1S2AA

Crystal structures of prostaglandin d2 11-ketoreductase in complex with the non-steroidal anti-inflammatory drugs flufenamic acid and indomethacin
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of prostaglandin D(2) 11-ketoreductase (AKR1C3) in complex with the nonsteroidal anti-inflammatory drugs flufenamic acid and indomethacin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2004-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1s2aA00
2HDJA 1PWLA 2PFHA 3S3GA 3RX3A 4WRHA 4YVPA 1Z8AA 4FZIA 3F7JA 1M9HA 3UZXA 2IPJA 4IJRA 2PF8A 4FALA 5LIKX 2BP1A 3GUGA 4YVXA 1AH4A 2VDGA 4G5DA 2PDCA 4HMNA 1Z9AA 3H7RA 2IKHA 2BGQA 3R43A 2BGSA 1PYFA 3UFYA 3N6QA 3D3FA 4ICCX 2IPGA 3BURA 3LZ5A 4Q7BA 3LQLA 1MZRA 3WCZA 5AZ0A 5LIYX 2PDYA 1R38A 3LBOA 1X97A 3LN3A 1PZ1A 1EL3A 3GHUA 3H7UA 2HVNA 1C9WA 2ACQA 4WDUA 2R9RA 3VXGA 2I16A 2WZMA 3U2CA 3R7MA 4QR6A 4LB3A 2HVOA 4R9OA 3P2VA 1S2AA 2HE5A 3B3DA 4XAPA 4IJCA 3UZZA 3LD5A 1JEZA 4JQAA 2CLPA 3BCJA 2PDLA 4L1XA 4WDXA 4JTCA 3V0UA 3R94A 3CAQA 2IQ0A 3FJNA 1EF3A 3EB3A 2A79A 1RALA 2FZ8A 1ZUAX 2HEJA 2PDKA 2PD5A 4Q3MA 4XO6A 2J8TA 3WBWA 4NKCA 2AGTA 2R24A 2DUZA 4IGSA 3LQGA 3FX4A 3R58A 3Q65A 4DBSA 2FZDA 3H4GA 3RX2A 3R6IA 4JQ1A 2I17A 3M4HA 4PRRA 1XF0A 1LQAA 3MB9A 4PUWA 2PEVA 4LBRA 1RY0A 4I5XA 1HW6A 4WEVX 1EKOA 2ACSA 1S1PA 2PDIA 1FRBA 4JTAA 4YVVA 3G5EA 5M2FX 3UP8A 1PWMA 4WDTA 1ZGDA 4FAMA 4PMJA 3WG6A 5C7HA 1S2CA 2P5NA 4JTRA 1X96A 1AZ1A 2FGBA 3KRBA 1GVEA 1AZ2A 3RX4A 2PDPA 5JH1A 3BV7A 4JQ3A 3UGRA 3CMFA 5HA7A 4GA8A 4H7CA 2PZNA 1XGDA 4QX4A 4F40A 1ZQ5A 3EAUA 1MRQA 2PDBA 3Q67A 4GIEA 2ACUA 3NTYA 5KETA 2INZA 1QWKA 1US0A 2ISFA 1Q13A 4YS1A 1A80A 4JQ4A 3LZ3A 3LUTA 4JIHA 4DZ5A 2HV5A 2IS7A 3V0SA 1S1RA 4PUUA 1QRQA 3V36A 4YU1A 4WGHA 3UG8A 4ASTA 3O3RA 5LIWX 3CAVA 3G1RA 4QXIA 1YNPA 2PD9A 2IPFA 1Z3NA 1AFSA 3MC5A 4EXBA 4AUBA 2FZ9A 2PDXA 4JIRA 4ZFCA 1AH3A 3V0TA 2INEA 3LEPA 1RY8A 2PDGA 4H8NA 2PDUA 3CV6A 4EXAA 1XJBA 1J96A 1SM9A 1YNQA 2IKIA 3N2TA 1YE4A 2NVCA 4GCAA 4HBKA 3LENA 2PDQA 1IEIA 1T41A 4JTQA 4XO7A 3LNMA 4XVDA 3GHRA 4GQGA 2DUXA 5JH2A 1LWIA 3R8HA 2PDFA 1EXBA 3T42A 3GHSA 4LB4A 2IQDA 1VP5A 1T40A 4WDWA 4OTKA 1ZSXA 3ONBA 2WZTA 3UWEA 1UR3M 2IKJA 4XK2A 2PDHA 2PDMA 3CV7A 1K8CA 1ADSA 1Q5MA 4GQ0A 2PDWA 1HQTA 3UZYA 3UYIA 3R8GA 2ACRA 4QBXA 4PRTA 2PDJA 3O0KA 4FA3A 3GHTA 2F38A 2NVDA 4XZNX 1MI3A 1YE6A 4LBSA 1PZ0A 4MHBA 3CASA 4XZLX 4LAZA 5DANA 2DV0A 4GABA 1AH0A 4XZHA 3ONCA 1Z89A 4JQ2A 2FZBA 2QXWA 4L1WA 1X98A 4JIIX 3M0IA 5AZ1A 5HNTA 1IHIA 2ALRA 3C3UA 3ERPA 3BUVA 1VBJA 4XVEA 4XZIA 4DBWA 3WBYA 3EB4A 5HNUA 3QKZA 4LAUA 4PR4A 4JTDA 3WBXA 3DN5A 3V35A 2IKGA 4DBUA 4XZMX 2FVLA 2F2KA 1OG6A 5LIXX 2IPWA 5LIUX 3DOPA 3COTA 2C91A 4GACA 2PDNA 4RPQA 3UZWA 2HE8A 3M64A
chains in the Genus database with same CATH superfamily
4UMCA 4KFOA 3UCCA 1XYAA 4H9UA 1P0EA 1QPKA 3K5XA 3RXZA 4JXCA 4IMEA 4GUIA 1IT7A 5HMSA 3WLOA 1W6TA 2P8CA 1JJKA 3QC3A 2WHLA 4TQTA 2QPSA 4MFDA 1U1HA 4EANA 5I2UA 5EPDA 3UW6A 2J66A 4S3KA 3BG5A 3H7RA 3SJ3A 1PXGA 1JCXA 1YYAA 2PSNA 1VRXA 3GNNA 2O0TA 3WUGA 2VC5A 4EK7A 4LS2A 3W29A 2P50A 3IIXA 2TSYA 3I7QA 4S3AA 3DYPA 4Q7BA 4HNCA 1KCXA 4REQB 4DWSA 4HA0A 3HM7A 3GNRA 2GJXB 3NFUA 3VDBA 3P6LA 1M7XA 4DY1A 3KBJA 5H2ZA 1JDEA 2W6RA 1K7EA 3VGGA 2CZDA 2E8YA 2Y7DA 3IGUA 3R0DA 1TELA 1W37A 4HU4A 5C9WA 5HDRA 2EPOA 4ZO8A 4A05A 1JCMP 1A3HA 5CPMA 2JKPA 1UH2A 4TV6A 2XGZA 4LB3A 5IDIA 1L2UA 1UZ1A 2OSWA 4D6IA 1XKJA 4GIAA 3S5ZA 1ZAIA 4CKQA 4XKYB 2DQXA 2PC4A 1GEHA 3EWCA 3HGOA 3MMWA 2AGKA 5REQA 5HPOA 1IXPA 4C6DA 4BZYA 4CNPA 1K9FA 2ZRVA 1RK5A 3WBAA 4WY0A 3MKVA 5FF7A 5FJOA 3HBLA 2XJ7A 2PDKA 1Y65A 1EPXA 4EPKA 3MDWA 1UMLA 3UXKA 2G4FA 4WVXA 3L66A 5J5RA 4ACZA 1S46A 1UUOA 2ZCGA 2XVPA 4C6PA 3CL7A 1NM9A 1NTHA 4D2JA 2DZTA 3WIJA 1T6MA 4ZZ9A 4R27A 3N04A 2J8GA 1AL8A 5FA5A 3CAWA 1HW6A 4OECA 3W1AA 1BEUA 1KFLA 3MDUA 4FK9A 4MNLA 3AAMA 1TZZA 4YYFA 3SR7A 3DXIA 1ZJAA 3N25A 4DO5A 2FFIA 1P0NA 2OKOA 1HJSA 1W3JA 1C90A 3GH4A 3T07A 1HIZA 2DSUA 1KW1A 5HWMA 4O1BA 3C2RA 2DIJA 4RDYA 1DJWA 4DF0A 1XC6A 4DI8A 2NWSA 2G0WA 1MNSA 3RUBL 1YEYA 4LVDA 2CHNA 1L6FA 1YDYA 2E6FA 2INZA 5A1AA 3WQEA 1UASA 4B3LA 3L0GA 4YWSA 2CESA 1CZ1A 3EDKA 3MP3A 3A5FA 2CZEA 2JKAA 4ALDA 4LNYA 4DZ5A 4HHLA 4GVHA 5D04C 1VPQA 3LTYA 5FF4A 3LSCA 4PMRA 5A6TC 1YRRA 1Z69A 3E9AA 2VUNA 4DEFA 2FVMA 1JCJA 3O3RA 4XWUA 3GWQA 1JXJA 4QXIA 1A0EA 1WAUA 1XBYA 1B3OA 1B3VA 1PKLA 1Z41A 3ABRA 4DJFC 5L9FA 1FWBC 3VTRA 3T9PA 2FJUB 3ATYA 2QKFA 3EX6A 1FWCC 2G5WA 4Z17A 4P7OA 4ZVJA 2PDXA 1H60A 1JRCA 2DSVA 2YYUA 4LEQA 4XBJA 2VZUA 3MS8A 4FNSA 2Q8LA 1EJ7L 2ODOA 1QTWA 1TVNA 4YNGA 1XIFA 3NPVA 1FH7A 2PDGA 4H8NA 1NQKA 4F4RA 5IXEA 4NZCA 3AICA 3VX0A 4D8ZA 2DT1A 4JS3A 1S5MA 1S39A 3G6MA 1EDQA 1FCVA 1G01A 4P8WA 3SY8A 1C8QA 4UCFA 2DUXA 4W93A 2PDFA 4AC7C 5LKYA 1PL9A 4MB1A 2CLIA 4WIWA 5BU9A 4HPJA 1PZ2A 3BZJA 2O7SA 4PUKA 4GXMA 5E5CA 1W9DM 1WZMA 1O1ZA 4UQDA 5JIWA 9XIAA 2YFNA 1SO5A 2EPKX 5CAKA 3EA1A 4PTVA 4KQNA 1B9ZA 1E6ZA 4QBXA 1EB3A 5AECA 4PBGA 2YCIX 1P1XA 3W7JA 4HNVA 4NZ5A 5FI8A 4JTLA 3Q45A 4LPCA 3E02A 3OIXA 4BY3A 2HQAA 4HOZA 2REQA 2V5LA 1EEXA 1M41A 1CXIA 4HU3A 1VIZA 2XGBA 4KESA 4UMBA 4DM2A 4ZCWA 2ATSA 2FZBA 1SZRA 4IP5A 4U31A 1WOBA 2WPBA 4PGLA 1V0LA 1TMQA 1PX8A 4FHAA 4GRSA 1W1YA 4OV9A 4A8RA 5F1UA 1XSKA 1SR0A 1NSJA 1VBJA 3WBYA 1F6PA 1FWNA 3BGGA 5G4WA 3WDJA 3FXGA 4QDMA 3NGFA 2R82A 2G8ZA 4GHRA 1LROA 4GY0A 2B7NA 3G77A 3AMCA 3VOGA 3QV8A 3SCUA 3CNYA 1QO2A 4BF7A 4M7TA 1OFQA 2HXUA 1WP6A 3WQ5A 3DOPA 2QJHA 3FIGA 1CGWA 4RPQA 5M03A 3VD9A 2DZBA 5BOOA 3S3GA 1GZGA 1EP2A 4DXKA 2J7BA 2RJHA 2UZ9A 1J2BA 7TAAA 1JVNA 5EMYA 2IPJA 1UKQA 4CN4A 3VMOA 2WSYA 3TCEA 4L6OA 2VDGA 2EGZA 3VIJA 2FMNA 3P5YA 1ZAHA 2R1PA 3KTSA 2HNHA 1KXQA 1V0NA 3TH6A 2OG9A 4CNSA 3SM0A 2V8ZA 1M68A 4Q4SA 3WH7A 2JEQA 5CLWA 3DU0A 3O15A 4O4WA 4QS5A 1I2OA 4C91A 2POZA 3N3TA 3R10A 3G0XA 3GAYA 4I8YA 4ZQCA 3W81A 2I16A 4M19A 4Y9AA 8A3HA 4C7FA 2PS2A 4AZ6A 3DZ1A 3FGCB 4PN2A 2BX7A 4IIGA 4IJCA 5MKGA 4TOQA 4S23A 4L5ZA 4N2YA 3B9AA 4PBFA 1Q4WA 4CU6A 4JTCA 1OFOA 4QG9A 3EDEA 5CBBA 1M5WA 1UZ4A 5LA2A 3NQEA 4PCFA 4ZL1A 4AEEA 4QCFA 3CT7A 5CZSA 1D8CA 4M6UA 4ZB5A 3ITGA 3CPRA 5K7JA 3LERA 2GDVA 4FIRA 4O16A 1XM3A 3BMVA 2DZWA 4AYSA 4GIYA 4LYRA 1O1HA 2WJDA 3Q65A 4MGGA 5EB8A 3VOIA 4PCSA 2Z27A 3W76A 2I17A 1TX2A 5EKYA 5K2ZA 2Y8KA 1BWVA 3LCLA 1AODA 1WV2A 3MB9A 1CBGA 4E0CA 1PO9A 3BLKA 4IISA 4IICA 4YIWA 4NJKA 2D73A 3GK0A 2TODA 1JXKA 1XRVA 2XIJA 1ZL1A 5DY3A 2NZLA 1XH1A 1QASA 3WQ6A 3IJIA 3ZSSA 2G3FA 3Q58A 4JTAA 2J62A 3VCRA 4BQ2A 2W0UA 1YIXA 3ECQA 3EMZA 4NYYA 5DMLA 3VGDA 4MAZA 1UOZA 1WDPA 1UC4A 3C0QA 1RLDA 1VJZA 3PVFA 2ATMA 2ZUVA 3I6TA 1ML1A 2PU1A 1JCNA 5DBTA 2R6OA 1SO3A 2J7DA 3TXVA 2Y7EA 4E38A 3UESA 5AVHA 1QI3A 4S38A 5U4NA 3EKZA 2JF7A 3Q67A 2ZVIA 3N9KA 3IV3A 2ICSA 4ADTA 2X42A 2PWFA 3LM3A 3CUXA 5AYBA 1FWTA 1GVQA 1PJ9A 1OYCA 5J04A 4ORMA 3VGEA 4C5YA 4JIHA 1RJQA 5GVJA 5DELA 4NRSA 2X1RA 4C6EA 2WBGA 5E0FA 4DAIA 1QU4A 3LHUA 1LL7A 3CZJA 4XV0A 5AC4A 2J13A 5BXRA 2CYGA 1VCFA 3WZ0E 5BYWA 3SUSA 3QPZA 3VNYA 4EACA 4AUBA 3T4CA 1I8JA 1V4YA 1PKYA 3HB9A 3CQKA 1GWJA 3KRUA 3GZAA 1EBHA 5H8UA 2QCGA 3JVAA 4TO8A 3B8WA 2DVTA 4ES4A 3PUOA 2ZX6A 3KL5A 2QVHA 1D9EA 3LB0A 1E1FA 1IEIA 1FFRA 2J25A 3TZFA 3B8DA 3SIMA 5XIMA 1B5TA 1VKFA 1YDVA 3R2GA 1DJXA 4K1GA 2PP1A 4E4FA 5CXPA 1FCQA 4B91A 4UOQA 5LNWA 2XGIA 3CGTA 4WOZA 3W1QA 4W5ZA 2TRSA 1XWYA 4HA3A 1UC5A 4GNJA 9RUBA 2YA2A 3Q94A 4F9JA 4WLCA 5I07A 1VPXA 1KA9F 1MW2A 2FGZA 2HCVA 3WLTA 3AHZA 4Q7NA 2ZA1A 4LAOA 1TQXA 4MPKA 5AHIA 3P84A 1XP3A 1W3LA 2EAWA 5LZLA 3NQFA 4GABA 1FWRA 4GXWA 3LXAA 2PWUA 4DF1A 3ONCA 3W7KA 2OWXA 3H53A 5G4EA 1ITQA 4NRRA 7A3HA 2ZKMX 1KRBC 5XIAA 4PTMA 3IPWA 4O0KA 3N4AA 3VDGA 5HWNA 1C93A 3KLLA 3OQEA 2D22A 3N73A 3MUY1 4DRSA 1ADOA 2NQJA 4B16A 3CEPA 1E72M 1HG3A 2C16A 2BXVA 2PBOA 1IZJA 3OB8A 1B31A 1R87A 1ONXA 4CD6A 4CD8A 2XIOA 2J7GA 1UR8A 2J4GA 3IGHX 3P7YA 2OQLA 4PTDA 4Z2IA 3T2PA 1X8CA 1FDYA 3W2KA 1Q45A 3TTQA 2IPWA 4C6NA 1E3ZA 3T81A 1RP8A 2QUNA 3ZM8A 4AZCB 4O14A 1JZ7A 4ROQA 1SFSA 2W5FA 3RJXA 1MDLA 2ZYFA 2ZZ3A 1HJXA 2VQTA 3T8LA 5FIPA 4WRHA 3LPFA 4FZIA 1FWJC 2CLHA 3T0CA 1MUMA 4WSKA 3S0CA 2ZXAA 3FK4A 3NO5A 1ZLPA 1TJ0A 4ZE5A 1XYCA 3UXLA 3GVWA 3N18A 3RN6A 1U33A 3LXBA 5D2WA 1UA3A 1Y5XA 1SGJA 4B4FA 1OIFA 4M1BA 4PFMA 4FLSA 2J24A 3EGJA 4S3DA 4ZGYA 1MDRA 5ECVA 2P0IA 1GHSA 1G6CA 3AXKA 2AQVA 4O53A 4MYXA 1QOQA 1W5PA 1FY6A 1EJXC 4LCQA 1Q8JA 1JYNA 1XSJA 1ZRQA 1VBHA 3G3MA 2GYIA 5I3FA 2ISVA 3VGBA 1CX9A 1LT8A 3KL3A 4MIMA 5EA9A 8XIAA 1GVSA 3EZ4A 5CSRA 2GUUA 3JUGA 1T8XA 3W83A 3L0KA 1R86A 2IXUA 3M46A 5D30A 1JNDA 5FL0A 3E2RA 3B0YA 2WZMA 1ONRA 4IXXA 3EX1A 1A5AA 3HG3A 1XCXA 1NF7A 3WLNA 5E6YA 1JF5A 3R89A 2J6VA 3D46A 3BCJA 2VFIA 2NT1A 2YYTA 1JYWA 4FP1A 2QDDA 3VNIA 2BODX 1FHDA 3FYOA 4DF2A 2PF0A 2XH2A 1FDZA 2OQHA 4B3ZA 2A2IA 4ZR8A 2XN1A 4AHOA 1Q4NX 1DIEA 1RBAA 4CVWA 2KX9A 5AB3A 2XVKA 1XIGA 1TE6A 3AROA 1LYXA 3P62A 3VNLA 1SW0A 1K70A 2AGTA 2R24A 3NURA 4N9EA 3LX9A 3BJSA 4IHCA 1E40A 2O4MA 4A21A 2E6AA 4LNCA 3FHQA 4AX7A 2VZVA 2A7PA 4JQ1A 2D0GA 1RVKA 4QEEA 3FEMA 4B90A 4MWAA 1B1YA 3OLDA 4E2OA 1XLKA 1R3QA 2L5HA 4K8EA 4WEVX 4CQ9A 5TD4A 3JZUA 4L4PA 5A8OA 3R79A 5M2FX 2A4AA 2V63A 2QJNA 5KEZA 4I5UA 2VTFA 1E4MM 1GJPA 1TWZA 4HYWA 1KV5A 1BPLB 1RH9A 2WMGA 1MRAA 1B30A 3SGGA 1CXHA 4F66A 4WHBA 3BTNA 2I5QA 1AZ2A 2ZWZA 5JXQA 3AI0A 4S3FA 4WY0F 4Q8NA 1WZAA 2OTDA 4JTHA 4AYGA 3VYLA 2OSXA 3T2QA 1UG6A 2V69A 3T78A 5KZ6A 3WQ4A 2ESCA 2UV8G 5I78A 2JQXA 2OT1A 3STCA 4Q32A 2QCMA 2WSKA 2AQWA 4IFKB 2ALDA 2O9OA 1JULA 1J0HA 3A3XA 4OUEA 3MI6A 4TVDA 4J9JA 1OWQA 2BTMA 1B3WA 4DYJA 1BQCA 1LZOA 2GQAA 5FKYA 3HGRA 3S5YA 3UA3A 4V28A 1XL9A 5D02A 1RV8A 4KEVA 4ZB2A 5CBJA 2G4JA 2EF9A 5KMYA 4DB7A 5FEZA 3PPFA 3WKZA 1XISA 1PTAA 3FDGA 4C6FA 3AO0A 2XTKA 2Q3RA 1JYXA 3QV7A 1XINA 3T7VA 4C6MA 1GKPA 3STEA 4IIBA 4AU0A 1HVQA 4IUOA 2H6RA 4R34A 3U4FA 1M65A 4JL1A 3BICA 1KFEA 1K4HA 2EBNA 2GZXA 3GFZA 1R3SA 2QUMA 3LGGA 1OCNA 1N7KA 3TDFA 3SCRA 3VOFA 4CLMA 2QF7A 3CV6A 6XIMA 1H7NA 2BVDA 3URAA 2Z29A 4N42A 2Y2WA 4J2PA 2ZQ0A 5I6SA 2A3HA 5F4SA 2WWCA 2XG9A 1VB9A 3AYRA 5CEWA 4JCMA 3WEZA 3VC5A 1JPIA 3AFBA 3AHXA 4DYKA 4JTJA 4PUEA 1JI2A 1UKPA 2QHAA 1B4EA 1V3IA 3NAVA 2YGYA 3NPXA 3ENLA 3CLMA 1MSSA 2PDHA 5CPNA 5EU9A 2C18A 4X61A 2FLIA 4C7DA 4DWSD 1DJZA 2VEFA 1WKFA 1HL8A 3ARRA 1N8WA 1JCYA 1BTMA 1Q65A 1G4EA 1LTDA 4OQVA 1E1CA 3DUGA 2MNRA 4H4IA 1TPVA 3G1YA 1ECEA 3AS1A 3GTXA 1MQRA 4KIEA 4PMXA 3DC8A 3M0YA 3EX2A 4AXKA 3C61A 2CBIA 4NL1A 4KFNA 3WL1A 4KERA 2VCCA 2YFOA 4LUIA 1BWKA 4AD1A 1J9YA 4GVGA 3OBKA 1NVMA 4GFIA 1UKSA 1BXNA 2VEKA 2NQHA 2DP3A 1ZBCA 2PLCA 3PP7A 1JF6A 3SIZA 2WCSA 3PG9A 1TA3B 3TSMA 2XN2A 5RUBA 3TNOA 1VFSA 5D8WA 3VKCA 3LPPA 4QLKA 1BSLA 2QCDA 2WSRA 5GNXA 3WNLA 3W27A 1J5TA 3MYOA 2YCLB 3LI1A 2F2KA 1WUFA 1XPYA 3CUIA 1H09A 3PSVA 1OG6A 5HOSA 2AL2A 4XBKA 1KM5A 3CH0A 3DAQA 2AKZA 1J93A 1B0IA 4HZ8A 3RHGA 1R6WA 4QP0A 2GLKA 1CGXA 2D2GA 3A5VA 2A21A 5E0KA 4LUTA 4YMZA 3M0LA 5HATA 3BLIA 1BG4A 1QBAA 2WNWA 1GKRA 1HJQA 4H9YA 1ZNNA 4C6QA 1TR9A 1V6XA 3E3HA 1F4AA 3NDZA 3U0HA 1V6YA 4IMGA 2WMHA 2ZA2A 1OVDA 4FXRA 3BLFA 4BI7A 2BGQA 5FF0A 1YHTA 3GYEA 2BVTA 3L5MA 1G4SA 2Y8UA 3WF1A 3HTWA 3RK8A 3T0BA 3WCZA 3B4YA 4PUJA 4MZ8A 5CJNA 3GQYA 4G6CA 4DWSC 4QSHA 3THUA 4IMFA 4RJEA 3GKAA 1PZ1A 3GHUA 4P7LA 3W28A 3P5ZA 1R9ZA 2G37A 2ACQA 7REQA 4RNJA 1GOOA 4HVXA 3ZIZA 4KCUA 3BLLA 1BYCA 3ZJ6A 3VKBA 2Q6ZA 1JQVA 1LP6A 4NJJA 5BOEA 4CU7A 2HE5A 2VO5A 2I1OA 3WLLA 4Q8UA 2QCEA 2BLEA 3RYSA 2HRWA 3GDLA 3KRZA 2Y7FA 2G97A 1ICPA 1SZEA 1EOMA 4JTUA 1E0UA 3CAQA 3RLGA 3OVGA 1A5OC 2H9AB 3MWAA 4LAMA 4FNRA 3AISA 1GOKA 1RALA 3KBWA 1FKWA 3TW9A 2IMRA 1VRDA 3N15A 2DZUA 4NX5A 3SAZA 2VCBA 2HPIA 3MCMA 3ZVHB 4NKCA 4HOWA 5CCZA 3AJ7A 5D2XA 4JHOA 5BW6A 1VEPA 4NXKA 4O15A 4Z1DA 4Z42C 3THAA 2E5BA 4YCPA 4W9TA 4WX2A 3MSYA 3WDHA 1MEIA 2YSWA 4QQUA 1XLGA 3O1NA 3QQWA 2FTYA 4PRRA 5JBDA 2F6UA 4D6FA 1XDJA 3L12A 2D24A 2V5DA 4B4HA 2OX4A 4JEJA 2GWGA 4TUFA 1FWHC 1JIBA 4O10A 1O66A 2AQOA 1Q6CA 2J27A 3E38A 2V0TA 3ZJ7A 1TB3A 2ZA3A 1VAHA 3KUMA 3IRDA 2V5JA 2Q8ZA 3M0HA 5D2TA 3MUIA 1RPXA 1X96A 3AS0A 4C5ZA 3PUDA 1W9PA 4YXGA 3BGAA 5T9CE 1O12A 4L61A 2XFRA 1PEZA 3TSDA 3L5LA 3RO6A 4D6JA 5K9CA 1WA3A 1XLFA 3NZ1A 4RNHA 2GUYA 3CMFA 4AEOA 4KCWA 1V7AA 4K3ZA 3RPMA 1LBMA 3HJZA 1SZFA 4PSPA 2DPEA 2F6KA 1DWFM 3ZXWA 3TCSA 4LRTA 1I75A 4JICA 2VELA 2FPVA 2O9TA 4ZB0A 1PTDA 4H2CA 3W07A 3MP5A 5FEXA 4E8CA 4H3DA 1P5BA 2BS9A 2OX1A 1I2RA 1WUEA 2DH3A 3CB8A 4IP4A 4ZXLA 2WSPA 2PMQA 4EAMA 1QRQA 1V02A 4QSFA 3V36A 1BHGA 2JGQA 5BZAA 4OE7A 2E6YA 2A0NA 1ME9A 4KETA 1FWWA 3G1RA 4P5UA 3QY8A 1I2QA 1G9HA 4AVOA 2VHLA 1A49A 3CHFA 5C2CA 2GVLA 3ZYZA 4ML9A 3MMDA 1R2SA 1AH3A 3ARVA 1HP4A 1FQ0A 1O5KA 1UZHA 1KO0A 3G1AA 3W82A 4NIRA 4GBDA 3PBUA 1J4EA 3WLQA 1IEQA 3HJEA 2J88A 2CLMA 2QF8A 4EXAA 4RL3A 3TW6A 1XCFA 1EX1A 1U22A 3NA8A 3LNMA 1ZHAA 1EWEA 1VC4A 2WK2A 1LWIA 4C1LA 3KBVA 3POCA 2ZIDA 1SO6A 4DXXA 2WVVA 2PRMA 5EL1A 2CC0A 1ZSXA 3K4DA 3LI0A 2RAGA 3WK0A 4KH2A 3MY9A 2PCQA 2A6NA 1JUBA 3CS2A 3NQMA 5DLCA 4I9JA 4RZ5A 2W92A 3UZYA 1B57A 2PP3A 1Q85A 2V82A 1HT6A 5DEZA 3IJDA 4MKSA 2ZUSA 4GUJA 1S3HA 5C9UA 3RIKA 3MV01 1CXFA 3AU6A 1KQZA 1KFKA 3LTSA 2DEPA 1O5XA 1IV8A 4K7VA 1SR9A 2A6LA 3WLRA 1CGYA 1HJWA 4XZHA 3T05A 3FJ4A 3D47A 5JBFA 3PZNA 4QFUA 1MW1A 3WQFA 3WH6A 4NX0A 2OGJA 4AXNA 3O07A 4L9ZA 4U5IA 1BKSA 4X2PA 3EB2A 3IJ7A 6A3HA 3NXLA 3GTIA 4QROA 3LTPA 2E6DA 1PKMA 3VKJA 1GZ1A 1MUCA 3TIMA 5CZ0A 4ZQNA 3ABOA 4FI4A 3WNNA 1I9CB 5D37A 1QNQA 3QYSA 4JNYA 1XD0A 3CHVA 5D9PA 4GISA 4UR9A 1AMKA 3S2LA 3NSNA 1UYQA 2PI6A 2PWVA 2YZRA 2GGEA 7TIMA 3L2MA 2FH8A 3N12A 1PWLA 1N82A 4O8AA 2VVNA 2WHJA 3MPGA 1C9DA 3QMSA 1JCLA 3RGTA 5FJJA 1FX6A 6REQB 4JY8A 4J4KA 3R0UA 4P8VA 1TJ2A 4GY7A 2A3BA 4UCGA 2WAGA 2BFGA 2PF8A 2C0AA 1D3CA 3ITCA 3W87A 4C90A 4H00A 4MKNA 2CW6A 2NVAA 2Z1KA 3E0VA 4H9XA 1KFWA 3G1SA 4V27A 1RJPA 3O16A 3WJYA 1XFBA 5LXXA 4R7WA 2IXVA 2ZZ4A 3KL0A 3IUIA 3KVJA 1TPDA 1W54A 5CH9A 3LGDA 4PB4A 4WCJA 4ZTXA 4Y9NA 1JNEA 2QLYA 1E9LA 3L4ZA 4UOZA 1KLYA 3LBOA 4DJDA 2I5GA 4AF0B 2HISA 4RUBA 2O4QA 1Q2SA 2ZZ1A 4HK6A 4X60A 2X2YA 3VM5A 3UR2A 1PHQA 1KGUA 1LL6A 1XLJA 1V08A 3N2MA 3VU2A 3GDRA 3CZGA 3CQ0A 1OK6A 2PTZA 5HMEA 4GUGA 4KGLA 3VDAA 3BQ5A 3REQB 1H61A 5A69A 3UWQA 1O68A 5CQ1A 3GU2A 3EOLA 4Q4MA 2Z1SA 4GZ7A 4LV4A 4PBEA 3FJ6A 4WSJA 2BHYA 4UFKA 1AA1B 1ZUAX 2XIQA 1HN1A 1LLZA 1IZCA 1P0DA 2YB4A 2GK1A 2WHMA 3GIYA 3K8LA 4XO6A 1NH6A 4MTVA 2DUZA 4EF9A 4EE9A 3ISIX 4BFAA 1OD0A 4JCLA 2FTPA 4BS0A 5DCBA 1A5MC 1DORA 1SFTA 2G3NA 3BSHA 1R9YA 2DVUA 2GSHA 2C3ZA 4DO4A 1EFZA 3CUJA 4AW7A 1R3YA 3QMRA 2X1IA 4IM4A 2DT3A 2WV8A 1KCKA 3ZWSA 5MKGB 4LTSA 4P7RA 2X1TA 4NJHA 1OZMA 1VYPX 5FJUA 3W38A 5CSSA 3SUVA 2HWGA 3NQAA 1PBGA 2GQ9A 3GE7A 3N2XA 4K7YA 4N7QA 3MZNA 4J3SA 4R9XA 3PF3A 2NV2A 3C8NA 4WDTA 4M29A 3TVAA 5AN7A 1QDSA 3RCYA 4MFEA 3V75A 4JTRA 3URNA 3TUUA 4M82A 3WDQA 2X7WA 1PDZA 3U3HA 1EP3A 4BI5A 4AHPA 1WDQA 2VXNA 4ML4A 1S2UA 5DRCA 3E12A 1UWRA 1IEVA 3L4XA 3KDNA 1QCWA 3DGRA 3C4UA 1OC5A 1UJQA 1S2WA 4DVOA 1BXCA 1UP2A 4RE4A 2Y1HA 3OGVA 2PPGA 4Y6GA 2QCLA 5HA7A 3ZWTA 4UB9A 4H7CA 2QCNA 3KP1A 5A6SA 1W1A1 2VR4A 4F40A 4QTGA 4JKKA 2E77A 4KKXA 2YOCA 4RE0A 1RSCA 3CPUA 2OQYA 4PUNA 4L7ZA 5M5DA 3B04A 2ZTJA 1KM6A 8RUCA 1TUXA 3M1ZA 2P0OA 4ICMA 3M44A 3NGJA 4UFLA 1A5KC 2VEGA 2A3CA 3D5HA 1KBBA 3TN6A 2V5KA 2XFWA 4B15A 1QPNA 3NDYA 4IJBA 2C7FA 2W79A 2VFFA 1ICQA 2X0YA 2E8ZA 3GNOA 3ARUA 1Z3NA 5A6BD 4PTXA 5ECUA 2V5CA 4EXBA 3PZOA 1QMLA 4PB3A 1K1DA 4PMYA 1Z42A 1O95A 4KWUA 3EWWA 3BOFA 3M0VA 1G4TA 4OWGA 1W5NA 3I3EA 4FSAA 1VHCA 2J8FA 3KS5A 1FWIC 3VKKA 3WUBA 4C6CA 3MJYA 3NM1A 4ZOEA 2E09A 1JZ5A 3OZYA 4M51A 1ONEA 3RPTA 1FH9A 4WJXA 1QI2A 2J75A 4M7SA 3GSMA 1Q8AA 4WQ6A 1TPEA 3PFMA 4LGXA 5I3JA 4MMWA 2OO0A 3FEQA 1VLWA 3SFWA 3GHSA 3CYVA 1Q7ZA 4WOQA 3NO3A 4QAIA 4N9BA 2I56A 4DN1A 3UXAA 4HNNA 2WNZA 4X0VA 1I0DA 3LV5A 3WJZA 1JZ2A 3WH8A 3F03K 1VBRA 5JU6A 3PB2A 1SVDA 3I6EA 3SADA 2V3EA 4E8GA 2I57A 3EEZA 3ZFHA 3PB0A 4I7VA 2PDMA 3L4WA 3G1DA 1GYMA 3LHVA 4DJED 1ODUA 3VCCA 1B2YA 5HAOA 1CXLA 2PWEA 3NQCA 1VFLA 3MJMA 2PUZA 3A21A 2NQ9A 3P8JA 5EMMA 5I02A 2Z6JA 5A6MA 2GUBA 4HJFA 3RFAA 3M5XA 3R8RA 3TXZA 4UFMA 3M9YA 2OODA 3BAJA 3MHGA 1Z89A 3B9DA 4LUSB 4Z2HA 4QAWA 1ISYA 4WGXA 3IJ6A 3W26A 2HJPA 1P7TA 4FF7A 3GY1A 5AZ1A 1RK6A 3QV6A 3O2LA 4ZE4A 4XZIA 2Y4SA 3BVJA 3STFA 1LOSA 5D9MA 2GGGA 3CL8A 2OYKA 3APYA 1REQB 3KVMA 1F8MA 4FLQA 3BK0A 3FKRA 3W7LA 3V35A 5A8MA 1UH4A 4XZMX 4DBUA 4DLFA 1MQQA 1RLCL 2QVNA 2YX0A 3R25A 4W8LA 5FAJA 3ZZ1A 1V03A 1VR6A 5HJLA 1ELSA 2ZZ5A 3L65A 2V9DA 2B7QA 3UZWA 2IW0A 4H01A 3FXYA 5FOOA 1N8FA 5LHEA 2Y63A 1UWAA 2YDAA 4YVPA 4PEEA 1A4LA 4KCVA 4IJRA 2ZVRA 3BW3A 2NXIA 3VD4A 3UR5A 1K9EA 5FJRA 3FW6A 4UTHA 5GPRA 2PDCA 2WVUA 3QTGA 4PCNA 1W1ZA 5CZTA 2ZADA 1LBLA 4S3JA 1GG1A 1JPHA 5CJMA 3GG8A 4X3ZA 3EPMA 4HNLA 4E2VA 3CL6A 2GVGA 1SYTA 3D3FA 1ZB5A 3BURA 5DCEA 1OGGA 3FN9A 5F2LA 1W5MA 3OG3A 4AG0A 3V5OA 1H51A 4DZAA 1TQJA 4FNUA 4AMAA 1H4PA 2GGJA 4NG3A 4RR4A 1AQHA 2GGHA 3WLPA 3WEMA 4XZWA 3VXGA 4C6IA 1FXQA 5A6AA 5D4YA 4E2BA 2EHHA 1RR2A 3G1XA 3S1XA 2B7PA 1TWIA 5F2MA 3FCPA 4P61A 2EG6A 2NX3A 4L1XA 1CLKA 2WWDA 1H7WA 1M04A 3CQIA 5LNRA 1OC7A 3PUEA 3FJNA 4V2XA 3OIHA 4GX9A 1EDTA 1EF3A 1OEPA 5HMFA 2FZ8A 1ISWA 2C6QA 3QSTA 3RILA 1KRCC 2J79A 4GJJA 5CC7A 1XBZA 3BOLA 3UNTA 4JX4A 1PDYA 1OBAA 4BCEA 1LUCA 2XWDA 3KWSA 3SDOA 1OX6A 4B5WA 1WDSA 2RJGA 1IGWA 4AVFA 4OJYA 5LXEA 3AYTA 3M0MA 3I10A 3U8GA 1EIBA 3N14A 2QCCA 1Y7VA 4XKMA 1BF2A 3ELFA 2Z2BA 4Y9MA 3MTWA 3RF9A 3R12A 5AC8A 3QN3A 1ZU8A 1PIIA 5FAGA 1EXPA 1V3LA 3F4NA 4FS9A 3UP8A 3MVIA 3S1UA 3PPHA 2OFJA 4MWAE 4X22A 4Q4RA 1KFCA 1IXQA 3NL2A 4JFUA 1ZBVA 2VX5A 1G67A 4QLLA 1MVYA 3OW1A 5CAHA 5AC6A 5E9AA 3DFQA 1L0PA 1DWIM 1GOWA 2YCEA 1DXEA 3BARA 2C19A 1F3XA 4L65A 5HNRA 4PMVA 1RAKA 3W6MA 2OU4A 4RCXA 3CMJA 1G7UA 3LV6A 3TTYA 3VE7A 1R8LA 5F1VA 1EDGA 1KRAC 4MWAB 5CC6A 5KETA 1UW9A 1NFBA 3KM8A 2DSWA 4LU0A 3T44A 2XUCA 3LLFA 2BHZA 2P76A 5SWUA 1CT5A 2A1YA 3L4YA 4TMBA 1TPC1 1J0IA 5HR6A 1OFAA 4OHQA 3H2MA 1O7AA 3AYSA 3SECA 1RBOB 3WUFA 4GH3A 3QV9A 3QOMA 3W1UA 3MWCA 3TKFA 1B3XA 4UQAA 4INFA 4NAEB 2DSKA 3EXSA 1J5SA 4DUOA 1XIHA 2FHFA 4CNUA 3BANA 3AHTA 2X2GA 4HJWA 1R9XA 3ARQA 4BI6A 2R8WA 4CN6A 4ZSTA 4UZSA 4FNQA 3MP4A 4HTYA 1CB7B 2PGEA 4LYQA 1ENUA 1SO4A 4NY2A 5CC3A 1RQHA 2ZDRA 1MMFA 1RVGA 2VL4A 3QJAA 3TV8A 5BRQA 2YL5A 1SZGA 3KTXA 2E7FA 3PZGA 4HZ7A 4IXHA 3GX9A 2R1LA 4O12A 5FACA 2GVJA 1DIKA 3G8EA 5IBXA 4F2BA 4UOJA 1JZ4A 4IPPA 4AIEA 4JYFA 4UTIA 5GJMA 2C1GA 4ZTYA 3A4AA 2XSBA 3GLCA 2A7RA 4RZ4A 3ABXA 2ZZ6A 3T6CA 2A3LA 1BTCA 4RV8A 5I3KA 2HBXA 2FDSA 5D09A 2VUYA 2CZ5A 1J0JA 1NFGA 1KKOA 4D8AA 5KITA 2QDGA 4PH6A 2G50A 4O18A 4PODA 4C65A 2DW7A 3SBFA 3IVSA 3W3OA 2ASHA 1UR3M 4XK2A 4EF8A 1GYNA 1QNRA 4BF9A 4H41A 1W9UA 1MUWA 1Q5MA 1RD6A 2WMIA 1A5UA 2Z24A 3GVGA 3UJFA 3OU8A 1UPMB 2ACRA 2WNNA 4XG1A 3M5VA 4QLJA 4DO7A 2VOTA 3LG3A 1W17A 1JAEA 2GJRA 2OZTA 2A85A 1HP5A 3GAKA 1TO3A 1E3XA 2VWSA 2PURA 3KOFA 2UWFA 3LSBA 3A47A 2QUVA 4AD0A 4B9ZA 3H2EA 2OLHA 1W8GA 1C7TA 4U3CA 4NJGA 1QOXA 1TPFA 3W1XA 4GKLA 1UD6A 3EDFA 3GG7A 3TROA 1DIDA 2H3DA 2X09A 2DSZA 2B4GA 1Z32X 1CWYA 3S47A 3SGZA 2JIEA 3NOYA 5A95A 1GORA 5M17A 4B5VA 1FCUA 4PL2A 2NW0A 1SUXA 1GVYA 3JU2A 1VJSA 2J78A 3OO2A 1SJDA 4JN8A 3H8AA 2VX4A 1W56A 1OFDA 1A5SA 4BEUA 3GBEA 4CCDA 3BLEA 1V79A 1EJTC 1V3MA 4RK8A 5T26A 3P61A 3HQOA 1R7AA 1XIIA 4QG8A 1NF0A 3SO7A 4LC6A 3S1VA 5LHFA 1JAKA 2Z7KA 3IAQA 4ZQOA 2ZZ2A 3NQ7A 5D2VA 2NVCA 3G18A 3S6TA 4KBXA 2CBJA 3NL3A 3OJGA 2QS8A 4LVGA 4BF5A 1WAWA 3A4JA 4IG2A 1LL4A 4Z2JA 4ORIA 2FMOA 4P2VA 4IQJA 1W5OA 5ABTA 4YCOA 5JVLA 2ZRZA 3W6YA 1TPH1 1AH4A 5CGQA 3KVLA 1JD9A 1X6UA 4AQLA 5C2XA 3QR1A 4GGBA 3W84A 4FXSA 3U4AA 1H50A 4JPGA 3R43A 1CYGA 1CIUA 5CSYA 4Z2GA 1OCQA 4KEZA 3CHCA 2OGYA 2PTXA 2VENA 1CEOA 1MZRA 3CUHA 1S5WA 4JFSA 1F74A 1KNWA 4UTMA 2HVMA 1ONWA 1PHWA 1W1VA 1KRMA 1A5BA 2WVSA 1EGVA 3W75A 4LQ1A 3TA9A 3N4FA 4R3UA 3W7CA 5ABFB 3SCTA 3IJQA 5ABEA 1Q63A 4IWWA 5E1QA 4AFYA 1GQLA 1MQPA 2X1UA 4PFHA 3ZR5A 1LWHA 1NP0A 3WJSA 3DFPA 4JQAA 3G8RA 4XIMA 4A3QA 3O06A 1U2YA 1KTNA 3M6YA 1TTIA 3GRIA 3R94A 2PB1A 1B54A 3PS7A 3S2MA 3SCSA 3HV8A 2VT0A 1WOAA 1NY1A 3FY1A 3KXQA 1NOWA 1OM0A 4IIEA 2PAJA 3NWRA 1GPWA 1K02A 3ZLGA 1M03A 3UPMA 1MXSA 3ITYA 4REQA 2Z2AA 3L2LA 4XSLA 2CITA 3VOJA 1F3EA 2GJXA 3MZ2A 4OIFA 1HKVA 2CCRA 4Q4OA 1ODZA 4Z1BA 3VD5A 3TP4A 2FZDA 1ZJHA 3H4GA 1JFXA 4BKNA 1UR1A 1W0MA 5G2WA 1UKOA 4HCHA 4O13A 4JIQA 1PUDA 2PEVA 5CZJA 3N11A 5KSWA 1KCLA 4WD0A 4MJ4A 4XBSA 4JFVA 5G2IA 3GC2A 4J28A 1S1PA 2A3AA 4XKYA 5A2BA 1V77A 2DIKA 4L6DA 2ZXDA 4JX5A 1L6WA 3UBPC 1YTEA 1V0MA 2FGBA 3KRBA 1FHLA 3MV11 2C71A 2V67A 2VVSA 1E0XA 4M24A 1LT7A 2XFYA 1XG4A 1OX4B 2Z28A 4ZFMA 2YDRA 3ITLA 4LBUA 3UGRA 1SZNA 3WO8A 1CW2A 1M01A 2UY2A 4YPJA 2PZNA 3N19B 4OBRA 5A3HA 1GEQA 1FA2A 2PDBA 4JYEA 3NTYA 2Y85A 3CQHA 4K8HA 3FVMA 1TPB1 3L2IA 3OVQA 1TV7A 4JQ4A 1DWJM 3DKLA 3W37A 1UJPA 2OEJA 2Z0IA 4JEQA 3NL6A 2EO7A 4GVFA 4PYSA 3W72A 3BXWA 3HPSA 3BO9A 5G2HA 3DC0A 3W70A 4PTWA 2YA1A 3PWAA 3VZZA 1EGMA 3IUDA 4FR1A 3DFOA 2PWDA 1XPGA 2W9MA 2OJPA 1CXEA 9CGTA 1XXXA 3QPEA 1OYAA 4HYVA 3G22A 4NQ1A 1V02E 1A3XA 1RA5A 5J8LA 1XH2A 4ZFCA 2OLAA 3U7BA 4KFPA 2YLAA 1D8WA 3LDVA 1F4HA 1E1EA 2PCEA 3OZOA 2NXHA 4X9YA 1O60A 1XGEA 3TW7A 3GXPA 4PRWA 2CBUA 2E5DA 2X30A 3KW3A 4W89A 1JYVA 4HYRA 1J12A 3GU9A 3ITVA 4B92A 2PDQA 1F73A 3GTFA 4QDPA 2Y8VA 4OFCA 4OZOA 3PZIA 3BLOA 4MADA 4GZIA 3PSWA 4FLOA 1E43A 3VIPA 4EPEC 1L8PA 3N6JA 1EWDA 2OPJA 2OMAA 4S3BA 3EKGA 1R5YA 1LQ0A 3IK4A 1ALDA 3A9IA 3F5JA 3GKFA 3QR0A 4DJDD 3CT2A 5HWJA 1J79A 3WY1A 1TVLA 4R85A 4QHRA 1DJYA 3TYDA 4H2HA 1O94A 1DHPA 3P93A 2QV4A 5I3GA 4YTQA 4Z2LA 2PDJA 2BNJA 5M3WA 3NIYA 4S3GA 1VYSX 4U5KA 3K8MA 3I6RA 1CTNA 3HO8A 2GPTA 4Y7EA 1AG1O 4DELA 3WSUA 4ICNA 5DANA 2W61A 3CHEA 3PBMA 1VFHA 1AH0A 3CK5A 1DQUA 5T9BG 3F2BA 1EH9A 4L4LA 2PTDA 4JQ2A 2MANA 4HMEA 3QZAA 5LNSA 4LVAA 3LLXA 4RW3A 2I5IA 3M0IA 1LJYA 3CBWA 2ALRA 1G5AA 2XZ9A 1J10A 1AQFA 2AAAA 2VCAA 4FX7A 4BJHA 4IF2A 2QUUA 3H54A 2Z1WA 4PR4A 4GE8A 4AIOA 4J5NA 3U7VA 3DN5A 2JE8A 2QPUA 2E28A 1EP1A 5CJ5A 3IARA 5DQPA 3WENA 4EX4A 4RXGA 5JIPA 1E6RA 4UTLA 3SI9A 4IPLA 4BQ4A 3PBGA 4AD5A 1NDYA 5A6KA 4GACA 2PDNA 4I90A 1U5JA 2UY4A 3GDMA 5AYZA 1GQNA 1EC9A 4NU7A 1HKWA 1TTPA 2QYGA 2GFTA 1DTUA 2P3EA 4PEKA 1YMYA 3TC7A 1EX5A 1W2VA 2WYSA 2ZUNA 2XVLA 3ES8A 1BWLA 4NNAA 4YHEA 2J9ZA 3M07A 3VZYA 2XYLA 3W02A 3VINA 1GT8A 4HMNA 5FEPA 3CZEA 5AYIA 3LS9A 4CD5A 1PYFA 4N6FA 1H62A 3KE0A 3W24A 3N6QA 2BVYA 1JPKA 4LANA 5HINA 3NQVA 3GW3A 1Q7QA 3S2JA 3I4KA 5LIYX 4HP5A 1T96A 1R38A 1BAGA 1X97A 1DE5A 2WANA 4DJDC 3L4VA 3H2CA 2HROA 4IMDA 4QIUA 5BOFA 3S5SA 2ZX7A 4Q8OA 3AWOA 1O5RA 1FWDC 2BOEX 4A2RA 2JF6A 4RZBA 1QK0A 3SRKA 1XDMA 2QCFA 2XH0A 3HGSA 2J7EA 3MANA 1EYWA 3WELA 3AIEA 5AHNA 2NUWA 3TN5A 3WJXA 2LLEA 1Z48A 2RHGA 4GBUA 4NI3A 3I7RA 3UZZA 3K46A 3NEHA 1V3JA 2ZC8A 4LFYA 3P81A 3H6OA 3SZ8A 2O56A 1GQIA 1OCBA 2ZXBA 3K4AA 1QOPA 3A9BA 1A53A 1OD8A 2C14A 2IQ0A 1W3KA 2V68A 1DVJA 2I9UA 1AJ2A 1YDOA 3DCPA 4B5NA 5IDZA 1H1ZA 3HMJG 3N2BA 2W27A 3W00A 4OBSA 4FEZA 1J0YA 1VQTA 2VC6A 4AD2A 2J9XA 5CC5A 3DFSA 3P0WA 1W1TA 3AS3A 1LWJA 3QQ0A 4LAKA 3T2OA 4D6CA 3FGCA 3VK5A 1GOIA 3FOKA 4I6VA 2ACSA 3IIPA 3NDOA 4KIRA 3W7RA 3WFLA 4BK9A 5BRBA 4YTSA 3RLHA 3LCFA 4QITA 3TWBA 3WD3A 2P5NA 3W7EA 5EY5A 1KTBA 1AJZA 3DX5A 3WFZA 4US5D 1H0IA 3MHFA 4FOUA 4O17A 1KBKA 2X7VA 3RX4A 3RRAA 2HSAA 9XIMA 3BE7A 1VCVA 1IE7C 3FSUA 4EOUA 2ANUA 5GQBA 2VFHA 4NNBA 1JFHA 3TFCA 1J0KA 2NUYA 3RM8A 3DI1A 3KCJA 1W1B1 1WPCA 4TU1A 2NXGA 3A24A 3RRXA 4NYUA 3KBMA 3B8UA 3PUGA 5A8NA 4HB7A 1HKKA 1QW9A 1KWKA 4A3RA 4G56A 4GNVA 3ZQ9A 3FAXA 5EFDA 1ZY9A 4U33A 1TWDA 2FPYA 4FNPA 2GSJA 3TOPA 4PC8A 4HHHA 4U4MA 4JHZA 3TC6A 3WNOA 2NT0A 1RJRA 4MUZA 1WDDA 1IWBA 1VF8A 2DZXA 1XLBA 3WD1A 4GYJA 4RX0A 4KRUA 1OQFA 1MO0A 4QJ4B 3BOXA 3B06A 2BXYA 2WMFA 3OGSA 1Y0EA 3PPCA 4LW7A 1KXHA 1WB0A 3N4EA 3G24A 1UROA 3DGBA 4GO9A 2H8ZA 4LS0A 2VM8A 4W8AA 2DGAA 4GKTA 5AHMA 3HV9A 3OHIA 1BRLB 4GCAA 2A3EA 4HBKA 1IYXA 3B9EA 1QNSA 1UHVA 2BSLA 1XDLA 1OGSA 4FB7A 2BDQA 1B3ZA 1RUSA 4O11A 3OBAA 1QHPA 5E9XA 1OABA 2Y89A 2ZX8A 4LV9A 3WD2A 4MAVA 1YPFA 3CV2A 2XSXA 1EA0A 3DG7A 4BQ5A 2Q3OA 4G2DA 1WYIA 4FXFA 1CGUA 3C0JA 1KV8A 4H7VA 4OUIA 4TV5A 3TONA 2RH9A 2V5BA 4E4PA 4QEHA 5TIMA 4MNMA 1XUUA 1I1XA 1EJSC 3HURA 2OO6A 4OT7A 3CU2A 1JGMA 3O0KA 2DW6A 5U7SA 3P14A 2C0HA 4DWDA 1F6KA 1YBQB 4FIQA 3BV4A 4IGHA 3VNDA 4MKVA 3W7HA 1J0ZA 2DT0A 4L80A 1JGIA 3VMPA 2ZRUA 3BJFA 2PGRA 5LNUA 4GUFA 4UNKA 2CEQA 4IIHA 1KM4A 1TZ7A 1XGZA 3B0PA 1S2TA 2E9LA 3RU8X 1LOLA 1UR4A 1DL3A 1LRNA 3IK2A 3S83A 4JOMA 4JFTA 3B0VC 1GNXA 3HA1A 5C55A 1K8YA 3C3UA 3BUVA 1UA7A 4TMCA 4XVEA 1R3RA 4UWMA 3TEVA 2FTWA 3UY8A 5G1TA 3WNPA 4AZ5A 1LORA 5B7ZA 3MW7A 1J18A 4S2CA 5PTDA 2X16A 3MT1A 3TYCA 3EWUA 4F2UA 2Z00A 4G7EB 5ABGA 3KCOA 3OG2A 3GTNA 3LRLA 2OWWA 2EPLX 3WMCA 3RPDA 1P6BA 5HPCA 4MJZA 3PAJA 1FTXA 4GGHA 4J7RA 1HXJA 1SJBA 3M64A 5GJNA 3SN1A 4A29A 5E70A 5BNKA 3T0AA 4H6KA 4ADSA 3MO4A 5AYXA 3KOZA 3A22A 5LA0A 1EUAA 4P8UA 1RP9A 3FSTA 4LYPA 4A22A 4XB3A 4CNNA 1YNYA 1UCWA 3HGJA 4XUGA 1IGSA 4DIAA 4CEUC 1WKEA 1IIHA 4C60A 1XQLA 5DXXA 2DT2A 3ZJKA 2CFFA 1X7FA 1CGTA 2VX7A 4AISA 2Q09A 1IZKA 1OSEA 3WBEA 1HGYA 2WKGA 4ZOCA 2PA6A 5C0QA 1W31A 4Q4KA 1W3HA 4TX6A 2WZEA 3AHYA 4AZCA 4LYKA 3CJPA 4JIPA 3K2GA 1E6SM 3C86A 3QY6A 3UXDA 3VO0A 1D7FA 3DBPA 4GYPA 3F1QA 1ZPTA 2RDWA 3E74A 5AHFA 3H70A 2GGIA 3IRSA 1CDGA 3RITA 1WZLA 2ZWYA 4MB4A 3H12A 4EVZA 1JCTA 3GG1A 4NVTA 4GH1A 4FR6A 1W2PA 1GYLA 3V0UA 2ZX5A 4AY7A 5EGRA 4NAFB 5C9XA 3P67A 4HNTA 1WDWA 2QR6A 3O6DA 1E6XM 2CIPA 4M6VA 1BF6A 3QXBA 2HEJA 3PN8A 1TX0A 1W91A 3NZQA 3WH9A 1H3GA 2XM2A 2PBGA 3AXMA 1EJWC 3BMXA 1QPRA 2DUAA 3CV1A 4L4OA 2X05A 2C79A 4U2ZA 3GYCA 5HJYA 1XRFA 1THFD 4C6BA 3EOOA 3SCNA 1JUEA 1VFMA 4LBRA 3A4XA 4X63A 3AMKA 1ZBKA 2DFAA 3SGUA 3V1PA 4LVFA 3RCNA 3B05A 1GJUA 4UC5A 1JR1A 5CPOA 4CUCA 1S2CA 1SFLA 1NWUA 5JUVA 1DQWA 4MLRA 4J1OA 1TMLA 4Y2WA 1F3TA 2PDPA 3QOKA 4B5UA 3BSGA 2DY3A 1UR9A 4H04A 4F0KA 4LOCA 3P80A 1H5VA 1MZHA 1KGXA 1NELA 2QIWA 4UIOA 1C29A 5I00A 4MZYA 1GKQA 2NQLA 1S38A 4O19A 1NDWA 2P88A 5T8GA 3QMTA 3KX6A 1TTJA 2NV9A 2FHBA 3PBWA 4J27A 1VBUA 4H6RA 1EZWA 1MEHA 2ISFA 4YS1A 1GTEA 1C91A 3EXRA 1EQCA 1LG2A 3V0SA 4U2YA 3BAYA 4UTKA 2G3IA 2R14A 1JL8A 3FLUA 3TK7A 3QEZA 3CAVA 4ENLA 3NSXA 5TQLA 2O9RA 2OCZA 5D05A 3SCVA 3FFSA 3OOQA 4PSRA 1XLHA 3LA4A 4HHMA 5A6BA 1OB0A 1JZ6A 3IV8A 3B97A 1Q6FA 3WF2A 3B0UX 4N0RA 3BCFA 3BJTA 3G0UA 2WCGA 2EXOA 3WLIA 5IBXC 3CZ8A 4YTTA 1FBAA 1Q66A 2WSQA 3W74A 5DRIA 1A0CA 3ABZA 2NQ5A 3AXHA 1BYBA 4MDOA 3NXFA 4FXJA 2FPTA 5GNYA 2DIEA 3I65A 3RLVA 5CPTA 3W2JA 4IPNB 3DBNA 1EXBA 2ON3A 4PA8A 2JFEX 5D38A 3W1PA 5DT5A 2PGWA 1E71M 5I03A 1K7FA 2RKXA 3S6OA 4A8IA 5DXYA 2WMJA 1YKWA 2X8RA 4WDWA 3ONBA 1I60A 4DNHA 4DX3A 3GO2A 3INPA 3L9CA 2ZE0A 1E0TA 2AOSA 2H3BA 3HG5A 2QPXA 4G1NA 5DX7A 2QCHA 2XIMA 3E2SA 5BMXA 4DJEA 3MSGA 4C7GA 1GONA 5C70A 4TIMA 4XZNX 3CIWA 3VNMA 2Z1BA 3QRHA 3N3MA 1W8SA 2BY0A 1PYMA 7ENLA 4TX8A 4JTTA 1NDVA 8TIMA 3AZTA 1UMYA 1N8IA 4EP8C 1UR2A 2Q02A 3W7DA 4H6EA 4I3GA 3PFRA 4L64A 5I5RA 1KM1A 3SN4A 1E0VA 1HFBA 2WO5A 1H49A 1DHKA 1LQ2A 3VNJA 5HQMA 3QKZA 3E2QA 1JDCA 1WDRA 3VX1A 4L9YA 1PX3A 5CPSA 4JBRA 4XZBA 1NOUA 4E8DA 3W88A 4Q22A 2DZPA 4GJIA 1CPUA 3GXDA 5KZDA 3HFYA 4J3TA 2EJ1A 3H22A 3ARSA 5LSMA 1YDNA 3H24A 4LT9A 5LIXX 4QNWA 5LIUX 3WQOA 4H7ZA 4JYDA 3GR8A 1ITCA 5I7GA 2POTA 4XAYA 4UTJA 3RR4A 2XWEA 4FF5A 2Y70A 4Y8FA 2PLMA 3HZ3A 3TNBA 1XIMA 4GO8A 3W1TA 4PZVA 1FVPA 2V2DA 4NI8A 5A2CA 2WQDA 3OYXA 2W66A 3R5EA 3NR0A 3WJWA 4R33A 4A8NA 4LUYA 1TA3A 3D0CA 3F4VA 1KQYA 3PC0A 2YBVA 4Z1YA 4CCEA 2PGFA 1WKDA 4POCA 3T4WA 2FFCA 2DJXA 2YCLA 3JZEA 2C13A 5C6MA 4JKMA 5LGXA 3LHZA 4GJ1A 3E5PA 1TMHA 1V3HA 3LN3A 4A3YA 6TIMA 1H5YA 5FJIA 2ZUWA 1RCOB 4GI4A 1AK5A 3T8QA 2Z4GA 2VDIA 1UWQA 1C9WA 2QJJA 1F5ZA 5BWAA 4JDBA 2XHYA 3B9OA 2R9RA 1H7XA 4DBEA 5CGMA 2QJMA 3L7RA 4MDPA 5I77A 5EBAA 3EPOA 4QNEA 2G96A 4KWWA 1TWSA 1I0BA 3GVQA 5FEWA 3GH5A 5HMDA 3GM8A 3WNKA 3QM3A 2GSEA 1V6VA 3WQ8A 1FOBA 3B8SA 3NM3A 1F8IA 4W84A 3BAWA 3M5YA 3HOJA 3R4IA 5DCDA 2J8TA 4GOAA 3WBWA 1AW5A 3QPYA 3GXIA 3VKAA 4KEUA 3SQSA 3W85A 2XM1A 3UA4A 3URBA 1OX5A 2ADAA 4H9ZA 4KWVA 1IQ8A 3U48A 1ZZMA 4C1NB 2VURA 3AOFA 3CMGA 1UUQA 4AEFA 3AIBA 3GS6A 1HKMA 4HCDA 4Y96A 1TRIA 3WLMA 2CLEA 4Z0SA 3SCWA 3BLPX 1GPFA 2J47A 4ZXOA 3IWPA 4HK7A 2YL8A 3SFKA 1JPMA 1PWMA 3QY7A 1C8VA 4H9MA 1OGBA 3WLJA 3AU2A 3CC1A 3SUTA 1H1NA 1KLZA 2H9AA 3W22A 2VEMA 4BQ3A 5LA1A 3P3BA 3O8AA 5TAOA 2E68A 4A6GA 2BOGX 3N6HA 4O50A 3F2CA 5H91A 1D3GA 5A8GA 3ZVHA 3TC3A 4JD4A 3U2EA 3VIIA 1TR1A 4B9YA 3PBYA 1NP2A 3AMLA 3DHFA 4I9AA 3DEQA 4Q8MA 1K9TA 4AD4A 1X8FA 1P6CA 1SPQA 3A64A 3WUEA 4D6EA 3BQ6A 1HF6A 2ISSA 3TJIA 1H2JA 1PV8A 1QWKA 1Q13A 3B8VA 1A80A 1VZWA 1GG0A 3E0WA 5D9NA 4ZO9A 1DJQA 1IT8A 2HBVA 2QUTA 2V3DA 3ARXA 4AD3A 2E1DA 2FHCA 4UFIA 4DJFD 3ICJA 4F0HA 3I4EA 4JTEA 1XI3A 3F5KA 3PK7A 3TWAA 4V33A 1HUVA 3GIQA 2WW5A 4UQEA 1LM1A 2E9MA 4ZEPA 1BYDA 4V15A 4AIUA 1WXYA 1H41A 4XD6A 2VI0A 5FF3A 2EG8A 3K30A 3NVDA 3O9NA 3SQLA 3XINA 3SRDA 4UTTA 2INEA 1U1UA 4F2TA 4M6PA 4HGXA 3M0JA 5EYWA 2R1KA 4KCTA 1L9WA 4N4QA 1LLWA 4N4PA 3VMNA 4UNIA 1P48A 3WFAA 3N2TA 1H11A 1F3WA 4JTQA 2TPSA 4H83A 4IP7A 4LH8A 4NILA 1LCOA 3L0NA 2TMDA 3TYAA 1K4GA 3R8HA 1F61A 3QGAC 3UZJA 2Q8XA 3ANYA 2P10A 4Z2KA 3HPZA 2WZIA 4HSHA 3V7PA 4GCXA 2GQ3A 1YW1A 4OTKA 4GQRA 2W63A 4HZ6A 1LOQA 3MI2A 1QFEA 2CXGA 1BVZA 3M41A 3CV7A 2PZ0A 2B0MA 1M3UA 1EOKA 2XSAA 4MY9A 3TMLA 4EAYA 3S1WA 3UPBA 5DY2A 1IIGA 4DBDA 4GQ0A 1P6WA 2O7QA 3UYIA 1E4IA 4PRTA 4XIAA 1SSDA 2E25A 4XAZA 5JQ9A 1W3NA 1JQXA 4FNTA 2F38A 1ISVA 1PE1A 3CM4A 3FDKA 3MKCA 4HKPA 4QDWA 2CKSA 3ZS4A 1J01A 2OT0A 3SJNA 3VDHA 4GD0A 2TYSA 2HK1A 2OELA 2VKZG 2NSXA 1W32A 4HOXA 3LMYA 3SCQA 3PWIA 4LC8A 4W85A 4Q8QA 2FDMA 1UD4A 1XX1A 3MUCA 1QJWA 2ZRWA 1LG1A 3IJ8A 3WK2A 1LRTA 4QE1A 3KVKA 1VCGA 1XUZA 3RU6A 4DBWA 3STGA 2V2HA 3PJXA 4LAUA 1K8ZA 1EC8A 3GVVA 3GH7A 3VIHA 4J35A 1X38A 3WMSA 1BYAA 2SFPA 4PMUA 3NPUA 4ONVA 2XFFA 2PU0A 1WXJA 3SUUA 4BEQA 4M56A 4DWSB 5FESA 5IHSA 1C8XA 1EJRC 3F5LA 2ZXQA 2QMJA 4IMCA 1WNOA 2Y5JA 2CHOA 3URQA 1M7PA 1D2KA 3B9NA 4Q8VA 2YR1A 2Z6IA 5HANA 3SSZA 2X1SA 4IPIA 1FP8A 4U3AA 5H6HA 4M3PA 3OA3A 4JZ5A 2XN0A 3EWYA 2YZ5A 1L2QA 3GUWA 5FSEC 1HKIA 3Q37A 1UWTA 4KEMA 3HFTA 5F2IA 1MYRA 3HQ1A 1B90A 2FH6A 1E9IA 2BMBA 2BWGA 3CQJA 3PANA 4W7UA 4CNOA 3W2LA 1L8NA 1Z9AA 2BB0A 5REQB 1SMAA 4E3TA 2R94A 3MUAA 3W6LA 2B31A 4HCLA 2QZRA 3UFYA 5HJXA 4WY0B 2FYMA 3UD6A 5I0DA 2VRQA 4HU0A 4ICCX 2IPGA 4TTGA 2Y5EA 3PTQA 2R1MA 2HS6A 4ACZB 3CAKA 2W4XA 3VI2A 1EL3A 4GI6A 2NWRA 4DLMA 3NCOA 3LXCA 2WQPA 5D33A 1VEMA 4D71A 3CO8A 1VGAA 3E1F1 1U5HA 3TJLA 4JL2A 2GJPA 4EWJA 1ZCOA 2WBKA 6REQA 2WC3A 4DI9A 5BRPA 3P2VA 2RDUA 2VDHA 4YLWA 1XQKA 2ZFAA 2RGLA 3IIOA 4M5PA 3ZLFA 2D20A 5F4WA 5TBOA 1R2RA 4CNTA 2VGBA 3BH4A 2VYOA 2A79A 4X2RA 5D03A 3M5ZA 1YTDA 5B7YA 1VFFA 2OWCA 1US2A 1PSCA 4MJMA 5IRPA 3JRKA 4XAGA 4AZGA 3RM4A 3W1NA 3S2NA 2QV5A 2F9RA 4O8RA 2JIWA 1O5QA 2QDHA 4BA0A 3LHTA 2B81A 4AF0A 3BC9A 1QK2A 1SSGA 4QCEA 3ARTA 4UNLA 3P82A 3FX4A 1X1ZA 1TE1A 3PNUA 5E6ZA 5C5YA 4RLIA 3QGKC 1SW3A 3U5YA 3S2CA 3SCOA 3OVPA 2AMGA 1ZS2A 1HX0A 4DQWA 3RM9A 3R13A 1KB3A 1KM2A 2Z2UA 2KAUC 1V5XA 1E70M 3OZPA 3REQA 4DNMA 2PDIA 3GIPA 3KLKA 5CG0A 2YCJA 3E0LA 5G4HC 3NQ8A 2QJGA 3G1VA 4D1IA 1DWHM 5C7HA 3SUWA 2JKEA 1AZ1A 1PZ3A 1YXDA 3BW2A 4ATLA 3A12A 4M6QA 4ROPA 2Q71A 1FWSA 3GW0A 3IJLA 3TU9A 4IIDA 5JH1A 6ENLA 3BV7A 4WZHA 4JTFA 3KRSA 4ZOBA 3HQNA 4OV4A 4JTKA 1DJHA 1IEXA 3UT0A 4I8DA 1QNVA 1R2TA 3OLGA 1ME8A 1H0GA 4A3HA 4EKJA 1BQGA 1OFEA 1W9XA 5BMWA 1ZJBA 1TSIA 3W86A 3XIMA 1Q6RA 2ACUA 1RBLA 3FYYA 4QE5A 3I3DA 1TWWA 3LOTA 1XLCA 3MQTA 4IQLA 3H2NA 3R11A 2CBVA 3GNDA 4GNKB 4PUUA 2GVEA 3W2MA 2F61A 4XAFA 3AXIA 1NWRA 2XU2A 5JBEA 1NDZA 4XSMA 4TX9A 1VPYA 3B4UA 5DO8A 2PD9A 1RQEA 1SMDA 2IPFA 5A8PA 5E0CA 2BVWA 3V5CA 2VC9A 1A47A 1ADDA 2VEPA 3S9YA 1P0BA 3TLQA 1B9BA 3EX4A 1JPDX 3U57A 4LY8A 3GG0A 2HNEA 4YTUA 4B5TA 1MW0A 4ZODA 2REQB 2O92A 3IANA 1GK8A 3WLHA 1F76A 3BLDA 1JI1A 3SURA 1WKYA 1C7SA 5IHRA 2W3ZA 5JH2A 5HR7A 2XISA 3GDTA 4LCSA 1I45A 3ITTA 3S9IA 1A50A 5HNNA 3BL3A 4AWUA 2GQ8A 1HTIA 2GWNA 4M1RA 3L4TA 2J7HA 5FF2A 3DENA 2D0HA 4PCTA 3DFHA 4LUJA 3IVTA 3AMGA 1EGZA 3ZT6A 3S42A 1J8VA 3EWBX 4AB4A 2Z1VA 3DESA 1FWFC 1G1YA 2OOGA 3RNDA 1OCJA 3BG9A 4K8GA 2BHUA 1QI4A 3E0IA 1Z44A 4B2DD 3A13A 1MI3A 1AW2A 2WNQA 4HN8A 2VFGA 1KBIA 4MHBA 4YHGA 4WF7A 3S8HA 3VD7A 4N9CA 3UJ2A 4Q6XA 2V2CA 4LAZA 3LRKA 4IGNA 3EYPA 3IUHA 3IIVA 1DWAM 6ALDA 3LHWA 5D8ZA 3GVRA 1E9YB 2PTYA 2P53A 1R85A 3CWOX 5K4ZA 1SU5A 1QBBA 4IMAA 5G1MA 1LF1A 4XTDA 3KS6A 4JTDA 2XINA 3RAOA 3EWXA 4E4UA 2IKGA 1OIMA 2PTWA 4BHYA 2D23A 3C52A 3TR2A 3VC6A 5JMUA 4R5EA 3UNDA 3VIKA 3F2DA 3MA8A 5D32A 5LNVA 3JR2A 3S6DA 4S3EA 4CD7A 2CERA 1SJCA 3C0LA 2P1FA 3F4CA 1UD8A 4GYFA 2QQ6A 4XUYA 2OKTA 3C56A 4C6JA 4W87A 2V30A 1C3FA 1RQBA 4GQQA 4LS1A 1TCDA 3JS3A 2GJLA 3W2NA 6CGTA 4LUSA 2I7GA 5I79A 5LIKX 1PVNA 1TV2A 3ABSA 3ID7A 4RKAA 1JZ8A 2WJFA 1EHNA 5C2GA 3WD0A 2IKHA 3S9ZA 4I5RA 2CHRA 4Q6JA 2FZMA 3CH9A 1REQA 1JRBA 4L56A 4GZEA 5KZMA 4W8BA 3VILA 4ACYA 1TV5A 1QAPA 1E51A 1HL9A 1AL7A 5D2YA 4FOKA 2F8QA 1VFTA 4JDYA 3MKKA 1HO4A 3HN3A 2NLYA 4KGJA 2INFA 1Y8BA 3EMCA 1R47A 2CKRA 4WDUA 3UWZA 4G8TA 3FVDA 4ADUA 3GXTA 1XSIA 5DMNA 3CO4A 1S5TA 3I68A 4K37A 5AC7A 4GYPC 2PWHA 4S2BA 1GVIA 5HXMA 2DQWA 3PHAA 3SRHA 3T1GA 1N55A 1S2AA 1G94A 3ZOAA 4P7NA 1WX0A 5EMLA 1H7RA 4CCZA 2WPGA 1TRDA 3KDOA 1UBPC 1AD1A 2WZHA 5HUOA 4WJEA 1K77A 3FYPA 3NYDA 4D6GA 4NZJA 5I3IA 2E40A 4KRZA 4I7UA 3IIZA 7ODCA 3AYVA 4UTWA 2W91A 3C3NA 4GK8A 4JFWA 1EUNA 4PCPA 3HIJA 3HPFA 2ABAA 3M0XA 4UQ9A 1Q6OA 4GYKA 4H8UA 1DP0A 4KWSA 1IF2A 3C0SA 1MNZA 4YN5A 3R58A 1TYGA 2NX1A 3C2FA 1BGGA 3EDJA 1XLIA 2VD8A 3HPAA 4V1YA 1XF0A 1Q6GA 3G1FA 2EKGA 1RCXB 3WNMA 3W23A 4YYCA 4PUDA 3BMWA 2VGFA 1YQ2A 3LCHA 1HNYA 2I9EA 3N17A 3M47A 1XIJA 2BXZA 1XG3A 2W67A 4JR5A 1P4CA 1FRBA 4YVVA 4JTSA 1K03A 1BXBA 2YDSA 1XFCA 3G2GA 1DEDA 3MCOA 4Z0JA 4HHPA 3GB6A 1V8EA 1JDAA 3VABA 2JEPA 4GUHA 2J7FA 4HT3A 4Z1CA 4US5A 3LMZA 4JQ3A 1K6WA 2CNCA 2C15A 1TIMA 2DZAA 3G1HA 1QUMA 2ZBTA 4QJ1A 2UY5A 1TCMA 1PAMA 5HBFA 1QHZA 3KBNA 2Y62A 2FZNA 1PIFA 1MRQA 4R88A 5DFAA 3CXOA 4S1FA 4CEXC 1VIWA 3LU2A 1UZDA 1R30A 5TF0A 1HJUA 3LUTA 1DIOA 3TJ4A 2HV5A 4IIFA 3C2OA 1R3VA 1DV7A 4UR7A 5EMJA 4EPDC 4AC1X 4JN7A 3DKJA 3UG8A 3AIQA 2E4TA 1G0CA 3B8TA 3I7SA 3U9IA 3D6NA 1H1YA 3KHDA 1FHVA 3V4BA 4KPLA 5L6UA 1AFSA 2ZICA 4MPQA 2VRKA 1FXPA 2EJAA 1XBXA 3AWNA 3EOEA 3B0XA 1P43A 2CZFA 2VGGA 1OY0A 3FNDA 1D3HA 1UQZA 4F8XA 4AY8A 3E2VA 4WKAA 4CQCA 3OTRA 2AL1A 3QYQA 2ZUTA 3UU0A 2KZHA 3LEPA 1AQMA 3S5OA 3H26A 5DMMA 4CQDA 5FJPA 3GC5A 4CQ8A 3WK1A 6PTDA 3AIVA 2QIIA 1XRTA 3LENA 1HKJA 3ZR6A 3ORWA 1T41A 2F84A 2RDXA 4XVDA 4IX0A 3VGHA 2FB2A 2DVXA 3LBCA 4L1GA 4IFRA 4NASA 4BWLA 4WK9A 3HG2A 3FKKA 3RJYA 1JD7A 3THCA 4Q8TA 3TN4A 2ONEA 2W62A 1BSIA 1I2PA 2E3ZA 1CENA 2PRLA 2Y5SA 4NAEA 3BDKA 1OFPA 4ZO7A 4OOZA 2GVYA 4QGCA 4MNJA 1YXCA 5EMUA 5CLTA 2VEIA 2QGHA 4KT2A 5GNZA 4AZBA 1UD5A 1F9CA 4QS6A 4NZ3A 3GXMA 1SFJA 3K8KA 4MF4A 3ZJ8A 1R3TA 4DJEC 5TNVA 5KTLA 4JTGA 3QLLA 1YE6A 3LCWA 3CPGA 4O1AA 1E55A 2FB3A 4QISA 3KOWA 2A7NA 3OVRA 4KRTA 4K2SA 3H2FA 1GQJA 4O28A 3FS2A 3N9RA 4MY8A 1KM0A 2WHKA 2XDFA 1V51A 3GU1A 4O52A 2JGYA 1X98A 4NXSA 3UWVA 4W86A 2ZX9A 4JIIX 3G0SA 3NG3A 1SQ7A 3CIXA 1PS9A 4HN4A 4LCRA 2FVKA 3PZTA 4L6HA 4QJ5B 3DH7A 4IH3A 3ANUA 1XLAA 4ATWA 4B5SA 4J3WA 3CWNA 5IOBA 2VGIA 3UWWA 4D6HA 1B3YA 1VD6A 1KR1A 3W25A 1TJ1A 2C91A 5C9RA 4H6QA 2HE8A 3WDRA 2DJLA 3IVUA 4FX8A 4HK5A 2IUZA 1EO5A 4HMCA 5LYRA 3TYBA 4JGDA 5BXPA 1YPIA 3W7QA 1IR2A 3UZXA 3LPGA 2D2OA 1TJRA 4H1ZA 3MSDA 1DJGA 5AYYA 4M0XA 4FALA 1CECA 1DJIA 3GUGA 1QW7A 1X7IA 4FX6M 4YVXA 3UQNA 3VZXA 3AALA 2WCAA 4WKFA 2AKMA 2EPHA 3UG4A 1UQYA 4D6DA 4NNCA 5DT7A 3WYZA 3TLLA 4G7FA 3WQCA 3TAKA 3LQLA 3UWUA 1DWGM 4CCCA 3ARPA 3H55A 5T91A 4B3KA 4DUVA 3DHUA 3T55A 2ZTKA 4LF1A 3VUPA 1V93A 4A8LA 3U2ZA 2CETA 1IWPA 4FLRA 1XYMA 4HD5A 4IL2A 4NSBA 4NJIA 3AZSA 1E5NA 1QNPA 1JDFA 3GBDA 1K3UA 2HZGA 4GXPA 5F7UA 1IT0A 3TN3A 1VFUA 4JIEA 2BASA 1F6YA 7CGTA 1UD3A 1RZMA 4N9DA 3RMJA 1UPPA 2HVOA 4RXFA 4AIBA 2G3JA 3KOYA 3B3DA 1ECQA 1JEZA 5A94A 3W0KA 4JN6A 1S5NA 3KAOA 3WK3A 1VBGA 4D8LA 1RXOB 2CZVA 3GR4A 1G7VA 3PZMA 8CGTA 3MU7A 6XIAA 1CLXA 4JTIA 5AHLA 1E0WA 1XD1A 3THDA 1CLVA 4K68A 2CWXA 4AZHA 5DBUA 1A5NC 5E93A 5F4XA 3PM6A 5CKSA 3WQGA 2QEZA 2HMCA 2YIHA 5BU6A 4IGSA 4UQBA 2HPMA 2PP0A 4Q8WA 4LY4A 4PMQA 5HQLA 1VS1A 5FL1A 3SCPA 5BCAA 1QNOA 3C2YA 4AHQA 4AWEA 5BXSA 3R6IA 2CLLA 2WJZA 3O0FA 2DU2A 3C2VA 1LQAA 4MB5A 1VHNA 5ABFA 4PUWA 3UEQA 2CLFA 3BWWA 2Y6ZA 2QDEA 2VP8A 2AMXA 1VEOA 5E09A 3ITOA 1GZJA 1K6AA 2I14A 5I09A 4TR9A 1YPXA 5AKQA 3T40A 3PY2A 1W9BM 2X41A 4YJ5A 4FAMA 3H21A 5FJTA 3VIMA 3NZPA 4D9PA 1KD0A 3L5AA 1IWAA 3HF3A 1GVEA 3WDIA 3L68A 2Y0FA 4MOZA 3EX3A 2ABBA 3WX7A 5CSUA 4LF2A 4UBPC 3HG4A 3OPSA 1P0KA 3WDPP 2EQDA 3CEUA 3QLDA 3C5QA 3TZNA 1YXYA 3NO1A 2YB1A 1A0DA 4EWND 1EQPA 3CZKA 1V6WA 2OR2A 3TYUA 4QX4A 2OVLA 2Y24A 1BGAA 3EAUA 2GDUA 3CUZA 3UCDA 2WC7A 2F7FA 3NQ2A 4HPHA 3DFYA 1KXTA 3M7SA 4DPPA 5IFPA 1DYSA 2CXEA 1AD4A 4WUIA 3NEVA 1HL2A 5AVNA 4GX8A 1TG7A 3MMTA 5H8PA 1DE6A 3WF0A 2YCKX 2IS7A 4CQBA 1UR0A 3LM7A 4C6OA 1S1RA 3NQBA 3VDCA 2VZTA 3GR7A 2B7OA 4HNOA 4YU1A 3V1HA 3GXFA 3TQ0A 1SW7A 5LIWX 1CB2A 4HU8A 4DHGA 3QKEA 4K6AA 3AS2A 5AFDA 4KMQA 5DMYA 3TTEA 4ILSA 1OX4A 5D9OA 3EOSA 1OADA 3PWGA 2V38A 3UPWA 1BG9A 3SRFA 4H9VA 4PMDA 4LXFA 1E1CB 4UTTC 4P8XA 3L67A 2J77A 4GINA 1UIPA 3PJUA 1GOXA 1J96A 3SN0A 1CCWB 2VOMA 3QBUA 3S1GA 4FOJA 3A6OA 1KCZA 1W3TA 3UERA 2BG5A 3W9ZA 5K9DA 1WQ5A 3GHRA 3LBMA 3PNZA 3PAOA 1UP0A 3QSRA 3W1RA 3CZLA 3LCIA 1U1JA 1VP5A 1ESWA 3O05A 4R7JA 3W01A 4MVAA 2WZTA 2QCDB 2BY1A 1NIUA 1GVFA 3TA6A 3W7NA 3DHDA 1W9VA 2IKJA 4I9TA 1DTNA 3DG6A 2ISDA 2X0SA 3FA4A 2AL2B 1GTHA 1S3TC 4CVUA 3K1GA 3PZVA 5KZEA 1TPWA 4J2MA 2WM0A 2JBMA 3GZ3A 4FMVA 3JW7A 4FA3A 4W5UA 4F48A 2YLLA 3N34A 4LUTB 1QXLA 1E9ZB 3N1AA 4WJ8A 3AIUA 5C7VA 4M80A 1I2NA 2FIQA 2BBFA 1M7JA 3PR2A 3KCLA 3VPLA 4AY1A 4UZUA 1PTGA 1L6GA 1ZTVA 1F2JA 3GFXA 1XLEA 5DN1A 1ZENA 5HQEA 1RA0A 3KHJA 3QW3A 4I9MA 1F07A 3OQ8A 4U10A 3D3AA 4XZ9A 3TJXA 3NZGA 2P8BA 2CU0A 1EC7A 1CI1A 1DKWA 3U5UA 2BY2A 3WBXA 4IZGA 4DAFA 2PWGA 3CTTA 1C8YA 4UFHA 1OFBA 3WQWA 1R3WA 4C6KA 3XISA 1WBJA 5HUPA 2VNCA 1MFVA 4OOUA 2OZ3A 4AZIA 7REQB 1U83A 2V3GA 2WB5A 4A4AA 2Y88A 1XYZA 4XD3A 3OP2A 3EA3A 3W53A 2ZRYA 3OLEA 1YX1A 4O4VA 4R53A 1U5VA 1MEWA 3QGVA 4RE3A 3TOYA 3MBDA 4HPGA 4LEFA 4GI8A 4GI9A 3O6CA 4UMAA 1EEPA 4J40A 4AWTA 1FFQA 1EIXA 1BD0A 3ZO9A 4AMCA 2GOKA 1HVXA 2BGSA 1QATA 4OBTA 2YDQA 4CQAA 2PDYA 1KR0A 3J7HA 3WMLA 1XIDA 2QJIA 3E0FA 4X9SA 3UVAA 4JNMA 4ATDA 3QFEA 3N13A 1CNVA 2YBTA 3UG3A 2OYMA 2HVNA 2PC8A 4LRSA 4OU1A 4UUIA 4QQ3A 4CD4A 1E6PA 3ZLHA 2V6AA 3CB3A 2QNEA 2CLKA 5HK4A 3U2CA 3MCNA 3L4UA 4R9OA 4URIA 3ZR4A 3SY5A 3EWZA 2NLIA 3VVGA 1DQXA 1GVRA 1T8QA 3LD5A 4XQ6A 2CLPA 5CBIA 2BY3A 2PDLA 3DYMA 4MYAA 5A8QA 1QR7A 2QAFA 3LNPA 2YPIA 4IX2A 1OF6A 3M0ZA 1JZ3A 2PLKA 4HPNA 3PZ9A 1WZKA 4ZO6A 1MFUA 2E67A 1GQKA 3AMDA 3DIPA 2PD5A 1TJPA 2WM1A 2YW3A 4MM1A 3VNKA 2VFDA 1LDCA 1DXIA 3U6WA 5AHEA 4O1FA 1G69A 3LK6A 1GW1A 3RX2A 3O7UA 4CU8A 1GVOA 1XW8A 1GOQA 5CPLA 2ZRXA 3VD3A 4C1KA 1KM3A 1NWSA 4QG6A 2OEKA 1XKYA 4AWSA 4MG4A 3N29A 1EKOA 3PTKA 3UETA 2XVGA 3VIOA 1IR1A 1M6JA 4JNZA 1VENA 1KBJA 1Z7AA 1X6NA 1AUSL 3MMUA 1W1PA 4P7QA 4O57A 1FP9A 1QPOA 4NUWA 3FJLA 2NV1A 4Z1AA 1LLOA 2HK0A 2NSOA 1TIWA 3Q2DA 3BGJA 2RUSA 1A5CA 2QGYA 2Z26A 1FUYA 3UJRA 3QF0A 2TAAA 2ZUUA 4Y9PA 4F0LA 3AIRA 4YWIA 4JX6A 4L4MA 4GA8A 3IGSA 4H8HA 4IOTA 1XGDA 5I24A 2CPUA 3CHDA 4GIEA 3POHA 4D1JA 4IQEA 4Y8EA 2FGLA 1HZYA 3MYPA 1YLVA 3SEPA 3AIWA 1US0A 4UTUA 3PJTA 2QMKA 3CWHA 1GUVA 3ARZA 2QT3A 1HJVA 2JALA 3W73A 1KGWA 3W2UA 3LGEA 1US3A 2UBPC 4EIVA 7XIMA 1Z6KA 5HULA 3VIGA 4JHMA 3NYZA 3IAPA 2WC4A 4K38A 3W1LA 4RDWA 1TV3A 1X6LA 4O0QA 2WVVB 3OGRA 2J9YA 1GHRA 4UTFA 2YBUA 4O54A 2D2JA 3ARYA 4E2DA 1J6OA 3N2CA 4S39A 1E15A 2J7CA 1NAL1 1POKA 4UR8A 1YNPA 1GOMA 4DJFA 1Q7MA 3O6AA 2QULA 2FQIA 4HNUA 1OJXA 3AJXA 4PMZA 1E56A 1RCQA 4MUPA 2FZ9A 4NHVA 4RW5A 7PTDA 4JIRA 4DZIA 3BSMA 3TTOA 1WO2A 3APTA 1MXGA 4MZ1A 1Q6EA 3EBVA 3NUKA 4ZSUA 1RY8A 2XH4A 3DFNA 3EXTA 1IEWA 1YE4A 4GFSA 2OZ0A 4DUWA 1ZALA 1H7PA 4GQGA 2WKLA 3VOHA 3L21A 3PBVA 4RV3A 3T08A 1PX4A 2IQDA 1T40A 4RDVA 3PZQA 1E4LA 4O0ZA 3UWEA 2YL9A 1AJ0A 3ZMRA 5A5WA 4PMOA 3EA2A 4X0NA 4Y90A 1S2VA 3TX9A 4TXEA 5AC5A 5B80A 3MHUA 3UXIA 1OHLA 3W7IA 2GL5A 4D72A 3M7WA 1JDDA 3FA3A 2ZC1A 1WCGA 1P1MA 4NZ4A 3A3HA 2ZOXA 1HQTA 5BWFA 3R8GA 3GTHA 5BROA 4HIBA 1XLDA 3OEXA 4Z08A 1UWIA 3DYOA 5CGTA 4S3CA 3GDKA 5H8MA 3QR3A 1UP3A 3DHPA 4V1XA 4IPJA 4RZ6A 3H7VA 4XZLX 1OT2A 4JAWA 1U30A 2DV0A 1BRLA 3QZEA 3WF3A 2D1ZA 1DBTA 1LBFA 1HGWA 4HTBA 2EEXA 1UB3A 3M0KA 4UXDA 3KZPA 4W7WA 1TREA 3VAVA 2NQZA 4LWWA 3HU7A 5G1YA 2VR2A 3FV9A 3ANVA 1FDJA 3BCDA 3EB4A 1FCBA 4MLJA 5HNUA 2QW5A 3QZ6A 3LHYA 2PODA 1V3KA 2FVLA 1EF2A 3VE9A 5H1WA 2C8NA 5EBUA 1IXNA 2VMFA 1OF8A 1ZJIA 2E5CA 3E6EA 3EWDA 1YBQA 5C9ZA 1FH8A 4PB5A 3RR1A 3SW6A 2HDJA 2PFHA 2H90A 4PUMA 1PB0A 1ZCCA 3RX3A 3OODA 3SQMA 1DXFA 2V81A 3LYEA 3QHMA 3GC4A 4TVCA 1PKNA 2O55A 2BP1A 3ES7A 3UGVA