3SSJA

Crystal structure of methanothermobacter thermautotrophicus orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-ump
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
214
structure length
214
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Methanothermobacter thermautotrophicus orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-UMP
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 87
structure length 214
sequence length 214
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ssjA00
3W85A 3C2EA 5KZDA 2KZHA 2GQ9A 3P7YA 2ZZ3A 2TYSA 3QJAA 2ABBA 1Q6LA 1SO3A 1XM3A 2CZ5A 4CQ8A 4O0ZA 3DH7A 1RQBA 4EF8A 3O63A 4FHAA 3T4CA 3UZ5A 4LTSA 2Y61A 1KLZA 3SFKA 4MZYA 4ML9A 4FNRA 2H8XA 1KM2A 1RVGA 1X1ZA 4M6VA 4K38A 4NVTA 1LOSA 3W07A 2WOQA 4JTTA 4NU7A 4S2BA 1G7VA 4FNTA 3UXAA 3N3MA 4BF9A 3PC0A 5DXYA 1S3HA 4O1BA 3SGUA 3PB2A 4PODA 3W2KA 3NEVA 1H61A 1OJXA 2OZ0A 1SZEA 1VH7A 1MEIA 1F73A 4GUFA 3E96A 5E1QA 1LP6A 2CLOA 2YPIA 5L9FA 1PIIA 1TV7A 5F1VA 5DBTA 3W71A 4DF0A 2PRMA 3ZR4A 1EA0A 2A21A 3W1AA 3G1DA 4YCOA 4M5PA 3R89A 2BLEA 3MBDA 1XCFA 4Q4KA 1O5XA 3RLUA 3DFTA 2J9YA 4FX6M 4TMCA 3TH6A 4FB7A 3WJWA 4TU1A 3NQAA 1TPWA 1DKWA 2B0MA 3F1QA 3W1RA 3CWNA 4IGHA 1JUEA 3W1TA 4PEKA 5BRBA 1LYXA 3LM7A 1DVJA 2PURA 3MYPA 1SSGA 2Z2UA 4MIMA 2Z1BA 1ML1A 3C6CA 1D3GA 4I7WA 1VLWA 3W1XA 1GTHA 2ZZ2A 4IMEA 3UWWA 4FXRA 4U28A 4QQ3A 2Y70A 3THQA 3BW2A 1KM0A 4PH6A 1THFD 1I2OA 2HS8A 4HSNA 2YW3A 1RZMA 3U6WA 4ZQRA 1Q3NA 3W7MA 1TQXA 1TMHA 1ZENA 1NF0A 2QJHA 4K39A 2ISSA 2DZSA 4UTKA 1WV2A 4NZJA 3DFQA 4UTIA 4LVAA 3HG3A 2VFGA 4NQ1A 5AHFA 3C2RA 2P10A 3N14A 1FWTA 3LHZA 4GBUA 3E49A 1K3UA 3JS3A 2J9ZA 3P80A 3DFSA 3IIOA 3BLEA 4I9AA 5KZEA 2GPTA 4ICNA 1FXQA 1W0MA 4R34A 2C15A 1MO0A 2ZTJA 1TV8A 4CQAA 5A5WA 3USBA 4IPIA 4OHQA 1J5TA 3QEZA 2ZZ1A 3M6YA 3PUDA 2FDSA 3NPVA 4IXXA 2FJKA 1QOPA 2QJIA 4AF0B 3RMJA 4DELA 3L67A 5C6MA 2J27A 1M7OA 4RXGA 1FXPA 3FEMA 2H6RA 1EWEA 2QCFA 4IPJA 3NL3A 1OF8A 5CSSA 1OVDA 1NFBA 1OYCA 3TA6A 4LC6A 4XTIA 1IXOA 4LVBA 3R2GA 3PM6A 3HGOA 4Z1BA 4LU0A 2CZFA 4B5NA 4EIVA 6ALDA 4BI7A 1GEQA 2A85A 3CTLA 5DN1A 1ZNNA 3T7VA 4GE8A 3EKZA 2W6RA 4JXCA 4OV9A 2YR1A 1DL3A 4O12A 4XBKA 1KTCA 5FF3A 1H7NA 1YTEA 1GG0A 3S1WA 3DFOA 1RPXA 2W0UA 1S5WA 4KFPA 1EEPA 2RFGA 4EF9A 1OFOA 4RZ4A 4WD0A 2JGQA 4UMBA 2E5BA 3QW3A 2BWGA 2HMCA 3QF0A 1F7BA 3MMTA 1TIMA 4QISA 3OBKA 2EPHA 1S5VA 2ATSA 2DZTA 4KWVA 3W7OA 1H63A 2DZWA 3QQ1A 3ANYA 5BW6A 3VKJA 3NQ2A 3EWYA 3EEGA 2QCDA 2X1TA 1YPFA 4NNBA 4BFAA 2C1HA 1QDSA 3LX9A 3UY8A 3THAA 5HWMA 1IF2A 1VS1A 3BO9A 4AWSA 2F84A 2FPVA 3L65A 4O11A 3STGA 4MLJA 3W7KA 3FIGA 1TO3A 2P0OA 3DAQA 1C8VA 4M19A 4NT0A 3G1VA 4LWWA 4O28A 5D32A 2C13A 2VEMA 4JTUA 4X22A 3PSVA 4RR4A 4JNMA 5GVJA 2QCLA 1J2WA 4DO5A 3F4NA 3EWWA 2NX1A 4S2CA 1LM1A 5C55A 4RZ6A 2G5WA 4MVAA 5AN7A 3LCFA 1VCGA 3FYPA 3S0CA 4C1LA 4UC5A 4FF7A 4E2BA 2GJLA 3I7QA 3HOJA 2PCQA 4IUOA 3W7GA 4GUGA 2ZRUA 5D03A 4TO8A 5J5DA 1R47A 5K4XA 2NX3A 3EWZA 1G4TA 3TFXA 2B7NA 3RU6A 4MJMA 5DCBA 2QR6A 5SWUA 5EBUA 5G2IA 1I2NA 1IIGA 5F2MA 3DFPA 3QMSA 4O1DA 4R33A 1XFBA 3C61A 3CLMA 1NAL1 3SR7A 1B57A 3HGRA 3CWOX 3TROA 1SW7A 2E6YA 1K7FA 5FEZA 3DXIA 1ICPA 2A4AA 4UXDA 1KA9F 2YYUA 4KWWA 3NM3A 3W7LA 1JQVA 5IM51 1EX5A 4MZ1A 1GZGA 3W74A 1KTNA 5DCEA 5CZ0A 5KINA 5J5RA 1E51A 3NQ6A 2HTMA 5F2LA 3L5LA 5CPLA 2UV8G 5G1TA 4TIMA 1F76A 4K36A 1EB3A 4CLMA 5D2TA 4O0KA 2JBMA 4FEZA 5AFDA 2AGKA 3B05A 1BWLA 5CPNA 2WNQA 4UTUA 3R13A 3M7WA 4K8HA 3UNDA 3G1XA 4G1KA 4PFMA 1WOAA 1KV8A 4AF0A 3LCXA 4NXKA 4CCCA 1I45A 1KFKA 3KXQA 3VFLA 1SW3A 1FUYA 3NR0A 3ATZA 4NXSA 5D2WA 1ZAHA 1WOBA 2VFFA 3M9YA 3G3DA 3AJXA 3ABRA 3O6CA 5TIMA 2FB2A 3EB2A 2OT0A 4N4PA 5LNVA 3MWAA 4K7VA 5T26A 3P60A 4JY8A 1OFQA 2GQAA 1F6PA 5BMXA 3LHUA 3MI2A 3VE9A 2NX9A 3W1PA 2X2GA 1QMLA 1GVOA 2PE4A 2X16A 2VELA 3HO8A 4OE7A 2ALDA 1L2UA 3CT7A 4WQ6A 5IBXC 3LV6A 2E68A 4WOZA 1C29A 4WX2A 2VOMA 4PA8A 3G18A 5CGQA 1QAPA 5HJLA 4FIRA 4HNTA 3MHUA 3S5ZA 2NWRA 2E1DA 3EXSA 4MJZA 4O4VA 1MZHA 3Q58A 4LS2A 3W72A 3GKFA 1J4EA 5DY2A 4X9SA 2DZUA 3PR2A 4HSOA 3FS2A 3PG9A 2NUXA 1JRBA 3L21A 4IMFA 1T8XA 1FX6A 3NM1A 4FX7A 1R2RA 1ME9A 1ZJIA 2YFOA 4LT9A 1G4PA 3EX6A 3ZWTA 1X7FA 3W7CA 4FNSA 4MYAA 1RQEA 2P1FA 1ICQA 1QWGA 5C5YA 2BXVA 4K7YA 1TRDA 1Z42A 1N55A 1ZFJA 1R46A 3DBPA 1EP3A 3TE9A 1OYBA 3W7QA 2CW6A 3T44A 2Z6IA 1HG3A 3STFA 3I7SA 3P5ZA 1FCQA 3LCWA 4LW7A 3DKLA 5EYWA 5F4WA 4Z1AA 3U8GA 3ZS4A 3LCHA 4YXGA 4N9EA 4UTWA 1I2RA 1G69A 2O7SA 2VXNA 3NPXA 3HMJG 5LSMA 3WJYA 2FPTA 3H53A 2ZDRA 4WXYA 3G1YA 3DENA 2QCMA 3QYQA 4N2YA 3LRKA 1JCXA 1XUZA 1KBIA 1TPVA 1G6CA 1OFBA 3GDLA 4UFMA 3A21A 4ZQPA 2I1OA 3I6RA 4HPJA 3PY2A 2Y7EA 4FNPA 2ZRYA 4MUZA 5F1UA 1T99A 1W31A 3K30A 4UTHA 3G1SA 2NUYA 1B4KA 4DO4A 5TQLA 3QMTA 3W86A 3EX2A 2V5LA 2QUUA 3SSJA 3LHYA 3DI1A 3ZWSA 4KFOA 2A5HA 4LOCA 1FDJA 1NSJA 5G5IA 1OHLA 4Q32A 3M44A 2NXGA 4O1AA 1M7PA 3OVPA 3P74A 2OMAA 4R53A 4O54A 3W1UA 3LOTA 4LY8A 1AMKA 3W73A 3WJSA 1VQTA 3MP5A 5HR7A 3N2MA 1VYPX 1Q6QA 3OA3A 4EVZA 1YXYA 3IV3A 2G97A 3G1FA 4CCEA 3KOFA 3JR2A 3C2FA 4JICA 3O8AA 4AEOA 2A7RA 1FDZA 2QCGA 3RNDA 1ZCOA 2FPYA 2Q8LA 3Q2DA 2GQ8A 1VCVA 3I68A 3GDKA 1EUNA 4Y90A 3S6DA 1W3IA 1UUOA 3LTSA 2F7FA 1XBZA 1FCVA 2PRLA 3W75A 1TTJA 3NL6A 3PUOA 4O15A 3TCEA 4N02A 1W5NA 1JRCA 2ABAA 2I9EA 3SZ8A 4XWUA 2YCEA 1JUKA 5I3GA 5KMYA 5CPMA 3TW7A 5AYZA 4D2JA 3P8IA 5A8GA 1MXSA 1JCJA 3ABQA 1H7RA 1IIHA 3QPYA 2FLIA 4PL2A 1ZAIA 4GRSA 4WZHA 2VENA 2WO5A 1TJRA 3UY7A 1JVNA 2EHHA 1O94A 5G4WA 4TMBA 1M6JA 1D3HA 5MHBA 4KFNA 1PCWA 1YTDA 1K02A 1TREA 5D37A 7TIMA 5AYYA 4UIOA 1R2SA 1PL9A 3SY5A 4FXSA 1DBTA 3INPA 1TTQA 3P67A 2VFEA 1TCDA 4UTMA 1TPB1 3NAVA 3RLVA 2DP3A 1OG0A 2QCNA 3M43A 1YADA 4JTSA 2B7QA 1AK5A 1DV7A 1FCUA 3OHIA 3TKFA 2R8WA 1JCMP 5AHMA 4JTIA 4N9CA 4JDYA 5AC8A 3O15A 5K7JA 1WA3A 5FEPA 1VRDA 3HGSA 3HG2A 3LLFA 1H7WA 3CC1A 3TAKA 4CQ9A 2AAMA 3BGJA 1XBVA 1UB3A 3LGEA 2R14A 2V82A 1CX9A 1OABA 2FTPA 4JEQA 3NZ1A 1OK6A 3LXAA 1VHNA 5HINA 2OCZA 3NYZA 1OX4A 1L6WA 4AVFA 3L68A 3MHFA 2CLIA 1OYAA 2RDTA 3UWQA 3OG3A 5I3FA 2EF9A 1VGAA 2CU0A 4LV9A 5K9DA 3FOKA 3GK0A 1KW1A 5F2GA 1G4SA 2J24A 2X1UA 1PHWA 1OFPA 1OFDA 2YXGA 2V2HA 2X1RA 3R5EA 4HT3A 1WXJA 3CHVA 3HPSA 1UASA 1YPIA 3HGJA 4O17A 1RD5A 3UYCA 1W5MA 5ABTA 1K7EA 4MKNA 4ONVA 2CLFA 1GWJA 3BGGA 4Z0SA 1SPQA 3HPZA 1FWSA 3PBUA 1TJPA 1DJQA 2A0NA 2TRSA 1KFBA 1DOSA 2QCHA 1WX0A 4HNNA 4NJIA 4OQVA 4Z1CA 1P0KA 3NGJA 3LXBA 2FIQA 4A3UA 1N7KA 1EUAA 3GYEA 4N9DA 5LNUA 2B4GA 1F74A 3N19B 2BZNA 1KFCA 1TQJA 2VFDA 4RXFA 3QH2A 2V5BA 3W2LA 3O1NA 3SJ3A 1AW5A 2A7PA 1PVNA 3QRHA 4MFEA 3TQ0A 1KFEA 3IVTA 1A5AA 1KM5A 1QPOA 3B06A 3O07A 4UFLA 1OFRA 1UBSA 4RZ5A 1OX6A 2NZLA 1KM4A 3LBMA 3LHWA 5AB3A 4GJ1A 4UFHA 1GVSA 1OK4A 1W5OA 3NG3A 4J9JA 3M0ZA 4GUJA 1LOLA 2VKZG 2ZBTA 1RR2A 3FJ6A 3GAYA 1W1ZA 3LHVA 3IEBA 1YXDA 2Y63A 3IIVA 4LVFA 5AOUA 3TDFA 4XQ6A 1LROA 1W8SA 2GVLA 2VC6A 2ZCGA 3A9IA 2NV1A 1HO4A 2WSRA 5FF7A 5E0KA 3LTPA 1LRNA 4IWWA 2YX0A 1K8YA 1HFBA 2HS6A 1H7PA 5F4SA 4NJJA 3GZ3A 3TC6A 3A5VA 2WPBA 2VEPA 3NQ7A 2WQPA 4DO6A 1GT8A 5E93A 5F2IA 2V2CA 4IXHA 2IQTA 5FESA 3DZ1A 4FNUA 1XDMA 1FCBA 3NQMA 3P8JA 4N6EA 4ORMA 4ADSA 4PCFA 3KRZA 3L0NA 2VEIA 5AHIA 2E77A 5TBOA 1LRTA 5DY3A 1K8ZA 3KHJA 2FB3A 3LBCA 1KTBA 4DPQA 3S9YA 2E6AA 4HHPA 1K7XA 2Y7FA 1B3OA 4W9TA 5KTLA 1EP2A 3W23A 4JN6A 3LI1A 3KX6A 1TYGA 4QIUA 3GIYA 4JYEA 2QCEA 2Y6ZA 4JD4A 4XBSA 3C3NA 4I7UA 1F5ZA 3NQVA 5FEWA 3WK2A 2JKEA 3CU2A 4U4MA 1XC4A 1FDYA 1GYNA 1TB3A 4JTJA 4UTJA 3T55A 2C6QA 3NQ8A 1GG1A 2A1YA 2RH9A 1WBHA 1XXXA 3PAJA 3B8DA 3A5FA 3KFTA 3WK3A 5HR6A 5H91A 4GC4A 3UWZA 4X2RA 3M1ZA 5HMSA 3G24A 3FFSA 4OBTA 1AL8A 5D04C 1DJNA 3UXDA 1SZNA 3PBWA 4BWLA 2WNZA 3TSBA 1OF6A 4ORIA 1DQWA 1A5SA 2Y7DA 4OU1A 3O05A 1T96A 2Y62A 3QQ0A 4OV4A 1EIXA 3IVSA 4RLIA 1LTDA 3KVJA 4AAJA 2ZTKA 4A2RA 3GR7A 1RQHA 2W79A 3W88A 1TPEA 1XI3A 1TV5A 2J9XA 2NV2A 2NXHA 1KV5A 3IRDA 1LBLA 3NQGA 3H55A 5DELA 3W2UA 1B9BA 4LC8A 4MZ8A 2ZZ6A 4JTHA 4ADTA 1FY6A 3GX9A 3ATYA 2A7NA 3W3OA 1LOQA 1LCOA 3LCGA 3M47A 3PG8A 3ABSA 5AC7A 5D30A 3NXFA 1QOQA 4QNEA 1JJKA 1PCKA 2VFHA 3VI2A 3A22A 2V81A 2I14A 1LBFA 4RX0A 1XL9A 3EX1A 4BI6A 2G96A 4DQWA 6TIMA 3G8EA 3G8RA 1H60A 1OX4B 3NL5A 3GKAA 1TPFA 5K3VA 1LBMA 4PTNA 3PBVA 3L9CA 5CZSA 1LLWA 1SO4A 3S1XA 4XTDA 4AMAA 4ZMGA 4GUHA 2BTMA 1H5YA 1GPWA 3MP3A 1VHCA 3W7EA 1G7UA 1O4UA 3B0PA 3UWVA 1XDLA 2RDWA 2WKJA 5D2XA 2ZA2A 2GUUA 1FWWA 5HQEA 2B7OA 4CNOA 3W84A 4WUIA 4DBEA 4WY0A 3BW4A 3UWUA 4ZQOA 4UMCA 4O50A 3TK7A 4NZFA 3NDOA 3DU0A 1H7XA 1QPRA 2EKCA 3SECA 5CSRA 3DFNA 3LDVA 4GUIA 3MW7A 1QO2A 1H62A 1JULA 2E5DA 1G4EA 3PULA 3S1VA 1KM3A 3EXRA 1QO5A 2XN0A 4CNNA 3N2XA 1A5BA 2J6XA 3P61A 3BARA 2YYTA 8TIMA 3W83A 1DQXA 3BG3A 1M5WA 1QPQA 5DLCA 3W2MA 1R2TA 1W5PA 4P61A 3W7NA 2ZA1A 2ZYFA 3E12A 3STCA 2QAPA 2WJZA 1H7OA 3G0SA 5AHNA 3HB9A 2G95A 4BI5A 4NUWA 1RV8A 3TQKA 5FF0A 1DORA 3TXVA 4JIPA 3DHFA 2ZZ7A 4DEFA 5HNRA 3C56A 2WNNA 3PS7A 4E0CA 3G0UA 4NX0A 3NQFA 4TX9A 4JGDA 3LRMA 5FEXA 3GXPA 2R94A 3L66A 4JX4A 4Z0JA 5FI8A 5HULA 4UTLA 3W9ZA 3HPXA 1CI1A 1VYSX 1LRQA 5HWNA 4NJGA 3DI0A 3BG9A 1ZAJA 4WY0B 5LZLA 3M5VA 1LLZA 1B4EA 2OJPA 1IGSA 4UFIA 4N6FA 4LUJA 5KSWA 1S5TA 2GVJA 2J88A 4A2SA 1H1ZA 3WJZA 3OIXA 3TX9A 3W7PA 4QM1A 3WFAA 3IIPA 4AHPA 1V7YA 3E9AA 3GR8A 1O5KA 4RJEA 3S42A 3BPWA 3MI6A 1VPXA 1UCWA 3M41A 4TR9A 2ISVA 2A2IA 2XN1A 3WK1A 4HN4A 1IXPA 1YDNA 4RKAA 5LKYA 3GDRA 3I7RA 3G22A 3W1QA 3UQNA 3DHDA 1GOXA 2CLLA 3O6DA 1U83A 1NEYA 4Y96A 4EOUA 4O57A 3BG5A 4RK8A 4WOQA 4UUIA 3BLFA 5U4NA 3TR2A 5LHFA 3IIZA 2FQIA 3MJYA 3KRUA 5CPOA 4DPPA 5H2ZA 3QC3A 4HNVA 3NPWA 3QM3A 1GQNA 2NXIA 3CPRA 3P62A 2YZRA 3FLUA 2YGYA 4AB4A 2X30A 3M5ZA 2ZQ0A 3L5MA 3TSDA 2AQWA 4FX8A 3TFCA 3ELFA 2V30A 4O4WA 3FA5A 5EKYA 3JRKA 1AW1A 1FBAA 2YFNA 5EY5A 3L2IA 3CEUA 2X1SA 4O14A 3VNDA 4JX5A 1SFLA 2QAFA 1DHPA 3MI3A 4IMDA 5AHLA 3HIJA 1AG1O 2QUTA 1N8FA 3W87A 4M7SA 3S8HA 4ZQNA 4UTWC 4O8RA 3CQ0A 5G2WA 3MUXA 3L0GA 4UTTC 3SW6A 3NQCA 1P1XA 4LRTA 1KLYA 3G3MA 4UMAA 3RF9A 1BKSA 2ZRZA 1KFLA 1R30A 3EX3A 4BWLC 3DKJA 2Y89A 3SIZA 4ALDA 4K37A 3P84A 2D73A 3KVLA 1T0OA 4O10A 4XKYB 4UNKA 2BSLA 2JK2A 2Q3OA 4O1CA 3QFEA 1Z41A 1KM6A 1TTPA 4EWND 1G67A 4MYXA 3LERA 1FQ0A 3TNOA 2BX7A 4WY0F 4NJHA 3NQDA 2QDGA 4MY9A 5AC6A 1MSSA 1C9DA 1YDVA 3GDTA 1FWRA 3NL2A 1WAUA 1BEUA 5DBUA 5BNKA 4YL2A 4LVDA 3W70A 3HG4A 2NUWA 1WDWA 3SI9A 3PBYA 4O16A 1HUVA 4R7JA 3W7RA 4QAIA 5I3KA 4BK9A 1I4NA 4RV8A 1LDCA 5CKSA 2V8ZA 2CLHA 3W2NA 1H1YA 1SQ7A 5D09A 4PC8A 1OFEA 2O7QA 4MY8A 1WYIA 2ISWA 4MY1A 4HPXA 2H3DA 3LHTA 3B0VC 2DORA 3C52A 1H50A 3HJZA 1O95A 4Q33A 3S5NA 4AHQA 5G4EA 2C3ZA 3F03K 3W7DA 1OFAA 1D9EA 1TPC1 4IOTA 3ZFHA 1JUBA 1BWKA 3PWAA 1W54A 4QSHA 2TSYA 3A24A 2EGZA 3KVKA 5LNWA 3TIMA 4CCDA 1KBJA 3PF3A 1JR1A 2R91A 2QJGA 1ALDA 4PL1A 2GJNA 2WSQA 1YTKA 3RFAA 3STEA 5BOOA 2YSWA 1TPH1 3BVJA 3M5XA 3FKKA 4E38A 4UTTA 2OT1A 3TAOA 4GNJA 3O6YX 4RCXA 3MP4A 1TRIA 1XUUA 4KKXA 4M7TA 5I3JA 1HL2A 3IIXA 5D2YA 4A22A 4IMCA 1F2JA 3TXZA 3L5AA 3HQ1A 3GVGA 4K6AA 2DZPA 5D33A 2WSYA 2DU2A 3W76A 3TMQA 2PRHA 3NPUA 4LS1A 5G2HA 1UJPA 3BK0A 1TPUA 2HSAA 2H8ZA 5I3HA 4YCPA 1YLVA 1IXQA 1ZALA 1A50A 4UNLA 2EAWA 5KITA 1QCWA 2ZRVA 1EWDA 3W1LA 1K03A 3QPZA 4M6QA 2V9DA 4NNAA 4DF1A 3PSWA 1QPNA 4DXVA 3P82A 3LI0A 1SO5A 3O06A 3A23A 3AO0A 3C2VA 3W7HA 5LGXA 1NVMA 1GVRA 1I2PA 1A53A 3GNDA 4O19A 3T78A 3PUEA 2V0TA 4DF2A 3U2OA 3LRLA 2JKAA 3EWBX 5EL1A 4XZ9A 1L6YA 4L4LA 1GVQA 3NQEA 4HIBA 3TMLA 2GVGA 4JDBA 3LTYA 1VJIA 4LRSA 3BLIA 4QJ1A 3UPBA 1QFEA 3R8RA 2Q8ZA 1SZGA 3MBFA 2ATMA 3FKRA 2H3BA 4NX5A 1KFJA 1AL7A 1P5BA 3PVFA 1GTEA 1GYLA 4JYDA 3S5YA 2WV8A 2XFWA 4FO4A 1ZHAA 3F4WA 3GNNA 4QITA 3IVUA 3L0KA 1P4CA 2GOUA 5L6UA 1I2QA 2QCDB 4GWEA 4O53A 3NVTA 4HKPA 3HBLA 4OWGA 3CIXA 3DGRA 1UUMA 1Y0EA 2Z6JA 3YPIA 4A21A 5K2ZA 1XBXA 2C16A 1VR6A 1F6KA 1MEHA 1Q6RA 3S1UA 1GVFA 2E6FA 5HWJA 3OEXA 4Y6GA 2C19A 5U7SA 1QR7A 1W5QA 3QMRA 2RKXA 1PS9A 5CZTA 3BV4A 4ZL1A 1U5JA 4LUIA 5K4ZA 5EA9A 1I8JA 5LHEA 5C2XA 4H6KA 5K9CA 2LLEA 5LNRA 3N34A 1VLIA 3NZRA 5FF4A 1X6UA 5AYXA 3D0CA 4JS3A 4IX0A 4DBDA 2CZEA 1X8FA 4FNQA 3T40A 1PE1A 2QUVA 1Q45A 2OX1A 1LORA 1JCLA 2NLIA 4XUGA 1PV8A 3FJLA 1SUXA 4JTKA 2JGYA 1OX5A 1XKYA 2Y7GA 1ONRA 3B03A 2XN2A 3TV8A 1IXNA 4Z1DA 3RK8A 1ZY9A 3HG5A 2NWSA 3IGSA 3EWUA 4QNWA 4CNPA 1ME8A 3LCIA 2CLKA 3W1MA 4MPQA 1WQ5A 1A5CA 1CW2A 1HO1A 3N73A 4JTGA 4OGZA 4HNUA 4H3DA 1ME7A 5DCDA 1FWNA 1LZOA 4ZQMA 1VYRA 2Z0IA 4Z08A 1ADOA 1YDOA 1YXCA 1Q6OA 3KAOA 3LCLA 3IGUA 1SZFA 3P5YA 2A6LA 2TPSA 3W7IA 3EWXA 1ICSA 3H54A 3TU9A 2E5CA 3WK0A 2C18A 2ZA3A 4H4IA 2RHGA 2C0AA 4C1KA 2CLEA 2DZXA 1W56A 4YLWA 3NA8A 4UR7A 5C54A 3TUUA 3KRSA 4Y8FA 3TW6A 4I7VA 4L4MA 5BMWA 2A6NA 4FIQA 1AW2A 4JY9A 4NJKA 3VE7A 4UCGA 3EKLA 4N9BA 3NOEA 4OT7A 2CWNA 4JR5A 3UD6A 3LV5A 4UFKA 3FYOA 4MLRA 4IMGA 4WXZA 4BR1A 2CZDA 2RDUA 1PHQA 2CLMA 1JCNA 2TMDA 2VEKA 3O16A 1XBYA 4MFDA 4K8EA 1W37A 2H90A 3LXCA 1O60A 1SU5A 3GXNA 1L6SA 5D2VA 4YMZA 2QCCA 1Z48A 4IX2A 4ZQCA 3TSMA 3SGZA 1JQXA 5IBXA 3W22A 3W1NA 4M6PA 1SSDA 2Y88A 1K8XA 3MHGA 1EP1A 3E0IA 3OVRA 2YW4A 1EPXA 1TSIA 3W7JA 4GXMA 4LVGA 2PC4A 4IJBA 4AWUA 1SFJA 1QNVA 3LLDA 5CG7A 1WBJA 3TC7A 5EPDA 4JTFA 4UR8A 1NF7A 1W3NA 1SO6A 3Q94A 3QZEA 2Q3RA 3UPWA 2E6DA 3GDMA 1VCFA 3UZJA 1BTMA 3G1HA 3ABOA 4AH7A 5HUOA 5LNSA 1HTIA 2QDHA 3M16A 1SW0A 4GFSA 1YYAA 2DJXA 3GLCA 4O13A 5HUPA 1KM1A 2FFCA 5DXXA 3PB0A 4Y9AA 4JTEA 3W2JA 4WJEA 3QSTA 3E02A 3C8FA 4AHOA 4A29A 3V75A 2B7PA 3GAKA 3W6YA 3IGXA 4S1FA 1X1OA 3WJXA 3CB8A 4UFJA 1TTIA 3EX4A 3NO5A 1V5XA 3MO7A 3C4UA 3GXTA 3CM4A 3KVMA 3S5OA 5I3IA 3I65A 5K9XA 4P2VA 4YWIA 3N9RA 3Q37A 3OVQA 3G0XA 1VC4A 3CIWA 4AWTA 2V2DA 3M5YA 4POCA 1JCYA 3P81A 5G1YA 4LV4A 5KZMA 3C2OA 3NNTA 3LB0A 2ZZ5A 2ZRXA 5AHEA 5FF2A 3QSRA 4ZVJA 2QEZA 3MYOA 3UWYA 3QW4B 5D02A 2JKPA 3EXTA 3CEPA 4X3ZA 4MOZA 5EMUA 2YDAA 4ZZ9A 5D38A 4JYFA 4AXKA 4N4QA 2ZFAA 3G1AA 2DZVA 1SR9A 3B04A 3GB6A 4XKYA 4JIQA 1GJPA 1TPDA 2CFFA 2ZRWA 1H51A 3VCRA 1F05A 5F4XA 3V1PA 2E09A 2VFIA 4LNYA 4O18A 3BW3A 3N9SA 2C14A 4JTLA 4ADUA 4NNCA 4JX6A 2ZZ4A 3C0JA 3TJLA 3B4UA 5LGZA 1W3TA 2Y85A 3TQVA 4IQLA 3R12A 3TJXA 1L9WA 5CZJA 1P0NA 1VZWA 4LS0A 4E2DA 2DJLA 1MEWA 1Z44A 5D05A 2QF7A 3HF3A 4O52A 3B0UX 2QKFA
chains in the Genus database with same CATH superfamily
3VIOA 4FPSA 4AY1A 5KZDA 2KZHA 3P7YA 5DMLA 4KIRA 2BG5A 1PXGA 1Q6LA 3KOXA 1ZJAA 1RQBA 4EF8A 3UZWA 4GH1A 4MWAA 2BBFA 4LYKA 1UWUA 4YVVA 3VIJA 3PPCA 1HKVA 4XZIA 3REQB 2OQYA 2EPKX 3KTSA 3UZ5A 4GZEA 4LTSA 2Y61A 1KLZA 2WM1A 4IQDA 3RN6A 3SFKA 5HOSA 5JH2A 3SCPA 1KM2A 2JF6A 3WDQA 1XIGA 2WOQA 3FYYA 4JTTA 4NU7A 3ITLA 2OVLA 5FSEC 1G7VA 4ZOAA 1QBBA 4J5NA 1A4LA 1D3CA 1Z9AA 4DAFA 4V1YA 2G41A 2QPXA 1Q2RA 4O1BA 3SGUA 3PB2A 1X7IA 1H61A 3BSMA 4JQ1A 3APYA 1AZ1A 1SZEA 3N17A 3M4HA 2JQXA 3S2CA 1EKOA 3E96A 5E1QA 2YPIA 3K46A 4GX8A 3WLHA 3BCFA 1PIIA 2YZ5A 4F66A 5F1VA 1LL7A 1UKOA 2FGLA 3W71A 1M1BA 3B3DA 2PRMA 1EA0A 4GYFA 2D3NA 3VAVA 3GUWA 4M5PA 3MBDA 3CQHA 3RLUA 4FX6M 1BPLB 4TMCA 3GSMA 3AS0A 2DVTA 2C71A 4TU1A 3NQAA 2Q02A 2B0MA 2PSNA 5A1AA 1FWJC 3W1TA 4PEKA 1LYXA 3GNXA 2OPJA 3MYPA 1GOIA 3BXWA 4MIMA 3QBUA 1ML1A 3C6CA 6XIMA 3THUA 4C60A 3UWWA 3R4IA 2PTYA 3KCOA 2Z27A 1RBLA 3HPFA 3MUZ1 4FXRA 3AAMA 5A2AA 2Y70A 3VCCA 3QLDA 2HS8A 4AD0A 4X0VA 1DJZA 2Z4GA 3GVWA 1Q3NA 1TMHA 1ZENA 3VM7A 1F8IA 5AKQA 4UTKA 1XSJA 3DIPA 4NZJA 3DFQA 1M9HA 3GWQA 2FZ8A 3SADA 3GC5A 1Q65A 1V6YA 2NT0A 3SN0A 2PI6A 3GIPA 3ISIX 3IJIA 4JTDA 5KZEA 1Q4WA 2GPTA 4ICNA 4AQLA 3GHUA 2OSWA 1MO0A 4CQAA 5A5WA 1ZUAX 3GTFA 3B9OA 1J5TA 4R5EA 4UQ9A 3M6YA 3K4WA 4IXXA 3GIQA 3RMJA 4D6HA 2I7GA 3L67A 5C6MA 2J27A 1E3XA 4GI6A 1FXPA 3K1GA 4Z2GA 3FEMA 2XPKA 4IPJA 4ZCWA 2QVNA 4PCNA 5DRIA 1NP0A 2QMJA 1FWCC 1OYCA 3EWDA 4B9YA 1IXOA 4LVBA 3R2GA 2PF0A 5I23A 3HGOA 4PUMA 2CZFA 4B5NA 4JKLA 1SJCA 6ALDA 3KWSA 5DN1A 1ZNNA 2CKSA 2QUMA 4CEXC 4CN1A 2VR5A 4L4PA 1KTCA 4J40A 1WB0A 3DFOA 1H11A 4Z17A 3W02A 4KFPA 4S3KA 1YBQB 4BQ5A 1FP8A 1SJBA 4FMVA 4RZ4A 3JZEA 3MKKA 4GK8A 2E5BA 2F2HA 3QW3A 3QF0A 4PBEA 1KWKA 4QISA 3OBKA 3B8IA 1OADA 1LQAA 4MG4A 3R8HA 4B2DD 3ANYA 1ZSXA 5BW6A 1JNEA 4H01A 3ZIZA 3LPPA 3UEQA 3QR1A 3XISA 2BGQA 3QHOA 1SMDA 3BO9A 4AWSA 2FPVA 4O11A 3URBA 3STGA 4MLJA 4LUSB 2W27A 3GTXA 1TR9A 1Y7VA 3PNUA 1PJ9A 4WKHA 4JNMA 3A64A 5GVJA 3EB4A 4KWSA 8RUCA 4AX7A 4U3AA 1HJSA 4WKFA 4S2CA 1S1PA 1PPIA 1LWIA 4ZO7A 5BRPA 1VFFA 3TN4A 2NVDA 5AN7A 1E3ZA 4S3AA 2WANA 4MM1A 3WL0A 3FYPA 4FF7A 4E2BA 1WCGA 2GJLA 3I7QA 3HOJA 1ECQA 3ID7A 4MF4A 6PTDA 2OU4A 1R47A 1XP3A 5K4XA 2J7EA 2NX3A 3EWZA 1G4TA 4Q7NA 3BLPX 4MJMA 5DCBA 3AS1A 1IIGA 5F2MA 3DFPA 3QMSA 2XU2A 3VZYA 4R33A 3W24A 1H1NA 4G7EA 3CLMA 3NSMA 3N18A 3P3BA 3S2JA 4YHGA 3HGRA 3IJLA 1Q7ZA 1EF2A 3CWOX 2E6YA 1DWGM 4E4PA 1ICPA 2A4AA 4UXDA 4KWWA 3NVDA 1Q7QA 2O9TA 5I03A 2AAAA 4M1BA 4P5UA 3W74A 1KTNA 1ONEA 4P7LA 3WLLA 1EDGA 1W1A1 4XV0A 3SUUA 5CPLA 2UV8G 5G1TA 1WE5A 3K8KA 3UGVA 1V02A 3FVDA 3D3AA 4K1GA 3B05A 5AY7A 1IWBA 4UTUA 4P7OA 3UNDA 1BG9A 2YL8A 3K1DA 2NV9A 1ZBCA 1YNYA 1FUYA 2GQ3A 3VOHA 5C7VA 4LANA 3WMSA 2J13A 3O6CA 3EB2A 3MB9A 2OT0A 4JIEA 1HQTA 5HA7A 3APGA 3P60A 4TXEA 4JY8A 1OFQA 2GQAA 1F6PA 1CGVA 1UD3A 4IIHA 1EDQA 3W37A 4S3BA 3WQ5A 1QMLA 1V6XA 1GVOA 2PE4A 3VKBA 2X16A 4PTMA 1IWPA 5ECUA 3SCUA 1L2UA 3CT7A 4ENLA 1PEZA 5DFAA 4PA8A 1HJWA 1CXFA 4DZAA 5PTDA 1LT8A 4XB3A 5HJLA 4CQBA 2Y0FA 1A3HA 1EXPA 1M3UA 4W87A 4MJZA 4O4VA 2J7BA 1CYGA 3W72A 1AH0A 1J4EA 1UIOA 2CESA 2DZUA 3PR2A 4GH3A 1JRBA 4PSRA 4Q8PA 5FJUA 4PUJA 1HXJA 5DX7A 4X60A 1R2RA 4EX4A 1ME9A 4XAYA 2HVOA 4BEUA 2PDPA 1MW1A 1G4PA 4I3GA 1UH4A 3ZWTA 2HBXA 1KGWA 3GG0A 2P1FA 4J4KA 5C5YA 4U10A 1REQA 4K7YA 1N55A 2RDXA 4GBDA 3RO8A 3WD0A 3VUSA 5EFDA 3W7QA 1HG3A 4IISA 3I7SA 3RUBL 4Z1AA 4YN5A 1OD0A 3LQLA 4RDVA 3QPEA 4N9EA 3WQOA 1I2RA 4YXGA 1G69A 2VXNA 1MUMA 2R1PA 2PDJA 5LSMA 5T91A 3MMWA 3H53A 3W25A 3LG3A 3DENA 2IKGA 3NO3A 4GZ7A 4NAEA 4NI8A 3LRKA 3L23A 1OFBA 2NQZA 2I1OA 4FNPA 1VFUA 4MUZA 4H7VA 4RNJA 2ZE3A 2NUYA 1H09A 3W86A 3GS6A 4A35A 1UG6A 4UOQA 4ZOCA 3RM9A 2P50A 1FDJA 1REQB 1UWIA 3ZLHA 1UMYA 3NEHA 3DCPA 4O1AA 4WDXA 3OVPA 3F5LA 2PZ0A 1KXTA 3L12A 2XIMA 4R53A 4O54A 1K9FA 4DNHA 1NU5A 2YA1A 4GZIA 4LEFA 1UP0A 4HVXA 1SGJA 1RP8A 1XPGA 1VQTA 1L2QA 3N2MA 3SRDA 3OA3A 3VNYA 2IQDA 1Q8JA 2VI0A 3JR2A 4JICA 5FL1A 1W9VA 3HURA 1ZCOA 5CC3A 2Q8LA 3BURA 3UG5A 3AUJA 1UD2A 1LUCB 5H1WA 3VKCA 1EUNA 4US6A 1UKTA 1W3IA 4UQCA 5LIXX 1XD1A 1XBZA 3P0WA 1KO0A 3NL6A 1GCYA 3PUOA 4O15A 4DRSA 4EANA 3U7VA 3DN5A 4JFWA 1JYNA 3SZ8A 4B15A 3LPOA 2IQ0A 1JUKA 1EBGA 4YU1A 3LY0A 1YNPA 2J66A 1JI1A 4CU6A 3UXIA 2J7HA 4G56A 5IFPA 1K9TA 2PGFA 2FLIA 4PL2A 4H9ZA 5C8BB 3NOYA 4C6LA 2VENA 1TJRA 4A3RA 3OBEA 3SGGA 3IUHA 1ZP3A 2AL1A 3IJ7A 3E2QA 1UP3A 1QW7A 3SY5A 4D8ZA 4V33A 5CAKA 3HMCA 2VFEA 3WLOA 4UQAA 3NAVA 1YADA 3OHIA 3TKFA 1JCMP 2VR4A 1P0BA 4N9CA 5AC8A 3GDBA 4PULA 3HGSA 4E3TA 3HG2A 3LLFA 1UPMB 3I4KA 3WBYA 4IGSA 1XBVA 3LGEA 1X96A 2R14A 4MGGA 4JEQA 1GQIA 3NZ1A 1OK6A 3LXAA 1VHNA 1OX4A 4P7RA 4AVFA 1EJRC 4K3ZA 3U5YA 1BLIA 3RG6A 2CLIA 1CGTA 4RW5A 5I24A 4G6CA 3B9NA 3N15A 1XIFA 2J24A 3I10A 2X1UA 2NQJA 5B80A 2PMQA 1OC7A 3WQFA 2YLLA 1UASA 1RD5A 3K4AA 1QK0A 4PRRA 3BGGA 2KAUC 3WF0A 1M41A 4Z0SA 3WDHA 1Z8AA 1K9DA 2C0HA 3V35A 4NJIA 3MMUA 4A3UA 3WQ6A 1G01A 3RILA 3IPWA 2I9UA 3GYEA 3PJXA 2B4GA 1B3WA 2DY3A 3AZRA 4RXFA 4EPEC 2V5BA 3W2LA 3SJ3A 1P7TA 2QXWA 2V6AA 3WH9A 3TQ0A 3CV7A 3B06A 2VVNA 1ISWA 2Y5EA 1OX6A 1QK2A 3AHVA 4GJ1A 4UFHA 2VZSA 2CHRA 1W5OA 4J9JA 3M0ZA 1W91A 1B0IA 4GNKB 2VKZG 3FJ6A 1UZDA 3VOJA 3IIVA 2Y63A 3BJSA 3T8QA 3UXKA 1LROA 1LWJA 1W8SA 2VC6A 2E8ZA 1HO4A 1RCXB 4IWWA 4LXFA 3M0XA 4KPLA 3A5VA 1A49A 2WPBA 4G1NA 2VJXA 2JEPA 2WQPA 2WKGA 5E93A 3F2BA 5F2IA 3ONBA 4IXHA 2IQTA 1QI2A 5FESA 3DZ1A 3EYPA 1FCBA 4N6EA 1OC6A 4E4FA 5AHIA 5EMKA 1ESWA 2FH6A 3G6MA 3D5HA 4MAZA 3IACA 4LAZA 2OODA 4TTUA 1RK5A 4HHPA 4KF1A 1E1FA 5DMYA 4W9TA 3GH5A 3LI1A 3SQMA 1W1IE 2PTDA 2PBGA 3VNMA 2QCEA 2E3ZA 2VT0A 1TMLA 5M03A 4WGXA 2HNEA 1F5ZA 3NQVA 1JF5A 3N9KA 4FR6A 3CU2A 4U4MA 2WWDA 1XC4A 1FDYA 1GYNA 1X6NA 1TB3A 2QJNA 3T55A 3NQ8A 3N2TA 2FVMA 1WBHA 3UR2A 3H6OA 3PAJA 1WDSA 1RVKA 3KFTA 2FTWA 3WK3A 1U1HA 4GC4A 1CXIA 2IPGA 2OELA 1E9ZB 3G24A 5EMMA 3FFSA 4P8WA 3VD9A 3AUOA 1A80A 1EXBA 3I3EA 1UYQA 1FOBA 4ORIA 5HANA 3TSBA 2V5CA 4OU1A 3O05A 4AEEA 2Y62A 1EPVA 4L9XA 1EIXA 3KVJA 3ZSTA 4AAJA 1T5AA 4A2RA 3GR7A 1TV5A 3FW6A 1WUFA 1RA0A 3VMPA 3N04A 3NQGA 3R11A 3H55A 4HMEA 4XD5A 1XYCA 2A7NA 1BWVA 2PWEA 3T6CA 4L1GA 3SCOA 5AC7A 3GG7A 5D30A 1KC7A 1MUWA 2VFHA 5IDIA 4MB5A 2OR2A 1LG1A 1VBHA 1DWIM 4GX9A 1H60A 3NL5A 1TPFA 2FZNA 1W1TA 3MKCA 4DJED 3GW3A 1HIZA 3S1XA 1P1MA 5HAOA 4D9PA 5LIWX 4RNFA 2VTFA 3VDBA 3TTSA 1XLHA 3XINA 3MP3A 1ADSA 1G7UA 2CXEA 1XPYA 2Z7GA 1IE7C 4D6IA 3AISA 3SCWA 5HQEA 2NW0A 4WY0A 1V77A 3UWUA 4ZQOA 3SQSA 1VFTA 1C8XA 4O50A 5CG0A 3NDOA 2DEPA 1H7XA 1QPRA 2EKCA 3BSGA 4ECLA 1KXHA 4F48A 3PULA 2CC0A 3S1VA 2FVKA 1QO5A 2BB0A 4CNNA 3N2XA 2YIHA 1A5BA 3P61A 2YYTA 3DFHA 4GY1A 3W83A 1X1NA 4CD6A 1IV8A 4H9XA 1M5WA 5DLCA 4WJ8A 1B3ZA 1XYMA 1EYWA 4XSLA 3W7NA 1QHZA 2QQ6A 3WQGA 2PWVA 2E1WA 3V4BA 5AHNA 3HB9A 4NUWA 1GJUA 2WLZA 1FH7A 1RV8A 1YE6A 3TXVA 3PPHA 3DHFA 3WQCA 1OD8A 4DEFA 3H2CA 2G3IA 1CGYA 3C56A 3LM3A 1NDWA 3NQFA 2WBKA 2CCRA 2R94A 5CJNA 3L66A 1ZJHA 4Z0JA 5FI8A 3VFCA 1JZ3A 1JYXA 1K1DA 1EQCA 2W66A 1AQMA 3F5JA 4UTLA 3HPXA 1S5MA 1LRQA 1VYSX 1MYRA 3IUIA 3DI0A 3KLKA 4WY0B 1QPKA 2CBUA 1LLZA 2PF8A 3KBWA 4UFIA 1R3RA 4HK6A 1FKWA 3AHYA 1H1ZA 1NDYA 2WB5A 2J78A 2J47A 4AHPA 3E9AA 4BF5A 2HISA 3S42A 1XLJA 1UCWA 3M41A 4TR9A 1IXPA 3GDRA 3I7RA 5DT5A 4NASA 3UQNA 3DHDA 3ES8A 2CLLA 1NEYA 4EOUA 1VKFA 7ODCA 2GZXA 3UGRA 3TR2A 3QR0A 3IIZA 3C0QA 5B7YA 4QXIA 3KRUA 4F9DA 5CPOA 5CBIA 3QC3A 4HNVA 3NPWA 3QM3A 2NXIA 3CPRA 3CUGA 1GOMA 2DUXA 4TVUA 3T8LA 5AZ0A 3MZNA 2ZQ0A 3RR1A 4IPNB 2GYIA 2V30A 3FVMA 4DN1A 1AW1A 4XO7A 1FBAA 2YFNA 4L9YA 3NFUA 4QDWA 4EACA 1DHPA 2D0HA 3O3RA 2QUTA 1N8FA 1Y65A 1S39A 4AZIA 4EWJA 3WNOA 3CQ0A 4REQB 3WBEA 4C5YA 1MWOA 3CQJA 2WSKA 3AIEA 3QV8A 3G3MA 3RF9A 4MSSA 2Z29A 2ZRZA 3DKJA 3LNPA 3CASA 7TAAA 3SIZA 2QV5A 4K37A 3P84A 1JIBA 1PX4A 2I17A 5FJRA 4Z2IA 3EA3A 3S2MA 2W61A 2BSLA 6A3HA 2Q3OA 4MYXA 3POHA 3TNOA 1JFHA 1X98A 4FALA 5FJIA 1UROA 2DSZA 4NIRA 4F0HA 1E1CA 1C9DA 1YDVA 1P6WA 4AVNA 4HYVA 3NL2A 5DBUA 1BEUA 4F8XA 1SJAA 5I06A 2W62A 3W70A 1QNOA 2SFPA 1EX1A 3SUSA 3DYPA 3PBYA 5FJTA 1JDAA 4QAIA 4DYEA 2D2OA 3AOFA 4MWAE 5XIMA 1H1YA 1PKLA 1SQ7A 1GW9A 2HE5A 3AHZA 3WKZA 4J1OA 2O7QA 1WYIA 2ISWA 2QIWA 4MY1A 3D3FA 2DORA 3O2LA 1H50A 2I5QA 3HJZA 3URNA 3S5NA 1HKMA 1GORA 3ZFHA 2D1ZA 4MAVA 3H26A 2O56A 1X39A 2TSYA 3A24A 1G1YA 3KVKA 2F6KA 3ARZA 3A9BA 3DG6A 2UZ9A 2BHUA 3M0IA 2WSQA 3STEA 4MB1A 4TX8A 2YSWA 4DZHA 3UWEA 3M64A 3M5XA 4KWOA 1LLOA 4UTTA 4RCXA 2ACQA 3MP4A 3H22A 1HL2A 3IIXA 1OQFA 1OCBA 4HK7A 3TXZA 3HQ1A 1GJWA 3MQTA 4GIYA 1UJPA 2O0TA 1SZRA 1XR2A 4IHCA 1YLVA 1IXQA 1ZALA 4S3JA 2FGZA 4UNLA 5KITA 1EWDA 4KEUA 3W28A 3V0SA 1DJGA 4CD4A 3BANA 4M6QA 4NNAA 9XIAA 3PSWA 1QPNA 1OCJA 4QX4A 2WK2A 3KCJA 5BOEA 1PTDA 3AO0A 1D8CA 4F2TA 1GONA 3W7HA 5LGXA 2VMFA 3ITVA 4LCRA 3R58A 5HJXA 3T78A 3M0MA 3U2OA 4C91A 4V27A 4EE9A 4ZXOA 4HA3A 4XZ9A 5H8PA 2JE8A 1F4HA 4L4LA 1IZJA 3TMLA 3N6HA 1FH8A 4WSHA 4W84A 1BD0A 4QJ1A 4BCEA 3UU0A 3R8RA 1JZ7A 2J7DA 4GABA 4PMQA 3S2NA 1AL7A 1FFRA 3EOOA 3PVFA 1JD9A 4B4HA 2XSBA 3UNTA 1GYLA 4DNMA 4PTVA 3PZGA 4Z2KA 1H3GA 2NLYA 3VNJA 2ZUTA 2UY2A 2GJXA 3EPMA 3L0KA 3URQA 3WEOA 4GWEA 1OEPA 4HKPA 1PYFA 3HBLA 2VDHA 1ECEA 1XX1A 3AMLA 1RA5A 2D24A 3CT2A 2Z6JA 4A21A 5K2ZA 5C2CA 3S1UA 4D8LA 1ENUA 4A6GA 1EJWC 4XAFA 4WRHA 3OEXA 4Y6GA 3PJWA 1QR7A 5EU9A 2ZX8A 4B5SA 2Z1SA 2KX9A 2ANUA 3BV4A 5EFFA 5BOFA 4ZL1A 4Q22A 5K4ZA 1J0YA 5EA9A 1CNVA 2PLKA 2PDCA 4R9OA 4L1XA 3AJ7A 2Z2BA 2X41A 4GO8A 5FF4A 3NJ3A 3WFZA 1X6UA 5AYXA 4XAGA 3LSBA 1XG4A 4IX0A 1P0EA 4DBDA 3MDWA 5AC4A 1RAKA 5GQBA 2V3FA 1FVPA 5M3WA 2OX1A 1LORA 5HQMA 2WMHA 2NLIA 1SUXA 5A2CA 2JGYA 1OX5A 1VD6A 1ONRA 3O9NA 2Z26A 5I6SA 1GUVA 1ZY9A 1M65A 3VDCA 2NWSA 4CNPA 5C9ZA 1XRSA 3VILA 1E43A 3W1MA 2YLAA 2PDKA 4FLRA 3ZXWA 3OHMB 1W3JA 1A5CA 1CW2A 3VGEA 1HO1A 1JZ8A 3WD1A 2WVUA 2HXUA 3OZMA 1ME7A 5DCDA 1S2VA 2OLSA 1LZOA 2Z0IA 2DW7A 1UWRA 2HCVA 3LCLA 4WHBA 3BAYA 1TR1A 2A6LA 1Q13A 1F8MA 2Y1HA 4FOJA 4H6RA 3W7IA 3CL8A 2IXUA 2E5CA 4NRRA 4ZE4A 2C0AA 2OEJA 1V6TA 2DZXA 3KRSA 4KRUA 3TW6A 1HF6A 2A6NA 4FIQA 1AW2A 2GOKA 4UCGA 3NWRA 4C6EA 1W17A 5T8GA 1PWLA 2CWNA 2RJGA 1DTNA 3UD6A 3GHRA 4JFUA 2OYLA 4CQDA 4WXZA 2EG7A 5JMUA 1EQPA 2CLMA 5JU6A 2OB3A 5IFTA 4OIFA 1JF6A 3O16A 4HHLA 1XF0A 1TCMA 1XBYA 4K8EA 3LXCA 1DXEA 3SCTA 5D2VA 1BVZA 1CXHA 1Z48A 1IGWA 4YTUA 5FAGA 3B0YA 3RXZA 4HU4A 4GYPA 3GU1A 1SSDA 1J0ZA 2J79A 3W7JA 1P43A 4M82A 4LVGA 3PBGA 5LXXA 3BAWA 3DHPA 2XIOA 3TC7A 3QOKA 5EPDA 2OEMA 3AROA 1W3NA 3Q94A 2Y4SA 4XIMA 2Q3RA 3NO1A 3UPWA 3GDMA 3L4XA 2J77A 2V67A 3UVIA 2E4TA 5CC7A 3JU2A 2DDXA 2ALRA 2VC5A 1KKRA 5HUOA 5LNSA 3E0FA 3WL1A 2NT1A 2QDHA 5D9PA 5CLWA 3M16A 3QY6A 2DJXA 3KE0A 1V02E 5HUPA 4L6HA 3CMJA 1XICA 4JTEA 1F3TA 2JEQA 3W2JA 3M0LA 3C8FA 4AHOA 3BAXA 3L4TA 2B7PA 3SURA 1R86A 3IGXA 2CIPA 3MSGA 3VC5A 2R82A 3ZVHA 4C65A 4UFJA 4W85A 1EJ7L 3EX4A 2DSWA 3A3HA 3WMBA 3ZR6A 3GXTA 3PHAA 3CM4A 4P2VA 3N9RA 1RY8A 1KB3A 3OVQA 4LAKA 3CIWA 4H83A 2V2DA 4DI9A 1UD8A 3P81A 5G1YA 5FJJA 3C2OA 5A2BA 1FA2A 4KEZA 2BDQA 1GZJA 2BFGA 3CZKA 4C6KA 1EGVA 4AZHA 4ZVJA 2QEZA 2JKPA 3R25A 4X3ZA 4NYUA 1J0JA 5EMUA 4YTTA 5D38A 3IGHX 4J3WA 2UBPC 2ZFAA 1UWQA 4IIBA 1JD7A 2ZRWA 4UQEA 4U3CA 3WMCA 1D7KA 3TYCA 2E09A 3OYXA 4CD7A 2VFIA 4K1WA 4PMYA 1YE4A 5TD4A 1E1CB 4JTLA 3C0JA 3TJLA 2JIEA 4FXJA 1GQLA 3PZQA 3EOSA 3OW1A 2XTKA 2WWCA 4QDMA 1KXQA 2I5GA 3TJXA 3UJEA 4KS0A 5CZJA 1BFNA 4O52A 5DRCA 2QKFA 5A8QA 3W85A 3C2EA 4CU7A 2TYSA 2L5HA 4IT1A 2CZ5A 4C6IA 3DH7A 3OVGA 2EBNA 1OGSA 4D6FA 4QE4A 4J2PA 4ML9A 1LUCA 4HPNA 2EQDA 1RVGA 3IUDA 1TZ9A 4M6VA 4NL1A 2WJFA 4K38A 1Y5WA 2PDHA 4PRWA 1IEXA 1POJA 2VO5A 3LK6A 4FNTA 4BF9A 2GJPA 1PZ3A 1C9WA 3POCA 1S3HA 1F07A 4FK9A 2OOGA 3GFZA 3OPSA 2XGZA 2YBUA 2ZX5A 2HK0A 2OZ0A 4ACZA 1KRMA 4DJFA 5A69A 3N4EA 1KBBA 5L9FA 3V0TA 3N25A 2PFHA 5HBFA 1TV7A 4DF0A 2ZE0A 4NAFB 3ZR4A 4ROPA 4C6BA 1VIZA 3H24A 2QDDA 2PDGA 3GNOA 3DFTA 2J9YA 4M8UA 3WCZA 2GJXB 3TH6A 1RP9A 4RPQA 3F1QA 3W1RA 3CWNA 3BZJA 1J96A 2POTA 3LM7A 3U2ZA 3EMQA 3KL0A 2PURA 1ZZMA 5A8PA 3PFRA 4XISA 1BG4A 1GTHA 4IMEA 2XG9A 4RZBA 2P5NA 1MQRA 2W67A 3BV7A 1I2OA 4WDWA 3SN4A 2YW3A 3H7VA 1EZWA 4ZQRA 4AD1A 3W7MA 2QJHA 4K39A 2ISSA 4Z1YA 1E6QM 2DZSA 2J8FA 4S3DA 4UTIA 4XBJA 4ACZB 9RUBA 3GG8A 2P10A 2IPJA 4GBUA 1BSIA 1K3UA 3M0VA 3N4FA 3BLEA 1E9YB 3G6LA 1GKRA 1W0MA 4R34A 2ZTJA 1BXNA 2WM0A 3USBA 2VP8A 4OHQA 1MDRA 1FKXA 4NF7A 5AYBA 5A6LA 2ZZ1A 3OLIA 3PUDA 2WLYA 3NPVA 4PYSA 4ZBCA 2QJIA 3RX4A 3VCNA 3RPTA 3CUIA 2E40A 4YNGA 4KGJA 3CZ8A 5EMJA 2EG8A 3AIBA 3FXGA 3PM6A 1VFOA 4HU3A 3PTQA 3AC0A 4BI7A 2A85A 3GBDA 1SJDA 1NQKA 3O0KA 1XRTA 4JXCA 3WDPP 2Y8KA 5BWAA 3VXGA 4PMRA 1E9IA 2BMBA 3I6EA 1VBRA 1RPXA 2W0UA 2Y24A 1DJYA 4M51A 1UW9A 4WD0A 2VWTA 1JFXA 3MMTA 3FAWA 4GZJA 1WP6A 2EPHA 1KCZA 5CCZA 4R3UA 2XZ7A 3QN3A 2DZTA 1GQJA 2R1MA 1H63A 2DZWA 2DT1A 3EEGA 1Y5VA 2QCDA 1MXGA 1TVNA 1XGZA 2C1HA 2D69A 3UY8A 4HN8A 1P48A 1MVYA 2P3EA 1VS1A 2OSXA 2F84A 1EHNA 3FIGA 4RV3A 1TO3A 4C6CA 4HPGA 2P0OA 3DAQA 3B9AA 3MDUA 2P88A 4M19A 2CHOA 5D32A 2W9MA 2C13A 1HW6A 1V0NA 4JTUA 1AJ2A 4L6OA 3THDA 4ERAA 2OYKA 1J2WA 3MUCA 1HVXA 3CUHA 1WXZA 1LM1A 4YYFA 5C55A 1ZB5A 1W6TA 1IWAA 2YL9A 2J4GA 4D72A 3RPDA 4C6QA 4LCQA 3SEPA 1UIPA 1HKKA 3T05A 1S38A 1O1HA 3BSHA 4TO8A 4DBSA 4I5RA 4QCFA 4H7ZA 2ZUNA 5REQA 2XSAA 5G2IA 1I2NA 4X63A 4O1DA 1CIUA 3E2VA 4GG9A 4H00A 1XCXA 4QBXA 4LY4A 1B57A 1PX8A 1CDGA 3EMCA 3ZR5A 1SW7A 2O4QA 1QW8A 3GVRA 3W7LA 1JQVA 2VD9A 1EX5A 1GYMA 3M6DA 3GNPA 1B90A 1E51A 3W0KA 3B4YA 4AD3A 2VNCA 3WEMA 5F2LA 1H2JA 4TIMA 3J7HA 4K36A 1EB3A 3VX1A 1AQ0A 3L4UA 4V2XA 4FEZA 5AFDA 3BLKA 2WVVB 4MB3A 5DMMA 5HXMA 3M7WA 3UYIA 4PFMA 3SN1A 1WOAA 1KV8A 4AF0A 4NXKA 1I45A 1KFKA 3KXQA 1OG6A 3OLGA 1ZAHA 2PDLA 4PN2A 2VFFA 3M9YA 5AZ1A 3G3DA 1S2TA 3AJXA 1XIBA 3ABRA 2FB2A 3REQA 5LNVA 1ZJBA 1D8WA 2EO7A 1UQYA 1M53A 4ZSUA 2QT3A 3WH5A 1MNSA 3TOPA 3MCMA 4CNTA 4BQ3A 4OE7A 2ALDA 4DWSC 3MU7A 3CHEA 4IP5A 2E68A 4WOZA 3CTTA 2CZVA 3G18A 1PYMA 1Q6DA 1E4NA 3CV6A 4C6OA 3MY9A 3TR9A 4OBRA 3K8MA 1GPFA 3EXSA 2FFIA 1MZHA 3Q58A 1N8IA 1U2YA 3ERPA 5DY2A 5I7GA 3E5PA 4HSOA 4IMFA 2XYLA 3L21A 2WVVA 3WMLA 4BF7A 1T8XA 1ZJIA 2HXTA 3RPMA 3WQPA 4C1NB 4MYAA 2ZOXA 1ICQA 5I5RA 2BXVA 3PWIA 1Z42A 2BOGX 3VPLA 4XD4A 3DBPA 1EP3A 3UR5A 4IJRA 3ALFA 4DXKA 2Z6IA 4GA8A 2WZHA 4W7UA 1FCQA 3LCWA 4LW7A 3BC9A 4LAMA 3BLDA 3GH7A 3U8GA 3A47A 1QWKA 3ZS4A 3FY1A 3LCHA 4UTWA 1W2VA 1XW8A 3NPXA 1CLKA 3WQWA 2FPTA 4WXYA 4C7FA 3PUGA 4EAMA 1P7TB 2ODOA 3IJ8A 4N2YA 5GNXA 1TMQA 1JCXA 1XIEA 3KEHA 1G6CA 2E67A 3HQPA 3ALGA 1UUQA 3GDLA 4M29A 4ZQPA 4GJJA 4HPJA 4Y9OA 3WX7A 5F1UA 1T99A 1W31A 1Q63A 1ZL1A 3G1SA 3VO0A 5LA1A 2OO0A 4M81A 4JCMA 3EX2A 4GQGA 3LHYA 4RDWA 3ZWSA 3DESA 1NSJA 3CQIA 1EO7A 1XKJA 4D71A 1DXIA 1A3XA 2F8QA 3W38A 4EP8C 2E9LA 3NDZA 3SY8A 4I8DA 1OWQA 1VRXA 5XIAA 4ZB5A 3LOTA 3T2OA 1AMKA 1YDYA 3FK4A 4Y9MA 2YDRA 2ISDA 1R3TA 3VIKA 8XIAA 5HR7A 1VYPX 3ZMRA 2G97A 3N2CA 3KOFA 3AXIA 4RW3A 3IJDA 3O8AA 4AEOA 2ICSA 2QCGA 1F4AA 2BV9A 2VEFA 2HEJA 3NIYA 1EGMA 5E9XA 3I68A 3GDKA 2WC7A 4UOJA 4MWAC 3W27A 3ZJ7A 1UUOA 2F7FA 1O68A 1JRCA 1WO2A 1PKYA 2HNHA 2I9EA 2J74A 2XISA 2YCEA 4QQUA 5KMYA 3TW7A 5AYZA 1R6WA 3K4DA 4D2JA 4B16A 3AI0A 5A8GA 4Q8VA 3VD3A 1Q6EA 3WQVA 1H7RA 3II1A 3SFWA 3QPYA 3KBNA 1ZAIA 1ZBKA 1VEMA 2PEVA 1O94A 3U3HA 1M6JA 1D3HA 3LU2A 5IDZA 1PCWA 2A79A 4HNLA 3GTHA 1V79A 1TTQA 3SCRA 1XLEA 5JVLA 4LUSA 4UTMA 2Z1XA 3RLVA 1OG0A 1OINA 4X0NA 3M43A 3KWXA 1DV7A 4DB7A 1FCUA 3VK5A 4ZFCA 1NY1A 3IWPA 4JTIA 4H1ZA 4JDYA 3O15A 5FACA 5JBFA 3TTOA 3IS4A 2D20A 2Y8VA 1BXCA 1XLKA 3CC1A 3TAKA 2AAMA 1XLMA 1HP5A 2V82A 4QP0A 4MNKA 1CX9A 1OABA 3W29A 1LL6A 1OIFA 4KT2A 2OCZA 2X7WA 3MHFA 1OYAA 3UWQA 3OG3A 2ZICA 2CU0A 4LV9A 5K9DA 3FOKA 1KW1A 3JUGA 1H0IA 1IEQA 4PUUA 2X0YA 1V0KA 5LYRA 2V2HA 4TVDA 3UYCA 1W5MA 2CITA 1WZLA 1K7EA 2O4MA 3VYLA 2GGGA 1GWJA 2E0PA 2BHZA 1XYZA 1DJQA 1JPKA 2YB1A 1CGXA 2QCHA 3TYEA 2BODX 3LXBA 2QULA 3CH9A 1TIWA 3QY8A 3TJ4A 3KZSA 3SIMA 4PR4A 1F74A 1OZMA 1R9ZA 2ZADA 2A7PA 1HGWA 1QPOA 1OFRA 1UBSA 6XIAA 2EXOA 1EC7A 1KM4A 3NG3A 4F9JA 4GUJA 2ZBTA 1RR2A 3GAYA 3LHVA 4PB5A 3MSYA 1A47A 5AOUA 3EDEA 4O1EA 4XQ6A 3T0BA 2OZ3A 1BYBA 3A9IA 1FWHC 2OO6A 1WKEA 5FF7A 5E0KA 1RK6A 2RGLA 3E3HA 1K8YA 1HFBA 2HS6A 2QLYA 2X0HA 3ARTA 1V3KA 4W86A 1CGWA 2VEPA 3NQ7A 4W8AA 5CSYA 4IQJA 4IL2A 3H2EA 1IT7A 4FNUA 1XDMA 3ARVA 2FHFA 3NQMA 3KRZA 3L0NA 3M07A 2EKGA 2VEIA 4FF5A 5TBOA 3LQGA 3RIKA 1OCQA 1YX1A 1HKJA 1LF1A 2BHYA 3ZOAA 4ZXLA 3U9IA 1BGGA 4L64A 4AZBA 1K7XA 2Y7FA 1B3OA 1FWBC 2V3DA 4JN6A 4YVXA 1CGUA 5E09A 1C3FA 2Z28A 4IUGA 3GIYA 1E4IA 2YOCA 5FEWA 1PUDA 2ONEA 4UTJA 3ITXA 3TA9A 3OLEA 2A1YA 2RH9A 3A5FA 3HQOA 3VNLA 2PP3A 2WSPA 5HMSA 3TYUA 4OBTA 2ZUWA 1AL8A 3PBWA 4BWLA 1DQWA 1A5SA 3PANA 5REQB 1CEOA 8A3HA 3BWWA 4JL2A 3TJIA 3QQ0A 1BHGA 4OV4A 3SCSA 4RLIA 2VC7A 3UBPC 1LTDA 4U31A 4YYCA 3WH6A 1M68A 1RQHA 2XVKA 3LGDA 1VFHA 1XI3A 1PAMA 1JGIA 2XIIA 3WD4A 3VGFA 4UWMA 3WLJA 4PBGA 5CEWA 2PBOA 2YCIX 3IAPA 4B5UA 3W2UA 1C92A 4MZ8A 4PB4A 5ECVA 2QZRA 3ATYA 5FOOA 4DUVA 3LCGA 3PG8A 3DHUA 1TUXA 2O55A 1K6WA 2IUZA 3VI2A 2V81A 1A5OC 1H41A 3OGSA 3MUIA 4QDPA 4RX0A 3EX1A 4BI6A 1CXLA 2G96A 1F9CA 3G8EA 4XVDA 4EXAA 4MKVA 2V3EA 4GHRA 3ARXA 1TV2A 3UVAA 3L9CA 8XIMA 1LLWA 4IGMA 1BSLA 3AHXA 2O9PA 3WDRA 3WYZA 1XH1A 4XTDA 4AMAA 4DXXA 2P53A 4ZMGA 3ZVHB 1B31A 1H5YA 1GPWA 1T6MA 1Q66A 4B5XA 3UJSA 4WEVX 2WKJA 3WNLA 4I9TA 3CZEA 2ZA2A 4HNCA 4PEEA 2GUUA 4XG1A 4DJEA 1FWWA 4DBEA 3BW4A 4YWSA 4ZO8A 4RE3A 1FHVA 1I1WA 1Q6FA 4O8AA 3DFNA 3LDVA 1D7FA 5JBDA 1QO2A 1E6SM 1JULA 1G4EA 3S6TA 1KM3A 3EXRA 2EPMX 2J6XA 8TIMA 1A3WA 4H19A 4J3VA 2R1NA 3DX5A 4O0QA 2DH3A 4PMVA 1S2UA 5CH9A 1KRAC 4IIGA 1AQHA 2ZYFA 4JIRA 4R27A 2QAPA 3CBWA 1H7OA 4MJ2A 2WMJA 2G95A 4P7NA 4R9XA 3UG8A 5FF0A 1IT8A 2PS2A 3OTRA 3PS7A 2ZKMX 4E0CA 3G0UA 4J3ZA 4TX9A 4JGDA 2QDEA 2YB4A 2VGGA 4INFA 4JAWA 2PWUA 4C1NA 4DM2A 3ITYA 4HHHA 4J3SA 4GI8A 3W9ZA 1CI1A 4HA4A 4IL0A 1JNDA 5HWNA 1E55A 2JIWA 4NJGA 1Q4NX 3M5VA 3BOFA 1XIDA 4LUJA 4A2SA 1B5TA 3A4AA 2OSYA 4AIUA 1NELA 3OIXA 1MRAA 5FAJA 3VZXA 2Y2WA 3CZLA 1V7YA 4Q8TA 3GR8A 1O5KA 1IHIA 2O9OA 4B4FA 2A2IA 1IZKA 2FVLA 3B8SA 2DQWA 3QTPA 3ANUA 3CPGA 1GOXA 2XJ7A 2DUZA 3BDKA 4Y96A 4WOQA 4CGTA 3LZ5A 4AY7A 5U4NA 3BAIA 2JALA 3ARYA 1J11A 2UY4A 3LS9A 2XWEA 4UQBA 3V36A 1US0A 1EF3A 3DC8A 5DF0A 1WKYA 3P62A 2HBVA 1GKQA 2YGYA 4AB4A 4WLCA 4HHMA 1V4YA 4J7RA 1R8LA 3UPMA 6ENLA 1PIFA 3L5MA 4UTFA 2AQWA 4YTSA 4U33A 1J5SA 3ELFA 3AU2A 4OFCA 1KQZA 1E73M 5EY5A 2X1SA 4JX5A 4TVCA 2PLJA 4PB3A 1VIWA 3AWOA 2XIJA 2BGNE 4M7SA 3S8HA 2DT2A 1R9XA 7PTDA 1GEHA 4HMNA 2FKPA 3KUMA 1P1XA 4LRTA 1WAWA 3ARQA 2VCAA 4BWLC 2CERA 4ALDA 1XYAA 2IKIA 4IM4A 4W8LA 2D73A 2GGIA 4M24A 4WGHA 2EPLX 3KVLA 5I77A 1T0OA 4O10A 1AZ2A 3GVVA 5ABGA 3GXDA 2JK2A 1ISVA 3QFEA 4NRSA 1KM6A 4GXWA 1G67A 2MANA 4J28A 1H49A 5AC6A 2PLCA 4JOMA 2VUNA 1MRQA 1FWRA 1XCWA 4XO6A 4DLMA 3WQEA 1UWSA 3RITA 2NUWA 4GIRA 4O16A 1HUVA 4R7JA 4Y7EA 3B8UA 3E2SA 5A6AA 1LDCA 4ZOBA 2AOSA 2V8ZA 2E28A 2CLHA 5C9WA 1TG7A 4AD5A 4MY8A 4Y8EA 3LHTA 3TOYA 4JTQA 1R7OA 4GMEA 1O95A 4HZ6A 4AHQA 4ILSA 5T9BG 3F03K 1OFAA 4GY0A 1D9EA 1B3XA 2DUAA 1JUBA 3PWAA 3WY1A 3HU7A 3CQKA 4IP4A 3VGDA 3TIMA 5JQ9A 1KBJA 3PF3A 1ALDA 1BQGA 4HP5A 4AZ5A 2HRWA 4KIEA 3EDKA 4WIWA 1XGEA 4GNJA 4I9JA 1UZ4A 1X8CA 4BHYA 5TNVA 1G9HA 5I3JA 1XINA 1HGYA 1JXJA 4R7WA 1F2JA 2HPIA 2PWFA 1P0DA 1UJQA 4K6AA 3WBWA 3LGGA 2WSYA 3TMQA 3RDKA 1KD0A 2D2HA 1PB0A 3BK0A 1TPUA 4HGXA 2WMIB 5I3HA 4ERIA 5A6SA 3ARPA 3W00A 1E1EA 4YCPA 1A50A 3H4XA 4PUEA 2EAWA 6CGTA 3R1ZA 1C90A 3P82A 4KCUA 3WUEA 3R7MA 5IRPA 2HZGA 3A23A 3C2VA 2YL5A 3GNDA 1R3QA 2VM8A 3PUEA 2V0TA 3LRLA 2FZDA 3ICJA 3WUGA 5EL1A 3DERA 4Q6XA 2GVGA 2X1IA 3QKZA 3SCQA 4FLSA 3T2QA 1VJIA 4LRSA 1TV3A 2OWWA 3UPBA 3CIVA 2Q8ZA 1SZGA 2ATMA 3FKRA 2ASHA 1P5BA 3DDMA 1GTEA 2GDVA 4PMDA 2D0GA 1EJUC 3S5YA 2WV8A 3SRKA 4J27A 2XFWA 3KTCA 4FO4A 2FHCA 4US5A 4J3XA 3VMNA 1XRFA 1ZLPA 2WMGA 2QCDB 1Y5XA 4HCDA 4O53A 3W4RA 3NVTA 3A6OA 1UP2A 3CIXA 1E72M 1XLCA 3D47A 3MTWA 3EGJA 2C16A 1TWZA 1VR6A 1NWTA 5HWJA 1UKSA 5U7SA 4EXQA 1MI3A 5F7UA 3OGRA 4RDYA 3MC5A 3CYJA 1PS9A 1SFTA 1U5JA 4IPLA 4O1FA 4DJDD 4HNOA 1ITUA 2AQOA 1CBGA 3CAQA 2PDMA 1TZ7A 5LNRA 1VLIA 1IEVA 1W9DM 4GQ0A 1F6YA 1O6IA 4HCLA 1A5NC 1W1B1 4FNQA 3UESA 1W9PA 4Q7BA 3F4DA 3C86A 3OU8A 1JZ4A 1FWAC 4DYJA 4G8TA 2PDUA 1JCLA 1CB2A 2F61A 1ZGDA 1M7JA 3QR3A 1XKYA 4TOQA 4HZMA 3TV8A 1BVNP 3ME3A 4N0RA 3AYRA 1WQ5A 4FS9A 4Y9NA 3N73A 4JTGA 4J3UA 4KGLA 2Z2AA 3LSCA 4E4UA 4JFTA 2NQLA 1MUCA 3EAUA 7REQB 3M46A 3QFWA 2DIEA 1Q6OA 4I6KA 3B97A 3IGUA 4MB4A 2QGHA 1U22A 3EWXA 1ELSA 2OEKA 4NILA 1I0DA 3TU9A 5LXEA 3WK0A 1EYEA 1PZ1A 2C18A 4W88A 2CLEA 4GYJA 1W56A 2CKRA 4UR7A 3PZTA 3TUUA 5DEZA 1W32A 5BMWA 3NXLA 4I90A 3SO7A 2C1GA 1AH3A 4JR5A 3PWGA 3LV5A 2QMKA 3FYOA 3IV8A 4GQQA 4JQ3A 1Z32X 2ZDSA 1T40A 4B90A 5IHSA 1W37A 3RRXA 4TV6A 2C8NA 4NAFA 3RM4A 2W5FA 3BCJA 3NZGA 2WMFA 1J93A 4HU8A 5EBAA 4JBRA 1WDRA 1JQXA 4S3FA 1BQCA 2ZIDA 2BXZA 3E0IA 1OY0A 4REQA 2YW4A 3U2CA 4TTGA 1JPMA 3R0DA 3B8VA 3ANVA 3GM8A 3H7UA 1M7XA 5CG7A 4WDTA 3GFYA 1SO6A 1AD1A 3UJ2A 2E6DA 3UFYA 2E8YA 2OWXA 1JDFA 3UZJA 1FHLA 3MO4A 3G1HA 3ABOA 4AH7A 4ZR8A 4JIIX 4KW2A 3LA4A 1SW0A 4GFSA 1YYAA 2ZC8A 3GLCA 2XUCA 1DWJM 1KM1A 3EBVA 1MW2A 4Q6JA 1WDPA 4NG3A 4UCFA 3QSTA 1GOKA 4XZMX 3VX0A 4A29A 3QY7A 3A4JA 2G4FA 4S1FA 3LNMA 3PJUA 2TAAA 1Q7MA 1R87A 1UKPA 1VFLA 5BYWA 1S46A 3C4UA 1B54A 4ES4A 3S5OA 3I65A 3E38A 4YWIA 3B0XA 3G0XA 1EBHA 3L4ZA 3V18A 4PMXA 2J25A 2WYSA 3CO4A 1FTXA 3M5YA 4KEMA 4POCA 5KZMA 4MMWA 3ES7A 4DWDA 2ZRXA 5AHEA 5FF2A 3UP8A 2INFA 5A6BD 4K68A 4G9PA 1AA1B 3QW4B 3EXTA 4DHGA 3KOYA 3COTA 4E5TA 2DSUA 4XZNX 5CJMA 4EPBC 2ZC1A 3B04A 1BRLA 1TPDA 3WF3A 4CEUC 1H51A 5F4XA 1CZ1A 3RCYA 4PSPA 4O18A 3BW3A 4C6FA 3TW9A 2A3HA 4MJ4A 4LBRA 3TQVA 3R12A 1L9WA 1P0NA 3Q67A 7CGTA 3RCNA 4PCPA 1MEWA 3C5QA 2VUYA 1SYTA 4S38A 1KXVA 2GQ9A 2W91A 2ZZ3A 2ABBA 4DWSD 1SO3A 4CQ8A 4K2SA 4O0ZA 3RGTA 4ZGYA 4ICCX 1DTUA 5HNUA 3O63A 1LL4A 4FHAA 5J8LA 5HNTA 3HQNA 1MW0A 3CL6A 4MZYA 2H8XA 4JHZA 3M0JA 1X1ZA 4NVTA 2PAJA 3W07A 3EPOA 3OA5A 2ESCA 4LJ3A 3N3MA 4HK5A 5CQ1A 2PC8A 3PC0A 2GWNA 5DXYA 1ISYA 3TP4A 4FR1A 1E0TA 5LA0A 3NEVA 3O0FA 1QT1A 1OJXA 1E15A 5E9AA 4JZ5A 1VH7A 3T42A 4JHOA 3NCOA 2GWGA 3H2NA 1LP6A 1O7AA 1GHRA 1OIMA 5H6HA 5JH1A 1J12A 1C8YA 2A21A 5C70A 3G1DA 1KCKA 4YCOA 3R0KA 1WZMA 4JKKA 2GUBA 2I5IA 1XCFA 4Q4KA 5FJPA 1O5XA 4Q8OA 4FB7A 1TPWA 1DKWA 1WDDA 3AMDA 4IGHA 1JUEA 3PZIA 4QJ5B 1DIDA 4D6JA 1DVJA 3CPUA 3GTNA 1SSGA 4QS6A 1OC5A 3ZT6A 2IKJA 3RCMA 2QPSA 2Z1BA 2VDGA 1L6GA 3MVIA 2UY5A 3AS2A 4I7WA 2YBTA 2G3NA 4LAUA 3MZ2A 3PPFA 4AC7C 4AUBA 3LN3A 4QQ3A 3BW2A 4ATDA 4PH6A 1THFD 1RZMA 4NP7A 1WPCA 1CT5A 3U6WA 4QE1A 1GZ1A 1NF0A 3S9ZA 1WV2A 3STPA 4NQ1A 3UW6A 5AHFA 5IHRA 2RGMA 1FWTA 3WENA 4EKJA 3LHZA 3VGGA 3E49A 1O12A 1US3A 3ENLA 3FV9A 4GIAA 3GC4A 3AXMA 3DFSA 4I9AA 1FXQA 3VMOA 3D6NA 2DIKA 1TV8A 3SDOA 4IPIA 3U48A 1OM0A 3B9EA 2C79A 1AFSA 1QOPA 4AF0B 3R0UA 5M2FX 4AZ6A 3RO6A 5HNNA 1ZBWA 2H6RA 2QCFA 4BA0A 3NL3A 5CSSA 1NFBA 3SY1A 4LC6A 4XTIA 5C7HA 4QRNA 3CO8A 1L8PA 1WKFA 1V93A 4EIVA 1TE1A 3CTLA 3KP0A 1GOOA 4GE8A 4D6EA 2YR1A 4JTRA 2J7FA 2P8CA 5FF3A 1H7NA 1TUFA 3K8LA 2WJDA 2O9RA 2JGQA 4W5UA 4UMBA 3Q4DA 2HMCA 4JQ4A 1F7BA 1TIMA 3U2EA 4JEJA 1S5VA 1XYFA 2ATSA 2DV0A 1PKNA 3W7OA 3WLTA 2X8RA 3K2GA 2JF7A 1QI0A 3EWYA 2NVCA 2F2KA 3IARA 3PBMA 1QDSA 3LX9A 3PP7A 5HWMA 5JIWA 2VDIA 5MKGB 3UCDA 5HMEA 4KRZA 1JPIA 5BXRA 4AD4A 1EO5A 3W7KA 1JPHA 1C8VA 2UWFA 4NT0A 4LWWA 3LPGA 4X61A 2A3EA 4I5XA 1BYCA 3GRIA 3NGFA 3PSVA 4RR4A 2CEQA 1WKDA 4DO5A 1QHOA 4UR9A 3F4NA 3EWWA 2NX1A 2IKHA 2OLHA 2X2YA 3ZJ8A 2XINA 4PGLA 2WXDM 1VP5A 3NUKA 3CZJA 1EOKA 3WNKA 2NVAA 4UC5A 3CUXA 1HL8A 3WNPA 4IUOA 4HZ8A 2ZRUA 4DWSA 3TTYA 2J75A 5J5DA 3TFXA 2B7NA 3R79A 3SB0A 1RLCL 2QR6A 4JTAA 3M0KA 1JPDX 4LALA 2XH4A 4P7QA 3C61A 2QGYA 2VX5A 4JN7A 5G4HC 1U1UA 1UR3M 4Q8NA 3ABXA 3TROA 3E0LA 1FWFC 3AMKA 4D1IA 1K7FA 2PGRA 4QROA 1MMFA 1WNOA 3EDDA 5D9NA 3NM3A 4G2DA 4PMOA 4XAPA 2VR2A 4H6QA 3KZPA 4ZO9A 4DJDA 1RSCA 1XD0A 4GNVA 2QYGA 4KCTA 5CZ0A 1JYVA 5J5RA 3APTA 3NQ6A 2HTMA 4AXNA 2NSXA 3L5LA 4QGCA 1RD6A 3O7UA 3BE7A 4B5WA 1F76A 1UC5A 4CLMA 5D2TA 4O0KA 2OKTA 4AD2A 1T8QA 2WNQA 4AIEA 2VX6A 3LEPA 4QEEA 3ITGA 3CNYA 3ZSSA 3UZZA 3LMYA 3G1XA 2VRQA 4G1KA 4GKTA 1Q2SA 4HMDA 2J7GA 3VKAA 4B91A 1SFSA 3VFLA 1SW3A 1EJXC 2X09A 4NXSA 5D2WA 4LF2A 5C9UA 3RRAA 5TIMA 4L80A 4A3QA 4N4PA 1A5KC 4K7VA 5T26A 3NDYA 2HVMA 1WZKA 3EOUA 1UBPC 5BMXA 4Q4OA 1UA7A 4I9MA 3LHUA 4A05A 4A3HA 1W9BM 1ZPTA 3BUVA 1B9ZA 3WNMA 3W1PA 2X2GA 5A6JA 5IBXC 4M3PA 1F61A 3LV6A 1V6UA 4WX2A 2VOMA 5CGQA 1QOXA 4FIRA 4JHMA 3MHUA 3S5ZA 3WLRA 3ARSA 2E1DA 1TX2A 1KBKA 3VIPA 4LS2A 4X9SA 3BMVA 3RX2A 3PG9A 1XISA 1FX6A 1E5JA 3NM1A 1QU4A 4OUEA 4FX7A 4L6DA 1GW1A 2YFOA 3KBVA 4IZGA 4LT9A 1RJRA 2FGBA 2R9RA 3QHMA 3EX6A 3WZ0E 1X7FA 4IP7A 2G4JA 1N82A 1QRQA 1RQEA 5EGRA 4LGXA 3CUFA 2PDNA 5D4YA 1ZFJA 2RUSA 1R46A 4N42A 1OYBA 2X40A 2CW6A 3OGVA 4JFSA 3T44A 2GDQA 3WH8A 3STFA 3P5ZA 4TV5A 4QHRA 2PWDA 2PPGA 5E0FA 1GKPA 2PDYA 4HA1A 2REQB 3WJYA 2ZDRA 3FHAA 4CU8A 1C93A 4NYYA 1AQFA 3G1YA 1RPKA 3T9PA 2XFFA 4PRTA 3ZM8A 1KBIA 3HN3A 3WQDA 5RUBA 4UFMA 1POKA 3I6RA 3MMDA 2Y7EA 4IICA 1V8EA 3K30A 4UTHA 4GVFA 3UR8A 4NY2A 3VZZA 1PDYA 2VZUA 3BICA 1GOWA 1B4KA 3QMTA 1JDCA 1PWMA 1Q6GA 2V5LA 3DI1A 4H41A 4LOCA 5A3HA 1JG9A 2YDSA 3F4VA 1EHAA 5G5IA 1HKWA 2C7FA 4LAOA 1CXKA 3M44A 4C7DA 1E0VA 3T0AA 1PTAA 3HM7A 1FP9A 3P74A 2OMAA 4LF1A 1I1XA 3CWHA 4OUIA 4H9TA 2P0IA 3W1UA 4AY8A 3UXLA 4LY8A 3OYZA 3GBEA 3UA4A 3WJSA 3W82A 1Q6QA 4EVZA 3QHNA 3G1FA 4CCEA 4KBXA 3C2FA 2WZTA 2Y5SA 1CPUA 3RNDA 2F9RA 4WVXA 4QE5A 3WUFA 3Q2DA 3CAVA 4CUCA 1EGZA 2GQ8A 2PDXA 2D2JA 4C6JA 1K6AA 3LTSA 3P93A 1FCVA 3VIFA 4JCLA 4QG6A 3TCEA 2ABAA 1L0PA 2OGYA 4H2HA 3PAOA 4LYRA 3T08A 1Q5MA 5M1TA 1JCJA 4B2DA 3ABQA 1OBAA 2W4XA 4HYWA 5E6ZA 4GRSA 5KZ6A 2VQUA 3UY7A 1E6PA 3GVQA 1JVNA 2EHHA 3TTEA 3IK4A 2PB1A 3L2MA 4KFNA 1NTHA 1CXEA 1K02A 5D37A 4WJXA 5AYYA 4UIOA 2IMRA 2PU0A 1PL9A 1W2PA 4FXSA 3INPA 4GFIA 3A3WA 1TPB1 4Q4MA 2BASA 2DP3A 4XAZA 2QCNA 1S3TC 4JTSA 1UR4A 2Z00A 3W26A 5BCAA 2PDBA 4QJ4B 4IFKA 2R8WA 5AHMA 1IT0A 3E1F1 2PP1A 1E6RA 2I16A 3N6QA 1VRDA 1Q6CA 1H7WA 3BGJA 3TZFA 3BH4A 1WDQA 1UB3A 3UCCA 4IH3A 1BYDA 4F2UA 1RUSA 3SSZA 5CBJA 3KOWA 3NYZA 1L6WA 3OLDA 1ONWA 2RDTA 3PZUA 1VGAA 1K4GA 3GK0A 1G4SA 1WUEA 1PHWA 3R5EA 2ON3A 3VNZA 2WMIA 1WXJA 3CHVA 2DT3A 3GXMA 4PUDA 1V03A 3HPSA 1CTNA 4O17A 4MKNA 4ONVA 1RCQA 2CLFA 1T41A 2EPNA 1SPQA 3HPZA 1FWSA 2BY3A 3PBUA 2GGJA 2FMOA 2Z1VA 4DWSB 4ZTXA 4HNNA 2DSKA 4OQVA 1A5MC 1P0KA 4UB9A 3TYAA 5CGMA 2RJHA 1N7KA 1EUAA 3OZOA 1IEWA 2YCJA 4N9DA 5LNUA 2YXOA 1KCXA 3WBAA 1R5YA 3QH2A 3O1NA 4GGBA 2FHBA 1DE5A 1PVNA 2PA6A 3QRHA 1KFEA 3VNIA 5FCZA 1VEOA 1KM5A 4GC3A 3O07A 4UFLA 3WEZA 3WBXA 1MFVA 2NZLA 3FAXA 3LBMA 3LHWA 5AB3A 4JIHA 3N2BA 5I02A 1GVSA 1OK4A 2HWGA 4GXPA 1ISXA 5DT7A 3ZZ1A 1W1ZA 3VIIA 3IEBA 1YXDA 1GHSA 4I8YA 4GACA 3BAKA 2GVLA 3E0VA 4XZLX 2ZCGA 1TELA 1VF8A 4QG9A 1JDDA 3NURA 4GI4A 2WSRA 2QJMA 3LTPA 1N8WA 2EEXA 1DWHM 2BY0A 2PTWA 1H7PA 3S83A 3GZ3A 4C90A 4LPCA 3ZLFA 1AVAA 4DO6A 1GT8A 2HVNA 3VD5A 4ROQA