1S1PA

Crystal structures of prostaglandin d2 11-ketoreductase (akr1c3) in complex with the non-steroidal anti-inflammatory drugs flufenamic acid and indomethacin
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of prostaglandin D(2) 11-ketoreductase (AKR1C3) in complex with the nonsteroidal anti-inflammatory drugs flufenamic acid and indomethacin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
total genus 119
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1s1pA00
4GQGA 2HV5A 4PRTA 4QX4A 2HDJA 1A80A 2I17A 4WRHA 4XAPA 2ACSA 4ZFCA 4WDXA 1K8CA 2NVDA 4WDTA 1MI3A 5AZ0A 2FZ9A 3RX4A 1EF3A 4WDWA 1S2AA 1T40A 3GUGA 3H7UA 3GHUA 1US0A 2PDXA 2IKIA 2IQ0A 4FAMA 3MB9A 2ACUA 3LD5A 4JTQA 3RX2A 1Z3NA 2PD5A 2DV0A 3FJNA 2PDJA 2ALRA 4YVVA 1XGDA 2HE8A 3P2VA 4PUWA 5LIWX 1PZ0A 1Z9AA 4XO7A 3R94A 1SM9A 3LENA 1X98A 1PZ1A 3V0TA 2IPWA 4EXBA 3Q65A 2FGBA 4WEVX 1PWLA 3CV6A 4GIEA 1YNPA 3LQLA 1IEIA 3R58A 4DBSA 3LZ3A 3FX4A 1ZSXA 2IPFA 1Q13A 4LB4A 3WBWA 3UG8A 3T42A 2IKHA 5JH2A 3LNMA 1S1PA 2PDFA 2WZMA 4WDUA 4JQ2A 2IKGA 3QKZA 1RY8A 5M2FX 2R9RA 4GA8A 3WBXA 1RALA 2INEA 2PDMA 1OG6A 3UZZA 3D3FA 2PDHA 5DANA 2A79A 2HEJA 3UYIA 1AH3A 5C7HA 2DUXA 2PD9A 3C3UA 5HNTA 4JQ4A 2HVNA 3DOPA 3LQGA 2VDGA 4JIIX 2HVOA 3UZWA 3CAVA 1LQAA 3F7JA 1PYFA 3BUVA 1MRQA 4NKCA 1ADSA 3EB3A 5LIUX 3WCZA 4XK2A 2PDPA 4YVPA 4LAZA 4XZMX 3LN3A 1X97A 1YE6A 1AFSA 1HW6A 3UFYA 4JQ3A 2IQDA 2IKJA 1AZ2A 2PEVA 4RPQA 2PDGA 1UR3M 3ONBA 4GACA 2PDUA 4Q3MA 3M64A 3R43A 1VBJA 1Z8AA 4ICCX 3U2CA 4PMJA 4FA3A 4I5XA 1EKOA 3DN5A 1HQTA 4JTCA 2FZ8A 3G1RA 4XVEA 3WBYA 1AZ1A 1JEZA 2J8TA 4PR4A 2ACQA 4MHBA 4GQ0A 4JQAA 2PDQA 1J96A 4F40A 4OTKA 4PRRA 5LIKX 3B3DA 2PF8A 4LBRA 4LAUA 3LZ5A 1YNQA 2IPGA 2FZBA 1FRBA 3UP8A 3LEPA 2HE5A 5HA7A 4DBUA 1S2CA 3BURA 1C9WA 3R7MA 3R8GA 3M4HA 4LB3A 4FZIA 2PFHA 2P5NA 3UGRA 2ISFA 4HMNA 4IGSA 3EB4A 1Q5MA 1XJBA 2WZTA 1T41A 3M0IA 4Q7BA 2QXWA 3V0UA 2PDWA 2BGQA 4ASTA 3UWEA 2F2KA 4XZHA 3NTYA 2CLPA 1XF0A 1R38A 3R8HA 5JH1A 2FVLA 3ERPA 3KRBA 4L1XA 2IS7A 3BCJA 1IHIA 2PDNA 3Q67A 4DZ5A 1MZRA 4GABA 2F38A 3CMFA 2I16A 3CAQA 4FALA 2PDCA 1Z89A 3CASA 1X96A 4XZLX 3BV7A 2BGSA 3ONCA 2PDBA 3EAUA 4IJCA 2NVCA 3GHSA 4XZIA 4XO6A 2PZNA 3S3GA 4G5DA 4WGHA 1QRQA 4H8NA 3CV7A 3V0SA 1YE4A 4YVXA 2AGTA 3GHRA 2C91A 3N6QA 5LIYX 4AUBA 4JTDA 1RY0A 3WG6A 2PDLA 3UZYA 1ZUAX 3VXGA 3LBOA 4H7CA 2DUZA 3O0KA 3COTA 4JTAA 1M9HA 5LIXX 4YS1A 1AH4A 4EXAA 2PDKA 1VP5A 4GCAA 1PWMA 5HNUA 3N2TA 4R9OA 2BP1A 2INZA 3V35A 4L1WA 4DBWA 3G5EA 4IJRA 3V36A 3R6IA 2ACRA 3H7RA 3MC5A 4JIHA 5AZ1A 1AH0A 2IPJA 3LUTA 1EL3A 3O3RA 4JQ1A 3H4GA 4PUUA 4YU1A 1LWIA 2PDYA 1QWKA 4JIRA 4QXIA 1ZQ5A 2PDIA 4JTRA 3RX3A 2R24A 4QR6A 4QBXA 1S1RA 1EXBA 1GVEA 4LBSA 4XVDA 1ZGDA 3GHTA 4XZNX 5KETA 2FZDA 4HBKA 3UZXA
chains in the Genus database with same CATH superfamily
1KD0A 2WMFA 4QM1A 4GC3A 1BVWA 1THFD 3QR1A 2F7FA 3KHJA 4GNVA 3GD6A 4YTQA 4DQWA 4LU0A 3DFOA 4QDMA 1XLGA 1RH9A 4QCFA 3W87A 3A21A 4B3ZA 1NDYA 3CWHA 3SSJA 1LCOA 2YW4A 1EQCA 4CQBA 3ME3A 5FF7A 1NWSA 1U1JA 3V5CA 1UBSA 2W62A 1IYXA 3W6MA 2QJNA 3PWIA 3U9IA 5D09A 3L9CA 1FQ0A 4C6DA 1KBIA 1EDQA 3LERA 3KTCA 3RK8A 3STCA 2O4MA 3MWAA 2KZHA 1V02A 1GJPA 2XGZA 2QCNA 4H01A 4ZOAA 3L4TA 1SW7A 3RIKA 3OZMA 2A3EA 1WZAA 4CNSA 4YVVA 3MCMA 5I3JA 1EO7A 1XW8A 1OFPA 3LLFA 3LHUA 1XFBA 3D6NA 1W37A 2E28A 4ZQOA 2OEMA 5LYRA 3MANA 3W7EA 3UG4A 5LIWX 1W3KA 2FFIA 2WHLA 3REQA 2HPMA 3OTRA 4KQNA 4GZIA 3OVRA 1ZP4A 3NGFA 1NELA 1DE6A 1P7TB 1JDCA 2OGJA 1KRAC 4NP7A 1VRDA 1TSIA 1IXQA 2OKOA 2OLSA 3CBWA 4HSHA 1O5KA 3P7YA 4L61A 3NQ7A 1S38A 4HK7A 4ZEPA 1C93A 2DUAA 5FESA 4K38A 3L21A 2IKHA 5FAGA 3VX0A 2PTXA 3H2CA 3TW6A 1HGWA 4UMAA 1BFNA 1R3RA 2ZA2A 4QAWA 1VLIA 5D8WA 4JFUA 3K5XA 1ZALA 1XIBA 3VDBA 2VEGA 3P3BA 4MDPA 5I77A 3CZEA 4JKLA 1EH9A 4CVWA 4A05A 4O50A 5I3IA 5T8GA 1K03A 1UMYA 1ZU8A 4JIIX 2QEZA 5LNSA 3BK0A 1UZHA 2QCEA 3OYXA 4J40A 3KBVA 2TPSA 2PAJA 4WD0A 2B7QA 1TWZA 6XIMA 3AHYA 1MRQA 1EJTC 1BTMA 3KL3A 4H41A 5D04C 2QAFA 6XIAA 4ZMGA 4B9YA 1GQLA 1IV8A 5I3HA 1A5OC 5K9DA 4I5RA 2J88A 4ROQA 4J7RA 4CU6A 4FR6A 4HNNA 4WJXA 1S39A 1JULA 2O7QA 1LL6A 3K4DA 1KW1A 3WIJA 4JHMA 5HOSA 4CD7A 1UR3M 2W5FA 2JKEA 4R7WA 5I7GA 1VBJA 1J79A 1Q4NX 3UXDA 2WCGA 4E3TA 1V79A 4QLLA 3DN5A 4ZFMA 3DZ1A 1NM9A 1SSGA 4OOUA 4XVEA 3MPGA 3C2FA 3LM7A 2VQTA 3BQ6A 1U1HA 1GVYA 4YTTA 3NQDA 3WNOA 2CBVA 3M16A 1B3XA 4V28A 4QNWA 3QPEA 5JBFA 1V3KA 1KXHA 1PEZA 4CLMA 1Q2RA 3G6LA 1NSJA 1C9DA 3N19B 4Z2KA 4OZOA 1DHKA 3UP8A 5LGZA 2RJHA 3VIMA 4D8AA 4DXVA 2WMJA 3E0VA 3WMCA 3HPFA 3L67A 1NQKA 3NZ1A 2CW6A 4MLRA 2ISFA 3E3HA 1XIGA 1Y5WA 1CWYA 5DRIA 1T41A 4M19A 2QUUA 3S2NA 3W6LA 3VCCA 4AZCA 4ZSUA 1FWBC 2PDWA 3HV8A 4RDWA 4JL2A 3MSYA 3QC3A 3QHNA 4PZVA 2V30A 2Q8XA 5BXTA 4LVGA 1AQMA 3BLFA 3NTYA 5LXEA 4GI9A 4CQ9A 1P1MA 3PZGA 1W8SA 2VEKA 1EPXA 4PMXA 3GXTA 5HUOA 1A5AA 4L56A 4IP4A 1VBGA 1CGWA 4B5WA 3EMCA 4O1AA 4LALA 4WZHA 2D2GA 1W54A 1UHVA 5TNVA 1X96A 3QQWA 1PZ2A 2ZZ6A 1BEUA 4Z0SA 1WDSA 3BLLA 1VJIA 2NVCA 4GD0A 4XZBA 1PE1A 3M43A 1QRQA 3II1A 2Q8LA 3CV7A 3EEGA 1N8FA 4F66A 3UWZA 3QHOA 2AGTA 2G3MA 1HJQA 2EPKX 3SM0A 3BAJA 4EVZA 3H2AA 2DY3A 1CXKA 5JBEA 3CYVA 5L6UA 2NXHA 4C6OA 2Y7EA 1UROA 1QW7A 1ZUAX 1PS9A 1TPUA 1NDZA 4N02A 3NQ8A 2BOGX 1UR4A 3S6OA 3UR8A 1JPIA 4EAMA 1IXPA 4AF0B 2B0MA 3KOZA 4Y9MA 4PMUA 5CH9A 4AXNA 3WLMA 2BP1A 3GQYA 1PHQA 3V35A 2RDUA 1S5MA 2NSOA 1VJSA 1CPUA 2Y6ZA 1FXPA 3PWAA 3ZLFA 2C7FA 1LT7A 3M47A 3MC5A 3L4ZA 1XRTA 4U4MA 4DX3A 4LC6A 2WJZA 3EPMA 2OO0A 2WNNA 3HMJG 1T8XA 1XHGA 4GXWA 1ESWA 1KWKA 2VR2A 3KP1A 2VO5A 2NT1A 4UOQA 5LZLA 1UWQA 5AC6A 1XRFA 3AMGA 1OZMA 1EDGA 4GOAA 1SO3A 2O56A 4MZYA 3JRKA 2PDIA 2EKCA 1YTKA 4XUGA 1DQXA 2RGLA 4CCZA 4UFJA 5M1TA 1PO9A 1S1RA 3WEZA 1K6WA 1VFFA 3VMPA 2QCMA 1H09A 1PTAA 4D71A 3OG2A 2QF8A 5CAHA 1UP2A 4RPPA 2CIPA 3GHTA 3N04A 5J5RA 2X1TA 1CGUA 4HBKA 3IJLA 3SN1A 3O6YX 5K4ZA 3ZM8A 1KM5A 4KWVA 1F3TA 2YXGA 1MQQA 3ZJ8A 4DWSC 3B04A 4GUJA 1RP8A 2DIKA 2V2CA 3H23A 4TTGA 4BWLA 3HO8A 5IXEA 1JZ2A 2NVDA 1KCXA 1BGAA 5HAOA 2EJ1A 3BO9A 4W7WA 1OD0A 4WDWA 4AEFA 1CTNA 1T40A 4KRZA 2BODX 3RR4A 2DZBA 4I9AA 1WYIA 3CWNA 3TCSA 4FPSA 3HA1A 4JTIA 1EO5A 1P1XA 2A6LA 2WANA 2BWGA 3N6HA 1TYGA 3THDA 2FPYA 1XC4A 2XHYA 3VOIA 3W2MA 1U1UA 3SIMA 2XH0A 5FKYA 3O1NA 1NOUA 2WOQA 3FJNA 3P62A 1H49A 1G5AA 4AG0A 2W3ZA 2E6YA 2BLEA 3O7UA 3I6TA 5CLTA 2I57A 4MUZA 4BEQA 4Q4RA 5AYZA 4IGHA 1PZ0A 3IV3A 4IFRA 4ACYA 3UZ5A 1HVQA 2EJAA 1BRLA 4M6UA 5G1TA 3N2XA 2ZRVA 3KVMA 4KEMA 4ZCWA 4EXBA 5FD0A 3C0QA 4K6AA 3GTFA 3BDKA 1P5BA 1FOBA 4F0RA 3DAQA 1Y5VA 3WJWA 4EF9A 7CGTA 3ZMRA 5HJLA 1OYAA 5FF2A 3T42A 1KNWA 2GYIA 3HG4A 3PB2A 1O5RA 2NQHA 4C1NA 1OCNA 1RY8A 5LHEA 2FIQA 4L5ZA 2HVMA 3VABA 4GA8A 3V3WA 3B8WA 2VX5A 3N15A 4O19A 3NYDA 2AMXA 2QUVA 4AY1A 5CGMA 1E0VA 2PMQA 2C6QA 1OWQA 3LQGA 1NDVA 5HMEA 5HR6A 1A0CA 4DF1A 2DQWA 3PZOA 3M6DA 4HZMA 1ADOA 3K4AA 2QS8A 3CZ8A 3TNBA 1DPMA 2OWCA 5CJNA 4MFDA 4JEQA 2VR5A 4A8LA 1Q6DA 2WVVA 1V51A 2Z26A 5C7VA 4IFOA 1OB0A 1KKRA 4LAZA 1VC4A 4E8DA 2NUWA 4O1BA 4POCA 4JNMA 5I79A 5G5IA 4JFSA 1QPOA 5A6MA 2X0YA 1SZNA 3IJ9A 3BTNA 1O7AA 2CHOA 3GIQA 3N17A 3W7CA 2G3NA 1E15A 3TN5A 4X63A 3S4TA 4S2CA 4GO9A 4UQDA 1Z8AA 1KFWA 3GG7A 1EKOA 2VFIA 2A3HA 1XLHA 1UQZA 1GCYA 4KEZA 2VFHA 3LCGA 1JDAA 4DF0A 2ISSA 2PUZA 2FTWA 4LAMA 3ATZA 1REQB 3RR1A 4E2BA 1K3UA 1HF6A 3KDNA 1N8IA 3FA3A 4ZQMA 3ZIZA 3S83A 4ZODA 3W1NA 3RCYA 2ZXBA 1O68A 5EU9A 5I2UA 2BHZA 2DZTA 2Q01A 2J75A 1W3LA 3CO8A 4AHPA 1GOKA 3LV5A 1PCKA 3AXMA 2XSXA 1S2CA 3P8JA 1DQUA 1ZAHA 2E9LA 4AYSA 1R30A 1E5NA 3KVJA 4R34A 5XINA 2ZRYA 1J18A 1LF1A 2CEQA 1RZMA 4BF5A 4UMCA 3UWEA 4C6QA 1TE1A 3ZLHA 1YPIA 3K8KA 1JYVA 3TV8A 3TX9A 5TQLA 3MMUA 1CXIA 3KRBA 3THAA 3VNDA 3AMKA 3MU7A 2BHYA 5JIWA 3JW7A 1IHIA 5IBXA 4DZ5A 3MP3A 1OFOA 4S3DA 5HWMA 3NZQA 4XX6A 5BMXA 4GC4A 3E1F1 2EG8A 1QBAA 1LG1A 4HPGA 1U5JA 3DUGA 1CGYA 4WY0B 4UQ9A 1WAUA 3VIIA 1W3IA 4E6MA 3QGVA 4H7ZA 2FB3A 3VILA 1GEQA 4C6CA 4P7LA 4RXGA 3W1RA 4ZQNA 2WC4A 2QVNA 2YBVA 1GORA 3NXFA 1B5TA 3SFWA 3T0DA 2Z27A 5RUBA 3FW6A 4XKMA 4FK9A 2YW3A 4E5TA 5KZEA 5DT5A 3EMQA 1F61A 3TSBA 3PZUA 3AZRA 3G77A 2Y7GA 5KEZA 1UMLA 4CCCA 3RLVA 3U5YA 2QUTA 5EMUA 1VP5A 1PYMA 1FP8A 3HJEA 4J28A 3KZPA 2F6UA 4CNNA 2XU2A 2CHRA 1HJUA 1GHRA 4NU7A 3NQBA 2D0HA 5C9WA 5M17A 4PB3A 3CQKA 4D6JA 4C7FA 1ONEA 3DENA 5AZ1A 2BXYA 3HG2A 1CB2A 3LPOA 3QY7A 4DY1A 4O13A 1ZLPA 2H9AA 1GVOA 1IT7A 3CJPA 1TJPA 3WLSA 4LEFA 1ML1A 4P61A 3N3MA 2AKMA 5EB8A 5CSUA 3I3EA 2VJXA 1L6YA 1VB9A 3GTNA 2Y7DA 5AYXA 1ZBKA 1GYNA 5DQPA 4XVDA 4HVXA 2JGQA 1UWAA 3HFYA 3UNTA 4H9YA 1I2RA 3SR7A 2E5CA 5FL1A 4W5UA 1OGBA 2FMNA 5A2BA 2CWNA 4YWSA 4AC1X 4R7JA 1RA0A 1K77A 1V03A 3DBNA 2WM1A 3G18A 1FWCC 1K9EA 1EJXC 3ABRA 1VZWA 3VCNA 3U4FA 2CERA 1JCMP 4A2SA 5K3VA 4M56A 3C8NA 4EKJA 4FNUA 3GDBA 3GBDA 4TUFA 3IJ6A 3P60A 2WWCA 3BAKA 3V1HA 5HXMA 2XIMA 3HQPA 3IARA 4LBUA 1OABA 4DJFA 4EP8C 4G1KA 4NAFA 3G8EA 1S2AA 4YTUA 3LU2A 4P7NA 1ICPA 3SSZA 4NJKA 4DUXA 2IKIA 1JPKA 4E8CA 3LHYA 2ZQ0A 2P10A 4KCTA 3SCRA 1VHCA 2ACUA 1O5QA 1OK6A 1JXKA 1FCBA 2OYMA 3RX2A 3O63A 1GQKA 1FWAC 1KGWA 3MJMA 3RG6A 3P2VA 4QG6A 2ZX7A 3FXYA 4IPJA 3IJQA 3WQOA 3DC8A 1A53A 1W2VA 1Z9AA 2XIQA 2WHKA 2DORA 2NX3A 3JUGA 1NP0A 5REQB 1SM9A 3L65A 3N4EA 3IUDA 3DFYA 2NQ9A 1JZ5A 2NUXA 1TVNA 4QISA 2JFEX 4I7UA 3TTSA 1R5YA 3PJUA 1MQRA 5LA1A 1CLKA 1IEQA 4N42A 4KH2A 4ORIA 2I5QA 2NLYA 1V6UA 1OF8A 3RF9A 3IV8A 5D38A 1QCWA 2HBVA 4MLJA 4KERA 3W9ZA 2O9PA 1RA5A 3ZSTA 1XKJA 1S5NA 2NV2A 3O6DA 3VKJA 4NJJA 3AICA 4NL1A 1RALA 2FKPA 1OG6A 3TTQA 4D2JA 2VCCA 3OBEA 1D3CA 1HP5A 3UPBA 1OZQA 4K37A 2HEJA 5C55A 1VCVA 2GJNA 2PD9A 3C3UA 2BFGA 3SY1A 2NSXA 1QASA 1WUEA 4Y9OA 4Q8PA 4HA1A 3ARUA 3UZWA 4HA0A 3TTOA 3WD0A 3WQGA 2V2HA 3WH7A 1GKPA 3B8SA 3EB3A 1CLXA 4IHCA 4L80A 2IUZA 2XG9A 2X1IA 2V68A 1JNDA 1JUKA 2GFTA 3CIVA 2QCLA 5DO8A 1WOBA 5EL1A 4XKYA 3DEQA 4DLMA 1L6GA 1XG3A 1AQFA 2WM0A 2ZX5A 3HGSA 1REQA 4F48A 2NQLA 3FY1A 2OT0A 3VO0A 2XH7A 1M5WA 4Q22A 1JDEA 3CUIA 3T2QA 3N3TA 4KRTA 4ZENA 3UGVA 4IGNA 3CNYA 2C1IA 4IP5A 3PNZA 1EGVA 4PRRA 2QCDB 3AISA 3T0BA 5A8NA 4R53A 3TXZA 2ASHA 1XLBA 2JF6A 1T99A 1DIOA 4D6DA 2IPGA 4UQBA 3PF3A 4C7DA 1G01A 3WD1A 3H4WA 1DJWA 3GTHA 2W63A 3IIOA 3GZ3A 4NVTA 1EA0A 3CQ0A 2DW6A 4LB3A 3WH8A 3GE7A 2ZUTA 1OQFA 5A8GA 1F6YA 2V9DA 4H7VA 2RJGA 1JPMA 4MJ2A 1QO2A 4IQEA 1M68A 3TA9A 4J3UA 4NHVA 3W3OA 2P88A 1FP9A 3UNDA 2VC7A 1LUCB 3UF9A 3L4XA 4PCFA 4WGXA 4EOUA 2ZRZA 2GK1A 1Q6QA 3IIPA 4B9ZA 2YR1A 1EUAA 1KXVA 3T0TA 2VUNA 4S3FA 4CKQA 3N2BA 1KV5A 2VM8A 4UTIA 4IMFA 1F76A 2Y8UA 3DI0A 4H6EA 4AD3A 5CEWA 4B2DD 2GDUA 3P5YA 1Q6OA 3BCJA 3WQWA 3RN6A 4X61A 3QW4B 4WCJA 3WL1A 3T9PA 1XI3A 2Q02A 3ITVA 4KCVA 3A3WA 1S2VA 3PBGA 4G7FA 4LH8A 2VI0A 3H21A 4A8RA 3LCIA 3VI2A 4JTHA 2EEXA 4O8RA 3GO2A 4ZO9A 3AI0A 3ZQ9A 1QI3A 2G4JA 3V0SA 2QGYA 1Q6RA 2E6DA 2J7GA 2WVTA 3BH4A 3EBVA 1ITCA 3IAQA 4MAZA 3WJSA 3VX1A 2NV9A 1TMHA 1NF0A 5KZDA 4ATLA 1E0WA 4BEUA 4JTAA 4EACA 4DHGA 3B8UA 1S5VA 1XG4A 5AYYA 4BK9A 3VC5A 5F2GA 3LI0A 1RHCA 3EDDA 3VPLA 3REQB 3URNA 3UBPC 1ZCOA 3WQPA 2BHUA 4FOJA 4J3ZA 2I5GA 4GUHA 3NQGA 3KM8A 1KBLA 4W87A 1W3NA 3M6YA 4DF2A 4J4KA 4TVUA 3MHUA 3VFCA 4MM1A 2XZ7A 2V5KA 1TV7A 2C71A 1TELA 3G24A 3MS8A 1IR1A 1SO5A 4IG2A 1NWUA 1LWIA 4M80A 2EBNA 3GFXA 1YBQA 3FJ4A 3HTWA 1RJRA 3CL8A 4AHOA 3AROA 4IIBA 4UTHA 2GJRA 2QCGA 1KV8A 3RXZA 3CH0A 3WD3A 3BMXA 1E1FA 5HANA 1A5NC 4PUKA 4AEOA 3BAXA 4IQLA 1W3HA 4DYJA 1GOOA 4AISA 3OLDA 2DSWA 4FIQA 3H53A 4Z1CA 3AMCA 3VK5A 4NASA 2KX9A 9XIAA 2PTDA 4PTWA 2GGHA 3PUGA 4GK8A 2YL6A 1P0DA 1V93A 3PTKA 3N9KA 2FZ9A 1LLOA 1H41A 2RGMA 4B5SA 2YFNA 2VQUA 4NYYA 3L4UA 2R6OA 3LLDA 4KCWA 2VX6A 1UA3A 1QHPA 2DEPA 4GIYA 2E68A 1Q8AA 3F5KA 3EGJA 3JZUA 5CXPA 2JGYA 3UERA 2OFJA 4FX7A 3VIKA 3CUHA 1AODA 5U7SA 3CT2A 3R89A 4UBPC 8TIMA 1JAEA 4A8IA 2D23A 2PDJA 1X8CA 4UCFA 1DTUA 1ZFJA 2YZRA 2A2IA 4HPXA 4Y90A 2YA1A 1PKNA 4YYFA 2ZTJA 5A8OA 4AXKA 3AHVA 3ISIX 4ZQRA 3R8RA 1W5PA 3VE7A 2BSLA 2HISA 4Z08A 3VNKA 1VCGA 2FGBA 4GIEA 2WC7A 2F9RA 2OMAA 3VFLA 3LQLA 3T4CA 3PZMA 4WHBA 1WDDA 1GOWA 5ABFA 4NZ4A 1Z41A 3PANA 2R91A 5HBFA 3SRHA 2QCDA 3QLLA 4N2YA 3ANYA 3OOQA 2G3JA 4UTMA 3PPFA 2P0OA 4DRSA 4QROA 4L1GA 2BTMA 4KS0A 3WBAA 1KBKA 5CZJA 4QQ3A 3APTA 1E6PA 3NL6A 4EWND 1SPQA 3H24A 4L64A 3MCOA 3QMTA 3ZT5A 3RMEA 2FFCA 5AC4A 5CBBA 5E09A 2WKLA 3AWOA 3NSMA 3ABOA 4JY8A 5G2HA 5BRQA 3E38A 1E55A 2Y85A 3IGHX 3TW7A 2BY2A 4MKSA 5JIPA 5MHBA 3VDAA 3E0FA 3EDJA 3QMSA 5BOOA 3BUVA 1UYQA 3CAKA 2XFRA 3DYOA 1JCYA 1SSDA 4F2BA 1QW9A 4BWLC 1G1YA 3AXIA 4KMQA 3RPDA 4PB5A 1UR1A 3VGGA 4KWUA 1LBFA 4GY1A 1JR1A 1KM4A 3GYCA 3G1AA 2BB0A 2HK0A 2PP3A 4Q33A 5EMKA 3PR2A 2V0TA 3C61A 3G1XA 3VOFA 4W9TA 4P8UA 2V5DA 1KTNA 4JNZA 4QDWA 3OBAA 3SQSA 5M03A 5I23A 4MJ4A 3P67A 4PTVA 4KGJA 3WNLA 1JEZA 4QIUA 1ALDA 7ODCA 3NL3A 3VIHA 3ES7A 4ONVA 4BJHA 3FN9A 4PEEA 1QK2A 3B3DA 4L9YA 2A4AA 4LUTA 3EX2A 4W8AA 1KR0A 2R1KA 3CGTA 5CZTA 4MKVA 3K1GA 4LNCA 4KFNA 4KKXA 4DBUA 3EXSA 3W1TA 1PIIA 5C2CA 4UFIA 1N55A 4UNKA 4ZO7A 1EP3A 5I3GA 2OR2A 4QJ3B 3ZJ6A 2Z24A 1LUCA 5AB3A 5ABFB 1PAMA 2WBKA 3M0IA 2IMRA 2XFWA 3D5HA 3IK2A 1GHSA 3SQLA 3U0HA 1TA3A 4S1FA 1ADDA 4JXCA 2XYLA 1WO2A 1X7FA 3A6OA 5I07A 1XDLA 2HWGA 1OX5A 1PKYA 4PMQA 2CLPA 1XFCA 3B4UA 3G1FA 4D1IA 3PUDA 4O53A 4IG2B 3TSDA 3F2DA 3OG3A 3BLDA 1SMDA 4GI8A 2A7PA 2YCLB 1JPHA 4KBXA 1VFUA 1J2WA 2PSNA 3GC4A 4FALA 4OWGA 3QH2A 3TQVA 3PBMA 4AEEA 1LRTA 5DFAA 1NDWA 2GVGA 2E7FA 2QUMA 3FEQA 1XLMA 5HULA 4AVOA 1ITUA 5LHFA 1H1ZA 4TOQA 1WZKA 3MTWA 3OZPA 3EKLA 4X0VA 4AZIA 1BF2A 4DPPA 1IEWA 4H00A 3W0KA 3QPYA 4AB4A 1EPVA 4MWAA 4KT2A 3RO8A 2PP1A 3RPMA 4DUWA 2WMHA 1VHNA 4TR9A 2HRWA 3TYUA 4DO6A 3HM7A 4R9XA 3V4BA 3BJTA 1WPCA 3BLOA 5H6HA 2OT1A 4C6MA 3U2EA 1XPYA 1TIWA 2CC0A 3A5VA 4OT7A 1PCWA 3G5EA 2B31A 3J7HA 1RLDA 1DORA 5D9PA 4RX0A 4MNMA 2PGEA 1MEHA 2REQA 1DWJM 2XIIA 3TWBA 4HCLA 4L6DA 3UJRA 1EWDA 5A2AA 4PMNA 2YA2A 5DCDA 2BMBA 3TQ0A 3U5UA 2YXXA 3G1YA 3B9EA 1BWVA 3M0HA 3U2OA 2CZDA 4Q6JA 4JIRA 4Z1BA 3AYTA 1QI5A 1UC5A 2O4QA 3B4YA 4GYFA 4LQ1A 3LHTA 1TQJA 3C86A 4PBEA 4Z2HA 4LS1A 3DFSA 3NDYA 3P14A 3A4XA 4C6IA 1J0IA 3ALGA 1N8WA 2ZICA 2MUCA 2B7PA 1XIDA 5CC3A 1C91A 1RD5A 2ZZ4A 3S2LA 3NM3A 1KCZA 1R7OA 2G96A 5CZ0A 5C5YA 4OVXA 3PUOA 4MDOA 3UQNA 1UWSA 4KWSA 4IUOA 4XBKA 4KWOA 4WDTA 2BXZA 4J3WA 1E6QM 1KTBA 1R7AA 2OU4A 5CC5A 3E5PA 3WO8A 3EEZA 3H7UA 4A3HA 1AW5A 4AH7A 1US0A 2PDXA 3PAJA 3QGAC 4XIMA 2WMIA 3GXIA 2ANUA 1QTWA 1AVAA 5F7UA 3A4AA 4A2RA 2BASA 4JTQA 2Z1VA 2XSAA 1EJSC 2ABAA 2A1YA 4JN7A 1UKSA 4CNTA 1HX0A 1OFEA 1J11A 4S3AA 3QHMA 1Z6KA 1EEXA 3AHXA 2BVTA 2DZPA 2JK2A 3R94A 2FDMA 4IIFA 2RKXA 3W1MA 1BSIA 2VVNA 2HNEA 4HA4A 3S9ZA 2QDDA 5E93A 3PTMA 1PJ9A 3R58A 3LZ3A 2W66A 2FMOA 5D8ZA 1EIBA 2A5HA 3DU0A 1XIFA 2GWNA 1IR2A 3P82A 1D3HA 4ATDA 1Q13A 1FFQA 1JDFA 3KOWA 1V0KA 5I00A 4KETA 4NAEA 1YDVA 3HF3A 1IXOA 2GGGA 2ZUSA 3LNMA 2RHGA 3M7WA 5M2FX 2CWXA 4F0KA 1MEIA 3KEHA 1E51A 1XRSA 3P8IA 3M7SA 3WDHA 3UZZA 4RNJA 4IISA 4AWUA 1OFRA 4REQB 3BARA 1IGSA 3OEXA 2VZOA 3A12A 2V5CA 4HIBA 5FJIA 3NXLA 1EDTA 3NM1A 4DZIA 1SGJA 2VX7A 1B9BA 4GLEA 3SRFA 2TYSA 1TTPA 3WBEA 1W5OA 3WK2A 4DXKA 4JX6A 3GVGA 3LB0A 3WLOA 2PDPA 1B3VA 1PSCA 2QHAA 5CZSA 2O7SA 3FJ6A 1PDYA 1WE5A 3WLJA 1WV2A 3MWCA 3SUSA 3WDRA 3NVTA 3ZO9A 1XLDA 4GUIA 1HL2A 1UG6A 1ONRA 5A6TC 5C2GA 3BW4A 4UOZA 1POKA 1FCVA 1A49A 3W71A 4JICA 4HPNA 3SIZA 2GVJA 4W5ZA 1F9CA 3FAWA 3G1RA 3B40A 2VRQA 5ECVA 1R8LA 2Z2BA 1XYFA 2PDQA 4OTKA 3CTTA 1F8MA 1BVNP 3E6EA 3T40A 1J9YA 3NURA 5BOEA 2VWSA 4PBFA 1E6RA 3W73A 2W61A 3P5ZA 3OPSA 4LYQA 1A5KC 1LLWA 2WZIA 3GXNA 4I6KA 3U2ZA 2PWFA 4Z2IA 1C9WA 2PFHA 3TA6A 3HIJA 1NU5A 2Q8ZA 4LRTA 3A5FA 4IP7A 3LG3A 1LQ2A 3WLNA 5HR7A 3LPFA 2YOCA 5D30A 3SCTA 3W1LA 1FKXA 4KW2A 4K7VA 2I1OA 3KZSA 2G97A 5DMMA 1SR9A 3L68A 3TJ4A 1T8QA 3S8HA 2F2KA 1F4HA 1FBAA 1OC6A 3LHZA 4PYSA 1KLYA 3FKRA 5M3WA 2V38A 3R8HA 5AC5A 3BGJA 4W88A 3TIMA 2Y8VA 2UBPC 1GVQA 1EBGA 2X30A 2YJQA 3ITYA 4PUDA 1DJHA 1ZJHA 5E0FA 2YB4A 2WLYA 4URIA 3S9YA 3T09A 1S5WA 3E5BA 1LBMA 4QE4A 2J9XA 2J78A 5E0KA 1UH4A 3QOKA 2GSJA 1JL8A 1X39A 3ENLA 3CZLA 3UJ2A 1F3XA 3NYZA 4R33A 4PE8A 4BI7A 4XO6A 1GEHA 3R13A 2GLKA 2GL5A 3PM6A 5I0DA 4M81A 1W5QA 3L66A 3WMLA 5CC6A 5D2YA 4G9PA 1YYAA 4MWAD 2ATSA 1ZNNA 4DUVA 3EWBX 2OQYA 1PVNA 4B3LA 3W2UA 2D2OA 3GU9A 3IPWA 4J5NA 1UWTA 3GFYA 1NP2A 2TRSA 4MSSA 1UZDA 4YS1A 4C7GA 1XDMA 1UQYA 4R9OA 3K8MA 4RE4A 2YZ5A 1GGOA 3S2JA 4K8GA 1VFTA 3H22A 1BXNA 1OEPA 1KM3A 3TVAA 4LS2A 4YCPA 1GW9A 4JN6A 2DZAA 3C4UA 1E9ZB 4NG3A 4KCUA 3VNYA 1LL7A 3DG3A 4J35A 4H3DA 3OW1A 1GOQA 4RZBA 2G3FA 4OQVA 3M1ZA 3H4GA 2JE8A 4LV4A 2WO5A 2J7EA 3GW3A 3W1AA 1RQBA 1IZKA 2FYMA 3CB8A 3MJYA 4NIRA 4BKNA 2BOFX 3E12A 4CN1A 3MP5A 4FLSA 3S2CA 2X2GA 1Z7AA 1ZRQA 2AOSA 3H2EA 4QBXA 3O15A 3SCVA 1OY0A 2XWDA 3EA3A 1YXCA 3SUVA 3VGBA 1JZ3A 3F4WA 1ZENA 2QAPA 3GU1A 2Y61A 3RM4A 1XXXA 4ZXLA 1W1VA 4FLOA 3TW9A 4PMDA 1WDRA 2E4TA 4B92A 1J4EA 1Q6GA 1ZP3A 1XLLA 4C60A 4JAWA 1A3XA 3GIPA 1NTHA 5C6MA 2EG6A 4U28A 1YKWA 5EA9A 3IWPA 1KFBA 3PNUA 2ZXDA 2PGRA 4RE2A 3MZNA 3RRAA 3WNPA 1J0YA 1CW2A 1K9TA 3R10A 1ITQA 1BSLA 3ZJ7A 1QNOA 1E6SM 3TR9A 4PMVA 1ONXA 1IXNA 4AZ6A 3BMWA 1MNSA 1FDZA 1RQHA 3N12A 3VKDA 1IEVA 5FJUA 5FEXA 1J0HA 3C5QA 1MMFA 3RPTA 1Q85A 1FCQA 3APYA 4A3QA 1T0OA 3SY5A 2FJUB 1TMQA 2VRKA 4XBSA 1Q2SA 4BZYA 1B3OA 5D33A 4GXPA 3A4WA 3KWSA 4NUWA 1QR7A 3FSUA 3TEVA 2XJ7A 4HZ8A 1FHVA 4LV9A 2WVVB 1PWLA 4KFOA 4PFHA 1S2UA 1G0CA 4FX8A 3BAIA 3WD2A 1VJZA 6TAAA 2CBUA 4M0XA 3HPSA 1R87A 1Q63A 2ZUWA 1A4MA 4OUEA 1S1PA 2FQIA 3WELA 1C8VA 3FLUA 1TVPA 3EWUA 3MUIA 3C56A 3MI6A 2Y62A 3CAWA 1UUQA 1L0PA 3WBXA 2INEA 1UUOA 1HKJA 3NJ3A 2E5BA 1LRQA 2CXGA 1T5AA 4Z1DA 4MPQA 3W28A 3QTGA 3SCOA 3UYIA 8RUCA 2DT0A 3B9NA 1VEPA 1ZAJA 4Z1YA 3BCFA 1DEDA 3NQMA 3E74A 1L6WA 1ZJBA 3TXVA 4CQAA 1DJIA 3VTRA 1PZ3A 4RLIA 4HHMA 1O1ZA 3OIXA 4GVGA 3IJ7A 4QAIA 2VT0A 4H9MA 4XK2A 3WQEA 3RYSA 3UWWA 3T8QA 1YE6A 2DFAA 1E3XA 1V3MA 3PWGA 2D73A 3MI3A 5CPLA 1E9IA 2PDUA 1GZGA 2PLKA 2J7FA 4OUIA 4HMDA 5EMJA 2FH8A 4NJGA 2HTMA 3N73A 4XTIA 5F4XA 1BYAA 4MVAA 4OBSA 1BKSA 3LXBA 3TQPA 1XYCA 2FZMA 3S47A 4GI4A 3CWOX 5BNKA 4IFKA 1B1YA 4PH6A 4ACZA 2PF8A 1US2A 3ZOAA 2XH4A 2ZWYA 2V82A 2CLEA 5I09A 3IEBA 4HMCA 1V8EA 1UASA 5DT7A 3QR3A 3LEPA 4P7RA 1NOWA 4CCDA 4JTTA 5TAOA 4JS3A 1HJSA 3KL0A 1ZZMA 2RDXA 4GY0A 2OO6A 3LNPA 4M7SA 1RPKA 5CBIA 4LT9A 4FZIA 3N25A 1GWJA 2PF0A 3WK3A 3SBFA 1TIMA 3BJFA 4LSBA 1JYXA 5ABGA 4EXQA 3OU8A 2A7NA 3BZJA 4D9PA 2LLEA 1LDCA 4Q7BA 5C0QA 1MXSA 2Q09A 3LTSA 2YFOA 1FDJA 2VP8A 2FJKA 4ASTA 2VRJA 4MF4A 4Q4KA 4D6FA 4UZUA 5HWNA 3WLLA 3UXKA 4MNLA 1BWLA 4KEUA 3P0XA 3DECA 2V3DA 1W1IE 3NL5A 4GISA 1JAKA 5CC7A 1EHAA 4GPNA 1E0UA 2EF9A 3Q67A 4LXFA 1XIHA 4FIRA 2R82A 2PDCA 1Z89A 5JBDA 2W9MA 3MKCA 2AKZA 5IHRA 3BV7A 1UB3A 3SFKA 4C1KA 2ZZ3A 2HROA 3EAUA 3BCDA 3NAVA 2J13A 3M0ZA 4ZOEA 4HGXA 1JCTA 3BAYA 4O17A 3G3MA 4M1RA 3LOTA 5K9XA 4DIAA 3M0KA 4CUCA 1VRXA 4LYKA 5PTDA 1JCLA 4KF1A 2VL4A 3ITXA 1V6VA 5D2WA 1KXQA 3TKFA 1KRMA 4DWSB 2PDLA 2PWUA 4DBEA 3STGA 2ISWA 5XIAA 1V5XA 1NFPA 1Z44A 1W3TA 3BL3A 3LXCA 3FHQA 3HB9A 3SZ8A 2J25A 4H9VA 1AH4A 2PDKA 3N2TA 3QYSA 1C8YA 3TDFA 4NT0A 1Q8JA 4LVFA 3CLMA 4IM4A 1ECEA 3TN6A 2VEIA 3QQ1A 4I5UA 2GGJA 1JRCA 3W84A 4U2YA 4DJDD 3V36A 4TV5A 4MB4A 1V3LA 1J6PA 5DBUA 1AH0A 5CGQA 3IGXA 2IPJA 3NPUA 1ZY9A 2V67A 3MO7A 5HMSA 2ZIDA 4K1WA 1XLKA 2W27A 3IRSA 3T8LA 3TYDA 1K9DA 1OX4A 4TU1A 4AZCB 1QUMA 3NZPA 3QXBA 4GYPC 4FNQA 3L5MA 2DJLA 3WUBA 7REQB 4DXXA 1BG9A 2WMIB 1UD3A 4YN5A 2WJDA 3FGCA 5F2MA 3QTPA 4ML4A 2BNJA 5AY7A 2BZNA 2YGYA 2PCQA 3VM5A 3EOSA 1IT8A 2GQ3A 3B03A 5KMYA 3HOJA 4UXDA 4F0HA 3ITCA 1K7FA 4DNHA 2Q71A 4JGDA 3W22A 2Y88A 4XG1A 2GGIA 1A80A 3ID7A 2I17A 3VMOA 3MMDA 2E09A 3PN8A 3SCNA 1TB3A 5HPOA 3BQ5A 5FCZA 2ZBTA 8XIAA 5GJMA 4PCPA 2WVUA 3AFBA 4FSAA 3TFXA 3SI9A 4W89A 5CKSA 3BPWA 1JCNA 5AVNA 3BOXA 1CXHA 3PSVA 3W1PA 4HD5A 4HT3A 3OP2A 1VPQA 2ZRWA 1V6XA 3D0CA 5LNWA 4NRRA 3T2OA 3R12A 1JGIA 1S2TA 3O6CA 4EIVA 4HKPA 2WLZA 2NX1A 1TG7A 4H8HA 1XGDA 5D2TA 1HJWA 4IF2A 5CG7A 4PEKA 1YIXA 4WOQA 4E2VA 1QI4A 3T07A 3WQVA 2UZ9A 4MZ1A 4UB9A 1DV7A 2IXUA 5G2IA 3NO5A 1E4IA 4FNSA 3PJTA 4DAIA 1X98A 3GNOA 1NFGA 1PDZA 4WQ6A 3N2MA 3SCWA 3CC1A 1W9PA 4E3VA 2UWFA 4LUSA 1P43A 3VIFA 1ZSXA 1MUWA 2IPFA 1TWIA 1H50A 2INFA 2Y4SA 3SY8A 2WSYA 1GKQA 1ZCCA 1SO4A 1OT2A 4I9MA 4HSNA 6TIMA 1I9CB 1IIHA 1K8XA 4UR8A 1FWFC 3VOJA 1IQ8A 2BDQA 4UTKA 2O92A 2HBXA 2OG9A 4WDUA 3CHEA 1V6YA 2G3IA 2GK1B 4ORMA 2XVNA 4V27A 2C19A 3KLKA 1VR6A 2HS8A 3SAZA 2AGKA 2PU1A 3AS1A 3LMYA 3LXAA 1F8IA 3GDTA 3D3FA 3CUJA 4LCRA 5T91A 4YHGA 1FWNA 3VGFA 1OGSA 2G4FA 3OVGA 1SFJA 1LOQA 4PFMA 7A3HA 4LF1A 3Q4DA 3VINA 3BG9A 3NIYA 1WBHA 1OT1A 1W3JA 4OV9A 1US3A 3WF1A 1IEXA 2DSUA 2Y24A 3QMRA 7ENLA 1TJ2A 1V7YA 5CCZA 4YVPA 4E2DA 5EGRA 1QI0A 4S23A 4C6NA 2W0UA 5A8MA 2CLMA 1X1NA 3O05A 3P84A 4S38A 3VDCA 1X97A 4Y9AA 2YBUA 2E40A 5HQMA 1L8PA 2E8ZA 3FCPA 1F6KA 4I8YA 5JUVA 2IQDA 4LW7A 4NF7A 4AZBA 5H1WA 4NAFB 2GJXA 1UD2A 3ECQA 4O4WA 5CSYA 3LPPA 4H2HA 2JKAA 4DEFA 3A13A 3W24A 6PTDA 3KBJA 4I5XA 2J8FA 1DJXA 2H3DA 1FFRA 4QP0A 4OV4A 3SRKA 1HJVA 2VELA 3N9RA 4ICNA 4NJIA 3R4IA 2X0HA 4O1EA 1Q6FA 2FZNA 1RD6A 4F40A 3IANA 1MUMA 2GQ8A 2D2JA 2J8GA 2DSZA 3AO0A 5BYWA 3MKKA 4HZ6A 1E3ZA 4H6KA 3UT0A 4I90A 1XBXA 3UJEA 1TWWA 1H4PA 2POTA 1WKFA 4AD2A 2P0IA 3BLEA 1NAL1 2DZXA 1VBUA 1PTGA 1QAPA 4GZJA 3ABZA 4IPLA 4LYRA 3M5ZA 4HU8A 2G5WA 3GZAA 4TMBA 4U31A 2QXWA 3EB2A 4RKAA 1ECQA 2E25A 3STEA 4MPKA 3V18A 4CQ8A 2VZTA 4I9TA 2ALDA 1W1YA 4RL3A 1K8YA 1GONA 1VBRA 3LX9A 3RLGA 2WNZA 4MNJA 1SU5A 4O4VA 1H7WA 4MGGA 2AL1A 5JMUA 2EAWA 2IS7A 1M03A 4W85A 4ICMA 2BY3A 4HTYA 5GNYA 3TTYA 4E4PA 2J7HA 1OHLA 4HYWA 2A3CA 3NGJA 3MCNA 3WK1A 2QR6A 1TFVA 2FGZA 2OGYA 4RDYA 1W9BM 5AECA 2PDBA 5G4EA 1SZFA 4PUNA 4J27A 3WH5A 4G5DA 2OTDA 4A3RA 3MDUA 4XAFA 1SFSA 1OCQA 4UR9A 5AHMA 4MB5A 1QNPA 1QDSA 5LIYX 3ABSA 4HYRA 2NWRA 4QQUA 3MV01 4ENLA 1OC5A 1FWEC 3UY8A 3M5VA 3DH7A 2V5LA 2BXVA 5DMNA 3RUBL 1JPDX 1M9HA 9XIMA 1WKYA 3WLPA 2UY3A 1QHOA 4FS9A 2I5IA 3VKKA 1B9ZA 4L7ZA 3UR7A 1DXIA 2OLHA 3UESA 3CPUA 3B8TA 4XSLA 5K4XA 1P6CA 1Q4WA 3R6IA 3B0VC 3SADA 1E0XA 4M6VA 7TAAA 4H9ZA 3E2VA 1V3JA 3DIPA 2JEQA 3CHDA 1JVNA 1CX9A 3O3RA 1VPYA 4HPHA 2OLAA 3E2QA 3CZJA 4N0RA 4FI4A 3CV2A 4CN6A 4B15A 1W32A 2YL5A 1JZ6A 2PBGA 1ZQ5A 3WFLA 3LA4A 4IQJA 1K1DA 3LK6A 1JF5A 1KM6A 4L9ZA 4K39A 1XINA 5FJJA 4LBSA 1SZGA 4MFEA 1P0EA 4MOZA 4F9JA 2GSHA 2WZEA 1HUVA 1V0LA 2V5BA 2ZDRA 2RAGA 1KO0A 4ZZ9A 4GQGA 2HV5A 4PRTA 3W76A 4ZGYA 4WRHA 4XB3A 4GJ1A 4YLWA 1J2BA 5JXQA 4Q4PA 3KTXA 2C0HA 4UZSA 3SDOA 3W75A 5DN1A 3K46A 3B9AA 4N7QA 4IX2A 4ZFCA 3C8FA 3SGGA 3C0LA 5K7JA 5IM51 3BGAA 1WAWA 5G4WA 4GY7A 4IWWA 7XIMA 4M6QA 1Z48A 2Z28A 5M5DA 1ODUA 1W9UA 1BQCA 3AJ7A 2F6KA 3S5SA 5CJMA 4J2MA 1TX2A 2QKFA 2WSRA 3QYQA 4GVFA 1LLZA 4IPPA 2BG5A 2XWEA 2XGBA 4PN2A 2B4GA 2DV0A 4ZL1A 4E4UA 1FWJC 1ZB5A 2HE8A 3W25A 1R9ZA 2ZC8A 4X9SA 3WDIA 4IIGA 2GJXB 4DYEA 3POCA 3XIMA 1HTIA 4CD8A 5FSDC 1QATA 3ARTA 3BLPX 4Q7IA 3C0SA 3POHA 1BG4A 1XLIA 4AW7A 1K7XA 2R8WA 4L9XA 1J10A 1JCJA 4WEVX 3GWQA 1CXLA 1IEIA 2BVDA 1LTDA 3HGOA 4DZAA 3FX4A 2GUBA 1JUEA 1Q7QA 3CU2A 1E6ZA 4IL0A 4M29A 3L0NA 4NJHA 4RCXA 1KRBC 1K02A 2CU0A 4PCSA 7TIMA 1OX4B 1BXBA 1OIMA 3DX5A 3EOLA 1HKMA 4IFKB 1DJZA 1DKWA 2MNRA 1VFHA 3WEMA 4G7EB 1I2QA 3O2LA 1UR2A 3WN6A 5A1AA 1Q6CA 4LVBA 5DANA 1RCOB 1WCGA 3MUZ1 2E1DA 3U7BA 3STPA 2P50A 3URBA 1FX6A 4Q4SA 2VDGA 1IF2A 2H8ZA 4UTUA 3U8GA 1ONWA 2VGBA 2VZVA 3NQCA 1SW0A 4HCHA 4Z0JA 3UG3A 2DZWA 4A4AA 4H8UA 4JTUA 1FWIC 2UY5A 3FYYA 4NI3A 5A94A 4U3AA 3U48A 4TIMA 4JQ3A 3QC0A 5CQ1A 3T6CA 1BYCA 2QJIA 3TK7A 2W6RA 3Q45A 4HU3A 2VCBA 3N4AA 4JKKA 4ICCX 3D46A 1UOZA 4CD6A 2WHJA 3GVVA 2XUCA 3CM4A 3FVMA 3ARPA 3R0KA 1AZ1A 3EDEA 3WF4A 2J8TA 2OKTA 4QLJA 4GQ0A 3CPRA 3G1HA 1OBAA 4RXFA 4MIMA 3R11A 4JCLA 4AU0A 1R2TA 1BQGA 3FDKA 4LAUA 1JQXA 1R9XA 1XYMA 4UFHA 4DJEC 3VD4A 1FRBA 5GNXA 3QJAA 1TJ0A 4GVHA 3NDZA 3R7MA 1OCBA 2O9TA 3I7SA 4IGSA 5E6YA 1ISWA 3TE9A 2PODA 2ZZ2A 2VEFA 3RM8A 1M7XA 2E67A 3W7RA 4WXZA 4ATWA 3ALFA 1UPPA 4H6QA 4JPGA 4CNUA 3PBUA 1XV8A 4MJZA 4RNFA 4F3HA 2ZX6A 5C70A 1E1CA 2WBGA 3PC0A 2WYSA 1O12A 4IPNB 1J01A 3PZNA 1KBBA 3S6TA 3IUHA 4X60A 1MDRA 3A24A 1XIIA 2QIIA 1PIFA 2GOUA 2BY0A 3OJGA 4QRNA 2R1MA 5DXXA 3L12A 3KCLA 3VVGA 1ZS2A 5D2VA 3HPAA 3OBKA 1QFEA 4AVNA 3CMFA 1WXJA 1KKOA 1HL9A 2XFFA 4GH3A 2BGSA 1EUNA 1B3YA 4YXGA 4MB1A 3WQ5A 1VFMA 3O6AA 2PZNA 2ZZ5A 1HKWA 4BFAA 3VE9A 1A50A 1TPC1 4C65A 3GHRA 3HV9A 3LRKA 1RK5A 2VZSA 4UNIA 3VNZA 1U33A 1OX6A 3WYZA 4JN8A 4AWSA 3RU8X 5CPQA 2J6VA 4Q4MA 4ECLA 5DRCA 2POZA 3GXPA 1NY1A 4GBDA 4GBUA 1R46A 3GR4A 1XH0A 5AYIA 3W7MA 4IUGA 3TYEA 1EZ2A 4JTJA 1IGWA 1GQJA 2Z2AA 1WB0A 3SQMA 4OBTA 4LY8A 4B16A 1Q3NA 1D7KA 3Q37A 4JIHA 2XTKA 4ZA0A 4CU7A 5ABTA 2C13A 2X40A 3T2PA 3WQ8A 3TH6A 3F4CA 4K1GA 4GMEA 2D0GA 4MG4A 4D6GA 5FF3A 2J4GA 2PC8A 2JIEA 3GVWA 3KE0A 1QU4A 3L4WA 2E6AA 3F4NA 1D8WA 5CPTA 3TLQA 2F2HA 2CLLA 2WW5A 1V7AA 2PI6A 5REQA 5GJNA 4XAGA 2PWEA 1WDQA 3IAPA 2BY1A 1O95A 1C29A 4MWAE 2CBJA 2FPVA 2B7OA 1L2QA 2J27A 4O0QA 4GE8A 2J77A 4N4QA 2NT0A 3AALA 4ZSTA 1UP0A 2XN1A 5BU9A 1SMAA 2HDJA 2G37A 4F0SA 2A3BA 4I3GA 5CPOA 3ZSSA 3I6EA 2CCRA 5A5WA 4RE3A 1C8QA 1J5TA 3OO2A 5F2LA 4QTGA 4TTUA 5AZ0A 3SCUA 3ZVHA 2EO7A 1KQYA 1FWHC 1B4EA 2BGNE 1XSJA 3ARWA 4XBJA 2QJMA 1I0BA 2CKSA 1SFTA 2ON3A 4P8WA 1W1TA 5DY2A 1SJCA 1E9YB 1WNOA 3TYCA 3VOCA 1FDYA 5FEZA 1H7PA 3VAVA 3KOFA 3AU2A 1G7VA 3FAXA 5HMFA 5BMWA 3VUSA 1MYRA 3H12A 1UR0A 4TVCA 3KRUA 3TC6A 3MMTA 4X2RA 1ISVA 1XIJA 4K8HA 1W8GA 2VZUA 4DWSD 3CTLA 1H60A 4INFA 5FOOA 3L0GA 2C18A 3R0UA 3FA4A 5D32A 4XIAA 2XVGA 3S0CA 3K1DA 3QSTA 1UR8A 1EOMA 4X0NA 1UKQA 1EF2A 4W4QA 3EX4A 1XRVA 2XDFA 4A8NA 4P5UA 4Z2JA 3QM3A 4Q6XA 2AL2B 3VKCA 3W86A 1ZBCA 2E5DA 1SR0A 4WY0F 3OHMB 1W2PA 2JBMA 2PGWA 1UD5A 5BU6A 1SJBA 3TYBA 2CBIA 4ZO6A 2X7WA 1E72M 2HVNA 1QPRA 1XIMA 1RK6A 5K2ZA 3QV9A 5B80A 3IVSA 2V69A 3FVDA 1OYBA 2G95A 2P1FA 1U5VA 4LYPA 1F74A 3BW3A 2V3EA 3LHVA 1LQ0A 2TSYA 4DBDA 1C7TA 4W93A 1RBAA 3MSDA 2OQLA 2YYUA 3ANUA 3ARRA 2ZUVA 2GGEA 1HW6A 3KXQA 4JR5A 1PKLA 5D37A 4AIUA 1R0MA 3E2SA 3EDFA 1OGGA 3AIRA 1JUBA 1A5MC 2E8YA 2A85A 2GJPA 3M64A 3R43A 3UY7A 4PMJA 1UWRA 1XM3A 3M5XA 4JTCA 3FA5A 3BE7A 4PULA 4QS6A 1TO3A 4WF7A 2HS6A 4P7OA 3SCPA 4OJYA 1GQNA 1AD1A 3LGEA 3UEQA 3RAOA 2FH6A 3CL7A 4JKMA 4O1CA 5CG0A 1QNQA 3WF3A 5C9ZA 4FF5A 3TR2A 3UG5A 4D72A 2GPTA 3UWYA 4H04A 3BSHA 5F2IA 4C1NB 4JTFA 2DVXA 4XSMA 1ICSA 2VEPA 2VOMA 5DX7A 1G67A 2WB5A 1YXDA 3T44A 3WNNA 1P7TA 4UTWA 2X2YA 4MY9A 3SGZA 3W7DA 2DP3A 5FA5A 2VFFA 1XJBA 4HHPA 1VCFA 5EBAA 3Q94A 4K7YA 4ZB0A 4C91A 3NVDA 3V1PA 2NV1A 2PTWA 3JS3A 3VGDA 1EQPA 2BGQA 3HG3A 3L23A 2X1UA 4AIOA 1XQKA 1TUXA 4YTRA 2C1GA 1X8FA 4AZ5A 2ISVA 3DYPA 4WK9A 1LWHA 1I2OA 3LBCA 4EPKA 1Q65A 1LWJA 3IGSA 1XS2A 4A6GA 2Z2UA 4B4HA 2QYGA 3GDLA 2NXGA 4Y96A 4XTDA 2I9UA 1U5HA 2Y0FA 2YDRA 4HJWA 3K4WA 3D3AA 4OBRA 3G2GA 4OHQA 2Z6IA 2VNCA 1Y65A 5EKYA 1HIZA 4JD4A 2WJFA 4B3KA 4XZIA 3MI2A 3WLTA 1EJRC 3S3GA 1G4EA 3UR2A 4H8NA 1UD4A 3H26A 4XQ6A 3S5ZA 4HNVA 2VC9A 5CJ5A 4Y8FA 2WNWA 2Y63A 5I06A 3N6QA 1I2PA 3W4RA 4P8VA 3ARSA 4PL1A 3TJLA 3V75A 5GNZA 5A6AA 5LXXA 2PRLA 4UR7A 3M0YA 3SECA 5KITA 1TTIA 4HSOA 3MYOA 5HATA 4GNKB 4E38A 3C2OA 2QCHA 3GAKA 3GFZA 4A35A 1OG0A 3ARQA 1RV8A 6A3HA 2PBOA 3HURA 1M7OA 4IMGA 1K8ZA 3PJXA 2EXOA 1CZ1A 3W02A 4REQA 1IZCA 4RZ5A 1X38A 4NX5A 4J2PA 1YNYA 3NPWA 3UYCA 3GG0A 2V3GA 4PB4A 4TO8A 1DWAM 1EL3A 3N34A 5I02A 4IOTA 4ADSA 2GVEA 2QCFA 4PTMA 1O1HA 1CGXA 2QJJA 2WPBA 3TP4A 1R3SA 2CLFA 3NNTA 3BSMA 2V6AA 5LNUA 2PDYA 1GPWA 1W6TA 2YLLA 2OPJA 1AMKA 2R1PA 4MZ8A 4QXIA 1GKRA 3PPGA 5I3KA 1M6JA 1SVDA 3CT7A 1CBGA 1HGYA 1OADA 2AAMA 2OSYA 2UY2A 2E6FA 2OZTA 2Z7GA 2XPKA 3FS2A 4OKDA 4GQBA 1AJ0A 4IICA 2VWTA 1WXZA 3FYOA 3FXGA 1HL8A 1J0ZA 1YPXA 9CGTA 2ESCA 3NUKA 3MQTA 1PV8A 1U83A 4S3KA 2ZE0A 1DWHM 1TWDA 4QJ1A 3WY1A 4WR3A 4PUEA 3R1ZA 1SJDA 5I24A 5HNRA 1EF3A 3GKAA 3S1GA 1AL8A 3H7VA 4XAYA 4Y7EA 3GB6A 1H7RA 1G69A 3TLLA 4CQCA 4JEJA 1J8VA 1PKMA 5C54A 3PUEA 4PUJA 3A47A 1H5VA 2DH3A 4PUWA 2JALA 4ACZB 2B7NA 1E5JA 3KCJA 1V6TA 4UTLA 5AOUA 3M07A 5IFPA 3BOLA 1QVBA 3RLUA 1QNSA 2HPIA 1TPVA 2A0NA 3L2LA 3OGRA 4MTVA 4JIEA 5CSSA 1E56A 4X22A 1Q7MA 1PZ1A 4LS0A 3MUCA 4K8EA 3CV6A 4JTLA 2PWHA 1M04A 5EBUA 5BXPA 5IDIA 4DBSA 2ZX9A 5BWFA 2AL2A 1EIXA 2O9OA 5AN7A 3C0JA 3RCMA 2QZRA 1LP6A 2XIOA 4LB4A 1OSEA 2QPUA 3ARXA 2GQ9A 4TXEA 1WX0A 4K2SA 1RBLA 5JH2A 4DNMA 1F7BA 1NOFA 2ZC1A 4JQ2A 4B5XA 1GYMA 2IKGA 3QKZA 2YCEA 4LFYA 1FA2A 4PL2A 3WDPP 2FGLA 2R9RA 2CZVA 2Y70A 2ZZ7A 1XYLA 1JYNA 1W9DM 5T9CE 5ABHA 1WQ5A 1GTEA 3THCA 1QXLA 2ZVIA 3STFA 1TTJA 1FWRA 3LS9A 2DUXA 3KAOA 4JQ4A 3I7QA 4C5ZA 5A8PA 2Z00A 5H91A 4H1ZA 4Q7NA 3F5JA 2CZEA 3RHGA 3VMNA 4F8XA 1LROA 4WKAA 1HNYA 2P8CA 2PTYA 3B97A 1TA3B 1A0EA 4DELA 3EX1A 1CECA 3S9IA 1GNXA 4K3ZA 1NWTA 3MKVA 4YYCA 3BANA 1IWAA 4OIFA 2VFDA 4V33A 3MY9A 1DYSA 2ZRUA 1VBHA 4JIPA 3DBPA 2WSQA 4D6IA 1ICQA 1MFUA 3UCQA 2PDGA 2PWGA 4GACA 3QW3A 1C90A 1F2JA 3VOHA 3O06A 4CGTA 2Y8KA 5AHEA 3U2CA 3WLRA 1HQTA 3NEHA 3KFTA 1WZLA 4O11A 4PGLA 4DJDA 5CAKA 1EGMA 3Q58A 3TTEA 3V16A 3WL0A 1EB3A 2F61A 3GX9A 1BYBA 3VIJA 4LUJA 4PMYA 1P0KA 4JTSA 1SQ7A 1Y7VA 2Z7KA 5FJPA 4FXFA 2WJEA 1QNVA 4WSHA 4HK5A 4BHYA 3PTQA 1TCMA 4L4LA 4NXSA 2ZDSA 1EJWC 1JNEA 3WJXA 3R0DA 3BICA 1B3WA 3F2BA 2FZBA 2HXUA 4MB3A 1RQEA 1BXCA 3UGRA 4LPCA 4O15A 4DO5A 3UWQA 4L4OA 3TOPA 1F6PA 1TQXA 3A64A 4AX6A 5E9XA 2EPLX 1JCXA 3UW6A 2DQXA 2QJHA 2BS9A 3QV7A 4O8AA 1XYZA 5GPRA 4WIWA 3QY8A 1F05A 5FJOA 4N9BA 4LY4A 3GDMA 4GINA 4H8VA 2FTYA 3IACA 1TCDA 4KGLA 1CXFA 2HSAA 3WENA 3LCWA 5TF0A 3ZR6A 2G50A 4A29A 4QE1A 1UPMB 1F3WA 3K2GA 3GVQA 1BRLB 2WQPA 1OD8A 3M0JA 3KBWA 2VC5A 1KM2A 1XLAA 4KEVA 1UP3A 3AXXA 1E1CB 4WUIA 3EXRA 2WNQA 4D8ZA 8CGTA 3ZWSA 3WQ4A 3W37A 1V6WA 1BF6A 3PFMA 3TQKA 3S5OA 1RY0A 3WG6A 1MW2A 1MWOA 4S3CA 4UOJA 5T26A 4ADTA 3GG1A 1DHPA 2E9MA 1TVLA 2DT3A 2RUSA 1NH6A 5KINA 5LA2A 3O0KA 1EEPA 2XVPA 3HFTA 5ENLA 4AD0A 1OF6A 2OOGA 4L1WA 4DBWA 1MFVA 3CHVA 3I7RA 3KL5A 5E1QA 3RJXA 1N7KA 4JX5A 1DJGA 4DN1A 1ENUA 3H7RA 2X09A 2CETA 3TFCA 1ISYA 3PSWA 5DY3A 1B54A 1VYRA 3EKGA 1VFLA 1XL9A 3DHFA 4BR1A 1EX1A 4WY0A 2ABBA 4G6CA 3BXWA 3H2NA 2W92A 4GHRA 3RU6A 4FXRA 3B05A 3AIEA 4IX0A 3QFEA 2FDSA 2JQXA 4DM2A 1JFHA 4YNGA 3RX3A 1QPKA 2R24A 1H61A 4QR6A 2Z0IA 1ELSA 4W7UA 4J3SA 1UH2A 3NQEA 1J6OA 4Z2LA 5D9MA 3OZOA 4CN4A 3IVTA 4C6KA 2Q3RA 3U57A 1GVIA 5KETA 1GG1A 4RZ4A 3N6JA 4LTSA 3IRDA 1TV8A 4WKFA 1V4YA 1YADA 3CO4A 1BKHA 4O14A 4RE0A 4YPJA 1ITXA 3G22A 1W5MA 3EWWA 2OODA 3TMQA 3IIXA 3L5AA 4AY7A 3OA5A 4XAPA 2ZCGA 4O10A 3QVQA 5I3FA 3W23A 4BI5A 3PPCA 4RUBA 2L5HA 4AIBA 1ZJAA 3AU6A 4WDXA 1K8CA 3THUA 3VIGA 4S39A 4ZE5A 4LUSB 1GUVA 4GJJA 3G0UA 3NA8A 1K4GA 3PVFA 4ZOBA 5D2XA 3GUGA 4G1NA 2QW5A 1KFEA 1VYPX 4Q8MA 3TN4A 3EXTA 1B2YA 2PZ0A 3KBSA 4GO8A 2JIWA 2WZHA 4R7OA 1G7UA 3DFNA 2Z29A 4GWEA 1Z3NA 4M5PA 1DXEA 5G1MA 3VD3A 3DYMA 5LGXA 3LCXA 3DHPA 5F1UA 1X1OA 3ICJA 3NG3A 5AFDA 3AYSA 3ITLA 3MVTA 4GFIA 4FB7A 4F2TA 2J9ZA 3GY1A 3DFQA 5G4HC 2C15A 3URQA 1JQVA 1T6MA 1BPLB 3VA8A 3T0AA 1TPH1 3TJIA 1M41A 4U5IA 1LJYA 4HNLA 5XIMA 3M9YA 4DM1A 4Y9PA 2WCSA 1TUFA 2QDGA 4FMVA 2F8QA 4WVXA 4NRSA 3V7PA 3RJYA 4R27A 3C2VA 1OM0A 1VIWA 5K9CA 1FKWA 1DXFA 4MY8A 4C90A 4BA0A 5H8UA 4GYKA 3N9SA 4AC7C 3NOEA 4DUOA 1RSCA 2G8ZA 4LVDA 2VC6A 1YDOA 3I65A 2W67A 2P53A 2BOEX 2DZSA 1B0IA 1MO0A 4UIOA 1AA1B 1O6IA 1EZWA 1KLZA 3CPGA 3NDOA 1XLCA 3WD4A 1EOKA 3NZRA 4BQ3A 5CSRA 3A9BA 3I3DA 3W2KA 1HJXA 1ZL1A 2X1SA 4ZOCA 3CAVA 1FY6A 2WHMA 2AQVA 1ADSA 4JCMA 1VF8A 2HZGA 3HBLA 4LAKA 3ZXWA 5D4YA 3UPMA 1P48A 1JF6A 4Z2GA 3RO6A 4XV0A 4OOZA 1AZ2A 3IIVA 4O57A 3B8IA 3TWAA 4IGMA 2H9AB 4P2VA 2R94A 5TD4A 5CPNA 2ZWZA 3LSCA 1DJNA 1EA9C 3LM3A 1F73A 1PHWA 3MSRA 4JZ5A 1A0DA 4GJIA 3LYEA 1QBBA 3B8DA 4RW5A 3PZVA 4NAEB 4JQAA 1TPWA 1J96A 1U2YA 4MADA 3SJ3A 4NZ1A 5LIKX 3EA1A 2YCKX 3RMJA 4UNLA 4GIAA 3GG8A 3UXLA 1E73M 1OYCA 3TZNA 2VD9A 1VYSX 1Q6EA 1TV2A 4HZ7A 5HNNA 4I8DA 4G7EA 1WKEA 3BURA 2O55A 3K30A 3EOUA 4US6A 3CQHA 3FSTA 5C8BB 1C3FA 1MZHA 4JBRA 2AQWA 2OEJA 4M24A 5JU6A 4H2CA 3AAMA 1GT8A 2J47A 5F4WA 4EPDC 3VDGA 1W56A 2DZUA 4ZB2A 4XZHA 2JKPA 3LCLA 3M44A 4MY1A 2DT2A 2PS2A 4LNYA 5JH1A 1NIUA 1OFAA 3T7VA 2E0PA 2C8NA 4QSFA 5FSEC 4DYKA 1P6BA 3LRMA 3M0LA 4ZR8A 3TSMA 1MZRA 3XISA 4B5NA 2J66A 5JVLA 4R85A 5D02A 2YKKA 1LOSA 4AD1A 4H83A 1E40A 3VC6A 4QG9A 3ARZA 2HCVA 1LM1A 3GHSA 3GAYA 3AS0A 1SZRA 3ZVHB 3JVAA 4IL2A 3C52A 1E1EA 3W1UA 1OCJA 4XZWA 3R79A 4PCNA 4HP5A 3AXKA 2YLAA 2NUYA 3ANVA 2RFGA 3EMZA 1Y5XA 2W79A 3OODA 5BW6A 4EK7A 1ZTVA 3LBOA 1MUCA 4H7CA 2DUZA 3W7HA 3N4FA 3C6CA 1KQZA 4BQ2A 3DKLA 3TNOA 4GZEA 4I7VA 1O60A 3W7JA 5LNRA 1A47A 5HNUA 1Q7ZA 1BWKA 3MZ2A 2YPIA 1T96A 2C16A 1QHZA 2ICSA 3BGGA 1UWUA 2UY4A 4C6JA 3FIGA 1CXEA 6REQA 1MSSA 5H8MA 3P81A 2Z1KA 2ADAA 1GZ1A 2D24A 1YEYA 2J24A 3GTXA 4JNYA 4V15A 4BQ5A 1AL7A 1HG3A 4JQ1A 2Z1XA 4Y8EA 4LANA 3KX6A 3NO3A 3KOXA 4PUUA 4LWWA 4AWEA 3WLQA 2DT1A 3H6OA 1GVFA 3VUPA 1QT1A 1H0IA 1YLVA 2EKGA 5BCAA 1RJQA 2EPHA 4CD5A 4O28A 3H70A 4Q8WA 3A4JA 1EXBA 5HQEA 3UZJA 2ZXAA 4K36A 2VHLA 1TKKA 4LUTB 2QCCA 1BD0A 2X7VA 1BTCA 1ZAIA 2Y7FA 2V8ZA 1OFQA 1EFZA 3CV1A 1E70M 1BGGA 3L2IA 3F03K 4QX4A 1QJWA 2XIJA 5GVJA 1M7PA 2OZ8A 1CNVA 3VU2A 1R47A 1KC7A 2DZVA 4XZ9A 1B30A 2C0AA 4QEHA 1K9FA 3E02A 4AHQA 3ABQA 3TUUA 1IWBA 1KXTA 3QN3A 1M1BA 4EPBC 3WF2A 2FTPA 3QRHA 1XISA 1O94A 4AZHA 3WLIA 3EWZA 3LD5A 4ZTXA 2OELA 3IGUA 3OLIA 3TONA 1QK0A 1XR2A 3QGKC 2GWGA 1JDDA 4U5KA 2NQJA 3AS3A 2YCIX 3MUAA 4XD3A 5DELA 5FF4A 1HP4A 4IIEA 1VKFA 3VIOA 1S3HA 4QCEA 4Y9NA 4GX9A 3VZXA 4AY8A 2GOKA 1JI1A 1TTQA 2ZUMA 3V0TA 4UQEA 3WQCA 2IPWA 3PJWA 3W7GA 3MBDA 3G8RA 4I6VA 3OLGA 1VPXA 4A3YA 4F0LA 4JX4A 4US5A 3W26A 4AYGA 3E9AA 3L4VA 6ALDA 1MW1A 3T05A 3QFWA 3Q2DA 4TX6A 3FFSA 3KVKA 3LTYA 5A69A 4L65A 4Q8UA 2Y2WA 3LMZA 4AX7A 3FOKA 1XICA 2R1NA 2GDQA 4M3PA 1L6FA 3WH6A 4O16A 4RDZA 3DFTA 1AH3A 5E0CA 4NI8A 1J0KA 6ENLA 3NSNA 1KB3A 1XUZA 5MF5A 2HVOA 5DMYA 1UZ1A 5E6ZA 3WJYA 1R86A 2XGIA 3GKFA 4TX9A 1W1PA 3F7JA 1ME8A 5FL0A 2QPSA 2EHHA 2ATMA 2V2DA 3CK5A 4B2DA 1XCXA 1J93A 1GQIA 1B31A 3B9OA 3LN3A 4ML9A 1BAGA 3KP0A 1TJRA 3NQ6A 1LL4A 3AHTA 1AFSA 3MHFA 4UMBA 3PS7A 5DF0A 3N11A 3PZTA 2B81A 1HT6A 2YDSA 3N14A 5I3DA 3ITTA 4WJEA 1LZOA 3ZR5A 3MDWA 3BLIA 3TZFA 3L0KA 2PRHA 2ZA1A 3KRZA 2QIWA 2VCAA 1KBJA 1H5YA 2O9RA 1JG9A 1FH7A 4GNJA 5KSWA 1MVYA 4U2ZA 3OQEA 3EDKA 1PUDA 2J9YA 1V08A 4PSRA 5F1VA 3WQ6A 5LSMA 3AIVA 1KGUA 3LZ5A 1FWSA 5GQBA 1U30A 1Q6LA 1NWRA 4ILSA 2I7GA 1B3ZA 1RBOB 4S3EA 1RR2A 5IOBA 1K4HA 2YIHA 2VGGA 3BW2A 1RCXB 4G56A 3KUMA 5HDRA 1XBZA 5E9AA 1CGTA 3DG7A 2E3ZA 3SCQA 3OHIA 2VR4A 3LHWA 4TQTA 4LAOA 2VD8A 1TV3A 3GBEA 4H6RA 3B8VA 1G4PA 3V0UA 2X16A 1VFOA 4LUYA 2J74A 1AW1A 2DIEA 2WKGA 2YXOA 4J9JA 2A21A 3INPA 2VVSA 4C6PA 3TAKA 2VEMA 3U7VA 1DWFM 2D3LA 4HOXA 1HKKA 1AMYA 1W5NA 3VDHA 2CZFA 4DWSA 4WSJA 2XISA 4NZFA 4TX8A 3LGDA 1E0TA 1TZZA 3ERPA 2PE4A 4QDPA 1K70A 3H2FA 1DIEA 1OFDA 1R85A 5A6SA 4PUMA 1T7LA 4LVAA 1CENA 3CASA 4GUGA 5J5DA 4A3UA 4AD5A 2C79A 2YDAA 2AMGA 3MVIA 4LRSA 1I8JA 2XVKA 3GNNA 1PPIA 3BWWA 3UETA 1GK8A 2FVMA 5AVHA 4DJFC 1YTDA 2H90A 4O54A 3DERA 1P4CA 2C91A 2D20A 2I14A 1W31A 2Z4GA 2OQHA 1K6AA 3EOEA 5BRBA 1XH1A 4OU1A 4O0KA 3UZYA 3OIHA 4UUIA 3LCHA 4UQAA 2ODOA 2NVAA 2WWDA 1NVMA 1EC8A 4PTNA 4FLRA 4DJDC 4C6LA 3W00A 3PY2A 3V5FA 3P0WA 1UC4A 5FF0A 1YRRA 1NEYA 4UTTA 4V1YA 2ZA3A 3DI1A 4RZ6A 2XFYA 4B5TA 2ACRA 4BS0A 1EX5A 3MV11 2OYLA 4N9CA 4QE5A 2QGHA 3T0CA 3A23A 3O07A 3S2MA 3QV8A 5EFFA 3HQNA 3MO4A 3CEPA 3EOOA 2UV8G 1JRBA 4QLKA 3K13A 2WMGA 2OSXA 4IMEA 4YTSA 4FXJA 3T4WA 1FVPA 3USZA 1EXPA 3KS6A 3GR7A 4LUIA 4NY2A 5AYBA 3QZ6A 2EPNA 2DGAA 2P3EA 4EANA 4AZ7A 1TE6A 3UWUA 4PSPA 1I1XA 2YL8A 4CNOA 1H11A 3O8AA 3PFRA 3UZXA 1XPGA 1I6NA 4B91A 3MMWA 4B90A 3E2RA 5IFTA 1A3WA 2C1HA 4PA8A 2AAAA 2CFFA 4EX4A 5C71A 4CEXC 4ES4A 1MI3A 3WKZA 1YHTA 3GNPA 3RX4A 3QPZA 3NQAA 5GJPA 2AQOA 4W8LA 1AJZA 1J12A 4ERGA 1UBPC 2H8XA 1TWSA 4QGCA 3MB9A 3GLCA 1RLCL 4CD4A 4LJ3A 3RNDA 4M1BA 3P74A 1HFBA 3WJZA 1JZ4A 1P0NA 5E5CA 4PMOA 3PZ9A 3N13A 2ALRA 1KCKA 4JHOA 1EJUC 1D3GA 4WKHA 4IJBA 1QPNA 3R5EA 3KCOA 1ZBVA 1FWTA 1PTDA 4JDYA 1PBGA 5JQ9A 2V3FA 4UFKA 2PB1A 4O18A 3F2CA 3LRLA 3U4AA 3N29A 2PTZA 4S2BA 3LENA 3KOYA 5D05A 5DXYA 1UUMA 4JFWA 1G94A 4ALDA 3Q65A 4F79A 4E2OA 1YNPA 4F0MA 3C2YA 2DU2A 2WPGA 3ZLGA 3CQIA 1RUSA 2XM2A 3PHAA 4HU0A 1E43A 4RR4A 1IIGA 1O5XA 4B4FA 3ZT6A 3LSBA 1LBLA 1V3IA 1DE5A 3W38A 5DLCA 4F9DA 5EPDA 3EYPA 2Z1SA 2ZVRA 1L6SA 3IJDA 2OSWA 3VKAA 4WXYA 1S2WA 1GYLA 1IT0A 1R3TA 3T55A 4DJFD 2GDVA 4DO7A 4X2PA 2PDHA 4IZGA 5DCBA 2PA6A 4HU4A 3VGHA 4PC8A 5C7HA 1SZEA 4U33A 2QMJA 2EGZA 3CIXA 4GQQA 2YL9A 3K8LA 1FHUA 3RGTA 4ZXOA 1AG1O 1E4MM 2XN0A 1AUSL 1OJXA 1TREA 1JJKA 1KGXA 4FXSA 4PRWA 1JD7A 3AC0A 4RJEA 4W84A 1W17A 3AIWA 2XSBA 4IMAA 3CZKA 3WCZA 1RXOB 3TC7A 1H63A 3S6DA 4Q8NA 3WNKA 1GVSA 1DP0A 4EPEC 1MW3A 3UFYA 2IKJA 3OYZA 3EPOA 1I2NA 4IXHA 1QMLA 2DIJA 4BF9A 1E9LA 4AD4A 2D22A 1HN1A 4Q8OA 3PG9A 4JTKA 3IVUA 1XCFA 1MW0A 1V0NA 5CZKA 2ISDA 1BLIA 1VIZA 1SUXA 3W1QA 1Z32X 3W29A 4NNCA 4W7VA 3HPXA 3NZGA 2JF7A 4UQCA 2FHCA 3JU2A 4ZB5A 1UD8A 4WJ8A 3ORWA 1YNQA 3ZYZA 4YWIA 1V02E 1V77A 1XP3A 5HA7A 5U4NA 3AJXA 3QF0A 1L8NA 3DDMA 4MAVA 4Q8TA 5DBTA 3B0YA 4M8UA 2OWWA 2YBTA 2FHFA 1XLEA 1Z42A 2Q6ZA 1I60A 3VNJA 1CGVA 3AHZA 1R3YA 3NEVA 5I5RA 5KZMA 3PZQA 3GXFA 4JFVA 2WSKA 2YDQA 3FEMA 3SB0A 1HXJA 1J0JA 3AS2A 5IRPA 2GUUA 1CYGA 4DO4A 3UR5A 1E4NA 3C3NA 1ME9A 4Z17A 4HB7A 4RV8A 2FVLA 2DVUA 3W01A 1QOXA 1KTCA 1R3VA 5EYWA 4A22A 4C5YA 1POJA 5HWJA 2PPGA 4ERIA 1YQ2A 1JZ8A 3HGJA 3SURA 3CQJA 3GNXA 4HOWA 3PAOA 3M46A 3GDRA 3GYEA 4JDBA 4IJCA 3A9IA 2VMFA 1W1B1 5G1YA 5A6KA 3ZT7A 1YPFA 1GVRA 1EC9A 3EPNA 2VGIA 3MW7A 2PURA 3C2EA 3PG8A 2VDHA 1NQ6A 2D0FA 3GM8A 4AUBA 4R3UA 4N6EA 1LYXA 3W85A 3P80A 4JTDA 3ELFA 4ZE4A 4DVOA 1K7EA 2CLHA 2CXEA 1XQLA 3AYRA 1TPDA 3A3HA 3H54A 2X1RA 1PX4A 2XM1A 4ZBCA 3CUZA 5LIXX 3TC3A 2TMDA 5J04A 1L9WA 5IHSA 2X8RA 1GJUA 4GCAA 3M41A 4JHZA 1HO1A 4M6PA 1Y0EA 2P3ZA 3O16A 4M82A 1Q66A 4I9JA 1E71M 1QOPA 3CIWA 2BBFA 1RPXA 1VLWA 2D1ZA 1GPFA 4U3CA 2G41A 1UR9A 1H0GA 2VFGA 4NX0A 3L5LA 5KZ6A 3KRSA 3GXMA 1KFJA 2FLIA 4DPQA 4MWAC 4PMZA 1AQHA 4U10A 4IIDA 2VENA 4AAJA 4HPJA 4JTRA 3RDKA 1PIGA 3PULA 3DGBA 4OECA 4PODA 1GVEA 4IIHA 2CLKA 1CI1A 4CU8A 1RJPA 5H8PA 2FHBA 3HU7A 3OVQA 2Y5SA 4XWUA 1J5SA 2VX4A 3BOFA 4MUPA 4GVIA 2HXTA 4D6EA 2E9BA 1M7JA 6CGTA 1KA9F 3F1QA 4TV6A 1UJQA 1RVKA 3W82A 1QW8A 1I1WA 1RP9A 2OX1A 1TV5A 4DZHA 4B5UA 1VEOA 4YL2A 3RCNA 3WZ0E 5D03A 1CCWB 4YHEA 3NOYA 4JYFA 4NZ5A 5I6SA 1UIOA 4I7WA 3S1UA 2NX9A 1UJPA 2BVWA 2BVYA 3GHUA 3HN3A 4HHLA 1KRCC 4GFSA 3WFZA 5AC7A 3CYJA 3NSXA 1BVZA 4GKTA 4RK8A 9RUBA 1NF7A 3CUXA 4JY9A 1G6CA 2WAGA 1XGZA 3FK4A 4KFPA 1Z69A 5BRPA 3OLEA 3ITOA 5EMLA 3ZR4A 3AZSA 1Y8BA 4RDVA 3W74A 4IMCA 2NW0A 1H7NA 1XUUA 4PTDA 5A8QA 4JOMA 3W81A 4GRSA 1E6NA 3HJZA 4N6FA 2OZ3A 5LA0A 3RLHA 4BY3A 3NR0A 7REQA 3VIPA 3AZTA 5C2XA 1EHNA 2QPXA 3KHDA 2P76A 1KM0A 4S3BA 1UW9A 3VNMA 2CKRA 4OE7A 1NARA 1F07A 3CEUA 1PX3A 1XWYA 3BV4A 2PC4A 3GU2A 2WZMA 1VQTA 3O9NA 1XSKA 5EMMA 3S1VA 4GYJA 3W7LA 3QY6A 1R3WA 1LT8A 3TCEA 1DJYA 1XLJA 4IH3A 1MNZA 3NCOA 1H51A 4GQRA 2YB1A 3M0MA 4H9TA 3WQFA 3DOPA 4KRUA 1HZYA 3UVAA 5D9OA 2WXDM 1GG0A 4HOZA 1LQAA 4AF0A 4G2DA 3AMLA 3RM9A 2CPUA 3WMBA 4L6OA 1YDNA 2OCZA 1BHGA 1AK5A 1EP2A 2HK1A 3SUUA 2QMKA 4MYAA 2R1LA 3USBA 3UVIA 4AQLA 1KR1A 2ZX8A 3QKEA 1A5UA 3FKKA 3WQDA 3AWNA 3NFUA 2PEVA 5BZAA 3QLDA 1XSIA 3M0VA 3ONBA 3MUXA 3NQFA 4B5VA 1UA7A 4ZQPA 3BG5A 1KFCA 1TJ1A 3WH9A 3AUJA 3H2OA 3P6LA 3DKJA 3QR0A 3GR8A 3B0UX 2PLJA 4FP1A 1WBJA 4MHBA 3W2JA 3W2LA 3GNRA 2NLIA 3WUEA 2ZUUA 3BZGA 1YTEA 4O1FA 3W83A 3VYLA 4YCOA 1PXGA 1IE7C 4IXXA 1JIBA 2NQ5A 2HQAA 4LBRA 2VFEA 3UWVA 1MEWA 3NO1A 2WKJA 2OB3A 4ROPA 3CHCA 3CL6A 3MHGA 5IDZA 1QPQA 1YMYA 4GCXA 5FEPA 3B9DA 1RVGA 2EG7A 2Y5EA 3M4HA 3AXHA 1V0MA 2WC3A 2P8BA 2GUYA 3QZEA 5B7ZA 1CB7B 4R5EA 2DPEA 3FGCB 3UCDA 3E0LA 4YIWA 3GDKA 1WOAA 1DJQA 4GZ7A 3IJIA 3CXOA 3I4KA 1O66A 1W91A 1XX1A 3T1GA 3TOYA 1L2UA 4MWAB 1V3HA 1WDPA 3W70A 4HTBA 1DWIM 1XF0A 5EY5A 2QV5A 2PCEA 1FH8A 1A5CA 4PMRA 4TMCA 4NZCA 1R2RA 5SWUA 3I4EA 3KDOA 4NXKA 3BC9A 4JYDA 2KAUC 2PDNA 1QO5A 1EYWA 3BJSA 3QOMA 4GABA 1WKDA 4W8BA 1AD4A 5ECUA 3DXIA 2V81A 2J7BA 3WLKX 3ONCA 2V5JA 2ZE3A 3CMJA 4EWJA 2F6XA 4IPIA 1TV4A 2OVLA 2ZUNA 3GRIA 1D7FA 4WGHA 3PPHA 1X7IA 4QFUA 1I4NA 1YE4A 4X9YA 1ME7A 2ONEA 5CPSA 3MYPA 2PRMA 1EWEA 2QDHA 4DJED 4Q4QA 1UKOA 4FF7A 4C6BA 8XIMA 4QSHA 2H6RA 3BAWA 4Q32A 3TJXA 2FPTA 4J1OA 4M7TA 2HMCA 4NILA 5DMLA 5T9BG 3CHFA 1CT5A 1TRIA 1TPEA 4EXAA 2XVLA 3LGGA 1R9YA 4XAZA 3W72A 4Y2WA 2WQDA 3WFAA 5I78A 2VUYA 3GS6A 1DTNA 3URAA 4HYVA 1CIUA 3VM7A 4JTEA 3KWXA 3LTPA 1FUYA 3G1SA 4D1JA 3A22A 5F4SA 3W1XA 4F2UA 1DVJA 3PTDA 3DCPA 1VEMA 3CUGA 1CDGA 5CPMA 4HNCA 1D9EA 3UXAA 2MANA 3VKBA 3SW6A 4DI9A 3HMCA 4YU1A 5FAJA 4P7QA 5MKGA 3AIQA 3KBMA 2XZ9A 3GNDA 1ZPTA 1R3QA 2X41A 1ZBWA 3QV6A 3ZZ1A 4NZJA 4DLFA 4E0CA 2W4XA 3T08A 5FACA 4AZGA 4FOKA 2WK2A 4D6CA 1H1YA 4J3XA 2CYGA 5EMYA 1X6LA 4XD5A 2HNHA 3E0IA 1GJWA 3E96A 1OINA 4D6HA 4QITA 1YX1A 4W86A 2CITA 1XH2A 2FB2A 3FV9A 4HK6A 3VNIA 3OA3A 5HINA 3AMDA 3CH9A 4MKNA 4RNIA 1JYWA 2G0WA 1HO4A 4DAFA 1QI2A 1ZHAA 2ACSA 3KS5A 4CNPA 2QQ6A 4JIQA 1TR1A 3QQ0A 3VD7A 4MNKA 4Q8VA 5D9NA 2PLMA 2O0TA 1D2KA 1AJ2A 2CLOA 2OJPA 1TZ9A 4JFTA