3I7SA

Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIREATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title How essential is the 'essential' active-site lysine in dihydrodipicolinate synthase?
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 107
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3i7sA00
3W7JA 5T26A 1MO0A 3MBDA 1PS9A 3W3OA 5HULA 4GJ1A 5EBUA 1XC4A 3HB9A 1OABA 1H51A 3B0UX 2RHGA 3UYCA 1R2RA 3DXIA 3A5VA 4LUJA 2DORA 2HSAA 4NX5A 3PS7A 3W7EA 3FYOA 1GG1A 4JTUA 3LBCA 4Q4KA 4FO4A 5IBXA 3NG3A 5D32A 2ABBA 2VXNA 2H90A 2WNZA 1AL7A 1H7NA 1MXSA 1PE1A 1ADOA 2Z1BA 2GQ9A 2C6QA 4OV4A 3MJYA 1SZGA 1FQ0A 3T44A 1SR9A 1VCFA 4JEQA 2QCHA 3P8JA 1F6PA 5D2YA 1Q45A 2EPHA 1M7PA 3A9IA 4J9JA 3S0CA 5D2WA 3QJAA 1WOBA 5AC8A 3EKLA 2D73A 4UTUA 4GUJA 1WYIA 3SZ8A 4RR4A 4M5PA 3ATZA 4NQ1A 2VFHA 4ICNA 1SO3A 3R89A 1QDSA 2EF9A 4A21A 2ZRVA 1TPUA 3S1WA 1AMKA 1FX6A 2I9EA 2ZZ4A 4O16A 2E6AA 1BTMA 5E1QA 2RDUA 1TTQA 3NL3A 3BK0A 2Y7GA 4QM1A 3EWYA 2C13A 5DBUA 2NXIA 3WJXA 3B0PA 2A7NA 1IXNA 1LRQA 4RZ6A 4XKYA 1IXOA 1PIIA 3M44A 5TIMA 3A5FA 3NQGA 2H3BA 2J27A 2JKAA 2ZZ3A 2A7PA 1B57A 1DJNA 1A5CA 3DFQA 2HMCA 3R13A 4Y90A 1EWEA 4WXZA 4ZQPA 1EB3A 5I3KA 1W3TA 3B05A 2C14A 5KITA 3AJXA 1O94A 4WXYA 3E02A 3LM7A 3S6DA 4R53A 1RV8A 1FWRA 3YPIA 1DL3A 1K03A 2XN0A 4O12A 1XDMA 1TTJA 4UFIA 2X2GA 4OWGA 3O6DA 4GUGA 4HIBA 3Q37A 2TRSA 3NA8A 1LLZA 4LTSA 3RNDA 3LHYA 1QPRA 3W1PA 1A53A 3LDVA 3TC6A 1QO2A 3B04A 4FIQA 4CNNA 3CIXA 2Z6JA 3CPRA 4FX6M 3P81A 1Q3NA 2V5BA 4RX0A 5J5DA 1SZFA 4JDYA 3W7DA 5AHLA 4AWSA 2XFWA 3BO9A 4N9DA 3UD6A 3UZ5A 1AK5A 1GYNA 2ZZ7A 1TQJA 2E5BA 3UY8A 3STGA 3TE9A 3FS2A 1F73A 4LS0A 1K8ZA 2FB2A 1R2TA 5A8GA 2YPIA 3IVTA 3NPWA 4S2CA 2HTMA 2VEKA 2YZRA 1QOQA 2J24A 3MHUA 1LM1A 4DF2A 3GZ3A 1TTIA 1DJQA 1JVNA 2OT1A 3PSVA 3DAQA 3RMJA 5K2ZA 2UV8G 2QCDB 1L2UA 3S5NA 2FPYA 2NLIA 4RZ4A 4BFAA 2PC4A 5AHFA 4O53A 1GVFA 2CZEA 2QDGA 2NWRA 3HBLA 3MP4A 3OHIA 2Y6ZA 5HINA 2B7NA 4O13A 4O10A 3SW6A 3MUXA 2QKFA 3BV4A 1S3HA 3PG8A 4C1LA 1G67A 1AW2A 3CB8A 4TMBA 3SSJA 2ZZ1A 2DU2A 3P5ZA 3GXPA 4FXRA 3QEZA 4LV4A 3ANYA 4LT9A 3TA6A 3JS3A 5CZTA 1FCUA 7TIMA 1RQBA 1ICSA 4JTLA 1SSGA 1SW7A 4RJEA 1TPWA 1WBHA 1H1YA 5LNWA 1KLZA 3MP5A 3W1RA 2B0MA 2Y88A 1OK4A 3I68A 1ML1A 2NUXA 1M6JA 1G4SA 1T99A 4N2YA 3L68A 4TIMA 3DU0A 3HG3A 4X3ZA 4BF9A 2Z0IA 4GUHA 1L6SA 2DZVA 2E6FA 1GVOA 3W85A 4NU7A 4OV9A 1N7KA 3PY2A 3O16A 3SECA 4RXFA 4IPJA 4LRSA 3LBMA 4AWUA 4R33A 2VENA 1P0KA 5F2LA 4YLWA 3G1VA 4JY9A 1F7BA 4I7UA 4BWLC 2XN1A 3DGRA 5F4SA 3UWWA 2CLKA 4AHOA 3UWQA 2CU0A 3TSBA 4ONVA 3W6YA 1EP3A 3UZJA 1OYAA 3LCWA 4JTHA 2LLEA 4UFLA 4DQWA 3PBYA 1HUVA 3KVJA 3HMJG 1VYSX 4JNMA 3TW6A 3KRUA 2V9DA 3LXCA 3FYPA 4DO5A 2YR1A 5LNRA 2ZZ6A 3EX3A 4GUIA 1YXCA 4XKYB 4Z1BA 3NDOA 3THAA 1YDNA 3G1DA 5FEWA 2FPTA 4UNKA 1TJRA 2C18A 1H62A 5FF0A 1P1XA 4M6QA 2PCQA 2GVJA 5DY3A 1XBVA 1YDVA 1XXXA 3L66A 1JCYA 2FQIA 3BLFA 4K38A 2Q3RA 5HJLA 3NQ6A 4OU1A 3RFAA 1W5MA 1ZFJA 2E09A 5U7SA 5LGZA 2QJHA 3L21A 4X2RA 3PULA 1DORA 3QM3A 3W2NA 4ADTA 4GXMA 2ZDRA 3VKJA 2A1YA 1PL9A 4UFKA 1G4TA 4FNPA 1X7FA 4CQ9A 3QQ0A 1S5VA 1L9WA 2TYSA 4LVGA 4POCA 2G96A 2V0TA 4EWND 4B5NA 1K3UA 3QH2A 3GDMA 3Q2DA 4K6AA 4LC8A 4Z0SA 1ZALA 3KRSA 2BZNA 5HWNA 1YXYA 3UWUA 3E9AA 3WK3A 4UFMA 2B7PA 4GNJA 1XI3A 3NZRA 2WSRA 3CT7A 2QCFA 1JR1A 1RZMA 3EX4A 1K7EA 4CQ8A 4LY8A 1YPFA 2Y89A 2AQWA 3MWAA 3KVLA 4UMCA 5DCEA 3IGXA 3L0NA 4N4QA 1ZENA 3HOJA 1EUNA 3E96A 3P82A 5K3VA 3DFTA 2H3DA 3CLMA 4OBTA 3FJ6A 5AN7A 4GE8A 1I2RA 5D03A 3HGJA 4UTHA 2ISVA 3GNDA 4GBUA 2ZRUA 1SW3A 3TMLA 3P7YA 4FB7A 5D30A 1PCWA 1H7XA 1V5XA 2DJLA 3C2VA 4PL1A 3GR7A 3MP3A 4UC5A 4O1AA 4BI5A 5E93A 2ZRWA 3S8HA 1KTCA 3ABOA 3DFSA 2ZZ2A 4IXHA 4IPIA 2QUTA 3LXBA 2YDAA 4I7VA 4C1KA 4Y6GA 5L6UA 2VOMA 2EKCA 1FUYA 3O1NA 4AHPA 3HJZA 4AVFA 1BKSA 2ATMA 4JYDA 3NQEA 4ORMA 1PCKA 3K30A 4OE7A 2CZ5A 3TNOA 2ZRYA 3ZFHA 3NXFA 3FOKA 2VEIA 3S5OA 1TPFA 3C2EA 3FEMA 1T8XA 4ZZ9A 2E1DA 5BW6A 5I3IA 3NVTA 5DXYA 2I14A 5C55A 1GTHA 2V2CA 3LRKA 1EPXA 3DI0A 4AWTA 2V81A 1W0MA 3PC0A 2WKJA 1GOXA 3W70A 3O15A 1HG3A 1OJXA 4NJHA 3ZWSA 1D3HA 1VS1A 2QJGA 2JGQA 4YCOA 1WDWA 3GXNA 1TB3A 4QIUA 2GOUA 3T78A 3STCA 2QUUA 3TSMA 3ELFA 3W84A 1OX6A 3O6YX 3EWWA 4DF0A 1A50A 5LHFA 3W2LA 1AG1O 3MMTA 3GDRA 3QPZA 1X1ZA 4MFDA 3G0XA 4O50A 1DV7A 2QF7A 1WX0A 1GPWA 4UTWC 1VHNA 5AYYA 4CQAA 3BG3A 3DFNA 1OG0A 4NJIA 3W74A 4CNOA 3W7KA 2WNQA 5LNVA 3MHGA 1VHCA 2Y85A 4MY9A 3IVUA 5K9XA 3BLEA 4FNQA 1JQXA 3W72A 1HO4A 5KTLA 4W9TA 3C56A 4AB4A 3A22A 2ZZ5A 2VELA 2P10A 2VFIA 3IEBA 1I4NA 4QQ3A 3N2MA 3W2UA 3M16A 3KOFA 2J9ZA 5E0KA 4QNEA 1MEIA 4Y96A 1NSJA 4CCCA 5DBTA 3C2OA 3G22A 5I3FA 3FKKA 3BPWA 3JR2A 5I3JA 3NM1A 4RLIA 1QFEA 1I2PA 5CSSA 3NM3A 5D09A 1I2QA 1LBMA 4JTSA 4IMEA 1W5NA 3UY7A 4HKPA 1Z48A 3CC1A 2VEMA 2H8XA 3LXAA 5FF2A 1AW1A 4LRTA 1KW1A 4IX2A 1J4EA 4U28A 3TJXA 3KAOA 5GVJA 2CFFA 1Q6QA 2NUYA 3DENA 1TPEA 3LB0A 1Z44A 4P2VA 3W22A 2R94A 1LORA 4RZ5A 2QCLA 2OJPA 3TXVA 4XQ6A 4HNTA 3W75A 5C54A 2G95A 1EIXA 4MJZA 3GDLA 1OF6A 1GZGA 1JCMP 1V7YA 5D2VA 1LROA 3U6WA 4O1CA 5D02A 3RLVA 1KFKA 3NGJA 2CLFA 1MSSA 3FKRA 3N9RA 4WY0F 4QNWA 1K8XA 4NZJA 2E6DA 2YSWA 4O1DA 3DFOA 2W6RA 5FF4A 4NXKA 4DPQA 3G8EA 3VE9A 3VFLA 4AF0A 2C0AA 2Y7EA 2GUUA 4Z1AA 3P74A 1UASA 4AH7A 4I7WA 4XBSA 4KWWA 3PUDA 3NPVA 4N9EA 1JRBA 2G5WA 3TMQA 1XUUA 3TQ0A 3LV6A 1YLVA 4PTNA 2DJXA 1XBXA 5DY2A 4DO4A 2RFGA 1KM0A 3LHVA 4MOZA 3IGUA 1LOQA 3S42A 1B9BA 3A21A 2QJIA 3LLFA 4RKAA 2VFEA 4UXDA 1K02A 3L5AA 4ORIA 4O8RA 3GKAA 4R34A 3T7VA 3TC7A 3BLIA 3U8GA 1EUAA 2QCMA 4MIMA 3W7IA 1JUBA 5CPLA 2BSLA 4PA8A 1TPDA 4E38A 4CLMA 3C2FA 1IIGA 1PHQA 3C61A 3CEPA 4XTIA 3HPZA 3L2IA 5TBOA 2PRMA 1W31A 4JTKA 1VJIA 2ZBTA 3TXZA 4O52A 3QW4B 3W2MA 5CPNA 3ZS4A 4WY0A 4ZQCA 4KFOA 4DBDA 4IMDA 3MYOA 1W5OA 3UQNA 3EWBX 4MUZA 2J9YA 3DHDA 4WX2A 3O05A 3QSTA 3IIZA 3SI9A 4UTIA 3UNDA 1RR2A 1OX5A 3W1AA 5HQEA 3Q94A 3EX6A 4LC6A 4UTTC 5EPDA 1ZY9A 5DN1A 4UR8A 1LYXA 2QCNA 2TMDA 1OF8A 2NX1A 1K7XA 2YW3A 2VFGA 3IIXA 2H6RA 3V75A 4OGZA 4M6VA 4IUOA 5CZSA 3LOTA 3NO5A 4FNRA 2YGYA 4O11A 2O7SA 2YW4A 1ZAIA 3W7HA 3W2JA 2CW6A 3C2RA 3GX9A 3W23A 5EL1A 1OX4A 1RVGA 2WSYA 4ML9A 4JTGA 1I2NA 5U4NA 1NAL1 2JBMA 3CIWA 3FLUA 5H91A 4PFMA 5KZMA 5CSRA 2DZUA 4EF8A 4M19A 3MW7A 2GQ8A 2WPBA 1DQWA 2P1FA 2E68A 2VKZG 4MYXA 1AL8A 2RKXA 5CZJA 2VFDA 5HR7A 2NX3A 5MHBA 3EEGA 5G2HA 2B7OA 1Z42A 2P0OA 1XDLA 1W3IA 5AHNA 1PV8A 2X1UA 3W88A 4WZHA 2FPVA 5AYZA 4JR5A 5DLCA 1D3GA 3N34A 3GVGA 1D9EA 4K39A 4Y8FA 1TYGA 4NNCA 3TFXA 1MEWA 1P0NA 4YWIA 4ZQOA 5G4EA 4N02A 2PRLA 1LOLA 4QSHA 3LHWA 1GTEA 2J6XA 3PBUA 3TK7A 1B3OA 3R5EA 4FNSA 3GLCA 3S5YA 1G4EA 1L6WA 2Z2UA 3T40A 2A4AA 3QYQA 1KV5A 3P80A 5DXXA 1XL9A 1QAPA 4FEZA 5FESA 3MYPA 4O19A 1OVDA 3KFTA 4ALDA 1YDOA 4O4WA 3N14A 5LHEA 5D33A 5IBXC 4DF1A 2OX1A 3NPXA 1OFOA 2FTPA 3LHUA 1DOSA 3WK1A 4AF0B 4MZ8A 2ZRXA 5DCBA 3QMRA 4CCDA 1TSIA 3GNNA 1EP2A 3WJSA 2Y63A 1H5YA 1LRNA 4LU0A 1O5KA 3M5YA 1W8SA 4S2BA 2PURA 3LTYA 4UMBA 1SFJA 5G2WA 1ZAHA 3IVSA 4JX4A 4P61A 3IIOA 4UCGA 1LDCA 2OT0A 4PL2A 1KA9F 4JY8A 1LOSA 3B0VC 4EOUA 2FDSA 1UCWA 4IX0A 4HPJA 2YXGA 4FIRA 4YXGA 4JTEA 1DVJA 4NNBA 4CCEA 4KWVA 5DELA 4ZL1A 2J88A 4BI7A 1OYBA 3P8IA 4TMCA 3M9YA 2X1TA 1S5TA 1TREA 1UB3A 5ABTA 2FIQA 1CI1A 2JKEA 3NL5A 3NEVA 4QJ1A 3G24A 1FCBA 5D37A 3GYEA 3TSDA 4WY0B 4K36A 4MJMA 4H4IA 4JS3A 4A2RA 2Y61A 1W5PA 3LI1A 2PE4A 3SR7A 3C4UA 2V30A 3L0GA 3LCIA 1H7OA 1TQXA 1A5BA 3PUEA 2BX7A 3UPWA 4EF9A 1ZAJA 4XWUA 2WSQA 3R8RA 4NNAA 4TX9A 4A3UA 4K8HA 4PC8A 2C3ZA 3EX1A 4EIVA 2JK2A 3FIGA 3L65A 5AHEA 4Z08A 5HUOA 3SIZA 3TAOA 2ZTKA 2W79A 3NQ7A 1GG0A 3MI2A 4KFPA 4BR1A 5A5WA 3ABRA 1X6UA 1VGAA 3EX2A 2FFCA 4LVFA 2ZRZA 3F1QA 3O07A 1WA3A 4MZYA 4IMFA 2XN2A 3MBFA 3LI0A 4A29A 1F76A 1OFRA 1ZCOA 3CEUA 5KSWA 5K4ZA 3NYZA 1JRCA 2FB3A 1KBJA 1L6YA 3WK2A 5CKSA 1JQVA 2BLEA 1OX4B 4JIQA 3A24A 2X16A 1KM2A 3QC3A 1BEUA 1LCOA 3M5ZA 5FEPA 2AAMA 3HQ1A 3NL6A 5D2TA 3RF9A 3RU6A 2PRHA 3U2OA 2VFFA 4MKNA 3P84A 3TR2A 2C15A 1TCDA 1NEYA 3M5XA 2RDTA 5F2MA 3CWNA 2VEPA 5BNKA 1GQNA 2CLLA 4IMCA 3CU2A 5K9CA 5H2ZA 4GRSA 4XUGA 3G1SA 1FBAA 3TQKA 3NQDA 5K7JA 4JYEA 1MZHA 5AHIA 1SUXA 3BG9A 3DH7A 6TIMA 4N9BA 3OG3A 3HPSA 2Y70A 5I3HA 5KZEA 4N6FA 2QUVA 3GR8A 4N9CA 4M6PA 4UNLA 3G1FA 1DBTA 3THQA 4JIPA 3O63A 1SO5A 2Y7FA 1LLWA 3NQFA 4MFEA 4EVZA 3WK0A 1TPVA 3VI2A 3NQAA 1SZNA 4LUIA 3TAKA 4HHPA 3OVPA 3SY5A 3QW3A 1JCNA 2QCGA 4MVAA 1GVRA 3NQ8A 2E6YA 1IXQA 4FNTA 3NPUA 1OFQA 2YFNA 2YYUA 2E5DA 4L4MA 3TH6A 3PBWA 3TU9A 3QRHA 3LHTA 1KM3A 3DKJA 2CLMA 3TROA 3W1QA 1H60A 4IMGA 1N55A 1QPQA 5G2IA 4X22A 5CG7A 3PG9A 4LVAA 1HFBA 1FXPA 5D05A 4ZQMA 1JJKA 1JCLA 1Q6OA 5F1VA 1N8FA 5HWMA 3LCHA 1G6CA 4IQLA 3M7WA 2JKPA 3AO0A 1SPQA 1JCXA 3NQ2A 3S1VA 4UTTA 4O0KA 4FX8A 1O5XA 1VCVA 3G8RA 3M43A 3KVKA 1KV8A 1H50A 4AEOA 3TJLA 4JTJA 4HN4A 1F74A 1XCFA 3G1XA 3ZR4A 1JULA 1WBJA 1NF0A 3NAVA 3VNDA 3NNTA 3HF3A 2YYTA 3W1XA 3S1UA 2R8WA 4QISA 2NXGA 1VH7A 4K37A 2HS6A 4LS1A 4R7JA 4K7YA 4NXSA 1RQEA 4U4MA 5KMYA 2A7RA 1OYCA 5TQLA 3LCGA 4FHAA 3DFPA 3L67A 1QMLA 3OA3A 2V2HA 5J5RA 4CNPA 1QCWA 4JX5A 5IM51 1IF2A 1VZWA 4JN6A 4NZFA 2ZCGA 1HO1A 4O4VA 5D04C 1S5WA 3I7RA 5AC6A 3GXTA 1C8VA 2HS8A 1ICPA 4O15A 1P5BA 1VLIA 3PUOA 3SJ3A 1ICQA 2B4GA 3HG4A 3H55A 1H1ZA 3LGEA 1W37A 2CZDA 1EA0A 4LVDA 5BMXA 5HR6A 1GVSA 4O0ZA 3MO7A 1NFBA 4NJGA 3F03K 3PWAA 3HG5A 3D0CA 1QO5A 3N73A 5HUPA 4MLRA 4G1KA 1T96A 3O8AA 4RK8A 1TRDA 4D2JA 1O4UA 2V5LA 1ZNNA 4IJBA 3B4UA 2WJZA 4O54A 3S1XA 1T0OA 5D2XA 1RPXA 2Y7DA 1KBIA 3STEA 1TTPA 4MYAA 1G7VA 1LBLA 2EGZA 3R12A 3QPYA 1TO3A 4H3DA 2CLHA 3HIJA 3MI3A 3QZEA 5DCDA 2GVLA 2NWSA 2RDWA 3W7CA 2ISSA 4Z1CA 3EXTA 1TV7A 1W1ZA 4IWWA 8TIMA 3F4NA 5EMUA 1I45A 2V8ZA 3O6CA 4WUIA 2TPSA 3QMSA 4N4PA 4GFSA 1EP1A 1XBZA 1YTEA 1QOPA 1TV5A 2AGKA 4LV9A 1HL2A 5FF7A 3W7RA 2JGYA 2IQTA 1H7WA 3IV3A 1WOAA 4Q33A 2ZA1A 4ADSA 3QFEA 2Z6IA 4Q32A 1RD5A 3L5MA 1H7RA 2QR6A 1QNVA 4LVBA 2VC6A 5AYXA 1LP6A 4FX7A 1QPOA 3TW7A 2EAWA 1VR6A 2H8ZA 5F1UA 3WJZA 1IIHA 4O14A 4AAJA 5C2XA 3I65A 3TX9A 4BWLA 1Q6LA 2WQPA 3PM6A 2NZLA 4IXXA 4IGHA 2QAFA 5D38A 3SGZA 4AMAA 4MPQA 4HT3A 5CPOA 5KZDA 5LKYA 5L9FA 3EXRA 3ABSA 4XZ9A 2DZWA 3IRDA 1ME7A 3UPBA 4UFHA 1JUEA 1GVQA 1SZEA 1XM3A 3C0JA 3LTPA 3W7MA 3INPA 1TMHA 5F2IA 1LBFA 1KFJA 2X1SA 2GQAA 3G18A 4HSOA 2ABAA 1IGSA 2RH9A 3M41A 4O1BA 4QITA 5KINA 1KFLA 5FI8A 4FXSA 4WOZA 2O7QA 4H6KA 4UR7A 2WO5A 3P60A 4LWWA 2WV8A 3P61A 1KM4A 2ZQ0A 1SW0A 4JGDA 3BVJA 3ABQA 1FXQA 4E0CA 5F4WA 2R14A 3ATYA 2DZPA 3G3DA 4S1FA 1FY6A 3A23A 4OQVA 4NVTA 4HNUA 5AOUA 5HWJA 1OFBA 2BXVA 3S5ZA 3M0ZA 1NF7A 3TIMA 4M7TA 1C9DA 2X30A 1JUKA 4XBKA 4MY8A 4OT7A 3PVFA 1FDJA 1NVMA 1F5ZA 4UMAA 5F2GA 1KM6A 3B8DA 4MY1A 1TPC1 3C52A 4DXVA 3UXDA 1R47A 1R2SA 4I9AA 5LNSA 3OIXA 1YPIA 1OFDA 3O06A 3G1AA 1G4PA 3Q58A 4HPXA 1LTDA 1K8YA 3NR0A 4PCFA 4RCXA 2C19A 3E12A 1AW5A 1BWLA 5HMSA 4DBEA 1B4EA 4UFJA 1YYAA 2Q8ZA 1O95A 2DZSA 1SFLA 1EWDA 1A5SA 3G3MA 1SU5A 3KXQA 3W87A 3GIYA 3MI6A 2W0UA 3M6YA 4O17A 1R46A 1I2OA 4WD0A 1ME8A 3PF3A 4MZ1A 4MLJA 3H53A 3LLDA 5G1TA 5C5YA 3TQVA 1SO6A 3G1HA 2ALDA 3KVMA 3QMTA 1FDYA 1SSDA 1XKYA 2ZYFA 3RK8A 3PR2A 3CHVA 2DZXA 3IIVA 4JTIA 4JTTA 3W86A 1GJPA 2FLIA 1LZOA 1W56A 2A5HA 3OVQA 4BK9A 4Y9AA 2CZFA 3NZ1A 1TPB1 1OFEA 3W73A 4UTJA 4UTLA 4LS2A 2I1OA 1DHPA 1RQHA 1B4KA 2NXHA 3BARA 3KHJA 3N19B 1VPXA 2GJNA 1TV8A 4NJKA 4LNYA 3QSRA 1KM5A 3B06A 3CTLA 5BRBA 1Y0EA 3W7NA 3BW2A 5EYWA 4FF7A 4JXCA 1LRTA 2Q3OA 1IXPA 3PAJA 4WJEA 4JD4A 3P67A 4ZQRA 4JX6A 5AB3A 1UJPA 3SFKA 4A22A 1SO4A 3WFAA 3H54A 3C3NA 4DPPA 3EWZA 3NOEA 3UWVA 2V2DA 2ZTJA 3DBPA 4ZMGA 2BWGA 3W71A 4KFNA 1OFPA 3LHZA 3I7QA 5EA9A 3LCFA 1KFCA 2YX0A 2QEZA 3C8FA 3UWZA 2QDHA 3LX9A 3LCLA 1UBSA 3RLUA 2V82A 1DKWA 1WXJA 4AXKA 3OEXA 3G0SA 4UTWA 3TCEA 3LERA 4NJJA 5EY5A 2ISWA 1PVNA 4AHQA 4WOQA 3UXAA 3LCXA 2F7FA 1TPH1 3TDFA 1TRIA 1M5WA 3N3MA 3HGRA 4NX0A 3OVRA 3LTSA 4GUFA 1GWJA 3QF0A 3W76A 3VE7A 4TO8A 4BI6A 1ME9A 4O57A 3TUUA 1ZJIA 2YCEA 2FJKA 3GAKA 3JRKA 1WQ5A 4UTMA 1H61A 3B03A 1WAUA 1YADA 1XUZA 2R91A 4TR9A 3V1PA 4N6EA 2KZHA 2B7QA 3P62A 3F4WA 1G69A 1FWTA 3W1MA 2WNNA 1TIMA 1F2JA 2ZFAA 3EWXA 4Z1DA 4Z0JA 2QCCA 2DP3A 3USBA 5CGQA 5BOOA 2A0NA 4RV8A 3PBVA 4GC4A 4PODA 3W7LA 3DI1A 5LGXA 3T55A 1E51A 2CLIA 1M7OA 3BW4A 4UUIA 3W9ZA 4ADUA 1JCJA 4RXGA 1O60A 3W7GA 3BG5A 4GWEA 3ZWTA 3W07A 3BGJA 3NQMA 3T4CA 1VLWA 4JICA 1TJPA 1FCQA 4JYFA 3M1ZA 5LSMA 5BMWA 1W5QA 3TFCA 1THFD 3G0UA 3NL2A 3UWYA 1QR7A 1VC4A 3OBKA 2A2IA 3STFA 5K9DA 3S9YA 1DQXA 5FEZA 1J5TA 3FA5A 1VYPX 4ZVJA 3W2KA 3PB2A 1KLYA 2C16A 2CWNA 4JTFA 4YL2A 3TKFA 2A6NA 3HG2A 1F05A 3N9SA 1ZHAA 3LV5A 3DHFA 2A21A 1KTBA 1FWSA 3EKZA 4A2SA 1FCVA 3KRZA 1X1OA 2X1RA 3LRLA 4DEFA 3PSWA 5LNUA 5K4XA 3TV8A 1GEQA 4LW7A 1OHLA 1C29A 2NX9A 3LRMA 3FJLA 5CZ0A 3GK0A 3IGSA 3W1LA 3HGOA 4PH6A 1Z41A 3I6RA 5SWUA 2YFOA 2GPTA 1KFEA 3KX6A 5G5IA 1U83A 1H63A 4PEKA 2CLEA 4K7VA 2E5CA 1OK6A 2BTMA 3NQVA 4L4LA 2OZ0A 1MEHA 5G1YA 3I7SA 3P5YA 3W1UA 1U5JA 2EHHA 4UIOA 1QPNA 1F6KA 3BGGA 1XBYA 4X9SA 1KTNA 1VQTA 3W7PA 1GYLA 3QQ1A 1UUMA 1K7FA 2NUWA 2A6LA 3HGSA 1ALDA 3L0KA 2NV2A 4O28A 1J2WA 1Q6RA 4NT0A 4HNNA 1W3NA 3W7OA 5AC7A 3NQCA 5HNRA 2NV1A 2ZA3A 2G97A 4XTDA 3W7QA 1YTDA 3EB2A 3PB0A 3L5LA 4E2BA 1X8FA 2ATSA 4TU1A 1A5AA 1KM1A 1EEPA 4YCPA 1HTIA 3GAYA 5AHMA 2C1HA 2WOQA 5FEXA 2DZTA 1ONRA 5G4WA 5I3GA 4DO6A 3VCRA 2QCEA 4QAIA 2GVGA 6ALDA 1UUOA 1P4CA 5LZLA 2A85A 1EX5A 3DKLA 5C6MA 3IIPA 5FF3A 1XFBA 1FDZA 3MHFA 1BWKA 4WQ6A 4NUWA 4HNVA 3CM4A 3EXSA 3E0IA 4M7SA 3SGUA 1GT8A 3GDTA 4KKXA 1VCGA 2OMAA 1FWWA 3BW3A 3M5VA 3N2XA 3G1YA 1R30A 3DZ1A 3GDKA 1I8JA 2E77A 1H7PA 1FWNA 2Y62A 1W54A 4OHQA 5F4XA 3W1NA 2ZA2A 1YXDA 3C6CA 2J9XA 1G7UA 3GB6A 2QAPA 3R2GA 4E2DA 3CWOX 1OFAA 4JDBA 5CPMA 2F84A 3HO8A 3W83A 2CLOA 3L9CA 4IOTA 4LOCA 4UTKA 3M47A 1CW2A 1SQ7A 4HSNA 4K8EA 2TSYA 3GKFA 1PHWA 3W1TA 4ZQNA 3E49A 4DELA 2GJLA 2QCDA 3HPXA 5AFDA 4YMZA 1YTKA 3EWUA 1VRDA 1KFBA 1CX9A 1WV2A 1VYRA 2Q8LA 3WJYA 4FNUA 5EKYA 4O18A 3WJWA 1QWGA 3CQ0A 2OCZA 3FFSA
chains in the Genus database with same CATH superfamily
1MO0A 2FGZA 2P76A 4RPQA 5FAJA 4ZEPA 1B54A 4PMQA 4M1BA 1H51A 3UYCA 1R2RA 3DXIA 3T07A 3A5VA 1E15A 2DORA 4CD7A 3FYOA 1GG1A 4D71A 4Q4KA 5IBXA 5D32A 2VXNA 1AL7A 1KGWA 1JG9A 1YQ2A 2GQ9A 2DVXA 1K9TA 3QYSA 2WK2A 3P8JA 1EDTA 4GH1A 4U5KA 1F6PA 3WKZA 3MY9A 4J9JA 3BXWA 3EKLA 3W6MA 4UTUA 4J3XA 4GUJA 3CHCA 2UBPC 4RR4A 4K1WA 1EJXC 4F2BA 3BLPX 2BDQA 1TJ0A 3THCA 2C79A 4ICNA 1SO3A 2EF9A 4XD4A 3BAXA 1TPUA 3NZPA 3T0AA 3S1WA 1UPMB 1Q5MA 4GY0A 1KXHA 1JYVA 1GVIA 1ZZMA 2WJFA 1JXJA 3BK0A 3M0IA 1R38A 2C13A 1EL3A 1CLXA 4ZXLA 2A7NA 1IXNA 3BLLA 5FIPA 3COTA 1IXOA 1PIIA 3M44A 3W82A 4AYGA 3GC5A 2J27A 1PAMA 2A7PA 5EFDA 5DQPA 3DFQA 1QNRA 1EWEA 1RUSA 2ADAA 3DHUA 3CYJA 2ISFA 3E2VA 4B2DD 1WP6A 4PCPA 2PSNA 3L2MA 5KITA 3CZJA 4WXYA 4DWSC 2BOEX 1P0BA 2FYMA 4O12A 3OBAA 4H9TA 4UFIA 5GJNA 4HIBA 4AX7A 3HV8A 5DF0A 1LLZA 2XZ9A 4LTSA 4J27A 5C8BB 1Q6CA 5AZ0A 4J3UA 2XM1A 3HMCA 3P81A 2AL2B 2V5BA 3RU8X 4RX0A 3VX0A 5J5DA 2XFWA 3UD6A 1AK5A 4RPPA 3SQMA 1GYNA 4MSSA 3MV11 1CIUA 3GH7A 2FB2A 5HMFA 2YPIA 3TQPA 3NPWA 3HZ3A 1FTXA 2YZRA 1ZS2A 1TCMA 2OGYA 3ZT5A 1UD3A 3M7SA 2XFYA 1M7XA 4F9JA 4RNFA 1JD9A 1FKXA 2OT1A 1I0BA 2INFA 3L4TA 2QCDB 1NM9A 4LUTB 1L2UA 3S5NA 3OYZA 3KBVA 3WEZA 4F79A 1I1XA 4PUWA 3HBLA 1DXEA 1IEXA 2DEPA 1VBJA 2Y6ZA 5HINA 4O13A 3KZPA 4O10A 3SW6A 3N25A 5ABFB 2DQXA 4IF2A 4Q8MA 4JTAA 1S3HA 3PG8A 3QY6A 3PHAA 3AMGA 2OZ8A 4JFSA 3IJLA 2ZZ1A 3VNMA 2PD9A 4LV4A 5FJOA 2E3ZA 4E4UA 1RY0A 1ICSA 2A3BA 2DZBA 1W9PA 3SUSA 1TPWA 5LNWA 1KLZA 4DWSD 1J6OA 2Y88A 3I68A 1G4SA 4N2YA 3S5SA 3VX1A 3HG3A 2ZVRA 4X3ZA 2YJQA 2Z0IA 1AMYA 2E6FA 2DFAA 3QGKC 3VC5A 3WF2A 3AROA 4GNKB 1N7KA 2WC4A 4ZE5A 4RXFA 3FEQA 1QW7A 3S9IA 2BMBA 4YVVA 4HU4A 1LUCA 3OU8A 4R33A 2CEQA 2VENA 4CN1A 1CXHA 1P0KA 1YX1A 4HHLA 2CLKA 2FZDA 3IUHA 1UIOA 3WF0A 4ONVA 1P0EA 1OYAA 1FWDC 3LCWA 4JTHA 2YL9A 4UFLA 3PBYA 1HUVA 3TW6A 3LXCA 3I10A 2VCCA 4O0QA 4OFCA 2YR1A 4FPSA 4GUIA 1YXCA 4Z1BA 1W1YA 3NDOA 3THAA 1MWOA 4YYCA 4W5ZA 2D24A 3EWCA 4REQA 3KP1A 5T91A 2ZXBA 4IQDA 1XBVA 2FQIA 4MWAC 4K38A 5HJLA 2BODX 3RFAA 2E09A 5LGZA 4JCLA 1XX1A 2BVTA 4KEZA 1HJVA 4E8DA 2EPLX 2GL5A 2Z27A 3VNKA 4LY4A 3VD5A 3ALFA 4K8GA 4Y9NA 1T7LA 4Q7NA 4UFKA 1CXFA 4DXKA 4FNPA 4CQ9A 3QQ0A 1OZQA 1S5VA 1UC5A 1W1TA 3H7VA 1MVYA 1ZJBA 4Q8OA 4LVGA 4HZ7A 1JIBA 2QS8A 4LC8A 1RBOB 4Z0SA 3LEPA 3R94A 3ITGA 4AFYA 2BZNA 8A3HA 3E9AA 4GNJA 3CT7A 2GQ3A 2WSRA 3B8IA 1JR1A 5CCZA 4TVUA 4LY8A 3M0JA 2AQWA 3MWAA 2WB5A 2FFIA 2C0HA 3L0NA 2GJPA 4GLEA 2VCBA 1JXKA 3E96A 5BCAA 4HU0A 1CGYA 1EPVA 3TW9A 5AN7A 4GE8A 3RRAA 5TAOA 4UTHA 3GNDA 2PCEA 5A8MA 2X42A 3P7YA 4C6DA 2ZC1A 4QTGA 2DJLA 3GR7A 3BOFA 4O1AA 3DFHA 1FWHC 2ZRWA 2EPNA 3MS8A 2GGEA 2ZZ2A 3LXBA 1XLEA 2YDAA 3E5PA 2EKCA 1FUYA 3GU2A 4AHPA 2ATMA 7REQA 1F6YA 1TX2A 3K30A 4OE7A 2ZRYA 3ZFHA 2IXVA 1TPFA 2PP1A 3FEMA 1MW0A 2FTYA 3LPFA 4W85A 4F9DA 5DXYA 4AY1A 1WDRA 4H9XA 2I14A 1GTHA 2V2CA 4ZENA 2V81A 1JI1A 3LMZA 1M3UA 2WKJA 4IIGA 2VRJA 2R6OA 3O15A 3ZWSA 3R0UA 3UA3A 1D3HA 4D6GA 2JGQA 4MWAD 3N17A 3GXNA 3STCA 4XZNX 3W84A 2QULA 3EWWA 4DF0A 1A50A 2WC3A 1HKIA 1AG1O 1XYFA 4GXWA 3QPZA 4MFDA 3G0XA 4JHZA 2QF7A 1WX0A 3GFYA 4RNJA 1ZJHA 1EQCA 2WSKA 3KLKA 4GQBA 1UKSA 2R82A 3S2CA 1BXBA 1X96A 3BG3A 3DFNA 3ES7A 4CNOA 5LNVA 1A0DA 3GTHA 2CIPA 2C8NA 3QR3A 2OSWA 3MTWA 4JTDA 1F8IA 3C56A 3FA3A 3A22A 2VELA 2CBVA 4QQ3A 3SCSA 3DUGA 3N2MA 4FSAA 2DIEA 1MEIA 1E6NA 3R0KA 2X40A 2XM2A 3F4DA 4TX6A 3G22A 4HSHA 1TWDA 3B9EA 3BPWA 4ZOAA 4RLIA 3GHRA 2GGGA 1QFEA 4X60A 4PCNA 1I2QA 2VEGA 4IMEA 4AZCA 3CC1A 1GHSA 1UWSA 3LXAA 1EHNA 3BH4A 3B8TA 4IX2A 1J4EA 2ZKMX 1QUMA 1V8EA 3KWSA 2P88A 3PWGA 1Z44A 2C71A 1ZP3A 4P2VA 1GPFA 5H6HA 1HL8A 4PMOA 1LORA 2OJPA 3W75A 1E9YB 1AA1B 3UGVA 1DPMA 2OZ3A 4M1RA 1OF6A 3TTQA 1GZGA 5H8PA 2OEMA 4DJDC 1V7YA 1LROA 1P6BA 1XYLA 1ONEA 5D02A 1KFKA 3G6LA 2ZX5A 2IKGA 3NO3A 2E6DA 1UMYA 4NXKA 1SJCA 1J11A 3LU2A 2FVLA 1Q7QA 3RO8A 4AD5A 3SB0A 3DYMA 3M0HA 3WH7A 1EHAA 4ICCX 4LCRA 5A95A 3GR4A 4AH7A 1UR2A 4XD6A 1V08A 3TMQA 2GUYA 1BVZA 1XUUA 1R5YA 3TQ0A 2VQUA 1TWIA 2XFFA 2RFGA 2QZRA 3LHVA 3WBXA 2QMJA 3S42A 1B9BA 4GY7A 4GI8A 5H8UA 1PTAA 1XLDA 1UWIA 3RCNA 3L4VA 4R34A 5A94A 4MIMA 5HNTA 1JUBA 4GCAA 2ZUUA 1FWAC 3VGFA 2HBXA 3ZZ1A 2PRMA 3SCQA 3VGHA 4UOJA 4XAGA 2ZBTA 1HP5A 4Y7EA 4FOUA 2RJHA 3ZS4A 1QHZA 4KFOA 1VFUA 4UNIA 1W5OA 3UQNA 1PUDA 4PBEA 1OT2A 4C6JA 2YIHA 3KLLA 3CB3A 4MM1A 2RDXA 1XR2A 5HAOA 2WCAA 1EJ7L 3IIZA 1IZJA 3SI9A 1NQ6A 1XG3A 4UTIA 3LQLA 3VA8A 1RR2A 1OX5A 2AL1A 9CGTA 3CUFA 1QHOA 2HWGA 4HP5A 3I6TA 2I16A 1GNXA 1YMYA 2PDJA 1V03A 2TMDA 2XUCA 1OF8A 5A69A 3IIXA 1WZLA 4OOUA 4OGZA 3WY1A 3CZEA 4IUOA 3GNRA 3NO5A 1U22A 1V93A 3VIGA 1AVAA 1G94A 3EBVA 2VX5A 2F9RA 5AC5A 5BYWA 1U1JA 5EL1A 2XIQA 3NTYA 5M17A 5U4NA 1NAL1 1DWGM 1UR9A 2OWXA 5JU6A 2HDJA 1UR0A 1UA7A 4CD4A 1XIMA 3KCJA 4B5XA 4LCSA 4M56A 4NAEB 1DJIA 5CZJA 1ZQ5A 1EQPA 5PTDA 4DY1A 4LB4A 3VD3A 2YCIX 3KL0A 2P0OA 4HNOA 5A2AA 2ON3A 1YNYA 4GZ7A 4WZHA 5AYZA 1E9LA 3BV7A 1D9EA 5I79A 4Y8FA 3WMBA 4B5VA 3L4YA 5EMMA 3V5FA 4IMAA 4I6VA 2WWDA 1W3KA 5CPSA 3RR1A 3PBUA 3UWEA 2F6UA 1L6WA 1HIZA 1KRMA 3ZLHA 3R0DA 1QAPA 4FEZA 3TLLA 3MYPA 5FESA 2O55A 1OGBA 1XLJA 5GNYA 4DF1A 3P0WA 5C9XA 2FTPA 4JKKA 4GIEA 4PUEA 3N6QA 5DCBA 2W61A 3QOKA 2W92A 1TSIA 1MQPA 1US2A 3WJSA 2OYKA 3OJGA 1O5KA 4DYEA 1W8SA 4QP0A 1KR1A 1JCTA 2Q6ZA 4ZGYA 4ROPA 2G3FA 2QXWA 1SFJA 5JXQA 4JX4A 3IVSA 2Z1SA 4P61A 3IIOA 1KWKA 2V5KA 1VP5A 3K4WA 4M6UA 1KA9F 4B3KA 3N12A 4JFUA 4IH3A 2V38A 4IX0A 4B90A 1PEZA 5BOFA 1JZ3A 5BU6A 2J88A 3M9YA 2Y5JA 1XRVA 3W01A 5DFAA 1Z3NA 1W32A 3P14A 3SCTA 2ZUSA 3ARQA 3QBUA 4DJEC 3QZAA 1UR3M 5D37A 2OLHA 3DC0A 4K36A 4WY0B 1MRQA 3IJ7A 2YL6A 4JS3A 3WUEA 2A79A 4YHEA 2DSZA 2PE4A 1SJAA 3SUTA 2WHJA 5CJMA 4W88A 4AD2A 2BX7A 3CQJA 3UPWA 1ZAJA 2WSQA 4EXBA 5HQLA 4A3UA 3MJMA 4G5DA 4QJ5B 2C3ZA 2DIJA 1LJYA 4EIVA 2JF7A 3Q45A 2D2HA 3L65A 5AHEA 3SIZA 3T09A 5C71A 3MI2A 3H4GA 2GGIA 4Q22A 5A5WA 2CYGA 4RE4A 1NP2A 4Y9PA 3WFLA 1CXLA 4LVFA 2ZRZA 3LNPA 1Z9AA 1KBBA 1RBLA 4UCFA 6A3HA 3AAMA 1ZCOA 5K4ZA 4LNCA 1XYAA 3TZFA 4HYWA 4YWSA 5CKSA 1SZRA 1OX4B 3VD4A 2WNWA 1GOQA 3V5CA 1IEQA 1WO2A 3QC3A 4S3JA 4EX4A 3WMLA 4DZHA 2AAMA 3HQ1A 5D2TA 3N11A 4B9ZA 2PRHA 2VFFA 1JPIA 4S39A 1Y65A 1GKPA 3FVDA 2CLLA 2HCVA 3N2CA 2VHLA 4XUGA 4NRRA 3G1SA 2DT1A 3TQKA 1DTNA 4J4KA 3CUXA 4F40A 1XH0A 3EDEA 4DBUA 2A3CA 3EDKA 4W4QA 3NWRA 6TIMA 1Z69A 1WUFA 3OG3A 4N6FA 3W02A 3G1FA 1JYWA 1XLAA 4JIPA 3XINA 4P7LA 4XSMA 4FOJA 3O3RA 1EEXA 3DCPA 3TWBA 1IGWA 2EG8A 4ZR8A 4HVXA 1VJSA 1W1B1 5EMLA 5I02A 2Z1VA 1XHGA 4DJED 1JCNA 2QCGA 4L1GA 3NQ8A 4WSKA 2G50A 3WDIA 4FNTA 3NPUA 3DG6A 1XKJA 2IUZA 1QW9A 3QRHA 2J7BA 3LHTA 1YW1A 2GK1B 3A4JA 1ZBVA 2XDFA 5A8QA 3WD2A 1B30A 2HK0A 1QPQA 1MI3A 3PZMA 1EO5A 4GJJA 5A8OA 5CG0A 2QIWA 5CG7A 3LSBA 1BD0A 1XLHA 1FXPA 2A3HA 2E1WA 4IQLA 3AZTA 4KQNA 2OOFA 3M7WA 2NW0A 3EPMA 4YS1A 3PPFA 3S1VA 4UTTA 3G8RA 3KVKA 1KV8A 4F4RA 3TJLA 5I0DA 2B31A 4LEQA 1UD8A 3ZR4A 4M0XA 5JBDA 1WBJA 3RN6A 1NF0A 3NAVA 4G7EB 4R7OA 3NNTA 5CC5A 3W1XA 3S1UA 2J7FA 2R8WA 3WLOA 2HS6A 3LUTA 1RQEA 4G1NA 4U4MA 2BOGX 5C9UA 1VENA 3EOSA 1S46A 1V3LA 4FHAA 3L67A 1QMLA 1LL6A 4H2HA 4U3CA 4LANA 3RITA 4JN6A 2XH2A 5D04C 4Z1YA 3HURA 4HHHA 1R3QA 3GXTA 2HS8A 1ICPA 3VOIA 1ICQA 2B4GA 1EA0A 1W37A 5BMXA 5C2CA 5AZ1A 3MO7A 1E1FA 1H49A 3F03K 3E0VA 2OPJA 4DO7A 3GG8A 3BAIA 3QQWA 2MANA 1W3HA 4NYUA 4G1KA 4C6BA 5E9AA 4RK8A 3T8LA 5D9OA 1UJQA 3B4UA 3MC5A 2VX7A 1KBIA 3STEA 1TTPA 1KGUA 1B9ZA 1FWJC 1G7VA 1LBLA 3N6JA 2CLHA 3LA4A 3W0KA 1FFRA 2XSBA 1NDYA 2NQJA 3W7CA 4Z1CA 3EXTA 3M0KA 8TIMA 3F4NA 1I45A 2TPSA 1JDEA 2Z2AA 4C1NB 1RLDA 1EP1A 1XBZA 1QOPA 2JGYA 1W9DM 2ZA1A 3QFEA 1JDAA 2DT0A 1JDCA 4M24A 3IUIA 2QR6A 1ECQA 2DH2A 1VR6A 5REQA 3WJZA 1IIHA 3MDUA 1EF3A 3I65A 3VIJA 4BWLA 2WW5A 4M29A 3CQIA 4IGHA 2RGMA 4GVIA 5A6AA 4B16A 5CPOA 4Y2WA 5E0FA 4H6EA 5LKYA 2P8CA 1PJ9A 3CS2A 3B3DA 1HGWA 4D8ZA 3UU0A 3IRDA 1ME7A 3MMUA 1JF6A 1OB0A 2BG5A 4GZJA 3AYSA 4H9UA 1Q6DA 2D0HA 1OCBA 2EJAA 2ABAA 1IGSA 3UXLA 4X61A 4QITA 2ACSA 3I3DA 3ONCA 4A3HA 1DE6A 3CUZA 4H6KA 4NG3A 4AZIA 2G8ZA 1NIUA 2WO5A 3GC4A 1KM4A 1C9WA 1MUWA 1SW0A 4LF1A 2BXZA 2AKMA 2TODA 3E2SA 2YDSA 3A23A 3BSMA 4DM2A 4OQVA 3URNA 2BXVA 2I57A 9RUBA 4KRZA 4W8LA 3VMOA 1JUKA 2G4FA 4L4PA 4OT7A 4Z2KA 4JEJA 4XUYA 1F5ZA 1PBGA 4MY1A 3C52A 4NP7A 5LNSA 4I9JA 1WDPA 1YPIA 3O06A 4BQ2A 3EB3A 2V5DA 1G4PA 3Q58A 1K8YA 4KH2A 4RCXA 2C19A 3C2YA 4WEVX 2VMFA 3VIFA 4DBEA 1DJZA 2Q8ZA 1JFXA 1EXBA 2DZSA 1SFLA 1EWDA 3G3MA 5MKGA 2W4XA 2PDPA 1RJQA 4IG2B 5XIMA 4O17A 2OFJA 2ONEA 3VKAA 4KT2A 2O4QA 3SBFA 3H2MA 3BSHA 3KVMA 4Z2IA 1D8WA 1M65A 1XKYA 3RK8A 3CK5A 4JTTA 1EYEA 3APYA 4AD1A 2FLIA 3RM4A 2A5HA 3NCOA 3V0SA 2WZEA 4HMEA 3ID7A 4RE3A 4UTLA 3RX4A 3FV9A 2E28A 3BARA 3S4TA 1E1CB 2QUNA 3N19B 3IV8A 1VPXA 1V6WA 4LNYA 3QSRA 3WLLA 5BRQA 3CTLA 5BRBA 1QASA 5DMYA 3W7NA 3VOFA 1AJZA 3SN1A 1UWTA 2Q3OA 4UB9A 4JD4A 4ZQRA 2P53A 5DX7A 2P50A 1UJPA 3WMSA 3BQ6A 4FLQA 4XO6A 5CJNA 2XGIA 4WSHA 3W37A 1QI5A 1UZ4A 1DJWA 2WMFA 2BWGA 3W71A 1WPCA 5DEZA 1KFCA 2WJDA 4DWDA 3BL3A 2F6XA 4B9YA 3URAA 3REQB 1UBSA 3AI0A 2O9RA 2CPUA 2XVKA 4WJXA 2Z1WA 3ZVHA 1WXJA 4AXKA 4BF7A 4UTWA 3TCEA 1X6LA 3FW6A 3RHGA 3U3HA 3RPDA 1Y5VA 3U57A 4F8XA 1EJRC 4V28A 1IR1A 4KRUA 1QI2A 3W76A 1Q13A 1ZJIA 2XTKA 2YCEA 4NIRA 3EGJA 3ALGA 1QATA 1HJQA 5I5RA 2JEQA 1FWIC 1WAUA 3PK7A 1UKOA 4IL2A 2R91A 3ZYZA 4C6CA 2C1GA 3WBEA 4GACA 3FYYA 4WDTA 1FWTA 3W1MA 2WZHA 4LYPA 1TIMA 2ZFAA 4RDVA 1HVQA 4GVGA 2DP3A 4GBDA 3USBA 3F4CA 3PBVA 4PODA 3DI1A 1KCXA 4P7RA 3UZWA 2CLIA 1M7OA 3H7RA 3KOWA 1JCJA 1O60A 3W7GA 3A47A 4BS0A 3ZWTA 1BFNA 4HMCA 1X6NA 1IWPA 1NELA 4YVPA 3VKBA 4FLOA 1TJPA 2O9TA 1YHTA 1N8WA 3AU2A 4W8AA 3TFCA 1B2YA 3OBKA 3NVDA 1YNQA 3B8VA 3OGSA 1J5TA 3EPOA 4HCHA 3QGAC 4YU1A 2CWNA 3ITXA 1ISYA 3LM3A 1RA0A 1UUQA 3EMCA 4XAPA 3N9SA 4Q8QA 4J35A 3EKZA 3MU7A 4DEFA 3KRZA 2G41A 1ZTVA 3EWDA 2NX9A 3LRMA 1RJPA 4F48A 3GK0A 3W1LA 3HGOA 4PH6A 4PRWA 3KX6A 2Z24A 1ZP4A 3KCLA 5C9WA 4BQ4A 4V2XA 5HPCA 1OK6A 3NQVA 2P5NA 4R9OA 4D6DA 4U2YA 5G1YA 3W26A 2IKIA 3TP4A 4HHMA 1CTNA 3M0VA 4DYKA 1XBYA 1BAGA 2DT3A 4X9SA 3UCQA 3W7PA 3TNBA 1RP9A 2NUWA 2DVUA 2A6LA 3WMCA 5GQBA 4GO8A 4XO7A 4HNNA 1ZJAA 1B3VA 5AC7A 1JDDA 4C6OA 3W00A 4OOZA 5HNRA 5A3HA 5ABHA 2VWTA 3PB0A 2E8YA 4E2BA 4ES4A 1X8FA 4XIMA 1KM1A 2UY3A 4YCPA 3IJ9A 1PTDA 1AD1A 2OXNA 4JN7A 3NXLA 3GXFA 3W4RA 4H9MA 2WOQA 5FEXA 1ONRA 1JNDA 2GVGA 1P4CA 5LZLA 3R4IA 1DHKA 4XG1A 3WIJA 1VEMA 3O2LA 1BWKA 4KCUA 3C3UA 4LGXA 2QPXA 4DLMA 2AQOA 1XLIA 2IXUA 3DOPA 1OCQA 3R7MA 4HBKA 5BXRA 5BXSA 3E74A 3G1YA 1J0JA 1I8JA 2Y62A 1RK6A 4OHQA 2XFRA 2ZA2A 1WAWA 1UPPA 4OVXA 1S2CA 4AZBA 3GB6A 3KZSA 4F3HA 4LYRA 2ZWYA 2IS7A 3CWOX 3RPTA 4JIRA 4IZGA 1IWBA 1CW2A 2BY1A 4HSNA 2WVVA 3GKFA 1PHWA 4OIFA 4S3FA 3HPXA 3IK4A 3NQBA 5AFDA 2W91A 4D6JA 1VRDA 1KFBA 3KBMA 1J96A 1VYRA 2PDNA 1JPHA 1VFLA 4PMNA 3WJYA 5EKYA 2P8BA 1XYZA 3W27A 3FHAA 3U4FA 4ZTYA 1PS9A 1KFWA 3WCZA 3H2OA 1UWAA 5EBUA 1SJDA 1OABA 4LBSA 4A8RA 3LD5A 1DWFM 4LUJA 4I5XA 2HSAA 4PUKA 3W7EA 2X05A 1UYQA 3PJWA 3WLHA 4FO4A 2UY5A 3NG3A 4IFRA 3TYAA 5I06A 8CGTA 1S39A 3C0LA 5ECVA 4IIDA 1MXSA 4J1OA 3D3FA 4L65A 4OV4A 4QHRA 3N6HA 3LPGA 2DH3A 1SZGA 3FHQA 4JEQA 1XIFA 1XDJA 3REQA 3S0CA 2R24A 4S3BA 3SZ8A 4M5PA 3RXZA 3H6OA 3AALA 1XPGA 4A21A 3WBWA 2ZRVA 2HVMA 1CGWA 1FX6A 4W86A 1U1UA 1FP9A 1BTMA 4QDWA 5E1QA 3KOZA 2Y7GA 2DGAA 4IFKB 3L12A 2NXIA 3ES8A 4LEFA 3WLKX 3XIMA 4YTSA 2J8FA 3LZ5A 5IHSA 3SUUA 4RZ6A 4DRSA 4Q4QA 4XKYA 1L8PA 4NKCA 3WZ0E 3NQGA 2JKAA 1A5CA 2HMCA 4CD8A 4WXZA 1W3TA 2C14A 3E02A 3LM7A 3PN8A 4H01A 1MQRA 1RV8A 1DL3A 3T6CA 4XSLA 3W6LA 2PP0A 1R3TA 3NA8A 4JBRA 4GVFA 1V4YA 3VDGA 4LYQA 3LHYA 3RNDA 4FALA 3B04A 5FD0A 2Y4SA 1PKMA 2Z6JA 3CPRA 2BVDA 3IUDA 3EKGA 1XQLA 3JW7A 4JDYA 3ZJ7A 1V02A 5AHLA 1EOMA 3T81A 4F0KA 4EWJA 4UOZA 2E5BA 4RUBA 3CQHA 2ZADA 3STGA 1F73A 1QPKA 1TWWA 4KCWA 2OWCA 4S2CA 3AXKA 3MPGA 2YZ5A 2J24A 3MHUA 1LM1A 4MJ2A 2RGLA 1ZB5A 3HQOA 1DJQA 3GHSA 5HMEA 4EPBC 3N3TA 1K9EA 3DAQA 3VXGA 5AC4A 1WKEA 3OGRA 4KERA 4RZ4A 1DWJM 1QNQA 3W29A 5HXMA 1TJ2A 2CZEA 1GGOA 2P3ZA 2NWRA 2ZICA 1XIDA 1DIDA 3WDRA 2VGGA 1C91A 2ZE0A 2OSXA 4CGTA 4QSFA 4R5EA 1TKKA 1LLOA 3AMLA 3M6DA 4FXRA 2PDFA 1Q6FA 4C6PA 4CVUA 5CZTA 3ZJ8A 4HB7A 1UG6A 1RQBA 3MUY1 4LX4A 3ZJ6A 3GHTA 2O92A 4GI4A 4R7WA 1SW7A 1S1PA 2OELA 3FJNA 3HQPA 1WBHA 4QEEA 4PGLA 3MP5A 1M6JA 3UXKA 5E6YA 3DU0A 1HKKA 4BF9A 3W38A 1HF6A 1L6SA 4TOQA 3N29A 4LUSA 1W2PA 3W85A 3WQFA 4OV9A 2FKPA 3FNDA 4PTWA 1MUCA 5FJRA 5HBFA 4G7FA 1RVKA 2E0PA 3ABZA 2DY3A 3VC6A 3XISA 1F7BA 4S3KA 2Z4GA 6REQA 2CU0A 3TSBA 4H7CA 1EP3A 2QV5A 3N4AA 3UZJA 4C6IA 4DQWA 3KVJA 4UQCA 3KRUA 2XH4A 4DO5A 3AS1A 1YDNA 5FEWA 4OECA 5FF0A 1V02E 2W62A 1VPQA 3RR4A 3GG0A 1P1XA 5G4HC 3AYRA 3OO2A 1YDVA 4A6GA 4AVNA 3L66A 1JCYA 4JIEA 1JAKA 1A49A 4ICMA 2NVDA 3BLFA 2Q3RA 3NQ6A 4OU1A 1W5MA 1ZFJA 2JIEA 5U7SA 5IXEA 3ITLA 2QJHA 3L21A 3VUPA 1RHCA 3QM3A 4ADTA 3C0SA 2ZDRA 4YJ5A 1VBRA 1G4TA 2XVNA 8RUCA 4LF2A 2TYSA 4C6EA 1RALA 2PTDA 3QHNA 1K3UA 4K6AA 3Q2DA 1MDLA 4DLFA 3UP8A 4Z2LA 4ZE4A 3UPMA 1YXYA 3VNYA 3WK3A 4UFMA 2B7PA 1UROA 2PUZA 3ANVA 3CO4A 1RZMA 1UZHA 2QJJA 3EX4A 1K7EA 4OKDA 5A6JA 3CL7A 1YPFA 5AY7A 2DPEA 3WLMA 3QV7A 2NT1A 3AIWA 3NZQA 3P82A 3PWIA 1AJ0A 3OTRA 1YBQA 2PLCA 4E2OA 2ISVA 4V33A 1SW3A 3T4WA 4AU0A 4FB7A 1PCWA 1K6AA 3C2VA 4KGJA 3RRXA 4UC5A 3K5XA 5E93A 3S8HA 3ABOA 3B40A 4IXHA 4S3EA 4C1KA 1HGYA 2VGIA 4A8IA 4AD3A 1JPMA 4JQ1A 2VOMA 1M7JA 2E67A 1UR4A 5AYIA 3O1NA 2PTXA 3HJZA 1BKSA 4JYDA 3S1GA 4I6KA 2CZ5A 3J7HA 3M4HA 1K4HA 3NXFA 1AQMA 4KWSA 3S5OA 3C2EA 2J8TA 4A3RA 2E1DA 1KGXA 4JFWA 1Z89A 5C55A 3N2BA 3H8AA 3LRKA 1EPXA 3DI0A 3R6IA 4AWTA 1RP8A 2G3NA 1BXNA 3CQKA 2G4JA 1ITXA 1NDVA 3BAWA 3VPLA 3SJNA 1TB3A 5EFFA 4L9YA 2CHOA 3H22A 1E6PA 3B9DA 3O6YX 1B1YA 3GVQA 1AH3A 3NOYA 1H1NA 3FXGA 1JYXA 1F8MA 2BY3A 3W2LA 3MMTA 4XAZA 3VCNA 4ERGA 1L0PA 4B5UA 2GJXA 1DV7A 4CNUA 5EMYA 3V18A 3A3HA 1GPWA 1KXTA 4XD3A 2VZVA 3ORWA 1K9FA 3U2EA 1GJUA 4NJIA 4YYFA 1Y5XA 2D0FA 4FI4A 3E0FA 3W7KA 3C5QA 2WNQA 5H8MA 3MHGA 1XH1A 3U0HA 2FMNA 1PWMA 4MY9A 3TN3A 5K9XA 5A1AA 4FNQA 1HO4A 5I77A 3QV6A 4AB4A 2NSOA 2ZZ5A 3IEBA 2JE8A 2J9ZA 4H83A 1C92A 2FDMA 4QNEA 4Y96A 1PKLA 2D20A 3ZR6A 3C2OA 1TV3A 2PC8A 4M82A 1Q4NX 3JR2A 3NM1A 3QR1A 3NM3A 4X63A 3K46A 4GA8A 4X2PA 2VD9A 2VEMA 1KW1A 2X7WA 2ACQA 1LWHA 3WDPP 4U28A 1ISZA 2ZUTA 2CFFA 1Q6QA 2NUYA 1TPEA 3USZA 4KWOA 1XJBA 3LB0A 2VVNA 3IANA 4C6MA 2R94A 5LA0A 3WX7A 1J2BA 3OLDA 4R27A 1OD8A 4RZ5A 2QCLA 4JTQA 4PUJA 3TXVA 4JFTA 3ITYA 4ZB5A 2FZNA 4MJZA 3GDLA 1VFFA 2PODA 3IJIA 4L9XA 1DIKA 3B9AA 2O4MA 2CLFA 3PZOA 4WY0F 4QNWA 2PP3A 3WUBA 4TX8A 1R3WA 3DFOA 9XIAA 4DPQA 3G8EA 3VE9A 1CGUA 5B7YA 1JZ8A 1LQAA 3VFLA 4AF0A 1W6TA 2Y7EA 1XINA 4Z1AA 3E2RA 4Q7BA 1GJWA 1E43A 3QR0A 4I7WA 3PTKA 3NPVA 1JRBA 3PJTA 2G5WA 3TYUA 2PDBA 3LV6A 1ZU8A 4PTNA 1XBXA 5DY2A 3FA4A 3OODA 4I90A 3EAUA 1J18A 1XG4A 1KKOA 1LOQA 3TVAA 3WBAA 3A21A 2VGFA 3AXMA 3LLFA 5J8LA 2VFEA 2MNRA 1BVWA 3CNYA 4ORIA 3T7VA 3BLIA 2QCMA 4P8VA 5E0CA 3W7IA 2NQ5A 5JVLA 2BSLA 5CGTA 3C2FA 1IIGA 4WGXA 3O0FA 4XTIA 1XD1A 1K4GA 3HPZA 3FSTA 4NI3A 1PYFA 1W31A 4JTKA 3QW4B 4DNHA 2WMGA 3W2MA 4MADA 5A6KA 4CD6A 1NWRA 1X8CA 2J9YA 3DHDA 4WX2A 2PDXA 4H6QA 3OZYA 4LB3A 4H6RA 1IEIA 3RMEA 5HQEA 4LC6A 4UTTC 1SFSA 5EPDA 5IFTA 1ZY9A 5DN1A 4D6FA 4M80A 2QCNA 2F38A 3M46A 1XIHA 1K7XA 3SGGA 2YW3A 2VFGA 2BY2A 3S47A 1E6SM 1M03A 2WMIB 4O11A 3M0LA 4A4AA 2E4TA 2EPKX 2YW4A 1ZAIA 1UP3A 4L61A 2D69A 1C3FA 2ZUWA 2Z1KA 2PZNA 2CW6A 3C2RA 3GX9A 3W23A 4K1GA 2ZVIA 3UJSA 1I2NA 4DUWA 1EJTC 3ZVIA 3CIWA 3GTIA 4PFMA 5CSRA 4M19A 2GQ8A 5I09A 3POHA 1XYMA 2J75A 2VOTA 5IDZA 3MSRA 2VKZG 4MYXA 4CVWA 2VFDA 2NX3A 3BCFA 1W1IE 4ACZA 5G2HA 1ISWA 4IICA 2WZTA 1E6RA 4WSJA 1W3IA 1WXZA 1VFSA 5AHNA 2X1UA 2FPVA 4Y9MA 5A6BA 3N34A 1LQ2A 4K39A 3OLIA 3KRBA 4ZQOA 4US5A 4LH8A 4WDUA 4QSHA 3UZZA 2JIWA 3LHWA 1GTEA 2J6XA 1CYGA 3TTYA 3S5YA 4KCVA 3OVGA 3FK4A 1KKRA 3WF4A 4MNJA 1F4AA 1OVDA 4H41A 4Z17A 3MCNA 5HNNA 1TUXA 4XAYA 1ODUA 1V6XA 3ARZA 1IEVA 3N14A 3N2TA 2OQLA 3E38A 4DBWA 3VIOA 3GYCA 1DOSA 3WK1A 3EOUA 4MZ8A 2ZX9A 4AQLA 3GNNA 1SFTA 1H5YA 3UW6A 1UD2A 4O1FA 4GGHA 2FH8A 4S2BA 4JIIX 2O56A 4W89A 1RCQA 1ZAHA 4V15A 4HA0A 1Q4WA 3EDJA 4JY8A 1LOSA 3B0VC 3IAQA 4AIUA 1MZRA 4EOUA 2GUBA 1UCWA 3FSUA 4FIRA 5CGMA 4YXGA 1XD0A 4JTEA 1RA5A 2YLAA 2WXDM 1I60A 5FA5A 1PIGA 3KCOA 4MDOA 3WQWA 1TREA 1S5NA 1IT8A 2JKEA 1ADDA 2GJRA 3TSDA 1NP0A 2Y61A 3GG1A 4Q8VA 3UVIA 2WCGA 3CIVA 2V30A 3L0GA 4J2PA 1H7OA 4DVOA 4JTCA 4DYJA 1F9CA 3BMWA 3VDCA 3A4WA 1A5BA 4MWAB 5B7ZA 1OCJA 4EF9A 3VDHA 3JVAA 4LCQA 3ANUA 4TX9A 3Q4DA 2QQ6A 4IUGA 2VVSA 3B8UA 7PTDA 3FIGA 1Q6GA 2J7EA 3TAOA 5DRIA 1HVXA 4LBUA 3NQ7A 1GG0A 1XP3A 2FVMA 2J66A 1UD5A 2E8ZA 4IMFA 4A29A 1TJ1A 3E1F1 2OGJA 3WK2A 4Q7IA 4PUNA 4ZCWA 1KM2A 1XLMA 4G6CA 3MANA 3T9PA 3VNJA 2DW7A 4GYFA 4C7GA 4PUMA 3TR2A 1R9XA 4H8HA 1TCDA 3UCDA 3M5XA 2F8QA 5F2MA 3CWNA 3WLRA 1GQNA 1OIFA 3CMFA 4GIRA 1E3XA 4E3TA 1TA3A 1FBAA 3NQDA 5HA7A 2EPMX 5K7JA 5EMKA 2H9AB 5MF5A 4Q8WA 2PDHA 2CKRA 2ZUNA 4N9BA 1H2JA 2Y70A 4FLSA 4QXIA 1DBTA 5FL0A 3O63A 1LLWA 3B0XA 3NQFA 4XKMA 3VGGA 4EVZA 3SQLA 5C0QA 3QPEA 5A8NA 1AFSA 4LUIA 4A05A 3TAKA 3H4WA 4BHYA 1BSIA 3OVPA 3SCWA 5GNXA 3TEVA 1GVRA 1R0MA 3OB8A 2DSKA 3R11A 3TTEA 3TN5A 3K8MA 2YFNA 2PGWA 1XGDA 1J01A 2O9OA 2E5DA 3TH6A 2EQDA 5BWFA 4W87A 1TVPA 2IPGA 1K1DA 1V51A 4E4PA 2CLMA 2D3LA 3W1QA 3AS3A 1H60A 1NU5A 1N55A 4DJFC 3GIPA 4DWSA 2L5HA 1U33A 4LAOA 1R86A 3W24A 5CJ5A 3SCVA 3FGCA 2FZMA 2XG9A 5F1VA 5HWMA 1V0LA 4GINA 1SR0A 1E5NA 5DMNA 2JKPA 3NQ2A 3PBMA 1Y8BA 4O0KA 4FX8A 1O5XA 3L23A 5J04A 1DWIM 4HCDA 1TUFA 4HN4A 2PA6A 4B4FA 4K2SA 1P7TA 5JBEA 1W3LA 2IW0A 2YYTA 3V0TA 1ZRQA 4J3VA 2WANA 2VYOA 2HXTA 4K7YA 3QTGA 1JZ4A 1UR1A 5TQLA 3LCGA 4TQTA 3IJDA 3ZOAA 3VMNA 3CTTA 2OO0A 3G6MA 2YXXA 4LBRA 1IF2A 2ZCGA 1PTGA 1BKHA 3PUOA 3HG4A 3H55A 2CZDA 4LVDA 3HFTA 1GVSA 2I56A 3BMVA 3D47A 3UXIA 4CU7A 3HG5A 5HUPA 4MLRA 1O4UA 2V5LA 2BB0A 1BLIA 2WJZA 4NRSA 3WNPA 4U10A 1A3XA 4MHBA 4UQEA 5JUVA 4MYAA 2WWCA 3EMQA 4S3GA 3TN6A 3GNXA 3HIJA 3MI3A 3QZEA 4RL3A 2CKSA 2ISSA 1A3WA 3KE0A 1FWEC 3O6CA 1BRLA 4N4PA 1WUEA 4NAFA 4DJFD 4LV9A 4UBPC 1HL2A 2YBUA 4AY8A 4KESA 1WOAA 3AIEA 4JQ4A 3RAOA 2Z6IA 2C1IA 3MMDA 4Q32A 1Q8AA 2YCLB 4CQBA 3IGHX 3WNMA 2VC6A 5AYXA 1QRQA 1QPOA 2QPSA 1E4NA 5I07A 2BHZA 1V7AA 3TX9A 1Q6LA 3PM6A 5JIWA 4L7ZA 1F3TA 4MPQA 4X0NA 2J7CA 3MKVA 3ABSA 4XZ9A 3SY1A 5D9NA 1JUEA 1RCOB 1SZEA 1XM3A 2GDUA 3LQGA 3W7MA 2E25A 3GNOA 3VGDA 5F2IA 1NJJA 5ENLA 1MNZA 3T2QA 3WFZA 1J9YA 5FJJA 2GQAA 4H19A 3CO8A 4C7FA 3O6AA 2RH9A 3M41A 4S3DA 3IAPA 5JMUA 1FHLA 1KFLA 3VK5A 3A12A 4BCEA 3AMKA 5KEZA 3P60A 3RDKA 4LWWA 4ECLA 3P61A 2ZQ0A 5JIPA 1WE5A 2Z7KA 4QR6A 2HV5A 4S1FA 5CQ1A 3ARSA 7ENLA 5LXEA 2PBGA 4EACA 2YA2A 3JZEA 3CT2A 1HJUA 3CHEA 4YN5A 3DG3A 3BCDA 5AOUA 1OFBA 4INFA 3L2LA 2CESA 4LPCA 1C9DA 1A47A 4XBKA 4MY8A 3UGRA 1S2UA 3PVFA 1UQYA 3WQ6A 2Z7GA 3AIRA 4F0RA 1MQQA 4DXVA 3UXDA 1R2SA 4I9AA 3OIXA 3RO6A 1DYSA 1CNVA 3AYTA 4GYJA 4PUDA 4QS6A 1QHPA 3K13A 4JTRA 3WD4A 3NR0A 5HMSA 1US0A 4PMJA 1O95A 1FHUA 4IIEA 3VNIA 1SU5A 3KXQA 3V3WA 1GONA 5CH9A 3GIYA 4Q8NA 4GFIA 3WQ8A 3M6YA 1R46A 4AEEA 1M04A 3GFZA 4WD0A 5FACA 1ME8A 3DX5A 3FJ4A 4PR4A 4MZ1A 3H53A 5C5YA 2ALDA 1FDYA 2PMQA 1B90A 1SSDA 2ZYFA 3OGVA 1V3HA 3PR2A 4HU8A 4JTIA 3ITCA 1GJPA 2DSUA 4Y9AA 1TPB1 1SMAA 1B3ZA 4CEXC 1RSCA 1DEDA 4PBFA 1GVYA 1B4KA 3L4UA 4I9TA 3KHJA 4DIAA 3F2DA 3IJ8A 3CV6A 4NJKA 1KM5A 3B06A 4IIFA 3E3HA 5EYWA 3V36A 1OINA 1E4MM 4JXCA 3IK2A 1LRTA 1SYTA 5E9XA 1PDYA 1VFMA 2Z2BA 4V1XA 1IXPA 4WJEA 2CWXA 5I3DA 3JUGA 3KP0A 4OBSA 5AB3A 3R8HA 3MZNA 1R3VA 3WFAA 3NOEA 1VIZA 2V2DA 3DBPA 3AS2A 3WDQA 4QFUA 4NYYA 4KFNA 1OFPA 3LHZA 3RIKA 4KIRA 1AD4A 3ARYA 2QEZA 2QDHA 3UR8A 3LX9A 3LCLA 2POTA 2E40A 2P0IA 3F4VA 4MWAE 3AIUA 1EGMA 1DKWA 1JD7A 3HN3A 3OYXA 3ARUA 5IRPA 3MVTA 3UR7A 1GOWA 1T41A 4WOQA 1XW8A 2F7FA 1TPH1 1TRIA 5CSUA 1UKTA 4CCZA 1O6IA 3OVRA 3SRKA 3LTSA 1YEYA 1EA9C 1GWJA 3QF0A 4MAZA 4TO8A 3IS4A 1ME9A 3VE7A 4O57A 3TUUA 2FJKA 3NDZA 1EJSC 3DDMA 4NSBA 1ZSXA 3P0XA 1H61A 3B03A 3NEHA 5DT5A 3TZNA 3V1PA 2B7QA 1F3XA 3GWQA 4BA0A 3NFUA 4UZUA 4XB3A 1AZ2A 2PLMA 4Z0JA 2QCCA 5CGQA 2ESCA 2OYMA 4GC4A 3W7LA 4YPJA 2GDQA 4E2VA 3T55A 3BUVA 1NWUA 4ADUA 3KTXA 2VNCA 1E3ZA 2CHRA 4HJFA 1Z6KA 3TYEA 3W07A 3BGJA 3NQMA 3CLWA 2ZXDA 1DIOA 1POJA 2REQB 1VLWA 4ZB0A 3CZ8A 2OKTA 3AWOA 3BGAA 4JYFA 4KGLA 4EPKA 3G0UA 3G77A 4XZHA 3VGEA 3VOJA 4Q3MA 1MFUA 4HPGA 3STFA 4DJDA 4QG9A 3FAXA 2QMKA 3BOLA 3S9YA 1DQXA 5FEZA 3QKEA 4DNMA 1RH9A 4ZVJA 3W2KA 4DAIA 3MSDA 3SQSA 2FHFA 1OEPA 2X7VA 2D3NA 1V6TA 3TKFA 1LF1A 4AY7A 2A6NA 4WIWA 3LV5A 1X97A 3PPHA 3KM8A 1FH9A 3SM0A 2FGBA 5LNUA 3F2BA 1ADSA 1GEQA 4LW7A 1C29A 3MKCA 4EAYA 3I6RA 1H11A 2INZA 2NVCA 3BWWA 2EEXA 4AYSA 5G5IA 2YB4A 1H63A 4PEKA 3ZM8A 4D8AA 2BTMA 1OC7A 3H2AA 3P5YA 4M51A 1U5JA 2EHHA 4PSPA 4B91A 1T8QA 3ZQ9A 3ZXWA 1W1A1 1K70A 4QRNA 3QV9A 1VQTA 1GYLA 4C5YA 2HVNA 5I03A 1BYAA 4UZSA 3L0KA 3PUGA 1KXQA 4HGXA 1Q6RA 4I5UA 4NT0A 4QBXA 3L7RA 1KCKA 3T08A 1HQTA 3OPSA 4XTDA 5CZKA 1ZUAX 3W7QA 1YTDA 3L5LA 2X8RA 2ACRA 3WLJA 4TU1A 2FZ9A 2OTDA 4Q4MA 1EEPA 4IGNA 3OG2A 2C1HA 4TXEA 3CMGA 5C7HA 1EFZA 3T0TA 5G4WA 4DZIA 4D6IA 1ECEA 1EX5A 2Y5SA 5C6MA 4PCSA 2DT2A 4KBXA 4BEUA 2PI6A 3CV2A 1L8NA 4FZIA 5DRCA 3BMXA 3F5KA 4GOAA 3CM4A 3EDFA 3CAQA 3SGUA 2AL2A 1GT8A 2QVHA 2V3EA 1FWWA 3WQDA 3N2XA 3WLPA 3DZ1A 3GDKA 4HK6A 1REQB 1W54A 5F4XA 2W67A 3P6LA 5CPQA 1OQFA 2PU1A 3LS9A 1DJGA 4S3CA 3VM7A 1JGIA 1HKJA 3R2GA 3ZSTA 4L56A 4E2DA 5CPMA 2F84A 2CLOA 1J0HA 2C91A 2VR5A 3WQCA 3UG3A 3SN0A 4LOCA 2VZUA 1E70M 1SQ7A 4K8EA 4D8LA 3WH9A 2ZUMA 3W1TA 2QCDA 4LUTA 3VU2A 3EWUA 3OP2A 1TVLA 2Q8LA 4FNUA 4O18A 5I78A 1W17A 5EBAA 5LIKX 1F61A 4GZIA 5T26A 1XIIA 1XYCA 4ZO8A 3GUWA 2POZA 1HKWA 2GVEA 3W3OA 5HULA 5ABFA 1XC4A 4EP8C 3B0UX 4MMWA 4OTKA 3U4AA 4NX5A 3WLSA 4GQRA 4C91A 3LBCA 3KS6A 1C93A 2BHYA 2BBFA 2PDUA 2BFGA 2R1PA 2WNZA 1AH4A 4H9ZA 1H7NA 1P43A 1NDZA 4UQDA 3B8SA 4RE2A 1ADOA 2C6QA 3QC0A 1FQ0A 1SR9A 1VCFA 2QCHA 1CGXA 3KBJA 4FLRA 3H21A 2WMHA 1EDGA 1DWHM 3QJAA 5AC8A 4NZ4A 3RCMA 1XLFA 2VFHA 4WLCA 2PDKA 2IKHA 2X0YA 4P8XA 3R89A 5BWAA 1IHIA 1QDSA 1V6UA 4GABA 2I9EA 2ZZ4A 4O16A 2E6AA 2J79A 3G5EA 1GW9A 1V0KA 3AYVA 1TTQA 3NL3A 3MUAA 4QM1A 5DBUA 1QOXA 1UHVA 3ZLGA 3ENLA 3WJXA 1LRQA 4PTXA 6PTDA 3AICA 3S6OA 5TIMA 1R3YA 4RE0A 2ZZ3A 2C7FA 2WYSA 4WK9A 2VR4A 3SFWA 5I3KA 1GVEA 4FK9A 3AJXA 1O94A 3S6DA 1PX8A 3CUGA 2G3IA 3YPIA 1K03A 2XN0A 3SSZA 5ECUA 3U2CA 2X2GA 3UFYA 4L64A 3AOFA 3BAJA 3O6DA 1HKMA 4GI9A 2OVLA 2TRSA 4JL1A 3GVWA 1O5QA 3ZIZA 4RDYA 4QE4A 3WUFA 2BP1A 1DTUA 1QPRA 3W1PA 1A53A 3LDVA 3GVVA 4J3TA 2X0SA 4FIQA 2VUYA 4CNNA 4FX6M 1GCYA 2HPIA 1Q3NA 3A13A 2OX4A 4UR9A 3W7DA 5LXXA 1TR9A 2W66A 4N9DA 3UZ5A 5HPOA 4EAMA 1L6GA 1TQJA 1UOZA 4IPLA 4IGSA 4HK7A 4GPNA 4LS0A 1Z8AA 4DUOA 1R2TA 5A8GA 3IVTA 2VEKA 3SUWA 4ASTA 1QOQA 1GHRA 3QOMA 3DBNA 4DF2A 3GZ3A 2HXUA 3W53A 2WHKA 3VZZA 3PSVA 4PN2A 1C7TA 3DGBA 3AU6A 5K2ZA 2UV8G 1IZKA 2FPYA 4BFAA 2PC4A 5AHFA 4O53A 1UH4A 1GVFA 1QT1A 1WKYA 2QDGA 3OHIA 2DSWA 4JHOA 5BXPA 1TG7A 2B7NA 4C6FA 1Q65A 4KEUA 2QKFA 1I75A 3BV4A 1G67A 1VBGA 1F3WA 3CB8A 3SSJA 1Z32X 3P5ZA 3V4BA 3QEZA 1C7SA 3KHDA 4ILSA 4XBJA 3JS3A 1R3RA 2FTWA 1FCUA 4H9VA 3Q65A 4XZLX 3EA1A 1UD4A 3MT1A 1UR8A 1NOWA 3L4WA 1M01A 4P5UA 2ZWZA 3CV7A 3W1RA 2B0MA 4FP1A 2OWWA 1ML1A 4BZYA 1T99A 4NL1A 4TIMA 1EX1A 4ZFCA 2ZX8A 1KQYA 2DZVA 4LAMA 1GVOA 1B3WA 2E9MA 4NU7A 1HL9A 3O16A 3PY2A 4IPJA 4LRSA 3GW0A 3LBMA 3UEQA 1GQJA 4AWUA 5F2LA 4NZCA 4JY9A 3VO0A 4I7UA 3NIYA 1CXKA 4AHOA 1UQZA 3GUGA 3UWQA 4DUXA 2LLEA 1XGZA 1VYSX 2V9DA 2EBNA 3FYPA 2ZZ6A 3EX3A 3RCYA 2C18A 1H62A 1BYDA 4PYSA 3QTPA 2FHBA 1BSLA 4WDWA 4M6QA 2PCQA 5DY3A 2YCKX 1XXXA 2YOCA 1RAKA 3UF9A 3KWXA 1Q2RA 4ZTXA 2XIJA 1EC8A 3OQ8A 3SAZA 4GXMA 2JFEX 3PFMA 2A1YA 1PL9A 3EDDA 3ARVA 4B3ZA 2QW5A 3VD9A 4ACYA 1E9IA 3SN4A 1XPYA 2G96A 2V0TA 4EWND 4F0MA 3MV01 4ZODA 3QH2A 1ZALA 5HWNA 3UWUA 1XI3A 3NZRA 3LNMA 4DI8A 4IP7A 3WQOA 3M0XA 1F3EA 4ZOCA 4XIAA 2Y89A 1IWAA 4PCTA 1N8IA 3UCCA 4UMCA 3IGXA 1V79A 4QAWA 4N4QA 3AIQA 2WM1A 1EUNA 1W91A 3LPPA 5K3VA 4GXPA 1XSKA 3UG4A 4TV5A 3CLMA 4KRTA 4HOZA 4GMEA 4OBTA 4LQ1A 1I2RA 5D03A 3HGJA 1TZ7A 4HPHA 3TMLA 4GBUA 1S3TC 1RY8A 2BVWA 2Y1HA 5D30A 1H7XA 1V5XA 4PL1A 1XLGA 1JGMA 3MP3A 4TVDA 4BI5A 1BXCA 1KTCA 3GS6A 2A3AA 4IPIA 4IL0A 1Z7AA 2QUTA 2CXGA 4Y6GA 4GYPA 1EH9A 5L6UA 5LIXX 3M0YA 1H41A 1KC7A 1A5LC 4E8CA 2NT0A 1PCKA 1EYWA 3WELA 3FOKA 4N0RA 4AXNA 4G8TA 8XIAA 1T8XA 1Q8JA 4AMCA 3SADA 3NVTA 1WZKA 4R9XA 1KCLA 3M07A 3B9OA 2YA0A 3WDJA 4TTUA 1AQFA 3W70A 4NJHA 3JU2A 5FJIA 1PWLA 4QIUA 5A8PA 1HP4A 2GOUA 3CPUA 2QUUA 2GWNA 3TSMA 3ELFA 4I9MA 1MYRA 4L6DA 5LHFA 3BJSA 3MUIA 3S83A 1LUCB 1H0IA 4GZEA 4O50A 5CC3A 4AZ6A 5I2UA 1UOKA 3WYZA 1VHNA 1A80A 1IE7C 2QYGA 2QF8A 1OG0A 4CKQA 3W74A 3NURA 2OODA 2NQHA 4GI6A 1ISXA 1VHCA 1QNPA 2Y85A 1UKPA 3MDWA 3BLEA 4EXQA 3W72A 5KTLA 2WVTA 3U48A 2P10A 2VFIA 1SMDA 1YIXA 4FOKA 4REQB 3W2UA 3NSMA 3KOFA 2PDGA 1W1PA 1S2AA 5DBTA 2Z00A 2Q02A 2VURA 3K4AA 5I3FA 2OSYA 4PE8A 3FKKA 3CASA 5I3JA 4NAEA 1P6WA 4P7QA 3K2GA 1I2PA 5CSSA 4JQ2A 1LBMA 2V6AA 4JTSA 1W5NA 4PTVA 1Z48A 3WENA 2CHNA 2H8XA 4US5D 5FF2A 1AW1A 4LRTA 4D6HA 3QGVA 3ARPA 3M0MA 3TJXA 4C6NA 5GVJA 3DENA 4AX6A 1R3SA 1LT7A 1OC6A 3TN4A 2VZTA 3AHTA 2Q01A 3QY7A 4W5UA 4XQ6A 4HNTA 2WKLA 2GDVA 2NLYA 2BASA 2G95A 2PDMA 4LUYA 1OIMA 3T1GA 3V35A 3ARWA 2YA1A 5D2VA 4O1CA 2J13A 3W81A 1MSSA 3FKRA 3DEQA 2QVNA 4F2UA 1K8XA 4NZ5A 4NZJA 1M9HA 4O1DA 4PTMA 2W6RA 5FF4A 2VD8A 3LPOA 1OADA 4HCLA 5FJTA 2C0AA 3ERPA 2GUUA 1OY0A 5BZAA 4D1JA 4PB5A 5I6SA 1TVNA 4JQAA 2JALA 4WKFA 1I9CB 1CT5A 1S1RA 3WNNA 1E56A 2DJXA 3ONBA 3AUOA 7REQB 4DO4A 3IGUA 1PB0A 4UXDA 1K02A 3L5AA 4O8RA 3GKAA 3TC7A 2R1LA 3KEHA 3IARA 3GO2A 3VMPA 3GW3A 4KCTA 5CPLA 4PA8A 1PXGA 3HPAA 2YXOA 3IRSA 4MGGA 5TD4A 2VDHA 3L2IA 3S2JA 5D9MA 3TONA 1VJIA 3TXZA 4O52A 3KOYA 4GC3A 4WY0A 5CC6A 4ZQCA 1BG4A 2OR2A 2Q09A 1SJBA 2AOSA 2WVUA 1LWIA 2ZUVA 1J93A 4W8BA 3NZGA 1LG2A 1QTWA 1MW3A 2Q8XA 4U3AA 1Q2SA 4WJ8A 3UNDA 4GCXA 1KR0A 3W1AA 4DAFA 2OLAA 3EX6A 3UR5A 3UJEA 3NO1A 3I3BA 3AXIA 5HDRA 3UG8A 4AC1X 1PYMA 3BJFA 1A0EA 4UR8A 2PWEA 5TNVA 4EKJA 2NX1A 1JI2A 2H6RA 1QNOA 3V75A 1W1VA 3WD1A 4M6VA 3R8GA 1FH7A 3LOTA 2YGYA 3GG7A 2BV9A 4HZ8A 4J5NA 3BC9A 2O7SA 3TLQA 3W7HA 3A3XA 2ZX6A 4BKNA 1M68A 3W2JA 3VAVA 5F7UA 2I5GA 3RJXA 1VRXA 1NDWA 1OX4A 4ML9A 2WSYA 1QVBA 1YPXA 3UVAA 4JTGA 3R25A 2JBMA 3FLUA 5H91A 1E40A 3TCSA 4QEHA 4U31A 3ARRA 2DZUA 3GU1A 3F5LA 2W3ZA 1XGEA 1DQWA 2WPBA 4BQ3A 1B3YA 5DO8A 3EEZA 2VCAA 7ODCA 7CGTA 1VIWA 5HR7A 1PKNA 2HE5A 5MHBA 3EEGA 4AZCB 2B7OA 4PBGA 1Z42A 1XDLA 2CERA 1PV8A 1UD6A 4MKVA 1U1HA 4F2TA 4JR5A 5DLCA 1M1BA 2PGRA 1TYGA 4NNCA 3TFXA 3U5UA 1MEWA 1P0NA 5I7GA 1IT7A 2AMXA 4YWIA 5G4EA 1JZ5A 2PRLA 1LOLA 2XWEA 1ENUA 2VQTA 3R1ZA 4FNSA 5M2FX 4HNCA 3T40A 1KV5A 4R88A 2CBIA 4ALDA 4UQAA 2FVKA 1JPDX 4O4WA 5DT7A 1EJWC 1JZ7A 5LHEA 5IBXC 1CXEA 1A4LA 2FZ8A 2OX1A 1B31A 3PBGA 3NPXA 5FCZA 2Z26A 2GK1A 1R85A 1G1YA 2ZRXA 4CCDA 5LIYX 1EP2A 2Y63A 1J12A 2DUZA 1D3CA 3M5YA 4NASA 4NZ1A 3LTYA 2J62A 4UMBA 2Y8VA 3CUHA 4URIA 4UCGA 4EPEC