4DI9A

Crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
293
Chain Sequence
LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLKRLVDDAPKDKFLEVAGRLPAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTAWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Catalytic Mechanism of LigI: Insight into the Amidohydrolase Enzymes of cog3618 and Lignin Degradation.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
molecule keywords 2-pyrone-4,6-dicarbaxylate hydrolase
total genus 98
structure length 293
sequence length 293
ec nomenclature ec 3.1.1.57: 2-pyrone-4,6-dicarboxylate lactonase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4di9A00
4LAKA 5HMEA 4CEUC 1V51A 2F6KA 3E0FA 3G77A 4EPDC 1GKPA 2D2GA 2Z2BA 3FEQA 1EJVC 4GK8A 4NP7A 3BE7A 1QW7A 4C6JA 4F0RA 1I0BA 2Z7GA 3WZ0E 2AQVA 2GOKA 2VM8A 3MVIA 3F4DA 1DPMA 1M68A 4KETA 3WMLA 4E3TA 3S2NA 3URBA 4I6KA 4YIWA 1S3TC 3UR5A 3GTXA 3E3HA 4DYKA 2Z4GA 4V1XA 4MUPA 2IMRA 3ORWA 3UPMA 4R88A 3TN6A 4HK6A 4LANA 3OJGA 3QGKC 2W9MA 3GRIA 4IH3A 1A5KC 4RDVA 3A3WA 1A5LC 3IPWA 3TN3A 3UF9A 4CNUA 3K4WA 1EYWA 3RCMA 4HK5A 4KIRA 4C60A 1RJQA 4WHBA 4H9ZA 4J5NA 5FSDC 2Z28A 4IG2B 4J2MA 3IJ6A 1PO9A 3LSBA 4CNSA 2OQLA 4C6PA 4B92A 3GIPA 4DO7A 1KRCC 3FDGA 3S2MA 2O4QA 4J35A 3DCPA 2BGNE 4C6NA 3RYSA 4L6DA 5E5CA 1K6WA 4JOMA 4F0LA 3QY6A 4C6LA 4NI8A 3V7PA 1J6PA 4OFCA 4IFOA 2CZVA 3MDUA 1RK6A 2R1PA 1PSCA 4ERIA 3OOQA 1FWBC 4M51A 1V7AA 2I5GA 4LCQA 4L9XA 4QROA 1FWFC 2YB4A 3GG7A 4D8LA 2R1LA 4LH8A 4DNMA 1V79A 1EF2A 4H9XA 1ADDA 2PGFA 3IV8A 4GY1A 4PCNA 2DVUA 2D2JA 2I9UA 2PUZA 3AU2A 2Z24A 3R0DA 3GTFA 2PLMA 1V4YA 1EJUC 3QY7A 2PGRA 1J6OA 4I6VA 4ZSUA 1ONWA 2ZC1A 4GBDA 1EJWC 3TN5A 4DZIA 4GX8A 1R9YA 4XAZA 4KQNA 4C6MA 1WXZA 2G3FA 2XIOA 1FWIC 4EP8C 4DIAA 5G4HC 3LA4A 1E9YB 5A6TC 4RZBA 2Z27A 2HQAA 1NDYA 2RAGA 3URQA 1NDVA 2VR2A 4H01A 3RHGA 2WJFA 1EZ2A 2R1MA 1KRMA 2VC5A 3MJMA 4CQCA 2UBPC 4H9TA 1R9ZA 4LAOA 1PB0A 4KF1A 2VHLA 1RJRA 2WJEA 3O7UA 3S4TA 1JGMA 3EWDA 3SFWA 4CQDA 3QY8A 3ICJA 4G2DA 4WVXA 4XD5A 3UR2A 1POKA 3MTWA 4C6CA 2P53A 2Z2AA 3MDWA 4GY0A 4CEXC 3E74A 4PE8A 1NDZA 4XD4A 3OODA 4C5YA 4XAYA 3PBMA 4GXWA 4P5UA 2PAJA 2UZ9A 4PCPA 2DVTA 2ANUA 4LCRA 4C65A 4PBFA 1FWHC 1R9XA 5HMFA 2E25A 3C86A 4PBEA 3OVGA 4XD6A 1FWCC 4WGXA 3TNBA 1GKQA 4INFA 3NURA 1V77A 1XGEA 2FTYA 2GWGA 4GC3A 3LGDA 2YXOA 3F2DA 3IARA 1RA0A 1FWEC 1HZYA 1UIPA 4QRNA 1YNYA 4LFYA 1FKXA 4C6OA 5LXXA 1YMYA 4H9UA 1KRAC 4H00A 2Q01A 5AKQA 4C6DA 4B3ZA 4F0SA 2Q09A 4UBPC 4KERA 3PAOA 3QGAC 3E38A 1EJTC 3N2CA 3IRSA 1E9ZB 4IF2A 4TQTA 4EPBC 1FWGC 3LNPA 1M7JA 1O5RA 1RAKA 3JZEA 4HJWA 1VFLA 2HBXA 2AQOA 4LALA 3AUOA 2E1WA 2YZ5A 3GTHA 4G7EA 2GWNA 3LSCA 2D2HA 3GIQA 3LU2A 1I0DA 4C5ZA 3GU9A 1ITQA 3ISIX 3GU1A 4XAFA 3S2JA 4C6EA 2Z29A 1M65A 4GOAA 3DC8A 2Y1HA 3LY0A 2Z25A 3URNA 4DLFA 2WM1A 4IFKB 4GYFA 4ERGA 4CNTA 2OOFA 3T81A 4GZ7A 3D6NA 4IQJA 2EG8A 4C6QA 2R1NA 2VC7A 4XD3A 4DZHA 3AU6A 1QXLA 1P6CA 5FSEC 1A5NC 3PNUA 1IE7C 4BY3A 4HA0A 4DI9A 2R1KA 2O4MA 4KEVA 1P1MA 4QS5A 4ZSTA 4H9MA 2WJDA 4H9YA 4G7EB 1UMLA 2HPIA 4KEUA 1YBQB 1K1DA 1J79A 3GUWA 3PANA 4EPKA 1XWYA 4IG2A 4QTGA 1XRTA 1RK5A 3CJPA 4LCSA 2Z00A 1UBPC 2QPXA 1ONXA 3EGJA 4NG3A 1ITUA 4C6BA 3E0LA 4B91A 2VUNA 1KRBC 4KESA 2GZXA 3IACA 2OB3A 1POJA 3HM7A 4AC7C 4BJHA 3E2VA 3GU2A 1XRFA 1EJSC 3RN6A 1O12A 1FKWA 3ID7A 3MVTA 3IGHX 2FTWA 2A3LA 2EG6A 3B0XA 3EWCA 3NQBA 3CS2A 3MKVA 1RA5A 3F2BA 3PNZA 1BF6A 1A5MC 3S2LA 2Z26A 5HMDA 1NFGA 3A3XA 4KEZA 3URAA 4H9VA 4DI8A 4EPEC 4QS6A 4IGMA 4RE0A 3WYZA 1A4LA 3LGGA 4C6FA 2DVXA 2HPMA 3A4JA 2AMXA 1YRRA 4BKNA 3B40A 2OGJA 3MSRA 3KM8A 1A5OC 1ZZMA 1J5SA 4GY7A 1P6BA 4AQLA 3CAKA 4QSFA 4R85A 4C6IA 2ICSA 2OODA 4ERAA 3F4CA 3DUGA 1EJXC 2QVNA 4IFKA 1FWDC 3K5XA 4RDWA 1FWAC 4R7WA 3FDKA 2P50A 3MPGA 3GTIA 4V1YA 3UBPC 3K2GA 4IFRA 3NEHA 3ITCA 1A4MA 2FVKA 4ICMA 2FVMA 3T8LA 4Z42C 1W1IE 4UB9A 2FFIA 3OU8A 1UIOA 3O0FA 1YBQA 3F2CA 4LEFA 1PTAA 3LS9A 4DLMA 1YIXA 4GX9A 3HPAA 3T1GA 2HBVA 2EG7A 2GSEA 2BB0A 2KAUC 4RDYA 1K70A 2QS8A 2ADAA 5CH9A 1KCXA 4CQBA 4HK7A 1NDWA 2QT3A 1RJPA 4RDZA 3OQEA 4C6KA 4XAGA 3B0YA 1FWJC 3HTWA 1GKRA 4LAMA 3SO7A 2HNHA 3TN4A 1EJRC 4IGNA 1WXYA 2YB1A 4B90A
chains in the Genus database with same CATH superfamily
3H2CA 4UIOA 2ZUTA 1L9WA 1Y0EA 4JKMA 2YDRA 4EWJA 2Z2BA 4GMEA 3C0QA 1F4HA 4Q4QA 1I0BA 1XLFA 3KEHA 2HSAA 2E67A 3KDOA 3WLQA 4AIUA 2AQVA 3CIWA 1DQWA 2UY3A 1ICSA 1E6RA 3F03K 3MP4A 1IEXA 3T44A 3G24A 3S8HA 2OYKA 4E8DA 3ALFA 3LGEA 3SCQA 3TKFA 3UPMA 1WKYA 1HJQA 1LG2A 2DP3A 2J7GA 2FHBA 1A5CA 1BWLA 4AB4A 3WELA 2IW0A 3IJIA 3AYRA 1FFRA 5D9MA 4UOJA 1U5HA 1S2CA 3S5YA 1M6JA 4YYFA 4LY4A 2ISSA 2GGGA 2Y4SA 4NZ5A 1ML1A 1Z69A 2W79A 4HOWA 2V63A 4D6JA 1CTNA 3N9SA 4X3ZA 5D32A 3RGTA 2H3DA 4F0LA 4PTVA 1DQUA 4ZENA 4GIEA 1BPLB 4AU0A 4NJGA 4JTJA 4A3YA 3W71A 3WLMA 2WCAA 4J2PA 2Q8LA 2CITA 1WKEA 4PCNA 4BEUA 4Y9AA 3R25A 4RE4A 5LNRA 4OT7A 4QFUA 2P88A 5HWMA 4W86A 1KM0A 1S5NA 2OU4A 4GX8A 4RV8A 3UJEA 1E0UA 4P8WA 3MUZ1 1TG7A 4ZGYA 1WDQA 4RW3A 1NDYA 3RO8A 2BVYA 1IZCA 3WK3A 2R1MA 3VIGA 1PKNA 1RALA 4HHPA 3O2LA 2W91A 1PB0A 5D2TA 1B0IA 3HO8A 3VUSA 3AZRA 2DIJA 1Z44A 4OUEA 1LQ2A 2PP0A 2FDMA 1OWQA 3WDPP 2ZZ4A 2DZVA 5AB3A 4K7VA 1ZFJA 2XSAA 4M6QA 5AC6A 3EDKA 2HVNA 1SSGA 1I2PA 4ZQCA 4AZCB 3DYOA 3WF4A 5C7HA 1GPFA 4JX4A 1F05A 3ARZA 2ISFA 5HINA 2WMIB 4IMEA 4CU8A 4WJEA 4U10A 4OUIA 2NQLA 3W38A 1XYCA 2YXOA 1KR0A 2Y5EA 8TIMA 1AK5A 2PWHA 2WZHA 3LCIA 1UIPA 4V33A 1TQJA 3QYQA 4ZEPA 4C6OA 3WENA 1SO6A 3EB3A 4O18A 2POTA 3E49A 2PWEA 3TC6A 5G5IA 2VX4A 3B03A 1W37A 4C1LA 1WZMA 3JZUA 1EX1A 1V0MA 1CLKA 3T2PA 1LOQA 3N6QA 5CPLA 4PUEA 3A24A 3L4YA 5CG7A 1FTXA 4YVPA 4KCWA 4OE7A 1QNOA 2OR2A 4Z1AA 5EFFA 3R12A 1CWYA 1LL6A 5DEZA 3SCUA 4R5EA 3DHPA 2FH6A 4QQ3A 7A3HA 2VELA 3ZSTA 5AYXA 3WD2A 3VKAA 3WJYA 3A4XA 4JIHA 3CV6A 4QITA 3IIVA 2G96A 3QF0A 3GQYA 2V2CA 3SRKA 2MNRA 7CGTA 4ML9A 4V2XA 3IVTA 3FSUA 3E2QA 3L67A 3F5JA 1NU5A 1TWZA 3WJXA 1G94A 1WBHA 5JIWA 1JXJA 5HBFA 4QTGA 4XZIA 3NTYA 4Z2HA 2NT1A 2BOFX 3LNMA 1UWTA 3W7OA 3GHUA 1GG0A 2W92A 2QYGA 2HISA 3TROA 2A0NA 2CLPA 1QHPA 4HHHA 1PYFA 4GNKB 3NZ1A 4D71A 3WJSA 1OCJA 1GOXA 2X0HA 5AC4A 1ZJIA 4R7OA 4ZQRA 3RN6A 3PTQA 3S83A 3LEPA 1E9IA 3OYZA 1J0IA 1QK2A 3CYJA 5EMLA 3PTDA 4OHQA 4TTUA 3M0HA 3GZ3A 3WY1A 1XPYA 4WIWA 3AMKA 1ZP3A 3TQ0A 3USBA 3AYTA 3O15A 3H4GA 1MUWA 1NFGA 3AHYA 3LHUA 2GPTA 4LS0A 2BX7A 3FGCA 3AC0A 3L0GA 3A4JA 5DBTA 4M6PA 4DX3A 3VXGA 3VNJA 2A3CA 2BY2A 4GY7A 1B54A 4D2JA 2WQDA 1E4LA 4QLKA 3M0VA 1M04A 3DI1A 4D6IA 3CTTA 4ZE5A 5GJMA 4E8GA 5LIKX 2H8ZA 3DUGA 2XVNA 4QG9A 2F6XA 4CD6A 3ONBA 2OT1A 1UWUA 3MANA 4D1JA 4IT1A 3UBPC 3PUGA 2G41A 3W2JA 4Q8QA 1GPWA 1W1IE 1IEWA 1UIOA 3CYVA 4LBSA 1Y5VA 3N18A 1TMHA 4NYYA 3PB2A 2EG7A 1BQGA 1RV8A 4N0RA 2IQDA 3UJ2A 5GVJA 4MGGA 4AG0A 3UWVA 3DECA 4IL0A 3WNLA 2OWWA 3TJLA 4M1BA 1W1B1 3WK2A 4QM1A 2CXGA 2DW6A 4CQ8A 1XRVA 1XLKA 2BDQA 1SW7A 4DYEA 4JTDA 5M17A 4QE5A 4PC8A 1XLAA 4GGBA 3DDMA 3GHRA 1FX6A 1TPDA 3NL5A 3R0UA 4ADSA 1R5YA 2J78A 5FA5A 1KFBA 1XBZA 1US0A 4Z1CA 2G97A 3VGDA 1B2YA 1FWTA 3E3HA 4PTDA 2E9MA 1C7SA 1H7PA 3N04A 3M47A 3ECQA 4AWSA 5L9FA 1ZU8A 3UZJA 1LDCA 2PA6A 3KRBA 1X39A 1FFQA 1F5ZA 2J9ZA 1VFMA 5EKYA 3A22A 4HSOA 4CNUA 1K8CA 5HK4A 3T0AA 5D9NA 3QH2A 3ANUA 4HK5A 4S3BA 1EDTA 2V5KA 1RJQA 4FB7A 5FSDC 2PE4A 4ACYA 3BLFA 5ABTA 3NGJA 2F9RA 3LSBA 4IIEA 2OQLA 5DF0A 5ABFB 4Y9NA 3K46A 1UKTA 3G18A 1YEYA 1R3WA 1QW8A 2Y8VA 1CLVA 2OG9A 3V7PA 3KBMA 4OFCA 4MTVA 3T40A 3GDRA 2R1PA 3TYZA 1PSCA 1WYIA 4WXZA 4MWAE 1V7AA 4LCQA 2QV5A 1H1ZA 3W27A 1FVPA 2OX4A 4N4QA 5CBJA 4JQ4A 3BARA 3ITXA 4LH8A 4DBWA 3H8AA 4MOZA 2XWEA 1HJSA 5A8NA 2ZCGA 5BCAA 2D23A 4JBRA 3SIMA 3UCQA 1HT6A 2VC6A 3AU2A 2GUBA 4UNLA 2W6RA 4X63A 3DG3A 3SAZA 5BRBA 3WLOA 3GKFA 2VR4A 3I4KA 3OLIA 1E5NA 4I6VA 1UB3A 1DIDA 1J0KA 2ZRVA 3PZUA 1EJWC 4LRTA 3WD4A 1WCGA 4W8AA 2VDIA 2XIOA 3HZ3A 4GUGA 1K4GA 2NWRA 2V5CA 4RZ4A 1WAWA 1QOXA 4S3CA 1KB3A 1W56A 4Q4OA 4C1KA 3S4TA 3EOOA 3EWDA 1CXIA 3B8SA 4XD5A 2BY0A 3H55A 2AQWA 3PPHA 3TFXA 3KBSA 1TVLA 3MMUA 4NQ1A 4GG9A 4GD0A 2PU1A 1OCBA 2Y8UA 1G1YA 3BLPX 4XAYA 4W7WA 1KV8A 1BVWA 2PDGA 1TV2A 4IMCA 4HU4A 4AF0B 4WDXA 2PD5A 4P8UA 4PBEA 4XD6A 3NR0A 2VQUA 2WHKA 4OJYA 2CIPA 3HGOA 5TNVA 4MDPA 2TRSA 2QQ6A 2PDKA 3SW6A 3H4WA 4CCZA 2Q3RA 5C55A 1SFJA 4H6QA 4L65A 5ABEA 5K7JA 2CZDA 2X0SA 4Q4PA 4GQRA 1RA0A 3AYVA 3STCA 5G1MA 1TO3A 4QRNA 3NVDA 3KP1A 2WHMA 5I07A 3PZOA 3LG3A 2Z6IA 3PC0A 3QHNA 4XBJA 3E38A 4HA1A 1BWKA 1EJTC 5FJPA 3AZTA 1W6TA 3NUKA 3GR7A 1M7JA 3QVQA 2HVMA 3VM5A 3QYSA 3ZLFA 1M7XA 3B4YA 3DKLA 4W8BA 2BHUA 4NT0A 1HO1A 2BVDA 3WLNA 1I0DA 3W1XA 3P82A 3WNMA 2X42A 2ASHA 3HPXA 3S6OA 1QNVA 4F2UA 4AAJA 4N02A 4FR1A 2YA1A 5CJNA 1V7YA 1K7FA 1NF0A 5CGTA 2FHCA 2OZ0A 2XIQA 3AUJA 2ZZ5A 1P6CA 3N11A 3VNLA 3NL6A 3GM8A 2ZVIA 1A5NC 4R9OA 3EZ4A 2R1KA 4K2SA 5A2AA 1VFUA 4MDOA 1GVIA 3UXIA 1YBQB 2ZQ0A 6REQB 2C18A 1T0OA 2VZUA 3RCYA 5TAOA 1VJZA 4TVCA 2OYMA 1E56A 2BLEA 3ZZ1A 1Y7VA 4H7VA 2GVLA 3W1LA 3VD5A 2GDVA 2YCIX 5E1QA 3CU2A 2WAGA 2OB3A 1ZBKA 2AKMA 3N34A 3TE9A 2UY2A 2X1UA 5T91A 1FKWA 2FTWA 1FCVA 5FF3A 3FCPA 3E2RA 1H3GA 2CEQA 4K3ZA 2DSWA 3MKVA 1QHZA 2UWFA 3R58A 3EMZA 4JTHA 1R3VA 1VGAA 2RJGA 1A5MC 2GYIA 3S2LA 1DIEA 1UQYA 3WQFA 4YL2A 4HU0A 1XL9A 1JUEA 1DTNA 3UG5A 4QS6A 4IGMA 3W7IA 4NXSA 2DVXA 3H26A 3P14A 1XYAA 3BGJA 2OO6A 1MSSA 3POCA 1N55A 3UXAA 3SQMA 4B5NA 1V6WA 1OF8A 1BYDA 1XIIA 2GQ3A 3AIUA 3BLOA 3EPNA 2CFFA 2CLIA 3E0IA 4J4KA 1P7TA 1YKWA 4BS0A 3ALGA 1W5PA 5LZLA 3KHJA 2OZ3A 5ENLA 3T2OA 2CHOA 1KTBA 3DIPA 1B30A 3AXMA 4HYWA 2YL6A 3EA1A 1DL3A 4H7CA 2V3EA 3W1TA 3HPAA 4Q3MA 1LUCA 1EHAA 2GSEA 3TTOA 3IAPA 1CB2A 3C2RA 2XINA 3WQ6A 4EK7A 4P8VA 4HK7A 4GI4A 3ZYZA 3THCA 2Z2UA 3HN3A 2OZ8A 4U28A 1HKIA 3OHMB 3REQB 1DWJM 2EKCA 4MF4A 3EWWA 3W23A 2VWSA 2PC8A 1YPFA 3L21A 4QX4A 3LPPA 3ARPA 2NSOA 1U1UA 4A2RA 3CV1A 1OC7A 2WVTA 1EJVC 5HNRA 2J79A 3O6CA 4FIQA 8XIAA 5JUVA 3VE7A 5M2FX 5IRPA 1CBGA 4Z2KA 1HJXA 1TPFA 2HDJA 3URBA 3WMLA 4IQEA 1RP9A 4W7VA 4R34A 4HCHA 2Z4GA 4V1XA 1LBLA 4NXKA 3P5YA 3VPLA 5LNUA 1GWJA 1V02E 2E7FA 1TUXA 4GZJA 4IH3A 5AOUA 4L61A 2UV8G 3W7RA 3A3WA 5AN7A 2GGEA 3R8HA 3TN3A 3UVIA 2ZXQA 2PDHA 2OSXA 4GZEA 3U2ZA 4YTRA 3PZMA 1GUVA 1JPMA 2WKLA 3G1HA 1CNVA 3UY8A 3KS6A 5EB8A 4Z08A 3WF3A 4UR8A 4RE3A 1XLLA 1A53A 1JF6A 1U5VA 3R4IA 1KRCC 1AVAA 5HWJA 4C6NA 5DFAA 1XLEA 1FDJA 4MPQA 3ZS4A 4DNHA 3GNXA 1Q6RA 1ZAIA 1LBFA 3LDVA 2D1ZA 3MYPA 1SFLA 2I5GA 3MWAA 4AZ5A 4N9DA 1QUMA 3BWWA 1ZTVA 3VKJA 4YS1A 1FWFC 3CPUA 2YB4A 3R94A 2ATMA 2E8YA 4LEQA 4ZXOA 3TUUA 3IV8A 4NJKA 4GY1A 2XJ7A 2BSLA 3CPRA 1D3HA 4NJIA 4TUFA 2Y7EA 2ZE0A 5D2XA 4NYUA 1O5XA 3W37A 4OZOA 1JZ8A 5HMSA 2CHRA 4NASA 1BYCA 4RXFA 3OGVA 1J2BA 1DYSA 3MYOA 4N9BA 4HKPA 3B9EA 4H8HA 1LRQA 1FHDA 1EDGA 5B80A 1NEYA 3NJ3A 1TTQA 4L4MA 2C1IA 4Z2IA 2J8TA 1ICPA 2X05A 4JTKA 4KF1A 3WL0A 2WMHA 4DUXA 2PSNA 1TQXA 4WVXA 5AC5A 1U22A 4UTIA 2P53A 4K6AA 3UZYA 2V3DA 3VNYA 1ZGDA 2YW4A 1XV8A 1TV5A 4V27A 4WY0F 3T08A 2C71A 4OU1A 1TTIA 1W2PA 3TYAA 5EPDA 4S38A 2R91A 4MADA 1UD4A 4MZYA 4GINA 2V82A 3UPBA 3MUY1 1AD4A 3LXBA 4DJFC 5CC7A 4DO4A 2O7SA 3QRHA 3WKZA 2J62A 2H8XA 2GJRA 2DZTA 4R27A 1TELA 4PR4A 3DFPA 3VCRA 1IWBA 3NL2A 1XRSA 4Y2WA 3SCPA 4O53A 1R2RA 3ABRA 2JE8A 2Q01A 2CC0A 1AQHA 5AKQA 3ES8A 3W1AA 1JCYA 3H2EA 1J4EA 1VIZA 3MHGA 4O17A 4UWMA 1O7AA 3N2CA 4DM2A 1WPCA 4IF2A 2EF9A 2PEVA 1F7BA 1EPXA 2ALRA 3CNYA 1FHUA 1NWSA 1YADA 2UY4A 4NUWA 4N2YA 4GUFA 5AYZA 3ELFA 2D2HA 3WDJA 3L0NA 1JNEA 2EPHA 4M1RA 1A5AA 4NY2A 2Z25A 2WM1A 4O11A 3SCRA 3BMXA 4N4PA 1ZCCA 2PRLA 1DIKA 3B06A 2WMKA 2PRHA 2PTWA 2DZUA 4AZGA 1WE5A 1VEOA 5JBEA 1PEZA 4NX0A 3MP5A 5FJUA 1D7KA 1F9CA 2PDYA 4QCEA 4WOZA 3SQSA 3OVPA 5M03A 3PANA 2X2YA 4GUJA 2XIIA 4ALDA 1R46A 1DJGA 1SSDA 4JIIX 1EXPA 1EXBA 1JJKA 5DMLA 2OOGA 4RX0A 1ME7A 2QPXA 4F0MA 3RX4A 4B5SA 3BLIA 4L6HA 1V3HA 1EEXA 3NFUA 1IXQA 2PBOA 2ZX5A 3KCOA 2ZOXA 4ZB5A 2PZNA 4HHLA 1O12A 2V5JA 2VFEA 3BZGA 4TIMA 3SCNA 2FDSA 3M7WA 4GFIA 1QPQA 3CMGA 1OX6A 4JTEA 5A6LA 3DYPA 5HMDA 3TTQA 1R85A 1VZWA 3URAA 4NX5A 1TX0A 1LORA 3OHIA 3F1QA 3TYEA 4YHEA 4C7DA 1MDRA 6TAAA 3PVFA 1WOAA 4HMEA 3N4AA 3CHFA 3GNNA 4FO4A 5CPSA 1UR3M 3PBVA 3NDOA 2QCLA 3HMCA 3MSDA 4L1GA 3QEZA 1FWAC 3TYBA 1WB0A 4JYEA 1VRDA 1MW3A 1GW9A 1XYMA 3IJ9A 1LF1A 2YLLA 5BXPA 2FVKA 3TOPA 1UPMB 5T9BG 1VH7A 4MB4A 1QI0A 3OU8A 1KO0A 2AAAA 4AMCA 2WVUA 4EAYA 3GC2A 3DERA 4GX9A 4Y8EA 2VGFA 4XBSA 3HF3A 5EYWA 1E6SM 5A6BA 4Q8OA 4ZR8A 3DEQA 3W86A 3ZIZA 4NAFB 1E70M 1GJWA 1ZL1A 3SUSA 1GKRA 1EB3A 5B7ZA 2HROA 4JKKA 1Z7AA 2WHLA 3M6YA 2G37A 3MMDA 1EJRC 4LAKA 3E5BA 1LLWA 5CJ5A 5XIAA 4L4PA 1W31A 5F7UA 1PVNA 3AHXA 3BE7A 3WX7A 2E77A 4U3AA 3ZWTA 5H1WA 4HU3A 4NILA 5SWUA 3BAXA 3BVJA 1Q3NA 5ECUA 1M68A 1W3IA 4GWEA 1U2YA 4I6KA 4ML4A 2ZXBA 3W53A 3WH9A 3MBFA 2ON3A 5XIMA 3ZM8A 1E4IA 2IMRA 3Q94A 4R88A 4ONVA 2WWCA 4MHBA 3QHMA 1IEQA 2XFRA 1HUVA 4XG1A 3SCTA 3VILA 1QOPA 4DB7A 1OIMA 1OFRA 3K4WA 4HNUA 3D3FA 2BV9A 3OA3A 4IG2B 3M4HA 4J2MA 4PBGA 3SY5A 1DXEA 2OYLA 1MQPA 1BEUA 2NW0A 1OIFA 3JW7A 4J35A 4PMNA 4HYRA 3KAOA 3VDGA 3NYZA 2ZXDA 3GBDA 3R5EA 4UTHA 2ZA3A 1CEOA 3NO5A 1LWIA 5K9XA 4UQCA 1N8IA 3PG8A 1E0VA 4CU7A 5I00A 2AAMA 1AZ1A 3SGUA 3TW9A 5KZEA 1OCNA 3ITLA 1C9WA 4J3TA 1AL7A 1ZJHA 4B2DA 3W25A 3V5OA 2PTZA 3LD5A 3EXTA 3V1PA 4ACZA 4D8AA 5I3JA 1JQVA 3BGGA 3SB0A 1Q5MA 2UY5A 1I1XA 3W1NA 2MUCA 1DJXA 4JY9A 3TQKA 1OG6A 5T26A 2FZ9A 2JQXA 4W85A 3B04A 2WVSA 4GYJA 3RK8A 1GJUA 2Z1VA 4HBKA 4GKTA 4JGDA 5T9CE 3W2KA 3IJ8A 2NQZA 4DJDA 4B15A 4ILSA 2BHZA 4FX7A 3MTWA 1XC4A 1V0LA 4GY0A 1JI1A 3TIMA 3QFEA 1IXOA 3VIHA 4MJ2A 1WV2A 4GO9A 3EB4A 3HG5A 4LUTA 3UCCA 1EOMA 3CPGA 1NH6A 4DN1A 5EBUA 2ANUA 2IPGA 4Z0JA 1KGUA 4I8DA 2FPVA 5JU6A 1ZENA 4HA4A 4M80A 3C6CA 2OPJA 2Y7GA 3NURA 2YOCA 1FP8A 3LZ5A 1Q6QA 4A2SA 3WF2A 2GWGA 1QBBA 1I8JA 2C7FA 3GY1A 5F4XA 1LLOA 4PUWA 2NWSA 5C9XA 4LFYA 3A9IA 4HQVA 5DRCA 1KFLA 4DBEA 1JZ5A 3SADA 5LXXA 1FDZA 2PDJA 1CI1A 1FP9A 3V0UA 2D24A 3KTXA 3K13A 4B3ZA 4F0SA 3OB8A 3PAOA 1VFOA 4IP7A 1OEPA 4RK8A 3HBLA 4TQTA 2B7OA 1XYZA 1RAKA 3IK4A 1X7IA 1MEHA 2PFHA 1VFLA 3KP0A 2AQOA 3AUOA 4OTKA 3LM3A 3M0XA 5G4EA 3VGEA 1SO3A 1YXDA 3T7VA 2ZWYA 1RQBA 5BYWA 1VYPX 5JIPA 2ZVRA 3DBPA 2Z29A 3W9ZA 4XZ9A 2EQDA 4U31A 4JYFA 2E40A 2PURA 1VCFA 3BLEA 3QMRA 4BQ2A 1TKKA 3FFSA 4Z17A 3BSHA 4YU1A 2OOFA 3RPTA 1S2VA 4LPCA 4DZHA 1PXGA 4H41A 3WQEA 3O6AA 3TJXA 1RLCL 3CT7A 1DJYA 3FJ4A 1R3YA 3SCOA 3EWXA 4C7FA 3E12A 3P0WA 8RUCA 2XGBA 4DY1A 3M43A 3FNDA 1DHPA 3RMJA 2BP1A 4JS3A 1LT7A 5EGRA 1P0DA 1P0NA 2HPIA 2WSYA 3N14A 1O95A 4LTSA 1DEDA 2QMJA 2WOQA 2JEQA 5KITA 4DUVA 3VNKA 4FIRA 1RK5A 1A0EA 2V3FA 3NNTA 3UNTA 2JK2A 1PBGA 4O0QA 3BXWA 4C6BA 3EOUA 2XVGA 3ARYA 4PMZA 2OKTA 3VMNA 4PMQA 5HATA 5DMNA 2ZE3A 1JYWA 4HYVA 1VBJA 3GVGA 3VGBA 4MWAB 1DE5A 4GVFA 1XSIA 1BXBA 3CUIA 3UP8A 3QOMA 1KM1A 4EWND 2PF0A 4O10A 5MKGA 3K4DA 2QR6A 3SN0A 3CUFA 4I9AA 1PAMA 4GQGA 1PWLA 4IIGA 3BICA 4WY0B 3IEBA 2E09A 4H9VA 3MJYA 4IGHA 1R30A 3R79A 1OJXA 1OM0A 1XD1A 2F38A 3PZ9A 5I3GA 4PMUA 1ME9A 3ZJKA 3VIFA 3K8KA 3A12A 2QDDA 1O6IA 2VTFA 4Q4RA 2HCVA 2POZA 1EQPA 4M19A 2A79A 2PCEA 4O0ZA 3NYDA 2A3BA 3VDCA 3QV9A 3U6WA 1MNZA 1VQTA 2D3LA 2YIHA 4GVGA 3W7HA 3LRLA 1Q6LA 2X41A 3W81A 2FVMA 4Z42C 2F8QA 1J8VA 2PDCA 3HQNA 1KM6A 3QGVA 4R9XA 4JQ1A 2WSPA 3GH4A 4O14A 4B4HA 1QK0A 2CKRA 1X6NA 4JDBA 1ZPTA 3V3WA 4HNVA 1SJBA 1IT7A 2PTYA 1E6XM 1I45A 1F3WA 4WJXA 1BYAA 1GGOA 4PRRA 1H0IA 3KWSA 4J3ZA 1P7TB 2A5HA 4FSAA 3TN4A 1WAUA 1TSIA 1BQCA 2IKJA 3N2TA 4GKLA 5AVHA 1DVJA 3TXVA 3ITYA 1RCOB 2ZZ7A 3G77A 3VE9A 1TTPA 4HHMA 5FJRA 4NP7A 1J2WA 4IPPA 1JL8A 3FW6A 5REQA 1H5VA 1OFAA 2GOKA 1KCLA 1W9BM 1PJ9A 4B5XA 3PWAA 2QGHA 4GH1A 1GK8A 2R94A 3QZ6A 4UMBA 3UG4A 1O1HA 3G8EA 1TV3A 4QDPA 1EBGA 2Y61A 2ZX6A 3DFTA 4IIFA 4RDVA 1XCFA 5CZSA 2GK1A 3DXIA 1NQ6A 1UJQA 4WDWA 5I3KA 2JGQA 3ZOAA 1NP2A 4NRSA 1T41A 4C90A 4XZHA 2J7BA 3V5CA 1G01A 4UTTA 1FCUA 2X16A 3G2GA 1W3KA 3WG6A 4DO7A 1DHKA 2O4QA 3PBGA 3VM7A 1RVKA 3RYSA 3WMCA 1FUYA 1AODA 5CAKA 5KEZA 3DGRA 4PA8A 1XBVA 1D9EA 2VQTA 5A6SA 2P1FA 3OOQA 4HTYA 5CPMA 4GPNA 2EPLX 1BVZA 5DO8A 5JXQA 4GE8A 3KVMA 4M6UA 4QROA 3MV11 3AALA 2VDHA 2QCGA 4NL1A 3VOIA 1JPIA 1SZNA 5DY2A 2DVUA 1TE1A 3PJUA 1IR2A 5A2CA 3R0DA 1VFHA 4HJFA 5J04A 3D47A 3ZLHA 2CLMA 4ATLA 1J6OA 1K4HA 4TVDA 3WF1A 4NSBA 5CLTA 1WXZA 3IJ7A 3OZOA 1OGSA 2GQ8A 4M81A 5A6TC 3OZYA 4MFDA 4X9SA 3U7BA 3W0KA 5LSMA 4AZCA 1WZLA 1QI2A 2QDEA 5AHMA 2QUMA 2XM1A 2VFGA 3DBNA 3O9NA 4AD3A 2UBPC 3CUHA 1IIGA 1JUBA 3FJNA 5C70A 4LUIA 1NIUA 1W5OA 1OABA 3OLEA 3W2UA 3QY8A 3W7NA 1BF2A 3E74A 3ZR6A 1HO4A 2QLYA 2Z1BA 4AZIA 1K7XA 5BZAA 3I3DA 1KBLA 2OJPA 1M9HA 8CGTA 2J75A 4BCEA 3NQ2A 4PCPA 4G5DA 2R9RA 1TJRA 1XH0A 3Q2DA 3VZXA 1EWDA 5BU6A 1UKQA 2YCJA 3DI0A 3UZZA 5D8ZA 3W85A 3HG3A 1DWFM 1ZUAX 2NV9A 3L68A 5D2YA 3MQTA 2QJJA 4AD4A 4Y9PA 1KXHA 4FLOA 1T96A 3VNMA 4HVXA 3LCFA 1KXVA 1YDOA 3W01A 3GE7A 4DRSA 3DHDA 3P74A 4O0KA 3ZT7A 3R7MA 1HZYA 2B7QA 4YVVA 2R82A 1JG9A 4XSLA 1UUMA 2NT0A 2Q3OA 1W8GA 3GFYA 3STEA 4LS2A 5FIPA 1UWQA 1H51A 4UBPC 3BGAA 2OEKA 1R3TA 5A3HA 4B9ZA 1E9ZB 1GQNA 2C19A 4XZNX 1QU4A 3AJ7A 3CQ0A 3PHAA 5I2UA 3U5UA 3W00A 4ENLA 3GIQA 3LU2A 2YBUA 4GQ0A 1V03A 3NSMA 3PJXA 3ABSA 3CBWA 5BXRA 1UR1A 3PS7A 5A94A 4BWLA 8A3HA 4L1XA 3N3TA 1W5NA 2YL5A 4IPJA 3T81A 3WCZA 3R8GA 5DQPA 3EX6A 2DV0A 1HKWA 3HQ1A 3VKBA 1MVYA 1D7FA 9RUBA 4PUNA 1QXLA 1VJIA 1RBAA 4I7UA 1H0GA 1UWAA 5BNKA 1HL8A 3C2FA 4HMDA 1TPH1 2IPFA 1O66A 1QASA 3R1ZA 4PB4A 2YW3A 2Z7KA 4DJDD 4JN8A 1IGWA 3I4EA 4PUJA 4IGSA 4RW5A 1LLZA 1EQCA 3RXZA 2NV2A 5HNNA 3CH0A 3FVMA 1BTCA 1KRBC 5U7SA 2C15A 3KBVA 4PUMA 1KM5A 1ECEA 1Q45A 2NX9A 4IOTA 2A1YA 3HM7A 4DXKA 3NXFA 4NZFA 2QCCA 3GUGA 2QUVA 1H5YA 3G0SA 3S2CA 3GHSA 1XLHA 4Z1BA 3I3BA 3VOHA 2A3EA 3CS2A 1JXKA 3H70A 3OBEA 3IWPA 3NZGA 4KEZA 1XLIA 3WQ5A 4NZ1A 4DF2A 3FA4A 3PSWA 2RJHA 4C6FA 4I9TA 4UTTC 3SDOA 4ZOCA 4BKNA 3BG5A 1PWMA 2E5DA 5GNZA 3KM8A 4Z1YA 2FMNA 1J5SA 3GDMA 5AZ0A 4EE9A 4RZ6A 5I3DA 1I1WA 5CSYA 1W9XA 1BGAA 3JU2A 1ME8A 1YE4A 2PDWA 1ZY9A 1X1OA 3QR1A 1UR2A 4LV9A 3U7VA 3QV6A 3MPGA 4NIRA 3ANYA 1KXQA 3GTIA 4IFRA 1TR1A 3AISA 1P1XA 1GCYA 4LU0A 3T8LA 1KGWA 4RV3A 3ARQA 1IWPA 3FVDA 4WZHA 4D6HA 1PTAA 2QUTA 3TW7A 1YIXA 1W3JA 2GQAA 1W1YA 1RBOB 1W3HA 4FPSA 4QSHA 2H9AB 1TWIA 2PGEA 2FGBA 5HJLA 4XAGA 2INZA 4OVXA 5E6ZA 3W6YA 3GIYA 1PZ3A 4IGNA 1UR9A 5F1VA 3GD6A 5FEWA 2J24A 1EOKA 2F6KA 4AZHA 4US5D 2E5CA 2DU2A 3D46A 3QSRA 2J66A 2OXNA 3HPSA 3GVQA 4HA3A 3FEQA 3GW0A 3KL5A 2PCQA 1IXPA 3GYCA 3I68A 5FEZA 2QCFA 3BW2A 1SPQA 2CNCA 4KGLA 1QWGA 3L23A 1XX1A 1RZMA 2OTDA 3L2MA 4LB3A 1KA9F 1BXCA 3GO2A 5IFPA 3CZEA 1OQFA 1V5XA 2DGAA 3EXRA 4MUPA 3CH9A 1GHSA 3P5ZA 3DC0A 3S3GA 4ZFCA 3EX3A 4IZGA 3G0XA 1IIHA 2ZRXA 5AYIA 3FXYA 1B31A 4U33A 4O15A 2VEKA 4FNSA 4PZVA 4OBSA 3AXXA 2WW5A 3W83A 4O1BA 2VOTA 3MC5A 4PMOA 1QT1A 1X1NA 3WDHA 2Z6JA 3MS8A 1KQYA 1B3XA 3GIPA 2QVHA 3DCPA 4JNZA 1BD0A 4ZO6A 4CKQA 3W07A 1F07A 2WC7A 1XGZA 3NQVA 3ZMRA 3WD1A 3CHEA 2XH7A 1Q8AA 2ZKMX 4L9XA 3NPWA 2DSVA 3W6MA 1E1FA 5K9DA 3RJYA 1VEPA 2ZADA 3PBYA 4TMBA 1JNDA 2DZXA 1AW2A 3QJAA 4DUOA 1XI3A 4DJEC 2HNEA 1Z8AA 4JHMA 3C5QA 2JBMA 3LBMA 2A85A 1V4YA 5FAJA 3FJ6A 1GTHA 3HPZA 4TU1A 4BQ3A 2W0UA 1GVRA 1XISA 3TN5A 4EACA 1DJQA 2I14A 1KXTA 1CXFA 1HW6A 3NQ6A 4DIAA 4JIPA 1DXFA 5FACA 4E4UA 1WDWA 1KM2A 1EPVA 4ZB0A 4N9EA 1CGVA 5FEPA 1S2TA 4Q6XA 1Z32X 1OK4A 4CQDA 1IHIA 3FXGA 3BOLA 4B3KA 5FJIA 3ANVA 1UZDA 1BSLA 1V6TA 1E15A 2FGLA 1NWRA 1GTEA 4PBFA 4A21A 4ZODA 3UU0A 3V16A 4MB3A 3FLUA 3WQ4A 4XV0A 3WF0A 3A4WA 3U2OA 1U83A 3LGDA 4KWSA 1TA3B 3AXKA 3PZTA 5D2WA 4JIRA 3W88A 1ZBCA 3N6HA 4LBUA 1C8YA 1JULA 3MSYA 4MUZA 1HTIA 4NF7A 1HP4A 1TWDA 3LV6A 4CVWA 1SW3A 3N2BA 3TJIA 4IXXA 4H6EA 1ITCA 2C8NA 2OLAA 3KXQA 3LNPA 2XSXA 5D30A 3RX2A 3JZEA 4CQ9A 5CZ0A 3H2NA 2HS6A 3QKZA 1S1PA 3OGRA 3LSCA 4NU7A 3ZLGA 2VCCA 1SJCA 1DXIA 4EOUA 2Y1HA 4AY1A 3MKCA 2YPIA 3W2LA 4ERGA 3SR7A 1W54A 3ZT6A 1H60A 3EWZA 2VNCA 3P6LA 3M16A 5M1TA 3UWZA 2YFNA 3TV8A 1QR7A 1C9DA 2V69A 3PNUA 3SI9A 5LGXA 2VVNA 1KFKA 4KEVA 2P3ZA 2RDXA 4IWWA 4U5KA 2QW5A 1QRQA 3PG9A 3RO6A 1OYBA 1EA0A 3EOSA 3KTSA 3WBEA 1K1DA 1VHCA 2A6NA 4HU8A 1T5AA 1Q6GA 2V30A 7PTDA 3G1SA 4MWAD 2PU0A 2ZDRA 4DQWA 3EGJA 4NG3A 1AH3A 3BW3A 1OC5A 2QEZA 4MFEA 4KIEA 3PULA 3PAJA 3DG6A 4PGLA 2X09A 4AWTA 2JIEA 1RD5A 1Y8BA 1OD0A 3NQ8A 1G7VA 5H6HA 1W1VA 2O9PA 5D4YA 2BVTA 4X9YA 1LJYA 1H1NA 1FCQA 2PZ0A 3HV8A 3VIOA 3LBCA 1JD9A 4FMVA 3AAMA 1REQB 3INPA 4ADUA 4JZ5A 1AUSL 1R8LA 3BAJA 1OZQA 2GJXB 2HPMA 3MZ2A 1G67A 1VCGA 4U3CA 1LOLA 2OGJA 1JDEA 3VC6A 4MB1A 4JQ3A 4X60A 4AZ6A 3J7HA 1C93A 3G1AA 1WDRA 4F4RA 4WR3A 1AMYA 2WLZA 1JCXA 3CZLA 4MAZA 2VZTA 2G3IA 3BDKA 2E6DA 1IEIA 3M5VA 3K2GA 4AFYA 6ENLA 4RUBA 1KM4A 2QKFA 3EDJA 2FFIA 3OGSA 4PB5A 3U3HA 1E6PA 3S1WA 1L6FA 3HPFA 1XG4A 5GPRA 3LHVA 3PPGA 2TYSA 3MSGA 1UKOA 4MJMA 1RJPA 1SW0A 2QCDB 4HGXA 4Q7BA 1DJIA 3OA5A 3UXKA 1H4PA 2DZSA 3LI0A 1JDFA 2V2DA 2NSXA 5IHSA 2PTDA 1UG6A 3AIVA 3QOKA 3ZFHA 3CWHA 4J3XA 2JIWA 4IUGA 2ZRZA 4TTGA 4H4IA 5K2ZA 2A4AA 3RITA 3STFA 3IJDA 2I56A 1HKKA 1BFNA 4M56A 2PDQA 3B9DA 1IT8A 3GDLA 2EPMX 3DG7A 4FR6A 3WZ0E 3VKDA 3EOLA 4XO7A 1DJNA 3M0MA 3VNDA 5D38A 1DPMA 2ZUVA 2J8GA 2X1TA 2Z1WA 2XN0A 4E3TA 4YIWA 3EDDA 4F8XA 3M0IA 4PMYA 3ARWA 4UZSA 3T55A 1NSJA 2YBVA 3HQPA 1VC4A 3A64A 3WMBA 4W5UA 4UOQA 2E5BA 2W3ZA 4GH3A 2Z0IA 5E9AA 1PDYA 2EPKX 4DWSD 1HP5A 2ATSA 4ICNA 4C60A 4MY9A 4QCFA 5I23A 5U4NA 3VDAA 5C9ZA 1PO9A 1ZJBA 1G9HA 2NQ5A 3A9BA 4PTXA 4HMCA 1MDLA 2DJXA 3TYUA 3LCLA 3VMPA 3RMEA 3SRDA 4IFOA 2CZVA 2NXHA 2INEA 3VIIA 5I03A 2J6VA 3D5HA 1H61A 2V5DA 1DWIM 1QMLA 2W63A 3VNZA 1WDDA 5LXEA 2G0WA 3AXIA 2GLKA 4A8RA 4AH7A 3ERPA 2X0YA 4NNBA 2QUUA 3PR2A 2Y5SA 2D2JA 4U5IA 4K38A 1DORA 5K9CA 3CMJA 4S23A 3NQAA 3CUXA 4QJ4B 3WK1A 1TB3A 3CZ8A 4FXFA 4HTBA 4KS0A 3M0KA 3F5KA 2VEGA 1VB9A 5A8QA 3G0UA 3Q65A 1FDYA 4JDYA 3RU6A 4U2YA 1R9YA 3U2CA 4QJ1A 1L8PA 3TWAA 4UTWA 1L6WA 1CDGA 3QTPA 1PX4A 2RAGA 4AYGA 2DQXA 2WCGA 3PJTA 4P7NA 1RJRA 3H7VA 4AZ7A 1TPWA 4ZO9A 1P0KA 1XR2A 3WFLA 4K36A 3IGSA 1KW1A 4YMZA 4OIFA 2Y70A 2XVPA 4CCDA 3CWNA 3U8GA 1R9XA 1A49A 1SJDA 3SY8A 2Z1SA 3IUHA 2OVLA 3KHDA 4MYAA 2OSWA 1CZ1A 2C1HA 1RD6A 2CLOA 2OWCA 1XH1A 2A7RA 1LTDA 1CLXA 1XM3A 1XGEA 1XYBA 1O60A 3WLRA 3LCXA 2PTXA 3OG2A 2R8WA 1VCVA 3ARRA 5I06A 1XW8A 2HZGA 3GR8A 3UJRA 1TREA 1ENUA 1HVXA 4PH6A 4CNOA 4H00A 2F2HA 4O1FA 4BZYA 3T09A 4O28A 3FKRA 4GCXA 1VPXA 3S9IA 1I9CB 1JVNA 2EKGA 1O5RA 1EEPA 3GH5A 3W29A 3ARUA 4M5PA 1W0MA 4HZ7A 4XZBA 3UD6A 4FNQA 4MKSA 3W1MA 4JTQA 1V6VA 1V8EA 1M65A 2BOEX 2ZRUA 2D0FA 4IFKB 4WSJA 3V4BA 2HE5A 4O4VA 2JEPA 2XVKA 4IQJA 2EG8A 2VC7A 4DAIA 4DF1A 2XFFA 2EJAA 3GH7A 2VD8A 3BCDA 4B5WA 4DI9A 3THUA 1EH9A 2A6LA 4WKFA 3WDIA 3QQ1A 5LYRA 4HSNA 4PEEA 3UA4A 1J79A 1G6CA 2VT0A 5H91A 2CBJA 1OINA 3DX5A 4XIAA 1W91A 3EBVA 1CXLA 3VYLA 3QC3A 2E9BA 1XLJA 4LOCA 3NCOA 1I75A 1ITUA 4XVDA 4KESA 2GZXA 3SBFA 4Q4MA 2TODA 3FHQA 1F8MA 2FZMA 4K37A 1G69A 5HPOA 3PY2A 5EA9A 2X2GA 4GBUA 1MWOA 1KQZA 3ID7A 1MW0A 2WK2A 2GSJA 4GCAA 3PPFA 2PDMA 1XKYA 3Q4DA 4DM1A 4O13A 2VZOA 1TPUA 3QQWA 3F2BA 3DHFA 1OB0A 1J9YA 3MZNA 4Y6GA 4IICA 1Q85A 1QNSA 2V5BA 1H7NA 3SCSA 1U5JA 4AIOA 4HMNA 2BHYA 4Y8FA 2PD9A 4WCJA 3HG4A 1P0EA 2HJPA 3LBOA 1T40A 1CGXA 3WFAA 1TRDA 4UZUA 4HNTA 2NUWA 3OZPA 3W1UA 2QVNA 5HULA 1XCXA 3CL7A 3FDKA 3N1AA 4XVEA 1ZS2A 4W93A 2Q8XA 3W1QA 5J5DA 4WGHA 4J28A 3O06A 4ZOEA 1B9BA 4S3GA 4K68A 3POHA 3VZZA 4I5RA 4LEFA 5AHNA 1NELA 1GG1A 3CEPA 2PDUA 4QEEA 2QS8A 1UBSA 3TCSA 2ADAA 1TYGA 1K8YA 4CQBA 1NWTA 3AHTA 1TPC1 4L56A 3LI1A 4PB3A 3QV8A 4O19A 4LAMA 3PBUA 3VI2A 3MUCA 2DSZA 2OEJA 3D3AA 4CN6A 3H12A 4A8NA 3CEUA 1LQ0A 1UD3A 5HMEA 4XTIA 2VD9A 4XUGA 2DQWA 4E8CA 4FOJA 2CWNA 4D9PA 3EYPA 4EPDC 4I7WA 4BF7A 3MWCA 3AWNA 1OX5A 5CJMA 1I2NA 2QGYA 3BW4A 1K77A 4W4QA 5LNSA 3VC5A 3W7JA 1DTUA 3GDTA 4UTLA 3OW1A 1HQTA 2WYSA 3UR5A 5LIWX 3O05A 5KZDA 3SUWA 3WNOA 3RLGA 1TIWA 2CLKA 1H50A 3G3DA 4KGJA 3AMGA 4NZ3A 4MKNA 1F2JA 1GQKA 5TF0A 2VI0A 5I09A 1A5LC 3UF9A 2IQTA 2PI6A 3S1UA 3N25A 1PX3A 1PKLA 2BG5A 4LC6A 3THDA 2V9DA 5DN1A 3M0JA 1OFOA 3DAQA 1R0MA 1RQHA 2BWGA 6XIMA 2CLLA 3WK0A 4AWUA 5CC3A 3DN5A 2ZX9A 2J6XA 1X7FA 1VYSX 4JOMA 3HJEA 5HUPA 4C6LA 4NI8A 4XWUA 5F2MA 3RPDA 3B4UA 3EA2A 4DPPA 3BOXA 3Q58A 3F4NA 2YSWA 4JNYA 2DT2A 3GNDA 3HQOA 4AD5A 3R2GA 3THAA 4E4PA 1XSKA 3TSDA 3D0CA 1V79A 1CGTA 1LWJA 1JDDA 1ADDA 4YYCA 3GG0A 2H9AA 2G3JA 1KKRA 2WV8A 3VFLA 2C0HA 2EJ1A 3E6EA 3ABQA 4RPPA 3R89A 1IXNA 2J7CA 2CHNA 3APTA 1OY0A 3PWIA 2C91A 1FH8A 2ZC1A 1E5JA 1LYXA 5GJPA 3NQFA 3WD0A 1FWWA 1JYVA 1ISYA 4XZLX 2BXYA 3GAKA 1PZ0A 2CWXA 5LA0A 1B5TA 2VUYA 2HQAA 3WO8A 2BASA 3GDKA 3O07A 4AWEA 2QMKA 3KW3A 4A4AA 3MU7A 5M5DA 4PSRA 1JGMA 3AZSA 2VDGA 3RUBL 3GK0A 2GK1B 5H2ZA 2GUYA 3T42A 3BURA 2Z2AA 3MDWA 3CHCA 2J74A 4M3PA 2DZWA 3CQIA 3DFSA 5KTLA 3OVQA 1X96A 5CLWA 4RCXA 1GEHA 2X7VA 1B90A 3WEZA 4UQ9A 3NQ7A 1IEVA 4Q8TA 4Z0SA 5HMFA 5C7VA 2VKZG 1GT8A 2WZEA 3PTMA 2Q02A 1K03A 3MO7A 3C0LA 4ZTXA 3W74A 1BG9A 1P6WA 1NOUA 3W2MA 3N4FA 4GVHA 3MHFA 3P8IA 2VFDA 2ZTKA 4H8NA 1DV7A 3GXFA 4A3UA 4KKXA 3I65A 1T99A 1E3ZA 4R7JA 1G4SA 3PUEA 1E1EA 4BK9A 4C6DA 1PIIA 1PV8A 1T7LA 4JYDA 5A8MA 1VPYA 2VJXA 4L1WA 3AIRA 1QFEA 5IM51 1JIBA 1JD7A 3E2SA 1CGWA 1VFSA 1ZBWA 1B4KA 2Q71A 4ZQMA 3VDHA 4HJWA 2HBXA 3STGA 4LF2A 3WH6A 2A2IA 4IIDA 4FK9A 3VD7A 3KBNA 3LRKA 1ZAJA 6PTDA 1JEZA 2XFYA 4DJFA 4DJEA 3M0ZA 2Y88A 3U5YA 2XDFA 4GZ7A 5TQLA 3TYCA 1H1YA 3DFNA 4KW2A 2EXOA 1FWRA 4K1GA 3XINA 2X1SA 4O16A 3WL1A 4QXIA 4BY3A 1XFBA 2GSHA 1B9ZA 4PCTA 2QXWA 4IJRA 1P1MA 4QS5A 4ZSTA 3H7UA 4G7EB 4KH2A 1GONA 3C2OA 4NZJA 1K3UA 3GUWA 5CXPA 3FA3A 3RR1A 1A0CA 1K9FA 1S39A 3CK5A 2VFHA 4Y90A 4B9YA 1EA9C 5IFTA 4LNYA 5CC6A 9XIAA 1UP2A 2P8BA 4RXGA 4NHVA 2PMQA 4CN4A 1POJA 3DFYA 4BJHA 3IIOA 3TXZA 1ISZA 3FK4A 5HPCA 3PZNA 3BQ6A 1ISXA 2WO5A 3EWCA 1ZBVA 1SQ7A 2NZLA 1OG0A 3FIGA 4GI9A 2I5QA 3V18A 3WLHA 1OX4B 1XBYA 5J5RA 1U30A 4CU6A 3LN3A 3OEXA 4UMCA 2WNWA 1UROA 2Z26A 3TC7A 5AYYA 7TAAA 1XC6A 5F2LA 5D2VA 4Z2GA 3ZJ7A 4YWSA 3OIXA 2H3BA 1YPXA 1EZWA 1W2VA 1RCQA 1YRRA 1GOMA 3VFCA 3SJ3A 5BOOA 3H6OA 2YXGA 5A8OA 1O5KA 3WQCA 2ICSA 4A29A 3G1XA 1OYCA 1W5QA 3REQA 2ZZ6A 3K5XA 2WPBA 4LRSA 3BC9A 5AVNA 3U9IA 2WSQA 3ITCA 1JZ3A 4L7ZA 2PB1A 5D09A 3UY7A 3UCDA 4OOUA 3TQVA 4QLJA 3L4ZA 4ZA0A 2XFWA 4WQ6A 4F66A 1WOBA 3K30A 1GOOA 3QTGA 3O0FA 5CKSA 4M8UA 3IIZA 2B4GA 2NUXA 4P7OA 2OKOA 2RFGA 2CERA 3XISA 1VBUA 3VU2A 1OSEA 4HOXA 2VRJA 3TVAA 1Z89A 1GOQA 2TPSA 3SO7A 2HRWA 3APYA 3PBWA 1YTDA 1ALDA 1WXYA 2QJGA 3NEVA 4LS1A 1OADA 4N9CA 1NVMA 3N29A 5F4WA 1J0YA 2PWDA 1VYRA 3CUGA 2FZDA 2VEIA 4HNCA 4TXEA 4GK8A 1QW7A 2VC9A 5FJTA 2Z7GA 3C52A 1VAHA 4JTGA 3WLIA 1RR2A 1U1HA 3MP3A 1FH9A 4GUIA 4PRTA 5I3HA 4H19A 3OJGA 3QGKC 3WLTA 1THFD 3EXSA 3V0TA 2OLHA 3IPWA 4XAPA 3ARVA 1VHNA 4Q8MA 1Q66A 1MMFA 4EANA 1D2KA 4BR1A 4WHBA 2PLJA 1WX0A 2Z28A 3TR9A 2DDXA 4HZ6A 4JXCA 1UD8A 2V2HA 3B8TA 4S3JA 3ZT5A 1K6WA 4FF5A 3TH6A 4JTCA 4C91A 3QY6A 1YQ2A 2IPWA 2E4TA 4YTSA 2J13A 1EIXA 1J93A 1XLCA 4WRHA 5EMKA 2OO0A 1VF8A 5J8LA 4IQLA 2ZC8A 2H90A 1E6ZA 4HN8A 5JMUA 4XIMA 4GYPC 2YJQA 1EKOA 4YVXA 4UXDA 3VD9A 3W7EA 3F5LA 2ZBTA 3MUXA 3P67A 1K8XA 1XFCA 3NQCA 1LROA 3EA3A 1YNPA 2DUXA 1D3GA 4I5UA 5FD0A 5HJYA 1ONWA 7REQA 3OZMA 1M53A 3R0KA 2EPNA 2VVSA 1FWIC 4EP8C 1S2WA 3TTSA 4PFMA 2PDNA 3P62A 4IPNB 2ZIDA 4H01A 3CL6A 2AOSA 1VIWA 2DZBA 3LYEA 1T6MA 4TV6A 3E0VA 3W28A 4H8UA 3UR2A 1S5TA 5BWFA 3IVSA 4PE8A 3TEVA 3I7SA 4QDMA 4CGTA 2PLKA 4JTFA 3R8RA 2PAJA 1HG3A 3FEMA 3OVRA 4HPJA 2P0OA 1E71M 2OQYA 3C86A 3OVGA 2BGSA 4LVDA 4CQAA 4AIEA 3TNBA 2PDLA 2D20A 3OO2A 4IMGA 3L2IA 2FTYA 4ROQA 1M03A 4E2OA 1ECQA 3T07A 3B9AA 1VFTA 1B1YA 2QIWA 3APGA 4I9JA 1VBHA 3WUGA 4QJ5B 5D37A 5M3WA 4KFPA 2YDQA 4B2DD 2XUCA 4NJHA 3G1RA 1EJ7L 3HIJA 1W17A 2BVWA 3LENA 3FGCB 4EPBC 1PX8A 3NWRA 2PPGA 4LAUA 4WY0A 4D72A 4JY8A 2E1WA 1VPQA 5FCZA 3AMCA 1M7PA 1WO2A 3THQA 3GU9A 1QNPA 1KD0A 1Q65A 2V68A 2AGKA 2WSKA 5GJNA 3ONCA 1BRLB 4GLEA 1Z9AA 4OBRA 4DXVA 4GYFA 4LT9A 3AXHA 1XICA 3NL3A 4C6QA 2E6FA 4HIBA 3B0UX 2VX6A 3AS1A 1E9LA 2WNZA 4MWAC 3CB8A 5JBFA 1XIMA 3QLLA 2YCLA 4OWGA 1JRBA 3IUIA 3KUMA 3K4AA 4IX2A 1QVBA 3N17A 2Z1XA 2IPJA 5BROA 4PSPA 3VD4A 3N3MA 4PODA 5C2GA 4GJJA 3RFAA 3IAQA 2DEPA 3B3DA 3VKCA 2RGLA 1XXXA 4E5TA 2NVAA 3JR2A 4HP5A 1XRTA 3CJPA 3B9NA 2PDXA 3QSTA 3AFBA 3BSGA 3GXTA 4B91A 4XX6A 1TWSA 1JCLA 3TP4A 2IKGA 3SUUA 1XRFA 4M7SA 3NOYA 4ATDA 2FB2A 3CAVA 3GTNA 3U0HA 3ATYA 2V3GA 4LVFA 1K9EA 1LZOA 4P8XA 1K9TA 3FX4A 3DU0A 3LMZA 1BF6A 5CZTA 2DH2A 1V3IA 3N12A 3GFXA 4FNTA 4Q33A 2DUAA 3RM9A 1A4LA 3GVRA 1S5WA 3VDBA 5A8PA 2WVVA 4H3DA 3MSRA 4MVAA 5TIMA 1A5OC 2JF7A 3T6CA 2KZHA 5C9WA 4UFLA 4FHAA 1IF2A 4NAFA 2E6AA 4IFKA 2Y63A 3QMSA 1KLYA 1TPVA 1FOBA 4V1YA 1ODUA 4ASTA 5JH2A 4BI5A 2VMFA 1J0ZA 4JFSA 1A3HA 1JDAA 2E3ZA 4IX0A 1EP3A 2ZRWA 4RDYA 1EP1A 1K70A 3C4UA 4JX6A 4XQ6A 3ARTA 5A8GA 4EAMA 3GVVA 2CZFA 4AMAA 1G4PA 1BKSA 4XUYA 4E3VA 3AIQA 5FKYA 3NM1A 2VEPA 2J25A 5EMMA 2VZSA 1NFBA 4UOZA 1W9DM 1GOKA 4UUIA 4UNIA 4X2RA 2D0GA 2RGMA 3QPYA 2XVLA 5HAOA 2ISVA 4MNLA 3EPOA 3PZQA 3F4DA 3CO8A 3S2NA 3N19B 3HGSA 3LX9A 2XZ9A 1HL9A 3VIKA 1HJUA 1BLIA 3PPCA 1A5BA 2QCNA 5HOSA 3CAWA 2W5FA 3LV5A 4JL2A 2QAFA 3CLMA 3L9CA 4LUTB 3BJSA 3CL8A 4NVTA 1OBAA 1TX2A 2YL9A 2X1RA 4H9ZA 1PDZA 4YTTA 5BOFA 4Y9OA 3TCEA 5CSUA 1HKJA 4L9YA 1AMKA 7REQB 1NOWA 4HPNA 1UZ1A 3SGGA 3LK6A 3S2MA 3WUFA 1VJSA 4GYKA 1JYXA 1TJ2A 4ICCX 2YL8A 3EKGA 4P7RA 1J11A 3W1RA 1S5MA 3PF3A 3SY1A 4E6MA 2GQ9A 1DE6A 4M6VA 4D8LA 1TMQA 2E6YA 3BJTA 3CZKA 1MNSA 4X22A 1MEIA 1JAEA 1MXSA 5F4SA 2DW7A 3SRHA 1XJBA 3BOFA 2HEJA 5IDIA 3IGXA 1SZFA 2ZXAA 2FPYA 1JF5A 4QE4A 4PMDA 1R2SA 5GNYA 3WBXA 3GXDA 3CT2A 2Y24A 1PS9A 3L4XA 3QY7A 4S39A 2YYTA 2R6OA 3SRFA 4NNCA 1F3EA 3KS5A 2VRKA 3BMVA 3V36A 1F4AA 2WQPA 3KRSA 4OGZA 4GVIA 3ENLA 4URIA 3XIMA 3URQA 4GHRA 1EZ2A 3H4XA 1ZP4A 3KRZA 3MJMA 2I16A 1R9ZA 2WJEA 4H8VA 3SFWA 2XISA 4JTIA 1DKWA 4E38A 3H22A 2QF7A 4C5YA 1AQMA 3ME3A 4QLLA 4P5UA 1TJ0A 3V5FA 3LM7A 1MUCA 1SO4A 2Y6ZA 4JR5A 3GHTA 2FFCA 4HPXA 4LCRA 2BTMA 3OP2A 2WMGA 1ZNNA 2E25A 4YWIA 5AHIA 1B3YA 5DLCA 3TR2A 1S2UA 1R3SA 1OCQA 1FWCC 1VLIA 1GKQA 5GQBA 3C61A 1V77A 1OC6A 5H8MA 4AD1A 3GFZA 3GX9A 3UWUA 1EC9A 1EL3A 3AIEA 1GEQA 5FEXA 1EBHA 4D8ZA 3I3EA 2WWDA 1FKXA 3MCMA 1E1CB 1SZRA 4ZB2A 3BCFA 4JIEA 2Q09A 4JQ2A 3CASA 3L12A 4H2CA 2VFFA 1GJPA 4XISA 5KMYA 3DYMA 3PM6A 1IYXA 6ALDA 1UOKA 1XD0A 4Q7IA 3CO4A 4QAWA 1Q6OA 5DMMA 2GWNA 1CENA 3CQHA 3DOPA 3ZVHA 4D6CA 3SURA 1HVQA 3RRAA 4KWWA 1O94A 3DC8A 5CAHA 1BGGA 3IUDA 2PBGA 3URNA 1V93A 2CZ5A 3MUAA 3WLLA 5E0FA 4ZVJA 4CNTA 5I3IA 3VIPA 4S2BA 1JR1A 9CGTA 4RNFA 2W27A 2CESA 1W5MA 1UQZA 3W6LA 4IUOA 1RQEA 3MV01 3H2FA 3IRDA 1F73A 2X30A 1E6NA 1B3OA 3HGJA 1X38A 3UT0A 3DZ1A 5K3VA 4ATWA 2DIEA 3H2AA 4JFUA 3TNOA 5I5RA 4K8EA 5CBIA 4Q6JA 1MUMA 1OT1A 4IG2A 3A5FA 2J88A 4DEFA 4MIMA 4IP4A 3AQUA 3EAUA 2E68A 1JUKA 4EXAA 1V08A 4XKYB 3TMQA 2VUNA 1C3FA 4PUKA 3IACA 1ZRQA 3G1DA 1GQJA 3L7RA 3FSTA 1GVQA 1HF6A 1EF3A 3SJNA 2OGYA 4A6GA 4YCPA 4W8LA 1AH4A 3VAVA 3K1DA 3W24A 3B0XA 7ODCA 1F6PA 1MQQA 1BAGA 3ZR5A 2ABAA 4Q4SA 1CYGA 2WVVB 3EPMA 1KFJA 5AHFA 5C0QA 4W88A 4WX2A 3TA6A 4KWVA 3LERA 3S9ZA 4GZIA 4JTSA 3NM3A 2Y0FA 1OFBA 4EPEC 3WYZA 4RE0A 3LGGA 1A5SA 3KZPA 4MZ8A 3QR3A 3KOFA 4HZMA 4V15A 3LQGA 3B0VC 2FQIA 1AL8A 5A6BD 3BLLA 3DHUA 3CAKA 1C8XA 5C9UA 1O1ZA 5BOEA 4UNKA 4UFIA 4JICA 1FXQA 1PE1A 5BMXA 1FWDC 3VMOA 1W9UA 2CZEA 1A80A 5CZKA 1FH7A 1GOWA 1KKOA 3BUVA 2QPUA 3NZRA 2ALDA 2J7EA 3VTRA 1VS1A 5EY5A 4ICMA 2VURA 1TCMA 4FX8A 4DO5A 3CHDA 3KVKA 2GJXA 4XB3A 4DLMA 5REQB 2V6AA 4LVBA 1BTMA 2KAUC 3UR8A 4CVUA 1HNYA 1V6XA 4HCDA 4O1AA 5LHFA 3GDBA 2YKKA 4G9PA 3NDYA 2Y8KA 2OSYA 3W7MA 4DJFD 5DELA 3DFQA 3A6OA 1A3XA 4PMVA 3VA8A 1X8CA 1XS2A 3LTSA 1FBAA 1QWKA 4MSSA 4ORMA 5I79A 2CKSA 2FIQA 3T0CA 2PC4A 4CD7A 2P8CA 3IK2A 1UH4A 1WKDA 3IGUA 1HL2A 4GJ1A 1I60A 3PZVA 5FI8A 2VM8A 4NAEB 1XSJA 2CBUA 3HG2A 4RJEA 1BXNA 4CNPA 4I90A 5DY3A 1XIHA 3ZJ6A 4PUUA 3TN6A 2YCLB 3TSMA 2XH0A 1H63A 2QJHA 3PK7A 2DY3A 4AD2A 1Q63A 2NLYA 1N2VA 1ITXA 4FOKA 3TAOA 4GXPA 4M7TA 1DIOA 3O16A 4B3LA 4J3UA 2WZTA 3W76A 4UQDA 3W26A 1WUFA 1FRBA 4LV4A 4FX6M 3MA8A 4GGHA 1IV8A 1AJ2A 4J3SA 2GOUA 1SYTA 3VOCA 3FAWA 3FDGA 4H1ZA 3WNNA 4UTWC 2O92A 4DBDA 5E5CA 2J9YA 4KRZA 1UPPA 3NO1A 5MKGB 1BKHA 1CCWB 3H2MA 4I8YA 3VIJA 3CWOX 1EFZA 3GYEA 1ADOA 5AECA 2WANA 3ZR4A 3TDFA 1VBRA 2VGBA 1XLDA 1C29A 2GGJA 3GG7A 3UEQA 3EB2A 4AD0A 2AL2B 2SFPA 1MW2A 2QNEA 4L64A 1UC4A 2Z24A 3K8MA 1H7WA 1Q8JA 3UESA 4KFNA 4PEKA 5H8UA 3QZEA 2PLMA 3LPOA 5G1YA 4AVNA 4IP5A 5CZJA 4ZSUA 1GVSA 3FY1A 1JGIA 5C8BB 1R38A 4XAZA 4KQNA 3RJXA 4IJCA 4C6MA 1XGDA 4L80A 4J9JA 1PCKA 2HK1A 1MO0A 1KCZA 5I6SA 1KRMA 2VC5A 3LLXA 4UTUA 2B81A 1PZ1A 2XIJA 4LAOA 1DOSA 2ZA2A 3UZXA 4A3QA 3MB9A 1R2TA 4C6CA 1Q6EA 5DXYA 2QCDA 1F74A 1NDZA 1LM1A 4XD4A 3C2VA 3OTRA 1B4EA 3T4CA 2W4XA 2VENA 4GXWA 1K02A 3OIHA 3VZYA 2ZFAA 1UMYA 1A47A 4JCMA 1LQAA 2VX5A 3G1YA 3W4RA 1LWHA 5BXTA 3LCHA 3WJWA 4UFHA 4DWDA 3CZJA 4O1CA 2IXVA 3UXLA 3UWEA 3KOYA 1F6YA 1WBJA 1PKYA 1G4TA 4LNCA 3OG3A 3WNPA 3BANA 1XF0A 2EHHA 3IARA 1Q7MA 3SN4A 1I6NA 2TSYA 5ECVA 2Y85A 5AHEA 2ABBA 4H9UA 1L8NA 3VINA 1D8WA 4ZQPA 1PCWA 3NSNA 2D3NA 2X40A 3LRMA 4WD0A 5LNWA 4M29A 1FY6A 5DXXA 1FHVA 5DRIA 1HFBA 2I5IA 3MBDA 3LOTA 3MCNA 1F8IA 3DKJA 3QKEA 4Q7NA 1LOSA 1OX4A 3S9YA 3GB6A 2PODA 3KOWA 4S1FA 2WMIA 1LL4A 1Z42A 2Z1KA 4QG8A 1YDNA 3GSMA 3MCOA 1K6AA 3MMTA 2V0TA 4GXMA 2GL5A 3S2JA 4C6EA 1F3XA 2VR5A 1DWAM 3FAXA 3UNDA 3HGRA 1QATA 4MB5A 2L5HA 1MXGA 1OHLA 4QGCA 3IIXA 2JALA 1XYLA 3PUDA 3AU6A 4L4LA 1JYNA 3P81A 1NARA 3GR4A 3T78A 3B97A 1V3LA 1IE7C 4HA0A 3MW7A 1K7EA 3A4AA 4RL3A 1IR1A 5HDRA 3F4WA 4AVOA 4HNLA 3MI2A 2WSRA 4JIQA 4YCOA 2Q6ZA 5G2IA 3T2QA 5AFDA 1Q6DA 4JFVA 4RE2A 3UA3A 2C0AA 1WQ5A 2D0HA 1QCWA 4ZMGA 3UZ5A 4IIBA 4Z1DA 4P2VA 4GIYA 2REQB 3NGFA 3CB3A 3GZAA 1V3KA 2ZUUA 1G4EA 1FWSA 1SUXA 1M41A 3UJSA 3O8AA 3AS0A 4LWWA 3IGHX 4GQBA 1JQXA 4E0CA 3G5EA 4QEHA 3GWQA 1CECA 3AJXA 3KBJA 2BY1A 2ISWA 2PRMA 4POCA 1C8VA 1SMAA 2A7NA 2J9XA 4KWUA 2WC3A 1UUOA 3GNRA 2FZNA 4DELA 3EDFA 2QCMA 1UASA 2O0TA 2DSKA 3C8NA 3P80A 1ZZMA 4A8LA 4AQLA 1PIFA 4JTRA 4C6IA 3VOFA 3L2LA 1DJHA 3BCJA 4O1EA 1NY1A 1W3NA 4AXKA 3TZFA 1LUCB 2P50A 3TTYA 1SJAA 4UR9A 1P48A 3QPEA 4F2BA 4UQAA 1AJZA 1JCMP 3S0CA 1OFDA 4QISA 3FYYA 1ZB5A 3LS9A 5D33A 2FHFA 1GVYA 2ZZ3A 3TWBA 2VCAA 4D6EA 1KCXA 4AY8A 2HXUA 1NQKA 5IOBA 3QW4B 4WLCA 1B3WA 4N42A 1Q4NX 2V38A 2HNHA 3C3UA 1UYQA 2GDQA 4B90A 2RUSA 1XQLA 1CPUA 3CUJA 4MY8A 1MZHA 4H6RA 4R33A 2GJLA 5BRPA 4G56A 3BG9A 1A5UA 3RPMA 3WDRA 2D73A 4ORIA 2QHAA 1UA3A 2FLIA 5FF7A 3FS2A 4GI6A 1VBGA 3B8DA 3GTXA 1UA7A 3W75A 4UFKA 4KPLA 4IMFA 4WEVX 4BA0A 2GVJA 1ODZA 2B7NA 3II1A 3EMQA 2V81A 2W9MA 3IV3A 1KLZA 1W1TA 3V35A 3QQ0A 5I77A 3RCMA 1BWVA 1MFUA 1ELSA 4ZQOA 5CCZA 1UKPA 4BWLC 4B92A 3HFYA 1I2OA 4ZOAA 4A3RA 1JI2A 1MZRA 3NA8A 3JRKA 2XH2A 1A50A 2WHJA 4L6DA 3AS3A 4X61A 4PRWA 4ZXLA 3CM4A 2O56A 2CBIA 3W72A 2VXNA 1RK6A 2ZUWA 3PTKA 2P76A 3TTEA 4WDTA 2OMAA 4KWOA 2OZTA 3QR0A 2J27A 3AO0A 3L4WA 4V28A 5EL1A 1M01A 2YA2A 1R47A 1ZJAA 2I9UA 2PUZA 1YPIA 3VX1A 4B5VA 4OV4A 1OGGA 3AS2A 3RR4A 3KBWA 1KM3A 2XIMA 3L5MA 4L5ZA 4LUSA 3ZXWA 3G1FA 2CW6A 3VNIA 3MMWA 3WQDA 1TIMA 1XYFA 4JHZA 1E9YB 4GABA 2YCEA 4UTKA 2FYMA 2YR1A 5A95A 5I7GA 6CGTA 4QAIA 3WN6A 2X7WA 4NKCA 5A69A 3P84A 4H6KA 2IKIA 4DXXA 2JFEX 1UH2A 1Z41A 2D69A 4ZZ9A 3BO9A 2WPGA 3ITTA 3Q67A 1UD5A 4HNNA 5AC8A 2PWFA 4E2DA 3KCLA 3BAKA 3KLLA 4TVUA 2BOGX 4GO8A 3SQLA 2UZ9A 2ZZ1A 3WDQA 2DORA 1XCWA 2DVTA 3SFKA 2PDFA 4LYQA 1QPOA 3SCVA 4MJ4A 1FA2A 3N73A 4L9ZA 4JX5A 5L6UA 4J27A 1ZLPA 3U4FA 3W7LA 1A0DA 2ZX7A 2YX0A 4DWSA 4EXBA 5I24A 1EO5A 5CGQA 4QBXA 3ABXA 4GC3A 1AJ0A 3IJLA 1MYRA 3OYXA 2ODOA 2WZIA 5T8GA 1FWEC 3WH8A 4MLJA 1QO5A 1YMYA 2VGIA 3NZPA 2XZ7A 4GISA 2OFJA 2NX3A 4AVFA 3RLUA 5D03A 3M5YA 2KX9A 3ITGA 1ISVA 4UR7A 1O5QA 2TAAA 3QGAC 1DWHM 5A5WA 4QIUA 1GYMA 4RNHA 3FJLA 4LBRA 3PZGA 3PUOA 4W87A 3ZVIA 3TU9A 2YZ5A 1QI4A 4FNPA 3MHUA 2V5LA 2FJUB 3CQJA 4C5ZA 3HJZA 3O63A 4IXHA 2C6QA 1WA3A 3CGTA 3DENA 1JPDX 5LKYA 4F48A 1J0HA 3PP7A 1R87A 4YXGA 1F61A 4RNIA 3UETA 2HTMA 1E6QM 3TLQA 1ISWA 5D9OA 3HB9A 2ZTJA 4EKJA 3GXMA 3LMYA 3O6DA 1KTNA 3IANA 5FF4A 2Y7DA 4BQ4A 3MI6A 2DZAA 4RKAA 1N8FA 1Y5XA 4E2BA 1GYLA 2ACQA 4EX4A 1S2AA 1XWYA 2HMCA 3S42A 3S1GA 5FJOA 5E09A 3OBAA 2YYUA 1YLVA 2DT0A 3N2XA 1BYBA 1RY8A 1QNRA 4YJ5A 3WLJA 4AUBA 3HOJA 4K7YA 2XGIA 3ITOA 1DWGM 4TX9A 2BODX 1EJSC 3MT1A 1NAL1 2O7QA 5EMUA 4MYXA 3MVTA 1OFEA 2BGQA 3M07A 3G8RA 3S47A 2WBKA 4QP0A 1V6YA 4XBKA 5CEWA 4L6OA 1JZ4A 1QBAA 3BMWA 4PMXA 3ATZA 2D22A 1D8CA 1M7OA 3WQPA 3R6IA 2ZZ2A 1YYAA 4PMJA 4S2CA 2YDAA 2J7HA 3TQPA 1CXHA 5FOOA 2WJZA 1AZ2A 2F6UA 1H2JA 2W66A 4F9DA 3RX3A 1BRLA 4K39A 3W84A 4R85A 2WBGA 2WMFA 3GXNA 3OLDA 3V0SA 5MHBA 1FCBA 1HGYA 2JF6A 4GACA 1NFPA 1QDSA 2WB5A 3EKLA 5KSWA 3CMFA 3SSZA 1US2A 2XPKA 4UB9A 5D02A 5HQEA 4OOZA 2FJKA 4RZ5A 4LAZA 3G6LA 1WDSA 3NXLA 4ZL1A 3UWWA 4G7FA 1R7OA 5C9RA 2PP3A 4LX4A 4C6KA 3B0YA 3EEGA 5HWNA 3W7CA 1YDYA 3I7QA 2NQ9A 4JFTA 2WMJA 2WNQA 4HZ8A 1KR1A 1LP6A 4OKDA 2A7PA 4CUCA 2D2GA 3DFHA 4MM1A 2LLEA 1TE6A 3NAVA 4A8IA 4REQB 3RLHA 2I17A 3CHVA 3PN8A 1SGJA 2DZPA 4IHCA 4MNMA 1FWNA 4YTQA 2GDUA 4RLIA 2RHGA 3G1VA 3M64A 3ORWA 3BTNA 4LANA 5A6AA 4O52A 1V3MA 3KX6A 1Y65A 2DJLA 1A5KC 1CGUA 4GI8A 4OBTA 4AYSA 1LG1A 5D8WA 3S46A 2A21A 3P8JA 3LLFA 4WK9A 3WH7A 3CAQA 1YTEA 3UFYA 3ARSA 4KIRA 4LW7A 3U57A 4S3DA 3WIJA 2ZDSA 4PFHA 1MQRA 3VABA 2ACRA 2V8ZA 4DF0A 5FF2A 1SVDA 4E2VA 2YCKX 4JL1A 3TK7A 5F1UA 1DJWA 3E02A 2J7FA 1J6PA 2J7DA 4WF7A 1GZGA 3MDUA 1OD8A 4LVGA 1RY0A 1UWRA 3C0SA 4ACZB 1PTGA 1S5VA 1F6KA 2OQHA 4AZBA 3M46A 1XBXA 2BZNA 2W67A 2INFA 1CGYA 4AEOA 3EX4A 2PWUA 1PYMA 3MI3A 3QHOA 1RLDA 1WDPA 3PWGA 1NWUA 3CLWA 3GTFA 1V02A 4XTDA 1D3CA 1EJUC 3ZQ9A 3UVAA 4TR9A 4FLQA 2OLSA 2CCRA 3NO3A 3NDZA 4PN2A 3LLDA 1XLBA 1YNQA 2G3FA 3VX0A 4D1IA 1KFWA 1GVOA 5G4HC 4FEZA 3NZQA 1TZ7A 2X8RA 3M44A 3P3BA 1WZAA 4TMCA 2WJFA 3YPIA 2CU0A 3IIPA 4LYRA 1KBBA 1FQ0A 2ACSA 4NNAA 3NQDA 2C3ZA 2TMDA 3O7UA 2E9LA 1TZZA 1JZ7A 3RRXA 1B57A 3ICJA 1POKA 1T8XA 2VO5A 1QPNA 1F76A 2Q8ZA 4GIRA 2QV4A 3EMCA 1TV7A 3B8WA 4HPGA 4I5XA 2QJIA 2A3HA 4FA3A 1NF7A 4S3AA 4AY7A 1WXJA 2I7GA 3VD3A 3CTLA 5A6MA 1AH0A 1DP0A 1I4NA 2ZX8A 4CLMA 4WGXA 2F7FA 3H53A 1AQFA 1AW5A 2YLAA 4JFWA 2IXUA 1UR4A 2FKPA 5AZ1A 4CD4A 2BNJA 2J77A 2XGZA 1W9PA 5EU9A 2Y5JA 3BL3A 2EAWA 3H24A 4I9MA 1JFHA 1YE6A 3UYIA 1S1RA 4W5ZA 3TX9A 1YTKA 3W02A 1PZ2A 1WUEA 1RVGA 3NQMA 1GQIA 4W7UA 1YW1A 1XIJA 2YA0A 3SUVA 4HCLA 3ZVHB 3VIMA 3C3NA 5D04C 5A1AA 1MXDA 2ZRYA 2F84A 3W7DA 4JTLA 2XN1A 3KZSA 3N6JA 3CIXA 2VGGA 1KBIA 4C1NB 5ABFA 4US5A 1R7AA 4ZCWA 4CD8A 3GC4A 4G1KA 1DJZA 2OELA 2NVCA 3L0KA 4JHOA 3AI0A 3QLDA 3M41A 1OT2A 1XHGA 3RNDA 4H7ZA 2W62A 3LXAA 3STPA 1E4MM 4QQUA 1UWSA 4HD5A 3ZJ8A 4JPGA 2QDHA 2G4FA 5LA2A 2GVEA 3AHVA 3DH7A 1KGXA 3S1XA 3S6TA 1WNOA 1GYNA 1CT5A 4K1WA 3WJZA 1UKSA 3TA9A 1OZMA 1EGMA 2CYGA 4EPKA 3K1GA 5FF0A 3M9YA 1MI3A 4WKAA 3VGFA 1ADSA 2C14A 5GNXA 3ITVA 4UTFA 1EWEA 3GXPA 3PJWA 3GAYA 2E0PA 4PTMA 4AC7C 1UJPA 1E1CA 1FXPA 4FALA 1OK6A 1SZGA 5HJXA 2YBTA 2QCHA 5B7YA 1HJVA 2NXGA 3WLKX 2A3LA 4LGXA 3AHZA 2CLHA 1RA5A 1W3LA 5MF5A 4ZBCA 3OLGA 1LL7A 4NAEA 5FAGA 3UGRA 3A3XA 3NIYA 4IIHA 4QJ3B 5C2CA 1HIZA 2XWDA 5CPOA 3RAOA 3MY9A 3A21A 2GGHA 5F2GA 1QI5A 1JZ6A 2PWGA 5I02A 5DX7A 4J7RA 3PSVA 1P6BA 3KTCA 4QSFA 1KCKA 2YDSA 6XIAA 1TZ9A 3F4CA 1TV4A 9XIMA 1L0PA 3KFTA 4RDWA 3L66A 2DIKA 1TFVA 1EC7A 1P4CA 5RUBA 3NEHA 1EDQA 4REQA 1Y5WA 5K4ZA 5DCEA 1UWIA 4KRUA 2HE8A 4FP1A 1VKFA 2NUYA 4P7QA 3WEOA 4DHGA 4MKVA 3LB0A 3TONA 1I2QA 5IXEA 4KFOA 3O6YX 3R13A 4QR6A 4PUDA 1EUAA 1ZAHA 5I3FA 1UD6A 5FL0A 2AKZA 2I57A 5HNUA 3HTWA 1HXJA 3IVUA 3G3MA 3M7SA 1HKVA 4ES4A 1N82A 5HQMA 3WBWA 1YDVA 1J12A 4MNKA 5CG0A 3QW3A 4CEUC 1XQKA 3E0FA 3TW6A 2VWTA 2FMOA 3W7KA 1H41A 1W32A 4WKHA 2DUZA 1P43A 1OVDA 2HWGA 4KETA 1X8FA 1B3ZA 3WLPA 2OWXA 4O1DA 2RKXA 4Q8UA 6TIMA 1GORA 1ZSXA 4HB7A 1Q13A 7XIMA 2NVDA 3BK0A 1W9VA 4HK6A 3UPWA 2O9RA 1B3VA 1E0XA 2YGYA 1XDJA 3GRIA 5CPNA 1AQ0A 4GJIA 1HN1A 5HXMA 2G8ZA 1C91A 2WLYA 3FYPA 4FNUA 1EYWA 5HR6A 3PFRA 1XPGA 2FGZA 1H49A 1TTJA 3EWUA 4DJDC 3VGHA 5BU9A 3IJ6A 5DT7A 5I78A 3N9RA 3N9KA 1QAPA 3UJFA 4F40A 1UH3A 1PTDA 2EGZA 4TX6A 1XP3A 2BFGA 2EO7A 1TRIA 1JCTA 1JFXA 1W1A1 2BGNE 2PDPA 3R11A 1HX0A 2OCZA 5ABGA 1BVNP 5E6YA 4O8AA 3LHYA 3SIZA 2AL2A 5EFDA 4ERIA 1N7KA 1QW9A 3U48A 4F0KA 4O54A 3VUPA 5LGZA 6A3HA 1J5TA 1KV5A 4UFJA 2QPSA 3WMSA 5IDZA 2P5NA 3GG8A 1EHNA 3WLSA 3I6RA 4UTMA 4DNMA 4LF1A 1EF2A 4X0NA 3RM4A 4O50A 1LCOA 1CB7B 1O68A 4U2ZA 1XLMA 2G3MA 1PL9A 3L4TA 3EEZA 3E1F1 3B0PA 2O55A 4F9JA 4OQVA 4M24A 4K8GA 1TJPA 2E1DA 4O4WA 1ZALA 3LA4A 2B31A 4RZBA 5CGMA 1DQXA 4ZO7A 4JN6A 2VR2A 4GRSA 5G1TA 1H62A 4MJZA 2RDWA 1EP2A 1EX5A 2DH3A 2R24A 2VHLA 4F2TA 1V0KA 2FTPA 4J1OA 4GYPA 3WBAA 1YHTA 4ZTYA 2ZWZA 4CEXC 4IMAA 4MLRA 3A3HA 5A2BA 3KCJA 3PBMA 2FVLA 2GJPA 1R6WA 1X6LA 3NSXA 1NM9A 5BRQA 4MPKA 1E0WA 4C1NA 1IZJA 4M82A 4KRTA 3RF9A 2O9OA 2X1IA 2F61A 1KWKA 1L2QA 3B8UA 4KCVA 5AY7A 4I7VA 1X97A 2G3NA 4NZ4A 3G22A 2I9EA 3C56A 1K8ZA 3F2DA 3LQLA 1EIBA 1U1JA 3B05A 5AC7A 3QFWA 3TSBA 4L4OA 3RU8X 4BF9A 8XIMA 1Q2RA 1REQA 3Q37A 4EIVA 3UR7A 4OV9A 5HANA 2P0IA 4RNJA 4ECLA 1FWGC 1U33A 3UGVA 3WH5A 4WOQA 1JPKA 1QTWA 3FA5A 3KL0A 4LALA 1RSCA 2IUZA 3DFOA 3JVAA 4G7EA 3O3RA 4LY8A 1BG4A 3WUEA 3GU1A 1XUUA 4XAFA 3GG1A 1PHQA 2HXTA 3UG8A 3LY0A 2PGWA 3JUGA 1SR9A 1QOQA 3TLLA 3VVGA 4NI3A 4A3HA 4JCLA 1EGZA 4N6FA 5BMWA 1Z48A 1XH2A 3DGBA 3SSJA 3GW3A 4XD3A 4XO6A 4IISA 3M0YA 5C2XA 3GBEA 3NQGA 4F79A 3S5NA