3SSJA

Crystal structure of methanothermobacter thermautotrophicus orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-ump
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
214
structure length
214
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Methanothermobacter thermautotrophicus orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-UMP
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 87
structure length 214
sequence length 214
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ssjA00
4E2BA 4MYXA 3SR7A 3SIZA 2O7SA 2RDWA 4K7YA 3H55A 2A5HA 1ME8A 3SW6A 3O63A 1YTEA 3G0XA 4M6VA 4JTSA 1FX6A 1E51A 1SZEA 4ICNA 4IX0A 1OK6A 5H91A 4AHPA 3LTSA 1CX9A 3GZ3A 3TK7A 6TIMA 1W5NA 3VE9A 2WQPA 3G1VA 4HNTA 4N2YA 4DXVA 3S42A 1YPIA 2A4AA 4I9AA 2R8WA 2Y6ZA 4ALDA 3TC7A 4YL2A 5AYXA 1GPWA 3PBYA 5CZSA 4UNKA 3STGA 1R2TA 1GVSA 3LXCA 3M43A 3TMLA 1THFD 4XUGA 1B9BA 1K7FA 1F7BA 5I3FA 3OA3A 5CPMA 3PSWA 4AH7A 1LORA 1QCWA 5AOUA 2YW3A 1EEPA 1VRDA 1QDSA 1NF7A 1LDCA 3GLCA 3LHUA 3NQFA 2YFNA 1RQBA 5I3GA 5BOOA 3GNNA 3ZWTA 1OYAA 2C16A 3LCHA 4JDBA 3LDVA 4Y96A 5I3HA 5LNRA 3S8HA 2DZUA 3MP4A 4AF0B 4ZQMA 4PEKA 4B5NA 5AB3A 4N4QA 1RZMA 3C2VA 1QNVA 5AC6A 3QH2A 2XN0A 4NJGA 5G1YA 5LHEA 5LGXA 1VPXA 2HMCA 3TXZA 3G1HA 1TYGA 2VFGA 1LM1A 1SO5A 3NQAA 2CZ5A 1TJRA 2YZRA 3N3MA 3W22A 2TMDA 3GB6A 2PE4A 2J88A 3P8JA 3P8IA 1R2SA 4E0CA 1Z42A 5D2TA 1KTBA 2E5BA 3WJXA 3SY5A 4JYEA 1LZOA 3BGJA 1FBAA 3TX9A 4N02A 4A21A 3IIPA 2Y7FA 1A53A 1ICPA 1TTJA 3W87A 3LBCA 3PUEA 4OQVA 5D04C 4O1AA 3W2MA 4PC8A 3C2FA 3LLDA 2ZZ5A 2DORA 2WJZA 1O5KA 2QCFA 1VHNA 2H8XA 3HO8A 3OIXA 3TMQA 1ZCOA 3PY2A 3HGOA 4RJEA 3TFCA 3W86A 5F1VA 3OVRA 3FYPA 1AL8A 1DL3A 4EF8A 3VNDA 1MEIA 5DXYA 1G6CA 5LHFA 4WY0A 1QFEA 2BZNA 1KW1A 4OGZA 1AK5A 3GX9A 2B7OA 3G0UA 3G3DA 3ELFA 1JCLA 1NF0A 3LHWA 3UWYA 1W54A 3OG3A 1HL2A 3SI9A 1WAUA 2RHGA 2WNQA 1L6YA 1OVDA 1G7UA 3FS2A 3RFAA 4YCOA 2CW6A 3L5AA 1T99A 2FPTA 1G4EA 2QKFA 3C6CA 3T4CA 2ABBA 1ZALA 4LU0A 3HGRA 4K8EA 3WK1A 1C9DA 1TPC1 3H54A 3UWWA 3W2NA 5D05A 7TIMA 1DORA 2Z6IA 5D2VA 2V9DA 2R94A 1JUBA 5L6UA 4DBEA 4PODA 3A24A 3W1MA 2WV8A 2QJGA 5D2WA 3N9SA 4MY1A 4S2CA 3QPYA 4BFAA 3W85A 5CKSA 1O94A 2KZHA 1SR9A 3QYQA 1I45A 3OHIA 1KM5A 2GJNA 4O18A 1PL9A 5KITA 3DH7A 2ATSA 1GVQA 1LBMA 2GQ9A 4BWLA 1OFRA 4O4WA 2ZRZA 4R53A 3GIYA 2E6YA 1TV7A 2XFWA 1H50A 3PAJA 4JTEA 3W75A 3PR2A 1R47A 2TRSA 1FWSA 4Y9AA 3GDTA 1F5ZA 5A8GA 1I2PA 3CIWA 1EPXA 3O8AA 2DZSA 1TRDA 4JIPA 3PB2A 1GOXA 2ZZ7A 4UTHA 4DELA 1CI1A 2BLEA 4JX4A 5AHNA 3W7NA 4LV4A 2GQ8A 2VELA 3C2RA 4K8HA 1DHPA 3W3OA 1QWGA 3DKJA 3MI6A 4JX6A 3NL5A 3S1WA 3RLVA 3B04A 3W2JA 2Q8ZA 2Y7EA 3PG8A 1G67A 3LV6A 2WSYA 3I7RA 3A22A 3MI3A 1SFLA 1HFBA 1LBFA 4AXKA 5EMUA 1VR6A 3KVLA 2JGQA 3M41A 1A50A 4NZJA 1K3UA 2ZA2A 2HS6A 3P80A 3PBWA 1K7EA 3U8GA 2V81A 3Q94A 3O1NA 5EL1A 3EX2A 2YXGA 2WNZA 4UFJA 2ZBTA 4UTKA 5LNSA 1QO2A 4GFSA 1TTIA 3L67A 1SW3A 4C1LA 4L4LA 3SSJA 2CLOA 4N9CA 4RZ5A 1JQVA 3CC1A 5KSWA 1H63A 1GZGA 1Z44A 5G1TA 1W3NA 1OX6A 1ZHAA 2Y7DA 4O54A 1KM6A 1YDNA 1DBTA 3B05A 1LOQA 5F2IA 2NV2A 2ZZ3A 4PTNA 5F4XA 4UTUA 4ZZ9A 2V0TA 2GPTA 5AYZA 3L0GA 1OYCA 1VS1A 4IMDA 3UWQA 2AQWA 4BR1A 3S9YA 2JKEA 2VFIA 1AL7A 4IPJA 2EF9A 3U2OA 5U4NA 3OVPA 5G4EA 3W70A 3HJZA 5DELA 2EGZA 2OT0A 4K7VA 1K7XA 1QPNA 3NG3A 4IJBA 4WJEA 1LP6A 3PS7A 4AHOA 3VE7A 4MKNA 1X1OA 4U28A 3BG5A 1S3HA 3G1XA 2Q3OA 4M6PA 3TSMA 5C2XA 1VH7A 4A22A 1NFBA 3LCXA 3TKFA 1KBJA 4POCA 2C14A 4UNLA 1FDZA 4NZFA 2ZZ4A 4UFLA 2VEIA 3QJAA 5G2HA 3HG4A 5CGQA 3VFLA 3BPWA 3W84A 1OFPA 4CNNA 3DBPA 8TIMA 2YGYA 3G1DA 4KFNA 3W71A 5C55A 3W2UA 2DZXA 3WK3A 1LRNA 4WUIA 1XBYA 3UWUA 3MW7A 3LV5A 1I2NA 3LTPA 3SZ8A 3B0PA 1GVOA 2H3BA 3IGUA 2H3DA 2Q8LA 3W7HA 5D09A 2A6NA 4LVAA 2GQAA 3KRUA 4N9DA 4WOQA 1TRIA 2ZDRA 5AYYA 1EWEA 4UTJA 5FF0A 3QQ1A 4EOUA 4K38A 1XL9A 1F76A 5D32A 4MLRA 6ALDA 4NJHA 2VFDA 1WV2A 4YWIA 4Z08A 2QUUA 4H3DA 3R12A 2W79A 4O53A 3NVTA 4DF2A 1X7FA 3QZEA 3LHZA 3LTYA 2NWRA 4JYFA 1TPB1 3QSRA 3UYCA 1LLWA 1L9WA 1TPH1 1L6SA 3R13A 1QO5A 1DOSA 1WBJA 4O50A 3P7YA 4ADUA 2V5LA 2E6AA 1SZFA 4BI6A 3KVMA 2FDSA 2R91A 3CEUA 3GDLA 3TQVA 3B4UA 1YTKA 3DZ1A 3TROA 4M19A 3IVTA 2ZCGA 1M5WA 3VKJA 1SW0A 1FXPA 5KZMA 1VQTA 1KFKA 1MZHA 3CPRA 3G0SA 4AB4A 3M7WA 5FI8A 3I7SA 3HG2A 3OBKA 3L0NA 3L5MA 1FWRA 4UTWC 2OT1A 4JTHA 3G3MA 1BTMA 3HMJG 2DZWA 2QCEA 1XBVA 2FFCA 2C19A 3W76A 4AWTA 2X1SA 1EB3A 5TIMA 3BW2A 1OFDA 3N34A 2R14A 1O95A 3LXAA 3QQ0A 3W1RA 4CQAA 3C3NA 1M6JA 3TUUA 3GXTA 1VC4A 3UXAA 4FNRA 1ONRA 1EA0A 4PCFA 3UWZA 1W3TA 2VFEA 3W7EA 3DHFA 2A0NA 3HPSA 5A5WA 5DBTA 1KM0A 3M16A 3G1YA 2QCLA 4XZ9A 5HWJA 4HKPA 3I7QA 5DXXA 2AAMA 3QPZA 2QAFA 1ZNNA 2WPBA 3VI2A 5SWUA 5K7JA 2OCZA 3HG5A 3EB2A 2QDHA 3S6DA 3K30A 5I3JA 3W74A 3W6YA 1WX0A 2VOMA 5E93A 2CZEA 2NV1A 4LS0A 4DEFA 1OF8A 4NJIA 3P84A 3GDKA 4IWWA 2E09A 4YXGA 1T0OA 3A5FA 3IEBA 3QC3A 2QJHA 4DO4A 3LI0A 3TXVA 1XXXA 2W6RA 5CSRA 3JS3A 4K36A 3S5OA 4IX2A 4E38A 2NXHA 3GDMA 2FQIA 3H53A 4HNVA 3C52A 1F2JA 4BF9A 1IIHA 3EKZA 4NUWA 4XQ6A 2RKXA 4GWEA 4MLJA 1XFBA 4LS2A 1W8SA 3MO7A 1OK4A 3BARA 3BLIA 4QNWA 3O07A 1ZFJA 4KWVA 3FEMA 4M6QA 3M5YA 2PRHA 5L9FA 3F03K 3LHTA 4PL2A 2VFHA 2GOUA 3NQ6A 4KFOA 3TNOA 2QCDA 1TV8A 1XUZA 4YCPA 2QCCA 4X9SA 3ABSA 1XBXA 4GUGA 4I7UA 1OJXA 4AEOA 2A1YA 1K8XA 1FQ0A 4MJMA 1RPXA 4R33A 3USBA 4M5PA 2H90A 3U6WA 3V1PA 1F6PA 4EVZA 3TU9A 4JIQA 3LHVA 5AC8A 1Q6OA 3DXIA 2J9YA 3N19B 4JTLA 2A2IA 3TR2A 2A21A 3E96A 4D2JA 1VCGA 3FJLA 1HTIA 2V82A 3LRMA 5CSSA 3DFOA 3MHGA 2J9XA 2ISVA 4O0KA 2QUTA 3W7JA 2P0OA 1TQJA 3C61A 3TH6A 1J5TA 2E1DA 4FEZA 4FNQA 3G18A 1QPRA 1M7OA 1TMHA 1TJPA 2OX1A 4R34A 2J24A 4UFMA 1NEYA 3M44A 5G5IA 1J4EA 1LROA 4HSOA 4IPIA 4UTTA 3KVKA 4DPQA 4ZMGA 2E5DA 1XC4A 3WK0A 3RLUA 1SQ7A 1KM1A 1MEHA 1H7NA 4JTGA 4WOZA 4ONVA 2H6RA 4ZQRA 4JY8A 2VEPA 1MXSA 2X2GA 1DQXA 3W7KA 4OV9A 2ZYFA 1XBZA 5D02A 1GTEA 1D3GA 1GQNA 1S5TA 4MZ1A 3DFPA 4UMBA 1YPFA 4HT3A 4K6AA 4DO6A 1W3IA 4XBKA 1AW1A 2GVGA 1SPQA 1P5BA 3NPWA 1WOBA 3UZJA 5DN1A 3EX6A 4DPPA 2F84A 2PRLA 1V5XA 3Q58A 3W1LA 2QAPA 5EA9A 1MSSA 2A7RA 4OHQA 2A7PA 2ZRYA 2Y85A 4GUHA 2Y88A 2B0MA 3W7PA 2FB2A 5DCBA 1IGSA 4R7JA 5BRBA 1VLWA 3G22A 1IF2A 1FUYA 1OFAA 3LXBA 3CU2A 4RXFA 2Y63A 3UPBA 5DY2A 5F2GA 2QR6A 3D0CA 3RU6A 2NX1A 3PM6A 3WJWA 4NX0A 3QEZA 4LTSA 4NT0A 4GNJA 2G97A 4IOTA 4O8RA 1HO4A 2C6QA 3TA6A 3QMSA 4H4IA 3CEPA 3I65A 4DQWA 1U83A 2C3ZA 1Z48A 4PH6A 2ZRXA 3MHUA 3NQCA 4JNMA 2ZZ6A 3IRDA 4FIRA 4N6EA 1OHLA 3W2LA 3MYOA 5DCDA 1DQWA 3L66A 4N9BA 4JYDA 4AAJA 4WY0B 1YDVA 2A6LA 1P0KA 3E12A 2X30A 3S1UA 2ZTJA 2VEMA 3WJSA 1VJIA 1Q6RA 4JS3A 3AO0A 3UD6A 4LNYA 3ATZA 4N6FA 2NXIA 1SO3A 1QOQA 3TJLA 1O5XA 4O12A 3UY7A 3L5LA 4IUOA 3TAKA 2E77A 3DGRA 3QM3A 4IMEA 1UASA 2DZTA 1WXJA 3B03A 3S5NA 2CFFA 3YPIA 1SSGA 3LBMA 3NQ7A 2E68A 2VENA 4O1CA 4UC5A 1AW5A 2CLFA 1ZJIA 2EPHA 3TV8A 2ZRWA 2C15A 1NVMA 1SSDA 3C2EA 2JBMA 3GK0A 5KTLA 1KM4A 3M6YA 4JXCA 3ZFHA 4Z1AA 3W07A 3CQ0A 3E0IA 3T40A 3UWVA 3O05A 1EP3A 1SUXA 3O6CA 1QMLA 2RFGA 3WFAA 3P5YA 1KLYA 2C0AA 3LI1A 5K4ZA 3NQ2A 3MHFA 2QCHA 1XKYA 1BWLA 1LLZA 4UR7A 4O1BA 1KV8A 3I6RA 4CCCA 3QW4B 5HULA 4JEQA 3PULA 4U4MA 1ME7A 1F73A 1W5OA 4FNUA 4RX0A 4AHQA 4TMBA 2B7NA 2V30A 1R46A 3EWYA 2I1OA 4BK9A 2V5BA 1F05A 5FF2A 5K2ZA 1JR1A 3M5XA 5HMSA 3P61A 2NX9A 3HB9A 3NAVA 3W1UA 3FKKA 4O13A 4A29A 4BI5A 5C6MA 3B0UX 1TV5A 3MBDA 2Z0IA 5GVJA 4HSNA 1GVRA 3THAA 2QCMA 5KZEA 2OMAA 1A5SA 4NNBA 3G8RA 4ORIA 3Q2DA 3PVFA 1QAPA 2VXNA 1Q45A 1UUOA 3HPZA 4UMAA 3F4WA 3STCA 4MIMA 3STEA 3IIZA 5FESA 4OWGA 1QPOA 2YYUA 4N4PA 4HPXA 4W9TA 2HTMA 4JTJA 1XUUA 1JCYA 1TPUA 3LCFA 1KFJA 3W72A 3MBFA 3GDRA 5CZJA 4OBTA 2V2CA 1W37A 3PB0A 2D73A 3ZWSA 1WOAA 3C0JA 1H61A 1I8JA 3FJ6A 5BW6A 5F4WA 2FB3A 1H5YA 2Y62A 5D2YA 1TB3A 5TBOA 1OX4A 2BTMA 3LERA 3UY8A 3MP3A 3B0VC 3A9IA 5K3VA 2ZRUA 3NA8A 3W1AA 1PS9A 2ZRVA 4X22A 4JTIA 4NU7A 1ADOA 4KFPA 3EEGA 3ABQA 4DBDA 4FXSA 2NXGA 1P4CA 5T26A 3WJYA 1ME9A 5HWNA 3DHDA 5CZ0A 2ATMA 3KRZA 1N55A 3NM3A 2E6FA 4QSHA 5CPOA 4LVGA 4GE8A 4AWSA 5AHMA 2Z6JA 4UCGA 4XTDA 5EKYA 5AHIA 3EWWA 2B7PA 2CWNA 3LLFA 4AMAA 2C13A 2PCQA 3JRKA 4LC8A 5HUPA 4ZQCA 1SU5A 3I68A 4NXSA 4FIQA 3ZS4A 3EX4A 2QJIA 3GVGA 4YMZA 3MYPA 3SJ3A 2CLMA 2PC4A 3L2IA 2DJLA 3R5EA 4X2RA 5EY5A 3NQGA 3NQEA 3SECA 3TW6A 4LRSA 3S5YA 4ZL1A 3CIXA 5FEXA 3GXPA 1K8ZA 2NUYA 4PL1A 4RZ4A 2ZFAA 3TCEA 2Q3RA 3TE9A 2X1RA 2ZTKA 2AGKA 4LY8A 3A23A 4HNUA 1G4SA 3IVSA 4WQ6A 1GG0A 3B06A 2YYTA 1W0MA 4OU1A 1ZAIA 3CHVA 3LHYA 4FX8A 1OFOA 1K8YA 3E02A 5AHEA 5EYWA 1G69A 1DV7A 3PWAA 3W7RA 4IMGA 4G1KA 3OEXA 5FF4A 4LOCA 4RXGA 3N9RA 3MMTA 4O0ZA 2C1HA 4RKAA 4MZ8A 1N7KA 5IBXA 5J5RA 1H7WA 1NAL1 1LYXA 1KFCA 1IXNA 3FLUA 1H7XA 1FXQA 3W88A 1EUNA 2P1FA 3E9AA 3DI1A 2XN1A 3TSDA 3M9YA 4Q33A 3CB8A 2QF7A 4Z1BA 4Y90A 3Q37A 2CZDA 4UTIA 3NL2A 1RV8A 1A5CA 4O52A 2E5CA 1QR7A 1JQXA 3W1XA 4MZYA 3W7QA 3B8DA 3HGSA 3W1NA 4QNEA 1LRQA 1VYSX 1H7PA 1W31A 5F1UA 4MVAA 1KTNA 1SO4A 3RK8A 1OF6A 3DFQA 3TSBA 2H8ZA 3EWXA 2NUXA 2QEZA 3WJZA 3NQDA 4UFIA 2WSQA 5DCEA 2V8ZA 1EP2A 3P60A 4LVDA 3S1XA 4EIVA 5EBUA 1PVNA 4TMCA 1YDOA 3MUXA 4O10A 1DJNA 1C29A 1W5MA 4NNCA 4O16A 3W23A 1L6WA 1WDWA 5IBXC 1ZY9A 4CNOA 5C5YA 2VEKA 2Z1BA 3CWOX 3KXQA 3MI2A 1YXYA 1EP1A 3C56A 3S0CA 5BMXA 2FIQA 3NNTA 1N8FA 5CPNA 3LX9A 3E49A 4NNAA 4UXDA 4AVFA 3DU0A 3P81A 5CZTA 1HUVA 1OFQA 1TPVA 4UTTC 4H6KA 1K03A 3O16A 3IV3A 2JGYA 3LRLA 3AJXA 4UFKA 2JKAA 4Y8FA 5ABTA 3ATYA 2JK2A 3W7OA 1B57A 3ABOA 3S5ZA 1SZNA 3W7DA 4XTIA 3HOJA 3O6YX 5K9CA 4C1KA 3R89A 1ICSA 2Y7GA 1FWTA 5AFDA 2RDTA 3M47A 3S1VA 2GUUA 5MHBA 4HIBA 1FCUA 4M7SA 4JTFA 2G95A 1G7VA 2QUVA 4UTMA 2J27A 5G2IA 5TQLA 1VGAA 3W7IA 1PV8A 2Y61A 4S1FA 4RCXA 4IXHA 4JD4A 2B7QA 3CT7A 4TU1A 1JCNA 4WZHA 2X1UA 1YADA 3DFTA 2O7QA 3C2OA 4O17A 3EX1A 1LTDA 1ALDA 3HIJA 2FTPA 3NDOA 1JULA 2ALDA 1LBLA 1SO6A 4IMCA 1ZAJA 2NWSA 2X16A 2FJKA 4BWLC 2WKJA 1TSIA 5KINA 5KZDA 4NJJA 4O19A 3FA5A 5LZLA 4LUJA 4MY8A 3INPA 3QW3A 5FEZA 1S5VA 1TPDA 4JTTA 2FLIA 2ABAA 4AF0A 2YCEA 1C8VA 3NM1A 3W9ZA 3SGZA 3NPUA 4K39A 4JX5A 1RQEA 1H7RA 4O57A 2JKPA 2TYSA 1KFBA 4HN4A 5KMYA 5G4WA 1EUAA 3STFA 1D3HA 4E2DA 3TC6A 3TJXA 2Z2UA 3EXRA 3N2XA 3ZR4A 1EX5A 1UJPA 5HQEA 1OX4B 4QJ1A 1GYNA 4UTWA 1Z41A 2DZVA 3PSVA 4GRSA 4Z0JA 4UTLA 1RD5A 2BSLA 2XN2A 4WXYA 3EWZA 4QAIA 1JJKA 3PC0A 1R30A 2RDUA 4WD0A 3TAOA 4FB7A 4LVBA 4NX5A 1JRCA 2DJXA 4O15A 1VZWA 1GWJA 3R2GA 3GR7A 1TREA 4GC4A 1SFJA 2WNNA 4UMCA 2QDGA 4PFMA 2YR1A 3UPWA 1KA9F 3DENA 1HG3A 4HPJA 4TO8A 2FPVA 1FCQA 3DI0A 4JGDA 2J9ZA 4QQ3A 1LRTA 1DJQA 3KFTA 4MFDA 3NPXA 3W7MA 5BNKA 1YXDA 5K9DA 1B4KA 3CTLA 3IIOA 4FF7A 1IXOA 1X8FA 4LUIA 2W0UA 4LS1A 2QCNA 4O28A 4LWWA 1DKWA 2DP3A 1GEQA 3QF0A 1QOPA 4Y6GA 3NZ1A 4BI7A 2ZA1A 1ZENA 5D37A 1Q6LA 2Y89A 2C18A 3HQ1A 5FF7A 3SGUA 3LGEA 2V2HA 3QSTA 5D03A 4TX9A 1P0NA 2YFOA 1S5WA 1FY6A 3NL6A 3C8FA 3DFNA 3T78A 5D30A 4QIUA 4ZQPA 1UUMA 3EXSA 2OZ0A 1ICQA 4JICA 1CW2A 4Z1CA 3W73A 2B4GA 3L65A 4MJZA 1Q3NA 1T8XA 4KWWA 1FCBA 1PCKA 5FEPA 3DAQA 1GJPA 3NPVA 4O1DA 1MO0A 4DO5A 1GT8A 4X3ZA 4NQ1A 4NJKA 1IXPA 1H1YA 5F2LA 4K37A 4N9EA 4FNTA 3IIVA 3UXDA 4AWUA 1Q6QA 3L0KA 1M7PA 1TO3A 3CWNA 2ISWA 4YLWA 2EHHA 3T44A 1GYLA 1YTDA 4GUFA 4JR5A 3M5VA 4CLMA 1KLZA 2E6DA 1VYRA 3NR0A 1B3OA 1SW7A 1Y0EA 5IM51 1YYAA 3KX6A 1RVGA 4DF1A 2ISSA 1GG1A 3GKFA 2NUWA 2IQTA 4ADTA 4P2VA 3HBLA 5FEWA 2CLKA 3G1SA 5EPDA 2FPYA 3EX3A 1XCFA 3JR2A 4EWND 1PE1A 3OVQA 4XKYA 4MPQA 1K02A 1TTQA 3MWAA 4S2BA 2NLIA 4FHAA 1XDMA 3QMTA 3GAKA 3LOTA 4RLIA 3T7VA 1H7OA 3KVJA 2EAWA 1ZAHA 5D2XA 2Y70A 5LGZA 3A5VA 5AN7A 2GVJA 3O06A 2QCDB 4A2RA 5LNUA 2PURA 4OT7A 1BKSA 4RV8A 1XI3A 3TQKA 3W2KA 5DY3A 2CLLA 4IMFA 2I9EA 4O11A 4A2SA 4LV9A 2BWGA 1VCVA 1F74A 3GKAA 4M7TA 3W1QA 3NEVA 5HR7A 3A21A 4GJ1A 4P61A 3N2MA 1BEUA 1FCVA 2LLEA 3BW4A 1X1ZA 4CNPA 1IIGA 3EXTA 1H62A 2ZZ2A 1T96A 2YDAA 4J9JA 4NVTA 1KTCA 3C4UA 1KV5A 5FF3A 2GJLA 3G1FA 1RQHA 3NYZA 2VC6A 3R8RA 4A3UA 1I2RA 3NGJA 1W1ZA 1KFLA 1LOLA 3BLFA 2DU2A 1WQ5A 3EWUA 4CCDA 3QFEA 5E0KA 3TQ0A 3BG9A 1IXQA 1FWNA 1FWWA 3P67A 3LM7A 2UV8G 4GXMA 5AHFA 5AHLA 2G5WA 3FYOA 1JCMP 5LNVA 4HHPA 4ZQNA 1ML1A 2WO5A 1SZGA 3O6DA 3EWBX 4CQ9A 4WXZA 5E1QA 4IXXA 3VCRA 3NO5A 4TIMA 2GVLA 4Z0SA 3N73A 4QITA 2CU0A 3BK0A 2WOQA 4OV4A 1EIXA 3F1QA 1JVNA 3PF3A 1FDJA 3KHJA 4GUJA 3GXNA 1O60A 1TCDA 3NQ8A 4O14A 3LCWA 1H60A 2CLHA 2PRMA 3HF3A 1G4PA 4Q32A 4ORMA 2A85A 1LCOA 3N14A 3T55A 1OX5A 1X6UA 3O15A 2A7NA 3BO9A 2YSWA 4O4VA 3KOFA 3GAYA 3TW7A 1KM2A 3RF9A 4DF0A 2I14A 3BLEA 1A5AA 1VHCA 4LT9A 5G2WA 3G8EA 3NZRA 4FXRA 1JRBA 3W7CA 1JCXA 5CG7A 2HSAA 3KRSA 4MY9A 3UQNA 1F6KA 3DKLA 1MEWA 3NXFA 1I2OA 2VFFA 3FIGA 3W1TA 3CM4A 3NOEA 5HR6A 1JUEA 4MOZA 3GNDA 5D38A 1W5PA 3P62A 1TIMA 5DLCA 5K4XA 2P10A 3M1ZA 4JDYA 4LW7A 3UNDA 1AW2A 1D9EA 1P1XA 4UR8A 4JY9A 3WK2A 2BXVA 3CLMA 3BW3A 2HS8A 5J5DA 3GR8A 1PHWA 1DVJA 3BVJA 4WY0F 5AC7A 3PUOA 1TPWA 3MJYA 3FKRA 3G24A 2WSRA 1HO1A 4XWUA 2YW4A 4XKYB 1AMKA 3HGJA 4MYAA 2OJPA 3PBVA 5LSMA 2YPIA 4GBUA 4XBSA 2J6XA 4QM1A 5U7SA 3GYEA 3PUDA 1J2WA 1UBSA 2EKCA 3V75A 2VKZG 2X1TA 4OE7A 1PCWA 4LRTA 1OG0A 4MFEA 4UIOA 1YLVA 4ML9A 3IVUA 4RK8A 5C54A 2F7FA 1GVFA 1PIIA 1I2QA 2BX7A 3FOKA 4ADSA 1QPQA 4PA8A 4UUIA 1FDYA 1OABA 3KAOA 3P74A 1NSJA 1R2RA 4EF9A 4Z1DA 1AG1O 3W1PA 3QMRA 3QRHA 5K9XA 1W56A 4NXKA 1WYIA 2YX0A 1KFEA 5H2ZA 5HNRA 4JTKA 2ZZ1A 4HNNA 4CCEA 1KM3A 3ANYA 5I3IA 3W83A 1TPEA 1PHQA 3NQMA 5CPLA 1TQXA 1U5JA 3M5ZA 3P5ZA 5HJLA 5BMWA 4IGHA 4FNSA 4ZVJA 5LKYA 4L4MA 1A5BA 2CLEA 4FX7A 2CZFA 3BGGA 4WX2A 4CQ8A 3NQVA 1V7YA 3TIMA 1UCWA 4JTUA 3L68A 1XDLA 2V2DA 3BG3A 3PG9A 4RZ6A 4FX6M 3PBUA 3THQA 2RH9A 5D33A 4MUZA 4I7WA 1I4NA 1B4EA 3L9CA 1VCFA 3LCLA 3RMJA 4UFHA 2QCGA 3TFXA 1JUKA 3IIXA 5I3KA 2CLIA 4FNPA 4IQLA 1G4TA 3SFKA 3IGSA 2NZLA 4GUIA 3LCIA 5F4SA 4LC6A 4QISA 1O4UA 1WA3A 3M0ZA 2NX3A 3L21A 3F4NA 1L2UA 4TR9A 4RR4A 2TSYA 1GTHA 1EWDA 1BWKA 1H1ZA 1JCJA 3P82A 3RNDA 2DZPA 3HG3A 4FO4A 1OYBA 4I7VA 3W7GA 3DFSA 5HWMA 2G96A 5LNWA 1VYPX 1UB3A 3LRKA 1VLIA 1KBIA 1YXCA 2ZQ0A 1TTPA 1OFBA 3FFSA 3UZ5A 3HPXA 5F2MA 3LB0A 1XM3A 3TDFA 1H51A 1LOSA 3MP5A 4LVFA 5HINA 1RR2A 1W5QA 2TPSA 3LCGA 1TPFA 4JN6A 4ZQOA 3ABRA 5DBUA 4Q4KA 3G1AA 1OFEA 3W7LA 3BV4A 5HUOA 4KKXA 3IGXA 1WBHA 3NL3A 2ZA3A 3EKLA
chains in the Genus database with same CATH superfamily
2FZDA 3SIZA 2O7SA 3AIBA 2FHBA 3O63A 1UR3M 4JTSA 3T42A 1SZEA 1UZHA 1TV2A 5T9CE 1R3VA 5H91A 3GZ3A 3AU6A 3TK7A 3BANA 4AQLA 2CHRA 2ZXQA 2A3HA 3WBYA 2Q71A 4QAWA 4C6PA 3K4AA 2NVCA 4DXVA 3N2OA 4HTYA 3C3UA 2R8WA 4AIUA 4KGJA 3PBYA 5CZSA 1XYCA 4ZEPA 1NDWA 4GVIA 3M43A 3TMLA 1THFD 1XISA 1TUFA 5ABGA 1PZ3A 3DERA 1JZ4A 1E71M 4C6KA 4US5A 3G2GA 3LSBA 3PSWA 2R1LA 1O7AA 5BYWA 3UFYA 1UH2A 1LDCA 3GLCA 4GYPA 1RQBA 2TAAA 4S3JA 4OBRA 5I5RA 1M04A 3HPAA 4DJEA 2Y8VA 4Q4RA 5I3HA 3S8HA 2VC9A 3MP4A 1ZB5A 4PEKA 1W9UA 2IKGA 3C2VA 5AC6A 3VNZA 1LQ2A 4NJGA 3PBGA 5CQ1A 1JNDA 2HMCA 3TXZA 1WNOA 1QNPA 1SJAA 1SO5A 3H4WA 1A5KC 4QDPA 4GLEA 4D9PA 2J88A 2J78A 2WMGA 3N25A 2VZUA 3MMDA 1U1JA 3EB3A 3PPHA 1Z3NA 1DWFM 1HF6A 2J7GA 2J62A 4N02A 3ITVA 4PMNA 1TTJA 1IZJA 2W61A 3LBCA 1NP0A 3PUEA 3O2LA 3W2MA 4PC8A 4PULA 4KCTA 3VILA 1ZLPA 2QCFA 1RD6A 1VHNA 4GYPC 1UKPA 4M51A 3PY2A 4RJEA 3OW1A 3W86A 8XIAA 4QFUA 5F1VA 5C70A 4PMDA 3MZ2A 4EF8A 4OFCA 1CB2A 4IGNA 1KW1A 4AX7A 2B7OA 3CTTA 3G3DA 1JL8A 3LHWA 4GXPA 1L6YA 3FS2A 4ZOCA 3L5AA 3ISIX 2FPTA 4AUBA 4K8EA 2OGJA 3H54A 3UGRA 7TIMA 1B9ZA 4MPKA 2R94A 1JUBA 3MCNA 2VYOA 2BY1A 4DBEA 3GH7A 2QJGA 4Z2LA 1W32A 4S2CA 1TMQA 5CKSA 1O94A 1SJBA 1SR9A 3QYQA 2FVKA 1LBMA 3FN9A 4BWLA 1OC7A 3A4XA 3RRAA 4JTEA 5FKYA 1R47A 4LEQA 3CV2A 6CGTA 5J04A 2WMIA 1FWSA 2IMRA 1U1UA 4IICA 1I2PA 3WIJA 5TF0A 3W24A 3SFWA 1IZCA 4QLJA 3O8AA 4JIPA 2O4MA 5LIYX 4DELA 4C7FA 4MAVA 2BLEA 1T6MA 1ZL1A 2EPMX 3W3OA 3DKJA 5DRCA 4F4RA 3NL5A 3IARA 3RLVA 2PAJA 2Q8XA 3MSGA 1JZ6A 2D2JA 3W2JA 1XSIA 2O9TA 3ZJ7A 2J7HA 1SFLA 1LBFA 1C7TA 4AXKA 2ZX5A 1GVEA 3M41A 4X61A 3B0XA 1I6NA 1GK8A 1OEPA 3EX2A 1WDRA 2ZBTA 4B3LA 2AAAA 1KRAC 3APGA 3L67A 3NCOA 4C1LA 3SRFA 5KEZA 1H63A 1Z44A 2DVUA 3A47A 1W3NA 2Y1HA 2A79A 1KM6A 4E2OA 3UETA 2PLMA 4WGHA 5F4XA 2Z7GA 3KOYA 2GPTA 5AYZA 1HQTA 2FFIA 1Q8JA 2GGIA 3S9YA 3U4FA 1AL7A 3WX7A 4K68A 3BLDA 1TE1A 2O4QA 5G4EA 3W70A 1JEZA 3HJZA 3K1DA 4PGLA 2EGZA 4C6FA 2OT0A 4K7VA 4DX3A 1F3TA 2Y4SA 3B0YA 4W4QA 2G3IA 3PS7A 3SRKA 3ALGA 2Q3OA 2VT0A 3LCXA 1XLBA 4PYSA 3T0CA 5TAOA 1FDZA 1M53A 1JPKA 4MGGA 2Y5EA 5G2HA 2FZMA 3W84A 4BEUA 4PUJA 4QG6A 4YNGA 3G1DA 3W71A 5C55A 3W2UA 3WK3A 1LRNA 2QJJA 3WUFA 3ZOAA 2XINA 1I2NA 3B0PA 3B8IA 1HT6A 1W2VA 1Q6EA 3R58A 5D09A 2GQAA 2OEJA 1QATA 4DBUA 3BOFA 2CC0A 2ZE0A 5AYYA 4DJFD 4ZOEA 3R4IA 1WV2A 1QNOA 2QUUA 1G9HA 1GZ1A 3QFWA 3NVTA 3WLTA 1X7FA 3LHZA 3OGSA 1TCMA 2NWRA 1MDLA 3C0SA 3LNMA 1ONEA 1WUFA 1TPH1 1DOSA 4B5XA 4O50A 3P7YA 6XIMA 4ADUA 2V5LA 4BI6A 3KS5A 2FDSA 2R91A 3UU0A 3WQ6A 5A95A 1MW1A 2YDSA 4LANA 2PTDA 2BV9A 3TQVA 4C65A 1UD3A 3EOLA 2ZCGA 4WJXA 1FXPA 1KFKA 2E7FA 5A8PA 3CPRA 1I60A 1XLMA 3IJ6A 3WLIA 4L1GA 2XIJA 3OZPA 3L0NA 3VD3A 4JTHA 1BTMA 2C91A 2DZWA 2W63A 1XBVA 2X1SA 2GSEA 1CBGA 1EB3A 5TIMA 3G5EA 1OFDA 3NVDA 4WKHA 1JGIA 4AY8A 4JNYA 1FVPA 2ESCA 3CAVA 1E3XA 1RBLA 2ISDA 4LUSB 1M6JA 4GZEA 3AXKA 2BS9A 4S38A 5A6JA 3L4ZA 3DHFA 3WLNA 1BYBA 2QCLA 1XIEA 4XZ9A 4UZSA 5C9ZA 3T09A 2V5KA 4KPLA 2QAFA 3VUPA 2W3ZA 3CPGA 3ZJ8A 2AKZA 4XAFA 4J7RA 4KF1A 2NVDA 2OCZA 2QDHA 1P1MA 2CESA 4IGMA 3W74A 3WBAA 1CT5A 1WX0A 2VOMA 4LS0A 5IRPA 2X40A 3GIPA 1AQMA 3R8GA 3GDKA 2E09A 4H9VA 3WD4A 3UR2A 1KCZA 4DO4A 3AYSA 4TVUA 3AXMA 3GIQA 3TXVA 1HKKA 4OVXA 4GYKA 4IX2A 3RPDA 3BLPX 2NXHA 1B30A 1F2JA 1E0WA 5EBAA 1P7TB 1SFSA 4JFUA 2RKXA 3AIUA 2WSPA 3MO7A 4JIRA 1ZFJA 2A3AA 2PRHA 3UZXA 3LHTA 1XRVA 3OODA 2RDXA 3TOPA 3VDGA 1TV8A 3TEVA 3GDBA 1XBXA 1AUSL 4GUGA 3LG3A 3HMCA 1RPXA 3USBA 5C9XA 2CNCA 1F6PA 4EVZA 2DV0A 1UQZA 3TU9A 2UY3A 3GNXA 3BMVA 2PTYA 4XIMA 2A21A 4ZB5A 2YXXA 4BJHA 3E96A 2QMJA 4D2JA 1VCGA 1X96A 2V82A 4F66A 4GIAA 2J9XA 2QUTA 2P0OA 1ZJAA 4LF1A 5BXSA 7REQA 2RJGA 4LAMA 1M7OA 2ADAA 1UIPA 2J24A 4HSHA 2JFEX 2CBUA 3M44A 1J2BA 1J4EA 5JBEA 2PDPA 1ZBCA 1Y7VA 4ZODA 3RAOA 4DPQA 1XC4A 3WK0A 1H0IA 4YTQA 3TZNA 1KM1A 4WOZA 1H5VA 2H6RA 4ZQRA 2R82A 1NDVA 1MXSA 2X2GA 5D02A 2O92A 3DEQA 1GQNA 4ZO8A 4JIIX 4FP1A 1HL9A 2D0GA 4CN6A 4NY2A 1CTNA 3LGDA 3GFYA 4AZGA 2PU1A 2WLYA 1CYGA 1WOBA 4EKJA 1E6QM 4CD5A 3M4HA 1V5XA 1GVIA 4Q8PA 4Q8MA 2ICSA 5IOBA 4GUHA 1I1WA 2B0MA 3W7PA 4R7JA 1E9ZB 1VLWA 3G22A 1IF2A 4Z2JA 2Y63A 5DY2A 3S6TA 2P76A 5E9AA 2NX1A 3WJWA 3DG3A 2VEGA 3QEZA 4NT0A 3UEQA 4G6CA 1A49A 2BOEX 4IUGA 3CEPA 4IT1A 1U83A 2BHYA 3MMWA 3RM4A 4V27A 1Z48A 1DTNA 1P43A 3PJWA 3WQFA 4PCTA 1OHLA 3MYOA 5DCDA 4N9BA 3WNLA 1EJXC 3H70A 1P6BA 1FHUA 1W1VA 2G50A 5CC7A 1P0KA 3E12A 1Q6FA 1A80A 4RDYA 1KBBA 3CV6A 4JS3A 2ZIDA 4L5ZA 4URIA 4R88A 4LNYA 4OKDA 3EDKA 2VVNA 4N6FA 2I7GA 4NAFB 1QOQA 4O12A 5E0CA 3S83A 3V3WA 3B8UA 4G8TA 3DGRA 3QM3A 5EGRA 2DZTA 3YPIA 3WQOA 1SSGA 4GQBA 1TG7A 1FHDA 4O1CA 3ARYA 3ECQA 3T08A 3L2LA 3WNMA 1RK6A 4L9YA 1ZJIA 1V77A 4MNLA 1BKHA 1SSDA 4OTKA 4A8IA 4ATWA 4HGXA 2CYGA 1KM4A 2WBKA 3AMGA 1YDYA 3CQ0A 3T40A 1IWBA 3AQUA 3O05A 3HQOA 5BZAA 5C2CA 9CGTA 3OVGA 3WF0A 3WFAA 4DUOA 5JMUA 1ELSA 3C5QA 3VK5A 4AD3A 2C0AA 5K4ZA 3T0AA 1D3CA 1V3LA 1BWLA 2VUNA 1LLZA 4W7UA 1K4HA 3OU8A 3PULA 3AIVA 4F40A 2OODA 1W5OA 2BGSA 4AHQA 3VD5A 4TMBA 1VFHA 2VTFA 2OQLA 3BLLA 2IQ0A 5HMSA 2NX9A 3HB9A 3NAVA 4B2DD 4M56A 3EEZA 1V3MA 4LYRA 4O13A 2X05A 4A29A 1LT7A 3TR9A 3PFMA 1TV5A 2XZ9A 4D6DA 3P3BA 5GVJA 4HSNA 1GVRA 4FLSA 1GNXA 2C1GA 2YL6A 2YKKA 4NNBA 1RY8A 4ORIA 4R9OA 1DJHA 1QAPA 1Q45A 1UUOA 4UMAA 3STEA 3IIZA 1QPOA 3DYPA 1VFMA 4HPXA 2XVPA 3H7UA 2HTMA 4JTJA 1XUUA 4AZIA 3LCFA 1MI3A 4PBFA 3VOIA 4OBTA 1E40A 1W37A 3PB0A 1MDRA 2D73A 1WOAA 1Z69A 4WKFA 2FZBA 4H9UA 4XISA 2FB3A 4MB3A 2PDCA 2INEA 5IFPA 6XIAA 1TB3A 1KKOA 1EH9A 3DECA 1UPPA 2G37A 3LQLA 5K3VA 2ZRUA 2KAUC 3NA8A 3W1AA 1PS9A 4X22A 4IP4A 3EEGA 1VEPA 3WG6A 1XLIA 4FXSA 3KCLA 2J75A 1BG4A 2OGYA 4AD5A 5CZ0A 1LL7A 2ATMA 2CCRA 2A3CA 3K8KA 3NM3A 4LVGA 1IT7A 3ZJ6A 4AWSA 1TVPA 3CO8A 4DZ5A 1R3QA 1V02E 1PIGA 1NFGA 3Q4DA 3LLFA 4AMAA 2C13A 2PCQA 3JRKA 4LC8A 2Q01A 1SU5A 4J3UA 3GVGA 4WEVX 3H26A 3RDKA 3MYPA 2DIEA 4MNJA 2PGFA 2DJLA 1YKWA 2VDHA 3LEPA 4AZBA 3NO3A 3NQGA 3EPNA 3GXMA 1V08A 3S5YA 4C60A 1KCLA 1F3EA 5CZKA 3CIXA 1RUSA 4TXEA 1K8ZA 5DX7A 2IKJA 4I5XA 4RZ4A 3TE9A 2WVVA 2X1RA 1HNYA 2YBTA 4CD8A 3WNPA 3A23A 2O56A 3EWCA 2PDXA 4RW3A 4CVWA 2ZUUA 3GW3A 2JE8A 2XSXA 1TZ7A 4FX8A 1Z32X 2CIPA 1HKWA 3AHYA 3B9NA 4FXJA 3V0TA 4ATLA 3WCZA 1DV7A 4IMGA 8A3HA 4G1KA 3OEXA 4O0ZA 2OLAA 1HXJA 3CQIA 1V6TA 2JALA 3GRIA 2L5HA 4E8CA 1K6WA 1MNSA 1NAL1 1EIBA 3FLUA 1UOZA 3FA4A 4D8AA 5A1AA 3P6LA 4FPSA 4AISA 3WH5A 5IHRA 3KTCA 3M9YA 4Q33A 2P88A 4Z1BA 3WH7A 1RV8A 1A5CA 4GH3A 3SB0A 2OB3A 4G56A 1V0NA 1B0IA 3W1XA 1JQXA 1OT2A 3HGSA 5CSUA 1LRQA 3OQ8A 1VYSX 3N6JA 3AXXA 3VOGA 1H7PA 2DZAA 5F1UA 3PN8A 1KTNA 1SO4A 5A2BA 4H2CA 2H8ZA 3WJZA 4HZ7A 3NQDA 4UFIA 1E6RA 4DI8A 3QR3A 4M82A 4EIVA 5EBUA 4O10A 1D7KA 1E0UA 3WH6A 1VFTA 3FYYA 3WKZA 1ZY9A 1XQLA 2VEKA 3WEOA 3LSCA 2Z1BA 4RPPA 1RLDA 3UYIA 5I03A 3MI2A 4WJ8A 1UIOA 3C56A 4YWSA 4QE5A 1ZPTA 2FKPA 2VQTA 1XH2A 1N8FA 1IR2A 4NNAA 3P81A 4UTTC 3O16A 2HXTA 2NQ9A 4HYVA 2PDLA 2PF0A 2PLCA 3AJXA 4UFKA 3TQPA 4R3UA 1KRBC 1B57A 4C6NA 5XIMA 3W7DA 4PMRA 1EDQA 3HOJA 4HCHA 1UA3A 1NFPA 3BDKA 1RXOB 2VCBA 5AFDA 2VL4A 3TTYA 2XTKA 3VMOA 2QPUA 4HIBA 4M7SA 3R94A 2VX6A 3HJEA 2J27A 5TQLA 5G2IA 2CKSA 4Q8WA 1PV8A 2Y61A 2YDQA 4FOJA 3HV8A 3W81A 4IXHA 4JD4A 4INFA 1JFXA 4KWUA 3IJ7A 3ALFA 2FTPA 5LIWX 3S2LA 3AYTA 4M80A 2ALDA 2Y8KA 1LBLA 1WUEA 1ZJBA 1ZAJA 2J47A 3EGJA 1JXJA 5KINA 2WHKA 1JZ7A 3DHPA 3LBOA 3SQLA 1ZTVA 2ZC1A 3VNKA 1S5NA 4XZHA 1S5VA 4Z2KA 4JTTA 2FLIA 4W5ZA 3MUCA 3ARQA 4AF0A 2YCEA 3NM1A 3SGZA 5AECA 4JX5A 1R3SA 4D1IA 1WDSA 1M03A 1KFBA 1JNEA 3WF3A 1E9LA 5KMYA 3BJFA 5G4WA 1EUAA 4E2DA 1ZSXA 1U1HA 2NQHA 1EF3A 3H22A 4D6EA 4JKLA 2PDFA 3MSDA 4UTWA 2DZVA 4Z0JA 3C0LA 1RD5A 1Q6GA 4XAPA 2QV5A 1R30A 4WD0A 4FLRA 1JRCA 1VPYA 3ZQ9A 3OBAA 4FOKA 4O15A 2DT1A 1VZWA 3R2GA 4TV6A 3GR7A 1TREA 3P93A 1K9DA 7REQB 2WNNA 4UMCA 1BD0A 3UPWA 5CGTA 4KGLA 1OSEA 3P0XA 3LLXA 1LLOA 2FGLA 4U31A 5FL0A 2XFFA 2ANUA 1O6IA 2GUYA 2OKOA 3QOKA 1M1BA 4C6DA 2NQZA 4MADA 4LWWA 1DKWA 2ZUSA 1KGUA 2G3MA 2QMKA 2Z1SA 2X0YA 1RCQA 1ZENA 2XZ7A 4UCFA 1DWGM 3OLDA 5FF7A 3Q45A 2XSBA 2V2HA 5D03A 3GXDA 1K77A 5GNXA 3NSNA 2BBFA 1S5WA 9XIMA 4DXXA 2OZ0A 3CPUA 3IUIA 4JICA 4MHBA 4HBKA 4Z1CA 3MMUA 3W73A 2B4GA 4XO7A 2AL2A 1SMDA 1ZP4A 4V28A 4IJRA 1Q3NA 1T8XA 4KWWA 2P8BA 4MG4A 2YXOA 4N0RA 3AS0A 1M65A 5FEPA 3DAQA 1W3HA 1MO0A 1GT8A 2NW0A 2WM1A 5HQMA 3IIVA 4AWUA 5C9UA 1WZLA 3U9IA 2XIIA 3CWNA 5M03A 2ISWA 2EHHA 3BOLA 1EJUC 3AMKA 1YTDA 4PMJA 4YVXA 3KUMA 1GOQA 1QI2A 3NR0A 1Y0EA 1Y65A 1LJYA 1DE6A 1UKQA 1YYAA 1NTHA 3RU8X 4DF1A 2NUWA 1AQ0A 4DWSA 4I5RA 1QI5A 4W8BA 2CLKA 1G5AA 3JR2A 3OVQA 2NLIA 3LOTA 4RLIA 3USZA 1ZAHA 5LGZA 3A5VA 3VDAA 3GXFA 1NWTA 1XYZA 4OECA 1US0A 5ECVA 4YTTA 4BF7A 1S38A 2PURA 4NF7A 4OT7A 4RV8A 3W2KA 1XI3A 1HP4A 3RR4A 4IMFA 4A2SA 1VBGA 3MDWA 3VC5A 2D2GA 1DWJM 3GD6A 4GK8A 3VX1A 3I3BA 4MTVA 1BEUA 2LLEA 1BTCA 1TJ1A 5H6HA 1T96A 4DAFA 1PKLA 1RQHA 4U5KA 3VKDA 3TWAA 1C8XA 1HJQA 3EWUA 1UD4A 1YE6A 5E0KA 2HWGA 1CGUA 3TQ0A 5AHFA 3QC0A 5AHLA 4AWEA 2HVMA 2J8TA 3TA9A 1JCMP 3U7BA 1XLAA 2XIQA 3O6DA 3EWBX 4CQ9A 1Q6DA 4Q8VA 4F0KA 4B5WA 1WZKA 3CZ8A 3VCRA 3MSYA 2G8ZA 3NWRA 5C9RA 5FACA 1YW1A 3F1QA 1JVNA 3AXHA 2ACQA 1POKA 2F2KA 4GUJA 4Z2GA 3QR1A 3AMDA 1VB9A 2I17A 1H60A 2CLHA 1JDFA 2PDHA 2PUZA 1FTXA 2A85A 4XK2A 5FIPA 3N14A 1X6UA 1PX8A 3UR5A 4JAWA 2YSWA 3IV8A 1EGVA 1R0MA 1CXHA 4DF0A 3V5CA 1C7SA 4L80A 3BLEA 1A5AA 1TJ0A 4XVEA 3NZRA 4B91A 2ZXDA 2W5FA 2XISA 1BYDA 4MY9A 2OVLA 4Y8EA 4WF7A 1XLLA 3DKLA 3W1TA 4G5DA 2VD9A 2EBNA 3EA3A 4CCZA 4Q8UA 1UYQA 3E6EA 2E1WA 5I23A 1VBUA 1FKXA 1KO0A 1W9PA 2PEVA 1FWAC 4HPNA 1SZRA 4M8UA 3S46A 4DZHA 1MQPA 4WHBA 3SCUA 2HS8A 3E2VA 5J5DA 4A8LA 2ACRA 4WY0F 5AC7A 2P53A 3G24A 4XKYB 5CLTA 3HGJA 3B8SA 4HPHA 1MNZA 2P5NA 2YPIA 4XBSA 1DIKA 5U7SA 3GYEA 3WL0A 4P8UA 3THDA 1YLVA 4ML9A 3HA1A 3IVUA 4FLQA 1E72M 5C54A 2VNCA 4Q4QA 4R7OA 3CQKA 4MB5A 1X6NA 4DXKA 4PA8A 3WH8A 2AGTA 1RPKA 1NSJA 1R2RA 1UWTA 5H8PA 4GACA 3EOSA 1Z8AA 3NTYA 4NXKA 2XYLA 1WYIA 2YX0A 5H2ZA 3KBJA 4UBPC 1Q7MA 4PSPA 3ABZA 5I3IA 1TPEA 3NQMA 3KBVA 4N42A 2W66A 1O1HA 1QOXA 3EZ4A 4ZVJA 5C7HA 5LKYA 2PP0A 3MZNA 3POHA 1KRMA 4WX2A 2DGAA 3EBVA 3VDBA 2WCAA 1UCWA 1XDLA 5FJOA 4DM1A 4JKKA 2JEPA 5BXRA 3OIHA 4L4OA 4JQ1A 3WQ8A 3THQA 4C6BA 3BWWA 4Q4MA 4O1FA 4I7WA 1EJRC 4K8GA 3ARVA 2OFJA 3N3TA 2PWVA 2Z00A 3D46A 4QROA 4UZUA 2G4FA 3TFXA 1YHTA 3S4TA 5DT7A 4FNPA 4IQLA 3SFKA 2Q09A 4ZENA 3M0ZA 3L21A 1KXQA 1L2UA 1WP6A 1XLGA 4TR9A 3VNIA 4IISA 4RR4A 1S2CA 1GTHA 4RE4A 1FH9A 1GQJA 4ERGA 3RMEA 3CMFA 2DZPA 3HG3A 4FO4A 3VDHA 1M7XA 2IUZA 3S2MA 1A4LA 3ZT6A 4BS0A 3KLKA 5TD4A 1XLJA 3R10A 1VLIA 1KBIA 5A6BD 3CGTA 1XS2A 1CGTA 3FFSA 3HPXA 1PDZA 1DP0A 5F2MA 3TDFA 1H51A 1V6UA 4LEFA 3CT2A 1AZ1A 2OZ8A 1XGEA 2PFHA 4REQA 1IE7C 3QY7A 1W5QA 4XD5A 4JN6A 2DW6A 3ABRA 1SJDA 1RA0A 2ZX6A 3MS8A 2J66A 3BV4A 1XD1A 3CWHA 8CGTA 3IGXA 3KCJA 2E0PA 2G3FA 5HNTA 3NL3A 1FWDC 3W28A 3SR7A 5DEZA 2R1PA 1N2VA 1B90A 2A5HA 1B5TA 1ME8A 4ACZB 3SW6A 1GW9A 1YTEA 3GVWA 1GQLA 4QG9A 3GE7A 5CG0A 4JEJA 4IX0A 4MNKA 5CXPA 1VBJA 4V15A 3LTSA 4AHPA 1AA1B 3SADA 1W5NA 5I24A 4TVDA 2YJQA 4RW5A 1YPIA 2F6XA 4I9AA 1VENA 4ALDA 2VDGA 4BA0A 1GPWA 2JEQA 1XPGA 2Z28A 4A35A 2XWDA 1QT1A 1EDTA 1F7BA 1EZWA 2DFAA 2VCAA 3SUTA 4AH7A 3XINA 1QCWA 3D47A 1EEPA 1JF6A 1QDSA 3LGGA 1F8IA 6REQB 3NQFA 2ZX7A 1D2KA 3EDJA 1OYAA 3LCHA 4MKVA 4JDBA 4Y96A 4E8GA 4PBEA 3T05A 3MCOA 2D3LA 4R7WA 5G1YA 4Q7BA 3MO4A 3WQPA 2GWGA 2HRWA 1TX0A 4C6JA 2VFGA 3N3MA 3BC9A 1B54A 2PE4A 4X63A 4D6CA 4J27A 4MWAA 4E0CA 1ZU8A 1LZOA 1EPVA 1R5YA 3TX9A 4TTUA 3BL3A 4A21A 5FL1A 3IIPA 2Y7FA 3KWXA 1A53A 2VR5A 3CZKA 3LPGA 1R6WA 2YLLA 3WQGA 5ABEA 3W87A 2OSXA 3WD0A 3M0JA 1X97A 4CNUA 2YA0A 1DXEA 2YL8A 3MUZ1 2DORA 1O5KA 2OQHA 1Q6CA 3TMQA 1EJTC 3CUZA 1ZUAX 3RO6A 1ZCOA 3HGOA 2D22A 3NDZA 4Y9MA 3VIFA 3VFCA 1DL3A 4GVFA 5DMMA 5A6MA 5LHFA 4WY0A 1QFEA 2BHUA 4CN1A 2BZNA 3GC5A 1IHIA 3URAA 1UQYA 1AK5A 5A6KA 3DIPA 3F7JA 1NDYA 3UZZA 4Q22A 1NF0A 3EDFA 1W54A 2X8RA 3OG3A 1WAUA 2WNQA 1G7UA 4YTSA 2OG9A 1T99A 2QKFA 3C6CA 2AL1A 3CZJA 3KW3A 3LUTA 1DORA 1MVYA 3EOEA 1LUCA 2PWFA 1OCNA 5L6UA 4QJ5B 4KCVA 4HA1A 5HJXA 3A24A 3W1MA 4I9TA 1A3HA 3SUSA 4MY1A 5JIPA 3QPYA 4R27A 4BFAA 1E15A 2KZHA 2HZGA 4O18A 1PL9A 3DH7A 2ATSA 3ES7A 3BAJA 1EO7A 1FH7A 4HCDA 4O4WA 2EPKX 3E1F1 1Z89A 3W75A 2XPKA 3UG8A 3MKVA 4Y9AA 3GDTA 3ZR6A 4P7OA 5HAOA 3CIWA 3AYRA 1B3YA 4KMQA 2CITA 3T4WA 4LBUA 2X7VA 3UVAA 1M01A 2JIWA 4DAIA 4UTHA 3FX4A 1QXLA 4Z17A 1CI1A 4PUWA 3W7NA 4DWSB 2GGHA 4LV4A 2QHAA 3F5LA 3MI6A 3O0KA 3UA3A 3LV6A 3I7RA 3GG8A 1FWHC 2OEKA 1QI4A 1JG9A 4DN1A 2ZX9A 1VEMA 2D2OA 1Q63A 1F61A 3A3HA 5JIWA 2HS6A 3P80A 3PBWA 2PZ0A 2I57A 3GY1A 1LF1A 1V51A 3Q94A 3EDDA 3O1NA 1C91A 3AFBA 2DH2A 1YNQA 3VGEA 2WNZA 4XKMA 1K9FA 4UFJA 1MXDA 5JBDA 1QO2A 1J0JA 1V6WA 1TA3B 1P0DA 4IIHA 3FJNA 3ITLA 4RZ5A 1JQVA 1L6GA 1GZGA 1J8VA 3OA5A 2WC3A 4CU8A 1V3IA 1OX6A 4OOUA 4O54A 5FCZA 1BLIA 1NJJA 1UH4A 5XINA 4DBSA 3VCCA 3B05A 1LOQA 5F2IA 3DFYA 2DW7A 2WJEA 3MPGA 4LNCA 1ISWA 2E8YA 3FHAA 1VS1A 1YBQA 4IMDA 2AMXA 4BR1A 1XGDA 2VFIA 4NZ3A 2F38A 1WKDA 2EF9A 3TYCA 5U4NA 1QASA 5TNVA 3ANUA 3OVPA 1PX3A 2GVYA 1K7XA 4IJBA 4WJEA 1A3XA 3LS9A 1F8MA 1KXVA 2QVHA 3PTQA 3ARWA 3G1XA 1I0DA 4A22A 3IRSA 4LFYA 3UNTA 3N4EA 3W02A 3CZEA 1EJVC 4F9JA 3HG4A 3VFLA 4EAYA 4ACYA 2FJUB 2GJXA 3TTSA 4CNNA 3DBPA 1E0XA 4KFNA 2NQLA 3F4DA 3E3HA 2VX7A 2DZXA 4NZ5A 3MW7A 3VM7A 3PK7A 3LV5A 4MB1A 3SZ8A 2J74A 1K1DA 2H3BA 1GKQA 2VCCA 2VO5A 1IT8A 4BQ4A 3W7HA 2FTYA 3GG1A 3H2NA 2YCJA 1EWEA 1QPKA 3QQ1A 4EOUA 4B16A 1ISXA 1F76A 5D32A 4KRUA 4NJHA 3QHNA 4H8UA 4O53A 1X6LA 4Q7NA 4KRZA 3BCFA 1E0VA 1LWHA 3AHVA 4XZMX 3QSRA 3UYCA 1DJXA 1LLWA 3SY1A 1QO5A 1WBJA 3A4JA 1SZFA 1HW6A 4LUSA 5CH9A 3KVMA 4H83A 3GO2A 1QHZA 4AZ6A 3E5BA 5EMLA 4RNFA 4OUIA 2ALRA 4M19A 1V0LA 3QBUA 3VKJA 1U30A 2HISA 5KZMA 4G7EA 1VIWA 1MZHA 3QZ6A 3G0SA 2ZDSA 3OZMA 2J25A 3U5UA 5A8NA 4DM2A 1FWRA 3EYPA 2OT1A 3G3MA 1R9XA 3I3EA 2C19A 3W76A 5I77A 3BW2A 1VJZA 2UWFA 3N34A 1HJXA 1RLCL 2B31A 1O95A 3W1RA 2WZIA 4CQAA 2XVGA 2GVEA 4FNRA 1ONRA 1FWJC 3UWZA 4XD4A 1UW9A 1AQHA 1PIFA 3HPSA 1KM0A 3G1YA 3UJEA 2WZHA 5HJYA 5DXXA 3I7QA 2AAMA 4F0HA 2V63A 4JQ2A 1EJSC 1KRCC 3VI2A 3GFZA 2VX4A 4W85A 1KNWA 1B3ZA 1UWIA 1DJIA 3M7SA 3HG5A 5CJMA 2CZEA 2NV1A 3EA2A 3KTXA 4P8VA 3T0TA 4DEFA 2ZUNA 3NGFA 4YXGA 1T0OA 4MWAD 1TVNA 3AISA 3E0FA 2DT2A 3LI0A 4S3AA 4XZIA 2HJPA 4K36A 1EGMA 4HNVA 1DE5A 3C2YA 3RX3A 4M81A 1QI0A 3KDOA 3EKZA 4NUWA 3CZGA 4XQ6A 1FOBA 3GBEA 4MLJA 4LS2A 1XFBA 1NU5A 3BARA 3O07A 1PDYA 2PBOA 5HANA 3M5YA 5H8UA 5LIUX 1JZ5A 4AZ7A 3A9BA 2PWEA 2QCDA 1XUZA 3UBPC 2IXUA 4X9SA 1S5MA 3V5FA 4I7UA 1OJXA 1XHGA 4K3ZA 1K8XA 3UXKA 4IL0A 3F2CA 4M5PA 2HE8A 1WAWA 3V1PA 1VPQA 3LHVA 3FXGA 2F6KA 2QUNA 4ICCX 2WVVB 3NSMA 3SQMA 2J9YA 2A2IA 3N4FA 3PUGA 3WNOA 3FJLA 1T7LA 3THUA 4E6MA 1S39A 2ISVA 3FGCA 4FNQA 1QPRA 3CMJA 3VKKA 5LA1A 1TMHA 2OX1A 1J18A 3MUY1 1ECQA 4HJFA 3W27A 4IPIA 3VGHA 4FR1A 1BFNA 2DSVA 1OZQA 4F3HA 2QQ6A 5FAJA 4DJDC 1TWDA 5A8QA 1NWRA 5A6TC 4ROPA 3STPA 2HBXA 2Y8UA 2DUXA 5CC5A 4OV9A 2ZYFA 1Q13A 3FGCB 3IK4A 1D3GA 1HGWA 1J93A 4OUEA 2PGWA 1XRFA 3DFPA 1UPMB 4H6QA 2X0SA 3WEMA 1JPDX 2YLAA 4XX6A 2GVGA 3DN5A 1QJWA 3NPWA 1FP8A 5G4HC 3E0LA 3UZJA 3WUEA 2F84A 2DT3A 2YBUA 5DMLA 3W1LA 1MSSA 1B2YA 4YHGA 4YTRA 4IPLA 2A7PA 4XZNX 3S47A 1S2UA 1W1YA 5BRBA 3WMSA 4C5YA 1GW1A 3CU2A 4L64A 3UPBA 3CNYA 5F2GA 2QR6A 3D0CA 1OG6A 3RU6A 3T8QA 3KOXA 3PM6A 3CV7A 2E40A 2Z1KA 4NX0A 2G97A 4LCSA 4GNKB 4O8RA 1HO4A 4EPKA 1ECEA 3W53A 3ZT5A 3I65A 1M68A 4EWJA 4PH6A 3NQBA 4N6EA 1DQWA 4JYDA 2WXDM 4GMEA 3OBEA 4WY0B 4MDOA 2A6LA 1GEHA 2VEMA 2XGZA 5EFFA 2VQUA 3WJSA 1Q6RA 1AMYA 3AO0A 2PDYA 3PZUA 3DBNA 4B15A 1QHOA 3ATZA 2CXEA 2NXIA 2NLYA 2IPJA 3ORWA 3VVGA 1O5XA 1CXEA 3VOCA 4WK9A 3UY7A 4PMXA 4GY0A 2E77A 2OYLA 4IMEA 1CNVA 1OC5A 3B03A 3S5NA 2CFFA 1FWBC 4GZIA 3ICJA 4LJ3A 2E68A 3O3RA 2G41A 2JQXA 3COTA 3QV6A 3TV8A 1T5AA 4Z2HA 2PGEA 2JBMA 2D1ZA 3GK0A 3M6YA 3AZSA 1XLDA 4JXCA 4Z1AA 3W07A 2DSWA 4JTQA 1SUXA 5FD0A 2XU2A 1QMLA 2HNEA 3CS2A 4JZ5A 2GGEA 2RFGA 1XYLA 3BCJA 4M0XA 1M7JA 2QZRA 4V1YA 1UKOA 3OGRA 4J3VA 3MHFA 1XKYA 3ZJKA 1KV8A 3I6RA 3H2MA 4GKLA 1IEVA 5LXEA 2RUSA 2EKGA 1GZJA 4RX0A 2V30A 1R46A 3UJ2A 4BK9A 3M5XA 4S3BA 3P61A 3W1UA 4BI5A 1O66A 4L1WA 2PDKA 3B0UX 4YN5A 1JYNA 3MBDA 1UHVA 3CUHA 3PZIA 2Z0IA 3THAA 4CVUA 4Y9PA 2OMAA 3RO8A 2GOKA 4AEFA 5A8MA 2VXNA 1WZAA 7A3HA 3STCA 3CH0A 4OWGA 4N4PA 3IAQA 5CJNA 2OR2A 1KFJA 3MBFA 5CZJA 2V2CA 3BAKA 3SCWA 3AJ7A 4XV0A 3CL6A 2FMNA 5BXTA 2QW5A 3BURA 3FJ6A 2PD9A 1H5YA 2Y62A 1F3WA 4ZXLA 1FHVA 3ARXA 3WYZA 2BTMA 3UY8A 3MP3A 4GYFA 3RUBL 3AALA 3M0MA 2ZRVA 3QY6A 1R9YA 4NU7A 1ADOA 3EPMA 1L0PA 4MSSA 2FZ8A 3GW0A 4ERIA 1JI1A 1P4CA 3WJYA 1EXBA 4YIWA 3A12A 3D3FA 5EMMA 5HWNA 1JDEA 3DHDA 1BAGA 2MNRA 2WZTA 3KRZA 1O1ZA 4QSHA 5CPOA 4GE8A 2DQXA 1J96A 4XTDA 5EKYA 3EWWA 2VC5A 3QVQA 2Z27A 4HZMA 3I68A 3ZS4A 1REQA 4YMZA 1Q85A 5F7UA 2OU4A 2OYMA 4AVNA 4X2RA 3GC2A 1QWKA 1DJZA 1J0HA 4X60A 5EY5A 3NQEA 3WLSA 2XVLA 3TW6A 4LCRA 3FHQA 4PTVA 2DVTA 5ABFB 1KFWA 5B80A 4YS1A 1F4AA 1UR8A 3TCEA 1NWUA 3XIMA 3KL3A 4HNUA 1SFTA 1JPIA 3B06A 3MTWA 2Y5JA 4C6OA 3LHYA 3WQDA 3WLLA 2QXWA 3GG7A 1Z6KA 1K8YA 3E02A 3PWAA 3EWDA 5FF4A 4LOCA 1YNYA 3MMTA 4MZ8A 1N7KA 3ZT7A 1NOUA 5IBXA 3URQA 1H7WA 1LYXA 1Y5WA 4ZSTA 5FAGA 4KESA 1IXNA 1OD8A 4EANA 3WBXA 3W88A 1EUNA 2EG7A 2FDMA 3WQEA 5I0DA 4NAFA 3CB8A 4Y90A 3T1GA 3QY8A 3UZWA 2CZDA 3NL2A 4JTAA 1NM9A 2A3LA 3CYVA 1S2VA 3M0VA 2XFRA 4DUXA 3W1NA 4QNEA 5BROA 3UGVA 3A64A 3RK8A 1CPUA 3MVIA 3U4AA 1H3GA 4QCEA 2NT1A 3Q67A 3MU7A 2VR4A 3S1XA 1PVNA 4TMCA 2Y5SA 4Q6JA 2YB4A 1DJNA 5HMDA 5IBXC 4O16A 3W23A 4YU1A 1W9DM 2PA6A 3BJTA 4CNOA 1GUVA 2WM0A 1V0KA 2PP3A 3SGGA 4PUDA 4YYFA 1FKWA 4WCJA 2FVMA 5E5CA 4AZCA 5CPNA 3LX9A 4J1OA 4MWAC 4UXDA 3VNLA 4AVFA 1PTGA 4WSHA 4L56A 1HUVA 1TPVA 3OLIA 1K03A 2JGYA 3N2TA 3DHUA 3ATYA 3LPFA 3W7OA 2PDQA 4A05A 3MC5A 5AY7A 4XTIA 1C93A 4WDUA 4IG2B 1ICSA 1GOMA 2BVTA 4GO8A 2R9RA 3S1VA 2GUUA 5MHBA 1FCUA 2G95A 2QUVA 1VF8A 4HYRA 5BRPA 2BY0A 3VC6A 4S39A 5M1TA 4AVOA 1H0GA 2X1UA 2O7QA 3ZVIA 1YEYA 3EX1A 3IACA 1LTDA 1JDCA 1I0BA 1Q4WA 5IFTA 1UKTA 3NDOA 5IDIA 1SO6A 4Q4SA 4XD6A 3ANVA 3IJDA 1NIUA 3FA5A 5LZLA 1K4GA 5I79A 4AIBA 4LUJA 2RGLA 3INPA 5FEZA 4AU0A 3CUFA 1TPDA 3C86A 2YB1A 3LYEA 3H4XA 1C8VA 1GORA 3OG2A 4K39A 1T41A 4IQJA 4O57A 4EAMA 2PPGA 2VZTA 4WSKA 2TYSA 3K4DA 1YRRA 3SURA 1RJPA 2WMHA 1TV3A 2IS7A 4ZXOA 3AS2A 3EXRA 4AZHA 4UWMA 3R25A 3ZR4A 2ZVIA 4QJ1A 1Z41A 2BSLA 4JNZA 1MRQA 1JJKA 3TAOA 3RM8A 1VRXA 4LVBA 4YVPA 3CXOA 4DLMA 1PKYA 2DJXA 3GHSA 3T81A 2RGMA 4B2DA 1LWJA 3M0HA 1HGYA 4AC7C 4C6CA 1RBAA 2YR1A 1V6XA 1KA9F 1S2TA 1HG3A 2FPVA 2Z1VA 4FR6A 4IGSA 1V3KA 3NPXA 3W7MA 1H2JA 1B4KA 2WZEA 4G2DA 4RE0A 3CL7A 1WE5A 2AOSA 1ZZMA 2QCNA 1HVXA 4O28A 4TX8A 1A4MA 2ZKMX 4AMCA 1B1YA 1QOPA 4JHZA 3NZ1A 4Y6GA 3AICA 3VZZA 4UR9A 1Q6LA 4LAKA 3QSTA 3TP4A 1P0NA 3QV7A 1JFHA 5D30A 4ZQPA 1GKRA 1UUMA 1Z7AA 1WDDA 3KTSA 1GONA 3UERA 2P8CA 3M6DA 4ZE5A 4B5UA 4C1NA 1FCBA 1PCKA 2PI6A 3HQNA 1FHLA 4DO5A 4X3ZA 4NQ1A 4NJKA 3VAVA 1IXPA 4PSRA 2GLKA 4K37A 4FNTA 4YYCA 2DIKA 1VEOA 5E9XA 4TOQA 2ZC8A 4PB4A 5M3WA 1KB3A 1RBOB 3HPFA 4GUFA 4JR5A 1R7OA 1KR0A 2O9OA 2O0TA 4YHEA 1EQPA 4Q7IA 1KLZA 2WK2A 1VYRA 2Q6ZA 3IK2A 4DHGA 4QTGA 1BYCA 1EBGA 5IM51 3WF2A 3KX6A 3BAWA 4LYPA 3TLQA 3B9EA 2WJFA 4EXBA 2IQTA 4P2VA 4X9YA 2FPYA 3E38A 3BMXA 3MUIA 2VZOA 2VX5A 3QMTA 3FAXA 3B9AA 3NDYA 3GAKA 3TONA 3W6LA 4QHRA 4W7WA 3GVVA 2QVNA 5AN7A 2GVJA 4Q6XA 2DEPA 5EMKA 3VD9A 4EACA 4QRNA 4BF5A 5LNUA 1XSJA 3TQKA 1DJYA 4LPCA 3ENLA 4B9ZA 3F2BA 4EPBC 1VCVA 2I16A 2ZXAA 2WWDA 3NEVA 4ZFMA 5HR7A 3ES8A 1PPIA 3A21A 1SVDA 3A6OA 3HQPA 4GJ1A 3N2MA 3ARZA 3VOHA 3VYLA 1FCVA 3SN4A 4H9TA 4HZ8A 2GFTA 4HU0A 1H62A 1PO9A 1WKFA 1E6NA 1K70A 1KTCA 1KV5A 2AQVA 3G1FA 2J7FA 2DY3A 3NYZA 2HVOA 3VIKA 3R8RA 1Q7QA 4CKQA 3NGJA 3SUUA 1W1ZA 4IIFA 1KFLA 4U3AA 3BLFA 3NXLA 3ZSSA 4CCDA 4AIEA 1FWNA 3P67A 3T9PA 3LM7A 2UV8G 2BG5A 3FYOA 3ITYA 1EFZA 5CGMA 1QW9A 4DZIA 4DRSA 2VHLA 1SZGA 1T8QA 4NASA 2EO7A 1FP9A 1Y8BA 5E1QA 1UOKA 2PF8A 2ON3A 3NO5A 3W37A 2IPWA 1YX1A 3J7HA 3H7RA 3GNOA 1GOWA 3CIVA 2WOQA 4OV4A 4CD4A 3A3WA 1JZ2A 3PF3A 1FDJA 3KHJA 3GXNA 1BPLB 4HK7A 4A3RA 3NQ8A 5HXMA 4O14A 3LCWA 5EMYA 2NQJA 4Q32A 4ORMA 1A0CA 6PTDA 3T0DA 1OX5A 2QIIA 2WJDA 3IJIA 3GAYA 5DO8A 3VD7A 1C8YA 1N82A 3RF9A 2WKGA 1L8PA 2XIOA 1TKKA 1XIJA 4UOQA 1VHCA 5B7YA 3BGAA 2YCLB 3BMWA 2F61A 1JCXA 1XIMA 3SEPA 8XIMA 3VPLA 1F6KA 1MEWA 2VFFA 3PHAA 1A5LC 2GK1A 1XH1A 5D38A 1E9YB 1TIMA 3OQEA 5DLCA 5K4XA 4LW7A 3WSUA 4C6IA 2J6VA 1J9YA 3WK2A 2BXVA 3H2CA 2WHLA 1V3HA 3NSXA 1DVJA 3RJYA 1PTAA 2BVWA 1U22A 3RN6A 4XWUA 2YW4A 1QRQA 2IXVA 3S3GA 2OJPA 3PBVA 2FVLA 4QM1A 2X09A 1H4PA 3PUDA 3W01A 1J2WA 2EKCA 2HXUA 3PPFA 3TW9A 4OE7A 1PCWA 1S3TC 1OG0A 4MFEA 4UIOA 2Z26A 1PIIA 1K8CA 2QNEA 2REQA 3FOKA 3M0YA 5AVHA 2GYIA 3UT0A 4UUIA 3KAOA 3LPPA 5AYIA 1IV8A 1AG1O 4FALA 4GPNA 3W1PA 3W00A 3QMRA 1UROA 4LUTB 3RX2A 1W56A 3CJPA 3ZYZA 3CH9A 5HNRA 4JTKA 2ZZ1A 3PP7A 3SO7A 4CCEA 1SMAA 5I3DA 5C8BB 1TVLA 3ANYA 3SJNA 3W26A 1A5OC 5LXXA 1Q65A 5REQA 5CPLA 1X7IA 1U5JA 1HJSA 2X1IA 4ZOAA 1BSLA 2EPOA 3TOYA 1JPHA 2Z1WA 3PWGA 4FX7A 1V6VA 3W38A 4CQ8A 3TIMA 3L68A 2BNJA 3KP0A 1TJ2A 1XFCA 1EC8A 4RZ6A 1REQB 4FX6M 3PBUA 3G1RA 4I5UA 4PE8A 2RH9A 1D8CA 4D8LA 3L9CA 4H9YA 3GH5A 2BGNE 3RMJA 2QCGA 4MM1A 1JUKA 1KKRA 3IIXA 5AC4A 1CGVA 1G4TA 4GUIA 4WVXA 1BWVA 2WZMA 2NX3A 3F4NA 2MANA 2TSYA 3IANA 3TZFA 3PZTA 2ZUTA 3RNDA 1XIHA 5LNWA 3M07A 1UB3A 3WH9A 1YXCA 4HMEA 4NI8A 4FF5A 4TUFA 1OFBA 3UZ5A 4GCXA 4MJ2A 3VIHA 3SN0A 1GKPA 1LOSA 2O55A 3MP5A 4LVFA 1WXZA 5HINA 1ZJHA 1RR2A 2W92A 3LCGA 4LB4A 4ZQOA 5E09A 4Q4KA 4ENLA 3G1AA 3WLKX 2OZ3A 1WBHA 3EKLA 5GQBA 4E2BA 3RGTA 3W6MA 3NOYA 5DMYA 1JYVA 3O0FA 3W25A 1EA9C 4M6VA 1UD5A 1FX6A 2SFPA 1AQFA 1E51A 4AW7A 5D9PA 1OK6A 3S2NA 1CX9A 3UJSA 4Q8TA 3QN3A 3R0UA 2OOGA 3PZOA 2HCVA 1FFRA 4H41A 3G1VA 4UQEA 3DYMA 4HNTA 4N2YA 3SCNA 4O8AA 2BY3A 3S42A 4X0NA 4YL2A 3STGA 1R2TA 1GVSA 1QUMA 2XM1A 5BU9A 1B9BA 2HQAA 1LORA 3GSMA 5AOUA 4L6DA 2YW3A 1UR2A 2F9RA 1VRDA 3VMPA 1J10A 3LHUA 2V5CA 1J01A 2YFNA 5BOOA 3R11A 3ZWTA 2FTWA 1J0ZA 3WLQA 3LY0A 5LNRA 4AF0B 3WD3A 3MY9A 2VD8A 4B5NA 5FJJA 1HL8A 1MYRA 2I5GA 1QNVA 1S2AA 4HMDA 2XN0A 3XISA 3VD4A 1BVZA 1VPXA 2FGZA 1RCXB 3G1HA 1LM1A 3JU2A 1TJRA 1W9XA 1WXYA 3W22A 2QJNA 3P8JA 1CGXA 3NIYA 1FFQA 5T8GA 1Z42A 3VKBA 3WJXA 2CZVA 3SY5A 4ROQA 2XGBA 5JH2A 1FBAA 4GH1A 3L4YA 1ICPA 1CXLA 2DSZA 2B81A 4OQVA 4DBWA 3ARRA 5CC3A 4KEZA 3C2FA 3F2DA 5D9NA 3N1AA 1XINA 1ZP3A 2H8XA 2W4XA 3HO8A 5A6AA 1NP2A 4J2PA 4FK9A 3ZVHA 4L9ZA 1ADDA 3GS6A 4JFSA 3D5HA 3OVRA 3BAIA 1AL8A 5DXYA 5CAKA 3VGBA 1G6CA 4PMZA 1B31A 4P5UA 3N6HA 4REQB 3VKAA 3GX9A 3IWPA 1A5NC 4J4KA 4ZFCA 1JCLA 1Z9AA 5EU9A 1HL2A 2RHGA 1HP5A 1QW8A 1RCOB 3M0KA 1S2WA 2WW5A 2BOGX 4LU0A 2FHFA 1Q2SA 3WK1A 1TPC1 3W2NA 5D05A 4QS5A 4U5IA 5ABHA 2V9DA 2YL9A 4EXAA 4PODA 4UQAA 4HP5A 2CEQA 1A0DA 2QS8A 1B3VA 5D4YA 1FA2A 2FZNA 3N9SA 2UY2A 3RJXA 4UNIA 1I45A 1KM5A 1LWIA 1QW7A 2J7BA 4XIAA 1GVQA 2HROA 2GQ9A 4ECLA 1OFRA 4R53A 1V02A 3GIYA 1EEXA 2GJRA 1TV7A 3CB3A 1R3WA 3PAJA 2EQDA 4M1BA 1E4IA 5FOOA 1F5ZA 1UWUA 1UZ4A 1UZDA 2E67A 1EPXA 3NURA 3V18A 2R1MA 3PFRA 2DZSA 1TRDA 3GTXA 4RDVA 3SCOA 4PTDA 3DGBA 1JZ3A 4JX4A 3SCQA 4OIFA 3WUGA 1R3RA 3C2RA 2X42A 1DHPA 1QWGA 1CLKA 1PWMA 4B5SA 3S1WA 1XICA 4NKCA 1CXFA 2WCSA 2Y7EA 5HNUA 3WF4A 2IPGA 3FW6A 3N12A 1OGSA 3VKCA 1F6YA 5EMUA 1VR6A 2V3GA 3K4WA 1K3UA 4HN8A 1K7EA 2V81A 5EL1A 4CQBA 3AIWA 5FJIA 4IMAA 1BRLB 4UTKA 1RP8A 5H8MA 3G6MA 4ACZA 1R7AA 1TTIA 1SW3A 4J40A 2DZBA 4L4LA 3SQSA 2CLOA 1M41A 3CC1A 2G0WA 5G1TA 1IR1A 3GHRA 3H2FA 1ZHAA 4LAZA 4LBRA 2VI0A 4GNVA 4GKTA 3CZLA 9XIAA 1SYTA 2ZZ3A 4PTNA 2YCIX 3OJGA 2WVTA 4ZZ9A 1WCGA 1OYCA 2JKEA 4IPJA 4H8HA 3U2OA 1QNSA 4E3TA 1MUMA 3R6IA 1JYXA 1QPNA 4HCLA 1E5NA 1LP6A 4IHCA 4MKNA 3CUGA 1HKMA 1E4LA 4YJ5A 1S3HA 3PTMA 4M6PA 3VO0A 3GNRA 1B3XA 4MUPA 5C2XA 1VH7A 1IEQA 1NFBA 2QYGA 2X41A 3TKFA 4BKNA 1KBJA 1EXPA 4XVDA 1R8LA 4POCA 4ES4A 1I75A 4UNLA 4QE4A 4UFLA 2VEIA 3QJAA 3SSZA 3BPWA 1U33A 3WBEA 3E0WA 1E4MM 3UWUA 1VFLA 3M0XA 1UWQA 3ERPA 2PDBA 3ZMRA 1GVOA 4IZGA 1LT8A 1R9ZA 2FH6A 1PUDA 2A6NA 2EG6A 3F4VA 4LVAA 2E28A 5CBIA 4EE9A 2V68A 3TN6A 3NFUA 3R1ZA 3SAZA 1TRIA 2ZDRA 1MQQA 1PWLA 1XL9A 1QK0A 3UR7A 4MLRA 6ALDA 3CAQA 2VFDA 3GHUA 4Z08A 3VOJA 1OINA 3RCMA 4P7LA 2W79A 4QG8A 4GZ7A 3QZEA 1KBLA 4JYFA 1L9WA 1L6SA 1L8NA 4O0QA 4OZOA 2WVUA 1GPFA 2E6AA 3QXBA 1XLCA 1OCQA 2HDJA 2ASHA 3CEUA 1Y5XA 2JF6A 2ZXBA 3B8TA 3DZ1A 1KC7A 4D6HA 1SW0A 1AJ2A 3NZQA 1RP9A 4MWAE 5LA0A 1VQTA 2WMKA 5FA5A 1L6FA 4AB4A 1GHSA 3M7WA 3OBKA 3L5MA 1OM0A 5IHSA 5DFAA 4HVXA 3HMJG 1E1CB 4AWTA 3LQGA 3LMYA 2XH0A 4GA8A 4IF2A 3KZSA 4BY3A 3QQ0A 3LXAA 1UR9A 3T2QA 2PODA 3TUUA 3KRBA 1WO2A 3UXAA 4IQDA 2VFEA 4R5EA 4QX4A 2WC4A 4PMYA 4S3DA 4QQUA 2GK1B 3WLHA 2FYMA 3FVMA 7TAAA 3I3DA 4RZBA 4FA3A 1CCWB 5HNNA 5MKGB 2VRJA 3TLLA 3VOFA 1HKVA 4QCFA 2J8GA 3N4AA 4NZCA 1ZNNA 3LNPA 2WPBA 1XIDA 3BQ5A 5K7JA 1R3YA 4LH8A 5A6BA 1E4NA 4I90A 5E93A 1VBHA 1H41A 1J12A 2CLPA 4S3EA 3RXZA 3A5FA 4AD1A 3IEBA 1G0CA 3V16A 3E74A 3U3HA 3AAMA 2W6RA 2NSXA 1KGWA 1DWIM 2KX9A 3TC3A 1GOKA 2WYSA 2REQB 1IIHA 1KQYA 4NRRA 4GWEA 9RUBA 5DRIA 1W8SA 5T9BG 4D6FA 1OK4A 4QNWA 4QEHA 4NILA 1XH0A 4KWSA 2VGFA 4KWVA 3FEMA 4M6QA 3VU2A 2QPXA 3NZPA 5L9FA 3L4XA 3F03K 3PZNA 3UJRA 4PL2A 4ZE4A 4I6KA 3LMZA 2Y24A 1TUXA 2V69A 2EPLX 4H8VA 1FQ0A 4MJMA 2OELA 2GDQA 2H90A 2INZA 4NAEA 3UCDA 3QOMA 3PPGA 1OIMA 4JKMA 1Q6OA 1PSCA 3DXIA 3SCPA 3GYCA 4Y7EA 4C7DA 1M9HA 4JTLA 4NZ4A 4DWSD 3TR2A 4F0MA 1C92A 4PRRA 1Q5MA 3I6EA 1EGZA 4HA0A 4ZB2A 1EQCA 3MHGA 2VEFA 2Z4GA 2PDUA 4O0KA 3UXLA 1KR1A 5LA2A 3C61A 2E25A 1J5TA 2E1DA 4FEZA 3P0WA 3G18A 5CPTA 3K46A 1TJPA 4R34A 4G1NA 2J7EA 1OADA 1PJ9A 1NEYA 5G5IA 3ARUA 1LROA 4UTTA 4PTMA 2E5DA 2J7CA 4GIYA 1ZS2A 1MEHA 1L2QA 4ONVA 2VEPA 3MV11 1DQXA 3W7KA 1XBZA 2D2HA 4RE2A 1S5TA 3WUBA 4UMBA 3WELA 4DO6A 3HU7A 2UY5A 1W3IA 4XBKA 4HU4A 1SPQA 2OEMA 1ISVA 4M1RA 5KZ6A 4Y9NA 3AC0A 1W1IE 6TAAA 5DN1A 4N7QA 2CBJA 3EX6A 3H24A 4DPPA 1UH3A 3Q58A 3LPOA 5EA9A 4OHQA 2A7RA 1JAKA 2PBGA 4HNLA 2H9AA 1HVQA 4XZWA 1UA7A 1X8CA 2FB2A 5DCBA 1DJWA 1HX0A 3IJ9A 3ARPA 2E9LA 3BTNA 3UF9A 1FUYA 1XRSA 1OFAA 1NDZA 2BODX 4GJJA 1P7TA 2D0FA 4RXFA 3IJ8A 1XYAA 4NSBA 4L6OA 4PMVA 4PRWA 4EPDC 2C6QA 1BQGA 4CUCA 2XHYA 4H4IA 4ZTYA 1OZMA 5CEWA 4GVHA 1VKFA 2C3ZA 2ZRXA 3MHUA 3NQCA 4JNMA 4HOXA 3QLDA 2AKMA 2X2YA 3W2LA 3L66A 4AXNA 1KXHA 1W1PA 3C0QA 1YDVA 4L4PA 2X30A 4PUEA 4JTDA 1PZ2A 2NQ5A 2Z2AA 3VIGA 4LALA 1SO3A 4M3PA 3TJLA 3W82A 3WY1A 2WLZA 5I78A 3L5LA 1V79A 4IUOA 3E0VA 4DNHA 4PMOA 1UASA 4LF2A 1UP3A 3BLOA 4C6MA 3QLLA 1V93A 2ZWYA 4J2MA 1AW5A 1NELA 3RILA 3WD1A 2EPHA 5I09A 2ZRWA 3N2CA 2C15A 4HNCA 3WD2A 5JUVA 2UBPC 3C2EA 3QV8A 4IFKB 3TYEA 7ODCA 1DWAM 3E0IA 3TN4A 3O6CA 1FWIC 1EZ2A 4XUYA 1YMYA 3ARSA 1KLYA 3CK5A 3GTNA 5HK4A 3LI1A 2BASA 3NQ2A 4D72A 2QCHA 4UR7A 1GVYA 4O1BA 3Q65A 3QW4B 4WGXA 2BFGA 4JEQA 4U4MA 4IJCA 1ME7A 1BHGA 1N8WA 2XH4A 4FNUA 3RM9A 3EWYA 3TVAA 3E2QA 1CGYA 5K2ZA 1A5MC 3FKKA 3SRHA 1XV8A 3H23A 3B3DA 3ITCA 2YA2A 1NQKA 3K8MA 3NUKA 1KD0A 3FDKA 1ZBVA 7PTDA