3I7SA

Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIREATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title How essential is the 'essential' active-site lysine in dihydrodipicolinate synthase?
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 107
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3i7sA00
3G1VA 5HWNA 1TRIA 3HBLA 4NX0A 5FI8A 3HJZA 3PBWA 4UR8A 2E5CA 3EWXA 4NJIA 4JD4A 2DZPA 4FXSA 4WUIA 3E02A 3IVTA 1EWDA 2QCMA 1YPIA 1FXQA 3TSDA 1YTEA 3OVQA 1A5SA 2WOQA 1ICSA 5A5WA 2X1RA 1KTNA 2NXHA 1LORA 5K9CA 1K03A 1TTPA 3U8GA 3ANYA 4Z1BA 3MI3A 3T78A 5K3VA 4IPJA 4FIRA 3TU9A 2ZA3A 3NM1A 4AWTA 4B5NA 1LOQA 1ME8A 3NNTA 3PAJA 1TPH1 1X1ZA 2QUTA 3Q37A 4AHPA 5AOUA 2RFGA 2J6XA 3GYEA 3LX9A 2X1SA 3L68A 3L5MA 3P84A 3C6CA 4O0KA 2CFFA 2NUWA 3KHJA 3FKKA 4WX2A 2ZZ4A 3IRDA 3IV3A 5MHBA 5C6MA 4N9CA 1AW2A 4HPJA 1Z48A 4QJ1A 3VI2A 4O1DA 4R34A 3G1XA 3B03A 3GNDA 3LCLA 1LZOA 1F6KA 1XUUA 1B3OA 4H6KA 1KFJA 1TPUA 4RV8A 2CW6A 4UMBA 3W22A 4P61A 3I7SA 2CWNA 3G8RA 2WJZA 5TQLA 4O17A 5LGXA 2R91A 3H54A 3ZR4A 2HS6A 3GB6A 5CZTA 3D0CA 1I2QA 2GQ8A 4X9SA 5C2XA 2E6AA 3W2NA 3QM3A 1EA0A 3HGRA 4EIVA 2YX0A 5AHLA 1S5TA 4EVZA 4Q33A 3HG4A 5CSSA 5CPOA 3BG5A 5HR7A 2FIQA 2HTMA 1P0NA 4YMZA 3NR0A 3QH2A 2GPTA 3KXQA 1NEYA 5KTLA 4NQ1A 4TO8A 4ZQCA 3TCEA 4UFLA 2NZLA 5LNRA 1M7PA 3TFXA 4OQVA 1P4CA 1DHPA 1XKYA 3G1YA 2HSAA 3W70A 2A2IA 3ZWTA 1AW5A 2QAFA 4UMAA 3P62A 1TB3A 3I7QA 4LVAA 4XKYB 2F84A 1ALDA 6TIMA 4LUIA 1DOSA 2J9ZA 3T44A 1PCKA 1DBTA 4GRSA 3IIXA 5BOOA 5EKYA 2DZUA 4FX7A 3R12A 2VENA 4PFMA 1QPNA 4O10A 1VCGA 3FA5A 1SO4A 1J2WA 4DO5A 2A85A 4JX5A 1W3TA 4CLMA 2Y61A 3T55A 3LV5A 2NLIA 1QDSA 3GKFA 1PE1A 1WBJA 4O18A 1SZNA 2QJIA 3QW3A 5E93A 3P80A 2GVLA 1YLVA 5F2LA 3GXTA 4WY0A 3CLMA 1I4NA 1EWEA 1LBMA 3S1VA 3QRHA 4L4LA 3SGZA 4ALDA 3W2KA 3M9YA 3CPRA 3P60A 3WK0A 1RQHA 3HB9A 1M6JA 1YXYA 2E6YA 4MY8A 2GJLA 3HQ1A 4AHQA 5J5DA 2PCQA 3TKFA 1SW3A 1KM3A 3CWNA 1QOPA 3LHYA 4LVFA 4NNAA 5DN1A 3P5ZA 1EUNA 3S5OA 3QPYA 2QCHA 3LTSA 3NQFA 5C55A 3A5FA 4HKPA 5KZDA 3T4CA 2HMCA 3Q2DA 2D73A 5FF3A 2E77A 2NV2A 1VR6A 4H4IA 2RH9A 3EWWA 1HFBA 2NX1A 5FEWA 1LBFA 2FTPA 2VFDA 3TXZA 3W74A 3W76A 4WXZA 4JICA 1OX4B 5FEPA 3W1TA 3B06A 4I9AA 3CWOX 2FJKA 2YCEA 3S5YA 4TU1A 3BG3A 1QOQA 3F4NA 4DF2A 1F5ZA 3BPWA 3BVJA 3V1PA 1WA3A 1JQXA 3INPA 2WQPA 2ZCGA 1K7EA 4N6FA 4Q4KA 2CLEA 1DVJA 4UCGA 3W23A 3N2XA 1L6WA 3W7PA 3T7VA 2QJHA 3BGJA 3M0ZA 1H63A 4IX2A 1FCQA 3NQ6A 1QPRA 4QNEA 4ZQMA 3HMJG 2V9DA 2JGYA 3U6WA 2ISSA 2FB3A 1A5AA 5T26A 2QCGA 1MSSA 2RDTA 1YPFA 1R30A 4LU0A 3IIVA 4NJHA 5H91A 1TRDA 4BFAA 1K3UA 4JTTA 5F1UA 5A8GA 1VYSX 4RLIA 2ZZ1A 3DHDA 3PBYA 2JKAA 1TTQA 4NJKA 4WD0A 4NZJA 3DKLA 3GR8A 3GDRA 1VC4A 4J9JA 2NV1A 3TROA 4EF9A 2CLLA 1RZMA 3HG2A 2A1YA 2B7QA 1H62A 4WZHA 1H5YA 3NG3A 1KFBA 4RR4A 4S2CA 3TX9A 3G1AA 1BTMA 3R5EA 5F4XA 1XL9A 1KFLA 1IIHA 4CNPA 2BTMA 1NFBA 1UUMA 4BI7A 1W1ZA 5CG7A 1OG0A 1LROA 1THFD 1TPVA 1R2RA 3P82A 2ZZ2A 1JUKA 3S9YA 1W5QA 4TMBA 1VYPX 3KRZA 3VE7A 1S5WA 3DKJA 4N4PA 4QSHA 4LRTA 3CQ0A 5D32A 1AG1O 3GXPA 1ZFJA 4UIOA 2DORA 2O7SA 1SZFA 1GTEA 3DFTA 4JTHA 3PG8A 1EPXA 1YDVA 4Y8FA 1SSGA 4PTNA 2QJGA 1IGSA 1KW1A 4UTWC 4LY8A 1F76A 5G2HA 3NZRA 2DZSA 3EX1A 3KOFA 1OF8A 1QO5A 1W5PA 3FYPA 3TXVA 1G4TA 4JTSA 1KV5A 1OYAA 4ZQPA 1LLWA 2EGZA 3MMTA 4N02A 3ZFHA 4MZYA 3FIGA 4A21A 3QMTA 1NF7A 1SW7A 1GEQA 4LNYA 1S3HA 3E12A 5I3KA 3JR2A 2VFFA 3C56A 2C1HA 3BK0A 1MXSA 3LXCA 1ZY9A 4X22A 4KFNA 1LLZA 3LI0A 3PBUA 1HTIA 1ZAJA 5HNRA 4ADUA 2ABBA 3BLIA 3WK2A 2ZZ7A 1ME7A 3MP3A 5CPNA 4IXXA 1KFEA 2A6NA 1GG0A 1Q3NA 4LUJA 1V5XA 4JTJA 2NX3A 3KX6A 3TH6A 4A2RA 2E5DA 3T40A 4CNNA 4FHAA 3KRSA 3LCGA 4JTLA 3FLUA 3G0UA 1KM5A 2EHHA 3CEUA 1VHNA 2E68A 2FPVA 1J4EA 3NPUA 1FWTA 1I2NA 3TW7A 2I1OA 1M5WA 4GE8A 5LZLA 2E6FA 1T99A 2C14A 1R46A 3W2UA 2V82A 1LBLA 2NX9A 3E49A 1JR1A 4LC6A 4U4MA 3NQ8A 3HG5A 2PURA 2UV8G 4Z08A 2RDUA 1GG1A 3L9CA 4M7TA 4GC4A 1TQJA 4U28A 4JIPA 4M7SA 2J88A 4DPPA 3LBMA 3UWYA 1AL8A 5FESA 1H1ZA 1VZWA 4S2BA 3THQA 3LHVA 1ZHAA 5I3HA 3STCA 4MIMA 1OHLA 4UMCA 2IQTA 4FNQA 5G1YA 4GXMA 4JNMA 2Z6IA 3QZEA 2BWGA 1RD5A 2ABAA 1QPOA 2W6RA 1ML1A 1QNVA 3NPVA 5K4XA 1MZHA 1OX5A 2CLMA 3HF3A 3OVPA 1MEIA 3PUEA 3W7LA 3PVFA 3CU2A 1FXPA 3GAKA 4IQLA 1B4KA 1XBXA 2QEZA 1H7RA 3NAVA 1H7OA 5DBTA 3GDMA 1IF2A 4TMCA 2NXIA 2OT0A 1G67A 4WY0B 4ZQOA 1FWSA 5LKYA 3B8DA 5HR6A 3PUDA 3IIPA 3W2JA 1VS1A 4RJEA 5TIMA 1GZGA 3LOTA 3M5XA 3QSTA 2H6RA 3L5LA 1X1OA 3N14A 2YW4A 3PWAA 2ZZ3A 3PG9A 4HT3A 2A4AA 3DZ1A 1Q6RA 2ATSA 1PS9A 5CZ0A 4K7VA 4UFIA 3VKJA 1SSDA 4PC8A 1JUBA 3W88A 1WBHA 3NDOA 3KAOA 3FJ6A 2GVGA 3M43A 3LB0A 4TR9A 1VHCA 4NVTA 4LC8A 4LVGA 3PS7A 4K8HA 3OA3A 4FNUA 5D2XA 1QAPA 2CLOA 4AWSA 5G2IA 4GNJA 5KITA 3P7YA 2C0AA 1Q6LA 3EWZA 4MY1A 3E96A 4IX0A 1W5MA 4ADTA 3SGUA 5AHMA 4K38A 5D33A 3BARA 2BLEA 1LDCA 3NQEA 5HUPA 5EBUA 3GNNA 1PVNA 2A21A 2WO5A 2TYSA 1FWRA 2E6DA 3MHGA 1NSJA 3KVLA 3UZ5A 5D02A 2ZZ5A 4YCPA 4Y6GA 1N7KA 1QWGA 4HNVA 4O50A 3W2LA 3RFAA 4HSNA 4X3ZA 4AF0B 2Q8LA 4HIBA 3NL3A 1VGAA 3HO8A 3NVTA 3NO5A 4K36A 1YDNA 1GVQA 3RLUA 2DJXA 3RNDA 1SQ7A 1TQXA 3IIZA 3TC6A 2CLIA 2X1UA 2DU2A 3LCHA 5F2MA 4C1LA 3TV8A 1IXOA 1B57A 3B04A 4XTIA 1YADA 3W07A 1G7UA 5LNWA 2JK2A 5DCEA 4MLRA 1FWNA 1W5NA 4MKNA 3M6YA 5CZJA 3HPXA 2B7OA 4NNCA 2V8ZA 1PV8A 4O1CA 4RXGA 3NOEA 4UNKA 1JCJA 3K30A 1UCWA 2E1DA 1UJPA 4JTEA 1E51A 3S1XA 3BG9A 3KRUA 3DENA 3TK7A 2ZRXA 2BXVA 3HIJA 3GLCA 3PF3A 1JQVA 4O14A 2TPSA 5ABTA 4JTGA 2P10A 2J9XA 3MI2A 3CHVA 1KBJA 2A7RA 1FY6A 4IJBA 3E0IA 4YLWA 5E0KA 3QF0A 1AK5A 4JEQA 1W56A 3QMSA 4KFPA 3L67A 2VEMA 3W1UA 1JRBA 1VRDA 1QO2A 2Y63A 4XBKA 1KFKA 1DJNA 1O5KA 1H7NA 2CZDA 4I7UA 3W83A 4IWWA 1JCLA 3MJYA 1OFRA 1IIGA 5AYZA 2C18A 5D30A 1C9DA 3M16A 1IXNA 5DELA 3CC1A 1A50A 3QSRA 1C29A 3PUOA 4HN4A 2V5LA 1CI1A 1GT8A 5D2TA 5J5RA 3G1FA 2PRHA 5DXXA 1YXDA 2VXNA 1D3GA 1LCOA 3BW3A 4FNPA 4DBDA 1HO1A 4UXDA 1OFBA 3OEXA 3VCRA 3ATYA 2ZDRA 3PM6A 3U2OA 2C16A 3W86A 4JTFA 3JS3A 4JDBA 1QCWA 4K7YA 3L65A 3ZS4A 3O1NA 1EP3A 1S5VA 1SR9A 4N6EA 4IMDA 5FF2A 2H8XA 1KM1A 1W0MA 3I68A 3G18A 1XDMA 5KZMA 3TR2A 3HG3A 3N9RA 4QISA 2G97A 5I3IA 1TTJA 2WPBA 3LLFA 1XCFA 3EWUA 3QEZA 3SSJA 3RLVA 4TIMA 4O4WA 1GJPA 5I3JA 4FXRA 1I45A 1RVGA 5U7SA 4R53A 4A3UA 3G22A 5AC6A 2QUUA 2ZZ6A 3FEMA 4K6AA 5AFDA 1G6CA 4M6PA 4GUJA 3IEBA 4LS0A 4NZFA 2QCDB 4K37A 3EXSA 4QQ3A 4LS1A 4UR7A 3I7RA 4AAJA 3W84A 2Y6ZA 3CIXA 3LTPA 4LV4A 3TA6A 4RK8A 4JN6A 3IGSA 3MP5A 3SIZA 1GPWA 3UWWA 2BZNA 4GUHA 3EKLA 4ICNA 3FOKA 3M44A 4RCXA 2V0TA 4WY0F 4PODA 4PL2A 3ZWSA 2E09A 1RR2A 1H50A 3NQAA 4OV9A 2HS8A 2ATMA 2RHGA 3ATZA 3DAQA 4AH7A 1H7PA 3VE9A 3UQNA 3MBFA 3EX4A 3O07A 5D2WA 3W7IA 3I65A 3SW6A 4QIUA 1PL9A 5DY2A 2XN0A 2VC6A 1OFQA 1ZAIA 1GVSA 3O16A 3LCXA 3LTYA 3NQ2A 3KVMA 2FPTA 3DFPA 3L0KA 4I7VA 3TAKA 3FFSA 1PIIA 5IM51 3B0PA 4JYEA 4UFHA 4DPQA 4O19A 4UTTA 3GKAA 4CNOA 4FNSA 1C8VA 1F73A 2VFGA 1PHWA 5G4WA 2R94A 5LNSA 4QM1A 4UTTC 3W7HA 3G24A 4LS2A 1H7WA 1XFBA 4N9EA 3RF9A 2DZWA 3P74A 3TAOA 2CZ5A 4O53A 4BF9A 1VH7A 4NUWA 4OV4A 1ZALA 1ZJIA 4JDYA 4O8RA 2WKJA 5LHFA 5AHNA 4Y90A 3QW4B 4AMAA 2V81A 2QCNA 4O16A 2CU0A 2H3DA 2QAPA 4AF0A 3EXRA 1DQXA 4CQ8A 3LBCA 3LHZA 3O06A 4OHQA 3W7JA 2I9EA 1R2TA 3BV4A 2QCCA 2V5BA 1X6UA 2OZ0A 1K02A 2A6LA 4GWEA 1FCVA 1TPDA 2Q3RA 3EX3A 3TQKA 5GVJA 3CTLA 3S1WA 2VFHA 3G1HA 4O52A 3TFCA 1F6PA 5D38A 5K4ZA 5DCBA 1QR7A 3DXIA 4JTKA 2CLHA 1L6YA 3RK8A 4O0ZA 1G7VA 2CZFA 3LXAA 3S8HA 5FF4A 2VEPA 5F4SA 1TSIA 3P5YA 1KM0A 1K7FA 3S1UA 2Y7GA 2A7NA 1TCDA 1WYIA 2XFWA 5DY3A 2ZRVA 4FO4A 5LSMA 4MZ8A 1GYNA 5DCDA 1G69A 1F74A 3CEPA 3V75A 4I7WA 2C15A 1LOSA 1JULA 1Q6OA 5SWUA 4IXHA 2EAWA 2BX7A 1EUAA 3ABOA 2FB2A 5DBUA 1KLYA 1XDLA 2J24A 1SO3A 5C5YA 2GQ9A 5CKSA 4HPXA 3MBDA 3GVGA 4O28A 4NNBA 5K9XA 2FDSA 4ML9A 4UNLA 1OJXA 1P0KA 1OYBA 2Z2UA 4G1KA 4DBEA 5KMYA 4HNTA 3W75A 5DLCA 3M1ZA 1HO4A 3EWYA 2Y85A 1XM3A 5K7JA 1DORA 4IUOA 2V2HA 4MYAA 4JY8A 8TIMA 4R33A 1U83A 3QQ1A 3B0VC 1OFOA 5TBOA 1W37A 5E1QA 3EWBX 1TYGA 3W7GA 3OG3A 1UBSA 1BWLA 4UUIA 5LGZA 3C52A 1GWJA 5HMSA 4PEKA 1BKSA 2VEIA 3WJWA 2X16A 1GVOA 3N2MA 4NJGA 1EB3A 4JYFA 1SPQA 3Q94A 5AHIA 3W6YA 1TJRA 1QMLA 4FX6M 4RZ6A 4CQ9A 4EOUA 5FF7A 1WOBA 3M5YA 2YPIA 1EX5A 2EKCA 4PCFA 1JCMP 5BMXA 1L2UA 1ZENA 3DBPA 1GYLA 2C19A 2Y62A 3C2EA 3EX2A 4MOZA 1T0OA 3PB0A 4S1FA 5L6UA 3G0XA 5CSRA 1GVFA 1VYRA 4AVFA 2DZXA 1O95A 3DGRA 4DXVA 4DEFA 3QC3A 1OFPA 1DKWA 3PY2A 4WJEA 1I8JA 2YXGA 3W87A 1ZNNA 2JBMA 4MPQA 5DXYA 5BMWA 2QCDA 1LRTA 3OHIA 3WK3A 3A21A 3DFSA 1H7XA 2CZEA 1TMHA 4Q32A 5D05A 2GOUA 3PSWA 2TSYA 5D37A 3DI1A 1HUVA 3PR2A 3TW6A 4GJ1A 4R7JA 4FEZA 2ISWA 1LRQA 3W7DA 1I2RA 1WV2A 4OT7A 3W71A 4YXGA 2A0NA 3C2VA 5K9DA 4UFKA 5FF0A 1I2OA 3W7MA 5LHEA 3NM3A 1V7YA 3NYZA 3N34A 4BWLA 5CZSA 1KM6A 1JUEA 3W85A 3O8AA 4BWLC 1MEWA 2AGKA 1M7OA 6ALDA 2ZRZA 3R8RA 4RX0A 1N55A 4IPIA 2V30A 5F2GA 1RQEA 1LM1A 1FDJA 5HINA 4MFEA 5C54A 2JGQA 1A5BA 3DFNA 1JCNA 5F4WA 2B7PA 4BK9A 1TV5A 1NF0A 1MO0A 3C4UA 2PRLA 2V2DA 1YXCA 3KFTA 4L4MA 4Z1DA 3WJYA 3Q58A 5G1TA 5IBXA 4QITA 2KZHA 4UTKA 5HJLA 3L66A 4O1BA 1LTDA 3STEA 2YYUA 3CIWA 2J9YA 1ONRA 2WNZA 3KVJA 5AYXA 3SI9A 4MZ1A 4FB7A 5AN7A 1LP6A 3IVSA 3LHWA 2R8WA 4CQAA 3ELFA 3W7QA 2Y7EA 4POCA 3C0JA 2VFIA 3LDVA 1FDYA 3S42A 1JRCA 2YDAA 4HSOA 1SFJA 5H2ZA 3PB2A 1K8XA 2H90A 4N9DA 1Q45A 2EPHA 1TJPA 3W7NA 3S5ZA 2QKFA 5F2IA 1X7FA 3I6RA 2YZRA 1WDWA 3LXBA 3GXNA 1YYAA 1ZCOA 1XXXA 5CGQA 3DHFA 4OBTA 4LVBA 5L9FA 1SO5A 2Q3OA 1NAL1 3JRKA 3LCFA 2TMDA 2YYTA 3W7OA 3NA8A 1H61A 3BLFA 3MYPA 3WFAA 4DQWA 1P1XA 2WSRA 1OVDA 2QR6A 4A22A 2DZVA 3NZ1A 3LLDA 4FX8A 3TIMA 5CPLA 4DELA 2GQAA 3M47A 3UWQA 1P5BA 1AW1A 1HL2A 1OK4A 4N9BA 4E2DA 2OCZA 2Y88A 4Z0JA 3W3OA 1UB3A 3MHFA 3F03K 1O5XA 3LV6A 1ME9A 3L0GA 2VFEA 5LNVA 5HQEA 2JKPA 2W79A 3FYOA 4FIQA 3USBA 1DQWA 3SR7A 4LWWA 2QUVA 4GUFA 3PC0A 2ZRWA 5AYYA 4A29A 3L2IA 1MEHA 3BGGA 2ZYFA 1FX6A 1SW0A 5G4EA 1O4UA 5BW6A 1I2PA 3NL5A 3AJXA 3DFOA 3RU6A 1VCFA 3MW7A 4DF1A 4N4QA 4H3DA 3WK1A 2QDGA 5D2VA 2A7PA 1W54A 4OWGA 4O4VA 1AL7A 4WQ6A 2YW3A 1XBZA 3NQMA 4JGDA 4RZ5A 2C3ZA 1H60A 1O94A 1W8SA 3TQVA 3S5NA 4DO4A 4RXFA 4E38A 4XZ9A 1VPXA 3F1QA 3A23A 3C3NA 3NQVA 1XC4A 3LGEA 3BW2A 1L6SA 5AHEA 4DO6A 1W3IA 3QPZA 1GTHA 2ZRYA 2FLIA 3M41A 1IXPA 2I14A 2GJNA 1JJKA 4NT0A 4ZL1A 5D09A 3NQCA 2TRSA 5I3FA 4GUIA 3W1XA 4MYXA 5EA9A 2YFOA 4YWIA 4QAIA 2LLEA 4MVAA 3GK0A 3G3MA 2Z6JA 3R13A 3N3MA 3EB2A 3PBVA 4M5PA 4A2SA 3S0CA 1SFLA 2CLFA 3MYOA 1KM4A 2DZTA 4XWUA 2P1FA 2FPYA 2FQIA 3W1MA 3G0SA 5F1VA 1TIMA 4BI5A 2WNNA 5KINA 3W1AA 1Q6QA 3BLEA 2ZBTA 1PCWA 1ICQA 4BI6A 2GUUA 1OYCA 1YDOA 1N8FA 1LYXA 3SFKA 3R2GA 3SJ3A 3O6CA 4XUGA 1K8YA 2NWRA 1Y0EA 3W1PA 3QQ0A 4Z1CA 1QFEA 3THAA 2ZQ0A 3GDLA 4LT9A 1B4EA 2CLKA 2F7FA 3NQ7A 4LOCA 4TX9A 4IMFA 3B0UX 4NJJA 3W1QA 3STFA 4QNWA 4WOZA 3UD6A 2AQWA 2ALDA 1VCVA 3DU0A 1ADOA 3MP4A 1W31A 3NL2A 4JR5A 1W3NA 1F7BA 4EWND 5BRBA 1JVNA 3QJAA 1XBVA 3OIXA 2X1TA 4ZMGA 1TPWA 3A22A 3TQ0A 4O12A 3UYCA 2RKXA 2H8ZA 3OBKA 1K8ZA 3W1RA 1KTBA 4WXYA 4O15A 4Y96A 1JCYA 4Z1AA 5EL1A 5D04C 3C2OA 1HG3A 1H51A 1R47A 5D03A 3KVKA 4NX5A 4YL2A 1LOLA 3M5VA 4O57A 4AWUA 2Y7FA 4UTIA 5KZEA 3ABRA 1OK6A 4JTIA 2NUYA 5LNUA 2Z1BA 4OU1A 4UFJA 2A5HA 4MFDA 4LW7A 3A5VA 1T8XA 2GVJA 4ORIA 4PL1A 4CCEA 5G5IA 3SECA 3NL6A 3UNDA 1TPEA 4NU7A 4NXSA 4RZ4A 1QPQA 4XQ6A 1R2SA 3G3DA 3AO0A 4O1AA 4UFMA 4D2JA 3TJLA 4K39A 3WJZA 4GFSA 4FF7A 3NGJA 1CW2A 3W1LA 3MHUA 4JY9A 4AHOA 2Y70A 2YR1A 4MUZA 4O13A 1XUZA 3P67A 3CT7A 3IVUA 1WXJA 3IGUA 3NXFA 1OFEA 2P0OA 2Z0IA 3UWZA 3N9SA 1WX0A 4JS3A 5EPDA 4E2BA 2WV8A 4PH6A 2WSQA 3FS2A 3TUUA 1TPC1 2XN1A 3ABQA 1KM2A 2VKZG 4M6VA 3VNDA 3DH7A 3BW4A 4ZZ9A 1W5OA 2AAMA 4KWVA 1U5JA 4ZVJA 1OABA 4O11A 3L0NA 3DI0A 3LERA 2BSLA 3P81A 2B4GA 3BO9A 4AXKA 2NWSA 2WSYA 3UXDA 3C2FA 4HHPA 4NXKA 3EKZA 4IOTA 5AC7A 2DJLA 2NUXA 1D9EA 3NEVA 3NQDA 3A9IA 3IGXA 3L5AA 1IXQA 1NVMA 4AB4A 3GIYA 5FEZA 1Z41A 1GVRA 3UPBA 1KBIA 4IMEA 3F4WA 1CX9A 1UASA 4UTUA 1KFCA 1SUXA 3RMJA 3HGSA 1WAUA 4P2VA 4JX4A 2OJPA 1OFAA 1KTCA 2QF7A 4IMGA 2V2CA 2XN2A 4FNRA 1G4EA 4WOQA 1EP1A 3FJLA 3MI6A 4CCDA 5HWJA 1FWWA 3SY5A 1J5TA 4JTUA 3UY7A 1TREA 4W9TA 4UC5A 1SO6A 3P8JA 3G1DA 1JCXA 4ORMA 2PRMA 3O6DA 3QYQA 1UUOA 4GUGA 2J27A 5K2ZA 1A53A 3TJXA 4UTWA 3S6DA 1BEUA 1G4SA 1RV8A 1XI3A 3YPIA 1O60A 1A5CA 4EF8A 1K7XA 2ZA2A 3MUXA 4HNNA 1TO3A 3TMLA 3QMRA 2OX1A 2VOMA 3NPWA 4AEOA 3LRMA 2B7NA 4DF0A 4M19A 3STGA 3PULA 2FFCA 3HGOA 4FNTA 2C13A 2G95A 4OE7A 3QFEA 2YGYA 3M5ZA 1OX6A 1FBAA 3HPSA 3O6YX 1SU5A 1G4PA 2QCEA 1H1YA 3W7KA 2PC4A 2VELA 4ZQRA 4CCCA 4HNUA 2Y7DA 1KLZA 5KSWA 2QCFA 4LVDA 4JIQA 1SZGA 3IIOA 3PSVA 4KKXA 3LHTA 1EP2A 3W1NA 2ZRUA 4Y9AA 3G1SA 3SZ8A 3M7WA 3UPWA 2EF9A 4M6QA 3G8EA 3B05A 4XKYA 2X30A 1B9BA 3TSMA 1FUYA 3FKRA 1F2JA 2JKEA 3W7RA 2ZFAA 2NXGA 1SZEA 5U4NA 3TE9A 4K8EA 3P8IA 5CPMA 1ZAHA 1DJQA 2QDHA 4C1KA 1EIXA 3C61A 3UZJA 1Z42A 3L21A 1OF6A 2C6QA 4ONVA 3C2RA 3HPZA 5EY5A 3C8FA 1OFDA 4IMCA 1EEPA 4JXCA 2W0UA 3TNOA 3UY8A 3HOJA 5D2YA 4MY9A 5BNKA 2H3BA 1TV7A 2OMAA 7TIMA 3GZ3A 4KFOA 2QCLA 3MWAA 1Z44A 1D3HA 1AMKA 3LCWA 3LHUA 2G96A 2ISVA 3MO7A 3TDFA 1TPB1 2G5WA 1FDZA 3LI1A 4UTHA 5HULA 4XBSA 3LRKA 3LM7A 2YFNA 1TPFA 4IGHA 2OT1A 1BWKA 2DP3A 5AC8A 1X8FA 3GDTA 3ABSA 3WJXA 3B4UA 1TTIA 3UWUA 3HGJA 4UTJA 4Z0SA 3H53A 3TMQA 3W2MA 1VQTA 3OVRA 1FQ0A 1PHQA 4OGZA 3O15A 3NQGA 5IBXC 5FEXA 4YCOA 3DFQA 2O7QA 4JX6A 2VEKA 2Y89A 3EXTA 2ZA1A 1OX4A 3UWVA 5EMUA 2PE4A 5AHFA 4MLJA 3LCIA 3O63A 1YTDA 3TC7A 1KV8A 3CM4A 2WNQA 1TV8A 1YTKA 2ZTJA 3CB8A 2X2GA 3GAYA 1FCUA 3N19B 4UTMA 4MJMA 3EEGA 5G2WA 4LTSA 3W72A 3N73A 3VFLA 1RQBA 1T96A 1VLWA 1GQNA 3GDKA 3EX6A 1WOAA 3A24A 1RPXA 3W7CA 3WJSA 1F05A 2Q8ZA 3TSBA 1XBYA 1VLIA 2R14A 3GR7A 4LV9A 4JYDA 4GBUA 1L9WA 4KWWA 5HWMA 3E9AA 1DV7A 5HUOA 4O54A 4N2YA 4E0CA 2YSWA 4X2RA 1FCBA 3R89A 3W9ZA 1LRNA 3NPXA 4RKAA 4XTDA 3LRLA 3UXAA 4BR1A 5AB3A 2E5BA 1ICPA 1WQ5A 3W73A 3GX9A 1KA9F 4ADSA 4LRSA 5I3GA 1DL3A 2ZTKA 4PA8A 2B0MA 4MJZA 3H55A 5EYWA 1GOXA 3W7EA 2RDWA 1VJIA 4ZQNA 3P61A 3O05A 4UTLA
chains in the Genus database with same CATH superfamily
3EDKA 1WCGA 1PDYA 1PYFA 3ARQA 1TRIA 5C9RA 1KWKA 3RR1A 3HJZA 4UR8A 3GO2A 3EWXA 2DZPA 3SUUA 3R11A 4FXSA 2XGZA 5CC3A 1EWDA 2ZUVA 4PUUA 3PZVA 1ICSA 1KTNA 3ZMRA 3WDJA 5E0FA 3OLGA 1TTPA 3ANYA 3MI3A 4IPJA 2ZX5A 3GR4A 5I79A 4FIRA 3TU9A 2BFGA 2ZA3A 4B5NA 1LOQA 1ME8A 3NNTA 3FSUA 1JDFA 2QUTA 4FLSA 4AHPA 5AOUA 3GBEA 3LX9A 3C6CA 3LPGA 1RCOB 2NUWA 2QPUA 4E8DA 4WX2A 3IRDA 1VPQA 4PRTA 5C6MA 3R8HA 5T9CE 3G1XA 3B03A 2V68A 4NIRA 3G2GA 2PEVA 4W5ZA 1YBQA 3A4AA 3LCLA 5B7YA 4GX8A 4H6KA 1OGSA 1TPUA 4RV8A 3W22A 4P61A 2CWNA 2O0TA 4XAPA 2WJZA 4S3DA 4O0QA 1YHTA 1XLHA 1FH7A 4LJ3A 2PTDA 2CEQA 2GQ8A 4IG2A 4H19A 4X9SA 1MNZA 4L1XA 2Y5JA 4TOQA 4HK7A 3HG4A 1MUWA 3PWIA 1XIIA 1UIPA 1UWTA 2FIQA 1TZZA 1P0NA 4XO7A 4YMZA 3QKZA 2XZ7A 3NR0A 4KCTA 2GPTA 4ZQCA 4AZ7A 3QFWA 4R7WA 1P4CA 3R4IA 3U9IA 4R85A 3NCOA 3V36A 3A3HA 3W70A 1KXTA 5E9AA 1Z8AA 4UMAA 3P62A 1KGUA 4XKYB 2F84A 1ALDA 3NDZA 2GDUA 2PP0A 4ZOEA 4LUIA 5A3HA 3CZJA 3WLTA 3JU2A 4GRSA 3IIXA 4Q8MA 3R12A 2VENA 4PFMA 1KRCC 1UR4A 4GGHA 4Z2GA 4CKQA 3SRKA 4DO5A 4MPKA 2CZVA 2IKGA 3DBNA 1FVPA 4TUFA 4L56A 3N12A 3GKFA 4O18A 3PZIA 3QW3A 3DFHA 5E93A 3P80A 1WUEA 2E67A 1ODUA 4W87A 1LBMA 1S2UA 4ERAA 2Y0FA 2O4MA 4ALDA 2Z1KA 3W2KA 1V3IA 3USZA 1VEPA 3WK0A 2PPGA 1M01A 2BB0A 3AYRA 5XIAA 4MY8A 1C92A 3HQ1A 5J5DA 2PCQA 4DY1A 1KM3A 2XFFA 3TYEA 4DI8A 1FOBA 3NQFA 5C55A 5GQBA 4G1NA 5KZDA 3T8QA 3T4CA 2GJXB 2D73A 2VGFA 2I56A 3AXXA 2FTPA 1SJBA 2VFDA 1HJXA 2MANA 3FW6A 4GBDA 2RGMA 2WVVB 5FEPA 1QI0A 4O1FA 4IFKB 3H2CA 2DUAA 2FJKA 2FHBA 3CWOX 2D20A 3CO4A 3BVJA 3BPWA 2OOGA 4AX7A 3UZYA 3DCPA 2CLEA 1ISYA 3W23A 1QK0A 1K4GA 4HJWA 3N2XA 2WC3A 2V6AA 3GDBA 1V4YA 2E28A 4R9OA 2ZIDA 4AZHA 3WLIA 3NUKA 2J7FA 3WN6A 4ICMA 5A8OA 2V9DA 1RJRA 3CASA 3R6IA 4HN8A 3ORWA 3P0WA 2QCGA 4EWJA 3AALA 4RW5A 4AQLA 2J66A 2OEKA 4LU0A 1Q63A 3SRDA 4YYCA 1LWIA 2ZZ1A 3ID7A 2PDIA 3DHDA 3PBYA 4DJFC 2IXVA 3OQ8A 4JFUA 2IPFA 4J9JA 1K9FA 1DJHA 3HG2A 4MF4A 1PJ9A 1TE6A 3TX9A 4HSHA 1KFLA 4QQUA 4JTAA 1Y8BA 3SCWA 2VNCA 3QY7A 1NDYA 4AUBA 1ELSA 1LROA 4C6BA 1UD3A 1TPVA 1R2RA 1XINA 3P82A 2Q6ZA 2PDGA 2G41A 1JUKA 2ZZ2A 3QHMA 4QG6A 4M56A 1W5QA 1VB9A 1S5WA 3DKJA 3CQ0A 3F5LA 2G0WA 1FKXA 5DMLA 4JTHA 1E3ZA 4LCSA 2BVDA 2UY5A 1KW1A 1NOUA 1UOKA 1OB0A 3CL6A 3AZRA 1F76A 3UA4A 4GZJA 1QO5A 3TN3A 3D47A 1DXIA 3TXVA 3RYSA 4JTSA 1KV5A 1OYAA 4H1ZA 3ZFHA 3QOKA 1J8VA 1F3XA 7ENLA 1QHPA 3EGJA 4QR6A 4H6RA 4H8HA 4X0VA 1UOZA 3E12A 3AS1A 5J8LA 2C1HA 1QW9A 1Q4WA 5LIWX 3G6MA 1NH6A 2EQDA 4KFNA 5HJXA 1LLZA 3MKKA 3BJSA 1HTIA 5HNRA 3P3BA 3T42A 4C6KA 2ABBA 2D2GA 1ME7A 1KFEA 3PZUA 4LUJA 1C93A 2ZDSA 3T40A 3GNOA 2WCAA 4P8VA 7REQB 1J18A 3IUDA 2FVLA 2G3NA 2HVMA 1AQHA 3VOIA 1R46A 1T8QA 1TWDA 1NWTA 2V82A 1XRVA 3A4JA 3AYTA 2DSUA 4HTYA 4NASA 2I5GA 3CUFA 4GZEA 3L9CA 4M7TA 4GC4A 4DBWA 3KZPA 4QROA 1WE5A 4U28A 4M7SA 1HQTA 2J88A 4Q6XA 3TR9A 2PA6A 2WNWA 1AL8A 5FESA 3VIFA 1H1ZA 4ACZB 2FVKA 4S2BA 4JKMA 3THQA 3ITYA 1ZHAA 3ZT6A 3STCA 4UMCA 3WZ0E 4C6JA 2DY3A 5G1YA 1RBOB 3W01A 2ABAA 5IFTA 2X8RA 2UY4A 4YYFA 4HA1A 2NQ5A 5K4XA 2CLMA 4CU8A 3PUEA 3WDPP 2PWVA 3ZIZA 4IQLA 1DWFM 3RHGA 3WD0A 1Q6EA 1XBXA 3R0DA 1H7RA 5DBTA 4CD8A 3RU8X 1GCYA 5CSUA 2NXIA 4ZQOA 1G67A 2GJXA 3EPOA 1FWSA 2YL6A 5HR6A 2PLMA 3PUDA 5FJOA 4ZO7A 4RJEA 5TIMA 2PI6A 3M5XA 3HU7A 1W2PA 1S3TC 1X1OA 2WVVA 3G6LA 4US5D 4BQ3A 5FOOA 5KEZA 1Q6RA 4IFKA 1KXVA 1GHRA 5CZ0A 4HZ7A 1HGWA 1SSDA 3BOXA 3ITLA 1EL3A 1U5VA 1R86A 3LB0A 1NU5A 2XH7A 2D0FA 1IWBA 3PS7A 4K8HA 1QAPA 2CLOA 2PLCA 3TNBA 3RLGA 3P7YA 4MB4A 5ABHA 3E96A 4ADTA 3SGUA 1POKA 5AHMA 3VO0A 1GK8A 5HUPA 4AFYA 4PB3A 4I5RA 4IH3A 2HRWA 3VDAA 3UZ5A 2D69A 1E6QM 3CAVA 1FHDA 2ZZ5A 2E9MA 5MF5A 1VBRA 4HNVA 3N4AA 1AVAA 4HSNA 4AF0B 2VC9A 2Q8LA 4BF5A 4NAFB 3II1A 4EANA 4C65A 2NVDA 1GVQA 1LL4A 4ZTXA 3WQVA 3BJFA 4GY1A 4DWSC 5IOBA 1DWHM 2X1UA 2DU2A 3LCHA 3HMCA 3TV8A 1WKFA 1CZ1A 1B57A 4QG8A 3B04A 4WDTA 5LNWA 3MDWA 3VGDA 4F2TA 1V7AA 5H1WA 4L65A 2V8ZA 1MVYA 1XX1A 3GY1A 1O66A 3LEPA 2ZOXA 3IACA 1JCJA 4XD6A 1N8IA 3S1XA 3KRUA 4HYVA 2BXVA 4GYPC 3L23A 2VCAA 4O14A 3MDUA 4RW3A 3C0LA 4JTGA 2PDMA 1EJXC 2P10A 2J9XA 2A7RA 5FCZA 3E0IA 3E2QA 4GPNA 2PTXA 3QF0A 3QMSA 5H8PA 3L67A 2VEMA 3PZMA 2WMKA 4XBKA 3VCNA 4JL2A 3RGTA 4M0XA 5HDRA 5LIUX 3W83A 3KBWA 3UR2A 1NARA 3HQPA 4FP1A 3EA1A 3VMOA 5I77A 4AC1X 2PDUA 1XC6A 3GNXA 5DELA 1AJ0A 1HGYA 2W61A 1HX0A 1A50A 7REQA 1CI1A 4IIFA 2PDXA 1LCOA 3WMSA 3LD5A 3S3GA 4DBDA 4UXDA 2NT1A 3OEXA 2ZDRA 3U2OA 3W25A 1S1PA 3WIJA 4F8XA 3VKDA 3WLMA 4JTFA 3JS3A 1QCWA 3VIOA 3L65A 4G7FA 3ZS4A 1GONA 2ZXQA 1S5VA 1KM1A 1W0MA 1XDMA 3N9RA 4QISA 3BUVA 1TTJA 1IR1A 3QEZA 3AZTA 4O4WA 1GJPA 1I45A 2CESA 1PPIA 3EMQA 4L4PA 4PULA 4W4QA 1RVGA 1NWUA 1BXCA 1G6CA 1UUQA 4IGNA 4GUJA 4NZFA 2XUCA 1XLCA 5A1AA 2HE8A 1IWPA 4UR7A 3I7RA 2Y6ZA 1MMFA 1RJQA 3CIXA 3LTPA 2IKIA 3Q65A 4Q8WA 2J47A 1PAMA 3TP4A 1KXQA 2BZNA 4ICNA 3M44A 2R1NA 2V0TA 4H41A 4PODA 4PL2A 1MQPA 4HPNA 1UH4A 3LG3A 2Z2AA 3M0VA 1H50A 2GDQA 4EX4A 3NQAA 3LU2A 1MDLA 2ATMA 3DAQA 1H7PA 3UQNA 3MKVA 3O07A 5D2WA 2G50A 2XVPA 5M5DA 2NQ9A 3CV6A 2B31A 4DZAA 3F2CA 5CCZA 3KVMA 4XAFA 3L0KA 3TAKA 4CU6A 2DGAA 5CC5A 4AY8A 2XIBA 1EGZA 3RM9A 4UTTA 4CNOA 3S46A 4TXEA 4ZENA 1WP6A 2QYGA 3R25A 4UTTC 4MJ4A 1M03A 2W67A 4F2UA 4B9ZA 1IE7C 1RBAA 4O53A 5DF0A 3GIPA 1ZJIA 4JDYA 4O8RA 3H4GA 4Y90A 1MI3A 1ZTVA 1I0BA 2V81A 2QCNA 4O16A 5HNNA 2CU0A 3AHTA 4I5XA 4AF0A 3UERA 3PPHA 3N4FA 4NAFA 4D6GA 4OHQA 1R2TA 4XD3A 3GXDA 1IGWA 3AMCA 1X6UA 2OZ0A 1UR8A 2A6LA 4GWEA 1OIFA 1FCVA 3AIQA 3S6OA 2VGGA 3EX3A 5GVJA 3CTLA 3LK6A 3G1HA 3ZJ7A 3TFCA 3OGVA 2CWXA 3WQOA 5DCBA 3RK8A 3WL1A 2CZFA 2ZE3A 4M82A 4H9ZA 3IRSA 2VEPA 3TVAA 2BNJA 1GW9A 1K7FA 3BGAA 1C8XA 2Y7GA 1WYIA 1VFMA 1UYQA 2WC4A 4FO4A 4D8AA 2FDMA 3RR4A 1GYNA 1JPIA 1JPKA 5DCDA 1HXJA 3BLOA 3F2BA 1FWHC 5CPTA 3V75A 5C8BB 3WMLA 2C15A 1SMDA 1E9ZB 4ES4A 1Q6OA 1DYSA 2EAWA 2BX7A 2YCIX 3SURA 4HTBA 3WF1A 4WLCA 5DBUA 3MUZ1 3LM3A 1KLYA 1XDLA 1Q7QA 5LIXX 1HN1A 2J24A 1SO3A 5C5YA 7CGTA 4C6FA 3L4YA 3R94A 3WLOA 5K9XA 1EZWA 2OKTA 1Z89A 1H41A 4UQCA 2PODA 4ATWA 1P0KA 4DJFD 5GJPA 1Z9AA 4XVEA 2UBPC 5DLCA 3TLQA 3BSMA 1DHKA 4JY8A 8TIMA 1U83A 3B0VC 1A5LC 1W37A 1J12A 1TYGA 3OG3A 2BOEX 2NW0A 3LN3A 1UD2A 2CBUA 1OCQA 1GWJA 1M1BA 5E6ZA 1H2JA 4MMWA 3BQ6A 4DXXA 3U4FA 4XAYA 1KQZA 1RD6A 2DT0A 4LYRA 3W6YA 4RZ6A 1WOBA 3PJXA 1L0PA 5BMXA 1R3TA 3DBPA 4A8IA 3EX2A 1T0OA 4LANA 2IQDA 4S1FA 4P7OA 3VAVA 3KLLA 5CSRA 2DZAA 4E6MA 2DZXA 3DGRA 4DXVA 4DEFA 5D9OA 1I8JA 3TLLA 2YXGA 3AXIA 1UR2A 3A21A 1TMHA 2GOUA 3AISA 1ZPTA 5CBBA 2EPNA 2TSYA 5D37A 4AD4A 3TW6A 1AODA 1KKRA 2IW0A 2A3CA 2ISWA 4FXFA 2TODA 4QP0A 3TN4A 3UCCA 3ISIX 2A0NA 3WQFA 4D8LA 3WQDA 3W7MA 2OR2A 3GE7A 2YDSA 2FKPA 1V7YA 3KDOA 2PTWA 1KM6A 3O8AA 4Q4QA 1G01A 4PMVA 4ENLA 2ZRZA 4KERA 2QJJA 3CL7A 3WMCA 4RX0A 2MNRA 5RUBA 4MAZA 1D8WA 1TR9A 6REQA 4UQBA 2OGJA 3VUSA 5HINA 4MFEA 1FWCC 2I7GA 4MNJA 4YWSA 4EPBC 3VX0A 3R58A 3KL3A 3LA4A 2X1IA 2YBTA 4F0MA 3CMFA 3RJXA 3FK4A 1AFSA 2KZHA 2WMJA 2WHKA 1XYFA 3UESA 2E0PA 3STEA 1XW8A 2J9YA 4V28A 1ONRA 4DX3A 3EOEA 2QW5A 3GG0A 3VIMA 3VOCA 2OZTA 5EU9A 5BWAA 1T41A 1LP6A 1PDZA 3N29A 1F8IA 3IVSA 4H9MA 2Y7EA 4ASTA 2ZWYA 2QGYA 2OXNA 2D3LA 3IGHX 1X98A 1TJPA 4XZMX 2FZ9A 1F3EA 3WD1A 5HAOA 3OYXA 2YZRA 1WDWA 3BTNA 5FJPA 4ZOBA 4MGGA 5M1TA 4OBTA 1JZ6A 4LVBA 4Y9NA 1SO5A 2HBXA 3ERPA 1P7TB 2VRQA 3W7OA 4CGTA 3HPFA 4DM2A 3IJ7A 9CGTA 2E3ZA 3H2OA 1P0DA 1FTXA 2BDQA 4KT2A 2DZVA 3RJYA 3NZ1A 4FX8A 1JFXA 4PBEA 2GQAA 3WUGA 1OK4A 3AYVA 1O7AA 1TVNA 1XLGA 3W3OA 3MHFA 4IFRA 5FSDC 5CAKA 1O5XA 3LV6A 2VFEA 4GVIA 4XX6A 5HQEA 3USBA 2QUVA 3PC0A 1UH3A 1XLBA 2GSHA 4A3YA 1F4HA 1FX6A 2FH6A 1O4UA 3GC2A 1I2PA 1G1YA 3D6NA 3KOWA 3N6QA 3DFOA 1BD0A 1AJ2A 3MW7A 2YKKA 1FHUA 5ABFA 5D2VA 1W54A 4OWGA 2YW3A 2HPMA 4WF7A 1W8SA 3K4WA 3S5NA 1Y5XA 4XZ9A 1VPXA 4OECA 4PCNA 2GL5A 1OZMA 3MS8A 3MJMA 1L6SA 3W81A 4DWSD 1UPPA 1QVBA 1AD4A 4WIWA 4XAZA 2W66A 4HOWA 4F0KA 2Z00A 2O9RA 2ONEA 3WDQA 3H2NA 4GUIA 4MYXA 2YFOA 4YWIA 4GQBA 4W7VA 3GK0A 5H8UA 4AU0A 3G3MA 3LENA 1BSLA 4OOUA 3EZ4A 1SFLA 2CLFA 1F3WA 5I24A 3GH5A 5CJNA 3GXIA 4MADA 3KHDA 2WNNA 5KINA 3W1AA 2VZVA 3ZJ8A 2ZBTA 1E6PA 1V93A 1EYEA 5CG0A 3SFKA 4E3TA 3R2GA 5CZKA 3ARPA 4B3ZA 3ZSSA 4Z1CA 3GDLA 1PTGA 5EBAA 1XH1A 4AZIA 4C6CA 4LBRA 4I6VA 3NQ7A 4LOCA 2O4QA 4LBUA 2CYGA 3V7PA 4JHZA 2J77A 3WQ4A 3PNZA 4GO8A 3UD6A 2AQWA 2ICSA 2Y8VA 1ISZA 3V18A 1AQMA 1CIUA 3DU0A 4S3EA 2NSXA 1ADOA 2FGLA 4B3LA 3B97A 1Q2SA 3OIXA 4H00A 3RPMA 3B40A 3WDHA 1TPWA 5DQPA 3HFTA 3GG1A 2H8ZA 3Q45A 2BY3A 4F48A 4O15A 4Z1AA 4E4FA 2XPKA 5D04C 4PUEA 1X97A 1HG3A 5D03A 4NX5A 2OQYA 4AWUA 3NDYA 3AZSA 1KQYA 1OK6A 3DGBA 3HFYA 4ZTYA 4UFJA 4LX4A 3UJRA 3N3TA 3W00A 3A5VA 4I8DA 3U48A 3OGRA 4KGJA 1XYLA 1QRQA 4C6PA 1RA0A 3SECA 4H9XA 1TPEA 4NXSA 3RITA 3CH0A 1QPQA 4XQ6A 1R2SA 4D2JA 4UFMA 1NDZA 4R9XA 3TJLA 4YTTA 1JYNA 3P2VA 4GFSA 1OGBA 4FF7A 3CPUA 1MFVA 1WZMA 4X2PA 4MG4A 4K8GA 3H4WA 4MUZA 1FWJC 1UKTA 3ZVIA 3CT7A 3GU1A 1PZ1A 1WXJA 1XLIA 3IGUA 1Q2RA 1UWAA 1OFEA 1HKWA 4E2BA 3N9SA 2WV8A 1P7TA 8RUCA 1LQAA 5G1MA 1UKOA 3TUUA 1CLXA 2WVSA 3BW4A 4ZZ9A 1XS2A 4KWVA 1S46A 1U5JA 4RNJA 4ZVJA 1MW3A 1OABA 2V3GA 3GM8A 1R3WA 3ARZA 1XISA 3BSGA 3BO9A 3ZM8A 3T1GA 3UXDA 1G5AA 2VX7A 3AMGA 4A3QA 1PX8A 3EKZA 1DIOA 3WBAA 2NUXA 4CQCA 2VRKA 3L5AA 3HZ3A 1E5JA 3VU2A 2Y4SA 3M0JA 1LJYA 5IDZA 1GVRA 1PKYA 5DT5A 1KBIA 1ISWA 1KFCA 3RMJA 3KE0A 1WAUA 3H7UA 3GG7A 3LQGA 2XWEA 1IT8A 1KTCA 1JZ5A 2Y24A 4IMGA 4YHGA 4FNRA 4QBXA 4AZGA 2PAJA 1EH9A 4WOQA 1EP1A 3FJLA 4CCDA 2FGZA 1Y65A 1FWWA 3K1GA 3KBSA 4JTUA 4Y9PA 3UY7A 3CHCA 3G1DA 4JNYA 4A8RA 4GUGA 4WK9A 5K2ZA 1FWEC 3L7RA 1A53A 1HKKA 3TJXA 4H04A 4UTWA 3S6DA 3UGRA 3H2FA 1QWKA 4IHCA 1IEQA 2A3AA 2OX1A 6XIMA 1U1HA 1E72M 4AEOA 4QS5A 5C2GA 4PB5A 5D9MA 3W02A 3STGA 2FFCA 4F0LA 4IQJA 3TYZA 3GSMA 1WZAA 3QFEA 2YGYA 3M5ZA 2WLYA 4KGLA 4GOAA 3SCOA 3O6YX 4WRHA 4OUEA 1E9YB 1VFHA 3THUA 2XU2A 4FMVA 2X7VA 5EFDA 4HNUA 2PS2A 1XKJA 4LVDA 3E1F1 3LHTA 1BPLB 2ZRUA 1OCJA 3O3RA 1TWWA 1R38A 3SZ8A 3M7WA 1V6WA 2EF9A 3WFZA 2X30A 2FZNA 7PTDA 1P6WA 4ZEPA 2VHLA 3TZFA 3SN1A 3G77A 2NLYA 1CGTA 3AQUA 3W7RA 1L8NA 1U5HA 2OVLA 2RJGA 1SZEA 4D1JA 2BP1A 1RH9A 3VD4A 5CPMA 2QDHA 4CN1A 4C1KA 5DMYA 4QEHA 1Z42A 3L21A 2XM1A 3C2RA 2NVCA 4L9XA 4IMCA 3BMVA 3MPGA 3TNOA 1XYAA 5D2YA 1LT7A 1W32A 1TV7A 5I6SA 3GZ3A 3M64A 4JN8A 1DJZA 3DDMA 3CZGA 4QCEA 1IHIA 3LCWA 1OM0A 4U10A 2G96A 2ISVA 1MWOA 3RX3A 3N9KA 4UTHA 1CYGA 2WW5A 2J8FA 1BWVA 4IT1A 5HBFA 4IGHA 3EDJA 4C90A 2DP3A 5AC8A 3GDTA 4TTUA 3B4UA 1BKHA 3H53A 4MHBA 3W2MA 1FQ0A 4PTMA 5IBXC 3O15A 5FEXA 1Z3NA 3W28A 2Y89A 1XQLA 4JIIX 4H9VA 1JI2A 1GQKA 3L2LA 3MCNA 3OLIA 1KV8A 1QBBA 2ZTJA 4I8YA 4C6QA 3E5BA 3MC5A 4PMOA 3KOXA 3EEGA 1X1NA 5G2WA 3I6TA 4LTSA 3GTXA 1T96A 1VLWA 3LNMA 3EX6A 3W7CA 1F05A 1RK6A 2Q8ZA 5BOEA 3OZPA 1WPCA 3E2RA 2HE5A 2D23A 4WVXA 3OTRA 3EMZA 4RL3A 3UVAA 1QNOA 3PZ9A 4XTDA 1JAEA 2OYKA 1B5TA 3GX9A 5I3GA 4IFOA 4PA8A 4YS1A 4GC3A 3H55A 2WSKA 2XSAA 1VJIA 4LXFA 1MUCA 1M9HA 4NRRA 4XIAA 1S2AA 5HWNA 1AH4A 1UC5A 2CITA 2XFYA 5FI8A 3AIEA 3A3WA 1PZ2A 5CLWA 4HCLA 4D72A 2E5CA 2HDJA 4JFSA 5C9XA 3I10A 2OLAA 1A5OC 4J1OA 1PUDA 3OVQA 4U5KA 3B8IA 2WOQA 5A5WA 2I17A 3I4KA 3M07A 4CUCA 2X1RA 3VMPA 5GPRA 5EMMA 3FX4A 4A3HA 1WDRA 3MU7A 3T78A 5HQLA 3VKCA 2PFHA 1UA3A 4Q8OA 3H7RA 3VILA 1PWMA 2CIPA 4L6DA 2YL9A 1TPH1 3FA4A 1VBHA 2XISA 2YLAA 1FWIC 3GYEA 4KESA 4HVXA 3T0CA 2X1SA 1R9ZA 4XBJA 3N6HA 3WLNA 2ZZ4A 1KD0A 3BMWA 4L4OA 4V1YA 2GUYA 1AW2A 3W4RA 4QJ1A 1W1TA 5DFAA 4JQ3A 4PTXA 4XV0A 3MUCA 4Q8PA 1LZOA 2POZA 1F6KA 3BH4A 1KFJA 4UMBA 3S83A 1RP8A 4OOZA 3TOPA 4IPPA 1R7OA 4H2HA 3UEQA 8XIMA 4P7QA 2DH3A 3SFWA 2R91A 5CZTA 4RDZA 1R3VA 3D0CA 2IXUA 1EQPA 3HM7A 5E0CA 3GU2A 3U0HA 3ZZ1A 1J96A 1VEMA 3W2NA 1EA0A 3HGRA 1PKLA 1A4MA 1KBKA 4Q33A 3UG8A 3QLDA 3I3DA 1Q5MA 1NFGA 1XYZA 4EPDC 2EO7A 3KXQA 1GVYA 5C9UA 3OBAA 4BS0A 4AYGA 1M7PA 1V3JA 4PR4A 3TFXA 4BHYA 1B90A 4HYWA 3U3HA 1EDGA 2A3HA 1PIFA 2HSAA 2A2IA 1TA3B 3MMDA 3SY8A 4K2SA 3KCOA 2AOSA 5JBEA 2J9ZA 3EOSA 2GK1B 4J27A 2DZUA 4FX7A 2D2OA 1QW8A 1QPNA 3GZAA 4O10A 1HJUA 1VCGA 4WJXA 3CK5A 1YKWA 3BOFA 4JX5A 4AYSA 4CLMA 1V08A 2VWTA 1VBGA 3UCDA 1PE1A 3VIIA 1SZNA 1RY0A 7ODCA 2GVLA 5F2LA 3VVGA 1UR9A 4FLOA 1I4NA 1EWEA 4S3GA 3PJUA 4LUTB 3QRHA 3LBOA 6CGTA 2VJXA 1Q7ZA 3M9YA 1EOKA 2OQLA 4G2DA 1CGUA 3FA3A 4AHQA 2WHJA 1BYCA 4QE4A 3LHYA 1NIUA 1S2TA 3NGFA 3S5OA 2QCHA 3LTSA 1Q65A 3A5FA 3C8NA 4H7VA 4A6GA 2HMCA 3W29A 4WKAA 4HU8A 1VR6A 3AIUA 2NX1A 1LBFA 1XHGA 3TXZA 3W74A 3W76A 2PP3A 1GZ1A 4WXZA 4JICA 5ENLA 1OX4B 2R82A 1N8WA 2ZUTA 1ENUA 4I9AA 4V1XA 1MZRA 2PLJA 4TU1A 5IHSA 4H6EA 1QOQA 4GXPA 1JIBA 1WA3A 2G3FA 3INPA 3PFRA 2HJPA 4J3XA 3QHOA 4Q4KA 1RCQA 3PPFA 4P8UA 1X6LA 1J0YA 3T7VA 3BGJA 1UWUA 1EJVC 3BZJA 2XJ7A 1FCQA 4NILA 1QPRA 5FKYA 2EPOA 2R9RA 2RDTA 4PMZA 5H91A 5EMKA 1K3UA 4HZMA 4L7ZA 4EK7A 1ZRQA 4GQGA 3V35A 1ZSXA 5A69A 2C91A 4NJKA 3TOYA 1JPMA 4OZOA 2NV1A 3QV9A 4HB7A 4EF9A 4US6A 2B7QA 2ALRA 1CXIA 4WZHA 1H5YA 2NQJA 1KFBA 2CHRA 4ZR8A 3N04A 3S2CA 1IQ8A 3G1AA 4GI8A 3R5EA 5F4XA 1XL9A 2PUZA 4ZO8A 3S2LA 4CNPA 3CMJA 2WAGA 2XIMA 3GFYA 4GI9A 1THFD 2PGRA 4UOZA 2AAAA 1GQIA 3BWWA 4RE0A 1VYPX 3VE7A 5A2AA 1C7SA 3CYVA 3QV8A 5D32A 1JI1A 1AG1O 4ICCX 3NSXA 2O7SA 4DUWA 3DFTA 4PCSA 3DG3A 2XM2A 1SSGA 3MCMA 4W8BA 6ENLA 2VTFA 5C7HA 3LY0A 4I9MA 2DZSA 1CT5A 1P48A 1OF8A 3WBXA 1R3YA 4IJCA 1W5PA 3FYPA 4WKHA 3WSUA 4ZQPA 1LLWA 2EGZA 1Q6DA 3KCLA 2WWDA 3FIGA 4A21A 1EYWA 2WVTA 3JR2A 1NQKA 2VFFA 1MXSA 3PK7A 2R6OA 4HNCA 4PBGA 1ZAJA 3WK2A 2G8ZA 2ZZ7A 4ZE4A 3MP3A 3ZO9A 3V3WA 1I75A 1RLDA 4A2RA 4CNNA 3URAA 4LF2A 3G0UA 2XIIA 3WMBA 1VHNA 2FPVA 1J4EA 3ITCA 4PFHA 6PTDA 2I1OA 1TA3A 2BOGX 2YLLA 1NDVA 1T99A 1E0TA 4D6IA 2C14A 3CQHA 1XIDA 2UY3A 3W2UA 2GK1A 2NX9A 2PC8A 3E49A 1XGZA 4LC6A 1EGMA 3HG5A 2PURA 2UV8G 4Z08A 3UF9A 2L5HA 1GG1A 3VDGA 2J8GA 4HBKA 4F9DA 4HU3A 3VNYA 1X7IA 3LBMA 3UWYA 5BXRA 3SGGA 3WDIA 4L5ZA 2FTYA 1EC8A 1AQFA 5I3HA 4YTRA 1OHLA 1E6ZA 2IQTA 3QGKC 4ZGYA 4FNQA 3BCJA 5FL1A 2Z6IA 2BWGA 1QPOA 4LUTA 2PP1A 4A8NA 5E9XA 4UBPC 5I07A 3CMGA 1R3QA 2E1WA 3BLDA 1MZHA 3A9BA 2PTYA 3RXZA 1MEIA 1U2YA 1A5KC 1HNYA 1FXPA 3GAKA 2AL2B 4NHVA 2FMNA 3WLJA 2FH8A 2A3LA 4HMDA 4WY0B 3H2MA 2WZEA 1DE6A 4HK5A 1ITXA 5LIYX 4AZBA 3DESA 1DPMA 1VS1A 4QJ4B 1MYRA 4DIAA 1GZGA 3LOTA 3HQNA 2H6RA 4E8GA 4OBSA 4GLEA 3PG9A 3HV9A 1H11A 2A4AA 3DZ1A 5EMLA 3MY9A 5HNUA 1A80A 4GKLA 2ZC1A 3VKJA 3IK4A 1WBHA 4Q22A 1A0EA 3KAOA 1XLAA 3KCJA 2DSZA 4TR9A 4FNUA 3WENA 4FK9A 1G9HA 1FKWA 4AWSA 3L4ZA 5G2IA 4GNJA 5KITA 2HZGA 1Q6LA 5HMDA 3RMEA 2O9TA 1H5VA 2YOCA 5CQ1A 3AU6A 4K38A 5D33A 3BARA 2BLEA 3NQEA 2WLZA 3KBJA 2OELA 5EBUA 3GNNA 4Z2HA 3WQCA 2VZTA 3KVLA 5D02A 3L4UA 1HF6A 2ZX8A 3AROA 3R10A 2NT0A 1V6TA 1ZB5A 3KS5A 2PU1A 4FXJA 4C6MA 4D9PA 5REQB 2AKMA 4X3ZA 5JIWA 2YBUA 4K68A 4RDYA 4XIMA 2NV9A 1A3WA 1YIXA 3GW0A 3BV7A 3WNLA 1B9ZA 3TC6A 2CLIA 3DECA 5HK4A 4JKKA 5CAHA 1W3JA 3O0KA 1KBLA 3K46A 4LYPA 1IXOA 3WCZA 2ADAA 1UG6A 5ECUA 4TVUA 2EBNA 1G7UA 3ARTA 1W5NA 3LLXA 1YMYA 2F6UA 1O12A 1CDGA 4RXGA 4UNKA 4HGXA 2E1DA 2F9RA 3GLCA 3PF3A 4FLRA 2TPSA 4V27A 4UWMA 4KF1A 5H6HA 4ECLA 1FY6A 2PWHA 4IJBA 2UWFA 2DSWA 1DIDA 4ZE5A 1AK5A 4FR1A 4KFPA 4ERGA 3TYUA 2CNCA 1XIHA 2XDFA 3W1UA 1JRBA 4YVXA 1O5KA 4I7UA 4Q8TA 2QIWA 1JCLA 1HVQA 3MJYA 5I2UA 1UZ4A 3WQ6A 1UZHA 3NIYA 1BVWA 3FV9A 4PUWA 2C18A 1CLKA 3MV11 1C9DA 1XH0A 3M16A 4NKCA 2BBFA 3S9IA 4KRUA 3PUOA 1ZJAA 1FHLA 1FFQA 4DUXA 5FSEC 2PD9A 2VXNA 2VX4A 3GH4A 4FNPA 4JTDA 4Z2IA 1HO1A 3KTXA 1OFBA 2E9BA 3H22A 1BGAA 1HJVA 2VX5A 1ZGDA 1IT7A 1X39A 4Y9OA 1EP3A 3T8LA 3I68A 3G18A 4ZXOA 2E8ZA 3HG3A 5I3IA 1DEDA 2WPBA 4UOQA 4M51A 3SSJA 3RLVA 2DDXA 3AIWA 2EXOA 1XD0A 3FVDA 5U7SA 4R53A 3G22A 2QUUA 2F8QA 3FEMA 3A47A 2OTDA 5AFDA 1JZ2A 3BAKA 4LS0A 2AL2A 1W6TA 1GORA 4LS1A 4X60A 4EXBA 3IV8A 2DVTA 3A12A 2OOFA 4F2BA 4JN6A 3IGSA 1F8MA 3FVMA 3BLKA 3UWWA 3CLWA 3EPMA 4GUHA 3LPFA 3WUFA 1PXGA 3FOKA 1T40A 4RCXA 3VGGA 1W17A 2Q71A 4GI4A 1TX0A 4MTVA 3AXHA 4H8UA 3ZWSA 3P6LA 4LAKA 2QJNA 3N15A 4OV9A 4I6KA 4GQRA 1IEXA 3ATZA 4AH7A 3VE9A 3EX4A 3GIQA 4HJFA 3I65A 3SW6A 3AI0A 1KRAC 4GVGA 1EJUC 4F0HA 1VFLA 3K8KA 3U5YA 1GVSA 1RLCL 3O16A 3NQ2A 3EDDA 1MRAA 3RCMA 3DFPA 4I7VA 3QLLA 3FFSA 1PIIA 4DUVA 1XSJA 5IM51 4DPQA 4O19A 3ARRA 1PHWA 3PP7A 3RILA 4PMRA 3T4WA 1H7WA 1XFBA 3RF9A 1CXFA 3TAOA 1VH7A 1LQ0A 4QXIA 2WKJA 3QOMA 4N0RA 5AHNA 3SY1A 4MDPA 3TONA 4ML4A 1SR0A 2ANUA 4D71A 5REQA 1OT2A 2QAPA 2WB5A 3EXRA 1QNRA 2WBGA 4CQ8A 3LBCA 2BGSA 2I9EA 4AY1A 5M2FX 4CD5A 4FA3A 4Y9MA 3I4EA 1F07A 1IEIA 3LNPA 1ZBVA 4Q7IA 1TPDA 1EO5A 4J5NA 3GQYA 1F6PA 5D38A 5K4ZA 1UKPA 1BAGA 1QR7A 3DXIA 1B1YA 1L6YA 2QXWA 4O0ZA 2INFA 5FF4A 4WSKA 3WQWA 3B8TA 4GD0A 1TSIA 4IICA 3UCQA 2PB1A 1E0UA 3XISA 3UZXA 2XFWA 5DY3A 2ZRVA 4HD5A 4ROPA 2F38A 3AOFA 3CNYA 1G69A 1QT1A 3BDKA 1LUCB 2ZWZA 4I7WA 4A8LA 1DTNA 1LOSA 4IXHA 4P8XA 3UU0A 4AWEA 3V0UA 3CJPA 4PMNA 3ABOA 2FB2A 1XIGA 3M0HA 1CNVA 3DYMA 1V8EA 2WJEA 5CKSA 4HPXA 1W1IE 1JD9A 2MUCA 1O1ZA 3GVGA 4O28A 4LEFA 3ZR6A 1PO9A 4BKNA 2WC7A 2DH2A 1JEZA 2GDVA 4EP8C 3WLSA 4UNLA 1REQB 2CETA 2Z7GA 2Z2UA 4G1KA 4DBEA 2DIEA 5TAOA 4HNTA 1PX3A 1E6RA 4XZLX 5A8QA 4J40A 1JG9A 4MYAA 4R33A 1P1MA 1OFOA 5TBOA 3VIKA 1BVZA 2X41A 5E1QA 1P0EA 2ASHA 1RVKA 3VD3A 3W7GA 2EKGA 4GQ0A 1EOMA 1FH8A 3B0XA 3C52A 1WXYA 5HMSA 4GI6A 4LNCA 4DXKA 1GVOA 2WZIA 2J7DA 3N2MA 2VC7A 1EB3A 3FCPA 4PMXA 4JYFA 3CHDA 5E09A 2PGEA 4RZBA 4GNKB 2BHZA 2P3EA 4H9YA 2YPIA 4HYRA 3URNA 2A79A 2EKCA 1JCMP 2W4XA 1L2UA 1WDQA 3C2EA 3MMUA 3PB0A 5L6UA 1MXDA 3G0XA 4L61A 4PUKA 3WD2A 1GVFA 1VYRA 1O95A 2BGQA 4U31A 5EGRA 5TF0A 4CNSA 1NTHA 1DKWA 1OFPA 4WJEA 4EAMA 1ZNNA 2JBMA 3ABXA 4US5A 2ON3A 3K8MA 1E43A 5D05A 3IUIA 2HVNA 1B3VA 1S2WA 3DI1A 1HUVA 3N6JA 4GJ1A 5CLTA 2PWDA 2ZC8A 3B0YA 3GU9A 2F61A 3S1GA 5LHEA 3SUSA 4JQ2A 4N7QA 2JF7A 3OJGA 2W92A 4BWLA 3N34A 5CZSA 2YIHA 4PRWA 1E15A 4BWLC 4E8CA 3KP0A 3GTIA 1M7OA 1SM9A 1N55A 1R0MA 4QTGA 5F2GA 1C9WA 4TVCA 2BASA 3NZGA 2JGQA 3RN6A 3DFNA 1JCNA 3POCA 2W63A 2WQDA 4C6EA 2X05A 2PRLA 2Z1VA 1YXCA 3KFTA 4PUJA 4L4MA 3WJYA 3BLPX 1VKFA 3FY1A 4C5ZA 1M53A 1XLDA 4O1BA 3WLQA 2QDEA 1LTDA 3CT2A 2FZDA 2WNZA 3KVJA 5AC4A 3OODA 1MNSA 4FB7A 2Y5SA 3R0UA 5FAGA 3AJ7A 2R8WA 1MFUA 4CQAA 3W7QA 3ZOAA 3LPPA 4POCA 1X96A 3WEMA 4GIRA 2NQZA 3QTPA 4PZVA 3ICJA 2VM8A 3E74A 1K8XA 3TCSA 4K3ZA 1EX1A 1GPFA 2VVNA 4P7NA 2WVUA 2EPHA 3SQSA 1WAWA 4PMDA 3S5ZA 4U3AA 4IZGA 5F2IA 1ZBKA 3I6RA 1GOMA 2OZ3A 4XSLA 4D6EA 2PWGA 3Q67A 3A3XA 1ZCOA 1E71M 2WMIB 3DHFA 3EBVA 5BYWA 2Q3OA 1NAL1 4PCPA 4H8NA 1JYXA 1S1RA 3JRKA 2TMDA 2YYTA 4WJ8A 1TE1A 4GINA 3KM8A 3VNMA 2WSRA 4M1RA 4DZIA 3LSCA 5BXTA 4JCLA 3THCA 5A95A 2INZA 2QVNA 3TIMA 4DELA 3AIRA 1KXHA 2BOFX 5A8PA 2J79A 4LBSA 4C6NA 4Z1YA 1AW1A 1HL2A 3TWBA 4Z0JA 4IGSA 4Q4OA 3C3UA 3L0GA 3RUBL 3IJLA 5LNVA 1Z69A 3CXOA 2W79A 1AZ1A 1F61A 4LWWA 1UR3M 3MUIA 5CBIA 2ZRWA 5AYYA 2FHCA 4A29A 4QLKA 3UVIA 3L2IA 1BQGA 1DWAM 1MEHA 3BGGA 1JYVA 5ABEA 2YA2A 3NL5A 3RU6A 2OB3A 1J9YA 3V5FA 2E8YA 2QDGA 3V16A 3EDEA 3RO8A 4WQ6A 4JGDA 4RZ5A 1MRQA 1EJTC 4DO4A 2BVTA 3NQVA 1ZL1A 3T0AA 3CUGA 5AHEA 4UTFA 4DRSA 1BYAA 3SUTA 4CQBA 1CGWA 2DQWA 1C8QA 1W3IA 2X09A 4ZB5A 2G37A 1JJKA 4ZL1A 2VDHA 2IPJA 1MW2A 3M6DA 5BRQA 5IDIA 1XLMA 3LYEA 1W9UA 2DZBA 5BU9A 2VYOA 3R13A 4HNLA 3N3MA 3LZ3A 3EB2A 2CHOA 1BSIA 3B9EA 4XWUA 2P1FA 1E0WA 4PSRA 4E4UA 3T81A 2FQIA 1TIMA 3MMWA 3BLEA 1PCWA 1AJZA 3V1HA 2GUUA 1YDOA 1N8FA 3O6CA 3WLHA 1DJYA 3BL3A 2ZQ0A 4QX4A 1TJ2A 1TVLA 1GVIA 3B0UX 4NJJA 3BICA 2Z4GA 1Q6FA 3W1QA 4QNWA 4OKDA 1SJDA 1VCVA 2BY2A 4JZ5A 4OIFA 4L1GA 3FXYA 4C6LA 4NYYA 3NL2A 1W3NA 3ARVA 1XBVA 3T2OA 4ZMGA 4JCMA 4ZFMA 5JU6A 4O12A 1OC7A 3UYCA 2HCVA 3VFCA 4AZCB 3THDA 1EZ2A 1ECQA 2VURA 2YCLB 4EAYA 4Y96A 1N2VA 1JCYA 5EL1A 5CC7A 1TWSA 2V69A 2E4TA 1OSEA 1LWHA 3GNRA 3UR7A 1LOLA 2ZUSA 1FWGC 2Y7FA 5HNTA 1WDDA 1XPYA 4NZ1A 4ZO9A 2A5HA 3WUBA 4LW7A 4ORIA 4PL1A 3P14A 3BAXA 1H09A 3CUJA 3NL6A 3UNDA 2J7CA 2Q8XA 3G3DA 4LF1A 1DWIM 1E0XA 4K39A 4J3TA 3HTWA 1EJSC 3MHUA 4PUNA 1FFRA 3IJ6A 1XRFA 3CGTA 2YBVA 3SCVA 4O13A 1XUZA 3REQB 1XH2A 3H7VA 4G7EB 2WMIA 3VNIA 4H7ZA 2GUBA 2Z28A 5EPDA 3APYA 5BXPA 3S2JA 4F40A 1E1EA 4HU4A 1JCTA 4PH6A 2GVYA 5DANA 2WSQA 3ABQA 2VKZG 4M6VA 4J3SA 1W5OA 1FA2A 3OP2A 2R1LA 1KCZA 4GX9A 3L0NA 3PWGA 4PBFA 3DERA 3P81A 4AXKA 5I09A 2AMGA 4HHPA 4UQ9A 4DJFA 1FP8A 4Z17A 3MO4A 1JNDA 2JE8A 3PANA 1UWIA 5T9BG 1D9EA 3FAXA 3NEVA 3A9IA 1H3GA 3QYSA 4R3UA 4IMEA 3F4WA 3WNKA 4UTUA 2RGLA 5C71A 3HGSA 1QBAA 1TUFA 2WCGA 1SJCA 3O6AA 4JX4A 4DWSB 4EXQA 2OJPA 1YRRA 2XVLA 3K4DA 4YPJA 2QF7A 5HOSA 3U2EA 2V2CA 3UYIA 3BAWA 3MB9A 2DT2A 1XICA 4LCQA 1ONXA 5J04A 1XG4A 2JIWA 4JHOA 3SY5A 1D7KA 1FWBC 4K1GA 3PPGA 4URIA 4HA0A 1G94A 3VA8A 1UUOA 2OODA 3APGA 4DVOA 3OB8A 1BEUA 3VGFA 4CVWA 1A5CA 4LB4A 1GVEA 2VWSA 3OW1A 4EF8A 4HNNA 3CB3A 3LRMA 3B8SA 1FHVA 4AVNA 4S3JA 2BY0A 3UZZA 4FNTA 3DHPA 1FBAA 3HPSA 2JF6A 3NFUA 2PDNA 3VOGA 1SU5A 4Z2KA 1TV3A 4DYKA 1XP3A 3RCNA 1SGJA 1B3WA 3CBWA 3FEQA 4LYKA 4FOUA 1KLZA 2XSXA 1KR0A 1KRMA 1SZGA 4KKXA 2ZXAA 3W1NA 1R7AA 3UZWA 3B8VA 1V0MA 1XCXA 3T05A 4M6QA 4R7OA 4XKYA 1E6NA 1B9BA 1TWIA 1FUYA 1B30A 4BEUA 2G4FA 1CB7B 1POJA 3LMYA 2ZFAA 4PGLA 4INFA 3OQEA 3P8IA 3S9ZA 1EIXA 3UZJA 4RDWA 1OF6A 4W86A 2C6QA 1XYBA 3HPZA 5GJMA 3C8FA 4H9UA 1OFDA 1XLLA 4JXCA 1BFNA 4RNIA 4AZCA 4FSAA 4JTCA 3UY8A 3COTA 2VGIA 1KO0A 4MY9A 2YCLA 2ZX7A 2OFJA 4LH8A 1V6VA 4GYFA 2QVHA 3RLHA 3K2GA 1DJXA 3B4YA 1VJSA 4KMQA 3GHUA 1GKRA 1TPB1 3F5JA 1OZQA 3OZYA 3LPOA 4XBSA 1DJWA 3VZYA 3LRKA 1IZCA 1TPFA 1X8FA 4XZHA 3WJXA 3H23A 1TTIA 1ZZMA 4D6HA 1OCBA 4UTJA 4Z0SA 3UJSA 3OVRA 1PHQA 3VIPA 1NJJA 3NQGA 2O7QA 4QLJA 3SCPA 5EMUA 2P5NA 4YVVA 1JZ3A 1O6IA 3NWRA 4I9TA 2UZ9A 3O63A 3REQA 1QI2A 3CM4A 1TV8A 3DYPA 4G7EA 1JPHA 3CB8A 4NL1A 1K77A 1N82A 3N19B 3P0XA 4UTMA 4MJMA 3DIPA 5IHRA 4UQAA 4X61A 3N13A 3VFLA 1RQBA 3BSHA 4HU0A 1GQNA 3VDBA 3A24A 3DOPA 2P3ZA 3WF3A 4JYDA 4O54A 1VBUA 3GVWA 4E0CA 2YDQA 1FCBA 3R89A 1LRNA 4RKAA 3GHRA 5AB3A 1OIMA 2E5BA 1ICPA 1E6SM 1AH0A 3JZUA 2B0MA 4MJZA 3KDNA 4IQDA 1GOXA 4HP5A 2QF8A 3WKZA 1OT1A 3HBLA 4NX0A 4IUGA 2E25A 4DWSA 4NJIA 2RUSA 4WUIA 3ITXA 5TD4A 3E02A 2QCMA 1AQ0A 4JPGA 2AL1A 1HKMA 1EXBA 1FXQA 3TSDA 1YTEA 3QXBA 2DSVA 4GIAA 4JBRA 4EACA 3VM5A 1V0NA 3MA8A 4C6DA 1LORA 5K9CA 4P7RA 3U8GA 4IISA 4UQDA 3U2CA 4WDUA 4GXWA 3PAJA 1X1ZA 4GYPA 3Q37A 2J6XA 3AFBA 3L68A 3P84A 1XSKA 1O68A 4O0KA 2CFFA 2X7WA 3IJDA 3IV3A 5MHBA 2XH2A 1CXHA 1KC7A 1Z48A 3VI2A 1G0CA 1LL7A 4J28A 1F4AA 2BXZA 1XUUA 1BF2A 1RK5A 1J11A 1B3OA 4MNLA 4A3RA 9XIMA 4J3VA 2CW6A 3WF4A 4YHEA 3G8RA 6TAAA 5AZ1A 4O17A 4NRSA 3F4DA 3ZR4A 2HS6A 3W24A 1HJQA 1PB0A 3ONBA 4Z42C 4EPEC 1R8LA 1TUXA 1S2VA 3ZLHA 1RAKA 4L6OA 2E6AA 3QM3A 1U1JA 2YX0A 4OFCA 3F2DA 5CPOA 5HR7A 2VR4A 4M8UA 4B5XA 2HTMA 4GY7A 4JHMA 1M3UA 3QH2A 2J7BA 2PGWA 3TCEA 3PTQA 4TO8A 2YXOA 2WHLA 1U22A 4OQVA 4RE3A 4IP5A 4E2OA 1GUVA 1OD8A 3ARUA 4B4HA 2J13A 2W5FA 4ACZA 1XKYA 2E7FA 3G1YA 4KWOA 3ZWTA 2GLKA 1AW5A 4PCTA 1TB3A 3I7QA 1WDSA 4DLMA 6TIMA 3T44A 3C0QA 1PCKA 1HVXA 4DWDA 1WKDA 1SO4A 1J2WA 1VJZA 5AZ0A 2ZXDA 1JNEA 3U57A 3BC9A 4MNKA 5CSYA 3T55A 1EEXA 3LV5A 1QDSA 3RRAA 2G3JA 3JUGA 4TV6A 4OTKA 2QJIA 5I5RA 3WUEA 3OIHA 1JL8A 3GXTA 3CLMA 1O5QA 3K1DA 2RAGA 4L4LA 1B3ZA 3NOYA 3HPAA 3P60A 3H8AA 1YXYA 1YNYA 3GXFA 1XLEA 1SW3A 4NNAA 2WKGA 3QPYA 4AVOA 1FH9A 4W5UA 3Q2DA 1PX4A 3ZSTA 2NV2A 4H4IA 2BG5A 2RH9A 2PWFA 3EWWA 3IANA 3VCCA 2BV9A 4HPGA 3RRXA 5FEWA 3TZNA 3KEHA 3MSGA 1HP5A 4JQAA 4JN7A 1JXKA 3BG3A 2PDBA 2BVYA 2VT0A 1EDTA 2Z25A 4DJEA 1JQXA 2ZCGA 2F6XA 1J2BA 4DJEC 1LQ2A 4UCGA 1K9DA 3CUZA 1J01A 1H63A 3N25A 3QBUA 1Y5VA 3VGEA 4ZQMA 2OYMA 2JGYA 1V3HA 3U6WA 2O92A 3CQIA 3BAYA 1R85A 1MSSA 1UP3A 3KL0A 1M7XA 1VAHA 5F1UA 5A8GA 1VYSX 5CH9A 2V38A 3F4VA 2GFTA 1V3KA 3IK2A 3KOZA 2JKAA 3QY6A 1TTQA 2CBVA 3OLEA 1ZLPA 4WD0A 3TWAA 3GR8A 1JDDA 5EMYA 2EEXA 4Q8VA 1L2QA 1I1WA 2WZHA 1IEWA 2WBKA 4WGHA 4V15A 1H62A 3N1AA 4GYJA 2I5QA 3LMZA 2EG8A 3CAWA 1Q6GA 1WKYA 2OO0A 2BTMA 1NFBA 1P43A 4M1BA 1CGYA 1W1ZA 1OG0A 1ITUA 2QMKA 4C91A 4XZWA 3KRZA 5B80A 4QSHA 4LRTA 3HQOA 2J6VA 3AUOA 1R9YA 1P6CA 2PZNA 1BG4A 2IKHA 1QXLA 4DUOA 4UIOA 2DORA 4B3KA 1SZFA 1ITQA 1GTEA 4HCDA 1KGXA 4AC7C 2VD9A 4Y8FA 4PTNA 4MKVA 1IGSA 1JZ8A 3DYOA 2PGFA 4FPSA 5G2HA 5DX7A 5AECA 3FHAA 1G4TA 3H2EA 4Q7BA 3MANA 1NF7A 1SW7A 1S3HA 5I3KA 3C56A 3BK0A 1EPVA 4L6HA 1Z32X 3MTWA 2WSPA 3LI0A 3PBGA 1PSCA 5XINA 4ADUA 3BLIA 4IXXA 1GG0A 1Q3NA 2PF0A 4FOJA 1V5XA 8XIAA 3KX6A 1IWAA 3KRSA 2VCBA 3KBNA 3PN8A 4AIUA 3NPUA 3R43A 1O1HA 2OO6A 1I2NA 3TW7A 1M65A 4HHHA 2DVXA 5LZLA 2E6FA 3KP1A 1KKOA 3WQ8A 2HK1A 1BTCA 4AIBA 3DHUA 1US2A 1JR1A 4Z2JA 1PZ3A 4CNUA 3SB0A 4F0SA 4JIPA 2F2HA 3CUIA 4DPPA 2JEQA 3U7VA 1L8PA 2PDLA 1VZWA 1J10A 1IV8A 1TMLA 2GVEA 1TR1A 1NY1A 4YNGA 3LHVA 1HW6A 3GRIA 2FMOA 1OY0A 4GXMA 4JNMA 3QZEA 2VQUA 4DLFA 3R8GA 1ML1A 3B9AA 3VKAA 1LWJA 1ZU8A 3HF3A 3OVPA 3W7LA 3S6TA 3ECQA 3CU2A 1L6FA 2GOKA 1B4KA 3OLDA 4RNFA 4M81A 3ZJ6A 2QEZA 3EDFA 3OBEA 1H7OA 2YL5A 3GDMA 4TMCA 5BWFA 4IM4A 2OT0A 2CLPA 3XIMA 5MKGB 5AVHA 3B8DA 5F7UA 4IP4A 2GGGA 3S47A 1J0HA 1KRBC 3L5LA 4QEEA 4HT3A 2YW4A 3PWAA 2ZZ3A 1TJ0A 1PS9A 2PU0A 2HV5A 4PC8A 1JUBA 4GIYA 3NDOA 5IXEA 4IL2A 2GVGA 3M43A 4XG1A 4WSJA 4S39A 1JDAA 1VHCA 4LVGA 3OHMB 2DW7A 4MM1A 3DX5A 1NFPA 1RBLA 4H83A 4KCWA 4J3UA 2GJPA 3E0VA 1CCWB 2C0AA 1BG9A 4MY1A 1W5MA 4G56A 2G3IA 1Q8JA 2Y1HA 4ZO6A 1LDCA 4GQQA 4XO6A 3EWDA 1PVNA 1XG3A 2EG7A 3KRBA 1FWRA 2E6DA 1XIBA 4EE9A 2FZMA 1UP2A 4YCPA 2ACRA 4PUDA 1N7KA 4O50A 1DWJM 2OGYA 3MWCA 1E56A 3N2TA 3HO8A 3NVTA 5I78A 3NZQA 4F66A 1UMLA 3FJNA 3NO5A 1YDNA 4M6UA 4EXAA 3QVQA 3RLUA 4M80A 2V3DA 4H7CA 1XLJA 3RDKA 1BHGA 1V0LA 2J74A 2PDHA 1SQ7A 1TQXA 4NAEB 1GKPA 3FJ4A 1NWRA 4KW2A 5F2MA 5CPSA 4B4FA 3EWCA 3LGDA 4XTIA 1RUSA 4OVXA 3W07A 5DCEA 1R3SA 3M6YA 5CZJA 3HPXA 1SVDA 1PV8A 4O1CA 3NOEA 3OOQA 4H9TA 2J62A 3BURA 3K30A 1UCWA 1TCMA 1UJPA 4JTEA 4CD6A 2Z24A 2ZRXA 3HIJA 4DBUA 1E1CB 1JQVA 1PIGA 4NF7A 3H4XA 2PDYA 3IJQA 5A2BA 5ABTA 4HK6A 2B81A 4AIOA 3FYYA 5E0KA 1VIZA 4JEQA 3GVQA 1VRDA 1QO2A 2Y63A 3N11A 2J7GA 2WZTA 2W9MA 5I00A 1KFKA 4S3KA 3VIGA 1R9XA 3RX4A 4D6FA 3MCOA 2CPUA 1OFRA 4UB9A 4AD5A 1IIGA 1LF1A 5AYZA 1EJRC 1UWSA 5D30A 3GFZA 1V3LA 1OADA 4LUYA 3SCRA 3CC1A 4IPLA 2DUZA 4UZSA 3ZLFA 1C29A 4TX6A 4HMNA 3QZ6A 5D2TA 5J5RA 4FOKA 5XIMA 3OYZA 2PRHA 6A3HA 1UBPC 2XINA 3UR8A 3AC0A 1J79A 1V02E 5EB8A 1NM9A 3BW3A 3W38A 2XVGA 5D8WA 1TFVA 3R79A 4AZ5A 5I03A 3PM6A 2QMJA 5A6MA 4HNOA 4JDBA 4F0RA 2YB1A 3OZMA 1IYXA 4AD3A 1SR9A 2FYMA 4IMDA 5FF2A 3PTMA 3TR2A 3W82A 1ZS2A 3ZVHB 4J2MA 1NQ6A 3EWUA 2VX6A 3UGVA 5DRCA 4MKSA 5I3JA 4HHMA 1BGGA 1TMQA 3E3HA 3TN6A 1CXLA 3EPNA 1R6WA 4A3UA 5AC6A 1QNSA 4ZOCA 1YQ2A 1UWQA 4K6AA 3A4WA 4M6PA 3EXSA 5C70A 3VD7A 4MWAB 4H01A 3W84A 3PZTA 4LV4A 4RK8A 3N2CA 4S23A 3Q4DA 4ACYA 5MKGA 3MP5A 3SIZA 1GPWA 1U1UA 4WDXA 4BA0A 1BF6A 1B54A 3EKLA 3TJ4A 4WY0F 4LCRA 3WD3A 5E5CA 3CH9A 4J3ZA 1HZYA 2BGNE 3MBFA 1F9CA 3VC6A 4QIUA 3MV01 1PL9A 5DY2A 2VC6A 1OFQA 1ZAIA 4JFVA 1R5YA 5BU6A 2WM1A 3LCXA 3LTYA 2A3EA 4AD2A 3MVTA 1HKJA 3T0DA 2FVMA 1V6XA 3B0PA 4QDMA 2QV5A 3DC0A 1C8VA 3ZYZA 2R94A 1FP9A 3UETA 4QM1A 4PTDA 3VOFA 3MSDA 3W7HA 1S5NA 3G24A