4UTUA

Structural and biochemical characterization of the n- acetylmannosamine-6-phosphate 2-epimerase from clostridium perfringens
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
229
structure length
229
Chain Sequence
b'GSSHHHHHHMLDVVKGNLIVSCQALSDEPLHSSFIMGRMAIAAKQGGAAAIRAQGVNDINEIKEVTKLPIIGIIARNYDDSEIYITPTMKEVDELLKTDCEMIALDATKRKRPNGENVKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSVDFELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQITKRFTDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLMANNOSAMINE-6-PHOSPHATE 2-EPIMERASE
molecule tags Isomerase
source organism Clostridium perfringens str. 13
publication title Structural and Functional Characterization of the Clostridium Perfringens N-Acetylmannosamine-6-Phosphate 2-Epimerase Essential for the Sialic Acid Salvage Pathway
pubmed doi rcsb
total genus 87
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2014-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4utuA00
3O05A 4K6AA 2E5CA 2YPIA 3S9YA 2V82A 3B03A 1QAPA 3PUOA 3RF9A 4UTIA 1AK5A 3S1XA 4TR9A 3GKAA 5G2IA 2Q8LA 5AHFA 2QCCA 3IIXA 3BV4A 3EX6A 3OVPA 5KITA 4YCOA 2HMCA 2W79A 4HHPA 4JIPA 4TMCA 1ADOA 1F05A 5DLCA 1G6CA 3FYPA 1XXXA 3TK7A 3HPSA 3MYOA 5D02A 3E0IA 2CZDA 3G1XA 3PR2A 4GBUA 1W56A 4QJ1A 4XBSA 4WZHA 4N02A 1EP1A 2FLIA 3MI3A 4JTHA 1Y0EA 3P84A 3TUUA 2QUTA 3NPVA 4AXKA 2H8ZA 3W74A 2NUWA 4A29A 1Q3NA 2ZZ3A 1VLIA 3HPXA 4UTMA 2FQIA 3STCA 2VENA 3W1MA 5D38A 3M5ZA 3CLMA 3P67A 5EL1A 1H61A 1EPXA 1A5SA 1IIHA 2Y7GA 5I3GA 3W1UA 3G8RA 3C6CA 5F2LA 3LCFA 1XFBA 3W7EA 4O53A 1HTIA 3PULA 3N9SA 5CZTA 5EBUA 4BI7A 1YDNA 1JRBA 2Y7FA 1WXJA 4IX2A 3O8AA 4M19A 5KZDA 3C4UA 1WBJA 5FI8A 5F1VA 5G2HA 3QC3A 4KFOA 1HL2A 1GQNA 3PY2A 2YCEA 1EUAA 2WJZA 1DVJA 1RQHA 2XFWA 1THFD 3N19B 1VCGA 4O4WA 2Y88A 4PH6A 1F5ZA 3TDFA 1OK6A 4O19A 2PURA 1RQBA 1LLZA 3QSRA 1OF6A 3LXCA 4O52A 3OG3A 3QFEA 3CB8A 5KINA 1DV7A 1PV8A 2C0AA 1SZFA 3G1FA 4L4LA 2FIQA 1XBVA 3NL3A 3W9ZA 2DJLA 3PF3A 1PL9A 3RK8A 5DBUA 4DPPA 4TIMA 1TV8A 4M6PA 1Q45A 1DJNA 2X16A 4LOCA 3RNDA 1FDZA 2ZTKA 1GYNA 1O60A 2NXGA 3LCLA 4PL1A 5EY5A 3W84A 1Q6OA 4CCCA 5LHFA 3R5EA 4O15A 1KM5A 5LKYA 4O1DA 1TREA 4K7VA 5I3FA 2H3DA 4RJEA 2C15A 4JTJA 3W1PA 2QAPA 1FY6A 3TJLA 4BK9A 3G0SA 1H63A 4Z1CA 3TJXA 5CZJA 3O1NA 3P8JA 3LOTA 1QO5A 1OFDA 4N6EA 1ZFJA 2NX9A 2CU0A 2J6XA 3TKFA 3M16A 4IXHA 4K38A 2CLFA 4OV9A 1CX9A 3B0VC 1B4KA 2E09A 1VGAA 3NQ2A 3W7GA 4X22A 1VQTA 2X30A 2OCZA 1F73A 3M1ZA 1DKWA 2JGYA 1MO0A 4NUWA 3KXQA 3NQVA 5I3JA 2VOMA 3L5MA 1FXQA 2YDAA 3W2NA 1TPB1 1G4PA 2A85A 5AHNA 1TTJA 4FIRA 3NOEA 4UFHA 1XBXA 3KVKA 5KZEA 2NUXA 2WKJA 3DHFA 3UY7A 4DBEA 5LNVA 3DAQA 3KAOA 3THAA 3EXRA 4D2JA 2H6RA 3W1QA 1GEQA 1XBYA 5D30A 4CCDA 1I45A 4GFSA 3W7MA 1XKYA 1TSIA 5TIMA 5G5IA 4YXGA 3VNDA 1DJQA 4JYEA 3SGUA 3WK2A 3W7IA 1LOSA 3IVUA 1FQ0A 1H7NA 1SPQA 3M5XA 1EP3A 3FOKA 4PA8A 1L6YA 1TCDA 2H8XA 3LI0A 4ML9A 3I6RA 3BGGA 3B4UA 1M6JA 3M5YA 1KBIA 3ATYA 3MP4A 3NVTA 4UFMA 4C1KA 2GVLA 3GIYA 4O0ZA 3LHUA 5HR6A 3BW3A 3UPBA 1RPXA 3C2VA 2A21A 4GRSA 1KM4A 1DL3A 1ICQA 1D3HA 1W5NA 3DU0A 3IRDA 1PCKA 3UZ5A 5D2VA 4EWND 1TTPA 3CIWA 4GUFA 3E49A 1IXPA 2NUYA 4K36A 4FNSA 4UXDA 2LLEA 4EF9A 1FBAA 1T8XA 2PRHA 2C6QA 1X8FA 1K8XA 1YXYA 4UC5A 2GJLA 1YADA 3IIVA 1BKSA 2W6RA 3B04A 2VEIA 4RZ6A 4WY0B 3RU6A 3GXPA 1W3TA 3HOJA 4UUIA 1H50A 5U7SA 4WY0F 4GJ1A 1I8JA 2PCQA 4MLJA 4XBKA 3BLIA 1SFLA 1B9BA 4ORMA 1OG0A 3USBA 1VYPX 3LLFA 3PUEA 3Q58A 4UTJA 5IBXA 4IMDA 4LY8A 1I4NA 3NQAA 1QPRA 2VFFA 1HO1A 3LERA 1K02A 5G4EA 2YW4A 2B7NA 3PC0A 2E68A 1N8FA 3V1PA 4FNTA 2RDTA 3LRKA 2NXHA 3WJZA 1H7PA 4JTLA 3LTPA 5L9FA 2V8ZA 1NAL1 4ALDA 1MEHA 1S5VA 3BPWA 3W87A 4I9AA 2ZA3A 2WSYA 2C19A 1JCXA 3UNDA 4HKPA 4S2CA 4N9EA 1JQVA 5D2YA 3W72A 5LNSA 1P5BA 1O5KA 3DI1A 1TJRA 2WQPA 2YGYA 1FWRA 4E2DA 3CTLA 3W2UA 3JR2A 3G1VA 3NA8A 3DFSA 1TTIA 4JTEA 1KW1A 2X1SA 1P0NA 1FWSA 3RFAA 5CPOA 2PE4A 1ME7A 4QNWA 4DF2A 3UWZA 3LTSA 2YFNA 3P5ZA 1W54A 4YCPA 1VC4A 5C5YA 3GZ3A 3LXAA 4AWSA 4ZMGA 1RQEA 4JYDA 3NR0A 2ZTJA 1ZAJA 2WV8A 2NV1A 3G18A 1O94A 1NVMA 5IBXC 1KM2A 4OQVA 1EEPA 1LRQA 4ZQOA 2ZRYA 1I2RA 3NAVA 1VH7A 4WX2A 3G1AA 2CWNA 1J2WA 5E0KA 5KZMA 2J9YA 1GOXA 5TQLA 5FEWA 4MJZA 4GWEA 1SZGA 4LWWA 4BI6A 4OV4A 1KFLA 1W37A 3EWYA 1JRCA 4HIBA 1YTEA 3BLEA 1TIMA 5HWMA 5G1YA 1OHLA 3CM4A 2GOUA 2EAWA 2C3ZA 2F7FA 4IJBA 3CHVA 2NWRA 3LCIA 2RDUA 3H53A 5CG7A 2Y61A 3E02A 1MXSA 3CEUA 3LCGA 1JULA 3M7WA 2CZEA 2DZSA 4UTTC 1F74A 1X6UA 4QQ3A 2ZRWA 5U4NA 1GTEA 2VXNA 4E2BA 1G4EA 3TAOA 4FX6M 4AHOA 3AO0A 3LCWA 3VI2A 3EWWA 1GVQA 2QCNA 5DXYA 2OT0A 1EA0A 4JY9A 5BMXA 1YPIA 1JCMP 3G1SA 3EWZA 5AOUA 2Z1BA 4LC8A 1R46A 1EUNA 5D33A 5KSWA 5D04C 1LYXA 1UB3A 1P0KA 3HG2A 3R89A 4JTUA 1SW0A 5K4XA 1UCWA 1YXDA 4BWLC 4ICNA 1EB3A 1F6KA 1FCVA 2BZNA 3L5LA 4LS0A 5D2WA 4M6VA 2F84A 1KV8A 1LROA 5D05A 4U4MA 2YR1A 3DENA 2V5BA 1U5JA 3UWUA 1FCQA 2QAFA 3L0KA 3OEXA 5DXXA 5LGZA 3MWAA 3NM1A 1G67A 4NJGA 2QKFA 5GVJA 1LBFA 5D09A 4DXVA 3MHUA 4R53A 5AYYA 2CZ5A 3LCXA 3TQVA 7TIMA 2ZRVA 4X3ZA 4WD0A 5EMUA 1TQJA 3EX4A 4DO4A 2WO5A 3LB0A 2QCDB 4I7UA 1I2OA 4JXCA 4N6FA 2A4AA 3KX6A 2YFOA 2GUUA 4JTSA 3N2MA 1S5WA 1KFCA 3OA3A 4N9CA 3N9RA 5HQEA 3M41A 1F2JA 2ZZ6A 5CSSA 3CEPA 2CLIA 3B0PA 2CFFA 3MP5A 3PBWA 2Y63A 4FNRA 2R94A 3MP3A 3QRHA 1SZEA 3W7JA 1A50A 2B7OA 2ZFAA 3EXSA 2NXIA 2V2DA 1GG1A 2FTPA 3QW4B 4M6QA 1WOAA 1FX6A 1OFEA 2IQTA 3HGOA 3VFLA 3T44A 5DCEA 3W1RA 2B4GA 5DBTA 1XI3A 1CI1A 4A3UA 1KA9F 3R8RA 5LZLA 3FJ6A 1IIGA 4UFIA 3FS2A 1G7VA 3OBKA 5CGQA 4ADSA 3BLFA 4NNCA 3W2JA 1T0OA 1SSDA 4ZQRA 1TMHA 1UBSA 1FCBA 4LUJA 1TO3A 4WUIA 5AYXA 4N9DA 4JNMA 3W1XA 2OMAA 3KVLA 3NQFA 1L6SA 1GG0A 3M44A 5HMSA 4FX7A 3PSWA 2ZZ7A 2ZDRA 1NFBA 1A53A 4BFAA 4A22A 4MPQA 3W7DA 3IIZA 5TBOA 1JCLA 2QCLA 3GX9A 3G1YA 3N73A 1JCJA 3IIPA 1J5TA 1RR2A 1F6PA 3I65A 1NF7A 3S5NA 3IIOA 3GAYA 1EIXA 3KVJA 1QCWA 2C18A 1TPUA 2ZRXA 2QCGA 3LI1A 3MBFA 4P61A 2Z6IA 3STGA 4JGDA 4H6KA 3PS7A 3UYCA 2E1DA 1KTCA 5BOOA 5AHEA 4FXRA 2ATMA 1SW7A 5DY2A 4H4IA 2XN0A 2Q8ZA 3O63A 4XKYA 3GB6A 5HR7A 3C2EA 3W75A 3M6YA 1SUXA 4LC6A 1LRNA 3BARA 5DELA 4O57A 1WDWA 4MY9A 1K7FA 3RLVA 3DKJA 4UFLA 4Y8FA 4FO4A 2J9XA 1FCUA 4UTWA 3SIZA 4BI5A 1QO2A 4K8EA 2WNQA 5FF7A 4A21A 3GXTA 1ML1A 1ZAIA 5AFDA 3C3NA 4LNYA 5DY3A 3LBCA 5I3KA 4LVGA 4RXFA 1TPC1 2I1OA 2NV2A 4O4VA 3NQGA 1YTDA 4MYXA 5HUPA 3GK0A 2QCMA 1TPWA 3L2IA 3GKFA 4CLMA 1GYLA 3HBLA 5AB3A 4OGZA 1P1XA 2RFGA 4IQLA 3C61A 4Q32A 2CLOA 1AW1A 2QEZA 1ZENA 4UTTA 3MI2A 1BEUA 1H7OA 5MHBA 3NQ7A 2V2CA 3FLUA 4DF1A 1XUUA 4YWIA 3TR2A 1H1ZA 3WJWA 1JCNA 2YSWA 4YL2A 1F7BA 3CPRA 5FF4A 3BW2A 1FDYA 2FPYA 1DQWA 1ZNNA 2ZZ4A 3A22A 4AF0B 4IGHA 4JICA 2VKZG 3TMLA 3DZ1A 4UMBA 1OFRA 2FDSA 1DORA 1W0MA 4A2SA 5AC8A 2YXGA 1H60A 1QPOA 3N3MA 3GNNA 3VKJA 3KFTA 3NL6A 2W0UA 2A7RA 4PC8A 3P74A 3NQDA 5AC7A 4IUOA 5ABTA 1LP6A 3F4WA 2A5HA 3QW3A 3WK0A 4RCXA 1ZJIA 2JBMA 4IXXA 5HINA 3DHDA 4R33A 2J9ZA 1L2UA 4O11A 2WOQA 1DOSA 3QPYA 2CLHA 3GR7A 1FXPA 4IX0A 1OFQA 3ZS4A 1LM1A 2V30A 1RV8A 3PBYA 4E38A 1X1OA 3U6WA 4LUIA 2JKPA 1OFOA 2AGKA 5D03A 5LNRA 4AAJA 1KFKA 3W71A 3SFKA 3AJXA 3BGJA 1Q6QA 3PAJA 3TAKA 2DZVA 1TQXA 1SR9A 1Z41A 3QMSA 1JVNA 4GC4A 1V5XA 1XC4A 4I7VA 4FXSA 1GPWA 4POCA 3O15A 4N4QA 3P8IA 1VYRA 3M47A 3DGRA 3L0GA 1U83A 4JDBA 3TC6A 5FF3A 3F4NA 1R30A 2VFDA 2Y89A 4OE7A 1R47A 3LTYA 2XN2A 3ZWTA 2ZCGA 1I2QA 2V0TA 2UV8G 4OWGA 1MEWA 4M7SA 3H55A 3STEA 4O18A 2DZWA 2QCFA 4IWWA 3PB0A 5LGXA 4R7JA 2OT1A 5J5RA 2FPVA 1LBLA 1S5TA 4JEQA 4CNNA 1MZHA 4EIVA 4TU1A 4MZYA 4LTSA 4O54A 3C2FA 3QQ0A 4NJHA 4DELA 2ZZ1A 3NPXA 4MVAA 1TPFA 1EX5A 2R8WA 4WOQA 3UXDA 4DO5A 4LRTA 1OX4B 1K7XA 3TQ0A 3W73A 4XUGA 3T4CA 3HB9A 1FWTA 4U28A 1Z42A 4UIOA 1SQ7A 2VFEA 1HFBA 2VEMA 1OJXA 3KRSA 2WNZA 3SJ3A 3TSBA 4O16A 1Q6LA 4QAIA 3BG3A 2JKAA 4CNPA 2ZRUA 1KTNA 5FESA 2CZFA 4TMBA 3BG9A 5HWJA 3QZEA 4UNLA 1LORA 1C9DA 3P82A 4NNAA 4IPIA 4N4PA 3GDRA 3PG9A 1PVNA 3PG8A 3UD6A 4GUIA 3G1HA 3A24A 4GE8A 1ZAHA 3A5VA 2QJGA 1FWWA 3QM3A 4A2RA 1ZALA 3PBVA 3TMQA 3E9AA 1JCYA 2E6DA 3VE9A 2E6YA 3EXTA 1QDSA 5G4WA 2PRLA 3WJYA 3UPWA 2Y6ZA 4FIQA 3B8DA 5HWNA 4ZQNA 1RZMA 2EHHA 3W7LA 3I7SA 3LCHA 2VEKA 1TPDA 1XBZA 1M5WA 3HGSA 4JX4A 1X7FA 2WSQA 3L68A 3LHYA 2KZHA 4IOTA 3C52A 1Z44A 3UWVA 3S42A 1VR6A 4MKNA 4HN4A 4QM1A 4PFMA 5A8GA 3M9YA 3SW6A 1ZHAA 6ALDA 1H51A 3MI6A 4WXYA 2DZTA 2TSYA 3V75A 4UTHA 1DQXA 1F76A 3GDKA 3PSVA 1OFPA 2BX7A 5H2ZA 1TPVA 2Z0IA 4LW7A 4OBTA 3P81A 3LHVA 4AMAA 3P7YA 2WPBA 5DCDA 1W3NA 2A2IA 4LS2A 3C56A 3QQ1A 4LVBA 4PEKA 3GNDA 3NEVA 1TYGA 4ZQCA 5I3IA 3Q2DA 4CQ8A 1ONRA 3TA6A 4WJEA 1JUBA 4UR8A 1WYIA 1GWJA 2GVJA 1ZCOA 3MO7A 3EWUA 4Y9AA 2C14A 4Y6GA 4K37A 4EVZA 4HNVA 3MHGA 3G22A 4ZL1A 1AMKA 4NX0A 5F4SA 3SECA 4JTFA 1FUYA 3GXNA 4MLRA 2P1FA 3GYEA 3W2MA 5LNUA 2E5BA 3MBDA 1C8VA 2V81A 1XM3A 4MJMA 3IVTA 3LV6A 1LRTA 3NNTA 4JYFA 3W22A 5CPMA 3U8GA 1W5PA 3DI0A 1KFBA 4MUZA 5D2TA 3RMJA 1YYAA 4R34A 2G97A 1YPFA 2ZQ0A 1TJPA 3FKRA 1QWGA 4XWUA 4FB7A 3S1WA 3NQMA 1KTBA 2CW6A 5CZSA 1LOLA 1GVRA 2JKEA 2RDWA 3ABQA 2J88A 4JIQA 3WJXA 3TC7A 5C55A 3HJZA 1VCVA 2GPTA 3GR8A 4LU0A 2ZRZA 2WNNA 2YYUA 1WAUA 1XDLA 1M7PA 5KMYA 4UFJA 2G95A 3DBPA 3S0CA 1LZOA 1H5YA 1AL8A 2FB2A 5HJLA 3HO8A 3QSTA 1IGSA 2DZPA 3THQA 5CKSA 4EF8A 4LRSA 4K39A 2X1UA 4BWLA 5LNWA 1K8YA 4UTWC 3W7RA 3SR7A 2GQ9A 3MW7A 4Q33A 3HPZA 4OHQA 4OT7A 3E12A 1QPQA 4JX5A 3L0NA 1QR7A 2YYTA 2X1RA 1R2RA 3TW6A 3QPZA 1SFJA 1B4EA 3LHWA 4MFEA 2EGZA 3G0UA 2NWSA 3W07A 3DH7A 2NX1A 3LRMA 4JTGA 4MZ8A 1PIIA 5AHLA 4C1LA 4Z1BA 4B5NA 5BW6A 3IVSA 3SZ8A 3ZWSA 1EP2A 4UFKA 2B7PA 3WFAA 1OFAA 1LDCA 3NQCA 1WQ5A 4NNBA 3YPIA 1SW3A 3W2LA 4M5PA 2J24A 3T55A 3G3MA 1B3OA 4H3DA 1SU5A 4L4MA 1W31A 3R12A 1CW2A 1KM6A 4XTIA 1NEYA 2ISSA 4ADTA 1IXOA 3S5YA 4Z0JA 3IGUA 2QR6A 3G1DA 1KFJA 1D3GA 3KVMA 4MZ1A 1PHQA 1VHCA 3N2XA 3NYZA 1RD5A 3D0CA 2YZRA 2ABAA 1P4CA 4MYAA 2O7SA 4IMCA 4AEOA 1PS9A 2QUVA 1VRDA 2VC6A 2FFCA 4WXZA 2R91A 2V2HA 3QF0A 2BSLA 3EB2A 1VS1A 3UQNA 5AN7A 3JS3A 3LHTA 2A0NA 2WSRA 4GUJA 3A23A 4MIMA 1N7KA 3HQ1A 1VPXA 2VEPA 2NLIA 3W7PA 1LBMA 3QEZA 3NM3A 3O07A 1W1ZA 4UR7A 1W5QA 1HG3A 3LGEA 1ICSA 1H62A 3DFPA 4P2VA 5K9XA 1TRIA 4LS1A 4XZ9A 3DFNA 2E5DA 5AYZA 5T26A 5HUOA 4O1BA 3TH6A 3W3OA 2Q3OA 1YLVA 1YDOA 2TYSA 1OFBA 3K30A 4I7WA 4BR1A 3W1AA 4UMCA 1C29A 3LRLA 1GVOA 4DPQA 5G2WA 1IXQA 2A7PA 3BVJA 2EF9A 1G4TA 3GVGA 2ISVA 4NU7A 5K9DA 4IMEA 4NT0A 1G4SA 3M0ZA 3NXFA 1OABA 1KM0A 1TV5A 2CLLA 1TPH1 1QOPA 2J27A 3HG4A 4RZ4A 5BMWA 4AH7A 2ZZ5A 3HGJA 2HTMA 1IF2A 4FF7A 1OYAA 2YW3A 4M7TA 4IPJA 1Z48A 3CWNA 1H7WA 5EYWA 3CWOX 4JD4A 3IGXA 3U2OA 4NXSA 4CQ9A 2I9EA 2EKCA 5FF0A 2OX1A 1UJPA 3Q37A 4N2YA 3PWAA 4NJIA 2G96A 4NXKA 2D73A 1JUEA 2OZ0A 3TXVA 5KTLA 3F03K 1IXNA 2C1HA 4PODA 2BLEA 4HSOA 1SO4A 3UZJA 1YDVA 2VFHA 4UTKA 1GJPA 4HSNA 4FX8A 3KRUA 3TROA 3B0UX 3INPA 2VFIA 2ISWA 3W88A 4FNQA 4LT9A 3I7RA 3WK3A 4DQWA 5E93A 3M5VA 5CSRA 2NZLA 1M7OA 4JTIA 4KFNA 1LOQA 1UASA 4AHQA 3TW7A 8TIMA 3GDLA 1KLZA 2PC4A 3W85A 2FPTA 4O17A 3KOFA 5FEXA 3A5FA 5EKYA 3FFSA 3LDVA 1K7EA 3EX1A 3F1QA 4ZQPA 1VCFA 4CQAA 4E0CA 1AW2A 3CU2A 4HNTA 3W1TA 2TPSA 3ABSA 4O8RA 2GQAA 3MYPA 5AC6A 2DJXA 4O13A 1LLWA 1OX4A 3DFQA 3W7NA 3PB2A 6TIMA 3C0JA 2VELA 2QUUA 5HULA 3GDTA 1SZNA 4O12A 4DO6A 5K9CA 2QJHA 2ATSA 2QCDA 3GAKA 3W7OA 4RK8A 3NPWA 3ABOA 2Q3RA 3UXAA 3W76A 2Y70A 2QCHA 2V5LA 3EX3A 3HG5A 2GQ8A 2GJNA 5CPNA 3TNOA 2I14A 5LSMA 5F2IA 1T96A 4OU1A 1FWNA 3P60A 3QYQA 3A21A 3LLDA 1YTKA 1R2SA 2C13A 3PBUA 5F4WA 3W7HA 3R2GA 3P62A 4UCGA 2ABBA 1ME9A 3LXBA 3S5ZA 1BTMA 3W83A 3ABRA 1KFEA 4FHAA 2CLMA 4ZZ9A 1S3HA 4FNPA 3ANYA 1UUMA 3NO5A 4KFPA 4LVFA 3T40A 4QNEA 4O28A 3H54A 4HT3A 4KKXA 4O0KA 4RKAA 2PRMA 1XCFA 3QJAA 4GUGA 2RKXA 4K7YA 3DFTA 3NGJA 2QJIA 4IMFA 4MY1A 3W1NA 4FEZA 3CT7A 3SY5A 1TTQA 3ELFA 1QMLA 5D37A 3KHJA 2FB3A 3G0XA 2E6FA 3PVFA 1T99A 1KBJA 4O1AA 2CLEA 1O4UA 3NQ8A 4CCEA 1PE1A 1DHPA 2A7NA 3SI9A 4NZFA 3TIMA 5G1TA 3ZFHA 1EWDA 1FDJA 1PHWA 1OK4A 3ZR4A 5C6MA 2NX3A 5E1QA 3HIJA 1A5BA 4JTTA 3HG3A 1W3IA 3TXZA 3LHZA 3N14A 5L6UA 1X1ZA 3B06A 3MJYA 5FEZA 2ZZ2A 5IM51 1OYBA 3EKLA 1WBHA 3W1LA 3O6YX 1LTDA 4X9SA 4O50A 4KWWA 4LV4A 2HSAA 3C2RA 3DKLA 3FA5A 4MY8A 4LV9A 3O6DA 2EPHA 4HNUA 3WK1A 3LBMA 4JR5A 4WQ6A 1ALDA 1ME8A 1TV7A 3JRKA 1WA3A 3P80A 1K8ZA 4YLWA 3RLUA 1GTHA 3P61A 2AAMA 3UY8A 3M43A 4ONVA 4QSHA 3TCEA 1GVSA 3MMTA 3TQKA 3W86A 4S2BA 4GUHA 1VJIA 3NL5A 5CZ0A 3C2OA 4JDYA 4DBDA 4NZJA 1R2TA 3TFXA 1XL9A 2DZXA 3HMJG 5SWUA 1QFEA 2QDHA 2QCEA 5D32A 1OX5A 5D2XA 2P0OA 3T7VA 5K2ZA 1UUOA 3L9CA 1NF0A 1NSJA 1SO3A 4Z1AA 4UTUA 1MEIA 3Q94A 1AW5A 2ALDA 2JK2A 3EEGA 3O6CA 5A5WA 1WV2A 1SO6A 5EPDA 3BO9A 4UMAA 1JJKA 2CLKA 3N34A 1OX6A 2G5WA 2FJKA 4G1KA 3MHFA 1EWEA 1ZY9A 1YXCA 4DF0A 4QITA 3L66A 3W23A 4N9BA 4JN6A 3W2KA 4HPJA 2QF7A 1TRDA 3CIXA 5LHEA 4EOUA 1SSGA 2VFGA 3SSJA 4TO8A 1BWLA 3G8EA 2YX0A 3P5YA 3VE7A 4FNUA 4XQ6A 4AB4A 4AHPA 3NDOA 1N55A 3HGRA 1E51A 1KM3A 4ADUA 5C54A 1SO5A 3NQEA 1MSSA 4O1CA 1ICPA 3L67A 4JY8A 5H91A 2A6LA 4HPXA 4Z0SA 3R13A 3GLCA 1AL7A 2O7QA 4GXMA 4RZ5A 2TRSA 3ATZA 4PL2A 3I7QA 5C2XA 1V7YA 5F1UA 4S1FA 4QIUA 1OF8A 5AHIA 1KM1A 4NQ1A 3NZ1A 3VCRA 5K4ZA 3W7CA 3DXIA 2DP3A 3TX9A 3HF3A 3SGZA 4NJKA 4CNOA 3KRZA 1W5OA 3BG5A 4JS3A 2E77A 3S8HA 2HS6A 1J4EA 2A6NA 3S6DA 3CQ0A 3E96A 3LX9A 1H1YA 4O10A 5I3HA 2R14A 1VHNA 3EWBX 3PUDA 3MUXA 3S5OA 3IGSA 1G69A 4W9TA 2Z6JA 3OHIA 5HNRA 5F2GA 1W5MA 4Z1DA 1G7UA 1QPNA 4XKYB 1VZWA 2Y7DA 1KV5A 2B0MA 4AWTA 5K3VA 4BF9A 1PCWA 1Q6RA 4HNNA 3FYOA 5EA9A 3QMTA 3TFCA 2QDGA 3L21A 1L9WA 2AQWA 1VLWA 3IV3A 3QH2A 5FEPA 3T78A 3FKKA 5CPLA 1HUVA 2Z2UA 4O14A 1KLYA 1W8SA 2HS8A 4QISA 4RXGA 2C16A 5F4XA 4RV8A 3W7QA 1DBTA 1TPEA 2Y62A 2ZYFA 4Y90A 3G3DA 1H7XA 4AWUA 2JGQA 4PTNA 3FEMA 1GT8A 3S1VA 4UNKA 3NQ6A 1GZGA 3S1UA 1QNVA 3W70A 2ZA2A 1I2NA 1O5XA 1I2PA 1O95A 2DORA 3I68A 3L5AA 5J5DA 2XN1A 3B05A 5K7JA 4WOZA 1VYSX 3QMRA 3IEBA 3CC1A 1BWKA 3GDMA 4RX0A 4NX5A 1JQXA 3A9IA 4Y96A 1D9EA 3STFA 4DEFA 4JX6A 4UTLA 3TSMA 2GVGA 3DFOA 4AVFA 4NVTA 1AG1O 4YMZA 2ZA1A 4MOZA 4TX9A 1WOBA 4AF0A 3L65A 1JUKA 3UWYA 2ZBTA 4RR4A 3EX2A 4GNJA 1LCOA 2X1TA 5BRBA 1OVDA 3LV5A 1K03A 5AHMA 3FJLA 3NL2A 3OIXA 2BXVA 1WX0A 5F2MA 3LM7A 3W6YA 4LVDA 5DN1A 1HO4A 2P10A 5FF2A 4LVAA 2BWGA 3C8FA 3O06A 4Q4KA 1TB3A 1B57A 1RVGA 2BTMA 3OVQA 4J9JA 2A1YA 2B7QA 4WY0A 1A5AA 2OJPA 2TMDA 4ZQMA 4X2RA 5BNKA 3UWQA 4XTDA 3O16A 3G24A 3NPUA 2Y7EA 4Z08A 3EWXA 5DCBA 3UWWA 1GVFA 2DZUA 4ZVJA 4NJJA 2H90A 3W7KA 2RH9A 2V9DA 1A5CA 4K8HA 1XDMA 4MFDA 1QOQA 3PM6A 3OVRA 3NZRA 1H7RA 1K3UA 4JTKA 2X2GA 3TE9A 1XUZA 3TU9A 2DU2A 3BK0A 3TSDA 2H3BA 3NG3A 2RHGA 4KWVA 2E6AA 4ORIA 1JR1A 3EKZA 3BW4A 3TV8A 4IMGA 1OYCA 1L6WA 2Y85A 3FIGA 4RLIA 3WJSA 4PCFA
chains in the Genus database with same CATH superfamily
4GYPC 3S9YA 1S2WA 3WMCA 3RF9A 1AK5A 1N82A 4Z2KA 4I3GA 2OKOA 3DFYA 2ALRA 2ZDSA 2PZ0A 4A8NA 2R1NA 3IIXA 4GI8A 3B8UA 3OVPA 4LYRA 2W79A 1MYRA 4HHPA 4JIPA 1F05A 5DLCA 4LF1A 4DZ5A 3OLIA 3HPSA 3MYOA 5D02A 3BAKA 2CZDA 3G1XA 2PDNA 1MI3A 1FHDA 1W56A 4XBSA 3SBFA 4WZHA 1TJ0A 2FLIA 3TUUA 2DDXA 3K46A 1UBPC 2YBVA 3W74A 3UCQA 2CERA 4KCUA 4A29A 3GW0A 1Q3NA 2ZZ3A 4GIEA 1F4HA 2FQIA 1B3WA 2VENA 1JZ7A 2F9RA 1A4LA 5BXPA 4X2PA 2AOSA 2C7FA 1IEIA 1J0ZA 1C92A 1IIHA 2Y7GA 2DEPA 3WLHA 1OGGA 4YHGA 1HTIA 5CZTA 2EKGA 4B91A 1BXBA 3OZYA 2GGIA 3HV8A 3N13A 4IX2A 5KZDA 4JQAA 1WBJA 5F1VA 4P7RA 1V3MA 4YNGA 1V4YA 1GQNA 3OYZA 3W26A 3R58A 1THFD 2VMFA 3M7SA 1VCGA 2Y88A 1F5ZA 1CB7B 3TDFA 4AZCB 1BG9A 4O19A 2PURA 1LLZA 5I7GA 3WQ6A 4JBRA 1EQCA 1DV7A 2PZNA 2C0AA 1A5MC 4QJ3B 3MVIA 1CDGA 2H9AB 2L5HA 2DJLA 3PF3A 1I1WA 1VBUA 4NIRA 4DPPA 5LYRA 4G9PA 1TV8A 3DG7A 4M6PA 4NRSA 1DJNA 1UZ1A 2PGRA 1E0XA 2ZTKA 4Q6XA 2NXGA 5D8WA 4O15A 1KM5A 5LKYA 2E28A 3ARRA 4O1DA 4F0SA 5I3FA 4JTJA 1HZYA 3G0SA 1XPGA 2GJRA 2IMRA 3H6OA 1TWWA 2PLCA 4HOZA 3P8JA 3LOTA 1QO5A 2PDYA 4RDYA 4N6EA 1XP3A 2IQDA 4CD5A 2CU0A 2J6XA 5FJPA 3TKFA 1UKPA 1FWAC 3CZEA 4IXHA 3W01A 1K8CA 3K1DA 1VGAA 4ACZA 7CGTA 3NQ2A 3H2OA 4J40A 4Q8OA 3IJQA 2X30A 5H8PA 2O9RA 1F73A 2JGYA 2PI6A 1MO0A 4NUWA 1V02A 3L4ZA 2YDAA 4NAEA 1G4PA 4UFHA 2GSHA 3LGGA 5HJYA 4A8IA 2V3FA 2P8CA 2NUXA 5LNVA 3DAQA 1TMQA 1A49A 3EXRA 2FKPA 5EMYA 5A8PA 3C0LA 4J1OA 3W7MA 1XIEA 3CL7A 2Q09A 2AGTA 3SGUA 1I75A 5FJUA 3M5XA 2XDFA 1WXYA 1TCDA 3LI0A 3BGGA 4PR4A 1M6JA 1KBIA 3ARQA 3MP4A 3NVTA 4UFMA 3A12A 4C1KA 4LBUA 4CN6A 1QNQA 3LHUA 1U33A 4B16A 5DFAA 4XAZA 1TVNA 1BGGA 1KM4A 1YE6A 3CJPA 3P3BA 5HANA 1W5NA 4GBDA 3UZ5A 1UHVA 4EWND 1TTPA 4B3LA 1Y8BA 3E49A 1XYCA 2KX9A 4K36A 1E1CA 4LYPA 4UXDA 3BE7A 2LLEA 2XIQA 2J66A 3QOMA 2FZNA 3EAUA 2W6RA 2Y5EA 3KHDA 4D6CA 1W3TA 2JEQA 1BXNA 4UUIA 1CPUA 4W85A 4M82A 3BOXA 1I8JA 4MLJA 4R27A 3SRDA 2BFGA 1E1EA 1TELA 4I6VA 3USBA 2ZC1A 1VYPX 3LLFA 4JNYA 4E8GA 3TLQA 4ILSA 1CB2A 4XSLA 2DZAA 3LERA 1K02A 1AH3A 2YW4A 2B7NA 3PC0A 1V51A 1N8FA 1E1CB 3GYCA 1OB0A 3V1PA 3VGHA 4UZUA 2NXHA 2WZHA 2E9LA 3KOYA 1NU5A 1W1YA 3W00A 1MEHA 2W5FA 4NG3A 1F07A 1POJA 3S2JA 2ZA3A 2WSYA 4KCWA 3RX3A 1JCXA 1I1XA 4S2CA 1ZP4A 2IUZA 1EXBA 1WNOA 2CWXA 3DI1A 3S83A 1TJRA 2YGYA 4EP8C 4KIRA 3BANA 3JR2A 3G1VA 3NA8A 4GABA 1P0NA 4CVUA 1ME7A 5AC4A 5CLTA 1W54A 1Q66A 3LEPA 4AWSA 1RQEA 4Q8TA 2AL1A 5CQ1A 4DM1A 1ZAJA 3G18A 1FWJC 4RNFA 1O94A 5M03A 3H2FA 1J0YA 1QVBA 5HMEA 3NAVA 1I2RA 2BNJA 1XLIA 3G1AA 4L1GA 3RO8A 1J2WA 5E0KA 2DGAA 5KZMA 3DESA 3B8IA 5TQLA 2QDEA 5FOOA 5FEWA 1UD8A 4GWEA 1SZGA 4LWWA 4KEZA 4OV4A 3EWYA 3N04A 1UD5A 3VTRA 4JFUA 5HWMA 5G1YA 1OHLA 3CM4A 3FA3A 4GACA 3LCIA 2RDUA 2VUNA 2Z26A 1UPPA 1MXSA 1JULA 1IT0A 4PUWA 1F74A 1B54A 3E0WA 2ZRWA 1JNDA 5U4NA 1CECA 1UH4A 3ABXA 4AHOA 3AO0A 1UWUA 3EWWA 3VUPA 2PS2A 3KP1A 1E55A 4GMEA 3BZGA 1HIZA 3WLIA 2DZBA 2WNWA 1EA0A 3ZR6A 1JCMP 4UQDA 3G1SA 1KR0A 1B3XA 1IV8A 4HYVA 5AOUA 1V7AA 3QLDA 2Z1BA 4LC8A 1R46A 5KSWA 2F6KA 4W8AA 4GQQA 2FVMA 1LYXA 2F2HA 3R89A 4JTUA 1SW0A 1CLVA 2J7FA 3LU2A 4WDTA 5D2WA 4M6VA 3RLHA 1LROA 1W2VA 3UWUA 1FCQA 2QAFA 3L0KA 4ZOEA 3MWAA 1G67A 3P2VA 4G1NA 4Q7BA 3B8WA 3E2VA 4XSMA 1TR1A 4XG1A 1E0WA 4XZMX 4Y8EA 3UJFA 5KETA 1VKFA 3W37A 1UR8A 1XLBA 2A4AA 4N6FA 1VJSA 1EDQA 4I8YA 4P5UA 3DEQA 3OA3A 4ZBCA 6CGTA 3N9RA 3VYLA 2ZZ6A 1XLCA 1RJPA 3B0PA 2Z25A 4AG0A 1KB3A 1Q4WA 1KWKA 1A50A 2ZFAA 3EXSA 2V2DA 2FTPA 3AXKA 2E67A 3QW4B 4KQNA 1WOAA 1RVKA 2GVYA 3WO8A 2VC7A 2FZDA 1TR9A 2V63A 1ZS2A 3W1RA 2B4GA 1IT8A 4IPPA 4L64A 2P8BA 4IT1A 1EC9A 4B9YA 1TE6A 2NVAA 4CD4A 1SSDA 4ZQRA 1TMHA 1TO3A 4WUIA 3AICA 4DYKA 3IJ6A 1S39A 5JBDA 3NQFA 4TX6A 3M44A 4PCNA 3XINA 4FX7A 3KOXA 3PSWA 2ZZ7A 2ZDRA 2ZUTA 1NFBA 1J0KA 3FHAA 4X9YA 1NM9A 2PSNA 5JUVA 2Y2WA 4D71A 5I0DA 3BMXA 5A6AA 3PFRA 1J5TA 1F6PA 2XSBA 5I00A 3S5NA 1NDWA 3KVJA 3WDIA 1F9CA 1TPUA 5AECA 2QCGA 4DJFC 2XIMA 2D2OA 2YKKA 3BSHA 4H6KA 4NZ3A 3AFBA 3UYCA 5GQBA 3KL0A 2ATMA 4S3CA 4H4IA 2CNCA 2Q8ZA 2XN0A 3O63A 5HR7A 3GC2A 2IPGA 2JFEX 1SUXA 4LC6A 2YL5A 4O57A 4MY9A 1E5JA 1YPXA 1K7FA 4FO4A 4G56A 2J9XA 4JTRA 4JHOA 4RNIA 4DAFA 4UTWA 1ZZMA 5RUBA 3CK5A 4GC3A 1SJBA 1QO2A 2UY3A 2YDSA 2WWDA 5FF7A 1RHCA 4LNYA 1B30A 2BBFA 4HYRA 4A4AA 2HEJA 3OYXA 1E6ZA 2NV2A 1GOQA 1J96A 3IS4A 4DLFA 3EZ4A 5HUPA 1E6RA 2RJGA 1EIBA 3IACA 4DYJA 5AZ0A 1H3GA 1ZENA 3MI2A 4TUFA 3FLUA 4HPNA 3VMNA 3WIJA 4YWIA 1JGIA 3WJWA 3BTNA 1GQIA 3CPRA 5FF4A 4W84A 1ECQA 3APYA 4AF0B 1HJWA 1NWTA 3TJ4A 4R5EA 2DSVA 5LXEA 4H1ZA 1M01A 5I3DA 5FCZA 4QBXA 3A4WA 4S3KA 3GNNA 4YYFA 3WQEA 2W0UA 2WC4A 3GIPA 3QZ6A 3MUY1 3NSNA 5AC7A 1CNVA 1J18A 4HK6A 3QW3A 3WK0A 1XH2A 4RCXA 2IXVA 1MW2A 5HINA 1XSKA 2J9ZA 2PDBA 2WOQA 3QPYA 1OFQA 3A3XA 4XK2A 4OUEA 4WJ8A 4E6MA 3NJ3A 4I90A 2JKPA 1OFOA 5D03A 4GHRA 3VC5A 3BMVA 1FKXA 2OOFA 5TD4A 2CBVA 3K5XA 3BGJA 3AISA 3F5LA 1KO0A 3O7UA 2DZVA 1TQXA 1ISWA 9CGTA 1Z41A 3EWCA 2POTA 3QMSA 1V5XA 3UJ2A 5CBJA 4YYCA 4JL1A 4PUNA 4WR3A 2OGYA 4NI8A 1UKTA 1TMLA 2P3EA 3DGRA 1X38A 4JDBA 4K8GA 4JHMA 2XN2A 2ZCGA 2PLMA 4DZHA 2X7WA 1E73M 1E6PA 3H21A 2ZUUA 3P0XA 2QCFA 2WBGA 4IWWA 5FJTA 5LGXA 1XYAA 3BAJA 1F3EA 1S5TA 4JEQA 2WHKA 2BMBA 2POZA 2W91A 1XGDA 3QQ0A 1BF6A 1EKOA 1DJHA 2ZZ1A 1EX5A 2X0SA 3POHA 1LL4A 1T8QA 3TQ0A 4J2MA 1VEMA 2XVKA 4XUGA 2YA2A 4HU3A 1EL3A 1SQ7A 2VEMA 4O16A 5I03A 4CNPA 1V02E 3BG9A 1XH0A 4UNLA 2Y24A 4KGLA 4KS0A 4NNAA 6TAAA 3GDRA 3NGFA 3MSGA 4PB4A 1PVNA 4Q4OA 3PG8A 1AUSL 3T4WA 3G1HA 1FFRA 4ZEPA 3SUWA 3CYJA 1FWWA 5B7ZA 1JCYA 3MUIA 1JDFA 5G4WA 2WSPA 4AVNA 3OZPA 8RUCA 3DG6A 3RX4A 5A69A 1CLXA 3WY1A 1ZTVA 2WSQA 4IOTA 4V27A 1VR6A 2TODA 3PZQA 4HN4A 4QEHA 2RJHA 2TAAA 3B4YA 5A94A 4PFMA 3SW6A 3GU9A 4QFUA 3V75A 4UTHA 5DANA 4P7OA 1DQXA 3PZGA 3BGAA 3GDKA 5E70A 4X61A 1QK0A 1TPVA 1KRCC 1X6LA 3UGRA 4PB5A 5HNNA 2GUBA 1KRMA 3LHVA 4TVCA 2WMGA 1W3NA 4LS2A 3C56A 5A6TC 3WBWA 4EAMA 1C91A 4CCZA 4LVBA 1Q2RA 3GNDA 2NW0A 4CQ8A 3CUHA 1TV3A 3GXDA 4M81A 4FXFA 3RR1A 1GWJA 1JFXA 3GSMA 3MO7A 4Y9AA 3H4XA 4FLOA 4Y6GA 4BEQA 4HNVA 1UP2A 3S9ZA 1M03A 5G4HC 1AMKA 1ADSA 3MANA 4PSRA 3SECA 3W2MA 1RLCL 2V67A 2Z7KA 1K9FA 1B2YA 2JALA 1FWEC 4MJMA 1LRTA 1FHLA 2WHLA 3VOCA 5CPMA 3BCJA 3QVQA 4MUZA 2CXGA 5T91A 3CV7A 4UR9A 1YYAA 3RMJA 2G97A 3ARPA 2R24A 3S1WA 1K70A 3AS1A 3WUFA 2C8NA 4Z2JA 3U5UA 1WZMA 3W82A 3LSCA 2J88A 1IZCA 3WJXA 4DJED 1JDAA 1WCGA 2XSAA 2ZRZA 4H8NA 1QW7A 1U1JA 1M7PA 1PXGA 2EJ1A 3FK4A 3MZNA 1P0EA 4UFJA 1T7LA 1MXGA 2PDCA 3SJNA 2OEJA 3KRBA 2FB2A 4BF7A 3QSTA 3WSUA 1J0IA 4LCRA 1IGSA 4LRSA 3WBYA 4D8AA 3FJNA 3W7RA 3R0UA 2PU0A 3U4AA 2FZMA 1QPQA 2V5DA 3L0NA 2X1RA 1R2RA 3ERPA 3OA5A 3QPZA 2BY3A 4OBRA 4MFEA 3G0UA 4PUEA 1NQ6A 1KGXA 2QLYA 2NX1A 1YBQA 4JTGA 5AHLA 2NQLA 1AQ0A 4NILA 3TWBA 4IQEA 5DMNA 1UMLA 5ABFB 1GPFA 4G7FA 2WVVA 1MUMA 3THUA 1OFAA 2ZUVA 1JI1A 3QLLA 1A5OC 1EA9C 4AZ7A 4F9DA 3TYCA 3RXZA 2GYIA 5I77A 4IG2B 1KM6A 1NEYA 4DO7A 1B3VA 2BY0A 1JPKA 3LZ5A 1XYLA 2PDFA 4CQBA 2I5IA 1KFJA 3MQTA 3C8NA 3S6OA 3N2XA 1RD5A 3KLKA 4B5SA 1KGWA 1P4CA 2UY4A 3UYIA 1SMAA 1D7FA 2I56A 2OLHA 1HX0A 4RNJA 2C1IA 4HMCA 3TA9A 4ACZB 4R88A 3KBNA 2HK0A 2PTZA 1Z89A 2A0NA 1TJ1A 1IEWA 2WSRA 3Q4DA 4GUJA 3QKEA 3A23A 2INZA 3FDGA 1HP4A 4K68A 2VEPA 3PJWA 5A2BA 1PZ3A 5CPQA 3NM3A 3OGRA 3O07A 5C2GA 1W1ZA 2PU1A 2VI0A 1HG3A 1R6WA 4L65A 1XWYA 4G5DA 1EZ2A 3BMWA 5T26A 4XZ9A 1GYMA 4U5KA 4U5IA 5HUOA 3EYPA 3EGJA 3TH6A 3W3OA 5JBEA 1LWHA 1YDOA 2TYSA 4LEQA 3DFHA 3A47A 1W9UA 3TR9A 4Z17A 4V28A 2BB0A 3CB3A 4Q7IA 4DPQA 1NARA 5G2WA 3BVJA 3GVGA 2ISVA 1WAWA 1NOFA 1Z69A 4NT0A 2Z2BA 1KM0A 2CIPA 2CLLA 1TPH1 2HV5A 2J27A 4RZ4A 1FA2A 4AH7A 1XINA 4Z2HA 4X0NA 1IF2A 2YW3A 2Z2AA 2DVXA 2G50A 3AS0A 3TTQA 4XD3A 1CGUA 1FWGC 2XFYA 4AY8A 2IKHA 1L2QA 4DY1A 1FP8A 2GJPA 1JUEA 1IXNA 2C1HA 2Z24A 4WIWA 4EPBC 2BOEX 4PUMA 5XIAA 1J0JA 1GJPA 1PZ0A 4OZOA 5FKYA 2A3HA 1ENUA 3MKKA 1X1NA 3KRUA 3L4WA 2JF6A 4Q8PA 1GEHA 3UZZA 1RP8A 3NQBA 1VEOA 4LT9A 2NVCA 3AXHA 2XGZA 1EJ7L 1J10A 2ZX6A 2RDXA 3AMGA 3NZGA 1DIDA 3OIHA 1M7OA 4KFNA 2OLAA 1R3TA 4PUDA 1O5QA 2GGGA 5FEXA 3TN3A 5EKYA 3ES7A 3FDKA 3LDVA 3UZXA 4FF5A 3FSTA 4CQAA 2R6OA 4AZCA 1E9ZB 5GNXA 3WNNA 2J8GA 4HNTA 3UVIA 2D2HA 2J7HA 4H6EA 3MYPA 3BAIA 1E6SM 2ON3A 3DFQA 1OX4A 3C0JA 4KPLA 2VELA 5HULA 3WNKA 3GDTA 4O12A 3SCQA 4GJIA 1UD4A 4GH1A 1O12A 5HNUA 2ATSA 1EDGA 1XRSA 3NPWA 3ZLGA 3SRFA 3W76A 2PP0A 2Y70A 3IAPA 3RAOA 5AVNA 3L4YA 3P60A 4JKLA 3CTTA 3QYQA 1XLGA 3RPMA 2C13A 3SIMA 4K2SA 3W7HA 1T5AA 3R2GA 3P62A 4WK9A 3S5ZA 1ME9A 4D6JA 1KFEA 2OQLA 3V0SA 1LG2A 4IL2A 3DBNA 3T40A 3CMJA 4OJYA 3H70A 4HHMA 1XS2A 2RKXA 1J8VA 4AXNA 2QNEA 3NGJA 2QJIA 4GLEA 3SSZA 1QMLA 5D37A 2F2KA 4LCSA 3KHJA 1W9XA 3PVFA 1VJZA 2F8QA 2JIEA 5I02A 1KBJA 4NYUA 1EQPA 3O3RA 3MKCA 3SCUA 3APTA 3NQ8A 5LA2A 4XD6A 3E6EA 3SI9A 4NZFA 3TIMA 1EWDA 1OK4A 5E5CA 1VIWA 3ZQ9A 1QI3A 3W27A 2EO7A 1YRRA 1X1ZA 1AJ0A 2ZZ2A 5FJOA 3EKLA 2E0PA 1RA5A 1WBHA 3GM8A 1H11A 4X9SA 4O50A 4P8XA 3O6DA 4DJFD 4LX4A 3VM7A 4HNUA 2R1MA 3E2RA 3ARZA 1ALDA 2PTWA 1V0MA 4HQVA 1XLDA 2PP1A 1K8ZA 1D3CA 4ZB5A 1FHVA 3P61A 4XV0A 4QSHA 3TCEA 4KT2A 4HBKA 4HU4A 2PPGA 3NL5A 1NOUA 2VCAA 3WKZA 5SWUA 3AYSA 2YCKX 2J78A 4MKSA 1OX5A 1XD1A 4ZO6A 3WF4A 3L9CA 4PMYA 4DBSA 3ITLA 3PZNA 4Q6JA 1SO3A 4LPCA 4IIDA 1MEIA 2X8RA 3EEGA 3O6CA 2MNRA 1R9YA 4HNLA 1WV2A 1H0IA 1W1PA 1PKLA 5EPDA 3BO9A 1K9EA 2VEGA 2CLKA 1Z9AA 4HZ6A 3ZJ6A 5BZAA 1VFMA 1E4MM 2XVPA 4GXWA 4LY4A 2NVDA 4YVPA 4MNLA 3SSJA 1UROA 3LLXA 4AHPA 4HU0A 3WNLA 1N55A 4ZOBA 3HPFA 4ADUA 3CBWA 4P7QA 3PZMA 3GTNA 3V36A 2G3NA 1MSSA 4DJEC 4O1CA 1ICPA 4NF7A 2A6LA 4HPXA 4Z0SA 3GLCA 3WQ5A 1AH4A 4GXMA 4RZ5A 2VZOA 3I7QA 4OVXA 4QG9A 1WKEA 3KTSA 1YX1A 4AUBA 1XLHA 2DP3A 5AZ1A 4KCTA 3TX9A 3HF3A 4KEMA 4HSHA 4NJKA 4CNOA 3SM0A 2YL6A 1YEYA 2W62A 2C1GA 1QPKA 3WQ4A 3SDOA 3DDMA 1RLDA 3EPOA 2DT0A 1A47A 2ICSA 4O10A 2ZXBA 4V15A 1VHNA 4M1BA 2D22A 1SVDA 3PUDA 3ARWA 4W9TA 1G69A 3CL6A 3KBVA 1VFSA 5DRCA 6PTDA 5HNRA 1W5MA 3VIHA 1QPNA 4S3BA 3I3BA 4XO6A 1UH3A 1K77A 3GE7A 1FWCC 5MKGA 1V6UA 1KBKA 1KV5A 2JEPA 4RUBA 1Q6RA 1VENA 4HNNA 3QMTA 3TFCA 1JCTA 1L9WA 1VEPA 4NZ1A 3M0YA 1QNPA 1V3LA 3QH2A 1MQRA 3FKKA 3V4BA 1B31A 3MJMA 1KLYA 2QT3A 1W8SA 1OZMA 4QISA 4RXGA 1JZ5A 3KZSA 4NHVA 3ITVA 1TPEA 2Y62A 1ZBWA 4Y90A 5A6LA 3TOYA 3USZA 2JGQA 3OGSA 3ZLFA 3QBUA 1XIBA 4GO9A 1CCWB 5FACA 3HFYA 3B05A 1OGSA 2REQB 5DT5A 3CC1A 4GOAA 3GDMA 4NX5A 1PDYA 4B3ZA 4Y96A 4DEFA 2J7EA 3WQVA 3S9IA 1LQ2A 1IZKA 4QSFA 3H12A 3BV7A 4AVFA 3B9NA 3IAQA 1OGBA 3TYEA 4D72A 1W3HA 3FXGA 3SN1A 1A0DA 3L65A 2XH4A 3MB9A 3EX2A 4GNJA 2YBTA 1LCOA 3UR5A 3QHNA 1OVDA 3LV5A 1IQ8A 1K03A 5AHMA 4WEVX 5CAHA 1PIGA 3NL2A 3UPMA 4PCSA 2BXVA 1SJDA 4LVDA 3GNPA 5FF2A 2HJPA 5BOFA 1NWSA 2FTWA 1K1DA 1NY1A 1GZJA 1B57A 1RVGA 4DWSD 3GFZA 3NO3A 1QT1A 2D0FA 1GORA 4J9JA 4WY0A 4KW2A 4ZQMA 2OJPA 2R82A 2VZVA 3WD4A 3G24A 2AQVA 1DWIM 4G6CA 2HE8A 4ZVJA 4XX6A 3G1RA 4EPDC 4NJJA 4NASA 2YXOA 3OPSA 1ZSXA 4X63A 4ES4A 4BQ2A 5TAOA 4YS1A 3ZJ7A 4GISA 2V9DA 2QMKA 2WMJA 1PYFA 3AJ7A 1OC5A 3C86A 2EBNA 1A3XA 1K3UA 4JTKA 2X2GA 3TE9A 1XUZA 1H41A 3CUJA 3NZPA 1FH7A 4DWDA 5EB8A 4TOQA 3WNOA 2GWGA 3OZOA 1Q7ZA 4HB7A 1L6WA 4QG8A 3WN6A 4RLIA 4ZA0A 4BQ4A 4K6AA 2E5CA 2YPIA 3FNDA 1QAPA 3UU0A 1UKQA 4TR9A 1IR1A 1TV2A 2HE5A 2WM0A 4BHYA 2V6AA 1L6GA 4A35A 3BV4A 3F2CA 1J9YA 4YCOA 1PTGA 3WLNA 5HMFA 1AD1A 1ADOA 1L0PA 1G6CA 2XPKA 3FYPA 3RCMA 3E0IA 4H00A 4DXKA 5C7HA 5CPTA 3PZOA 1C7SA 2AMGA 2XGBA 3G6MA 1F61A 1VFUA 3MI3A 4AD5A 2ONEA 4JTHA 2QUTA 3WQ8A 4YIWA 4RV3A 1IEVA 4S23A 3PPFA 1JG9A 6XIAA 1RBLA 3HPXA 4UTMA 3QY7A 2V38A 4BY3A 1S3TC 5EL1A 1XR2A 4HMEA 1GK8A 5BWFA 2Y8VA 1H61A 1JL8A 1EJSC 2WW5A 5I3GA 1QASA 3W1UA 3G8RA 5F2LA 3LCFA 1XFBA 3W7EA 3PULA 1VFOA 4E3TA 3WF2A 1VFHA 4H19A 5HQLA 4I8DA 1O1HA 1JRBA 2IKJA 2ZX7A 3R8GA 3AAMA 3C4UA 3H23A 5FI8A 4MUPA 5CJMA 4U2YA 1HL2A 2NQJA 2YCEA 1EC8A 1BXCA 1DVJA 4GZIA 1D8WA 3MA8A 5HA7A 1TZ9A 4PUUA 4PH6A 1RY8A 4DJFA 3Q65A 3PANA 5DMYA 4F4RA 5HK4A 1G01A 2X42A 1OF6A 3LXCA 3OG3A 5JH1A 4H9ZA 5KINA 1FFQA 2SFPA 1PV8A 1S5MA 2FIQA 4I9JA 3CUZA 3QQWA 3WL0A 1PL9A 3WQDA 9RUBA 3PWGA 1GCYA 4PL1A 3W84A 5LHFA 3CV2A 1UIOA 1TREA 2H3DA 4RJEA 1CLKA 3W1PA 1SM9A 1PX8A 3TJLA 3WF0A 2GQ3A 5CZJA 3AC0A 3N1AA 3O1NA 4OBSA 3D3FA 1DJIA 5E09A 2NX9A 2DUZA 3M16A 1AMYA 5I24A 4X60A 5C9ZA 3B0VC 1PEZA 2E09A 1RAKA 3B9AA 2J7DA 3R43A 2E8YA 1RALA 3NQVA 4IIGA 3L5MA 3KL3A 3OBEA 2A85A 5AHNA 3VA8A 3VX0A 1V3IA 1TTJA 4FIRA 2VC9A 3KVKA 2WLYA 1KWGA 2WKJA 3UY7A 2WAGA 3KAOA 3THAA 3N9KA 3TOPA 2XM2A 3AYTA 1ONEA 3PUGA 4JQ1A 3GTHA 4CCDA 1I45A 4ZXOA 2W67A 1CXEA 3HTWA 1UQZA 3ZVHA 3VNDA 1BQGA 1JZ6A 4ZTXA 1XG3A 4HGXA 3IVUA 1QW8A 1H7NA 1AJ2A 1X6NA 1UR9A 4DJDA 3FOKA 1L6YA 2H8XA 4ML9A 3VCNA 4OECA 1UQYA 5E6ZA 3VD5A 3M5YA 2D3NA 3IJDA 2GVLA 4O0ZA 3BW3A 3UPBA 3C2VA 2A21A 2Y5SA 2P53A 5FAJA 1ICQA 4GZ7A 2YZ5A 5D2VA 3T09A 4P7LA 4FNSA 4FPSA 3R79A 1A3WA 2PRHA 1X8FA 1K8XA 4C1NA 1O68A 2JIWA 4UC5A 1YADA 3I4KA 3B04A 4IP7A 4JIRA 4GVFA 4WY0B 1EHAA 2QIWA 1NH6A 3RU6A 1I0DA 1P6WA 2OEMA 2RAGA 1XPYA 4US5A 2WKGA 1H50A 2CESA 1HP5A 1UW9A 2ZC8A 3RLGA 4PTVA 2W61A 1IWAA 3QTGA 1SFLA 3M0JA 3WD2A 1OG0A 4NZCA 4UTJA 3PUEA 2XFRA 2VZUA 4EPEC 2V68A 1FTXA 3MDWA 3HQNA 3UXKA 1VD6A 2FH6A 3DUGA 1PO9A 1XGZA 5G4EA 4ERGA 1MMFA 3SUSA 3BCDA 4U10A 4B90A 2PGWA 4N0RA 1AD4A 3WJZA 1H7PA 4JTLA 1RCQA 3LTPA 2IPWA 1DWFM 3WLQA 1E71M 2V8ZA 4P8VA 3QTPA 1E3XA 1S5VA 4XZWA 1R3QA 2DSZA 2ZVIA 4I9AA 1TIWA 3VD9A 2C19A 5MKGB 4N9EA 5D2YA 5LNSA 2EPMX 3AWNA 1TV4A 1FWRA 1OY0A 3DFSA 3LG3A 4F79A 4JTEA 4AD0A 4H7ZA 1FWSA 4HHLA 1KXHA 4QNWA 3CPUA 4QAWA 4BZYA 3LUTA 4OOUA 2BS9A 3LXAA 1XIHA 2OR2A 2D3LA 3A13A 2ZICA 2ZTJA 2WV8A 2NV1A 3UBPC 4AVOA 1NVMA 5IBXC 1QW9A 1EEPA 4IJCA 1I9CB 3V5OA 3SY8A 2VL4A 1XIGA 3PPHA 2J9YA 2F6XA 1GOXA 1US2A 1REQB 4MJZA 2PDJA 1E9YB 4PE8A 4MWAC 1V79A 1R85A 4BI6A 1VFFA 4HIBA 1QI5A 3BLEA 3DECA 5H6HA 2IS7A 3ITYA 2XVGA 3VNZA 1XLAA 3BOFA 4IZGA 4IJBA 3CHVA 1CGVA 1E6XM 2Y61A 3E02A 3E0VA 4MAVA 5DRIA 3M7WA 2CZEA 3RUBL 4YTUA 1QRQA 3TAOA 4L9XA 4F2UA 1GVQA 3WH5A 2QCNA 1U5HA 4JY9A 5BMXA 2GLKA 4IIFA 4WHBA 2DSKA 2QVNA 3WLJA 3HM7A 1W3LA 1EUNA 5D33A 2VCBA 4A3RA 3DCPA 5D04C 1V08A 1FWIC 1UB3A 3CAWA 4H7CA 5K4XA 3BLDA 1UCWA 1YXDA 4GY0A 1OCJA 4ICNA 1F6KA 1ZBVA 5D05A 2PDXA 2J8FA 4MNKA 1U5JA 1EOMA 4HZ8A 1EFZA 3OEXA 5LGZA 3NM1A 2AL2B 2QKFA 2IW0A 5GVJA 5D09A 4P8UA 3VNYA 1V6YA 3MMUA 3MHUA 2Q6ZA 4I6KA 4R53A 7TIMA 2VZSA 2OG9A 4X3ZA 2ZIDA 4IIHA 1TQJA 1DWHM 4GVGA 4RE3A 4DO4A 2D2GA 1JPIA 3VKKA 3LB0A 2QCDB 1TWSA 1XIMA 3E5BA 3ZZ1A 4JXCA 2EPNA 2V3GA 4JTSA 5EMMA 4O1FA 4W86A 4LF2A 3M41A 3SUVA 2XH2A 2CLIA 3C3UA 2QUMA 2ZUMA 3R0KA 1VFTA 2B7OA 4W87A 2NXIA 5ABHA 2PDUA 3H7RA 3BUVA 1CIUA 2IQTA 2YLAA 2ZUWA 4RE4A 1BSLA 4CGTA 1XI3A 1CI1A 1Q65A 4H9XA 2E9MA 1Q6FA 3OBKA 3BLFA 3W2JA 2Y4SA 1UBSA 3QY6A 4LUJA 1Q8JA 1GQJA 2WKLA 4UOZA 3TYZA 4NRRA 5EMKA 3WEZA 2WMFA 3W1XA 4Z2GA 2OMAA 1GG0A 3GU1A 2EG8A 4C6FA 4EWJA 4FSAA 3K8LA 1A53A 1W9BM 2J7CA 4BFAA 4A22A 2ASHA 3IIZA 5TBOA 3R8HA 3CMFA 1WO2A 3NUKA 4H41A 1J0HA 1ITQA 3I65A 1NF7A 3GAYA 1EIXA 2ZRXA 2ZUSA 2PLJA 4LEFA 4P61A 2Z6IA 2VX4A 5D9OA 1W9PA 3PS7A 1GOIA 1L8NA 3AIRA 4AEEA 4W8BA 1LRNA 3AQUA 3GC5A 4HA4A 3MVTA 3PZUA 3DKJA 4L6HA 4M80A 1U5VA 2XH7A 5A8NA 1AFSA 2GSJA 1GQKA 4QROA 2VDIA 1ML1A 3MMWA 1ZAIA 3L2MA 5AFDA 3SN0A 1LJYA 3LBCA 5CSUA 5I3KA 4LVGA 4RXFA 4DBUA 2UBPC 3VIGA 3F2DA 2YDRA 4L4OA 3NQGA 4MYXA 1TUFA 2PWDA 1Y7VA 3GK0A 4MWAB 4P7NA 3GKFA 4CLMA 1GYLA 3HBLA 5AB3A 1XYFA 4JIEA 4OGZA 4J35A 3ITCA 4XO7A 2RFGA 4IQLA 1WXZA 3O2LA 1DJWA 5BXRA 2E8ZA 3AHXA 5M2FX 3EEZA 1H7OA 3IV8A 5MHBA 3NQ7A 4DUOA 3PHAA 1X97A 2V2CA 2PDWA 3N11A 2VR4A 1W9DM 3H8AA 3EA1A 2OODA 3CPGA 4IM4A 1HT6A 5CC7A 1FDYA 1ZNNA 2VKZG 5I2UA 2F38A 4J3SA 4W7UA 4NI3A 3N3MA 4YPJA 4C6OA 3VKJA 3DC0A 1FWHC 1ZJHA 3NL6A 2VQTA 4MHBA 4L56A 3G6LA 2QF8A 1QUMA 4PC8A 3P74A 3NQDA 5DEZA 5LA0A 2GL5A 4YVVA 1ZJIA 3DHDA 3BLOA 1L2UA 3P14A 1O1ZA 4MNJA 2V3EA 1WKFA 1DOSA 1SJCA 4FA3A 3T81A 3V3WA 4IX0A 3EMQA 3WFLA 3G5EA 1BKHA 1X1OA 3U6WA 1R3RA 1LUCB 4K1GA 5LNRA 4AAJA 4MB3A 1CGWA 3RO6A 1KFKA 3W71A 3GHUA 1WZAA 4D6IA 2XHYA 1XCXA 4G2DA 4LB4A 3TAKA 4M3PA 3PJTA 1UR1A 5C9RA 3VNLA 4AIBA 4GC4A 4HTYA 4FXSA 4LH8A 1HJSA 4D6DA 1LLOA 1VYRA 3L0GA 1Y5XA 2PUZA 2VCCA 1TFVA 5FF3A 2VX6A 5CC6A 1RK6A 4OE7A 3WCZA 4MPKA 3AHYA 2V0TA 4OWGA 5ENLA 4CNTA 3GR4A 1MEWA 3BWWA 4O18A 4PBEA 2DZWA 3PB0A 1LUCA 4R7JA 5J5RA 4FI4A 4ZOAA 1LQ0A 1FWDC 4CNNA 1MZHA 4MZYA 4LTSA 3TN6A 3T8LA 1S1RA 4NJHA 3SUTA 4GKTA 5B7YA 4ZFCA 1JI2A 4GKLA 2RUSA 5A6BD 2A3CA 4MVAA 2I17A 1HJVA 2R8WA 1QJWA 4WOQA 1ZP3A 3IK2A 1KGUA 2AKZA 3AIUA 3HB9A 2VOTA 1M41A 4U28A 1XX1A 1OJXA 1VBGA 2BVWA 5JH2A 5JQ9A 3SJ3A 2HDJA 4B2DA 4C6QA 1BFNA 4MB4A 1GJWA 3BG3A 3RCYA 1JD7A 4H9TA 3EA2A 1ISVA 2QVHA 3QZEA 5KEZA 4AZHA 1LORA 1C9DA 4D6EA 4IPIA 1RBAA 3SCTA 1XSIA 4QX4A 3ZSSA 3PZIA 3UD6A 5D9NA 4GE8A 4AWEA 3S3GA 1YHTA 3MC5A 3CT2A 4XZNX 1ZALA 3ES8A 2P5NA 1OWQA 4KGJA 3WQFA 4Q8MA 2E6DA 4DJDC 2HVMA 3WDQA 3MUAA 2PRLA 3WJYA 3TC3A 4GI9A 4ZE5A 4L61A 3AHZA 1RZMA 1W1VA 1M5WA 5BU6A 3WBXA 3L68A 4DWSA 2IXUA 4JAWA 3S42A 1ZJAA 3K13A 4DI8A 3T8QA 1U2YA 1CBGA 6ALDA 2VHLA 1H51A 5I23A 2FMNA 1FRBA 5E6YA 2BX7A 3N4EA 5H2ZA 1EC7A 1EZWA 4OBTA 2ZVRA 4CU7A 4LUTA 5DCDA 5M3WA 3QQ1A 3WZ0E 4C6KA 1DJZA 4PEKA 3NEVA 3FY1A 1HL9A 3TZFA 1FP9A 2G0WA 2XVNA 2Y0FA 1FKWA 4UR8A 2WQDA 4A3HA 2GVJA 2PODA 3GIQA 4JTCA 5CBBA 3EWUA 1M7XA 3U2CA 4BS0A 4ZOCA 3MHGA 5F4SA 2VWTA 3N17A 3BQ6A 4JTFA 1FUYA 4MLRA 1X8CA 2P1FA 1QNSA 2E5BA 3MBDA 4RDWA 3R1ZA 2VTFA 1C8VA 1VB9A 1UKSA 1XM3A 4B5VA 3IVTA 2WPGA 1R7AA 3DG3A 4XBJA 4JYFA 3FEQA 5EMJA 3U8GA 3N25A 2WC7A 4R34A 1KKRA 2ZQ0A 3FKRA 3NQMA 5CZSA 3K2GA 3V1HA 2RDWA 4MWAE 5D9PA 5FAGA 4JIQA 4E2OA 2XIOA 3TC7A 4HHHA 3UZWA 4LU0A 4UOQA 3UGVA 4Z1YA 2H9AA 3NXLA 3MPGA 1XRFA 1E4NA 3CQJA 3P6LA 3DBPA 2OWWA 4E3VA 1AL8A 3RPDA 5IFTA 3HO8A 4J7RA 4A8LA 4BQ5A 3NFUA 2DZPA 2QMJA 2WWCA 1FVPA 2YIHA 4HOWA 3MU7A 2XUCA 2GDVA 4LBRA 2GQ9A 3S47A 4MJ2A 5FJJA 3QV6A 3QGAC 3WH7A 4JX5A 2YYTA 4I9TA 4RW3A 3KBJA 3LHWA 3BAXA 3KDNA 1GVEA 3A6OA 4L5ZA 1V0LA 3WH9A 2VEFA 1PIIA 1PJ9A 1OZQA 4F0MA 5BW6A 3SZ8A 4S3AA 2B7PA 7REQA 3NQCA 1WQ5A 3YPIA 1SW3A 3QOKA 4M5PA 1O6IA 3T55A 1O66A 1UC4A 1NIUA 4LYKA 2E3ZA 3PFMA 1U1UA 1M1BA 1CW2A 1X98A 2PDIA 4LUYA 2ISSA 4XTIA 4ADTA 1IXOA 3IGUA 2QR6A 1D3GA 4HTBA 2DW6A 3KVMA 3RM4A 1QI2A 3KZPA 2VR5A 1LWJA 1ZU8A 3D0CA 4BQ3A 3WENA 1H0GA 3MV01 4ZSUA 3WUEA 3WYZA 4PMNA 9XIAA 1VRDA 4UCFA 1P7TA 6REQB 2V2HA 3QF0A 4ICMA 3IJ8A 1VS1A 5AN7A 1R7OA 2EPKX 1R9XA 1GVIA 1CXHA 4F48A 4PSPA 5GJPA 1EGMA 4CNUA 7REQB 1MDLA 4PTXA 2NLIA 4L6DA 3E0LA 3W7PA 4C60A 2PDPA 4REQB 5HNTA 1JDCA 1KBLA 3AWOA 3KTCA 1W5QA 3M0KA 4UZSA 3OW1A 1VRXA 3LPOA 3DFNA 2E5DA 4O1BA 4PTWA 2Q3OA 1YLVA 3K30A 4I7WA 4BR1A 3S46A 4R9XA 3VOHA 3LRLA 1IXQA 2A7PA 5IHRA 1UD3A 2EF9A 1V93A 3UR7A 4S3FA 1BAGA 4MGGA 3HQOA 4Q8QA 1D8CA 3FSUA 1ZGDA 1TV5A 4E8DA 2XISA 3HG4A 2JE8A 1JXKA 2BVYA 5BOEA 3DIPA 4INFA 4M7TA 4XZIA 4PMXA 4AEFA 1Z48A 1C8XA 3GZAA 3U2OA 4CQ9A 4E4UA 3CQKA 2DIJA 4N2YA 2PD5A 2ZE3A 4XIAA 2G96A 3VFCA 5KTLA 3F03K 3CZKA 2DUAA 3GUWA 2BLEA 4HSOA 1Y65A 1EX1A 2VFHA 4C6MA 4IMAA 3K4AA 3PTKA 5FD0A 1TVPA 1CGTA 1DE5A 4HSNA 3MCMA 3R4IA 3GXFA 3FGCB 1NDYA 1NFGA 1YIXA 2VC5A 5ABEA 2ISWA 4DXXA 3I7RA 4DQWA 1DWJM 3ARUA 5E93A 2GJXA 1ZCCA 3EB3A 2NZLA 3T6CA 1CXFA 1LOQA 4Q8WA 1UR3M 2O4QA 8TIMA 1KLZA 3UCDA 1JPDX 2FPTA 1DJGA 3KOFA 4H01A 3FFSA 3V35A 1GOMA 2FGLA 3L23A 3ONBA 1YE4A 1PPIA 3ANVA 3W1TA 2DT3A 4KWUA 3KCOA 2YBUA 4S3JA 3LA4A 5AC6A 3B9DA 3QYSA 2DJXA 4WRHA 3PB2A 4QE1A 3UXIA 4HJFA 1PKMA 1WUEA 1UIPA 4I5UA 3NEHA 3DHPA 3HQPA 3ABOA 3RR4A 3ZIZA 1XIFA 4WLCA 4DUWA 1E56A 3EX3A 4GA8A 4HPGA 3VOIA 3AS3A 3TNOA 4JL2A 5LSMA 3CZLA 3VIJA 3WEOA 4U2ZA 3AIBA 8CGTA 4MB1A 3LLDA 3E2SA 4Y9OA 1YTKA 3CZJA 3PBUA 4AU0A 2REQA 3TONA 2ABBA 4Y2WA 3ABRA 4FHAA 1S3HA 4M0XA 1UUMA 3W53A 4CD8A 2VO5A 3H54A 4S3DA 3FJ4A 4O0KA 1MDRA 2PRMA 1XCFA 3QJAA 4GUGA 4IMFA 4JCLA 3GTXA 3W1NA 4C6BA 5AC5A 3SY5A 1TZZA 4EKJA 2V5KA 3G0XA 4H8VA 2YOCA 4W7VA 2CLEA 2PBOA 3LY0A 1W1A1 1PE1A 3VXGA 4KEUA 2A7NA 3D46A 1FDJA 1PHWA 2NX3A 5E1QA 3HIJA 3B0XA 4JTTA 1GKPA 3LHZA 3N14A 4RE0A 1HKWA 3B06A 3EPMA 1KRAC 1BQCA 4U33A 5IM51 1OYBA 3DN5A 2JQXA 2PDGA 3W1LA 2VVNA 1JXJA 1UD2A 4PRRA 2G4FA 1LTDA 4IUGA 2PWHA 2HSAA 2FYMA 3VNKA 3UT0A 2EPHA 3ISIX 3LBMA 4HYWA 4JR5A 3VMOA 3K8MA 4US5D 4AISA 1Z3NA 1TV7A 3W0KA 3O0FA 1WA3A 3PJUA 3QGVA 2WVUA 2EG6A 2Z28A 1PAMA 4ZR8A 3E3HA 3PP7A 4AYGA 3MMTA 4IFKA 4PBGA 2P88A 5CAKA 4UWMA 4GINA 1RA0A 4NZJA 3CASA 1R2TA 4RDZA 2INEA 2DZXA 3HMJG 2QDHA 4N42A 2QCEA 2ZX8A 3SCRA 3LS9A 2WK2A 1IZJA 2QXWA 1SO6A 1ITCA 2J79A 2I5QA 1ZY9A 4YJ5A 4QITA 2X7VA 3W23A 4TXEA 2WLZA 1ZL1A 3LPGA 4HPJA 1TRDA 1QTWA 4EOUA 3FV9A 1MRAA 2VFGA 1BWLA 3GVVA 2DPEA 2YX0A 1RP9A 3ICJA 3W6LA 4REQA 4FOJA 4HMDA 1KM3A 1SO5A 4GY1A 3NQEA 2FH8A 3FAXA 3L67A 4AFYA 1IEXA 1AL7A 3UWEA 5EFDA 1HVQA 1V7YA 4ZCWA 4UBPC 2YCLA 4EX4A 5AHIA 4NQ1A 1M3UA 5K4ZA 2MANA 3DXIA 2CKRA 1B3ZA 5T8GA 3SGZA 1UOKA 3KRZA 3ITXA 2WMIB 2C71A 1YKWA 2BASA 3S8HA 3KS5A 3V16A 2FHFA 1UA7A 1R86A 4IQDA 3S6DA 4EXAA 3ABZA 5CG0A 2G3FA 4XVEA 5FIPA 3MUXA 1XKJA 3S5OA 4HMNA 3OHIA 1QHPA 1RY0A 1G7UA 3G2GA 4A8RA 4ZE4A 2F6UA 2HXTA 2P50A 3GVQA 4JKKA 1E43A 1BVZA 4M56A 1VAHA 1EO7A 3WBEA 3FVDA 3TYDA 4DJEA 4YWSA 3T78A 2J47A 5CPLA 4H8UA 4O14A 3VDAA 1SMDA 1HNYA 1UPMB 8XIAA 2HS8A 4AC1X 1JFHA 1HKKA 1DBTA 2PFHA 3WH6A 1QHZA 3N4AA 1IEQA 3VK5A 2HBXA 3G3DA 2PDKA 5C7VA 3GVWA 1W1IE 1GZGA 1Q6CA 1QNVA 3XIMA 3W70A 2ZA2A 3VX1A 1O5XA 1DQUA 2X09A 4HVXA 4WOZA 3ZR5A 4JTQA 2WJEA 3WH8A 3GH4A 2ACUA 1D9EA 3STFA 1A0CA 4DM2A 4JFWA 2FGZA 2GVGA 5BROA 3JZEA 1AZ2A 1AH0A 1AG1O 2ZA1A 4QE4A 4IH3A 4MOZA 4TX9A 2AL2A 3Q67A 4W89A 1WOBA 2VD9A 1VFLA 1JUKA 2WMKA 4QG6A 1F4AA 2ZBTA 4RR4A 1BWVA 4QS6A 3UEQA 2X1TA 3GG8A 2OWCA 4DX3A 3MT1A 2VP8A 3AIWA 1HO4A 1R0MA 2P10A 4HNCA 4LVAA 4OUIA 4ROQA 3BH4A 2WVSA 3A4JA 3TYAA 1BPLB 2FVLA 3OVQA 3LMYA 2B7QA 1BD0A 1A5AA 2TMDA 1FOBA 2FZBA 2J62A 4XTDA 3WD0A 2NT0A 3NPUA 2Y7EA 3EWXA 4IGMA 4F0RA 5DCBA 1GVFA 1SFTA 2CBJA 4K8HA 3OQ8A 1XDMA 1QOQA 3KWXA 3NZRA 4ACYA 3F5KA 4H9YA 4M6UA 3KBMA 1EF3A 3TSDA 3FVMA 5AYBA 3N2OA 3NG3A 4KWVA 4AD4A 1JR1A 2VZTA 4ATDA 3BW4A 3TV8A 5CC5A 1J79A 1EPVA 3WEMA 4R9OA 1AJZA 3T1GA 4J5NA 4PMVA 2Y85A 3EMCA 1XC6A 4QDMA 2IPJA 3O05A 1LT8A 4DVOA 3U4FA 2HWGA 2YB4A 3HN3A 3S1XA 3WQGA 2Q8LA 2QCCA 2QGHA 3U0HA 4HN8A 3LPFA 1M53A 2OYKA 1CEOA 2Z29A 4IFRA 3HFTA 5HDRA 4L1WA 1XXXA 3TK7A 3AIVA 4EK7A 1T40A 2YB1A 4GBUA 1A5NC 4XB3A 4WGHA 4XKMA 2VM8A 3B9EA 4WDXA 2V5CA 1Y0EA 3P84A 2YA0A 3SCWA 3NPVA 1WDQA 4AXKA 2H8ZA 1DEDA 3FHQA 4IGSA 4QLLA 1UZHA 3UW6A 1HVXA 1Q6DA 5M1TA 3STCA 3VGFA 1R9ZA 4GQ0A 5D38A 3P67A 4XUYA 2OQHA 1EPXA 1IHIA 1A5SA 3AS2A 5CPSA 1E4IA 2WBKA 4Y7EA 3VIMA 3CV6A 3QV9A 1QNRA 3IJ7A 1T41A 4JNZA 4BI7A 2CETA 1YDNA 4ZO7A 1WXJA 1J5SA 3O8AA 4MTVA 3HZ3A 4M19A 2DFAA 2D69A 4DB7A 2D2JA 4N7QA 5H1WA 2XFWA 1EBGA 4O4WA 2X1IA 2X41A 1OK6A 2O9TA 3G77A 1REQA 3QSRA 1XG4A 2QGYA 3QFEA 2DVUA 1HKVA 3G1FA 1SZFA 5I78A 1XBVA 4QP0A 3NL3A 4PBFA 3ARSA 3HA1A 1R3VA 3W9ZA 3N12A 3OHMB 3RK8A 5DBUA 1OADA 1HJXA 2OO0A 1A5UA 3GG0A 1Q45A 2X16A 4Z42C 3F2BA 4XAYA 4LOCA 1FDZA 3TYBA 1GYNA 1O60A 4CCCA 3UFYA 1EBHA 3R5EA 1UZ4A 1NFPA 3W29A 4K7VA 4E2VA 2DW7A 3WLMA 1PIFA 1OCBA 1R3SA 2QAPA 2HQAA 3W25A 2DT1A 4MSSA 3K4WA 3RG6A 3TJXA 3BURA 1KD0A 2GJXB 4TV5A 1XLMA 5M17A 1S2TA 4YVXA 2PLKA 3GBEA 5CGTA 4OV9A 2CLFA 4PMUA 2HVNA 3ZMRA 5LA1A 4DZAA 3H4WA 1UKOA 4X22A 1JAKA 3WD3A 3GD6A 2WXDM 3QFWA 3CAQA 3M1ZA 3WQCA 3VZZA 3KXQA 1J2BA 2VOMA 4TX8A 2OB3A 3M46A 1CYGA 1TPB1 3F4CA 3NOEA 3VDGA 3EBVA 3D6NA 3DHFA 4DBEA 4GK8A 1UWRA 1MUWA 1Z8AA 1X96A 1GEQA 2VQUA 3ARVA 1XBYA 3VIKA 4H7VA 1TSIA 4J2PA 5TIMA 5G5IA 2YXXA 1RCOB 4AIOA 4JYEA 1V6TA 4H2HA 4GPNA 3WK2A 4J3TA 1LOSA 4D6HA 1FQ0A 2VT0A 4GYPA 3KL5A 1EP3A 3HJEA 1TKKA 2BXZA 1P0DA 3I6RA 3ATYA 3SGGA 5HR6A 3VNMA 1XV8A 3EOUA 3CUGA 4GRSA 4TV6A 1IWBA 1D3HA 1M9HA 4Q4QA 3IRDA 1PCKA 3AXXA 3CIWA 2XG9A 4DZIA 3QV7A 2Q01A 1UWSA 3V0UA 3PZVA 3HU7A 4L1XA 2C6QA 3E2QA 4MNMA 1YXYA 3H2AA 2GJLA 2VEIA 1ISYA 3GXPA 3UJRA 3QR1A 1EJXC 4LJ3A 3Q45A 5U7SA 4WY0F 1GVYA 4YTRA 2PCQA 4XBKA 2ZXDA 5E0CA 1ZUAX 4ORMA 3SFWA 2OWXA 3AUJA 5IBXA 3CS2A 4W8LA 1VBHA 4LY8A 1E0UA 2WZIA 3NQAA 1QPRA 1TWZA 1OM0A 1HO1A 3FXYA 4EACA 2E68A 3GVRA 4FNTA 2D23A 2RDTA 4FMVA 3QGKC 3WLSA 4C6EA 1OC6A 4ALDA 1WKYA 3VO0A 3W87A 1W17A 1BYDA 3MTWA 4HKPA 1JQVA 3SY1A 3W72A 4RL3A 1G1YA 2WQPA 2QHAA 2QJNA 3CTLA 3VD3A 2PE4A 2AAAA 3UWZA 3LTSA 1B0IA 2YFNA 2ZWYA 1V0KA 4MKVA 1VC4A 1SZRA 3EB4A 3GZ3A 1CXIA 3VKBA 3MUZ1 3LQGA 5HATA 4AY7A 3QR3A 1ZLPA 3AU2A 1LRQA 4WSHA 4WX2A 3AXIA 4KCVA 2G4JA 4NY2A 1JNEA 1JRCA 3NZQA 4Z2IA 1P7TB 8A3HA 3H7UA 3V5CA 1OCNA 2HROA 2GOUA 3TZNA 2XZ7A 2EAWA 2F7FA 5CG7A 3H53A 5BWAA 4GX8A 4GY7A 3COTA 3CQIA 4NKCA 3LCGA 4QR6A 3DYPA 3NOYA 2DZSA 3BJFA 4UTTC 4QQ3A 4KRUA 5BRPA 1AA1B 3A3WA 4FX6M 3PZ9A 3LCWA 3VI2A 4ZGYA 2JF7A 4YTTA 5DXYA 1EOKA 2QPXA 1Q13A 1YPIA 3VM5A 1E1FA 2PDHA 2I5GA 3EWZA 4L7ZA 2HISA 2OZ8A 3VGEA 2J4GA 3K4DA 3N6HA 4QS5A 1JDDA 5BXSA 1P0KA 2CKSA 3THCA 4BWLC 3UNTA 1EB3A 1FCVA 3MKVA 3L5LA 4LS0A 2F84A 1KV8A 5DXXA 4NJGA 2ZXAA 5ABGA 3F5JA 3C0QA 5AYYA 4LUSA 3TQVA 3KUMA 4GNVA 2EPLX 3EX4A 1GQLA 1JPHA 4ATWA 2YL8A 2WO5A 1K4GA 3SEPA 2HNEA 5TF0A 1Z6KA 4XZBA 4I7UA 4PUJA 1I2OA 2DIEA 3KX6A 4AX6A 3VNJA 3R0DA 3N2MA 4HZ7A 3DHUA 5CC3A 1S5WA 3NDZA 4N9CA 4UTFA 5HQEA 1F2JA 3EDFA 3RRAA 3MP5A 3AMDA 2Y63A 2R94A 3QRHA 1J93A 1NP2A 4UOJA 4DIAA 3VU2A 4ASTA 5DMMA 1A3HA 3VINA 4M6QA 4IFKB 3ONCA 3LM3A 1OFEA 1J11A 3HGOA 3VFLA 1YQ2A 4NZ4A 4B4FA 1DIEA 5LZLA 3FJ6A 1IIGA 1MRQA 4UFIA 7TAAA 1W3KA 1G7VA 1E6QM 4IISA 2PCEA 4ADSA 1T0OA 1ODZA 3GQYA 1BRLA 5AYXA 4N9DA 4KMQA 3PN8A 3N6QA 4NP7A 2ZUNA 4GI6A 3KVLA 1L6SA 2AQOA 5CBIA 3WLPA 1NDVA 3URAA 2J75A 5C0QA 2EXOA 3OLEA 4NAFA 2YLLA 3W7DA 3GX9A 3T9PA 3CHFA 3AI0A 3N73A 1JCJA 1EJTC 3IIPA 3WUBA 1RR2A 1TCMA 3GU2A 2ACRA 3IIOA 2PP3A 1GOOA 4KWOA 3VNIA 3LI1A 5IDIA 3L12A 3EDKA 3DYOA 3C2YA 2Y8KA 3STGA 4JGDA 2QIIA 4C7DA 1AVAA 2E1DA 1KTCA 4BKNA 1SFSA 1XQLA 3T0CA 3ARTA 4XKYA 5BCAA 5IXEA 3C2EA 3H2NA 3M6YA 5DELA 4JQ4A 2MUCA 1CGYA 1BYAA 3IJ9A 3RLVA 3WF1A 4F2TA 4Y8FA 3RRXA 4DI9A 2XM1A 3T0DA 1WPCA 3SIZA 5E9XA 4WSKA 4K8EA 2WNQA 4A21A 4V1YA 2WMIA 1XYMA 1ZQ5A 4XAFA 1TPC1 5XINA 2I1OA 1Q63A 1ITUA 4A05A 4F9JA 1UZDA 4LGXA 4AD1A 1WB0A 2BGNE 2ISFA 2EQDA 3E74A 1BTCA 4U31A 4AMCA 2AKMA 2XWDA 4Q32A 2CLOA 1POKA 3KP0A 4UTTA 3U3HA 3RJYA 3MSDA 3D5HA 4XZLX 4ZXLA 4DF1A 4WDUA 4EANA 3UF9A 3PJXA 2ACSA 2D24A 2YSWA 5F7UA 4H9VA 4YL2A 3BW2A 1C8YA 1DQWA 3MZ2A 4PYSA 2GK1B 1Z7AA 3M07A 3VDBA 3TMLA 4UMBA 1OFRA 1DORA 3ITOA 1KFWA 4A2SA 1QPOA 1VPYA 4DNHA 3KFTA 4Y9PA 1LWIA 4W5UA 1MVYA 1O7AA 2QZRA 1MFUA 4IUOA 4Q7NA 1LP6A 4KRZA 3F4WA 2J7GA 1JYVA 3OZMA 2OSWA 2JBMA 3I6TA 2BG5A 3C0SA 4US6A 2QV4A 4R33A 4OFCA 2ZX9A 3GR7A 1TWDA 2HXUA 3ZS4A 3W28A 1UP3A 1LM1A 1ONXA 5M5DA 4E38A 4D1JA 1DXEA 3IARA 4AZGA 1VPQA 2AGKA 4D1IA 3R6IA 3SFKA 5C8BB 3AJXA 5C9WA 5FJIA 1PKYA 1GW9A 5FSDC 5DO8A 1SR9A 4GX9A 2WCAA 3U9IA 4PRTA 1PWLA 4LQ1A 4QCEA 2WCSA 4AX7A 3O15A 4N4QA 3AMCA 2WYSA 3TC6A 1R30A 3EA3A 1EO5A 3FW6A 4PCPA 3LTYA 3ZWTA 1XW8A 2O9OA 1CWYA 2WZEA 3CO8A