4DI9A

Crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
293
Chain Sequence
b'LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLKRLVDDAPKDKFLEVAGRLPAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTAWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-pyrone-4,6-dicarbaxylate hydrolase
publication title Structure and Catalytic Mechanism of LigI: Insight into the Amidohydrolase Enzymes of cog3618 and Lignin Degradation.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 98
structure length 293
sequence length 293
ec nomenclature ec 3.1.1.57: 2-pyrone-4,6-dicarboxylate lactonase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4di9A00
4J5NA 1EJSC 3O0FA 3SFWA 1O5RA 1A5MC 4H9ZA 4HJWA 3NQBA 4AQLA 1J79A 2BGNE 1XWYA 3WMLA 4G7EB 2E1WA 1RAKA 1YBQA 1R9YA 2Z4GA 4H9XA 2I5GA 4LFYA 1RJPA 3B0XA 4C6PA 4PCNA 1J6OA 4AC7C 1FKWA 3LY0A 2E25A 2PLMA 4RDWA 2Z26A 3UPMA 4H9UA 1RJQA 3LGDA 1WXZA 3URBA 3UBPC 4JOMA 4LAOA 3GIPA 1A4MA 3AUOA 2OOFA 1NFGA 4RDVA 4CQBA 4J2MA 1QW7A 2CZVA 4DLMA 4HK6A 1V77A 3HTWA 3K4WA 3DCPA 4KEUA 3LGGA 2Z25A 3BE7A 1GKQA 1EYWA 3GUWA 2UZ9A 2YB1A 2HQAA 5LXXA 1XRTA 2P53A 4E3TA 3GRIA 1A5NC 4DYKA 3AU2A 3ITCA 3F4CA 1RJRA 1PSCA 1NDVA 4UBPC 2R1LA 3T81A 2D2GA 1ITUA 1M7JA 1M68A 2PGFA 3CS2A 4DZHA 3TN5A 2XIOA 2OGJA 1KRBC 3MTWA 4LAKA 3IARA 1K6WA 3LU2A 5A6TC 2ZC1A 3IGHX 2GSEA 4DLFA 4HK5A 1NDZA 1EJRC 1P6CA 1YRRA 4INFA 2DVUA 4LH8A 4ERIA 1O12A 4R88A 2BB0A 3IACA 4F0RA 2Z24A 4WHBA 3URQA 4QTGA 3NURA 4DO7A 3IPWA 4GZ7A 3GIQA 2YB4A 4WGXA 3WZ0E 4GY1A 2Z2BA 3GU9A 2PGRA 1XRFA 4XD3A 2PUZA 2WJDA 2VR2A 2VHLA 3ISIX 4XAFA 1XGEA 2O4MA 3ICJA 4GC3A 1I0BA 3A3WA 1DPMA 3MDWA 4H9YA 4KEVA 1KRMA 4C6OA 1KRAC 4ZSUA 3S2NA 1V79A 1FKXA 4LEFA 3GTFA 3E0FA 4L6DA 2Z28A 4GX8A 2GWNA 4PBEA 5HMEA 3AU6A 3E0LA 4PCPA 4IG2A 2YZ5A 4B90A 4RE0A 1EJUC 4C6IA 1UMLA 3TN4A 4EPEC 4DI9A 2PAJA 1FWGC 4G2DA 4LCQA 1I0DA 3MSRA 3E2VA 4GY0A 4J35A 3CJPA 4NP7A 1UIOA 3FDGA 4GBDA 3F2BA 1J6PA 2HBVA 3QGAC 4C5ZA 4C6CA 1V4YA 4IFRA 4C6KA 4PE8A 4NG3A 3E38A 4MUPA 2R1PA 2W9MA 4IF2A 4B91A 3UR5A 4C60A 2R1KA 4IFKA 2Z27A 1E9ZB 1PO9A 3S2LA 4IGMA 2QPXA 4H9MA 2Z00A 5CH9A 3QY8A 4IFOA 4DIAA 3K2GA 4ICMA 4IG2B 4Z42C 4C6FA 1R9ZA 4GX9A 2AMXA 3NEHA 2R1MA 4XAYA 2YXOA 2QT3A 1EF2A 3DUGA 4C6QA 3T8LA 4R7WA 2ICSA 4B3ZA 4C65A 4P5UA 4CQCA 3F2CA 1KCXA 4XAGA 2EG6A 4LCRA 3HPAA 2AQVA 3CAKA 4DZIA 4C6BA 4EP8C 2GZXA 3IJ6A 2QVNA 4F0LA 3WYZA 4KESA 4R85A 3RYSA 3OOQA 1FWAC 1JGMA 2ADAA 1P6BA 4GXWA 4V1YA 1NDWA 1M65A 3EGJA 3S4TA 2HBXA 4WVXA 2FVKA 1QXLA 4C6EA 1W1IE 3B40A 4F0SA 1FWHC 3C86A 1A5LC 4DI8A 4IFKB 4CQDA 1S3TC 2OQLA 5G4HC 2AQOA 1RA5A 3RHGA 3LNPA 2UBPC 2P50A 4RDZA 3UF9A 2D2JA 1EJXC 4C5YA 4LANA 4HK7A 2OODA 2QS8A 3F4DA 3OQEA 1FWBC 4BKNA 4KIRA 2ANUA 3QY6A 2KAUC 1P1MA 3D6NA 4GYFA 4EPBC 1YNYA 4EPKA 4UB9A 2Q01A 4GK8A 2FVMA 4C6JA 1V51A 3GU1A 3OVGA 2HNHA 2RAGA 2VC5A 3K5XA 2VM8A 2VC7A 1PTAA 4C6NA 1ONWA 1V7AA 1VFLA 3PNUA 1UBPC 1POJA 3GTHA 3ORWA 3F2DA 2HPMA 3IV8A 4C6LA 1UIPA 5HMDA 5FSDC 3B0YA 1GKPA 4H00A 2R1NA 1FWJC 4QS5A 4NI8A 5FSEC 2F6KA 1ADDA 4LALA 1KRCC 2FTWA 2Z29A 3E3HA 1FWIC 3R0DA 3S2MA 4D8LA 1J5SA 1BF6A 4CNSA 3ID7A 5HMFA 4KERA 2A3LA 2VUNA 4QSFA 1GKRA 3QGKC 1EJVC 4L9XA 4ERGA 4KF1A 5AKQA 4GY7A 4OFCA 4B92A 1EZ2A 1WXYA 4V1XA 4KQNA 3FEQA 4H9TA 3TNBA 4QROA 1FWFC 3MPGA 4QRNA 1A5OC 1PB0A 4CEXC 2IMRA 4M51A 2Y1HA 4CNTA 1FWEC 2GOKA 4IH3A 4XAZA 3FDKA 2WM1A 3LSCA 3OJGA 4XD6A 4HA0A 2EG7A 1ONXA 4EPDC 3LA4A 3GG7A 3LSBA 3OU8A 4LAMA 3GTIA 1ITQA 3N2CA 3PAOA 3PBMA 5E5CA 1RK5A 3DC8A 4RDYA 4YIWA 3MKVA 1YIXA 1YBQB 2FFIA 3GTXA 3TN3A 4PBFA 3UR2A 2G3FA 3SO7A 1A4LA 4GOAA 4DNMA 1IE7C 3A3XA 2WJFA 3KM8A 4XD4A 1FWDC 3URAA 3QY7A 2EG8A 4IQJA 1E9YB 4ZSTA 3OODA 2I9UA 3EWCA 4TQTA 3GU2A 3PANA 1ZZMA 4KEZA 1RK6A 3HM7A 4XD5A 3EWDA 4CNUA 1K1DA 4QS6A 3S2JA 2WJEA 3MDUA 4C6MA 3A4JA 1RA0A 3IRSA 2D2HA 4RZBA 1YMYA 4I6KA 4G7EA 4H9VA 2HPIA 4IGNA 4ERAA 3MVIA 3E74A 3LS9A 1EJTC 4H01A 1FWCC 3URNA 3V7PA 1A5KC 2FTYA 4I6VA 1HZYA 1POKA 3JZEA 4BY3A 3PNZA 4C6DA 3RN6A 2DVXA 3RCMA 1R9XA 1NDYA 1K70A 2Q09A 4CEUC 2Z7GA 2O4QA 3MVTA 2GWGA 4BJHA 4KETA 3G77A 3O7UA 4LCSA 3TN6A 2Z2AA 3MJMA 3T1GA 2OB3A 1EJWC 2DVTA
chains in the Genus database with same CATH superfamily
2W5FA 1EJSC 5CSYA 2EQDA 4LOCA 1X7IA 2D1ZA 1CIUA 2BGNE 4I8DA 1R2SA 1EGVA 1GG1A 2AOSA 5G4EA 4YCPA 4KFNA 3NO5A 1VR6A 3A24A 1RJPA 4AHQA 1ZBVA 1V6UA 3WH8A 1V08A 3NYZA 1K8XA 3UNDA 4UFHA 3DAQA 1PIFA 2R91A 3ZWSA 2NQZA 1BWKA 1B3WA 3C0LA 1OX5A 3XINA 3GBDA 3QLDA 1HJQA 4P61A 1JJKA 1XCWA 2XISA 4IP7A 2ZA1A 1DIDA 1JI1A 1FY6A 3QBUA 3V1HA 4UFKA 4AHOA 3SAZA 3VNLA 3F5KA 4S3FA 3TQPA 3P3BA 3P0XA 1LCOA 3WQ4A 3IJDA 4I9MA 1ITUA 2ZA2A 1X8CA 5AC6A 2V3FA 4YTRA 3FFSA 5BRBA 2QDEA 4JQ2A 1UOZA 4LAKA 4L6HA 3MJYA 2VZTA 5A6MA 1EX5A 4MJ4A 1H3GA 3ABOA 2YXGA 1SMAA 3PP7A 5DCEA 3QFWA 1JXKA 3ITXA 3GHUA 3W1UA 2CHRA 1TPFA 2CLFA 1IGWA 5F4WA 3APYA 1UKQA 1VEPA 3GFYA 1S5MA 1T6MA 3SUWA 1C93A 1VBHA 2QHAA 1E71M 2D22A 2DUAA 4PR4A 3E2SA 4GRSA 4WGXA 3WZ0E 1MEHA 3GDLA 4L1XA 4Q8PA 2WJDA 1EDGA 2J8GA 2C0AA 3F4WA 2WHKA 5A6AA 2TSYA 4O16A 2GK1B 1YXDA 1UWIA 2ZDRA 5IBXC 3ZOAA 3SY5A 4KH2A 1KRMA 5EU9A 2P5NA 2WCAA 4JKLA 5CAKA 3FS2A 1FKXA 3STEA 4HYWA 4BCEA 4LC8A 4AIUA 1E1FA 3R11A 2IXUA 3WD4A 4JFVA 1B0IA 2R6OA 3FA5A 1CGVA 3VCRA 3N4FA 4D6GA 1VFMA 3UZJA 1IEQA 2AGKA 1I0DA 3BUVA 3O6CA 4FLQA 1UYQA 2CLKA 2X8RA 4GIEA 3MP5A 4O1DA 3WF0A 5I07A 1EIBA 3D0CA 1DWGM 3SIMA 1OFRA 8XIAA 3BCJA 4S23A 4X60A 3UR5A 3VIGA 3UU0A 1KBBA 4JZ5A 1TWZA 1XKJA 4M5PA 2QCCA 4C6FA 1YX1A 1XIHA 1OWQA 4LF2A 2AMXA 3WQ8A 3SCPA 1GNXA 1H7XA 3MC5A 3GLCA 2XUCA 3TE9A 4GFIA 1XX1A 4QM1A 4DZIA 1V6TA 4FXFA 1B3VA 4B4HA 1JYWA 2Y5EA 3NQVA 3OOQA 2ADAA 4M82A 3TA9A 1J9YA 4D6HA 1QW9A 5ABTA 2J62A 4IFKB 4MAVA 3HFYA 5G4HC 4UTUA 3LZ5A 2FTPA 5JH2A 1OT2A 1W5OA 1TMLA 1XYAA 3TV8A 4O19A 3NPVA 4XB3A 5M5DA 2ISDA 4L65A 4Y8FA 2W61A 3CUFA 5D9NA 4X2PA 1P1XA 4LVAA 1S2UA 4YU1A 1V0LA 2YOCA 4GYFA 4GVFA 2CETA 2W62A 3WFZA 4W5ZA 3WQ6A 2YR1A 3PHAA 1ZBCA 4E8DA 2VC5A 1QBBA 3QHNA 4R53A 3FHQA 3RDKA 4RR4A 1WDDA 3R5EA 5GNZA 4YVVA 1UUOA 1S1PA 1W1YA 2GVGA 1LT7A 2FTWA 4Z1AA 2GVJA 3TYCA 3WLMA 1Q6DA 4FNPA 1QNVA 1LUCA 3CV6A 2QJGA 4K36A 5AYIA 4QSFA 3H2NA 1M5WA 4GY7A 4J3UA 1C29A 2PDBA 1GYMA 4V1XA 1EHNA 3C5QA 1FWFC 5EMLA 4Q4SA 1CGUA 3FGCB 2Y1HA 2TAAA 2OYKA 4JIEA 2J4GA 4DJFD 5H8PA 5HDRA 4HMEA 3S1WA 4CNTA 2WVVB 1VPQA 4X9SA 1U1UA 1UD8A 4LPCA 4KWSA 2WM1A 4TR9A 1GJWA 3B8UA 4PL2A 3CIWA 3I4EA 4A29A 2FGLA 5E5CA 3WF4A 1Q6EA 4OKDA 3S0CA 4GNKB 1DE5A 3N1AA 3UY8A 2XH0A 3V0UA 1TV4A 2EG8A 4MNJA 2ACSA 3KWXA 1XG4A 1XXXA 4HPXA 4B5NA 4H8UA 3GU2A 2IPJA 2J6VA 1M53A 2ZUMA 3HM7A 2PI6A 1MNZA 3VGHA 4D6IA 3A4JA 2V5CA 3LTPA 2VURA 3KS6A 3M46A 3W7OA 1ADOA 3MUY1 4QQUA 5A1AA 5TNVA 1E0UA 2H8XA 2VJXA 4HOZA 4REQB 2DZPA 2VOTA 1MUWA 3N9SA 3OW1A 4BF9A 1OT1A 1I2RA 1TR1A 3DDMA 3HV9A 1FHUA 5HQMA 2AAAA 1AQFA 2XU2A 1VGAA 1SZGA 2A0NA 1YYAA 8RUCA 2PWVA 3TN6A 3ARSA 3VC5A 2OG9A 2Z2AA 2GQ9A 3CYJA 1RVKA 2DQXA 5M3WA 4J5NA 6TIMA 1EC8A 1MSSA 3NQBA 2IKGA 3HGRA 3VNKA 4XUYA 3SQSA 4IL0A 1HW6A 5HR6A 1PV8A 4I90A 4LFYA 4AC7C 5BU6A 3O2LA 4BI7A 5C9ZA 4LBUA 2B7OA 3G22A 1ECEA 1RJQA 2VI0A 3CIXA 4PB5A 3URBA 3H2CA 4M29A 1IR1A 1N2VA 3R79A 4PH6A 3WEZA 3MZ2A 3LPPA 2Y7DA 3M0JA 1NFGA 1YDYA 1K8ZA 2YLLA 1SSDA 3PJWA 1UH3A 1EOKA 1SO4A 3RNDA 3DFNA 3W37A 3QMTA 3VUPA 1XRTA 1AW1A 3NQAA 4DYKA 3VDHA 4GGBA 2QULA 4JL1A 3KE0A 1TB3A 1DWHM 4ADUA 1M7JA 3L2MA 2CHNA 1GVFA 1A49A 2A4AA 1KXTA 3FA3A 3CUIA 4KT2A 4AB4A 3J7HA 1KQZA 1V3IA 2UWFA 3WLHA 1BXCA 2AKMA 5T26A 4K2SA 1A47A 2D3LA 4DLFA 2WB5A 2FFCA 2OEMA 1KFJA 2R82A 2Y4SA 1ODZA 3VINA 3IACA 5E93A 4F0RA 3BK0A 3H54A 2WPBA 4G8TA 3SN1A 4IGSA 1BHGA 3FK4A 4B2DD 3VOCA 4ADSA 3M16A 3QTGA 2VR2A 3UZWA 5EA9A 3ISIX 2RJGA 4S2BA 2PODA 3O06A 3VX1A 5FEXA 3QC3A 4C1NA 3S2NA 4H7ZA 3RLUA 1MWOA 1TCDA 5CZSA 5J5RA 1V3KA 2Z28A 2GWNA 1A0EA 4A22A 3VYLA 1OZMA 2DJXA 2DW6A 4FNQA 3ITTA 4ACYA 3MV11 4MNMA 1FP8A 5J5DA 3AS3A 4NAEB 1KWKA 1FQ0A 1DP0A 3MHUA 2OWCA 2Y63A 3QKZA 4JTSA 4GY0A 5TQLA 5DQPA 4LY4A 1TO3A 4QLKA 4EXQA 1ITCA 1DJXA 2VCCA 2OSWA 3GD6A 1UKSA 2GGJA 3IUDA 2XFYA 4HN4A 2WANA 4U2ZA 3B06A 1H09A 2J7HA 4LU0A 2IPGA 1G01A 2V67A 3A4AA 2X0SA 3QKEA 1AJ0A 2R1KA 2WWCA 1NELA 1R38A 3M0YA 2ZCGA 3VKAA 4DIAA 1LTDA 4CQ8A 4M81A 1ZUAX 1KM0A 4OV9A 4C6QA 3FYPA 2W0UA 1TTPA 3F2CA 2C91A 2EG6A 2ZRXA 1OGSA 1VBJA 1AZ2A 3OHMB 4TMBA 3A3HA 1M7XA 2VRQA 5H2ZA 1QWKA 1B5TA 5HWNA 1EKOA 1GJUA 3RLHA 1XPYA 3O3RA 3OGVA 1S2WA 5BCAA 2I56A 2J24A 3VOJA 3WLTA 1X1NA 4A4AA 3ZSTA 5I77A 2OMAA 4OBRA 3HPXA 3PM6A 2I5IA 4ES4A 3K13A 3U48A 4IX0A 3KTSA 2EPOA 2YSWA 2PS2A 3ITGA 2QUVA 4YL2A 1XLJA 1DVJA 3THQA 3L65A 5C71A 4EPKA 3ZR5A 4PMZA 1ISVA 1IT8A 4WY0A 1M9HA 3WDPP 3OVGA 3HPFA 3D46A 3K5XA 4XSMA 1TTQA 3KAOA 3DG3A 4HOWA 3F2DA 2WNWA 3OG2A 5HMDA 1UD5A 4KS0A 2GJRA 2WOQA 2IS7A 2O9TA 1UQYA 2ZVIA 3TK7A 4L64A 3VNYA 3W7MA 5BXSA 1T7LA 1FWIC 2BXZA 4DJDA 3W29A 4ZZ9A 1T0OA 4LQ1A 4HNVA 4C90A 3PWAA 3FY1A 3I3BA 4LUJA 4JFWA 2ZADA 5I3JA 4LUTB 4RCXA 4GFSA 2P1FA 4UTLA 4QROA 1OX4B 1W3HA 3TYZA 4YWIA 1LQ2A 3WQ5A 1LG1A 4YYCA 1UROA 3SN0A 2ZYFA 4U5IA 2OZ0A 3QV9A 2GDQA 1HQTA 3GUGA 3VKJA 1XBYA 1DHKA 2EHHA 3C2EA 3KOWA 1GZ1A 1XQLA 3GG8A 3HN3A 2G3FA 3LDVA 3USBA 2F38A 4PUJA 2IUZA 5BMWA 4EWND 1Q65A 4PTMA 3KZSA 4PTNA 3HU7A 3W6MA 3N4AA 3PANA 4KEZA 1X6LA 4MKNA 1SZRA 1S2VA 1F8IA 3EWDA 3RGTA 4CNUA 2WPGA 3VMPA 3PTMA 3S47A 1JL8A 3MDUA 3LCHA 3ZJ7A 1VEMA 2VVSA 4JFUA 3CUGA 2HNEA 4MMWA 1KLZA 4AVOA 5KMYA 2ZBTA 4HNNA 2IQDA 3KZPA 1PJ9A 3M0KA 4A2RA 3W76A 1TZZA 3GWQA 4WY0F 3WF1A 1F74A 2DPEA 2QIWA 5AYZA 2FTYA 3W75A 1OF6A 3GNDA 3GVQA 3LRLA 2PTDA 2E6FA 5AHLA 3IJLA 2JBMA 4DWSD 1SW7A 2VR5A 3E0VA 1ADSA 1NP2A 3QYQA 1FWRA 1K9FA 4KETA 2QDHA 3EA3A 3WQEA 1JIBA 3LN3A 2YFOA 2UV8G 2FQIA 1A5MC 3H26A 3FIGA 2O7SA 2EGZA 2DZSA 3VVGA 4WDTA 4ALDA 4I9TA 1MMFA 2E1WA 1L6GA 3NXFA 1XGZA 4RX0A 4A21A 2PB1A 3KOZA 2G3NA 1WOAA 5LNVA 4HT3A 4FEZA 1RVGA 2OPJA 4I5RA 4JD4A 2E6DA 3DH7A 4BZYA 4Q6JA 1FXPA 2WWDA 3SIZA 4TUFA 4B5WA 3LGGA 1FWTA 3NQ7A 3BE7A 3SUUA 4A8RA 4JTJA 1LORA 1UWSA 2P53A 3TVAA 4AZ6A 1LBMA 5I3IA 1EQCA 2PBOA 1KM3A 4UBPC 3HMCA 1G7VA 3O9NA 3W2KA 1SZFA 3B8SA 1PS9A 1P6WA 1UR1A 2GOUA 4ZQRA 5F7UA 5JIPA 3TSDA 2J25A 3W6LA 2J77A 1KRBC 3MTWA 1KBJA 3DOPA 1TV8A 4S3DA 3LU2A 1PUDA 3CUXA 3TFXA 4QJ4B 4J27A 1G4EA 1B31A 3HQ1A 3SGGA 2YYUA 1UWRA 3W1XA 3VD9A 5B7ZA 2WZMA 4QSHA 5G1TA 2O9RA 5I0DA 2ATSA 3DN5A 1FUYA 3WD1A 2OYLA 4DO7A 2F8QA 1CLKA 2PC4A 1DL3A 2WM0A 1SSGA 1WB0A 4AFYA 4XZLX 4I8YA 2YZRA 3CWHA 1ZP4A 1JPIA 1XGEA 1Y5WA 3H4GA 3GSMA 2X05A 3MDWA 3HIJA 2P88A 4QXIA 2XM2A 1QK2A 1J4EA 2G41A 2MUCA 3WD2A 4PUUA 3E0FA 2YA2A 3NEVA 4UIOA 1H7RA 3FJNA 4N9DA 1US3A 8XIMA 4C6IA 3L4TA 3RO6A 5M17A 3TX9A 3B0VC 4EPEC 4RW5A 5D02A 1F6KA 4W87A 3BOLA 3QPEA 2J7CA 4O28A 3M41A 3SJ3A 2A79A 1XLIA 4L56A 3PFRA 4LS2A 1J6PA 3P7YA 1EJ7L 4C6CA 1CXFA 4PE8A 3TXZA 1XPGA 1XKYA 1QI4A 4Y7EA 5AYYA 4MTVA 4IG2B 1TPUA 1DYSA 2FPVA 2RH9A 1YTDA 4GYPC 2YDQA 3WUFA 4ZXOA 3VNDA 3NL5A 5C55A 1A3HA 5E1QA 2WMKA 1H4PA 2FHFA 3QXBA 4C65A 2PU0A 3HG3A 1VBUA 3HPAA 3CM4A 3V5FA 2EF9A 4ROPA 3LHUA 4HOXA 3TR2A 4QE1A 4F0LA 5E0FA 4DF2A 3KCOA 2ONEA 3NTYA 3R8RA 3W86A 2ZUTA 4AY8A 4MF4A 1QXLA 1GVQA 3LK6A 4E38A 1T41A 4IT1A 4LVDA 1A5LC 2QCMA 1G94A 1TZ7A 4V33A 3WK1A 5D9MA 3PZ9A 4K38A 3AISA 2VFGA 4PUEA 4U2YA 1VHCA 2PF8A 2WNQA 1PX3A 1KC7A 1ODUA 2D2JA 3UPBA 3W7IA 4JCLA 3F4DA 1EH9A 5IM51 4HMNA 4WJEA 2ANUA 3P6LA 2Q6ZA 3KBMA 3MV01 4MUZA 3GVVA 2W27A 1R3YA 3ABRA 4NILA 1IZKA 4K8GA 4ORMA 1QNOA 4IMGA 2RHGA 3T0AA 4A8LA 3ARRA 2FJUB 1OINA 2W4XA 4AZ7A 2PZ0A 3GXFA 1HJWA 4QJ5B 1A0CA 2RAGA 3GHSA 4MB3A 3H4XA 4NAFB 1POJA 1V02A 3BARA 3ZYZA 1KGXA 2VRJA 1S5VA 2YJQA 1SR0A 3MSDA 2VX7A 4WX2A 1GK8A 2V3DA 2A7PA 3FOKA 2HXUA 3OB8A 3EEZA 4DF1A 1BF6A 2D3NA 3S8HA 1PAMA 4DX3A 3NQGA 3CK5A 1OYBA 1R85A 3CZGA 1ISYA 1EZ2A 1WAWA 5FEZA 3TYUA 4JAWA 3F5JA 2WC4A 4CEXC 4G1KA 3FVMA 1C8VA 4C1LA 3CL8A 2OTDA 5FL1A 1FWEC 3AXKA 3PZVA 1V93A 4MYAA 4XAZA 4HPJA 5AC7A 3O6DA 3ZLGA 2GQ3A 1PTGA 1X6UA 2F84A 4GQBA 1AMYA 4J40A 1O5KA 1OY0A 3REQB 3VNZA 4XG1A 3SI9A 2O9OA 2XSBA 3N29A 3KM8A 2EAWA 1OGBA 2BOFX 4JL2A 3PUEA 3LB0A 1XJBA 4IQJA 1E9YB 1OYCA 1UR4A 1HVXA 2E6YA 3BLPX 4DXKA 4EWJA 3P8JA 4QS6A 4YLWA 2C71A 2XSXA 4RK8A 2GJXA 2FKPA 2AGTA 4LX4A 3S83A 3MUXA 4YVXA 4U10A 2ZDSA 5AZ0A 3MA8A 5F4SA 4H6KA 3MS8A 5DF0A 3EWWA 5D32A 1JPMA 5REQB 4AVFA 4IISA 5DMMA 3LPOA 3LCFA 3GDBA 5E9AA 3BV4A 3QOMA 1OF8A 3FGCA 3WQWA 2ZICA 1FCBA 3N3MA 2ZUVA 3R25A 2XFFA 2WVVA 2Z7GA 2YBUA 4X61A 3G77A 2QV4A 1XLAA 4JNZA 3RXZA 2A3AA 4TVDA 3I3EA 1O5RA 2WMGA 4UTFA 1JNEA 4ZB5A 2QJHA 4O11A 4O0QA 4A3QA 4Y9PA 1JD7A 4FOUA 3E0IA 1EC7A 1CXIA 2OEKA 2E25A 2HMCA 3LY0A 4RDWA 3C6CA 1ZY9A 2V6AA 3ZJ8A 2H8ZA 3RMJA 5T8GA 3H6OA 4UNKA 3I6EA 4M80A 4H04A 3BOXA 3ME3A 3WH7A 1K6AA 4O1CA 1ZHAA 4CD6A 3UD6A 3LQLA 3WBYA 4B5TA 4RDVA 4J2MA 3VD5A 3HTWA 2PRHA 4RLIA 1LRNA 4LY8A 1F7BA 1REQB 4RV8A 4BWLC 5A2AA 2QUTA 3B03A 3UCDA 5LXXA 3UXLA 3ARYA 1A5NC 4REQA 2GVYA 1S2CA 1J18A 5HWJA 2R1LA 1M1BA 2PDXA 4AIEA 4A6GA 4DQWA 4O1AA 3MT1A 3IARA 4ZMGA 1P0NA 3ZO9A 3IGHX 4HZ6A 2DSWA 5LNUA 3PZTA 4QFUA 2YFNA 4JY8A 4LH8A 5EGRA 1VYRA 4DJEA 3OIXA 5FACA 1IHIA 1F3TA 4JQ4A 1FP9A 1YDVA 4O14A 1XFBA 2OELA 3RPDA 2CKSA 3BAIA 2X1UA 2ASHA 1BPLB 2VHLA 4JTEA 3CEUA 1J0HA 3A5FA 1TMHA 2GGIA 4CU6A 2ZE0A 2QCEA 3SBFA 1ZAIA 3MBDA 3OP2A 1BAGA 4L7ZA 4HTYA 3SCWA 3USZA 4A3UA 4KCWA 3A21A 3PR2A 5E70A 3QLLA 1ALDA 3NQ2A 1Q6OA 1EEXA 3NIYA 4HZ8A 3CIVA 4B90A 4RE0A 4MG4A 1CXKA 5BOOA 2V8ZA 3LV5A 4DI9A 3UERA 1RALA 4GCXA 3V5CA 4LB4A 1G4SA 1IIGA 3K1GA 1PE1A 1WA3A 4I7UA 1RPXA 1IIHA 4ZENA 4ATDA 4BQ4A 4DM1A 3WK3A 2DIEA 3CJPA 4NP7A 1DE6A 3MCMA 3ARZA 5CZ0A 2MANA 4HGXA 5BOEA 5GJPA 4GD0A 2HBVA 3EKZA 3SURA 4TVCA 3BGAA 3ARTA 4JN6A 2PDGA 4NG3A 3W4RA 1W5MA 2Z0IA 2BMBA 4B91A 5BYWA 5LIUX 2QCNA 1JQVA 2G96A 2ZZ2A 2OFJA 1E9ZB 1UG6A 5LGXA 2EXOA 4IGMA 3W2LA 2VDGA 4NJJA 1BTCA 1NOWA 3TTEA 4GX9A 1Q2SA 4DWDA 2XZ7A 5M1TA 3RPTA 2YL6A 4D6FA 3LERA 4XZ9A 5EYWA 2QCDB 5C9UA 4RW3A 3SUVA 2L5HA 4P5UA 3EZ4A 3QQWA 3CTLA 2WAGA 2YLAA 4XX6A 3VCCA 4LC6A 3ABZA 2H3DA 2PE4A 4ML4A 4H6EA 3WBEA 3M0VA 4U5KA 2EKCA 4S3AA 3TR9A 3C86A 1XIGA 3C52A 4DUVA 1Z89A 1JCYA 3RJYA 4EXBA 3CXOA 5BWFA 4HVXA 4NAEA 2YA0A 4M3PA 1EWEA 1ISZA 1H5VA 4GUJA 4DNHA 4TV6A 1C8XA 2OT0A 4RDZA 1JPKA 2QNEA 3U2ZA 3DYOA 4IJBA 5DT7A 2VELA 4BK9A 4YTUA 4E8GA 1GG0A 4E8CA 1O94A 3AIVA 4NZ1A 3WJWA 4D8ZA 1TYGA 4ZOBA 3D6NA 2VX6A 4IQEA 3ARWA 4E2DA 4ENLA 2BHUA 3B4UA 3W7DA 4MWAA 3PN8A 4UB9A 5I23A 1ZGDA 3VD3A 5ABFA 3TSBA 4JXCA 4X63A 3RU8X 1BXNA 4WKHA 3UG4A 3DGRA 3N18A 2QF7A 4HHPA 4XBJA 3IVTA 1EBGA 5CPMA 3MCOA 3B0YA 4OBSA 3OEXA 1W3TA 4QS5A 3E5PA 2OX4A 3DYPA 3VI2A 1Q63A 4H19A 1BRLB 4UTJA 4KERA 1AG1O 4PB4A 4MB1A 4HCLA 4CLMA 1D7FA 3KL3A 5CJ5A 3FEQA 3AJXA 3UXIA 1UUQA 1NJJA 2WBKA 1O5XA 4NZFA 2OQHA 1VAHA 5KTLA 3FN9A 2FGZA 4JFTA 5FF0A 2PRMA 3M6DA 5LGZA 2DORA 3THCA 3LUTA 2WV8A 1ONXA 1YDNA 3GH4A 3NR0A 3PUOA 4DHGA 2BGQA 7REQB 4YTQA 1JZ8A 1XIMA 1RK5A 5AOUA 5KZ6A 5H8UA 1I60A 3VKKA 4OHQA 2XGBA 1FCUA 1FWDC 2FMOA 1GQLA 4HNUA 3HFTA 1V5XA 4JTAA 3QW3A 2ZZ6A 3WLLA 4N4PA 2I9UA 3W7CA 3E1F1 1HKWA 1RR2A 4XD5A 1GGOA 3ATYA 2D24A 2OGYA 3UZ5A 3KBSA 3UEQA 4G7EA 4UR8A 1OBAA 5LYRA 1TV2A 4XISA 3M7WA 4AY7A 3GKAA 3N2OA 4Q8NA 5XINA 1WAUA 2XGIA 2OU4A 2DSVA 4LUTA 3U0HA 7ENLA 1OX4A 3KRZA 3AHXA 1Q6QA 3AXMA 4ECLA 5HNNA 1RY8A 1IT7A 4GZEA 4ILSA 5DN1A 5CGMA 1OC7A 3PB2A 1AL7A 4LVBA 5E9XA 1MZHA 5HPCA 2VL4A 1K7FA 3QMSA 3SFWA 4CD8A 2QUMA 3BC9A 3UA3A 3W82A 3RFAA 1K3UA 1PHWA 3V0SA 4R3UA 2E28A 1R9YA 2XVKA 3HZ3A 1TV7A 3WLRA 3L4YA 1HO4A 2V5DA 5A8GA 4GA8A 4OBTA 1E51A 1XC4A 1PKMA 5BXTA 1V6WA 4H3DA 1V0MA 1SFLA 3AXXA 1VIZA 1I2PA 1UZHA 1TQJA 2R8WA 1TQXA 3KHJA 2P10A 3G6MA 2P0IA 1TIMA 4HZMA 1M41A 3BW3A 3AUOA 1E6NA 3NZPA 2CITA 1OG0A 3IUHA 3EWBX 3GUWA 2ZWYA 3U7BA 1BF2A 4IIGA 1NY1A 4QP0A 4IWWA 1US2A 3TNOA 1RJRA 3CZEA 4WXYA 1F2JA 2J75A 2J88A 2XIOA 2V38A 2OGJA 1Q6GA 4OV4A 3AYTA 1E55A 3CB3A 1A0DA 2PGWA 3BSHA 5HQEA 3WKZA 3R12A 5EMKA 4E2OA 5C70A 1ENUA 1UH4A 4Q33A 4PFMA 3ONBA 4K39A 3TAOA 3GR4A 1EC9A 1XICA 5AHFA 3UXDA 1J0JA 3GH7A 1PZ3A 4P7RA 2Z2BA 4Y9AA 4HHHA 3OLEA 4H41A 2PUZA 2NXIA 3NGFA 4QEEA 3R8GA 1TPB1 4NJKA 1GVOA 4FOJA 3U3HA 4H7VA 4Z0SA 3KBNA 3TJLA 4DBSA 4DY1A 9XIAA 3TH6A 2ACUA 2A6NA 5A8PA 3C61A 5JQ9A 1P4CA 4W7UA 4OJYA 1J01A 1BTMA 3UT0A 3VOGA 1W3KA 2YDRA 4AEFA 5JIWA 2C16A 5DLCA 3SSZA 1HL8A 1W91A 3EKGA 4MHBA 3EOUA 5E0KA 1NFBA 1E43A 3MSRA 4OECA 1B90A 3UZZA 3WLJA 4CD5A 3TQ0A 2WHJA 3UJ2A 2NWSA 4PYSA 1AH4A 2DGAA 3IJIA 1ELSA 1NQ6A 1OIFA 3E5BA 1JZ6A 3P80A 5CXPA 2WHLA 1V6YA 3TP4A 2Z27A 3MBFA 2OZ3A 2VCBA 4GUIA 2V2CA 2PA6A 1G4PA 4Q4MA 3B0PA 3VNJA 2I57A 3L4WA 2CXEA 4QDMA 3AOFA 4O50A 3AALA 1FVPA 2PZNA 3NEHA 3QN3A 5TIMA 1XSIA 2WK2A 4H2CA 1EWDA 3SRFA 3AIEA 1K4HA 4GPNA 3LHTA 2C1HA 1TWWA 2OWWA 2Z1WA 3PPHA 1F9CA 1H49A 2V69A 1KLYA 1XG3A 3GVRA 3PWGA 3TONA 5CPOA 4OQVA 1GQNA 1NDWA 1QOPA 1WXJA 4DYJA 3W84A 4AZCA 2TMDA 1EGZA 3QHMA 1SR9A 4QG6A 5AY7A 1LF1A 4ZR8A 4US5A 4GC4A 1H7OA 4B5UA 3ZT5A 3VMNA 2Y70A 3JUGA 1IXPA 3OLGA 5E6ZA 5U7SA 1ICQA 1IZJA 1RCXB 3BL3A 3LMZA 4WKAA 1EZWA 4NJIA 3WLNA 3BZJA 4RE2A 4JR5A 1Q8JA 3EOSA 1GVRA 2POZA 4EPBC 1TPDA 4FR1A 5CLTA 2CZFA 1H1NA 3O05A 4X0VA 1CX9A 2VM8A 4CVUA 3AYSA 4WKFA 3W7NA 1TVPA 2A7NA 3ORWA 1W54A 3GK0A 3ELFA 1VYSX 2BZNA 1FWJC 4H8HA 2JKAA 1AUSL 1C90A 1P5BA 1UMYA 2BXYA 1R46A 1KRCC 3T78A 2IW0A 4D8LA 4Z2KA 2EPKX 2RKXA 1VFFA 1R7AA 4XO7A 5BXPA 3M0MA 2J6XA 1MW0A 3VOIA 1HP4A 4AZIA 3EXSA 4IX2A 2IMRA 1YTEA 2FZ8A 2ZC8A 5CBIA 2Y89A 1FH9A 1VJSA 4E4FA 3DHPA 5GVJA 4D71A 4EPDC 3G0SA 3NUKA 1TX0A 1E6ZA 2GFTA 3VMOA 4DXVA 2P3EA 4RDYA 3NWRA 5LIXX 3MKVA 1YIXA 1KM6A 2I17A 4N02A 2GDUA 4RUBA 3DFPA 3UA4A 3GB6A 1GCYA 1MUCA 2DZVA 3URAA 5D37A 4HNCA 1K8CA 3E9AA 3MI3A 1KXVA 2OSXA 1TJ0A 1XIBA 1AODA 2ZZ7A 4WDWA 1ZZMA 1RK6A 2ATMA 3CAWA 5LNWA 3B04A 1FXQA 4I6KA 3KXQA 5MF5A 2VFHA 5CSUA 2QYGA 1EJTC 1UD3A 4G9PA 4H01A 2BY1A 1UHVA 1KKOA 5CC5A 1POKA 2QJIA 3PSWA 4AEOA 5CBJA 1XYFA 1R9XA 3TW6A 4GO8A 4AZBA 4O17A 4L4LA 3W71A 5FAGA 2GDVA 1AQMA 1I2OA 2CLLA 3MJMA 1L6FA 3P82A 3PPCA 6TAAA 1CB7B 4JNYA 4Q4PA 1IYXA 1OFOA 1P7TB 3G1DA 1ICPA 3QH2A 3NPUA 3NXLA 3K8KA 4PCNA 1BFNA 1FWWA 1MDRA 2RDUA 1J6OA 5B80A 1BEUA 4FXRA 3DERA 4HSHA 3VIOA 4AH7A 2WMFA 1BVNP 4H9UA 1YHTA 5L9FA 3QRHA 3UBPC 1V8EA 3QZ6A 1U2YA 1LM1A 2A21A 1IWPA 1HJXA 4DEFA 2W63A 2QPSA 1SJAA 3WEMA 1F4HA 2BVYA 3RR1A 3CZ8A 3DCPA 1NWUA 2Z25A 3IS4A 1OADA 4JTLA 1MQPA 3DHFA 4G5DA 3F4CA 1XFCA 5REQA 2PP3A 4WOZA 2RGLA 4KWWA 1H7PA 4ZCWA 5ABEA 1YW1A 2ZWZA 1TUFA 4AXKA 3VM5A 1EXPA 1AW5A 1JQXA 1EJRC 1FCQA 3QOKA 1W31A 3T55A 2PLKA 1J0ZA 3OVRA 3IIZA 4CN4A 2DQWA 3STPA 4M56A 2J13A 4EE9A 4IJRA 4WHBA 3T6CA 1UP0A 2QAPA 3O8AA 3QVQA 3ZVHB 4CCEA 4MZYA 2XIQA 3AMKA 4IMFA 2VNCA 3EX1A 2CLEA 2ZA3A 3CT7A 3GXIA 3PZQA 1SMDA 4XD3A 1QPOA 3MQTA 1NSJA 2Q71A 1DPMA 1MUMA 1G0CA 3PJXA 4J7RA 4DRSA 1KRAC 3VM7A 4P8WA 4KIEA 4P7LA 1C9WA 4Q8MA 3EWXA 3Q45A 1REQA 2XG9A 3H22A 2AL2A 1VKFA 4I9AA 5HMEA 3I65A 5D03A 3HQNA 2MNRA 2SFPA 1J2WA 1E72M 5I3DA 4LNCA 4RZ4A 5DANA 2C1GA 2YCLB 3KTCA 5HBFA 1ZTVA 1NWRA 4DWSB 2E68A 2JF7A 3W01A 1UIOA 1K03A 2ZUSA 4HHMA 4P7QA 1S2TA 1CDGA 3PSVA 4UNIA 4C6KA 1XYLA 4ZTXA 1L8NA 1ZJHA 1DHPA 1GEQA 3AMLA 2VZOA 2RGMA 2PDKA 4HP5A 3S2LA 4H9MA 3P84A 4PSPA 2C19A 5CC7A 1M7OA 1GPFA 2ZZ3A 5I24A 3UWQA 1ZCCA 1QR7A 1XDMA 3UWUA 3VGBA 1OD0A 5AVHA 3U2OA 3GZAA 4NT0A 3Q37A 3Q67A 4CCCA 4PMQA 3Q2DA 3VK5A 5DBUA 1A5SA 3WYZA 1PYFA 3RYSA 2NUYA 2Z1VA 2G0WA 3W7EA 2E5BA 1BVWA 3W2JA 3IUIA 5KZMA 2YYTA 1V3LA 1OVDA 3BG5A 3PUGA 3EWZA 2AQOA 2QUNA 1E15A 5I78A 3RHGA 3KVLA 4MJMA 4Y90A 2CLIA 3JVAA 5KETA 4QR6A 4HK7A 3VD7A 2QS8A 3PWIA 3OQEA 5BXRA 5HJXA 1QASA 3S5YA 1OFBA 4Q3MA 1UKTA 1QPRA 3GDKA 2CWNA 2JF6A 1O60A 1TJRA 5F4XA 1RCOB 4WLCA 2B7PA 4WSKA 4DO6A 4N9EA 3SQMA 3DG7A 4HN8A 4Z2IA 3S1VA 4DPQA 3PNUA 3VFLA 2XHYA 4WRHA 2YXXA 1V6VA 1M7PA 1E9LA 4QBXA 5LSMA 4IZGA 1WZKA 3CT2A 4H00A 2QF8A 2GVLA 2B0MA 4PBGA 1HVQA 4MNKA 3T08A 4FXSA 3PK7A 1PPIA 4GQQA 4GVIA 1ECQA 3D3FA 3WCZA 1J5SA 3QSRA 3BV7A 4GCAA 1L2QA 3V18A 1IT0A 3A4WA 1DJQA 3QGKC 4L9XA 3SCOA 3KL0A 4GE8A 1T40A 2HVOA 1ZJBA 5HQLA 3GYEA 3QR3A 3ZT6A 4I7WA 1PB0A 4M51A 1T8QA 2X2GA 4HPNA 4HB7A 1LZOA 5A8QA 1WDPA 2XVGA 5EB8A 4HA0A 2OO6A 5LKYA 4IPIA 4GQ0A 4S3EA 4N2YA 3GTXA 4Z1YA 4XK2A 4JTUA 1U33A 1B3OA 5LHFA 3ONCA 3PFMA 3VNIA 2OXNA 5JBEA 2GUBA 2VKZG 5C2CA 5LZLA 3SFKA 3DFOA 2LLEA 4NX0A 2VVNA 3MWCA 3DC0A 2PRLA 2CHOA 1M01A 1U5HA 2WZIA 3W83A 3VZXA 5BW6A 1W3IA 4RZBA 2FDSA 5JU6A 4JEQA 4GXMA 1BRLA 4GWEA 2AL1A 3WFAA 3PZUA 3AYRA 3V7PA 3BG9A 4GI6A 4I6VA 2R14A 3LHVA 4AMAA 2G37A 3IGXA 3RCNA 3M47A 4PODA 2PWGA 4CEUC 4FNTA 5A6BD 1CXEA 2DDXA 2BTMA 2QW5A 3A64A 3EBVA 1AW2A 5HMSA 3W28A 1UR2A 1KTNA 2D0GA 1TWIA 4IP5A 1SVDA 3S1GA 2VZUA 4GINA 1M6JA 2F2KA 3G1HA 4FX6M 4DUWA 2I5GA 3W38A 3WY1A 2O56A 5KITA 2O7QA 5I09A 4YN5A 1VRDA 2YA1A 1WZMA 3W1TA 1H62A 2HSAA 1XCFA 3QZEA 4MZ8A 3GW3A 4JKMA 1QW7A 1F8MA 3H53A 4L6OA 2J8FA 3GO2A 4BQ3A 3TW9A 5LA1A 4RXFA 2NV9A 4GIRA 3M0LA 1CGTA 3RMEA 4E3TA 3GRIA 2R94A 2J27A 4GYKA 4JNMA 3S1XA 2KX9A 2XIBA 4DZHA 1AA1B 4DZ5A 3CV1A 3QR0A 4LVFA 3B05A 4M6VA 5I6SA 1XM3A 2RFGA 1F05A 5G2IA 4Q4RA 3W7LA 1MI3A 2ZC1A 3CQHA 2CZ5A 1HX0A 1EX1A 3F7JA 4Q32A 3INPA 1AQHA 1J0YA 2CIPA 3LQGA 1ZAHA 3NSXA 4HHLA 3NL6A 4DYEA 4AUBA 4ZQPA 1NIUA 1MRAA 1R87A 3URQA 3N2MA 3S6TA 5BU9A 2WCGA 4GZ7A 3IAQA 4XBSA 4GY1A 1C9DA 1I2NA 1RP8A 4JTDA 2A5HA 1W17A 1UA3A 4FF7A 3T05A 1V3HA 3M7SA 2UY4A 4QJ1A 3GYCA 1GQJA 4ATLA 3ZIZA 4GC3A 1KM5A 3GXDA 4JPGA 1N8FA 4W84A 4ZFMA 4Q7IA 1PL9A 1GTEA 4AY1A 2XM1A 2BSLA 3AICA 3I3DA 1TCMA 8A3HA 3T40A 2JIWA 4GX8A 4X2RA 1W1PA 1K7EA 1CLXA 4IP4A 1GOKA 1Q3NA 1B57A 5CG0A 4GVGA 2A7RA 4QE4A 4ICCX 4PRTA 1FWGC 5GPRA 1G1YA 4J1OA 4XZNX 2NQ9A 4NZ4A 3K4DA 4UQCA 4R9OA 3WDJA 4DJFA 2BBFA 2VC6A 2V63A 3FDGA 3GS6A 2CFFA 3KOFA 4JIIX 5IBXA 4C1KA 3DI1A 5EMMA 1EYEA 1QOXA 4IFRA 4NJGA 1XUZA 4MUPA 2WZTA 2Y85A 2NQJA 4F2UA 1SYTA 4DJEC 3UPWA 3QW4B 5CH9A 2IKHA 3EOOA 5A6SA 3GVWA 3W24A 3EAUA 1RQHA 4E4PA 4B9ZA 3B3DA 5E6YA 5EMJA 1VJIA 1WDWA 5LHEA 2AQVA 1NARA 4H8VA 4DN1A 2BS9A 5C8BB 4FHAA 1EDTA 4IMCA 4A8NA 1WKYA 3FVDA 2DIJA 4V1YA 1ZALA 1W1B1 3FA4A 2DZBA 4F0SA 4AIOA 5FJUA 2NQHA 1XW8A 4PMRA 4DI8A 1G69A 4YS1A 1JPDX 4AD1A 1PZ2A 1OHLA 3DBNA 4KW2A 1ZRQA 1ZNNA 2E1DA 1W9PA 2NQLA 3L4VA 3M0HA 4E4UA 2YL8A 2BVDA 4FMVA 3H23A 5JMUA 4PMJA 3O1NA 1XIIA 3R58A 2BX7A 3N11A 3BAYA 2WNNA 1JF6A 4MOZA 3WLOA 1QOQA 3FXGA 3SCUA 1K9EA 3RU6A 1DJHA 1XH1A 2GSJA 3UZYA 1PBGA 2PWHA 3RILA 2YDAA 3GTHA 3T2PA 2E8YA 5CC6A 4PA8A 2W66A 2X1SA 4EF8A 3HJZA 3WQFA 3VXGA 2PLCA 5A3HA 1UBSA 1B2YA 2C18A 2Y62A 1OG6A 5TF0A 1TZ9A 2NWRA 4HU4A 3U5UA 3WNPA 2YCJA 1JAEA 5U4NA 3WH9A 1WX0A 4FPSA 2VUNA 1D3HA 3DGBA 2WXDM 3WX7A 4B92A 3OGSA 5DXYA 3OYZA 2JFEX 3GBEA 3TNBA 4BI6A 4ZO8A 1BYBA 3GXNA 2W67A 2DSZA 5HNTA 1YPIA 2ESCA 2QV5A 2V3GA 4JYDA 4W8BA 4POCA 2I1OA 1TE1A 3BW4A 3K8MA 3FW6A 5FESA 1IR2A 4WCJA 1E3ZA 3N2CA 1KV5A 3PBMA 4PEKA 3LLFA 3WD0A 1KWGA 5CG7A 3THUA 1WUFA 4HCHA 3SO7A 4MWAC 4MWAE 2XH2A 4AAJA 3MP3A 5A95A 3L0NA 3V0TA 3OG3A 4GACA 4OE7A 2GL5A 4ICNA 4B2DA 4US6A 1UPPA 4V28A 1GQKA 3T2OA 3GH5A 5D2YA 2ZFAA 3QF0A 3NO1A 1GOMA 1I6NA 2NW0A 1MRQA 1X97A 4FLSA 5TBOA 4Q4QA 4PCSA 4GUGA 1JCNA 4EKJA 4ZOCA 3AIUA 6XIAA 1DEDA 2VC9A 1XHGA 3NQ6A 1BG4A 3AMGA 1TVNA 1GYLA 4NXSA 3TW7A 3EX6A 1VPXA 4AWEA 3B97A 1A53A 4PMXA 3A6OA 3MYOA 3RF9A 3RCMA 2CESA 1MNSA 2NV2A 1DKWA 5EMUA 1PDYA 4JS3A 2ABAA 4NUWA 3L67A 5G1MA 3TCSA 3LCLA 4QJ3B 3FEMA 4H9ZA 2CLOA 9XIMA 4EOUA 5EBAA 5LA2A 1SO5A 2YBVA 1ONRA 4J3WA 1LOQA 5CAHA 1JDFA 1S5TA 3W1PA 3NCOA 4MSSA 1W32A 4QG8A 2VGGA 4QCEA 3NQEA 3DIPA 1D3CA 1K4GA 4EXAA 3WLPA 1HFBA 3DFQA 3CHEA 1P0EA 5AHMA 4LYPA 4MYXA 3LTSA 1MW3A 1LLWA 4O0ZA 4RNHA 3CPRA 4PRWA 1ZBWA 3PBWA 5L6UA 3ZM8A 3KRSA 4ZQCA 3WENA 2HISA 2V9DA 1A50A 3VDBA 4S3KA 4ZBCA 1SUXA 3WJSA 3IIPA 3H2EA 3ATZA 2YB1A 5AC8A 1JVNA 3G8RA 4MM1A 1Y7VA 4AWUA 4QAWA 3BG3A 4WSHA 4M7TA 4MLJA 1PSCA 4FO4A 4LUIA 1XCXA 2PD9A 1XDJA 2DZUA 1QU4A 4GI9A 3A5VA 1CGWA 5F2GA 4HCDA 1CI1A 2WVTA 4AD4A 3UR7A 3UJFA 4LRTA 4GMEA 2EJ1A 3GVGA 2HK0A 1P7TA 2BB0A 4XKYB 3NVDA 2Z24A 3KCLA 2XFRA 1KTBA 4O10A 4W88A 1RBOB 1TJPA 4H7CA 4O4WA 5I3KA 1Z69A 5D38A 4IMAA 3IK2A 3SRDA 3DBPA 3HG5A 1MW2A 2J9XA 3RM9A 4PMOA 4XAFA 4E2VA 3RX4A 4Q8OA 3G3DA 1JF5A 1XS2A 3Q4DA 4KEVA 2IPFA 3CB8A 4F2BA 3BCDA 4HIBA 3G1AA 2H6RA 3NZRA 4E2BA 4LEFA 2ISSA 3H4WA 3CYVA 3XIMA 2QJJA 2WZEA 3TTQA 3HMJG 1XIDA 4CU7A 3VIHA 3CUJA 3F03K 2B4GA 4IPLA 1E40A 3M5XA 1W3NA 3H21A 4CCZA 2Y61A 4XQ6A 1FHVA 3NA8A 3VU2A 3E2VA 4J3XA 2CBJA 3L5MA 4JTTA 3WNKA 3CPUA 3AJ7A 4JHOA 3IV3A 7ODCA 5J04A 1X8FA 2C79A 3PZOA 5BRQA 1XYZA 5FJOA 3LBOA 3MI6A 3DI0A 4QQ3A 4IJCA 2HROA 2GUYA 1QUMA 1UASA 3GDTA 2YGYA 1IEVA 1QNRA 2E4TA 2XIIA 4IMDA 4YHGA 3V5OA 1MXGA 2E77A 5HJYA 1VQTA 4O12A 3QY8A 3TYAA 2RJHA 4PN2A 3ZVHA 1XBXA 4KWVA 4L9YA 5CQ1A 4KWUA 1RY0A 1QTWA 3MUAA 4XAYA 2F7FA 4Q22A 4ZFCA 5K4ZA 4PTVA 1SM9A 4B9YA 1R3VA 5DO8A 3DUGA 5LIYX 1AH0A 4XVDA 1S3HA 3VFCA 3K46A 3CAKA 3EKLA 5EKYA 1YADA 1MO0A 5HNRA 3T44A 2GZXA 4CN6A 4KESA 3U2CA 3RK8A 1WZAA 3BGJA 4GXWA 3SY8A 1YNQA 2E7FA 3TA6A 2VGIA 4C6EA 3BQ5A 1W1IE 3L2IA 2FLIA 4AIBA 1IWBA 1JDAA 1SW3A 4GI4A 3GNNA 2EPNA 3LRKA 2IXVA 4XWUA 3STGA 1OFAA 1GT8A 2YIHA 4DWSA 5K9DA 5AHIA 3V3WA 4U3AA 3R6IA 1FWBC 2PC8A 4KGJA 4W7WA 1KD0A 2CKRA 4KIRA 4MJ2A 1VFUA 3EWYA 4N6EA 4RV3A 1KFEA 2PDYA 3QY6A 3NZQA 4LJ3A 3KVJA 5I79A 3WSUA 3M0XA 1EUNA 5FF7A 3TWBA 1VBGA 4HMDA 1F07A 3DFSA 4C7FA 3ABQA 2HNHA 3LCGA 2YCEA 2VTFA 4L5ZA 4PC8A 3T42A 2HWGA 5CLWA 3FXYA 1ZS2A 1SGJA 3GX9A 4NI8A 2F6KA 2ZX5A 3CU2A 3E3HA 3O07A 3OA3A 1YNPA 4LBRA 3ID7A 3WH5A 4F79A 1TKKA 5CEWA 2V81A 4FF5A 4H2HA 1DORA 1S5NA 3UG8A 2JIEA 4LUSA 4D6EA 1VP5A 3T4CA 3ITVA 5CJNA 4UTHA 1MQRA 3IIXA 3CZLA 2VGFA 1QO5A 2I5QA 3CWOX 5CPSA 4XVEA 4P7OA 2QUUA 3BJSA 3MUCA 5F1UA 3LG3A 1HJUA 1W9XA 1Y65A 4QDWA 4QEHA 2HZGA 3NQMA 3PAOA 3ZXWA 4RNJA 3JRKA 4HYVA 1PEZA 4LB3A 4PMUA 3SDOA 1LUCB 4NYYA 3NSNA 1UW9A 1NTHA 2OZTA 5GQBA 3SCNA 3EPNA 3RX3A 4D1IA 3TFCA 2DT2A 1UP2A 2HV5A 3B8WA 2H90A 2A3CA 1X96A 4ADTA 4L1WA 3LCIA 3SR7A 4PTDA 1KB3A 1XC6A 5HPOA 1IEWA 4NNAA 3ZR4A 4Q8VA 5I3HA 3EB2A 1MZRA 2ISFA 4HZ7A 1GVYA 1W1VA 4H9VA 4RL3A 3JR2A 4O0KA 2XSAA 4NASA 4J3ZA 3IAPA 3KRUA 4UR9A 3B9EA 1KM1A 2P8BA 3NSMA 4GIAA 1DJZA 1KBKA 1BSIA 3S5SA 1EFZA 3BLOA 4OUIA 5HR7A 2C14A 3OHIA 4TO8A 3PY2A 3V1PA 2PDPA 1C7TA 5J8LA 3SUSA 1L6SA 4QTGA 3T0BA 1EP2A 3CQIA 3UVIA 4I5XA 1E70M 1VYPX 2V30A 4IPJA 5I3GA 1TWSA 1FDZA 1BG9A 5KEZA 4PUDA 3TAKA 1Z41A 4JTGA 1TPWA 3F5LA 1P0DA 4A3RA 5DCDA 1TE6A 4LS0A 5EY5A 2DZXA 2QXWA 4KBXA 3L23A 4WIWA 1Q8AA 2REQA 2WMIA 1JRBA 4W9TA 3GIPA 3QV7A 3ITYA 3BDKA 1KV8A 5BNKA 4Q4OA 4JY9A 3HG4A 4DLMA 4NYUA 4Q6XA 4FI4A 3NQ8A 5D8WA 7TAAA 4GJJA 4FR6A 1TTIA 4JIPA 3T2QA 5D9OA 3G1FA 1L9WA 1RH9A 2HQAA 2C1IA 3ITCA 2INFA 1VEOA 1E4LA 2B31A 4O1FA 3DHDA 3FHAA 2NX1A 1JDEA 3C8NA 2FHCA 3BMWA 4IXHA 2IPWA 5G2HA 2NXGA 1K6WA 2Q8XA 3N25A 1O1HA 1YRRA 4INFA 3GC2A 1FH8A 1XI3A 4LYQA 5I02A 1E4IA 1Q45A 1VRXA 3T07A 4JTFA 2ODOA 4NZJA 3I4KA 1LQ0A 1T96A 3SM0A 3VIJA 3GZ3A 5EBUA 4WSJA 1NWSA 1TMQA 1P48A 4KGLA 3WMBA 2FPTA 4GO9A 2D2OA 3P60A 3K4AA 1JYVA 3BJTA 3A3WA 1YXYA 1TRDA 1EIXA 3QZAA 3UJEA 3QHOA 2J9ZA 3NO3A 1D2KA 3G18A 4UR7A 3AU6A 2YZ5A 3L5LA 4L80A 3TYDA 1KKRA 6A3HA 1VFTA 3LCXA 1H2JA 1E9IA 3UWZA 3NPWA 1JG9A 4PUWA 4ZE4A 1J8VA 3V35A 2VFIA 1K9DA 4XZIA 3LHWA 2BV9A 5AFDA 3KDOA 2E0PA 1DBTA 3AIQA 2JKEA 3KOXA 2PDQA 3HBLA 1GZJA 2BHZA 4HSOA 4UMAA 4DBUA 2Z00A 4UTTA 4QCFA 5MHBA 2E09A 5TAOA 1ZCOA 1I1WA 1KFLA 2XINA 2PTWA 3RR4A 4N0RA 1HKKA 1L6YA 1DWFM 5BOFA 1QWGA 3N6JA 2VZSA 1U1HA 1EOMA 1TA3A 4PMVA 4DF0A 1WBHA 4KRUA 4AWSA 4RE3A 3OA5A 1S5WA 3AHYA 3W27A 2I9EA 3VILA 3W0KA 3MSYA 3TXVA 3B9OA 1LJYA 2QCGA 2FDMA 5K9CA 1GHRA 3WBXA 3BMXA 1DWIM 4LANA 2W3ZA 1XH2A 1WP6A 3AIBA 3GDMA 2ZRZA 4JN7A 1WQ5A 2KAUC 1P1MA 5AYXA 1UD2A 1ITXA 4R27A 2ISWA 4QNWA 3SB0A 2PDCA 1XYCA 1V51A 1AFSA 2PP1A 1UOKA 4PL1A 4ACZA 4ZE5A 1JCXA 3R13A 4C6NA 1JZ4A 1VFLA 2WYSA 2VEIA 3CC1A 5D8ZA 1FWNA 1DWJM 1HKVA 2QKFA 5TD4A 3U4AA 3ZSSA 1B1YA 3AMCA 2G4JA 3TYBA 1W2PA 1IXNA 4F48A 2YCKX 3VUSA 2ZRUA 3AFBA 2Z1XA 5A5WA 3AI0A 4CNSA 6CGTA 3FJ6A 3SW6A 3PBUA 2WMHA 2BLEA 4UFIA 4KF1A 2TPSA 4RPPA 3ZFHA 2HEJA 1J5TA 4YNGA 1L8PA 4KQNA 1RUSA 4WY0B 4JHZA 4OTKA 3AO0A 5IRPA 3WJYA 1FDJA 5D30A 2V0TA 4I9JA 3TC3A 3ZLFA 2ON3A 4H6QA 4DBDA 3RLVA 2VD9A 2TRSA 1TWDA 1S46A 2PWFA 2QMKA 2TYSA 4W5UA 3FDKA 2PDWA 4Z1DA 4NZ5A 2TODA 4ZO6A 1UZ4A 2IKIA 2G95A 4JQ3A 5GJNA 4LT9A 2O0TA 1YBQB 3UR2A 3TJ4A 3O16A 4GLEA 1FOBA 3A3XA 3GFXA 2C7FA 4XD4A 1Q4WA 3EDEA 4F66A 4Z2JA 3L0GA 5CPNA 1WBJA 3EDDA 2ZZ1A 5SWUA 2HJPA 3L66A 2F9RA 3HOJA 2VYOA 2J7GA 5CPLA 3AWNA 3DKLA 3AHVA 3KP1A 1DXFA 1DXEA 1F6YA 3W23A 3K30A 4XAPA 1HZYA 5IDZA 5EPDA 4GXPA 3W9ZA 2XIJA 3L4XA 1G9HA 1MQQA 1K70A 4GISA 1IEIA 4JBRA 1QT1A 2X0YA 5D2WA 3P67A 1VH7A 3MVTA 2GWGA 4OOZA 2I14A 2OLHA 5FOOA 4WF7A 2C0HA 1XINA 2ABBA 2DVTA 1O5QA 3EX3A 1H51A 4C7GA 4NKCA 1B54A 2YL5A 1DTUA 1XD0A 3FJ4A 3G1YA 1SO6A 2Z4GA 3WLQA 1XH0A 3OVQA 3POCA 4WR3A 3L21A 4G1NA 3EX2A 1I4NA 1EO5A 5IOBA 2PWUA 2OO0A 1VIWA 3PZNA 4MPKA 1XBVA 4N6FA 3VD4A 3VIIA 1XQKA 2XH7A 4JN8A 3D47A 3B0UX 1A4MA 2G4FA 4NX5A 1ESWA 3ITOA 3AXHA 2WKJA 5FI8A 2E9MA 4PUKA 1GKQA 4PUMA 3PBVA 1H50A 3M07A 1HXJA 3G1SA 3AU2A 1H0IA 2OKOA 1O1ZA 4EX4A 3C3NA 1GONA 4NXKA 3CV2A 3WF2A 3WUEA 2VT0A 2KZHA 1AK5A 2GK1A 3CH9A 1GPWA 3QPZA 4Z1CA 1LYXA 3Q94A 5A6TC 1R3RA 1SJBA 1THFD 3GG1A 1JEZA 1JFXA 2ZOXA 3BICA 1TPH1 4L4MA 4ERIA 1AQ0A 4DUOA 4JGDA 2GJPA 1L6WA 4F0HA 1J12A 1SZNA 4Z08A 1R47A 3W85A 3RCYA 3H7RA 1HF6A 3NURA 2ZRWA 1ZU8A 3P14A 4PMNA 3S6OA 3GIQA 3MUIA 3P62A 1O68A 4UFJA 4B5VA 2NX9A 5HJLA 5I03A 4D6DA 1RP9A 3LXCA 4B5XA 4HU8A 3RJXA 5K4XA 1JCTA 1I75A 3KX6A 2J79A 4GUFA 1I0BA 3HG2A 4WDUA 1NP0A 2J66A 4Z2LA 4A3HA 4U28A 5H1WA 5FIPA 3RM4A 3KP0A 3W2MA 1WDSA 4AU0A 2PFHA 2QPUA 2BODX 1BWLA 1KFKA 3D3AA 1XSJA 3LI0A 3WMCA 2CLPA 3ERPA 3VAVA 3ZR6A 1B4KA 4MY1A 3BAWA 1ZP3A 3CLMA 4FZIA 3EOLA 1HKIA 2XN2A 1DV7A 3L12A 4W4QA 2V68A 4HU3A 1XLHA 1F61A 7CGTA 5G4WA 4UZSA 5JXQA 4ZODA 4WDXA 3QGAC 2O9PA 1IXQA 4AISA 2E8ZA 2VO5A 4J3TA 4WGHA 3DZ1A 1UCWA 5DCBA 4XKYA 4IFKA 3PBGA 4WJ8A 5I7GA 4N4QA 3H70A 2QJNA 4KCUA 2Y0FA 3FAXA 4O8RA 4ZL1A 3NQDA 1BKHA 2GYIA 2PPGA 3R1ZA 3LLXA 3EDFA 1OD8A 3IJ9A 4B3ZA 4CQCA 4AYGA 2X40A 2ZXDA 3NPXA 3MI2A 2FMNA 5LA0A 3B9NA 5HUOA 3LZ3A 2HVNA 2WKGA 4Q8WA 3QQ1A 4ZB2A 2ACQA 2OX1A 3WDIA 2PF0A 2OQLA 3W1QA 1RD6A 2V5KA 1WCGA 4ZQOA 1KO0A 2GQAA 1G4TA 2DZAA 3LBCA 3GM8A 1YLVA 4DM2A 4DVOA 4KEMA 3RIKA 1BKSA 2W6RA 1XRVA 2OODA 5LNRA 3EX4A 1QVBA 3TQVA 1QHPA 3SEPA 2V82A 4DJFC 1IGSA 1D9EA 3CV7A 7XIMA 3RRXA 1Y8BA 1DJIA 2CCRA 2G3IA 1QBAA 3N14A 1JGIA 1E5NA 3F1QA 1PXGA 4AG0A 2XPKA 3ZWTA 3DECA 3W87A 4GH3A 4B16A 1NFPA 1CYGA 4B4FA 3EA1A 3KLKA 2X1TA 1FFRA 1FCVA 3APTA 1CWYA 1UIPA 4L1GA 3QMRA 2CBIA 5K3VA 4GUHA 4IQDA 4ORIA 1JUEA 1OFEA 1SFSA 3PPFA 4UCFA 4ROQA 4ERGA 3UFYA 3AXIA 2C3ZA 3M1ZA 2XH4A 5FF3A 3FKRA 3MPGA 2VENA 4QRNA 1FDYA 2D0FA 3WG6A 3BLDA 3DESA 1TFVA 1X7FA 4XD6A 3WF3A 1OFPA 1Q7QA 2OEJA 2D69A 3LA4A 2BDQA 1CGYA 3GTIA 3WN6A 3AZSA 4ZEPA 2PMQA 5CBBA 1LL7A 1LOSA 4R33A 3DC8A 3F4NA 1W0MA 3H2MA 3NZGA 4UTIA 1DJNA 4IIFA 1KFBA 4CQAA 3CHVA 3GC4A 1U1JA 1IE7C 4DNMA 3NL3A 1PCKA 3CBWA 1KGWA 3KBWA 1GYNA 1EO7A 5HUPA 1PWLA 3UR8A 1VJZA 3AC0A 3PAJA 5BRPA 4S3BA 1K8YA 1XLMA 4UNLA 4ZVJA 1EUAA 1LRQA 3LHZA 3PZIA 5CPTA 1ZL1A 2J7EA 2QMJA 5F2MA 3W1NA 3AS0A 3ARQA 3HGOA 1V0NA 1UC5A 2XIMA 3M9YA 1J11A 1TUXA 1NM9A 3HGSA 1G7UA 4FK9A 1RQEA 1E4MM 1Q6CA 1UC4A 1XLKA 2DVXA 3GNOA 4D72A 4JTKA 5FJJA 3I10A 2A85A 2PTXA 4J28A 1XIEA 2O4QA 4N42A 3B4YA 3U5YA 1KM2A 3UCCA 3BOFA 1E6QM 2GJXB 2P3ZA 3C2FA 4GZJA 1QNQA 2J78A 4O8AA 1OSEA 2VEFA 1W5QA 3P93A 1VLIA 3B0XA 4JYFA 1BXBA 4C6PA 4ZXLA 2QIIA 3R7MA 4CD7A 2DZWA 6PTDA 4F8XA 2B7QA 5DRIA 1E5JA 3HO8A 3TQKA 1UR0A 3C8FA 1C3FA 3NNTA 1H5YA 3WNOA 5CZJA 3NYDA 1JDDA 1X6NA 2DIKA 3HF3A 1GOWA 5D2TA 2XGZA 4ASTA 4CQBA 3PC0A 2R24A 2FIQA 3K4WA 4FA3A 1WUEA 4KEUA 4R7OA 3EMZA 3W3OA 3G6LA 3T0DA 1XLLA 3N2TA 1W1TA 5HOSA 1AVAA 1NF7A 2FGBA 3RRAA 3CMGA 3T81A 3W88A 5BWAA 4V2XA 4ZOAA 2BXVA 3L0KA 1LOLA 1F6PA 3E12A 2OJPA 3G2GA 1TPC1 2BP1A 3O6AA 1V3JA 2BWGA 4P8VA 2D20A 2FH8A 4Q8TA 1NWTA 3VTRA 4CNOA 5H6HA 5BZAA 4PRRA 3L5AA 3NGJA 1B4EA 1R3WA 3WL0A 4NY2A 5LIKX 2CZDA 4K1WA 1F3XA 4EAYA 1CT5A 1V3MA 3P74A 3WK0A 4TIMA 2YB4A 1VB9A 3WJXA 4JX4A 2OLAA 3CMFA 1XBZA 3KFTA 4UXDA 3ANYA 1R2RA 2VD8A 1R3QA 3A13A 2O4MA 2VX5A 2DY3A 4H9YA 3FYOA 2X30A 3TLQA 4P7NA 1KA9F 1YPXA 4IIBA 3G8EA 3M0IA 1V79A 1F3EA 3GTFA 1K9TA 4L6DA 3IJQA 4PEEA 4IHCA 4UMCA 4QGCA 3A9BA 4LCQA 2PDUA 3N13A 3SSJA 2D0HA 2NSXA 1ISXA 3RLGA 4IICA 5KINA 1Z8AA 3OIHA 3MYPA 4KRTA 1V4YA 1JZ7A 5ABHA 2R1PA 2W9MA 4K1GA 3PPGA 2J8TA 2YKKA 2PCEA 2HRWA 1MXSA 4C91A 4YTSA 4ICMA 2QCHA 3H12A 2VMFA 3W1AA 4O18A 2BHYA 3WUGA 1LT8A 2XZ9A 1CECA 2GSHA 3LM7A 4QAIA 3TIMA 2BVTA 1R3SA 1W9UA 4IUGA 4TX9A 4Y9NA 2VWSA 5CCZA 4R85A 2VUYA 2X1RA 1P6BA 2QDDA 3EDJA 3MB9A 5E09A 2PWDA 5CSRA 4UOQA 4YPJA 1FWHC 2XJ7A 3HV8A 5DRCA 1PX8A 2BASA 5C9RA 3W2NA 2H3BA 5T91A 2WSKA 5LXEA 1NU5A 5AHEA 3EB3A 3LNPA 1S2AA 1YDOA 1AJZA 1KCLA 1EJXC 4NNCA 2H9AB 3UG5A 4YVPA 2PEVA 1OB0A 4JTQA 3W25A 4QITA 3G3MA 1JUKA 2GVEA 3C0JA 1E56A 4U3CA 2CLHA 3VX0A 4P8UA 1CBGA 1YNYA 4BA0A 1PVNA 5D2XA 1B9BA 3GU1A 4AD0A 4PMYA 1Q5MA 3OVPA 2OLSA 2AQWA 4LF1A 1V7AA 3IIOA 4EF9A 3SZ8A 2PSNA 1SJDA 4AYSA 4BQ2A 1ZENA 3N6HA 1OX6A 2YX0A 2AKZA 3VIKA 3QQ0A 3TTOA 1QJWA 5C6MA 2G5WA 3KEHA 3BH4A 4LALA 3KRBA 2NVCA 3ABXA 2P76A 3WDRA 3R0DA 1UJPA 1IZCA 4L4OA 2A3LA 1T5AA 4GI8A 4MWAB 4JIQA 4MJZA 5ABFB 4LAZA 3LXBA 3OGRA 4M6UA 2CW6A 5GJMA 3UXKA 4AW7A 3UW6A 3WQCA 2W79A 4IH3A 2PU1A 5I2UA 4U4MA 3STCA 4K7YA 4DWSC 3GG7A 1VLWA 3KW3A 3M0ZA 9RUBA 4ZB0A 2EEXA 1LRTA 1KBIA 3ANVA 5FKYA 1FWSA 4PBFA 2HVMA 3ARVA 1VD6A 3GAYA 3VA8A 1I9CB 1OJXA 3PS7A 5A69A 2NXHA 5HATA 4LXFA 3TLLA 3GG0A 3GNRA 3AHTA 3T0CA 4TQTA 1ZSXA 1IQ8A 3W70A 2HS6A 4BF7A 3MZNA 1K1DA 4IQLA 4AX6A 4HKPA 4X9YA 1PTDA 4O52A 1RA0A 3IRSA 2E6AA 1YXCA 4OU1A 4IGNA 1KFWA 3MVIA 4MFDA 3SQLA 2CPUA 1GEHA 4DPPA 1R5YA 2QCLA 3WQPA 1V6XA 3M5YA 3VGDA 4XKMA 3R10A 3OLDA 4MY8A 3PZGA 4ATWA 1UR8A 1PWMA 1C91A 4C6DA 4AD2A 3SCSA 5AHNA 3EPOA 5AECA 3S46A 3E2RA 1PX4A 5BMXA 3BO9A 4LCSA 1Z32X 1ONEA 1VFOA 3DHUA 1OQFA 3U9IA 3TN3A 3WEOA 1Q13A 4K8HA 5FL0A 3G0XA 3N9KA 4R9XA 3V4BA 3C2YA 1UA7A 4RPQA 3JS3A 4G7EB 1RAKA 1YBQA 1JRCA 3L68A 4S38A 5A94A 3A47A 4TVUA 3SECA 1D3GA 4A8IA 1E4NA 2GUUA 1H61A 3NVTA 1QI5A 1XLFA 4FALA 2E40A 3T4WA 1QPQA 2ZRVA 1QATA 3W6YA 4WOQA 5K9XA 5PTDA 1GQIA 1AZ1A 2IQ0A 3BW2A 2CBVA 3GR8A 1KCZA 3A12A 4P2VA 3FLUA 2ZX8A 3PULA 3UCQA 2E3ZA 3WLSA 2CYGA 2X16A 1JAKA 1W56A 5CGTA 1P0BA 2JQXA 2Z2UA 1UP3A 3LBMA 3EPMA 2IKJA 1VCFA 1TPVA 3MKKA 3A23A 3P5ZA 1HN1A 4UQ9A 1VS1A 2DSUA 9CGTA 3HURA 4YWSA 3THAA 2O55A 3SRKA 3W7HA 4NU7A 4DB7A 4G6CA 4WEVX 5MKGB 4F40A 1TSIA 4AF0B 4WUIA 5DBTA 3DU0A 2UY2A 3GE7A 4KFPA 3GU9A 3DX5A 5HXMA 3TOYA 3WFLA 3V75A 1E6XM 3NFUA 1PKLA 5C5YA 1LBFA 5XIAA 4D6JA 5JBDA 1ZJIA 5EFDA 2ZE3A 3ICJA 4GABA 4PTWA 4ZGYA 1A3WA 1HKJA 5XIMA 3HQPA 3E6EA 7A3HA 3BXWA 3MHGA 1DQUA 3THDA 4RZ5A 4UCGA 4IG2A 1QI2A 1RBAA 1RV8A 1V7YA 1O7AA 3VC6A 1LWIA 1QRQA 2JGQA 3CLWA 1Q4NX 1N82A 4F9DA 4Z0JA 2DU2A 5G1YA 4LV9A 1BYCA 1UR9A 2ZTKA 1UWAA 1XGDA 4JTIA 4FX8A 2QEZA 3F2BA 2VFFA 3UG3A 8TIMA 1YPFA 1YQ2A 5DMLA 4CCDA 3P8IA 1BYDA 2FB3A 4QNEA 3EWUA 1UPMB 3U7VA 3ANUA 3E38A 3IJ8A 3LGEA 1E6SM 4S3JA 4FNRA 4MPQA 4C60A 1RPKA 1OYAA 2Q3OA 3TTYA 1OCQA 2QPXA 2BOGX 4R5EA 2Z1KA 5DY3A 3BLKA 2BGSA 1MYRA 3W7RA 2XTKA 4WJXA 2G97A 2OCZA 4TOQA 2YXOA 3CO4A 4AX7A 5IFPA 3UJSA 3OPSA 2JEQA 4XAGA 3BAKA 4PTXA 4HYRA 4CU8A 3KVKA 3IJ6A 4PCFA 3S5ZA 2Y8KA 2GGHA 3IWPA 5HULA 1F3WA 4L4PA 1XYMA 1EP3A 3E0WA 3EA2A 4HPGA 3BLEA 1ZAJA 1S3TC 4W85A 4YCOA 4NAFA 1W6TA 1EA0A 1XIJA 1BLIA 1RA5A 2XWDA 3BLLA 4HNLA 2VDHA 4S39A 2WMJA 1AD1A 3OYXA 5A6BA 3EXRA 4JX5A 4AHPA 3AROA 4MZ1A 4Z2GA 3ZLHA 1XLBA 4DJDC 3WQVA 4LVGA 3NJ3A 4ZA0A 3APGA 1GUVA 3HPSA 3QM3A 3W00A 4NNBA 2Z6IA 3RUBL 4C6JA 3T9PA 4GYJA 1ME8A 3ABSA 4AZCB 1XR2A 4UTTC 1YEYA 1X38A 4J3VA 4P8XA 3VNMA 5FSDC 2FPYA 1KM4A 1GKPA 3WH6A 1R0MA 1E73M 2XYLA 4Y9OA 4TXEA 4GG9A 1X1ZA 1X1OA 2OWXA 2NLYA 1ADDA 1LBLA 4E5TA 3S2MA 3REQA 3VCNA 4UQBA 5KZDA 4JDBA 4XZWA 3EOEA 4DBEA 1GVEA 4RKAA 3TKFA 2VCAA 3WNNA 5C9WA 3CWNA 2RDWA 5FA5A 1RLCL 3UQNA 4LBSA 4K68A 3RPMA 5A8MA 1WKFA 3NAVA 3MMTA 3R2GA 3WIJA 3MSGA 4UQDA 1H7WA 4D1JA 2ZZ4A 3LRMA 5ECVA 1W8GA 3VIFA 2EJAA 3GKFA 1HGYA 3OZPA 1B30A 1DTNA 4YIWA 1LDCA 5CPQA 4F0KA 1KGUA 3TROA 3RITA 3CUHA 1N8IA 1G67A 3GDRA 5I3FA 3WNMA 4M8UA 1LWHA 2V2DA 2VEPA 3OODA 3W7PA 3IK4A 4J4KA 1D8CA 1PHQA 4LW7A 3DEQA 1K02A 2WJEA 1Z7AA 2WO5A 3H2FA 4C6MA 4G56A 1TVLA 1OABA 2PDFA 2WBGA 3LEPA 5F2IA 3W02A 2WHMA 1R3TA 3LS9A 1OK4A 2ZRYA 4F3HA 4OUEA 2VQUA 2XVPA 4OVXA 1UKOA 1DXIA 1H1YA 2P0OA 2Q09A 1WZLA 1OM0A 1O66A 2V5JA 3QSTA 3IJ7A 2W92A 4JQ1A 3ALGA 4GNVA 4LYRA 2ZUNA 3UP8A 3LMYA 3S9ZA 3M5ZA 1XL9A 3T1GA 2WLZA 2XDFA 1WKEA 1KR1A 4YJ5A 3SADA 2YPIA 3VZYA 1T8XA 1VFSA 5FF4A 3BAJA 4H9XA 4OZOA 3UVAA 1IV8A 4TV5A 5EMYA 1VPYA 2BNJA 2PLMA 2PLJA 3UPMA 4DO5A 3C2OA 2BG5A 1DJGA 2QGYA 3UNTA 1WXZA 3RM8A 6ENLA 5FJTA 4NQ1A 3W7KA 5A6LA 3CHFA 3ARXA 1GOOA 1DIOA 2QGHA 2CZVA 2JEPA 4DJDD 3GNXA 1QHZA 1V77A 1PYMA 3FX4A 3ZS4A 2J9YA 4IIEA 1XISA 1HGWA 2UZ9A 4TTUA 1VCGA 3DFHA 3G1XA 4F0MA 3H24A 3CTTA 1WYIA 2OSYA 1NDVA 3FV9A 1HJSA 4AEEA 1M68A 1FRBA 1XYBA 4X22A 2VRKA 3TN5A 5M03A 5DT5A 3LPFA 3ZZ1A 2J47A 4QIUA 3NDZA 3BCFA 4NRRA 2CERA 3N9RA 2Y8UA 2DV0A 2NLIA 1Z9AA 2X7VA 4JTHA 4YXGA 4J9JA 3DFYA 2DSKA 4MVAA 3U8GA 2INEA 1RD5A 3GW0A 4W8LA 5FAJA 3BVJA 4U33A 4XSLA 5HAOA 3IPWA 3H55A 4OOUA 3SJNA 4GQRA 2VFDA 2RDTA 2F61A 5CZKA 5GNXA 2PGRA 1XV8A 3W22A 1Z42A 3ALFA 4AD3A 3CGTA 4DAFA 2Y88A 3B8VA 3PG9A 2VQTA 1GVSA 4CQ9A 5IDIA 5GNYA 5IFTA 1HG3A 3WLIA 4N9BA 3VGEA 3O15A 1LWJA 2VEKA 3ZT7A 1G6CA 1U30A 5A2CA 1U5VA 1QDSA 3TOPA 3F4VA 3OBAA 2WW5A 1UWUA 4B15A 1CEOA 1U22A 2QCDA 2E9BA 1XD1A 2DFAA 2X09A 3KOYA 5A2BA 3M5VA 3PF3A 1FHDA 3GR7A 3ZJ6A 2NUWA 2WVUA 4PB3A 1Z44A 2DUZA 4KCTA 5LNSA 3ZVIA 1GWJA 4RZ6A 5DFAA 2V2HA 1WE5A 5AZ1A 3DFTA 4J3SA 2XVLA 4TU1A 3WQGA 1GOQA 3U57A 2Z7KA 4XZMX 2AL2B 5H91A 5KZEA 3I6RA 3OO2A 2FZ9A 5C2GA 2GJLA 3PBYA 3TJIA 3K2GA 4HA3A 2Y7FA 3R8HA 5IHSA 4Q7BA 1DIEA 1QAPA 1PKNA 2ICSA 1SO3A 1FH7A 3G0UA 3GFZA 3IGSA 3P2VA 1FHLA 2E67A 2Y2WA 4U31A 3LLDA 1SQ7A 1NVMA 4HQVA 2QVNA 4GH1A 5C54A 2X1IA 1FWAC 3KWSA 3OQ8A 3B8IA 4O57A 1RCQA 2HBXA 4WVXA 2WC3A 4NZ3A 4HA4A 3PJTA 3MY9A 4CQDA 4S1FA 1F4AA 1NAL1 1GOIA 3FSUA 5E0CA 1GTHA 4UFLA 2HK1A 1V02E 1BD0A 4JKKA 4AZ5A 3NG3A 4D6CA 1K7XA 1YE4A 3WELA 1JULA 1R30A 5AYBA 4JEJA 1J96A 2ZX6A 1BWVA 4O1EA 2OT1A 3DENA 3HQOA 1FA2A 4EAMA 3W7QA 4XZBA 3B9AA 3MKCA 3TYEA 4M6QA 4TX8A 1W8SA 4GK8A 4S3CA 2FVMA 2QDGA 1JCMP 1PCWA 3KBVA 6REQB 3VIMA 2DT0A 1EDQA 2A2IA 3CEPA 1LP6A 1MVYA 1SFTA 3EMQA 2YCIX 1HNYA 3EDKA 3S1UA 1KW1A 4CKQA 4LWWA 7REQA 4B5SA 4MADA 5HK4A 4K6AA 3I7RA 3P0WA 4YTTA 4NI3A 5HMFA 1C7SA 5KSWA 4JX6A 1CENA 4MKVA 2OKTA 2ZX9A 1O95A 4XV0A 4KRZA 1WXYA 4MLRA 1J0KA 3ENLA 4IGHA 3VOHA 3QV8A 3GXMA 4LNYA 2NVDA 3WBWA 4UTWA 2X0HA 4ZO7A 3PJUA 2H9AA 1DOSA 4J2PA 3LSCA 2AMGA 1IWAA 3CNYA 1E1EA 3OU8A 4BEUA 5I00A 1L0PA 2GGGA 3SCTA 1JUBA 2B7NA 1WKDA 2FFIA 5HA7A 3I7QA 4B3LA 5JVLA 1XIFA 4IUOA 4ZO9A 4JCMA 1QW8A 4WZHA 1IXOA 1KNWA 4WXZA 6ALDA 3PZMA 3EWCA 4I7VA 1G5AA 5C7VA 3KBJA 4LS1A 4EK7A 2GQ8A 1OCJA 3VPLA 2ALRA 1JYXA 4TTGA 4K8EA 2D2HA 5D4YA 1YMYA 4EANA 3R0UA 4GGHA 4YHEA 1SW0A 4W86A 1XLDA 2ACRA 4MB4A 1CXHA 2WQDA 2GPTA 1QO2A 4O4VA 3JZEA 2WSPA 3M4HA 1LG2A 5HANA 3PNZA 3G5EA 3UXAA 1B9ZA 1HIZA 3CZKA 1H11A 4NHVA 4PULA 1OGGA 3HA1A 2FVLA 1EGMA 4FIRA 3CO8A 3SGUA 5FEPA 2OVLA 5FCZA 4M6PA 4BQ5A 1EJWC 1FBAA 3O0FA 3AWOA 1TREA 4HJWA 4AQLA 1XWYA 3WDHA 3WMLA 4F2TA 2E5DA 3SGZA 4JIHA 1RHCA 3LTYA 1FKWA 3EXTA 3V16A 3ZJKA 1ICSA 3M44A 4H4IA 1OFQA 3TJXA 4JOMA 1KFCA 4LAOA 3BTNA 4S3GA 3S42A 3VZZA 1W37A 1OIMA 4RE4A 1AMKA 4AD5A 1L2UA 4UFMA 2WNZA 4QG9A 8CGTA 3TZNA 3WQDA 1I2QA 4HMCA 4F9JA 5D04C 1RSCA 4BF5A 1Z48A 2OYMA 2HE5A 4MKSA 2WCSA 2Z1SA 4JHMA 2D2GA 2PGFA 1OCBA 1UWTA 7TIMA 4JFSA 4LYKA 4IL2A 1W2VA 4PCTA 4MDPA 3MANA 3BMVA 3S9IA 1Q7MA 3Q58A 2GSEA 3CAVA 5H8MA 4V27A 2WZHA 1LROA 1P6CA 2DH2A 2DVUA 3EYPA 4HBKA 1S38A 2Q3RA 3IVSA 3L4ZA 4FLOA 3VABA 5F1VA 1LLOA 1E6RA 3SCQA 3RG6A 3POHA 3ZQ9A 1UD4A 3W1MA 4NJHA 1ZFJA 5K7JA 5I5RA 2UY3A 3MMDA 1F76A 1XRFA 3FJLA 4ML9A 4WQ6A 5D05A 3PB0A 3TDFA 3CQ0A 3VDGA 2HS8A 1W3JA 4PFHA 1GHSA 2PURA 3UWWA 3NOEA 1W9DM 2ZQ0A 1JCJA 2YW4A 1FTXA 1LQAA 3EB4A 3NDOA 1Y0EA 3QYSA 3E0LA 3PTQA 4FIQA 4ZQMA 1XF0A 2WLYA 3W07A 1UMLA 5CGQA 3UWVA 4Z2HA 3NM1A 3TN4A 3E49A 2PAJA 4G2DA 4GJ1A 4GQGA 1P0KA 2PWEA 4UTKA 1GW9A 4J35A 4O15A 5IXEA 4Z17A 3GNPA 3UWYA 3AMDA 1BQCA 3C2RA 1KTCA 1BGAA 2B81A 3UYCA 1XLEA 3QC0A 3NZ1A 1M3UA 3E02A 3XISA 3AZRA 5MKGA 4LUYA 2D73A 3AQUA 3OZMA 4MY9A 1EF3A 4AF0A 3CASA 1W9BM 2NVAA 4G7FA 1R9ZA 4MAZA 1J10A 1VENA 2WVSA 3A4XA 3QPYA 3AHZA 3UYIA 3WL1A 4UQEA 4UOZA 3NQCA 5DMNA 4HU0A 4D2JA 1JFHA 4R7WA 1SPQA 3NL2A 3AS2A 1KCXA 4XUGA 4UOJA 1PZ0A 3GTNA 3TEVA 4XO6A 2FHBA 3AS1A 3OBEA 3T8QA 1R7OA 1ME7A 3LI1A 1EHAA 1MFUA 3EGJA 3R4IA 3TSMA 3S4TA 2PDIA 3N12A 1W5NA 1CLVA 3BZGA 2BOEX 1Q85A 1DWAM 1HO1A 1GW1A 3JU2A 1PIIA 3W26A 5D9PA 2ALDA 5D09A 3R94A 1D7KA 1NOFA 2EO7A 1ZPTA 2DZTA 1V03A 3N73A 2IQTA 2VEMA 4DJED 4CNNA 1AH3A 2PD5A 3W1LA 3OLIA 1QPKA 4W8AA 4BFAA 4CD4A 3BLIA 3YPIA 3WMSA 1C92A 3N17A 2HE8A 2VDIA 4W7VA