3I7SA

Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
292
structure length
292
Chain Sequence
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIREATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How essential is the 'essential' active-site lysine in dihydrodipicolinate synthase?
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
total genus 107
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3i7sA00
1FCQA 4O1CA 3TSMA 5LNVA 3FJ6A 1TTQA 2VFFA 1FXPA 4A2SA 3TQ0A 3GAYA 3LTPA 3LCIA 1Z44A 2Y61A 2E5BA 3L65A 2YGYA 3NR0A 2E6FA 3W7JA 2ZTKA 2VFIA 1B9BA 2ZRXA 2ZZ1A 3UNDA 4UMAA 4AMAA 1PHQA 2P0OA 4N9BA 3TR2A 3E49A 1ICSA 1DORA 4E38A 2QCEA 3MO7A 1EWDA 5G5IA 4E0CA 4UR8A 5D32A 3ABRA 4CQ9A 3P62A 3L5AA 2A7RA 3LHWA 3TJLA 1L9WA 1K02A 3LBCA 2GJNA 1LTDA 3NA8A 2A1YA 2NUWA 3IIXA 1H60A 3BW3A 4FIRA 4FNUA 1TTPA 4GUFA 1ZAHA 1ME9A 1KTCA 4JYFA 3EWYA 5HJLA 1SQ7A 3DFNA 2E6YA 5I3HA 3OVQA 2ZFAA 5BNKA 2ZYFA 3O1NA 3M41A 4TU1A 3FA5A 4RR4A 3N9SA 3ZS4A 1QPNA 1ZFJA 1W54A 3PBWA 5F1UA 3FIGA 4YMZA 5LZLA 3HF3A 3Q37A 3W1TA 3K30A 4CCDA 4N9DA 4RXFA 3R2GA 4CNNA 1JCNA 4IX2A 3FFSA 4ADSA 3W70A 4O1AA 4DBEA 3RU6A 2B7OA 2XN2A 4A21A 3MP3A 4ZQOA 1I8JA 1MO0A 4IMCA 4X9SA 1KM2A 3LHZA 2V30A 3FKRA 2X1TA 4LVGA 2EF9A 4XWUA 3VKJA 3SGUA 4BI7A 2GPTA 3S42A 4O1BA 4HNUA 3NYZA 2QCLA 1WA3A 1KTBA 3NZRA 1N8FA 4U4MA 5HNRA 2CLEA 4YXGA 2DJLA 4FEZA 5FESA 4ZQNA 1C29A 4PL1A 2BX7A 1VLIA 3DZ1A 4UFLA 1A5BA 1LOSA 6TIMA 1SW7A 5CPOA 2I1OA 1TB3A 5AYYA 4N9EA 4AWTA 4G1KA 4O4VA 2NX3A 3W7PA 5EL1A 1JRBA 4QM1A 1IIHA 3LRLA 2QDGA 3W1MA 2OT0A 2V81A 1OHLA 4LVBA 2TPSA 1GTHA 3QPZA 3QQ1A 1W31A 2QJGA 1KBJA 2J88A 2QCHA 5DCBA 5D05A 4UIOA 3IIVA 1GYNA 4K39A 2FDSA 3CPRA 3VFLA 3PR2A 1QNVA 5F2LA 5C5YA 5IBXC 4QISA 1A50A 1W5NA 2VC6A 3USBA 4O19A 3W7RA 3FS2A 3N34A 1VPXA 2WSQA 1FWWA 1ZHAA 3LLFA 4Z0JA 4AHPA 2LLEA 2X2GA 2FQIA 1XBXA 3KVKA 2E6DA 2FJKA 3FLUA 1H63A 1W3IA 2WO5A 5AHNA 2X16A 1FCUA 4C1KA 5K4ZA 4HNNA 1DOSA 1M7PA 1O94A 3RLVA 4PFMA 1D3GA 1OF6A 3L9CA 3QH2A 4Z1AA 4NUWA 4QIUA 1RQEA 4GWEA 3CEPA 4OT7A 1OFPA 1YXDA 2E09A 5BMWA 4MY8A 1GPWA 1UBSA 5LSMA 1SW0A 2EAWA 1DKWA 1VCGA 1VGAA 3TU9A 3TFXA 3NQAA 1LRQA 1I4NA 4H4IA 3E12A 3QF0A 3FEMA 3LXBA 1KLYA 4CCEA 1M6JA 3I65A 4O12A 1FWNA 3SZ8A 1HO4A 2C14A 3Q94A 2CZEA 1KBIA 1TPEA 1YADA 1KM0A 3W85A 3UQNA 1F7BA 4AB4A 4JS3A 2YYUA 6ALDA 4Z1CA 4JYDA 1WOAA 1QR7A 3NPVA 4Y9AA 4ZQCA 4DPPA 5GVJA 4LUIA 1EEPA 3UWQA 1SFLA 3E0IA 3UWVA 1OFBA 3W84A 3FYOA 3W1QA 2FTPA 2ZA2A 1ME8A 3PB0A 2ISSA 1QO5A 4N02A 4O11A 5AOUA 1XL9A 3TW7A 1RVGA 1PE1A 1QOPA 1YTDA 3M9YA 1LP6A 4M6VA 5U7SA 1YDOA 2UV8G 4LS0A 3G8RA 3P8IA 3W2JA 1HFBA 3M6YA 3M5YA 3N73A 3GKFA 3MI3A 4LW7A 2E68A 2HS8A 4GUIA 5G2IA 2O7QA 4EVZA 5LKYA 2VEMA 3LCHA 4MZ8A 1JUBA 1KFLA 2DZXA 5F2MA 4WZHA 3LCLA 3RLUA 1K8ZA 3GNNA 4BR1A 2VFGA 4O4WA 2ABAA 4P2VA 3W7EA 4GRSA 1XUZA 3L21A 3N9RA 5K2ZA 3EX6A 4QSHA 1FDJA 2J6XA 3GK0A 4UFHA 5AHFA 2A85A 1K03A 1TO3A 3G22A 2WSRA 2A7PA 2BXVA 4UTKA 3W9ZA 1XI3A 2BTMA 4LV9A 7TIMA 5KTLA 1T96A 3CWNA 4N6FA 5D33A 2V8ZA 5HMSA 1IXQA 1ONRA 3NOEA 3WK0A 1TV7A 1K7FA 2CZFA 4JR5A 1VYSX 2V2CA 3NQ2A 3HMJG 5K9DA 1A53A 2Z6JA 1AW1A 4K38A 1L6SA 2Y89A 4O10A 1RQBA 5EY5A 5D2TA 1PS9A 5K7JA 3LGEA 1V7YA 4BK9A 3QEZA 4CCCA 3DHFA 1KM5A 5KITA 2A0NA 4IMEA 2QDHA 5K9XA 5D30A 3DBPA 4ONVA 3DI0A 5CPNA 1FWTA 1G4SA 2FFCA 3B8DA 1JCMP 1UJPA 4O15A 2TSYA 1B4KA 2P10A 3W74A 1TRDA 1D3HA 3G3MA 3QYQA 1H7PA 1XKYA 2YFNA 2ISWA 5T26A 3HGRA 3EEGA 3TROA 3PUEA 2HSAA 5FF2A 4HNVA 4DO6A 3MHFA 1H1ZA 1WBHA 3G24A 3KAOA 1F76A 4JTTA 3B4UA 1PHWA 4QJ1A 4Q33A 4OBTA 4JTLA 5HR7A 1ZAIA 4E2BA 2RHGA 2C15A 4UTWC 2Y88A 3T55A 3NG3A 1BTMA 4JTEA 3W7IA 1FUYA 1G69A 1VYPX 3O06A 4Z08A 3B05A 1EWEA 2WNNA 5C55A 2H8XA 1YXCA 2O7SA 1WYIA 2JKEA 4ADTA 4A22A 1CI1A 1ALDA 3EKZA 4IGHA 5CPLA 2WOQA 3BK0A 1KFJA 2CLKA 4MZYA 3LCFA 3WJSA 4K8HA 1QO2A 2FB3A 3C6CA 5K4XA 4XBSA 1O5KA 1H1YA 3W07A 5F4XA 3EB2A 3UWZA 5I3IA 4JY9A 2R94A 3LV5A 3LXCA 3BW2A 2V5BA 2HTMA 1OFAA 1S5TA 1R47A 8TIMA 4O53A 5AHEA 3KVJA 1EA0A 1VC4A 3GAKA 2FLIA 5L9FA 1VR6A 2CW6A 3W76A 5CZJA 3S5OA 3TMQA 3PBYA 3ANYA 4UTJA 2FB2A 4UTMA 3IIOA 3EXSA 3TH6A 4ADUA 4FNRA 4PC8A 1WBJA 2ZDRA 3G3DA 4WD0A 1P1XA 4NQ1A 5G2HA 3O8AA 3MJYA 3G1DA 5DBTA 1TTIA 3VE7A 1MSSA 3M5ZA 4JN6A 3MUXA 4BI6A 1R2RA 1XUUA 2OCZA 3P82A 3GNDA 1AL8A 1ZAJA 1NF7A 1SZGA 5DLCA 4FXSA 1SPQA 3H54A 4JD4A 1C9DA 1IIGA 5LNSA 1OABA 2G96A 4UTTC 2ZZ5A 1GYLA 3GDMA 3NQ7A 3IEBA 1DV7A 2X1SA 3R12A 1ZCOA 1ICPA 3W1NA 5F1VA 3PUOA 3LI1A 1IGSA 1PIIA 1EX5A 5A8GA 4M6PA 5DY2A 5I3FA 4AWSA 5FI8A 4FNPA 5CSSA 3T4CA 3SFKA 3BGJA 4XTIA 3F4WA 4BWLA 4GUGA 4DXVA 5DCEA 3L66A 1J5TA 4TX9A 1QCWA 4MYXA 2VENA 4IOTA 3NZ1A 1KFBA 2QCNA 4HSOA 3TKFA 3DKLA 2F7FA 3CU2A 3THQA 3UZJA 5CKSA 5H2ZA 3QSTA 5CZ0A 1HO1A 1JCYA 1GOXA 3I7SA 3ATYA 4JX5A 1LCOA 3W2LA 1EP3A 1D9EA 3AO0A 5CPMA 3UXDA 3KRZA 4KKXA 4U28A 1Z41A 1P4CA 4YCOA 3LERA 5G1TA 4AEOA 1J4EA 1Q3NA 2QJHA 2ZZ4A 4DF2A 1DVJA 4FNTA 3B0PA 5C54A 3M7WA 3W7MA 1K7XA 2E5DA 3ABQA 4TO8A 5IBXA 3W1AA 4N9CA 2Y6ZA 2FPVA 2X1RA 5LGZA 1DBTA 3JR2A 2ZRYA 3S1UA 4EWND 5DELA 3IVTA 3P74A 3G0XA 4DBDA 3NNTA 1FY6A 4BF9A 3PULA 2W79A 4KFOA 4XTDA 3HQ1A 2I14A 4O0KA 1A5SA 4IXXA 1Q6OA 4Z1BA 1XM3A 3ZWTA 1JCXA 3HPSA 1IXNA 5KZMA 4FXRA 2ZZ2A 4DO4A 4JIQA 4JXCA 3A21A 3E02A 1TPDA 4WXZA 2GQ9A 1ADOA 3NGJA 4M7TA 4NNCA 1GG0A 3W2KA 3MP4A 4MLJA 3L2IA 2TMDA 1JQXA 3GDRA 1WX0A 2ALDA 3PUDA 1RZMA 2QCDA 3LLDA 3GXNA 2PE4A 2DP3A 1O95A 2QEZA 3QJAA 4M19A 4UR7A 2V2HA 4RJEA 1TIMA 1ZNNA 5TQLA 2C1HA 1CW2A 2BLEA 3L0NA 3CIXA 3R8RA 4UXDA 3NEVA 2YYTA 5E1QA 4QNWA 3PM6A 4MIMA 4WJEA 2XFWA 3W1LA 3QW3A 4MUZA 3G0UA 4MVAA 3VCRA 2CFFA 3THAA 3GDLA 3TQVA 1AMKA 2ZRZA 3DI1A 2EPHA 3D0CA 1SW3A 4JTUA 3F1QA 4TMBA 1TSIA 2BZNA 1TPH1 3I68A 3WJYA 2FPYA 3C2RA 4AAJA 2WV8A 1WXJA 2A6LA 1F2JA 1F73A 5F2IA 3FOKA 3UWWA 3EWBX 4MY1A 5EMUA 3P60A 1IXOA 3PAJA 4OQVA 2B7QA 3PB2A 1FXQA 3YPIA 3EKLA 5KZEA 4MPQA 3UD6A 2NX1A 1X8FA 3ABSA 3UXAA 1K7EA 3WK2A 3UWYA 4EIVA 1QPQA 3ABOA 1L6YA 3IRDA 3P8JA 3MYPA 2OJPA 2G5WA 3C52A 4OV9A 1XBZA 2E77A 3TAKA 3UYCA 5EYWA 2NXIA 3DXIA 5AYZA 1TPC1 1U5JA 1QMLA 2YW3A 3OIXA 2NXHA 3RK8A 4AF0B 4RXGA 2DZWA 1RPXA 3A5VA 4UFKA 5KMYA 1FWRA 3HG2A 3QMSA 4IJBA 2BSLA 1OK6A 2ISVA 2W6RA 1SO3A 2Q3RA 1H7NA 3W75A 2B0MA 5KZDA 2ATMA 3W7NA 4UFMA 3NDOA 4GJ1A 4JDYA 4S2CA 4CLMA 1TPFA 4AWUA 1AG1O 1TJPA 3TXZA 2VEKA 4KWVA 5AC6A 3M44A 4JTJA 4NVTA 3OG3A 3O6DA 2ZRUA 4R53A 2Y63A 4JTIA 4RLIA 4W9TA 2GVJA 1LRTA 4M6QA 1M7OA 5KSWA 3C2VA 3PSVA 1T0OA 4WQ6A 2Y85A 3GR7A 3KVLA 3UY8A 4IMDA 1YPIA 3GLCA 3S5NA 2EKCA 1JCJA 4MYAA 1JULA 4JNMA 4JTHA 2QKFA 3JS3A 4EOUA 3E96A 3EXRA 2Q8LA 3IV3A 3EX2A 2FIQA 3Q58A 3P67A 2NXGA 2NX9A 3G18A 5F4WA 3W3OA 3WFAA 4S2BA 4GUJA 3LM7A 1DL3A 3HB9A 3G1XA 4Z0SA 2J9ZA 2TYSA 3EX1A 4KWWA 3UY7A 4NJJA 4D2JA 5G4WA 3SY5A 3STGA 1XDLA 1GWJA 5FF0A 2RDTA 4WY0A 1OFOA 2QF7A 3W23A 3QQ0A 1W5PA 1J2WA 2WKJA 4JTKA 2KZHA 4NJHA 1TV5A 4NZFA 5LNWA 4XBKA 3I7QA 3TJXA 1BEUA 5G1YA 3DKJA 4M5PA 2E5CA 3LXAA 1SZEA 3LRKA 1NFBA 1JUKA 1GVRA 1AW2A 1RQHA 2CZDA 3TK7A 1FX6A 4DPQA 2WNQA 5SWUA 1KFKA 3A9IA 3KHJA 4QNEA 5HR6A 4WOZA 3V75A 4PCFA 5FF4A 3ZFHA 1YPFA 3C56A 1H51A 1SO6A 3M1ZA 3STFA 4XKYA 2FPTA 3WK3A 2DORA 1RV8A 2ABBA 4N4QA 1XFBA 1ML1A 2DZSA 4RZ6A 3ZR4A 1R30A 1G7VA 4H6KA 4O14A 3Q2DA 3UZ5A 3W83A 2ZA1A 2YCEA 2V9DA 3EWZA 3GB6A 3DHDA 4O13A 4O52A 4NX0A 3HPXA 3W7KA 2QCCA 4GC4A 4HHPA 1OYBA 1W56A 1H7RA 5LHFA 1UB3A 3HO8A 4MFEA 2V0TA 3OBKA 5AFDA 3MBDA 4P61A 4K37A 1I2OA 3BG9A 4IXHA 4MY9A 4YCPA 4R34A 2WQPA 2E6AA 1TYGA 1OX6A 4FX7A 1OK4A 3NAVA 2CLIA 3LDVA 3W2UA 1SSGA 2J24A 5AHIA 4LY8A 5BW6A 1Q6LA 1TQXA 3GYEA 2XN0A 4UUIA 3R13A 5FF3A 3MYOA 2RDWA 3W7QA 1P0KA 5ABTA 1MEWA 4FX6M 4UMBA 1FBAA 5KINA 3DU0A 2VEPA 3TC6A 4NXSA 3MI2A 3AJXA 1KW1A 2ZRVA 1L2UA 1M5WA 4K6AA 3LI0A 4GFSA 3S5ZA 4TR9A 5BMXA 4FNQA 4Y6GA 4I7WA 3QPYA 2QCGA 3IIZA 3TSDA 4HIBA 1LBLA 3WJZA 3H55A 4AXKA 1AK5A 1HTIA 1OF8A 2HS6A 3IGUA 3LCXA 4MJMA 5HUOA 1SZFA 4BI5A 3BGGA 4AH7A 1ICQA 1EP2A 2R91A 3GDTA 4O28A 5FEXA 2Y7EA 3W73A 5DBUA 3G1AA 2B7NA 3NM1A 4RX0A 4LVDA 3SJ3A 3RF9A 2QR6A 3NVTA 5LNUA 3NQCA 3TC7A 4LRSA 3DFSA 2C3ZA 4OHQA 4UTWA 4O16A 4WY0B 4A3UA 3PWAA 4L4MA 3HGSA 1EIXA 4UTLA 1GEQA 1H5YA 2DZPA 5C2XA 1UASA 4UFIA 3H53A 3TAOA 4TMCA 3PF3A 3KVMA 3P80A 3W7OA 3TV8A 2BWGA 1UCWA 2JKPA 2DZUA 5D04C 4RV8A 4WXYA 2YZRA 4K7YA 3KOFA 4IX0A 3GX9A 4HPJA 3QZEA 3TCEA 1QWGA 4NZJA 3SGZA 1H61A 3SW6A 2Y7GA 1B57A 3W72A 1PCKA 5FEPA 1QPRA 1XCFA 3KFTA 1A5CA 3BLEA 4XQ6A 1K3UA 5FEZA 4OV4A 1NF0A 1O4UA 4ICNA 2Y70A 2NV1A 2HMCA 2PURA 2GJLA 3O15A 4AHQA 2CWNA 4RZ4A 2IQTA 2C18A 1R2SA 5BOOA 1YTEA 3W2NA 1KM3A 4WX2A 3BG5A 1XXXA 5D2VA 4YL2A 1VCVA 4WUIA 3W7HA 1GT8A 4HNTA 3W1RA 4PTNA 1YDVA 5CZSA 1WDWA 3UPWA 2NWSA 2YR1A 3IVUA 2A5HA 1LDCA 3TX9A 3ATZA 3F03K 3IGSA 5FF7A 4JYEA 4LS1A 4RK8A 4OU1A 4WOQA 4ALDA 4MJZA 3PS7A 1OX4B 2YXGA 1TRIA 5D2YA 1H7WA 2VXNA 2QUUA 5HWJA 3M0ZA 4NJGA 1ME7A 5EBUA 1I2QA 3QMTA 1VCFA 1BKSA 1THFD 1OFDA 1T8XA 4BWLC 4Y96A 5AC7A 3BLIA 2NLIA 1LROA 5LGXA 2ATSA 1KFEA 1NAL1 1GVSA 1P5BA 3N14A 5CSRA 1H7XA 2DJXA 1T99A 3CC1A 2A4AA 2V2DA 2V82A 1GG1A 3NQ8A 2VFHA 4NT0A 1Q6QA 1NEYA 3C2FA 5G4EA 2JGQA 4LRTA 3FYPA 4O1DA 1TTJA 1OFEA 3TSBA 2DU2A 1P0NA 1C8VA 1VS1A 4M7SA 3B04A 3A24A 3NQEA 2QAFA 5D2WA 4X2RA 1OX5A 2NUXA 2Z0IA 1XBYA 2B4GA 3P84A 3DFTA 5BRBA 3NQFA 2I9EA 3O6CA 1E51A 5E93A 3IVSA 3MWAA 3MHGA 3HG4A 3TMLA 4CQAA 3CLMA 4FF7A 4UFJA 3O6YX 2JGYA 4PH6A 3TIMA 2CLFA 5DN1A 4H3DA 1SUXA 1QDSA 2C6QA 2NUYA 1GTEA 3G1HA 3TUUA 1FDZA 3LTSA 4LOCA 3HBLA 1OG0A 3MMTA 1W0MA 3NO5A 4HN4A 1TPVA 1GVOA 2Z1BA 3G8EA 5J5DA 4ZMGA 3DAQA 5FEWA 1N55A 1OVDA 3DFPA 1DJNA 3LHYA 2JKAA 2PRHA 3EX4A 3WK1A 4KFPA 2A7NA 5H91A 4E2DA 3CT7A 2B7PA 1LYXA 3LB0A 4LUJA 2VEIA 1TCDA 1EPXA 1H7OA 2A6NA 3S8HA 2W0UA 4MLRA 2QCFA 1X6UA 3LCGA 3U2OA 1VYRA 1R46A 1F6PA 5D38A 4R33A 1KM6A 5AB3A 3W86A 4ZQPA 5AN7A 4DEFA 2GOUA 1R2TA 3R89A 1U83A 4GNJA 1KLZA 3C3NA 4OE7A 2GQ8A 4QITA 2VKZG 1G6CA 4UTUA 3CTLA 4I7UA 3W7CA 3NL3A 3W7GA 4GE8A 1EUAA 5D03A 5D37A 3C0JA 1NSJA 3HG3A 1PV8A 4LC6A 2H3DA 1SR9A 3B0VC 4CQ8A 5HWMA 5IM51 1JCLA 3C2EA 4JX6A 4DO5A 2AAMA 3DENA 2OX1A 1LORA 4GXMA 4RCXA 4UCGA 4XZ9A 3CB8A 4RZ5A 2X1UA 3QSRA 1MEIA 1TPB1 3QMRA 3LX9A 3STCA 3C8FA 3SI9A 5L6UA 4I7VA 1ZALA 4EF9A 3NM3A 3HJZA 3TNOA 5DXYA 4LV4A 4JDBA 3ZWSA 4NJIA 3LHVA 3BPWA 1EP1A 3C2OA 2Q3OA 2WSYA 2C16A 4JTSA 2RDUA 3INPA 1G4EA 1O60A 3CIWA 3KX6A 3W1XA 3P5YA 4MOZA 1VLWA 1S3HA 4XUGA 1GJPA 1IXPA 4Y8FA 2PRLA 3T44A 3R5EA 2RFGA 2J27A 1TPWA 3GXPA 1GQNA 4HPXA 3U6WA 5HWNA 2DZVA 1KTNA 4Z1DA 3RFAA 1SO4A 1G67A 2J9YA 2VOMA 5DCDA 3S6DA 4K36A 1KV8A 5K3VA 5G2WA 3PG8A 2QJIA 5TIMA 2NZLA 3P61A 3S9YA 3E9AA 1OX4A 1VJIA 2A21A 1NVMA 4FO4A 5EKYA 3SR7A 3HG5A 3TQKA 4BFAA 3L0GA 3G1YA 1KV5A 1OFQA 4NNAA 4N6EA 2OT1A 1K8XA 3ELFA 1LOQA 2ZZ6A 3FJLA 3NQ6A 3M47A 4LC8A 3NPXA 1UUOA 3NQDA 1JRCA 2OMAA 3CM4A 4JGDA 1KM4A 1L6WA 1X1ZA 1PCWA 3CWOX 3G1FA 2A2IA 1F6KA 1AL7A 4AHOA 2PC4A 1FCVA 5AC8A 2H8ZA 3BLFA 1KA9F 3N3MA 3LOTA 4X22A 1LBFA 3NPUA 1I45A 5F2GA 1LRNA 3RMJA 3TW6A 4YLWA 5I3JA 3OEXA 2P1FA 4ZL1A 4ZZ9A 2Y62A 1GVQA 2AGKA 4CNOA 2TRSA 3T40A 3FKKA 1QPOA 1DQWA 3STEA 1YLVA 3W7LA 4OGZA 4IMFA 1FDYA 1X1OA 2ZZ7A 3EWXA 3QC3A 4DELA 3CQ0A 5MHBA 4LNYA 3WJWA 3O07A 3BG3A 1LLZA 2RH9A 4FX8A 2NV2A 3V1PA 2XN1A 2G95A 1TREA 3O63A 3A5FA 2EGZA 3GXTA 3LHTA 1YDNA 2H3BA 1O5XA 1OYCA 2QCMA 2CLMA 2ZA3A 1XDMA 1LM1A 1XC4A 3MHUA 3NL5A 4LS2A 5LHEA 1VQTA 3SSJA 3W71A 5I3GA 1JR1A 1A5AA 1W5MA 3P81A 3EXTA 2RKXA 4UNLA 4MFDA 2ZQ0A 3OVRA 1OFRA 2ZCGA 1W5OA 3HIJA 3PG9A 4UTHA 5A5WA 1Z48A 2Z2UA 4NXKA 4RKAA 3L5LA 3GKAA 1W5QA 4I9AA 2Y7DA 5DY3A 1EB3A 3TFCA 2CLHA 3VI2A 3JRKA 1VZWA 5CZTA 4X3ZA 3G0SA 3KRUA 4N4PA 2PRMA 4XKYB 1LOLA 2F84A 3LBMA 4LTSA 1IF2A 3LHUA 3LV6A 5E0KA 1I2PA 2JBMA 1KFCA 4O18A 2VELA 2NWRA 3M5XA 3W22A 1G4TA 4HSNA 5AYXA 1GZGA 5C6MA 1LBMA 1G4PA 2VFEA 1RR2A 3HPZA 1AW5A 3A22A 3CEUA 3CHVA 2CZ5A 3M16A 4LT9A 3NQGA 4AF0A 4JX4A 5HQEA 3PY2A 1FWSA 1G7UA 5U4NA 3HOJA 2WPBA 5I3KA 3F4NA 4MKNA 1KM1A 3N2MA 5DXXA 1QFEA 2Z6IA 3NL6A 3M5VA 1H62A 2YPIA 1VRDA 4UNKA 3UWUA 3IGXA 1HUVA 4A2RA 4PODA 1K8YA 3DFOA 3OHIA 1LZOA 5EPDA 1YXYA 3W1UA 2ZTJA 4UC5A 3QW4B 2QUVA 4FB7A 3SECA 3QRHA 5TBOA 2PCQA 4O8RA 2R14A 4ZVJA 4QQ3A 1EUNA 5HULA 2C13A 1W8SA 1DQXA 3KRSA 2OZ0A 1ZY9A 4POCA 1PVNA 5AHLA 2H90A 4IUOA 3DFQA 3O16A 1PL9A 4O0ZA 4LVFA 2YW4A 5HUPA 1TQJA 4ZQMA 4J9JA 1TMHA 3PC0A 4IPJA 2ZBTA 4IPIA 2D73A 3W88A 3B03A 3B06A 5K9CA 4Q32A 3OA3A 4UTIA 4YWIA 4K8EA 1B3OA 3W87A 1Q6RA 2CLLA 4O57A 1HL2A 3PVFA 3DGRA 3L68A 1S5VA 3BW4A 5CGQA 5F4SA 2GVGA 1GVFA 1QAPA 4ZQRA 3GIYA 5CG7A 3UPBA 4JEQA 1I2RA 3MW7A 3BV4A 3S1WA 1TPUA 2JK2A 3M43A 3MBFA 4ORIA 1OYAA 1HG3A 1QOQA 4ML9A 3BARA 4CNPA 2Q8ZA 3W6YA 1WOBA 4Q4KA 1FQ0A 1FCBA 4Y90A 3G1VA 1OJXA 1Q45A 4GUHA 5AHMA 3EX3A 1UUMA 4S1FA 2E1DA 4A29A 1MEHA 3PSWA 3C4UA 4PEKA 2AQWA 5HINA 2ZZ3A 4AVFA 5D2XA 3L0KA 4TIMA 4O17A 4MZ1A 3OVPA 4GBUA 1F05A 2DZTA 4O50A 3S5YA 3GDKA 4JIPA 3NQMA 5J5RA 4NJKA 1YYAA 2YDAA 2J9XA 4JTFA 4FIQA 1WV2A 4QAIA 4JTGA 4L4LA 4PL2A 3NL2A 3L5MA 4JY8A 3B0UX 3TDFA 1RD5A 5D09A 4IQLA 3VNDA 5LNRA 1TV8A 1WQ5A 1VH7A 3SIZA 2VFDA 1WAUA 4LVAA 2R8WA 4LWWA 3RNDA 3S0CA 2G97A 4O54A 3BVJA 4NNBA 2H6RA 4DF1A 3GVGA 2V5LA 2QUTA 1DHPA 4HT3A 4B5NA 4IMGA 2Y7FA 2ZRWA 3W1PA 1ZJIA 3WJXA 3U8GA 4ORMA 4WY0F 3PBUA 1JVNA 3GR8A 3L67A 3NPWA 3O05A 3DH7A 1SU5A 4JICA 1B4EA 2WNZA 3TXVA 1JJKA 1VHCA 1S5WA 1VHNA 2EHHA 1XBVA 3P7YA 3QM3A 4K7VA 4KFNA 3QFEA 3GZ3A 4N2YA 3LTYA 4UTTA 5D02A 1LLWA 3W7DA 1SFJA 1SZNA 3A23A 2GQAA 1MZHA 3LCWA 1TJRA 3N2XA 2CU0A 3HGJA 3EWUA 3S1XA 1I2NA 4DF0A 4FNSA 1SO5A 2C19A 3NXFA 3P5ZA 2YSWA 1JQVA 1N7KA 2C0AA 3EWWA 1Z42A 4C1LA 3TE9A 3G1SA 4LU0A 4NU7A 3NQVA 1V5XA 3C61A 3T78A 3LRMA 3MI6A 1F74A 1YTKA 4PA8A 1W1ZA 1H50A 4IWWA 3IIPA 4FHAA 1SSDA 2QCDB 2WJZA 2QAPA 1BWKA 2GUUA 1ZENA 1W37A 3KXQA 4EF8A 3W2MA 4UMCA 1F5ZA 3S1VA 3N19B 3PBVA 3BO9A 1X7FA 2YFOA 4OWGA 1CX9A 1W3TA 3VE9A 3T7VA 2CLOA 4DQWA 1Y0EA 5EA9A 3I7RA 2GVLA 1DJQA 1MXSA 3MP5A 4HKPA 4R7JA 3TA6A 1BWLA 1W3NA 3I6RA 2YX0A 1JUEA 2X30A 4NX5A 3HGOA
chains in the Genus database with same CATH superfamily
1TA3B 1NM9A 5LNVA 4W5UA 3N9KA 3TSMA 2ZXDA 1KB3A 5A8NA 3MZ2A 2CBJA 3LCIA 1Z44A 4FA3A 4WKHA 1H0IA 3I4EA 3A13A 4N7QA 4KEMA 2A3AA 4AMAA 2P0OA 7REQB 4N9BA 4A4AA 1DORA 2FGLA 4E38A 2WB5A 3MO7A 4IZGA 4CQ9A 3L5AA 2A7RA 2V5JA 3KBVA 3OB8A 3ARYA 1K02A 4GZEA 5HBFA 1FHDA 2GJNA 3EAUA 2GK1B 4GYPA 3DFHA 1JFXA 4F9DA 3P3BA 4QE1A 1LTDA 3IIXA 3R11A 5DEZA 3UU0A 1TTPA 3BCDA 2HV5A 3N4FA 3T8LA 4UNIA 1XYBA 1ZBVA 1QNQA 4A3HA 5BNKA 1BSLA 3ZS4A 1V3LA 2QUNA 3D3FA 4JTRA 4N9DA 3F2CA 2AMXA 1JCNA 5IOBA 5FJJA 3RU6A 1HVXA 2D3LA 1MNZA 2XN2A 3MP3A 2VHLA 1CDGA 3BZGA 3OLDA 1MO0A 5C2GA 2EF9A 4BI7A 4NSBA 1HJXA 2O9OA 3S42A 3L4WA 3RPMA 4BZYA 4HNUA 2WHJA 4X63A 1SFSA 1Y65A 3NZRA 4PUMA 1YNQA 2CLEA 3RAOA 4YXGA 4FEZA 5CH9A 2GGEA 3BCJA 4ZQNA 2Y0FA 4E3VA 1B54A 1GEHA 1J0HA 3CQKA 3MSGA 2FYMA 2VRKA 3AYRA 6TIMA 2HWGA 1HXJA 1ECQA 4AG0A 4G1KA 4QM1A 4X2PA 1JDDA 3VNYA 2DQWA 4LVBA 4BCEA 3QPZA 2WSPA 4H6QA 4U3CA 3AS3A 1XINA 2XISA 5DCBA 5D05A 3IIVA 4WJXA 4K39A 1DPMA 4X60A 2EPKX 1M41A 4M8UA 4PE8A 1UD6A 1UA7A 5I6SA 1W5NA 2VC6A 1XD1A 3WENA 3RIKA 4O19A 3T0AA 3W7RA 1V7AA 1VPXA 1ZHAA 4Q8UA 4Z0JA 1IQ8A 4AHPA 2LLEA 3QHNA 4GIRA 3S2CA 2FJKA 1CGVA 2WO5A 2PD5A 4CVWA 4GCXA 1WNOA 4WDTA 1UWRA 1D3CA 4HCHA 3N2TA 3MKVA 1VKFA 4Z1AA 4GA8A 4EPKA 4R9XA 1PZ0A 2E09A 1UBSA 1NWRA 5LSMA 3KM8A 1SW0A 3TU9A 1J5SA 3TFXA 1I0BA 3NQAA 1I4NA 2J78A 3QF0A 2VOTA 5HQLA 1KLYA 2TODA 1M6JA 4HCLA 4HJFA 4XZNX 3QPEA 3OIHA 2CZEA 1KBIA 1YADA 3R58A 1F7BA 3UEQA 1UPMB 4Z1CA 3MS8A 4JYDA 4LUTB 3WQPA 1QR7A 4GJJA 3NPVA 4ZQCA 3DERA 5GVJA 1B31A 4F0HA 3E0IA 1UP3A 1OFBA 5TF0A 4QBXA 3RYSA 3W84A 1V51A 3GM8A 3APGA 1MW0A 1QO5A 3WNKA 1QOPA 1R0MA 4GQRA 4TX8A 4M6VA 1CNVA 2PLKA 2V38A 5U7SA 1YDOA 2X42A 3EOSA 1HFBA 1S39A 2PLMA 3GKFA 4NILA 2O7QA 2QDEA 2VEMA 5A8PA 3GBEA 2VZSA 1JUBA 4Q7IA 1T8QA 1RP8A 4AZ6A 4NZ3A 5F2MA 3U4AA 3GNNA 3GH4A 3FHAA 1PKNA 2ABAA 3W7EA 4HYWA 2F61A 4KCTA 3BQ6A 4QSHA 1FDJA 3GK0A 4UFHA 2A85A 2X0HA 3G22A 2HBVA 4LUTA 3W9ZA 3K13A 1WO2A 4CNUA 3TJIA 2E8YA 1ONRA 1K7FA 2CZFA 2QJJA 4W89A 5I0DA 4H9MA 5K9DA 2ZDSA 4KRUA 2DQXA 1AA1B 3GFZA 5D2TA 4WKFA 3ICJA 4NKCA 5LXEA 4CCCA 1A0CA 2G3FA 3DHFA 5KITA 1K77A 1CB2A 2QDHA 5D30A 1REQB 1JNEA 2PBGA 1AD4A 1JCMP 1M1BA 3CO4A 3OZOA 1UJPA 2TSYA 4DUOA 1SR0A 3DGBA 3N6JA 4QDPA 5T26A 4IGSA 3TTYA 1QK0A 2HK1A 4F0LA 5E0CA 2J47A 5FF2A 4M82A 1ITUA 4HNVA 1DXEA 3KAOA 2VEFA 4QJ1A 4Q33A 4OBTA 4NIRA 5HR7A 1EL3A 4E2BA 1XRSA 2C15A 2Y88A 3T55A 3W7IA 1RY8A 1HIZA 3B05A 5JH1A 3ITGA 2O7SA 4ADTA 5CPLA 3LCFA 3WJSA 4K8HA 2IKGA 4WLCA 1O5KA 3PFMA 4GIEA 4ZTYA 2XIMA 2R94A 3AXXA 4AD2A 5GNXA 3CZEA 8TIMA 4EKJA 2WLYA 3BAWA 3QLDA 4ZO8A 3TYZA 3CNYA 1UR9A 3W76A 1EJXC 3S5OA 1FWAC 2FH6A 4AZ5A 4F0SA 1XW8A 3IIOA 4DI8A 4FNRA 3GIPA 2QDDA 2ZDRA 3WQWA 4B3ZA 4WD0A 1EXPA 1R9ZA 3H7VA 1C9WA 3G1DA 2B81A 5FAJA 1TTIA 1MSSA 1R2RA 1AL8A 3M4HA 4Z17A 2BGNE 4JD4A 1C9DA 3S6OA 2G96A 4UTTC 2ZZ5A 2X09A 2VX6A 2IUZA 1DV7A 3T2PA 3M0MA 3CPGA 4YVPA 5A8GA 5DY2A 4ENLA 1EEXA 2FKPA 1IZKA 3DC0A 3WO8A 1E70M 3T4CA 4JEJA 3BGJA 3WNOA 4I5RA 4ATDA 1AH3A 3VGDA 1J5TA 1BYCA 4TX9A 2Y5SA 1S2CA 3CQHA 5A8QA 3CYVA 3TOYA 3NIYA 3GSMA 1XP3A 3CU2A 3HZ3A 3WNMA 4PGLA 3CMJA 5BWAA 3WFLA 5CZ0A 1DJGA 5CAKA 1K9EA 4ROPA 1GOXA 3IJDA 3RN6A 4I8YA 1LCOA 3W2LA 3UJSA 2FZDA 1VEMA 1UKOA 4JQ2A 4KKXA 1Z41A 5CGTA 4YCOA 2OFJA 1ODUA 3WLJA 5EMLA 1EC8A 2V3EA 3B97A 1CCWB 2QJHA 3RR4A 2WMKA 4FS9A 4C7FA 2XM1A 3M7WA 3G1RA 3KS5A 2AOSA 1JPKA 1JDFA 4B5UA 4N9CA 2DW6A 5LGZA 1DBTA 3JR2A 1J18A 3L23A 3IVTA 4R85A 2XWEA 4RE3A 4HYRA 5J04A 3HQ1A 1XWYA 2OYLA 5FJPA 2I14A 3OGSA 4ZE4A 3AMCA 1Q6OA 4IXXA 3WSUA 4W7VA 1JCXA 3S46A 1MFUA 2VYOA 4U10A 4HP5A 1IT0A 1SZRA 2J7DA 4EXBA 1R86A 2V6AA 1QNPA 3KP0A 3RPDA 4M7TA 4MLJA 3ITTA 1OCBA 3AQUA 1JQXA 2A3CA 4AEEA 4W7WA 4HB7A 1CB7B 2CIPA 2QVNA 4LY4A 4PSPA 5BU9A 1BHGA 2PE4A 1CXLA 1O95A 4GH3A 4UR7A 2V2HA 4DNHA 5HOSA 5FIPA 3L4TA 3CIXA 3R8RA 1QPKA 4E6MA 1R85A 3LEPA 3VUPA 4QJ3B 5E1QA 5CLWA 3NYDA 3PM6A 3RU8X 1UWQA 3QW3A 4MUZA 2VGFA 4MVAA 1US2A 4BQ5A 2FJUB 3WL0A 3DI1A 4UB9A 2QHAA 1F8MA 1SW3A 2V3GA 4JTUA 9XIMA 3UXLA 2BZNA 4CEUC 3DFYA 3WJYA 4S39A 1F73A 5F2IA 5EMUA 3P60A 3ARPA 3PAJA 2B7QA 3VDHA 1FXQA 4AZ7A 5KZEA 4E4FA 1RK6A 3C8NA 2NX1A 4P8VA 3CZKA 1K7EA 1MNSA 2PA6A 3WK2A 4EIVA 1L6YA 2F8QA 3IJQA 3TLLA 3CT2A 3WLSA 3MYPA 2OJPA 2G5WA 4AVNA 1QNSA 4YPJA 5I09A 1DXIA 3DXIA 3PZNA 5AYZA 3II1A 1Z9AA 2NXHA 1J01A 4AIOA 3RK8A 3O7UA 4EP8C 2VR5A 1VENA 2PB1A 4PRRA 5KMYA 2DZWA 3A5VA 3HG2A 3LSCA 3C2YA 1XRVA 5FJUA 4NG3A 2QPUA 1WDQA 2B0MA 4B91A 3SCWA 3WD2A 1HW6A 3XISA 4GJ1A 3SGGA 1YRRA 4CLMA 2WXDM 2V69A 4LF2A 1L0PA 3NZGA 1A5NC 1AG1O 1GKQA 4J28A 4US5A 4IPPA 1XIBA 3OG3A 4R53A 4L9XA 3EOEA 4W9TA 1V6YA 3KOZA 5KSWA 2J13A 2QJMA 4H41A 4ZA0A 4FLRA 4IMDA 1F3EA 3GLCA 1OEPA 2I7GA 4JTHA 2A3HA 3U0HA 1FWDC 4RPPA 4KEZA 1UOZA 3IV3A 5D9MA 3ZR6A 4C6JA 3Q58A 4KWOA 2NX9A 1LL7A 4C6MA 4TQTA 2CPUA 3LM7A 1NARA 1XV8A 3MJMA 5G4WA 3XIMA 3STGA 2VMFA 1XDLA 2CHRA 1TJ2A 3A3HA 3EZ4A 6PTDA 1JEZA 2KZHA 1GZ1A 1UW9A 4NZFA 5CEWA 1PBGA 4XBKA 2Z26A 3I7QA 2VWSA 3TJXA 1BEUA 5G1YA 2E5CA 1QXLA 1SZEA 6A3HA 1XLFA 3LGGA 5FA5A 3IAQA 3PZUA 3DX5A 1RQHA 2ACRA 4DPQA 2WNQA 3FHQA 5SWUA 5T91A 4WOZA 4PCFA 4P5UA 4W86A 3C56A 2PP3A 1SO6A 4GINA 2R1LA 2PEVA 4CU7A 2OWXA 4E8GA 1RV8A 4EPBC 4AD4A 5EBAA 1TX2A 2PZ0A 2QGHA 4H8HA 4PMOA 1CLXA 2PDHA 4GG9A 1HKIA 1G7VA 3UZ5A 1I1XA 2VI0A 1IYXA 2YCEA 2V9DA 3KBMA 1KWKA 3USZA 1NDVA 4Y9PA 2GK1A 1DIEA 3HPXA 4Z2IA 3W7KA 3BAXA 1E9IA 2GWNA 3MO4A 2PUZA 1W56A 5LHFA 2QW5A 3B9AA 1W1IE 2WAGA 1RA5A 3RJYA 3U7VA 1NH6A 2WQPA 2PF8A 2X05A 1HVQA 2E6AA 1OX6A 3GRIA 1B30A 1KNWA 1AZ2A 1OGGA 3TYBA 1CECA 3W2UA 1N8IA 1SSGA 4IPLA 4XIMA 1XCXA 1X6LA 4CD5A 9CGTA 3QKEA 5AHIA 2PFHA 5BW6A 1BPLB 1QI0A 1TQXA 3MC5A 1LWHA 3MYOA 1OT2A 5ABTA 3R0KA 1ADDA 4G8TA 3DU0A 2DPEA 3TC6A 4NXSA 2XIIA 1IGWA 1KW1A 3LY0A 2C7FA 1HJQA 4K6AA 3SRKA 2FVKA 3DC8A 3PAOA 1TWWA 5I77A 2GJXB 3IIZA 4V27A 2VDIA 5ECVA 3S9IA 2X7VA 1XX1A 2XH4A 3F7JA 1TWSA 3IGUA 3LCXA 3K1DA 1SZFA 4NI8A 3SCSA 4BI5A 3DYPA 1UIOA 2HBXA 1ICQA 3CK5A 5FEXA 2O56A 5CJMA 3W73A 4FLOA 4RX0A 3NM1A 4LVDA 3SJ3A 2QR6A 1E3XA 1CGYA 3NVTA 2ANUA 1S5MA 2C3ZA 4PTWA 4LB4A 1KCXA 1EBHA 1EJTC 4KRTA 4A3UA 4L4MA 4AVOA 1IEXA 4GKLA 3RDKA 1GEQA 4U33A 2F6XA 1E4LA 4W84A 4UFIA 3ZSTA 2UY4A 5JBDA 4G7FA 2WJFA 1UCWA 3WLIA 1EC7A 2DZUA 3VAVA 5D04C 3KOFA 4IX0A 4M29A 4NZJA 1QWGA 3HQPA 1H61A 1T7LA 1PCKA 3UJFA 5FEPA 3UNTA 1K3UA 3TONA 2HMCA 3L4YA 3O15A 1Q63A 3ARRA 1MZRA 4HA0A 4ZO7A 1XLCA 3CHCA 3TZFA 4GNKB 1R2SA 5BOOA 3PBGA 2R1NA 2BDQA 1QW7A 2PDGA 1KM3A 3MY9A 4ACZB 4LFYA 3MVTA 4IG2B 1WUEA 3RILA 3S6TA 2NV9A 1GOQA 2P5NA 4PTNA 3AIVA 1H0GA 1UG6A 1FP9A 1RALA 3IVUA 1LDCA 2BHUA 3TX9A 1OGBA 3K8KA 3KWSA 3VUSA 1KC7A 2PLJA 1NU5A 2YXGA 3I3DA 5D2YA 2VXNA 4NJGA 1ZS2A 1JFHA 3M0IA 3SCPA 1FP8A 3BLIA 2ZXQA 2PDCA 1UYQA 1J0YA 1JXJA 1AH4A 1KD0A 5CSRA 3WELA 3NQ8A 5FJRA 4L6HA 4AYSA 1NEYA 3C2FA 4WSKA 4O1DA 1EF2A 3KTXA 1TTJA 1OFEA 4G56A 3TSBA 2JIWA 4WDXA 1P0NA 1GOKA 4M7SA 5IHRA 4B5WA 3P93A 1R3SA 2CCRA 1OX5A 2BVTA 2Z0IA 3PZIA 5BCAA 5CC5A 3DFTA 5BRBA 3DYMA 3O6CA 1QI3A 3HG4A 3ZO9A 4I9JA 4HJWA 4YS1A 4PH6A 1VEOA 2C6QA 2ACQA 3A6OA 4LAKA 3DYOA 3LTSA 4B5SA 2Z2BA 1JZ7A 1RVKA 1OG0A 1W0MA 4L5ZA 1TPVA 3QBUA 5J5DA 1WKDA 3DAQA 1OVDA 3DFPA 1DJNA 3N2OA 3LHYA 2JKAA 4IUGA 4ZBCA 1U2YA 1LYXA 4LUJA 4JN8A 1Q66A 1H7OA 2A6NA 1DJZA 1WKEA 2QCFA 3LPOA 3FSTA 1KM6A 3W86A 1D8WA 4KGJA 3ZQ9A 3UETA 4CU6A 3ZJ8A 4KWUA 4OE7A 2YA1A 2Z7KA 2VKZG 1R3QA 3E2VA 5A1AA 3GUWA 3BAKA 3ID7A 3W7CA 4RW5A 3BOXA 3VX0A 4GE8A 4H2HA 4MNMA 2OO0A 4ZSUA 5E6YA 3C0JA 1NSJA 3H2CA 4MNJA 2DIEA 4LC6A 3B0VC 3TP4A 5HWMA 3VDGA 4S3DA 3DENA 2OX1A 1LORA 2Q09A 4RCXA 4UCGA 3D3AA 1ENUA 3EMZA 2WCAA 5I00A 1FOBA 4HCDA 3WD1A 2GUBA 1TPB1 4IFKA 4I7VA 4EF9A 3TNOA 2GGHA 3RM4A 4GVFA 3LHVA 3WLHA 1RK5A 1P6WA 2NLYA 3DEQA 1W32A 2WSYA 3D47A 4MM1A 3QR3A 3W6LA 1G4EA 2OSWA 3KX6A 3P5YA 1GJPA 1U30A 4HYVA 3CHEA 2I17A 3R5EA 3VIIA 3D46A 3OG2A 2HJPA 5IXEA 1N8WA 3VD3A 1GQNA 1XLMA 4HPXA 4PUDA 3VC6A 1ISXA 2CETA 2PDFA 2WJEA 3M0YA 4Z1DA 3E0WA 4DXXA 1BF2A 1KCLA 1RCOB 1SO4A 5DCDA 2PWDA 5K3VA 3OZPA 5TIMA 3KBJA 4Q4PA 2NZLA 3S9YA 1C8YA 5C9UA 2ZUTA 3S9ZA 1OX4A 1QI5A 4B4FA 4HZ6A 3CAKA 4HNOA 2A21A 3ITVA 1NVMA 3AZSA 1WKYA 5HPCA 3HG5A 3OLGA 1FFRA 3L0GA 4C6EA 3BMVA 3PWGA 4NNAA 1PX3A 2FHBA 4ZFCA 1JNDA 2ZZ6A 4AMCA 1IWBA 4PTDA 4PYSA 2ZC1A 3OHMB 3TWBA 4JGDA 4NZCA 1KM4A 2A3LA 5CPTA 3VM7A 3A3XA 1F6KA 4AHOA 1FCVA 4MJ2A 1AH0A 4FOJA 4WCJA 3N3MA 1LBFA 4FALA 1V79A 3E5PA 3WMLA 2E40A 4Q4RA 3TNBA 5F2GA 1LRNA 4YLWA 2VJXA 3OEXA 2P1FA 1UH3A 1Y5WA 2EKGA 4OTKA 4IIEA 4REQA 2Y62A 2B31A 4XB3A 1E1FA 1GVQA 4W8LA 2P53A 2R24A 2Z27A 1Q4NX 4OVXA 3T40A 4K3ZA 1JPHA 1QPOA 3GH7A 1TV3A 1HJVA 1YLVA 3W7LA 3BLPX 4HA3A 3E3HA 4A35A 1QHZA 3CQ0A 4M6UA 5MHBA 3WJWA 1T5AA 3V1PA 2G95A 3WH5A 2EGZA 1RJQA 3SUTA 1O5XA 1ZJBA 3LNPA 2CLMA 3SO7A 2INEA 3NDZA 2AMGA 3TYAA 2OKOA 4Q4MA 1OB0A 5LHEA 3SSJA 3W71A 1B3XA 3L2LA 1W5MA 3AOFA 4DM2A 4UNLA 1OWQA 3OVRA 3GG1A 2ZCGA 2ISFA 1B1YA 1A5UA 5BOEA 3PG9A 5A5WA 1GOOA 1ONEA 5H8PA 3L5LA 2WVTA 3VD5A 2Y7DA 4XSMA 1CXIA 3VI2A 4H7CA 3K4WA 5AYBA 5CZTA 3WF3A 5JUVA 3G0SA 4ZR8A 3LBMA 4LTSA 1IR1A 4MAVA 1DIOA 2PS2A 3ZT7A 2JBMA 5E09A 4O18A 4J3UA 1XH1A 2VD9A 1W9UA 4KMQA 4AD0A 5HMEA 1UWTA 1KBLA 2VFEA 4HOWA 1UKTA 1HJUA 2FZBA 4US6A 5LIWX 1NOUA 4JHMA 3CHVA 2CZ5A 3M16A 3ZJ6A 4AF0A 4JX4A 3ABZA 5HQEA 5XIMA 3E1F1 1G7UA 4DX3A 1AMYA 4B5TA 5DXXA 1QFEA 1MI3A 3HTWA 2YPIA 3TVAA 1US0A 3IRSA 4H8NA 4WR3A 3SBFA 3UWUA 3WF1A 4E8DA 1EBGA 1RBOB 1K8YA 4TX6A 4LJ3A 1Q4WA 1FWIC 1FWBC 1GQIA 5A6BD 3NSNA 4ZVJA 1EUNA 1IZCA 4IT1A 5HULA 3FW6A 4DWDA 4XAZA 2V68A 4YIWA 4PRWA 5AHLA 4GD0A 1PIGA 2BG5A 4CD4A 3M7SA 4C6DA 5CBBA 4ZQMA 2BY0A 1YHTA 1KGUA 1R3VA 3GHRA 1ZGDA 3W88A 3GXIA 3L4ZA 3O0FA 1EO7A 4YNGA 1V03A 2IQ0A 4JCMA 2D24A 1TJ1A 3GVQA 4GVHA 2WMIA 3WH8A 3EGJA 4JHZA 4Q4QA 1S5VA 3BW4A 1WKFA 2GVGA 4GH1A 1GVFA 3AALA 3KWXA 1TZZA 3MW7A 3BV4A 4GOAA 4C65A 4A6GA 1TX0A 4ORIA 1W1TA 4BEQA 3WBYA 1FQ0A 3TYUA 4J4KA 2QZRA 1PKMA 3HMCA 3T6CA 5BXTA 9XIAA 2E1DA 1PTDA 4A29A 3PSWA 3GIQA 3U2ZA 2YCIX 2EQDA 1FFQA 3SQMA 1KKRA 4O17A 4HBKA 4MZ1A 3OVPA 3TEVA 1F05A 3TN3A 2DZTA 3UVAA 2IPJA 1W3LA 2RJGA 4HHLA 4JIPA 5D4YA 4QLKA 5J5RA 2BMBA 4M56A 2YDAA 3T8QA 4JTFA 3N4EA 2CEQA 3NL2A 1RD5A 2G3NA 1F4AA 2CKRA 3L7RA 4LVAA 2R8WA 3UJEA 4IP5A 1T40A 4LWWA 1LQ0A 3RNDA 4DI9A 3TTEA 4MSSA 3S0CA 2OZ8A 4LGXA 4W93A 4IL0A 2H6RA 2OODA 5EFFA 4HT3A 4PULA 4LUSA 3W1PA 2VD8A 5BWFA 5F7UA 3GR8A 1XC6A 3NPWA 2GSJA 3DH7A 4ZTXA 4JICA 3RCYA 1XICA 2F9RA 1A4LA 1VHCA 1S2UA 1S5WA 4V28A 1VHNA 2EHHA 3SFWA 1ITCA 4K7VA 3AMDA 3GTXA 5I78A 1LLWA 3APYA 4J7RA 2GQAA 3A23A 3LCWA 1CTNA 1EO5A 5DMMA 1W6TA 2JIEA 1XYZA 3N2XA 4B2DA 4CN1A 4ZENA 1A49A 1QW9A 1O12A 3O9NA 3RLHA 4DWSD 4B3KA 3NXFA 2VC5A 4WKAA 2C0AA 3EWWA 3WQ5A 3TE9A 4QSFA 4NU7A 1TR9A 4YTQA 3S4TA 2Z1WA 5EGRA 5M3WA 1Y7VA 3G6MA 5GJPA 1MDLA 2XIJA 1KXVA 4IWWA 5A6BA 2OLAA 3UG5A 4NRSA 2WJZA 2QAPA 4EK7A 2I56A 4IIBA 3HPAA 4UCFA 3WBXA 4QAWA 2G4JA 2PWHA 5CCZA 4UOZA 5FL0A 3N19B 4PRTA 1UUQA 2YFOA 1W3TA 5HQMA 4NY2A 1V0NA 3EOLA 1CXKA 5C2CA 1BSIA 4GI9A 4CQBA 2VRJA 3I6RA 3QC0A 4KESA 1ITXA 1B5TA 1OG6A 1EHNA 1FCQA 2X40A 2XGIA 1JD7A 2DIJA 1X38A 1FXPA 3VDBA 3H7RA 3AZTA 3LTPA 2E5BA 3L65A 3LMZA 3BLLA 1G5AA 2A3EA 1Y5XA 1QNRA 2INFA 3UNDA 1XS2A 3LM3A 1PHQA 4PMYA 3TR2A 3RO8A 4H8VA 4AY8A 3W29A 1EWDA 4E0CA 2GFTA 3LHWA 3TJLA 3H2NA 1E6NA 1E6PA 1MQRA 4YTUA 3QY7A 3N18A 3PTMA 3EPMA 2YBUA 1VBUA 4FNUA 1BGGA 2F38A 1JPMA 1ZAHA 1KTCA 5HJLA 3L4VA 1U5HA 5BRPA 3F4CA 1DTNA 2WC3A 3O1NA 1FH8A 3M41A 4TU1A 3FA5A 2BODX 3RMEA 4MB3A 5A6TC 1KGWA 2XVNA 1ZFJA 1QHOA 1W54A 5F1UA 3HF3A 3Q37A 3K30A 5AY7A 3R2GA 1PZ2A 4O1FA 2DEPA 2UY2A 3ZJ7A 4QQUA 3TN5A 3WQVA 2BOFX 2WWCA 4DBEA 4PMQA 4YTSA 2WHMA 1UZ4A 1MW3A 4LVGA 4XWUA 5EMMA 2XPKA 3VKJA 5BU6A 4MADA 4O1BA 2YA2A 3W00A 1UOKA 3PNZA 3NYZA 3BICA 2QCLA 5I06A 1N8FA 2OQLA 2QLYA 2DJLA 2D0FA 3DG3A 5FESA 4QJ5B 2KX9A 3AI0A 4Y9NA 2PTXA 1CGXA 2BX7A 1J6PA 4MWAB 4UFLA 2OX4A 3H2OA 3VD7A 2I1OA 2ON3A 5AYYA 2Z25A 3ZXWA 3ZLGA 2NX3A 3CHFA 1IIHA 1V02A 3MCOA 1V4YA 3RX2A 2OT0A 4L4PA 5I07A 1UQZA 2QPSA 1GTHA 3QQ1A 4JQ1A 4AUBA 4B16A 5D8ZA 1S2VA 2QJGA 2J88A 3NOYA 4LNCA 2QCHA 7ODCA 4U5KA 2XUCA 1NFGA 3CPRA 2RUSA 2BY2A 5F2LA 5IBXC 3N25A 1A50A 3USBA 4KEUA 2P3ZA 4H9TA 3BLDA 3N34A 1FWWA 4QP0A 1VBRA 2VDGA 2I57A 3RXZA 1JYNA 5FCZA 3KVKA 2E6DA 3DUGA 3T0CA 1H63A 4ZGYA 4GQBA 3CUZA 1Q6GA 1FCUA 2REQA 1UD8A 3VIGA 4M81A 3F4VA 4H04A 3IUIA 1MW2A 2PSNA 3RLVA 1D3GA 1A5OC 1OF6A 1NWUA 5JMUA 4CVUA 2W92A 3L9CA 5IDZA 4QIUA 1FHLA 2ASHA 2R1PA 4AZCA 4OT7A 1UD4A 1E0WA 4B92A 5BMWA 3HFTA 3AISA 3ITCA 1OIMA 2FMOA 2Z1KA 2EAWA 1VGAA 3BSMA 1P7TB 1XIDA 1XYLA 1LRQA 4H4IA 3E12A 1ZRQA 2WC4A 3LXBA 2I16A 3SZ8A 1TWDA 2C14A 2PU0A 3Q94A 3WD0A 3OA5A 2G8ZA 3GNXA 4AB4A 4JS3A 6ALDA 4FPSA 4HMEA 1XLLA 4Y9AA 1UZDA 1WDRA 4FOUA 3LQLA 3UWQA 3UWVA 2ZKMX 2ZA2A 5HMFA 1ME8A 2CHOA 4O11A 1VIWA 1XL9A 4C6OA 1IT7A 2DH3A 3GTNA 4PMJA 1PE1A 1YTDA 1PYFA 1KQZA 4Y2WA 1LP6A 1UH4A 3AMLA 1B90A 4P8WA 5IFPA 4XZHA 4LS0A 3BGAA 4D6GA 3H21A 4LW7A 4GUIA 5G2IA 4EVZA 5LKYA 3LCHA 4MZ8A 2PTWA 1Z7AA 3CAQA 2E8ZA 2DZXA 3VM5A 4P7LA 1FWCC 1W91A 2E67A 4BR1A 1K4GA 3PN8A 3GU2A 3ISIX 2O9RA 1EOKA 3L21A 5K2ZA 5AHFA 4QG9A 1K03A 1TO3A 5FJIA 2A7PA 2GQ3A 2WCGA 4LV9A 3U48A 5KTLA 3WG6A 3REQB 3QGAC 5HMSA 2V8ZA 3NOEA 3WK0A 3A4AA 1PKLA 4JR5A 1A3HA 2FGZA 2J66A 2DUAA 1Z8AA 4ERAA 4UQBA 2QV5A 2Z6JA 4M1RA 4K38A 4DXKA 1XPGA 1L6SA 2Y89A 4BF7A 5LA0A 5EY5A 1PKYA 3LGEA 3BE7A 1R6WA 3QEZA 3ARXA 1W3HA 2YIHA 4IMEA 3DI0A 5CPNA 3B8DA 3CAVA 1ZCCA 4HHMA 3STPA 3ME3A 3LUTA 2P10A 3W74A 4TXEA 2OWCA 1B3YA 2XGZA 2I5IA 3RCNA 1XKYA 1R3WA 4K68A 5A6MA 1BVWA 3HGRA 1HJWA 2HSAA 1BVNP 4Q8OA 3AHTA 2EEXA 3WDPP 2O4QA 3MUCA 1WBHA 4JKKA 3WUEA 4JTTA 2EJ1A 4Q22A 4Q4OA 3POCA 1PHWA 2VC9A 5I7GA 1LWIA 3P0XA 4ZODA 2RHGA 2W61A 2VQUA 1M03A 3NG3A 1BTMA 4KGLA 3O06A 4Z2GA 3GXFA 5C55A 1YXCA 2JKEA 3CUXA 1WXYA 2QULA 3VVGA 1CI1A 1E6SM 1BXCA 4IGHA 4QGCA 4AZCB 1NOFA 3BK0A 3L4XA 3PJXA 1DP0A 5ECUA 3E2RA 1UIPA 3W07A 2ZUMA 4FXJA 2CBVA 3H22A 3EB2A 4H00A 1DHKA 4HD5A 3LV5A 4DWSA 1S5TA 1GVIA 1OFAA 4Q8NA 4XKMA 4ACZA 3URNA 2FLIA 4HNLA 3QQWA 3V18A 3TMQA 4HHHA 4UTJA 3G2GA 5EB8A 2FB2A 3ZIZA 1NELA 2FVMA 2WZMA 5FJTA 1H49A 1P1XA 3ZYZA 1ZU8A 1R3TA 1UD5A 4JOMA 3MJYA 5DBTA 3TA9A 1EQCA 3VE7A 4JN6A 3MUXA 2PC8A 3P82A 3GNDA 5E6ZA 2WYSA 2Q8XA 1QW8A 1NF7A 1H3GA 1ZAJA 2VX5A 1IIGA 5JBEA 1DWFM 1R3YA 4S3AA 3IEBA 2X1SA 1UQYA 4TVDA 1ZCOA 3PUOA 1E73M 3T05A 1DYSA 2VDHA 5FI8A 3CO8A 1W9PA 4D9PA 1VFHA 4S3FA 4BWLA 5DCEA 1QCWA 2VENA 4IOTA 1KFBA 2XVGA 4HSOA 3TKFA 1GOWA 4D8AA 3GVRA 1ECEA 2F7FA 3THQA 1EGZA 4A8NA 4YTRA 6XIMA 5JIPA 3QSTA 3OQEA 1J93A 2JF6A 1JZ3A 4U2YA 3QR1A 1EP3A 3KRZA 2GZXA 2X7WA 2OKTA 2R82A 3B9OA 4AIUA 1CWYA 2ZZ4A 4UQCA 3MPGA 3GU9A 1VF8A 3UGRA 1QBBA 1K7XA 3ABQA 3ONCA 4J3TA 2FPVA 1GCYA 2X1RA 2ZX9A 4LCRA 3P74A 3UA3A 3NNTA 1FY6A 3PULA 1H11A 2W79A 1LG1A 4Z1BA 4H19A 3HFYA 4DO4A 2PZNA 4JIQA 1X97A 1N82A 1GORA 4JQ3A 1ADOA 3I3BA 4NNCA 3MP4A 4TUFA 3L2IA 2TMDA 1WX0A 2ALDA 3RG6A 3AS2A 3PUDA 2FZMA 1RZMA 3GXNA 3LENA 2DP3A 1E9LA 3PANA 3QJAA 4M19A 4RJEA 1TIMA 2OYKA 1M9HA 5GJNA 1JD9A 1CW2A 4UXDA 4DJFA 4NAEA 3FVMA 3T42A 4QNWA 2XFWA 3JU2A 3ZJKA 3VCRA 5CQ1A 3GDLA 3VKBA 4HZ8A 3MZNA 4WDWA 2WKGA 3F1QA 3QVQA 4TMBA 3LG3A 1TSIA 1TPH1 3C2RA 4RZBA 5EMJA 4AAJA 2PWFA 4X9YA 3AS1A 3FOKA 3EWBX 2QGYA 1HZYA 2HEJA 4OQVA 3VILA 2HVNA 3YPIA 3FCPA 5DMNA 5FACA 4MPQA 5CAHA 4NL1A 3MWCA 2E9LA 3ALGA 2GLKA 2PU1A 2I5QA 3RRXA 1M68A 2DDXA 1OD0A 3SUVA 1MMFA 1S2AA 3RITA 3C0LA 2DUXA 4PUKA 4QE4A 3ARVA 1U5JA 1JZ4A 3BOFA 4MB4A 2YW3A 4IJRA 7REQA 5ABEA 1SMAA 2HPMA 4RXGA 1RPXA 3RM8A 4B9ZA 3UZWA 1FWRA 3QMSA 4LAUA 2ODOA 1QOXA 1XIHA 2ISVA 2W6RA 3AUJA 2D3NA 2RDXA 1UR2A 1CXHA 3EOUA 3KE0A 1ISZA 1XH2A 5C9ZA 4GY1A 4QJ4B 3EDJA 3LA4A 3WQOA 4I6VA 9RUBA 4DZ5A 5ABFB 5AC6A 2Y8UA 1O5QA 4GACA 4JTIA 2PBOA 4M6QA 4AC7C 1M7OA 3CYJA 1HKMA 4A3YA 1CXFA 2JALA 3C2VA 3PSVA 3CQIA 3KVLA 3UY8A 2MNRA 2GYIA 1DJXA 8XIMA 4F40A 1VFFA 1JULA 3QOKA 4JNMA 3RJXA 3T1GA 4FXFA 4EOUA 3EXRA 4NASA 2X0SA 2FIQA 3W3OA 1TMQA 4GUJA 2OLHA 1DL3A 4F3HA 4XK2A 2J9ZA 5EMYA 4ATLA 2TYSA 3EX1A 8CGTA 4KWWA 3UY7A 1B3VA 1BQCA 4D2JA 2IPFA 3AYSA 3SY5A 2W9MA 4LCSA 1GWJA 5FF0A 1BLIA 2RDTA 2QF7A 4GIYA 1W5PA 2WKJA 2Z7GA 2G0WA 3GXDA 3NTYA 2D0GA 5LNWA 5HPOA 1JIBA 3UJRA 4IISA 3ZZ1A 4XAYA 3LXAA 1NFBA 1TIWA 2IKJA 1WZLA 1EDGA 3KHJA 3V75A 4DHGA 4BJHA 3GW0A 2PTYA 3STFA 2WVSA 3KBNA 4XKYA 1IZJA 4GHRA 3AHZA 3WK3A 2DORA 3UW6A 1UZHA 3WEOA 4EXQA 1ML1A 3QTGA 4RE4A 3ZR4A 1R30A 1E6QM 2GJRA 4BKNA 3GFYA 2ZA1A 1UMLA 2FZNA 3OO2A 1GUVA 4D1JA 4DNMA 2DVXA 4O13A 4A05A 3NQBA 1XQKA 2QCCA 1XLHA 1FWGC 1XSJA 1HL9A 4HHPA 4G7EB 1OYBA 3ARWA 3HO8A 4MFEA 2V0TA 4AISA 4IP4A 1BXNA 1I2OA 3BG9A 4IGNA 4MY9A 3UGVA 1E4MM 3WDQA 2VZOA 1E9YB 1N2VA 4FX7A 5B80A 2BGSA 1D7KA 1X8CA 2CLIA 3LDVA 1RBLA 4H1ZA 3V5CA 4LY8A 1Q6LA 4UUIA 2XN0A 5FD0A 1E5JA 3W7QA 4UZSA 4PUWA 4C6NA 4IF2A 5DO8A 4FX6M 4LB3A 5LIUX 3QV8A 3UXKA 1E71M 3EA3A 3AJXA 4JNYA 1Q6EA 1Q85A 2YA0A 5E9XA 1M5WA 1FTXA 4GCAA 3LI0A 4LYRA 4MTVA 3S5ZA 4TR9A 1MWOA 2J77A 4FNQA 1LG2A 1Q6FA 1XYCA 1Q5MA 2DIKA 3UWEA 4P7QA 1YNYA 1UD2A 2EG8A 4HIBA 4ICCX 3MDUA 4PZVA 1VIZA 3RM9A 1QU4A 4Y9OA 3KBSA 3BGGA 1EP2A 2R91A 3AHXA 1LLOA 5DBUA 2PDBA 3RF9A 3H4WA 3N11A 4LRSA 4OHQA 3VIFA 4O16A 2CLPA 4G5DA 2I9UA 3PWAA 2FH8A 3HGSA 1IT8A 2R6OA 2JQXA 1C3FA 5C2XA 1Q8AA 3E74A 4AY7A 6REQA 3TAOA 2DT3A 3PF3A 3N04A 2WZEA 3KVMA 4RDWA 3P80A 4GYJA 3F4DA 2RJHA 3DESA 2EG6A 3UP8A 2HXUA 4LBRA 3AIEA 2JKPA 4QG8A 3LPGA 4DWSC 3QV7A 1EF3A 4RV8A 3BOLA 1SFTA 1G9HA 1OCJA 5EFDA 5BYWA 3TCEA 2PDUA 4TVUA 3P2VA 1TG7A 1B57A 2ESCA 1QPRA 1XCFA 2VNCA 1NF0A 3DG7A 3H2AA 4W85A 2BY1A 2PURA 1ZBKA 5M1TA 5BXSA 2DVTA 4XIAA 5C7VA 4GQ0A 3TR9A 1X98A 1XXXA 4FR1A 3GE7A 4WUIA 4ZO6A 4HGXA 3W1RA 1QJWA 3NZQA 2F6KA 3UPWA 2NWSA 2A5HA 3THCA 3ZVHA 5FF7A 3NO3A 4JYEA 5ABFA 4LS1A 2CITA 4RK8A 3VKAA 4MJZA 4WJ8A 3SCUA 1C93A 1ZQ5A 5HWJA 2C0HA 2QMJA 1I2QA 3U7BA 4DJEC 3CMGA 3CWHA 1BF6A 4YJ5A 4BWLC 1NDYA 1UWSA 2ATSA 1P5BA 1US3A 1VD6A 3CC1A 1P0EA 1SVDA 3UXIA 4HA4A 1OD8A 2JGQA 4LRTA 3FYPA 3UG4A 2DU2A 4J2MA 1MDRA 1HX0A 3B04A 3NQEA 1Q13A 1W1YA 3LYEA 4X2RA 3SUSA 2NUXA 3BMXA 3WDIA 2VM8A 3WX7A 1A3XA 2NVDA 3KRBA 4QR6A 3TMLA 3H70A 3CLMA 3TIMA 5DN1A 3KS6A 5C9XA 1GYMA 3TUUA 2YJQA 3DDMA 2V3FA 3HBLA 4GO9A 3MMTA 3W28A 1R9XA 1LT7A 1GVOA 2Z1BA 4PEEA 1N55A 2CC0A 2PRHA 4KFPA 3TC3A 2B7PA 4ZOCA 3QFWA 1EPXA 3WYZA 1MUWA 4PCSA 4XD3A 1ONWA 1EGMA 2GGGA 3KCOA 1R46A 1Q2RA 1F8IA 4QEHA 2IMRA 1CXEA 3WH9A 1U83A 3V35A 1Z6KA 3H8AA 1KLZA 1R5YA 1KXHA 3SJNA 2CNCA 3ES7A 4JL2A 3SIMA 1G6CA 4UTUA 3CTLA 5GPRA 5CSYA 1JXKA 5AC4A 1EHAA 1KGXA 3W7GA 1ITQA 3UA4A 4IP7A 3BDKA 2P8BA 3H2MA 4JKLA 5D37A 3HG3A 4ECLA 4FOKA 4D6DA 4L9YA 4XVEA 4Q8VA 1JGMA 4CQ8A 5IM51 1JCLA 5DRIA 3OOQA 4QTGA 6CGTA 3CB8A 5TAOA 2P0IA 3QSRA 1MEIA 3LX9A 4I9TA 1ZALA 4EPEC 1EOMA 1VP5A 4LV4A 3BANA 4GXPA 4NJIA 4RNJA 3C2OA 2Q3OA 3I10A 5AC5A 1O7AA 8A3HA 3INPA 2D2GA 3HPFA 3UF9A 4XZMX 1O60A 3QR0A 3SRHA 2VC7A 1ESWA 2YXXA 1XQLA 3EKGA 4MOZA 3EDKA 1IXPA 4Y8FA 2X0YA 4CKQA 3ZLFA 3T44A 4XBJA 1A5KC 3LZ5A 2JEPA 2OB3A 1TPWA 3GXPA 3GVVA 1DJHA 2VQTA 1I1WA 1SJDA 1FKWA 3BJSA 4KETA 4HTBA 4JQAA 1K8CA 5GJMA 1CPUA 2VOMA 5H1WA 5G2WA 3P61A 5E9AA 2PDPA 2YDQA 4NZ5A 1ZPTA 5EKYA 2PF0A 3ES8A 3TQKA 4BFAA 4IL2A 1PWLA 2NVCA 3M47A 1ZBWA 4LC8A 3NPXA 4WGHA 5EMKA 4EAYA 3U57A 4FLSA 3CM4A 4MB1A 1KRBC 1PIFA 5A6JA 1DXFA 1L6WA 1X1ZA 3WFZA 1PCWA 5HDRA 4TTUA 1FH9A 3WH6A 1KA9F 1S3TC 4X22A 4L6DA 1RCXB 3G77A 3KZSA 1POKA 2HE5A 3BTNA 4M24A 4AU0A 3A4WA 4ATWA 4W87A 5LYRA 3N6HA 2NSXA 3VKDA 2HVMA 1ZTVA 2AGKA 3O6AA 4R88A 1KXQA 4CNOA 2TRSA 1DJYA 4S3BA 1TV2A 4NF7A 1VBHA 5DMYA 3R10A 2VEGA 1GKRA 3EWXA 3MDWA 4DELA 3E6EA 4LNYA 1U5VA 5A94A 3BG3A 5T9CE 2NSOA 1HN1A 3O63A 4C6LA 3GXTA 3OBAA 1OYCA 3WCZA 2QCMA 3EB4A 4GGHA 1P7TA 3VKKA 3AIRA 1XC4A 3NL5A 1JGIA 1VQTA 5DFAA 5I3GA 1JCTA 3A9BA 1F3WA 2RKXA 4G7EA 3QXBA 4PBGA 3UR2A 2ZQ0A 3BLOA 3BMWA 3GVWA 3V0UA 1ZSXA 2WQDA 3HIJA 1PX8A 1DWJM 3QOMA 1AJZA 1EA9C 3KLLA 2WK2A 5E70A 2PTDA 4I9AA 3T81A 3ARUA 2OZ3A 3IGHX 2CLHA 3TFCA 1UR0A 3JRKA 4X3ZA 4N4PA 4XKYB 5KETA 1BGAA 1LOLA 4B5VA 3LV6A 3REQA 1XLJA 3BWWA 3TWAA 1G4TA 5AYXA 1LBMA 3MQTA 3PPCA 1FHVA 2X41A 1AW5A 3CEUA 3UESA 2G4FA 1VFMA 3PY2A 2YDSA 1LQAA 3HOJA 3VGFA 5I3KA 3F4NA 4MKNA 3VZYA 4W4QA 1EGVA 2Z6IA 2YL6A 1F07A 4UNKA 3IGXA 4G1NA 1HUVA 4D1IA 4I6KA 4A2RA 3DFOA 3LPFA 4CNTA 4KF1A 7PTDA 1YXYA 1M7JA 4LUYA 5AVNA 3QRHA 4O8RA 3GWQA 4XISA 2R14A 4Q7BA 2C13A 1XG4A 3KRSA 3DBNA 3NWRA 4UBPC 3FY1A 3EYPA 2H90A 4B3LA 3O16A 1PL9A 2VZVA 4L1WA 4DUWA 4O0ZA 1E1CB 3AC0A 4J9JA 1TMHA 2WMIB 3NZPA 4I8DA 4IPJA 2ZBTA 3GG7A 2ZVIA 3PZMA 4IPIA 3UR7A 2D73A 4DUVA 5G1MA 5ABGA 3F5JA 3B03A 3B06A 2XSXA 2VZTA 3E2SA 1BKHA 3JUGA 4K8EA 3W87A 3BSHA 1TFVA 3LPPA 1P6BA 5A2AA 4LH8A 1AZ1A 5F4SA 4AIEA 4ZQRA 5CG7A 3VNZA 2C79A 3KW3A 4JIIX 4MKVA 2VR4A 3M43A 3MBFA 5DQPA 2AL2B 4ML9A 1HG3A 2CHNA 3W02A 2Q8ZA 1WOBA 2XIQA 2AKZA 1V3HA 1O5RA 4AD1A 3G1VA 5XIAA 2BV9A 4RPQA 2Q02A 3WNLA 4M80A 4Z2KA 3IACA 4FR6A 1E56A 1UUMA 4KIRA 1PZ3A 1XIGA 2AQWA 5MKGA 4AVFA 5LIYX 2HVOA 2J8GA 4KEVA 1A3WA 4GBUA 1JDAA 3W81A 4O50A 3CMFA 3NQMA 3PZTA 2IW0A 3PZQA 3IJ6A 3WLKX 4DAIA 4FIQA 4F48A 1GOIA 4JY8A 3NGFA 3S2MA 4N0RA 1MYRA 1TV8A 1WQ5A 3JVAA 1UBPC 3SIZA 2VFDA 2VL4A 4DJEA 3K1GA 2G97A 3UERA 4O54A 1X6NA 3ECQA 3NDYA 1R7AA 3KP1A 4IMGA 1XIMA 4ORMA 3L67A 5C7HA 4F66A 1H09A 2ZX6A 2J79A 3TXVA 1F4HA 3SSZA 3OLEA 1W1A1 4US5D 2F2KA 3CASA 4QCEA 1X7IA 3SUUA 1ZP4A 4Q8PA 3N2BA 3W7DA 1SZNA 4OIFA 3DN5A 1JYWA 3GO2A 2CU0A 3CTTA 2VUYA 4CQCA 4IQJA 4D71A 3S1XA 3SRFA 4LYQA 1SO5A 2P76A 1Z42A 3G1SA 1V5XA 3C61A 3MI6A 1YTKA 4PA8A 5CC7A 5REQA 3M0JA 3CIVA 3IIPA 2QCDB 3H23A 3TTQA 3E2QA 1EDTA 1TKKA 1ZENA 2AQOA 3KXQA 3M07A 4BEUA 3CL8A 3SURA 2QXWA 1G1YA 1DE6A 1F5ZA 1Q6CA 3OU8A 5HANA 1QT1A 1X7FA 1EJRC 5JH2A 2CLOA 4DQWA 1ISYA 3P6LA 5EA9A 3CXOA 3IJ9A 2D1ZA 4HKPA 4R7JA 1W3NA 1J2BA 1M01A 3URAA 2YX0A 3SGUA 4INFA 2DW7A 3FJ6A 1S5NA 2VFFA 1I9CB 1PDYA 5DF0A 3GAYA 3NR0A 2E6FA 3W7JA 1MVYA 2Y5EA 2XFFA 2OGYA 2JEQA 1B9BA 3MVIA 3B8SA 3ZT5A 1EJWC 4WK9A 3E49A 4RUBA 3WLQA 3RUBL 5G5IA 4UR8A 5D32A 1EDQA 3P62A 4MG4A 3MMUA 3EOOA 4MWAC 2J75A 1ZB5A 1L9WA 1OZMA 4V2XA 5JIWA 1V6UA 2NUWA 1H60A 3BW3A 4FIRA 2J7FA 4D72A 2VCBA 3BH4A 3DFNA 2E6YA 4XO6A 5I3HA 3UCQA 3OVQA 3RPTA 3WLTA 3Q67A 1DWAM 3QV9A 3W6MA 2J7HA 4RR4A 4WSHA 3GYCA 3N9SA 3VMOA 1QPNA 1J11A 2PGRA 5AZ1A 2E4TA 3PBWA 3B8WA 5LZLA 2XSBA 4RXFA 4NAFA 1BYBA 1RJPA 1P0DA 2XJ7A 3FFSA 4ADSA 1NP0A 3W70A 1EKOA 4YU1A 4UOJA 4A21A 4B4HA 1XISA 3ZLHA 4BQ2A 2EBNA 3PZ9A 3C0SA 2W91A 2V30A 1YQ2A 2X1TA 3FKRA 3LS9A 2XWDA 2Q71A 3N15A 1A0EA 2NQJA 1EJUC 4GI4A 3VNKA 4F2UA 1WA3A 4HU3A 4J3ZA 5HAOA 3DZ1A 1LOSA 1SW7A 2VP8A 5CPOA 3R94A 5A6AA 1K6WA 4N9EA 4AWTA 4O4VA 5EL1A 1JRBA 3LRLA 3W1MA 2PDQA 2E9BA 3E0FA 2PMQA 3PTQA 2P50A 4KCVA 5BZAA 3DCPA 3VMPA 1AODA 1V6WA 1CGTA 1H2JA 3IUHA 4UIOA 4GFIA 4JTCA 4LCQA 1GYNA 1XYMA 4H83A 1CIUA 1LL6A 2ZXBA 2Y8VA 3PR2A 1QNVA 4AIBA 5C5YA 4QISA 1YBQB 4AZGA 4IIDA 3FS2A 2WSQA 1UJQA 2BB0A 2ZICA 4IIGA 4B5XA 2X2GA 2FQIA 4JFSA 1W3IA 3ANUA 4LANA 2FMNA 1M7PA 2HCVA 4K1GA 1XRFA 1ZBCA 1NDZA 4PFMA 3FJNA 3QH2A 4HK7A 3AAMA 3MSDA 3UR5A 1LQ2A 4GWEA 3AMGA 3AROA 1XHGA 1YXDA 2O9PA 1YX1A 4L1XA 3N3TA 4MY8A 1GPWA 4DBUA 1J96A 1M3UA 1DKWA 1NOWA 3I6TA 4RE0A 4QRNA 1YMYA 4MHBA 3GHUA 2OVLA 1Z89A 2PPGA 3I65A 3CJPA 4U3AA 3GXMA 1TPEA 3H4GA 4MF4A 3W85A 3FDKA 4WDUA 2YYUA 4GY7A 4OUEA 1AJ0A 1VFTA 4W8BA 3XINA 3NSXA 5GNYA 4J2PA 3O0KA 5A8MA 4DPPA 3BV7A 4WVXA 1SFLA 2XSAA 3W1QA 1RA0A 1DWGM 3UZYA 2FTPA 3L12A 3DECA 2ISSA 4R5EA 5AOUA 2VX4A 3VA8A 3M9YA 4TVCA 3RLGA 2UV8G 2VVSA 3G8RA 3P8IA 3M6YA 2R1MA 2WC7A 3M5YA 4PTVA 3N73A 2PWEA 2QVHA 4E2VA 3VCNA 3V1HA 5JU6A 1BG9A 3A3WA 4WZHA 4MGGA 3RLUA 1R87A 4O4WA 3WF2A 4GRSA 3NCOA 3EX6A 2PODA 4Q8WA 2J6XA 5D9PA 2DSWA 3TYDA 3ITOA 2REQB 4UTKA 1IWPA 1IR2A 3GC2A 2BTMA 3UG8A 1U1JA 1T96A 3TOPA 4XV0A 5D33A 1IXQA 1V08A 5C71A 1XIEA 3SY1A 1VYSX 2V2CA 2WVUA 2Z00A 3HV9A 5K7JA 4OOUA 1RQBA 3UR8A 6TAAA 1V7YA 1A4MA 2OU4A 4BK9A 3VCCA 4WRHA 1GVYA 1MFVA 2A0NA 4MB5A 5K9XA 4DZAA 4WGXA 1G4SA 2FFCA 1WPCA 1B4KA 1PTGA 1TRDA 2BXZA 1VRXA 4PMVA 3MV11 3SADA 1H7PA 2YFNA 2ISWA 3PJTA 2NT1A 3VPLA 3TROA 3PUEA 3WLNA 5HJXA 3K4DA 3B9DA 3MHFA 1H1ZA 4F0RA 3G24A 1L2QA 1F76A 4C6QA 3MSRA 2WCSA 4ZOAA 4IH3A 2OGJA 4JTLA 3W24A 3T9PA 4GZJA 4UTWC 3QN3A 3ITYA 2BFGA 2WSKA 1FUYA 2ZX8A 1UHVA 4Z08A 1PTAA 2WNNA 2ZUVA 2H8XA 4QHRA 1WYIA 3OW1A 3TN4A 1LL4A 3EKZA 3GDBA 3KHDA 5HK4A 5MKGB 2CLKA 4MZYA 2FB3A 3C6CA 5K4XA 1RBAA 3GNOA 1YBQA 3VNLA 5F4XA 3UWZA 4JFTA 2HTMA 3SRDA 3AHVA 3CV7A 3A64A 1S38A 4AC1X 4O53A 5AHEA 2E3ZA 3KVJA 1VC4A 2QF8A 5L9FA 1E6XM 2CW6A 2J7CA 5CZJA 1JPDX 1VFSA 3FEQA 3LU2A 1OINA 2QIIA 1GHRA 3RGTA 3S83A 4F79A 2WVVB 4UTMA 1UKPA 3EXSA 4ADUA 2ZUUA 3PNUA 4PUUA 3SQLA 4PC8A 4XZIA 1WBJA 3WF4A 3G3DA 4IQEA 4C6CA 5G2HA 3O8AA 4MAZA 1JAEA 3URBA 2C71A 4J35A 4S23A 4BI6A 1XUUA 3R6IA 5DLCA 4FXSA 3SCQA 4RDZA 4YHGA 1OCQA 3PTDA 3FJ4A 1OABA 1WE5A 1V3IA 1GYLA 3NQ7A 3R12A 3IJIA 1Y8BA 4J3WA 5F1VA 3LI1A 1IGSA 1EX5A 4AWSA 1JF5A 2XH7A 2MUCA 4QX4A 4QFUA 5HNNA 1E1CA 1GZJA 3OODA 3SFKA 1WB0A 3F4WA 4DXVA 1TWIA 2D22A 2WZIA 4JIEA 4MYXA 2PGEA 4LAZA 3DKLA 1S2TA 3IAPA 1GPFA 3UZJA 3LNMA 3UZZA 5H2ZA 1QI4A 4DYKA 5I03A 1JCYA 1LJYA 4YVVA 4DJDC 4JX5A 3Q65A 1D9EA 3AO0A 5CPMA 2C1GA 4Y9MA 3UXDA 2D2JA 3V0SA 1MXDA 3WQ6A 4AEOA 1Q3NA 3F5LA 4DF2A 1MRAA 7CGTA 1DVJA 2XG9A 1T41A 3B0PA 3N4AA 3VZXA 3ARSA 1H41A 5IBXA 4IGMA 3IK2A 2Y6ZA 2CERA 3FV9A 4DBDA 4BF9A 3RRAA 2DZAA 4KFOA 4XTDA 4JCLA 4AYGA 1AJ2A 4ZB2A 4DYJA 4HA1A 4C6BA 1A5SA 3CUFA 4XZLX 3N1AA 3HPSA 5KZMA 1FWEC 4PMZA 3QHMA 4PUNA 1CGUA 3A21A 3KOYA 1TPDA 5FSDC 3EWDA 2GQ9A 3N12A 3NGJA 4QS6A 2A3BA 3W2KA 4HU4A 3SB0A 2QCDA 4DM1A 3MTWA 2QEZA 1HGWA 4B9YA 2GVYA 3IJ7A 4KBXA 1ZNNA 5TQLA 2C1HA 4QG6A 1GNXA 2YOCA 1EJSC 1RP9A 2PDNA 4Q8TA 4FF5A 2YYTA 4MIMA 1Q7MA 4WJEA 3W1LA 1V77A 3G0UA 2CFFA 3THAA 3VGBA 4UOQA 4HOXA 1AMKA 4J5NA 3W38A 4M3PA 3WL1A 1E5NA 1A47A 4Z2LA 3LZ3A 3K8MA 1EJ7L 2FPYA 1RXOB 4HNCA 2A6LA 1E40A 1F2JA 1EPVA 2WZHA 2F6UA 3OQ8A 1IXOA 1J79A 4IFOA 3PB2A 3VGEA 1G0CA 2H9AA 4P8UA 1FRBA 4O0QA 1X8FA 4GBDA 3ABSA 5HATA 3UXAA 3WH7A 5BXRA 2W4XA 5A6LA 2BGQA 1XD0A 2PCEA 1QPQA 3ABOA 4S3KA 3ZMRA 1X96A 3P8JA 3C52A 4OV9A 1B3ZA 2E77A 2FHCA 5EYWA 2ZOXA 3V3WA 3AIWA 4DLFA 1TPC1 2DT2A 4C91A 1OGSA 4OBSA 2BY3A 4ZSTA 4UFKA 3WQGA 2GSEA 5AKQA 4FMVA 1BG4A 4IJBA 1ZP3A 1UP2A 1SO3A 4ZFMA 1H7NA 4TTGA 5KZDA 2ATMA 1G94A 3NDOA 3MB9A 4C90A 3AFBA 5KZ6A 4S2CA 4AWUA 3TXZA 1JF6A 5A6SA 4KWVA 1W9BM 3M44A 2PDJA 4JTJA 4CGTA 3O6DA 2ZRUA 3MV01 2HXTA 4RLIA 2GVJA 1LRTA 1UR4A 3ARZA 4XUYA 4AXNA 2O92A 4REQB 1YPIA 1KWGA 5C9WA 3S5NA 1XLIA 4Z1YA 1JCJA 3ITLA 4E8CA 2QKFA 1TUFA 3JS3A 3E96A 2AL1A 2ADAA 2Q8LA 4ZOEA 3N29A 3MCMA 4DAFA 3M46A 3G18A 5F4WA 1NTHA 7ENLA 4GMEA 3HB9A 3G1XA 3FSUA 3WLMA 1F61A 4BQ3A 1EYWA 5REQB 3ZVHB 4GY0A 1OQFA 3BZJA 3FXGA 3B8UA 3WY1A 3DHUA 1MQPA 2WZTA 1LT8A 3QTPA 3GTIA 2FGBA 3W26A 1K9TA 3W0KA 4M5PA 3GG8A 3LRKA 4JL1A 1JUKA 2