2FLIA

The crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
217
Chain Sequence
TLKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPNISFGADVVASMRKHSKLVFDCHLMVVDPERYVEAFAQAGADIMTIHTESTRHIHGALQKIKAAGMKAGVVINPGTPATALEPLLDLVDQVLIMTVNPGFGGQAFIPECLEKVATVAKWRDEKGLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLFKASDLVSQVQTLRTALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords ribulose-phosphate 3-epimerase
publication title d-Ribulose 5-Phosphate 3-Epimerase: Functional and Structural Relationships to Members of the Ribulose-Phosphate Binding (beta/alpha)(8)-Barrel Superfamily(,).
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 80
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 5.1.3.-:
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2fliA00
3G1SA 2A7RA 2E1DA 2C19A 1UB3A 3CIWA 3THQA 2UV8G 1HTIA 1Q3NA 3ZR4A 3NQVA 3UXDA 1H7WA 3O6DA 3MMTA 4MFDA 3QPZA 3S5OA 3SIZA 1TPEA 1RR2A 2YW3A 3L21A 4UR8A 4ZMGA 4KWWA 1T99A 3BLEA 3QFEA 4NZFA 1SZNA 3FFSA 4JTSA 4XQ6A 3UPBA 1EA0A 4N9CA 2Y89A 5I3IA 5DXYA 1O94A 4FNPA 4Q32A 3LXAA 3P5YA 1AG1O 1VYSX 4A2SA 3TIMA 1W5NA 3LCIA 3C61A 4U28A 1B4KA 1YDOA 1D3GA 4C1KA 3CLMA 2E5DA 1JRCA 3LTYA 4P61A 4O0KA 3E96A 1KLYA 3UD6A 3VCRA 2EGZA 3BW2A 3W84A 1H5YA 4UC5A 5SWUA 4NNCA 3P80A 2FJKA 3E49A 1GVOA 2QAFA 1FXPA 3BVJA 3PC0A 2HS6A 1F2JA 3NA8A 1KBIA 4XKYB 4ZQNA 4E0CA 2ZA1A 4UTTA 1ZALA 5CSRA 3RMJA 3WJSA 4CLMA 3OIXA 4L4MA 3H53A 1FUYA 1M7PA 5FEWA 1QAPA 3BLFA 2OJPA 4TU1A 2NXGA 5EA9A 1FDYA 3G1FA 4XKYA 1G4EA 4UCGA 3CT7A 3T7VA 5GVJA 3MBDA 3STGA 3MP3A 4I7WA 4NJKA 4HHPA 3GXTA 5DLCA 1AW1A 3S5YA 4ZZ9A 3W72A 1OX4B 2Q3RA 1HUVA 5DCEA 3W3OA 3P74A 1OFAA 2NUXA 4XUGA 3S9YA 4GJ1A 4R33A 3W1XA 4Z08A 2OT0A 1OFBA 4I9AA 4XZ9A 2G5WA 3B03A 1OX4A 2NUWA 4UFJA 1K7EA 4GUIA 2EKCA 5CKSA 1FCBA 4LTSA 4O53A 3F4NA 3L0GA 2FPYA 1DKWA 1MEHA 4JTKA 3G22A 1VPXA 3P7YA 2NV1A 1O60A 1A53A 3NZRA 3L2IA 1FCQA 1JCNA 1G6CA 4IPJA 5F2GA 1XC4A 1MSSA 1OYCA 2W0UA 3C2VA 5CZTA 2GQ8A 3A24A 4XBKA 1OFDA 2GJLA 5I3FA 3S1UA 3C2OA 4AHOA 5IBXA 3O06A 4NJGA 3DENA 2ABAA 3TMQA 1XBYA 1RVGA 3GZ3A 3GIYA 1FWWA 5CZSA 2ATSA 2WSYA 4LVGA 3EXRA 2OX1A 2ZZ4A 4OT7A 4MUZA 3GDLA 2QCHA 3ABSA 3LV6A 1GQNA 1WDWA 5J5DA 1AL8A 4IX2A 1A5BA 2WSRA 1ALDA 5AHMA 3NM1A 2RKXA 1QPQA 3MHFA 3S42A 1NVMA 2CLOA 3TDFA 1HO4A 3GNNA 1TPH1 3P82A 1IXQA 3TV8A 3W9ZA 4IXHA 5HWNA 1IGSA 3W86A 2CZFA 2G97A 2E09A 3TC6A 1WYIA 4AHQA 4N6EA 4ZQPA 5HUPA 1VZWA 3G1AA 3UQNA 1UJPA 1KM2A 3LTSA 1JQVA 4JTFA 2QUUA 5F4WA 2J9YA 1L6SA 1FWSA 2J6XA 3B0PA 3DXIA 5F2MA 2Y70A 3GB6A 3SZ8A 2PRMA 2PC4A 3G0XA 3HBLA 2DZSA 1RQBA 1EUAA 2H6RA 1CI1A 1TQJA 4OBTA 3B04A 3M5ZA 5G2WA 3F1QA 2QCDB 4DBDA 1G4SA 2CLEA 5FEZA 3VE9A 3TAOA 3MYPA 1H7RA 3W76A 4WX2A 2ZA3A 3DFQA 3W2NA 6TIMA 4WZHA 3V1PA 1KFEA 5HMSA 3FKRA 3U2OA 1FX6A 1K7XA 2Y61A 2QUVA 2WV8A 2FB3A 3TU9A 3DFTA 3N9SA 2NZLA 2J9XA 5DELA 3KVKA 2ZRYA 3FS2A 1DJNA 3MI2A 2QCDA 5AB3A 5D33A 3M7WA 4O17A 4AWTA 1KM5A 1R2TA 1TRIA 5C55A 1OYBA 1BWKA 1KM3A 4DELA 5AHNA 1T8XA 4PCFA 4LV4A 1AW5A 4KFOA 3O63A 3LRLA 1OF6A 3EWBX 3TQ0A 3OG3A 3F03K 4FIRA 1YADA 2P10A 2V2HA 3W2JA 1T0OA 3GVGA 4DQWA 2YDAA 3NDOA 1HG3A 4FNQA 3PBYA 2W79A 5HR6A 4K7VA 4ZVJA 4OV9A 3G1DA 2F7FA 1H62A 3GYEA 1K8ZA 1VJIA 1T96A 2H8XA 4ICNA 5LGXA 3R2GA 2FPVA 4PH6A 3QPYA 1LOQA 1H7NA 3W1NA 1R30A 3UWZA 3P84A 3RK8A 5MHBA 4XTDA 4HNTA 1B57A 1K7FA 5HINA 4M6PA 2WQPA 4FX6M 1RZMA 1GG0A 1N55A 2GVLA 3NQCA 4JTUA 5H91A 3CWNA 1R47A 4NX5A 2C18A 1JCLA 3C2FA 1F7BA 5BNKA 2YYTA 1U5JA 4NX0A 1XDMA 1DBTA 1J2WA 1XI3A 2VXNA 1QDSA 1LRTA 1ZAJA 1PVNA 4ZQMA 1KM0A 2ALDA 4GWEA 4K7YA 4MY9A 3QRHA 3LLDA 2E6FA 4ZL1A 3LI1A 3NG3A 3PF3A 3BLIA 2YFOA 2ZRVA 4LC6A 3BK0A 4UFMA 4U4MA 3KVJA 4FX8A 5C6MA 4JX6A 2P0OA 4UTKA 5K9DA 1R2SA 5F4SA 1H7PA 2WNZA 3W23A 2VEKA 1H1ZA 5KZMA 4PTNA 3W2MA 1Z42A 3TXVA 2A7PA 5AC8A 1VH7A 5BMWA 2OMAA 3T40A 4N6FA 4YCPA 4GBUA 5G5IA 1GG1A 3BO9A 5G2HA 4UTJA 5EL1A 3SECA 5D2YA 1FWNA 2PCQA 1KM6A 1V7YA 4IXXA 4LVDA 3UWQA 3LTPA 4GE8A 5K7JA 3PUDA 4MY8A 2CLLA 2NWRA 4O54A 3TX9A 5AHIA 3NPUA 2QCGA 1TJPA 3HPZA 1QO2A 3E02A 2W6RA 3G18A 2QDGA 5BOOA 3A9IA 3C52A 3S6DA 3MYOA 3BG3A 5G1TA 4UNLA 1TPFA 4X2RA 1H50A 3TSMA 2BWGA 5LKYA 2TPSA 1NF0A 3W7RA 4EF8A 5LSMA 3L65A 5F2LA 4DEFA 4L4LA 3LRKA 4MIMA 3CHVA 3N19B 3ZWTA 1LYXA 4UTTC 1GZGA 2JGQA 2V0TA 1XKYA 2A1YA 4MLJA 3CEPA 4UIOA 5L6UA 3SJ3A 3DZ1A 2Z1BA 3GXPA 3STCA 1I2OA 3L0KA 4O19A 3NL3A 1SZGA 1OG0A 3G24A 4JXCA 1LRNA 5LZLA 3ATZA 1P5BA 1OF8A 1SO5A 2JKPA 2V30A 4WOQA 5HWJA 3B0VC 1TV7A 3USBA 1DVJA 4TX9A 4RCXA 4S2CA 4FIQA 3W1TA 1XBZA 4OU1A 4TIMA 4BK9A 1SFLA 3W7DA 3PM6A 2EPHA 1QR7A 2RFGA 1P1XA 2BLEA 3U6WA 3P61A 5K9CA 1FBAA 1VLIA 3UYCA 1R2RA 3AO0A 5DCBA 4QISA 4N4PA 3O1NA 3S5ZA 1Z41A 3W7MA 1KV5A 4FEZA 3LCHA 5CPNA 1HL2A 1UCWA 3TUUA 4Z1AA 4Y96A 4O50A 2V82A 3HG3A 4NNBA 3DH7A 3CC1A 3GR8A 1UASA 1H1YA 4MOZA 1L9WA 3EEGA 3DI1A 2J24A 1FCUA 4ZQOA 1K02A 5KINA 3L68A 1ZAIA 2Y63A 3WJZA 5IBXC 5TBOA 1UBSA 4HKPA 1MEWA 2V2DA 1YYAA 4CQAA 1TPVA 4JD4A 3GX9A 4EF9A 5DBTA 1TMHA 3TQKA 5KTLA 2B7QA 4N9DA 1K8YA 4NT0A 4M19A 4E2BA 3QMRA 3L5AA 4LW7A 3EWXA 3UWYA 3W88A 1KFBA 4QIUA 1LZOA 2Y7FA 2OZ0A 3RU6A 4IMGA 2QKFA 1B4EA 1LOSA 1A50A 1OJXA 4JIQA 4R34A 1YXDA 4EOUA 3A23A 3PB2A 4JN6A 1SQ7A 5HQEA 3P81A 3FLUA 1GPWA 1Q6QA 1W5MA 1I4NA 2BSLA 3E0IA 2Z2UA 4FHAA 4K38A 4DBEA 1TCDA 1QPNA 2VEIA 4HSNA 4LS2A 3PUOA 3K30A 1EPXA 5AHEA 1X8FA 4N4QA 1VCVA 1MO0A 4FXRA 3W2KA 1KM1A 5D04C 3EX2A 4DPPA 1IF2A 3LGEA 3LV5A 3G1HA 3ELFA 1WAUA 3LDVA 2FTPA 3EX6A 1PCWA 3PVFA 2NLIA 1TTQA 5CZ0A 2VENA 3SW6A 3M6YA 5LHFA 4MZYA 3HPXA 5FEXA 3GDKA 3TJLA 3TK7A 4R7JA 3VFLA 4Y90A 3TQVA 2YPIA 4WD0A 1FCVA 1SW0A 3LCGA 5U7SA 2QCMA 3TXZA 2DP3A 2YGYA 4UMBA 4D2JA 1L2UA 2QR6A 2C14A 2D73A 4CNOA 2QJHA 1H63A 5D09A 1I45A 4JY9A 1XDLA 1FXQA 1WXJA 1ONRA 1THFD 3LB0A 1JULA 4FNSA 5DY3A 3OHIA 1N8FA 1NEYA 2CLFA 3KVMA 4JYEA 2ZRUA 4TO8A 2GJNA 5DY2A 2XFWA 2B0MA 1VYPX 1LBFA 5HUOA 3I68A 1SO4A 1SO6A 2WSQA 1ZFJA 4UFIA 3N2XA 3W07A 4MJZA 2E5BA 3KHJA 2C1HA 3U8GA 1JR1A 4PEKA 5FF4A 4AH7A 1VRDA 4RJEA 2QCCA 1WBJA 4QITA 2YZRA 3FYOA 4JYFA 5D38A 1G7VA 2H8ZA 5T26A 1QOQA 2H90A 4YXGA 3O6YX 3PSWA 1QO5A 4P2VA 2R91A 3L5MA 4OGZA 4AVFA 1G4TA 4IMEA 3IIVA 3OBKA 1GOXA 2QDHA 4NUWA 1TIMA 4MPQA 1E51A 1Q45A 1W3IA 1B9BA 3WJXA 1FDJA 2ZRWA 2JKEA 3O07A 3S5NA 2ZQ0A 3W7OA 3KAOA 5K3VA 3S1XA 4Y8FA 2DJLA 1KW1A 5ABTA 3C4UA 2EF9A 1XXXA 5D2WA 5L9FA 1WBHA 1TTPA 1Q6RA 3W7LA 2XN2A 3BW3A 2DZVA 1OFRA 3DKJA 4LRSA 3I7RA 4M6VA 3ZS4A 3HGJA 3W7HA 2CZ5A 1EEPA 5EYWA 5TQLA 4GNJA 2B7OA 1H51A 1NF7A 2Y88A 2ZZ6A 4CNPA 1I2PA 4UR7A 3B8DA 4M7TA 3LHTA 5D32A 2AGKA 3BGJA 3L9CA 1MEIA 3MI3A 2JBMA 2PE4A 5G1YA 4JX4A 1FWRA 3RF9A 2VFHA 4UFLA 3R89A 1V5XA 2ISSA 4RLIA 4MKNA 5D02A 2X30A 3TMLA 4LY8A 2ZBTA 1JQXA 3EB2A 4PODA 4A21A 2B7NA 2Q3OA 4LV9A 3M44A 3EWWA 1RD5A 1ZNNA 3LERA 4CQ9A 5DCDA 2C13A 5CGQA 4UXDA 4IMDA 4CCDA 3BPWA 1KTBA 1F05A 1NFBA 1OK4A 4WQ6A 2I14A 2E77A 3PBWA 3NO5A 2QUTA 4FB7A 1N7KA 1ML1A 1VYRA 3C2EA 5G2IA 2C3ZA 2CLKA 1JCJA 4MYAA 2VELA 3NPWA 2Y62A 2Y6ZA 4FNRA 1LROA 3P67A 1QPRA 3SY5A 2CW6A 3MWAA 2LLEA 3NQDA 3LCWA 2J27A 4LS1A 3I65A 2YX0A 5AOUA 3PBUA 3QSTA 3IIPA 4LUIA 3M1ZA 5CZJA 1OFEA 3ABQA 3L5LA 3S1VA 2G95A 1RQEA 1P4CA 3PB0A 2FDSA 4RZ6A 3W1QA 4IGHA 2C0AA 1VCFA 3I6RA 1TV8A 3WJYA 4PA8A 2QJIA 3PS7A 4A29A 2H3DA 3IGUA 2GVGA 4IMCA 2ZZ3A 1K03A 1YTKA 4MVAA 4HIBA 4GUJA 3TJXA 1GVSA 3M5VA 3M41A 4BFAA 1JJKA 3L66A 3TW7A 5KSWA 3UY7A 2ISWA 3TKFA 4O52A 1EUNA 1GVQA 4YMZA 4DO6A 1R46A 1ME9A 3EXTA 2ISVA 4Y9AA 3NPXA 5IM51 3N34A 4O1BA 3TW6A 2ZDRA 5LNWA 1SO3A 5FI8A 4O16A 1S5WA 1LBLA 4Z0SA 2R14A 3GDTA 1D3HA 5LNSA 1LOLA 2OT1A 3G1YA 2H3BA 2NX9A 2RH9A 3LM7A 3NM3A 5CPOA 4WY0B 4UMCA 3A22A 5D30A 4B5NA 4DO5A 4LWWA 2GUUA 4LOCA 2YFNA 4EVZA 3CTLA 5F4XA 2I9EA 5A8GA 1A5CA 3W1LA 2NX3A 3W71A 3ZFHA 3FIGA 2BX7A 3PG9A 3W70A 5K4ZA 3MHGA 4I7UA 3GDRA 2NV2A 1AK5A 2NXHA 1YPIA 3B0UX 3PR2A 4WY0A 3HG2A 4JICA 3O15A 2I1OA 3PAJA 5BW6A 3DFNA 1YXYA 3W87A 4AHPA 2V8ZA 1JUBA 2NXIA 4JTIA 3W1MA 1QNVA 4TMCA 3DHDA 4RZ5A 1ICPA 1VHNA 3W1AA 1F6PA 3NVTA 4ADSA 4LRTA 4CNNA 3FKKA 4HPXA 3EWUA 3RNDA 2G96A 3NGJA 3QEZA 1G7UA 1G67A 2A85A 1P0NA 2CLIA 1JUKA 1SSGA 2AQWA 3G8EA 4HSOA 3V75A 4IOTA 4UTWA 1RPXA 3GKAA 3W2LA 3TA6A 3TE9A 3JR2A 4LUJA 4FX7A 3STFA 3T78A 1TREA 2E6YA 3LX9A 3W75A 1OFPA 3KOFA 5K9XA 5LNUA 1TO3A 3B05A 3IVTA 5I3GA 1QMLA 3LHVA 3SR7A 2GVJA 2VFFA 3C6CA 2RDWA 3CIXA 4K36A 1OYAA 4N02A 4FNTA 4FXSA 1TPDA 4I7VA 3KRUA 1DQWA 3ATYA 3HB9A 3NQGA 3HGRA 5I3HA 4YCOA 2A4AA 1W54A 3MP5A 3DHFA 1QOPA 2YYUA 1ME7A 2ZRZA 3P8JA 2Q8LA 4BI6A 1JCYA 1KFCA 4X22A 1TYGA 3UWUA 4N9EA 4GRSA 4O13A 3NZ1A 3M0ZA 3QYQA 1EIXA 1OK6A 5EKYA 3BGGA 4IJBA 1EWDA 3OVQA 1IXPA 1SW3A 1L6WA 2WOQA 3MP4A 5DN1A 1PV8A 2A7NA 2QCNA 4O1AA 4A2RA 5LNVA 2JK2A 4GUFA 2X2GA 5LHEA 3EX3A 2RDTA 4NXKA 4BWLA 1Z48A 2XN0A 2Z6IA 4KWVA 3YPIA 4OE7A 2EAWA 4RXFA 2P1FA 5D03A 2WJZA 4NJIA 3IGSA 4UTMA 2FPTA 3DFSA 2VFGA 1J5TA 1PS9A 4UTIA 5H2ZA 3IIXA 1OABA 3L0NA 3LXBA 3UY8A 2C16A 3VNDA 2WNNA 3EX1A 3HPSA 1QPOA 2CLMA 1UUOA 2XN1A 1KA9F 2DZTA 2GQAA 4FO4A 1F74A 1FWTA 1KFKA 4K37A 4QQ3A 5CG7A 3G3MA 1KTNA 1W37A 1DOSA 4JIPA 3STEA 4X3ZA 2VEPA 6ALDA 3G8RA 3G0UA 1HO1A 4O57A 2CWNA 3MO7A 1DJQA 4Z1DA 2QCEA 5CPMA 4Y6GA 1OX5A 1X7FA 3A5VA 4AF0B 3O6CA 1AMKA 3GAYA 4WJEA 3NR0A 4O4VA 4RKAA 1JVNA 3UZ5A 3GR7A 5J5RA 1H60A 2A6NA 5EPDA 4JTHA 4MJMA 4ADTA 2Z0IA 4ONVA 2HSAA 1YXCA 1M7OA 3EXSA 1AW2A 4JDBA 1SPQA 4PFMA 3RLVA 2V9DA 4FF7A 4AF0A 3DBPA 3GAKA 5TIMA 2DORA 2F84A 3SGUA 1ICSA 4AWSA 3DKLA 4O4WA 1W3TA 4OV4A 2BXVA 3G0SA 1XM3A 3L67A 1F6KA 3D0CA 3OVRA 1FY6A 5EY5A 3R13A 1FQ0A 4UFHA 2RHGA 1GWJA 4JX5A 2Y7EA 4DF1A 1WOAA 3VE7A 3LCLA 4E38A 5EMUA 3N73A 1I8JA 4CCCA 4NXSA 4Q33A 2J9ZA 1KM4A 2R8WA 1YDNA 3HO8A 1PIIA 3CEUA 3JS3A 5HJLA 3E9AA 1ZJIA 4UTHA 5HULA 4LU0A 3M43A 4GUGA 1I2RA 1JRBA 5E93A 1C8VA 1SUXA 1VGAA 4WOZA 4LC8A 4ZQCA 1PE1A 2YW4A 3TSBA 4AXKA 1SZFA 1X1OA 3LHUA 5K4XA 3QQ0A 3NYZA 4O28A 4JEQA 5DBUA 3DFOA 4AMAA 3R8RA 3WK3A 5D2XA 5A5WA 2ZZ2A 4JTLA 4DPQA 4O18A 2YXGA 3DFPA 3WJWA 4UUIA 3ABOA 3WK0A 4JGDA 1I2QA 3LXCA 5KZEA 2ZZ1A 3AJXA 4LS0A 5U4NA 1JUEA 1SZEA 4KKXA 4IUOA 4YL2A 2DZWA 3G1XA 4R53A 5AYXA 1Q6OA 3W7JA 4A22A 4CQ8A 5I3KA 3W7KA 1CW2A 3EKLA 4O8RA 5E0KA 3QZEA 2HMCA 2QCFA 1W1ZA 2O7SA 4DXVA 5FF3A 5G4EA 1H7OA 1G69A 1IIHA 3BV4A 3DU0A 1HFBA 2YCEA 1LRQA 4JYDA 2DZUA 3Q94A 4MY1A 2O7QA 4BI7A 3NXFA 3HF3A 4GUHA 4ORMA 2EHHA 4HN4A 1J4EA 1GVRA 3VI2A 3NPVA 2QCLA 3PWAA 1XUUA 1GEQA 1YTEA 1K8XA 3CWOX 2V5LA 2Z6JA 4O11A 1C29A 1FDZA 4K8HA 3IGXA 1TPWA 3O05A 1Z44A 3I7SA 1LLZA 3LBCA 3M47A 3CPRA 4PL1A 3HGSA 3TROA 3W6YA 1BWLA 5AFDA 3NQAA 4DF0A 1H61A 1RV8A 3UZJA 1K3UA 1JCXA 3W7QA 3TAKA 1ME8A 2ZYFA 1SSDA 2R94A 3NQ6A 5AC6A 1WQ5A 4K8EA 4MYXA 4JDYA 5DXXA 8TIMA 2JKAA 4ML9A 1KFLA 2GQ9A 3W22A 4PL2A 2WPBA 3PULA 3PBVA 1X1ZA 3FJ6A 5C2XA 4NJJA 4X9SA 4G1KA 1X6UA 3MHUA 3KFTA 3DGRA 2A5HA 3S8HA 1F73A 2A0NA 1O5XA 2VC6A 3G3DA 4RX0A 2VFDA 3W7NA 3MW7A 3I7QA 4JS3A 3DI0A 1IIGA 3TC7A 3HGOA 2NWSA 4PC8A 1OFQA 5KITA 3W85A 1YPFA 4NQ1A 4O14A 4RR4A 3QW4B 1GT8A 1XBVA 2AAMA 2YR1A 1XBXA 3FEMA 3SFKA 3KX6A 4KFPA 1KTCA 4O0ZA 4UTLA 1TPUA 1BEUA 3N2MA 3C0JA 5D37A 1DORA 2CLHA 3N14A 1D9EA 4MZ8A 4N9BA 1TTIA 2X16A 4TMBA 4IWWA 3UXAA 4CCEA 3G1VA 3NQMA 5D2VA 2QAPA 3P8IA 2Y85A 1RQHA 4EIVA 3QMSA 3FYPA 4YWIA 1ADOA 2ZTJA 3BG5A 3GDMA 4O1DA 4UMAA 4UTWC 2B7PA 1A5AA 1S5TA 7TIMA 3W73A 2E5CA 2YSWA 1O95A 3TH6A 1JCMP 1VHCA 3JRKA 3EWYA 3DAQA 5FF2A 3EKZA 4IQLA 4BF9A 2B4GA 4A3UA 3LBMA 2WKJA 3QSRA 4JR5A 1TSIA 4Z0JA 4FNUA 4OQVA 4M6QA 3A21A 1PL9A 2CZEA 2FB2A 3NQ2A 3TCEA 1CX9A 2QF7A 3HJZA 3WK1A 3M9YA 5E1QA 1EWEA 4QAIA 1EX5A 2JGYA 3SI9A 3EWZA 5AHLA 1NAL1 3W83A 1TTJA 3CQ0A 3M5XA 2GPTA 5FF7A 1TPC1 4XWUA 4ADUA 3RLUA 1TQXA 4M7SA 3FA5A 4WY0F 3W7PA 4ORIA 2QJGA 3HG4A 3C8FA 3BARA 5CPLA 3GK0A 4M5PA 5K2ZA 2C15A 1XFBA 1F5ZA 4JTTA 5AN7A 4WXYA 4LVAA 1W3NA 2FLIA 4LVFA 1OVDA 2X1SA 4BWLC 1M5WA 4H6KA 5AYZA 3IVUA 1DV7A 3LHYA 3TR2A 3FOKA 3QF0A 1WV2A 4S2BA 2ZTKA 4E2DA 5FEPA 5BMXA 2E6AA 3B4UA 1SR9A 2VFIA 5AC7A 3EX4A 2Y7DA 2CU0A 1TJRA 1WA3A 3C2RA 2V81A 1DL3A 1XCFA 1KLZA 3CM4A 1P0KA 5F1UA 4MLRA 3GKFA 3M16A 3W7EA 2ZZ5A 5I3JA 3QJAA 1W8SA 2TRSA 3PG8A 1A5SA 2FQIA 2J88A 4Q4KA 1DHPA 3W2UA 2FIQA 1LM1A 3RFAA 3T44A 2X1UA 4MFEA 2IQTA 2GOUA 4KFNA 2TMDA 4RZ4A 3SSJA 3W1RA 1YTDA 1W56A 4WUIA 2VOMA 3C56A 3ABRA 3QH2A 4O1CA 3VKJA 1LP6A 2CFFA 1W5PA 2X1RA 1EB3A 3W74A 2ZCGA 3O16A 4LNYA 4N2YA 5C5YA 2WO5A 1G4PA 1IXOA 3S0CA 1F76A 1SW7A 3T55A 3P5ZA 1DQXA 4J9JA 3LRMA 4MZ1A 4ALDA 3KRZA 1C9DA 2ZFAA 2PRLA 4K39A 1TPB1 2NUYA 3N3MA 3LI0A 1VS1A 2RDUA 1XUZA 2E6DA 2X1TA 3HIJA 3LCXA 4JNMA 4XBSA 1W0MA 3C3NA 2A21A 2BZNA 4HNVA 2V2CA 3MJYA 4H3DA 3NQFA 1M6JA 1MXSA 4GFSA 4JTGA 2DJXA 3GXNA 4O10A 1GVFA 1TRDA 2KZHA 1GTEA 1TV5A 3PY2A 4O12A 3LOTA 2Q8ZA 3MBFA 2ABBA 2BTMA 5KMYA 3IVSA 3Q37A 4HT3A 1KBJA 5F1VA 2A6LA 1AL7A 1I2NA 4IX0A 4RXGA 3KRSA 4NVTA 4RK8A 2HS8A 3O8AA 1GTHA 2DZXA 2TYSA 3T4CA 4AWUA 1Y0EA 1GYLA 4JTJA 4UNKA 3P60A 4IMFA 4DF2A 1OX6A 4QNEA 4O15A 3MI6A 1VLWA 3NEVA 4OWGA 3S1WA 3HG5A 1PHWA 3INPA 4AB4A 3Q58A 1LLWA 3MUXA 1YDVA 1W5OA 3LHWA 4GXMA 3GLCA 4JTEA 1TB3A 1VCGA 4LT9A 1LORA 2C6QA 3H54A 3LHZA 3R5EA 5FF0A 1OHLA 3R12A 4C1LA 5LGZA 5AYYA 5BRBA 2DU2A 1GYNA 3HOJA 4ZQRA 4QSHA 1BKSA 4OHQA 1S3HA 3E12A 1XL9A 5CSSA 3KXQA 1BTMA 4W9TA 5KZDA 1EP1A 1H7XA 3B06A 5F2IA 4Z1BA 4NU7A 3TFXA 3HMJG 2DZPA 4HPJA 3UWWA 4NNAA 3N9RA 2CZDA 2ATMA 3THAA 1SFJA 1GJPA 4K6AA 1UUMA 1ZENA 4GC4A 4HNUA 1EP2A 3CU2A 4BR1A 1KV8A 5FESA 3QC3A 5D05A 2V5BA 1VC4A 1WX0A 3NNTA 3OVPA 5HR7A 1LDCA 4QNWA 4H4IA 3PSVA 1W5QA 1PHQA 2E68A 3CB8A 3ANYA 3FJLA 3QMTA 2ZRXA 3NL2A 3GNDA 4UFKA 4NJHA 3NL6A 4LVBA 5EBUA 3TFCA 1S5VA 4IPIA 3WFAA 3P62A 1LCOA 3W7GA 1ZCOA 3W7IA 2QEZA 5AHFA 3NQEA 1W31A 3NOEA 3IIOA 1ZHAA 5HWMA 1Q6LA 1U83A 3HQ1A 2TSYA 3PUEA 3IV3A 4XTIA 1NSJA 3OA3A 1VQTA 4S1FA 3TNOA 4NZJA 1L6YA 3QW3A 1VR6A 3BG9A 1SU5A 1MZHA 2Y7GA 3IRDA 3W1UA 4AAJA 1EP3A 4WXZA 1O5KA 3LLFA 2VKZG 4YLWA 5C54A 3ZWSA 4TR9A 3Q2DA 2NX1A 3A5FA 3W7CA 2PRHA 1PCKA 1ZAHA 4UTUA 1YLVA 5LNRA 3IIZA 2PURA 1ZY9A 3QQ1A 3NL5A 2HTMA 2FFCA 4JY8A 1KFJA 1QFEA 4Z1CA 3UWVA 4DO4A 1O4UA 3F4WA 5HNRA 1LBMA 1OFOA 4EWND 1WOBA 3UPWA 4AEOA 3KVLA 3SGZA 3NQ8A 3TSDA 5D2TA 2VFEA 3W1PA 2WNQA 2OCZA 1ICQA 3UNDA 3OEXA 4HNNA 1IXNA 1QWGA 4QM1A 3NQ7A 1QCWA 3LCFA 3NAVA 3QM3A 4QJ1A 5G4WA 2ZA2A 4RV8A 1B3OA 1LTDA 3BW4A 3M5YA 2VEMA 2ZZ7A 4BI5A 3H55A 2A2IA 4POCA 3WK2A 3IEBA
chains in the Genus database with same CATH superfamily
3GC4A 3SUSA 3VTRA 2VURA 2W3ZA 3G1SA 3H8AA 1MRAA 2ZE3A 4HU8A 3K8MA 2PP0A 2OXNA 1UB3A 4J3WA 3SGGA 3THQA 2ACSA 1V8EA 1JDFA 2VGGA 3NQVA 4PMDA 3UXDA 3SIZA 4HJFA 1RR2A 2VR2A 4DJEA 2BHZA 3GTNA 1EF3A 1T99A 3PZNA 4H9TA 4FLQA 4S3CA 4NZFA 1SZNA 4TV5A 4DWSD 1EO5A 4NASA 4LY4A 1A5LC 4Q32A 3LXAA 2P3EA 1AG1O 1Q7ZA 2OWCA 3KTSA 1W5NA 3KBJA 3C61A 4U28A 4HK7A 2E5DA 1KFWA 1JRCA 2VEFA 4UQ9A 3E96A 1JZ7A 3VOHA 3BW2A 4H83A 4NNCA 3P80A 1GOIA 1LL4A 1BF2A 5A2BA 3PC0A 3VKAA 2IPFA 3VD3A 1AH0A 1X6NA 5I0DA 4XKYB 1XLEA 2PEVA 3GE7A 2VCAA 5CSRA 3RMJA 3DECA 3OIXA 1HNYA 2WC3A 4L4MA 1GQJA 3R8HA 3DHUA 4GQGA 1Z69A 4FLOA 3SN4A 2OJPA 4TU1A 1ISVA 3ES8A 3CT7A 5CLWA 5GVJA 4NAEA 3MU7A 3STGA 1AD1A 3F4VA 4HHPA 3W27A 3B40A 3H2CA 4ZZ9A 2Q3RA 1W1A1 1HUVA 3VVGA 3LN3A 3TR9A 4IPPA 1SVDA 3P74A 4DNHA 1OFAA 5B80A 4CVUA 4Z08A 1EDQA 1OFBA 4RV3A 2Z26A 4YS1A 1Q8AA 1MUCA 4PUJA 1X97A 3TYDA 5JVLA 3SQMA 2NUWA 4UFJA 4GUIA 2INFA 3RX2A 3HFTA 4LTSA 3R10A 2E8YA 4DJFD 5FSEC 2QF8A 1R87A 4F8XA 1KRMA 4MJ2A 3SUVA 1MEHA 2NV1A 1FCQA 1OG6A 3UG8A 4IPJA 4DI8A 2NQ5A 2W0UA 3WY1A 3TVAA 1PO9A 4G5DA 2PWHA 2P3ZA 3GHSA 1NELA 3CV6A 2ZE0A 3SN1A 3AYSA 1F3TA 1MQPA 3GVRA 2ABAA 2ODOA 4XX6A 3WQFA 4GACA 1NP0A 2NQHA 3MZ2A 3F4DA 3VCCA 2XHYA 3RN6A 4OT7A 2PODA 2XFFA 3CS2A 3CUJA 3EGJA 3LV6A 3ZYZA 4D71A 3RAOA 4E4UA 3TJ4A 4IQDA 4A8NA 1M1BA 3CHCA 1ALDA 2X42A 2RKXA 2JFEX 4JIRA 1KGXA 1NVMA 2CLOA 4TVUA 1LQAA 3GNNA 4MDPA 1JYVA 2ZXAA 1OIFA 3AIUA 3T42A 5HWNA 1IGSA 1CENA 2CZFA 2CXGA 3HU7A 4ZQPA 1TUXA 4LH8A 1VZWA 2D3LA 3PJXA 1JQVA 3HM7A 4C5ZA 3RG6A 3UCDA 3WLNA 4KBXA 3B0PA 2V3FA 1ZLPA 1M9HA 4HSHA 1EQCA 2DZSA 1RQBA 2WVVA 4EPBC 1CI1A 4Q4PA 3B04A 3F1QA 1FWDC 1KWKA 3ARSA 5FEZA 3VE9A 3NDYA 1H7RA 3W2NA 4AW7A 2D69A 3V1PA 1OC7A 4JTAA 3CZEA 3DBNA 3FKRA 1FX6A 2Y61A 4AYSA 2QUVA 3TU9A 2NZLA 5KZ6A 2O0TA 3KVKA 5FJIA 1ZBWA 1TUFA 5AB3A 1NWTA 4AWTA 4HA0A 1KM5A 1RXOB 1H4PA 4X61A 3CMJA 4J3SA 4KFOA 3LRLA 3M7SA 2O9PA 3EWBX 4WR3A 4D6JA 4DQWA 2YDAA 4FNQA 1JDCA 4AD3A 5ECUA 1IT7A 3JVAA 2X7VA 2NT0A 1L2QA 3EZ4A 2OYMA 4K7VA 4ZVJA 1GQIA 1K8ZA 1VJIA 3BSMA 2FPVA 3RLHA 3FJ4A 4PH6A 3ITXA 2BY0A 1R30A 3VGFA 4XTDA 4HNTA 1A4LA 1K7FA 3OGVA 5HINA 1RZMA 1GG0A 2GVLA 3V5CA 3VFCA 1R47A 2D0FA 1G9HA 4B9YA 5E09A 1US3A 1EKOA 1ZQ5A 2DH2A 4GIAA 1MVYA 3A64A 3VUSA 4MY9A 3LLDA 2R9RA 1EXPA 2E6FA 3PZGA 3LI1A 4GY7A 3GDBA 4LC6A 4AISA 5IRPA 4L56A 5AY7A 2W5FA 4PSRA 3S6OA 2O56A 4YJ5A 5FJRA 4KQNA 4WKFA 4UTKA 3ZSTA 2MANA 5ABFB 3B8SA 1OADA 2ZWYA 3W23A 1QU4A 2VEKA 1WZMA 5AC8A 2D2GA 4IG2A 2BY3A 4N6FA 3U48A 5KEZA 5MKGB 2BGSA 1US2A 2MNRA 2VHLA 1OCBA 2HPIA 1GPFA 2INEA 3PWIA 4JKKA 5GJNA 4LUSA 3UJEA 3LTPA 4GE8A 3NSMA 1RA0A 1AH4A 3TX9A 1W1IE 3KE0A 3G18A 5BOOA 3EPNA 3TZNA 3BG3A 4US5A 3NZPA 1V6TA 1BKHA 2J8GA 1EQPA 3QGKC 3UJFA 1NF0A 1XG3A 1CT5A 4CCZA 5D4YA 4DEFA 3E0FA 2VQTA 4MKSA 1J9YA 1TVPA 4G7EB 4EKJA 2V0TA 2R1MA 2FVLA 3CEPA 1FWEC 3QTGA 5LZLA 5HWJA 4QG6A 1B3WA 3AISA 3B0VC 1MFVA 4LFYA 4GYJA 4TX9A 3LZ5A 1RBLA 4ZCWA 1MWOA 4S2CA 3CBWA 1XCXA 4OU1A 4PTDA 2VT0A 1SFLA 3PM6A 2EPHA 1QR7A 4I8YA 2ZICA 4AU0A 2BLEA 4H9ZA 5AECA 4Q8OA 3GH5A 3NQBA 3VC6A 1V3JA 3AO0A 1Z41A 3CLWA 4FEZA 3S9ZA 5I7GA 1UCWA 3TUUA 4MB3A 4F0RA 4EPEC 3KZPA 1A3HA 2WLZA 1Q4NX 1DWAM 4MOZA 4YYCA 4JOMA 3L68A 1ZAIA 4FK9A 1UBSA 1Q7MA 4HKPA 3OYXA 4GOAA 2VEGA 1YYAA 4EF9A 4H8VA 5CC7A 5DRIA 3F2CA 1K8YA 2ZXQA 2DW7A 4E2BA 4YYFA 3QMRA 3AXIA 4V2XA 3EWXA 4QP0A 1SFSA 1A5MC 3C2YA 3W88A 1JEZA 2YBVA 1KFBA 4QS6A 2WMGA 1LZOA 2Y7FA 1ONXA 4YIWA 2ZC8A 3PTQA 2V38A 1A50A 1OJXA 4JIQA 4GO9A 3A23A 1SQ7A 1VBGA 4G1NA 1GOWA 1NM9A 3P81A 3THUA 1W5MA 3E0IA 1V77A 3VKCA 5IHRA 4K38A 2HE8A 1GW1A 4BF5A 1UMYA 3K30A 1EPXA 1O5RA 4FXRA 4GPNA 4LYRA 3G2GA 1IF2A 3LGEA 3GG1A 1QBBA 3NO3A 2YJQA 3F4CA 2FTPA 1GZ1A 3EX6A 3VGEA 2ZVRA 2EG8A 2PTXA 4W87A 3U7VA 2XVKA 3M6YA 3FDGA 3TNBA 5FEXA 3TJLA 3TK7A 4Y90A 3PANA 3T0CA 4RW5A 5C7HA 1WE5A 5U7SA 2PDLA 3VOFA 1WP6A 3GNRA 3U2EA 3H2OA 1L2UA 2QR6A 5CC6A 3AFBA 1DIEA 2D73A 3S2MA 1X96A 3WFLA 1I45A 3SRFA 4JY9A 3AJ7A 2J7EA 1FXQA 1ZJAA 2CYGA 3AS1A 4S3GA 2R6OA 3URQA 3WD4A 3RJYA 1V08A 4B4FA 2A3BA 5DY2A 5HUOA 2XSXA 3I68A 3MA8A 4JHMA 2WSQA 4ML4A 2XH4A 3N2XA 3UZYA 1SYTA 1WKYA 1PEZA 3P0WA 4MJZA 4INFA 1JR1A 3VILA 4QJ4B 3E2RA 3PPCA 5FD0A 1WBJA 1NY1A 2CIPA 2Y1HA 5D38A 5T26A 2YL6A 4YXGA 3O6YX 4NZ1A 1XLFA 4GGHA 4HHLA 3IIVA 1M04A 5CJ5A 4QROA 1E51A 1W3IA 3CL7A 4IH3A 5A6SA 3TWAA 3S1XA 3U0HA 3LYEA 5D2WA 1JI2A 5L9FA 2OZ8A 3AOFA 2XN2A 3S2JA 2PWVA 3BW3A 1OFRA 4JTDA 4M6VA 3ZS4A 6XIAA 3VM7A 5EYWA 5TQLA 4H2HA 4PBFA 4JL1A 1CGXA 4CNPA 1I2PA 1E6NA 3KOWA 3AHTA 3FA4A 3LHTA 3BOFA 5M1TA 5JQ9A 4P7NA 4OECA 3MI3A 3RHGA 4UQAA 4IFRA 2PE4A 5G1YA 1J0KA 1FWRA 1PZ1A 2VFHA 3GG0A 3SDOA 2ISSA 3PJWA 3HQPA 1J01A 1Y7VA 3TMLA 1LWIA 3EB2A 3PZUA 2GYIA 1KC7A 1U30A 1RD5A 1ZNNA 2BDQA 4FXJA 2C79A 4C6JA 4UXDA 2OWXA 3ALFA 1F05A 3WQOA 2I14A 4V27A 2NLYA 2I16A 3TWBA 3ITOA 4BEUA 3NO5A 1UP0A 2QUTA 4W89A 4MKVA 3HV8A 5G2IA 2QHAA 3AUOA 3MDUA 3RPDA 2WPGA 4YTRA 4MWAD 2CLKA 1HJWA 1UR8A 2HVOA 2VZUA 4MYAA 4BKNA 4Z42C 2FZ8A 2VYOA 4CNSA 3GNXA 3MS8A 5I77A 3P67A 1MNZA 4AVOA 1OM0A 2LLEA 1JNDA 3GFZA 5I02A 5C9UA 3LENA 1OZQA 2GUBA 4Z1YA 5E6YA 4DAIA 3R43A 4L6DA 1ENUA 4Q8TA 4DXKA 1VCFA 3VDBA 4XK2A 2V3DA 3KLLA 3IJLA 2FYMA 2H3DA 3AI0A 5C9RA 2BB0A 3K1DA 4MVAA 3RCNA 1NWUA 4CN1A 3TW7A 3TKFA 3QV8A 4O52A 1EUNA 3IJ7A 4OFCA 1E4LA 3URBA 4B15A 3DDMA 1REQA 5IM51 4ZO9A 4O1BA 3TW6A 2ZDRA 3W29A 2WCAA 1SO3A 5J04A 2HZGA 1KQYA 1J79A 1E6SM 2QPXA 3BZGA 1Z6KA 3UZWA 1D3HA 5LNSA 1V3MA 3F5LA 1LOLA 3WBYA 4H9UA 4L1WA 4C6OA 1UD2A 3LM7A 1WCGA 4UMCA 1QWKA 1KR1A 4F0SA 4A3YA 3WDQA 1NFGA 2I9EA 3COTA 5A8GA 3MUZ1 3SB0A 4DAFA 3W1LA 1U22A 1B3ZA 3FIGA 3PG9A 3TN5A 3W70A 4DHGA 4GG9A 4I7UA 2NV2A 3NXLA 5JH2A 3O15A 3PAJA 2ZXDA 1YXYA 4PCPA 3U2ZA 1M65A 3SCUA 4BA0A 1VHNA 3L4TA 1W1B1 4HU4A 3W1AA 4L5ZA 4CNNA 3WEZA 3EWUA 3RNDA 2G96A 3QEZA 5CBBA 4W5ZA 4HSOA 1G67A 1UROA 1SSGA 1ONEA 3VZYA 3P14A 3WLIA 1RPXA 3AROA 1DJYA 2WHLA 5I24A 3STFA 1TREA 4F0KA 3LX9A 4LALA 2ZUSA 3I4EA 1PDZA 1GVIA 4JEJA 5LNUA 3IVTA 1PUDA 3UJ2A 3LHVA 1CDGA 5I00A 4N0RA 2GVJA 2VFFA 3CAKA 3OZOA 4FXSA 1A47A 4I7VA 3LA4A 3GM8A 3UXKA 1D7KA 3CO8A 3VKKA 3TN3A 3HGRA 5I3HA 2A4AA 1W54A 3MP5A 3UCQA 3DHFA 4ZBCA 3EDFA 1ME7A 2ZRZA 4BI6A 1JCYA 2WQDA 3LM3A 4X22A 3O0FA 4DUVA 4O13A 3TC3A 3M0ZA 1EIXA 3DC8A 4IJBA 1IXPA 2VR4A 2WOQA 3MV01 2A7NA 1XJBA 4A2RA 3SCWA 1YDYA 4IL0A 4A3HA 2RDTA 3VD9A 2Z6IA 4MWAE 3YPIA 4RXFA 1NIUA 3BLPX 2DSZA 3IGSA 3N11A 2QXWA 3EA2A 2FPTA 4F0LA 1V3HA 4W88A 4H8NA 3ECQA 3KS5A 1VBHA 4UWMA 2C16A 3UVIA 1GQKA 3B8VA 1EZWA 4HTBA 1KA9F 3GBEA 2GQAA 2QS8A 3KTCA 4FO4A 2EXOA 4KMQA 4K37A 4TTUA 4GZJA 3STEA 2E25A 4IZGA 4E2VA 5CG0A 1HKJA 2VEPA 1E9YB 6ALDA 3ME3A 3G0UA 2CWNA 1JZ6A 4Y6GA 3SUTA 1OX5A 2GDUA 1X7FA 3NR0A 3OJGA 4RKAA 1JVNA 4BS0A 3PFMA 5J5RA 1QI4A 2XSBA 2GFTA 4JTHA 2DT2A 2ZX8A 4ONVA 5CPQA 1YXCA 1M7OA 1AW2A 4JDBA 1SPQA 4PFMA 4F0HA 2C71A 4AF0A 1L0PA 3GAKA 5TIMA 2DORA 3SGUA 5C2CA 4MF4A 4AWSA 4O4WA 2CBUA 4ACZA 2HWGA 4H9VA 2BVDA 4JHOA 1XM3A 3L67A 2WMKA 3ARTA 4HNOA 3FNDA 3WQVA 2JIEA 3NDZA 3BAIA 7XIMA 4JIEA 4DF1A 4BQ2A 4NF7A 1QATA 3LCLA 2NQ9A 1K8CA 3B4YA 1KM4A 2VGFA 1WDDA 3HO8A 3JS3A 3N18A 3NVDA 4DJED 2TODA 4UTHA 5HULA 4LU0A 3VUPA 4D8LA 3UZXA 5G4HC 4Z2IA 1M3UA 5E93A 3FJNA 4WOZA 1U5HA 4C6PA 3F5KA 1S5MA 2HNHA 3TSBA 4AXKA 1W3KA 4HHHA 2WK2A 1SZFA 1KCXA 3LHUA 1AFSA 5K4XA 1LWHA 2J7DA 3ERPA 5DBUA 3EOSA 3D6NA 2CEQA 1CIUA 3ARRA 5D2XA 3CL6A 3WH7A 3RLGA 1A5KC 3WK0A 2QULA 4IT1A 4JGDA 4PMRA 2G4FA 5KZEA 2DSWA 3AJXA 2WZEA 5FJUA 4IUOA 1QI3A 4YL2A 2DZWA 4R53A 5AYXA 3T08A 2AL2A 3QC0A 3BAJA 1IEXA 3W7KA 3MCMA 3FEQA 3ID7A 3EKGA 1YNQA 3DU0A 1DJIA 4NYUA 2O7QA 4YNGA 3M46A 4KF1A 3NXFA 1YBQB 2OOFA 4G6CA 4J3UA 2VVNA 3PPFA 2YCLA 2QCLA 4CQBA 5FAGA 1E72M 1QVBA 3UXLA 3WUBA 5HQMA 2PDBA 2E9BA 3OGSA 1UJQA 1C29A 3W38A 5DMNA 2GWGA 1FDZA 4YTQA 3O05A 1Z44A 5EMLA 1S3TC 3LBCA 3N12A 9XIMA 2PDHA 4LBRA 4PL1A 1IHIA 1XD0A 3TROA 5M3WA 4LF2A 1SSDA 1WQ5A 4MYXA 8TIMA 5DXXA 4PULA 5AZ1A 3W22A 3PULA 4TX6A 3FJ6A 1XH2A 3LPPA 1X6UA 3MO4A 4LAUA 3WF4A 2A5HA 3WENA 5DEZA 2A0NA 1UA7A 3GXIA 3KCJA 2VFDA 2V5KA 3DI0A 4BJHA 3TC7A 3HGOA 2Z1VA 4YHEA 2OO0A 3W85A 1YPFA 1W1PA 4O14A 3VOCA 5DMYA 3FY1A 1UOZA 4NAFA 4JFSA 3S2CA 2IKIA 5FSDC 1TPUA 3N2MA 3C0JA 5D37A 4JZ5A 1DORA 2RJGA 3TLLA 3A4AA 4DZ5A 4N9BA 4C6IA 1QPKA 3TA9A 4WRHA 3K1GA 4J7RA 3OP2A 3NQMA 2C8NA 1E0WA 3N1AA 4WSHA 5AC4A 3P8IA 2XVGA 1GKPA 1UG6A 1CXLA 5CLTA 1D2KA 3E6EA 2ZDSA 1UWTA 4XZLX 1UKOA 3M0IA 4UMAA 3GDMA 1WO2A 1S5TA 3S9IA 3W73A 3EWYA 3EDKA 4B2DD 3WF0A 5HMFA 2WKJA 2P5NA 1K4HA 4OQVA 4M6QA 3WUEA 4Q6XA 4DM2A 2G37A 1CX9A 2A3LA 2VC7A 8A3HA 1OD0A 3SCQA 4B90A 1JPHA 1UKSA 3LG3A 3QN3A 1YQ2A 3BOLA 3MJMA 2WBGA 3M5XA 1FHLA 2DSKA 5FF7A 4CD7A 4XWUA 3CQHA 3WQDA 4M82A 3WLJA 2VD9A 1HF6A 2OELA 3HG4A 1EEXA 1ITQA 3GK0A 7ODCA 1VEOA 1XFBA 4OJYA 4QCFA 3CZJA 4WXYA 5FL0A 2FJUB 2FLIA 1JZ2A 3OLIA 1UR1A 3CASA 5A8OA 4BWLC 1M5WA 5AYZA 3IVUA 3LHYA 1RALA 3FOKA 3QF0A 1BHGA 4UQCA 4IP5A 4GCAA 4C90A 2C7FA 1V4YA 2ZTKA 4E2DA 4X60A 3WQPA 2E6AA 3B4UA 3OBEA 3VIFA 3EX4A 4RDYA 5LA0A 4BHYA 1DL3A 3CM4A 5F1UA 1XX1A 3HJEA 5I3JA 1W8SA 2TRSA 1A5SA 4DX3A 2FQIA 5A6AA 2AMXA 1BSLA 3NO1A 2X1UA 4AEFA 4A6GA 4I9JA 5A94A 4MFEA 2FGZA 5D8ZA 4WKHA 4FOUA 2IQTA 1SJCA 2GOUA 3T0BA 3SSJA 2DY3A 1DIOA 1OGBA 3N25A 1DWFM 3S5SA 3C56A 3ABRA 3AHZA 3QH2A 3VKJA 4ERIA 3EWDA 4IIEA 2I5GA 4ZOCA 3W74A 2ZCGA 1CYGA 3UF9A 3BL3A 3I10A 3S0CA 4JCLA 1F76A 1VBRA 1PBGA 1SW7A 3IK2A 3P5ZA 4ROPA 1DQXA 3A47A 4WJXA 1TKKA 3KBWA 3UBPC 2FDMA 4K39A 2NUYA 4DUWA 2RDUA 4XBSA 3HIJA 1XUZA 3VKBA 1W0MA 1X6LA 4UR9A 2BZNA 3SN0A 4HNVA 2V2CA 1EYWA 2DV0A 4GFSA 3KOZA 1GVFA 1XIFA 4O10A 3VNIA 5CSUA 5CGMA 3KOYA 4P7QA 1R8LA 3MTWA 2YBUA 3QOKA 4AZ6A 5KMYA 4HT3A 1WDQA 1IEVA 4NVTA 4AZIA 4DUXA 4P5UA 1XGEA 1HKWA 7PTDA 4MM1A 4RDZA 3OW1A 3U4FA 4UNKA 4UQEA 2HXTA 3P60A 4Q8MA 5CAKA 3TTEA 3PZVA 4QR6A 4REQB 3VIJA 3NEVA 4GABA 4OWGA 3HG5A 3MUXA 1YDVA 4L1GA 1W5OA 3NWRA 1E9LA 3LZ3A 4US5D 4ZB0A 2BY2A 1GVYA 1DWHM 1HX0A 5CXPA 2VJXA 1XR2A 3R5EA 5HANA 5FF0A 1OHLA 4C1LA 5AYYA 1IYXA 4ZQRA 1BKSA 2GWNA 4MNLA 3NSXA 4HMNA 3KXQA 1VEPA 2OQLA 1EC7A 2NSXA 3IJ6A 2ESCA 1XICA 1DJGA 3HMJG 3WSUA 3PPGA 2DZPA 3LQGA 2D0GA 3UWWA 4PZVA 4DWSC 4DZIA 5IOBA 1KB3A 1SFJA 3K46A 1EP2A 3MVIA 3FAXA 1CB7B 5D05A 3TJIA 1WX0A 3NNTA 3SCTA 2OG9A 1PHQA 5I23A 2GGIA 3ANYA 3RO6A 3QMTA 3AIBA 5JBEA 3NL2A 4D8ZA 3BC9A 3VCNA 5GPRA 3PJUA 3NL6A 2PDQA 4IPIA 3WFAA 4KESA 1Z9AA 2DQWA 5AHFA 4AX7A 4L9ZA 4QDWA 2FZMA 2OGYA 3CZ8A 2BHYA 3NOEA 1U83A 3HQ1A 3PUEA 2PGWA 2G3IA 1BXBA 3OA3A 4NZJA 3G6MA 3WLRA 1VR6A 3TTSA 2V6AA 2PLJA 2BP1A 2IKHA 1MZHA 1EP3A 1XLJA 4H7ZA 1O5KA 4QLKA 2W67A 4YLWA 1DEDA 3F2BA 3ZWSA 3K4DA 1XH0A 3V5FA 2PRHA 1PCKA 5LNRA 1MZRA 4WDUA 2F9RA 1ZY9A 3EOOA 4BCEA 3NL5A 1HKKA 2QPSA 1A0EA 4B91A 4Z1CA 1O4UA 4UOQA 2Z2BA 4C6LA 3EDDA 1N8WA 2ACRA 4FP1A 2PDPA 3GXDA 4EWND 2DT0A 1SR0A 4TV6A 4JQ2A 2VFEA 5LIXX 5BZAA 3H26A 1G0CA 1PZ0A 2HV5A 3PZTA 1RSCA 3LCFA 4YN5A 2D24A 3QM3A 2WCGA 4PCTA 1GGOA 3M5YA 3H55A 4AIBA 1JAEA 2ALRA 3T09A 1Z7AA 2A2IA 3WK2A 1BAGA 1QJWA 4MDOA 1EL3A 5FJJA 3OLEA 5REQB 2OEJA 4PMNA 3BLDA 1HTIA 3S46A 1Q3NA 1LLOA 2J25A 4MFDA 1TPEA 1R3RA 3OLGA 4ZMGA 2XH7A 1Q6DA 3BLEA 1O1HA 4DM1A 2VUYA 3CNYA 4XQ6A 4JTSA 2WMIA 4Q4MA 5DXYA 4FNPA 4PRWA 1WZKA 3LQLA 1PIFA 1GQLA 1E0XA 2QMJA 3LCIA 3TEVA 4AD1A 5AKQA 3AMGA 4NZCA 4P8XA 4X0VA 1KLYA 1H5YA 4UC5A 5SWUA 1JGIA 2FJKA 3E49A 3VGDA 1GVOA 2QAFA 2PD5A 3SCOA 3BVJA 1IEIA 1F2JA 1PYMA 4E0CA 2ZA1A 2VTFA 1OZMA 3BH4A 4PBGA 3WJSA 4CLMA 2E7FA 3V4BA 1IEQA 1LG1A 1FUYA 4Z2KA 4YTSA 4KRZA 2I9UA 1KXVA 1TR9A 3G1FA 3APTA 1BVWA 2GVYA 1XGDA 3OZMA 3MBDA 4UQBA 4I7WA 4GXPA 4NKCA 3DEQA 3AWOA 3WQ8A 2F2HA 1OX4B 5HA7A 5DCEA 3LEPA 2BXZA 1CTNA 1HJSA 4ZOBA 4GJ1A 3AICA 2XISA 3QV6A 4I9AA 2WM0A 1C8YA 4NRRA 1EYEA 5CKSA 4HK6A 1XSJA 4XIMA 3UR2A 3OTRA 4JTKA 5HDRA 3G22A 4HMCA 1O60A 1JCNA 1G6CA 4OZOA 2E28A 1MSSA 1OYCA 1JZ5A 4Q3MA 3WH9A 5CZTA 3EMZA 3BCDA 1R38A 4UNIA 4NILA 1OFDA 3WEOA 5I3FA 3C2OA 2ZX6A 1JDAA 4EANA 1YPXA 4Y7EA 3AYTA 2CCRA 3DENA 3TMQA 1RVGA 1FWWA 1YX1A 2WSYA 4MUPA 1FWIC 3ABXA 2G8ZA 1XV8A 3GDLA 4J40A 4JKLA 1TV2A 1BXNA 1WDWA 1AL8A 4E6MA 1FWJC 4W8BA 2BASA 4IX2A 1A5BA 3S42A 3TDFA 1XLDA 4E5TA 1HO4A 3U4AA 3H2EA 5HJYA 1VFFA 3TV8A 5A95A 4QLLA 1BYCA 3ZSSA 3V0SA 3L7RA 1XS2A 2I7GA 1XW8A 2BBFA 4GX8A 1TCMA 2VDHA 3UQNA 3G1AA 1KM2A 4IJRA 1PSCA 4JTFA 1JFHA 4AD4A 4DI9A 2J9YA 1L6SA 3B0YA 5LA2A 2J6XA 2Y5SA 5BXPA 2Y70A 3CPGA 2JEPA 4Y2WA 3ITYA 1A0DA 2ZUUA 1EUAA 2H6RA 2A79A 2VDIA 4D6FA 3APYA 2XGZA 3M5ZA 1EGVA 2X1IA 2QCDB 2O9TA 1G4SA 4ZO8A 1PAMA 5FIPA 3W76A 2ZA3A 3DFQA 4GQRA 4WZHA 3VNJA 1B3YA 4IIDA 1XIIA 1B90A 4HU0A 5T9CE 2WV8A 1EOMA 2FB3A 1TJ0A 3DFTA 3N9SA 1NDYA 2J9XA 2XZ9A 4B3LA 3FS2A 3MI2A 4QS5A 3ZIZA 1TMQA 5T8GA 1XQKA 5D33A 3LGDA 4ATLA 2J4GA 1FVPA 1XLIA 5C55A 1V79A 1T8XA 1O7AA 3IWPA 1UP3A 3UXIA 3E38A 1W9XA 2P10A 4S39A 3W2JA 1CPUA 1T0OA 2Q09A 1HG3A 3PBYA 1BG4A 2G4JA 2W79A 2Z27A 5HR6A 1DJWA 1KBLA 2F7FA 1T96A 3KRBA 3LSBA 3HPFA 3KBVA 4ICNA 5LGXA 3R2GA 3A4XA 4W5UA 1LOQA 4CU6A 3W1NA 3KCOA 1XSIA 1W32A 3P84A 5MHBA 2OPJA 1HP5A 3R0KA 1S2WA 4FX6M 1PB0A 1XP3A 4NL1A 5H91A 3CWNA 4NX5A 3C2FA 5BNKA 1F7BA 4YHGA 4HB7A 2YYTA 2GJXA 1U5JA 1XDMA 5EMYA 3QY6A 3EOEA 2VXNA 1QDSA 1W9VA 3CH0A 3FHQA 4KIEA 4MAZA 4GWEA 5M03A 3PBGA 4XVEA 2YIHA 3VKDA 1KGWA 4PMXA 2ZRVA 2F2KA 5DQPA 2HBXA 4UFMA 9RUBA 2I17A 3KVJA 4R3UA 2XTKA 5HXMA 4JX6A 3WD1A 5K9DA 3PBMA 3UJSA 4RNFA 1E6ZA 1H7PA 1DIDA 3CUZA 2HNEA 1XISA 1J6PA 3T4WA 1WXYA 4PTNA 3VIPA 3W2MA 2XIQA 1WKDA 3REQB 5CZKA 5E0CA 4L65A 1ISZA 3E1F1 4UTJA 3OPSA 5EL1A 4FLSA 3GTFA 4H01A 1E40A 1FWNA 4E8CA 1YMYA 1V7YA 4IXXA 3UJRA 2GDQA 2CLLA 2OODA 1I75A 1XPYA 4O54A 2ZOXA 4AMCA 2QCGA 2IW0A 1F4HA 1TJPA 3AS2A 1KRAC 2W6RA 3GR4A 3RYSA 4H04A 4Q8PA 3A9IA 5H8MA 3C52A 3S6DA 1BG9A 3MYOA 1ZSXA 2WNWA 4L4OA 5G1TA 3MT1A 7REQA 3MZNA 4NZ3A 4KETA 2TPSA 5LKYA 4EF8A 3WG6A 3HTWA 3L23A 1F07A 3KBSA 5HOSA 4GX9A 4MIMA 4LCSA 3N19B 1NQ6A 1H11A 1LYXA 4HK5A 3ZT5A 4DBWA 1XKYA 3H4XA 3KCLA 1RK6A 2X2YA 3GXPA 3STCA 4JFTA 3L0KA 4WK9A 2OLSA 4CEXC 4O19A 3GH7A 4JXCA 1LRNA 1P7TA 1GNXA 1P5BA 1OF8A 1QW8A 1SO5A 2JKPA 3PP7A 3PTKA 1TV7A 3WDPP 1MFUA 5DRCA 4XIAA 5CJMA 1OWQA 5JIPA 4YWSA 4RCXA 4KPLA 5JUVA 1RP9A 1O68A 4U10A 2GGHA 1JZ4A 1ZUAX 4TIMA 4I5XA 4Z17A 4DXXA 2RFGA 1U1JA 5K9CA 1VLIA 1P0BA 4B5UA 1WAWA 3XINA 4QISA 2VC9A 4ZE4A 2RUSA 3S5ZA 3O1NA 5CPNA 2QVNA 2PC8A 4MPKA 4UZUA 4LUYA 3ABZA 1JG9A 2BMBA 4GMEA 3GR8A 4JN7A 2PBGA 1OSEA 1UASA 5LIKX 2IUZA 3V7PA 3EEGA 2BOGX 4ZQOA 2FZDA 1L6FA 2Y63A 4RNHA 3MVTA 4LAKA 3J7HA 1FHVA 4JN8A 2RDXA 3WH5A 4GYFA 5IBXC 5TBOA 5ENLA 2V2DA 4JD4A 3C5QA 3TQKA 5KTLA 2P88A 3ZZ1A 4KW2A 5LXXA 1XWYA 1YRRA 2PWEA 3VD7A 1DTNA 2HQAA 3H7VA 4QIUA 1DXIA 3WLOA 2QKFA 1LOSA 4AD0A 1YXDA 5EMKA 3PB2A 5HQEA 4F66A 4ZR8A 1Q6QA 4EAMA 2AMGA 2BSLA 1UYQA 2Z2UA 3BOXA 1ZJHA 4R9OA 1QRQA 1EJXC 2VEIA 5BXRA 3PUOA 4LANA 1H41A 4Z2LA 5CAHA 2YXOA 2P8CA 3L4UA 1MO0A 1E6QM 3GTXA 3CZKA 5D04C 4I9TA 3EX2A 1E6PA 1P6BA 3LV5A 3G1HA 3ELFA 3LDVA 3B9DA 4HOWA 1PCWA 2DGAA 3SQLA 1C91A 2FMNA 5CZ0A 4L7ZA 2O9RA 3LUTA 5LHFA 3HPXA 3S2NA 3OYZA 1QNQA 1UD8A 3RPTA 3APGA 2A3EA 4KT2A 1R3VA 3K8KA 2E9MA 3KWSA 4F9JA 2CZVA 1H0IA 2DP3A 4UMBA 4LJ3A 1E4IA 2Y8UA 2QJHA 1H63A 5D09A 3CQKA 4GIYA 3UU0A 1K9EA 1U1UA 3QHNA 4AG0A 1H2JA 4PRRA 3PUGA 3O3RA 3KVMA 3WQCA 4JYEA 2ZRUA 3MKCA 4JPGA 4TO8A 2GJNA 3M0MA 3B9EA 4MMWA 1EC8A 1UH3A 1WKFA 2E5BA 3AHVA 4EP8C 3A13A 3GVVA 3VMPA 1VRDA 2QCCA 1SJBA 1W6TA 5A8QA 1G7VA 4IMAA 2H90A 4S3JA 5JU6A 3GNPA 7TAAA 2FTYA 2Z1SA 4PMZA 4OGZA 1G4TA 4XSMA 3QBUA 4KEMA 2PDGA 3N9KA 4MPQA 2ICSA 3UA4A 3U5UA 3S5NA 3QXBA 3KAOA 2OEMA 5K3VA 2DH3A 2DJLA 3WQGA 1M68A 1TTPA 1XRSA 1AQMA 3N15A 4L4PA 4QSFA 3WDJA 3W7HA 1A80A 4GZEA 2ZZ6A 2F6XA 4I90A 2Z25A 3B8DA 3BQ5A 1W1TA 3CUGA 4IJCA 5JMUA 4M7TA 1HKMA 2AGKA 1C92A 3BGJA 4ZOAA 1PKYA 3UG5A 1V5XA 4AVNA 1U33A 1E1CB 1UZ1A 2B7NA 5TNVA 3M44A 4C6EA 1KBBA 2PFHA 3FGCA 2C13A 4DVOA 1TJ2A 2VCBA 4XKMA 3QZAA 2WHKA 1N7KA 2H9AA 4XAZA 4MJ4A 2EPKX 2X0YA 1XLKA 1HJUA 3WELA 2C3ZA 1ITUA 3NPWA 4N7QA 1QPRA 1TWIA 2CW6A 4QQUA 4G2DA 3KDOA 1UKPA 3IPWA 1IWAA 3A6OA 4GFIA 3QSTA 1XLBA 3RM9A 2PDXA 3S1VA 4M29A 4B9ZA 1IE7C 4ROQA 3W1QA 2C0AA 1TV8A 2QJIA 4O8AA 3PS7A 3IGUA 2UY5A 4HVXA 1EJVC 1GVSA 4ZSTA 1YNPA 3PWGA 3R6IA 5M2FX 3IANA 3ZO9A 4DO6A 1G94A 4Y9AA 3R0DA 4W8AA 2WW5A 5LNWA 3V5OA 4JL2A 5FI8A 2PCEA 1S5WA 3UERA 2R14A 2EPNA 4PFHA 3VM5A 4JTCA 1NTHA 1X8CA 2RH9A 2WYSA 1FP9A 3A22A 4IGNA 5D30A 3BCFA 4TUFA 1B9ZA 4LUTA 2YFNA 4EVZA 3CTLA 2OQHA 3CAWA 3OOQA 3H21A 1WB0A 1RD6A 2NXHA 3PR2A 4KCTA 2CERA 3WL1A 4WY0A 3HG2A 4GNKB 3BZJA 4C65A 2BVWA 1KRBC 2DUXA 3ZVHA 2NXIA 4GVGA 4JTIA 3F5JA 4DYKA 1QNVA 4TMCA 4NI8A 4DLFA 4HA4A 1S2UA 4LRTA 1Q2RA 1FOBA 3LBOA 1E4MM 3M0XA 1P0NA 1XYCA 1I60A 3O2LA 1XCWA 5A6KA 2UY4A 3GVWA 4M81A 3GKAA 3TA6A 3W02A 2X05A 2J78A 3OGRA 4LUJA 5HQLA 3C0SA 2E6YA 1CCWB 4G8TA 2NW0A 1TO3A 3B05A 3SR7A 6REQB 1NFPA 1R3SA 3C6CA 3WUGA 1OYAA 4C91A 2OFJA 4FNTA 2QDEA 3L4WA 2EG7A 4J2MA 2XYLA 3CQJA 1CB2A 4HMDA 2WJDA 1QI5A 3CV1A 1CGVA 3ANVA 1MXDA 3AXXA 2QUMA 1TZ7A 2QZRA 1EGMA 2CESA 5CPSA 4AX6A 4XG1A 4N9EA 4GZ7A 3VX0A 4GRSA 4DN1A 4FAMA 3WLQA 1OK6A 1BRLA 1J2BA 2BV9A 1JXJA 1L6WA 1B30A 1PV8A 2QCNA 2JK2A 4GUFA 5LHEA 3LPOA 3SCSA 2A3CA 4NXKA 4BWLA 1RY8A 4KWVA 4Q8WA 4OE7A 2WJZA 4J5NA 1BXCA 1H3GA 4EACA 4UTMA 3BJSA 1VFTA 2VFGA 1IZJA 2DEPA 2J7GA 1PS9A 1TE6A 3IIXA 3VNDA 2GK1B 3EX1A 1QNPA 3C3UA 2DZTA 2HBVA 1DXFA 5CG7A 5D9PA 4X3ZA 3G8RA 2RGLA 1GYMA 3MO7A 1KQZA 4RE0A 1EGZA 3FSTA 3O6CA 1AMKA 4N42A 3AZTA 4WJEA 1IZKA 1E0UA 1NWRA 2KX9A 4EAYA 3KL5A 3GR7A 1RH9A 3D3FA 1KCLA 1H60A 1F6YA 4Q8VA 2A6NA 1SMDA 4H6RA 1QOXA 4X9YA 2HSAA 3R79A 1AVAA 3VIHA 1EO7A 1BQCA 3GC2A 3KEHA 1BF6A 2CPUA 3GU1A 4CD5A 1ZP3A 5XINA 2W9MA 3BLOA 2BXVA 3CAVA 3OVRA 1FY6A 3S83A 1FQ0A 1QASA 3QYSA 1GWJA 4JX5A 2Y7EA 1E55A 4JTQA 2G3MA 1EIBA 3VDCA 2V5DA 1MYRA 2Q8XA 4E38A 5EMUA 3N73A 1I8JA 4CCCA 4NXSA 2R8WA 3MPGA 3CEUA 2Z7KA 3WH8A 5HJLA 3E9AA 1J5SA 3LNMA 3N13A 1I2RA 1JRBA 4QAWA 4B3ZA 1C8VA 3QR0A 1SUXA 5FACA 1FWGC 2WANA 1PE1A 1HKVA 1FFQA 3GS6A 3RDKA 1X1OA 1G5AA 1RP8A 1FP8A 1R3TA 1E6XM 1AQHA 1BVZA 4O28A 4V28A 8XIMA 3GO2A 3OG2A 3WK3A 2WZTA 1VRXA 4O18A 2YXGA 4HA3A 3WJWA 4UUIA 3ABOA 1ZBCA 2JEQA 2VUNA 1E6RA 1GKRA 1I2QA 1UIOA 3TOPA 2VP8A 1F4AA 1XYLA 5E70A 3D47A 1EHNA 1XINA 3W7JA 4A22A 1CW2A 1QTWA 2HMCA 1W1ZA 3VYLA 2O7SA 1SMAA 4DXVA 5FF3A 5G4EA 4M1BA 3BV4A 1DP0A 1W3HA 2YCEA 4CD4A 1LRQA 1Z32X 4HNLA 3Q94A 3WFZA 1S1PA 4ORMA 3NZGA 1J4EA 3O0KA 2ZUWA 3VI2A 1FTXA 1J0JA 4QJ3B 1XUUA 1GEQA 1YTEA 1W3JA 1K8XA 2JE8A 3CWOX 2V5LA 3QGVA 4PSPA 4O11A 1E56A 4MG4A 4IPNB 1TVNA 2Q71A 3G6LA 3IGXA 1H5VA 3I7SA 3M47A 3CPRA 1BWLA 3NQAA 4DF0A 1RV8A 3N17A 3UZJA 1B0IA 1JCXA 2WWDA 1TWWA 1ME8A 2R94A 2R1NA 4K8EA 4JNZA 2DUZA 1KFLA 4AUBA 2PTWA 2PWGA 2YZ5A 5CPTA 1TX2A 2PMQA 3PBVA 1X1ZA 2EG6A 4G1KA 5C7VA 3IARA 1O5XA 4Q8UA 5GNXA 3W7NA 3MW7A 3I7QA 4JS3A 2GQ3A 2NWSA 3II1A 3OVGA 5KITA 1V3IA 4D9PA 4RR4A 1MW3A 1XIBA 2Z29A 5T91A 2EEXA 3PJTA 4UTLA 4GYPC 1K6WA 2Y8KA 1KWGA 1M01A 2WMJA 1UKTA 3FX4A 2D2HA 4MZ8A 4J3TA 1TTIA 3THDA 1KXHA 1XIGA 5EMMA 3UXAA 4CCEA 1BWVA 3OO2A 4PE8A 2R24A 4D6IA 2Y85A 1RQHA 1DIKA 2QV5A 4F4RA 4GH3A 1WUEA 1KGUA 3ITTA 4YWIA 1ADOA 1GKQA 2ZTJA 4UTWC 2B7PA 2YB4A 1IZCA 3VDHA 3K4AA 2YSWA 4HPNA 3TH6A 5A6JA 3DAQA 3EKZA 4IQLA 3MSRA 3QLLA 1HVQA 3KL3A 1E71M 3QSRA 2CZEA 2FB2A 4QCEA 4BZYA 3SO7A 3HJZA 3M9YA 6XIMA 2PDYA 5D9OA 4QAIA 3QFWA 2Z2AA 3SI9A 1QK0A 1CGWA 1NAL1 1R85A 5IFTA 3T0TA 4GZIA 2GPTA 3H6OA 3V0TA 3WLSA 1TPC1 4F2TA 4LNCA 1NJJA 3FA5A 3WKZA 4ORIA 3TOYA 3CHEA 3C8FA 3LS9A 3BARA 4IFKB 4U33A 1F5ZA 3PFRA 4M1RA 2FVKA 4JTTA 5AN7A 4MWAB 4C7FA 4AD5A 1XLCA 1H09A 3CJPA 4ZFMA 3TR2A 1GUVA 4O1FA 4S2BA 3W28A 5FEPA 1UH2A 1AD4A 4B5VA 4HA1A 2ISDA 4HOZA 2VFIA 5AC7A 2CU0A 1TJRA 5BXTA 1TELA 1WA3A 3R94A 4LX4A 1BD0A 4LAZA 5KETA 1XCFA 1KLZA 1P0KA 3M16A 4AD2A 5I09A 2FZBA 2ZZ5A 3PZQA 3PG8A 2QPUA 2J88A 2GOKA 4Q4KA 2FIQA 1LM1A 3ANUA 5GJMA 3RFAA 3T44A 3WMLA 4LUTB 3S1GA 1HJVA 4Q8NA 3BV7A 3AZSA 1ECQA 1QI2A 3LPFA 5LIYX 1YTDA 4QGCA 2VOMA 1OCQA 4H1ZA 1LP6A 2CFFA 2BOEX 1W17A 4LNYA 1LG2A 2A3HA 3RMEA 2WO5A 2WHMA 3CGTA 1VFMA 1ELSA 3TYUA 3WBEA 4EXAA 2YXXA 3K4WA 4J9JA 3A3XA 4E3TA 3LRMA 3S4TA 2Z00A 2ZFAA 1VFOA 1TPB1 4IQJA 2X1TA 1HW6A 4JNMA 3AWNA 3LCXA 1MW2A 1TE1A 2A21A 4LEQA 1EX1A 3MJYA 2VWSA 3UYIA 3D5HA 4G7FA 1MXSA 2DJXA 1BGGA 3EOLA 1GTEA 1JCTA 1Z3NA 2ON3A 3MBFA 2XH2A 3MKVA 4D8AA 3CUIA 3IVSA 3AIWA 2PZ0A 1TZ9A 5ABEA 1V0LA 2A6LA 1AL7A 3W81A 4IX0A 3RO8A 1PZ3A 4GCXA 4KEVA 2VD8A 2TYSA 3DUGA 5E5CA 1FKXA 2DSUA 1D7FA 2BHUA 5IDIA 4DF2A 1ODUA 3ORWA 4JFVA 4QNEA 4JAWA 1VLWA 3INPA 1LLWA 2XJ7A 4GXMA 3GLCA 2V68A 3U7BA 3Q65A 4JTEA 3VU2A 1TB3A 1VCGA 3Q67A 5BWAA 1LORA 3H54A 2E8ZA 1X39A 3R12A 1Q63A 1LUCA 1GYNA 1FRBA 4QSHA 2XDFA 4OHQA 3VOGA 1OB0A 1XL9A 4HNCA 5CSSA 1L6GA 2VMFA 3VDGA 4W4QA 4JIHA 4GINA 5DFAA 2UZ9A 2EPMX 1VIZA 1Q85A 2E1WA 4NNAA 2CZDA 3THAA 2IMRA 5JH1A 2WWCA 1GJPA 4K6AA 1ZENA 4GC4A 4HNUA 4BR1A 1KV8A 1QNOA 3QC3A 4GYKA 4S3EA 1XIMA 3OVPA 3ZLGA 4C6CA 2REQA 1LDCA 1HGYA 4H4IA 4AZCB 3CB8A 1EJWC 4F2UA 2ZRXA 4PTWA 1C7SA 3N4AA 5EBUA 4AZ5A 1LCOA 4GC3A 4OOZA 1TX0A 1AZ1A 4C1NB 2VC5A 5A6BA 1RY0A 1JD7A 1A3XA 1W31A 1ZHAA 3GG8A 1Q6LA 5DO8A 2P53A 3H12A 3QR1A 4XTIA 4HBKA 4S1FA 1M7XA 1OCNA 3TNOA 3CYVA 5J8LA 1SU5A 1DYSA 1O6IA 3WEMA 3W1UA 4AAJA 4BQ5A 4OIFA 3LLFA 1NH6A 5B7ZA 2ANUA 1AH3A 3ITLA 3A5FA 2QJMA 1GVEA 3CYJA 5G1MA 1NP2A 3M0KA 4CNUA 1X7IA 4AC7C 3QQ1A 4JY8A 4NSBA 1PKNA 1QFEA 2PGEA 3QHOA 5HMDA 3UWVA 4DO4A 3AIQA 3W00A 2PP3A 2WB5A 4CUCA 1OFOA 3BSGA 4FOJA 3SSZA 1WOBA 3UPWA 1SJAA 3SGZA 2GJPA 3W1PA 1MDLA 3OEXA 1IXNA 1YEYA 1ITCA 3NAVA 4M24A 1Z8AA 4QJ1A 2VX5A 4RV8A 1B3OA 1LTDA 1TWSA 2X09A 2SFPA 4QXIA 1JIBA 3BMXA 3W53A 3JZEA 2DT3A 4AXNA 4JQ4A 1QUMA 5E6ZA 2C19A 5AVHA 2Y8VA 3V36A 1C3FA 1IT0A 4UQDA 4NZ4A 1C8XA 3T0DA 1H7WA 3QPZA 3S5OA 2YW3A 3L21A 4GLEA 4KWWA 2X7WA 3QFEA 2J79A 3KP1A 3UPBA 1EA0A 3EEZA 4HCDA 4N9CA 2Y89A 5I3IA 1FH7A 5ECVA 2CHOA 1O94A 4PRTA 4L9XA 4FF5A 3UR8A 3P5YA 1DE5A 3VZZA 3F2DA 3TIMA 1A3WA 3FA3A 1B4KA 1YDOA 2YBTA 4C1KA 3CLMA 1CXHA 3T05A 3LTYA 4O0KA 4R27A 3W6MA 3E0LA 3RX3A 3W84A 2ZWZA 2BG5A 2VNCA 2XIJA 4KCWA 1DWJM 4HQVA 2D2OA 1TZZA 4ZQNA 2G3NA 4NAEB 1ZALA 1NOUA 2YLLA 3QTPA 4S3DA 2DDXA 4IFOA 1C93A 4EK7A 3OIHA 3K2GA 4NP7A 3NJ3A 1M7PA 1QAPA 3IJ9A 3BLFA 1K6AA 4JBRA 1T7LA 2DT1A 3ARWA 5EA9A 1FDYA 3AMDA 4XKYA 1LL7A 2FHBA 4FSAA 4UCGA 2NVAA 2EPLX 3T7VA 3CH9A 3MP3A 2C1GA 4NJKA 3XISA 1R6WA 5DLCA 1AW1A 1K4GA 3DYPA 3DN5A 1CXKA 1OD8A 3E2SA 1S39A 3GG7A 2NUXA 4XUGA 4HN8A 4R33A 2OT0A 4M56A 3MB9A 1EJUC 2MUCA 3BLKA 1VEMA 3GFXA 2G5WA 1I0DA 3B03A 3FXYA 1QT1A 3GNOA 3VO0A 1GEHA 2F38A 4O53A 4UOJA 5D9MA 3F4NA 4JKMA 3L0GA 2FPYA 3H22A 1VPXA 3P7YA 1P1MA 1O12A 2DIEA 1XC4A 3C2VA 2YDQA 1AJZA 2VZSA 3A24A 4I3GA 2IQ0A 3DFYA 1OC6A 2CXEA 5IBXA 3O06A 1RBOB 3EB3A 3KBNA 4B4HA 1XBYA 4PGLA 5M5DA 3ZJ8A 1NQKA 3GIYA 1F9CA 2ATSA 4AY8A 2OX1A 3RR1A 2ZZ4A 4MUZA 3BMVA 3QGAC 4Z2JA 1Q66A 3VGHA 3H2MA 2QCHA 3ABSA 3CV2A 5J5DA 5FOOA 3M64A 4C6DA 5DANA 2WSRA 5AHMA 3NM1A 1QPQA 2Y5JA 3R58A 1L8NA 2OSYA 3P82A 1IXQA 4IXHA 4OVXA 4NI3A 4ZOEA 3VX1A 4X0NA 3TC6A 1WYIA 4G56A 4N6EA 1J8VA 5HUPA 3T2OA 1JI1A 2WVVB 3LTSA 2FHCA 2OQYA 4MADA 2WLYA 1ZZMA 4JQ3A 5IXEA 5EBAA 3H70A 5MF5A 3ARXA 5F2MA 7CGTA 4MB4A 3SZ8A 2PRMA 1JXKA 5H8UA 3HBLA 3RCMA 3AAMA 2XUCA 1TQJA 3ARVA 4OBTA 4H8UA 5AYIA 4FPSA 1BVNP 1A4MA 2CLEA 4E4PA 3MYPA 1RCQA 3GIQA 3I6EA 3U2OA 3QLDA 4L61A 5A6LA 5C9XA 5DELA 1DJNA 2PDFA 3M7WA 1XQLA 2ZUVA 2PBOA 1OYBA 4DELA 2O55A 2FZNA 5AHNA 4PCFA 2OEKA 1AW5A 1IGWA 3VIKA 3WBWA 3TTYA 4Q8QA 4NIRA 4KGJA 5A8NA 1RLDA 1YADA 2HE5A 4D72A 1H1NA 2V2HA 1GCYA 4HZMA 3NDOA 1XC6A 4XAFA 2VM8A 4E8GA 1DJZA 5BOEA 1TFVA 2BFGA 4OV9A 1KKRA 3G1DA 1H62A 3LY0A 1E73M 2H8XA 3QPYA 1H7NA 3W01A 3UWZA 4ZGYA 3TTOA 3H7RA 2X8RA 1B57A 2PI6A 3EPOA 4FALA 4HCLA 4M6PA 2WQPA 5HBFA 1N55A 4GVHA 4JTUA 3VINA 4DBUA 3JW7A 5BCAA 4RPPA 4HMEA 4XD3A 4D1JA 3K13A 1XI3A 3TN4A 1IEWA 1LRTA 1PVNA 2ALDA 3UT0A 2WAGA 3BDKA 3PF3A 3BLIA 2YFOA 4DJDC 4IG2B 2WKLA 4AY1A 4CNTA 2CKSA 5C6MA 4FI4A 1R2SA 5F4SA 4XD5A 4LUSB 3VZXA 1GORA 1PXGA 1H1ZA 2QQ6A 5KZMA 3AU2A 1Z42A 2A7PA 2OMAA 5GJPA 4GBUA 1R86A 1GG1A 3OU8A 2WSKA 5ABFA 1XG4A 1Y65A 2PCQA 1OIMA 3OBAA 3LLXA 5K7JA 5I06A 2VGIA 3RM4A 2NQLA 4L6OA 1E43A 1XLLA 1BLIA 5AHIA 3NPUA 5MKGA 1ITXA 2XVPA 3WX7A 1I0BA 3ZM8A 4JTRA 2QDGA 4O1EA 4GH1A 1B5TA 1BGAA 1H50A 4CU8A 4XZBA 3NEHA 3VIGA 3W7RA 5LSMA 4WDWA 2NSOA 3WIJA 1QBAA 1J6OA 2EBNA 1BQGA 4UTTC 1GZGA 3R7MA 4IIFA 2A1YA 4MLJA 1TR1A 3UPMA 3O9NA 2KAUC 3DZ1A 4U3CA 5FCZA 4Q4RA 2XWEA 1SZGA 3G24A 3ISIX 1JD9A 4IF2A 5BYWA 4XAYA 5I5RA 3BAYA 4IM4A 1RCOB 2E4TA 1T5AA 3E2QA 3DGBA 3WDIA 4BK9A 2X0SA 2E3ZA 4IGSA 1P1XA 3U6WA 4ZTXA 3P61A 5I03A 2DUAA 5DCBA 1P0EA 4L9YA 3POCA 3B8TA 4L64A 4H00A 2PF8A 3DESA 4N4PA 3W7MA 3GW0A 3LCHA 1HL2A 1RJPA 1VF8A 3ARZA 1Q2SA 4Y96A 4O50A 4GQQA 1V93A 4NNBA 3DH7A 1OGGA 1Q65A 3CC1A 3O7UA 1ZGDA 4GI6A 3UA3A 4Y9OA 1L9WA 4H2CA 4B5WA 3DI1A 3H4GA 1DXEA 2VDGA 4JFUA 1VIWA 1V6XA 3C8NA 1OT2A 4ZA0A 1XYMA 4CQAA 4GA8A 5DBTA 3AS3A 5EMJA 1RPKA 3CMGA 4CN4A 3ZLFA 3F7JA 4M19A 3QKEA 3EOUA 3L5AA 2INZA 4GIRA 4KH2A 4KERA 3SIMA 2OZ0A 3RU6A 4IMGA 2DVTA 3CK5A 1MUWA 1J12A 3UW6A 2HK0A 3FLUA 3KLKA 2JIWA 1F8IA 3C0QA 4DYJA 5LYRA 4FHAA 5FJOA 4DBEA 4KCUA 4QJ5B 1W9BM 1QPNA 3VA8A 1GJWA 1EC9A 3AZRA 4HSNA 4LS2A 5A6MA 5AHEA 3TN6A 4ZXOA 2PWDA 4PB3A 3W2KA 4I6VA 1UH4A 2PWFA 3IGHX 1V0NA 1AQFA 1TWDA 1CLVA 4PR4A 3BTNA 3PVFA 5FJTA 4TXEA 3SW6A 3K8LA 4MZYA 2CBIA 3GDKA 1V0MA 1EDTA 4R7JA 1BPLB 5EB8A 1EBGA 5I78A 1FCVA 1SW0A 4LB4A 2QCMA 4DY1A 2YGYA 4F3HA 4J3ZA 2C14A 2OR2A 2BVTA 1CXFA 1XPGA 4S3BA 2OO6A 1THFD 2PDNA 1JULA 4FNSA 5DY3A 1N8FA 4MNKA 1NEYA 3WNLA 3AXKA 2GUYA 1PKLA 4WIWA 1HKIA 2XFWA 4J2PA 2B0MA 3GVQA 1SO4A 1SO6A 2J8TA 1ZFJA 4ILSA 2Y4SA 3W07A 4ZXLA 2C1HA 1U5VA 3U8GA 5FF4A 1CWYA 2VCCA 1XDJA 1UPMB 1HJQA 2BGQA 1XLHA 1JF6A 1LF1A 4QITA 3FYOA 4JYFA 1ZS2A 1QOQA 2HVMA 1EF2A 1QO5A 3GY1A 3S3GA 1SZRA 1EXBA 4RDVA 4AVFA 4AZGA 4UBPC 3ZT6A 3OBKA 2NV9A 3T9PA 6TAAA 4NUWA 1TIMA 3U57A 1Q45A 1B9BA 5C8BB 5C9WA 1FDJA 3OHMB 2JKEA 5LIUX 5EU9A 2ZQ0A 1OQFA 2ZX9A 3A12A 4Y8FA 1J10A 1KW1A 4M0XA 5ABTA 3C4UA 4C60A 3FW6A 3CUXA 1ODZA 1XXXA 4ZEPA 4QBXA 3AU6A 4S23A 1Q6RA 2D22A 1XRTA 2B81A 1S1RA 3AQUA 1K1DA 4LRSA 2Z7GA 4HYVA 1EEPA 1MW1A 4FA3A 4GNJA 2B7OA 1H51A 5PTDA 1XIEA 3T6CA 2VX7A 4UR7A 2J13A 3V35A 1ESWA 3IAQA 3VNKA 2XGIA 1LT8A 3P2VA 1E1EA 3L9CA 1MEIA 5LIWX 4Y9MA 4PUKA 3RF9A 1XYFA 3ZR5A 1JYNA 4UFLA 1Q5MA 4RLIA 3QR3A 4MKNA 2HRWA 5D02A 2X30A 2ZBTA 1JQXA 4A21A 2Q3OA 3EWWA 5DCDA 3UNTA 2G50A 1FFRA 3CMFA 4IMDA 2OSWA 4CCDA 1QI0A 1CXIA 3BPWA 4KGLA 1E3XA 1OK4A 4WQ6A 4B2DA 2I5IA 4FB7A 1ML1A 3C2EA 1T40A 4QEHA 1JCJA 3IAPA 2Y6ZA 3GWQA 4ASTA 1LROA 3P6LA 3MWAA 3OODA 4PB4A 5C70A 2DSVA 3LCWA 4KWOA 4LS1A 4J3VA 3I65A 5AOUA 4D6CA 2PSNA 3PBUA 3IIPA 4LUIA 2GGJA 3ABQA 1V02A 2G95A 3URNA 2FDSA 5C2GA 1WKEA 4ZE5A 1VFLA 3W4RA 2QJNA 1REQB 2GVGA 3CTTA 4IMCA 1K03A 1YTKA 3ZT7A 4HIBA 4GUJA 3TJXA