3KVMA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with amino-benzoic acid inhibitor 951 at 2.00a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
366
structure length
366
Chain Sequence
ATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
publication title Discovery of novel inhibitors for DHODH via virtual screening and X-ray crystallographic structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 138
structure length 366
sequence length 366
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kvmA00
3KVMA 3UWZA 3UWYA 3MP4A 1W31A 2CZDA 2QCGA 3S8HA 1DJNA 1ZAJA 4IX0A 3G22A 5D03A 1P0KA 4RV8A 3C56A 4AHQA 3QH2A 4JNMA 1ML1A 4Q32A 4O28A 5HWNA 3WFAA 4ZQOA 5L9FA 2AGKA 4A2RA 3B0PA 4EF9A 1WYIA 3LV5A 1QPRA 3N9SA 2NXGA 5BRBA 3P74A 1FBAA 1TB3A 3CIWA 3G24A 4BF9A 1ZAIA 1I2OA 1H7NA 1DVJA 4UMCA 3W2NA 3FIGA 2OCZA 2YW3A 3NQ6A 1LDCA 8TIMA 1UJPA 2Z1BA 3NR0A 2CZFA 1VYRA 1HTIA 2RDWA 2DZPA 3MO7A 4O19A 4CCEA 4UTWC 1XBZA 1ME9A 3RMJA 3TAKA 5FESA 2Q3RA 1XUUA 3L2IA 3DBPA 5CZ0A 1KLZA 2JBMA 1PS9A 2F84A 1K8YA 4JTEA 1LBMA 2CLHA 4NX0A 5H2ZA 4YMZA 3QSRA 4J9JA 4N2YA 4IJBA 3STFA 2NZLA 2PC4A 2E68A 1SUXA 1KV8A 1SO4A 3ABQA 4GUJA 2ZZ7A 3C0JA 4DF1A 1RPXA 5CZTA 3NA8A 4UTWA 3HG4A 4LS0A 5D33A 3NQGA 5I3KA 1ZNNA 2CLOA 3L5AA 2W0UA 4JYFA 4MJMA 3T78A 3S42A 4QIUA 2E6AA 4FB7A 4HNNA 5E93A 3TE9A 4H4IA 1X8FA 4MFEA 1KA9F 4DPPA 1OVDA 3KX6A 1W3NA 1TIMA 4FEZA 2G97A 4RCXA 1AW1A 1TPFA 2DJXA 4E2BA 1KFCA 1A5SA 3G0SA 3LRLA 3OEXA 4NNAA 2NWRA 2EHHA 4CCDA 2GOUA 3IIPA 3L9CA 4MY9A 4NZJA 3LBCA 2ZRYA 3GNNA 4I7VA 3LDVA 3BLIA 3GDRA 2ATSA 3UWUA 4FIRA 4LRTA 3HIJA 3W7KA 2Q8ZA 3BGJA 1XC4A 1GT8A 1JJKA 1KLYA 3S9YA 4DEFA 2YX0A 3LHWA 1VRDA 2CFFA 1B3OA 4O10A 4IOTA 3M16A 4HKPA 1S3HA 5C5YA 4LV9A 4WY0F 2Q8LA 3GAYA 2YCEA 5C2XA 1S5WA 1WOBA 3W2JA 3KXQA 4EOUA 5I3HA 3W1AA 5AC6A 2Y61A 3PBWA 3IVUA 3R13A 3ZWTA 4UTKA 4Y9AA 3EWZA 4PL1A 4AWSA 3EX3A 3TNOA 4IMDA 1K02A 1MXSA 5HULA 3HOJA 5AN7A 4CNNA 3ZS4A 4DO5A 3QJAA 3DENA 3KRZA 1G7VA 2Z6JA 5CG7A 2VFEA 2ZRVA 3O16A 1H1YA 2A5HA 1YTEA 3E9AA 2XN2A 4GJ1A 3TMLA 1RD5A 1WQ5A 3B06A 3LTSA 3FFSA 3STEA 3T7VA 4CQ9A 4LTSA 2FTPA 4DXVA 3P81A 3LB0A 4FNRA 2OZ0A 1RVGA 3W73A 1ZCOA 3A22A 1W5PA 3THQA 2NWSA 3O6CA 4K37A 4IUOA 4JX4A 3TQ0A 3C2OA 3KHJA 5I3GA 4RKAA 1EPXA 5HMSA 1VJIA 3EWWA 3WJYA 3GKAA 4EF8A 4UTIA 2DZVA 1TPC1 3W85A 4N6EA 4K8HA 4OT7A 4Z1DA 5AFDA 3HPXA 1U83A 1C9DA 3RLUA 1G4SA 1W0MA 3EXSA 3QRHA 5G2WA 1OX4B 1Q6LA 3CTLA 2ZCGA 1EP3A 3SECA 3EWUA 1E51A 3MP5A 5LHEA 3OIXA 4O54A 1KM1A 1JUEA 2TPSA 4C1LA 4M6PA 2A21A 1FDYA 3FS2A 3NQ7A 3OHIA 4JYDA 2NXIA 2OX1A 2QAFA 3BK0A 1AL7A 1DQXA 2H8XA 2YSWA 4OWGA 1TPDA 4P2VA 1GTEA 1RZMA 3VE7A 3GKFA 3EWBX 2V5LA 2QCEA 5AYXA 2ISVA 3VE9A 1LOLA 4D2JA 1XKYA 2E5CA 3G1FA 3TA6A 1OFPA 3FYPA 3C6CA 1NFBA 1AW2A 2R94A 2UV8G 4OV9A 3PF3A 1K7XA 3N73A 3NG3A 3R2GA 2H90A 1L6SA 3PULA 4JTJA 4JIQA 3W7CA 5K4XA 3DFNA 3SIZA 2E09A 3W1QA 4A29A 3B0UX 3PB0A 3G1XA 1LCOA 3ELFA 2V9DA 5D2YA 1MEHA 5CZSA 1XBVA 2DJLA 3WK2A 1W56A 1QCWA 3VFLA 3W3OA 2WNNA 5HUOA 4JYEA 2E6YA 3JR2A 1FDZA 3KRUA 1OFQA 3TSMA 3JS3A 2XN1A 4AAJA 2QDGA 3L68A 1OHLA 4JXCA 4CQ8A 4UFJA 4O15A 4UTLA 4O0KA 3SFKA 4LT9A 2ZTJA 4BI7A 3UZJA 1H7RA 2J9XA 5FF2A 3PBYA 2CZEA 4MY1A 2EF9A 1MSSA 3GNDA 4CNOA 4MJZA 3W7RA 1JQXA 3E12A 3GXNA 5FEZA 2P10A 3HGSA 4O0ZA 5HR7A 1JUBA 4O17A 4UFMA 1GWJA 5AC7A 3UWWA 3A21A 4KFNA 1FXPA 5D2XA 3S0CA 2WJZA 5AHMA 1F2JA 3Q94A 4ADSA 3TC6A 5J5RA 3EKZA 3DFPA 2ZZ1A 4O57A 1ZHAA 1Q6QA 3GXTA 4UTTC 1G6CA 3OVRA 4ZL1A 4E2DA 1IXNA 4RZ6A 1F74A 3PUOA 5DXYA 2QCHA 3BVJA 2A85A 5EL1A 3GDLA 3Q37A 4NU7A 2I1OA 1PHQA 3N14A 2ZZ4A 3A9IA 3MBDA 3VI2A 1EUAA 1TPUA 4WY0A 5EPDA 3W1LA 3F4WA 1TV7A 4HPXA 3CT7A 1XBXA 5EKYA 3MI2A 3L65A 4O1AA 3NM1A 3TSBA 2C18A 1W5OA 1HFBA 3P8JA 4M6QA 6ALDA 5F2IA 3PM6A 3W88A 5EYWA 2ZZ5A 4BWLC 1Y0EA 2R91A 3TXVA 1VR6A 3E0IA 4QJ1A 1FX6A 3I7RA 2TSYA 4KWVA 3G0XA 1LM1A 3O05A 4BR1A 1OFDA 3N2MA 1GZGA 1TRIA 3W75A 4ZQPA 1UUOA 1ICSA 1UB3A 2RDTA 4ZVJA 2Y7FA 3HB9A 4K6AA 1X1OA 1KM6A 3CLMA 1DJQA 3W7OA 3W2UA 3S1VA 3GDKA 1JUKA 3UPBA 3RLVA 4CLMA 5HUPA 3NL5A 4FXRA 1P5BA 1GVQA 3PBVA 1IXQA 1QPQA 2GVLA 1GVSA 1ICQA 4FNUA 1KM2A 2CLEA 1L6WA 3LBMA 1RR2A 3EB2A 3PY2A 4KFPA 3PSVA 5CGQA 2FPVA 2ZA1A 5MHBA 3W86A 3H55A 2CLMA 3NDOA 2OT1A 2P0OA 4NNBA 1GVRA 4YXGA 4LVGA 1EP1A 3QPZA 3HPZA 3S5NA 3IVSA 4AH7A 2A7RA 3DGRA 5E0KA 5KITA 1G4EA 1YYAA 3UZ5A 3N34A 1OF8A 3MYOA 1GVFA 5FEWA 2X30A 1XBYA 2QJHA 3TJXA 3W9ZA 3CPRA 2NUXA 1KM4A 3BW2A 1M6JA 1ZJIA 1YPFA 5D2VA 2J24A 1TSIA 4B5NA 2YYUA 3M0ZA 1BTMA 2R8WA 4ADTA 3WJZA 4YCPA 3T4CA 1QPNA 4RR4A 3LM7A 4ML9A 2YDAA 1SZFA 4L4MA 4IMEA 4IX2A 4LVDA 3MYPA 5HINA 1VHNA 2CWNA 3GX9A 4UXDA 3I6RA 5KZEA 1SU5A 3W72A 1XDMA 5G2IA 3NPWA 5DBTA 2QUVA 3A5VA 3G1AA 2CW6A 2VEKA 1MEWA 2E5DA 4Z08A 5F2LA 3TDFA 3I7QA 4OU1A 1KV5A 3TR2A 4MPQA 3O6DA 4HNTA 1JR1A 1G67A 3MI3A 2FB3A 4N9BA 2J9YA 3KOFA 3CEPA 2G95A 3PVFA 1WAUA 2TYSA 1UASA 2LLEA 5IBXA 3N9RA 1KFBA 1LLZA 5K9DA 5KZMA 3LHYA 2ISWA 3W76A 1PIIA 3S5YA 1SW7A 3DH7A 1JCLA 4AF0A 4UNLA 1YXDA 4O52A 5TBOA 2NUYA 1SO6A 4R34A 4UFIA 2HMCA 3TCEA 1GG1A 1I45A 5IM51 4EVZA 3SR7A 4K36A 3NPUA 3EXRA 1JVNA 1NVMA 1AL8A 3PUDA 4W9TA 3V75A 4O4WA 4JTSA 1Q6RA 1S5VA 4FIQA 1JULA 2YXGA 4TR9A 2VEIA 5LNUA 3QSTA 4ORIA 1B9BA 3UY7A 2ZZ3A 3S6DA 3BW4A 1OYBA 2ZBTA 1TRDA 3MHUA 4MYXA 5AHFA 3VKJA 4ALDA 2NX9A 3W7EA 1TPVA 1EP2A 2Z0IA 3QMTA 3GR7A 3LERA 3W70A 1UUMA 3HGRA 4MLRA 2I9EA 1L9WA 2P1FA 4P61A 3F4NA 2C3ZA 1SZEA 1XCFA 3D0CA 1VS1A 1D3HA 3OVQA 4N4PA 1QPOA 3A5FA 1H7OA 4MVAA 3Q2DA 4U4MA 4NXKA 3TFXA 1NF0A 1D9EA 3LHZA 2CLLA 1T8XA 3KFTA 3TU9A 1ME7A 3HG2A 4WD0A 3W84A 3P67A 3OG3A 1IXOA 4IQLA 4UC5A 3QEZA 3U2OA 2V5BA 5D05A 3CU2A 4NT0A 5U4NA 2ZA3A 3AJXA 4XTDA 1R2RA 3L5LA 1BWKA 3DHDA 4HHPA 5A5WA 2CLIA 3B04A 4OBTA 1Z44A 3GIYA 1OYAA 2XN0A 3BG3A 5AHIA 2QAPA 3BGGA 1TPWA 3EWYA 1VH7A 4POCA 2OMAA 1I2QA 3TUUA 3LI0A 1EWEA 1PHWA 1QOPA 4EIVA 3PG9A 3HO8A 3S1UA 2QDHA 4WY0B 1EEPA 4JICA 1I4NA 4H6KA 3DAQA 3LOTA 5DLCA 1A5BA 4GFSA 4ORMA 2V2CA 3LX9A 3W7PA 5BW6A 3G1SA 5BOOA 1W5NA 3IGUA 1R2SA 2QKFA 2PRHA 4LC6A 4FNPA 1RV8A 1GYLA 2D73A 3MWAA 2E77A 4R7JA 3C4UA 3W1XA 5D38A 3B05A 4QISA 1R46A 3I68A 1J5TA 3UQNA 4NZFA 2VEPA 1W3IA 4Z0SA 3ABOA 3SZ8A 2PCQA 2ZTKA 1SFLA 4DF2A 1W5QA 4LC8A 1DHPA 4YL2A 4S2BA 3QMRA 5K7JA 1WBJA 1Q45A 3SY5A 5AHNA 1JCMP 1KTCA 1YTKA 5K3VA 1JQVA 3BLFA 1X6UA 3HGOA 4NNCA 3MBFA 3SW6A 5G2HA 4DQWA 1NEYA 3NYZA 5DN1A 1KBIA 4QQ3A 5KMYA 4UTHA 1OABA 3L0NA 2H3DA 1PCKA 3W1TA 1VYSX 4X9SA 2YYTA 1TCDA 1OK4A 3W7QA 1PE1A 5E1QA 4JR5A 1K7EA 1SW3A 5D02A 3LCLA 1R30A 4IPIA 3LCHA 1SPQA 1BKSA 3NZRA 2J27A 2B7OA 4WQ6A 2DU2A 2BTMA 5FF3A 1WV2A 1PVNA 2WSQA 1FWTA 3G1YA 1VCGA 1KM5A 4KKXA 4TO8A 4Z0JA 1U5JA 3GDTA 4LY8A 3KVKA 1R2TA 3LLFA 3KRSA 3HMJG 4N4QA 1L6YA 1XFBA 3P5YA 4S2CA 2E6DA 4TX9A 2RH9A 3T55A 4GUFA 1YDVA 1KTNA 3WK3A 4JDBA 3LGEA 4A22A 4MY8A 5CSRA 5I3IA 3SSJA 2V81A 1QNVA 1LLWA 5HWMA 3DXIA 1ADOA 5F4SA 4LVBA 3LTYA 1WOAA 5KSWA 1ZFJA 4IXHA 4K7YA 3ZWSA 4PODA 1Z48A 1RQBA 4DO4A 4Z1AA 5F2MA 3LRKA 2J6XA 1CW2A 4TU1A 3PC0A 4JS3A 2A4AA 4LVAA 2HTMA 5AHLA 2YFOA 2GVGA 1TQXA 3HBLA 2WNQA 4IMCA 3C8FA 3UNDA 5A8GA 1VZWA 2YW4A 1LRTA 1HL2A 4HSOA 3W7JA 2BLEA 2BSLA 5LNWA 2X16A 2X2GA 2ZZ6A 4MLJA 1PV8A 2X1RA 3UXAA 5KINA 2KZHA 4JTKA 1RQHA 1W8SA 1VHCA 3T40A 1O5XA 1KM3A 4AF0B 4LW7A 1K8XA 3W22A 2QUTA 5CPNA 3HPSA 3TROA 2IQTA 1MEIA 3DU0A 5AC8A 2CU0A 1H62A 3R12A 4IMFA 3LLDA 3NGJA 3SGUA 2DZXA 2WSRA 2J9ZA 5EY5A 2Y7EA 4FX8A 4X2RA 2QJGA 3QFEA 4DBDA 3SI9A 3HG3A 4U28A 5LNVA 3CIXA 3L5MA 1ICPA 3NL6A 3GZ3A 2XFWA 4AHOA 2DP3A 1N55A 4N9CA 5J5DA 2QEZA 4MKNA 3R8RA 1UBSA 3M47A 4GNJA 1ZALA 1GJPA 2A2IA 4R53A 4TMCA 3M6YA 3C3NA 3IV3A 1S5TA 2C19A 4RZ4A 1TV5A 3JRKA 1F05A 1VPXA 1ONRA 3B03A 3TMQA 2Z6IA 2JGQA 2C15A 3LCIA 3G1HA 3WK0A 7TIMA 1KFKA 1NF7A 2FPYA 1O95A 4GWEA 5TQLA 4UIOA 1Q6OA 4O16A 3QF0A 5K4ZA 2AQWA 3BG9A 4MIMA 4UR8A 1H7PA 4AB4A 4RJEA 2WQPA 1TO3A 1FCVA 1F7BA 2V8ZA 3DHFA 2DZTA 2WNZA 1H51A 2B4GA 3G18A 4QITA 4XTIA 3DI0A 3V1PA 4ZMGA 1F6KA 3M44A 1EB3A 2ZRXA 3IVTA 3W2MA 4Q4KA 4ZQCA 5HWJA 1I8JA 5F1VA 4XBSA 4BI6A 2RHGA 1FWNA 2GPTA 2CLKA 1DV7A 4IMGA 1DKWA 5F4XA 1EWDA 3O06A 3UPWA 2H3BA 3QMSA 1G69A 1M7OA 3CWOX 3RU6A 2ZRZA 4DPQA 4JTIA 4JTUA 5FI8A 4JX6A 2CZ5A 3O8AA 4MUZA 1GQNA 3TW6A 4HNVA 1B4EA 2OT0A 4M6VA 3A23A 4PFMA 4GC4A 5DBUA 4XUGA 3LI1A 4XWUA 4CQAA 2ZQ0A 5FEXA 2TMDA 1PCWA 2C6QA 2V2HA 1JRBA 3QYQA 1KFLA 1KBJA 3W2KA 5AYZA 1AK5A 1YDNA 3LXBA 1TV8A 5KTLA 2ZRWA 5BMXA 4NJJA 3EX4A 1EX5A 3CEUA 4LNYA 4LU0A 3LXCA 3FJ6A 1QMLA 1H7XA 4ZQNA 1EUNA 4C1KA 4PH6A 4S1FA 3EX2A 4X3ZA 1XI3A 3VCRA 4N6FA 3W23A 1SQ7A 1GVOA 3MHGA 3UWQA 4UTUA 4WJEA 1F76A 3NQCA 3DZ1A 1P1XA 4LRSA 2ALDA 2G96A 2WSYA 2YGYA 3NAVA 2C0AA 4LOCA 2C14A 3OVPA 3W2LA 3STCA 2VC6A 5LHFA 2ZFAA 1FCUA 2C16A 2VFIA 4I9AA 3EXTA 1D3GA 3W83A 2QCMA 1VCVA 3LTPA 2V0TA 1XL9A 3UWVA 1TMHA 1OJXA 3HGJA 3PSWA 1LOQA 1DQWA 3NQ2A 4YCOA 1TJRA 3WJSA 1RQEA 5DY2A 5CPLA 4BFAA 4JTLA 3LHUA 5K2ZA 1SFJA 2C1HA 4Z1BA 2DORA 5D09A 3LRMA 1LP6A 3C2RA 5C6MA 3TFCA 1FWRA 1OX6A 5IBXC 2WV8A 3LHVA 3CB8A 1B57A 2GQ8A 3G3MA 4L4LA 2Y70A 2Z2UA 1BEUA 3FOKA 4FF7A 2FJKA 4O4VA 3G1DA 4QAIA 1QR7A 4FO4A 3Q58A 3NQFA 1H63A 5LZLA 1OK6A 2G5WA 2NX3A 4HSNA 4WOZA 4LV4A 3MI6A 3U6WA 2E1DA 2Y89A 1TTPA 3MUXA 3TIMA 2BWGA 4UFHA 5CSSA 1J2WA 2WKJA 2Y88A 3FJLA 5HJLA 5D2TA 4NJGA 3TAOA 2FIQA 3N3MA 1MO0A 2W79A 4PEKA 4LVFA 3IGSA 1VYPX 4H3DA 4O53A 4R33A 5U7SA 4PCFA 2HS8A 2PURA 2QCLA 1QDSA 2VFGA 1LROA 4N02A 2VELA 1SR9A 1H7WA 2RDUA 1YDOA 1GEQA 3ATYA 4JTGA 2X1UA 3L0GA 3IIZA 1TPH1 1IIGA 1AMKA 4FX6M 5C55A 1M7PA 2A6LA 3NZ1A 3P84A 4RXFA 4UMAA 2QCDA 3FA5A 3P7YA 5BNKA 3H53A 3ZFHA 2PRMA 4GBUA 4LS1A 2ZYFA 3TV8A 4DBEA 4GUHA 5LKYA 1Z42A 3QC3A 1ME8A 4UTMA 4XZ9A 4JD4A 3GR8A 1OFRA 3LHTA 3CWNA 3CQ0A 5F1UA 1J4EA 1FXQA 1YTDA 2RFGA 3IRDA 1M5WA 1QAPA 1LRNA 1LYXA 1TTIA 5CKSA 3RNDA 1FCBA 3OBKA 2ZZ2A 1SO3A 3HF3A 4O12A 3TXZA 3NQEA 4N9DA 4OGZA 4Y6GA 2EPHA 1LRQA 4MOZA 2VFHA 1OF6A 2QCNA 4JDYA 5FF7A 1HG3A 1CI1A 2VENA 2JK2A 2O7QA 3DI1A 2B7PA 1VCFA 1LOSA 3PBUA 3H54A 1EIXA 3W74A 5H91A 4FHAA 3P62A 1F6PA 3K30A 1FWWA 3G8RA 5HR6A 3PB2A 1FQ0A 3UYCA 1THFD 3M7WA 3NNTA 3ATZA 1I2NA 3INPA 3LCFA 3SGZA 4AVFA 2GQAA 3HJZA 3EX1A 3NO5A 2EGZA 3HQ1A 2YZRA 1EA0A 1SZNA 4O50A 3TKFA 3C2VA 1IIHA 4E38A 5G1TA 5HNRA 3TK7A 4NVTA 2GJLA 1VC4A 2X1TA 1L2UA 2V30A 3DKJA 2EKCA 3F1QA 1Z41A 3B4UA 1G7UA 4UFLA 4K8EA 4OE7A 3P5ZA 2ISSA 2Q3OA 1FDJA 1OYCA 3G1VA 3ZR4A 2AAMA 1O60A 2QUUA 4WXZA 1P4CA 1GYNA 1LBLA 5DXXA 4NUWA 5CZJA 3NPVA 4WZHA 1T96A 3M5VA 4XKYA 1W3TA 2JKEA 1KW1A 1N8FA 4FNTA 2FFCA 4PA8A 4GE8A 4LUJA 3VNDA 3F03K 1VGAA 3C2EA 3KAOA 1K8ZA 2QF7A 1YLVA 5C54A 3E49A 4GRSA 5DCEA 3DFTA 3USBA 3S1WA 1JRCA 5FEPA 4PTNA 4O1CA 1QOQA 2BX7A 3TX9A 1A5AA 1DL3A 2Y62A 4FNQA 1B4KA 2J88A 3WK1A 3THAA 3S1XA 5SWUA 1F5ZA 1H5YA 4XBKA 2A1YA 2GJNA 3WJXA 5FF0A 3GK0A 3BG5A 3M43A 4K38A 2FB2A 2QCFA 4NJHA 4UFKA 4UMBA 4LUIA 5F4WA 4QNWA 3O15A 3G0UA 1I2PA 4JY9A 4KWWA 1FWSA 1ALDA 4AXKA 4JIPA 4QSHA 2O7SA 3NL2A 2A6NA 1G4TA 3W7NA 1VLIA 2RKXA 4MFDA 4MZ8A 4AMAA 3EX6A 4QNEA 3PG8A 4Y90A 1O4UA 1WX0A 3M5ZA 1G4PA 2GVJA 3NQMA 3S5OA 3NXFA 4HNUA 2JKPA 3C61A 3P82A 5T26A 4JEQA 4Y96A 3FEMA 1HO4A 3GVGA 2ZA2A 3M41A 4IXXA 4WX2A 1CX9A 3IIVA 5HQEA 2ZDRA 4RX0A 1GOXA 4AWUA 1H61A 2R14A 4GUIA 4O1DA 3W07A 3NVTA 1GG0A 2VKZG 4YWIA 4CCCA 3W1UA 5LSMA 1W54A 1UCWA 4NXSA 4RXGA 3GB6A 1LBFA 2HSAA 1VLWA 1N7KA 4EWND 4PC8A 5TIMA 3W7DA 1OFAA 4ZZ9A 3I65A 4K7VA 1FCQA 1OFBA 4HN4A 3TC7A 5EBUA 4Q33A 5CPMA 2NUWA 2B7NA 2W6RA 3IIXA 2NLIA 3CHVA 3LCWA 2I14A 4OHQA 5G4EA 6TIMA 3M9YA 2EAWA 2Y7DA 2PRLA 4NJKA 4MZYA 4O13A 1H60A 1KFJA 4TMBA 4O11A 4PL2A 3NQDA 1YXYA 1H50A 2VOMA 1JCNA 3PS7A 3CC1A 1OG0A 1K7FA 2QR6A 3FKKA 1W5MA 3EEGA 3I7SA 4ZQMA 5AB3A 2BXVA 3BARA 3U8GA 4RZ5A 1OFOA 1QO2A 4DELA 2CLFA 4MZ1A 2QCDB 3BV4A 5EMUA 1GPWA 4FXSA 4OQVA 3L21A 2E5BA 1WBHA 3DFQA 1PL9A 4RLIA 3M5XA 3W7HA 4NJIA 3TQVA 1NAL1 3PUEA 4IGHA 5FF4A 4X22A 3GLCA 5BMWA 2Y85A 4CNPA 3TH6A 4DO6A 1TQJA 2F7FA 3W87A 3QW3A 5D2WA 1H1ZA 3CM4A 3NQ8A 5DY3A 3BO9A 3NM3A 1X7FA 1T99A 3GYEA 3EWXA 4UUIA 2DZUA 3RK8A 4AEOA 4N9EA 1XUZA 2DZSA 2X1SA 4I7UA 1ZY9A 1W37A 1K03A 4A21A 1TYGA 4OV4A 2OJPA 3N2XA 2FPTA 4WXYA 3N19B 1SO5A 3MHFA 4M5PA 1V7YA 4WOQA 5DELA 5KZDA 2A7NA 1AW5A 2NV1A 4JTHA 5D04C 1P0NA 4IWWA 3W7GA 2E6FA 1Q3NA 1MZHA 2JGYA 5EA9A 4Z1CA 4ONVA 2FLIA 1XDLA 5D37A 3TW7A 1JCJA 1V5XA 1QO5A 2H8ZA 3TQKA 2WOQA 1HUVA 5LGZA 3LCGA 1ZAHA 5GVJA 5D30A 3PR2A 3LXAA 4DF0A 1YPIA 2PE4A 4AWTA 3C52A 3SJ3A 2VFFA 5I3FA 4E0CA 5LNRA 2ABBA 2ZRUA 3O07A 5LNSA 1OX5A 3BW3A 4UR7A 5DCDA 3RFAA 1FY6A 4O18A 2NV2A 4TIMA 3STGA 3O6YX 3IIOA 1WDWA 3G3DA 1DOSA 3EKLA 3L0KA 3A24A 1SSDA 1F73A 4RK8A 4HPJA 1K3UA 5G1YA 1JCXA 1LTDA 1R47A 4XKYB 3P60A 2VEMA 1KFEA 3P8IA 3C2FA 2FQIA 3P80A 4HIBA 3OA3A 1OFEA 4UTTA 1KTBA 4MYAA 2YPIA 2B7QA 1O5KA 1QWGA 1DBTA 4QM1A 3W1PA 3UXDA 4JN6A 4JGDA 2GQ9A 2C13A 1NSJA 4JY8A 2DZWA 2NX1A 3P61A 4GXMA 1BWLA 4KFOA 3B0VC 2VFDA 3G8EA 3S5ZA 3TSDA 1DORA 3LV6A 2V2DA 4O8RA 3DKLA 1LZOA 3QW4B 1QFEA 3ANYA 3BLEA 4FX7A 3E96A 2NXHA 1C8VA 1O94A 3KVJA 3QQ0A 1VQTA 3B8DA 4LWWA 4G1KA 3IEBA 3E02A 3FLUA 3PAJA 4JTFA 2GUUA 4BWLA 5D32A 2V82A 2WO5A 4BK9A 4YLWA 1IXPA 3M5YA 2VXNA 3YPIA 2A7PA 4A3UA 1YXCA 1FUYA 3DFSA 1T0OA 2Y7GA 2QCCA 2Y63A 1SSGA 5K9XA 1C29A 1LORA 3DFOA 3GDMA 5G4WA 4FNSA 4LS2A 1HO1A 3NQVA 4ICNA 4ADUA 4AHPA 1ZENA 1A53A 1TTJA 1XXXA 3R89A 2WPBA 1IGSA 2BZNA 4M7SA 3W1RA 4XQ6A 2JKAA 3ABSA 3FKRA 1JCYA 3ABRA 3NQAA 1TTQA 4O14A 3GXPA 1X1ZA 3QPYA 4UTJA 1A5CA 3UY8A 2TRSA 3W1NA 1XM3A 5I3JA 3O1NA 3MP3A 5ABTA 3R5EA 4A2SA 4K39A 1W1ZA 4UCGA 5G5IA 1TREA 4GUGA 3W7LA 2QJIA 1AG1O 2FDSA 3RF9A 3O63A 3WJWA 2YFNA 1TPEA 3W6YA 5AHEA 3L66A 3NOEA 5K9CA 3NPXA 1OX4A 3FYOA 5AOUA 3NL3A 3QQ1A 3IGXA 4I7WA 1GTHA 3W71A 3PWAA 2YR1A 5LGXA 5F2GA 2Y6ZA 4ZQRA 3M1ZA 2A0NA 5AYYA 4WUIA 5DCBA 5L6UA 1TPB1 4HT3A 3BPWA 3MMTA 4M7TA 3QM3A 1A50A 3MW7A 2ABAA 2H6RA 3QZEA 5CPOA 3HG5A 4NX5A 4JTTA 4IPJA 3T44A 3W7MA 1SW0A 3W1MA 2HS6A 3NEVA 3TJLA 4UNKA 1TJPA 4BI5A 3MJYA 1IF2A 4NQ1A 3AO0A 3LCXA 1SZGA 1KM0A 1YADA 2B0MA 3KVLA 4M19A 1WA3A 2ATMA 3W7IA 1I2RA 4Y8FA 4O1BA 1WXJA 3UD6A 3GAKA 4JX5A 3L67A
chains in the Genus database with same CATH superfamily
3S8HA 3SUUA 3G22A 3QV6A 5D03A 1P0KA 4HHLA 3IPWA 4AHQA 3QH2A 4Q32A 4F0KA 1TE6A 3PP7A 2EKGA 1XH0A 5D8WA 1XGEA 3N29A 1XIEA 2GL5A 1WYIA 3PPCA 5M03A 2Y8UA 1P0BA 4LEQA 3N9SA 4G7EA 1GGOA 3P74A 1FBAA 4H9MA 3CIWA 3WUGA 1OIFA 3G24A 1F6YA 3HURA 1JYVA 4KRUA 4UMCA 1PX4A 4HOZA 4K2SA 4H7ZA 1UPPA 1D8CA 8TIMA 4F2TA 3AHYA 4RNJA 2CZFA 3MO7A 1HTIA 2RDWA 2DZPA 4O19A 3QHMA 2JF7A 5DMLA 4ECLA 4EK7A 2PDMA 3CV1A 1XUUA 4FOUA 3L2IA 3CK5A 1KCLA 3SCPA 4LNCA 3WH6A 1IZKA 4NX0A 3VM5A 1ZBCA 4YMZA 3QSRA 2R1LA 2UBPC 4J9JA 3MKCA 4N2YA 4S3JA 1WUFA 2QIWA 3WN6A 1CDGA 2E68A 4QLJA 3KOWA 1YE6A 4DF1A 1P6CA 1RPXA 2WK2A 4E3VA 3VIOA 8A3HA 2OLSA 5I3KA 5HJYA 1E3ZA 4OOUA 3AROA 3N2TA 3KM8A 3L5AA 1KC7A 2W0UA 4JYFA 3H2EA 2E6AA 2XVLA 5DT5A 4HNNA 4Z2HA 2PI6A 4DPPA 1OVDA 5CLWA 3GDBA 1TIMA 4GIEA 4FEZA 1V0KA 3U0HA 3KTCA 3SBFA 1AW1A 1TPFA 5C9XA 4E2BA 1A5SA 3AC0A 2ZDSA 4J1OA 1GKQA 3VDGA 3DC8A 4NNAA 1C91A 4CCDA 3IIPA 2ZRYA 2HQAA 2PTWA 3BLIA 3UWUA 1EDQA 4JFUA 3C86A 2Q8ZA 3W7KA 1ZSXA 4KF1A 4B4HA 3UEQA 1B3OA 4IOTA 2C7FA 4GH1A 1OSEA 2Z28A 3BLKA 5C2XA 1WOBA 3QN3A 1VD6A 3WKZA 4EOUA 2Y1HA 1EX1A 1M53A 1JXKA 3PBGA 4ML4A 3BQ6A 3ZWTA 1N8WA 4AZHA 1MDLA 3EX3A 5CLTA 3TNOA 4IMDA 3UZZA 3UBPC 1R86A 2BY2A 3E74A 4DO5A 5CG7A 5H8PA 2VFEA 2ZRVA 3VZXA 3URQA 1V02E 2A5HA 1YTEA 4GJ1A 4IT1A 1WQ5A 3STEA 3FFSA 2FTPA 1LWIA 4DXVA 3BZGA 3P81A 3VU2A 3FW6A 5JIWA 1RVGA 3CUZA 3A3XA 2XWDA 3O6CA 4JX4A 1WKYA 1O12A 3KHJA 4QCFA 2PZ0A 1VJIA 3EWWA 1PPIA 3GKAA 2OSYA 4UTIA 2DZVA 3ID7A 2RUSA 2YCKX 1C9DA 3RLUA 4ZTYA 4H83A 3SECA 8XIMA 3OIXA 3IJIA 1E1EA 1IV8A 2DSWA 4V33A 1JCTA 3REQB 2NXIA 2QAFA 3BK0A 3LD5A 2YSWA 2WWCA 4ATDA 2XM2A 4OWGA 1RZMA 1JXJA 4BQ4A 3EWBX 4UQEA 2C1IA 2V5LA 4GI4A 4GINA 1CGUA 5EMMA 1LOLA 3RU8X 2OZ8A 2E5CA 2XVPA 4XD3A 4GX9A 2EPOA 3AU6A 4OV9A 3PNZA 5I78A 3N73A 4XX6A 1CB7B 2H90A 1GKRA 3UA4A 1L6SA 4JTJA 4XZIA 1I60A 3W1QA 4H2CA 3B9DA 1QNQA 3RLGA 1MW3A 2F6UA 3G1XA 1LCOA 1EO5A 1W1PA 3ELFA 5H1WA 4RPQA 4F0RA 5XINA 3VFLA 1WDPA 1YNQA 4S3KA 2CKRA 3ORWA 2FKPA 2FZNA 4QTGA 4O15A 4UTLA 1REQB 3SFKA 4LT9A 1PB0A 3UZJA 3E0LA 5CQ1A 1MW0A 5EU9A 4JZ5A 4MY1A 2OZTA 3G1RA 4CNOA 3W24A 4MJZA 2W67A 4S38A 5FEZA 4IIFA 3IK4A 1JUBA 1QI4A 2J47A 1GWJA 5AC7A 3UWWA 1DEDA 4DZ5A 3A21A 3S0CA 3Q94A 4D8ZA 2DY3A 3TC6A 3EKZA 3AFBA 3EYPA 4OIFA 4XAYA 1ZHAA 3IGHX 1Q6QA 3GXTA 4RZ6A 1Q6GA 1TVLA 2XU2A 1GOWA 4QDPA 3I6TA 3GC4A 2DT3A 2V3EA 1XISA 5DXYA 4GCXA 3I10A 3BVJA 2A85A 3GDLA 2ISFA 3Q37A 1A49A 2OSWA 3F4CA 3LNPA 2EPNA 1UG6A 3N4FA 2I1OA 1PHQA 1C8QA 1TPUA 1XLGA 2MANA 4X61A 3FDGA 4H9YA 4WGHA 2FGLA 3PTMA 1J79A 1JL8A 1A5MC 1XBXA 3CT7A 5DMYA 3NM1A 4CQDA 3N2CA 3RM9A 1HFBA 4AD4A 3BLLA 4WSKA 3PM6A 3CQKA 4IP7A 3TXVA 2OLHA 3E0IA 3GD6A 1FX6A 1NTHA 5AY7A 3SGGA 3G0XA 2PODA 3W75A 1AQMA 5E5CA 5D9NA 3L12A 3DG6A 4K6AA 5GJMA 4CN4A 1KM6A 4INFA 3NSNA 4S23A 3W2UA 1JUKA 3RLVA 4BJHA 1OGBA 3ABXA 2CHOA 4I90A 4GQQA 4UB9A 2DUXA 2GVLA 2HVNA 2TODA 2CLEA 4P7OA 3LBMA 3DN5A 4XK2A 3AHZA 4KFPA 4BQ3A 4IJCA 5HJXA 5MHBA 2CLMA 3MZNA 3UCDA 1GVRA 1UJQA 3QPZA 3S5NA 1IYXA 3IVSA 4KH2A 3TN6A 5E0KA 3F5KA 1S38A 1YYAA 3GG8A 3KBJA 3UZ5A 2VUNA 5FEWA 2G3IA 1NWRA 3F4VA 4AD1A 2QPXA 2PDGA 2QS8A 3TJXA 3OBEA 2NUXA 4U3CA 2OWCA 4H8NA 3V5FA 3JZUA 5DF0A 3B8TA 4PUNA 4FOKA 3WJZA 5IOBA 2FH6A 3LM7A 4ML9A 2Q8XA 4MWAD 1CT5A 1JYNA 2XFYA 2MUCA 3QGKC 4IX2A 5FJUA 3WEMA 1UOKA 5HINA 5AC5A 3PHAA 5AZ1A 1QK0A 4LBUA 3TN5A 4J3SA 3U2EA 4LH8A 2OYLA 1R3VA 3NPWA 3A5VA 3G1AA 5F2LA 3GHTA 3U9IA 3TR2A 4MPQA 2JFEX 3O6DA 3UYIA 1R7AA 2FB3A 4N9BA 3CEPA 3PVFA 3KBWA 1TVNA 1JD7A 2LLEA 2DZBA 4B91A 1LLOA 4I9JA 2P50A 4BEQA 1LLZA 2VGGA 5K9DA 5C2GA 3M64A 2QVNA 4AF0A 3CZJA 4UNLA 1YXDA 3KOXA 3NOYA 1AJ2A 1SO6A 4MB1A 4R34A 1W17A 1W8GA 1GG1A 1U30A 2XJ7A 1UBPC 3B0XA 4KCUA 4K36A 1E6SM 1AL8A 4W9TA 2VNCA 4FIQA 3ZT7A 3WEZA 2VEIA 2FHFA 2PF0A 3QSTA 4ORIA 1KRCC 1TRDA 1VKFA 3MHUA 3DX5A 4Z42C 4GJIA 3QZAA 3C0LA 3W70A 1OC7A 2VL4A 3HGRA 2DIEA 2I9EA 3R94A 1G01A 2HE5A 2C3ZA 1SZEA 5IRPA 3S2LA 3OVQA 4N4PA 5JUVA 3A3WA 3A5FA 1H7OA 3GNPA 1CCWB 5CG0A 5CSYA 3TFXA 4FZIA 3DFHA 3VOCA 2HRWA 3HG2A 4WD0A 3W84A 1GUVA 4IQLA 2BFGA 2FVKA 2CKSA 3QEZA 3U2OA 4Q4RA 3QLDA 1UOZA 4HQVA 5U4NA 3BGAA 3AJXA 4NI8A 1GONA 4B3ZA 4XTDA 5A5WA 1TV3A 4KCTA 1Z44A 3GIYA 2XN0A 3BG3A 2J8FA 4POCA 1TPWA 5AECA 4AEEA 4DXXA 4XIMA 1UROA 1QOPA 3EPMA 3JW7A 5ABEA 1SJBA 2QDHA 1EEPA 4JICA 1ITCA 2UZ9A 4AZCA 3FEQA 3SY1A 3ARXA 1V0MA 4XAGA 1Q2RA 2ZX8A 5D9OA 1X1NA 5BOOA 3IGUA 3H2AA 2WZMA 3K4DA 3DYMA 1ELSA 1XIIA 4R7JA 3JUGA 4MWAC 3IV8A 4AG0A 3R10A 1HW6A 5JBEA 3TWAA 1FWHC 4NZ4A 4NZFA 1WDQA 1W3IA 2PCQA 2ZTKA 1SFLA 2BHUA 2QHAA 4YL2A 1E9YB 4S2BA 1E40A 4HYRA 1YBQB 3QMRA 3N3TA 3WQEA 1EF3A 4MDOA 3J7HA 1X6UA 3BTNA 4DQWA 1NEYA 5DN1A 5KMYA 1OABA 3KZPA 1VFSA 4X9SA 1E0UA 1G5AA 3ARZA 1OK4A 4PTXA 5CSUA 1GYMA 1K7EA 1SW3A 3AOFA 2NQZA 1XWYA 1QI3A 4S3DA 4M0XA 3U5YA 1HJQA 4JTDA 1NOFA 1FWTA 1VCGA 4QE4A 3WQ6A 1ZRQA 1U5JA 3BOXA 3KVKA 1X38A 4N4QA 3OPSA 3GG0A 4DZIA 5CGMA 1V79A 1L6YA 2YKKA 4C91A 1KR1A 4E3TA 4HOWA 1E4IA 2RH9A 1ITQA 5JQ9A 3ES7A 4MUPA 5I00A 1V6VA 4K68A 4JDBA 1V8EA 3KLLA 3H2CA 2V69A 2V81A 5BYWA 2INFA 2Z7GA 1XYMA 1IEIA 2BOFX 2EPKX 4GQGA 3HM7A 1R3RA 4LVBA 3LTYA 2UY4A 2BVDA 1ZFJA 2UY2A 1DIDA 4IXHA 1OY0A 2ZC8A 4DO4A 1FHVA 5F2MA 3LRKA 4L4PA 2HNHA 5C71A 3NDZA 2DFAA 2X7WA 2I5IA 2IUZA 3PC0A 4LVAA 2HTMA 4Y9PA 3WG6A 4Y9OA 2YFOA 3OHMB 2GVGA 2WYSA 4IMCA 3POHA 5A8GA 1VZWA 2YW4A 1HL2A 4Q22A 3ZZ1A 5EMYA 5CC3A 4AC7C 5C2CA 4MLJA 2OYKA 4CD7A 1W9VA 5G1MA 2REQB 2PGWA 1BFNA 1VHCA 3UR2A 1EL3A 4IPNB 1O5XA 4QX4A 5M1TA 1BYDA 3QOMA 3W22A 3OGVA 4DNHA 2PLMA 5AC8A 2PU0A 4UR9A 4GPNA 3R12A 1UMLA 3AS0A 3OLEA 5B7ZA 3SGUA 2AAAA 3WQDA 2FH8A 4M51A 2GJRA 1HL8A 1R3TA 2WSRA 5EY5A 1SR0A 3SI9A 3UU0A 1OC5A 3NL6A 4AHOA 1N55A 3LZ5A 1C8YA 4HCDA 2A2IA 1WKDA 1U2YA 1OBAA 1H2JA 5DMNA 1S5TA 2C19A 4GO9A 4XISA 7ODCA 3F2BA 3SFWA 3VMNA 4KEZA 1VFLA 1F61A 4IPPA 1Z3NA 2C15A 3BCJA 2X09A 1Y5XA 4IIGA 3MUIA 2I56A 2ICSA 7TIMA 2XIIA 1NF7A 1XD0A 4L9XA 4Z2IA 1EF2A 1UR8A 4GWEA 2IQDA 1Q6OA 3GC5A 3QF0A 3FK4A 4AB4A 2QGHA 4RJEA 2OTDA 3RIKA 2V8ZA 3RCYA 2DZTA 4XTIA 5T8GA 1NY1A 3SURA 1EB3A 4L1GA 2CC0A 3H24A 4Q4KA 3RHGA 3AYTA 3WNPA 5F1VA 2WJFA 1FWNA 2ON3A 3WBXA 3ITXA 4D6IA 2XVGA 5F4XA 1EWDA 3BAYA 3UPWA 3B97A 1BVZA 3GE7A 3QMSA 1M7OA 3CWOX 3RU6A 3QFWA 2VWSA 4KETA 4JTUA 3CBWA 3TW6A 2CXGA 2CBJA 4PFMA 1R9XA 5DBUA 4IISA 3LI1A 4XWUA 3AICA 3PWGA 3H12A 3VABA 3SRDA 2C6QA 5A94A 3OLDA 4PMVA 3CMJA 2TAAA 4FLRA 4XAZA 1KNWA 1EQPA 2ZRWA 2VQUA 1MW1A 2HCVA 2CBUA 1QT1A 1XGZA 3FJ6A 3MMWA 3GFZA 4DWSD 1EUNA 4C1KA 3TYZA 1MUCA 1V51A 4AY8A 4DJFA 1XI3A 4N6FA 2HK0A 3WBEA 2Q6ZA 3MHGA 3KTXA 2OYMA 3E2VA 5AVNA 2GJXA 2G96A 1UMYA 1EJTC 3STCA 5HPOA 3HU7A 3W83A 2QCMA 5AC4A 1UPMB 4QBXA 1T5AA 3LTPA 2V0TA 3SCQA 3IAPA 1DQWA 3NQ2A 4IQJA 1YQ2A 2GK1A 3AAMA 2YXOA 3WJSA 1FWEC 1MDRA 3AIUA 4DWDA 1J10A 1SFJA 4R5EA 2C1HA 4H6QA 3TFCA 4B4FA 4M56A 4L4LA 3A47A 2Z2UA 4NYUA 2QVHA 3RR1A 3FYYA 4HK5A 4FF7A 4O4VA 4NSBA 1GQIA 1VFOA 2PDPA 4H7CA 1EOMA 3VMOA 1NWTA 1OK6A 1ZP4A 1GVYA 1MXDA 2XIQA 1P7TA 1TTPA 3XINA 1UZ4A 1EQCA 1IT7A 4UFHA 1WKFA 1J2WA 2WKJA 1RCQA 2ZX6A 1X8CA 5CSSA 5JBDA 1E0TA 5HJLA 4NJGA 2UY5A 1TA3B 3DHUA 4N7QA 2HS8A 1G94A 3LGDA 2E40A 1HJUA 1SR9A 5AYIA 3E2RA 4QCEA 1XLEA 1P0EA 5AKQA 2RDUA 1R9YA 1YDOA 4QS5A 4HNLA 4JTGA 4TVCA 1TPH1 1IIGA 1MNZA 2PS2A 1NQKA 1E4MM 3SUSA 3BXWA 2VO5A 3ARVA 3FA5A 4O1EA 3CAQA 3OBAA 2WMHA 4H6RA 2BHZA 4GUHA 4ZOAA 3PJXA 4UTMA 5T9CE 1JDEA 3GR8A 5A8OA 3KWXA 3MT1A 3CQ0A 3GWQA 3TOYA 1VJZA 1ZBKA 4RE0A 3IRDA 1BHGA 4HBKA 3RNDA 4KWSA 4UZUA 1XQKA 1SO3A 4O12A 3U4FA 3NQEA 2PDWA 2Z1KA 2WVVA 4N9DA 2VMFA 3WMLA 1UKOA 2VFHA 3KUMA 1J96A 4L4OA 2NVDA 2H9AB 5EB8A 3MTWA 2JK2A 2O7QA 1XLHA 4DJEA 1LOSA 3VOFA 6ENLA 3AQUA 3H54A 4CD5A 3TJIA 4FHAA 4B5SA 1F6PA 4DWSC 3V0SA 4MAZA 3VKCA 1FQ0A 3UYCA 3M7WA 1J0IA 3ATZA 1PKYA 3R6IA 1OT2A 3HQ1A 2YZRA 4US5D 4X9YA 5FSEC 4O50A 3BOLA 3C2VA 1I6NA 2A3BA 2X1TA 4NAFB 2V30A 1EJUC 5I07A 3B4UA 1G7UA 4Q8QA 3N6HA 5CPTA 4R9XA 3T0AA 4UFLA 3P5ZA 1FDJA 1XCXA 3G1VA 3ZR4A 5C9UA 1H41A 1P4CA 1XYBA 1LBLA 4NUWA 3NPVA 3THCA 1QK2A 2BVTA 1W3TA 4YNGA 3STPA 4L80A 3AWNA 4LUJA 3VNDA 3TQPA 1VGAA 1BG4A 2VRQA 3RITA 3UR8A 1K8ZA 3VOGA 2J7BA 1YLVA 2DSZA 4V1YA 3MWCA 4LYRA 2PTXA 3CZ8A 4LYKA 4J3TA 2XIJA 3DFTA 3USBA 4U3AA 3II1A 3NZGA 2VZUA 1SM9A 5BXRA 1QOQA 4F4RA 5ABFB 3R58A 3TX9A 1A5AA 4FNQA 4YU1A 3I4EA 4ZR8A 4B92A 3OGSA 2YZ5A 4B15A 4K38A 4D6CA 3OP2A 4JY9A 1FWSA 3GSMA 4QSHA 3GC2A 4AMCA 3L2MA 1XDJA 4JN8A 4AD5A 4RNIA 1TZZA 5A6JA 1LWJA 2AL2B 4AMAA 2C91A 5A2BA 2VD8A 4Q8PA 1V7AA 3R11A 4C6QA 3S5OA 8RUCA 1GOIA 3AUOA 6PTDA 2Z2BA 3CO8A 4Y96A 3M41A 2ZA2A 3IIVA 4GI9A 1YEYA 4IIHA 3CQIA 4I9TA 2OPJA 4AWUA 1H61A 3W02A 2NQLA 4L6OA 2WM1A 2J7DA 2RJGA 4O1DA 3N4AA 1GG0A 2VKZG 4YWIA 4KCWA 4UQDA 1LQAA 4PFHA 5LSMA 2CHNA 1YNPA 3QVQA 4EWND 4H7VA 1PJ9A 1OFAA 2O56A 3I65A 4K7VA 1HKMA 4DLMA 1HX0A 4HN4A 3DCPA 1JZ8A 9XIAA 2IKIA 4Q8OA 2ZXQA 4JFVA 2B7NA 2NLIA 2I14A 6TIMA 1DJZA 3M9YA 1CPUA 2Y7DA 4MZYA 1V6TA 1UP0A 1FFRA 5A69A 1KFJA 1Y65A 1JNDA 4O11A 4PL2A 3FAWA 3NQDA 3PS7A 3CC1A 1OG0A 1KRBC 3LM3A 1K7FA 2QR6A 3FKKA 1W5MA 3EEGA 4CU7A 4F48A 4G2DA 2EG7A 5AB3A 1YE4A 4Q4OA 3QGAC 4FR1A 2BG5A 1KRAC 3R25A 4DELA 1W1B1 2QCDB 3PN8A 5REQA 1X96A 4Q8TA 4QHRA 5AYBA 1BRLA 1H5VA 1GOKA 3DFQA 4RLIA 4GYPC 1NAL1 3WZ0E 2VI0A 3EZ4A 3MSGA 4CNPA 3GHUA 2B81A 2OGYA 3NQ8A 3CYVA 3NM3A 1V3HA 1UR9A 1UZDA 1NELA 4AEOA 5BRQA 3EDDA 2X1SA 3O0KA 4I7UA 1ZY9A 1W37A 3QR1A 1TYGA 1LQ2A 3N19B 1SO5A 3A4WA 1V7YA 1DHKA 3AUJA 2A7NA 4JTHA 5D04C 1UC4A 1XIHA 2VZTA 3Q65A 3W7GA 1M3UA 1Q3NA 4Z1CA 1K1DA 3EKGA 2FLIA 2CWXA 3F2DA 3BH4A 5LGZA 4WKHA 3UVIA 2ZVIA 3K1DA 1CGYA 3GBEA 3SQMA 5E0FA 3SM0A 1GVIA 1YPIA 1PZ3A 5HA7A 3TR9A 4DF0A 1UR2A 3HV8A 2WXDM 3SJ3A 2V5KA 5LNSA 1CGVA 3PWIA 4AISA 3RFAA 4V28A 2XSBA 4RL3A 2WKGA 1ZLPA 2AMXA 4TIMA 2VX5A 4LUSB 5A1AA 1HXJA 4JHOA 5BXPA 4HPJA 3CQHA 3UT0A 1Z32X 1TVPA 1LTDA 1SFTA 4XKYB 3ALFA 1XHGA 4A05A 1U5VA 1E5JA 2IMRA 1RLDA 3DYOA 3GIPA 4D6DA 4UTTA 1KTBA 4MYAA 1XLIA 1P6BA 2XZ7A 3G6LA 3VUPA 3GXFA 3UJ2A 3UXDA 1SMAA 4S3AA 1EYEA 2C13A 4HMNA 4JY8A 3P61A 4GXMA 3S5ZA 5FIPA 3MJMA 4FX7A 2NXHA 4NKCA 5A6TC 3K4WA 1SJAA 4LWWA 3IEBA 3WMSA 3UGRA 3FLUA 3PAJA 3VGGA 4BWLA 2WO5A 2VX4A 4YLWA 3RRXA 1IXPA 2VOTA 1RY0A 4JL2A 2W92A 4JHMA 2X1IA 2WZIA 2FVLA 3LENA 3SUVA 4YTQA 1DXFA 4LS2A 3BL3A 4WIWA 1H09A 1QJWA 1XXXA 1A5NC 2IKJA 1XLAA 3RX4A 4XG1A 2JKAA 1JCYA 1SZRA 5DRIA 4DUOA 2DIJA 1A5CA 1VFMA 3W1NA 1PKNA 2PDBA 7PTDA 4K39A 5G5IA 4FXFA 5LA2A 1TREA 3AS1A 1CGXA 3M0KA 4JBRA 3WF0A 3W7LA 2QJIA 1XINA 3EWCA 2UWFA 1S2TA 1BGGA 2ODOA 2F8QA 2YFNA 4Y9MA 3L66A 3NOEA 2PLJA 1H4PA 1OX4A 3CXOA 2J7GA 4AZ7A 1AZ2A 4ICCX 1B2YA 2ZIDA 3LQGA 1IT8A 1GTHA 3VINA 1VAHA 4I8DA 1VPQA 2EPMX 5LGXA 3TZNA 5EFDA 1ZU8A 4LF1A 4MG4A 2ZXAA 4L56A 5DCBA 2DZAA 4HT3A 3BPWA 4LUYA 3MMTA 3WLHA 4H9XA 2WMJA 3H23A 2CHRA 3AMLA 3AI0A 3HG5A 3QY7A 4JTTA 3EB4A 1WAWA 4M24A 4REQB 4RNHA 3T44A 4CCZA 3GXIA 1G0CA 1AQ0A 1SW0A 3IUDA 3NEVA 4ZOCA 3DUGA 4YVPA 1QBAA 2PDCA 4MNLA 1IF2A 3LCXA 2B0MA 4H9ZA 1TWDA 1WA3A 3KL0A 3ZVHA 3W7IA 2DUAA 3UD6A 4O1BA 2FVMA 3WQ8A 3BJFA 3KVMA 4ZB0A 4H19A 4AY1A 3ZIZA 2CZDA 1ZAJA 2HDJA 3WFZA 3WY1A 4W8LA 3MDUA 2BB0A 1BQGA 5DFAA 3CH9A 5HWNA 3KWSA 4A2RA 4LUTB 3DFYA 1MVYA 4EF9A 1E5NA 1LWHA 4US6A 2BNJA 2NXGA 1P1MA 1N2VA 4PCSA 1ZAIA 4HVXA 1H7NA 3FSUA 1DVJA 3FIGA 2OCZA 2YW3A 3NQ6A 3WLIA 2ZE3A 4MGGA 3NR0A 3KCJA 1VYRA 2IQ0A 4CCEA 1ME9A 3TAKA 3CV7A 5FESA 2Q3RA 2FZDA 5HQLA 3DBPA 1KLZA 1PS9A 3OB8A 4F9JA 3LK6A 3K5XA 4GCAA 4ATLA 2CLHA 5H2ZA 4AIBA 5EFFA 3HN3A 3RYSA 4F0SA 4PGLA 3STFA 1KV8A 1SO4A 2QGYA 4GUJA 5CZTA 3HG4A 4LS0A 4KEUA 1ZNNA 1QI5A 2CLOA 4MJMA 1PAMA 3EPOA 3S42A 5MF5A 2IPGA 4I3GA 2YJQA 2XH0A 4H4IA 1KA9F 2AQOA 1W3NA 3FAXA 1J0HA 3URAA 1W6TA 3SQLA 3RO6A 4C5YA 4ZB5A 3L4XA 1W9XA 2G97A 4IQEA 4RCXA 1SYTA 4RE2A 2BXZA 3KBSA 4KPLA 1DWIM 4M81A 1E43A 3EPNA 5HXMA 1DPMA 2GOUA 4MY9A 4NZJA 4I7VA 4LY4A 3LDVA 1AQFA 2ATSA 2XSXA 5FJIA 4FIRA 3HIJA 4XB3A 5DO8A 1IEVA 1KRMA 1KLYA 2ONEA 3GTHA 4LV9A 4A8NA 3W2JA 3KXQA 5I3HA 2WAGA 2PSNA 1X97A 2OEKA 1ZJAA 2Y61A 3DESA 3PBWA 3IVUA 4PUJA 3R13A 3F2CA 4AZBA 2VX6A 1YHTA 3PZIA 3MV11 1MFVA 1EZWA 2J74A 4CNNA 4GI8A 1G7VA 2Z6JA 2VDHA 1W32A 3EOLA 4JCLA 4ZTXA 1S46A 4QDMA 3UW6A 3TMLA 1RD5A 3LTSA 4LTSA 1UWTA 3CZEA 1K9FA 4FNRA 2OZ0A 2VT0A 3W73A 4DJFD 4K37A 4IUOA 2DH3A 3UP8A 1J0KA 3R0UA 3QY6A 4EF8A 1TPC1 4N6EA 1M03A 3M0VA 1WZMA 1G4SA 5XIMA 1LUCB 1YIXA 1K77A 3E0WA 1A5KC 3CTLA 2JALA 4GYFA 3PZMA 3N15A 4IGMA 3GIQA 3L4ZA 3VAVA 4O54A 4C1LA 1BAGA 4M6PA 4JYDA 3TTSA 2OX1A 4A6GA 1AL7A 3UXKA 1TPDA 1GTEA 4FI4A 3GKFA 2QCEA 2ISVA 3ZJKA 1XKYA 3VO0A 3WH8A 2XZ9A 4Q8NA 3B8UA 3GTIA 2P8CA 5CBJA 4J35A 3PANA 3GHRA 3GFYA 2HV5A 3K8MA 3W7CA 1QASA 4JIQA 3SIZA 2E09A 2Y5JA 4GZ7A 3PB0A 4H6EA 3WF1A 3EB3A 5JXQA 4H00A 4RUBA 2V9DA 1MEHA 5CZSA 4QR6A 1W3JA 3T0CA 1RA0A 1W56A 3LGGA 1K4HA 9XIMA 3WLPA 4J4KA 5LA0A 2E6YA 4WHBA 1XLFA 1OFQA 3GNXA 3TSMA 3T09A 5ECUA 2QDGA 3L68A 5TF0A 2BGSA 4G7EB 1DJYA 3ARRA 4CQ8A 3EOUA 3DGBA 4YYCA 3AWOA 2P88A 4GQ0A 7REQA 4IQDA 2XGBA 1HJXA 2PUZA 4DBWA 2EF9A 4F3HA 5A6MA 2WW5A 2V63A 1AQHA 4G8TA 1JQXA 1RP8A 3E12A 2P10A 3IAQA 3HGSA 4O0ZA 1U1HA 3OGRA 3P14A 2OU4A 3ZMRA 2V67A 4JQAA 2WJZA 4L7ZA 2HROA 5J5RA 4H9TA 2ZZ1A 4DM2A 4ZL1A 4LAKA 4IH3A 2ZWYA 3IJDA 1LT8A 3OZOA 4C60A 4DJED 1V3IA 3P6LA 5H8UA 1B3ZA 1PWMA 2OEJA 4S3EA 4UZSA 4NU7A 2ZZ4A 3MBDA 3VI2A 1EUAA 5MKGA 5EPDA 3W1LA 3UNTA 1AJZA 3ZXWA 4HPXA 3WLKX 3L65A 4W4QA 3KL3A 3CO4A 1W5OA 2PDIA 3WELA 2ZZ5A 4KWUA 1Y0EA 1Y8BA 2R91A 1VR6A 4MF4A 4MB4A 3RUBL 1UD5A 3T2OA 1LM1A 5A6SA 1EC7A 1FWBC 3N2MA 4W84A 4ZQPA 3SDOA 1XIBA 3GNOA 3TJ4A 4C6KA 4F8XA 4ZO7A 3WEOA 3AMGA 3CLMA 4AU0A 3APYA 1J2BA 3V35A 3UPBA 5HUPA 2YBTA 4FXRA 2ACQA 1GVQA 3UVAA 1R3WA 1IXQA 1QPQA 2BGQA 4ZO6A 1ICQA 5HANA 2WLZA 1Q85A 4FNUA 4RNFA 1R3QA 3PY2A 4PR4A 3W6MA 3MZ2A 3PSVA 3PTKA 2D22A 3EAUA 3W86A 3H55A 5CXPA 3NDOA 5BOFA 3IACA 1OD8A 1AODA 2P0OA 4L9ZA 4E4FA 4LVGA 2WSPA 3CT2A 4PB4A 2PU1A 4AH7A 5FAJA 1H0GA 1GVFA 2X30A 2J8GA 1V6WA 2QJHA 1UIPA 4PBFA 2P53A 1J6PA 4CN6A 2J24A 1TSIA 4J2PA 1W3HA 2R8WA 1QPNA 4RR4A 1ISZA 3C2YA 2XH4A 3M0JA 4CD6A 4XZLX 4X2PA 3V5CA 3MYPA 2PF8A 4J40A 3VDHA 2V3DA 1ODUA 5KZEA 2ZUWA 1XDMA 5DBTA 2QUVA 2CW6A 2VEKA 3QY8A 3L7RA 2WZHA 4Z08A 1GJWA 3RAOA 3MUAA 4OU1A 5H8MA 2VD9A 3QBUA 4A8RA 2GLKA 3TN4A 2R1PA 1BTCA 1EHNA 2J9YA 2G95A 1WAUA 3ARSA 1ZBVA 4IZGA 4WDUA 4RDZA 5IBXA 4W5UA 3LHYA 1NM9A 3NCOA 4LFYA 3W76A 3UG4A 1ONEA 3E2SA 3O7UA 3PK7A 2ACUA 2NUYA 4B5XA 1Z7AA 5IM51 2GUBA 1A3WA 4EVZA 4HGXA 1E6NA 5CC5A 3NPUA 4C6LA 3EXRA 2W9MA 1VF8A 3D3AA 3V75A 1E71M 2BOGX 3EA2A 3T0BA 4H41A 1UP2A 5LNUA 2G3NA 1K4GA 4HMEA 1N8IA 3BW4A 1GOQA 5EBAA 1V08A 1REQA 2IKGA 4ZODA 1EP2A 2D3NA 2QDDA 4HTBA 3GR7A 4FXJA 1F4HA 1UUMA 2P1FA 1DE5A 1XCFA 2PGEA 3D0CA 4LCSA 3O3RA 3A4XA 4IJRA 4PSPA 1PTDA 4MVAA 4Q4PA 1DQUA 2CITA 4NXKA 3B40A 4N42A 2DT1A 3IJLA 6TAAA 3E0FA 3KFTA 3TU9A 2ANUA 2V5BA 3CU2A 4EPDC 4PUKA 4NT0A 4GH3A 3S47A 3WLJA 3DHDA 1PXGA 2OKOA 3WLSA 3LPOA 1EWEA 4C5ZA 1PTAA 4EIVA 2VGBA 4MB5A 1XQLA 3S46A 4H6KA 2GGGA 3IS4A 3LOTA 4GFSA 3CS2A 2ZKMX 4L6HA 4ORMA 2RDXA 2INEA 2WZTA 1W5NA 2PRHA 2WANA 3CMGA 1RV8A 2OG9A 4WLCA 2IW0A 3JZEA 3AIWA 4I5UA 1OT1A 1OQFA 1ZS2A 2J4GA 1G1YA 2WJDA 4QISA 1H3GA 1KXVA 3UQNA 1AH4A 4HOXA 4JKKA 3UJFA 1W5QA 4DF2A 5JBFA 1DHPA 3VTRA 2GSJA 3HZ3A 3BSMA 4IL0A 1UD8A 5AHNA 4L64A 1KTCA 1YTKA 1WZKA 5CBBA 4GYJA 4U5IA 4X0VA 4WKAA 3BLFA 4NNCA 5G2HA 5DRCA 1DJGA 4YTTA 1RJRA 3U7BA 1PCKA 4BZYA 2YYTA 1TCDA 3W7QA 1PE1A 2ZE0A 4JR5A 2J79A 5IXEA 4PE8A 3LCLA 3LCHA 4WQ6A 2J27A 2B7OA 3RRAA 2X05A 2BTMA 4IHCA 4EPEC 2QJJA 2WSQA 3G1YA 2BY1A 1O5RA 5EMJA 2ZC1A 4TO8A 4UQCA 3GDTA 2YL9A 1WDRA 2FZBA 1SJCA 4QEHA 2WJEA 4FLOA 5E70A 1R2TA 3GBDA 1V6UA 3TEVA 4KRZA 3P5YA 2E6DA 4TX9A 4JKLA 1XLKA 1AD1A 1RPKA 1BSIA 3LGEA 2XTKA 4A22A 4MY8A 3P3BA 1L6FA 3UZYA 3AS3A 3DXIA 4NZ1A 7A3HA 5F4SA 2V3FA 3ITVA 3A4JA 4C6CA 2W91A 3ZWSA 1J0JA 4PODA 4H9UA 2J78A 4P8UA 1CW2A 4TU1A 3NFUA 4JS3A 1I75A 3BMVA 4GVIA 3HBLA 2WNQA 2WPGA 5JIPA 1EJVC 1TCMA 4L1XA 3VNKA 5LNWA 1JNEA 4ZE5A 1Z9AA 4ZBCA 1QHPA 3VMPA 3PJTA 4JIIX 1PEZA 1DJIA 1MMFA 4FK9A 1J6OA 1W8SA 1E1FA 4EAYA 4AF0B 4Q7NA 1K8XA 2QUTA 5CPNA 4IGSA 5XIAA 1H1NA 3EA3A 1MEIA 3R8GA 4XZBA 2J6VA 1TWSA 3LLDA 3T42A 1JDFA 1E73M 1GOMA 3N2OA 2J9ZA 2Y7EA 3AXXA 2QJGA 2OEMA 2WVSA 4PMZA 4WEVX 2F6XA 3EGJA 4AX6A 1KXTA 5J5DA 1QNOA 4MKNA 3R8RA 3M47A 1RALA 1ZALA 1GJPA 4TMCA 3M6YA 3C3NA 4C7DA 2QLYA 3EA1A 5FD0A 1CGTA 4NI3A 3FV9A 4RZ4A 1B30A 1TV5A 3OODA 2PDHA 1F05A 1XG3A 3TYEA 1ONRA 1C9WA 1XLCA 2JGQA 3WD1A 1HVXA 1FP9A 2I17A 1Q66A 2D0FA 1HKKA 5TQLA 3S4TA 3CV2A 1E72M 3VNMA 3ZR5A 1VEOA 1JZ6A 1RXOB 3SCTA 5K4ZA 2WHMA 3BG9A 1UQZA 3VD4A 5JU6A 3WBYA 3H7UA 3ARUA 5E6ZA 1TO3A 3DHFA 5FL0A 1R0MA 1KO0A 2WNZA 1TWIA 1M7JA 3G18A 4JIRA 4C6PA 1TMLA 1I1WA 3IVTA 5HWJA 1EO7A 4MAVA 2DIKA 4XBSA 4BI6A 1Q6DA 2RHGA 5F7UA 4FF5A 4KIEA 3WD2A 4IMGA 1G9HA 3NZQA 4IICA 3WDIA 3O6AA 4PBEA 3ZJ8A 4AZCB 4DPQA 1D3CA 3ITOA 3H2OA 2Y0FA 4JX6A 4GFIA 4E8DA 1O5QA 1GQNA 2YB4A 3E3HA 2VEGA 3WNKA 2OZ3A 1W1TA 2FJUB 4M6VA 3GS6A 3A23A 1E6XM 3LEPA 4XUGA 5HNTA 4CQAA 2ZQ0A 4DJDD 1ONWA 4W89A 2V2HA 3VNLA 1KFLA 4A3QA 3E1F1 1KBJA 3DIPA 1JZ3A 2Z26A 3CEUA 1Q7MA 3K13A 1CB2A 1QMLA 4GQBA 5ABHA 1UA7A 3EX2A 2VTFA 3B9EA 3MY9A 4PZVA 3CZGA 3ZT5A 2R82A 4KIRA 1PX3A 1GVOA 3QHOA 1S5NA 4FSAA 3DZ1A 1P1XA 4LRSA 2ALDA 2YGYA 4WJXA 3PAOA 4QG6A 1IE7C 3SEPA 2XIMA 1MUMA 4ZA0A 5LHFA 2HPMA 1DJXA 2C16A 2VFIA 1B9ZA 1JPMA 4Z2JA 3KBVA 2E7FA 2WKLA 1VCVA 1GPFA 1IWPA 1XL9A 3O0FA 3UWVA 2DW7A 1FH8A 3HGJA 3PSWA 1TJRA 3VNYA 1K70A 4YTRA 1CZ1A 6XIAA 3WLRA 1BWVA 3LHUA 3GTFA 3S2MA 3VD3A 3NXLA 5DEZA 2DORA 1XSKA 5D09A 1UD4A 1FWRA 1QBBA 1KGUA 5BU9A 3H7VA 3W37A 3S5SA 1GKPA 1QI2A 1BEUA 3FOKA 4KMQA 1KBKA 2FJKA 1QR7A 1R6WA 3Q58A 3NQFA 5JH1A 4C7FA 4LV4A 2VRJA 4NASA 3BQ5A 2E1DA 1GW9A 4EKJA 3TIMA 2BWGA 3QZ6A 3E5BA 2R24A 1JDAA 1TWWA 1XPGA 8CGTA 2FIQA 1OG6A 4MMWA 4PEKA 4A3HA 4RE3A 3IGSA 3T2QA 4R33A 2POTA 2XWEA 2VELA 1ECQA 1S5MA 2JE8A 1GJUA 1GEQA 1JD9A 2X1UA 3L0GA 3IWPA 1DXIA 2VDGA 2D2GA 1DWJM 1M7PA 4RXFA 5BNKA 1HZYA 4FLQA 5B80A 2PRMA 4GBUA 3T2PA 2ZYFA 3TV8A 4DBEA 5LKYA 1NFGA 1S2CA 2ZICA 3QGVA 3LHTA 1O1HA 4MM1A 1J4EA 2RFGA 1LQ0A 4FAMA 5I09A 1XV8A 1LYXA 2DVTA 5CKSA 2Z24A 4HD5A 3OBKA 3UF9A 3OIHA 4DJDC 4R3UA 1OF6A 3GTNA 2QCNA 1HG3A 3VIKA 4U2ZA 1U5HA 3VKBA 3PBUA 3P93A 4PULA 3CQJA 4Z1YA 2F61A 1ECEA 4HJFA 1X6NA 5H91A 3P62A 4AD2A 3VNIA 3I3BA 4DLFA 1L2QA 3PB2A 1PZ1A 3W82A 1M68A 3THDA 1THFD 3M0HA 2PTZA 4YJ5A 3AIEA 1I2NA 4L1WA 3LCFA 2GQAA 3NO5A 2EGZA 2WC3A 1H0IA 3DOPA 3TKFA 5KZ6A 3TNBA 5FAGA 3TK7A 2GJLA 4OJYA 3DKJA 3KDNA 3ANVA 1Z41A 3E0VA 3F1QA 4URIA 1I1XA 4NRSA 1NFPA 3GVRA 4GOAA 1OYCA 2V38A 4E4UA 1RCOB 1UZHA 2J7HA 1O60A 3RJXA 5A6BD 5JH2A 1O6IA 1WDDA 1OGGA 4ZSTA 1AD4A 3MB9A 2NV9A 3NURA 4FR6A 2FFCA 1NWUA 4E5TA 4GE8A 1LL6A 3BOFA 4GK8A 1FWJC 1GHSA 3C2EA 4MKSA 3KAOA 2QF7A 5BZAA 5C54A 1I0BA 4GKTA 4GRSA 4HPHA 5CEWA 3PPGA 3S1WA 2I16A 1JRCA 5FEPA 2DSKA 4P5UA 4W7UA 3H2FA 4O1CA 4C6BA 1BG9A 2PD5A 1DL3A 3SRFA 3LZ3A 1B4KA 4HP5A 2VVNA 2ZUNA 3WK1A 3THAA 1XIMA 4RDYA 1H5YA 4NG3A 4HTYA 3DDMA 3NGFA 5FF0A 3GK0A 1XIJA 4KW2A 3MSYA 2QCFA 1KD0A 4LUIA 1E4NA 4XAFA 3O15A 3ZSSA 1ALDA 4IUGA 1VFTA 3SCOA 3EOOA 1G4TA 1F4AA 3D3FA 2INZA 4J3UA 2QPUA 3DG7A 2GJXB 2VC5A 4MFDA 4PTMA 4XZHA 2YLLA 3H70A 4AVNA 2GDUA 3WENA 1G4PA 1EC9A 2GVJA 1ISWA 1UR0A 4HNUA 1US3A 2E4TA 4K1GA 2C8NA 1JGMA 1SMDA 4WGXA 2NQJA 1IEQA 2NQ9A 3IJ9A 2Y8VA 4DBUA 1EH9A 3FEMA 2PLCA 3GVGA 2ZXDA 3TTYA 4ZFMA 3AHXA 2GK1B 2R14A 3NVTA 4IFKA 1FKXA 4Q4SA 3DBNA 1RCXB 3W1UA 3ITYA 4PEEA 1W54A 1W9UA 4HN8A 4RXGA 3GB6A 3F7JA 4LBSA 1LBFA 2HSAA 4Q8MA 1IQ8A 1VLWA 4PC8A 4PRRA 5TIMA 3W7DA 2PLKA 4DX3A 1UIOA 4ZZ9A 4MDPA 1QUMA 2EJ1A 1FCQA 3E38A 3BANA 5EBUA 5M2FX 2EBNA 3IIXA 3LCWA 3GW3A 5FKYA 2J66A 5G4EA 3ARQA 1Q7QA 2PRLA 4O13A 3PNUA 3NTYA 1B3WA 1ISXA 2E8YA 4WCJA 4TMBA 1H50A 2J7FA 1JCNA 4D72A 3QKEA 4PMOA 2QMJA 5LIKX 4QJ5B 5I0DA 4ZQMA 1CLVA 3GXMA 3T81A 3MS8A 4GVHA 4V15A 1QO2A 2EJAA 3BV4A 1GPWA 2XDFA 4OQVA 1IEWA 2AKZA 3W7HA 2YLAA 3SCWA 4IGHA 5FF4A 3GLCA 5BMWA 3WUEA 3COTA 3TH6A 2G4FA 2BVYA 4HZ7A 2HK1A 4C6OA 2F7FA 1H1ZA 3CM4A 4WDWA 3OTRA 4OECA 1XD1A 3LMYA 1S2VA 1QHOA 3RK8A 2DZUA 2WSKA 4N9EA 2WWDA 1XUZA 4JHZA 2DZSA 2DUZA 5FJOA 1UQYA 3OZMA 2WLYA 3OYZA 3N2XA 5T9BG 1HVQA 4NL1A 3VYLA 4KS0A 4BY3A 1Q4NX 1C90A 2XH7A 5DELA 5KZDA 4IWWA 3WLOA 2E6FA 3WLQA 2WVTA 3GYCA 1XDLA 1BF6A 3TW7A 3O9NA 2POZA 1ZBWA 1FHDA 2WOQA 1QNPA 1HUVA 2GGJA 1JPHA 5GVJA 4DXKA 3VGDA 4LEFA 3LXAA 3AXMA 4AWTA 3C52A 3VIJA 1J9YA 3MCOA 5I3FA 4OZOA 1PYMA 1IGWA 5FA5A 5DCDA 1V3KA 2GQ3A 1ISVA 4J27A 3O6YX 2HWGA 4DVOA 2OB3A 1WDWA 5GJNA 3L0KA 3A24A 1F73A 3CJPA 1CXFA 1K3UA 5G1YA 2Q01A 5LA1A 1LG2A 3KBMA 1US0A 1XIGA 3IANA 2I5QA 5A6AA 5M3WA 4GJJA 5LIWX 3P8IA 3TA9A 4D8LA 2YCIX 3P80A 4AEFA 3KBNA 1QNRA 4YWSA 5C9ZA 1W3LA 1JI1A 1O5KA 2XSAA 4E8CA 5A2AA 5EMKA 3W1PA 2Y24A 4JGDA 4EPKA 2PPGA 4WDTA 3WUFA 4KFOA 3B0VC 1E70M 3G8EA 3TSDA 1B90A 4G7FA 1QFEA 3ANYA 1BD0A 2VZVA 3CWHA 2VZSA 4BQ2A 1C8VA 1BVWA 1CXKA 3NEHA 1O94A 2GGHA 3E02A 5J04A 4XD4A 1VBRA 1XW8A 3N17A 2GUUA 3VUSA 3H4XA 1IHIA 4IIBA 1ITUA 3W28A 3BURA 2VXNA 1FRBA 1TR9A 2A7PA 1HKWA 3DFSA 2YDQA 1XRVA 4GKLA 2Y63A 2V5JA 2FMOA 1E4LA 1LORA 2VZOA 3GDMA 5G4WA 2O4MA 1F8MA 3CUXA 1ZENA 1A53A 2OOFA 3GUGA 2WPBA 4H04A 4M7SA 1A4MA 3O2LA 1GOOA 3ABRA 4GC3A 1TTQA 3GXPA 2BBFA 2TRSA 1XRSA 1IR1A 2X7VA 3DHPA 3ONCA 3S2JA 3R5EA 4A2SA 2CPUA 2W62A 2Y4SA 3VKKA 3ITLA 2XM1A 4H1ZA 3PZ9A 4GUGA 1R9ZA 2PWEA 2P8BA 3APGA 4PTWA 3L4UA 2FDSA 3U2ZA 3RF9A 3O63A 3WFLA 3VIPA 4B3KA 1TPEA 3W6YA 5K9CA 3W25A 2A3HA 4F0LA 3QQ1A 4X0NA 3IGXA 2YA2A 3ISIX 5G4HC 4I6VA 2ESCA 2YR1A 5F2GA 2BODX 4WF7A 1XLBA 5AYYA 4WUIA 1TPB1 2FGZA 1GW1A 2YBVA 3MW7A 3N18A 1CWYA 1T40A 4NX5A 3OA5A 5KETA 3E2QA 1IWAA 4D9PA 4AZIA 3M46A 7TAAA 1KCXA 3M7SA 3W1MA 4R7OA 3TJLA 4ENLA 5EGRA 1TJPA 1H49A 2BMBA 5REQB 1E9ZB 2YB1A 3LMZA 1BRLB 3VVGA 3PTQA 1SZGA 3L67A 3ARPA 3IJQA 3KVLA 2ATMA 4Y8FA 3AALA 5C8BB 2VURA 3AYRA 2QCGA 1CIUA 1DJNA 2YOCA 2ZUUA 1GQJA 4ILSA 3WCZA 1ML1A 1JEZA 1A5LC 2E67A 2WHKA 4ZQOA 5L9FA 2AGKA 3M0IA 3CB3A 3LV5A 3KDOA 1QPRA 3AHVA 2FDMA 4G5DA 4BF9A 4ROPA 1J8VA 3T4WA 4LSBA 3DYPA 1LDCA 3KS5A 1UJPA 2Z1BA 4DUWA 2WHJA 1XBZA 3RMJA 4CNTA 1E55A 5HQMA 3AMDA 3LN3A 3GUWA 3F5JA 2HZGA 1VP5A 1VBUA 4J7RA 2F84A 1ZPTA 2YA1A 4G9PA 4D6EA 1LBMA 1Q8AA 2OWWA 5ECVA 3FVMA 3TOPA 1QW9A 5IFPA 3ABQA 3C0JA 4LAZA 3NA8A 2YL8A 1MZRA 5D33A 3P0XA 4LGXA 4Q6JA 1GZ1A 2O55A 1AVAA 1JZ7A 3FNDA 3T78A 1PO9A 1XFCA 1A80A 4QIUA 3A9BA 3N04A 3TE9A 3TYDA 1E6QM 4MFEA 4ZE4A 3GG1A 2GUYA 3BSHA 1FWGC 3KX6A 2J13A 2RAGA 2GSEA 1VFFA 1J01A 1D7KA 3B8WA 3EWDA 4NY2A 5C7VA 4MJ4A 3GO2A 1J5SA 3G0SA 4WVXA 1F9CA 3QC0A 3LRLA 1E1CA 4P8WA 1RUSA 1T41A 1BYAA 3GH5A 3LBCA 3GNNA 6A3HA 3MSRA 1ZTVA 4LPCA 4LRTA 4RV3A 3KOZA 1XC4A 1GT8A 1O66A 4ROQA 3VKDA 4O10A 3M16A 1S3HA 3GVWA 1MFUA 5C5YA 4WY0F 4LAMA 2Q8LA 3GAYA 4MWAA 4Y9NA 1L8NA 3W1AA 1A5OC 2C1GA 4C6FA 3WNOA 3EWZA 4PL1A 3CUJA 3VC6A 3HOJA 3RGTA 3QJAA 4XO6A 3DENA 3KRZA 1XX1A 4H9VA 1NWSA 1L0PA 1H1YA 3E9AA 3V4BA 2EEXA 3B06A 4YHEA 4CQ9A 2W63A 3T7VA 3V0UA 2X0SA 2D20A 3KTSA 1GHRA 3A22A 3THQA 2CIPA 4C6EA 3N11A 3TQ0A 3K8LA 3SQSA 4DO7A 2D2JA 1TFVA 4Y2WA 1XIDA 5I3GA 4MHBA 4FA3A 4ZO8A 3WJYA 1EXBA 1F3TA 4JNYA 3W85A 4K8HA 4OT7A 3H22A 1W0MA 1OX4B 1Q6LA 3ALGA 1EP3A 3AISA 3EWUA 3MP5A 2FZMA 1KM1A 2UY3A 5DANA 4ACZB 3ABZA 2XINA 1FDYA 3OHIA 3W01A 3OO2A 4Z2GA 1DQXA 4P2VA 3VE7A 1TZ7A 5HNNA 3A6OA 5GPRA 1TIWA 4HK6A 4D2JA 1Y5VA 3DG3A 4NIRA 3G1FA 4CUCA 3KP1A 2CZVA 1M7XA 2BV9A 1EDTA 3C6CA 4EXQA 1NFBA 2R94A 2D3LA 5FJRA 2UV8G 3QXBA 3TWBA 3PF3A 1K7XA 3ZT6A 3NG3A 5IDIA 3R2GA 4JTCA 3ZR6A 1TELA 3PULA 6REQA 1P6WA 3R4IA 1Y5WA 2VGFA 2QDEA 4O0QA 5B7YA 3ZVHB 1XLLA 3AMKA 3AYVA 3CAKA 2O9RA 1XBVA 3WK2A 4M1RA 4L61A 5C0QA 4LYQA 2OWXA 1QCWA 4GX8A 2WNNA 5HUOA 2OQHA 4JYEA 1FDZA 1RVKA 3JS3A 4AAJA 2DW6A 4HHMA 5TNVA 3WMBA 1OHLA 4JXCA 4O8AA 2VRKA 1NARA 4NZCA 4O0KA 4HA0A 2ZTJA 4BI7A 1V3LA 4U33A 2X40A 2J9XA 1VIWA 2QUNA 3PBYA 1O7AA 9RUBA 4HZ6A 2PDYA 3FGCA 4PMDA 1OCJA 1A0EA 3W7RA 3N6JA 2G37A 3GXNA 3G77A 1PDZA 3OVGA 4C1NA 4O17A 4W5ZA 4UFMA 4DAFA 2YL6A 4GY7A 4AYGA 1JI2A 1FXPA 4KFNA 5AHMA 1F2JA 4ADSA 4O57A 2NVCA 4E2DA 1IXNA 3SAZA 3UGVA 4M1BA 3PUOA 4F0MA 2QCHA 5EL1A 1PSCA 4Z2KA 3BUVA 3HFYA 3N14A 4LXFA 4LCQA 1U22A 1DIOA 4WY0A 1TV7A 1DWAM 4OKDA 5C70A 4W7VA 1DTUA 4PN2A 3TSBA 4M6QA 3P8JA 6ALDA 3HFTA 1MUWA 3W88A 2WM0A 5GNYA 3RPTA 4ASTA 4QJ1A 3CAVA 3WLLA 1R38A 2TSYA 4KWVA 4C6DA 3S2NA 4BR1A 1MQPA 1OFDA 1TRIA 1GZGA 3LY0A 5A3HA 3LA4A 1EXPA 4XSMA 4ERAA 2KAUC 3GNRA 2EPLX 3MUY1 4LAOA 4F9DA 1DJQA 3W7OA 4LB4A 4CLMA 2OSXA 4IG2A 3ME3A 1P5BA 2PTYA 2YCLA 3B9OA 3NDYA 3PBVA 1GVSA 4PMXA 1KM2A 1L6WA 2YL5A 2PDLA 4HJWA 5CGQA 2ZA1A 2ZX9A 4CD8A 1HJSA 4Q7BA 2W66A 4IFOA 2PDUA 2XGZA 1KCZA 3MSDA 4YXGA 1EP1A 3CHDA 3TONA 3LPFA 3OOQA 3POCA 4XD6A 2A7RA 3DGRA 3UWEA 5KITA 4GI6A 4AD3A 1OF8A 1RY8A 3CHCA 3MYOA 4JTAA 1NIUA 3H2NA 3RO8A 1TX0A 3W9ZA 3CPRA 3BW2A 5I06A 4EXAA 5DQPA 1JDCA 1YPFA 5CH9A 5D2VA 3W00A 4PTDA 4CU8A 5BCAA 3RM4A 3M0ZA 1BTMA 2JIWA 4U2YA 4NHVA 3NO1A 2CBIA 2W5FA 4YCPA 1XC6A 3ZLGA 1KBLA 3QQWA 4GGHA 3ZM8A 2YDAA 3IJ6A 4IMEA 2HXUA 4M80A 1EPVA 4LVDA 3WSUA 1Q13A 3OW1A 3T08A 2CBVA 2CWNA 3GX9A 3N6QA 3FCPA 4UXDA 1HP4A 3FXYA 1XYAA 4YVVA 3W72A 5G2IA 4OBRA 3MUCA 3S2CA 1KV5A 1KWGA 1JR1A 3FX4A 3MI3A 1EYWA 3WDJA 1UWSA 3U4AA 2TYSA 1UASA 3TYCA 3N9RA 2VC9A 2BY3A 4L5ZA 5KZMA 1Q6FA 1GZJA 1PDYA 1Q63A 3S5YA 1SW7A 3VNJA 5FOOA 3DH7A 7XIMA 5TBOA 2CXEA 3TCEA 4JTQA 3C0SA 3NVDA 2XFFA 3S3GA 4LYPA 3N4EA 1S3TC 1JVNA 1BVNP 4O4WA 1Q6RA 3MUZ1 3R43A 2YXGA 1Z69A 1ZQ5A 2QV5A 1XG4A 4NILA 1JPKA 4ZSUA 1OYBA 1BKHA 2DQXA 4AD0A 4PB3A 4R9OA 1F8IA 3W7EA 3WF2A 3WDPP 3QMTA 4HCHA 3LERA 3BLDA 1L9WA 7REQB 1XP3A 2HE8A 2X2YA 1UD3A 1VS1A 1D3HA 2Y8KA 5PTDA 1QPOA 3Q2DA 5A8MA 1HT6A 3IRSA 1NF0A 3CL6A 2GYIA 1D9EA 1ZJBA 3LHZA 1ZGDA 3CUFA 1OEPA 3H6OA 1T8XA 1JF6A 4MWAE 4Q8VA 3P67A 3PUGA 4NF7A 3OG3A 2G3FA 3FHAA 5D05A 4HSHA 3WH7A 3AXHA 4W8AA 2ZA3A 3AHTA 3V18A 1XS2A 1R2RA 1BWKA 3CL8A 4HHPA 4D6GA 1AZ1A 2PBGA 4DWSA 5AHIA 4AIOA 2Z1XA 3BGGA 3VNZA 3LI0A 1PHWA 3B8SA 2WZEA 1M04A 3HO8A 5MKGB 2ALRA 1I4NA 3WO8A 3DAQA 3WX7A 3GQYA 5DLCA 1A5BA 5I77A 3SIMA 1O1ZA 2PWGA 3UA3A 4GIRA 1QOXA 3W7PA 2QKFA 4QFUA 4LC6A 1GYLA 1KGWA 2D73A 3C4UA 5D38A 1FWCC 3G6MA 3TTQA 3I4KA 4W88A 1J5TA 2A3AA 2GWGA 3EDEA 2F9RA 3PPHA 4CEXC 4AZ6A 3SZ8A 4JQ4A 2WMIA 3U3HA 1ENUA 4B3LA 4J2MA 5K7JA 2W3ZA 1WBJA 5E6YA 2V68A 1Q45A 3MCNA 3W6LA 4NAEA 3S6OA 4BF5A 3NWRA 1JCMP 4NZ5A 3VPLA 4J3XA 4QG8A 1JG9A 1M01A 1UR3M 3PJUA 3RM8A 3L0NA 1X6LA 1XSJA 4WDXA 1VYSX 4L6DA 5E1QA 4D71A 5CPQA 2G3JA 4Q4QA 4IPIA 1SPQA 1BKSA 1M41A 1AMYA 2QT3A 1CXHA 1WV2A 1PVNA 1KM5A 4KKXA 1XYFA 4P8XA 2BP1A 4P7LA 4LY8A 3LSBA 3UG3A 3BZJA 3AIQA 2PGFA 3LLFA 3BDKA 1Q7ZA 3KRSA 3HMJG 3SUTA 1UHVA 4W8BA 3KL5A 1XFBA 3ARYA 3T55A 2VR4A 4GUFA 4FOJA 3MC5A 1J11A 5I3IA 3SSJA 1QNVA 5HWMA 3V0TA 2V5DA 5HNUA 2Z1VA 2PMQA 4E2VA 1BXCA 1ADOA 1Z8AA 1KQYA 3K1GA 4D1JA 5D8ZA 1BPLB 5KSWA 1RQBA 2VP8A <