4DI9A

Crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
293
Chain Sequence
LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLKRLVDDAPKDKFLEVAGRLPAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTAWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-pyrone-4,6-dicarbaxylate hydrolase
publication title Structure and Catalytic Mechanism of LigI: Insight into the Amidohydrolase Enzymes of cog3618 and Lignin Degradation.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 98
structure length 293
sequence length 293
ec nomenclature ec 3.1.1.57: 2-pyrone-4,6-dicarboxylate lactonase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4di9A00
2I9UA 3T81A 4KF1A 4LAKA 1A5KC 1P6BA 3A3XA 3WMLA 3MDUA 2YZ5A 3MTWA 2AQOA 1GKPA 3NURA 4QS5A 4C6EA 3GUWA 1NFGA 1GKQA 3B40A 1RJRA 3TN4A 2QVNA 5HMDA 1R9YA 1I0DA 4GY1A 1UIOA 3ICJA 4J2MA 4DLMA 1ADDA 1V77A 4H9ZA 4V1YA 3O0FA 2WJFA 3URBA 4PBEA 5A6TC 3OOQA 3K2GA 3EWDA 4F0RA 4RZBA 3IGHX 4WHBA 4C6LA 1FWCC 4C6IA 3GU2A 4H00A 3OJGA 4INFA 2HQAA 1V7AA 2Z24A 3DC8A 4PBFA 4QSFA 3K5XA 3LSBA 4DI8A 5FSDC 2XIOA 2Z29A 1M68A 3N2CA 4ICMA 3MVTA 3E74A 1J79A 4GBDA 3UF9A 2DVTA 4E3TA 1UMLA 4B92A 1O5RA 1FWHC 2VM8A 2QS8A 3KM8A 3TN3A 2Q01A 2EG7A 4DI9A 4RDYA 3QY7A 2QT3A 4LCSA 4C6BA 4NG3A 3GU9A 1NDYA 5LXXA 2VUNA 1RK5A 2I5GA 1EZ2A 1RA0A 4LEFA 2VHLA 3IARA 4AQLA 1RK6A 3QGKC 4IGMA 2BB0A 3A4JA 4G7EB 2ZC1A 1J6PA 4DYKA 3MSRA 1NDVA 2ANUA 4G2DA 4CNSA 4LANA 2Y1HA 3F4DA 3LS9A 4CQBA 1A5MC 2FVMA 3E0LA 1PSCA 3E38A 4H9YA 1EYWA 3WYZA 1FKWA 2O4QA 1POJA 4IFKB 3RYSA 1V51A 2VC7A 3RN6A 4P5UA 3LU2A 4LAMA 3IRSA 3UR2A 2BGNE 3GIQA 3AUOA 1UBPC 5AKQA 3WZ0E 1ONWA 4GYFA 3B0YA 1GKRA 2A3LA 2UBPC 4ERAA 1FWJC 1VFLA 5FSEC 3URAA 4YIWA 1ZZMA 1W1IE 4R85A 1RJPA 3OVGA 4C5ZA 2OODA 2RAGA 2P53A 4C6QA 3FDGA 2Q09A 2PGFA 1YMYA 4GK8A 4G7EA 1YNYA 3TN5A 3E0FA 1KRBC 4Z42C 4CNUA 3GIPA 3PNZA 2Z25A 2R1MA 1EJRC 3AU2A 4GC3A 3NQBA 1QXLA 4RDWA 2HBVA 4LALA 2EG8A 1HZYA 4HK7A 2P50A 3PBMA 3LGDA 4IFKA 3F4CA 4C65A 3OU8A 4I6KA 4KERA 2FTWA 4MUPA 4RDVA 4LCRA 2GSEA 3JZEA 4C6JA 2FTYA 1EF2A 2CZVA 4IQJA 4J5NA 2E25A 3URQA 1S3TC 1YIXA 4KIRA 2PUZA 1IE7C 4LCQA 2GWNA 4B3ZA 2HBXA 1K1DA 2QPXA 2Z4GA 3O7UA 4H9VA 1FKXA 4GZ7A 4IFOA 3G77A 2EG6A 3V7PA 3BE7A 4WGXA 2DVXA 1KRMA 1A4LA 3NEHA 4OFCA 3S2LA 1P1MA 1YBQB 2R1KA 4HK5A 4EP8C 4ZSUA 4EPEC 4C6OA 4DLFA 1RJQA 4ERGA 4C6CA 4M51A 4NP7A 4V1XA 2HPIA 3LSCA 2IMRA 4DZIA 4HJWA 1EJVC 3GRIA 3DUGA 1R9XA 1PTAA 2GWGA 4ZSTA 4F0SA 1M7JA 2OQLA 1UIPA 4QRNA 1FWFC 2WJDA 2F6KA 1DPMA 4C6MA 3RCMA 4H9UA 1A5OC 3TNBA 3T1GA 4GXWA 4XAFA 3DCPA 1BF6A 1FWBC 3FEQA 4CEUC 4IFRA 2GOKA 3MPGA 4DNMA 4QS6A 1WXYA 4IF2A 4LH8A 2DVUA 5E5CA 2WJEA 1M65A 4HK6A 1POKA 4QTGA 3S4TA 4D8LA 3F2BA 4C5YA 3RHGA 4CQCA 4GX9A 2UZ9A 2Z00A 3E2VA 1V79A 4H9XA 2E1WA 4XAZA 4LFYA 4XD5A 3ITCA 2R1LA 3GU1A 1YBQA 1RA5A 4GX8A 4EPDC 5HMFA 2AQVA 3K4WA 1P6CA 3C86A 4WVXA 4L6DA 2PLMA 2HPMA 3HTWA 2D2HA 3UPMA 2GZXA 3EWCA 4KETA 2VC5A 2G3FA 3PAOA 4C60A 1ITUA 1WXZA 4XAYA 3FDKA 1PB0A 2OB3A 2VR2A 3QY8A 2W9MA 4BKNA 4EPKA 3GTFA 4B91A 2WM1A 4J35A 1ITQA 3MKVA 4IGNA 4C6FA 1FWAC 4GOAA 4ERIA 1XWYA 3GTIA 3A3WA 3S2NA 4C6DA 1EJWC 3ID7A 3SO7A 4I6VA 1PO9A 3OODA 3B0XA 4UB9A 2Z26A 3CAKA 1XRTA 1A5NC 3T8LA 4L9XA 1XGEA 4HA0A 1A5LC 2PGRA 1FWGC 1K6WA 4IG2B 3GTXA 3LGGA 4KEZA 3QGAC 4GY0A 1ONXA 4CEXC 3PANA 2FFIA 3HPAA 3MDWA 4XD6A 1FWDC 3E3HA 3SFWA 4NI8A 3IV8A 4CNTA 1J6OA 2KAUC 4TQTA 2OGJA 4C6NA 5G4HC 1RAKA 3IJ6A 2ADAA 4DO7A 3TN6A 2O4MA 1FWIC 3URNA 4GY7A 4DZHA 4LAOA 1J5SA 2OOFA 4PCNA 4R88A 1QW7A 4C6PA 4KESA 4B90A 1KRCC 2YB1A 3ISIX 1R9ZA 4UBPC 3LY0A 1A4MA 2Z7GA 1EJXC 1V4YA 3EGJA 4BY3A 5CH9A 4XD3A 2YXOA 1EJTC 3F2CA 2D2GA 4KEVA 1EJSC 3OQEA 2AMXA 1NDWA 4IH3A 4CQDA 2YB4A 3CS2A 2R1PA 4KQNA 4IG2A 4RE0A 3PNUA 1KRAC 3UR5A 3CJPA 3F2DA 4RDZA 2D2JA 2ICSA 4H9TA 3GTHA 4XAGA 2Z28A 4C6KA 2FVKA 2PAJA 4F0LA 3R0DA 1K70A 3AU6A 1I0BA 1JGMA 4QROA 4XD4A 4BJHA 1KCXA 4JOMA 4PCPA 3ORWA 4EPBC 4AC7C 1E9ZB 1E9YB 3MJMA 1EJUC 3LA4A 5HMEA 1FWEC 1XRFA 3UBPC 3D6NA 2Z2AA 3GG7A 3S2MA 1NDZA 3IPWA 4R7WA 3MVIA 2Z27A 2Z2BA 1O12A 3HM7A 3IACA 3S2JA 3QY6A 4KEUA 2HNHA 4H01A 4H9MA 1YRRA 3LNPA 2R1NA 4PE8A 4DIAA
chains in the Genus database with same CATH superfamily
2BY0A 3AICA 4LAKA 5KZMA 3IUIA 1UMYA 2WHMA 4DJDA 5I3JA 4MZ8A 1RVKA 3MUAA 4DQWA 1BD0A 1CGXA 2JE8A 3NURA 1QRQA 3MCMA 2IKHA 4J2MA 2O9PA 1QPQA 1ZAHA 2OYLA 4O18A 4NF7A 3XISA 4E0CA 5C2GA 4DUXA 2BY3A 1XKYA 1E3XA 1JZ5A 1P0KA 3C2EA 1VENA 2NVCA 4JIPA 4B5UA 5HNNA 3N9KA 1VBUA 1IZKA 4MY8A 1ENUA 3GW0A 3HN3A 2Y6ZA 3S9IA 1KM3A 2W63A 4RL3A 3R8RA 4KW2A 3MVTA 2PF8A 1JDAA 4S3KA 2H9AA 2QNEA 4PMVA 1CGYA 2XH0A 3R12A 4PUWA 7TAAA 4UTIA 1XSIA 1LOQA 1XIMA 3AZRA 3GDLA 4AD3A 3UVIA 4NG3A 4H6KA 4JZ5A 3HJZA 1V02E 3N04A 1A5SA 3CV1A 4L56A 3S83A 1L6WA 1A3WA 3MHGA 5DELA 3KCLA 4W87A 3V0SA 4GZIA 3R2GA 5C7VA 1XBYA 4O12A 1YX1A 3QR0A 2PB1A 3QLDA 1RLDA 3GXMA 5DO8A 1JYXA 3OO2A 4PMUA 3GNRA 2VRQA 5AVNA 5H6HA 1TMLA 3G0SA 1W2PA 4NNAA 4UOJA 1HVXA 3W1TA 1H5VA 4OT7A 5A95A 3R25A 4H2CA 1UR8A 4N42A 1NF7A 3QV8A 3DX5A 1W8SA 3VNDA 1W3IA 4JXCA 4QJ4B 5I09A 1NQ6A 1VZWA 3O3RA 2GVJA 2YL9A 3EKLA 4DJDC 3R8HA 2EO7A 3VI2A 4AX7A 1UJPA 4H6QA 5F4WA 3OZPA 4JX6A 2OG9A 1R46A 4GJIA 1UD6A 4H7ZA 3G1FA 1F61A 1PHQA 3PG9A 2C1HA 3C2YA 3UR8A 2FHBA 3KOXA 3QQ0A 3S5YA 3UWUA 3AZTA 3UERA 2CZVA 4IQJA 4J5NA 5CBBA 3TW9A 3BAYA 1O4UA 1EGVA 4HPGA 5IRPA 1S5TA 2R6OA 2ZUUA 5MHBA 1WP6A 3CEUA 2OLHA 4P61A 1E4NA 3U9IA 1JCMP 4P8XA 4R9OA 3BH4A 5CGQA 1JFHA 1LQAA 3DFPA 1WBJA 3ZR6A 3NZRA 1BWVA 1Q7QA 5AOUA 2YBVA 2Q6ZA 5I07A 2NLIA 2VD9A 4O19A 2X8RA 2IMRA 4I3GA 3GRIA 1G4TA 1YE6A 3QSRA 3K13A 1M7JA 3NUKA 3A9IA 3CUJA 3VIMA 4DAFA 3BXWA 3STEA 4QDMA 3IIXA 1AMKA 4GKTA 4RX0A 5E9XA 1GNXA 1ZAJA 5BCAA 4MDPA 3ARZA 2Z00A 4TU1A 1W5OA 4H8HA 4KWWA 1EHNA 2FMOA 4CCDA 2F61A 4XKYB 4NHVA 4O0QA 3SJ3A 1S38A 5HXMA 4PR4A 3UPMA 3QFWA 3M0LA 3P14A 4A3RA 1KR1A 2X2GA 3PAOA 2PFHA 2W9MA 3C6CA 2OPJA 3AUJA 1CGWA 4TOQA 4IGNA 1FWAC 2FIQA 1JCNA 4N9CA 3DENA 5M03A 1RVGA 1KV8A 2HE5A 3MB9A 2YLAA 1K8XA 3SQSA 4F4RA 2D3NA 3EXTA 1Q7MA 1FWGC 3G1AA 1GVRA 3UPBA 6ALDA 1LORA 3QGAC 3AIVA 1TTIA 1BWKA 2PCQA 4EANA 1TYGA 3PANA 5FKYA 3H2FA 1A3HA 3RMJA 2BHYA 4FNQA 3F1QA 1GOQA 4ZMGA 2G50A 1FCUA 3CAVA 1JI2A 1KFBA 4JEJA 4ZENA 1V4YA 4HA4A 3GC2A 1W1VA 3CUFA 5KZDA 1O5KA 1VBGA 2ZRVA 1SPQA 3TCEA 2XN1A 1TUXA 1OG6A 2PURA 2VEPA 2VVSA 3UYIA 1TO3A 4YTTA 1J5TA 3F2DA 4RDZA 1KGUA 2HCVA 4XVEA 4JEQA 2D3LA 3ES7A 4WDUA 3AROA 2FVKA 1C8XA 1B54A 1I0BA 1RCOB 3UGRA 4Z1BA 2ABBA 3VFLA 2P88A 2QCFA 4UFKA 3WD0A 2PDBA 2NV2A 4E8CA 1DTNA 5FL1A 1WPCA 2C6QA 3ZJKA 2C16A 4QJ5B 3OBAA 4O0KA 3FCPA 4W85A 1JD9A 2DH2A 4G7FA 1IR1A 4M6UA 4WOQA 2FPVA 3LLDA 2IPGA 4RNFA 4H9MA 2OYKA 4DBUA 4X2PA 4PE8A 3T81A 1HKIA 2YZRA 3WY1A 4NX5A 4F9DA 4O15A 5JMUA 3W2NA 3M0HA 3MSGA 2D20A 1G4SA 1VGAA 4GACA 1TVPA 2EGZA 3I3BA 3BZJA 1W56A 4G9PA 1F3WA 3N25A 3EEZA 4E2VA 1SFTA 4GIRA 1RD5A 3VKKA 4KFNA 3KRZA 4OQVA 5KMYA 1UPMB 4JQ3A 3BMVA 2P10A 3WLPA 4MJ2A 4WHBA 1CLKA 2QJJA 2WC4A 5KEZA 4M6VA 4INFA 1WZAA 1KFWA 3DC8A 4NXSA 1R8LA 3SGUA 3C61A 4H7CA 1PHWA 4MFDA 5FF4A 1BKHA 3W7GA 2PWGA 4HPJA 3TXZA 5BROA 4GBDA 3GXFA 3IUDA 4Y8FA 1L6FA 1GOIA 4B92A 3HGSA 1Q6RA 3WD1A 4R9XA 2WK2A 4A29A 2DZAA 3VNIA 5IHSA 2DQXA 3KRSA 1MEWA 1W6TA 1XLIA 1UP0A 1U33A 3KVJA 4E2BA 1UWUA 3QGKC 1QNQA 1DJWA 1M6JA 1S5MA 1K9TA 4NL1A 4KT2A 3GDRA 1MO0A 3VKJA 2DUXA 1FTXA 4M56A 5AYXA 4DB7A 3PJWA 4WY0B 3OTRA 5CPMA 4RZ6A 4CQBA 1ZB5A 5EMJA 3E0LA 3TJXA 3NTYA 3B8UA 2X1SA 3CQIA 4JTUA 1OFRA 3VGHA 1V51A 2CYGA 4QM1A 2RDWA 3OG2A 4D8AA 3PUOA 3SR7A 4I7WA 2OKTA 1XW8A 4B3KA 4N6FA 4GH1A 5TF0A 2WLZA 1KBLA 3FHQA 4LS2A 4TX9A 3RX4A 4H6EA 3O0KA 3PZGA 3NZ1A 1ZZMA 3LXCA 3GH5A 3KWSA 4S3EA 3KHJA 3KP0A 4IIGA 2Y5JA 2GUUA 4PMNA 4Y96A 4FNSA 1YDYA 3QYQA 1E73M 2JGQA 1ECQA 4NYUA 3PNZA 1OQFA 3PFMA 2VELA 4UNLA 3B03A 2GQ8A 2V2CA 2RJHA 3B04A 5DBTA 5DCDA 4Y9OA 4ZOAA 3OBEA 3CL6A 2AL1A 3N6JA 5LNSA 1VFSA 1QFEA 2PDNA 1ISZA 4AXNA 5KZEA 4LCRA 6TIMA 3URQA 4D9PA 4REQB 5BU9A 3R0KA 4B9ZA 1L2QA 3U4AA 2BX7A 1HKJA 3LD5A 1NELA 5HJLA 3I6RA 4MB1A 1FDZA 1RP8A 4DYJA 1FHUA 2IXUA 2OSXA 4NZ1A 2J8GA 1H0IA 2BHUA 3S2LA 1V6XA 4ZSUA 5G1TA 4UR9A 4ERGA 4JHZA 1CI1A 4F3HA 5DRIA 1Y8BA 1RSCA 4OHQA 3WD4A 3EXSA 4YLWA 4JQAA 4D1IA 3C3NA 1DPMA 1YLVA 2W79A 3AS0A 4PMQA 1FHVA 1L8NA 3VZZA 1XXXA 2V68A 1E6NA 2PBOA 3GS6A 4FR6A 4HNTA 2DZWA 3RPTA 1K7FA 3VABA 3U6WA 5A8NA 3OGVA 4EWJA 4D8LA 3H6OA 4CQCA 2QKFA 3HJEA 2P8BA 3HV8A 3V3WA 5HINA 1QHZA 4IMCA 2RDXA 3NVDA 4L64A 2OWWA 5CPOA 1J8VA 1H7NA 3K4WA 4HIBA 2BDQA 1QNRA 3TTQA 4ZQNA 4QHRA 1SJAA 4LYQA 1PVNA 3M7SA 4UTTA 1R3WA 5FCZA 3G3DA 1H7RA 1WXZA 2O0TA 3T2OA 4TMCA 3VGEA 5E9AA 1THFD 2PU0A 1ITQA 4JICA 1QMLA 1KCZA 1TKKA 2CLOA 1KA9F 3MY9A 4JCLA 4C6DA 2UY5A 2R82A 3O2LA 3BAXA 4DWSD 3MUXA 4Z2IA 4WDTA 1BGAA 2DZBA 3W7IA 3O6AA 1NSJA 2AL2A 3YPIA 4L9XA 1XH1A 3C52A 3T2PA 1H5YA 2IW0A 2ZYFA 4DY1A 3U2OA 3DC0A 3ARUA 3TOYA 5LHFA 4J40A 1D2KA 2YCLA 3ONCA 2XIBA 3KZPA 3P8JA 3I6TA 1IYXA 2GJLA 4LUSB 1EDTA 2ZVRA 3PWAA 2B7QA 4CN6A 3GC4A 3DHDA 4DWSA 4LUTA 2XPKA 3S6DA 2QEZA 2I57A 2J7EA 4HVXA 5D9MA 5D9PA 2HVMA 4Q8WA 1E9LA 4FP1A 1I1WA 3QQWA 3EGJA 1JFXA 5C7HA 2R24A 3M16A 5DY2A 4CQDA 5M5DA 2L5HA 3W6LA 4JTRA 1XYAA 2J9YA 1GW1A 5HR6A 4IG2A 4AZCB 1VFHA 3T0TA 3VA8A 3EWWA 3VE9A 1PUDA 1UD2A 1JG9A 4GQRA 3M0XA 1H2JA 1PKMA 3DHFA 2PAJA 4CD5A 4HCDA 4F0LA 5K9CA 2DZVA 3R58A 4O13A 1P6WA 4BJHA 4S2CA 4BQ5A 1E6QM 2PDHA 2Q8XA 4Z2KA 4GZJA 5XINA 4O1AA 1L8PA 1E3ZA 3PS7A 3W76A 1I9CB 5ABTA 3NYZA 3S2MA 4L4PA 3BL3A 3TLQA 1VAHA 4QE1A 1DP0A 1HT6A 3LCHA 4D6GA 3KE0A 4QFUA 1HKWA 5AC6A 3GXNA 2VR5A 1MNSA 4DX3A 3H7VA 2D23A 4Q4SA 2CKRA 4UTTC 3SCWA 1DXFA 5LYRA 3G6MA 7REQA 1Q63A 2YZ5A 1KFEA 3QEZA 1R3YA 3TQ0A 3LENA 1FH7A 3WMCA 3SJNA 4KWSA 2YCEA 4H9ZA 1KTNA 3EXRA 3C8FA 3N14A 2WJFA 4FK9A 4B4HA 4PBEA 3SRHA 3PUDA 3VDGA 4Q7NA 2OLAA 3L0KA 4MYAA 2Z24A 1H0GA 4L61A 3UXIA 3SCOA 2O9OA 1T8XA 2NUXA 4X0NA 2VX6A 2GUYA 1O94A 5DRCA 5FESA 4CCZA 2G3NA 4AIBA 3U2ZA 2QGHA 2J78A 4DWSC 2PDPA 3WG6A 4Y9MA 3C8NA 4O14A 3ARSA 1W54A 5B7YA 4DZAA 3QTPA 3BUVA 3KBNA 4ZO9A 2J13A 4O0ZA 3UR7A 4CNSA 2Y1HA 4O52A 2XSBA 2VX7A 1HKVA 2Y24A 3UCCA 2FHCA 3EDEA 4HU0A 2PC4A 2ZXBA 4H9YA 1JCTA 4P8WA 2BODX 1A5BA 1IT8A 1OVDA 1LOLA 4GCXA 1K8YA 3WEMA 5I6SA 4FOUA 3RFAA 2V67A 1XR2A 1B2YA 4H04A 1EXPA 5D30A 2P3ZA 2XH7A 2CW6A 4HNUA 3DDMA 3B0YA 4QE5A 3NVTA 4OGZA 3H4XA 1HW6A 3HG2A 1E6RA 4PTWA 4G7EA 5FIPA 3TN5A 2PP3A 3KL0A 4ZB0A 3RX3A 1QK0A 1P0DA 4GPNA 3W87A 2GL5A 1CGTA 2D2OA 1KBIA 1AL8A 3EOSA 3UXDA 1XLHA 3BLEA 3W26A 3U3HA 3H54A 2HISA 1ZBKA 3W1QA 2EG8A 1ZL1A 2UY2A 4HK7A 3WDIA 4IFKA 1PKNA 2DY3A 4YYFA 4Q6XA 5AFDA 4JTQA 3WJZA 4HOWA 3SZ8A 1B4EA 4M80A 3PTDA 4GYPA 3UP8A 1PEZA 1JZ3A 2V5BA 1F6YA 3DXIA 4AX6A 4K39A 3TP4A 3RF9A 4D6IA 1RALA 4B5WA 4JR5A 3S1WA 4CCCA 4GXMA 3WJXA 3DN5A 1HTIA 4HN8A 5HWNA 1A5CA 4JNMA 2WC3A 3VZYA 1UP2A 1KB3A 3VUPA 1US3A 4JY8A 3CC1A 3CZEA 3DFNA 2QIWA 5DEZA 3VNZA 1XICA 4HK5A 1ODZA 1SFLA 5BU6A 3PG8A 3ZO9A 3TWAA 2E0PA 3WH7A 3EOUA 4GFIA 2HPIA 2WKGA 5F7UA 5I0DA 1ME9A 1FOBA 2QCEA 3ZJ8A 3ZR5A 3K1GA 3WQDA 1X7FA 1NU5A 2QDEA 4YWIA 4C6MA 3POHA 1PZ0A 4L4LA 3VOCA 2WCAA 4XBKA 4GXWA 1LCOA 4UTWA 3SN1A 4PB3A 3SW6A 4UIOA 4H19A 4FX7A 3UCQA 3MO7A 3BMWA 5JIPA 2HV5A 1K4GA 3F4NA 4HBKA 3QV6A 3TLLA 2F7FA 2A1YA 3C5QA 5CGTA 2IQ0A 5AZ1A 4O16A 3ITCA 1OX4A 1RA5A 1S1RA 2DZSA 4CD7A 3MI2A 5A94A 3AJ7A 4A8RA 3C86A 4W8AA 1UWTA 2V2HA 4LVDA 2ISSA 2V2DA 1HJQA 2VZTA 2G3FA 1LM1A 4DXVA 4HZ8A 3FDKA 3WJYA 3EB4A 3FS2A 3GHRA 4MZ1A 3UJRA 3GBDA 4OBTA 4AZ6A 2DJXA 2ZA3A 2R94A 1UH4A 1GG0A 1V7YA 3SCSA 3FNDA 1DJIA 3RCYA 2WZEA 3D5HA 1M7XA 1HJXA 1CLXA 4ZBCA 3UWEA 3BMXA 1A3XA 3C2VA 4GYPC 2GPTA 2BY2A 1XRSA 5FF2A 4BQ2A 3THAA 4A3QA 3ZJ6A 4GVHA 1AW5A 2ISVA 1ZU8A 1DHPA 4UFJA 2ZRZA 1Y65A 1O60A 3B05A 4TQTA 4GBUA 3VGDA 4O1CA 1SSGA 1FWWA 3ANYA 3O6DA 4FSAA 4YXGA 5FF3A 4US5D 5ABGA 2ZUMA 3A4XA 2OOFA 4R88A 4S1FA 1OEPA 4K1GA 3GW3A 3WUBA 2AQWA 2QAPA 1JDFA 2DPEA 4R34A 2TPSA 1YPFA 3PUEA 5DBUA 1ZFJA 1UB3A 3MU7A 1XIIA 4GIEA 1KM0A 2QYGA 1EJSC 5HWJA 4IIHA 2P0IA 4J3VA 1LT7A 4IUOA 3BLLA 1ZCCA 3OVPA 4US5A 4QDWA 3BLPX 3W07A 5J04A 2B4GA 4UTWC 3FXYA 3WQWA 4DXXA 5D9NA 2NV1A 4C7GA 3LPGA 4PTVA 1XX1A 3PJTA 1E1CA 3B8IA 1UKPA 3K30A 4FOKA 3ZJ7A 4AY1A 3EYPA 4FEZA 3MJMA 3TQPA 2W6RA 3VM7A 3OHIA 4L5ZA 3WMBA 2PD9A 1BSIA 2FFCA 1JZ6A 5BOOA 2CITA 4OECA 1OYBA 3GDTA 1EX5A 3AYVA 2X0SA 3G2GA 3STGA 2VFHA 3C0QA 3KZSA 2BV9A 3ATZA 3LNPA 4QGCA 1DIEA 3TYEA 4DIAA 3UG8A 5AY7A 1ZUAX 1Q6GA 3ECQA 3VMNA 2D73A 2OEMA 3GUWA 1UUQA 1S5VA 4UOZA 1H51A 1G69A 1MUMA 3GR7A 3JR2A 4GY1A 1UIOA 1ADDA 1EDQA 1GOXA 1E0WA 4Q4QA 1TCDA 3FAXA 3E0WA 4W9TA 3EWDA 1EA0A 4JQ1A 3H8AA 2FJKA 1G94A 1WZMA 4QDPA 3IAPA 3VIIA 1Z32X 4PBFA 5FSDC 4DN1A 1UBSA 2H90A 2FZDA 4ICMA 4GQQA 4PCFA 1JZ7A 4JFVA 3WEZA 4QLJA 3RILA 5H8MA 2WMGA 2CLLA 2BSLA 2OZTA 2VXNA 3WK3A 1YW1A 2IPWA 3TN3A 3E6EA 3ELFA 1MW0A 4AB4A 4PEEA 4AIOA 1SUXA 2PWUA 2DH3A 3CB3A 2POTA 4BHYA 3T4WA 4XTIA 1KV5A 1NDVA 2X41A 1AJZA 4I8YA 3M64A 4GI9A 3F4DA 2CLEA 3S1UA 4AMAA 1W9XA 5CG0A 3PB0A 3NEVA 2XG9A 3N4AA 2BP1A 1POJA 4HT3A 2CETA 1ZY9A 1TX2A 2VVNA 4N2YA 3AXMA 3W7MA 4I5UA 3RN6A 3CWOX 2GYIA 4P5UA 1HQTA 2QGYA 4RNIA 3C2RA 4KGLA 1UD3A 2XM2A 1V8EA 1X98A 3C56A 1UKOA 2VENA 3RM9A 2XFWA 2PODA 1XDMA 3WQ8A 4M24A 4AHPA 4K8GA 4AZ5A 2F6UA 3I7SA 3A22A 5A2AA 5KZ6A 4XZBA 3UJ2A 1BEUA 4K36A 4W8LA 5C6MA 2WNQA 1IGSA 3F5JA 4PMOA 3GQYA 3VM5A 3VFCA 4ML9A 1SR0A 2C71A 3BAKA 3OQ8A 4Y8EA 1W1A1 4HPHA 1X38A 1REQB 2WQDA 1ZGDA 3WX7A 2QMKA 3VKBA 1O5QA 3W1PA 3ZVHA 2A3CA 2FQIA 5D03A 2H8XA 1OC6A 5DX7A 4MUPA 1JIBA 2GSEA 5M2FX 3CT7A 3IGUA 3VNKA 1CXFA 1F9CA 4HCLA 4KIRA 1DJXA 4JTLA 4LVFA 1OHLA 3OYZA 2E9BA 4H9VA 3IANA 1GZ1A 3GYCA 1TQJA 5G4EA 3TYDA 5CZKA 3KHDA 1KRMA 1H1NA 2R1KA 2OELA 4TUFA 5HQEA 4JN6A 3G18A 4UQBA 4C6CA 2ZRXA 1GOWA 3IIOA 4ORIA 4ZFMA 4YTRA 1P1XA 4GQBA 5HBFA 4TV5A 3BCFA 2HEJA 1UIPA 3PZUA 1QO2A 1J0JA 4WRHA 4F9JA 4UTJA 1BVNP 5CCZA 4ICNA 3W86A 4GIAA 1FWBC 1LBFA 4K8HA 1VCVA 3MPGA 1QAPA 4QS6A 4C1NA 2ZUSA 4DELA 2ACSA 2Z1WA 4AVNA 2WSRA 1XINA 1KCKA 1LZOA 3AXXA 5D33A 1D8CA 2ZA1A 4HMCA 3RU8X 4WLCA 4PTNA 3VNLA 4ATWA 4DM2A 4WCJA 2OR2A 2OO6A 1VQTA 1XQLA 1VF8A 4U33A 4UQEA 2YYUA 2OB3A 2Y61A 3NQ6A 1C9WA 2XSXA 1DWFM 3OPSA 3NQ8A 2BGQA 2B81A 3MKVA 4C6FA 3EX2A 2D0FA 2WBKA 3W37A 1IWBA 3B0XA 1EWEA 4ZEPA 4ZODA 4IPPA 4IL2A 3IJLA 5K9XA 1JYWA 3GTXA 5L6UA 3T6CA 1QWGA 3ZQ9A 1EP1A 1DQXA 1AFSA 1JCYA 3TONA 4A22A 3H7UA 1VS1A 4HA1A 1X6NA 1V0MA 4PTDA 2OGJA 1D8WA 3CGTA 5D2YA 3WDQA 3IJ6A 3RO8A 2O92A 2QV4A 3AMCA 4HOXA 3SCRA 2PF0A 4DZHA 1UUMA 1QO5A 4QX4A 3UG5A 3HQOA 4P2VA 3ZFHA 4OBRA 4G5DA 5L9FA 1E72M 2GVYA 1YXYA 4Y9PA 2CNCA 5G2IA 1E70M 5HK4A 3VIJA 1JNDA 3W85A 4F2BA 4U3AA 3RPMA 1LWIA 1CCWB 3HPSA 3V4BA 2YB4A 1Z89A 3AQUA 2MNRA 4E5TA 2G3IA 5CSYA 4S3GA 3N2OA 1R7OA 4IPNB 4RUBA 2Y4SA 3UZZA 3REQA 3GTHA 1M41A 1EPXA 1U5VA 3MKCA 4DXKA 4Q7BA 1C7SA 3BGGA 1KCXA 3WNNA 5ABEA 1V3LA 3VNYA 1X8CA 3I3EA 4G8TA 4UOQA 3TAOA 3BVJA 3VO0A 3NGJA 5ECVA 3MVIA 3DEQA 3KUMA 9XIAA 5FJUA 1KCLA 3UWWA 5D9OA 2FLIA 2I16A 3W6YA 1YRRA 4BF7A 4XB3A 3T8QA 4YTQA 1P6BA 2Y7EA 3SY8A 3L4TA 3WQPA 4F2UA 1UW9A 1SW3A 3MDUA 2WLYA 1Q2RA 4C6EA 1A0CA 1LQ0A 4LGXA 1Q6QA 4DO5A 1BKSA 1KGXA 4EWND 4Y9NA 2J24A 2WCGA 1VKFA 2QZRA 4AF0A 1WX0A 4LX4A 1TTQA 4EAMA 1UR0A 4H00A 3TW6A 2B0MA 3CEPA 4QSFA 4B15A 4Z2JA 4M82A 4AWTA 3PK7A 3WLNA 3VOFA 5CQ1A 3NL3A 3QGVA 5I02A 5DXYA 3UF9A 1O5RA 2WZHA 1J0HA 3N2BA 6ENLA 4F40A 2I5QA 2REQB 4V33A 2OLSA 4NJKA 1X1OA 5CG7A 1JL8A 2Y7DA 1JQVA 1PTGA 2VGBA 3FX4A 1TV5A 4XZLX 3HOJA 5C0QA 2YX0A 3S46A 2WQPA 1QUMA 3ZLHA 3GU9A 1HL8A 2VUNA 1OZQA 1GQKA 3VGGA 1C29A 1Y7VA 4IIEA 2ZCGA 1LF1A 2BB0A 3O05A 3CV2A 1S39A 1K8CA 1UD8A 3ATYA 3LPFA 1M7PA 3DYOA 5M17A 1F05A 3ABOA 1TRIA 6A3HA 1PAMA 4FI4A 1D3CA 2DIJA 1BQGA 1XS2A 2CU0A 2RHGA 1EYWA 2PWEA 3S1GA 2YCKX 3TWBA 4I7UA 1O5XA 1NARA 1T7LA 5D2VA 5LNVA 3F03K 3UZXA 4C7FA 5H8PA 2ZRWA 3M0YA 1HJWA 3AUOA 3G1VA 1RBLA 3SIZA 2OQHA 3T40A 3U7BA 1LWJA 2YCLB 5C70A 1KWKA 1UR3M 4KFOA 3KS6A 1QNOA 5AHNA 5EU9A 4K8EA 1WUEA 4LUTB 4W89A 2Z25A 4QLLA 4RDWA 1E56A 2HS6A 3R1ZA 3T0DA 2YDQA 1VC4A 4M3PA 4MFEA 3CUXA 1JCLA 1BYAA 8A3HA 3A13A 3AHZA 1QPNA 2QV5A 3MC5A 4WSJA 3FJLA 3W7EA 4X9YA 2DZPA 4P7QA 1K03A 4J3UA 2DIEA 1ZJHA 1GWJA 3W0KA 2HBXA 4ATLA 1K1DA 1WDQA 3QHNA 4MADA 2XDFA 3O7UA 2PS2A 1E4MM 2NUYA 1M53A 4YVPA 1WUFA 1OB0A 4O1FA 3N12A 1A4LA 3W2KA 3W7RA 4AU0A 3GG1A 3RAOA 1HO1A 3AISA 2OZ8A 4LRSA 5BOFA 1N55A 4IMFA 3SEPA 3TTYA 5C9RA 2XIJA 1XC6A 5REQB 2XISA 1P48A 4IT1A 2DQWA 1XYFA 2JKEA 2XHYA 1HXJA 7REQB 3KOFA 3TNBA 3W00A 2ZX8A 4L1XA 1R0MA 1W5NA 2WO5A 2GK1B 4IFRA 4WK9A 1DTUA 1JXKA 3T0AA 3EKZA 4TVUA 5GVJA 3U48A 1DL3A 4HK6A 4IMGA 1EJ7L 4KCVA 2WNWA 3HG4A 3NOYA 2J77A 3TZNA 4HMDA 2H6RA 3G1HA 4FLOA 1LYXA 1E51A 1QI5A 3W7DA 1FBAA 4NZ5A 4D71A 1PWMA 1DQWA 5LZLA 1LQ2A 1MYRA 3EEGA 3MA8A 1Z69A 2CBJA 2X1TA 2CBUA 3ZZ1A 3DFTA 1TX0A 1TTJA 3NQGA 1J01A 2VO5A 3KBJA 1WA3A 2NW0A 5EA9A 3TX9A 5I5RA 3W25A 2FGZA 1I2RA 4ERIA 5CJ5A 1UWIA 3FAWA 2OCZA 4A8NA 3N34A 2V3DA 3GDKA 4GNJA 4MZYA 3W73A 4MLRA 3P80A 1S2TA 3RRAA 3FXGA 4KEZA 4GY0A 3PZOA 3I10A 4NZ4A 1HP4A 1UR1A 5M1TA 2CCRA 2NSXA 1Y5VA 3GNDA 4XKYA 3R43A 1TPWA 4Y6GA 1FWDC 5I00A 1WDRA 2Y63A 1T5AA 1ME8A 3TN6A 1YXDA 2YLLA 3VDBA 4S2BA 3TSMA 3A9BA 1GJPA 4DJFA 4RKAA 3W22A 3ISIX 3S2CA 4S39A 2CERA 2WHKA 3CMGA 4O50A 1VYRA 5F2GA 4IJCA 1TREA 4MPKA 2R8WA 3W72A 1EJTC 2VD8A 4MHBA 2D2GA 1E0TA 1GOKA 3CS2A 3WQEA 2X0YA 3FA5A 1XLKA 4WGHA 2G3MA 4AZGA 4WY0F 3L23A 5DMYA 5E70A 2BOEX 4H9TA 2Z1BA 3SCUA 1XYMA 2CLKA 3GXPA 4H1ZA 3R0DA 2X40A 1JGMA 5I3FA 2WVTA 1ZALA 4EPBC 1E9ZB 3E1F1 4AEFA 2E6AA 3KVMA 4I9TA 3IGSA 4DO4A 1XRFA 2CWNA 3ARWA 3OZOA 3O6CA 4HN4A 4IISA 1MWOA 1FWRA 3W70A 5F4XA 1XPGA 2W62A 3IVUA 5ENLA 3VMOA 3VDCA 1OFOA 1CEOA 3XINA 3OP2A 1AVAA 4LXFA 3BGJA 4QS5A 4CNPA 2YJQA 5E6YA 1UR9A 2B7PA 2DT3A 1RJRA 2A21A 3L7RA 3TN4A 4MKVA 2J9ZA 2VT0A 1XPYA 2XZ7A 6REQB 3O6YX 2RGLA 1XIFA 1MMFA 1MUWA 1A47A 1Q8JA 3ZT6A 4RE2A 1TJPA 5FACA 4A8IA 2FZBA 2HVOA 1K7XA 3NQDA 3QN3A 1SZGA 1FVPA 4YS1A 2OT1A 2PDKA 2JF6A 3N6QA 1AA1B 1O95A 1EIXA 2XN2A 1TPEA 4E3TA 3SBFA 4IIBA 2XWDA 1XUUA 4HZ7A 2Y8VA 3WNKA 2YFOA 3BICA 2NX1A 1NDYA 2F6XA 1RK5A 2I5GA 4IGSA 2VHLA 2X42A 1RK6A 2YA1A 4JIEA 4RW3A 5FI8A 4X61A 3WK0A 4I9MA 5HWMA 1GTEA 5J5RA 4JHOA 2O55A 3DBNA 1A5MC 4ZB5A 1RPXA 3RX2A 1AL7A 1K02A 3BLIA 3E38A 3MUCA 1OK6A 3MW7A 4IX2A 1FKWA 1QJWA 1CIUA 2OT0A 1A53A 2PSNA 2ZZ2A 2NQHA 4K3ZA 3AJXA 4IL0A 3HPXA 2OSWA 2NUWA 1GKRA 3DOPA 3V5OA 2QUTA 1R3VA 4MNKA 3CHEA 5K4XA 3S3GA 4J3SA 2OODA 3H12A 1KFKA 1AW1A 5CC3A 2Q09A 4AISA 6CGTA 4CU7A 8RUCA 3E0FA 2FTPA 1XH0A 2GGHA 4YHEA 4V15A 4Z42C 4WY0A 3G6LA 2VUYA 1W91A 3D46A 3MZ2A 2QULA 1DWIM 4ACZB 1XCFA 1VJZA 3PF3A 1FWTA 4UZUA 3N2TA 3QKZA 2C0AA 4IZGA 1CXKA 1FFRA 4DPQA 2ZBTA 3OU8A 4L9YA 3NDYA 1H4PA 1QPKA 2YR1A 4HNLA 1PYFA 3RDKA 1G01A 2FTYA 4HYRA 2E25A 2RFGA 3UETA 2A5HA 1EC8A 3VIOA 2GWNA 1GVQA 1EA9C 3AS2A 4HNVA 2DW6A 4PYSA 1W32A 3CLMA 1V0KA 3T4CA 4JTCA 2FDSA 1R3SA 1QBBA 4NRSA 3EZ4A 3WLLA 4QAIA 1KQZA 1R5YA 3OW1A 1HL9A 4JDBA 1YBQB 3VIPA 1NWSA 1L9WA 3CAWA 1S5WA 4M81A 1QBAA 5A69A 2A79A 4M51A 4AG0A 4DZIA 5DT7A 2ZUTA 3DUGA 3B4UA 4LVBA 1B9ZA 4PSRA 1BGGA 5FJTA 2CZFA 3QC3A 3RCMA 4H9UA 1A5OC 5A2BA 3W2MA 3BV7A 1XCXA 1XYZA 1E6PA 4REQA 3E02A 4MWAB 5DXXA 5D4YA 3OB8A 1OK4A 1OFQA 3NSNA 2DVUA 3N4FA 3H21A 3HZ3A 1CDGA 3AYSA 4JX5A 3QMRA 3QLLA 4N6EA 3SM0A 1UWQA 4GX9A 1B3VA 1YNQA 3KOWA 4PMXA 4DBDA 4XAZA 2G96A 1L2UA 2VI0A 2R1LA 3AMGA 3UD6A 1KKOA 2E6DA 3PWIA 7ODCA 3FGCB 1J0IA 3GH7A 1TVNA 2ATMA 1YDNA 2Q8ZA 3GUGA 3Q2DA 4XO6A 1EPVA 2GDVA 1UROA 3KBWA 4D6FA 4XBSA 3EMZA 4BKNA 3KWXA 3GM8A 4KWUA 3GTFA 3CZLA 1XD1A 1XF0A 2I5IA 3Q58A 1JZ2A 1X6LA 4X22A 2QJGA 3SO7A 2OO0A 1BWLA 3G8RA 3PZVA 4PUNA 1A5LC 2C13A 2NT0A 2VDIA 2BHZA 3BW4A 3MYOA 3MSDA 4Z08A 3AIUA 3VD5A 3QOKA 1D3HA 3MCOA 1V3MA 3WF2A 1CW2A 1J0KA 3WO8A 4C6NA 3CUGA 4KFPA 3IV3A 4M1BA 2CHOA 1G7VA 3VOIA 3URNA 3L5LA 1VHNA 4OOZA 4HPXA 3RJYA 4PCNA 3CZKA 4J3XA 4Y90A 3KTXA 4KESA 4IQLA 1KRCC 4JBRA 4MTVA 3D3FA 4MVAA 3VPLA 3CQHA 1GQIA 3QHMA 3M0VA 3HU7A 1IXPA 3H70A 4CNOA 1E0VA 3HMCA 4NKCA 1IT0A 1KXVA 2OX1A 1VBJA 1GT8A 4Y9AA 3MBDA 4F79A 3VKAA 4CD6A 4DM1A 2ZX5A 4Q8VA 3VCCA 3W1LA 4R27A 4ADUA 1I2QA 2XVNA 3PZTA 4Y7EA 2HK1A 3FVMA 4XD4A 3APGA 1Z42A 4LUSA 4OVXA 7TIMA 4AC7C 1LL4A 1UG6A 1PX3A 2BG5A 2PDYA 4MM1A 4AYGA 1HFBA 2VZSA 1KM1A 1NDZA 2QCLA 1E15A 1ZBCA 3W1XA 4FOJA 3SRFA 3NZGA 2V5CA 4HP5A 3DYPA 1PPIA 1UASA 4K2SA 3BJTA 1SZNA 2R1NA 3T0CA 5FF0A 5LNWA 1DXEA 1DVJA 5EY5A 3W7JA 2ZIDA 4AZCA 1YTDA 3LCLA 1LJYA 3O07A 3LRKA 5CBJA 2Q3OA 4R7JA 3KP1A 1ONRA 1UQYA 4XUGA 3MMWA 5BMWA 2G8ZA 2Y89A 3IGHX 2J7DA 4C6LA 3BK0A 3L2LA 1M1BA 4FF7A 3KX6A 3K5XA 3EKGA 4CU6A 5A6MA 5AB3A 2VFFA 4POCA 3N2CA 4UMAA 3N9SA 4PB5A 4OZOA 2WSKA 1IIHA 3W7QA 5AC7A 3OGSA 4DHGA 5IBXA 4GNKB 2ZXAA 1NM9A 3UJFA 1IXOA 1YEYA 5JVLA 1E40A 1W1ZA 1OINA 1WDDA 1B3ZA 3EOLA 4JQ2A 1EB3A 4ILSA 5H1WA 3NXFA 1R3RA 4UFHA 3LZ5A 1XGZA 4KMQA 3TXVA 3ARPA 2EPKX 2PLKA 3F5LA 4NAFA 4CQ8A 2ZZ7A 3TTSA 3RRXA 2FH6A 5HANA 4KEMA 2XSAA 1CXEA 4H6RA 4B2DD 1TCMA 2CLPA 2NXGA 3S1XA 2CESA 4BFAA 2Z1SA 1ME7A 4N0RA 4UNIA 3QZEA 3DIPA 4EXBA 2GJPA 1J11A 2QHAA 1ZS2A 3MZNA 4Z1YA 3PPCA 3WLIA 3P61A 6TAAA 2V5LA 1BRLB 4Q8UA 2X1RA 4ERAA 5IDIA 4NU7A 4MNLA 3LV5A 1NWUA 1MQQA 3TOPA 4B2DA 4YIWA 4HU8A 4UR7A 4JTFA 2LLEA 4MLJA 4ZL1A 3DFSA 2D0HA 9RUBA 4FLQA 4YNGA 3NR0A 2J6XA 1TIWA 1JCJA 3M07A 5BXSA 4PMDA 2EF9A 2YKKA 2ZDRA 4FXJA 4U5IA 1EYEA 5HULA 2DZTA 3VKCA 4RZ4A 3EX1A 4ZE4A 4QLKA 1X1ZA 3M47A 3IAQA 1JQXA 1YE4A 5HUOA 2C15A 3ARVA 1MNZA 4HHMA 4NASA 1MEHA 2J27A 3TMQA 4O8RA 2PRMA 1FUYA 1QOXA 1OADA 3T09A 3SCVA 1Q6FA 4LCQA 5GJNA 2HWGA 2Z0IA 2PDJA 5FOOA 3DESA 1PWLA 4AWSA 1VIWA 5GNXA 3AC0A 1AQFA 3BE7A 4PFMA 4WGXA 3CZ8A 2RJGA 1ITCA 5A6BD 4J9JA 4ZTYA 4I5XA 1PDYA 3GG8A 4IX0A 3BANA 4NZJA 4DLFA 4DJED 1LL6A 2X7VA 4OJYA 4B5XA 1TV7A 4MPQA 3LSCA 4J3WA 4BS0A 2X09A 2Y5SA 5HAOA 2PC8A 1XCWA 4JFWA 4HHPA 5LNRA 2JF7A 4GFSA 5I3KA 2ZRUA 3O9NA 2ZXQA 1MI3A 4OV9A 1Y5XA 4NSBA 3DCPA 3QYSA 3SN0A 5A6BA 2EQDA 1UP3A 3K46A 4EXQA 5E5CA 3UWYA 3ZWTA 3O8AA 2PRHA 1RXOB 3UU0A 3WLKX 4DJEA 1XBVA 3JS3A 1VB9A 3G1YA 3PTKA 1E6ZA 1EBGA 1TB3A 1P43A 4ZO7A 8CGTA 1B3WA 3IRDA 2CXEA 4IMEA 1EOMA 4UWMA 4GX8A 2RGMA 5RUBA 3CUHA 3TC7A 4LNCA 1NY1A 2PDFA 1C9DA 4ZR8A 2Q02A 1TJ0A 3S5OA 3TIMA 5EMUA 5I3IA 3CZGA 1GONA 4ZXLA 1C91A 1KNWA 1OF6A 3OGRA 5JIWA 1AQMA 3CB8A 3RR4A 4B91A 3SUWA 4PRTA 4YU1A 3UCDA 3U5UA 3SIMA 1MXSA 5CAKA 3QV9A 3B8SA 4OUIA 2C79A 2AAAA 4QAWA 2ISDA 3ZYZA 1PZ3A 4DYEA 2WXDM 3LG3A 2CWXA 3AMKA 3K4DA 2HXUA 2BS9A 4G1NA 5I24A 4Q8PA 1KBKA 1U22A 5HDRA 1B9BA 3L65A 2E9LA 1RY0A 4W7VA 3KFTA 1KQYA 1PE1A 4E4UA 5KETA 4NI8A 4LQ1A 3D0CA 1VLIA 2B7NA 3UXKA 3WBAA 4BEUA 3WLJA 5CEWA 4AD4A 4GVIA 3NA8A 3WF4A 2BWGA 1W9BM 2G95A 4Z0JA 4C6PA 4B90A 4BF9A 4UTKA 4XSMA 4NUWA 4A8LA 1R9ZA 4D6JA 2Z7GA 2PBGA 2P1FA 1E6XM 4XD3A 4CVUA 3B97A 4LBUA 3V0UA 2WZMA 1NP0A 3ME3A 4FNTA 3H2AA 5ABFB 1DJGA 4XIMA 5G2WA 4RE0A 3CJPA 4BK9A 1SJBA 2D2JA 2PPGA 1N82A 1VPYA 2Z28A 1QHPA 2EPOA 4MAVA 3B8DA 5G1MA 2KX9A 5DCEA 1EF3A 3P60A 4I9AA 1KKRA 5FEPA 4DJEC 1XDLA 3DYMA 2Y0FA 2Z1XA 3UYCA 3NO3A 4FMVA 3V1HA 1HJUA 2V69A 1EO7A 2WPGA 2Z27A 4MUZA 1O12A 1ZBVA 1H62A 3IEBA 2FGBA 3GNPA 4IJRA 4IQEA 3W24A 3WD3A 4GUIA 2OMAA 1PKYA 4Y2WA 2WWCA 3WLQA 1WZLA 1LDCA 2OOGA 3NSMA 1SJCA 4N02A 2OSYA 1UC5A 1F6KA 1ICPA 1IEQA 3R89A 1I0DA 1OGBA 2IQDA 1V6UA 5A6TC 4NXKA 2WMHA 3NDOA 3UG4A 3GDMA 3K2GA 3KTSA 4F0RA 4O1DA 1JNEA 3LUTA 4DVOA 1V93A 2WVSA 2HXTA 3RPDA 2J25A 4HTYA 2J7BA 3NXLA 3NL6A 4BQ3A 1PCWA 4G6CA 1M68A 4LBSA 3EDKA 1CYGA 3E74A 4J3ZA 3WD2A 2DVTA 3BWWA 4RW5A 2WBGA 4AD1A 3NWRA 2QS8A 3DU0A 4QISA 2VFEA 1WB0A 2ZZ1A 1MRAA 2DUZA 4QNWA 1ZENA 1HNYA 1JPIA 3R11A 3SY1A 4KGJA 3S42A 3T42A 4CN4A 2BFGA 3AWNA 2Z6IA 4RPQA 1WDWA 2VOTA 3A4JA 2BVWA 4ECLA 2ANUA 3RLGA 1XSJA 3CYVA 3DKJA 4PCSA 1BXCA 3AO0A 4AMCA 2FZNA 3GC5A 2GJXB 3MV01 2C18A 2C8NA 4B16A 1W9PA 4W8BA 1TPDA 3I3DA 4KWVA 4FX6M 3SB0A 3GIQA 4LYRA 1LTDA 2YIHA 3CQ0A 3H24A 4PODA 2A3LA 4A21A 3H4GA 2J66A 5FSEC 1JJKA 2GVLA 4C1KA 3VOHA 4C6QA 4UTUA 2PTXA 3KRUA 2ACQA 1S5NA 3C2FA 1JI1A 2YOCA 4MMWA 3EPMA 2HBVA 1JEZA 4WDWA 3LGDA 3KAOA 4JX4A 2J7GA 3M41A 2ZUWA 2ZKMX 4PBGA 4B5TA 1R86A 3G24A 2J4GA 1JRBA 3CO4A 2PCEA 3BQ5A 1ECEA 3FA4A 1KBJA 2G0WA 3B3DA 3PZIA 3BC9A 1W9DM 5CZ0A 3GXDA 2O9RA 1X96A 3IJ7A 3ABXA 4NILA 2OZ0A 4LC6A 1BSLA 3LRMA 4OKDA 2VEMA 4NVTA 1P1MA 5BW6A 1Q6EA 1GCYA 3GVWA 1GQNA 5D05A 4JFTA 3DHPA 2KZHA 1O6IA 1S3HA 5H91A 3WJWA 1REQA 4ZOCA 3TU9A 2YL5A 2E5BA 1K9EA 3JU2A 3WUFA 4D8ZA 3S6TA 4ICCX 1PTAA 2OQYA 3WUGA 1W1YA 4K7VA 4QRNA 4JY9A 2X1IA 3UNDA 1VRDA 3W1NA 4M19A 3XIMA 1EX1A 1JDEA 1B5TA 5LA2A 1MXGA 1IEIA 2QUNA 4NYYA 2IKJA 1H49A 3W84A 4IF2A 3LTYA 2NSOA 4QTGA 4J3TA 3H53A 1KO0A 4BEQA 3FJ4A 4XISA 3I7QA 1P6CA 3W01A 1XSKA 5T8GA 4HB7A 1MDLA 3L5MA 2V38A 3PBWA 2J8TA 4LNYA 2PDUA 2DT0A 4N4QA 1J96A 4GJ1A 3MMDA 4H8VA 4JIQA 2OFJA 4AHOA 3DBPA 4QNEA 4GUHA 3TTEA 3VNMA 5LA1A 4UTLA 1QK2A 3ID7A 4TO8A 4HU4A 4J28A 2P3EA 1OZMA 4GJJA 3CAKA 3B9OA 3LCIA 6PTDA 1GPFA 1DJZA 2YL6A 3LGGA 4ZB2A 3LHZA 4BI5A 5TBOA 1DYSA 3MP3A 5FF7A 1C3FA 5EYWA 4AHQA 1LROA 1TWZA 3N2XA 1GGOA 1JUEA 2PWVA 4QP0A 3M7WA 1OYAA 4CN1A 3BSMA 4AWUA 2ALDA 4ADSA 1SJDA 5EMMA 3TSDA 4AZ7A 3WBEA 5EB8A 5AYZA 4GMEA 1F8IA 2AGTA 2VCBA 1I8JA 2EEXA 3IUHA 2YXOA 1Q6OA 1MW3A 3F2CA 1TPUA 3WF1A 1UPPA 5D09A 1I75A 2WC7A 1ZLPA 4UXDA 5BRPA 3NYDA 3G5EA 2QJNA 4LSBA 2ZFAA 4JTIA 3MQTA 4DZ5A 3EX6A 4L65A 2X05A 3B9AA 3PNUA 1PZ1A 4C7DA 5M3WA 2A7NA 1ISVA 2YFNA 1RHCA 4XV0A 2Y70A 3G0UA 2A3BA 1W9VA 2PDMA 1FX6A 1LLOA 4IXHA 2ZQ0A 4Q33A 1ADOA 1E9YB 3TFXA 2J75A 3L4YA 4JHMA 4TX6A 5HMEA 4JDYA 3UBPC 2ZADA 4UCGA 4EF8A 5DMNA 1PCKA 1GVSA 3S2JA 1NEYA 4FIRA 4RLIA 2GOUA 3H22A 3VIFA 4DNHA 3A5FA 5C9XA 3BSHA 2EKGA 3RU6A 2I9UA 3RJXA 2QDDA 1LL7A 1DJYA 4UTHA 1NFGA 4ZQMA 3LHYA 3W7HA 3DFQA 1R9YA 1WQ5A 4AIUA 1V77A 1W37A 1TWWA 2W0UA 1SVDA 5LIWX 1SZFA 4KWOA 4HJFA 3KDNA 4GG9A 1GVOA 4FZIA 3HPFA 1Y5WA 4GH3A 1CXIA 3WQ6A 3WJSA 3AIEA 1DWAM 2VFDA 5CZTA 1TPVA 3LSBA 2WNZA 3VCRA 1XQKA 4O57A 3J7HA 2AKZA 8XIMA 2NX9A 3TA9A 1SO6A 1S46A 2V5JA 4JTEA 5GNZA 5KINA 4GRSA 3E96A 3KTCA 2VM8A 3AXKA 4J1OA 2NQ5A 5K4ZA 3T7VA 4HU3A 4AW7A 4OOUA 5EL1A 3DKLA 3WQ5A 5LXXA 4LEFA 1RA0A 5IHRA 1IF2A 4GCAA 4AQLA 3PFRA 3VIHA 4Z2GA 1XLCA 3HGOA 2XTKA 4HMEA 4IP7A 1SQ7A 5HNRA 5C2XA 4LANA 3WN6A 2JKAA 3W7NA 4A2RA 1QTWA 2QIIA 4J2PA 3TROA 1PYMA 2UV8G 4FXRA 2FVMA 2Q8LA 4DUVA 3M0ZA 4CCEA 3PM6A 3L12A 5E1QA 3A64A 4R5EA 1MXDA 4MYXA 1WBHA 1W3JA 3ARYA 2REQA 2ZUNA 5JU6A 2B7OA 3N1AA 1SW7A 3L21A 4HQVA 2UBPC 5LGZA 4O11A 1OFAA 4P8VA 3JZUA 4EK7A 1M04A 1RJPA 3OVGA 4C5ZA 3QPYA 3G1SA 1VLWA 1YNYA 4XK2A 3FN9A 3M44A 4K38A 1J10A 3AOFA 2R1MA 3LHVA 3WDRA 2WVVB 3QH2A 4U3CA 3TYAA 4AZBA 3TW7A 2GDQA 1BFNA 1UA3A 3OG3A 3HGRA 3P0WA 3BJFA 1I45A 3LX9A 1Q6LA 3B8TA 3ZS4A 3UFYA 3JZEA 4GIYA 1DIOA 4DBWA 1YIXA 1HKMA 1V6WA 2WANA 1UA7A 5XIMA 1R87A 1UYQA 2WW5A 1YYAA 5F4SA 3P8IA 3EWYA 1WKFA 4QG6A 2DVXA 4MB5A 1QW9A 4XZMX 1ZHAA 3S5NA 1KR0A 3I68A 2VWSA 3A4WA 3O1NA 2NVDA 4UR8A 2PTWA 4UUIA 4L80A 1F7BA 5D37A 4QJ3B 4HJWA 1J9YA 2VGFA 1FP8A 2Y85A 3RM8A 1LUCB 2NQLA 2V30A 3CLWA 4M6QA 1JUKA 4H2HA 1ITXA 4TVDA 4S23A 3NOEA 1KFCA 2JALA 3FKRA 3HIJA 9CGTA 3CIXA 4AC1X 3CO8A 3FEQA 1VBHA 3STFA 4DNMA 1VIZA 3GNNA 3HO8A 2VR4A 3LHUA 5CPTA 1M65A 1NF0A 3D47A 4BWLA 4N9BA 1LT8A 3K8LA 4ZOBA 4H9XA 2R9RA 4X2RA 3HGJA 4MB3A 4WJEA 4EPDC 4WKAA 5HMFA 3L4XA 2PDQA 1W17A 1TV3A 3H2CA 1B57A 3KEHA 3WDHA 4JIHA 4GI6A 2DEPA 2JEQA 4HTBA 1M3UA 4AY8A 1ISYA 4I90A 4IICA 2VEKA 5REQA 3M1ZA 3KCOA 1D3GA 3W1AA 4EPKA 1WDSA 1MQPA 4YN5A 3GX9A 3CH0A 3R94A 4NNBA 2O7SA 2PA6A 3PZMA 6XIMA 4YVVA 1NOFA 3VINA 2GK1A 2B31A 1PO9A 1KM4A 2QPUA 4AZIA 1L6SA 2NXHA 3KBVA 2AMGA 4UB9A 3CL7A 1UWSA 3LPOA 1PV8A 4NAFB 1XGEA 3VVGA 2PGRA 1XISA 2ZC8A 1VPQA 4NZ3A 7PTDA 4M6PA 3CV6A 4XWUA 4UTFA 3VX0A 4GABA 4XD6A 4LAUA 4GXPA 4F0MA 3MCNA 1FWSA 3MP5A 4NY2A 4EACA 4DO7A 3CHVA 1KTBA 4O4VA 4DF2A 2J47A 2OGYA 5GJPA 3E49A 3DG3A 1IQ8A 2BNJA 1V5XA 1ZP4A 2CFFA 3M0JA 2YA0A 5BWFA 3POCA 1KFJA 4R33A 4S3JA 2C0HA 3NIYA 4GHRA 2MUCA 4KEVA 1GZJA 3QXBA 1NDWA 1YHTA 2XYLA 1U1HA 2PU1A 2GFTA 4EE9A 3TTOA 3B9DA 4O54A 3VYLA 5B80A 3SI9A 2P0OA 4XAGA 4FNPA 2VQUA 1H1ZA 4IJBA 4NIRA 4AD5A 4BWLC 1WKDA 3ZIZA 3MSYA 3CUIA 3VC6A 1FWEC 3KOZA 2G97A 4YL2A 4PUUA 2WPBA 4RNHA 3GIYA 4HNNA 4ZA0A 4EF9A 2XVLA 5LIKX 3MYPA 2YDAA 4ENLA 5EPDA 3ZSTA 4H4IA 4J27A 3QFEA 1IR2A 4Q3MA 1GHSA 1G9HA 4OBSA 5EFFA 3V75A 4RCXA 2NQ9A 3K8MA 2QVNA 3ICJA 4DLMA 1MDRA 3WENA 2WHLA 2GJNA 3FA3A 3WH9A 5JH2A 2YSWA 3QW4B 3NQMA 1IGWA 4WSHA 4DAIA 2FGLA 1ADSA 4D72A 4K37A 2G41A 2E3ZA 1CB7B 1FWCC 4C6IA 4L4MA 3MS8A 1RQBA 3K1DA 2PDIA 1NH6A 2QCHA 3ZXWA 3V16A 3GLCA 5BWAA 4ORMA 3V0TA 3W02A 1LP6A 2ZDSA 1GOOA 3KL3A 1N8FA 2DV0A 4Q6JA 1G5AA 1KFLA 2JEPA 1YXCA 4O10A 1H63A 4RDYA 4DF1A 1RP9A 2HMCA 3LGEA 1XG4A 4ZO8A 1S2UA 1U5HA 4U2ZA 3W1RA 5A6LA 3SRKA 1EZ2A 3DGBA 3IARA 4CD4A 1PZ2A 4IHCA 6REQA 5JUVA 3UGVA 2IKIA 1TV4A 2PGEA 1W3NA 1K9DA 3NL2A 5C5YA 4W7WA 4WOZA 5MKGB 2YYTA 3Q37A 1TE6A 4KRUA 1BVZA 1P4CA 2OZ3A 2CXGA 3OA5A 4JYDA 3RXZA 1EC9A 5BXPA 3IWPA 2VZVA 1PL9A 3BAIA 1ISWA 2PDWA 4H3DA 3WL0A 3CNYA 1RQEA 4CKQA 4V27A 1OY0A 4MB4A 4QSHA 1JF6A 5K7JA 1WNOA 5BMXA 1MW2A 1BXNA 4PMYA 4GYFA 1UCWA 4GUGA 5HOSA 1FWJC 4GD0A 4XZWA 1FQ0A 1ALDA 1GEQA 2X30A 2PDXA 4JTKA 2PDCA 2GSHA 3WLTA 3FDGA 2HZGA 3KOYA 5CLTA 3SDOA 5CKSA 2Y7FA 3AI0A 3THCA 4FLRA 1IXQA 1S2WA 4M7SA 4CNUA 1R2SA 4UMBA 4DBSA 3AU2A 4GC3A 3NQBA 4LALA 1F4HA 7XIMA 3NSXA 1Q4NX 1TPB1 1XH2A 3WQFA 3WF0A 1IEWA 1F3TA 4P8UA 1UR2A 3BAJA 2E9MA 3USZA 2F9RA 1AMYA 4LOCA 4LYPA 5BRBA 5JBDA 2NT1A 4GVGA 4RDVA 2GUBA 4MJ4A 2QMJA 4B5NA 3BW3A 3AYRA 1H3GA 3BDKA 4FF5A 1DQUA 2PUZA 1IE7C 2QDGA 4B3ZA 2W5FA 3WUEA 4MNJA 2Z4GA 2G5WA 4JYFA 1EC7A 3E2RA 1EKOA 1T8QA 3AIWA 2F2KA 3LK6A 3PBGA 4K68A 1CECA 3L4WA 4L6HA 1F74A 4ACZA 3AHYA 3B9NA 4A3YA 1AQ0A 2PGWA 4HSHA 3VD3A 5C9WA 3SCPA 2YXGA 1C8VA 1EFZA 3E2QA 4PGLA 2OQLA 3PN8A 5A6KA 1AH3A 2CBIA 3UA3A 1ZQ5A 5H8UA 2WKJA 2EAWA 3OLDA 3PSWA 3DFHA 1E6SM 2WJEA 4FHAA 4JL1A 4ZOEA 4HNCA 1PS9A 2JGYA 4UMCA 2BTMA 4JIIX 3RHGA 1XLMA 1OX5A 1V79A 4KS0A 2QW5A 5A8QA 4MWAD 3AIBA 3LYEA 1YBQA 3EOOA 3NAVA 5BYWA 1K8ZA 3ANUA 4WXZA 1OD0A 3GYEA 5A8OA 3PTQA 2W66A 2D2HA 2FMNA 2X16A 3EWCA 1X6UA 4KETA 3DFOA 3QSTA 4XAYA 3C2OA 4QEHA 1N8WA 3W7LA 5HQLA 3VDHA 3UW6A 3CUZA 3B0PA 2J7FA 3SCNA 4V2XA 2WV8A 4GOAA 4FA3A 5T26A 3VILA 1E43A 2YGYA 2Y8KA 4MWAA 3AHTA 2JBMA 2TODA 3PTMA 5FA5A 3SQMA 1ELSA 2UWFA 1PKLA 1R2RA 3ZMRA 4GVFA 1QWKA 3GNOA 3TUUA 1M5WA 1CGUA 1TQXA 2FFIA 3HPAA 2NLYA 3E3HA 3VIKA 3FGCA 1XIJA 4XAPA 4LTSA 1JCXA 2GGEA 1FHLA 3P82A 3EDJA 3OVQA 1PIFA 1FWIC 5E0KA 1UOKA 4MY1A 3WNOA 4BA0A 3THUA 1NOUA 2TRSA 1XYLA 4WXYA 2C14A 1UKQA 1T99A 5FJRA 3N6HA 3P67A 4UBPC 1ESWA 3AWOA 1EJXC 4JTJA 3CWNA 4I8DA 3AXHA 3L2MA 3UWVA 4LPCA 3CAQA 4GLEA 3IS4A 3SN4A 2VEIA 4JS3A 4LRTA 5J8LA 1KWGA 4Q4KA 1TRDA 5G4WA 3LTPA 1Z3NA 4V28A 5KITA 2R1PA 1KXHA 1UZDA 1WZKA 1F2JA 5TIMA 3TYBA 4UCFA 1P0BA 2VCCA 3B9EA 4HZMA 1IHIA 1C8YA 2HTMA 1IEXA 2IS7A 2Z7KA 2E77A 3BZGA 3AU6A 1AK5A 2E5DA 3F4VA 3TNOA 4XO7A 4JOMA 3LTSA 2A4AA 5TAOA 3OLGA 4OTKA 4PUMA 1KXTA 1XIBA 1N2VA 4UFIA 2V82A 5CLWA 4PMZA 5A3HA 3LCFA 1V0NA 4UC5A 3V1PA 2WMJA 1GKQA 5D2WA 4AZHA 4FR1A 3AIRA 3HG5A 1PJ9A 3CU2A 3R6IA 4FNRA 4MWAC 3LI1A 3QZAA 4W84A 3W2LA 5E6ZA 3URBA 1TR9A 8TIMA 4LVAA 4A4AA 1UH2A 5E0CA 4DF0A 2ZZ6A 1U30A 2TAAA 1ZJBA 3GU2A 5MF5A 1D9EA 2VJXA 4MGGA 4GO9A 5FAGA 2A0NA 2BMBA 3GFZA 2I17A 1JZ4A 4PTXA 4JCMA 3RM4A 1MFVA 1XYCA 2XGZA 2VEFA 4K1WA 3L4UA 5I78A 2NV9A 4GA8A 5FJPA 5AC4A 5CGMA 3ALGA 2YXXA 3GZ3A 4DI9A 1I2NA 4R53A 1F3XA 3TDFA 4C6BA 3LZ3A 3EWXA 2XFRA 1YTEA 2F8QA 5DT5A 1RD6A 1TPC1 3FYPA 3WCZA 3DG7A 3G1DA 1XM3A 1OT2A 2QJHA 1XLEA 3M5VA 1ZTVA 1XUZA 4JTHA 1FA2A 1K7EA 1DJQA 2XM1A 3AMLA 1SO5A 2DU2A 5I7GA 2OXNA 4JD4A 1CENA 1JF5A 2CLHA 3I6EA 3BCDA 4JTTA 3S5SA 4LAMA 4MDOA 4CD8A 2I14A 3P62A 2Y62A 4EOUA 2BVTA 1VFOA 3UZYA 3CYJA 2ALRA 1VFLA 3NM1A 4CGTA 3FLUA 3RR1A 1V02A 4A3UA 5LA0A 1H11A 1RUSA 4R85A 3CH9A 2P53A 3CTLA 3GVVA 4JTDA 4PSPA 5AN7A 2ZTJA 1SR9A 4JGDA 1AODA 3W7KA 2XH4A 3VZXA 2HDJA 5FL0A 1R85A 3ENLA 2FKPA 4QEEA 4AVOA 1XP3A 2CBVA 1EJRC 5CSSA 3A12A 1C90A 1JGIA 5FEZA 5CJMA 4LT9A 1VH7A 1OFBA 3PBMA 1BPLB 3E0IA 1GHRA 1EOKA 3M0KA 5TD4A 3EB2A 2ZZ3A 3H23A 3KL5A 4KERA 2P8CA 3WDJA 1XBXA 3CMJA 1BRLA 5A5WA 1E4LA 3AS3A 2IQTA 2ZX9A 1TG7A 2JQXA 2BOGX 2BGSA 3GSMA 1XKJA 2JK2A 2YL8A 3ABRA 3LXBA 4TIMA 4ROPA 4LY4A 2WSQA 4AVFA 3QBUA 1Q2SA 1FKXA 2Y88A 2GDUA 3FIGA 4IFOA 2XU2A 3G77A 3P84A 4Z1CA 3I65A 3VD4A 1UH3A 4DEFA 3HFYA 3W83A 4OFCA 3AALA 1CBGA 1YKWA 4F0HA 1TSIA 2AOSA 4N9EA 3BLDA 3N17A 4XG1A 3S6OA 4LV9A 3WK2A 4E8GA 3RCNA 1Q66A 1JR1A 4X0VA 2J74A 5D04C 3PZQA 2DSKA 2GSJA 4E6MA 4NZFA 4LUYA 3CXOA 3BO9A 4WIWA 3THDA 3U0HA 4CU8A 7CGTA 2QJIA 3UY8A 1RLCL 3W28A 4C90A 3RGTA 4YTSA 3GVQA 4F8XA 4LB3A 5FD0A 3W1UA 1J2BA 2OU4A 1A0EA 4QR6A 2HRWA 3L2IA 1NOWA 2D69A 4JN7A 2AQVA 4M8UA 2TYSA 1TWSA 4JKKA 1HGYA 4LB4A 2PLMA 1OFEA 2HPMA 3HTWA 4US6A 1XHGA 3NQFA 3AIQA 1QNVA 3TFCA 5HQMA 1H50A 2WM0A 3BV4A 5LXEA 3MKKA 3WF3A 1OFDA 4QXIA 4J35A 1SGJA 2HNEA 4QBXA 1HUVA 2PZNA 1AJ0A 1ZCOA 3S2NA 1U83A 4O8AA 5C8BB 1KBBA 2FB3A 2EPNA 1XFBA 2CPUA 4UQ9A 4LBRA 2CHRA 3NJ3A 1US0A 3WK1A 3T8LA 1TV8A 3WEOA 4RXGA 2YCIX 4ATDA 2P5NA 3QMTA 3CPGA 2EPLX 1AJ2A 2OTDA 1XIEA 4E2OA 3IV8A 1DIKA 3V5CA 1IXNA 3M5ZA 1RAKA 5AHLA 5JQ9A 3TV8A 2DZUA 2DSVA 3AHVA 1BG9A 2O7QA 4TX8A 3IGXA 2WCSA 4H7VA 4BY3A 1R3TA 4FS9A 5DFAA 4PMJA 1YDOA 4ES4A 4M29A 3H2OA 3MWAA 2YA2A 3OLIA 4IH3A 4JFSA 7ENLA 2EJAA 2OX4A 2VTFA 3MV11 2QUUA 1X1NA 1K9FA 1H09A 1KRAC 1MFUA 4IPJA 4U10A 1EBHA 4NJHA 4IMDA 1B90A 3FFSA 3W88A 4X9SA 1QI3A 4LV4A 4ZE5A 3G3MA 5HA7A 2J6VA 4WJXA 5I2UA 3VC5A 4HD5A 1V3HA 3PR2A 1TA3B 5GNYA 2VOMA 2A7PA 2DT2A 3UZ5A 3IIVA 4PN2A 5HJYA 4KRZA 4LY8A 1EQCA 3WELA 4H83A 3LB0A 4H01A 1M7OA 1W3LA 1J93A 3R7MA 3IJIA 5LSMA 4GC4A 1GYLA 3FKKA 1T96A 1WE5A 3FJ6A 2EPHA 3WMLA 1Q65A 4NRRA 5ABFA 3B0VC 4GNVA 1G1YA 4IIFA 1PDZA 3LHWA 1QNSA 3EA3A 4DWDA 1BYBA 1VPXA 3TEVA 3L68A 3OIHA 3UT0A 4V1YA 1C7TA 1JPHA 1Q7ZA 3TSBA 5CZJA 4HA3A 2RUSA 1NWRA 3CMFA 3WH8A 5CZSA 4KRTA 4XZIA 2HQAA 1QPRA 2QCDB 3WFZA 1SZEA 1AH4A 4R7OA 3BPWA 3W4RA 1Q8AA 4XKMA 3EX3A 1J79A 1WO2A 2WMIA 3A23A 3LM7A 1QPOA 1AH0A 1WAWA 2PMQA 3RO6A 3MT1A 3MHFA 3MMTA 4H8UA 4IIDA 4O17A 1UOZA 3UZJA 3AS1A 4WD0A 1S2AA 1F8MA 3CQKA 1QDSA 4W4QA 3EAUA 3EA1A 1AZ1A 2VP8A 5F2LA 3L0NA 4WSKA 5HUPA 1X39A 3AFBA 1MUCA 3LS9A 4HSNA 5CPQA 2PWDA 3SUVA 3RLUA 4YJ5A 3ZWSA 1MVYA 3DI1A 5B7ZA 1J0ZA 5AZ0A 1C93A 2O4QA 3KLKA 1EWDA 1H7PA 3BSGA 2EBNA 2VCAA 1DHKA 4TR9A 3SUUA 3TH6A 3RMEA 2WB5A 1TJ2A 2BGNE 1GG1A 3PVFA 5HPCA 3A24A 1UQZA 1RQHA 3C0SA 4DO6A 1J18A 1DORA 1ZAIA 4NX0A 3DGRA 4CNNA 3I4EA 4WX2A 2OVLA 2XVKA 2CLFA 5DN1A 1NFBA 2OYMA 3CHCA 1HJVA 1FRBA 3G1RA 4N9DA 4UFLA 4U31A 3U7VA 4YPJA 2Z6JA 2PLJA 3E12A 4JAWA 4Q8TA 2ASHA 4M7TA 4XUYA 3ZSSA 3VOJA 4PULA 1QXLA 2W91A 3KS5A 2GJXA 4JKLA 1EEXA 5AC5A 5GPRA 1WKYA 1M03A 3FK4A 2JIWA 1HIZA 1TPFA 4IQDA 2UY3A 4I6KA 2JFEX 4KKXA 2PLCA 1BXBA 2V3EA 2VNCA 3M5XA 3NQEA 3MHUA 1OC7A 3UA4A 3RLVA 1IZCA 3NQVA 5AECA 3QMSA 4BI7A 1TZ9A 3WLMA 1QOPA 4ZVJA 3T78A 4LUJA 2ONEA 3II1A 1ZBWA 5CXPA 3BW2A 3MANA 4GZ7A 1H61A 1P7TB 1UUOA 3RLHA 3NEHA 3OHMB 2ZZ4A 2JIEA 4EPEC 1J12A 3KBMA 3O16A 4Z2HA 1Q5MA 3GXIA 1WCGA 4O1BA 4PZVA 3VMPA 2ZA2A 4O53A 1FP9A 4OIFA 1R9XA 4D6CA 2BZNA 1O68A 4F0SA 4RE4A 1GJWA 4HOZA 1Y0EA 5CPSA 1SO4A 5CSUA 2WJDA 3N9RA 3PPFA 5C9UA 2PP1A 4EVZA 2FZ9A 3R4IA 1CXLA 3NZQA 3WBWA 2GGJA 3PWGA 3WNMA 4BI6A 5TNVA 2WZTA 3VTRA 3OBKA 1W3HA 4OWGA 2PI6A 5I3DA 4IWWA 3PULA 1MSSA 1OABA 3LRLA 1XLAA 3H2MA 5JH1A 1WXYA 4WQ6A 1DKWA 1XYBA 4LH8A 1QATA 1V3KA 5ABHA 5AHFA 4Q8OA 3CBWA 3BOLA 3MO4A 3FW6A 1EHAA 2YW4A 2UZ9A 1Z41A 1JUBA 4XD5A 3CZJA 5FJOA 1OM0A 4K7YA 4L6OA 1CGVA 1EDGA 4WVXA 2F38A 4PUDA 1CLVA 5FJIA 2GZXA 2PRLA 1RY8A 1UWRA 3W23A 1CX9A 3OIXA 4C60A 4TVCA 4BCEA 4F0KA 1HF6A 1OBAA 2PZ0A 2GLKA 5D8WA 2O9TA 3PBVA 1YNPA 2DDXA 2PWHA 3G8EA 3HF3A 5I06A 2IPFA 4BR1A 1QOQA 5A8GA 2IKGA 3QRHA 3UXLA 2VX5A 1ISXA 1KC7A 4HA0A 3PPHA 4BF5A 2WNNA 3DAQA 5E0FA 1GJUA 4PFHA 1SFJA 1UD4A 3MDWA 2WOQA 4Z0SA 1FCVA 4CNTA 3PHAA 2VGIA 4ZQPA 5AYYA 3TA6A 1HX0A 3P93A 2C1IA 2GQAA 3EPOA 1J5SA 4LAOA 1QW7A 3Q65A 4YYCA 1P5BA 5BNKA 4FAMA 1F07A 4YCOA 3UG3A 1LLWA 1N8IA 5CH9A 4MG4A 3ITGA 2IPJA 4WUIA 4X60A 2Z2UA 1VP5A 3SCQA 2DIKA 1EIBA 3W71A 5C71A 3QKEA 1TUFA 3EWUA 2QCNA 2WSYA 3RIKA 3HBLA 1DOSA 5A2CA 4G1KA 1W3KA 1F76A 1NFPA 4H8NA 1LRTA 3OLEA 4MOZA 2GVGA 3IVSA 2QCMA 3GWQA 4XTDA 1MRQA 4RV8A 2E5CA 3ERPA 3L5AA 1XBZA 4XBJA 3ORWA 4GGBA 4UFMA 4XVDA 1BAGA 1UKTA 5ECUA 1E9IA 2QLYA 2Z2AA 4NQ1A 4HPNA 3IPWA 4P7LA 4R7WA 2ZTKA 2E67A 4LUIA 2GVEA 3HM7A 5LHEA 1R30A 2QQ6A 4JKMA 1ZPTA 3QY6A 2H9AB 3LPPA 4GISA 1JDCA 3M0MA 4I9JA 3N2MA 4IXXA 3L67A 4JNZA 3B8VA 3PY2A 3HMJG 3A3XA 4HMNA 1K77A 3ZOAA 2AQOA 3DECA 3GVGA 2V6AA 2G37A 3UVAA 3B40A 5T91A 1ZJAA 5G5IA 2AAMA 4QQUA 3ZR4A 1VEOA 3GFXA 4JIRA 3O0FA 3AZSA 4LW7A 1HP5A 2BXYA 3Q45A 4RZBA 3TE9A 2PDGA 1GVYA 4UZSA 4QE4A 5XIAA 2WKLA 4E3VA 3PBYA 1GYMA 2AGKA 1SYTA 1R47A 2XN0A 2HJPA 4GUFA 1BVWA 4QITA 1CWYA 2DJLA 3H26A 1V08A 4O4WA 3IIZA 4O28A 5EFDA 5BOEA 3QR3A 3VXGA 2ISWA 3R79A 1PXGA 4IGMA 4PRRA 1VRXA 2DSWA 4PA8A 3MI3A 1BTCA 3ES8A 3H4WA 4DYKA 3CTTA 1OT1A 3LCGA 3LBOA 1TJ1A 2Y7GA 1GVIA 4B4FA 4UQCA 3AXIA 3LOTA 4MY9A 1P0EA 3EB3A 3WLSA 3ARXA 1VEPA 2E6YA 2RDUA 4RZ5A 4CLMA 2EJ1A 5A8MA 1RV8A 2VC7A 5CPLA 4XX6A 1CPUA 3LU2A 2BLEA 3IRSA 1XLGA 1LRQA 1UBPC 3ITLA 3UZWA 5CC5A 1JULA 3SFKA 3URAA 1EGZA 3TVAA 1EP2A 3HG3A 4WZHA 3WLOA 2DSZA 2WAGA 3QTGA 1YMYA 3N18A 3VGBA 4ZTXA 1IWAA 3LBMA 3WQ4A 1VYPX 5D32A 3W2JA 3LHTA 3N3MA 3GFYA 3NG3A 4KPLA 4HYWA 3UY7A 1WKEA 3NQ2A 1U2YA 3KXQA 4HHLA 5LGXA 1AD4A 1EL3A 2DGAA 1HZYA 2P50A 4K6AA 4NAEA 1B3XA 3NFUA 4ZQOA 2CZEA 2W3ZA 3R10A 1OFPA 5SWUA 1OIFA 4GQ0A 1W0MA 1S3TC 3UXAA 4AWEA 1W5QA 2PTZA 1NWTA 2W27A 2QPXA 3CPUA 3FSTA 1FHDA 3AHXA 2IUZA 4PH6A 1AUSL 4YWSA 1W5PA 3TMLA 3H55A 2VX4A 3WLHA 4LAZA 1HVQA 4C6OA 1FWNA 4DPPA 4D6DA 3ZM8A 1XGDA 3F5KA 5EKYA 4NP7A 3NM3A 2WVVA 2VQTA 3QC0A 4RJEA 4W86A 5DF0A 1FFQA 3SCTA 1EJVC 2VFGA 4MKNA 1T40A 4NI3A 3U2CA 4GINA 3WKZA 1BQCA 4U5KA 3T1GA 1S2CA 1WOAA 2YPIA 1BF6A 1O7AA 2GOKA 4LJ3A 1DWHM 1GVEA 1MQRA 4LS0A 3GKAA 1PIIA 2G4FA 1IEVA 4C5YA 4PUEA 3NPUA 2W61A 2E1WA 3W1MA 4OE7A 4YCPA 1WDPA 4AEEA 3QHOA 2FDMA 1V3JA 3A4AA 3I4KA 1CZ1A 2XJ7A 2WZIA 2ZICA 5K3VA 2NQZA 2E09A 1V03A 1VCGA 2BVDA 4Q8MA 3VOGA 1WXJA 2VR2A 3ANVA 1ICSA 3GD6A 1LUCA 1LRNA 3PP7A 3FJNA 4BQ4A 2XVPA 1NAL1 1OCJA 3S1VA 1XWYA 5EGRA 1CTNA 3WDPP 3EBVA 1EJWC 4I6VA 1HN1A 1OSEA 4JTSA 4U4MA 2E6FA 2V5DA 2ODOA 3G1XA 1US2A 3W38A 1XRTA 3L0GA 5A6JA 1ZSXA 5AYIA 1K6WA 3C0LA 3ABZA 2BXVA 1W31A 1YADA 2C1GA 1ONXA 4CEXC 1XLJA 3SADA 4EX4A 3S0CA 5DLCA 5CC7A 1EXBA 2BXZA 5G4HC 1XL9A 3WNPA 3ITOA 4MJZA 1TR1A 3TQVA 2D22A 3U2EA 3SY5A 3UPWA 1GQJA 2ZZ5A 5HMSA 3N4EA 1W3TA 3QV7A 2Z1KA 2ZUVA 2YB1A 1YPXA 2QUMA 2ZWZA 3SGZA 5GQBA 1UZ4A 2F2HA 1VFFA 5TQLA 4DRSA 2AKMA 1U1UA 3WLRA 4HGXA 2XWEA 3E5PA 3STPA 5K9DA 3ZLGA 1IIGA 4J4KA 1FH9A 3UR5A 1JYVA 1G4EA 3ZT7A 3GHSA 4B9YA 3TJ4A 3N15A 4QQ3A 3W27A 2WVUA 3BG5A 3M4HA 4E2DA 4M0XA 4P7RA 3W7PA 4QROA 4QJ1A 2YW3A 2HS8A 2PEVA 2A3AA 1AQHA 2GGGA 4FNUA 3D6NA 1FXPA 2QF8A 2E40A 2QVHA 2Z2BA 4CUCA 4WF7A 4IUGA 1VFUA 2QCGA 2A6LA 2OWCA 2FPTA 2J9XA 4NT0A 1KTCA 1BF2A 5I79A 1FDJA 5I3GA 3HPZA 5HJXA 1NQKA 4WKFA 3M46A 3GB6A 4Q4RA 1ZRQA 3THQA 4WKHA 4QG8A 4P7OA 3KLLA 1GKPA 5I03A 3GR8A 2QDHA 3EA2A 2BOFX 3LNMA 2ON3A 4OV4A 3WQVA 1EZWA 1Q45A 3LBCA 1B1YA 5HNTA 1VD6A 3NPVA 3P6LA 5KTLA 3VX1A 5U7SA 3ARTA 5D02A 1U1JA 1OCQA 2J79A 2X7WA 1VEMA 5PTDA 3T08A 1NTHA 2XIQA 1TPH1 3ITTA 3W29A 1JAKA 5LIUX 3TR9A 3CPRA 1TZZA 1W8GA 4OU1A 4AD2A 5HATA 3SAZA 1QNPA 2VURA 2I56A 4AYSA 1JRCA 1K3UA 1YTKA 2PWFA 1TJRA 5DANA 3NQ7A 4QCFA 2NWRA 2EG7A 3A3HA 1VR6A 3QY7A 3W75A 2QT3A 1SU5A 5H2ZA 1ODUA 1TE1A 1L6GA 3W7OA 1X97A 3CHFA 3HFTA 3LQLA 5A6SA 4IP4A 4NZCA 3SQLA 2D0GA 1HGWA 2NWSA 4HNOA 2CZ5A 3EWBX 2ESCA 3USBA 2HE8A 3SSZA 4G2DA 1OCBA 4EAYA 3VDAA 5I23A 1DIDA 5HNUA 3FY1A 1W9UA 3BG3A 1PX4A 1A49A 3S8HA 5LIXX 1D7FA 2XINA 3NNTA 3E9AA 1CNVA 1LBLA 3RYSA 3F7JA 4L1WA 4NJGA 4U2YA 3JW7A 3CWHA 1XLLA 4Z2LA 1Z48A 1Q6DA 3ABSA 1LOSA 3FV9A 4ZQCA 2XFFA 3L4ZA 1QHOA 2DSUA 1WV2A 1BHGA 3WMSA 1LG1A 1ONWA 3SRDA 4XIAA 3RNDA 1BYCA 5AHIA 3I7RA 1OGGA 2HK0A 4GQGA 5D2TA 2RAGA 3ITYA 2ACUA 3SECA 3OA3A 2DT1A 1E4IA 4IPIA 4PRWA 1F73A 2E8YA 5MKGA 3AMDA 3W3OA 1TMHA 4TTGA 3VD9A 3WH5A 4MF4A 2OEJA 2FHFA 4HCHA 4Q32A 1I2OA 3H2EA 4LF1A 4A35A 5CAHA 1GVFA 3A6OA 1TVLA 1DEDA 4LS1A 2HSAA 4KH2A 4C65A 2GJRA 2BBFA 3U5YA 4R3UA 2QR6A 4O1EA 3A47A 5EBAA 2VZUA 1G67A 1FDYA 4HZ6A 4MIMA 1D7KA 1EF2A 3A5VA 1XD0A 3H7RA 4CQAA 2VL4A 1JPDX 2Y5EA 4X63A 3PBUA 7A3HA 1LLZA 2E28A 3L9CA 1I1XA 3KCJA 4LC8A 3TJLA 4CVWA 2V8ZA 5CJNA 1RR2A 3NGFA 4AUBA 4ACYA 3S9YA 3KVLA 3TC6A 2CLIA 3SURA 3UWZA 3EX4A 3O06A 4IOTA 4HHHA 2VKZG 3GG0A 3LV6A 4IMAA 1L6YA 4ZSTA 4DUWA 1JAEA 4W5UA 1TWDA 2G4JA 4XZNX 2XFYA 1MW1A 3WBXA 3TAKA 1XLBA 4S3AA 1EUAA 4XAFA 5DY3A 2NQJA 2WMFA 4Q7IA 4L1GA 4EXAA 4D6EA 1YDVA 3EMQA 3KRBA 3PC0A 5C9ZA 3PB2A 1MEIA 2AL2B 1HKKA 3W74A 3S47A 4UTMA 3E2VA 2J62A 5LKYA 2W92A 1XDJA 4GKLA 4LFYA 3GKFA 1EUNA 2PE4A 3DZ1A 2WYSA 4D1JA 3EMCA 4ZCWA 2WMIB 4DWSB 5F1UA 1H7XA 4ZXOA 2J7CA 3QY8A 4JTAA 3P2VA 1R6WA 3SUSA 2CKSA 3T44A 4LYKA 3N19B 4PC8A 4S3FA 2YDSA 3PZNA 2CHNA 3GTIA 1EP3A