5T26A

Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
293
structure length
292
Chain Sequence
HMFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 4-hydroxy-tetrahydrodipicolinate synthase
publication title Kinetic, Spectral and Structural Characterization of the Slow Binding Inhibitor Acetopyruvate with Dihydrodipicolinate Synthase from Escherichia coli.
rcsb
source organism Escherichia coli o8 (strain iai1)
total genus 108
structure length 292
sequence length 293
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2016-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5t26A00
4UXDA 2F84A 4LOCA 5F2IA 1PCKA 1PS9A 2P10A 4HNNA 4PC8A 5FEPA 3HGOA 1KFJA 1L9WA 3NPWA 3W7IA 1OYAA 2ZTKA 2A85A 3SR7A 2WV8A 4RXGA 4UFIA 4O17A 5TQLA 1JRBA 1O95A 4JTEA 1BTMA 4I7WA 4EF8A 4NT0A 3UY7A 5KITA 1QWGA 4MJMA 5HUPA 2GVLA 3G1XA 4YWIA 3B06A 1KLYA 3HGRA 4EOUA 3NQAA 1G4EA 3M6YA 1W3TA 4UTJA 1HL2A 1FCVA 1NSJA 5LNWA 4IOTA 5F4SA 2V82A 2VEKA 3A21A 2A0NA 4TR9A 4EF9A 2Q3RA 1RD5A 4IPIA 1F76A 1N8FA 3HF3A 3DHDA 3G1VA 3LLFA 4S2CA 2XN0A 4DPQA 3S5YA 3MP3A 3RLVA 1ICQA 2BWGA 4J9JA 4E38A 4NJKA 3E9AA 1YDOA 3STFA 3F1QA 4TX9A 4LVFA 3W74A 4PA8A 3C2RA 1OF6A 5I3HA 4ZZ9A 3HGSA 1EUAA 4OT7A 1M5WA 3L65A 1LDCA 1WBJA 5CZ0A 5BNKA 4O0ZA 5U4NA 3EXSA 4ADTA 3WJYA 4O14A 3M5ZA 3GYEA 2ATSA 1PIIA 4AXKA 1ME9A 2CLLA 4L4MA 3ZS4A 1MZHA 1GYLA 1KA9F 2J9ZA 1Q6OA 1XKYA 1EP1A 2YZRA 1P1XA 2QCCA 1L6WA 3B0PA 3S1UA 5HR6A 4AEOA 3TFXA 4CCEA 2NUWA 3GKAA 3OVPA 3U8GA 2XN1A 3CEUA 2QCHA 4M19A 5AHFA 4NJJA 1GPWA 1XC4A 3DKLA 4NQ1A 5F4XA 1KTNA 3BGJA 3GDTA 3GXTA 3DFOA 4Z0SA 2Y7GA 4GC4A 1H1YA 4Z1BA 3S0CA 5CPOA 3G8EA 3LERA 5J5DA 4P61A 2O7QA 1FX6A 4UTHA 3BVJA 1Y0EA 1FDJA 4HN4A 3W6YA 5EBUA 2GVJA 3PWAA 5CGQA 1X7FA 3QMTA 2G97A 3PSWA 3NOEA 3PB2A 3ZWSA 3P67A 2YXGA 3W75A 1PHWA 4UNLA 4MYXA 5IBXA 3B03A 4O11A 3I68A 5I3KA 1MO0A 1XBYA 4ZL1A 4UMAA 4GUIA 5K9DA 1G6CA 4HSNA 1LYXA 1EWDA 3HG3A 4CNOA 1RQEA 4KFPA 2PURA 4PCFA 4A29A 5MHBA 3RK8A 3SJ3A 4WD0A 4UNKA 1WA3A 3DFPA 4JTTA 1O5XA 3JR2A 2VFFA 5LZLA 5DCBA 1WAUA 3NXFA 2PC4A 1OK4A 2ZQ0A 1UJPA 4QAIA 1K8YA 1R47A 3B04A 4JICA 5KTLA 3GIYA 2JKPA 4MPQA 1WOAA 4K6AA 3LXCA 3W1PA 3SGZA 3B0VC 1SZNA 1W5NA 1YDNA 1MEHA 2YDAA 1XL9A 3O6DA 1Q6RA 3EWBX 4WUIA 1DORA 3PY2A 1W3IA 4JDBA 1NEYA 1WQ5A 4JYFA 1A5CA 2QUVA 4O1CA 5DN1A 5FESA 1K02A 2V5LA 1MSSA 4IPJA 3R2GA 3EKLA 3N19B 3UWVA 1JCLA 1FY6A 4O1DA 2V0TA 3E12A 1OG0A 2J9YA 2I9EA 3EWXA 1FDZA 2ZYFA 4AH7A 1FWTA 3MJYA 2HS6A 3A22A 4IJBA 5D03A 5D2XA 2YR1A 1RZMA 1SW3A 1ZJIA 4PL1A 3DZ1A 4CLMA 1VS1A 2AGKA 3PF3A 3TW7A 4R34A 4FIRA 5FF0A 1S5WA 4M6PA 3G22A 3M41A 3L5AA 2ZZ7A 1T96A 1W0MA 3TQKA 3OG3A 3TK7A 3W86A 4I9AA 2NUYA 2YYUA 3HPXA 3PS7A 1JCNA 2JGQA 4AHQA 2Y62A 4POCA 3NDOA 3C2FA 2FB3A 1GYNA 3QMRA 2Z1BA 3QQ1A 2W79A 4LRSA 3F4WA 3VI2A 3HO8A 3QQ0A 4LS1A 4RZ6A 2VEIA 2DJLA 4Z1AA 3UWYA 1O5KA 2CLOA 2QDHA 3W72A 4WY0A 2OCZA 2NLIA 1P5BA 3SFKA 1ZFJA 2E6YA 3LCFA 4NVTA 3IGXA 4HPXA 4JIQA 3NQVA 3P62A 1W31A 4Z0JA 5DCEA 3T55A 3ABQA 2RH9A 3MI3A 1NF0A 3P7YA 5LKYA 3D0CA 5DBTA 1VZWA 4HPJA 1P4CA 4MZYA 4YCPA 2DZSA 3PC0A 4NXKA 3BLFA 4XUGA 5D32A 4YLWA 2TYSA 2V8ZA 4NNAA 2WKJA 4WZHA 5AC6A 3L66A 3NPUA 4PL2A 1GQNA 3OVRA 3DU0A 4QQ3A 2Q3OA 3C2EA 3NL3A 2VEMA 3W7OA 5D02A 4R53A 2CZDA 1BEUA 1GTHA 1PE1A 4O50A 1GVRA 3M5XA 1SZGA 1TQJA 3WJXA 5H2ZA 4N9DA 1C9DA 1R46A 3N9SA 1Q6LA 4A2RA 1TV5A 4K38A 4LY8A 1LLZA 3G3MA 2W0UA 4O52A 3S5NA 4BK9A 3WJSA 2YW3A 3N2XA 1H63A 2BTMA 1B9BA 3KRSA 4PFMA 5E0KA 4RK8A 1JCMP 3L2IA 3NA8A 1I4NA 1XDMA 1PV8A 4LT9A 3EXTA 4JEQA 3P5ZA 3GR7A 5KMYA 4N4QA 2DZPA 5DXXA 5KSWA 1T8XA 2BZNA 1TJRA 1MEWA 3CEPA 4LV9A 2QAPA 3W7CA 3BG9A 3M5VA 4LVBA 3NQ2A 1SPQA 1I8JA 2VFEA 2H8ZA 2H3DA 3G1YA 5FF3A 3W1LA 2B0MA 1TV7A 3KVMA 3GDRA 1SU5A 3NZ1A 3P80A 2QCMA 5HQEA 3P8JA 1F6PA 3C2VA 3L5LA 1KFEA 1LRNA 3ZWTA 5BW6A 1FXPA 3LHUA 5IM51 3FOKA 3DFSA 3MMTA 3W7LA 5D37A 1TPFA 2E5BA 3W84A 1W5OA 1XI3A 3HIJA 2ZZ6A 4C1KA 3TJXA 1ZY9A 3BV4A 3G24A 1TPB1 2A1YA 2QCFA 1IIHA 3QF0A 3BW2A 2WSQA 4DQWA 3GNNA 5HJLA 2O7SA 1TRDA 3KXQA 1IIGA 4BI7A 5LNVA 3M16A 1TPEA 3UYCA 1EX5A 3H53A 4LUJA 2EAWA 4O16A 5AB3A 2CLHA 3IVSA 3DI1A 5IBXC 2VFHA 1JULA 2VFIA 2E6FA 4FEZA 3NM1A 4IX0A 4JX5A 3GKFA 4DO4A 2NUXA 1AW5A 3WK1A 3AO0A 1EP2A 2Y70A 5L6UA 5AC8A 4NJIA 2ZRUA 4ICNA 4KWVA 5G4EA 2LLEA 4IMFA 3FS2A 4O4VA 3LTPA 2CLEA 4XQ6A 5G2WA 1IF2A 2CLMA 1N7KA 1AW1A 1WYIA 4FNUA 2G95A 3BK0A 4ADSA 4MJZA 2Q8LA 1TPH1 2PRHA 3G0SA 4LTSA 2C3ZA 4H3DA 5AYXA 3C0JA 3JS3A 5DXYA 2A7PA 4UR8A 5TIMA 5KINA 1KM0A 3IIVA 3UZ5A 3TE9A 1X1ZA 3L0KA 2Z0IA 4JNMA 5D30A 2AAMA 3MBDA 2NXIA 3TMLA 1A5AA 3TSMA 4S1FA 5CZJA 3QRHA 3IV3A 1GG0A 2A6LA 1ME7A 1L2UA 2QJHA 2A21A 3NQ7A 5F1VA 1OJXA 3HGJA 3UY8A 1KFCA 3W2KA 3FYOA 2E77A 1AL7A 3U2OA 4HIBA 1GVSA 1YXYA 1GVQA 1VRDA 3I7QA 4BI5A 1CI1A 4A22A 1S5VA 2ZRZA 1OFRA 3LI0A 4Q4KA 3W2LA 1NFBA 3G8RA 2DZUA 1XFBA 1W5QA 2YCEA 3G3DA 1UCWA 2C14A 2QKFA 1EEPA 2R14A 1SW0A 3G1SA 1TSIA 3DBPA 4YL2A 2PE4A 3BGGA 4LWWA 1YTKA 3HB9A 3W7DA 3LBCA 1SQ7A 1GVFA 3RFAA 2FQIA 3LCGA 1LBFA 4OE7A 3LXBA 2DZXA 3UWWA 3TA6A 3NR0A 2QJIA 1QR7A 2V30A 3O07A 3DKJA 5K9CA 4AMAA 4UTWA 3W88A 1O94A 2QCEA 1M7OA 4O4WA 2A2IA 5FF4A 1KFBA 3W7GA 4NZJA 1H62A 1VCVA 2RFGA 1OFOA 2ZCGA 3KRUA 5DY3A 2VFGA 4R7JA 1B3OA 4CNNA 3NQMA 3KVLA 1PCWA 3MHFA 4M6QA 3P74A 4XKYA 1HFBA 3IVTA 4MLJA 3CTLA 1L6YA 3DFNA 3EKZA 4UR7A 8TIMA 2CU0A 3KVJA 1TREA 3W85A 2HMCA 2ZFAA 1LBMA 1TPC1 1XUUA 1G4TA 3OEXA 3NGJA 2C1HA 4QNEA 4JDYA 2CLIA 4A21A 3CU2A 4DELA 3NO5A 2R94A 4M6VA 4ONVA 4AAJA 4OWGA 1J5TA 3WK0A 1U5JA 2YSWA 4MVAA 3O16A 3LHZA 3L67A 1DKWA 1ONRA 2CZ5A 4JGDA 3HBLA 1LM1A 5J5RA 1R2SA 1XCFA 4HKPA 1ICPA 1F5ZA 5BOOA 4GUFA 3Q2DA 4JTJA 4OV4A 5HWNA 4AHPA 2CFFA 4N4PA 1QNVA 2J6XA 3C61A 3W83A 3EWYA 1GG1A 4QISA 2FPTA 3SZ8A 4DPPA 3NAVA 4WXYA 3TXVA 3FKRA 2VKZG 2BX7A 2Y63A 3GAKA 1YDVA 2GVGA 3Q58A 4FIQA 4K7YA 4E0CA 2JKAA 2ZRXA 3LBMA 4O18A 3DENA 4NJGA 3MBFA 5I3JA 3HG2A 2V2DA 4O19A 2Y6ZA 3KRZA 4Z1DA 5EMUA 1HUVA 4OBTA 4TMBA 2WNNA 5F1UA 7TIMA 3QFEA 4JYDA 4OGZA 3LCXA 4RJEA 2B7NA 2ZA2A 1LZOA 4FNTA 1C8VA 1OFDA 4DF1A 1L6SA 1OX4A 1QAPA 4RZ5A 2WSYA 4O1AA 3W2JA 4O15A 3MYOA 4JTHA 1G7VA 3W1XA 1KM6A 2OT1A 2P1FA 4WQ6A 4Y8FA 4ZQNA 2FDSA 3TAOA 1UB3A 4LS2A 1VYSX 3SY5A 3W7NA 1KTBA 2C13A 1TV8A 2CZEA 4O28A 2BLEA 1H7OA 1OVDA 3NL2A 4Q33A 1EB3A 5C6MA 2ISVA 1F05A 5CPNA 1FCUA 3L68A 3BG5A 3DFTA 5DELA 5D2TA 3ATYA 4UMCA 3OVQA 2YX0A 4JIPA 1JUBA 4LV4A 3LCIA 2FLIA 3KVKA 5K2ZA 1FWWA 3EX2A 1YPFA 2FTPA 4ZVJA 4AHOA 4KFNA 1PVNA 1W1ZA 3FIGA 4UTLA 1F74A 1H7XA 1JCXA 1F6KA 4DEFA 2WNQA 2RDUA 3W1MA 1H50A 2ZRYA 5LGZA 3QW4B 2J24A 3UNDA 5AYYA 1F7BA 4RXFA 3EWUA 2J9XA 3OIXA 4QJ1A 1LCOA 2CLFA 4X22A 4PEKA 5LNUA 3FLUA 1X6UA 1TMHA 3SIZA 1WOBA 1KV5A 5G1YA 4FXSA 1QPOA 4I7UA 3RLUA 3EEGA 1I2PA 2WNZA 3TXZA 5C55A 2E6DA 3TIMA 2F7FA 2FPVA 1OX4B 3W2NA 3R89A 4UTMA 3CT7A 4QNWA 3UZJA 3W76A 1A5SA 2BSLA 3O06A 3W9ZA 3S9YA 3HG5A 4UFKA 3B0UX 5AHEA 3W7JA 1B57A 2C15A 3UWZA 1Q45A 1DVJA 1QDSA 3W7KA 3GLCA 4MLRA 1AK5A 5CSRA 3STEA 1A50A 2ZA1A 3ATZA 3G18A 1UBSA 3HPSA 1MEIA 5EPDA 5LHFA 3PUEA 1O4UA 1ZCOA 1KM2A 1ADOA 5EYWA 4LVAA 2C19A 4DBEA 1LBLA 2XN2A 5CSSA 5C54A 2GUUA 5AHNA 4MY1A 5CKSA 5K4ZA 1VH7A 2Z2UA 1TPVA 3O1NA 5CPMA 3W87A 3VCRA 2GQ9A 4WOQA 4OV9A 4O10A 1VHCA 4DF2A 2B7OA 2A5HA 4FX7A 2OX1A 4Y9AA 2X30A 2ZRWA 1SZEA 1QMLA 3QEZA 4YCOA 1R2TA 2V2HA 1OFPA 1VYPX 5C5YA 3PVFA 1TRIA 1JUEA 4NU7A 4HNTA 2ATMA 1V5XA 5F2GA 5D38A 3CHVA 1EP3A 2WQPA 3MP5A 4N2YA 2QCGA 3W1TA 1CW2A 4PODA 3UXDA 4WJEA 4UTWC 4JXCA 1DJQA 2Z6IA 4FO4A 5A5WA 5HWMA 4K8HA 3TQVA 2QUTA 1P0NA 4JS3A 1XBXA 1TTIA 4CCCA 3TMQA 4FB7A 1RV8A 4UFJA 3QJAA 1T99A 4JX6A 4IXHA 1OYBA 1OFAA 1VYRA 3CB8A 4FX6M 3TR2A 1TPWA 1WDWA 5E93A 2ISWA 3UPBA 2EF9A 4NXSA 1O60A 3MHGA 5FI8A 3W1NA 4N02A 3M9YA 4GJ1A 1A53A 1SO4A 1YXDA 3R5EA 4D2JA 1E51A 1J4EA 5HULA 1S5TA 1UUMA 3DXIA 3HG4A 3PUOA 5K4XA 1TB3A 4DF0A 4GRSA 4HSOA 1Z48A 5AC7A 4LS0A 1Z41A 4WY0F 1TCDA 2GOUA 2KZHA 2EHHA 4BR1A 4N6EA 3IVUA 4GUHA 2W6RA 1IXQA 1LOQA 3NZRA 3ZFHA 2IQTA 2RHGA 1SZFA 3PG9A 4NNBA 1K7EA 2VEPA 1TTPA 5DCDA 2WOQA 2JBMA 2E09A 3RNDA 4O13A 5F2LA 3P5YA 3DGRA 5EKYA 3ABSA 1IGSA 3CPRA 5KZMA 1W3NA 1QPQA 4ALDA 3H55A 4IXXA 2WJZA 3GAYA 3W7HA 1W5PA 5HR7A 3M47A 3S5ZA 2X1RA 3T4CA 4WY0B 2X16A 3PBUA 3BW4A 2VOMA 4GNJA 4U4MA 1ZAIA 3MWAA 4JTUA 3VE9A 5CG7A 3TV8A 5D09A 1K7XA 1KBJA 1G67A 4LU0A 2E5DA 1DQWA 3C6CA 1VQTA 3GDMA 5L9FA 2GQAA 3NL5A 4MY8A 5LNSA 4U28A 3VNDA 1B4EA 5CZTA 2P0OA 4O1BA 3LV6A 4LRTA 3FA5A 4P2VA 4YXGA 1D3HA 2NXHA 4JTKA 3M43A 1THFD 2RDWA 4NX0A 5D2VA 1JCYA 2UV8G 3TDFA 5CPLA 1A5BA 3GR8A 2A6NA 1EA0A 4CCDA 2VXNA 3INPA 5C2XA 3PR2A 3PUDA 3RU6A 3V75A 1CX9A 3LOTA 4UFMA 1ZAHA 3EB2A 5TBOA 4XTDA 3EX3A 4AWSA 2J27A 1SW7A 3B05A 3T7VA 5T26A 1GTEA 2C0AA 3TCEA 1TJPA 3OHIA 2GQ8A 1FXQA 3W7RA 2EKCA 3I6RA 4PH6A 1ME8A 3W3OA 4RV8A 4O0KA 3TUUA 2PCQA 2XFWA 2Y85A 3KHJA 4QITA 3N73A 1VR6A 4MIMA 4ZQMA 3SI9A 3EX4A 1W37A 2TPSA 4M7TA 4MKNA 1KM1A 1D9EA 2VC6A 1W8SA 5CZSA 3WJWA 1H51A 1JVNA 2FB2A 4H6KA 3PAJA 3ABOA 3LHVA 1BWKA 3K30A 5D04C 4UUIA 3Q94A 3W71A 3MO7A 2Y61A 1C29A 4FNSA 3RF9A 4FXRA 1YXCA 1TTQA 4DXVA 3LV5A 3EWZA 2QCDA 3T40A 3THQA 3C56A 3IIZA 3LHTA 1SO5A 2A7NA 2HTMA 4Y90A 4KKXA 4TU1A 4UTUA 2DZWA 2TSYA 2FFCA 3I65A 3LX9A 2NXGA 1ZNNA 1VHNA 3G0UA 3QSRA 4LNYA 4RKAA 5F2MA 4KWWA 3NNTA 4I7VA 3L21A 1TQXA 2WSRA 2QF7A 3G1FA 1ML1A 2Y7DA 1Q3NA 3W7MA 5SWUA 2Y88A 4N6FA 3C3NA 1K7FA 3F03K 3M1ZA 1K3UA 2QR6A 2WPBA 3P8IA 3LHWA 5E1QA 5EA9A 5FF7A 3S42A 2BXVA 3IGUA 3I7SA 4CQAA 2ZA3A 4EWND 1X8FA 2ZDRA 5D2WA 2QAFA 3MUXA 5GVJA 3L0NA 4CQ8A 1ZAJA 1EPXA 2R91A 5I3GA 5BMXA 1NVMA 2ZZ2A 4K7VA 2TMDA 4HT3A 1LP6A 2CLKA 4IMEA 2NV2A 2ZTJA 4L4LA 3NQCA 3GK0A 4O8RA 5K7JA 2DORA 4YMZA 1T0OA 3O05A 3KFTA 3W2UA 4JY8A 3A23A 3BPWA 2E1DA 4FNRA 2B7PA 3NG3A 2AQWA 1UASA 4G1KA 1JR1A 1TTJA 3IGSA 2A7RA 2FJKA 1YTEA 2OJPA 4LVGA 3LHYA 2JGYA 2I14A 1DOSA 1IXNA 3R13A 1QO5A 1H7PA 4IWWA 1YPIA 3L0GA 4MFEA 1M7PA 3NQ6A 1OABA 2G5WA 3AJXA 1K8XA 3P61A 3A5FA 2QCDB 1OX6A 4JYEA 4RR4A 2R8WA 3E0IA 3WK3A 1F73A 1UUOA 1PHQA 3HQ1A 1LOSA 2WO5A 2V9DA 3CWOX 3KOFA 3IRDA 3KAOA 3W22A 3W7PA 3LI1A 5K3VA 1FWRA 2OZ0A 3SSJA 3F4NA 2JKEA 1FUYA 1TYGA 1VPXA 3CIXA 1VGAA 3S1WA 4XBSA 1WXJA 3NQ8A 4HNUA 1LORA 3PM6A 1LOLA 4O54A 4UFHA 1QFEA 1FBAA 1YYAA 5AN7A 3BG3A 3ANYA 3BW3A 4ADUA 3LCLA 3C52A 1RQBA 1ZALA 3TJLA 1SR9A 5BRBA 4ORMA 3A5VA 3HPZA 2FIQA 2YW4A 2CZFA 1DQXA 3DH7A 2QUUA 1I2NA 4UTTA 3O8AA 3IEBA 1VCGA 1F2JA 1GEQA 3THAA 3P60A 6ALDA 3W1RA 4Z08A 2YYTA 1RR2A 1GZGA 2VFDA 1XDLA 4GFSA 1VLWA 3TROA 3W7QA 1VCFA 3G0XA 3UWUA 2E5CA 1SO3A 1XM3A 1PL9A 3LTSA 3GNDA 1D3GA 2HSAA 1FWNA 2V5BA 3IIPA 1DBTA 2Y7EA 4X2RA 4XKYB 2FPYA 3TKFA 3LGEA 1K8ZA 2NWSA 2YFOA 5G2IA 1SSGA 2NX1A 4N9BA 1N55A 4BWLA 4QIUA 1V7YA 4JTSA 5A8GA 4UC5A 1LRTA 4XWUA 5K9XA 2H6RA 5HWJA 2ABBA 3G1HA 3MI2A 3L5MA 4LUIA 2CW6A 1ALDA 1G69A 4E2BA 3TW6A 4BF9A 2GJLA 1QOQA 3S1XA 1LLWA 4Y6GA 1SFLA 3TSBA 3STGA 3W1UA 1ZHAA 2ISSA 3TC7A 4GXMA 1KLZA 3B8DA 1BWLA 3TC6A 5LSMA 1W5MA 1KV8A 3W1AA 3CM4A 2C6QA 4AWTA 3EX6A 4QM1A 1FCBA 3MHUA 3LLDA 2DU2A 4WXZA 3TSDA 4ZQOA 3S8HA 1OK6A 3P81A 3FYPA 1XUZA 2E68A 4OQVA 4BI6A 3DFQA 1VLIA 5LGXA 4GUJA 4IQLA 3W23A 4R33A 1KTCA 3N34A 3QSTA 3C2OA 4ZMGA 3LM7A 1OHLA 2EGZA 1G7UA 5AHMA 1H7RA 3DHFA 1YTDA 5AOUA 3GVGA 1JRCA 6TIMA 2DZTA 3GXPA 1H61A 2C18A 1H1ZA 3N2MA 3TQ0A 3CWNA 3BLIA 3DI0A 1OFBA 4ZQCA 1XBVA 3KX6A 1NAL1 1R2RA 3EWWA 3CIWA 4XZ9A 4OHQA 3USBA 4ZQRA 4LC8A 1I45A 3W7EA 4NJHA 3LCHA 3N14A 4M7SA 1DJNA 1FCQA 1KW1A 1OX5A 1YLVA 3M5YA 3S6DA 3CC1A 5AFDA 1KM5A 3BLEA 4AWUA 4IMDA 2OMAA 4W9TA 2Q8ZA 3FFSA 4AF0A 3A9IA 4DO6A 4WOZA 3R8RA 4MZ8A 3QW3A 2QDGA 2QJGA 4O12A 4Y96A 5EL1A 1P0KA 1FWSA 5LNRA 4PTNA 3P84A 1G4SA 5LHEA 4K39A 5D2YA 1SFJA 4H4IA 3ZR4A 1H7WA 1GOXA 4S2BA 4IX2A 4RX0A 3O63A 3WFAA 5G4WA 2PRMA 1JQVA 1VJIA 3M44A 2A4AA 1NF7A 3SGUA 1Q6QA 4GWEA 4MYAA 3TH6A 3MW7A 2H3BA 4MFDA 1B4KA 1QO2A 1DV7A 3LXAA 3ELFA 3I7RA 3NQFA 3NM3A 3W2MA 5HNRA 2Y89A 3LB0A 1JJKA 4TO8A 3N3MA 1AG1O 3JRKA 3VE7A 1OFEA 1OYCA 3LDVA 4ML9A 1JCJA 1QPRA 1HG3A 4MZ1A 2C16A 3GDKA 2RKXA 4CQ9A 1EIXA 2YPIA 4BFAA 2EPHA 1SUXA 4JN6A 4O53A 4TMCA 4A3UA 3O15A 3W07A 4IMCA 2D73A 1AL8A 2B4GA 2YGYA 1XBZA 3RMJA 2Y7FA 1LROA 4FX8A 4K37A 5FEZA 4IGHA 2H90A 4X9SA 4E2DA 3LTYA 3LRLA 4X3ZA 1MXSA 4K8EA 4QSHA 4HNVA 4AF0B 5HMSA 4LVDA 4FF7A 4JTFA 4IMGA 5D05A 2H8XA 5D33A 3TX9A 3W1QA 3VFLA 3STCA 1W56A 3IIOA 4RCXA 3NEVA 2TRSA 3PB0A 3ABRA 1KFKA 4NX5A 5KZDA 4MOZA 2YFNA 2ZZ5A 3CLMA 2DP3A 5G1TA 1WV2A 1RVGA 3UD6A 1Z44A 1TPUA 2CWNA 5HINA 3DAQA 3TFCA 4XBKA 3WJZA 5AYZA 4EIVA 3SECA 3UPWA 3C8FA 5AHIA 3MYPA 1M6JA 3YPIA 2V81A 1KFLA 4ZQPA 2X2GA 2NWRA 4UMBA 3PBYA 3S1VA 4MUZA 1FQ0A 3OA3A 1JUKA 2J88A 1HO4A 1EUNA 5AHLA 1QPNA 1SO6A 2NV1A 4FHAA 4UIOA 4M5PA 3GXNA 1KM4A 3FEMA 3R12A 3NQEA 4N9EA 1K03A 1KM3A 4UTTC 1DL3A 3CQ0A 1I2OA 2NX9A 1GJPA 4ORIA 4LW7A 3PBVA 4NNCA 1VC4A 4DO5A 5FEWA 2ZZ1A 1AW2A 4C1LA 5DY2A 3BARA 4JTGA 3G1AA 5KZEA 3N9RA 1IXPA 3C4UA 2PRLA 1H5YA 2QCLA 1LRQA 5G5IA 1S3HA 3MI6A 5G2HA 4NUWA 4O57A 2ZZ4A 4BWLC 3UWQA 4Q32A 3PG8A 1HTIA 4CNPA 3Q37A 3TU9A 3E02A 3HMJG 4JTIA 3LRMA 5I3FA 3LRKA 1X1OA 2ZZ3A 3NVTA 3T78A 4EVZA 3UXAA 2E6AA 3A24A 3O6CA 2NX3A 2QEZA 2Z6JA 2I1OA 1WBHA 4WX2A 5FF2A 3HOJA 3QPYA 4NZFA 4HHPA 3L9CA 3P82A 1Z42A 2ZRVA 2X1UA 3QC3A 1ICSA 3QYQA 4K36A 1XXXA 3QM3A 5EY5A 3B4UA 3VKJA 1TO3A 4FNQA 1U83A 1OF8A 4AVFA 4JY9A 3FJ6A 5H91A 1GVOA 1RPXA 5U7SA 3TAKA 3H54A 3V1PA 5HUOA 5F4WA 2RDTA 2NZLA 2GPTA 4A2SA 3GB6A 4DBDA 1TPDA 3EXRA 4GBUA 3PSVA 4FNPA 1FDYA 4UTKA 3PBWA 3G1DA 1I2QA 5DLCA 2B7QA 3EX1A 1G4PA 3M7WA 3QMSA 2G96A 1OFQA 4B5NA 2ALDA 4JD4A 3W73A 3BO9A 4GE8A 1J2WA 4OU1A 3OBKA 1HO1A 3QZEA 4GUGA 5I3IA 4JR5A 1IXOA 2HS8A 4UCGA 1SSDA 3MP4A 4AB4A 3WK2A 3TNOA 3NL6A 2DJXA 4RZ4A 4LC6A 3NPVA 4Z1CA 4JX4A 3FKKA 5BMWA 3M0ZA 1LTDA 5DBUA 1H60A 2X1TA 3NQGA 3QH2A 1TIMA 4MY9A 1QOPA 1EWEA 5FEXA 3QPZA 1WX0A 1R30A 3S5OA 4UFLA 1YADA 2ZBTA 2VENA 3NPXA 4RLIA 3E96A 3GX9A 1JQXA 3W70A 2OT0A 2GJNA 2QCNA 3UQNA 3PULA 1DHPA 2V2CA 3SW6A 3HJZA 1AMKA 3FJLA 2DZVA 4N9CA 3GZ3A 2VELA 1H7NA 3LCWA 1RQHA 4TIMA 4KFOA 3NYZA 1GT8A 2ABAA 4XTIA 3E49A 1ZENA 3T44A 3GDLA 1BKSA 1QCWA 5ABTA 1GWJA 3NQDA 3U6WA 1W54A 2JK2A 1I2RA 3O6YX 3IIXA 1KBIA 2X1SA 4IUOA 4UTIA 4JTLA
chains in the Genus database with same CATH superfamily
1PS9A 2J7FA 2DV0A 5PTDA 4GZ7A 1KFJA 4IPNB 1Z69A 4GXWA 3W7IA 2EXOA 1U1UA 3A4WA 1CXFA 4RXGA 4UFIA 2PI6A 4O17A 5TQLA 5I24A 1O95A 2OPJA 5M5DA 1TWWA 3SN0A 4MJMA 5HUPA 3AIVA 3G1XA 3MCOA 4YWIA 3TN3A 2ZUWA 3B06A 1KLYA 2GYIA 1GEHA 1W3TA 4UTJA 1HL2A 1FCVA 3PWIA 3ONCA 4AD2A 5F4SA 4H01A 3RIKA 2A0NA 4EF9A 3WLLA 2VEFA 1NH6A 1N8FA 4Y9NA 5HA7A 3DHDA 3G1VA 3LLFA 4PUWA 4FZIA 1ZU8A 4JTDA 5MKGB 4HN8A 3S5YA 3BMVA 3MP3A 4IM4A 3CO8A 4NRSA 5ECUA 3SURA 1HJVA 1ICQA 3V36A 3F1QA 3U5YA 4ZZ9A 3HGSA 1EUAA 3AROA 4OT7A 2NLYA 4ZENA 5D9MA 1O7AA 4G1NA 3VTRA 5BNKA 4ADTA 3GVWA 3I3BA 2CWXA 4GNKB 4AXKA 4GJIA 1RY0A 2CLLA 4L4MA 4GGHA 3ZS4A 1MZHA 1W2VA 3N29A 4PRWA 3WFZA 2J7DA 1BGGA 3FJ4A 2J9ZA 1AJ2A 3UCQA 1SMDA 4OBRA 3TFXA 1EBGA 1JYNA 2GSHA 3THCA 4WJ8A 3U8GA 1OCNA 4NJJA 2HXUA 4PMQA 3GXTA 1U22A 4GC4A 1J0YA 1H09A 1X6NA 3S0CA 2VYOA 1HX0A 3FJNA 3TLLA 3BVJA 2YL5A 3SAZA 1NWTA 5CGQA 4AD1A 1CZ1A 1SM9A 4K68A 1WDSA 1UKSA 3SO7A 5A1AA 2D2HA 3MUIA 5AC4A 3NOEA 3PB2A 1V6XA 2Z7GA 2YXGA 2UZ9A 2INZA 3W75A 3BANA 4MYXA 4O11A 4A8LA 1XBYA 3ITLA 1V6VA 3HG3A 3VCNA 1RQEA 4A29A 4PCFA 4MHBA 3DFPA 1Q4WA 1O5XA 3EPNA 5HPOA 1GQIA 2DUAA 3TVAA 2PTDA 1LQ2A 5DCBA 3KS6A 1TJ2A 2R1MA 2NSOA 1CENA 3PJTA 1UJPA 2ZX5A 3GTFA 3GIYA 2YB4A 2EPMX 3NIYA 1D2KA 5EGRA 3W1PA 3SGZA 3B0VC 1YDNA 3PZIA 4JBRA 3SFWA 3NQBA 3BQ5A 4NKCA 4NAFA 1XH1A 4DXKA 1NEYA 1WQ5A 4E4FA 4JYFA 3DYMA 3CQIA 3SCSA 2QUVA 4HOXA 1S39A 4J3UA 3VIGA 4O1DA 1OT1A 2WVTA 3EWXA 3TC3A 3NWRA 5D03A 1FH9A 2YR1A 4IFKA 2E9BA 3UZXA 4I6VA 1PEZA 4CLMA 3TLQA 2C79A 1LL7A 3G22A 2ZUUA 4EPBC 3OG3A 1IT8A 3W86A 4I9AA 3LGGA 4GNVA 2CHRA 2NUYA 2YYUA 4F2UA 1OM0A 4WGHA 5I0DA 4Q8WA 1EHAA 3C2FA 3IUHA 1GYNA 2IKHA 4CUCA 5AECA 4UNIA 4S39A 4XIMA 2AMXA 3VI2A 3HO8A 3O3RA 4UWMA 2Z1VA 2DJLA 2Q6ZA 3OBEA 1V0MA 3S2CA 2OCZA 4UOQA 4L61A 3H4GA 1P5BA 5BROA 4C6LA 3WUFA 1ZFJA 8RUCA 3LCFA 4EE9A 4NVTA 3FHAA 3TOYA 4H1ZA 3RLHA 3RJYA 4JFSA 4FPSA 3T55A 1EDTA 3MI3A 4EPDC 3CHDA 2IKJA 3XIMA 3R0UA 1MNZA 1I1WA 4HHMA 3A4XA 1E15A 3D0CA 1P4CA 3NSMA 3PC0A 3ALGA 3WEOA 2P8CA 3BLFA 3ZSSA 4DY1A 5KEZA 2WKJA 3H7VA 2DIEA 2QDDA 2VJXA 3ECQA 3UETA 4QQ3A 2WYSA 4AIBA 4MJ4A 2CZDA 3AIBA 3DEQA 4S3CA 1GTHA 2F2KA 4O50A 1GVRA 5H2ZA 4N9DA 4IFKB 1C9DA 1Q6LA 2J4GA 3WL0A 4DUXA 4A2RA 4P7LA 3S5NA 1FTXA 1TMQA 2YW3A 3N2XA 3VA8A 3KDOA 1O1ZA 3EWCA 5E0KA 2E40A 3GHSA 3NA8A 2O55A 1PV8A 3IPWA 3CHFA 5CXPA 2WB5A 2DZPA 5DXXA 5KSWA 1UD6A 2HXTA 3PHAA 2MNRA 4PGLA 1EPVA 3EEZA 4GZEA 3BG9A 2OFJA 4UQ9A 2HNEA 1SPQA 1H4PA 4KF1A 1GQJA 2XSXA 3A3HA 4J1OA 3QXBA 5FF3A 3GDRA 1SU5A 2OQYA 3P80A 2W67A 4JQ1A 4JFVA 1W9DM 1F6PA 4WR3A 1KFEA 1XH2A 3A9BA 1RA0A 1OB0A 5BW6A 1CGTA 5M3WA 1SJDA 1VKFA 2E5BA 1IEXA 1W5OA 5A6KA 3W38A 3WF2A 4LAZA 4I5UA 2HQAA 3HIJA 3CPUA 1W1PA 3TJXA 4FR1A 4IQJA 4LAUA 3RUBL 4KRTA 1UWRA 2PU0A 1XIGA 4GGBA 2PFHA 4OIFA 2EEXA 1EYEA 3QVQA 5GJNA 1OCJA 1TPEA 1EX5A 1V7AA 1EC8A 4XZBA 2X2YA 5A6BD 2CYGA 4J4KA 9CGTA 3IVSA 5CSYA 2ZADA 4DJEA 1XKJA 2GK1B 3NM1A 4IX0A 4DO4A 4PTXA 2QGHA 2D24A 4PB5A 3MUAA 1UWQA 2IQ0A 4UQBA 4DJFD 2P0IA 1ZBVA 3ARQA 2XZ7A 4ICNA 5G4EA 3HV9A 4G8TA 4G9PA 3LUTA 3LTPA 4QLLA 4A35A 5GPRA 2GUYA 3AMKA 3N4AA 2X41A 1WYIA 4FNUA 4PMXA 4HCHA 1OSEA 2Q8LA 3T2QA 3G0SA 2WQDA 1BRLA 5AYXA 3C0JA 1A5NC 3JS3A 2A7PA 3NTYA 3RRAA 3IIVA 3VNJA 4JTQA 4L56A 4EWJA 1V51A 4E8CA 3MBDA 2NXIA 1P6BA 3VKCA 2VGFA 1A5AA 4ZOBA 2XDFA 3WQ8A 2A6LA 1NP2A 1ME7A 2A21A 3NQ7A 3NYDA 1QNSA 4PUDA 4QR6A 1TV4A 1KFCA 1P7TA 1TCMA 1D7FA 3FYOA 2E77A 3U2OA 3AS3A 3SSZA 3SCTA 3FAXA 1GVQA 4NL1A 1W1YA 1AQHA 1KBLA 4Q4KA 2YDSA 4MAVA 1RK6A 3G3DA 4DYJA 2R14A 4AX6A 2BGSA 1SW0A 4JKKA 4YL2A 4M51A 3UXLA 1RLCL 4ZB0A 3W7DA 1MUWA 3K4AA 3RFAA 3LCGA 3QYSA 4DUWA 1BTCA 4OE7A 1HJXA 3LXBA 4D6IA 2VZVA 4DIAA 2WMIA 1QI0A 5HK4A 3O07A 4IUGA 4Q4MA 4UTWA 4EXQA 5HAOA 1O94A 1XW8A 3DYPA 5LYRA 2A2IA 1V3KA 1AJZA 2JALA 5FF4A 5H6HA 3CNYA 1VCVA 3CAKA 1XGEA 3A13A 2VFGA 4QGCA 2AOSA 1EC7A 1PCWA 4M6QA 4ERGA 1BLIA 2Z1XA 1Q66A 3RG6A 3U7BA 3RX4A 3RITA 4QBXA 2V63A 8TIMA 1JNDA 2PEVA 3H24A 1TREA 1BRLB 3VIIA 4EXBA 3EA1A 3B9EA 4PMRA 3NGJA 4JDYA 2CLIA 5ECVA 1QNRA 3CUJA 4FOUA 3CU2A 3BURA 1U5VA 4RUBA 3GBEA 3U0HA 3VMOA 4E2VA 7ODCA 3LHZA 1ONWA 3CLWA 3M0KA 3MSDA 4OTKA 2JE8A 2W9MA 1R2SA 1E1CA 4ENLA 3CYVA 4GUFA 3MWCA 2GUBA 4XISA 4LYRA 4AHPA 2CFFA 1CXKA 3V35A 4ECLA 3W83A 1GG1A 1UZ4A 2FPTA 1S2AA 4DPPA 3TXVA 2J7CA 3FKRA 2GVGA 3Q58A 2DW6A 2RJGA 3T2PA 2X09A 3PZMA 5HQMA 2VM8A 5M03A 4CU6A 3DENA 3GC5A 2WMIB 4IP5A 2Z1KA 1XIJA 1UR4A 3TOPA 4JYDA 4OGZA 5EFFA 4RJEA 4DJFC 1P6CA 4QG6A 1ZL1A 4DF1A 2NT0A 2ZXBA 3VPLA 3MV01 4N7QA 1OX4A 4RZ5A 2HNHA 3IARA 3W2JA 1UG6A 3FA4A 3MYOA 4JTHA 2XH0A 2A3CA 1G7VA 2OO6A 3W1XA 4Q8UA 2P1FA 2DH3A 4JKMA 3MZNA 4ZQNA 2Y5JA 3WQVA 2C13A 1X7IA 1TV8A 5BRQA 2CZEA 3L2LA 2BLEA 1H7OA 3S46A 5TD4A 5C6MA 1DIDA 1MQPA 1E56A 4DYEA 1UW9A 1F05A 5CPNA 3BSMA 3DFTA 1XWYA 5DELA 4NF7A 3OVQA 3H2AA 1YBQB 4JIPA 1JUBA 4LV4A 1RBAA 3TYBA 1O12A 2HVNA 3LMZA 3KVKA 2IXVA 3HFYA 2QPXA 5K2ZA 3EX2A 3BAIA 1EBHA 3CPGA 4ZVJA 1PVNA 1EX1A 3SGGA 3FIGA 5FL0A 5C2CA 3W1MA 1R5YA 5LGZA 3WLOA 2EG8A 3QW4B 4KCTA 5IDIA 3UNDA 1XFCA 4S3DA 5G1MA 1A3HA 3EWUA 1LCOA 3E0FA 1X6UA 1Z32X 4XX6A 4FXSA 4U5KA 1QPOA 3PNZA 1RD6A 4X9YA 4I7UA 3M0JA 4GVIA 5BWAA 2JF7A 3GFZA 3KP0A 3SUSA 2FPVA 1CYGA 1OX4B 5E9AA 3IJ8A 3WNMA 1GOQA 5DT7A 1A5SA 2BSLA 4FXJA 1B57A 3QKEA 4F66A 1Q45A 1XIDA 3ATZA 2X7VA 4U3AA 2VNCA 1ZCOA 3UCDA 4LJ3A 3KL0A 4EP8C 3WQGA 2JEPA 4HA1A 4LUSA 3HN3A 2GUUA 4KIRA 5AHNA 4MY1A 1VH7A 3T1GA 3VCRA 4ZFCA 4PZVA 1XIIA 1VHCA 2B7OA 4Y9AA 1W32A 1XLGA 1SZEA 1S2WA 2XFFA 2VD9A 1KCXA 3PVFA 1TRIA 4HNTA 3VIMA 1ESWA 2ATMA 1S3TC 4NP7A 1BXNA 5F2GA 3QHNA 2WQPA 3WMCA 2IS7A 3UXDA 4B90A 1DJQA 1MUMA 4FO4A 5A5WA 2OQLA 1S2TA 3VIFA 1VFSA 6A3HA 5HWMA 4K8HA 4JS3A 1XBXA 1TTIA 2OKTA 3GD6A 3M46A 3VMNA 4FB7A 4JTRA 4JX6A 3UJEA 3CB8A 4FSAA 4FX6M 3TR2A 1AZ2A 1TPWA 1WDWA 4GO9A 4LUTA 3WQDA 5AZ0A 3GU9A 5FI8A 3WEZA 4AIEA 2CEQA 3A3XA 1S46A 3RM4A 1XLIA 4E4PA 1UUMA 3PUOA 3C86A 1R9ZA 4DF0A 5BWFA 4GRSA 4DYKA 2WZMA 2D0HA 4WY0F 4QJ4B 3EMZA 1RUSA 1VFOA 1TCDA 2KZHA 4BR1A 3VOHA 1UIOA 2ACRA 2D2GA 1IXQA 1Q6FA 1SZFA 1OC6A 4PMJA 1YKWA 1ZB5A 4G6CA 4O0QA 5F2LA 2VTFA 1JD9A 2ZOXA 2Z28A 3ZIZA 5KZMA 1W3NA 1QPQA 1QK2A 2WJZA 3W6LA 2CBIA 2OODA 2X1RA 3PBUA 1EJVC 2VOMA 1ZAIA 5T91A 2R1NA 5D09A 1JZ8A 3EPMA 2E5DA 4GFIA 3BJTA 1TWSA 1AMYA 3NL5A 1FFRA 1FWBC 4MY8A 5LNSA 1B4EA 4LCSA 1ZBWA 1O68A 3LV6A 4C6OA 1QASA 3FA5A 4MWAB 2ZKMX 1THFD 4NX0A 1EA9C 4RZBA 1JCYA 1R7AA 4H8HA 2PDYA 3ARVA 4L5ZA 5CPLA 3TTSA 3H22A 2ACSA 3INPA 1MFVA 1PUDA 5CG0A 3IS4A 2GSEA 5DO8A 4NASA 4XTDA 4L1WA 2V3FA 2J27A 3T7VA 1GTEA 2XWEA 3W7RA 4PH6A 1ME8A 4RV8A 3AZTA 2XFWA 4C5ZA 4BZYA 4C6MA 3N73A 4BQ4A 6ENLA 1M9HA 3MVTA 4HZ8A 3EOUA 1DJGA 2VC6A 1W8SA 2WHKA 2JFEX 4CQDA 1JVNA 1Q8JA 3LPFA 4XAYA 4UUIA 3Q94A 1E55A 4C6CA 4L4OA 3I4KA 4ATDA 3NXLA 1ISXA 4ZODA 3BLDA 3WNOA 4H7CA 4DXVA 3GTIA 3GHUA 2NSXA 4X2PA 3LEPA 3VOIA 5XIAA 1JDAA 1MW2A 3THQA 4OBSA 4B2DD 1BHGA 3C56A 1SYTA 4LBRA 2A7NA 4E5TA 4Y90A 3ZOAA 4UTUA 2QV5A 4W7VA 4NY2A 2HE5A 1UOZA 4LNYA 5F2MA 5EMKA 3NNTA 1BXCA 4I7VA 5BZAA 3H2FA 3WD3A 2WSRA 2QF7A 2WC4A 1Q3NA 3W7MA 4ACZB 5A6JA 1CXLA 2Z26A 3F03K 1K7FA 2YA2A 3DC8A 3L4TA 1G5AA 2V5JA 5BYWA 1KRCC 5EA9A 4R7OA 4S3JA 1Q7MA 3D47A 3N3TA 5FF7A 3GVRA 2CBJA 5D2WA 2QAFA 4M29A 1WB0A 2XG9A 1T7LA 3L0NA 2E3ZA 1ZAJA 1EPXA 1JYWA 2R91A 5I3GA 5DF0A 1NVMA 1GZJA 1C92A 1LP6A 2CLKA 2NV2A 4GX9A 2ZTJA 3VGHA 3NQCA 2X8RA 1XR2A 4MGGA 2A79A 1JDEA 3O05A 3H2CA 4H7VA 4YTRA 3BPWA 2B7PA 4JIHA 1TTJA 2FJKA 2OJPA 1DOSA 2BY2A 4DAIA 5AC5A 4Q4OA 1QO5A 2BVDA 4QE1A 3LA4A 4MFEA 4XB3A 3NQ6A 3P61A 1OX6A 4JYEA 3S3GA 3MPGA 5JBDA 4HZMA 2ANUA 5LXEA 1UUOA 3KBMA 4BJHA 3RX3A 4OUIA 3HQ1A 3M64A 1DE6A 4IQDA 2WO5A 3UYIA 2V9DA 3KOFA 3KAOA 1ITQA 3LI1A 2EG6A 5K3VA 1FWRA 5E0FA 2EPOA 3RHGA 2Q02A 3F4NA 3WQ4A 1IZKA 2NQHA 3OZOA 1VGAA 3B40A 2XSBA 4JL1A 4IG2A 1MMFA 4O54A 5BXPA 1YYAA 1XLCA 3TZFA 1WKDA 3C52A 2GSJA 2PWEA 4ORMA 1IT7A 3HPZA 4H8UA 4X0VA 2CZFA 3DH7A 2QUUA 1L8NA 4GHRA 3THAA 6ALDA 2DEPA 1A5UA 3W1RA 1DIEA 3GR4A 2VFDA 2ZUTA 1XDLA 4GFSA 1LUCB 4ML4A 3W7QA 3GG8A 3G0XA 5AVNA 1SO3A 4Z2HA 1PL9A 3LZ3A 1QHZA 3T08A 2YFOA 4RDYA 1LL4A 4XZLX 2PDWA 2FVKA 4HPHA 2VGGA 4QIUA 1KXTA 2WC7A 5A8GA 4UC5A 5K9XA 5HWJA 2ABBA 2J62A 4H83A 2B31A 3AXXA 1OZMA 2AAAA 1JCTA 4AZIA 1G69A 5A8NA 3VC5A 4J3TA 4BF9A 3N25A 2YCIX 2EG7A 1ECEA 3PWGA 3W1UA 2Y5SA 1WXZA 4PEEA 2ISSA 3TC7A 3V16A 4GXMA 1KLZA 2J74A 3TC6A 4F0MA 1QWKA 3CMGA 3W1AA 3TEVA 1GKRA 3CM4A 2F6XA 4NG3A 4OQVA 3DFQA 5DMLA 1K6AA 3GSMA 3MZ2A 4BS0A 2PB1A 4R33A 2WKLA 1H7RA 8A3HA 3GHRA 2GGHA 3JVAA 2DZTA 4MSSA 4DNHA 4F2TA 1H1ZA 3GM8A 3TQ0A 1DWJM 1A0DA 2OSWA 3BLIA 4TV5A 3TTQA 3WYZA 3OB8A 2AL1A 1ITXA 3OG2A 5D8WA 3CUZA 2REQB 3VIHA 3M7SA 4OHQA 1HGYA 6REQA 3LCHA 3ARUA 3F5JA 3I4EA 4S3AA 4RPPA 1DJNA 2IKGA 3BLEA 5REQA 2Q8ZA 1FFQA 1R3QA 3RM9A 2BNJA 3VM7A 4MZ8A 3JW7A 3EGJA 1UWIA 2QJGA 4O12A 4W89A 2P3ZA 1WKYA 1PDYA 1P0KA 5CPSA 4PTNA 5LHEA 3N12A 2ZUVA 5D2YA 3UA4A 3MC5A 1SFJA 4XK2A 4P8XA 5HXMA 4IX2A 2FTYA 1B3WA 3DCPA 5G4WA 1JQVA 1F4HA 5C71A 1TX2A 3M44A 2V67A 3RCYA 4GY0A 3TH6A 1F8MA 3W24A 2H3BA 4MFDA 1QO2A 1DV7A 1V02A 1XCWA 3W2MA 3ZO9A 1QI5A 5BXTA 4PBGA 1AG1O 3BCFA 1EC9A 1XYCA 1KKOA 2FH8A 3CUIA 5A8OA 1JCJA 4PCNA 4MZ1A 3K4WA 2VC5A 3GDKA 2RKXA 2WC3A 1UKQA 1SUXA 4JFWA 2EKGA 3KUMA 2A3BA 3N11A 3RMJA 6REQB 3OBAA 4QEHA 4AEEA 1TWDA 3AALA 2PSNA 3LTYA 5REQB 3WD1A 1JF5A 3SUWA 4QSHA 3O0KA 3HURA 3QZAA 4J2MA 4LVDA 1UH3A 4FF7A 5HMSA 2EBNA 2H8XA 1FWJC 3BLOA 1DWHM 4QXIA 3EMQA 1W56A 3GZAA 4JFUA 3UXIA 1KFKA 4NX5A 5KZDA 2YFNA 1BGAA 2DP3A 1E0TA 3VDGA 3W81A 2CWNA 3EMCA 1QK0A 4XZIA 5AYZA 1NJJA 4RL3A 3MTWA 5F7UA 3UPWA 4D72A 4L6DA 2Q8XA 1IR1A 1QNQA 3EOSA 2ZX8A 1GYMA 1XYAA 2NWRA 3PBYA 1JUKA 1HO4A 1EUNA 5C9UA 4HTBA 1QPNA 4OZOA 1Q6GA 1ZJBA 1U5HA 3SCUA 1B3VA 4M5PA 2WAGA 2OLHA 3R12A 4N9EA 3FCPA 4A8RA 4JTAA 2OXNA 2V69A 5E9XA 2XFRA 1GJPA 4J35A 4LW7A 1TR1A 1K4GA 1MNSA 2JF6A 4TQTA 2PP0A 5DY2A 5AVHA 1TA3B 4BHYA 4DWSB 1PIFA 3P6LA 3S4TA 3JZUA 2PDFA 3L4UA 4QTGA 3MKVA 1S3HA 2WCSA 1JAEA 4BWLC 3UWQA 3V5CA 4CNPA 3VZXA 3TU9A 4JTIA 2OO0A 3PZNA 3N15A 1CTNA 3LRKA 4FR6A 3ZVIA 1HL9A 3NVTA 3T78A 1C3FA 2E6AA 3A24A 3O6CA 1EO5A 1EOMA 1QBAA 4WX2A 4DZ5A 3WLTA 3QPYA 1S38A 4KCVA 3QV7A 4JPGA 3PFRA 3P82A 2VZUA 2X7WA 3SCPA 2ZRVA 2GGIA 2X1UA 3AS2A 5I3DA 3KCLA 3QYQA 3CAVA 1PKMA 3QM3A 4FNQA 1EO7A 2QJMA 1GVOA 1LLOA 4YNGA 1RPXA 1TUXA 3V1PA 2FVLA 4PB4A 3GB6A 3MA8A 4O1EA 3EXRA 5DT5A 3PSVA 3BOFA 4S23A 1I2QA 1IT0A 4B5NA 4W8LA 2GJRA 3U57A 4TX8A 4JD4A 4PUJA 3NURA 2P5NA 1HO1A 3SCOA 1W1VA 1RLDA 3MP4A 2YLLA 3TNOA 4IPPA 4IIEA 3R7MA 1JI2A 4OVXA 4RZ4A 4LC6A 5IHSA 2GL5A 2VP8A 4PRRA 1BKHA 1LTDA 3SIMA 3ITXA 3QH2A 1TIMA 3CMFA 1JG9A 3FHQA 4KRUA 1WE5A 4XD5A 1CXHA 4PUMA 1BVZA 3RLGA 2ZBTA 2O9OA 2VENA 4RLIA 4K3ZA 4B5VA 2YB1A 4US5A 3UQNA 2OT0A 2QCNA 3PULA 2DZVA 3GZ3A 4JCLA 1GQKA 2ABAA 4Z2GA 5M2FX 3U6WA 4J2PA 3ZJ6A 2FYMA 3O6YX 3IIXA 5BU9A 2BMBA 4IUOA 4JTLA 2GJPA 2UY5A 4UXDA 5JVLA 3LN3A 1KNWA 1TZZA 4QSFA 3HJEA 5FEPA 2VC7A 4ZXLA 3VKBA 8CGTA 1OIMA 3E0WA 2X0HA 1JZ6A 2E8ZA 3CZGA 4TVUA 1VEMA 1HF6A 1TZ9A 4ZTXA 1JRBA 4WSHA 4I7WA 3GBDA 2A3HA 2GVLA 4RE0A 3HGRA 3MKCA 3ARPA 4KIEA 1G4EA 5CPQA 2G3JA 2I17A 2WZIA 3CL6A 3BL3A 1PZ1A 3OGSA 4S38A 3WBWA 3AISA 2OELA 3HF3A 1QW8A 4CN6A 3WIJA 2BWGA 4J9JA 4E38A 4NJKA 1J6OA 1YDOA 3RO8A 4LVFA 5LA0A 4PA8A 2F61A 3C2RA 3R6IA 4QRNA 1DPMA 1CT5A 3EXSA 3WJYA 4O14A 2CXGA 2ATSA 4DI8A 4DAFA 1MRQA 5KETA 1OGBA 3NJ3A 1HKKA 3S1UA 2QCCA 3B0PA 4CCEA 4ACYA 4JNYA 5AHFA 5F4XA 2Z25A 1JF6A 3WG6A 1KTNA 1XYBA 2BGQA 3KHDA 1OIFA 3PANA 3GDTA 3EBVA 1E1FA 1H1YA 4DBUA 2XH4A 3FYYA 5CPOA 1TX0A 2Z1SA 3G8EA 5J5DA 3AIRA 4P61A 2O7QA 1A0CA 1Y0EA 4HN4A 1Q65A 3W6YA 2IKIA 2G97A 1D8WA 2RDXA 3EWDA 4V15A 2GQ3A 5CJ5A 3UR7A 1EOKA 3I68A 4LCQA 4PTMA 3FK4A 1MUCA 5K9DA 1K9EA 5JBEA 3O7UA 4RNHA 1K9FA 4KFPA 1DWFM 5MHBA 1RPKA 3SJ3A 4WD0A 4UNKA 1UP2A 2VFFA 1OG6A 1MQQA 3D3AA 1REQB 3NXFA 3UZYA 4FS9A 2FZMA 5CCZA 5GQBA 5KTLA 1M03A 1WOAA 1R6WA 4K6AA 4QX4A 1V3IA 1RBOB 1SZNA 1W5NA 3O0FA 3O6DA 3WLQA 4WUIA 1DORA 2OG9A 3EDFA 3T0BA 1KBBA 3OJGA 4O1CA 3AIQA 2EJ1A 3R58A 3OLGA 4IPJA 1FHVA 3R2GA 2HE8A 4FMVA 3EKLA 1NU5A 3UWVA 2V0TA 4LEFA 5HBFA 2I9EA 1JZ5A 2ZYFA 4XV0A 4AH7A 1FWTA 4IJBA 5D2XA 1FKWA 2PD9A 4PL1A 3DZ1A 1HKIA 1TE1A 1XJBA 3SUUA 4BA0A 4AYGA 1VP5A 1T96A 1W0MA 4JKLA 3CV1A 4PTVA 3WNPA 4AY8A 2CKSA 3HPXA 4AHQA 2Y62A 1BYAA 2ADAA 2BY3A 3LPGA 3QMRA 1EHNA 4Y2WA 4Q3MA 4AW7A 3QQ0A 3VGFA 5FL1A 1OZQA 4WSJA 1O5KA 2QDHA 3W72A 3PZOA 4WY0A 3VCCA 2NLIA 4LF2A 4Z2KA 4Q7NA 3C5QA 4NZ5A 1J93A 3AHZA 3ARZA 4QJ5B 3CHEA 3IGXA 3UP8A 4JIQA 1W31A 4PN2A 5EFDA 5DCEA 3ABQA 2RH9A 3FV9A 1C8YA 1NF0A 5LKYA 4Y7EA 3AMDA 3KBWA 1IR2A 3QTGA 1VZWA 4HPJA 4YCPA 2DZSA 3NEHA 3F5LA 3GH7A 1ZQ5A 5D32A 2V8ZA 3T42A 4NNAA 2BODX 1V3JA 3R10A 2WJDA 3OIHA 3WDIA 4E6MA 4PL2A 4KMQA 3LU2A 3W7OA 5D02A 4ICMA 1US2A 4OOUA 1XYFA 2O9TA 3N9SA 4PCSA 4QJ3B 4GXPA 2W0UA 1KGWA 4BK9A 3WJSA 3WDPP 1F3EA 4PFMA 3DUGA 4RK8A 1JCMP 3L2IA 2ESCA 4PCPA 4XSMA 2D23A 3MO4A 1NARA 3GWQA 4Q8TA 4BF7A 1TJRA 1V02E 3CEPA 2QAPA 1DHKA 1W8GA 4LVBA 4B4FA 3NQ2A 3MJMA 3N04A 5CQ1A 3AZRA 1AQ0A 3G1YA 3MSGA 4D71A 3WMBA 5GNXA 1A5MC 3COTA 3NZ1A 2QCMA 5HQEA 1Q2SA 3C2VA 3L5LA 3N18A 3LHUA 4HU0A 5IM51 2VUNA 3MMTA 5D37A 1TPFA 3AMLA 3PBGA 2PWGA 4JAWA 3BJFA 1E6ZA 1QI4A 4GH3A 3L2MA 3QC0A 4KCUA 3BV4A 1UPMB 4HSHA 5HDRA 2QCFA 1U1JA 3XISA 1KXHA 2O7SA 2PWUA 2Y0FA 1UA7A 1BQGA 1IIGA 4BI7A 5LNVA 4EPKA 2EAWA 4B15A 3DIPA 2CLHA 2ZVIA 1R9XA 3DI1A 5A3HA 3H6OA 3M0MA 1CEOA 3NVDA 1JULA 2FFIA 3GW3A 3QY8A 4FEZA 4TTGA 5CAKA 3WK1A 3FVDA 4C1NA 3OA5A 2Y70A 5D9PA 5L6UA 5AC8A 4AZBA 3UJSA 3C0LA 4IMFA 3FS2A 1CNVA 4ZFMA 4O4VA 9XIAA 1KO0A 4FOKA 4XQ6A 1IF2A 2A3LA 3QFWA 1AW1A 3BCDA 5JIPA 3KBVA 2PDKA 1ZRQA 1AH3A 1TPH1 2PRHA 2VRQA 3S1GA 2WVUA 5HJXA 5KINA 2POTA 3TYAA 3M0LA 3TE9A 2Z0IA 3CWHA 3LBOA 4JNMA 4IJCA 2AAMA 3TMLA 5FAJA 1DQUA 3TSMA 4S1FA 3L4VA 4LNCA 3QRHA 3IV3A 4MADA 5F1VA 4IP4A 3AI0A 3ARSA 2WWCA 4UQDA 4WKHA 1AL7A 3VD4A 1V3HA 1AA1B 1R9YA 1YNQA 4BI5A 4HP5A 3S6OA 4BQ5A 1CI1A 4A22A 1S5VA 2ZRZA 2I56A 3LI0A 4R3UA 3B3DA 1PB0A 1O1HA 1UZDA 3HTWA 3NSXA 5BOEA 1PBGA 1W5QA 3FX4A 1EEPA 3RILA 4A4AA 3CH0A 3F2BA 2BHUA 3BGGA 4LYQA 4DJED 1YTKA 4LXFA 1SQ7A 2Q71A 4GYJA 1DTNA 2NV9A 4GACA 5XIMA 1CLXA 3TA6A 4B3ZA 2GDUA 3EAUA 5M1TA 2QYGA 5K9CA 4B9YA 2SFPA 4XG1A 4C1NB 2C71A 1SFTA 4NZJA 4Q8QA 1V8EA 2RGLA 4KESA 2J25A 2GFTA 4R7JA 4CNNA 1RJPA 5HNUA 2WM0A 3N2OA 3P74A 2WZTA 3IVTA 2AMGA 4MLJA 1DXIA 1QUMA 1RP9A 5JU6A 1POJA 3EKZA 3VVGA 2CU0A 4H04A 3UGVA 3KVJA 4H6EA 4JHMA 3T0TA 3W85A 2HMCA 2ZFAA 2ZX9A 4YTTA 1TPC1 1XUUA 3OEXA 2G3NA 4BEQA 4QNEA 4YYFA 2Y4SA 4OWGA 1UKOA 1J5TA 1XLMA 4PTWA 1NDYA 5E09A 1W3KA 3L67A 4MM1A 3BAYA 1LM1A 5J5RA 1XCFA 4PUUA 1ICPA 1F5ZA 4W88A 4L65A 1ADSA 1OCBA 5HWNA 3PPFA 4N4PA 1GVYA 1QNVA 2J6XA 2FH6A 5HOSA 2ALRA 2J7GA 4B16A 2R6OA 1X96A 3OZYA 2BX7A 4FIQA 2R9RA 1YDVA 1Z8AA 4K7YA 3E74A 1XQLA 5A8MA 1VBUA 3CV6A 2JKAA 2ZRXA 3RPTA 4L4PA 3UZZA 3MBFA 5I3JA 1OY0A 3HG2A 4H19A 4CD8A 1QOXA 5JXQA 1EZWA 2VGBA 2FGBA 4C6BA 1ONXA 4TXEA 2NW0A 2MANA 3VIPA 4DM2A 4TMBA 3W0KA 1TZ7A 1M7XA 5CAHA 4LBUA 2PBGA 1IZJA 2WSYA 4PSPA 1XRFA 4O1AA 1V03A 4ZOAA 2CHNA 3AXKA 4H7ZA 3H7RA 4Q22A 4W7WA 2F9RA 1UB3A 3AWNA 4DZIA 1KTBA 3P0WA 1HJUA 4O28A 3GC4A 3PZVA 3NL2A 4Q33A 3VGEA 5LA2A 4F0SA 2ISVA 4MPKA 3L68A 2Z27A 5D2TA 1FHLA 3ATYA 3IGHX 1ITUA 3VD9A 2YX0A 4LH8A 3LCIA 3B8VA 4ZB5A 1FWWA 2QS8A 3QV9A 4DI9A 4AHOA 3ZLGA 4KFNA 1W1ZA 3SCRA 4UTLA 4B5XA 1F6KA 2WNQA 2Y5EA 1ITCA 5FKYA 2ZRYA 1M41A 4X61A 3U2CA 1AODA 4GY1A 3N13A 2WPGA 2EPNA 5AYYA 1F7BA 4RXFA 4BKNA 4DJEC 1ISWA 4AWEA 1GVIA 1TMHA 2QNEA 3V5FA 1KV5A 4DLMA 1TUFA 3HQNA 1GOWA 4K1GA 3MSYA 2WNZA 3TXZA 1E5NA 1EJWC 2F7FA 1Q63A 1AQFA 1HJQA 2YIHA 3R89A 2Z00A 2XINA 3CT7A 1SR0A 3W9ZA 3S9YA 1C7TA 3N1AA 3B0UX 3KOXA 1XD0A 1QDSA 3W7KA 2G8ZA 4F0RA 4EAYA 1EGMA 1JPDX 7REQB 2ON3A 1KD0A 3WBYA 2XSAA 3EOEA 3PUEA 2PLMA 1KM2A 1ADOA 4NRRA 2OSXA 3PPCA 4LSBA 4UTFA 5CSSA 5C54A 2X05A 5CKSA 5ABGA 4LAMA 1TPVA 1UJQA 5CPMA 1VENA 4WOQA 3ZLHA 2FZ9A 1X98A 4AU0A 2P50A 1QPKA 3PUGA 1E0UA 3MKKA 1QMLA 3E5BA 4YCOA 2AKMA 1R2TA 5FA5A 2V2HA 1OFPA 2G50A 3SRKA 3ITCA 1W1TA 1V5XA 4L9ZA 3H12A 3OYZA 3V4BA 4AC1X 2F8QA 2OZ8A 3CQHA 1E4LA 1TR9A 2FVMA 3UA3A 4WJEA 4UTWC 2PUZA 3LY0A 4XZWA 1J01A 3TQVA 4AZHA 1P0NA 1AD1A 4GISA 3TMQA 1V0KA 3WLRA 1T99A 3T0AA 4IXHA 3WUGA 1OFAA 1UP0A 3ZYZA 2DGAA 2ISWA 1JD7A 3UPBA 4NXSA 3LGDA 3MHGA 5AY7A 1IWBA 3M9YA 4GJ1A 3WN6A 1SO4A 4WDUA 2V6AA 4O8AA 4ZE5A 4ZGYA 2PWVA 1J4EA 5HULA 4MTVA 1PTDA 3AIUA 4PUNA 2XU2A 3WQEA 3ZT5A 4A8NA 1Z48A 1N2VA 5AC7A 4HK7A 1JPMA 3NGFA 4TUFA 4BY3A 3F2DA 2QJNA 4QDWA 3TJIA 3IVUA 4FAMA 2OGJA 2J7EA 3ZFHA 2J7BA 2RHGA 3PG9A 1TVPA 4L9XA 2OVLA 2YA1A 2I5IA 2VEPA 5DCDA 4P7RA 1F3WA 1LQ0A 5EKYA 3ABSA 2ODOA 3S9IA 1FKXA 3DECA 3H55A 1GKQA 3GAYA 3M47A 5C9XA 1EFZA 1UHVA 2XPKA 4Y9MA 3MWAA 5CG7A 2D69A 2GLKA 2XVGA 4X63A 1ZBCA 1K7XA 4DZHA 4KEVA 4LU0A 5CBIA 1HKMA 3RJXA 3DFYA 1NTHA 1VPYA 2GQAA 3L4YA 2TODA 3VNDA 3BAWA 2XIJA 3H21A 1BG9A 1ISYA 4EPEC 3H4XA 2NXHA 1X38A 3QZ6A 1YPXA 5D2VA 2J8FA 3TDFA 1A5BA 4JIEA 2A6NA 3AYTA 4CCDA 5CPTA 4EKJA 1AD4A 1PZ0A 1QT1A 3PUDA 3V75A 3LOTA 3IK2A 4M24A 5TBOA 4AWSA 1BVNP 3UCCA 2VWTA 3CL7A 3AUOA 3ZMRA 5T26A 2C0AA 1YEYA 4FLRA 4HK5A 1C90A 3OHIA 3E2VA 4WDWA 4QITA 1ADDA 1BYDA 1E4IA 1VR6A 3A64A 3SCWA 2J66A 3VUSA 1GUVA 1KM1A 2HROA 3AJ7A 1KKRA 3L12A 3FW6A 5CZSA 3WJWA 2WBKA 1H51A 2DVUA 2FB2A 1GONA 1B1YA 1F3XA 3ABOA 3LHVA 1BWKA 4H8NA 5D04C 3UU0A 1M68A 3MO7A 1E5JA 1C29A 2G3FA 1YXCA 3FAWA 3PK7A 1TTQA 2PDCA 4CD6A 3GS6A 4WDTA 3LHTA 2VRKA 2BB0A 4GIAA 4TU1A 2DZWA 3VNYA 4OOZA 5CLWA 2Y2WA 1ZNNA 3G0UA 3QSRA 3UNTA 2GVEA 3VXGA 1XLDA 3S9ZA 4KWWA 1NWSA 1LT8A 1ODZA 2PGEA 3MUY1 4CNSA 1VFUA 2Y88A 4N6FA 1MDRA 3ZJKA 3ITTA 4ZEPA 3M1ZA 1J0KA 3SDOA 1W9BM 1VFHA 2WPBA 3FA3A 3P8IA 4GI4A 4IIFA 4R9OA 3HM7A 1FRBA 3S42A 1XDJA 3PZUA 3CAWA 4IISA 3MUXA 5DMNA 1LT7A 2XVKA 3B8SA 3WKZA 3GY1A 3RPMA 4ERAA 4L4LA 4P8VA 1SGJA 5K7JA 2DORA 1T0OA 1PJ9A 1JI1A 3KFTA 3P14A 3W2UA 4LYPA 4PB3A 1U30A 3NG3A 2AQWA 1JZ2A 4HD5A 1JR1A 1KR0A 5A6AA 2A7RA 4XD3A 1QI3A 3LHYA 1IXNA 3R13A 4WDXA 2PAJA 1YPIA 1QU4A 4MNKA 5FACA 1OABA 4F4RA 4DVOA 3PZQA 4RR4A 3W01A 4UZUA 1DJIA 3BTNA 3WH6A 1F73A 1GVEA 3EDEA 1PHQA 4ZA0A 4YJ5A 3P93A 3AUJA 2V3GA 1UMLA 2VEGA 1ZCCA 2CPUA 1S2VA 1D8CA 4UQAA 2WSPA 4WVXA 1F6YA 1FUYA 1TYGA 2O0TA 2PLKA 3D5HA 3TA9A 3T6CA 1PZ3A 3PM6A 1FBAA 4JN8A 1EQCA 3BW3A 1XD1A 4ADUA 1RQBA 4DXXA 1NDVA 4B9ZA 3EB4A 2EQDA 3BJSA 1PPIA 1RH9A 2OB3A 1I2NA 3O8AA 3IEBA 2C1IA 3QGAC 4QROA 1B3ZA 1F2JA 1GEQA 1KXQA 2OGYA 3OO2A 3P60A 1Q6CA 4Z08A 2YYTA 3B4YA 1TV3A 2WJEA 5KZ6A 2O9PA 4E2OA 4DJDA 4W93A 4IIDA 2PDJA 2FGLA 3GNDA 3IANA 1FWNA 2WNWA 2DQWA 3IIPA 4X2RA 3E2SA 4XKYB 4D1JA 3TKFA 2AKZA 1K8ZA 3LGEA 1K70A 5G2IA 1SSGA 4IJRA 2C91A 1NWRA 1V7YA 4JTSA 1XCXA 1L0PA 1YW1A 1LRTA 5ENLA 4XWUA 4RDVA 3UWEA 1PX8A 2H6RA 3W82A 4EX4A 2ACQA 3G1HA 4LUIA 3ITVA 3SUVA 1ALDA 1EJXC 2PWHA 2YXOA 3S47A 4B5SA 3B9DA 3TW6A 4KGJA 3S1XA 5FSDC 4ZE4A 4GD0A 3BC9A 2OKOA 4QLJA 3C0SA 5DQPA 2PDBA 5CJNA 5LSMA 2C6QA 3EDKA 3USZA 3LLDA 5FJRA 2DU2A 4U2YA 3P81A 3FYPA 1P0BA 1XUZA 2E68A 4BI6A 3UF9A 5LGXA 3KDNA 1J0JA 4DRSA 3MQTA 3WQCA 4GUJA 3UVIA 3QSTA 4C7FA 4WLCA 1OHLA 2EGZA 1G7UA 5AHMA 1UD8A 3IAPA 5AOUA 3GVGA 2QHAA 3GXPA 1H61A 2C18A 3O9NA 4HBKA 2PDLA 3SRFA 2RUSA 3DI0A 1WZAA 1OFBA 3FN9A 3KX6A 4NI8A 1R2RA 4JQAA 3USBA 4MB3A 5I2UA 4LC8A 1I45A 2VWSA 4A05A 3W26A 3W7EA 2D20A 3F4VA 3N14A 4N0RA 3W29A 4JEJA 1KW1A 1S2CA 3CC1A 1KM5A 4AWUA 4HA0A 2OMAA 3DFHA 3FFSA 3KWXA 4S3BA 3ITYA 4RNFA 1XLEA 4AF0A 5A8PA 4WOZA 1B2YA 2PS2A 1NOFA 2D1ZA 1B31A 3ALFA 4XUYA 1JPKA 2EJAA 1W9PA 4U33A 2WCGA 4YHGA 1V79A 1Q6EA 3P84A 3W27A 4K39A 4PMYA 3T0CA 2YOCA 4H4IA 1H7WA 3D6NA 4S2BA 1SZRA 4HMDA 2HDJA 3VDBA 1WDDA 3UR5A 4H2CA 1GW1A 3O63A 4NHVA 3WFAA 2WHMA 2PWDA 2PRMA 3BQ6A 1VJIA 2A4AA 1XX1A 1H0GA 5CSUA 1FH7A 4YU1A 1DJWA 3MW7A 5E0CA 4E4UA 3LXAA 3NQFA 1HVQA 1WAWA 3NM3A 2IW0A 5HNRA 3LB0A 2V3DA 4W5UA 3JRKA 1EQPA 5JQ9A 2YDRA 1OYCA 1GNXA 3BCJA 4JL2A 1QPRA 2G3IA 2E7FA 2GOKA 3GUWA 1O5QA 3UBPC 4TMCA 3WDJA 2VCAA 1HJWA 1W3LA 4IMCA 4IFRA 4PSRA 3V0TA 4AVNA 1XBZA 3KW3A 1FWIC 3N6HA 5GJMA 3PAOA 2O9RA 4HU4A 3VNKA 4XD6A 4X9SA 4GA8A 5E70A 2E67A 3VOFA 2BS9A 4LF1A 3E0LA 1E6NA 4AF0B 4KH2A 4ATWA 5D05A 4OUEA 3TX9A 3VFLA 3W28A 3PB0A 1XP3A 5RUBA 2ZZ5A 5G1TA 1RVGA 4IFOA 1Z44A 2QUNA 3C8FA 5AHIA 5IFPA 5XINA 1M6JA 1XIMA 3A4JA 3YPIA 5IXEA 4INFA 3ARYA 4B5TA 2PF0A 2X2GA 2YL9A 1FQ0A 2I5QA 2GK1A 3G6LA 4J7RA 1GJUA 1M01A 2NV1A 1KCZA 4IT1A 4PBEA 3FEMA 2J13A 6XIMA 1OT2A 4GI6A 3BAJA 2PZ0A 4U31A 2WBGA 4L1XA 4M80A 1VAHA 4HYRA 1I2OA 2NX9A 4ORIA 4IIHA 4JOMA 4R88A 3GHTA 3ANVA 4JQ3A 3MCMA 1WDPA 1TE6A 1E6PA 3VYLA 3G1AA 5KZEA 1IXPA 3C4UA 3IV8A 2PRLA 4M1RA 1H5YA 1HKVA 2QCLA 4HU8A 1LRQA 3QQWA 3AYVA 3I3EA 5G2HA 1HW6A 3GFXA 3H26A 5D9OA 2PDHA 1BYCA 4Q32A 1HTIA 3Q37A 5EU9A 3ES8A 1XRVA 3HPFA 2V5CA 4HQVA 1FP9A 3DG7A 1X1OA 3II1A 3M6DA 3LPPA 2QEZA 3NO1A 4AUBA 2I1OA 1WBHA 2AL2A 2W91A 4NZFA 3S2MA 2Y8UA 3A4AA 3R4IA 5AYIA 3L9CA 2WMJA 3QC3A 1UYQA 1KCKA 3QV8A 1B90A 4D6FA 3QLLA 3B4UA 3VKJA 1OF8A 3W37A 4G56A 3A3WA 4JY9A 3FJ6A 2VO5A 6PTDA 1JXKA 5U7SA 3WL1A 3BV7A 2QDEA 3H54A 5HUOA 2OSYA 2J8GA 4OECA 2GPTA 4A2SA 2WLYA 4DBDA 2VX6A 3APTA 5A6TC 3MUZ1 4A3QA 1TPDA 2Z7KA 4GBUA 3VMPA 2FGZA 1XG4A 3M0VA 1IE7C 4FNPA 3PBWA 3AHTA 2VX4A 3G1DA 4GZIA 2WLZA 3M7WA 1OINA 1Z6KA 3VUPA 2G96A 4DZAA 3WLMA 2ALDA 5HATA 4Q7BA 3BO9A 4XVEA 3K1GA 1HP5A 3G6MA 4GE8A 3OBKA 1XH0A 1R7OA 4GUGA 3TWBA 1SSDA 4L80A 4CEUC 1JEZA 2VZSA 4Z1CA 1K8CA 1OC7A 2VGIA 2DIKA 3BE7A 1CIUA 1EWEA 3WF4A 4QAWA 1ZBKA 5DMMA 1KRAC 3PZTA 1WDRA 4UFLA 3NPXA 3SQMA 3E96A 3GX9A 3ZLFA 3GO2A 3SW6A 4JIRA 1AMKA 1IEIA 3UJRA 4N9CA 1RQHA 4KFOA 3NYZA 5B7YA 1GT8A 2AL2B 1WO2A 1BXBA 3E49A 1ZENA 1XS2A 3T44A 1BKSA 2D3NA 4F48A 1QCWA 5ABHA 4JN7A 4D8LA 4MDPA 1E6RA 2JK2A 4MKVA 1XLKA 5J04A 5LXXA 3BOLA 2PTZA 4QEEA 2R1LA 4UTIA 3EZ4A 4KS0A 5EMJA 5F2IA 4LOCA 3VX0A 1PCKA 2P10A 3N2CA 5I7GA 2WKGA 4Q4SA 4LANA 1L9WA 3CAQA 4QCFA 2ZTKA 3SR7A 3KTSA 5H8UA 2NQJA 4MMWA 1J8VA 3GNRA 4JTEA 2WMGA 3I6TA 3E2QA 3PJWA 4G7EA 3DX5A 1D7KA 2WWDA 4NT0A 4EF8A 5KITA 1PKYA 1QWGA 4PMNA 4RNJA 3WQOA 4Y9OA 4BF5A 4EOUA 3DN5A 1UC5A 3WQ5A 4XKMA 2V5DA 1J18A 3WFLA 4QS6A 2VEKA 3A21A 1BVWA 1H3GA 1RD5A 3BH4A 4US5D 4IPIA 1F76A 2PCEA 1W17A 4UZSA 4AD3A 5DMYA 5FD0A 1I9CB 3BSHA 2CHOA 2XN0A 4DPQA 1YBQA 2IUZA 3RLVA 2PDMA 2G4JA 1XC6A 4WSKA 3E9AA 3STFA 2X0SA 3UG5A 1KGXA 3W74A 3KBJA 4I8YA 1OBAA 1VBHA 1M5WA 1LDCA 4S3FA 1WBJA 1W9UA 4O0ZA 5U4NA 3BMXA 1W9XA 3M5ZA 3GYEA 1DJHA 1PIIA 1ME9A 5T8GA 1SJBA 1GQLA 3LSBA 3Q45A 1KA9F 1Q6OA 1EP1A 2YZRA 1HKJA 1P1XA 5HR6A 1L6WA 2XGBA 1UR8A 4AEOA 1HIZA 3ZR6A 1QW7A 1GOKA 3CEUA 1W1B1 2QCHA 4M19A 2QMJA 4W85A 3PTQA 1XC4A 4NQ1A 2FDMA 1EJTC 1C91A 3UG4A 3WD4A 5HMFA 3BGJA 3DBNA 1MW1A 4G7EB 4GZJA 2Y7GA 4H41A 3GC2A 3UERA 3VDHA 1FX6A 4WCJA 4UTHA 1FDJA 5EBUA 1X7FA 3OGRA 3QMTA 3PSWA 5A6MA 2MUCA 3P67A 3AYSA 2O92A 4ZXOA 1E43A 5IBXA 1FOBA 1TJ0A 3B03A 1NY1A 4G2DA 4UMAA 2VZTA 1W3HA 1G6CA 3KBNA 2ZC1A 1EWDA 2YL6A 5E5CA 4CN4A 3URQA 3WLKX 2D2JA 1PWLA 1UR3M 3V0UA 4GABA 1WA3A 1W3JA 1CLKA 3JR2A 2YLAA 3A6OA 3M0IA 4IMAA 1AUSL 5LZLA 1SMAA 1S5MA 4TTUA 1WAUA 3W53A 5I6SA 1HKWA 3WLPA 3VM5A 4QAIA 3RMEA 1VFFA 1K8YA 1R47A 4JICA 3PPGA 2BXZA 2V5KA 1R38A 4CQBA 1QXLA 4NZ1A 1NWUA 3MU7A 3SN4A 2BVWA 4A6GA 1UWSA 4GQ0A 4AQLA 1MEHA 1XL9A 2DW7A 1OGGA 4N42A 3PY2A 4OFCA 3L4WA 3W6MA 1PX3A 5FESA 5FJJA 3B9AA 4AVOA 2DZBA 2TAAA 2DT0A 1OG0A 3VZZA 1GOMA 3AS1A 1FDZA 3UR8A 3N9KA 2HS6A 1ZJIA 4KEUA 3PF3A 3TW7A 4MF4A 1NOUA 1S5WA 3ARRA 3M41A 3TQKA 2X42A 1KQYA 2E4TA 3PFMA 4I3GA 1PX4A 3SADA 3QOKA 2P53A 2BASA 3T8LA 1M53A 3IJ7A 3UVAA 3NDOA 2FB3A 4CD5A 5M17A 4MNJA 3QQ1A 3T05A 4LS1A 4GQRA 3M0HA 4Z1AA 3S5SA 3UWYA 2CLOA 1CCWB 4WKAA 1E72M 5EMMA 3S6TA 3UFYA 4UQEA 3RR4A 3R79A 5C9ZA 4ZBCA 2CKRA 3B9OA 4HPXA 3NQVA 3P62A 4Z0JA 7CGTA 3VKAA 1IHIA 3BLPX 3P7YA 4GKLA 2EPKX 5DBTA 3WNNA 4IGSA 4MZYA 1JNEA 4GJJA 4MWAA 4NXKA 3BUVA 3WEMA 2YBTA 5MF5A 4YLWA 2TYSA 1VBRA 4RNIA 4URIA 2D3LA 3L66A 1EH9A 3OVRA 3DU0A 4FLOA 1QRQA 4GYPA 4HCDA 3SB0A 1RSCA 2VEMA 3K8MA 3IAQA 4R53A 2WXDM 1BEUA 1F9CA 1PE1A 1OGSA 1SZGA 2W66A 1QATA 1GOOA 3VOGA 1R46A 2CIPA 3AU6A 3F5KA 4F3HA 3K8KA 4J28A 1VJZA 3G3MA 4O52A 5JUVA 2CESA 1ZTVA 2PDQA 2VUYA 2BTMA 1B9BA 3KRSA 4W87A 1I4NA 4YTUA 3GYCA 2QQ6A 4FLQA 4PMZA 2WMKA 5KMYA 4N4QA 3KCJA 3D3FA 4WGXA 3WQFA 1G94A 4CGTA 1B9ZA 2BZNA 1MEWA 4LV9A 1DWIM 3M5VA 3OW1A 3H2MA 1I1XA 3GTXA 1I8JA 1QJWA 3W1LA 4RDZA 5AYBA 1TV7A 3FGCA 3PJUA 1C8XA 3P8JA 1LRNA 1FXPA 1Y5VA 2ZC8A 4IICA 1IEWA 1NIUA 3WQWA 5EBAA 2ZZ6A 1ZY9A 2Y8VA 4DWDA 4JQ2A 1TPB1 5JBFA 1Z3NA 4ACZA 2A1YA 1JDDA 3BW2A 2WSQA 3GNNA 5LIWX 3NCOA 4QE5A 4Q6JA 3KXQA 2QUMA 2B81A 1XLBA 4HPNA 3M16A 3H53A 3A47A 5AB3A 5C8BB 3GNOA 3IJQA 3QR0A 2VFHA 1IEVA 4AZGA 4JX5A 2NUXA 1AW5A 4P7NA 3WH8A 1EP2A 2CITA 2PLCA 2ISFA 2OX4A 4F9JA 4KWVA 4J40A 2LLEA 3DDMA 3VDCA 1VFMA 4HZ6A 4V1XA 1ZP4A 2CLMA 2DUZA 5EMYA 1MWOA 3U9IA 4LALA 5CC6A 3NZQA 3WLNA 4ADSA 4MJZA 4C6DA 2C3ZA 2OR2A 3IJLA 5DXYA 3RAOA 1E0XA 1XICA 1KM0A 3FGCB 1E1EA 2IPWA 3L0KA 3MANA 4HNLA 5D30A 2CNCA 3UGRA 4HOWA 2I7GA 2DSWA 3VD5A 4LX4A 1L2UA 2QJHA 1OD8A 2ZE0A 3HGJA 1XSJA 3WO8A 1XRSA 3UY8A 2FHCA 4YTQA 3W2KA 2YCLB 2OWXA 1RJRA 1BPLB 1GVSA 5ABFA 2DZUA 3U3HA 4BEUA 3VINA 1XFBA 2YCEA 4M82A 1FP8A 1UCWA 2QKFA 3WQPA 1TSIA 3LG3A 4LWWA 3BOXA 3LBCA 1ZSXA 2FQIA 2QZRA 1LBFA 4GQQA 3NUKA 2DZXA 4C6JA 2W3ZA 4L64A 3UWWA 3VU2A 3NR0A 3SQLA 3W00A 2V30A 4AZ6A 3DKJA 2QVNA 4JFTA 3T09A 2QCEA 1HNYA 4O4WA 1XYLA 2DT1A 1LUCA 2PDGA 1KFBA 5CC7A 4XAZA 1GKPA 2RFGA 2ZCGA 5DY3A 1O5RA 1HN1A 3NQMA 4RV3A 4MB4A 3KVLA 3MHFA 3PJXA 4QG8A 1HFBA 2I5GA 3DHPA 2BOGX 3CS2A 1V0NA 4GOAA 3CTLA 1JPIA 2YZ5A 1XV8A 4YN5A 2OLAA 4WEVX 1LBMA 4RDWA 1G4TA 3KP1A 4JTCA 4M6VA 4ONVA 4AAJA 2VD8A 1JZ4A 1BWVA 3OHMB 3WK0A 1U5JA 4MVAA 2XISA 3URAA 1DKWA 1ONRA 3E5PA 2CZ5A 4JGDA 1ZS2A 3CV7A 3DG3A 2VVNA 4HKPA 3WMLA 3CTTA 3Q2DA 4GVFA 5HPCA 4PFHA 4JTJA 3CUFA 5ABFB 4KWSA 3SEPA 5C0QA 1NFGA 3C61A 4QISA 4R9XA 3WBAA 3SZ8A 3NAVA 3RPDA 4Z2IA 2VKZG 4ZO7A 1O6IA 3OQEA 2H9AB 4E0CA 4P5UA 3UJFA 2W92A 5B80A 4U3CA 3GG7A 4AC7C 4IZGA 4M1BA 1UROA 5I23A 1EGZA 2Y6ZA 5I03A 3KRZA 5EMUA 1DWGM 1Q8AA 2QIIA 2WNNA 3BAXA 5F1UA 7TIMA 2REQA 1GGOA 3GIQA 2B7NA 5JIWA 4CNTA 2ZA2A 1LZOA 1E4MM 1OFDA 2VR4A 1L6SA 3EA3A 2DSZA 4O15A 4KETA 1S5NA 3N2BA 1KM6A 2OT1A 4WQ6A 4Y8FA 4LEQA 3VOCA 1OC5A 3N2TA 2AQOA 2DY3A 3TAOA 4LS2A 1KWKA 4W8AA 3W7NA 4H9MA 5DX7A 4KWUA 2XIMA 3ARXA 1E9LA 2WSKA 1PTGA 1EGVA 1SFSA 1NOWA 4WF7A 1KWGA 4FOJA 1UR0A 2E9LA 5LIUX 4GVGA 2OOGA 3ZQ9A 3BG5A 8XIMA 2OZ3A 4RE3A 4UMCA 1B5TA 2DFAA 3IJDA 3OOQA 4NZ4A 1QW9A 5DRIA 2XJ7A 1L6FA 4NYUA 3OLIA 1TVNA 1YPFA 2FTPA 4YVXA 1M3UA 3VZYA 1A47A 3LNPA 3U5UA 4AZCA 5C2GA 1JGMA 2NQLA 4KRZA 4HMCA 1AH0A 4QJ1A 2CLFA 2DH2A 4KBXA 4X22A 3MV11 1NP0A 4PEKA 1RALA 3ZJ8A 1A4MA 5G1YA 1JFHA 3QTPA 1DE5A 1KC7A 3R8GA 1XPGA 5JMUA 3RLUA 4HA4A 4ZR8A 2Z4GA 3CHCA 3GU1A 4H9TA 3T4WA 5C55A 3T0DA 1EEXA 3W2NA 4UTMA 2ZX6A 3W76A