4UTUA

Structural and biochemical characterization of the n- acetylmannosamine-6-phosphate 2-epimerase from clostridium perfringens
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
229
structure length
229
Chain Sequence
GSSHHHHHHMLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRAQGVNDINEIKEVTKLPIIGIIARNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRKRPNGENVKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSVDFELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of the Clostridium Perfringens N-Acetylmannosamine-6-Phosphate 2-Epimerase Essential for the Sialic Acid Salvage Pathway
pubmed doi rcsb
source organism Clostridium perfringens str. 13
molecule tags Isomerase
molecule keywords N-ACETYLMANNOSAMINE-6-PHOSPHATE 2-EPIMERASE
total genus 87
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2014-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4utuA00
3MMTA 1ADOA 5U4NA 5EYWA 3UWVA 1DHPA 3UPWA 4PH6A 1HTIA 2H3DA 1SZEA 4BFAA 4O0KA 5K7JA 1THFD 1IXNA 4JTIA 4FB7A 3KVKA 4JTFA 2Z6JA 2ABAA 4NJHA 5AC8A 3SZ8A 2Y62A 1BWLA 1VCVA 1A50A 3TK7A 2ZRXA 1F74A 3TQKA 3WK2A 2QCNA 3UPBA 3MI6A 4E2BA 3M5YA 2B7OA 1W56A 1FWRA 1PCKA 6ALDA 3PUOA 1OFEA 2GUUA 3BLIA 2Z6IA 1GYNA 2ZZ3A 1OK4A 2NXGA 5C54A 1XXXA 3LRKA 1KFJA 1GQNA 1H50A 2XFWA 3T44A 1WX0A 2ZA2A 3QW4B 1T8XA 3PC0A 1TJPA 1W31A 4A2SA 1ZCOA 3T55A 3W1NA 3CIWA 5C55A 4M6QA 3TW7A 3FYPA 4EWND 2F84A 2VEIA 3B4UA 4O1CA 3TV8A 2DP3A 3TA6A 4K36A 2Y88A 3ANYA 3PBUA 5CPMA 3B04A 4O8RA 3PAJA 1TCDA 3NYZA 1GOXA 4M19A 1AL7A 3M7WA 2VC6A 3TUUA 3NQGA 3SGZA 1F2JA 1SO5A 4RX0A 1X8FA 5EKYA 2CZ5A 2OX1A 1WBHA 4TR9A 2ZRZA 3GKFA 1MSSA 1Q6LA 3NQEA 1VZWA 1OF6A 3MYPA 4DO4A 4ZQPA 4HHPA 3VKJA 3PSWA 4MFEA 4JN6A 1TRDA 5D2WA 3SGUA 5I3HA 1PIIA 3O6YX 3NO5A 2D73A 4Y96A 3EXRA 5GVJA 1L6WA 3LBCA 3W85A 4B5NA 3FJLA 1XBYA 3AO0A 3NG3A 5TBOA 4UTTC 2B7PA 2V82A 3W7PA 3NOEA 1JQXA 4IMFA 2GVJA 2R8WA 4DPQA 4NU7A 3T7VA 2A1YA 4DPPA 5AB3A 3DZ1A 4X22A 4WJEA 4O15A 3QRHA 4AXKA 4O1DA 1F73A 4M6PA 3C2OA 3LI0A 1YPFA 4AH7A 2DU2A 3EKLA 3PSVA 5C2XA 3YPIA 2CLKA 1K8ZA 1ZAIA 3MP3A 1S5TA 1O4UA 4S2BA 3MI2A 3G0SA 4LVDA 3QM3A 4NUWA 3HJZA 1I2NA 5F1VA 1SQ7A 2QUTA 3M1ZA 1FWSA 3M44A 3NXFA 4S2CA 2W6RA 5F4WA 5K9XA 3M43A 2FB3A 4MUZA 3LLDA 4UMAA 5E1QA 3GK0A 3LV6A 3NDOA 1IXOA 4ZL1A 4MJMA 3TJLA 4NZFA 3G0UA 2Y61A 3W72A 1TSIA 5ABTA 3QYQA 5DY2A 2ZFAA 3IIXA 5AOUA 3HPXA 2VFDA 1FDYA 1PHWA 2A7PA 3GXNA 5DCDA 3KX6A 3TDFA 1JUBA 5EA9A 3TE9A 1QO2A 2AAMA 4JNMA 3B0VC 2FFCA 1ME8A 4LY8A 4NNCA 3C8FA 4A29A 4QJ1A 2V8ZA 1FQ0A 3EWYA 3G1FA 4WXZA 2JKAA 1LOLA 5DY3A 3A5VA 4RJEA 3KAOA 1JCXA 3C0JA 3NPWA 2QUVA 3NL5A 4AF0A 2CLOA 4O16A 3NQAA 3W7EA 4LRSA 5D30A 4L4LA 4K6AA 4Y8FA 4MPQA 2PRMA 3GYEA 5I3IA 3W1QA 1Q6RA 3GDLA 1H7RA 2PCQA 3TJXA 3BG5A 3G3MA 1U83A 1W54A 1D3GA 1SU5A 2VENA 1QR7A 3HOJA 4JYDA 2DJXA 3MP4A 1X6UA 3W2MA 4TX9A 3W71A 3GKAA 4NJIA 2PURA 4ZMGA 5E0KA 3S1VA 1LORA 4H3DA 2RDWA 4DQWA 3LERA 4BR1A 1VGAA 5D2VA 3QQ0A 4GUHA 3HG2A 5D33A 2ZRWA 5BNKA 4Q4KA 1UB3A 4PODA 1RPXA 1OYCA 2J6XA 3TH6A 5DN1A 2I1OA 3HO8A 2WNZA 4E38A 1JCLA 4OWGA 1R30A 3IIPA 1QPOA 3G18A 1KBIA 1R2TA 4UNKA 5K3VA 1W8SA 2C16A 4RCXA 3GX9A 4WUIA 2DZUA 4UC5A 4FEZA 3WJSA 2YX0A 4E0CA 4K37A 3PB2A 4O52A 3E9AA 2EKCA 2V5BA 1OFQA 3E02A 4O4WA 3E12A 3BLFA 3R5EA 3KXQA 2Y63A 3MW7A 1O95A 2JGYA 3A5FA 3N73A 1ZJIA 1VQTA 3IVUA 3P67A 1XBZA 1Z44A 2YW3A 4Q33A 3O6CA 1KFKA 1TMHA 4NQ1A 2Z1BA 5EY5A 3NZ1A 2TYSA 2A2IA 3BGGA 3DENA 3TNOA 4DBEA 2X1TA 2QCLA 1LRNA 1WYIA 2F7FA 3FKRA 1SSDA 3LI1A 4PC8A 5CZSA 3W1UA 2J27A 2P0OA 2QUUA 3HMJG 4N4PA 4RK8A 3LHZA 2Y7DA 3UNDA 3UXDA 5LGXA 4M5PA 3NA8A 5EBUA 1T96A 3DU0A 1XDLA 4I7WA 4I7VA 3SW6A 4FXSA 4XKYB 2ZZ2A 4A2RA 1TPUA 2CZFA 3Q94A 3G1YA 2BXVA 5EMUA 3DGRA 4O57A 1QNVA 4WXYA 5KINA 4M7TA 1P0NA 1YXCA 1EIXA 3MWAA 1OFRA 1J2WA 4LS2A 1FWTA 2GQAA 2VFEA 4WY0F 4K8EA 4CCCA 4JYEA 3P74A 4MFDA 3L0KA 4YL2A 3TSDA 4LUJA 3W7OA 3ZS4A 1K8XA 1LOSA 2ZA1A 3HGRA 4RXFA 2WV8A 4JIQA 2VFIA 2ZRYA 1LTDA 1PHQA 1FCUA 4CCEA 1XDMA 3MBDA 1I2PA 1QPRA 1OHLA 1BKSA 2VELA 5HR6A 1SO6A 2CLHA 5DCBA 3HGSA 4TMCA 2BZNA 2FJKA 5K2ZA 3VFLA 1MEIA 1H62A 1VHNA 3GIYA 1HFBA 4KWWA 3O16A 1K7EA 1TPFA 1H51A 5CKSA 2GJNA 1ZNNA 3RLVA 2AGKA 3CPRA 4JYFA 4O4VA 1YDOA 1PL9A 1ZENA 5FF0A 3LHTA 1L6SA 1SW0A 2DZPA 3PS7A 4AHPA 1JCMP 4EOUA 1VPXA 4JS3A 4DEFA 3LBMA 3VI2A 3PB0A 5J5RA 2A5HA 4YCOA 3N3MA 1EPXA 2FIQA 4UUIA 5LKYA 3C2RA 4L4MA 1F5ZA 4O13A 1O5KA 4NNAA 4CQ9A 2YFNA 1ME7A 4NX0A 5BMXA 4WOQA 5DXYA 1VJIA 3LTSA 3DBPA 4QITA 4UFMA 1VH7A 4O54A 4UR8A 3BW4A 3W1LA 2Q8LA 2HTMA 5IBXC 2Z2UA 2I9EA 4ADTA 4PL2A 3UWWA 5G4WA 3UWZA 2J9XA 3EEGA 3NVTA 3CT7A 2NUYA 3W1TA 1GG0A 3VCRA 1LCOA 3LCIA 1AK5A 2XN1A 3P8IA 4GWEA 4IX2A 3DFOA 2DZTA 3LCGA 3HB9A 3VE7A 1C8VA 1HO4A 5G2WA 1EEPA 1CW2A 1QDSA 3TC6A 5K4XA 5SWUA 3QSRA 3W2LA 4NJKA 2QF7A 1KW1A 3L65A 3G1AA 5G4EA 2JGQA 3BPWA 1W5NA 2OT1A 3HPSA 1XC4A 2PE4A 3BARA 2Z0IA 3UZ5A 1XBXA 4C1KA 1W5QA 3FA5A 1SSGA 4IMGA 1V7YA 2NLIA 1A5AA 3EXSA 3ABQA 2Q8ZA 3WJXA 3DXIA 3W3OA 3W9ZA 4OT7A 3NGJA 3QMSA 4UTUA 6TIMA 2OCZA 4AHOA 1MO0A 4YMZA 4LV9A 5H91A 4IMDA 4HN4A 4IMEA 2FPTA 3BVJA 3LM7A 4R7JA 3LLFA 1KM1A 1OYAA 5DCEA 1OYBA 2A7RA 2C13A 4X3ZA 4EF9A 1PE1A 1RVGA 2G95A 2E5BA 5AC6A 4O11A 5A8GA 1W3TA 1X1OA 2YDAA 4KFNA 4E2DA 2X1SA 2YFOA 4MY9A 1GWJA 3S5ZA 4U28A 4QNEA 4NX5A 4RZ6A 3KVMA 2QAPA 3W87A 4GNJA 5HINA 1GG1A 3TXVA 4IMCA 2RHGA 5G5IA 2DJLA 3CC1A 4N9DA 5DELA 1ZAHA 3PM6A 4ZZ9A 1F6PA 2ZZ4A 3PUEA 4H4IA 3TROA 3M9YA 2C1HA 3IGSA 1K03A 2A0NA 3UWYA 1VR6A 2E6AA 3V75A 1T99A 3JS3A 5U7SA 3TAOA 3WK3A 1A5SA 3R2GA 4NJJA 3PWAA 3SSJA 3CQ0A 2P1FA 3I68A 3N2MA 3OG3A 3G1SA 3STFA 1GJPA 4WX2A 3ZWSA 4LV4A 2ALDA 2ZTKA 4MKNA 2HSAA 4UR7A 8TIMA 2WQPA 4FHAA 3S9YA 4N02A 4XTDA 1WQ5A 3CEUA 4RXGA 3TQ0A 5LGZA 2RDTA 4HSNA 1SZNA 3QW3A 5MHBA 1Q6QA 4LUIA 1ML1A 4CNPA 2E68A 1VHCA 4O10A 2WPBA 4FNTA 2YYTA 1FCBA 4LW7A 3THQA 3AJXA 4HKPA 3QZEA 1F7BA 3CTLA 1IXQA 4RV8A 1IIHA 4JY8A 3TMLA 1I4NA 3M47A 4I9AA 1QOPA 3GDMA 3EWZA 4P61A 1IXPA 1I8JA 1H7XA 3LXBA 1PCWA 3QEZA 4N2YA 4N9BA 2J9ZA 3GAKA 3UQNA 3HQ1A 4LWWA 4LTSA 1QAPA 4UTIA 2HS6A 4ZQRA 5HMSA 3LCLA 1KM2A 3Q37A 2WSQA 3EWUA 4UFKA 1SR9A 3P61A 2Y6ZA 4K7VA 2BTMA 5A5WA 4O14A 3O06A 4ML9A 1XM3A 1L9WA 1WAUA 4JTHA 4MY1A 1TPVA 1H7PA 1GVFA 3DFPA 4LOCA 5D02A 3LRMA 4BK9A 2H6RA 1AMKA 3BGJA 3OIXA 1GPWA 4CCDA 1ICSA 3GXTA 2GJLA 2A7NA 1B3OA 2G97A 3CEPA 3DKJA 5BMWA 3RFAA 4Y90A 3F03K 1NF7A 3JRKA 4YCPA 4OV9A 1R2RA 4EF8A 4FX8A 4IQLA 3FEMA 5H2ZA 2VOMA 1VRDA 5KSWA 1DORA 2J9YA 3W7IA 3MP5A 1JCYA 3PG8A 2RFGA 3W7KA 3I6RA 1R47A 1WXJA 1VS1A 3STCA 1BTMA 1UASA 3F4WA 1SW3A 3DFTA 1M5WA 3UY7A 5F2GA 1MEHA 5G1YA 5AYXA 2V2DA 2X30A 2CLIA 4UTMA 4N6EA 5D37A 3W7HA 4AEOA 3W75A 3U8GA 3FLUA 2ZTJA 1FWNA 1K3UA 3MJYA 4O1BA 5KZMA 1VLIA 3NQDA 2H3BA 5FI8A 2CWNA 4JD4A 2FB2A 3V1PA 3EXTA 5K9DA 1FCQA 1XUZA 1JJKA 3RMJA 4FNPA 4Q32A 2NXHA 1KTNA 1TTPA 3IIVA 1EUNA 1UJPA 1A5BA 4LVAA 3C52A 4M6VA 4YWIA 2JKPA 4U4MA 1V5XA 1G69A 4O12A 2A21A 4N9EA 3EX6A 3W7GA 3NQ6A 5AFDA 3W1MA 2GPTA 3LCWA 5K9CA 1DQXA 1GVOA 1H7WA 3HGJA 1GVSA 3M5VA 5BOOA 2ZA3A 3WJWA 4WOZA 1S5WA 5T26A 5DBUA 4NXSA 4UXDA 4X9SA 2GVLA 3LHUA 2J24A 3C2FA 4MIMA 3WFAA 1GZGA 4RR4A 3QMTA 4O50A 1F6KA 1JQVA 3BK0A 5CPOA 2B7QA 1HO1A 4LC8A 1TQXA 4ZQCA 3MO7A 1H7NA 3M6YA 3DKLA 2R94A 3PF3A 1CI1A 1SZFA 3TKFA 1AL8A 1OVDA 3W86A 4DF0A 1LRQA 2H8XA 4AHQA 3C3NA 4JTKA 2H90A 5KZDA 3O63A 1EWEA 1YTKA 3GLCA 4MYXA 1Q3NA 3N2XA 1WDWA 2HS8A 1NEYA 5AN7A 1AW5A 1YLVA 1UUOA 3PG9A 3QF0A 4IX0A 3TAKA 3KRUA 4UTLA 2C18A 4QQ3A 4OGZA 2FPYA 4K7YA 1ME9A 4JTSA 3U6WA 3LHYA 3TMQA 3OEXA 3INPA 2CLLA 3L0NA 3LXAA 2QCDA 5LHEA 4IWWA 3GDKA 4IXXA 3N19B 5CSSA 1DKWA 3MI3A 4FNUA 2ATSA 3TFCA 1ALDA 2EAWA 3H53A 1KM3A 4X2RA 3TR2A 3B05A 2VFHA 3ZWTA 2TPSA 2EGZA 4N6FA 4QNWA 4TMBA 2RH9A 3DFQA 3SFKA 1NSJA 3GR8A 2EPHA 1G7VA 4UFLA 4FIQA 3IEBA 2IQTA 1TV5A 4IPIA 1L6YA 4O28A 3DHFA 4FNRA 2G5WA 1C9DA 3NAVA 4JDYA 1LBFA 1M7OA 3NL2A 2B0MA 4XWUA 4AWUA 2DZXA 5L6UA 4WQ6A 4HNTA 1G67A 1OX4B 2CU0A 2CW6A 3P7YA 2DORA 3EX1A 1FCVA 4JEQA 3GDTA 5HQEA 1TTJA 1H1ZA 1GVQA 5FF4A 3W76A 1ZFJA 5K4ZA 4LS1A 1Z48A 2J88A 3G22A 3G3DA 5FESA 1XI3A 1OX4A 3QPZA 2WKJA 4RZ5A 2C15A 5FEZA 1GTEA 1EUAA 1EA0A 1OJXA 1LBLA 4HPJA 5CG7A 4JDBA 2RDUA 3O1NA 4LS0A 3H54A 3KRZA 3NQVA 4KKXA 2QCMA 2QKFA 4BWLC 3LDVA 3WK1A 1J5TA 2ZZ6A 4XZ9A 3LOTA 3T78A 4GUJA 2G96A 2JBMA 2YCEA 4NZJA 1B4KA 4GE8A 3ZFHA 4Z1DA 5FEPA 1DVJA 2NV1A 4IOTA 4NJGA 1RQEA 4POCA 3IGXA 1JUEA 4WY0B 2VKZG 3O15A 2TRSA 4AB4A 5AHFA 4UTHA 1IGSA 4O18A 1QPQA 3FJ6A 3RF9A 4XQ6A 1S5VA 5D2TA 3OBKA 1GYLA 2E77A 1OABA 2E6DA 1TPDA 3S0CA 2Y7GA 1RD5A 3S5YA 4YXGA 5E93A 3ATZA 4ALDA 3RU6A 1DBTA 1TPEA 3HIJA 2ZDRA 3M16A 2KZHA 4QIUA 4ZQNA 2R14A 1P0KA 3FOKA 4HSOA 4A22A 4UTWC 3D0CA 1ZAJA 3TC7A 3BO9A 4CNNA 1WOBA 1G4PA 1S3HA 3GNNA 2PRLA 4QM1A 2Y85A 3KFTA 3CU2A 4JTEA 3GB6A 3B0UX 5F1UA 2EHHA 2ISVA 3UWUA 3TW6A 3T40A 1KA9F 3W1PA 3N34A 4O17A 1U5JA 3TSBA 1KLYA 4G1KA 5TIMA 3O05A 1XCFA 1MXSA 3P8JA 3OHIA 1LDCA 1QPNA 2DZWA 3S1UA 1JCNA 3L5AA 2FQIA 1I2QA 4Y6GA 5I3FA 2FPVA 1P4CA 2PRHA 1DV7A 2ABBA 1TQJA 2BWGA 4IXHA 3ATYA 4DO5A 2WOQA 1I2RA 2TSYA 2UV8G 5HWMA 3LB0A 5AHEA 2W79A 4FIRA 1VYPX 1JR1A 3G1HA 3PBYA 3E96A 3EX3A 5F4XA 5TQLA 3WK0A 3LCXA 3P62A 4GC4A 1KM4A 2YGYA 1H61A 5LNUA 1EP1A 1D9EA 4C1LA 3EX2A 4UCGA 3W70A 3DFSA 5D03A 5CZTA 1LYXA 1KTCA 3TCEA 3S8HA 4HNUA 5EL1A 1FY6A 1KFBA 4Z0JA 3Q2DA 3KOFA 4OE7A 3W2UA 1FWWA 1XFBA 2GOUA 1UUMA 3IIOA 3CWNA 1SPQA 3CB8A 1VCGA 1WOAA 3R12A 3THAA 1DJNA 1NVMA 3P81A 2EF9A 3TSMA 3FFSA 2QCGA 4M7SA 4GUGA 4OBTA 1LZOA 4OU1A 3QC3A 1TB3A 2FTPA 1WA3A 3LXCA 3EWBX 4A3UA 4S1FA 2NUWA 2JK2A 3KVJA 3FIGA 3L0GA 4O1AA 2BLEA 2WJZA 2NXIA 3B06A 5FEWA 4K38A 5C6MA 3OVPA 2NX9A 2Q3OA 3N9SA 3W2JA 3PUDA 1ICQA 3IGUA 4R33A 3HBLA 3RK8A 1FDJA 3G8EA 4HNNA 4JY9A 3PVFA 1OG0A 5FF2A 4XBKA 3QSTA 5D2XA 5J5DA 3RLUA 2E5CA 3DHDA 5F2IA 2QJGA 2QCFA 5HUPA 1RQBA 2FLIA 3DI0A 4PA8A 2Y70A 2H8ZA 4FXRA 3IRDA 3R8RA 1TPC1 2YPIA 3EKZA 3DH7A 4KFPA 1HUVA 3PULA 3G1XA 2BX7A 2E1DA 3TQVA 3S5OA 3KHJA 1IF2A 1QMLA 3KRSA 1T0OA 2QDHA 3VNDA 3NQ8A 1TTQA 4GRSA 1Q6OA 1ZALA 3W74A 4UFHA 3TU9A 3W73A 3JR2A 1YADA 4PFMA 5HR7A 1B4EA 4LU0A 3BLEA 4ZVJA 1SFLA 4AVFA 3NPXA 4DXVA 3UD6A 3GR7A 1TREA 3W7JA 4HNVA 4O53A 2QCEA 4DO6A 2NUXA 1J4EA 1R46A 4LT9A 2OZ0A 2ZRUA 3W7CA 4ONVA 4WY0A 4LRTA 2JKEA 1UCWA 3G1VA 1G6CA 3LTYA 1OX6A 1R2SA 4R34A 2ZBTA 1B9BA 4BI5A 1JRCA 3UZJA 1JCJA 3LRLA 3L68A 1LBMA 3W2KA 5LZLA 1XBVA 4DF1A 4MZ1A 1I2OA 2ZYFA 1KM5A 1QO5A 2WO5A 2V5LA 1N55A 4ORMA 1F76A 1Z41A 2ATMA 5CSRA 5I3GA 3EWXA 3I65A 1W5OA 5DBTA 3R13A 4I7UA 2YZRA 3W1XA 1K7FA 3GNDA 4JXCA 3MYOA 1CX9A 1LRTA 3MUXA 3IVTA 3IVSA 1F05A 2V2HA 4HPXA 2LLEA 1LOQA 3W7LA 2WNNA 4DELA 4Z1AA 5BW6A 3IV3A 2I14A 3U2OA 3UXAA 1OFBA 3CHVA 3UWQA 2X1UA 3LCFA 4JTLA 5I3JA 2WSYA 5HWJA 1Y0EA 4JX6A 4AWSA 1VC4A 4TU1A 1D3HA 1W3NA 3BG3A 2OMAA 2HMCA 1JVNA 4HT3A 4NVTA 1H63A 4UIOA 3QH2A 2ZQ0A 4IUOA 1YYAA 4WZHA 1WV2A 2GQ8A 4OV4A 1Z42A 3ZR4A 5D32A 1TJRA 4LVBA 2VEKA 2V30A 2QCDB 2VEPA 3P84A 3GZ3A 5D38A 2Y7FA 5CZ0A 3STEA 2O7SA 3C2EA 4ORIA 2AQWA 4A21A 2XN2A 5AHMA 5AHLA 1KM0A 2WNQA 4JICA 1FBAA 1N8FA 4QISA 4Z08A 4LNYA 2QCCA 1W37A 3NEVA 2YYUA 3S42A 2E6YA 3MHGA 3VE9A 3M5XA 2A6NA 2E6FA 2FDSA 2YSWA 2B7NA 2OT0A 1P1XA 4BWLA 1KBJA 4IJBA 4MJZA 4Z0SA 1A5CA 3NL6A 2NX3A 1SFJA 2O7QA 3I7RA 5C5YA 5D05A 3ABSA 3TX9A 5IBXA 3W7NA 2TMDA 4WD0A 1Q45A 1KM6A 3C4UA 1OFPA 1BEUA 1AW1A 4JTUA 4RKAA 1KFEA 3QFEA 4K39A 3TXZA 3NQMA 3ABOA 1VLWA 3L5LA 5F2MA 1H60A 3A9IA 1H5YA 2P10A 1KFLA 3MHUA 3L67A 1MZHA 1YXDA 2ZCGA 3M0ZA 3W7RA 4JGDA 3NM1A 4UTTA 2C0AA 5AHNA 2CLFA 1BWKA 5DLCA 1M6JA 4O19A 3W1RA 3F4NA 4FF7A 2CLMA 1YTEA 2DZVA 4MZ8A 1DOSA 5IM51 3L21A 3W22A 1JUKA 2X16A 5FF7A 2X1RA 1W5MA 1FXPA 3SR7A 1SW7A 1LLZA 1FX6A 2C14A 4MLRA 3P80A 3SIZA 3CM4A 1LLWA 3O6DA 3W88A 2QEZA 4MYAA 4GUIA 1KV8A 1NAL1 4KWVA 2ZRVA 1IIGA 4BI6A 2NWSA 3QJAA 1GEQA 4DF2A 2Y7EA 1XKYA 3G1DA 2QJIA 3W23A 2CLEA 3R89A 5D04C 2CZDA 4UNLA 3A22A 1K8YA 2V0TA 1E51A 1XL9A 1SUXA 4BF9A 1RR2A 2QR6A 4ADUA 1ONRA 3WJZA 4AWTA 2ZZ1A 2DZSA 1SO3A 4UTJA 1ICPA 2NWRA 2QCHA 2ISSA 1O60A 3S5NA 1OX5A 3F1QA 3BW3A 1RV8A 2PC4A 4QAIA 4JTTA 5FEXA 4OHQA 3L5MA 1AG1O 3PBWA 4NXKA 5KTLA 4FX7A 2V2CA 2VXNA 4ADSA 2NX1A 2XN0A 1PS9A 4N9CA 3GDRA 3IIZA 3W7QA 2VFFA 5LNVA 1YPIA 1VYSX 4Z1CA 4UFIA 1TPB1 3MHFA 1YXYA 3SJ3A 4CNOA 3G0XA 1OFOA 3G24A 1K02A 1G4TA 1LP6A 5HWNA 2CZEA 2W0UA 3P5YA 4CQ8A 5FF3A 3BW2A 3G8RA 3ABRA 3W84A 4JTJA 4JX5A 4UMCA 3DFNA 3HG5A 4AAJA 2ZZ5A 5CZJA 1B57A 4GBUA 3B03A 3H55A 3QPYA 4JR5A 5LNWA 3NPVA 2C19A 2B4GA 4TIMA 5CPNA 3LGEA 4FO4A 4ICNA 1C29A 1I45A 4GUFA 3LHVA 1JRBA 3MBFA 1EP3A 3O07A 1UBSA 5G1TA 3NQ7A 1N7KA 5F2LA 1RQHA 3S1XA 2WSRA 5BRBA 1WBJA 2YR1A 3UYCA 1OK6A 1VCFA 1RZMA 4UTKA 1P5BA 3CLMA 5G2IA 4UMBA 4CLMA 1DQWA 3QQ1A 4AMAA 4JX4A 3I7SA 1TV8A 1PVNA 5I3KA 3PBVA 2Q3RA 1G4EA 3A24A 3C2VA 1FXQA 4UFJA 7TIMA 2NZLA 5LNSA 1W5PA 4GXMA 4D2JA 3SECA 1QCWA 1OF8A 5KITA 1XUUA 3GAYA 1QWGA 4H6KA 4AF0B 4FNQA 1EX5A 5HJLA 1TIMA 4QSHA 4DBDA 3I7QA 1QOQA 3C61A 1W0MA 2E5DA 1NF0A 3NZRA 4XTIA 4R53A 4J9JA 3W7DA 3LHWA 3E49A 1O5XA 3NQCA 4MZYA 1G4SA 5AYZA 5LNRA 1VYRA 3N9RA 3W1AA 3W6YA 5HNRA 4FX6M 2VFGA 1W1ZA 5D2YA 3B8DA 5DXXA 2OJPA 5G2HA 4NT0A 1ZY9A 3HG3A 4PCFA 1GT8A 2V81A 4ZQOA 4XUGA 3S6DA 3FKKA 4JIPA 3W2NA 3E0IA 2C6QA 3N14A 1TO3A 1TPWA 3SI9A 1O94A 3L66A 1GTHA 3P5ZA 1LROA 5KMYA 2CFFA 2A85A 3C6CA 4LVGA 5D09A 1A53A 4N4QA 3K30A 3GXPA 3TIMA 1PV8A 3HGOA 3M41A 3CIXA 3S1WA 4KFOA 3FS2A 3DAQA 5AYYA 3RNDA 3KVLA 3QMRA 4MVAA 4ZQMA 1EWDA 1OFDA 5F4SA 4PEKA 3P82A 1TYGA 4JTGA 4HIBA 3CWOX 3W7MA 4RZ4A 3NQ2A 2YW4A 3NNTA 4RLIA 5LHFA 5EPDA 1NFBA 2E09A 3HPZA 5HULA 1X7FA 2QDGA 3LTPA 2ZZ7A 3OA3A 1YDVA 2VEMA 2A6LA 3UY8A 4EIVA 3ELFA 4FNSA 1KV5A 4EVZA 1KFCA 4P2VA 2YXGA 3OVRA 5AC7A 4LVFA 3GVGA 3NM3A 4XBSA 1TRIA 2GVGA 1GVRA 1YDNA 4GJ1A 4TO8A 5HUOA 2RKXA 1KLZA 1SO4A 4O0ZA 1M7PA 2ISWA 2C3ZA 1DJQA 3SY5A 5LSMA 3EWWA 3A23A 4MOZA 2BSLA 3DI1A 4IGHA 1EP2A 3Q58A 3NPUA 4YLWA 3WJYA 1LM1A 5CPLA 3M5ZA 3O8AA 1QFEA 3HG4A 3B0PA 3NL3A 3W83A 3LCHA 4PTNA 1H1YA 1SZGA 1YTDA 1KTBA 3STGA 4K8HA 4W9TA 3LV5A 2X2GA 3NQFA 1JULA 1TPH1 1OFAA 2R91A 1L2UA 3HF3A 3P60A 5AHIA 4GFSA 1AW2A 1EB3A 4NNBA 4BI7A 1DL3A 2GQ9A 1HG3A 2A4AA 2QAFA 1W3IA 2NV2A 3BG9A 4PL1A 3PY2A 1HL2A 3W07A 1ZHAA 3EB2A 4IPJA 3A21A 3EX4A 5L9FA 1G7UA 4UTWA 4Y9AA 3NR0A 1H7OA 5KZEA 3USBA 2V9DA 3TFXA 2QJHA 3C56A 3LX9A 1FUYA 1TTIA 4MY8A 4MLJA 5CGQA 3PR2A 4CQAA 2Y89A 4OQVA 1TV7A 4LC6A 3T4CA 1FDZA 1MEWA 3FYOA 1X1ZA 4XKYA 3BV4A 3OVQA 3L9CA 4Z1BA 1K7XA 3L2IA
chains in the Genus database with same CATH superfamily
3OGRA 1KRAC 1GNXA 3GNOA 5J04A 3GFYA 1B30A 4KIEA 5XIAA 3UZXA 3TZNA 3UPWA 5I3DA 5A6BA 3S4TA 1JYXA 4BFAA 4G2DA 2VRKA 4O0KA 1UHVA 5K7JA 4PMQA 2HDJA 3U9IA 1IZCA 4HA4A 2ZKMX 2DV0A 2EJAA 1LQ0A 2Y62A 2ZRXA 2PGFA 5CAKA 2X7VA 1JXJA 3UPBA 3MI6A 2CERA 2FZBA 6ALDA 3RM9A 4QCEA 1LWJA 4XAPA 2ZZ3A 4R9XA 4HZMA 3M0KA 1KFJA 1UIOA 2V69A 4F0HA 4IPNB 3T05A 2ZA2A 3CBWA 4A3RA 3W1NA 3WQ4A 2YL9A 3B4UA 1DE6A 4O1CA 3W00A 3TA6A 3UG8A 3NO3A 1TJ2A 3CUHA 3ANYA 2RGMA 4WDTA 2QVHA 3TTOA 1R0MA 4GQQA 5A3HA 1UZDA 3MZ2A 2NQ5A 5CPMA 4LEQA 4M19A 4DJEA 1E0XA 1PDZA 3A9BA 3AXKA 1DWHM 3NQGA 4I8DA 5A2CA 3GFXA 2CZ5A 1WBHA 4TR9A 2ZRZA 4ROQA 2QMJA 1VZWA 1J6OA 2G50A 4DO4A 1OZQA 2PDMA 1Q13A 3PSWA 2ZWZA 4MFEA 2WJFA 1ITCA 3NO5A 2F6UA 2RDXA 1YE6A 3LBCA 2DIEA 3AO0A 3VNJA 3JZUA 3NOEA 2QUNA 2ZXAA 1X96A 1O7AA 2R8WA 3A47A 3T7VA 4X22A 2ACSA 1TUFA 4AXKA 4U3CA 4O1DA 3M7SA 3H2MA 2BXZA 1TJ0A 2Y24A 3C2OA 3LI0A 3GG0A 4AH7A 3PSVA 4C6DA 5C2XA 1HP4A 3MP3A 2QDEA 2Z25A 1S5TA 3MC5A 4LVDA 1XIDA 1UPMB 3HJZA 2C0HA 1I2NA 2WHLA 3WO8A 1PIGA 3NXFA 3VMNA 2G3MA 5E1QA 1WKEA 4GK8A 4NF7A 8XIMA 4FI4A 1A80A 3BCDA 4NZFA 3W72A 5BXSA 4Q8TA 1SJDA 2VDHA 4B5WA 1A5OC 4GINA 1UMLA 4R27A 5DCDA 4EAMA 3GD6A 4H8VA 1JUBA 2Z27A 1QOXA 2AGTA 2RJGA 1ME8A 5HJYA 3C8FA 4DUXA 5DY3A 4GYKA 2BVTA 3A5VA 4RJEA 3KAOA 4P8WA 3FX4A 1MQPA 2P3ZA 1WZLA 2R1MA 2CLOA 8XIAA 1V6TA 2W91A 4K1WA 4Y8FA 4K6AA 4MPQA 5I3IA 4F4RA 1Q6RA 3CYVA 3BG5A 4JTQA 2VENA 2VX7A 3V16A 4NJIA 4ZMGA 2J25A 3S1VA 3QV7A 4DQWA 3LERA 1LL6A 4F0KA 1E9LA 3AWNA 5A6MA 1UB3A 3KBJA 3UYIA 1REQB 1CWYA 1KGXA 4ICCX 2BGSA 4OWGA 2EKGA 1R2TA 2NQHA 4PR4A 4UC5A 4KCVA 3U5UA 3F2DA 2CYGA 2Z28A 1NFGA 1OFQA 1JEZA 2IPWA 1E3XA 1ITUA 1O95A 2OEJA 1VQTA 1YDYA 4WSKA 3P67A 3FGCA 3JW7A 4Q33A 2HVOA 5A6LA 1AH4A 3EDFA 1QNOA 4NQ1A 2YIHA 3L12A 4ZOCA 3H23A 3QZAA 3TNOA 1XG4A 1FWAC 1PKNA 3CUZA 3EOUA 3W1UA 5H8MA 3OZYA 1A0DA 3ARPA 4TXEA 4MKVA 3NA8A 4I7VA 7CGTA 4XKYB 4A2RA 1PAMA 1B0IA 3UERA 1O5RA 3CAKA 3WLLA 4E6MA 4LS2A 3U3HA 3C2YA 3DHUA 4JYEA 4YL2A 4LUTA 3RR4A 4S39A 3ZZ1A 2C7FA 2PZNA 4ZSUA 1IV8A 2VUYA 1LTDA 3MKVA 4WVXA 1XDMA 3MBDA 1I2PA 4JTDA 1QPRA 1OHLA 4UQBA 3T2PA 2QLYA 3DEQA 1POJA 3EA1A 2WHKA 5BCAA 1HFBA 1C91A 1TPFA 4E8GA 4JYFA 1OGGA 4FZIA 2NQ9A 1ZENA 3R0UA 3SCRA 4BJHA 1QPKA 2DZPA 1F4AA 3WQGA 1JCMP 1C93A 1VPXA 4FXFA 3SCTA 2BVDA 4GKLA 1AD1A 3P0XA 3PB0A 4DJEC 1V0NA 4PTMA 5LKYA 4MB3A 1OCJA 4C5YA 1O5KA 5LXXA 1ECQA 4NNAA 4U10A 3BH4A 1BXNA 1ME7A 4W5ZA 5DXYA 1VJIA 4O54A 3BW4A 5I78A 2J7CA 1UD4A 1UC5A 4LUYA 3UWWA 5G4WA 3UWZA 3CT7A 3LCIA 4I9MA 4GI9A 1C8VA 4DN1A 1EEPA 1QDSA 3KCOA 1W6TA 4HZ7A 2GGJA 1W5NA 4HA0A 1XC4A 4DJFA 4PMRA 4IMGA 6CGTA 2ZC1A 3WLHA 4M80A 5C9WA 2Q8ZA 3WJXA 2BY1A 2HVMA 3NGJA 4XZBA 5JH2A 3UA4A 4YMZA 3UETA 3OIHA 4IMDA 4W84A 4HN4A 2FPTA 3REQB 1J18A 1YRRA 1KM1A 1RSCA 1G9HA 4RPQA 4ZGYA 3E3HA 3Q65A 2A7RA 1OCQA 1US2A 2V5JA 3AROA 4BF5A 5A8GA 1W3TA 3ZJ8A 2VWSA 4KFNA 3OG2A 1GWJA 5IFTA 3S5ZA 2ONEA 2W3ZA 4BEQA 1UWIA 1HT6A 4ES4A 2DJLA 4N9DA 2G0WA 1ZAHA 3HV8A 4ZZ9A 4JFVA 4U33A 3H24A 3TROA 2EPKX 2O55A 1QHPA 2C1HA 3UWYA 1VR6A 4ZO8A 5U7SA 2GYIA 2FH8A 3TAOA 3R2GA 2XU2A 3PWAA 5EU9A 5T9BG 3SSJA 3CQ0A 4JN7A 3KEHA 3I68A 2C8NA 3OG3A 3G1SA 3STFA 3NUKA 4GYPA 1FHLA 4RDYA 3POCA 1HNYA 1UR4A 3QGKC 2WQPA 3S9YA 1XINA 3I3DA 3DECA 1P0EA 1BWVA 2J47A 3CEUA 4RXGA 2WSPA 3PTKA 3OJGA 3QW3A 3FHQA 1LJYA 5MHBA 1H0GA 4PUKA 3P2VA 2Y1HA 5HXMA 3UZZA 4LUIA 3VGBA 1ML1A 1UA7A 4D6FA 2WPBA 4PE8A 3BAXA 3AIUA 1TVNA 4Q4RA 3V4BA 4B3ZA 1F7BA 1QW7A 4DI9A 3CTLA 4ACYA 4RV8A 2QPSA 4H04A 4HPHA 4C6NA 3M47A 3V35A 1X97A 4P61A 4CQBA 1SVDA 1Q6FA 1PCWA 3ZLGA 2ZUMA 1OC6A 3PPHA 3E38A 3HQ1A 5C9ZA 2DSKA 1KM2A 3EWUA 4H6RA 4UFKA 3P61A 1TG7A 4O14A 1TZ7A 2BP1A 1CT5A 1L9WA 1WAUA 2VM8A 4JIIX 3MCOA 1N8IA 1XLKA 3FW6A 3DFPA 2J13A 3CAVA 2XVPA 3I3EA 3FJ4A 1T41A 3ARUA 3AWOA 4HK6A 3S2CA 4A8NA 5AVNA 1XX1A 3N2CA 2GJLA 2A7NA 1B3OA 3CEPA 3JRKA 1KCLA 3UVAA 4PRTA 3WLJA 2O9RA 4IQLA 1K6WA 2W27A 1VRDA 3WN6A 2REQB 2HE5A 4QJ5B 3EB3A 3CYJA 1WXJA 4XIMA 1M5WA 1KO0A 5EMMA 1UH4A 5LA1A 2YXOA 3SADA 4FOKA 1HQTA 2V2DA 2VDIA 3K2GA 1ZBWA 3W7HA 3GXIA 2KX9A 3U8GA 3FLUA 1MFUA 3DC8A 1ZBKA 4XZHA 4F40A 5KZMA 1VLIA 2H3BA 2CWNA 3R0KA 3V1PA 4UZUA 5K9DA 1GKPA 4X61A 2PLCA 1XDJA 4IQEA 3RMJA 4F0SA 2OTDA 2R1LA 5IFPA 2YZ5A 3NCOA 3IIVA 1EUNA 3W0KA 1A5BA 4M6VA 3UU0A 2JKPA 4U4MA 1V5XA 1H5VA 3QY6A 4N9EA 1MFVA 2GGHA 3H4GA 3NQ6A 4M8UA 2HE8A 1DQXA 1AODA 4C6OA 4EXBA 5HNTA 4AX7A 3M5VA 5I5RA 1VENA 2VVNA 1S5WA 2J79A 4UXDA 3T6CA 1TWWA 2GVLA 3V0SA 4Q8QA 4EKJA 5A6BD 4AMCA 2VUNA 1F6KA 1JQVA 5CPOA 4GA8A 1HO1A 4C7DA 1H7NA 1UMYA 1JZ6A 3PF3A 1GQKA 4GXPA 4PUNA 2JE8A 1LRQA 1ZRQA 3AXXA 4JTKA 3DG3A 5KZDA 2OELA 3O63A 1J0JA 1YTKA 4X60A 3VDGA 5BOEA 1E0TA 3N2XA 2HS8A 3LEPA 4LBSA 1UUOA 2ESCA 2PMQA 3TAKA 3GDBA 1X8CA 4QQ3A 4FPSA 2E9LA 1Q6CA 4JTSA 3U6WA 1XLJA 3N6QA 1PZ2A 1VBGA 3INPA 3BAJA 2XSXA 3L0NA 4IWWA 4KCTA 3AU6A 2R1KA 4PBEA 1A3XA 3VD4A 3WH9A 3ES8A 1E4NA 1XRVA 4IG2A 3H53A 4U31A 3B9AA 2I9UA 2VFHA 2I5QA 1R5YA 4QNWA 4TMBA 3SIMA 2WVTA 3BURA 4Z2HA 4FIQA 3T0AA 3VCNA 4IPIA 1L6YA 4GX8A 3ZSTA 1JZ5A 2PP3A 2PFHA 1I0DA 2B0MA 4UWMA 2G41A 3OHMB 3NZQA 3ARXA 3EX1A 3CNYA 1FCVA 1N82A 2DT1A 1E70M 4NHVA 5HQEA 4H2HA 1V02A 5FF4A 3W76A 1ZFJA 3RG6A 4F0LA 4B2DA 3G3DA 3QPZA 2WKJA 5JU6A 4RZ5A 3AYTA 4HPJA 4MB5A 3SY1A 3TQPA 3WENA 4LS0A 3KRZA 2QKFA 4U2ZA 4NZCA 3LDVA 4PMYA 3WK1A 1AQ0A 2Z24A 3UNTA 4XZ9A 3T78A 2DVXA 3A64A 2JBMA 1B4KA 4B2DD 1HKKA 2J7GA 1MUCA 1O1HA 1WXZA 3IGXA 2GGEA 2TRSA 4M0XA 4UTHA 1NWTA 4O18A 1K9FA 4QG9A 4XQ6A 3OBKA 2E6DA 1ZZMA 4Q8WA 4J3VA 3RJYA 7PTDA 5JIPA 3LMYA 3ATZA 2FZ9A 2ZDRA 1HJQA 3M16A 3WBYA 4I90A 3IARA 1OIMA 1CGXA 2IS7A 1EA9C 2R14A 4UTWC 3BO9A 3CHCA 9RUBA 5A8NA 4WF7A 4YTTA 4CNNA 1TE6A 1S3HA 3E6EA 4ECLA 4DI8A 3CHDA 1TV4A 3T81A 5EMJA 1ZGDA 4QGCA 2OVLA 1A5LC 5LYRA 3UWUA 3N34A 1NELA 1U5JA 1Q7ZA 1KLYA 3IJQA 2GSHA 2PS2A 3W37A 1S38A 3PZ9A 4CN6A 5JVLA 1EO7A 4IJCA 5BXPA 1AQMA 3FVDA 5I3FA 3U2ZA 4B3KA 3JZEA 2FPVA 1P4CA 1V02E 1JG9A 2BASA 3QHOA 4DO5A 3TA9A 2TSYA 1EH9A 4KEMA 3LB0A 4H00A 4C60A 3GH7A 2VC5A 3G1HA 2PDUA 5TQLA 5I07A 3AHTA 3OLDA 1PIFA 1KM4A 2HXUA 3KOWA 3MT1A 4C1LA 3EX2A 1XISA 4UCGA 3KHDA 1XGDA 4QP0A 4L4OA 1VFUA 5D03A 5CZTA 4CU7A 1RHCA 1MQRA 3N4AA 4EANA 3Q2DA 3T09A 1TWDA 4OFCA 4OE7A 1UUMA 1VCGA 1W3JA 2VJXA 1BF2A 4W7VA 3R12A 3THAA 1E4LA 1DJNA 3FFSA 3E5BA 2BHZA 1V3HA 1LZOA 1OGSA 1PEZA 2HNEA 2WMHA 4DM2A 3LXCA 3EWBX 1KXTA 5FSDC 4C6BA 5CC7A 3BMXA 1D8CA 4O1AA 1UROA 1UG6A 4WEVX 3SCVA 5FEWA 1W8GA 3OVPA 2P50A 2NX9A 3KP1A 1ICQA 3BL3A 4QE4A 3G8EA 4HNNA 4MJ4A 1V0KA 3FJNA 3RN6A 4XBKA 3CQJA 1R3YA 4QEEA 3U57A 5F2IA 3S47A 2QCFA 3R1ZA 2FLIA 3B8TA 2PCEA 1V4YA 2FYMA 3WQOA 4FXRA 3ABZA 4J1OA 1I1WA 2Z1KA 3VDHA 2YPIA 3EKZA 1HUVA 2VT0A 3MA8A 3G1XA 3HJEA 4J3UA 2MUCA 2E1DA 3W82A 3TQVA 4IIHA 3S5OA 1QMLA 1MYRA 3KRSA 2XFYA 1K9EA 3BOXA 2QIWA 2OPJA 2QDHA 2XWEA 4FA3A 2VCBA 3BOFA 4LCRA 1Q6OA 3W74A 3G1RA 3A6OA 4C6JA 1VFMA 1B4EA 5KEZA 4LU0A 1D8WA 3K4AA 4ZVJA 3NPXA 3LLXA 4DZHA 1TREA 3IJ8A 1SR0A 4DO6A 1R46A 2X09A 3W7CA 4WY0A 1QHZA 3TYBA 4J4KA 3UZJA 1SJBA 3E0WA 4C6FA 1DHKA 3URBA 4GYPC 5EFFA 2V5LA 2GLKA 1Z41A 3F5KA 3EWXA 3TTEA 3W6MA 2ZVIA 3WD0A 1PYFA 2JIEA 1RP9A 3SSZA 5F7UA 3IUIA 4WK9A 3GNDA 1XQKA 2A3CA 1JIBA 5HNUA 4H8HA 1J11A 3U7VA 5I02A 4JTAA 4HPXA 1ONEA 2LLEA 4HA1A 3W7LA 4FS9A 2WNNA 3RX3A 2YCKX 4DAFA 2EBNA 3ONCA 2UY3A 3IV3A 4HOZA 1UD5A 3SN4A 2WZTA 1CDGA 1XQLA 3OQ8A 4CD5A 4ZOEA 4JTLA 1PO9A 2OYMA 5I3JA 1DWGM 2OWCA 4JX6A 1D3HA 4A6GA 3BG3A 3BSHA 1ZL1A 2HMCA 2VX4A 5I79A 4P7OA 3SUWA 4C1NB 2GQ8A 3ZLHA 1UPPA 1P6BA 3T08A 4M6UA 2HVNA 2V30A 3IJDA 1MDLA 4PUJA 5DMNA 3B97A 5D38A 4N0RA 1OADA 5CZ0A 3STEA 4NAFB 2AQWA 2W5FA 2BY3A 4A21A 4XG1A 3ZJ6A 4US5D 2QF8A 4HTYA 1FBAA 1RCOB 1V3LA 5B80A 2YYUA 1KBKA 2QT3A 2A6NA 1FWDC 1V51A 3WQPA 5C9XA 1IEXA 1OT1A 2B7NA 1FWHC 1P1XA 1O6IA 4Z0SA 2O7QA 3ES7A 1F9CA 1E5NA 4HU4A 3TX9A 5IBXA 6A3HA 3C4UA 3CAQA 4NY2A 1OFPA 4H9YA 1AW1A 2QULA 4ROPA 2VQTA 1BRLB 3TXZA 1C7TA 5FACA 1RJPA 2OO0A 5GJPA 3VXGA 2B81A 3MHUA 4E3VA 4J3SA 1AD4A 2VGBA 3AOFA 4Q6JA 3EMCA 1Q66A 2C0AA 2J7DA 5AHNA 3URNA 2YBVA 3KS5A 3W1RA 2DDXA 2Z1SA 2CLMA 2XH7A 3H2NA 2X1RA 4PZVA 1QNQA 4MLRA 1BGAA 4O1FA 3UJSA 1DJZA 2GSJA 4MYAA 4GUIA 1PSCA 3KUMA 1LT7A 4DRSA 1QJWA 1IIGA 4BI6A 4E4PA 2NWSA 1M68A 1ZP4A 1YQ2A 3SFWA 4NAEA 2REQA 3G1DA 2QJIA 1VFLA 4PCTA 1T8QA 5H6HA 2PWUA 1FKWA 4IIGA 1UH2A 2QR6A 4ADUA 4ZOBA 1ONRA 3OLEA 4PTDA 4H19A 2DZSA 1SO3A 3PZQA 2NWRA 4B91A 3XINA 2F8QA 1NWRA 1O60A 3QV9A 2QHAA 4EX4A 3F1QA 4NI3A 1A4LA 5TAOA 4FXJA 5FEXA 3L5MA 4NXKA 5KTLA 4FX7A 2V2CA 1MZRA 3F4DA 2XN0A 3MQTA 1PS9A 2WZIA 1V8EA 3IIZA 4JTCA 3U0HA 4UFIA 1TPB1 4Q8OA 3WDJA 2CZEA 1Y65A 2ANUA 2W0UA 4CQ8A 1GHSA 4AY7A 2Z2BA 3BW2A 4CN1A 3ABRA 2FDMA 4WHBA 4TVCA 4JL1A 3FCPA 3H4WA 4AAJA 2I17A 1NY1A 4WSHA 5HNNA 4GBUA 3H55A 4I5XA 4JR5A 1VFSA 1R3WA 2IKJA 1VP5A 2B4GA 4WIWA 4FO4A 4ICNA 1TWIA 4GUFA 1HKJA 3UJ2A 1ECEA 1ITXA 4FLOA 3THUA 1PYMA 1HZYA 2RGLA 3AJ7A 1XRTA 1GJWA 2NT1A 1RQHA 3S1XA 4QG8A 4YWSA 1YIXA 2YR1A 1OK6A 4UTKA 2ZUWA 5HQLA 3IGHX 3CLMA 3QQ1A 4AMAA 4JX4A 3I7SA 1PVNA 5CPSA 1XYBA 4MAVA 4ATLA 3V0UA 4ERIA 1KD0A 3N1AA 5ABFA 2BB0A 4GXMA 4D2JA 1BQCA 3H8AA 5BZAA 1QCWA 5KITA 3GAYA 3OB8A 1QWGA 3WF0A 4F48A 1K9DA 4HMDA 1TIMA 2YDQA 2INZA 5BYWA 5LIXX 2PA6A 1NF0A 3QR0A 2OOFA 3IS4A 1QI0A 4J9JA 2VX6A 3W7DA 4HNOA 3RHGA 1A49A 1VYRA 3W1AA 2DQXA 5HNRA 5CSUA 1J0KA 3RGTA 5G2HA 2HBXA 4NRRA 4ZQOA 1M01A 3S6DA 2ADAA 3GYCA 3ICJA 3CASA 1WKFA 3N14A 3PJTA 1TO3A 2E9BA 3SI9A 3R79A 1VIWA 3KOYA 4W7WA 1QNPA 1X7IA 2C71A 4PEEA 5KMYA 2A85A 5D09A 3TP4A 1M9HA 3GXPA 3AXIA 3UG5A 2XZ7A 5A95A 2YL5A 3DAQA 3RNDA 3QMRA 3LM3A 4RE3A 4ZQMA 4QE5A 4HTBA 1LWHA 5F4SA 1TYGA 2WMFA 2AL1A 4HIBA 1WDPA 3CWOX 5EGRA 3NQ2A 3LZ3A 3OO2A 1JI2A 1K8CA 1NFBA 1X7FA 2QDGA 4HMEA 4W93A 2ZZ7A 5EMKA 4IFRA 4KQNA 3SURA 3SCQA 3FXYA 5ABHA 4DBSA 4D6JA 5AC7A 3NM3A 4L6DA 2PD9A 3ZT5A 4TO8A 1E0WA 5HUOA 2RKXA 1KLZA 1SO4A 4O0ZA 1VFOA 4JBRA 3UT0A 3DI1A 1EP2A 3H6OA 1TR1A 1WDDA 1LM1A 2VHLA 3M5ZA 1QFEA 5I2UA 3HG4A 2R6OA 2HCVA 4LFYA 2O56A 2P0IA 4XKMA 3LV5A 1TPH1 3WQ8A 1OFAA 4LCQA 1A5NC 1L2UA 4YTRA 4GFSA 1AW2A 1EB3A 4BI7A 4MPKA 2OSXA 2P76A 1W3IA 2NV2A 3BG9A 4ZENA 4S3AA 1UKOA 1ZHAA 3EB2A 4R9OA 4AW7A 4JCMA 4Y9AA 3M6DA 1H7OA 3OZPA 1PBGA 1HJVA 5CGQA 1RALA 1ZP3A 3PR2A 1E6NA 3TLLA 3MMUA 1XH0A 1WNOA 4HMNA 2HRWA 2BOGX 4XKYA 3FYOA 1CYGA 1DWIM 1XYAA 3FA3A 3RIKA 4GYFA 4UQAA 2NVDA 3DG7A 5U4NA 3UWVA 1JDEA 2QGHA 4OUIA 5KETA 1SZEA 5HQMA 1PZ0A 5D9MA 4OBSA 5G4HC 1IXNA 4JTIA 4XUYA 3KVKA 4JTFA 4ACZB 3GU9A 2ABAA 1K9TA 2ZVRA 1FTXA 5AC8A 1S2UA 1QT1A 2EG7A 3GHSA 3WNOA 1DJXA 4RV3A 2QCNA 3M5YA 3PJWA 1PCKA 4QAWA 4IISA 5ABEA 1GYNA 1HL9A 1OK4A 4WDWA 1KGWA 4D6CA 1GQNA 1PTAA 3LU2A 1H50A 4LYQA 2XFWA 3GH4A 1XIJA 2CLPA 1T8XA 3PC0A 5I77A 4A2SA 4D6HA 1AJ2A 2DY3A 2YXXA 5C55A 3KTSA 4M6QA 4W7UA 3FYPA 2F84A 4FLRA 2Y88A 1FHVA 3B04A 4O8RA 3PAJA 3NYZA 3ZR6A 3FEQA 2PDPA 4B92A 3M7WA 5HPCA 2VVSA 3TUUA 4IQDA 3ONBA 1SO5A 5FD0A 4RX0A 1X8FA 1ZTVA 4RNIA 1Q6LA 1V6UA 3BGAA 5CPTA 2PBOA 3MCNA 1WUEA 4MB1A 4HHPA 2PB1A 3HFYA 4G7EB 4PMVA 4JN6A 1JZ4A 3PFRA 5D2WA 1PIIA 3B8UA 3EXRA 5GVJA 3W85A 3FJLA 1JD9A 5TBOA 1J01A 4DYKA 5D8WA 2BOEX 1P7TB 1IR2A 3OGVA 4OOZA 1UR0A 4XSLA 3SGGA 5FA5A 1EJTC 3QN3A 1DQUA 2WK2A 1MNZA 2DU2A 2HV5A 1F61A 3EKLA 1ZPTA 2CLKA 5LIYX 3VNMA 4D8LA 3G0SA 4XBJA 3QOMA 1AFSA 3H12A 4PUUA 3WF2A 1G5AA 3S6TA 4WDXA 2W6RA 3LGGA 1V77A 5K9XA 4MUZA 3LLDA 4UMAA 1XLEA 1J10A 1FKXA 3LV6A 3NDOA 1X38A 2YCJA 4ZL1A 1RCQA 3SN1A 1Q2SA 3TJLA 3G0UA 2VTFA 4EP8C 1UP3A 1EOMA 2VFDA 1FDYA 2WLZA 2VEGA 3R4IA 3RCNA 2A3AA 3KX6A 3K4DA 1UD8A 2HROA 5FL0A 5IRPA 1GOQA 3T8QA 3B0VC 4G8TA 1OQFA 1MRAA 1FQ0A 2XH4A 3CMGA 4CQDA 1LOLA 2HJPA 1FFRA 3VIFA 1JCXA 1OD8A 5LA2A 2XM1A 4MAZA 4O16A 4D6GA 4LRSA 2OOGA 4HGXA 2FVLA 2PRMA 3GYEA 3PFMA 3UCDA 4AIOA 2BXYA 1DPMA 3W1QA 3W6LA 5D4YA 2PCQA 3ANUA 3TJXA 3KTCA 4DLMA 1UZ1A 1QR7A 4QE1A 2OWXA 2XM2A 2GUYA 2WMJA 1RK5A 1X6UA 3GKAA 3MVIA 4PMJA 2PURA 4IZGA 2RDWA 3CUXA 4BR1A 3QQ0A 5D33A 2OZ3A 1WXYA 4Q4KA 4PODA 3GXMA 4S3BA 1E56A 2I1OA 2FKPA 2YCLB 4GJIA 3W24A 1IZJA 4L64A 4UQEA 3GM8A 4J3ZA 3R6IA 3OQEA 2WHJA 3IIPA 3SEPA 4LB3A 3G18A 1KBIA 5K3VA 2C16A 4LF2A 3GX9A 1V08A 4L1WA 1BAGA 4XZIA 3WEMA 3AMGA 3AS3A 4FEZA 5DF0A 3UFYA 2YX0A 1WZAA 1CGUA 3QXBA 2NQJA 4O52A 1MDRA 1WCGA 4O4WA 3E12A 2D23A 2CITA 5A2BA 3P3BA 2JGYA 3N73A 5A8PA 3IVUA 2ISFA 3J7HA 2WKGA 4EPBC 4B4FA 2YW3A 4ZODA 1VBUA 2YCIX 3GFZA 1KFKA 4RE2A 1J2BA 1TMHA 3VA8A 3FNDA 4WKAA 1HJUA 3EOSA 3ARSA 4DBEA 2X1IA 2VD8A 2O0TA 2QCLA 2X1TA 4ERAA 2F7FA 3BV7A 1L8NA 4PC8A 5CZSA 2DT3A 2P0OA 3HMJG 3FSTA 4RK8A 3K5XA 3LHZA 3UNDA 5DO8A 3UXDA 1M7XA 5XIMA 3BZGA 3DU0A 5ECVA 2ZOXA 4GJJA 1RD6A 2ZZ2A 2INEA 1TPUA 1T6MA 2CZFA 2Z4GA 5EMUA 1L6FA 3DGRA 4M7TA 1P0NA 1YXCA 1EIXA 4K3ZA 3MWAA 1OFRA 1KC7A 2CXEA 3BDKA 2FH6A 4K8EA 3VGHA 4ICMA 3MDUA 3BC9A 2YCLA 1XICA 4RXFA 2VZSA 4GVHA 2WV8A 2QPUA 4HJFA 4JIQA 5I09A 4RW3A 1PHQA 4YTQA 2O9TA 3C0LA 1BKSA 2CBVA 4CD8A 2CLHA 2G4FA 5DCBA 3WNKA 2FVMA 3OVGA 4TMCA 5DRIA 4JAWA 1NWUA 5K2ZA 3VFLA 1MEIA 5T91A 3WFLA 1H62A 1UW9A 3O16A 5CKSA 3BJTA 3WUEA 3HU7A 4AD5A 3RLVA 2AGKA 3F2CA 3VO0A 4O4VA 4D6DA 3LHTA 4MDOA 1OCNA 3CPGA 4KMQA 3GZAA 4D6IA 1Q7MA 2PPGA 2ON3A 1U1HA 3U5YA 2DSZA 5DFAA 5CXPA 3USZA 4HQVA 3AMLA 4CKQA 4B5UA 2OGJA 5J5RA 3PN8A 1PXGA 4AX6A 3N3MA 1EPXA 2FIQA 4O13A 3MMDA 3EDEA 1LWIA 4WOQA 2CNCA 4UFMA 1JD7A 3L4XA 2ZC8A 2HTMA 3UJFA 3S2JA 2CXGA 3WEZA 2I9EA 4ADTA 1J6PA 1V6XA 4PL2A 4CGTA 4FAMA 3EEGA 1Q2RA 3NVTA 4B16A 3N15A 2NUYA 2WVVB 3VCRA 1LCOA 5IDIA 3GHTA 3P8IA 4GWEA 3QV6A 4IX2A 2OO6A 3CIVA 1TIWA 5A2AA 3HB9A 1E9YB 3DG6A 4B5SA 1J5SA 1CW2A 4ENLA 4U3AA 4GG9A 5K4XA 2PF8A 1HKWA 4NJKA 2WBGA 4LAKA 3G1AA 4HK7A 5G4EA 2OT1A 3WF3A 3LPPA 1RUSA 1H3GA 2AAAA 1W1IE 3WLRA 1W5QA 3MSGA 3CL7A 4E2VA 2VZUA 4OT7A 5HMFA 1MO0A 3V5OA 5H91A 1R87A 2V67A 1SJAA 2PWVA 4IL2A 4N7QA 4IPLA 4HPNA 1OYAA 2OXNA 4HU3A 5DCEA 4AUBA 7XIMA 1ZJHA 4JNYA 4DY1A 4GZEA 4C91A 4NZ5A 1OYBA 4AZHA 4GHRA 1PE1A 2G95A 5AC6A 1BYBA 4O11A 2PGRA 1J0IA 1XYZA 4LCSA 5CJMA 4E2DA 3UJRA 3WNMA 8CGTA 2BGQA 2GWGA 4RDZA 4QNEA 3KVMA 1BXBA 3UA3A 5HINA 4IMCA 3IWPA 1TMQA 4TTGA 2ZZ4A 3PUEA 4H4IA 4CCZA 1E73M 3ZR5A 3IGSA 2A0NA 4JNZA 3BLPX 4V28A 1GPFA 3JS3A 4JFSA 4IGMA 3U2CA 1JYNA 1E1CB 2GJPA 2P1FA 1A3WA 3BCFA 2PUZA 1GQIA 3S6OA 2J75A 4MF4A 2I16A 4PB4A 2E3ZA 2ODOA 1J79A 4UR7A 1V93A 8TIMA 2P8BA 1EXBA 1BLIA 3F2BA 1A5KC 4XTDA 1WQ5A 2D0GA 5LGZA 2V3DA 4LYRA 1H41A 3A12A 1VEMA 4K1GA 5DRCA 1XF0A 3N11A 4FLQA 1VHCA 1OBAA 4O10A 4L7ZA 3CWHA 1EYEA 3PANA 3GUGA 5C2CA 3QZEA 4JZ5A 3ZVIA 3CV6A 2TAAA 1IIHA 1XD1A 4QS5A 4JY8A 2EO7A 1KRBC 1I4NA 2QYGA 1QOPA 1WB0A 3GDMA 1GQJA 1HN1A 1IXPA 4GNKB 1XSKA 4V27A 2XIQA 1AUSL 4KS0A 4N2YA 3ZLFA 1XJBA 3IJ9A 3UQNA 3VKAA 4LWWA 2BVWA 4PMXA 3VGGA 2FHBA 1E43A 3IUDA 2OQYA 2BTMA 4NZ3A 5A5WA 1R3VA 2WMIB 3O06A 4LGXA 3L2LA 4ERGA 2GQ3A 2WNWA 2G3NA 3SUVA 1H7PA 1QHOA 4OIFA 4DUVA 3AIEA 2IPFA 4Y9NA 3W29A 3M46A 1AMKA 3OBEA 3RRXA 2BODX 1AZ1A 1VFHA 3RFAA 3PZUA 3ZJ7A 2QQ6A 1LQ2A 4EF8A 4FX8A 5HJXA 3FEMA 3T0CA 2DFAA 4GGHA 2J9YA 2PTZA 5TD4A 3PG8A 2RFGA 3W7KA 4RUBA 3TJIA 1VS1A 1BTMA 1UASA 3RM4A 2YLAA 1BRLA 5G1YA 8RUCA 5E9XA 2X42A 2YL6A 4AEOA 1ZBCA 4GIAA 3SCWA 3HQOA 5J8LA 1FWNA 2Z2AA 1K3UA 3M07A 5FI8A 1FCQA 2EPLX 1XUZA 3TN4A 1JJKA 3LUTA 1B2YA 3M0VA 1IWBA 4G7FA 4Q32A 4FNPA 1XLDA 1SYTA 1KTNA 3L4WA 4BQ3A 4LVAA 4YWIA 2ACRA 2WJDA 2JQXA 3VDCA 4O12A 5JBFA 3EX6A 4R88A 3DERA 3W1MA 2GPTA 4XAFA 4M3PA 4RNHA 3UR7A 3PNZA 1GVOA 1O66A 3HGJA 5BOOA 5M3WA 2ZA3A 1VPQA 4ZB5A 5DBUA 1RBAA 4X9SA 3C2FA 3WFAA 1GZGA 4RR4A 1HP5A 4O50A 3FAWA 3HM7A 4AZ6A 1KBBA 1KKRA 3EZ4A 3M6YA 5CBBA 3L4VA 3DKLA 4LSBA 1CI1A 2FZMA 3TN3A 3TKFA 4L56A 2H90A 2YBTA 1EWEA 3CMFA 4TV6A 3VK5A 3GC4A 2PWHA 1WDWA 1F3EA 5AN7A 1AW5A 3WELA 1ISWA 3PG9A 3VKCA 3VMPA 3QF0A 4IX0A 3B0YA 4Q7BA 2C18A 4LAMA 2P8CA 3UR5A 1ME9A 3TMQA 4BZYA 3OEXA 2CLLA 3MUCA 4HHHA 1XLFA 4GYJA 2QCDA 1MW3A 3KBMA 3M0JA 3GDKA 3WLMA 1FWJC 3AIRA 3VM5A 3MI3A 3ZVHB 3KS6A 1MQQA 3TR2A 3MV01 3B05A 1PWMA 3GR4A 1FA2A 2GDUA 5HA7A 1T7LA 3NOYA 3BUVA 3GR8A 3VIGA 1CZ1A 2EPHA 2PEVA 1PUDA 4GO9A 4GI6A 4FNRA 3T0DA 4JDYA 4B5VA 3B9DA 3VYLA 4Z42C 1LBFA 2G37A 3HURA 4CD7A 4V1XA 4ZCWA 2PDCA 2DZXA 1I0BA 2X7WA 2D69A 4WQ6A 2W61A 3AIWA 3P7YA 1TKKA 2DORA 1XIHA 1XH2A 3RRAA 4JEQA 1TTJA 2PDJA 2UBPC 3KOZA 2J88A 3CK5A 3JVAA 4AD0A 3ALGA 1XI3A 4WSJA 1UWTA 4UR9A 1GTEA 2FTWA 1LBLA 5CG7A 3GTNA 2RDUA 3O1NA 4KWSA 2QCMA 5HBFA 3V0TA 4GGBA 3RM8A 1GW1A 3LOTA 4DJFC 3TZFA 4GE8A 5EFDA 1V0LA 3LS9A 5FEPA 3OU8A 1DVJA 4GY0A 2VCCA 2NV1A 1EJUC 1JGMA 1I1XA 1OC7A 4E8CA 2VKZG 3O15A 2SFPA 3MPGA 4AB4A 3ZVHA 4L1XA 1QPQA 3TN6A 3MUIA 3RLGA 3II1A 3GNXA 3WF1A 4H9UA 1TPDA 1UH3A 2Y7GA 1RD5A 3MMWA 1DBTA 1TPEA 5CPQA 4D9PA 4M82A 1SGJA 3M4HA 4HOXA 4HVXA 4U5IA 5CGMA 4HSOA 1DTNA 4U5KA 2QJJA 1FOBA 3AFBA 3MV11 1YE4A 2PRLA 2Y85A 3CU2A 4KGJA 2YB1A 1BFNA 2VRQA 2V6AA 2FVKA 4P8UA 2BMBA 5F1UA 2XIIA 2EHHA 4JKLA 3T40A 3WMBA 4KRTA 4HZ8A 1BG4A 2Y0FA 4KEUA 3TSBA 2QV4A 4G1KA 5TIMA 1MXSA 1QPNA 4W88A 2XHYA 5A1AA 3BCJA 3APYA 3L5AA 4PUEA 1I2QA 4Y6GA 5H8PA 1EF3A 3QQWA 2NW0A 3GG1A 3VFCA 4XISA 4HYRA 4IXHA 3ATYA 3VOFA 4H9XA 1LG2A 5AHEA 4FIRA 1VYPX 2XVNA 3PBYA 3UR2A 1SJCA 1H61A 2J7HA 5LNUA 1EP1A 1D9EA 1UOKA 1NDVA 3QZ6A 1AQHA 3NYDA 3SAZA 3WDQA 1E9IA 3OODA 3W70A 3DFSA 4IJRA 2GDQA 2WKLA 2PDYA 5EL1A 3T0TA 4Z0JA 3GVVA 1CGWA 4JHOA 1E55A 3RX2A 5GNZA 3WBAA 3IIOA 5DT7A 3W81A 1NVMA 3P81A 3RR1A 3TSMA 3V7PA 2QCGA 4GQBA 4QDPA 3MCMA 4OU1A 2ZX7A 1TB3A 3E2SA 4GX9A 4A3UA 5C8BB 2JK2A 3KVJA 4PUWA 3SRHA 5LXEA 4M24A 1XPYA 2NXIA 2HBVA 3B06A 4K38A 5C6MA 3GSMA 4MM1A 3W2JA 2WC3A 2PC8A 3PUDA 3PTQA 3HBLA 4AIEA 2D2GA 4C1NA 3KW3A 3W27A 5FF2A 4IGSA 3NDZA 3WIJA 5J5DA 1BVWA 3RLUA 4GLEA 3N9KA 2QJGA 3V3WA 1RQBA 3DI0A 1VB9A 2Y70A 2H8ZA 3DUGA 3GG8A 2VD9A 5I24A 1TPC1 5GJMA 1ZSXA 3PULA 3UXIA 2UY2A 3KHJA 1IF2A 4MKSA 3WBWA 2JF6A 4ZXOA 4S3GA 2DUXA 1MUWA 3E2RA 4GRSA 3FA4A 1B90A 3UF9A 3TU9A 3KZPA 1ZS2A 4Z1YA 3BLEA 4L61A 3ITGA 2HK0A 3UD6A 3AYRA 1E6XM 1KNWA 3W7JA 4HNVA 1S1RA 1S5NA 1Y5XA 1J4EA 3GNRA 5CZKA 2OZ0A 4ONVA 5D8ZA 2J78A 3WDHA 4GVIA 3G1VA 1G6CA 3RAOA 3VNZA 1CIUA 1B9BA 3LK6A 2DUZA 2XWDA 1JCJA 1LBMA 1XBVA 4YVPA 4DF1A 1MI3A 1I2OA 2ZYFA 3KL5A 4IP4A 1HIZA 3OA5A 1K70A 1N55A 1F76A 2ATMA 3H7RA 3G6LA 3I65A 4I7UA 2YZRA 5A6AA 4JXCA 4OTKA 3CV7A 3GHRA 2WZHA 3AZRA 1JYWA 1LRTA 3MUXA 3WLIA 1F05A 3B8SA 3GTIA 3R25A 1GJUA 1W9XA 4ZO6A 1IGWA 2I14A 2PZ0A 3RUBL 5JQ9A 2XUCA 3CHVA 1CLXA 3UWQA 4PBFA 4ZE4A 3WDRA 2Z1VA 1KFWA 1VC4A 4TU1A 3AIVA 2RAGA 3JUGA 1W3NA 2AQVA 2R9RA 3GUWA 1H63A 4IIBA 2GVEA 3SUSA 3T42A 3PTMA 3D5HA 2PD5A 1QTWA 1Z42A 4MNLA 3ZR4A 4IMAA 1TJRA 3AQUA 1Q6EA 2QCDB 3EWCA 2PLJA 2UY4A 1UYQA 2Q8XA 2Z1WA 2Y7FA 3UZYA 4L65A 5PTDA 1NJJA 4QS6A 2XN2A 5AHMA 1KM0A 1ZUAX 2PGWA 5IXEA 1QBBA 3C3UA 3VOHA 1N8FA 4Q4QA 4QISA 4LNYA 1M7JA 2QCCA 1W37A 3NEVA 3S42A 4A35A 1NFPA 3M5XA 1PKMA 1Q8AA 5REQA 2IUZA 3A4AA 1V0MA 2E6FA 2FDSA 2FZDA 1EPVA 4JIEA 1US3A 3NL6A 5CBIA 1YMYA 2NX3A 4GFIA 5C5YA 4ZB2A 1JDDA 5FJPA 3W7NA 4XZMX 2EXOA 4H8NA 3PZIA 4AZCA 2VURA 4Y8EA 4DX3A 3QFEA 1QNSA 3N2BA 1FWCC 1VLWA 5F2MA 3A9IA 2X05A 2P10A 2XIOA 5DANA 2Z26A 3TCSA 5BXRA 3UCCA 4UTFA 3NEHA 1Q4NX 2WJEA 1YXDA 2F2KA 2ZCGA 3M0ZA 4PMUA 4UTTA 2FZNA 2CLFA 7A3HA 4D72A 5DLCA 4O19A 3F4NA 4ZA0A 3RPDA 4KCWA 4UNIA 4MZ8A 2E7FA 1ISYA 1DOSA 5IM51 2CBUA 2R1NA 3W22A 1JUKA 3BLLA 3IJIA 1IEVA 3TYUA 4Q7NA 1W5MA 3EDKA 1FXPA 1LLZA 1FX6A 1MVYA 2E67A 2C14A 1ODZA 5DMYA 3P0WA 4B9ZA 3SIZA 3CM4A 3O6DA 5CJNA 2QEZA 3E0LA 5HATA 3UGVA 3R94A 4C6KA 2E0PA 5DX7A 4LBUA 4DF2A 1RLCL 1JF6A 2Y7EA 3ABXA 1V7AA 3EPMA 4QHRA 3O0KA 2CZDA 4P5UA 4DJDC 2V0TA 1E51A 1XL9A 2PDFA 4HOWA 4BF9A 3SO7A 3WJZA 4AWTA 4B5TA 4UTJA 1EJRC 2OQHA 2QCHA 1IT8A 2ISSA 1HVXA 2G3JA 1OX5A 3BW3A 2VNCA 4QAIA 4OHQA 4L4PA 1QATA 3APGA 4BQ5A 5FJTA 4D6EA 2NSXA 4AEEA 1HGWA 3W7QA 3UPMA 5LNVA 1VYSX 1WAWA 1UQZA 1OFOA 1HKMA 3QLLA 1G4TA 1LP6A 5HWNA 3P5YA 1UR2A 2VP8A 3K13A 4MWAD 4UMCA 2ZZ5A 3EPNA 4FR1A 3LD5A 1DXIA 4ZE5A 1UUQA 4GIEA 4E8DA 4OUEA 4XB3A 1UKPA 1BVZA 2BHUA 1JRBA 1LUCA 2XSBA 4F8XA 4DWSA 1UBSA 1XS2A 2UWFA 3QHNA 1YNYA 1VBHA 2VEFA 3QTGA 1S2CA 5BRBA 3PTDA 1EGMA 3CUIA 1RZMA 4MNKA 1W9UA 3ORWA 1P5BA 4IG2B 4UMBA 4L1GA 2FTYA 5E0CA 1TV8A 3ARZA 2G8ZA 1RAKA 3BOLA 1EHAA 4GH1A 2Q3RA 1FXQA 2XVKA 3SECA 1OF8A 2PLKA 4XO6A 1V3JA 4Z17A 3R10A 4DBUA 1JPHA 4H6KA 1E0UA 4AF0B 1OSEA 1NOUA 4QSHA 1EJVC 5AYBA 3F4CA 2VDGA 1AMYA 3VDBA 1W0MA 4IIDA 3G2GA 1ADSA 4GABA 1GGOA 4XTIA 3ISIX 2PDGA 4MZYA 2WB5A 4AQLA 2Z7KA 1EGZA 2AKZA 1MW2A 2GWNA 3QGVA 3W6YA 1RJQA 1OC5A 1IEIA 2VFGA 5DXXA 3LSCA 1BG9A 3B8DA 2OJPA 3AYSA 3ARYA 4NT0A 1Z3NA 2QXWA 3FKKA 4BF7A 3C0QA 1G1YA 3E0IA 3W2NA 4AYGA 4KERA 2ZXQA 2R24A 4DZIA 4RDWA 3EEZA 1RBLA 4G1NA 2GL5A 4LVGA 1D7KA 4S3KA 2PDBA 3H70A 1W91A 2DT0A 3K30A 3TIMA 3EGJA 4I8YA 3GIPA 3S1WA 3GRIA 3DESA 1PTDA 1EWDA 3WBXA 2WSKA 2J6VA 3P82A 4YVXA 2YW4A 1W2PA 3NNTA 4CVWA 4RLIA 1GVIA 2PDHA 3ZT6A 3CXOA 3EOEA 3HPZA 2DQWA 1W1VA 1YDVA 2EG6A 1GOWA 2VEMA 3UY8A 1KV5A 2J8GA 2W62A 2YXGA 3OVRA 4LVFA 3GVGA 3Q67A 2GVGA 1GVRA 2A3BA 1Z6KA 3S2LA 1NIUA 2XH0A 3SY5A 4IM4A 1YKWA 2WWCA 4Q8UA 3WJYA 1IE7C 4ATWA 2G4JA 3XISA 1K1DA 5E9AA 3NL3A 2PDQA 4WDUA 2Q02A 1WO2A 3LCHA 1H1YA 4PTNA 4TX8A 1YTDA 4B90A 3NSMA 4YJ5A 3CO4A 2PWDA 4H83A 4K8HA 4W9TA 3R8HA 5CBJA 5C7HA 4RE4A 1EQPA 1JULA 1XP3A 4JQ3A 2PP0A 2V5KA 3A3HA 5FJRA 3VOGA 3AISA 4Z2IA 3P60A 1FWFC 4UB9A 1GVEA 2V5CA 1ITQA 2QAFA 1CBGA 4PL1A 4RNFA 2F61A 1NP0A 3VOJA 4XD3A 2FJUB 2J77A 5L9FA 1G7UA 3FGCB 3LN3A 4DNMA 1CXFA 3NR0A 4ACZA 2ZICA 3USBA 3OGSA 3ITTA 1LL7A 3LX9A 1FUYA 3DGBA 1TTIA 4MLJA 1VJZA 4PTVA 1OG6A 1TV7A 1U30A 3ARTA 1X1ZA 4ML4A 1UA3A 3IRSA 3MMTA 4BKNA 1DHPA 1HTIA 1QI2A 2H3DA 4KGLA 3EYPA 1XPGA 4J3WA 3DYPA 2OKTA 4FB7A 4QFUA 4DUWA 3VZXA 3CL6A 3UW6A 5HAOA 4L9ZA 1KRCC 4C90A 1VCVA 1A50A 3TK7A 1F3WA 3TQKA 4E2BA 2B7OA 1W56A 4LANA 3RDKA 1OFEA 2GUUA 3N2OA 3UCQA 1XXXA 3LRKA 4DWDA 3HN3A 2OX4A 3UJEA 1RBOB 3T44A 4LEFA 1F3XA 3VPLA 1TJPA 1W31A 3OOQA 3AMDA 1ZCOA 3CIWA 2GJXA 2VEIA 4KCUA 4IUGA 4XZLX 2DP3A 1QUMA 4K36A 4ZO9A 3D3FA 1JXKA 4ZSTA 4MSSA 3PBUA 2WAGA 1AL7A 3VD5A 2OX1A 2VRJA 1MSSA 3NQEA 5FKYA 3ARWA 3MYPA 4MDPA 4ZQPA 3SB0A 3VKJA 1W9PA 4LAUA 3QPEA 4E3TA 5I3HA 3PPGA 4Y96A 1QVBA 2XGBA 4KF1A 1JFXA 4PB3A 3DYOA 1XBYA 3NG3A 4UTTC 3RCYA 2V82A 3W7PA 1JQXA 4HB7A 4DPQA 1X6LA 4GIRA 4NU7A 3DZ1A 2XIBA 4WJEA 4O15A 4Q4MA 1ZQ5A 1OINA 2QPXA 3GC5A 4M6PA 5IHSA 4FF5A 2RUSA 1J8VA 5LIKX 3QC0A 4Q4OA 5DQPA 1YPFA 3TYDA 1R86A 3YPIA 1ZAIA 1TZZA 3MI2A 5D9NA 5M03A 1J0YA 3M1ZA 1FWSA 3BICA 4S2CA 2FB3A 2F6XA 4JOMA 4G5DA 4B5XA 4MJMA 4HHLA 3PBMA 1XLIA 4E4FA 4LX4A 1M1BA 4S3DA 2POTA 1HXJA 4TVUA 1SFSA 3IIXA 5AOUA 1PHWA 3TDFA 5KZ6A 3TE9A 4JNMA 1IT7A 2OFJA 4LY8A 4A29A 4QJ1A 2B31A 3G1FA 4WXZA 9XIMA 4Y9PA 1PPIA 3DN5A 3WDPP 3A4JA 2W67A 3NPWA 3NL5A 2XPKA 3NQAA 4FOUA 4ZEPA 1BKHA 4L4LA 1QU4A 3TR9A 3WY1A 3GDLA 4HPGA 4IH3A 3AS0A 4QSFA 3WMSA 1W54A 3EB4A 1D3GA 1KQYA 1SU5A 3NO1A 4AZIA 4U2YA 5CEWA 2O92A 4JYDA 3L4UA 2DJXA 3SN0A 4LAZA 1Y5VA 1NH6A 3RPMA 1LORA 1XYLA 5CC3A 2HEJA 4NP7A 1A4MA 1VGAA 5HANA 2DUAA 3H7UA 4GUHA 4EACA 1EEXA 1DJHA 3VIPA 6ENLA 1SMDA 3LNPA 3HPAA 3HO8A 1E6ZA 4LUTB 2WNZA 4E38A 2GVYA 2Y8KA 4HU8A 2OSYA 1QPOA 5DEZA 4AFYA 4RCXA 3MS8A 4WUIA 2DZUA 3WJSA 4DBWA 4PULA 3PB2A 4Q8VA 4XD5A 5ENLA 3TOPA 2J66A 2EKCA 1QRQA 2DH3A 3R5EA 3KXQA 4GZIA 2FHCA 3N25A 1V3KA 1XBZA 1FHDA 1Z44A 4MMWA 4IGNA 4AZ5A 3TEVA 3O6CA 3ALFA 3H22A 2Z1BA 5EY5A 3NURA 3NZ1A 3UP8A 3BGGA 4F66A 1WYIA 3FKRA 2ZE3A 1SSDA 4Q3MA 4JHZA 2J27A 2Y7DA 3K1DA 3D46A 4M5PA 1BPLB 4PUMA 5EBUA 4MNMA 1SMAA 3T0BA 1T96A 3SW6A 1YPXA 4FXSA 3DC0A 4XSMA 2QUMA 3RITA 1QK2A 4CD4A 2PTXA 1XIEA 3Q94A 3G1YA 3A3XA 4WXYA 1ZLPA 3GXDA 2BFGA 1GVYA 4BHYA 1FWTA 2GQAA 4CCCA 4MFDA 3TSDA 3ZS4A 2ZA1A 4C7FA 4FOJA 3H4XA 1FCUA 3BJFA 3KP0A 2VELA 4CN4A 5HR6A 1F6YA 2HNHA 1GZJA 2BZNA 1PDYA 2FJKA 1BYCA 1UZHA 2QNEA 3GIYA 4KWWA 1K7EA 4QJ3B 3BAWA 3CPRA 3ITOA 2IKHA 1YDOA 3SRDA 2OLSA 1C3FA 1SW0A 3PS7A 4AHPA 3BAKA 5A8MA 4I5RA 4EOUA 4DEFA 1KCXA 3VI2A 3VOIA 5CQ1A 4LF1A 3KBWA 1F5ZA 2DVUA 4CQ9A 2YFNA 4C6IA 4NX0A 1QW8A 5BMXA 4QTGA 3DBPA 4QITA 1VH7A 4UR8A 3W1LA 4C6CA 3AU2A 3SRFA 2DH2A 2I57A 5IBXC 2VZTA 2ZDSA 1R85A 1GG0A 4PRWA 4H7CA 4US6A 4K68A 1AK5A 2XN1A 1RK6A 1OD0A 3DFOA 2OQLA 2UZ9A 3H2AA 3LCGA 3VE7A 3CZJA 3TC6A 5SWUA 3N6JA 3QSRA 3V5FA 2QF7A 1KW1A 2EEXA 3L65A 1M41A 2CESA 2JGQA 2D2OA 2JIWA 4GOAA 3HPSA 1TV2A 1XIMA 2IPJA 2Z0IA 3UZ5A 1MW0A 1SSGA 3WX7A 1V7YA 2NLIA 3P6LA 3AXMA 3ABQA 4MG4A 3DXIA 3ZYZA 4UTUA 3QMSA 1JZ7A 1R9XA 1S5MA 4LV9A 3DCPA 4OVXA 1CGVA 1VJSA 4HCHA 3LLFA 5CC6A 4I9TA 3ERPA 1TWZA 2C13A 4X3ZA 2PWEA 1RVGA 3FAXA 4MGGA 7ENLA 1DJWA 2YDAA 3HQPA 2X1SA 4NYUA 2R82A 3VNYA 1W17A 4U28A 3B9EA 4HCLA 4NX5A 4RZ6A 3TXVA 4C6QA 4AD3A 2GGIA 3CC1A 4DWSB 1EXPA 2J7FA 2A3HA 3O2LA 1K03A 2H9AB 2E6AA 4INFA 2QIIA 3V75A 1KCKA 4MJ2A 2WBKA 4A3HA 5ABFB 4NSBA 3MANA 3UG3A 1MWOA 2FGBA 3AMKA 1GJPA 1CXHA 3ZWSA 4LV4A 3CLWA 2ALDA 4MKNA 3AXHA 4W89A 3ECQA 4FHAA 4NZ1A 5HMEA 4E4UA 3W4RA 4IHCA 3TQ0A 2RDTA 4HSNA 4CU8A 1S2AA 1CLKA 2BDQA 4B3LA 4S3CA 4NIRA 1HF6A 5E6YA 2VR4A 4CNPA 4S23A 1BSIA 2ZUSA 1U5HA 2Y8VA 2IQ0A 3TYZA 2V3FA 4FNTA 4IFOA 1GCYA 1FCBA 3THQA 3CO8A 3AJXA 4HKPA 4LYKA 3VNIA 3G5EA 1TA3B 1DIEA 1KQZA 3EWZA 1H7XA 4N42A 5M2FX 5A94A 1HX0A 1W32A 2BY2A 2CBIA 5E70A 4N9BA 1CCWB 3GAKA 4JEJA 1JZ3A 3WD3A 3EMZA 1KGUA 4D1IA 2HS6A 3I6EA 5HMSA 3LCLA 1FHUA 3ARQA 4RE0A 4K7VA 1SFTA 2Y6ZA 1HJXA 4ML9A 1JPKA 1XM3A 3KCJA 4JTHA 3WLNA 1UP0A 4HNCA 1R9YA 2F38A 3EA2A 3AICA 4HN8A 1GVFA 4AZGA 4LOCA 5D02A 3LRMA 4BK9A 5BWFA 2H6RA 1XLBA 4GZJA 4J3XA 4H01A 3OIXA 5C2GA 1SZRA 1ICSA 1C92A 3VC6A 4IIEA 3K8KA 3F03K 5DT5A 4A3YA 2WM1A 2IKGA 3WMLA 3LPOA 1W3LA 1EX1A 2FFIA 1XR2A 4KWUA 1BGGA 4DUOA 3ZXWA 5KSWA 4L6HA 3W7IA 3MP5A 1Q85A 4NAEB 4Q8NA 3I6RA 1R47A 4AEFA 4S38A 5HOSA 3F4WA 1P1MA 1SW3A 3SJNA 3AUJA 3DFTA 3UY7A 4YYFA 5AYXA 3LPFA 3VKDA 3M0HA 4N6EA 6XIAA 5D37A 2ZTJA 2E25A 4URIA 3BLOA 4NILA 4O1BA 3NQDA 3MUZ1 3BQ5A 3W25A 3SCOA 2X0SA 4EK7A 5BXTA 2NXHA 1W9VA 1TTPA 3R58A 2D3LA 4KEZA 5LIWX 5I7GA 1V3IA 4NI8A 3WD1A 2WCSA 3KL0A 5GNYA 2FHFA 3WLTA 2A21A 4AY8A 5EBAA 1P6WA 4ATDA 2ZIDA 3LCWA 5K9CA 3UR8A 3PHAA 1H0IA 3TN5A 1GVSA 4HMCA 3WJWA 4AWEA 3WL0A 1XV8A 3LHUA 2J24A 1R7OA 2Q6ZA 4MIMA 3SM0A 4PMOA 5JH1A 3QMTA 1KXQA 2B7QA 5FAJA 4LC8A 1TQXA 1J0HA 4Z2LA 4ZQCA 3MO7A 3SUTA 4LPCA 1XWYA 4KEVA 4R7OA 1AL8A 2PU1A 3PK7A 3W86A 3C3NA 4NASA 3I10A 5BU9A 1EBHA 2ZUUA 4KRUA 5BRQA 4J7RA 4MYXA 1NEYA 1VBRA 1YLVA 4Q6XA 1F8MA 3H2EA 1UWSA 3V18A 4OGZA 4LJ3A 1RP8A 1W1TA 2FPYA 1B3VA 3LHYA 1CECA 2VOTA 1ZJBA 1KBLA 3QVQA 3AZTA 4IXXA 5CSSA 1DKWA 4FNUA 2ATSA 1ALDA 2EAWA 4X2RA 2PTYA 3ZWTA 3LQGA 5AC5A 2RH9A 3B0XA 3GHUA 3DFQA 3SFKA 3H7VA 2POZA 1VAHA 2AL2A 2IQTA 1TV5A 3KOXA 3W02A 2YKKA 1B3YA 5AYIA 3DHFA 4AY1A 1XHGA 2G5WA 3AC0A 1C9DA 4C6MA 2XZ9A 2PDLA 1PJ9A 2HWGA 4AC1X 3NL2A 1U1JA 1FH9A 5L6UA 1NWSA 2CU0A 1AA1B 2CW6A 1XSIA 4A8IA 4FALA 3WNLA 3L4ZA 3GDTA 1H1ZA 1GVQA 2EG8A 5K4ZA 4ZB0A 1Z48A 3G22A 4DZ5A 2D22A 1H2JA 2Y5JA 5FEZA 1CXIA 1DJYA 1EUAA 1EA0A 1OJXA 1ODUA 4A4AA