4UTUA

Structural and biochemical characterization of the n- acetylmannosamine-6-phosphate 2-epimerase from clostridium perfringens
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
229
structure length
229
Chain Sequence
GSSHHHHHHMLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRAQGVNDINEIKEVTKLPIIGIIARNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRKRPNGENVKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSVDFELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLMANNOSAMINE-6-PHOSPHATE 2-EPIMERASE
publication title Structural and Functional Characterization of the Clostridium Perfringens N-Acetylmannosamine-6-Phosphate 2-Epimerase Essential for the Sialic Acid Salvage Pathway
pubmed doi rcsb
source organism Clostridium perfringens str. 13
molecule tags Isomerase
total genus 87
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2014-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4utuA00
1LM1A 3GIYA 1OK6A 4HNUA 5F2LA 3P7YA 4DF2A 2QCGA 3W2KA 2E1DA 2P10A 4QM1A 1JQXA 5T26A 4JS3A 4DF0A 1ZAIA 4P2VA 1TV5A 3R89A 1UB3A 1PS9A 3CIXA 3LRKA 3OVQA 1XBYA 2E5CA 2EPHA 2QCDB 4O18A 2ZYFA 1X1OA 2ZZ5A 1D9EA 3PY2A 5CZJA 3W22A 1W5QA 2A7NA 3GDRA 1G4TA 3KVKA 3TA6A 4WX2A 5AYZA 4IXHA 3BV4A 1I45A 4Z1CA 3UWVA 3R8RA 3NG3A 3BW3A 4ZL1A 3EXRA 2QCCA 4NZFA 4BR1A 1LROA 5DBTA 2IQTA 4BWLC 4LS2A 3LGEA 4O4WA 4PH6A 3NL3A 4PEKA 4X2RA 3LV5A 3GR7A 5HMSA 2QUVA 1TO3A 1QOPA 3MW7A 4S2BA 3NAVA 3G8RA 3HO8A 1L6WA 1X7FA 4RZ5A 4JYEA 1QDSA 3LDVA 3GXTA 3UPWA 3VI2A 1GYLA 1FCVA 1W8SA 1FCBA 1O95A 5EMUA 4MUZA 3LBCA 1TPH1 4CQAA 3M6YA 2ZZ3A 2AGKA 3DI1A 4JX4A 4C1KA 2J27A 5LHFA 1PVNA 5EA9A 1MZHA 3G1FA 4I9AA 5K9CA 2XN0A 3ZR4A 3GK0A 5AN7A 1LOSA 3W1LA 1EUNA 4UTIA 4OT7A 3F4WA 4NJIA 4MYAA 1QAPA 1TJRA 4WY0B 3KRZA 4IPJA 4UFMA 1K8XA 1VCGA 2BZNA 2E5BA 3QJAA 3S1VA 1ALDA 3P62A 3ZFHA 3NL6A 1TPWA 4R33A 1ZNNA 5D2VA 2YDAA 2V2CA 1Q3NA 1KV5A 1LRQA 1FWSA 1H50A 4UFLA 3W87A 2QUTA 3LCLA 5K9DA 3F4NA 3DI0A 3LERA 4E0CA 3CIWA 4RV8A 2RDUA 1OF6A 3PWAA 4GJ1A 4MJZA 4WOQA 5DCDA 2DZUA 1KLYA 1K7XA 3MHFA 1E51A 2F7FA 3B04A 5SWUA 1XKYA 3IGUA 4DPPA 3W2JA 3NQ7A 1GYNA 2E77A 1SZFA 1ZY9A 4D2JA 1ZAJA 4MZ8A 3GLCA 3CWOX 3OA3A 2B7QA 2ZFAA 2QR6A 8TIMA 1YLVA 3PB2A 4FX8A 1X8FA 4P61A 4EF8A 3ZS4A 1LORA 4UTTC 1WX0A 2ZA3A 2VFGA 1K8ZA 5LNVA 3NQFA 1TMHA 3UWZA 4Q4KA 2PRMA 3BG3A 3TQKA 4JDBA 3QH2A 3R2GA 2C1HA 3KX6A 4U28A 1F73A 3M41A 4HSNA 1FUYA 5J5DA 3MYPA 1P0NA 4K8HA 3H55A 4U4MA 1CX9A 2Y7DA 3QSRA 1T8XA 3PF3A 1TPC1 4O14A 4NNAA 3DENA 3L5MA 3TW7A 1JRCA 3P5YA 1JJKA 3MHGA 4IGHA 3IIZA 4A29A 3TCEA 3OIXA 2YFOA 1AMKA 2HMCA 1SZEA 3EKZA 2XN1A 4ICNA 5IBXA 1H7WA 4DQWA 5FF0A 7TIMA 1H7OA 5LNRA 5D30A 1H7PA 2BWGA 4IJBA 3WK3A 1P1XA 3BGJA 4JTFA 3A22A 3SW6A 1QPNA 5AHNA 1QO5A 3OG3A 2WV8A 4QNEA 4DEFA 2B7PA 1SU5A 4O1DA 4N9BA 4GUJA 2NWRA 4FNTA 1CI1A 3S9YA 5DCBA 5KMYA 3NOEA 3TJXA 2PRHA 3UWUA 3G8EA 4K6AA 1QWGA 4K37A 5LSMA 4O17A 3HG4A 4MY1A 3TW6A 3A5FA 1NAL1 2X16A 3FLUA 3QM3A 1OYCA 2C18A 3I68A 3IRDA 3NQVA 2YFNA 1GQNA 1TTJA 4RKAA 3UXDA 2NX1A 2CLLA 2FPVA 2W6RA 5DXYA 4IMDA 2E6AA 3F1QA 3U8GA 3C3NA 4IPIA 1S3HA 1JUKA 3T44A 4BI5A 1WQ5A 4JYFA 1Q6QA 5FF4A 5L6UA 1OFAA 1R47A 4CQ9A 3STEA 3B0VC 3FEMA 3EXTA 4NX0A 5D33A 3SECA 4IX2A 1TCDA 4A2SA 1LBLA 1SO6A 1N8FA 1KBJA 3PSVA 4R53A 1XUZA 4E38A 3EWYA 2OT0A 2WSYA 3PUEA 4QNWA 1OJXA 2CWNA 1AW1A 3OBKA 3M43A 2A1YA 3O1NA 4XTIA 3G1XA 3HG5A 4LVDA 3LB0A 4BI6A 2RDTA 1EWDA 2X1RA 2ZQ0A 5AHMA 4A22A 1H7XA 4QISA 4GWEA 4FNRA 4IWWA 2Q3RA 4N2YA 1UCWA 3DKJA 4R34A 1GTEA 5DCEA 2NXGA 3NZRA 2YYTA 3O05A 1SO4A 3NQEA 1OFBA 3WFAA 4LV4A 3L5AA 2Y63A 4LT9A 4AWSA 2ATSA 3LXBA 1G4EA 4LU0A 5HULA 2JKPA 1DKWA 1F05A 2WNQA 3CEPA 3HG3A 1TRDA 3BPWA 3TQ0A 3HGRA 2X30A 4O28A 1W54A 1IXNA 1UUOA 4K36A 3SZ8A 3TUUA 4LS0A 4MFDA 2NXIA 2X2GA 1FWTA 1IXPA 1T99A 4ML9A 1H61A 4WZHA 1X1ZA 3Q58A 4HT3A 3SFKA 2VC6A 2QDHA 2CZFA 3OEXA 3IEBA 4AWTA 3C6CA 3P8IA 3M5YA 2P1FA 2OCZA 1ICSA 3IIXA 3W07A 4JTEA 1XUUA 4UTWA 4UTJA 3O06A 4JTKA 3TMLA 4PC8A 2C0AA 4ZZ9A 3LTPA 1DJNA 4TU1A 4UR8A 3PUOA 5AYXA 3OVRA 2FIQA 3D0CA 1I2NA 3AJXA 5DY2A 3W86A 1JUBA 1JCNA 2EGZA 3NO5A 1RD5A 4ZQCA 3L66A 4IX0A 1KTNA 1L2UA 3UD6A 1OK4A 5HR6A 1DQXA 3LHWA 1KFKA 1ICPA 3W70A 2G95A 4XKYB 2BXVA 3EX1A 1LOLA 1VQTA 2ZZ1A 2CLKA 1YXDA 3HIJA 2Y89A 3GDLA 1IXQA 3G3DA 4TIMA 3G18A 1VLIA 1ZENA 1EUAA 2B7NA 4XBSA 4J9JA 4PFMA 2DJLA 1KFBA 4NZJA 2V5LA 1VYRA 4Z1BA 1LBMA 3L0NA 3V75A 3GR8A 1DV7A 2NUXA 5F4XA 3HB9A 1P4CA 3NPUA 4Q32A 1OYAA 3FIGA 4BFAA 2HSAA 4FHAA 5D2WA 3LCHA 1GTHA 3KXQA 1YXCA 2YW4A 1KM5A 2QJIA 3N34A 2YSWA 3QW4B 1VH7A 3PAJA 4JTHA 5KINA 1YPIA 3NL2A 2DJXA 4Y8FA 3STFA 4GUGA 1G7UA 1ICQA 3YPIA 3EWUA 3LTYA 2X1UA 2CLEA 3QZEA 1NF0A 3EWZA 2JGYA 3TV8A 4JX6A 5I3GA 2DORA 3G1SA 3UWWA 3L67A 1A5CA 3TXVA 4CCDA 1FWRA 2VFFA 3K30A 3DFTA 3L0KA 3NL5A 3NNTA 2TYSA 3P8JA 2Y61A 3PG8A 4KFNA 3L68A 3W23A 1DORA 2VENA 2QCNA 3I7SA 1M7PA 1FX6A 1KFLA 1L6SA 1OG0A 3UWYA 2P0OA 1F7BA 2ZRWA 2QCEA 1QPRA 2FB2A 3P74A 3SGUA 1YYAA 1MXSA 1SZGA 3W7CA 2YW3A 3M1ZA 4Z1DA 4FNSA 4LUIA 3NEVA 5CPNA 3SI9A 4O50A 1GEQA 2FFCA 3O07A 3SSJA 5KTLA 1I2QA 2ZRUA 2H90A 2H8ZA 2Y62A 2WQPA 2XFWA 3KHJA 3N3MA 4NJGA 1PL9A 1TTQA 3H53A 2CLIA 2JBMA 4S1FA 3C2RA 3VE7A 1GT8A 5D02A 2OT1A 1BTMA 1KA9F 4UFHA 4LWWA 4TX9A 5D38A 4AF0A 1RQEA 1SW0A 2QCDA 4GC4A 4CCCA 3G1YA 1S5TA 4IMGA 4Y6GA 3VCRA 3LI1A 3W7EA 4LV9A 5FF7A 4NNBA 5H91A 1O5KA 3EEGA 1NF7A 4WQ6A 1L9WA 3G0XA 5E0KA 1QFEA 3KAOA 3LHZA 1G4SA 3E02A 4MLRA 1ZJIA 3DGRA 2UV8G 3G22A 1C29A 2E6DA 2B4GA 2C13A 2ATMA 4LY8A 3QMSA 5G4WA 1AW5A 4ZMGA 1OF8A 1ZHAA 3M47A 3EXSA 3PS7A 1QOQA 1W31A 3DFQA 2Y70A 4NXSA 4EF9A 5K9XA 4M7TA 1DHPA 3DFSA 3C2FA 3W76A 4MZYA 2ZDRA 4L4LA 3R13A 4JTGA 4BK9A 3O6CA 3CHVA 1UBSA 2YPIA 5D37A 5AOUA 3Q94A 3S42A 2F84A 3S1WA 1ME7A 3W1PA 4RR4A 5L9FA 1BKSA 1LLWA 2FPTA 3BK0A 1GWJA 2GPTA 3G0SA 2CW6A 4ADUA 3CB8A 3QF0A 1XI3A 4GUIA 3TJLA 4NX5A 3PBYA 4Z1AA 4ZQMA 3Q37A 1N55A 3NQAA 5D2TA 3GDTA 4JY8A 1TPUA 5BMXA 2V81A 3RLVA 1OFEA 3T40A 1A5SA 4IMCA 2ISSA 3UQNA 4O16A 4JTIA 4I7WA 4CNPA 3OHIA 1WBHA 4WUIA 3GXPA 4RZ6A 4MJMA 3LOTA 4M7SA 2ZTKA 4K39A 4K7YA 1W5OA 1O5XA 3R12A 3M0ZA 1LDCA 2JKEA 2V5BA 3IIPA 5CPLA 1W1ZA 4JIPA 1H62A 4M19A 3DU0A 3T78A 1AW2A 1M7OA 4HNVA 5FEZA 1Q6RA 5BRBA 4HN4A 2V82A 3UNDA 3DZ1A 4FIQA 3BW2A 3P5ZA 2ABAA 3HMJG 1KM3A 3HG2A 4M6PA 1H1YA 4KWVA 4GNJA 5CSRA 5EY5A 1VZWA 2GJNA 3ATYA 4O1AA 4OWGA 1OFDA 3NQDA 5K4ZA 3FJLA 5AC7A 4GUFA 3S8HA 3CTLA 2NX3A 3VFLA 3EWBX 3M7WA 2QCFA 3BLIA 4XUGA 4HNNA 1RQBA 1TV8A 3TC6A 3VKJA 4FXRA 1XXXA 1F5ZA 4O4VA 1AK5A 4UNLA 1DVJA 2C19A 2VEKA 3W1UA 4YCPA 1A53A 4WXZA 4GXMA 1Z44A 1GVSA 2A2IA 4LVAA 1H63A 3W7DA 6TIMA 3QFEA 3P81A 2GVJA 1FWNA 3NQ2A 5I3IA 4O15A 3GAKA 3LCGA 4DO6A 5K4XA 2Y7EA 4MOZA 2WO5A 4QQ3A 4GRSA 3W1AA 3DFOA 3W74A 2W79A 3P84A 3TK7A 1JULA 2WNNA 1WOAA 3IGXA 1K02A 3W2LA 3N9SA 1OVDA 4JTTA 3LCIA 4Z0JA 5FF3A 1QO2A 3USBA 5CZ0A 5G1TA 3NYZA 2DZPA 1VR6A 4EVZA 3RNDA 4AH7A 2J6XA 5HQEA 5IM51 2Q8LA 1ML1A 3CC1A 2VKZG 1V5XA 5CGQA 3UYCA 2WSQA 4DBDA 3FJ6A 1CW2A 1RPXA 1G69A 3FS2A 4BI7A 2X1SA 2R8WA 1GVOA 2DP3A 3FYOA 1N7KA 4DF1A 4NNCA 3STGA 4UMBA 4FXSA 1RZMA 3PULA 3SR7A 3HGOA 3W7PA 4RJEA 4DPQA 3L65A 4JTLA 3IIOA 3LCWA 2O7SA 3W7RA 3G1HA 4OE7A 4UFKA 2EAWA 4HSOA 1HG3A 4AWUA 3P80A 3GB6A 4O10A 1H1ZA 3MBDA 2TMDA 1KBIA 4LRSA 4HPJA 2ABBA 2VXNA 1LBFA 5H2ZA 5HUOA 1KM1A 3W1XA 4ZQOA 1I8JA 2X1TA 3QEZA 3BLFA 3W83A 1H7NA 4W9TA 1UASA 3L21A 2QDGA 3MYOA 5HWNA 3C2OA 1SR9A 1ZAHA 2CZDA 3T55A 1BWKA 3HPXA 2W0UA 4YL2A 4O57A 1YTKA 1ZALA 1GZGA 1SSGA 3ABQA 3W88A 2TPSA 4S2CA 1A5AA 1VLWA 3PG9A 3L2IA 3NM1A 4H6KA 1FCQA 2ZRZA 1R46A 2DU2A 4MPQA 2I9EA 2DZWA 3CQ0A 4XTDA 4ZQPA 4BF9A 3I6RA 3CWNA 1JCYA 4XQ6A 2VFEA 5LGZA 2J9YA 3B8DA 3B4UA 1HTIA 2GQ9A 1FCUA 3IVTA 2CLOA 1T0OA 3TSDA 3NQ6A 3VE9A 5CZSA 5FI8A 2C3ZA 1I2OA 2ZRYA 1TTIA 4CQ8A 4JICA 3GVGA 3N19B 4UC5A 3I65A 2Z1BA 4JEQA 4IQLA 2JKAA 3NPVA 1W3IA 4O0KA 3WK1A 1LTDA 1JCMP 2GVLA 5A8GA 3WK2A 2C6QA 4LOCA 4CNNA 3QC3A 5D09A 3PBWA 2QJHA 1XDMA 3A5VA 1J2WA 4C1LA 4B5NA 2YZRA 4JY9A 1R2SA 4DELA 4R7JA 4IMFA 5KZMA 4OHQA 4PL2A 1PIIA 1W56A 3W72A 3MP5A 2I1OA 5C54A 3O15A 3QRHA 3MI6A 2A7RA 2PURA 3BG5A 1T96A 1W3TA 4QJ1A 3DHFA 1YADA 1G67A 2ZZ6A 1TQXA 4GE8A 3NQCA 1MEWA 5FESA 5F2IA 5DLCA 3W7MA 2QF7A 2EF9A 1LRNA 5F2MA 1IGSA 3W71A 1KM6A 1A50A 4YCOA 4O54A 2V0TA 3ZWTA 5G2HA 2V2HA 4PA8A 1R2RA 5C6MA 2J9ZA 3GXNA 3TE9A 4ONVA 5AC6A 3ABSA 3QSTA 2ZBTA 4QITA 1TSIA 2WJZA 3FYPA 4OV9A 4PL1A 3PB0A 2OMAA 3UY7A 3EKLA 3W7LA 5ABTA 2BSLA 1YDOA 2EKCA 4UTWC 4I7VA 5I3KA 3PVFA 3TU9A 2E6YA 3NPWA 1P5BA 5FEPA 5LNWA 3G24A 2QJGA 5DN1A 1YDVA 3P67A 3W2UA 2VFDA 4WD0A 2NXHA 3IIVA 1OYBA 1Q6OA 2O7QA 3HPSA 4RCXA 3PR2A 1R2TA 4K8EA 2WNZA 1TREA 1C8VA 1VRDA 1KTBA 3LHYA 3I7QA 1ME9A 4JN6A 1OFQA 1TB3A 4Z0SA 4A21A 5I3JA 2DZSA 3LXCA 1LP6A 5AHEA 3TAKA 3QQ1A 3LLDA 2A4AA 2QCLA 4YWIA 4YMZA 1K8YA 1YTEA 4AVFA 2YR1A 5A5WA 5K3VA 2H8XA 1A5BA 2VELA 4A2RA 2J88A 3LM7A 3VNDA 4LTSA 5U7SA 4CNOA 4X3ZA 4JR5A 4HPXA 1VC4A 3DAQA 3G3MA 3TMQA 5E1QA 1OX4B 2G96A 1K3UA 3JR2A 3PC0A 2VEPA 5AHLA 2WSRA 4JX5A 1WV2A 2CFFA 4MY9A 5LKYA 1PE1A 4N6FA 4UFIA 5HUPA 1SO5A 1AL7A 3MJYA 3UZ5A 5GVJA 4AB4A 3NM3A 4E2DA 2YCEA 1H51A 2A0NA 1VCVA 2FPYA 4MVAA 4N4QA 3BGGA 5AHIA 4YLWA 2AQWA 3C2EA 3TC7A 3G1AA 3MMTA 2QKFA 2ZA2A 4OBTA 2TSYA 1ME8A 3LHVA 4MFEA 4GFSA 1D3HA 1JCXA 1K7EA 1VJIA 2CLMA 1J5TA 1LYXA 5CSSA 5G4EA 2PRLA 4LRTA 2ZTJA 3TAOA 3F03K 3G1VA 1UJPA 1TPFA 4JTUA 4JGDA 3CM4A 4IXXA 1JQVA 4AEOA 4E2BA 5KZDA 4FX6M 1XM3A 5D2YA 2QAPA 1PHQA 1IXOA 4JNMA 1L6YA 1W3NA 4ADSA 2A6LA 2NZLA 2QAFA 3HBLA 5D2XA 3TR2A 4UTMA 4FB7A 3GKFA 3TQVA 3E0IA 1TYGA 3C56A 3CEUA 5EPDA 2J24A 1U83A 1ZFJA 3A24A 4N6EA 2QCHA 5CKSA 2Y88A 4QSHA 3NZ1A 4UTUA 3N14A 1VS1A 3KRUA 2HTMA 2E6FA 2ZRXA 3W84A 4NXKA 3B05A 3NQGA 3QYQA 1WAUA 1JCLA 2RKXA 3OVPA 4LC8A 4X22A 3T4CA 2RHGA 3JRKA 3PM6A 5C5YA 3W7KA 4DO4A 5D32A 2GJLA 3AO0A 1F6PA 3W7GA 2ISVA 2DZVA 1AG1O 4N4PA 2Z0IA 5HR7A 1QPOA 2FB3A 1P0KA 4QIUA 5C55A 4XZ9A 5G2IA 1XFBA 3I7RA 4EWND 5TBOA 2OX1A 3FKKA 1YDNA 1GPWA 2J9XA 4NVTA 5DXXA 5D03A 4O53A 4O13A 2A21A 2GVGA 3RK8A 3BVJA 3SGZA 3B0PA 3BG9A 3TH6A 4WY0A 1M6JA 5BMWA 2YXGA 4UIOA 1NSJA 1YXYA 4AF0B 5K2ZA 1FBAA 3M44A 1B4EA 4I7UA 1KM0A 3GKAA 2G97A 5G2WA 4XWUA 1X6UA 1TRIA 1VYPX 3DKLA 1MO0A 4BWLA 3QPYA 1ONRA 2YYUA 1QNVA 4JD4A 3KOFA 3TKFA 4WOZA 3V1PA 4H3DA 1FDYA 3EX3A 1DJQA 3TIMA 1K03A 4ORMA 1S5VA 2CU0A 2E68A 3IV3A 3W85A 4NQ1A 1WYIA 3LRMA 1B57A 5U4NA 3LXAA 4TR9A 3CT7A 2R14A 3M5XA 4M5PA 2Z2UA 3LCXA 3LHUA 1O4UA 1QMLA 4KFPA 1XBVA 3EB2A 1OABA 3DBPA 3N73A 5EKYA 1KFEA 2DZTA 4ZQRA 1XDLA 1Q45A 3WJSA 3GAYA 3MI3A 4LC6A 1XL9A 1XBZA 2TRSA 4ZQNA 1THFD 1SW3A 1LRTA 3NR0A 2V30A 2Z6IA 4UMAA 4Z08A 3HOJA 4HHPA 3DXIA 3JS3A 3TNOA 3HQ1A 1J4EA 1LCOA 1RVGA 5F1VA 1BEUA 3E12A 3W2MA 1QR7A 2WPBA 3HJZA 1KTCA 4L4MA 3W1NA 3U6WA 3S5OA 2NLIA 2YX0A 3TXZA 4FNQA 3W73A 3C2VA 5J5RA 1FDJA 5G5IA 5D04C 3C61A 3O8AA 1EEPA 3LCFA 5E93A 2JK2A 3MWAA 1U5JA 2YGYA 4WJEA 3KFTA 4LVGA 3W6YA 1W0MA 2NV1A 1I2PA 4AXKA 3LV6A 5DY3A 5EL1A 5F4WA 3KVLA 3O6YX 3TROA 1QPQA 3GZ3A 2R94A 3NQMA 1TIMA 3W7QA 2A6NA 1WDWA 4UTLA 5C2XA 3P82A 2C14A 2NV2A 3GNDA 3UY8A 3MO7A 4UTTA 4CCEA 1EP3A 4MY8A 3CU2A 4X9SA 1M5WA 4MLJA 2RDWA 4TMCA 4K7VA 3MBFA 3IVUA 4N02A 1R30A 2DZXA 1I4NA 3PSWA 4O1CA 1FQ0A 3GDMA 3L0GA 1PV8A 3O63A 1EIXA 5AC8A 1SFLA 3S1UA 2QEZA 1RR2A 4N9DA 3SIZA 3ATZA 3SJ3A 4HIBA 2GQ8A 1OFPA 3B06A 1LOQA 4OV4A 3B03A 1SO3A 1RQHA 3MP3A 2E09A 3QW3A 1TPDA 4N9EA 3RF9A 1F74A 4UTKA 3ANYA 4Q33A 2KZHA 3FA5A 2OJPA 4UR7A 3RU6A 1C9DA 3TDFA 2PC4A 4LVFA 4MKNA 3LBMA 1Y0EA 4JTJA 3QQ0A 1G7VA 3W7NA 2NUYA 4HKPA 1DL3A 1VPXA 1EP2A 1O60A 1EP1A 2V8ZA 5HWMA 4LVBA 4OQVA 3S6DA 1GG1A 3WJWA 1EPXA 5IBXC 2A85A 3EWWA 3INPA 5HNRA 3HF3A 3CPRA 4O11A 1IIGA 1SPQA 4AHPA 1PCKA 3IVSA 1F6KA 1EA0A 3STCA 1W37A 3W7JA 2BLEA 3W7IA 5EYWA 1O94A 3NQ8A 1HUVA 5KSWA 1G4PA 2OZ0A 4WXYA 2CZEA 3LHTA 4FNPA 4O52A 2GQAA 4UXDA 1LLZA 1GVQA 1UUMA 4UFJA 2RH9A 3P61A 2XN2A 2QUUA 2WOQA 3S5NA 2FQIA 3PBUA 1KFJA 1RV8A 4RZ4A 3S5YA 2PE4A 4YXGA 5EBUA 1MEHA 2Q3OA 4RXGA 1V7YA 4GBUA 4FEZA 4KKXA 4RX0A 2VOMA 1TPEA 2FJKA 4DBEA 4RLIA 2NWSA 5CZTA 4DO5A 3KRSA 1OX6A 2B7OA 5G1YA 3C4UA 4AMAA 5DBUA 1HO1A 1PCWA 1K7FA 4O0ZA 3C8FA 1KW1A 3BLEA 4GUHA 1IIHA 3WJXA 1MSSA 1SUXA 3PUDA 1WBJA 2VFIA 3EWXA 1SW7A 3T7VA 3IGSA 5K7JA 1DOSA 4UNKA 1Z48A 1GVRA 3WJZA 4O12A 4EOUA 3E9AA 4NU7A 4JXCA 3BARA 2Y85A 3LTSA 2ZA1A 5FF2A 2H6RA 2G5WA 5HJLA 4WY0F 4PTNA 2FLIA 2C16A 4IMEA 3L5LA 2Y6ZA 5TIMA 1SSDA 4XKYA 3SY5A 4NJKA 2EHHA 1YTDA 1BWLA 4HNTA 2AAMA 3O16A 4DXVA 3RLUA 1F76A 1Q6LA 1VHNA 5F1UA 4IUOA 2Q8ZA 3N9RA 3NGJA 3W1MA 1GOXA 1KM4A 4POCA 5I3HA 3QMTA 1VCFA 3MI2A 3FKRA 6ALDA 2GOUA 4ADTA 1GVFA 3FFSA 4FX7A 1WA3A 2C15A 3E49A 5BW6A 1GJPA 1H60A 1XC4A 1G6CA 2CZ5A 4NUWA 5F4SA 2BX7A 1FY6A 3HGSA 1JRBA 2NUWA 4H4IA 3A9IA 3FOKA 1TJPA 4NT0A 5HINA 5MHBA 2VEMA 4JIQA 3W1RA 4OU1A 2Y7FA 3CLMA 3S0CA 4AAJA 4AHQA 3BW4A 3C0JA 3L9CA 2WKJA 1TV7A 2ZZ4A 1JR1A 4M6QA 1SFJA 5I3FA 3W1TA 3EX4A 1MEIA 1SZNA 3THQA 5LNUA 3RFAA 1AL8A 1WXJA 1I2RA 4NJJA 5LNSA 2HS6A 2ZCGA 3HPZA 1Z41A 5LZLA 4LUJA 1OX4A 3MHUA 1XBXA 3U2OA 4AHOA 1H5YA 3S5ZA 2CLHA 4RXFA 1VGAA 2VFHA 3W1QA 4IOTA 5D05A 3B0UX 1B9BA 2B0MA 5BNKA 5TQLA 1NFBA 3QMRA 1EX5A 5AB3A 3NVTA 2RFGA 1H7RA 3P60A 1JVNA 2ISWA 3QPZA 3DFPA 3WJYA 4N9CA 4XBKA 3ELFA 4MYXA 5AFDA 3UWQA 4O19A 1KV8A 3THAA 5DELA 3TFXA 1NEYA 3BO9A 3LLFA 3A21A 5FEWA 2FTPA 3M16A 2A5HA 3MP4A 5F2GA 2ZRVA 3DHDA 4UMCA 5BOOA 4M6VA 1TTPA 3ABRA 3R5EA 2HS8A 4OGZA 5CPOA 2ZZ2A 4FIRA 5AHFA 4LW7A 3TSBA 1ADOA 1DQWA 3GDKA 5CPMA 1ZCOA 4ORIA 5CG7A 4TMBA 5KITA 4LS1A 1OFRA 2D73A 1VHCA 5FEXA 1OX5A 3ZWSA 1YPFA 4A3UA 3H54A 1XCFA 4EIVA 4PCFA 3UPBA 3S1XA 1IF2A 4UTHA 1EWEA 3PBVA 4UCGA 2V2DA 2V9DA 3EX2A 3GYEA 2R91A 2FDSA 4TO8A 4ZVJA 1KLZA 4QAIA 5AYYA 3M5ZA 1FWWA 2CLFA 1B3OA 3O6DA 3TFCA 1VYSX 1EB3A 3HGJA 3LRLA 2VEIA 2H3BA 1DBTA 1HO4A 3TX9A 3RMJA 1W5NA 1FXQA 2PCQA 1Z42A 4LNYA 3NXFA 4PODA 4JTSA 1OFOA 3LX9A 3W9ZA 1LZOA 2JGQA 5LGXA 3G0UA 2GUUA 3GX9A 4O1BA 3Q2DA 2I14A 3KVMA 4Y90A 5LHEA 1FDZA 1W5PA 3N2XA 3UXAA 1D3GA 3W7HA 1TPB1 3E96A 4JDYA 2E5DA 3A23A 4RK8A 3NA8A 2Z6JA 1FXPA 2ZZ7A 3M9YA 5KZEA 3W2NA 1KFCA 4FO4A 2LLEA 1TPVA 2Y7GA 1SQ7A 2A7PA 1TQJA 4MIMA 1HFBA 3DFNA 4KFOA 1QCWA 2QCMA 1F2JA 4Y9AA 4KWWA 4FF7A 4G1KA 3G1DA 4FNUA 1WOBA 3LI0A 2NX9A 3NPXA 3UZJA 1PHWA 3WK0A 2H3DA 3M5VA 1HL2A 4MZ1A 3ABOA 3W75A 1S5WA 3N2MA 3W3OA 3EX6A 1OHLA 3W7OA 5HWJA 4O8RA 3KVJA 4Y96A 3TSMA 2BTMA 4K38A 2ALDA 1JUEA 1W5MA 3NDOA 4ALDA 1JCJA 4CLMA 4NJHA 4UUIA 1B4KA 4JYDA 1NVMA 3DH7A 3MUXA 1GG0A 3C52A 3GNNA 1KM2A
chains in the Genus database with same CATH superfamily
1LM1A 3UZXA 2CEQA 5F2LA 1TR9A 2Z4GA 3CQKA 3P7YA 4DF2A 4FP1A 2P10A 4IT1A 5T26A 3CL8A 4JS3A 3SCSA 4F2UA 4C6FA 3CIXA 2PA6A 3OVQA 1JAEA 1XBYA 5E6ZA 3V5OA 4O18A 1D9EA 3WN6A 1X98A 3W22A 3BANA 4UZSA 2A7NA 4H00A 3GDRA 1XFCA 3KVKA 4Y2WA 1UD8A 3BV4A 3KM8A 4LH8A 4N7QA 4Z1CA 2ZUNA 5IFPA 5A6TC 3R8RA 5BRPA 2E40A 3OBEA 1FKXA 2XDFA 1VFFA 5DBTA 3I4KA 3AUOA 4EWJA 4PH6A 3NL3A 4D71A 3WKZA 4CQBA 2PLJA 4C7GA 3A4XA 4JL1A 1E40A 3NAVA 5GNYA 3G8RA 2GJRA 4DJDD 3HO8A 5HJXA 2FYMA 1XKJA 3LDVA 4DUVA 1IT7A 4RZBA 1FCBA 1O95A 3VUPA 4KCTA 1NP2A 5A2AA 3LBCA 1TPH1 1ECQA 2ZZ3A 3WMCA 3WD1A 2HPIA 3BTNA 1LJYA 3DI1A 4NF7A 2GJPA 4C1KA 1HGWA 4KCWA 4Q6XA 1H4PA 1OSEA 3ARRA 3RPDA 1F8MA 3G1FA 3BSGA 3VOGA 3ZR4A 3GK0A 4OT7A 2OQHA 3B8TA 1EBGA 1QAPA 5XIAA 2FMNA 4WY0B 1W1PA 2D2JA 1K8XA 2QW5A 2BZNA 2WM1A 3DHUA 3MV11 1CXHA 4XVEA 3GNRA 3WH7A 4JTAA 1ZNNA 5D2VA 4JQ1A 4F79A 3TN6A 1M9HA 3VVGA 1LRQA 5K9DA 3DI0A 1O5RA 4LYKA 1VFMA 2PWHA 1OF6A 3WNKA 1UZ1A 3HFTA 4MJZA 4WOQA 3VNKA 2DZUA 3MHFA 3POHA 1NH6A 1E51A 4GQBA 3LSCA 1XKYA 3W2JA 3NQ7A 1P6BA 1FOBA 5GJPA 2E77A 2XTKA 1SZFA 2IUZA 3CWOX 3BV7A 3OA3A 1JD9A 2QR6A 3WBEA 4CU8A 1AUSL 3S6OA 9CGTA 5RUBA 3DC8A 1WX0A 2Z7KA 2VCAA 1K8ZA 3UWZA 2BS9A 1K4GA 4H04A 3KBJA 2ZXBA 4JDBA 4JEJA 2HE8A 3KX6A 1SZRA 3CUGA 4HSNA 4KEVA 1NTHA 3H55A 4U4MA 3QSRA 1PWMA 3PTMA 3CZLA 3WYZA 1OEPA 2ODOA 3P5YA 2QDDA 4IFOA 1XLEA 2OOFA 3MHGA 1PTAA 4IGHA 4GY0A 4GFIA 3IIZA 4OOZA 2XIOA 1AMKA 5FF0A 3LMYA 5FL1A 1H7PA 4IJBA 1V3MA 1FWFC 4JTFA 4BF7A 5H6HA 5AHNA 1DWGM 2QS8A 1OD0A 4QNEA 2POTA 2B7PA 1SU5A 2NWRA 3VDHA 4L5ZA 4D6CA 3NOEA 2J7DA 3TJXA 1Q7MA 4RE2A 2EXOA 4O17A 1Z9AA 3TW6A 1UWRA 3A5FA 3B8SA 1NAL1 2JQXA 5HDRA 3URAA 4IUGA 1FH8A 3KEHA 2HVMA 1RCOB 3HPFA 2OWXA 1TTJA 3N04A 4LUSA 2NX1A 1FA2A 2CLLA 3D6NA 3H2MA 2ICSA 4HMNA 4LBSA 4Z42C 3PFMA 4IMDA 2HNEA 1OBAA 1A80A 2PLMA 3U8GA 1WQ5A 3OLEA 5HMFA 4NKCA 5L6UA 1A0EA 1EJ7L 3EXTA 4PUUA 3U4FA 4A2SA 1N8FA 1WDRA 2XVNA 2HEJA 5JVLA 5IXEA 1VEPA 4PBGA 2OT0A 4QNWA 4MB1A 3OBKA 3E2SA 5CJNA 5JIWA 3G1XA 3SFWA 4KCVA 1C7SA 2RDTA 2X1RA 1H7XA 3F2DA 1Q66A 3M6DA 3BAXA 4JKMA 4IWWA 2Q3RA 5AVHA 4N2YA 1UCWA 3DKJA 3JZEA 2VZUA 4PUJA 4W8BA 4KEZA 4ZTXA 4GA8A 1SO4A 3NQEA 2Z27A 1OQFA 2W3ZA 2GFTA 2Y63A 4AWSA 1RCQA 4RUBA 2ATSA 3ZSTA 4QBXA 1KRMA 3OGRA 1M03A 5HULA 4W7WA 2JKPA 1DKWA 1MXGA 3HG3A 3VIJA 1TRDA 3TQ0A 2REQB 1GOQA 3UZZA 5CJMA 2PDLA 3W00A 3ITLA 2I16A 1ZP3A 1ZBKA 1FWTA 2PTWA 4JFUA 3WCZA 1H61A 3SFKA 1NARA 1HT6A 3MSDA 3M5YA 2P1FA 3SADA 3OIHA 1ICSA 3GU9A 3GWQA 1XUUA 2MANA 3LTPA 4UR8A 3R8HA 2R1MA 3D0CA 1I2NA 2G8ZA 2VRKA 3AS2A 1UWAA 2EGZA 1PDYA 3NO5A 2YXXA 5EMYA 3MPGA 2PC8A 1OK4A 4US5D 3QV8A 1NDWA 4GI9A 3AHTA 3A3XA 4AZ5A 1YXDA 4D6GA 2Y89A 3GDLA 2P0IA 3QV6A 5FJOA 3P0XA 1J93A 1A5MC 3G18A 3AUJA 1ZENA 2B7NA 4J9JA 1A0DA 2DJLA 3CUIA 3EWCA 5E09A 1UH3A 1TZZA 1CWYA 4IGSA 1IEXA 3L0NA 3SQLA 1DV7A 5F4XA 1P4CA 4Q32A 3R0KA 5D2WA 1GTHA 1YXCA 3PTQA 4JTHA 3E0WA 4LFYA 4Y8FA 1UROA 4IG2B 5FJJA 4GUGA 4E3VA 1V6WA 1G7UA 3FEQA 2VDIA 1EJXC 2X1UA 4WGXA 2F6XA 3EWZA 3G77A 6ENLA 1XYCA 4ZCWA 2DORA 3N29A 5H8PA 1FHVA 2XFYA 3WIJA 4MWAA 3K30A 3MDWA 3L0KA 1XWYA 3P8JA 2E9BA 4CD5A 3T0BA 2JEQA 3W23A 1DORA 4REQA 2YZ5A 4B16A 3WBXA 1F7BA 1UKTA 5DMLA 3SGUA 3O3RA 1EJRC 1MXSA 1SZGA 1X6NA 3W6MA 1XICA 3MSRA 4FNSA 3L4WA 3NEVA 3SI9A 1Q65A 1IWBA 4JQ3A 4Q22A 5CCZA 4C1NA 2WQPA 3KHJA 4S1FA 1FWGC 2JBMA 3CAWA 3AIBA 3PFRA 2BVTA 3VINA 3ZT6A 3VX0A 4TX9A 1SW0A 3LPGA 1TV2A 2PDMA 4BQ3A 1JNDA 1SMDA 1NF7A 4U5IA 4WQ6A 4H9MA 3G0XA 3MKKA 2Y8VA 4MLRA 3DGRA 3AHVA 4CNTA 4AWEA 3QMSA 4HYWA 5A6LA 4D6EA 3QY8A 3OQ8A 3UA3A 3PS7A 1QOQA 2VJXA 1BXBA 1QVBA 4X60A 1KQZA 4DYEA 1ADSA 4LF2A 3O2LA 4L80A 4MZYA 4FI4A 2VQTA 3EDEA 3VC6A 3U2ZA 1S2AA 3CHVA 1UBSA 1WCGA 3PZOA 5D37A 5AOUA 3CT2A 3BC9A 2V3EA 3S42A 3S1WA 3B8IA 1ME7A 3OJGA 3UCCA 3T05A 2FPTA 3BK0A 3M0JA 2CW6A 4ADUA 3CB8A 4LYRA 3QF0A 3TJLA 4GACA 1WXYA 1RK5A 4YVPA 5BYWA 1VJSA 3HFYA 1PKYA 1YPXA 3NQAA 4W5UA 1CLVA 5D2TA 2ZX7A 1TPUA 4X63A 5BMXA 1UWUA 1WPCA 3T40A 2BY2A 1EIBA 3H22A 5XIMA 3STPA 4XBJA 3VU2A 4ACZB 4M7SA 2ZTKA 3NGFA 1KXTA 1W5OA 3A3WA 3APGA 3IIPA 4IGMA 2I56A 4JIPA 1H62A 3BLOA 4KEUA 3KL0A 1A4MA 1F3TA 3LM3A 3OBAA 1ZS2A 4XD6A 5FEZA 2PP1A 4HZ6A 1EBHA 3Q45A 4Z2HA 5BRBA 4HN4A 3DZ1A 3HG2A 1JNEA 4WDWA 3DG3A 3IJLA 4D6FA 1VFSA 3BDKA 2XHYA 3ATYA 1NM9A 1M1BA 3HJEA 4GUFA 3V1HA 5LIYX 1H2JA 4OBRA 1V77A 3VO0A 3BLIA 1TV8A 3VKJA 1Y5XA 1E5NA 3N4AA 4RPPA 4O4VA 1JYWA 4UNLA 2C19A 4CD8A 2GVYA 1ZTVA 3W1UA 2EEXA 3V0UA 1PSCA 1PX4A 3GFZA 2J75A 4I3GA 4LVAA 6TIMA 2HPMA 3P81A 2GVJA 3LMZA 3GAKA 4DO6A 1X6LA 4MOZA 2WO5A 1Q6EA 3DFOA 3W74A 2W79A 3K8LA 4HJWA 1K4HA 3G6MA 3KRBA 1K02A 4Z0JA 1KWKA 5G1TA 1HGYA 3WQ5A 1UWTA 3NYZA 5DMMA 3JUGA 1JPIA 3AS0A 3NURA 3SAZA 1TVLA 2J6XA 5IM51 2Q8LA 4L64A 2VKZG 3T8LA 4JIEA 4DBDA 3F2BA 4WSKA 3FJ6A 4XO6A 1RPXA 2KX9A 2ZICA 1GVOA 4FXSA 4IMAA 3SCVA 3TCSA 1HKKA 1EX1A 1RUSA 1AJ0A 3IIOA 3LCWA 3GRIA 2CPUA 3G1HA 1DJYA 4OE7A 5JBDA 3GB6A 1ZRQA 2I7GA 3VDAA 1ZGDA 1KBIA 4E5TA 4GIYA 2ABBA 1LBFA 4Q4SA 1KM1A 3W38A 2PTDA 1CGXA 2VX7A 4IP4A 4XUYA 1F07A 4HU3A 1SR9A 1QI0A 3T55A 3HPXA 1CGTA 2W0UA 3ZMRA 4PTMA 3EKGA 3ZT7A 3UPMA 1ZALA 4GI8A 3ABQA 4EPBC 3U2CA 4GVHA 2TPSA 1ENUA 3L2IA 2ZUWA 3P93A 3CQ0A 4XTDA 3VK5A 3I6RA 3B8DA 3GZAA 1HTIA 3K13A 1FCUA 2CLOA 3TSDA 3VKDA 1LWHA 5HMEA 3EOLA 4F9JA 3RIKA 5FI8A 7REQA 2P8CA 2ZRYA 3CQHA 4JICA 2YLLA 2YDRA 1EPVA 3N19B 4UC5A 2Z1BA 3S4TA 1HVXA 4IQLA 2JKAA 3NPVA 1W3IA 2J7HA 1NQ6A 2FVKA 4LPCA 2CC0A 3WK2A 3N9KA 3MC5A 3QC3A 1V79A 1UZHA 4C1LA 4JY9A 4C6NA 2IXVA 4IMFA 3MMWA 2W5FA 2J8FA 2W92A 1BXNA 4NIRA 2INZA 2J6VA 4HA4A 3E0LA 3H7VA 4QAWA 3VIFA 5C54A 3PHAA 3MI6A 1LL4A 2A7RA 1CXEA 3GIPA 1YADA 5I3DA 4AC1X 2G3MA 3N4EA 5I03A 2XGBA 2QF7A 4A6GA 2EF9A 4ZE5A 1A47A 1YNPA 1A50A 1V4YA 3ZWTA 2CWXA 1DTNA 4PA8A 1R2RA 3TE9A 4DJFD 3QSTA 3WEMA 3WLKX 3FYPA 4PL1A 1KCKA 3UY7A 3W27A 2Y24A 1S1PA 2BSLA 2EKCA 4PCPA 4ATDA 3KOXA 5I3KA 4YVXA 3TU9A 2E6YA 1BQGA 3WQGA 1P5BA 1D7FA 3VGGA 2QJGA 4F0SA 3GTNA 1BQCA 1JDEA 3EWDA 2NXHA 3IIVA 3QOKA 2Y8KA 1R2TA 2YDQA 4BY3A 3VOHA 4GVGA 4JN6A 1HJXA 4QDWA 1JGMA 3N4FA 3DOPA 4OFCA 1E3XA 3RRAA 2HXTA 3W53A 4W86A 3PJWA 1X1NA 3CLWA 2QCLA 1XV8A 1F4HA 4TOQA 1VIWA 2L5HA 5A5WA 3S47A 2VELA 4A2RA 4F4RA 2J88A 1CXIA 3KCJA 3WZ0E 4LTSA 5U7SA 5FOOA 2WHLA 4JR5A 4KS0A 5CC5A 3WQVA 4H7ZA 2ANUA 3JR2A 2O56A 1EJWC 5LKYA 4N6FA 4UFIA 3SIMA 3UZ5A 4M0XA 3R7MA 5GVJA 4AB4A 2PDHA 1H51A 3UZYA 3BGGA 5AHIA 4D9PA 4L61A 3GG8A 4B4FA 2VR5A 3BAJA 3UG3A 1HIZA 4GFSA 1XLBA 1D3HA 1Q6CA 5CSSA 2PRLA 1P0BA 2ZTJA 4HOWA 1UJPA 1R5YA 4GLEA 4WR3A 4XSMA 3CM4A 3MTWA 1OZMA 3CJPA 4FX6M 2ON3A 1SJAA 2PSNA 2Q09A 3TR2A 4UTMA 4FB7A 3GKFA 1MRAA 3SCTA 4OVXA 3T42A 1TYGA 4U10A 5AECA 4DN1A 3CEUA 5EPDA 1EZ2A 2YCLA 1PX3A 2JF6A 4PB5A 2QCHA 4YJ5A 2HK0A 1E56A 2Y88A 1MDRA 1XLGA 2BY0A 2ZRXA 3N2TA 3EDDA 1JCLA 4X22A 3RM4A 4H01A 3AS1A 3FSUA 1T41A 2J8GA 2QYGA 3CIVA 2GJLA 3AO0A 1F6PA 2ISVA 3GW0A 2IW0A 5ECUA 3ZR6A 1BTCA 2PU0A 4N4PA 2Z0IA 5HR7A 1QPOA 1VBJA 2FB3A 4QCFA 4ZFMA 3THDA 1HJVA 1E15A 4EWND 2AOSA 1R7AA 2Y5SA 3FKKA 2D3LA 4WDTA 1IR2A 4LCQA 1FWEC 4O13A 2GVGA 3SGZA 1E0TA 3BG9A 3FA4A 1M6JA 4KIEA 4WY0A 1AODA 5BMWA 1NSJA 1YXYA 2G3IA 4KGLA 1A5LC 1VRXA 1B4EA 3M44A 4Y8EA 4I7UA 1REQA 4G2DA 3VIIA 1X6UA 4HZ8A 1RJPA 3E3HA 3DKLA 3W28A 1MO0A 2V5JA 5AVNA 1H11A 5HQMA 3WQ6A 1HKVA 1ONRA 3QVQA 2A3LA 4DZ5A 4MTVA 5I78A 4IZGA 3WH6A 2EPMX 2Q8XA 4US6A 1FDYA 1KR1A 2PB1A 1C9WA 1KD0A 4AD0A 3TIMA 1K1DA 2CU0A 2VD9A 1L6FA 1KXVA 4NQ1A 4JQAA 1KWGA 3CT7A 2R14A 3M5XA 4M5PA 3GYCA 1UKQA 3WF1A 4HA0A 1O4UA 1EC7A 8XIAA 3KBNA 5EKYA 2WKGA 4ZQRA 1XDLA 1Q45A 3L12A 4LC6A 1KBLA 3PZUA 3IPWA 4PUWA 3FN9A 1S46A 3TZNA 3AYVA 4QEHA 4CQCA 3NZQA 3L2LA 4UMAA 3DXIA 4P7NA 4S3DA 4PYSA 2PDCA 4DXXA 3E12A 4UQEA 4CU6A 2R82A 3U6WA 1K9EA 2PDYA 1EF2A 3TXZA 4FNQA 3OZPA 1ODZA 3C2VA 1FDJA 3AC0A 3ITXA 1A3XA 3I6EA 3LENA 1CENA 5ABFA 1DWHM 1PYMA 4GI6A 3W6YA 2F6UA 1I2PA 3CK5A 1XYLA 1VBGA 5BXPA 4DNMA 1R9YA 3O6YX 1MQQA 1QJWA 1WDWA 1VFUA 4RV3A 3P82A 2XH0A 2VCCA 2C14A 5C9ZA 3AU6A 4LYPA 4CCEA 3KOWA 2DVUA 1EP3A 4X9SA 3CU2A 3GXMA 4MLJA 4WGHA 3MO4A 2DZXA 2ACUA 4UQCA 4O1CA 3AIVA 1PV8A 3O63A 3UGVA 3S1UA 2QEZA 2GGGA 2CZVA 4EKJA 1QNQA 3UEQA 2Z1SA 1VP5A 4HIBA 1OFPA 4GKLA 3B06A 4NI8A 3B03A 1UIPA 1TPDA 4N9EA 2XFFA 4H9UA 4UTKA 4FS9A 3QGAC 2WVUA 2OJPA 4DAIA 1QW9A 1IWAA 4JTJA 3ARQA 3T1GA 4HPGA 5GQBA 4W84A 3BMWA 1EP2A 5T9BG 5HWMA 1VFTA 4FSAA 2IKGA 1U30A 4QG9A 3LQLA 5EB8A 1J01A 1W9UA 1CDGA 4LAMA 4U2YA 3RR1A 2QGHA 5HNRA 1FRBA 2FVMA 2XGIA 4O11A 1BD0A 4UOQA 4AHPA 1MMFA 1SM9A 1PCKA 5DF0A 4AG0A 2QHAA 3UXKA 1KKOA 5EYWA 1HUVA 3LHTA 4F66A 1JYNA 4UXDA 1LLZA 1P7TB 3P61A 2V38A 1E9LA 3PBUA 3OYZA 3WDRA 1RV8A 4RZ4A 3S5YA 4GBDA 1J96A 1EYWA 4GBUA 4JL2A 3VYLA 4RLIA 1OX6A 4MGGA 2P5NA 4D6DA 4C6OA 3V0TA 1K7FA 4KRUA 1HN1A 2ZC8A 4GUHA 4C7DA 4IIFA 2UY2A 5FD0A 3OZMA 2A3HA 4DJEC 3QR1A 2OWCA 3EWXA 1SW7A 4EXQA 3IGSA 2FHBA 3CZEA 3FHQA 4XAPA 1Y5WA 1GVRA 4F9DA 3BARA 3LUTA 3DG7A 3LTSA 2ZA1A 5FF2A 3KZPA 1W2PA 3VAVA 4WJ8A 5C2GA 4R85A 4W4QA 2C16A 2ZUUA 3A4AA 3L5LA 3MQTA 5TIMA 1QASA 3SY5A 3N6JA 1IZKA 4GOAA 3NUKA 1BWLA 1POKA 3O16A 3BCFA 4DXVA 4RL3A 3S2LA 3N9RA 4LEFA 3W1MA 1GOXA 4UTFA 5AYBA 2P3ZA 1WNOA 4KCUA 1ISVA 2GOUA 1YKWA 4PSPA 4KWOA 2C15A 1GJPA 1H60A 1GZ1A 2CHNA 4YTQA 2CZ5A 5TD4A 1EC9A 2BX7A 1FY6A 2PF8A 3VILA 1LQ2A 1TVNA 2FTWA 3V35A 3LBOA 3CYJA 4FOUA 3W1RA 4OU1A 4QFUA 3MCNA 3S0CA 4J28A 3BW4A 3C0JA 2WKJA 1E4MM 3T07A 1JR1A 1SFJA 1Q4NX 4MDOA 1FKWA 3EB4A 5DO8A 5M2FX 3S3GA 2OB3A 3THQA 3R1ZA 3EBVA 2YB1A 4NJJA 3B9DA 3S2NA 1RY8A 3HPZA 5LZLA 4LUJA 1OX4A 2DW6A 4W88A 3U2OA 1CLXA 1AJ2A 1QNSA 2CLHA 3PTKA 5LXEA 4IOTA 3UG4A 2A3CA 1NFBA 1AQMA 2EPNA 1XIBA 3P60A 4KH2A 3QPZA 4M6UA 1FHUA 3DFPA 1W1YA 1QUMA 5G1MA 1L8PA 4IIBA 3DBNA 1PTGA 4DM2A 2F61A 4X9YA 3NXLA 4CN1A 3BLKA 2QV5A 4GY7A 5REQB 4M1BA 1QRQA 4FALA 2DUZA 5FEWA 2GOKA 3M16A 1FWIC 2X8RA 1M3UA 4C6EA 1EHAA 4YVVA 3DG6A 5F2GA 4QTGA 2BV9A 4UMCA 4M6VA 1OT1A 5CPOA 2ZZ2A 4LW7A 2OEKA 3TSBA 3RAOA 4XSLA 1CGWA 3VM5A 3ZSSA 2PCEA 6CGTA 2I5IA 2D73A 3AMGA 3EOOA 1OC6A 1XIJA 4WSJA 4A3UA 1XCFA 2ALRA 3UPBA 2R1NA 1EWEA 4PULA 1WXZA 2V2DA 2V9DA 3AIWA 1R3RA 3TLQA 1EJTC 2PZNA 1RLDA 1MWOA 1VYSX 3U2EA 1WE5A 2H3BA 5I77A 4P8WA 1VF8A 3TX9A 4QS5A 2Q01A 2BHUA 2D0GA 2W27A 1NOFA 3PZVA 2X09A 1TUFA 2ZX9A 5EMJA 2DVTA 3VMPA 2JGQA 2I14A 1DJIA 2G0WA 1W5PA 3UXAA 3SDOA 4DVOA 3MUCA 1Y8BA 3E96A 1GVEA 1FXPA 1FWJC 2E9LA 5EMMA 3VZXA 3GFXA 1TQJA 1HFBA 3TP4A 4KFOA 1XIDA 3ARYA 4Y9AA 2PDPA 4JPGA 2BMBA 3AHZA 4KWWA 3T81A 4OKDA 4FF7A 4G1KA 2DFAA 3LI0A 3IK4A 4EXBA 3UZJA 1H09A 3CXOA 2H3DA 3M5VA 5D8WA 3ABOA 4KESA 4ZE4A 3W7OA 2XH2A 2TODA 3RITA 1JUEA 1W5MA 3H2EA 4CUCA 4ENLA 1S5MA 1B4KA 4V15A 1FWCC 2YLAA 2AQOA 1KQYA 3WD3A 2GGEA 3GIYA 1OK6A 1IHIA 1RJQA 4BZYA 2QCGA 1AFSA 2O55A 1JQXA 1J10A 3E2VA 1TV5A 3VNLA 4V1XA 3LRKA 2PDGA 4LNCA 2D20A 2QCDB 2DY3A 2WMIA 2ZYFA 4HOZA 2ZZ5A 3PY2A 3L4ZA 1GNXA 2VMFA 4MSSA 1G4TA 3MB9A 1LL6A 3TA6A 2CNCA 3NG3A 1YW1A 4A8RA 3BW3A 4IJCA 1UR9A 3EXRA 2QCCA 4ZODA 5C7VA 4NZFA 3BQ6A 1LROA 4BWLC 2IQTA 3V5FA 3N13A 4LS2A 3LGEA 4O4WA 4AY1A 4X2RA 1TO3A 4MKVA 1D7KA 1L6WA 3LQGA 4RZ5A 4JN8A 4HCHA 3VIOA 5JBEA 2P88A 5CAHA 4E8DA 1DYSA 4PUEA 4CQAA 5JU6A 1E71M 2VZOA 4JX4A 1BF6A 3D47A 1PVNA 5LHFA 5EMLA 2YBVA 3AZSA 1E9YB 1O1ZA 5AN7A 1PKLA 2FTYA 2R6OA 4UTIA 3KTXA 4NJIA 4MYAA 3AZRA 1XLIA 5JMUA 1TJRA 3KRZA 3E5PA 4UFMA 1W2VA 1EDGA 3BAIA 1HZYA 1VCGA 3QJAA 1Q6GA 3DHPA 1ALDA 3NL6A 1TPWA 4R33A 3ZQ9A 4ATLA 2V2CA 1KV5A 4UFLA 2BOFX 4HMDA 3RN6A 1CXFA 3CIWA 4RV8A 4PMOA 2MUCA 3C5QA 3PWAA 5AYIA 1Z7AA 1K7XA 3WLIA 3M0IA 5HPOA 3CTTA 1GYNA 2D2HA 3EEZA 1CXKA 1JYVA 1MNZA 4D2JA 1WP6A 1V02A 1YLVA 2OELA 4FX8A 1I0BA 1ZB5A 1F8IA 1HKJA 1XHGA 2ZA3A 3U0HA 2VFGA 1IGWA 3TQPA 3N2CA 3JU2A 1NDZA 3BG3A 2DZAA 3TQKA 1DJXA 3R2GA 2E67A 2C1HA 4JQ2A 2O9RA 2WYSA 1ZPTA 1GOIA 3MYPA 4W85A 3ZZ1A 4K8HA 2WBKA 1CX9A 3A64A 1T8XA 4UCFA 4O0QA 1WKEA 2VC5A 4I6KA 3IWPA 1TA3A 2DSUA 1N2VA 3L4XA 4AFYA 4A29A 3TCEA 3OIXA 2YFOA 3I10A 1XW8A 1SZEA 5D9MA 2NQHA 1YRRA 5IBXA 4YTTA 1FFRA 1H7WA 4TX6A 1AQ0A 5LNRA 1KO0A 2GUBA 3TN4A 1TELA 4CD4A 3AYTA 5A6KA 5CLWA 5CSUA 3OG3A 5MKGB 4GY1A 1ITXA 4DEFA 2QV4A 4N9BA 4GUJA 5LIXX 4KEMA 2CLPA 4DXKA 3LEPA 5JH1A 2IS7A 1GQLA 4FLSA 4K37A 3V3WA 1DJGA 2X0YA 1Q13A 5I23A 3EMZA 2DEPA 3NQVA 3JVAA 2E28A 2FPVA 5DXYA 3PPFA 3W29A 2E6AA 4C6IA 4FLOA 3WY1A 7TAAA 4IPIA 1S3HA 1JUKA 2GVEA 2QVNA 3HN3A 4JYFA 3XISA 1UP3A 4FLRA 3TWAA 1TCDA 1WKYA 4KT2A 1YBQB 1S1RA 1KBJA 4HU0A 5A6SA 4PB3A 4R53A 1XUZA 3EWYA 3WLSA 2WSYA 1AW1A 4G9PA 3HG5A 3LB0A 1AA1B 4BI6A 2WVVB 1WAWA 2FHFA 4DYKA 4A22A 1UD4A 4IP5A 4GYPC 2W63A 4FNRA 4L1GA 3K4WA 2J7BA 5DCEA 4JFVA 4H2CA 5CC7A 4H6RA 1MW2A 4YWSA 1XLLA 4BCEA 1KXHA 3NSNA 1G4EA 1R8LA 3UA4A 4LU0A 1F05A 2G50A 4Q8NA 2XVPA 1NP0A 1IXNA 4AEFA 1UUOA 3S83A 3SZ8A 2DIJA 4LS0A 4ZO7A 1EXBA 1T99A 2V67A 4ML9A 3OA5A 4HT3A 1S2VA 2VC6A 5FAGA 2QDHA 3OEXA 4I8YA 1GOMA 1BXCA 3W07A 4AY8A 3CHDA 1IZCA 3EA3A 2C0AA 1DJNA 5AYXA 4RNFA 1ISYA 3OVRA 2FIQA 2AMGA 5DY2A 4HA3A 1RD5A 4IX0A 2GYIA 5CBBA 1EJUC 5HR6A 2OODA 1KFKA 1OIFA 1ICPA 3W70A 2G95A 4XKYB 2D1ZA 1PDZA 3EX1A 2IPJA 4XK2A 2Y2WA 1LOLA 4XB3A 2CLKA 4RNIA 3SGGA 1J0JA 1KCLA 1TWWA 4WSHA 4TIMA 4DBSA 4DJDC 1MNSA 3KOYA 4XBSA 3M0HA 1VYRA 4JFSA 3GR8A 2NUXA 1OYAA 2XIJA 4BFAA 1XLCA 5GPRA 2YIHA 3QW4B 3UBPC 1VH7A 3KWXA 5KINA 1IWPA 1YPIA 3NL2A 2O92A 3STFA 1O6IA 5C70A 3YPIA 5CPSA 1D3CA 1KNWA 1UOKA 3LTYA 4NL1A 3QZEA 3PBMA 2JGYA 3AIQA 3TV8A 4JX6A 2J8TA 3L67A 1FWRA 2VI0A 2J7FA 3DX5A 3BWWA 1U1HA 3WLLA 2Y61A 6XIMA 2R9RA 3HV8A 4PUMA 1EOKA 3I7SA 1M7PA 1L6SA 3UWYA 2QIIA 2ZRWA 3UJEA 1QPRA 2FB2A 4AUBA 2ADAA 3W7CA 2PP3A 2YW3A 3THCA 2ZXAA 2AMXA 1W9VA 3SSJA 4QDMA 5KTLA 3WLOA 2H8ZA 1V0KA 2Y62A 2BVWA 3IARA 1PL9A 1TTQA 1V51A 4NJGA 3VE7A 4Z1YA 4DJED 2OT1A 1LG2A 4PBFA 1KCZA 3CS2A 2F38A 1XRTA 1PKMA 2CETA 3ARUA 3LI1A 1PWLA 3W7EA 4ZBCA 5FF7A 4DBUA 1DWJM 4H6QA 4NNBA 2HBXA 1RSCA 3EEGA 2NV9A 1L9WA 5E0KA 2X1IA 3LHZA 1G4SA 1ZJIA 2YCJA 3GXFA 1MQPA 1C29A 2B4GA 2GDVA 2BASA 3CV7A 4U33A 2NVAA 5G4WA 3H2AA 1GHSA 1ZHAA 1DIKA 1J79A 3K46A 2Y70A 2C7FA 3KCLA 4V1YA 1DHPA 2P50A 3BXWA 2VHLA 4L4LA 1VEMA 4PBEA 3LZ5A 1DE5A 2WHJA 3R13A 3M0YA 4JTGA 4BK9A 4AIEA 4IIGA 1GONA 3QXBA 2OLAA 3VCNA 1X96A 4RR4A 5T91A 4NAEB 4DY1A 1OINA 2PDWA 2GJXB 3IUHA 4DWSD 4Q4MA 1HJWA 1PEZA 4XZLX 3PBYA 4ZQMA 4HQVA 4IH3A 4EACA 1Y7VA 2GK1A 4ZOCA 2ZWZA 1IEQA 3GDTA 3FY1A 2OYLA 3SRDA 3VFCA 4F2BA 2W4XA 3WNNA 2ISSA 4JTIA 3WQCA 1UC5A 1YX1A 3LOTA 4AD1A 1UMYA 4JHMA 4K39A 1J6PA 3UU0A 1O5XA 4QE5A 1LDCA 4JNYA 5CPLA 4ECLA 3BAWA 1W1ZA 1UYQA 3DU0A 1ZQ5A 1AW2A 1M7OA 2QJJA 4JIIX 3GHTA 2BP1A 3K8MA 4J3VA 4H9TA 2XVKA 3BW2A 3P5ZA 3HMJG 1KM3A 3DYPA 1MQRA 4KWVA 2POZA 4JTQA 5CSRA 5EY5A 4GG9A 1VZWA 2GJNA 4OWGA 2IQDA 1S2CA 3SCOA 4ILSA 1NDVA 4PTVA 4AZGA 2Z1KA 4XD3A 2BY1A 3T9PA 3M7WA 3CQJA 1GPFA 3RJXA 1RQBA 3DERA 5HANA 5FSDC 3FAXA 2ZIDA 3ARTA 1F5ZA 1W17A 1AK5A 4NASA 3V18A 1A53A 4XZHA 6XIAA 1Z44A 2D22A 4C6PA 3QFEA 4G8TA 1L0PA 1FWNA 1VPYA 4O15A 5I3IA 2Y0FA 1D8CA 2PDBA 2Y7EA 2QMKA 4GRSA 4A8LA 3LYEA 3QHNA 4QP0A 2WNNA 1WOAA 3H2FA 2OYKA 1AH0A 1P7TA 2G3FA 4JTTA 3A6OA 4GQRA 5FF3A 4LB4A 3TTYA 3P2VA 5A6BA 4LSBA 3RNDA 3AMLA 1ELSA 1OADA 3WLTA 3AIRA 1V5XA 5CGQA 1JZ3A 1UW9A 1SFSA 1G1YA 1R3TA 2RAGA 1CW2A 1G69A 2X1SA 2OO0A 2CKSA 1XLMA 4DF1A 4UMBA 4EE9A 1XRFA 1JEZA 4DPQA 3WD4A 3L65A 4JTLA 1IZJA 1MDLA 4W93A 3HZ3A 1VFOA 4INFA 1B2YA 4HSOA 1EZWA 3P80A 4AD4A 4ZSUA 3LPFA 1F9CA 2TMDA 1JZ7A 3EZ4A 4Q3MA 3EA1A 3OOQA 2W62A 2FFIA 1BRLA 5HUOA 2WB5A 1CYGA 1UR8A 2ZVIA 3BLFA 3NIYA 4W9TA 1XH1A 2PGRA 3SCNA 3VIMA 3MYOA 5HWNA 3BCJA 1ZAHA 2CZDA 3NTYA 1KGWA 4J1OA 4JTCA 1YTKA 3WEOA 2WCGA 1GEHA 1GZGA 1SSGA 3UETA 4PMZA 3NM1A 2DU2A 3E38A 1MRQA 4MPQA 2I9EA 1A3WA 1V6YA 3UVIA 4XZWA 1JCYA 2DT0A 2VFEA 3WH9A 5H8UA 6TAAA 4HZ7A 2Z1WA 5GNZA 1ONWA 2NQZA 3B4UA 1O68A 1YNQA 2GQ9A 1SJCA 4FR1A 1AZ1A 5CBIA 3NQ6A 1W1TA 2XM1A 1ZSXA 5ABGA 3N6QA 4CQ8A 3GVGA 4YIWA 4C6JA 3I65A 4LQ1A 4K68A 1DPMA 4H9XA 4O0KA 3MMUA 2C6QA 3WD0A 3FGCB 4ZTYA 3AMCA 5D09A 1R9XA 1J2WA 4XZIA 5M1TA 4AD3A 4XZMX 4GJIA 4DELA 1R85A 5IDZA 4NZ1A 1JXJA 3UR8A 4B5XA 4PL2A 3H70A 4GX8A 1PIIA 1OT2A 3O15A 5REQA 2PURA 1T96A 1W3TA 2HJPA 4PMUA 3NQCA 1E6PA 3QGVA 1MEWA 5DANA 3WLRA 3WQPA 1IGSA 2XYLA 1KM6A 4YCOA 2YCIX 4S3CA 3ZJ6A 3C8NA 4WKFA 1FHLA 4A35A 3VMNA 5C6MA 3C0QA 3EPMA 3ABSA 2ZBTA 1IEVA 3PZTA 4XAZA 2OLSA 1TSIA 2FZMA 4OV9A 4X2PA 2OMAA 5ABTA 1YQ2A 3IJ8A 3KWSA 3PVFA 1S2TA 3MVTA 4YTUA 4QG8A 3KP1A 3NPWA 4R9XA 3G24A 1YDVA 4KGJA 4HU8A 3GM8A 4GCAA 4K8EA 2WNZA 1C8VA 4MKSA 2GGJA 1CCWB 3I7QA 3WQ4A 3AAMA 2CHOA 2XPKA 4GMEA 4ROQA 2A3BA 1TB3A 4Z0SA 2DZSA 2Z25A 8RUCA 1NWUA 4KRTA 4PCNA 4QQUA 3KOZA 4YWIA 1RA0A 3N18A 3U4AA 2WLYA 4Q7NA 1JI2A 4PEEA 1CNVA 2E0PA 4PMNA 3S1GA 2VWSA 3LM7A 3VNDA 3GVWA 5KETA 4HPHA 2XJ7A 4J3SA 3LD5A 1W6TA 2WSRA 3UJFA 1G94A 3ZIZA 3RRXA 1SO5A 3NM3A 2VO5A 4E2DA 2A0NA 3TTOA 5A94A 2D23A 5A1AA 4XX6A 2QPSA 3S6TA 2AQWA 1EJVC 3G1AA 3MMTA 4OBTA 2ZA2A 1ME8A 3CBWA 4IF2A 1J6OA 4BJHA 2I5QA 1SFTA 2WMGA 1XRVA 1VJIA 3U5UA 3T4WA 1RY0A 1TX2A 2X40A 1L2QA 1B30A 4LRTA 5C9RA 3G1VA 4HCDA 4JTUA 4IXXA 1U5VA 3AICA 1XM3A 1IXOA 3IJQA 4JNMA 1L6YA 1ESWA 1XGEA 2A6LA 3HBLA 1HQTA 2GGIA 2INFA 2WJDA 1Q7ZA 2O9OA 3C56A 1ZBCA 2F2KA 3R43A 2J24A 2WVSA 4Q8VA 1XSKA 2GLKA 3AI0A 3AWOA 5CG0A 3NZ1A 1GORA 5I07A 1VS1A 3T08A 3WBYA 1XG4A 4AC7C 1KB3A 1A4LA 3NQGA 3QYQA 3PZNA 4URIA 3CV2A 3OVPA 4PCSA 1UR0A 3T4CA 2RHGA 5H1WA 3PM6A 5C5YA 4CCZA 4DO4A 2J7GA 1UOZA 4RNJA 1AG1O 3K1DA 1CEOA 7ENLA 4WIWA 1P0KA 2X42A 5E0FA 2QUNA 3QHMA 1J5SA 1Q6FA 1GPWA 4NVTA 1EH9A 2MNRA 3LY0A 3A13A 3B0PA 4UIOA 1JDDA 4AF0B 2PDXA 5G2WA 1TRIA 1VYPX 4PTXA 4BWLA 2Y8UA 3OTRA 2FGZA 3QPYA 1VFLA 1CBGA 4UB9A 3KP0A 2YYUA 1POJA 4LEQA 3REQB 1E1EA 1VEOA 4BA0A 1QK0A 3TKFA 7A3HA 1S5VA 2ACQA 2E68A 1XG3A 3PUGA 4QLKA 5A8OA 1PXGA 1A5OC 4QJ5B 3RPMA 4U3CA 1QMLA 3FDKA 1XBVA 3DBPA 2DSZA 3MI3A 3VIHA 1XBZA 1HVQA 3PPGA 1KRCC 5A69A 3FNDA 4ZXOA 4B4HA 2PGEA 1SW3A 1LRTA 1RPKA 3NR0A 4MDPA 1FWHC 2RDXA 3TNOA 1GJUA 4QE1A 3DC0A 3IAPA 1LCOA 4P8VA 1RVGA 1V08A 4ASTA 4F2TA 5IRPA 1M53A 1JF6A 4HSHA 2E8ZA 2PTYA 3RR4A 3K4AA 2ISFA 2YX0A 2I9UA 5J5RA 1YDYA 1Q63A 5D04C 5CXPA 1V6XA 3WFZA 1E0XA 4PMYA 4C90A 3MWAA 4ACYA 3TONA 1NU5A 4PTDA 3KFTA 4LVGA 4R27A 2NV1A 4QXIA 3WF2A 4AZHA 3GE7A 4AXKA 3PWIA 3WF3A 3BOLA 3TROA 4JKLA 3NQMA 2WW5A 4TVCA 3MKVA 5C2XA 4GIEA 3GNDA 3ITYA 1DIDA 3UY8A 4BF5A 1JZ6A 4DJFC 4LCRA 5XINA 4GJJA 4TMCA 3MBFA 3IVUA 3SUWA 4HK5A 1FQ0A 3BSHA 3OYXA 1EIXA 5AC8A 1SFLA 1UD6A 4N9DA 3K8KA 1BGGA 1CPUA 4Z2GA 2BBFA 2QUMA 1LOQA 1RXOB 1RQHA 1V6UA 3QW3A 2ZADA 2OKTA 1PIGA 1F74A 1XD1A 3ANYA 1DJHA 4GYKA 1UWSA 1XCWA 4L9YA 2QNEA 2KZHA 3FA5A 3VKKA 4AD5A 3RU6A 2FHCA 3WQ8A 5A6JA 1Y0EA 3WDJA 1XPYA 4B3LA 2RJGA 2NUYA 3SQMA 3H4GA 1EOMA 1VPXA 1EP1A 2V8ZA 1JXKA 3CUJA 4IIHA 4XD5A 3WF4A 1YBQA 4LVBA 4OQVA 4PRTA 2OG9A 4JAWA 1GG1A 3NSXA 1Q85A 3DGBA 5PTDA 5A8PA 1BVWA 2WVVA 3GC5A 3P14A 2ZVRA 4AYGA 4M51A 2J13A 2R1LA 4Q8PA 1TWDA 2ISDA 3STCA 1W37A 4ZOBA 4GK8A 1J0IA 1CXLA 3NQ8A 4E2OA 5KSWA 3IGHX 4LGXA 3VNJA 2GSJA 4ZA0A 4EXAA 3GBDA 3KS5A 5I6SA 4O52A 2GQAA 4MPKA 4CN4A 1GVQA 1UUMA 4FOJA 4L7ZA 2RH9A 3TEVA 3OHMB 4UBPC 1BG4A 2QUUA 4W8LA 1X39A 3LZ3A 2PD9A 1JCTA 5C7HA 1O7AA 6REQB 3PPCA 5EBUA 1MEHA 3PWGA 4RXGA 1V7YA 4QE4A 4KKXA 4RX0A 3S9ZA 1IV8A 2X05A 2FJKA 4DBEA 4FMVA 2NWSA 5CZTA 2B7OA 3HU7A 4A05A 1YE6A 1HO1A 1KGXA 2D24A 4O0ZA 1JPKA 3QTGA 3C8FA 3BLEA 2QT3A 4K3ZA 3WQFA 1SUXA 3SRHA 3T7VA 4Q4QA 3H8AA 1DOSA 4UNKA 3K1GA 2V3FA 1Z48A 2WHMA 4B2DA 4GYPA 4WDUA 4EOUA 2Y1HA 3ANVA 4JXCA 3ARVA 2G5WA 2O4MA 5HJLA 4WY0F 5BOFA 4GGBA 1SMAA 3WBAA 4IMEA 1SSDA 4XKYA 4HNTA 1E43A 4AIOA 1Z6KA 1JG9A 1VJZA 1F76A 3JW7A 3HV9A 5LA1A 1VHNA 4IUOA 4POCA 3HMCA 1FWBC 1VCFA 4MB4A 3MI2A 4LUSB 3GTHA 3ARSA 3FFSA 4FX7A 1K77A 1XC4A 4NUWA 2RGLA 5F4SA 2Z1VA 4TQTA 3VZZA 1GUVA 2YXOA 2NUWA 5LIKX 1V3JA 1HP4A 3FOKA 1TJPA 1E70M 5MHBA 1LUCA 3R94A 2Y7FA 4C6QA 5DT7A 5HOSA 3CUZA 1BF2A 3W0KA 4D8AA 2YDSA 5D8ZA 4TVDA 4M6QA 1S39A 5I3FA 3ID7A 3W1TA 3CASA 2ASHA 5IOBA 5LNUA 1WXJA 1FWDC 5LNSA 2X2YA 2DGAA 1Z41A 4DI8A 3MHUA 4P7RA 4QHRA 4AHOA 4RXFA 2G4JA 3WLMA 2VVNA 3CUXA 5D05A 3WMBA 5TQLA 1R0MA 3NVTA 4HTBA 3IJDA 1XQLA 3WH8A 1JAKA 5HQLA 4DJDA 1C8XA 4MF4A 4LAZA 4MYXA 4O19A 3ZJ7A 1NIUA 1KV8A 5DELA 3TFXA 3BO9A 4IQJA 4NYUA 2DT2A 3LLFA 3A21A 1FWAC 1Q2SA 2DH2A 3KHDA 1WKDA 3I3BA 5B80A 5BOOA 4ZFCA 3R5EA 2HS8A 3V0SA 1KCXA 4EX4A 4JBRA 4FIRA 1ADOA 5CPMA 1U2YA 3ES7A 2XZ9A 1RK6A 3EGJA 3G5EA 3OG2A 3ALFA 4LS1A 1OFRA 3VOCA 1OX5A 1UZDA 3H54A 4EIVA 2HVOA 2O0TA 2XSBA 4MWAC 4UCGA 3DFHA 4FXFA 1KLZA 4QAIA 1V3HA 5HPCA 1V3LA 2HDJA 3TZFA 1EB3A 3HGJA 3SUVA 2VEIA 2BG5A 4DYJA 3EA2A 1J0ZA 3ZYZA 1TV3A 4F3HA 1CECA 4PRWA 1FXQA 5I02A 2PI6A 4LNYA 3WDIA 3M46A 1EGVA 4MB3A 1LZOA 3QV9A 4S39A 5LGXA 3ORWA 2GUUA 3GX9A 4O1BA 5DT5A 5LHEA 3A23A 1FP9A 2ZZ7A 3M9YA 2Z6JA 3OPSA 2LLEA 2Y7GA 2JALA 5T8GA 4AZCA 4K1GA 4MJ4A 3KLKA 4C6LA 6A3HA 3IJ9A 4FNUA 4JZ5A 3TR9A 4GH3A 3WD2A 2BVDA 4R88A 4MWAB 1HL2A 3W75A 2R1KA 3CL6A 3W3OA 1OHLA 4O8RA 2XH4A 4Y96A 1PPIA 3TSMA 3RU8X 4REQB 3NDOA 1OZQA 4H7CA 1XP3A 3AJ7A 5HATA 1JCJA 2VL4A 1H5VA 4NJHA 4UUIA 4M3PA 4JYDA 3MUXA 3GTXA 3C52A 4LXFA 3EOSA 1RA5A 3KTCA 4F8XA 2WSKA 4YYCA 4ZR8A 4C1NB 4O1FA 3W2KA 2E1DA 4QM1A 1GOWA 2W66A 4KWSA 4Y9OA 2HZGA 1UB3A 1PS9A 2E5CA 2EPHA 4G1NA 4KETA 4RPQA 9RUBA 4IPPA 4PSRA 1H49A 1U5HA 1E55A 4Q8OA 4IJRA 3TLLA 3C0LA 1J0YA 4IXHA 5AYZA 3TOYA 1OB0A 1QOXA 1I45A 2WCSA 3UWVA 3AYRA 1FFQA 2PMQA 2D2GA 3LGGA 5HMDA 2OQYA 3RILA 1Y5VA 1C8QA 4PEKA 3LV5A 3M0LA 3R10A 1QOPA 4TV5A 1LWIA 1X7FA 3K4DA 1UR2A 4CEXC 4NRRA 4W87A 1GYLA 1FCVA 2G3NA 3ZXWA 1R7OA 1LQ0A 5EMUA 2HCVA 2XWEA 5I79A 2NVDA 2OVLA 2AGKA 2DT1A 4DO7A 1BHGA 2OO6A 5E9AA 2OZTA 3GTFA 3VIKA 4S3GA 3B0YA 4JTDA 1MZHA 2XN0A 4PTWA 1LOSA 4H8UA 1EUNA 3F4WA 1OGBA 4MM1A 3AIEA 3MSYA 4MMWA 3P62A 1WUFA 1JPMA 1RVKA 2HISA 4JOMA 3WLPA 4DWDA 1NWSA 1H50A 3W87A 2QUTA 3LCLA 2BY3A 3F4NA 4LAKA 3LERA 5DX7A 2E25A 2RDUA 3LPPA 3BURA 5EU9A 2D3NA 4GJ1A 5DCDA 2F7FA 3IGUA 3GDBA 3PBGA 1IEIA 2GWNA 4BQ4A 5J04A 1ZAJA 4MZ8A 3RPTA 3WQWA 3RO8A 2B7QA 5CBJA 8TIMA 1X8FA 2AL2A 4EF8A 3ZS4A 4PMQA 1LORA 4UTTC 4DNHA 3UESA 4B5SA 2ZX5A 1UP2A 5LNVA 3VIGA 3NQFA 4US5A 4Q4KA 2PRMA 5I09A 1TZ7A 5MF5A 3QH2A 4U28A 1P43A 2PZ0A 1LT7A 1XSJA 1P0NA 2X7VA 3FXYA 3QKZA 3W81A 4L4PA 3PF3A 1TPC1 3L5MA 4JN7A 1WO2A 2PD5A 4XZBA 1JJKA 2WVTA 2PGFA 1VKFA 4NZ4A 2Z26A 2HMCA 1CTNA 3EKZA 3DCPA 3SCPA 1QBAA 2QZRA 1TKKA 1EO7A 2WMJA 2CXGA 4J4KA 1H7OA 4H8NA 3GBEA 2EKGA 5D30A 4ZSTA 3R58A 3GUGA 4WJXA 5KZ6A 2ZE0A 1QT1A 3A22A 5HNTA 1TR1A 3ARWA 1ZJHA 1EA9C 4O1DA 4FNTA 1CI1A 5DCBA 5C8BB 2PRHA 4LX4A 4Q7BA 2YA1A 4GCXA 4Z2IA 3HG4A 1KBBA 1V3IA 2AQVA 2X16A 3FLUA 3E2RA 1OYCA 1GQNA 7CGTA 4RKAA 2DSWA 2W6RA 1SVDA 1W1VA 1ZJAA 4HJFA 3CMFA 3C3NA 4BI5A 1Q6QA 5FF4A 4MG4A 4KWUA 1WZKA 3FEMA 3MKCA 4NX0A 5HBFA 5D33A 1VBUA 4IX2A 1SO6A 4PMXA 4R9OA 5I00A 2PDUA 3EOEA 3GNXA 1MUMA 4MAVA 3BMVA 2PDJA 1N82A 2CWNA 5A6MA 3QTPA 4XTIA 4LVDA 4J5NA 3T0TA 3IJIA 5AHMA 2YCKX 3OO2A 1XJBA 4GWEA 4LF1A 4LAUA 4J3WA 1GTEA 4C6MA 2NXGA 3NZRA 5ENLA 1ZUAX 1OFBA 1G01A 1BSLA 4LV4A 3L5AA 2DVXA 1DWFM 2W61A 2QMJA 1V0MA 2EPOA 2WMFA 2WNQA 3CEPA 3V16A 3BPWA 2VRJA 4LCSA 3ARZA 2X30A 4O28A 1DXIA 1RP9A 2HQAA 4MFDA 2IPGA 1UZ4A 2NQJA 2CIPA 3M07A 1BYCA 3A3HA 3IEBA 4AWTA 2ZWYA 1F3EA 3C6CA 1G0CA 3P8IA 1R87A 4GABA 3TTQA 3GO2A 2OCZA 1UD5A 2VCBA 3ALGA 5C9XA 4JTEA 4Z2JA 4E4PA 4QLJA 2HNHA 1ZCCA 4UTJA 4JTKA 3VD5A 3GNPA 4ZZ9A 4TU1A 2VRQA 2XH7A 3OLDA 4GZEA 1DE6A 3ZVHA 4LUTA 4ZQCA 3E74A 3AXHA 4TTUA 3RX2A 1L2UA 3UD6A 1DQXA 1GKPA 4HNOA 3MV01 2OSWA 2BXVA 3WX7A 3HQOA 2ZZ1A 3VGDA 3GUWA 4GPNA 1QHOA 2IXUA 1IXQA 3GG0A 4CQDA 3H23A 1EUAA 4AZIA 3UGRA 1XR2A 3CZ8A 4I9JA 3H4XA 2C0HA 5CH9A 1DXEA 1ZL1A 4E8CA 3T6CA 4Y7EA 2P8BA 5A6AA 3NDYA 3FIGA 4LYQA 1M7JA 2HSAA 3LCHA 1EJSC 4PMJA 3KXQA 2YW4A 3E5BA 2QJIA 3N34A 1LT8A 3PAJA 3SRFA 4MNMA 2WC4A 3A4WA 1BSIA 1EXPA 5EGRA 3CUFA 5LIUX 5GJNA 1OCBA 3IJ6A 2CLEA 1XRSA 2VWTA 3PNZA 3TVAA 5E5CA 1Z89A 1XIEA 3G1SA 2VEFA 4CCDA 3DFTA 3NNTA 3TJ4A 2CCRA 3S2JA 1WDPA 4KFNA 1B3YA 3L68A 3VDCA 1RCXB 1TWZA 2VENA 4M82A 2QCNA 1JZ5A 1OG0A 4X61A 2J77A 1KXQA 3P74A 1YYAA 4PN2A 5AC4A 3M1ZA 4XO7A 4Z1DA 4D6IA 1I1WA 1BGAA 1BYBA 4PE8A 3O07A 1YMYA 2QULA 4BKNA 2ZRUA 4FK9A 1XS2A 3XINA 2YL6A 4C91A 3H53A 2CLIA 4IFKB 1GT8A 1RLCL 5D02A 1KA9F 4UFHA 4LWWA 1PB0A 4NAFB 1RBOB 4AF0A 4GC4A 4CCCA 2WHKA 4IMGA 4Y6GA 3VCRA 1BVNP 4LV9A 4C60A 1JDFA 2JE8A 3F2CA 4ES4A 2PDKA 3WNPA 4ZOEA 3KAOA 3E02A 2UV8G 3G22A 3REQA 1T5AA 3VKAA 1V3KA 1OWQA 4LY8A 1XLDA 2OSYA 1AW5A 2IMRA 4ZMGA 3VD7A 1IT8A 3CB3A 3UYIA 2V69A 4E3TA 1W31A 3DFQA 2ZE3A 4NXSA 3EDFA 5K9XA 4HD5A 4M81A 3DFSA 4LALA 3W76A 2ZDRA 1BFNA 4MADA 2VR2A 5ECVA 1R3VA 1RH9A 3O6CA 4L6DA 3FHAA 4DUXA 1JD7A 2J7CA 3USZA 3N17A 1EDQA 2F84A 2GUYA 2IKHA 1RJRA 2VX6A 5L9FA 1LLWA 1P0EA 2PLKA 1HW6A 3BH4A 4PCTA 1GWJA 1XISA 3G0SA 1TE6A 2INEA 3H4WA 2BGNE 3F7JA 1E1CB 3WNMA 1YNYA 3MU7A 1FH9A 2X7WA 1WDSA 2WZMA 4Z1AA 1N55A 3S5SA 1Q4WA 2ZXDA 3D46A 2YCLB 1TE1A 2RJHA 2FZNA 1PZ0A 5CPTA 3N11A 1UH2A 3QGKC 4OUEA 4AZBA 3PJXA 4CU7A 1VPQA 5KEZA 4O16A 2PF0A 1HL8A 1WBHA 4H1ZA 4WUIA 4B3ZA 3DESA 1UR3M 4K7YA 3DIPA 4ZOAA 1EQCA 2YL5A 3WL1A 3PANA 4D6JA 3M0ZA 3GR4A 2JKEA 2V5BA 2CESA 3SRKA 4QDPA 2XGZA 4M19A 5BXTA 1XX1A 3AXMA 4ZO9A 3WLHA 4G6CA 3WLNA 3MSGA 4LBUA 4ERIA 1Q6RA 5F7UA 2V82A 4YS1A 2GSEA 4FIQA 1H0GA 2ABAA 3VABA 1REQB 3HM7A 4NP7A 1FP8A 3FK4A 5CC6A 3AIUA 3NQDA 3GNOA 1E9ZB 5AC7A 4YN5A 2J7EA 2VR4A 4MWAD 2EPKX 1PX8A 1DQUA 3R0UA 3EWBX 4DZHA 1CB2A 2QCFA 3W4RA 3GW3A 4HNNA 2GZXA 1OC5A 4FXRA 3VD4A 1XXXA 4TXEA 1DVJA 2VEKA 3CO8A 2C91A 4YCPA 4A3HA 4WXZA 2ZUTA 4GXMA 3FYYA 4DZAA 1H63A 3PZ9A 5A3HA 2PS2A 4OJYA 4DJFA 5DRIA 4Y9NA 3U5YA 1PJ9A 3VM7A 3T2QA 3P84A 4P7OA 3WLJA 1JDAA 1JULA 3BGAA 3QHOA 2RGMA 4PMVA 1QO2A 3USBA 1K9DA 5CZ0A 3F4DA 3AMDA 4I90A 2DZPA 1JPDX 4EVZA 4AH7A 4AU0A 5HQEA 5HJYA 4HTYA 6REQA 3CC1A 5LYRA 4BHYA 3UYCA 2FZ8A 2WSQA 1C8YA 1XLAA 2V6AA 2EPLX 7ODCA 3KZSA 4Q7IA 5IFTA 1AJZA 1C91A 3FS2A 1QI2A 4EANA 1ECEA 4QX4A 2R8WA 4FZIA 4J3UA 2BB0A 4B5WA 2WWCA 3T0CA 3SR7A 5ABFB 1Q7QA 3HGOA 4WK9A 3W7PA 1R3SA 3B9NA 4DBWA 2B81A 2O7SA 3W7RA 1GQJA 4TTGA 4KPLA 4UFKA 4AISA 4B5TA 3NDZA 3ONCA 1U1JA 4H6EA 2O4QA 1H1ZA 3UJRA 4LRSA 3O6AA 4PUKA 3F5JA 5EMKA 2VXNA 1EL3A 1KGUA 4HN8A 5H2ZA 5CC3A 1TJ1A 3Q65A 1I8JA 2X1TA 3QEZA 4OBSA 3W83A 3CH9A 1H7NA 1X38A 1XLKA 1DP0A 2CKRA 1VBRA 3U3HA 6PTDA 3BAKA 3ABZA 1NFPA 3L21A 2XIMA 2QDGA 2FMOA 4W7UA 1XLFA 1EGZA 1OGSA 3C2OA 2Q02A 4GZ7A 2GDQA 3TTEA 1AZ2A 3ZT5A 2V68A 3WQDA 1E6XM 4J35A 3QC0A 4XIAA 4WF7A 4S2CA 2PGWA 1VLWA 1BWVA 1UR1A 3PG9A 2REQA 4QCEA 1R46A 1A5NC 3I4EA 4ZQPA 1M65A 5I0DA 1UQZA 5BROA 4XQ6A 3CWNA 5LGZA 1W3KA 3L23A 3S2MA 3IVTA 3N15A 1T0OA 4HMCA 4HZMA 3VE9A 5CZSA 2C3ZA 2Z2BA 4NYYA 2PWFA 4JEQA 2EG8A 1CZ1A 1MUWA 1JCMP 4F0RA 2GVLA 5JIPA 1ZP4A 5A8GA 5EBAA 4DLMA 2WANA 4FA3A 3R4IA 4LAOA 3TW9A 3PBWA 2ZXQA 1XDMA 4UOZA 3ICJA 1I6NA 3P3BA 4J3ZA 3CHEA 4WHBA 4R7JA 3ITGA 1WZLA 1WDQA 3V36A 4OHQA 3FJ4A 2OU4A 2VVSA 3W72A 4AIUA 4V27A 1I0DA 3GFYA 2I1OA 5BU9A