3I7SA

Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIREATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How essential is the 'essential' active-site lysine in dihydrodipicolinate synthase?
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
total genus 107
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3i7sA00
3S8HA 1RQBA 2CLFA 1W37A 4MY8A 4LV4A 2C14A 4MZYA 1FWNA 1I2PA 1KBIA 1O95A 3UYCA 1J2WA 3CLMA 2V81A 4Z1AA 3B05A 3K30A 2Y62A 4JTHA 2V2DA 3O05A 4NU7A 5FF3A 1TPEA 4KFPA 5EYWA 2VFIA 4MZ1A 5AC6A 3NQ8A 4PODA 5D2VA 2QCHA 4BF9A 3DBPA 1EUNA 5EY5A 3Q94A 5EBUA 3B0UX 3BGGA 4RXFA 3LRLA 1EWDA 1LRQA 2Y7GA 1GVFA 2TSYA 5FEXA 1WOBA 3QM3A 3W2NA 3E0IA 3NM1A 5D04C 2CLHA 1WXJA 1KFEA 3W23A 2ZBTA 4FF7A 1NF0A 2NUYA 2QCEA 3SY5A 4ONVA 3PF3A 3H53A 1H50A 2VFHA 2B4GA 2NX9A 3LHZA 1H1ZA 4LVDA 1RV8A 3TE9A 4RJEA 3S1UA 1H7XA 1YXDA 4DO5A 1H62A 5CPLA 1YPIA 3PB2A 1QO5A 2BXVA 3U2OA 3DGRA 1TPFA 3W84A 1SSDA 3EWUA 3QPYA 3LBMA 3QQ1A 1RD5A 4HSNA 4OU1A 1T96A 4K7YA 5ABTA 2C15A 2P1FA 5G4WA 2ABBA 3NR0A 3W2KA 4BFAA 1W3NA 1LROA 3I68A 5HULA 3DFTA 3ZFHA 6TIMA 2VFEA 4G1KA 3NZ1A 4QIUA 2YXGA 1SFJA 3MHGA 2QJHA 2YCEA 3E12A 1KLYA 2OX1A 3EXSA 4R7JA 3DFNA 2GJNA 3S5OA 3LXBA 3CWOX 1XM3A 1FCVA 4XKYB 3KHJA 4JTEA 5DCDA 1JULA 1R2SA 2NV1A 4MOZA 1IF2A 4LVAA 1KFCA 3LHVA 3G3MA 3DKLA 3BLEA 2ZDRA 2YYUA 3ABRA 1TTJA 1L6YA 5D2YA 3W1TA 4GUFA 1H7NA 2VFGA 1SW0A 5CZ0A 1GTHA 3G0UA 1HO1A 1OYBA 1R30A 3GDLA 4POCA 1SO6A 3MI2A 5K2ZA 1FWSA 3TK7A 1KM5A 2O7QA 4DPQA 3W7MA 4JTFA 2Y63A 4Y6GA 1JCLA 4NJKA 3BLFA 2A1YA 4O18A 1N7KA 1B4KA 4Z1DA 3QW3A 1XC4A 1LBFA 1LP6A 3CB8A 2ISVA 5D2WA 3I65A 4MFEA 1HL2A 3W6YA 2XFWA 2Y6ZA 5EKYA 1G4SA 1IXQA 1VYPX 1JRCA 4UMCA 4DF2A 2NZLA 4RR4A 2GVLA 2CWNA 1L9WA 3BG9A 1XCFA 2QEZA 3KVLA 3KXQA 1F5ZA 3JS3A 3R13A 2TRSA 3TQKA 3KAOA 5LKYA 5AHFA 3MUXA 1VCGA 1I2QA 1RQHA 2X1SA 4O52A 1FWWA 2C3ZA 4DEFA 2V82A 2E09A 2PE4A 1VC4A 4PC8A 3S6DA 1LCOA 4TMBA 4NX5A 2NWSA 2VEKA 3KVMA 4NNBA 3MWAA 4O1AA 1K7EA 4AHQA 3TXVA 4RXGA 3C3NA 1TO3A 1K3UA 1TSIA 1KLZA 5I3FA 1FDJA 1DVJA 4AF0A 3GDTA 3T4CA 1OFPA 2YPIA 1D9EA 2NUXA 3W2UA 1ZCOA 4IPIA 5KINA 1GEQA 2EGZA 4FX6M 4L4LA 2QCNA 4UTTC 3QZEA 4TX9A 4YMZA 1ZAHA 1OX5A 3R2GA 4LTSA 4NXSA 1LRNA 4U4MA 1P0KA 2VFDA 3NQGA 4UXDA 4RZ4A 2ZRUA 4KWVA 1FX6A 1T8XA 4A2SA 4K8EA 3W1LA 3OVRA 4P61A 1JUEA 3MW7A 3EWYA 5HINA 3BG3A 3NQDA 2ZCGA 1GTEA 3YPIA 3INPA 4ZZ9A 2VOMA 4ORMA 3W1AA 5FEZA 4RK8A 1WQ5A 5TQLA 4AH7A 2B0MA 1CX9A 3L0KA 4BK9A 1SZFA 4UTKA 2QCDA 3PSVA 1UUMA 3QC3A 2BWGA 1MEWA 3JR2A 4UFLA 4H4IA 5FF0A 4RCXA 5AN7A 3BV4A 3G1DA 5BMXA 1EX5A 2Q3RA 1YDNA 1NSJA 3W7JA 3NPUA 3NPXA 1OHLA 5IM51 4QM1A 5LNRA 5C6MA 2NV2A 3GLCA 3CIWA 3EWBX 1VZWA 2NXIA 2UV8G 3M1ZA 1VGAA 4JYEA 4K38A 3IEBA 3OEXA 4HPXA 3NQVA 3HPXA 1M7PA 3CU2A 4J9JA 3W85A 2WNNA 3I7SA 3S0CA 3LBCA 4AXKA 3W7QA 1KM1A 4ZL1A 3P61A 2ISSA 2E6DA 1H7OA 3RF9A 4DF1A 1QWGA 3GDRA 3TCEA 5G1YA 1DORA 1OFEA 4FB7A 1QO2A 1FWRA 3M5ZA 4WUIA 1ZNNA 1YTEA 3G1AA 5E0KA 3VE9A 5J5RA 1XDMA 4GC4A 3P8JA 3EX4A 3NXFA 3TSDA 5I3IA 1KBJA 1QFEA 5HMSA 4OT7A 4UTTA 2C0AA 3W86A 4NZFA 3PY2A 4CQAA 2A21A 4Q4KA 3C52A 4HKPA 4YWIA 3TQ0A 3T40A 3VI2A 3QRHA 1EP1A 3W74A 3UWWA 4LS0A 2C1HA 2WJZA 1L6SA 3A22A 2HMCA 3L66A 1TPH1 5HWMA 2Z2UA 4BI6A 5E1QA 4CNOA 5C5YA 3GDKA 2CW6A 3PG8A 1RR2A 1TTIA 3P7YA 5F2MA 4NVTA 5LNSA 2CZEA 3EKZA 1L2UA 1QNVA 3TW7A 4UFKA 1P5BA 3A5FA 1WOAA 1YYAA 3QQ0A 4UMBA 4FIQA 3RNDA 5D03A 1IGSA 3BO9A 4MUZA 2BZNA 2JBMA 4E2DA 3STEA 4MPQA 5L6UA 1X8FA 5CPOA 3MBFA 4UFHA 4WY0B 2ZZ2A 5EL1A 4N9DA 1A5CA 1K8XA 1I8JA 2FPYA 2G5WA 4O13A 1PIIA 2ZRZA 1QAPA 1UUOA 1TQXA 3NL3A 1AW1A 1KTNA 4Z0SA 3B8DA 3B04A 3HJZA 3LCGA 3C2EA 4IWWA 2J24A 5HUOA 3E9AA 4CCDA 1LBLA 5MHBA 2PRHA 2R94A 4UC5A 4NNAA 4UTMA 4LT9A 2C6QA 2QUTA 4XZ9A 2DZTA 1NVMA 3NQEA 2DU2A 3PS7A 3UNDA 3HGRA 1IIHA 3N9RA 3O06A 4C1LA 3SECA 3TSBA 4O1BA 5H91A 1F76A 1OX4B 4UCGA 3QMSA 2H8ZA 3D0CA 4LU0A 1TJRA 4QNEA 2E5CA 3PVFA 4I7UA 2H6RA 2VC6A 1X1OA 3NPWA 1DQXA 4I7VA 3PULA 4XTDA 3LTSA 4LS2A 3T55A 5FEWA 1X6UA 3N19B 3W2LA 2GVGA 3GK0A 4Y90A 1T0OA 3STGA 3TAOA 5F2GA 1KFJA 5D2TA 3UXAA 5AFDA 4DPPA 1N55A 1F05A 4MYAA 5CSRA 5HJLA 5CPMA 1OFAA 4EF8A 2FPTA 3SW6A 1GVSA 1W5QA 1XBVA 2WNZA 2YR1A 5TBOA 2FJKA 5U7SA 5C55A 3BGJA 1YDOA 5HR6A 1JQVA 1ZY9A 3LHYA 4PFMA 4WOZA 3WK0A 5KITA 1JJKA 3UWVA 4GBUA 2JKPA 3A9IA 3R8RA 1MEHA 3LXAA 1BWKA 2BX7A 2Z6IA 2ZYFA 2RFGA 3G1YA 2CZDA 4WD0A 2P10A 1V7YA 1WDWA 2WSYA 5HR7A 3S5ZA 1K8YA 3O6DA 2Y88A 5F2IA 5BMWA 2G97A 3FEMA 4O15A 4OWGA 4FNUA 4N2YA 4HNNA 2CZFA 1BKSA 2Z0IA 1QMLA 1F7BA 1KM6A 3W76A 2Y7EA 1LM1A 4M6VA 2BLEA 1DV7A 1Q6OA 1G4EA 3HG3A 4Z1CA 2VELA 5D33A 2NXGA 4OV4A 2ZZ6A 1ICPA 3W7EA 1GG0A 3IGXA 3P82A 1O94A 3LOTA 3GZ3A 1GJPA 5CGQA 5BOOA 5K9DA 3C56A 4LWWA 3U6WA 2GQAA 5F4WA 3QMRA 2ATSA 2RH9A 1W31A 3G24A 3NQAA 1C8VA 3BVJA 1K8ZA 3NVTA 3S42A 2DJLA 1ME8A 2AQWA 5AHIA 3NOEA 2CLLA 1F6PA 1TPB1 4GE8A 4IXXA 1QPRA 2DZVA 2V9DA 2E5DA 3DHDA 4UTJA 3LI0A 3B03A 3Q2DA 5D02A 4FXSA 4QJ1A 4AF0B 1LORA 3LCHA 5KZMA 3QF0A 3C2OA 1NF7A 4FIRA 4UTWA 3LRMA 4HNTA 1VPXA 1Q45A 3NPVA 3IIVA 2GOUA 2ABAA 4RV8A 4MKNA 3P5YA 3FFSA 4AHOA 1F74A 2FQIA 4JTSA 1J5TA 5FF4A 3ZS4A 1Q6QA 4GWEA 3DFQA 1VHNA 4AEOA 2ZRVA 4HPJA 3IGSA 1JRBA 4E2BA 1SQ7A 3ABSA 1R47A 1VQTA 1V5XA 1JCXA 1GVOA 4JICA 1LTDA 4RKAA 4Y9AA 1DKWA 2CLOA 3F03K 1Y0EA 4FNPA 3U8GA 1EUAA 3I6RA 1M6JA 3GX9A 3MI3A 2EKCA 3NA8A 2ZTKA 3QW4B 2QUVA 4PCFA 1FCUA 4S2CA 3MYPA 1A5SA 4QAIA 5HQEA 3M6YA 3LCIA 4HHPA 1ML1A 3KRSA 1MZHA 4X22A 3P80A 4IMGA 4UMAA 2F84A 2A6LA 1PCKA 1JR1A 3QJAA 3T7VA 5G2HA 5K7JA 3FJ6A 2I14A 4QQ3A 1R46A 5K4ZA 4JX4A 4JDYA 2AGKA 2VEPA 4N4QA 3LHUA 2AAMA 4KWWA 1TYGA 2WQPA 1SO5A 1R2RA 4MLRA 4GUGA 4UFIA 1KFKA 4DO4A 2R8WA 3OVQA 1OFDA 1N8FA 5DY3A 4A22A 4N4PA 1UBSA 5G5IA 1W3TA 1OG0A 3C8FA 2A7PA 4ML9A 4JD4A 4TO8A 3GKFA 4OGZA 3HG4A 2Q3OA 2OCZA 4YXGA 1PCWA 4QSHA 4FEZA 2VFFA 1ADOA 1TRIA 1GT8A 1JCMP 1DOSA 1VCFA 3LCXA 1SU5A 2ALDA 3JRKA 3NQ7A 1SPQA 4YCOA 3ZR4A 4WX2A 3I7QA 3SSJA 1GYNA 1U83A 3HF3A 4K39A 1AMKA 2Q8LA 3PBYA 3KOFA 2CZ5A 1FY6A 2TPSA 4IMDA 3EWXA 2CLEA 3USBA 1JVNA 3M43A 4MIMA 2CLKA 5CG7A 3DH7A 2CLMA 3OHIA 2JGQA 1KFBA 3NQFA 2Y7DA 3WJZA 2HS8A 4P2VA 1C29A 4R33A 4LV9A 2QAFA 1VHCA 3G3DA 4TU1A 6ALDA 2A6NA 3PBVA 3A24A 4LVGA 3EXTA 5CPNA 4FXRA 5FEPA 1LYXA 2WV8A 1IXNA 4CLMA 1SR9A 3O16A 1DBTA 2J9YA 3BW2A 1HG3A 4MY1A 3M7WA 3SI9A 1R2TA 4LVBA 3FKRA 3UD6A 3NDOA 4WXYA 2HSAA 3FKKA 4Z08A 5H2ZA 1GZGA 4ZMGA 2QCLA 4OHQA 1KM0A 2RKXA 4GUJA 4UTHA 4NJGA 4O0KA 2NXHA 3WJXA 5DCBA 1S5TA 4XBKA 4MJZA 4HNVA 3G8EA 3PSWA 3O1NA 3DAQA 4JX6A 3M5YA 2RDUA 3IV3A 3W1MA 3C4UA 1TTPA 2FB3A 3PR2A 3O6CA 1XDLA 1ZHAA 3A5VA 3G1FA 3GDMA 1WBJA 4FX8A 2EAWA 4O53A 1W3IA 3G1SA 1GWJA 3EX2A 1YXCA 2V5BA 3L0NA 1PHWA 4AWSA 2YFOA 4HT3A 3QSRA 3L67A 4PH6A 1AW2A 2QCDB 2QDHA 1XBZA 2ZZ1A 1LOQA 4O11A 5BNKA 4HN4A 2VKZG 2W0UA 3PM6A 2XN0A 2R14A 1G67A 3MO7A 3PWAA 5D05A 3CTLA 1UASA 2ZA2A 4O57A 1LDCA 3OA3A 4YL2A 2OT1A 3O15A 4DELA 4X9SA 4NXKA 5T26A 1Z41A 2Q8ZA 3W7HA 5D30A 1F2JA 1VYSX 3G1XA 5C2XA 1B9BA 3TNOA 3L5AA 1QDSA 2B7NA 5HUPA 3TJLA 3TR2A 3EKLA 3GR7A 1PS9A 3BLIA 5LZLA 1B4EA 4JTTA 3G22A 3KRZA 5CSSA 1WAUA 4MLJA 1NEYA 2TYSA 3NAVA 2A4AA 5LGZA 3M44A 4IXHA 3WFAA 4JGDA 3N34A 4ZQCA 1NFBA 2QF7A 4Q33A 3W7LA 3LLDA 3EXRA 1SSGA 1H60A 1G69A 3EEGA 1DJQA 4LOCA 3F4NA 2VEIA 3BG5A 3IIOA 4JN6A 1XL9A 4LUJA 1B57A 5FI8A 3LTPA 4EIVA 3E49A 1BEUA 1I2NA 1AL7A 1TPVA 4NT0A 4UTIA 3ATYA 1TQJA 3DI1A 3LDVA 1H1YA 2PURA 4BWLA 3PBUA 3HGOA 3DXIA 3PAJA 8TIMA 1YXYA 4NNCA 5D09A 5D38A 4KKXA 1GG1A 1VS1A 1TMHA 1O5XA 1XFBA 3C2FA 4BI5A 1W5MA 1AG1O 4LC8A 1HO4A 5DY2A 2WNQA 4HSOA 1EEPA 5AYXA 1XUUA 2RHGA 3OIXA 1LLWA 3W1RA 4FO4A 3L5MA 4PTNA 1SZNA 3IGUA 3TAKA 3NYZA 5DBTA 2DP3A 4MZ8A 1RPXA 5KTLA 2ZRXA 4ADSA 1H51A 3TA6A 2A0NA 5G2WA 1TB3A 5HNRA 4LW7A 2X2GA 2DZUA 1EPXA 2FIQA 1OABA 3FYPA 2B7QA 2QCMA 4MFDA 5U4NA 2WO5A 3S1VA 4EOUA 4JTGA 2QKFA 2V5LA 3E02A 3GNDA 4OV9A 2QJIA 3A21A 2GVJA 5D32A 3LX9A 3L21A 5IBXA 1S3HA 1THFD 1TPDA 4IGHA 3W75A 3SJ3A 4JEQA 2E6YA 4KFOA 2KZHA 3TQVA 3TX9A 1PHQA 1QCWA 3S9YA 1DHPA 4K8HA 1EP2A 3FA5A 5K3VA 3GB6A 3HGSA 3CEPA 4N6FA 3QPZA 4JIPA 1FCBA 5AB3A 1PL9A 2FDSA 4IMFA 3NL6A 4U28A 1LLZA 1KM4A 4PA8A 3UWQA 2ISWA 3M0ZA 1F73A 2H8XA 1D3HA 4A2RA 2A7NA 3EX3A 5L9FA 1KFLA 2OZ0A 4MVAA 3HMJG 2V8ZA 3PUOA 3THAA 3HOJA 1H5YA 1TPUA 5BRBA 3P81A 4XQ6A 4MY9A 3A23A 3QSTA 1AW5A 5FF2A 4ICNA 3TSMA 3CC1A 5K4XA 5HWJA 1VLWA 1SFLA 1XBXA 2J9XA 4O8RA 4R53A 2E68A 4O50A 1MSSA 3CEUA 4AB4A 2JK2A 2H3BA 2CFFA 2VENA 5LGXA 1CW2A 1ICQA 2NWRA 2V2CA 2QJGA 3IVTA 1FUYA 3N9SA 3SGUA 4O54A 3C2VA 4LRTA 4AWUA 3W07A 4OBTA 4UFJA 2Z1BA 1OK4A 2QCCA 1SZEA 1ZENA 4NUWA 3W7RA 1HTIA 4LC6A 4RLIA 1QPQA 1G7UA 3TW6A 4CNPA 1VLIA 4O0ZA 4CQ9A 3ELFA 1OYCA 4ZQNA 4QNWA 4ADTA 1UCWA 1QOQA 4Z1BA 3S5YA 1YPFA 1I2OA 3OVPA 1HFBA 1ZAJA 3W88A 4A21A 2XN1A 1TRDA 3S5NA 1P0NA 1KA9F 4DBDA 4A29A 1H7RA 4LVFA 1KM3A 2E1DA 1W1ZA 3IIXA 1M5WA 5K9XA 4FX7A 5EMUA 2ZFAA 3TV8A 4O12A 5EA9A 3F4WA 4WY0F 2E6FA 1K03A 1KV5A 4O1CA 1YADA 2H3DA 5SWUA 2XN2A 2YZRA 4PL2A 3GAKA 1EA0A 1VR6A 2X16A 3W71A 1LRTA 2J27A 4JDBA 3R89A 3G1HA 3QMTA 3FIGA 4JYFA 5CKSA 3UWZA 4XUGA 2OT0A 1W5NA 3TXZA 1SW3A 1FWTA 3DFOA 2HTMA 3EWWA 3P8IA 4JNMA 4BI7A 4IUOA 4GRSA 4JYDA 4DBEA 1PVNA 1ZFJA 2ZQ0A 3FOKA 4PEKA 1KV8A 4ORIA 4YCPA 4CQ8A 1QOPA 1PE1A 2DZPA 1GPWA 1J4EA 1ICSA 4AMAA 3TMLA 1K02A 2I9EA 1M7OA 3C61A 4LRSA 4FNTA 3P5ZA 1OFRA 1GVQA 4B5NA 4WZHA 1TPC1 3VE7A 2G95A 3N73A 1MXSA 3PG9A 1JCNA 2Y70A 1MEIA 3N14A 3LHWA 4N9BA 4GXMA 3TU9A 1LOLA 1AK5A 4LS1A 2QDGA 3FS2A 3LV6A 3W7KA 5D2XA 4FHAA 2W79A 3HB9A 1XUZA 3LRKA 5F2LA 3PB0A 4UR8A 4ZQPA 5AC7A 4K37A 4LUIA 4M7TA 1TTQA 4K6AA 3ABOA 5HWNA 2WSRA 3BPWA 2QCGA 4RZ5A 3G8RA 1Z44A 4OE7A 2B7PA 1Q3NA 3SIZA 4CCEA 1HUVA 3DENA 2FB2A 4I9AA 4JY8A 5DLCA 5BW6A 2A7RA 2X30A 2GQ9A 3W7CA 1SUXA 1MO0A 2NX1A 3BW4A 3L2IA 3SZ8A 3W7DA 1K7XA 4TMCA 3STFA 1VH7A 3LM7A 2NX3A 4AHPA 2NUWA 4AVFA 1Q6RA 4IX2A 5DXYA 3HBLA 3MI6A 3P74A 4UTUA 4UTWC 2WOQA 3DKJA 3Q37A 4OQVA 3W22A 2NLIA 1S5VA 2X1TA 1AL8A 1UJPA 4O4WA 5F4XA 2IQTA 4IMCA 5AHMA 1SO4A 4GNJA 4ZQOA 3RFAA 3W83A 1VYRA 1OF6A 3L9CA 5TIMA 1RZMA 2YSWA 1H63A 5EPDA 3HG5A 1GYLA 2PRLA 4O4VA 5A8GA 3W2MA 2J6XA 4JXCA 2YYTA 3ABQA 1WX0A 1S5WA 2YW3A 3RU6A 4DF0A 1XKYA 3QH2A 1Z48A 3ZWSA 3T44A 2ATMA 1WV2A 2EHHA 1ME7A 3VFLA 3R12A 1D3GA 5F4SA 3DU0A 4NQ1A 1EWEA 2Y85A 3G1VA 3STCA 1KM2A 1XI3A 3FYOA 3UWYA 1O4UA 1QPOA 5D37A 1K7FA 3I7RA 1W0MA 3IRDA 2BSLA 3LTYA 4RZ6A 2ZA1A 5E93A 4HNUA 1OFOA 1TV5A 1YTDA 4O17A 4ALDA 1L6WA 3GYEA 1GQNA 4RX0A 3M5XA 4GUHA 3W2JA 3W1XA 4NZJA 3VKJA 3LERA 3T78A 3SFKA 1IXOA 4TIMA 2Z6JA 3N3MA 1FBAA 1FXQA 3GAYA 2C13A 4JTIA 3CM4A 2JKEA 3L65A 3IIZA 4EVZA 3DI0A 3B0VC 1OJXA 2WKJA 5A5WA 1W5OA 2G96A 1TV7A 3O07A 3TKFA 2ZZ4A 4O1DA 1G7VA 4XKYA 5LHFA 3O8AA 1DQWA 1VRDA 3QEZA 3MHFA 4S2BA 3IVUA 1JQXA 1OF8A 1VCVA 1GOXA 2PRMA 3OBKA 2VEMA 3M5VA 5AHLA 1YLVA 4ZQMA 5GVJA 5FF7A 3CT7A 5G4EA 1ONRA 4UNKA 1ZALA 3L68A 4NJIA 4E0CA 3H54A 3SR7A 1W56A 1T99A 3Q58A 5F1VA 3VCRA 1OFBA 1WYIA 3N2MA 4X2RA 1FQ0A 5CZTA 4BWLC 5AYZA 4R34A 2FTPA 3GXNA 5LSMA 2ZA3A 3IVSA 3RK8A 1A50A 5AHNA 3W1NA 5FESA 1VJIA 3CPRA 1O60A 2CU0A 3DFSA 3RLVA 2VXNA 3LXCA 1JCYA 3C6CA 4DQWA 3NO5A 1FXPA 3AJXA 1EIXA 4UNLA 3W1PA 2C16A 1ZAIA 2V30A 3NL2A 1LOSA 1W8SA 3LLFA 3KX6A 4M6PA 2I1OA 3KRUA 5DCEA 2DZWA 3WJYA 1I45A 3B0PA 3GVGA 3P67A 4XTIA 3M9YA 3VNDA 4IJBA 4Y8FA 2PC4A 3TUUA 4O16A 3TH6A 4M6QA 5DELA 3MJYA 4CCCA 4DO6A 3LCLA 2ZZ5A 2YFNA 1H7PA 2J9ZA 5G1TA 2OJPA 3TC7A 3NG3A 4UFMA 3MMTA 1A53A 2ZZ3A 2DZSA 3GXTA 3C0JA 3GXPA 1P1XA 5IBXC 1F6KA 1E51A 2GQ8A 1OYAA 1PV8A 3GR8A 4UR7A 4A3UA 4WJEA 1YTKA 2F7FA 2DJXA 1FDZA 4K7VA 3NZRA 1TJPA 1X7FA 5I3JA 3PUDA 3W9ZA 3G18A 3HG2A 3W7IA 4FNQA 2GJLA 3WJWA 4JY9A 1OVDA 1EP3A 4D2JA 1C9DA 1LZOA 4JTUA 4Q32A 4S1FA 2E5BA 3MP4A 4C1KA 1OX4A 4DXVA 3S1XA 4QISA 3NEVA 4Y96A 4PL1A 2P0OA 2YDAA 3CIXA 3W7PA 5AC8A 2DZXA 2QCFA 4AAJA 3LCFA 3H55A 1JUKA 2EPHA 3TFCA 3DZ1A 2A5HA 4IOTA 3HQ1A 1P4CA 7TIMA 3PUEA 3ANYA 4N02A 1X1ZA 4QITA 2ZRWA 2PCQA 4FNRA 3HGJA 1KTCA 3LCWA 4Z0JA 4EF9A 3NGJA 3W1QA 5F1UA 3MYOA 2ZRYA 2RDTA 3HPZA 4XWUA 2YGYA 4CNNA 1H61A 2FLIA 3MP3A 3R5EA 4MYXA 4UUIA 3V1PA 1TIMA 3GIYA 2A2IA 1OFQA 3FLUA 3UWUA 1U5JA 4WQ6A 1W54A 1JUBA 2GUUA 3KVJA 1G4PA 1WA3A 2QAPA 2WSQA 4AWTA 3W3OA 1Z42A 3NQ6A 2DORA 3TMQA 1UB3A 1TV8A 4WOQA 1CI1A 4HIBA 3TFXA 5AHEA 3TIMA 2OMAA 1RQEA 1EB3A 1I2RA 3AO0A 3W1UA 5DBUA 5KSWA 2E6AA 2EF9A 3MHUA 1ALDA 2J88A 4XBSA 3QYQA 2Y7FA 4JIQA 3LI1A 3FJLA 5KZDA 4KFNA 3G0XA 4JR5A 3W72A 4N9CA 4EWND 3UQNA 1DL3A 4M5PA 1RVGA 2WPBA 4N9EA 1DJNA 4JX5A 3KFTA 4H3DA 5CZSA 1KW1A 3OG3A 3M41A 3WJSA 3W7NA 1OX6A 2ZTJA 3PBWA 4IPJA 4NX0A 3M47A 5CZJA 5K9CA 1YDVA 3O6YX 4BR1A 4M19A 2X1UA 4ZVJA 3W7GA 3EX6A 4IX0A 5I3HA 4X3ZA 1A5BA 3NL5A 2CLIA 4K36A 4JTJA 1NAL1 4O10A 5LNVA 1QR7A 1B3OA 3EB2A 3P62A 2QR6A 1IIGA 3UY7A 1I4NA 2JGYA 3LB0A 3UY8A 5KZEA 3MP5A 4NJJA 4WXZA 4L4MA 5LNWA 4NJHA 3UPWA 5I3GA 5G2IA 3ATZA 5I3KA 3C2RA 3EWZA 1JCJA 2D73A 1TPWA 3E96A 1H7WA 3W87A 3W73A 3S1WA 1GVRA 1TREA 2B7OA 2W6RA 2V0TA 2RDWA 4JS3A 1SZGA 3MBDA 3UXDA 4GFSA 4O19A 2YW4A 3F1QA 1WBHA 1TCDA 2HS6A 3CHVA 1ZJIA 3DHFA 3DFPA 1BTMA 3THQA 4ADUA 3HIJA 3NNTA 4FNSA 2FPVA 2FFCA 3GNNA 4M7SA 1QPNA 3BARA 3LGEA 4N6EA 2Y61A 3BK0A 5AYYA 2X1RA 2YX0A 4JTLA 3O63A 4E38A 5C54A 3V75A 1W5PA 3LHTA 3WK3A 2C18A 1G6CA 2H90A 3P84A 3LV5A 2A85A 3N2XA 3RLUA 2GPTA 4GJ1A 3KVKA 4W9TA 4WY0A 4LY8A 1G4TA 4GUIA 4I7WA 2ZZ7A 3TROA 3G0SA 3P60A 3HO8A 4JTKA 2TMDA 3WK1A 3NM3A 1XBYA 1SO3A 3GKAA 1ME9A 3NQCA 4H6KA 3UZJA 4YLWA 2Y89A 1LBMA 3M16A 3B06A 2V2HA 2R91A 4TR9A 3NQ2A 1O5KA 1Q6LA 3TDFA 3TC6A 1BWLA 3L5LA 3NQMA 3PC0A 4MJMA 1FCQA 3W7OA 4O14A 5LNUA 3UZ5A 2LLEA 1OK6A 2JKAA 3ZWTA 3TJXA 3WK2A 3QFEA 1FDYA 2E77A 4IQLA 3HPSA 3CWNA 3RMJA 4IMEA 4ZQRA 1KTBA 4O28A 2C19A 5J5DA 2QUUA 4LNYA 5LHEA 5KMYA 1IXPA 3EX1A 3W70A 3BW3A 1A5AA 4UTLA 5AOUA 3UPBA 1XXXA 3CQ0A 4UIOA 3B4UA 2BTMA 5DXXA 3SGZA 3L0GA 1SW7A 5DN1A 2O7SA 3IIPA
chains in the Genus database with same CATH superfamily
2Z1XA 1KXHA 4HZ6A 4WGHA 2C14A 4MZYA 2V38A 3NGFA 5JBEA 1ZS2A 1O95A 4FXFA 3WMLA 1J2WA 3CLMA 1DWAM 4Z1AA 1EJTC 1P0DA 3B05A 3GHUA 3WBAA 3K30A 3Q65A 1E6QM 2V2DA 1NP0A 3AYTA 1K4GA 4NU7A 1TPEA 3WQ8A 1HJXA 5T9CE 5FL0A 5AC6A 3NQ8A 2QCHA 2G50A 4KETA 4N0RA 3A12A 3Q94A 3BGAA 4D6DA 3BGGA 3E5PA 1GOWA 1EWDA 1B54A 3KLKA 1M01A 3E0IA 4B2DD 2CIPA 3QR0A 3T0DA 2QCEA 4AVNA 3H21A 3H53A 1H50A 2NX9A 3LHZA 3HM7A 4LVDA 4XIAA 1RV8A 3W00A 3DX5A 3CUZA 4RJEA 1HL8A 2DW7A 2VR2A 3PB2A 1QO5A 1TPFA 3QPYA 3LBMA 4BKNA 3ARWA 1RD5A 1RXOB 4HSNA 4DWSC 4EXBA 1T96A 1AQ0A 5ABTA 2P1FA 5G4WA 4BFAA 3SSZA 5EFDA 4Z2JA 2VFEA 3MO4A 4QIUA 1J2BA 3MV01 1TV4A 3PPFA 1J0HA 1NY1A 2YCEA 1RAKA 1KLYA 3MS8A 1A5LC 3BWWA 3S5OA 4B90A 3CWOX 3UG3A 2VD9A 2YCKX 5RUBA 1MI3A 1JULA 4GIEA 1IF2A 4LVAA 1KFCA 1AH4A 3BQ5A 3LHVA 3G3MA 2PDUA 4CQDA 2ZDRA 3AYSA 1PPIA 2R6OA 1PZ1A 4W8BA 2ICSA 2GZXA 1H7NA 3M0HA 3W29A 3SAZA 4AZHA 5HJYA 5IDIA 3VCCA 4AMCA 5K2ZA 3A4WA 4LAZA 2O7QA 4W7VA 4KWOA 1JCLA 2BVWA 4NJKA 3BLFA 2P3EA 2G3IA 2A3CA 2FTYA 1N82A 5CPTA 3WX7A 2E0PA 3A64A 3MMDA 4R27A 3T0TA 1XC4A 1LBFA 2PLKA 3VFCA 5D2WA 1G1YA 1HKVA 3T0CA 3C86A 2AOSA 2XFWA 1VYPX 2V67A 1A5KC 4HU8A 2HE5A 4UMCA 1A5OC 2NZLA 2GVLA 4C91A 3HPAA 2OSWA 4HMDA 1XCFA 1C7TA 1F5ZA 2QMJA 4ILSA 4S3BA 3TQKA 3KAOA 5EFFA 1VCGA 1VC4A 4PC8A 3PZMA 3RM8A 3KRBA 2OOFA 4ZO9A 5DMLA 4D1JA 4ZSUA 3TXVA 4RXGA 4J3WA 1E0VA 1TSIA 1KLZA 1V77A 3PPHA 3H26A 4CD6A 1BQCA 3GDTA 1IEXA 3V5FA 2DH3A 1UIPA 1MUWA 1F3EA 1D9EA 1YNYA 3LSCA 1ELSA 4FX6M 4B3KA 3T6CA 4MWAC 4YPJA 1ZAHA 1F3WA 2XZ9A 3WF2A 4LUSB 1OX5A 3KBJA 2HPMA 4U4MA 3NQGA 2VFDA 4IL0A 1WZMA 1RK6A 2VDIA 1FX6A 3W1LA 1QNQA 4AY7A 1G5AA 3OVRA 4WK9A 4D8ZA 3H4GA 4UQBA 1W2VA 3NQDA 3VD7A 3YPIA 2BY0A 1US2A 4ORMA 4CNSA 2CXGA 5G4HC 4AH7A 3L0KA 4B5VA 3WD4A 3IRSA 1NWTA 1MEWA 1GGOA 5FF0A 5AN7A 4G2DA 3BV4A 1J8VA 3PJUA 1NSJA 2R9RA 3W7JA 1OHLA 1W9XA 4DY1A 4QM1A 1YPXA 3LPGA 1TZ7A 4ECLA 1J9YA 5CPQA 1JAKA 2NV2A 4GY7A 2VCAA 5FJIA 5FSEC 3GLCA 4MTVA 4HCLA 1NDWA 4JYEA 3ZLFA 3NQVA 3WBYA 3UJ2A 1XJBA 3W85A 2WNNA 3MZ2A 3C2YA 3S0CA 3BANA 2UY5A 7REQB 5EMMA 3CHEA 1H7OA 1UD2A 5EMLA 1QWGA 3GDRA 3TCEA 4J2MA 4F3HA 4WUIA 2G4FA 4LJ3A 1ZNNA 3VYLA 3FDKA 4WVXA 1TJ2A 3UG8A 1KBJA 2C0AA 4A35A 4R85A 1E6PA 1FWGC 3PY2A 4Q4KA 4US6A 3WO8A 1CWYA 3V18A 3E2SA 3GVRA 1BD0A 5FAJA 1OCBA 4LS0A 1EGZA 2HMCA 3L66A 2XGZA 4Q4QA 3VZYA 1TPH1 1PDYA 2FGLA 4CNOA 3GDKA 4GYFA 3GVWA 3CH9A 2XIBA 1RR2A 1TTIA 5F2MA 2FZMA 3IWPA 2CZEA 4I9MA 1W3KA 1Q6EA 3RX4A 3A5FA 3LK6A 3V0TA 4GI6A 2XH7A 4HZMA 1YYAA 4UMBA 1DJXA 4L9YA 1SMDA 1NOWA 4NIRA 3KM8A 1IGSA 3FEQA 2JBMA 4XIMA 4E2DA 1W6TA 4HU4A 5JIWA 4J3XA 4MPQA 4KCTA 5HANA 1H1NA 2ZZ2A 4DNMA 4NI8A 1A5CA 3OYZA 4WDUA 1QHZA 2G5WA 4O13A 1QAPA 4KRZA 3TLLA 3NL3A 2J7FA 1AW1A 3UG4A 1QK0A 4QG9A 5CC3A 3WCZA 4JHMA 1KTNA 2ZDSA 3B8DA 1XIIA 3PZNA 4L80A 4IWWA 1C93A 3LBOA 2O9RA 3WLQA 4Q8PA 3UU0A 3E9AA 4PBGA 3N6JA 4NNAA 4K1GA 3V5OA 3ONBA 4LT9A 3QZAA 3R4IA 3UNDA 1B0IA 3CS2A 4PB4A 1EXPA 3R0UA 1UPPA 3C8NA 4P5UA 3O06A 1GPFA 1AUSL 3PTMA 5C7HA 4O1BA 1NFPA 4UCGA 1TJRA 4QNEA 4I7UA 3WH9A 1CNVA 3GR4A 3GH4A 5LYRA 3PAOA 1LL7A 3PULA 3AHXA 4XTDA 1A4LA 2PDQA 4LS2A 3GM8A 2WBKA 4TX8A 2GVGA 2WHJA 3GK0A 3STGA 4ZOAA 3BOLA 1KFJA 2J4GA 4DPPA 5CSRA 4IGMA 4EPKA 5LIYX 2YBTA 3M64A 1W5QA 2WNZA 2FJKA 3BGJA 2FVKA 1YDOA 1QRQA 1JQVA 1QI0A 5KITA 1XW8A 2JKPA 3A9IA 1V6TA 1KRBC 4JQ1A 1B3XA 3G1YA 2P10A 1H3GA 1V7YA 5HR7A 4GNKB 4Z17A 3AI0A 1FHLA 2Y88A 3PFMA 2ZVRA 3VTRA 4OWGA 1JG9A 4WGXA 2Y8KA 2DQWA 5E0FA 3CHDA 2X7WA 4DJFD 1JPKA 1R38A 2XFYA 2J7EA 4F48A 1OEPA 2XHYA 2YLLA 1Q6OA 1DIKA 1Y5XA 3N2CA 1G4EA 1CXLA 3HG3A 5HMDA 4OV4A 4AUBA 1ICPA 3W7EA 1GG0A 3P82A 2PP3A 1IZJA 3LOTA 3GZ3A 3TTOA 1GJPA 4DJDD 5BOOA 1O7AA 1UPMB 3CTTA 4HN8A 2GQAA 1W31A 3MT1A 3BVJA 1XDJA 3AC0A 3MWCA 1NFGA 2YA1A 2DJLA 3R10A 1Q7QA 3ES7A 5AHIA 3HPFA 2CLLA 3NOEA 3E0WA 1F6PA 4CNTA 4GE8A 1QPRA 1EZWA 3B8WA 2DZVA 4UTJA 5DANA 1KXVA 1PYMA 4FXSA 2V63A 4W8LA 1WKEA 3LMYA 5A6AA 5KZMA 4TOQA 1NF7A 3KBVA 4UTWA 4BEUA 4HNTA 2XYLA 3IJ9A 3WNKA 3UR7A 2DT3A 2AAAA 1KCLA 4L1WA 2YCIX 3P5YA 2ACQA 3OP2A 2FQIA 1HJSA 2HROA 1UWQA 4B16A 3AUOA 3BZGA 5DMYA 4QRNA 3VXGA 1R3TA 2UZ9A 1MRAA 5TNVA 1NJJA 2WNWA 2DUAA 3ABSA 1R47A 1ADSA 1VQTA 3FV9A 3G5EA 4FNPA 3TONA 3GX9A 3DERA 3MI3A 2PTYA 2VR4A 3QW4B 2QUVA 8XIMA 3WH7A 4PCFA 4HTYA 3WIJA 5CG0A 1NOFA 4FI4A 4LPCA 1E6ZA 1WUFA 1A3HA 4X22A 3CHCA 1ZQ5A 4UNIA 1PCKA 3M07A 3B8TA 1JR1A 1KQZA 4PUDA 3FX4A 3T7VA 5G2HA 5CC6A 1FWEC 5BXSA 1W9UA 2XUCA 5ECUA 3LHUA 4GIAA 1KCZA 2CBIA 2PDKA 3QKZA 1X39A 5BCAA 3A4AA 2J78A 4UFIA 1KFKA 1P7TB 3VDBA 2WCSA 2R8WA 3GZAA 3CQHA 4A22A 1V0KA 4N4PA 4KRTA 4EX4A 1E9LA 2GOKA 2A7PA 4ML9A 3OU8A 1C3FA 5HMFA 4FEZA 3WF1A 1WZAA 4P8UA 4WIWA 4F4RA 3JRKA 1KNWA 4TV6A 1NIUA 4GYPC 3LM3A 4L6OA 3HF3A 3H2CA 3B8SA 1FY6A 3USBA 3DECA 2CLEA 1XYAA 4L61A 1JVNA 4NAFB 5CG7A 4LCSA 1GJUA 2JF6A 2CLMA 1P6WA 4QG6A 4US5A 5CPSA 1C29A 5HDRA 1J96A 1VAHA 2YB1A 1J10A 4LV9A 2GK1A 3MSGA 4PUWA 3KTXA 4GA8A 3R6IA 3WQEA 4KERA 4FXRA 4YIWA 4AYSA 1LYXA 1IXNA 2J9YA 3ARVA 1C7SA 5A2BA 2QNEA 4MY1A 3FHAA 4RZBA 3WKZA 3VD9A 3GTHA 4IH3A 1DIEA 1Q5MA 4WXYA 4RDWA 4QAWA 1WE5A 2GSJA 1L6GA 4PUKA 2H9AA 3FKKA 2MUCA 3D3FA 1G94A 3AS2A 4ZMGA 2D20A 2RKXA 4FOUA 1ZGDA 1Q6DA 4NJGA 4D8AA 4O0KA 4XBKA 3NO3A 3U4AA 3CO4A 2HBXA 2NT1A 4AG0A 4LCQA 3IV3A 3W1MA 2FB3A 4GIYA 4C60A 3PR2A 4O53A 1W3IA 1V3LA 3G1SA 5ABFB 4AWSA 3UZYA 2PDIA 3VKDA 3QSRA 4PH6A 1AW2A 3LLXA 2ZZ1A 1LOQA 3SCOA 2W0UA 4DJFC 3SIMA 2X7VA 1G67A 4GYJA 1YIXA 4BQ2A 3VCNA 4Y9OA 1A80A 4NXKA 1E56A 2JQXA 2Q8ZA 2EXOA 2ZXAA 5C2XA 2EBNA 1E43A 3CMFA 1E6NA 4JTTA 5CSSA 4MLJA 2PDYA 4LEFA 4DVOA 3M44A 4IXHA 1JI2A 4Q33A 3W7LA 4CVWA 3AXKA 3EXRA 3MVIA 1H60A 1E9IA 3F4NA 3BG5A 3IIOA 2VMFA 3BXWA 1B57A 1YNQA 3OQ8A 1F6YA 1IV8A 1I2NA 1Q8AA 3CZGA 4X2PA 4LQ1A 4NT0A 1JDFA 1BHGA 3WLIA 4BWLA 3ONCA 4PTMA 1LQ2A 2TAAA 4I3GA 2NQJA 3VZZA 3PAJA 4F2BA 4ZE4A 3WBEA 2PGRA 4AVOA 4NNCA 1BYDA 1GG1A 4BI5A 2AL2B 1AG1O 3TJIA 3WDJA 3GXMA 4ML4A 4RE0A 4LF2A 1DXEA 1EEPA 5AYXA 3VKCA 3VKBA 2RHGA 4EWJA 1LLWA 5FCZA 2WVUA 3TTEA 3NCOA 4FO4A 3PZVA 4BF5A 3TAKA 2DP3A 4AX6A 4WLCA 1UYQA 3E2RA 1JAEA 2R82A 1TB3A 3EYPA 4EAYA 5HNRA 4LW7A 2DZUA 4XD3A 2VZTA 2B7QA 1DWHM 1FH7A 3WF3A 4DWDA 4EOUA 1PTDA 3ZVIA 3TW9A 3IK2A 2V5LA 4GZJA 5D32A 4PYSA 4A3RA 5CC5A 2Y2WA 4KFOA 2KZHA 3TQVA 4GI8A 3S9YA 1DHPA 4K8HA 4NILA 3SBFA 4P8VA 3SDOA 3GB6A 2Y5EA 5A2CA 1V0NA 4N6FA 3UXKA 4IMFA 2PWFA 1KM4A 4O0QA 4PA8A 1CPUA 3A47A 5A8MA 1QNRA 2WMFA 4XUYA 4HBKA 4A2RA 7TAAA 1KFLA 4KCUA 4IM4A 3RDKA 2REQA 2P50A 1AZ2A 3KBNA 4WR3A 5BRBA 1WDPA 4JN8A 3A23A 3QSTA 5FF2A 3DBNA 3V36A 2CHNA 1J0JA 1XRSA 1UD8A 2R1NA 5HWJA 4MJ4A 5FSDC 4ZO7A 2C79A 2E68A 2VDHA 4BCEA 3GS6A 2JK2A 5LGXA 3OLEA 4C7GA 2VL4A 2NWRA 2QJGA 1FUYA 5JIPA 4I9JA 4IISA 4O54A 3GXDA 4DLFA 1E6XM 2BP1A 4GKLA 4W85A 2ZICA 4C6JA 3W7RA 3QLLA 2YJQA 4HU3A 2XWDA 4O0ZA 5C9WA 1Q7MA 3J7HA 2G3JA 2NQLA 4XISA 2OSXA 4QNWA 1TWSA 1UCWA 3CZEA 1EHAA 3UVIA 4OOUA 3CHFA 1LL6A 4XBJA 1K6WA 1I2OA 1MXDA 3VD3A 2XN1A 1AFSA 4DBDA 1KA9F 4WRHA 4A29A 3TN6A 4LVFA 2IKIA 5CJMA 5LA2A 4GQGA 1J6PA 4HOZA 4UZUA 4FX7A 1CGYA 2YA0A 5EMUA 4E3TA 2W62A 4WY0F 1V6VA 2WHLA 1KV5A 4FP1A 2FJUB 2J8TA 2H3DA 2GGJA 4PL2A 4LALA 3GAKA 3LN3A 1EA0A 3S2NA 2PWUA 4MDOA 2ZX7A 3HV8A 4JQ4A 3TR9A 3FIGA 5EMYA 4XUGA 1ODZA 1W8GA 1W5NA 2VC5A 2G3MA 4KT2A 2DT2A 5I2UA 3DFOA 4JNMA 4BI7A 7PTDA 4IUOA 4GRSA 4JYDA 4DBEA 1ZFJA 1Y5WA 2WJEA 5FJTA 1M03A 1A0CA 4ORIA 4S3DA 1SJBA 4YVPA 4YCPA 2QIWA 1RH9A 4CQ8A 4Y9NA 1UIOA 1H0IA 4DX3A 4PB5A 2P88A 1JL8A 2HVNA 3P5ZA 1S39A 1JZ4A 1TPC1 5TAOA 3BAKA 4GIRA 3VE7A 1MWOA 3IV8A 1UD6A 4EPBC 1HW6A 3AXXA 1NOUA 5GJNA 1AK5A 4UOZA 2Z28A 3M4HA 2IPWA 3LV6A 1V3KA 4WKAA 4JIEA 1LT7A 4ZQPA 3VZXA 4K37A 4LUIA 4QTGA 3GU2A 4K6AA 3ABOA 2PBOA 4GYPA 4YHEA 3QYSA 5C9ZA 4WJ8A 2GJRA 4RZ5A 3SY8A 3WEZA 4BS0A 4DWSB 4W8AA 5DMNA 1CXIA 4IPLA 1Q3NA 3SN4A 1EJRC 3KL5A 5I02A 2FB2A 1E1CB 4I9AA 5DLCA 5BW6A 1TR1A 1XYMA 2X30A 3CB3A 1J18A 1C8QA 1U1JA 1BVWA 5D9MA 4C65A 5TF0A 4B92A 2NUWA 1PYFA 2DZBA 1W9VA 1Q85A 1JGIA 3W22A 1UWTA 1GZJA 1SVDA 4O4WA 2IQTA 3SQLA 4UTFA 3CGTA 5AHMA 1SO4A 1REQB 3TTQA 1OF6A 1JYNA 1H63A 5EPDA 1HX0A 4WDXA 5DRIA 3APGA 4O4VA 1DYSA 3W2MA 2EG8A 3D5HA 1P0EA 3ABQA 1I0DA 1V03A 3RU6A 2WAGA 4X9YA 3LY0A 2YKKA 5JMUA 4GCAA 1WV2A 4ACZB 4AD0A 1CBGA 1JZ8A 2D0GA 4HHMA 2Y85A 3STCA 1QPOA 1BFNA 3N04A 3PPGA 1K7FA 7A3HA 1IR1A 4OBSA 1A0EA 1YTDA 4O17A 1L6WA 3GYEA 4RX0A 3M5XA 4PMXA 4UQCA 4NZJA 1PJ9A 2W5FA 3SFKA 4FAMA 1BXBA 4L1GA 2WJDA 3L65A 3BICA 4D6CA 3BMWA 3IIZA 1S2CA 3DI0A 6A3HA 1K6AA 5A6SA 1U5VA 3AS0A 4CD5A 4F0MA 1SYTA 3O07A 1JPIA 1EL3A 1U1HA 4P7QA 5LHFA 1VRDA 3I10A 2OLSA 3CPUA 2ZX8A 3MHFA 1JQXA 4CD4A 1GOXA 1KRAC 2HRWA 2BHYA 2PRMA 3AIEA 3OBKA 1YLVA 2VEFA 4ZQMA 3G1RA 3WF4A 5GVJA 5FF7A 4OOZA 4DUOA 5G4EA 3NQBA 3L68A 3EOEA 3H54A 5JU6A 3Q58A 1DPMA 1S3TC 1WYIA 1MW1A 4X2RA 4BWLC 3KZPA 2FTPA 3VNKA 2W63A 4DI8A 5AHNA 3BV7A 1O60A 3DFSA 1KCKA 1VBGA 2E9BA 3SGGA 4HK7A 5J8LA 3NO5A 2WC4A 2D69A 1UJQA 3VNJA 3W1PA 1XGEA 2C16A 5E6YA 1ZAIA 4PMNA 1LOSA 3LLFA 4C7DA 1QHPA 3GVGA 3P67A 1CIUA 1GNXA 4Y8FA 5XIMA 3B8IA 4CCCA 3LCLA 2OZ3A 1H7PA 4DIAA 3WLNA 3NG3A 6CGTA 3OG2A 4I6VA 4UFMA 1EEXA 3GXTA 3U2CA 3MA8A 1GW1A 1EDTA 2GWNA 4J35A 3GG0A 3W28A 2PP0A 1PO9A 5FJUA 4UR7A 4ZOCA 3WNNA 3U7BA 1XV8A 3GNRA 4Q8VA 1UKQA 3UW6A 3W53A 1TJPA 2E8ZA 4EPDC 4WF7A 1ZP4A 3HG2A 2ESCA 1A5NC 1PWMA 3GG7A 1D8WA 4D2JA 1GKRA 4S1FA 1VFUA 1KO0A 4A8IA 5KETA 4QISA 3NEVA 2A3EA 4DYEA 3UNTA 2DQXA 5AC8A 3EAUA 3LCFA 5E6ZA 3DZ1A 3CZJA 1NELA 3M0MA 1IZKA 3ANYA 3S4TA 5FACA 4QITA 2PCQA 1KTCA 5A2AA 3O6AA 1CEOA 3MUY1 4LAUA 3W1QA 3O2LA 2CCRA 5T91A 1DEDA 1UQYA 3JU2A 3Q45A 4UUIA 1RUSA 3SUVA 5I77A 3DG6A 1W54A 3SM0A 3O7UA 1B1YA 3KVJA 2QV5A 3AIUA 1WA3A 4JEJA 2QAPA 1MYRA 5FL1A 4HIBA 4QJ5B 4H00A 3KS5A 2OMAA 2Z29A 1YHTA 4I8YA 5DBUA 4H9XA 1ALDA 1CT5A 3QYQA 4JIQA 2Z1SA 3G0XA 4EWND 4M5PA 5B80A 4JX5A 4LYPA 4DUXA 3NFUA 1OX6A 4PULA 2MANA 9CGTA 2XZ7A 4J3ZA 4PMQA 4HNLA 3RX3A 4G1NA 3KBWA 4AZGA 1UH2A 3CUHA 4ZVJA 4ZXOA 3EX6A 1VKFA 2CLIA 5DT5A 1IGWA 2EPMX 3DUGA 5LNVA 1LWHA 1QR7A 4AZ5A 1TZ9A 3RRAA 3IJ6A 2QR6A 3AMDA 1Z69A 2DSWA 1Q66A 1I4NA 1YMYA 1F3TA 3UY8A 5KZEA 4NJJA 4X60A 1MFVA 4QROA 1U33A 3N29A 3TWBA 4L4MA 2J66A 1S46A 3RLGA 1I6NA 4HK6A 4NJHA 5I3GA 3OGSA 3ATZA 5I3KA 4WKHA 3STPA 3AUJA 1H7WA 1ZBWA 1XH0A 3E38A 4GACA 2DSKA 2VQTA 3MSYA 3F4VA 3MBDA 1JGMA 1H11A 3UGRA 4EKJA 1WBHA 1KR0A 3A4XA 4C5YA 1RPKA 2XGBA 2X1IA 2IQ0A 3O0FA 1ZJIA 3GW3A 5C9UA 4ADUA 5A95A 3WQOA 1AD4A 5ABHA 3UZXA 2FFCA 4M7SA 4CQBA 2INEA 2VRQA 3A9BA 5AYYA 2CWXA 6REQA 5GNXA 4H7VA 3O63A 2J7GA 3GE7A 2C18A 3EPNA 1G6CA 2J62A 3V0SA 2FGZA 4WSJA 1DJWA 3CUIA 4I7WA 3SCWA 5I09A 2TMDA 3E1F1 2OVLA 3NM3A 1XBYA 2G3NA 4GG9A 3OLDA 3UZJA 4TQTA 3O0KA 4YLWA 3ENLA 3M16A 1QT1A 4H01A 1EQCA 3NQ2A 3R43A 2JIEA 4JTAA 1FCQA 3W7OA 3F5JA 1IWBA 2L5HA 1EBHA 3UZZA 4PSPA 3AALA 3WK2A 5HQMA 1CENA 3HMCA 3CYVA 4HZ8A 4TVCA 1W1B1 2XIJA 2GUYA 3BW3A 4M0XA 4CVUA 4YNGA 3GBEA 1UBPC 5DXXA 3V3WA 4DJEA 2GDVA 4X63A 3GH7A 5DN1A 1S2UA 3WDHA 3S8HA 4AWEA 5HBFA 5EBAA 4LV4A 1FWNA 1SJCA 1EPVA 4UB9A 5A8OA 4MB5A 1LLOA 4GKTA 4GCXA 3PTKA 3TYAA 2OQLA 4D6FA 4JL1A 1E4NA 4LNCA 1H2JA 3KDNA 4H83A 3DBPA 4L4PA 1PWLA 3HQNA 2A3LA 5EBUA 1XLDA 3B0UX 4B9YA 1GVFA 3BSGA 4LYRA 3OBEA 3QM3A 2W27A 3VOGA 4YTTA 3FJNA 4E4FA 2ZADA 1LUCA 2X41A 3SCRA 1UKPA 3WDRA 5IOBA 1BRLA 3S1UA 4WCJA 1H7XA 1YXDA 1EGVA 3VGBA 3DGRA 2J6VA 3H7VA 3W84A 3SUTA 4K7YA 3H8AA 2C15A 2ABBA 3NR0A 1LROA 2FVMA 4H8VA 3DFTA 1MMFA 5REQA 1U5HA 2D2GA 2XVPA 2ZXDA 3NZ1A 4L9ZA 3V7PA 1SFJA 3GH5A 2F6XA 3ZSTA 3EXSA 4R7JA 3DFNA 3APYA 1E55A 2EG7A 1UHVA 3LMZA 3AHZA 1XC6A 1FCVA 2QYGA 4JTEA 5DCDA 4L6DA 3LS9A 2YL8A 3CQIA 3WD0A 1NARA 1JYWA 2O92A 2O56A 2Z2AA 2J7BA 1O12A 5D2YA 5I00A 4GUFA 4W87A 1MNZA 4QXIA 3N2OA 4POCA 1SO6A 3GNXA 2DSVA 4PB3A 3MI2A 2Z25A 1FWAC 3SUWA 2RGMA 4RE4A 2Y63A 1V7AA 4JTDA 1JYVA 4Z1DA 3MU7A 3QW3A 1UWRA 9RUBA 1LP6A 1QOXA 2PAJA 3DYPA 1GJWA 5FD0A 1RSCA 2F2HA 3LUTA 3OOQA 2B31A 5EKYA 4HYVA 1XISA 1JRCA 1MDLA 5CBBA 4C6DA 2W67A 1ZBKA 4PTXA 2CWNA 3WH6A 1PKYA 1FWCC 1UP3A 2WJFA 5H6HA 1EOMA 3JS3A 5E5CA 3ZYZA 2BXZA 3MUXA 4O52A 1I2QA 1RQHA 1VFTA 2X1SA 4DEFA 2V82A 5CZKA 1NDYA 1UKOA 2E09A 2PE4A 1BF6A 5AVHA 1LCOA 3S46A 3BOXA 4NX5A 2NWSA 2W92A 4O1AA 1A47A 1OADA 2ODOA 4EACA 4AHQA 3C3NA 2ZUVA 3GUGA 5I3FA 2AL1A 2V5KA 2NW0A 2GGEA 3RCNA 3I4EA 4AF0A 4AIEA 1OFPA 1FFQA 5LIKX 1B3VA 3MQTA 1ZCOA 3SJNA 4E8DA 2EGZA 4UTTC 2QCNA 1DE5A 3WQCA 4YMZA 5GQBA 1QTWA 3W37A 4LTSA 1P0KA 2PDXA 4Q4PA 1GVIA 4UXDA 4KWVA 3UF9A 1W1VA 3GTXA 3WLOA 3QY8A 3BUVA 4Z2GA 3W6LA 1JUEA 4XB3A 3EWYA 5HINA 2E9LA 3TN3A 5FEZA 4RK8A 1PX8A 1FH8A 1KXTA 4BK9A 2XWEA 1SZFA 3HQPA 4W88A 2QCDA 2ZUUA 3TZNA 1R3WA 2CPUA 3R11A 1UUMA 3CH0A 2GSHA 1OWQA 4UFLA 5DO8A 4GQQA 3SCSA 3NPUA 2DVTA 4B5WA 4G9PA 3TYDA 3A3WA 3EWBX 1VZWA 2NXIA 1AODA 2UV8G 4LBSA 3IUHA 3VILA 2CBVA 3RYSA 1UC4A 1BGGA 4Q4MA 1EIBA 5BXRA 4J9JA 4BF7A 4BY3A 4GVGA 4ZL1A 1UH4A 4AD4A 2Z1KA 3P61A 2ASHA 4DWSD 2ISSA 2E6DA 5G1YA 1K70A 3AOFA 3OLIA 3F4CA 3T2PA 4FB7A 1QO2A 3IANA 5EMJA 1ONWA 4QE1A 3G1AA 3RJYA 2VVNA 5E0KA 5J5RA 5A8QA 3P8JA 3EX4A 1XLMA 1V3IA 1QFEA 3K4AA 2O55A 3VOIA 3KUMA 4HZ7A 3W86A 2ZX9A 2D1ZA 1E3XA 3C52A 4HKPA 4I9TA 3TQ0A 1B2YA 3VIMA 3QHMA 2YL9A 3W74A 1V3HA 2OLHA 3MSDA 2WJZA 3ES8A 2P76A 5E0CA 1AJ2A 2I5IA 3SB0A 4BI6A 5E1QA 4XVEA 5C5YA 4L6HA 4H8NA 3PG8A 4RDZA 2OELA 5LNSA 3P14A 3EKZA 1NTHA 4S3KA 3RCMA 1R5YA 1F9CA 1L2UA 1UMYA 1TV2A 4J28A 3H70A 1WOAA 3VNLA 3W26A 3RNDA 4ATDA 1KKOA 3BO9A 1C90A 1DJGA 3ZJ6A 1FVPA 4XK2A 3UT0A 5L6UA 1X8FA 2BVYA 4UFHA 5EL1A 3ARYA 4N9DA 1K8XA 1I8JA 1PIIA 1TVNA 2ZRZA 1JFXA 3AXMA 1TQXA 1EJ7L 5DRCA 4Z0SA 2IXUA 3VDHA 4AZCA 4DXKA 4ZEPA 3HJZA 1HJQA 2J24A 5HUOA 4F8XA 3L7RA 2R1KA 1T40A 3FGCA 1X7IA 3AIQA 4KCWA 3H22A 3CQJA 1YBQA 2DIEA 5CLWA 2WMIB 4RE2A 3HTWA 1NVMA 2NVDA 3BAWA 1XLGA 1XFCA 3E0FA 1QI2A 2Y24A 3P0WA 1TVLA 3N9RA 1DJIA 3QN3A 3SECA 3H2EA 3POHA 3LQGA 2ZUNA 3UXLA 3EOOA 5H91A 1OX4B 1A4MA 2H8ZA 3D0CA 2IPFA 2E5CA 3PVFA 3F5KA 3NPWA 1XIHA 4I7VA 4YU1A 1XICA 1VD6A 1T7LA 1K9FA 1JCTA 1O6IA 3CXOA 4GJIA 1LWJA 1T0OA 3CL6A 3QFWA 2UY2A 3TAOA 3RR1A 3DG3A 2EJ1A 3GC2A 3H2NA 4IFKB 3UXAA 5AFDA 4MYAA 2IKGA 4NRRA 2VGIA 3RGTA 4EF8A 3SW6A 5C55A 4TTGA 1WDRA 1XD0A 4WOZA 3ECQA 4GZ7A 3UWVA 4GBUA 4R9OA 3LXAA 2XIMA 2GSEA 2Z6IA 2RFGA 4PCSA 4WD0A 1EOKA 3G6LA 3QGAC 1WDWA 4ZE5A 3VMNA 4MKVA 4OTKA 1K8YA 4KESA 1IEVA 1RBAA 2UY4A 4HNNA 2WQDA 2Q8XA 1P48A 1R87A 4URIA 5ECVA 3F2DA 2Y7EA 4S3CA 4P8XA 4OFCA 1LM1A 1D2KA 1JIBA 3MCOA 5H1WA 1DV7A 2CEQA 4NI3A 1MXGA 1CXHA 4GQBA 2NLYA 4Z1CA 2VELA 4MG4A 1Z6KA 1J0KA 4W84A 3VM7A 3TYZA 1V93A 5HQLA 3U2EA 5CGQA 2FZBA 1OIMA 3N12A 3SCPA 3FA3A 1XH2A 5K9DA 1UWSA 3C56A 4TX6A 1MQQA 4LWWA 1W9DM 1HF6A 2XH4A 2VDGA 2AGTA 3NQAA 1C8VA 3NVTA 3S42A 1XYBA 1ME8A 3KWXA 3WMSA 1DXFA 4S39A 3HN3A 4JNYA 1YE6A 4DO7A 3C0SA 3GQYA 4QEHA 2V9DA 4UOJA 2BFGA 2BGSA 3LI0A 3B03A 3Q2DA 4AF0B 3LCHA 2VZSA 3QF0A 3C2OA 3CASA 1TCMA 3N4EA 2D0HA 1EKOA 4PFHA 1Q45A 2ABAA 4RV8A 4MKNA 2VVSA 1V0LA 1RBLA 1F74A 2OO0A 5JQ9A 5C70A 4CU8A 1XLKA 1J5TA 5FF4A 1BXCA 1Q6QA 4FLQA 1RA5A 3WUGA 4AEOA 4HPJA 1VIZA 1JCXA 1GVOA 1LTDA 5DX7A 1Y0EA 1EUAA 3I6RA 3ANUA 1EJUC 3E2VA 2EKCA 3NA8A 2J79A 2ZUTA 2YZ5A 5EMKA 4CKQA 3DFHA 1ISZA 3MYPA 1O5RA 1OSEA 4NAEB 3UGVA 4QAIA 2E1WA 2E25A 5DEZA 3LCIA 4QQUA 4CGTA 2IUZA 2DUZA 4C6CA 4B2DA 3P80A 1V6WA 2PC8A 3VX1A 1UA3A 3EZ4A 2WKGA 1XIDA 2A6LA 2QDEA 1UWAA 2DZAA 3UEQA 4RDVA 4DUWA 3GIPA 4HHLA 4PTVA 3QJAA 4H9ZA 2PDPA 3FJ6A 2I14A 4N42A 1AZ1A 4H9VA 3DC0A 4KPLA 3ZLGA 1R46A 1EJSC 4KW2A 4JDYA 2VEPA 1WDSA 4LY4A 4N4QA 2AAMA 2FH8A 2ISDA 3QLDA 3ZJ8A 1R2RA 3PP7A 4A8RA 4IHCA 3KCOA 4EXQA 1IT8A 1OFDA 3NDZA 2OSYA 4WSHA 3KBMA 4Q6XA 1J0ZA 4U33A 4MJ2A 4JD4A 4TO8A 2V69A 2OCZA 4YXGA 4CCZA 2YOCA 5I3DA 1PCWA 2WM1A 4QSHA 2VFFA 1QI3A 1ADOA 1ONXA 1DOSA 3TZFA 1VCFA 4GVIA 1SU5A 2PS2A 2PU1A 3XIMA 2JF7A 4YCOA 4JNZA 3BLKA 3ZR4A 4WX2A 1GYNA 2BNJA 4BQ3A 2Q8LA 3N2BA 4ZTYA 4AQLA 2OR2A 1GONA 2I56A 3RHGA 4IMDA 4UCFA 1HKJA 3TN4A 1KFBA 4AZBA 3NQFA 3WJZA 5A6BA 2IPGA 5C7VA 1VHCA 2CHOA 3G3DA 3UA3A 6ALDA 3PBVA 3AICA 1XG3A 3EXTA 4O1EA 3ZJKA 1UR2A 3WQ6A 1DBTA 1HZYA 1HG3A 3BQ6A 3SI9A 1TG7A 4PMDA 1R2TA 4PUEA 4LVBA 3PZQA 3AZTA 3VIOA 4MWAD 4IP4A 4Z08A 3IJLA 5H2ZA 1GZGA 2DSZA 2PDGA 2QCLA 1HL9A 2X0YA 3A3HA 3URBA 2AMGA 1CGTA 1VBHA 1OZQA 4HA4A 4HNVA 3G8EA 3PSWA 3DAQA 3M5YA 3BJFA 1XDLA 3VGDA 4FX8A 4CNUA 4NZ1A 4EAMA 4M3PA 3EX2A 1CGXA 1YXCA 2YFOA 4TVUA 3L67A 3N15A 1A3XA 1UD3A 2V68A 2ADAA 4O11A 4NYUA 3NXLA 1XRFA 1E1CA 3PM6A 2PD9A 1CTNA 1WKYA 3MO7A 2JEQA 4HP5A 4DM1A 1UASA 4PGLA 1J12A 2E3ZA 3O3RA 1UWIA 1E5JA 5T26A 2PF8A 1JEZA 1Z41A 4LSBA 2PBGA 1VYSX 3G1XA 4MNLA 4GO8A 5CGMA 3TNOA 3L5AA 1QDSA 3PJTA 3EDDA 3BLIA 1XLCA 4PUNA 3G22A 1XSJA 4W86A 3SY1A 1WAUA 1NEYA 2TYSA 4IIEA 2XSXA 3MKVA 3P3BA 3WFAA 3VDAA 3LLDA 1SSGA 3V0UA 3REQB 4YVVA 4JN6A 1XL9A 4LUJA 4HMCA 4EIVA 2PTXA 1AL7A 3DG7A 1P0BA 1TPVA 3ATYA 4FXJA 3HGOA 1WZKA 3E2QA 2C0HA 1YXYA 3SUSA 1VS1A 4H1ZA 1XFBA 1HO4A 2NVAA 1ISVA 4ROQA 1DQUA 4L9XA 2ZVIA 4H6RA 2WMJA 3BAXA 4KS0A 1E6RA 3HFTA 4LGXA 2XPKA 1I60A 3NYZA 5DBTA 1MUCA 5KTLA 2V5CA 4XZIA 1H51A 3FXGA 2A0NA 2VX6A 3UJEA 2GYIA 2NQ9A 1AQMA 1CLKA 1EPXA 1OABA 3FYPA 1C9WA 3T07A 5U4NA 2CKRA 3KCLA 3S1VA 4LX4A 3W0KA 3EB3A 4OV9A 3A21A 2GVJA 3LX9A 4OIFA 1ENUA 5IBXA 1S3HA 4XSLA 5ABEA 4JEQA 2F2KA 2W66A 4PTDA 1PHQA 1O66A 5K3VA 3AAMA 3THCA 1TVPA 3QPZA 3RXZA 4AZ7A 3K5XA 3NO1A 1QW7A 1JF6A 2G37A 1OY0A 1DTUA 2BBFA 3NL6A 1LLZA 4QDPA 3S2CA 1F73A 1HXJA 2H8XA 1D3HA 1BG4A 3EX3A 3T05A 3PANA 5L9FA 3R25A 3VO0A 2OZ0A 4MVAA 4CD8A 3HOJA 1TPUA 4Q7IA 4P7LA 1OT2A 4ES4A 3I3BA 1AW5A 4MMWA 3QVQA 1E15A 4O8RA 4DI9A 3CNYA 2ON3A 3W4RA 2OWWA 4O50A 1YW1A 5JUVA 1CW2A 1ICQA 5HXMA 3LENA 4JQAA 2BHZA 6XIMA 3R8GA 2PDMA 1LUCB 2PDBA 3OZYA 4JCLA 1GCYA 2VUNA 2Z1BA 4PCNA 1SZEA 4CUCA 4NUWA 4LC6A 4RLIA 5HOSA 1QPQA 3TW6A 1VLIA 4CQ9A 4L56A 1GKQA 3ELFA 4L5ZA 3B97A 3JZUA 1QOQA 1Y8BA 5D9OA 1U22A 3QTPA 3S5NA 4AX7A 3IIXA 1E0XA 4R3UA 1ZZMA 1M5WA 3GD6A 4HPGA 3WLTA 3WQDA 2OLAA 2O4QA 3G6MA 3LQLA 1JPHA 4O12A 1RALA 4ACZA 2F6UA 2WVVA 2O9TA 2OEKA 1VR6A 5C0QA 4RW3A 3W71A 2J27A 3ITOA 4JYFA 3U2ZA 5CKSA 3LPFA 4LAOA 3QV7A 3LD5A 3QR1A 4ICMA 1ZUAX 4KGJA 4A4AA 4PMYA 3HJEA 2OQYA 3RPDA 1KV8A 2Q6ZA 2OQHA 2DZPA 1GPWA 1M65A 3RMEA 2G0WA 1IT7A 4PSRA 4E3VA 2WMGA 1K02A 3EA1A 3S47A 2I5QA 3C61A 4FNTA 2I17A 3IACA 1EJVC 1KWGA 2QHAA 1OFRA 3AXHA 1GVQA 4B5NA 2DY3A 2DUXA 1VFOA 2G95A 3MDUA 3CO8A 1MXSA 1JCNA 2BMBA 2ANUA 2Y70A 3LHWA 4N9BA 4GXMA 1FFRA 1LOLA 3GSMA 2CKSA 1FA2A 1OBAA 3FS2A 1ZU8A 4B5TA 3LRKA 2OPJA 4GNVA 5AC7A 2WZMA 4M7TA 5E9AA 3UG5A 1TTQA 1QU4A 3CUXA 4AW7A 3CZLA 1UUQA 3VD5A 1WZLA 4OE7A 1Q4NX 3CLWA 4J3VA 4JY8A 4K3ZA 4S3GA 3QBUA 1CYGA 4DRSA 2WYSA 2NX1A 1DJZA 4HOWA 3STFA 1VH7A 3MUZ1 1XLAA 3MCMA 3PZ9A 1Q6RA 3ARXA 5DXYA 3HBLA 3P74A 3UCQA 4C6BA 2IMRA 5I06A 3GXFA 4DLMA 2NLIA 5JXQA 2X1TA 4LB3A 1AL8A 1UJPA 2PP1A 2XH0A 5AYIA 3BAIA 1CLXA 4GNJA 4AIOA 4FALA 1PBGA 3ZSSA 4GX9A 3L9CA 2YSWA 1VPQA 3B4YA 2E7FA 3IGHX 5E09A 2YYTA 3APTA 2BODX 1KRCC 3AZSA 1ME7A 3DEQA 2YA2A 1R3RA 1O68A 1LQAA 4NQ1A 2XU2A 4FSAA 3G1VA 4QDMA 1KM2A 1XI3A 3M0LA 3UWYA 1US0A 5D37A 3I7RA 1W0MA 3IRDA 2BSLA 3LTYA 4RZ6A 2ZA1A 4F79A 3MMWA 3N6QA 4HNUA 2VTFA 4TUFA 3LPPA 3VIIA 4JKKA 3W2JA 3W1XA 3N13A 2Z6JA 3NTYA 4MM1A 1FXQA 2J25A 4DB7A 3GHRA 1GQLA 1V02E 4K1WA 5BU9A 2WKJA 3KOZA 1TV7A 4AC7C 3TKFA 3AJ7A 2CERA 3M6DA 3WDPP 3EDJA 3QEZA 1RJPA 4RPPA 1DTNA 3RIKA 1VFSA 4QLJA 4G7FA 4GH3A 1EH9A 2Z24A 2VEMA 3A6OA 4DHGA 5HATA 3CUGA 1QI5A 4ZO8A 3CT7A 1TR9A 1XLEA 1Q13A 3K13A 3VMOA 4UNKA 1WP6A 1ZALA 2QPUA 3K8KA 4ZBCA 3ZR6A 2AMXA 3SR7A 1W56A 2EPKX 5F1VA 4ZFCA 1OFBA 1ITQA 5AYZA 2VX7A 4R34A 3GXNA 4JTQA 2ACRA 3RK8A 3T2OA 3UBPC 5GNZA 2CU0A 3ABZA 3LXCA 1PKLA 2F8QA 1JCYA 3C6CA 1EIXA 1OB0A 4EE9A 2ZOXA 3IARA 3VIJA 3GVVA 1H49A 3WDQA 3W6MA 2I1OA 1UR1A 4Y7EA 2DZWA 1I45A 3M9YA 4IJBA 4QJ3B 2DIKA 1VJZA 5A69A 1JXJA 3TH6A 5BROA 2XSBA 2D22A 4M6QA 4HCDA 3BSHA 4P7RA 2QF8A 2XVGA 5G1TA 4Z2HA 1XLBA 3TC7A 3MCNA 3AU2A 2ZZ3A 2VJXA 1HN1A 4E2OA 4M1RA 5IBXC 3FXYA 2GQ8A 4FPSA 3IS4A 3OODA 3RAOA 1Z8AA 3N1AA 2OZ8A 4U3AA 2QDDA 1DP0A 4E2VA 2F7FA 1FDZA 1FP8A 4AU0A 3NZRA 1X7FA 1A3WA 3PUDA 1X38A 3N2TA 1XLHA 5ABGA 2WLZA 3UXIA 2GJLA 4JKMA 1EP3A 2G3FA 5C71A 1NQ6A 2G8ZA 4Q32A 3ARZA 2BDQA 1QW8A 2E5BA 1OX4A 4YS1A 2YCJA 3S1XA 4Q8TA 1E4IA 3KOXA 4D6JA 4RPQA 3CIXA 2DZXA 2GJXB 4AAJA 3EPMA 2PGEA 4HOXA 3H55A 1JUKA 4YTQA 3HQ1A 4DZ5A 2O4MA 1P4CA 7TIMA 2E8YA 4N02A 1X1ZA 2ZRWA 2VNCA 4FNRA 3LCWA 1IT0A 4Z0JA 3NGJA 1XF0A 4Q8WA 4HA1A 5CLTA 2Q09A 3II1A 4CNNA 3MP3A 2IPJA 1RVKA 2VQUA 1QNOA 1YX1A 3V1PA 3GIYA 2A2IA 5HPCA 3FLUA 1E0TA 2AKMA 4IJRA 1AVAA 1MUMA 4IFRA 1POKA 3PJWA 4CU6A 4RNFA 4AWTA 3NJ3A 2DORA 3NQ6A 1UB3A 4UWMA 2Y5JA 4WOQA 4KEMA 2VGGA 2QMKA 5AHEA 1EB3A 1I2RA 2HWGA 3AO0A 3W1UA 5KSWA 3GO2A 1Y5VA 2J88A 3KE0A 3RRXA 4PMVA 1VRXA 3LI1A 3FJLA 5KZDA 3W72A 3BZJA 2GQ3A 3UA4A 1ECQA 1RVGA 2WPBA 2PGFA 2A3BA 5F7UA 5HPOA 2NT0A 3KL0A 2OB3A 1BG9A 5ABFA 1HVXA 1E1EA 7ENLA 5BRPA 4C1NB 3M41A 1UC5A 1E40A 3WJSA 1OC5A 3UERA 4NX0A 2PGWA 2QGYA 5K9CA 3F5LA 3WG6A 4BR1A 4M19A 3W7GA 4K36A 3SCQA 2EPOA 2QS8A 4O10A 3B9DA 1H41A 3WUEA 3TLQA 2PDHA 3P62A 4GMEA 3SQMA 4HA3A 1O1ZA 3TOYA 1OD8A 3UPWA 1GOOA 1ZPTA 1TFVA 3U4FA 1TPWA 3E6EA 3W87A 4HD5A 2HNHA 3W73A 1TREA 1TUXA 4JS3A 1SZGA 2ZUMA 2YW4A 3I6EA 1TCDA 4PRTA 3CHVA 4XV0A 3R0DA 2BASA 4OVXA 3PNUA 5MKGB 4X61A 2PWDA 4MB3A 2OO6A 4P7NA 1QPNA 3BARA 5A8PA 3AROA 5CH9A 1XSKA 1GOIA 5C54A 3V75A 3WK3A 2DT0A 8A3HA 2H90A 3FCPA 4RNJA 3L4VA 4GH1A 3KVKA 4W9TA 5JBFA 1X97A 4HHHA 1G4TA 4GUIA 1JDCA 3KEHA 5LIWX 3WBWA 3BURA 4HNOA 1VBJA 5H8PA 4H8HA 4QLLA 4GVFA 3NQCA 5C2GA 3BTNA 4V1YA 4MPKA 1ITUA 3B06A 2V2HA 4DBSA 2HPIA 4US5D 4WJXA 4NP7A 3L5LA 3PC0A 2GVEA 3OO2A 4Q4RA 4IGNA 3GNPA 2EEXA 4O14A 2DIJA 3KZSA 2BOGX 4DWSA 4HNCA 4YYCA 3DIPA 3QFEA 4LH8A 3NZGA 3HPSA 3IJQA 5D9PA 4IMEA 4ZQRA 1KTBA 2C19A 1CB7B 5J5DA 4JFTA 1R0MA 1A5AA 3UR2A 1O5QA 4UTLA 3UPBA 2BY3A 1XXXA 3NUKA 2G41A 1VEMA 2BTMA 3SGZA 1KBLA 2OG9A 4E4PA 1SW7A 1V0MA 2O7SA 4REQA 3IIPA 5FJJA 1W37A 3DHPA 4MY8A 1I2PA 3QV6A 1KBIA 4A3HA 3QR3A 1E0WA 1UA7A 1LL4A 1MDRA 2V81A 2WCGA 2C7FA 1IYXA 1UZ4A 3GBDA 5BZAA 3PBMA 3O05A 3ZVHB 2R1PA 3AMGA 4KFPA 4TXEA 1R6WA 4CN6A 1G9HA 1XR2A 2VFIA 3WLKX 4MADA 1EO5A 4PODA 3ERPA 1P43A 5D2VA 4X0NA 1EUNA 5EY5A 4Z1YA 2O0TA 5DFAA 3AIRA 4MUPA 1LRQA 2TSYA 5FEXA 3PZGA 1TWDA 3AFBA 1QW9A 1EQPA 2WSPA 5M1TA 2CLHA 1KFEA 2I7GA 3W23A 3UJFA 3SY5A 3H4XA 4ONVA 3JW7A 3PF3A 3VIFA 5ENLA 4S38A 3QHNA 3TE9A 3OYXA 2VWSA 1H62A 2CBUA 2BXVA 3U2OA 3JZEA 1SSDA 3EWUA 3T4WA 3WH8A 1S5NA 1PAMA 1Q63A 4I90A 2POTA 3W2KA 1W3NA 5HULA 1W1PA 3ZFHA 3OA5A 4IIBA 2YXGA 4QHRA 3MHGA 4PMUA 2QJHA 3E12A 2OX1A 2TODA 1AQFA 1F07A 4JOMA 1MW0A 3LXBA 1BKHA 4K68A 1XM3A 1Q65A 4J1OA 3W82A 4XKYB 2VURA 4MOZA 2NV1A 4QLKA 3GU1A 3BLEA 2DFAA 3ABRA 4F66A 1L6YA 3W1TA 6XIAA 4CN1A 1SW0A 5CZ0A 1GTHA 3G0UA 1OYBA 1R30A 3GDLA 2GFTA 3I4KA 4KQNA 3TK7A 4DJDA 4JTFA 4Y6GA 1WPCA 2A1YA 4O18A 5LA0A 1B4KA 1DHKA 1N2VA 1R7OA 3UP8A 4I8DA 3CB8A 1HP5A 1R3QA 3RPTA 3DOPA 2X0SA 3OJGA 2YLAA 4CEUC 3LNPA 4MFEA 3AMKA 3K4WA 3W6YA 1EF3A 1IXQA 1RP8A 3VGGA 1L9WA 3ITGA 3BDKA 4IP7A 4J2PA 3BG9A 2A3HA 2QEZA 2TRSA 2XM1A 4BZYA 2C3ZA 3VOFA 4YTSA 1K9DA 4TMBA 3QGVA 2F9RA 5JBDA 3N25A 1K7EA 3SURA 4INFA 3KTSA 1TO3A 3H2MA 1FDJA 3WMBA 5DQPA 4BQ5A 3DGBA 1OCQA 2YPIA 4ZENA 1BAGA 3S5SA 5KINA 3KWSA 3QZEA 4TX9A 1B3ZA 1KWKA 3R2GA 2HVMA 3TOPA 1T8XA 4A2SA 3GHSA 1XIGA 5FJRA 4E6MA 4P61A 3MW7A 3OB8A 2WZTA 4IL2A 4YTRA 1PXGA 2AKZA 4R5EA 1WQ5A 1EC8A 5TQLA 4IT1A 1CX9A 4U5KA 2FFIA 1S38A 1P6BA 3MVTA 3NSNA 3PSVA 2HEJA 3QC3A 2BWGA 3HA1A 2FHFA 4RCXA 4A3QA 3G1DA 4JQ2A 1YDNA 4J3UA 3GTNA 3QPEA 5IM51 5LNRA 5C6MA 4JKLA 1JNEA 3NSXA 1DWGM 2WK2A 3CIWA 1R9ZA 4QJ4B 4W5UA 3IEBA 3OEXA 2H9AB 4OECA 1M7PA 3GFZA 2VCCA 1TMQA 1XWYA 4AXKA 4H19A 3S6OA 3W7QA 1KM1A 1PSCA 3KOWA 2PD5A 4G8TA 3TNBA 4Z2LA 1XPYA 4DF1A 1EJWC 2PMQA 1WKDA 5I24A 1OFEA 3WLRA 1FWRA 3M5ZA 1FHDA 3TA9A 3NYDA 3N6HA 3VE9A 3GNOA 4XAFA 3WLJA 4GC4A 3NXFA 1BYBA 5I3IA 4OT7A 4MWAA 4M1BA 4NZFA 1E73M 2A21A 4YWIA 3T40A 2WW5A 3QRHA 1EP1A 3L4UA 3UWWA 1PDZA 4EANA 4ZSTA 3A22A 1REQA 1T41A 1JXKA 2Y4SA 2CW6A 2YXOA 4J27A 3P7YA 3ID7A 1RJQA 1QNVA 1W1TA 1EXBA 4B91A 3VD4A 2VUYA 3QQ0A 2Z27A 4HTBA 5D03A 4GI4A 4MUZA 4GINA 2BZNA 3PFRA 4D1IA 1AA1B 1D8CA 1DXIA 2P3ZA 4PE8A 2VD8A 4XD6A 1R9YA 2FPYA 4G56A 3AQUA 1XKJA 4GZIA 3LNMA 2OWXA 1EZ2A 1B90A 1F61A 2PEVA 3V5CA 3LCGA 3C2EA 4QX4A 2QIIA 1VBRA 2WZEA 2PWHA 4MB1A 3FSTA 3ALFA 1LBLA 3U7VA 5MHBA 2PRHA 3GXIA 3CUJA 1KKRA 2EJAA 4UTMA 4JQ3A 2C6QA 4DZIA 2DZTA 4J3SA 2GVYA 3IJDA 3PS7A 4M29A 3HGRA 4B4FA 2VYOA 1IIHA 3SCVA 3WFZA 2QVNA 1ZSXA 1FH9A 3A13A 3HURA 2X40A 4GVHA 4CU7A 1V8EA 1C92A 4LU0A 3WQPA 4F9DA 4W4QA 4W7UA 3AHVA 2VC6A 1X1OA 1DQXA 2VWTA 1IWPA 3T55A 2W61A 1E71M 3N19B 1NWUA 3MPGA 1MRQA 4JL2A 4M56A 3CUFA 5D2TA 1F05A 2XIQA 5CPMA 3GTFA 4ZGYA 1UKSA 4GY0A 2HZGA 2FPTA 1GVSA 4I5RA 1DIDA 1XBVA 2YR1A 4Q3MA 5HR6A 3VPLA 1V08A 1LQ0A 3LHYA 3FK4A 3OZPA 1VFFA 3DCPA 5HJXA 2XIIA 1JJKA 3SCUA 1MEHA 3MY9A 3H2AA 3RM9A 2WVTA 1BWKA 2ZYFA 4IIHA 1QASA 3DC8A 2HK1A 3U0HA 3AYRA 4UQAA 2CZDA 4H7ZA 1J01A 3UETA 2VR5A 3O6DA 5F2IA 5BMWA 5A6LA 3WQFA 2QUMA 2CZFA 1BKSA 3FA4A 4ICCX 1LWIA 3IAPA 2FDMA 1JNDA 3ZR5A 1KM6A 1V6XA 1SJAA 1Q6CA 4OZOA 3UJRA 2PSNA 4M6VA 5AC5A 2BLEA 3VUSA 3BH4A 3Q67A 4ZA0A 3D6NA 4XD5A 3WF0A 1K4HA 1SM9A 2NXGA 2GLKA 3IGXA 1FWJC 1O94A 4F2TA 3GG1A 1XYLA 3SN0A 9XIMA 4QE4A 3M0KA 3QMRA 2ATSA 3MANA 3WUBA 2RH9A 3ZJ7A 3G24A 2J7HA 1V4YA 3BLOA 2FZNA 2DEPA 1QATA 3MUIA 2AQWA 3UWEA 5IFPA 1TPB1 4B5SA 4F9JA 4IXXA 3U48A 2E5DA 4L64A 3DHDA 3B8UA 5LIXX 5D02A 1PZ3A 1RP9A 1ZRQA 4KMQA 4FIRA 2V5JA 3H2FA 2QJMA 1VPXA 2ZXBA 3B40A 3OVGA 3FFSA 4AZ6A 2FZ8A 3UR5A 3EEZA 4H6QA 4GWEA 3DFQA 1P6CA 1JDEA 2J13A 4LYKA 4E2BA 1SQ7A 1V5XA 4L4OA 5IXEA 3AYVA 2P5NA 2CLOA 3F03K 1WDDA 1YDYA 1M6JA 4BHYA 3NVDA 3AZRA 4C6EA 2PDCA 1S1PA 2GK1B 1FCUA 1GHRA 2QVHA 2PLJA 5HQEA 1Q8JA 3M6YA 2JEPA 3ARRA 4IIFA 5CBIA 1ML1A 1FKWA 3KRSA 4IIGA 1MZHA 3W02A 3IAQA 3DFYA 4PUMA 2F84A 3UCCA 3EKGA 2B81A 2WBGA 3ZT7A 2FHBA 5CXPA 6PTDA 2QULA 1ZBVA 3U5YA 2ACSA 2GDQA 5K7JA 4QQ3A 3VNYA 4JX4A 2AGKA 3NSMA 1GOKA 2WMHA 4QCFA 3G77A 1AD1A 4MLRA 3TN5A 4W93A 4DO4A 1JZ7A 1N8FA 2ZE3A 4U2ZA 4GABA 5FA5A 5M17A 3WL1A 3CQKA 4OGZA 4ATLA 3LPOA 3HG4A 1EO7A 2Q3OA 1PKNA 3SADA 3K46A 4IG2A 1GT8A 1NM9A 3SEPA 1P7TA 3H24A 1L6FA 2OKTA 3NOYA 2ALDA 1XYFA 4ERAA 2P8BA 3NQ7A 1SPQA 4R7WA 1RLCL 4FLRA 4K39A 1AMKA 3PBYA 4I5XA 3KOFA 1RHCA 1J79A 1ADDA 2TPSA 4PMRA 4MWAB 2CLKA 2Q71A 1T8QA 3DH7A 4RW5A 3TQPA 4TVDA 3CIVA 4IQDA 4V2XA 3RU8X 4R33A 1RCQA 3T81A 2A6NA 3TTYA 1ZB5A 4Q8MA 2WV8A 4B4HA 3O16A 1XQKA 2Y0FA 5D8WA 3CPGA 1IEQA 1CB2A 3FKRA 4GY1A 3UD6A 3NDOA 4GPNA 2HSAA 4W5ZA 3F2CA 2VRKA 4OHQA 1HQTA 1TZZA 4GUJA 3BJTA 3KBSA 1OIFA 5A6BD 2NXHA 5DCBA 1S5TA 3LZ5A 4MJZA 2FTWA 2CETA 3PZUA 7REQA 4ZB2A 3G1FA 3VX0A 4C1NA 3QXBA 1FKXA 1K8CA 4EXAA 3K1GA 1GEHA 1GWJA 3L0NA 4HT3A 4J7RA 5B7YA 2QDHA 2FMOA 3BLLA 8RUCA 4NY2A 1TX2A 4