4UTUA

Structural and biochemical characterization of the n- acetylmannosamine-6-phosphate 2-epimerase from clostridium perfringens
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
229
structure length
229
Chain Sequence
GSSHHHHHHMLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRAQGVNDINEIKEVTKLPIIGIIARNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRKRPNGENVKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSVDFELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords N-ACETYLMANNOSAMINE-6-PHOSPHATE 2-EPIMERASE
publication title Structural and Functional Characterization of the Clostridium Perfringens N-Acetylmannosamine-6-Phosphate 2-Epimerase Essential for the Sialic Acid Salvage Pathway
pubmed doi rcsb
source organism Clostridium perfringens str. 13
total genus 87
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2014-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4utuA00
3IIOA 2X1UA 4Q32A 2DU2A 5C54A 2CZDA 4BK9A 2QUUA 4ADTA 8TIMA 1G4EA 5HUOA 4YWIA 2BSLA 4RX0A 2QAPA 5CZTA 4JS3A 2WOQA 1W54A 1M7PA 4C1KA 4I7UA 3LTSA 2G5WA 1YLVA 3BG5A 4LY8A 3TU9A 2J9YA 3WK3A 5CPLA 5LHFA 3EWYA 2F7FA 2PRLA 1TV7A 2WSQA 4MZ8A 4RZ6A 3DU0A 1JR1A 1ME8A 3MO7A 3G0SA 4U28A 5L6UA 2DJLA 3LRKA 3WK1A 1QPQA 3BLEA 1KFJA 2E5DA 1SU5A 4Y8FA 3IVSA 3G0UA 4BWLA 1QCWA 4FEZA 2CFFA 4O12A 3ZWTA 2QCHA 4JXCA 2Y7FA 3BGGA 4MZ1A 3WJZA 3HGJA 3W2NA 5F1UA 3G1VA 4M7SA 3G1HA 3OEXA 3BK0A 3ABQA 4DO4A 1XDLA 3CTLA 1TMHA 1EUAA 2C1HA 3BPWA 3CEPA 3KVJA 5KITA 1ZJIA 4EF8A 3P81A 1GOXA 4JDBA 1G7VA 2E6DA 3FYPA 3UWWA 5DXXA 3SGUA 3TC7A 4UTIA 5DELA 2O7QA 1DHPA 2EGZA 1GJPA 4A29A 3KXQA 3LGEA 1A53A 1F73A 3VE9A 7TIMA 4UTWC 1JRCA 1SO3A 3O8AA 4HPJA 2GVGA 4UXDA 1VZWA 5BRBA 4JX5A 4JYFA 1SZGA 3T55A 1H7NA 2V2HA 3MYOA 4G1KA 4M5PA 4IMGA 3C2VA 5I3KA 4NJIA 1QWGA 3LCWA 5E1QA 2PCQA 1QDSA 3PBYA 3TUUA 2A7PA 3R2GA 1TPVA 4O14A 3O06A 3ELFA 5CSSA 4O4WA 2ZRVA 2NWSA 4WXZA 3F03K 2VELA 4RJEA 5EKYA 1GWJA 4E2DA 4UTLA 3GNDA 4S2BA 1W3NA 2OMAA 1LLZA 1F74A 1KM6A 1TO3A 2H3DA 2AQWA 3UY7A 5HR7A 4Z0JA 3SI9A 3CIWA 3UD6A 3G1DA 1F7BA 3DKLA 4CNPA 4LS0A 1RQEA 4AH7A 3WJYA 1X8FA 1A5SA 1GVQA 1TSIA 2I1OA 4O0KA 3NM3A 1PHWA 2H3BA 1KLZA 1QPNA 2GPTA 3G8RA 4O18A 3N14A 1G69A 4UTWA 2LLEA 3P82A 5D05A 4RK8A 1S5WA 3QW3A 4O53A 3QZEA 3A5VA 1SSGA 6ALDA 1FXQA 2A21A 2X1TA 1PV8A 3P61A 5K4ZA 1VGAA 4LTSA 4NNBA 1OFDA 2BWGA 3O63A 4A21A 2Y7GA 3NQVA 5FEXA 4JY9A 3HPXA 3LCGA 3LHTA 4MOZA 3TQ0A 4QSHA 1OFBA 1TTQA 4OGZA 3OVRA 4OT7A 2ZA2A 3UNDA 4AHOA 1FWRA 1WYIA 3LCHA 4HPXA 4J9JA 4RKAA 1SQ7A 2H90A 1SW7A 4JTLA 1MO0A 1FQ0A 2ZRUA 5G2IA 3W7QA 3QFEA 2C19A 3M9YA 3F4NA 5A8GA 3WK0A 2VFFA 3HPSA 2C0AA 5FEPA 1J4EA 1GTEA 4O4VA 3F4WA 2YPIA 3W1QA 1CW2A 4JTFA 2QAFA 2HSAA 3W2UA 1P5BA 2YGYA 1XDMA 1GPWA 5G1YA 1FCBA 3PSWA 1H7PA 3NQMA 3CC1A 4UR7A 3HG2A 4JIQA 4WJEA 1H51A 1TQJA 2R94A 3PUEA 4PCFA 3UZJA 1KBJA 1QMLA 3W1MA 3W7NA 3W1PA 5BOOA 3EX6A 1I2RA 1NFBA 3T4CA 2HS6A 3T44A 4ONVA 3I7QA 1KM3A 4OQVA 1KM2A 5KINA 3M0ZA 3IVTA 3O6YX 2I14A 1OJXA 2V5LA 2OZ0A 5J5DA 3L5AA 1K7EA 2W6RA 4UFIA 4XUGA 4WUIA 1HTIA 1DBTA 3P74A 5AYZA 3VI2A 2A85A 4QNWA 3STGA 4ZVJA 4LOCA 3I68A 2OT1A 1A50A 2CLOA 2TPSA 3EWZA 4MY8A 5G2WA 1YADA 4DELA 3GDRA 2RH9A 4ZQCA 1H62A 5I3GA 3KHJA 2G95A 2Z6JA 3NPUA 4GRSA 4P61A 5TBOA 4IWWA 2C3ZA 2QDGA 3PSVA 3LI1A 1CX9A 3A5FA 4AMAA 4R33A 2DZVA 4QJ1A 5DCEA 5TIMA 5FEZA 1M7OA 4KFNA 4NX5A 3TX9A 2NXIA 5AHLA 1QO5A 1D3HA 1TCDA 1S5TA 1KFKA 4NJKA 5IM51 3MP5A 3FIGA 3A24A 3CEUA 4QAIA 4ALDA 3NL6A 2JK2A 4O28A 4K6AA 3PBUA 4CLMA 2J6XA 3W83A 2VFHA 3ZR4A 2B7NA 4IXXA 2ZZ1A 2JGYA 1ME9A 2B7PA 2YCEA 3ZFHA 1ZY9A 3S5OA 3O07A 2NUWA 2ZQ0A 3UWQA 1LOLA 1N55A 3DH7A 1KFBA 3GAYA 2GUUA 3QYQA 4TR9A 1F05A 1H1YA 1VPXA 3WJSA 1AL7A 1UUMA 4O1AA 3S1WA 4BFAA 5FI8A 3TE9A 1LM1A 1AW5A 2X2GA 2J9XA 4O19A 5D2XA 1VCVA 3LBMA 2ABBA 5FF7A 3QSRA 1SZEA 3MI6A 1SFJA 4FNQA 3U2OA 1FDZA 4LRSA 3NQ8A 4RXFA 1VYPX 4TIMA 1OX4B 4ZQPA 2W0UA 1K8ZA 3KRSA 3TSDA 5CPNA 3BW4A 4LVAA 3O6CA 3TFXA 1BEUA 2RDWA 1GT8A 3W71A 4N6EA 2GQ9A 4IXHA 2NUYA 1R47A 2NXHA 4MJZA 2A0NA 5KMYA 1FXPA 3NA8A 3QH2A 3CPRA 4JIPA 2NX9A 2CLHA 4LS2A 4BI7A 5LNSA 4HSNA 4M6VA 3W7KA 2Y63A 2ZZ2A 3W07A 4OV4A 3C6CA 1W5MA 3B04A 2A6NA 3USBA 3PM6A 1IXOA 4OHQA 2NV1A 2CZ5A 4DF1A 4JTKA 1SZNA 1T8XA 4M7TA 4O50A 3W7PA 3PBVA 1OHLA 2CLIA 2V81A 5EA9A 1DQWA 4HHPA 4FXSA 3QQ0A 2P1FA 2ZRZA 1JUBA 2YXGA 1XUZA 3PF3A 4ML9A 3PB2A 4O10A 3TR2A 1XBVA 4D2JA 3BVJA 1X7FA 2V9DA 1LDCA 3OA3A 4NXSA 2QF7A 2FLIA 4Y9AA 3S6DA 4ORMA 3DFOA 4TMCA 4QNEA 3THAA 3OIXA 3TMLA 1JCJA 5LNRA 3CHVA 3IRDA 2GJLA 1SO5A 3FJ6A 3S1VA 2RDUA 4K7YA 2YSWA 3W7IA 4LUJA 5EMUA 1W37A 5LNVA 3RLUA 1LRNA 1R2RA 2R14A 3T78A 4KWWA 3LOTA 4XWUA 3HG5A 4AB4A 2ZFAA 4H3DA 2ISSA 2J24A 3NQAA 3LHZA 3KAOA 1OVDA 1BKSA 3NR0A 1KTCA 3B0VC 3NQGA 3M43A 3CT7A 4XZ9A 4X3ZA 3GR7A 4DPPA 4K37A 1H60A 1MEHA 2D73A 3L66A 4LUIA 2OX1A 5FF4A 3B0UX 1MZHA 1OX6A 4O57A 3SECA 3SFKA 1IXPA 1X1OA 1IXQA 2E5CA 3C52A 1OABA 5EPDA 3GXTA 4IX2A 4GUGA 3TJXA 2A6LA 2ZZ7A 2A7NA 3C61A 2DZPA 2FTPA 3T40A 3DHDA 2BZNA 2GQ8A 3PR2A 2CLLA 1HFBA 3QQ1A 4NZFA 4UNKA 1VJIA 5G5IA 5E0KA 4R34A 4K8HA 3FLUA 2QDHA 2EPHA 1GG0A 1ALDA 4GUIA 3UQNA 2ZZ4A 4UFHA 4XKYB 3TK7A 3GR8A 3W88A 3LV6A 4Q4KA 4O17A 4NNCA 1W0MA 3G1FA 2C16A 3YPIA 3VFLA 3TQKA 1I8JA 3I65A 3M47A 3TXZA 1RQHA 3ABOA 1JQVA 3DFPA 2EF9A 3HBLA 1H7OA 4BWLC 2QCFA 4HNNA 2QCDB 4N9DA 1HO1A 3W6YA 2PURA 2Q8ZA 5HWMA 3B03A 1D3GA 1LBFA 4HSOA 1V5XA 1K7FA 3HO8A 3C8FA 1TPEA 1FWSA 1LYXA 3ZWSA 1W5OA 4YXGA 5LGXA 4MYXA 3Q37A 4UC5A 3G1SA 3RU6A 4LNYA 3G3DA 2ZBTA 4BR1A 1W3TA 3N73A 1JCXA 2ISWA 4IJBA 3KFTA 4LS1A 3GB6A 4MPQA 1XKYA 1LZOA 3QPYA 1PVNA 3UWVA 2WSYA 4MJMA 3PVFA 1U83A 4JYDA 3C0JA 2ZDRA 4CQAA 4RLIA 3DKJA 5EBUA 4WOZA 1OX5A 3W1TA 4XTIA 4N9CA 3KVMA 5EYWA 3HMJG 1TRDA 3DGRA 3W2JA 4EOUA 3B0PA 3LCIA 2JKEA 3L68A 4N4PA 1BWLA 3HGRA 1KV8A 3GDKA 1F2JA 2XN2A 2PRMA 1TPFA 2YFNA 5F4SA 5KSWA 4FIQA 5G4EA 2V82A 3GKFA 4HNTA 4QITA 4ZMGA 1FDYA 3N3MA 3M44A 5D2YA 4M19A 3FOKA 1LORA 1WXJA 1VQTA 4XQ6A 3RNDA 1M5WA 3OHIA 1H7WA 1SSDA 3UWUA 2X1SA 3IIXA 2ISVA 5KZDA 4UTTC 3E9AA 5DCBA 4UNLA 1IIHA 1NF0A 1GEQA 3P60A 1YPIA 5I3HA 2VXNA 4KKXA 4FX6M 2A7RA 3BLFA 1OYBA 3MBDA 5HULA 2Y70A 1YDOA 5HINA 3TIMA 1N7KA 1SZFA 3UPWA 1E51A 1OFQA 3W7OA 4JEQA 1JCLA 1W5NA 5LNWA 1OF8A 5AYXA 1JCMP 3W1LA 1RD5A 4IMEA 5BMXA 3SR7A 5DBUA 2QEZA 2JKAA 3SJ3A 5BMWA 3DENA 3TW7A 5T26A 4LV9A 3W7LA 1S5VA 3GZ3A 3EB2A 3E12A 4WY0B 1NAL1 4MY9A 3HIJA 2QCEA 1DKWA 1FX6A 5DXYA 3DI1A 3PBWA 3BW2A 3KX6A 4UTTA 5ABTA 1KBIA 1W5QA 2EAWA 3C4UA 5LHEA 1LLWA 1HUVA 1QO2A 1KV5A 4JTIA 1UBSA 2FPYA 3S5YA 3TQVA 3LLDA 4UTKA 2ATMA 2FB2A 2RDTA 1EEPA 1GVOA 2XN1A 3GX9A 3NXFA 2DZXA 4IMCA 4I7WA 4DO5A 2VFIA 1FWNA 4K39A 3TV8A 2QKFA 4DXVA 3W9ZA 1YYAA 2GQAA 4N6FA 1K03A 3NZRA 4JN6A 3MI2A 1H7RA 1XBXA 3S8HA 1TTPA 4XKYA 1GZGA 4LVFA 4Y90A 4BI5A 4UFLA 2Y89A 3G1AA 2JKPA 3QEZA 1L6SA 1OFOA 2HMCA 3NQCA 4AVFA 3ABRA 1I2OA 4MZYA 1DV7A 4LV4A 2V8ZA 3PAJA 4JD4A 2V2DA 2CLEA 3BV4A 4POCA 2QCDA 3NZ1A 3M16A 1LRTA 5C55A 2ZTJA 1TPB1 3PY2A 2QR6A 1Q45A 4W9TA 4TO8A 1TJRA 4UIOA 5CPMA 3O16A 4YCOA 4IMFA 4UTHA 1U5JA 2YZRA 3LBCA 4Z1DA 1FDJA 3G3MA 3QM3A 1XFBA 2ZA3A 2TMDA 5AHEA 5BNKA 2G97A 2ALDA 3TKFA 4AEOA 3FS2A 3PS7A 3E0IA 5G1TA 1XUUA 5AHFA 3W22A 4CQ8A 1QPOA 2R8WA 4DO6A 2J88A 1R30A 1RPXA 2NWRA 5MHBA 2QJIA 2WV8A 2E09A 5I3JA 3CB8A 1YTDA 3W75A 3W76A 1VYRA 3IIPA 4AAJA 2V30A 2YDAA 2VEIA 2VKZG 4DPQA 3HGSA 5DBTA 3QW4B 1PL9A 1PHQA 3MI3A 3QF0A 1WOBA 3JR2A 4A3UA 3NQ7A 3MHFA 3PULA 1SO4A 3IIVA 4EIVA 3PG8A 4E0CA 4HNVA 1L6YA 4LW7A 1QFEA 2AGKA 3CQ0A 4ZQOA 4OBTA 1HL2A 3DXIA 2VFGA 1Q3NA 3I7RA 4WD0A 4EF9A 1Y0EA 2WJZA 1W56A 4O13A 2Y62A 1I2QA 4RZ5A 1VYSX 2CLKA 4JTHA 1B9BA 3TROA 4NQ1A 2JBMA 4UMBA 3W7EA 4PEKA 3DI0A 1M6JA 3NAVA 3OVPA 4UMAA 1YXCA 4PODA 4CNOA 3HPZA 3L0NA 4LC6A 1DOSA 2QCGA 4HNUA 4Y96A 3GIYA 4FNSA 1K3UA 1JJKA 3NVTA 2NX3A 3H53A 4R7JA 5F4WA 2ABAA 4EWND 3TAOA 2YR1A 3UYCA 5C2XA 3LRMA 4FIRA 5FESA 5D09A 2CZFA 3M5YA 1YXDA 4MLRA 5C6MA 2WPBA 2VOMA 3RLVA 3CU2A 3V1PA 2ZRWA 5FF3A 3P62A 4FO4A 5F4XA 4DF0A 1I2PA 3BARA 5LZLA 1A5AA 3S0CA 3PUDA 1ICQA 4UTJA 3GNNA 3W86A 3W2MA 1JVNA 3IGUA 1LCOA 1XC4A 3BGJA 2WKJA 2PC4A 3D0CA 2UV8G 1ZALA 3DFTA 3R5EA 5K9XA 3H55A 1FWWA 3W72A 1ZCOA 1WX0A 1Q6LA 1CI1A 5EY5A 1I4NA 1XBZA 2ZYFA 1VS1A 1NEYA 5D33A 4C1LA 3G0XA 3W84A 3LHUA 3W1UA 2FB3A 2E77A 1ICPA 3G8EA 5DN1A 1YXYA 3GDLA 3EKLA 3NDOA 2Z0IA 3GAKA 3JS3A 3MBFA 2YX0A 3N19B 1A5CA 1IXNA 1H5YA 1SUXA 2B7OA 4LC8A 1AG1O 1PE1A 3INPA 3GLCA 3FFSA 1ML1A 2B0MA 5CKSA 1OYCA 4CCDA 2KZHA 3NL3A 3N34A 3QC3A 4MLJA 1KLYA 2VEKA 2CU0A 1Z42A 4I9AA 2C14A 3UZ5A 3LHYA 3FYOA 1UJPA 3FKKA 3UWYA 5AC8A 1PCKA 3NEVA 2QCMA 1SPQA 3TW6A 2NLIA 5SWUA 1O5XA 1FCQA 1K8YA 5KTLA 3G22A 4N02A 4O1CA 3B8DA 4RR4A 5KZMA 5F2IA 3DFNA 5DY3A 4A2RA 4MUZA 4UFKA 3W74A 3M1ZA 4TU1A 1ME7A 1EWEA 2A2IA 1G67A 3CIXA 2EKCA 1VLWA 3SGZA 3LLFA 5U7SA 3PUOA 1O4UA 3AO0A 5CPOA 5D2TA 5K9DA 1TYGA 1EIXA 4NXKA 2E6FA 4NT0A 1BWKA 1KA9F 1PIIA 1FCVA 4O15A 3N2XA 2ZZ3A 4JDYA 2FJKA 1N8FA 1RQBA 3LXAA 3P7YA 3LX9A 2DZUA 3GVGA 3P84A 4ZL1A 4O1DA 1OFPA 5CG7A 1UASA 3HJZA 3W2KA 1WV2A 1I2NA 1OK6A 3LCXA 2GOUA 3EEGA 1RVGA 4B5NA 1P0NA 3TMQA 4LU0A 3W2LA 2WO5A 3W1XA 4DBEA 5TQLA 1NF7A 1GVFA 3NPWA 1T0OA 1WBHA 3KRZA 1VH7A 3EXTA 1WOAA 2FDSA 1W5PA 1YTKA 2CWNA 4PH6A 3N9SA 2JGQA 4FXRA 2XFWA 1G4SA 4HN4A 1RV8A 1SR9A 3IV3A 2RHGA 1PCWA 4WY0F 4E2BA 2QJGA 4M6QA 5IBXC 1UUOA 2Y61A 3T7VA 3LERA 4NU7A 4IGHA 1O60A 4CQ9A 4UTUA 4FNPA 1AW1A 3NG3A 4OE7A 3NL2A 4PA8A 1ZHAA 3W7GA 1SFLA 2VC6A 1I45A 1QOQA 1VLIA 4JY8A 3M5VA 4UCGA 1YTEA 1LOSA 2EHHA 4PL1A 2YYUA 4JTUA 1G4PA 1RR2A 2P10A 2H8ZA 2Y85A 3L9CA 2C6QA 1QOPA 2NV2A 4LT9A 3ZS4A 3RMJA 4NJJA 3W7CA 4KWVA 1DORA 5AOUA 5G4WA 4LRTA 1A5BA 5K3VA 1THFD 1B4EA 1VRDA 4XTDA 4UR8A 1DVJA 3WFAA 4PL2A 3NOEA 3B06A 1LRQA 1GG1A 3LRLA 1O5KA 3PB0A 4AWTA 2A5HA 5H91A 2BXVA 2Q3OA 2PRHA 3P80A 3FA5A 2ZZ5A 2Z2UA 3E96A 3E49A 5IBXA 2FFCA 2CZEA 1EUNA 3L5LA 1NVMA 2TYSA 3EWUA 1WDWA 1VHCA 1KFLA 5D32A 3ANYA 2A1YA 1HG3A 1OX4A 3STCA 2Y7DA 4DEFA 3EKZA 4MY1A 1GQNA 2ATSA 1GYLA 1H1ZA 5AC7A 5AHIA 3M7WA 1AW2A 3O6DA 1T99A 1QPRA 2G96A 1WA3A 3R12A 4ICNA 2CW6A 2Q3RA 4IMDA 5FF2A 3NQ2A 4JTJA 1Z41A 1W3IA 3VNDA 1EP2A 3TC6A 1KM0A 2E1DA 3F1QA 1KTBA 3ATZA 1QNVA 3W7MA 4FB7A 2CLFA 3GDTA 2I9EA 3W7JA 3L65A 1GVSA 1OF6A 3I6RA 3VKJA 3P8JA 4UMCA 3M5ZA 1C8VA 4CNNA 2V5BA 3NYZA 3EX1A 2VENA 3TSBA 1ICSA 2DZTA 4FHAA 3W7DA 4QQ3A 4U4MA 5F2GA 3ABSA 5EL1A 3DAQA 3P5ZA 5F1VA 5K2ZA 3WJXA 2NX1A 4E38A 4FX7A 3W85A 5LKYA 1G7UA 4XBKA 3TA6A 4OU1A 1XI3A 1HO4A 4NX0A 3EXSA 4YLWA 2YFOA 1UB3A 4JICA 4WQ6A 1MXSA 3LHWA 2WNQA 1YDNA 1JCYA 3A9IA 1ZENA 5KZEA 5CGQA 5E93A 4JR5A 1H61A 3L67A 1AK5A 1K02A 1R2TA 5J5RA 5BW6A 1WQ5A 3P67A 3W7HA 3RK8A 3A22A 1AMKA 3UPBA 3W3OA 3S42A 4FF7A 1XCFA 1B4KA 1P4CA 3M5XA 3N2MA 1GYNA 4JTTA 1ZAHA 3Q58A 1TIMA 2ZTKA 3GXNA 1KFCA 4UTMA 1WBJA 4AHQA 4HKPA 5K7JA 3MYPA 1W8SA 3TAKA 1X6UA 3G24A 4FX8A 2J9ZA 2Z6IA 4WOQA 3TFCA 1YDVA 5LNUA 1JRBA 1T96A 2ZRYA 2H8XA 4OWGA 2YW3A 2ZA1A 3TDFA 5FEWA 3NL5A 1TPH1 1VCFA 1TB3A 2NUXA 2QUVA 2QCNA 1IIGA 3C2FA 3P5YA 3TXVA 2WSRA 1VC4A 4GC4A 4MFEA 4JX6A 3NM1A 3LTPA 4X2RA 2HS8A 3MMTA 2YYTA 3QMRA 3VE7A 1MEIA 3LV5A 2B4GA 4JX4A 1JQXA 3FKRA 1NSJA 1TJPA 3MP3A 1J2WA 4O16A 4L4LA 2VEMA 2GVJA 5HR6A 1PS9A 2GJNA 3LM7A 3UXDA 1GVRA 4O8RA 3HB9A 3S1XA 2WNNA 4BF9A 1GTHA 4MKNA 3W1RA 3NGJA 4LVGA 5U4NA 4ZQNA 4MYAA 4ADSA 2Q8LA 3IEBA 3K30A 3QPZA 5K4XA 1B57A 1K7XA 3IVUA 4Z1BA 1WAUA 1FUYA 4WXYA 4GJ1A 1TRIA 1W1ZA 3SSJA 4UUIA 2BX7A 1ZNNA 3Q2DA 4PFMA 3W73A 3GXPA 3P8IA 3EX3A 4Z1CA 1Z44A 2Y6ZA 1DQXA 4HIBA 1XXXA 1RZMA 4O54A 1R46A 3TSMA 4IPJA 1R2SA 1EA0A 3BG9A 2WNZA 1G4TA 3N9RA 1KM4A 3UWZA 5AC6A 5CZ0A 3UXAA 1XBYA 3NQ6A 3QRHA 4YMZA 5DCDA 1EWDA 4NVTA 5H2ZA 2R91A 4RZ4A 1F5ZA 2RFGA 4AF0B 1L2UA 1ZAIA 5C5YA 4ZZ9A 3WJWA 1H63A 4LWWA 3TH6A 3LXBA 4GE8A 5D03A 2YW4A 3HQ1A 4QM1A 3HOJA 3LB0A 1V7YA 5F2MA 4K8EA 5AN7A 3DFQA 4IOTA 3LDVA 1X1ZA 5AYYA 1C9DA 1G6CA 4JTSA 3O15A 5AB3A 3HGOA 4PC8A 1FWTA 4AXKA 4NJGA 4EVZA 4NNAA 1FBAA 4Z0SA 3H54A 3EXRA 4JNMA 4OV9A 4WX2A 1OK4A 5D02A 2V0TA 3BW3A 3C3NA 3CLMA 1KM5A 1JUKA 5LSMA 3DFSA 1D9EA 3MHUA 3A21A 3EX4A 4NZJA 4NJHA 1L9WA 2ZCGA 1XM3A 1YPFA 4A2SA 2TSYA 3GYEA 5CZSA 2QCCA 4AWSA 1SW0A 3IGXA 1TTIA 4H4IA 1OFAA 4MVAA 1TQXA 3LHVA 3CM4A 3W1NA 3SY5A 2FPVA 2Y7EA 1FCUA 3U6WA 4H6KA 3NQEA 5G2HA 1L6WA 1K8XA 3U8GA 2AAMA 1KTNA 2Z1BA 5D2WA 1B3OA 4O0ZA 2Y88A 3KRUA 4S2CA 4XBSA 3RFAA 3EX2A 3C2RA 5HQEA 4AWUA 1KM1A 4FNTA 4HT3A 4DQWA 2E6YA 3MWAA 3LTYA 5HWJA 1BTMA 4RV8A 3NQDA 1VR6A 4RXGA 1F6PA 2F84A 4IX0A 4Y6GA 4A22A 1Q6OA 4N2YA 3OG3A 4GWEA 4IUOA 2HTMA 3QMSA 3RF9A 3AJXA 2OCZA 4Z08A 1O94A 1S3HA 4KFOA 5D04C 5HJLA 3HG4A 5D30A 1JULA 4NUWA 2BLEA 2VFEA 3S5NA 2C13A 4BI6A 3ATYA 2DP3A 2E5BA 2X30A 4GBUA 1JUEA 1SW3A 4K36A 5I3IA 4Q33A 3HF3A 1OG0A 4I7VA 1SO6A 2B7QA 1DJQA 4GXMA 4WY0A 5HMSA 3L21A 3FEMA 4DF2A 4X9SA 1Q6QA 6TIMA 3S5ZA 3G18A 3BG3A 3V75A 3DHFA 4Z1AA 3W70A 5HWNA 1P1XA 4JTEA 4K7VA 4YL2A 3CWOX 3KVKA 5DY2A 3B05A 1EP1A 1Q6RA 3O1NA 4IQLA 1EB3A 1QR7A 3L0KA 4QISA 1F76A 4ZQRA 3A23A 3G1XA 4GUFA 1TV8A 4ZQMA 2DJXA 4P2VA 4QIUA 3GDMA 3PC0A 4MIMA 3STFA 3S1UA 4JGDA 3S9YA 1ZFJA 5I3FA 1MSSA 3LCFA 1IGSA 2ZZ6A 4M6PA 1LP6A 1H7XA 3GK0A 1MEWA 2NZLA 3HG3A 1EPXA 3OVQA 1UCWA 2DZWA 1ONRA 2NXGA 3NQFA 4RCXA 3TCEA 4O1BA 4JYEA 3MP4A 1VHNA 3IGSA 4TX9A 5CSRA 2E6AA 2H6RA 3EWBX 3WK2A 2IQTA 2XN0A 2VEPA 5DLCA 4O52A 3GKAA 2O7SA 3QJAA 3SW6A 3STEA 1JCNA 4DBDA 3TJLA 4FNUA 4YCPA 4JTGA 3QSTA 3SIZA 2PE4A 3MJYA 4IPIA 3KVLA 3FJLA 1LBMA 1Z48A 3NPVA 4FNRA 1TTJA 4R53A 3LXCA 3E02A 1F6KA 2FQIA 1KFEA 2E68A 5HNRA 4N4QA 5AFDA 1ADOA 3W87A 2WQPA 4GFSA 4ORIA 3OBKA 2TRSA 4ADUA 5F2LA 2X16A 3O05A 2QUTA 1TV5A 1O95A 2C18A 1LOQA 2P0OA 4AF0A 4CCCA 1DL3A 3L2IA 2V2CA 1LBLA 2GVLA 4N9BA 3NPXA 1XL9A 3B4UA 2QCLA 4TMBA 1TPUA 3IIZA 2RKXA 2X1RA 3I7SA 1P0KA 3Q94A 3VCRA 1C29A 3BLIA 2BTMA 1AL8A 5FF0A 2J27A 1QAPA 5D37A 3QMTA 1LTDA 3THQA 1LROA 1TPC1 4LVBA 3DBPA 2CLMA 3C2EA 2FIQA 5L9FA 3C56A 2OJPA 3DZ1A 5HUPA 4GUHA 2C15A 3BO9A 3EWWA 1TREA 4CCEA 5K9CA 1EX5A 1OYAA 3MUXA 3PWAA 4N9EA 3EWXA 3L0GA 2A4AA 4GNJA 3NNTA 4PTNA 2QJHA 3PG9A 3SZ8A 4O11A 1H50A 3TNOA 3JRKA 3NO5A 3R13A 2FPTA 1J5TA 1VCGA 3R8RA 4UFMA 5D38A 4L4MA 3W23A 5GVJA 4S1FA 3R89A 3G1YA 3L5MA 2W79A 4UFJA 3LI0A 5A5WA 3KOFA 2DORA 3W1AA 4X22A 5AHMA 1ZAJA 1EP3A 5CZJA 4LVDA 4WZHA 5AHNA 3UY8A 1OFEA 1TPWA 3CWNA 1W31A 1FY6A 4K38A 1KW1A 1IF2A 3MW7A 3LCLA 2ZRXA 4KFPA 5LGZA 3C2OA 1OFRA 3MHGA 2OT0A 3M41A 4GUJA 2VFDA 4AHPA 3W7RA 4MFDA 2DZSA 1DJNA 5D2VA 3M6YA 1TPDA
chains in the Genus database with same CATH superfamily
3UA3A 5C54A 1PX8A 3E6EA 3ZXWA 1G4EA 4YWIA 2BSLA 1FWGC 4RX0A 3LSBA 1XH1A 4JS3A 5BOEA 4Y2WA 1JF5A 4H41A 1QNPA 2V6AA 4Q4SA 2D2HA 1FHLA 5LHFA 2PRLA 1TV7A 1HKJA 1DJXA 2NT1A 1JR1A 1MW0A 1UD3A 1A0EA 2PDYA 4U28A 3VOJA 2DJLA 3LRKA 1KFJA 1R3VA 5KEZA 4BWLA 3URQA 2DSKA 1QCWA 4FEZA 3MSYA 1W9DM 2QCHA 2ESCA 1XLGA 3FA4A 3C0LA 4JXCA 3V0TA 3VGFA 3HGJA 4RPPA 3CT2A 4EXBA 3KL0A 4ZXLA 2REQA 5I02A 2HNEA 2BXZA 3IARA 4IGNA 2C1HA 5CCZA 3BPWA 1JI2A 2X41A 5DX7A 2OWWA 4EF8A 3UR5A 3FK4A 1FWBC 4UTIA 5DELA 2EGZA 3VK5A 4BQ4A 1TMLA 3KXQA 1A53A 4E5TA 4ML4A 2BGQA 1F73A 2XSBA 1JRCA 4GVHA 4HPJA 2WVUA 3FNDA 2BY3A 3K8MA 4HMNA 1GKPA 3C2VA 5I3KA 1C3FA 3T2OA 1U1JA 5E1QA 3ZSTA 4XBJA 1WCGA 1EGMA 2NQJA 4F8XA 4O4WA 2DQXA 1A80A 4OVXA 3GNDA 4DB7A 5C7HA 2FKPA 3NWRA 3GG0A 2OMAA 1LLZA 1Y8BA 4DBUA 2IKIA 1DIDA 4PEEA 5HR7A 4Z0JA 2GDUA 1LQ0A 1F7BA 3LMZA 3JVAA 4LS0A 4URIA 2WBKA 4AH7A 4AZIA 1X98A 1F3TA 3SUUA 3RAOA 1E1FA 2PDPA 1E0UA 2H3BA 1KLZA 3RR1A 2GPTA 4J28A 4G56A 1G69A 1LL6A 4UTWA 3R4IA 3GD6A 1S5WA 3QW3A 4MTVA 5JQ9A 4PFHA 2OEJA 3P61A 1Q4NX 4KEZA 1VGAA 4LTSA 3VDAA 4H19A 2BWGA 3LCGA 4HQVA 4KEMA 1A3HA 2ZA2A 1V0KA 3KEHA 4H6EA 3AS0A 4KH2A 4NKCA 5G2IA 3EEZA 4CNUA 3MZNA 3C0SA 1VFUA 3QFEA 4GIYA 1MQPA 1BKHA 2ZVIA 2WVVA 3BE7A 2I7GA 1E4LA 2F2HA 2QAFA 2HSAA 4JL1A 4QE5A 2YGYA 3R10A 1FCBA 2CXEA 3IJQA 3VTRA 2FTYA 1CZ1A 1HJXA 4BZYA 4NAEB 2R94A 4S39A 1QMLA 1SFTA 2Z24A 1OWQA 1MFUA 2WM1A 3UJEA 3QKZA 5BOOA 3PTQA 5T8GA 3PK7A 3T44A 3OYZA 1JAKA 3IVTA 2DQWA 4NZ1A 1OJXA 2OZ0A 1OSEA 2IQDA 2VRQA 5J5DA 2FH8A 3M0LA 3WLJA 2W6RA 4B3LA 4WUIA 4GI8A 2XG9A 1XIJA 1R3SA 2OWXA 3GHTA 1G94A 4QNWA 3STGA 4ZB2A 1IHIA 4XB3A 5EMKA 2Y5JA 2RH9A 1DEDA 4ZQCA 3NPUA 2Z6JA 4GRSA 3U7BA 4P61A 4IWWA 4G7EA 1ZLPA 3CYVA 1YE4A 1AQFA 1CX9A 5HA7A 4MB5A 1NQ6A 2XSAA 3V5FA 2WZMA 5CBIA 2A3LA 5AHLA 1FTXA 1D3HA 1YQ2A 1S5TA 3WH9A 3KZSA 3EOSA 3MP5A 3CEUA 4HHHA 4LBUA 1XGZA 4GY0A 4ZBCA 1UR3M 1XGDA 4UB9A 4Y9OA 1XRTA 1Y5WA 4KRUA 4I9TA 2CHOA 5A6AA 2JGYA 2HZGA 3U4AA 1ME9A 1TWWA 1MRQA 2NUWA 4S3FA 4XK2A 2OSXA 3PJUA 3K4DA 2GZXA 1H1YA 1VPXA 2ISDA 1RCXB 7REQA 1UUMA 5HJYA 3TE9A 1LM1A 1AW5A 4O19A 4B5XA 3CUXA 3MUZ1 2DSUA 1NARA 4KW2A 1A5OC 2QNEA 3EWCA 1W1IE 2OWCA 2VDGA 4YTRA 3AC0A 4NYYA 5MF5A 4AX7A 4PUKA 2RDWA 1E71M 2GQ9A 1R47A 1KB3A 4NZCA 2PDLA 3DYMA 4ROQA 2A0NA 2IPWA 3WMSA 2PDNA 5AVNA 4Q8PA 4JIPA 5LNSA 3S2JA 4M6VA 1NH6A 2W63A 3W07A 4V1YA 4OV4A 3A9BA 3USBA 3UT0A 5C9WA 2NV1A 1XLCA 2PDIA 1T8XA 3PJXA 3W7PA 1LQAA 2YZ5A 2O55A 2RDXA 5EA9A 1DQWA 5E0FA 3VC6A 1Q6GA 5FCZA 1EDTA 3EB3A 3B4YA 2MUCA 4ML9A 3PB2A 2O0TA 3CNYA 1KGWA 3BVJA 1HJVA 4ORMA 2OOGA 3DFOA 1QJWA 1V4YA 2W5FA 3OIXA 1JCJA 3S1VA 4K7YA 1LJYA 4H9YA 1VP5A 3ABZA 5EMUA 2XM1A 3RLUA 1R2RA 2R14A 4D9PA 4DAFA 4KWWA 3U2CA 3LOTA 3KBSA 2ISSA 2J24A 3NQAA 4LB4A 1OVDA 3VNZA 1WAWA 1KBLA 3NR0A 1MMFA 4XZ9A 1H60A 2QXWA 4LUIA 4B16A 3MO4A 4RE4A 2PF8A 1X1OA 1H4PA 4JTRA 1LQ2A 5EPDA 3E1F1 3T09A 4W5ZA 1K8CA 5JBFA 2IUZA 2DZPA 3T40A 1V0LA 1VJIA 4D6FA 1JDDA 5BRPA 1QI5A 2WC4A 3EBVA 2BFGA 2QDHA 5BXPA 5AYBA 2EPHA 1F3EA 4JTAA 1F8IA 4UFHA 3TK7A 3GR8A 3K8LA 1JI1A 2W92A 2WXDM 4NNCA 4DHGA 4I5XA 2WSKA 2VR4A 3VFLA 3TQKA 4CUCA 2ZVRA 1ZS2A 2A79A 1IT8A 1XIGA 1JQVA 1J0JA 2QCFA 4HNNA 2OYMA 2Q8ZA 2FTWA 1JL8A 4YVPA 4E8CA 4GX9A 2CBIA 4ZSTA 4M80A 1E70M 4AZ7A 2CIPA 2EJ1A 1G0CA 3CXOA 1V5XA 3BLLA 3A47A 1TPEA 4QCFA 3ZWSA 2WCGA 1W5OA 2F2KA 1CECA 3T9PA 3RU6A 3DFYA 3GIPA 3JZEA 1TZ7A 4BR1A 3N73A 2ISWA 4IJBA 4GI6A 1AUSL 4DZ5A 2PWUA 3TOYA 4GCAA 1LZOA 3F5JA 4MJMA 4V27A 4JYDA 3C0JA 4CQAA 4RLIA 4WOZA 1OX5A 3W1TA 4N9CA 5EYWA 4F79A 1UC4A 3HMJG 3TYBA 3EOEA 1EZWA 2QDEA 2PDCA 1JPMA 1BWLA 2P53A 3ISIX 2FZ8A 3KOXA 4L6DA 3C3UA 2DSWA 2YFNA 1XLBA 1CBGA 4FIQA 3WD2A 2ASHA 1XYMA 3VVGA 1FDYA 1IYXA 2XU2A 5BWAA 1LORA 1WXJA 3PBMA 1QHPA 4XQ6A 2PEVA 1M5WA 3OHIA 3WD0A 1H7WA 4F48A 3CH9A 1K9EA 4P8WA 2HISA 1NTHA 2I17A 1GVYA 1IIHA 1HJSA 2PP3A 4BEUA 1GEQA 3ZJ6A 1YPIA 4Q8UA 5I3HA 1JNDA 1RAKA 2VXNA 4KKXA 4FX6M 2A7RA 3BLFA 5FJUA 1TVLA 3A12A 1JDFA 3MDWA 1N8IA 2FMNA 4E8GA 1VEOA 3U5YA 1V02A 5HINA 2QPUA 1N7KA 3NOYA 1JCLA 5PTDA 5LNWA 4TVCA 4D6JA 4QGCA 4W4QA 3EA2A 2BVDA 1KXVA 5AYXA 2MANA 4GZEA 4LBSA 3WF1A 4IMEA 3I3BA 2OTDA 1B3VA 1PDZA 2JKAA 4ZOCA 3W7LA 1PZ3A 3SN0A 3GZ3A 3EB2A 7PTDA 4WY0B 4XZLX 4MY9A 2GK1B 2PU0A 3ZSSA 3BW2A 3VOHA 5ABTA 5LHEA 5LXXA 1LLWA 1QO2A 1KV5A 2J74A 5D8ZA 1US2A 1J79A 1ZP4A 1HJUA 3MMDA 4U10A 1NJJA 4KF1A 4DJDA 3T2PA 5CXPA 1PB0A 3SUSA 1YRRA 1KWKA 1EEPA 5HXMA 3GFZA 4LEFA 4XAYA 2DZXA 5GJPA 4Z1YA 1RD6A 4IMCA 2Q01A 3VIPA 1FWNA 2XGZA 2QKFA 4DXVA 1K03A 2VWSA 5AZ0A 1H7RA 1XBXA 1XRSA 1W6TA 2ON3A 5TD4A 3WNKA 4IJRA 4CD6A 2YA2A 9RUBA 3SO7A 1EJ7L 4UFLA 3SGGA 3W00A 3P3BA 2JKPA 1L6SA 4B3KA 2HMCA 2NVAA 2GSJA 4AVFA 1DV7A 4P7NA 3BICA 3DESA 5ENLA 4JD4A 1UP3A 2NVCA 3S9IA 3ENLA 2V2DA 3CTTA 4JQ4A 3KL5A 3VKBA 5C55A 2ZTJA 3PY2A 1DWIM 2GL5A 1KXQA 2XYLA 4W9TA 5CPMA 4IMFA 2EPNA 5I23A 4UTHA 1IEWA 1U5JA 2YZRA 3O0FA 3AAMA 2VDHA 3WY1A 3W6MA 4TV5A 5BNKA 2G97A 3FDGA 3OP2A 4GY1A 3IJ9A 3E0IA 3CMFA 5G1TA 1UKSA 1AODA 2R8WA 2VQTA 2J88A 1R3RA 5MHBA 3SCVA 2QJIA 2WV8A 1V3JA 1UZ1A 2E09A 2VOTA 1BYBA 1YTDA 1ZPTA 3CV2A 4DPQA 3WELA 1JZ6A 2D2OA 1W8GA 1XX1A 1KKOA 3TW9A 3NQ7A 2R1MA 4FLSA 4W85A 1L6YA 1QFEA 2AGKA 3KTXA 4OBTA 2VC5A 4GYJA 3T1GA 4DYEA 3UJ2A 4ZO7A 4IQEA 3PTKA 3CUFA 4KEUA 4QDPA 4GY7A 4JTHA 1POKA 2QV5A 3GWQA 3QHMA 2WYSA 4FXFA 3NDZA 3DI0A 3NAVA 4F40A 1YXCA 3REQA 5HPOA 3L0NA 1H09A 2QCGA 1EO5A 4Y96A 2BASA 4QE1A 4GYPC 1X8CA 3NVTA 2NX3A 4R7JA 2ABAA 4LGXA 1V77A 1SJCA 3L2LA 5C2XA 4UCFA 3NZPA 1PDYA 3H2CA 5D09A 1D7KA 2BP1A 1IZKA 2VOMA 3CU2A 1U2YA 3HV9A 1XR2A 2J13A 3S0CA 3VGDA 1A5AA 4J2MA 1K6WA 1QBBA 1SFSA 1JVNA 4LF2A 1EDGA 3VOGA 2WMHA 3IGUA 3VIFA 2WKJA 2V67A 3AIWA 3H55A 1FWWA 1TR9A 3UG5A 5AC4A 2Z4GA 3I6EA 2Z2BA 2WJFA 1CI1A 1XBZA 2ZYFA 1VS1A 2EPKX 1NEYA 2Y4SA 4C1LA 4GQ0A 3W1UA 3N2BA 1XKJA 1HNYA 1WXYA 2B31A 1ICPA 3U57A 2YOCA 1V7AA 3GAKA 2XHYA 3SDOA 1A5CA 1IXNA 1H5YA 2B7OA 4JFWA 3FFSA 4GMEA 2EG7A 3L4VA 2Y1HA 3DHUA 4WLCA 4I9AA 3SCRA 3LENA 1UJPA 1TUXA 3AIRA 1VPQA 1SPQA 2WKGA 3QR0A 3ITXA 1K8YA 1S39A 3G22A 2ZUSA 2QZRA 3B8DA 1DJGA 4RR4A 3DFNA 1JD9A 1ZBWA 3PZUA 3A4AA 5DY3A 4MUZA 5GQBA 1HKIA 1P43A 3KW3A 2E25A 3N11A 2A2IA 3CIXA 1VLWA 1UD2A 5GNYA 1XGEA 3PUOA 5BU6A 5CPOA 5FJPA 3VUSA 5K9DA 4PUEA 1QW7A 1BWKA 4DO7A 4O15A 2QYGA 3LYEA 2ZZ3A 4PMNA 3AMKA 1HL8A 3F5LA 1RQBA 3LXAA 3P7YA 1BYDA 3P84A 2DIEA 2CBJA 3K8KA 1FWEC 1UASA 4IJCA 4KCVA 2Y2WA 3LCXA 3M0HA 4CD7A 1BG9A 4KGLA 1BXNA 2EQDA 3TMQA 3OQ8A 5ABFB 1C90A 5IOBA 4H00A 3WQOA 1TPDA 5TQLA 4DRSA 4U3AA 3WQCA 3NPWA 1T0OA 1GYMA 3OBAA 1RBLA 1VH7A 2E7FA 4XUYA 1UC5A 5EFDA 1D7FA 2JGQA 1CXKA 4RNIA 1PCWA 2WC7A 2QJGA 2XVLA 5HJXA 1UUOA 2PDJA 3T7VA 4JKKA 1HVXA 4F0LA 3GHUA 4UTUA 5CSYA 4FNPA 1DIOA 4OE7A 4PA8A 1REQA 3ZJ7A 3L12A 3AYRA 3VMPA 3J7HA 1YTEA 1LOSA 4GACA 5LIYX 1SZRA 4JTUA 4HZ6A 3PTMA 3TA9A 5BU9A 2P10A 4AC7C 3AXXA 3ZS4A 5E0CA 2QUMA 4LRTA 1THFD 3A3HA 4UR8A 1DVJA 5XIAA 3VFCA 4GQQA 3VA8A 1OCQA 4RE0A 3E96A 3AHVA 3VIMA 4AZCB 5IHRA 2XIMA 2FFCA 3IWPA 2DT2A 3SCNA 3KWSA 3CL7A 4F9JA 4RDVA 1PIFA 1XD1A 1WDSA 3EWUA 3RO6A 1VHCA 1DIKA 3IAPA 2A1YA 4JTCA 1HG3A 1GQNA 3BV7A 2ATSA 1GJWA 3TYZA 1OEPA 3M7WA 4B2DD 1QPRA 2Q3RA 4IMDA 5FF2A 2BNJA 4XVEA 3ARZA 2R6OA 1S2CA 4JTJA 1Z41A 1W3IA 3VNDA 1KM0A 2E1DA 1V6YA 1QNVA 1Q7QA 3W7MA 4C7DA 3CZKA 2BG5A 3W7JA 4Q4MA 4KQNA 1OF6A 4V1XA 3CJPA 3AZTA 2V5BA 1F6YA 1QASA 4HN8A 3LSCA 4GOAA 2DZTA 1XLMA 2J8TA 3ABSA 3RXZA 3KWXA 1UWTA 4MSSA 5HQMA 1RBOB 3QR1A 3C0QA 3QKEA 4E38A 3WBAA 1S2AA 2G4FA 2VGBA 2I5GA 4YLWA 2YFOA 1UB3A 1S1RA 2XFFA 1UWRA 1EA9C 2VZOA 3A9IA 1ZENA 3AXHA 1ZJAA 4I90A 5E93A 3PPGA 2HE8A 4R9OA 1R2TA 4YVXA 5HAOA 5BW6A 3S1GA 3P67A 3S5SA 3VUPA 4W7UA 3ZQ9A 4KWUA 3UPBA 3PPHA 3GFYA 4FF7A 4AIOA 2OR2A 3GDBA 3M5XA 3N2MA 3LNMA 1GYNA 4HZMA 3JW7A 3E0VA 4HKPA 2ZX8A 3MYPA 3TAKA 3E2QA 1X6UA 1C91A 1EKOA 3WQ6A 1ZCCA 4W5UA 4HZ8A 2H8XA 4OWGA 1M9HA 2ZA1A 3TDFA 3PPCA 4D6DA 3NL5A 3GNXA 2NUXA 1B9ZA 3PNUA 3GG7A 3C2FA 4WDTA 2ZX9A 4EAYA 8XIMA 4X2RA 2HS8A 4C6KA 3MMTA 2BVWA 3MDUA 3M0KA 1VFOA 5M2FX 1JQXA 3MP3A 3OIHA 2GVJA 2GJNA 1GVRA 4TTUA 3S1XA 1GTHA 4MKNA 3F2DA 5U4NA 1EZ2A 1AH4A 4ZQNA 2WHJA 4ZTXA 3ARXA 3IEBA 3K30A 3U3HA 1FUYA 1EJWC 1P7TB 1TRIA 4UUIA 2BX7A 1ZNNA 3Q2DA 4PFMA 3HA1A 1Z44A 4HIBA 1XXXA 2PLJA 3MKVA 4J3ZA 4B4FA 3GC5A 2AMXA 3POHA 1HT6A 2XVKA 3MB9A 4PCPA 5KETA 1DPMA 1R2SA 3BG9A 4H8VA 1PTGA 5AC6A 1KM4A 4PMJA 2WSPA 2C7FA 4MMWA 1XBYA 3QRHA 3UXAA 4YMZA 4L9YA 5DCDA 2FYMA 1V3HA 4DYJA 3P6LA 1MUWA 3R8HA 3WLOA 1BYCA 5D03A 3KBWA 3HQ1A 1GJUA 5F2MA 1QW8A 3DFQA 3LDVA 5CJ5A 2IPGA 3B0YA 3O15A 3DN5A 5AB3A 3HGOA 3ARUA 4FZIA 4JNMA 3UU0A 2V0TA 3BW3A 4J3SA 4PTDA 4PULA 4S38A 1D9EA 3MHUA 4KCTA 1DWHM 4NZJA 4HPHA 1L9WA 2ZCGA 4YN5A 5CZSA 5HNNA 1V6XA 4F0MA 3MMWA 3PTDA 4CVUA 5ECVA 2GGGA 2L5HA 3W1NA 2XVGA 1FCUA 3U6WA 5G2HA 1W1A1 4GLEA 4ZTYA 2Z1BA 2INEA 1B3OA 1LF1A 2Y88A 1B90A 1DJYA 4XAZA 4XBSA 3AXKA 4QG6A 3WQ4A 3C2RA 5HQEA 1KM1A 3DYPA 5MKGB 1J93A 4PMOA 1KR0A 2J6VA 2WZTA 3UJRA 1H0IA 3NQDA 4IHCA 1E6SM 3CH0A 4ZO9A 3U2ZA 1UZDA 1RY0A 1K9TA 1LWHA 4L1GA 1MNZA 4N2YA 5CLTA 3OG3A 4IUOA 3RF9A 2OCZA 1O94A 3VM5A 4GI9A 3R7MA 5D04C 5C9UA 1C7SA 1LUCB 2BHUA 1JULA 3GR4A 1M65A 4ZFMA 1SW3A 4K36A 5DRCA 1XYBA 4Q33A 3FN9A 1W9UA 3H2NA 2YB4A 3UPMA 3A13A 1SO6A 3BDKA 2B7QA 1R0MA 1ODUA 4WY0A 5HMSA 3ZLHA 3L21A 5A8MA 2PD9A 3E0WA 3BG3A 2PWEA 1E55A 3AOFA 4L4PA 3B05A 3PHAA 4PMVA 1ISWA 4IQLA 1LT7A 3BCFA 4DWDA 1QR7A 1Q6EA 2ZUUA 3G1XA 1QK2A 3PC0A 4MIMA 4JGDA 2JE8A 3S9YA 1ZFJA 5I3FA 1MSSA 3LCFA 4AZHA 4UQDA 1TJ2A 3CUGA 4W8BA 5E5CA 1EPXA 3HMCA 3FAXA 1ONRA 2NXGA 4PE8A 1R3YA 3WLQA 4N0RA 5CSRA 2UBPC 1WZLA 5B7YA 2INZA 2PLCA 3SW6A 2EG6A 1JFXA 3U7VA 1AD1A 3IJ7A 1OM0A 5FJJA 1ITUA 3SIZA 3FYYA 3ZT6A 4RV3A 1DE6A 1IWPA 4GQRA 3LXCA 2JFEX 1MRAA 4NF7A 1FWIC 2ZC8A 4QFUA 3W87A 4O1EA 4DYKA 3MU7A 2WQPA 3MTWA 4Y7EA 2CPUA 3OBKA 1HN1A 4UQ9A 4RNJA 3O05A 3VZYA 3RPTA 1TV5A 2OQYA 1JEZA 3NXLA 4AF0A 1E4NA 1J12A 4XZIA 2Z00A 2C71A 2QCLA 2RKXA 2X1RA 3Q94A 3B3DA 4RNHA 3CGTA 5FF0A 3PFMA 5T91A 1QAPA 5D37A 3MUAA 3TQPA 4WIWA 1E6PA 4ERIA 3LUTA 1ZQ5A 1Z9AA 4GGBA 1DHKA 2OJPA 3T07A 1OYAA 2UY3A 4HTYA 3EWXA 1DIEA 3L0GA 5AY7A 3T4WA 4S3JA 3M0IA 4DXKA 1WKFA 5CH9A 3V5CA 1PYMA 3JRKA 3NO5A 1NM9A 2FPTA 4UFMA 1LWIA 3OLGA 5D38A 4PMXA 3MV01 4OJYA 1UR0A 3R89A 3QBUA 4UFJA 3W02A 2DORA 3W1AA 1NELA 1XQLA 5AHMA 1BYAA 3IGHX 3LPFA 5CZJA 4FLQA 5AHNA 2ZXDA 2PGRA 2WVTA 1TPWA 5REQB 3AHTA 4AYSA 1IF2A 2ZXAA 2ZRXA 1OFRA 2VI0A 3MHGA 1OT1A 4F66A 1PUDA 2FDMA 2DZSA 5D2VA 1JYNA 1CGTA 1SJBA 3LPGA 3M46A 4DX3A 4Z17A 1DWFM 2CZDA 5TF0A 4Q8WA 4ADTA 3EGJA 3MT1A 3WBEA 5CZTA 2WOQA 4CD8A 4I7UA 1CNVA 2G5WA 3WEZA 1YLVA 2QLYA 3TU9A 2J9YA 3FCPA 1A3WA 5CPLA 4YHGA 4MNMA 3EWYA 2F7FA 3VIIA 1A0DA 2W62A 3DG7A 4MADA 4RZ6A 7XIMA 3DU0A 3ARYA 1FH9A 1ME8A 3MO7A 3G0SA 4OBRA 2E5DA 1SU5A 4Y8FA 3UR8A 3CYJA 4GNVA 3R0UA 2PF0A 1M53A 2CFFA 4O12A 3ZT5A 5AC5A 4NI8A 3WF3A 3W2NA 5F1UA 3G1HA 4GK8A 4NY2A 4HYVA 2ACQA 4UQCA 3KVJA 1IT7A 5E9AA 2E6DA 2TODA 3FYPA 4EXAA 1OT2A 1SR0A 3TC7A 2VEFA 3NVDA 1GJPA 1CTNA 4DWSB 1UR2A 3LGEA 4L6OA 7TIMA 3QTPA 2UZ9A 1DJIA 3WLKX 2GVGA 4UXDA 5BRBA 3UJFA 2FZ9A 4JYFA 1SZGA 3T55A 2V2HA 4M5PA 3I3DA 1HJWA 1QDSA 3PBYA 5LA1A 3U5UA 2A7PA 3R2GA 2NV9A 3USZA 3O06A 1TWZA 5CSSA 2H9AB 5M03A 3BLKA 4RJEA 5EKYA 4S2BA 1G5AA 1W3NA 1V0MA 1KM6A 1TO3A 1VD6A 2H3DA 3UY7A 4L9ZA 3SI9A 3CIWA 3G1DA 1L2QA 2X8RA 4CNPA 3WJYA 1X8FA 2P50A 4I9JA 2Y0FA 2YLAA 4FAMA 1LG1A 2R1KA 3EDDA 3N14A 4ERAA 3MPGA 1RJPA 2Z7KA 5D05A 4PTXA 5CEWA 5C9RA 5BRQA 3A5VA 1SSGA 3B8UA 6ALDA 2A21A 4LH8A 2X1TA 2WHMA 1PV8A 5I03A 4GA8A 4NNBA 2AL2B 1EF3A 3O63A 3W37A 2Y7GA 3NQVA 5FEXA 1PKMA 4AEFA 3OVRA 4AZBA 1P0EA 1WYIA 4J9JA 5E6YA 3M0JA 1MO0A 3OTRA 3WNPA 3UFYA 1FQ0A 4JPGA 1F3WA 5A8GA 2EEXA 4IIEA 2VFFA 2C0AA 1DQUA 1J4EA 3H2MA 4BS0A 2NSXA 1RHCA 3W2UA 1P5BA 1XDMA 5G1YA 3PSWA 3AWOA 3NQMA 3R6IA 3CC1A 1T41A 3RM8A 2HPIA 4AIBA 2O9TA 1TQJA 3PUEA 4PCFA 4W89A 2XIJA 3VCCA 1PSCA 3W7NA 1FKWA 4DBSA 1M7JA 3MCNA 1I2RA 1NFBA 5LA0A 4F3HA 2D0FA 1KM2A 3BAKA 4LBRA 1XSJA 1FRBA 4AZCA 5FJRA 3TR9A 3ZIZA 1KCXA 3L5AA 2PGEA 1HTIA 4DZIA 1XCXA 2G37A 4FPSA 3UP8A 3VI2A 5AYZA 3QPEA 4EANA 4ZVJA 2OT1A 1WDQA 4E8DA 4MY8A 5G2WA 1CLVA 4B92A 1MI3A 3N04A 1E72M 2QDGA 3PSVA 4J1OA 2OQHA 1HP5A 3WENA 3A5FA 4AMAA 3LN3A 4HOWA 2IXVA 3DG6A 2J7BA 2Z1XA 5A6TC 4HJFA 3TX9A 1J96A 3C86A 1K9FA 7TAAA 3RCYA 1KR1A 1FWDC 3WO8A 3AUOA 3M0MA 3WLSA 4NJKA 5IM51 3FIGA 3A24A 4JNZA 1EBHA 4H2HA 4ALDA 3GZAA 3NL6A 4QAIA 3SJNA 1JXKA 1JPHA 4CLMA 2D0HA 3RX2A 2YL6A 2BY1A 1DYSA 2VFHA 4YJ5A 1XRVA 4K1WA 2JIEA 1RALA 2B7PA 2YCEA 4L56A 1ZY9A 1TX0A 1UOKA 2EG8A 4MNJA 1FWHC 3O07A 3PP7A 3UWQA 1BSIA 1LOLA 1N55A 2DT0A 3G77A 3GAYA 2GUUA 4TR9A 5AZ1A 5JUVA 1F05A 3ZVHB 2FMOA 4F2BA 3FSUA 5JIPA 2ZWYA 3RLGA 4BFAA 5FI8A 2VT0A 3VXGA 2BGNE 5FF7A 5J04A 3QSRA 4E3VA 1SZEA 3SCOA 2G3FA 3ARVA 2AAAA 2XWDA 1VYPX 1BSLA 1GW9A 5BXSA 3H2OA 1K8ZA 3VD4A 2FJUB 4C7GA 3O6CA 3TFXA 2GJXB 3SM0A 3I10A 2NUYA 2NXHA 3FJNA 3G1RA 3NGFA 1FOBA 2NX9A 1AQHA 1I60A 2PTYA 2AL1A 1FKXA 4HSNA 5HQLA 1I1XA 3W7KA 3M0XA 2ZZ2A 1UYQA 2CHRA 2J7EA 2WHKA 1W5MA 3B04A 4NSBA 5A6MA 2OGYA 3E74A 4JBRA 5M5DA 2VC9A 4DF1A 3WLRA 4KWSA 3WMLA 4KMQA 2V81A 3VDCA 4ZOEA 3PF3A 3GG8A 1WZKA 4N42A 5C70A 2ZIDA 1XBVA 3TR2A 1U5VA 5D8WA 4D2JA 3AI0A 1X7FA 1LDCA 3B9DA 1KGUA 4GI4A 4UOZA 3S6DA 3KUMA 1DTUA 4PTMA 4HOZA 1L8NA 2VCAA 1P7TA 3CHVA 2GJLA 2RDUA 3UZYA 1A5UA 3DC0A 4RDYA 3WQVA 4M56A 5ABGA 5LNVA 1LRNA 3T78A 3HG5A 4AB4A 3PANA 3KAOA 3MSRA 4ACZB 3LLXA 1KTCA 3H2AA 3NQGA 3B0VC 3M43A 3CT7A 2W66A 3UR2A 3GR7A 4DPPA 1O5QA 1EEXA 2X1IA 4K37A 4IGMA 3GQYA 2D73A 3L66A 4GHRA 4KESA 2DW6A 1MZHA 4O57A 3SECA 4AISA 3SFKA 3QY7A 1XH0A 2ZUMA 4HCLA 1IXQA 2WLYA 1UWQA 4HMCA 3C52A 3GXTA 1Z69A 2V38A 3KCOA 3RILA 1NQKA 4F9DA 4KERA 2FTPA 4IF2A 1E6ZA 1A5NC 2CLLA 1HFBA 4LYPA 1V93A 2DVUA 4UOQA 3O2LA 3ARPA 4HA3A 4MG4A 1ZU8A 1OC5A 4HVXA 4NIRA 3QZ6A 4Q8TA 1CPUA 3UVIA 4GGHA 1GPFA 3LV6A 4MWAE 4Q4KA 3G1FA 4S23A 2C16A 4PB5A 3TEVA 4D8AA 4A05A 2YL5A 5RUBA 3N6JA 1ZJBA 4TXEA 1F61A 4IG2A 5A6BA 1H7OA 2WCAA 4BWLC 3W6YA 1HO1A 2PURA 2X2YA 5HWMA 3B03A 4AVNA 3QN3A 4GX8A 3ECQA 4V28A 2WPGA 1X97A 2WQDA 3HO8A 3WSUA 3C8FA 1FWSA 2TAAA 3KDNA 6TAAA 4QP0A 5LGXA 3WBWA 1E9YB 3G1SA 1LUCA 3TYAA 1RJQA 3ZOAA 3W0KA 3KTCA 3WBXA 5DEZA 3QPYA 1P48A 2HEJA 3LG3A 4JN7A 2WSYA 3BCJA 3WLMA 4HU4A 4K1GA 1ODZA 3DKJA 5I7GA 1GOIA 4CKQA 1VEMA 3DGRA 4EOUA 3B0PA 3LCIA 2IPJA 3AMCA 2JKEA 2VHLA 3L68A 4H04A 1V79A 1N8WA 2YA1A 3HGRA 1UIOA 2CWXA 3U0HA 1XF0A 2FHFA 5F4SA 3T2QA 5G4EA 2V82A 6REQA 5DQPA 3V4BA 1RP9A 2QVHA 4QITA 4U5IA 1EJRC 3M44A 3QY6A 9XIAA 4D6EA 1BF6A 2ZOXA 4DWSD 4BY3A 5EMYA 1HKVA 4F0KA 2EBNA 1X39A 4GXWA 3RNDA 4I5UA 3F4VA 3TTOA 1ITQA 1MVYA 2CETA 2BY2A 3PJWA 4G9PA 3IIXA 2XIQA 4UTTC 4X9YA 5D9OA 4N7QA 1NF0A 1TG7A 2Z27A 1K9DA 3APYA 1XYFA 4AX6A 3T0DA 4US5D 3N2TA 2Y70A 1E51A 3ERPA 3W7OA 1W5NA 4LUSB 6XIMA 4Q8NA 1OF8A 4I8DA 5ABHA 2ZE3A 4BF7A 1NU5A 1CB7B 5BMXA 4E4PA 2WC3A 2BV9A 5BMWA 4M3PA 3TW7A 3S4TA 4LV9A 3TJ4A 2A3BA 3IPWA 3AIEA 1H49A 1V6WA 3W25A 1GONA 1UD8A 1NAL1 2BOFX 1GEHA 1UWSA 1E40A 4UQBA 1DKWA 5DXYA 3URNA 1GOMA 1KBIA 1W5QA 2EAWA 1GOOA 1TVPA 4AD3A 4JN8A 1QNOA 3IS4A 4XD6A 3SN4A 1UBSA 3ITGA 2X7WA 1Q63A 5BCAA 2FB2A 5I2UA 1TA3B 1VBJA 4INFA 4OUIA 2P76A 3NXFA 1F3XA 2E28A 2EJAA 2E8ZA 4S3AA 3BMVA 3AYTA 4I7WA 3NQBA 4LUTB 2I9UA 1UKPA 2VFIA 3CK5A 3E38A 4K39A 3TV8A 1I0BA 1UIPA 4L9XA 1ZB5A 4GVIA 3S8HA 1TTPA 2FZMA 2FGZA 4XKYA 4A3YA 4P5UA 1GZGA 4LVFA 2Y89A 4QR6A 3G1AA 1MQRA 1J2BA 1RBAA 3QEZA 1ESWA 3TONA 4LV4A 5FSDC 2V8ZA 4YIWA 3PAJA 3BV4A 4RL3A 4POCA 2JALA 2QCDA 3M16A 2QR6A 4TO8A 3UCDA 1HQTA 4UIOA 2OLAA 3O16A 1SJAA 1GQLA 3E3HA 2VL4A 3PN8A 4J3TA 5FSEC 4HOXA 1ECEA 2P3EA 1N2VA 5GJNA 5EMMA 2G41A 1KBKA 1UWIA 3G3MA 2PD5A 5FJOA 2HRWA 2IS7A 3BXWA 1YIXA 3FS2A 4PUDA 1XUUA 3W22A 4GINA 1UOZA 1JXJA 1R30A 2NWRA 1ZGDA 3CUJA 3H7UA 4W8AA 1BPLB 3W75A 3VNIA 3IIPA 2V30A 1W3JA 3WLLA 3N4FA 5B80A 4EPBC 3B8TA 1PHQA 1W9XA 1WOBA 3G5EA 4MJ4A 3WMBA 2OPJA 2YBUA 3P14A 4CCZA 4LW7A 2AOSA 3CQ0A 4FR1A 2VFGA 1UKQA 3I7RA 4WD0A 4EF9A 4O13A 2Y62A 1S46A 1MZRA 3U2EA 5LXEA 4PMZA 2CLKA 4W8LA 3WQ5A 3ZVIA 5ABEA 5A6LA 5IDIA 3P2VA 2XZ9A 5I77A 1R5YA 2JBMA 4UMBA 4NZ5A 4UMAA 5G1MA 2YXOA 3HPZA 2OLSA 4S3KA 1DOSA 3LMYA 2NQLA 4HNUA 3QGVA 2QW5A 4L64A 1K3UA 3GVQA 2ZX6A 3H53A 4RDWA 2G0WA 1U30A 3DECA 2DSZA 2HVOA 2GJPA 1WNOA 3TAOA 3UYCA 1XLEA 2E0PA 3AROA 3LRMA 1ZSXA 4MLRA 2H9AA 5JXQA 3MC5A 4PTWA 5FF3A 3KLKA 4FO4A 4DF0A 1XC6A 4CN6A 1I2PA 5CBBA 1ICQA 3WFZA 3W86A 3W2MA 1C9WA 3CS2A 5JH1A 3UNTA 3IJDA 1XC4A 1WXZA 3GH7A 4UNIA 2QS8A 2PC4A 3D0CA 1TV4A 2UV8G 1UMLA 3DFTA 3R5EA 3KM8A 1WX0A 2RGMA 4AFYA 1I4NA 5D33A 1C8QA 4J3XA 3G0XA 4GKLA 1EC9A 3CV7A 3RHGA 2FB3A 2OSWA 1BVNP 3ZYZA 3G8EA 3WDIA 4C6DA 4GYPA 4NZ3A 2DW7A 3PNZA 5IFPA 2Z0IA 1EOKA 2YX0A 3N19B 1SUXA 2GVEA 1AG1O 1PE1A 4XD3A 3SQLA 2ZICA 5CKSA 1A5LC 2AL2A 4S3GA 3N34A 1KLYA 4QJ5B 1JYVA 5DMYA 1Z42A 3ORWA 3KRBA 3FKKA 3UWYA 5AC8A 4CNSA 1C92A 3BSMA 3N9KA 4HZ7A 2F38A 3ITCA 2X0YA 5SWUA 4GYKA 1YHTA 4EACA 4N02A 4O1CA 3G6MA 5A69A 4P7RA 3IJ6A 4A2RA 4UFKA 3B9EA 2HNHA 2DH2A 4UQEA 2OKTA 1G67A 2VZTA 3AO0A 1EXBA 4B90A 1TYGA 3I3EA 4L65A 4NT0A 4AYGA 4CGTA 3N2XA 2O9RA 4DJED 1E9IA 4JHMA 3LX9A 2V5CA 5D4YA 2Q6ZA 4WGHA 3W2KA 3HJZA 3ITOA 3MMUA 3QOKA 1OK6A 1RVGA 3RITA 1P0NA 4LU0A 2GOKA 4PMYA 3W1XA 1VAHA 1VIZA 4DBEA 4AIEA 5A6JA 1NDWA 1RUSA 1W5PA 1AH3A 1JDCA 2Z26A 1UD5A 2XFWA 1G4SA 4IPPA 1M41A 4WDWA 1RV8A 2PU1A 3EDEA 5BWFA 2RHGA 3AS1A 4HA1A 3WD3A 5I24A 2DY3A 4W86A 2HBVA 5D9MA 4IIHA 4XKMA 1O60A 3VABA 1AW1A 3NG3A 3NL2A 3Q67A 2VC6A 1I45A 1QOQA 1VLIA 1XFCA 4JY8A 4FALA 4HTBA 4L61A 4PL1A 1G4PA 3EKGA 1NFGA 5ECUA 1RR2A 2Y85A 4LJ3A 3CO8A 4LT9A 4CQDA 4NJJA 3W7CA 1DORA 5AOUA 1Q6CA 5G4WA 4HU0A 1ZJHA 1MXDA 4XTDA 3ARSA 1OD0A 1R85A 2XIOA 3ZVHA 3B06A 1MFVA 4AWTA 3UVAA 5H91A 3THUA 2CKSA 2ZWZA 4IFOA 3UW6A 3E0LA 5HDRA 2Z2UA 4D1JA 1XW8A 4EWJA 2JEQA 3AU6A 2J8GA 3UR7A 1OBAA 2CC0A 4B5TA 2YA0A 1O12A 1KFLA 3GFXA 4FMVA 3ANVA 4FOKA 1EC8A 2Y7DA 3EKZA 1IT0A 2C1GA 3MQTA 5AC7A 2ISFA 3QV9A 1LWJA 4Q4PA 2GJXA 1PZ2A 3CPUA 5AHIA 3O6DA 4HSHA 3R12A 4ICNA 1A5MC 5CAKA 3NQ2A 1Z7AA 3LNPA 4TV6A 4IP5A 3ATZA 3ARTA 4FB7A 4J2PA 4W93A 3GDTA 1I9CB 3L65A 2BOGX 1KXHA 4UMCA 2PDGA 3NYZA 3N17A 2E40A 2WWCA 4HD5A 4PMUA 2VENA 4UZUA 2WMIB 3W82A 1V8EA 3WL1A 4AEEA 3CHEA 4I9MA 2BBFA 5AVHA 1JF6A 1TV2A 1TUFA 1ONWA 1YE6A 1ISYA 3W85A 3OU8A 3TA6A 4NYUA 4C6BA 4DM1A 3VC5A 3F5KA 3UG4A 1CEOA 4HK7A 5KZEA 3NZGA 1AK5A 1K02A 2BB0A 4LEQA 3DOPA 5J5RA 1NIUA 3QV8A 1WQ5A 3H70A 3II1A 4X0VA 3TJIA 3A22A 3FAWA 3E5BA 1XCFA 2GVYA 2DGAA 4JTTA 1OGSA 3WQGA 2VX5A 4UTMA 1R8LA 4JIEA 4R27A 4AHQA 3E2SA 4K3ZA 2NQ5A 3F2CA 1A5KC 3VD3A 1XIMA 3TFCA 1YMYA 5LNUA 2VDIA 3KLLA 3FVMA 2O9OA 4PCTA 1O6IA 2YW3A 2J7DA 2DVTA 1TELA 3OVGA 1EH9A 1VCFA 2QCNA 1IIGA 3N4EA 3RJYA 3SCQA 1HKKA 1WKYA 2WSRA 3N2OA 4GC4A 3NSMA 2OO6A 2OYKA 1HKMA 2A3HA 2WNWA 4NI3A 3V16A 3VE7A 2ACRA 3AZSA 4DI8A 1ENUA 3FKRA 1NSJA 1TJPA 1MQQA 3MS8A 1XIBA 5HR6A 3GUWA 2DVXA 4LQ1A 3HB9A 4O8RA 2WNNA 2BVYA 3NGJA 1M01A 3MKKA 4P8VA 4ADSA 1YPXA 3QHNA 2Q8LA 4MF4A 1K7XA 1KBBA 4Z1BA 1RK6A 1EX1A 3AU2A 1LL4A 4XD4A 1W1ZA 1BQCA 4GFIA 3GXPA 3BAXA 4Z1CA 1MXGA 4G7FA 1UP2A 3VNMA 4A8RA 1R46A 3GW3A 2DUZA 4NAFB 3SBFA 4LYKA 1ADSA 2CYGA 3QGAC 1EA0A 2RAGA 3VYLA 2HJPA 1G4TA 3N9RA 3UWZA 2YDRA 4NP7A 5CZ0A 4NVTA 5H2ZA 2R91A 4RZ4A 2RFGA 3K13A 5C5YA 1ZAIA 4ZZ9A 1U1HA 2CKRA 4QDWA 3WUBA 1H63A 3AXIA 3TH6A 3SRDA 4GE8A 3S2MA 1BRLB 2O9PA 1XIFA 5CC7A 1VBUA 1QRQA 1TZ9A 1X1ZA 5AYYA 3PBGA 1GOQA 4D72A 3TWAA 1D2KA 4AXKA 4WX2A 1BGAA 3C3NA 3M0VA 1JUKA 6A3HA 3EMCA 3DFSA 3LU2A 1K1DA 3IGXA 1PIGA 3SQMA 1NDZA 4H4IA 4D8LA 3GHSA 3LHVA 1W9BM 4J5NA 3SY5A 1E1CB 2Y7EA 3KBVA 5IXEA 1L6WA 1H11A 2PGWA 4XZWA 2XJ7A 3EX2A 5C71A 1VENA 4ZODA 4FNTA 4PMRA 4E4UA 1VR6A 3WUEA 3CHFA 1F6PA 2PP0A 3ZJ8A 4XSLA 3WQDA 1Q6OA 1OY0A 4O8AA 1W3KA 4K68A 3CUZA 2VTFA 4GWEA 2Q8XA 4KFOA 5TNVA 2W61A 4B5WA 3BANA 2VX4A 1OCNA 2OEMA 3L2MA 2PBGA 1FP8A 4BI6A 3BAYA 5IDZA 1EFZA 2DFAA 4GBUA 4B5UA 1JUEA 1JG9A 2J7HA 4WSHA 3R25A 3LPOA 4ZEPA 2D1ZA 4YWSA 2JIWA 1EQPA 1UWUA 4ATLA 6TIMA 3VD7A 4E3TA 4EKJA 1XICA 3SEPA 3V75A 2PUZA 3W70A 5HWNA 2ZADA 3KVKA 5DY2A 1CGXA 4B5SA 4AXNA 3F4DA 3PZOA 3L0KA 1F76A 2YIHA 4ZCWA 2REQB 2WK2A 3RCNA 4QIUA 3STFA 4ACYA 3S3GA 4HK5A 4KEVA 3HURA 1V02E 4ENLA 4LUTA 4KCUA 2B81A 3HG3A 1UCWA 3MUCA 1PO9A 2DZWA 2HK1A 1B54A 1UR4A 1JNEA 4RCXA 3A3XA 3TCEA 4NRSA 2NQHA 4GYFA 4O1BA 3MP4A 2CEQA 3IGSA 4GKTA 2J66A 2IQTA 1WKDA 2VEPA 1R6WA 3VOFA 1B3YA 4S3DA 3STEA 3VINA 3DG3A 2YL8A 4QCEA 3C2YA 3QSTA 3N4AA 3NJ3A 3WLNA 3RU8X 1JFHA 2PSNA 1P6BA 3FJLA 4ZXOA 1EC7A 1JPDX 4R53A 1TTJA 1E0WA 2EPMX 5EU9A 2HBXA 3PFRA 1HGWA 2WCSA 2P8BA 3GXIA 2PZNA 3ALFA 4A3RA 1L8PA 1H2JA 2TRSA 1A49A 1R86A 4L80A 1PZ1A 2P0OA 4CCCA 2DV0A 3WNLA 2J77A 1DL3A 2DEPA 3L2IA 4LANA 1LBLA 1UHVA 2GVLA 2J7CA 3AIVA 2ONEA 2YBTA 4P7LA 4U33A 3TTYA 2ZUVA 3IK2A 3VCRA 1C29A 3BLIA 5KZ6A 1AL8A 1V3IA 2J27A 4QG8A 3DHPA 3TZNA 4A3QA 3DBPA 3VMOA 3C2EA 4GBDA 2FIQA 5L9FA 3DZ1A 3EWWA 4CCEA 1H1NA 5K9CA 1EX5A 1M7XA 3MUXA 3QLDA 3BJTA 1CXHA 4GNJA 1HZYA 4PTNA 5M3WA 1KFWA 2QJHA 3PG9A 4MWAD 1IWBA 1H50A 2WVVB 5JVLA 4Q6JA 1DJHA 1US3A 3GNRA 1W1B1 3W23A 3G1YA 4YVVA 1WP6A 1ISZA 3LI0A 5A5WA 3KOFA 1KO0A 3S47A 5I78A 3SADA 1ZAJA 2GLKA 1YNYA 1OFEA 2G8ZA 3NSXA 4K38A 3TTQA 3LCLA 3WQWA 4KFPA 2NQZA 2A3EA 5C2CA 5DRIA 3BJFA 3HV8A 1AJ2A 4GG9A 2VFDA 4D6GA 4E2VA 4DLFA 1PBGA 2ZX5A 4JIHA 3R94A 4L5ZA 3IIOA 2X1UA 4Q32A 2DU2A 4JHOA 3DERA 2QUUA 2DH3A 5HUOA 1JDEA 8RUCA 4ZO6A 2QAPA 3HPAA 3LD5A 2AKMA 4BHYA 1W54A 3M6DA 4C91A 3BG5A 4A3HA 3FW6A 2BODX 2CCRA 3THCA 3DGBA 4MZ8A 5L6UA 1R3WA 3WK1A 1IR2A 3BLEA 3Q65A 1CCWB 3IVSA 3G0UA 2R1LA 1BD0A 1QT1A 1NDYA 1XV8A 3GTFA 4EPDC 4Z42C 2Y7FA 4MZ1A 4GZIA 3SQSA 2OG9A 3OEXA 3BK0A 3ABQA 3SCTA 3CAVA 1XDLA 3CTLA 4HA0A 1TMHA 1EUAA 3OPSA 4DI9A 2J79A 3R1ZA 5KITA 3HU7A 3B9AA 3P81A 1OC7A 1G7VA 3UWWA 5DXXA 1JZ7A 2O7QA 1TR1A 4ZB0A 2ZUTA 1W3HA 1N82A 2G3IA 3K2GA 1E1EA 1SO3A 3HM7A 1VZWA 4QG9A 7REQB 2X7VA 4IMGA 1OGBA 4X60A 4IFKA 3TNBA 2XVPA 3NCOA 1NWTA 4OKDA 4IQJA 1G9HA 2ZRVA 2NWSA 2PZ0A 4ZA0A 2VELA 4E2DA 4UTLA 3S83A 1Q2SA 2QDDA 5C9ZA 3W6LA 2AQWA 2YKKA 3IAQA 4D1IA 1OCBA 2R1NA 4C5ZA 1GVEA 1VKFA 1RQEA 1S1PA 4Z2HA 1XLLA 1A5SA 3SN1A 4WVXA 4L1XA 3O3RA 1V08A 1QPNA 2PDXA 2RJGA 3P82A 4Q3MA 4RK8A 3AQUA 4QLLA 1R3TA 6ENLA 4Q6XA 1QNSA 3I4KA 1KRCC 3ZO9A 1FXQA 4CVWA 3T6CA 1K77A 4CEXC 1ISVA 3HJEA 1W91A 4DXXA 1OFDA 4JY9A 2FFIA 3N6QA 4MOZA 4GH1A 4QSHA 1A4LA 1OFBA 1TTQA 2VMFA 3BOXA 4OT7A 4OGZA 3UNDA 1SQ7A 4JTLA 2QIIA 3FGCB 3UYIA 1US0A 1IGWA 2C19A 1TWIA 3F4NA 3WK0A 1F07A 1RA0A 4IIDA 4O4VA 3F4WA 1CW2A 3D47A 3FV9A 4LAMA 2Z1KA 1GPWA 4I6VA 2HVMA 1EL3A 3ABXA 4UR7A 3HG2A 4JIQA 1H51A 2A3AA 3UZJA 1KBJA 5LA2A 3W1MA 3W1PA 5A2BA 2WW5A 2V63A 3T4CA 4ONVA 3I7QA 1KM3A 2Z1SA 5C8BB 2FHCA 3AIQA 5KINA 3M0ZA 4YU1A 4M24A 4HGXA 1HKWA 5DMNA 4I6KA 1K7EA 4MNLA 4ZSUA 3GNOA 2OKOA 2VGIA 4IT1A 3P74A 2A85A 3I68A 1A50A 1WUEA 2CLOA 3EWZA 3OZOA 1I0DA 2CHNA 2FVMA 4DWSC 3STPA 3GDRA 5I3GA 3KHJA 3ONCA 2IKHA 1WO2A 2C3ZA 4M51A 4YS1A 3RMEA 4AW7A 2P8CA 4AUBA 5DCEA 1CXIA 3LEPA 1M7OA 2PDQA 4I5RA 3AIBA 4NX5A 3V3WA 2HK0A 2NXIA 3SUVA 4MB1A 3KOZA 1QO5A 3FJ4A 1KFKA 5FOOA 2UY4A 4OBSA 1XH2A 3B9OA 2XIBA 2JK2A 4DAIA 2WMIA 4O28A 2E1WA 4K6AA 4P7OA 4IP4A 2J6XA 3W83A 2B7NA 4GZJA 2ZZ1A 5CQ1A 4BCEA 1TV3A 4LY4A 3ZFHA 4QROA 1J0IA 2Y24A 4HCHA 1B2YA 3DH7A 4GD0A 1KFBA 1QPKA 4C6FA 3QYQA 2XFRA 1G1YA 2HROA 4U31A 4KIRA 3FVDA 2GSEA 1E0TA 3GNPA 4HPNA 5D2XA 2X2GA 2J9XA 2QVNA 4R3UA 4R7WA 3LBMA 3EPOA 4E4FA 5HPCA 3QTGA 4FNQA 3U2OA 5EB8A 4LRSA 2Z2AA 1MYRA 4KPLA 1OX4B 4ZQPA 1JYXA 3B97A 2W0UA 3CO4A 3GVRA 3KRSA 4AD1A 1KKRA 1ITCA 1ZRQA 1JZ2A 4S3EA 1BEUA 1C93A 5I3DA 3DC8A 2YJQA 1FXPA 5E70A 3NA8A 3CQKA 2PWGA 3W27A 4EX4A 2OB3A 3JZUA 3H7VA 4LS2A 3TYCA 4BI7A 2ACUA 2V5KA 2CBVA 4FS9A 3GTIA 4Q4RA 1FA2A 3MY9A 2GYIA 3E2VA 5CGMA 2PWDA 3BGAA 4DN1A 4PRWA 4LX4A 2A6NA 1ONXA 1IXOA 4HA4A 4OHQA 1IEVA 6CGTA 4JTKA 1SZNA 4M7TA 4O50A 3PBVA 3T08A 4FXSA 2ZRZA 1JUBA 3GRIA 4QHRA 1MW3A 1VBHA 2VCCA 2GGHA 2NT0A 4NXSA 2QF7A 4RW3A 4TMCA 1UH4A 4QNEA 8CGTA 3NYDA 1AQ0A 5LNRA 1R9ZA 3IRDA 3FJ6A 4RDZA 2IKGA 1NFPA 2PCEA 3W7IA 1ITXA 4QJ4B 4IH3A 1PTDA 1HJQA 3F4CA 1TWSA 1GZ1A 1Q7MA 2FZBA 4XWUA 2G3NA 4GH3A 2ZFAA 4H3DA 4CU8A 1TMQA 3LHZA 4PN2A 4XZBA 4NAEA 1OG6A 4EXQA 2DZAA 2QGHA 3BUVA 2OX1A 3B0UX 3UCCA 1OX6A 3MV11 3CAKA 1BRLA 1DJZA 2E5CA 5HNUA 1OABA 3WNMA 3TJXA 2A7NA 4LSBA 2BZNA 2GQ8A 2QULA 3PR2A 4ECLA 4CU7A 3P93A 3QQ1A 4NZFA 5G5IA 1X7IA 4R34A 3FLUA 3D5HA 2XH4A 3OO2A 1FH7A 1J18A 5CPSA 2VUNA 2VR2A 3MZ2A 3UQNA 2ZZ4A 5M17A 3SY1A 3GYCA 3SIMA 3ARRA 4GO9A 3QZAA 3W88A 1ADDA 4GZ7A 3H21A 3RCMA 4O17A 3TN3A 3YPIA 4AQLA 1IEIA 4HU3A 1P1MA 4UBPC 3PZVA 5HBFA 3TXZA 3V7PA 1RQHA 3ZJKA 4MKSA 4LALA 3RM4A 3IK4A 1UR1A 5FIPA 4TVDA 3SB0A 3RX4A 3DFPA 5BOFA 1S38A 4Z2GA 3VGEA 4N9DA 3RN6A 1KGXA 1WZMA 3ICJA 2BS9A 5I07A 1D3GA 1KD0A 2FVLA 3WQEA 1LBFA 2E67A 1UWAA 1K7FA 1W3LA 2HCVA 4J4KA 3CQHA 3W26A 1KCZA 1LYXA 3ME3A 3TWBA 4HK6A 4MYXA 3Q37A 4QS6A 4WKHA 4QQUA 1NWRA 1P0BA 3N15A 4ROPA 4PB4A 2ZBTA 2V3GA 5DFAA 1GKQA 1JCXA 1QNRA 3BAJA 1UG6A 4W7WA 1XKYA 2I16A 5D9NA 3W29A 2WJEA 3CUIA 1PVNA 3UWVA 4FF5A 1B30A 4DUXA 1X96A 3M07A 4TX6A 4MGGA 2PTZA 3S2NA 4AY7A 2PTDA 4XTIA 4H6QA 3BWWA 3W2JA 3V18A 1Y5XA 2ANUA 2I57A 3XIMA 3URAA 1EYEA 1KV8A 3WYZA 3GDKA 2PRMA 1TPFA 4WJXA 3UZWA 4ZFCA 4D8ZA 5KSWA 4GO8A 3GKFA 4HNTA 1RJRA 2FHBA 4ZMGA 2XZ7A 3CZGA 1KCKA 1F9CA 3FOKA 5TAOA 5BXTA 3RDKA 2YCKX 3KP1A 4PUUA 4DJFC 1BVZA 1QWKA 3WLHA 2X1SA 2ISVA 1E0VA 3REQB 3E9AA 5JH2A 3P60A 5C7VA 1VFTA 1OYBA 3MBDA 4ES4A 1RVKA 4DJEC 3HFTA 3TIMA 5BXRA 3KBNA 3UPWA 2VX6A 3TVAA 2Y8VA 3WCZA 3PZIA 2BDQA 4LF1A 1YDYA 1FP9A 1PXGA 3KOYA 3N13A 1RD5A 3CQIA 4V2XA 3SJ3A 3BLOA 3DENA 2ACSA 5EFFA 1GVIA 1QUMA 1UR8A 4YNGA 4H9MA 3BOLA 1BQGA 4HCDA 3CZEA 3MKCA 3N29A 1EHNA 2PBOA 2QCEA 3BZJA 1FX6A 3DI1A 2X42A 4UTTA 5CC3A 3SCWA 3C4UA 1HUVA 3TTEA 3VGBA 4JTIA 2QQ6A 3BAWA 3KCJA 3VZZA 3S5YA 4JIIX 4H9VA 1J01A 4UTKA 2ATMA 2VUYA 3O6AA 2RDTA 2XN1A 2PLKA 3BOFA 3WLPA 2FZDA 4LCRA 4IUGA 5FL0A 1VEPA 4M81A 3W9ZA 1YYAA 2GQAA 4N6FA 3WDHA 3NZRA 3MI2A 2YDQA 1EHAA 4US6A 3NZQA 4MB3A 1U5HA 4LPCA 4DBWA 3S2LA 1UA7A 4F0RA 3QY8A 4GPNA 3ABRA 3EA3A 2PDKA 4DNHA 4WDUA 3T0BA 2CLEA 3AICA 2PTWA 5A8OA 4JOMA 3IJIA 1LRTA 1ELSA 2C91A 1UROA 4GABA 1TJRA 3VMNA 1XP3A 3C8NA 2XVNA 4QLKA 3V1HA 1EOMA 5AYIA 3QM3A 1XFBA 3ZLFA 2X40A 3NIYA 2TMDA 5AHEA 4EAMA 2PDMA 2Y5SA 3TKFA 5F7UA 4AEOA 2VEGA 3PS7A 3W81A 1E3ZA 5AHFA 1QPOA 1VJZA 3VKKA 2XDFA 1RPXA 4C6EA 1GUVA 1DXFA 2EKGA 2QV4A 3IRSA 5JU6A 3RJXA 4AAJA 3ZR6A 2YDAA 4K2SA 4QE4A 2VKZG 3HGSA 5DBTA 1R9YA 1S3TC 3QW4B 4MM1A 4PZVA 2BY0A 1GHRA 1TIWA 3UWEA 1IEQA 3PG8A 4E0CA 4HNVA 3KHDA 5EMLA 1REQB 4ZQOA 5E9XA 3GXDA 1HL2A 4LFYA 1TJ0A 4HP5A 4PUWA 1V0NA 4U5KA 4ZO8A 4B2DA 3KCLA 1W56A 1AA1B 4AWEA 4B3ZA 3H23A 4RZ5A 2CXGA 1D8CA 4FLRA 3TROA 4NQ1A 1VBRA 5CC6A 1XYLA 2WKLA 1M6JA 3OVPA 4H9UA 1C8XA 1EYWA 1D3CA 4PODA 2Q71A 4LC6A 3TN4A 5GJMA 4FNSA 1JJKA 1E73M 2ZXBA 2A3CA