1VPYA

Crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
269
structure length
251
Chain Sequence
HHHHMIRLGLTSFSSTLYEYASHLPLVEMDTAYYGIPPKERVAEWVKAVPENFRFVMKVYSGISCQGEWQTYYASEEEMITAFLESMAPLIESKKLFAFLVQFSGTFGCTKENVAYLQKIRHWFKDLPIAIELRNNSWYQPNFVKQMLQFMKENQFSLVIVDEPQIPTNPVPFYPYVTNPNLVLFRFHGRNAAGWKKRTLYHYNTQEIADLSEAVLKMSQEAKEVGVIFNNNSGGDAAENALQMQKVLNLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (hypothetical protein EF0366)
publication title Crystal structure of hypothetical protein (ef0366) from Enterococcus faecalis v583 at 2.52 A resolution
rcsb
source organism Enterococcus faecalis
molecule tags Unknown function
total genus 75
structure length 251
sequence length 269
ec nomenclature
pdb deposition date 2004-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01904 DUF72 Protein of unknown function DUF72
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.410 Alpha Beta Alpha-Beta Barrel TIM Barrel Protein of unknown function UPF0759 1vpyA00
1VPQA 1ZTVA 1VPYA
chains in the Genus database with same CATH superfamily
3EMCA 8RUCA 2HISA 2INEA 1V3LA 4GC3A 1DIEA 1S3HA 3MP4A 4DJDC 3NZPA 2V69A 3GTIA 3RX4A 2C0AA 4JEJA 4H8NA 2F38A 3VOIA 3P60A 4FPSA 3TX9A 3W1UA 2BHYA 3RO8A 2PWUA 3W2JA 4YTRA 1EJVC 4B92A 3VI2A 5DLCA 3TQ0A 4NP7A 4IPJA 1O5QA 1PBGA 4QAWA 3O1NA 3VAVA 4UIOA 2EPHA 4QJ5B 3FNDA 1XD0A 3TMLA 5A8PA 1W9BM 4JDBA 1V3IA 3UGVA 4JN8A 3POCA 3WLMA 2YB4A 4IL2A 3UCQA 4CU6A 2EJAA 1I2PA 5JBFA 3AHVA 1NARA 3GY1A 4HOXA 4A6GA 1JJKA 1WPCA 4ORMA 3LY0A 2BNJA 1XLCA 1A3HA 3NR0A 2BASA 4NZ1A 3SRKA 1HN1A 3L5AA 1R7AA 3SY8A 1XIMA 3G0UA 4GVGA 4PBGA 3NA8A 3HFYA 5A8NA 3BCFA 2HNHA 3WK1A 3C4UA 2VZTA 3GW0A 2NT1A 1TPDA 3V4BA 4BF5A 4AD0A 4IXXA 4L5ZA 2A6NA 4LCQA 3RU6A 3ZZ1A 4ROPA 4M1BA 3VIGA 1LWHA 4IMGA 3DFOA 1LRQA 2BODX 4L61A 3G3DA 1B4KA 5EMJA 1MEHA 3WNMA 2EJ1A 2ZRVA 3B0YA 1A3WA 1J4EA 3W84A 5LSMA 1Q8JA 1KGXA 5H8PA 3AHTA 3CMFA 7XIMA 1P4CA 1TRIA 2ZC1A 3B9NA 3UETA 4HNUA 4IPIA 2DZPA 3CAKA 3GR8A 4DJFC 4DJFD 3C8NA 4PCTA 5CJ5A 1VEPA 4HN8A 1N8IA 1VFTA 3P6LA 3BGJA 4AEFA 1VAHA 2E5BA 1ONEA 4Q6XA 3LRMA 4GYPC 3EXRA 4UBPC 5BNKA 1T96A 3K5XA 5FF7A 2OVLA 1XIGA 1VFOA 4WR3A 2AL1A 2RKXA 3SM0A 2CLIA 3I3DA 4LH8A 3PZOA 4JN7A 1TUFA 4JTJA 2VRKA 2VHLA 3W1AA 1NF0A 1ZPTA 4GO9A 4FR6A 1KA9F 1G94A 3BW4A 5F4SA 4PBFA 5D2TA 4KEZA 3CM4A 4YTSA 1YHTA 4A05A 3JRKA 5HR7A 1ITQA 2YLLA 5I0DA 3F4CA 3BLDA 3VFCA 4Z1AA 1NFGA 3W1NA 3NQDA 5BU6A 4CGTA 2NWRA 2FH8A 1M3UA 3PUEA 3OVPA 1QPQA 1O1ZA 3WQ4A 4GCAA 3E12A 1MDLA 2DVTA 3QC3A 1MFVA 4LAUA 3WQOA 1HKWA 4ACYA 1OFOA 4ZQCA 2IXVA 1PX8A 3KP0A 5JMUA 4ZQPA 1BF2A 4LAZA 3GDRA 5GVJA 4LUYA 4C1LA 1GYNA 3LXBA 3VM5A 3ERPA 3M0LA 3VGHA 3VILA 3PZVA 4A22A 2ZA2A 3G1HA 4UMBA 2OJPA 2VCAA 3F4NA 1RK6A 3CL6A 1JCLA 2G4FA 1V0MA 4KRZA 3ZT6A 3VNDA 4LAOA 2J8TA 3BAJA 2YCEA 3R11A 1J0IA 3S1XA 4LVAA 3LTSA 3K4AA 4WF7A 2QXWA 4NZCA 3WFZA 3VIMA 2Z1WA 3WH8A 4KESA 3M43A 2REQA 5EBUA 4QXIA 4REQA 3SGGA 7TIMA 3CHVA 3GNOA 4ZO7A 4BA0A 4D1IA 3VZYA 1V6UA 1H60A 2PDIA 3RCYA 4NAEA 2Z26A 3BAKA 4WOQA 1DQWA 3HQ1A 1MXDA 5DEZA 1BGAA 3NZGA 3SW6A 3SN0A 4ZFCA 3SCVA 3C8FA 3TXVA 1FWGC 3VX1A 2WLYA 1DWHM 1CB2A 5HMDA 1JZ7A 3BAXA 4QJ1A 2V63A 2WBKA 1B90A 2OLHA 3CZ8A 1OZMA 5I23A 5CAKA 5EA9A 1EHAA 1AH4A 1EC7A 1Z42A 4U3CA 1B3YA 3ARUA 3RGTA 3S1VA 4CQ8A 4FXSA 4IMAA 1I4NA 3GTXA 3L4UA 5D2XA 1H41A 1GQNA 1E71M 3TMQA 4JQ2A 3CEPA 3LB0A 3VD3A 2IW0A 1W37A 2BVWA 1E5NA 1J0JA 2WK2A 2BXZA 3JW7A 4R33A 1Y5WA 1LLOA 3G1YA 4RDVA 1UUOA 4NYYA 4CNNA 4A3YA 1SQ7A 3LLDA 3H2MA 3Q94A 1G69A 2YFOA 3VOGA 2J62A 2A3AA 3WMCA 3MV01 2R8WA 3CZKA 1G4SA 3VKDA 4OT7A 2BG5A 4O57A 2YXXA 2G3FA 2TMDA 4K2SA 1MXGA 3A21A 3BMWA 1RY0A 2YYTA 3RLHA 3LNMA 3NUKA 1UBSA 4JX4A 3UNTA 1TCDA 1KBJA 5B80A 2OYKA 2C79A 3UPBA 1BWVA 2G0WA 1EZ2A 2VC6A 3DERA 3I68A 3EKLA 2PDMA 1ME9A 1HKKA 1UR0A 4O18A 4W5UA 2Y2WA 7A3HA 5FSDC 2VX5A 3QHNA 3W87A 4M3PA 2NQ5A 4IMDA 1Q6OA 3FDGA 2XVGA 2BVDA 3BWWA 1R2SA 5I03A 3HZ3A 4JN6A 5CJNA 3DKJA 2P3ZA 2PDWA 2VELA 2PB1A 4AZBA 2XIJA 3A3WA 1WUEA 1GOQA 2GL5A 4H8UA 4PZVA 1J2WA 2VGIA 2I9UA 3S8HA 2DY3A 3TYBA 3IVTA 1AG1O 2V3EA 3AZRA 3TDFA 4LB3A 2DVUA 1KFBA 3RLGA 4JOMA 1GYMA 3SCRA 3HG2A 5ABGA 4K1GA 5U4NA 3BLEA 3KVJA 3TYUA 1ZAIA 4XD6A 2V2HA 1D2KA 3W7PA 4B4FA 2DT1A 3CB3A 3NQCA 2D2HA 4TUFA 1UKPA 3E5BA 3FDKA 2CPUA 3VU2A 3U2EA 3BQ6A 4LUTB 3A23A 3W1MA 4B5NA 3HJZA 1C93A 1TPVA 3LSBA 5A5WA 3LHUA 1JNEA 4CN1A 3QSTA 1ZP3A 3B8VA 4UFKA 5DRCA 1ICQA 1TQXA 3EDJA 3LCWA 5K3VA 1J0HA 1HX0A 3EWWA 4JX5A 4PB3A 3GTFA 2PS2A 1U5JA 2WKGA 5J8LA 1EEPA 3CS2A 2ISDA 1WO2A 2WZEA 3REQB 3KTSA 5EFDA 1X7FA 6ENLA 4QEHA 4AHQA 4YN5A 1YPFA 2YZRA 3ABOA 5A8GA 4GJJA 4I9MA 4J4KA 1CX9A 5JUVA 2PTDA 4MY8A 4HCHA 4CQDA 3M7WA 2GQAA 1VPXA 3G1FA 3DC0A 3BLLA 3OOQA 2VM8A 1O5KA 3W2KA 3VOJA 2WM1A 2Z0IA 3E5PA 4AWEA 1ZTVA 2WNWA 4GXWA 4GNJA 1EBHA 5KZDA 4UFLA 2PODA 2V5CA 2CYGA 1EGMA 4ZO8A 1A0CA 1L6GA 3UP8A 3D47A 1CGYA 3SUSA 3ISIX 3W83A 3NURA 5CPLA 3T8LA 4A2RA 4F0KA 3W22A 2DSWA 1CW2A 4YCPA 1VB9A 1RQEA 1YDVA 1F74A 3B04A 2BV9A 2JGQA 4UTWA 4L1GA 4G5DA 4C60A 2E1WA 3BJSA 3SECA 3UJ2A 7REQA 1KRCC 3SCPA 3CYVA 5G2HA 4E2DA 1SR0A 4RDZA 2VOTA 1W9VA 1UZ4A 1GTHA 3W7JA 3PJWA 1D8WA 2BOEX 1KM5A 5A6MA 4B16A 1ZRQA 1RCOB 1VFUA 3ATZA 2CZDA 5TAOA 2YIHA 5A6TC 5KTLA 1OT1A 1OB0A 3UERA 4U33A 1M7XA 3RM9A 4X63A 1K4GA 2R6OA 1XH1A 4LV4A 1SW3A 2G8ZA 5D09A 3Q2DA 1NP0A 2WSRA 4PCSA 4DO5A 3DFYA 4WVXA 1BFNA 3PM6A 3KOZA 3WDQA 3OLGA 3F2DA 2GGHA 2XPKA 4TQTA 4KT2A 1J8VA 1BXCA 3CWHA 3V7PA 4PCNA 1LM1A 5D8WA 3NYDA 2CETA 1IIHA 4ZQRA 3RPDA 1KBLA 2V2DA 5I00A 2NQJA 3WQVA 1M7PA 3DZ1A 2GJPA 1S39A 1G4PA 4JFWA 1JGIA 2CCRA 2DW6A 2PBGA 2J77A 1Q3NA 1S1RA 3NCOA 5A94A 3OQEA 5DELA 3LLXA 4GQRA 1OSEA 1VYPX 3R4IA 4J35A 1RBAA 3U6WA 3W24A 3TTEA 4IIGA 2BXVA 3GE7A 4V15A 4JNZA 1CXIA 2EPOA 3ZVHB 2OSYA 1H1NA 4Z2HA 2E5DA 2QCFA 1FFRA 1ZBKA 1XSJA 4EE9A 2VFIA 2E5CA 4AMAA 1LJYA 2JEPA 3NO5A 1UA3A 3SO7A 4GGBA 4DJDA 4O4WA 1U2YA 2O4QA 3U5UA 3A12A 1B3XA 2Z4GA 4ZB0A 2D3LA 3OZMA 1WYIA 4GI9A 1XPGA 3W26A 1TTPA 3C2OA 4RE0A 1NQ6A 1KRBC 1EYWA 3CQIA 1V3HA 1NY1A 3ZR4A 4Q8VA 3N9SA 1PYMA 3SADA 1DWGM 3IEBA 1X1NA 3IIOA 3O15A 1R9ZA 1FKXA 4N9BA 4RNFA 3BURA 3RR1A 3N9KA 3MKCA 3TJIA 1KM3A 3WF3A 1XS2A 4EWJA 4FNRA 1OZQA 3WBEA 4S3BA 4LCRA 1H4PA 3L4ZA 3BICA 1EUAA 4MY1A 1BLIA 5CKSA 1H62A 3VNJA 4M0XA 4XZNX 1FWWA 3JZUA 3CV6A 3OU8A 3M0KA 1JUBA 3B0XA 5F2GA 2A6LA 2RDWA 9XIAA 3MU7A 2ZX7A 1PZ0A 3IIXA 1NVMA 5LXXA 1SFTA 8CGTA 1EL3A 1TWWA 4FP1A 3O6AA 2A21A 3QFWA 2GGEA 4MJZA 2QPUA 5ABHA 4BI7A 1DJGA 3BCDA 4H7ZA 1UJQA 5CPOA 4CLMA 4KCWA 3PZ9A 3A9IA 2OMAA 4XAYA 4O13A 1AW1A 3UJEA 4RZ4A 3WLOA 1PKYA 5BMXA 4MPQA 3PY2A 1A80A 2NLYA 3R94A 4J1OA 3BGGA 2WSQA 2D0HA 4GJ1A 3BDKA 1IEQA 4I7UA 1NAL1 1V5XA 3KEHA 3VIJA 5I24A 5AC6A 2Z7KA 3CTTA 3MP5A 4FLOA 1QNPA 1M68A 1V93A 2X40A 2VJXA 3RIKA 3AHYA 3FVMA 4PUKA 3I7RA 1AH3A 4X2RA 4GYPA 4DYJA 1CGVA 4I9AA 4W8BA 4DWDA 5DF0A 3WD4A 3PAJA 2ZX9A 4PBEA 3G24A 4DF1A 3WNNA 3UWQA 2NXGA 4HGXA 1HJUA 3OVQA 3NJ3A 4D1JA 2VVSA 1DOSA 1AJ0A 3ABQA 1DWIM 4MNJA 1KV8A 1ISVA 1FOBA 2HBVA 2ON3A 4O19A 1PVNA 2HS6A 3IJDA 3F4WA 3LMZA 4ATDA 1XQKA 1JYXA 1TVNA 4CNSA 1NSJA 2ACSA 3M16A 3V75A 1EQCA 2PLJA 3MCOA 3BARA 1ME8A 1UASA 3HU7A 3UVAA 2XSBA 5PTDA 5LA1A 1HVXA 3NSMA 4LNYA 3DFPA 4U5KA 3UCDA 2FYMA 3OGVA 1G6CA 3XISA 2ZUNA 3VD4A 2MANA 1UD4A 2TPSA 3M0ZA 3G6MA 1O5XA 2YDRA 3N4AA 3QSRA 2RDXA 3FHAA 5DN1A 1YDNA 4K7YA 3I65A 1HP4A 1RBOB 1RD5A 4LTSA 5GNYA 2JKAA 3MWAA 4XO7A 4HMNA 4V33A 1XXXA 1I2RA 2ZDSA 1UR8A 4GMEA 2I7GA 4LYPA 1GW1A 4EXBA 5LGZA 1XCWA 2PDKA 2PU0A 2G37A 4URIA 5F1UA 4YMZA 4AY1A 1W2PA 1BTMA 2Z28A 1JF6A 2ACQA 2NXIA 3G1SA 3KOXA 3AYTA 2G3JA 3FHQA 1ZNNA 4LUJA 2C71A 1EPXA 3EA2A 1L2QA 3PZQA 4KPLA 3MUAA 2JKEA 4DUXA 3FA5A 1F8IA 3NOEA 1YNPA 2P3EA 4AWUA 3B9OA 2OCZA 1QFEA 3A4JA 3UZ5A 5AC7A 5EPDA 2GUUA 5E9XA 1UG6A 2C14A 1DXFA 3R10A 3ZLHA 2DZTA 4K39A 1DXEA 2OOFA 4S3CA 3H4XA 5C9ZA 1O6IA 2O7SA 3FA4A 1WXYA 1HKMA 4GABA 4JTGA 3SQLA 3TR9A 4TMBA 4B91A 1KM1A 3IGSA 3AIQA 2X16A 2BSLA 3RMJA 5HXMA 2WVSA 3E2SA 4GZ7A 2Q8XA 3W6LA 3GDKA 3R1ZA 4A4AA 5H8UA 4NUWA 3W7KA 1VEMA 4GFSA 3U8GA 3N2OA 3ONBA 4P7OA 3K8LA 2YPIA 3MW7A 3M5VA 4IQJA 1ISYA 3FXGA 1MRQA 1VBJA 1WNOA 1M6JA 2QUVA 3C3NA 5EKYA 4HA3A 4YCOA 5FAJA 5F1VA 5A6SA 1Z48A 1ZQ5A 3TFCA 3VMNA 1UKOA 3L23A 3P81A 1EWEA 2W91A 2A7PA 1IZCA 4GY7A 2PRLA 3RCNA 3GDBA 2OR2A 1UH2A 2DFAA 3IUDA 3ZSTA 3UWEA 2OEKA 5H8MA 3HQOA 5F2LA 4Z42C 4GUJA 1OWQA 4CU7A 5I5RA 3DHPA 4H9YA 4YHEA 1XYBA 1EFZA 4RJEA 3PWGA 3ITCA 1WKDA 4RNHA 3ES8A 4AD4A 3M5XA 3VMPA 1EJSC 1Q66A 4EPBC 1VLWA 3HIJA 2GJRA 1QNQA 3IUHA 1H61A 1A5OC 1PTAA 3TH6A 5K7JA 1K7XA 3LPPA 3E96A 7PTDA 4Z1YA 4GIYA 1UP3A 3LV6A 1P5BA 1FXPA 4BWLC 3DN5A 2J8GA 1DXIA 3DI1A 5F7UA 3V35A 2HE8A 4GFIA 3LQLA 3MV11 1OFBA 1NDYA 4FNPA 1W8GA 1FTXA 3CMJA 1GOWA 1SVDA 1VZWA 1QJWA 4KETA 4HZ8A 2B81A 3JZEA 3TR2A 4LVDA 1CDGA 2Z2AA 3G2GA 5BXRA 4D6FA 1RJPA 1TJ2A 3UYCA 3HF3A 5IM51 3W7NA 3BTNA 4AVNA 2WZMA 2VDIA 4NRRA 3VCNA 1YTEA 1F4HA 1YE4A 3SN4A 3I6RA 5DFAA 1QNOA 3FLUA 9XIMA 3N9RA 3IIPA 2V8ZA 4DUOA 1W54A 2VC7A 3MY9A 4DZAA 4ML4A 1WDWA 2DZXA 3B05A 3BGAA 2Q71A 2HPMA 3TN3A 2ZZ7A 3HMCA 2HQAA 1Q5MA 4A8IA 4O4VA 4BEUA 1D3GA 1MZRA 1P43A 5EMMA 3NDYA 2DSUA 3TV8A 3BMVA 6PTDA 3GG7A 3WN6A 3HG4A 3BAYA 2XINA 2EBNA 1T40A 1TIWA 2VI0A 1WDQA 5D02A 5CH9A 1DQXA 4Z2GA 3CL8A 1PSCA 1TV7A 3GZ3A 2VC9A 1SSGA 4DO6A 1QW7A 5IFTA 2EG7A 4G6CA 4NF7A 1DORA 4L80A 2CITA 4IOTA 1GVFA 3R6IA 4DJEA 3JS3A 4YYFA 1E6PA 3N34A 1FWAC 3EDEA 2ZUVA 3VCRA 3K46A 1JUEA 2WVVB 4GD0A 3EZ4A 3WJSA 4ZA0A 4S2BA 1R38A 2QLYA 1TO3A 3P67A 2XG9A 3LV5A 4CVWA 3S3GA 2DT3A 1E4NA 2ZKMX 3SUTA 4HCLA 5GQBA 2I5GA 2GJXA 3EDDA 3O0FA 2UWFA 2GSJA 4M19A 4AQLA 4XAPA 2ISSA 3M0HA 3RITA 3EOEA 3ZQ9A 4OJYA 1WZKA 3CV7A 1XDLA 1T5AA 3S2MA 3O2LA 4LSBA 3I7QA 3MPGA 1W3JA 4Z2IA 3SSJA 1H7WA 1UKSA 3ZJKA 3OW1A 2IS7A 1JCJA 3PHAA 1WAWA 1TPH1 3EPMA 4NZ4A 3WK0A 1S1PA 3OA5A 4GXPA 2PTYA 4S3EA 4JTSA 3IGHX 4HSNA 4OUEA 1QHZA 4GNVA 3L65A 4HK7A 4YIWA 3UWUA 4PGLA 4AYGA 4ZO9A 3W85A 1EH9A 1TZ9A 5GNZA 2EG8A 4FX7A 3WF0A 4CD5A 3FIGA 2VGBA 3OVRA 3S2JA 4PMNA 4RDYA 1XRFA 4MAZA 5E0CA 2QDGA 4WJEA 4MKNA 4ASTA 3ZVHA 4H1ZA 2VQTA 3KLLA 3N6JA 3AAMA 3AFBA 3BLKA 2FGZA 3RHGA 1FWEC 2AQOA 4AEOA 2J74A 2PDPA 5TQLA 1JCTA 4JL2A 1WXJA 2CLPA 3NIYA 5IDIA 3TEVA 5BWFA 4K6AA 4QDPA 1ZBVA 3K1GA 3NM3A 3ITVA 2CKSA 3P14A 4ZOCA 1UP2A 1Z3NA 3EWDA 2O7QA 1JRCA 4HKPA 1DJXA 5L9FA 1K6AA 3WLSA 1GEHA 5MF5A 5I3JA 4LOCA 4IICA 4F4RA 4IM4A 4Q8UA 1CI1A 1OGGA 3QKEA 1S5VA 5U7SA 3QTGA 3QR0A 3PTMA 4S3KA 1MUCA 1J79A 1PHQA 1E51A 3NO1A 2WNZA 3TW9A 5JBDA 1S2AA 4QLJA 1VFHA 1HKVA 2J13A 3IVUA 1EF3A 5I07A 2CLKA 2QAFA 2XIQA 5DT7A 1F3XA 1QI0A 3FKKA 3GXPA 4Y9AA 1E0UA 3M1ZA 1DTNA 4JIHA 4YTUA 3EOSA 1A47A 1LF1A 1HGYA 5EMLA 1AVAA 1FDYA 3MHFA 3NGJA 3H6OA 4LYQA 1J5SA 1E6SM 2KZHA 1ODZA 4FK9A 4EF8A 2DUXA 2IKGA 4NI3A 3PJTA 4UFIA 4LUIA 1QK2A 2IPFA 4AVOA 3C0JA 3V1HA 3AMLA 3GRIA 2IKJA 1JZ8A 3MSGA 1LBFA 2I16A 2XGZA 5E9AA 2BHUA 2YBTA 3G1XA 4QE4A 4AIBA 5I02A 2XDFA 3T2PA 5K2ZA 3KBNA 5G4EA 3SIMA 4AZCB 2CWNA 2X1TA 2PDUA 1QATA 1XBVA 1E72M 2Y8KA 1YKWA 2OTDA 3LDVA 5DCBA 5G5IA 1JDAA 2QVNA 2A3LA 1OX6A 3QY6A 3LRKA 5AYIA 5FJRA 3H53A 4QDMA 4GIAA 3ZLFA 5A6BA 1UIOA 5K4ZA 2GQ9A 3IJQA 4UZUA 1LYXA 2YL5A 4LPCA 1BHGA 2J75A 2YR1A 3HA1A 2CXGA 3TW7A 1BD0A 5REQB 2Y5JA 3CZJA 4JQ3A 4EXQA 3L4YA 5DO8A 5BWAA 1ZHAA 3MKKA 4LFYA 2I56A 3NQ7A 1R47A 4O1BA 8A3HA 3U2OA 1CXLA 1ODUA 1FH7A 3FEQA 4OOUA 2ZE0A 2GJNA 2A5HA 1HKJA 2B7QA 1IQ8A 2W67A 3HV9A 1H7PA 4IIHA 3W53A 4EOUA 4GBUA 3GK0A 5ABTA 3AALA 3HN3A 4QIUA 3N14A 3SB0A 3WUEA 1TPC1 3VO0A 1VFLA 1FCBA 1UH3A 4N02A 3ENLA 2AGKA 2QQ6A 3AICA 5A2CA 4UWMA 3P3BA 1B9ZA 2POTA 1RV8A 4K8EA 1JDEA 2DIKA 4H01A 4Z0SA 4JTAA 4MUPA 4UTKA 1OHLA 3LCHA 3HTWA 3H7RA 1QCWA 4GIEA 2J6VA 3WQFA 2ZWZA 3E3HA 6ALDA 3H26A 4FX8A 4O52A 4HZ7A 1G0CA 2WJFA 2INZA 4G7FA 1KFCA 4CCEA 1TV2A 4GA8A 2YKKA 4E3VA 1QPNA 1HJSA 3UF9A 3CPGA 4J3XA 2F8QA 3TOPA 1YADA 1HIZA 4US6A 5FSEC 1JG9A 1MXSA 3MMUA 3W23A 4CCCA 3CNYA 5A3HA 3LI1A 1DJIA 2WNQA 1BYCA 1CLXA 2RGLA 2Y5EA 3W01A 6XIMA 4GKTA 1A5LC 1XLEA 3IK4A 3IJLA 1GVRA 4MKSA 2HVMA 2IXUA 3GXIA 4JTQA 3EWYA 5A2AA 1OCNA 4Q8OA 1H63A 4O0ZA 4ZB2A 4QLLA 2EEXA 3CUZA 3TLQA 2FDSA 4H6RA 1V8EA 1GQKA 5A2BA 3TSMA 3URNA 1UR1A 1BVZA 3DFQA 4RDWA 4E0CA 1Z44A 1NU5A 5E1QA 4X61A 2WC3A 2WKLA 1Z41A 1WUFA 5CG7A 4LYKA 2FFIA 4KEUA 4PRRA 4M7TA 1O12A 1UR4A 4L1XA 1DJZA 4G56A 3AI0A 2EPKX 4L1WA 3AJ7A 1X7IA 3GH7A 1OF8A 4HK5A 3ZT5A 5H6HA 4O54A 1XYAA 2CZ5A 4KKXA 5HNRA 1W1VA 4OFCA 2RAGA 3EAUA 1DPMA 3WNKA 2A3CA 4ZGYA 3E6EA 2WVTA 3DG7A 4KRTA 1TV8A 4PUNA 2EKGA 2V81A 2Z6JA 3W7RA 1HNYA 1SR9A 1MQRA 3Q65A 3QHOA 3OQ8A 3W7HA 3KRZA 3UY8A 4YU1A 3HO8A 3G1VA 2ZRWA 3HBLA 4LU0A 3KRBA 4OUIA 3CAQA 3IJ9A 2X2YA 3L0NA 4HJWA 2GVEA 1ISXA 5C2GA 2VR4A 3S5NA 3PZTA 1HTIA 5BXTA 5T26A 3P74A 2ALRA 1QR7A 1EJUC 4W8AA 1EP2A 1OVDA 3WLLA 3M64A 1C7SA 4GK8A 2OZ3A 1L6FA 3K8KA 5KETA 1YNQA 3PFRA 4CD7A 3QN3A 2OEJA 2D2JA 3LK6A 3LRLA 4XTIA 1W56A 1BF6A 2YL9A 3EPNA 3TONA 2GK1A 4AISA 3DCPA 1LOSA 2AAMA 3VGGA 4AIEA 3MC5A 5F2MA 1HQTA 1BKSA 4BQ4A 4L9YA 2YJQA 1PAMA 5FF3A 3WF1A 1PO9A 3R0KA 4DYEA 2CU0A 3VE9A 1LL7A 5FL1A 3LBCA 1WZLA 2NZLA 4M7SA 3KZSA 5FD0A 4IIEA 1KC7A 3U0HA 2VFFA 2UY4A 4M1RA 4PEEA 3OJGA 4RZBA 4WIWA 2WNNA 4W89A 3I7SA 3CHEA 3NL6A 3B4UA 2V5JA 1G5AA 2BB0A 2YBUA 1ISWA 4Q4MA 4ZZ9A 1SU5A 4GH1A 2QCCA 1P0EA 4O15A 2J25A 1X1OA 2I1OA 2OLAA 4NILA 1GCYA 3TKFA 3C56A 1XLGA 2PP3A 2FB3A 3QPYA 1E9ZB 1VBUA 3AXKA 1SO5A 4B2DD 4N7QA 2X30A 4AY7A 3AMKA 4J9JA 1XL9A 4EIVA 2J6XA 4POCA 4I7VA 1T99A 3GFZA 4BCEA 3OLIA 4BWLA 1JUKA 3TAOA 4YL2A 3UZJA 3MI3A 4O10A 1S46A 3VOCA 3I3EA 4EP8C 1V6XA 1JR1A 1NJJA 2QAPA 4JFTA 5AHIA 1CEOA 1R7OA 2FHCA 2VC5A 5AHNA 2PP1A 1ALDA 4BEQA 2CZVA 1VHCA 2V9DA 4EF9A 1U83A 2ZRYA 1GPFA 3MANA 1L6WA 4JIQA 4R53A 3W73A 3O07A 4HSOA 3N29A 3ALFA 1XYMA 3MUIA 4IZGA 3EA1A 3AIRA 3PUGA 4HA1A 4UR8A 1BRLB 1I6NA 2IUZA 2C13A 5KZMA 4Q7NA 2GUYA 3WX7A 3W75A 2C7FA 1E73M 3VINA 1W9DM 3QMRA 5SWUA 4QE5A 1JCMP 4R5EA 3PWIA 5I2UA 2DV0A 2P10A 1Y5VA 2CBJA 3GVWA 1RCXB 1MNZA 1B3VA 3GKAA 4L56A 1MMFA 1EB3A 4C6JA 2IPWA 2HXTA 3S9IA 3CO8A 1NOUA 2PTXA 5G2WA 1J0ZA 3WLJA 3VE7A 2WSYA 3WDHA 5MKGB 3UWWA 4HTYA 2H6RA 4QNEA 5LYRA 3SCWA 1EYEA 3DX5A 3T8QA 2FTYA 3IS4A 4WKFA 3V0TA 2BGSA 1WOAA 3K2GA 3HPFA 4L64A 1H49A 4F0MA 3MSDA 1PCKA 2VX6A 4GVFA 3EX2A 4K37A 3A5VA 4I5UA 3NQ8A 3CL7A 3MBDA 3WNPA 3ITXA 3BV7A 3G22A 4JFSA 4QG9A 4F9JA 3USZA 4AZ6A 2GUBA 1LTDA 2Z2BA 3D6NA 3DXIA 1ECQA 4HPHA 3S9YA 3B9EA 3MP3A 2ZZ3A 4ERAA 4JZ5A 3UXIA 2YX0A 2CLOA 3DYPA 1ADSA 2R82A 5FF4A 5K9XA 2V68A 4I5RA 3TYAA 2PDGA 3WNOA 4AUBA 1XX1A 5D05A 5M3WA 5AHEA 5IBXA 3SN1A 3LM7A 5TIMA 4RUBA 3G1AA 3DHFA 3EA3A 1ONRA 3AIUA 4JCMA 3SQSA 1XKYA 1TPWA 3AMCA 3NL5A 1CZ1A 3VTRA 3ITYA 2FFCA 1J6OA 5CC7A 1OG6A 2PRMA 4UC5A 3KVMA 5AOUA 2PWHA 3C86A 3AIEA 5CSYA 2DU2A 4HNVA 3O6CA 1S5NA 3R79A 3PJUA 1UP0A 1W5MA 3GNRA 4IIDA 1LL6A 4X0NA 1AA1B 3ANYA 3OTRA 5H2ZA 2ZRZA 2NQZA 1EA9C 2Z27A 3UT0A 2UZ9A 2ISFA 3WQDA 3C5QA 5D2WA 4WSKA 2O92A 1BG9A 3VIIA 3R8HA 2BDQA 1TMQA 3U7VA 3W02A 3KVKA 4D9PA 2DEPA 2WCGA 3WLPA 4RXFA 4DVOA 5J5RA 4LJ3A 3XIMA 2VCCA 3ZR5A 1LT7A 4ZSUA 1B30A 3L2LA 5LHFA 4BQ5A 4GUIA 2CLMA 2E77A 1C8XA 1ADDA 1KKOA 4HB7A 3L5MA 3IRSA 1PWMA 1EHNA 3L21A 3WF2A 2XIOA 3TSBA 2A7NA 3FVDA 4M56A 1Q7ZA 3DFTA 1XIEA 1ONXA 2ZX5A 3WD1A 3WO8A 3GKFA 5CXPA 1KTNA 4IPPA 1QBAA 5FOOA 5D33A 3STPA 5CPQA 3THUA 3PZMA 1E1FA 3KP1A 3EOOA 2ABAA 4HYWA 2D69A 3N11A 4KFOA 2Z7GA 1ENUA 3NFUA 3VZZA 4JQ1A 1SZRA 3TVAA 2WBGA 4QG6A 4S39A 5REQA 1SGJA 4OZOA 1IF2A 1SYTA 2HK1A 3MJYA 1M04A 2ZFAA 2PLKA 3R89A 2I17A 3RLUA 5FACA 3F7JA 3QZAA 3G18A 4PTVA 1YRRA 1UZ1A 2GVGA 3PSVA 5G1TA 2H3BA 4TV6A 1PS9A 3GBDA 1RLCL 4BQ3A 2CFFA 1VRDA 4C6PA 3QV8A 2OKOA 3HGJA 2DZWA 4C1NB 1EQPA 4NZ3A 4H41A 3Q67A 4JFUA 2JIEA 1XP3A 4CQAA 2PGWA 4MWAE 2P5NA 4KCUA 3TYZA 4Y9NA 3BG3A 4RR4A 4RZ5A 3O63A 3GC4A 1FA2A 3VC5A 2YA2A 2QR6A 3WL0A 4F66A 3WJZA 1F6YA 2GDQA 3IACA 4E8CA 3GNPA 1YEYA 1TRDA 1NEYA 2D0FA 2PPGA 4XZLX 5AHMA 2DUZA 5BU9A 1OX5A 1TCMA 1KO0A 4MWAB 2WWDA 1RA0A 1XLHA 3H2CA 2I9EA 4GX8A 5HQLA 4CUCA 4UB9A 1ZFJA 1KCZA 1MFUA 2F6UA 3NEHA 2ZZ2A 1E4MM 4KMQA 3W2UA 3VIPA 5E6YA 3K13A 3AXMA 2NVAA 1H1ZA 4UR7A 3W81A 1CXHA 3OYXA 4PSPA 2VO5A 3OIHA 1W3TA 2YL6A 4FAMA 4C7DA 4C90A 2Y7GA 1R2RA 5CQ1A 3KL3A 4FEZA 1O4UA 3DHUA 1ZU8A 2P0IA 2X0YA 3B97A 3R25A 1F8MA 1JVNA 2DUAA 4PA8A 3NQAA 4D6DA 1P48A 1G1YA 1J01A 1R3WA 4J3UA 3CZEA 3FV9A 1HUVA 2AMGA 4DUVA 2OZ0A 5JXQA 3KHDA 1Z32X 1US2A 3E38A 3T08A 1L8PA 3T81A 4PTXA 5LIYX 1GVQA 1GJUA 2I5IA 5T8GA 2PDYA 1SFLA 3N2XA 1LQ2A 2X41A 3SR7A 4H6QA 1ADOA 4MFDA 3FKRA 3GDTA 2BOFX 3LYEA 3O9NA 2D0GA 4BI5A 1RUSA 3ITOA 4UOJA 4OECA 5C7HA 2PI6A 5HR6A 1XJBA 2QUTA 2VT0A 4HN4A 2NV2A 1DIKA 2IKIA 1FWBC 1UWQA 5T91A 2SFPA 4TO8A 4B90A 2D20A 1VLIA 2OT0A 3P93A 3G0XA 1GVYA 4AD3A 1VEOA 3ZMRA 4WDTA 4S3FA 2PAJA 3AYRA 2PSNA 1OFPA 2EPLX 1VJZA 2Y0FA 5HANA 5G2IA 4NNAA 4FLSA 4NL1A 3WUGA 5FJIA 3BOFA 3L9CA 3E9AA 1GG1A 1TG7A 1IEXA 1OCJA 1NDWA 1S5WA 2WHJA 1QAPA 3OGRA 2X7WA 3NQVA 3ARYA 3PANA 1KRAC 1RVKA 3RFAA 4W85A 3GHUA 3M0MA 4R7OA 3WYZA 4Y8FA 4KWSA 5A69A 5G1YA 1PL9A 1XGEA 4ZQNA 2O56A 1SMAA 4WDUA 4ENLA 1R3YA 1VENA 2ATMA 2VD8A 1TX2A 5TD4A 2FZBA 1H0GA 3CLMA 3NDOA 4UTJA 4US5A 4UFJA 3QGKC 1DEDA 3IJ6A 4G1KA 1IZKA 3UG5A 3VPLA 2J7HA 1T6MA 3VUPA 5GPRA 1DHKA 4M6VA 3BC9A 1V79A 1O7AA 3T05A 1LQAA 3MO7A 4UQBA 3H4GA 3ITLA 4IX2A 2VDHA 4RNIA 1PWLA 5BZAA 5HUOA 1EX5A 2ZUMA 3DUGA 2GOUA 1GQIA 1CENA 4GI6A 3LCXA 1W17A 2PTWA 3UA3A 2CLEA 2ZUWA 4AD5A 3LPGA 1LOLA 3RK8A 1BQGA 4PL1A 2HXUA 1QOQA 4NIRA 2B7PA 5FI8A 2QJJA 4M8UA 1LWJA 4B5TA 1TWZA 3EX4A 1E40A 2R94A 3VNIA 4RX0A 1CECA 3QC0A 3LHWA 1D7FA 1WDDA 3WELA 1XHGA 1O66A 1QOPA 3GTHA 3VVGA 4KH2A 1HJQA 3W70A 2FVMA 1GVSA 4PFMA 5DT5A 3ZXWA 4CN6A 2CLFA 2W61A 3D46A 3HJEA 3UGRA 1SZEA 4GH3A 3WY1A 4MAVA 3B8IA 3RX2A 1QPKA 1JPHA 2DIJA 3T2QA 1OJXA 1C29A 4JTKA 5B7ZA 1UZHA 1DE5A 3LTYA 4LB4A 2FIQA 4Y2WA 3VD9A 1FWCC 2FZ8A 3CEUA 1GZJA 3AIBA 1SZFA 3M0JA 4JS3A 2PU1A 2JEQA 4Y7EA 2XVPA 4LGXA 4ZQMA 1W5NA 1G9HA 4JFVA 4PTNA 2FMOA 1TZ7A 1C8YA 4HOZA 3BH4A 4WJXA 3GR7A 3WJWA 1RA5A 1KW1A 1FBAA 4KEMA 2QCDA 3TA9A 3DAQA 1XIIA 2KX9A 5LA2A 3M7SA 3M6DA 4ZR8A 4DZ5A 2QVHA 1V6VA 1NIUA 1LZOA 1Y65A 1DJQA 4PMXA 4M51A 3P80A 5CZJA 3DECA 1M53A 1MUMA 2NQLA 4YWSA 1SZNA 4Z1BA 2Z2UA 1E9IA 3MTWA 3I6TA 1HL9A 3GXFA 1FDJA 4PMQA 4O14A 1CPUA 1JI1A 2C3ZA 5C55A 4UTWC 4EAYA 1XLFA 4WGHA 4Q7BA 3S5YA 1R87A 1YLVA 3WH5A 4AFYA 1X6UA 1RLDA 3AIWA 3W37A 3LXAA 4E4FA 1GJPA 2VCBA 3NQEA 1NP2A 1QPOA 2WYSA 3CZLA 4O8RA 5MKGA 4HZMA 1BAGA 1EDQA 3SJNA 2W66A 2OO6A 1REQB 3MB9A 1OK4A 4KQNA 1FRBA 2HV5A 3VDCA 4ERIA 3CUGA 1DVJA 5I09A 4IP7A 5D30A 4QJ4B 1ZJBA 4U3AA 4KFPA 1OYAA 5FKYA 2D22A 1DIOA 1FHUA 2V5LA 4JICA 3L68A 1BEUA 3QMSA 4FLQA 4J3WA 2FDMA 2JQXA 3G6LA 4L6DA 1EUNA 3N73A 3VGFA 4N4PA 2Z1VA 3EEZA 1F2JA 2QPSA 5DMMA 2XH4A 3I10A 4DELA 2DH2A 2OZTA 1AQ0A 4JQ4A 1ZS2A 4UFMA 5C9RA 2J79A 4K8HA 1JZ2A 4KCVA 4N9CA 5DANA 4DRSA 4ALDA 4O11A 5FEWA 3W72A 5I6SA 3RJXA 1FWRA 2YW3A 4QSHA 1AH0A 3QY7A 3T6CA 2ZWYA 1RY8A 4YXGA 4J7RA 1JNDA 2ABBA 3WCZA 1WBJA 3P62A 5JVLA 2D24A 3E2QA 4NXKA 2E1DA 2OQYA 3KHJA 1VKFA 4KGLA 3L66A 4UQAA 1Z9AA 3I3BA 3LLFA 3OHIA 4FOKA 1U1UA 3TSDA 4O0KA 4A8LA 3UJFA 1S3TC 2YZ5A 3P8JA 4OBRA 4D6HA 3CH0A 1K70A 1YNYA 3WBAA 4RW3A 4PFHA 1ZALA 1GOOA 3CPUA 4ACZB 1W2VA 3EX6A 3MVTA 1P6WA 3B8DA 1FCQA 1GOMA 4UOQA 4M5PA 4RV8A 4UQCA 3GVGA 1XBYA 2FQIA 2Z25A 4YVVA 2QDDA 3B0PA 4IFRA 4H19A 4DJDD 1FHDA 4WXYA 3FJLA 2DQWA 4GE8A 3U9IA 2OSXA 4JNYA 2PRHA 5CZKA 1DHPA 2RDTA 4V27A 3MT1A 1TWIA 1UD6A 1QRQA 5E93A 3EB2A 2YL8A 3QZEA 2A0NA 1A5MC 5FJUA 4AC1X 1OINA 1CGXA 4DXVA 1W3LA 4KWWA 2VOMA 3APYA 1LBLA 3WQCA 3T55A 4F2TA 3EWZA 1O1HA 4IFKA 3EGJA 3TP4A 2O9RA 2EPMX 3P5YA 2UV8G 3TW6A 3SRFA 1P1XA 4W93A 1MRAA 2FZNA 1R85A 2BLEA 4Z1CA 1Z89A 2UBPC 4UNKA 3VK5A 3PPCA 3PAOA 5I3DA 1HJXA 2WMHA 2Q02A 1YTKA 5KITA 3LUTA 3ARVA 4E3TA 1OG0A 1OD8A 2OU4A 4LY4A 1RH9A 2EG6A 1B57A 4H9UA 1JYVA 4IF2A 2DZSA 5AC8A 4PE8A 1PV8A 4UNIA 1FP8A 3KAOA 2WSKA 2J27A 3UQNA 5A8MA 4B4HA 4HU4A 5HINA 3W7EA 3O05A 1YBQB 5AY7A 3FJNA 2DT2A 3C52A 3W4RA 3GFYA 5AB3A 4GQ0A 4QSFA 3PBUA 1UROA 1H7NA 2CLHA 3FFSA 4JBRA 3H2EA 2ZXQA 1B9BA 3AISA 1IWPA 4Q4QA 1YE6A 4PMRA 2WPBA 2X42A 1QWKA 4XD4A 3GR4A 5LA0A 2V67A 1LUCB 3TN4A 1BYDA 4AHPA 3UJRA 2D23A 4WRHA 1ECEA 3ZT7A 2FH6A 4F0SA 1PKLA 3LCGA 3AWOA 2VL4A 1PYFA 2OWXA 1A4MA 2G3IA 4BKNA 2QDEA 4C1NA 2EF9A 2D2GA 3QQWA 1TJPA 2E9BA 4L4MA 2YXGA 3NQMA 4R7JA 4AEEA 3KFTA 4O1FA 3ARZA 2WMFA 5CPSA 3ID7A 4XK2A 5XINA 3ES7A 1S2VA 1AL7A 1R3QA 1LLZA 3DFSA 3WG6A 4B9YA 3KE0A 1FHLA 3AJXA 1V0LA 1W9XA 2J8FA 4EXAA 2OLSA 1PJ9A 2EO7A 4MWAA 1A50A 4N9EA 1YPXA 2J24A 1TTQA 2ASHA 1RK5A 2H90A 4B5WA 1I9CB 1FP9A 4ZB5A 1MEWA 3RU8X 4OV4A 2Y8VA 5CSSA 3KBVA 3C2YA 3W7GA 3ITTA 3ZVIA 1TR1A 3ARTA 1R2TA 3UPMA 3L0GA 4OBSA 4LUSB 4CNUA 1DJYA 3GHTA 3H2AA 1K3UA 1J0KA 2QT3A 3B8SA 1GOIA 1XLJA 3UU0A 1IT0A 1WKYA 3PG8A 4I90A 3CHCA 4E8DA 2E25A 3M0YA 5HUPA 2NV9A 4OBTA 5D04C 4UTUA 2UY5A 3IV3A 5A8OA 4HOWA 4N42A 5DCDA 2X0SA 4H00A 1VD6A 2EXOA 3TNBA 3LSCA 2A79A 2QUUA 3HPAA 4RK8A 3DEQA 2PUZA 2WOQA 1AZ1A 3SCUA 3W2NA 4MB5A 2WMIB 3SFKA 2DQXA 3JU2A 4Q32A 5RUBA 1Q6DA 1P0BA 3SCOA 1G67A 1QNVA 2C0HA 3TNOA 3SJ3A 1TJ1A 2VX4A 3H7VA 4KWVA 3GBEA 4IG2B 3CT2A 1ZCOA 2E8ZA 5HK4A 1FWTA 2G3NA 3AOFA 4IGMA 3WLHA 5BRQA 4NNCA 4Y9MA 2NUXA 2NX1A 2NT0A 5H1WA 3CHFA 2F6XA 1M1BA 1TA3B 1F05A 2XIBA 4MUZA 3RYSA 2J9ZA 1UMYA 3G5EA 2D3NA 3KUMA 4GQBA 1RAKA 3GO2A 1OC5A 3S2LA 3WSUA 1XM3A 5FEZA 3A47A 1UZDA 4LBUA 4E8GA 4XISA 1XICA 4NZFA 5CJMA 1BGGA 3OG2A 3A64A 1R3SA 4GACA 1PXGA 4O53A 5B7YA 1PIFA 4HHHA 1WKFA 4Q8NA 5FF2A 1E0TA 1XGDA 4HYRA 3LCFA 1K77A 3W3OA 4B3LA 3POHA 4IMCA 3CQ0A 3WMLA 2DVXA 4GQQA 4UTLA 2ZX8A 4BI6A 2RHGA 4HPGA 1I1WA 3H2OA 1US3A 4MG4A 5JH1A 2XVLA 1OCBA 1M7JA 3E0WA 3UG8A 4PTDA 1WX0A 1KWKA 2E6FA 4IQLA 2XFYA 2R91A 4NT0A 2VFHA 3W7IA 1W5PA 3CC1A 5MHBA 4ADTA 1V3JA 3CPRA 2VENA 4PTWA 3FA3A 4MYXA 1RZMA 4J3TA 5BOEA 2ISWA 5D4YA 1W1YA 1LOQA 3E1F1 5HPOA 1AK5A 2VP8A 3CMGA 3WQ5A 3BAWA 4LX4A 2PGFA 3NL3A 4IT1A 3DHDA 2GSEA 4LY8A 4H9VA 2PDQA 4Q8PA 3S0CA 4JTFA 2QUMA 2J78A 4FLRA 1FQ0A 4MKVA 4F2BA 4JIIX 4UOZA 1IXOA 4AC7C 1XGZA 4NKCA 1I8JA 2NUYA 3F1QA 4DM2A 2VEKA 5A6AA 2WJDA 2ZICA 3QGAC 4ZQOA 1R6WA 2Q8LA 3LCIA 2ONEA 3CAVA 4KWUA 3MMDA 2XN2A 4HHMA 5K9DA 1VGAA 3PB2A 5LKYA 1TX0A 1NOWA 5E0FA 4PH6A 3VIFA 3HB9A 5AHFA 1JAKA 2VD9A 1NFPA 1U5HA 3BUVA 1RQBA 5LNSA 4P61A 4A35A 1TJRA 2IPGA 3LBOA 4O28A 1S2CA 1RJRA 3QTPA 1XBZA 1HL8A 3UVIA 1E6QM 4YHGA 4CD6A 3AROA 1FUYA 1X1ZA 3GXTA 1DJWA 4WZHA 1XISA 2J4GA 3DC8A 3O3RA 3VKKA 3CHDA 1S38A 1Z69A 3HGSA 3EKZA 3M46A 3SCNA 1JZ6A 3OYZA 1E0XA 2PWDA 5JBEA 1UB3A 2AOSA 3W6YA 4CNTA 2E28A 4JTIA 1CLVA 2C19A 1XIFA 3E2RA 1UOKA 1NOFA 3A22A 2V3DA 1E4LA 4C6IA 2E67A 3EOLA 5D2YA 1POKA 3LGEA 1XI3A 4ZO6A 1MSSA 3OO2A 1JPIA 3LHZA 4P7QA 3PN8A 1X96A 3N13A 4BR1A 3DFNA 4H6EA 3B03A 2R24A 4PYSA 4EACA 3LG3A 4M29A 3W76A 3QXBA 4DJEC 1KFJA 3H21A 4FB7A 1O94A 4DJED 1RCQA 2VRJA 1REQA 1FWHC 3RDKA 2PLMA 2QJMA 3S1GA 2B7NA 1A5SA 3TQVA 1XSIA 4HNCA 1VCGA 2J7FA 1JYWA 5CLWA 1GHRA 3WQEA 3LGDA 1U1JA 4LVGA 3O06A 2BWGA 3GZAA 2OQLA 3WD3A 1EP3A 5HAOA 4ZENA 1AZ2A 4GQGA 3MUY1 1A5CA 3TE9A 5DRIA 5DBUA 3TQKA 4XAFA 2XISA 3BK0A 3GM8A 4DBSA 1N55A 4FXFA 3L7RA 4AAJA 5KEZA 3F5JA 2QS8A 5A95A 1KRMA 3KX6A 1G7VA 1P0KA 2PFHA 5D9PA 1T8XA 3PB0A 3TU9A 1XCFA 2PURA 5M17A 2D1ZA 3WDJA 2CBVA 1PZ1A 2JFEX 3E02A 2BX7A 3EMZA 3NDZA 1Q4NX 3VFLA 4GG9A 3IK2A 4C65A 3H2NA 3ZIZA 2F6KA 2VWTA 1JZ4A 1HZYA 1JXJA 2FVKA 1K9DA 1V02E 2BS9A 3DENA 1EBGA 3LHVA 1A5KC 1RQHA 4XZMX 2PBOA 1FY6A 1UUQA 4AW7A 3GSMA 2QIIA 3BLFA 2WMKA 4GXMA 4ROQA 3WDRA 1H5YA 2E40A 1RALA 2O9TA 1KGUA 3AS3A 5DY2A 1MQQA 2A85A 1B54A 4GZIA 4HA0A 4L6HA 4MZYA 2AL2B 4TIMA 1IV8A 4PR4A 4LBSA 4EPKA 3MKVA 5AYXA 4ACZA 4DX3A 4J3SA 4KF1A 1ZAJA 1ML1A 2E7FA 2GJXB 4LAMA 1K8ZA 4O1DA 3VX0A 1NWTA 4YS1A 1KXHA 3CUHA 3OHMB 4K38A 2W0UA 2DGAA 1HO4A 1FX6A 4UCGA 4BK9A 1GZGA 4ZBCA 1L6SA 1AW5A 4XSMA 3RCMA 3LHYA 1CB7B 2V2CA 3ARSA 4AZHA 4DAIA 2PZ0A 4ICNA 4TTUA 2AQVA 4J40A 1D3CA 3N2MA 4MJMA 1QI2A 4PCPA 4JTEA 3STFA 4EK7A 5AZ1A 2E6AA 5AYZA 4I7WA 4NRSA 1V08A 1LG1A 2IQTA 2VEFA 4BFAA 4WEVX 5C6MA 2PDCA 1GONA 3GIYA 2G95A 3T40A 1OIFA 3T09A 4PULA 1K7FA 3P2VA 3WEZA 1DL3A 4WY0B 2IMRA 1UH4A 4GGHA 3T1GA 1KXQA 2HDJA 1RHCA 2IKHA 1JXKA 1T0OA 2A7RA 2WMGA 4C6MA 3BSHA 4MF4A 2QV5A 2RDUA 2XFRA 3G1DA 1FWDC 1R9YA 4PMOA 3BE7A 1UD5A 5ABEA 5IXEA 2XGIA 4FMVA 3TCEA 4Q8TA 4PUUA 2C1GA 2FKPA 3A9BA 3LD5A 1I45A 3VABA 4N9DA 3QOKA 1ZENA 4D72A 2OGJA 2V0TA 4AIOA 4YVXA 3A24A 3GHRA 4RE3A 4XZHA 5GJNA 3FXYA 5HNTA 4QEEA 3GWQA 4AXNA 4GKLA 2CXEA 5ECVA 1YBQA 2FTWA 4FO4A 1MW2A 1XFBA 2XWDA 3L0KA 2QGHA 3WD2A 5LNUA 1B3ZA 4H9MA 1N82A 1XLDA 3QLDA 3WLIA 1DJNA 4OKDA 3ZJ8A 4Q4OA 3MHGA 1LROA 2YDQA 3WQWA 4LRTA 4BHYA 3OLEA 1WOBA 4JHZA 5HMSA 4HU0A 3RR4A 4FNTA 1RBLA 3K30A 3FAWA 4PEKA 2QJHA 5G4HC 1TPFA 1LUCA 1N2VA 3LZ3A 4JDYA 5IFPA 3UEQA 1KXTA 4JEQA 5I79A 4ZSTA 1Z6KA 5HNUA 4DEFA 2J7DA 2P53A 5ECUA 3M47A 4L9ZA 2GDUA 5A6BD 2ZUSA 3HG3A 3MYOA 2BY3A 1GQJA 3EWCA 5K9CA 2YCLA 1FVPA 1EIXA 3PC0A 2OO0A 1Q63A 3BAIA 3WH7A 2F61A 3N4EA 3WH6A 3P61A 3LERA 2JGYA 3THQA 4QX4A 3M0XA 4XKMA 2ZZ6A 1ZB5A 1XLKA 3APTA 4W8LA 3WBWA 3EOUA 5KMYA 4CEXC 4UTTC 2VDGA 4F79A 1JPDX 1SSDA 4GC4A 4C5YA 1Z7AA 4GZEA 3P7YA 3LPFA 2Y70A 3NAVA 4NASA 2XN1A 4KERA 5BCAA 1SW7A 3Q37A 3SGUA 3AC0A 4YPJA 4LS2A 4LUSA 1KFEA 2INFA 1EX1A 3S4TA 3RF9A 3TYEA 4KBXA 2J7BA 1DBTA 4RLIA 4TX8A 1OABA 1FFQA 2E6YA 1RR2A 1US0A 1B0IA 4GJIA 2BBFA 3D3FA 3D0CA 3RPTA 1H7XA 1FH8A 3E74A 1V77A 4ORIA 4C6LA 3TTOA 3T0CA 4DLMA 5A6JA 4O16A 2HROA 4NJGA 2E09A 2VKZG 3R7MA 9CGTA 1O68A 2P50A 5HJLA 1S2UA 3VDHA 3U7BA 4PMUA 2WMIA 4JAWA 4E5TA 3HFTA 1P0NA 3USBA 2ZYFA 5HWMA 3F03K 3S42A 2Z1BA 3RRXA 2NX9A 3AYSA 4IG2A 2CESA 4NZJA 4Z2JA 4QCEA 3S1WA 3ANVA 1C91A 4S23A 4Q4RA 4Y8EA 4QR6A 2VEIA 1TV5A 4PMVA 1TA3A 1GGOA 4LC8A 1MDRA 1CGTA 3BCJA 5T9BG 4K1WA 1CCWB 1KBIA 1N8WA 2OKTA 3GG1A 1WCGA 5LIWX 4CD8A 2Y4SA 3LOTA 4J2MA 2NLIA 3MCMA 5EB8A 3VMOA 4O8AA 4AF0B 4OVXA 2QV4A 4A8NA 4LRSA 1LQ0A 1NFBA 4DM1A 4NAFB 5CGQA 2JBMA 2VUNA 1EIBA 2XUCA 3S6DA 4YLWA 2HWGA 2GSHA 4LC6A 3MA8A 2R1PA 4GBDA 4JPGA 4D2JA 1PZ2A 4KRUA 3WJXA 1TSIA 2Q3OA 2DH3A 3UWYA 3PFMA 1QMLA 4MIMA 3WLKX 3GC2A 4JIPA 2ALDA 1JCYA 1WDRA 4PL2A 3OBEA 2Z1KA 2VZOA 4R88A 4C6QA 5DY3A 2CIPA 2V82A 4DLFA 3URQA 1HT6A 1ZY9A 4LS1A 4HZ6A 3UNDA 5EMUA 4D71A 3KOYA 2ZZ5A 2GOKA 2GGIA 3R0DA 1H7RA 1WZMA 4S3AA 1UWIA 5BW6A 4U5IA 5CGTA 1Q6CA 3FYYA 4ATWA 2CBIA 1VPQA 5CC3A 2O9OA 2VXNA 1UA7A 1GW9A 4HU3A 3F4VA 4INFA 4TTGA 1QPRA 2PD9A 3OEXA 2V30A 3KVLA 4E4PA 3SQMA 4QITA 1UD2A 3GDMA 4QP0A 5CPNA 1OGBA 3WMBA 4D6GA 1PX4A 1EKOA 1EGZA 2GYIA 3W1XA 2ZUTA 2OODA 4JIRA 1OEPA 1E9YB 1F6PA 3SI9A 3PZNA 1YYAA 2R1NA 2YSWA 2OELA 3BANA 3MZNA 4LVFA 3DOPA 4W9TA 5EBAA 3THDA 1P6BA 1JZ5A 3QFEA 1OY0A 1B4EA 2CKRA 3KTXA 4ZXOA 5BOFA 1RSCA 2Z00A 2J7GA 3PUDA 1CXEA 3BLPX 3GU9A 3WQ8A 3OBKA 2W4XA 1KFLA 1Q6EA 1SJBA 5D9MA 1Y0EA 3W7CA 1AD4A 3LMYA 2H8ZA 4LT9A 1KV5A 3N25A 1V4YA 3MQTA 4ML9A 3M0VA 2E6DA 3FCPA 2OB3A 4YYCA 3QW4B 1LLWA 3VCCA 3EB4A 3G8EA 4X22A 5FJJA 2ZTJA 2Y7FA 7ENLA 2YFNA 4FOUA 4RPQA 3GNDA 1JCXA 3KL5A 3T0DA 1XLAA 4HBKA 4L65A 3S6OA 5T9CE 4PN2A 2O9PA 1XF0A 3CIVA 1OFAA 3BG9A 1WB0A 2GK1B 1E0VA 4LEFA 4MFEA 2XYLA 1THFD 1YXCA 3MJMA 4HNOA 1KQZA 1IT7A 3WEOA 4JY8A 2G50A 1B3WA 3H23A 4S1FA 2HRWA 2ANUA 4GZJA 3FK4A 3GAKA 4L9XA 3RXZA 5D8ZA 4HNNA 3LEPA 4B5UA 4F2UA 4GYKA 3T07A 3QVQA 2VZSA 7CGTA 4DZIA 1HGWA 4A2SA 4MNMA 1UW9A 1W1TA 1WZAA 2QJIA 2VEGA 5G4WA 4ONVA 1KM2A 3WDIA 1O60A 4OWGA 2V5KA 4WKHA 2LLEA 3EWUA 1EXBA 5EY5A 4H3DA 3BSGA 5C2CA 5DMNA 5M2FX 3VUSA 3PBWA 2R14A 3S1UA 4GINA 3W1PA 2HS8A 1Q6GA 3HGRA 3WK3A 4ZODA 1W0MA 1WE5A 3W1QA 5A8QA 2PWVA 2X1UA 2CNCA 2DZUA 3GXDA 3E0LA 1RXOB 1TR9A 2XH2A 4GVIA 8XIMA 2CHNA 4PB4A 2GPTA 1XIHA 4GYJA 2NX3A 2EQDA 1EDGA 4MZ1A 1KWGA 3C2VA 2XVKA 5CC6A 2D73A 3CIXA 3H7UA 2HEJA 3LPOA 2ZA1A 4LV9A 1XH0A 5FL0A 4J28A 1EOKA 2P76A 5BMWA 1W3KA 1V0NA 1ESWA 3S2CA 4W7VA 5I77A 1GKRA 3W25A 2BZNA 1XBXA 1JCNA 3BJFA 4UQEA 2C8NA 2AL2A 5E5CA 4XSLA 1V02A 3WENA 4OOZA 2WXDM 5HA7A 4H2HA 1BWLA 2GVLA 3MS8A 4IP4A 1N8FA 1EJRC 1GQLA 2G96A 1WAUA 3AUJA 3WD0A 3KBMA 4GPNA 4DO7A 3S6TA 1R30A 1UPPA 2A4AA 3B9AA 4IQEA 1H09A 5I3HA 4QRNA 1XLBA 4GI4A 2Y62A 4Q8QA 4JTCA 2WHMA 3T44A 1UD8A 1EGVA 1VFFA 5IBXC 2VGFA 2ISVA 3CV1A 1FCUA 5LIXX 1QXLA 1XIBA 4AB4A 4RPPA 1ITUA 3GHSA 4JKKA 3H54A 3BW3A 1JULA 4JTDA 1A0EA 2XH0A 1NDZA 1IXQA 4BF9A 2NVDA 4HHLA 1OFQA 2B0MA 3N6HA 1I2OA 3COTA 1LWIA 4M6QA 2PCEA 1UMLA 1UWAA 1BVNP 3LA4A 4MHBA 2DZAA 1TB3A 1JGMA 4WY0A 3EX1A 4IP5A 4JYFA 4AZGA 4S2CA 1NF7A 3W00A 4P8WA 3DI0A 1DJHA 1GKQA 2FGLA 4MVAA 1TPEA 3DDMA 1KGWA 4Q3MA 2R1LA 1E0WA 5CZ0A 1E5JA 2RJHA 1E55A 4JY9A 3W7MA 3MUZ1 3UG4A 4XKYB 4LS0A 2GFTA 1XYLA 2VR5A 4WK9A 2WQDA 4GUGA 4P7LA 4E6MA 1TMLA 3QW3A 1VFMA 4WQ6A 3GG0A 2H8XA 4P8VA 3T9PA 3KCJA 1E4IA 1FWFC 2C1HA 4EANA 3WF4A 4PMDA 1QBBA 3GX9A 4JKMA 1QW9A 1SFJA 3KOFA 1PKMA 1PDYA 1C90A 3R0UA 3T78A 3SUWA 4DWSC 4C1KA 1K8YA 4C6OA 4DWSD 6XIAA 4LANA 1QNRA 4M24A 3O0KA 3FW6A 4NU7A 4X9YA 4K36A 2J9XA 1LBMA 2KAUC 3C0SA 1R3TA 2J47A 4FA3A 3EWXA 3GU2A 4KFNA 1YIXA 2HNEA 1EF2A 4ZEPA 2OGYA 3IANA 2Y8UA 3PBGA 1L0PA 4L6OA 4IGNA 1MQPA 3VDBA 3HGOA 1QDSA 2CWXA 1TE6A 3U4AA 1WDPA 5LXEA 1W3NA 3CASA 1UD3A 5C70A 2YGYA 3ABXA 3F2CA 4QDWA 4WUIA 4DI9A 2DZBA 3VNKA 4XQ6A 1Z8AA 1A0DA 1VCVA 3QPEA 5HJXA 4RE2A 1PDZA 3NG3A 1J11A 1Q13A 1X8FA 3ZWTA 3MZ2A 3R2GA 3AZTA 1TE1A 4PB5A 2OZ8A 3L4VA 4ZE5A 2VQUA 4JCLA 1XG3A 3CT7A 3A4AA 4P5UA 3SDOA 2P1FA 4NY2A 1A49A 4MADA 1ZJHA 1XQLA 1TVLA 1NH6A 2GGJA 4DWSB 2PDJA 4XZIA 4DO4A 3ZFHA 2WSPA 4AX7A 1GVOA 3NNTA 1D9EA 3NPUA 1XRTA 3P0WA 1JDDA 4Z1DA 2RUSA 4N6FA 5HNNA 2PGRA 4XIMA 2VZUA 3A3HA 5CBJA 1TTIA 3G3MA 3N17A 4FS9A 2DPEA 1I60A 2WJEA 3EEGA 3UZZA 5GNXA 3RNDA 4AD2A 4GX9A 3WBXA 3OGSA 2ACUA 1M9HA 3KLKA 3VYLA 2OOGA 4IX0A 2QMKA 4C6EA 4PC8A 4LQ1A 1OT2A 1E1CA 1VCFA 4IQDA 3M9YA 3KCLA 1A5AA 2PTZA 1X6LA 3UG3A 4H4IA 2X1IA 4ZTYA 5D38A 4UTTA 3ARXA 2UY3A 2ZRUA 5ABFB 1AMYA 5HQMA 2GJLA 1R8LA 4PCFA 3NQBA 4AZ7A 4FXJA 3KTCA 3UZYA 4AG0A 5AVNA 3TROA 4CCDA 3GAYA 2PF8A 3MSYA 1TYGA 4H9TA 4TR9A 4TMCA 5C2XA 3QYSA 1Y7VA 3PUOA 1PTGA 1VBGA 2YW4A 4D6CA 4Z2LA 2EKCA 1CLKA 4DF2A 4IPNB 1QW8A 5DMLA 4G7EA 1XCXA 3EXTA 4AF0A 3SZ8A 1HW6A 4AHOA 2WM0A 3H22A 4MLJA 4IJRA 2RGMA 1YX1A 2ZXAA 4NAFA 3AXIA 4O1EA 1XLMA 4U31A 1Q45A 1ONWA 1K8XA 1NWRA 3WUBA 5M03A 3NSNA 3T4WA 5C7VA 7ODCA 2P88A 3WNLA 1E56A 3PZIA 4YNGA 4RL3A 4D8AA 3GQYA 2PCQA 3RN6A 2Q3RA 1AJZA 1ZBCA 2WJZA 2BY2A 3HPZA 4MJ2A 1IE7C 2PDBA 4C91A 4I9TA 2BOGX 5M1TA 5JU6A 3B8TA 1OC7A 3TK7A 3VGDA 1D8CA 3ARQA 1K8CA 2PDHA 5CAHA 3SBFA 1VS1A 3K4WA 2JF7A 3QJAA 1OQFA 3AS1A 2OWCA 2PZNA 3FAXA 2ZZ1A 3GXNA 4R7WA 2X2GA 3S47A 1XIDA 2ODOA 3B9DA 1TQJA 4HIBA 3L4XA 4AWSA 4EWND 1X38A 2CZEA 3IUIA 1S5MA 2DJXA 1KBBA 3MWCA 1IGWA 3QQ1A 4US5D 1VF8A 1WXZA 3OZYA 5JH2A 3WKZA 3ZYZA 1DTUA 3ZO9A 3TOYA 4C6BA 1OK6A 2EGZA 5G1MA 2QNEA 5AKQA 2QGYA 3HQPA 4D8ZA 2EHHA 1WA3A 4HA4A 1W1B1 3T0BA 3W29A 4H7CA 3BOXA 4AZIA 1QUMA 2YB1A 5EMYA 2G4JA 4JHMA 3ECQA 4EKJA 2VEPA 1YDOA 4NHVA 1V7AA 3HURA 3TYDA 3BV4A 4FIRA 3V1PA 2I57A 2QKFA 1QI4A 3U5YA 3M5ZA 2IPJA 4XBJA 1J6PA 1OADA 3BO9A 1UWTA 1HJVA 2D2OA 1UCWA 1ZL1A 1QNSA 4TXEA 1W9PA 3A3XA 3VD5A 2BFGA 2PA6A 3N19B 2OEMA 4RE4A 3IRDA 3NYZA 1V6WA 5I3GA 4NYUA 3FJ6A 4XG1A 3UR2A 2E68A 2C1IA 4IISA 3NQGA 4GISA 1C9WA 4Z17A 4QAIA 3BQ5A 3BVJA 1Q6FA 1YPIA 1W32A 1WQ5A 3NQFA 2QIWA 5A6LA 4JNMA 1JFHA 3W7DA 3AHZA 2CHOA 3WK2A 4HQVA 3EPOA 4Y6GA 4EPDC 5E09A 1OYBA 4YJ5A 1JF5A 4HPNA 3ZOAA 1JYNA 2FGBA 3OA3A 1LDCA 5D9OA 5JIPA 1HO1A 1NTHA 1CTNA 3O6DA 5F4XA 1DWJM 5D03A 1VJIA 1AUSL 4IHCA 1E3ZA 3PPGA 5XIAA 1ME7A 5CBIA 3O8AA 4XZWA 4FZIA 1Y8BA 3IJ8A 3BXWA 3UFYA 1XDJA 4WHBA 4S3DA 2WV8A 4UXDA 4OU1A 2HVOA 3II1A 4JYEA 5AZ0A 2DORA 2CZFA 3I6EA 2QW5A 4ADUA 1SPQA 3QKZA 4A29A 2H3DA 3UWVA 1S2WA 1KCXA 1NWUA 3PSWA 2AGTA 3ABRA 1TWDA 3FSTA 3CV2A 1ZJAA 4L7ZA 1GT8A 2WVUA 3BSMA 4M6UA 1JQVA 3CBWA 1XV8A 2BY1A 4RCXA 4HD5A 3TN5A 3P0XA 3L2IA 4E38A 2PC4A 1UOZA 1G01A 1UYQA 4N6EA 1W31A 4HVXA 3LBMA 2A3HA 4GLEA 4R9XA 1H11A 1OIMA 2QCDB 3ORWA 1GVIA 2Y89A 1ZCCA 3L67A 2ZE3A 1V6TA 1EPVA 3VKCA 3IV8A 3V36A 3FY1A 1H5VA 1PEZA 3JVAA 1AD1A 4DN1A 4DJFA 4W7WA 2PDNA 1UIPA 2VZVA 2GDVA 4IIFA 4P7NA 4DIAA 1Q7QA 1CNVA 4RW5A 1NM9A 4LVBA 4JYDA 1EJ7L 1X6NA 3MHUA 4CN4A 1F4AA 3WIJA 5IHSA 2QCEA 3CK5A 3NZRA 2A3EA 3KXQA 5CZTA 1NDVA 4HSHA 3STEA 3UD6A 3V0SA 3PP7A 4CQCA 1LORA 4AYSA 2JK2A 3T0TA 1C7TA 3QBUA 1Q2SA 3ARWA 3KZPA 1KD0A 4QJ3B 1ZAHA 3WLNA 1TTJA 4AXKA 4FI4A 4J3ZA 4EVZA 5EU9A 3NM1A 2VFDA 5FESA 2Q6ZA 1ITCA 1H1YA 1TVPA 3B06A 3BZJA 1DWAM 1HKIA 1BQCA 3PNUA 4BZYA 3MUXA 2J66A 3T2OA 1D7KA 2J7CA 3U4FA 1CBGA 4LYRA 1OD0A 2A2IA 3NQ2A 2ADAA 3RRAA 4XKYA 2XIIA 5C9WA 3O7UA 3UA4A 3QM3A 2G3MA 3QZ6A 2I14A 3QV6A 4C6DA 2P8CA 3C3UA 2ZBTA 3A4WA 1I0DA 5XIMA 1J96A 1K02A 5K4XA 1E6RA 3MDUA 2OXNA 3WDPP 2BXYA 2OQHA 2W63A 3CAWA 4EX4A 3EKGA 2AMXA 4P8XA 4IFOA 4GY0A 4B15A 4QNWA 2XFFA 1FWSA 3H2FA 4DBEA 3TWBA 1QTWA 4XVEA 4H04A 2P0OA 4FSAA 4DZHA 4WOZA 1C8VA 3GH5A 4FNQA 5KZ6A 1KLYA 3V18A 4CEUC 3KDNA 2QJGA 3KWXA 1E70M 3CJPA 1MW1A 1PIGA 3MMWA 1ITXA 4H8VA 5JQ9A 1J10A 2YYUA 3AXXA 4O12A 2DDXA 5C9UA 4XUYA 4XX6A 3L5LA 4TV5A 1GNXA 4E2OA 1EXPA 1EDTA 1KR1A 4F40A 3UY7A 4M80A 3RX3A 1IIGA 1V7YA 3MCNA 4K7VA 3BLIA 3PJXA 3SY5A 3W7LA 3U2ZA 4EAMA 1K6WA 2WPGA 4Z0JA 3EDFA 1BPLB 1CIUA 4XWUA 1K9TA 1KM0A 3K1DA 3C2RA 2QULA 1ZSXA 4IFKB 3N2CA 3NQ6A 1JD9A 4AX6A 2R1KA 4GYFA 3SCSA 4EPEC 3UXAA 4HK6A 5C71A 4YTQA 3B3DA 4DWSA 2Y24A 2VWSA 3NVTA 1SO3A 5J04A 3AUOA 4LW7A 2DW7A 3ZM8A 3MYPA 2QF7A 4TU1A 3M44A 3UESA 4GCXA 3MVIA 3TQPA 1VC4A 3KCOA 2FPVA 4PUEA 5HOSA 2DP3A 4I3GA 2BHZA 3DH7A 4MSSA 1LRNA 1AL8A 1K4HA 2DZVA 4KCTA 1Q6RA 1J2BA 1OX4B 1XYFA 3OZPA 3S5ZA 1XR2A 1PIIA 5AYBA 1KFWA 3CGTA 4PUWA 1OYCA 4MWAC 2JALA 4OIFA 4AZ5A 2GWGA 4MWAD 2PWGA 2WAGA 3RO6A 2A1YA 2YLAA 2YOCA 1FHVA 1HF6A 2VR2A 4A3UA 3C0LA 1QT1A 4O50A 4FX6M 2FPYA 2YA1A 5EL1A 1RD6A 4K68A 3DGBA 4PUJA 4IPLA 5EFFA 3AS0A 8TIMA 1X98A 1JPMA 2QMJA 3FSUA 4DBDA 1TPUA 1AMKA 4TOQA 1V0KA 4LUTA 2ZVIA 1BSIA 3KBJA 2PWEA 3CUJA 5ABFA 2B4GA 2WW5A 3PBYA 1NELA 4KS0A 1SO6A 4U2YA 4AY8A 3WUFA 2C15A 2NQHA 4F8XA 2QF8A 1YW1A 1FWJC 4UTFA 1DYSA 4X0VA 5I3IA 3REQA 2HZGA 1LCOA 3THAA 4IXHA 3W1TA 5HBFA 3VDAA 4Q8WA 2ATSA 4QBXA 2FTPA 3RLVA 1Q7MA 3MI2A 1U5VA 4MPKA 3W82A 1AFSA 3NO3A 2V5DA 1QHPA 3DYMA 1V3KA 4AD1A 2DSKA 1XRSA 4DNHA 3UXLA 3ZWSA 2PDFA 3DIPA 2Q09A 1HP5A 2HPIA 3WEMA 3CQKA 2VFEA 4KWOA 1BG4A 1XIJA 3SGZA 4PMJA 1GG0A 2E4TA 2PMQA 1Y5XA 4N0RA 3VKBA 4V1YA 5HQEA 3UR5A 1PKNA 4QHRA 5CCZA 3UXKA 1TV4A 4S38A 3M5YA 2W79A 1OM0A 3W27A 3C6CA 3SFWA 4D6EA 1RPXA 3LS9A 3T7VA 1XC4A 1R3VA 1DWFM 1AQFA 2Y7EA 1JIBA 2NW0A 4XD3A 4MJ4A 5FA5A 4UTMA 3NPWA 2RJGA 4P7RA 4I5XA 4IMEA 3GDLA 3VNLA 1CGUA 5DXXA 3KS6A 2ZCGA 1K03A 5H91A 1UC5A 1IEWA 3GUWA 2H9AB 3RUBL 3EDKA 3WL1A 4A8RA 4UTIA 3QEZA 1MO0A 5BXPA 3BZGA 1OFRA 4B3ZA 3TC6A 2VRQA 3UPWA 1EEXA 4V1XA 2QCHA 1BWKA 3ALGA 1X39A 4LF2A 3TTYA 3AXHA 1T8QA 1VHNA 2ZTKA 3W2MA 8XIAA 3MBFA 3SCQA 3DG6A 5JIWA 3CUXA 1KBKA 1JEZA 3CZGA 2TYSA 6REQB 1KM6A 4ILSA 3GD6A 3E2VA 2FZ9A 2OT1A 5AHLA 3CIWA 2Z1SA 4Q4SA 2XU2A 2QCNA 1GHSA 3MO4A 3TTSA 5KZEA 1XC6A 2WMJA 4PUDA 1H2JA 4IWWA 1VRXA 5FJPA 1MUWA 3ABZA 1W9UA 3GG8A 1XG4A 4AWTA 2X09A 3H12A 1SW0A 5CG0A 2A3BA 4W7UA 1S5TA 4Q22A 1EJWC 2IQDA 3P8IA 1PX3A 4XB3A 3E49A 1YDYA 4UMCA 3M0IA 4JX6A 5IDZA 2WZIA 1KM4A 3IAPA 1R86A 3NTYA 1J9YA 5CPTA 4ICCX 2BGQA 1SO4A 2HCVA 5HULA 5CBBA 3PG9A 3VNMA 1GVEA 3W1LA 1G4TA 1GYLA 4J2PA 4CD4A 1XD1A 2XN0A 2WKJA 4MTVA 4R9OA 3QLLA 3QOMA 4IMFA 4I8DA 1PTDA 4WXZA 4JR5A 3CUFA 4IGSA 2C6QA 2P8BA 2ZA3A 2GQ8A 3GYEA 4R34A 2VURA 4L4PA 1I2QA 1BXNA 3ZJ7A 1ZBWA 1MYRA 1UWSA 1TFVA 4WDXA 1QI5A 2Y88A 4NJIA 3GU1A 3FX4A 2VUYA 1GWJA 1OCQA 3INPA 2VEMA 1S2TA 4ZE4A 1J18A 1LG2A 2WB5A 1OC6A 3N3MA 5BROA 2ZUUA 4LEQA 2XH7A 1QO5A 1GZ1A 4KIRA 1H3GA 2O4MA 4GHRA 1UR9A 2WCSA 3QY8A 4DY1A 4C7GA 5FJOA 4H83A 4FNSA 1CXFA 4LNCA 3W74A 1F6KA 2QCLA 3LGGA 1VYSX 3F5LA 1DIDA 4W4QA 1LL4A 2GZXA 2CBUA 4FIQA 4HPXA 2NXHA 3R13A 1V51A 1XRVA 4FF7A 5AYYA 2FZDA 3OVGA 4NSBA 1TJ0A 3HG5A 4ZXLA 3VIHA 4F3HA 5GJPA 2BP1A 4X3ZA 3KW3A 1E43A 3VOFA 3IPWA 3TZNA 2UY2A 4R27A 4KIEA 4RV3A 5A1AA 1F07A 2B7OA 4QS6A 3NWRA 4W5ZA 4NX5A 5LIUX 3GVRA 4MZ8A 2GWNA 1QWGA 3JUGA 2W92A 1AQHA 1ICSA 4XD5A 1KQYA 2WANA 1PCWA 2VFGA 2RFGA 3NEVA 4L4LA 2XZ7A 1NQKA 5HMEA 4D8LA 4NG3A 4UQ9A 3UYIA 4Q33A 1GTEA 4XBKA 1SZGA 1U22A 5FEPA 1XSKA 2XGBA 2F7FA 3WQGA 3RM4A 4BJHA 4NI8A 3PVFA 3Q45A 5HWJA 2F9RA 4TVDA 3K8MA 5KINA 1QI3A 3GLCA 4Z08A 1TPB1 2QPXA 4GUFA 1NWSA 1CWYA 3UR8A 4QQ3A 4YWIA 4DAFA 3E0VA 4HCDA 4QG8A 3D3AA 3AU2A 3N12A 5TF0A 4NJJA 1WBHA 1Q4WA 2RH9A 4NNBA 3C0QA 4QGCA 2W3ZA 5LZLA 2R1MA 3NVDA 2NSXA 3L4WA 1DV7A 2Z24A 4D6IA 4R85A 1EP1A 4UFHA 3RAOA 3BLOA 4IUOA 3UZXA 4Q6JA 1YXDA 2C16A 2W27A 3BW2A 3S5OA 6TAAA 1IWBA 1VBRA 1DKWA 3SCTA 1VPYA 3VA8A 3VNYA 1B3OA 1M7OA 4BQ2A 3LNPA 2OYLA 4PSRA 1R46A 3W7OA 1IXNA 2L5HA 1DE6A 2HJPA 2NWSA 3LENA 4H9ZA 3GW3A 4AVFA 1H0IA 4UTHA 3V0UA 1QASA 4LAKA 5D9NA 1YMYA 1BXBA 4ECLA 4KW2A 2XWEA 4FF5A 3IIVA 3SY1A 1Q85A 4ZOEA 2G5WA 3URAA 2WLZA 1LRTA 3DFHA 1U33A 3H24A 5FJTA 1JDCA 4Y9PA 3OIXA 1CXKA 3EB3A 1XYZA 4P8UA 3M6YA 3TUUA 4RKAA 4XZBA 3UW6A 4Q4KA 1M01A 2ZRXA 3TZFA 5CLTA 2WWCA 2PC8A 5EMKA 3B40A 1ZLPA 4YVPA 3IJ7A 2IQ0A 2ZDRA 3ATYA 5BRPA 3PBVA 2OX1A 4DHGA 3ZR6A 3AWNA 1B5TA 3GIQA 3FS2A 2GQ3A 1GEQA 4FXRA 2WCAA 2XVNA 3DBNA 3G8RA 3A4XA 4HPJA 3H55A 4MDOA 4Z2KA 3EX3A 2X8RA 4UQDA 4NZ5A 2VVNA 4GIRA 1H51A 4K3ZA 3OODA 4BS0A 3W88A 1VIZA 3CQHA 4H6KA 1EOMA 2QUNA 4M81A 3S9ZA 3WQ6A 2VMFA 2XTKA 1SJAA 4B5VA 4DPPA 1F7BA 3L2MA 2PEVA 1VR6A 3Q58A 5HPCA 1E9LA 5CC5A 3LTPA 4B3KA 3B4YA 1EA0A 2QDHA 3CTLA 2FVLA 2Y5SA 3WQPA 1H50A 4GNKB 2PLCA 1OBAA 4HJFA 2HMCA 4ZCWA 2TSYA 3I4KA 1C92A 1JAEA 3LCLA 3M41A 4TX9A 3PPHA 1P7TB 4IJCA 1WV2A 3J7HA 1OX4A 3ZJ6A 1K7EA 4DXXA 3PK7A 3GFXA 3QV9A 4QM1A 3LI0A 4JTLA 1GPWA 2WHKA 3TWAA 4H7VA 4G8TA 4Q7IA 3P84A 4W84A 1KTBA 2ZXDA 4GO8A 2CW6A 3NPXA 1R5YA 3WFLA 1RP8A 2Z1XA 1W6TA 1EO7A 2ZZ4A 2V3GA 4IIBA 3STCA 3ONCA 4WD0A 4C5ZA 2XJ7A 6TIMA 5L6UA 3QYQA 1A4LA 2B31A 3SURA 3N6QA 3PBMA 4LWWA 3EWBX 3UWZA 1EZWA 4IGHA 4J5NA 3PULA 4WDWA 2BMBA 2PDLA 1TREA 1QK0A 1M03A 1ISZA 4D6JA 4JKLA 1BKHA 4WKAA 4WLCA 1JZ3A 5EGRA 2HTMA 4DYKA 2VTFA 4UNLA 3GVVA 2Y1HA 2Y61A 2YCLB 2QYGA 1W1A1 4R3UA 1ZP4A 4CNOA 1BTCA 1VJSA 3NZ1A 5F2IA 4NVTA 3CO4A 3SEPA 4AU0A 1UPMB 1P6CA 5BXSA 5BYWA 3LN3A 5AVHA 1N7KA 1KR0A 1H7OA 4CU8A 3HQNA 3L4TA 3QQ0A 1UKQA 2XFWA 1VQTA 3CU2A 3H70A 1Q2RA 1AQMA 5IRPA 3HPSA 1W1ZA 3FGCB 4G1NA 4ATLA 1XH2A 4OTKA 2E9MA 1F76A 1KLZA 1GORA 2W5FA 3OLDA 4NQ1A 4MY9A 2TODA 3ARPA 2Z6IA 1ZUAX 4QLKA 2EAWA 2AAAA 3PS7A 1OGSA 3ABSA 2FJUB 2DSVA 3QRHA 4E4UA 4WGXA 3DU0A 2QJNA 3IWPA 1MNSA 2V6AA 2E0PA 3EYPA 5I78A 4JIEA 3N2TA 2ZQ0A 1JL8A 3QMTA 4JTUA 3ARRA 1XFCA 3U48A 5LGXA 2YDAA 3SRHA 1MVYA 3QR1A 4GUHA 1EO5A 3W28A 4DBUA 3AMGA 2QCGA 3PF3A 4XAGA 4P2VA 4HT3A 1ZGDA 3VZXA 3WZ0E 1IWAA 2I5QA 1VYRA 2X0HA 4J27A 3WLTA 1E6ZA 3W07A 3S83A 3OB8A 1FDZA 1SJCA 4JTHA 2JF6A 3UZWA 2H9AA 2WVVA 3PTDA 1UQYA 4QE1A 3GYCA 1F5ZA 2XSXA 1ZJIA 1KTCA 1MEIA 3B0VC 4MB4A 1W8SA 3LXCA 4XBSA 5DCEA 3W71A 3RMEA 4JGDA 3LX9A 1U1HA 3IIZA 2Q8ZA 2HE5A 2W9MA 3U2CA 4LCSA 2PF0A 2F2KA 3KRSA 3IGUA 3ITGA 2QEZA 4U2ZA 4QS5A 6REQA 4H8HA 1XKJA 4I9JA 2J9YA 4L4OA 1CYGA 1OF6A 3PPFA 1RPKA 2CHRA 1TZZA 4CKQA 4UR9A 2G97A 3ANUA 1X97A 1B31A 1QOXA 5C0QA 2X05A 3FJ4A 2F84A 2PD5A 1IT8A 4V2XA 4UMAA 5C8BB 3OP2A 2W6RA 3PTKA 2CC0A 3LHTA 4XTDA 4FHAA 1A5NC 2PE4A 4JXCA 4DBWA 3T42A 2AKZA 4IJBA 2OSWA 3N1AA 4FR1A 2JKPA 3PTQA 3WBYA 5TNVA 4HMCA 1IR1A 4PODA 2BTMA 4E2BA 3R12A 4TVCA 3TXZA 1CT5A 3TLLA 3TN6A 1MI3A 2VYOA 2GGGA 4O17A 1I2NA 3K4DA 1V03A 4PMZA 1CGWA 2JIWA 3VXGA 3N2BA 3PR2A 2FB2A 2HBXA 4N2YA 1XW8A 1W5QA 4CNPA 3GIPA 4Q8MA 4ZMGA 4UZSA 2QHAA 4CQBA 3LM3A 4BY3A 4XO6A 2GVJA 5FCZA 3SAZA 3WMSA 4C6KA 2ZOXA 1ICPA 1R0MA 3MMTA 3BOLA 3CB8A 1VFSA 3LU2A 1T7LA 3PWAA 3AQUA 3ICJA 3XINA 1D3HA 3AIVA 1L2UA 1XINA 2FHBA 4KGJA 4X60A 1Q6QA 4HU8A 3NZQA 3RPMA 1E6XM 2V5BA 4XV0A 1AJ2A 3FYOA 3TJ4A 5DX7A 4ZL1A 2C18A 2BGNE 1RVGA 1HXJA 3A5FA 3RJYA 1M5WA 4UCFA 4JHOA 1JI2A 5C54A 1SM9A 1I0BA 4E2VA 2ZIDA 1FKWA 1GJWA 1F3EA 3Q4DA 4CCZA 3C61A 3NXFA 3NSXA 4NXSA 2CEQA 1PPIA 3KOWA 4RNJA 5I3FA 4QROA 2O55A 4F0HA 2CLLA 3P5ZA 4Y96A 2HVNA 5LNVA 3W6MA 1YTDA 2E9LA 5LNWA 4ES4A 4MB1A 1XLLA 4PRWA 3R8GA 1ELSA 5FIPA 3NXLA 2Y6ZA 3SIZA 3AO0A 4X9SA 3THCA 3KS5A 1FCVA 4UUIA 4A3QA 5C5YA 3V5CA 1PZ3A 4MYAA 3CQJA 3AS2A 3DG3A 4GWEA 1FH9A 3NL2A 5AC5A 3MI6A 4FALA 4A3RA 3F2BA 3G0SA 2WQPA 3H8AA 3F5KA 1FWNA 1W1PA 2XM1A 2FJKA 3V16A 3O6YX 4I6KA 1W1IE 1F73A 3CH9A 4Y90A 4PMYA 1HFBA 3VD7A 4AZCA 2Y7DA 1QU4A 1AODA 3S5SA 3G1RA 2G41A 4DNMA 3SRDA 2POZA 3UBPC 1KNWA 3RG6A 3AYVA 5E0KA 4IUGA 4MLRA 4U28A 1Q6LA 3DESA 1UR3M 1IR2A 5EYWA 3HPXA 3TJLA 1L9WA 4YTTA 3TCSA 4AIUA 4B9ZA 1M65A 2ZXBA 2ZVRA 3V5FA 3LZ5A 2TRSA 4Q4PA 1W3HA 3NOYA 1K1DA 1J12A 2FLIA 3GUGA 2YCKX 4GY1A 2Z29A 1F9CA 1EJTC 3U57A 2JE8A 3FYPA 3HMJG 2DIEA 1M41A 2XHYA 3CYJA 5HWNA 1KKRA 5LHEA 3TFXA 5FF0A 1U30A 3DYOA 2ACRA 2OX4A 5E70A 3B8UA 1POJA 1C8QA 4S3JA 4H9XA 3GTNA 3VIKA 3WLRA 5DQPA 3MSRA 2BY0A 3URBA 3C2EA 3RILA 5CPMA 4OE7A 3V5OA 1GK8A 3FOKA 2PWFA 3ME3A 3IARA 2J88A 4Y9OA 5C9XA 3VNZA 2OG9A 5E6ZA 2WC7A 5IHRA 2NVCA 1JRBA 4G9PA 2VNCA 4JL1A 3OBAA 3QF0A 4XAZA 5I7GA 3WH9A 1IXPA 3FN9A 2NUWA 3N18A 1IEIA 5FAGA 2W62A 1KFKA 1E3XA 1IZJA 3NPVA 3AMDA 5AC4A 4B5SA 4AMCA 4M82A 5GJMA 2ZX6A 5LIKX 1EJXC 2XIMA 1K9FA 1PUDA 3TAKA 5BOOA 2OPJA 1ZZMA 2YCJA 3MDWA 2X1RA 1R9XA 1V3MA 3B8WA 3G77A 4X2PA 2XM2A 1HL2A 3N15A 2XSAA 2WHLA 4U4MA 3TIMA 1UHVA 2HK0A 3CUIA 1FXQA 4ZOAA 3YPIA 3C2FA 4QCFA 4LBRA