3SSJA

Crystal structure of methanothermobacter thermautotrophicus orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-ump
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
214
structure length
214
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of Methanothermobacter thermautotrophicus orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-UMP
rcsb
source organism Methanothermobacter thermautotrophicus
total genus 87
structure length 214
sequence length 214
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ssjA00
2E09A 3S6DA 1ZJIA 4IMCA 1OJXA 1EEPA 2QCDB 1ZAHA 1ICSA 3GAYA 4BF9A 5HQEA 5HINA 3UQNA 1R47A 3L2IA 1GT8A 5KITA 3THQA 3GKAA 1SZEA 4UTKA 3IIXA 1AW1A 4A22A 2Y85A 5FF2A 3IV3A 3ZS4A 4LVGA 4AB4A 4KKXA 5FEXA 5G4EA 3SGZA 3PBWA 5LNSA 4UTIA 1DV7A 4PFMA 3PBUA 4JTEA 1EPXA 4CNNA 4PODA 1FDJA 2C13A 2Y70A 4OHQA 4PL2A 3W7OA 3S1UA 3UPBA 4K6AA 4FF7A 1ZY9A 1GWJA 3KRUA 1EP1A 1W3TA 3UNDA 1LRQA 4HT3A 3PR2A 2QR6A 4JTTA 3N3MA 3UYCA 5DXYA 1I4NA 4IXXA 1Z48A 2E77A 3AO0A 4AWSA 4EOUA 2ATMA 1OYAA 2ISSA 3P8JA 4X3ZA 3FKRA 3TQVA 2X2GA 4GBUA 1FDYA 1EUAA 3F4NA 3UZ5A 1TSIA 3STGA 1SO6A 4DBDA 1OFDA 3A24A 2ZFAA 1JUBA 5GVJA 5AHNA 5CPOA 3SFKA 3RU6A 4FX6M 2C6QA 5F2GA 2ZZ5A 5I3KA 3ZFHA 4JXCA 1RPXA 1TREA 3G0UA 5J5DA 1SFLA 3EWXA 4GUFA 3G1VA 1KFBA 2A7PA 4N9DA 1T96A 5CKSA 3DI0A 1N55A 4QJ1A 3F03K 5BNKA 2BXVA 4O1BA 2JGQA 5HULA 3L0KA 2Y62A 4N6EA 3NL5A 4ZQRA 3FKKA 1FWTA 4IMFA 1XM3A 2C19A 1VPXA 2E6YA 1R2RA 4JTGA 2G96A 3LI0A 4ML9A 3IIOA 4QITA 4Y9AA 5AYYA 2NXIA 3PAJA 3I7RA 5AHLA 1LOLA 3ATYA 2UV8G 4QAIA 3TFXA 1DQXA 3GYEA 3PM6A 1ZENA 2QEZA 1KW1A 3NQMA 1FCQA 1R46A 3VCRA 3WJZA 4GNJA 3E02A 4M19A 1EWEA 2ZDRA 3WK1A 3R8RA 3UY8A 2DZPA 3G0XA 2P1FA 3GB6A 2VEPA 5BMXA 1AG1O 4BI6A 4AF0B 3QSRA 2A6NA 3N9RA 3DU0A 4JTIA 2O7SA 2JBMA 4R53A 4E0CA 3M7WA 4BFAA 4AAJA 3MP5A 1TTIA 3EX6A 1LM1A 1C29A 4DF0A 2TPSA 3ATZA 2R14A 4JY8A 2DJXA 1OX4A 3HBLA 1S5TA 4UTWA 2E5DA 1TRDA 2WNNA 1JR1A 2YGYA 4J9JA 3L0GA 1VCGA 1VH7A 3NZRA 5DLCA 4Q33A 1KM1A 4TMCA 3N14A 1PE1A 3W2JA 3NQEA 3TW7A 4O1CA 4RZ5A 2YFNA 4AVFA 1DJNA 5AFDA 3QC3A 5BW6A 1QPQA 3KRZA 3W71A 2LLEA 2NLIA 2FFCA 3DFPA 1RVGA 4P2VA 4AWUA 4FB7A 4IUOA 3OA3A 2CWNA 1WDWA 3BLIA 3W7GA 3HF3A 3LCIA 2A2IA 4XKYA 3R12A 2BWGA 4JEQA 1DOSA 3QMSA 1FWNA 3W70A 1PVNA 3NEVA 4O57A 2Q8LA 3M9YA 5DBTA 4LW7A 3RFAA 2A1YA 4K39A 4JDYA 3W85A 1ALDA 3LB0A 4JTFA 2DORA 2F7FA 2QCHA 3M5XA 4U4MA 2DP3A 4I9AA 1W37A 1T99A 2H3BA 3C0JA 3UPWA 3V1PA 5G4WA 4Y96A 1WXJA 3CIXA 5D2YA 4TU1A 3HMJG 1F2JA 2ZRZA 3VKJA 2QCCA 1OX6A 1IXPA 4NJJA 2ISWA 3WJWA 2YFOA 4MFDA 4Y90A 4LWWA 1DHPA 1LLZA 3S9YA 4O14A 4LV9A 1VS1A 4FEZA 5SWUA 3BGGA 4GUIA 4TIMA 2DZUA 1G7UA 1KLYA 5HWMA 1ADOA 3FS2A 5C54A 3N34A 2G5WA 2B7NA 3VI2A 4JTKA 1A5CA 1G67A 5FESA 3RF9A 3R89A 3TJLA 4O54A 1TQXA 3L66A 1Z44A 1ZHAA 3GZ3A 3MI2A 3E12A 4UCGA 2QDHA 1XFBA 3WK0A 2NV2A 4K8HA 1K8XA 4ZL1A 3TCEA 1B4KA 3KRSA 4KFPA 1H1YA 2V2HA 2XN2A 4D2JA 3LOTA 4PL1A 4XWUA 1GVQA 4AEOA 3B03A 7TIMA 3P5YA 3LTYA 3OVPA 1LOSA 5D33A 3O63A 3C4UA 1LBLA 2RHGA 3IEBA 1RV8A 2OX1A 4S1FA 3WJXA 4CCDA 3W1PA 3S1XA 3TSDA 3LTSA 5LGZA 2YW3A 1GVSA 3HOJA 5F1VA 2B0MA 2YX0A 2R8WA 3CIWA 2BLEA 4NQ1A 1TQJA 2Q8ZA 4IQLA 1NF0A 5E0KA 4W9TA 4WOQA 4XBKA 1J5TA 3NXFA 3GLCA 5EPDA 3P81A 3QPYA 2F84A 3UXDA 5K9DA 3S42A 4JY9A 1LOQA 3LLFA 3SSJA 3G18A 1O95A 2WJZA 3W3OA 5CPMA 5FF3A 4UTWC 3NPVA 3BVJA 3MYOA 1E51A 1PHQA 4O18A 1BEUA 1YYAA 3C52A 3QMTA 4GXMA 1HUVA 3UWVA 3UWYA 3DFOA 3W1AA 1XUZA 3OEXA 4O50A 4XZ9A 1EUNA 3FYPA 1MEWA 3HG4A 3NQ2A 4ORMA 3P84A 2CW6A 4WXYA 5KMYA 1KTBA 1TJRA 2QAFA 3VE7A 2OZ0A 4FHAA 3TFCA 3PSWA 3HJZA 1EP2A 4UFKA 3H54A 2TRSA 5FEWA 4TX9A 1QPOA 1GQNA 1FWSA 5CPLA 4IPIA 3Q58A 3QJAA 1W0MA 1VYSX 3G0SA 2A7RA 5LGXA 4UR7A 1UBSA 2CLIA 1K3UA 4RK8A 1FCBA 1WX0A 5LNRA 4MKNA 1B3OA 4M7TA 1JRCA 1L6WA 1TTJA 3M16A 2DU2A 4IMDA 3LHUA 5K4ZA 3I7QA 4Q32A 3P61A 3LBMA 2TMDA 1XBVA 2RDWA 5AHIA 1SU5A 4JIPA 3S5YA 4BR1A 2TYSA 2VFDA 4ADTA 1TTQA 4NX5A 3HQ1A 3Q2DA 3CM4A 3M5YA 4NZJA 1S5WA 4QIUA 3N9SA 1YPFA 3EEGA 3GXNA 2CZ5A 3Q37A 1PIIA 3HG3A 4DO4A 1JUEA 3NVTA 3DXIA 3W86A 1KM0A 3TQ0A 1YXCA 3KVMA 1TPVA 2A4AA 3QW4B 2YZRA 4IOTA 3KX6A 2FJKA 3U8GA 2HSAA 3ANYA 4FNTA 3W1LA 4MVAA 2V5LA 4TMBA 5CGQA 4NXKA 3WFAA 4X22A 1K8YA 4KFNA 4HKPA 3UY7A 5J5RA 2NUYA 3P60A 1SW7A 2VXNA 5FEZA 3N2XA 1QR7A 3TH6A 3ELFA 2NX1A 3SZ8A 4PCFA 5AYZA 4ZQNA 1FWRA 1TPFA 3EX3A 1KM4A 1CI1A 4CCCA 3QMRA 1Q6LA 5DELA 1WYIA 3MHGA 3PBVA 3L9CA 3O1NA 3IGXA 3NPUA 1I2RA 4R7JA 2QCFA 3W7RA 3C2OA 4OT7A 3W2NA 8TIMA 4UFIA 2CLKA 1CX9A 3W75A 3BG9A 5DY2A 3HG2A 1OFEA 3L67A 3HPXA 2VEIA 3O06A 3G1XA 3R5EA 3N73A 2B7QA 2O7QA 3USBA 4NNAA 1M7OA 2B7PA 1OYBA 1ZALA 1WA3A 5D04C 3T55A 1VCVA 4I7UA 2GOUA 2H6RA 3NM3A 4JTSA 2QCNA 1XBXA 4JGDA 3DKLA 2D73A 1LRNA 1I2QA 4M6VA 3PUEA 3W7PA 3NYZA 4HIBA 5HMSA 3M0ZA 1JCNA 4HN4A 3D0CA 1ONRA 2I1OA 3DH7A 3L5MA 1QFEA 2YPIA 3W7LA 2EGZA 1ICPA 4RZ6A 1T8XA 1F73A 3ABSA 3PB2A 3PY2A 1J2WA 6ALDA 3DKJA 3EX2A 3L5LA 5BOOA 4MIMA 3PG8A 1W5PA 1TPWA 2CLEA 3TXZA 4AHQA 3PS7A 3DFSA 1XL9A 2BTMA 2V5BA 2X1SA 3GVGA 3HGOA 3CWNA 4HNNA 3LHVA 2WSRA 4EVZA 1L6SA 4X2RA 3M5ZA 1Q6OA 2NZLA 1OX5A 1K7EA 3GX9A 5IBXA 1PV8A 5G5IA 1P5BA 2VEKA 3DZ1A 1ZAIA 5AHMA 3TMQA 1GVFA 5L6UA 2QCMA 3W2LA 3WJYA 3LI1A 5F4SA 5DN1A 4O0KA 2G97A 1SW0A 3I65A 4MYXA 1AMKA 1GTEA 2GJLA 3PUDA 3HGJA 1PCWA 3FOKA 1V5XA 1W56A 2CLFA 1EP3A 4JTHA 4LU0A 1YDVA 2QKFA 1VR6A 1HL2A 3M5VA 4C1LA 5KINA 3QZEA 3L21A 2QJIA 2JKEA 3U2OA 3UWUA 4LVAA 1AK5A 3L68A 3W9ZA 1OF6A 4Z08A 4UFLA 1VGAA 1FDZA 1W3IA 2V2CA 2DZXA 4S2BA 4C1KA 3GK0A 4ONVA 2QCGA 2FIQA 4UMAA 3LX9A 3QQ1A 4N02A 3W74A 1N8FA 2QCLA 3S5NA 4EWND 4O19A 2V2DA 6TIMA 2ZRUA 4N9CA 2BX7A 2CLMA 1QO5A 5K2ZA 2HS8A 4YWIA 4JD4A 4QNEA 3B04A 3NQ6A 3TAOA 1OG0A 3BO9A 5DCDA 2BSLA 3GXPA 3LCWA 5D37A 4AHOA 4JIQA 1KLZA 4NVTA 1KFCA 1K7FA 3BG3A 5ABTA 4OWGA 3O07A 4O0ZA 3LCHA 1FCUA 4GE8A 1GYLA 5CZTA 3MBFA 5D2WA 5AC6A 3W87A 4HNVA 4O11A 5K7JA 1K8ZA 2VFGA 4LS0A 3TA6A 4M6PA 3FFSA 4ZQOA 3B05A 3LM7A 5IM51 1A5SA 1XDMA 1UASA 2C14A 5D2TA 3UWWA 4A2RA 2ALDA 2VFIA 2RH9A 3IIVA 2ZTJA 3MW7A 3KOFA 3BLEA 1G4EA 4LS2A 4JX6A 5HWNA 5HUOA 2KZHA 4FXSA 3E49A 2ZZ7A 3QYQA 2VKZG 4WQ6A 4JICA 4WJEA 4LUJA 1YTKA 1BTMA 2PCQA 4NU7A 3NL6A 5DXXA 5EL1A 4NJKA 3PG9A 3JR2A 3W2KA 4N9EA 1LYXA 5LKYA 2ZBTA 3R2GA 3CLMA 1EB3A 2CZFA 4I7WA 1U5JA 1A5AA 4MFEA 3S1VA 3SI9A 4ADSA 2JGYA 2VENA 1ME8A 3BG5A 1QDSA 2E5CA 2FTPA 2QCDA 4HPJA 1LORA 3TROA 2FQIA 5HJLA 3QW3A 1LRTA 3ABOA 1VCFA 4MLJA 1YDNA 3JS3A 3TNOA 2QUTA 4CQ9A 2R91A 2NWSA 5LZLA 3ABRA 1THFD 1XXXA 1F6PA 3BGJA 4CNPA 5EMUA 4GUGA 3RK8A 1SPQA 1VYRA 4R33A 4DPPA 1UUMA 5IBXC 3PSVA 1M7PA 3DENA 1KV5A 4Z1DA 4JTLA 4H3DA 1LLWA 1SZFA 2FPYA 3A21A 4I7VA 3S5ZA 5CPNA 3EKLA 3ABQA 1FQ0A 1S3HA 3W83A 3KAOA 4ORIA 4LRTA 2ZZ6A 3LHTA 1DBTA 1HO1A 4UXDA 5DY3A 2Z2UA 3EXRA 2H8XA 2P10A 1I2PA 1OYCA 3IVSA 2X16A 1SO3A 1BWLA 5CSRA 4ZMGA 1PHWA 3W1UA 4ALDA 4FIRA 1JCLA 5LHFA 3LERA 1DKWA 3HG5A 4O12A 4DQWA 5D09A 3QSTA 1NFBA 1TYGA 4L4MA 4WOZA 2J27A 1JCMP 3CEUA 2Y89A 2ZQ0A 3NGJA 2WO5A 3IVTA 5EKYA 2RDTA 4XBSA 3TJXA 3MYPA 1NAL1 5FF4A 3NQDA 1H7PA 1LBFA 1FX6A 5D32A 4O17A 4WY0B 3S0CA 3FIGA 2V30A 3M1ZA 2J9YA 1JCXA 3WK2A 4RCXA 3HB9A 2WSYA 4FNSA 4Z1CA 3W7CA 3W72A 2H90A 4LVDA 1YXDA 1TTPA 4O16A 4E2DA 2FB2A 2FDSA 5D38A 4O4VA 5A5WA 3P62A 1TIMA 4QNWA 1F7BA 4YL2A 4LT9A 3I68A 3NZ1A 1Q45A 5TIMA 1OK4A 2VFEA 3FJ6A 3LBCA 1L6YA 2EHHA 4RX0A 3DHDA 5AN7A 4X9SA 2C0AA 2DZTA 3NA8A 4GC4A 1NSJA 1H51A 1BKSA 3OVRA 4PC8A 1QWGA 4GUHA 1K03A 3VE9A 3IRDA 3CU2A 4B5NA 2Z1BA 2V9DA 3W88A 4CQ8A 4UFMA 3DHFA 2BZNA 1KFKA 5K9XA 4E38A 5LSMA 2E6FA 2Y7EA 1QOQA 5F2LA 3EX4A 1KA9F 2W0UA 2FB3A 3A22A 4HSNA 3NOEA 4N4QA 4Y8FA 2GJNA 4AF0A 3TW6A 5I3GA 4MPQA 3DFQA 2RFGA 3W22A 4BWLA 1WBJA 2ZTKA 1Q6RA 4JX5A 1KM6A 5CZJA 3O05A 1CW2A 1FY6A 1HO4A 3I6RA 3C6CA 2OMAA 3G1FA 5AOUA 3ZWTA 1TPH1 4IX0A 4JYEA 2VC6A 4LV4A 4BI7A 3KVKA 3LRMA 4RXFA 3O15A 1WOBA 2YYTA 2V8ZA 4R34A 3S1WA 5I3HA 1M6JA 3R13A 4DXVA 2ZA2A 2NUWA 1MEHA 1FUYA 1RZMA 3PULA 4DBEA 3W7EA 3SJ3A 1WAUA 4GUJA 2C15A 3B8DA 3EX1A 4JR5A 3NNTA 1WOAA 4O52A 1LDCA 2G95A 2E5BA 3LXCA 4NXSA 3PBYA 2PRHA 2GPTA 3A9IA 2CLOA 3BK0A 3G8EA 4FNQA 4O28A 1H7RA 3HIJA 1GPWA 1ME9A 4UTTA 1DORA 3KHJA 3TAKA 3LHYA 4MZ8A 3W07A 1X1OA 3NL2A 3B0VC 2AAMA 4CLMA 4Z1AA 2H8ZA 3TE9A 5AC8A 3LDVA 1GYNA 2NWRA 1JULA 3HO8A 5HR7A 1KM5A 1W5NA 4EIVA 2HS6A 3BARA 3LCFA 3GDLA 3NL3A 1O94A 1R2TA 1VC4A 1YDOA 3QRHA 1F76A 5DCBA 4UFHA 4O1DA 3W84A 3CQ0A 2QUVA 3CWOX 3QF0A 3GDRA 1D3HA 4HPXA 1VYPX 4WZHA 1WV2A 5FF7A 1KFLA 3IGUA 3W7DA 2GVLA 4NJGA 5LNWA 3KVJA 4QISA 3PF3A 4PTNA 1FWWA 5G1TA 1RR2A 3PVFA 4Z1BA 2PRMA 4IMEA 1MXSA 1XKYA 5I3IA 1F74A 1EWDA 3NPWA 5AC7A 3O6DA 1W1ZA 3HGSA 4UFJA 2YCEA 3UWZA 3MHUA 4WY0F 2ZRYA 5C6MA 1SUXA 3WJSA 3GDMA 1QMLA 2VEMA 4LC6A 1VQTA 4WD0A 3LRKA 4QM1A 1HFBA 2W6RA 1F05A 1R2SA 5F4WA 3GNNA 4Y6GA 1XCFA 1PS9A 3TR2A 5D30A 3F1QA 4O10A 5D2XA 4IGHA 3G1SA 1H1ZA 2DZVA 4MJZA 2YR1A 2J24A 5G1YA 3LCGA 3GR7A 1OFQA 4A2SA 4AMAA 5DCEA 2ABBA 1H7WA 1X1ZA 3NQVA 2A21A 5D03A 2ATSA 2Z6JA 1QCWA 3CT7A 4FO4A 3TXVA 4TR9A 1NF7A 2WSQA 3DI1A 4CNOA 3T40A 4MJMA 1H7OA 2TSYA 1O60A 1D3GA 2ISVA 3NQGA 4ADUA 3G22A 3INPA 1Y0EA 3SW6A 3MO7A 2AGKA 4A29A 3K30A 3CB8A 2E1DA 3T44A 3LV5A 3Q94A 1JJKA 3GR8A 2EAWA 3NQCA 4QSHA 1YTDA 1X7FA 3TMLA 5LHEA 4A3UA 3UWQA 1L2UA 2ZYFA 2QCEA 4QQ3A 4N4PA 4FX8A 3GDTA 3HPZA 5F2MA 5D02A 4DELA 1H7NA 1X8FA 2GVGA 5KTLA 1GVOA 5EY5A 3DAQA 1LCOA 3EWWA 1SQ7A 3TV8A 4LVFA 3W7HA 4BWLC 2DZWA 3LRLA 3P67A 2CZDA 3STCA 1V7YA 3W1TA 1A5BA 3E0IA 1U83A 5T26A 4HNTA 3TKFA 1UJPA 1TB3A 4KWVA 1G6CA 1OX4B 1MO0A 3QFEA 4FXRA 1P4CA 4KWWA 2OCZA 3AJXA 3DFNA 3G1YA 3THAA 3W73A 3LHZA 1H60A 1VRDA 3H53A 4UNKA 5FF0A 1F6KA 3UZJA 3L0NA 3VFLA 1HG3A 4UTLA 5I3JA 5K9CA 1GEQA 3EXSA 1SO4A 1TMHA 3RMJA 4UNLA 5C5YA 4HSOA 3S5OA 3NQ7A 3BPWA 3G8RA 5DBUA 1AL8A 3GDKA 3B4UA 1QNVA 3C2VA 4UTTC 4GWEA 1GJPA 2X1TA 2Z0IA 3OVQA 2NX9A 1GG1A 5H91A 1TPUA 4LRSA 4XTDA 5U7SA 1OK6A 1TRIA 2CLLA 2C3ZA 1AL7A 3TQKA 4IXHA 1OFPA 4MOZA 3G1HA 4XKYB 4MYAA 1ML1A 1WQ5A 4H4IA 1LP6A 3W2UA 3B0UX 3G1AA 1G4TA 2NV1A 2CFFA 2EF9A 3MMTA 3NQFA 4NJIA 1OHLA 2Y7FA 2ZRWA 4IMGA 4AWTA 4RZ4A 2WPBA 3G1DA 3QM3A 2JKPA 2NX3A 1ZCOA 3MHFA 4A21A 1SFJA 2QUUA 3EWBX 2B4GA 4UTUA 1QAPA 1R30A 2J9XA 1IF2A 1KTCA 1B57A 1N7KA 1OABA 5F2IA 1D9EA 1G69A 5F1UA 3SR7A 4ZVJA 4U28A 4UMBA 2XN0A 3M6YA 3FA5A 2A5HA 2PE4A 2J6XA 3DBPA 3HPSA 2VELA 5CZ0A 4NZFA 3FJLA 2I14A 3P8IA 3W7MA 1OFBA 1TPB1 2NUXA 2J9ZA 3NPXA 3EWYA 1SW3A 4FNRA 3O8AA 1A50A 4O8RA 1ZFJA 4OU1A 4P61A 4XQ6A 3NAVA 5HR6A 1W5MA 4JN6A 3A23A 4LTSA 2QJGA 1XUUA 3LXBA 5AYXA 3QQ0A 1O5XA 2Y63A 2WKJA 4M6QA 4JX4A 1NEYA 4G1KA 3O16A 4Q4KA 3LLDA 3LV6A 1TJPA 4NNBA 3C2EA 4AXKA 4WUIA 3W6YA 3LHWA 3OG3A 2WV8A 3DFTA 1LBMA 4YXGA 3EWUA 5G2WA 4O4WA 4ZZ9A 3QPZA 2A85A 5KZMA 4JTUA 4M5PA 1I8JA 3LXAA 2GQ9A 3BW2A 2J88A 1SR9A 3KFTA 4LUIA 4Z0SA 1OVDA 1RQEA 3MP4A 4OV9A 1DJQA 1H63A 1KFEA 4RKAA 1YXYA 5KSWA 2RDUA 1JVNA 4FX7A 3CHVA 4M7SA 1KM2A 1Q6QA 2GQAA 4JDBA 5D2VA 3KVLA 2NXHA 1UB3A 3IIZA 1QOPA 1ME7A 4HNUA 2P0OA 2Y88A 2JKAA 4Z0JA 2X30A 1T0OA 1IIGA 1GVRA 2GVJA 4LS1A 1IIHA 1VLWA 4O13A 3G3DA 2FPTA 3T78A 1SZNA 2GQ8A 2JK2A 2W79A 1OFOA 4TO8A 2A0NA 3QH2A 3M41A 1I2NA 1AW5A 3LCLA 2PURA 4DF1A 5CG7A 1FCVA 2HTMA 3CC1A 4MLRA 3UD6A 1UCWA 4LC8A 3W7JA 1QPNA 3MUXA 1SSDA 5LNVA 5KZDA 4ZQPA 5C2XA 2DZSA 2NXGA 3MP3A 1SO5A 2VOMA 1HTIA 1BWKA 2Z6IA 4RR4A 1K02A 2ABAA 3NO5A 4WX2A 1LZOA 3EXTA 2Y7GA 1DVJA 1EIXA 1FBAA 2YYUA 4ICNA 4RXGA 5F4XA 2CU0A 1JQXA 3TC6A 4YMZA 1RD5A 5K3VA 3HGRA 2C16A 2HMCA 4K7VA 3O6CA 1B9BA 5AHFA 2ZZ2A 3BW4A 1IXNA 4FIQA 2QAPA 3CPRA 3C8FA 4K37A 3B06A 5KZEA 1L9WA 4MY9A 3TSBA 3GXTA 2XN1A 2DJLA 3E96A 1OF8A 3SIZA 1KFJA 1A53A 4OGZA 3GKFA 1YPIA 4OE7A 1W8SA 4K7YA 2Q3OA 2A7NA 3T4CA 5HNRA 3MWAA 3S8HA 1FXPA 2WQPA 1PL9A 3N2MA 5FI8A 1GTHA 1Q3NA 3W1QA 1VJIA 5C55A 4OV4A 1P0KA 5AB3A 3KXQA 4O15A 2AQWA 2V0TA 4IPJA 4GRSA 1I2OA 3FYOA 3P80A 4NX0A 4UMCA 3TC7A 4CQAA 1KBIA 4JYFA 3STFA 3YPIA 3SY5A 1RQHA 1TO3A 1UUOA 4UTJA 3M47A 4HHPA 1JCJA 3QEZA 1DL3A 1P1XA 2XFWA 4UTHA 3W23A 1IXOA 4FNUA 4ZQMA 3C56A 1LROA 4EF9A 3RLUA 1ZNNA 2ZRVA 1X6UA 4L4LA 5E93A 1F5ZA 1YLVA 2OT1A 3OIXA 3TU9A 2CLHA 4K38A 1W54A 5I3FA 4LVBA 5E1QA 3FLUA 4DO5A 4AH7A 1G4PA 4LNYA 1H5YA 3M43A 2E6DA 1EA0A 1YADA 1MZHA 3TK7A 1TPDA 2PC4A 4DEFA 1ICQA 5H2ZA 1JQVA 1VZWA 2Q3RA 2ZZ4A 3G3MA 4XUGA 3W7QA 1RQBA 1TCDA 1XBYA 3PUOA 2V81A 4DO6A 3RLVA 1OFAA 3B0PA 3E9AA 3L65A 4BK9A 3W2MA 2R94A 1H61A 3SGUA 4XTIA 1H50A 4JS3A 3M44A 4O1AA 3DGRA 5L9FA 1IGSA 2Y61A 3PWAA 4MY8A 4MZYA 5BRBA 4NT0A 1IXQA 3V75A 1H7XA 1PCKA 4POCA 4IWWA 1KTNA 1W5OA 1P0NA 3CEPA 1G4SA 4NNCA 5AHEA 3IIPA 4RJEA 3BLFA 3GIYA 5EA9A 4JTJA 3LTPA 2EKCA 1TPC1 3MJYA 4CCEA 3BV4A 4N6FA 3U6WA 4OQVA 3P74A 2PRLA 3SECA 3ZR4A 2WOQA 4IJBA 4K36A 2ZA1A 3W1XA 2QF7A 4UC5A 2RKXA 4KFOA 3P7YA 1W3NA 5BMWA 1SSGA 5A8GA 3UXAA 4DPQA 2GUUA 1M5WA 3EKZA 1KM3A 2A6LA 2V82A 2C18A 2YSWA 4UTMA 3GAKA 2WNZA 3TIMA 1TPEA 1W31A 1Z41A 5EBUA 5U4NA 4JYDA 4YCOA 5TBOA 3W1RA 3W7IA 4OBTA 1GZGA 1S5VA 1QO2A 3A5FA 5D05A 3CTLA 1TV7A 3O6YX 2CZEA 2IQTA 1JCYA 4YCPA 1JRBA 4PA8A 4IX2A 1KBJA 1I45A 1VHCA 3L5AA 3NQAA 1JUKA 1DQWA 3LCXA 5G2IA 3VNDA 5K4XA 4N2YA 3EB2A 4PEKA 5EYWA 1G7VA 4WY0A 1WBHA 2WNQA 4S2CA 4YLWA 2I9EA 2ZZ1A 1FXQA 1K7XA 4GFSA 2EPHA 2OT0A 3P82A 1O5KA 4LY8A 3BW3A 4NUWA 2E6AA 3F4WA 1AW2A 2YDAA 4UR8A 4O53A 1SZGA 3A5VA 3W1NA 4MUZA 3RNDA 2YW4A 3C2RA 1XI3A 3NDOA 2VFHA 4LOCA 5G2HA 1W5QA 3NM1A 2Y7DA 2ZZ3A 1Z42A 2FLIA 3TDFA 3ZWSA 3WK3A 4RV8A 5MHBA 2OJPA 5HWJA 4UUIA 3PB0A 3W76A 3NR0A 1XBZA 3TX9A 1O4UA 1GOXA 2ZA3A 2QJHA 2VFFA 5FEPA 3OHIA 4E2BA 3MI6A 3LGEA 2FPVA 4K8EA 4MY1A 1NVMA 2QDGA 3GNDA 3IVUA 1GG0A 3MI3A 4NJHA 3W7NA 1VHNA 3TSMA 3IGSA 3C2FA 4UIOA 5HUPA 2X1UA 2E68A 1ZAJA 2H3DA 4PH6A 3JRKA 3W1MA 3TUUA 1EX5A 1XDLA 2ZRXA 3NG3A 1YTEA 1VLIA 1MEIA 5CSSA 3N19B 5TQLA 4WXZA 4FNPA 4BI5A 1C9DA 3MBDA 4N9BA 5CZSA 1J4EA 4MZ1A 1KV8A 2B7OA 3H55A 4JNMA 2ZCGA 2Y6ZA 3STEA 1B4EA 1C8VA 4AHPA 2C1HA 3PC0A 1TV5A 1XC4A 4RLIA 4ZQCA 2X1RA 3OBKA 5LNUA 1H62A 3I7SA 1MSSA 3G24A 4GJ1A 4DF2A 3W7KA 1QPRA 3C3NA 3NQ8A 3C61A 3FEMA 3T7VA 3P5ZA 4EF8A 4H6KA 2YXGA 3EWZA 1LTDA 1OFRA 1TV8A
chains in the Genus database with same CATH superfamily
3GXFA 3N29A 4IMCA 4PMVA 2PTWA 2FGLA 2QCDB 3GAYA 1SJBA 4LEQA 3DC0A 1J12A 2AQVA 3L2IA 3UQNA 1V4YA 3ENLA 3GW3A 3KTCA 1SZEA 1AH4A 3IIXA 1AW1A 3FGCA 3WNNA 3ZS4A 3RR1A 4IF2A 4KEZA 4LVGA 3B9OA 4CNNA 5EFDA 5TF0A 4PODA 2Y70A 3W7OA 4PL2A 3MA8A 1HKKA 1B3XA 4LX4A 2W91A 3VDHA 1J01A 1N8WA 2OEKA 4FOUA 1FWAC 4TVUA 1UR4A 3UYCA 3N3TA 1I4NA 4EOUA 2ISSA 3P8JA 3L2MA 2X2GA 4W84A 2XUCA 1FDYA 2QVHA 3VIIA 2IPWA 1FKWA 1EUAA 3F4NA 1HKVA 3UZ5A 1JDAA 3A4XA 1TSIA 3VCNA 1FFQA 1MI3A 1OFDA 4Y9OA 1JUBA 1PTGA 3W37A 4LYKA 5CPOA 5DMMA 5F2GA 5EBAA 1J6PA 3E1F1 2BDQA 5A94A 4JXCA 1RPXA 1GOOA 3PZNA 1RK6A 4TVDA 4GUFA 2P76A 1XIMA 3BJTA 3DI0A 1VEPA 2JF6A 5BNKA 4JTDA 3GHSA 3L0KA 3K4AA 3FKKA 3GXIA 1CGYA 3WKZA 1UC4A 3PZOA 3TYAA 3IIOA 5D9PA 1FWBC 3W00A 3ATYA 4QAIA 3MSGA 2UY3A 1DQXA 1OGBA 2QEZA 2F38A 2DSWA 4PE8A 4G5DA 1XF0A 1R46A 1JF6A 1RY0A 2Z1VA 5KEZA 3T2OA 2YB1A 3BE7A 2HVMA 3IV8A 3CZGA 3N25A 1A5NC 4D9PA 3NFUA 1PO9A 3U7VA 5CQ1A 4C5YA 4H8HA 2DZPA 2YL9A 1U5VA 3G0XA 5BMXA 2INEA 2FVKA 4BI6A 2E4TA 2A6NA 2O7SA 1F4HA 4LAZA 3OTRA 4DY1A 3MP5A 1DJGA 1LM1A 1XYZA 1C29A 1UR3M 1UKSA 1QW7A 1POKA 1S5TA 2E5DA 3VTRA 4GX9A 1TRDA 4B5TA 2JQXA 1QPKA 4WHBA 4J9JA 1VCGA 1VH7A 3IJ9A 3Q4DA 5DLCA 4Q33A 1KM1A 3KOXA 1LL6A 3T05A 5DF0A 3FAXA 4ZOBA 3W2JA 3MU7A 1A5OC 5JQ9A 5A2AA 4O1CA 3WQ4A 3DN5A 3QR0A 1RALA 2QZRA 1M04A 2XSXA 5FA5A 2F9RA 1V02E 3B8VA 2FFCA 1JZ3A 1VRXA 1KQYA 3ZLHA 3KZPA 1K8CA 4FB7A 1MVYA 5A6JA 1KBBA 4R5EA 1E73M 5I24A 3HF3A 4XKYA 1XHGA 4RPQA 2O4MA 4B5UA 1FWNA 3KBJA 2Q8LA 3QGVA 3OPSA 4F4RA 2A1YA 4K39A 2VEFA 2XJ7A 4JTFA 3M5XA 4M29A 2PDLA 1W37A 3UR7A 1T99A 3REQB 1E6ZA 2I9UA 4QE4A 2A3AA 5A2CA 1WXJA 5D2YA 1P7TB 3VKJA 1YKWA 1IXPA 3HFTA 1TWWA 4Y90A 1DHPA 1LLZA 3P6LA 1CDGA 4FEZA 3BGGA 4GUIA 4TIMA 1QU4A 1DE5A 2RUSA 3COTA 2XHYA 2G5WA 4AW7A 1G67A 3M0KA 4YTTA 3ZMRA 4LJ3A 1J93A 1Z44A 3MI2A 2WJDA 4EXQA 2VNCA 2Z2BA 1GOWA 1EGMA 2PSNA 1K8XA 4KFPA 2V2HA 3LOTA 4PL1A 4XAPA 1VBRA 2REQA 3WCZA 3BAWA 3LK6A 4GI9A 2GGHA 2GOKA 1LBLA 3BLOA 1JPHA 3TSDA 4PMOA 2YW3A 4G2DA 1R86A 2P8CA 3HOJA 4DUXA 2QHAA 2YX0A 2R8WA 3CIWA 4EXBA 4WK9A 2BLEA 4IQLA 4ZB5A 4U33A 3H2CA 4C6IA 4DZAA 1SFSA 3AS2A 3KP0A 2WJFA 1P6CA 1Q66A 1LOQA 1ODZA 1XX1A 5CC6A 2HPMA 4LPCA 4I5XA 4JFUA 1TVPA 2QUNA 1FHDA 5FCZA 1PHQA 4MWAD 4GXMA 3WFZA 3UWVA 3UZWA 3AMLA 4P8XA 3R8HA 1PYMA 3OEXA 4XZ9A 3BWWA 3HG4A 1CXHA 3IJDA 3GWQA 3HQNA 4IJRA 2HXUA 2QAFA 3VE7A 2OZ0A 3UVIA 4TX8A 4L4OA 3AHTA 2W61A 4B3ZA 3RYSA 1QPOA 4LUTA 5FAJA 1GQNA 3BGAA 3U48A 3H70A 4DBUA 1RHCA 5RUBA 1W0MA 1VYSX 3G0SA 2CKRA 2A7RA 3FGCB 4RK8A 2D20A 1FCBA 1WX0A 5LNRA 3IJLA 2XINA 1B3OA 4DUWA 4M7TA 1UQYA 3LHUA 3I7QA 3IK2A 3VD7A 1FH9A 2B31A 1VFFA 4IP7A 3ZT5A 1SU5A 1QASA 4JIPA 4BR1A 5CBIA 4HJWA 4BCEA 3CV1A 3HQ1A 3Q2DA 3BLDA 3M5YA 4QIUA 3FAWA 1W1A1 1RSCA 4XVEA 1PIIA 3NVTA 1PWMA 1U5HA 3CTTA 1YXCA 2Z26A 2BFGA 1TPVA 2YZRA 2VP8A 3OLGA 1DXEA 4CQBA 4MHBA 3ANYA 2BBFA 3C0LA 4FNTA 4MVAA 2PWHA 4DJFD 4JHZA 1JZ8A 1NQ6A 3V5CA 1XR2A 1YMYA 3AXKA 2W63A 4YTUA 3VDGA 1K8YA 3OG2A 1GKQA 1ZSXA 2VCAA 5J5RA 2ISDA 2NUYA 1EIBA 1BXBA 3U57A 3N12A 3ELFA 3SZ8A 2VR5A 1Q85A 5AYZA 1E43A 4P7LA 3EX3A 2DSKA 4GVFA 1CI1A 1QHZA 3QMRA 1Q6LA 5DELA 4GQBA 3BH4A 4IIFA 3M4HA 3VINA 1JFXA 3L9CA 1V3HA 3NPUA 1I2RA 2PLMA 2F8QA 3CV2A 3AMDA 4MKSA 5DY2A 4WEVX 3OYXA 3O06A 2VEIA 2RJGA 3N73A 4NHVA 4NNAA 2B7PA 4H9VA 3VNIA 4I7UA 3THCA 1DTNA 4ZSUA 3NM3A 2R1MA 4MWAE 4JCMA 4C7GA 4DWSC 6A3HA 3APYA 3VK5A 4GY7A 1M41A 3KW3A 1QI2A 3N13A 3GBEA 4HIBA 4IFRA 5HMSA 1JCNA 3E3HA 2AL2A 1I0BA 1ONRA 2F61A 2Z2AA 2E1WA 3U4AA 3W7LA 1T8XA 4R3UA 3PB2A 3URNA 1J2WA 3WDJA 4LUSA 3L5LA 1TPWA 2CLEA 3O6AA 3PS7A 1XL9A 4UCFA 5BXTA 2V5BA 3GVGA 3VGGA 3GU1A 1SJDA 1ZTVA 3SB0A 3GX9A 2R24A 4S3JA 5G5IA 4HZ7A 3RGTA 4A8NA 1ZAIA 5AHMA 1K6WA 4EACA 2YL5A 3V7PA 2QCMA 3EOUA 1XYFA 3BXWA 3I65A 1OCBA 6XIAA 2ZOXA 4YIWA 1XD0A 3NVDA 4KWSA 1GTEA 3VUPA 1E55A 2POTA 3ZIZA 1PCWA 1V5XA 3FXYA 1IT0A 1NY1A 3ITTA 1XLJA 3WUGA 3WQFA 5C7HA 3WNKA 1JPIA 3L21A 1NP0A 1AK5A 1OF6A 4Z08A 3CUJA 4GNVA 1K4HA 1BYDA 2V2CA 2PCEA 5LXEA 3GK0A 4ONVA 4IPLA 2QCGA 2QNEA 3HPFA 3QQ1A 1DWIM 4N02A 4NZ4A 5HJXA 3SM0A 3S5NA 4EWND 4Z2LA 3LMZA 3T6CA 2B81A 4JN7A 4F9DA 5K2ZA 1PIGA 3XINA 2PBOA 2OB3A 3HZ3A 2PDJA 3NQ6A 3ECQA 5BXSA 5T9BG 1AA1B 4HVXA 3CO4A 3SY1A 3CAVA 2WKLA 3BG3A 3W81A 3O07A 3E38A 3RRAA 1WB0A 1FCUA 5FD0A 4Z42C 2WM0A 4LS0A 3FFSA 4ZB0A 1V6UA 2C14A 2VFIA 4MNJA 3Q67A 2G0WA 3IIVA 3CZ8A 3KOFA 4NZ3A 1G4EA 4ZTYA 4JX6A 4PUWA 1WE5A 2KZHA 4KW2A 4L1WA 1XISA 1ZL1A 4WQ6A 3VIPA 3F2CA 4LAMA 1D2KA 1IE7C 1E9LA 4E3VA 1JG9A 2J7DA 5EL1A 4H83A 5BROA 4NF7A 3O2LA 1XIIA 4N9EA 3M0HA 3R2GA 1EB3A 5HK4A 1XIHA 4QLLA 2YLLA 1ME8A 3DESA 2D2JA 1QDSA 3FSUA 2E5CA 2FTWA 3BUVA 4WKHA 1TWIA 1A3XA 1LL4A 3JS3A 1DJWA 2EXOA 4G6CA 2FZNA 2R91A 1TA3A 5LZLA 1THFD 5BWAA 1F6PA 3B9NA 2IS7A 1SPQA 1VYRA 4R33A 5PTDA 5I6SA 4JIRA 2DSZA 3DENA 1KV5A 4R9XA 2ZE3A 4I7VA 1UD3A 3S5ZA 2CESA 3ABQA 4LUTB 4ORIA 4IISA 1V6XA 4FXJA 4UXDA 2OYMA 4RW3A 3WQOA 1UIOA 4CN1A 2P10A 1I2PA 3GR4A 4EWJA 4QP0A 5BRQA 3F4VA 4PMDA 2QJMA 1F4AA 3M46A 1Q63A 1WNOA 3KZSA 3A12A 5LHFA 2ZUWA 1QI3A 3HG5A 2R9RA 1NFBA 4LFYA 1F3WA 1OADA 4L4MA 3VIHA 3FW6A 3NGJA 3EKGA 3F2BA 2YCLA 5C9XA 3NQDA 3TZFA 1BRLA 3LUTA 2V30A 4LCRA 4B4HA 9CGTA 1G0CA 4KQNA 1UBPC 4HMEA 2WSYA 4YVVA 4Z1CA 4AQLA 4ES4A 1JEZA 4OOZA 4O16A 2FB2A 2PD5A 1ISWA 2R82A 5HQMA 1F7BA 4Y2WA 4YL2A 3VYLA 2Q71A 2YCIX 9XIAA 1A4LA 1Q45A 1XW8A 2PS2A 4GPNA 4F2UA 1WKFA 4UBPC 4HQVA 4UQAA 3DHDA 4MNLA 5AN7A 3AC0A 4X9SA 1EJVC 4CVUA 4HBKA 2DZTA 4IPNB 4Q8OA 1KWGA 4DB7A 3F5LA 2XVKA 4B5NA 2V9DA 2BHZA 1M3UA 4MPKA 4CQ8A 2AGTA 3DHFA 4JTAA 1XQLA 1JGMA 2FB3A 4AF0A 3VX1A 3A64A 1PTAA 3AMCA 4BWLA 3KP1A 1Q6RA 5CZJA 4X0NA 3VNLA 5JH2A 3THDA 3K1DA 2OMAA 2Z1SA 5AOUA 4R27A 4LV4A 2OZTA 4ZXLA 8CGTA 3SO7A 3LRMA 2Z7GA 4AD2A 3ZJKA 5BU9A 2YYTA 4O1FA 5I3HA 2PWFA 4PTXA 2AL2B 4NG3A 4DXVA 1S2TA 3NCOA 1WAUA 3CQHA 3EX1A 2ZWZA 1LDCA 3M64A 2E5BA 4ZFMA 2PRHA 1YHTA 2CLOA 2OSWA 4B92A 4O28A 1PZ1A 1HVXA 4UTTA 3TAKA 3WH7A 3LPOA 3LHYA 3NOYA 3DIPA 1XV8A 2H8ZA 3GNRA 5AC8A 3LDVA 2NWRA 3HO8A 1G1YA 1VP5A 4WDWA 4Q4SA 4B15A 2HS6A 2PDFA 4EX4A 3BARA 3LCFA 2WW5A 5I7GA 4HK5A 3GDLA 2X0YA 3WNMA 3PPCA 1ITXA 1F76A 2YOCA 4PMYA 4UFHA 4O1DA 5DFAA 2QUVA 2VDGA 2IKIA 1R3RA 4PMUA 1E72M 4HPXA 1VYPX 3MCNA 3OQ8A 1WV2A 5HDRA 3H2NA 3W7DA 3LSCA 2WB5A 2QPSA 1TWZA 4QISA 3PF3A 1B3ZA 1RR2A 1OT2A 3GC4A 4A3QA 1MXSA 1F74A 4B16A 1H2JA 5JMUA 5I78A 4A6GA 3WELA 1ITQA 1UR8A 4HK6A 2VEMA 4WD0A 5A6BA 3AMKA 3LRKA 1HFBA 3V1HA 3VOFA 1LUCB 3UJSA 1EJSC 3CL6A 3ICJA 2J24A 3MS8A 3LCGA 3K8KA 5A3HA 4P7OA 3NQVA 3W6MA 4AD4A 3A3HA 1NWTA 2A21A 1QCWA 4FO4A 3K4DA 3TXVA 1XCWA 3DI1A 2CBJA 1MWOA 1RLCL 3CV6A 1R7AA 3INPA 1Y0EA 3L4TA 3T44A 1Y5VA 3LV5A 5BWFA 4PTMA 3Q94A 1JJKA 4KGJA 3SN0A 1YTDA 2Y24A 3RN6A 1J0KA 4YU1A 3QOMA 3QYSA 3QGAC 4JL2A 4QQ3A 1EYEA 2R6OA 3GDTA 2PWUA 4Y9NA 3UNTA 1M65A 2FZ8A 5D02A 2WANA 1X8FA 2GVGA 2YB4A 3DAQA 1LCOA 1TUXA 3DHUA 1OIFA 4AY1A 2FDMA 5I5RA 3W7HA 3R0UA 3LRLA 2CZDA 3STCA 3RM8A 3WSUA 2OO6A 3W1TA 3TN4A 3E0IA 3KE0A 3WD0A 5A8PA 1TB3A 3BC9A 4KWVA 4Q7BA 1IWPA 3BICA 3WNLA 1OX4B 1P4CA 4F3HA 4XD4A 2OCZA 3AJXA 3W73A 4H9XA 3LHZA 4HNLA 1VRDA 3RO6A 4S38A 3WBAA 5CGTA 4OZOA 3UZJA 4S3FA 5C8BB 3EXSA 1EGVA 3VIKA 1V0MA 4HSOA 1MFUA 5IHSA 5DBUA 4URIA 3WF4A 4E8CA 3OJGA 1GG1A 3KBVA 1TPUA 1A5MC 4H2HA 4HZMA 1TA3B 2EEXA 4MOZA 4W8LA 3R6IA 4Q8MA 2EO7A 3UCDA 3IUIA 5BOEA 4YYFA 2OVLA 1IEWA 1EOKA 3BCJA 4XIMA 3B0UX 4P7NA 2CFFA 4DJDA 2D3LA 3I6TA 4JNZA 5A95A 3CMGA 4GG9A 3H21A 1TR1A 2JKPA 4GH3A 4B5WA 4WF7A 4DM2A 4CNSA 1RVKA 3QZAA 2Q01A 3CYVA 2WMFA 1Y5XA 4I9MA 2J9XA 3DYOA 2ALRA 5I03A 1HP5A 1G69A 4V33A 1UP3A 3LN3A 4XZHA 3WLIA 4HA3A 4UMBA 2VMFA 2CZVA 1PEZA 3M6YA 1GOMA 2CC0A 1FKXA 2J6XA 6ENLA 1FP8A 2VELA 1W9PA 4NZFA 2WCAA 3V0TA 2I14A 2VEGA 1HIZA 3URAA 2XIMA 3WDHA 3E2RA 2SFPA 2XWDA 1SZRA 3NAVA 3I10A 1J11A 5HR6A 1W5MA 2Z29A 4JN6A 2XU2A 4LTSA 1QBAA 2QJGA 3LGDA 4NRSA 5AYXA 2O9PA 1O5XA 4PUKA 4Z2KA 4ASTA 4M6QA 3GYCA 3RITA 3L12A 3O16A 3EWDA 3SRKA 3BAIA 3LLDA 1F07A 4FLRA 2GDQA 4GOAA 2XM1A 3CL7A 2OOGA 1RBLA 4K3ZA 4LY4A 3LPPA 4O4WA 4ZZ9A 3UJ2A 1CENA 3O0FA 1BXCA 3BW2A 1Q2RA 2J88A 2QT3A 1SR9A 3AYVA 3KFTA 2VD9A 1YNQA 3FX4A 3BOXA 1KCZA 1KFEA 5GJMA 4FX7A 3OBAA 4W7VA 2UZ9A 1PYFA 2XGZA 5D2VA 1RK5A 4ECLA 3IIZA 1QOPA 4HNUA 2P0OA 3RU8X 2PPGA 4ZSTA 4HP5A 4UZSA 3T81A 1TMLA 4F79A 3T78A 4S3DA 1E71M 2JK2A 2W79A 1CLXA 3QH2A 5DANA 2PURA 2Z4GA 3WYZA 4MLRA 3NDYA 5B7ZA 3PAOA 4KRTA 3TYUA 1KC7A 2DUZA 1SSDA 5KZDA 2HVNA 2VZTA 4H8VA 3ERPA 4U5IA 1DYSA 1SO5A 3WD2A 1BWKA 5C0QA 1K02A 2ABAA 2J4GA 3TVAA 3CAWA 3H2FA 1UZ4A 3T2QA 2Y7GA 2CXEA 4KWOA 2YYUA 3ZJ6A 3C2YA 3WFLA 1R3YA 5F4XA 5K3VA 5BCAA 1N82A 1ECQA 4Q8VA 2HMCA 4K7VA 2D0FA 1ISXA 1L9WA 4MY9A 2EG8A 3UJEA 3E96A 4MADA 2AOSA 3SIZA 3W01A 1KFJA 4OGZA 1BVNP 4OE7A 1W8SA 1UROA 3CH0A 2Q3OA 2A7NA 3A4WA 5HNRA 4Q8TA 2QXWA 1GPFA 1XRSA 3OP2A 3ZM8A 4BQ4A 3B8SA 2D2OA 4ZA0A 3GH5A 5FI8A 3W1QA 4EANA 1MW1A 4MDOA 4L6HA 1EA9C 4AZIA 5CC7A 3VNMA 3GZAA 4L5ZA 1I2OA 3AWNA 4NX0A 2IMRA 1K6AA 3H7VA 3STFA 3IK4A 3WIJA 3I4EA 1TO3A 5IRPA 4DO7A 1X8CA 4HHPA 1JCJA 2HBXA 1UR1A 3ES7A 5C9RA 1DL3A 4DJFC 4FZIA 1IXOA 3H24A 3RLUA 3UZZA 1K9TA 4XAZA 5E93A 1F5ZA 4ZFCA 3TU9A 2ZC8A 5CAKA 3EB4A 1S2UA 5I3FA 2V5JA 4DO5A 1OCNA 1JYXA 1YADA 1YBQB 2FHCA 3BL3A 4XAGA 1C3FA 3CQIA 3AWOA 2E28A 1VZWA 2ZZ4A 3VA8A 4XUGA 4AX7A 1RQBA 2ASHA 4M0XA 3OZMA 2IXUA 3WD4A 2CERA 3L65A 4BK9A 4Q4QA 1H61A 3SUWA 4S3BA 1UP0A 1PX4A 1IGSA 5BRBA 1WDSA 2WVVA 3XIMA 2DFAA 1E1EA 4POCA 1BKHA 1P0NA 4HHMA 1U1HA 4YWSA 3BLFA 3J7HA 2J6VA 5EA9A 1RJRA 5J8LA 1KB3A 4OQVA 4DLMA 2PRLA 3AALA 4M1RA 2P88A 2WOQA 1W9BM 4C6QA 1M5WA 1I1WA 1KM3A 1PKYA 2YBVA 4WDTA 3HV8A 4UTMA 2WNZA 1VFLA 1D8WA 1XWYA 1W31A 3Q45A 4PCPA 5EBUA 1O66A 1M7JA 5TBOA 2XPKA 4OBTA 1Z9AA 1GZGA 1X97A 1QO2A 4KH2A 1DXIA 3G5EA 3CZKA 1CTNA 3O6YX 2BGNE 4CD8A 1OC7A 4IX2A 3O9NA 3R10A 1VHCA 3NQAA 5G2IA 3RMEA 2QDEA 2WWCA 1XQKA 4UZUA 3MDUA 4N2YA 3CXOA 4WY0A 4W85A 4S2CA 2ZZ1A 1FXQA 1V0LA 2EPHA 1QBBA 2GYIA 1O5KA 2O0TA 4J2MA 1AW2A 1W3LA 2ZC1A 4AD1A 3PTDA 1X38A 1XLEA 3W1NA 4MUZA 1QW9A 1LT7A 1MFVA 5J04A 3NDOA 1A5UA 1EGZA 5G2HA 2ZZ3A 2FLIA 2TODA 3DERA 3WK3A 3T0AA 5MHBA 3IWPA 3QGKC 3PB0A 5M1TA 2HXTA 3TX9A 1V6VA 5IXEA 1NWUA 6PTDA 2GUBA 4E6MA 4JFVA 2QJHA 2VFFA 1KXQA 1NOFA 1ZQ5A 1GQJA 5A8MA 2D23A 3FN9A 3VAVA 3MI6A 1E70M 2FPVA 3VZXA 2QDGA 2NQ5A 1RJPA 3TSMA 3OYZA 5HUPA 5CJ5A 4L80A 3KBWA 4KGLA 4PH6A 3JRKA 2YXOA 3W1MA 4HU8A 1XDLA 3NG3A 1YTEA 3ISIX 1MEIA 3CHCA 2J7GA 4WXZA 4FNPA 1TVNA 4JTCA 4H6RA 4N9BA 5CZSA 3B9DA 2PEVA 1SYTA 3QR1A 4JNMA 4DJED 4UWMA 4D6EA 1EPVA 1YDYA 1RP8A 1ITCA 1TV5A 1XC4A 4ZQCA 2X1RA 1AQ0A 3CL8A 1V08A 5GPRA 3IJ8A 4GCXA 4F9JA 3GHUA 4KCVA 4L1GA 2YDQA 1QPRA 3C3NA 1UWTA 3MMDA 4GZEA 3C61A 3L4VA 1UH2A 2Z1KA 1JCTA 4EAMA 2YXGA 3EWZA 1WCGA 4W7UA 3WQPA 4KESA 3WLHA 4X2PA 1EEPA 5HA7A 4C60A 1ZAHA 2WC4A 1PKNA 2OQHA 3VIGA 5HINA 4FR6A 1R47A 4GIYA 4XSMA 1E6SM 3AQUA 3CAQA 5HJYA 3UWEA 1FWFC 4J3TA 4PUNA 2YKKA 1UKTA 3L2LA 3U3HA 4GYJA 5LNSA 1W6TA 1DV7A 3PBUA 4JTEA 1EPXA 1J18A 3BCFA 4W86A 2C1GA 4JHOA 4FF7A 4FLQA 2PFHA 2HJPA 3VIOA 3E0LA 4Z2HA 3KRUA 4J5NA 1EP1A 4JAWA 3T0TA 4HT3A 2AKMA 2HV5A 3PR2A 5BXRA 1GOIA 3SUVA 1BXNA 3N3MA 2XM2A 3B0YA 3TN5A 5DXYA 4LB4A 3HN3A 3AO0A 4AWSA 1OYAA 3FKRA 2V69A 1QI5A 1XS2A 1UD2A 1LWHA 3D6NA 4A4AA 2Y5JA 1GQIA 1IGWA 2IW0A 1HX0A 4BA0A 2X0HA 4DBDA 4XZBA 2OLAA 3A24A 2G4JA 5GVJA 1SMAA 4BQ5A 3RU6A 1EDGA 4OECA 4AC7C 2INZA 1G94A 1W3HA 4RUBA 2ZZ5A 4AZCA 2YXXA 5JH1A 4D6JA 1TREA 3G0UA 3EB3A 2H9AA 3EWXA 1YW1A 3SGGA 1KFBA 4GVIA 4HTYA 2Y2WA 4QJ1A 2JGQA 5HULA 1IEVA 1FH7A 3NZGA 1AZ2A 4ZQRA 1H41A 4IMFA 2C19A 1GJUA 1OGGA 4F8XA 5AYYA 3M0LA 2IQDA 2QVNA 3I7RA 4CQDA 1OIMA 4IICA 3PM6A 5CXPA 3NQMA 3WL1A 2X41A 4QLKA 4LANA 3IJ7A 3WJZA 1FWDC 3E02A 3M0VA 3N2BA 1MUWA 4I6VA 1EWEA 2ZDRA 2OGJA 3WH5A 4C6EA 4WSHA 2P1FA 2P3EA 1Q13A 1AG1O 3GQYA 3QSRA 4JTIA 3S3GA 2BHUA 4R53A 2C1IA 2BP1A 4U31A 4E0CA 4AAJA 2PDHA 4DF0A 3ATZA 2R14A 4JY8A 3U5UA 2DJXA 3A6OA 1SGJA 4ZO8A 4UTWA 1OT1A 1JR1A 3LU2A 2YGYA 1TZ7A 3NZRA 3ARTA 2DW7A 3ABXA 3NQEA 3TW7A 3T0BA 2NW0A 2CLPA 3WZ0E 2XFYA 4PB3A 4RZ5A 3MMWA 2YFNA 5AFDA 1DJNA 3QC3A 4HOWA 1PX8A 2E9MA 1R5YA 4PTDA 3HQOA 1GYMA 3WX7A 1RVGA 1WZAA 4M1BA 1NOUA 4GZJA 4AWUA 1R3WA 3FVDA 4AG0A 2DUXA 3OA3A 4HN8A 2O56A 1ADDA 2QGYA 3LCIA 3AZSA 1NJJA 1PDZA 1V7AA 3V5OA 1PVNA 2V3GA 3NEVA 2GFTA 4HMNA 5A6BD 4KCUA 4EAYA 3OBEA 3W85A 2W5FA 1L8NA 3LB0A 3TR9A 4GBDA 4U4MA 3TTEA 4ACZA 2JEQA 4QDWA 3KCOA 2H3BA 3UPWA 4DNHA 3WUBA 1ITUA 1OX6A 1AFSA 3MKKA 3QY8A 4Y7EA 3UR2A 3NQBA 1IZCA 1ISVA 1YX1A 1TG7A 2ISWA 4NJJA 5I07A 1I6NA 3TYZA 3S9YA 3QHMA 1LG1A 4W87A 3ARVA 5SWUA 4KMQA 3SADA 4ROPA 1XLMA 1ADOA 4S23A 5DRCA 3VNJA 3FS2A 1XPGA 2IPFA 3N34A 4CD5A 4JTKA 5FESA 1X6NA 3RF9A 3R89A 2CXGA 1TQXA 1ZHAA 4UCGA 1H3GA 3UBPC 3WF0A 1K70A 1B4KA 2QDDA 1P43A 3KRSA 3GU2A 4I8YA 3WLQA 2XN2A 4XWUA 1GVQA 4AEOA 1UG6A 2YA0A 4AZGA 1LOSA 1C8QA 3FDGA 4UQBA 5D33A 3O63A 2EKGA 2CHNA 2ACRA 4IFOA 2RHGA 5TAOA 1Q7ZA 2XH7A 4CCZA 3WJXA 4CCDA 3S1XA 4XSLA 1N2VA 2DUAA 3P0XA 4GIRA 4OTKA 3L7RA 5F1VA 4OVXA 3WMLA 4C1NA 3KHDA 3LSBA 2Q8ZA 4XBKA 1H11A 2VZSA 1YNPA 4BEUA 5EPDA 3QPYA 3LPGA 2F84A 4FLOA 4WVXA 3VIMA 4JY9A 3LLFA 3SURA 4S3AA 2QPUA 1BG9A 1ZRQA 3AUJA 5FF3A 3NPVA 4XD5A 3C52A 3QMTA 5IDIA 4ICCX 4B5VA 3S9ZA 3SQLA 4AEEA 1P6WA 3Q65A 3W1AA 4O50A 1EUNA 1W32A 1KRMA 4DJDD 2CW6A 3H23A 2GGJA 4WXYA 3P3BA 2XIOA 1TJRA 4XAFA 5I2UA 3TFCA 4HPGA 1QNOA 3HJZA 1KKRA 3UT0A 4UFKA 2TRSA 4TX9A 4IIBA 4LAOA 1NWSA 5CPLA 1YIXA 4GINA 3Q58A 3P0WA 1ZU8A 4XISA 5I3DA 2CEQA 5LGXA 5AC5A 1JF5A 1MW0A 1UBSA 2CLIA 3B9EA 3NWRA 1XLHA 3M16A 4U3AA 1LLOA 4J40A 3VGFA 1X39A 3LBMA 2TMDA 2RDWA 5AHIA 4C6MA 3S5YA 3UZXA 4BJHA 4WLCA 3CM4A 4NZJA 2BGQA 2VJXA 2HEJA 3GUGA 3Q37A 2CZ5A 3VM5A 5A8NA 4TOQA 3AXHA 1XIJA 4DO4A 1ESWA 3DXIA 3E74A 3W86A 2VCBA 1V3KA 4TQTA 3KVMA 2A4AA 3N2OA 3QW4B 4AZHA 2VX4A 3EZ4A 4HNOA 3RM9A 4B9ZA 1FHVA 1VKFA 1F3TA 3WLMA 1HJQA 1JZ2A 3PP7A 2G3MA 2WHMA 5FJUA 1XINA 3RPDA 2NQLA 3UY7A 4ATWA 3NDZA 3PJTA 2E8YA 1BVZA 2VXNA 1E6NA 3N2XA 3WQEA 3TH6A 1KRBC 4RDVA 1RUSA 2ZVIA 1I9CB 3HTWA 4AZCB 4D6GA 4ZQNA 1FWRA 1TPFA 3WL0A 2H9AB 3B8UA 1CLVA 1CB2A 1SMDA 1WYIA 3AU2A 3O1NA 3IGXA 3W7RA 3QHNA 4Q4OA 3ONCA 3FJNA 5D9MA 1OQFA 2AAAA 1KQZA 4M6UA 3W75A 1KCKA 3T1GA 4AZ5A 3SCPA 3L67A 3QV9A 3H2EA 3R5EA 1EDQA 2B7QA 5AKQA 1P1MA 1ZALA 3T55A 1VCVA 3URBA 1IWBA 2QCNA 3KLKA 3OB8A 3SCSA 2Q02A 1FWGC 1XBXA 3VFCA 1GJWA 3ABZA 3B97A 3DKLA 1WPCA 2D73A 1KGXA 1I2QA 2G41A 4M6VA 4PUMA 5B7YA 2XZ7A 4D71A 3M0ZA 1KWKA 4AX6A 3DH7A 4QEEA 5IFTA 4RZ6A 4PBGA 3WBXA 3ONBA 1JYWA 5DO8A 2PZ0A 3W4RA 3DKJA 3EX2A 5AY7A 2P0IA 5BOOA 4IL0A 1EC8A 3VDBA 2VQUA 2BTMA 4AVOA 3HGOA 4AIEA 2VVSA 2QJJA 2WSRA 3UXKA 1KGUA 3NO3A 3M5ZA 1OX5A 2PUZA 4CNTA 7PTDA 5IBXA 3ITOA 3TMQA 1GVFA 3F5JA 1YNYA 2WHKA 4CQCA 3OGSA 3DUGA 4MWAA 5E09A 2G97A 1HKIA 4U2ZA 4A8RA 2QW5A 3K1GA 4MYXA 3QV7A 2XVGA 4CNUA 3SAZA 1W56A 2CLFA 3ARWA 4JTHA 4LU0A 2QKFA 2ZX9A 3HJEA 7A3HA 1HL2A 4EPEC 5A6AA 4C1LA 5C7VA 2QJIA 2JKEA 3GTFA 3U2OA 4DN1A 1QHOA 3L68A 2WYSA 4LVAA 2BVWA 1F6YA 4IP4A 3L4YA 1SJCA 2DZXA 4S2BA 1XP3A 3VDAA 2FIQA 3LX9A 4MNMA 1REQA 1N8FA 2ZX8A 4EE9A 3PK7A 1KR0A 2IKHA 2HS8A 4UOJA 3H4WA 4YWIA 2DDXA 1O1HA 3VIFA 3POHA 1OG0A 5DCDA 2BSLA 5M17A 4IT1A 4AUBA 2AKZA 4RPPA 3DYPA 4JIQA 1GW9A 1K7FA 2O92A 2VDHA 3P14A 4O0ZA 4I6KA 1TWSA 2J66A 1DIOA 1O68A 4GE8A 5CZTA 3VOCA 2E7FA 2HBVA 3W87A 4HNVA 4O11A 5E5CA 1PX3A 2VFGA 4ZQOA 3LM7A 1O5QA 3WLSA 2GVYA 3VZZA 3LS9A 5D2TA 3UWWA 4P5UA 1JFHA 1JPMA 1V77A 1I60A 3T4WA 3IS4A 4L4PA 1S3TC 3MCMA 2ZZ7A 1D7FA 4LB3A 2X09A 2DVUA 5LYRA 1HN1A 5A6KA 4WJEA 1PUDA 2J8TA 4LUJA 4X61A 3CV7A 1YTKA 2G3FA 5TNVA 3NZQA 4C1NB 5AVHA 4W8BA 4TXEA 1HJVA 1UR2A 3PG9A 5B80A 1GKPA 3JR2A 3VD3A 2NVCA 3UETA 3DX5A 4JQ4A 2CZFA 3PZGA 4I7WA 1S5MA 3AI0A 3VKDA 1U5JA 3SI9A 6CGTA 2FZBA 5FSDC 2QCDA 1LORA 3FA3A 1TCMA 1JIBA 1FHLA 1M01A 1VFMA 3GH4A 2FQIA 3JVAA 4LBSA 4MLJA 1YDNA 4LEFA 1CPUA 5EGRA 2NWSA 4AYSA 4P8WA 1E9YB 1XXXA 4CNPA 1H0IA 5EMUA 3VO0A 4HD5A 2OX4A 3RK8A 3FHAA 2P8BA 3ARSA 1LWJA 4JTLA 1SZFA 3WBYA 2FPYA 1EC7A 1Q6DA 1VFTA 2XG9A 5CPNA 3CYJA 1QUMA 1VENA 1S3HA 2WHLA 3WQ5A 4LRTA 2ZZ6A 4GZ7A 1DBTA 3OIHA 3CBWA 1JD9A 5JIWA 4DIAA 1C8YA 3IVSA 1SO3A 3W1UA 1FTXA 1FWHC 1JZ7A 1E4LA 4O12A 1TKKA 1Q7QA 1DIDA 3EMCA 1TYGA 3K46A 4WOZA 1T40A 2X42A 2RDTA 1AQMA 3TJXA 2CPUA 5LIKX 2WVTA 3GTHA 1LBFA 3UXLA 1FX6A 2BY1A 3S0CA 1XIEA 3TYCA 4QQUA 1KFWA 5CC5A 2AQOA 3HB9A 4GJJA 4XD6A 2VL4A 4FNSA 3W7CA 1YXDA 3V0SA 2YDRA 1HJXA 5C70A 1TMQA 4H9TA 3HPAA 5D38A 4B5SA 4ZO9A 3R79A 2XYLA 4LT9A 3U4FA 3I68A 3NZ1A 1OM0A 1E0WA 3VD9A 1R0MA 1OK4A 2WSKA 3FJ6A 3LBCA 3BAYA 3QTPA 4RX0A 2QPXA 2DZBA 1PDYA 1H51A 1BKSA 3OVRA 4CEXC 4PC8A 1QWGA 3C0SA 1HP4A 1JD7A 3IJ6A 4M56A 4WGHA 3AIWA 1GORA 4AD0A 3R1ZA 3S9IA 5ABHA 2ZX7A 3DFYA 3NOEA 4Y8FA 4NZ1A 1XDJA 4QG8A 3TW6A 3AIRA 4ZR8A 3DFQA 3PJXA 4ICMA 1E6XM 2XIIA 4JIIX 2ZTKA 1Q6CA 4JX5A 1KM6A 1ZGDA 1CW2A 3MUCA 1HKWA 2ISFA 3WQ8A 3G1FA 3SUTA 5XIMA 1TPH1 4IX0A 4RNFA 2QV4A 3PUGA 4JPGA 3V16A 3SSZA 2QJNA 2V8ZA 3CQKA 5JU6A 1L6FA 3ID7A 4DBEA 5KZ6A 2IPGA 4IIEA 2FTYA 3B8DA 1HJSA 3NNTA 1WOAA 2G95A 2VGGA 5H8PA 2D2GA 2XH4A 4PB4A 1E5NA 4NXSA 3PBYA 3EDEA 4DJEC 3G8EA 3GVQA 3HIJA 1GPWA 4EXAA 4MZ8A 3ITLA 2GVEA 1X1OA 3W07A 2ZDSA 3HURA 5BOFA 3TE9A 2FZDA 3UG4A 4BS0A 1BWVA 2PDGA 4TTGA 3SFWA 4GYPA 3IAQA 1W5NA 3RDKA 4ACYA 4AWEA 4EIVA 3BLPX 1BG4A 5EMYA 1IT7A 4Q4MA 4S3KA 1O94A 1R2TA 3WQDA 1VC4A 2G3JA 4GI6A 3CQ0A 5LIUX 3BSGA 2HZGA 2DQXA 2WMIA 4ZB2A 2PZNA 4NJGA 2BB0A 5LNWA 1Z7AA 3N17A 1O12A 2FH8A 2XWEA 4H9UA 4HZ8A 5G1TA 2PRMA 1AH0A 3O6DA 5E0FA 3HGSA 1A4MA 2ZRYA 4B9YA 1HJUA 4ZOEA 1EQPA 4E8GA 4IIHA 2QIIA 4WSJA 1U33A 2HE8A 2BVYA 2HK0A 1PS9A 1Q5MA 4GQGA 1D3CA 4MJZA 1VFHA 2PGEA 3O0KA 1OFQA 2NSXA 4AMAA 3EOSA 1G9HA 1SFTA 4WKFA 2Z6JA 5M5DA 3L4XA 4RV3A 3SCWA 2PDCA 4TR9A 2PTDA 3VNZA 3T40A 4CD6A 1D3GA 3OA5A 2ISVA 1Q2SA 4ADUA 2R1KA 4GI4A 3G22A 1UWSA 5BZAA 4DAIA 3OHMB 2AGKA 4MB3A 1EJUC 5EU9A 1GZ1A 3K30A 4S3GA 2EAWA 3NQCA 1X7FA 3VNYA 3UWQA 4HSHA 1E1CB 1XYMA 4CU6A 4UQEA 3WQ6A 3HPZA 3TYEA 3WLNA 5F2MA 5FJTA 7REQB 1H7NA 2OEMA 3TW9A 1GVOA 4GIAA 1OBAA 3BMVA 1FWCC 4IPPA 3TV8A 4BWLC 4KWUA 3PPHA 1F61A 4NSBA 4FMVA 4ZOCA 1A5BA 3G77A 3TKFA 4PMJA 3PNZA 3F4DA 4EPBC 4KWWA 3DFNA 3G1YA 3THAA 1ODUA 4UNKA 3H53A 4JFSA 3WY1A 4GMEA 3L0NA 3VFLA 1C93A 5I3JA 1SO4A 1TMHA 1M53A 1WZLA 1UD4A 2VVNA 3S5OA 3BPWA 3GDKA 4P8UA 1V3LA 3C2VA 4UTTC 2Z0IA 3OVQA 5E6ZA 3CUXA 3UERA 3KTSA 1H4PA 1OK6A 2CLLA 1GVEA 1A0EA 3HV9A 3CMFA 1OFPA 2VC5A 3E5BA 3GNOA 1VPQA 3RJXA 3UPMA 3BCDA 4JQ1A 3U5YA 4JHMA 2EF9A 1X6LA 3NQFA 1OHLA 2Y7FA 1TE1A 1US2A 2E9LA 3K2GA 4RZ4A 4XZLX 4QAWA 1EHAA 1MRAA 4A21A 4M24A 2QUUA 2VRJA 1CXLA 2B4GA 4UTUA 4YHEA 5HPCA 1ZP4A 1QAPA 3MDWA 3S4TA 1IF2A 1KTCA 2Y8KA 1B57A 3N4AA 5F2IA 2ZVRA 4XAYA 1YRRA 4D6CA 7TAAA 1XG3A 1NTHA 3GVWA 2PE4A 1RCQA 3DBPA 4FPSA 3CHDA 1FHUA 4FOJA 3KTXA 3FJLA 4H2CA 4NRRA 1TPB1 3B3DA 4US6A 2J9ZA 3EWYA 3MO4A 1SW3A 4R85A 3AYRA 1A50A 4P61A 4NASA 1V03A 1U1UA 2I16A 2WKJA 4JX4A 4G1KA 1BSIA 4HOXA 4O8AA 1EJTC 5EB8A 3SN1A 4AXKA 4QE5A 3FVMA 4WUIA 2VR2A 1TELA 3LHWA 1EOMA 1WP6A 2ODOA 2WV8A 3OG3A 3EWUA 5G2WA 5ABGA 3CZEA 3VGHA 3QPZA 1VFOA 2A85A 1IV8A 4A8IA 4JTUA 1RPKA 4H7ZA 3GHTA 4DYKA 4UNIA 1MQPA 3QPEA 1OVDA 4A8LA 3WEMA 1OB0A 4F2TA 2RDUA 1JVNA 3FCPA 1X98A 3FV9A 3JZUA 4M7SA 4DWSB 1KM2A 3WQVA 1HL9A 2GQAA 1WDRA 2WPGA 1OC6A 1DJHA 3ITYA 2UY2A 3MSYA 5A6TC 2WZTA 2X30A 2PMQA 3CQJA 1GVRA 2GVJA 2CWXA 1VLWA 4N0RA 2FPTA 1SZNA 1UWRA 5HMDA 2Z1WA 3V5FA 2FH6A 4TO8A 1I2NA 2WZEA 1OCQA 1Z3NA 1VEOA 2IKGA 5C9UA 2BNJA 4F0SA 1NM9A 4IJCA 4QDMA 1UCWA 3EPMA 5C2GA 5LNVA 4AZBA 3E2SA 5FJRA 1OD0A 3HU7A 2DZSA 3VC6A 4DWDA 4KERA 3H7RA 4WJXA 3H4XA 1HTIA 4WGXA 3MC5A 1XYAA 1QI0A 2EG7A 2FKPA 3MVTA 3R25A 3NO5A 3W0KA 2ZUUA 4DZIA 2BODX 1DVJA 3UG8A 4PMQA 2JE8A 1W1PA 4DJDC 2CU0A 3S6TA 1FWJC 3GXDA 3AIEA 3TC6A 2FGZA 5FJPA 3N9KA 1B9BA 4JL1A 2ZZ2A 4BKNA 2OPJA 1IXNA 3CPRA 4HJFA 2D1ZA 3C8FA 3QC0A 2WMIB 5KZEA 4G9PA 3ARQA 3GXTA 1CXEA 4FF5A 2CHRA 4R7WA 3WO8A 3GKFA 3ME3A 1S46A 1B5TA 3BAJA 3S8HA 4QS6A 4LCSA 1FXPA 3BURA 1Q3NA 5E70A 3N2CA 3AYTA 3BQ6A 5AB3A 2V3EA 3CH9A 4GRSA 4X63A 2E8ZA 3P80A 2WWDA 3TC7A 1W3JA 1XGDA 1AODA 4UTJA 2YBTA 7CGTA 2J77A 4FNUA 5ECVA 4ZQMA 1GKRA 1QATA 4EF9A 4I9JA 1SM9A 1ZNNA 1X6UA 2OT1A 5JBDA 2GSHA 3RR4A 4K38A 4LVBA 3R8GA 4AH7A 1QT1A 3JUGA 3ZXWA 3LPFA 2DT3A 2E6DA 1EA0A 4O1EA 3T0CA 2XZ9A 1UP2A 2PC4A 3GM8A 1ICQA 1JQVA 3G3MA 3CHEA 1TCDA 1HXJA 2POZA 4FOKA 2ONEA 1UHVA 2CNCA 2ZE0A 2V81A 2XVNA 4DO6A 4Z2GA 1OFAA 5H8UA 3GG8A 4XTIA 1H50A 2GSEA 3M44A 1J0HA 5L9FA 4MY8A 4V1XA 3V75A 4TX6A 3VOIA 4HTBA 1W5OA 2OKTA 2CBUA 1UMYA 2VDIA 1W1B1 3M6DA 4Q8QA 2EKCA 4CCEA 4QJ3B 3ZR4A 3ANVA 4K36A 2ZA1A 3R58A 1M68A 2RKXA 2J7HA 1EF2A 4KFOA 4Q6JA 1UZDA 2WM1A 2Z25A 5BMWA 3UXAA 2A3EA 2YJQA 2V82A 4ZODA 3VIJA 4OUIA 5E6YA 3BQ5A 1KRAC 4U5KA 1R9ZA 5BYWA 5C9ZA 1TPEA 2PP3A 1QRQA 5U4NA 3RHGA 3UR8A 3DEQA 3W1RA 1S5VA 1UA3A 1XLIA 2OQLA 3GU9A 3A5FA 8XIMA 3UCCA 1TV7A 3SCNA 1IWAA 4YCPA 4IG2A 2PU0A 1JGIA 3N11A 4QFUA 4GVGA 1PTDA 1I45A 1NH6A 1WAWA 3RX3A 1DQWA 3LCXA 2GQ3A 1QI4A 4F0RA 3VNDA 4NAEB 4ENLA 3EB2A 1WBHA 2WNQA 2GJRA 2ADAA 1L6GA 4BY3A 2E3ZA 1EJRC 3HM7A 2BOFX 4GFSA 4IL2A 3BW3A 2PGWA 4DX3A 2YDAA 4UR8A 4PMNA 1ZJAA 3U2CA 3A5VA 1W8GA 2YW4A 3C2RA 3RO8A 4D6FA 3ORWA 4KEMA 1V8EA 4GD0A 1XYCA 4IH3A 1AUSL 3S83A 5HWJA 3W76A 3WLOA 1AZ1A 4V15A 3WDIA 1E6QM 4PUJA 4XO6A 4ZXOA 7XIMA 1GEHA 4LSBA 1T8QA 3GNDA 3IVUA 1GG0A 4NJHA 3W7NA 3N2TA 5BXPA 3TN6A 2ZUVA 3IGSA 4QE1A 2X1UA 2E68A 2J75A 1GVYA 3SRHA 1R3VA 3TTSA 3WNOA 3N19B 5TQLA 3KS5A 3N18A 1GOKA 4B5XA 1J0YA 1XJBA 3ZLFA 1J4EA 4MZ1A 1XYBA 2WHJA 1KV8A 1QK0A 3H55A 2OTDA 3GIQA 4QBXA 4GIEA 1C8VA 2ICSA 2YIHA 3CAKA 1U1JA 5LNUA 3TTQA 1UA7A 4D8LA 4H9YA 3RX2A 1B1YA 3B9AA 2OODA 4Y9PA 1W1VA 3FEMA 3T7VA 3FNDA 4B91A 4GK8A 1DIKA 4GISA 4DXKA 1LTDA 1OFRA 3N6QA 5GNZA 3S6DA 1ZJIA 4JKLA 3UZYA 2F6UA 4KPLA 1ICSA 1XLBA 3WQWA 5HQEA 3EWCA 4Z17A 1GT8A 3APTA 3S2MA 1Q7MA 1H1NA 3GKAA 3C3UA 5HBFA 1F3XA 3A9BA 5FF2A 1XRVA 3MVIA 1WDPA 3UXIA 5FEXA 4ZBCA 4AB4A 5HNUA 5G4EA 3SGZA 3WNPA 4UTIA 1B3VA 3MANA 2ACUA 5EMKA 1KCXA 4OHQA 2Q6ZA 1M1BA 1DEDA 1ZY9A 4NZCA 4AIUA 3BOLA 1LRQA 4QRNA 3NEHA 2QR6A 1JXKA 4GX8A 4R7OA 1Z48A 2E77A 1QK2A 2ATMA 3KCLA 4M80A 3TQVA 4GBUA 3V3WA 3A13A 3AYSA 2P50A 3RPTA 4AZ6A 2GGGA 4U3CA 3QR3A 2ESCA 3BMWA 4QTGA 1X1NA 5REQA 1LUCA 3S47A 2ZFAA 5AHNA 1MZRA 4FX6M 1HL8A 2PDUA 3OU8A 3THUA 1A0CA 2YLAA 2O9RA 1QWKA 3G1VA 1T96A 5CKSA 3OO2A 4O1BA 3AXMA 2Y62A 4N6EA 3NL5A 4DWSD 1HT6A 5LIWX 1FWTA 1XM3A 2E6YA 2CBVA 4JTGA 1HKMA 3LI0A 1JDFA 5AHLA 1LOLA 3MSRA 2DZAA 3GYEA 3WQCA 1KW1A 4EKJA 2IUZA 1VBGA 2FMOA 4GNJA 1KR1A 5BU6A 1IEIA 2VYOA 4ZE5A 2L5HA 2RGLA 1J6OA 3WK1A 4J28A 1HZYA 3SUUA 2GDUA 1AJZA 1FH8A 2X2YA 3PBGA 3GB6A 2PDWA 2VEPA 2C91A 3ARRA 3T8QA 4M51A 1XG4A 4GZIA 4BFAA 1TTIA 2WAGA 3EX6A 1A80A 1K9FA 1E9ZB 2D2HA 3KS6A 1OX4A 4ROQA 3V36A 3SDOA 3N15A 2VO5A 1VD6A 1XH0A 2VZUA 4MB5A 4YJ5A 3K4WA 3G2GA 3G6MA 4X9YA 4AVFA 3PFRA 4PMZA 3W71A 2LLEA 4KT2A 1PZ2A 2NLIA 4BEQA 1S2CA 4DJEA 3DFPA 1GUVA 2ANUA 3S2CA 4IUOA 2WMJA 1WUEA 3W7GA 4C6LA 1R3SA 4C7FA 1J96A 1NQKA 4ERIA 4JEQA 3AIQA 3RIKA 3QMSA 1DWFM 3W70A 3U2EA 2QYGA 3W27A 3M9YA 2WQDA 3MPGA 4H7VA 4JDYA 1ALDA 3UYIA 2QCHA 2DP3A 4QROA 1JNEA 2OQYA 2CHOA 1G01A 4U10A 3ZJ7A 3V1PA 4G56A 2PLJA 1A0DA 5G4WA 1OZMA 4TU1A 1F2JA 4PR4A 2QCCA 4PN2A 1CYGA 4E2OA 4GABA 4IG2B 2YFOA 2E25A 4N42A 4MFDA 4LWWA 2RAGA 2ZIDA 4O14A 3H4GA 1RCXB 1G7UA 1KLYA 5HWMA 3RLGA 3DFHA 5C54A 2B7NA 3VI2A 3TJLA 3M0MA 2J7BA 3WBEA 4O54A 4ZEPA 3L66A 3GZ3A 1XICA 2VHLA 3RCYA 1XFBA 3WK0A 3WEZA 4RNJA 1GQLA 3V35A 4JFTA 1UKQA 3B03A 2OR2A 7TIMA 1UR0A 3OVPA 1CXFA 4Q8NA 3IEBA 1IQ8A 1RV8A 3SRDA 4H19A 3MTWA 5LGZA 4AZ7A 4C6BA 3AIBA 3EYPA 3OGRA 3PZ9A 3KLLA 1YQ2A 4ATDA 4OBSA 1TQJA 5E0KA 4JZ5A 3ZSTA 4QDPA 4WOQA 1CT5A 3NXFA 3WBWA 4L9ZA 3GLCA 4XO7A 3M0IA 3MB9A 1RAKA 3CJPA 5AYBA 3SSJA 3G18A 4IHCA 3NURA 3MV11 2WJZA 5A69A 1V0KA 4W7WA 1KKOA 5CPMA 2EPLX 2XVPA 4UTWC 3BVJA 1E51A 2FVMA 1JZ6A 1YYAA 1C9WA 4PMXA 1HUVA 4H7CA 3L4ZA 4QX4A 4IGSA 1A47A 1XUZA 4WKAA 3FYPA 2Y0FA 4ORMA 4XZNX 4C90A 5KMYA 1LQ0A 3CUFA 4FHAA 3AUOA 2PWVA 3LNPA 3PSWA 1EC9A 1GQKA 2WZIA 5FEWA 1FWSA 1EBHA 3QJAA 2XTKA 1HKJA 4UR7A 1K3UA 5A2BA 4MKNA 3VZYA 3U7BA 1Y7VA 1JRCA 1L6WA 2PDMA 3AZTA 4IMDA 1VIZA 4Q32A 2VX5A 1XBVA 3CWHA 1US0A 2QV5A 3W38A 2TYSA 2VFDA 4ADTA 1TTQA 2EG6A 1YPFA 4C6PA 2GZXA 3QKEA 3HG3A 1JUEA 3S2JA 1KM0A 1T7LA 4HA0A 3TQ0A 1EX1A 4IOTA 3KX6A 3CGTA 4LYPA 2DVXA 2TAAA 2V5LA 4TVCA 5C71A 4NXKA 1E0TA 1NDWA 3D47A 4AYGA 5AYIA 3H2AA 5REQB 4H01A 1TZ9A 3P60A 1SW7A 1LL7A 4PCSA 5FEZA 1QR7A 1V6TA 2NX1A 1Z32X 1WXZA 3EDFA 1VJSA 5CJMA 4JKMA 3SBFA 3UGVA 4ERAA 4CCCA 2VRKA 3PWIA 4QR6A 2NVDA 4PSPA 1JL8A 1O6IA 3M7SA 3PJWA 4G8TA 4OT7A 1QXLA 5FJIA 4LAUA 1CX9A 4CKQA 2W67A 3HG2A 3BAXA 1OFEA 3G1XA 3TC3A 1M7OA 1YBQA 1OYBA 1WA3A 5D04C 2UWFA 6TAAA 3A47A 4LBRA 2INFA 3KBMA 2OO0A 3MUZ1 3EPOA 3DHPA 3W02A 4DM1A 4JGDA 3CT2A 4PTVA 1QHPA 4XBJA 3WLJA 4AXNA 3W7PA 3N6JA 3GTIA 3LENA 3CB3A 3D0CA 2I1OA 4J3ZA 1XGEA 4P7RA 1NWRA 4K8GA 1O7AA 3L5MA 1W9XA 4FP1A 3B4YA 1ICPA 1M9HA 3AHXA 4UTFA 1CCWB 4GKTA 1F73A 1VJZA 3H26A 3FHQA 1R3QA 3VX0A 1W5PA 4HU3A 3TXZA 4KRZA 3DFSA 2DT1A 2X1SA 4HNNA 3LHVA 1WDQA 1ZUAX 1Q6OA 1E0XA 1DPMA 1K7EA 1PV8A 3HQPA 5CJNA 2W66A 1P5BA 2VEKA 1UPPA 1HNYA 3B8WA 1BVWA 1EH9A 1DTUA 1XH1A 2J7CA 3WJYA 3LLXA 3MQTA 5DN1A 3HFYA 2HNHA 1XIBA 1AMKA 1V6YA 3PUDA 3HGJA 1EP3A 1WKYA 1YE6A 5HMEA 4REQB 3M5VA 3S5SA 5KINA 3QZEA 3GVVA 3UWUA 4H8UA 3W9ZA 2D0HA 4UFLA 1R9YA 3AFBA 1VGAA 1FDZA 4XX6A 1BGAA 3CNYA 4UMAA 4PYSA 2VCCA 2WJEA 2DV0A 2QCLA 4O19A 2V2DA 2ZRUA 2ZICA 3OLIA 4N9CA 2BX7A 1ZZMA 3K8MA 1X7IA 4QNEA 4C91A 3TAOA 3QY7A 3GXPA 5D37A 5DEZA 1O5RA 4XVDA 2WC3A 4AHOA 5I00A 2EPNA 3OLEA 4X0VA 1UH4A 1MXGA 2Z24A 1GYLA 3DECA 3QKZA 5D2WA 1ZPTA 2EPMX 2FJUB 1K8ZA 4F66A 5JBEA 3GIPA 2XFRA 4M6PA 3TA6A 3EMZA 5I0DA 3IRSA 3ALGA 5IM51 4FI4A 5M03A 4DI9A 2ZTJA 3MW7A 3MZNA 3V0UA 3BLEA 4F48A 4LS2A 5HWNA 5HUOA 2X05A 3E49A 4HU0A 2IXVA 2R1LA 3PZVA 4JICA 3EMQA 2O9OA 2PCQA 4NU7A 2FZ9A 1VFSA 1JPDX 3CUHA 1LYXA 2O55A 3GD6A 4IMAA 2ZBTA 3CLMA 4KRUA 4LUYA 3BMXA 2PB1A 1A5AA 3S1VA 2JGYA 2VENA 2GK1A 1SVDA 2WBGA 2VWSA 1H49A 4DYEA 3IJIA 4HPJA 3VUSA 5HJLA 4TTUA 2Y5EA 3QW3A 4I9TA 1LRTA 2I57A 1BYAA 3ABOA 3BJSA 4J3XA 3TNOA 3ZZ1A 4DI8A 2XH2A 3ABRA 1JDDA 4WIWA 4UQ9A 3GG7A 3UESA 2V3DA 5IBXC 5GNXA 4DPPA 3PSVA 4FSAA 3V4BA 1UD8A 2WVSA 1LLWA 4J1OA 1EEXA 1R9XA 3EKLA 4MWAC 3CHFA 4NYYA 3LHTA 1J10A 4C6DA 5DY3A 2OWXA 1XCXA 2OXNA 3EXRA 2H8XA 1BWLA 4YN5A 5LA0A 5CSRA 4G7EA 3NSNA 3P93A 1DIEA 4FIRA 4IQEA 3AS0A 1DKWA 1AJ2A 4DQWA 1TV3A 3QSTA 2Z28A 2J27A 1UOZA 1JCMP 2WO5A 2QULA 4XBSA 3R0KA 4UR9A 4PTWA 2JIWA 1F8IA 3ZVIA 5D32A 1XFCA 1MW3A 5A8QA 4FXFA 3FIGA 3APGA 1KXVA 4RCXA 5C2CA 2PBGA 4YTRA 1UYQA 1GCYA 5MKGA 4S39A 3W72A 2H90A 4HHLA 1US3A 4LVDA 1TTPA 2BY2A 4CN6A 3KL5A 2FDSA 5A5WA 3P62A 1KO0A 4OJYA 3MUAA 4QNWA 1B30A 2NSOA 3I4KA 3KDOA 2EHHA 2HNEA 4JFWA 2C0AA 4CD7A 1BTCA 4GC4A 4KCTA 4PUEA 4F0KA 2CETA