5T26A

Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
293
structure length
292
Chain Sequence
HMFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate synthase
publication title Kinetic, Spectral and Structural Characterization of the Slow Binding Inhibitor Acetopyruvate with Dihydrodipicolinate Synthase from Escherichia coli.
rcsb
source organism Escherichia coli o8 (strain iai1)
molecule tags Lyase
total genus 108
structure length 292
sequence length 293
chains with identical sequence B
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2016-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5t26A00
4NNBA 1RQBA 4H3DA 4UFLA 1GYLA 3V1PA 4DF2A 1K8ZA 2GVGA 3FKRA 3GDMA 1C8VA 4UTKA 1G7UA 2J9XA 4ZQOA 1S3HA 1O4UA 4JD4A 4M6QA 5D37A 2ZZ2A 3W22A 3UXDA 1FCBA 1KA9F 2V9DA 1AW2A 4TU1A 3G1HA 3HGOA 2Y63A 2ALDA 4YLWA 3O6CA 4LOCA 1NEYA 3P62A 3TW7A 3CC1A 5F4XA 3TH6A 4N6EA 1VRDA 1K8YA 4FIRA 3VFLA 3TQKA 2NXHA 1TJPA 3BPWA 3FYOA 5HWNA 1J2WA 1TQJA 4XTDA 5TIMA 3W7MA 4O54A 4MFDA 1W3IA 3ZWSA 2BSLA 2HMCA 3W1RA 4WXYA 3TNOA 4LS0A 4K39A 1PVNA 1FDJA 1VYPX 5F2LA 3MYPA 2X2GA 2EAWA 1NSJA 4O57A 3LDVA 3PBUA 3LHUA 2YZRA 1IGSA 3WJXA 2Y6ZA 3W76A 4JTKA 1FBAA 2H8ZA 1LOQA 5DBTA 5K3VA 4LRTA 4A21A 3QZEA 3EWUA 4O1DA 2BXVA 1UCWA 4FNSA 3UWWA 1I4NA 3M44A 3EWBX 2ZRWA 3NG3A 3N14A 1VQTA 4GE8A 1SPQA 1GTEA 2C16A 1XCFA 3MI2A 3VI2A 3OIXA 1R2SA 1ALDA 2H6RA 4MJZA 2H3BA 3RK8A 1QO5A 3HMJG 4PFMA 4PTNA 5CZSA 1GZGA 2NV2A 2LLEA 5DBUA 1H7XA 4O1AA 3L5MA 4HNNA 4JTUA 3GR7A 2ZRZA 2DZSA 1K7FA 3LV5A 3P7YA 4XWUA 5HMSA 4MLRA 4O53A 2VFDA 3PR2A 4QJ1A 4AAJA 2VEKA 5K9DA 3R5EA 4UTJA 4CNPA 1MO0A 3LTPA 3GDLA 3W75A 3HG5A 4K36A 2R91A 1BTMA 1W3TA 5CG7A 1F7BA 3WK3A 3IEBA 3UYCA 3LERA 1SU5A 3S5OA 3EXTA 1KTCA 2QAFA 5DY2A 5I3GA 1A5AA 4OE7A 1TREA 3EWXA 3OHIA 3R2GA 4IQLA 2AGKA 2J9YA 2ZTKA 3O16A 1P1XA 3RNDA 1LLZA 4AB4A 3G3MA 4JX6A 1CW2A 5ABTA 3BG3A 1Z41A 2VEPA 1I2NA 1B4KA 4I7VA 1DORA 4U4MA 5EYWA 1YTDA 5CPMA 1TPWA 4UTLA 3QC3A 3TW6A 4JTEA 4O16A 4YCPA 2C6QA 1DJNA 3T4CA 3KVKA 2DZUA 4NXSA 3OVQA 4IOTA 1EPXA 4JTTA 5CZ0A 2R94A 3W1PA 4Z0SA 3L68A 3HPZA 1YTKA 3R12A 2F7FA 2NXGA 3RLVA 1LRNA 1JRCA 1OFAA 1OX6A 2QUUA 3W2LA 4JTHA 5G1TA 2PRMA 4OU1A 5A8GA 3NR0A 2CU0A 2A7PA 2VEMA 3EWYA 4NZFA 4BI6A 3W7GA 3NL2A 2NX3A 4M19A 5EMUA 3N9RA 4O1BA 4O4VA 4ADUA 1F76A 3BLEA 2RDUA 3WJYA 3LHYA 1KFLA 2YCEA 3C2EA 4TMBA 3NO5A 5EL1A 1H62A 1L6WA 1S5VA 1TYGA 4XKYB 3NNTA 1OK6A 1FWTA 1VCFA 3W2MA 4UC5A 1VLIA 4AHQA 2QJHA 4LV9A 3W23A 4CCEA 3A24A 1FXQA 1KTNA 1KFBA 4DQWA 5C2XA 1OABA 2QCMA 2WSRA 4XBKA 3LLDA 4LW7A 5FI8A 2ZZ7A 3D0CA 3LCXA 2EF9A 3IRDA 2C1HA 1WYIA 3CTLA 5BMXA 4EF8A 3BW4A 5GVJA 4YCOA 1JCNA 4TIMA 1W8SA 4UIOA 1YPFA 4AHPA 2Z0IA 4FB7A 1R47A 3INPA 4QQ3A 2FB3A 3LLFA 3GDKA 4IX0A 2DJXA 3NPXA 1O5XA 2GVJA 4JICA 4GC4A 3R8RA 3S8HA 4IMEA 4FNQA 1I2RA 2FQIA 2GQAA 4AEOA 1TTPA 4UR7A 3TK7A 3RMJA 1UB3A 2ATSA 2GQ8A 1JUKA 3DGRA 4D2JA 1SW0A 3STFA 3BW3A 4JGDA 4JTIA 1K8XA 3UWUA 5LGZA 3CEPA 4O13A 1T99A 4UNKA 3TXVA 1SSDA 3GNDA 5EBUA 5HNRA 4RJEA 1SZFA 4HNTA 4QSHA 3C2OA 4IMGA 1WDWA 3EB2A 3TKFA 4ORMA 3CLMA 3SFKA 3C0JA 3I68A 3P84A 2AQWA 4O4WA 3IGXA 4HPJA 3LI1A 1T8XA 4JN6A 5D2WA 5I3HA 4UTUA 4EF9A 1Z48A 2QDGA 4NJKA 4X9SA 2VC6A 3JR2A 3W1LA 3V75A 4ICNA 3TJXA 4K6AA 5LGXA 3IIVA 5HINA 1UUOA 4UR8A 4JTLA 4O50A 3T40A 4E0CA 3S9YA 4UTTA 3N73A 3MBFA 3EXRA 2E6AA 3CWNA 1RR2A 1UASA 3HPSA 1V5XA 2WO5A 2OZ0A 1SW7A 3CIWA 3HOJA 3I6RA 3L21A 1HO1A 4JXCA 3MI3A 3G0UA 2YFOA 4ZQPA 2YPIA 1FDYA 2ZA3A 4JY9A 4GNJA 3FFSA 4JS3A 1KLZA 4L4MA 3KVMA 2B7PA 5AYYA 4PL1A 5I3IA 1RPXA 3EXSA 3NOEA 3PULA 3PWAA 1JRBA 2A21A 3W7HA 3LRKA 1O60A 1L2UA 3B0PA 1F2JA 4XZ9A 3KX6A 2C3ZA 2EHHA 2BX7A 1ZAIA 1QFEA 1ZALA 3T55A 1TTJA 3NQDA 4A29A 3NQ6A 3MBDA 3W7NA 1SZEA 3M47A 3H55A 1JCYA 3DENA 3L5LA 3UZ5A 2JGYA 1SR9A 1GYNA 3MHUA 5CSSA 3WK0A 1VPXA 4LVDA 3BGJA 3W7EA 4FX6M 1TB3A 4JDYA 4HNVA 1MEWA 3I65A 4DO6A 1CX9A 1WXJA 3FJLA 4O0ZA 2O7SA 5D03A 2NUYA 3P8IA 2G96A 4UFJA 1SW3A 2CFFA 4Y6GA 1OFDA 3HG4A 2C15A 4UTIA 1GVOA 3C4UA 3E0IA 3B0UX 3W7CA 2FDSA 4P61A 3DKLA 3I7RA 1G4TA 4OHQA 4A22A 4UXDA 2CLEA 5DXYA 1W5PA 3CHVA 4WX2A 3OVRA 3SSJA 1TRDA 4QAIA 4YXGA 4PC8A 1EUAA 3QW3A 3ELFA 4UTTC 3VE9A 1T96A 1LCOA 1HTIA 3MJYA 5KINA 2VOMA 4AWSA 3SI9A 4M7SA 4JIQA 1GJPA 2DP3A 1NF0A 3G22A 1TO3A 4KFOA 5D2VA 1Q6LA 4Q32A 1Z42A 4CNNA 4JX4A 3SECA 1KW1A 2RKXA 3W1UA 3QYQA 2HS6A 3YPIA 3CPRA 3GVGA 1YPIA 3LOTA 5J5RA 3MP3A 1QR7A 2ATMA 3MP4A 4O11A 1UJPA 4UFIA 1R2RA 3W2JA 3DFNA 4AF0B 3BW2A 1L6SA 3ABOA 1O5KA 1G69A 1TTIA 3MHGA 3TFCA 4I9AA 3NQMA 1B4EA 4ML9A 4N9DA 4X22A 3BGGA 3THQA 1ZNNA 5J5DA 3C52A 1GT8A 2ABAA 2P1FA 3S5ZA 1BWKA 1VLWA 3CB8A 4Z0JA 4HIBA 5D38A 4MZYA 4GRSA 1K7EA 3T78A 1I2QA 4M6VA 4WQ6A 4FNUA 1HO4A 3KOFA 1CI1A 1TPH1 3N19B 2NXIA 5U7SA 2ZRYA 3NQCA 3QEZA 1PS9A 3HQ1A 4N2YA 3FOKA 4H6KA 1VS1A 3LX9A 1H1ZA 5KMYA 1ICQA 4WD0A 1DV7A 2A4AA 2PRLA 3W3OA 2V2CA 5K4ZA 1WA3A 3L67A 1YYAA 4W9TA 3RF9A 4ZQCA 4K38A 3M1ZA 1F5ZA 4RKAA 1YDVA 3PBVA 3OVPA 3IV3A 4LRSA 2NLIA 4PL2A 3R89A 4IMCA 3HF3A 4Z08A 5C55A 3TQVA 4NXKA 3MP5A 3AJXA 3NL5A 1KV5A 4EWND 1OFEA 4KFPA 1FDZA 1F6PA 4N02A 1TCDA 1KLYA 2CZDA 1SFLA 4DBEA 1RVGA 5F1VA 4JY8A 2V0TA 1WAUA 4IGHA 5AYZA 3W88A 2V82A 3IIZA 3W1AA 1GEQA 3A5VA 4BI7A 3DH7A 3BG9A 2A85A 2Z1BA 3TUUA 3S1UA 1H7OA 3HJZA 3UZJA 2A6LA 4FHAA 1NFBA 1OJXA 2CLOA 1VCVA 3EWWA 1VJIA 3TMQA 4GUJA 1VR6A 4TMCA 5E93A 2PCQA 4E38A 1K02A 1LZOA 4FX7A 2A7RA 2ZQ0A 2G97A 4ZQMA 4QISA 1HUVA 3IGSA 5DELA 2XFWA 3QPYA 4KFNA 5AHIA 3QPZA 1ME8A 5LNVA 1U83A 3BK0A 4I7WA 2E6DA 1TMHA 3GDRA 4JTSA 4N9EA 5TBOA 4MZ1A 1V7YA 2E1DA 4ZL1A 1X7FA 5FEZA 3N2MA 3PUEA 4WXZA 2ZCGA 3GKFA 1QDSA 2Y7DA 4CLMA 3S1VA 5AC8A 2FTPA 2Q3RA 4DPQA 4DBDA 2Z2UA 3W1NA 3GIYA 5K4XA 3P5ZA 2YYUA 4J9JA 1TSIA 1DKWA 3DI1A 1PV8A 5AHFA 4B5NA 2JKAA 1TPFA 2NX9A 5DCEA 4R34A 5IBXC 1LLWA 1LBLA 1QAPA 4N4QA 2B7NA 2GVLA 4TO8A 4LY8A 5F4SA 2QJIA 2J9ZA 4PEKA 4ALDA 4UFMA 5HWJA 1MXSA 1DVJA 1LOSA 3LHVA 5D32A 6TIMA 1AL8A 1W5QA 4ADSA 3QRHA 3QFEA 3LCGA 1U5JA 3HIJA 3LHTA 3THAA 3QH2A 1O94A 2QEZA 1JCXA 4AMAA 1HG3A 2ZBTA 1EP3A 4PA8A 2Q8LA 4IUOA 3OEXA 3F4NA 2JKEA 1Z44A 4DPPA 2B7OA 4LT9A 3W7PA 1E51A 3EX2A 1TPC1 1IIHA 1XXXA 2F84A 2R14A 4NU7A 2PE4A 4M6PA 3W7KA 1LOLA 2FPVA 5BRBA 4OQVA 4LC8A 2VFGA 1C29A 1WBHA 1EWDA 4R7JA 1XC4A 1XBYA 2TPSA 3HB9A 3TIMA 1W5OA 3M5YA 4CQ9A 5KTLA 2Y88A 4LWWA 4ONVA 4X3ZA 5DCBA 3KFTA 1VHCA 3TAOA 5F2IA 1LBFA 4I7UA 1EB3A 2FFCA 5G2HA 4NQ1A 1TQXA 2CLKA 1LM1A 3LBMA 3PM6A 1N8FA 4UFKA 4UTHA 3EX3A 2P10A 3WJSA 3EX4A 4O18A 3UNDA 2V2DA 3TFXA 2WSQA 4N9BA 3B4UA 1JULA 3L2IA 4XTIA 1TV7A 1EEPA 1TV5A 5G4EA 2C13A 3O07A 3PS7A 3UD6A 1OFOA 4N4PA 1N55A 2BWGA 3LBCA 2C19A 4BR1A 1KM2A 1OVDA 4RX0A 4JX5A 3P82A 3ZFHA 5I3FA 1M5WA 4JYDA 5L6UA 5BOOA 2ZFAA 5D04C 1AK5A 5D30A 3PVFA 1ZFJA 3HO8A 3IIOA 3A5FA 1SO6A 3GZ3A 1OX4A 4DELA 2QCHA 4N9CA 3KRZA 2HTMA 1QPQA 2RHGA 3E9AA 3TJLA 3P61A 3W2NA 2ZZ4A 1XM3A 3LCIA 1TJRA 4RXGA 1OFBA 2Q3OA 3LTYA 3CM4A 2QAPA 2DZVA 4MVAA 4FNRA 5FF7A 4O28A 4AH7A 2BLEA 1FQ0A 2YDAA 2OT1A 1FXPA 4MUZA 4MOZA 4RCXA 5D2TA 2V81A 2XN0A 2FB2A 5K2ZA 1H1YA 3F1QA 3G8RA 5HR6A 4RR4A 2WNZA 1EWEA 3EX1A 4PH6A 4ADTA 5AOUA 3PY2A 1I2OA 2JGQA 3M5ZA 3PB0A 1NVMA 5BMWA 3UWYA 1AW1A 1LP6A 3M0ZA 1WOAA 1WV2A 4K7YA 1GG1A 4M5PA 5E0KA 2TMDA 4Z1DA 3W7RA 2R8WA 3DXIA 1QNVA 4LU0A 3C2FA 5G2WA 2CZ5A 2ISSA 4KWVA 2WOQA 5K9XA 3BG5A 1C9DA 4O12A 3MW7A 5SWUA 5FF4A 3UY8A 5G5IA 1GVFA 3GAKA 5TQLA 1AMKA 4ZZ9A 4JNMA 3USBA 4JIPA 3GXPA 1KBIA 3PG8A 5FEXA 4G1KA 1PHQA 3STGA 3CWOX 3G0SA 3M6YA 3NL3A 3KRUA 4Z1CA 3W83A 2GPTA 4MZ8A 3C6CA 4H4IA 3UWZA 2JK2A 3S5YA 2Y85A 2DU2A 1OK4A 2C14A 5KZEA 3KRSA 3N9SA 3LHZA 3WFAA 2V30A 4QM1A 3O05A 3O15A 4BK9A 3UY7A 2VELA 2KZHA 5HR7A 2GJLA 1N7KA 5IM51 1ICSA 3NQ2A 5D2YA 3ZS4A 3KHJA 1KTBA 1QMLA 4N6FA 1JR1A 4KWWA 4CCDA 4Z1AA 1IF2A 4FXRA 1GTHA 4JTJA 4KKXA 4NZJA 3PF3A 2Y89A 5LNWA 4TR9A 1KM1A 4GUFA 1KFKA 3M5XA 3QMTA 4WOZA 3W9ZA 1AG1O 3ZWTA 1UUMA 3GXNA 3W87A 3VCRA 4DF1A 3TQ0A 4IMDA 2QDHA 5AHNA 2PC4A 2I14A 1IXOA 4MFEA 4LVGA 2JKPA 1TIMA 1W56A 2YX0A 5U4NA 4PCFA 3T7VA 3HGJA 3QQ1A 2QCEA 4E2DA 1MSSA 3GK0A 2ZZ6A 2E6YA 1TPUA 3ATYA 3TDFA 3W1MA 1T0OA 2DZXA 3KXQA 2WPBA 3P80A 3HGSA 4LV4A 1OFQA 3VKJA 3DHDA 6ALDA 4WJEA 4CQAA 4UCGA 4PODA 4QIUA 4LS1A 3TX9A 1XI3A 1A5SA 3W2KA 4EVZA 1JUEA 1MZHA 1I2PA 5F1UA 3DFQA 4RZ6A 2GQ9A 4MYAA 1A5CA 3PSWA 5FESA 3N3MA 3GLCA 5G1YA 5LKYA 1EP2A 4LNYA 3W2UA 4NNAA 5D33A 1P0KA 4EOUA 3P5YA 1KM3A 2E68A 3MO7A 2FIQA 4U28A 4AWUA 3WJZA 5T26A 1WOBA 3NVTA 4HPXA 1UBSA 1TPDA 1EX5A 2FLIA 5FF0A 4RZ4A 2HSAA 3KVJA 1WBJA 4IXHA 3PAJA 3O6YX 3MYOA 1H63A 1PCKA 1FWNA 3NA8A 3O8AA 4FEZA 3TA6A 3HG2A 3SJ3A 3DZ1A 3O6DA 3DBPA 4DO5A 1LTDA 3N34A 2Y62A 4NNCA 4AWTA 2E5BA 4WUIA 4UTWC 3NXFA 4R33A 2WNQA 1SO4A 4WY0A 2V5BA 4O1CA 3NEVA 4HT3A 4FNPA 1H7RA 2V8ZA 2J88A 3GAYA 3QW4B 2P0OA 3GXTA 4LUJA 2BZNA 4TX9A 1DQWA 3C8FA 3EKLA 4S2CA 1LYXA 3W1XA 3O63A 7TIMA 3U2OA 5CSRA 1FUYA 1G6CA 2PURA 1SO5A 1GVRA 2CLIA 2Z6IA 3TSBA 1JQVA 3G1DA 4MIMA 3IIXA 4UMCA 1KV8A 3BO9A 4WOQA 4O10A 5CPOA 3GDTA 1DHPA 4O14A 4R53A 4BFAA 3G1YA 1G4PA 3TCEA 5CPNA 1H51A 3S5NA 4GBUA 1P0NA 5C54A 2VFHA 2NWSA 4IJBA 4MJMA 3SR7A 1W0MA 3HGRA 1R46A 4AVFA 2VEIA 3BLIA 3DKJA 2YW4A 3PG9A 2EPHA 3Q2DA 4FIQA 1YXCA 4MYXA 3BVJA 3S0CA 3GYEA 1JCJA 3WJWA 3GX9A 3NAVA 1PCWA 5MHBA 3NPVA 3UQNA 1SZNA 2YFNA 1D3HA 3W7JA 2QUTA 3N2XA 1PE1A 2OJPA 3MUXA 1AL7A 1RV8A 1K3UA 3W84A 2VXNA 1M7OA 1OX5A 3CU2A 2WJZA 2YR1A 1D9EA 4X2RA 1H5YA 1PIIA 2RDTA 3LCLA 4JTFA 3QJAA 1X6UA 1JCLA 3W7LA 4O17A 2TRSA 5AHEA 4LUIA 5IBXA 3UPBA 3G18A 1ME9A 4P2VA 4O8RA 3P60A 5KZDA 1AW5A 5CPLA 1DQXA 2UV8G 3P67A 1WQ5A 3A22A 4HN4A 3DU0A 2DORA 2ISVA 2YYTA 3MMTA 3PBWA 2J27A 5G2IA 3I7SA 1X1OA 3B04A 3G1FA 1DJQA 3DFOA 1OYBA 3M16A 1ZAHA 1JJKA 5E1QA 1TV8A 2ZRUA 3NM1A 3TSDA 1TTQA 1XL9A 3L66A 4HSOA 4OV9A 3LCFA 1EUNA 3L9CA 4YMZA 3C61A 5A5WA 3HPXA 5L9FA 1XDLA 1A53A 1VHNA 1GG0A 2QCCA 3EX6A 3IGUA 4NVTA 2NUXA 2QCDA 1B57A 2YW3A 3NQAA 3QQ0A 4UFHA 3NQEA 2C18A 4DXVA 2B7QA 1GVQA 2Y70A 2QCFA 2Y7GA 3C2VA 5HUOA 3CIXA 4OV4A 1NAL1 1VZWA 4UMAA 2W0UA 3P81A 1RQEA 1XBVA 2H3DA 2A5HA 1ADOA 1GPWA 3W71A 1J5TA 1IIGA 3B8DA 2B4GA 3OBKA 4Q4KA 5FEPA 3Q58A 3LV6A 3G1AA 4Z1BA 3CQ0A 3GB6A 2VFEA 2G95A 2A2IA 5D2XA 3ATZA 3TAKA 2X30A 3C2RA 3PSVA 3TROA 2ZA2A 1J4EA 1OYAA 3B03A 2ZYFA 4LC6A 1SSGA 2VENA 5I3JA 2BTMA 1VGAA 1HL2A 3NYZA 2CLHA 5DY3A 3K30A 5BW6A 1TRIA 2RFGA 1IXNA 1PHWA 3C3NA 3ZR4A 5BNKA 4CQ8A 1XUUA 1G4SA 3KVLA 3NQ7A 4MKNA 2QCLA 4XUGA 3L0GA 4AHOA 3RU6A 5AC7A 2TYSA 3FA5A 1W37A 5D09A 1W54A 5H91A 1XUZA 1ONRA 1QWGA 2C0AA 3G0XA 5DCDA 1X1ZA 2E6FA 4ZQRA 3NDOA 4L4LA 5HWMA 2O7QA 2X1TA 4NJHA 3W7QA 5HJLA 3DAQA 3SW6A 1Q45A 1QOPA 2RH9A 2XN2A 4FF7A 5C5YA 4OWGA 1MEHA 3E02A 4O52A 2WQPA 4MLJA 3TC7A 3FLUA 3ABQA 1TPVA 1ZHAA 4BI5A 2TSYA 1EA0A 3LB0A 1SZGA 3UPWA 2ZA1A 3R13A 4GUIA 3FEMA 3G1SA 1RD5A 3SIZA 3QMSA 3PC0A 1H7NA 1OYCA 3IVUA 1QPNA 4CCCA 2X1RA 3LRLA 3PUOA 1A50A 3SGZA 4JYFA 3EWZA 5F2GA 1I45A 3HG3A 3TSMA 1OHLA 4POCA 1XBZA 3QSRA 1YLVA 1OX4B 3UWQA 4BWLA 2WSYA 3S42A 2WKJA 1JVNA 1KM6A 4RK8A 3NGJA 5KSWA 1PL9A 1P5BA 4IXXA 3G1XA 2CZFA 1JQXA 1Y0EA 4QNEA 3M5VA 1W5MA 4RZ5A 5FF3A 3G3DA 4K8EA 1DL3A 1LDCA 1XBXA 2DJLA 5D05A 5LHEA 2ZRVA 3H54A 3TE9A 5K7JA 2E77A 2FPTA 1F73A 3H53A 1O95A 4O0KA 3SY5A 3U8GA 5KITA 3NQ8A 1R30A 1YDOA 2X1UA 4DF0A 3LM7A 2CLMA 3WK1A 5LNRA 1LRQA 5F2MA 5LNSA 3W86A 1H7WA 3MWAA 1LRTA 1M6JA 5CZJA 2CW6A 3QM3A 4MY1A 5EY5A 3TR2A 3OA3A 5AB3A 4YL2A 2W6RA 3PBYA 5FF2A 4IPJA 4JTGA 2VKZG 4JR5A 2PRHA 3NPWA 2ZTJA 2I1OA 3W7OA 1A5BA 3ANYA 4NT0A 1EP1A 1ML1A 2QCNA 1OFRA 2FPYA 1KM0A 2ABBA 2OT0A 4BF9A 5LZLA 4YWIA 3JS3A 3PB2A 3W70A 5AFDA 5KZMA 3LGEA 1Q6OA 1H50A 4OGZA 4IX2A 4NX5A 3U6WA 3W1QA 2H8XA 3MI6A 1YDNA 5CZTA 5EKYA 2G5WA 3L0KA 3Q37A 4JEQA 2V5LA 3GKAA 2ZDRA 1ZAJA 2XN1A 3TXZA 2Y7EA 2EKCA 1QPRA 3LTSA 4HNUA 4NJGA 4OBTA 3QMRA 1XDMA 3P74A 1BKSA 5CKSA 1W3NA 4UNLA 3W7IA 4EIVA 1JUBA 4BWLC 4GXMA 1P4CA 5K9CA 5C6MA 2QUVA 3BLFA 2CLLA 3A9IA 2Y61A 2QR6A 1GVSA 3STCA 1LBMA 5EPDA 5EA9A 1OF8A 3W72A 1OF6A 3TU9A 1FWSA 2YXGA 3S1WA 4S1FA 4DEFA 4QNWA 4AXKA 1SO3A 2E5CA 3L0NA 4WZHA 3B06A 3NQGA 5AC6A 3LCHA 2Q8ZA 5HUPA 4XKYA 1I8JA 2I9EA 1GQNA 3A23A 3G24A 3I7QA 3HBLA 3W74A 1F05A 4GUHA 4MY9A 1GWJA 1EIXA 1OG0A 4K8HA 2QJGA 5FEWA 4NJJA 1QCWA 2EGZA 1FX6A 3NL6A 2WNNA 3RFAA 1VH7A 1R2TA 1F6KA 3WK2A 1FY6A 3OG3A 1K7XA 3O1NA 1HFBA 2GOUA 4UTMA 4MY8A 4UMBA 2ISWA 3KAOA 1RZMA 3PUDA 3QSTA 3W07A 2NX1A 2ZZ5A 5AYXA 3M41A 1ZJIA 4K37A 2J24A 5CGQA 5HULA 4RLIA 4ORIA 1H61A 2VFIA 4GJ1A 4UTWA 3BV4A 4LVBA 5HQEA 3FKKA 1BWLA 4LS2A 1M7PA 1XFBA 1IXQA 3NPUA 3L5AA 3UXAA 4Y90A 4S2BA 2Z6JA 4RXFA 3LXBA 2OMAA 2ZRXA 1Q3NA 1NF7A 3JRKA 1TPEA 4A2SA 3DFSA 5LSMA 3LXCA 1W31A 3STEA 4NUWA 2A1YA 3IIPA 3M7WA 3G8EA 3LHWA 4NX0A 3DFPA 1G7VA 3B0VC 3M9YA 1W1ZA 4Y8FA 8TIMA 4A3UA 3ABRA 4FX8A 1S5TA 1FWWA 1QOQA 3IVTA 3DFTA 1D3GA 4OT7A 3TC6A 5DN1A 1FCQA 4NJIA 2DZWA 2YGYA 2YSWA 4WY0B 1Q6RA 1F74A 2GJNA 2JBMA 2QF7A 1G67A 3DI0A 1H60A 3IVSA 1VYSX 1JCMP 2HS8A 3B05A 5LNUA 2WV8A 3SGUA 1KM4A 4UUIA 2E5DA 3NZ1A 5AN7A 2GUUA 3CEUA 3SZ8A 1H7PA 2IQTA 3NZRA 4XQ6A 4K7VA 2VFFA 3S1XA 3NQFA 1SFJA 3FYPA 4GFSA 1VYRA 3F03K 2A0NA 1TPB1 1THFD 4IPIA 5AHMA 3LRMA 2OX1A 4QITA 3LXAA 5F4WA 5D02A 4LVFA 1LORA 4O19A 3G1VA 2AAMA 3DHFA 4ZQNA 4C1LA 3W6YA 4XBSA 1DBTA 4LVAA 1Q6QA 3NQVA 3W7DA 1BEUA 3FIGA 4LTSA 3E49A 3Q94A 2W79A 1RQHA 2J6XA 4HSNA 2NWRA 4DO4A 2H90A 4Y9AA 3W85A 1B9BA 1WX0A 4E2BA 4FXSA 1XKYA 2FJKA 4C1KA 3GR8A 2CWNA 5LHFA 4MPQA 1FCVA 4WY0F 3RLUA 4IWWA 1ZY9A 3L65A 3TV8A 4FNTA 3FJ6A 1IXPA 3VNDA 1OFPA 2CZEA 3EKZA 1L9WA 5DLCA 1FWRA 3O06A 4FO4A 2ZZ1A 1L6YA 1KFJA 3C56A 3LI0A 4Q33A 1ZENA 2DZTA 4IMFA 4HHPA 4CNOA 5AHLA 1LROA 3MHFA 1QPOA 1YXYA 4GWEA 1ZCOA 5G4WA 1ICPA 3LCWA 5H2ZA 1GOXA 2X16A 3S6DA 2ZZ3A 3CT7A 1KM5A 1SQ7A 2QKFA 4Y96A 3T44A 3NM3A 1MEIA 1B3OA 1KFEA 3BARA 3P8JA 4JDBA 3W73A 2RDWA 4ZVJA 1S5WA 5I3KA 3GNNA 1G4EA 3E96A 1VCGA 1DOSA 2Y7FA 3UWVA 2OCZA 3ABSA 3EEGA 4O15A 1VC4A 1YTEA 3FS2A 3A21A 3W1TA 1FCUA 1X8FA 3QF0A 5DXXA 2QCGA 2NUWA 3TMLA 4ZMGA 1W5NA 1SUXA 2E09A 3M43A 2QCDB 1YADA 4A2RA 2DZPA 3AO0A 1YXDA 3F4WA 1QO2A 2A6NA 4JYEA 4AF0A 3E12A 4HKPA 2X1SA 2D73A 2V2HA 3VE7A 2CLFA 1KFCA 2NV1A 2B0MA 2NZLA 4GUGA 4RV8A 1ME7A 2A7NA 4M7TA 1KBJA 1K03A
chains in the Genus database with same CATH superfamily
1R7AA 3V1PA 2YCIX 4DF2A 3FKRA 4X61A 4UTKA 3ZT5A 2KAUC 1S3HA 1Q6GA 1BYDA 2ZZ2A 4FI4A 3UXDA 2Y8VA 1R9YA 1V02A 4M51A 1KA9F 1FWJC 4K68A 4LYRA 4CN1A 4JNYA 4L61A 4TU1A 3HGOA 1W1B1 1LWJA 2V67A 4K1GA 2ALDA 4YLWA 5AC4A 1NEYA 3P62A 3TW7A 4DJFA 3CQIA 5F4XA 5A95A 4N6EA 2FH8A 1V0LA 2NXHA 3TYBA 1EDTA 5HWNA 1XV8A 1L2QA 5TIMA 1V6XA 2OX4A 3W1RA 2XVLA 4WXYA 3AXIA 1NDWA 4LS0A 4K39A 4Y9MA 1W8GA 3CV1A 4RW3A 3MYPA 2X2GA 3WLSA 5G4HC 3EEZA 2XFRA 2YZRA 3AIBA 4GQGA 4S3EA 3G6MA 4HU3A 2Y6ZA 3O6AA 3W76A 4JTKA 1XP3A 2G37A 1YMYA 4IPPA 2VRJA 4KETA 5K3VA 4LRTA 3EWUA 1KQZA 1W1PA 4FNSA 3EWBX 2QMJA 4FLRA 4IISA 3RO6A 1VQTA 1GTEA 3VOHA 4JIHA 4AX7A 1Z69A 4JKKA 1UZDA 3OIXA 1ISYA 1R2SA 1ALDA 3RK8A 2R1LA 5A2BA 2Z1KA 3EZ4A 3VPLA 5CZSA 3BLDA 2NV2A 2LLEA 4I9TA 1QNSA 4LUTB 2XIMA 4JN8A 4HOXA 2VZVA 2IPJA 1LWHA 3TZFA 4AAJA 2VEKA 4D6IA 3GDBA 1AD1A 5T9CE 3WQFA 4UTJA 4CNPA 1XRTA 1MO0A 5CG7A 1F7BA 5G1MA 4JTQA 3VO0A 3WK3A 3IEBA 3B97A 1SU5A 2OFJA 3XISA 4ZEPA 1XLLA 1TZ9A 1M9HA 5DY2A 3EWXA 3CZLA 1XLDA 2XG9A 4IFRA 4IQLA 1MRAA 2OG9A 2ZTKA 3MCMA 4LX4A 1P1XA 4LUTA 5B80A 3RNDA 2BHUA 3TOYA 4IIBA 3G3MA 4EE9A 5EYWA 1YTDA 5B7ZA 1KBKA 2W67A 3KVKA 4NXSA 1GKPA 3U0HA 3JVAA 4JTTA 5CZ0A 3W1PA 4D1JA 4XD6A 3HPZA 1LRNA 3GZAA 4CQCA 1JRCA 1OX6A 2QT3A 4PRTA 2PRMA 2R24A 4OU1A 4WRHA 1XIDA 4MKSA 3L12A 4NZFA 3NL2A 5EMUA 3N9RA 2EG8A 4RDVA 4O4VA 1PTAA 3PJWA 1ISZA 2D3LA 3VK5A 3HURA 1GKQA 2R1MA 3UZXA 1IR1A 1ISWA 3R10A 4JHZA 3NO5A 5EL1A 1H62A 1XX1A 1A4LA 1R9ZA 1QTWA 1FXQA 4OKDA 1KTNA 2Z29A 3M7SA 2PDFA 1M03A 2QCMA 2WSRA 1LL6A 2GUYA 3LCXA 2C1HA 1BFNA 3K1GA 3V36A 4GZEA 3RM8A 3BW4A 4YCOA 1JCNA 4WVXA 4TIMA 5C2GA 4ZE5A 1UC4A 2Z0IA 4DAIA 3INPA 1ZBWA 3SUTA 1O5XA 2GVJA 5FAJA 2SFPA 2VZOA 2CZVA 2VC9A 1I2RA 1NIUA 3SGGA 4AEFA 2BXYA 4AEOA 3RMJA 2XVPA 3DGRA 4D2JA 1K8XA 5BXRA 5LGZA 4LYKA 1T99A 1B5TA 3SDOA 1EDGA 4CCZA 5A8OA 5EBUA 3ABZA 1ZP3A 1SZFA 4HNTA 1NM9A 3C2OA 3OQEA 1WCGA 2GWNA 3EDFA 1MUCA 3EB2A 2BVWA 3VX1A 4IFKB 2XM2A 1GW1A 2WMIA 3DHUA 1NQKA 3CMJA 4X63A 4H7ZA 1T8XA 3SURA 1B1YA 4JN6A 2OQLA 3WDIA 4D8AA 1Z48A 2OEJA 1D8WA 1DWHM 5H8MA 3MMUA 1MW3A 3V75A 5LGXA 5HINA 1UUOA 3BLPX 4JFTA 4U3AA 3T40A 4UTTA 3RO8A 1V5XA 1K8CA 3CIWA 2XU2A 2XH4A 4H2HA 4F0SA 4P7NA 1ODZA 4ZQPA 1F6YA 5A69A 5HATA 2VT0A 4NP7A 4OOUA 3FFSA 4L4MA 5D9NA 3IJLA 4XBJA 1BXBA 1EIBA 4ZGYA 2DH3A 2L5HA 3W7HA 5C70A 2F9RA 1OGBA 1L2UA 3B0PA 1F2JA 4PUMA 4GVGA 4CGTA 4C6IA 2EHHA 3ZJ8A 1ZALA 3LQLA 3NQ6A 3F2DA 2HVMA 2JGYA 4JPGA 1VPQA 1CX9A 3ERPA 1UJQA 3FJLA 2NUYA 5HNUA 3IV8A 3V5CA 1RPKA 3D3FA 1GVOA 3AMCA 1RUSA 4M80A 4R7OA 3C4UA 3E0IA 3V4BA 3T07A 3W7CA 5JH2A 5M5DA 4EPDC 5I78A 3UG4A 3T0BA 3KRBA 4UXDA 2VYOA 4Z2HA 4YXGA 2DW7A 1EUAA 2GDQA 2IKHA 3VGBA 4KCVA 3T6CA 4L9XA 1ZUAX 2HNEA 3NZGA 3KP0A 2WMJA 2J7DA 2VEFA 2WBGA 3QY7A 5CPSA 1B3WA 1LCOA 3GNOA 3E1F1 2OLSA 5KINA 2VOMA 4AWSA 3SI9A 4JIQA 4GQ0A 1E6RA 4R88A 1DQUA 3PBMA 3IJ8A 1XW8A 4HN8A 3NURA 5DEZA 1JDDA 4KBXA 3AMGA 2G3JA 4UQAA 3GHUA 3PZTA 2EPNA 2RKXA 4IT1A 2HS6A 1BVZA 2PLMA 4S3JA 4GINA 1LT7A 3BW2A 3E2RA 1V0KA 2FGBA 3C3UA 3ABOA 3UJFA 1G69A 3TFCA 4I9AA 2BVYA 1NWRA 3N1AA 4ML9A 4N9DA 4KH2A 4GIYA 4HU4A 1ZNNA 1Y5XA 1GT8A 4MHBA 3A3XA 3CHCA 4DWSC 1GCYA 2NVCA 1JZ5A 2VR5A 2BFGA 4BF5A 1VFFA 3ZM8A 4IJCA 5D38A 2W3ZA 4GRSA 3S9ZA 2GK1B 3I10A 4LBRA 2C1IA 4IMAA 1UZ1A 3IJIA 5U7SA 2ZRYA 4O0QA 3C0QA 1TE6A 4QRNA 3HQ1A 1VS1A 1H1ZA 4PMRA 1ICQA 2DPEA 3O7UA 2PA6A 1J5SA 4XIAA 1XH1A 2Z27A 3TP4A 2VRKA 2CHRA 3APYA 3E2VA 1PZ0A 3RF9A 4K38A 1YDVA 4W7VA 3CQJA 3IV3A 4LRSA 2NLIA 4PL2A 4PCNA 4DM1A 3HF3A 4Z08A 4HYWA 4J3WA 3VXGA 3GTNA 1HVXA 3SRFA 3CZEA 1YBQA 2QJNA 1OZMA 1KLYA 1RVGA 5F1VA 4JY8A 2XISA 4IGHA 1ADSA 3WF2A 4L56A 5I24A 2XFYA 1WDPA 3URAA 3FCPA 1MQRA 1RCQA 4AQLA 3GE7A 4PMQA 4AIUA 1DIOA 4HNCA 3WF3A 2G97A 3QPEA 3CQKA 4W8AA 4CNUA 3QPYA 3MUCA 3GU1A 1U83A 1IWAA 3LMYA 1XQKA 1K4GA 4N9EA 3WG6A 3GVQA 1TR9A 4QS5A 1EBGA 1X7FA 1KGXA 3VNLA 1JAEA 3PUEA 4WXZA 1W1VA 5DX7A 4C6PA 4DPQA 1PWMA 3LYEA 3VU2A 3VKCA 3OTRA 1BRLA 1DKWA 3VD3A 3DI1A 2A3LA 1PV8A 3MKKA 4R34A 4ZB2A 5IBXC 1LLWA 1LBLA 4FMVA 2B7NA 3LEPA 4LAOA 2GVLA 4C6DA 1JNEA 2QJIA 4ALDA 1MXSA 4D6HA 2NVDA 2DH2A 3LHVA 4B5TA 4EPKA 1FH7A 1EF3A 1W5QA 4KCUA 4ADSA 4K1WA 2W91A 2BNJA 3LCGA 2A3CA 6CGTA 1SJBA 1CT5A 4HK5A 3UBPC 1HG3A 1XKJA 4BS0A 4N42A 4MDPA 4ACZB 1EP3A 4RE2A 2WM1A 4HMDA 2WANA 3W25A 2O9PA 4XAYA 2Y2WA 1PTGA 4CEUC 2JKEA 4U10A 4BCEA 4HNLA 4DPPA 2B7OA 3GO2A 3AHVA 3EX2A 1B9ZA 4C6FA 4NU7A 1Z3NA 4TX6A 5DMLA 2I17A 4XIMA 5BRBA 4OQVA 4DYKA 1C29A 4ZO9A 1XC4A 3T8LA 1B3XA 4CQ9A 5GNXA 4W88A 4HPNA 2I7GA 4PB5A 2ZUUA 2CBIA 2OXNA 1NDVA 1LM1A 3LBMA 1T5AA 2I57A 3NSXA 1BSIA 1DTUA 3M0VA 2P10A 3QR0A 4HHHA 1S5NA 1Q5MA 3TFXA 2WSQA 3B4UA 4W8LA 1TV5A 5G4EA 3OPSA 2JFEX 3PS7A 1T7LA 3UD6A 1AH4A 2HDJA 1P48A 1OFOA 4N4PA 4PB4A 2VR4A 4C6JA 4W93A 5I3FA 2W63A 3VIJA 3OJGA 2EPKX 4CNSA 3PVFA 3IIOA 2VC5A 3A5FA 4DUOA 2F38A 5AZ1A 2QCHA 1VFMA 2XIQA 3P61A 3K8KA 3LCIA 1GHSA 4RXGA 4F9DA 2Q3OA 4NYUA 2VQUA 2QAPA 2XH7A 2OO6A 2DZVA 3BANA 4XD3A 3PK7A 4OUEA 4DY1A 4D9PA 2XPKA 3OLEA 3AHYA 2BHYA 1RLDA 3IGHX 4LALA 2PWDA 5K2ZA 3IANA 3T4WA 2ZWZA 4RR4A 4UZSA 1XLCA 2J13A 1GVYA 1F07A 2P5NA 3M5ZA 5BMWA 4NZ4A 1AW1A 1LP6A 1WV2A 4K7YA 1O7AA 4DN1A 2R8WA 4B90A 3TTOA 3WLTA 1GPFA 2PP1A 2XM1A 5G2WA 2HQAA 2CZ5A 5K9XA 3BG5A 1OD0A 3H22A 3ARVA 4PBEA 2VQTA 1US0A 3TQPA 1ZTVA 1J18A 2PDJA 3EKGA 5C71A 1HIZA 3UETA 5ABHA 1GVFA 3GAKA 1S2UA 5FA5A 1HP5A 1P0BA 4JNMA 3RILA 2E8ZA 4J2PA 4Y9PA 4GNVA 3GXPA 5FEXA 3G0SA 4GXWA 3BDKA 1A5LC 1QXLA 3A6OA 3PZQA 4IGMA 4DJEA 3CUZA 2GPTA 3C6CA 3V7PA 4H4IA 2JK2A 4KESA 2Y85A 1E71M 3GYCA 2DU2A 1TJ1A 2J74A 1R3QA 3N9SA 2JEQA 1P1MA 4QM1A 5T8GA 2VELA 5DO8A 3A13A 4QR6A 3GG8A 3ZS4A 3KHJA 1KTBA 3H23A 4Z1AA 1IF2A 1GTHA 4NZJA 3GNRA 2UY3A 2PTZA 4OBSA 4TR9A 3GR4A 4JNZA 1KM1A 3MU7A 2WZIA 1KFKA 3M5XA 4MWAE 4AY1A 4GD0A 3ZWTA 3MWCA 1UUMA 4S3AA 1YX1A 4DF1A 1O1HA 4IMDA 3LPPA 2I14A 2J6VA 1IXOA 1A5UA 4LVGA 3MY9A 2ACQA 1Q85A 2YX0A 5EU9A 5U4NA 4PCFA 1DJYA 3K4DA 1KD0A 3QQ1A 4E2DA 3GK0A 2E6YA 1TPUA 1GOWA 3ATYA 3BQ6A 3QXBA 3UERA 2V5CA 4LV4A 1FWEC 4GIRA 4WJEA 4NAEB 3R6IA 4UCGA 4QIUA 1UKSA 3GH5A 1MZHA 1XYAA 3QY6A 1UR1A 3PSWA 5FESA 3DC8A 3QBUA 3AYVA 4ICMA 5LKYA 1GK8A 2ISDA 5TAOA 3MS8A 3W2UA 2XSAA 5LIKX 3SIMA 2E68A 1Q8AA 5E0FA 4AWUA 1W9DM 3PZUA 4AUBA 1WOBA 4XAGA 1UBSA 5A6KA 4ZXOA 4DLFA 3KVJA 1WBJA 3G77A 1XRFA 4LY4A 2JE8A 1HVQA 3SUUA 1H1NA 1F3WA 3QZAA 3CYJA 5JUVA 2J7HA 3SCNA 4XVDA 2V3GA 3W0KA 3O8AA 1R9XA 4FEZA 2Q09A 1CEOA 4NAEA 2D23A 4PSRA 1C7TA 4DO5A 3USZA 3RCNA 4AFYA 1HKJA 4QG6A 2IQDA 2OSWA 3NXFA 3EMQA 4WEVX 1JDAA 4HT3A 3OGVA 4ZCWA 3KBJA 1UA7A 3WZ0E 1FHDA 4LUJA 3AICA 4S2CA 3O63A 3MPGA 3TSBA 3E0LA 2VX7A 1JQVA 3SAZA 3G1DA 1KB3A 1KV8A 2YDSA 3VM5A 4AZCB 4IQEA 5CPNA 2Z7GA 5D9MA 3ITXA 3RX3A 4J3SA 1SFTA 3KCJA 1LQAA 2NWSA 3L4WA 2HEJA 2RJHA 3HGRA 1ZU8A 4AVFA 4G7FA 2GJXB 3SN1A 3Q2DA 1YXCA 3BLOA 1JCJA 3WJWA 1PCWA 3B9NA 3NPVA 3UQNA 5H8UA 3PTKA 1KCZA 2YFNA 3W7JA 1N8WA 4ZFCA 3CB3A 1E0XA 4XX6A 3VX0A 1K3UA 3N2TA 1JF5A 4GK8A 3B9AA 1LWIA 4AZCA 2TRSA 4LUIA 2PD9A 3REQB 5JU6A 5KZ6A 3VMNA 4B9YA 2ZDSA 4ZENA 1ME9A 4P2VA 3FW6A 3P60A 1X6LA 3P67A 1WQ5A 4I6KA 2BY1A 2O4MA 1R0MA 1W1TA 5I77A 1QNOA 2ISVA 3MMTA 4BEUA 3WQ4A 2J27A 3AHZA 1X1OA 3WD2A 4IFOA 4I3GA 3ID7A 1CIUA 1HZYA 4NI8A 3TSDA 2QHAA 4H8HA 3DG6A 3L7RA 4Z2GA 1BQCA 4WKHA 3L9CA 3C61A 1E73M 3IAQA 3BOFA 3U48A 3IGUA 4NVTA 4QLLA 5CPQA 3UR5A 1UD5A 2C18A 2Y70A 3LD5A 4LF1A 4OV4A 1RQEA 5FSEC 1XBVA 3ITYA 1GPWA 1KWKA 1D7FA 3BMVA 1M7XA 1Q65A 3G1AA 1V6YA 3ES8A 3POHA 2G95A 1QASA 2GGGA 2Z1WA 4KGJA 3TAKA 3VIOA 4DJDA 4JQ2A 3TROA 2ZA2A 1J4EA 2DW6A 3B03A 1HKWA 2ZYFA 2VENA 4IJRA 4DXKA 1DTNA 1VGAA 1UD4A 1NOFA 1V3IA 4LBUA 3ZMRA 3TN6A 5BW6A 1TRIA 3C3NA 4KEZA 3H24A 2Z00A 3OZOA 3R0UA 3OW1A 1G4SA 3A4WA 3WBYA 2QCLA 4XUGA 1XG4A 2PF8A 3XINA 5D09A 1ITCA 1JZ7A 1QWGA 2C0AA 2WCGA 1US3A 2YBTA 2PZNA 2O7QA 3QGKC 3W7QA 5HJLA 3DAQA 3SW6A 3DG3A 1ZS2A 4WSJA 3APTA 1MEHA 1UD3A 3H4WA 3QZ6A 2WQPA 4MLJA 1ZHAA 1XC6A 2HPIA 3DFYA 1VBHA 3M0JA 3M0YA 2TSYA 4MNJA 4R7WA 1AH3A 1KCXA 1K70A 1EA0A 1SZGA 2ZA1A 4DJFC 3FEMA 3DEQA 1OYCA 2Z24A 3RR1A 1EFZA 3IVUA 1S3TC 2X1RA 3LRLA 3P0WA 4QHRA 4P8UA 1MQPA 5CH9A 3KZPA 3ZJKA 1OX4B 1UR8A 5BU9A 1KRBC 3NGJA 2O9RA 4C6QA 4WK9A 4IXXA 4QFUA 1KRCC 4GYPA 1JQXA 1Y0EA 3V1HA 4QNEA 1AFSA 2EG6A 1W5MA 1E5JA 4K8EA 3WLLA 1BYCA 5D05A 3QFWA 3UT0A 3CBWA 2FPTA 4DZ5A 4ACYA 2HZGA 3H53A 2PDKA 4O0KA 4IICA 1NP0A 3U8GA 3NQ8A 2ZE0A 3K4AA 1VB9A 2GGJA 3MUAA 2NSOA 4H8VA 3WK1A 3TZNA 3PZNA 5F2MA 2ZC8A 3W86A 3NO1A 4MTVA 4Q6XA 1J79A 2WJFA 3VGDA 5CZJA 4MY1A 3K4WA 3VDBA 2UY5A 2W6RA 3UEQA 2PDPA 3MUIA 4JR5A 2W4XA 5AYBA 1RY0A 1EJTC 1XSKA 4QP0A 2QCNA 3GHSA 4Q8WA 2VZTA 2GQ3A 2OZ3A 1KM0A 2OT0A 4YWIA 1CLKA 1JDCA 4OGZA 4NX5A 1ODUA 4O1FA 2ICSA 1E6NA 5E0CA 3Q37A 4JBRA 4CEXC 3E2QA 1ZAJA 2Y7EA 2EKCA 3LTSA 4Q7BA 4HNUA 3FDGA 2PMQA 3TYCA 3QMRA 4ERIA 1TWDA 1BKSA 2GLKA 3AALA 2HJPA 3N17A 4UNLA 4BWLC 3WL0A 5C6MA 3OA5A 2CLLA 4EPBC 1JL8A 3STCA 3ZOAA 1Y8BA 4Z17A 2VCCA 4H9TA 1SZRA 3TU9A 4PSPA 1YRRA 2YXGA 3S1WA 4PUKA 3WQ8A 4DZAA 4AXKA 2OEMA 5DRIA 4Q7NA 4J1OA 3LCHA 3KL5A 2PS2A 4XKYA 1I8JA 2I9EA 5EFDA 1EXPA 1GQNA 4K3ZA 3HBLA 1SM9A 3GNPA 2VVSA 4KGLA 1F05A 1UR2A 2VGBA 3SFWA 3O0FA 2CKRA 1EIXA 1OG0A 4K8HA 4W85A 2O92A 2F6UA 4NJJA 1TWWA 1W9BM 3ZT7A 3NL6A 3RFAA 2TODA 1SVDA 3WK2A 1FY6A 3A4XA 4FLQA 3O1NA 3W28A 3TYAA 5IOBA 4H7VA 1XLEA 4I5UA 1RZMA 2NX1A 2OODA 5A6AA 3M41A 5BRPA 1NDYA 2J24A 4ORIA 2VFIA 4UTWA 3ARUA 3BV4A 3MANA 5HQEA 1N8IA 1R6WA 1M7PA 4WSKA 3NO3A 4S2BA 1W1IE 2ZE3A 3LXBA 4V1YA 1LL4A 2Q02A 5EMYA 1MUWA 1Q3NA 2ZRXA 4Q8QA 1XLBA 1KGWA 3JRKA 4GPNA 3EWCA 1EGMA 3LXCA 1W31A 2QULA 1YHTA 3G2GA 3G8EA 1HGWA 3WQWA 3W01A 2VNCA 4NX0A 3DFPA 3M9YA 1W1ZA 1EC8A 1O68A 4IUGA 4FP1A 1DJGA 3TCSA 3VMPA 2YSWA 4G8TA 3SRHA 1F74A 2QF7A 1G67A 3SCQA 1H60A 2E4TA 2QLYA 3SCUA 3B05A 3LPOA 4ENLA 1KQYA 5AN7A 3U4AA 3GW3A 1N2VA 3CEUA 1LQ2A 5CCZA 1H7PA 3UPMA 1ECEA 4XQ6A 1C91A 2YLLA 2AQVA 4ZE4A 4CD5A 4L64A 3RLHA 1OM0A 4IPIA 3NVDA 3H7RA 3LRMA 1R5YA 2PDHA 3PBGA 5EMKA 3WQCA 4Q8PA 1C8YA 2OEKA 3W6MA 4AIOA 4C1LA 2CHNA 2PUZA 1Q6QA 3NQVA 1DJHA 1CXEA 1BEUA 1R8LA 3E49A 5A94A 2TAAA 1RH9A 1RQHA 4MJ2A 4Y9AA 1HL9A 4YPJA 4G5DA 4E2BA 1QWKA 1XKYA 4INFA 3FAXA 4QSFA 3MMWA 4MPQA 1ZY9A 2YB1A 3TV8A 4BJHA 1K6WA 3VNDA 2VP8A 1L9WA 4H6RA 3O06A 2VMFA 4ZA0A 2WMGA 3C56A 3LI0A 4Q33A 2GOKA 2HCVA 3D47A 3CV2A 3VIGA 1QPOA 2JIEA 1TE1A 2D0HA 3BAKA 2XFFA 5G4WA 1DXIA 2PDBA 2X16A 1BPLB 3SUSA 1SQ7A 3NM3A 4XZBA 3ARSA 4MB5A 3IK4A 3P8JA 3DUGA 1W2VA 3IJ7A 1WKYA 1S5WA 4HU8A 5I3KA 3GNNA 1VCGA 1RA0A 5E5CA 2Y7FA 3UWVA 3MSRA 3ABSA 4B2DD 2ZUWA 1XGZA 3AIEA 4O15A 1YTEA 2Y1HA 3GTFA 2JIWA 1MYRA 2X0YA 1SUXA 2YBUA 4Q8MA 4B4FA 4NL1A 3BCDA 4Q3MA 4YTQA 3FHQA 4A2RA 2OQHA 3F4WA 1QO2A 5MF5A 3DGBA 2RUSA 1UH3A 3RCMA 1AJ2A 1FWHC 4WDTA 4W86A 4LYQA 2B0MA 4GUGA 1XFCA 5HDRA 4NNBA 3SBFA 4UFLA 2EXOA 1K8ZA 1NARA 1G7UA 1KCKA 2J9XA 4JD4A 4M6QA 1E3ZA 1JD9A 1E70M 3BJTA 4QDPA 1XLIA 1LUCA 2PSNA 4F66A 3A4AA 2ASHA 4GG9A 3G1HA 1JZ4A 5IRPA 4W5UA 2BGSA 4HJWA 2A3EA 3O6CA 3ABXA 4ZOAA 3CC1A 1XCXA 4FXJA 3D5HA 1K8YA 4FIRA 3GC2A 3TQKA 2UZ9A 4AD2A 2ZXDA 1TJPA 3BPWA 3FYOA 1JFHA 3GXMA 1J2WA 1TQJA 1BLIA 2WQDA 2XVGA 1JI2A 2DVXA 1W3IA 3IARA 3ZWSA 2WHJA 2BSLA 2NSXA 2PGEA 3G1RA 2ZC1A 1SJDA 5DF0A 4JIIX 3P2VA 4AXNA 2WKLA 1NSJA 1UROA 3SCSA 4GKTA 3AHTA 1IGSA 3O2LA 4ECLA 5KEZA 2WYSA 1J8VA 3PAOA 3QGAC 4J3XA 1LOQA 4L6DA 3QZEA 3ONCA 1UCWA 3DFHA 3UWWA 2ZRWA 3NG3A 1WUFA 1SPQA 2C16A 3B0YA 4MAVA 3CTTA 5HPCA 4Q8UA 3VI2A 3GM8A 2H6RA 2H3BA 1QO5A 3HMJG 4EXAA 4PFMA 4PTNA 3QC0A 4HJFA 1GZGA 4R9OA 3PANA 1H7XA 1LLOA 1SMAA 3L5MA 4S39A 4CN4A 4J3UA 3GG7A 1A5KC 3H12A 1K7FA 2FH6A 4GGBA 3QY8A 3P7YA 3V35A 2BY0A 2OLHA 4G6CA 2VFDA 4PMUA 2ZUMA 4XD4A 3ITTA 1NH6A 2WLYA 4CQDA 3KCOA 4M1RA 1O66A 4M81A 3LTPA 3GDLA 4IIGA 3W75A 3HG5A 4K36A 2YLAA 4PUNA 3ARXA 5JBEA 1DP0A 3LERA 3AWOA 5EMMA 3WH7A 1P0EA 2EQDA 3T1GA 3UR2A 3G6LA 5I3GA 2X1IA 3OHIA 4HGXA 1TZZA 3SCTA 3O16A 2ZX6A 3K8LA 2W92A 3AUOA 1LLZA 3LSBA 4JX6A 4AZ6A 1Z41A 1I2NA 1X7IA 1XH0A 1DORA 4PUWA 5CZKA 1TPWA 3QC3A 4JTEA 4YCPA 2C6QA 3LPFA 3OVQA 5AC5A 5FJRA 4DBWA 1YTKA 3GG0A 5I79A 2F7FA 5J8LA 1EJWC 1XDJA 1PTDA 3W2LA 5G1TA 1XR2A 4QLJA 4KIEA 2CU0A 2A7PA 2VEMA 4BI6A 3W7GA 3FN9A 5XIAA 2NX3A 4CUCA 4S3CA 1FP8A 3T2PA 4MF4A 5CJMA 3H2EA 2RDUA 3WJYA 1TV2A 3LHYA 1EJ7L 3FDKA 4WSHA 1CNVA 3IUIA 3GHRA 4TMBA 1CBGA 1L6WA 1TYGA 1UIPA 3AROA 3V18A 4UC5A 1VLIA 1JXJA 3W23A 4CCEA 5C2XA 4CQBA 4M1BA 2CPUA 4OJYA 3LLDA 4RW5A 2ZZ7A 1HGYA 4EF8A 4G9PA 2QUMA 5GVJA 1W8SA 2VX5A 1OCJA 1R47A 1OIMA 2FB3A 5AYIA 3LLFA 2O9TA 5AZ0A 2Z28A 3NPXA 1VFTA 4GC4A 3WMLA 4PUJA 4S3DA 5XINA 2YB4A 4B9ZA 2XWDA 2ATSA 3ZO9A 1JUKA 2VHLA 1SW0A 3STFA 2VL4A 4JTIA 4JGDA 4JTRA 3FA3A 3KWXA 2D2OA 3RITA 3UWUA 5ENLA 3CEPA 4O13A 3GNDA 4XAFA 4F79A 4RJEA 3E2SA 4IQJA 1WDWA 1FFQA 3NIYA 1H4PA 3DHPA 3CLMA 1M53A 3I68A 1KRAC 3P84A 4B5VA 1XRVA 1XYBA 2WVUA 3ZYZA 1K9EA 4O4WA 3LI1A 4FOKA 5I3HA 4UTUA 2CXEA 3ARYA 4EF9A 4NJKA 4RDZA 2VC6A 3WLNA 1S1PA 2BY3A 1E9ZB 3IIVA 1CXFA 2YA2A 4M56A 2D24A 1X6NA 3S9YA 3FGCA 2GGEA 2BOEX 2E6AA 1RR2A 3TJ4A 1SW7A 3HOJA 3L21A 1OT1A 2YFOA 4KF1A 1FDYA 4B5SA 2ZA3A 3SEPA 4GACA 3ICJA 2G0WA 2XUCA 3K5XA 2VURA 4B15A 4BY3A 1WNOA 4GNJA 2ZICA 3WF0A 1KLZA 3LM3A 3KVMA 2B7PA 3RRXA 3TN4A 4PL1A 3I3BA 1FWIC 3FYYA 3BOXA 1RPXA 3EXSA 3NOEA 4J4KA 2Z1SA 1CLVA 3PULA 4HHLA 3W6LA 4UTFA 3PWAA 1LG1A 7ODCA 4DUXA 1JD7A 2VI0A 4XZ9A 2C3ZA 1ZL1A 1X97A 3NZQA 1ZAIA 3WELA 3SN4A 1QFEA 1TTJA 4TV5A 1RCXB 1HJVA 2Y4SA 3WKZA 4IIHA 4AW7A 1SZEA 3SCPA 2X40A 3DENA 1SR9A 1GYNA 3EOUA 3MHUA 4DZHA 3QV6A 4L65A 3W7EA 3EPNA 4HCLA 3TN3A 1MEWA 3I65A 4PMVA 4DO6A 1EO5A 4O0ZA 4DWSA 4WGHA 2G96A 1V0MA 3Q65A 4DJEC 5A2CA 4H8NA 4Y6GA 4US5A 3HG4A 3QYSA 2I9UA 1MFUA 5FOOA 3ECQA 1HJQA 3DESA 5ECVA 4L6OA 4MNMA 1W9XA 3NOYA 3VD5A 3DKLA 3UNTA 3I7RA 1A80A 4A22A 2CLEA 1TRDA 4LUSB 4Y9NA 4QAIA 3QW3A 3ELFA 4I8DA 2BOGX 4PULA 1Q7MA 3KCLA 4QLKA 2OWCA 1YQ2A 3DERA 4A35A 2NT1A 4GI9A 3U7BA 5LXEA 2F6XA 2DP3A 2BDQA 4IGNA 4W8BA 1S5MA 3NXLA 2RJGA 1IWBA 2UY4A 4Q32A 3GH4A 2XHYA 5D9PA 4CNNA 5TF0A 4JX4A 4LAZA 3W1UA 3YPIA 3RGTA 3WLMA 1PYFA 3CPRA 4C65A 4E8CA 2J75A 3MP3A 4F2UA 3ZQ9A 4O11A 3MP4A 1V6VA 3UG3A 5I7GA 4LUSA 3DFNA 4HMCA 4JQ1A 1TTIA 3MHGA 3MUY1 3NQMA 4B16A 4X22A 2WPGA 3BGGA 3I4KA 1R3WA 1RAKA 3CZ8A 4HA3A 3C52A 4I8YA 3AHXA 3P93A 3WD4A 3S6OA 4LB4A 4NZ3A 1K7EA 1FWDC 4WQ6A 1HO4A 4PTVA 2WZTA 3AS3A 2REQB 1PS9A 4IG2B 4H6KA 5KMYA 2P8CA 1AVAA 3RLGA 4MWAD 4WD0A 3LMZA 3MQTA 1E43A 1YYAA 4W9TA 1UG6A 2HVNA 4LF2A 2C0HA 4RKAA 1ZBVA 3PN8A 2PB1A 1RXOB 5C55A 4NXKA 1EJVC 4S23A 3IJ6A 3NL5A 3NWRA 4KFPA 1FDZA 1H11A 1C3FA 1F6PA 2QYGA 4DBEA 2XWEA 1BYAA 1WAUA 3GFXA 4HD5A 4JAWA 5I3DA 1CB7B 1GOQA 4MJ4A 4A05A 3IIZA 3W1AA 3A5VA 3W38A 2HWGA 3DH7A 1EZWA 3W00A 1DYSA 3KW3A 3AYRA 2DT2A 1OJXA 3R8HA 4RUBA 3EWWA 4L4OA 1AJZA 3TMQA 4TMCA 2PCQA 4FX7A 2A7RA 2ZQ0A 4ZQMA 4QISA 1IEIA 3AISA 3AZSA 1WB0A 1E4NA 3QPZA 3VIMA 1VIWA 2J79A 4QQUA 1BVNP 5LNVA 3BK0A 3GDRA 1TMHA 3P6LA 1RSCA 1VBRA 4JTSA 5TBOA 4MZ1A 1V7YA 4WR3A 2V5DA 5XIMA 4NG3A 4AZBA 2G50A 2Y7DA 2YOCA 2FTPA 2Q3RA 5FJJA 4GIEA 5BRQA 3BAXA 4HZ7A 4YS1A 4HCHA 1R38A 3IUHA 4B5NA 3CUIA 3TLLA 5DCEA 5JVLA 2CBVA 3BTNA 3THCA 2HE8A 4UFMA 3TN5A 5HWJA 1OBAA 1DVJA 4LNCA 2A3HA 2DSZA 2Y5EA 1XYMA 3VMOA 1V77A 4Z2IA 2PDCA 1XYZA 1YIXA 3SB0A 2IKGA 3LHTA 3OOQA 2PDUA 3QH2A 1O94A 3AXKA 2QEZA 5PTDA 4DNHA 2BP1A 2QJMA 1P6BA 2IKJA 4F2TA 1E1CB 2J8GA 3UF9A 3F4NA 4UR9A 1FHLA 2VX6A 3HFTA 2WK2A 1K4HA 3M0LA 4AIEA 3HQPA 4LT9A 1FWGC 1TPC1 2F84A 3VC6A 2W61A 2R14A 2PE4A 1XLFA 4JFSA 1WPCA 2NT0A 3FA4A 4R3UA 1WBHA 1EWDA 1TJ2A 4YYCA 1W5OA 3M5YA 3WLOA 4DLMA 5FIPA 3N2BA 3U7VA 4X3ZA 2P76A 3IK2A 5DCBA 4C6OA 2QGYA 3TAOA 2G41A 4FXFA 2FFCA 3CO8A 2AL2A 1GONA 4NQ1A 4ZB5A 1E15A 1YPXA 2CLKA 4UQ9A 1L8PA 4QG9A 4FPSA 1N8FA 4UFKA 1FFRA 3I6TA 1ZBKA 3EMCA 3GBDA 3UNDA 1JULA 3T0CA 1ZGDA 3CUGA 1HJWA 1TV7A 3Q67A 5BOFA 1IT8A 1JYVA 2PP3A 1N55A 1XISA 5EB8A 1DE6A 3B9DA 5A6BA 1KM2A 1XD1A 3GBEA 1E1FA 4KWOA 5IDIA 2OGYA 4RX0A 2VCAA 4TX8A 1EDQA 3ZFHA 4JQAA 1U5HA 1AK5A 2X8RA 3UU0A 3KRZA 3CL6A 1QPQA 2RHGA 5CLTA 3W2NA 2IS7A 1TJRA 3CM4A 4XO6A 2BLEA 1NFGA 1GKRA 4MUZA 1R3SA 4QTGA 4URIA 2V81A 1YE6A 3F1QA 4B5XA 3U2ZA 2INZA 3EX1A 3VOIA 4F40A 4PH6A 2ZADA 6REQA 1I2OA 4XKMA 4YIWA 1NVMA 1KC7A 1CGWA 4C6LA 3UWYA 5A1AA 4F9JA 1AJ0A 4M5PA 1E72M 2POTA 3DXIA 1QNVA 2FGLA 4LU0A 1B90A 4KWVA 2WOQA 4QCEA 2VTFA 1C9DA 1F4AA 3PJXA 4S3KA 4PMXA 3U2CA 1PDYA 3UY8A 1F3EA 5TQLA 1AMKA 1NP2A 3USBA 3TTYA 1XIFA 5CGTA 3S5SA 3G5EA 4G1KA 3STGA 4H8UA 4MKVA 4F0RA 3W02A 3KRUA 4C7FA 3H2OA 1Q4NX 3KP1A 4MZ8A 3QV7A 1QI3A 1I0BA 2C14A 5KZEA 3WFAA 3ZJ6A 1MW0A 4BK9A 4F4RA 2KZHA 2YKKA 4JEJA 5LA1A 5HR7A 3DOPA 3PZGA 3ITVA 4N6FA 3VDAA 4FXRA 4LAUA 3LQGA 3PF3A 5LNWA 2PWHA 4C6CA 3CNYA 3QMTA 3ITLA 4NASA 3FJNA 1RJPA 3ITCA 4GY0A 2PGFA 1M1BA 5BWFA 3OZYA 4FR1A 2GSJA 4ZOEA 3WD1A 2QIIA 1K77A 2JKPA 3H2MA 1TIMA 4C6EA 4TOQA 3UJSA 4UOJA 3TDFA 1G94A 1T0OA 3BLKA 1HKIA 3DHDA 3VKJA 6ALDA 4CQAA 1U1UA 5DQPA 4Y7EA 4RE0A 4EVZA 1JUEA 1AMYA 3B8TA 3SM0A 4RZ6A 2GQ9A 4MYAA 1M65A 2WVVB 1RP9A 2V5JA 2PAJA 4LXFA 5DFAA 1ZZMA 1EP2A 1EJXC 4LNYA 4NNAA 3ALGA 1JPHA 3P5YA 1KM3A 4CU8A 3MO7A 2FIQA 1P6CA 1Q4WA 1WDQA 2H9AB 5T26A 3NVTA 3QR3A 3AAMA 1EX5A 1ZRQA 3W82A 2HSAA 3AI0A 3N9KA 4IXHA 1U1HA 1PBGA 3O6YX 3H2CA 2ZIDA 3KWSA 1QI5A 4QG8A 3R8GA 4F48A 4JTAA 3SJ3A 3DZ1A 3H21A 3O6DA 5HMEA 3QQWA 3N34A 4M82A 1V3HA 4UTWC 3PJTA 4YTRA 2PLJA 1I6NA 4WY0A 5BROA 4KT2A 2V5BA 3NEVA 1JG9A 4FNPA 3IAPA 1EYWA 1H7RA 5M3WA 2V8ZA 3GAYA 3QW4B 2P0OA 4EXQA 3EGJA 2NW0A 4YTSA 4QEHA 4H6QA 2R82A 1DQWA 1GHRA 1LYXA 3L4ZA 3WQ6A 1G6CA 1SO5A 4U2YA 1X1NA 2R6OA 1JYWA 2WJDA 1XIIA 4KRTA 1V3KA 5HJYA 3ZR6A 1H51A 3S5NA 1QW9A 4GBUA 2MUCA 5C54A 1V03A 2VFHA 2ZX9A 2VCBA 4IJBA 4MJMA 3CHDA 1R46A 2VEIA 3DKJA 2YW4A 4NAFB 3PPFA 2DIKA 5JH1A 4MYXA 3S0CA 3GYEA 4P8WA 3WQVA 3GX9A 3NAVA 3QV9A 2UY2A 3GTIA 3VM7A 1S2WA 3KBSA 3SCVA 3B8IA 5HMFA 1D3HA 1XSIA 4W7WA 2QUTA 3N2XA 1PE1A 2OJPA 3MUXA 1AL7A 3RJXA 1QNQA 3W84A 5A6TC 2OU4A 3RU8X 1M7OA 4NILA 1OX5A 3UJEA 3GFZA 4S3FA 2RDTA 3UCCA 2YL9A 4JTFA 3H2AA 3QJAA 1JCLA 4O17A 3CV6A 5AHEA 3KLKA 3G18A 4QDMA 4KWSA 1SJAA 1AW5A 5CPLA 1DQXA 3A22A 4DUVA 6XIMA 3JZUA 5CSYA 1BF2A 3ZVIA 4HTBA 3B04A 3G1FA 1F61A 1DJQA 4F0LA 2XDFA 3ARTA 3M16A 4U5KA 1IEXA 1JJKA 5E1QA 2GDUA 2ZRUA 3NM1A 2QQ6A 3BCFA 4Q4SA 2F8QA 3VABA 2WM0A 3VIKA 3L66A 4ML4A 4OV9A 1VPYA 1P6WA 1H41A 5L9FA 4A8LA 1X98A 2QCCA 3CPUA 4MPKA 3LUTA 2PTDA 2QCDA 3LY0A 2YW3A 4J3ZA 4TVDA 2ZUVA 2PDQA 2B7QA 1WKDA 2D20A 3UR8A 1V7AA 2QCFA 3CIXA 1MMFA 4UMAA 4CNTA 2OQYA 2D0GA 3ZLFA 1ADOA 3W4RA 2V38A 1J5TA 3LA4A 2QVNA 3CL7A 2E25A 4PUEA 4PRWA 5A2AA 1BGGA 4Z1BA 3CQ0A 2VFEA 1JPIA 5M03A 2ISFA 2W62A 2VUNA 3ATZA 1O12A 2X30A 3Q45A 3FVMA 3IS4A 4FSAA 1UH2A 1UQZA 1UMYA 3ENLA 1MXDA 1WXZA 1XSJA 2JEPA 5I00A 3GG1A 5I3JA 5EMLA 4ZTYA 2F2KA 1GVIA 3E6EA 2FZNA 1KKOA 3K30A 1R3VA 1XGEA 4GBDA 1PHWA 4DWDA 4MDOA 1FA2A 3OGRA 4M6UA 4AEEA 2UBPC 1EQCA 3WH5A 2OZTA 5LIWX 3RU6A 4A8RA 5AC7A 8A3HA 3UJ2A 1W37A 1NQ6A 2VVNA 1W54A 1XUZA 4B92A 4AD1A 2E6FA 3NDOA 2C7FA 4L4LA 5FJPA 1Q45A 1QOPA 4TTUA 3U57A 3UXIA 1D7KA 3LS9A 3E02A 4M3PA 4O52A 5E9AA 4H2CA 2A79A 4DIAA 1TPVA 1ONXA 1HF6A 4DRSA 2E67A 2WVTA 2Y0FA 4CKQA 4UWMA 3QGVA 1UWSA 4GUIA 4EPEC 3G1SA 1H7NA 4P5UA 2Z1VA 1QPNA 3BMXA 4IPNB 1VJZA 3PUOA 3S2MA 1A50A 1V02E 5M17A 3A47A 5F2GA 1M41A 1CGYA 2W9MA 3QHMA 2GJPA 4EP8C 1E6PA 2FHFA 2ZXBA 1EJUC 4E3TA 4BWLA 2WSYA 3THUA 4TTGA 3CZGA 4MB3A 2WNWA 3FAWA 4GQRA 3VAVA 2CZFA 3WF4A 3WYZA 1VAHA 1LQ0A 3V5FA 4F0MA 3PHAA 1XBXA 3H54A 8XIAA 5C9XA 1KO0A 4F2BA 1F73A 2BGNE 2VRQA 3SY5A 1CECA 5BXTA 1R30A 2X2YA 1YDOA 2X1UA 4DF0A 4GHRA 1IT7A 2PZ0A 2DT0A 1H7WA 4Y2WA 3KUMA 4PCTA 2PC8A 2CW6A 3QM3A 2CC0A 2X0HA 1F9CA 3UFYA 3B0XA 2PWVA 2BG5A 4P7LA 3OYXA 2QPSA 3F5LA 3UJRA 1T8QA 2ZTJA 3W7OA 1EP1A 1ML1A 4JN7A 1EX1A 3UVIA 2CIPA 3PB2A 2OYKA 1G5AA 5C9ZA 2Q71A 1W2PA 3H2NA 4IX2A 3DC0A 3GWQA 3U6WA 3T42A 2B81A 2OLAA 3EDJA 1G01A 1POJA 2V5LA 1A4MA 2ZKMX 3GKAA 4HNOA 2XN1A 3GY1A 4PFHA 3TXZA 4J5NA 4AC1X 4DAFA 3MC5A 2FKPA 1W3NA 3WY1A 1AA1B 4RDYA 1P4CA 5K9CA 4ROQA 3BJFA 3S83A 2DT1A 5EPDA 4M24A 1DJWA 4GJJA 1OF6A 2I16A 1R86A 2OR2A 3VNYA 3LK6A 4MNLA 1OIFA 4EX4A 4MG4A 3GXFA 2ZVIA 3L0NA 4F3HA 2Q8ZA 4BQ3A 5AECA 4NRSA 4NZ1A 2FZMA 1PEZA 4YVPA 5FJIA 3W74A 4TQTA 3BMWA 1KCLA 4GUHA 4LEQA 5F7UA 3WBXA 1E0TA 1XYCA 5FEWA 3H2FA 1FHVA 1OC5A 1KR0A 3EDEA 3RM4A 5IHRA 1TUFA 2WHMA 3AS0A 4XZLX 1R2TA 3CUXA 3M0KA 4D6EA 1E6ZA 1Z8AA 4QGCA 4XZIA 4PCSA 1HFBA 1REQB 2QNEA 4UTMA 4UMBA 3KAOA 4BA0A 2ZZ5A 4REQB 4K37A 4KS0A 5CGQA 4RLIA 3OBEA 3W53A 1H61A 1JPKA 3QKZA 4GJ1A 4H01A 4YVXA 3FKKA 4JL1A 1BWLA 4LS2A 5HQLA 4MUPA 4Z2KA 1XF0A 2AKZA 1W32A 2HK1A 1CTNA 2OMAA 5DT5A 5E70A 1OZQA 2MNRA 4X0VA 1TPEA 4A2SA 1J01A 4UBPC 4DZIA 4IFKA 1VEPA 3STEA 4A8IA 3IIPA 1TKKA 3M7WA 1UR9A 1OB0A 4B3ZA 3F4VA 1G7VA 2J66A 3CH0A 4Y8FA 1NOUA 8TIMA 1V4YA 4FX8A 3BE7A 3VZYA 3T0AA 3GTXA 5GQBA 4MB4A 4P8XA 4OT7A 3OBAA 3TC6A 5DN1A 3UGRA 4AMCA 4E4FA 3IVSA 4FLOA 2OPJA 3PNZA 4MB1A 2YL5A 4UUIA 3NCOA 1AZ1A 2QPUA 3SZ8A 2RGLA 4K7VA 4NF7A 3NQFA 1GNXA 1A0CA 4Q4OA 4GFSA 1VKFA 1E3XA 1UR0A 4PMNA 2A0NA 4KEMA 1F8IA 4IHCA 2J25A 3SRKA 4KCWA 2OX1A 4QITA 1LORA 4O19A 1QVBA 2FTYA 3DHFA 3MSGA 4ZQNA 1J11A 1HNYA 2WC7A 4XBSA 3W6YA 3K46A 2CXGA 1CPUA 3W7DA 3FIGA 2PDXA 4HMEA 3Q94A 2W79A 1UOKA 4HA0A 3VKKA 4HSNA 2NWRA 2H90A 3FX4A 3W85A 1QBBA 3R4IA 1VFUA 3VOGA 2OOGA 3GR8A 2QZRA 1FCVA 3RLUA 1KBLA 4IGSA 4IWWA 1IXPA 1CXLA 3EKZA 5DLCA 1WO2A 1FWRA 2BY2A 1L6YA 1J0YA 1KFJA 3R79A 4PTXA 1ZENA 4IMFA 1UWAA 2HBVA 3CUJA 1H3GA 4H9UA 4GFIA 2O4QA 1GOXA 3S6DA 2ZZ3A 3CT7A 3FEQA 2QKFA 3T44A 4QEEA 4AD4A 1B3OA 1KFEA 4AC7C 1V79A 3T0TA 1M7JA 3TTQA 4LANA 5D8ZA 4ZVJA 3WQOA 3CQHA 3U9IA 4LCRA 3GC4A 1TELA 2VM8A 3W1TA 1FCUA 1X8FA 1R3YA 1ONWA 1TA3B 2OWWA 4BZYA 3MB9A 4OUIA 1V8EA 2A3AA 3RCYA 2WC3A 2Y5SA 1YADA 2FVMA 2DZPA 1YXDA 2E7FA 5BXSA 3NGFA 3E12A 2YCLB 3DYOA 2DSVA 1DEDA 1CXHA 5A8PA 1XINA 1B0IA 1CGVA 3PZMA 3UESA 3AZTA 4H3DA 4CD4A 3WSUA 3N6JA 1BHGA 1ZPTA 1DJIA 1C8VA 2D3NA 3GDMA 3BL3A 3H26A 5IHSA 5D37A 2RDXA 1IYXA 1I9CB 1QI0A 2PEVA 1QNPA 2V9DA 4MAZA 2GK1A 3GTHA 4GNKB 1QW8A 3HZ3A 2Y63A 3W26A 5JXQA 1PZ1A 1IHIA 1B30A 3WLIA 2OB3A 4WGXA 1VRDA 5JIWA 4XK2A 3VFLA 1GGOA 3SSZA 3JZEA 2XJ7A 4MFDA 3GD6A 1CB2A 2IPFA 2HMCA 3MZ2A 3MA8A 2WHKA 3TNOA 3V0TA 5F2LA 2EAWA 1GJWA 4O57A 3PBUA 1V6UA 3A12A 3UR7A 1TV4A 1WZMA 3CH9A 1TMQA 1G1YA 7CGTA 1FBAA 1ESWA 1GZJA 1NJJA 1E4MM 4A21A 4ZFMA 1J6PA 1I4NA 1RJRA 3VZZA 1UKTA 2PI6A 1XPYA 3N14A 1ZJBA 4OVXA 4GE8A 4C7DA 1VJSA 1XCFA 3MI2A 4GISA 2XH0A 1EHAA 4WJXA 5HPOA 4LEFA 4MJZA 1EPVA 1UR4A 4WDWA 4GZJA 4XO7A 3AYSA 1T6MA 4EXBA 2DFAA 4YJ5A 4J7RA 2P88A 3PFRA 4JTUA 3GR7A 2ZRZA 1Y65A 1ITXA 4IZGA 3FXYA 5HMSA 1Q8JA 4FS9A 4O53A 3U5UA 3PR2A 4QJ1A 4Q8TA 2E9MA 1HKMA 1E40A 4ASTA 3AWNA 2R91A 1W3TA 1VEMA 2HPMA 2XTKA 1JZ3A 3UYCA 2YXOA 3TA9A 1FTXA 1LT8A 2QF8A 1A5AA 4OE7A 4RE4A 1TREA 3ARPA 3R2GA 4U3CA 2EBNA 1MVYA 2AGKA 2J9YA 2WWCA 3C2YA 3WEOA 3IPWA 1EH9A 3HJEA 1ADDA 2POZA 4AB4A 5ABTA 2VEPA 4I7VA 4JHMA 5FACA 3U4FA 1QK2A 4U4MA 4ZTXA 3EAUA 4ACZA 5EGRA 1XYFA 2DUZA 1DJNA 3BXWA 4IOTA 4ZOCA 5CAKA 2R94A 3WIJA 4H00A 3DIPA 1OFAA 4R9XA 1AQFA 1EJRC 4JTHA 5A8GA 1TMLA 3NUKA 3NR0A 3TWAA 3EWYA 2G4JA 4M19A 4PTMA 4CU7A 4ADUA 1F76A 3WQ5A 1TVLA 2PCEA 5GJPA 1UA3A 2X42A 3BGAA 1E9LA 5MKGB 3C2EA 4IPLA 1DIDA 2XGBA 5H1WA 3NNTA 3VOFA 1PZ3A 5I09A 4D6DA 4AHQA 2ANUA 2E28A 1EA9C 2QJHA 4LV9A 3A24A 1OWQA 1MNZA 1KFBA 4CD8A 4GCXA 1OABA 2ZOXA 4XBKA 7REQB 4LW7A 1IR2A 4IIDA 3WDHA 3VKBA 4C7GA 1JI1A 3D0CA 3IRDA 1TX0A 3TYZA 1WYIA 5BMXA 4OECA 4JL2A 1MWOA 3URBA 4FB7A 1Q6DA 3BQ5A 2C91A 1GW9A 3OQ8A 3GDKA 4JICA 4XUYA 2DEPA 3ZXWA 1SFSA 3R8RA 2JF7A 1AODA 4FNQA 1S2VA 3EOOA 2WZMA 2FQIA 2VWSA 2HISA 2GQAA 4L5ZA 1OINA 1UB3A 3BV7A 2PWGA 3VNKA 2PF0A 2CNCA 2R1KA 4LQ1A 4UNKA 3TXVA 3RM9A 3VCCA 2C8NA 2PLCA 7REQA 1J0IA 3O0KA 1H0GA 3H7VA 3R0KA 4DVOA 3WD0A 2E9LA 3OG2A 3H70A 4ZXLA 2AQWA 4AIBA 3TYUA 4E4UA 1VENA 7A3HA 2BMBA 3VGGA 2PDYA 4AD3A 1NELA 2VOTA 2XSBA 3UXLA 2QDGA 1NWUA 1JZ6A 3W1LA 4ICNA 3TJXA 4K6AA 4H83A 4WCJA 1UD6A 2IKIA 2YL8A 4NZ5A 1JDFA 4UR8A 3K2GA 4O50A 5HJXA 4E0CA 3RG6A 4E3VA 1MUMA 4M8UA 1PZ2A 3N73A 2PODA 3EXRA 3CWNA 4LH8A 1UASA 3HPSA 4QJ4B 2X7WA 1RD6A 3THDA 3P3BA 2O9OA 1YE4A 3VTRA 1HO1A 4H41A 4C1NB 3G0UA 3WNKA 1B3YA 2GL5A 3F2CA 4YHGA 4JQ4A 5CJNA 1OG6A 4XG1A 1FWAC 5I5RA 5AYYA 2QV4A 5I3IA 3ARZA 1OSEA 1JRBA 3LRKA 5A6LA 1KNWA 3L2LA 1IZKA 5FCZA 2BX7A 4I5RA 3T55A 3UVAA 1XIEA 4A29A 3MTWA 3URNA 3SADA 3M47A 4JKLA 3L5LA 1BTCA 3DG7A 2D69A 3WK0A 3BGJA 4C1NA 4FX6M 4JDYA 4HNVA 1WXJA 3OHMB 2O7SA 3WLJA 4Q8OA 5D03A 3P8IA 5C7HA 1DJZA 2CFFA 1OFDA 2C15A 4JOMA 3RRAA 3KE0A 4D1IA 1M3UA 1WZKA 3HPAA 4OHQA 3PPGA 5DXYA 1WKEA 1W5PA 3CHVA 4WX2A 5M1TA 2I5QA 3SSJA 4PC8A 4H9VA 2CWXA 4IP5A 3VE9A 3W27A 4MGGA 2QW5A 3M0XA 2OSYA 3MT1A 2QPXA 2QMKA 3CMGA 1UPPA 3QLDA 4W5ZA 4J3VA 3LNMA 1VFHA 1F3TA 1GJPA 1NF0A 1TO3A 1J10A 1UOZA 4KFOA 1C90A 3EA1A 3ZR5A 2R9RA 4CD7A 1Q6LA 3VNZA 3CHEA 3LENA 1XH2A 1KW1A 1KXTA 1W1YA 3NSMA 3N6QA 3LOTA 2ATMA 1XLHA 1JYXA 3W2JA 4AF0B 2BXZA 1IWPA 4KEUA 6ENLA 1B4EA 2HVOA 2XGIA 4ROPA 1HJSA 3LGDA 2HNHA 5J5DA 2J78A 3CJPA 3WEMA 4KQNA 1GYMA 3CB8A 4Z0JA 3ANUA 3VIFA 4A6GA 2ZUNA 4MZYA 3KTXA 4Q4RA 3T78A 1QU4A 4M6VA 1UD8A 4FNUA 1V51A 3KOFA 4NI3A 1L0PA 3KM8A 3HTWA 3N19B 2NXIA 4NZCA 4Y9OA 4QBXA 1I0DA 3QEZA 2GGIA 3II1A 1ISVA 3FOKA 3LX9A 4AVOA 3DCPA 4P7QA 3ARQA 1XICA 1DV7A 3LZ5A 2XINA 2V2CA 2INEA 5K4ZA 1WA3A 3L67A 4E2VA 1TFVA 3PBVA 4FALA 1A5OC 1NU5A 3AIUA 1J96A 1E9IA 3AJXA 2GJXA 4PUDA 3K1DA 4U31A 1OFEA 1OGGA 1UQYA 5CXPA 4N02A 1OT2A 2V0TA 1MQQA 2IPWA 4AX6A 5AYZA 3UZZA 4JFVA 4GGHA 2V82A 1OY0A 2X41A 3TOPA 1DJXA 3BG9A 2A85A 2Z1BA 1QHOA 4FHAA 1TZ7A 1OCBA 4DB7A 2B31A 2CLOA 3VINA 1VFOA 3AXHA 4E38A 3REQA 1K02A 3EA2A 1HUVA 3BSGA 3IGSA 3VGEA 1E4LA 5DELA 2XFWA 4PTWA 4HZ6A 3WBAA 4PMOA 4IH3A 4NHVA 2I5GA 3RPMA 2PFHA 2F61A 1IEQA 4GYFA 5BWAA 1EZ2A 4XZHA 3VC5A 4ZL1A 5FEZA 1A0EA 2PBGA 2Q6ZA 1U5VA 3MSDA 4H1ZA 5I07A 1QDSA 3S1VA 5AC8A 3T08A 3CUHA 1JIBA 2PWEA 2FVKA 3W1NA 3BAIA 3RN6A 1A0DA 5K4XA 4J9JA 4L1XA 3LLXA 2JKAA 1TPFA 4Y8EA 3UWEA 3CK5A 4JFUA 3VOCA 4TO8A 4E4PA 4GX8A 2J77A 3ZLGA 5LYRA 1LOSA 3CO4A 5D32A 3PUGA 1AL8A 1K9DA 3QRHA 3GUGA 4ERAA 1I1WA 1XS2A 3QFEA 4C6MA 1XIMA 3THAA 4LAMA 4AMAA 3PNUA 2ZBTA 4L1WA 2ZX7A 1FWBC 3OEXA 4NY2A 2QDDA 3AIQA 2PGRA 2C1GA 4K8GA 4J40A 3R7MA 3W7PA 3HFYA 1E51A 1IIHA 1XXXA 4M6PA 4AZIA 1UD2A 1LOLA 2YA0A 1RBAA 3ZIZA 3AMDA 3VIPA 4R7JA 1PKLA 1XBYA 3KBVA 4V15A 5D9OA 5KTLA 1RHCA 4LWWA 3LZ3A 3KFTA 4A3YA 5F2IA 1LBFA 4I7UA 1EB3A 2ODOA 5G2HA 2PDIA 1TQXA 4GC3A 3ZSTA 2OKTA 3WJSA 5TNVA 1TR1A 1V93A 1J0HA 4B2DA 2V2DA 3CUFA 3M0MA 2WMFA 1E56A 5CPTA 1YNQA 3L2IA 4XTIA 1EEPA 2CETA 4Q22A 4B3LA 3NZPA 1E5NA 3DBNA 1F4HA 2IPGA 4KRZA 4RDWA 2C19A 4BR1A 1OVDA 2E40A 4JX5A 4LFYA 3GSMA 3P82A 3PZOA 1M5WA 3NQBA 1EHNA 4JYDA 5L6UA 5BOOA 2ZFAA 1AQ0A 1N82A 1G0CA 2VEGA 5D30A 1ZFJA 3WNMA 3HO8A 1DHKA 8XIMA 1OX4A 2GDVA 4N9CA 4DELA 3HM7A 1JXKA 3WO8A 2DSKA