5T26A

Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
293
structure length
292
Chain Sequence
HMFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic, Spectral and Structural Characterization of the Slow Binding Inhibitor Acetopyruvate with Dihydrodipicolinate Synthase from Escherichia coli.
rcsb
source organism Escherichia coli o8 (strain iai1)
molecule tags Lyase
molecule keywords 4-hydroxy-tetrahydrodipicolinate synthase
total genus 108
structure length 292
sequence length 293
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2016-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5t26A00
4N9DA 4O13A 4QSHA 4WD0A 1WV2A 2Y85A 3NR0A 3BLEA 1OX4B 2ZA1A 3FA5A 4UNLA 2EF9A 3CPRA 3FYOA 4UTJA 2JBMA 1KLYA 1P1XA 1PV8A 4Z0JA 3CQ0A 4K7VA 5AHLA 1OYAA 4JTJA 4N6FA 1MEWA 5CKSA 4PL2A 2DZSA 4RXGA 2QUVA 1A5CA 4AXKA 4DF2A 1F05A 2O7SA 2CZDA 3CEUA 4GUJA 2F84A 4AMAA 2Y7GA 4AVFA 4BWLA 5J5DA 1THFD 1FWNA 1G4EA 3H55A 5HINA 3EXRA 3C4UA 4GFSA 1TPB1 1V7YA 2YR1A 2J9YA 1ZNNA 2ZBTA 4JTHA 2V30A 2NLIA 2PRMA 3LTSA 5AYXA 4ZQRA 2G96A 3G1AA 3LV5A 4M6PA 2V2HA 4KWVA 2QJIA 4IWWA 4JGDA 4Z08A 2A0NA 3G18A 3T40A 4R53A 3N34A 3UD6A 4LS0A 1PVNA 3NL3A 2ZRZA 3T44A 4UUIA 4ZQNA 1VYSX 1OG0A 4A3UA 3EX6A 3P5YA 3THAA 1SPQA 3KVMA 4UTTC 3NM1A 5U4NA 5BRBA 3W7NA 2W0UA 2QCGA 2G95A 5G2HA 2X1UA 5D38A 1MSSA 1KBIA 5I3HA 3C2EA 3QMSA 4POCA 5A8GA 3BGJA 2JGYA 3HO8A 4NNAA 3MJYA 1UUMA 4P2VA 2OCZA 3G1SA 4K39A 4NZJA 1SW0A 1AW5A 3JR2A 1T96A 3LCWA 3ZS4A 1WYIA 4LU0A 4DPPA 4JYFA 1W5NA 2Y62A 4XKYB 4NJKA 2CWNA 2YXGA 3TA6A 1IIHA 1GQNA 4MJZA 4A2SA 1DQWA 2A4AA 1LM1A 3W74A 2CW6A 3NZRA 2X1TA 3L0NA 3WJWA 1JR1A 4PCFA 3TC6A 2ZZ1A 1GTEA 3T55A 3G1YA 3IV3A 4EVZA 4FIQA 3EWZA 4N9BA 5EYWA 4O57A 5FF2A 5LHFA 5KINA 2NUWA 3W1RA 4JTEA 1YLVA 5HUPA 3E49A 1WQ5A 4YL2A 3PS7A 3T4CA 4DELA 1LBLA 2DZXA 1LORA 2Y63A 3VNDA 3B0PA 1F6PA 2NXIA 3W1NA 1MEIA 2J6XA 4R34A 5CPLA 3T7VA 3N2MA 4RLIA 3KX6A 3BGGA 4WJEA 3DHDA 2ZFAA 5DCBA 3W9ZA 4OE7A 5D2WA 3W1QA 4LVAA 5BNKA 2QAPA 4MKNA 2QAFA 1EUNA 3TU9A 3CTLA 1WOAA 3MMTA 1F74A 2ZRVA 4UR8A 4HNNA 1WX0A 3M7WA 2C3ZA 5D03A 1G67A 2V2DA 4A2RA 2VKZG 3TDFA 1SZFA 4GE8A 1AK5A 4MY9A 3IIOA 3Q94A 1LROA 3W1AA 3ZR4A 3ZWTA 3L2IA 5K9XA 2A2IA 2OT1A 3M41A 2V81A 1EP2A 4JX5A 4UFKA 3O6YX 1F5ZA 1I2OA 3STGA 4ZVJA 4AWSA 2Y89A 3MBFA 3LCXA 5EA9A 1Q6OA 2DZTA 2JKAA 3LCLA 3FKKA 1H1YA 1QFEA 4CCCA 2C16A 5D02A 2EKCA 5AB3A 3SY5A 3MHUA 4M5PA 2YGYA 1KM1A 3MP4A 5CGQA 2ZTKA 4LC8A 3B8DA 5FEXA 5C2XA 4MVAA 5ABTA 4Y9AA 4NJHA 1DKWA 2VENA 4WZHA 4BI7A 5AC8A 1XBVA 4S2BA 7TIMA 4MZYA 4HSNA 1DBTA 3P74A 3LOTA 3W7DA 2GJNA 4IXXA 4HNTA 1XL9A 3C2RA 4XKYA 3KVJA 1TJPA 3D0CA 2TMDA 2ATSA 5DXYA 3E9AA 3RNDA 4B5NA 5AC7A 3P62A 3NQ2A 4MYXA 4RCXA 1JRCA 2ZZ4A 4OBTA 2QUTA 4WX2A 3L5LA 4FNRA 1MEHA 4G1KA 3DKJA 4Z1AA 3GK0A 2TYSA 1DHPA 4K7YA 3GVGA 4EF8A 3W1MA 4AHQA 4MYAA 4HKPA 1JVNA 1PL9A 5D32A 4CQ9A 5CPOA 3W83A 4XUGA 1K7FA 1LLWA 1EWEA 3MUXA 1RQHA 3LI0A 1T8XA 3PBWA 5CSRA 1R2TA 5BMXA 2YPIA 3IIXA 1ICSA 2E5DA 3PB0A 2AAMA 4Z0SA 1NEYA 1B57A 1XBYA 1S5VA 1X7FA 3LDVA 1MXSA 4UFIA 4MZ1A 4JDYA 1CI1A 4NQ1A 2GQ9A 3GLCA 5KTLA 4UFLA 5AHIA 3Q2DA 1A5BA 1M6JA 1BKSA 4JS3A 3N2XA 1YDOA 3CEPA 3K30A 3CB8A 3P8IA 4QISA 1XKYA 3WJXA 3LLDA 3PUEA 3FOKA 4JX6A 3S9YA 2PRHA 3PM6A 2GOUA 3B0VC 5LNWA 3C56A 4UTLA 3TE9A 2B7PA 4QQ3A 4AHOA 3QH2A 4UFMA 3UXAA 1OX6A 4GUGA 1X1ZA 2B7QA 2DORA 5EBUA 4JTKA 1G6CA 1LOQA 3IIPA 1W8SA 4JY9A 4E2BA 1JCYA 3HB9A 3SECA 1VC4A 5D09A 1QPQA 3S5YA 2QEZA 2ABBA 2YW3A 2VEMA 3ABQA 4E0CA 1UCWA 2I9EA 3LBMA 3M44A 5LNRA 3OIXA 3PR2A 1SZNA 1I2QA 1LLZA 3LHTA 2BZNA 3P80A 2C14A 3P5ZA 1TV5A 3MI3A 3NQMA 2NX9A 5F1UA 5H2ZA 3O05A 4U4MA 1PCKA 3UQNA 4CLMA 2QJGA 2WQPA 3W2UA 2Y70A 3LRKA 3W2MA 1FCVA 2JKPA 2NX1A 1ZJIA 4IMCA 3NQ8A 2WOQA 2TSYA 2H6RA 1X6UA 3U6WA 3E12A 2E09A 4JTSA 3NEVA 1JUBA 1TTJA 4RZ5A 1BWKA 1O95A 3M16A 3HPXA 2J9ZA 4HHPA 1KM3A 2Q8LA 3OEXA 3BK0A 1RR2A 1JCMP 4R33A 3NPVA 1W5MA 4JTFA 2QUUA 3GR7A 4NJIA 4LTSA 3TX9A 3W1LA 3BPWA 4O16A 3G22A 3BO9A 3FFSA 1GZGA 2CZEA 4ZQMA 1HTIA 3NOEA 1IXPA 3MI6A 3QZEA 3NYZA 1N55A 1EEPA 3EB2A 1TPDA 2A7NA 4FHAA 4JD4A 3ABRA 3BLFA 1EPXA 5HQEA 5D04C 5CZ0A 4FO4A 1WDWA 4FX8A 5LKYA 3DFPA 3W7HA 2V8ZA 1V5XA 5CG7A 1K03A 3A5FA 3W2KA 3ZFHA 2C18A 1GG1A 1YYAA 4UTMA 4RV8A 1XUZA 3S42A 3W6YA 4LVDA 2E5BA 4JN6A 3W1TA 1W5PA 1LCOA 4OU1A 4YCPA 1SZGA 1H7OA 5A5WA 2C1HA 4FXRA 1GVRA 1E51A 3C61A 3F1QA 1C9DA 3LCFA 2J9XA 3RLUA 1RQBA 3I7SA 4LUIA 4GBUA 5AC6A 5L9FA 4JNMA 1FY6A 1C29A 3UYCA 2EGZA 3IGSA 4BI6A 3CU2A 3NL2A 1M5WA 3FLUA 3W70A 3GR8A 1GG0A 1QPRA 1SW3A 2QCHA 4LOCA 1SFLA 1TRDA 3I68A 1QAPA 3W7PA 3G1XA 3L9CA 5HJLA 5F2MA 3R13A 1I2NA 3TCEA 5DCEA 4Q32A 3NM3A 1KLZA 2OT0A 3LHYA 4PODA 2XN2A 1YXYA 4GNJA 3ABSA 1QDSA 2V5BA 1NFBA 3LCGA 4ORMA 3PF3A 4DPQA 2YW4A 3NL6A 3S8HA 3FIGA 3O15A 3GYEA 3GNDA 1QPNA 3RU6A 4M6QA 1DORA 4XBKA 1K8YA 4LWWA 3PBYA 3TQ0A 3C2VA 3MBDA 3W1PA 5AHEA 3LLFA 1YTDA 4FEZA 4PFMA 1FWSA 2CFFA 5EY5A 3M5XA 1L9WA 2WNNA 3GXNA 1OF6A 3GXTA 3TJLA 4JTUA 1P0NA 1ZAJA 3QRHA 4BI5A 3R2GA 3C0JA 3HMJG 1D3HA 1T0OA 1OHLA 3P60A 1XUUA 1TREA 3PAJA 3S1XA 1KM2A 2Y88A 5LSMA 4X9SA 1EB3A 5C55A 1VHNA 1JCNA 1H7RA 3IEBA 3L66A 3GIYA 4D2JA 4TO8A 4P61A 4N2YA 5HUOA 3W7QA 1ML1A 4JTTA 3W7GA 3DU0A 4NT0A 1OYCA 2RH9A 2G5WA 1LTDA 3VCRA 5HWJA 1SU5A 1K3UA 1ICQA 1GEQA 3QMTA 3NQVA 4RKAA 4JR5A 3NGJA 2GQ8A 4HN4A 1VGAA 2B7NA 3L68A 1VCFA 3KHJA 1FX6A 4L4LA 3C3NA 2FDSA 3UPBA 1H60A 3TQVA 5G1YA 2Z1BA 4K36A 2A85A 2VFDA 4NZFA 1W3NA 3NDOA 1F76A 3DZ1A 3O06A 1R46A 4ZL1A 4IUOA 3DHFA 1VZWA 2RKXA 5D37A 1TPEA 4FNUA 3VFLA 3P67A 3P61A 3STCA 1W56A 3JRKA 4IX0A 1EIXA 1G4TA 4GJ1A 2NUXA 3TSMA 4E38A 2H3BA 3QFEA 3LRMA 2DU2A 3MHFA 2OX1A 1PS9A 3W85A 2AGKA 3I6RA 4O11A 1YTEA 1KFJA 4JTGA 1OFEA 5CZJA 3FEMA 3R12A 4AWUA 3WFAA 2ZZ5A 1X8FA 2AQWA 3A5VA 3M6YA 3HBLA 1K7EA 3G1DA 2W79A 4FF7A 1HO1A 3PULA 1N7KA 1LP6A 3QC3A 4FX6M 5SWUA 4WOQA 3CIXA 5EMUA 5DCDA 2YYUA 3YPIA 3UWZA 3PY2A 4AWTA 2ISSA 1ZALA 5BW6A 1R2RA 1GWJA 1WBJA 1D9EA 1NF0A 1ONRA 5LNSA 4EWND 3EWWA 6ALDA 3UY8A 3W07A 3UWQA 2CLOA 3W7CA 4X2RA 1KM4A 3O16A 2ZA2A 3BARA 4UIOA 2YYTA 1EP1A 1OFPA 3NPWA 1ZCOA 1CX9A 1TPUA 3QQ1A 4CNOA 1W5QA 2NX3A 3B04A 4LVFA 4HNUA 2F7FA 4Z1BA 3M47A 1O5KA 5EL1A 4IJBA 4TMCA 5HR7A 4ZQPA 3TK7A 4IMFA 5GVJA 1K7XA 3GNNA 3EX3A 2J24A 1LRTA 3O63A 4QNEA 2NWSA 3HJZA 2VFFA 1OJXA 3DKLA 3E96A 1Z48A 3UWUA 1AL7A 2DZVA 3F03K 1KFBA 1LBMA 1OFDA 2C15A 5LGXA 4IPIA 2ATMA 5C6MA 1S5WA 3UWWA 3BV4A 3STEA 4DEFA 1ADOA 5G4EA 4NUWA 5TIMA 4K8EA 5MHBA 3BG3A 3BLIA 1GPWA 2QCDB 2DJXA 2ISVA 3G1VA 5HULA 3SGUA 4C1KA 2A7RA 1PHWA 3WJSA 5DY2A 3IRDA 2XFWA 3F4WA 4O18A 5HMSA 2ZYFA 1JCXA 2Y7DA 4LUJA 2R94A 4RX0A 5FEWA 3W1XA 1O60A 1BEUA 5K9CA 5T26A 2HMCA 2YFNA 5KSWA 3L0KA 5D30A 2QCNA 4JICA 1Y0EA 3HG5A 1TPVA 4DXVA 3UPWA 5I3KA 4RZ6A 3N14A 4S2CA 1FXPA 2VFHA 3BW3A 4EIVA 3KRZA 4GRSA 2WJZA 1SQ7A 1ICPA 1EP3A 1SUXA 2BSLA 3QSTA 1TCDA 4LVGA 1OFBA 3TW6A 2DZPA 3TV8A 2YDAA 2A6NA 5HWNA 1TPC1 1ZHAA 5IM51 1NSJA 2A5HA 1GT8A 2V5LA 2VEKA 4XWUA 2I1OA 8TIMA 2FLIA 4HPJA 2A21A 1FCUA 4Y96A 3I65A 4FXSA 2FQIA 1UBSA 3N19B 5FESA 1ZAHA 4RK8A 3S5OA 4Y8FA 3QF0A 4AF0B 3IVTA 1VRDA 1IXNA 3HG4A 4MFDA 2VXNA 4N02A 3W87A 1W3IA 1PCWA 1B4EA 5CPNA 3FJ6A 1SSDA 4MFEA 2J88A 1TV7A 2CLLA 3PG8A 1SSGA 3ELFA 1FWWA 1I45A 4PH6A 2TRSA 3NQDA 4O1DA 3OVRA 3RMJA 5F4XA 3PWAA 1RV8A 3M1ZA 1B9BA 5D2YA 4A22A 1QNVA 3GKFA 2ZTJA 2Q3OA 1S5TA 4O17A 1WAUA 1NF7A 4AH7A 1JCJA 3G8EA 2CZ5A 1ME7A 4K37A 4O14A 1R2SA 2QCDA 2ZCGA 1LOSA 3LHZA 3W23A 2QKFA 2A1YA 1XI3A 2FPTA 1FDJA 3BVJA 5F4WA 3H53A 1KV5A 4H6KA 2NZLA 3C2FA 1DV7A 4JYEA 1NAL1 4OQVA 1FXQA 2ABAA 4HSOA 3TUUA 2CLHA 4GWEA 3SI9A 1KTCA 1XDLA 3O8AA 5KITA 1VQTA 1VH7A 2JK2A 2H3DA 3LXBA 1Q45A 2R8WA 2V82A 3PC0A 4FNQA 3VKJA 1TRIA 1B3OA 3PB2A 1QWGA 3DENA 4Z1CA 3DAQA 3O6CA 4WY0F 1QMLA 1P5BA 1YADA 1I8JA 1DOSA 2C19A 2P1FA 1LZOA 2Z6IA 1G4PA 5AYZA 3EX2A 1G7VA 4NX5A 3SFKA 4A29A 3TKFA 4MZ8A 1LDCA 3DFNA 3IIZA 5FF0A 1JUKA 3WK1A 3BG5A 4BK9A 2VFIA 4YCOA 3P82A 1GVQA 2ZRYA 2B0MA 3HGRA 2Q8ZA 4ALDA 2Y61A 4LT9A 1W1ZA 4NU7A 2HTMA 2WNZA 2FJKA 3W1UA 3W22A 2E6YA 4AF0A 1TMHA 3NNTA 2BX7A 1RVGA 4O1CA 4UR7A 1RZMA 3GDTA 4OGZA 3VI2A 4GC4A 3SR7A 2CU0A 1LRQA 3BG9A 1FBAA 2A6LA 5HR6A 1WOBA 2FPVA 3GAYA 4NJJA 2E1DA 3L5AA 1KV8A 2ZRWA 3WK3A 3TH6A 3G0UA 4M6VA 2ZZ7A 2BLEA 2Z0IA 2H90A 1TQXA 4JIQA 3W7JA 2E5CA 1AW1A 4UMBA 3DXIA 4H4IA 3EX4A 2J27A 5E93A 3L0GA 3HGJA 3NPXA 3P84A 2X1SA 5DELA 1XC4A 1GTHA 3FYPA 1H1ZA 5D2TA 1H61A 2ZRXA 4NNCA 4O12A 5KZDA 3CIWA 4NNBA 1H7PA 2P10A 2Q3RA 3OVPA 4WXZA 1TTPA 3AO0A 4MJMA 1FDZA 1XBXA 2QF7A 3UY7A 3N9RA 2QDHA 3LV6A 2RDUA 2XN0A 1W54A 3DH7A 1QR7A 1FCBA 1H7NA 3R89A 2VELA 2WSQA 3ZWSA 1TO3A 2I14A 1OFOA 5I3GA 2LLEA 1TYGA 1H7WA 2ZZ6A 3S1WA 4LW7A 5DN1A 3VE7A 3O1NA 4X22A 3USBA 1SO5A 3LXCA 1T99A 1VR6A 1IIGA 1TPWA 4LS2A 3AJXA 3F4NA 3S1UA 1TB3A 2QCEA 1XM3A 3CLMA 5LZLA 3EXSA 5I3IA 1QCWA 3RF9A 3TMQA 4IXHA 1JQXA 3BW2A 4IGHA 3T78A 4AHPA 4UTWC 5C54A 5FI8A 4DBEA 5KMYA 3W3OA 4UTKA 3A9IA 2P0OA 3PUDA 4DO6A 2CLFA 5J5RA 5KZEA 1U5JA 2PCQA 1TIMA 1KM6A 3NA8A 4IQLA 4PA8A 3RK8A 4CCDA 4OWGA 5CSSA 2G97A 1H50A 5G1TA 1IXOA 4AEOA 2NV1A 1W0MA 2DJLA 4UC5A 3S5ZA 3I7RA 5DLCA 3EKLA 4MOZA 1JULA 4RR4A 4GUFA 4UTUA 3W84A 1GVFA 4Q4KA 1SO4A 3UWVA 6TIMA 1VJIA 1XCFA 2HS6A 3QYQA 4N4PA 1TTQA 5F2IA 4ML9A 3OG3A 3GB6A 4ZQCA 4WUIA 1UB3A 2RHGA 2FPYA 1J2WA 1GVSA 3DI1A 3IGUA 3L21A 4TR9A 1ZY9A 4CQ8A 3W7LA 2BXVA 4TMBA 2CLIA 1RD5A 3Q58A 4LV9A 3KVKA 4O0KA 4UNKA 3ATYA 4JEQA 4L4MA 4IMDA 4NVTA 3WK2A 4YXGA 2DZWA 2TPSA 1Q6RA 2YZRA 1EUAA 5LHEA 3KRUA 3W75A 3E0IA 4O10A 3TAKA 2QJHA 1L2UA 3QPZA 5AYYA 3C2OA 4N9EA 1FUYA 4QAIA 3A21A 5CZTA 5E0KA 4S1FA 3NPUA 3PBUA 3V75A 3W7OA 4XZ9A 3G24A 1P4CA 2B4GA 2ZRUA 1F73A 5G5IA 1H5YA 4UTWA 1Z44A 4RXFA 2E6FA 1VCVA 5L6UA 1HL2A 1HO4A 3HGSA 1KBJA 4H3DA 2UV8G 4ZQOA 5AN7A 3B06A 1SW7A 4LRTA 3FKRA 1VS1A 3TROA 1A5SA 4UTIA 1AG1O 4OT7A 1KTNA 1A5AA 2R91A 4NXSA 3ABOA 3MP5A 3S6DA 2Y7FA 4JY8A 2V9DA 3B0UX 5DBUA 3G1FA 3NG3A 2EAWA 4N9CA 3DGRA 1LBFA 2ISWA 5DY3A 3DFQA 3TSDA 4UTTA 1KFKA 3TQKA 4GUHA 1DVJA 2Z2UA 5FF3A 1EX5A 1MO0A 3A22A 2PC4A 2OZ0A 4I7WA 4LS1A 3TC7A 1DJQA 1CW2A 1LRNA 3NVTA 1JCLA 2DP3A 3W2NA 3GXPA 1G69A 4J9JA 3QSRA 4PC8A 3LXAA 4YWIA 4BR1A 3HG2A 1I2RA 4FNSA 1J5TA 4TIMA 4LRSA 1X1OA 5TBOA 3SZ8A 1J4EA 3TFCA 5F2GA 3W73A 3GDRA 2C13A 1QOPA 4A21A 3C52A 1MZHA 3PUOA 4IMGA 5HWMA 3E02A 5EKYA 4Y6GA 3M5ZA 4Q33A 3MW7A 4TX9A 3NQ7A 4LNYA 1YPIA 1SO3A 4MUZA 1OYBA 3LRLA 4NJGA 3TXZA 2HS8A 2YSWA 1GVOA 3TXVA 5BMWA 4QM1A 3HGOA 4GXMA 5FEPA 2H8ZA 3CWOX 5AHNA 1G7UA 3NZ1A 3LERA 2A7PA 3LGEA 1KW1A 1IXQA 2B7OA 3P8JA 3MP3A 1EA0A 4MLJA 4M19A 1KTBA 1RPXA 3G3DA 2VFEA 3P81A 3QJAA 1HFBA 1YPFA 3OHIA 3KOFA 2ZQ0A 4DO4A 4LV4A 3RLVA 3SW6A 1UJPA 3TAOA 1WBHA 1DJNA 4MY1A 5F2LA 3UNDA 4MIMA 1Q6LA 3G3MA 4UXDA 1W31A 2GQAA 3TSBA 3W7RA 2QR6A 4UMCA 4XTDA 1YXCA 2YFOA 1SR9A 1D3GA 4PL1A 3TFXA 1JJKA 4BFAA 1F7BA 1I4NA 4JXCA 1KM0A 3HPSA 1XBZA 3NL5A 3W7IA 3B03A 5KZMA 3LBCA 3HOJA 4UTHA 1TQJA 3W7MA 2WO5A 5IBXC 2CLKA 2JKEA 2Y7EA 5FEZA 3QW3A 2DZUA 2BTMA 5EPDA 1A53A 3GAKA 3I7QA 1G4SA 1ZENA 4O53A 1OF8A 3IVUA 4ONVA 2YCEA 3L67A 4HT3A 5D05A 3PSWA 2O7QA 1YTKA 1TV8A 3V1PA 1BTMA 4K38A 3IIVA 3U8GA 3KAOA 1RQEA 3NQ6A 2KZHA 4XBSA 5LNVA 1AW2A 3LHWA 3M9YA 4O1AA 1L6WA 4JIPA 5F1VA 2D73A 1ME9A 3PVFA 2PURA 2WSYA 3Q37A 4K8HA 3GDKA 4WOZA 2WNQA 2QCCA 3LCIA 4MPQA 1S3HA 5E1QA 3EX1A 3QMRA 1P0KA 4XTIA 4CCEA 1EWDA 4KFPA 2FB2A 4RJEA 3HPZA 1OFRA 1FWTA 2V0TA 1VLIA 3EWXA 5H91A 3PG9A 4QITA 2QCLA 2QDGA 1VLWA 3W72A 2GVGA 1Q6QA 5K2ZA 4IX2A 2W6RA 4TU1A 1KFCA 5LGZA 1SO6A 4ORIA 1F2JA 3M5VA 5TQLA 4X3ZA 3CM4A 4O52A 3GDMA 3DFOA 3R8RA 2FB3A 5AFDA 3CWNA 4CNNA 4DO5A 1W5OA 1UASA 3JS3A 5G2WA 4O1BA 3HF3A 4ADUA 1LYXA 3R5EA 1N8FA 3NQGA 1ZFJA 4O8RA 5C5YA 3NQEA 4QNWA 1QPOA 4KFNA 2FIQA 4O19A 3HG3A 4O0ZA 4DBDA 1W37A 4BWLC 3NO5A 4O4WA 3W88A 4EOUA 2NXGA 1OVDA 3LB0A 4OHQA 3CHVA 3UWYA 4CQAA 1F6KA 4FX7A 3INPA 3GZ3A 3DFTA 2GVLA 1KA9F 4DQWA 3G8RA 1WXJA 3HIJA 3GDLA 1Z41A 4ZZ9A 3ATZA 1W3TA 3N3MA 1JQVA 4R7JA 2WKJA 3B4UA 3UZ5A 1YDVA 3LX9A 3W7EA 4KFOA 4ICNA 1TPH1 1OABA 1XDMA 4E2DA 5CPMA 1SZEA 4Z1DA 1M7OA 2ZA3A 1I2PA 3OBKA 3PSVA 1TSIA 2HSAA 3VE9A 4CNPA 2RFGA 4JYDA 2GJLA 2C6QA 1KFLA 1KFEA 5FF7A 3DI0A 3NQCA 2VC6A 1VYPX 1A50A 1YXDA 2FFCA 4UFHA 1H62A 1AL8A 2OJPA 1H7XA 4O4VA 1HG3A 3NQFA 1K8XA 2VFGA 3FS2A 4WY0B 3STFA 2EHHA 3H54A 4FIRA 1C8VA 1XFBA 2CLEA 3O6DA 1PHQA 2Y6ZA 1GOXA 2X1RA 1FDYA 1Z42A 1OFAA 2XN1A 4ADSA 1QO2A 2VEIA 1B4KA 2QCFA 4UCGA 3P7YA 4QIUA 1ALDA 3MWAA 5K9DA 1O5XA 1L6SA 3LHVA 4I9AA 4QJ1A 4Y90A 3KRSA 1PIIA 5F4SA 4YMZA 3EWYA 5BOOA 3QM3A 1TPFA 1M7PA 5G4WA 5I3FA 3WJYA 3LTYA 5LNUA 1JRBA 4U28A 4AAJA 4OV4A 4EF9A 4XQ6A 3EWUA 5K4XA 3ANYA 3U2OA 4JTLA 4DF1A 4IMEA 1SFJA 2ZDRA 3LHUA 3DFSA 5U7SA 3W2JA 2FTPA 3LM7A 1K8ZA 1TTIA 3QEZA 1U83A 5FF4A 3N9SA 2BWGA 1XXXA 3N73A 3M5YA 2IQTA 2V2CA 2RDTA 3EWBX 1R30A 4LC6A 4O28A 2X30A 1ZAIA 3MYOA 5AHFA 3LCHA 5HNRA 4N6EA 2CLMA 3PBVA 1WA3A 4PTNA 3C8FA 1H63A 4MLRA 4W9TA 5AOUA 2JGQA 1DL3A 5D33A 3LTPA 2VOMA 2VEPA 3TW7A 3OA3A 3QPYA 4JX4A 1YDNA 3SIZA 1IF2A 3KFTA 4GUIA 2E68A 4YLWA 1JUEA 5CZSA 4N4QA 4UFJA 3TR2A 3THQA 4IPJA 2NXHA 3NAVA 4BF9A 3SGZA 4OV9A 2YX0A 4AB4A 3W71A 1OX4A 3BW4A 3HQ1A 2RDWA 1TJRA 4RZ4A 3WJZA 2ALDA 1VYRA 3CC1A 5I3JA 2NWRA 3KVLA 3W7KA 2R14A 3MI2A 1FCQA 1OK4A 2QCMA 3MYPA 1OFQA 2WSRA 1LOLA 3KXQA 1ME8A 4ZMGA 5AHMA 4WY0A 3UZJA 3TIMA 4MY8A 4KWWA 1GYLA 4HNVA 1O4UA 5D2VA 4IOTA 1HUVA 2NUYA 3MHGA 1GJPA 4O50A 1FQ0A 2ZZ2A 3QW4B 1VCGA 5D2XA 4JTIA 2E6AA 4WXYA 4FNPA 4ADTA 4C1LA 4NXKA 1PE1A 3RFAA 4UMAA 3S5NA 3WK0A 3W2LA 2CZFA 2WPBA 3O07A 1AMKA 3IVSA 4KKXA 3B05A 3GX9A 2PE4A 3FJLA 1VPXA 3G0XA 2NV2A 4FB7A 3MO7A 1QOQA 4O54A 3W86A 3IGXA 4LVBA 2GUUA 5IBXA 4LY8A 3SJ3A 5DBTA 1R47A 2PRLA 4HIBA 2ZZ3A 2H8XA 3NQAA 4FNTA 3G0SA 3A24A 4K6AA 4DF0A 2Z6JA 1NVMA 1QO5A 3TMLA 1K02A 4I7VA 1OX5A 2X2GA 3DBPA 1KM5A 1Q3NA 3C6CA 5G2IA 2E6DA 4M7TA 3L65A 1GYNA 5K3VA 1IGSA 4WQ6A 3EKZA 3OVQA 3M43A 1VHCA 3S0CA 2WV8A 1L6YA 4PEKA 3UXDA 3GKAA 5K4ZA 3SSJA 3G1HA 3A23A 2GPTA 2C0AA 4M7SA 1BWLA 2EPHA 3TNOA 3EEGA 1O94A 1H51A 2GVJA 1OK6A 1DQXA 4O15A 3W76A 3L5MA 1UUOA 4I7UA 4JDBA 2E77A 2OMAA 3NXFA 4NX0A 3QQ0A 1FWRA 5K7JA 3CT7A 3LI1A 4HPXA 3TJXA 3M0ZA 5DXXA 2X16A 3S1VA 3EXTA
chains in the Genus database with same CATH superfamily
5LIWX 4O13A 2YL6A 3NR0A 4DN1A 3HU7A 1OX4B 3PZVA 3FA5A 3MSYA 4IIFA 3ANVA 1US3A 3CPRA 5ABGA 2Q01A 1KLYA 3VINA 4JL2A 3WFLA 5AHLA 4GOAA 2E28A 3WQGA 2QUVA 1A5CA 4DF2A 2CZDA 4FSAA 4AMAA 4BWLA 2HK1A 1E4MM 1E6PA 4FOKA 4QS5A 4PR4A 1G4EA 2ISFA 3EXRA 4EPBC 1PTAA 3K46A 1KBLA 4KBXA 3JU2A 1TPB1 1O5QA 3KBMA 2PDNA 3LSBA 1DJYA 1Q6GA 2W63A 2C1GA 3IAPA 4AMCA 5A8OA 4TVUA 3WUFA 3VIIA 4KERA 2VMFA 4BQ5A 2A0NA 4R53A 3UD6A 1PXGA 1R3TA 1SGJA 3WMCA 4DAFA 3UR7A 1SPQA 4IG2B 3WFZA 5BWFA 4P8WA 3FSUA 2ZOXA 4UQAA 2G95A 4PTDA 2IPWA 5I78A 2X1UA 2VCCA 4POCA 5A8GA 1BWVA 3BGJA 2EPKX 1XC6A 2YZ5A 2IPJA 3MJYA 3P2VA 4Q4OA 2OCZA 3G1SA 3EPMA 1DIKA 3UESA 3N6HA 4DUVA 2ZIDA 1P6CA 2INZA 5J8LA 2E0PA 1UH4A 1W5NA 2Y8KA 4XKYB 3SRKA 3GG8A 3S3GA 3PZ9A 1DQWA 3W74A 5M1TA 1T6MA 3ARVA 3R0UA 3L0NA 3WJWA 1OIMA 3PZGA 1AVAA 3VOCA 3WN6A 3E38A 3T55A 3SRHA 2FHCA 2CESA 4RDVA 5FF2A 5LHFA 3MWCA 4X60A 5KINA 2NUWA 1EH9A 1KBKA 4CD8A 4ES4A 3AROA 3UG4A 3WLKX 3PS7A 1RSCA 3T4CA 3DG7A 4L56A 3ARPA 4KIEA 1CLKA 1FH9A 4H2HA 3ZT5A 2E9MA 4FLSA 3KX6A 4WJEA 4IP7A 5A8NA 5DCBA 6REQA 1YBQB 4B3KA 1J2BA 4IISA 3R1ZA 3TU9A 1EX1A 1WOAA 3U3HA 2ZRVA 1UMLA 4HNNA 2C3ZA 2D24A 4GE8A 1K6AA 4HOZA 2EPLX 1CXKA 2FVMA 3IACA 2A2IA 2OT1A 4JX5A 3O6YX 4IIDA 3W25A 5FIPA 5ABHA 4W7UA 3SCSA 2EG8A 3OZOA 2G0WA 1B3WA 3MHUA 1R86A 2YGYA 5A8PA 3ZVIA 5CGQA 3BANA 2ZUWA 3SQLA 5C2XA 4NJHA 1DKWA 2VENA 3EDEA 4BI7A 4HSNA 1DBTA 3P74A 3LOTA 1OT1A 2W27A 4IXXA 4HNTA 3VIGA 4XKYA 5DXYA 1TELA 3STPA 3TJ4A 3VDAA 2UY4A 1RBLA 1JRCA 3LA4A 3CUZA 3L5LA 4FNRA 4GYJA 2FDMA 2X0SA 4GQRA 1D3CA 3GVGA 3ZVHA 4MYAA 2YCJA 1JVNA 1WXYA 5D32A 4DM1A 4XUGA 1MZRA 1EWEA 5CSRA 2J6VA 1ICSA 4E6MA 4EPEC 3HMCA 1FWHC 1KFWA 1UIOA 1V08A 6REQB 5LXXA 1MXSA 4MZ1A 4JDYA 2GQ9A 3TJIA 3UZWA 2EQDA 1M6JA 2PDIA 3SN1A 1LWJA 3CZ8A 4FR1A 2PRHA 3H2MA 2ZICA 3PM6A 4JFSA 5JUVA 3C56A 3EPNA 3TE9A 2B7PA 4AHOA 1GQLA 3U57A 2X7VA 3QH2A 1DQUA 5I24A 4JIRA 4UFMA 1X1ZA 3UCDA 5EBUA 1DPMA 3UA3A 5M3WA 1TVPA 4MJ2A 3HB9A 1VC4A 2HBXA 5D09A 3ABQA 5LIKX 3PR2A 2YA0A 1LLZA 4E4PA 2EJAA 2Z1KA 3LHTA 2J8TA 1NOWA 5F1UA 3GNRA 3O05A 3UQNA 2QJGA 4MJ4A 4RDYA 1IWAA 2Y70A 3LRKA 3C86A 4GMEA 3QC0A 2NX1A 3ZVHB 1ZJIA 4IMCA 5J04A 4F48A 1KD0A 4ZR8A 5BU6A 1X6UA 1SJDA 3CV7A 2R1LA 4D9PA 4ZB2A 1JUBA 4MWAE 2PB1A 1CLXA 2DFAA 3MO4A 4JOMA 4S3JA 2Q8LA 3PTQA 3H23A 4LF1A 3GR7A 1VBHA 4I3GA 4X0NA 3TX9A 3W1LA 4O16A 3BO9A 4J3WA 2A3CA 2AMXA 4ZQMA 1ECEA 2YXOA 2Z1WA 3MI6A 4JIEA 3EB2A 1OD8A 2A7NA 3AU2A 4CU6A 3BLFA 1EPXA 3C3UA 5HQEA 2CBIA 1FOBA 4FO4A 1JXJA 1WDWA 2PGFA 4HU4A 1RY8A 3RR1A 5LKYA 1W1TA 4M56A 4PUKA 1V5XA 5GPRA 3ZFHA 1AJ0A 4UTMA 1XUZA 3S42A 3QR3A 2WZHA 3W6YA 2E5BA 2IQ0A 1XD0A 4F0KA 5A5WA 4WDUA 4FXRA 3M0HA 1QHZA 1C9DA 2GK1B 2J9XA 3RLUA 4GXPA 1QW7A 3WQ8A 3HA1A 4LUIA 4I90A 2I56A 1FY6A 2E8YA 3CZLA 2BY3A 4W85A 4O8AA 3FJNA 1M5WA 1QHPA 2WXDM 1QPRA 3W7PA 3WNLA 3GVQA 5F2MA 3VC6A 1E0TA 4JIHA 3TCEA 5DCEA 4OFCA 1P0EA 1VBGA 2OOFA 1KLZA 1FWGC 3BICA 1R6WA 2XHYA 2Y4SA 2V3EA 3LCGA 3PF3A 3DOPA 2WAGA 3S2MA 3NIYA 5TAOA 3GYEA 1CXHA 1OZQA 1QPNA 4NIRA 3RM8A 2QF8A 4XBKA 1K8YA 1OCNA 1ZCCA 1XISA 1FA2A 1RK5A 3OBEA 2HCVA 3C0SA 1W91A 3MBDA 1XH2A 5AHEA 2YBUA 1E15A 4FEZA 3TYUA 2OB3A 6TAAA 2CFFA 3EOLA 2VZTA 5AKQA 2GFTA 2WNNA 2BMBA 4K8GA 1QT1A 3GXTA 4JTUA 1ZAJA 3BCDA 4DLMA 3SQSA 3T2OA 3LU2A 1A0CA 4AC1X 1OHLA 3P60A 4Q7IA 3WLOA 1EYWA 1GPFA 3N2CA 3N11A 5C55A 1VHNA 2HVOA 1JCNA 1H7RA 3IEBA 2Z2BA 5DMMA 3V4BA 4PUNA 5A6AA 1RLDA 4L64A 1CGWA 4GX9A 2FJUB 2RH9A 1K3UA 1GEQA 3QMTA 3WO8A 1XLKA 4GZ7A 1VCFA 3ZIZA 3DERA 4ZA0A 3UPBA 4Q6JA 2BG5A 1H60A 4P7QA 2A85A 4NZFA 2UY5A 2GZXA 3MUCA 4E4UA 3SCTA 2PTYA 1R46A 3MJMA 4ZL1A 4IUOA 5D37A 3LUTA 1NM9A 3GIQA 3TN5A 1JZ7A 4GJ1A 4M81A 2VHLA 2VCAA 1GVEA 5CZKA 2DU2A 1TFVA 4GYFA 2OX1A 1PS9A 1WDSA 3LNPA 3FV9A 2BVWA 2AGKA 4IZGA 2VWSA 4O11A 1YTEA 5DX7A 1KFJA 3VKCA 1NQKA 5CZJA 3R12A 4Z2KA 3D46A 4OVXA 3PJUA 1HO1A 4K68A 3N2TA 3NO3A 4FX6M 5M17A 3RHGA 3NYDA 4QSFA 2NVCA 4GY0A 3QTPA 3FYYA 4AWTA 1ZALA 1GWJA 1UIPA 1D9EA 1NF0A 1ONRA 1JYVA 2ZDSA 3UY8A 3MMUA 5JBEA 3W07A 2CLOA 2XWEA 3ITOA 2ZA2A 3BARA 4UIOA 1EP1A 1UR4A 2FZMA 1K4HA 5C9WA 1ZCOA 4NRSA 1E4NA 3M47A 1ZB5A 2VWTA 4ZENA 1UA3A 2NQZA 1TR1A 3QVQA 3W38A 4IMFA 2G3JA 5GVJA 2PDCA 4LXFA 2GGJA 3EB3A 2CCRA 2QXWA 1F8MA 1X8CA 1OFDA 2V6AA 3VMOA 3BV4A 3UF9A 3ONCA 5ECVA 1W1B1 4NUWA 3VGHA 3LQLA 4RW5A 1VBJA 3BG3A 3VNYA 4F9JA 1SMDA 1C93A 3G1VA 3GTFA 1C92A 4IH3A 4GY7A 3LPPA 4ZO9A 4PMVA 4AG0A 2E3ZA 5I07A 3GXDA 1CT5A 1CTNA 3TN4A 1W1PA 2FZDA 2OO0A 3DGBA 4S3GA 3LQGA 3CS2A 4PMQA 4IIHA 1VF8A 4S3DA 3HG5A 1HW6A 3T0DA 2XVKA 5I3KA 3N14A 1JAKA 1FXPA 1F3EA 3QY6A 1R9ZA 1XW8A 3U7BA 4YN5A 1TPC1 3U4AA 2D3LA 2A5HA 2XGZA 4XWUA 4TX6A 4BEQA 1FCUA 4Y96A 3I65A 1IT0A 2FQIA 1UBSA 3N19B 4CNTA 4RK8A 3QV6A 3QF0A 1A0EA 4AF0B 3ITLA 1JI2A 1VRDA 3HG4A 3NDZA 3VO0A 3V35A 3B8IA 2ICSA 3WQ6A 3W87A 1W3IA 4PN2A 1B4EA 3FJ6A 4CQDA 1XYLA 4MFEA 2J47A 3IJLA 3THCA 4A3RA 1Q7MA 4FOJA 1FWWA 1GJWA 5I09A 3N6QA 2TRSA 3WNNA 1IEQA 4HK6A 4P7OA 3CZKA 1RV8A 3M1ZA 4A22A 3Q4DA 1JZ4A 2Q3OA 1HKWA 1WAUA 3EWDA 3ZLGA 3UR8A 1QU4A 1CECA 1JCJA 3G8EA 1AH0A 3GIPA 2F9RA 3LD5A 5E9XA 2QKFA 1Z9AA 2QDEA 3W4RA 1XI3A 5F4WA 4WDXA 4AZ5A 3H53A 2P8CA 2PDYA 5I00A 4C7FA 4OQVA 1YW1A 7TAAA 4XVDA 3CMGA 2ABAA 4L1WA 2V63A 3AWOA 1KTCA 1VH7A 2H3DA 4X0VA 1VFMA 3LY0A 3RXZA 1TRIA 1B3OA 1VENA 3PB2A 1KR0A 4U2YA 1NY1A 4Z1CA 3DENA 1LT8A 4HCLA 3O6CA 2XIJA 3ALGA 3FAXA 4HPGA 3ICJA 2P1FA 3XISA 1G4PA 4NX5A 4L9ZA 2OO6A 3TYEA 3IIZA 1JPDX 4YCOA 1PDZA 4IL0A 4GZIA 7REQA 2Q8ZA 3GNPA 2MANA 2F2KA 2HTMA 2VX7A 8RUCA 4AF0A 3NNTA 4QRNA 9XIMA 4ACZB 4UR7A 1RZMA 3GDTA 3S6OA 3BCFA 4GISA 3IK4A 4CUCA 3BG9A 1HKIA 3ABXA 5HR6A 2FPVA 1P1MA 1EBHA 3AFBA 3BZJA 3L5AA 4U10A 2ZRWA 1UBPC 4UB9A 3AYVA 3BJTA 3G0UA 1XF0A 5CQ1A 3W24A 3ZJ8A 4H04A 4AX6A 1UJQA 1A4MA 2RDXA 1W2VA 5HATA 1Y5XA 3OP2A 3HGJA 3NPXA 3P84A 1XC4A 4XAZA 3MSRA 2ZRXA 1IE7C 2IKJA 2P10A 2Q3RA 3OVPA 3G6MA 1XP3A 4F8XA 4HPHA 3AIRA 3LV6A 3CUGA 2RDUA 2W61A 1W54A 1FCBA 4LEQA 3PZMA 5CBIA 1FWJC 1E1CB 2QJNA 3ZWSA 4GGBA 1OFOA 1TYGA 4AZHA 5DN1A 3AHTA 3IK2A 3CB3A 3VE7A 2WHMA 4AY1A 3T9PA 4X22A 4IGSA 1VR6A 1IIGA 3AJXA 1XM3A 4W4QA 3E0WA 4IGMA 2BHZA 4C6BA 3EXSA 4DJFD 4JFUA 3RF9A 4AD0A 4MHBA 1JQXA 1T8QA 3BW2A 4AHPA 4ROQA 1E9ZB 5C54A 4UNIA 4L6DA 1NELA 1FKXA 3W3OA 1H49A 3OOQA 3A9IA 2P0OA 3AXIA 1XWYA 4AFYA 1ONWA 1TIMA 1WCGA 1Q13A 1AZ2A 2D69A 2G37A 4S3BA 3ZLFA 2PODA 3VNZA 1GOKA 2PDQA 2QW5A 1IXOA 3I7RA 5DLCA 3EKLA 3VCCA 4A35A 3RO6A 1JULA 6ENLA 4GUFA 1Z7AA 3W84A 4B5WA 3NTYA 2PC8A 1SO4A 3KBWA 1XCFA 4ICCX 2HS6A 3OG3A 1E0WA 3ZXWA 1W32A 4B5UA 3HV8A 1V6YA 2GJPA 1A5KC 2PLJA 1S39A 3L21A 3WBXA 1J6OA 4TMBA 2CLIA 1B90A 1RD5A 4XB3A 5T8GA 3Q58A 3AIUA 4O0KA 5FJJA 4L4PA 1H1NA 4R88A 3W29A 4IT1A 1N2VA 4H9TA 1G1YA 2TPSA 2OODA 1BPLB 3KRUA 3W75A 2X40A 4O10A 3QPZA 3TLLA 1XLGA 3MKKA 3R25A 4RE0A 5HNNA 1A0DA 2FVLA 3NPUA 3W7OA 4XZ9A 3G24A 2OWCA 4ZXLA 4UTWA 1UQYA 3M0MA 4RXFA 1GOQA 2XTKA 2X0HA 1ISVA 4Y7EA 1BGAA 4J3XA 1ISZA 4NAEA 4OT7A 1A5AA 1Q85A 3EDDA 4HPNA 4B2DA 4ERIA 1F4HA 3RM9A 3G1FA 1HJXA 2POTA 3TCSA 1LT7A 3DGRA 3K2GA 2ISWA 1EDQA 3RPDA 4X9YA 2GWGA 3DFQA 3TSDA 3WL1A 4DJDC 3PANA 2BASA 5C0QA 1DVJA 1SMAA 4LCQA 4US5D 1CZ1A 2OZ0A 1JPKA 4LS1A 3TC7A 4R27A 1DJQA 1LRNA 1US2A 4PMUA 3W27A 3KP0A 1FP8A 1NU5A 4Q8QA 4J9JA 3PPFA 2DSUA 1SM9A 1I2RA 4FNSA 1J5TA 1PTDA 1BYAA 3AMLA 5ENLA 1J4EA 5BXPA 3W73A 4Q4SA 3C52A 1MZHA 4J35A 2OYLA 1PTGA 2C7FA 5LXEA 4KWUA 4KRTA 3LM3A 4TX9A 2OQLA 1YPIA 2XIBA 1KGWA 4MUZA 4KCUA 2VM8A 1IZKA 1JDDA 3TXZA 2YSWA 1GVOA 2G3FA 3HGOA 5RUBA 1Q6DA 2ANUA 1FHDA 4HYWA 5FEPA 4CN4A 5AHNA 1E9IA 2C1IA 1KW1A 1JDEA 3T42A 3P8JA 3MP3A 4A8RA 1RJPA 1UA7A 3GTHA 2VFEA 5EB8A 1DXEA 2XVLA 5TNVA 5CPQA 3KOZA 3UG8A 4DZIA 1NARA 3OHIA 3KOFA 5ABFB 4NAEB 4QGCA 4DO4A 1QPKA 3WQOA 2HVNA 3RLVA 1VJSA 3N4AA 3V5CA 3PBGA 3TAOA 4JPGA 3ARYA 2ZUUA 3S6TA 3PJWA 5A2BA 2Y0FA 3UEQA 2SFPA 2VC7A 1Q6LA 2CBUA 3LZ5A 2PCEA 3SURA 2PDMA 1D3GA 3XIMA 4PUWA 2PD9A 1JJKA 3OTRA 1F7BA 4XZIA 3PNZA 3RDKA 4AWEA 3NL5A 3W7IA 3HOJA 1EGZA 4UTHA 4TV5A 3LK6A 1DTNA 4R9XA 1C3FA 2WO5A 4DWSB 2Y7EA 4LEFA 2BTMA 3F2DA 4WJ8A 1A53A 4XD4A 1EC7A 1G4SA 4JHMA 1ZENA 1TJ2A 4JHOA 2YCEA 4JIIX 1YBQA 4HT3A 5I02A 3PSWA 3ZQ9A 3TC3A 4DWDA 1EZWA 1JZ5A 1RQEA 1BYDA 3NQ6A 1XLEA 5HJXA 1GYMA 2IXUA 2DH2A 3M9YA 1L6WA 2WQDA 4AEEA 1ME9A 4NP7A 1HJVA 1OC5A 2WSYA 5DQPA 3UZXA 3HQPA 5JIPA 3WD1A 1P0KA 4CCEA 4QROA 2FB2A 3DHPA 1Z6KA 4ATWA 1Z89A 1Z32X 1GW1A 4GYPA 1JZ6A 1IR1A 2QCLA 2J7DA 4JFVA 3W6MA 4IX2A 4MNJA 1KFCA 5LGZA 4ORIA 3M5VA 3HZ3A 4O52A 2TAAA 4BQ2A 1W5OA 2CHRA 3L23A 4QJ5B 4IPNB 1TV2A 5DEZA 1QPOA 3TP4A 1M65A 4O0ZA 1V3KA 3B40A 4DZHA 4DBDA 5CC6A 3W88A 1ZL1A 4EOUA 4OBSA 2NXGA 3LB0A 3OZPA 3ARZA 2WKLA 3UCCA 4CQAA 2BY2A 1F6KA 3INPA 3DFTA 3GC4A 4PBEA 1FVPA 9XIAA 4DWSA 3CASA 1Z41A 2C91A 1UZ4A 3ATZA 1ZBKA 4R7JA 2KAUC 3NFUA 3B4UA 3V5FA 2CC0A 1QW9A 1R87A 3EMQA 2GGEA 4ICNA 4RW3A 1CCWB 1XDMA 2DIEA 4JTRA 4CCZA 3SUWA 5A6KA 1VFTA 2HSAA 1TR9A 3VE9A 1HJUA 3RJYA 4KGJA 4QJ4B 1KFLA 3MTWA 2VC6A 1VYPX 4UFHA 1AL8A 2XSXA 4HHLA 4HQVA 1JAEA 1HG3A 3NQFA 4O4VA 3MS8A 4JN8A 4JFWA 1W6TA 2EHHA 2J8GA 4TUFA 2CLEA 1JL8A 2FZ8A 4YHEA 1XD1A 1P0BA 1GOXA 3GHTA 4MNMA 4H7ZA 1QO2A 1B4KA 4KPLA 2W67A 5LA2A 4D6GA 1ALDA 1FP9A 4QJ1A 3THDA 3E1F1 1TWSA 5BOOA 3WQEA 5G4WA 2VDGA 3ITCA 7ODCA 1JRBA 3FNDA 2WCSA 4AAJA 4OV4A 3DC0A 2R24A 3AYSA 4ILSA 1KC7A 2BXYA 2ZDRA 3HTWA 3LHUA 3RRAA 3DFSA 2WJEA 3W2JA 1D7FA 4I9JA 1LG2A 3M5YA 1TWZA 2HE5A 4O28A 3LCHA 5HNRA 3L4ZA 3GTNA 1WZMA 4PTNA 5BZAA 5AOUA 4Y9PA 1AMYA 1XG3A 1EZ2A 3TW7A 3OA3A 3QPYA 4C7GA 4QE1A 4JX4A 4GUIA 2E68A 3ARQA 1OCJA 5A6LA 4JNYA 1XLHA 1WZKA 5CZSA 4CEXC 1CPUA 4QQUA 3W01A 3THQA 3BLKA 3RAOA 3U2CA 2RDWA 2ALDA 2CZVA 3CC1A 5I3JA 3VM5A 1PX3A 3W7KA 2QCMA 3MYPA 2WSRA 1GZ1A 5XIMA 4QDWA 3IJ7A 4ZMGA 1WE5A 1PDYA 1WUEA 4HNVA 1O4UA 1HUVA 1IQ8A 3MHGA 4O50A 1FQ0A 3JVAA 4W5ZA 4LBSA 4JTIA 2E6AA 4DUWA 4EACA 3UA4A 5JQ9A 3S83A 3EB4A 3W2LA 3GHRA 1DE5A 4Q4PA 3U5YA 4KKXA 2FGZA 3B05A 1QATA 2PE4A 3FJLA 2GK1A 3KP1A 3W86A 1XCXA 2I17A 4LVBA 2GUUA 3C0QA 5IBXA 1V02E 4ZXOA 2G3IA 3UFYA 1R7OA 1GHRA 4K6AA 4DF0A 2E25A 1QO5A 1W9DM 2ZWZA 3C6CA 4JL1A 5G2IA 2E6DA 2WVTA 3L65A 3ARXA 3P14A 1YIXA 1EPVA 4MADA 3OVGA 3GKAA 5I7GA 3A23A 3FGCA 2GPTA 1AJ2A 1BWLA 1QK0A 3ITYA 3BAIA 1H51A 1DQXA 2W3ZA 4O15A 1CNVA 3L5MA 2PWFA 3GD6A 3DC8A 3NXFA 5K7JA 4M24A 3LI1A 4QS6A 3KZSA 2CITA 2FTYA 4GCXA 3WBWA 4U3CA 1XLIA 4N9DA 4QSHA 4WD0A 3S2NA 1V6XA 1A5MC 3BLEA 3QZAA 4JHZA 1TKKA 2CKRA 4OOUA 3R7MA 4UNLA 1TJ1A 1MUMA 3UZZA 1MMFA 4JTJA 3FXYA 4N6FA 4PL2A 5E0FA 3WEOA 3UNTA 1KXQA 3AUJA 2WMJA 2O7SA 3RU8X 4GUJA 4AVFA 1HJQA 3O0FA 5J5DA 1THFD 4H9VA 5FAGA 3VGDA 5HINA 3H55A 2Z28A 1ZBVA 4RDZA 2Z1VA 3C4UA 2ZXAA 2YR1A 4PRTA 1ZNNA 5FKYA 3WCZA 2E8ZA 1IEXA 4X61A 4JTHA 2WB5A 1E4LA 3WLLA 4ACYA 4XD6A 1AODA 1TUXA 2E7FA 1QW8A 5AYXA 2G96A 4AIUA 4MGGA 1P48A 3EA3A 2QJIA 1UMYA 3GU1A 4IWWA 2QJJA 4I9MA 4JGDA 4Z08A 3DCPA 3G18A 3N34A 1NTHA 1C91A 3NL3A 1GOMA 2IMRA 2UY2A 4LBRA 4UUIA 1VYSX 2G41A 4AYGA 4A3UA 3EX6A 3THAA 3CK5A 4UTTC 1IHIA 2AAAA 4HOWA 2BVDA 1S2UA 3TOYA 1XFCA 5G2HA 4QLJA 2NQJA 1MSSA 4L6HA 5I3HA 5B80A 1V79A 5M2FX 3W82A 5B7ZA 4GNVA 1ONXA 4NNAA 2NQ5A 3KL3A 1SW0A 3FN9A 5HXMA 1AW5A 4EPDC 1T96A 1B3XA 3V0UA 3ZS4A 3TA6A 1GQNA 1QUMA 2A4AA 1LM1A 3A3XA 1DYSA 4PUDA 3IV3A 4Z42C 4DBSA 4EVZA 4FIQA 5EYWA 3FX4A 3UW6A 2FVKA 4GQGA 1YLVA 3II1A 3KHDA 4J4KA 3TEVA 1LBLA 2DZXA 1LORA 1I60A 4PMYA 3GW3A 3W1NA 3NZGA 1V93A 3CYJA 4R34A 1WAWA 4BS0A 1V3HA 1PZ2A 3L4XA 3PJXA 3RR4A 4Z17A 4RLIA 4W7VA 3OLGA 3DHDA 3W9ZA 3H2FA 2QAPA 2E67A 2QAFA 4MKNA 3VOFA 3WDIA 3WSUA 1F74A 4PCTA 3W00A 5D03A 1G67A 2V2DA 2VKZG 3TVAA 2G8ZA 3BWWA 4MY9A 3W1AA 4UBPC 3ZWTA 1EXBA 3D3AA 1I2OA 4AWSA 3MBFA 1Q6OA 1M53A 3LCLA 1H1YA 4CCCA 3KL0A 5D02A 5AB3A 1F61A 1PX8A 4IPLA 3MP4A 3BJFA 2ZTKA 3VILA 5FEXA 3W28A 5H1WA 3FY1A 3HN3A 4WZHA 1XBVA 4ECLA 7TIMA 1MRQA 3W7DA 2FHFA 2GJNA 1XGDA 4ZSUA 1R5YA 5EU9A 4MDPA 2NSOA 3C2RA 2PWEA 4UCFA 1UZHA 3C2YA 1TJPA 2PWGA 2V5CA 4G7FA 5AC7A 4GQ0A 1LQAA 2HXUA 2X2YA 1F8IA 1Y5WA 3P62A 2ZC8A 4MYXA 4RCXA 3SCPA 2IPGA 1LL4A 4OBTA 4WX2A 3DYMA 4HOXA 4G1KA 3UGRA 1DHPA 4K7YA 5EBAA 3W1MA 3LEPA 4HKPA 4D6EA 2ZUTA 3W83A 4PTWA 1K7FA 2AMGA 3VIMA 3CQIA 1R2TA 2YPIA 1SVDA 4JQ2A 3IIXA 3VK5A 2AAMA 2YA1A 1M41A 4DYKA 1X7FA 3LDVA 4NQ1A 1CI1A 2UY3A 4DVOA 2Z4GA 3N18A 3CZEA 4PCNA 3W0KA 2VX5A 1AQHA 2CLPA 4S3EA 3N6JA 3NOYA 1YDOA 3CEPA 3VAVA 1ZJHA 2PLCA 2X7WA 1UKQA 1XKYA 3WJXA 4JX6A 3FOKA 3CO4A 3N1AA 2GJXB 4GZJA 3M07A 3WBAA 1MRAA 5CLWA 3UXAA 1TWIA 5GJPA 2B7QA 1QNQA 1G6CA 3IIPA 4J3VA 1E6RA 3KCOA 1D8WA 3URBA 4C1NB 4E2BA 3SECA 4MSSA 3WNMA 1QPQA 3S5YA 4GH1A 2ABBA 1HGWA 2YW3A 4NKCA 3BZGA 1UH2A 1UCWA 3LBMA 3OIXA 2FZ9A 2PPGA 4HD5A 2YL9A 2DGAA 2ZUMA 4KCVA 3FVDA 4FLOA 1DIEA 1EIBA 3KTXA 1TV5A 3USZA 4ROPA 3NQMA 5M03A 3E6EA 1PCKA 2DW7A 4CLMA 3B9OA 1I6NA 4JN7A 4XZWA 3W2UA 2QPUA 1FCVA 1EJRC 2JKPA 4AZGA 3NSMA 1FTXA 3NQ8A 2YCLA 1XRFA 2H6RA 3U6WA 1EJTC 3CL7A 1XLCA 2IKGA 2E09A 3E12A 3NEVA 4JTSA 1TTJA 4RZ5A 4J5NA 1B30A 1BWKA 2PDJA 4GK8A 1X6LA 2NQHA 3M16A 4D8AA 3QN3A 3G77A 1XRTA 1KM3A 3UR2A 4QJ3B 1JCMP 4J27A 1EGVA 4O1FA 4LTSA 4DJFC 4ASTA 1DHKA 2BY1A 3ZJKA 1M3UA 1RBAA 3CT2A 1YQ2A 2VGGA 1TPDA 3PZTA 2F2HA 4P7LA 5D04C 3ERPA 3WENA 1J9YA 4FX8A 1OBAA 3DFPA 2GJXA 5JMUA 1EA9C 3THUA 3VU2A 3A5FA 1FFRA 5H8MA 4PULA 1YYAA 1J6PA 2ZKMX 4JTDA 4J3UA 1MVYA 2VZVA 3W1TA 4U5KA 1XLFA 3VDGA 1LCOA 4HA3A 4C1NA 1UWQA 4M80A 1H7OA 1GVRA 4ZO8A 4L1GA 5AYBA 2A3AA 4CKQA 2BOEX 4LX4A 3F1QA 1RQBA 1UROA 3LSCA 4JCMA 4G1NA 5AC6A 4JNMA 1OD0A 2PMQA 3GRIA 4OZOA 2EGZA 3OYXA 2BNJA 3GR8A 2QCHA 4DXKA 4C6CA 4W84A 3E0FA 1QAPA 4HZ8A 3I6EA 2ZX5A 3CGTA 1NOFA 3I3DA 1XYFA 3E3HA 4DYEA 1HXJA 1ISYA 1J12A 1HKJA 1UD6A 4YIWA 1XYMA 2YCLB 1UD3A 2OT0A 3LHYA 4A4AA 4PODA 1XKJA 2XN2A 1YXYA 1QDSA 3E2SA 1R0MA 4AYSA 1JPMA 3S8HA 2WYSA 4IJCA 4JFTA 4NZCA 4RNHA 4HZMA 3GH5A 3RILA 2FTWA 1CB2A 1CEOA 1K70A 3CAKA 1IWBA 5CJNA 3LLFA 4LAZA 1XV8A 1SFTA 2BFGA 4LPCA 5EY5A 2DSKA 3NGFA 4RDWA 3ID7A 1ZUAX 1OF6A 3TJLA 1P0NA 4WJXA 3AMGA 2IW0A 3L4WA 3HMJG 4KEUA 3J7HA 3R79A 2I57A 2R9RA 4CQCA 1XUUA 5A3HA 1XRVA 1TREA 4PGLA 2OYKA 1EB3A 3VKAA 2C79A 3WF4A 2WWDA 3L66A 4A05A 1FRBA 2J13A 4N2YA 4DWSC 2RGMA 1GONA 3SN4A 1LTDA 4WGXA 4W8AA 1SU5A 3N17A 3NQVA 4RKAA 4UZSA 3ZR5A 3NGJA 2GQ8A 4AZCA 2DT1A 4FLQA 3APGA 3C3NA 1KCZA 2FDSA 3TQVA 2PP3A 4K36A 2VFDA 3ZM8A 4GQBA 3O06A 1GOOA 1B0IA 1VZWA 3GFXA 4YJ5A 1RUSA 2ONEA 3CXOA 4QR6A 3STCA 2H9AA 3JRKA 4IX0A 5C8BB 3TSMA 2F6KA 2H3BA 3QFEA 1XPYA 2OZ8A 4GQQA 1X39A 1KO0A 3EEZA 5AYIA 1Q6CA 3VX0A 3I6RA 1CGYA 4G7EA 5KEZA 1VFOA 4AC7C 1KKOA 2ZZ5A 1Q7ZA 3GM8A 4PEEA 3M6YA 2WW5A 4I6KA 3R11A 1XH1A 3UGVA 3HPFA 4BKNA 1Q7QA 4H6QA 2PDPA 3PPHA 1N7KA 1LP6A 3PTDA 3GWQA 3VUPA 4L6OA 4WOQA 3VNIA 1XLAA 5EMUA 2R1NA 1EC9A 4LUYA 2YYUA 3O0KA 2WMGA 3VOIA 5BW6A 1R2RA 2V5JA 1OC7A 3NDYA 3FEQA 3WDRA 4PTMA 5LNSA 2BODX 3PZQA 2PI6A 5HBFA 4X2RA 1KM4A 1E3ZA 1E6QM 1V3IA 1E56A 5LA1A 2NLYA 1BYCA 2O55A 4Z1YA 1TPUA 1W5QA 2NX3A 1AD1A 3ARUA 2NQ9A 1KB3A 2F7FA 2EBNA 1O5KA 5EL1A 4IJBA 4XUYA 2GDUA 3B9AA 3TK7A 3BAJA 4WKFA 3EX3A 1J18A 1R3WA 3O63A 3DKLA 3E96A 1ZP4A 3SEPA 1AL7A 3CUHA 4GVHA 4FA3A 1T40A 2PU1A 1KFBA 1BQGA 2C15A 3PPGA 5ABFA 2ATMA 3LGDA 4KF1A 2H9AB 3ES8A 4DEFA 3APTA 1PKMA 1ADOA 1V7AA 5G4EA 2WZEA 5TIMA 5KETA 1GPWA 1IT7A 2DJXA 2ISVA 5HULA 3SGUA 5EFDA 3WJSA 3PUGA 5DY2A 1XGEA 1W3LA 3IRDA 5HMSA 4O18A 3E2VA 3SCOA 1EKOA 4PTXA 2WLYA 4LUJA 4IHCA 2R94A 4RX0A 5FEWA 3W1XA 1O60A 5K9CA 3SN0A 2QPSA 4JQ1A 2QCNA 3EDFA 4JICA 3B4YA 4J3ZA 1TPVA 4GKTA 4WKAA 1VIWA 2OQHA 3UPWA 2QIIA 3BW3A 4EIVA 3KRZA 1R3SA 2E40A 1NH6A 2YLLA 1ICPA 1EP3A 3TTOA 3QSTA 4LVGA 3TW6A 2DZPA 4WSKA 2YDAA 1RCQA 1NSJA 1V02A 4H7VA 5FL0A 2I1OA 2W92A 4RNJA 8TIMA 2W66A 2I5QA 3WG6A 4WRHA 5DFAA 2CIPA 3IVTA 4N02A 4BJHA 5CPNA 3RGTA 1K1DA 2D0FA 4N0RA 4G6CA 2CLLA 3VOHA 1UC5A 1I45A 4PH6A 4KETA 4O1DA 3OVRA 2NT1A 1V0KA 5F4XA 3PWAA 5A6TC 2OR2A 1B9BA 1W8GA 4GC3A 5D2YA 3WNOA 2BB0A 2PTWA 4I5XA 3TYBA 1QNVA 1M9HA 4HSHA 3AIVA 4DXXA 4OUIA 3M46A 3ALFA 4BCEA 4AH7A 3LENA 1ME7A 1W17A 4O14A 3U9IA 1LOSA 2AL2A 3PZUA 3VD3A 2A1YA 3H2NA 5C9RA 2VT0A 4D6IA 3W81A 3OLEA 5A6BA 4UQ9A 4H6KA 2NZLA 3N12A 1UWIA 2Z7GA 1DJHA 2FMNA 4HSOA 1GCYA 3SI9A 5KITA 4JKLA 2O0TA 4AD1A 1W9UA 2V82A 4YTQA 4Y9NA 1QWGA 1E9LA 2VCBA 5CJMA 2B31A 1VJZA 2PDBA 1V0MA 3IARA 1DOSA 1LZOA 3I3BA 1G7VA 1WDRA 1JD7A 4MZ8A 4PMZA 4DM2A 4US6A 5DO8A 3WK1A 3WLJA 2DVTA 1XX1A 4LB3A 4HA4A 3CAWA 1V03A 2Y61A 3WDJA 2WMKA 3W1UA 2CYGA 3W22A 3WYZA 2VR2A 2V5DA 1RVGA 3FAWA 4DI9A 1K4GA 3SR7A 3VIOA 4X2PA 1LRQA 1VBUA 4YTRA 2EPNA 4MWAD 1G9HA 4XV0A 1CGVA 2VUNA 2QVHA 4PBGA 3TH6A 2O56A 4M6VA 1I1XA 2C0HA 4BF7A 4EE9A 5FJOA 2PEVA 4HU3A 4JQ3A 2H90A 4D6DA 3GG1A 3UCQA 1V0LA 1ZZMA 3I10A 5BXRA 3F5KA 4AZBA 5E93A 3EX4A 2AL2B 3L0GA 5C71A 5DT7A 4ZTYA 3FYPA 1GTHA 1H1ZA 3VD7A 1FKWA 1E43A 2PGWA 4F2TA 3WH8A 1FDZA 2O4MA 1XBXA 3PHAA 2WSPA 6CGTA 4DAIA 2QDHA 3ITTA 2XN0A 3VNJA 2OSWA 2WSQA 3AS3A 1TO3A 2I14A 5I3GA 2LLEA 4LW7A 4PSRA 1JNEA 5CCZA 1KGXA 3FW6A 3LXCA 1J0IA 2HNHA 5FJPA 3OZYA 4J3TA 4DJEA 5LZLA 1OT2A 5F7UA 4HMNA 4AW7A 2A79A 2DUAA 1YX1A 2O4QA 4IXHA 1B5TA 4IGHA 3T78A 3WQ5A 4O0QA 3GU2A 1XIEA 3I6TA 4DUOA 4US5A 5KMYA 4B92A 1M7JA 1NOUA 2CLFA 5J5RA 4H1ZA 3NXLA 2PCQA 3A9BA 2OLAA 3KLKA 2F8QA 4IQLA 4CCDA 2HXTA 1WKYA 2I9UA 2G97A 2VD8A 1KGUA 5G1TA 4AEOA 1W0MA 2DJLA 4UC5A 2WJDA 2VZUA 5BOFA 2QGYA 1GOWA 2Y8UA 2ACUA 4Q4KA 4MF4A 3WH9A 3BAKA 1AQMA 3QYQA 4N4PA 3B8TA 1PZ1A 2X0YA 4ZQCA 2YBVA 1GVSA 3DI1A 5IOBA 1B54A 1OWQA 3DESA 4TR9A 3NURA 1F4AA 1V77A 3VD4A 3ME3A 3CL8A 3W7LA 2BVYA 3AZRA 3WL0A 2P5NA 1RP8A 2PZ0A 3WK2A 3PK7A 5I77A 2DZWA 1MXDA 1EUAA 3M0XA 4Z2LA 3RPMA 1VAHA 4DHGA 4LFYA 2QJHA 2XGBA 5AYYA 3HURA 1QI3A 3FGCB 1FUYA 3RM4A 5E0KA 4S1FA 3BV7A 3L4UA 1TV4A 1OZMA 3WLHA 5LIXX 4P5UA 1P4CA 2B4GA 3S46A 5L6UA 1HL2A 3TZNA 3HGSA 2UV8G 1C9WA 4ZQOA 4OIFA 3IJQA 1O1HA 1UP2A 2Z24A 4YHGA 3FKRA 1TE1A 4GI4A 1JXKA 3TROA 1A5SA 3P93A 1JZ8A 2R91A 3AICA 2DW6A 2DPEA 2DZAA 3ABOA 4RE4A 5DBUA 3EMCA 3NG3A 2EAWA 4N9CA 3DECA 1JZ3A 1C7SA 5IXEA 4GUHA 5FF3A 1MO0A 3DG3A 2VJXA 4I7WA 1CW2A 1OB0A 1WDQA 1FWFC 1DJIA 2V69A 2GVYA 1AH3A 2WNWA 3W2NA 3QSRA 4PC8A 7CGTA 4HU8A 3VIKA 4YYFA 5TBOA 2GYIA 4B5TA 1M7XA 2I7GA 2QMJA 4M0XA 1E73M 2VEFA 3PUOA 1SFSA 4WIWA 5EKYA 4C7DA 3M5ZA 5HQLA 4Q8NA 1XIGA 4Q33A 1UWAA 3WD4A 3MW7A 3H7VA 2RGLA 2P53A 4HBKA 1H0GA 1DIDA 4Z2JA 3SCNA 3GG7A 2HS8A 5D9PA 1VP5A 3POHA 2H8ZA 4ZEPA 1NWRA 1ODUA 1G7UA 2E4TA 3LERA 3BAYA 4LCRA 4KWOA 5CC5A 5AC4A 1IXQA 4JEJA 4CD6A 1ITCA 3LNMA 1CXLA 2PBGA 4MLJA 1KTBA 3EOSA 5I03A 3P81A 2O92A 3QJAA 2J25A 4OJYA 1BAGA 1L6FA 4IICA 2X1IA 3O7UA 3T0AA 2J77A 2OFJA 4L80A 2V5KA 1EDTA 4U5IA 3TR9A 1PWLA 1PAMA 4H8UA 1UJPA 1HKKA 4QX4A 1WBHA 2PGEA 1DJNA 1PIFA 5F2LA 4P7RA 3ITVA 4JQAA 4AIBA 5TD4A 1DWAM 2VQTA 2BGNE 4UXDA 1E6ZA 4CN6A 2QR6A 3ZR6A 1QRQA 4XTDA 1AQFA 3TQPA 3SUUA 3TFXA 1R9YA 4C91A 5MKGB 2R1KA 2PS2A 1KM0A 5E0CA 1RP9A 2PDLA 2AKMA 4MG4A 3HM7A 2WLZA 3LBCA 3U0HA 3MDUA 3UJ2A 3DX5A 1TQJA 3QW3A 4J28A 1UWUA 5E6YA 3GAKA 3I7QA 3MUY1 3DHUA 4O53A 3L67A 5D05A 1HF6A 1YTKA 3V1PA 1DEDA 4K38A 4QBXA 3U8GA 2AL1A 4B3ZA 2OWWA 1HZYA 4LYQA 2ZUNA 3LHWA 4O1AA 4JIPA 1QBAA 4RPQA 3OU8A 4K8HA 3RCYA 1BSIA 2WNQA 3LCIA 1S3HA 2YIHA 1QASA 3EX1A 3QMRA 1OY0A 3DN5A 3WH7A 3HPZA 3KEHA 3D3FA 3BSHA 3EWXA 4C65A 3TTSA 3PG9A 1UQZA 4D6HA 1J0HA 3DYOA 2GVGA 3GXIA 5HQMA 3MMDA 3AXKA 2YDSA 1V51A 4TU1A 3P6LA 3CM4A 4HMCA 2ZE3A 3GDMA 3DFOA 3R8RA 1L8PA 2PP0A 3GVWA 1M04A 3UJSA 1UASA 2ACSA 1XSJA 2D23A 3HF3A 1LUCB 1PYFA 1ZFJA 4O8RA 5C5YA 3NQEA 1WZLA 4O19A 1MFVA 1OINA 3DUGA 2W4XA 1B3VA 2QT3A 4KH2A 2Q8XA 3NO5A 4O4WA 2OEKA 1OVDA 4F2BA 1H4PA 4QHRA 3CHVA 3UWYA 3CO8A 5JH1A 3TZFA 1FWCC 4D6FA 2GVLA 1KA9F 4DQWA 4M6UA 5JH2A 3VTRA 1KCLA 5GQBA 3MANA 1UPPA 4B91A 1PWMA 2NVAA 3OODA 3UZ5A 3BL3A 2DT0A 3LX9A 1B3ZA 4PRRA 4KEVA 1TPH1 1OABA 4E2DA 5CPMA 3RYSA 4Z1DA 1OG6A 3KCJA 3NVDA 3OGVA 1DJWA 3DFHA 4TTUA 1TSIA 1C8XA 1IEVA 3AHVA 2RFGA 4XZMX 4GJIA 2C6QA 1F3XA 3MSDA 5FF7A 4JCLA 1A50A 4YVVA 2FFCA 2QJMA 1H62A 2OJPA 1ZS2A 4XAYA 4ZB0A 4WY0B 3STFA 1CYGA 5FJRA 3DBNA 3A4JA 4MM1A 2AOSA 4PFHA 4I6VA 2V38A 5BCAA 1VFHA 2X1RA 1Z42A 1A3XA 1OFAA 3V7PA 4ADSA 2VEIA 3GXFA 1ZU8A 2QCFA 4UCGA 3P7YA 3BCJA 3MWAA 5K9DA 4XZBA 2XFFA 4I9AA 4AU0A 3V36A 4PRWA 5F4SA 4YMZA 3QM3A 1A5NC 4NF7A 5I3FA 3LTYA 2XG9A 4C6QA 3QKZA 5K4XA 3VZXA 1MW1A 3QFWA 4DF1A 5CSUA 5U7SA 2AKZA 1L2QA 3OW1A 4S3AA 1HP4A 2YB4A 1U83A 4FXFA 3BLDA 2BWGA 3N9SA 3KBNA 4GVIA 4LC6A 3MQTA 1ZAIA 1QI0A 5REQA 3N29A 1ZBWA 1DWIM 3FK4A 3C8FA 1H63A 4MLRA 4W9TA 2JEPA 1AH4A 4Q7NA 4MB3A 5AY7A 3LTPA 3NQBA 2VOMA 1SZRA 3WD0A 1UR9A 1WZAA 3KWSA 3B97A 4YLWA 2GLKA 3JW7A 4N4QA 3GO2A 2XISA 3PN8A 5C7VA 1XIFA 4S3CA 1TJ0A 3WJZA 4ZOEA 2D3NA 2D1ZA 1UWRA 1PX4A 2DQXA 3MI2A 4CD7A 4XKMA 1OK4A 3CZJA 2VDHA 4YYCA 1PKLA 3LMYA 4WY0A 4DLFA 3TIMA 5JBDA 1KWGA 3M6DA 1XYBA 1ZJAA 2PUZA 1DIOA 1TZZA 3L4TA 1Q4WA 3JZEA 3H70A 2ZZ2A 4DJED 4GCAA 5D2XA 4FNPA 3M0JA 3VZZA 3RFAA 2DV0A 3LPFA 1EYEA 1HQTA 1AMKA 1FWBC 3ABZA 1VPXA 1B3YA 2NV2A 3OPSA 4O54A 3IGXA 3T2PA 4IJRA 3EOUA 3QY8A 3VABA 2WM0A 3SJ3A 5DBTA 4GH3A 4HNCA 3G0SA 1UH3A 1NVMA 4Q8PA 3TMLA 1K02A 1OX5A 1J11A 1Q3NA 1GYNA 2UBPC 3H12A 4INFA 2O9OA 3EKZA 3A4WA 3OVQA 1VHCA 1S1PA 1UD2A 4RE2A 3S0CA 1KR1A 3L4YA 4PEKA 4GGHA 3L2LA 3EZ4A 3RN6A 5K4ZA 2VVSA 5REQB 1CENA 4M7SA 3TNOA 4H8NA 3QV7A 4JDBA 2E77A 2OMAA 4NX0A 3UETA 5HPOA 2XGIA 3QHNA 4XZLX 2GVEA 2PWHA 3M0ZA 5DXXA 1EGMA 3PZNA 3BOFA 4HTBA 2ZA1A 3HPAA 4DI8A 3K1GA 4UTJA 4OOZA 8XIMA 1PV8A 1P1XA 4Z0JA 3UT0A 3EA1A 3CQ0A 6PTDA 4EXQA 2XIQA 3CWHA 4LJ3A 5CKSA 4RXGA 4NAFA 4AXKA 2YDRA 1PIGA 2YOCA 1AFSA 3H2AA 3SBFA 1E1EA 4QG8A 1V6UA 3PNUA 1Q63A 2D0HA 1FWNA 1HNYA 2Y1HA 3CQHA 4LF2A 1V7YA 2J9YA 4AZCB 2ZBTA 2QULA 4KEZA 3VKDA 2Z29A 4AZIA 2I5IA 2ODOA 4XO6A 4CVUA 1S1RA 3MCMA 4M6PA 1NWUA 4YTUA 4V1XA 2YL8A 3BLOA 1I9CB 1U5VA 3T40A 2WZMA 2J7FA 4LS0A 1PVNA 2ZRZA 3T44A 4ZQNA 1AUSL 2DVXA 1BVNP 1XIMA 3QXBA 3P5YA 2A3EA 1QNRA 5CAHA 3NM1A 5U4NA 5BRBA 5BWAA 4G7EB 2QCGA 2VRJA 4DZ5A 1ZSXA 4F40A 1KBIA 4DYJA 3C2EA 2JGYA 1UUMA 3VUSA 4P2VA 4NZJA 2CPUA 3I4EA 4HK7A 4IIGA 2Q6ZA 3LCWA 1TWWA 3KDOA 1XQKA 2WBGA 4DPPA 3AMCA 4JYFA 4QP0A 3CUJA 4TVCA 2VURA 2Y62A 3VIJA 3GFYA 1CGXA 2J7GA 2CWNA 5BRQA 4LYRA 4A2SA 3OZMA 1VFLA 3QYSA 4GACA 4FF5A 3NZRA 2X1TA 4NAFB 4PCFA 4QCEA 3EA2A 2ZZ1A 2RAGA 3G1YA 4HMEA 3G6LA 2PU0A 5D9OA 4ZOAA 3FHAA 3W1RA 1OGBA 1KCXA 4GI9A 1BG9A 1DTUA 1WQ5A 2G3NA 1IV8A 4NYYA 4DELA 3WUEA 2VEGA 1JNDA 2Y63A 3VNDA 1F6PA 4P8VA 1H5VA 4XIAA 5I79A 5CPLA 3T08A 1UD5A 3ZJ6A 4G2DA 4C5YA 1JYNA 1EJUC 2VQUA 3T7VA 2HE8A 3IWPA 4YU1A 3PFMA 2ZFAA 1P6WA 4OE7A 5D2WA 5BNKA 3CTLA 1POJA 3WLRA 4UR8A 4RUBA 3M7WA 3CHDA 4HNOA 3N4EA 1JZ2A 4A2RA 4ENLA 3TDFA 1AK5A 3ANUA 3Q94A 1LROA 3ZR4A 2GQ3A 3CJPA 5K9XA 3ARSA 5CXPA 3M41A 3C5QA 2V81A 1EP2A 4GHRA 2NV9A 2DZBA 1TX0A 3LZ3A 4UFKA 3STGA 1E71M 2YCIX 4U2ZA 3H7RA 3N2BA 4ZVJA 2Y89A 1ZBCA 4YPJA 1KQZA 5EA9A 3S2JA 1DWGM 1GKRA 1XINA 3NWRA 4LH8A 5EFFA 5CGMA 5IDZA 2OSXA 1KQYA 3IUDA 4M5PA 1IT8A 3CV1A 4ZB5A 3S2LA 5ABTA 5IRPA 4J7RA 3PJTA 2G4JA 1XL9A 1EJ7L 3KVJA 1A49A 5BU9A 1UWTA 1WDDA 3E9AA 1DXFA 1EF2A 1JFXA 3ARTA 2Q09A 3CV2A 5A8MA 3VGFA 3MDWA 5E6ZA 4LAUA 3U4FA 4AD3A 4GLEA 2ZZ4A 3WQPA 3B0XA 1MEHA 3GK0A 4L1XA 2TYSA 3IUHA 4TVDA 3HFYA 1XLDA 3R8HA 4EWJA 1PL9A 4MWAC 2EG6A 5CPOA 1YNQA 2J7EA 2XYLA 1RQHA 3LI0A 3MUXA 3WF2A 1QHOA 1BVZA 3F4DA 2E5DA 2OU4A 5IHSA 1FFQA 4AX7A 1NEYA 1B57A 4FXJA 1S5VA 1J01A 3AZTA 3UU0A 6XIAA 5KTLA 3WNKA 5AHIA 4NHVA 3Q2DA 2OPJA 4QCFA 4GI6A 1UKSA 3IUIA 4C6NA 2XM2A 1R3VA 3T8QA 5HANA 3GQYA 3V0TA 2A3BA 3I3EA 3PUEA 3S9YA 2XH2A 1DJGA 4JTAA 4RL3A 3V0SA 4UTLA 4QQ3A 1GQJA 3V1HA 3R0KA 1BKHA 4NASA 1OX6A 4R9OA 1E40A 4JTKA 2UWFA 1LOQA 7A3HA 5C2CA 4JY9A 1JCYA 2GL5A 3KOWA 3F2CA 4V28A 4AISA 1HL8A 4MDOA 4YNGA 2VEMA 1VFFA 4S38A 3JUGA 3HV9A 5LNRA 2V3FA 1SZNA 1I2QA 3ECQA 3DIPA 5I2UA 2VYOA 2XDFA 3FA3A 4M3PA 1B31A 1KXVA 3OGSA 2NX9A 1GORA 3R58A 5FD0A 4U4MA 2D2GA 1WDPA 4PCSA 1Q65A 2J78A 3V18A 2OELA 1LL6A 1GQKA 3BC9A 1A5LC 2WOQA 1EJSC 3T1GA 1O95A 3SRDA 1VPQA 2J9ZA 5AC5A 5GJNA 3OEXA 4R33A 3GVVA 1W5MA 5DMLA 2XH0A 4RE3A 2QUUA 1W9PA 3BPWA 3G22A 3FFSA 1GZGA 4E5TA 4PUMA 1HTIA 1UOZA 3N15A 3NYZA 3R0DA 1N55A 1EEPA 2PDWA 1EFZA 4FHAA 4JD4A 4J3SA 4F0RA 2PGRA 2PWUA 2VRKA 4OECA 5MF5A 4B5VA 2XVGA 4EANA 3S2CA 2V8ZA 1Y7VA 5CG7A 1K03A 2GOKA 3W2KA 2C18A 2QZRA 4FMVA 1NIUA 1GG1A 4RV8A 1GW9A 1W5PA 2XFRA 2VDIA 3V3WA 3VIHA 4AVNA 2C1HA 4R85A 4ZOCA 2HDJA 1E51A 3G1RA 4MNLA 5DMNA 3LCFA 4EXAA 5HA7A 3NZQA 4XD5A 3EOOA 3I7SA 4GBUA 2CETA 3E5PA 1C29A 2XIOA 1XLLA 3NL2A 4A8LA 3FLUA 3OLDA 3OB8A 3W70A 1NQ6A 4WR3A 1SW3A 1SFLA 1TRDA 3G1XA 1UYQA 3EWCA 3L9CA 1JGIA 3AXMA 3H2CA 3K1DA 1E1FA 2WCAA 2WMFA 3IGHX 2VOTA 1M1BA 1YPXA 3O6AA 2Y5EA 3ABSA 4GNJA 2V5BA 1NFBA 4URIA 1CXEA 1UR0A 3UXIA 1VEOA 3NL6A 3O15A 4F9DA 3AOFA 3GNDA 2J7BA 4FALA 3RU6A 4F66A 3BAXA 4M6QA 3FA4A 1KKRA 3MPGA 4LWWA 2ZX6A 2I5GA 2VUYA 5IHRA 3TQ0A 3W1PA 1TIWA 2POZA 3AS1A 2V3GA 2HRWA 3GZAA 1FWSA 1QXLA 2XM1A 3C8NA 2DQWA 3SCWA 4IMAA 4F0HA 1FHUA 1G0CA 5FOOA 3REQB 3BLLA 3AHZA 3AMKA 1J0YA 3FCPA 4C5ZA 3QRHA 4BI5A 1RAKA 5FCZA 1T0OA 4PMOA 3PAJA 3S1XA 3CZGA 2Y88A 1C8YA 5EMKA 3GIYA 1GZJA 4W89A 4TO8A 5HUOA 3W7QA 3WIJA 4H2CA 1HN1A 3W7GA 4H01A 5CJ5A 3DU0A 4HZ7A 4NT0A 1OYCA 3VCRA 3CPUA 5BXTA 3QGVA 4JR5A 4HN4A 3IJ6A 4KS0A 3N9KA 3IJIA 3K5XA 3L68A 3KHJA 3M4HA 3WZ0E 3O9NA 4HGXA 2VD9A 4Y9OA 4L4LA 2Y8VA 4MTVA 1B9ZA 1Y5VA 3CAQA 4HK5A 3DZ1A 2QQ6A 4Q4MA 1HJWA 1HVQA 4MB5A 1YKWA 4FNUA 3VFLA 3RLHA 2OWXA 3W02A 3P61A 1W56A 1BHGA 1DWHM 3WMLA 2NUXA 4E38A 4Q6XA 1E4IA 5T9CE 3IAQA 2Z00A 2WC4A 3W85A 4CNUA 3GTXA 3I4KA 1OFEA 3ES7A 1IGWA 1X8FA 2OLHA 2AQWA 4KIRA 3OYZA 1UW9A 4FF7A 1VFSA 3PULA 8A3HA 1J93A 4WF7A 3N04A 5SWUA 3TYDA 3T6CA 4O1EA 2OGJA 3DFYA 3UWZA 3MMWA 1XIDA 2YBTA 1V4YA 3KE0A 2VC5A 4U31A 4EWND 3EWWA 1JDFA 2CWXA 2AQVA 6ALDA 5G1MA 1XLBA 5TF0A 3O16A 2OOGA 4ZE4A 1T41A 1OFPA 3SIMA 1CX9A 1KRMA 3QQ1A 4CNOA 3WDHA 3TTYA 2J7CA 2VC9A 1NDWA 4Z1BA 2I16A 1QOXA 4IP5A 1CXIA 4TOQA 4TMCA 1XRSA 3BUVA 4H41A 5HR7A 4ZQPA 1K7XA 3GNNA 2YKKA 2J24A 2Z25A 3OO2A 1LRTA 2ADAA 2NWSA 2VFFA 3MU7A 1BXBA 1Z48A 2R82A 1W3JA 2DZVA 1CWYA 1U2YA 3F03K 4ZFMA 1LBMA 1UR8A 3RMEA 3L12A 1TVNA 5C6MA 1S5WA 1VKFA 3UWWA 4EAMA 3FDKA 3RRXA 3GHUA 3MY9A 1J8VA 2GGIA 3AXHA 2WANA 4K8EA 5MHBA 2QCDB 4ATDA 4C1KA 2JF6A 2A7RA 4XZNX 1BYBA 3VIPA 3Q45A 2XFWA 3F4WA 4V1YA 3UZYA 2ZYFA 1JCXA 1XR2A 2Y7DA 4HYVA 1U1JA 3BOLA 3P0XA 5MKGA 1UUQA 1BEUA 5T26A 1EHAA 2YFNA 1ODZA 5D30A 4MPKA 1KRBC 1QJWA 3B9NA 3SO7A 1Y0EA 2JQXA 2YCKX 5IDIA 4DXVA 2JFEX 4RZ6A 4S2CA 1F07A 1JYXA 2VFHA 2A3HA 1OCBA 2PWDA 4QDPA 3MZ2A 2BSLA 1TCDA 1OFBA 3TV8A 3KBJA 5IM51 1SJBA 3AUOA 2V5LA 3P0WA 2QHAA 3LN3A 3BMWA 3AQUA 4HYRA 2HVMA 4NILA 4W88A 2DH3A 4LUSB 1VPYA 3S5OA 4Y8FA 4EXBA 1YMYA 1IXNA 1XH0A 4MFDA 5T9BG 3UERA 3OG2A 3TLQA 4M1BA 1PCWA 2DT3A 1SSDA 1VD6A 2J88A 1D2KA 4PB3A 3BLPX 3FJ4A 1TV7A 1YHTA 5IFTA 3WF3A 3ELFA 3VD9A 4YTSA 4AQLA 2WVSA 4G9PA 2ZTJA 2DDXA 3ITXA 2XU2A 1UZDA 1S5TA 1S5MA 4O17A 1CLVA 4K37A 4Q8MA 2ZX7A 1J0KA