E5NA 3VDBA 1KCXA 3UZJA 1AW1A 1I6NA 3WN6A 5BXPA 5MHBA 1ZNNA 1TMHA 2O92A 1V3HA 3KTSA 2B7PA 1LQ2A 4JX5A 4K37A 7CGTA 4PSRA 4HVXA 2E6DA 5EU9A 2CKRA 1SPQA 3WQFA 2ZXDA 4UNKA 2WCSA 3H2MA 3GQYA 5I09A 4F40A 3R2GA 1XH2A 3ITYA 1XHGA 1A3XA 4UMBA 2J88A 2DZPA 4PRWA 1N55A 3IIVA 3AIBA 4C5ZA 2G3FA 3F5JA 4O28A 1B3OA 1MWOA 4IG2B 2V6AA 3KCOA 4AD1A 4L9XA 3WBWA 2YYUA 1F73A 2Z7KA 4HPNA 4HK6A 7REQA 2VZOA 3KM8A 2VX6A 5IBXA 4D6EA 3C0LA 3DIPA 1ME7A 5T9CE 1XINA 4XBKA 1W6TA 4NILA 5FJJA 2GSJA 3HMJG 3S2JA 4QNEA 4O0ZA 1Q3NA 2PC4A 3U4AA 1JFHA 1HJSA 3KHDA 3WLLA 6ALDA 1JRBA 4IMDA 1IT7A 4HB7A 1O1ZA 3VCRA 3NO3A 1P1MA 3QJAA 3N2MA 3VIMA 3CUJA 1BGAA 7TIMA 4IT1A 2XU2A 3MS8A 4HMDA 3LM7A 4GNJA 4XIAA 1DHKA 3RIKA 2W61A 4D8AA 4F66A 3BOXA 4HJFA 2VL4A 3WG6A 4P2VA 1XIEA 1JFXA 4Q7IA 3A3HA 4PMUA 2W92A 4JNZA 3WJWA 4MPQA 4D9PA 4IGMA 2ZOXA 2QLYA 4UNLA 1TWZA 3N29A 4G7EB 2WVUA 3NYZA 5A6SA 4RUBA 2V3EA 2J8FA 3BICA 5GJPA 4GVIA 2V5CA 2YA0A 1FWJC 1T6MA 4JTQA 3L68A 4C6MA 3NEHA 1ZP4A 1VC4A 2PWVA 2B31A 5DO8A 2AKZA 4R27A 3SUWA 1PE1A 3ABXA 1VRXA 2ANUA 3WLJA 2HVOA 1XICA 8RUCA 3MMTA 4I3GA 1HXJA 3SCNA 3NPVA 1XDLA 2POZA 1IIHA 4H9XA 5AB3A 3O7UA 3BLEA 5HOSA 4ZB2A 4F9DA 2OO0A 4OV4A 3GAYA 3MWCA 3JUGA 2YPIA 2GL5A 3B9EA 2GZXA 3UJ2A 4R34A 1EXPA 4OFCA 1ELSA 4FLRA 4I7UA 4JD4A 1B3YA 1PCWA 3T07A 4RZ4A 2ZTKA 2PDUA 4DZ5A 3K46A 3OIXA 1S1PA 3IEBA 1S5WA 3E9AA 1J10A 3TYBA 4XZMX 1MRQA 5JIWA 3B0VC 1WXJA 3M6YA 2PGRA 1VS1A 2FZDA 1H5VA 3B03A 4C6IA 4CNOA 2YFNA 4AZ6A 4A3YA 3NQVA 4D71A 3NQ6A 1GPWA 3STPA 3FJLA 3FN9A 1ML1A 2A3HA 2R1PA 1J0KA 3G2GA 3U0HA 3MA8A 2BOEX 3GH5A 3VMNA 3EDKA 3FK4A 3N18A 1N2VA 1OD8A 3DOPA 1XLDA 3G6LA 1YBQB 4N02A 3E74A 3KUMA 3CL6A 2PDJA 4EACA 3N4AA 1FVPA 3THQA 2V0TA 3UWYA 3P8IA 3BPWA 1PTAA 2OODA 1OK4A 3CBWA 3NZGA 3U2ZA 4QG6A 4WKHA 3KTCA 1LM1A 4L80A 2OVLA 3QV8A 1OFPA 3A9BA 3ARRA 2GLKA 2XIIA 2GGJA 4NI3A 3CEUA 4NSBA 3UGRA 1ONXA 1SSGA 2X1RA 3N25A 1H62A 4JX6A 3W1TA 1G7UA 2GOKA 3L2LA 4C1LA 3PULA 3FA5A 1BYDA 3PUDA 2V5JA 3F4VA 3ONBA 2GVEA 3ITVA 3BL3A 5EBUA 2Q8XA 3SAZA 4UOQA 4WSKA 2RJGA 4MY8A 2GVLA 4QNWA 4YHGA 3MSYA 4IQLA 3PP7A 4B5UA 1NDZA 4GINA 4DZHA 6XIMA 2V81A 1IF2A 3VZYA 1L6WA 4JN7A 5HQEA 5HK4A 5C2XA 4A3HA 1SO4A 1KGWA 5HATA 2JKEA 3PG9A 3O16A 1L6SA 4JIEA 1UIPA 1TPWA 2CIPA 4RNHA 2QMKA 1V08A 1KB3A 1FOBA 4HOXA 3LRLA 5D8ZA 1SUXA 2G3NA 3VCCA 3RILA 3H22A 3W7LA 3WH8A 4YS1A 1W9XA 4R9OA 1QO5A 1QWKA 3TJXA 2TSYA 1AL7A 3L4TA 4Q8UA 2XN0A 1XRSA 1UH3A 4WY0A 3URNA 2FTWA 3W1NA 2RGLA 1LRTA 5ABFB 3KBSA 5E09A 2VRKA 2VMFA 4QROA 3U7BA 1GZGA 3CHFA 1VYPX 4RNIA 1Q85A 1UROA 5I79A 4L6OA 5I3JA 3U4FA 2E3ZA 3GZAA 4C6DA 2WW5A 3AXHA 1YXCA 4O1CA 4EPDC 3GX9A 5AHFA 1KLYA 3WJSA 1V02E 1TSIA 3ABQA 3CQJA 3IV8A 4GWEA 1E6NA 1VIZA 2XFYA 1I2RA 1ONEA 2WSYA 4A8NA 4GK8A 1AMKA 1H1ZA 1NELA 1FWDC 3EPOA 5A6MA 4Q7NA 1XG4A 4Z2KA 1WBJA 3G22A 1LQ0A 1AW2A 3VFCA 1UR4A 2QJMA 3WEMA 1GKQA 2CHOA 2J13A 5I3FA 3HPSA 1EHAA 3LI1A 4C1KA 3C0JA 4LFYA 1F6PA 1BXNA 5U4NA 4D6GA 1OK6A 4NF7A 3AI0A 1OF6A 2DPEA 2F84A 1W3HA 3N9SA 2VDHA 1G94A 2GQ3A 2CBIA 4PUJA 4JFWA 1UHVA 3EPNA 3MPGA 4FHAA 4UB9A 1NEYA 3GUGA 1RZMA 4V27A 3PY2A 1XYLA 3BJSA 4JFSA 1BXBA 3NQEA 4AYSA 2QUTA 5E93A 4CNSA 2X05A 2PDYA 4CCDA 2NT1A 2C1GA 5ECVA 1B3XA 2DT3A 5BW6A 3BMWA 4X9YA 2VFGA 1G69A 3IV3A 3BVJA 4QXIA 3PJTA 4HGXA 1LL6A 1IR2A 1UOKA 3MHFA 3UXAA 1XSIA 1QRQA 3AHZA 4B2DD 1A5OC 1E4MM 4QJ4B 4DXKA 3GVRA 3W88A 1UZ1A 5EFFA 3K4WA 2WLZA 1T8XA 4PTDA 2C13A 3ALGA 3I3EA 4WD0A 5BXRA 1M9HA 2TRSA 2WC3A 1IT0A 1EC8A 4HQVA 4UIOA 3WLPA 3QQ1A 1EJTC 4CN4A 4X0VA 1EYEA 3GIPA 4GY1A 4J1OA 1E4IA 4FXRA 4LS1A 1JD9A 1V0MA 3S5NA 1QBAA 4IMCA 3S1XA 3N2OA 4N2YA 4L9ZA 5BOOA 2D2JA 3G77A 4NKCA 2W6RA 1WYIA 3E0LA 3NDYA 2E7FA 2CHNA 3VIPA 8XIMA 3HZ3A 4HOZA 4AVNA 3PZ9A 2C8NA 2ZRUA 3TN5A 3VC5A 1TPB1 4K1GA 3RLHA 4IFKA 5IOBA 3BZJA 1VPXA 1J8VA 1NIUA 2DSZA 2H6RA 4U33A 1B3WA 4AWTA 5DY3A 4JTKA 4PA8A 3TVAA 1YTDA 1QPNA 5D33A 4FNQA 1QFEA 4FP1A 1SW3A 2G3MA 5LGZA 2HJPA 5H1WA 2HQAA 1NWRA 1YDOA 1EDQA 5FI8A 3V1HA 2E67A 2GJPA 5M1TA 3L5LA 3TSBA 4E2BA 1F5ZA 1K3UA 1G9HA 3T0DA 3E2VA 4K36A 5D2TA 2WK2A 3KRZA 4NG3A 4Q8MA 5GNZA 2WNQA 4O8RA 4WGXA 2Z1WA 1PTDA 1PVNA 2A7PA 4PBFA 1LRNA 4I7WA 3ES7A 1SO6A 3M9YA 3TXZA 2VFHA 1DJQA 4LUIA 3LSCA 1VD6A 5I78A 3F4NA 1WPCA 3O6AA 4AIEA 4NVTA 2EJAA 1C7SA 3L2MA 2A0NA 4PC8A 4A29A 1H11A 3QY7A 4JFVA 4HPJA 3H2CA 1O60A 1KM4A 3A4WA 4O16A 3QPEA 3AXMA 1LORA 3K8MA 3W6LA 3HV8A 4QAIA 2V5BA 1IXOA 1K02A 3CV2A 3ARSA 1GQLA 1R6WA 1E5JA 5EMMA 3R4IA 3WJZA 1Y7VA 4HMNA 1DIKA 4XTIA 3TH6A 1R7OA 4P7LA 5C54A 1KWKA 2OO6A 1J2BA 2BBFA 3UJFA 3M0VA 1FWIC 2P3EA 3EWCA 4EAMA 5I6SA 2BHUA 3OVRA 4K6AA 1TCDA 1JZ3A 4FLSA 1KFJA 3DYMA 2C91A 3UYIA 4P7OA 4UQBA 2B7OA 1A3HA 3R8GA 1QO2A 3R43A 3PWAA 1R3WA 1U1UA 3E3HA 2BXVA 1FFRA 4PUDA 3QKEA 2X2YA 3SN0A 1F6YA 4BA0A 5J5RA 1OADA 2W67A 4W87A 1L6FA 3MVTA 3MU7A 5CEWA 4RCXA 1A49A 2CW6A 3C2FA 2VD8A 4LWWA 1A5UA 2C14A 3WNOA 3I3BA 4KCTA 4U4MA 2EGZA 4AVFA 2OWCA 2Y8UA 1CYGA 3SCWA 1OCNA 4KH2A 3WQEA 1BVWA 2GFTA 4DJDC 3W07A 4H1ZA 4TMCA 3BURA 1Y5WA 3V3WA 4HNTA 2VKZG 3QY8A 9CGTA 4MJMA 1OX5A 2F6XA 5MKGB 1J0JA 2XIMA 4IGSA 1GOQA 4P8XA 1DIEA 5CC6A 3TW6A 3UG3A 1PIIA 3WFAA 5F2MA 5G2IA 1V0LA 3U7VA 3GR4A 3DG6A 2P76A 1XLJA 1JDEA 5IM51 2TAAA 1PCKA 1BFNA 2NX1A 2OB3A 3GG8A 1JG9A 3H6OA 4H6KA 1TQJA 2GJNA 3UFYA 1FWTA 2GWGA 3L65A 3ZYZA 2RFGA 1R2TA 1W3JA 3VD4A 1UR1A 1ME8A 4PODA 4ZSUA 4IJBA 4J35A 2VC9A 3TWAA 1DPMA 1HKIA 4I8DA 3R58A 1TIMA 1R46A 4LX4A 1B1YA 2E28A 3B0PA 1MDRA 3W1UA 4LAKA 1W1ZA 1MW1A 2ZZ7A 1V03A 4JHMA 4KIRA 4WR3A 4MB4A 4U2ZA 2XFFA 1A0DA 3OGSA 4Q4KA 4MB5A 1RY0A 3W1XA 3DFHA 2IS7A 5CPQA 5F2GA 5BCAA 4AXKA 1IEQA 1M65A 3RO8A 4DO6A 3GD6A 2DVXA 4JTRA 4AEFA 4QEEA 2BLEA 3FFSA 3LA4A 1UKTA 1I4NA 1S2WA 4V2XA 1Z48A 4IIEA 4LEQA 4AH7A 4U3CA 4NUWA 3PR2A 1POJA 4DBDA 3U5UA 4IUOA 1XISA 1TV2A 2Y7EA 3H53A 4RNFA 3SCQA 3FDGA 4QG9A 4PUMA 3G0SA 5IHRA 3ENLA 3W7MA 4LJ3A 2J79A 1EB3A 3W37A 3TWBA 5HQMA 3NZPA 1OFOA 2VR4A 5E6YA 1JZ7A 1KFWA 1XIBA 1QUMA 4M7SA 4XG1A 4YVPA 1HJUA 3WK2A 1OSEA 3GG0A 4KWWA 3WQ4A 1TTIA 2R1MA 3AHXA 5AYXA 1OFBA 3I6EA 4DYKA 4UCFA 5FJUA 1K8CA 2WZEA 1SFLA 2J7CA 3UWQA 3IJ6A 3RFAA 3L4UA