1S2AA

Crystal structures of prostaglandin d2 11-ketoreductase in complex with the non-steroidal anti-inflammatory drugs flufenamic acid and indomethacin
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of prostaglandin D(2) 11-ketoreductase (AKR1C3) in complex with the nonsteroidal anti-inflammatory drugs flufenamic acid and indomethacin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1s2aA00
2HE8A 1Z8AA 1S1PA 3RX4A 4XO6A 4PRRA 4QXIA 1A80A 1T41A 2IPJA 1IEIA 1HQTA 4HMNA 5LIKX 3GHTA 4L1WA 3ONBA 3UP8A 1IHIA 3BURA 3R8HA 4QBXA 4GCAA 2PDUA 2PDQA 1HW6A 4JTRA 3CV7A 4XVDA 4LB3A 1AH0A 3CASA 4XZMX 3UYIA 1SM9A 4Q7BA 4JQ2A 4JTAA 2INZA 3EB3A 4LBSA 2PDKA 4PRTA 4ICCX 1AZ2A 4WRHA 3GUGA 1Q13A 4JIIX 2IPWA 4PUWA 3LEPA 4IJRA 4QR6A 2F38A 3S3GA 4FA3A 4JTQA 3GHSA 3NTYA 1MI3A 4WDXA 4DBUA 3P2VA 2VDGA 4YVVA 4XZHA 2ACRA 4XO7A 2ALRA 4GIEA 4EXAA 2IKJA 2WZTA 4H7CA 3LZ3A 4WGHA 4H8NA 3R94A 2PDGA 3M64A 2BGSA 2PDIA 1XF0A 4Q3MA 2BP1A 4JIRA 1Z9AA 3H7UA 2PZNA 2FZDA 2FVLA 2PDPA 1YNPA 1MZRA 2PDJA 2QXWA 3G1RA 4YVPA 3UZYA 3ERPA 2ACQA 2HEJA 2I16A 4WDUA 3LZ5A 1X98A 2PDLA 1VBJA 1PZ0A 1YE6A 3COTA 3F7JA 3R58A 1ZGDA 5KETA 4JIHA 4MHBA 3KRBA 3V0SA 2PF8A 2IPGA 1PWMA 5AZ0A 3G5EA 2IKHA 4DBSA 2PDNA 2PEVA 2DUXA 3UG8A 4LB4A 2HDJA 2PDYA 3WCZA 3LQGA 3UGRA 1RY8A 3BV7A 2INEA 1LWIA 3H7RA 4WDWA 1ZQ5A 4XK2A 2PDCA 4XZIA 1C9WA 3R7MA 2DUZA 2J8TA 1QWKA 1GVEA 3N2TA 4AUBA 3ONCA 3U2CA 2ACUA 4YS1A 3WBWA 5M2FX 1K8CA 3GHRA 1FRBA 1ZSXA 1ADSA 1PZ1A 4HBKA 2A79A 1XJBA 2F2KA 4RPQA 1MRQA 3Q65A 4XVEA 5LIWX 1EF3A 1EKOA 3MC5A 4R9OA 4OTKA 1RALA 4IGSA 5HNUA 3V35A 1R38A 3T42A 4XZLX 3D3FA 5LIXX 2FGBA 1YE4A 2HE5A 5JH1A 3V0UA 3BCJA 2FZBA 3CV6A 2IQDA 2I17A 4FZIA 3WBXA 2ISFA 4PR4A 3V36A 3M0IA 1LQAA 2HVNA 1AZ1A 2IKGA 4GA8A 5LIYX 4LAZA 2PDXA 3DOPA 1XGDA 2IQ0A 4EXBA 5DANA 3O0KA 3CMFA 3M4HA 4L1XA 3UZZA 1OG6A 3CAVA 2PFHA 5HNTA 3O3RA 4ASTA 3RX3A 1Q5MA 1JEZA 1T40A 1ZUAX 4DBWA 3MB9A 3WG6A 5C7HA 3LBOA 3RX2A 4ZFCA 3B3DA 4JQAA 4G5DA 2WZMA 2PDBA 4GQ0A 3UZXA 1X97A 5LIUX 2PDMA 3DN5A 4YVXA 3CAQA 2FZ8A 3FJNA 2DV0A 4JTDA 2ACSA 3VXGA 3R8GA 4GABA 4FAMA 2NVDA 3LUTA 2PDHA 1PWLA 2HV5A 4F40A 3UWEA 4JQ1A 3LD5A 3LN3A 4XAPA 1Z3NA 1X96A 1US0A 4LAUA 4JQ3A 1UR3M 1QRQA 4DZ5A 4WEVX 2IS7A 2R9RA 2PD5A 4GQGA 5JH2A 4FALA 2HVOA 4YU1A 1M9HA 1EL3A 3EAUA 4PMJA 3UZWA 3QKZA 5HA7A 2BGQA 4XZNX 4LBRA 2CLPA 4JQ4A 1AFSA 4JTCA 2AGTA 2IPFA 3R43A 1S2CA 1S1RA 1Z89A 3N6QA 4NKCA 1PYFA 5AZ1A 2R24A 1EXBA 2PDFA 3Q67A 3BUVA 2NVCA 2P5NA 4GACA 2IKIA 3UFYA 3V0TA 3GHUA 2FZ9A 1YNQA 4PUUA 2PDWA 3C3UA 3LENA 3H4GA 3WBYA 4IJCA 1VP5A 3FX4A 4I5XA 2PD9A 4WDTA 4QX4A 3LQLA 1AH4A 3EB4A 2C91A 1RY0A 1J96A 1S2AA 3LNMA 1AH3A 3R6IA
chains in the Genus database with same CATH superfamily
4GUGA 5HANA 4HA4A 1M65A 4NYUA 4XO6A 1WA3A 4MNKA 4NX0A 3OYZA 5TD4A 1JFXA 3S1UA 1I4NA 3LGGA 1S2UA 3W2UA 2ZRWA 1PXGA 3SGGA 5E5CA 1KFJA 1A3HA 1UUQA 2BNJA 2GVYA 3UY8A 2Z6IA 4RDWA 1Q2RA 2NLIA 4KIEA 1E43A 2WWDA 3PBMA 1XBVA 3LGDA 2CITA 2FJKA 4LVDA 4KGLA 1QU4A 4B5XA 4HZMA 3CU2A 3FVMA 5HOSA 1M7XA 4Z2JA 2OEJA 2BY3A 5HNNA 1IF2A 2NQZA 2CLFA 3P7YA 4IT1A 3BMWA 2YFOA 3OQ8A 4DYKA 4DHGA 1CYGA 1MYRA 4WJ8A 5H6HA 3B9DA 5G4WA 2D2GA 4IJRA 4QR6A 4M6PA 5HUOA 3OG3A 2INFA 1J8VA 4DB7A 2ABBA 3C3NA 3AYVA 3C0SA 3EDDA 5JBDA 1FCVA 3M5ZA 4OBRA 3KZSA 3C2YA 4J27A 4K38A 2ZWZA 1NU5A 4Y8FA 2FZNA 3LZ3A 4D8AA 1XLDA 3AXKA 3GNDA 2A85A 3QMSA 2PDIA 3C56A 4H8UA 4GO9A 1FY6A 1QMLA 3VNIA 5EGRA 3CH0A 2Y8KA 5C9RA 2C1IA 5E09A 1DWHM 3AJXA 4I6KA 4Q8TA 2V5LA 1R3TA 3A12A 3QQWA 5EMKA 2WCGA 3OLDA 4MSSA 3DESA 4PCSA 3TNOA 4CN4A 3EA1A 5CKSA 3FLUA 3V0SA 2PF8A 2ZXBA 2IKHA 1FCQA 4UOZA 2FMOA 5FJRA 4MJMA 3SN0A 1X8FA 1QNPA 4LY4A 2V5JA 1EJXC 3CC1A 2NZLA 3O0FA 2P0OA 3TJIA 1KA9F 1XIMA 5A6JA 4E2VA 1O66A 1XRFA 4FP1A 3DG7A 2ZA2A 3G1HA 2X0SA 4E8GA 1TV4A 1SZEA 4PMRA 2XVNA 3AS3A 1OWQA 4GUIA 1LL4A 1VEMA 1F07A 3MV01 2NT1A 1HO1A 1HTIA 2PLJA 1PZ1A 1XDJA 3W7QA 4D6FA 2YYTA 3W1XA 2XFYA 3TDFA 1H0IA 4HU3A 3QM3A 1AQFA 3Q65A 2OZ0A 3PWAA 1XSIA 1VIWA 3H2NA 5ECUA 3VOFA 4KH2A 1VAHA 4U10A 3EDKA 1RQHA 3WJSA 1H5VA 4F0HA 5I3GA 4ES4A 2E8YA 5CJNA 2UY2A 1FWWA 4D6EA 1BKHA 1Q65A 4AXNA 1TCDA 2DFAA 3CV6A 2A0NA 4OVXA 4H2CA 4NNCA 4ZBCA 1VBHA 3C2FA 4GE8A 4GY7A 1SQ7A 1V6UA 4RNHA 3EYPA 1T8QA 3GG7A 3W01A 4QNWA 1MUCA 4DJEA 1LQAA 2DZUA 2JBMA 5BXPA 2E9MA 1EC8A 4LAZA 4GKTA 3HIJA 3TWBA 1GOMA 2PDXA 4IMGA 1WE5A 2V2DA 5D09A 3AOFA 5EMJA 2DZXA 1H50A 5K2ZA 2FLIA 1EOMA 3G1AA 4C6NA 3PG9A 3SAZA 4TU1A 2D0HA 2AL1A 3APGA 3VNZA 3W53A 4M6VA 4Q4OA 3WG6A 1WO2A 5A2BA 3H53A 3E02A 2FIQA 1J0JA 4MB1A 1OD0A 5ECVA 3UWQA 4QRNA 1A5CA 4WGXA 2FZMA 2XIMA 2BWGA 2PWHA 4YWSA 3VCCA 4YCPA 1EO7A 4PE8A 2VD9A 5BXTA 1V3KA 4CD6A 3LRKA 2OVLA 1J5TA 1DPMA 5LNVA 1F6KA 5AB3A 2RFGA 3GDRA 3SCPA 2BB0A 3W82A 1CGYA 4HNCA 1XH2A 2F61A 4N2YA 3EOLA 1LOLA 6XIMA 1SVDA 1KFLA 2Z1KA 3VDAA 5FI8A 4RDZA 3SUWA 3CO8A 1B5TA 5F1UA 4KMQA 3PTMA 3GW3A 1LYXA 4JN6A 2YL5A 3ZWTA 3W86A 4PTMA 3WBEA 3PR2A 1E0UA 1W1IE 5DN1A 2Y62A 4JD4A 2VOTA 4JQ4A 3H7VA 3SURA 1K6AA 1LBMA 4M7TA 2HNEA 4Q8MA 4PRWA 4JL1A 3DENA 1MUMA 4Q4RA 2X1TA 1ZY9A 3AMCA 3AIUA 3AUOA 1E4NA 3GHUA 4C7DA 5U4NA 4CQ9A 4H6RA 3PZOA 2FZ9A 3TYEA 3VABA 3NOYA 4ZO8A 1FKXA 3NG3A 3RF9A 1UWAA 4DWSA 2Y70A 1E72M 3W71A 3U9IA 4RXGA 4EF8A 1MW2A 2OODA 2QCDA 2VDHA 1VP5A 1XLEA 4XG1A 4C5ZA 1XIBA 4NJHA 4YL2A 1UQYA 2J7EA 3UWVA 1E9ZB 3BWWA 3F4DA 3EB4A 3CMGA 1H7WA 3USZA 3WMBA 1KM3A 3CMJA 1XQLA 3D47A 3L0NA 1GW1A 5CQ1A 3PY2A 1OC7A 1S1PA 5HWJA 4A8RA 3ARTA 2Q3OA 4L4MA 4DPPA 4NJIA 3H8AA 3FSUA 3A4JA 2V3DA 3UZ5A 1A4LA 4UTJA 4Y8EA 2HPIA 5HWNA 3TN5A 3PZVA 3RYSA 4F9DA 3WUEA 3VKBA 4AZ6A 1O5RA 3NO1A 1UD3A 4OWGA 4RX0A 2XIOA 4IM4A 2PC8A 3ELFA 1RPKA 4QEHA 3N73A 1SFJA 3QXBA 1W3JA 4KWVA 5F1VA 1EX5A 2ZICA 3B03A 3RXZA 1PVNA 1DJWA 1C8XA 4LY8A 4HSNA 1DWFM 4ZA0A 3UCCA 3UPBA 3VIGA 3GKAA 5DXXA 3LMZA 3SGZA 3EPOA 2B81A 1POKA 4HU8A 1BXCA 3GU1A 4I7UA 2V38A 3EB3A 3G8EA 3ZOAA 4Q32A 2P76A 5GQBA 4S3JA 4O1EA 3KRSA 1SMDA 4N9BA 1TJRA 2ISWA 3A24A 4FB7A 3U2EA 1Z6KA 1V3JA 4K2SA 1F74A 1RSCA 2EGZA 3NTYA 3DKLA 4NNAA 4BR1A 2FDSA 2CHNA 3FYPA 2WNZA 4GJJA 1RVGA 2Q8XA 1B30A 1T96A 4WK9A 3NPXA 3RPDA 4J3XA 3URNA 1K70A 3S2JA 4H6QA 5E0FA 4Y9AA 3QHNA 1ML1A 2GLKA 6ENLA 4H7CA 3HURA 4JPGA 4OE7A 3M64A 2R1LA 4FNRA 4MNJA 3NQ8A 4UQBA 1ZLPA 5D9PA 4QQUA 4X2RA 4O4WA 5HXMA 1A5BA 3RAOA 4LVBA 2WHMA 3DHFA 5REQA 3PBYA 4C1NA 1EFZA 1DWGM 4H9TA 1ZJAA 1FFQA 4JY8A 3R79A 6ALDA 3O07A 3W7OA 1C3FA 3E0LA 1OC5A 3R58A 3KRBA 2VXNA 3SGUA 1E1CA 5A6TC 1JZ6A 2WWCA 1C92A 2BFGA 4ZQRA 2WAGA 3LRLA 1UWRA 1ZBKA 3GK0A 4DUXA 1XX1A 3T1GA 5D9MA 1LWIA 3CUIA 2YIHA 1TA3A 1OBAA 4A29A 4ZSTA 4XTIA 4L9YA 4DJEC 2Z1BA 1OFOA 5FOOA 3GIQA 3U48A 5C0QA 1Q8JA 4LF2A 1OX6A 3FXGA 1W3KA 3OGVA 4DO7A 3SR7A 1GONA 4OFCA 1E6ZA 4S3CA 1UROA 2YYUA 5JMUA 5LNSA 1XL9A 1B9BA 4AG0A 4DPQA 3L2IA 4Z08A 3FA3A 4XUGA 3OVPA 1EF3A 4B9ZA 2J7DA 3TYDA 1JDDA 2QEZA 1KFKA 1JI1A 1UB3A 3NO3A 2WSPA 1UCWA 2YA1A 3UA3A 3WJXA 2OOFA 2PF0A 4D8ZA 1GOIA 4FOUA 5GJMA 3BCJA 4K7VA 3GXNA 4WXZA 1BGGA 5FF4A 2IMRA 3NVDA 4GVHA 3WBXA 3PK7A 2CHOA 4XX6A 3SRDA 5JIWA 4KFPA 2YDQA 3A6OA 1XYLA 2ISVA 4A35A 3G22A 3L4UA 3EEZA 2DJXA 1W17A 1MMFA 3TR9A 3L68A 4FS9A 1J79A 1L6SA 4R7OA 2P53A 3W1MA 5E70A 3PG8A 1N82A 4HN8A 2GK1A 4KRTA 4QGCA 1LUCB 3IIOA 1JZ7A 2QJGA 2YZ5A 3WD1A 4AD3A 3HGJA 4LUIA 1JR1A 4OIFA 4WLCA 1K4GA 3FNDA 4CVUA 3NM3A 3G18A 2CBVA 4WY0B 2OYMA 5T9CE 3GH7A 4GQ0A 4GBUA 4TR9A 3UGVA 4DXKA 3UNTA 1BRLA 2ZVRA 4A3UA 2VGGA 4OBSA 2DV0A 3OYXA 1I2PA 3AYTA 3S2LA 4OZOA 3AISA 2QS8A 3RIKA 4GABA 3AHTA 4UTKA 3GYCA 5HAOA 1N2VA 3N9KA 4AVFA 1WP6A 4DWSC 4E5TA 4F0SA 1NWSA 4OQVA 3SRKA 4E2OA 2VX6A 1JZ4A 1US0A 1YW1A 3D5HA 3SUTA 4ZQPA 5I23A 3VNDA 3VKCA 3VNLA 5BXSA 4UFKA 3O6YX 2ATSA 4D1IA 4XSLA 1GQJA 4AVOA 1KLZA 3PAJA 2V5BA 4C6KA 2FH8A 5LA1A 1IEWA 3ZR5A 3PUEA 3P0WA 3GVGA 3AMDA 4IPNB 3ARZA 2Y7FA 3OHMB 3CJPA 3RLGA 4ZO9A 3KRZA 4RW5A 2X1RA 4O28A 5A2AA 1EJVC 5E6YA 3VOCA 2KX9A 1PE1A 5A6MA 1XQKA 4P2VA 4Y9PA 3WSUA 5DXYA 1XDLA 3VGDA 3MUIA 3VD4A 1F4AA 2PTDA 1LL7A 2VVNA 3W6MA 3L4VA 4ZZ9A 3V1PA 2XVGA 1DORA 1QW9A 3BAXA 5LXEA 4ZO7A 4QISA 4HHPA 3WQFA 2DZTA 1XDMA 1W8SA 2YDRA 4AB4A 5J5RA 3N3MA 2J9ZA 2XGZA 2XWDA 1TR1A 2AL2A 2FFIA 1K7FA 5XIMA 3TNBA 4DZIA 2F6UA 4DUWA 1A80A 4IP5A 3QY6A 3N2BA 5ABFB 1N7KA 1FH7A 1O5KA 5CZSA 1VCGA 3LHZA 2DZVA 3WUGA 3AXMA 1V3HA 5FEZA 3R8HA 3W2KA 4YXGA 2XISA 2PDUA 2A3HA 2NSXA 4KCVA 3NYDA 1M7PA 1XIGA 3BGGA 3OLGA 1UC5A 1VKFA 1AH0A 3W02A 1Z41A 1JYVA 2O9TA 1FWAC 2AQOA 1IEXA 3S9YA 7ODCA 1O68A 1DQWA 4UQ9A 2Y7DA 1C8VA 2XIBA 2DEPA 2PBOA 4LAKA 1ISVA 1EHNA 1O95A 1AZ2A 1XCWA 2CWXA 1SR0A 3OVRA 4JYFA 3TU9A 3PZIA 3WD4A 4Y7EA 1H09A 3G77A 3VKAA 1UR9A 4HJFA 5D05A 2DJLA 4JTHA 1A5KC 1J6OA 4JTTA 3KBMA 4DBUA 5HQMA 4JX5A 2VVSA 3PPFA 4E4UA 4Q8VA 3PJWA 5JIPA 2DZPA 4I5UA 4HA3A 2JKEA 3HTWA 4QSFA 2NUWA 5HMFA 2DSKA 4EXAA 3GDBA 5XIAA 1XFBA 3PZNA 3DFSA 2F84A 3WLQA 1W5OA 1EP1A 1E71M 1TPUA 4AZIA 3LGEA 4XAZA 2OSWA 4HHHA 1EXPA 4X9SA 1J6PA 3DKJA 3O16A 1JXKA 2JIEA 3V75A 1A53A 1NF0A 2BOFX 4P8XA 4KCWA 3N3TA 2A1YA 4DYJA 2VZTA 1XYBA 3I4EA 3TK7A 2BSLA 2PDLA 2X40A 5FJJA 3UJEA 1Q85A 3LHUA 3TYAA 3KDNA 3COTA 3BOXA 4MHBA 1TX2A 1KQZA 2PP1A 2DP3A 5H8UA 3LSBA 3BLEA 3LLDA 3M44A 4KT2A 4WF7A 1HP4A 3PSVA 2QV4A 3ZXWA 4OHQA 5G2IA 3TLLA 1JYXA 4PZVA 3LQGA 3FY1A 3L2MA 2P3EA 4DJED 3UYCA 4TVCA 2CLLA 4PBFA 1LWHA 3RK8A 2H9AB 3VKDA 2J74A 2XIQA 4ZXLA 1I1XA 5F4XA 3WBWA 3BC9A 2RHGA 2KZHA 1QCWA 2TODA 4ZB5A 4NQ1A 1SO6A 4JNMA 2NQJA 1XFCA 1YPXA 1U1UA 1LRQA 2F6XA 1UMLA 1MRQA 2WC7A 3LV6A 1PV8A 3FHAA 1VPXA 1I2OA 1YDOA 1XINA 3OO2A 3NOEA 4ORMA 1RALA 2YXXA 3M1ZA 3B8SA 5LA2A 3S42A 3T42A 4H9MA 3GM8A 2I9UA 4MJ4A 1HKIA 4HK6A 1H61A 1WPCA 3FEMA 2I17A 3RDKA 1KXQA 3FV9A 4ADSA 1POJA 1ZHAA 2E6YA 4PR4A 4DN1A 3PTQA 3N2CA 3WK2A 3H2AA 3DECA 5DMMA 3KP1A 3QHOA 2ALDA 4Q4PA 3DOPA 3IJDA 2OO0A 4A3HA 1JQXA 3WK0A 1E70M 3VGEA 4LU0A 4DWSB 1NEYA 3MZ2A 2JF7A 4CD7A 3WLLA 3D46A 1JEZA 1JNEA 4GYKA 1AJZA 3V3WA 2VD8A 5E0KA 3ZVIA 3KOWA 4G5DA 3G1FA 3B9AA 1PTGA 1KLYA 3CAQA 4HNNA 3GY1A 4DWSD 3SCOA 4P8WA 2D23A 3TN3A 3EWBX 4LW7A 4LPCA 1EGVA 3AS0A 4L65A 1V3LA 3ALFA 3NJ3A 3WF0A 4AWEA 4BI6A 1DJNA 1VFLA 3HQOA 2PP3A 2E68A 5G2HA 4NZJA 2PU1A 2IW0A 3LN3A 4LRSA 3W3OA 4M0XA 4O50A 3F1QA 4ZEPA 4HMEA 4MKSA 5L6UA 1FP9A 1MRAA 1RJQA 6PTDA 4D6DA 3N34A 4FXJA 3SIMA 5CC3A 1R8LA 3JUGA 4S3BA 3QKZA 2YDAA 4FI4A 3PNZA 4IX0A 4UTMA 4IPJA 5EA9A 3WQOA 1E51A 4H7ZA 3MVTA 1TR9A 1QPQA 1MZHA 1CWYA 4J3ZA 2FYMA 3R43A 5KZEA 2ZXQA 4C91A 1XLKA 2FJUB 2XZ9A 4C90A 4Z17A 3QHMA 3EDJA 3TXVA 4DEFA 2R24A 1U33A 1EXBA 3CPRA 5D4YA 3DFPA 2P5NA 4GACA 1PIGA 2HPMA 1O60A 4FXRA 2J13A 1EGMA 2WHLA 1O5QA 3DDMA 4MKNA 1O6IA 1XIHA 4HSOA 4AD2A 1XYAA 3NL5A 1TWSA 3STCA 4I5XA 1G0CA 3BMVA 2PD9A 5K9DA 2HJPA 1FWNA 1JPDX 4MYAA 1GUVA 3UWWA 3RM8A 3A4XA 3T2OA 1MEHA 2FB3A 3I6TA 3KM8A 3V7PA 3GZ3A 4CQ8A 1TPFA 3FFSA 4PL1A 1VYPX 4MWAE 4PRRA 4AY7A 3TONA 2HMCA 2Z26A 3STFA 3SN4A 1ISXA 4DXVA 3URAA 2V6AA 1JCLA 3SQSA 2YCEA 2VCBA 4GISA 1A5OC 2YB1A 3JVAA 4FR6A 1JDEA 3E0IA 1NJJA 2YJQA 4GBDA 3ZM8A 3P3BA 4P7RA 1IT0A 3STGA 1NP0A 2GJNA 2OFJA 1W54A 5LNRA 2GVJA 2MUCA 4IUGA 1UPPA 2GJXA 4HCLA 3LPFA 1BF2A 4RNIA 3NR0A 2VT0A 2WO5A 4P8UA 4O57A 2OSXA 1KM6A 1PS9A 2GUUA 5TAOA 3H54A 4MNMA 3N4FA 4RLIA 4ATDA 1UH4A 2XTKA 1QVBA 1PDYA 3SUSA 4NSBA 4K1GA 1JGMA 1OX4B 5HINA 4ZVJA 4B9YA 4MM1A 4MUZA 1Q6DA 2E67A 1VEOA 3OZYA 3CXOA 4WDXA 4B5WA 3LHWA 3T9PA 3UXAA 3EEGA 5HPCA 4JOMA 4XZHA 3LA4A 2CU0A 4E8CA 1IZJA 1S39A 4GFSA 2DT1A 2Q01A 4RW3A 3A3XA 3E96A 4UTHA 1O4UA 1NDZA 5CXPA 3H2FA 1Q4WA 3ANYA 1Y5WA 3THQA 4O52A 5KTLA 1LCOA 3TW7A 4H1ZA 4YWIA 3WLJA 1H60A 2BLEA 2D0FA 4KCTA 3S9ZA 1BTMA 3KAOA 1VJIA 4N0RA 1MZRA 4HNLA 1L8NA 1SMAA 4Q4MA 3RILA 1TX0A 2Z00A 2DIEA 2WHKA 2QAPA 3CBWA 1EUAA 5BRPA 1Q6LA 4H8VA 3WQWA 4Z1BA 3WNLA 1B54A 3MY9A 2RDTA 3UJFA 1TTPA 1P0NA 3BO9A 4F48A 2G5WA 1DJZA 4OT7A 1R9ZA 4W7WA 4XKYA 3ME3A 1E0WA 3GG0A 4HQVA 5F4WA 1G94A 1I6NA 3KBSA 2XM1A 3ZLHA 4JNYA 3DHUA 4UFJA 2QQ6A 3KWXA 1GT8A 5H1WA 4JTGA 3ITCA 2BY2A 3QV9A 2EBNA 1CGTA 2VEPA 3S4TA 3T40A 2XVPA 3TYBA 4FSAA 3IARA 4G1NA 1CB2A 2V69A 1UASA 1P48A 3VGHA 3BDKA 1C91A 4NAFA 4UTTA 3O1NA 1ADSA 2VUYA 3WLRA 1UA3A 2X16A 2WNNA 5DBUA 1PL9A 3VGGA 3DHPA 2OOGA 2C16A 3R4IA 3AHVA 3MWCA 5C54A 4UMBA 1SZGA 5I3HA 5FF3A 1OCQA 3KL0A 2HE5A 4R34A 1JDAA 2JK2A 1TE6A 3UWUA 3WNPA 3ARUA 1SU5A 2WMFA 4LGXA 4ZQCA 4CCCA 4IQDA 4MZ1A 3B8DA 4NZ4A 1JG9A 1CT5A 4IPPA 5HULA 1JCNA 2FB2A 2I1OA 3VTRA 3MVIA 2I14A 1A3XA 1JRCA 1HJSA 4IXHA 4DM1A 3K8MA 4NZ5A 1QNOA 4IWWA 1XICA 5EL1A 8RUCA 2HSAA 2TRSA 5JUVA 4CN6A 4H2HA 3K8KA 3HZ3A 5EFFA 4AWTA 2V2CA 1KBKA 2PFHA 4NVTA 3FIGA 1GHSA 1YIXA 2GVLA 2YLAA 1SJCA 2Y88A 3TTQA 4DBWA 3AIQA 5RUBA 3GNPA 1Y8BA 1UR2A 4Y96A 3GH5A 5DCBA 4GZEA 2QCCA 3S8HA 4PMVA 4O11A 1TWZA 2FQIA 2E6FA 3A23A 3LXBA 3L4TA 3L0KA 3VNYA 4J1OA 4N9CA 2FZ8A 4NUWA 1QBBA 1OSEA 3HV9A 2DQXA 3N9SA 3GDTA 4UFIA 3MI6A 3M0ZA 4Q8NA 4NZCA 3QVQA 4UCGA 1C7SA 3OVQA 2IXUA 1XM3A 4OV9A 3FJLA 4JTFA 3W2MA 2BG5A 4PB4A 4JGDA 4K36A 1A5LC 4UOJA 3MSRA 2R9RA 1KD0A 1RBOB 3EGJA 5JH2A 1QI4A 1RHCA 2H8ZA 4LYKA 3BQ5A 2VELA 1D8CA 3UZWA 1JCJA 3EWYA 4S3DA 1VFHA 1DIEA 1J01A 3VDBA 1KM5A 3OQEA 4OOUA 3SCWA 3WK3A 1AUSL 2C13A 3WNOA 2A2IA 4J4KA 4DRSA 1TRDA 2JF6A 1S2CA 3SQMA 2WMKA 3JW7A 2HZGA 2EQDA 3R10A 2O7QA 1RR2A 1EJRC 2YBUA 3EXTA 2Y8VA 4AVNA 1HKWA 3W28A 4E2DA 1MDRA 4ATWA 4MWAC 3H55A 2ZRYA 4IFOA 1RK5A 5CAHA 2V3EA 4RE2A 2Y6ZA 1IIHA 3WF1A 4I7WA 2PWDA 2OTDA 2P3ZA 1J93A 1FCUA 3C4UA 4MB5A 4CU7A 1RY0A 4PUKA 1OFDA 2BHZA 3NO5A 4AEOA 5HWMA 2OQHA 2GGHA 5IOBA 2Q09A 3N1AA 1XUZA 2OWWA 4UTWC 3U2ZA 1CGUA 2X30A 1T41A 3REQA 3W7EA 3WQPA 5CC7A 4PUJA 4PTXA 1ME9A 3W7DA 3LPGA 3OP2A 1Z44A 3BQ6A 1G5AA 1THFD 4QSHA 4D71A 4HOZA 2J27A 1TJ0A 3K4WA 2Z2BA 3EWDA 1GQKA 3CTLA 1YX1A 2PDQA 5C9ZA 1CXKA 3W7NA 4JICA 4JTRA 2Q3RA 1OJXA 3THUA 3RMEA 3T44A 5CSSA 3UBPC 4UFLA 2EJ1A 3FXYA 3QSTA 4I9TA 5IBXA 1ADDA 4IQLA 1XP3A 1TRIA 2BHUA 4MY9A 4HPJA 4AEEA 3QPZA 3R13A 2GQAA 4J3UA 4AF0B 1KGWA 1M68A 2WQPA 1ZP3A 4NU7A 2ZX9A 1ZCOA 3DYOA 3GVVA 5HBFA 3BAYA 2PCQA 3SSZA 2QF7A 4M82A 4W8BA 2W66A 4K39A 3W1QA 1W9VA 4QP0A 3BLFA 2QJMA 4O1FA 3GWQA 4RDVA 3MYOA 4US5A 1SPQA 2YL6A 1XLBA 3LXCA 4PUEA 4Z1CA 4PH6A 2OSYA 1I0DA 3SY8A 5B7ZA 1QXLA 1WUEA 2C8NA 1MW3A 3AMKA 2BBFA 1ZBVA 4IISA 5DX7A 2TPSA 4MY1A 2XSBA 4Q6XA 4C5YA 5K4ZA 2PTZA 2V9DA 4YVPA 2WVUA 3VNJA 4A22A 4TV6A 3N2OA 1LLZA 3FSTA 3GNRA 2FTPA 3QR3A 4RV8A 2DSUA 3W1NA 3NGJA 1TZZA 3W00A 3BG3A 3GB6A 4RNFA 5LNUA 1O7AA 4S3KA 2DT3A 2UWFA 1B3OA 2HDJA 3TR2A 1OFPA 1EJUC 3N04A 4MMWA 2WPBA 1TMHA 1U5JA 4NASA 4JBRA 4CD5A 4LALA 4HPNA 2GUYA 4GZ7A 1DKWA 2NV1A 3QFEA 2WM0A 1H7PA 5HUPA 4E4FA 4WDWA 3WNMA 4G7EA 3WQGA 1RP8A 1D8WA 4QAWA 2VCAA 1QNSA 1QI3A 3MHFA 2QDHA 4UFMA 1YYAA 2OR2A 4A05A 3VX1A 1HFBA 1UWQA 4BI5A 1UWSA 3O15A 4J2PA 4K3ZA 4QQ3A 3GHRA 4TXEA 3B4YA 1NWTA 1BPLB 1ONXA 1P7TB 1F3TA 1LT7A 2YXOA 3RCYA 1UZDA 3VCRA 1G69A 3P14A 3N19B 1P1XA 3DBNA 3EZ4A 5ENLA 1PKNA 4MY8A 4GVFA 3M0JA 4LVAA 1A5NC 1SSGA 3ICJA 1EBGA 2W91A 5EBAA 3S2CA 4QJ3B 1UOZA 3JR2A 4WCJA 3MBFA 1RZMA 3K46A 3WDIA 3GRIA 4JDYA 1FXPA 1XIIA 2OXNA 4RKAA 1P0KA 3MDWA 2EJAA 2REQA 2WB5A 3ID7A 3M43A 1FWDC 3L67A 4DI8A 2HS8A 1UR0A 1WBJA 4ERIA 4UTLA 4X61A 3LHTA 5DQPA 5IFTA 3QV6A 2JKAA 7CGTA 3PN8A 2VFDA 3QJAA 1BYCA 3M9YA 1TPDA 2OMAA 5EY5A 3IUDA 4C6DA 1ZBCA 2E1WA 4KQNA 4UWMA 1WDPA 4GCXA 4WHBA 5B7YA 1JJKA 3K30A 3MSGA 4AHQA 2VZUA 1GQIA 4X63A 3G0UA 1WDDA 3UXIA 1S2WA 1XR2A 2PGWA 2QULA 1F5ZA 2F6KA 3CUGA 1A4MA 3VMOA 4DIAA 3W74A 1TJ1A 1LQ2A 4DLMA 4E3TA 3VUPA 1A5UA 3WEZA 1P6CA 1OB0A 5M5DA 2ZQ0A 1BQCA 1BWVA 4PBGA 3W25A 2PDHA 1X1ZA 5EYWA 2P10A 3GZAA 1MEIA 1W31A 5D9NA 1G01A 3UPMA 1WBHA 1T6MA 2YDSA 1EDQA 2PTXA 2A6LA 1LLOA 3SSJA 3VKKA 1GZ1A 1UR3M 3W1PA 1BG4A 4MWAB 4GQGA 4CCDA 3EA2A 2WYSA 1QR7A 2CEQA 4FLRA 3ZJ8A 3NL6A 4DELA 5KZMA 1WX0A 4Q6JA 3WUFA 2A3LA 4U3CA 1GEHA 4HMCA 1ZS2A 3WDJA 3BK0A 4W5UA 1U5VA 2ONEA 2QJNA 1FDYA 3OBEA 1JF6A 1JYWA 1K02A 3GXIA 4MWAD 5I3IA 3GC2A 2I57A 1BG9A 5HDRA 2G3MA 1WUFA 3L7RA 4JFWA 1UR1A 4YTUA 1QDSA 2YXGA 4HTBA 2NXIA 3CLWA 4B3LA 4PUUA 1EPXA 3PPGA 3VD3A 3WBYA 4CCZA 5BNKA 1XG3A 4DF2A 4MZYA 1RPXA 4GQBA 1N55A 3WLOA 4E8DA 5IBXC 4IFRA 1ZL1A 2FVKA 1RJRA 5KSWA 3DAQA 3T0AA 3E3HA 3UR5A 3GTXA 3UVIA 1LG1A 1W1B1 1IT8A 3UXKA 1OFBA 2NSOA 3AALA 5C71A 4LUSA 2V5KA 2XGIA 1RD5A 4BK9A 2PPGA 3TSBA 3AU2A 2EKCA 3S2NA 3BURA 3A21A 2NXHA 1MW0A 3KOYA 1XGZA 3V18A 3IWPA 3LK6A 4W88A 3ZT6A 1AW2A 4TX9A 2QJJA 2Y0FA 5CCZA 3W1RA 3I3BA 3WF4A 2CBJA 3LCGA 5D03A 2WK2A 3LDVA 3CASA 3GQYA 5XINA 3V4BA 6TAAA 3MMWA 3OPSA 4CUCA 1F2JA 1WKEA 4ZB2A 3NGFA 3C2OA 1YEYA 5FSDC 4ERAA 3VNMA 4B90A 1KR1A 1MQRA 1Q13A 3KTCA 1YPIA 3KBNA 1RQBA 3IVSA 3PZGA 5DFAA 4OGZA 3VUSA 3MYPA 1QJWA 2UBPC 3PNUA 1G4PA 4PEKA 3F5JA 3S3GA 1QPOA 1NFGA 4WSHA 3IAPA 3II1A 3FOKA 2ZUUA 2W62A 5IXEA 3AYSA 4M51A 2OWCA 3T2PA 3VZYA 2B7QA 2YZRA 2QPXA 3WK1A 1UD8A 3IS4A 2WZTA 1L6GA 3O6CA 3W1LA 1AODA 3XISA 4DX3A 3QH2A 4DF0A 1PYMA 4ZOBA 2GFTA 2ZZ5A 2Z0IA 3NDOA 3TIMA 3H2EA 3E2SA 2B4GA 3MBDA 3WD3A 3DG6A 2DT2A 1WB0A 3KRUA 2ZYFA 3AS1A 4O16A 1HXJA 2CXEA 3ARVA 4W86A 1AQ0A 3N6HA 4CNTA 1V79A 4H6EA 4MNLA 1AD4A 1PWMA 1AJ0A 4DBSA 2PEVA 2GZXA 1W32A 5CBBA 3T8LA 1UWTA 1XGEA 3NCOA 4PMQA 3NEHA 5A2CA 1H7OA 2E7FA 5M1TA 3A5VA 4E0CA 5AVNA 1RY8A 3BV7A 4PBEA 3A3WA 5JU6A 1EDTA 1WZLA 3CNYA 1GJWA 4MLJA 5E0CA 2R1KA 4ACZA 2XHYA 3CL6A 2G4JA 2E5DA 1GVEA 3N2TA 4UB9A 1QI2A 5I3FA 1Q6RA 1I8JA 1IIGA 4GYPA 2JE8A 4EPBC 3QMRA 3MW7A 3URBA 4FOJA 2Z24A 3GIYA 4XV0A 4HU0A 3EPNA 1Q3NA 1XJBA 4O12A 2X42A 1RA5A 1MEWA 4IXXA 1W9PA 1S2TA 4UOQA 5K9CA 3WQVA 3L5MA 3AZTA 1V7AA 5IDIA 5HNUA 1NSJA 4WKHA 4DF1A 2PWUA 4QROA 5LIXX 2BHYA 5ABEA 3CQ0A 1YE4A 1U83A 3AAMA 4QTGA 4B15A 2IQDA 1OGSA 1OT1A 5HR6A 4PULA 1SYTA 3FA4A 3TOYA 4OV4A 1HJUA 4B5NA 1E5JA 4HYVA 3S1VA 4Q7NA 4YHEA 4RDYA 4M56A 2I5IA 3C8NA 2PSNA 3P5ZA 3PFRA 3W72A 3GX9A 5EB8A 3NUKA 1JD7A 2CESA 1UHVA 4RJEA 4Z2HA 4EIVA 5BU9A 2YCJA 1R3QA 4JKKA 3P67A 1OFEA 8CGTA 3RFAA 1EPVA 1DWIM 3TN4A 4QFUA 5HNTA 1FDZA 3ZJ6A 1NTHA 1RLCL 4XZ9A 1ZUAX 2FPVA 3HG3A 3R12A 4A3YA 2CLIA 3R8RA 1XIJA 3LBOA 2QR6A 2WANA 1EC7A 9XIMA 1NDYA 1VRXA 1QOXA 1F6YA 1KC7A 2B7OA 2QGHA 3RU8X 1AVAA 4R7WA 2QIWA 3ZMRA 1ICSA 1R3WA 1GTHA 3VDHA 3REQB 1BKSA 2OLAA 1PPIA 1F8IA 3ANVA 4NAEB 2Z7KA 3I10A 4Z2GA 2ZDRA 4LS0A 1TPH1 1KRAC 4Q22A 4Q33A 3TVAA 1JVNA 3WQCA 1AJ2A 2QMKA 3W0KA 3KL3A 1AMYA 1E4LA 4RZ4A 1O1HA 3IJ6A 4O0ZA 3UEQA 4BF5A 3W7GA 4LBRA 2XUCA 4JNZA 4KWWA 1UUOA 5DY3A 3PUGA 4H01A 2WVTA 3F2DA 1G4EA 3RRAA 3U7VA 1SW7A 1UKOA 3VPLA 2V3FA 4UTIA 4WJXA 3TQPA 5I3JA 2ZUWA 4YPJA 4QCEA 4KESA 1CGVA 1XRSA 1QAPA 3UT0A 4IL2A 2FTWA 3B0YA 4W89A 3R89A 1J2WA 4N6EA 5EKYA 1FWJC 4U3AA 3KBWA 3LENA 2J8GA 2V8ZA 3IIPA 3NQ6A 5C9WA 1K7XA 3LOTA 1R6WA 1JYNA 1OCBA 4LJ3A 3MKVA 1J9YA 1J96A 2WMGA 1RBAA 4DUVA 4TTUA 4X0NA 3R6IA 1I2RA 3C8FA 2HE8A 9XIAA 1BYBA 3RX4A 4J3WA 1TPB1 4ECLA 4GMEA 2G0WA 1QHZA 1HF6A 3G6LA 3L2LA 1EO5A 4I90A 3ONBA 3M7SA 3CUFA 5FAGA 1IHIA 4PMDA 1MFVA 1W3IA 3UXDA 4ERGA 3UD6A 1TTQA 2BVWA 1TUFA 3TC6A 2NUXA 3M0VA 3WFLA 5HNRA 3AFBA 3W38A 2XM2A 4Z1YA 5HJXA 2E5CA 4LS2A 1W9UA 3BLPX 4POCA 4Q7BA 4CNSA 4HNVA 1GG0A 2WVVB 1Z42A 4GINA 2ZUMA 3ORWA 4W7UA 3VD9A 4PGLA 2D22A 4XQ6A 4QLKA 4C6JA 3B0PA 3VU2A 1R9XA 4O19A 2BVDA 3EPMA 1OFQA 3GNOA 4ZQNA 3CEUA 2J77A 4I7VA 3E0VA 3W2JA 3ZSTA 4G7EB 1XUUA 1EEXA 2Z7GA 1OK4A 3DFOA 3LEPA 1UQZA 2XIJA 2J6VA 4ZODA 4PSPA 3SIZA 4GIAA 3PB0A 4UR8A 5LGZA 3TOPA 1XBYA 1J4EA 4AIBA 2CFFA 2DSVA 1Z32X 4DJFC 1REQA 2Z4GA 4KW2A 4IQJA 3ATYA 1XYFA 3UG5A 2ACRA 1W6TA 3C86A 4LNYA 4HT3A 1BD0A 3EKGA 1WZMA 2X0YA 2QDEA 3DYMA 5FF2A 1Q6QA 2P1FA 1HJWA 1T7LA 1VENA 1V3MA 2Y5EA 1XF0A 3VKJA 1UH2A 2YLLA 4JIRA 3ISIX 1US2A 2OT0A 2RH9A 3ZJ7A 1WXZA 3ZQ9A 3RCNA 3VI2A 4UQEA 4O1AA 5DMLA 1H2JA 2REQB 2WKJA 1JNDA 1YTDA 1PEZA 1PKMA 3RM9A 4GYPC 5JBFA 1C90A 2A3CA 2DSZA 3A47A 3UNDA 1DXIA 3GAKA 1SR9A 4NYYA 5LSMA 2W67A 1PZ0A 2JGQA 4CQAA 4I9AA 1H62A 4U31A 3DI0A 3NPVA 1K7EA 2IPGA 4DJDC 3P8IA 1X7IA 4BFAA 3CL8A 3LCHA 3NQFA 4AHOA 1OF8A 3FJ4A 4M80A 4LSBA 3N12A 3D6NA 2R82A 4FO4A 5DELA 2Y2WA 2WPGA 4WSJA 2UV8G 3B8IA 4D1JA 4FXSA 1WDSA 3T09A 4FF7A 4Q8WA 1ZQ5A 3C2RA 3NQBA 4MF4A 4TX6A 1MQPA 4XZWA 1RAKA 1KWGA 4TMCA 2BGNE 1H1YA 1Q6FA 1T0OA 1YXYA 3KVLA 2EG6A 4YS1A 3HGSA 2ZA1A 1A5MC 1VLWA 2CCRA 1QWGA 3QLLA 1PIFA 1GVOA 1MDLA 1JPHA 1VFOA 2VWTA 1OYAA 3MP4A 1UKQA 4XBSA 4N9EA 4F2BA 3VDCA 2HBVA 4WXYA 4GXWA 4R9OA 5KINA 1CXLA 4H9XA 3E1F1 2D2HA 3IVUA 2EEXA 4TV5A 2WSQA 3QC0A 1T5AA 3BMXA 1DV7A 3MT1A 2RUSA 2QMJA 4QIUA 2CBUA 2W0UA 1NF7A 3U5YA 5HR7A 3HG4A 5F2LA 4ZMGA 4C6LA 4PMXA 3OLEA 3BGAA 5CG7A 1YDVA 2NX1A 3TJLA 4CLMA 1UR4A 2YKKA 1VBRA 3W73A 3L0GA 1BLIA 3W7JA 4JFUA 2ZKMX 3APTA 4O1BA 1BXBA 3IJ9A 2Z29A 3T55A 2WMIA 2CBIA 1KO0A 2IQ0A 1TSIA 1XLHA 4S2CA 3CM4A 4W8LA 2CLKA 3CZLA 4L1XA 3OU8A 1E6NA 1OG6A 3CAVA 3MUY1 3TEVA 1KXTA 4ASTA 1H49A 1T40A 2PWFA 3W7RA 1J10A 1IYXA 2FHFA 1AMKA 1CXHA 5FL0A 3F4NA 4AZCA 3AROA 1IWPA 1NDVA 3B3DA 4LAMA 5DBTA 4E6MA 3DCPA 1V0MA 3GIPA 1X6LA 3QGAC 1X97A 4Z2LA 4ZTYA 5DMYA 4IIGA 3E12A 4JXCA 5BROA 1V03A 5AC7A 4QJ1A 2A7RA 5K9XA 1D2KA 4QG6A 4FAMA 1AL8A 2DUAA 4HK5A 4F2UA 4RUBA 3TYUA 1HT6A 4C65A 2UY4A 3S5OA 5I07A 1VBGA 5MKGA 4O17A 3NQVA 1E9YB 1E3XA 2I5GA 2ZUSA 4P7OA 3NQMA 4JQ3A 1VIZA 3ZVHB 1I45A 3MKCA 1YHTA 2WBKA 4NG3A 3RJXA 4XAFA 4FALA 1HO4A 4FIQA 4Z1AA 1RLDA 5D02A 6REQB 4HZ7A 4L56A 1K8ZA 2QW5A 5I0DA 1GOQA 1ZJHA 4QJ5B 3DGBA 3G1XA 2VHLA 2RDWA 1EYEA 3TSDA 1W5QA 2V30A 3VGBA 2PDFA 3NURA 3V1HA 2HXUA 3W1TA 3W7CA 2VR5A 4J7RA 3BJFA 2NT0A 4QE4A 3B8WA 4KWSA 3UW6A 3NQ7A 1DL3A 2ODOA 1VCVA 3M5VA 2ZIDA 4IF2A 2WBGA 1H7NA 5DF0A 3I3DA 3W7MA 4HA0A 4JR5A 3EKLA 2XPKA 3QR1A 5BRBA 1QHOA 1PBGA 3PS7A 3G1VA 4UTUA 5DY2A 1KGUA 3BTNA 5HMSA 3UWYA 4FX7A 3CYVA 3W76A 2X2GA 1VS1A 5E9AA 3KVKA 2YB4A 2J66A 3SCVA 4CQCA 1UD6A 3SUUA 4HHLA 2BXVA 2GGGA 4CD8A 3CWHA 2J47A 4CNPA 4HPHA 5BCAA 1XLLA 5FEXA 3T05A 3AHZA 1EP3A 3FVDA 2G37A 3QN3A 4X3ZA 2JQXA 2NVAA 2R94A 2V63A 3TFXA 5ABTA 4HMNA 3PUDA 1U22A 3AJ7A 4V27A 4GQQA 2AAAA 3UP8A 1EIXA 4AYGA 2C6QA 1B9ZA 2G41A 2X8RA 1KM2A 3VD7A 4OKDA 5HJYA 4M8UA 3DFNA 2Z2AA 5J04A 1HW6A 2VC7A 4E4PA 4XVDA 3F5LA 5C9XA 2QLYA 1J0ZA 5C55A 2VP8A 2DZWA 3H6OA 3BLKA 3B04A 4IHCA 4PMYA 4NI8A 4JFTA 3L5LA 2INZA 4D72A 2V82A 3VZXA 3HGRA 1W9BM 3E6EA 3VX0A 1OT2A 2IPWA 3NZGA 4XTDA 5IFPA 3OZOA 4WX2A 4XIMA 3GTFA 5A6BA 4EAMA 1PKLA 1LROA 3QPEA 4DJFD 3KDOA 3ALGA 2VR4A 3VIIA 4M6UA 1MI3A 4IFKA 2C0HA 1LDCA 1XH1A 5PTDA 4S1FA 1ITXA 2FPYA 3SFKA 2WZIA 5BOFA 4AYSA 1BGAA 3GH4A 4DXXA 5I77A 1NOFA 3WQ8A 1J11A 3VIJA 4GYJA 3TN6A 4Q3MA 1JAEA 3H7UA 4EE9A 3RLHA 7REQA 3SCNA 4AC1X 2O9OA 2PUZA 1IE7C 1H7XA 4V1YA 1TE1A 3GXPA 4IMFA 4DJDD 3LERA 4C6QA 1G9HA 3LZ5A 4A3QA 1CENA 1G4TA 1P0EA 4P7QA 3EMCA 5HMEA 4NP7A 3F7JA 3POCA 5KETA 2NV2A 5E93A 1V6VA 3EX6A 4DM2A 2F7FA 5AZ0A 4PODA 3QW4B 4O8AA 3BAWA 3CK5A 5KZ6A 2WNQA 3N13A 2FMNA 3SJNA 3TV8A 4KFNA 4HOXA 5BWAA 1W3LA 3BCFA 5A1AA 2CLOA 4IJBA 3QTPA 2G3FA 4G9PA 3IK4A 1R47A 1JPMA 1NFBA 3M47A 3WLIA 1GYNA 3AIRA 4PA8A 3PF3A 3GW0A 2EF9A 4MADA 4AX6A 2ZA3A 3M16A 4C6OA 2ACUA 3SRFA 4ICNA 5M2FX 3LBMA 3O6AA 3AMLA 3K4DA 1ZZMA 2ZRZA 1TV8A 4HBKA 3SCUA 2YCIX 1XXXA 4P5UA 3JS3A 1PCKA 3WYZA 1E6XM 3N9RA 1UP3A 1W37A 1TG7A 1MSSA 1FKWA 1OCNA 3M6DA 1DIDA 3TXZA 2JKPA 1V02A 4J5NA 2CIPA 1GTEA 5SWUA 1VYSX 3GKFA 4NJGA 4O53A 4LH8A 4KS0A 3KS5A 3LNPA 4PMUA 1VFMA 4J3SA 4TX8A 2RDXA 3EKZA 3M0YA 4JTJA 4GNKB 3T2QA 1OCJA 1JCXA 3IJIA 1KQYA 2D3LA 4LV4A 5BMXA 1B57A 2NX9A 3VAVA 4L7ZA 6TIMA 3O6DA 3V5CA 2I5QA 3G1SA 1TV5A 3QLDA 3LTPA 4IX2A 3FDGA 4CEXC 3RLVA 2ASHA 3MJYA 4I8YA 1OZMA 2XIIA 1ZRQA 1IXNA 1TVNA 4ROQA 4EVZA 3UZZA 4ALDA 1TPVA 2BVTA 3TUUA 1MWOA 3T78A 3U0HA 1W5NA 4XBKA 4L6HA 5D8ZA 1OY0A 4G6CA 3RPMA 3QBUA 2L5HA 5CZTA 4K1WA 1C93A 2RDUA 4ENLA 1KXHA 5M3WA 3CZ8A 1DE6A 1BFNA 4GI9A 4N02A 3B05A 3DG3A 4ZB0A 4BWLA 2PDMA 3MO7A 3KCOA 1W1ZA 4AZ7A 4NIRA 5IDZA 1R86A 1XLFA 4AZHA 1FX6A 4O54A 1GEQA 4G56A 1DQXA 5BU6A 1V51A 4F40A 3HPZA 4HGXA 4TTGA 2G96A 3RRXA 4IOTA 3LD5A 4NF7A 1S5TA 1I60A 2HXTA 2QZRA 2GJPA 4UMCA 1PHQA 5A6LA 2I56A 1IWBA 2PWVA 3HBLA 1SJBA 3NA8A 5M03A 3I3EA 2A7PA 1LT8A 2XN0A 4KETA 1SZRA 3LM3A 1XLJA 4V1XA 4CN1A 2HVOA 4G1KA 3S47A 4QHRA 1AG1O 4BHYA 2OQLA 4MIMA 4S3FA 3TZNA 4GRSA 5FSEC 3OB8A 4JIEA 3WL1A 2TYSA 1OK6A 3Q58A 3DYPA 4DZAA 3KOZA 4LEFA 1LORA 3EWWA 2OO6A 5GNYA 2HK1A 2VZSA 1GKQA 2Y1HA 2FHCA 1NQ6A 3W83A 3GNXA 4R88A 1FOBA 4LT9A 4I9MA 1M6JA 4F0KA 4ATLA 3SCTA 1AQMA 4L6DA 3BARA 3DFQA 2W63A 2P0IA 1VD6A 2XSXA 4NRSA 3ZT5A 2AMXA 3VE9A 3CHEA 3LQLA 4FX8A 4LUJA 4N7QA 2ISDA 1UW9A 1FWEC 2CLEA 2PU0A 3H26A 4AD0A 1AH3A 1B3YA 2QKFA 1QK0A 1Z8AA 2E77A 3LI0A 5I3DA 1GG1A 1EHAA 3IIVA 1TELA 3LRMA 1R3YA 4A8NA 5C6MA 2CW6A 1JZ8A 3AXIA 3QY8A 2OLHA 3RO8A 3WF2A 5LIKX 4LUTB 3S5SA 4Y9MA 3O9NA 1CXEA 3FJ6A 3ENLA 3R0DA 4D2JA 3E2RA 4YLWA 4QBXA 1FQ0A 3W6YA 1PUDA 3AZRA 3SI9A 3QYSA 2BV9A 3T4WA 3B9NA 4NI3A 4HZ8A 4IZGA 1VPYA 2A7NA 3AS2A 1UKSA 4XZMX 3B9EA 1HVQA 1TWIA 4FPSA 4MYXA 4QAIA 1PZ3A 4RZ5A 3WMSA 1HNYA 2ZTKA 3V5FA 2QF8A 1AK5A 1TB3A 3G1YA 3I65A 1Y5VA 3WIJA 4LBSA 3STPA 3RLUA 4WRHA 2W92A 2XN1A 2CZEA 1I75A 3KXQA 3OW1A 1T99A 3MUAA 2A6NA 3AMGA 3ZS4A 3G0SA 1EGZA 4EPKA 3SDOA 1WOAA 4JTSA 3W4RA 3VYLA 3CB3A 3H22A 1GWJA 1V7YA 4EK7A 5AC8A 5E6ZA 4EKJA 3VFCA 1LOQA 4RCXA 3R0KA 2ZZ4A 4XO7A 4NX5A 4U2YA 2CZVA 2FPTA 3MS8A 1Q2SA 1KTCA 2O55A 2VJXA 3SQLA 1O5XA 1B4EA 4LYRA 1Z9AA 3KOFA 4E2BA 4GWEA 4HYRA 4HJWA 2FVLA 4M81A 3IK2A 3AICA 4G2DA 1VBUA 2VYOA 2QXWA 1UZHA 4GUFA 3W7LA 3MCOA 1W2PA 4REQB 2QVNA 2ACQA 2ZADA 3WH9A 1NIUA 4BF7A 1ZNNA 3CT7A 1GHRA 4JAWA 3S83A 1PIIA 1G67A 2LLEA 2QIIA 1DJQA 3GD6A 1UWUA 3TSMA 3HQNA 1QOPA 1ONRA 4GVGA 4ZOEA 1FHUA 2B7PA 1R30A 1QHPA 3W2NA 4CEUC 3QV8A 3P80A 5FF7A 3W87A 3BJSA 5J8LA 1O94A 4F0RA 3U6WA 3BW2A 1V8EA 2INEA 3POHA 2PDCA 1NAL1 3R7MA 5EFDA 2J8TA 5BYWA 4UUIA 1OIMA 2PWEA 3GFZA 1M03A 3DH7A 1E5NA 1HGYA 2GWGA 5D9OA 4R9XA 3DHDA 3WQ4A 1TQXA 1H51A 1FHVA 3DFHA 5BMWA 1UJPA 2UY3A 3FKRA 4XVEA 3PZUA 4AZBA 4FNUA 1E15A 3DZ1A 1JZ3A 4O10A 3N17A 5CGTA 4OTKA 5A8MA 1P43A 4IGSA 4MPKA 4PL2A 2VR2A 1CZ1A 4L5ZA 1R5YA 3V35A 1Z69A 3W23A 3D3FA 4RNJA 4IPIA 3EMZA 2R8WA 4MTVA 3WQDA 1EJ7L 2D1ZA 1FWSA 1YDYA 1D3CA 4AIOA 5K3VA 5D2VA 3AC0A 2C18A 3DERA 4FZIA 5C8BB 1V3IA 3B97A 4HCDA 4Z2KA 3T8QA 4BWLC 1CB7B 4XUYA 4PMOA 3M0IA 3SZ8A 1BWLA 2AOSA 5FCZA 3L66A 2XSAA 2WCSA 3EX3A 2BZNA 3BG9A 5A8PA 1ISWA 1SJDA 3O05A 2JALA 1XGDA 3FW6A 3O63A 5I03A 2UZ9A 3TKFA 3NL3A 2CPUA 1IZCA 1CLXA 3O3RA 3KTXA 3B8VA 1HKMA 2AAMA 1VQTA 3IUIA 4H8HA 1JI2A 4B5UA 3S5NA 2OU4A 4QCFA 2ZX8A 1YQ2A 3R25A 4JQAA 3SY1A 3MV11 4HMDA 2H3DA 3WQ5A 2BTMA 1V4YA 1XLCA 1KCZA 1OG0A 3WNNA 2Z27A 3MPGA 3DN5A 7ENLA 1TZ9A 3LCLA 3R8GA 5H91A 4GX8A 4GH1A 4YN5A 4AFYA 3B4UA 3QV7A 4JHOA 3W24A 1GORA 2JEQA 1TQJA 4M5PA 3CZEA 3OGRA 3UJ2A 3N14A 4U28A 1XIFA 4J9JA 1X96A 4M24A 4NZ3A 1DWJM 2DZSA 5D37A 3ES7A 5GJNA 1P6BA 4JTKA 3IJQA 2VL4A 4WEVX 3SADA 1XCFA 3KX6A 5DMNA 3LCIA 1PO9A 4AWUA 2ZZ2A 4N9DA 2RJHA 2CLHA 1CLKA 4IIDA 5HA7A 2GVEA 3TLQA 3W70A 1TPC1 4CNNA 4B5VA 5D2XA 1B31A 2BODX 2E28A 1CXIA 1ZTVA 1S3TC 4JL2A 5G4HC 4Z0SA 3UPWA 4DVOA 3TCEA 4GIYA 3W9ZA 3FGCA 1KV5A 5I24A 4QG9A 1RBLA 5DO8A 2PRMA 2BXZA 1CGXA 2G50A 1YNQA 3ABQA 3ECQA 5L9FA 4YHGA 1W3NA 1DJXA 4CCEA 4IJCA 3NZQA 4ZQMA 1RH9A 2H3BA 2OB3A 3WH7A 3E0WA 5EBUA 1SO5A 3RGTA 1AH4A 5M17A 4URIA 2DW7A 3JZUA 3KLKA 3IGUA 3PSWA 3FCPA 2WW5A 2HROA 1R9YA 4YYFA 2NQ5A 4IIBA 5TQLA 1UJQA 5K4XA 4IICA 1MQQA 3OBKA 4AAJA 1W1VA 1HQTA 3VIPA 2E9LA 3E2VA 2FKPA 2Z6JA 1HKKA 1E0XA 1GQNA 3GHTA 2ZC8A 3KCLA 1SO3A 4JIQA 2JFEX 4DUOA 4AIEA 4X60A 5AC4A 1A0EA 3QZEA 2PI6A 4LTSA 1QI0A 3IV8A 2OGYA 3UXLA 3QZAA 3BOLA 2BOEX 4KCUA 3DC0A 3MUXA 3N25A 4JHZA 5A3HA 5F2IA 4NHVA 4EF9A 3I7SA 1OF6A 5HATA 3AZSA 4WKFA 4FIRA 3T7VA 2GL5A 4JQ2A 5GVJA 1E6SM 2VGIA 4DWDA 1GVYA 3QSRA 3GYEA 4GG9A 3RMJA 3HQPA 1K4HA 1XC4A 2ZE3A 4A4AA 4PRTA 4H9VA 1MXDA 1NP2A 4K8GA 3WDHA 3TCSA 3EWUA 4PUWA 3AXXA 2F38A 4KERA 1IGWA 3RM4A 4RV3A 2H90A 3TTSA 1KRCC 4UC5A 2ANUA 2QCFA 4ZO6A 3RU6A 4NILA 4W84A 4U4MA 2BMBA 4GUHA 3AIEA 4TVUA 2XYLA 3G3MA 1R85A 4PTNA 3OLIA 4H9YA 4IPLA 1OGBA 3C2VA 2VDGA 2YL9A 4C60A 3S2MA 4GLEA 4QM1A 1LUCA 2YBVA 2VEIA 3CYJA 1W1PA 1PZ2A 3TC7A 3ARSA 3HGOA 4O8RA 3DI1A 2XH0A 2H6RA 4HIBA 3K8LA 2YCKX 3QTGA 2VEMA 1HL2A 5DRIA 2C14A 2PZNA 1ZFJA 2AQWA 2BOGX 4WY0A 3CHDA 1GYMA 1FA2A 1X6NA 1YLVA 3QKEA 4R33A 1EP2A 3BGJA 1IXQA 4QDMA 4WDUA 2OEKA 1K8YA 2W3ZA 4YIWA 3G8RA 3ITYA 3I68A 3OBAA 2C19A 1A47A 7XIMA 1HG3A 3G3DA 3G5EA 3EWZA 4GKLA 2X09A 2QCDB 5CJMA 4GVIA 5CAKA 1CX9A 2VURA 1SSDA 2V2HA 3LMYA 2ZUTA 1CW2A 4U5IA 2XJ7A 1KCXA 1W9XA 4XZIA 1YTEA 2ZWYA 3ZSSA 4W4QA 4HP5A 3SCSA 1DJYA 5FAJA 3EBVA 1O12A 1FRBA 1WQ5A 3M5YA 4XAGA 1W3TA 1KKRA 1IXOA 4CQDA 3M0KA 3VM5A 1OHLA 3VIMA 3NIYA 2BX7A 3QOKA 3MSYA 2V68A 4GJ1A 4R3UA 4FR1A 3EX2A 1CECA 4LCRA 7PTDA 1GOKA 1R38A 1SZNA 2XFWA 2Z2UA 1TTJA 2CZFA 1G4SA 2RKXA 1J0KA 2EAWA 4XWUA 4NJKA 5DT7A 3N6JA 3VC6A 2G8ZA 3H4XA 2XFRA 4GOAA 1Y0EA 2QUMA 5I5RA 1VH7A 2H8XA 3OODA 2ZBTA 4H9UA 3TA9A 1FP8A 2PP0A 4H7VA 3NQGA 1KGXA 4RE0A 4P8VA 5LHFA 4CD4A 3S46A 4JCLA 1LQ0A 1LLWA 4C6MA 1AZ1A 4JKMA 4DNHA 4MLRA 3QMTA 3WJWA 5ABFA 5LIYX 2QDGA 4UR7A 2VI0A 4D6CA 4AWSA 4J28A 1UIOA 3MANA 2FHBA 5CBIA 1DVJA 4UTFA 1GKPA 3K1GA 1XISA 4MFEA 4EXBA 4INFA 1P1MA 2P8CA 3WLKX 4V28A 1EIBA 4ZTXA 4GIRA 3DFTA 3GR4A 4EPEC 2EG8A 1K9DA 1XSJA 3B40A 3VO0A 5C7HA 2EPHA 4OUEA 1YTKA 2XG9A 4DO4A 2WZMA 2PDBA 3THAA 3T0CA 3HPSA 1W5MA 5REQB 4L64A 2DT0A 3C6CA 3KVJA 4C1NB 3SUVA 1UG6A 1EWDA 1SO4A 5KMYA 2PWGA 3SCRA 2TAAA 2V81A 3BSHA 4PB5A 1LZOA 2VQTA 3GTHA 3AI0A 4GGHA 1DIKA 4KF1A 2HK0A 1L6WA 5EMMA 3UWEA 1E6RA 1E1CB 1TCMA 2QAFA 3IRDA 2CERA 2TMDA 3NXFA 3CWOX 1EH9A 2PCEA 4BQ4A 4KWOA 1J5SA 5CPMA 3G2GA 3PPCA 3TX9A 3QEZA 4IGNA 8XIMA 3LPPA 3IGSA 3EAUA 3TZFA 1FWIC 4WSKA 1TA3B 1XV8A 4QJ4B 1Q4NX 1US3A 2CLPA 3W85A 2O92A 4Q8OA 4NZFA 3MUCA 4Q4KA 2VZOA 3M7WA 1GZJA 3FKKA 4G7FA 3NSXA 2C79A 5AZ1A 3WMLA 4HD5A 3LCXA 3BUVA 2VX7A 8A3HA 5C7VA 2NVCA 4L1GA 2CZ5A 2G3NA 3UFYA 3V0TA 4J3TA 4LC8A 2J9XA 4PMZA 2CYGA 3M46A 5D2WA 1PJ9A 3EX4A 3WEOA 3VIOA 2EPNA 3F2BA 3IACA 3TQVA 3FX4A 4KRUA 1B1YA 1M53A 1SZFA 2PE4A 1BSIA 1L9WA 4WDTA 6CGTA 1B90A 4JS3A 3OJGA 3LXAA 4Q8UA 3RJYA 1TUXA 1I2QA 4DBDA 2PGFA 4P7NA 4F0LA 1KCLA 2CZDA 4ICMA 1YXDA 1F4HA 1QI5A 2AKMA 4EACA 3IEBA 3VMNA 2H9AA 1V6XA 4DY1A 2QPSA 3BCDA 4OJYA 4LFYA 5GNXA 4YYCA 1CIUA 5J5DA 2J7BA 1PAMA 4LXFA 3THCA 1Q8AA 3OA3A 1G1YA 4FHAA 2O9PA 1F76A 2CETA 3BL3A 3Q37A 2GK1B 1ECQA 2QJIA 5LYRA 4PTDA 3ZJKA 2PA6A 2WMHA 3DUGA 1VEPA 4A2RA 1VYRA 4LQ1A 4PYSA 1LL6A 4LB3A 1HJXA 1CXFA 1ECEA 4M1RA 4G8TA 4R85A 3W22A 1SW3A 2YBTA 1WV2A 1ZPTA 5AY7A 4IMEA 1HZYA 3IJLA 1DYSA 4AD4A 1C8YA 5TF0A 1UYQA 2DIJA 1BRLB 4JIIX 1OC6A 1PDZA 5AC6A 1EA9C 1XC6A 3H21A 4JTUA 4FA3A 4MJ2A 2MNRA 4F66A 3AQUA 3CPGA 2YL8A 2ZX6A 3H2CA 4YTQA 5FEWA 1FWHC 1RCOB 1ZJBA 1M04A 5FF0A 1YKWA 2J9YA 1H63A 2ZC1A 3M0MA 3FA5A 4UCFA 4LYPA 1KCKA 3L12A 1PHWA 1RQEA 3LSCA 3BVJA 3RUBL 4K7YA 4HNOA 2VRJA 2FTYA 1XLGA 2CHRA 3ARYA 4DLFA 1J0IA 1KFWA 1VPQA 3H2OA 3U3HA 3BJTA 3KOXA 2PDPA 4PEEA 4FLOA 4H00A 3WENA 1NELA 3G1DA 4FLSA 3K4AA 4C6BA 2I16A 1TMLA 1V0NA 3UG3A 3UCQA 3UY7A 1CDGA 1X98A 1WCGA 2NLYA 4CU6A 1ZGDA 1X38A 4BKNA 1YPFA 1A50A 1F05A 3I7RA 3WLHA 2Z1SA 1FHLA 4B4FA 1ZAHA 4O4VA 2DUXA 1K8XA 3WLMA 4NXSA 3K5XA 3NDYA 3ZIZA 1FVPA 3D0CA 1E55A 2R14A 3GXMA 3O2LA 2WHJA 3GDLA 3UGRA 4FNPA 2RGMA 2AL2B 4LWWA 1NWUA 3P61A 3OHIA 1FH9A 2DUZA 4H9ZA 1I9CB 2JGYA 4HVXA 1ZJIA 1UKPA 2XU2A 4B2DA 1UP0A 3RITA 3SN1A 2YX0A 3SY5A 2F2KA 3P60A 1OX5A 8TIMA 5AYXA 2G4FA 3GE7A 5LIWX 4MJZA 1EZWA 3BLLA 1K9TA 4H41A 1ZAIA 2POZA 4KEMA 1OVDA 2QT3A 4JX6A 1FBAA 5I02A 5CSUA 3CV2A 2DY3A 4GNVA 4HOWA 4AZ5A 5C2XA 4K37A 2HISA 1W56A 3O7UA 1DE5A 4QG8A 4GQRA 3AUJA 1F3EA 1KB3A 3ZWSA 4D6GA 4YNGA 2J4GA 4GI6A 2OJPA 1WZKA 3IIXA 1GKRA 1PX8A 3ZLGA 1AQHA 5AHMA 5GPRA 2OG9A 2B31A 1EYWA 3QGKC 1UOKA 3NZPA 4BI7A 4MFDA 4BS0A 3FGCB 3ZFHA 3XINA 2X1SA 3UJSA 3O0KA 2OYLA 3SCQA 3KHDA 3TYCA 1M5WA 1BQGA 3DEQA 3GR8A 3CO4A 3TQKA 5LZLA 3MB9A 1EUNA 1KBIA 3JRKA 4QITA 4WOQA 3OVGA 5FD0A 1YADA 1N8FA 3CLMA 4Z2IA 3GSMA 3ZO9A 3LM7A 3WLPA 2JIWA 4L6OA 4TO8A 3UZXA 1EZ2A 5LIUX 4TOQA 2EPLX 5FA5A 5CSYA 1IXPA 4YVXA 1TV7A 4Q4SA 4DI9A 4NY2A 3N29A 4S2BA 1OX4A 3SEPA 2E09A 4QE1A 1K3UA 1ZP4A 2J8FA 1HX0A 3T81A 5AHFA 4JYDA 1F3XA 3T0TA 4KGJA 3N2XA 2WCAA 5CH9A 4QDWA 3HO8A 3C0QA 3ITVA 3MP5A 5C5YA 1XSKA 2HQAA 1Z3NA 1JUBA 1XYMA 3K1DA 3TFCA 1GJUA 1C29A 3HFTA 1EC9A 1D3HA 2IS7A 4CKQA 2PD5A 5MHBA 1ESWA 2VFGA 2WQDA 2WV8A 3W2LA 3CIWA 4MKVA 4YU1A 2QCGA 2ZUVA 1EL3A 3CZKA 2C7FA 5BW6A 3VOHA 2J79A 1DJGA 4A2SA 1TYGA 4V2XA 1XD0A 1ZBWA 4GNJA 2DDXA 2PURA 3WD2A 3EOUA 2J25A 1TJPA 1J2BA 3CV1A 3QY7A 3QR0A 5D8WA 3K2GA 3OEXA 1A0DA 3MI3A 1S5WA 3P6LA 1R87A 3LCFA 2QUNA 3W6LA 3UVAA 1Q6CA 1BVZA 1Q63A 1V93A 2IKIA 3GFYA 2ZZ7A 3FK4A 2PS2A 4IP4A 4AIUA 1CI1A 3BW3A 2WKLA 4W85A 1JXJA 4F9JA 2PDWA 1XYZA 2VFFA 5DRCA 1NQKA 3RR4A 4U2ZA 1NFPA 1VC4A 2P50A 3J7HA 4Q4QA 1JAKA 1QK2A 4AU0A 3E74A 3Q45A 5I79A 4QX4A 3NQ2A 4IG2A 3RHGA 4CNOA 3F4WA 3C0JA 3HB9A 1GOOA 3LNMA 4HU4A 4JZ5A 1HL9A 2YGYA 4MUPA 4MOZA 4UTTC 2VO5A 3PBWA 5CPLA 3SW6A 1BYAA 3MHGA 3KHJA 1A0CA 4FNQA 5HQLA 3WQEA 4MDPA 3BLDA 5CZKA 3C2EA 4L4OA 3GXFA 2BY1A 3BV4A 5AYIA 4EXQA 3LPOA 1FH8A 3WY1A 2WXDM 4GCAA 5CZ0A 2J6XA 3M0HA 2EXOA 2J78A 1WYIA 4XB3A 1OYCA 3DBPA 3T0BA 3UETA 2W79A 1L6YA 1LG2A 5BRQA 1TV3A 3RR1A 1U1HA 3TW9A 1VFFA 4EWJA 5HMDA 2ABAA 2EG7A 3L65A 3WMCA 1NY1A 4BQ3A 2PODA 4IP7A 5I06A 3B8UA 4AISA 2PDKA 1V5XA 1PX3A 4ICCX 3MMUA 4IIHA 2VX5A 2VOMA 1DWAM 5AHNA 5HPOA 5G1MA 2VUNA 2B0MA 1S38A 1S46A 2IXVA 1WOBA 5BOEA 1LRNA 4GI8A 4TQTA 4ADUA 1CTNA 5DCEA 3SFWA 1UZ1A 2VEGA 2OPJA 4GD0A 4GUJA 1NOUA 3EXRA 3FHQA 4PSRA 4RXFA 4ACYA 2W4XA 1NVMA 1VHNA 3DXIA 4Z1DA 4IIEA 3EDEA 4PUDA 4M29A 3PBGA 2DU2A 1VCFA 2R1MA 4BQ2A 4H8NA 1A5SA 2D20A 1RUSA 1RK6A 5DLCA 2DSWA 5JXQA 2E6AA 2QNEA 1W91A 5CJ5A 5E1QA 5TBOA 4AY8A 2KAUC 5I7GA 3FEQA 4WJEA 3UWZA 1YNPA 3UERA 1W1A1 3HPFA 3ZR6A 3LBCA 5I00A 3CT2A 1XLMA 4B92A 4EOUA 2DVUA 3CQKA 2FDMA 4AW7A 1SW0A 1XPYA 4PC8A 2E3ZA 2WSRA 3VA8A 5FJUA 1QOQA 3PJTA 2DQWA 5A5WA 1S5NA 1ISYA 3L4XA 3KLLA 1VR6A 3U4FA 1GVRA 5D32A 5F4SA 4ZL1A 1DHKA 2VDIA 4NJJA 4GY0A 4KIRA 3USBA 1KNWA 3L4YA 4OUIA 3BE7A 2GQ9A 3STEA 2Y61A 4NL1A 1BVNP 3H7RA 3BLOA 4XD3A 4P61A 1JZ5A 4AUBA 4HN4A 3EDFA 3P82A 4ZOAA 4A8LA 2O0TA 1K8CA 2HNHA 2F8QA 1ZSXA 1OD8A 4LCQA 2GUBA 3GNNA 3HJZA 3M6YA 2OZ8A 2GGJA 4HK7A 3BXWA 4LF1A 1OYBA 4RPQA 2ESCA 3GTNA 4RR4A 3MI2A 1EKOA 3MC5A 3VOIA 3BZJA 5BWFA 4F8XA 3QZ6A 2R1NA 2VKZG 3P81A 1KRBC 4CVWA 4WZHA 2GJXB 2OKOA 4XISA 3BAIA 4C6CA 1E1EA 1ITCA 4UNLA 1V77A 5FEPA 5LKYA 3L4WA 3ITLA 6XIAA 2F2HA 4BA0A 4XD4A 1XI3A 2DH3A 5A6SA 2VC9A 4XD5A 1PKYA 5I6SA 4GA8A 2RJGA 3H12A 2D69A 2ZRXA 3CB8A 3KWSA 4S3EA 2C0AA 3VNKA 4PMNA 3CHVA 3AHXA 4M3PA 4DYEA 3NQAA 1TIMA 2ZVIA 3M4HA 1TWDA 4CNUA 4FLQA 4LC6A 4I8DA 3I6RA 1XKYA 3RX3A 3CL7A 3B0XA 1KRMA 2E6DA 2DORA 4MB4A 3RX2A 1UD2A 4QEEA 2W6RA 1H4PA 1XG4A 3ZZ1A 4PCNA 2VNCA 1JF5A 3WJZA 5MF5A 1TV2A 3OIHA 1E73M 4AF0A 1DQUA 1L0PA 4O0KA 1U2YA 3BAKA 1XPGA 2GOUA 4A21A 3GFXA 3W29A 4F0MA 4D6IA 3MSDA 1NDWA 5IM51 4BZYA 2OX1A 1BTCA 2QV5A 4R27A 1PWLA 3WX7A 4TIMA 2C1HA 4XKYB 5CC6A 5AHIA 4NZ1A 4KEUA 4AEFA 4BJHA 4ZENA 3S0CA 2NWRA 4H3DA 2WLYA 1QBAA 3NM1A 2ZX7A 3U2OA 1IT7A 1QRQA 2E25A 1WKDA 2OQYA 4S3AA 1VFTA 8XIAA 3TW6A 3QGVA 2DH2A 2ZFAA 1QO5A 3SM0A 1D9EA 2O56A 2WNWA 3WLNA 4C7GA 3ARPA 3IJ7A 4JKLA 3TTYA 2PTWA 2J24A 3BSMA 3TTEA 1KFCA 2XFFA 1XRVA 4M7SA 4NKCA 4NAFB 1H3GA 1XS2A 2YW4A 1LOSA 3MU7A 3O06A 3CUXA 4S3GA 5TIMA 4B3ZA 1Q7MA 1MXSA 1UZ4A 4GI4A 2C3ZA 4NT0A 2ZRUA 3HN3A 3P5YA 2PMQA 1OM0A 3N4AA 4KEVA 1S2VA 1K03A 3BSGA 2RAGA 5HJLA 3RPTA 3EXSA 1S2AA 2X7VA 3BZGA 4WIWA 3EOSA 1TREA 4X9YA 3VOGA 1PTDA 3CH9A 1LTDA 4BF9A 4XSMA 1J0YA 2X0HA 1JCTA 2DPEA 2ISSA 2IPJA 3CUJA 2MANA 2Q02A 2YA0A 3WUBA 2XWEA 4P7LA 2A5HA 1OGGA 4TUFA 1P7TA 3WDQA 3I4KA 3A22A 1E0TA 1KM4A 2HS6A 2E8ZA 1IWAA 5D38A 3PUOA 3PVFA 1BHGA 3P74A 4ZOCA 4E38A 3LHVA 3FYOA 2OGJA 2GQ3A 1YMYA 3CV7A 1OADA 5CBJA 1B2YA 4GHRA 1R2RA 1GQLA 1TPEA 5AYZA 5IHSA 1EEPA 4J3VA 3PZTA 4GXMA 3WH5A 3ITOA 4JTAA 1FXQA 1ONEA 1AD1A 2X1IA 1F3WA 2VGBA 2B7NA 3PTKA 3PZQA 1CNVA 1JGIA 2PRHA 3M41A 3TYZA 2EKGA 4UXDA 2YA2A 3VK5A 3QFWA 3MDUA 1LJYA 4X2PA 3SJ3A 3GBEA 2CC0A 1Q7QA 4I6VA 4JTQA 4D6JA 3KP0A 3HPAA 2PBGA 1QPKA 3QYQA 2Z1WA 1KBJA 2CKRA 1SGJA 4MVAA 4JFVA 2X41A 3AWNA 1E6QM 4L80A 3THDA 1SFSA 1CLVA 4HZ6A 1MFUA 1ITUA 1B3VA 4C7FA 2NUYA 1CBGA 1FTXA 3MTWA 4F3HA 4L61A 4WGHA 3R94A 3W07A 4NNBA 3CTTA 1L8PA 2IQTA 4B2DD 2YPIA 2E5BA 1JIBA 2HWGA 3GR7A 3G1RA 3H70A 1RVKA 2GDUA 4H04A 1ODUA 3XIMA 3AO0A 2GSEA 4JEJA 4F79A 1KXVA 1RP9A 4C6IA 5LNWA 1XYCA 1YXCA 1VBJA 2QYGA 1YE6A 2V5CA 1W1TA 4M1BA 4ZSUA 1MO0A 3A3HA 4IQEA 1GNXA 3UR2A 4L9XA 1X39A 1XW8A 3INPA 5AHEA 3UG8A 4LB4A 1F7BA 1HGWA 5F2GA 1IEVA 5EMLA 1VHCA 5F7UA 2PDYA 1WDRA 4MWAA 2D2JA 4KPLA 1HKJA 1YNYA 3GTIA 3ARRA 2VC6A 3ARXA 1Q6OA 3QRHA 1E4IA 2DVTA 4W7VA 4DO6A 2AGKA 4MDOA 1UH3A 3PJXA 2VRKA 4PCTA 4EANA 3ANUA 3WDPP 3NQEA 2GWNA 5CC5A 5T9BG 2Y5JA 3L9CA 1GYLA 2V0TA 3L4ZA 3DC8A 5KEZA 2YCLA 2YFNA 1ZENA 1CCWB 1P0BA 4UTWA 5IRPA 2NV9A 1FWFC 3IGXA 4X22A 5CLTA 4ONVA 3UF9A 3OIXA 5T8GA 4FK9A 5FKYA 3VZZA 2PC4A 3WJYA 4UNKA 4OECA 5U7SA 3WF3A 2FGBA 2QCNA 3UCDA 4C6EA 1XIDA 1RV8A 4F4RA 3ITTA 4UFHA 4RZ6A 1BVWA 4YMZA 1KR0A 3ABXA 1EJTC 3MJMA 3C0LA 1Z48A 7TIMA 1QW7A 4RK8A 1K9EA 2VMFA 3LYEA 1GVFA 2XINA 2XVLA 3NVTA 1FWBC 4QLJA 4WD0A 4EP8C 1IR1A 1TJ2A 3IUHA 4K8EA 1K77A 4YTSA 5IHRA 1QO2A 3W7HA 4WOZA 2OX4A 2V3GA 1CEOA 4GX9A 5CPOA 3CUHA 2QCMA 2POTA 4KFOA 2WSYA 3WFZA 3R11A 3QQ1A 4IG2B 3P62A 3AYRA 2A3EA 2Y7GA 3FAXA 4LANA 3I6EA 4PB3A 1DTUA 3FYYA 2GQ8A 1KKOA 5AHLA 3S1GA 3BW4A 4US5D 4O14A 2Z28A 4MAZA 3E0FA 4WY0F 3BAJA 1RCQA 4LS1A 5FJIA 4JY9A 1V6YA 1MVYA 1MW1A 3B0VC 1FWCC 2D2OA 2HCVA 4JQ1A 3BPWA 2GSJA 4L4PA 5CEWA 1DEDA 3KCJA 3E2QA 5A95A 4BCEA 2DZAA 3VC5A 2Y89A 3RO6A 4UQCA 4DZ5A 1EJWC 2ZZ6A 1OABA 4WUIA 3VFLA 4JFSA 5CG0A 3W37A 4H6KA 1EJSC 3AIWA 5G4EA 1F9CA 2E1DA 3NYZA 4IMAA 2X1UA 4OU1A 1SFTA 1QTWA 2O9RA 3A9BA 4S38A 1B3ZA 1UUMA 4U5KA 1Y5XA 3OG2A 3Q67A 4AMAA 1FUYA 5A8QA 5BOOA 1GJPA 3MQTA 4AXKA 4J35A 3AIVA 3TTOA 4W8AA 2BXYA 1M01A 4JN7A 3CIXA 4YTRA 3NPWA 2QCEA 4OBTA 1HL8A 4R53A 5CPSA 3H4GA 1JZ2A 4R7JA 2A21A 1JCYA 2PLMA 3EX1A 3KEHA 2BY0A 4JTIA 3G0XA 3UZJA 4O1DA 1CGWA 1N8WA 4Y90A 2QPUA 4W93A 5GNZA 1UC4A 3NFUA 1JCMP 3JZEA 3KE0A 3FDKA 1TVPA 1MNZA 3PJUA 3MMDA 1IV8A 4A8IA 2OT1A 2P8BA 2EPOA 1ITQA 1TTIA 3CHCA 4L1WA 3DGRA 2UY5A 1BWKA 5BXRA 3IJ8A 2V5DA 7A3HA 3PPHA 4RL3A 3CWNA 3PB2A 3T07A 2VQUA 3B9OA 1XBXA 4ILSA 2HRWA 1QUMA 3NSMA 3S9IA 1M7JA 3TH6A 1FWTA 2Q8LA 5G2WA 4GC3A 1JDFA 1TKKA 2VX4A 2EPMX 4HPXA 2VRQA 1VLIA 1RJPA 3Q2DA 5EPDA 2OYKA 2X05A 5TNVA 4ZE4A 3WO8A 3E5BA 3ITGA 3PANA 4N4QA 2WZEA 4K6AA 1GVIA 1ICQA 3PTDA 4HA1A 4LX4A 3N2MA 4US6A 2ICSA 1HN1A 3CQIA 1ME8A 1JUKA 4DAIA 1EQCA 3TA6A 3CZGA 1V08A 5A6AA 1GZGA 1XBZA 2PTYA 4GC4A 2W27A 3GO2A 1LWJA 4GIEA 2GVGA 1KFBA 2CXGA 1T8XA 2IKJA 3VILA 3W7PA 1DTNA 1JQVA 3L23A 1ODZA 2YSWA 2BGSA 2GGEA 3APYA 3CS2A 4I3GA 2BP1A 1WZAA 4LRTA 4B4HA 2XN2A 1VF8A 5AC5A 2ZOXA 2PDJA 1WKYA 3CZJA 3LLXA 1H1NA 3C5QA 4IH3A 3UZYA 3L5AA 1X6UA 3U4AA 3T4CA 2QUTA 4HTYA 3W81A 1KV8A 2C1GA 4O1CA 4AY1A 1ENUA 3G6MA 1VJSA 3KL5A 4UZUA 4HYWA 4JIHA 4NAEA 1JRBA 3ABOA 4IL0A 1ELSA 3KS6A 4LAOA 2O4MA 3CPUA 3W27A 1H41A 5FJPA 3W7IA 5C70A 4KEZA 3GS6A 4FEZA 2X7WA 4KBXA 3O8AA 2ZXDA 3ABRA 4WVXA 1D3GA 1QWKA 4DNMA 2WOQA 1D7FA 2VM8A 3BH4A 1WNOA 2A3AA 3MO4A 4LUSB 5JVLA 5AN7A 1E9IA 5CLWA 2GGIA 5C9UA 2VZVA 2DVXA 4MB3A 1Y65A 2VWSA 3GVWA 5A94A 3IIZA 1TFVA 3WN6A 3TC3A 4LOCA 1QASA 4RE4A 2WZHA 3BOFA 4ORIA 3WBAA 1QPRA 3JU2A 3WLTA 1M7OA 3LB0A 1UBPC 4PCFA 1IR2A 1QATA 5G5IA 3RG6A 1WKFA 3VOJA 3H4WA 2G3JA 2WM1A 2YW3A 1V6WA 3ATZA 2WC4A 4N4PA 2E9BA 3V36A 4J40A 2ZDSA 3IAQA 4WKAA 3W88A 3HPXA 1XH0A 2A3BA 3C52A 3LX9A 1UD5A 4S39A 1W3HA 3IANA 1EF2A 4EPDC 2QGYA 4JCMA 2XVKA 4RZBA 2XGBA 4CGTA 3F03K 3HMJG 1UPMB 2R91A 1FDJA 3VE7A 1QFEA 5H8MA 4Q8QA 4QLLA 1VFUA 1YBQA 2WVVA 4PFMA 4ZFCA 4FNTA 5CPQA 4JHMA 1R3SA 1WDQA 3R1ZA 1NOWA 2YOCA 3EA3A 5I2UA 1J0HA 4QS6A 3CAWA 2C71A 3U5UA 4JTDA 2ACSA 2DIKA 3VXGA 2WJEA 1DXFA 3N15A 2Z1XA 4UMAA 2FGZA 3S6DA 4D8LA 5EMYA 2ZXAA 3WDRA 1R3RA 3PZMA 4GJIA 1FWRA 2XH2A 2GDVA 1M41A 3HV8A 2NVDA 3RNDA 3WELA 5AKQA 2HV5A 3KW3A 1XD1A 3DX5A 4AMCA 2W9MA 5FIPA 1A5AA 3UQNA 1LP6A 3PULA 4JTLA 2WJFA 3I7QA 3MA8A 4V15A 4JN8A 1D7KA 1V0LA 1W8GA 2I9EA 7TAAA 3MCNA 4O18A 4AC7C 2WMJA 4PMJA 3IPWA 4IMDA 2QUVA 2AQVA 3N4EA 1IGSA 4B5SA 1GPWA 4ACZB 5D30A 1ICPA 3OZMA 1S5VA 3E49A 1AFSA 4JTCA 2G95A 3AIBA 1L6FA 3DIPA 1UWIA 1GCYA 3PP7A 3GXTA 3N6QA 1ALDA 4D6HA 1PYFA 3GVQA 2Y4SA 4MZ8A 3CQHA 3VVGA 3VGFA 4UZSA 4F2TA 4HPGA 4QNEA 2OEMA 3HOJA 1HP5A 4W5ZA 1EOKA 4GZJA 2PLKA 4V33A 3UESA 4AH7A 3A13A 3U7BA 1XRTA 4LV9A 2HBXA 1B3XA 3OA5A 1XKJA 3C3UA 3TMQA 4OOZA 1GGOA 4GYFA 1R0MA 3NQCA 1KBBA 3ARQA 1UP2A 3W26A 5HK4A 5K7JA 3M0LA 4AX7A 2C91A 1GPFA 3LS9A 2NWSA 3LG3A 3OGSA 3NEVA 1J18A 2VENA 1OFAA 2Y8UA 5T91A 1B0IA 9RUBA 4BEUA 1GK8A 4BY3A 2PB1A 3S5ZA 4QXIA 3P0XA 3S6OA 3W1AA 1Q7ZA 5FJTA 3PWGA 3HA1A 3QW3A 1IEQA 3E9AA 5AYBA 1TVLA 1ADOA 3BG5A 2GJRA