4DI9A

Crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
293
structure length
293
Chain Sequence
LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLKRLVDDAPKDKFLEVAGRLPAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTAWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 2-pyrone-4,6-dicarbaxylate hydrolase
publication title Structure and Catalytic Mechanism of LigI: Insight into the Amidohydrolase Enzymes of cog3618 and Lignin Degradation.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
total genus 98
structure length 293
sequence length 293
ec nomenclature ec 3.1.1.57: 2-pyrone-4,6-dicarboxylate lactonase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4di9A00
3LU2A 1FWHC 3B0XA 1GKQA 3TN3A 1UIOA 4XD6A 2WJEA 5FSEC 4QSFA 1V77A 2BB0A 1NDWA 4OFCA 4DIAA 4ERGA 1KRMA 3GU2A 4TQTA 2W9MA 4ERAA 4BJHA 4DZIA 4C60A 2D2JA 2YB1A 1O12A 3URBA 1PSCA 3DUGA 4GY1A 2VC5A 2HBXA 1PB0A 3E38A 4C6EA 3TNBA 3QGKC 1I0DA 4GX8A 4HA0A 2DVXA 1A5OC 4IG2B 4C6NA 4LCQA 2WM1A 2XIOA 4B3ZA 2WJFA 1XWYA 3S2JA 4DZHA 4H9MA 2FTWA 4IF2A 4HK6A 3ITCA 2OOFA 4H9YA 2KAUC 1RA0A 4QS5A 3FEQA 2GOKA 2YXOA 4B90A 3TN5A 3FDGA 2DVTA 1EJUC 2EG8A 1FWGC 1J6PA 3PNZA 4EPBC 3F4DA 4LEFA 1RJRA 1QXLA 2Z2BA 3OOQA 3MSRA 3N2CA 4KIRA 4GOAA 1FWEC 2EG7A 2Z24A 2GWNA 4LAKA 4LCSA 4I6VA 4IH3A 4XAZA 4NG3A 5G4HC 4V1YA 4LH8A 3GU1A 4CNSA 2QVNA 4DO7A 4CEUC 1K70A 3GTFA 4ZSUA 4INFA 1XRTA 4H01A 4IQJA 3FDKA 1KRCC 4BKNA 4EPEC 1FWCC 1PTAA 3S4TA 3MDWA 1J6OA 1K6WA 1A5LC 2OGJA 2GWGA 4GY7A 1FWFC 3PNUA 4G7EA 2R1NA 4RDZA 2UZ9A 3GTHA 1FWJC 4F0RA 4NI8A 4XAYA 1GKRA 2AMXA 1ONXA 2FVKA 3MPGA 4CQBA 3OU8A 3HM7A 3F2BA 4C6PA 2O4QA 3CS2A 2YZ5A 1EJWC 2P53A 3IPWA 3IACA 4RZBA 3WMLA 4XAFA 1O5RA 3LSCA 2Z29A 2AQOA 2VHLA 3UBPC 4KESA 4C6KA 1EJVC 1VFLA 3GIPA 4F0LA 1ZZMA 1NDYA 1K1DA 4C6BA 3LY0A 3S2NA 3TN6A 4H00A 3GIQA 3QY6A 3GG7A 2BGNE 4GY0A 3B40A 4GX9A 4C65A 2E25A 3LNPA 2PAJA 1M7JA 2D2HA 2ANUA 4H9VA 3EGJA 1WXZA 4KETA 3QY7A 2E1WA 4KQNA 2HPIA 2I5GA 3DCPA 4IFKB 4R88A 1YRRA 1P6BA 3V7PA 2VC7A 2ZC1A 4HK5A 3LS9A 3SFWA 3A3XA 4KEVA 1R9XA 3GU9A 2HQAA 1FWAC 1HZYA 1EJRC 4C6IA 1PO9A 3LGDA 1YBQB 4AQLA 3JZEA 3O7UA 3OVGA 2OQLA 2DVUA 3S2LA 4Z42C 4CEXC 1P6CA 4PCNA 2O4MA 3OJGA 5HMEA 4EPKA 5AKQA 1KRBC 3IARA 4PCPA 4IGMA 2UBPC 2P50A 1ADDA 3WYZA 2OB3A 1KRAC 1YIXA 2FVMA 4RE0A 1FWDC 4RDYA 4L9XA 2Q01A 1NDZA 1EJTC 1V7AA 2Z2AA 5HMDA 4EP8C 3NEHA 2FFIA 4J5NA 3KM8A 2HNHA 4CQCA 4DI9A 4R85A 3OQEA 1EZ2A 3URAA 4H9UA 1ONWA 4QROA 3E2VA 3PANA 3F2CA 3T8LA 3NQBA 1YMYA 3GTIA 3T1GA 4UB9A 4GC3A 3LA4A 2D2GA 1EF2A 4B92A 3K2GA 3OODA 3MTWA 2YB4A 2I9UA 3QY8A 4H9XA 3URNA 4C6QA 1FWIC 3R0DA 1R9ZA 1JGMA 3WZ0E 4KERA 3E3HA 4HJWA 4PBEA 1DPMA 1RK6A 3AU2A 5CH9A 4H9ZA 4KEUA 3URQA 4LAOA 1J79A 4B91A 3GTXA 2HPMA 4LFYA 4LAMA 4CNTA 4C6DA 4C6CA 4C6MA 2VM8A 1S3TC 2ADAA 1YNYA 3MJMA 4IG2A 2AQVA 3S2MA 3HTWA 1NDVA 1XRFA 3B0YA 3ISIX 4C6JA 1EJXC 3GUWA 3A4JA 2QS8A 3A3WA 2CZVA 3IGHX 4QS6A 2GZXA 4DLMA 1RJPA 3LSBA 1POJA 2QT3A 4R7WA 3RN6A 4G2DA 2Z25A 1RA5A 4PBFA 3C86A 4DLFA 4C6OA 4G7EB 4QRNA 3MDUA 3UPMA 2QPXA 2VUNA 2Z27A 4C5ZA 1M68A 3UR2A 3EWDA 3K4WA 3F2DA 3PBMA 4GXWA 4L6DA 4D8LA 4LCRA 4XD4A 1A5MC 4LALA 4XD3A 4DNMA 3MKVA 4KF1A 2Z4GA 3NURA 1KCXA 4GBDA 3G77A 3MVIA 4JOMA 5LXXA 3T81A 4C6LA 1V51A 2VR2A 3CJPA 3E0LA 1A5KC 3RCMA 2RAGA 3RHGA 1V79A 3ICJA 1FKXA 3IRSA 3IJ6A 1WXYA 2PGRA 4HK7A 2PLMA 1RK5A 1ITUA 3CAKA 1A5NC 2Z00A 3TN4A 1XGEA 3PAOA 4C5YA 4KEZA 4V1XA 4P5UA 1E9YB 3RYSA 4ICMA 4F0SA 3UR5A 2R1KA 1P1MA 4YIWA 1EYWA 3K5XA 4GZ7A 4M51A 4WGXA 2GSEA 1RJQA 1UBPC 2PGFA 4IFRA 4J35A 1FWBC 4PE8A 3GRIA 5E5CA 5HMFA 4J2MA 4WHBA 4E3TA 2F6KA 4IGNA 4CNUA 4QTGA 1RAKA 3LGGA 1A4LA 4DYKA 3D6NA 3ID7A 3IV8A 1GKPA 4DI8A 1W1IE 3AU6A 3O0FA 2Y1HA 4XAGA 5FSDC 2A3LA 4H9TA 1BF6A 2OODA 2R1PA 3ORWA 3HPAA 4ZSTA 2Q09A 4BY3A 3F4CA 2HBVA 4WVXA 3E0FA 2Z7GA 2FTYA 1M65A 3DC8A 4CQDA 2R1LA 3UF9A 4EPDC 4LANA 4ERIA 1E9ZB 1A4MA 3QGAC 4GYFA 1R9YA 5A6TC 1V4YA 3AUOA 4NP7A 1I0BA 2EG6A 1J5SA 4IFKA 2R1MA 1POKA 3EWCA 4XD5A 4RDVA 1NFGA 3BE7A 1UIPA 1ITQA 4UBPC 4I6KA 2G3FA 4AC7C 3SO7A 4MUPA 2IMRA 2Z28A 4IFOA 1QW7A 4C6FA 1IE7C 1UMLA 2PUZA 1FKWA 2ICSA 3MVTA 4GK8A 3E74A 1YBQA 1EJSC 2Z26A 2WJDA 4RDWA
chains in the Genus database with same CATH superfamily
2VEMA 1NU5A 1FP9A 1TA3A 3KTXA 4M81A 3SY8A 3GNXA 3ZM8A 2JALA 3REQA 2F9RA 4JQ3A 3OZYA 2ZA3A 2XGZA 4QISA 5G4WA 2DJXA 1GZ1A 1FWRA 3M0IA 4HPHA 4E38A 1RD6A 4WY0A 3HG4A 4DB7A 1SFSA 5CSUA 1O12A 3NPXA 3GFZA 4NNBA 4ZE5A 1H4PA 3ITYA 4GFSA 4ROQA 4GH1A 3OYZA 4HCDA 4AY7A 1EXBA 1SUXA 2AAMA 2WMJA 1KBKA 3CUIA 1EDGA 4AIUA 3NDYA 2O9PA 2XFYA 4Z1CA 3TN5A 3UYIA 4R34A 1IWAA 3SCNA 3W1XA 2FPVA 3NWRA 3CTLA 1EC7A 1SZNA 4JX4A 1C8QA 1E5NA 2HK1A 4XO6A 4KT2A 1RY8A 1KLZA 1KR1A 3G0XA 1SW7A 2YCEA 3TFXA 1ECQA 1EBGA 3QQWA 1VB9A 4JFUA 5FL1A 3MO7A 1S2VA 2A3BA 1UWSA 1QBAA 3VPLA 1W37A 2HE8A 4JTAA 3O1NA 1XFBA 3DYMA 3MCNA 3PFMA 5FESA 4IQJA 2PDKA 4JCLA 1HJWA 3OIXA 3QW3A 4TTGA 2MUCA 1XYCA 1N82A 4ZQOA 3GC5A 1XIHA 3FHAA 2DSWA 4HZMA 4EOUA 3GHSA 1P0BA 2XTKA 1P43A 1IR2A 2UZ9A 3YPIA 3WUEA 2IQ0A 1ZLPA 3STEA 5DMMA 2WVVA 3CZGA 1DL3A 1W3JA 1RP9A 1HTIA 1L8PA 4HTBA 1RCOB 2ZDRA 3P14A 3VCRA 4LS0A 1CGYA 2NW0A 3QFWA 1EKOA 5EBUA 1V08A 2HK0A 1J96A 3QGVA 4MG4A 3UGRA 1ZUAX 2HSAA 2HISA 3DBPA 3SDOA 2GDVA 3QKEA 2CYGA 3TN6A 2SFPA 3GIQA 1KM2A 4P61A 1F05A 4FSAA 1AQ0A 2WSYA 2PTZA 2B4GA 3I7RA 5C7VA 3WQGA 3R4IA 3RCNA 1CDGA 1Q6FA 2A1YA 3DFHA 2NV2A 3UESA 2YLLA 1L0PA 1J2WA 5D2WA 1KXTA 3FYPA 4YTTA 3ZJ6A 2VX6A 1W32A 2R14A 4M24A 4GUIA 3VIPA 2CHOA 2PTYA 5HA7A 4M19A 4KWWA 4QNEA 3DG3A 1CT5A 1W5QA 5CBBA 4MNJA 4D6JA 2Q6ZA 3BURA 5AFDA 1I1WA 3BL3A 4MADA 2ZC8A 2HRWA 2LLEA 1GVRA 4JFWA 1X6LA 2G37A 1X1ZA 4DJEC 2OWXA 5I0DA 3IARA 3MZNA 2J27A 3M16A 1LOSA 3O6DA 2AOSA 3PPCA 1EL3A 4FNRA 4H3DA 1REQA 4RDYA 1GVSA 3WH8A 4D72A 1OFDA 5AC7A 1K7XA 4A21A 5A8GA 4Q4QA 2O56A 4LQ1A 3ARQA 3DKJA 4H9UA 3RUBL 2VKZG 3OZPA 3EB4A 1HG3A 3M0VA 4JYFA 1QTWA 4IPPA 3F2CA 3VUSA 1IWBA 3N3MA 4JTJA 1DXIA 2CW6A 2AKMA 2NQZA 4OVXA 2WCAA 4HA1A 4PBEA 1TWSA 4ATWA 3URQA 4MVAA 1SZGA 4B91A 1CI1A 3RO6A 2WMIA 4J3TA 4DAIA 3WD1A 2OZTA 1VFOA 3GO2A 2FGZA 2FPTA 3S1XA 5TF0A 5FJUA 5KSWA 3QR1A 4RLIA 1UR4A 3RJYA 4XSLA 5C9XA 3S9IA 3PUOA 3U2OA 3H70A 4JTKA 1EGZA 3EWXA 1DWFM 2Z1SA 3SBFA 1ZQ5A 1Q7ZA 2PBGA 1J93A 4WLCA 3S5YA 1PIGA 5FEXA 4TVUA 1FX6A 2C71A 3XINA 3WBWA 1YPFA 4AX6A 3JUGA 3P8IA 3IIXA 4LALA 3FLUA 1M04A 4R9OA 3MT1A 2W66A 3RPDA 3L4YA 3PBGA 3BO9A 2E5BA 5I3IA 2E5CA 2C14A 2VJXA 4J40A 2ASHA 5DLCA 3VU2A 1PPIA 4AYSA 4FHAA 2PLMA 4RJEA 4KWOA 5DT5A 4O1DA 4S1FA 3BLIA 4HPXA 2QGYA 1CXEA 3GHRA 1H7RA 1V3KA 2NT1A 2XDFA 3K8LA 4ZR8A 3NM3A 1RJQA 3UWUA 4OBRA 1FP8A 1VRXA 2PGFA 2A0NA 2J8GA 3P81A 2CZ5A 4XTDA 1HJSA 2Y7GA 3O6CA 4FMVA 3N15A 3W28A 4IT1A 1YXYA 3H55A 3GK0A 4E2VA 3AYTA 3ZWSA 2QXWA 3LV6A 1OWQA 4BR1A 3QN3A 4AWEA 3NR0A 2UY3A 1IXNA 3VOIA 1Q6GA 2A3LA 4DO6A 2YBUA 4S3JA 4NXKA 1BXBA 3N4EA 5BWAA 3VIJA 3LEPA 1QUMA 1ONRA 4H19A 3QQ1A 4JN6A 4EPDC 3LTSA 4CCDA 3VC5A 4W7WA 2QUUA 3ME3A 3XISA 2AAAA 4OOUA 2A7RA 1I2OA 4AHQA 2D2OA 1NFGA 1E15A 3UWWA 3FKKA 5TIMA 2G3FA 1B9BA 1G7VA 4C6FA 4J7RA 4IMFA 1H5YA 1UMLA 2VCBA 4MOZA 3A24A 2VFEA 4CN4A 3P60A 2WJDA 4RDWA 3MYOA 3LU2A 3O06A 2DUAA 2JFEX 4H1ZA 3GXDA 2V9DA 3MUAA 3Q67A 1PX8A 1VBGA 4N4PA 1UA7A 2NX1A 2PTXA 4A8IA 4M5PA 4X0VA 5CJ5A 2HROA 3MWAA 4BJHA 4PGLA 3DUGA 1OZMA 4PRRA 4C6EA 1K02A 1UQYA 3WF3A 3RIKA 3UCCA 4ZE4A 3N34A 1GVQA 1EJ7L 4DM1A 1C7SA 2OOFA 5HINA 4K8GA 1JQXA 1LORA 4AWUA 1GHSA 3HGOA 1HVQA 3KOWA 2BODX 2FJUB 1H63A 1KTNA 1F8IA 2AGTA 1DQXA 3VTRA 1LQAA 3SADA 3OOQA 3HN3A 2DUZA 3U7BA 4DJED 2NXGA 3AQUA 4Q8OA 4ZFMA 1MXSA 1KW1A 2IQDA 5GJNA 4PZVA 4DEFA 3VNZA 5DBTA 4OWGA 4XAZA 1BWVA 2BVDA 4WJEA 4ADSA 2NSOA 4DN1A 1E6XM 4MNKA 5A2BA 2ZTKA 4Q4PA 2IXVA 2OZ8A 3PM6A 4RCXA 5TBOA 1ISYA 3S4TA 1J6OA 2GLKA 4FNSA 1XS2A 2WKLA 3A47A 1FWFC 5C8BB 2B81A 4TX8A 1IEXA 1UUQA 4OIFA 3TNOA 1E3ZA 4PTDA 4MDOA 3OHIA 3W27A 1KFBA 3TYUA 2YZ5A 2W3ZA 3WH7A 4OHQA 2ZUTA 2YSWA 4DYEA 5HR7A 3LBOA 3WMLA 4Z1AA 1O5RA 3KFTA 4LYRA 1Y65A 3CU2A 2WZTA 1EX5A 2F7FA 1KM1A 4W5UA 4WGHA 3W22A 1VCVA 5AN7A 1C90A 1GOXA 3H2OA 1IIGA 2VURA 1J0JA 4JXCA 1UWIA 3QM3A 2Y85A 2YLAA 2INZA 3TC6A 2XGBA 1I45A 3VM7A 3H6OA 4KCWA 4H8HA 4QJ4B 1KC7A 1EIBA 5AHNA 2WOQA 4ASTA 1QHZA 4ZENA 1GVEA 5F2GA 5H91A 1JDEA 1QR7A 1US3A 1WCGA 2ZC1A 1MZRA 3CHEA 3P5YA 1NELA 1JD9A 4D6GA 3P80A 2VDHA 4UFJA 7A3HA 1EUAA 3K8MA 1N8WA 3HPXA 3GYEA 3U4FA 1AL7A 3N6HA 3WDHA 5BYWA 1FH8A 1JRCA 1MEIA 1I60A 3ZVIA 1UC5A 2PI6A 2ZX7A 1D7FA 2V67A 3KBSA 4DM2A 1V7AA 5EMLA 4ZOEA 1MYRA 2ZADA 2ZIDA 1DIKA 2DZTA 3WO8A 4F0KA 3L7RA 1W31A 1PE1A 5I3KA 2O9RA 3NQCA 4R5EA 5ABTA 3K4DA 1XKJA 3C2VA 4OKDA 1TV2A 2XYLA 2BXVA 3LLFA 3CHFA 3TR9A 4B92A 3STGA 2YB4A 3L23A 3W25A 4C6QA 6CGTA 3LXAA 1S5MA 1UR1A 1Z48A 3P5ZA 5G2IA 4LVDA 3A4XA 2CLOA 3CAWA 2Y0FA 3LDVA 3OLIA 3I68A 1XR2A 3VKKA 3WF0A 1R30A 2CU0A 3T40A 4IG2A 2JIEA 2C1HA 3BJTA 5I2UA 4JTTA 3HIJA 5A8NA 3VOHA 3ISIX 1XLAA 1XPYA 4C1NB 4UNKA 4AWSA 1V7YA 3M0KA 4DLMA 1OABA 1XLJA 2QT3A 2OT0A 2JF7A 3M41A 2Y5JA 3VMNA 1O5KA 3C61A 3C86A 4H2CA 1R5YA 4X3ZA 1IXOA 4P7RA 3H4XA 3BQ6A 3TTOA 1XX1A 3W9ZA 3DESA 1GOQA 4JX6A 3BAIA 3WNLA 3NURA 3G1XA 4O28A 3H7VA 2CLHA 5LXXA 1CENA 2C15A 1UOZA 3L4VA 4FAMA 3AMDA 3P8JA 4JBRA 3EEZA 2GL5A 3Q65A 3W73A 2A3HA 1GUVA 1G6CA 1A5NC 3AHTA 4L64A 2E77A 2I5IA 3W0KA 1SFJA 3NPUA 1Z32X 2QHAA 3RAOA 1H49A 3VCNA 3MV01 7REQA 1XKYA 4IJCA 3IIVA 1WDDA 2A3AA 1OEPA 2EGZA 4HPNA 4UFKA 4CNUA 2JF6A 1A4LA 1SR0A 2QCLA 4L7ZA 3LPFA 4PB5A 4NJHA 8RUCA 3WQFA 3NQ8A 3V36A 3GYCA 3IVSA 3TR2A 1RVGA 1R7AA 4W93A 5I77A 2GQ8A 3KRBA 4EAMA 4ZSTA 3N6QA 4K6AA 1LM1A 4P8VA 3TCSA 1SO5A 2ZRXA 3G1AA 2PC4A 3BG5A 3MCOA 1JDFA 1R9YA 1ZNNA 2EG6A 3TA6A 3TQVA 4GYPA 1KV5A 3L68A 2GGIA 4PSPA 4DNHA 1MEWA 3BMXA 1C93A 3I6RA 4XD5A 5C5YA 4B16A 1UIPA 3PK7A 5KZ6A 4MB5A 2V38A 3F1QA 5KITA 4RE2A 4K7YA 4KBXA 3TYEA 1QASA 1W1PA 1UZ1A 3A13A 3QSTA 3E74A 2ZUWA 5DRIA 2GJRA 4JHMA 3W87A 2V2HA 3L0NA 3VD9A 1Y7VA 4U5IA 2PZ0A 3MSGA 1XYFA 4AVOA 4WSHA 4ERAA 2W67A 1W1B1 1KXQA 4ONVA 4M6UA 1BPLB 4YWIA 1RUSA 1PSCA 4JTRA 5BCAA 3OG3A 3AZTA 3B4YA 1GK8A 4BS0A 4DBUA 3LERA 1JVNA 2XUCA 4I9AA 5A8PA 4O4WA 3R8HA 1VIWA 4OGZA 3ES7A 3SFKA 9CGTA 4PTVA 4ZO8A 4HA3A 1OCBA 1W6TA 5FEWA 2BY1A 2Q3OA 3NQDA 1PZ2A 3DH7A 4GA8A 4RPQA 3F4DA 1MW2A 3IGXA 3HFTA 1UB3A 2AL2A 3DBNA 4Y9AA 2XM1A 1XIIA 4RL3A 5BXSA 2WQDA 3A5VA 3WMCA 1XIDA 3T78A 1GW1A 4YHEA 4I7WA 3UZ5A 2VVNA 2YJQA 1W8SA 4I6VA 5G4HC 3OGRA 5IRPA 2Y8UA 3I4EA 4LV9A 2VYOA 5U4NA 5F2MA 4F2UA 1BF2A 4GJJA 4LRTA 3EKZA 2IKJA 1GPFA 3PJUA 1UG6A 4QEEA 4BKNA 2PRMA 3QZ6A 1TJ2A 4GFIA 1E6PA 1W5NA 4GZIA 1RLCL 3TIMA 6REQB 1WUFA 1G1YA 1BYAA 3H26A 1LOQA 1KWKA 1HL2A 3QR3A 4JTHA 1ME8A 1FDJA 3L2IA 1XLDA 1E9IA 3PN8A 3EA2A 1JEZA 1VCGA 1QPQA 2QUNA 3W7PA 4LVGA 3GKFA 4ACZA 3RNDA 2G41A 4JQ2A 4M56A 3G6MA 3GNDA 3PWIA 2WZMA 2YPIA 4HHMA 1D3CA 4ATDA 1VYRA 3QOKA 1EIXA 3SCRA 1JYNA 2IXUA 3LY0A 4Y7EA 3USZA 4FF5A 3R1ZA 3WUFA 2Q3RA 2PAJA 3CZ8A 3G1RA 4QX4A 3LPGA 1B4EA 1E0UA 1S2WA 1VFSA 1LBLA 4FLQA 2C1GA 3GDTA 1DWJM 4FLRA 2RUSA 2Q8LA 1AVAA 2PDGA 4UWMA 2Y5EA 4HBKA 2V3DA 3KOXA 1GJWA 1OIFA 4DWSB 1X1OA 1FWSA 1DQWA 1PKYA 1QK2A 2QZRA 5K9CA 1FWAC 4CLMA 4ZFCA 4R53A 1K9FA 1WQ5A 4NT0A 1GOIA 2A6NA 3S2LA 4O53A 2ACQA 4S3FA 1OYCA 5HMEA 1C7TA 1OFAA 1W9VA 2GJXB 2P50A 3LCWA 1KRAC 4HN8A 1W1YA 4XZMX 2FHFA 3NA8A 4L9XA 3BUVA 2EQDA 4PUMA 3U48A 3ZLHA 4H6KA 3NEHA 4J5NA 3KM8A 2HNHA 2OZ3A 3OQEA 3VKDA 4MZ8A 4DY1A 3E2VA 3CNYA 3T05A 4I3GA 5CPQA 2OX1A 3W26A 3BCJA 2FTPA 3VE9A 4M80A 2VX5A 3FJ4A 4LU0A 3PFRA 3B0PA 4MB4A 1FY6A 3SRDA 2OJPA 2QLYA 3PG8A 4NXSA 3KL0A 3E3HA 1XXXA 4NY2A 2ALDA 3AS2A 2REQA 3CZEA 3ZR6A 3W7LA 4WDTA 3LRKA 5D2TA 2VEKA 1R3WA 1VR6A 3ZXWA 5AZ1A 5AC8A 5GNZA 5EFDA 2G50A 4OT7A 4Q4OA 5GJPA 3RLVA 1OGBA 1YNYA 5FAGA 3TX9A 3S2MA 1NDVA 1HFBA 1K7FA 3W82A 4PUWA 3I10A 2E09A 2WV8A 4AZ6A 2GZXA 2Z1BA 2XN0A 4KCVA 3E49A 3CO8A 1WDWA 4LVFA 3WH6A 4J3XA 2ZCGA 4W8BA 1JFHA 1O7AA 2Z27A 4UXDA 5I06A 2VGGA 4GISA 1TCDA 2X05A 4XX6A 4JTGA 4IL2A 1A5AA 4JFVA 2H8ZA 3OLEA 3SR7A 4PMXA 2ISFA 1F3EA 3E0LA 4X60A 2OR2A 2WSPA 1VFTA 3TTYA 3LI0A 3EOUA 1TQJA 1RK5A 3TU9A 1AJZA 2Z00A 4P8WA 3TN4A 3T4CA 2ZXBA 4I5UA 4KEZA 2TSYA 3RYSA 4KPLA 4AD0A 2QCEA 4GRSA 2OCZA 5CG7A 1EYWA 3SI9A 3UXIA 3WNNA 1XCWA 1N7KA 5FJRA 4LB3A 4MJ4A 2P8CA 1P7TA 3U7VA 1YDVA 5CPLA 2CCRA 4RNFA 3DENA 3N17A 5AHIA 4FX7A 3UD6A 2WSRA 4ORIA 1GGOA 3NM1A 4XKYA 1OGGA 3WG6A 2BVWA 5LGXA 2Z7GA 3FX4A 5ENLA 5F2LA 4CQDA 5CLWA 1M41A 4E8GA 4AIEA 1E9ZB 1A4MA 5BZAA 3TYAA 5A6TC 5C9UA 3V35A 1HP5A 4UFLA 4NP7A 2HEJA 4IOTA 3C6CA 3IGUA 4X22A 1I4NA 2R1MA 4GYJA 3JW7A 5I23A 1ZAHA 5FF4A 3FYYA 5F7UA 2XPKA 1JCLA 5LNVA 4ZXLA 1A3WA 2HS8A 4MUPA 2A79A 2D0FA 4IFOA 4WKFA 4PUUA 1XJBA 3QZEA 3UXLA 3MMUA 1NF0A 1OYAA 4GK8A 1VPYA 3N12A 4FNQA 1KM0A 1Q2SA 5CQ1A 4MGGA 3FXGA 2XSXA 5M2FX 1M7PA 4HMCA 2Q8ZA 3EDJA 5DXYA 1VLIA 3HMCA 3IANA 2ISDA 1BHGA 4QCEA 1KRMA 1JF6A 2BY2A 1KTCA 4OU1A 1TZ9A 1V0MA 5MKGA 4MPKA 3VDHA 1ESWA 1TZ7A 4AVNA 3WLLA 2DVXA 5EYWA 2DH2A 2GPTA 4B3ZA 4G9PA 5HJYA 3U4AA 2WKJA 2GJLA 4PMRA 4AHPA 1E0VA 5C2XA 3BG9A 3KVKA 2IPGA 2E6YA 1FUYA 1UPPA 2V2CA 4G1KA 5FEZA 2NWRA 4UTIA 2EG8A 1OHLA 1YQ2A 3IWPA 1RCQA 3S5NA 5EPDA 3RLGA 1PDYA 1YE4A 1R3TA 1JDCA 4CVUA 2E6FA 1J0YA 1PDZA 4L4MA 1JI1A 4LCSA 2EXOA 1GYNA 5CSRA 4HCHA 3EDFA 4JTIA 1VPXA 3L4UA 4IH3A 4JFTA 1KM4A 3NZ1A 5CZTA 4H6EA 1E1FA 4RX0A 3UVIA 1ISVA 1G4EA 5ABEA 4ZSUA 3P93A 1W17A 1A53A 1MDRA 1YXDA 5JU6A 1XLMA 2HS6A 3GDBA 3DKLA 4XTIA 1SJAA 3CBWA 3H12A 2WVUA 3ANVA 4PC8A 2CZDA 3OPSA 4NKCA 3W02A 3WDPP 3GS6A 3QHOA 3WJWA 6ALDA 3AUJA 3SCWA 4Y9MA 3N11A 4ZBCA 4NZCA 3BW3A 4CNOA 4LJ3A 2ABAA 1EGVA 1RSCA 1GEHA 1OZQA 4RNHA 1LZOA 3EXSA 4XBJA 4S3KA 4HYVA 3UCDA 4AX7A 2WYSA 1B3YA 3R25A 1A5BA 3LM7A 1MRAA 1VF8A 3KBJA 3SN4A 4KESA 2BLEA 2WC4A 2J88A 3EDEA 3TK7A 1TVLA 2E9BA 3WSUA 3WNKA 3G3MA 3S2NA 1LOLA 1Z6KA 4GE8A 4W86A 2H9AA 4UCGA 1M6JA 3B40A 3BZJA 3HU7A 4H9VA 3CUFA 2A4AA 1JPKA 4AUBA 4NZJA 3UETA 2E5DA 2VR4A 4KQNA 1Z69A 3S6TA 1IHIA 3N4FA 4B2DD 2EKGA 1P6BA 5EKYA 2Y61A 4A05A 1VIZA 2VC7A 3RU8X 3RF9A 3WEMA 1EYEA 2VT0A 2GSJA 1J10A 4NRSA 1T5AA 1GJPA 3JZEA 3VXGA 5DQPA 3W7IA 2X16A 4F48A 3M43A 3KOYA 3SQLA 3BLLA 4MKSA 1J0KA 4JD4A 4HNVA 4GMEA 1ADDA 3R11A 1FWDC 1A47A 3QFEA 3L5AA 2Z2AA 5CBJA 3CMGA 3PJTA 1D2KA 4EF9A 2AGKA 5GJMA 1X38A 1FWNA 4NNAA 1S1RA 3EB2A 1H11A 1K8CA 1A3HA 3OHMB 5LNWA 1TWDA 5H2ZA 4IP4A 4GLEA 3VI2A 3GTIA 4UB9A 3JS3A 4O1CA 3PB2A 3K2GA 4Q4SA 2VEGA 4IIDA 3QY8A 3RG6A 3RRXA 5IBXA 3FIGA 3RM4A 1FFRA 4JPGA 2ZZ4A 2FB3A 2VFGA 4LFYA 1MMFA 4LAMA 4CNTA 2GJNA 1YLVA 1VP5A 2J6VA 4W5ZA 5C9RA 4OOZA 4QP0A 3WJYA 1JNEA 1HVXA 1EJXC 1OM0A 3KE0A 5MHBA 2QCFA 3TONA 3O8AA 5IHRA 4RV8A 3VGBA 3ABSA 1C92A 3CPRA 2Y89A 1XUUA 4N9EA 5HUPA 3UR2A 3VMPA 2EPLX 2G5WA 4AZCA 3MP5A 2J8TA 1UWRA 2P8BA 9XIAA 2VR2A 4XBKA 1F76A 2OXNA 2X0HA 2JIWA 4REQB 2C16A 3CPUA 2CZFA 2FB2A 2GVLA 1DJQA 4DXXA 1MUWA 1ME9A 4L9YA 3RX2A 3IJ7A 2ZRYA 2CLLA 1E4MM 3VFLA 3FXYA 4RR4A 4YIWA 1UR9A 4UTTA 1KM5A 5FJPA 3XIMA 2CLMA 3Q37A 2VVSA 3FVDA 5IDIA 5HMFA 3WBEA 4G56A 1QPRA 2F8QA 4DYJA 3H21A 2ZX9A 1JXJA 1N8IA 3W7MA 1G5AA 3LHZA 1SR9A 2XHYA 3CQ0A 2WMFA 3UA3A 4D6EA 2RH9A 3ZR4A 4ZOBA 1BF6A 4NAEA 2H3BA 1XSIA 4IIHA 4EACA 3OLDA 1XLEA 1IZJA 4IXXA 1N55A 3W37A 4ZQPA 2R1LA 1E6ZA 1K4HA 2J75A 5CC7A 3DGRA 2V5DA 3CHDA 4GXPA 2QCHA 4A2RA 1H3GA 1A50A 2V6AA 1ZBCA 3P61A 5E6YA 3UWZA 4DXKA 5IM51 3UYCA 3EX1A 2ZRWA 3LB0A 3FGCB 4PMNA 1NWRA 1CBGA 4H7VA 3RLHA 4LUTB 1UWAA 2V3FA 1XIFA 5KINA 1RBLA 2ZRVA 5D38A 5I79A 4Q8WA 1KKRA 4IIEA 4EE9A 1QHOA 2PDJA 1R2RA 2CKRA 3RU6A 1YE6A 2QAPA 2VDIA 2ZZ3A 3B04A 1LWIA 1JCNA 4AEEA 3H23A 4K37A 4I7UA 4QQ3A 2E4TA 3CIVA 2NX9A 4HA4A 3WY1A 1DWAM 3VX1A 4JGDA 4AB4A 4HA0A 4PEEA 5D2XA 4J3SA 4W88A 3EMZA 5T8GA 2XIOA 4CD6A 4GKLA 3S2JA 1DE6A 4DZHA 1P6WA 3O3RA 4HK6A 1CYGA 1RA0A 2J79A 3R6IA 4QS5A 4G1NA 3RRAA 1DV7A 5DXXA 4Q8UA 4HKPA 4B5SA 1IQ8A 2ZE0A 3WNPA 2XFRA 1FCBA 4B3LA 2BY3A 2WCSA 3WEZA 3WMSA 2Y63A 4D6CA 1XH2A 3PJWA 4MYXA 4KIEA 3IIPA 4E2OA 2QJJA 1I2RA 2E67A 3E0IA 2YFNA 2Y7DA 4GC4A 2I56A 1Q8JA 1B90A 4V1YA 1KCZA 3I6EA 4DBSA 2VGBA 1UP3A 5CGTA 4DWSC 2GGJA 1XRTA 4H01A 2ZYFA 4J2PA 2WCGA 4BFAA 5JUVA 2VQTA 4UOZA 4UC5A 1AW2A 1V0LA 2FDMA 3G6LA 4XIMA 2E6DA 3SSJA 3RDKA 2EBNA 2ZUUA 5BU9A 1VGAA 4CU7A 3C5QA 4ZTYA 1VJSA 4XAYA 3PZVA 4QR6A 4NILA 1BG9A 3CXOA 3HM7A 1EJWC 4KFNA 4J9JA 2O9TA 3QRHA 5BMWA 1LBFA 4HJFA 3CV6A 1THFD 3GDMA 3CZLA 4L1GA 4AXKA 1LL7A 3WELA 2PF0A 3AYRA 4LWWA 1S39A 4XKMA 3CHCA 4MAZA 1BQCA 2ABBA 3KS5A 1G4PA 5JH2A 3WF4A 2CWNA 1WXZA 2E1WA 1ZJAA 2I5GA 1F3WA 3WLOA 2PB1A 3T0CA 3U57A 1WKDA 1TIWA 4U2ZA 4J27A 4HOXA 5HUOA 5EU9A 3WD4A 1ZHAA 4QDMA 4C6IA 3A23A 3SAZA 1QO2A 3ARWA 4AIOA 4UMAA 3BGGA 1TA3B 4YLWA 3MKKA 1UA3A 3AWOA 3REQB 2PDUA 4XV0A 3PZTA 5EA9A 2XN2A 3BLOA 5K9DA 4WY0B 5D05A 5IXEA 4IHCA 3WQ4A 4NYUA 3W74A 2BX7A 1W1VA 1RV8A 3C0QA 3INPA 1F8MA 2VGIA 3CUGA 5HQLA 1T8XA 4PCSA 4RE3A 1UWTA 3H4GA 3VDAA 2I14A 3T7VA 1SVDA 3EA3A 2FZBA 3GG8A 2PD9A 3H53A 2R6OA 3LA4A 3W75A 3CO4A 4ROPA 1U5HA 3G3DA 3QTPA 4KERA 4JTSA 3W70A 3QQ0A 3VVGA 1BSLA 3CAQA 3TLLA 2JEQA 1C8XA 1DXFA 2XWEA 4C6DA 3BPWA 3G8EA 3EPNA 2F84A 1EQPA 1Q45A 5JIWA 2WSKA 4PH6A 2NVDA 3N6JA 4YTSA 4O50A 1PV8A 1XW8A 4AG0A 4Q8QA 2E8YA 3N13A 3A4JA 4O10A 2F6XA 1POJA 4I9TA 3IIZA 5EY5A 5CGQA 4ES4A 2VNCA 2WVVB 5FF0A 2WWDA 4BCEA 1ZGDA 2V81A 3V3WA 4MWAA 3ZWTA 3WNMA 4XD3A 3F03K 2I1OA 4M6PA 4U31A 1PYFA 2Z4GA 4JIIX 3T07A 3WFAA 2GVJA 2O7QA 4A2SA 5ABFA 1SJCA 1LQ2A 2X1SA 1U22A 3TXZA 3IRSA 3FNDA 3GB6A 5EL1A 4ADTA 1UC4A 5MF5A 1F74A 2OLAA 1H50A 2OFJA 1QO5A 1TX0A 2GUYA 1QNSA 4B5XA 4CU6A 2PWEA 2DGAA 4J35A 3KCJA 1W91A 3GRIA 2J7FA 4FEZA 2IKIA 3WLKX 3VNIA 2BMBA 1NWUA 5F2IA 4GZJA 4WHBA 3CB3A 3OTRA 3VNDA 3THQA 1KR0A 2QDDA 4A3HA 3NXLA 4GUFA 4XWUA 4HVXA 3UU0A 3RX3A 4HSOA 1OX4A 3P3BA 1US0A 2CFFA 2WXDM 4DWSD 2GUBA 4TU1A 3LMYA 3U9IA 1Q6OA 4WXYA 4X0NA 2QCDA 1HP4A 3VOJA 3PBWA 3UF9A 1ZAJA 4ERIA 5CJMA 3ALGA 1REQB 3GW0A 3WL1A 5LA0A 1OC7A 3GXPA 4JNYA 1WXJA 3OO2A 2YCLA 3PG9A 3EWCA 2WW5A 1ZFJA 2J8FA 4K7VA 3GVRA 4JN7A 4O8RA 3USBA 2Y8VA 2DFAA 2GSHA 3LQGA 1GG0A 3CMJA 3PPHA 3L2LA 1EJSC 2BGQA 4AXNA 1DWGM 1TUXA 2BVYA 3B0XA 4OTKA 4UZUA 3TN3A 1TWZA 2E8ZA 1JUEA 2VOMA 4MF4A 3FOKA 1FOBA 3AYSA 2OELA 2E28A 4UNIA 2QJHA 4TQTA 1T8QA 2WMIB 3KWSA 5IFPA 3AIBA 3VDCA 1XG4A 4GY1A 3A4WA 1E0WA 1EEPA 1AD4A 3RCYA 1A5OC 4N0RA 3LV5A 3MCMA 1XWYA 3LPPA 1KFEA 3VAVA 4HB7A 4PCFA 2BOFX 3BVJA 3GE7A 2DZSA 3A64A 3OVRA 4MKVA 1H61A 3GVWA 1ZL1A 3K46A 3HFYA 3ARYA 4F2BA 5LA1A 3RMJA 1PXGA 2PLKA 4JICA 3MSDA 4GVGA 5HATA 1XH0A 3UPWA 2V63A 3DI1A 2VEFA 1XFCA 1TIMA 1ZSXA 4IISA 5EBAA 4JTCA 2ON3A 5A6LA 4FOKA 2W27A 4LVAA 1J11A 1RCXB 1DHKA 4DO7A 3PY2A 3N73A 2FH8A 1QAPA 1TPB1 2R94A 3POHA 1HGWA 5T9CE 4EPEC 1CXKA 3UJRA 3N2XA 2BS9A 3CEPA 3JU2A 5HNUA 4MHBA 1SU5A 1B3WA 4AD5A 8CGTA 1GORA 4IIGA 4NZ5A 2R1NA 1QNQA 1SJBA 2G0WA 1QMLA 1FWJC 3HF3A 4YL2A 2R9RA 1NOWA 1TB3A 4V27A 4WY0F 3T4WA 4FR1A 2X7VA 1L2UA 4UTMA 1T0OA 1XYBA 1AQHA 3V4BA 4XZNX 4IPIA 3R12A 1EP2A 3UBPC 1ODUA 2EPKX 4C6KA 3GVQA 1B4KA 4IQEA 3BLKA 3N2TA 4UMBA 4HHLA 4AISA 2Z1XA 1KFKA 2ZOXA 5FJJA 4HHHA 2QCCA 4AD4A 4WKHA 1PTDA 4F9DA 3D0CA 2OG9A 4W85A 4H6QA 1JPDX 3WQWA 4GQRA 3A12A 1JF5A 5AYYA 4F3HA 5FCZA 4AQLA 2Y8KA 3O7UA 2PDYA 1QI2A 3R0UA 3VIIA 4CEXC 5A6KA 4M0XA 1ENUA 3PSVA 1KRBC 4WSJA 3O63A 5CC5A 3NL3A 2FVMA 5CPTA 3TJIA 1NDZA 3WH9A 2WK2A 1JZ5A 4Y96A 3T2OA 1WPCA 2YIHA 4UQAA 3ZJ8A 2FFIA 1XIEA 1IT0A 1UOKA 1XYAA 2W4XA 2AMGA 3HQOA 4ZO6A 4N02A 2FDSA 1ZJBA 1BAGA 3TOPA 4NQ1A 1XF0A 4L4OA 4Y2WA 3U3HA 4UUIA 1FVPA 2CBVA 4FIRA 4QXIA 1TX2A 1BTCA 1KCLA 1JZ4A 4DJFA 3W2NA 3O0KA 3URNA 1XD1A 3WJXA 1KGXA 3EOOA 4B5UA 1WZMA 1TV7A 1O5QA 3W3OA 1WNOA 1DPMA 1NEYA 3AI0A 4JY9A 1RK6A 3WQDA 3APTA 4DELA 4DZ5A 2EPNA 5D2YA 3FCPA 3MUY1 4M29A 5LHFA 2WBKA 1TPDA 1SQ7A 1OK6A 1ADSA 3WQPA 2H8XA 3CASA 5A2CA 1VH7A 2R91A 2AQVA 4PMYA 3DX5A 3G1YA 1XRFA 1PTGA 1R2TA 3KZPA 1GZGA 1LWHA 3NUKA 5AHFA 1TRDA 3E1F1 4CN6A 4O11A 4D8AA 3S2CA 1EUNA 2NV9A 3NZPA 1PZ0A 4GVFA 4LB4A 3WQCA 4PODA 1KXHA 4ZQMA 3AFBA 1BRLA 1OF8A 3BGJA 2HDJA 2BASA 3WEOA 1G7UA 4US5D 3KBNA 3DC0A 4AFYA 2F2HA 1DJWA 3AMKA 2NVCA 3NSMA 2XU2A 1R0MA 4C6LA 4IMAA 1XICA 3AXIA 3LENA 3WF1A 3T0BA 4ZB2A 2XN1A 1M7XA 1TQXA 1FKXA 2W61A 2TMDA 3LUTA 2WC3A 1WXYA 4C91A 3L5MA 3UJEA 4PRTA 1W0MA 2OEJA 2P10A 2VZOA 4GUHA 2DT3A 3Q45A 1V8EA 1YDOA 1AW5A 4HZ8A 4E3TA 2F6KA 5L6UA 3R10A 4F40A 1XRSA 3DFOA 2PMQA 4FALA 1EQCA 1Q8AA 2X1IA 1FFQA 1QOPA 3MBDA 3NNTA 3S5SA 1ZS2A 2W92A 1B3ZA 7CGTA 1S2CA 3E0FA 2DZWA 4DUWA 3H4WA 2QAFA 1NQKA 1Y0EA 4IICA 4S3CA 3N29A 4QDPA 4IP7A 1J12A 1V6WA 4CN1A 1IXQA 4JN8A 1KFCA 2WANA 3DIPA 4URIA 1XQKA 3QLLA 3ANYA 1ML1A 2GGHA 1B2YA 1ITQA 3KHDA 5C2GA 4UBPC 1B3OA 1OFRA 3CK5A 2Z28A 2V3EA 1K77A 2OYLA 3HZ3A 3LD5A 1K3UA 3SN0A 3W7HA 4XZWA 3GFYA 3FV9A 2BFGA 1H1NA 1QI4A 1WKFA 5GVJA 4WEVX 1FWHC 1HUVA 4PBGA 4E8DA 4Y90A 5AHMA 1OCQA 5KZMA 5DX7A 3IUIA 3KDOA 1GQLA 1Q63A 1V77A 2DORA 2DY3A 1CLVA 1NDWA 3I3DA 3TYCA 1NWTA 1ZBVA 3KTCA 4GABA 4NI3A 3ITOA 3URBA 4HNNA 4DO4A 2VEPA 3SCUA 3E38A 1PB0A 3BCFA 3R2GA 2FZMA 3NQ2A 4IG2B 1CXHA 1QPKA 1JD7A 4HYWA 1IYXA 2BBFA 4FLOA 1Q2RA 1D7KA 3P62A 3PULA 2GQAA 2X1TA 4Z2KA 1LROA 1HJVA 1KBIA 2VDGA 2JK2A 4JHZA 1AW1A 3VKBA 2ZQ0A 4UQBA 1J0ZA 3F5JA 1K9TA 3VYLA 3HB9A 1MI3A 2EO7A 3MS8A 1WUEA 4IX0A 2FZ9A 1WBHA 3UY7A 1FWEC 3VKAA 2V5LA 1QNVA 2FGLA 3CAVA 1XUZA 2Z1KA 2PWDA 3BANA 1ZB5A 1H41A 5A6JA 1JYVA 2D0HA 4CU8A 4JEJA 2IPWA 4UTHA 4LUSB 1P4CA 1PKNA 2GQ9A 1T99A 1B3VA 3NXFA 3PTMA 4GBUA 4AMAA 1V02E 1FCVA 3AIRA 4FP1A 1EO7A 2GWGA 5AC5A 4IXHA 3UZZA 1ITCA 3H2CA 7REQB 1W9BM 4EANA 1MW0A 5SWUA 4C6PA 1KTBA 1KFLA 5C6MA 4QLLA 3PUEA 2AKZA 3CLMA 2HZGA 1QW9A 3T8QA 1DKWA 2J7CA 1U83A 1TMQA 1FHUA 1TJPA 2FZNA 1W54A 1SW0A 2YYTA 3GAYA 2QCNA 1MUCA 4GX9A 3VNLA 4RUBA 3MHFA 2DIJA 4DWDA 3W7RA 1CLKA 4UFIA 2YX0A 5A1AA 4GGBA 1NFPA 1DJNA 1PX3A 1DJIA 2XIBA 4CQ8A 2UY4A 3H24A 3AHXA 2GOUA 4JTLA 4XBSA 2PDXA 4OV4A 2X09A 5HMSA 4K38A 2HVMA 4OE7A 2ALRA 3L67A 1XSJA 2UV8G 3C0SA 3S1VA 4HNOA 3DECA 1OADA 1PWMA 3OJGA 5AKQA 3IJDA 1F3XA 2TPSA 3KLKA 1ZRQA 4H41A 4AZHA 1RQHA 2D3NA 5A6SA 1MZHA 4YXGA 4OJYA 3UA4A 3V1PA 1T6MA 4E2DA 3OA3A 4OBTA 1OCNA 1Z89A 3TV8A 1KBLA 3MKCA 4CQCA 1WZAA 2G4JA 3BG3A 2DZBA 4Z1DA 1E72M 3NTYA 1AMYA 2P3EA 3BZGA 3T6CA 3T8LA 1OT2A 2A6LA 4EX4A 2AL2B 1M3UA 1XIJA 3M5VA 3O16A 4A35A 5A6BA 4PMQA 1G4SA 3UFYA 2DPEA 1ZCOA 3N04A 3GTXA 5T26A 1DXEA 7ENLA 3OBKA 4OECA 3T44A 1VYSX 3HPSA 1F6PA 4BWLA 4C6MA 4DPPA 2DT0A 3ARPA 4HMEA 3T0AA 2X2GA 4QG8A 1YTEA 2C8NA 3HPFA 1F9CA 3ARVA 4HU4A 4J3WA 2JKEA 3A3WA 1L6YA 6TAAA 2XH4A 4S39A 1OT1A 2H6RA 4M6QA 3LSBA 2NLYA 3K1GA 5DF0A 3CH9A 4NZ1A 2Z25A 4QRNA 4IPNB 2QPXA 4MB3A 3NZRA 1LDCA 4K2SA 2YKKA 5D9PA 2CHNA 3G1DA 3W1MA 4HN4A 3B8IA 4AF0A 3SCVA 3G1HA 4MWAE 1YHTA 1MVYA 1S1PA 3FAXA 4ACZB 2QEZA 2R8WA 1TJ1A 1W56A 4KF1A 5HULA 2HJPA 3QLDA 3LXBA 3T81A 2ZRZA 3QJAA 3ZMRA 4J4KA 2PODA 2OMAA 3ITTA 3TC3A 3RGTA 3TXVA 1ALDA 4JHOA 5D37A 4L56A 2VI0A 3TC7A 2WM0A 2YGYA 4P5UA 1E9YB 4ICMA 3EXTA 4F0SA 1VEPA 2D0GA 1WDSA 2PWGA 3SECA 2V30A 4C1KA 3S83A 2A21A 3B8SA 3HGSA 1BTMA 1Q13A 1W1TA 3E0VA 1R85A 3TYDA 4J2MA 3M47A 2OO0A 4D6DA 3LGGA 3ARSA 4I8DA 1LUCA 1W5MA 3KAOA 1XDLA 3LHUA 3OVQA 3PZMA 1UR2A 1UZ4A 1CPUA 4G7FA 1UKQA 5J5DA 4JL1A 3W1AA 4FOUA 1MXGA 5I3HA 3N4AA 4RK8A 4LBUA 4XAPA 1GVYA 3EYPA 4I8YA 4IFKA 4KRTA 3RJXA 4HSHA 4RDVA 3M44A 4QJ1A 2O7SA 2QULA 4LY4A 1JZ6A 5I5RA 4O1EA 1BVZA 3SO7A 2DZXA 3VE7A 1SJDA 3BOLA 4QJ3B 3AOFA 2Y5SA 3ZYZA 1PL9A 1PAMA 3T08A 5AYZA 1UR3M 3AXKA 1QNPA 5AVHA 3DFPA 1LQ0A 4LT9A 3C2EA 4N6EA 3HV9A 4M8UA 3S9YA 1G67A 5D8WA 3QV8A 2REQB 4Z2IA 3WK2A 2QMJA 2W9MA 1H7XA 1OFEA 3EKLA 3HOJA 2WPGA 8TIMA 2Y88A 4ZODA 2GYIA 3MU7A 3NSNA 2VC5A 2OOGA 4ZEPA 2HBXA 4POCA 4RNIA 3QMSA 2YL8A 2GDQA 4LBRA 3Q4DA 3C2OA 3LBCA 5CEWA 1LT7A 3UERA 1VEMA 2POZA 1K03A 3LTPA 5HNTA 1AA1B 1GOMA 3SIZA 2BDQA 3EOSA 3NIYA 1GW9A 3TUUA 2ODOA 3QH2A 3K8KA 1OX5A 1ZTVA 1OF6A 2PTWA 2HXTA 2Y6ZA 2BHYA 4B5TA 1F73A 1B30A 1MO0A 1MSSA 4PA8A 5F1VA 7TIMA 3VGHA 4GOAA 2I57A 2XVLA 3N3TA 3VD3A 1O4UA 2DW6A 1T96A 2Z24A 2B7PA 3TA9A 4CNPA 5LIKX 5BOOA 3PZUA 4AMCA 4GVIA 1AZ1A 5HQEA 2ZXAA 3NAVA 1HIZA 4X2PA 1ISWA 4K39A 2YCJA 4TIMA 4LSBA 2VEIA 4BI6A 4W9TA 2PDLA 2OYMA 4NJJA 1DQUA 1Y5WA 4PMZA 5CJNA 5CPNA 2BWGA 3KBVA 1B9ZA 3FJNA 1FWCC 3Q2DA 1Z41A 1X96A 3JRKA 2PGWA 1SSDA 2OEMA 3NO5A 4XZIA 3E5BA 3UY8A 4GO8A 3GTHA 3EEGA 1EH9A 2FMNA 5EMYA 3RITA 1TZZA 3VKJA 1W3KA 3OU8A 4D71A 2Z2UA 1NQ6A 4X61A 3V16A 4ATLA 2HTMA 5DFAA 1TPWA 1TPVA 2O4QA 2YCKX 2J47A 5XINA 1P7TB 3G1FA 2O9OA 3EKGA 3Q94A 3IPWA 3MI3A 4JDYA 3P67A 4LS2A 4YU1A 3TTQA 3CWHA 1E51A 3FSUA 4XKYB 5CPOA 3GZ3A 1NDYA 1K1DA 5FA5A 2C19A 1VHNA 2VFIA 1I1XA 3W1TA 2J13A 2BGNE 2PLCA 1EBHA 1UWUA 2FVLA 2AL1A 1GHRA 1VFFA 3P7YA 3PZGA 3ZT6A 1WV2A 2DIKA 1VEOA 1DJZA 4E8CA 3DCPA 5AVNA 3I65A 3BCDA 3JZUA 3H2FA 1CWYA 3E6EA 3BV7A 4DBDA 3K30A 1VZWA 1JGIA 1AJ0A 2BY0A 3NZQA 4TVCA 4ACYA 1W3IA 3TW7A 3W53A 3LGDA 2VQUA 2ZXQA 2JKAA 1FCUA 2FPYA 2PSNA 4CKQA 3DFSA 1AFSA 3QV6A 1FCQA 2JKPA 1YEYA 4PR4A 2MNRA 1MNSA 2OB3A 5K3VA 1WAWA 1YIXA 1RHCA 5I07A 3GXTA 5MKGB 4MTVA 1X97A 5HMDA 3SUSA 2XIJA 3NDOA 3NVDA 3DG6A 5I3FA 3QMTA 3NQVA 1OK4A 4R85A 1EZ2A 5CXPA 1E71M 3IIOA 4TOQA 5CZ0A 3CUZA 2GJPA 3H2AA 4Y6GA 3UG4A 3GX9A 2XZ7A 3L5LA 4LX4A 1EEXA 3FEMA 1WA3A 5LKYA 1H60A 3VCCA 3VA8A 3OODA 2ZVRA 5DY2A 4H9XA 3IS4A 3LPOA 1HKMA 1LP6A 5BOEA 4MIMA 2J74A 1EF3A 2QV4A 4ZQCA 4XIAA 4YYFA 2ZFAA 4DAFA 1TE1A 3HGRA 4YN5A 3WFLA 1Z42A 2HPMA 3E96A 5I09A 5C7HA 3SUTA 1E0XA 1EO5A 1YNPA 4TXEA 2NXIA 2IQTA 2ADAA 3E2SA 1WX0A 1LLZA 3MP4A 1JZ8A 1W9DM 2D20A 3BMWA 1HL9A 1Q5MA 4KWSA 5A6AA 2WZIA 3MSYA 3IGHX 3WQ6A 3IJIA 3DHPA 3ALFA 1Q6DA 4HD5A 1H1YA 2OSXA 1G0CA 1QCWA 4C6OA 4Z17A 3UPMA 3SW6A 3CL7A 3EZ4A 4KFPA 4LUIA 1QW8A 3WDIA 5A5WA 3DGBA 3ARUA 4EVZA 4AZBA 3VNJA 3NQ6A 3FVMA 1JUKA 3OBEA 3EA1A 3G77A 4JTUA 5CBIA 3LQLA 1Q7QA 3VK5A 1V79A 1F6KA 1TTQA 1LJYA 1OBAA 1NFBA 1QATA 2H9AB 3V0UA 1HQTA 3W6MA 1VC4A 2PGEA 1XGZA 2NQ5A 1NARA 1QPOA 1RBAA 4GZ7A 2VELA 3TSDA 4IFRA 1FWBC 4LVBA 3ZT5A 3GDRA 4PE8A 1EFZA 3CIWA 4AW7A 2VENA 1YPXA 3CT7A 1JL8A 2QDEA 2UY2A 5E70A 4GQQA 3WF2A 4DYKA 4E5TA 2VP8A 3HURA 3CHVA 1SO6A 4DI8A 4NL1A 2E68A 3O0FA 2Y4SA 1AG1O 2WB5A 1EC9A 1E6NA 4GQBA 3AAMA 3WN6A 1ODZA 3MZ2A 2C1IA 3V18A 4PMJA 1GQJA 4GH3A 2XGIA 4JTEA 2DEPA 2NQLA 2DZAA 1H1ZA 1G94A 3OGVA 5H8MA 1FDYA 3H22A 3BGAA 3WLSA 5CAHA 1JYXA 1V6UA 2YXGA 2Z1WA 1NOUA 2QYGA 4UR8A 3RILA 1QRQA 1UD3A 4PYSA 3RK8A 5FACA 3FFSA 4GCAA 2PP0A 3IVTA 4V2XA 4IIBA 1KFJA 2XSAA 3UCQA 4WJXA 3SCTA 3V1HA 2C7FA 1EHAA 1OG6A 3GW3A 4WCJA 3MMDA 1WDPA 1EB3A 1WKEA 2ZXDA 4B9YA 4DBWA 4XD6A 3L65A 2BZNA 4HU8A 3EWZA 3HQNA 4ERGA 4WDUA 2ZE3A 1O60A 3U5YA 2YB1A 2QDGA 1H09A 2RDWA 2YBTA 3OZMA 1XLLA 1D8CA 2O0TA 4XO7A 4F4RA 2QF7A 1UQZA 4JTDA 3KOFA 4KRZA 4GACA 1XIBA 2GOKA 3KWXA 4Q4KA 5B80A 1Q6RA 2G4FA 1VS1A 5AYBA 3B8VA 1HF6A 2CC0A 4AEOA 3W1LA 2Z2BA 3M0JA 3CB8A 1DJXA 1P0DA 2FZDA 4AZCB 2E9LA 4XZLX 1S5VA 1XIGA 4ZB0A 3ABXA 3UG8A 3FS2A 1BKSA 3W71A 3UR7A 4NG3A 4RKAA 4GYPC 3EMCA 3SGZA 4KKXA 5C71A 3ZS4A 5KEZA 2TRSA 1TTJA 4INFA 5CZJA 4U3CA 4FX6M 4RZ4A 3PHAA 5IDZA 1KRCC 1V6YA 4I7VA 3FKRA 1UUMA 4L65A 2FYMA 2FZ8A 1NH6A 2FIQA 4JS3A 4NJIA 1H0IA 1RXOB 3NQ7A 1XLBA 1XL9A 4PEKA 2OX4A 1NTHA 4EIVA 1SPQA 4LNCA 1UD8A 2WAGA 2C3ZA 1D8WA 1K8XA 4IX2A 4ML4A 2Q8XA 3P82A 1JZ3A 3APYA 3W4RA 4GUJA 1VFHA 3VX0A 4BQ2A 1QU4A 1NP0A 4OBSA 1FHDA 5FJOA 3AISA 4QAWA 4NAEB 3GZAA 4PFMA 4C6BA 1DJGA 2EHHA 3WBAA 5CCZA 4K8HA 2PS2A 4MFEA 3EWUA 4HP5A 1XM3A 1M7JA 3QBUA 3HMJG 1Q6CA 3W1UA 4TX9A 3PZIA 1C8VA 4LYKA 3ABZA 5I3JA 3MC5A 3IJ9A 3TAOA 2GGEA 4PUNA 4A29A 4A22A 7PTDA 1SFTA 6PTDA 1M53A 5HPCA 3FA5A 3E2RA 3QF0A 3Q58A 2ISWA 3TJXA 4PB4A 1AK5A 2XH0A 5AECA 1W9UA 2YDAA 1A5UA 2OQLA 2ZUNA 4LUSA 3FJLA 3VZYA 3W1NA 2CZEA 4P7OA 1MEHA 1ISZA 3WJZA 2VOTA 3B4UA 1LL4A 2X1RA 4MKNA 2VFFA 1S2UA 2XVKA 2HVNA 3KBMA 2OKOA 4O0ZA 3W23A 1J18A 4ZQNA 5JBEA 3M5ZA 2YYUA 3CUXA 4Z2JA 1H5VA 1C3FA 5ABHA 1RD5A 1XBZA 3FY1A 3PUGA 2FQIA 2CLPA 2L5HA 1LG2A 4HU0A 2EKCA 4GC3A 3B9DA 1I75A 1VFUA 2I9UA 4Q8NA 1XG3A 1SM9A 4J3ZA 1B3XA 1JGMA 1LG1A 3WZ0E 1H7NA 4JTFA 4E6MA 4H8VA 1V0NA 4EKJA 1TJRA 1E3XA 4O14A 1BFNA 1A0CA 2VM8A 3BJFA 2XWDA 2D3LA 3GR7A 2CHRA 4P7NA 2QJGA 2PDQA 1XD0A 3GD6A 4HOZA 5M3WA 1VQTA 1JAKA 4PL1A 2BXZA 3VDGA 1P48A 3GUWA 4FNTA 2WNNA 4JIQA 4I9MA 4S3BA 1JUBA 2INEA 2I7GA 1C91A 1WDRA 3MMTA 3VC6A 2ZRUA 3DHUA 2VUYA 1B0IA 3S3GA 3C2RA 3R79A 4HSNA 4MY1A 4K1GA 3K4WA 3GTNA 4GXWA 4QCFA 1V0KA 4XD4A 1OJXA 3QKZA 3GC2A 4JTQA 4OUEA 2RJGA 1YNQA 4MFDA 1PS9A 1YX1A 3MVIA 1F2JA 1IZCA 3M1ZA 1V51A 4LUYA 4YPJA 4ZO7A 1WBJA 3HJZA 5IOBA 3IJ6A 3O07A 1E70M 3WLQA 1BKHA 2EPHA 3W38A 3DXIA 3WFZA 1D9EA 3UR5A 2Y70A 1GCYA 4BF9A 1T41A 1DJHA 2FHBA 5GPRA 3KXQA 1XH1A 4DJDA 4GPNA 4PMUA 3WD0A 3W72A 3WD2A 3TMQA 3S42A 2V68A 4XVEA 3IV8A 3ANUA 1BEUA 1PIFA 1W1IE 3C0LA 4JCMA 4K36A 4Z1BA 5A2AA 3T2QA 4LYQA 3W1PA 3R8RA 3GBDA 2HNEA 2R1PA 4LC8A 4I5RA 3LI1A 5FJIA 1KXVA 3MW7A 3BLEA 3HPAA 3WQOA 2OVLA 4BY3A 1WDQA 5T9BG 4UOJA 4WX2A 1Z9AA 3J7HA 3A4AA 3LK6A 4L1WA 4LANA 2WHMA 1SZRA 1HKIA 3SUWA 5IFTA 3DN5A 2PDHA 4GWEA 5HK4A 3WQ8A 3L9CA 3VKCA 3G5EA 1XI3A 1NOFA 2DSUA 3ITGA 2FMOA 2IMRA 4QAIA 4R3UA 2PUZA 1IWPA 1RP8A 3A21A 3QZAA 3VOGA 1ZPTA 3UXAA 1V3JA 1YBQA 4QSHA 4ZQRA 5BU6A 3AMLA 3SCOA 4O1FA 1TFVA 4EWJA 3W1QA 1JULA 2VRQA 4QSFA 5BRPA 4WSKA 4OFCA 4DIAA 3EWWA 5ABGA 3GU2A 3HV8A 1X7FA 1ZY9A 4O16A 4MMWA 1X6UA 4C60A 1PWLA 2A2IA 3CLWA 4H4IA 3HG3A 3AMGA 4GX8A 1CXIA 2WPBA 4WQ6A 3U2CA 2NZLA 4JKMA 2OKTA 3VZZA 4D9PA 2ZZ6A 1ZU8A 3K4AA 1K6AA 1MNZA 5GNXA 2O55A 1EC8A 2KAUC 2YDRA 3MWCA 3MI2A 4RPPA 5FEPA 1EJUC 3LCXA 3T09A 4XG1A 4LEFA 4O0QA 1RJRA 2IS7A 4E4FA 3LTYA 1GTEA 1TRIA 1U30A 4MWAB 3UEQA 3PZQA 3MA8A 3MV11 2WHKA 1DTUA 1KLYA 4LAKA 2A7NA 2GUUA 3N18A 1TCMA 2HV5A 2XIMA 4GQ0A 1FHVA 5D2VA 1GVFA 3A3HA 3H7UA 1FHLA 4HOWA 4MM1A 3W2JA 2QVHA 4MAVA 3UZXA 3VGGA 1XIMA 1W3NA 4M1BA 5ABFB 3ZJKA 3F5LA 2VZSA 1FBAA 2J7GA 4O13A 4J28A 1YPIA 4BI5A 4IL0A 2Q71A 1D3HA 4WRHA 1O95A 1U1HA 3H2EA 5BWFA 1RPXA 2YW3A 2XVPA 4L6OA 5PTDA 4GY7A 4JX5A 3PNUA 1MW1A 2JGYA 1TELA 4X63A 1L9WA 1UP0A 1XINA 1NF7A 3W88A 2XH7A 5D04C 4LBSA 1UH2A 4CCZA 1SMAA 3RXZA 1XLGA 4NZ3A 2PTDA 4OV9A 5E0FA 2XSBA 3CS2A 4Q8TA 1Q6LA 3PC0A 3B9OA 3B9NA 4L9ZA 1WOBA 1BYBA 3CQHA 5AZ0A 4XAFA 1RBOB 2C6QA 3C8NA 2OSYA 3BK0A 1WAUA 3WL0A 4IIFA 1OX4B 2ISVA 1VFLA 3PTQA 2DDXA 2GK1A 3A5FA 4KW2A 3GFXA 3U0HA 3WLHA 4IPJA 4IP5A 4JQ4A 2QCDB 3GG7A 3WD3A 1WYIA 5TNVA 2G3JA 1UP2A 4I90A 2YL9A 2D2HA 2ANUA 1R47A 3EBVA 5DCDA 5I02A 3S1GA 4M6VA 1G4TA 1B31A 2V2DA 3QW4B 2DT1A 1OFPA 3IUDA 3GH4A 2H90A 3KEHA 3N14A 2YCLB 3QSRA 2WHJA 3MY9A 1Y5XA 2D24A 5FI8A 1XBVA 3S46A 3OP2A 3FW6A 3V0SA 1HZYA 4B5NA 1O66A 4KWVA 5J04A 4PRWA 1YKWA 1IZKA 2W0UA 2QJMA 5K7JA 3TEVA 3OLGA 1YADA 2O4MA 5KZDA 1JFXA 2UBPC 4UTWA 1TV4A 3AJ7A 1IF2A 2PDWA 2GVYA 5E93A 2DZPA 2Q01A 5G4EA 5D09A 3VIKA 3AROA 3VGDA 1RPKA 3A22A 4RNJA 5XIMA 1PX4A 1Y8BA 4GYKA 1WB0A 4C7FA 4CD8A 5E1QA 2IPJA 4Q3MA 3IAQA 4QROA 1MQRA 1ZP4A 2VC6A 3PANA 5LZLA 4PFHA 4EXAA 3T1GA 3KVJA 3GUGA 3KRZA 1HKKA 1AODA 1EF2A 5HJLA 3TQ0A 3DHDA 3N1AA 1R9ZA 2AQWA 2ZA2A 4AD1A 1XLIA 4HJWA 4S3AA 2TODA 4KEUA 1J79A 1QBBA 2XZ9A 3H2NA 1C9DA 1CCWB 2QDHA 4HZ6A 2F6UA 4YYCA 3NOYA 5ECUA 3PPFA 1XYZA 3LHVA 3MUIA 3AYVA 5A8MA 1QFEA 1EHNA 3I7QA 4NYYA 3M0LA 1E1CA 5FKYA 3AS3A 3NOEA 4JL2A 2FLIA 4HYRA 4GKTA 2I16A 3B8TA 3IEBA 2I17A 1HKVA 4LYPA 4Q7NA 3UXDA 4TMBA 4G2DA 1RA5A 4PBFA 4TR9A 1AL8A 4CD7A 1ZCCA 3EDDA 2BOGX 3MMWA 3SN1A 4JKKA 2ZBTA 4QQUA 1GYLA 3WLTA 3EWDA 4UTJA 3TQPA 3L4ZA 1SZEA 1OD0A 4W8LA 4A3YA 4P8UA 4YMZA 5M5DA 4F2TA 1KCXA 3H2MA 2IUZA 4DO5A 3GQYA 2CBUA 1OFQA 3DHFA 3LHTA 3RHGA 2ZUVA 2NUXA 1JPMA 3BTNA 3G8RA 4AU0A 3EX4A 1O1ZA 4I9JA 1AZ2A 2VX7A 4BI7A 2V82A 3OA5A 1QOXA 5IBXC 3MUCA 1JIBA 4DZAA 2C18A 1YYAA 3ELFA 1Q7MA 1GOWA 3PF3A 3HA1A 4C1LA 3M4HA 3DI0A 3C52A 1OGSA 1XDJA 1S2AA 1EXPA 3VOCA 5DMNA 1RZMA 3LX9A 4WDXA 4H9TA 1HJXA 2ZDSA 3L66A 2DZVA 2A7PA 3TMLA 3ARTA 3F4CA 1SYTA 4LGXA 1L6SA 4RW5A 3UXKA 1QK0A 3L2MA 1JNDA 1E43A 3WUBA 4MUZA 3B8DA 3ERPA 4Q32A 1Z44A 1C8YA 3AXXA 3PTDA 1ZAIA 5FD0A 2IW0A 2YOCA 4QLJA 1ICSA 1PZ3A 3SM0A 4O15A 3O15A 1FKWA 1OG0A 4AIBA 3D47A 2VXNA 2QGHA 1GKQA 3W7KA 3W07A 1UIOA 3RFAA 2WJEA 4DUOA 1UMYA 1L6GA 5JQ9A 3NGFA 4Y8EA 4Z08A 4L4LA 1DEDA 4Q7BA 5E9XA 4DZIA 1OQFA 2YL6A 4IMCA 4UTTC 5CKSA 2CXGA 2OQHA 3QGKC 2VO5A 3C0JA 4LCQA 2VFDA 1AJ2A 4RE4A 1GVIA 1X1NA 5DCBA 3VNMA 1EWEA 5F4WA 1XSKA 2RDTA 4Q6JA 3WKZA 3P6LA 3AS0A 1OYBA 3KL3A 4UTUA 1G01A 1BRLB 3KRSA 4R7JA 2J7EA 3B05A 2EEXA 1NY1A 3G0SA 1TPEA 1US2A 1TPC1 3GR8A 4W84A 1O5XA 3HG2A 3B9AA 4DUVA 4GG9A 2P76A 3IGSA 2CEQA 3QYQA 4HGXA 3QHMA 1LRTA 2NWSA 2VCCA 3S6OA 2ZZ5A 1HXJA 3OEXA 5LIXX 3P0XA 5C55A 4DJEA 4JFSA 3CTTA 4J3UA 2CITA 4TVDA 4BHYA 4PUDA 3ITXA 3MDWA 4QBXA 3S1UA 1U5VA 4GHRA 1GG1A 3AJXA 3G24A 1QOQA 3W7EA 1GKRA 3MYPA 2AMXA 5CPMA 2PA6A 5DCEA 4XZHA 5F4SA 1X8FA 2P53A 1U2YA 3BC9A 1Q6QA 3L21A 5C70A 4QGCA 4RZBA 1W2PA 4AVFA 1W1A1 1DWHM 2QW5A 4F0LA 2WHLA 1BQGA 4X9YA 5K9XA 3II1A 4HMDA 2E40A 3M5YA 3IAPA 1UKPA 3RPTA 3T0TA 3W86A 1XLCA 1ISXA 4GNJA 3W2KA 3S5OA 2CLKA 3ZFHA 3UWEA 4EWND 1ECEA 2NQJA 4WOZA 4M3PA 4FS9A 1LCOA 3AC0A 4R88A 3ZJ7A 3PZNA 5AHEA 2VR5A 4E3VA 2JQXA 4UMCA 4FXSA 2J78A 3KP1A 5BRQA 4L1XA 2C91A 1CB2A 1GVOA 1E6SM 3QOMA 1FRBA 4LEQA 3TH6A 3SFWA 4L80A 3TSBA 3KX6A 3P2VA 1UH4A 3DDMA 1EJRC 3NO3A 1PO9A 1JDAA 1EA0A 4X2RA 5HWMA 3F4NA 3KW3A 2H3DA 3LCIA 4YVPA 5E6ZA 3WDRA 3H54A 4NF7A 3WYZA 1PCWA 3KLLA 4MSSA 1RALA 2DQXA 3CM4A 3GG0A 4B5VA 4DUXA 1FTXA 1HO1A 3PS7A 3UP8A 4QG9A 2CPUA 4IWWA 1W3TA 5HPOA 4KCUA 4FX8A 3PPGA 4MY8A 3MI6A 1TWWA 3VFCA 1E0TA 3C2YA 1YMYA 3BH4A 3ZVHA 4LY8A 4A6GA 3ES8A 2OPJA 1L8NA 1QI0A 3B8WA 3VGEA 4AYGA 1RH9A 2C13A 3DFNA 3I3BA 3ZR5A 1RQBA 3EX6A 4MY9A 6ENLA 3WK3A 3W83A 1UD5A 2X2YA 2E7FA 1E40A 4RXGA 1SZFA 1JCMP 5A95A 3PZ9A 4QIUA 1QI3A 5REQA 1MUMA 4C6CA 4AH7A 3R89A 5FAJA 2BGSA 2GQ3A 3NFUA 4KCTA 1V3HA 2Y62A 5CLTA 1EX1A 4R9XA 2PCEA 3FJ6A 4ICNA 2WNWA 2FH6A 5I00A 1VYPX 4QS6A 2CZVA 2IPFA 5HJXA 3ZSSA 1R8LA 1KCKA 3ZLFA 3KBWA 3S1WA 2WKGA 4O19A 5EMUA 2QUMA 1HJUA 4CVWA 4Q4MA 4C5ZA 2DJLA 1BYCA 1XYMA 3FYOA 3PTKA 3VIHA 4GINA 3LBMA 3CL8A 5G1MA 2Z0IA 1P0NA 3IK4A 2PZNA 4K3ZA 4WR3A 1KQZA 4A3QA 1F4AA 4PUEA 4DRSA 4NAFA 3GY1A 3RCMA 4HTYA 1Z8AA 3VNYA 1OX6A 3DFQA 3OB8A 5G5IA 3LZ3A 4E4UA 1MQQA 1H62A 1WOAA 3N9KA 4UFMA 3HPZA 4K1WA 2G97A 4V1XA 1I2NA 2R1KA 5E09A 1TWIA 2J7HA 2CESA 1B5TA 3PJXA 3A6OA 3OQ8A 4ILSA 3MANA 4F0MA 5EB8A 1UBPC 2EJAA 1JPIA 1E4IA 3AIQA 2WWCA 4LV4A 1RAKA 4U2YA 3FK4A 5B7ZA 2OO6A 3QEZA 1MXDA 4XAGA 1I9CB 3F4WA 4KWUA 4HNTA 2OODA 3WQVA 2IKGA 5FJTA 2PWHA 2X42A 2Q09A 4GIAA 4KEMA 1U33A 2WO5A 5KTLA 2FTYA 2JE8A 4DQWA 1DWIM 1UW9A 3W85A 1GOOA 2CBJA 3C4UA 2ZTJA 1IGSA 1DHPA 4WOQA 1KNWA 5LA2A 4MWAC 1VHCA 4HNCA 4M1RA 2P88A 3OW1A 3UWVA 4DX3A 2CLIA 1V3LA 4QEHA 1QPNA 1QW7A 4KGLA 3UVAA 4UTLA 2WMGA 1OCJA 4RZ6A 2OLSA 4ZB5A 2J7DA 2TYSA 3VGFA 3U2ZA 1VRDA 2X8RA 3IJQA 4AZGA 3IJ8A 3N19B 4QHRA 3AO0A 1HKJA 6XIAA 4D1IA 4ALDA 3COTA 3THAA 1F3TA 1LYXA 2ACRA 1PHWA 1V3MA 3F7JA 3M6YA 1XYLA 1VBRA 3LLXA 5M03A 3WMBA 1DTNA 1CIUA 3WUGA 3NO1A 1YTDA 1HW6A 3NYDA 5HR6A 1FQ0A 4L61A 5XIAA 4MZYA 2O92A 3CV7A 1GT8A 4WKAA 4FOJA 3MP3A 4EPBC 1T40A 1X8CA 4B9ZA 2WSQA 1QXLA 3L12A 2YDQA 3M0YA 4GO9A 2ZZ7A 3MSRA 4GZEA 3LGEA 3THUA 2EG7A 4AF0B 2G8ZA 4B4HA 8A3HA 2VD8A 3EB3A 1BXCA 1HT6A 4WIWA 1B57A 4CNSA 3ABOA 4CEUC 1A0DA 1UR8A 2POTA 3GTFA 4K68A 2EJ1A 5CSSA 1QHPA 4IPLA 3LZ5A 4O17A 2ATSA 1ZJHA 3ABQA 3O6AA 1PTAA 3M7SA 2W79A 3R7MA 1I2PA 3EWYA 4LF2A 3H8AA 3S5ZA 1A5LC 2J77A 3NJ3A 1I6NA 1IEWA 4G7EA 2V5JA 4NI8A 2E0PA 1K4GA 2DT2A 4N9BA 4CD5A 1V3IA 3SIMA 3MPGA 4GI9A 3RPMA 4NJGA 1VENA 2Q02A 3LCFA 2PP3A 4UQCA 1S38A 3W84A 1DJYA 1LUCB 4W8AA 4IUGA 4FR6A 3C2FA 3W7OA 1TR9A 2NXHA 1EJVC 3N2MA 4JIEA 4ZXOA 3OYXA 4H00A 3KVMA 2CLEA 1W5PA 3QY6A 4FI4A 3W2LA 3M0HA 3GXNA 3VD7A 2RDXA 2XH2A 2EAWA 3EGJA 5DMLA 3M5XA 2GDUA 1GJUA 2TAAA 1KO0A 1H0GA 4UTKA 4IFKB 5C9WA 4YVXA 4JNZA 4PMVA 3GVGA 1P0EA 4S3GA 2VMFA 3V7PA 3V5CA 2OSWA 1Q4NX 3CYVA 3SSZA 3CGTA 4FPSA 4A3UA 2WJZA 2VFHA 1AH3A 3NQGA 1R3QA 3A3XA 4MNLA 4Z0JA 3EXRA 4PL2A 4DF1A 2D73A 3T2PA 3GHTA 2BP1A 3DEQA 2DVUA 1HNYA 3KL5A 2PEVA 3SZ8A 4Z42C 3SEPA 5HBFA 2NUYA 4D6FA 1KQYA 4IGMA 3DOPA 4FXFA 4V28A 2BOEX 1KFWA 1YTKA 4Y9PA 1DYSA 3NL6A 3MHGA 3HG5A 1YDNA 3BLFA 3S47A 3URAA 1ONWA 3CQIA 1TE6A 2E6AA 4FK9A 5EFFA 3NQBA 4QDWA 1ME7A 2D2GA 3W7NA 3VILA 1AQMA 1H2JA 1E5JA 5DO8A 3RM9A 4F66A 4H6RA 4RXFA 3W1RA 3QTGA 4HIBA 2Y7FA 2PWUA 4PCTA 3AU2A 5CH9A 2ZZ2A 5DRCA 1R86A 1OINA 5BMXA 1AD1A 1W2VA 4L5ZA 2V5KA 5LIUX 2QCGA 3BOFA 3I3EA 5D8ZA 3UWYA 1A80A 4MWAD 3WJSA 1B54A 1VLWA 3KOZA 3GSMA 2I9EA 2V3GA 4P7QA 4YWSA 2RKXA 3TKFA 3QV7A 3UR8A 3GC4A 1HKWA 3VOFA 3MDUA 3MHUA 2DU2A 1TVNA 1SW3A 4X9SA 3PBUA 3P74A 5C2CA 3B9EA 3EPOA 1TO3A 4D8LA 1EP3A 7ODCA 1VBUA 1XC4A 3QPEA 3RLUA 5JMUA 4NASA 3FAWA 3HO8A 3L0KA 3WQEA 3NQMA 1ZJIA 4WK9A 2YBVA 3GM8A 3BLDA 3WLNA 2R82A 3GG1A 3SUUA 1OVDA 2ZVIA 4U5KA 2QR6A 3KCLA 1BD0A 4DJFC 1OB0A 4M51A 3K1DA 5I7GA 1P1XA 2BVTA 4E0CA 3LCLA 2PF8A 5LNUA 1E4NA 4IGNA 2CETA 2QQ6A 5A6MA 3VIGA 4PTWA 2ZUMA 1GKPA 4PSRA 4GI6A 5FSDC 5TD4A 2KX9A 1JYWA 4Q4RA 1WO2A 3W6LA 1I2QA 3UZJA 4M7SA 4BQ4A 2ZX8A 3TW9A 1TTPA 4LUJA 5D02A 4MLRA 5DN1A 4JNMA 1N2VA 4NJKA 1JJKA 4NVTA 1RLDA 1LLWA 1LLOA 3U5UA 4QLKA 3SQSA 3QGAC 1E73M 4JYDA 2BTMA 1QT1A 1VJIA 2ZA1A 3V75A 3NG3A 1XBXA 2DSZA 1R3VA 4MJMA 4WJ8A 1TPUA 3E2QA 5D30A 1JCJA 3CUHA 1YDYA 1S5TA 3W7JA 3STFA 3WLIA 1IT7A 2WMKA 1P0KA 1FXQA 4BEUA 4ADUA 4HHPA 5LNSA 3KRUA 1EWDA 1UUOA 3NCOA 3BV4A 1TVPA 4NIRA 3UG3A 4EF8A 4W4QA 1XPGA 1WKYA 2E3ZA 3W7CA 4FF7A 2D2JA 2W6RA 2KZHA 3F5KA 1H7OA 4S23A 1UHVA 3DYPA 3TZNA 5ECVA 4IQLA 4C6NA 1R7OA 2WM1A 4NZFA 2XINA 1CX9A 1W9PA 2FTWA 2D1ZA 5BXRA 4IF2A 5G2HA 4CCCA 5CAKA 4TV5A 3A9IA 2INFA 4ML9A 1XV8A 3FEQA 1UZDA 5FF3A 4B90A 3FDGA 1J6PA 2UY5A 2NT0A 3MUZ1 2BXYA 1R3SA 2YCIX 4ZL1A 3K13A 3AXHA 3M0ZA 4KIRA 1UASA 1UJPA 4I5XA 4MB1A 1S5WA 4Q6XA 3LNMA 1O1HA 5M17A 5M1TA 1B1YA 4M7TA 7TAAA 3GU1A 1GYMA 2RDUA 2QVNA 3STCA 2WNQA 4V15A 1RY0A 3E02A 1BWKA 4PMOA 4KS0A 3FDKA 3G1SA 4S3DA 3CWNA 4HZ7A 2NSXA 5BXTA 4FNPA 3SY1A 1LBMA 3ARRA 4UR7A 1CXLA 4LPCA 4WXZA 3NDZA 1QNRA 4TUFA 1TYGA 5KMYA 1CLXA 1CZ1A 2PDIA 3UQNA 1CGXA 2NVAA 3TW6A 3E5PA 4FO4A 3CIXA 4P2VA 4XISA 1E6QM 5E0KA 2V8ZA 1IEVA 3T0DA 1ZP3A 3IACA 3LCGA 2BG5A 3GXIA 5A8QA 4XVDA 2X7WA 1G9HA 1NJJA 3NVTA 3BARA 3PZOA 3IUHA 4GIRA 1JQVA 2W63A 3DZ1A 3ZIZA 1L6WA 5IHSA 4GY0A 1AQFA 5LIYX 3CZKA 1J0IA 3TWAA 4HNLA 2YA0A 3TLQA 4K8EA 2XIQA 2HPIA 1NVMA 2HVOA 3JVAA 2V69A 4G8TA 1LRNA 2J6XA 1L2QA 5HWJA 4QJ5B 3VIMA 2DSVA 1JRBA 1J01A 4HK5A 2OWWA 1FH9A 4BK9A 4KEVA 1R9XA 3T9PA 1UR0A 4XZ9A 1DP0A 4AHOA 3ZZ1A 3SGUA 2X41A 4LAUA 9XIMA 5CZSA 1J8VA 2A85A 1P6CA 1S2TA 2OT1A 4Z0SA 1IXPA 4B2DA 1HO4A 2YA1A 3TCEA 1U5JA 1A0EA 4RE0A 2R24A 3CMFA 4LW7A 4DJFD 2BNJA 1EJTC 4MNMA 3LHYA 3VD5A 1P5BA 3LOTA 2YFOA 2ATMA 4AWTA 5AHLA 4DI9A 1JPHA 4QE4A 5DMYA 3UJSA 1F6YA 1GEQA 2CWXA 2JEPA 3HBLA 6XIMA 1KM3A 1JR1A 4N4QA 5I03A 1LRQA 5G1TA 4MJ2A 4QE5A 3FHQA 1R2SA 5D9NA 1FWIC 1UBSA 1DE5A 4JIPA 4ORMA 3IK2A 1TUFA 4OQVA 5AB3A 4UQDA 1Q66A 2ZWZA 3BICA 4LAOA 4CNNA 3B8UA 1IEQA 3TYBA 4ZZ9A 4QG6A 3EDKA 4NZ4A 1HN1A 4Q8PA 2BSLA 2GVGA 2WMHA 1S3TC 4HT3A 1E56A 4NUWA 2PFHA 3B0YA 5D9MA 1GOKA 1OC6A 2QKFA 4Q8VA 1TTIA 3FN9A 5TQLA 3EOEA 3R43A 2VZVA 1JDDA 1W3LA 5DELA 1OFOA 2PP1A 4R7WA 4D1JA 9RUBA 5CGMA 1ZBKA 4O8AA 4JDBA 5LXEA 3N9RA 2ACSA 2DUXA 3GNPA 5C9ZA 3KZSA 3U2EA 4S2BA 2QPSA 4LTSA 3PBMA 2QJIA 1VBJA 2J9XA 1GQIA 2X0SA 2WVSA 4O54A 4O18A 1MWOA 3NPVA 2FKPA 3CEUA 4AZIA 2PU0A 1KV8A 3KUMA 1JZ7A 3AS1A 1DIOA 3TAKA 3R94A 2F38A 4JIRA 1A5KC 4D8ZA 1LF1A 3BSMA 3AICA 1ITUA 2UWFA 3CV2A 4H7ZA 1MRQA 1XGEA 1LTDA 2OLHA 3GHUA 3W29A 1TV3A 5G2WA 1TKKA 2PLJA 3UWQA 4LC6A 3EMQA 4ZO9A 2Z6IA 3SCPA 3EX3A 4RV3A 2G3MA 4QTGA 3L4TA 2VGFA 4BWLC 3GNNA 1UKSA 4DF2A 5HNNA 1UD6A 1BG4A 4ENLA 4RW3A 4GNVA 3WCZA 3A9BA 3E0WA 4AZ7A 3SRFA 1TV8A 3SRKA 1GZJA 4UIOA 1KM6A 5A94A 3L0GA 5BXPA 5JH1A 1Y5VA 4DXVA 2XM2A 5EGRA 1ZENA 1EPXA 3UJ2A 4WUIA 1XC6A 5JBDA 4C90A 2PCQA 3HJEA 3JR2A 3NL2A 1POKA 3P84A 4FB7A 1SGJA 2CNCA 4HNUA 1NIUA 1CNVA 1DBTA 3BE7A 3GKAA 4BEQA 4AC7C 3BJSA 2J24A 4YJ5A 1IE7C 2QCMA 5A69A 3OG2A 1VCFA 5DBUA 3MVTA 4R7OA 2Z26A 1JCXA 4FIQA 3W2UA 5CG0A 5B7YA 3LLDA 4KMQA 2P3ZA 2VCAA 5F4XA 4NSBA 3VZXA 1V93A 2BB0A 3B97A 3PWAA 1W9XA 3QV9A 3ONBA 4YCOA 2PBOA 3ARZA 3CQKA 1I0DA 3OZOA 3W24A 4ZTXA 4F8XA 2B0MA 4H9YA 3C3UA 1DIDA 4Y9OA 5J8LA 1W8GA 3PP7A 2DVTA 4E4PA 4S2CA 3B3DA 1FWGC 4R27A 1VAHA 2QF8A 2ZICA 5BRBA 1UYQA 3QR0A 3HQPA 4W7UA 3TJ4A 2YW4A 1J2BA 1W5OA 3TYZA 2XIIA 2NX3A 3GXFA 1A5SA 1C29A 3N2CA 1SO4A 4J3VA 4UOQA 3NQEA 2OGYA 2GWNA 5JXQA 1PKMA 4S38A 1X6NA 2F61A 5FF2A 1KB3A 3DERA 1IGWA 2P0IA 2WBGA 2QIIA 4PTXA 4NX0A 1HX0A 3TSMA 4H8NA 4KRUA 4CGTA 4C1NA 5FF7A 4GI4A 3GDKA 2OGJA 4MPQA 1M9HA 4BA0A 4RDZA 3GNRA 4F0RA 3PBVA 4W7VA 1KKOA 3GH5A 2FVKA 4CQBA 4DHGA 1CGWA 5LIWX 3F2BA 3AIVA 1MQPA 2RFGA 2Y7EA 4UR9A 4C7GA 4GIEA 3N25A 3S8HA 2Z1VA 4WD0A 3ARXA 3BWWA 5D4YA 3N2BA 2HWGA 2VWTA 3STPA 1UJQA 3OBAA 3QPYA 3QC0A 5JVLA 4EXQA 3R58A 2ACUA 2CKSA 4XQ6A 2DV0A 3LNPA 2D22A 1IIHA 2F2KA 5AY7A 2NUWA 1LT8A 3QY7A 2PPGA 1YRRA 3PSWA 4H2HA 2FJKA 4NRRA 5BW6A 3L4XA 1ELSA 4U4MA 3AHYA 4ZOCA 1VD6A 1U1UA 2QMKA 3SJNA 4GVHA 2VC9A 5C54A 5I24A 3GU9A 2FGBA 3TP4A 4AY1A 4DBEA 1YBQB 4ZVJA 3I7SA 4AAJA 4AZ5A 2ZZ1A 1OFBA 4D2JA 1PBGA 2ZKMX 5C0QA 4QITA 2Y24A 4EPKA