1S2AA

Crystal structures of prostaglandin d2 11-ketoreductase in complex with the non-steroidal anti-inflammatory drugs flufenamic acid and indomethacin
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of prostaglandin D(2) 11-ketoreductase (AKR1C3) in complex with the nonsteroidal anti-inflammatory drugs flufenamic acid and indomethacin.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1s2aA00
4FZIA 5HNUA 1HW6A 1AH0A 1OG6A 2FGBA 2PZNA 4XZNX 1XJBA 2PDYA 3BV7A 1YNQA 4PR4A 4JQ1A 2IPWA 4JIRA 4RPQA 4JQ3A 2IPJA 4YVVA 3UZZA 1JEZA 3CMFA 3NTYA 4PMJA 1ADSA 1YE4A 2ACUA 1PZ0A 4GA8A 3GHSA 3GHUA 3UZWA 1Z89A 3WG6A 1J96A 1EL3A 2I17A 4NKCA 5LIYX 3R58A 2PDCA 4FA3A 3S3GA 4LBSA 1IEIA 4MHBA 2FZ9A 4IJCA 4JTDA 3G1RA 3UGRA 2HE8A 3U2CA 3ONCA 4JTQA 4Q7BA 4FALA 2PDHA 1ZSXA 2F2KA 4LBRA 4YS1A 4GIEA 1PYFA 2PDUA 1X96A 2FZDA 2PFHA 4PUUA 3M4HA 2PDLA 5AZ1A 4HBKA 4JIHA 2BGQA 5KETA 4GQGA 4LAUA 2IKJA 4EXAA 3GHRA 4DBSA 2WZTA 1C9WA 2INEA 3GHTA 2PDKA 3BUVA 4QBXA 3T42A 1QRQA 3V0UA 1S2AA 3CAVA 2PDWA 3V36A 3M64A 4DBWA 3EB3A 3LENA 2IKGA 2BGSA 4XZHA 3N6QA 2IS7A 1AZ1A 4XO6A 2NVDA 2FZBA 2I16A 4JQAA 3UYIA 1Q13A 3QKZA 3WBYA 4JQ2A 4WRHA 3LZ3A 5C7HA 3CAQA 4DZ5A 4XZLX 2HE5A 3O3RA 4WDXA 4FAMA 1ZUAX 5LIWX 1ZQ5A 2IPFA 2PEVA 4GABA 4GACA 3WCZA 3RX4A 3F7JA 2AGTA 3VXGA 1M9HA 4PRRA 3RX2A 2IKIA 4LB3A 2FZ8A 3EB4A 4H7CA 3COTA 5AZ0A 1EF3A 2PDNA 4XZIA 3V0SA 2ACQA 3C3UA 4EXBA 2PDBA 4I5XA 2WZMA 3V35A 3R8HA 3KRBA 4HMNA 3N2TA 2J8TA 2A79A 1MI3A 2FVLA 1ZGDA 2F38A 4XVDA 2R9RA 1X97A 4JIIX 2R24A 1S2CA 4JQ4A 3LUTA 1UR3M 3WBXA 1X98A 1PWMA 2PDQA 2P5NA 3R6IA 2INZA 3CV6A 3FX4A 2PDFA 3LQLA 4YU1A 2HDJA 4JTRA 2HVOA 3BURA 3O0KA 3Q65A 1YNPA 2IQ0A 3G5EA 3CV7A 4PUWA 2IPGA 2PD9A 4QX4A 2ACSA 3GUGA 3DOPA 3V0TA 1VP5A 1QWKA 3R7MA 2VDGA 2PDPA 3DN5A 4XAPA 2PF8A 2PDIA 4WDWA 2HEJA 1VBJA 4F40A 4WEVX 4WGHA 4DBUA 3BCJA 4LB4A 3UWEA 3UP8A 1Z9AA 1S1PA 5M2FX 2HVNA 4PRTA 5HNTA 1YE6A 1T41A 3LBOA 2DUZA 3RX3A 4IJRA 2ISFA 4LAZA 3LQGA 1SM9A 3H7UA 4GCAA 3EAUA 3M0IA 4ZFCA 1AH3A 3LEPA 4R9OA 1FRBA 3CASA 1S1RA 1K8CA 3MB9A 3UZXA 3ONBA 3R8GA 1AH4A 1LQAA 3LN3A 3P2VA 4H8NA 4XO7A 2BP1A 4XZMX 1MZRA 2C91A 1Q5MA 3UG8A 2QXWA 4JTAA 4WDTA 3UZYA 2DUXA 3MC5A 5DANA 5JH2A 1GVEA 1A80A 1EKOA 4L1WA 5LIXX 3R94A 1RALA 2ACRA 1R38A 4L1XA 3ERPA 5LIUX 2IKHA 4G5DA 1IHIA 1XF0A 4QR6A 1Z3NA 1RY8A 4Q3MA 4XVEA 1HQTA 4QXIA 4ICCX 1PZ1A 1RY0A 3LNMA 1Z8AA 2ALRA 4ASTA 3LD5A 2PD5A 4OTKA 2IQDA 4IGSA 4GQ0A 3Q67A 3H7RA 3R43A 5HA7A 2DV0A 3D3FA 3UFYA 2HV5A 1US0A 2PDGA 4WDUA 2PDJA 1AFSA 2PDXA 1XGDA 5LIKX 4YVXA 1T40A 3H4GA 4JTCA 4YVPA 4AUBA 3LZ5A 4XK2A 3FJNA 3WBWA 1PWLA 2PDMA 2NVCA 1MRQA 2CLPA 3B3DA 1EXBA 5JH1A 1AZ2A 1LWIA
chains in the Genus database with same CATH superfamily
4Z42C 4AWSA 1HL9A 3C4UA 2PP0A 1EWEA 3RO6A 4IISA 3QF0A 3W71A 4JR5A 3PPHA 2XWDA 3HGJA 1ZP4A 2UWFA 1AH0A 2X30A 3AHVA 3E12A 3STEA 1M41A 4ML4A 3IUDA 1GQLA 4MWAC 4EP8C 1UMLA 3A5FA 3BW4A 3TMQA 1XISA 1QNQA 1TQXA 1REQB 3QM3A 2VYOA 4J3TA 3SGZA 1GQIA 1VZWA 4JX6A 4AFYA 4ZB2A 2OWXA 3CEPA 3R8RA 1TZ7A 2C3ZA 1DYSA 4XUYA 2WWDA 2QMJA 3NQAA 1PZ0A 3CHDA 2WK2A 4PCNA 1WDRA 4G9PA 3VI2A 1GWJA 4RE2A 1S2UA 2I5GA 1JGIA 4RW3A 3HG2A 4W93A 3T0CA 3REQA 3O1NA 2HPMA 3R58A 1FFQA 4O11A 2FZ9A 2YCJA 1SFSA 4JTDA 5CC6A 1TPH1 2HE8A 1THFD 1PSCA 3UG5A 3CNYA 3U4AA 3GDBA 1YDYA 4CQAA 1ZCCA 4NT0A 2X16A 3DYOA 4TR9A 4O12A 3RCNA 4YS1A 3FGCB 3TYAA 1G4SA 1J0ZA 3VOFA 2WHMA 4BEQA 3ABSA 2PFHA 3CEUA 3TR2A 2ISDA 5FF0A 1RQEA 1KQZA 4RZ6A 4WSKA 5D32A 4AHPA 5B80A 2WSPA 3KL3A 2WC4A 1QOXA 3P6LA 3CZKA 5K7JA 3EXSA 5CZJA 3P0WA 1VC4A 3THCA 3BXWA 3STGA 4IP7A 2OKTA 1FWIC 3LHUA 4GHRA 1R3RA 1EDTA 4OBSA 3T09A 4ZMGA 1XD0A 3TJ4A 3ALGA 4FSAA 1EF2A 2BVTA 4QFUA 5I79A 3WUBA 3V0UA 1DXEA 5G2IA 1W9BM 2CEQA 4DBWA 3RFAA 3W38A 2XVGA 1V03A 4QG6A 5HAOA 4XO6A 4E0CA 1KFCA 4RK8A 4QLLA 4IQLA 3IJQA 4L5ZA 3IGSA 4C6CA 2Z7KA 1TWIA 1TR1A 1W9PA 2D22A 3MV01 2WCSA 1AQFA 4QHRA 5LIWX 1GQJA 4OFCA 4XAFA 2VRQA 3F4CA 4JD4A 1P1XA 4KWVA 1A50A 1G7UA 2FGLA 3M0JA 1K7FA 3SB0A 3JUGA 3LXBA 2VO5A 4Y9OA 2WM1A 3V0SA 3N9RA 1NP2A 2Z1BA 4GH1A 4GXWA 2VFHA 2CIPA 3A4AA 5CCZA 1XIHA 1BQCA 3ANUA 3STPA 3W7QA 4CCEA 1BWLA 3BOLA 1H09A 3WNOA 1IF2A 3W25A 1Y65A 1ZGDA 1ZCOA 2F6KA 2GWNA 2ZCGA 4KFOA 3STFA 4PTNA 4GZJA 1V6YA 2J7FA 1E72M 4YNGA 1C7TA 3KW3A 2VRJA 2OVLA 4P7LA 3WH6A 3QRHA 3VZXA 4P8UA 4JYDA 4PN2A 3SCRA 3RMEA 1PTGA 3B9AA 1ESWA 2DVTA 1MUCA 3APYA 3LYEA 3S2NA 4PUKA 4CEXC 3CHFA 2P50A 2Z28A 3AALA 4MJ2A 2VR5A 3NAVA 2DH3A 2GUBA 4AB4A 2ADAA 2NQHA 1T5AA 4LC6A 1SW0A 3QTGA 3TQPA 4YMZA 3QYQA 3F4VA 2DEPA 3FLUA 1FWTA 3HPAA 3EMQA 2KZHA 4L61A 4ZEPA 5D09A 1VBJA 3M46A 1V0KA 1V6WA 2R1NA 4R3UA 1Q63A 2NX3A 3TCSA 3MJYA 3KL5A 2A4AA 3TE9A 4HPXA 5HNTA 5TD4A 1ZZMA 4GUFA 3HJEA 4A4AA 5DCEA 3RX3A 5CZTA 1QASA 6TIMA 1SM9A 2GQAA 4G7FA 5FL1A 2Z6IA 2D2JA 3AICA 1K8CA 4YHGA 3MB9A 3VGEA 2VM8A 3H7VA 3L4ZA 5I0DA 3C52A 3RGTA 3CUXA 3NQFA 4J1OA 4U5IA 1BRLB 1ITCA 3LXAA 4H8UA 1JGMA 3P14A 5D30A 1YPFA 4UR7A 1Q5MA 3RHGA 1VH7A 5IXEA 4ZXOA 2TAAA 2G4FA 4IP5A 2EKCA 1Y5VA 3HFYA 1GCYA 1SJAA 3GIYA 1TPFA 1KV5A 1T0OA 5EYWA 1OADA 4WOQA 1TUFA 2BB0A 1MXGA 3TVAA 1OVDA 3EWDA 5CJNA 1LLOA 1JDAA 1F76A 1TRDA 1E43A 4Y9PA 4JTLA 4MJMA 3LM3A 4GY1A 4AZ7A 4PYSA 3GKAA 3WL1A 4AZ6A 1IT8A 3W74A 3CYVA 1M53A 4LUTB 4DM2A 3H53A 3IVSA 3WLPA 2OR2A 1M1BA 4OTKA 1RA0A 1W1VA 3BL3A 2Q01A 2XFRA 1TJ2A 4K3ZA 4IG2B 2VL4A 1A5MC 2NVAA 3P74A 4O15A 1M03A 1L6WA 4A22A 1ADDA 4W4QA 2WZIA 2QHAA 3UVAA 1JCLA 2CFFA 3R2GA 4ZCWA 3TR9A 3LBMA 1UZ1A 4DZIA 2CZEA 3WQFA 1H41A 3EWUA 2OU4A 4DO7A 2BY3A 3T2PA 3LCLA 1SO5A 3B4UA 3AYRA 3LZ5A 3GRIA 3OJGA 4IQJA 4LF1A 1UP0A 1RHCA 2I56A 5PTDA 3TYBA 1TPDA 4UQCA 1N2VA 1JI1A 3ECQA 4W88A 2FB2A 2NQJA 4Q4MA 1NF0A 4GVGA 2OGYA 4WLCA 5HNUA 3UZJA 3G24A 1QPQA 4MWAE 3SCWA 4L80A 1J01A 4RE3A 4U10A 3ID7A 3NL6A 1EBGA 2R6OA 3GDRA 5FEXA 1W54A 6XIMA 1EYEA 5H8MA 1XJBA 1JRCA 1BXNA 1RPKA 4PC8A 2QIIA 4JXCA 1YNQA 1OABA 1X6LA 3VZZA 1PCWA 4KCTA 4V15A 2DZUA 3MUY1 1W1IE 4ZODA 4R7WA 4CLMA 1KTCA 3EPMA 3GXIA 4GA8A 3GHSA 2H9AB 3KXQA 3UNDA 1M6JA 1B3YA 3BWWA 1AMKA 1Z89A 1V3IA 3LSCA 1EL3A 3DYPA 3ITVA 3STCA 4EACA 4CNUA 3WNKA 3W4RA 2NV1A 1YLVA 3MO4A 2XG9A 3HPSA 3QHNA 5AVHA 1BG4A 2EBNA 1S3TC 5I7GA 3TONA 4OWGA 4O0QA 4WHBA 4E3TA 1CCWB 3KBMA 1VFHA 1XD1A 2PDUA 3OOQA 3OLDA 2QCLA 4LRTA 2FZDA 4HBKA 4Q7NA 4GQBA 3AZSA 3B0YA 3VIOA 3CK5A 1QMLA 3CB8A 1GOMA 3JZEA 1LBFA 1H60A 3CV1A 1IGSA 1MNSA 2HWGA 2INEA 1PDYA 4AISA 4KEMA 1VLWA 1OFEA 2DSKA 4JTEA 2EO7A 3T42A 1J11A 2PSNA 2PDWA 3LPPA 3FNDA 1UR1A 1KLZA 1A0CA 4WVXA 1SR0A 1KGWA 2ZXBA 2BGSA 4C91A 1A5AA 1GHSA 2E1DA 2V6AA 4HN8A 1J79A 1BKHA 3E2SA 4RKAA 3NJ3A 3I68A 1C8QA 5I00A 5JU6A 1RQBA 1CENA 5CBIA 3MDUA 1QR7A 3MZ2A 1YYAA 4XZLX 2POTA 2PI6A 2OWCA 3UETA 3C0JA 1ZUAX 2VFGA 3CL7A 1UWSA 1KRMA 1QHOA 4WY0A 2NV2A 4F48A 3TOPA 3ES8A 4LB3A 3EB4A 5AZ0A 5I3KA 4ZOEA 1EJTC 4MGGA 4HYWA 5AC4A 4GISA 1Y0EA 5L6UA 1D2KA 4LJ3A 2WMJA 1TVPA 3N2TA 1MI3A 1ICSA 4FNRA 2VCBA 3ZS4A 2X8RA 2NUYA 3KBNA 4QS5A 4O4WA 1IEVA 1M3UA 3B40A 3H2FA 4QIUA 4JNMA 1REQA 3DC0A 5HJLA 1O12A 1SMAA 4P7RA 5EBUA 4MNLA 4MFDA 4N9EA 3CIWA 1GOOA 4QG9A 3RDKA 2P5NA 1NJJA 5H8PA 4L64A 1DWGM 2SFPA 4XQ6A 4Q8TA 4HNVA 6XIAA 1OFBA 4WXZA 5EA9A 6A3HA 4LS1A 1YNPA 3GC2A 1TX0A 3WDRA 3H23A 1Q6EA 1SJDA 5I23A 3ABXA 3PAJA 2C13A 2UY4A 1KFWA 2TMDA 2CPUA 5CGTA 4MUZA 3EB2A 2VC6A 1I4NA 4YN5A 4ZQRA 3WLQA 1V3JA 3IJIA 4X63A 1V3KA 1LBMA 1Z9AA 3LRKA 2QV5A 3BGGA 4P8WA 4BI7A 3U6WA 3B8WA 4UFLA 3BAYA 3QQ1A 2ZRUA 3N6HA 3MP3A 4AD3A 4HA0A 4DUVA 5A2AA 1P6CA 3H7UA 4PEEA 5CQ1A 3HMCA 4QRNA 2A5HA 2H6RA 4QS6A 4BF9A 4PB3A 2QCCA 3SY8A 3TW6A 3DENA 4H6RA 2WHJA 4UTLA 1CGTA 2E25A 4DNMA 2Z1WA 3ONBA 1O5RA 4LV4A 1RCXB 1CBGA 1XRTA 4WKAA 1ADOA 3MKVA 2DT1A 4DXVA 2VFDA 3OU8A 1XRSA 4ERGA 1XCXA 1L6SA 4OOZA 4GH3A 3SCOA 2NV9A 3K4WA 1DHKA 1MZRA 3R11A 3WF2A 4PBGA 5K2ZA 4CQBA 1EP3A 1FWEC 1O4UA 1V51A 4AD4A 4W89A 1GVEA 2POZA 4CQDA 4MWAD 3R94A 1LOSA 3GYCA 2VCAA 2QF8A 1OX4B 2YXOA 2VEIA 1EIXA 4S3GA 1J5SA 1VFOA 4G5DA 4JAWA 5BOOA 3CPUA 4CD8A 3A3HA 3BMVA 3AWNA 1XF0A 4MZ1A 2X1RA 2GVYA 2E40A 1PAMA 1RJPA 4N4PA 4MPKA 1PZ1A 4NI8A 3A12A 2TSYA 3CQIA 1MWOA 5DBTA 5A8NA 3ITCA 3IWPA 3WQEA 2QEZA 3ABOA 3SUUA 2HXUA 3B06A 1NM9A 1VKFA 1KFKA 1FVPA 2BS9A 3NQGA 4DBDA 1MVYA 3PZ9A 3NDOA 1GQNA 3GW0A 2F6XA 4GVHA 3TDFA 2J62A 2ZE3A 1TTQA 4ZB5A 3ZLHA 3HM7A 5BMXA 4O19A 3FSTA 5HWMA 5F2LA 3DHDA 5HR6A 4I7WA 5EPDA 4Q8WA 5G1YA 4JCLA 5D04C 1T40A 3TC6A 3DIPA 2V30A 1KV8A 2ANUA 1OHLA 3OEXA 2O7QA 4N7QA 4BI6A 4D8AA 2CLPA 1J6OA 1KLYA 2FJKA 2HSAA 1EHAA 3NG3A 5CPMA 4QJ4B 5TIMA 5LHFA 3OG2A 2PWVA 1XFCA 3SAZA 1U33A 2JEQA 3M0XA 1PE1A 2JE8A 5C55A 1B3XA 4C60A 4GZIA 2FGBA 1LT7A 5AHFA 5G4WA 3MCNA 1UZHA 4L9YA 2ZRXA 4RUBA 4HNOA 4W9TA 1FXQA 3PZUA 2J7DA 3U5UA 1BRLA 4PMVA 4JQ1A 4KQNA 1IWBA 2IPWA 2UZ9A 3WQCA 4Z1CA 1BD0A 2ZTJA 3TH6A 4DJDA 4JTTA 3PWAA 3MO7A 1NFPA 5ENLA 3TJXA 4F4RA 1J12A 2XU2A 2DIJA 3BE7A 3BLEA 4Q8PA 3TQVA 1L2UA 5A8MA 2YPIA 2VFIA 2OWWA 1EOMA 4QEHA 3QLDA 3NPUA 4DN1A 3NQ8A 3VIFA 3VIHA 3DDMA 3FVDA 3ARUA 3VNJA 2HISA 3VO0A 3OZOA 3WQVA 3EX3A 4KRZA 3LM7A 4A35A 4L9ZA 5FJIA 2DORA 3UR8A 2DJLA 3CJPA 5G2HA 3MUAA 5JVLA 5BXPA 3QJAA 1LWJA 5DBUA 4V1XA 3VD5A 5BRBA 4LUJA 3UG4A 3P80A 4GBDA 2AAAA 4GY0A 2Y1HA 4JX5A 4JPGA 3CTLA 3FYYA 5CC5A 2CLOA 4C7GA 4FXSA 1PIGA 2QR6A 4X22A 1BVZA 3C2VA 1RV8A 3NPVA 4IG2A 2H90A 3UPMA 4AIEA 4DLFA 3VGFA 5BRPA 3B8DA 4WOZA 1VFMA 3N6QA 4ATLA 3P60A 2AGKA 5I77A 2WVVB 1TELA 5EFDA 3LCGA 2AOSA 4JHOA 4IXHA 1ZTVA 2WNNA 4AEOA 3ZLFA 4WY0F 1WX0A 3ZWSA 5D8WA 1ZALA 5GNXA 1K9FA 2ODOA 4LOCA 5G4EA 4FAMA 3A3WA 4GABA 4GACA 2Y5SA 5DCBA 2CC0A 5LNSA 1CX9A 1BXBA 3GBEA 5I3JA 1MDLA 3RX2A 2IKIA 3VOJA 4AZCB 5EL1A 1E6QM 2FZ8A 4DPPA 4XZIA 2WKGA 3BG5A 3GO2A 4V28A 4DWDA 2D69A 2V8ZA 3AHXA 3NURA 1TA3B 2NQ5A 1ZPTA 4S3EA 3W1MA 4ROPA 2D3NA 1TZZA 4N6FA 3R8HA 3RYSA 1IT0A 4YYFA 1K7XA 1V7AA 1Z6KA 3KZSA 5D8ZA 3WSUA 4BF5A 2ZUWA 5DMLA 2VGGA 3P5ZA 1NWUA 3HQOA 3R12A 1DWJM 3QZAA 3VIMA 3LUTA 2VRKA 4IQEA 3MU7A 3S9YA 2DP3A 1DL3A 1E56A 1PWMA 3VNYA 4JDYA 1EJRC 2H9AA 1AW1A 4UFJA 1DIEA 3O0KA 5E1QA 4PCPA 3SURA 2P8BA 2DZVA 2INFA 3C0LA 4BY3A 4OECA 3BO9A 1OT2A 3TYUA 5BROA 3CM4A 4ZVJA 1T96A 2PDPA 2D2HA 1JAEA 4QCEA 3PTDA 4WIWA 5DX7A 5CSUA 1XM3A 5K9CA 4PTVA 5K4XA 1YMYA 4HSHA 1WAUA 3WJWA 4QITA 4GZ7A 1YE6A 4MY8A 3K8LA 3E38A 3W75A 5REQB 1LT8A 2WHLA 2TYSA 3IV3A 4P7NA 3CL8A 1K77A 2PLJA 3B03A 2E09A 1JDDA 2GWGA 1E3XA 1W3LA 1BXCA 4QAIA 4XSLA 1UR2A 1WDQA 3TCEA 4UXDA 3KUMA 3VD3A 1FCQA 1GZ1A 4ACZB 4HJWA 3AXXA 4GRSA 4J3UA 1GYNA 2E0PA 4Q6JA 1LF1A 5A94A 5CPSA 1TR9A 5GJMA 2VT0A 4R53A 4JTAA 4EPBC 3TA6A 4O16A 1Q2SA 1W8GA 4HZ6A 2WQDA 2EPNA 1SQ7A 1XLJA 3M5XA 1XLLA 3E3HA 1OG0A 2F7FA 3SGUA 1PIFA 4NNBA 3U5YA 4M6VA 4AZIA 4MNJA 4BZYA 1KO0A 3S2MA 3BOFA 1WKFA 3S4TA 3V16A 3EWCA 3G6LA 4LRSA 3DFYA 3MI3A 3L2MA 5HNNA 4J3VA 4R9XA 1RY0A 3E5PA 1IE7C 2RJHA 4CN4A 3S5NA 3MBDA 1ZU8A 1B3OA 1U1JA 2X1SA 5DXXA 4QE5A 4PMDA 1E3ZA 1J2BA 2OFJA 2E5CA 3LCFA 3MVTA 3FYOA 1XLFA 4LF2A 1BEUA 3APTA 2ZFAA 1C93A 3TJLA 3S5ZA 4H8VA 4LTSA 4GC3A 1XYZA 3KOYA 4AYGA 3VUPA 5B7YA 3NQDA 1R2TA 2ZA2A 3EKGA 1EP1A 3S1GA 3ICJA 4XWUA 3SSZA 3H4GA 4XK2A 3W23A 1GW1A 5DCDA 2NVCA 1MRQA 5MF5A 1R9ZA 4ATWA 3M7WA 2AL2B 3TJIA 4A3RA 2WVTA 4NYYA 3VGHA 2GJXB 3AROA 4KEUA 5I02A 2AMGA 3CO4A 2Y88A 3BSHA 4D1IA 2YL6A 2VTFA 3SUTA 3GR4A 4FXJA 2VHLA 3KEHA 1AQMA 3URAA 4U28A 6REQB 1HJWA 4XB3A 3VDAA 4PUDA 4HYRA 3VOGA 4S39A 1TCDA 1F05A 3RO8A 3WUFA 5CSYA 2E6YA 2Q09A 3PM6A 4GVIA 4DWSA 1NEYA 2ZZ1A 3PJUA 5LKYA 3SIZA 4JQ3A 3P8IA 3OVPA 1YE4A 1HN1A 4HCDA 2B31A 1JFXA 2O0TA 4EE9A 4HOWA 3RN6A 1TIMA 5C9UA 1GVSA 4MAZA 2D0GA 1ZNNA 2DZXA 1UC4A 1GZJA 4XIMA 5FOOA 4HK7A 2VZVA 4YTRA 1UR9A 2DZSA 2Y85A 1QDSA 4C5YA 1UWQA 1KM4A 1PUDA 1E5NA 2C15A 2PMQA 3RIKA 3OODA 3ZR4A 5C9ZA 3U2CA 2FMOA 4UCFA 3M9YA 3VKAA 2E67A 1E4NA 3CGTA 1ZBWA 3CHEA 2WMKA 3UWYA 2R91A 1R2RA 2NXGA 2V5BA 4NJIA 4QNWA 1X96A 3KTXA 1HVXA 1TV3A 3M0LA 2PDLA 5DRIA 1M5WA 4P8VA 3CBWA 4C90A 2F9RA 2BVDA 4LAUA 4F2UA 3THUA 2HNHA 2Z26A 2OQHA 4U2YA 3L21A 3MP5A 5G1TA 1XQLA 1G67A 1TMLA 4GKLA 2FMNA 4D6EA 2QCGA 3VMOA 3QR1A 2OO6A 1VPQA 4H1ZA 3MCMA 3E0LA 1RH9A 3I7QA 1AJ0A 4S3CA 1XINA 4D8ZA 1ME7A 3MZNA 4M1BA 4URIA 3ZVHB 4JBRA 3V36A 4UOQA 1ZENA 2YKKA 3KDOA 4AXKA 1KQYA 3ME3A 2ZX5A 4LSBA 4M29A 6CGTA 1E51A 4UTUA 1F3TA 1PJ9A 1WUEA 4DQWA 1KWKA 4FNPA 4DZ5A 2O4MA 2OQYA 3AC0A 5C70A 3O2LA 3AIEA 3SJ3A 1TUXA 4J4KA 3HQ1A 4NUWA 4D6GA 1UWAA 3G77A 4PRRA 1JG9A 3EX1A 3BCDA 1MXSA 4DZHA 3CB3A 4I9AA 4YWSA 1UD5A 1H3GA 4CD6A 1TRIA 4LVDA 4OIFA 3I4EA 1JYVA 1ISZA 1HL2A 4AAJA 4C6EA 1HUVA 2J8TA 2FQIA 4AD1A 2Z1KA 1VEOA 2F84A 3ABQA 3ARSA 5A95A 4DY1A 2QQ6A 1YXDA 1QPRA 6TAAA 3I7SA 4UZUA 3OIHA 1CDGA 3SIMA 3GC4A 3GNPA 2VUNA 4MKVA 2E6DA 4KWSA 4JICA 3SO7A 2XJ7A 1FDJA 2VI0A 5AYYA 3M0YA 2Z1XA 3S5YA 1QWGA 4YU1A 3RITA 1CW2A 1OGGA 3PTMA 5D4YA 4PUWA 3WDIA 5FAJA 2JF6A 4UTKA 2ZXQA 4DJEC 2CXEA 2CLHA 3O6DA 2J7GA 4JTKA 1B54A 2C79A 3N15A 2BOGX 3BOXA 3M0MA 4WEVX 3W7GA 1XYFA 1PIIA 3FXGA 5J5DA 3SY1A 1FH8A 1FH7A 3MSGA 4D6JA 2OZ3A 3PHAA 1SZEA 3BW3A 3NSXA 5CPTA 2PC8A 3EOEA 5E0FA 5AHNA 1JUKA 2BWGA 3E1F1 4GCAA 4D71A 3WLIA 1AH3A 1W56A 4MB4A 7TIMA 4RZ4A 1EDQA 3R4IA 2HZGA 2VD8A 4K8EA 4KETA 4QJ5B 5EMKA 2GUUA 5DEZA 1K8YA 2PLMA 5HMSA 4S3KA 2Z24A 4O0ZA 2WHKA 3HMJG 2XSAA 2XIIA 4M80A 2VZOA 3VNLA 3FCPA 3S1XA 3UJSA 3IRSA 4PBFA 1Z41A 3A6OA 4B2DA 6PTDA 4AX7A 3I3EA 3MMDA 1W5NA 1UUQA 2XSBA 1XQKA 2XFFA 4GZEA 3K5XA 3PR2A 3CYJA 1XLEA 1YPIA 1JD9A 4UTWA 1LWHA 1NDVA 3PAOA 4RDYA 2XH0A 2UBPC 2Y5EA 3GTFA 2BVWA 4TO8A 5KZ6A 1WA3A 5C54A 3OYZA 3N14A 1VS1A 4IIHA 5FD0A 5IBXA 1SZRA 5FKYA 2EG7A 4AZCA 1PDZA 1JPIA 2VEPA 1F7BA 4J5NA 1Q6OA 3H2MA 4DXKA 4IIFA 4KFPA 1TA3A 2PU1A 3GNRA 4AX6A 2X0SA 1NDWA 4BK9A 3DI1A 1VEMA 4US5A 1GKRA 1W8SA 3QW3A 1HTIA 3GR8A 3UGVA 4RNJA 4A29A 3CZJA 2YLLA 3AIBA 2DV0A 4JOMA 1BAGA 4OQVA 2VJXA 3EEZA 4ZQCA 1TKKA 4FP1A 5SWUA 4B5NA 1TJ1A 1XGDA 5I3FA 3TTOA 1JZ2A 3BC9A 1B2YA 5BU9A 3BLIA 2UY3A 2XM2A 4CNPA 3N17A 4A05A 3VIJA 3PTQA 4AHQA 3DBPA 4D9PA 4Z2IA 1HO1A 4GLEA 1JQVA 1WQ5A 1TO3A 2CHNA 2ALDA 3QMTA 3TNOA 1Q7MA 1LJYA 1P4CA 3OBKA 4L4PA 2GJRA 4LVFA 2BY0A 4M56A 1UA7A 1MQQA 1XIFA 2YX0A 1CIUA 5REQA 3GXDA 4MF4A 4PMZA 5D2VA 4WSJA 1P6WA 3WX7A 1PO9A 3EKZA 1NQ6A 3MTWA 2J74A 4Q8UA 2WLZA 1HKVA 2XWEA 1F07A 3VE7A 1DJQA 3IACA 3NOEA 4ACZA 1F3WA 1OX6A 3FS2A 4TVUA 1HX0A 3PP7A 5CJMA 4S2CA 4QDWA 3OGVA 2GSEA 4PMQA 2C1IA 1YIXA 2YJQA 4O18A 1J96A 3C56A 5A6JA 4XTDA 3NQ6A 2FKPA 3WQGA 4J27A 2G0WA 4N9BA 2YL8A 2VP8A 3TWBA 1DJYA 1RQHA 4FNQA 3MSRA 3UXLA 4H04A 4C6OA 1RD5A 1I2OA 4XISA 2RJGA 1W1ZA 1MYRA 1XKYA 1ZP3A 1VIZA 2NQLA 3KRUA 2FDMA 4TMBA 3M4HA 2WSYA 1ICPA 3MW7A 1J4EA 2R1PA 4X0VA 2D24A 3GW3A 4IUGA 8XIAA 4LAMA 1E6XM 2AKZA 2Z27A 3MDWA 3N18A 1F5ZA 3HFTA 3WNNA 4UQDA 1QRQA 1YTDA 3SN4A 1P0NA 3BQ6A 3W2KA 4EWJA 4BF7A 2FTWA 1OT1A 2C18A 2WJDA 3LENA 4O1BA 4A8NA 5C71A 3NM1A 1XLBA 1W3IA 4MFEA 1Z69A 4Q4OA 2FZBA 4LVAA 3UYIA 2DQWA 5FESA 4HKPA 2EJ1A 1AQHA 1R47A 4C6LA 3ITGA 4PFHA 4EK7A 5EKYA 3DCPA 4GIYA 2ZADA 1OWQA 1H1YA 2OEJA 1VCVA 1KXTA 3EDFA 2F6UA 2PEVA 4UTJA 3HA1A 1FWRA 4AZBA 1YDNA 1OC5A 3BTNA 4ROQA 3VXGA 4Z08A 3HF3A 3TSMA 2GJXA 3W27A 2VEGA 4DI9A 1KCZA 1K9EA 1RBOB 1TV8A 2HVMA 3IK2A 4CU8A 3TFXA 1FWAC 4N9CA 1A5SA 2R94A 3WH8A 4PULA 6REQA 4YXGA 1CI1A 2CYGA 1TV7A 4QE1A 2F38A 3WNMA 2VZUA 2VEFA 2PGEA 1TMQA 2OEKA 1UR3M 3OYXA 4PZVA 2ZZ4A 4TOQA 4O1FA 3DH7A 3R6IA 5CLWA 3OW1A 5BOEA 1C92A 3TA9A 3S8HA 2PDFA 2GGIA 3A9BA 2ZWZA 4A2SA 1X1ZA 1FWBC 4AIBA 2WWCA 3GH4A 3T07A 1OYCA 2ACSA 3WF4A 4TUFA 1FQ0A 1X38A 1MW1A 3WMBA 1E0TA 3BMXA 3I3DA 1GPFA 4N0RA 3VKJA 3W7KA 3B0XA 3M41A 2J7CA 4F40A 3AMGA 2YDRA 3CU2A 3BCJA 2E5BA 1EX1A 4HT3A 3ENLA 5GPRA 2A7RA 4LAZA 3T7VA 3WLSA 3F4WA 2PPGA 2XZ9A 5C0QA 1Z48A 4JN7A 2GJNA 4IMDA 1KD0A 3VD4A 1G4PA 3C8NA 1UA3A 3GDTA 1YPXA 2FHFA 4GYPA 4PEKA 1GGOA 4W84A 3CPGA 1JCTA 4LV9A 5A6SA 3G3MA 4Q32A 4WJ8A 1AH4A 3ZR5A 3PJWA 2C71A 1IEXA 5HWNA 2REQA 3ZVHA 2FFCA 3FHAA 2WSKA 1PCKA 2ZUVA 3H2NA 2XIBA 3R13A 1LROA 1XYCA 4XKYB 3UZYA 1GVOA 3AOFA 2YFOA 1OYBA 1AVAA 3BK0A 4NL1A 4O1AA 5BMWA 2R14A 3M5VA 2WO5A 3OTRA 4H8HA 3AJ7A 5ABFB 2GGHA 3KVKA 2GQ9A 2GGEA 3FVMA 4HIBA 1LCOA 2G95A 1IHIA 2V69A 1CGYA 3NZQA 2ZUUA 4WD0A 1IZKA 4E2DA 1HKJA 1E0VA 2YDQA 2P76A 1O5QA 4FPSA 4O53A 2ZIDA 3W01A 3BGJA 3L66A 3SFWA 3S1VA 4Q7IA 1GOXA 4I9JA 1XH1A 1ZFJA 5M1TA 3KZPA 5FF4A 5F2GA 3I4KA 3K46A 3JVAA 4N6EA 1XLKA 3S9IA 1WZAA 3H7RA 4K1WA 3QC3A 3P3BA 1SW7A 2A6NA 3W1AA 3E5BA 4PUMA 2YCKX 3MYPA 3SCQA 3VVGA 3WFLA 3VU2A 2B0MA 2PDJA 4JTSA 3CL6A 4AMCA 3O9NA 2PDXA 1OFOA 2J66A 1AD4A 1XIJA 3BARA 2VOMA 5BRQA 2BLEA 3M44A 4DBEA 1Q4WA 2XN0A 2E8YA 1TV2A 1UUMA 4QTGA 4CN6A 3GVGA 5HNRA 3FJNA 1ZHAA 2OTDA 1AG1O 2PDMA 1K1DA 3W73A 1ZL1A 1XH0A 4M24A 4TX9A 5GNYA 1KFEA 1UD8A 4O17A 3VNIA 3T0TA 5HOSA 4ZQPA 1S5TA 4KH2A 1UD6A 1KFBA 2XN1A 2Y7FA 4IIDA 1ME9A 4NVTA 1UPPA 4ACYA 3VDGA 4UQBA 1NARA 3W6LA 2VNCA 4F8XA 1D8CA 3FA3A 3HV9A 1G0CA 2X0HA 4JFVA 3LHYA 3M16A 5E09A 3ZMRA 1GOQA 2JK2A 3SCNA 3GG1A 1ALDA 4X9YA 4A3QA 1XGZA 5A8QA 2O9OA 2W4XA 4M82A 1TE1A 1TCMA 4IQDA 3SN0A 5DN1A 1TQJA 1H2JA 4L1GA 3UZWA 2PLCA 5C7VA 4LNCA 4CVUA 4JY8A 2WMGA 2FLIA 2WZEA 3SW6A 1KXHA 2AKMA 2QCDB 2HNEA 3A22A 1C9DA 3WLJA 2BNJA 4X2PA 4EOUA 3ZR6A 4H01A 1V3HA 2FTYA 2G3MA 1ZBVA 4B5SA 4W5ZA 4K2SA 1LBLA 3O6YX 1GK8A 4PCTA 2AAMA 2QULA 1KKRA 3NSMA 3WIJA 3VIIA 2AMXA 4GCXA 1TPC1 2GVEA 2WZTA 2J7HA 2PGWA 3HGRA 4AYSA 3GHTA 3G1YA 4DJED 4FOUA 4Z2LA 2PCEA 1SO6A 3RR4A 4J28A 2Q3RA 2PUZA 1PS9A 4AY1A 4QBXA 1Q2RA 1GEQA 1VFTA 2R1MA 3PG8A 3EYPA 2LLEA 3K2GA 3VZYA 6ENLA 4E8GA 1VCGA 3GTNA 1D3HA 3QYSA 1VEPA 1Q13A 2A3AA 3WBYA 2BXZA 5K9XA 2WNZA 3EOOA 3Q4DA 2EGZA 3S6OA 1OQFA 1DJWA 4E4PA 1P5BA 3EA3A 3V1PA 3HPFA 3ITYA 3QZ6A 3NO5A 3B8UA 3TTQA 1JUBA 4WKFA 4BWLC 5E93A 3GFYA 3RPDA 4O14A 2ZZ2A 3NEHA 1J0HA 2XFYA 4TU1A 4H19A 1V02A 2C0AA 2XIMA 2X7WA 5A2CA 3HPZA 1F61A 3REQB 2Z1VA 1W5PA 1YEYA 1TREA 2BFGA 3RPMA 3ZVIA 3LPFA 3KRBA 1DTUA 1TPB1 1VYSX 3LCHA 1SVDA 1U5VA 2UV8G 4DX3A 1P0EA 2DY3A 1ZJIA 3SCTA 3W1LA 2Y7EA 3W1UA 1F3EA 2J4GA 3P62A 4REQB 2FHBA 4FEZA 3GB6A 1O95A 1XWYA 5EMMA 2INZA 3CV6A 1E0UA 7PTDA 5A6KA 2J78A 3J7HA 1WKDA 2XVPA 3BURA 4K8HA 1LOLA 4KEZA 4GNVA 4HGXA 4D2JA 3MSDA 4HN4A 1V6UA 3IVUA 5LNUA 2J9ZA 2PAJA 3IJLA 1BYCA 1IR2A 3PZQA 5M2FX 4MB1A 4PODA 2GLKA 1T41A 4PCSA 4FR6A 5CSSA 3RNDA 3OO2A 3P61A 7XIMA 1TPWA 5IDIA 1TVNA 4KCVA 3WH7A 3M0IA 3QFEA 2ZQ0A 1S2TA 1S1RA 2FFIA 3WD0A 2Q02A 3T81A 1EJSC 1UG6A 1OFRA 1WOBA 3RU8X 4L9XA 4H9UA 5JIWA 2FH8A 1WO2A 5U7SA 1QTWA 3Q94A 3WH5A 2BXYA 3GLCA 1C29A 3KTSA 2PTXA 2XM1A 3WQ4A 4GNKB 5E0KA 1FX6A 2FPTA 2ACRA 1XUZA 1H1ZA 3QHMA 4S3BA 4CD5A 4WR3A 2BHUA 3DFQA 4HNLA 3LMZA 3QV7A 1M65A 3ITXA 3RK8A 3VTRA 3VKBA 3PUDA 4F0KA 1CXLA 2Y5JA 2VEKA 4H2HA 4ZA0A 2X05A 2OLSA 3DEQA 1B1YA 1Q6GA 1XIDA 1LLZA 3ARXA 1XFBA 3BAWA 4AH7A 1H7RA 4EPEC 1H7PA 3FN9A 2PRLA 1VB9A 3IGHX 3WLHA 3T0DA 3FAWA 1BWKA 4GI8A 4RPPA 2GJLA 1BWVA 1A53A 1SFLA 3PUGA 3CQHA 2BHZA 1O1HA 3O07A 4FLRA 3LTPA 1W37A 3W1QA 2D0FA 1XRFA 4MLRA 3HIJA 4HU8A 5AC7A 2PCQA 1OK6A 4QGCA 4IPLA 2YA2A 3K4AA 4E2OA 1EPXA 3JZUA 3NA8A 2XIQA 1ONEA 1IZJA 5JUVA 4AC7C 3FYPA 4DO4A 2OZ8A 3GDMA 5C2GA 2JALA 3K1GA 1HJSA 1IT7A 1T7LA 1W3JA 5AOUA 1R2SA 3GTIA 3O05A 3B0VC 3N11A 4HU0A 1XYMA 4Q4KA 3CH9A 3PUEA 3L2IA 3BLPX 3LHVA 3QY6A 4Z17A 4MB5A 2RGMA 2W0UA 2V3EA 3NXLA 2PBGA 4QDPA 3P84A 3BAIA 3MJMA 3TFCA 3ARTA 1GJPA 4F0SA 3MA8A 2V2HA 1TTPA 3FJ4A 4QDMA 3LK6A 3MBFA 2RDUA 3UY7A 3W7OA 1WUFA 3SCVA 3ZIZA 4ADUA 3N2OA 4FNSA 3R25A 1PHQA 3PY2A 1IZCA 3FOKA 1R7OA 5FI8A 3VUSA 4HNUA 3H4XA 3BJTA 3UA3A 3MUIA 2YCIX 5LGXA 4IX2A 4MTVA 3NQ2A 2ZXDA 3MKKA 1CT5A 1UP2A 4RPQA 4HNCA 2EPOA 3WQ6A 2QIWA 3B8VA 2QVHA 4PBEA 1DKWA 4ZB0A 3NQMA 4XKYA 1XCWA 2E4TA 5CAHA 1D9EA 1YDOA 5FJJA 3OA3A 3DYMA 2C1HA 1KM5A 1YADA 3QV8A 2OJPA 1QPOA 3FDKA 2HXTA 4JS3A 3B04A 3OPSA 5BZAA 1DE5A 1S5VA 5ABFA 3UWQA 1TSIA 4DPQA 1SO4A 2ZTKA 4RNHA 2XIJA 4UR8A 1CNVA 4KCWA 3WQPA 2F2KA 3V1HA 4F2BA 3W87A 1KCKA 5HR7A 4C7DA 1C8XA 3II1A 1FTXA 3WQDA 4GQGA 4EXAA 3FJLA 4GWEA 3L12A 1K4GA 1WZKA 4PCFA 1A4LA 1HJVA 4GBUA 1UWIA 5GJPA 2I5IA 4O1CA 1MQPA 1XKJA 4UNKA 3TTSA 4GX9A 1M7XA 1MFVA 3EX4A 4AG0A 2OYMA 1XUUA 2DZTA 4XZHA 5D2YA 1QNRA 4WGXA 2YBUA 2CHOA 3WQ8A 1MQRA 3WFAA 5A6BA 1VBHA 1CB2A 3BZGA 3WD2A 3GH7A 4BJHA 4MY9A 2NUWA 2XVLA 3V7PA 3IV8A 1A5CA 1K8XA 5C7HA 2PP3A 1B30A 4GJJA 4IUOA 4TQTA 4WUIA 3U3HA 4UMCA 1QT1A 3Q45A 2IPFA 3WLOA 3WD1A 1LZOA 4K6AA 1RP8A 3AUOA 3GVVA 3AYTA 2D2OA 2XFWA 1DIDA 4WKHA 2V63A 3COTA 1C90A 4CVWA 3PJTA 3L4VA 2OYKA 4XBSA 3DHFA 3QW4B 4O8RA 4GIAA 4JEQA 1ZBKA 3LRMA 4EF8A 2Q8XA 1MW2A 4QQUA 4G56A 4AMAA 3SECA 2EG8A 3HU7A 2YCEA 3MKCA 4S3FA 1J93A 4LH8A 4YWIA 2O9TA 4C6BA 1FFRA 5DELA 2YYUA 2QUNA 2QJMA 1Q7QA 4LEQA 1ZBCA 3AO0A 4DRSA 2JKPA 2GDUA 5AHMA 3FFSA 1R46A 4QX4A 3URQA 1XG4A 3H54A 4IWWA 3EA1A 4KWOA 4O57A 1V4YA 4RR4A 1W32A 1QO2A 2Y61A 1AUSL 4DBUA 1TE6A 4NXKA 1H61A 8CGTA 2G3FA 4JTJA 1GZGA 1RBAA 1PV8A 2W91A 4AY7A 1VJSA 1XL9A 3LBOA 5FF3A 3P8JA 4DJFA 1GOIA 4RXGA 1RR2A 2EXOA 5C9WA 2DT3A 1UOZA 3W1RA 4ZFCA 1GUVA 1XIBA 1K3UA 3PG9A 4R9OA 5FF2A 3RRAA 3PSVA 2VURA 2EAWA 2DU2A 3EDDA 1XDJA 4K68A 3UYCA 1WPCA 3OLIA 1ZS2A 3W83A 1UZDA 4WY0B 3CHCA 2OSYA 4GINA 3F03K 1OIFA 1TV4A 2G41A 2YXXA 3CLMA 4LUYA 1S2WA 3AMDA 2ZRYA 3UJFA 2WSRA 1U83A 4ICNA 2ZZ6A 4XV0A 3ZJ7A 1SZNA 3WNLA 4UFKA 2WANA 4H9VA 3WN6A 3W2MA 3W3OA 1E0WA 5A1AA 1KA9F 1KNWA 1R3WA 1IYXA 3TQKA 2OOFA 1R38A 5HUOA 1KGXA 2A3HA 1LQ0A 1DV7A 3HG4A 4HJFA 1KRBC 3W1NA 3TKFA 1H7WA 3VNMA 3RM4A 1DQXA 2GFTA 3O15A 3RLGA 3VIGA 1EOKA 2OODA 5E9XA 2GGGA 4QR6A 4W87A 1U30A 3PZNA 3AMLA 3W2NA 2YL5A 2VZTA 4E4UA 1DOSA 1GQKA 4S3DA 1ZAJA 4W8BA 4FX6M 2Y7GA 5LXXA 4PB4A 2FDSA 3PWIA 3FEQA 1NOFA 1QI4A 3EXRA 3T05A 3BLKA 4HPHA 4GQ0A 3Q67A 4ZO8A 3RAOA 1W17A 1W1PA 3Q37A 2YR1A 1FDYA 1FKXA 2Y4SA 4AEEA 4NYUA 3OZPA 2AQVA 4REQA 1CGXA 4YYCA 9CGTA 3O0FA 1LDCA 5ABEA 4KKXA 2B81A 2VDHA 2XISA 4WDUA 3TSDA 3WEOA 3W7JA 3SUVA 2BMBA 5LSMA 4B4HA 1Y8BA 4XX6A 3GY1A 2A3CA 3H21A 4AUBA 2VELA 2P1FA 1FCUA 1UD3A 4GY7A 3TZNA 2RDXA 3RILA 1LQ2A 2X40A 4IXXA 1EA9C 5GQBA 3EWYA 1B4KA 3PWGA 4CU7A 2V81A 4MUPA 3LERA 4XD5A 3PPGA 1YQ2A 1TB3A 1Q65A 3LGEA 3NEVA 4XD4A 4Y9MA 5F4WA 4ZE4A 1EGVA 3QQ0A 1JUEA 4MIMA 2JEPA 3BSGA 4JIRA 4NSBA 1NSJA 2GOKA 5ECVA 3BANA 5HATA 2YCLB 1UQZA 2QZRA 4EPDC 1E4IA 3WG6A 2FPYA 4BKNA 4IIBA 1PKLA 3MWCA 1EJWC 2PB1A 1PX8A 4FK9A 4GUGA 3R1ZA 1IEIA 3OLGA 5EMLA 2QCEA 2WPGA 5F7UA 4S3AA 3SFKA 5HANA 1R87A 4HD5A 1XR2A 3GIPA 3OZYA 1I8JA 1G01A 3SUSA 4HZ7A 4Q7BA 4EVZA 1DVJA 3WDPP 3K13A 3DKJA 2EPLX 3NPXA 4PSRA 4G7EA 1DIKA 1HJXA 1V3LA 2G4JA 1YRRA 3C2YA 2IKJA 1UZ4A 3U2OA 1OIMA 2OT1A 3DBNA 4BS0A 1JD7A 4W7WA 4KCUA 2PGFA 4UTFA 1BF6A 4MVAA 4MYXA 1E1CB 3G1HA 4US6A 3UWWA 3QV9A 3VCNA 3OB8A 2VFEA 3ZXWA 1VFUA 1M68A 2O9PA 3GVRA 4Q8NA 3KS5A 5E5CA 1QHZA 2WBKA 1CXEA 2YIHA 2NVDA 3N2CA 2DSVA 4LY4A 4P5UA 4W8AA 3WLRA 5CBJA 1UR8A 1J0YA 1TTJA 1RSCA 5AYZA 2ISSA 2YL9A 3WF0A 1KC7A 2DT0A 3D47A 4GJIA 2GUYA 2GSJA 2HE5A 4NJKA 4WXYA 5M17A 1DWHM 3LDVA 1SFJA 4ZOAA 3WCZA 3F7JA 1FHVA 3CWOX 3QVQA 4JL2A 3W70A 2QUVA 3OGRA 3ZLGA 1Z44A 5LYRA 3OHIA 3TZFA 3WUGA 2JIEA 1KBKA 3UJRA 2FVKA 3GDLA 3AYSA 3B9DA 4AXNA 5TNVA 2W5FA 3PB0A 3TEVA 2V68A 4MG4A 4AWTA 1Q4NX 2YZRA 3ZJ8A 4A2RA 5HJYA 2R9RA 3GM8A 3BG9A 4A6GA 4M81A 1LG2A 4NG3A 4I8DA 3W7PA 5KINA 1US3A 2GL5A 4FOJA 2NLYA 2W62A 1QW8A 1VFLA 5ABHA 2VQTA 4ALDA 3QBUA 1XLGA 1RK6A 3UXIA 3QY7A 2IQ0A 4M7TA 5D2XA 3KP0A 2PD9A 2VD9A 1GT8A 5AHEA 4RZ5A 4DELA 4LCQA 3C3NA 3PPCA 3W24A 1OBAA 2PDIA 2HROA 2JF7A 4NAEB 3W37A 3CZ8A 2GOUA 3CQJA 1HF6A 5HQEA 4ICMA 1EQPA 1VHCA 4ERAA 1QUMA 2DVXA 2WV8A 5FJUA 3E2QA 2HK0A 2NW0A 3PUOA 4UB9A 1Q6DA 3LQGA 4O8AA 2TODA 5EGRA 2OOGA 4G1NA 3M6YA 3CASA 4CCCA 2XIOA 3S5OA 1XBVA 1T99A 3M0VA 3EZ4A 4GQQA 3PB2A 8RUCA 4PE8A 4PGLA 1M7PA 5EMYA 5A5WA 1F4AA 1BPLB 3E9AA 1TWZA 4Q33A 1EP2A 1ENUA 2YZ5A 2QXWA 1EC8A 4B5WA 2WBGA 3AZRA 4QE4A 1HFBA 3EDEA 5HUPA 3W7NA 2DUAA 1EFZA 4CUCA 1IV8A 1J0IA 1GVQA 3WLKX 2W27A 1L6GA 4GQRA 3G0UA 4LYKA 3UCCA 1EXPA 3UPBA 1W1A1 3GC5A 3UR2A 2P53A 5FA5A 3TP4A 1YX1A 2BX7A 2ZZ5A 5I3GA 5HK4A 1Z3NA 2V38A 3NXFA 1FWWA 2R82A 2VFFA 3ZYZA 2CLKA 1BVWA 1JDFA 1OJXA 3V5CA 1LUCB 2BASA 5DY3A 1JZ6A 2DGAA 3ITLA 3BICA 1HKMA 2QUUA 1E9ZB 3LSBA 4CNNA 4OBTA 4PMRA 4RE0A 1JCJA 3CT2A 3IUHA 4D6IA 2DZPA 1JZ7A 2XGIA 1QFEA 3NO1A 1I2QA 1G4EA 3EOUA 1J2WA 4CD7A 5H91A 1AJZA 3KL0A 2A3LA 1JFHA 3DG6A 4TX8A 1KCLA 4Y2WA 1BG9A 3BG3A 4HA4A 1U1HA 3XIMA 1OY0A 1XBYA 3M5ZA 3LB0A 3B0UX 3OQ8A 4DF0A 3H2AA 1XIEA 3WUEA 3H2EA 1HJUA 3PZGA 4C1KA 2Y2WA 3BV4A 3KHDA 5HPOA 1VPXA 5M5DA 3GNDA 2NSOA 2CLIA 3O06A 4AY8A 1YBQA 4RDVA 1GVRA 2WCGA 3W7IA 2QPXA 4Z1AA 4IP4A 4PTXA 5AVNA 2H8XA 3VNKA 1NAL1 5JXQA 2IMRA 5AY7A 3AIRA 1UPMB 1VJZA 3PK7A 3A21A 3NZ1A 3N9KA 4C6DA 2YB4A 1GOKA 1HNYA 4KWWA 1TPUA 2DJXA 5I03A 1H4PA 1ADSA 4POCA 3HBLA 1P7TB 2ZDRA 1QPNA 1AQ0A 1OD8A 4KWUA 5HWJA 5JBEA 3A9IA 4M5PA 4OU1A 4R33A 4OUIA 2E9BA 3KLLA 3CUHA 4UBPC 2WSQA 3RCMA 1CXHA 3WD4A 5AFDA 4JN6A 1ITUA 3CIXA 2G3NA 1Q8AA 4O50A 2PDHA 3KWXA 2CXGA 1PXGA 3LHWA 3LTYA 4NX5A 3FK4A 4GMEA 1D8WA 4JIHA 2BGQA 3RG6A 3WEZA 1XSIA 1S5MA 5CPOA 2FTPA 3RLUA 2O56A 4IT1A 4UQAA 1CXFA 1GG0A 1DPMA 4O1DA 3TXZA 1ITQA 5D2WA 1C9WA 1G4TA 3T6CA 1WDSA 2NWRA 1XS2A 4H4IA 5XINA 1GNXA 3UQNA 4C6IA 4LAOA 4C5ZA 3JW7A 3GTHA 4DO5A 4D1JA 1XIGA 4DJDC 1RVKA 5ECUA 3OVRA 4JTHA 3SQLA 4TV5A 4MM1A 2NX1A 3THAA 2J6VA 2I16A 3QN3A 2EKGA 1JCYA 2NT0A 4HVXA 3T4CA 3AHZA 3S6TA 5CG0A 1OZQA 2JKEA 2RUSA 1B31A 4B15A 5AKQA 1H62A 3MY9A 3IANA 2TRSA 3LLXA 3PF3A 4DWSB 5IHSA 3O3RA 3TYCA 3LHTA 4DVOA 3UWZA 4KS0A 4OZOA 3N9SA 2HS8A 3GFXA 4GI4A 2G97A 3EGJA 2Y89A 2DQXA 3UR5A 2W6RA 4JFSA 3B8SA 2E9MA 4ZO7A 3IEBA 1NELA 4JTGA 1TPEA 4FF7A 1NDZA 1ZRQA 4EXBA 1P0BA 3E2VA 5BNKA 1K6AA 1V0NA 2NWSA 3PN8A 4ENLA 1UOKA 3GG7A 4B90A 4MWAB 5D05A 1I1WA 1VYPX 3BLLA 3R0KA 2R24A 3LGGA 4A8IA 2CWNA 3U0HA 1IEQA 4DI8A 3EWZA 3FEMA 1UKTA 1QBBA 2VCCA 3C86A 4CNTA 1F3XA 3WK1A 2A21A 4LCSA 3U7BA 3LQLA 5T8GA 2YCLA 4JTRA 4EF9A 4Y9AA 4C6PA 4RW5A 1EWDA 3L0GA 1VJIA 4K7YA 1J0JA 3GUGA 1QNSA 1K7EA 1VP5A 3PBWA 2VENA 3Q58A 3TU9A 4U4MA 4WDWA 1P1MA 3DFPA 1HIZA 3BCFA 3UWEA 4XAGA 3WDHA 2DZWA 5DLCA 1PTDA 3W9ZA 1CGVA 5CPNA 4HA1A 2OCZA 3I7RA 3SDOA 1XCFA 2QT3A 4KGJA 2J6XA 2F61A 4DYKA 2EJAA 4AZ5A 3ZSSA 5I6SA 1MNZA 5D02A 3RM9A 3R8GA 3W07A 1E1CA 3B97A 3E49A 3OLEA 2UY2A 1A3HA 3L2LA 1LQAA 3LN3A 4AU0A 4F0HA 3MWAA 1O60A 4XO7A 3GNXA 4TIMA 1GJWA 1RLDA 1ICQA 1XDLA 3WNPA 3DG3A 3AFBA 4A3UA 3QSTA 3FJ6A 4JGDA 1R5YA 3OBAA 1R85A 5C6MA 3WLMA 1EKOA 1CWYA 1HXJA 4H83A 4M0XA 2D1ZA 5AHIA 3ERPA 1UWUA 4NAFB 4CQ9A 5HMFA 2IKHA 3WJXA 1WYIA 1FWGC 3RCYA 4QLJA 3CQKA 2OEMA 2DZBA 1HZYA 1OF6A 1NWRA 3BSMA 3NQVA 1XGEA 4ICCX 3VK5A 3GDKA 5B7ZA 2NUXA 1G9HA 1QI3A 4MMWA 3W7EA 1AL8A 2QDDA 3ZJKA 1VAHA 1GW9A 4Z0SA 5C9XA 4U2ZA 3VNZA 1X8FA 2MUCA 3NYZA 3HOJA 1K02A 2ATMA 4N2YA 3OG3A 2C0HA 2VQUA 5LA2A 4FOKA 2PDGA 2ZX6A 1JPHA 1WDWA 2QF7A 3U48A 3OP2A 2ZUMA 4B4FA 3GX9A 1K03A 4EIVA 1OFPA 2C16A 2E3ZA 5XIMA 4M7SA 1JYWA 1ZLPA 2MNRA 1QK2A 3N04A 3S46A 4HHHA 1JJKA 3LRLA 2Q8ZA 4KPLA 1C3FA 1F74A 4NAEA 3GYEA 1WKYA 3EX6A 2ZVRA 3THDA 5AC6A 1LG1A 4RCXA 1EBHA 3TYDA 4DO6A 5BYWA 5H6HA 3B8TA 3VABA 3KVJA 1B3ZA 1ISWA 2ZC8A 5D9MA 1CZ1A 5C8BB 3P0XA 3MI2A 1KW1A 2UY5A 3C2EA 1M7JA 3R89A 3IAQA 3KHJA 4LUSA 2IW0A 3WDQA 5DQPA 2ZUSA 4HZ8A 3NOYA 3BJSA 2Y70A 3V75A 4K1GA 3A3XA 1MW3A 2GVLA 3DAQA 3ZQ9A 3TW9A 5KMYA 4PB5A 1NIUA 2V82A 5EY5A 2A6LA 4Z2KA 2IPJA 1EQCA 4IICA 1H49A 5IOBA 2VOTA 5A8OA 9RUBA 2YSWA 3VIKA 5D03A 1A5UA 3QR0A 3EPOA 1S46A 5A6MA 1XXXA 2E9LA 5BWFA 4FMVA 4YHEA 4TVCA 2O55A 2YDAA 2BVYA 2OT0A 3H2OA 2DT2A 2Z2UA 1SU5A 4F79A 2XH7A 3ONCA 1OFQA 2A1YA 2YBTA 4F0RA 3H6OA 1S5NA 4JTQA 3WKZA 2CESA 3L5AA 1E55A 2OZ0A 3WDJA 4UFHA 1FWSA 5CZ0A 3P67A 4PUUA 4XG1A 3WO8A 1GHRA 5KETA 2W61A 4IPPA 2NSXA 5F2MA 3CQ0A 1EJ7L 2P3EA 1LUCA 4E4FA 4G6CA 4HYVA 3AIVA 4HZMA 3W0KA 1CLXA 4LNYA 4DWSC 4JFUA 4IJBA 3DFSA 1IXPA 3W85A 4RV3A 3ANVA 4TTGA 1S2AA 5LA0A 3NNTA 3RJXA 4UFMA 1VF8A 3O6CA 4AWUA 3HO8A 3UNTA 2PGRA 4JQAA 1E6ZA 2QGYA 3W81A 1V3MA 4GOAA 4HMDA 3QGAC 3OVGA 3HQNA 2ZRVA 1WOAA 2ZRZA 3BW2A 2D23A 3ITTA 2X09A 3CAQA 4D8LA 2V5DA 4M8UA 1KM2A 2QGHA 4WDXA 4GXPA 1ONXA 1OSEA 4HMEA 5E70A 3T4WA 1NY1A 2PA6A 4H9MA 1UHVA 2X42A 3ZJ6A 4C6QA 4EX4A 1VBRA 3KOXA 4J2MA 4NJJA 1EF3A 1R3SA 2NXIA 4FLOA 1LM1A 3SCUA 3ZT5A 4ECLA 2WZMA 2WQPA 4F9JA 1SUXA 1OFDA 1Q6RA 1J5TA 1W31A 1EGZA 4Y9NA 4QQ3A 4XBKA 4IMCA 5EFFA 1S2VA 4GNJA 2ZZ7A 1DWFM 2HQAA 1HO4A 2FIQA 5GVJA 2PWEA 4ZSTA 1G1YA 1G5AA 2PDQA 3H70A 4MKNA 3FX4A 3FKKA 1A5OC 1KKOA 1P7TA 1E15A 4LYQA 3NGJA 1X6UA 3DGBA 3RMJA 1UBPC 1IXNA 3Q65A 1TJRA 5A6AA 4NNCA 3V3WA 1W3TA 4KW2A 3FA5A 3RLVA 4FX8A 3TC3A 2WMIB 1NOUA 3G1VA 3B05A 1RJQA 3SCPA 1JZ3A 1OD0A 3GBDA 4ZENA 4MJ4A 5BXRA 3ARWA 4J3ZA 4KT2A 1EHNA 2X7VA 4UMAA 3TC7A 4ZGYA 3GUWA 4PRTA 1GOWA 5DMYA 4YTSA 4TV6A 2Z6JA 4XBJA 4JN8A 4RDZA 3EAUA 2V5JA 2ZX8A 1R3YA 4HU3A 1EZWA 1WB0A 4F9DA 3DI0A 3N2XA 2CW6A 1PBGA 1UKSA 5FEWA 2FVMA 2A2IA 5FSDC 1UMYA 1UKPA 4N42A 4U3AA 4YCPA 2DH2A 3ZT7A 1BFNA 1FP8A 2GZXA 5G4HC 3TYZA 3P2VA 2P3ZA 2PF0A 1QNVA 5I5RA 3IIXA 1N8WA 5KZEA 4MDOA 1FWNA 3H55A 2BZNA 4FB7A 3TNBA 3UG8A 2X0YA 3QC0A 4ORIA 2I5QA 2QS8A 3LPOA 3UU0A 3JS3A 3NIYA 3NVTA 5AYXA 2ABBA 3GE7A 2PZ0A 3LI0A 4AVNA 5FCZA 3NZPA 5I2UA 2WKLA 4MYAA 2FZMA 2Z2BA 1Y5WA 3AXIA 4HSOA 4UTMA 5LIUX 2BG5A 4IFKB 4I8YA 3GU9A 2ABAA 4HCHA 4I5RA 4PTWA 3AXKA 3G1AA 3W7HA 3AU2A 2QPSA 2XSXA 1VHNA 3DKLA 4P2VA 1BQGA 1HQTA 4IMAA 1QI5A 4QXIA 1XLHA 4I90A 2DSUA 2NXHA 1R3QA 3LNMA 3WJSA 1O94A 2JIWA 1E6SM 4ZO6A 2PS2A 3K4DA 2VVSA 4MWAA 1IWPA 2QUMA 4G8TA 4JY9A 1EEXA 4JKLA 3DU0A 5LNWA 5MKGA 1HP5A 4I5UA 5C9RA 4PUEA 4N02A 2CKRA 1CGUA 3LG3A 4UTWC 2VGFA 1O5XA 3BLOA 1ISVA 4YVPA 5TAOA 1MUWA 4HU4A 4FR1A 4J40A 2QAPA 1P43A 3WBWA 1DBTA 4HPGA 2REQB 5IBXC 3EBVA 2OELA 1EXBA 4DJDD 5JH1A 1GPWA 1H5YA 3GXNA 3CHVA 2I7GA 1OC6A 4XD3A 3TN3A 4FXRA 1UWRA 3GXPA 1BVNP 4ERIA 4IH3A 2EPHA 4TMCA 3QV6A 3BH4A 3KBWA 4EXQA 3ZO9A 2XH2A 5A8GA 3UA4A 1JZ4A 3E2RA 1EGMA 4HPNA 3W28A 1WXYA 1V93A 2J27A 1NTHA 4DHGA 2BGNE 3NTYA 4B5TA 2QNEA 3VAVA 1WDPA 5DT7A 3F2DA 1N7KA 4LU0A 5DXYA 3SBFA 4NZ1A 4LVGA 3GG0A 2D20A 1O1ZA 4PTMA 2CU0A 2J7EA 4FA3A 5KTLA 4LBSA 3EMCA 1BYBA 1WBJA 4J9JA 4H9YA 3CLWA 1IIHA 4KRTA 3IK4A 1ZAIA 2QV4A 1YW1A 2OO0A 4NAFA 3PPFA 1TX2A 3UZ5A 3BLFA 4C6FA 3ELFA 1D7KA 1OB0A 3MMWA 4HP5A 4NRSA 4XZWA 3LY0A 2BY2A 3WY1A 4GFIA 1B3VA 5AZ1A 2ASHA 4N9DA 3R0DA 4H6EA 1PX3A 3MPGA 3ISIX 3IAPA 5AB3A 2OX1A 4DBSA 1R30A 4FLQA 2CBVA 4TVDA 1NDYA 3A5VA 4RX0A 2ZA1A 3SR7A 2BODX 1GG1A 3VDCA 3OGSA 4C1NB 1B3WA 1US2A 3CUZA 1RCQA 4Y90A 3AZTA 3QEZA 1KM1A 1I0DA 2WCAA 1M7OA 3ARZA 3EB3A 5CPLA 3KOFA 3WYZA 4QNEA 3PULA 3R0UA 4UTHA 3G18A 2PLKA 4RZBA 1M04A 5IFTA 3WK2A 1EX5A 3GFZA 1I2NA 1E6NA 3QMSA 2GK1B 2J9XA 3N4EA 2E6AA 1MFUA 1MEWA 2AGTA 3SSJA 5TQLA 5K9DA 5AYIA 4DF2A 3W2LA 4Y96A 1JRBA 3CWNA 4GI6A 4L56A 3Q2DA 4UWMA 4ZFMA 3NQEA 2XN2A 1R0MA 2H8ZA 4Q4RA 1PVNA 1AJ2A 4NZ4A 1J10A 5IHRA 1CYGA 2RH9A 1YTEA 3TLQA 1E9LA 3S5SA 4PL1A 4ORMA 3LS9A 4AQLA 3N6JA 1PKMA 1TIWA 2QDGA 3MUZ1 2D2GA 3RR1A 2H3BA 2WPBA 1JXJA 3QFWA 3DXIA 1R86A 3EWXA 1SR9A 3NQ7A 4LW7A 5FJOA 4XIAA 5C5YA 4NIRA 3ALFA 3IVTA 3G5EA 4H6KA 4PMUA 4E8CA 3M6DA 1YHTA 3B9OA 2Y24A 4B9ZA 5CEWA 1H0IA 2WKJA 1OC7A 4WGHA 3KE0A 3O6AA 1KXVA 1H50A 3GQYA 3UP8A 2X1IA 3VGBA 5I06A 3AWOA 3XISA 1HP4A 2ISFA 2R1LA 5CH9A 1XC6A 2W3ZA 1R9XA 3S2CA 2GGJA 4O10A 3QH2A 5JBDA 1LP6A 4JZ5A 3W7CA 5A6LA 1RVGA 2DZAA 1H1NA 2QJNA 3ARQA 1UQYA 4HCLA 5F1UA 4CU6A 4HHLA 3G1DA 3E0WA 1U5JA 4CGTA 2JBMA 4X3ZA 2WJZA 1E40A 1TWDA 1ZB5A 4B5XA 5KITA 1R9YA 1DQUA 1UROA 3DGRA 1EO7A 1XP3A 2C91A 4OKDA 1NF7A 4JIQA 4BI5A 1JCNA 5DANA 3WF1A 3FAXA 3T2OA 4JYFA 5F4SA 1FXPA 1JZ8A 3S0CA 1VLIA 3VX1A 2R8WA 3VPLA 1SZGA 2PWDA 4WZHA 1XV8A 1QXLA 4JHMA 4Q8QA 3POCA 3UXDA 4MSSA 4GYFA 4IPNB 4JFTA 1EUNA 3MV11 1LOQA 3W2JA 3SQMA 3WL0A 1F6PA 1TWSA 3VM7A 3KX6A 1XLIA 4JNYA 1LRNA 2CLEA 3O63A 4D6CA 1E9IA 3DHPA 3TIMA 4Q3MA 1NU5A 4AIOA 3N2MA 1PEZA 3M0ZA 4FXFA 5G2WA 2EQDA 2NT1A 1JQXA 5HBFA 1HVQA 2ALRA 4M19A 4GYPC 1YXYA 4ASTA 5DFAA 3ZOAA 3AMKA 5CLTA 1FOBA 3ABZA 1KXQA 4IGSA 7CGTA 1GTEA 3L4YA 3EDJA 3SQSA 1RLCL 4L4MA 5BU6A 4QISA 2EG6A 2J75A 3IGXA 4LGXA 4UQ9A 1QATA 5A2BA 1US0A 3NCOA 1F9CA 1NQKA 3N73A 3W82A 1EJUC 5E9AA 2C8NA 1AFSA 3FGCA 4Y8FA 4JNZA 1Z7AA 1EA0A 1XW8A 4BQ5A 3F1QA 4H2CA 4YVXA 1A49A 1H51A 3L7RA 5C2CA 1DJZA 5AECA 4R88A 3G1FA 4JTCA 3DG7A 4PMOA 4GO9A 4FHAA 4HSNA 4O1EA 2WMIA 3C8FA 4DWSD 4Q4QA 5CGQA 2XDFA 5H1WA 3AIQA 1GJUA 3WLLA 1A5LC 2QAFA 4YTQA 4A8RA 1QNPA 5IFPA 3PZVA 1O6IA 3A4JA 3P82A 1WP6A 3LU2A 1N8FA 2GSHA 1VPYA 4MLJA 3T0BA 4AD5A 1A3WA 1H63A 2V2DA 4L7ZA 5LZLA 4IPIA 1HW6A 1HKIA 2NZLA 3EDKA 5HJXA 1AMYA 3C0QA 1WNOA 4BA0A 4KMQA 2XUCA 1W3KA 3AAMA 2BTMA 3NYDA 4Z1YA 4LUIA 2ATSA 2VR4A 3RLHA 4OOUA 4IOTA 4KIRA 4YTUA 5T26A 3SRHA 4MADA 3W1XA 4K8GA 4X0NA 4M3PA 4ZQOA 1KTBA 3UZZA 1XC4A 1RAKA 3SJNA 3L5MA 3UW6A 2CWXA 1SSDA 4LBUA 1SPQA 1XYBA 1K4HA 1CTNA 3S1WA 1UH3A 1A0DA 1DIOA 4MHBA 2VEMA 4P7QA 4KFNA 1R8LA 1K8ZA 3PFRA 4IJCA 5FIPA 1V0LA 3ES7A 2B7QA 2CITA 5BOFA 3TV8A 3CMJA 1Z42A 4IFKA 7TAAA 1ZSXA 2OB3A 2A85A 1DWIM 5DF0A 4LBRA 4OE7A 2JGYA 3S2LA 2D73A 2TPSA 1FUYA 1EC7A 2QDHA 1XLCA 4XSMA 1VQTA 3GHRA 3L5LA 4OVXA 3QXBA 2CBUA 3WH9A 3MSYA 1UB3A 4E8DA 2PWUA 3A4XA 4B3ZA 1L8PA 3CUIA 3GTXA 3WQWA 2FPVA 1LORA 4I6VA 1RA5A 2V5LA 3M64A 3D0CA 5LA1A 2D0HA 2IKGA 2YGYA 3IJ8A 4AF0B 3WLNA 1VR6A 5M3WA 3QKEA 1AZ1A 5J04A 4LALA 2PODA 3F4DA 3TAKA 2G8ZA 4WRHA 1BSIA 1EO5A 4NF7A 3IJDA 4GO8A 3N25A 3TK7A 4BQ4A 3CIVA 5JMUA 2G50A 3PNUA 5HQLA 4KERA 4DNHA 3E0VA 2NX9A 1KR0A 1DE6A 1M9HA 2OMAA 3OBEA 5CZSA 1XLAA 4GKTA 1OGSA 5U4NA 4HK6A 2ACQA 4R7JA 3C3UA 4EANA 3F5LA 4HQVA 2HJPA 1EB3A 1GEHA 3U57A 4UMBA 1ELSA 3AHYA 4PMXA 2E77A 3HPXA 3LLDA 3ARRA 3B9NA 1E1FA 3NL2A 1VCFA 5TBOA 1X97A 2VC5A 4C6MA 2V2CA 5F4XA 1X7FA 3OVQA 3WK3A 1Q8JA 4G2DA 1SGJA 1X8CA 3TX9A 4K36A 1LLWA 1KM6A 1MMFA 1JPMA 3N3TA 3M43A 1HL8A 3E02A 4ZE5A 3USBA 1RK5A 3C6CA 1B9BA 4C1LA 3VCCA 2HDJA 2ZX7A 3VDBA 2HVOA 1TWWA 2W92A 3RUBL 1KBJA 2CLFA 3AXHA 1FWHC 2J8FA 1ITXA 2AQWA 1F4HA 3K8MA 5A8PA 2HTMA 3FXYA 2IQTA 1L9WA 1DWAM 4Q22A 3W6MA 1SJCA 4KRUA 1YTKA 5CXPA 4EKJA 3CTTA 4V27A 4LUTA 4HHMA 4NZ5A 4LS2A 4MY1A 1TPVA 1VGAA 2CBIA 4C6KA 3NFUA 4DZAA 4GYKA 3GNNA 3KDNA 1UJPA 4FS9A 3VMPA 4L6DA 1E5JA 2FH6A 3CAWA 4B2DD 3RXZA 1KWGA 1QVBA 3E6EA 1B57A 3VM5A 3G0SA 2WNQA 1DTNA 1UWTA 1VFFA 3LEPA 1F6KA 1FRBA 3AJXA 4Z1DA 3VKDA 5AC8A 3HB9A 2ZC1A 3B8IA 3DFOA 5DMMA 1BHGA 1OF8A 4C1NA 5I24A 1D7FA 3CZEA 2YOCA 1K70A 4AVFA 2CHRA 4DF1A 1F8IA 2VMFA 4DM1A 4WDTA 1QI0A 1FA2A 3HQPA 2E5DA 1GORA 3GXMA 3DC8A 3R10A 4GI9A 2DUXA 3MC5A 4ZXLA 4LY8A 2C7FA 4US5D 2IUZA 5EMJA 4HPJA 1WV2A 2ISWA 3IGUA 1LL7A 4B92A 4WX2A 4OT7A 2GK1A 3L23A 1J0KA 1F6YA 1RJRA 3GS6A 5HPCA 4CKQA 1FY6A 2EF9A 3DFTA 4B3KA 2J7BA 1E0XA 5CC3A 1RY8A 4H9TA 3TXVA 2PE4A 3GU2A 4UUIA 2BSLA 2RAGA 3LXCA 2OSWA 1UYQA 3H4WA 3GAKA 3F5JA 3MYOA 3MVIA 2PD5A 4S2BA 2O7SA 3GZ3A 4GIRA 1BGGA 1RPXA 1EEPA 3MI6A 3P93A 3FA4A 4GJ1A 3D3FA 1ONRA 3EOLA 2Z1SA 3GVWA 4S1FA 2C19A 1VRDA 4GUHA 5EU9A 4Z1BA 4J7RA 1SMDA 4NRRA 3W72A 4UZSA 3FDGA 2QCFA 4U33A 1PWLA 4HMCA 3EPNA 1BYAA 1VBGA 4PSPA 3VC5A 2WB5A 2ZICA 4IGHA 1E70M 4YL2A 4I9TA 2X41A 3N4FA 3BDKA 1AL7A 1DJXA 1KM0A 1CPUA 3UBPC 4QROA 1X7IA 4UTTC 4K38A 3G8RA 2J9YA 2YB1A 3GH5A 3TN4A 4RNFA 2QJHA 2VVNA 3BJFA 3NQCA 2PZNA 1OINA 2WXDM 3LPGA 3NVDA 3T1GA 2VX7A 4OUEA 4V1YA 4Z2JA 4MKSA 1S38A 2QLYA 1B90A 4KBXA 4R5EA 2CKSA 4X61A 3QPYA 2VX6A 2G3IA 1SZFA 1W3HA 4V33A 3N2BA 4AVOA 1W9VA 3ARVA 4TTUA 3G1SA 2W79A 4L65A 4MZYA 1V08A 1N82A 2GYIA 3QTPA 4H6QA 1JCMP 4PL2A 5LNRA 2CLLA 4ZSUA 2CNCA 2I17A 5D33A 4WF7A 5KEZA 4JKKA 2PU0A 3QZEA 3VOHA 4WQ6A 4MAVA 3UGRA 3E74A 2KAUC 1I60A 1FCVA 1I6NA 1M01A 3AXMA 4FALA 3APGA 1W5MA 4EAMA 4FIQA 3SY5A 3W00A 3KBJA 5F2IA 2W9MA 3USZA 3SCSA 2J25A 2VGIA 3XINA 1JYXA 3QOKA 5IM51 3IARA 2YA0A 1CLKA 4TXEA 1A5NC 4AC1X 1H7NA 1QU4A 5JBFA 2QDEA 2C1GA 5E6YA 3QLLA 3WBAA 3OZMA 2PDKA 2YW4A 3HZ3A 4CD4A 2ZUNA 4XZBA 1ONWA 1GTHA 4IZGA 3BUVA 2PWFA 1H11A 3JRKA 3CAVA 2ZRWA 1UIPA 1UD2A 2XZ7A 1XYAA 3LHZA 4RDWA 1PTAA 4MB3A 1VBUA 2YXGA 1W9UA 4PMYA 7ODCA 2ZKMX 1MSSA 4INFA 3EMZA 3VNDA 3U9IA 3EA2A 3KCOA 3TN6A 3ZSTA 2GQ8A 3BAXA 1DEDA 3W1PA 5JQ9A 1MEHA 3S42A 3PZTA 1BTMA 3WFZA 4DUXA 1V5XA 2V3DA 4NZCA 1G7VA 3IJ6A 3TTEA 5EMUA 4GGBA 5J8LA 2BDQA 3SRKA 3P7YA 4IFOA 3T55A 2E68A 4JHZA 2CZVA 4W7VA 2PDBA 1SYTA 3VKCA 4K7VA 3G8EA 5HQMA 3KBVA 3N12A 5FEPA 3HGSA 2OQLA 1HGYA 3GKFA 5HINA 3KRZA 4S3JA 2XHYA 1NFBA 3ATZA 1CGWA 5D38A 1OX4A 5DRCA 2VDIA 3KOZA 8XIMA 3VGDA 2CZ5A 3ABRA 5CAKA 2ZXAA 4G7EB 2CZFA 3LI1A 1SO3A 3WZ0E 1Q3NA 1WBHA 3UF9A 7REQB 1LRTA 2CERA 3GU1A 3AS3A 3DFHA 1UC5A 3LTSA 1FWCC 2ON3A 3UXAA 3UR7A 2IPGA 3SZ8A 3N34A 1BGAA 4NU7A 4BQ3A 5I3IA 3CAKA 3R7MA 3D3AA 1QNOA 3DN5A 1V02E 2JGQA 1Y5XA 5CC7A 3K1DA 3R79A 3NL3A 4GD0A 5I07A 4ADTA 1S1PA 3T08A 2RDWA 1DQWA 2EEXA 3G2GA 2VX5A 1XLDA 4Q8OA 2IXVA 3U2EA 1KRAC 1AD1A 4FLSA 5D9PA 4UCGA 1KTNA 5A69A 5L9FA 1QBAA 5D9NA 1KBBA 1E6PA 3AYVA 1JZ5A 3UXKA 5G1MA 4QP0A 2JQXA 3SRDA 4WCJA 2DVUA 2OKOA 3UG3A 3PBMA 1YDVA 3KAOA 2PTYA 3RRXA 1E73M 3URBA 3C61A 4NI3A 2YYTA 1QI2A 2P0OA 3K8KA 4AF0A 1U22A 5CSRA 3NL5A 4H7VA 4E38A 1EDGA 3SEPA 1Q6CA 1XH2A 5AYBA 2YLAA 3FW6A 1EIBA 4I6KA 1W9DM 2WVUA 1UASA 9XIAA 3T44A 3M07A 5JH2A 1A80A 2XPKA 4L1WA 4H00A 4UC5A 4PTDA 4IMEA 1QK0A 4B5VA 4J3SA 1DXIA 5F1VA 5HDRA 4A8LA 2JKAA 2MANA 3W26A 1SW3A 2WZHA 4KESA 2BBFA 3EXTA 4DJFC 3A64A 1UR0A 3IIVA 3ORWA 3EEGA 2EHHA 4K39A 2VX4A 1V8EA 2XH4A 3W2UA 5CBBA 2VKZG 4AZHA 4JCMA 4IF2A 1PYMA 3NM3A 5C2XA 1DJNA 1EH9A 1WKEA 1Z8AA 4QJ3B 4Q8MA 2H3DA 2Y8VA 2Z00A 2NLIA 1XBZA 2ZZ3A 4PUNA 1XICA 1MRAA 3S2JA 5HA7A 4B3LA 3M7SA 5A3HA 2ZOXA 1XLMA 3IJ7A 2ZA3A 1A3XA 2J77A 3F2CA 3DZ1A 2FHCA 4LT9A 3CMGA 1WAWA 4XD6A 4AEFA 1I9CB 1DP0A 4RV8A 3MANA 1CEOA 1K9DA 3PNZA 3DERA 1Q6QA 4GYJA 2A3EA 3B3DA 3WEMA 1WXZA 1E9YB 5BW6A 3MMUA 2CCRA 2B7NA 3EKLA 2FYMA 3IIZA 5AC5A 4H9ZA 4ZL1A 3UCDA 2E8ZA 3L9CA 1F73A 3MUXA 1W0MA 3W7LA 2Y62A 3WQOA 1OG6A 2WVVA 3VD7A 2KX9A 3AU6A 1TFVA 1TG7A 2P10A 1U1UA 2J47A 4QM1A 3WELA 2Z2AA 2PDYA 4L4OA 3M0HA 3PVFA 1TTIA 1J9YA 3LV6A 3ZFHA 2V67A 3CPRA 4M51A 2E6FA 4PMJA 3NWRA 4X9SA 5KZMA 2ZE0A 4QG8A 1P6BA 4NKCA 2VXNA 1EC9A 4ZZ9A 5A6TC 4BFAA 5KSWA 8TIMA 3RU6A 1MO0A 2GPTA 4UTIA 3LCIA 3GNOA 5LHEA 3L0NA 4AW7A 3EX2A 3NO3A 2YW3A 2Z4GA 1UKOA 3QGVA 4DIAA 1GKQA 1XYLA 5H2ZA 3KOWA 4GIEA 5DMNA 1H7OA 1LL4A 3W29A 1W6TA 1S39A 3GXTA 1G6CA 2DPEA 3TAOA 4H9XA 3PZMA 3H8AA 1NVMA 3LV5A 1A5BA 4GFSA 3SGGA 3U8GA 2W67A 1WCGA 1MZHA 5DY2A 4H3DA 3CWHA 3VC6A 2B4GA 3CT7A 3L65A 1PL9A 4W8LA 7A3HA 3U7VA 1VRXA 3HG3A 2F2HA 3HTWA 2HS6A 1YBQB 1CXKA 3NZRA 3N13A 4GG9A 1P0DA 1LL6A 3S1UA 3H26A 2IS7A 3UJEA 1NWTA 2OYLA 1SJBA 1RCOB 3ARPA 3KM8A 1JVNA 3UESA 3FV9A 4JQ2A 4BHYA 1Q6LA 2P0IA 4F2TA 1OYAA 2I57A 1LRQA 2DW7A 2VZSA 5AN7A 3NSNA 3H12A 1DJIA 3UWVA 4JX4A 1QOQA 4DJEA 4QAWA 7ENLA 1N8IA 5E6ZA 3LMYA 4X60A 1PX4A 3VE9A 4YTTA 3GXFA 1KM3A 2QPUA 2QJIA 3T40A 1AW5A 4H7CA 3LCWA 3B0PA 1V6TA 2PDNA 2C14A 4NXSA 5BXSA 2BHYA 4XAZA 3CS2A 4IMGA 1YXCA 5CKSA 3LX9A 2I1OA 4CQCA 4O28A 2E7FA 2A79A 2RDTA 1W91A 3L0KA 2E28A 1G69A 5GNZA 4XVDA 4W5UA 4UQEA 2WC7A 3BZJA 2JFEX 4IGNA 3W86A 1LYXA 1Q6FA 4YLWA 1PPIA 3QPZA 1L8NA 3BQ5A 4LS0A 1T6MA 4HB7A 4Z2HA 1JNDA 5EBAA 3VGGA 4S38A 2FZNA 2ZUTA 2X2GA 2F8QA 4NZFA 3KBSA 3ZT6A 3PBGA 2OPJA 3URNA 5FACA 4WJXA 3UERA 1B4EA 1RP9A 3W1TA 4JTUA 3HN3A 3DESA 3G22A 1FKWA 4W7UA 6ALDA 4AD0A 3PSWA 1XHGA 3L68A 2VDGA 2OLHA 1UCWA 1KB3A 2QKFA 1NH6A 3V5OA 2G96A 3WMSA 3A13A 3B9EA 3PANA 1TZ9A 5FJTA 2EPMX 1CXIA 4O54A 4WK9A 2W63A 1U2YA 1O7AA 4FF5A 4J3WA 3TWAA 3H22A 2PRHA 4B91A 1FWJC 5KZDA 4HK5A 4OBRA 1X6NA 4E2BA 3UEQA 1MXDA 4LVBA 1ECEA 2QJGA 3N29A 4IIGA 3JR2A 1IXQA 1JPDX 4WSHA 4J35A 4Y8EA 5DO8A 3FHQA 3UZXA 1ECQA 1IGWA 3OA5A 3T8QA 1TYGA 1W1YA 3MUCA 3TW7A 4JDBA 2WAGA 4BR1A 4DEFA 4WJEA 3O8AA 2AQOA 4H8NA 4F0LA 3N1AA 3VMNA 1RBLA 1LTDA 1AODA 2WNWA 3PC0A 2AL2A 4QSFA 1EZ2A 2DIEA 2J79A 2XYLA 3GZAA 3S83A 3GG8A 3CC1A 3LLFA 1GVIA 3TYEA 1X1OA 5LIXX 4M6QA 2VC7A 4L1XA 4ZTYA 2W66A 3L4TA 4LWWA 4JEJA 3QR3A 4ADSA 4JFWA 1BYDA 2CETA 3RF9A 3WJYA 2O9RA 1F2JA 3CZGA 2V3GA 4ZTXA 1W1B1 2O4QA 1UBSA 1TJPA 1UP3A 3AMCA 1DORA 3IIOA 1RUSA 4YIWA 2OXNA 4D6FA 1QAPA 1I1XA 3FY1A 4FNTA 3LD5A 4KF1A 5ABGA 4RLIA 5FF7A 3U4FA 4HOZA 4XAYA 2Z25A 3I65A 3R43A 2PRMA 3VA8A 1VD6A 1WDDA 1YNYA 1ZJHA 4IMFA 2E1WA 4LC8A 4E3VA 1W2PA 2R1KA 1JIBA 2WVSA 7REQA 4LX4A 1GVFA 4ZBCA 1ZAHA 3KLKA 3AISA 4J2PA 3DECA 1BLIA 4NILA 1TV5A 3WK0A 4LEFA 3I3BA 1UW9A 3O16A 4ILSA 5I3HA 1CECA 1NOWA 4BCEA 3BPWA 3AS0A 3I6TA 5RUBA 1UKQA 3RJYA 1VIWA 5FJPA 1W3NA 1MDRA 2Q71A 4GK8A 1V77A 2HPIA 3D5HA 4GUJA 1T8QA 1B0IA 4PFMA 1AZ2A 3G1XA 3BMWA 1LWIA 2GQ3A 1XIIA 3LNPA 2FB3A 5CJ5A 4B5UA 3SN1A 3DFNA 3QOMA 4CQ8A 1PKNA 4C6JA 2QCMA 4E6MA 3M47A 3DHUA 3EOSA 3PBYA 1A4MA 4AIUA 4ATDA 3F2BA 1QW7A 4HTBA 5FEZA 2PTZA 4MNMA 2X1TA 3TLLA 3BV7A 4I9MA 2B7OA 3KWSA 4G1KA 1FP9A 4PR4A 3VDHA 3W53A 3GD6A 4X2RA 1V6XA 4DAFA 4KIEA 1UUOA 1XSJA 1W2VA 2ACUA 3CXOA 3TTYA 1JDCA 4FNUA 1JF5A 3T78A 3T0AA 3N19B 2XGBA 1DJGA 3N4AA 1J18A 5LIYX 5J5RA 2V9DA 2PDCA 3G0XA 4L6HA 4UFIA 3D6NA 1OK4A 1WE5A