3SSJA

Crystal structure of methanothermobacter thermautotrophicus orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-ump
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
214
structure length
214
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of Methanothermobacter thermautotrophicus orotidine 5'-monophosphate decarboxylase complexed with 5-fluoro-6-amino-UMP
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase
total genus 87
structure length 214
sequence length 214
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ssjA00
3BVJA 2ZFAA 4OHQA 5AYYA 1IXOA 5FF3A 3NVTA 3DKLA 3TK7A 2C0AA 1K02A 1SZFA 5LHEA 2C19A 1GEQA 4KWVA 1YDVA 3M7WA 3LTSA 1FDYA 2J88A 3QH2A 4I9AA 2Q8LA 4DF1A 3W22A 3T78A 1XUUA 3TMLA 3HG3A 2FJKA 3FLUA 4LUJA 2VEMA 3ABRA 3NQ6A 3TDFA 5E93A 3HF3A 1KFBA 3W1RA 1VZWA 5LGXA 3OG3A 4LS0A 1ICSA 2WNQA 3W2LA 3LERA 3PAJA 5G1YA 4ZQPA 3W73A 2WNZA 3NQDA 1IXPA 2V9DA 1Z44A 3BG9A 3GX9A 1KLYA 2J27A 1VH7A 5DXXA 2BLEA 2WNNA 1PE1A 3HB9A 3P60A 2H8ZA 3PBYA 4N9DA 1UASA 4UFJA 1QMLA 4MFEA 5MHBA 3C56A 3G1DA 1TQJA 1FWSA 4MKNA 1OYAA 4CNPA 3LOTA 1GZGA 1DQXA 4IUOA 3BPWA 3UWVA 4DBDA 2QR6A 5J5DA 1GT8A 1LLWA 2ZCGA 3L5AA 5EA9A 4I7UA 1OF6A 3G1VA 1G4PA 1WV2A 4UUIA 3KAOA 4MVAA 2ZBTA 3G18A 2WKJA 3W74A 5CSRA 4RR4A 2LLEA 2QUTA 4QIUA 4OQVA 3FS2A 3U6WA 1F76A 1JCYA 4RK8A 4Z08A 3BLIA 5DY3A 3SW6A 1KFCA 2OT1A 1FXQA 1ME7A 1FY6A 3A21A 1A5CA 4GBUA 3U2OA 3M1ZA 3QMRA 3IVUA 5D33A 5D05A 2VFEA 3LI0A 2QDHA 4LWWA 1TPDA 1DQWA 3LTPA 5IBXC 3TC7A 3TH6A 2ZQ0A 3ABQA 1MZHA 2QCCA 1XBYA 2CLLA 2YYTA 2Y7FA 1LP6A 4DO4A 3G8RA 1RR2A 1WXJA 2YX0A 4NX5A 2E1DA 2RDUA 3GR7A 2Y70A 1TPUA 4MUZA 2B7PA 4LRSA 4FNUA 3U8GA 5D2VA 4IMEA 3P5ZA 4OV4A 3TX9A 1O94A 1JUBA 1T96A 1DBTA 2QCDB 4P2VA 5K4XA 3MW7A 2NUWA 1ALDA 2E6AA 3O6DA 3G0SA 5CPNA 1QOQA 1XCFA 1KTCA 2ABAA 2H8XA 1SU5A 4JTSA 2X1RA 3SGUA 1EUAA 3HMJG 3UXDA 3N14A 4U4MA 2PCQA 4GUGA 3IRDA 3N9RA 2NWSA 3KX6A 3PUEA 4JDBA 1N8FA 3W87A 2Y89A 4YLWA 3MI2A 1B4EA 2QCDA 1OFPA 4JY8A 1QPNA 4LC8A 2YFNA 4Y9AA 4N4PA 5U7SA 3A5VA 3LCWA 4MLJA 3S1VA 4RZ6A 4CLMA 2R14A 1OG0A 4GUHA 3C3NA 4BWLC 3NAVA 4O18A 3ZR4A 2XN1A 4QNEA 5C2XA 1VCVA 5FI8A 3MO7A 3BK0A 4YCOA 3UXAA 4OWGA 3TFXA 3LCIA 1VQTA 2JBMA 4A3UA 2JK2A 2GUUA 2F7FA 2XFWA 4XKYB 2FDSA 2DZVA 4XTDA 2A7RA 4KFPA 3SGZA 2ZZ4A 3N9SA 3V75A 4M6QA 1SO4A 3BARA 4XQ6A 3WFAA 4Y90A 1XDLA 3CHVA 3ANYA 1XBXA 3HIJA 4UTTA 4XBKA 5FF7A 3DFTA 4O54A 2I14A 3TE9A 4OV9A 3UZ5A 4X2RA 3S9YA 3PVFA 3A22A 4MFDA 3IIVA 1KM4A 4MJMA 4JYEA 2Y61A 5LKYA 1EB3A 5K2ZA 1S3HA 4QNWA 4XKYA 3MP5A 3FIGA 1JRCA 4GUJA 1W31A 3EKZA 3VI2A 4MZ1A 1O4UA 4WD0A 3EB2A 4LS1A 4UMBA 1ZFJA 3LHZA 4ORMA 5EL1A 2QCHA 4GC4A 1F6KA 4OT7A 3TCEA 3W7HA 1GVSA 2GVJA 4JGDA 1VLIA 1ZHAA 1QO2A 3P8JA 4N6EA 4UFIA 5DY2A 4LVBA 4Z0JA 2H6RA 3HG5A 1OFAA 3PB0A 1XKYA 3KVJA 5C54A 3TSBA 3VE9A 2ZZ6A 3L67A 4M7TA 2VXNA 2CW6A 5AHNA 1L6YA 1OVDA 4FO4A 2QUUA 3G1XA 3S5ZA 4B5NA 2HS8A 1OX6A 2TPSA 1A50A 2CWNA 1RD5A 4HHPA 4AHQA 3C0JA 4UFLA 1J5TA 4HNUA 1TO3A 1RQBA 3H53A 4JN6A 4NVTA 1VCFA 2G97A 4ORIA 3IGXA 2VFDA 1I8JA 3Q58A 3RNDA 3FYPA 2X1UA 4QITA 1GJPA 3LDVA 1SQ7A 3IIPA 3W70A 3A23A 4LU0A 2OCZA 1PV8A 2IQTA 3SSJA 2BXVA 4NXSA 4WXZA 3O07A 1OX4B 4BR1A 4N4QA 1HUVA 4AHPA 1ZJIA 1W54A 4AWSA 3KVMA 1LRQA 4IOTA 3QFEA 1AG1O 5AB3A 3GKAA 1JUKA 3IIZA 1JCNA 3W1NA 3C2RA 1VR6A 1SW7A 3W3OA 2HSAA 3WJXA 3FA5A 1K03A 4K7VA 1QR7A 1QDSA 2W0UA 3DBPA 1FCUA 3P82A 4IXHA 5FEWA 2E68A 1OX4A 3IGSA 1KA9F 3GDRA 1X1ZA 4K7YA 1D9EA 1KM0A 3EXSA 1THFD 2NXHA 2C18A 1ONRA 4CQAA 1X7FA 3DFQA 1TMHA 3RK8A 3RFAA 5BW6A 3RF9A 2GVLA 1XBVA 1P4CA 1R2RA 3EKLA 3UWUA 4JTJA 2VFIA 1ZAJA 1ME9A 4Z1DA 4AAJA 4E2DA 3R89A 4UTTC 2QCEA 3DFSA 2QKFA 3LHUA 4S2BA 3QYQA 2NXIA 1K7XA 4LC6A 4AF0B 1EP3A 1TPVA 2VEIA 2Y63A 1SO3A 3UD6A 1PIIA 4HSOA 1GYNA 3R2GA 1LCOA 2GQ9A 2P10A 2VFFA 3N19B 4BF9A 2J9ZA 2AQWA 4O1AA 4AVFA 3M6YA 4NZFA 4NNBA 5HUOA 3MHGA 1TRIA 4UR8A 2V2CA 3C2VA 1QNVA 1F6PA 3W71A 1AL7A 5HR7A 1ZNNA 3C4UA 1H63A 3BV4A 4AF0A 3P74A 3GIYA 3W07A 2YW3A 3L68A 1BWKA 3QPZA 5AHMA 2NX3A 1EPXA 3WK0A 3MMTA 3VNDA 2YCEA 2WQPA 4MIMA 3LV6A 3KRSA 2A7NA 1OFDA 1EX5A 2Y7GA 1S5TA 3SFKA 4FHAA 4JTLA 1JJKA 2CLEA 4NJHA 4R7JA 4UTWA 1W3TA 2G96A 3W6YA 3THQA 3L65A 4JYFA 2EF9A 5I3FA 4YWIA 2PRLA 4O11A 3LHYA 1FDZA 5G4EA 1JVNA 3NXFA 5C55A 5C5YA 3STFA 1WBJA 4RZ4A 1GTEA 2PRHA 3S0CA 3C8FA 3T4CA 3YPIA 3GNNA 3EWZA 3R12A 1Q6OA 4QM1A 3L0KA 3LI1A 3CIWA 3L5LA 1KTNA 1OK6A 4LRTA 3E49A 5HWMA 5D37A 4JX5A 1VLWA 1MXSA 4O12A 4DQWA 4AH7A 1OK4A 3BG3A 1VPXA 2FQIA 3IIOA 3PULA 4WUIA 1SSDA 1OYBA 2FB3A 3OIXA 2JGYA 3LHWA 5AHEA 2H90A 5KTLA 3R8RA 4IMGA 4ZZ9A 1FX6A 3D0CA 3HOJA 2V81A 3W7LA 1U5JA 5F2MA 2YR1A 3MUXA 3M47A 5K9XA 1JCLA 2Z1BA 3TQKA 3I68A 3VCRA 3NDOA 1UUOA 4TX9A 3RLVA 4GUFA 4RCXA 1X1OA 5HWJA 2JKPA 4HPJA 1Q6RA 4NNCA 3P80A 2TYSA 4K38A 2B7QA 3M44A 2ZZ5A 1OABA 3W7PA 1M7PA 4W9TA 1DORA 1EP2A 1O5XA 4IPIA 1SUXA 1NFBA 4K8EA 1KW1A 1L9WA 4HT3A 4XZ9A 3G3MA 4A22A 1LDCA 4PL1A 4O19A 2DZPA 5DN1A 2NX9A 4M7SA 5KZMA 3UWZA 5I3JA 1FCBA 3CPRA 4ML9A 5LGZA 1XUZA 3DI0A 5FEXA 5KMYA 4AWTA 3ZWTA 4X9SA 4UTUA 2YDAA 4UTHA 3THAA 1GVOA 2X1SA 5D03A 3DH7A 4ZVJA 3O16A 4E2BA 1TIMA 5CZSA 2NXGA 5HJLA 3HPZA 2X30A 3W7CA 2V0TA 5AHLA 2Y85A 4HNNA 2OT0A 4BWLA 1IXQA 2A7PA 1W8SA 1S5WA 4FNTA 4G1KA 3N73A 3LRLA 3M5YA 3LV5A 1D3GA 3O15A 3MP3A 4Y96A 2J9YA 3NZ1A 3MBFA 4LW7A 1TTPA 3L2IA 5LNVA 3NYZA 2QCFA 4ONVA 3TA6A 3W7GA 3P5YA 3NQFA 5DCBA 4JX4A 5DBTA 1L6SA 4UTWC 4DO6A 2I1OA 5D04C 1YYAA 4IGHA 5LZLA 3PUOA 3WJWA 3LCLA 4MJZA 4LY8A 3M0ZA 2Z2UA 3F03K 3INPA 3PBWA 5EBUA 1W5QA 2JKEA 1O60A 3TXVA 4KFOA 1LZOA 1TPEA 3FJLA 4JTKA 5C6MA 3PB2A 2D73A 5J5RA 3ZS4A 4AWUA 1BWLA 3E96A 4XTIA 1YPIA 4O0ZA 4RXFA 3DFPA 4WX2A 1XL9A 3HPSA 4I7WA 2JGQA 4WOZA 2E09A 3L66A 4LVGA 3PG9A 2PRMA 3L0NA 4NJIA 1G69A 4PA8A 3TXZA 3NQEA 2YXGA 4K36A 4ZQOA 1M7OA 3M5ZA 3UPBA 3DHFA 4JIQA 1GWJA 3M5XA 1AW2A 2QJIA 3STCA 1OJXA 3L0GA 3MHUA 3O06A 3GAKA 3SY5A 4LNYA 5AC8A 1FWNA 4NT0A 3TW7A 3KOFA 4CNOA 3UWWA 5DCDA 2A6NA 2YW4A 3EWBX 3KXQA 1LYXA 1P0KA 2CLOA 3FJ6A 4Y8FA 1AMKA 2DORA 3TFCA 2EAWA 3DXIA 1FCVA 3W1LA 4JTTA 4AXKA 3B8DA 3PWAA 3TSDA 3G1SA 1SZGA 3DFOA 2A2IA 1IIHA 2RH9A 4A21A 2F84A 4FXRA 4POCA 1R47A 4UR7A 3GDMA 1FBAA 5HNRA 4ADUA 2EKCA 4JIPA 4O53A 4UFHA 3NQCA 4YL2A 3ZFHA 5CPOA 2CFFA 3EEGA 1HG3A 4UTLA 4UNLA 3NL3A 2Q8ZA 3EWWA 1DHPA 3M5VA 1H7PA 4LUIA 3RU6A 7TIMA 5I3GA 1UBSA 3W7OA 3W2MA 2VC6A 1TTQA 2GPTA 2C3ZA 2WV8A 2CLKA 5G4WA 3UZJA 4MY1A 1F73A 3W1QA 4GNJA 2DJLA 1LM1A 1Z41A 1W0MA 3LCFA 1SFLA 1LORA 3MYPA 3USBA 2ATMA 1UB3A 2ZTJA 2C1HA 5A5WA 2GQAA 2I9EA 3BO9A 3NQGA 3OA3A 1DL3A 3TMQA 2WO5A 3PF3A 4LVFA 2R94A 5HULA 3DENA 1G4EA 3LHVA 3P81A 3PSWA 3QW4B 4JICA 1WA3A 3PY2A 4ADSA 4JTIA 3NPXA 2ZYFA 3LXAA 3NPWA 4O57A 1DJNA 1E51A 1OF8A 2ZRUA 5EPDA 5D30A 4D2JA 2Y6ZA 3HO8A 1Z42A 3T44A 1TTIA 4RJEA 1W5PA 2BSLA 3UY7A 1TPFA 3UYCA 2O7QA 4UC5A 3PSVA 3LLFA 3MJYA 3PM6A 1TYGA 4IX0A 5LNWA 4LS2A 1WDWA 3RLUA 1YDNA 1TPWA 1KFLA 1IXNA 3PC0A 1KV5A 5HWNA 4H6KA 5K7JA 2FPVA 1JCXA 1XI3A 1TPC1 3G0XA 4EOUA 1XDMA 5D38A 4N2YA 4HNTA 4M19A 1G7UA 5H2ZA 5KITA 4UMAA 1H1ZA 1FCQA 3S1XA 4ZMGA 3GDTA 2Q3RA 4PCFA 2J6XA 2TRSA 1X8FA 1O5KA 4KFNA 4BFAA 3W1TA 1H7XA 4O8RA 2WSYA 3G22A 4CCDA 4MOZA 3TJLA 4GXMA 3PG8A 4Z1BA 3IGUA 3UNDA 3L21A 1UUMA 4M6VA 1L6WA 5F1UA 5L9FA 3HGSA 4QISA 4RXGA 1TPH1 3PUDA 1I45A 3CB8A 3UY8A 1XBZA 3TAOA 1RVGA 3TV8A 3GAYA 4L4LA 1FDJA 2NUYA 4RZ5A 4JYDA 2E5CA 5AOUA 5LSMA 4C1LA 1QOPA 5KINA 1KM5A 4MZ8A 1LOQA 3DU0A 1Q6QA 4HKPA 1K7FA 2QCLA 2DU2A 1GVFA 1W3NA 3CU2A 3SECA 6ALDA 1TJRA 1VHNA 3GZ3A 2GJLA 4OGZA 1W5OA 3CTLA 3HG4A 4QQ3A 5AYXA 4X3ZA 2DJXA 4IWWA 2QJHA 1OFRA 1MEHA 1YLVA 2VELA 5I3HA 4JTFA 2B0MA 1SPQA 2P0OA 1YTDA 4IQLA 3QF0A 3EWUA 5EMUA 5F2GA 3QW3A 1SO6A 1SSGA 5D2WA 3G24A 1YTEA 2WSQA 1PCKA 2TMDA 3FEMA 4DPPA 5CKSA 3M16A 3HBLA 1ZENA 3NL6A 1KM2A 1Q45A 5DXYA 3F4WA 2VEPA 1H51A 1AW5A 3S5NA 2X2GA 4TU1A 1H7OA 3LCGA 4EVZA 1JCMP 4WJEA 3TSMA 3TUUA 5IM51 3B4UA 3VKJA 2GJNA 3LHTA 1C8VA 4GUIA 2FPTA 1FWWA 3P62A 3G1AA 4WY0B 5H91A 4LTSA 1EEPA 3TROA 2YGYA 1DOSA 4AEOA 3W1UA 3TU9A 3QMTA 4GJ1A 3HGJA 5LNRA 1QWGA 1T8XA 5BRBA 3FOKA 1LTDA 1YXDA 2EPHA 2V2DA 3O05A 3LX9A 1HL2A 2CLFA 3B04A 1NSJA 1CX9A 4RKAA 3SI9A 4RLIA 3DI1A 4OU1A 2DZXA 4FX8A 3LXCA 3KFTA 1U83A 3QQ1A 1M5WA 3SR7A 4WY0A 3EX3A 3W1MA 2E77A 3NL5A 4NXKA 3T40A 4DPQA 4Z1AA 3JR2A 1OYCA 5TQLA 2TSYA 1J4EA 2RHGA 3QM3A 1NF0A 1EWDA 3PS7A 2V30A 2BX7A 1TSIA 4WY0F 1R46A 4UFMA 4UTMA 3IV3A 4CQ9A 1P1XA 3QSRA 3QRHA 2VFHA 2Z0IA 1XFBA 2DP3A 1KM6A 2YYUA 4KKXA 1JULA 5G5IA 3NL2A 1SR9A 3DGRA 3GLCA 4NJKA 4BI7A 1F74A 5E1QA 4MZYA 2EGZA 3CEPA 3Q2DA 3B0PA 3GKFA 1IF2A 4BI6A 1A5AA 4A2SA 3OVPA 4O17A 3I7QA 4IXXA 1PVNA 3QMSA 3W1PA 1QPOA 5F4XA 1FQ0A 1WAUA 4FIQA 4Z0SA 6TIMA 3P7YA 1H7WA 2CLHA 3FFSA 1OFQA 3EX2A 5K9DA 2WSRA 1GG1A 1GQNA 1DJQA 5F2LA 2YZRA 4K37A 2NUXA 3GNDA 2VOMA 3W76A 1DVJA 5CSSA 4PTNA 3OVRA 3VFLA 4ADTA 4P61A 2R8WA 1Q6LA 2C6QA 3KVKA 4NQ1A 5L6UA 3IEBA 2C13A 5HUPA 3I6RA 4DBEA 3GYEA 5KSWA 3N2XA 1JCJA 4GWEA 2Y7DA 4TR9A 2NWRA 3ATZA 5A8GA 3EX1A 4WXYA 3W83A 3KVLA 4N9CA 1KLZA 3EXRA 4A29A 1V7YA 4LVDA 1SW3A 1K8ZA 4DF0A 4WQ6A 1KFKA 4O4WA 1EIXA 1TCDA 2XN2A 2Y7EA 2RFGA 3VE7A 1K8YA 1MO0A 4DELA 2R91A 2ZZ1A 4Y6GA 2FTPA 4TMCA 1YTKA 4O1CA 1LOSA 3PR2A 3KRUA 1H1YA 5K9CA 3UWQA 1I2PA 1RZMA 1AL8A 1HO1A 1KM3A 4O16A 5AFDA 3G8EA 3W7RA 3W7QA 3TQ0A 2ATSA 1ZAIA 1N7KA 1TQXA 3JS3A 3OVQA 1WQ5A 3B06A 3ABSA 1KBIA 2NX1A 3ZWSA 1K8XA 1EP1A 3CLMA 3WK1A 1K7EA 3FKRA 2A21A 4PH6A 1LBFA 3P61A 3W84A 3ELFA 4FNSA 2A0NA 4CNNA 3M9YA 3P8IA 1BEUA 2NLIA 1CW2A 2Z6IA 4UFKA 2PURA 4JR5A 3E02A 5LNSA 1P5BA 4FX6M 3W7EA 3NNTA 1KFJA 3B05A 3HJZA 1V5XA 3OHIA 4H4IA 4LV4A 4EF9A 1H50A 1RQEA 2W6RA 3NEVA 1ML1A 4GFSA 2C14A 2FB2A 2H3BA 3S5OA 3S1WA 5AYZA 1KBJA 1EA0A 5T26A 3NM3A 2QAPA 4JTUA 2C15A 1LRTA 2V8ZA 3S8HA 4FX7A 5G2IA 3L9CA 2C16A 1KFEA 3LGEA 3A5FA 1CI1A 3QEZA 1I4NA 5CPMA 3S5YA 1TRDA 4N9EA 3W1XA 2E5DA 1ZCOA 1B3OA 4LVAA 1LROA 1NEYA 4MYXA 4H3DA 3NGJA 3H55A 2DZUA 3B0UX 2VKZG 5LNUA 4S2CA 5G2HA 4UTKA 4JD4A 1QPRA 2KZHA 4PL2A 3T7VA 4PODA 2CZEA 3T55A 5CGQA 4NZJA 4KWWA 5BOOA 2QCGA 4JEQA 5DLCA 3STGA 3DFNA 3E0IA 3C2EA 1O95A 4JTGA 2CLMA 2VENA 3UQNA 3I7SA 4RV8A 1Q3NA 3CWNA 3W2KA 1YXYA 3NPUA 2YPIA 4FB7A 3P84A 5K3VA 3W72A 4PFMA 2CZDA 3SZ8A 1KV8A 1GPWA 1SZNA 1YDOA 4DF2A 1TTJA 5AC6A 3CIXA 5FESA 1FWTA 4UTJA 3TJXA 2ZA2A 3CM4A 4JY9A 4MY8A 3AO0A 1QCWA 3P67A 2QUVA 3W7DA 4HSNA 1SZEA 4UMCA 3Q37A 1A5BA 3NZRA 3CC1A 4JTHA 4JXCA 3GDKA 4ZQNA 1NF7A 4DO5A 4IMDA 1SFJA 4JS3A 2QEZA 3EWXA 2RDTA 4FNQA 1B4KA 1H7RA 3E9AA 3GXNA 3TC6A 3G1YA 4BI5A 5EYWA 4NJGA 1YXCA 1M6JA 1H60A 2ISWA 2VFGA 3BGJA 2AAMA 3IIXA 1GG0A 4IJBA 2E5BA 4R33A 4K8HA 3N3MA 4ZQMA 3EXTA 3GK0A 3W9ZA 1VS1A 5K4ZA 1T0OA 1WOBA 1RV8A 1LRNA 3O1NA 4WZHA 4AMAA 3Q94A 2B4GA 3CEUA 3G1HA 3W1AA 2YFOA 4FNRA 1B57A 1ZY9A 1Z48A 1K3UA 2WOQA 5FF0A 4NNAA 4U28A 4ALDA 1GVQA 1OFOA 4GRSA 2JKAA 1FWRA 2VEKA 1VC4A 3O63A 3AJXA 4FEZA 3HGRA 1LLZA 5F4WA 3KHJA 4TMBA 3BLFA 5CPLA 8TIMA 2GQ8A 3LB0A 1VYSX 1YPFA 3A24A 3IVTA 5F4SA 2QCNA 5G1TA 1H7NA 3F1QA 3I7RA 1I2OA 1Y0EA 4MY9A 3M41A 4O28A 4ZL1A 4UCGA 1JQXA 1LOLA 3LRKA 1PHWA 1TJPA 3G0UA 4QJ1A 2ZZ3A 3BG5A 3B0VC 5AC7A 4O1BA 1UCWA 3MP4A 5DBUA 1L2UA 2V82A 4O13A 1RPXA 2CU0A 1MEIA 3EX4A 4IPJA 2G95A 1G7VA 3QPYA 5EY5A 5CZTA 2ZZ7A 5E0KA 1VCGA 5HMSA 1ZALA 1HTIA 4DEFA 1N55A 3TAKA 1GYLA 3W7NA 3E12A 5AHIA 3NR0A 5CZJA 2Y62A 1WX0A 3W7JA 4E0CA 3WJSA 4AB4A 4QAIA 3QJAA 1VYRA 4PEKA 2RDWA 3W85A 1S5VA 2FIQA 3NA8A 3S42A 1WYIA 3M43A 1TB3A 1G67A 3W88A 1OFBA 3MI6A 1H61A 4YXGA 2DZTA 3MHFA 4XUGA 3HPXA 4YMZA 3QSTA 2DZSA 2O7SA 4R34A 1ADOA 3PBUA 2DZWA 3UPWA 1PL9A 4M5PA 2YSWA 4FIRA 5BMWA 3LCXA 4R53A 2RKXA 5F1VA 3DHDA 1A53A 3H54A 4DXVA 4N9BA 1VRDA 4ICNA 3W2UA 2HTMA 4HIBA 4PC8A 1EWEA 3C52A 3STEA 3FKKA 1H62A 3TIMA 3CT7A 3W7MA 2GVGA 1MEWA 1PS9A 2OZ0A 4AHOA 4JDYA 3DKJA 5KZDA 1TPB1 4N02A 2FFCA 5AHFA 2AGKA 2A85A 3LRMA 2H3DA 4X22A 3PBVA 2QF7A 3K30A 1IGSA 2ISSA 1DKWA 2NV2A 3ABOA 2QCMA 4NX0A 1LBMA 2NV1A 4K39A 4LT9A 2ZRWA 2ZDRA 2PE4A 4QSHA 4CCEA 5FF2A 1OFEA 2Y88A 3GVGA 3HGOA 2Z6JA 1NVMA 1DV7A 2B7NA 1XC4A 3IVSA 1G4SA 2V2HA 1R2SA 3V1PA 3N34A 3N2MA 4WOQA 3S1UA 3HQ1A 1VHCA 4XWUA 2W79A 2FLIA 1KM1A 1SW0A 1SO5A 1HFBA 2V5BA 1D3HA 3BW4A 5TIMA 4CQ8A 4O14A 1A5SA 1C29A 1IIGA 3BGGA 3W7IA 3W75A 2ZA1A 1VYPX 4NJJA 5EKYA 1GVRA 4I7VA 1ME8A 1TV5A 2P1FA 4MPQA 3WK2A 3O8AA 1AK5A 3GXTA 3GR8A 1H5YA 3RMJA 4C1KA 4EF8A 4Q33A 1UJPA 5CG7A 4MYAA 2QAFA 2A6LA 4OBTA 5F2IA 2BWGA 1FUYA 4E38A 5BMXA 3CWOX 1BTMA 4JNMA 2HMCA 4LOCA 1TV7A 2NZLA 1OHLA 2ZRYA 4Z1CA 3W23A 4LV9A 2WPBA 3NQVA 3OBKA 1W37A 3I65A 4A2RA 3LTYA 1ICQA 3NQ7A 1C9DA 3JRKA 5HQEA 2CZ5A 2A4AA 1XM3A 2HS6A 2ZRVA 3NM1A 4CCCA 2XN0A 3G1FA 3HG2A 4JX6A 5D09A 2OMAA 5I3IA 5FEPA 4NUWA 2V5LA 2GOUA 3C2OA 5D2XA 3SIZA 1W3IA 1NAL1 3NO5A 1QAPA 3C6CA 3NPVA 3R5EA 1F5ZA 1R2TA 4O1DA 2CLIA 1G6CA 4O10A 3LCHA 4TO8A 3CQ0A 3G3DA 5TBOA 2QJGA 3DZ1A 4O0KA 5D32A 2ZRXA 3QQ0A 2PC4A 5U4NA 4O4VA 1LBLA 1G4TA 1RQHA 5D2YA 1WBHA 3LLDA 1TV8A 5CZ0A 1MSSA 3LBMA 1HO4A 2B7OA 5KZEA 5DCEA 3NG3A 1B9BA 1TREA 3R13A 2E6YA 4EIVA 3TQVA 3QZEA 2E6FA 3GB6A 1WOAA 1PCWA 2FPYA 2A5HA 3WK3A 3BLEA 4JTEA 1W5NA 2CZFA 2EHHA 4ZQCA 2QDGA 3WJZA 5D2TA 5HINA 2ABBA 2BTMA 3LM7A 5I3KA 3NOEA 2Q3OA 1AW1A 2UV8G 1JQVA 3MI3A 4S1FA 1GOXA 1I2RA 1I2NA 1I2QA 4O15A 3C61A 5SWUA 3KRZA 2ZA3A 4IMCA 3S6DA 1W56A 1VGAA 2OJPA 3NQ8A 4Q4KA 3UWYA 5HR6A 2A1YA 3SJ3A 3NQ2A 1OX5A 5DELA 4N6FA 5AN7A 3OEXA 4FNPA 3BW2A 4GE8A 4UIOA 1XXXA 1F2JA 2ZRZA 3EX6A 4J9JA 1FXPA 3TR2A 3NQMA 1P0NA 3FYOA 1JUEA 1JR1A 1YADA 3LXBA 5BNKA 5D02A 5G2WA 4FXSA 2E6DA 3TNOA 3NQAA 3C2FA 5LHFA 3L5MA 3DAQA 5FF4A 1ICPA 1J2WA 4OE7A 3W2JA 3A9IA 4RX0A 1BKSA 2ZZ2A 1EUNA 4IMFA 4Q32A 4EWND 4UTIA 1GTHA 4M6PA 4FF7A 1QPQA 1VJIA 3EWYA 5FEZA 4O50A 3QC3A 4O52A 4K6AA 3O6CA 4ZQRA 3GDLA 1PHQA 4TIMA 2BZNA 1JRBA 1QFEA 3BW3A 5IBXA 4HPXA 3W86A 2ALDA 1X6UA 3F4NA 3W2NA 1T99A 4BK9A 3ATYA 1R30A 2G5WA 1F7BA 1W1ZA 5ABTA 3GXPA 2ZTKA 4IX2A 3O6YX 2ISVA 2WJZA 4HN4A 2J24A 2X1TA 3TKFA 3TW6A 3MYOA 1ZAHA 4UNKA 2J9XA 3MWAA 4MLRA 3B03A 1KTBA 2OX1A 5GVJA 1F05A 2X16A 4NU7A 4XBSA 4UXDA 4YCPA 4L4MA 3W7KA 3MBDA 1QO5A 3LBCA 1W5MA 4HNVA 3WJYA
chains in the Genus database with same CATH superfamily
2ZFAA 5LIKX 2GYIA 5AYYA 1NELA 1IXOA 1YEYA 5FF3A 3THCA 3H7RA 3TK7A 2C0AA 2OGYA 5E9XA 3TLLA 1OGGA 4E4PA 1VFHA 2PDJA 3RCNA 2DW6A 1I1XA 1WP6A 2OSXA 2J25A 4LYPA 1XUUA 2ON3A 3HG3A 3TEVA 2DUAA 1MFUA 1SJBA 1TWDA 3EOSA 3QLDA 1WDDA 2EJAA 5E93A 2CHOA 3DHUA 2PTDA 3A4XA 3GU9A 1A4MA 3LLXA 2RUSA 1ZP4A 4ZFCA 3NQDA 4JZ5A 3MS8A 2J27A 1W8GA 1EYWA 3UG3A 2RDXA 4FSAA 1PE1A 2ZX8A 5H6HA 4QE5A 5EMLA 3CAVA 2BY2A 1QMLA 5HXMA 2XZ7A 3UGVA 3R8HA 2OLSA 1V3JA 3HURA 4ZB2A 1C92A 3T9PA 2E0PA 2BGQA 1E6SM 3HQOA 3SAZA 2QR6A 3LPGA 2VZTA 1EJ7L 4B5SA 1LLWA 1V0LA 3MKCA 4ZGYA 3F5KA 3OVGA 5FJJA 3L5AA 4MNKA 3IJIA 4U2ZA 4NKCA 3EOLA 4AZ5A 1J2BA 4MVAA 4YVVA 2WBGA 3UESA 1IEVA 4RR4A 2LLEA 3RX3A 4MB1A 4QIUA 5ECUA 3T2OA 3QLLA 3FS2A 4H7CA 5DY3A 1KFCA 1TWWA 3OA5A 2OT1A 1UA7A 2CXGA 3GXMA 3H4GA 4GBUA 3QMRA 5LIWX 5D05A 3TR9A 1MUWA 3MUAA 1H0IA 1PUDA 2R24A 3TW9A 5A8MA 3TYEA 3ZIZA 2YOCA 1R3SA 2MANA 1FWBC 1A49A 2YXXA 3VOGA 3I4EA 4DYEA 2Y7FA 1LP6A 3NSMA 1WDQA 1NM9A 2YX0A 2E1DA 4PUJA 3WD2A 1K9DA 4LRSA 2DW7A 1X97A 3N2BA 3U8GA 5D2VA 1FH8A 4IMEA 3OO2A 4AX7A 3TX9A 2OWWA 5JBFA 1T96A 3UW6A 5K4XA 1W91A 4J27A 1KC7A 4NYYA 3RCYA 3O6DA 3G0SA 5CPNA 1XCFA 1AFSA 4JTSA 2POZA 3SGUA 4NYUA 1EUAA 3VIPA 3GTXA 2WYSA 3S83A 3THUA 3WCZA 3QHMA 4PUUA 1UJQA 1CGYA 3IRDA 3GS6A 4A3HA 3QKZA 3VIKA 4CNSA 3UU0A 2WVTA 3MI2A 1RA0A 2QCDA 4US5A 3DEQA 1LT8A 4LC8A 1SM9A 4N4PA 4E8CA 1PO9A 4GIAA 3G1RA 4DUOA 1EKOA 2R14A 1PX3A 4GUHA 4N42A 3KBJA 3RRAA 3NAVA 3ZR4A 1OG6A 2X40A 5IDIA 2GL5A 4RNIA 1HJXA 5FI8A 4O8AA 3F4VA 1VQTA 2JK2A 3BAWA 2GUUA 4PTVA 2F7FA 2XFWA 2XJ7A 4XTDA 2ZZ4A 3N9SA 2P3EA 3G5EA 2WCSA 1FWCC 2L5HA 2WZEA 4REQB 2XH4A 5BU9A 4UTTA 4LUTA 4XBKA 4AYSA 5LIYX 2YBVA 4P8WA 5AKQA 3TE9A 3UZ5A 2W67A 3RO8A 4JYEA 2Y61A 4HHMA 2ZUMA 5LKYA 3IUDA 4QX4A 3UR5A 1K4HA 3UZZA 3MP5A 4GUJA 3RLHA 1W31A 4NASA 4MZ1A 4WD0A 1FWAC 5FACA 5EL1A 3TVAA 2OOFA 4CU7A 4C1NB 5BYWA 1AA1B 4E8DA 2PDCA 4HU0A 2A79A 2A3BA 3RM9A 4Z0JA 4WDXA 1S2WA 3VE9A 4XISA 2ZZ6A 4GHRA 3L67A 2VXNA 4HNOA 2XWEA 3UZXA 2WVVA 3KZSA 2NQ9A 4FOJA 4PUDA 1AZ1A 3VDHA 5HPCA 1GK8A 2DIKA 1WO2A 1RSCA 3BZJA 1Y5XA 4K1GA 3RGTA 2FVKA 2D20A 3Q58A 3WX7A 2X1UA 3VDGA 1GJPA 2O4QA 3LDVA 2TODA 1W1TA 1BD0A 5DEZA 2OO6A 4LU0A 2OCZA 1A3XA 1ZLPA 2BXVA 3QV7A 3QKEA 3CV7A 4NXSA 3B4YA 3O07A 1OX4B 4LEQA 3T0BA 5C0QA 3GVRA 5FJRA 2ADAA 4AWSA 1AG1O 5AB3A 2WAGA 3GKAA 1JUKA 2PPGA 3SQLA 3IIZA 4JFTA 3C2RA 1VR6A 1SW7A 3WDPP 1EO5A 3T08A 4B9YA 4JOMA 4NRSA 4K7VA 4IIEA 1HKJA 1G9HA 2W0UA 3DBPA 1FCUA 2E68A 2PDWA 3KTSA 2Q8XA 3N9KA 2YCKX 2I5IA 1LQ0A 2GVLA 1R2RA 4JTJA 1ME9A 4Z1DA 1E9LA 4AAJA 4E2DA 1E15A 2GWNA 1MRAA 2QKFA 4QBXA 4C6JA 5C7VA 4UQBA 1CGTA 4LC6A 2Y63A 2D0HA 4RDWA 5ECVA 1LCOA 2P10A 4BF9A 5CBJA 4ROPA 2CBIA 3VDCA 4NG3A 4AVFA 2WXDM 2F6KA 4NNBA 5HUOA 4QS6A 1TRIA 3B40A 1QNVA 3WDIA 2OFJA 3VMOA 5HR7A 4JBRA 1H63A 1JGIA 4Q4MA 3LU2A 3SUTA 2YW3A 1P0DA 3QPZA 2O92A 1WDSA 3BLDA 3KRSA 3WD1A 2A7NA 1OFDA 4E5TA 1Y7VA 1S5TA 1OM0A 4JTLA 1JJKA 1X7IA 3VXGA 4NJHA 4GBDA 1W3TA 4W5ZA 3W6YA 4P8UA 2C71A 1VENA 4JYFA 3PWGA 1A5OC 2PRLA 1JCTA 5G4EA 1JVNA 3TJ4A 2PD5A 1J8VA 3B8WA 2BHUA 4ACYA 1HKKA 1GTEA 2FDMA 4H6QA 3CASA 5M17A 4IGMA 3VNJA 2R82A 5C9UA 3SY1A 2ZX5A 3KP0A 4HZ7A 5HWMA 4JX5A 4DQWA 3MTWA 4DXKA 1VPXA 2FQIA 4WUIA 3OIXA 2H90A 3UGRA 3APGA 4RW5A 4IMGA 1FX6A 2DVTA 3TOYA 3LPFA 4F2BA 1U5JA 5F2MA 1EEXA 3M47A 1KCLA 1FWGC 3W25A 3I68A 3VCRA 1QBAA 3W37A 2PMQA 1WNOA 1B30A 4TTGA 1V8EA 3P80A 4K38A 1OCQA 3M44A 3SBFA 1DTNA 2R6OA 1M7PA 4LBRA 2PUZA 4L5ZA 2YZ5A 4K8EA 2HVNA 2B31A 3VC6A 1ZU8A 4DXXA 2BP1A 1S5NA 4PL1A 3LZ5A 3AWNA 2O55A 4M7SA 5KZMA 5I3JA 1FCBA 3CPRA 4ML9A 5LGZA 2CERA 1XUZA 2GJXB 1ZB5A 3AS3A 2YDAA 3RITA 4UTHA 4PZVA 4XAGA 1V77A 4GC3A 1XH0A 2ZVRA 3OIHA 4HP5A 3CBWA 3ZVHB 3SRHA 4RE4A 5EFDA 1RJPA 2X30A 2D1ZA 4UZUA 2Y85A 1XPGA 2OT0A 5T8GA 1GQJA 1IXQA 5TNVA 1GVIA 1U22A 1KRMA 4ZODA 3T81A 2NQZA 1A5UA 4FNTA 5HQLA 3FJ4A 3RPDA 5A6AA 5H1WA 2PSNA 3UR2A 4HQVA 1XIMA 5FIPA 5LNVA 3MU7A 4ONVA 2PLJA 3WFLA 5BXRA 2PDYA 3NQFA 5DBTA 2XPKA 1XH1A 2D0GA 1DJIA 1REQB 1XLKA 4IGHA 3AU6A 3BJTA 3M0ZA 3HQNA 3F03K 5EBUA 5CC6A 1LZOA 2FMOA 4QRNA 1JAEA 4Q8OA 1E1CB 3GTHA 4AWUA 1BWLA 4U31A 3U2CA 3QHNA 3DFPA 5TD4A 4FLOA 3JVAA 2JGQA 2E09A 3MY9A 3VNZA 2Z25A 2OEMA 3L0NA 3KWXA 5JVLA 1QHZA 3UF9A 2YXGA 1S2TA 3SGGA 3UPBA 1LG2A 1UC5A 2QJIA 2YDSA 4ATDA 3DCPA 4ZB0A 3O3RA 1JD9A 4QJ4B 4LNYA 5AC8A 2Z1KA 4NT0A 3TW7A 2X09A 3KOFA 4L4PA 3DX5A 3VU2A 3UWWA 3V0UA 5DCDA 1E1FA 2VX7A 4R7WA 1IT7A 1LYXA 3FJ6A 3ARQA 1AMKA 1BF2A 3TFCA 3E5PA 1VFUA 2OELA 4MWAD 3QQWA 4BQ2A 5C9RA 1RK6A 3CV2A 4JTCA 1HKVA 3G1SA 3DFOA 2A2IA 2RH9A 4FXRA 1W9VA 3PANA 4H9YA 4BHYA 3APTA 1R47A 4G7EA 4HBKA 1FBAA 1O1HA 3VVGA 4WR3A 2VX4A 4JIPA 5T9CE 3ZFHA 1RH9A 1H5VA 5CPOA 1JZ3A 2CFFA 5JBEA 4GINA 5HNNA 1HG3A 4F40A 1GJUA 3ZMRA 2WLYA 2WLZA 3R4IA 4HU3A 1M9HA 1DHPA 4DJEA 1GCYA 7TIMA 1UBSA 5I0DA 2VC6A 2GPTA 3UXKA 3AIBA 4GH3A 4MY1A 2AOSA 2DJLA 2EPOA 3TZFA 3LCFA 1LORA 1EC9A 1XLLA 3ITYA 5KETA 5A5WA 2D3NA 1JEZA 4D6DA 2GQAA 5F7UA 2I9EA 3KE0A 4YTUA 3TP4A 3OA3A 3UWEA 5A6JA 1T5AA 4LVFA 1FKXA 1EJRC 1G4EA 2EPMX 1ZPTA 2ZUUA 3N3TA 2RAGA 1E43A 1VFOA 4EACA 1DJYA 2GWGA 1XIJA 1Z42A 3T44A 4J5NA 3EBVA 4RJEA 4WKFA 2BSLA 4WGXA 1E72M 1PBGA 3C2YA 4P7OA 1WDRA 3C86A 1TYGA 4BQ3A 3GWQA 4LS2A 1QK0A 1IEQA 3RLUA 1YDNA 1TPWA 1KFLA 1K1DA 3PC0A 5I24A 5HWNA 4PCPA 1U2YA 1XI3A 2OU4A 5C70A 4EOUA 4IFOA 4LUYA 4N2YA 4V27A 4Q7BA 1O12A 4LX4A 4UMAA 1H1ZA 2Z28A 1AH4A 3PWIA 3CZLA 1UZHA 2IQ0A 2TRSA 1O5KA 3W1TA 1H7XA 2QIWA 1ZQ5A 2WSYA 4JQ3A 1H3GA 4WVXA 5EU9A 4Z1BA 1XV8A 3K8KA 3N29A 5JBDA 4YTQA 2NLYA 1HJSA 4GXPA 3N04A 1HZYA 1WZKA 4GI4A 3OLEA 1D2KA 1O68A 1XSKA 4UQDA 4DZHA 4CU8A 3N4EA 1QT1A 2E5CA 2P3ZA 5AOUA 1EIBA 4RPQA 4MZ8A 1XLGA 1I0DA 2QCLA 3LSBA 4AZCB 2DU2A 6ALDA 4J3VA 2GJLA 4OGZA 1W5OA 3CTLA 2V3DA 2JF6A 2DJXA 4Q7IA 1J93A 1OZQA 3WNPA 1IT0A 4LYQA 2VELA 5A6MA 4JTFA 1SPQA 2P0OA 4NSBA 5EMUA 3A3XA 4DUXA 5D2WA 2BY0A 2WSQA 1GOWA 1PCKA 3FEMA 3LD5A 4GZIA 1EA9C 3QY6A 3GW0A 5CPTA 3NL6A 1KM2A 3KBNA 5FD0A 2X2GA 4GIYA 1HP5A 3BWWA 4QDMA 4EVZA 1Q5MA 5IM51 2GJNA 2DSUA 3OP2A 3V36A 1BVWA 2JFEX 3UT0A 1KCZA 1EEPA 6ENLA 3W1UA 3QMTA 4GJ1A 1QWGA 1T8XA 2WZTA 3C3UA 1E3ZA 3RIKA 2PU0A 2WJEA 3VNLA 1JDAA 1HL2A 1NSJA 1R3RA 3SI9A 3O0FA 3WG6A 1ELSA 5LA1A 1GKPA 1E9ZB 1EFZA 1O5QA 4WY0A 3W1MA 2PAJA 3NL5A 4NXKA 4DPQA 4R27A 1OYCA 2TSYA 3QM3A 1NF0A 1XLAA 3PS7A 1TSIA 4WY0F 4UTMA 2D3LA 2VQUA 1A0EA 2DP3A 4QJ3B 1JULA 5G5IA 1VAHA 3NL2A 4GXWA 4PMDA 4BI7A 3KL0A 4Y9MA 1DWAM 4CN6A 5CQ1A 1AUSL 1WKEA 3I10A 4W89A 4BI6A 3OVPA 2XFYA 3MUIA 1QPOA 1UWSA 2GDQA 1WAUA 3PTKA 6TIMA 4Y7EA 2CLHA 1DHKA 2WMGA 3CMFA 2Z1WA 1HX0A 3WDHA 4HSHA 1FFRA 3UFYA 1A4LA 4PMYA 3CL6A 3GNDA 2VOMA 3ONCA 3W76A 4N7QA 3F7JA 3SCUA 3ERPA 2RGMA 3PAOA 4NQ1A 1Q6FA 5H8MA 5L6UA 4S3EA 3E2RA 1SJDA 1A47A 4GWEA 1XQLA 2NWRA 3F4DA 3ZOAA 2V5KA 2YDQA 3EX1A 1UKPA 1HQTA 1KLZA 4MKSA 4A29A 4MWAE 1K8ZA 1KFKA 4QLJA 4E2OA 4QXIA 5HANA 2HE5A 4XSLA 1K6WA 1K8YA 1J12A 2R91A 4Y6GA 4TMCA 1LOSA 2QJJA 2Q01A 1UD2A 1BTCA 3QR3A 3UWQA 1AL8A 4JL2A 4IIDA 4GX9A 3W7QA 1WKYA 1N7KA 1EJWC 1NDZA 2ZOXA 3ABSA 1KBIA 3CK5A 1DE6A 1K8XA 3FKRA 3WLTA 3PNUA 2A0NA 2CNCA 1KQYA 2XGBA 3QY7A 5E5CA 4AZ7A 1CW2A 2Z6IA 4H8NA 4UFKA 2WCGA 4FXJA 1UR1A 1P5BA 3HPAA 3B05A 4LV4A 5CLTA 1J01A 1QU4A 1RQEA 2W6RA 4F4RA 3NEVA 1JPHA 4GFSA 2F6UA 2C14A 3SCWA 1EA0A 2ZUWA 2OZ8A 1Z8AA 2OZTA 4J3TA 5A6BD 1YBQB 5G2IA 2HISA 2C16A 5XINA 1CI1A 2DPEA 5DO8A 6REQA 4I6VA 2ZUNA 2BMBA 4QR6A 4NAFB 3GFXA 1OCJA 5EBAA 1EGVA 3ALFA 3ZT5A 1NEYA 5PTDA 2XM1A 1Q7ZA 4H3DA 4FA3A 2VKZG 4J3UA 4RE3A 2VMFA 4UTKA 4JD4A 2FMNA 3T7VA 4FS9A 2CZEA 3OZPA 3ECQA 2FGBA 3BMWA 2QCGA 4JEQA 1V08A 3ZLHA 5DFAA 1RBLA 4B91A 4JTGA 2VENA 1E0XA 1TVPA 3CWNA 1YXYA 4FB7A 5K3VA 4PFMA 3MUCA 1KV8A 1GPWA 2BGNE 2E40A 1YDOA 2W91A 3UR7A 2QDDA 2REQA 4CQDA 3M0LA 4CD4A 2W66A 4I5RA 4J35A 3CIXA 5AC6A 5FESA 1FWTA 4UTJA 3CM4A 6XIAA 2Z2BA 4LQ1A 4KESA 1AMYA 2QUVA 3W7DA 4B4HA 2VDGA 4JPGA 4KEVA 3NZRA 5A8OA 1B4KA 4HOZA 5I7GA 2IXUA 2E67A 4H00A 5HDRA 2O0TA 4TQTA 4BI5A 5EYWA 3BQ5A 1YXCA 3WNLA 1BG9A 1BF6A 3EZ4A 3BGJA 3GG7A 3LMYA 1GG0A 4IJBA 1CBGA 4ENLA 2HQAA 3EXTA 3SB0A 4EPBC 3FEQA 4WZHA 1LRNA 1ISYA 4PEEA 4DLFA 4MMWA 2YDRA 2ZIDA 3F5JA 2C8NA 4U2YA 3USZA 5FF0A 1MRQA 4JHMA 7REQA 4W7WA 3H7UA 1VC4A 3O63A 3NEHA 4FEZA 3KHJA 4TMBA 3BLFA 4EE9A 8TIMA 1CXIA 1OC6A 1VYSX 2DT3A 2GQ8A 3LB0A 2QV4A 3GU1A 1W1YA 3POHA 3ZSSA 3I7RA 1NJJA 2OSWA 2OKOA 3ICJA 4MY9A 3M41A 4O28A 1CXEA 1LOLA 4BF7A 2ZXDA 1OGBA 3ES8A 2VGGA 2R1LA 4O1BA 3KL5A 5FSEC 2YCLA 1E71M 3EDDA 4O13A 4B92A 1OB0A 3CMGA 3FY1A 3BV7A 4H04A 5E0KA 1VCGA 2HPIA 3VGEA 3QV9A 2WMIA 5I6SA 3V16A 9CGTA 1DPMA 3IACA 2ONEA 5AHIA 3NR0A 3URQA 1TE1A 2Y62A 1WX0A 1ONXA 2XVLA 3VTRA 3FVDA 4E8GA 1A0CA 1BSLA 2E28A 4QG6A 3ITXA 4QAIA 1YX1A 3W85A 1UROA 5REQA 1WYIA 2ANUA 1G67A 4S3BA 1OFBA 4HK5A 4M29A 2DT2A 4NI3A 3MHFA 4XUGA 1F6YA 2Y5EA 3PBUA 6CGTA 2DZWA 3OTRA 3UPWA 1ECEA 4DY1A 2YSWA 2BNJA 5BMWA 1XLMA 4DWSA 1A53A 4F79A 1E6PA 5DMYA 3RYSA 5EMYA 4PC8A 3C52A 2CXEA 1JXKA 2IPFA 2XGIA 3CT7A 1JNDA 2CBUA 5FJPA 1M41A 1UC4A 5A2BA 1PS9A 1J0IA 3R43A 5KZDA 3UETA 3LRMA 2WJDA 3BAJA 1BG4A 2QF7A 1LJYA 3W6MA 1KR0A 1Z89A 4ZR8A 3RDKA 2Z27A 1EF2A 1DKWA 1CECA 1IZJA 4K39A 2PDBA 2ZRWA 4QSHA 4CCEA 3AS0A 3U7VA 2Y88A 3GVGA 3HGOA 3ME3A 3QTGA 2PDLA 4NILA 3QZAA 2B7NA 1S2UA 3IVSA 4DLMA 1DIDA 3E0LA 1Z9AA 1R2SA 4O1EA 1PIFA 4MWAA 3N4AA 4WOQA 3AQUA 4JFSA 4GKLA 3EDJA 2W79A 2Q09A 2FLIA 4Y8EA 4TTUA 3BW4A 1GZ1A 5TIMA 4XB3A 4QDWA 1IIGA 4J4KA 1GHSA 3BGGA 3KEHA 4EXQA 1VYPX 2DY3A 4XUYA 3IJLA 1ME8A 2PDPA 4KPLA 4MPQA 4B5WA 3WK2A 4EXBA 5JQ9A 4RL3A 2A6LA 1W2PA 1EQPA 1US3A 4R9OA 3SSZA 1MXDA 4DB7A 5JIWA 3AUJA 4F0KA 5BMXA 3CWOX 4ILSA 2HMCA 4A3RA 2QMJA 3W23A 1FA2A 1W37A 3HFYA 4I8YA 3JRKA 3OGVA 4MDOA 5HQEA 2QQ6A 1O6IA 4GO9A 2A4AA 2Z1XA 1AD1A 2XN0A 3G1FA 4DI8A 1BQGA 2J47A 4AX6A 3PZUA 3AALA 3WEMA 3DECA 3C6CA 3R5EA 3LYEA 1R2TA 2CLIA 1G6CA 3URBA 1TJ2A 1CEOA 3AXKA 3LPPA 4TO8A 5TBOA 3MO4A 4HU4A 3PZOA 5D32A 3G6LA 3QQ0A 1C8XA 1LBLA 1RQHA 1TV8A 2QS8A 5KZEA 4GFIA 1B9BA 4HVXA 4D6EA 1OQFA 3CXOA 3IWPA 3TYUA 1GORA 3TQVA 3QZEA 4JQ2A 1PCWA 4XZMX 2A5HA 3WK3A 4JTEA 1DJXA 1W5NA 4GQBA 3WUGA 3CHDA 7XIMA 5HINA 3ZLFA 2ABBA 5CZKA 2Q3OA 1AW1A 4B2DD 3CUJA 1VKFA 2XFFA 2CLPA 1YPXA 2ZX9A 4F2UA 2ZA3A 1XGZA 4IMCA 1M3UA 4PMZA 4L56A 3NQ2A 5DELA 4FNPA 3BW2A 4GE8A 4L61A 3Q67A 5B7ZA 2ZRZA 1QASA 3EX6A 1FXPA 3TR2A 3N17A 3KOYA 3ARSA 3NQMA 4DNHA 3FYOA 1JR1A 1G1YA 3VDBA 3M46A 3ARXA 4GK8A 1A5NC 5CAHA 2A3AA 2XWDA 3TNOA 4QHRA 2PWEA 3W2JA 4WLCA 4RX0A 1BKSA 1S5MA 1WB0A 4UTIA 4PBGA 3S6OA 4K6AA 1LL4A 4KWUA 1FWJC 3GDLA 4LH8A 3PNZA 2ALDA 3W2NA 3GG8A 1KNWA 1EQCA 1R30A 4H9ZA 1F7BA 3O9NA 1Q8AA 3QR0A 4OUIA 5JIPA 4HN4A 2J24A 3TW6A 3VPLA 5MKGA 3FSTA 3EYPA 3MYOA 1ZAHA 3KBWA 3SCNA 1H41A 1UOZA 3MWAA 3UJRA 1OD0A 3T0TA 5ENLA 3B03A 2I57A 2I56A 3CUGA 2BBFA 5C9WA 3NJ3A 3RXZA 1QI0A 2X16A 5BXSA 4HMDA 1W32A 3W7KA 3DUGA 3XINA 3WIJA 5JH2A 1TA3A 1W5MA 3WJYA 3BVJA 1UQZA 2NVDA 3B8SA 4KWVA 3OZYA 1UR3M 3M7WA 3WLHA 1FDYA 2ZICA 3IJ7A 4AIOA 2J88A 1AH0A 2CEQA 4KT2A 4WHBA 3GVWA 1SZRA 3W22A 1C8QA 3WH6A 4LUJA 3RILA 3ABRA 1JZ5A 3NQ6A 2FKPA 4WKAA 3HF3A 1KBBA 3NXLA 3W1RA 2W9MA 3TQPA 3OG3A 1R5YA 1ICSA 4XZBA 2V9DA 1UKOA 4GX8A 1S2AA 1KLYA 1DIOA 3O7UA 4XK2A 3HB9A 3P60A 3UVAA 2H8ZA 4KCUA 3B9OA 3G1DA 4FR1A 1TQJA 4TVDA 4MKNA 1FHDA 2OWCA 1OYAA 3MT1A 3DERA 1CWYA 2ZADA 5C7HA 4DBDA 2OZ3A 3QOMA 4HNLA 4V1YA 2XSBA 5EA9A 3WMCA 1OF6A 3O2LA 4ICCX 3G1VA 1YE4A 4O1FA 4UUIA 2VGIA 2J74A 3HN3A 3RRXA 2WKJA 3N11A 2VUYA 5DX7A 1MQQA 5G1MA 4AD3A 3GD6A 3PHAA 2OQHA 4I6KA 1A5CA 4FLRA 3U2OA 3WD4A 3M1ZA 2X0YA 3FA3A 1GKQA 6PTDA 2VYOA 4Z17A 4HCLA 3E0WA 4BJHA 1JDEA 4LWWA 5IBXC 1CXLA 4F3HA 3TC7A 3TH6A 3E38A 4UB9A 2WJFA 1XLIA 2YYTA 1RR2A 2RDUA 3GR7A 2IPGA 3FGCB 4FNUA 4PB4A 5I78A 1X98A 1UR2A 3SRDA 1DBTA 4P2VA 1Q6EA 2WVUA 1SU5A 2P50A 1BRLB 3HMJG 4D6JA 3G77A 1RBOB 4IIGA 1JDCA 2PCQA 3WKZA 1FFQA 5DANA 2VRQA 3AHZA 4MADA 3PUEA 3W87A 3R0DA 4FR6A 4IPPA 4M56A 4Y9AA 3CYJA 4AG0A 3VKBA 2PGRA 1SMDA 1OG0A 4GJIA 4PUKA 2XN1A 2IKHA 5A6BA 3OBEA 3TFXA 1PX8A 3PZMA 2JBMA 1E40A 2CBJA 4XKYB 3VIMA 2FDSA 1VRXA 4KFPA 1TX2A 1SO4A 3WFAA 2QXWA 1O7AA 2D2OA 3CHVA 3GG1A 4GZEA 3N2CA 3HIJA 1JZ8A 2PC8A 2GGGA 1YHTA 3E2QA 5FF7A 3AU2A 2GK1B 4RE2A 1U1UA 3KDOA 3A22A 1TE6A 2NSXA 5I23A 3U4AA 1Y8BA 2XIQA 1S3HA 4HJFA 4KW2A 2J7HA 2VT0A 3FIGA 3ITCA 3KBSA 3VI2A 2HK0A 4REQA 1ZFJA 2VI0A 1ZBWA 1P6BA 1GVSA 2D69A 1VEOA 3FHQA 3CV6A 3P8JA 4IG2B 4D72A 3FCPA 1AH3A 3OLIA 3VX0A 3QGVA 1JZ4A 3HG5A 5C54A 1XIDA 3IPWA 3TSBA 5DQPA 2VJXA 5AHNA 3IAQA 4FO4A 2QUUA 5LYRA 4DNMA 3S5ZA 4EPDC 4B5NA 2HS8A 1OX6A 1A50A 2CWNA 2FFIA 4IT1A 1UWUA 4Q6JA 2ZE0A 4HNUA 3WNMA 4C1NA 3GUWA 1RQBA 3MMWA 4JN6A 2WMHA 4GIRA 4XZNX 2VFDA 3RNDA 5A69A 3FYPA 2PLCA 1GPFA 3W70A 4XZHA 4CD6A 2IQTA 3N6JA 4ZENA 3SSJA 5D8WA 1E0WA 1UD4A 3GVVA 4N4QA 1HUVA 3IV8A 4D9PA 3KRBA 1E5NA 3AHVA 1VFLA 1G0CA 3QFEA 1E6NA 3VGHA 5LA0A 1JCNA 3LY0A 2DH3A 3W3OA 3B9AA 1R8LA 3VCCA 3WJXA 3FAWA 2E25A 3BZGA 3NYDA 1QR7A 5IOBA 1QDSA 3TTSA 4OVXA 2PDMA 3P82A 3IGSA 1OX4A 4QEHA 1KA9F 3GDRA 4JIHA 4NAEB 4K7YA 3WQEA 2VHLA 2C18A 1ONRA 3AMLA 4V1XA 3RMEA 1PPIA 3DFQA 5BW6A 3TOPA 3UWUA 2FHFA 5GQBA 3BCJA 4H83A 2VD9A 3WNKA 4UTTC 2QCEA 2PWHA 1L6GA 4LSBA 4C6KA 3VD4A 2NXIA 1K7XA 1OC5A 1ZBCA 4AF0B 1AZ2A 3PZVA 4FLSA 4DVOA 1J6PA 2FYMA 2ZE3A 3UD6A 1FHLA 3PPGA 4AY7A 2VD8A 2VFFA 4MF4A 1U30A 3S2JA 3W82A 2J9ZA 4O1AA 3P3BA 1ITUA 1XG3A 4YYFA 2Q6ZA 2WMJA 4L1XA 4HB7A 1F6PA 1VFMA 4I5XA 3W71A 3M6DA 2IKIA 1E9YB 3DFYA 2E9LA 5CJ5A 3NDYA 4S39A 1R7AA 3GIYA 5AZ0A 3W07A 2GUBA 1KXHA 3L68A 1XD0A 3UVIA 3AISA 4X61A 3WK0A 3MMTA 2YCEA 2WQPA 1BHGA 3VDAA 2Y7GA 4W86A 4EPKA 4R7JA 4UTWA 2G96A 4MDPA 4OJYA 2EF9A 1TJ1A 1K9FA 2X7WA 3A3HA 4YWIA 3TYZA 2D24A 4LBSA 3NXFA 2XYLA 1E6RA 4R3UA 4PN2A 1RXOB 5M3WA 4IQEA 5C5YA 4GABA 4J40A 3S0CA 3C8FA 3T4CA 3GNNA 3EWZA 3R12A 4QM1A 4C6QA 1NDWA 4DIAA 1ESWA 3RM8A 4Q4SA 5CEWA 2QUMA 3AXIA 1JI1A 2O9OA 5D37A 1MXSA 3WY1A 1DTUA 2FZDA 3IIOA 3PULA 1SSDA 1OYBA 2FB3A 2JGYA 4GISA 3ABXA 2Y2WA 1V0NA 3QTPA 4JFWA 3HOJA 3D0CA 4DAFA 1RA5A 3CAKA 3UJSA 1WZAA 1E73M 1JCLA 2Z1BA 2Y5SA 3TQKA 4AIUA 4DJDD 3WQCA 3MZ2A 3NDOA 1K9TA 1NU5A 4TX9A 3RLVA 4U33A 3SRKA 5XIAA 3JUGA 1M03A 3CUFA 1X1OA 2JKPA 2HXTA 4GOAA 3TN6A 1E55A 3H7VA 4AD1A 2PDIA 3NGFA 1A80A 2TYSA 5HNUA 1OABA 1HGWA 1DORA 3M0IA 3QHOA 3ZJKA 1UWRA 3WQOA 1O5XA 1SUXA 2CHRA 4DUVA 2R1PA 1L9WA 4C60A 3G3MA 4A22A 3PPFA 2NX9A 4R88A 3DI0A 5FEXA 1JD7A 2W61A 3ZWTA 4I5UA 1PJ9A 1LG1A 2V5DA 2PCEA 4AISA 3UJ2A 4MB4A 5CZSA 1V6WA 2WANA 3FA4A 4AWEA 3W7CA 2BY1A 1W8SA 1TWIA 2WZHA 3M5YA 4GGBA 4W84A 4PR4A 3HV8A 2GJXA 3KHDA 4YTTA 3W4RA 2DIJA 4GYPC 3O0KA 2E8ZA 3P5YA 3GTNA 5DCBA 4B90A 3ZVHA 3CWHA 2F38A 2FVLA 2I1OA 3MJMA 5D04C 4F0RA 3KDNA 3WMBA 4D8AA 2OXNA 2DSWA 4LY8A 1VB9A 3INPA 1W5QA 2JKEA 3TXVA 3H2NA 1FWHC 3FJLA 4DUWA 4AW7A 4K2SA 4XTIA 1VPQA 4O0ZA 4B2DA 4RXFA 2PF0A 4Y2WA 1XL9A 3HPSA 2PODA 1XIGA 3PG9A 2PRMA 4NJIA 3TXZA 1IZCA 1REQA 3NQEA 4K36A 3M0MA 1PZ2A 4LUSB 3BJFA 4GKTA 3GIPA 3DHFA 3VIIA 3DYMA 1AW2A 3PBGA 4PMJA 3F2DA 3W6LA 3L0GA 5A8QA 3GAKA 3SY5A 1E1CA 4WRHA 9XIMA 4P7LA 4AIBA 2OLAA 3LBOA 8CGTA 4DBSA 2YB4A 4Q8TA 2PS2A 1P0KA 2CLOA 4Y8FA 3PJTA 4X2PA 3WUBA 2EAWA 1FCVA 4CNTA 4AXKA 4C7FA 3VKCA 3PWAA 2G3JA 1SZGA 3VNYA 4TV6A 1IIHA 4A21A 2F84A 3SCRA 3GDMA 3KLKA 5HNRA 2EKCA 4YL2A 2WHKA 3VCNA 4HCHA 5CBIA 4PE8A 1RCXB 4UTLA 1WE5A 1POJA 2ZDSA 4JNYA 4ACZB 3EWWA 4GQQA 3M5VA 1MMFA 4XZIA 5JH1A 5I3GA 2PEVA 1TTQA 3BOXA 5E70A 5GJPA 3VNIA 2INFA 2Q02A 1S46A 3UZJA 1BYCA 1BKHA 1F73A 3W1QA 1GOQA 1W0MA 2X41A 3DYPA 2HRWA 3EPOA 1E4NA 1V3LA 2BVTA 3N15A 2WO5A 3PF3A 1H09A 3I4KA 4L7ZA 3P81A 1JDFA 4HCDA 4JICA 3PZ9A 3PY2A 4JTIA 3NPXA 2ZYFA 3EB4A 3GTFA 3LXAA 4O57A 2XGZA 4S3KA 1OF8A 2ZRUA 4B3ZA 5EPDA 1Q6CA 4HZ6A 4ATWA 4D2JA 2Y6ZA 1DWFM 1TG7A 4KEMA 1TTIA 3D3FA 4W93A 3S2CA 3UYCA 3LLFA 3MJYA 4DYKA 3BSMA 1WDWA 2YBTA 4XAYA 2JEQA 3KWSA 4IPLA 1JCXA 5K7JA 1IQ8A 4PMUA 4UQAA 4QGCA 1H49A 4HNTA 1TZ9A 5KITA 3TWBA 4YN5A 3GDTA 4H6RA 4PCFA 3WQFA 4JQAA 1EDQA 2J79A 3MVTA 4N0RA 1E0TA 3CTTA 4UZSA 4H6EA 4W5UA 1RVKA 4AZHA 4JKLA 4O8RA 3G22A 3OW1A 3D47A 4MOZA 2Y0FA 3PG8A 3WNNA 1P6WA 4GZ7A 3PJXA 4Y9OA 4M6VA 4OTKA 4PTWA 1XIBA 3W81A 1XR2A 4DO7A 4ZCWA 3PUDA 4G6CA 2ISFA 3QPEA 5I3DA 3GAYA 4L4LA 3ZSTA 4KQNA 2ALRA 4HYRA 3CO4A 2NUYA 3KOZA 1EZWA 4GY1A 3WO8A 1R9ZA 5XIMA 1Q6QA 3CMJA 1RP9A 3H23A 4HKPA 1K7FA 3ZVIA 2XIMA 2JEPA 1QHPA 4XO6A 1KQZA 1OFRA 5I3HA 2WPGA 3GNRA 4DJEC 1YTDA 2HROA 3V7PA 1SSGA 2PDUA 3G24A 5BXPA 3TYAA 1QOXA 1CLXA 1KBKA 1A3WA 1UHVA 3LN3A 1YKWA 5DXYA 3S5NA 3MDWA 2J7FA 4AZCA 3TCSA 3EGJA 1U5VA 3TSMA 4QE4A 4I90A 1XLBA 1XW8A 3B4UA 3VKJA 3LHTA 4EAYA 5BRPA 4F0MA 3ZJ8A 2VVNA 2VRKA 3G1AA 4G7FA 4X0VA 1QNPA 5H91A 5FL0A 4LTSA 3UG4A 2XZ9A 2F61A 3MB9A 2YGYA 1DOSA 4AEOA 1ONWA 3NURA 5LNRA 5BRBA 3OYXA 5DRCA 1YXDA 1E70M 2DIEA 1W9XA 3LX9A 3UPMA 1GOIA 4HPHA 1UYQA 1AJ0A 4TVCA 1MNSA 1CX9A 4HZ8A 4CNUA 4XAZA 4OU1A 5D9OA 4FX8A 1DIEA 3LXCA 5FCZA 1M5WA 4CVWA 4GNKB 4YVXA 3VD7A 3M0JA 1UIPA 4R7OA 3UERA 1J4EA 1UQYA 2PLMA 4ZB5A 3T0CA 1R46A 4UR9A 1P1XA 3QRHA 3KBMA 1XFBA 1MUMA 4H7VA 1LWHA 3EOUA 3W26A 1SR9A 1TUFA 3U9IA 1F74A 1EX1A 3NIYA 2FVMA 5DRIA 4JCLA 1R0MA 2NQJA 3HPFA 3Q2DA 1F61A 1NWUA 4O17A 3I7QA 3L2MA 4IXXA 1PVNA 1CGXA 4TXEA 3ZR6A 4FIQA 1UD5A 4Z0SA 3P7YA 1H7WA 1CLVA 3OQEA 3AXXA 3FFSA 2J7BA 3V5CA 3B8VA 3EX2A 2WC4A 4UNIA 4KF1A 3AI0A 4PUNA 7A3HA 1GQNA 4D71A 1DJQA 1VIZA 4K37A 1UWTA 4NP7A 3R25A 2ZXBA 5CSSA 3OVRA 3FJNA 3VFLA 1WDPA 3SRFA 4B5VA 4P61A 1Q6LA 2C6QA 1J0HA 1TZ7A 2C13A 5HUPA 4C5ZA 4W8BA 3N2XA 4M80A 2Y7DA 5A6SA 5A8GA 1XF0A 1VBHA 3JW7A 4NIRA 4O4WA 1QW9A 2XHYA 1YIXA 1BYBA 2XN2A 4Q6XA 2Y7EA 3EOEA 3MMDA 5LA2A 3WSUA 3WLRA 4CQCA 1C93A 3RM4A 3KRUA 4YNGA 5K9CA 3T4WA 1KM3A 1Q85A 3VIGA 3QV6A 5T9BG 3V0SA 1ZAIA 2HBXA 1TQXA 4A8IA 1GQLA 1WQ5A 3B06A 2EG7A 3BTNA 3VM5A 1J11A 3LENA 3ZWSA 3WK1A 4XBJA 4PH6A 4Z2LA 2GDVA 1NY1A 3CYVA 1KWKA 8A3HA 3WQPA 4BS0A 1RHCA 3S2LA 2X2YA 3NNTA 1KFJA 2GSJA 4P8VA 4EF9A 5DMMA 1QNSA 2OPJA 2Y8KA 4HN8A 3S5OA 1KBJA 3UJEA 3V18A 3SO7A 5T26A 4JTUA 3FSUA 2C15A 2V8ZA 2CC0A 2YCIX 1KFEA 3LGEA 1P0EA 1I4NA 4DZAA 5CPMA 1TRDA 2W3ZA 4D6HA 2E5DA 5KEZA 1ZCOA 4LVAA 4YJ5A 4TOQA 4JKMA 1KR1A 4PMXA 1E56A 4LAOA 4PTXA 4MYXA 3H55A 2AL2B 1UBPC 5LNUA 2J4GA 4HHHA 3OU8A 1QPRA 3EWDA 1J9YA 1R3WA 1JF5A 4PODA 4B5TA 1M7JA 3BH4A 1YBQA 5BOOA 2BXZA 2PDGA 1FP8A 5DLCA 2O4MA 3STGA 3RO6A 5ABHA 3VGDA 1Q3NA 3MMUA 4NAFA 4P7NA 3P84A 2PWDA 1F8IA 2CZDA 3SZ8A 5JUVA 2C1IA 1AD4A 1NIUA 1ITCA 5CSYA 2Z7KA 1CXKA 4OZOA 4H2CA 1XHGA 1LQ2A 2F9RA 2CHNA 1ZP3A 3TJXA 1V6YA 3AO0A 1QCWA 3P67A 3II1A 3BAYA 3W00A 1SZEA 1W9PA 3Q37A 3GDKA 4IMDA 3SDOA 1SFJA 2QEZA 4C5YA 2RDTA 4FNQA 3CAQA 3RU8X 3E9AA 3BL3A 3VD3A 2XU2A 2VCCA 3A13A 1H60A 2AAMA 4E2VA 2WM0A 3GK0A 3W9ZA 3WLLA 1VS1A 1MQPA 1QPKA 1WOBA 3K46A 4AMAA 3ISIX 2B4GA 4XKMA 3SFWA 4LB3A 3SN4A 4FNRA 1NP2A 1K3UA 4WDTA 1M01A 4LALA 4FI4A 2VTFA 2VEKA 4DJDA 4ZE4A 3KOWA 3D6NA 4KGJA 3WBWA 3IVTA 3T6CA 4KGLA 4S3DA 4A4AA 1Y0EA 3WF0A 3ZYZA 1V93A 4GACA 1KXTA 3SQSA 1S2CA 4Z1YA 3AIEA 4GD0A 2JQXA 1K70A 1EGMA 2V3GA 2UY5A 2G3NA 1ONEA 1TWZA 3BG5A 1HT6A 5A6KA 3MP4A 4HU8A 5DBUA 2QT3A 5DT7A 2V82A 5D8ZA 2XISA 4PB5A 3NZPA 3I6TA 1G7VA 3QPYA 1V0MA 9XIAA 5EY5A 5HMFA 3ZT6A 3LA4A 3HJEA 1TX0A 1N55A 1FH7A 4H41A 1GYLA 3W7NA 2V67A 3E12A 3PTQA 3DOPA 1EHAA 1UH4A 1PYMA 2R1NA 1W6TA 1JPMA 3SCOA 2I5QA 4E0CA 3WJSA 3QJAA 2PTZA 3H21A 2ZC8A 4HJWA 1XJBA 2DZTA 2AMGA 3QSTA 4B3KA 1EJUC 1ZJBA 2O7SA 2KX9A 1DP0A 1WAWA 3DG6A 4WIWA 4FIRA 2XTKA 4F0HA 4GVFA 3LCXA 4R53A 4N9BA 1RBAA 1VRDA 2YCJA 4HIBA 5CPSA 1EWEA 3FKKA 4WSHA 3TIMA 1OGSA 3W7MA 3R11A 3CAWA 3I3BA 2DT0A 4AVNA 4DHGA 3CZEA 4H9VA 3BLOA 3RLGA 4DBUA 3N2OA 4AHOA 3WBXA 3GUGA 4IP4A 1OADA 3DKJA 2XVPA 1G94A 1TPB1 4N02A 2AGKA 3QN3A 2TAAA 3PBVA 2JIEA 1TV2A 4FOUA 1JG9A 2HVMA 2PE4A 3M7SA 5GNYA 1NVMA 3HTWA 3P14A 1HL9A 2BHZA 1XC4A 1Q4NX 5BROA 1G4SA 2V2HA 1JPDX 2EEXA 5I79A 3ALGA 3NCOA 3EDEA 3N34A 3EWCA 1CB2A 3S1UA 3KUMA 3K4WA 4X60A 3VABA 1D3HA 1TKKA 4P8XA 4WDWA 3W7IA 3R94A 2ZA1A 3W75A 3PZNA 4NJJA 2GGEA 4I7VA 1W9BM 1TV5A 4DZIA 3GR8A 4C1KA 3S3GA 4PRRA 2VEFA 5CG7A 4D1JA 2DQXA 1R7OA 5F2IA 2BWGA 1JF6A 4XD3A 7TAAA 1TV7A 4DX3A 5ABFB 4Z1CA 1OHLA 3QFWA 1TZZA 3LG3A 3I65A 3LTYA 2NQLA 1ICQA 3QOKA 2ZVIA 2VZVA 4PFHA 1C3FA 2PDNA 2CZ5A 1XM3A 3NDZA 3HG2A 4HTBA 4JX6A 5EMKA 4QDPA 1F4AA 4NUWA 4C6PA 2DUZA 1PEZA 2V5LA 5HAOA 1B90A 5D2XA 3B97A 2XIBA 1LLOA 1U1JA 4Q8PA 4WSJA 3RJXA 4O1DA 3C0LA 4BCEA 3CQ0A 2QJGA 2DT1A 4O0KA 2EG8A 5U4NA 4DWSC 1EC8A 1G4TA 2FZ8A 1HO4A 1D7FA 5IFTA 3ARUA 1RJRA 2ZXAA 3GYCA 4C6LA 1PWLA 3R13A 1HN1A 3GNPA 2FPYA 3NUKA 3VGBA 4HA0A 3M0YA 2CZFA 1ODZA 4ZQCA 4YS1A 2WM1A 1RLDA 1JQVA 2P8BA 4PYSA 4W8AA 3MI3A 3IARA 2GJPA 3B8TA 1IEIA 2Y24A 3C61A 4AY1A 3L4WA 3KRZA 3S6DA 3Q4DA 5HMDA 1W56A 1MNZA 3EB3A 3FV9A 4Q4KA 2PWFA 5I03A 2NVAA 3RN6A 3N1AA 3VZXA 3H2AA 4MWAC 3T0AA 3GH5A 3EMZA 4A6GA 1GQKA 1LUCB 2CITA 3LXBA 5BNKA 3E0FA 3CL7A 3NQAA 4KERA 3C2FA 5FL1A 3VKDA 5C71A 3ITOA 2V6AA 3L5MA 5FF4A 3A9IA 4IMFA 1GTHA 4M6PA 3VOFA 4O50A 3TN4A 1ZS2A 2X05A 1P0BA 1DWHM 4Q8MA 2BZNA 3BW3A 3ARTA 4HPXA 1X6UA 4ZOCA 1T99A 4FK9A 4XZLX 4BK9A 1R3VA 4U5KA 5ABTA 3GXPA 1XFCA 5CH9A 1AJZA 3FW6A 1MUCA 1NDYA 2ODOA 4EP8C 1CTNA 1W2VA 2XG9A 1R85A 4W7VA 3MUY1 3NO1A 4K8GA 4CEXC 4US5D 4MLRA 4GQ0A 1MDRA 4KIRA 2XFRA 1SR0A 1J6OA 2OX1A 4GCAA 4NU7A 9RUBA 2GDUA 2PP0A 4YHGA 1Z7AA 3FK4A 4IUGA 1XIIA 1SJAA 1HW6A 3DKLA 4YHEA 1K02A 1ADSA 1DYSA 1EDTA 4LJ3A 1XISA 5LHEA 3P0WA 3KS6A 1UKTA 1GEQA 4UCFA 2EPNA 3LTSA 1MW1A 3QH2A 4DF1A 3T78A 3ES7A 2PDKA 4IGSA 4JAWA 3TMLA 4OUEA 3LQLA 1TJ0A 3TWAA 4I8DA 2BVWA 5EGRA 3A4WA 3TDFA 4JIIX 4GVGA 1XGDA 4H9XA 4M1RA 1E1EA 5LGXA 2ZKMX 3OYZA 2WNQA 3FXGA 3PAJA 3UG8A 3W2LA 3WLJA 2WNZA 3VNKA 1IXPA 1XLFA 1Z44A 4HYWA 5DXXA 4J3WA 3GR4A 2Z24A 4UFJA 1ADDA 2EJ1A 4MFEA 5MHBA 3D46A 3OLGA 3WMLA 1FWSA 4EKJA 6A3HA 4CNPA 4JHOA 1WZMA 1BVNP 3STPA 1GZGA 3VUPA 1DQXA 3KS5A 3BPWA 3UWVA 4QJ5B 2CWXA 5J5DA 3FN9A 3ZLGA 4NF7A 2PZ0A 2V5CA 3CLWA 1J79A 3VKAA 2ZCGA 1K4GA 4I7UA 4H7ZA 1XYCA 2CIPA 2RJHA 2VR5A 2XIJA 2Z2AA 1JFHA 1WV2A 2WBKA 3KAOA 2ZBTA 3RCMA 1F9CA 2ESCA 1J0KA 3A3WA 2QUTA 4OQVA 1F76A 4RK8A 3SW6A 2WK2A 1TCMA 1SFTA 1FXQA 1ME7A 3A21A 3BLPX 2PTYA 4IH3A 5D33A 2VFEA 3LI0A 1XS2A 1T7LA 1CB7B 3LTPA 1XWYA 2WKLA 3L4TA 1B31A 4KETA 2ZQ0A 3CS2A 2QCCA 4XAPA 2OO0A 2CLLA 2PGEA 2OWXA 4DO4A 4HA1A 3PZIA 1M53A 2IMRA 4ZTYA 1WXJA 4LEFA 2Y70A 1TPUA 2YBUA 3GDBA 3LQGA 1W17A 4OV4A 1IZKA 4ZXOA 1JUBA 2FH8A 5IDZA 1IV8A 4F8XA 2NUWA 5GNXA 2YA0A 2E6AA 1QOQA 1KTCA 2H8XA 3GO2A 3GBEA 4PUEA 1E3XA 4ZO9A 1X6NA 2J7GA 3UXDA 3N14A 3U57A 4GUGA 4S3GA 1FOBA 3N9RA 1GVYA 4JEJA 3BDKA 3WH9A 3KX6A 3FGCA 1GOMA 4W7UA 4FAMA 4JDBA 4WF7A 1B2YA 1N8FA 1FTXA 4NZ4A 4B9ZA 4CU6A 3E2SA 1NQ6A 4RNHA 4JY8A 4LXFA 5U7SA 3S9IA 3ID7A 3TYBA 1W1B1 2JF7A 4CLMA 1FHUA 3WQ8A 3C3NA 4BWLC 3H24A 1BRLA 3RX2A 4O18A 2FJUB 4QNEA 5C2XA 4JIEA 3MO7A 3BK0A 3UXAA 1KXVA 1PXGA 5J04A 2VR2A 4J1OA 4U5IA 3LCIA 4H9TA 4MB3A 2DZVA 3V75A 2A7RA 4DWSB 4M6QA 3VZZA 1WUFA 1XDLA 1YW1A 1AVAA 3AZRA 1Y65A 2UWFA 3IS4A 1BGGA 3DFTA 3AMDA 3WQ6A 3QY8A 3BSGA 4OV9A 4WSKA 2D2JA 1KM4A 4ZOEA 3A4JA 5K2ZA 1HIZA 4QNWA 1AODA 3EA1A 4XKYA 1LQAA 4HA3A 3RR4A 1F3TA 4HMNA 3EKZA 1RUSA 1NTHA 1POKA 4LS1A 4UMBA 1OZMA 2G41A 4ORMA 3NZGA 2QCHA 4GC4A 2PLKA 1F6KA 2YJQA 2XM2A 3URNA 4JGDA 2GK1A 4QEEA 2PU1A 3UR8A 3N2TA 5DY2A 4LVBA 2CKSA 2PGWA 3PB0A 1OFAA 3KVJA 3DG3A 3U0HA 3UXLA 4M7TA 2CW6A 3U48A 1L6YA 1OVDA 2I17A 3BURA 3G1XA 4X63A 1CGVA 1KRCC 2TPSA 3R79A 1RD5A 4HHPA 3NSXA 1I60A 4UFLA 1TO3A 4NVTA 2CCRA 1YRRA 2G97A 4L1GA 3IGXA 4IG2A 1I8JA 5AVHA 2WC3A 2VZSA 1SQ7A 3EAUA 3IIPA 3H2CA 3A23A 3J7HA 5A95A 1UG6A 1ZJIA 4G8TA 4KRZA 5C8BB 1V3HA 4IOTA 2VOTA 2VGBA 1H0GA 1JYNA 3XIMA 1NWRA 3W1NA 3N12A 3VMPA 1U33A 1JNEA 3L7RA 2INEA 1W3JA 3FA5A 3NOYA 1G5AA 1Z69A 1O1ZA 4QG9A 1MW0A 3SN1A 4QCEA 5CC5A 1X1ZA 3IK2A 1D9EA 1KXQA 3EXSA 2NXHA 3M0HA 4OOUA 4AZ6A 1NOWA 3H2MA 4CQAA 3S4TA 2HBVA 1X7FA 3I3EA 1TMHA 3RK8A 4Y9PA 3RFAA 3WLKX 1C8YA 1UIOA 1P4CA 3EKLA 3KOXA 1ZAJA 4WGHA 3R89A 4R5EA 2CETA 3LHUA 4P7QA 3QYQA 4S2BA 1EP3A 1TPVA 2VEIA 3BAKA 1K8CA 1SO3A 2NT0A 1GZJA 4L9ZA 2WW5A 2GQ9A 3N19B 2AKZA 3M4HA 3T05A 2X1IA 5C2CA 1XD1A 2QDEA 1V03A 3ZR5A 4DAIA 3MHGA 3QYSA 4UR8A 1PX4A 3C2VA 3UG5A 4MB5A 2VEGA 4LF2A 5J8LA 2G3MA 4AF0A 1JZ6A 3P74A 3WELA 4XD6A 3KP1A 4ZBCA 2PDHA 1JIBA 3WQDA 2OTDA 1BWKA 3MSGA 5AHMA 5I77A 2NX3A 1EPXA 5B7YA 3LV6A 5CJNA 2FZBA 4MAZA 1PZ1A 2CLEA 3THQA 2VZOA 3L65A 4PBEA 1P43A 3LNPA 4GYKA 4DRSA 1W3LA 2WSKA 3LHYA 1FDZA 3UCQA 1G01A 5AYBA 3OQ8A 5C55A 3STFA 1WBJA 1DJZA 4RZ4A 5BWAA 4HTYA 1OSEA 4CUCA 3L0KA 1OK6A 1R38A 4LY4A 4MSSA 3V4BA 4O12A 2Z4GA 3BG3A 3CIVA 3VINA 3SCQA 2AMXA 3CO8A 4LYRA 1N82A 5KTLA 3R8RA 2J66A 1V79A 1W1PA 3W7LA 2YR1A 2HJPA 1YNYA 2AL1A 4HK7A 2VR4A 4C7GA 1UUOA 4GUFA 4RCXA 3SUSA 1V7AA 4PULA 5HWJA 4HPJA 1Q6RA 2VL4A 2WWDA 4M1BA 3K2GA 4IM4A 4CVUA 4H01A 4ASTA 3GXDA 3WQWA 2ZZ5A 4LGXA 3W7PA 1P1MA 1X1NA 1OINA 3CQIA 4W9TA 3FHAA 2QLYA 3N13A 3WH7A 5CCZA 4HNCA 4IPIA 1KW1A 4HT3A 3AYRA 4XZ9A 3AIWA 3VC5A 2QV5A 1WXZA 4O19A 1R86A 2V68A 2OLHA 2OG9A 1E0UA 1HF6A 3RJYA 4X9SA 2Y8VA 3THAA 4UQEA 1GVOA 2RGLA 3H12A 1IEWA 1TVLA 3DH7A 3MKVA 4HPNA 4ZVJA 1PDYA 3O16A 4E2BA 2NXGA 3HPZA 5AHLA 1JPIA 2XVNA 3R8GA 1XYLA 3QXBA 1S5WA 4G1KA 3LV5A 3DC0A 1D3GA 1EJTC 3AAMA 1DXFA 5EB8A 3B9EA 3MBFA 1TTPA 3L2IA 4GI6A 4NZCA 3NYZA 4JTAA 3PPCA 4IZGA 3W7GA 4B5UA 3S9ZA 4JX4A 4UTWC 1L6SA 2X42A 4DO6A 3AOFA 3B8IA 3PUOA 1JZ7A 4PUWA 4A3YA 3LGDA 2Z2UA 4A05A 3CQHA 2Y8UA 1O60A 1TPEA 4IGNA 5C6MA 3AXMA 3PB2A 2P88A 5J5RA 3BMXA 1AJ2A 3IUHA 3E96A 2MNRA 1YPIA 4EX4A 3VNMA 3WEOA 4MPKA 1I75A 2BS9A 3SN0A 4WX2A 4I7WA 2E4TA 5LIXX 1QI2A 3L66A 4LVGA 2HV5A 4PA8A 1G69A 3MANA 3UP8A 2W63A 3H70A 3WQVA 4NZ3A 1M7OA 3M5ZA 2QW5A 4JIQA 2Q71A 1OJXA 4HD5A 4B4FA 2QHAA 3CHCA 1XSIA 5AY7A 1UOKA 2CESA 4CNOA 1UMLA 3GBDA 3ONBA 2A6NA 3WF3A 3EWBX 2DV0A 3KXQA 1VJSA 3LEPA 1FWFC 4DJFD 3OOQA 1C9WA 3W1LA 1W1IE 4JTTA 4LUSA 1UZ1A 5FJOA 4TVUA 1E6XM 3SIMA 4IJCA 5JU6A 1WKFA 1L2QA 3T09A 3WF2A 4O53A 4UFHA 3C8NA 3CZKA 2WCAA 2V3FA 3EMQA 4AU0A 1F3EA 1OCNA 3SCSA 3VOHA 1PTAA 1PIGA 1M04A 2DVXA 4LUIA 4S38A 3W7OA 3GFYA 3WDRA 2HCVA 1YDYA 2WV8A 2CLKA 5G4WA 4W4QA 4GNJA 4MNMA 4FP1A 2C0HA 4L9XA 1SFLA 4QAWA 2ATMA 4GYJA 3H4XA 4AXNA 2ACQA 1UB3A 3UCDA 1PYFA 1M65A 4IFKB 3VM7A 4Z2JA 3NQGA 5H8UA 1XQKA 3ARWA 4ACZA 3ITLA 2R94A 1VJZA 3WENA 3DENA 4L4OA 1H2JA 4GZJA 3QW4B 1WA3A 3AROA 4A35A 3WFZA 1DJNA 1KB3A 1UA3A 2ZUVA 5A8PA 3HO8A 4BF5A 4AD2A 3H8AA 2OQLA 1K6AA 4C91A 4A8LA 4CN1A 1W5PA 3UY7A 3WMSA 4AEEA 2YKKA 4F66A 1HJWA 2O7QA 4UC5A 3PSVA 5FJTA 3GRIA 4H8HA 1OIMA 4IHCA 4KH2A 4HOWA 1IXNA 1KV5A 3BQ6A 3T8LA 1NARA 5D38A 4M19A 3OB8A 4NI8A 1FCQA 3S1XA 2J6VA 2YB1A 3OZMA 4KS0A 3GHSA 5DT5A 3OZOA 1X8FA 4BFAA 3COTA 2WMFA 1OC7A 2EKGA 3W24A 4MGGA 2BXYA 1GQIA 3L21A 1L6WA 5F1UA 1XLHA 3HGSA 3DGBA 5AC5A 4RXGA 1TPH1 1ZUAX 2YL8A 2J13A 3UY8A 3K8MA 1I9CB 4TV5A 2ZUTA 1FDJA 4M81A 5A1AA 5LSMA 4C1LA 4L80A 5KINA 3WLIA 1XX1A 1LOQA 3EDFA 4AIEA 4L1WA 4S3FA 2EG6A 1VHNA 4AC7C 2FHCA 4X3Z