1S2AA

Crystal structures of prostaglandin d2 11-ketoreductase in complex with the non-steroidal anti-inflammatory drugs flufenamic acid and indomethacin
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of prostaglandin D(2) 11-ketoreductase (AKR1C3) in complex with the nonsteroidal anti-inflammatory drugs flufenamic acid and indomethacin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
total genus 115
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1s2aA00
1FRBA 3LUTA 2PFHA 4FAMA 5AZ0A 3UG8A 2HE5A 4GABA 1ADSA 1AFSA 2CLPA 5LIYX 2HV5A 2QXWA 3CAQA 2IKHA 2HDJA 1MZRA 3UYIA 1Z8AA 1MRQA 3F7JA 1EKOA 3GHRA 3GHUA 4JQ3A 3R6IA 1PZ0A 4XVDA 1US0A 3N2TA 5LIXX 1IEIA 1S2AA 3GUGA 4IGSA 4DZ5A 3WCZA 3P2VA 1OG6A 4XO7A 1R38A 2PDFA 4JQAA 4JIRA 3WBYA 5LIKX 4WDTA 4I5XA 4OTKA 2PDLA 1X98A 3CASA 3B3DA 4PUUA 1XJBA 4GA8A 4GQGA 2HVOA 2PDPA 1A80A 2IQDA 3QKZA 4Q7BA 4JTQA 3LN3A 4XZLX 1HW6A 1Q13A 3M4HA 1J96A 2I16A 3UZYA 1QWKA 2PDCA 3BUVA 2PZNA 1YE6A 1Q5MA 4GCAA 3V0SA 1K8CA 2DUXA 4JQ4A 2WZTA 1EXBA 4RPQA 3WBXA 1PYFA 4QXIA 4YVXA 4DBSA 4IJRA 3FJNA 4XZMX 2HVNA 3R94A 2IPFA 2ACUA 1XF0A 2PDNA 1LQAA 3C3UA 2HE8A 3V35A 1VBJA 1M9HA 1HQTA 3MB9A 2NVDA 3RX3A 4GACA 3H4GA 3NTYA 4FZIA 1ZGDA 1T40A 2IPWA 2A79A 4JTCA 2DV0A 4PRTA 4JIIX 2R24A 3EB3A 1SM9A 2ALRA 1T41A 4XVEA 3ONBA 1AZ1A 4LAUA 2IKJA 4G5DA 5JH2A 5AZ1A 4HBKA 1ZQ5A 4IJCA 1EF3A 3LQGA 2ACRA 1AH3A 1C9WA 3EAUA 3H7UA 1X96A 4DBWA 4PUWA 2FZDA 4YVVA 1XGDA 3VXGA 2AGTA 2IS7A 4NKCA 1Z9AA 2PDMA 3ERPA 4WEVX 1ZUAX 2FGBA 2IPJA 2INEA 2PDUA 2IPGA 1S2CA 2F2KA 2PDHA 4QX4A 4YU1A 3RX4A 4QR6A 2INZA 4LBRA 1QRQA 3R58A 2PDIA 4FALA 3G5EA 4EXBA 2WZMA 3EB4A 3LD5A 1GVEA 3LNMA 3DOPA 1PWMA 3R7MA 3U2CA 3CMFA 2PF8A 4XZNX 3R8HA 3KRBA 3G1RA 1S1RA 3UFYA 1VP5A 3ONCA 2FZ9A 3UZWA 3DN5A 4XO6A 3BCJA 4HMNA 2BGSA 4GIEA 2NVCA 2P5NA 5KETA 2BGQA 1RY8A 4L1WA 2PDJA 3Q65A 3V0UA 3V0TA 1AZ2A 1EL3A 1IHIA 4AUBA 4JQ1A 2PDKA 5LIWX 4R9OA 1MI3A 3R43A 3LQLA 4GQ0A 2BP1A 3O0KA 4L1XA 1Z3NA 3LEPA 2PDQA 3M0IA 4H7CA 5DANA 2I17A 2PD5A 4JTRA 2ACQA 2IKGA 1ZSXA 3R8GA 2IQ0A 4LBSA 4ZFCA 2PEVA 3MC5A 3UWEA 3WG6A 4LB4A 3BV7A 1X97A 2C91A 3RX2A 4DBUA 4WDXA 2R9RA 2PDYA 3Q67A 4WDUA 3LZ5A 1PZ1A 4WDWA 4PR4A 1LWIA 5M2FX 1Z89A 3O3RA 3D3FA 5HNTA 3COTA 2FZBA 2FZ8A 3V36A 2ISFA 4MHBA 3H7RA 4JQ2A 3T42A 1YE4A 2PDXA 4JTDA 3GHSA 1YNQA 2PDBA 3CV6A 3LBOA 4QBXA 5LIUX 2PDGA 4PMJA 3UZZA 4XK2A 3N6QA 4WGHA 4FA3A 4JIHA 1JEZA 3UP8A 4ICCX 2FVLA 4LAZA 2PDWA 5JH1A 1RY0A 3WBWA 3LZ3A 4XZIA 3M64A 1RALA 1PWLA 4XZHA 4EXAA 2VDGA 2PD9A 4WRHA 2DUZA 3UZXA 2IKIA 3FX4A 4F40A 3GHTA 4XAPA 4YVPA 3BURA 5C7HA 4JTAA 4LB3A 1S1PA 4PRRA 3UGRA 4H8NA 5HA7A 2HEJA 3S3GA 2ACSA 1YNPA 1UR3M 4Q3MA 1AH0A 3CV7A 1AH4A 4ASTA 5HNUA 2J8TA 3LENA 3CAVA 4YS1A 2F38A
chains in the Genus database with same CATH superfamily
1E51A 3STCA 4D1JA 2E5BA 2VQTA 3FLUA 4IUGA 3W71A 5HQEA 4WY0F 3N2MA 2XIQA 2LLEA 2VEPA 1AJ0A 4POCA 1T99A 4A8RA 4C6EA 1EKOA 3A5FA 4JN6A 4J5NA 1GORA 3CM4A 1YYAA 5D30A 3GIPA 2WC4A 4WR3A 1Q6EA 1GKPA 4DJEA 5J8LA 4U3CA 1E0TA 2C16A 4S38A 2WM0A 1XPYA 3GUGA 2PWFA 3B9DA 3S6OA 4IP7A 3CPUA 1UH2A 4Q33A 5DO8A 2DIJA 3TXVA 1M03A 5AYZA 3C2EA 4AWTA 4DM1A 3C0JA 2J79A 1Z48A 4QG6A 3P82A 3U6WA 2EO7A 2QIWA 4C1NA 5C55A 1X98A 4H6EA 4DPPA 3GXIA 1CEOA 2ZTKA 3M0JA 1N55A 1UD8A 3UCCA 1U83A 4IX0A 1CT5A 4QCEA 5DXYA 4AIUA 1SW3A 1JDDA 3UG4A 1K3UA 1XRTA 2PDPA 5EFDA 4N9DA 3T0CA 4WJ8A 3SRHA 5DX7A 1XLFA 1FP9A 2OEMA 3H2OA 3M4HA 4PB4A 1J96A 1JDFA 1QU4A 3BO9A 3M0HA 5HJLA 3WK2A 1R9YA 2XGZA 1I2OA 2E40A 2F2HA 2NT0A 1E1EA 3BUVA 1JF6A 3K46A 6PTDA 2OYMA 1ZJBA 2Q09A 1FKXA 5AC4A 3CBWA 3WBXA 3A24A 2NX9A 5CKSA 2FPTA 4JEJA 2Y6ZA 3CC1A 5AOUA 2MNRA 3CQJA 3U57A 1HKJA 1MXDA 1MEHA 2H9AA 2YX0A 3PSWA 3OLGA 5DMLA 2XU2A 4US6A 3VGEA 3MMUA 3W7GA 1VAHA 2DV0A 5CSYA 2R6OA 4D9PA 1B9ZA 1EWEA 3RNDA 1SO4A 1TJ1A 2BDQA 5AZ1A 4HBKA 3VINA 4IMGA 2GDUA 4WK9A 3HQ1A 1UMLA 3EOLA 3EMQA 1OYAA 4BCEA 3ITOA 4QSFA 3M46A 3BAXA 1JUEA 3ISIX 1VBRA 3VUSA 3W7JA 1XGDA 3E2VA 3HIJA 1ZCCA 1UUMA 1VJZA 3P8IA 3OGSA 3UVIA 3ATYA 1G4PA 1K02A 1CGXA 4C1KA 3USBA 4JKKA 2I9UA 2VZOA 3LMYA 4M7SA 1V7YA 4FI4A 3OEXA 3WKZA 4HNVA 4JFTA 2AAAA 5DY2A 4AVFA 2AKZA 1V08A 2ZVRA 2VFFA 1BRLB 3KVMA 3CQ0A 1BKSA 1QNQA 1RQBA 4AD3A 3LV5A 3S9IA 2GSEA 1W8GA 2V81A 4YTUA 1SW7A 2FHBA 1FVPA 2FPYA 3LRLA 4DNHA 3L0NA 4EAYA 9CGTA 3PZQA 3S5ZA 1PWMA 1QJWA 3IEBA 1LLZA 3URAA 2NWSA 3IWPA 4ZE5A 1BYBA 4O0ZA 3RLUA 4XD3A 3H70A 2NVCA 3GDMA 2BGQA 1RY8A 1DTUA 3WLPA 1IT8A 2WVUA 3HO8A 4AB4A 2Y61A 4RZBA 3TAKA 3M41A 4AX6A 1R7OA 2I57A 3EOEA 1SZEA 1W3NA 1CLKA 1UIOA 1MW3A 4U10A 3U9IA 4Q4PA 1L2UA 4AF0B 1F6KA 1MDRA 1UWUA 3LNPA 3EDFA 4A8IA 1TWSA 1I9CB 3QY8A 1AG1O 3H2MA 2W3ZA 3D6NA 5MHBA 4AD5A 1IT0A 5IM51 1WKFA 4LB4A 3AC0A 3IV3A 2PP0A 1A49A 2DZPA 5F2LA 3TQPA 4NT0A 4W7VA 4J3XA 3RX2A 1DHKA 5FIPA 1NARA 4NYYA 3URNA 2V5KA 3M5XA 1GKRA 3FFSA 4PN2A 3PPFA 1AQ0A 2GYIA 2QJJA 1Y5WA 3AU6A 1RA0A 4NX5A 3APYA 2XSXA 3IUDA 1I6NA 1QNVA 1TV5A 4F66A 1IWAA 3SUTA 2WMKA 4IXHA 4ZQRA 3UEQA 2XDFA 4OECA 1QWGA 3VNYA 1WB0A 4JZ5A 1J12A 5FESA 1ZP3A 3CMGA 2CCRA 1PVNA 4JNMA 3UJEA 3GQYA 1VHCA 3QZEA 4HPXA 4MY9A 1H5YA 3BV4A 4PBFA 2DY3A 2OPJA 1E5NA 4TVDA 4GKLA 2Y1HA 4O8AA 4J7RA 3D3AA 3CUZA 5FJUA 1EC7A 3M64A 5EFFA 3TXZA 3H24A 4A2SA 1A0EA 3UZXA 3B8TA 4JFVA 5BRBA 8A3HA 1SFTA 3AIQA 1HO1A 1CI1A 5A8PA 3I6EA 4AFYA 1SYTA 3B04A 4LYPA 2QUTA 5CSUA 5I23A 1E1FA 4GQQA 1QHZA 3W3OA 3FA3A 1UWIA 3DFQA 5I3HA 1H09A 4B3KA 1ICQA 1ZAHA 5GVJA 3QPYA 1L6YA 1G0CA 1PHQA 1J0YA 2PS2A 1JPIA 4EPBC 1J2BA 1DXIA 3G22A 1T8XA 3BDKA 4IMFA 2YL9A 3M9YA 4KCVA 1M7PA 1C93A 4OHQA 1UR2A 1UZDA 4J40A 4PUJA 4OT7A 1YXDA 3NQVA 3NM1A 1KWGA 1NOFA 1GQKA 4FNUA 1TV7A 1W0MA 4C91A 3CNYA 1DJZA 4XSMA 5H8UA 1LLWA 1W1TA 5LIYX 2HV5A 1QHPA 3CAQA 4GWEA 3W72A 2X42A 5CAHA 2V69A 1XBZA 1WUEA 1IEXA 2CBVA 2YPIA 4JQ3A 5HMDA 3AS1A 5EU9A 5HQMA 3GTIA 2QV5A 4BEUA 5D9NA 3ZR5A 1FH9A 4AH7A 2GLKA 3WCZA 4C6QA 1JZ8A 4GX8A 3R13A 3HPFA 2Z26A 3TU9A 2YKKA 5LIKX 1YDVA 3CK5A 1R87A 1X39A 4PCSA 2VDIA 3OU8A 4DZHA 4L6HA 1OT2A 2YL5A 3PM6A 3C3NA 4ZENA 3SCOA 4CQ9A 4Z2KA 4A05A 2J62A 3TIMA 3ITYA 3AROA 1KWKA 3RF9A 2BY1A 1E3XA 3TSBA 4ZGYA 1ESWA 3MUXA 2ZRZA 4FLSA 1XUUA 3T0DA 1XDLA 1WAUA 4RDYA 1SQ7A 4JTTA 2XGIA 4XZLX 1GG1A 3SCUA 2VX6A 4LYKA 2J7BA 3SGUA 2RJHA 3A64A 2QJGA 1K8CA 2WCSA 5K9XA 2JBMA 4HPNA 4A3YA 2PGFA 2Z00A 2PRMA 1F6YA 1Q8JA 4EKJA 3N19B 3T8LA 4ZE4A 1J6PA 3F5JA 4J2PA 1W1IE 3RO8A 3C3UA 3DERA 5FEZA 1X8CA 4Y90A 3RCNA 2E68A 4ILSA 2OSXA 1V0MA 1P7TB 3RDKA 1LBLA 2E3ZA 2VUYA 4JDBA 3C52A 5D9MA 1R2TA 4PMRA 2DVTA 4PA8A 2YXGA 1EDGA 3WJYA 3FXGA 1OWQA 1ZY9A 2PP3A 4C60A 1E5JA 4OV4A 3TH6A 3LQGA 1L6GA 4L4OA 1C9WA 1I1WA 4Y9AA 1K7FA 2Z1BA 3DG7A 2WWDA 2OQLA 1R3RA 4A29A 3O16A 3QPEA 3MCOA 4XTIA 3AS0A 7TIMA 1VIWA 3OVPA 3MDWA 4F2TA 4X3ZA 1BHGA 4R88A 3UWVA 1KFKA 4YTRA 3FHAA 1ENUA 1YEYA 3P0XA 4Z0SA 3O2LA 3O6CA 4N0RA 2QV4A 4CN4A 4QM1A 3M7WA 2OLHA 2CWNA 4QX4A 5AYIA 1QOPA 6TAAA 3QV7A 4V27A 1OFPA 5H6HA 2VRQA 3C8NA 3N12A 3WLHA 2XTKA 1WZMA 5HULA 4NG3A 4F2BA 3AIEA 2OMAA 3RLVA 1JYWA 4TX6A 3KL0A 3W7EA 3VOCA 5F4XA 5M17A 2RJGA 2DSKA 1H11A 3CEUA 4HVXA 2VT0A 2HNHA 2Y7EA 3GH7A 2HSAA 1W5QA 3UWUA 5ECUA 3NAVA 1CGVA 2D0GA 3ANYA 2DZUA 2ZWYA 4KKXA 6A3HA 4O11A 1I45A 3HJEA 4QE4A 4RXGA 2KZHA 4O0QA 3UT0A 3SGZA 3EX4A 1J0KA 1FFRA 4JFUA 1S5MA 4AUBA 1QW9A 3AMGA 2ZZ3A 4L4MA 5CSSA 4R9OA 2JIWA 1LRTA 5G2WA 1FWFC 3T1GA 4NRRA 4L1XA 4LF1A 4RV3A 3ABRA 4G7EB 3IARA 4MKSA 4H7CA 3N11A 3KLKA 1JUBA 4J9JA 3VNLA 3QC0A 2AL1A 2XHYA 4RDWA 1AD1A 1ZSXA 3IIZA 3W7LA 3UWEA 4PGLA 2VXNA 3EXRA 3CYVA 1TTIA 2BXYA 4ATLA 1KXTA 1V6WA 3DYOA 2BOGX 3ITCA 1SFLA 3Q67A 5C6MA 1G7UA 1KTNA 2VZTA 3T8QA 1UIPA 3BLDA 2VDHA 1KTBA 3W82A 1YDYA 4JX5A 1OFBA 1EC9A 4NVTA 3JRKA 5FKYA 2X05A 4ZFMA 2G4JA 3ARZA 3ZJKA 3MW7A 4JQ2A 2YW3A 5REQA 3ZZ1A 3PJTA 3RRXA 1XYCA 1Z41A 5A2BA 5LNSA 3DU0A 1US2A 1H7WA 3FDKA 4K8HA 3NIYA 5U7SA 4E2DA 1X38A 2F9RA 3PJWA 1TWDA 4UFMA 2E1WA 4D6FA 1RY0A 1V6YA 3TAOA 3KRUA 3BGJA 3K8KA 1LCOA 3OQEA 2DUZA 3N2BA 3THQA 2G37A 3GXTA 4TTGA 3FA5A 2ZA3A 4AVNA 4MFDA 3AHTA 5ENLA 1UC5A 4Z08A 3UR2A 4FMVA 1I0DA 4H04A 1EBHA 2R14A 2Y7FA 3EWUA 3KX6A 4B5SA 3LB0A 2Z27A 3UPWA 4GVIA 3GDKA 2F38A 1UQZA 4IGNA 1TTPA 4YL2A 1PSCA 2V30A 3WEOA 5D32A 3U0HA 3TTYA 3S8HA 4JTLA 1V02A 1V3MA 1C91A 2H8XA 2V3FA 3WQEA 1SMDA 3GHUA 3VPLA 3DFYA 1R6WA 3UR7A 1NY1A 1SO5A 3N2TA 2WMGA 4YJ5A 4YIWA 2V38A 2EG7A 2Y5JA 2ZDSA 4NJHA 3NL2A 4NAFA 3NURA 4M5PA 1JYVA 3GW3A 1SO6A 4I5XA 4O1FA 3S9ZA 2XVNA 4E0CA 3V5CA 1GOIA 2WK2A 4OQVA 1SU5A 3E3HA 2PCQA 1RSCA 4MJ2A 1L9WA 3VNIA 1A80A 3NQBA 5DLCA 2CHRA 1TVNA 4PCPA 2O56A 4BF9A 2B0MA 1XIMA 5CPSA 1Q3NA 2YBUA 4H8VA 2UY5A 3WLRA 4WXZA 5T8GA 2V5JA 2QDHA 2W61A 1GZJA 2O4QA 3FYOA 2WNWA 5CPQA 2FDSA 1N2VA 4RPQA 3MZNA 2G41A 3FJNA 4E4PA 1YDOA 3R94A 1XKYA 5E0FA 4L9ZA 3E0VA 4A3RA 1EJWC 4B92A 3NQ2A 5MKGA 1LQAA 4XV0A 4QP0A 3GH5A 4J28A 2R1LA 4DWSB 2ZZ5A 4B16A 4O1CA 4IICA 3V16A 1TJRA 3W85A 5A2AA 2XN2A 4RPPA 3EKGA 4LT9A 1G67A 3EB3A 3GNXA 4HA1A 6ALDA 4V28A 4F48A 3CHVA 4W86A 4AYGA 3A3XA 3W27A 1BKHA 2J9ZA 1CGYA 5DBTA 4AD0A 2R1NA 4F3HA 1VYSX 2Z1KA 1FDZA 3IJLA 3HG5A 5DN1A 3PNUA 4OE7A 3MKVA 4U4MA 1EO5A 4TQTA 3W7PA 1LUCB 1M6JA 1TV3A 1W1A1 2JFEX 2E8ZA 3AMDA 4JTSA 3R25A 1VBGA 4GJJA 3CB3A 4HZMA 1R3SA 1UWQA 3G8RA 1ADOA 1DJHA 4AZIA 1VF8A 3BW2A 4LVFA 1JNDA 3OQ8A 2QKFA 1PXGA 2CETA 1WDPA 3L4TA 3KOWA 4CCDA 1VFTA 4ZQNA 3GC5A 3OG2A 4Y9NA 1IYXA 3R0DA 1M41A 4AVOA 3GH4A 4YU1A 5K4ZA 1TZ9A 5AYYA 4C7GA 1GHRA 2VRKA 1RP8A 3BLEA 2NZLA 1QRQA 3ATZA 4M1BA 3TP4A 1TMHA 1E71M 3TYZA 4DO7A 3VC6A 1OFQA 3AYRA 3LD5A 4IGMA 2QT3A 2OB3A 5D2YA 5I2UA 4ZCWA 3R0KA 1W3HA 1EPXA 2R1PA 1L0PA 3LHTA 4IMEA 3VGHA 2OXNA 2P88A 2C13A 5HJXA 3BZJA 1VP5A 5HDRA 3DN5A 3BCJA 2XZ7A 4M8UA 5FJTA 3ZJ7A 4X63A 2J13A 2C8NA 4KETA 4L1WA 3WF4A 1TPVA 2R8WA 3LSCA 3D47A 4HB7A 3EA2A 1XV8A 1AZ2A 4JQ1A 2PDKA 1FBAA 1UD3A 2CIPA 1J5SA 2ISSA 3ARRA 1OFOA 3R43A 2PAJA 5DMNA 1SZNA 4GI9A 4A8NA 3V1PA 2JEPA 3P80A 2ZX7A 3FA4A 3FAWA 3QC3A 2WZIA 5DANA 1SR9A 4PULA 3W7QA 2ACQA 1E6ZA 3GVQA 3MDUA 1FWWA 1YNYA 1H7XA 4LBSA 5SWUA 3WG6A 4AZ7A 1S5WA 1HL8A 3BGAA 1W37A 2PC4A 1ZAJA 5FF3A 2D69A 2C91A 3U2OA 1GYLA 2VZSA 2HCVA 2BHYA 3KLLA 4NUWA 2Z24A 3KXQA 3CUGA 1FWAC 3OYZA 4PR4A 4PE8A 1Z89A 4MDOA 4BQ5A 1AD4A 1CXEA 2X09A 3HQPA 3S0CA 1GZ1A 4ZO7A 5IXEA 3AXMA 4HNCA 2J7CA 2PGEA 3AYTA 3TYEA 4J27A 3BAIA 3DG6A 3A23A 3WLMA 3WBEA 4AIOA 3LI1A 4PTWA 3LPOA 3SUVA 2BV9A 5GJNA 4GZIA 3KWSA 5CGMA 5D09A 4K8GA 4FNSA 2DORA 1A5AA 2PLKA 2YB1A 2WWCA 3DBNA 4BI5A 3GUWA 3F5LA 5CLWA 1UHVA 2ZUTA 2VEMA 2Q71A 3P6LA 3RM8A 1HL2A 2OR2A 3MBDA 5E6YA 2OODA 4UQBA 3W7NA 4HZ7A 3U4AA 3LRKA 4Q4KA 2OSYA 4EIVA 2YL8A 1XBVA 4Q6JA 2RDUA 4M24A 2QCDB 3QGAC 1G7VA 4H8NA 2GJXB 1KRBC 4JHOA 2OWCA 3KTSA 2B7OA 1X1NA 2VMFA 1VJSA 1LL4A 5TNVA 2MANA 3LENA 3GW0A 3WEMA 2ANUA 3GXDA 4PH6A 4NAEA 3VDGA 3ARYA 1ITCA 2Y89A 3PUGA 3CH9A 2F61A 3P14A 2OZTA 3FVMA 2WAGA 2WNNA 4IHCA 1Q6LA 5H1WA 1DE6A 1LUCA 4E2BA 5DEZA 1XSJA 1TX2A 3GXNA 4FK9A 1FWCC 5F2IA 1D3GA 1GYMA 1EJSC 1DJGA 1PO9A 4KWUA 4KRZA 3FKRA 4EOUA 1E40A 1HJUA 2D2OA 1GVSA 1E9YB 2HPIA 2IMRA 1AODA 1JF5A 1IXNA 3AHZA 3WMLA 4HHLA 1SFJA 3I4EA 5EMJA 2YCEA 3G6MA 3LGGA 2D20A 4Q32A 3JS3A 3NSXA 1UWAA 5CBIA 1UZHA 4IMAA 2WLYA 4GVHA 4W84A 4E3TA 4ZOBA 4TX9A 2IQDA 1MW2A 3QKZA 1Q7ZA 4MWAB 4MB5A 4XAFA 4UTTC 3WQPA 2P76A 4FPSA 1QASA 1SJCA 4DXXA 1DXEA 3K8LA 1CCWB 1FWIC 4GBDA 2J47A 3SBFA 3ZXWA 7REQA 3PANA 3E2SA 1EGZA 3MVTA 3MI6A 1POJA 3HG2A 1TPC1 1HP4A 4O54A 4XZMX 4ROQA 2Y0FA 1ZCOA 1M04A 2PRHA 1GVYA 3ICJA 3MHFA 2Y8KA 3W88A 2C1IA 4PSRA 1B90A 1FHVA 1G1YA 1FCBA 1LJYA 1KCKA 3UBPC 2Y70A 5AC6A 5F1VA 4V33A 1AK5A 1EP1A 2EAWA 1DIOA 1KCLA 3I7RA 3PWAA 2WW5A 4PUEA 1SM9A 3BANA 3MHUA 4MTVA 1IR2A 4LAUA 4QQUA 3H26A 3OLDA 1R3TA 1ZQ5A 5KZEA 4Q8TA 3EMCA 2D73A 3ALGA 4H9YA 7PTDA 1PKYA 3SIZA 4HMCA 2NWRA 3EAUA 4KRTA 4HJFA 1BSIA 5AHEA 4PBEA 4K7VA 2O0TA 4V1YA 1M5WA 3QH2A 2RDTA 1S5TA 3VXGA 3K2GA 2EPLX 1WZLA 4Q7IA 2Z28A 4RDVA 1RVGA 3JU2A 1VFFA 3VNDA 1Q2SA 5RUBA 5AB3A 3VOHA 2IPGA 4GNKB 5I00A 3ZLFA 5F2MA 1TPEA 3R8RA 3RX4A 3TTSA 3JUGA 1WDQA 1H0GA 1KXVA 2Z1SA 3NQMA 2CWXA 2ATMA 2GJXA 2PBGA 5KINA 4KT2A 4B2DD 2NVAA 1F05A 1SO3A 3EOOA 1HF6A 3MBFA 1ZBWA 4MB4A 1KRMA 2WM1A 1E9ZB 3NZGA 5FSEC 1BF2A 2GDVA 1EXPA 1CENA 4IG2A 2FZ9A 1KM2A 2OEKA 3AI0A 3C2RA 4FNRA 4Z1AA 4QROA 2VEGA 3LM3A 2E77A 5HQLA 2ZVIA 3WQ8A 5KETA 1XLHA 4DRSA 3RCMA 2GVJA 3T0BA 2W0UA 3L65A 2C15A 3TEVA 1VEOA 2DZVA 1PIIA 2PRLA 1Z7AA 2A4AA 4ZO6A 3S5SA 4S3BA 3IJ7A 3WH8A 5CJNA 2BS9A 3RRAA 3LQLA 1W5MA 1H3GA 1OT1A 1PAMA 3NYDA 4EACA 3N04A 3CL8A 1XFBA 3HQOA 3E6EA 5A6AA 1I0BA 3ECQA 3LCFA 2EQDA 2DSWA 3T09A 1VR6A 2I56A 3KUMA 5JMUA 3PZUA 2E0PA 5IBXC 1E0VA 2I1OA 3PBVA 3W1RA 1P6WA 2PI6A 2P53A 4M29A 4ZSUA 4IOTA 1P5BA 1O1HA 1W3KA 4N9CA 4GYKA 4CU6A 3GG7A 2QYGA 1UR8A 2IUZA 4PYSA 3VE9A 2A3HA 3OJGA 4GPNA 3ITVA 5FJPA 1VFOA 5JIWA 3EA3A 2WSPA 3UWZA 3KTCA 1FTXA 3A4AA 1DIKA 1M7OA 1VJIA 1VBHA 4C5ZA 1P0NA 3V1HA 5EPDA 1HGYA 1OSEA 2CLFA 4B15A 4GO9A 2FZMA 3CUIA 1NIUA 2PDBA 3QHOA 1R47A 2WCGA 2W4XA 3VOJA 4LX4A 3QR1A 1JYXA 2TSYA 3IGXA 3PTDA 5HK4A 1HNYA 3LTSA 2A21A 2HTMA 3N6HA 1RJQA 3GDTA 1E1CA 1CXHA 3VD5A 1XLEA 2CNCA 4OGZA 3CUXA 3LCWA 5FJIA 2GVGA 4RLIA 3U7VA 1DJNA 4IFKB 3I10A 3AIWA 4GCXA 1PZ2A 4LUTB 3W1TA 4QG9A 1EZWA 4CD7A 4CD8A 2QAFA 4L7ZA 3RUBL 2WJZA 4ASTA 2GDQA 2A7RA 2WMFA 1WKEA 3EKZA 4ADTA 3EWZA 1HP5A 5AZ0A 3R89A 3WYZA 2AOSA 3CHEA 3GY1A 3KHJA 6ENLA 4A3HA 3W2NA 4E8DA 4L56A 1E6XM 4AD2A 3CJPA 4O12A 1V0KA 3ITTA 4GI4A 4DQWA 4BKNA 1P43A 1IEIA 4UTTA 3ID7A 1S2AA 4NZJA 2X2YA 3TLLA 1TUFA 3P60A 2R94A 4KGJA 5LHEA 2NLYA 1V3KA 5TD4A 2WSRA 4WF7A 5CJMA 1JJKA 3GNNA 3BQ6A 3BE7A 4ZVJA 1QPNA 3W70A 2GSJA 2V9DA 5I6SA 3SCTA 2ISWA 5M5DA 2VFEA 1V77A 7A3HA 3W1AA 5ABFB 3B06A 3E2RA 3K5XA 1TSIA 3QYQA 1VQTA 3VABA 2YSWA 1REQB 3FV9A 2PLJA 2J88A 3PN8A 2RDXA 2WMJA 4S3CA 4M6VA 5CZJA 1AL7A 4HPJA 3VGGA 3C56A 4W5ZA 5EY5A 4ES4A 4NZ5A 2X0SA 4QLLA 5HNNA 4YVXA 3MUY1 4JX4A 5G5IA 1XISA 3S4TA 3CZ8A 4QQ3A 4ADUA 5D8ZA 1KQZA 2FDMA 2D1ZA 2EKCA 2J7GA 2XGBA 1NSJA 4XD4A 4U5KA 1XHGA 3L21A 3L4WA 7ODCA 3IRSA 1F9CA 2IPWA 3VNZA 4WQ6A 4CNSA 5HINA 5FL1A 3LCXA 3G1HA 2DP3A 4CUCA 3AS3A 2EF9A 3WK3A 3L67A 3N2OA 8CGTA 1R3YA 1NFPA 1CW2A 1Q45A 4HK7A 4I3GA 3AOFA 4PEKA 1N82A 2GJRA 3GYEA 1OB0A 2WJEA 6XIAA 1JZ2A 2ZXQA 4GXWA 2C1HA 3B9EA 3KL5A 2ZFAA 4XD6A 4K1GA 5U4NA 1KFLA 1LRNA 1R30A 4EPEC 1RZMA 3BARA 2OKTA 3W6MA 1V6TA 3TYDA 5T26A 1QO5A 3BICA 2REQB 4GG9A 4NKCA 4UWMA 3I68A 1Z9AA 4IT1A 3UXLA 3KL3A 4DUXA 1E43A 1D7KA 4BWLC 1KGXA 4HA3A 4WEVX 1ZUAX 3TVAA 3NO1A 5CLTA 4AD4A 2X1UA 1B30A 2WVVA 3B0XA 1H2JA 3K30A 4TTUA 3M7SA 3GAKA 2BXVA 1JYNA 4Z2IA 3BTNA 4HOXA 1TG7A 1GWJA 3G24A 3C2VA 3MWAA 4K6AA 4GKTA 2F7FA 4GC3A 5FF4A 2OCZA 2WZMA 1VCVA 1JI1A 4JBRA 4WLCA 4DN1A 2QJHA 2OLSA 2VENA 1QI3A 5HUOA 2VVNA 4OKDA 3LHUA 3LNMA 3DG3A 5LGXA 5EBUA 2B31A 3UA3A 5G2IA 1KW1A 1XRFA 1OY0A 2XFRA 1OX6A 3RJYA 1OCQA 1H60A 4XBJA 2OU4A 2OGYA 4JL1A 4XZNX 4MZ1A 1YLVA 2Y5SA 3ONCA 2QCEA 2AL2B 3LPPA 3S2NA 1DJXA 3GXFA 3W86A 2EPKX 4OVXA 2QCNA 3H7VA 5CPTA 4E8GA 4S39A 5BNKA 1Z6KA 4MF4A 3VKJA 1EWDA 4AEEA 1JFXA 3E38A 1XIHA 2EEXA 3UXKA 4N6EA 2WANA 2X1RA 3FN9A 4GQ0A 2BP1A 2CZ5A 4J1OA 3OOQA 3L7RA 3WQ5A 1IV8A 1F4HA 4H1ZA 4J3SA 1RPKA 3FHQA 3G1SA 4JTRA 3IRDA 2XVPA 1YPFA 4UMAA 2TPSA 1WXJA 3E2QA 1Z42A 1UROA 2XN0A 3MC5A 3SCPA 1GOQA 3WNLA 1JPKA 4JN7A 4PMOA 1W1B1 2VGBA 3I4KA 4FX6M 2Z7GA 4OBSA 4TVCA 1S2TA 1CB7B 5CZSA 4LPCA 4GC4A 1W1YA 4JCLA 1I4NA 1TMLA 2BBFA 1DWHM 2D3LA 4WDWA 4WKAA 5M2FX 4K8EA 4DO5A 1WZKA 3MY9A 1XSKA 2AMGA 3RM4A 1S2UA 4ACZB 2CBIA 1F7BA 3V3WA 2ISFA 1QAPA 3UU0A 1IGWA 1KD0A 1HUVA 1JD7A 2UY2A 4LXFA 4L6DA 3SN1A 4ZXOA 1YNQA 2J7HA 4R7WA 2BODX 1TPFA 2EBNA 3I7SA 5JQ9A 1V0LA 4PMJA 4R33A 1EOMA 4XK2A 4DEFA 2VL4A 3C5QA 1W5PA 2PE4A 2DZAA 3FW6A 3AWOA 1QW8A 3S1XA 4QTGA 3OZOA 2FVKA 3PZ9A 3GTXA 4MWAE 4MJ4A 1E6QM 3KFTA 4CN1A 3LZ3A 3IJ8A 2BFGA 1E6RA 3USZA 4WD0A 1ITXA 1J5TA 4O13A 3L0KA 1LP6A 4WSJA 2GQAA 3BURA 3OHMB 3W38A 1XH2A 3EMZA 4IIDA 4REQA 3T40A 1PIFA 4E6MA 3QBUA 1UASA 1UR3M 2WPBA 1P4CA 3E0WA 1GW1A 1DE5A 2QGHA 3ARSA 1F8IA 4R7OA 1XCFA 4B9YA 3R4IA 4AC1X 2PWEA 1EEPA 1OIFA 3E1F1 4S2CA 2FPVA 5JU6A 2CLKA 2PLMA 3RO6A 5BMWA 3QLDA 3F4VA 1PB0A 3POCA 3QN3A 1OGGA 1NP2A 1D3CA 2AKMA 2IKHA 3CV2A 3N29A 1V02E 1DIDA 3S46A 4ML4A 1UD5A 4HU8A 1DJYA 5C0QA 3VCCA 3NO3A 1B9BA 2QMJA 2XVLA 1E6PA 1K70A 3IVTA 1OK6A 3EWCA 3RMJA 3IIOA 2QDGA 4XKMA 4X60A 3NDZA 1R2SA 3P2VA 4TO8A 1BF6A 1OEPA 2P50A 1ISVA 1D2KA 2YYTA 3VUPA 5L9FA 4D1IA 2Z1VA 3R11A 2FTPA 2WLZA 1C8XA 2DUAA 4JR5A 3WQFA 4B5WA 3BG3A 1G94A 3VX1A 1YDNA 3CHDA 3NYZA 4W4QA 1SZRA 3FKKA 2QW5A 4CN6A 4C6CA 4TV5A 2W67A 4KCUA 3WH6A 3AHYA 4IF2A 4WX2A 4IMDA 4RW5A 1R9XA 4UR9A 1HXJA 5DT7A 1PEZA 5GJMA 3TQ0A 3TFCA 1DXFA 1YRRA 4ZQOA 2C7FA 4IJRA 2QPSA 3PY2A 3QQWA 5CEWA 4I90A 2WOQA 2BOEX 4UMBA 5A94A 3MPGA 3APGA 5G1MA 2OYLA 1C92A 4Q8PA 4RXFA 1Y5VA 1BVWA 3LG3A 2VCBA 4CCEA 1U1HA 1E0WA 8RUCA 3Q94A 2ZZ1A 3K1GA 2FFCA 4JD4A 3ZVHB 1CECA 3ZFHA 2ZOXA 4IFKA 3DH7A 4XKYA 2R24A 4R5EA 3GFZA 3WK0A 5ABFA 3S1WA 1A5BA 2ZIDA 1VH7A 3AXKA 1B54A 3MO4A 5BXPA 2VFHA 2J7EA 5BYWA 1NWSA 5HR7A 2G4FA 2BB0A 1UBPC 4EF8A 4ZR8A 1A5LC 5ECVA 3U3HA 5C9WA 1KFWA 4JTIA 1CGTA 5T9BG 1LLOA 3CU2A 3QZAA 2D0FA 4NJKA 1IEQA 3AZRA 4XZBA 3A5VA 1GGOA 1E6SM 1Y5XA 4AG0A 5AFDA 5LNWA 5C9XA 1KCXA 3VI2A 1ZZMA 4MOZA 5A8OA 3N2XA 3FK4A 4ZB2A 3A4JA 3SZ8A 4C6NA 1L6WA 1WBHA 1TX0A 3EDDA 2REQA 2W79A 4FOUA 2DQXA 5JXQA 5I06A 2Z7KA 5BOOA 2OGJA 1QOXA 3M6YA 4BR1A 2WPGA 3TYUA 3LYEA 5GNZA 1J10A 4MGGA 3VILA 3GVWA 5AHMA 3P67A 2WVTA 4HA0A 1J9YA 1F8MA 1AA1B 1YKWA 2VEIA 4KWOA 3LS9A 5EBAA 1GTHA 1WKYA 3OHIA 3IGUA 4QE1A 3QFWA 5HWNA 3MSDA 4RK8A 3UNDA 1UKTA 3THDA 3NQCA 5AVHA 4AZ5A 4HMNA 5LA0A 1BG4A 3B0VC 3MYOA 2BGSA 1TMQA 1ME8A 3E0LA 3WDPP 1XUZA 4FF7A 3BZGA 3TSMA 2ZRUA 3DAQA 1P6CA 4DYEA 3VE7A 4N7QA 4E2VA 4BWLA 4FXFA 4C6FA 4PTNA 3CZKA 1XLGA 3WLSA 4I9TA 1IZKA 3TYBA 1A50A 4CU7A 2OZ8A 3QSTA 2HMCA 1CDGA 4NI3A 1BGGA 3UWYA 2PDQA 3M0IA 4FOKA 2ZUSA 2WC7A 4HHPA 4O19A 4J2MA 4Y9OA 4WJXA 2GWNA 2UY4A 1OADA 1FH7A 3W84A 2PTWA 2IQ0A 4ACYA 4EX4A 4OV9A 4KFPA 2BHZA 1EPVA 3FEMA 1TO3A 1E0UA 4UOQA 2XSAA 2PU0A 4H41A 4B4HA 4FR6A 1ONXA 1VC4A 3QMTA 2WKGA 2PWUA 1LWIA 4Q4RA 4JPGA 4MKNA 2QCDA 3ZQ9A 4JKMA 4LU0A 1F5ZA 2C6QA 1EJ7L 3NQ8A 1W3TA 3CV6A 3W1MA 4C65A 1H1YA 1GQLA 4QBXA 3WH7A 4KEVA 3DCPA 1JCYA 5I3JA 4IP4A 3AISA 5B7ZA 3VZXA 1BXNA 2ZA2A 4HU3A 3EX1A 3PG8A 3W7KA 4P8WA 2FB2A 1QFEA 1GW9A 1ZU8A 4LYRA 3UQNA 3FDGA 2C71A 5L6UA 5JH1A 2A7PA 1WUFA 3DX5A 1UW9A 3BLIA 3OBAA 3QGKC 2QHAA 1PCWA 1BG9A 1UPPA 2ZYFA 4G1NA 3BQ5A 3CB8A 4GFIA 3BC9A 4MNLA 3N17A 2XIBA 4FNQA 4EPDC 4IM4A 1TIMA 5CG0A 5XIAA 5EMMA 1PBGA 4JXCA 2C18A 2G3JA 6TIMA 2VHLA 2ATSA 3W07A 1K77A 1YNPA 3TKFA 1QBBA 2J8FA 3DHDA 3GTFA 1KBIA 3L5AA 3VD7A 4DJEC 1FH8A 5HNUA 3VKAA 3B4UA 3TW6A 1TWWA 2ISVA 1K4GA 1U2YA 1U1UA 1U30A 1UJQA 4GGHA 1PZ3A 3OZMA 1GJWA 7CGTA 3LCHA 4FAMA 1QI2A 3CO8A 4BFAA 1W3JA 1AFSA 3NDOA 4BF7A 1PX4A 2FJKA 4NNAA 1GVOA 5E0CA 5CBJA 5M1TA 4UFKA 2ZKMX 1MW0A 4DJDC 2OTDA 2VYOA 5CAKA 4OOZA 3R6IA 4LVDA 3O6YX 2PPGA 4L5ZA 2FHCA 4DWSC 3QMRA 1XRVA 1YADA 2J66A 2XISA 3AALA 2GL5A 4TMCA 1R38A 2JKAA 3QR3A 3MP4A 1KBBA 2YR1A 3WBYA 4ML9A 3W1PA 3VOFA 3VCNA 1V51A 3S1GA 4JTUA 4H01A 3N6JA 4I9AA 3IJQA 1EQCA 2H3BA 4D72A 4IPIA 2OWWA 3S5NA 1FKWA 2J78A 3GR8A 4U33A 1UR9A 1B4KA 3E49A 4JTQA 1UQYA 2X2GA 2VGGA 3EWDA 4A35A 3VAVA 1RUSA 1C8YA 4DX3A 4UR7A 3Q37A 3MYPA 4HCHA 3OVGA 4NASA 3PTKA 1EXBA 5DQPA 1TVPA 1ODZA 1PYFA 4DBSA 1XIFA 1FDJA 2HVNA 2PZ0A 3AFBA 2A7NA 3VTRA 5CPOA 4NX0A 1UA7A 1EOKA 3O0FA 1F61A 1TTJA 3KDNA 3A4XA 2TYSA 2VX7A 1FWDC 2W92A 2VD8A 5BOFA 3PAOA 3G3DA 3NTYA 1B3VA 2OQYA 5AHFA 2NV1A 2YB4A 4P8VA 1DBTA 4KPLA 4OIFA 1UH3A 4Z17A 3NUKA 1UP3A 2B7PA 4XVEA 3W76A 4JNZA 1P1XA 3NEVA 4Y9MA 2OJPA 5JH2A 3MA8A 1W9PA 3HPAA 5LNUA 4HMDA 3SB0A 1TREA 4NZ4A 1XDJA 3B8SA 1JPMA 3NVDA 3BLFA 2PWDA 1ZBCA 1X96A 1BWLA 1XINA 4RJEA 4M56A 4ZQCA 2AGTA 1QT1A 2DT2A 2IS7A 3LY0A 2IQTA 2ZXDA 4DLFA 3T0TA 3CLWA 2QAPA 4U2ZA 3L2LA 4AHPA 4UTLA 2NXIA 4ZBCA 3CL6A 5LYRA 4KEZA 3L4XA 4MMWA 1GNXA 1BVZA 1J0JA 3WLLA 3NOEA 1ZNNA 1I60A 3EGJA 1NF0A 5CZTA 1FUYA 2O7SA 1KLYA 5FAGA 4KESA 4Z1BA 1EZ2A 1JIBA 2JKEA 3G5EA 2OQHA 1OK4A 4O15A 3UGVA 4RR4A 2VEKA 1TA3B 4ADSA 4GX9A 2G3MA 2WSKA 5BZAA 2YA0A 4GE8A 4MNMA 2OWXA 1S1RA 3UFYA 5A6BA 3S5OA 3TMQA 1NQ6A 4P61A 3LLDA 3EWXA 5K9DA 3N34A 3DYMA 4IISA 4H7VA 4HP5A 4YWSA 4J35A 3ABZA 3FY1A 3NSMA 3WEZA 4IIHA 5PTDA 3GKAA 4C1NB 3WF0A 3UG5A 5C7VA 1L8PA 4XIAA 3I6TA 1RVKA 2KX9A 2IXVA 4KW2A 4LAKA 4I7UA 1K9FA 3H54A 2NV2A 2BASA 3G1AA 2HBVA 1DEDA 3LERA 4DAIA 2X41A 4MIMA 1K9EA 1PKMA 2B81A 4YNGA 3T07A 1XIBA 5FF0A 3RPDA 1Q6CA 3URQA 4JIPA 3OVRA 1OVDA 1Q7MA 2ABAA 1PV8A 1UOKA 5J5DA 1P7TA 4EXQA 4GIAA 3GG1A 1PPIA 4UTJA 2CKRA 2C19A 3TZFA 2XWEA 1POKA 1EX5A 3ME3A 2W6RA 1WYIA 3A13A 2WYSA 7XIMA 3I7QA 1U5JA 4GBUA 2OOFA 1YXYA 5ABHA 1HL9A 1DOSA 3NXLA 3CLMA 3LOTA 2DSZA 1M53A 3W01A 3TROA 2CC0A 5IHRA 1BXCA 3M0VA 5BCAA 3W00A 3EPNA 3KDOA 1F4AA 4HYWA 3VYLA 3BLPX 1AJZA 3B8DA 2HXTA 3UP8A 3HFTA 3OGRA 1L2QA 2WNZA 3HURA 3QW3A 2QZRA 1GTEA 3THUA 2PC8A 4EXAA 4DBDA 3KWXA 1TJ0A 1A3HA 1D8WA 1TE6A 1W17A 2W9MA 4IFRA 3TTOA 3FSUA 3EOUA 1TPB1 4W9TA 1KA9F 2X40A 4EK7A 1J8VA 1Q4WA 1K1DA 2Y4SA 4UOJA 4CQ8A 1NDYA 1H63A 3ANVA 3GWQA 2J24A 1BXBA 1YHTA 5LHFA 3WNKA 1I75A 2VCAA 4LUSA 5HA7A 2NV9A 3S3GA 1EHNA 1C29A 2W63A 3IVSA 2QJNA 3AAMA 4LEQA 4QNEA 5HPCA 4MWAC 3VGFA 1JL8A 2FMOA 4AHOA 4R9XA 1OZQA 2XFFA 5EL1A 3G6LA 2BVDA 5E1QA 3P8JA 3RLHA 4FOJA 2Y88A 1OZMA 4UBPC 3GBDA 1FRBA 1TKKA 2J9YA 1W1PA 1ONWA 3PB0A 3NPXA 2V0TA 2FH6A 3DZ1A 2ASHA 4LEFA 4HN8A 4GYJA 5C8BB 5DFAA 1N8IA 1QPQA 4L9XA 4EAMA 4ZOAA 3F4NA 3WL1A 1MRQA 3IS4A 5HUPA 4NZ1A 1GVQA 1XG3A 3ABQA 4PRWA 3WFAA 4PEEA 3TYCA 3W83A 3H53A 3WNPA 1XYAA 5C2GA 1GUVA 2E1DA 4H9XA 2DGAA 3Q58A 4KGLA 2GJPA 3UPMA 3F2CA 3EX3A 1UP2A 2PDFA 1G4SA 1TA3A 3PPCA 1UCWA 1NDVA 1LT8A 3HG3A 2BVWA 3DC0A 1FHDA 3E5BA 1KXHA 3BOFA 3EXTA 2G0WA 3FYPA 4LY8A 2PGWA 2P3ZA 3CASA 1M7XA 4ALDA 3VKKA 5HNRA 1GVFA 1D9EA 4JTGA 4B5TA 4GYFA 2WHJA 4Q7BA 2A5HA 3L4ZA 4CNOA 4D6GA 1CZ1A 4U3AA 2A3CA 1ME7A 5DELA 4S3KA 4K68A 1FWEC 1OFDA 2QLYA 2XZ9A 3WBAA 3S2JA 3IIXA 4QG8A 4PUDA 3CZGA 2Y85A 4LV9A 1FWHC 1Q5MA 2HWGA 3V0SA 1RJPA 3P84A 1MQRA 5K7JA 3WD2A 2JK2A 4WUIA 4HK6A 2E5DA 4PB3A 4JYEA 1KRCC 2QUUA 4PCFA 2OSWA 1W3IA 2X30A 1M1BA 9RUBA 1WA3A 1P0BA 4FZIA 4EANA 4N4QA 3PZNA 3O63A 1UWSA 3KE0A 3G0XA 1HIZA 1JCMP 1IXOA 4FHAA 4LALA 1PX8A 4DO4A 3L4UA 4S3GA 3E74A 3TA9A 4NQ1A 3LLFA 3W02A 1Z44A 1GCYA 3ARXA 4C1LA 3YPIA 3I3BA 1LT7A 1EF3A 2NUXA 3B8UA 2RKXA 3MVIA 1WV2A 1XLLA 1GOKA 3KBWA 3BH4A 3LM7A 1X6NA 1W1VA 2P10A 5IRPA 1MFVA 2TODA 4JFSA 3MCMA 4Y7EA 3U48A 1K9DA 5AYXA 3ZR4A 2NUYA 4V15A 3WFLA 1XC4A 5DT5A 3GC2A 2FTYA 4QLKA 1EA0A 2GQ8A 4XAYA 1A5SA 2RGMA 4INFA 4O0KA 4PMQA 1OC5A 1A5KC 1YQ2A 5LNRA 3EDEA 2ISDA 1LOLA 3A6OA 1TFVA 1TVLA 2QCMA 5GNYA 3VKDA 4PMXA 5KEZA 3N13A 1XBXA 5H8PA 4B4FA 3WY1A 1MEIA 3F2BA 5C54A 1CX9A 4O16A 4CEUC 3DFOA 3PULA 4AYSA 3WQDA 3M6DA 1MUCA 1BEUA 1Q65A 4JIQA 3VMPA 3F4WA 1TB3A 4LUSB 1FWJC 1KM5A 3FYYA 3MSRA 5KMYA 3CMFA 1H61A 5D2TA 4IZGA 1DP0A 3RK8A 1OCBA 1P0DA 1KR1A 4Y8EA 4ORIA 3T08A 3G1RA 1HG3A 4RE4A 4C6BA 3N9KA 2AGKA 5ABGA 3WFZA 1DL3A 4NAEB 3QOKA 5BRQA 3P81A 3HV8A 1MWOA 3W1QA 2D2GA 1FWSA 4MDPA 4XAGA 2JEQA 1O5KA 3V0TA 4K36A 5XIMA 1SJAA 4DF0A 3EWBX 4O57A 5CPMA 5K9CA 3BAWA 1ISYA 3U5YA 3IJDA 3KOFA 2W62A 1TTQA 3AXHA 5CZ0A 3UY8A 3NWRA 3CUFA 4BEQA 6REQB 2QQ6A 1O7AA 3QGVA 5AN7A 4QDPA 4MM1A 1LDCA 4C6OA 4FIQA 4UQAA 1DKWA 3LCGA 3BWWA 1H49A 2V67A 3GSMA 1ECEA 1UA3A 3TN6A 2O7QA 1RAKA 2CLHA 1XLCA 4JTKA 4R7JA 2J7DA 3OTRA 1YTKA 1Y65A 3E96A 3F5KA 4QJ3B 4DBUA 3BXWA 2ONEA 2CLEA 4UQ9A 3HG4A 1W2VA 4M3PA 4GHRA 4DBEA 4S1FA 1TQJA 4AF0A 1JFHA 2XYLA 2VC5A 3P7YA 2VRJA 4OFCA 2A0NA 2Q8LA 1OBAA 3LMZA 3N2CA 3QFEA 4H3DA 1A5UA 2CEQA 2O9PA 3A12A 4GIYA 3HN3A 4H2CA 5DXXA 1YE4A 3P62A 2GVEA 4PTDA 3ES7A 3GHSA 2NX3A 4QDMA 2ZICA 2VR5A 5JBDA 4RV8A 4ZB5A 4H6KA 1WX0A 2V63A 2PWGA 3UZZA 4QRNA 4GINA 4B90A 4ENLA 2WKJA 3I3DA 4WGHA 5AY7A 4O4WA 4NF7A 4NSBA 3W1NA 4A2RA 4IP5A 1H1ZA 3NFUA 4ICCX 5IHSA 1EX1A 1VCGA 1B4EA 1YX1A 1QVBA 4LAZA 1TUXA 2O9RA 2GK1B 4OBRA 3TZNA 2FGZA 3G8EA 1W9UA 2VDGA 1C7SA 1XFCA 4S3JA 1KNWA 4Q4SA 1EIBA 1R9ZA 3DKJA 4XAPA 5CCZA 3PZIA 3EWWA 5LNVA 3AJXA 1THFD 3QTGA 3QJAA 3PR2A 1J01A 2DU2A 4UXDA 3S83A 4N6FA 4YTSA 1Q6DA 4X0VA 5A6TC 1V8EA 4MUPA 4LVAA 1W9VA 1AQMA 4E38A 2HRWA 2J8TA 5I3IA 5K4XA 3LGDA 3W1XA 3QEZA 1O66A 2Y63A 3ABXA 1TPH1 1WDRA 3KZSA 4NXKA 1H51A 2Z6IA 2EJAA 3DBPA 3TJIA 4JAWA 4PMZA 2VZUA 3BAKA 2HDJA 3AS2A 3WK1A 2OG9A 3EA1A 3BAYA 4OUIA 1WPCA 1Z8AA 3J7HA 3IJ9A 1B0IA 3GHRA 4JFWA 2BLEA 3RHGA 4IGHA 2GFTA 4NJGA 3UCQA 1EP3A 3VDCA 3TJ4A 1XLAA 4WY0A 2X0YA 3QQ1A 4HNNA 2PWVA 4FSAA 2GVLA 3L23A 3ZJ8A 2VOTA 2OZ3A 4FLRA 1OG6A 4AZGA 3L68A 2NXHA 4I8DA 2FB3A 5BROA 4W93A 4IL2A 1B3XA 1EEXA 4UQEA 2BOFX 1ALDA 1SVDA 4KWVA 3RR1A 4JTHA 1WQ5A 4KIRA 4CEXC 1IWPA 1GQIA 5JUVA 1K8YA 3PTMA 4ACZA 5C5YA 1X8FA 2CHOA 3QF0A 4DF1A 1GJUA 3PC0A 3QYSA 3TWBA 4PUNA 1IIGA 3GDRA 3LK6A 3DHPA 3S5YA 4FS9A 4BZYA 3PBYA 3VDAA 3W1LA 1RA5A 2WZTA 1NAL1 1CXFA 2XWDA 3GNDA 1K8ZA 3VKCA 3AO0A 4M7TA 1OYCA 4W7UA 7REQB 3AZTA 1UB3A 1TJPA 3S42A 1EJRC 1O6IA 4QITA 5GNXA 1GEQA 3DIPA 3IJIA 3SRFA 1REQA 3CUHA 3OODA 4N02A 2ADAA 3MB9A 3HGSA 4QAWA 3H4GA 4AQLA 4CNUA 4MAVA 3ZO9A 1M68A 1ZGDA 2BY0A 3QV8A 2JE8A 5E6ZA 8TIMA 3W53A 4H4IA 4C90A 3KHDA 1EC8A 1T41A 5DRIA 3ONBA 2WKLA 5D8WA 1Q2RA 4Q8OA 2IKJA 1US3A 2EPNA 1QXLA 4S2BA 2FIQA 2YGYA 1MDLA 4UTWC 4D6HA 1P48A 4X0NA 3UPBA 4DJDD 4NZ3A 2QDDA 3ARUA 3AZSA 1BQCA 3O6DA 1N8FA 2FZDA 3L5MA 3W6LA 4BY3A 4H2HA 1A3WA 4XB3A 3QTPA 1M7JA 3W22A 3VM5A 4A3QA 4Q22A 2E09A 4ATDA 3QXBA 4NXSA 2ZE0A 1TCDA 2WSQA 3AYSA 4W8LA 1TCMA 3IIVA 2F84A 1HX0A 4FX8A 1E0XA 1E72M 2QVHA 4KF1A 1VPXA 1RD5A 3IV8A 2YBVA 1O5QA 1LBMA 4J3WA 2PDHA 4XD5A 3AICA 1GOOA 5EMYA 3M07A 1WCGA 5I3DA 4LBUA 1XW8A 3HGOA 1GK8A 3E12A 4G7FA 4XUGA 3R58A 1B5TA 2FQIA 3EB4A 3UXAA 2PF0A 3CZLA 1JG9A 2EGZA 3KP0A 3EX6A 2GSHA 3M0LA 1KKOA 5IDZA 4GUJA 4DM2A 4CVUA 3NPWA 2QR6A 1BPLB 4BQ4A 3GTHA 2QEZA 1OIMA 2FGLA 3R79A 4KRUA 2ZUVA 3WD3A 2O55A 5BWAA 2DIKA 3GDBA 1NU5A 4WVXA 3NOYA 1RK6A 2I5QA 4UTFA 3TSDA 4AWUA 1RCQA 4R34A 3VM7A 4HZ8A 3WH9A 2QMKA 4QS5A 3H12A 1J2WA 1JI2A 2E6DA 3EKLA 3S1UA 1TPWA 3GO2A 4GQBA 1WAWA 2NX1A 2B7QA 1PS9A 1A47A 3QV6A 5A6MA 1D3HA 1FP8A 1XH0A 4UR8A 3REQA 1XLKA 2DEPA 4L65A 1XLBA 2ON3A 2OOGA 4MFEA 4AX7A 5I09A 2XFWA 1PTAA 1RBOB 4F79A 5I79A 3V5OA 1UWTA 1RH9A 1VFSA 4HU4A 3TQKA 3PJUA 4MJZA 3WQOA 2WCAA 5A6KA 2ZWZA 3PZMA 3GX9A 3N3TA 3F4DA 5A1AA 5H8MA 3LTYA 2QCFA 4NP7A 4GD0A 1BWVA 3N15A 3U2EA 4GMEA 4HGXA 1IZCA 4WDUA 3HBLA 3LZ5A 1PZ1A 4Q7NA 3TQVA 1MNSA 4JYDA 1W5OA 3B05A 5F1UA 3VC5A 3CH0A 2Z2UA 4HIBA 1J11A 4ECLA 1LG1A 1R2RA 1GOXA 2KAUC 3JW7A 1UJPA 1W2PA 3GBEA 2G3FA 3P5ZA 1TV4A 2P8CA 3TNBA 2J9XA 4EWND 5I3FA 1ZBVA 2DVXA 1V3JA 5E93A 1I2NA 2WZHA 1DWGM 1ZJHA 4GISA 1OINA 4OUEA 4F0KA 2FMNA 3TR2A 1JEZA 3DC8A 1VENA 3DFSA 1F74A 4O4VA 2GPTA 2OX4A 4O1AA 1TPUA 2XSBA 1K03A 3LU2A 3PPHA 1UKPA 1LOSA 1NTHA 1XLJA 2AAMA 3N3MA 4HSOA 4PB5A 3CPRA 1R0MA 3D46A 4XZHA 3ZT6A 4I5RA 2ZUNA 3R12A 1EUNA 3FJ6A 3RYSA 5CC3A 1E9IA 3EDJA 3PZTA 3L5LA 5B80A 4LVGA 4J3UA 4FLOA 5D04C 1UC4A 3BAJA 3SO7A 4NNCA 1Q8AA 3QR0A 3WLNA 4LV4A 4AISA 5AECA 2H8ZA 2XIIA 1ZTVA 5J5RA 4DF2A 5BU9A 1TV2A 4K3ZA 5A95A 1NJJA 4D71A 4W8BA 1XLIA 3DGRA 1Q4NX 1A5NC 1CGWA 4IQEA 3H22A 4YPJA 2PFHA 4UTIA 4C6JA 4DLMA 3UG8A 1GKQA 3BJTA 5CPNA 1EP2A 4JTEA 2DT0A 2CLPA 2DW7A 1KQYA 5HXMA 3CZJA 4MADA 4RX0A 1OFEA 4PUKA 3GD6A 1MZRA 2Z29A 3LCIA 2UZ9A 4OWGA 4RKAA 1OJXA 1PZ0A 3R10A 1JCLA 4UTHA 3MI3A 3NVTA 5BXTA 4F9JA 3NQ7A 4HYRA 1TV8A 2VNCA 3IVUA 4IGSA 1E1CB 2PCEA 2ZCGA 2GUUA 3H2AA 1A4MA 4RZ6A 4DWDA 3TDFA 3IUIA 3WNNA 2YYUA 1CIUA 1OM0A 1X1ZA 3AMKA 1EUAA 4WSKA 5TQLA 4YWIA 3T6CA 5EKYA 3C2OA 4GQRA 5CGQA 3W87A 2E7FA 5E9XA 3GC4A 5CBBA 1PTDA 3MTWA 4Q8QA 4N9EA 3TN4A 2VKZG 4OOUA 2PMQA 4O17A 1VEMA 1WE5A 4C6KA 4MKVA 4UCGA 1J0ZA 1MYRA 4K39A 5HBFA 5FI8A 1L6FA 1CXLA 3FNDA 2E67A 1Q6FA 1LOQA 1WXZA 1QI4A 4OU1A 3WSUA 2IPFA 3W7RA 1BQGA 1VPQA 3RN6A 2X8RA 1CBGA 1JUKA 4ZTYA 1F3TA 2JALA 1PTGA 1KRAC 1MXSA 3V35A 1SMAA 3LLXA 4LUYA 3TOYA 2GGIA 4HPGA 4C6IA 3PK7A 4GACA 4RE3A 6XIMA 9XIMA 4K1WA 2YCJA 3HA1A 1BSLA 3B8VA 5BWFA 4KBXA 4N42A 3MUAA 3M0YA 2GQ9A 2B7NA 3IK2A 3WDJA 1WDSA 4S3FA 1IQ8A 1FA2A 4O1EA 2FYMA 2QUNA 4LS2A 4I8YA 3APTA 4JOMA 4MB1A 4X2PA 4IJCA 4RZ5A 1CXIA 4DUOA 2BZNA 3VZZA 3WQGA 4CCZA 4HA4A 2I5GA 4GYPC 1HJSA 1KBKA 1BRLA 1JCJA 1GG0A 3AHXA 1DJWA 1KM3A 3SCQA 2NLIA 1NELA 3DENA 4I5UA 2V2CA 4XWUA 1L8NA 1GOMA 1E6NA 3CWNA 5EMKA 5IDIA 4F0RA 3BLKA 2DW6A 2PDMA 4A6GA 2HPMA 3VD3A 1XIIA 2ZDRA 5CPLA 2IPJA 1RK5A 5XINA 2NQ5A 1Y8BA 1OX4B 4GZJA 4GGBA 2F2KA 5CGTA 2ZX8A 4JCMA 3TCEA 1KLZA 1SPQA 4GUGA 4RUBA 4LBRA 2DSVA 3SDOA 4WY0B 3QKEA 5DMYA 3D0CA 2YDRA 3M0ZA 2B4GA 3UWWA 2F6UA 3ZSSA 4HKPA 4REQB 1NH6A 3E5PA 1MUMA 4D6DA 1LTDA 3L66A 1O4UA 1JZ6A 2YXOA 3PZGA 3ELFA 4TR9A 4MY1A 1QPOA 3CWOX 3ABOA 3Q65A 3RITA 4CD5A 3V5FA 1ZPTA 4PCNA 3WUGA 2P0OA 4LANA 1T0OA 1W54A 4YTQA 3CIVA 3GK0A 3HMJG 1EL3A 3RGTA 1VGAA 2XIJA 4GOAA 2UWFA 1XC6A 3CT2A 2DH3A 4IQJA 2I9EA 3TFXA 2VC9A 1JVNA 4EF9A 3TLQA 3SAZA 4R27A 1GJPA 5FF2A 4FLQA 3GZ3A 1ISWA 3EYPA 3PBGA 3KOZA 4DI8A 3WUEA 2IW0A 1QO2A 3NPUA 1A4LA 4UTKA 1Q63A 1V0NA 3KBSA 3UF9A 3K4AA 1XDMA 1JZ3A 4WDXA 5A6SA 1ITUA 4CNNA 1WOAA 2EXOA 1A5CA 2OVLA 4ORMA 3W4RA 1NWRA 3D3FA 3WQ4A 3LHZA 1H7RA 2FZBA 4ZO8A 4M19A 9XIAA 4TUFA 2PDXA 4P7OA 5FJOA 3WO8A 4X61A 3PB2A 4BI7A 3MQTA 4WCJA 2WBGA 1UZ1A 2XINA 3CGTA 3PF3A 2FTWA 4H00A 1KM6A 1L6SA 3PTQA 3MUIA 3M5ZA 3MMWA 4MLRA 2CYGA 3GS6A 3FIGA 3LA4A 3M0KA 3B8IA 2WMIA 2FVLA 3A9IA 4LC8A 5FEXA 4QNWA 2XIOA 4MSSA 1NQKA 3FOKA 3ZVHA 3W28A 4G6CA 2L5HA 5CXPA 2PBOA 3SJNA 3C0SA 3FVDA 2QNEA 2GGEA 4WIWA 4YYFA 3FX4A 1PHWA 2YBTA 2BVYA 4H9VA 4HNLA 3STEA 1FCQA 2XFYA 3B9NA 3SURA 2VD9A 5KTLA 3UGRA 2BWGA 1D8CA 1KM4A 2EJ1A 3LTPA 2HEJA 2BY3A 2ACSA 5GJPA 2YW4A 4QEEA 3RPTA 1B3WA 4MNKA 1E4LA 5MF5A 1FXPA 5C9RA 4M81A 1KFBA 3WF3A 3ZJ6A 2C14A 3B97A 4YS1A 1X7FA 5FD0A 1OX4A 4HCLA 4YYCA 3NNTA 2R91A 3LUTA 1EHAA 3QQ0A 3S2CA 4KS0A 3RAOA 1HJXA 3OO2A 3GG8A 2JGYA 4L80A 4ZO9A 3UXIA 3A21A 5H91A 2A6NA 3RFAA 1MW1A 5HATA 4J3VA 4H6QA 3VNKA 4US5A 4Q8NA 1GONA 2G96A 2V3DA 2YOCA 1ZP4A 3CAKA 1JQVA 3L12A 3VDHA 1WDDA 1FXQA 3KOXA 2VWTA 3BSMA 3LHVA 4XO7A 1T6MA 3S6DA 1LWHA 1PYMA 3NXFA 1G9HA 1DJQA 3OLEA 4LGXA 4KERA 1X6LA 1XIGA 2Y24A 4UZUA 3KP1A 4PUUA 3ANUA 4D6IA 1TIWA 2MUCA 3WDHA 4XKYB 1ZS2A 2WNQA 2HVOA 1OF6A 1BGAA 3SW6A 1KR0A 1LM1A 1IXQA 2HNEA 4D2JA 1EYEA 2J74A 3LN3A 1TE1A 1Q66A 4IIBA 2CU0A 4DWSA 3C2FA 4IPLA 1W3LA 1VYPX 4DJFA 1AQHA 5FF7A 3ZR6A 2GUBA 1FHUA 3NL3A 3THAA 4GNJA 2UBPC 2C3ZA 4AY8A 2O9TA 3CUJA 5M03A 1UG6A 1T96A 3E9AA 5EA9A 3OGVA 3H21A 3KS5A 2VCCA 1C8VA 3W29A 1FHLA 3SI9A 4YN5A 5F2GA 3GVRA 1PJ9A 4LJ3A 3SCNA 1XD1A 2GUYA 4U2YA 5IFTA 5HJYA 2PU1A 1HQTA 3GNOA 4KWWA 4J4KA 3U5UA 3FSTA 4F9DA 4WKHA 4XQ6A 1Z32X 4P8XA 1R3VA 3M43A 2Z25A 4PRTA 2ALRA 1EFZA 4GY1A 3SCVA 4P7RA 1SR0A 3UXDA 3BCDA 4PTMA 5EMLA 5TBOA 3QSRA 1AH3A 3NM3A 3F1QA 3I6RA 4IUOA 1XRSA 2BXZA 5C70A 4F0SA 1JPDX 4UQCA 1AL8A 1EA9C 1ZRQA 1X7IA 1I8JA 3TMLA 1KV8A 1R46A 5DCDA 1ZLPA 4WKFA 2VR2A 3NQ6A 3TA6A 2BMBA 3A3HA 1XIEA 1NWTA 2Q8ZA 4GRSA 1P0EA 3OZPA 4MWAA 1G6CA 3UY7A 4K7YA 1HJWA 2O92A 4D6EA 3BSGA 1V79A 5FCZA 3FEQA 3UD6A 4AZ6A 1VLWA 3R1ZA 4A21A 4UNIA 1YTEA 4BA0A 4O1BA 4MY8A 2E6FA 1OD0A 1JNEA 4LYQA 3PJXA 1XQLA 3QHMA 1O95A 1E4NA 3UJRA 2J77A 1GVEA 2WJFA 4KEUA 5ABTA 4LF2A 3EWYA 2DSUA 3LBCA 1NM9A 4QISA 3U2CA 5JVLA 1KFJA 3L2MA 4QHRA 1ZBKA 1YMYA 2PF8A 4G7EA 3R8HA 1NWUA 1EYWA 3W75A 3AIRA 4GIEA 3HV9A 2HK0A 4LUIA 2P5NA 2X16A 3P3BA 4PFHA 4TV6A 4E4FA 2W27A 3ITXA 1GT8A 3WDIA 3GNRA 4GY7A 2CLOA 4HN4A 3O6AA 3WLOA 3GLCA 3RIKA 4AMAA 1K6AA 3DFPA 4GO8A 2QCCA 5BXSA 4GI6A 1OYBA 3HJZA 2I17A 4P8UA 4IL0A 3ZVIA 4U31A 2G50A 2I5IA 3RILA 2PEVA 2JQXA 1ECQA 4Z0JA 3L4VA 2WMIB 1QOQA 2AMXA 1BYCA 4EPKA 3P93A 5KZMA 1EBGA 4Z1DA 1XL9A 3HGRA 3H4XA 5HAOA 2ZRYA 1W5NA 3XINA 4GUIA 4BK9A 2UV8G 4PL2A 1A5MC 3HPXA 2D24A 1R8LA 3MCNA 5HNTA 2ZUMA 3COTA 3TW9A 1S38A 1XX1A 1A5OC 4G8TA 3GZAA 1PKLA 4Z1YA 3ARQA 4MHBA 1VYRA 4ATWA 1G01A 2ZBTA 4H9ZA 3TX9A 4K37A 4RCXA 1CWYA 1TWIA 2EG8A 2VQUA 1NDWA 1S2WA 5JBFA 1U33A 3PSVA 3VKBA 2CZEA 4F0MA 4JY8A 2GK1A 4M0XA 1O5XA 4B2DA 1JCNA 2PUZA 2NUWA 2PODA 4NYUA 2YDQA 4MUZA 4X2RA 4KQNA 3BG9A 1NP0A 2ZADA 4PMUA 3O1NA 2P1FA 3T9PA 1U22A 3PFMA 3DI0A 1BLIA 4X9SA 2WMHA 2JKPA 1FWRA 2GGHA 1B57A 4FX7A 4WRHA 2WO5A 4JTJA 2INFA 5JIPA 1PDZA 3IPWA 4L61A 3NZPA 4P5UA 1W1ZA 3HOJA 1KV5A 3TTEA 1V3IA 4QEHA 5ABEA 5C7HA 4LS0A 4LB3A 3GDLA 4P7QA 2POZA 2EPMX 3RLGA 4NI8A 4GY0A 5C71A 4W87A 5FJJA 1FX6A 4AEOA 1BYDA 1TWZA 2PTZA 3FJLA 4Z2GA 3WQCA 3CMJA 1IE7C 4KEMA 1HFBA 1UR4A 2DFAA 3UERA 4HT3A 5CG7A 4AU0A 3MS8A 2XVGA 4KMQA 4WJEA 3RJXA 3BOLA 3ZIZA 4GXMA 2QXWA 3TV8A 2FHFA 4JHMA 1PUDA 1HVQA 1S5NA 3NQFA 2V2DA 4AY1A 4DYJA 1XLMA 1VIZA 3OYXA 3WLJA 4PTXA 2DZXA 2ABBA 3SQMA 2OO6A 3ZS4A 1OCJA 3INPA 5CJ5A 1RR2A 4UC5A 1MFUA 6REQA 1US0A 2VWSA 3MJYA 5BU6A 2BY2A 4ONVA 4PMNA 1RQHA 4H9MA 4ICMA 3WX7A 2CLMA 4B9ZA 1QCWA 3IGHX 1XH1A 1JD9A 4HNTA 1UUQA 2ZZ6A 4MWAD 3SIMA 1XYFA 2Q6ZA 3K1DA 1YBQA 3W25A 5AC5A 3T2QA 3GB6A 2QCGA 3O05A 1WBJA 4GQGA 4PMVA 2CLIA 1XIJA 1O5RA 1O60A 2YZ5A 4CQAA 1QATA 4AY7A 1LQ0A 4QS6A 3URBA 1K9TA 4MG4A 4WHBA 4LW7A 3NJ3A 3GU1A 3SQSA 3DUGA 4HD5A 4M51A 1UWRA 2CERA 2XM2A 3W2KA 3FS2A 3AMLA 2CPUA 2E6AA 3VNJA 5A8NA 3DHFA 1Q6RA 5FAJA 3RR4A 1EB3A 1XF0A 4HK5A 3N14A 5D2VA 4DUWA 1Z69A 3GTNA 1LF1A 3UW6A 2V3GA 2NVDA 2ZRVA 2R82A 5DF0A 3RX3A 1BFNA 1H7OA 3QOMA 4FXSA 3G2GA 5LXEA 1F3XA 1WKDA 4DXVA 1J79A 4S3AA 2VX4A 3VIHA 3QPZA 2ZUWA 3HPSA 3GU9A 3ENLA 3SADA 4Q4QA 4Q4OA 5KZDA 4GZ7A 2BVTA 4KIEA 3GNPA 2DZBA 3H23A 4Z2HA 1XGEA 4RE0A 2IXUA 3W6YA 3PWIA 4GNVA 3ZT7A 4ERAA 1T8QA 4JYFA 3GRIA 3L9CA 1B1YA 3SCRA 1W31A 4DIAA 1QW7A 3IAPA 3QVQA 1ME9A 3T81A 2OZ0A 2FLIA 3P74A 3BMVA 1JCXA 4E2OA 3WLQA 5D9OA 4URIA 5LXXA 2ZXAA 2E8YA 3TTQA 4AWEA 4CQCA 2INZA 1SSGA 2PDIA 4FALA 5A8MA 1Y0EA 1HN1A 1ZJIA 1KM1A 4WZHA 2P3EA 4UIOA 2GQ3A 3T05A 1UD4A 2NT1A 1KGWA 4ROPA 3VGBA 5LKYA 5I3GA 5REQB 4C6PA 1Q6OA 1ZL1A 3DOPA 1G69A 4YCPA 4B5UA 5MKGB 2CITA 4PUMA 5D2XA 3LXAA 4LH8A 4F0HA 1R3WA 4IIFA 3L2IA 1KM0A 1HTIA 4AC7C 3STFA 1W9BM 1RBLA 4C7DA 1LWJA 1ZFJA 2PDJA 5GPRA 3UJSA 1C90A 3HQNA 4AIBA 4Z1CA 4XBSA 5AYBA 1E15A 1FFQA 3BMXA 2X0HA 1V4YA 3OLIA 2D0HA 3IK4A 2RHGA 4LOCA 2C79A 1XYBA 2DJLA 3GG0A 4I7VA 5E70A 5H2ZA 1XYLA 2EHHA 3EOSA 4LCQA 3B40A 1WXYA 4AXNA 1EDTA 2IKGA 2HJPA 3T2OA 2UY3A 4W88A 1M3UA 1A0CA 2GVYA 3C2YA 4CD4A 3LRMA 1H7NA 1A53A 3VIJA 2C0HA 4JNYA 3T55A 1WNOA 5AVNA 1G4EA 1HJQA 1VFHA 1JAEA 2PDYA 4HHHA 3GXPA 4BF5A 3LX9A 3NG3A 5EMUA 3W7MA 4JIEA 3T2PA 4G9PA 1JGMA 3NQDA 3MKCA 1DVJA 3TJLA 2G3NA 3HB9A 4HNOA 3V36A 3W73A 4PCTA 2FKPA 3T4CA 2W66A 1E4IA 1UD2A 4QE5A 3A3WA 2GOUA 3U8GA 2VELA 2D2HA 3VVGA 4ZA0A 1I2QA 2GGGA 3JR2A 3MKKA 3QM3A 1TRDA 4NHVA 3N6QA 3GU2A 4XSLA 4FA3A 3GIQA 1OGBA 4JIHA 4JS3A 2Z2AA 4TOQA 3G1FA 3DFHA 1V5XA 2ZX6A 3MT1A 4CNPA 2PDWA 3EX2A 1JCTA 1XXXA 1XGZA 4XZIA 5G1YA 1EF2A 1VKFA 4GZEA 3BLOA 3A4WA 3TOPA 5G4WA 5CH9A 1O68A 2VI0A 1DORA 2YA1A 4UZSA 1M01A 3ALFA 2Q01A 3AU2A 7ENLA 4YLWA 1SUXA 4QSHA 1H0IA 4I9MA 3H55A 2CFFA 2ZRWA 4IFOA 4ZTXA 1HZYA 4D8LA 5D03A 1J18A 1RHCA 5HOSA 1BWKA 3LSBA 3FJ4A 3IIPA 4JEQA 4RE2A 2WZEA 4C7FA 2F8QA 3AWNA 3GVGA 4LWWA 4AWSA 3LPFA 2YCIX 4AXKA 2E9BA 1MRAA 3ZSTA 1IWBA 4PZVA 3W24A 4O18A 2XJ7A 3H2NA 3SY8A 4CVWA 2Q02A 4KCTA 3TW7A 2CW6A 1YW1A 4PMYA 1JZ7A 3G0SA 3W26A 1UMYA 1DQWA 1IT7A 1OABA 1XPGA 1F6PA 1AW5A 2YFOA 1BTMA 1C9DA 1NF7A 5AHLA 4AIEA 5J04A 3GYCA 1KFCA 5DRCA 1HKMA 2YDAA 3TJXA 5G4EA 1FQ0A 3UETA 1E3ZA 4IQDA 4U5IA 3WF2A 5LA2A 2I7GA 3V18A 1T7LA 1H5VA 1OFRA 2PB1A 3VOGA 3VOIA 1X6UA 1YPIA 1EGVA 3ZYZA 2V6AA 3WL0A 1F76A 4H83A 1RJRA 3EPOA 4C5YA 4IJBA 5I03A 1HKKA 1DQUA 2WVSA 3PZVA 5BOEA 4XZ9A 4EE9A 1KCZA 1XJBA 3G1DA 1V03A 3CPGA 1AW2A 4GA8A 1UP0A 3RU8X 1EJXC 3KEHA 3AIBA 1EJUC 1DHPA 1UZ4A 2CXEA 4HOWA 2VFDA 1QNRA 2Y2WA 1OCNA 3SN4A 5A8GA 3BPWA 2BNJA 4YMZA 2I16A 3UZYA 1QWKA 4QDWA 5I3KA 3WJXA 3PS7A 3BG5A 1YE6A 3WIJA 3POHA 1F07A 4HZ6A 1QNSA 4MPQA 3DESA 3OBKA 2XG9A 4PC8A 4DZAA 2QPXA 5T91A 4M6QA 4CGTA 3I3EA 5D37A 3VIKA 3OA3A 2PSNA 4I6VA 2BSLA 2PLCA 4HSHA 1ITQA 1ZB5A 3M1ZA 1OC7A 4UB9A 3SR7A 4S3DA 3KAOA 2DIEA 2ZX5A 4ZB0A 4JTCA 1P0KA 2G5WA 4JIIX 3SUUA 4GVGA 2VGFA 3CTLA 2XVKA 2NQHA 2YLLA 1U5VA 3PUDA 4G1KA 4O28A 1LYXA 1VPYA 3NDYA 1EQPA 1LZOA 4L4PA 5TAOA 4A8LA 1MXGA 1UD6A 1QI5A 5FJRA 1WDWA 4KCWA 4L64A 1R3QA 3N4FA 3DDMA 2VZVA 3NL5A 2D22A 1FWTA 3R2GA 1AMYA 4JTFA 5K3VA 3M5YA 3ERPA 4GI8A 2FGBA 3UR8A 1RP9A 4LNYA 4LS1A 3KCLA 4NRSA 1E9LA 4O8RA 1U1JA 4UFIA 2GOKA 1CGUA 3SSJA 1YBQB 3NR0A 1K7EA 4B5NA 4PBGA 1JDCA 4AZCA 2HISA 4LSBA 1ZAIA 1I2RA 4Q8MA 4MZ8A 5LZLA 2JF6A 1U5HA 4KH2A 2Y62A 2WBKA 4DELA 2RH9A 2ZE3A 3WENA 3W7CA 2RGLA 1JRCA 1K8XA 4US5D 1TYGA 4UFLA 5AC7A 4QJ4B 1ELSA 3KRBA 5KSWA 1KTCA 2OYKA 3GAYA 4XO6A 1XR2A 4M80A 2VP8A 2YCLA 5F7UA 3CQIA 1QDSA 4TMBA 4NY2A 3WJSA 5DMMA 4AAJA 1IEVA 5E09A 2DDXA 1JRBA 4NU7A 3C0QA 3JVAA 1GEHA 1VRDA 1GQJA 3B0PA 3F03K 1LBFA 4FF5A 3M0MA 4W5UA 2WQDA 2NQZA 3FCPA 4XISA 2G3IA 1F3EA 5HWJA 1KFEA 1JAKA 1OC6A 3ZWSA 3PBMA 1DWIM 3TNOA 3UWQA 5EB8A 4DWSD 3LEPA 5C9ZA 2RDWA 4ERIA 5CZKA 4IX2A 3TC3A 4DJFD 3Q4DA 2YFNA 3GIYA 3QW4B 1S2VA 2OEJA 1SSDA 4K2SA 1MQPA 2ESCA 3MI2A 3BJSA 3NL6A 5F4SA 4C6LA 3RM9A 3TCSA 2HXUA 1OGSA 4W7WA 2XH4A 3BV7A 4UQDA 3WJZA 2YJQA 1ZENA 3HZ3A 3C61A 4HHMA 5I78A 2G95A 1QPKA 4QJ1A 4RNJA 2BX7A 2E9MA 4CU8A 1KO0A 1XCXA 3MO7A 5FEWA 5HMSA 3VDBA 4A3UA 1VHNA 3NGJA 4J3TA 4NL1A 4IWWA 4D8ZA 2RFGA 4DB7A 1IEWA 4Z2JA 1H7PA 1OD8A 4HOZA 5LIUX 5D9PA 4ZL1A 4MAZA 3C0LA 5JBEA 3PHAA 4AZHA 3N4AA 3WQ6A 1FDYA 1G4TA 2YA2A 2GZXA 1EH9A 2QULA 1XBYA 2AQVA 4UFHA 1MO0A 1FCUA 4ZQPA 1S46A 4ZZ9A 3ZLHA 1GPWA 5E5CA 2VX5A 2RAGA 1IXPA 2E5CA 3K13A 3S1VA 3MV01 1Q6QA 3ORWA 1DWJM 2H6RA 3C6CA 1HT6A 1JPHA 1TJ2A 2GJLA 2Z2BA 4MJMA 4W85A 2Y7DA 1VFMA 3NQGA 3M16A 5HR6A 4UFJA 4LC6A 1SW0A 3B8WA 1LQ2A 1BYAA 1J0HA 1JZ4A 3EEZA 3JZEA 1AH0A 4L6OA 1WZAA 2DJXA 1W32A 3F2DA 4G2DA 5D05A 1VFUA 4AZBA 5I0DA 3KVJA 3M44A 4YXGA 3XIMA 4Y8FA 3LXCA 2BHUA 2Y8VA 4GABA 4HYVA 2QS8A 2QF8A 2ZC8A 3HGJA 2TAAA 3F7JA 5FOOA 3REQB 2CZVA 1W8SA 2HVMA 2ZZ2A 4N9BA 5A6LA 2J27A 4H8HA 1XG4A 2E25A 4F2UA 1J0IA 5LIXX 3BLLA 4B3ZA 3RPMA 2FH8A 1TZZA 4DZ5A 1DWFM 1V93A 3G1YA 4LCSA 2QGYA 4MB3A 3GXMA 2GGJA 2VUNA 3IANA 4GFSA 3WF1A 4H19A 3W2MA 2PDLA 4PSPA 2QJMA 4LUJA 3B3DA 2ZXBA 3EXSA 3BMWA 8XIAA 3UJ2A 3T7VA 3A47A 4MLJA 3LI0A 4NJIA 3OP2A 5TIMA 4GUFA 4DY1A 1D7FA 1CB2A 2V5BA 4DNMA 3AMCA 2X7VA 3EPMA 3ZOAA 4H9TA 5AC8A 1Q13A 1DPMA 3UESA 5T9CE 1RCOB 3O07A 1XSIA 4FB7A 3S9YA 2DH2A 3NEHA 3EBVA 4GVFA 4HSNA 3VX0A 1JZ5A 5FACA 3WQWA 2Z0IA 1RCXB 4QXIA 1IR1A 5A6JA 1XD0A 1V3LA 1F2JA 3OZYA 2ODOA 4V2XA 1GVRA 3PFRA 4AHQA 4NILA 1CYGA 2DT3A 3IAQA 2XUCA 2YXXA 3NQEA 1T40A 2A79A 1DTNA 3T4WA 1SZGA 2X1TA 3TONA 1P6BA 2ALDA 5C9UA 3LCLA 4GIRA 1SJBA 4GJ1A 2WQPA 4E3VA 1ISXA 1UKQA 5I77A 2Z1XA 4KFOA 2H9AB 1I2PA 2OLAA 4JY9A 3WUFA 4CD6A 3B4YA 2YZRA 3H7UA 4DBWA 1ICPA 4ERGA 3AIUA 2WB5A 1VCFA 4FP1A 3WNMA 1OG0A 1DJIA 2J6XA 2J25A 3ZMRA 5CSRA 4XIMA 1VD6A 2TRSA 1LL6A 3DYPA 2TMDA 2P0IA 3MP5A 2OKOA 1TR9A 2A2IA 3MWCA 1ML1A 2VURA 1E4MM 3EEGA 3GE7A 4ICNA 3VFLA 3W2JA 2YIHA 3BW3A 4ZQMA 3W9ZA 3BCFA 3V7PA 1EIXA 1BD0A 1NOUA 3KS6A 3VD9A 4HNUA 3W2LA 4OJYA 1XIDA 1RQEA 3PBWA 3UZJA 2NQ9A 3LDVA 1JXJA 2OELA 3NQAA 3DI1A 2PTDA 3CZEA 3H4WA 4IPNB 2VTFA 1QHOA 4S23A 3N4EA 2XH7A 3VIMA 1XWYA 4NZFA 3SRKA 1OHLA 2F6XA 2JIEA 2OX1A 1J93A 4AD1A 4L4LA 4IH3A 3B0YA 3UZ5A 1RLCL 3R7MA 2H90A 4DVOA 4WGXA 1B3OA 2ZUUA 1JQXA 3PWGA 2YDSA 3Q45A 3THCA 4RW3A 1QK2A 2EPOA 2G97A 1B2YA 3UJFA 3CHFA 1PE1A 2DZSA 1VBUA 2VM8A 1HGWA 2VOMA 3H6OA 4W8AA 3IUHA 3K4DA 2QCLA 3UYCA 2ZX9A 1MNZA 4CKQA 3MANA 5BXRA 1KGUA 2YLAA 5LIWX 3MU7A 1EJVC 3WQVA 1ZALA 3H2FA 4J3ZA 1TPDA 1H4PA 1NVMA 4F4RA 2XH2A 3CO4A 2EKGA 4PFMA 3W23A 1CNVA 3UR5A 4Q6XA 1R7AA 2AL2A 2VGIA 3WMSA 1JDAA 1IGSA 4E4UA 1J6OA 4UTWA 4P7LA 3SFWA 4ZFCA 3CYJA 3O15A 4QCFA 3TWAA 1DWAM 2OT1A 1AMKA 2ZA1A 4GJIA 3PNZA 1FWNA 3K8MA 4FNTA 3W0KA 4F8XA 5IBXA 4DHGA 3VNMA 3LBMA 1IF2A 5BRPA 3OVQA 2CLLA 3PG9A 4B3LA 1XM3A 2VC7A 4H9UA 1HKWA 3LHWA 3CWHA 4M1RA 4BJHA 4M6PA 4DI9A 3K4WA 4V1XA 4X22A 1KXQA 2NSOA 4WOZA 3ABSA 3CL7A 1E73M 5GQBA 4JN8A 2BTMA 3QZ6A 4JTDA 5KZ6A 2W91A 4BHYA 4C6MA 3SGGA 1XICA 4CNTA 5EGRA 3RG6A 2J6VA 4RDZA 2WC3A 3GR7A 2FZNA 2PDGA 2E4TA 3ARTA 5LA1A 1ZJAA 1LRQA 3KM8A 2POTA 2QCHA 4JX6A 5G2HA 1MZHA 3O7UA 2V3EA 4DO6A 1FWGC 3NCOA 3C8FA 3WBWA 1Q7QA 2OO0A 1OQFA 1RALA 1SFSA 2CXGA 3TC7A 3WELA 1PL9A 3SFKA 4O14A 2F6KA 4F40A 1MSSA 1ADDA 1BVNP 2NW0A 4KFNA 3WLKX 3A22A 5AHNA 4PRRA 3AYVA 3NO5A 4I6KA 2RUSA 3SUWA 1VLIA 4NJJA 2NQJA 2Z1WA 1K6WA 1FWBC 3CV7A 3STGA 3ZWTA 4R85A 4IQLA 1DQXA 3P61A 5A8QA 4IIGA 1LL7A 3OA5A 1GVIA 3VIOA 2NQLA 3DHUA 1ADSA 5E0KA 3SSZA 4K38A 4LCRA 4XX6A 1HO4A 3UCDA 3M5VA 2VJXA 1JGIA 4CCCA 4MVAA 3G1VA 3N1AA 4UNLA 1CXKA 4IPJA 4HMEA 1QNOA 4IMCA 2CHNA 3STPA 2V82A 3HFYA 3IJ6A 3PAJA 3CTTA 1W56A 2ICSA 3LV6A 3PPGA 3WZ0E 1UR0A 4A4AA 5I02A 3BSHA 2WJDA 3DEQA 4Z2LA 3W7OA 2