3KVMA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with amino-benzoic acid inhibitor 951 at 2.00a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
366
structure length
366
Chain Sequence
ATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of novel inhibitors for DHODH via virtual screening and X-ray crystallographic structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
total genus 138
structure length 366
sequence length 366
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kvmA00
3GZ3A 2Z0IA 2DZWA 1N7KA 3B8DA 3DXIA 3E96A 3SZ8A 1WXJA 1K7XA 4JTTA 1EB3A 1VHNA 2JKEA 1DJQA 4S1FA 5D04C 2ZRXA 2UV8G 3O07A 3QMSA 4ADSA 5KTLA 2YCEA 2H3DA 3GDMA 4CNPA 2E5BA 4Y6GA 4O28A 4LWWA 3UWVA 1UCWA 4HNTA 1W5MA 2I1OA 2QJHA 4JTJA 1TYGA 4E2DA 3N9RA 3M41A 4E0CA 2JBMA 5CPOA 3T55A 1VRDA 3W1TA 4JDBA 3I7SA 2QCEA 2VFEA 3UZ5A 1Q6QA 4XTDA 4XWUA 2AAMA 2W79A 3BK0A 1OVDA 4TMCA 3Q58A 1JUBA 2ZZ4A 2B0MA 4DQWA 4JN6A 1M6JA 1H7NA 3LB0A 1EP3A 1PCKA 4N4PA 3NG3A 3LX9A 4HHPA 1FY6A 5CKSA 5AC8A 3STGA 1XC4A 1I2NA 1TRIA 4DBEA 4YCOA 1ICSA 1TSIA 3T4CA 1F2JA 1RQBA 2VENA 4UTIA 4ADTA 3G1SA 2WSRA 1WOBA 3W87A 2ZZ1A 4ZZ9A 1FWTA 2NXGA 4O10A 4OQVA 5F1UA 2VFHA 3KXQA 1JULA 4QITA 2H6RA 3NNTA 5LNVA 2A1YA 5G4EA 4JDYA 2ABBA 1EIXA 2E68A 3AO0A 4BI6A 3AJXA 2TMDA 3B0PA 1Q45A 4WOZA 1G4PA 4DF2A 1CW2A 4A29A 3C2VA 5BMWA 3FS2A 2ZZ2A 2TRSA 1HUVA 4M7SA 4O53A 3TCEA 2HMCA 2Y85A 4GFSA 3C56A 3P7YA 2CLLA 5D09A 3V1PA 1MZHA 2VFGA 3ZFHA 8TIMA 3CQ0A 3C4UA 3PB0A 5KZMA 1JQXA 2H90A 2E09A 3UPBA 4EVZA 3CIXA 3SY5A 3WFAA 1K7FA 4WX2A 3A24A 5H91A 3NDOA 4O12A 2ZA2A 3NL2A 1A5AA 1C9DA 3S5ZA 2RHGA 4EF9A 3O15A 4JIQA 4RR4A 1VYPX 1SO3A 1H7RA 1PIIA 3LXBA 2CLIA 4LVFA 4NZFA 2DORA 1AW5A 4EF8A 3C52A 3GDKA 4FB7A 1KM3A 4UFJA 2HS6A 2AQWA 2C13A 4XKYA 1SZGA 3OG3A 4MLJA 1KFKA 4FO4A 3W73A 3BLIA 4UTJA 5HINA 2WNNA 2A85A 3WK2A 5LNSA 4DEFA 3LHWA 1KFCA 2JKAA 3E02A 4FX7A 2ZQ0A 3FYOA 1PE1A 3M16A 4LUJA 3SSJA 1LZOA 4RKAA 3NR0A 4P61A 1S3HA 4O14A 3EKLA 4LS2A 3L5LA 5IM51 5DY2A 4AWSA 4CQ9A 5KINA 4LRTA 4TIMA 1DJNA 2ZZ7A 3I7QA 3TROA 1GTEA 4QSHA 2E6FA 2Y63A 3S9YA 4H6KA 5CZJA 4N9EA 2X1RA 4U4MA 4OHQA 4GE8A 4BF9A 2WSYA 2D73A 2TSYA 4IWWA 1Q3NA 3FEMA 4GUFA 4NJIA 2FQIA 1BKSA 2X1SA 5F2GA 4DPQA 4JS3A 4WUIA 2EGZA 2FB3A 4MPQA 1LROA 1SFLA 1WAUA 2V9DA 3PY2A 4FNSA 3W2NA 4MZ8A 4WOQA 3VI2A 2FIQA 1OX5A 2BSLA 2QF7A 3U8GA 1OK6A 2ZTKA 3EB2A 3C0JA 5AFDA 3C3NA 2J88A 4IQLA 2ZTJA 3SI9A 4Q33A 1SPQA 1XUUA 1JUEA 3L67A 3QSRA 1QFEA 2F84A 3PF3A 3R2GA 5HUPA 4HPXA 1HFBA 5LHFA 1MEWA 1QDSA 3UWQA 4JYEA 4RXGA 3PAJA 3EWYA 1OABA 5FF2A 5D32A 1DL3A 4BR1A 1UASA 3Q37A 3QC3A 4RXFA 1OX4A 3R13A 3FKKA 3GXPA 3O16A 4ZVJA 2Q3RA 3M47A 2Y7FA 4NJHA 2YYUA 1JUKA 4M19A 3F1QA 4K6AA 3PUOA 3O63A 1LRQA 5HJLA 4CNOA 3EX4A 3UXAA 2R14A 3BLFA 3NQAA 5D2VA 4A2RA 4IMCA 1A5BA 5LNUA 3C2OA 2GQ8A 4MKNA 3TKFA 2CLMA 3MMTA 5LKYA 3UQNA 3W7JA 2A0NA 4O1BA 1PL9A 4CNNA 6TIMA 4KFNA 4RK8A 4XTIA 3DZ1A 2Y70A 4IXXA 2J6XA 3WK0A 2NXIA 4O50A 1HO1A 3GAKA 4TO8A 3EWWA 2VEKA 1N55A 3NA8A 3W6YA 2C14A 4JX6A 3EWBX 5AHFA 3NZ1A 3NM1A 3L0GA 1VC4A 3NQMA 2HTMA 5LGZA 1GWJA 2WV8A 3W7NA 3NPXA 4IMGA 5AYZA 3PM6A 4PC8A 5DXYA 5FF7A 3KOFA 2B4GA 3C6CA 1XM3A 1H7PA 1O5XA 1P5BA 2NZLA 3L21A 3P60A 2TPSA 3TUUA 3F03K 2CWNA 1ZNNA 3T78A 3TAOA 3V75A 4RZ4A 5DBUA 3TK7A 5J5RA 3A21A 2OT0A 1XI3A 4K7YA 3WJZA 5TIMA 4RZ5A 1VQTA 1FDJA 5FEZA 1TV5A 3I7RA 2CFFA 4CQAA 1SSGA 3OVRA 1L6WA 1FXQA 4LC6A 4DO5A 2E6AA 4EIVA 1LLWA 3E49A 1H1YA 3S0CA 3G0XA 1VR6A 1UJPA 3OHIA 2B7PA 1JRCA 3BG9A 4CCEA 2DP3A 1UBSA 3IIVA 5FEPA 5DN1A 1KM4A 3LCHA 4FNUA 1QR7A 3DKJA 4JX4A 1KA9F 1WX0A 4LVGA 1S5WA 3HGJA 2RDUA 3KVKA 3WK3A 1TPH1 3IRDA 1I2OA 4FF7A 3FLUA 3EX6A 4UFMA 3W1LA 2ABAA 2Y88A 4Y96A 4GJ1A 1H63A 4YLWA 2PRMA 2VOMA 4ALDA 5C2XA 2CLEA 2Y62A 2C16A 1UB3A 1SW3A 2ZA1A 4FNPA 1RQHA 1O94A 2JK2A 3NL3A 5T26A 3TSBA 1JJKA 3NM3A 5KZEA 5HULA 3O6DA 4MLRA 1F05A 4R33A 3DFNA 1VJIA 4MY1A 3B05A 4JTEA 4MY9A 1GT8A 3PB2A 3T40A 1Z42A 5EPDA 1NVMA 3PUEA 2V5LA 1FUYA 4WQ6A 4Z1DA 1XXXA 1TPVA 1FCUA 4IX2A 1VGAA 1B9BA 3W1AA 1DORA 4UTMA 4NU7A 5HR6A 3B03A 2CLHA 4JY8A 3ZS4A 5C55A 3VFLA 1H62A 1O95A 3LRMA 3A5FA 2ATSA 2JGQA 1A50A 1ZAHA 4IOTA 3KHJA 4MYAA 1P4CA 2VEMA 3DKLA 3S1WA 5F4SA 1JCXA 4O8RA 3CU2A 5HQEA 2YX0A 3W75A 2DU2A 1J5TA 3L0KA 4PH6A 3F4NA 1L6YA 1YXYA 4FX6M 4OWGA 3JR2A 2WJZA 2A4AA 3QEZA 5C54A 1OFEA 4M6PA 1K8XA 1SFJA 3NPUA 3S5NA 5I3GA 4YWIA 3TU9A 4UUIA 2V8ZA 3DBPA 2EAWA 2V5BA 4IGHA 5TQLA 1KW1A 5HWNA 3MP3A 4KFPA 4UMCA 5U4NA 3W23A 5HWJA 2VFFA 3A9IA 1LDCA 1CX9A 3W7QA 3QMRA 4HT3A 5BMXA 3QW4B 2DJXA 1Q6OA 4PL1A 4X22A 1F74A 1AL8A 1T96A 1LOQA 2DZPA 5I3IA 3OVQA 1KLZA 2DZTA 4AVFA 1QPOA 1KFBA 4FNQA 4Y8FA 3UWZA 1FWNA 5CG7A 4X9SA 2CZEA 4I7UA 3UZJA 3TW6A 5D33A 1ICQA 3P8JA 1KM2A 3F4WA 5KITA 1PS9A 1EP2A 5K4ZA 4A2SA 3HG5A 3LV6A 2QCDB 4AF0B 2CZ5A 4LV9A 4N4QA 3TMQA 1GYLA 1KFEA 3NL5A 1YTDA 2G5WA 5I3JA 5HR7A 4O11A 2ALDA 3HBLA 3FA5A 3S8HA 3MBDA 4HSNA 1QO2A 1Z41A 1TPDA 4WY0B 1IGSA 4IUOA 4Z1CA 4NQ1A 1XFBA 3M0ZA 1KFLA 4LW7A 5A5WA 3GAYA 4MZYA 1GQNA 1DQXA 1KTCA 3NAVA 3C2FA 3MW7A 1YTKA 1IXPA 1LRNA 2CZFA 1RZMA 1F7BA 3W7OA 4IMFA 1FXPA 3VE7A 3HJZA 2WSQA 3GLCA 4K38A 1RVGA 3NPWA 1YDNA 4NT0A 1TV7A 3G1HA 5J5DA 2FFCA 2EF9A 2QAFA 4R7JA 3PR2A 2YFOA 1W3TA 1OFQA 4K36A 1GYNA 2QUVA 3BVJA 2ZRUA 1NF0A 1W5QA 3UWWA 1VYSX 4PEKA 3QW3A 1W5PA 3TXZA 3GDTA 3LXAA 1LRTA 3THAA 5CZTA 2GUUA 3QMTA 1SO5A 2J9XA 4YCPA 4OV4A 1SO6A 1KM6A 1I4NA 1TTJA 4W9TA 5EYWA 4H4IA 1XCFA 1XBZA 2DZSA 3I65A 4KWWA 3BGGA 1WV2A 2OMAA 3E12A 4Z08A 1A53A 3KVMA 3PG8A 2QUUA 1S5TA 3PVFA 3GB6A 2GVJA 4IPIA 2BZNA 1FWRA 3M6YA 3N73A 2GJLA 3DHDA 5AOUA 1LLZA 1LBMA 2FPTA 3JRKA 4LS0A 3W88A 3LDVA 2NUWA 2GJNA 2Q8ZA 3M7WA 2ZRYA 3ZWSA 3MBFA 4JGDA 3HPZA 5CZ0A 1KTBA 1AL7A 1B3OA 3N2MA 4UC5A 2QCCA 4QJ1A 3GNNA 4K39A 1T0OA 4MJMA 4I7WA 2Q8LA 3EEGA 3R8RA 1EWDA 3IIXA 2ZRVA 4FIQA 3TW7A 1KM1A 4HKPA 3G1DA 3GX9A 3YPIA 4QQ3A 5EL1A 3LTPA 5E0KA 1TPFA 4X3ZA 1M7PA 4UMBA 2CLFA 3BGJA 3HIJA 5CPMA 4GWEA 1BWKA 3FJLA 1XBVA 3HB9A 1ZJIA 3G1FA 3MYPA 3NOEA 1VH7A 2YYTA 4PFMA 2QJGA 4N9CA 1EEPA 4NZJA 5AB3A 1NF7A 2B7QA 3W85A 2A7RA 1SSDA 1TTQA 3W7EA 3TA6A 4NVTA 3QYQA 4RJEA 2BTMA 4EOUA 1QAPA 4UTLA 1QMLA 1W5NA 4AEOA 2OX1A 4A22A 4AWTA 3KVJA 4IJBA 2R91A 3RLVA 3KRUA 2QR6A 5LSMA 4DO6A 2PCQA 5AHIA 3DFQA 2OT1A 3CWNA 4O13A 3MUXA 2QCMA 3CT7A 1Y0EA 3HPSA 1K02A 1CI1A 1RD5A 4PCFA 3FYPA 4NNCA 3ABQA 2J24A 1AK5A 4UNKA 1ALDA 1GZGA 3LCGA 4LNYA 4UR8A 5D37A 5TBOA 3TE9A 3A5VA 3FJ6A 1G4SA 4IPJA 4UFLA 3KRSA 4XQ6A 1LTDA 1EPXA 2A7PA 1YDOA 1GVQA 3ATYA 3QFEA 1H7OA 2Q3OA 1DVJA 1D9EA 3W2KA 3L0NA 4OT7A 4UFIA 3CEUA 3N2XA 3QQ1A 1R2RA 4DBDA 5AHMA 3TMLA 5LNWA 2Z6JA 3TC7A 4O15A 3B0UX 3G18A 2VXNA 3LHYA 1N8FA 4DPPA 1ML1A 4MUZA 5EY5A 1RQEA 1SU5A 4H3DA 1R30A 1SQ7A 5K4XA 1IF2A 1F6KA 1OHLA 3LLFA 1G4EA 4Q4KA 4QAIA 1H7XA 3HGSA 2Y7EA 4UTTC 3DHFA 1UUMA 1H5YA 4LC8A 4YL2A 3S5YA 1OFBA 3N19B 2YR1A 1PHWA 1QO5A 4KFOA 1YPIA 1KM5A 3UD6A 3UWYA 3W2JA 3LI1A 2JGYA 3HGRA 1YPFA 3RMJA 1ZALA 3E0IA 4JR5A 1G67A 3MWAA 1M5WA 1OX6A 3M5XA 3GR7A 4BI5A 1IXQA 3NQ2A 5IBXC 4GC4A 5F2MA 3PWAA 2Y7DA 3P67A 4PL2A 1I2PA 1SW7A 4M6VA 3BG3A 1EP1A 1UUOA 3HGOA 3TNOA 5BW6A 3Q94A 2YFNA 4XKYB 1G7UA 1C29A 4QNEA 3SECA 4RLIA 4FEZA 4OV9A 5DXXA 4UTTA 3LCLA 3L68A 2WKJA 1FCBA 2YDAA 2X2GA 1ME8A 2ZCGA 1SW0A 1H51A 1QWGA 3M5YA 3W76A 2WNQA 3RU6A 1OYCA 1AG1O 2TYSA 1W31A 4O1DA 5AYYA 3GVGA 4PODA 5CPNA 4DF1A 1VCGA 3LCWA 1VCFA 2GPTA 7TIMA 4UTWC 5FF4A 1K3UA 5U7SA 3G0SA 4MVAA 5AHNA 2P10A 3RFAA 1X6UA 2GVLA 3DENA 3PC0A 3BW3A 3RF9A 1TJPA 3INPA 2R94A 4JEQA 3LRLA 4K7VA 3W1PA 5K7JA 1GEQA 1SUXA 3NQ7A 3S1XA 5AC6A 1W5OA 4FIRA 1HTIA 1XUZA 4P2VA 3ABSA 3EKZA 3P61A 3ATZA 4NX0A 5G2IA 4UR7A 4YXGA 3SGUA 3IEBA 5AYXA 2CU0A 3G1VA 1QOQA 3NQEA 4WZHA 4BK9A 2P0OA 3R89A 2CZDA 1FDYA 4NJKA 2A6NA 4UIOA 2GOUA 2NV2A 1GVRA 5HWMA 4O0ZA 2IQTA 2VC6A 3KX6A 1FDZA 3EWZA 3O6CA 4ORIA 1KFJA 2FPVA 5FEWA 4UMAA 3S42A 2Z2UA 1ZAJA 1D3HA 1TV8A 3N9SA 5F4WA 3D0CA 1SZNA 3G1AA 1W8SA 3BW4A 3R5EA 3ABRA 2E1DA 3NXFA 3LRKA 4O4WA 4LS1A 4RCXA 3UYCA 3H54A 3VE9A 3G3MA 1OYAA 3NQGA 3N3MA 2PE4A 5GVJA 3KVLA 1GJPA 5D03A 3LM7A 3TV8A 4GBUA 1EX5A 3LERA 3MO7A 2EKCA 3NPVA 2BLEA 1JCYA 5DY3A 3STCA 5FF0A 4O52A 3B0VC 1EUNA 3UWUA 4OGZA 1OJXA 2I9EA 3CLMA 3IIOA 3LCXA 1GVSA 2HSAA 5G4WA 4M5PA 2DZXA 1G69A 2V2HA 4TR9A 1I2QA 2YW3A 1LM1A 2HS8A 2Y89A 4BI7A 4R34A 3PBVA 2QAPA 3LCFA 2E6DA 4MFDA 2DJLA 3TQ0A 2FB2A 3KAOA 1GVOA 1DQWA 2DZVA 4CCDA 3N14A 4XBSA 3TIMA 1TPC1 1T8XA 5SWUA 1WA3A 2EPHA 5K3VA 3G1YA 1WYIA 1QCWA 1TQJA 3FOKA 1VS1A 2WPBA 3NZRA 3LHZA 1TTPA 2WO5A 3TX9A 1YDVA 1XBYA 4UXDA 1FX6A 5K9DA 3LTSA 1GPWA 1JCNA 2A2IA 1TRDA 3QM3A 4HSOA 3RNDA 5D2WA 2WNZA 4GUGA 4AHPA 3EX1A 4GNJA 4MYXA 4AWUA 3O06A 3CC1A 4LRSA 3VCRA 4Q32A 4I9AA 5K2ZA 4LV4A 2CLKA 3NQ8A 4J9JA 1P1XA 3HG3A 4O0KA 2A7NA 4FXSA 4JTLA 2XN1A 3QRHA 4I7VA 2C15A 1JQVA 3EWXA 5E1QA 1VPXA 3EXSA 3L5MA 5G1TA 1FBAA 1K7EA 2QUTA 3NEVA 3HPXA 1PCWA 4C1LA 1W37A 1DKWA 2KZHA 1NFBA 5BRBA 4N2YA 3W7MA 3SW6A 1RR2A 5AC7A 1F73A 1H7WA 2YXGA 3PULA 3LBMA 1HO4A 4D2JA 5D2TA 1TTIA 4O4VA 4JY9A 2C1HA 3PUDA 2FDSA 2AGKA 2RDWA 3NO5A 2V2DA 3IGUA 4RZ6A 4WXZA 1W0MA 3FIGA 4BFAA 4S2CA 4FHAA 1G7VA 1V7YA 1ZCOA 3DFOA 1KLYA 4UTKA 1OF6A 3W7CA 5HUOA 3GKFA 1OFPA 3GK0A 3GIYA 3O8AA 4LOCA 3W1UA 1ZHAA 2FJKA 3UY8A 4KKXA 3W84A 1WBJA 2A6LA 2QCFA 3NQVA 3GXTA 2LLEA 1FWWA 1PHQA 4UTWA 3GXNA 3W3OA 1W3IA 3LI0A 3DFPA 4CLMA 1KV5A 3QPYA 1SR9A 3P5ZA 2H3BA 3T44A 4HNVA 3MP5A 3TQKA 3T7VA 4LUIA 1KBIA 2RKXA 3H53A 3NQFA 2OCZA 5L9FA 3EXTA 1AW2A 4TMBA 4S2BA 1TO3A 3L65A 4HNUA 1TCDA 4K8HA 4NXSA 3BPWA 5DCEA 3CM4A 4FXRA 1J4EA 3W2LA 1VLIA 3STEA 4XUGA 1O5KA 4Y90A 4ZQCA 1LORA 4AAJA 4RX0A 3TH6A 2G95A 2WOQA 1NAL1 1U5JA 3E9AA 5K9CA 1Q6RA 5AHEA 1JCJA 1B57A 3C2EA 2Z1BA 1ICPA 1IXNA 3OIXA 2GQ9A 3S1UA 1F76A 2F7FA 4O19A 4LTSA 2GVGA 2A5HA 1O4UA 4HN4A 4OBTA 1C8VA 1H60A 4ZQOA 3W7DA 2RH9A 4GUHA 3PSWA 3LOTA 4DELA 1BTMA 5HMSA 3I68A 4POCA 4OU1A 2PRHA 2BXVA 2X1TA 3S1VA 3OVPA 3GR8A 2A21A 3LBCA 1TPB1 3M44A 2QJIA 2FPYA 3UXDA 3W1XA 4PA8A 1Z48A 2O7SA 3QZEA 5CGQA 3W9ZA 3BG5A 3IGXA 3G1XA 3TFXA 1QNVA 3G3DA 2VFIA 4ZQPA 2Y6ZA 2ISVA 2VEIA 4RV8A 3W86A 1W1ZA 1QPQA 4MJZA 4HNNA 1WBHA 1I8JA 4JICA 4L4LA 3M5ZA 2NX3A 3QF0A 5LHEA 3ANYA 3P80A 4GUJA 4NJJA 3PBYA 3W70A 3W71A 3NVTA 1FCQA 3HG4A 2V2CA 2QCLA 3EWUA 2FLIA 2ISSA 2QCGA 3L5AA 5FF3A 4L4MA 3LHTA 5D30A 3MP4A 1JCLA 4AXKA 3G22A 5I3KA 2RDTA 3W1NA 3IIZA 3DI1A 3DFSA 1JRBA 3W72A 2R8WA 1GG1A 1MEHA 3GDRA 3IVUA 5K9XA 2CLOA 4A21A 3DH7A 3M43A 1OFOA 1FQ0A 3MJYA 3WJYA 4PTNA 2X30A 2FTPA 3JS3A 2H8XA 4NUWA 1D3GA 2X1UA 2V0TA 3MHUA 1R46A 3DGRA 4IXHA 3G8RA 3LHUA 2QEZA 2X16A 4HPJA 3DU0A 3BV4A 2QCDA 4AF0A 2PC4A 2ZYFA 4ONVA 4JYDA 3P81A 3IVTA 3TDFA 5CPLA 2YSWA 1L9WA 5D02A 3M5VA 3USBA 4KWVA 3P82A 1KM0A 3GDLA 1G6CA 4O16A 3M9YA 1TQXA 1ZY9A 3NQDA 1F5ZA 5G2HA 3Q2DA 4JX5A 4UTUA 2WQPA 4IMEA 4NJGA 4ML9A 1GVFA 4MFEA 1ME7A 4JTKA 1FCVA 1THFD 1ONRA 1WQ5A 2PRLA 5AN7A 3EXRA 2ZZ6A 2W0UA 3VKJA 3QJAA 5DBTA 3TAKA 5KMYA 1H61A 1J2WA 1SO4A 2ZA3A 2OJPA 3C8FA 3PS7A 4ADUA 4LT9A 1OF8A 4AH7A 4FNTA 3LCIA 1OK4A 4MY8A 1VHCA 3HOJA 5CSSA 3PSVA 3KFTA 1KV8A 1YLVA 1TIMA 1DOSA 2NWRA 3G8EA 2NUYA 4DO4A 5D05A 2YW4A 3QQ0A 2J9ZA 1LYXA 3GKAA 3OA3A 1DV7A 1PVNA 2XN0A 1K8ZA 1YXDA 3HO8A 1U83A 3TR2A 3NYZA 4UFHA 2C3ZA 2BWGA 1A5SA 1I2RA 1JCMP 3THQA 1B4KA 1TMHA 3W07A 4E2BA 1MSSA 4Y9AA 2V82A 3RLUA 2YZRA 1XL9A 1XBXA 3M1ZA 3EX3A 2J27A 4LU0A 1IIHA 5C6MA 5BOOA 4O1CA 1A5CA 4O18A 1S5VA 2C6QA 2ZDRA 4M7TA 3W7KA 4GXMA 5E93A 1VLWA 4XBKA 3TJLA 3QH2A 1TREA 3TXVA 1K8YA 2OZ0A 1LBFA 2NX1A 2QCHA 4E38A 4LVBA 5I3FA 3B04A 3HQ1A 2PURA 4CCCA 4JIPA 1MXSA 5DELA 1P0NA 4TX9A 4ZQRA 3PG9A 5F2LA 1X1OA 4N6EA 1LOLA 5DCDA 5D2XA 1R2TA 3HG2A 3BW2A 1W3NA 3C2RA 5KZDA 1GOXA 3P74A 5G1YA 2QKFA 2XN2A 1TPEA 1E51A 2ATMA 4DXVA 4QIUA 2QDHA 3TJXA 2EHHA 5D38A 1VCVA 2ZRZA 5EA9A 1XDMA 4A3UA 4N02A 3L2IA 3ABOA 5FESA 5G5IA 4O57A 1KBJA 4O54A 5G2WA 2G97A 1VZWA 1X1ZA 4N6FA 3BLEA 3DAQA 5ABTA 4K37A 1XDLA 4JTSA 3QPZA 3SFKA 4FNRA 4O1AA 1LBLA 3GNDA 1RV8A 3NQ6A 1YADA 3IIPA 5LZLA 4JTHA 3H55A 4JD4A 3W7LA 3MHGA 3LTYA 2YPIA 2O7QA 4NNAA 3SJ3A 1LP6A 1WDWA 4WY0F 3WJSA 4C1KA 1OX4B 2H8ZA 4AHQA 3P62A 3GYEA 2E77A 4WJEA 5DCBA 5DLCA 1X8FA 1BEUA 2CW6A 3CEPA 3WJXA 1YTEA 3TQVA 4Z1BA 2G96A 5MHBA 1FWSA 3ELFA 1QPNA 4ZMGA 3U2OA 4NX5A 3BO9A 1O60A 4Z1AA 3VNDA 5EKYA 3STFA 1I45A 3N34A 1H50A 1NEYA 2NX9A 3FKRA 2RFGA 2GQAA 2I14A 3HMJG 1GG0A 3W1QA 3L9CA 3MYOA 1Z44A 2J9YA 2E6YA 1W56A 3HF3A 3TSDA 4MOZA 3C61A 2NUXA 4JTUA 2ZBTA 5L6UA 5H2ZA 4LY8A 4IMDA 4UNLA 2VKZG 4AHOA 4XZ9A 4M6QA 3W7PA 1B4EA 2C0AA 3K30A 4FX8A 1OFRA 2QDGA 4N9DA 1MO0A 4UCGA 2NV1A 1L6SA 5A8GA 3ZR4A 1L2UA 3CIWA 4N9BA 3DFTA 4ZL1A 1OG0A 4EWND 3O1NA 1RPXA 4ICNA 3RK8A 2ZZ5A 1DBTA 3B4UA 5F2IA 3PBUA 4LVDA 4AB4A 2V30A 1R47A 3WK1A 1W54A 1OFDA 3S6DA 2BX7A 4GRSA 3W22A 1SZEA 2C19A 1H1ZA 3A22A 5C5YA 3UY7A 2VELA 1SZFA 3SIZA 1HG3A 2DZUA 4HIBA 2ZRWA 4CQ8A 2NWSA 3BARA 3TC6A 2E5CA 1JR1A 3S5OA 4MIMA 4G1KA 4O17A 1QOPA 2NXHA 4JYFA 1IIGA 3CHVA 3ZWTA 1EUAA 3CPRA 1HL2A 4DF0A 3I6RA 2B7NA 3P5YA 1DHPA 2V81A 1YXCA 1TB3A 3W1MA 1NSJA 4NNBA 3W7RA 3MI2A 4Z0SA 3LLDA 4WY0A 3DI0A 3W74A 1ZAIA 3L66A 1IXOA 3G24A 5F4XA 3W7IA 1XKYA 4LVAA 4R53A 1YYAA 3O6YX 3WJWA 1TPWA 4U28A 3LV5A 3P84A 1WOAA 4JTFA 3MI6A 5LGXA 2XFWA 5CSRA 2NLIA 1X7FA 3LHVA 3CTLA 1TPUA 2JKPA 1EA0A 4B5NA 2ZFAA 1P0KA 2Z6IA 4WD0A 3W7HA 1T99A 2VEPA 4UFKA 4WXYA 3TSMA 3OEXA 3LXCA 4QNWA 1AW1A 3QSTA 2B7OA 4ZQNA 1M7OA 2ZZ3A 1G4TA 1EWEA 3FFSA 2Y61A 5BNKA 4UTHA 5HNRA 2QCNA 3W2MA 3CB8A 4JTGA 4QISA 1KTNA 1TJRA 2VFDA 1LOSA 5LNRA 3G0UA 1LCOA 3B06A 1R2SA 3A23A 2Y7GA 4OE7A 1PV8A 4NXKA 4BWLA 1OYBA 4ZQMA 5FI8A 5D2YA 2E5DA 4JNMA 1F6PA 4YMZA 4AMAA 4X2RA 1K03A 5I3HA 5FEXA 4QM1A 2W6RA 3W83A 1GTHA 1Q6LA 3O05A 1BWLA 4ORMA 3IVSA 3IV3A 2ISWA 4K8EA 5CZSA 3KRZA 1ZFJA 3P8IA 3NQCA 1JVNA 1ZENA 1ADOA 4GUIA 3LGEA 3MHFA 6ALDA 4TU1A 2C18A 1VYRA 3SGZA 3U6WA 3UPWA 5F1VA 5EMUA 4IX0A 3EX2A 1OFAA 2P1FA 1V5XA 3NGJA 3CWOX 1MEIA 5KSWA 4BWLC 3R12A 3NL6A 3UNDA 1AMKA 3W7GA 3TFCA 1QPRA 3W2UA 3MI3A 3IGSA 3W1RA 1ME9A 3PBWA 3SR7A 4MZ1A 4Z0JA 4JTIA 5AHLA 5IBXA 5EBUA 2YGYA 4JXCA 3OBKA
chains in the Genus database with same CATH superfamily
3GZ3A 2E0PA 2WJDA 3E96A 4KIRA 3L7RA 1WXJA 3N11A 3KW3A 3WQGA 2D2JA 3VZXA 1EB3A 1FHDA 1DJQA 2OYKA 4ADSA 2ZRXA 2UV8G 1UD5A 1R3YA 4D9PA 1SM9A 2YCEA 3IJ8A 2INFA 3GDMA 1BPLB 1KWKA 3VNJA 4Y6GA 4O28A 4DX3A 1LWIA 2X0YA 3H7UA 3MCOA 1A3WA 1LL7A 1LT7A 4E2DA 4E0CA 1HJUA 3E0FA 2QCEA 4XWUA 5GNYA 3BK0A 5A6JA 2WKGA 4TMCA 3Q58A 3ZT5A 2ZZ4A 2B0MA 1M6JA 3KS5A 1H7NA 1TIWA 3LB0A 1EGVA 1PCKA 4GXWA 4JFUA 4G9PA 5AC8A 3STGA 1I2NA 4YCOA 2W91A 1RQBA 4UTIA 1WOBA 3W87A 2ZZ1A 3SSZA 4DI8A 3ZVHB 4XZIA 5FAJA 1FWTA 2NXGA 2BS9A 3CTTA 5F1UA 3VX1A 1TWZA 4QITA 2OEMA 5LNVA 3EAUA 5G4EA 3FYYA 4PMJA 2E68A 1Y65A 1MRQA 1V0KA 3HQNA 4UQBA 1A5UA 1Z32X 1BF6A 4L9ZA 3FS2A 4CNSA 3TTOA 8XIAA 2TRSA 1YIXA 5BXTA 3TCEA 2Y85A 3AI0A 5D09A 3V1PA 3KDOA 8TIMA 4DM2A 3VMOA 3C4UA 3PB0A 5EMKA 1WPCA 2XFYA 3UPBA 4EVZA 4IH3A 3AYRA 3CIXA 3VIIA 1FWBC 1JIBA 4WX2A 5FSDC 1E0UA 2WWDA 3A24A 1YPXA 1GYMA 4GVIA 4I6KA 2ZWZA 1SO3A 3WL0A 4LVFA 2CLIA 3AYSA 4EF8A 4AYGA 4FB7A 2G3MA 4TTUA 4P8VA 4UFJA 4GINA 1KFWA 2HBXA 1E15A 4L80A 2C13A 1LL6A 4PMOA 4MLJA 4B3LA 4MG4A 3B0YA 1QWKA 3WSUA 3WK2A 2WNNA 3H2FA 4DEFA 3LHWA 4FX7A 3WD0A 1UH4A 4FZIA 3QFWA 3UG4A 3B97A 2VJXA 2QQ6A 4MSSA 3IJLA 1S3HA 2G3FA 5IM51 3MU7A 5KINA 3ZJ6A 2F2KA 4TIMA 3I7QA 1KXTA 4QSHA 5A1AA 1T40A 1UP0A 2E6FA 2Y63A 4N9EA 4U4MA 1G5AA 3UG5A 4GE8A 2BODX 2V6AA 4MGGA 3FEMA 3VGBA 2HEJA 3L12A 1J93A 4JS3A 4JHZA 4WUIA 5A6LA 3UA3A 1UD6A 4WOQA 4HMCA 1BD0A 2PD9A 3U8GA 4DWDA 4IQDA 4GYJA 3NDYA 4H04A 4O0QA 4LQ1A 3CZJA 1U30A 2J7GA 1JUEA 5HUPA 1RD6A 3PF3A 3KLKA 1HFBA 3Q67A 5LHFA 1QDSA 1CCWB 4KMQA 1C90A 1XIBA 4ZEPA 4G6CA 2PDWA 4BR1A 7ENLA 3QC3A 1T8QA 1Q66A 4NJHA 5FCZA 1POKA 5FJPA 4ZE5A 1RCQA 1PX3A 4CNOA 4S3AA 3HFTA 2J7DA 4H00A 2CZVA 1A5BA 4FF5A 4DJDD 3NIYA 3ES7A 2GQ8A 3IUHA 1B90A 4MKNA 2CLMA 3UZYA 3THCA 3WEMA 5LKYA 3UQNA 2EBNA 3W7JA 6TIMA 4PMDA 4XTIA 1V7AA 2Y70A 4IXXA 2J6XA 4ZSTA 3GFZA 3CQIA 1E0XA 3NZ1A 3NM1A 3L0GA 4ZGYA 4FLRA 4QE4A 4JTQA 3M4HA 3AMLA 4AZGA 2B4GA 3GNXA 4IFKB 1XM3A 1H7PA 1O5XA 1P5BA 2NZLA 3L21A 3P60A 4PTDA 1S1RA 4IIBA 4F0KA 5J5RA 3A21A 2OT0A 3I7RA 1G01A 4CQAA 4GJJA 1IZKA 4XZWA 3H4XA 1MRAA 3WNOA 4EIVA 1H1YA 4IT1A 1VR6A 1UJPA 4OOUA 1BVZA 3BG9A 1UBSA 2E40A 3LCHA 3ISIX 1QR7A 3FJNA 5GNXA 4Q4QA 4GY7A 1DPMA 3DKJA 2QIWA 4LVGA 2RDUA 3KVKA 3KL0A 4UQAA 3TYBA 3WLQA 4IIEA 3FLUA 1H49A 2W66A 4UFMA 3VAVA 3KTCA 1V02E 2ZX5A 1DIOA 4Y96A 1CLVA 3QOMA 2Y62A 1UB3A 1R3WA 4FNPA 3UF9A 4Q6XA 4Y2WA 5T26A 4F0LA 1V3JA 1B30A 3O6DA 4R33A 2DUXA 3NTYA 3T40A 2PDJA 2QUNA 1Z42A 4LUYA 1NVMA 4MM1A 2R82A 3B9DA 3ZVIA 2IKJA 3NSNA 3TYUA 1XF0A 1VGAA 3PZVA 4NU7A 5HR6A 2CLHA 3R7MA 3II1A 4CN4A 1EJWC 1EJUC 2G3JA 2REQA 2V5JA 3ZS4A 4C6QA 3VFLA 1E0VA 1VRXA 1KGWA 4H83A 1A50A 4IL0A 3PBGA 4MNLA 1ZAHA 3SCNA 3PFRA 4GACA 5FKYA 3VU2A 1VP5A 1P4CA 2XFRA 3DKLA 4K8GA 3V0SA 4CVUA 3AOFA 1VEMA 3AS1A 1SGJA 5HOSA 2F2HA 1F9CA 4HGXA 2DPEA 1R85A 3L0KA 2ZVIA 4UQEA 3JZEA 3JR2A 2WJZA 4IL2A 3U4FA 4C6OA 3H2NA 4Q4PA 3K8MA 3PJWA 1SFJA 3WY1A 2F61A 4GGHA 3I4EA 4JBRA 1CECA 1TKKA 1US2A 1E6QM 4XAGA 3WKZA 1ITQA 1KW1A 5F7UA 7ODCA 3W23A 4DZ5A 1F07A 1ZB5A 2VFFA 4RUBA 5A2AA 5CQ1A 4H8VA 3W7QA 5A8MA 4EXQA 3WF2A 5I3IA 1KLZA 4GQGA 2DZTA 3N04A 4AVFA 1KFBA 4NYYA 1FWNA 5CG7A 3V16A 3WLIA 3A4XA 2CZEA 3UZJA 3TW6A 3TQPA 5A3HA 5LIXX 1H11A 4C1NB 3P8JA 3ZSSA 5K4ZA 2BP1A 2HVMA 4LYQA 1JFHA 1PIFA 3SN0A 3LV6A 3K4WA 4MAZA 3NL5A 2CIPA 2G5WA 1J10A 3U0HA 2ALDA 3HBLA 4B4FA 2WC4A 1QO2A 3GXDA 1BYAA 4AZCB 3CAKA 3P3BA 4Z1CA 3QV6A 3OLEA 2OLSA 4MZYA 1DQXA 3APTA 1TVLA 1RZMA 4RDZA 2OWCA 1TV4A 1FXPA 3EPNA 3VE7A 3GLCA 4F2UA 3N25A 2YCIX 2PU1A 1RVGA 2D0GA 1ZU8A 4S3FA 4W5UA 3G1HA 2FFCA 1AQFA 2P3ZA 4XZLX 1C7TA 4LBSA 4CUCA 3ANUA 4ROQA 4ERAA 2F38A 2C79A 3WFZA 1RA0A 1UROA 1EJXC 3AHZA 1LRTA 5CZTA 5BOEA 1RJRA 4W87A 4OV4A 3WBAA 3CUZA 3CV7A 1KM6A 3K4DA 3SRDA 2VVNA 1KCKA 2P88A 1WV2A 2IQDA 4Z08A 3RX3A 2FH6A 3MDUA 4XZBA 2QUUA 2DSUA 3GB6A 1E55A 3KWSA 2Q02A 1PX8A 3DHDA 1LLZA 3KBVA 2QF8A 3RDKA 2VGFA 1RLCL 3TN6A 3JRKA 4LS0A 2PDUA 2GJNA 3IAQA 3MMUA 3AUOA 5GQBA 4JGDA 2AL2B 3HPZA 3SM0A 1AL7A 4R5EA 4DUXA 5I3DA 3ARQA 5B7YA 2F6KA 2DVTA 1UZ4A 5DMYA 3EEGA 3AUJA 3N13A 3IIXA 4BQ2A 2ZRVA 1BG9A 3LZ3A 1JCTA 3SEPA 3TNBA 1TVPA 1XLGA 4QQ3A 3H2EA 3LTPA 5E0KA 3KS6A 1GVYA 1ONEA 4B3KA 2YDQA 3BGJA 3SCOA 1E3ZA 4NAEB 3WENA 1XBVA 3NVDA 3AU2A 4AD5A 3NOEA 1VH7A 2YYTA 4N9CA 4NZJA 5AB3A 1DJYA 3BZGA 3OGSA 1IHIA 2O55A 3N6HA 1X97A 2WK2A 1W5NA 4AEOA 4KS0A 4X0VA 4QEHA 1A0CA 2J4GA 1A4LA 3RLVA 3KRUA 3DDMA 1SMDA 5AHIA 1GGOA 1Y0EA 1MFVA 2PDKA 1K02A 3PZQA 3TP4A 4V15A 3F2CA 4KRUA 3FYPA 1ALDA 1GZGA 4UR8A 3V4BA 5TBOA 3KZSA 3UCDA 3LM3A 1FWDC 3PP7A 4IGSA 3REQB 3KRSA 5BXRA 1W9UA 1HW6A 4JAWA 2E9MA 4CD4A 3OIHA 3W2KA 4MWAD 1DWJM 4UFIA 4N42A 3CEUA 3KOXA 4MDOA 2CBVA 4DBDA 3TMLA 1PKYA 3M0IA 4NASA 5BRPA 1XD0A 3D5HA 1NELA 4DPPA 5ECUA 1JZ3A 5EY5A 1MNSA 2CBUA 5K4XA 3PTQA 4MADA 1H7XA 1F61A 1XW8A 1UUMA 4I9JA 4LC8A 2ZIDA 3MV01 3KCLA 3MQTA 1X1NA 1PHWA 4KFOA 3MO4A 2WVUA 3UD6A 3LGDA 4IHCA 2ZDSA 1E6PA 2ZX8A 4PUWA 5E6ZA 3SO7A 4JR5A 2OLAA 4C90A 3MWAA 4DXXA 1M5WA 1UWQA 1R3VA 3NQ2A 3V0UA 1PKNA 3P67A 3S1GA 1UC4A 3SCWA 4KETA 1SW7A 4JIRA 4M6VA 3ONCA 1R9ZA 1UUOA 4DY1A 3WUFA 1MQRA 4FPSA 2YFNA 1A4MA 3PUGA 4BJHA 3NCOA 4AC1X 2ZUWA 5DO8A 4FEZA 4OV9A 5DXXA 3F4CA 3HTWA 3LCLA 3L68A 1I75A 2WKJA 1WAWA 2YDAA 4M0XA 1ME8A 4V1YA 1SW0A 3OODA 1QWGA 3C0SA 4F79A 1OYCA 2TYSA 1W31A 1ESWA 1VCGA 4Q22A 5U7SA 3UGVA 3RFAA 4EK7A 3DENA 1XP3A 2VO5A 2R94A 4I5XA 3LRLA 4WSJA 2F9RA 2AMGA 3I3DA 3NQ7A 4ZO9A 3WUEA 5AC6A 1IR1A 2Z28A 3O2LA 4XVDA 3NUKA 1XUZA 4WGHA 3DG3A 5AECA 5HPCA 2PWHA 4QE1A 4MB1A 1V77A 4RPPA 5DFAA 3EDJA 3I10A 2GGHA 2V69A 3O7UA 3ORWA 3R89A 1PUDA 2BGNE 3R6IA 4FXFA 5HWMA 1ZBCA 2PWGA 1Z69A 3BJTA 4GA8A 2Z1XA 3KX6A 1FDZA 3U3HA 3O6CA 1OB0A 2GZXA 3B3DA 1KFJA 2FPVA 4AZ5A 4BKNA 1JI1A 2AOSA 4PMXA 5F4WA 1K9EA 3D0CA 3TC3A 5J8LA 3GVRA 1ZRQA 2E1DA 4DAIA 5C7VA 4RCXA 2YB1A 1K9FA 3UYCA 1W9PA 3GG7A 2VX5A 3DFYA 3VE9A 3G3MA 4U33A 5GVJA 1GJPA 3BICA 3AZSA 4ZB5A 3TV8A 4GBUA 1KCZA 3LERA 3M46A 1F8IA 1XYAA 1AD4A 2EKCA 1EBGA 5FF0A 4O52A 3B0VC 4OGZA 3IIOA 3CLMA 1GVSA 1SR0A 4M5PA 2V2HA 3GHUA 2YW3A 1Q7MA 1LM1A 2HS8A 3RLGA 4O1EA 3LCFA 1H0GA 1DQUA 5ABEA 4K3ZA 4CCDA 4C5YA 3N14A 3OJGA 4HTBA 3DESA 4WEVX 1TPC1 3AFBA 1WA3A 5K3VA 3G1YA 2GFTA 1WYIA 2WPBA 4EXAA 1UZDA 3MVTA 1XBYA 4UXDA 1FX6A 3T07A 2D3NA 1NOWA 2WNZA 4AHPA 1J6PA 1O7AA 4MYXA 1EX1A 1J01A 1ECQA 3A3XA 2FZMA 4LRSA 2ALRA 3W4RA 2UWFA 4R27A 1NM9A 3A9BA 2ACSA 2CLKA 3HG3A 2DGAA 1AQHA 3WNNA 1UC5A 3QRHA 4H1ZA 1JQVA 3EWXA 4ATLA 2DUAA 4XIMA 4GCAA 1R87A 1MW1A 1K7EA 4L6DA 3CPGA 3E2SA 3IS4A 1P0BA 2UBPC 3W7MA 1XLBA 2XFFA 1RR2A 5AC7A 1E4NA 1JNEA 3PULA 4GKTA 1YDYA 5D2TA 4O4VA 4JY9A 2C1HA 3PUDA 1E9IA 2RDWA 4Q8PA 3VNMA 2EG7A 3UEQA 4S2CA 1V7YA 4KEUA 4HZ7A 3DFOA 1KLYA 3B9EA 4HZMA 4UTKA 2X8RA 1GQIA 1OF6A 5IHRA 3GKFA 1QASA 3GIYA 5D4YA 3O8AA 3W1UA 3LBOA 2FJKA 3GTXA 3PAOA 3W84A 1WBJA 1JAKA 1K77A 3MKVA 1PHQA 1HKIA 2FJUB 3GXNA 3W3OA 1BAGA 1CZ1A 5DF0A 1T7LA 1HJVA 2DIKA 1EJ7L 3W81A 4CEUC 5CZKA 4HNVA 1QBAA 3OA5A 4IFOA 1EZ2A 1QRQA 4LUIA 1KBIA 3H8AA 3UP8A 1AW2A 1WDDA 1E9ZB 1EH9A 1TCDA 4FALA 2BVTA 4NXSA 3O3RA 2WVTA 1PTAA 3CM4A 4FXRA 5DMNA 9XIMA 1VFFA 3LSBA 4RX0A 4NP7A 2EQDA 1U5JA 3E9AA 1Q6RA 4IFRA 1GKPA 1M04A 1VB9A 3S2CA 1JCJA 4X0NA 4RNFA 4JHOA 3N2CA 1JL8A 3W38A 4LTSA 1S3TC 3MSGA 4MJ2A 1O4UA 3BCDA 3MTWA 1B3ZA 4TUFA 2RH9A 2XVPA 1VENA 4GUHA 1R86A 4GLEA 3NO1A 5I23A 4YYFA 4RPQA 4CQDA 2PRHA 1V51A 2X1TA 3BLPX 4DWSA 3G6LA 2DSVA 4LCQA 3VIPA 1YEYA 1HJWA 3IUIA 2PZ0A 2BFGA 4U3CA 3T42A 1Z48A 4J2PA 1HP4A 2ANUA 1GHSA 1EKOA 4CU8A 1QPQA 4HNNA 3VCNA 2XHYA 2IMRA 4LH8A 3QR0A 1O66A 1WO2A 3GIQA 3QF0A 3CHFA 2FYMA 1JZ8A 2OR2A 1WKFA 1EHAA 3S2NA 1C9WA 4JCMA 2VC9A 4WDWA 2C1GA 3PHAA 2VGGA 3L5AA 3G6MA 4H7CA 1OM0A 3KBMA 3OZMA 3WL1A 1HKKA 1JCLA 2HZGA 2D24A 4M56A 3ZR5A 3QBUA 1Y8BA 1NWRA 1HJSA 3OP2A 4PB4A 1JRBA 1KC7A 3W72A 4EPBC 3N4AA 1GG1A 2ZKMX 1MEHA 1PB0A 3IVUA 4A21A 1XIMA 3WEZA 4Z42C 5HATA 2X30A 1QI4A 1EXPA 1GOQA 4UQDA 3HQPA 3WBEA 2H8XA 4D8ZA 1XV8A 3WLSA 3BANA 4LYRA 1J18A 3AC0A 1XKJA 1ZBWA 4FMVA 2XIIA 3LHUA 2QEZA 2X16A 1KNWA 3UWEA 3EBVA 3WF1A 2C8NA 4ONVA 2WMGA 2DT2A 3L23A 4DB7A 1S5MA 5FJOA 1L9WA 5D02A 1YBQB 3USBA 3BCJA 4A4AA 5ABFA 2CYGA 1XG4A 1KM0A 1XLKA 4JIHA 4H9VA 2FHCA 4NL1A 3JW7A 5BOFA 3NQDA 4ZSUA 2WSKA 5A2CA 2WQPA 2DT3A 2WMIA 4CQBA 1FWCC 4KF1A 3TYZA 3ZT7A 4JTKA 1AUSL 1WQ5A 1OT1A 1X38A 1O1HA 2W0UA 3QJAA 4L5ZA 4NI3A 5DBTA 1H61A 1TMLA 5CC5A 1QNQA 2DT0A 4DBSA 1Y5WA 4AH7A 1OF8A 1MUWA 4MY8A 2JE8A 3ITLA 3PSVA 4QR6A 4C6NA 2XTKA 1OBAA 3DERA 5D05A 3OA3A 1GEHA 3CUJA 2FKPA 1U83A 4JTAA 4UFHA 4C7GA 3TN5A 2C3ZA 3H23A 4RDYA 3EKGA 3FEQA 3ICJA 3OU8A 1MSSA 4AU0A 3DG7A 2YZRA 1XL9A 1H5VA 3M1ZA 3EX3A 1IIHA 1T41A 3OTRA 5C6MA 1A5CA 4O18A 1R38A 1CGUA 3GSMA 4M7TA 3W7KA 4NF7A 3FDGA 3K4AA 4F0RA 5E93A 1BKHA 3QH2A 2FHFA 1GK8A 1LBFA 2NX1A 2QCHA 5I3FA 4AG0A 1V3IA 3B04A 3HQ1A 1P0NA 1FTXA 3PG9A 3KL5A 5A6MA 3OO2A 4N6EA 4GHRA 3ZJ8A 3ALFA 4GNVA 1W3NA 4PCNA 2X0SA 3ARYA 2XN2A 4WVXA 1GQKA 1ZPTA 1E71M 2QDEA 5D38A 4A3UA 4N02A 4M1BA 4F48A 4B9YA 3ABOA 3AIQA 1XLHA 2VVSA 1KWGA 4FS9A 4ZR8A 5GPRA 4IPPA 2G97A 1J11A 1VZWA 1LQ2A 1FWGC 3WDPP 5ABTA 3RU8X 4K37A 1XDLA 3FV9A 3QPZA 5G1MA 2VX4A 4FNRA 4O1AA 1ONXA 1Q7QA 4MF4A 1RV8A 1OSEA 3V5CA 4W84A 5LZLA 4JD4A 5HA7A 2YPIA 1WDWA 3ITXA 1J9YA 1SJDA 1OX4B 2CERA 4WJEA 5DCBA 2CW6A 1ZTVA 1TV3A 4AZCA 4Z1BA 4HHHA 2PU0A 1KRCC 1QPNA 3VTRA 1EJRC 4Y8EA 3BURA 4FOJA 4HK6A 3VNDA 3STFA 1Q8AA 3H12A 2O4MA 1NEYA 1K9DA 1SMAA 2RFGA 4QDMA 1GG0A 2DV0A 3L9CA 2CHOA 2RDXA 3WNMA 2E6YA 1W56A 2V67A 3TSDA 1LWJA 1UIOA 2OOFA 4K68A 4IMDA 4ZTYA 2SFPA 3DC0A 4XZ9A 1YQ2A 3VUSA 1BRLB 3KP0A 2NV1A 1L8PA 2R1KA 5A8GA 4O8AA 1Z7AA 3DFTA 3MA8A 4U10A 1OG0A 2CHRA 4EWND 4D6EA 3O1NA 4AD3A 3VYLA 3ITVA 3RK8A 1CXIA 2YBTA 2ZZ5A 3S6OA 4TV5A 3PBUA 1F3EA 3SCSA 2VUYA 3S6DA 2BX7A 3ZSTA 3CL7A 1R7AA 3EA3A 4GYFA 1A47A 3GIPA 4Z2LA 5DQPA 4DZIA 3WLKX 4I8DA 1HNYA 4G1KA 2NXHA 1IIGA 3OBEA 3Q4DA 4C91A 3KLLA 3B9AA 1GQJA 3OLGA 3P5YA 2V81A 1YXCA 2YLAA 2VR2A 2PGWA 1VFSA 2BXZA 2JIEA 3UCCA 2YXOA 4QRNA 3SAZA 2WBKA 4Z0SA 3S46A 3T8LA 3DFHA 3B40A 1RP9A 3LLDA 4MDPA 3CMFA 3RR4A 3W7IA 2TODA 4R53A 3WQFA 1TPWA 1KRBC 1UP3A 3E2RA 4Q7NA 1R6WA 2Q09A 1UZ1A 3AHVA 3CTLA 1TPUA 2JKPA 3MC5A 2XH0A 3W7HA 4U31A 3PPFA 4KCUA 1CIUA 3EWCA 3DG6A 1C8YA 3S9IA 4UTFA 4ZQNA 5T9BG 3T0TA 3L4XA 1CLKA 3FFSA 4A3YA 2V63A 1MUCA 3WQ8A 2OODA 1EC9A 4UWMA 5LIUX 1KTNA 2OZTA 4OIFA 1XQLA 3G0UA 3CWHA 4NAFB 1LCOA 3B06A 1R2SA 1R5YA 3VDGA 3PWIA 3ZQ9A 2RAGA 5HQLA 3KRBA 4IISA 4BWLA 3SUSA 4ZQMA 5D2YA 2E5DA 3SGGA 4YMZA 4AMAA 4X2RA 5I3HA 4AD0A 2NQJA 2GL5A 2D22A 3ZR6A 2C18A 3XINA 2Z1KA 3U6WA 1DE6A 2KX9A 3OPSA 3GW0A 3GYCA 4QEEA 4I5UA 3S83A 1K6WA 1MEIA 5KSWA 3OQ8A 3R12A 1N2VA 4QCFA 2OQYA 4NYUA 4QJ5B 1OCJA 3PBWA 3S2LA 3H2AA 4MZ1A 4XD4A 4X60A 3R0DA 2YGYA 3IK2A 2Z0IA 1N7KA 4C6BA 3SCUA 5ABFB 2A3CA 1K7XA 4B92A 2VL4A 1VHNA 4H9XA 2PTYA 4KRZA 3O07A 5KTLA 2DW6A 3QLLA 3E0VA 2R24A 3B8SA 4NZ4A 1BVNP 1CGVA 2FDMA 1VRDA 1K70A 1LF1A 2VFEA 1VBUA 2AAMA 5DMLA 4OZOA 1OVDA 4UNIA 5BXPA 1JUBA 3WQ6A 3T08A 5HJYA 1UWRA 3NG3A 1FY6A 3L4TA 1TX0A 4DBEA 1JD9A 1TX2A 2PDMA 3ZM8A 4OTKA 3L4VA 3R94A 4ZZ9A 1JULA 1R7OA 3SRFA 1X6LA 1XYMA 2W61A 4JDYA 4KESA 2ABBA 1AH0A 4GD0A 5HNTA 1FOBA 5EBAA 3AO0A 5KETA 1XC6A 2G3NA 4EXBA 3AQUA 4WOZA 1W1A1 3HMCA 4OUEA 4H01A 1WDPA 4GFSA 3SN4A 3HFYA 2VFGA 2HISA 3ZFHA 1PTDA 2H90A 4WKAA 3RG6A 3P0WA 3VKCA 3E0WA 1TV2A 3D46A 3WFAA 2ZXAA 3GXIA 1K7FA 1A3HA 4AMCA 2ZA2A 4GK8A 5ABGA 2BV9A 3TVAA 4J3ZA 1FWFC 1TA3A 4EF9A 3SQMA 3CUGA 3O15A 4RR4A 1TWDA 2EPOA 5E70A 1DYSA 1CGWA 1PIIA 1NDYA 3A3HA 2DORA 3ARZA 1AW5A 3C52A 2W3ZA 1JF5A 4WR3A 1RY8A 3CQJA 3K5XA 2AQWA 4J35A 1SZGA 3BJSA 2DVXA 3W73A 1X7IA 1WDSA 1GZ1A 5LIKX 2ZQ0A 3FYOA 3M16A 4LUJA 1MXDA 1T6MA 4P61A 2OG9A 4UBPC 4AWSA 3CO8A 2XM1A 4FI4A 1DJNA 2ZZ7A 3N6JA 4DXKA 3GHTA 3TROA 1NARA 3PZGA 3GDBA 2WSYA 4IP5A 2ZC1A 3M0KA 4GUFA 2XIOA 2W27A 4PRTA 2FQIA 4NIRA 4GO9A 2X1SA 4S3EA 2JF6A 2EGZA 2FB3A 4MPQA 1SFLA 3WNLA 3FGCB 3W2NA 3MUY1 4MZ8A 1XSKA 1XLIA 3BAKA 1OX5A 3ZLGA 1UR4A 2QF7A 5I02A 4XBJA 1OK6A 3EB2A 1TE6A 3C0JA 4L56A 4F4RA 3C3NA 4KEVA 3GG8A 1CYGA 2J88A 1TZ9A 3SI9A 4Q33A 1U2YA 1XUUA 4OECA 1KR1A 3QSRA 1QFEA 3R2GA 4GPNA 3VC6A 4B91A 3UWQA 4RXGA 3PAJA 4PGLA 1DL3A 1S2TA 4AW7A 2FMNA 5LXXA 3GXPA 4ZVJA 2Q3RA 4YU1A 3M47A 1E43A 1EXBA 4Z17A 4H9MA 4UR9A 4ZCWA 3A3WA 5KZ6A 4K6AA 4HHMA 2IPFA 3O63A 1LRQA 5HJLA 8CGTA 1UIPA 1W2VA 3W24A 3LQLA 3FSTA 3H2MA 3KBNA 1S38A 4P8XA 4XG1A 1RCXB 1RSCA 3TKFA 2PZNA 1D7FA 3KBJA 4Q8VA 1XINA 2WCAA 3OGVA 1I1WA 4O1BA 1UKOA 1PL9A 3TOYA 4CNNA 4KFNA 3JZUA 3VMNA 5I78A 2NXIA 4M29A 3GAKA 2ADAA 2QPSA 2XWDA 3NA8A 3CK5A 4BHYA 3EWBX 3CUFA 4LX4A 1XRSA 4ZO8A 2WV8A 2WVSA 3QC0A 3W7NA 4IMGA 3DIPA 3PM6A 4WDXA 5FOOA 3KOFA 4HB7A 4LJ3A 3C6CA 1L6FA 3FJ4A 3GM8A 4CD5A 4HQVA 2E8ZA 1M68A 5H8UA 1WZMA 1J0HA 2DSZA 4KIEA 3V75A 4RZ4A 1UBPC 1V6VA 4K7YA 1VQTA 1H09A 3WQWA 2E9LA 5CC7A 1SSGA 3P6LA 4LC6A 3E49A 5T8GA 2D0FA 4CCEA 5FEPA 1UMLA 4YTRA 1XQKA 2BY2A 2ASHA 2P0IA 3VIOA 5DN1A 3KZPA 4H9ZA 3WELA 2J13A 4LAMA 1WX0A 4CKQA 1E4LA 1NDWA 1TWWA 1NJJA 5I09A 4ICMA 5GJMA 1OINA 1XIHA 3WD1A 3IRDA 4FF7A 3MSYA 1ZJHA 3C8NA 5A6BA 2Y88A 3D3FA 4GJ1A 1H63A 4YLWA 2PDIA 2PRMA 4QSFA 5B80A 2C16A 2ZA1A 1ZJBA 3GXFA 2PDLA 2HDJA 3CLWA 2JK2A 1AJZA 1BWVA 3VD7A 2FHBA 2A3LA 5CC3A 3NM3A 4I5RA 1H41A 5HULA 4MLRA 1F05A 3AIUA 2HXUA 3B05A 4MY9A 4PMVA 2ZX6A 2GDVA 4CU6A 3QTPA 3PUEA 3LNPA 5T9CE 4C6CA 1FUYA 4WQ6A 3TZFA 2Y24A 1WCGA 7REQB 1B9BA 3TWAA 1ONWA 4LUTB 4UTMA 1H2JA 4H9UA 4ROPA 2Z7GA 4F3HA 1Q6DA 4L7ZA 3VDHA 3KCOA 3A5FA 1GOIA 4FR1A 2GWGA 3H2OA 3A4AA 1ECEA 4GVGA 3RIKA 2IS7A 2Y5JA 1KKRA 2GVYA 3N17A 4G7FA 5F4SA 4O8RA 7A3HA 1QNPA 2VDHA 3SQSA 3W75A 1Q5MA 4PH6A 1HL9A 1L6YA 5AY7A 3UJFA 5BXSA 3CT2A 3E5BA 4DJFC 4PUMA 1K8XA 3S5NA 5I3GA 3TU9A 2FVKA 3PANA 3AWNA 3L4UA 4IGHA 5HWNA 3MP3A 4KFPA 5U4NA 2NQ9A 3OG2A 1VBHA 4PL1A 1Q6OA 2CCRA 3M0JA 3IK4A 1T96A 1YKWA 2PWFA 1WKDA 3LMYA 3ABXA 1GOWA 4L65A 4FNQA 4Y8FA 4X9SA 2Z1VA 1RA5A 3K8KA 1P1MA 3ME3A 4DJFD 5KITA 3LSCA 4N0RA 2OB3A 2ZE3A 1EP2A 4AY1A 3RYSA 4L9XA 4IIGA 3L4ZA 4ZOEA 4LV9A 3TMQA 1GYLA 1KFEA 1YTDA 3VKDA 5HR7A 4HZ8A 2OKTA 2BY0A 4JQAA 1B31A 3UR2A 2BOEX 1EO7A 4IUOA 4TX8A 3M0ZA 3QQWA 4LW7A 7TAAA 5A5WA 2PA6A 4V27A 3RCMA 1YTKA 2GDQA 1LRNA 1ISXA 2IUZA 1ADSA 4ZO6A 3HJZA 2WSQA 1XIEA 4QJ4B 3NPWA 3N2OA 4XAZA 1L8NA 3ARUA 3PR2A 2I9UA 1B3WA 4GVFA 3EDFA 3TEVA 3TYDA 1OFQA 3BVJA 1L6GA 1VBRA 4C6EA 3UWWA 1X6NA 3WBWA 1QBBA 2ZUSA 4N7QA 4OKDA 1V6WA 1W5PA 4QXIA 3IJ7A 4H6EA 2GUUA 3QMTA 3BMVA 4B2DD 3UR5A 4BQ4A 1EA9C 4XSMA 1I4NA 4V28A 4B5WA 3ARWA 2WNWA 5HDRA 4GO8A 2XVNA 3CL6A 3T2OA 4H4IA 1D2KA 4CEXC 3AALA 3I65A 4KWWA 3BGGA 2B81A 3E12A 1A53A 3PG8A 1GHRA 1OQFA 1S5TA 2Y0FA 3EOUA 4OBSA 3VCCA 3PVFA 2GVJA 3U9IA 4Q4MA 1M41A 4XUYA 4YIWA 2V5DA 5JU6A 5XINA 2HPMA 5AOUA 2YCJA 2REQB 1LBMA 2FPTA 3DOPA 3LPFA 3QTGA 4AIUA 5A94A 1W1PA 2NQHA 3LDVA 2NUWA 3BOXA 6PTDA 4NAEA 1KB3A 2DZBA 4JNYA 2IXVA 1P6WA 2E4TA 1YE6A 3CYVA 4UC5A 4GQQA 4QJ1A 1T0OA 5E0CA 2Q8LA 3VMPA 5MKGA 1EWDA 2BVYA 3MWCA 5FJUA 1JGIA 4U2ZA 1QW8A 5DT7A 3RX4A 3YPIA 2PB1A 1TPFA 1JYXA 4NAFA 4UMBA 2CLFA 3HIJA 3T2QA 3FJLA 1I6NA 3AAMA 4PFMA 4JHMA 1XR2A 2C7FA 3W28A 2QDDA 1NF7A 1JFXA 2J66A 5DEZA 1U1JA 4WDUA 3W7EA 4RJEA 2BTMA 1QAPA 2YXXA 1K6AA 1M03A 3HU7A 2OX1A 3KM8A 4EP8C 3IWPA 3AIWA 4TQTA 4NG3A 1UD2A 3JVAA 1V0LA 2OYMA 1C93A 2WSPA 1ITCA 3URQA 1C92A 3IGHX 4FOUA 4PCFA 4UNKA 4J2MA 1V3HA 3LCGA 1D8CA 4D6HA 4H2HA 4LNYA 4F0MA 3FJ6A 4UFLA 3ES8A 2Y4SA 4XQ6A 2A7PA 2PDFA 3ATYA 1H7OA 1YRRA 5A69A 1U1HA 1UWIA 3WH7A 4X63A 1D9EA 4OT7A 5EFFA 4DO7A 1VEPA 4FLOA 4C6DA 3B0XA 3URAA 5LNWA 3DC8A 2UY2A 1PDZA 4DJDC 3FX4A 3B0UX 2WHJA 1VKFA 3LHYA 2QPUA 1ODZA 1N8FA 3IJQA 1KXHA 3NYDA 2QV4A 3TCSA 1IEWA 1ML1A 1DWGM 4MUZA 4MNMA 4DJED 3M64A 3UJ2A 1IF2A 1OHLA 3LLFA 4QAIA 2D20A 2Y7EA 4MJ4A 4R3UA 1H5YA 4YL2A 4HD5A 3N19B 4E8DA 2AL1A 1YPIA 3THDA 2O4QA 4F0HA 4A35A 1RBAA 5CJNA 2JGYA 1YPFA 3RMJA 1U33A 3E0IA 2G0WA 1IXQA 5IBXC 1V3LA 5F2MA 3IACA 1FWHC 3AIEA 4NRSA 2FGZA 4US6A 2WPGA 1G7UA 3GD6A 1C29A 1CNVA 1KD0A 4QNEA 2WXDM 4UTTA 3FW6A 3DYOA 1RAKA 1H51A 2VDIA 3W76A 3I6EA 3SCPA 4O1DA 5AYYA 4Q7IA 3GVGA 4PODA 4S3GA 3B8UA 4UTWC 1LT8A 2ZWYA 4PN2A 3G5EA 5FF4A 4PE8A 1X6UA 2GVLA 4D6FA 3LPGA 4K7VA 1DJGA 1TJ2A 1F4HA 3APGA 1SUXA 4AUBA 3TWBA 1YE4A 3S47A 1VFUA 4FIRA 4JEJA 4HPHA 1XLLA 3VOCA 4FSAA 3EKZA 2Q01A 3ONBA 5I5RA 3ATZA 4NX0A 5FL1A 5G2IA 4UR7A 3SGUA 3IEBA 5AYXA 2RJGA 3G1VA 2GUBA 4KEZA 5CLWA 1J2BA 2JF7A 3NQEA 1XRVA 3AMKA 2F8QA 5JMUA 3WMBA 4BK9A 2RJHA 1TJ1A 1Y5XA 1XSJA 2YJQA 5A6TC 3C0LA 1RVKA 1KCXA 1ZCCA 1I1XA 2VC6A 4LAKA 2BVDA 1C91A 4ORIA 5HNUA 5FEWA 3TOPA 1ZAJA 1D3HA 4AZ6A 1HKVA 3N9SA 1SZNA 2WLYA 4ATDA 1HP5A 1M01A 3IUDA 3R5EA 1QI3A 1XS2A 3E74A 4LS1A 4E4FA 2DSWA 3GWQA 9CGTA 2PSNA 1ISWA 1XLJA 3NQGA 2PE4A 2X09A 3KBSA 4IIHA 3CMGA 3VIMA 3G77A 4E8CA 1Q85A 2ZUMA 3CPUA 3IANA 1JCYA 2VR5A 5DY3A 3PBMA 1Z6KA 1DTNA 3GG0A 3DECA 3URNA 4AZ7A 2I9EA 3WUGA 1AODA 2ODOA 3QXBA 1PXGA 3RX2A 3OHMB 1I2QA 2VM8A 2Y89A 4BI7A 1XH1A 2QAPA 4MFDA 4GIEA 3KAOA 4BZYA 1IZCA 2DZVA 4LXFA 4XBSA 1E56A 3SIMA 3L4WA 4IG2B 1MQPA 3R8HA 2EPHA 2PP0A 4WLCA 1KCLA 3NZRA 1QK2A 1TTPA 1AFSA 2WO5A 1TUFA 1OADA 3LTSA 4HK7A 2CKRA 1JCNA 4HHLA 4A3RA 1TRDA 3EEZA 3QM3A 2HV5A 1WE5A 5D2WA 3T1GA 1CBGA 3W6MA 4WCJA 5JIWA 3WZ0E 1H4PA 2PTZA 1IYXA 1ENUA 4AWUA 3NXLA 3GNRA 3QYSA 2OPJA 3QOKA 1V79A 1L2QA 1XD1A 4BEUA 2CXEA 4Q32A 4PYSA 4JCLA 3N2TA 4I9AA 5K2ZA 1XCWA 5DANA 1C3FA 3R10A 3NQ8A 4PCTA 4O0KA 4PCPA 2A7NA 1Q8JA 1EC7A 1OD8A 2EXOA 2C15A 4CNUA 2GVEA 3EXSA 3T6CA 1P6BA 3OQEA 2YA0A 1DKWA 3N4FA 2EPKX 3VK5A 3IRSA 1WUEA 1XLFA 2WMHA 1F73A 4I9MA 3BAWA 1OCBA 3E3HA 4AC7C 1A3XA 1HO4A 4Z2GA 2IXUA 1TTIA 1KRAC 3W27A 3NSXA 2VRJA 3BLLA 3WDJA 2ZUUA 4WXZA 4RZ6A 1Q4NX 3QVQA 4GIYA 4ZFCA 5C2CA 2WJFA 3B4YA 1XCXA 4PMQA 3UY8A 3PZMA 4KKXA 4M1RA 2QCFA 1US3A 3CJPA 3R43A 3POHA 1OGSA 1E6NA 1FWWA 2NW0A 2J77A 4IGMA 5AKQA 1KV5A 1QOXA 5REQB 5CAKA 1V6UA 2P76A 3T44A 1UWSA 1J6OA 3U2EA 2VQTA 3H4WA 4ILSA 1CWYA 2RKXA 3EXTA 4TMBA 4C6JA 2XSXA 2BASA 1V3KA 4E2VA 2JQXA 4DLMA 3BPWA 5DCEA 4FA3A 1X96A 4MNJA 3STEA 4XUGA 1O5KA 1SFTA 3K8LA 1LORA 2XH7A 4AAJA 2G95A 3AXKA 3AZRA 1DWFM 2X7VA 1NAL1 1Q6EA 1HKWA 2DEPA 2Z27A 3EWDA 1E1CA 4FAMA 4ASTA 1ICPA 3OIXA 3S1UA 4JL2A 1GOOA 2F7FA 4O19A 1US0A 4GZEA 1H60A 4V1XA 4ZQOA 6XIAA 3W7DA 3MUZ1 4L1GA 5CAHA 3LOTA 4GI8A 3AWOA 5HMSA 3WCZA 3QKZA 2J7CA 1ZQ5A 1QW7A 3AYVA 4I8YA 2GSEA 5LA0A 1BXBA 1DJHA 3LBCA 2A21A 3BE7A 4XB3A 4LALA 1OD0A 2FPYA 4JKKA 2VC5A 1UR8A 3W1XA 4DWSB 2C91A 1KQYA 2O7SA 3QZEA 2XIBA 3BG5A 1EC8A 2OZ8A 2VEIA 4RV8A 3QHOA 4MJZA 4JICA 3BDKA 2NX3A 1SYTA 3GR4A 3MDWA 3W71A 2DT1A 3J7HA 1VF8A 2R6OA 3NVTA 2V2CA 4HBKA 1FP9A 3UJSA 2QCLA 3EWUA 2VEGA 4DYKA 3LNMA 1XGDA 3K13A 4HMDA 4EANA 3WEOA 2J7FA 5D30A 3MANA 3G22A 1ZBVA 1A5LC 3IIZA 2DH2A 3CH9A 3WQPA 2R8WA 4AEFA 1WZLA 4MB5A 1P0EA 1JYNA 2BHZA 3BXWA 2AAAA 1FQ0A 2WZEA 4J27A 3KTXA 3AXIA 3UBPC 3WJYA 2BMBA 1AH4A 2FTPA 3MSDA 1XLCA 3JS3A 1D3GA 1XIGA 4S3CA 3LK6A 1R46A 3DGRA 1VBJA 2ZX7A 1OGGA 4IXHA 4QHRA 3VKBA 2PC4A 4UOJA 3AS0A 4HA0A 2EG8A 3M5VA 1IWPA 4LAOA 4M82A 4KWVA 1BHGA 3GDLA 3RGTA 4O16A 1TQXA 1ZY9A 1JXKA 2VEFA 1F5ZA 2OO6A 3CGTA 4HMEA 4PUUA 4NJGA 4ML9A 4PEEA 4MFEA 3VIFA 1THFD 3TJIA 5C9ZA 4ZOBA 3VKJA 3T0DA 4DUVA 3TAKA 1S2UA 1VIWA 1J2WA 3MMDA 4HVXA 5CEWA 2ZA3A 2OJPA 4YNGA 1W3KA 3C8FA 4ADUA 3IARA 1OK4A 5I24A 1V08A 1VHCA 3HOJA 3OZOA 4K1GA 4HPNA 3NO3A 1LYXA 3GKAA 3GUWA 4DUOA 1XLMA 3TR2A 3NYZA 3T9PA 2BWGA 3RCYA 4FR6A 2PDGA 2DW7A 1I2RA 3S3GA 2WM0A 4PTMA 1TMHA 3W07A 3HN3A 2WW5A 4HJWA 1S2WA 1WXZA 3AJ7A 1AJ2A 1XBXA 2J27A 4DNMA 5HXMA 1B3XA 3ZLFA 2C6QA 2ZDRA 2H9AA 4GXMA 2F6XA 1EO5A 3TJLA 4XBKA 4JOMA 4YVXA 1TREA 4H8UA 4E38A 4F2TA 4NZ3A 1A5NC 4ICCX 1MXSA 5DELA 4EPKA 2VWSA 1NTHA 1CEOA 1R2TA 3BW2A 4EAMA 1B54A 3C2RA 5KZDA 1GOXA 5G1YA 2QKFA 4MKSA 4NSBA 1NY1A 2O9PA 4HNCA 1GJUA 5EA9A 1ZS2A 1BXCA 4DAFA 4IG2A 3L2IA 5T91A 3TJ4A 3BZJA 2D2OA 3ZXWA 5JBFA 3GVVA 4O57A 4Q4OA 4O54A 5G2WA 2VZSA 4N6FA 3IJ9A 2H9AB 3CXOA 1DIDA 1LBLA 3GNDA 3NQ6A 3QN3A 1CPUA 1VFHA 3VGDA 3W7LA 1JEZA 5D8ZA 2GGJA 3LTYA 3BUVA 4WY0F 7REQA 1QI5A 2R1MA 2Z2BA 5I07A 5FA5A 4ZE4A 1BEUA 2XH4A 4QE5A 2G96A 3AIVA 3GC2A 1PKMA 2OZ3A 3BO9A 1O60A 3N34A 1H50A 2NX9A 3FKRA 2QGYA 2I14A 4D1JA 3MYOA 1Z44A 1FH7A 2J9YA 3W26A 1UOKA 1DXIA 1FA2A 2WVVB 4Q8UA 5JBDA 1E0WA 3C61A 4JTUA 2YL5A 5DX7A 3CQHA 5L6UA 4LY8A 4TVCA 3LUTA 2VKZG 3PK7A 2YCKX 3K30A 2C0AA 3WH8A 2QIIA 3SRHA 1L0PA 4YYCA 6TAAA 4FX8A 3WD2A 1MO0A 4UCGA 3SJNA 3AZTA 1L6SA 4E2OA 3ZR4A 3HA1A 2O9TA 1BG4A 5B7ZA 2A3EA 3CHEA 3ARPA 2JEPA 1PKLA 2VRKA 1MYRA 4KRTA 4C60A 1EQPA 3BSMA 8A3HA 3EB3A 3ARVA 2WHLA 4W8AA 3V36A 4D8AA 2Z00A 3WK1A 1W54A 3BOFA 1OFDA 1XYCA 3F5JA 2ACRA 1SZEA 2GWNA 4Z1YA 3A22A 3SIZA 1KO0A 3VGHA 3N1AA 1FHVA 3UT0A 3BARA 4MB3A 1W9XA 4HK5A 1QW9A 4JYFA 5HQMA 1HL2A 4AD1A 3V1HA 3I6RA 5EMYA 8XIMA 1DHPA 1QATA 3I3BA 2PWVA 1UR9A 4ACZA 1KBKA 2O9RA 4NNBA 4AEEA 1CXHA 2YL8A 3TZNA 3CNYA 4GZ7A 3MI2A 1Q6FA 2I5QA 3M6DA 3ZIZA 3DI0A 3L66A 2DZAA 1BQGA 1XKYA 1YYAA 3WF0A 3LN3A 3WJWA 4W7WA 1OGBA 2FZNA 5KEZA 4HJFA 3P84A 3KEHA 3B8WA 3AU6A 3MI6A 5LGXA 4BF5A 2OO0A 1X7FA 1ISZA 2A79A 4GI4A 1P0KA 2Z6IA 3LYEA 1BGGA 1V6YA 1AVAA 2JFEX 4WXYA 2Z26A 2E67A 1KGUA 4QNWA 1AW1A 1GVIA 2VI0A 3BSHA 3WH6A 4AWEA 1M7OA 2ZZ3A 2J62A 1G4TA 1EWEA 3FAWA 3XISA 4LUSA 4UTHA 5HNRA 2QCNA 3CB8A 4KWOA 3CV6A 4GI6A 2MUCA 1FFRA 4YTSA 3PPHA 4IZGA 4OE7A 4NXKA 4XVEA 1OYBA 2QXWA 4L6OA 3SY1A 1C8QA 3WLTA 2G4JA 5FI8A 3TONA 1I9CB 4GQBA 3VKKA 2XGIA 4XAPA 4QQUA 1K8CA 4D72A 3KDNA 4QM1A 3W83A 1GTHA 1Q6LA 4LFYA 1BWLA 1RP8A 3IVSA 2ISWA 4K8EA 5CZSA 1U5VA 5M17A 3E5PA 1ZFJA 4V2XA 2FMOA 4GUIA 1VFMA 5CLTA 1TWIA 1XX1A 3M0MA 4IX0A 3BSGA 3CAQA 1OFAA 1ISYA 2R1LA 5E09A 3WBXA 2GGEA 5BZAA 3BQ6A 2PCEA 3UNDA 1Q6GA 3TFCA 3W2UA 3MI3A 1ME9A 2DUZA 3CZLA 1XIJA 3M0LA 1E72M 4JTIA 4WHBA 1X98A 5IRPA 3QHNA 4WDTA 4AIBA 1UMYA 1NH6A 3DXIA 3CZKA 3SZ8A 4ATWA 2OLHA 3QR1A 4JTTA 4WIWA 3RILA 1PYMA 2KAUC 2JKEA 5D04C 3QMSA 3SCRA 3RJXA 3THUA 3VDBA 2HVOA 4CNPA 5FSEC 2E5BA 1V8EA 1RLDA 3UWVA 3WDHA 4HNTA 1E9YB 1TYGA 3BLKA 3N9RA 3M41A 2JBMA 1FKXA 3I4KA 1PJ9A 3W1TA 2I5IA 1Q6QA 2W79A 4ES4A 4DUWA 5A6BD 3OB8A 4DQWA 4M51A 2GDUA 4N4PA 3LX9A 4HHPA 1R3TA 5C9XA 3PFMA 1XC4A 1TRIA 3ERPA 1J0JA 4RDWA 1ICSA 3GH4A 3T4CA 1GQLA 4URIA 2V5KA 4W85A 4CQCA 3T0AA 2D3LA 2WSRA 2OX4A 3WQVA 2YLLA 1TR1A 4OQVA 3RO6A 3KXQA 1NWUA 3S2JA 3EMZA 2H6RA 2X40A 4E3VA 4NZCA 1J96A 3GVWA 2TMDA 1Q45A 1CW2A 4A29A 3C2VA 4EX4A 2XIJA 3M0XA 2Y8UA 5C2GA 1HUVA 4M7SA 3T0BA 2HMCA 3MJMA 3P7YA 3UG8A 3CQ0A 5KZMA 2BGQA 2HK0A 2VCCA 3H26A 1REQA 2Y8VA 5MKGB 3SY5A 2D0HA 3N9KA 3WLLA 5M5DA 5JH1A 1RCOB 3CBWA 5H91A 3NDOA 4GZJA 1A5AA 1CT5A 3S5ZA 2BOFX 4A3HA 4JIQA 2I7GA 4AZIA 3LXBA 4LBRA 3N4EA 2HS6A 3BAIA 1OIMA 3OG3A 1KFKA 2PGRA 4FO4A 1AZ2A 1J79A 3BLIA 4UTJA 5HINA 1KFCA 3E02A 2NQLA 2BG5A 4MMWA 1UG6A 2VZVA 1PE1A 1I0DA 1UH2A 1ZJAA 3SSJA 1LZOA 3GH5A 4TXEA 1DJIA 3GFXA 5DY2A 4CQ9A 5HMDA 4WK9A 1GTEA 3RM4A 1U1UA 1WKEA 5CZJA 5TD4A 4BF9A 2OELA 3BMWA 2Z25A 3DEQA 4IWWA 1XIIA 1FWJC 2YCLA 1UPPA 5F2GA 4DPQA 2WMJA 2V9DA 1RHCA 5C9UA 4Q8NA 3E0LA 2FIQA 2IQ0A 1WP6A 2P8BA 3B8VA 3R0KA 5AFDA 4IQLA 2QVNA 2PBOA 2P50A 4UZUA 3E2QA 1TE1A 1JDEA 2NVCA 4JYEA 4NILA 1OABA 1XYBA 5D32A 1UASA 1ITUA 3GE7A 3RUBL 1BFNA 1LL4A 1OX4A 3R13A 3FKKA 1OZQA 3EMQA 4HCLA 1K4HA 1M53A 2YYUA 1AQ0A 1JUKA 4M19A 4PZVA 3BCFA 2QHAA 3PPCA 3R11A 4PRWA 4R7WA 1BYDA 3L2MA 1QJWA 1CXFA 4ML4A 3UXAA 2R14A 3NQAA 5D2VA 1RK5A 1EDGA 3GBEA 1AD1A 4JIEA 5LNUA 3C2OA 1IR2A 7XIMA 3MMTA 1UKQA 3P0XA 4C1NA 1TJ0A 3BAYA 1HO1A 3V7PA 4TO8A 3MVIA 2VEKA 1Q7ZA 2C14A 1IWAA 4JX6A 5AHFA 3CAWA 1JG9A 3VNZA 3ZJKA 3NQMA 2HTMA 1CXEA 5LGZA 1V02A 3NPXA 4PC8A 5DXYA 4YTUA 3AIRA 4FLQA 5D9OA 3WIJA 1OG6A 2R1NA 4HU8A 3BV7A 4W93A 2TPSA 3KOYA 3TUUA 7CGTA 3F03K 1JYWA 2CWNA 3T78A 3A13A 3WJZA 4RZ5A 3MCMA 1FDJA 1TV5A 2CFFA 1L6WA 4R9OA 2BNJA 4DO5A 2E6AA 1LLWA 3S0CA 3G0XA 1JGMA 3KL3A 4CN1A 4MNKA 2B7PA 3OHIA 2DP3A 1P0DA 2VGBA 3MKCA 2ICSA 1FFQA 4BCEA 4X61A 4JX4A 4IICA 1XWYA 1S5WA 1VPYA 6REQB 2Q6ZA 3WK3A 1DP0A 4G2DA 1DJWA 3W53A 2PGFA 2XU2A 1DTUA 4GY1A 2VOMA 5C2XA 2CLEA 4REQB 3ARTA 2VD8A 1RQHA 2OEJA 5ECVA 1O94A 3M0YA 3VC5A 5EB8A 1IV8A 1EF2A 4YVVA 1BGAA 3NZGA 3TSBA 4JQ3A 2HXTA 1BF2A 4B5SA 3DFNA 1VJIA 1NP2A 2V68A 2I17A 4JTEA 1GT8A 3PB2A 4Q4RA 2X7WA 1JAEA 2V5LA 3MKKA 3SDOA 4IX2A 1V3MA 3NQBA 1DORA 3ITOA 2CPUA 5C0QA 1NWSA 5BCAA 4XD3A 1GW1A 4E6MA 4JY8A 1Z9AA 4KCTA 3K1DA 5ENLA 1E5NA 3OYZA 4WSHA 2WCSA 5C55A 4AIEA 4C5ZA 2ATSA 2NQZA 3D47A 1RY0A 4IOTA 3KHJA 1PO9A 4REQA 4O1FA 1HKJA 3S9ZA 5LA1A 2VEMA 3S1WA 3VDCA 3BQ5A 3FXYA 2UZ9A 3W37A 1JCXA 3CU2A 5HQEA 2YX0A 4HOWA 3T05A 4LCSA 1V6TA 2DU2A 5FAGA 1P6CA 1HT6A 1YXYA 4OWGA 4CGTA 3QEZA 5C54A 2QV5A 5CH9A 4M6PA 3HV9A 4YWIA 4UUIA 3DBPA 1XG3A 1Z3NA 4F66A 1KBBA 5TQLA 5JBEA 4UMCA 3M0HA 1NOFA 4IJRA 1O5RA 3A9IA 3AXXA 4E5TA 3BLDA 3TN4A 1XGEA 3QMRA 4HT3A 3FAXA 4HZ6A 2DJXA 4X22A 3BAJA 2DZPA 1LOQA 4OBRA 5DRCA 4LAUA 3LS9A 1M7XA 2CC0A 3UWZA 2NLYA 3F2BA 3CYJA 5D33A 1ICQA 1DEDA 1KM2A 4XO6A 1B9ZA 5E0FA 2PDCA 3CHDA 3HG5A 3ITYA 2QYGA 2OWXA 5CBIA 2RGMA 1DJXA 2QCDB 4AF0B 3OZYA 2CZ5A 4QAWA 4N4QA 1MFUA 5I3JA 4QGCA 3EPMA 3S8HA 1UH3A 4HSNA 2CHNA 1Z8AA 2VD9A 4V33A 4UOQA 3GAYA 1O1ZA 3VNIA 1GQNA 1XIDA 2D23A 1IXPA 1JNDA 1UQYA 4EWJA 3R8GA 3W7OA 2WKLA 4GC3A 2I16A 1A0DA 4J3SA 4G5DA 4JKMA 4R85A 1YDNA 4NT0A 1TV7A 2VMFA 5J5DA 3FCPA 2J8TA 2QAFA 3EGJA 4TVDA 2XH2A 2WQDA 3AROA 3DBNA 3GZAA 1S2CA 2AKMA 4K36A 2ZRUA 1NF0A 1QXLA 1W5QA 4PEKA 4C65A 1FHUA 5LA2A 4D6CA 3QW3A 1QU4A 2HE8A 1BLIA 3R79A 4P8WA 3GNPA 1UD3A 5G4HC 4OUIA 4L4OA 2XISA 3LXAA 3THAA 4UOZA 4YCPA 1SO6A 1W1TA 2RUSA 4B5VA 4IP4A 1EIBA 3PTKA 1XBZA 1NDVA 4FLSA 2VRQA 5CCZA 1MXGA 2PF0A 3KVMA 5C9WA 3GC4A 4EPEC 2PDNA 2OSXA 4IPIA 2BZNA 2AQOA 1XICA 1FWRA 3MSRA 4J3WA 3M6YA 4ZXOA 3W29A 3N73A 2GJLA 1JPIA 3WLOA 1UD8A 3DGBA 1DIKA 4J7RA 2Q8ZA 3M7WA 4YS1A 2Y1HA 2ZRYA 1EQCA 3IV8A 3ZWSA 1HVXA 3MBFA 5CZ0A 3PTDA 1Z89A 3N2MA 5I2UA 2QCCA 3U7VA 3GNNA 2GJXA 3ECQA 4ZOCA 4K39A 2PLJA 3S4TA 3R8RA 4DLFA 3TTSA 3DX5A 1LUCA 3TW7A 4CD8A 1UD4A 1TMQA 4Q6JA 5EFDA 3GNOA 4MPKA 3G1DA 3OZPA 2POTA 3QPEA 4X3ZA 2QJJA 1M7PA 4GWEA 1BWKA 1RK6A 2FTWA 3E2VA 3LENA 3MT1A 3MYPA 1N8WA 3W82A 3Q45A 1EEPA 2EEXA 3T8QA 3TYAA 3W85A 4W4QA 1TTQA 1SSDA 2OSYA 3QYQA 4UTLA 1F4AA 5IDZA 4A22A 2OWWA 3KVJA 3NWRA 2W92A 5LSMA 2PCQA 4AFYA 2OT1A 2AQVA 4O13A 3CT7A 1UW9A 3HPSA 1RD5A 1R9YA 1E6ZA 2EO7A 2PLKA 1JI2A 3ABQA 1AK5A 2ZADA 3NFUA 1ODUA 2ACQA 4IGNA 5IXEA 2INZA 5D37A 3V18A 2WZTA 1E4MM 1G4SA 4RE2A 3W6LA 4RNHA 3W00A 1H3GA 1LTDA 4B15A 4UQ9A 3AHYA 1ZP3A 4PULA 1OC6A 2Q3OA 1DVJA 3HZ3A 2Z1WA 1NWTA 3L0NA 5AC5A 3CASA 1XYFA 4C7DA 4HYRA 2NT0A 4L61A 1R2RA 3U5YA 4DWSD 5AHMA 4ZFMA 3TLQA 2GJPA 3PZUA 3KWXA 3TC7A 1M3UA 2VXNA 2PTDA 2QPXA 3EMCA 1BTCA 1PPIA 5BRQA 1RQEA 3GHRA 4HU4A 1SU5A 4H3DA 1R30A 1IEQA 1JDDA 2J7EA 5CGMA 4B2DA 1F6KA 1G4EA 3EOLA 3HGSA 4RE4A 3DHFA 4IPLA 3T2PA 1VPQA 3S5YA 1UJQA 3MB9A 1QO5A 3HV8A 4MWAC 2PC8A 3W2JA 2VT0A