4DI9A

Crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
293
Chain Sequence
LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLKRLVDDAPKDKFLEVAGRLPAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTAWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-pyrone-4,6-dicarbaxylate hydrolase
publication title Structure and Catalytic Mechanism of LigI: Insight into the Amidohydrolase Enzymes of cog3618 and Lignin Degradation.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 98
structure length 293
sequence length 293
ec nomenclature ec 3.1.1.57: 2-pyrone-4,6-dicarboxylate lactonase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4di9A00
2Q09A 4LCSA 4IFKB 2EG7A 4D8LA 2PUZA 2HQAA 4XAFA 1DPMA 1BF6A 2OQLA 3A3XA 4GK8A 1EF2A 4QS5A 4C5ZA 3LGGA 1ITQA 4EPDC 3NQBA 1NDZA 4H9TA 1FWEC 4GX8A 3R0DA 3DC8A 1A5OC 3B40A 3F2BA 2P50A 2Z27A 3LNPA 4EPEC 3OOQA 4KETA 1RK6A 2R1NA 2HPIA 4LEFA 5E5CA 3K4WA 2QPXA 3BE7A 5G4HC 1NDWA 4GYFA 3F2DA 5CH9A 1IE7C 2BB0A 2WM1A 1EYWA 3DCPA 1A5MC 3UR2A 2Z2BA 3LSCA 2Z7GA 4DYKA 1FWHC 4C6MA 3IACA 4C65A 1GKRA 3LGDA 4C6DA 4NP7A 1PTAA 4QSFA 2UBPC 1ZZMA 4IFKA 2R1MA 4RDZA 1FWCC 2Z2AA 1XRTA 4WGXA 3UR5A 3K5XA 3F2CA 3ORWA 3QY6A 3UBPC 2Z29A 4Z42C 4QTGA 5HMEA 3ISIX 1M68A 2AQOA 2FFIA 4F0LA 4H01A 2YZ5A 4XD5A 4DI8A 3TN3A 1V79A 4EPKA 4B91A 3GUWA 4XD6A 1R9YA 3S2JA 4CQBA 2Q01A 3TN6A 3GU2A 3NURA 4HK7A 4BKNA 3HTWA 4C6PA 1J79A 1V77A 4I6VA 3IJ6A 4CNUA 3LA4A 4GBDA 4GX9A 3AUOA 3S2LA 4R85A 3QGAC 1NDYA 4R88A 4H9YA 4CQDA 3OQEA 4KIRA 2Z24A 3WYZA 1NFGA 3RHGA 3PANA 2FVKA 1R9XA 4IGMA 4WVXA 2PLMA 2PGFA 1RAKA 3GTXA 3AU6A 2G3FA 3FEQA 4V1XA 2DVXA 2OGJA 2GWGA 1ITUA 4ERAA 3MVTA 3E38A 1FWBC 1YRRA 2RAGA 2Z00A 3JZEA 1RJPA 3NEHA 1RK5A 2UZ9A 4IH3A 3N2CA 4C6NA 1J6PA 3B0XA 4TQTA 4NG3A 4DO7A 4L6DA 4KERA 2PAJA 2QT3A 1UMLA 2DVUA 3F4CA 4UB9A 2ANUA 4DLFA 3PNZA 3EWDA 3QY8A 1V51A 4LAMA 3GTFA 3LU2A 4H9UA 4H9ZA 3E0FA 3DUGA 1YIXA 3A3WA 4GY7A 2KAUC 4GY0A 2ICSA 2PGRA 4J2MA 3KM8A 3GG7A 1K1DA 4LCRA 2OOFA 3GTHA 4C6EA 3T1GA 1EJSC 4C6JA 2P53A 3MDUA 1RA5A 1WXYA 3GU1A 4WHBA 4B90A 1R9ZA 3HPAA 3URAA 4IFRA 3QGKC 1YBQB 3QY7A 4DI9A 5LXXA 2WJFA 4P5UA 2GWNA 2VUNA 2D2HA 3IPWA 1UBPC 1XWYA 3RN6A 4G7EA 3A4JA 5FSEC 1EJVC 4LH8A 4XD3A 1GKPA 3RYSA 1FWFC 4XAGA 1YMYA 4XAZA 3URBA 3B0YA 3HM7A 4DZHA 3FDGA 1POJA 4C60A 4F0SA 3MSRA 2Z25A 4H9VA 4QRNA 1QW7A 2EG6A 4M51A 1FWAC 1XGEA 4IFOA 2VHLA 4BJHA 1A5LC 1FWJC 1RA0A 3MTWA 3EWCA 3CS2A 1EZ2A 1V4YA 1KRCC 3T8LA 4HJWA 3IRSA 3S4TA 4AQLA 3E3HA 1I0BA 2R1KA 3ICJA 4AC7C 4ZSUA 3E0LA 2VC5A 3LS9A 1YBQA 1J6OA 3TN4A 4PBEA 4H9MA 4C6BA 1PB0A 4BY3A 4C6FA 4GOAA 1V7AA 2O4MA 4IQJA 3IGHX 4RDWA 3OODA 1E9YB 4J5NA 2BGNE 4KQNA 1KRAC 1EJXC 4KESA 4H9XA 1FWDC 3MDWA 4C5YA 1A4LA 1KCXA 3LY0A 4CEUC 2F6KA 4KEZA 3URNA 1EJRC 1POKA 2AQVA 4INFA 4G7EB 3EGJA 4CEXC 1ADDA 2ADAA 2Y1HA 2IMRA 1P1MA 4I6KA 4IF2A 4KEVA 4C6KA 2HNHA 3MVIA 3RCMA 4HK5A 4E3TA 3OJGA 2VR2A 2YB1A 1ONXA 2D2JA 5FSDC 4F0RA 2XIOA 3IARA 3AU2A 1WXZA 1XRFA 3GRIA 4C6LA 4V1YA 2YXOA 3C86A 1UIPA 2ZC1A 1NDVA 2I5GA 3MJMA 1A4MA 3ITCA 2QVNA 2Z26A 3GU9A 3CAKA 2R1PA 1M7JA 4RE0A 5A6TC 4R7WA 5AKQA 2QS8A 1FKWA 1UIOA 4C6CA 2Z4GA 3ID7A 2O4QA 3FDKA 3TNBA 1M65A 3S2MA 4LANA 1PO9A 5HMFA 1RJQA 1ONWA 4JOMA 1FWIC 4C6IA 4IG2A 4G2DA 1KRBC 2I9UA 3URQA 4CNTA 1FWGC 3V7PA 3D6NA 3OU8A 3SO7A 3E74A 1GKQA 4IGNA 4DZIA 2OODA 4L9XA 1A5KC 2E25A 3O0FA 1O5RA 4XAYA 4GY1A 3OVGA 2HBVA 4PCNA 5HMDA 2HPMA 3T81A 2GSEA 2WJDA 2HBXA 1EJUC 2CZVA 4ZSTA 2YB4A 3GIQA 2WJEA 2E1WA 4DNMA 2Z28A 2R1LA 3MPGA 1S3TC 4EPBC 1P6BA 2DVTA 1W1IE 4ERIA 2EG8A 3UF9A 3SFWA 4PBFA 1FKXA 3O7UA 3GIPA 4LAOA 3K2GA 2W9MA 1E9ZB 4B3ZA 1RJRA 3S2NA 4ICMA 4KEUA 1P6CA 2OB3A 4LAKA 3IV8A 1K70A 3MKVA 2AMXA 4KF1A 4LFYA 1QXLA 1HZYA 3CJPA 1EJWC 2FTYA 1YNYA 4PCPA 4RDYA 3PAOA 4UBPC 4DIAA 1JGMA 4GZ7A 3GTIA 4J35A 4C6QA 4MUPA 4CNSA 1O12A 2VC7A 4EP8C 2A3LA 3G77A 2FTWA 3WZ0E 2D2GA 2VM8A 4GXWA 1VFLA 4B92A 1KRMA 4XD4A 4IG2B 3PNUA 4CQCA 3LSBA 4HK6A 1K6WA 4C6OA 4QROA 4LCQA 4PE8A 2GOKA 4LALA 1I0DA 4OFCA 4QS6A 4RZBA 4ERGA 4YIWA 3PBMA 4DLMA 2FVMA 1PSCA 3UPMA 1EJTC 4H00A 3TN5A 1J5SA 3F4DA 2GZXA 4HA0A 3E2VA 1A5NC 4NI8A 3WMLA 4RDVA 4GC3A
chains in the Genus database with same CATH superfamily
1TPFA 4W86A 4WDTA 5HR6A 2VELA 5LHFA 3E2SA 3EWYA 4FF5A 4UQBA 1LG1A 4O15A 1JCJA 1IGSA 2QIIA 2QDGA 4JDYA 1HKJA 1MEIA 2X42A 4P2VA 3OOQA 3QQWA 4JTKA 3PR2A 3TWBA 4IMCA 5G4HC 2E6YA 2FB2A 2YJQA 1D7FA 3CUFA 3H24A 1C7SA 1OEPA 3VK5A 4MHBA 1PKYA 3UR2A 3PFMA 4OVXA 2Z2BA 4GABA 1E72M 1FOBA 4JYDA 4DYKA 1TA3B 3N1AA 2WC4A 1NM9A 3M07A 2G5WA 1KFBA 1KM5A 4OUEA 3EDFA 1SJDA 4CD4A 4N9DA 4NX0A 3ZMRA 4E2VA 4RCXA 4C7FA 4QJ1A 4ALDA 4O28A 5HMEA 4QP0A 3C2YA 4O14A 4B5XA 4DI8A 4JPGA 2NQ9A 4ZO9A 4G1NA 3SCTA 4XZLX 3P84A 1JCLA 4JN6A 4AD2A 5HXMA 1WZKA 1TX0A 2DZWA 4K36A 1J79A 2DQWA 2DT2A 3FYYA 4B3KA 1QI5A 3AUJA 3KOWA 2A7NA 3LENA 5AVHA 3M1ZA 3VOGA 1I75A 1WAUA 4DM2A 2V5DA 3Q2DA 4QLKA 2RH9A 4FI4A 3GVGA 1P4CA 4AH7A 2E67A 3UR7A 2EJ1A 3E38A 1KFLA 2NQ5A 1J5TA 2PDJA 4C7GA 2QHAA 2A85A 3TC7A 2VT0A 2GL5A 1L6YA 2PAJA 3Q45A 4LWWA 1GZGA 3OVPA 4XZ9A 3F4CA 3O3RA 3KCJA 1IV8A 1ICQA 4XUYA 4MWAC 2GQ3A 4ZL1A 4GZIA 2J7EA 4H83A 1W0MA 5AYIA 4Y9OA 4GNKB 4PTVA 4B16A 3ALFA 1GW1A 1L6SA 3BOLA 5I3FA 1SJAA 3A23A 2XSBA 4ATLA 1QCWA 2PDQA 2WVUA 4NY2A 3FHQA 4FHAA 4PMRA 2HVOA 1HJQA 3LUTA 4UMAA 1UBPC 1EDTA 3M46A 3HURA 3LNMA 4TXEA 4JQAA 4AWTA 5AFDA 2WMIB 4KFPA 3C0QA 4BWLC 3WKZA 1KBLA 3MB9A 2HNEA 1TQXA 5AYBA 3NIYA 2OVLA 3TP4A 2FTPA 4NT0A 4HNCA 1GPWA 5HULA 3A64A 4JAWA 1C7TA 2PS2A 4YVXA 4MB5A 2WZEA 2C19A 1MRQA 1G0CA 1OGSA 1IF2A 2P8BA 2G95A 5CJNA 3TMLA 4H7VA 1DP0A 2A3HA 2PU0A 3GDRA 3KUMA 1VH7A 1GNXA 1XHGA 1CEOA 4ICCX 4WDUA 1E73M 3TUUA 1HJVA 4CNPA 1F7BA 1Z69A 1TTIA 2GUYA 4NASA 3CBWA 1E9YB 3AZTA 3GHUA 3SQLA 3LLXA 1XH1A 3PHAA 4RE2A 3GNPA 4L9YA 4AISA 1H7RA 3LN3A 4LNYA 3BJFA 4U28A 2XVNA 3DHDA 1GQIA 5LNUA 1EX5A 1GORA 5D9NA 1SO5A 1VHNA 1FUYA 4M24A 3WJZA 4LUSA 1P0KA 6TAAA 3DKLA 3CASA 2J27A 3W82A 4W8BA 3GUGA 3OJGA 4I5UA 1VIZA 1L6WA 4Q4KA 3GVRA 1CGWA 1XSJA 4V1YA 5GJPA 2WQDA 3BLKA 4JQ2A 3WMCA 5AHNA 2JE8A 3ABXA 4PCFA 4DJDD 3EWZA 3ARPA 5I02A 3GK0A 3ZJKA 3MANA 2Z4GA 4JTLA 4EACA 1Y7VA 4A22A 4WY0B 4C1LA 2C91A 4GMEA 2QJMA 4QR6A 1YTDA 4A8IA 2GQ8A 3VIHA 3CZEA 4GQBA 3KRSA 5DMLA 2VFIA 2CNCA 3GXMA 3I7RA 5C9ZA 1J10A 3K1DA 4S3CA 1UD5A 4DO4A 2CBUA 4AZ6A 1QRQA 4AMCA 5I07A 4UFKA 3UWQA 4M1BA 2W6RA 2I57A 4EPBC 3WLOA 2PC8A 3MC5A 3KOYA 2DVTA 3CB3A 3M5XA 5DX7A 1E4MM 3FJNA 3N73A 1UMYA 3TMQA 3REQB 4ILSA 1QBAA 2ALRA 4GACA 1E9LA 5FOOA 2VQTA 1W37A 1E9IA 2G0WA 4CVWA 3UGRA 1OBAA 3KE0A 4Q32A 2UWFA 4KFOA 3CLWA 3GXNA 1HL8A 4EAMA 4C6QA 2UY5A 1EH9A 1W56A 2VC7A 1D8CA 1AL7A 2A3LA 1FH7A 1I2RA 5JIPA 4H4IA 2VM8A 3MZ2A 3TLQA 4HK6A 1LORA 2GJNA 2ON3A 2EPKX 1VPQA 5GNYA 4BEUA 5A3HA 2PD5A 1QNRA 3AFBA 1IT8A 2EHHA 4DQWA 1O68A 1JJKA 5M3WA 3W6YA 3MP5A 1UROA 3B3DA 2H9AB 1TVNA 4JD4A 1IIHA 3VDAA 3U2OA 2Y61A 3CV6A 5DRCA 1J93A 3NM1A 4YMZA 2OZ3A 2YW4A 3F5LA 3UJSA 1EF2A 2VTFA 3OG3A 5D9PA 1UWSA 1K7FA 4HU8A 2HVNA 3OVRA 4ZE5A 4CNOA 3B40A 1RY8A 4LQ1A 3FHAA 1XPGA 1TZ7A 4LUYA 2P3ZA 2YYUA 4GNVA 3QVQA 5G2WA 2ZXQA 4X3ZA 1NDWA 1ESWA 4HA1A 4P7OA 3WLNA 2QCDB 1EOKA 2YKKA 1Y8BA 2QDDA 3STGA 1YW1A 4UQAA 2Q8ZA 3ES8A 1UKQA 3TC6A 2JQXA 3WLHA 2JKPA 4GIYA 2J74A 3MHUA 3FEMA 4AZCB 2IQDA 1PTAA 2XDFA 1K8CA 1E55A 3PSWA 4HCHA 4DF2A 3WQFA 3NVTA 2VFEA 9CGTA 2YL6A 1M7OA 4WGXA 3I6TA 1E6NA 3QH2A 3KBJA 1TTJA 1RPXA 3TTEA 1TWZA 4TVUA 3GDTA 2AQOA 4JNMA 3BQ6A 3RK8A 4RXGA 2FHCA 3J7HA 1VFSA 2D0GA 1FWTA 2W61A 4FX6M 4Y9MA 4GYPC 8XIAA 1XSIA 3IJ9A 1MNSA 4FR6A 4KIRA 3NGJA 2E5DA 4D2JA 1IWAA 3N29A 4NHVA 1SW7A 1C9DA 2PLMA 2PTYA 3HO8A 3QBUA 4HN4A 3SCVA 3FEQA 2W92A 5BOEA 4NNBA 1TUFA 3GYCA 4ADTA 5M1TA 3BCFA 5AYXA 3CIVA 3PG9A 1X7IA 3S46A 5H91A 4H6EA 3ZFHA 1UMLA 2I16A 4FXRA 3T08A 4DO6A 3QPZA 1ONRA 1Q6LA 2FVLA 3GTFA 1OX6A 2GGEA 3FVDA 4HMEA 4GY0A 4ADSA 3DECA 3BW2A 1DJXA 3QZAA 4UOJA 3CMGA 3V4BA 1RA5A 4O11A 1PTDA 2VO5A 4HP5A 5C8BB 4J7RA 3WQWA 1E56A 5DO8A 3TR9A 1XW8A 4J3WA 1F74A 3G1RA 1CW2A 4JTUA 5F2IA 1JF5A 3WJYA 2JKEA 4POCA 1OQFA 4HNLA 2I5IA 3CUXA 3PZIA 3R4IA 2G4JA 4H3DA 2OWXA 3IJIA 3U7BA 4CD6A 1X97A 4NXSA 4IMFA 3IIZA 2Z25A 4UCFA 3CYVA 4E2DA 1R3VA 3HN3A 4JHZA 8TIMA 2PDLA 3LXBA 4KMQA 3IRSA 1CWYA 3MJYA 3ICJA 3ZR6A 3NZGA 1QOQA 3JR2A 5CPOA 3ZJ7A 5JH2A 1QBBA 1U5JA 1U1HA 1CIUA 1PB0A 2Y0FA 2RDUA 1KTNA 5CSRA 4QBXA 3IGHX 4DY1A 4OWGA 4IGHA 1BAGA 3RLUA 3MBDA 1CENA 4F66A 3KTXA 3SUSA 5IFPA 1S1RA 2NZLA 1TKKA 4OIFA 3STEA 2YBVA 2ADAA 5LIYX 5AZ0A 1DJWA 3MVIA 1BGGA 3TTQA 4MYXA 4H2HA 4G6CA 1UD8A 3GRIA 1GG1A 3GYEA 4XZHA 1RQEA 1AD4A 2WVSA 4AXKA 1DEDA 1JZ2A 3W23A 3NQ2A 5CC5A 5FJJA 3NA8A 4AMAA 1UJQA 3CWHA 2CU0A 3LHYA 1QNPA 1FCUA 2VFHA 1LWIA 4WJXA 4AWSA 3WF1A 2PURA 3MI3A 2W91A 4AC1X 2DSVA 3D0CA 2A7PA 2SFPA 1US3A 2XN1A 2WKJA 4NYUA 3BG3A 2PGWA 1TPDA 1UR0A 5BXPA 2QUUA 3PULA 4OECA 3G0XA 2J62A 3N6HA 3GIQA 2WJEA 4L4OA 1MFUA 4FIQA 3MPGA 4RW5A 1XD1A 3UW6A 3A3HA 1OFEA 2EG8A 3W71A 3QLLA 5KMYA 4KRZA 1C90A 1LF1A 3SFWA 4YS1A 2WNWA 1CPUA 4FO4A 1BYCA 3L5AA 2VC9A 5T9CE 3S2NA 2V5CA 2J78A 6XIAA 3CC1A 3TTYA 5CGQA 3EOSA 4ONVA 2GLKA 4W93A 4DWSA 3OVQA 4P61A 1KM1A 4DN1A 1MQQA 2IKIA 1OFBA 3GAYA 1UC4A 4WCJA 5JXQA 4XZMX 1YXYA 4LVDA 1DIOA 2NX9A 2YL5A 2J9ZA 1LL4A 2OZTA 2PE4A 1K7XA 1V8EA 3WZ0E 3EPOA 3HGRA 1CXFA 2XUCA 1C91A 1L9WA 3WMBA 3I65A 3MMDA 2PBOA 1K6WA 3UVIA 1JYVA 3W2LA 4LALA 5AC8A 1I0DA 2G37A 4ZO8A 4Q8VA 4M82A 5CJMA 1E1EA 1VF8A 4JTQA 5CGTA 2GZXA 4HVXA 2HSAA 4FNQA 2QPSA 3T55A 3ITGA 2EG7A 1TV4A 3K4AA 1YXCA 3QOMA 4Z0JA 3GG8A 2PODA 3MHFA 2ZX6A 4Q7IA 4JTHA 5E6ZA 4EPDC 3VZYA 2VYOA 1RD5A 5ABFA 3NQVA 4IMGA 3UJ2A 4LC8A 1H50A 3F2BA 4FLRA 4HPNA 1A5BA 2GFTA 5DBUA 4ZENA 4GYFA 3BGAA 5CH9A 4XBJA 3ITXA 1O66A 5F4XA 2WANA 4KS0A 2DT3A 1IT0A 2DZVA 4HYVA 5EGRA 4HNVA 2CLHA 4GCAA 4KWOA 1L6GA 1QPOA 3TTSA 1AD1A 5TBOA 3CLMA 4W7VA 1GPFA 2R1MA 2ZQ0A 1FWCC 4BZYA 1SR9A 3TQKA 1VFFA 2P1FA 1QNQA 3R13A 3K5XA 4MDPA 3RR1A 6CGTA 5CAKA 4OBTA 2QCMA 1LM1A 1XUZA 5D9OA 1HVXA 4PMQA 2JGYA 3HGOA 3S2JA 1GK8A 4JTRA 1QHPA 4GGBA 2C0HA 3NURA 1GHSA 3UXLA 3WCZA 2D3NA 4H19A 3PZMA 2XH0A 4W7UA 4MADA 3AQUA 2BTMA 1P43A 2FMOA 2G3NA 1NDYA 1B3YA 3UY8A 4DO5A 4GA8A 2X09A 3CHCA 2FJUB 2J7BA 3PANA 4W87A 4UXDA 3DI1A 3GTXA 3UVAA 2G3FA 4V1XA 3U4AA 2QJNA 2ZRUA 3LHTA 4IICA 3BAJA 3MUZ1 9RUBA 2WBKA 2C71A 2EEXA 2NWSA 3DFNA 1FWBC 2PZNA 2TPSA 3BGJA 3NEVA 4AIUA 2PCEA 2UZ9A 3W7PA 4IQEA 4C6NA 4PUDA 3GKAA 3V0TA 4NG3A 3WJSA 4YYFA 5EMLA 3H4GA 4A3HA 2AL1A 3ZT6A 4AIBA 5FI8A 3LU2A 3HFTA 1EX1A 5A6AA 4W4QA 2ZWZA 1TMQA 3NZ1A 3SY1A 1WX0A 4V2XA 3KDOA 1F07A 4TVDA 2XZ9A 4B5SA 4S39A 4JX4A 4OE7A 3RRAA 3NOYA 4K6AA 2ZYFA 3EPMA 4UR7A 2FB3A 1UZHA 4E8DA 4TO8A 2R9RA 3B8WA 3NDOA 4JL2A 3FOKA 3OBEA 2NQZA 4FS9A 1H7PA 1OVDA 1QPNA 2XIIA 2H3DA 3ATYA 3OIHA 3WLLA 3W2KA 4U5KA 1XF0A 3PJUA 5LGZA 4N7QA 2Q3RA 2VP8A 1AVAA 3NO3A 3HZ3A 1TPWA 4L4MA 4RPPA 4O18A 2EG6A 4Y96A 3SCQA 4QLJA 4YTQA 3ZVIA 1W1YA 2V5LA 4MGGA 4HJWA 3T2QA 1ZJHA 4NZ4A 1I0BA 3TE9A 1S5TA 2A3EA 4MSSA 1H2JA 1M3UA 1J6OA 2CHNA 2BXVA 4YWIA 3VABA 1CXLA 1DWGM 4HSNA 3T78A 1OF6A 1E15A 2ESCA 5JBDA 1V7AA 4O16A 2WBGA 5BYWA 1EFZA 4KH2A 1IZCA 5DANA 3NCOA 3F03K 3A13A 4QJ4B 4YNGA 1HUVA 1XLDA 3RX4A 4X2PA 3LTYA 5J8LA 1L2QA 3WX7A 2AQVA 1EHAA 3WELA 1X98A 1S38A 4AEOA 5A8NA 1JXJA 4JEQA 1JYXA 3NQMA 1F3XA 3RILA 4E3TA 2X41A 1SJBA 1EIBA 1ONXA 5TQLA 4Y8FA 1J0IA 7REQA 4WUIA 3T4WA 4PMOA 3VXGA 3VNMA 1N8WA 3TXZA 1UIPA 1GJPA 2D3LA 4NXKA 5CEWA 1FKWA 1UIOA 3CMFA 4AYSA 4C6CA 4DEFA 4MYAA 2PEVA 4DHGA 5CC3A 4Z2GA 3KRZA 4BQ3A 4Y6GA 3S2MA 1TO3A 4XAPA 4BK9A 2NX1A 1XYZA 1FWIC 2OMAA 3SN4A 2PTZA 1RPKA 2IKJA 3P93A 1I60A 1KRBC 1DQXA 3V7PA 2PMQA 5A8PA 4L7ZA 1V6TA 2ZZ5A 1PDZA 2OKTA 3L5MA 1MDLA 3UNTA 1W3JA 3PF3A 3T81A 3TQ0A 4XTIA 4ZFMA 2X2YA 1TB3A 4GI4A 5JBEA 4WSJA 4IIHA 3AIEA 1B3WA 1B1YA 1YXDA 3NQ8A 4DBUA 1A49A 3U0HA 1GOKA 3BOFA 3WEOA 1OCQA 5JH1A 1A5SA 1LBFA 4UWMA 1CTNA 5U4NA 1V7YA 3WBAA 1BG4A 4QJ5B 1R2TA 4FXJA 3HG3A 3ARYA 4IJRA 3T9PA 4ZGYA 2NQHA 2YDRA 4WLCA 1PV8A 4EOUA 1JGMA 4JIEA 2WQPA 3S5SA 3W7IA 4E4UA 5K9DA 2ISSA 6ENLA 2WO5A 4KWSA 4V33A 4XD4A 5CLWA 4LV4A 4WOQA 1UASA 3FFSA 1T8QA 4JY9A 3M0XA 4A4AA 3GC5A 4AVOA 4DB7A 3FJ4A 3LCWA 2WSQA 4AUBA 3M43A 4H6QA 3GR4A 1TRDA 5DCDA 1EJTC 2G41A 2Q02A 1DQUA 2PWVA 1UQYA 3JVAA 4HA0A 5F2LA 3BLEA 5MKGB 1OD8A 4LBRA 1GVYA 2FHFA 3W2JA 4CCZA 1KM2A 1B3VA 1MO0A 4FNRA 2WCSA 3W9ZA 1A5AA 1WP6A 1RSCA 4MF4A 1OCNA 5FD0A 4MNJA 3MSYA 4OUIA 5FJRA 4WD0A 2DJLA 4JGDA 4R27A 2ZOXA 3H2AA 5LNRA 1TWIA 4R9OA 2Z7GA 1H1YA 3OB8A 2IPWA 5KITA 3IACA 3ZR4A 1AW1A 1RHCA 1W3NA 4CNNA 2Z2AA 1E3ZA 2ISVA 2OELA 3C0LA 1BWKA 5D4YA 3W38A 2XVKA 4DBDA 1EDGA 2PU1A 2BODX 2VGBA 4GVGA 4HTBA 1BVNP 4ORIA 4XD6A 5FIPA 1NP0A 3KCLA 3N34A 1HQTA 3AYSA 3ALGA 3GDLA 4O1CA 1KBBA 1NF0A 1LOLA 4GX9A 1W3KA 2ZC8A 4H9YA 3CL7A 5I7GA 1F61A 2P0IA 4BEQA 3EXRA 3GVWA 3M5VA 4P7RA 3POHA 3RMJA 3WLSA 5IRPA 4U5IA 1NWTA 4QM1A 4JX5A 1H11A 5CG0A 1TJ0A 3G0SA 1IYXA 1C92A 5E6YA 2J88A 1PWLA 4N4QA 2E9LA 3F4WA 3M0LA 3R8HA 4EANA 2XWDA 2TODA 2Z2UA 3LK6A 4AY1A 4PFMA 2J9YA 4PUWA 1H09A 1XX1A 4UB9A 3W2NA 1S2TA 4S3GA 3VE9A 2R8WA 3NG3A 3DGRA 2PI6A 3W1AA 3VIFA 2GJPA 2FMNA 3E0FA 3FYOA 1Z32X 3HJZA 4J2MA 3CHDA 4JL1A 5EY5A 3VD7A 5CKSA 2ZA1A 4N42A 2PLCA 5HQMA 1R3TA 3GU1A 1SFSA 2FPTA 3URAA 2FZDA 5D2XA 1LWHA 1H7NA 1ME8A 2GWNA 1W3TA 3W7CA 3QLDA 5C2GA 4YU1A 3T07A 3EWUA 1UA7A 2FZNA 5EPDA 2AGTA 4LUJA 4D9PA 1GKPA 1N82A 2QNEA 2ZRVA 3ARXA 1ITCA 2O9RA 3VVGA 1B3ZA 3LM7A 3UQNA 1O4UA 1KGUA 4P8VA 3G3MA 2BFGA 3O6CA 3VE7A 3KCOA 2VXNA 4QRNA 1LWJA 4JFVA 5EBUA 1MWOA 2C1GA 4YPJA 4FR1A 2YA0A 1BSIA 3PJXA 3GZAA 1IXPA 4DJEA 5LA1A 1FDYA 1H5YA 3O15A 5HQLA 5HAOA 1XI3A 3TYEA 4K1GA 4ZSUA 3UETA 4GI9A 4UR9A 2YGYA 3GHTA 3GNRA 4C1NB 3TN4A 4C7DA 1G1YA 3YPIA 4LJ3A 4LVGA 1K02A 4TVCA 3WQ8A 1V6VA 1NU5A 2VR4A 1FFRA 2ALDA 3QR0A 2PA6A 4NZ5A 4QCFA 3EMQA 3OODA 3DIPA 3HF3A 2ZUVA 2GQ9A 1Q66A 4AEFA 3KVKA 1K8ZA 4J3SA 3V35A 1F8MA 1KFJA 1DJZA 1YDYA 1AQHA 2I14A 1POKA 3GKFA 2BOGX 2CESA 4JTAA 1REQB 2J75A 3NPUA 4ES4A 1MRAA 4PRWA 4CN1A 2YL9A 1XFCA 4XK2A 3ZT5A 4C6KA 3T40A 3VUPA 3WLPA 5I78A 1NH6A 2XSAA 4GJ1A 1E71M 2D2OA 3GNOA 2YA1A 5FSDC 1XICA 1HN1A 5D05A 1SO6A 4KW2A 4G9PA 2ACRA 4JN8A 3DAQA 1A4MA 1LT8A 1NOFA 3MBFA 3ZVHB 3C2RA 4LPCA 2EQDA 3K8LA 4GYKA 3V18A 1NFBA 1THFD 3LOTA 4GI6A 3H21A 1DWFM 3A24A 1O6IA 3NYDA 3DXIA 3ITLA 1EKOA 2ZUNA 3L0KA 1I6NA 2OLSA 4J3VA 5K2ZA 2OWCA 2G8ZA 3N13A 3E74A 3GNNA 4JFSA 4Q22A 4J4KA 3N2TA 3VD9A 3FS2A 3FA5A 3B8SA 4XQ6A 4NRRA 1DHPA 4O1BA 4DPQA 3EDDA 1KV8A 2WB5A 3LTPA 4GUJA 1XBYA 5H2ZA 4W5ZA 4DXXA 1DKWA 2ACQA 1LUCB 1W1VA 2CXGA 5I00A 3MI6A 4QE5A 4J9JA 3STFA 1ODZA 4NIRA 5CZTA 4GQ0A 4PBFA 1TWSA 4ZZ9A 3GIPA 2VGIA 3W72A 2W9MA 3JZUA 1P6CA 1LL7A 3WNKA 1H7WA 3AS0A 2GJRA 2HISA 4CU8A 4Q4RA 4RZ5A 5HANA 3L67A 1R86A 3RLVA 1MUWA 3UG8A 1VJZA 4RDYA 5C2XA 4O1DA 4PSPA 4LOCA 4O54A 2EXOA 1UZDA 3G0UA 1O12A 3EEGA 2RKXA 3IUHA 4PL1A 1XR2A 4AZ7A 4PE8A 1KM4A 3I6RA 4XUGA 4UR8A 1J9YA 1B57A 3N17A 2WZTA 5IHSA 4E4FA 1WDQA 1OFPA 4EXBA 2HJPA 3NDYA 4WJ8A 1TCMA 4U2YA 1S3HA 1KWKA 4D6FA 4NI8A 1F9CA 3KLLA 4RDVA 1UW9A 2IXVA 1SSDA 3QJAA 1MQPA 1JDEA 4IPJA 3SGUA 5E9XA 1DWJM 2ZDRA 5C7VA 3MT1A 5D2VA 4AZGA 4QS5A 3KX6A 4RV3A 4FOKA 3L65A 3EX3A 1VGAA 3ENLA 4GX8A 4GHRA 5SWUA 4LRSA 4YJ5A 2R14A 3GFXA 1RK6A 4F0KA 2TSYA 3M9YA 1E6XM 3W7NA 5FJUA 3CWNA 2E28A 1KA9F 2AL2A 4RE3A 1KM3A 5BRQA 1A5MC 2X0HA 4X0NA 5AHLA 3EBVA 3LSCA 4OU1A 4AIOA 1IXOA 1W1TA 1TUXA 3FIGA 4OKDA 3WL1A 4A8NA 2Z1KA 2DPEA 4PUMA 2ONEA 5HATA 1RUSA 1XRTA 3S9IA 4RR4A 4LB3A 2Z29A 4H8UA 4HCDA 3TSMA 2ISWA 2CBVA 1KCLA 3ISIX 2BBFA 2Y7GA 4H01A 2W66A 1LTDA 1MZHA 3SFKA 3GUWA 3IGXA 3T6CA 2Q01A 4KGJA 3GU2A 2NT0A 3GDBA 3RIKA 5DMMA 2V2DA 4AVFA 2YCKX 1TMHA 4OOUA 2PGEA 1KCKA 4MFDA 3B9OA 3NQGA 3R0KA 3W84A 2GVGA 1GG0A 4R88A 1WV2A 3E2RA 1RBOB 3LQLA 4NZFA 3MSDA 4MJ4A 3AU6A 1Q6CA 4UOQA 4IIGA 2OLHA 1S1PA 4UMCA 3AHVA 1G7VA 3LD5A 1S2UA 3N4EA 1UWTA 3EKZA 3OHIA 5FJPA 3F7JA 2BXYA 4ZOBA 1L8PA 1QOXA 4IMDA 1E1FA 4L6DA 4KERA 1HTIA 3HQPA 5CQ1A 3C8NA 1J0JA 1XRVA 4LEQA 1V3IA 1PKLA 3HPFA 1ZBKA 4D6GA 4H9UA 2O0TA 1TJRA 1QTWA 1V0NA 5F1UA 2WLZA 1OC5A 2PGRA 5FJOA 5AYZA 4DUVA 2Y5JA 1WCGA 2WZHA 3H4WA 2J8GA 3GO2A 1R7OA 1TELA 1FWWA 3PUEA 3D3AA 2PP0A 2YOCA 3W00A 3QY7A 4MG4A 1OGGA 4P5UA 1VBUA 3OLIA 1UWQA 4R33A 3PBVA 3NZQA 1FWFC 2F9RA 3WQCA 1YMYA 3S6DA 3AJ7A 1VKFA 1GZJA 5A5WA 5A6LA 1QNOA 2D73A 4AW7A 3N18A 1DHKA 4M51A 4RV8A 4BJHA 1S5NA 1F8IA 1DXEA 3MTWA 4LUSB 4FNUA 3GSMA 1OK6A 1EC8A 1GOIA 1TTPA 1FVPA 4O1EA 1CT5A 4DWSD 1ZCCA 3ZJ6A 3B9AA 4AX6A 4P7NA 4B5VA 1C9WA 4JTFA 4PBEA 3RCNA 3MKKA 2V3FA 4ZBCA 4AWEA 3L2IA 4F9JA 1F5ZA 4DVOA 1CZ1A 3E0VA 2WHLA 1OK4A 2CEQA 1NOWA 2C79A 4ZQPA 3V0SA 3BGGA 1EJXC 1AMYA 3L4YA 4AF0A 4FNSA 1BKSA 2RJHA 5E1QA 1B3XA 1PCWA 3T0BA 4Q4MA 2CLFA 3BLIA 3UZYA 4QG6A 4I9AA 1B9ZA 2H6RA 3RU6A 1UP3A 2V67A 2YB1A 2Z1VA 1FDJA 5FESA 2XFWA 4I9JA 1XRFA 2WNNA 4GXMA 2BX7A 2ZC1A 3AS1A 2I5GA 3ECQA 2HE8A 3GC4A 1XC4A 4FXSA 3DZ1A 3GAKA 3EDJA 1S2CA 4UFHA 2PFHA 1GVQA 1K9FA 4GYJA 3C61A 1ALDA 3WNMA 1FP8A 3WH9A 3WQ6A 1F05A 2TMDA 5AC5A 7ODCA 4KEMA 1JZ8A 3HFYA 3H23A 3UT0A 1TV8A 5FKYA 3QQ1A 4J40A 4KWUA 4JTJA 1XLBA 3TEVA 1N55A 3SO7A 3VM5A 4KIEA 1GKQA 3HPXA 1J12A 4JKMA 3SCRA 5C55A 4PMYA 4JIPA 1BQCA 4U3CA 3S2CA 3TVAA 4O53A 3WD4A 4Y9PA 2NT1A 4S23A 4UTFA 3QN3A 2YB4A 1WDSA 2PWHA 1V02E 2EF9A 3UR8A 1P6BA 3TK7A 1JPMA 2J7GA 2P10A 4N02A 4O1FA 1R3RA 3A47A 2WPGA 2ZXBA 2OEMA 3DFHA 4KEUA 4CU6A 1UYQA 3AS2A 4OQVA 4TMBA 2NUXA 3IV3A 1XGZA 3LXAA 5M17A 4QE4A 4M6VA 4KRTA 4HZ7A 4ZOEA 1OFQA 2PLKA 3B9NA 3E9AA 3BZJA 3DI0A 1XUUA 4DJFC 4B92A 3W1MA 1JNDA 2G4FA 2DEPA 3L0GA 1TVPA 4HMNA 1AG1O 2CZFA 3LB0A 3WD2A 2ZCGA 3KHDA 4DLMA 4XVEA 2FGZA 2CHRA 4LVFA 4AHPA 4H00A 1EP2A 4WEVX 4RW3A 2ACSA 4YTRA 4GC3A 2Q09A 3AHXA 1UR3M 4CVUA 3B4UA 2VURA 1UA3A 2C0AA 3NSXA 3BXWA 3WBXA 2A79A 4OV9A 3D46A 4HHPA 4GGHA 1RP8A 2BNJA 3IVSA 1NDZA 4ACZA 1VLWA 3WK0A 2CETA 5C6MA 4EKJA 2Z27A 3T0CA 4N2YA 1C8YA 2A0NA 5AY7A 3M0ZA 5E5CA 3E49A 1AW2A 3OBAA 4YVPA 1A5UA 1K9DA 3CUJA 2WM1A 3A21A 4LBUA 3QHMA 3GVVA 4R9XA 2YPIA 4R53A 3LHVA 4MWAA 2VKZG 5I3GA 4I7VA 2AAMA 2WC7A 4PC8A 3LGDA 1I4NA 1H63A 1TWWA 3CHEA 1ZZMA 3N4AA 3AYVA 3CQ0A 1S5WA 3N9RA 3Q67A 5D02A 1VC4A 2DY3A 4ZOCA 2GUUA 4IP5A 1A5CA 1WOBA 4G56A 3RDKA 5LXEA 1GJUA 3E2QA 3IVUA 2E6FA 1E3XA 3P60A 1P6WA 2EKGA 3WQDA 3SN1A 3SCSA 2BG5A 3TN6A 4BKNA 1RXOB 5GJNA 1MZRA 3PZGA 5CXPA 3H6OA 4P8XA 3LA4A 4RK8A 2VZUA 4BWLA 4E0CA 1V3LA 2HDJA 3N2OA 3WO8A 1NQKA 4B4HA 3UXIA 5EB8A 1VCVA 1LOSA 1ZUAX 2BHUA 1IZKA 4IIBA 4MMWA 4IGMA 1AUSL 5D9MA 1NIUA 3WLQA 3WF3A 7PTDA 3EX6A 2E09A 2RDXA 1JDAA 4O1AA 7ENLA 1FTXA 1YRRA 4XKYA 3JZEA 1DOSA 4DZAA 3UCCA 1ZAJA 4O4VA 3FLUA 4Z2KA 3LG3A 3KTCA 1DJGA 4IX0A 2YXXA 2VOTA 5FJIA 4NUWA 3BMXA 3TC3A 4MKVA 3DUGA 4K2SA 3FA3A 4Y7EA 2OSXA 1F6KA 2BZNA 3KRBA 1J4EA 3EWXA 4I7UA 1JZ4A 1RR2A 3I7SA 3GTHA 3LBCA 3ZSSA 2NQJA 4H8HA 1W2VA 5G4EA 1HO4A 3CNYA 1LBMA 5LXXA 2WJFA 3LTSA 2DP3A 1CB2A 1TZ9A 3MYPA 3M47A 4HU3A 1SZRA 3P8IA 2VX4A 4RJEA 1VEMA 4XAGA 3NR0A 3TZNA 1YNPA 1IQ8A 5G5IA 3AHZA 1MNZA 2FKPA 1W9PA 2BHYA 1ZS2A 2NSOA 3P74A 3ONBA 1ZHAA 3K8KA 2PDUA 2V9DA 1MYRA 1U5HA 4HNNA 3VFLA 4GO8A 4N6FA 3R7MA 4MWAE 3S4TA 3E3HA 1Y65A 1OCJA 1TMLA 1W1B1 2VC5A 3LS9A 4JR5A 1VJSA 2WXDM 2WZMA 4JQ1A 1Z89A 4RNJA 3SW6A 4H41A 3CGTA 1PKNA 3PAJA 1HGWA 1DBTA 1LOQA 3WSUA 2HV5A 4KQNA 5I79A 4JTTA 3W83A 1A4LA 2QDEA 1YDOA 1W5NA 5AC7A 1XDMA 1HG3A 1XG3A 5FF0A 1H61A 3SGZA 3S9YA 4OJYA 3THDA 2JEPA 5JVLA 2Z7KA 4TOQA 1J0ZA 4A29A 3W74A 2DZAA 3IARA 4FP1A 2D0FA 5FACA 2VX6A 1D7KA 7TAAA 3PY2A 3MJMA 3B05A 4PCTA 3NL2A 3GS6A 3ZLGA 3QSTA 2B81A 1IZJA 9XIMA 3LPOA 3BJTA 2R1PA 4ASTA 3I4EA 5FEZA 5DT5A 2CLOA 3HMCA 4Q8TA 2PLJA 1GQLA 2QZRA 3GFYA 2ZDSA 1JZ3A 2POZA 1JCTA 1MW3A 4MKNA 2QAFA 1ZPTA 2XYLA 2HE5A 4FX8A 1NY1A 4NU7A 3N3MA 3M6DA 2WSRA 2PRMA 1EEPA 1ICPA 3FK4A 4IIFA 4DWSB 2CLIA 2R91A 1QI3A 1UHVA 1X39A 1RZMA 2WMGA 3H55A 3B8TA 3EA1A 4MNLA 2HBVA 4PCNA 2CYGA 3VIGA 5CZKA 2W62A 3BAYA 1EJUC 3UZJA 2CZVA 5ABGA 1VFUA 3IGSA 2R1LA 2XH4A 1GEQA 3FV9A 1S3TC 3VM7A 5E0FA 1HJUA 1NVMA 3EMZA 3EX2A 4B3LA 2CPUA 3NYZA 3VYLA 1PIFA 1RP9A 1F76A 1U33A 1NQ6A 2VUYA 4WX2A 3TQVA 3SEPA 1UKPA 3RX3A 4W9TA 3WLIA 1C8XA 4IPIA 4Y9NA 5JUVA 1UJPA 5C9XA 2J4GA 3MP4A 4E5TA 2OEKA 2FTYA 3VOCA 4GQRA 2OPJA 2QEZA 1RLCL 1K9EA 1ZJIA 1JG9A 3FN9A 1EC9A 1OJXA 4BQ5A 3W73A 4UFLA 2FTWA 3UNDA 2D2GA 6REQA 1TV2A 2Y70A 3LSBA 3CMJA 5A94A 1K7EA 5DEZA 3OZPA 1IXQA 4AB4A 4GJJA 1J5SA 1MI3A 2DSKA 3V5OA 2Y85A 1A5NC 3WMLA 1YDVA 4GYPA 2O56A 4JS3A 2ZRZA 2ZIDA 2BGSA 1I1WA 3GY1A 2Q3OA 3CZ8A 1ADSA 4XO7A 4HA3A 2RHGA 3E0IA 2QJJA 4MFEA 2V3GA 1U1JA 1JAEA 3ZLHA 3QFEA 3LNPA 1VLIA 1GVRA 1UWAA 5AHIA 1ECQA 2R1NA 2HPIA 2OR2A 5EMUA 3VGHA 1VYPX 2Z6JA 2NWRA 1X1NA 1Z42A 3RO8A 2EPOA 1JCNA 1N8IA 3MSGA 4AWUA 4YLWA 4CU7A 2EPNA 4O0QA 1GQKA 4PMZA 3T2PA 4C6MA 1HP5A 3V1PA 1DVJA 1F4HA 1SO4A 4C65A 2UV8G 4Q8MA 5DF0A 1GKRA 3VNIA 2XINA 5J5RA 5CC7A 3PWAA 5EA9A 3WFLA 2QVHA 1S46A 1GGOA 3CUHA 1UH4A 2VVNA 3G18A 1R6WA 2REQB 5EMYA 4RXFA 1HVQA 3OEXA 1MUCA 2QF8A 2FFIA 3FXGA 3AROA 1PBGA 1SVDA 4CQBA 1DTNA 5JMUA 3S6OA 3E0WA 1ZALA 4HB7A 3B8IA 1TE1A 1E43A 1JVNA 2OSYA 3LGEA 5D04C 3AISA 5CSSA 3UYIA 2W67A 4HZ6A 2Y8KA 1SFLA 4UFIA 3LBOA 3QZ6A 3VIOA 3NPWA 2FVKA 3L4TA 1QK2A 4YTTA 4PZVA 4NJJA 2QV5A 4XZNX 4ZTXA 3U57A 4PMJA 3KXQA 4FNPA 4QLLA 3GXFA 3E5PA 3N11A 4O8AA 4M19A 3THAA 1Q7QA 5BRBA 2CC0A 1JPDX 3CK5A 5U7SA 1IR2A 3PNZA 1M9HA 4J3UA 4AU0A 4GG9A 3WF0A 1KXQA 1UR9A 3LDVA 4XB3A 1RLDA 4PBGA 3XINA 4LTSA 3SRKA 4IL2A 3TAOA 1VCGA 1XINA 3KM8A 3RJXA 2V63A 1BWVA 4C6JA 2P53A 3RUBL 1SR0A 2OFJA 5C70A 3A4WA 5A6KA 2PC4A 1R9ZA 1U5VA 1XL9A 4ZEPA 3IS4A 3SADA 5IHRA 1REQA 3I3BA 2EAWA 4HBKA 5FSEC 3VKBA 5H6HA 1AW5A 4GPNA 3ZO9A 4UNIA 1GHRA 4LVAA 3BG5A 3KOZA 4PRRA 4RNFA 3VZXA 4BQ2A 3THQA 1SZNA 3WDRA 1FWAC 1XKJA 4MAZA 2QW5A 3BV4A 3TX9A 1A80A 3EWCA 4K68A 4N4PA 5EL1A 3L7RA 5HQEA 3MYOA 3VOHA 1TTQA 7REQB 3PPGA 3NZRA 2PP3A 1LRNA 5PTDA 4IPLA 1E4IA 1UPPA 4IGSA 3PBUA 2B7OA 2OZ0A 4GLEA 4C6FA 5K3VA 1I2OA 1X6NA 3IJDA 1I2QA 3PM6A 2O4MA 4NZ1A 3WEZA 3BO9A 4W88A 3VI2A 4DAIA 1HJXA 2BLEA 4H04A 1XLJA 3MS8A 4KWWA 2BGNE 3IIVA 1ZENA 4LY8A 4KESA 3GTNA 4CD8A 2QCNA 3KBWA 3TYZA 3WD1A 1OFAA 3OO2A 3B0VC 3A12A 3S6TA 2GDUA 3M0IA 4A35A 1QW8A 1LUCA 1UOKA 3EX1A 4O12A 1X38A 1ZNNA 3K13A 3UJEA 1VBHA 2DZXA 3UD6A 1S2WA 1P1MA 1JEZA 1SQ7A 3C2EA 5HR7A 4Z1DA 3RXZA 3RCMA 3C6CA 3TXVA 3E5BA 4TUFA 3VOFA 4QDWA 2YXOA 3WK1A 3QTPA 5JQ9A 1DE5A 4LS1A 2FH8A 3BWWA 4LW7A 2GK1A 4F2BA 3PBWA 5KZMA 5ECVA 4HIBA 1QPKA 3QRHA 1RD6A 2XN0A 2QULA 4IL0A 4RX0A 2A6NA 4CN4A 3U5YA 3PBGA 1LL6A 4XKMA 4YL2A 1TPUA 2XGIA 3ID7A 1O7AA 3OBKA 1P7TA 1ZCOA 3FCPA 4LANA 3FXYA 1XBXA 2VRJA 1M03A 1E0VA 1HKIA 1ZP4A 1W17A 5GQBA 3DFYA 4PCSA 3LMYA 4IGNA 2ZRXA 1F73A 1YHTA 1O94A 1W8SA 4GUGA 4XVDA 4GNJA 4A3RA 3W7EA 1PZ2A 1QJWA 4TTGA 2WHJA 1E5NA 1S39A 3TH6A 5DXXA 4ENLA 4YWSA 2ZRYA 3WIJA 1G69A 1YEYA 1WDWA 1W2PA 3BH4A 3USBA 1KW1A 4ZB5A 4MZ8A 3UF9A 5EKYA 3STCA 3OLEA 3UCDA 1KQZA 3C0SA 1GVIA 3W02A 4XSMA 3QV7A 1E1CA 3FSUA 3MO7A 1Q2SA 3RU8X 4UQEA 1KKRA 1Q6GA 1Q6QA 2J24A 5AHFA 1LQ2A 5CC6A 1ZQ5A 1WKEA 4DPPA 3S3GA 2FPVA 1ZB5A 2C18A 1W1PA 4J35A 3L4WA 3WJXA 4QAWA 3ITOA 1VRDA 1PVNA 1XIEA 1SU5A 5HNTA 1QW9A 1W31A 1CLVA 1NARA 3RFAA 2QCCA 4GUIA 2HVMA 3U6WA 1XYAA 4JNYA 1LJYA 4OHQA 2BY0A 4PYSA 4NX5A 5IDZA 2WNQA 1PSCA 5D8WA 3L2MA 2QR6A 3LHUA 1PX3A 3VNJA 1NAL1 3SR7A 2J7DA 3F4DA 4BCEA 1XLMA 3GDMA 2FHBA 1GOOA 4HCLA 3BLPX 5XINA 4G7FA 1RCXB 1O5QA 1EWDA 3AYTA 7XIMA 1LG2A 2P8CA 3MP3A 1U1UA 1XQKA 1MXGA 3BAKA 4F0HA 1A5OC 1GVEA 2V2CA 5HMSA 2IUZA 4JYFA 1PX8A 1UQZA 3MKCA 3TW7A 5ENLA 1ENUA 2F2KA 4F0MA 3B4YA 5AC6A 3PTQA 4FB7A 3A5VA 3GD6A 1GWJA 1OT1A 4NP7A 3ZWTA 3QXBA 3EWBX 1QMLA 5DXYA 1KWGA 3WNPA 3DDMA 4N9BA 1W8GA 3W07A 3CB8A 3F2CA 4IUGA 3QY6A 4UTIA 3ABSA 1DV7A 4XX6A 2OYMA 2QUNA 4F0LA 1FDZA 4I9TA 1AJ2A 2CLPA 4N9CA 1LP6A 2QGYA 5LYRA 1A3HA 2WMKA 1XIJA 5FEXA 3M0KA 2DZTA 2JFEX 3S1WA 3IJ6A 4CNUA 1BVZA 1UD2A 4RUBA 2E3ZA 4JTIA 4R85A 1V3HA 3OQEA 4RZ4A 1CNVA 3RHGA 1R9XA 4ZE4A 5C0QA 1TZZA 3O63A 2PPGA 2QUVA 1VBJA 3MZNA 3QGVA 4I90A 2VD8A 3NNTA 1OFDA 1WXJA 4HOZA 3BPWA 2VWSA 3R43A 2GVYA 3B0XA 4L61A 3N2BA 2B7QA 1VEOA 3NQEA 3S1GA 2Y63A 3AXIA 3UEQA 3QEZA 3EWDA 5B7ZA 4ZQOA 4WY0F 3BUVA 3M6YA 3DC0A 1JD7A 2WSYA 3ANUA 3O05A 4PMXA 1XIGA 5ECUA 2FPYA 1PYMA 2BOFX 3XIMA 4JBRA 3BW3A 4XZIA 4BS0A 3FA4A 2J77A 3V0UA 2Z1SA 3PJTA 1H7XA 4MIMA 3LCHA 1RBAA 4LNCA 1KLYA 3GG0A 2POTA 1DXFA 3H26A 3KWSA 3MUAA 1M53A 1ZLPA 4UQCA 1EJVC 3W27A 3DH7A 4LH8A 2XISA 4KCUA 2OLAA 3CL8A 1GOMA 4PTDA 4MJZA 2OYKA 3B0UX 3MV01 3FDGA 3UZWA 1NJJA 4E38A 1TREA 4CUCA 2V69A 3UFYA 2UY4A 3NQ6A 3CV7A 3T4CA 1XGEA 4F4RA 1JGIA 4MB4A 3BV7A 2OU4A 3EKGA 4B9YA 3OGVA 3W1RA 4M7SA 4E8CA 3PJWA 4HYRA 2X1UA 4LUTA 3GR8A 2FZMA 3C2OA 4FAMA 1W5PA 2OYLA 1SJCA 3PPCA 4LAZA 3UWYA 1ITXA 3WJWA 3ZJ8A 5D32A 1XYFA 1JQVA 4NJIA 3S83A 3A9IA 1TPH1 5DFAA 4JICA 4C5YA 3RM4A 2V2HA 1EJRC 2WZIA 3NQCA 5LHEA 3HA1A 4TU1A 1WKYA 2IQTA 3PK7A 4AYGA 2A1YA 3H2FA 3VIJA 3DBPA 5M03A 3T44A 4PTNA 5IBXC 1Q6RA 1TG7A 3M41A 3VNKA 1WB0A 2RDTA 1OC6A 4IMAA 4C6LA 2WSKA 2DUAA 1W3HA 2BDQA 4D72A 2Z26A 3H7VA 1E6QM 4DZ5A 1W5QA 4LC6A 3G1DA 3AIQA 2PDKA 5DMYA 1DJYA 1G4TA 4W84A 1JR1A 2OSWA 3S5OA 3AXHA 4QXIA 4X0VA 1E6PA 4AY8A 4GH1A 5BCAA 1RJQA 1ONWA 3CPGA 5HWJA 3WNLA 2A3AA 1QASA 1YPFA 2QDHA 4O4WA 2X40A 4MWAD 2VX7A 4HZMA 4JTCA 5E70A 2QXWA 2EO7A 3OHMB 4D6EA 1Q6FA 3O0FA 3IIXA 4PTWA 2Z1WA 4REQA 2E6AA 2OT0A 3M0MA 4QIUA 2PTWA 4WSHA 4ZSTA 1EQCA 1QNSA 3U2EA 2E1WA 3G6LA 2Z28A 3G1AA 3G24A 1BKHA 6PTDA 1QO5A 3NTYA 5C9UA 3N3TA 2ZKMX 2OT1A 2VJXA 3M16A 4PR4A 1CXEA 4ZTYA 4HHMA 1F2JA 2WW5A 2E7FA 1Q5MA 1H3GA 3G1HA 1W9XA 1JDFA 1XCWA 4BI5A 5A69A 4WQ6A 5F1VA 2VC6A 2XN2A 3SCOA 4S3AA 4HKPA 1NWSA 1EA0A 5TNVA 2OCZA 4J27A 4PMVA 2R6OA 1KNWA 2VDHA 1QXLA 4H7CA 1DE6A 1WDPA 4PCPA 3LRLA 4GZ7A 3GTIA 2AMGA 1Q45A 1VS1A 3EMCA 1OC7A 2FYMA 4QG9A 2EPHA 1J0KA 2FZBA 3LRMA 2AL2B 3RRXA 3UG5A 4XISA 3CUGA 5A6MA 3NM3A 5A8QA 3IJLA 4V27A 1FH8A 2YX0A 3CZKA 4HNUA 5KINA 3U2ZA 3SIMA 2H8ZA 1JPIA 3H2OA 3CQHA 4LCSA 1HW6A 3DFOA 3WLKX 2EGZA 1AJ0A 1HJSA 3THCA 4XAFA 2VDIA 1SYTA 1OADA 5ABEA 1W3IA 3LGGA 3QV9A 3WFAA 3V1HA 5JIWA 3W3OA 1EO7A 1MW0A 1J96A 4DJEC 4Q8NA 5I24A 4ROPA 1WKFA 3QV6A 3COTA 3QHOA 4Y90A 4KETA 1GTHA 4LEFA 5FL0A 3BE7A 5GNXA 1DJNA 1ZY9A 3UPBA 4PA8A 3OW1A 1EYWA 3G1FA 3W7DA 1RVKA 4RNHA 3B06A 4MAVA 4MLRA 4FPSA 4UMBA 3N2MA 3EDEA 4UZUA 4UTUA 1FWHC 3VNZA 4S1FA 2DZBA 1WUEA 1TJ2A 2NXHA 1FWSA 2E4TA 1XXXA 1QU4A 5D2YA 4YTSA 4JZ5A 1OX4B 1P48A 3SGGA 3SQMA 5HNRA 4WGHA 3PTDA 4NNCA 3BJSA 4PN2A 5CCZA 4NZCA 5FF7A 1M01A 1I45A 1V6XA 3TR2A 3TV8A 4ZODA 3GH5A 1TIWA 1JRCA 5AECA 3W24A 5DMNA 1VJIA 3HTWA 3UY7A 2X1IA 5HJYA 3WBYA 1X8CA 3TYCA 4U3AA 3EZ4A 4H8VA 1IEIA 2GJXA 1YTKA 1UR4A 4YCOA 3A5FA 2OO0A 2YFNA 4DELA 3KBMA 3VO0A 4LY4A 2QIWA 3B97A 3WLJA 1MW1A 4WKHA 3WD0A 1KD0A 4L4PA 4MOZA 1CGTA 3P7YA 1U2YA 5TAOA 3G1SA 4Q8WA 2WVVB 4ERAA 1I8JA 2XPKA 3GE7A 3NSMA 4Q7NA 3C56A 3NEHA 4UTTA 4D8AA 4IMEA 2GVLA 1Q6OA 4NF7A 3CTLA 2NVCA 4NJKA 4D1IA 3B8VA 2V30A 1TVLA 2ZUMA 4RZ6A 2JIEA 3MCNA 2B7NA 3SUUA 1D3GA 2JK2A 1HNYA 1ZU8A 4GY7A 3R12A 3S8HA 1ME9A 2WCGA 5A6JA 5EFFA 4IPNB 3GC2A 3WY1A 3LCFA 2PDHA 2WC3A 2DSZA 4C6EA 3ARSA 1EJSC 3MDUA 2OTDA 1XIDA 3VD5A 1WXYA 2H3BA 4O52A 3TJXA 3S42A 3PC0A 4HT3A 3CH9A 3S0CA 3RN6A 2WMHA 5H8UA 4O0ZA 3VINA 2YCJA 2JEQA 3ARUA 3BQ5A 4UTWC 3QOKA 3V5FA 4NYYA 4UTKA 4F2TA 2D69A 4AF0B 1D8WA 1UWIA 4QDPA 1CGUA 3TQPA 3W28A 3BL3A 3V75A 4Q8UA 2WHKA 3FAXA 4F79A 1J18A 1HKKA 2CHOA 3WK2A 3TCEA 1FCQA 1TPC1 4KKXA 4GUHA 2PP1A 1SZFA 4E2OA 3WDIA 1CB7B 2OX1A 3G1YA 3TLLA 1QAPA 4ZXLA 1PTGA 4GBUA 1V0MA 4NQ1A 2BHZA 2B7PA 2W27A 1KM6A 1V93A 4EE9A 4CEUC 3CT7A 3URNA 3VC6A 1ISXA 2GVEA 3O6YX 3VDHA 1RV8A 3W7LA 4O0KA 3VTRA 2IMRA 4KEVA 3GXIA 3H22A 4HK5A 1P0NA 3B9DA 4AAJA 3OLDA 1SFTA 4D6JA 2BVDA 4WR3A 3FX4A 1V6YA 4JFWA 3CAKA 3I68A 1XRSA 1Y5VA 2ZX5A 3CQKA 1MW2A 4D6IA 3WQGA 1A3XA 5XIAA 4JX6A 3TONA 1FFQA 3AIBA 2O4QA 3DERA 1QWGA 3LRKA 4HPXA 4HN8A 1H0IA 1IGWA 1PO9A 4LAUA 3VGDA 1XIMA 4M29A 3GVQA 3MMTA 5CBIA 1T99A 1O5XA 4ACYA 4CNTA 2DIKA 3VKCA 3RPDA 5C9RA 1EQPA 1DTUA 4GISA 3W87A 4QAIA 1Z3NA 5HMDA 1QPRA 4HU0A 2VGGA 2QQ6A 5K4XA 3L4VA 3BAIA 3G2GA 3ARTA 1LRTA 3BARA 2NLIA 1EPXA 1K77A 3GFZA 3CPRA 4DBEA 1RQHA 4MJ2A 3NUKA 4Y9AA 4LYRA 3G22A 2YL8A 3W85A 2E5CA 1N7KA 1XQLA 3DYMA 2IS7A 3IUDA 3AMGA 1E9ZB 5KZ6A 5HPCA 2O7QA 3IV8A 1QHZA 3QPEA 4IXHA 4AD3A 1KC7A 1PJ9A 3JUGA 4NL1A 2WK2A 3VUSA 1EJWC 3VDBA 4DX3A 3SRHA 2YW3A 2ATSA 3T0DA 3VDCA 4ACZB 3G8RA 1ZAIA 3I3EA 5EBAA 4EP8C 3PTMA 1W6TA 5BMWA 3KAOA 2FDMA 3WLTA 5HWNA 2X8RA 4GXWA 1XLKA 1VFLA 1KRMA 1X1OA 2A2IA 4D8ZA 4KCTA 2W3ZA 3ATZA 4C6OA 1WKDA 4LCQA 3CTTA 2ZXAA 3KTSA 1XLLA 2V6AA 2VENA 2HMCA 4RZBA 2REQA 5HNNA 4LX4A 2BV9A 1PZ0A 3TYDA 2HS8A 2HROA 3AJXA 4MWAB 7TIMA 1O5KA 3LCGA 4WXYA 3R1ZA 1LQ0A 4PRTA 3U48A 4RNIA 2PF8A 3MMUA 3STPA 3C4UA 4C5ZA 1XIIA 2VR5A 2IXUA 1BHGA 2ZX7A 3NQDA 4H9TA 4W8AA 2XVGA 2A3BA 1AZ2A 2YZRA 1VR6A 2CWNA 4FOJA 3W01A 3NQAA 3LZ3A 2VDGA 3WBEA 4AHOA 1G9HA 1BYAA 2X05A 3CAWA 1K4GA 1JNEA 1JCMP 3CV1A 3UPWA 4AIEA 3VKJA 1YTEA 5E0KA 4C6DA 4JKLA 3PFRA 3C8FA 3PS7A 4UQ9A 2YBUA 3BCDA 1EBHA 1TIMA 3RGTA 2XWEA 3XISA 2YYTA 3S1XA 4EX4A 4XKYB 2VGFA 5HOSA 4ZQRA 5AN7A 4D1JA 3EKLA 1Z48A 4GO9A 4Q4QA 1UKOA 4K3ZA 5BXRA 3PZVA 3OG2A 4C1KA 1UR2A 1IEQA 4ZVJA 2BVWA 4D6DA 1XLIA 4GKTA 3TA9A 1XG4A 4UOZA 1V77A 2B31A 5B7YA 2PDCA 2DFAA 2CLMA 1IR1A 5K7JA 1Z9AA 3VZZA 2ZX9A 4DJDC 2BY3A 4ATDA 1VENA 2RAGA 5I6SA 2YBTA 3AYRA 4CQ9A 1JCYA 1D2KA 4QCEA 1DWIM 4ICNA 4B9ZA 3II1A 2O7SA 4RL3A 1HL9A 1GONA 2BMBA 4UNLA 4A21A 1EXBA 5E09A 2ZX8A 2INFA 4JFTA 1JFXA 2DDXA 2ZE3A 3AWOA 3OZMA 5FAJA 3VIMA 4GQQA 4PULA 1VAHA 3T05A 1BYDA 1CLKA 4GRSA 3W1PA 1KXHA 3HPAA 3P5YA 3QGKC 5A2CA 2XH2A 2VI0A 2XM2A 2ZZ3A 1BG9A 1R85A 1XWYA 3L4ZA 4LT9A 1GT8A 9XIAA 2O9OA 2NSXA 4AZHA 2AOSA 3ITYA 4QEHA 2WKLA 4M3PA 1A3WA 1T40A 1U22A 3S1VA 4XAZA 5GPRA 4ZQCA 1NEYA 3F5JA 3WH8A 5FF2A 4I9MA 4WZHA 4H9VA 2X7VA 1BTMA 5BOOA 4MPKA 5I0DA 5LIXX 5HJLA 1FWJC 3KOFA 3PBYA 1EZ2A 3CZJA 3TYUA 3PSVA 5HUPA 2QLYA 3R0UA 1JI1A 3FGCA 1VFOA 5J5DA 3MU7A 3UXDA 4UTHA 2QUTA 3KLKA 2UY2A 5AHMA 3MA8A 3Q4DA 3VMPA 1ZP3A 4R34A 4ZFCA 3IWPA 2MANA 2PDPA 4M80A 3BANA 4IHCA 3RF9A 1CCWB 1KCXA 3LY0A 4WJEA 4YHGA 2QCHA 4UTJA 5LIUX 1HJWA 1TR9A 3AC0A 3ABOA 4INFA 2W63A 4TX9A 3SRDA 2Y88A 4OTKA 3CUIA 4URIA 4UTLA 1VP5A 1RQBA 3ANVA 2RUSA 1CGYA 2X0YA 1DWAM 2VVSA 3N12A 5H8MA 4I6KA 1AQMA 4IF2A 3QPYA 1CX9A 2Y24A 1Z41A 3U9IA 3HB9A 5HK4A 4BQ4A 1WXZA 1RCQA 2J8FA 1EP3A 1K8YA 1AH0A 1W54A 2AKZA 2PWUA 4R7WA 4DJFA 5FEPA 3JU2A 1IWBA 3PUGA 3ZYZA 5HPOA 1WZMA 3IRDA 1KB3A 1EO5A 1GOQA 1M65A 5HMFA 1AQ0A 1Z8AA 1GYLA 2VCBA 4Y2WA 2ZZ2A 1UCWA 4JIRA 1CBGA 3GQYA 1BXNA 3ZR5A 3TWAA 4U2ZA 2V3DA 2D0HA 4GQGA 2Y7FA 2FGBA 6REQB 4ZA0A 2BSLA 4S2CA 4NNAA 1DYSA 3QFWA 4FEZA 4K1WA 3ZM8A 3W26A 3HGSA 3LV6A 1R3WA 3NSNA 3BZGA 4JIIX 1QPQA 3O7UA 4KCWA 4QNEA 2CZEA 4ICMA 2CWXA 4LBSA 4BF5A 2X0SA 1TQJA 4GKLA 2VCCA 4NZ3A 3Q65A 4AVNA 3ZQ9A 4NI3A 4X60A 4AG0A 4IQLA 3QF0A 3EX4A 1BYBA 2E40A 4DIAA 2R94A 4U33A 4WDXA 4MUPA 3TAKA 5LNSA 4F2UA 1WUFA 3C3UA 4FALA 2XSXA 3WUBA 2J8TA 4ATWA 4EK7A 1UD4A 1MSSA 2BXZA 2HZGA 2YA2A 3EPNA 3S9ZA 1OG6A 1B9BA 3SI9A 2BY2A 4KBXA 3UYCA 5KSWA 3PBMA 3U5UA 1HKWA 3LHWA 2BP1A 1V6UA 1DIDA 3G3DA 3PZUA 3R5EA 5I77A 4QFUA 4D71A 5D38A 1TWDA 4B15A 4DAFA 4GVHA 4F3HA 1EB3A 2F61A 1SGJA 1ZRQA 4N0RA 1H1NA 1BF6A 1M41A 2PCQA 2GDQA 2OQLA 3W1XA 2A4AA 1W9BM 4W89A 4NAEA 1BQGA 1TPB1 2PDNA 3VIIA 2WAGA 3EB4A 4X61A 4M5PA 2P50A 5J04A 1E70M 1HGYA 1M7PA 2QPXA 3INPA 3K8MA 3MY9A 2VRQA 1OFRA 1DWHM 1E6ZA 3DCPA 5REQA 3QC3A 3UU0A 2Y2WA 5EU9A 1Q7MA 5LNWA 4E8GA 4CCEA 1MEWA 1N8FA 4PSRA 2OQYA 3O0KA 1JUEA 4CQAA 3WQEA 3KZSA 1XBVA 4RDZA 1BFNA 5DBTA 1GOWA 1S5VA 4PUJA 3N15A 4Z42C 4WOZA 1M68A 3C0JA 1X96A 1IEXA 3LERA 3LQGA 5I3JA 3C3NA 3TOYA 3VA8A 3WUGA 2GJLA 4GD0A 1DIEA 3SJ3A 4A3UA 2ZVRA 2Q71A 3NVDA 3QHNA 3NQFA 4K7VA 1OSEA 1PYFA 3IJ8A 4GBDA 2QCGA 3E96A 3GLCA 3K46A 2ZZ7A 3ANYA 4Q33A 3QYQA 1FHVA 3CXOA 1EIXA 5LIKX 4HOWA 1B54A 1TV7A 3VNYA 4FLOA 4L80A 2FFCA 2OGJA 4M6PA 4D6HA 5GJMA 5D8ZA 2G3MA 1V0KA 1FWRA 4MJMA 4IH3A 1UBSA 4JNZA 3N2CA 3GZ3A 1J6PA 4JTGA 2E77A 3W70A 1YE4A 4DYJA 4E4PA 4TX6A 2IW0A 2HK0A 3W6LA 3AIUA 2ANUA 3N19B 1A47A 5DRIA 4B2DA 3H2MA 3SM0A 4LAMA 4Z08A 6A3HA 2FIQA 4OBRA 4H9ZA 4K8GA 1OYAA 3PPFA 4DXKA 3POCA 1XYMA 4MPQA 2E1DA 4EAYA 2RJGA 4PB5A 5CSYA 1V3MA 3GH4A 2V5JA 3CUZA 3VAVA 4JIQA 2AKMA 1ONEA 1T7LA 2QCLA 5AC4A 1T96A 1TCDA 3MI2A 2Y7EA 3V36A 2Y6ZA 2CLEA 4CLMA 4HZ8A 2OXNA 1EGZA 3KP0A 3KS6A 2OOGA 3NL6A 3PUOA 4GH3A 4HHLA 4L1XA 4NSBA 1R3SA 4O8RA 3ELFA 4YYCA 2FJKA 4GZEA 1SZGA 1R47A 4A8LA 4EWJA 3NO5A 1UPMB 1QUMA 1VFTA 3QTGA 1JL8A 1E0UA 1BEUA 5DLCA 4IFOA 5AHEA 3BSMA 1B30A 1WBHA 4IJCA 4AD1A 4QSHA 1C93A 1V4YA 1IWPA 3V16A 4CCDA 4PMNA 4NAFA 2E6DA 4WXZA 1YBQA 3ABZA 5F4WA 5CPSA 2GK1B 3CIXA 3VD4A 3GNDA 1ODUA 2JGQA 1PKMA 2VFDA 5A2BA 3T42A 2PWDA 4MY8A 4GC4A 1EL3A 3Q37A 4WDWA 3TA6A 1P7TB 1Q2RA 4Z2IA 3RPMA 4US5A 4NJHA 3VGFA 2A6LA 2WV8A 3MHGA 1A53A 4G7EB 5CPTA 4DUOA 3CEPA 3ABQA 5FJTA 2XVLA 5BROA 2V82A 5CBBA 1XCXA 4TV5A 1UUMA 1PXGA 1AH3A 4KCVA 2P0OA 4H6RA 2ISDA 4A8RA 3BLFA 1Q13A 1OY0A 2VQUA 3N2XA 1XH0A 4LYPA 3SBFA 3CU2A 3ITCA 2QVNA 3VIPA 2DGAA 5F2GA 3AMCA 2QPUA 5BW6A 4WKFA 5KTLA 1AH4A 4JIHA 3PB2A 3O16A 1OGBA 2YR1A 1E1CB 2VEFA 3BTNA 1Q8JA 1I2PA 1RH9A 2QKFA 3DEQA 3W2UA 3OGRA 2ZUSA 3AZRA 1IT7A 3TKFA 4TX8A 2IPFA 1F3TA 4JTDA 4EXAA 4FSAA 4X22A 3JRKA 1ZJBA 3UG4A 1ML1A 5K4ZA 1UKSA 4PH6A 4L9XA 1UWUA 2V8ZA 3H8AA 3CM4A 4GY1A 1FA2A 1Q65A 2G3IA 4M1RA 1JXKA 2GSEA 5AB3A 1K4HA 3VILA 4UFJA 2ZE0A 2Y7DA 2HWGA 3W7HA 2OG9A 1B90A 1F6YA 3RG6A 1EEXA 1FBAA 4A2SA 3DN5A 2ABBA 3QMSA 3UZXA 3A4XA 1XDLA 2P5NA 3LCIA 5DT7A 5LKYA 4H1ZA 5MHBA 1UKTA 2PDIA 2VEMA 5BMXA 2QCFA 3KWXA 2WJZA 2JBMA 3OA3A 3OLGA 4LFYA 4XIMA 1HZYA 1G7UA 3RITA 1OT2A 1JYWA 2B0MA 3NPVA 1NTHA 3AIRA 1MEHA 3W7MA 3G77A 4PUNA 2CKRA 1B4EA 3B0PA 3GX9A 5A1AA 4CQCA 3OPSA 4Q6JA 4RPQA 2GOKA 1US2A 4QS6A 2PRLA 1RVGA 3EXTA 4MLJA 3DKJA 3P2VA 2F38A 1WZLA 3AHTA 1OX4A 4S3FA 1J8VA 1MFVA 2EJAA 3L21A 4N9EA 1HX0A 1EUAA 2W4XA 3WQ5A 3QZEA 3TJLA 3EDKA 2J6XA 2HQAA 1P5BA 3KFTA 1WO2A 1V3JA 3V3WA 1CECA 1EJ7L 1Q6EA 3M0JA 4GK8A 2B4GA 4C90A 4AD0A 3NQBA 2WOQA 3UA4A 1UR8A 3LPPA 1ZBWA 3DC8A 3S1UA 3MWCA 2Z6IA 3ZT7A 1X1ZA 2YCLA 1XP3A 3F4NA 1JFHA 1XIFA 3HG5A 2RGMA 3AICA 4ZOAA 4UUIA 4XZBA 3TOPA 4HMDA 3A9BA 2DIEA 3C52A 8A3HA 1V02A 2WVVA 1VFMA 3NPXA 4K7YA 4J28A 2ODOA 2D22A 3M7WA 4L5ZA 3HV8A 3FKRA 4JYEA 3NXLA 4IFKA 2V38A 3W29A 3E02A 3IJQA 3WH6A 3V5CA 2GYIA 1GVSA 1VB9A 4Q6XA 4HPGA 4AZ5A 5E93A 4L6HA 3SAZA 4OOZA 3IIPA 1KKOA 4DF0A 5C2CA 3WENA 1VEPA 1Q7ZA 2LLEA 4US6A 1G6CA 4C6PA 3SSZA 3SUTA 3RCYA 2Z1XA 1K9TA 1W9VA 1YE6A 5BU6A 1QATA 3S2LA 2DW6A 2WVTA 4CQDA 5C9WA 2Z24A 4O13A 2XIJA 1VBRA 4HQVA 2E9MA 4XBSA 3ME3A 1DL3A 4O50A 2ATMA 3PZTA 2V81A 2DVXA 4QX4A 1OD0A 7CGTA 3KEHA 1IEVA 3TCSA 3PWGA 2Z00A 1TX2A 1GZ1A 1RK5A 3MWAA 2DQXA 3L68A 2O9PA 1WDRA 3O9NA 4P8UA 2WMFA 2A21A 2WMJA 4BI6A 5G4WA 5CBJA 4DUWA 3EXSA 3HIJA 3IJ7A 4PTMA 1BTCA 1OM0A 2NXIA 3M5ZA 2WYSA 1YIXA 3W22A 5L9FA 4O17A 2KAUC 5DY2A 2BOEX 3AMDA 1R30A 2VEGA 1UB3A 4CD5A 1W1A1 1TRIA 3T1GA 2WCAA 2UY3A 2WLYA 1KGXA 3VCNA 4LUTB 4WHBA 3RJYA 3CYJA 1KFCA 2C7FA 3NFUA 3HJEA 4OBSA 3GW3A 3OYZA 3W76A 2D20A 3RPTA 1AK5A 4M56A 5KETA 2RDWA 3T09A 4XD3A 2CZDA 1KR1A 4DZHA 3H12A 1YADA 4F48A 1K6AA 5BU9A 4ZQNA 1POJA 3KL5A 4NRSA 3BW4A 2GQAA 1UR1A 3W53A 3AS3A 3ZLFA 3GNXA 1JDCA 1G94A 4UNKA 4AD4A 2C8NA 1M5WA 4Q4PA 3DYOA 4WF7A 3W37A 4K8EA 4MY1A 3HPZA 3RX2A 2PWFA 2WHMA 3ARVA 3LBMA 4AC7C 3E0LA 4AY7A 3VX0A 5I3DA 1G4EA 5CZJA 1O60A 4HYWA 1QNVA 4EVZA 4C6BA 4CN6A 4Q8PA 1HIZA 3OTRA 5K9XA 1E40A 1FP9A 4GOAA 2DIJA 2PSNA 2BGQA 3KBVA 2NW0A 4AZIA 3SECA 3GXPA 4JEJA 1XISA 1FWDC 1DJIA 2G50A 3DU0A 4LSBA 1LLOA 3U8GA 3K30A 3LCLA 6XIMA 3GW0A 5FF3A 1NOUA 3O07A 1S2VA 1WYIA 3GDKA 5T9BG 3WUFA 1OCBA 1X6LA 4REQB 3TU9A 4EIVA 4I3GA 3WLRA 2JIWA 2RFGA 4RE0A 2WWDA 4I7WA 3GB6A 1V3KA 3VKDA 2Y8VA 1KBJA 2E8YA 1G01A 1KFKA 3AXXA 3RNDA 3H53A 1E5JA 1K8XA 1P0EA 4MVAA 4A2RA 3QM3A 2J47A 3PWIA 3H2CA 1KQYA 1Z44A 2DU2A 4JOMA 4X9YA 1A0DA 1ELSA 3OU8A 3WDQA 4NILA 2OODA 5IDIA 4AD5A 1OIFA 5C71A 2G3JA 4DRSA 5RUBA 3LXCA 3L66A 1Q4WA 2G96A 1PDYA 3VCRA 1EPVA 3KZPA 2A3CA 2XU2A 4DNMA 3WQPA 2J66A 2EBNA 1XH2A 2WPBA 3TYBA 1M04A 1UWRA 4BFAA 2I1OA 3P81A 4GVIA 1F4AA 5E0CA 3EB3A 2XM1A 4FOUA 4HSHA 5AZ1A 3F5KA 3L12A 3K2GA 4GWEA 3H70A 4DXVA 4GZJA 4B3ZA 3IVTA 3UWEA 3P82A 4IM4A 4HGXA 2PDXA 2AMXA 1IIGA 5C54A 1UD6A 4GUFA 2ZBTA 5G1MA 3W88A 3DGBA 3I3DA 3W1LA 3QSRA 4HJFA 1H4PA 2VWTA 3BICA 1AJZA 4IWWA 3PAOA 3ONCA 1KTCA 1W9DM 2XIBA 4HPHA 2MUCA 1MDRA 1BRLA 4Q8QA 3WF4A 3NO1A 4DYEA 1H62A 4R7OA 1ISYA 3R8GA 4CCCA 1KM0A 2QV4A 3PPHA 1VD6A 3DESA 3CO8A 4J2PA 5H8PA 2IKHA 5I2UA 4XBKA 3LM3A 1TYGA 3W86A 3U4FA 3MCMA 4QGCA 1KFEA 1VCFA 1VYSX 4ORMA 3EYPA 3UP8A 8CGTA 3U2CA 2HEJA 3N4FA 3QQ0A 3Q94A 1SUXA 3W4RA 3LI0A 1W91A 1JD9A 3N25A 2I9EA 4MNMA 1JYNA 4Q8OA 1EF3A 3H7RA 4W85A 4XTDA 3R94A 1GVFA 1KV5A 4FLSA 2QYGA 5CPQA 4EPEC 2NUWA 2VZSA 4E6MA 1NSJA 1KGWA 2HK1A 3NZPA 1BLIA 3L9CA 4L4LA 1Q6DA 3H2EA 3RAOA 3TDFA 4GI8A 4WKAA 3SZ8A 4C91A 2GJXB 1VZWA 3N14A 3NDZA 5A6BA 5GVJA 4Z2LA 1UH3A 4QSFA 5T8GA 2HXUA 3HMJG 1DORA 3WEMA 1PZ1A 1PE1A 4IJBA 3KHJA 1Z6KA 1HL2A 3QR3A 5M2FX 3CZGA 3ORWA 1KTBA 1AL8A 4UZSA 2J25A 4I8YA 1B3OA 3GM8A 2L5HA 3VKAA 1HP4A 2PD9A 1V79A 3BCJA 1QOPA 3P8JA 3A6OA 3I10A 3OZYA 5GNZA 3G8EA 4JTEA 4CQ8A 2EPLX 3W1TA 4X63A 2OKOA 3TW6A 2PDBA 3CQIA 1P0BA 5HNUA 3TJIA 1UZ1A 2CCRA 1CI1A 1XIHA 1TA3A 2CERA 3WYZA 3W6MA 1FY6A 1TPEA 2DZPA 3R8RA 1V6WA 1VPXA 3VMNA 4WVXA 1JPKA 5I5RA 3MUY1 1GVOA 4OV4A 3PZQA 4MB1A 5T91A 5TIMA 4A05A 2J7CA 3MVTA 3VDGA 1RJPA 2VL4A 4TQTA 1JZ7A 1GW9A 3QMRA 2QT3A 2XHYA 3GIYA 4Z1YA 4DLFA 2F2HA 4DJFD 4EF9A 1BGAA 2DZUA 1YDNA 3ZSTA 2CITA 2YFOA 1S5MA 2MNRA 3U7VA 3N04A 5CLTA 1XSKA 4D6CA 4HA4A 2OOFA 5A8OA 5DELA 3QYSA 5FF4A 1JZ5A 4JFUA 1EGMA 4NJGA 3JS3A 4I5XA 1Y5WA 3UWWA 2VFFA 1SPQA 5IBXA 1X7FA 4BA0A 5D33A 3M5YA 5LSMA 3KVMA 4FXFA 3WQOA 1FXQA 3T7VA 4PMUA 1FQ0A 3RYSA 4JTSA 3W2MA 4UIOA 8RUCA 5BRPA 1LZOA 1GTEA 4XIAA 5D03A 2ASHA 1XJBA 3NGFA 4K38A 3P6LA 5FEWA 3CL6A 5IXEA 4L9ZA 1ZGDA 4HNOA 1G67A 1WDDA 1YPXA 1A5LC 4Z2JA 4CGTA 4ZO7A 1OFOA 2P88A 4FX7A 3VMOA 2R1KA 2XFYA 1W5OA 1C8VA 1MMFA 3ARQA 3BLLA 4M6UA 4LRTA 3T8QA 3ZIZA 3BK0A 3EEZA 3I4KA 1VPYA 3TFCA 1E4NA 2WMIA 5DQPA 3KRUA 4J5NA 1FX6A 1H5VA 2F6UA 2O92A 3DX5A 4PODA 2V3EA 4KEZA 3APTA 4PEEA 4J3ZA 2DSUA 3UG3A 2HTMA 3UZZA 4M7TA 1GJWA 5D2TA 1M7XA 4CEXC 4GVFA 5BNKA 5FA5A 2Y1HA 3FAWA 3NAVA 1UG6A 2X16A 2VR2A 4IISA 3IK2A 1JIBA 2DZSA 1R38A 3B03A 2V0TA 1F6PA 3SY5A 4IIDA 5FAGA 2F7FA 3R89A 4N6EA 1CXIA 5A6TC 5AKQA 2QJHA 1HF6A 4NZJA 1C3FA 5I09A 1GEHA 1KLZA 4B5TA 3SN0A 3W1QA 2V5BA 3PVFA 3UA3A 3CIWA 3P0XA 1PS9A 1D9EA 3CH0A 1NP2A 1ZBCA 3AI0A 1TPVA 1PZ3A 3S5ZA 1QVBA 1XLCA 4C6IA 4QG8A 1S2AA 4JQ3A 1QI0A 3ZWSA 3WH5A 5D37A 1LQAA 1UH2A 2TYSA 1ZBVA 2XGBA 1A5KC 5EYWA 2E25A 4S38A 3PB0A 4GE8A 5BWAA 1QR7A 3IUIA 3TSBA 3G1XA 2ZUTA 2WJDA 1VRXA 2QJGA 3W81A 1QK0A 2BVYA 1ISZA 4RKAA 2H90A 2C6QA 4PUUA 1W1IE 1BSLA 4O57A 3MUXA 3FJLA 2O55A 3GXDA 3HV9A 4UTTC 5IM51 1H7OA 1VFHA 1V03A 1O95A 4S3DA 4WY0A 4ZR8A 3GBDA 3DG7A 4FNTA 3S5NA 3H54A 2VOMA 3BURA 3HG4A 3DYPA 1XLEA 1Z7AA 1ICSA 3KBSA 2P3EA 3VKKA 2NXGA 3MW7A 3UZ5A 5BZAA 3SCNA 1YNYA 4DWDA 1SSGA 3LX9A 4MDOA 1IEWA 3DG6A 4CNSA 3HOJA 1EYEA 1V08A 3AWNA 2YLLA 2XIQA 1FHDA 4ZB0A 1EXPA 4IG2B 1OG0A 1X6UA 2BWGA 3D47A 1T5AA 1RCOB 4L1GA 3CWOX 3JW7A 3C5QA 4LYKA 2F6XA 2ZZ6A 4TR9A 1OB0A 2E0PA 3REQA 1ZJAA 2GGGA 4B2DD 2PTDA 2VEIA 4ZCWA 3TNOA 4D8LA 3KL3A 2PUZA 3HU7A 1XDJA 1PCKA 2PDGA 2Q8LA 4A6GA 1NELA 1FH9A 1E0XA 2ACUA 3S47A 4V15A 2J6VA 2FQIA 2VX5A 3MCOA 4FK9A 2VEPA 3P14A 1EUNA 4QE1A 3VC5A 1H60A 2DSWA 3K4WA 3CAVA 1BD0A 3N9KA 4JCLA 2CW6A 1IE7C 2BB0A 4XWUA 3W7RA 1RALA 2JF6A 3OYXA 3R10A 1MVYA 1AMKA 1JRBA 4PEKA 1YLVA 2VNCA 3R79A 4DWSC 3WL0A 1DIKA 2H9AA 2J9XA 3MUIA 3LYEA 1ISVA 2UBPC 4KRUA 1MQRA 3AAMA 2CZ5A 4EF8A 3UR5A 2C16A 1QO2A 1OYCA 3UBPC 3VGEA 4QTGA 1SW0A 1Y5XA 2Y62A 3AALA 5MF5A 2ZTKA 2YZ5A 3AHYA 1CLXA 3W7KA 4TIMA 1NFPA 4K39A 4LV9A 3WUEA 3CV2A 2ZXDA 3W1UA 4HK7A 4U4MA 2CXEA 4LU0A 5A6SA 3ZZ1A 4UTWA 2PB1A 2J79A 3HQNA 1A0EA 1HXJA 2QCDA 4G8TA 3AUOA 2YDSA 4R5EA 3QMTA 3QGAC 2A7RA 3LHZA 4US5D 1WNOA 5CAHA 1PL9A 5EMJA 4AZCA 5BOFA 1KBIA 4NVTA 2DT0A 1HT6A 1RAKA 4AEEA 2WM0A 2A5HA 1QI2A 4LS2A 2YDAA 2GWGA 3W75A 5FL1A 4DBSA 3GHRA 4UCGA 3ZS4A 3WLMA 1KXVA 4P7QA 4DO7A 3WBWA 2ZZ4A 2NV2A 3BDKA 1YNQA 3UJFA 3R25A 1V51A 4ZO6A 4J3XA 2GGIA 2YSWA 3ITVA 4F9DA 1US0A 3LPFA 2E8ZA 3A3WA 2BY1A 2JKAA 1B2YA 5BXSA 3BG9A 1FXPA 4PGLA 2WNZA 4GXPA 1J2WA 1FCBA 1QT1A 4G1KA 4S3JA 3NXFA 1XPYA 3CHVA 4B4FA 2PDFA 1K03A 4B90A 1E51A 4TTUA 3WF2A 3N9SA 1C29A 3FGCB 3AXKA 2GVJA 1IHIA 2VZVA 2D2HA 3KL0A 4V28A 1QFEA 4G7EA 3GH7A 1EBGA 3QW4B 4JDBA 1CGXA 3APGA 3B0YA 5A2AA 2DW7A 3VNDA 1TFVA 4ZMGA 3MSRA 5CZSA 2Q8XA 2QMKA 2I7GA 3GBEA 1QW7A 3P67A 4HSOA 3D3FA 2INZA 2VEKA 3K1GA 4L56A 4EXQA 3CS2A 1W1ZA 2F8QA 4IUOA 3FKKA 1KRCC 3T8LA 3IGUA 1R46A 2GPTA 4AQLA 4IIEA 4LUIA 2YIHA 2D23A 2XIMA 1GYNA 4MUZA 3TJ4A 1KXTA 4I8DA 2RGLA 2NX3A 4W8LA 3P80A 1PHWA 4H9MA 2DUXA 2PTXA 1FWNA 3SCUA 3WNOA 1QI4A 4HNTA 1H49A 3EOUA 2NUYA 2E5BA 4YTUA 1JZ6A 1J0HA 4B5UA 3SUWA 3L0NA 4GIAA 4H9XA 4QITA 1HO1A 3FJ6A 5CG7A 3W7JA 3MQTA 5E9AA 1JDDA 3OIXA 3EGJA