3KVMA

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with amino-benzoic acid inhibitor 951 at 2.00a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
366
structure length
366
Chain Sequence
ATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase, mitochondrial
publication title Discovery of novel inhibitors for DHODH via virtual screening and X-ray crystallographic structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 138
structure length 366
sequence length 366
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kvmA00
1A5SA 5KZEA 1F05A 2DZTA 3OBKA 1ZAHA 1LBMA 1L9WA 3WJYA 1XI3A 2OT0A 1P1XA 3LHTA 1ZFJA 2EPHA 4I7WA 5F2MA 3TW6A 5HULA 5CZJA 1W5OA 4Z1CA 3PUDA 3TSBA 1TQJA 3TQVA 1VCGA 1Z48A 1WOAA 4LT9A 2JK2A 3C56A 4IPJA 3IIPA 4NZFA 3F4NA 3TX9A 1UUMA 1EWEA 3GNNA 3R13A 5KITA 2V5BA 4OE7A 1FXQA 3W75A 3NNTA 3PG8A 2E5BA 3UQNA 4Z0SA 1KFKA 4FNTA 5H2ZA 2B4GA 4XBKA 2Y7GA 3EX4A 1VJIA 1X6UA 1QR7A 3E0IA 4XTDA 4K7YA 3G1SA 4WY0A 3QF0A 4O28A 2H8ZA 3TCEA 4WD0A 5DCEA 2WNZA 4LV4A 4AXKA 4EWND 1MZHA 1AW1A 4UTTA 1IXNA 1BWLA 4LS1A 3EWBX 2JKAA 1GTEA 1OFRA 2VEKA 1GEQA 3PB2A 1ADOA 2X1RA 1LM1A 3NA8A 1G7VA 5D33A 2Y70A 3A9IA 3G1FA 4HHPA 3W88A 4JNMA 4MOZA 4JYEA 2NX3A 1LYXA 4NUWA 1KLZA 3A5VA 3RFAA 5AYYA 5AHLA 4Z1DA 3DGRA 3OG3A 4HIBA 1TPVA 3EX1A 3W84A 4CNNA 4LV9A 1WDWA 4PC8A 1B4EA 1QMLA 1P0KA 1OFBA 4XZ9A 5CKSA 2E6YA 4S2BA 5EMUA 2J24A 3O6CA 3SJ3A 4EIVA 1OYBA 1K7EA 5U7SA 4LNYA 1W5PA 5K4ZA 4PCFA 1O95A 3LCXA 4K37A 1W5NA 3NPXA 4GXMA 2GJNA 3BW3A 4DEFA 4FX7A 2ZTJA 1RZMA 2WNQA 3HPXA 1WXJA 3S1WA 4IX2A 2E6DA 1LOLA 4X9SA 2PRLA 2VEPA 4DPPA 1O5KA 4GNJA 3TUUA 2ZDRA 3K30A 1R46A 3B03A 1DBTA 3MI2A 2ZRUA 3P60A 3WJZA 1W0MA 3GKAA 3GXTA 1CI1A 1X1OA 3BV4A 4P2VA 5CSRA 2ISWA 2QR6A 3O6YX 4UFLA 1JCNA 1MEWA 2CZDA 4U4MA 4XWUA 4WQ6A 4RV8A 2WQPA 3MYPA 4LS2A 5TQLA 1O60A 2VEMA 1SZFA 1TTPA 4JD4A 4O4WA 3B0UX 1EB3A 3M0ZA 3I65A 3WK1A 1TPC1 1VYSX 4N9EA 4POCA 4GBUA 1S3HA 1YTKA 3W7DA 3RLVA 5AHEA 3C2OA 3PSVA 4NX5A 3VFLA 3TJLA 1GOXA 5DCDA 2P1FA 1XUZA 3CTLA 2V0TA 1JCYA 1FCUA 1M7PA 3MMTA 4A2RA 4UXDA 3MP5A 2Q3OA 3W1UA 4RZ4A 3G1HA 2BXVA 1H62A 1P5BA 3TAKA 2H8XA 2WKJA 4K7VA 1H7WA 2A1YA 3SI9A 1EUAA 1Y0EA 4GE8A 3VE9A 4YL2A 4ML9A 5D09A 3GXNA 3KVLA 1E51A 1QOQA 3TSMA 3TMLA 5D2VA 5D03A 3TJXA 2H3DA 1PV8A 5D05A 1FWNA 1TCDA 4IXXA 3GVGA 2PURA 3CWNA 5G4WA 2CWNA 3TE9A 1A50A 1KA9F 1X7FA 3PBUA 4FNSA 3LM7A 4ALDA 5DCBA 4WXYA 3L5MA 1JUKA 3S1VA 4MJZA 5AOUA 3VCRA 3NM1A 4JXCA 3EEGA 2W6RA 2NXGA 4ADSA 4ORIA 2BZNA 4MZ1A 2B0MA 1Z42A 2QCHA 1EP3A 4PTNA 2NXIA 2YGYA 2V82A 1CW2A 3DFSA 3DI1A 1MEHA 4K36A 4EOUA 4BWLC 3O16A 4UTTC 1LORA 1RD5A 1LZOA 3W73A 1QNVA 3HGSA 5AC8A 4WY0F 3TU9A 5CSSA 2VFEA 3C6CA 5K9CA 3LXBA 3MI3A 4EVZA 1ICSA 4GUIA 5FI8A 4IWWA 5FF7A 3PUOA 1OYCA 3TA6A 3L0GA 5AHNA 3W2NA 5LHEA 1YLVA 4GUJA 5AB3A 2QCCA 1R30A 1ZY9A 1SSDA 5KZDA 1J2WA 2A7NA 3NM3A 3PC0A 5HWNA 3CB8A 3QM3A 2QUVA 1AG1O 1T0OA 3HJZA 3F4WA 4GRSA 3W7HA 4IJBA 3CT7A 1PHQA 3WJSA 4JEQA 3LOTA 3MHFA 3KVMA 3PWAA 1AW5A 5BNKA 4O54A 4MZ8A 5F1VA 2R14A 2XN0A 2GQ9A 4KWWA 3CPRA 1JR1A 1VH7A 1ZAIA 1M7OA 3DKJA 3CHVA 3B4UA 1FDJA 1ICQA 2NV1A 4LVGA 1GVQA 1XBXA 4I9AA 4WUIA 3PF3A 1EUNA 2KZHA 3QMTA 3VI2A 3U8GA 4GFSA 1K3UA 2QCNA 3W83A 4JX4A 4ZZ9A 4ZQOA 2P10A 4MVAA 1RQBA 4AWUA 4ZQCA 1K7XA 1B9BA 4QSHA 4ZL1A 1NF0A 2Q8LA 4AEOA 3C2EA 4YMZA 5F2LA 2FFCA 1TV7A 5EL1A 3Q94A 1UJPA 2RHGA 1PL9A 4O1CA 1NF7A 4O19A 4QITA 5HWJA 4XKYA 1L6YA 3SIZA 2QCGA 3W7CA 3NQ8A 5KZMA 3ZWSA 3BLEA 1CX9A 2J88A 1XDLA 1H1YA 1KV8A 2DJLA 3HGRA 4UNLA 1XBYA 3QMRA 2WSQA 2DU2A 4MY8A 5DBTA 1Q6QA 3W85A 2ZZ5A 1PVNA 3N2MA 8TIMA 5AC6A 2GVLA 3M7WA 2ZRZA 2CLOA 1RQEA 3NGJA 3CQ0A 3HO8A 1UUOA 4JX6A 1D3GA 1G69A 3G8EA 1VCVA 1H7RA 1BWKA 4QNEA 4FO4A 4AH7A 1FX6A 2H90A 1T8XA 3NOEA 4WOQA 4NX0A 3N19B 3O63A 1RQHA 2VFIA 1WBJA 2EHHA 1TB3A 4QISA 3L5LA 3NR0A 2ZRWA 4CCCA 3RK8A 5K3VA 4AVFA 3STFA 1ZENA 1H7NA 2ZA2A 3CU2A 1R2RA 2G5WA 4Q33A 4O1AA 1XFBA 2DZSA 3BLIA 1FDYA 3DFPA 4Z1AA 5C55A 5D04C 2B7QA 1JCXA 3O6DA 3LHUA 3W7LA 4JTTA 3OEXA 5A5WA 5HMSA 5F1UA 3KHJA 2QUUA 3IV3A 1IF2A 3DAQA 3LHZA 2HTMA 4H6KA 1OX6A 3BG9A 2EF9A 4FX8A 1KW1A 1NVMA 3ZWTA 4AHOA 3NQCA 4JGDA 5D2TA 4B5NA 3NL5A 1TRDA 1WAUA 3G1VA 1XKYA 1W1ZA 5FF3A 3NEVA 3ZFHA 1TYGA 3RNDA 4RJEA 1YPFA 1N55A 2NX1A 3EWXA 3V75A 1B3OA 4UC5A 3BPWA 3C2FA 3QPYA 4O13A 3HB9A 2CZFA 3PBWA 5LGZA 3W22A 3GDMA 1I2NA 3TDFA 2CLLA 1G4PA 4LUIA 3W2UA 2B7PA 3MHUA 3DXIA 3NZRA 4ORMA 4Z08A 4ZVJA 3PB0A 4O15A 3USBA 2QAPA 4PL1A 4AB4A 3OVPA 3PG9A 4O8RA 4XQ6A 4MYAA 2VEIA 4CNOA 3MBFA 2FPTA 3TQKA 4JTJA 1I2PA 4LVDA 5CPMA 2X30A 1D9EA 1OX4B 3E49A 3MO7A 4RLIA 3MP4A 4DQWA 2JBMA 4RXFA 1KM6A 5HJLA 4Y8FA 3KX6A 5LHFA 1JCMP 2R94A 4NJHA 3TROA 4LW7A 3UWQA 3HPZA 3HF3A 4AMAA 4ZQPA 2PC4A 3O07A 1DL3A 5K9XA 4U28A 1T99A 2X1TA 5F4WA 3R5EA 5KINA 4H3DA 4O4VA 1I45A 2WSYA 3RU6A 3QPZA 4QAIA 1EPXA 2TPSA 4N4QA 1GVSA 3W2JA 3AO0A 1I2RA 1TPDA 4OV9A 1YPIA 1MO0A 3PSWA 4GJ1A 2A4AA 1K7FA 2C19A 2Z2UA 3M5YA 4DPQA 1KFCA 5DY3A 1VHNA 1UBSA 4JTLA 3T40A 1YXYA 3W86A 1IXPA 3LV6A 1ZJIA 3ANYA 3MP3A 4CQAA 5EKYA 4BK9A 5L6UA 4I7VA 1KBIA 1SO5A 3B04A 3W1QA 2JGYA 2CLHA 5T26A 2BX7A 2QUTA 3W1AA 5LKYA 3LHVA 4R7JA 1XDMA 3V1PA 4HT3A 4BI5A 1GYLA 1DQXA 4RR4A 2FIQA 4IX0A 2YYTA 4KWVA 3BW2A 4AF0A 1EP1A 2DZPA 5ABTA 2YZRA 3S1UA 4UCGA 2V8ZA 4M7SA 5BOOA 3ABSA 3M16A 1L6SA 4OBTA 1LDCA 1F2JA 1QPNA 5I3HA 4E0CA 2ZTKA 2PE4A 3W9ZA 2VELA 4K6AA 4JX5A 5G2IA 1A53A 2BWGA 3H54A 3M5ZA 4MLRA 3PY2A 3PAJA 4RKAA 1I2OA 1FWRA 3M9YA 3FIGA 1EX5A 1PCWA 1DKWA 3FJLA 4BWLA 2E5CA 2W0UA 1AL8A 2CLEA 3G3DA 4A22A 1FWWA 2WNNA 4MY1A 1BKSA 4I7UA 2NWRA 3M5XA 3DKLA 3MI6A 2ZA1A 2BTMA 2ISVA 3BARA 1AL7A 4UTKA 1IXQA 5CZ0A 6ALDA 1W3TA 4N9CA 1YDNA 2Y7EA 2Q8ZA 1N8FA 1R47A 3WK3A 4JN6A 2GUUA 7TIMA 4Z0JA 1NSJA 4M6PA 3ZS4A 4X2RA 3EXRA 4XUGA 4UFJA 3TFCA 1QWGA 1P4CA 5FF4A 4ZMGA 4IGHA 3W1NA 3L67A 1VZWA 3GZ3A 3BLFA 3NL6A 5LNUA 4K8EA 3CC1A 1OFQA 2Y85A 1JQVA 1S5TA 2AGKA 3R89A 1ML1A 1PHWA 3UY7A 5HQEA 3VKJA 5EBUA 2QJGA 4UTHA 1Q6RA 4HPXA 2I14A 4G1KA 3FFSA 3UWZA 1OX5A 1FCQA 3LV5A 5I3JA 1K8YA 1LRQA 1H7XA 1FCBA 3GDLA 3S8HA 4JR5A 1XM3A 4E2BA 2ALDA 5K2ZA 3BG5A 3SFKA 3SR7A 4A3UA 1W37A 3FS2A 4DBEA 5CPNA 2C16A 3DHDA 3IIZA 4UMBA 1LBFA 2H6RA 5LNSA 1GVOA 5EY5A 4NU7A 3BO9A 3W7GA 1DOSA 2Y7DA 4DF1A 4BFAA 5D32A 4A29A 1WA3A 2YFNA 1QFEA 3VE7A 3UXAA 3W2MA 5FEPA 3IIVA 4JY9A 3FOKA 3W7MA 1LRTA 4UTMA 3O15A 4AF0B 4OU1A 1TPWA 1W56A 3LB0A 3NQEA 1TTQA 3MWAA 3N9RA 4TIMA 5K9DA 2OZ0A 2R91A 3PBVA 2V2CA 3G1YA 3DFNA 1XCFA 4WX2A 1VYRA 5BMXA 3N14A 4FX6M 3O1NA 1TMHA 1TPH1 2C6QA 1UB3A 4MJMA 1IIHA 1ZAJA 1DORA 2OCZA 4M6VA 1WYIA 2C1HA 3P62A 3SGUA 3KFTA 3BGJA 5G5IA 3G0UA 4LVBA 1BEUA 1K02A 1B57A 2C3ZA 5H91A 1VQTA 1ME8A 2HMCA 5J5DA 4UTJA 1XBVA 1OFOA 4LVAA 4UTWC 5CPLA 1QPQA 3TR2A 2ZRYA 5BW6A 4WZHA 3TNOA 4JTUA 2TSYA 2ZRVA 3QW3A 1LRNA 5D30A 1DVJA 1ALDA 2VENA 5AC7A 1YYAA 3E9AA 5DXXA 1O5XA 3RMJA 1HO4A 3W7NA 1ZALA 1HG3A 2WPBA 4MIMA 4LC8A 5G2WA 3F03K 4O16A 3NPVA 5GVJA 2Y89A 3I7SA 1DV7A 2F84A 3JR2A 2Z6JA 1XUUA 4IOTA 4UFMA 2DORA 1U5JA 2NUWA 1DHPA 2H3BA 2G96A 1SW3A 3LDVA 2ZQ0A 3B0PA 1JUEA 1OHLA 4LS0A 2VFDA 5HNRA 3IIOA 3EKZA 3I6RA 5D2XA 3DU0A 1OK4A 1OG0A 4WJEA 1J5TA 1H7OA 1H60A 3O8AA 3LCIA 4JTIA 4DO6A 1VRDA 3T4CA 4BI7A 3WK2A 5K4XA 3M6YA 2RDUA 5K7JA 3DHFA 5HUOA 1OFPA 3H55A 2FTPA 1XL9A 4YWIA 4O1DA 3W1LA 2I9EA 4X22A 3QQ0A 1QDSA 3TFXA 2QEZA 5G4EA 3R2GA 4FHAA 3E12A 4FB7A 4MLJA 3DZ1A 1G4TA 4M19A 2ZZ4A 4FXSA 2QDGA 5DLCA 3S42A 5HWMA 5BMWA 3P84A 1EP2A 2J9YA 2RH9A 4UFHA 1W54A 1SO3A 1H1ZA 4JTGA 1YXDA 1V5XA 5CPOA 5AHMA 2Y61A 3I68A 4O11A 3GDTA 4CLMA 3QSTA 3TAOA 1ME9A 2ZZ6A 3OVRA 5I3KA 3QZEA 1SFJA 5KSWA 3HG5A 3IGUA 1QAPA 3TC6A 1ME7A 4NJKA 4JICA 3EX6A 4JDYA 4IUOA 3TKFA 2FPYA 2CLFA 3P7YA 5C54A 5C5YA 2VOMA 4JTSA 3LCHA 1P0NA 5C2XA 3CEUA 2A7RA 2NUXA 3HBLA 2E09A 2AAMA 1DQWA 3QQ1A 3NQDA 2QCEA 3FJ6A 4AHQA 2ZBTA 3LRKA 2X1UA 5HUPA 2C18A 2ZZ2A 1KV5A 3NAVA 3W7IA 2ZYFA 1OF6A 4YCOA 2NLIA 3C2VA 4N6FA 3CIWA 1LP6A 2Z0IA 4GUGA 3W7JA 3SECA 1OX4A 1TSIA 3M44A 2ZA3A 1N7KA 2V30A 3LCFA 3A23A 4R34A 3HG3A 1GZGA 4NXKA 3W74A 4O10A 4HNTA 5E1QA 5CZSA 4EF8A 1VLIA 3BG3A 1OK6A 4PA8A 3UZJA 1KFEA 2ZZ3A 1YADA 2V81A 3G18A 3HOJA 1IXOA 4OQVA 2PRMA 4N4PA 1QPOA 4L4MA 1Q6LA 1OFEA 4RZ6A 4A21A 1VGAA 4GWEA 4NQ1A 2A7PA 1HO1A 4NT0A 4LC6A 4C1LA 3LLDA 3UXDA 1AK5A 4QM1A 2FLIA 4UR8A 2A0NA 1PCKA 3OIXA 3HGOA 3LERA 2OX1A 5DN1A 1JVNA 1I8JA 2YCEA 3C61A 1SR9A 3O05A 1VS1A 3MHGA 3NPUA 3NQ2A 3PM6A 1IGSA 1F73A 3KXQA 4MYXA 3UNDA 2A21A 3TW7A 3IRDA 2A6LA 1FCVA 4MFEA 3B0VC 4N2YA 1SZEA 3B06A 4ZQMA 1SSGA 4TO8A 4O52A 3PR2A 1UCWA 3WJWA 1G6CA 1OYAA 4NZJA 4NJGA 3NPWA 1TRIA 3B05A 3HG4A 3ELFA 4FNQA 3PUEA 3N3MA 2VKZG 3STEA 1RV8A 1QOPA 3MUXA 4O0ZA 3A24A 3EX2A 3KAOA 5G2HA 4AHPA 4MUZA 3FA5A 1SQ7A 3NQFA 3G1AA 3TIMA 3UY8A 4K8HA 1H7PA 5U4NA 3STCA 3UYCA 3DENA 4YLWA 3ATZA 4GUHA 4DO4A 3L66A 4WXZA 2GQAA 1L6WA 5FESA 3G3MA 1W3NA 1TJRA 2Z1BA 4O17A 4UR7A 2FDSA 3TH6A 4D2JA 3IGSA 1J4EA 3W87A 1H63A 3G22A 5DBUA 3T44A 3EXTA 3IVSA 3CWOX 5AN7A 3TSDA 4AAJA 2TYSA 1G67A 2OMAA 3ATYA 3P8JA 4RK8A 3P5ZA 4RCXA 4HSOA 1TPEA 5F2IA 4IXHA 5DELA 4O12A 5D02A 3QMSA 3DBPA 1NFBA 3SY5A 5AFDA 2V2HA 4UTUA 2FQIA 4N6EA 3LBCA 3LHYA 4K39A 2Y88A 1M6JA 2FB2A 3W1TA 1TV5A 3I7QA 3P5YA 3D0CA 1KFLA 1B4KA 1OF8A 2GOUA 2E68A 1TJPA 3S6DA 1SZNA 4KFOA 3W6YA 2B7NA 1YTDA 1TPFA 1GVRA 4Q32A 4PODA 3B8DA 3NDOA 4TR9A 4LRSA 3W7QA 2F7FA 1OFDA 4OV4A 2TRSA 3FKRA 3W1PA 1Q45A 1DJQA 3P61A 4N02A 1A5BA 1W31A 3F1QA 2DZXA 2QCLA 4Y96A 3A5FA 4BF9A 1ONRA 1GG0A 1PIIA 3FYPA 1ZCOA 3LTYA 3OA3A 1XXXA 4TMBA 1FUYA 3IVUA 3T7VA 3L0NA 3OVQA 2ATMA 3L2IA 4O57A 1GT8A 4PFMA 3NQ6A 3P74A 3L0KA 4UTWA 1H50A 4QJ1A 4HN4A 2C14A 2Y63A 3G1DA 1KLYA 1F5ZA 3MW7A 1VR6A 2C0AA 1YDVA 4O14A 4PH6A 4JTHA 3GX9A 1Q3NA 3Q37A 2RKXA 2NV2A 3R8RA 3UPBA 1JRBA 3L68A 3DH7A 3RF9A 2YPIA 4O18A 4Y90A 1L2UA 1K8ZA 3GAKA 3LLFA 2I1OA 2RFGA 4NJJA 4E2DA 1HFBA 2YX0A 1LOSA 4CCDA 1DJNA 3GK0A 1SW0A 4HNUA 1JQXA 4DF0A 1LOQA 2VXNA 1GPWA 1KM2A 1FQ0A 2QCDA 4UMAA 5TBOA 1NEYA 3KRSA 4HKPA 4QQ3A 3TK7A 3W7KA 1F6KA 3O06A 3HGJA 5KMYA 1FWSA 3UWYA 5FF0A 3FLUA 4JS3A 2O7QA 5A8GA 3HG2A 3NVTA 2YFOA 4C1KA 3QH2A 3GDKA 5LNWA 1XBZA 2EAWA 1T96A 3L65A 1U83A 4LOCA 4FNPA 5I3GA 3W07A 1GJPA 1VPXA 4GUFA 3P8IA 1RR2A 1X1ZA 5IM51 3IVTA 4OHQA 4IMDA 2ZCGA 3KVKA 1JUBA 1VCFA 3LCLA 1WV2A 4CCEA 1G7UA 1WOBA 3LBMA 4O53A 5AHIA 2DZUA 1GYNA 5KTLA 4FIRA 3A21A 3W71A 1RVGA 2VFHA 2IQTA 2Q3RA 3LI1A 3MJYA 3QYQA 1YTEA 4QNWA 3NQGA 3W72A 3BK0A 4RZ5A 4ONVA 4AWTA 3W2KA 3C3NA 5G1TA 4IMEA 3S5NA 4K38A 3W7OA 4YXGA 3GYEA 4JY8A 2O7SA 2J27A 3A22A 4EF9A 3TV8A 1I2QA 4FNUA 5LSMA 4Z1BA 1KM3A 4FEZA 2BSLA 3HPSA 3OHIA 4MPQA 3NZ1A 2TMDA 1ZNNA 1GVFA 5CZTA 1TTJA 3GNDA 4UTLA 3JS3A 2ZZ1A 3LCWA 3LHWA 5CG7A 3LTSA 2WOQA 1OVDA 3ZR4A 4S1FA 3C2RA 3W3OA 1GWJA 1NAL1 3THAA 2ISSA 4ADUA 2XN1A 3UWUA 5HR7A 5IBXC 3GKFA 3YPIA 1QCWA 3U2OA 3N2XA 4J9JA 4UMCA 1H51A 1SO4A 5CGQA 3S9YA 4Y6GA 2E6AA 2CU0A 3G0SA 3W7PA 3NXFA 2PRHA 5J5RA 4NNCA 2QCDB 5LNVA 3L21A 1VHCA 2C15A 4R33A 3NG3A 5E0KA 3SZ8A 2R8WA 5D37A 1KM4A 4JIPA 1MXSA 2JGQA 5AHFA 4NVTA 5F4XA 2NX9A 3EKLA 5FEZA 1WQ5A 4OGZA 4ADTA 1F74A 3DI0A 5FF2A 3HMJG 2X16A 3INPA 4XTIA 2J9ZA 4WY0B 5L9FA 5AYZA 1C29A 1QPRA 1PE1A 3GR8A 4IQLA 3Q58A 4PEKA 2YYUA 2HSAA 5D38A 4S2CA 4A2SA 4X3ZA 3M43A 1LLZA 5D2WA 4M5PA 2VFFA 3M41A 1SU5A 1X8FA 3W1RA 4DBDA 1WBHA 5AYXA 3NQAA 2QDHA 3NYZA 1SFLA 2GPTA 4NNAA 1SPQA 1FXPA 5E93A 4RX0A 2FPVA 1ZHAA 2NXHA 3KOFA 4TU1A 4NJIA 5MHBA 3L5AA 1R2SA 2CZEA 2EGZA 1F6PA 5DY2A 4W9TA 3WJXA 4MY9A 1JCLA 1LLWA 3BGGA 4DF2A 2X1SA 2WJZA 3Q2DA 3N9SA 4P61A 2XFWA 3LGEA 1M5WA 4JDBA 3GB6A 2YW3A 3U6WA 2P0OA 1OABA 2GJLA 1TQXA 3PVFA 4FNRA 2CW6A 1QO2A 3M47A 3C0JA 5HR6A 2FJKA 5SWUA 1JULA 1JCJA 4HPJA 1YDOA 1TPB1 3UD6A 1V7YA 2DZWA 3LXCA 3G1XA 4H4IA 4PL2A 2G97A 4HNNA 1SO6A 4LVFA 5C6MA 3S1XA 2V9DA 3W23A 3I7RA 4JYDA 1SZGA 1XC4A 4OT7A 4FF7A 2Y7FA 3C8FA 4TMCA 4Y9AA 2CLMA 3G24A 4Q4KA 5F4SA 2ATSA 4NNBA 3BVJA 3HIJA 3IEBA 1YXCA 1GTHA 2BLEA 4JTKA 4LY8A 5FEXA 2YR1A 3RLUA 2ZZ7A 2WO5A 2FB3A 2JKEA 5EPDA 3SGZA 5FEWA 1KM1A 3P81A 5I3IA 2RDTA 1SW7A 1LTDA 1EA0A 4O50A 2Y6ZA 3GLCA 3EWUA 3WK0A 2E6FA 3W2LA 1THFD 1H5YA 3KRZA 1JRCA 3DFTA 4CQ9A 2A2IA 1KFBA 2J6XA 1SUXA 4ZQNA 1H61A 3QFEA 1F7BA 4MFDA 1QO5A 2DJXA 3STGA 2QJHA 4DO5A 1TIMA 3EB2A 1KM5A 1WX0A 3QRHA 3THQA 3DFQA 5EA9A 1GG1A 2VFGA 1K03A 3GR7A 1HUVA 2HS6A 5F2GA 5D2YA 1W5QA 2D73A 2ZFAA 1IIGA 1TREA 3TQ0A 3PS7A 3CLMA 2J9XA 2YSWA 3P67A 2C13A 2WSRA 2ABAA 3KRUA 2GVGA 1KFJA 1O94A 1HL2A 1LCOA 3MBDA 2DP3A 3W76A 1S5VA 2ABBA 3SW6A 4JYFA 3QSRA 1EIXA 2GQ8A 1TO3A 1RPXA 4UTIA 1LBLA 2DZVA 3ABRA 3AJXA 5G1YA 4M7TA 2CLIA 1KTNA 3MYOA 2OJPA 1TTIA 3TC7A 1G4EA 5EYWA 3GIYA 3BW4A 4IMCA 3QEZA 4M6QA 2CZ5A 3E96A 1D3HA 3KVJA 1GQNA 3T55A 3TXZA 3LRLA 3PBYA 4OWGA 4IMFA 1R2TA 1KTBA 4L4LA 4MKNA 3NL2A 3G8RA 4JTEA 3QC3A 4LRTA 1VC4A 2LLEA 5DXYA 1Z44A 5TIMA 4WOZA 1EEPA 4LU0A 2E5DA 2QCFA 3LI0A 2YDAA 3GXPA 3EX3A 3WFAA 2RDWA 3NQVA 3EXSA 1PS9A 4LWWA 5I3FA 4N9DA 4JTFA 3UWWA 3DFOA 4BI6A 4NXSA 2UV8G 3QJAA 3M5VA 3LCGA 1Q6OA 3N73A 2NZLA 4LUJA 4YCPA 3GDRA 3N34A 1I4NA 4LTSA 3R12A 1VLWA 4ICNA 3NQ7A 3W1MA 5BRBA 3LTPA 1FBAA 3W7EA 5LZLA 2E77A 5HINA 4CNPA 4MZYA 3S0CA 1KM0A 3LRMA 1ICPA 1VYPX 1AMKA 4O1BA 2W79A 3FYOA 1G4SA 4UUIA 3W70A 3UWVA 3LX9A 3M1ZA 1C8VA 1FY6A 2EKCA 3PULA 4KKXA 4AWSA 3H53A 1MEIA 3GAYA 5LGXA 4KFNA 3JRKA 3NL3A 4JIQA 2GVJA 2CLKA 4GC4A 3CEPA 1AW2A 1F76A 2A5HA 2V5LA 3EWYA 2ZRXA 2QAFA 3CM4A 3P82A 4UNKA 3HQ1A 3C4UA 4TX9A 3FEMA 1FDZA 3UPWA 2G95A 3S5OA 5IBXA 2OT1A 3QW4B 1S5WA 2CFFA 4CQ8A 2Y62A 4BR1A 2QJIA 4HSNA 2JKPA 4FXRA 2QF7A 4XKYB 1O4UA 6TIMA 2A85A 3C52A 3P80A 1W5MA 2E1DA 3L9CA 1HTIA 1TV8A 4N9BA 3CIXA 2HS8A 1BTMA 4E38A 2AQWA 3T78A 2QCMA 1A5AA 3NO5A 4ZQRA 1W8SA 3NQMA 2YXGA 2Z6IA 4UFIA 1JJKA 4O0KA 3VNDA 2WV8A 1OJXA 2NWSA 1KBJA 2XN2A 1W3IA 2VC6A 3W1XA 4QIUA 3SSJA 1FWTA 3IIXA 1Z41A 3IGXA 3ABOA 4KFPA 3EWZA 3W7RA 4XBSA 1C9DA 3S5ZA 1LROA 1UASA 4IMGA 4DXVA 4UFKA 2QKFA 3E02A 1OFAA 3TXVA 2PCQA 2X2GA 3UZ5A 4RXGA 3EWWA 1TPUA 1MSSA 4R53A 3TMQA 3G0XA 4FIQA 3LXAA 4UIOA 3S5YA 3FKKA 3ABQA 4HNVA 4DELA 4IPIA 1KTCA 1EWDA 2B7OA 2YW4A 2NUYA 5LNRA 1K8XA 1A5CA 2V2DA 2A6NA
chains in the Genus database with same CATH superfamily
4MB5A 1ZAHA 1XPGA 3L12A 1XI3A 3F4VA 2OT0A 4L65A 4PR4A 3RCYA 1ZFJA 4I7WA 1RJQA 5F2MA 4ZSUA 4QS6A 3LBOA 2FHCA 5FJUA 3FGCA 1UH2A 1JNDA 3GNNA 1YBQA 2YDRA 1JPDX 3AHXA 3URQA 3W75A 3UQNA 3ZJ7A 4HMNA 3LS9A 3CL7A 1F6YA 3AYRA 2B4GA 3EX4A 1QR7A 1VP5A 4RDYA 3AC0A 2VOTA 2WBKA 4O28A 2H8ZA 3AYSA 1Y65A 4WD0A 3TCEA 1UR8A 5ABEA 1MZHA 1CXLA 1AW1A 1BWLA 4I90A 4B5VA 4GK8A 4YVXA 3TN3A 2SFPA 2XWEA 1NP0A 2EPNA 4XZBA 1WKYA 4AD5A 3QPEA 3W88A 4H6QA 4NUWA 3GUWA 4Z1DA 4W87A 1S38A 4LSBA 3DGRA 4DWDA 1BTCA 2OU4A 3RRXA 3ANVA 3EX1A 1CECA 4LV9A 4PC8A 3S2CA 1B4EA 1DQUA 5FJIA 3WF1A 1EF2A 3H7VA 2DVTA 2Y5EA 1GKPA 5EMUA 2J24A 4EIVA 1CEOA 4XG1A 4H7CA 3LCXA 3T8LA 3B9EA 1X39A 4GXMA 2DT1A 3BW3A 1F61A 2PDYA 2UBPC 2WVUA 3TLQA 3EOLA 2PTXA 3HPXA 4L64A 1KD0A 2QPSA 3SIMA 5MKGA 3L2LA 2VEPA 3HZ3A 1O5KA 4GNJA 2GWNA 3UA3A 4ZB0A 2A3EA 3B0XA 3GKAA 3GXTA 3ITCA 5T91A 1CI1A 2UWFA 3IAQA 2HZGA 3BV4A 4P2VA 2ISWA 2E28A 4UFLA 5C2GA 1JCNA 1MEWA 3GDBA 1A4MA 2WQPA 1D8CA 2YKKA 3WIJA 2GSHA 1E6XM 4B3ZA 3I65A 3WK1A 2I17A 1TPC1 4AD0A 4GBUA 1AH4A 4REQB 1YTKA 3RLVA 4DJDA 1UA7A 2D3LA 3C2OA 4NX5A 4KT2A 1J0ZA 1EJWC 4Q4SA 2P1FA 5AY7A 1FCUA 3QTGA 4XSLA 4CN4A 1XLHA 3T2OA 2BBFA 4XZMX 5HAOA 1EUAA 3ITVA 2C79A 3KL0A 2PU0A 2GGGA 3GXNA 3IUIA 5C70A 3Q67A 2J78A 4YWSA 5D03A 2O9PA 1PV8A 3TWAA 3MCNA 4K3ZA 5M2FX 2PURA 1RJPA 3GXFA 3PBUA 4FNSA 4ALDA 2VZSA 4W86A 3GQYA 3SURA 1NWRA 3L5MA 4WGXA 4KETA 2QGYA 3S1VA 1QW8A 4H01A 3VCRA 4W5UA 2OEMA 4H9ZA 2VDIA 2W6RA 5DANA 4B2DA 2BZNA 3ICJA 3RX2A 1EP3A 2YGYA 5E09A 2PS2A 1EBHA 3DFSA 2DVUA 3DI1A 4DNHA 4UQAA 1LORA 3AMGA 1LZOA 1DJWA 3GTXA 3HGSA 1H11A 3E2SA 4GBDA 4H9VA 3FHAA 1LWIA 2X09A 3NSXA 4ZBCA 4EVZA 1FWBC 2P5NA 1MMFA 3CUHA 1ICSA 1WDSA 2OPJA 3ALFA 3DCPA 3Q65A 3GH7A 1OYCA 3W2NA 4ICMA 5AB3A 3GVQA 1V8EA 1XLKA 1SSDA 1J2WA 2V67A 3OLIA 5HWNA 2PWVA 3RCMA 1PZ3A 3N2BA 4EPDC 2QUVA 3W7HA 3R10A 4IJBA 5I77A 1PHQA 4JIEA 2PD9A 1F4HA 3MHFA 3KVMA 4DM1A 2ACQA 4KWWA 3CPRA 2POTA 4GABA 1GK8A 3DECA 2J4GA 1J8VA 1M7OA 3CHVA 2VMFA 4GCXA 4LVGA 3ZVHB 1REQA 1UQZA 2KZHA 3QMTA 3U8GA 3GO2A 3W83A 4KWOA 2Z2AA 5JVLA 4P7NA 4UOZA 4KERA 4ZQCA 1B9BA 4D71A 1RA0A 3QV7A 1TV3A 5EL1A 1UJPA 4AXNA 2WBGA 1PL9A 1BQGA 1KFWA 2WVVB 3AOFA 2Z29A 1L6YA 3VO0A 3LPPA 2BVTA 4IIBA 1CX9A 1E5NA 1XDLA 4UNLA 2G8ZA 2DU2A 2DVXA 4Q22A 5EU9A 2YBVA 1E4IA 5CC7A 3B9NA 3N2MA 1MRAA 8TIMA 4LUTA 2GVLA 7ODCA 3NGJA 3CQ0A 3HO8A 1UUOA 1M53A 4JX6A 2Z25A 3WDJA 4WDWA 4B2DD 2VRKA 4QJ4B 5I06A 4FO4A 4AH7A 1FX6A 3V18A 3DG6A 3GH4A 1P6BA 1E6RA 4WOQA 4NX0A 1M41A 1V3IA 3DC0A 2VFIA 3F2BA 4FOKA 4CCCA 5K3VA 1E6PA 1A5LC 2VZUA 1EJ7L 4WCJA 1KC7A 3GTNA 4IP4A 4C7GA 4O1AA 1XFBA 1A47A 1FDYA 1YQ2A 3MT1A 1JCXA 2AL1A 3O6DA 3B8SA 4JTTA 2JFEX 3ITGA 3WENA 5A5WA 3RX4A 3KHJA 4MB4A 3H24A 4AD3A 2HTMA 1AJZA 1CLKA 5CSUA 1V0KA 3VKAA 3L4VA 2HNHA 5D2TA 4JGDA 1WAUA 3WMCA 2V3GA 1TYGA 4XD4A 2OLHA 3RNDA 2W66A 2X7VA 3EWXA 3ANUA 3D46A 1B3OA 1LG1A 4O13A 2JQXA 4OKDA 1PIFA 3RGTA 1ZPTA 1I2NA 3TDFA 4NRSA 3QY8A 3EPMA 1J0HA 2QULA 4D6EA 1MYRA 3B8IA 4O15A 4XQ6A 3U2EA 4KRTA 3NO3A 2VC5A 2YZ5A 1UR2A 1XYFA 2FPTA 4ZSTA 1IEIA 7ENLA 4LVDA 3MO7A 4RLIA 3EKGA 3KOYA 3ECQA 1R86A 4B4HA 5HJLA 2GGIA 4LBUA 2ACUA 3KX6A 4J5NA 2DT3A 3HF3A 4AMAA 2PC4A 4GCAA 3CQHA 4LCQA 4U28A 2X1TA 1T41A 5CPSA 5F4WA 3Q45A 3CIVA 1S5MA 5HPCA 3O0KA 2WZIA 1I45A 2V5DA 4GX8A 2GSEA 4N4QA 3OG2A 4OV9A 1MO0A 4P8XA 1E1FA 3VNIA 1PXGA 3WD1A 2G41A 2C19A 2PGWA 5C9UA 3PZUA 1J12A 1W17A 3FDGA 4JTLA 4PZVA 1A80A 3ALGA 3LV6A 3ANYA 2XZ9A 2NSXA 4BK9A 1KBIA 2PB1A 3W1QA 2BX7A 1XIFA 2BV9A 2BFGA 3FK4A 3W1AA 1K9DA 3VGBA 1DQXA 2V3EA 4ZB5A 3IPWA 2FIQA 4C6DA 2YYTA 3BW2A 4PMZA 1QWKA 5EMJA 2YZRA 5BOOA 4OBTA 1LDCA 4JPGA 4REQA 2ZTKA 4HMEA 3NEHA 1XIDA 1XLGA 1ESWA 1I2OA 2BOFX 3M9YA 3ABXA 3FJLA 1TELA 4BWLA 3CHEA 2W0UA 1V02E 3G3DA 1K77A 2WNNA 2QJJA 4MY1A 1BAGA 1WZKA 1ITCA 3DKLA 2BTMA 3U57A 4A8NA 1TJ2A 1AL7A 6ALDA 4QDWA 1JIBA 4N9CA 1YDNA 2W4XA 3EB4A 5LXEA 1B1YA 1R47A 5JU6A 4Z42C 1CGTA 1NSJA 6PTDA 2PAJA 3IJ7A 2B31A 2BGNE 4UFJA 3TFCA 2HVOA 4IICA 2INZA 3I4EA 4E3TA 3L67A 2XVGA 2OZ3A 3BAJA 2QVNA 1XLCA 1DIDA 2VCCA 4K8EA 1CXHA 3AIVA 3R89A 3MY9A 3QTPA 4HPXA 4X60A 3FFSA 3LV5A 1FCQA 5D9NA 1Q63A 5DRCA 3S6OA 2BY2A 3PWGA 3K5XA 1IHIA 1XM3A 4E2BA 1MW0A 2ALDA 1EHNA 4V1XA 3NGFA 2NVDA 4XBJA 2OLSA 1LBFA 2H6RA 5LNSA 3PZTA 3B97A 4IGMA 1DOSA 2JEQA 1W9DM 2YCIX 5D32A 2RJGA 4A29A 3CNYA 2YFNA 3GG0A 4ATDA 3W2MA 1EC9A 5FEPA 2VWTA 3IIVA 4JY9A 2PBGA 1LRTA 2EO7A 5TNVA 1XIGA 1TPWA 1P0BA 1QT1A 2OGJA 3PBVA 1DWFM 4TUFA 3UEQA 4NZ4A 1XCFA 1JYNA 5BMXA 7XIMA 3N14A 3V0TA 3OGSA 2FH8A 5FJJA 2C6QA 3O0FA 3UJEA 1UB3A 5CBJA 3EPNA 4LH8A 2OCZA 2Z7GA 3RN6A 1WYIA 3P62A 3TA9A 2BASA 3VMNA 3SGUA 1PKNA 1BEUA 4C1NA 2C3ZA 3M0HA 3WDPP 2XG9A 1HKWA 3V5CA 1XBVA 2GOKA 2CBUA 5CPLA 3TR2A 5BW6A 1Q4WA 2CBIA 2V38A 4NY2A 2TSYA 1LRNA 3BQ6A 3F7JA 1FFRA 1XD0A 2Q8XA 1ALDA 2VENA 5KZ6A 2WJFA 4PE8A 1E1CA 3RMJA 2ZX5A 3W7NA 2J8TA 1G94A 1ZALA 4LYQA 1ZB5A 1H3GA 2DY3A 3NPVA 4PUEA 3BJFA 2Y89A 4IT1A 3I7SA 1DV7A 2Z6JA 2KAUC 3T0AA 2WVVA 5LIXX 1G9HA 2DORA 1Q6EA 4ATLA 4ACYA 3ZSSA 4LAKA 4PB4A 2ZQ0A 1HVQA 4JHMA 3B0PA 2EJAA 4HZ7A 4JNYA 2VFDA 3AMLA 2PBOA 4QG8A 1XW8A 1OG0A 4GZJA 1J5TA 5FSDC 1H7OA 3LQGA 5BRQA 4RW3A 1SYTA 5K4XA 3ARRA 1ZL1A 5HUOA 4FR6A 3LGGA 3C5QA 2DFAA 1XL9A 1ZP3A 3W1LA 2I57A 1PUDA 4YVPA 3QQ0A 1AQHA 1QDSA 5FOOA 2QEZA 4LPCA 1QASA 3N25A 3SCQA 4D6JA 3R0DA 4FXSA 4JTAA 1NARA 2QDGA 5DLCA 4A8RA 2ONEA 5HWMA 7A3HA 5BMWA 1W54A 4QLLA 3SRHA 4DX3A 1OY0A 2E0PA 4JQAA 1SO3A 1AH3A 5ENLA 4JNZA 2UY5A 1YXDA 3BAKA 3H4XA 2NQ9A 2GYIA 4AYGA 5CPOA 2Y61A 2E40A 2PF0A 3VUPA 1BYAA 4LALA 4NG3A 1SFJA 2D2OA 2R1PA 1QAPA 4PUUA 1ME7A 4NJKA 4JICA 4RPPA 4LBSA 4C6LA 5E5CA 3EX6A 4JDYA 4LF2A 2CLFA 2IPWA 2VOMA 3LCHA 1Q85A 1TJ1A 1Q65A 3HN3A 2G3JA 4DWSB 3POHA 4HCHA 1OC5A 4AHQA 2RGMA 2X1UA 3WMSA 1KV5A 4HYVA 4AZBA 1NWTA 1OF6A 4YCOA 2NLIA 3C2VA 3E2VA 2FVMA 7REQA 3SECA 1AZ2A 3NURA 2ZA3A 3LCFA 2BHUA 2V5KA 5HANA 1PTGA 1JZ8A 1GZGA 3W74A 3BSMA 4J4KA 2P3ZA 3BGAA 2HBVA 2ZX9A 3BG3A 1H41A 1KFEA 3ARQA 1FKWA 3G18A 2CWXA 1Q6FA 2F2HA 1OGSA 4CU8A 1Q6LA 3T2QA 2NT0A 1V0MA 2A7PA 1HO1A 1DIKA 4I9JA 4NT0A 1JZ5A 3S5SA 2FLIA 4AD2A 4UR8A 2C1GA 4W88A 1O12A 1EFZA 1JVNA 1DWIM 3TOYA 3NQ2A 1C90A 3SQMA 1BXBA 1F73A 1RP8A 3B0YA 4L9XA 2XVKA 4E8GA 1QK2A 4I6VA 4N2YA 3B0VC 1W1PA 1SSGA 1MFVA 4TO8A 4GJJA 1UCWA 3PTDA 3WJWA 1G6CA 4NZJA 8CGTA 1NDZA 3GVRA 1TRIA 2PDJA 3ELFA 2P0IA 3UJRA 2ZVIA 2PZNA 3A24A 3IK2A 3RCNA 5I7GA 3PZIA 5I09A 3KBWA 3MO4A 1TVPA 3STCA 3UYCA 2XH7A 3TTYA 1A5OC 4NZ5A 4B5TA 1VBRA 3V16A 3WMBA 1TJRA 2IPGA 1VFUA 1TX0A 1KRMA 2Z26A 4WR3A 3G22A 5FAGA 4D6HA 1NQ6A 2TYSA 2VDHA 3VK5A 3P8JA 1XGDA 1IEVA 3JVAA 1TPEA 2PTDA 4QEEA 1JD9A 2PFHA 3QMSA 1OT1A 4AIUA 3ZQ9A 2PMQA 1BYCA 4LYPA 2DZAA 3T0BA 4UTUA 1PZ2A 3LHYA 1UROA 2BDQA 3ZSTA 1MDLA 1WKDA 2AMGA 1M6JA 1DXFA 3K1DA 3R8GA 2GDUA 1TV5A 5D9MA 1KCLA 4JZ5A 1OF8A 4G56A 5C8BB 1DWAM 1TJPA 1Z32X 3W6YA 2B7NA 4J40A 4KQNA 3GC4A 1HJQA 3TYCA 4HHMA 4JTCA 3B8DA 1EOMA 4YTQA 3W7QA 4CD8A 3FKRA 2GJXB 3W1PA 3N6HA 3P61A 4Y96A 3A5FA 1ZGDA 1PIIA 4C6MA 3LTYA 2G3NA 1XXXA 4TMBA 5LIYX 1IYXA 1QATA 1EJVC 2ATMA 1GKQA 4Q8TA 2C8NA 4WVXA 3KCLA 2DIKA 1UOZA 2ZXDA 1ITUA 1R87A 5J8LA 1I60A 5M1TA 3L0KA 4UTWA 3KBMA 1VFHA 1MXDA 4PB5A 4HA3A 4GA8A 1E9ZB 3I6TA 5I6SA 4LYKA 4L6OA 1YDVA 4GYPA 3WNPA 1PO9A 3GX9A 2E8YA 3Q37A 4LGXA 2WNWA 1W32A 1S2WA 4GACA 4HHHA 4IGNA 3E0WA 1JRBA 3UPBA 1ZSXA 1E56A 3RF9A 2FGBA 2Z1VA 1XJBA 2X0YA 2I1OA 3GAKA 3ITLA 2RFGA 2YX0A 4DBSA 1ADDA 4HNUA 3RPMA 1LOQA 1K4HA 3T0TA 1B5TA 2VXNA 1KM2A 1XINA 2QCDA 4UMAA 1QI2A 1OSEA 4HA0A 3GG1A 3B8TA 1F6KA 5GNZA 5AC4A 2O7QA 2J66A 2XVPA 3LM3A 3NZQA 2VR4A 4PRWA 3MKCA 4PMRA 2D2GA 1FWCC 1U83A 1V3KA 4MSSA 5I3GA 1GJPA 4BKNA 4NAEB 4OHQA 4JFSA 4IF2A 7TAAA 3LCLA 1WV2A 4CCEA 1WOBA 4WKHA 4Z17A 4DAFA 3OGRA 5KTLA 1ENUA 2D23A 2H9AB 3ARUA 2Q3RA 3LI1A 4INFA 3QYQA 4P7OA 2OQLA 3NQGA 1UZ1A 2PF8A 2E67A 4JOMA 4RZ5A 1NWUA 4ONVA 2WM1A 4K2SA 4K38A 1JGIA 2O7SA 3SN4A 4EF9A 4FNUA 4KEMA 3OHIA 4I9TA 4C60A 3N1AA 1GVFA 3VCNA 1IT7A 3JS3A 2ZZ1A 1LWJA 5CG7A 2X0HA 3LTSA 1UKOA 1J6OA 5LA1A 1IWAA 1QXLA 1TE6A 2QYGA 2F9RA 3CPGA 3AWNA 4LJ3A 4ADUA 2Z28A 4DZIA 4ZGYA 4IH3A 2YDQA 4OVXA 2CKSA 1QCWA 1AMYA 3CO4A 1HJWA 4O1EA 4UMCA 5B7YA 2XIQA 4Y6GA 3W7PA 3OYZA 2RGLA 2PTWA 1UH3A 4K68A 1GPFA 5CGTA 3GXIA 4MKVA 4B3KA 3FCPA 1DPMA 1QHZA 3SZ8A 1NQKA 5D37A 1MXSA 2JGQA 4NVTA 1TR1A 1US2A 3TTEA 1F74A 3QHOA 4U31A 1BWVA 1E55A 1QNQA 3KWXA 8XIMA 5FF2A 3HMJG 3OA5A 3UG8A 4XTIA 2J9ZA 1ISWA 3IJ8A 3W00A 2JIWA 1PE1A 1TE1A 5A6BA 4L80A 3Q58A 3SGGA 1UIOA 3ABZA 1JZ3A 1M04A 3BXWA 4Y9OA 1Z8AA 3PAOA 4DWSA 3M41A 3BLOA 1SU5A 3NDYA 1X8FA 2PLCA 1B3XA 5HBFA 1WBHA 1S2UA 3QGVA 3NQAA 1XYCA 4GIYA 1SPQA 3TW9A 5E93A 1K70A 1GOQA 2NXHA 1JF5A 3L5AA 2QMJA 2EGZA 2GSJA 1IQ8A 4M29A 1GOKA 3N4AA 3WLPA 2WJZA 3N9SA 4PTMA 1BYDA 1UKTA 3WQDA 2R6OA 3T6CA 1B3VA 3NQBA 3FA4A 4LCRA 4F40A 1VFMA 3SADA 5CSYA 2CW6A 3S6TA 4HZMA 4UR9A 3M47A 4Q8VA 1GQIA 3C0JA 1HJUA 4JHZA 2FJKA 3VGEA 2OQYA 5SWUA 1JCJA 1YDOA 3ARSA 2FZBA 3VZXA 1V7YA 2DZWA 5FJRA 1Q2SA 4PL2A 3MC5A 4I5XA 1A5MC 1SO6A 3SCVA 4UCFA 1VENA 2AKZA 1F8IA 3KOZA 1XC4A 1FWHC 2UY4A 2Y7FA 3C8FA 1VFFA 4TMCA 2G4JA 4Q4KA 4R7WA 1QHPA 5F4SA 2W63A 2YL5A 3NWRA 4EKJA 1MQRA 3ZJ6A 5FEXA 2YR1A 4FR1A 3RLUA 3NDZA 2ZWZA 2WO5A 2J79A 3PJXA 1ZLPA 1Q7MA 3WH7A 4D9PA 3VKCA 1EA0A 1IR1A 2DQXA 3BTNA 3EWUA 4GH1A 1V6VA 1KFBA 1J5SA 4KCTA 3WSUA 4PRRA 3MUY1 1EJRC 2DJXA 2QJHA 3GFXA 4DO5A 1HN1A 2J7BA 3QRHA 3VDAA 2BHZA 4DWSD 1K03A 3MPGA 2HS6A 1Q5MA 1JDDA 1PB0A 1IT8A 1O7AA 1W5QA 2FKPA 3PFMA 1TREA 3TQ0A 3PS7A 1EGMA 2C13A 3AXIA 2GVGA 1O94A 2YL8A 3ARYA 1UR3M 1LCOA 3MBDA 4IJCA 3HPAA 4RV3A 3W76A 5HXMA 1TA3B 4BZYA 1I1WA 4GZIA 3QSRA 3QKEA 1RPXA 1LBLA 2GJXA 2DH2A 2DZVA 4YHEA 3WX7A 5PTDA 1BVZA 3PPCA 3MYOA 4IPLA 1R0MA 1G4EA 3PPHA 3GIYA 3QEZA 4M6QA 4IZGA 3VNJA 1W9UA 4XVEA 1GQNA 3SCNA 1ZCCA 3N3TA 4IMFA 4M56A 4L4LA 2I56A 3NL2A 3WKZA 1VC4A 1BG9A 3LNPA 4D6DA 1EEPA 2FZDA 3CH0A 3LI0A 3UG4A 2VR2A 3EX3A 2RDWA 4ACZA 3EXSA 1PS9A 2HROA 1JYXA 5I3FA 2GDVA 3WFLA 4J3XA 3L4UA 3MMWA 2UV8G 1Q6OA 5DF0A 2V3FA 2NZLA 3MMUA 3R12A 2J7GA 4ICNA 5BRBA 3W7EA 3S0CA 4MZYA 1GQKA 3W24A 4MGGA 4AZGA 1VYPX 4GY1A 3FYOA 3LK6A 3UWVA 3RR4A 1C8VA 4J1OA 1VJZA 4AWSA 3H53A 2DSUA 2FFIA 2PWFA 3KL5A 3GAYA 5I23A 2CLKA 1CGWA 3EWYA 3L4XA 2FVLA 4UNKA 4NAEA 4TX9A 3FEMA 1JDFA 4B16A 3HM7A 4L6DA 5E9XA 1S5WA 1T7LA 4BR1A 2BOGX 4HSNA 2JKPA 1CB2A 2O56A 4GNVA 2A85A 3P80A 1CGXA 2E1DA 1JZ7A 3E0FA 1X97A 1QBBA 7PTDA 4H8HA 3T78A 2QCMA 1MUCA 9RUBA 2YA1A 4MAZA 3S47A 1QUMA 4O0KA 3K4AA 3ZT7A 3EOUA 1KBJA 2XN2A 3N17A 3VIFA 4QIUA 3PZMA 3SSJA 2YCJA 3IIXA 1UR9A 1Z41A 3LNMA 1VKFA 3W7RA 4F0MA 1C9DA 1UASA 4IMGA 5B80A 5HJXA 2HVNA 1XYZA 3TXVA 2X2GA 3UZ5A 3W53A 2A3CA 3OJGA 4FIQA 4UIOA 4WF7A 1DIEA 1WB0A 4HNVA 1SR0A 2ZUWA 4IPIA 2YJQA 2HXTA 1UD2A 4IP5A 4DN1A 4GMEA 5JBFA 1P1XA 2DH3A 1V51A 2XGZA 5HULA 1W5OA 2GL5A 3T07A 1UZHA 3OU8A 1TQJA 3TSBA 5HDRA 2P3EA 4MKSA 1VCGA 1WOAA 4LT9A 3T42A 1VFLA 3IIPA 3TX9A 1UUMA 4WKFA 3R13A 4OE7A 1EHAA 1WPCA 4GVGA 3PG8A 2E5BA 5IOBA 1HKVA 4IIEA 4Z0SA 1KFKA 5H2ZA 1W9BM 3SUWA 3E5PA 4XBKA 3PTKA 1X6UA 4HOXA 3CZKA 1EBGA 3QF0A 4ZFCA 4F0HA 5DCEA 4M1RA 4LV4A 4AXKA 4EWND 4NZ1A 5E0CA 5FD0A 2WHLA 5A95A 2OSWA 3N2TA 1S3TC 3P3BA 2VEKA 1OFRA 3UCQA 3PB2A 5FJOA 1ADOA 2D69A 2G0WA 3QR3A 1LM1A 3NA8A 2W62A 5D33A 2Y70A 3G1FA 2V63A 4KIEA 1FWDC 3JU2A 3VNKA 2I5QA 2NX3A 5FCZA 1EL3A 4JHOA 4URIA 5CGMA 4Q8UA 4ZA0A 4M81A 1EX1A 4F79A 3UFYA 4WSJA 1WDWA 1P0DA 1DWJM 1P0KA 1QMLA 1MW2A 3S9ZA 4AW7A 4GOAA 4S2BA 3O6CA 4OBSA 4XAFA 1OYBA 3S1GA 4LNYA 4IFRA 4PCFA 5K4ZA 5E6ZA 3QR1A 3IJIA 1UKPA 1J0KA 3R6IA 2DSZA 1W5NA 4J28A 2GJNA 4DEFA 2ZTJA 1WXYA 3DDMA 5KETA 4EXAA 4XK2A 1WXJA 4E4UA 1RK5A 4IX2A 1LOLA 1UJQA 1XLLA 2G3IA 1MQQA 3MI2A 3P60A 4F8XA 3AFBA 4IUGA 2NLYA 1KCKA 3RPTA 3OTRA 5CSRA 2QR6A 4RDZA 5BWAA 3EA3A 2EG6A 2XWDA 4YPJA 4YHGA 4XWUA 5HNNA 4CNTA 4RV8A 3UJFA 1FHVA 1FP9A 3TEVA 5TQLA 4LS2A 5DMMA 1UWSA 3KP1A 1OCQA 3M0ZA 3I6EA 3A64A 1XSJA 1B0IA 2VZVA 4DO7A 1S3HA 4D8ZA 1CGYA 5AHEA 3PSVA 1PDZA 3TJLA 5DCDA 3UESA 1JCYA 2WC3A 4O1FA 3W6MA 1E0UA 4ZEPA 1ZS2A 3LYEA 4QFUA 4A2RA 4UXDA 2Q3OA 3W1UA 4HK7A 4RZ4A 3G1HA 3R4IA 1H62A 1JZ6A 4DYEA 3WH6A 1WDDA 3AXKA 3E74A 4AD4A 4GE8A 5D09A 4O0QA 4G2DA 3CMFA 1E51A 3TMLA 3GM8A 2H3DA 1O1HA 2GLKA 1RXOB 3CWNA 1A50A 2R82A 3BL3A 3G1RA 1KA9F 1X7FA 4AX6A 1VD6A 2X42A 4S23A 3U7VA 4RE0A 4KCUA 3KLLA 4MJZA 5TAOA 3EEGA 1TA3A 3O9NA 4NZCA 1Q6CA 4WKAA 4DXKA 2A3AA 2NXGA 4ADSA 3QOMA 3W29A 4EAYA 3H2CA 4OUIA 2QCHA 3IRSA 1KXQA 2NXIA 2V82A 1V6TA 1D8WA 4AVOA 4E5TA 1VIZA 2WWCA 1CW2A 5REQB 4PCPA 1XLAA 3MSRA 4J3UA 4BWLC 3O16A 1XIMA 3W73A 1QNVA 4MG4A 1XRTA 1YE6A 2FHFA 5AC8A 4EWJA 3VILA 3MB9A 3LXBA 1X8CA 1EZWA 3AALA 4HBKA 1EF3A 2OX4A 4W8BA 4GUIA 5FI8A 3WLIA 1W8GA 1RCXB 3M0KA 4IWWA 5FF7A 3GHSA 3L4TA 3L0GA 4MMWA 5LHEA 1I6NA 1R30A 4GKLA 1TMQA 1IT0A 1E40A 3VDBA 1DWGM 3CB8A 2Q02A 3QM3A 4AEFA 1AG1O 3F4WA 2TAAA 3U48A 4GH3A 1PZ1A 3FHQA 3UG3A 1HW6A 3ZLHA 5ECVA 1CNVA 4Q4PA 3WLSA 3TTOA 3PWAA 4B3LA 4O54A 3RDKA 2R14A 4NRRA 4EANA 2XN0A 1ITQA 2DSWA 2GQ9A 1QHOA 1TZZA 1XLMA 3ITOA 1ZAIA 5HMEA 2D1ZA 3B4UA 1ICQA 3QN3A 3PZNA 4JKLA 4YN5A 1XBXA 5MF5A 3PF3A 1H0GA 2V3DA 1EUNA 3THUA 3BCFA 4GFSA 3K1GA 2OVLA 2P10A 4GYJA 1RQBA 4AWUA 2Q8LA 3EDFA 4V33A 2VURA 1EOKA 3GBEA 2RHGA 2HK0A 3VIGA 1FWEC 4O1CA 1NF7A 2FZNA 2DEPA 4JL1A 2VO5A 3MUZ1 2QCGA 3W7CA 3NQ8A 3BLEA 2NQJA 1EJXC 2J88A 2DJLA 3CZLA 4IPNB 2WSQA 4WEVX 5H1WA 1EQPA 2AQVA 1PVNA 1F07A 3M64A 1P7TB 5AC6A 4NF7A 2WK2A 2CLOA 1RQEA 2OWWA 4ENLA 5IDZA 2DSKA 3TN5A 1D3GA 1G69A 1TWZA 3EMQA 4QNEA 5GNYA 1T8XA 2E25A 4IIGA 4YVVA 3ZO9A 4H9TA 3O63A 3SN1A 4GFIA 4RNIA 3TR9A 1ADSA 3WBWA 1H7NA 2XFYA 5GNXA 4MB1A 4EAMA 1C7SA 2DZSA 2A79A 1XLEA 1UD4A 1TCMA 1OC7A 2Q01A 3DFPA 5D8ZA 1QI4A 5D04C 1JEZA 2VUNA 3ARVA 3RUBL 2PUZA 4M3PA 1R9YA 1KKOA 3IV3A 1IF2A 3LHZA 3KS5A 4H6KA 2NQLA 4N0RA 4F0KA 1TVNA 4M24A 1PWLA 5JIWA 3NCOA 4AHOA 1UBPC 4B5NA 4WDUA 1OIFA 2QV4A 5FF3A 3NEVA 4DYJA 3QXBA 1YPFA 4L9ZA 5J04A 2NX1A 3BPWA 3QPYA 2F6UA 3DUGA 1OC6A 5CQ1A 3U4AA 5LGZA 1ODZA 3H2OA 5D4YA 4BHYA 4HTYA 2Z7KA 5TF0A 5H6HA 3T9PA 2XZ7A 2QZRA 4H8VA 2X1IA 1AD1A 3DEQA 3USBA 4Z2GA 2Z24A 1JYVA 4AB4A 3OVPA 4O8RA 2BP1A 1EDQA 4ROPA 3WLNA 5EGRA 1D9EA 3SCRA 3VYLA 4DQWA 4RXFA 3CBWA 1KM6A 3B9DA 2QNEA 4I8YA 5FL0A 2O9TA 4XISA 4C6CA 1CDGA 4UOQA 7CGTA 1JCMP 2R94A 3CMJA 4LW7A 1JDCA 3AXHA 3O07A 4EP8C 1DL3A 1E4NA 1MFUA 3WLMA 4H3DA 1GVYA 4HNCA 1D3CA 2VGIA 2WSYA 3RU6A 4QAIA 1EPXA 4AC7C 3WBAA 3LUTA 5JH1A 1VF8A 3C0SA 3H7RA 1I2RA 1HF6A 3G5EA 3URBA 4A8IA 4W7VA 3EDDA 4QTGA 1WP6A 3FVDA 3IGHX 2WCSA 3VNYA 1HIZA 1K7FA 2Z2UA 3KRBA 3W01A 4DPQA 2HPMA 3VDCA 5DY3A 1VHNA 1UBSA 1CXKA 3I3DA 2BY0A 3GUGA 4MF4A 3MP3A 3BLPX 5EKYA 4F9JA 5L6UA 1JCTA 4I7VA 3WH9A 3B04A 3GNRA 5T26A 2CLHA 3BMXA 3XINA 2DDXA 3M4HA 1Z9AA 3CV2A 3VU2A 4ICCX 6ENLA 3LHVA 4R7JA 1XDMA 1HX0A 2P53A 2OO6A 3BMVA 3ISIX 2C1IA 4KESA 1GYLA 1XYAA 2F6XA 2VGFA 2FYMA 1SJDA 1J0JA 1KXVA 2DZPA 3OLGA 3G2GA 3VIJA 1XR2A 2WSPA 4L6HA 4BA0A 3ABSA 4ZTYA 2HV5A 1ELSA 5I3HA 2PE4A 4B5WA 4K6AA 1ITXA 4JX5A 5AZ1A 4AC1X 1GOOA 3LU2A 4FF5A 4JN8A 3PK7A 1DKWA 2VI0A 4EXBA 4G7FA 2YL6A 2CLEA 3W38A 1VBUA 2XH4A 1BKSA 4PMOA 2JE8A 3H23A 4PTDA 1QNRA 2ISVA 4UTKA 2AL2A 1IXQA 5CZ0A 1W3TA 1Y5WA 3WNNA 3UP8A 2Q8ZA 3KEHA 3AHTA 2Z00A 3WK3A 1FFQA 7TIMA 4Z0JA 1T5AA 3VNZA 2HE5A 1NWSA 4JKMA 1P4CA 2FGZA 3U5YA 3GNPA 5EFDA 2BVDA 4ZMGA 3H2AA 4PUKA 2PDLA 3CC1A 1OFQA 2VTFA 1FHLA 1S5TA 2R1KA 5HQEA 2J7CA 3MSDA 3FEQA 1NTHA 4CQDA 1W1B1 3UWZA 5I3JA 1XG4A 1AFSA 3GDLA 4NZ3A 5REQA 3BG5A 3FS2A 4DBEA 4UMBA 4UBPC 4DAIA 4NU7A 3LLXA 3BO9A 1UWIA 3VIMA 4DF1A 1OD0A 1QFEA 3VE7A 3UXAA 4XD5A 3QYSA 2PDXA 3H4WA 3FOKA 1WCGA 4GXPA 4UTMA 4AF0B 5FA5A 2VVSA 3D5HA 3MWAA 5K9DA 3LSBA 3U0HA 3WDQA 2V2CA 3G1YA 3DFNA 1Z7AA 4MJMA 4E2OA 2C1HA 3KFTA 3BGJA 1Y8BA 1R3YA 1K02A 1BSIA 1B57A 1D7KA 2HMCA 5J5DA 1EXBA 5A1AA 1OFOA 4UTWC 3K2GA 2ZE0A 4WZHA 2PDMA 3THCA 4JTUA 3SJNA 1N2VA 3E2RA 3QW3A 5D30A 1S1PA 1DVJA 1YYAA 2P76A 4D1JA 4PMXA 5E6YA 1UW9A 5CG0A 3P0XA 3TC3A 3MZ2A 3M0JA 4WIWA 2F84A 3H21A 3H26A 2PP1A 3GS6A 4QSFA 4IG2B 2NW0A 3HU7A 4PMJA 2NUWA 4YU1A 2G96A 1EPVA 4ERAA 3LDVA 1OQFA 1V03A 1JUEA 3POCA 3GFYA 4F0LA 3EKZA 1U1JA 5A8OA 3TYEA 5D2XA 3DU0A 2RJHA 3BSGA 4WJEA 1P7TA 4B5XA 3T4CA 3BAXA 4NILA 3FN9A 3Q4DA 3DHFA 1OFPA 2FTPA 2PLKA 3T09A 2F6KA 4E4PA 1I9CB 1BXCA 2POZA 1BKHA 1VBHA 3UZYA 4X22A 2BODX 1MI3A 3TFXA 4FHAA 3DZ1A 1G4TA 1WE5A 2J74A 3S42A 4IM4A 4QX4A 4DUVA 5BOEA 1JD7A 4XD6A 2XUCA 4BQ4A 1CWYA 4JTGA 1V5XA 2Y24A 4V2XA 4J3VA 5AHMA 4O11A 1S1RA 5FSEC 1WNOA 2X40A 3F5KA 4CLMA 3QSTA 1ME9A 1Q7QA 4P8VA 4KEUA 5I3KA 5FACA 1PIGA 1BPLB 3QZEA 4J27A 1PX3A 3IGUA 3W37A 3TC6A 3F4CA 1KO0A 4DJFA 3BV7A 3QOKA 3NZGA 4X0VA 4H9MA 3CV1A 3TKFA 2ZVRA 4Z2IA 4YYFA 3P7YA 3D3AA 3KUMA 4W7WA 2A3LA 3CEUA 4B5SA 2A7RA 2NUXA 4OJYA 3GU2A 2E09A 4LAMA 3QQ1A 1XQLA 3NQDA 2QCEA 1N8WA 4QE4A 5CPQA 2C18A 3ZLFA 5LA2A 3UR7A 2ZYFA 4A3QA 4HPNA 1LP6A 3XIMA 3KHDA 4MHBA 1VBJA 1TSIA 4GINA 4GC3A 3M44A 1N7KA 2V30A 1MNSA 3A23A 4FI4A 3AHVA 2IXVA 3HG3A 2WC7A 1CPUA 4NXKA 4O10A 5E1QA 1O1ZA 4EF8A 4DZHA 3UZJA 2V81A 3S9IA 1DJYA 1UWRA 1UKQA 1XGEA 1OFEA 4AU0A 2ACRA 1GYMA 1W9XA 3SN0A 4G1NA 4NQ1A 1IR2A 3GNOA 5M03A 3UXDA 1AK5A 1P1MA 3AQUA 1OZMA 3LA4A 4KRZA 1DJHA 1PCKA 3OP2A 2V6AA 3CHCA 2YCEA 1VS1A 2DPEA 3MHGA 5KEZA 4XO7A 1DP0A 2A21A 3VIPA 3IRDA 4DWSC 3RLHA 4MFEA 4JFUA 2PGEA 3SO7A 2PDPA 4K1WA 1A0EA 3WQEA 1SJBA 5IHSA 2D2JA 2HCVA 2VKZG 1QOPA 3MUXA 2KX9A 3KAOA 5G2HA 1JXKA 3PNUA 3TIMA 3UY8A 4YJ5A 1DE5A 1H7PA 4FALA 5U4NA 2PGRA 1JPIA 3DENA 3WD3A 5I02A 3TH6A 5A6SA 2W27A 1NOWA 3GC2A 4PSPA 1J4EA 3WLRA 4ES4A 5DBUA 3T44A 5A2BA 3IVSA 3ATYA 2WZMA 1B90A 2Q6ZA 1GCYA 4YNGA 2YBTA 1XRSA 5DELA 5EMMA 1FA2A 3DBPA 2VUYA 1M7JA 3SY5A 1TWWA 2GVEA 4N6EA 1E9YB 3FXGA 5AVHA 2GDQA 3CLWA 3WQPA 3D0CA 4BEQA 1KFLA 5XIAA 3FVMA 4GQGA 2XSXA 2IPJA 1E0TA 2E68A 1NU5A 2PODA 1NDYA 1YTDA 1E73M 4HGXA 3VD5A 3L4ZA 1TPFA 2AKMA 3WDIA 6XIAA 2QVHA 3T4WA 1GVRA 4GVIA 3M0VA 4QG6A 4GYKA 4LRSA 2F7FA 1OFDA 3C2YA 1ZBCA 1RAKA 1H4PA 2ZC8A 3LSCA 3WQ6A 3ZIZA 3IJDA 4TV5A 3IVUA 3VTRA 3HQOA 1QI0A 4O57A 1GT8A 2QF8A 2UY3A 1GUVA 3P74A 2IKJA 3I10A 4HN4A 2HPIA 1F5ZA 4NASA 1VR6A 2C0AA 1E9LA 4PH6A 1TUFA 4AWEA 2RKXA 2NV2A 4KEVA 2XJ7A 3VFCA 1X98A 4DBWA 3WF2A 3DH7A 2YPIA 1L2UA 3LLFA 5CJNA 4X2PA 1A4LA 4E2DA 1TMLA 1POKA 1RUSA 1SW0A 3CUZA 1LJYA 1GPWA 3CB3A 3TOPA 1LL7A 4HKPA 4AUBA 1W91A 3W7KA 4C6FA 3GR4A 4ZXOA 5FF0A 3FLUA 4JS3A 3HG2A 3NVTA 2Y1HA 2P50A 1GOIA 3QH2A 4IP7A 1T96A 4EXQA 1OADA 4DVOA 2WHKA 3H6OA 3P8IA 1RR2A 1X1ZA 1HL8A 4IMDA 5B7ZA 3KVKA 3QHMA 3WNKA 1FHUA 2OZ8A 1VCFA 1H5VA 3AJ7A 3G77A 1XG3A 4O53A 4GVHA 3NSMA 2NQHA 1MZRA 2WKLA 3W71A 4MADA 3SRDA 2IQTA 1CCWB 3MJYA 3EWCA 3FY1A 4XVDA 3W72A 4DRSA 3WQ8A 1A3WA 4AZCA 1WO2A 3W7OA 5LA0A 4QCEA 3LENA 2J27A 3A22A 4NI3A 3TV8A 5A3HA 3KZPA 4FXJA 1KM3A 1G0CA 4JN7A 3HPSA 2I9UA 4BF5A 2V69A 1ZNNA 1XPYA 5CZTA 3AAMA 4UTLA 4I9MA 3LCWA 3LHWA 4QLJA 5A8MA 3SDOA 1QBAA 2WOQA 3AYTA 3ZR4A 3UJSA 1OGBA 1XH2A 3W3OA 4CCZA 3A12A 4XX6A 3THAA 2ISSA 4ZE4A 4J3TA 4S3BA 4G6CA 3CQKA 5DMLA 3YPIA 3U2OA 3OOQA 4J9JA 4BF7A 2VC7A 3MV01 1QPKA 4YYCA 1SO4A 5CGQA 2E6AA 2WJEA 1K9TA 4KWUA 2PRHA 5J5RA 4CU6A 1E1EA 2C15A 1LT7A 1UP3A 3CAQA 3ZR5A 1JGMA 4JIPA 5AHFA 3AIBA 3KOXA 3EKLA 4OGZA 2BY3A 3DI0A 4HZ6A 3EMCA 2CCRA 5AKQA 3INPA 3QQWA 4WY0B 5BXRA 2D20A 4NYUA 1EZ2A 2PDFA 3WZ0E 4PEKA 3M07A 5D38A 4S2CA 4X3ZA 4HD5A 4CN6A 3M43A 1VPQA 5D2WA 1VFSA 4OFCA 2VFFA 2GWGA 2WMKA 3NVDA 4AZ6A 4DBDA 3ARXA 1UD3A 3JW7A 1BF2A 2QDHA 3SCWA 3OPSA 5AZ0A 1F4AA 3KCJA 2VRQA 4MDOA 3VCCA 4YTUA 3GH5A 1R2SA 1F6PA 2E1WA 4W9TA 3AUOA 3M0MA 3SCSA 3P2VA 4PTXA 1LLWA 2X1SA 3DFYA 1EDGA 1SVDA 3Q2DA 2PWEA 4XD3A 4KF1A 4AG0A 3WFZA 4DUWA 3WLOA 4R85A 1AJ2A 2GJLA 1TV4A 4V28A 3CUFA 1QO2A 3BWWA 1F3WA 3SY1A 5HR6A 3HFTA 4G9PA 4LUYA 1BLIA 3UZZA 1GHSA 1TWDA 1RY8A 1TPB1 3UD6A 3N12A 5XIMA 3EAUA 4WHBA 1W1VA 2G97A 4BJHA 5C6MA 1XS2A 2FMNA 4JYDA 1ZP4A 4L56A 4R27A 3G24A 2IKGA 1KR0A 3BVJA 3AROA 2BLEA 4JTKA 1O5RA 2F8QA 2XSAA 2ZZ7A 1DTUA 2JKEA 2OODA 4PBEA 1IWPA 4C7DA 1EEXA 3SGZA 1RK6A 1U22A 2QUNA 1SW7A 1LTDA 1GW1A 1FWJC 2IS7A 1J10A 3W2LA 1THFD 1H5YA 4W8AA 1JRCA 2PDWA 3BOXA 3VKBA 4LAUA 3H8AA 2PI6A 1SUXA 5JIPA 3BLKA 4ZQNA 3QFEA 1HXJA 4V1YA 1F7BA 3ITYA 1QO5A 1BHGA 1CXEA 3EB2A 1KM5A 1WX0A 2B81A 5F7UA 3THQA 5ECUA 1HVXA 1NH6A 3MUIA 4C6JA 1GG1A 1A0DA 4DHGA 5F2GA 3T0CA 3PZVA 1MVYA 1IIGA 3JZEA 2YSWA 3P67A 4FOJA 2ACSA 2WZEA 2ABAA 3KRUA 1KFJA 3WQGA 1HL2A 3GE7A 3TP4A 5A2CA 2ABBA 4TVDA 3SW6A 1UR4A 3WD0A 4JYFA 3E0LA 3RO6A 3WBEA 1TO3A 1ONXA 3AJXA 5CBIA 1PPIA 2OJPA 2XIIA 1TTIA 3VA8A 2CXEA 2WMIA 3TC7A 2BS9A 1V7AA 1V02A 3BW4A 4LX4A 4HQVA 3E96A 5AVNA 5C7HA 1YX1A 3PBYA 4OWGA 1L0PA 1YPXA 4MKNA 2G4FA 4IIHA 3URNA 3QC3A 1FWGC 4LRTA 4HYRA 2XVLA 3E0VA 4QRNA 1Z44A 5TIMA 2NQZA 3QV6A 2XH2A 3EDEA 4UQCA 2HISA 2QCFA 2YDAA 3GXPA 3WFAA 1G5AA 3WUGA 1W6TA 4KS0A 4N9DA 1BGAA 1BFNA 3B40A 4AFYA 4BI6A 3RX3A 1HNYA 3HQPA 5BYWA 4D8LA 5AECA 1WXZA 3QV8A 3DN5A 1H09A 3TYBA 1C9WA 3N34A 1I4NA 4LTSA 5CCZA 2BNJA 3VUSA 1S2VA 2E7FA 2VWSA 1FBAA 3KTXA 5HINA 4CNPA 3ITXA 4FA3A 1ICPA 4FZIA 1OCNA 4O1BA 4H8UA 4UUIA 3LX9A 3DG7A 1V08A 3FNDA 1E4MM 3PULA 3SQSA 5A6KA 2CBJA 4PYSA 1MEIA 2VVNA 5C9ZA 3OVGA 3UR5A 3UZXA 5LGXA 4NSBA 2QQ6A 3JRKA 2ZXAA 4GO9A 3UG5A 2GGJA 2WHMA 4S38A 1F76A 4JCMA 3ME3A 4WGHA 5D8WA 2ZRXA 2QAFA 1NDWA 3HQ1A 2VEGA 4HA4A 3UPWA 2WCGA 3GG7A 2MANA 4CQ8A 2Y62A 4FXRA 4Z2HA 2QF7A 4XKYB 2VNCA 1GKRA 1W5MA 4ZCWA 2XM1A 1TV8A 1QI5A 4PSRA 4HK6A 4Z2KA 4N9BA 4OUEA 3TYDA 2O55A 4Z2JA 2XISA 4I5UA 5BXTA 4TTGA 3QBUA 4TQTA 1W8SA 2YXGA 1P0EA 2DUAA 3VMOA 1ZUAX 4UOJA 2NWSA 3VXGA 2VC6A 5BOFA 5LIWX 2Y8UA 1FWTA 3IGXA 1ISVA 3ABOA 3EWZA 4DXVA 3E02A 2GJPA 2PCQA 2VR5A 4H1ZA 1FKXA 3H22A 3EWWA 3HV9A 2OQHA 3C0LA 4C90A 3G0XA 1A5KC 1W9PA 4UZUA 4DB7A 2ISDA 3ABQA 4J3SA 3DYPA 4E8DA 1C3FA 1E15A 2B7OA 3NTYA 3RG6A 1K8XA 4PUMA 1A5CA 1RPKA 5KZEA 1F05A 2DZTA 3OBKA 1L9WA 3WJYA 3W02A 3UJ2A 2EPHA 2GUBA 5I79A 2ASHA 2Z1WA 3F5LA 2OGYA 2PP0A 1UZ4A 5CZJA 4Z1CA 3UETA 3PBGA 1Z48A 1XRFA 2JK2A 3R43A 3FSUA 2L5HA 6CGTA 3F4NA 3D47A 3WEOA 2V5BA 1FXQA 1VFTA 3NNTA 3T2PA 4C65A 3SEPA 3OO2A 3VIHA 4HPGA 5EFFA 3ARZA 3DFHA 3IACA 4GI9A 2Y7GA 3UXLA 3E0IA 4NP7A 4WY0A 2GUYA 4ZO9A 1IGWA 3DIPA 1D2KA 4WRHA 3S83A 2EPOA 3SM0A 1WKFA 1ISXA 1FH8A 1AD4A 3WDHA 2IXUA 1GTEA 2D0GA 4AY7A 2ZWYA 1G7VA 3A9IA 1R9ZA 4HHPA 4KWSA 3WLLA 2BOEX 1EO7A 1LYXA 5BROA 3AWOA 4KMQA 3RFAA 5AYYA 5A8NA 5AHLA 3B9AA 3OG3A 4HZ8A 3ONCA 3VMPA 4PMNA 2DQWA 2XVNA 3W84A 4S3FA 3KDNA 4XZ9A 3OIHA 1KWGA 1W2PA 4RUBA 1K7EA 2DIEA 2E3ZA 1W5PA 3DC8A 1GONA 2FJUB 4K37A 4NAFB 3RM8A 3E1F1 3LEPA 3MDUA 1ZZMA 4GYFA 2J7FA 2WNQA 2EPLX 3S1WA 4B90A 3DBNA 1RHCA 4JFTA 2PRLA 4US5A 3TUUA 3BLLA 2ZDRA 3K30A 3B03A 4QGCA 2Z1XA 2YBUA 5A8PA 2WLYA 3O6YX 1DEDA 2Z2BA 3E3HA 4OTKA 4U4MA 3AMCA 1NIUA 4WQ6A 1NOUA 3HV8A 4MUPA 4MDPA 4TV6A 3MYPA 2YIHA 2D0HA 2VEMA 1SZFA 1TTPA 3ARTA 1M68A 3DHUA 2PDUA 1MWOA 1VYSX 4POCA 3QY7A 1R3QA 3VFLA 1GOXA 4L4PA 2V0TA 4U5KA 3WLQA 3I3BA 1X96A 1X6LA 5C9WA 1E6QM 1NFPA 3TAKA 1P48A 2QGHA 3VZYA 4C6BA 1H7WA 2A1YA 2ISFA 1PDYA 3AXXA 4XAPA 1R7AA 4RE3A 3LY0A 3ZVHA 3SI9A 1Y0EA 1O6IA 2WMJA 4ZOBA 3EYPA 1VRXA 2ZOXA 1AQMA 1EKOA 1QOQA 3GZAA 3TSMA 1ODUA 3WG6A 1B54A 5D2VA 3TJXA 1E70M 5D05A 1FWNA 2WVSA 1TCDA 1F3XA 4IXXA 5G4WA 2CNCA 2CWNA 4MJ4A 1D7FA 3LM7A 1UD5A 3OW1A 2RAGA 1JUKA 4RE4A 3WNMA 1EGZA 4XZIA 2AMXA 3H2MA 4FLSA 4IFKB 1WZMA 5AOUA 2VD8A 4AZHA 3V4BA 4R88A 3WUBA 4MZ1A 5DT5A 4PUWA 4PUDA 3ZJ8A 1Z42A 1TIWA 4PTNA 2HE8A 4GZEA 1QNPA 1CBGA 3WMLA 1MEHA 2RUSA 4EOUA 4UTTC 1RD5A 3AMDA 4WY0F 3TU9A 1OWQA 2VFEA 3MI3A 1TZ9A 3VD9A 4OOZA 3RU8X 3T8QA 4KCWA 1BQCA 4V15A 3PUOA 3TA6A 5AHNA 4US5D 3ORWA 1YLVA 1R85A 2QCCA 2Y8KA 5KZDA 2A7NA 3NM3A 3VINA 3AHZA 1NJJA 4YTRA 3TONA 5CAKA 4A3YA 1T0OA 4HU8A 4GRSA 2YCKX 1AZ1A 3CT7A 4Q8WA 4CD4A 3WJSA 2PU1A 1KQZA 3WF4A 4PBGA 3LOTA 2ICSA 4QBXA 4R7OA 1J0IA 5H8MA 3U9IA 4JFVA 1JR1A 1E6SM 1VH7A 3IV8A 3MSYA 3M6DA 2PWGA 5IHRA 2QPXA 1UIPA 2NV1A 3A9BA 4EE9A 4CN1A 2CC0A 4QE1A 3B9OA 4WUIA 1VEPA 1AQFA 3MWCA 4YTTA 1K3UA 2QCNA 4ZZ9A 1XV8A 2MNRA 4C6KA 3PBMA 1K7XA 4QSHA 4ZL1A 1GHRA 1NF0A 1XLJA 3C2EA 1E3XA 4YMZA 4WSHA 1B2YA 3EBVA 4GO8A 1YE4A 4QITA 5HWJA 2CETA 4XKYA 3SIZA 2XM2A 4XB3A 1JFHA 5KZMA 2XTKA 3ZWSA 2HNEA 2W91A 2WAGA 2FMOA 1H1YA 5CEWA 3PPFA 1KV8A 4LQ1A 4WJ8A 1BVWA 1V3HA 4MY8A 5DBTA 3PNZA 1Q6QA 3W85A 1VB9A 1HKIA 3D3FA 2ZRZA 3M7WA 3G8EA 1VCVA 3ZVIA 4CGTA 4MNMA 3WCZA 1BRLB 5JUVA 1RQHA 4H41A 4QISA 2ZRWA 4GI6A 3RK8A 4GQ0A 3STFA 1ZENA 4AVFA 4UQEA 2ZA2A 1R2RA 2G5WA 3PJTA 2WMFA 3BLIA 3BUVA 2YL9A 3STPA 4Z1AA 4QP0A 5C55A 2B7QA 1VIWA 2WZHA 5F1UA 2PDHA 1Q2RA 3DAQA 1OX6A 4X63A 3BG9A 2HVMA 2EF9A 4FX8A 1KW1A 3BQ5A 4M80A 1NVMA 3ZWTA 4JTRA 3NQCA 3NL5A 1TRDA 1XKYA 1W1ZA 4H8NA 1PJ9A 1N55A 3V75A 3TJIA 2VCBA 2A3HA 1QTWA 3PJWA 3HB9A 2CZFA 3PBWA 3UW6A 3W22A 3GDMA 4QXIA 1C8YA 3WL1A 1NP2A 2CLLA 1G4PA 4LUIA 5CBBA 2B7PA 3NZRA 3DXIA 4GQBA 2NV9A 4ZVJA 2VEIA 2QDDA 3TJ4A 4MAVA 4FMVA 4CNOA 3MBFA 2BVWA 4JTJA 3KBVA 2X30A 4IIFA 1OX4B 3E49A 3RAOA 3MP4A 3P6LA 2OWXA 3R11A 2D0FA 3RHGA 1UP0A 4Y8FA 3TROA 4R5EA 3UWQA 3LPGA 3HPZA 3KE0A 4YIWA 4ZQPA 2Y8VA 5K9XA 1Y5XA 3WELA 4I5RA 3V5OA 2VX7A 5KINA 5HOSA 1XIEA 4O4VA 1Q13A 3FAWA 1XLIA 2HEJA 3QPZA 2TPSA 4DJFC 3W2JA 3AO0A 1YPIA 5G4HC 1K8CA 4XAZA 4GJ1A 1YKWA 2A4AA 4DZ5A 2CXGA 3APTA 1MNZA 4HHLA 3E6EA 3M5YA 1CXFA 4LB4A 3T40A 1H49A 4OIFA 1IXPA 1YDYA 4CQAA 4ZTXA 1LUCB 2BVYA 4M1BA 3RIKA 2JGYA 3UZWA 3OBEA 3OQEA 2QUTA 5LKYA 1O5QA 1V4YA 1A5UA 1UG6A 3V1PA 4HT3A 1GNXA 3A47A 4QAWA 4HK5A 3WNOA 4DLMA 3N2CA 2HBXA 2DUXA 2F61A 2WXDM 1EP1A 4UCGA 2V8ZA 4M7SA 3WO8A 3M16A 1HGWA 1N8IA 4JEJA 1L6SA 4ZOCA 1F2JA 2DW6A 4XZNX 3VX1A 3W9ZA 3R0KA 2VELA 4GPNA 2WQDA 5G2IA 1SMAA 3OZOA 2BWGA 3H54A 4QG9A 3M5ZA 3VGDA 4MLRA 3PY2A 3KM8A 4AIOA 3CUIA 4A6GA 1RBLA 1KQYA 3FIGA 2INFA 1EX5A 1PCWA 4QEHA 2E5CA 1AL8A 2QHAA 1S46A 4DI8A 4CQBA 2I16A 2RDXA 3IJQA 1KGUA 2NWRA 5I5RA 3BAIA 3MI6A 3APYA 3BARA 1CZ1A 1K6WA 2Y7EA 2PWDA 4DJEA 1N8FA 4FLQA 3QR0A 3SB0A 4JN6A 2GUUA 2FVKA 4KGJA 3TN6A 4Q4OA 3ZS4A 4X2RA 3EXRA 4K8GA 1ZRQA 4XUGA 5I24A 1O66A 5I3DA 5FF4A 2O0TA 4IGHA 3WD4A 5IXEA 3V36A 3GZ3A 3NL6A 5LNUA 4IFKA 5RUBA 3AZRA 3TLLA 2Y85A 1XIBA 4J35A 1E5JA 5CLTA 2EG7A 5EBUA 1JPHA 2QJGA 4UTHA 1PWMA 3ONBA 4G1KA 1OX5A 3HURA 2VYOA 3SCUA 1K8YA 1LRQA 1H7XA 1FCBA 3E38A 3PHAA 4XIAA 3SRKA 4NKCA 3S8HA 1KBKA 1X7IA 2QUMA 3QZAA 5K2ZA 4IFOA 3ZOAA 3SFKA 3SR7A 3VABA 1W37A 2QDEA 3IIZA 4JIIX 2XGIA 3DESA 5CPNA 4A3RA 4U3AA 3GHTA 5EY5A 4ECLA 3WDRA 2P8CA 5LXXA 3W7GA 2Y7DA 1JG9A 4BFAA 4H2HA 3ARWA 1WA3A 4AZ7A 3V3WA 3U3HA 1PBGA 1R38A 3AYVA 3F5JA 5GJMA 4OU1A 3LB0A 3BMWA 4GXWA 2C91A 2OZ0A 2R91A 4PB3A 1GORA 4WX2A 2DT0A 3S2JA 4L7ZA 2OKTA 1TMHA 4XZLX 1FVPA 4M6VA 2HRWA 3EOOA 5G5IA 5EMYA 2EPKX 3G0UA 4LVBA 3UWEA 4U3CA 4R9XA 4O8AA 3G6MA 1ME8A 1FP8A 4UTJA 1XSKA 3OLDA 4JTDA 3TNOA 1NELA 9CGTA 5C7VA 2ZRVA 1ZTVA 2OSXA 5AC7A 1IV8A 3FDKA 3K13A 3OGVA 1HO4A 3EB3A 1HG3A 2WPBA 4LC8A 4O16A 4C6EA 3MA8A 5GVJA 3EZ4A 4DJED 3JR2A 3SBFA 2BMBA<