4DI9A

Crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
293
Chain Sequence
b'LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLKRLVDDAPKDKFLEVAGRLPAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTAWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-pyrone-4,6-dicarbaxylate hydrolase
publication title Structure and Catalytic Mechanism of LigI: Insight into the Amidohydrolase Enzymes of cog3618 and Lignin Degradation.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 98
structure length 293
sequence length 293
ec nomenclature ec 3.1.1.57: 2-pyrone-4,6-dicarboxylate lactonase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4di9A00
3ORWA 2P53A 4G7EA 2BB0A 1YIXA 3JZEA 3GTFA 3T8LA 1V7AA 2QS8A 4C60A 1GKRA 4XAGA 4LAKA 3E38A 3V7PA 4KETA 3SFWA 3GIPA 2XIOA 1RA5A 4XD3A 1NFGA 2R1LA 1R9ZA 2VC5A 4H9ZA 2Z2AA 4RE0A 2Z00A 4XAFA 1NDZA 4GBDA 3MKVA 2YXOA 1V51A 1KCXA 1R9XA 4BY3A 4H9XA 2HPMA 1RJPA 4CEXC 4F0RA 4L6DA 2HPIA 3F4DA 3QGAC 4BKNA 2HBXA 1V77A 1ITQA 1M68A 3PAOA 2EG7A 3MVIA 4RDZA 4UBPC 2Z24A 2FVKA 3ISIX 3SO7A 3MVTA 3MTWA 4XAYA 1UIOA 3B0XA 2Z27A 4H9UA 2PLMA 4C6FA 2PUZA 4JOMA 1E9YB 4I6VA 3DUGA 3ICJA 1FWHC 3RN6A 2OB3A 1E9ZB 3DC8A 4EPKA 1GKPA 1JGMA 4NP7A 4RDWA 4J35A 3PBMA 4C65A 2P50A 2VM8A 2Q01A 4P5UA 4DNMA 2AMXA 1EJTC 1FWBC 1S3TC 5A6TC 4EP8C 4EPDC 1J6PA 1ADDA 3LGGA 1FWIC 2ANUA 3IARA 4IF2A 2GSEA 2E1WA 4PCPA 4KERA 3GTHA 4F0LA 3E0LA 3A4JA 3EGJA 3GRIA 3GUWA 2D2HA 4QTGA 4M51A 4PCNA 5FSEC 3LY0A 4EPEC 1XRFA 4LH8A 4C6IA 3EWCA 4LALA 4IGMA 1P6CA 3A3WA 2R1KA 2WJDA 4L9XA 2FVMA 3URNA 2EG6A 2KAUC 4C6PA 1M65A 4IFRA 1NDYA 3S2MA 1XRTA 4GXWA 3N2CA 3URAA 3UR5A 4C5ZA 3T1GA 1FWCC 3HTWA 1O5RA 1PTAA 4DI8A 3B40A 2VUNA 2OQLA 1EYWA 1W1IE 3GU2A 4C6KA 4GX9A 4OFCA 2O4QA 2ADAA 3HM7A 1A5OC 3LSBA 2I5GA 2IMRA 4LCQA 1DPMA 4DLFA 2DVXA 4GK8A 2D2GA 3TN6A 3BE7A 4QSFA 4GY0A 3PANA 2GWGA 3CAKA 3OQEA 1YBQA 4RDVA 3GU9A 4ERGA 3RYSA 2VHLA 1YRRA 2Z28A 3IGHX 4XD4A 4C6CA 4NI8A 3K4WA 4INFA 3NEHA 2OOFA 4DO7A 4KEVA 3O7UA 4C6QA 5CH9A 4WVXA 3S2JA 3MJMA 3AU6A 1A5MC 1ONWA 4ZSTA 3TNBA 1UMLA 4V1YA 3MPGA 1O12A 2E25A 3B0YA 5FSDC 4GYFA 4RDYA 4R7WA 3LSCA 5HMDA 1A5NC 1J79A 3WMLA 4KQNA 1GKQA 2Z25A 3GTXA 3NQBA 1BF6A 1FKWA 1UBPC 3E74A 2QVNA 3K2GA 3LNPA 1ONXA 2UBPC 3URBA 3K5XA 2BGNE 3UPMA 4H9YA 4QRNA 3NURA 4C6NA 3PNUA 3QY6A 2Z26A 2G3FA 4PE8A 1A5LC 3S2LA 4IG2B 4LCRA 3C86A 3QY7A 3WZ0E 2RAGA 1POJA 3UBPC 3CS2A 4LCSA 3URQA 4CQCA 4LAMA 2AQOA 4HK7A 3ITCA 1RJRA 2YZ5A 1FWDC 1A4MA 2PGFA 2R1NA 3CJPA 4B91A 1FWGC 4C6OA 1J5SA 1RAKA 1EJSC 3MDUA 3TN3A 2O4MA 2ZC1A 4HA0A 3MDWA 3E2VA 1ITUA 3IPWA 3ID7A 1M7JA 3E0FA 3S4TA 4HK6A 3F4CA 2DVTA 4J5NA 2F6KA 1XGEA 3IACA 1V4YA 3FEQA 4IFKB 3D6NA 4XAZA 1EJXC 1FWAC 4G7EB 4B3ZA 4CQDA 1KRCC 2FFIA 4GX8A 4PBFA 4I6KA 2OGJA 4IFOA 1P6BA 4V1XA 4GC3A 4CNSA 2Z2BA 4LEFA 3GTIA 4B90A 3WYZA 3S2NA 2DVUA 2WM1A 4F0SA 1QW7A 4ERAA 2GWNA 3F2BA 2WJEA 4YIWA 2Z29A 3PNZA 4ERIA 4IQJA 4H9MA 3QY8A 3LU2A 4H9VA 4KF1A 4QS6A 1R9YA 3F2CA 4B92A 2OODA 3FDGA 4RZBA 2R1MA 3O0FA 3IJ6A 3OVGA 3MSRA 1EZ2A 1RK6A 4DIAA 3GIQA 1IE7C 2WJFA 4BJHA 4C6DA 2PGRA 4R88A 4XD5A 1A4LA 1PO9A 3T81A 4UB9A 2A3LA 4IGNA 4WHBA 3UF9A 1K6WA 4DYKA 3EWDA 1EJRC 4H01A 4WGXA 3QGKC 4CNTA 1QXLA 4GY1A 4ZSUA 4D8LA 5E5CA 4DZIA 4LFYA 1ZZMA 4E3TA 3F2DA 3R0DA 5HMFA 3TN5A 2GZXA 4GY7A 4H9TA 4G2DA 4C6JA 2EG8A 4LAOA 1FWJC 4ICMA 3IRSA 4KEZA 4LANA 1PB0A 1UIPA 1NDVA 2QT3A 2Y1HA 4DZHA 4MUPA 1XWYA 2W9MA 4EPBC 2D2JA 3AU2A 3IV8A 1WXZA 1KRAC 3FDKA 4Z42C 5AKQA 1RA0A 2VC7A 1YMYA 4QS5A 3RHGA 3LGDA 2UZ9A 3TN4A 1I0DA 5HMEA 1KRMA 3GU1A 1FWEC 2AQVA 2HBVA 4HK5A 4KEUA 2I9UA 4GZ7A 5LXXA 2Q09A 1RJQA 4C6LA 4J2MA 1RK5A 4XD6A 4C6BA 1EJVC 3LA4A 3OOQA 4C6MA 4IG2A 3GG7A 3UR2A 2Z7GA 4HJWA 3G77A 4IH3A 4AC7C 5G4HC 3E3HA 2QPXA 3DCPA 4NG3A 1J6OA 1HZYA 1YNYA 1YBQB 4GOAA 2Z4GA 4TQTA 1POKA 1FWFC 2PAJA 2FTWA 1EF2A 1I0BA 3RCMA 1P1MA 4KESA 4R85A 3KM8A 3AUOA 1PSCA 1VFLA 1FKXA 1WXYA 4H00A 3HPAA 2ICSA 1A5KC 3OODA 1K1DA 4QROA 2GOKA 4DLMA 1EJUC 4CEUC 2R1PA 2YB4A 4C5YA 3LS9A 4DI9A 2CZVA 2HNHA 2VR2A 4AQLA 2FTYA 4PBEA 4KIRA 2HQAA 3OU8A 1KRBC 2YB1A 4CQBA 3A3XA 4IFKA 4CNUA 1NDWA 1EJWC 3OJGA 1K70A 1V79A 4C6EA
chains in the Genus database with same CATH superfamily
7TAAA 1K03A 3IAQA 1MUCA 4X0VA 6ENLA 2AGTA 2W62A 2PMQA 3HGJA 4R7OA 3GZAA 1KLZA 1O5KA 3ZLGA 2R1LA 3WLHA 3S1VA 2H90A 3VD9A 3N4AA 2OXNA 2JFEX 1H4PA 5MKGB 5CEWA 2P8CA 2NWSA 2E4TA 3NFUA 2CU0A 2OKOA 3QHOA 1EO5A 3WLIA 5AYZA 1GT8A 4R27A 3W76A 1DTNA 3CQJA 1MEWA 2WM0A 4F2UA 2ZX7A 2Y6ZA 4DUWA 2VCAA 3KCOA 1V93A 3VX1A 2XH7A 3PK7A 2INEA 1QK2A 1TVLA 1UYQA 3A4WA 4RDWA 1ODUA 1OZMA 5LA1A 4CCZA 4M82A 4Y8FA 1Z32X 1RQEA 4RNJA 4QXIA 4F4RA 3WLTA 2FDSA 2BDQA 2ANUA 3PWGA 1EJ7L 2ON3A 4Q4OA 3K4AA 5CLWA 2YPIA 2WC4A 1GHRA 1Z9AA 3BURA 3GUWA 4O0QA 3VAVA 1PEZA 1EPVA 1S5WA 1ZJHA 1JEZA 5JH2A 1KBBA 2WJDA 4YLWA 4UZSA 1RZMA 1M65A 1F5ZA 3ZT7A 3UWYA 4O53A 3L5MA 2J88A 5C70A 4P7OA 3V36A 2PA6A 4H6RA 3FSUA 4ZB2A 2VUNA 3EWYA 3UQNA 1M9HA 1KWKA 1MFVA 3GXDA 3BW4A 4W7WA 2HZGA 3LHYA 3M6DA 4LCQA 2DZAA 3UXAA 2Y7FA 5M3WA 3PANA 3KZSA 4JAWA 4PMOA 1JCJA 3L2IA 1I6NA 1YRRA 3K46A 4F40A 4DJDD 4KEVA 1BSLA 3GG0A 5CH9A 4CKQA 4J3UA 4FNQA 3FFSA 4QSHA 3E49A 5E70A 1H11A 2KZHA 3UG5A 4AD3A 1EEPA 2ZZ4A 1X6LA 4JZ5A 3WMLA 1I1XA 1JDFA 1IXNA 3NQBA 1HJWA 3A9IA 5J5RA 4PTXA 3K2GA 1XBVA 3LNPA 3N9RA 4DM1A 4WF7A 4IMGA 1EL3A 1US0A 5BWFA 3TUUA 5EGRA 3QKZA 2JEQA 3SQLA 1A5LC 4IOTA 3V5OA 3MJYA 3VYLA 2QDEA 4AZBA 3CHFA 1JR1A 4WY0B 1C90A 4WZHA 4QAIA 2A21A 2J8FA 2YZ5A 3W2NA 2GK1A 3BG9A 2BP1A 4F8XA 3H8AA 3WF0A 4UTWC 2FH6A 4LVGA 4UTIA 4REQA 4PCSA 3GD6A 2R91A 1VEMA 2P88A 3PHAA 2PF0A 1CGXA 2F6KA 4FLQA 2WANA 5FJOA 1LUCA 2VR4A 3L4TA 3PJXA 3D6NA 4C7FA 2BWGA 1FWAC 2CBIA 4AEEA 4FA3A 3K1DA 4NASA 4I6KA 4N0RA 3H70A 3LNMA 2J24A 3JU2A 2NUXA 4ADTA 4IQDA 2G4FA 1K4HA 3UG8A 4K1GA 4JQ3A 3SRKA 5EKYA 3PB0A 4W87A 4LUSA 2C6QA 1QPKA 2ZDSA 3I6TA 3UWZA 2I17A 2YDRA 4IWWA 3ES7A 5CAKA 2OELA 2JQXA 3ZJ6A 1UKQA 1TWZA 2PWGA 4I9AA 3QTGA 3M44A 1IE7C 3VNDA 4R88A 2IKGA 3M0ZA 1SMDA 3RF9A 3DI0A 2E9BA 1B3OA 2V82A 2EF9A 2CLMA 1YTDA 1PCKA 3DYOA 5GJPA 4GY1A 4LYQA 2QJMA 4RUBA 3TMLA 4PMXA 1ZZMA 3GFYA 3HFTA 1PJ9A 3HIJA 4Q7BA 3WQDA 3VVGA 1LROA 2AKMA 4DJED 2RH9A 2D2JA 4MJMA 1UWAA 2XHYA 3PUDA 1E4LA 1BQGA 2P8BA 4H7CA 3W07A 1F76A 3B4YA 2PTDA 2A4AA 3TWBA 4PEEA 1YADA 1W2VA 3Q67A 4FNUA 4MLRA 1OFDA 1QMLA 3U2OA 4GXPA 5C2XA 3BLDA 3WH5A 1FH7A 1GYMA 4M3PA 1F3XA 1J0IA 3N4EA 3G77A 1EGMA 1A3HA 3AMCA 3UT0A 3DCPA 4ENLA 1XYAA 4TQTA 1IEWA 4BHYA 1EF2A 3PTQA 3V0TA 3KS5A 1NTHA 5HK4A 2WHJA 3G8EA 1FCBA 1HGYA 1SZGA 5K2ZA 4MB3A 5JBEA 1DE5A 3SCOA 3P82A 1UQZA 4W7UA 3BAXA 3WDQA 1TX2A 2GOKA 1KCLA 2R1PA 4UTWA 2Y62A 1E0TA 2VR2A 3BSHA 1H7OA 4L4OA 3STEA 3WSUA 3LGEA 1LQ2A 1R86A 2YYUA 3E12A 6ALDA 2A6LA 4I5UA 1TE6A 4B2DA 2PCQA 3W75A 4WK9A 3SFWA 4O13A 3GIPA 3M7WA 2HRWA 2V3EA 3VKKA 3WJWA 4LVAA 3NM3A 3ZJKA 4G6CA 4HCDA 2GK1B 3PPCA 3BUVA 1C7TA 2PCEA 1MVYA 5FOOA 1ITQA 3AXMA 2OKTA 3M47A 4N6FA 1MMFA 5FCZA 4BEQA 4FX8A 4LVDA 3UWUA 5JIWA 4N6EA 1UWSA 2ZUTA 3QEZA 1TJRA 4UTTC 3PB2A 1SGJA 2DW6A 4HVXA 2PUZA 3QMTA 4Y9PA 5I2UA 4O4VA 1UPMB 1F3WA 4H2HA 4XUYA 1R87A 1E9ZB 1BKSA 4ZZ9A 3LPOA 2WW5A 3TXVA 1SM9A 3RILA 1JFXA 5IFPA 1XIEA 4ALDA 1SJCA 3C5QA 4PULA 3BCDA 1BGAA 2C7FA 1VBJA 1W9BM 3UXLA 2E1WA 1VFMA 3IRDA 3KRUA 4LUSB 4DF1A 4UMAA 2AQWA 3BGJA 2YL8A 3TMQA 3GH4A 1NVMA 1BPLB 2C1HA 3H4XA 2ZUVA 5I3DA 3BAYA 4QE5A 1TTIA 1H7RA 1O94A 3G3DA 1SZRA 4UQCA 3UVIA 1NP0A 3N2CA 1V02A 1S5MA 1X1ZA 2BGQA 4CCDA 3TQKA 1JVNA 5F7UA 3WF3A 5FEZA 3GU2A 3VDGA 3GR4A 3B9OA 1R0MA 1EIBA 2ADAA 4DUVA 4PA8A 5BMXA 1KKOA 1LL7A 1H50A 1DPMA 3NR0A 3EMCA 1T0OA 3AYRA 6TAAA 4XK2A 2BOGX 2PP1A 2JEPA 4XIMA 3SCTA 1AZ2A 4AY8A 1ZJAA 3NEHA 5DO8A 3PTDA 2A5HA 1BKHA 3QW4B 4MAZA 3KLLA 4IHCA 1FVPA 4OU1A 3F4NA 1HP4A 1PZ3A 2VD8A 3BXWA 4GYFA 5H1WA 1G4TA 2PE4A 5EBAA 3R89A 3RK8A 3TCSA 3W7OA 3H6OA 1Q4NX 5JBDA 2CKRA 1QWKA 3I3BA 3UPMA 1L8NA 3C0LA 4GE8A 4QRNA 1ZAJA 4GVHA 5LGXA 1XYMA 4NX0A 4J2PA 1ZHAA 2RAGA 2RDWA 1R5YA 1DWJM 2C79A 4H6EA 2LLEA 4H8NA 4FNPA 2R1NA 1PIGA 1K77A 7ENLA 1HW6A 1QPNA 3HMJG 5C2GA 5GNXA 3EMQA 3QZAA 1ZSXA 4JQ1A 5CC6A 1VYSX 4FXSA 2YFOA 3G1AA 4HYWA 3DFPA 4I7WA 4YTSA 2DVTA 3V75A 3QHMA 1SR9A 4JQAA 3QQ0A 4DRSA 4UTTA 4HCHA 5HJXA 3FEQA 1TR9A 2ZZ7A 1XG4A 1YXCA 1RBAA 1UR8A 3QV8A 1FXPA 4CQDA 1JCXA 4RLIA 4RW5A 1LOSA 1ZBKA 1LBFA 1E9IA 1X98A 3KRSA 3KTSA 5DY3A 2WHKA 3PP7A 1CWYA 2VELA 3RO6A 1JXJA 2OOGA 2UY3A 3W02A 5J8LA 4PC8A 3U5UA 1DJQA 3H2OA 4QX4A 4MF4A 2GWNA 4EOUA 3ABXA 1X1OA 3HF3A 4DHGA 4BI6A 2Z29A 4W5ZA 1TUXA 4IQJA 3ITLA 4Q4KA 3G0UA 3M07A 4JTRA 3S42A 3EKLA 2E5CA 1E51A 4CUCA 3FDGA 1LBLA 2V68A 1XPYA 3S47A 3T44A 2BFGA 5AB3A 1R2RA 5I77A 3QKEA 4AY1A 1TPB1 2QW5A 3T81A 1HJVA 3E6EA 4NF7A 2A3LA 1FA2A 1UD6A 3FEMA 1OD8A 4XKYA 1RVKA 5LZLA 4O4WA 1GTHA 5AFDA 3ARQA 4BI7A 2O56A 1LCOA 3BG5A 3LHZA 1KFBA 2OLHA 4KBXA 4LFYA 5CBBA 4W86A 1SFTA 2DZVA 3P7YA 6PTDA 2BSLA 2HEJA 4FOJA 3TN5A 3LHWA 1YPXA 4JKLA 2AGKA 4G2DA 1L0PA 2VDHA 2HVMA 3AHZA 4NY2A 1OJXA 3H7UA 2XYLA 3ES8A 4DZHA 1KQYA 2X2YA 2VENA 1UBSA 2JF7A 2V5KA 4K36A 1WXZA 4Y9MA 3B8WA 3W86A 4W8AA 4Z42C 3LCWA 1SO5A 3NXLA 2I5IA 4GISA 4JL2A 3HB9A 2O9OA 2IUZA 4JIHA 4KFNA 5HMEA 4R9OA 2FZDA 5D2TA 3WQEA 1FWEC 2XZ7A 2QUTA 3POHA 2E09A 1VCVA 4UZUA 1H0GA 3LLXA 3BPWA 3KOFA 3LA4A 3GG7A 5EFFA 4I7VA 1E6PA 2QDGA 4O1BA 1HN1A 3MV11 4IH3A 4S3BA 4AISA 1JZ4A 5M5DA 2X1IA 4I5RA 1V3JA 4FB7A 3WFLA 1POKA 4NZ4A 2PAJA 1CX9A 3W7JA 4GUGA 3WH6A 2CXGA 1FKXA 3PZ9A 4O52A 1G1YA 5HXMA 3AWOA 1W9XA 3OZYA 4XBKA 4L1XA 4IJRA 2X1RA 4FHAA 3OU8A 3TQ0A 5T9CE 1PPIA 3THAA 4IFKA 1NDWA 1OVDA 4DBSA 2ZVRA 3G1RA 4R7JA 1O66A 2ZZ2A 2F6UA 1W91A 1RY8A 1SO4A 4XAGA 4GQRA 1XLMA 1F4HA 1QI4A 2ACSA 2GQ8A 2XIOA 3WEZA 4MZ1A 1ZPTA 7ODCA 1K8CA 3G22A 2XN0A 4GJJA 3AS1A 2DT0A 2ATSA 1J5TA 1HL8A 5CJNA 4H9XA 1F61A 3ITGA 2PZNA 1XW8A 4WJ8A 2WOQA 4HPXA 1X8FA 2ZWZA 5C7HA 3VFLA 1OYAA 5LSMA 3KS6A 4MUZA 3B0XA 3EDDA 3O1NA 3U2CA 1O1HA 3OZMA 3P62A 1Z69A 3UWVA 5LNSA 4LWWA 1FWHC 3QLLA 5G4EA 3TQVA 4NP7A 3VIJA 1SFSA 5SWUA 3OG2A 3ARPA 1EDQA 1ZY9A 4R3UA 3C3UA 2G50A 4M6QA 3NNTA 5DBTA 1OM0A 1WKDA 3NVDA 5A6MA 1H5VA 3BL3A 4EP8C 1XCXA 4UOZA 5E0FA 2EXOA 1S39A 1K3UA 3R79A 4DJFC 4CCCA 3AAMA 3M16A 1LTDA 1TELA 3UXIA 3L66A 3E0LA 2QJHA 2QNEA 2E6DA 3A4JA 1E40A 2D2HA 1PZ0A 3VDAA 4QTGA 3TJXA 4J3TA 3VIMA 1T8XA 4XBJA 1XLAA 3HOJA 2BVYA 3LX9A 3ZR5A 2BG5A 2BOFX 1QW9A 4IISA 3Q58A 2ZKMX 3W88A 2O7SA 4CNPA 1QR7A 3O07A 5CPMA 1EDTA 2WPBA 3GNNA 4ICNA 3ZMRA 2RUSA 4XKYB 4A8RA 4O28A 1JRCA 3FA4A 3OPSA 3NA8A 4FF7A 1FXQA 1IT0A 4AHQA 1KGUA 4GK8A 2DZUA 3TLQA 4QSFA 2YCLA 5HQLA 4OT7A 2Y89A 4X61A 3R94A 4TTGA 2WYSA 3VXGA 2CBUA 1VJZA 3TK7A 3G3MA 4AZ6A 4JIPA 1LRNA 1A5MC 1D8CA 3VA8A 3NTYA 2WKLA 5JBFA 4DPQA 1Q6DA 4QCEA 3CUGA 3L23A 4QNWA 2Q3OA 4PMYA 1VR6A 4C7DA 2QCEA 1UBPC 4JFTA 1HF6A 1WOAA 2F6XA 2J7CA 4IPIA 2XGZA 4JNZA 2PDYA 3GW0A 1OX4A 3P2VA 3BGGA 1MEHA 4F9JA 3M64A 5FL0A 5JH1A 3QY6A 4NXKA 4CU6A 4MYAA 3W1LA 3UESA 1Y65A 2PSNA 1W3KA 3VM7A 1B2YA 2VYOA 4MDPA 1W32A 4PMQA 3L2MA 4RR4A 3S1GA 1Q63A 3CJPA 3VUSA 3BV7A 5I09A 1NWTA 1W6TA 1EJSC 1M41A 4DEFA 3MW7A 3SCPA 1ITUA 3KVMA 2A79A 3ID7A 4OTKA 3B0PA 1M7JA 1T96A 2VWSA 1XI3A 4W85A 2WSYA 4OKDA 4P8UA 4URIA 4MAVA 2RFGA 4W84A 2VEPA 2DH2A 4IMEA 1DWFM 4IFKB 4XAZA 2J78A 1W5OA 1EJXC 2EJAA 3NSMA 1M5WA 4MWAD 3EWWA 2OGJA 2C0HA 4KEMA 1DE6A 2CLOA 1XD1A 1XD0A 1HGWA 1YXDA 4DJFA 4EX4A 2C0AA 4Z1DA 3PNZA 3QPYA 3QY8A 3MYOA 4UTHA 1GZGA 2ZRWA 4OECA 2PC4A 4GZIA 3WBWA 1WNOA 2VEMA 3W4RA 3IVTA 4HZMA 3FXYA 1PO9A 3LCGA 3DX5A 1F05A 1HKKA 1H5YA 4H01A 4I5XA 4J9JA 4PRWA 1QXLA 1QDSA 1GGOA 3WD2A 3OLIA 3PPGA 4DZIA 3TSBA 4RPQA 1M03A 4MADA 5PTDA 4RE3A 5I79A 1YPIA 1IIHA 5LGZA 1V0MA 2VEFA 3AYSA 3W7HA 3W7CA 2VFDA 1NDVA 1Q6OA 1VKFA 4GJIA 4FZIA 2JIEA 4ZOAA 3TOYA 4FPSA 1E1EA 1Q6CA 3W1NA 4D8ZA 3W83A 1M53A 5CPSA 1QJWA 5EU9A 1ONEA 3G1XA 4IPJA 4L6HA 4FX6M 3GSMA 2DZTA 5IOBA 1TSIA 3GXPA 3QXBA 4B5NA 4WDXA 1EB3A 1V6XA 5HANA 1IT8A 1QOXA 1ZUAX 5DRIA 1TZZA 1R30A 1AFSA 4N4PA 1FBAA 4RZ4A 3PBVA 1SPQA 2ZCGA 3KWXA 2ISSA 2V3DA 3H2EA 1FH9A 3RX4A 1P0KA 2WZEA 1HJSA 3SR7A 3Q45A 2R6OA 3HG3A 3TTYA 5CPTA 3W28A 2J7FA 1LZOA 2WMIB 1WDPA 1ADSA 2CW6A 4B5UA 4C5YA 3NL5A 5LHEA 3T4CA 2DIJA 4J3VA 4ZQPA 2FPVA 3A3XA 2VD9A 3CTTA 1OX4B 3ANVA 4P8VA 5A8PA 2PDGA 5D9MA 2QCCA 1W56A 3T0CA 2F2HA 3NL6A 2G4JA 7REQA 2VWTA 1Q13A 2EPNA 4MKVA 1G01A 2V5JA 1JCMP 2E68A 4L1WA 4JIQA 4XAFA 4PGLA 4PB4A 1UD8A 5GNZA 2Y70A 4LB4A 3IK2A 4C90A 3PAOA 4X60A 3TJLA 2XJ7A 3KP0A 2ZZ1A 1V6WA 1FFQA 1QK0A 3A64A 1X96A 3RRAA 4C6FA 3QV9A 4HGXA 3ZYZA 1LDCA 1PKMA 1H0IA 3AOFA 2VX6A 1GCYA 4GYJA 4Q4RA 1C8VA 1HJUA 3CQIA 2FGLA 3II1A 4BF7A 4HMDA 2NLIA 1TVPA 3B05A 5D4YA 3EMZA 1TZ7A 1XLFA 1K8ZA 3QQ1A 4M19A 2FHCA 3VNZA 4XG1A 1KNWA 2P0OA 3FVMA 5CGMA 2QDDA 4U3CA 2X05A 3WQPA 3OBAA 5CBJA 1UH2A 2OT0A 4WSKA 3LCLA 1J4EA 4C7GA 4JN6A 4FX7A 3U0HA 1PBGA 1OIMA 4MDOA 2PODA 1XP3A 5KZ6A 3MUZ1 3GRIA 3OA5A 2OT1A 4RE4A 3NWRA 4OHQA 2YYTA 4UFJA 3TW7A 1ZFJA 5EMKA 3M0KA 1MQRA 2ALRA 1FH8A 1P6CA 1M7PA 2EQDA 2BXZA 1E6QM 1FOBA 3I7RA 3IIPA 4WUIA 2OLSA 3B40A 1SZEA 2OQLA 3FYYA 3LM7A 3R11A 1PX8A 2EKCA 1HL2A 4ZQMA 4OFCA 5H2ZA 2EEXA 3VC5A 2FKPA 3DG3A 1C92A 3K13A 3EKZA 1XQKA 5A94A 3TLLA 1WX0A 2NX9A 4DJFD 1TTQA 3BQ6A 1G0CA 3QR0A 2E7FA 3U5YA 1NWRA 3EWUA 2FPYA 2WQDA 2Y5EA 4RK8A 4HZ8A 4ZOEA 4GI8A 1TWIA 4UC5A 3S2JA 4NQ1A 1OFRA 3DESA 1Q6FA 4UOQA 4JHZA 1EQCA 1J18A 1GVQA 1GTEA 3LG3A 3GHRA 5J04A 1US3A 4GQ0A 2FZ9A 4CQAA 3LCIA 2PDPA 2PLJA 4YXGA 2CERA 4V28A 3T07A 3RU8X 1PX3A 3M6YA 3PG9A 1IGSA 3CHCA 4X2PA 4ACYA 3S2LA 4I8DA 5I03A 2FLIA 4D72A 3TC7A 4NZ3A 1L9WA 3K8MA 4FSAA 3KOWA 1S1PA 3L5LA 3TONA 3TA9A 3R8GA 1L6YA 4YN5A 4CCEA 3HG5A 2V3GA 5F1UA 4D71A 4HHLA 3CYVA 3A9BA 4AWSA 5HINA 1JZ3A 3TC3A 1ZB5A 5BCAA 2D20A 2HS6A 1JYNA 3BTNA 4J5NA 4D9PA 3KBSA 4WIWA 3EPNA 5A2BA 2D73A 3NQ8A 4G7FA 1A0EA 2A3BA 4YWSA 1OGBA 4TV5A 1EKOA 4Y9OA 2WPGA 4UR8A 7REQB 2GGJA 1KW1A 4QE1A 4JY9A 2ISVA 1VLWA 4KGJA 4HB7A 4V1XA 4CNSA 4Y7EA 2R24A 4B90A 1PKYA 3HO8A 1DL3A 1C8YA 2CZ5A 4HPNA 3L7RA 3LOTA 1AL8A 2POTA 5K4XA 3FYPA 2QGHA 4BWLC 4KRZA 2WJEA 4RE2A 4RXGA 2C13A 2JKAA 2ZZ3A 3GVQA 2QCNA 3B97A 3UD6A 2OCZA 3O6YX 5FESA 1NARA 3ARXA 3E5PA 4US5A 3OEXA 4DIAA 1U5HA 4C6DA 3B03A 3C0SA 5EL1A 4IGNA 1I45A 4WGXA 3QGKC 3N18A 1DJNA 4N9EA 4DY1A 1XDLA 4ZO6A 1F9CA 4WKAA 4GIYA 4P7NA 3HPXA 1DXIA 3S3GA 3VZYA 3ZWTA 1UUQA 1DWIM 3WD4A 1BGGA 3GXNA 4IPLA 3RUBL 1DVJA 2ZQ0A 1CPUA 3TYCA 1AQMA 1PB0A 1JYWA 1UIPA 1EYEA 2Y1HA 2RJHA 1SJBA 3FGCA 4IZGA 3WLNA 5XIAA 3BC9A 1H63A 3STGA 2X7VA 3RITA 4IMAA 4Q8OA 3PZNA 2GDUA 4LEQA 4HN8A 3W1MA 1OB0A 2XM1A 3TDFA 1ZCOA 1XLHA 3A6OA 5C54A 4AIOA 4H04A 3ABOA 1IZKA 1N8IA 3R10A 2DIEA 4NYUA 3S6DA 2PRLA 2PZ0A 3E2RA 4MZYA 1TVNA 1LRTA 1GOWA 3VD5A 5A3HA 3TXZA 2VXNA 3I6EA 2YDSA 4AC7C 3W25A 2O7QA 5CZ0A 3GFZA 1GQNA 3BO9A 1XIHA 1F07A 3SEPA 1P1MA 3L5AA 1XG3A 3ITOA 1ICPA 3K8KA 4M6UA 2A7RA 3BSGA 1Q8JA 1KM0A 1JF6A 5D02A 3MWAA 1A5KC 3SGUA 1YE6A 5BW6A 3TZFA 3O05A 3ZZ1A 4UTKA 4HCLA 4GPNA 2J79A 4KIRA 4GKLA 2BTMA 2QCDA 3NQGA 2XTKA 5I3FA 4BS0A 3V35A 4XO7A 4GG9A 3W2UA 4E2BA 1ME8A 1E6XM 5C9RA 4EF9A 4AG0A 1CLVA 3NDOA 2J4GA 3AS3A 1MQQA 3SUWA 1P0BA 2Z2AA 3WQ6A 1UCWA 5F4XA 4GCXA 2ACQA 4E2OA 5HNUA 5HUPA 1BD0A 3LZ3A 4ILSA 4JN8A 3W1QA 2CEQA 4BWLA 3MVTA 4NZJA 2G5WA 4H9UA 4LRSA 4AWUA 1FHVA 4HT3A 1R3YA 3FYOA 5EMJA 4K8HA 3DC8A 4H19A 2E6FA 3A4XA 3PZQA 1JGMA 4A35A 5H8MA 4J35A 4TXEA 3VGFA 3PBMA 4H4IA 3M5YA 2P50A 5CGQA 3MP4A 4W7VA 1UKSA 1GVOA 1XDMA 3LXCA 2J62A 4ZE4A 1VFUA 4KCWA 1DTUA 1IZCA 4Z2KA 1QWGA 4MZ8A 1TCMA 1WQ5A 1IXOA 2MANA 3NG3A 2E0PA 4JTEA 3UYIA 4FIQA 4WRHA 3GAKA 4WXZA 3P60A 1NP2A 3UFYA 3UJFA 2VC6A 1NEYA 5F4SA 3S8HA 1BVNP 1UB3A 3GZ3A 1XJBA 2VQTA 3IIXA 3PM6A 4IFRA 1DJYA 3VNKA 3UR5A 2NZLA 4NJGA 2V5CA 3WF1A 3EX1A 2PBGA 2QAFA 1GNXA 5D04C 3LBCA 3R0KA 2FB3A 3VILA 1F7BA 2BVTA 4YYFA 1F6YA 2B4GA 3C2YA 4RNHA 2I5GA 2TPSA 1XHGA 2DT3A 3MO4A 5F2MA 3Q94A 1QASA 3APGA 2INFA 1WBHA 2ACRA 1PV8A 1OFQA 2EO7A 3TYBA 4OGZA 2CWXA 5CJ5A 3W37A 1RD6A 4OUEA 1JDEA 2OOFA 4A8LA 4GD0A 3P61A 1RH9A 3UERA 2W3ZA 3R0UA 1FHUA 2GGIA 3MPGA 1O12A 1I8JA 1VHNA 3IUDA 3LSCA 3AROA 1FCUA 1J2BA 3RGTA 2PDBA 1P0NA 1NOUA 2DSVA 4GO8A 3NYDA 1JCYA 2YSWA 2OYLA 4JYFA 4GH3A 4TO8A 3ANUA 3BAKA 2G3FA 3S5SA 2I56A 2NV9A 2V67A 3TCEA 3N2BA 4CQCA 4HK7A 2EJ1A 2GJRA 3CV2A 4DYJA 2FZ8A 4ES4A 4QJ4B 4QQ3A 1X97A 1RAKA 2PDUA 5HJYA 4D1JA 3MDUA 2GVEA 2ZC1A 4MB1A 3AXKA 3S9YA 3IPWA 4Z2JA 3ABRA 3RPMA 1A49A 5C55A 4M56A 3EB3A 1WUEA 1T6MA 1K9EA 3L65A 3N29A 1JDCA 1QNSA 1Z3NA 1DP0A 4AD4A 2VQUA 4POCA 4DBUA 1RCQA 2QCDB 3E02A 1CXIA 1UZDA 4N7QA 1J0YA 1YTKA 3LRMA 5CZJA 4ZXOA 3B9DA 1H1NA 3A4AA 1L2QA 1X6NA 4DUOA 1UP0A 3NPUA 4S3EA 2NUYA 4D6IA 2QCGA 1JPHA 3S2NA 2L5HA 1KXVA 4IICA 4U10A 2Q8XA 2WM1A 3ZT5A 4DWSC 1QW7A 3R25A 5CC7A 3EYPA 3ZM8A 4FALA 4TIMA 5KZMA 1UPPA 3ERPA 2VUYA 2V5BA 2IQDA 5MHBA 2EGZA 3VUPA 3CO8A 3R8HA 3E0WA 4CU8A 1JXKA 4B92A 1HJQA 2BASA 5HWNA 1ITCA 3M0YA 4HU3A 2CNCA 1UASA 3WD0A 5HWMA 4QFUA 2VGFA 4YTQA 2TAAA 5E0KA 3ABQA 3A12A 4L80A 1MXDA 4DM2A 1X1NA 2YCEA 3GE7A 1RP8A 2REQA 1UOZA 5ABTA 3VPLA 3UZJA 2NVCA 5DCBA 2WKJA 1TZ9A 4UTMA 3L21A 2QKFA 1UP3A 1B57A 3BLOA 1BFNA 4WDUA 5BNKA 4PTDA 4WOZA 3LERA 1SZNA 6A3HA 1E6ZA 1XM3A 9XIAA 4GQQA 3RXZA 4XTIA 4YTTA 2WV8A 2ABBA 1B1YA 4Q4MA 3LGDA 1F3TA 3VDBA 2WLZA 1JULA 5LNVA 2EPHA 5DBUA 1IHIA 3DENA 2P1FA 3PFMA 3OOQA 4ZOCA 4PMJA 3V0UA 2E5BA 8XIMA 4JEJA 3DI1A 5TD4A 3MI6A 1CB7B 3KOXA 4LC6A 4WOQA 2VRJA 3CV6A 1S5VA 2HS8A 5I3KA 4B4FA 1FWFC 1L6SA 2R82A 1QPRA 1NY1A 1NQ6A 3VGBA 4FAMA 1JI1A 1TRIA 4X9SA 3NQEA 3BAJA 4KFPA 4L65A 1UR1A 4RJEA 2D0FA 2FDMA 2WSKA 3HPAA 3N3TA 3STCA 4MB4A 2DW7A 2V5LA 3VKDA 2PWVA 5AHEA 3LTPA 1VBHA 1CLKA 3VKCA 4M1RA 2ZIDA 4ATLA 2DDXA 3W0KA 4QJ1A 4OBRA 5C9WA 2G96A 1FUYA 2XH0A 2P53A 3NL3A 4LAKA 5AYYA 3L0GA 2XZ9A 1OY0A 2GYIA 1S5TA 2NQ9A 2FPTA 3WNMA 5K3VA 3CL7A 3PBYA 3DEQA 4GQGA 2MNRA 1X39A 4DO6A 2DH3A 3QSRA 3B8IA 1REQA 3QPEA 3BJFA 4EIVA 3T55A 3CIWA 4LY8A 3O6DA 2D1ZA 1XIJA 2YW3A 4DWSA 4ECLA 1C8XA 1XISA 3TR9A 4MWAB 4ONVA 1RBOB 2HV5A 4NI3A 4JOMA 1DXFA 1IEVA 2E28A 3WLSA 4ZOBA 2W91A 4HIBA 1H60A 1WDSA 4M7SA 5I3IA 4JTJA 3O0KA 3OBEA 4HMNA 3V3WA 2XFYA 3WF2A 4QIUA 2EPMX 4IGHA 4HPGA 4DNMA 4Q7NA 3W7QA 8TIMA 1OGGA 1KR1A 1ADDA 1VB9A 4GGHA 1LT8A 2V38A 1V0NA 3W01A 2WVVB 1KCZA 3PUEA 1V3KA 3GVWA 4HHHA 3B9AA 4JQ4A 3L67A 1AZ1A 1M3UA 1VGAA 1NF7A 1P1XA 3A3WA 3EDEA 2R1KA 4EWJA 3RM9A 3URNA 3NCOA 4C6PA 1CEOA 1E71M 2IPJA 3V16A 4KWUA 1OWQA 5CXPA 1FWCC 1R3SA 1SO3A 1WYIA 1WE5A 5ABFA 3QN3A 5HOSA 1XLIA 2REQB 2WVSA 1A5OC 2IMRA 1D3HA 2QCMA 2PD5A 4ZQNA 3H23A 3L4WA 1XICA 3L4YA 4QDMA 2PU0A 1VRXA 1OCBA 1W9VA 3WL1A 3GIYA 3BV4A 4MYXA 1W8SA 1UD4A 5BZAA 1QHZA 3AMGA 3PZMA 1TPC1 3MJMA 3U9IA 3R5EA 1OGSA 2DSUA 4GMEA 3B0YA 4RDYA 1GQKA 1J79A 3IIZA 1DYSA 3TFCA 1GKQA 2Z25A 1W54A 2DZPA 3GTXA 3SI9A 1ZBVA 3TZNA 5XINA 2UBPC 4HD5A 4D8AA 2CCRA 1EWDA 2BGNE 1XSKA 1K7FA 3KRZA 2WBGA 3S6TA 3OLEA 1TQXA 3PAJA 1JNEA 4PE8A 3VE7A 1P4CA 2Y7GA 1Q6RA 3E0VA 1XCWA 1RP9A 3TTQA 3H4GA 3T0BA 3C2OA 3LV6A 4K7YA 2J9ZA 3GB6A 2Z1XA 5AC8A 3ITCA 1F8IA 2WCAA 1E0VA 3CEPA 3PSVA 2CESA 1DXEA 4ZFMA 1KKRA 3FA3A 4YHEA 5FA5A 5H8PA 4S3AA 4M80A 4WSJA 1NIUA 5A8NA 3R43A 4AXNA 4E6MA 1HXJA 1ISWA 2WVUA 5B7ZA 3TC6A 2BXVA 1S2VA 3SN0A 4E4PA 3GH7A 3TYEA 4A3HA 3BARA 4V33A 2X0SA 3M43A 3BOFA 4HNCA 3EX6A 5JU6A 3NQCA 4PBFA 1NM9A 1SJAA 3PWAA 1TIMA 1XLCA 4GC3A 2WLYA 4G8TA 2IPGA 1OC6A 4JEQA 4ORIA 2YLAA 5GJMA 1XIBA 4Z1AA 3WK3A 1TTJA 1UZ1A 3WMBA 1MXGA 5BXTA 3GLCA 4RZ6A 1REQB 4TTUA 3UZYA 1Z8AA 1S2AA 3LMZA 4DWSB 3PZGA 4GC4A 4AEOA 4FXJA 1E4MM 2OU4A 1RD5A 3BZJA 4HJFA 5AHMA 3SCRA 1HKVA 3U8GA 5E6ZA 1A3WA 5DMMA 3GXIA 3VO0A 3SADA 1TPH1 3DGRA 3OVRA 2XSAA 3UF9A 1TJ0A 3G1HA 3IGUA 4AWTA 4Y90A 4Q33A 4Z1CA 3U57A 2PP3A 1ZS2A 2C91A 1HIZA 4QR6A 2WKGA 3IUIA 3R0DA 5D05A 3CUZA 3MV01 4KCVA 5A6BA 1V3HA 4LAOA 1V02E 2PTWA 4E0CA 2V69A 1MO0A 3IRSA 5HATA 5CZKA 2UY5A 4KKXA 4U5KA 1TWSA 5A8MA 4UTJA 1R2TA 3T6CA 4QS5A 4Q8PA 1EPXA 3LRLA 2ZA1A 4PUMA 2NW0A 3TW6A 3MSDA 2TSYA 4NJKA 1EWEA 2WAGA 1KFLA 3SUSA 3H2AA 5ABFB 2ZOXA 2Z1BA 1UW9A 3ARYA 4HYRA 3N6QA 5A2AA 2WZTA 4NX5A 2W79A 1LYXA 3W73A 4DZAA 3MMUA 1HZYA 2OZTA 3P8JA 1FTXA 1FHLA 1S2WA 4J7RA 2Z0IA 2KX9A 5GNYA 3BAWA 1SJDA 3N15A 4K7VA 4HP5A 3E1F1 3CAQA 4PFMA 1BYCA 3MHUA 3CUHA 5LNRA 3H54A 3QRHA 3C2RA 1WZKA 1AL7A 3V1HA 1ODZA 1EBHA 3TP4A 3N2TA 1WKEA 3T78A 3SJNA 1MNSA 3OJGA 5LIXX 2BB0A 1YIXA 1WBJA 1ITXA 1E73M 1V7AA 3QFWA 5TAOA 1GKRA 3WMCA 4WQ6A 3E38A 4FXFA 3V7PA 4F9DA 4L4LA 3U4AA 4XZMX 1KFWA 1KO0A 4IGSA 1LLWA 4QJ5B 2ZRVA 1NF0A 3UXKA 5CLTA 1T41A 2HPMA 1UWQA 4Z17A 3WEOA 3PVFA 4LBSA 1XR2A 3QTPA 5CSYA 2EG7A 3MVIA 2FMOA 1SW3A 2WNQA 4NILA 1VBGA 2HK0A 2FVKA 2WHLA 4DXVA 2Q6ZA 2WMHA 2VZTA 1LWIA 2XFRA 2QV5A 4Q3MA 4JIRA 5CSRA 3LBMA 5LA0A 5E1QA 4Q8QA 1E0WA 2DEPA 3NGJA 4NU7A 1E5NA 3O8AA 3GY1A 2J6XA 5LKYA 1VF8A 2D3NA 1DKWA 3GK0A 4LAUA 1LF1A 5I6SA 3ARVA 1GOOA 2BS9A 1OK4A 4AD1A 2ODOA 1KM2A 4ZTYA 4KERA 4AX7A 3QV7A 2ZYFA 2VL4A 3KBVA 2XU2A 3EX4A 2AAAA 3TE9A 1GOXA 1LBMA 1W8GA 4A6GA 3N2XA 5KINA 1S2UA 3LYEA 4LH8A 3WUGA 4H6KA 4LRTA 2Y24A 3M4HA 1MDLA 4YL2A 1MDRA 1Q7QA 1PVNA 5BWAA 4K8EA 1WB0A 5J5DA 2OYMA 1J12A 4U4MA 1VP5A 4E38A 2BVWA 2E6AA 3NQDA 3ZJ8A 4KMQA 3FOKA 4FEZA 1BG9A 3W53A 5LA2A 2W63A 3EEGA 3KE0A 1YNPA 4GVGA 3OQEA 3DECA 2C1GA 2JGQA 2VHLA 3MANA 3ME3A 3U7BA 4TV6A 3LQGA 1CB2A 5G2IA 1BYBA 4S39A 2F61A 3C4UA 1C3FA 3AU6A 1OFOA 1ONWA 4V15A 4ZSTA 1A5AA 1HVQA 4QLJA 3S5YA 4R7WA 4CNNA 2XGBA 1GVRA 1RQBA 3AISA 1ZP4A 3MUCA 2UY4A 1T40A 1W9PA 3W27A 2VOTA 3BICA 4WD0A 3ZVHA 5EMMA 1Y5VA 1F6PA 3QBUA 1W3NA 3QY7A 5G2WA 4UFMA 2J7GA 4JFVA 5A8GA 3WN6A 5A6BD 1TV8A 4GYPC 3P8IA 1Y8BA 4B91A 4CLMA 5CZSA 3N1AA 4O16A 1K4GA 3DDMA 3CC1A 4F0HA 4GUJA 1Q3NA 4A3QA 3VGEA 2OLAA 4X0NA 4WGHA 1GUVA 2XM2A 4F0MA 3F5KA 1DQWA 1ICSA 4KW2A 6CGTA 3DGBA 2A0NA 1S3HA 4GZJA 3UW6A 1NFPA 3AXIA 4X3ZA 2WMGA 3AICA 4PB3A 2ZUNA 3CL6A 3W85A 1Z89A 2V30A 3BWWA 3G6MA 3A23A 2HSAA 5H91A 2ALDA 3SRFA 3WO8A 3P5ZA 4JY8A 2X1TA 3ARWA 3GDLA 5DRCA 2PC8A 3WFAA 4QAWA 2Z2BA 5AHLA 4FIRA 3WYZA 1DJZA 4QJ3B 3I10A 4LUIA 4O11A 2FZNA 1OINA 4PSPA 4GUHA 4K8GA 3F5JA 3RM4A 3GDBA 1RXOB 3MZNA 3GX9A 4YVXA 3U3HA 3GO2A 2PPGA 3LU2A 4H9VA 3FS2A 2H3BA 4JCLA 3QZ6A 5FJPA 2J7HA 5HPOA 1VCFA 1EZ2A 3S9ZA 1OX5A 1WA3A 1E4NA 3FW6A 4KT2A 3RR1A 5BXSA 3BLLA 3I6RA 1U1JA 2C8NA 3BOXA 4KWSA 5FI8A 3D3AA 4WHBA 1JJKA 4L4MA 3RDKA 2CLPA 4FF5A 4A2SA 4AF0A 3WD1A 4IJBA 3F5LA 4DF2A 4JTKA 3THCA 3VOFA 3HA1A 1ISZA 1E6RA 4AU0A 3F2DA 3UWQA 3LCFA 4BI5A 2J74A 2I7GA 2YL6A 3H2CA 2CZEA 1KM3A 2ZRYA 3UJEA 4FS9A 3N73A 1UR0A 1RLCL 3JVAA 2QUUA 4O14A 3AU2A 4AD2A 3I3EA 3CASA 3RR4A 1BWKA 4I9MA 2PWDA 3CYJA 1KA9F 3ONCA 4LU0A 4QNEA 1PUDA 3IJ7A 4BK9A 1JD7A 1W1YA 5DMYA 4HN4A 6TIMA 5LXXA 3HN3A 3AYVA 2PLCA 4J2MA 4LUYA 1RK5A 2QDHA 1EJVC 3QMRA 3SFKA 2G3NA 4IP4A 3CLMA 3E3HA 4EAMA 2XVLA 3SCVA 4NG3A 1E1FA 4I7UA 3KX6A 1E55A 5TBOA 3G5EA 1WUFA 4YVPA 1E0XA 3RCMA 1D3GA 1ZU8A 4GYPA 1XYBA 2JALA 3UNDA 3QMSA 1KTNA 3WBYA 5HR7A 1BG4A 4IIEA 4XQ6A 4QM1A 3H4WA 4Z0JA 2ZBTA 2HQAA 4M81A 4WY0F 2X0YA 4CQBA 1CIUA 4HOXA 3BANA 1X6UA 4RCXA 4V27A 1K70A 4C6EA 2UV8G 2X1UA 3T0DA 3E2QA 3F03K 3GTFA 1TA3B 4S3FA 3ZVHB 3CHDA 4GI6A 1RCXB 5I0DA 1VS1A 4QEEA 4XD3A 2VZSA 1R9ZA 3KEHA 2BXYA 1MFUA 2RDXA 1V0LA 2BBFA 4LNYA 1R7OA 4QEHA 2P3EA 4JBRA 1JZ2A 1V08A 2WMKA 3MS8A 4G5DA 2J9YA 1PIIA 2OR2A 1XH2A 3FX4A 1I2OA 1F6KA 2FJKA 3POCA 4ROPA 4XAYA 3U6WA 1W1A1 2FHFA 1KXHA 1UKOA 2H8XA 4I6VA 1VAHA 1RPKA 4EK7A 3ICJA 4IMFA 3PR2A 1MEIA 3APTA 4GI9A 5HJLA 3GTNA 3ZLHA 4C65A 4HNNA 2B7NA 3SGZA 3LUTA 3RAOA 1UH3A 1V5XA 2XH4A 3IARA 3INPA 1OHLA 3GTHA 5HMSA 2GJLA 3L68A 1UA7A 1VFTA 3EGJA 4QG6A 3B0UX 3FAWA 3M1ZA 4M6VA 2C3ZA 1R3WA 1TIWA 1V6TA 2O92A 4UOJA 5AYXA 3FXGA 1BAGA 2VOMA 4Q6JA 3XIMA 3IGSA 4IGMA 3V4BA 5I3HA 4GO9A 1E56A 4MTVA 1Z48A 3FNDA 2XPKA 3TVAA 3EWBX 4AHOA 4L56A 1OT1A 4S2BA 2ZXDA 4PUUA 1FCQA 2WMFA 2ZXAA 5D9OA 4F79A 1E3ZA 3TYDA 4AF0B 3W3OA 2V81A 4DAFA 1ZALA 4CD5A 3H53A 1U33A 4IUGA 3EX2A 2VMFA 3UR7A 1XXXA 3MC5A 5F1VA 3TNOA 4FOUA 3EEZA 5BXPA 3WUBA 4J27A 9RUBA 3YPIA 2X2GA 4CD4A 1CGVA 3CLWA 3GR8A 4NI8A 3LN3A 5AC7A 1G7UA 3VMNA 1HFBA 5F2LA 3M9YA 3I68A 4DXKA 2WMJA 3CWHA 1RVGA 4R5EA 1O60A 2ISDA 2CITA 5FJRA 1TTPA 4F2BA 4E2VA 3L4VA 3W87A 3E74A 1JUEA 2QVNA 4RKAA 3SUTA 3W70A 3FJ6A 5G4WA 2Y8KA 3L2LA 1EXPA 1Q45A 3M0MA 4IIGA 1ZP3A 2BY2A 1TO3A 2W92A 2G3MA 2ISWA 3RMEA 2QCFA 4Y8EA 2XUCA 3E0IA 3HPSA 3N2OA 4UTLA 4HNOA 1POJA 3SQMA 4AIUA 3CS2A 5C71A 4M5PA 1E43A 1Y5WA 1T7LA 2AQOA 4H7VA 4W88A 3CUFA 1A5BA 3MHGA 1CGYA 2ZX8A 4LF1A 1IR1A 3WDPP 2PTYA 3EB2A 1N8WA 3E2VA 3ITVA 3THDA 4KCTA 4YTUA 1PKNA 3E5BA 1R6WA 1GONA 4K1WA 2J7DA 3VCCA 2YBTA 4PRTA 4OUIA 5K9DA 1OCQA 4C1KA 4PH6A 3UCDA 4XV0A 3W1XA 4GUFA 1KRCC 4S38A 2FFIA 3SDOA 4GX8A 3SY1A 1W0MA 1T5AA 3RLUA 4KCUA 2TODA 4JFUA 4LS1A 2Y7EA 1GQIA 3OGVA 4MJZA 4LEFA 1ZRQA 3R4IA 4H7ZA 1F74A 2QMJA 2ABAA 5D32A 1P5BA 3WX7A 1XS2A 3T42A 3R12A 2XIIA 4GVFA 1IXPA 3MSGA 3JR2A 3F2BA 1R47A 4HHMA 4D6JA 3CZLA 1SFJA 3MO7A 2INZA 1QNPA 1ZGDA 3WUFA 3PZTA 1TMHA 3G6LA 3GDMA 1L6WA 1TREA 4IJCA 1O95A 3M0LA 1HTIA 2A3EA 1AG1O 2A3HA 1IYXA 3SGGA 5BOEA 4ZO7A 4E5TA 4PTWA 5FD0A 3AWNA 3PTMA 1LLZA 3N13A 1ZAIA 1FP9A 1DV7A 1WXJA 5AHFA 1UWRA 2WK2A 3USZA 2QUMA 4F2TA 1XGDA 4S3GA 2XIQA 4ZR8A 1PTDA 3AIQA 1C8QA 3SW6A 1NWUA 3IV8A 1YDOA 1LQ0A 4I3GA 4PUNA 4JTQA 1GVEA 4WSHA 2JBMA 1KM5A 5AKQA 3R7MA 1YW1A 2OWXA 1TFVA 4O18A 3WDIA 2WJZA 1A5SA 1UR4A 4ACZA 2ZICA 3S5ZA 2W5FA 1AJ2A 4AEFA 4AHPA 4O0ZA 1OFPA 1B4KA 4JR5A 4C6MA 4IIHA 3LEPA 3N25A 3AHYA 4HJWA 4MY1A 1K9FA 1YNYA 2V8ZA 3KZPA 1K02A 1Q7MA 4JFWA 4KWWA 4HU4A 1RLDA 2QJGA 3DG7A 2Q8LA 1KB3A 1XBYA 4QDWA 3UYCA 4NNCA 1CW2A 3N04A 4MJ2A 3QJAA 3TOPA 1K1DA 3FAXA 2JF6A 2VGIA 5K4ZA 1LG1A 4LBRA 5DY2A 3WJSA 4FK9A 1IWAA 1HL9A 4Q4QA 4O1EA 5DANA 2D0HA 1EJWC 1W5QA 4FP1A 2XISA 1VH7A 5IDIA 1DJIA 4G7EA 1GYLA 3PC0A 1XIMA 2QYGA 2HISA 4C60A 2H8ZA 4K6AA 1ONRA 4JTUA 4W9TA 5DQPA 2X1SA 3F1QA 2B81A 3VD4A 4AZGA 2Z00A 4GBDA 4QBXA 2QJJA 3S2CA 1KCXA 1SQ7A 1BYDA 4K37A 3LI1A 3BZGA 3GC5A 4CEXC 1EGZA 3GYEA 2HPIA 2YA0A 3UU0A 4GUIA 1V77A 3ECQA 2DZWA 2PU1A 4YMZA 1BQCA 4NZ5A 2XSXA 3P74A 3KOZA 2V0TA 3OIHA 4ZL1A 1XH0A 4TMBA 3CPGA 4D1IA 1EHNA 3HQ1A 3WJYA 1MUWA 3W24A 4JHOA 1UWUA 3VKBA 1PWLA 3NZQA 1KBLA 1S3TC 1OIFA 1U1UA 4UIOA 2DZBA 5DXXA 1EA0A 2YLLA 3MI2A 1AA1B 1AQFA 4Q8NA 4ZODA 5IRPA 2GSEA 3BJSA 3O16A 4IXXA 4F0LA 2R9RA 1B30A 3S9IA 2OX1A 3TWAA 4IX0A 2PTZA 2HXUA 4TR9A 1JZ8A 3P5YA 3KLKA 2XIBA 4NXSA 1ZBWA 1QI5A 1TJ2A 2DIKA 4LALA 5I5RA 2ZRUA 2WNNA 4B5TA 1XFBA 2C14A 4Q8MA 4HMCA 4G1NA 3O2LA 2WB5A 1EUNA 4JS3A 2YOCA 4H6QA 1ADOA 3HTWA 8CGTA 4DI8A 2F84A 3GYCA 1HX0A 1YQ2A 4XZNX 4HPHA 3QOKA 1VJIA 3MP3A 1W3HA 1TCDA 4Z1YA 3EXSA 5IHRA 1XLBA 3JW7A 1VC4A 4S23A 5CC3A 2Y7DA 5HNNA 4QHRA 4ZEPA 3EWZA 4GY0A 5AVNA 2IXUA 3HJZA 4IL2A 4KS0A 3T0TA 1EP3A 3G2GA 4WKHA 1AW2A 4YCPA 1CGTA 3OZOA 1E9LA 3KL0A 2I16A 3UG3A 1I75A 1NH6A 1IEQA 1OADA 3CAVA 2CXEA 1IIGA 4E8CA 1Y7VA 3Q37A 2H9AA 4AFYA 4V1YA 1CBGA 2PWFA 3VIGA 5I02A 1IZJA 4B2DD 2ESCA 2QXWA 5HMDA 3W7KA 4NRRA 4NZFA 4W93A 3H55A 4BA0A 4ACZB 2GSJA 4JTCA 3FLUA 2Z26A 4JTLA 1BXNA 3WZ0E 4DO5A 3UR8A 2PLKA 4DUXA 5TIMA 3GNXA 3H2MA 4LCSA 1PWMA 1YXYA 3NVTA 1LM1A 3VABA 3URQA 4O12A 1XL9A 1XRSA 3IJIA 4M29A 3P14A 4MJ4A 3HGOA 4JTAA 3MY9A 5CPOA 4PN2A 1E6NA 2YX0A 5G1TA 4CU7A 1QOQA 2P3ZA 4MM1A 3CMGA 3O9NA 2QCHA 4AZ7A 4DJDC 1FDJA 1XCFA 5CBIA 5I07A 4YCOA 3ARSA 4JX4A 4M8UA 3DYPA 3LDVA 2VI0A 2FIQA 2I14A 5HBFA 3C3NA 3WEMA 2ZX9A 1W3TA 1RCOB 3OHIA 4G7EB 5CPNA 1PAMA 4TVCA 3VTRA 1OD0A 5FF4A 3W1RA 1AW1A 4IFOA 1BWVA 1Z44A 4RL3A 4AY7A 5EY5A 2WC7A 4AH7A 1B31A 3KL3A 1EZWA 2VVNA 2DVUA 1YDVA 4F0SA 4WEVX 4UFLA 2GLKA 4JIEA 1TE1A 4HTBA 4JN7A 3W71A 3VFCA 4CQ9A 3STFA 2J66A 1E0UA 2CFFA 4LS2A 2VURA 1D3CA 4GXMA 2A2IA 3AMDA 4D6DA 3OVGA 1PCWA 3VOJA 1JQXA 1AVAA 2WJFA 4FO4A 4DX3A 3DOPA 3W6LA 4UB9A 3T2OA 3T09A 1ISYA 2Y0FA 1UWTA 3ZIZA 3IS4A 4HTYA 4PMDA 2QUNA 3WNOA 2HE8A 1S46A 4UR7A 1HKJA 3CH9A 3VC6A 4AZHA 1HG3A 4PL1A 4Q32A 4LANA 4XUGA 3WNNA 3P80A 1J9YA 2GJPA 4U2YA 2VRKA 4EPBC 1XH1A 1LWJA 3CQHA 1NQKA 5U4NA 4UMBA 4EF8A 3FHAA 3SZ8A 2Y88A 2VC7A 1JAEA 3N6JA 2ZZ6A 3UJRA 3TN4A 4C1NB 3VMOA 2I57A 1Q2SA 1SSGA 3EXRA 5ECUA 3GU1A 5A8QA 4HK5A 2OEMA 3R2GA 3TYUA 1B90A 4GYKA 1RJQA 1C91A 4GINA 2GJNA 4JTSA 4RXFA 4UQ9A 3S5OA 5KZEA 1PL9A 1GOQA 3ARTA 2PGWA 1ZNNA 1Q5MA 2YGYA 2PDJA 4AD0A 3NSNA 3TV8A 1AD4A 2BNJA 5HNTA 2J47A 5JUVA 1KM6A 2Y85A 2OQYA 3SN4A 1PSCA 1XQLA 4Z2LA 3IIOA 1WXYA 1XPGA 1EXBA 1Q85A 3QHNA 5HAOA 1C9WA 2H9AB 1FQ0A 3AZRA 4DJEC 2E77A 4MVAA 1AJ0A 1VQTA 2YZRA 1SVDA 1KRBC 3L9CA 4DJDA 4PZVA 2D2OA 3UXDA 4JPGA 4ZTXA 1IR2A 2VTFA 2F9RA 1LP6A 4UUIA 3G8RA 4JTHA 2ATMA 5A69A 3WD3A 5REQA 2VR5A 3DKJA 4PODA 1BEUA 4B3KA 1O4UA 3S83A 3U2ZA 4H9ZA 3WMSA 4CN6A 4BY3A 1QFEA 3NO3A 3WLRA 2WMIA 1OG6A 2XWEA 4BKNA 1VIWA 2IKIA 3U4FA 1QI0A 3MU7A 1FP8A 2C19A 3SO7A 1MZRA 1VPYA 3NQVA 2VDGA 3PFRA 4Z2GA 4J3XA 4JD4A 3B9NA 1G94A 1FWWA 1CXEA 4IQEA 2C1IA 2OB3A 4HHPA 4MSSA 1Q7ZA 3WK2A 4PEKA 5ABHA 4CNOA 2XH2A 2DSWA 4NAEB 4JHMA 3EDJA 3MMWA 2WHMA 1IQ8A 3QC3A 5BU9A 1CYGA 4LF2A 3BG3A 3GNRA 1FWBC 1S5NA 3SCNA 1UZ4A 4OQVA 2EBNA 3EWXA 4F48A 1VBUA 1MW2A 3BK0A 5EB8A 1DEDA 1KXTA 2XG9A 3MKCA 3GDTA 2I9EA 5AYIA 5D38A 1LL4A 4PCNA 3V0SA 1QBAA 4B5VA 1W2PA 3B3DA 2ZADA 2VEIA 5AYBA 4HSOA 5AVHA 3WIJA 1ZJIA 3LMYA 4C5ZA 4PCTA 3KBJA 2GJXB 3BLIA 1JGIA 3WFZA 1H41A 2Q8ZA 5M2FX 1W1IE 2VT0A 2ZE0A 3GR7A 1AD1A 1DJGA 4GH1A 1SZFA 1WP6A 5D9NA 3OGSA 2ZUWA 3N17A 1IWPA 3HM7A 3SSZA 3CZEA 3UNTA 5KZDA 4FLSA 1BXBA 4S1FA 3EA3A 1A0CA 5DMLA 5BU6A 1YBQA 3ZQ9A 1IWBA 2PDFA 3RYSA 3NSXA 4GACA 4ZE5A 4DWDA 1GW9A 3IGHX 1EO7A 1DIDA 1KFJA 4LXFA 4A3RA 4IL0A 1HJXA 1MI3A 3OO2A 4MOZA 2YJQA 2XVPA 2E25A 2PDNA 4FNTA 3H24A 1UP2A 7XIMA 3ARRA 4AZ5A 4DJEA 1ZQ5A 1VYRA 3RJYA 5AC4A 4GA8A 3S1WA 1XLGA 2GL5A 4QP0A 3KL5A 1KC7A 3PUGA 1N2VA 4WR3A 3W7PA 4GABA 5HQEA 3UBPC 1W1VA 5I00A 4YNGA 2GQ9A 5FACA 1F8MA 5AOUA 1B3YA 4ZCWA 5JIPA 5KEZA 3W7NA 4BFAA 3CIXA 3ITXA 4IQLA 1FWGC 1YKWA 3VZXA 3KCJA 1OFBA 9XIMA 1E4IA 3TN3A 1BVWA 3O6CA 3NQ2A 1WDWA 2X16A 4K3ZA 3FN9A 3HGRA 3AIRA 2W66A 3CQ0A 2WWCA 2HCVA 3UY7A 3WF4A 1RSCA 1ZCCA 3G0XA 2NXGA 1XGEA 1ZLPA 1Z41A 1CECA 1WKYA 2BMBA 4MIMA 4NJIA 5EMLA 2OYKA 4OBSA 1TRDA 4QLKA 1FDYA 3RX3A 3VD7A 4KWOA 1J10A 5REQB 3ALFA 2VRQA 2GDVA 4S3DA 5HQMA 1UR3M 4WJEA 1XC4A 3B04A 2PDKA 3UETA 3W1PA 7PTDA 1UG6A 2FQIA 2CHOA 3DG6A 1R3QA 1UD5A 3LXBA 1IV8A 3DYMA 2WZIA 3M0HA 1IEIA 2H3DA 3TA6A 5DEZA 1W31A 3CTLA 4QS6A 1J01A 2O9TA 4N42A 3F2CA 3APYA 1GW1A 2BLEA 1K7EA 4A05A 4RZBA 3DHUA 3HJEA 1DWHM 3OW1A 3R8RA 1EP2A 1CLXA 2DQWA 1RK6A 3GIQA 4P2VA 2VX5A 2OWWA 4BJHA 1M7OA 3XINA 3TTOA 4FI4A 3WDHA 1HKWA 1EJRC 1XLKA 4A21A 2RGMA 1GPWA 4NNBA 4GLEA 2BY0A 4B9YA 1UOKA 1XGZA 3RFAA 3UY8A 1WDRA 2VNCA 1DOSA 5HR6A 4E3TA 5HMFA 2GZXA 2C71A 3VMPA 1FX6A 3UWEA 3CXOA 4N2YA 1Q65A 4KEZA 4NKCA 2Z1SA 2Y8UA 5KETA 2GVGA 4W4QA 4NYYA 2DQXA 1RA0A 3H7RA 1IGWA 2VO5A 1WV2A 1KFKA 3ITTA 5JVLA 2JKEA 2X30A 2DZXA 2YA1A 3B9EA 3W2JA 1WAWA 3RLHA 3WQFA 3KRBA 4QISA 1W5NA 2BVDA 1SU5A 3GXTA 3D47A 5IHSA 3WLMA 3DKLA 3D5HA 1CZ1A 3WH7A 1SUXA 3CPRA 1AK5A 3P81A 5CJMA 4A3UA 2ISFA 1YBQB 1GOIA 3ITYA 4XSLA 3U48A 3UZZA 4GFIA 4O17A 5FKYA 3RG6A 1EQPA 3LCXA 3RJXA 1DIKA 4AWEA 5FEPA 1HO1A 1LLOA 1KBIA 2QUVA 4H00A 5FF2A 1L2UA 3OODA 1RUSA 4LT9A 1HO4A 1XIIA 4CEUC 4NRSA 3P0WA 4GI4A 4Z2IA 1JD9A 4E4FA 5EMYA 1KTCA 3WK1A 1DBTA 1XKYA 2HVNA 2DUZA 1TPDA 1XV8A 4CNUA 4PBGA 3DFOA 3KXQA 2ZXBA 3MP5A 2YCJA 4W8BA 1UQYA 2J25A 1IF2A 3GNPA 4ZO8A 3TIMA 5FF3A 3DHPA 3DZ1A 4MNKA 1NDZA 4B5XA 3MMTA 1AH0A 1K6AA 1YEYA 1RJPA 2RJGA 4F0RA 4JKKA 3KDOA 4HMEA 4L6DA 1JPDX 4TMCA 1I4NA 2E8ZA 3QGAC 2E8YA 4DVOA 5D2VA 1U1HA 1QAPA 2AOSA 3UGVA 4PL2A 4RDZA 3NUKA 4DBWA 5IM51 3C52A 3QQWA 1GEQA 5FF7A 1UIOA 1XBXA 2FJUB 3LHTA 2YDAA 3CEUA 4A2RA 3QYQA 5GJNA 1W1ZA 3CHEA 3N3MA 1CXKA 3RN6A 1N7KA 3O3RA 3OGRA 3RO8A 5C9ZA 4EPKA 2V3FA 1YYAA 3SUVA 1XIGA 2H6RA 1GKPA 1YNQA 1XC6A 4AVOA 4B15A 1ZTVA 1AH3A 4DPPA 5TQLA 1J6PA 3ZVIA 4QGCA 2IS7A 3CB8A 3LTYA 2I5QA 3W9ZA 1W17A 4PUWA 3VK5A 4A4AA 1S2CA 4O1CA 2B7OA 3VKAA 4JYDA 3WQOA 2NSXA 1AMYA 4Y9AA 3LLDA 4M24A 2GPTA 4US6A 1LWHA 3M0JA 4PUEA 3LY0A 3PG8A 2G0WA 4LV9A 3C2FA 1VEPA 3C2VA 3EWCA 5HA7A 3CQKA 1ISXA 3N34A 3LHUA 4CN4A 3D0CA 5C0QA 4MLJA 1BSIA 2B31A 4K2SA 5GQBA 1A3XA 1VJSA 1KXQA 2FB2A 3PZIA 1KV5A 3CL8A 3GG8A 4NIRA 4BCEA 3UPWA 3ZJ7A 1ZAHA 1QRQA 3AXHA 1J96A 5CGTA 3C61A 2GWGA 3CAKA 3DFYA 1JDDA 1WZAA 3WENA 4S3JA 1O68A 1OQFA 4INFA 2GUUA 4KFOA 2NSOA 3O7UA 3M5ZA 5ABEA 3W38A 3G1VA 2Q71A 2YL9A 1H09A 3SRDA 3VNYA 3WG6A 4KQNA 4REQB 1CXLA 1J8VA 4JDBA 3RX2A 5L9FA 2BY3A 3IEBA 1ZL1A 1DHPA 1YHTA 5CG7A 1KQZA 1I9CB 1L6FA 3OZPA 3GC4A 4YU1A 4C6NA 3GUGA 3WUEA 4S2CA 1LUCB 5D2XA 2WVTA 3AFBA 5G5IA 5JMUA 1M7XA 4PTMA 2OX4A 4Z2HA 5M17A 2NQLA 1RHCA 3E96A 3AQUA 4HA0A 1K9TA 2DP3A 3C56A 3TQPA 3H12A 4JL1A 3AC0A 6XIMA 1ELSA 1W9UA 5D03A 4AVNA 3G24A 3N19B 2CETA 3USBA 5C9XA 4C91A 2Q02A 1MYRA 1BLIA 1MWOA 4I90A 4MG4A 2Y5JA 3K30A 4HNTA 4B3ZA 4L9YA 1PDYA 1QO5A 1CGWA 4UNKA 1JQVA 4IPPA 2NUWA 3ZOAA 3PN8A 4XISA 2A7NA 1SSDA 1UR2A 4AX6A 3BVJA 1OF8A 3PPHA 3CBWA 2OG9A 3JRKA 3LV5A 3NQFA 3SRHA 3TFXA 2O55A 3NL2A 4PMRA 3LCHA 1GORA 3MCMA 1V7YA 4Q8UA 5A6LA 4H9MA 3RCYA 2DSZA 3BH4A 5EMUA 1W5PA 4L1GA 1FFRA 4IX2A 5DCEA 5CAHA 1EOMA 2PRHA 2R1MA 2F8QA 4KIEA 2PTXA 3AIUA 4S3CA 3UA3A 4XD5A 4GRSA 1IXQA 4JCMA 3NXFA 3CMJA 2GDQA 3WQCA 3PS7A 4FR6A 3EWDA 1J0ZA 2VGGA 1DIOA 4CNTA 5I23A 2Z6IA 4NJJA 4C1LA 3CO4A 1BWLA 4MWAC 2WSQA 2VEKA 3T2QA 4AD5A 4M1BA 2QIWA 4O1DA 3L4XA 5H6HA 1HUVA 2P10A 1SW7A 1XBZA 2YCIX 1V6VA 4HNUA 4GWEA 1S38A 2PDHA 2GVJA 3PZUA 1ENUA 3CWNA 1FCVA 1YMYA 1C93A 1V0KA 3WQGA 5E93A 2QF7A 2J13A 2X42A 3KUMA 3SSJA 3VZZA 3TYZA 3CUIA 4P8XA 3OVPA 3R1ZA 4PUDA 4DB7A 1FHDA 2P5NA 3BMWA 3DHDA 3WH8A 2X7WA 3V5CA 4LTSA 1US2A 3OP2A 4IG2A 3T4WA 3AXXA 2Z7GA 2QPSA 3T2PA 4MKNA 3BLEA 3K1GA 1MQPA 2QPXA 1VHCA 3UJSA 3KVKA 2PWUA 3ZSSA 4ZQCA 2ASHA 3CPUA 2GUYA 1SR0A 4XZHA 2YXGA 4JX6A 3NQAA 3C8NA 5FJIA 2G3JA 4PMNA 2RKXA 4UNIA 1NFBA 4Q6XA 4X2RA 1LORA 2YB4A 4XVEA 3W1AA 1UD2A 3KDNA 2HNHA 3CV1A 2FTYA 1M6JA 1OF6A 4IMDA 4PTVA 2PD9A 2QCLA 2Z2UA 3GBDA 1QI3A 2GGEA 3T40A 3DN5A 3AJXA 1QBBA 1G5AA 4GHRA 3T8LA 1B0IA 1TV3A 2QS8A 4LSBA 1PX4A 2ZA2A 5I3GA 2GFTA 3WJZA 3SURA 3CZKA 3H21A 3FKRA 4L9ZA 1S2TA 3S6OA 1H7NA 1NFGA 3BQ5A 3MQTA 2VC5A 3ABSA 3WDRA 2G3IA 4JIIX 4XZLX 1UJQA 4TUFA 2ZE3A 3P93A 1VCGA 1GWJA 3ZO9A 1UZHA 1QVBA 3M0VA 3LTSA 3WBAA 4D6HA 4US5D 3W23A 2A7PA 3PWIA 4KRTA 3B0VC 4LUJA 2PF8A 4MNLA 1XYCA 1TUFA 2FMNA 4BR1A 1XINA 3HBLA 1FWSA 3DFNA 3CHVA 1EIXA 2ZX6A 2XWDA 3SAZA 1H61A 2CLEA 2E9MA 4JTGA 1GOMA 3UPBA 1N55A 2HXTA 3G1FA 3PJWA 3ANYA 3TKFA 1R46A 1NOFA 1Y0EA 3WNKA 5A6TC 2PEVA 1J11A 4XSMA 1FWIC 4NVTA 3O06A 4IF2A 1GZ1A 2HDJA 2OGYA 5LIUX 1SYTA 4MWAA 2OQHA 1JCLA 3ABZA 4P8WA 3FY1A 1KFEA 2TMDA 5D33A 1W3IA 4ZXLA 2VX7A 2FZBA 4J1OA 2FVMA 4RNFA 1KFCA 1OABA 3S2MA 1XRTA 4GXWA 1J2WA 1WZLA 3IUHA 1UWIA 1PTAA 2V2CA 1ISVA 4JKMA 1EX5A 1TPWA 5BROA 2VFEA 3BLFA 4GVIA 2WVVA 4FNSA 3AI0A 1QTWA 3OIXA 3R58A 5AECA 4O8RA 4F66A 4RDVA 3HV8A 3W00A 3V5FA 3QLDA 4XD4A 1YDNA 2AAMA 1EEXA 3WLPA 5G2HA 3TTEA 5F2IA 4FR1A 2W67A 3CZGA 4C6QA 3KHJA 1BTCA 2NLYA 2OSYA 1DHKA 3TNBA 2HK1A 2DGAA 2D0GA 2QF8A 3UG4A 5A6AA 4GIEA 2C18A 1PZ2A 3VE9A 1A5NC 3VM5A 4J28A 3ELFA 2OO0A 3I65A 2B7PA 3FSTA 1B9ZA 3VNMA 4TX6A 3V18A 1VYPX 3W82A 3EX3A 2GGHA 4J3SA 3ENLA 2BOEX 4IG2B 1VFSA 3UEQA 4OV9A 2XGIA 4XIAA 4HSNA 4O10A 4LAMA 4RW3A 5LIWX 3GM8A 4OOUA 2ZFAA 4JYEA 3MHFA 2PDXA 4PCFA 4Z1BA 2J8TA 3FVDA 1XF0A 2PWHA 2GOUA 1TR1A 5T26A 2NXIA 1EC9A 2OSWA 1XSJA 1OFEA 1PIFA 5B80A 3WNPA 4GCAA 1OK6A 1BVZA 4JTFA 3G1SA 3BLKA 2JK2A 3U2EA 4Z0SA 5A8OA 1CDGA 3BLPX 2D24A 4O19A 1Q2RA 1XLDA 4N02A 2RGLA 2Z7KA 2DSKA 1NJJA 4D6CA 1AUSL 4B9ZA 4FMVA 3N2MA 2XVKA 1GZJA 1H1ZA 2NX1A 4LVBA 2X40A 4PSRA 4EANA 1TWDA 4BQ4A 2O9PA 2IPWA 3AHXA 4KF1A 4XZBA 4EVZA 2PURA 4D6FA 1R9YA 5D8ZA 1T99A 2OODA 3O0FA 3SIZA 2GVLA 1W1TA 2OSXA 2JE8A 2G95A 2PGRA 3NPXA 1A4LA 1BF2A 3GXFA 4L5ZA 3N12A 3REQA 2W6RA 2WSRA 3P84A 4ZSUA 4D8LA 5BMWA 1Z7AA 1HKIA 5E5CA 1Q66A 4A8NA 2WNZA 4Y2WA 2DT1A 4L6OA 4BZYA 3CNYA 3EZ4A 4H41A 2B7QA 4C6JA 4K38A 4RV3A 3EB4A 2HE5A 3HZ3A 3QGVA 2XFWA 4AIBA 1E70M 4MUPA 1XWYA 4HSHA 4E8GA 1PXGA 3V1PA 4JQ2A 3T7VA 5LNWA 2VDIA 3R13A 2HTMA 2QHAA 1GHSA 3RHGA 4X9YA 4Q7IA 1UKTA 4BQ2A 4PUKA 2E9LA 4DO4A 1U2YA 4KEUA 4AUBA 2V6AA 2I9UA 1KGXA 1KLYA 2BODX 3DFQA 2QJNA 1X8CA 1K8YA 3LPPA 2WBKA 3PF3A 5E09A 1Z6KA 3STPA 3DFTA 1NOWA 2QEZA 1WDQA 3KBMA 2VFIA 1YLVA 3W2MA 1QU4A 2FVLA 2J6VA 4H83A 4KESA 3SQSA 1I1WA 2YBUA 4ZQRA 1QT1A 5IBXC 3B8DA 4DBEA 1GVIA 4I9JA 5A6KA 1CNVA 1M1BA 1XLJA 3ZR6A 1G7VA 1JZ7A 5FAGA 3GVRA 2G8ZA 4O15A 5CSUA 4IIDA 5BXRA 3T05A 3N9KA 3PPFA 3AMLA 2CZVA 2W4XA 3W74A 5BOFA 1VRDA 4PBEA 3P0XA 3AIEA 2RDTA 4AYGA 1EC7A 3TEVA 1KM4A 1PTGA 5EBUA 1G4EA 1V79A 3AIBA 3B06A 4R33A 3ORWA 3PULA 4KWVA 5F4WA 4HA4A 3SM0A 4X22A 2WCSA 3BW2A 2V9DA 1MW1A 3A47A 2V2DA 1JF5A 2AL2A 2PB1A 1H3GA 3NPVA 1I2PA 4UQDA 5KTLA 3MKVA 1I60A 4M7TA 4ZENA 5CPQA 3EPMA 2VFHA 4I9TA 2QLYA 2GGGA 4GIAA 5CSSA 7A3HA 3NJ3A 4JDYA 4IP7A 3NOEA 2Z24A 2E6YA 5HPCA 4LGXA 4DN1A 2OZ0A 3H7VA 3GW3A 4UQAA 3T8QA 4DAIA 1CXFA 1U30A 4L4PA 1MNZA 2C15A 4AVFA 4CD8A 4JFSA 3QZEA 3C2EA 3KHDA 2CWNA 4DQWA 2VFFA 1OBAA 1JG9A 4ZVJA 2XFFA 3AZSA 3NOYA 1Q8AA 4OJYA 3THQA 3QF0A 2Q01A 4MPKA 2O9RA 4P5UA 4Q4SA 1ESWA 2J9XA 4EPDC 4WLCA 1QPQA 3CMFA 1B5TA 3FA5A 1RALA 4N9BA 1MRQA 3Q2DA 3GVGA 4U3AA 1JFHA 2YCLB 5FAJA 3HMCA 4J3WA 2W61A 3FHQA 4LYKA 4YVVA 2C16A 1XRFA 2IKJA 3IK4A 4IIBA 1MRAA 3GXMA 3OHMB 1U5JA 3SBFA 3S5NA 3W1TA 3F7JA 4EWND 2F7FA 5LNUA 5E0CA 2OVLA 3URAA 3W1UA 3T1GA 4BQ3A 3EKGA 3S46A 1YTEA 3WDJA 3QW3A 1CI1A 4QG9A 2ZUMA 3W22A 3OTRA 5DX7A 3REQB 4OE7A 1VZWA 4TVUA 4C6KA 1EC8A 1NSJA 4TVDA 1R3RA 3LSBA 3L0NA 3CIVA 4Q8WA 2DVXA 1WCGA 2DORA 3BE7A 3RU6A 3PBWA 5FL1A 1GK8A 3H2NA 5I7GA 2PI6A 2WO5A 4C6CA 3KP1A 1T8QA 2ZUSA 2E40A 5MF5A 3LI0A 3VDHA 3UWWA 4G9PA 3UZ5A 1EDGA 3GQYA 3WELA 5IBXA 4PYSA 2NV1A 3IVSA 1DORA 4N4QA 4Q8TA 2PGEA 5DLCA 3F4WA 3CK5A 4EKJA 3CT7A 2Z1VA 5AC6A 4O57A 3CGTA 2HMCA 4S3KA 3WBEA 4EXQA 3N6HA 2R8WA 3AIVA 3HQOA 3W81A 1AMKA 2YCKX 1VFHA 5DFAA 1F4AA 4DWSD 2XN2A 3OVQA 4XBSA 2IW0A 1F3EA 1A4MA 5TNVA 1VFFA 1VD6A 3B8SA 2NQ5A 3W2KA 3VCRA 1GJUA 2DJLA 3GFXA 2X09A 3S1UA 4NAFA 1JPMA 1PHQA 3L12A 1B4EA 3I7QA 4A8IA 3NYZA 2SFPA 1G9HA 3QC0A 3EXTA 4GGBA 1XYFA 3TTSA 3EAUA 3S4TA 4HK6A 5T9BG 4P61A 4V2XA 1H7WA 2VX4A 3CWOX 4WDWA 3KTXA 1TKKA 2X41A 4L64A 4MHBA 4ORMA 3GKAA 4Q4PA 1UUMA 1D7FA 2AMGA 1UROA 4UTUA 5LHFA 3GS6A 3JZUA 3ZXWA 4UQBA 1AH4A 4QITA 2AL2B 3LZ5A 3B4UA 2OZ3A 3TROA 3VGGA 3QVQA 2IQTA 2ONEA 3QV6A 5ABGA 1CENA 4ERAA 4UNLA 1VENA 2P76A 3WQVA 2CC0A 1JYVA 3RPTA 1B3VA 1ME7A 2VGBA 4NSBA 4IXHA 1OYBA 5G1YA 3TYAA 3KBNA 3WNLA 5DMNA 1H51A 1J0KA 3FJ4A 1E1CA 4JTTA 3Q65A 3EDKA 3MI3A 1Y5XA 1ECQA 1W37A 3TJ4A 9CGTA 1XIDA 1QATA 3BSMA 3OG3A 3OLDA 5C8BB 1KD0A 4ZQOA 3M0XA 1BYAA 1HP5A 1CCWB 4HA1A 5AZ0A 5U7SA 1R2SA 2BY1A 3UZWA 3HG4A 5FEXA 2J75A 3AUJA 1XKJA 3DBPA 3HQNA 4DXXA 2MUCA 3QYSA 3HQPA 2OEKA 4XZIA 1P0EA 3MBFA 1BHGA 4XZWA 2YXXA 4J40A 4UTFA 1OX6A 3LHVA 1J93A 2VEGA 4MKSA 1XFCA 2OZ8A 4UCFA 4XKMA 1NAL1 4LJ3A 3T08A 2PFHA 3UGRA 5KMYA 3AHVA 4TU1A 2HBVA 3ARUA 3BMXA 1DQXA 4LC8A 2PP0A 4WCJA 4C6BA 2HROA 3MKKA 5XIMA 3UR2A 4UXDA 4M6PA 3EBVA 5BRBA 1SFLA 2X8RA 5I3JA 1YE4A 4PB5A 3GKFA 1QNOA 3RPDA 2BHUA 3GBEA 3UZXA 1L8PA 5H8UA 2GVYA 2W27A 3OLGA 1F2JA 4P7RA 1B3XA 1YDYA 5LIYX 3SB0A 1OSEA 2DU2A 3L0KA 1GG0A 4HYVA 4U2ZA 2Y5SA 4PRRA 1EH9A 1GVYA 5C5YA 1UMYA 1N8FA 3JZEA 2D23A 4ML9A 3N4FA 5EPDA 2J7EA 2XIMA 1DWGM 4JICA 2WC3A 3LENA 4MGGA 1UKPA 4JGDA 1JDAA 1XYLA 2YXOA 5C6MA 1CT5A 3PZOA 5A6JA 1MZHA 3F4DA 4NAFB 1RR2A 5CCZA 5ECVA 1GQJA 2CPUA 4DELA 2CHRA 1C9DA 3MTWA 3HU7A 1OC7A 3FJNA 4E4UA 3HV9A 2DY3A 3DUGA 4Y9NA 1TA3A 4DBDA 3LD5A 2A85A 2NQHA 3F4VA 3IAPA 1VEOA 1LOQA 2F2KA 3W84A 3ZWSA 2VP8A 2Z1WA 3HFYA 1OYCA 4OIFA 3VIFA 3WKZA 3SY5A 4HA3A 2IQ0A 3OB8A 5AHNA 3B8UA 1KR0A 4UWMA 3TSMA 2HWGA 3MUIA 1Q4WA 3PJUA 3WBXA 3GDKA 4LYPA 1KTBA 1EGVA 4M51A 1GPFA 4Y6GA 4FXRA 4EPEC 1TB3A 3FJLA 1UC4A 2OWCA 1TJPA 4L9XA 1WAUA 1E1CB 1LRQA 2EG6A 1YX1A 3A5VA 1QUMA 2JIWA 1M01A 2FH8A 4UQEA 4MPQA 2Y8VA 1PDZA 3PBGA 1H1YA 1KV8A 2OEJA 2WQPA 3DFSA 1BRLA 4GX9A 5CG0A 1P48A 1FRBA 2P0IA 2PS2A 3SIMA 1RBLA 2QV4A 2VC9A 2D2GA 3TN6A 3UA4A 4ASTA 1G6CA 3B8VA 2YDQA 4P7LA 4W89A 4ERGA 2CLKA 2TRSA 2Z28A 4HU0A 3R6IA 4HOWA 1J0HA 3G0SA 3OA3A 4PTNA 3M46A 1UHVA 4LX4A 4EAYA 1TX0A 3IJ9A 1XX1A 5FSDC 3VIHA 4HQVA 4KH2A 3RLGA 4EACA 1BF6A 5KSWA 3RLVA 3MCNA 4HNVA 3GHSA 1MXSA 3K5XA 4F0KA 3O15A 3UCQA 1A47A 3ALGA 3C8FA 3EOUA 1NWSA 2WWDA 3FK4A 4NUWA 4L7ZA 4WX2A 4LQ1A 1QNQA 4D2JA 1OEPA 1X38A 2ZA3A 1UD3A 1H62A 2O4MA 1HKMA 4UR9A 3SJ3A 5HDRA 3VCNA 3CT2A 4E2DA 4QDPA 1JL8A 4MMWA 1U83A 4L61A 3ZSTA 3KVLA 3E0FA 3F4CA 1RY0A 1X7FA 1GQLA 5D2WA 2NVAA 1MW0A 1V4YA 4IUOA 3AS2A 3CB3A 1ME9A 1SW0A 4CQ8A 1TV5A 4HZ7A 3KTCA 3A3HA 4YJ5A 1O1ZA 4WDTA 3LPGA 1KWGA 2VZUA 2CYGA 1JI2A 3GTIA 3CZ8A 1W3LA 5HUOA 2UY2A 3VU2A 4UFHA 1TYGA 2DUXA 1OCNA 2PDWA 1MUMA 3U7VA 3HURA 4CGTA 1SO6A 3NPWA 1B9BA 2ZVIA 4M0XA 5E6YA 2HJPA 4AYSA 4ERIA 3WQ4A 4ATWA 4B3LA 3DHFA 4PR4A 4GJ1A 3N14A 3MBDA 4MNJA 3W7LA 3NDYA 3UCCA 2YR1A 3FGCB 1XIFA 1A5CA 3MSRA 4JTIA 1TG7A 1E5JA 2WZHA 4ZB0A 4DYKA 2NQZA 3LQLA 4UMCA 4E8DA 3HG2A 1Q6QA 3VD3A 4H3DA 5BRPA 2QULA 3IJQA 1DIEA 4GY7A 3EA2A 3VINA 4DYEA 4YYCA 5IXEA 1PYMA 2Y61A