1S1PA

Crystal structures of prostaglandin d2 11-ketoreductase (akr1c3) in complex with the non-steroidal anti-inflammatory drugs flufenamic acid and indomethacin
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
315
structure length
315
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of prostaglandin D(2) 11-ketoreductase (AKR1C3) in complex with the nonsteroidal anti-inflammatory drugs flufenamic acid and indomethacin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 119
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1s1pA00
4NKCA 1T41A 4JQAA 3V0SA 3V36A 3M4HA 4JIRA 3UWEA 1EL3A 4DZ5A 3V35A 3LUTA 2ACSA 4Q7BA 4H7CA 3GUGA 3CAVA 4MHBA 3EB3A 3WBYA 2IPJA 4F40A 1YNPA 4H8NA 4DBSA 3O3RA 2NVDA 2PDCA 1HW6A 4ASTA 1S2CA 3P2VA 4GQGA 2HEJA 2PDIA 4IJRA 2C91A 2IKIA 1X97A 2IPGA 3D3FA 1ADSA 4GABA 2I17A 3F7JA 1AZ2A 2FZDA 4I5XA 2HVNA 1Q13A 2HV5A 4WRHA 1Q5MA 3RX4A 2ACUA 3CV7A 2ACQA 1PZ0A 4G5DA 1Z89A 2CLPA 4JIHA 3R8GA 3GHSA 4HMNA 4JTQA 1AFSA 1EF3A 4DBUA 2P5NA 3B3DA 2AGTA 3R7MA 2PDQA 4PMJA 1UR3M 4WDTA 3UG8A 5LIUX 4GQ0A 5C7HA 2PFHA 4PUWA 2IKGA 3DN5A 4HBKA 4XZLX 5AZ0A 4PRRA 2INEA 1MRQA 1HQTA 2FZ9A 4EXBA 1AH3A 2BGSA 5JH2A 2PDHA 3CASA 2PDMA 4FZIA 3LBOA 1XGDA 1EXBA 1YE6A 4YS1A 1RY0A 2DUZA 3CV6A 4GIEA 1Z3NA 2ACRA 3EAUA 3EB4A 3BCJA 4JIIX 2HDJA 2R9RA 2PDJA 3R6IA 1FRBA 3UZYA 2PD5A 3ERPA 1JEZA 4YU1A 1ZQ5A 3MC5A 3GHUA 1PWLA 3G1RA 2FZ8A 3G5EA 3BUVA 4ICCX 2DV0A 3N2TA 1QRQA 4WEVX 3LEPA 4JTCA 4LAUA 3BV7A 3LNMA 4IJCA 1K8CA 4LAZA 3R94A 3GHTA 2HVOA 1T40A 2PEVA 3DOPA 2ALRA 5JH1A 3CAQA 5HNTA 4WDWA 1YE4A 4IGSA 3R43A 3UGRA 1RALA 4FAMA 2FZBA 2R24A 3COTA 4AUBA 2PD9A 3R58A 4LB3A 4XZIA 4XVEA 1Z9AA 4YVPA 2PDPA 1X98A 3LD5A 3LZ3A 4PR4A 4YVVA 3O0KA 3Q67A 2DUXA 2IQDA 5AZ1A 2BP1A 4QX4A 4L1WA 2WZMA 4XZNX 3LENA 4GCAA 4JTDA 2BGQA 1XF0A 1S1RA 3GHRA 2I16A 2PDGA 4QBXA 2HE8A 3UZXA 1ZGDA 1AH4A 1PWMA 5LIYX 3UZZA 2PDBA 4FA3A 2IKJA 1R38A 4Q3MA 1X96A 1EKOA 3MB9A 5HA7A 3WBWA 1IEIA 2PDLA 2J8TA 2QXWA 2A79A 3WBXA 1S2AA 3H4GA 3M0IA 5HNUA 3FX4A 4L1XA 2INZA 2IPFA 3LZ5A 1QWKA 1C9WA 3V0UA 3V0TA 2IKHA 4QR6A 3UFYA 4JQ1A 1XJBA 3NTYA 1PZ1A 4WGHA 4XO6A 2F2KA 1OG6A 1ZUAX 3KRBA 1Z8AA 4XK2A 5DANA 2PDWA 3LN3A 2PZNA 4XVDA 3WG6A 3H7RA 3BURA 3LQLA 4GA8A 3UP8A 2FGBA 1MI3A 2F38A 2FVLA 1LWIA 1M9HA 4JQ2A 4ZFCA 2VDGA 4JQ3A 1A80A 3N6QA 3LQGA 5M2FX 5LIKX 4DBWA 2PDKA 2PDXA 2WZTA 1YNQA 1AH0A 3QKZA 4JQ4A 3RX2A 4WDUA 1S1PA 5KETA 2PDYA 4XZMX 1SM9A 5LIXX 3UYIA 1LQAA 3UZWA 1RY8A 2PF8A 1PYFA 1GVEA 4QXIA 4XO7A 4PUUA 5LIWX 1US0A 3R8HA 4R9OA 4XZHA 2PDFA 4EXAA 2PDUA 4GACA 2IPWA 3WCZA 4JTAA 3RX3A 3M64A 4LB4A 3ONCA 1IHIA 4RPQA 3CMFA 4JTRA 1VP5A 4PRTA 2NVCA 4YVXA 2IQ0A 4OTKA 1AZ1A 1J96A 2PDNA 3FJNA 1ZSXA 3T42A 1MZRA 2ISFA 3Q65A 1VBJA 2IS7A 4LBRA 4FALA 4WDXA 3S3GA 4LBSA 3H7UA 3C3UA 3ONBA 3U2CA 2HE5A 4XAPA 3VXGA
chains in the Genus database with same CATH superfamily
4RDWA 3FA5A 1K3UA 4RZ5A 3W07A 3WLPA 1WE5A 4TV5A 3EZ4A 1MNZA 1VFTA 1GOOA 1ISXA 4O1EA 2GQ3A 1TIMA 1K7EA 2NX3A 2WW5A 2Z26A 1F3XA 4PFHA 1OGSA 3ZJ7A 1R3YA 1VRXA 3SUSA 3II1A 3KTXA 4HZ7A 1S38A 3EKGA 3USBA 1EP2A 5JBDA 5FEZA 3FAXA 3GK0A 1AJ2A 4H8NA 2OKTA 2YGYA 5F7UA 2TMDA 3CMJA 3M5YA 3A13A 3KEHA 4HYVA 3AXXA 4JPGA 1FHDA 4HQVA 1W91A 3O6DA 2IMRA 4NF7A 4ZOEA 1E3ZA 5GPRA 1C29A 4AB4A 2WZHA 4L4LA 4YHGA 2MNRA 4HU8A 3CK5A 3BDKA 4C1LA 3A4JA 2DJXA 1XYZA 3A24A 5CLWA 4PCTA 4NJGA 5DRIA 5FL0A 4A2RA 2ACUA 4HNOA 5FF7A 5HMFA 4AU0A 3KOXA 3SR7A 1JZ5A 3AS3A 2Q01A 4TTUA 3LK6A 3WL0A 2ZXDA 4Z1AA 1S5NA 2JE8A 3OBAA 4PMQA 5MHBA 2G4FA 4LS2A 1W1VA 3HPFA 3KRZA 1L2UA 4FLOA 1Y65A 1KXVA 2VX4A 1RLDA 1MFVA 1OFAA 5HATA 2NT0A 1H50A 5I3GA 2I9EA 1TCDA 2B4GA 1W37A 2GOKA 4YLWA 5CZJA 4PRRA 4OUEA 4K36A 4Q22A 8XIMA 4WSJA 4TMCA 4H19A 4KWSA 1PXGA 2DH2A 1ENUA 1QCWA 3MQTA 1O5KA 3CASA 1S5MA 2PDMA 4ATDA 1VBRA 3CO4A 3LBOA 4DUWA 2X2YA 3CLMA 4WHBA 5HJYA 5HMDA 2QMKA 1CLVA 1B3ZA 2UV8G 5HNNA 3G0XA 1ZENA 3SURA 4IFKB 1XIDA 1XC4A 1S5WA 1OT2A 3T0BA 3R13A 3MUZ1 3W01A 1A5SA 4MDPA 1IZCA 2OCZA 5EA9A 4H6RA 1JEZA 1H41A 3TTOA 4I7WA 1AL7A 1QFEA 4G1KA 2E28A 2NVAA 2V5LA 3PN8A 3QYSA 4B3KA 1B3VA 2AL1A 2WWDA 1M03A 3CUXA 3W84A 2ALDA 2XWDA 1H63A 1WQ5A 1SVDA 1EUAA 3BOFA 4DEFA 1BSLA 1I9CB 2WMIB 4C6IA 1C8XA 3DUGA 1WZKA 3W71A 5M3WA 3B0YA 5HMEA 2VRJA 1WDSA 4H9TA 4ECLA 4A21A 5C70A 2PLKA 1A4MA 4B2DD 3O6AA 4M82A 3OVRA 3LRMA 4LV4A 3OLDA 4O12A 4IFKA 1XINA 3W3OA 1PAMA 3ARVA 2C6QA 2XH2A 1S46A 2PRLA 4NI8A 3GTIA 4Q8NA 3N2XA 4NJIA 3TSDA 4Q7IA 1GJUA 3UGVA 2F6UA 3T2OA 3FNDA 4AH7A 2OQHA 3EX4A 2YB4A 1U5VA 2W91A 1V08A 3HG4A 3DEQA 1FOBA 1VJZA 3KWSA 4DWDA 1PIFA 3HQPA 3GWQA 1RAKA 4QE1A 3ZMRA 4IH3A 2P8BA 2FH6A 2E09A 2JEPA 3LCWA 4CCCA 2V8ZA 3DI1A 1EKOA 1FWSA 4E4PA 2Y4SA 4HNNA 1IEIA 2D24A 2J8TA 4Z1YA 2WM1A 3SY8A 3PBUA 3WBXA 3T2PA 1IV8A 3NL6A 4DYJA 4GY1A 1FCUA 1ZZMA 1A5KC 3WENA 1ITQA 2X0SA 3TW9A 1SZGA 4B2DA 2HISA 3B8SA 1LOLA 1TELA 3PWAA 1KR0A 3R1ZA 3CZJA 3SSZA 4JQ1A 2ZDSA 4L56A 4LGXA 2UY3A 3H2FA 4UQDA 4IP5A 3SGGA 3KLKA 1OG6A 1LRTA 3NIYA 3AICA 2DJLA 1KCKA 2PWVA 4AX7A 2DY3A 1J8VA 3A6OA 3MSGA 3LRLA 5FAGA 1IWAA 1W5OA 2QDDA 4LSBA 2V3FA 1GVIA 2VGBA 4QLKA 2VCAA 3PM6A 4BHYA 1PHQA 4JKKA 2CEQA 1XI3A 3NNTA 4MZ1A 1CXFA 2FVLA 3RF9A 4B3LA 2OEKA 5CGQA 2AGKA 2VFHA 4QEEA 3TJLA 1RD6A 4MB5A 1BKHA 3D46A 1KM5A 4NX0A 5LIKX 1E9IA 4DBWA 1YNQA 1AH0A 5E6ZA 2J7GA 5HOSA 2EPLX 2VEPA 3SO7A 4KETA 5REQB 5KETA 3NR0A 2CHNA 3TROA 1MUWA 1PTDA 4A3RA 4WXZA 3N19B 2XH4A 1QI4A 2QPSA 1DE5A 3R8HA 2PTWA 3CTLA 4ZEPA 4W5ZA 1P0NA 5EMMA 1XYCA 1SO3A 1KV8A 3WCZA 3BLDA 5F1UA 2VZSA 1GGOA 2WV8A 3BAWA 4ZR8A 3S47A 5D30A 5D04C 3V75A 3TC3A 4FNPA 3K2GA 3L65A 3GZ3A 1SFLA 1DJHA 5D9PA 2Z2UA 1XRSA 3OU8A 1GEHA 4RDVA 5EKYA 3PTMA 3KE0A 1HKWA 1GKPA 1HP5A 1NAL1 1W3LA 5ECUA 1KRAC 3SQSA 1OQFA 3QY7A 3Q94A 4QLLA 3PPHA 3UWYA 3LPPA 1T41A 2CLEA 2A3CA 4RNFA 3P0WA 3PWGA 1BQGA 3VA8A 3HM7A 2FTWA 2PRMA 1PIIA 3LPOA 1R6WA 3WQ4A 3EMQA 2WCSA 3EXRA 2QPUA 3CAVA 3BMWA 1I75A 3VOIA 3IIOA 3UWUA 3RCNA 1SZFA 2WSPA 3KP1A 2C14A 1YW1A 2O4MA 4HZ6A 4ES4A 4GRSA 2NVDA 3SIMA 4BEUA 1WA3A 1OFEA 1FVPA 3L68A 4HN4A 4WKAA 4E5TA 1QOPA 1QHPA 2GSHA 2TYSA 2Q8ZA 2BBFA 3WUBA 2E68A 2FYMA 3KVLA 2W27A 1WO2A 1V7YA 1YX1A 1HXJA 1HKJA 2EPOA 4KWWA 3CV7A 4NQ1A 2FPTA 3PP7A 4M6QA 4GX8A 1PZ0A 2DEPA 4DBDA 1JDCA 3QGVA 3MJMA 4KCWA 4R33A 3P7YA 3B4YA 2WNQA 4JTTA 1MW2A 3R8GA 5C9ZA 1ZJAA 4AHOA 4G56A 3RU6A 3MDUA 2X8RA 2V68A 4EOUA 4R34A 1FDZA 4PMJA 2ZZ5A 1WKFA 3NPVA 4RR4A 2B7NA 5G1TA 1XKJA 2DQXA 1FWCC 1TQJA 2ZX9A 4K8GA 5BXPA 1F61A 4Q4KA 2J27A 2PI6A 3NZRA 5CJNA 1KTBA 4AVOA 1XCWA 3QHOA 5K7JA 1P0BA 2WC4A 4EXBA 1E6NA 3KBMA 3SUWA 1L2QA 1X6LA 1RQBA 2YW3A 3LB0A 4GI8A 1EXBA 4YS1A 3FN9A 1UUMA 1FKXA 3FJ6A 4R88A 3WNKA 2H9AB 3BCJA 1LBLA 3P81A 3SRKA 1PKYA 2O9RA 1Q8JA 5GNYA 3OPSA 1K7XA 5BXTA 4DJFD 2WMFA 1HVXA 2Z6JA 4HPGA 2V0TA 1LQ0A 2YCKX 1DVJA 4ZSTA 3TN5A 2A7NA 1PWLA 4I9AA 1UIPA 3BAJA 1Q8AA 1FFRA 1EOMA 5GQBA 2VR4A 3U6WA 1J9YA 3B8VA 2MUCA 4NZ3A 2ZC1A 4X9SA 3WLKX 1BF2A 1LLWA 3C56A 3BMVA 2QR6A 1FQ0A 1A5BA 1BQCA 1RALA 1EJRC 2AOSA 1E40A 1K9TA 3WK3A 3VX1A 4TU1A 4Z2IA 3WQ8A 5A6SA 3B9DA 1MEIA 3TV8A 4DZIA 3VIKA 4QNEA 5I0DA 1HJQA 1XR2A 2VGFA 4QX4A 3ZFHA 2XGBA 2DFAA 2GSJA 3MA8A 4DJFA 1UKTA 4FNTA 5JIWA 2IQTA 1DV7A 1TE1A 4FNRA 1AH4A 3R79A 3WQOA 2QIIA 5A6KA 3PTDA 1K9EA 3NZGA 4RE2A 4UTMA 2Y5EA 1R3QA 3BAIA 2G3JA 3I7SA 3NEHA 1QXLA 4KEVA 3BW3A 4HU4A 2ZVRA 5BCAA 3UWVA 1YXYA 3W38A 1NWRA 2EPNA 4CNPA 4B4HA 3M0IA 4MB1A 3M7SA 2IPFA 1G69A 3DERA 3FVDA 1J0YA 3DHDA 1AMYA 4JICA 3V0TA 3DYOA 3W1LA 2XZ9A 4E2VA 4TOQA 2CLLA 1OB0A 4ILSA 4A05A 3QOKA 2O92A 3T8QA 1TKKA 3WEOA 2G96A 5EMLA 5AC5A 1LLOA 3T78A 4AMCA 3HPZA 1FH8A 2OMAA 1PSCA 2ZX6A 1QK2A 4H6EA 4AD3A 2PBGA 3CUZA 3R0UA 1W1B1 4KPLA 3WYZA 1OFPA 1BF6A 3E02A 5M2FX 1DWJM 1UIOA 3O63A 5E0KA 1HKIA 1ZBCA 2X09A 2QCDB 1S1PA 2I7GA 4YTQA 1DTUA 1E72M 2QCFA 1P7TB 4XD4A 4IISA 4GI6A 4IF2A 2DZWA 1US0A 2PDFA 1JZ4A 1JNEA 3RX3A 3M16A 1JRBA 3ONCA 3ANYA 3SM0A 1JDEA 2C71A 1FH9A 1V6UA 1Q66A 3QV8A 1H0GA 2P76A 1W2VA 3HV8A 1YEYA 3JUGA 1E15A 1P6CA 3FYYA 2BG5A 2NLYA 1Q2SA 1FWIC 3FOKA 3WMSA 2E8ZA 1UWQA 3GR8A 3NFUA 3LI0A 4LBRA 4JS3A 5I07A 3H2OA 4J3WA 2J62A 2SFPA 4PGLA 3S3GA 1QI2A 2YFNA 4O52A 4D1JA 2YDQA 3OW1A 3L23A 3BAYA 1VGAA 5A8QA 4ML4A 1CXHA 4XZBA 4JQAA 1DHPA 1TV4A 3L4YA 2GDVA 1FWTA 2QCDA 4U5KA 3I7QA 3M4HA 4LU0A 3NO5A 2XH7A 3VI2A 1P7TA 3S8HA 2E40A 4C91A 5I02A 1OX5A 3VFCA 4AF0B 3UXAA 2EPMX 4GVHA 4OFCA 5DELA 3O3RA 4IIFA 1E4LA 2PDCA 3CQJA 1MRAA 3IGSA 5J5DA 3K4AA 2WC7A 5LNWA 1EO5A 1LRNA 3CWHA 1SSGA 2XIBA 1X97A 1UPPA 2CLIA 2Z4GA 4Z08A 3U48A 3VOHA 1I6NA 2EGZA 4DJDD 4WRHA 5A2AA 4FIRA 3TYCA 5H8UA 1X1ZA 3W27A 3DHUA 3IRDA 4YCPA 5HINA 1FUYA 4O1AA 4JIHA 5BU6A 1EF3A 2E6AA 4DBUA 3GVWA 3WLIA 2HSAA 3IGXA 2A5HA 3AS1A 3AXKA 4LC6A 3B3DA 2GGGA 1E70M 4V33A 3T4WA 2C13A 1YDOA 4KCUA 4ZXLA 3WY1A 3LGEA 4I3GA 2PFHA 3PY2A 4BF7A 3APTA 1TPFA 2OQLA 3GSMA 1DWAM 1KM0A 4JN7A 5AZ0A 1VEOA 1J0JA 1ALDA 2NUYA 4AF0A 3EWBX 1SMAA 2VC5A 4RZ6A 4N7QA 1YDYA 1MSSA 1TRIA 2Y63A 2UY2A 2EPKX 1AODA 2PODA 3BARA 1I2OA 4UQCA 4UTWA 3E0LA 2XIJA 3UXIA 3LBCA 1OGBA 3CZKA 1KM1A 1E0TA 3G1AA 1EA9C 2EJAA 5TF0A 3EAUA 1O4UA 2EQDA 6ENLA 4DJDA 4QE5A 4JN8A 1Q6RA 4U3AA 1VPXA 2OWWA 4EK7A 4CGTA 3GHUA 1OK4A 2XVKA 1WKEA 3AI0A 4L61A 1O66A 2C8NA 3V5OA 1XP3A 4BKNA 3H12A 3CHEA 2ADAA 4IMCA 5CPQA 4ZQOA 3WD0A 4WEVX 3PUGA 3BV7A 1V0LA 1XLIA 3GD6A 1WBHA 4C6QA 4NJJA 3DBPA 3T0TA 1FHLA 1G4PA 2PEVA 5LNUA 2WKLA 4KIRA 4N6EA 3LM3A 5HNTA 4HYWA 3S5NA 2BY0A 4ERAA 4P8WA 1MYRA 2ANUA 3WH9A 4RZ4A 3N11A 1V3LA 1XLKA 4RLIA 3PPGA 3G1YA 1LCOA 1H61A 2PURA 4L6DA 5BW6A 1R9ZA 2PDPA 1KR1A 4QSFA 3LD5A 1XRVA 4JX5A 1GOQA 1VLIA 2P8CA 3VIOA 5D37A 1M3UA 1F4AA 1A5LC 1O7AA 3ZZ1A 1W5NA 2FVKA 5AC4A 3GB6A 1W3TA 4BZYA 3W74A 3GH7A 2OEJA 4AIBA 3ABQA 1NEYA 1WDPA 3ID7A 2XTKA 1D9EA 4CNSA 4TXEA 1FY6A 1FDYA 4PUMA 4ZQNA 5JXQA 4NJHA 4XG1A 4UFLA 4V27A 3NQ7A 3UT0A 5LIYX 4NZFA 3T07A 2X1IA 1NFBA 1N8FA 3VE9A 4N6FA 5E0FA 1WZAA 3QV9A 2WNWA 3WBWA 2V5BA 2O0TA 1UC5A 4A3UA 5HBFA 1VIWA 2XWEA 3WH7A 5I3DA 2HNEA 3I3BA 1SYTA 4F3HA 2TRSA 2ZYFA 5FEWA 3LXCA 2INZA 1ELSA 4LALA 3HGOA 3IPWA 4MNLA 3S2CA 2OLAA 4O11A 2YKKA 3H55A 2BX7A 2DT1A 3LU2A 3GBEA 1A5NC 4DXXA 4RXFA 2R94A 3DH7A 3VAVA 3OQ8A 1PZ1A 2V69A 4J4KA 5F4XA 1TRDA 1RP9A 3T8LA 3CIVA 4I6KA 3WLJA 1DWIM 1JQXA 1KM4A 4WCJA 1DJXA 1V6WA 5A6AA 5D8WA 1EJSC 3CQHA 3CH0A 2WKGA 4BWLA 7ENLA 3ABRA 1A5UA 4AWTA 2PDWA 1IF2A 3BG5A 1EX1A 2ZFAA 2BY3A 5D4YA 4LRTA 4HIBA 2F38A 2X7VA 2J6VA 3AHXA 4AISA 1W0MA 2WZEA 4GOAA 4I7UA 1DJWA 1G0CA 1EJXC 1DQWA 3OTRA 1E4NA 2PU1A 5HMSA 2PDXA 1DJQA 5I3IA 1ZBVA 4LF2A 2PLCA 3QSRA 3L4ZA 2E25A 1EJUC 3RFAA 4EXQA 5EB8A 4JHZA 4Y9AA 3A4WA 3HZ3A 3JS3A 4FNQA 1XLDA 1OFBA 1OWQA 4DLMA 4D72A 3VIMA 4KIEA 4O0ZA 5KINA 3OG2A 1ONRA 1KM3A 4EP8C 2F8QA 2ONEA 2XDFA 2Y0FA 4LANA 3UD6A 1P1MA 2O56A 3A9BA 3RM9A 1TX2A 4FI4A 4GG9A 3T42A 2J7FA 1FP9A 3ME3A 1MEHA 3HQ1A 3NDYA 3CNYA 2GWGA 2WNNA 2VEFA 1Q6OA 4GX9A 1ONWA 1R8LA 3KL5A 5C9RA 4WDXA 1E0UA 3QLDA 3TW6A 5AYZA 2Z00A 2E9LA 2E6DA 3OODA 3W7OA 3STFA 1LOSA 5BRQA 3SQMA 4EPDC 4Q4OA 1TV7A 3IUHA 3R89A 1CB2A 2A21A 7A3HA 5FJUA 1IWBA 2FTYA 2I9UA 1UP2A 3SUTA 3ECQA 4A8IA 3BCFA 3GUGA 5CSSA 3TVAA 2ZKMX 1KLYA 1B3OA 1SFTA 2VD8A 4IMDA 1A0CA 5KZMA 1VQTA 4ZSUA 1GZJA 1BTCA 2TODA 1XYBA 1YTEA 4TVDA 3DX5A 4IGMA 3I3DA 5HQEA 4GQGA 1UOZA 3E74A 1XICA 2O7QA 4NT0A 3K8LA 4PUDA 4CUCA 3DFOA 2VZOA 1AZ2A 4D71A 3VOFA 4JYDA 3TQVA 3TYBA 4Z2JA 1KCLA 1WKDA 2RHGA 4CLMA 4L80A 5L9FA 1E4MM 2H3DA 4Q6JA 5T91A 4UMAA 3BE7A 2GYIA 2Y8UA 3GHSA 4O54A 2QNEA 1ZY9A 1RBLA 2ZQ0A 4D8LA 4NILA 1JDDA 2VFFA 1XUZA 2CLFA 3ZVIA 2Y1HA 2VC9A 1BAGA 4IGHA 3DN5A 4DWSD 2CLMA 4JFWA 3B8TA 4J40A 5TBOA 1L8NA 1EGZA 3CQ0A 2DW6A 1TA3B 1PX3A 1SFSA 3GVVA 1AVAA 4FHAA 4XSLA 5FEXA 2CWXA 4Y2WA 2WJDA 2XVLA 4PE8A 2RDWA 1W3IA 3WFZA 1YQ2A 1XGDA 1DBTA 1ZALA 1K4GA 2QULA 2D23A 1RY0A 1B31A 1IWPA 3W9ZA 3WLNA 2YIHA 5AHIA 2PDJA 4ZENA 5I5RA 2QAPA 3NEVA 4JTLA 3R11A 4IQDA 3KLLA 2OR2A 3F5KA 3WELA 1IXPA 2VJXA 3SIZA 3NQBA 4M1BA 3VD4A 2ZXQA 3SFKA 1DWFM 4Y9NA 1XQKA 1Z32X 1GYLA 3DHFA 4GVFA 1K8CA 5ABFB 3AIBA 1XLGA 3TTSA 1GW1A 1L6WA 2AQOA 1TA3A 4DWSA 2QLYA 4IMFA 1SJAA 1XS2A 2JIWA 3UR2A 4NRRA 1EBGA 1E1EA 2OOGA 1W2PA 4HJFA 3URAA 3A5FA 1W3NA 5D8ZA 3K13A 4OBSA 3ELFA 3OBEA 3O7UA 3DC8A 4YVPA 2P53A 3MDWA 1BVWA 3KCOA 3W1QA 4TUFA 2ZRUA 4LPCA 1J2WA 5HUPA 4OECA 3RU8X 3VCCA 1QW9A 3UA3A 2WZMA 2AL2B 1IE7C 2OU4A 4S3GA 1FWDC 2BGQA 3B9AA 4LV9A 1PZ2A 2VURA 3P62A 2JK2A 1NU5A 2WJZA 2P3EA 2VRKA 3CT2A 3I65A 2I16A 2XM2A 2JQXA 1XFBA 3TE9A 1QAPA 3WLSA 1P4CA 1UQZA 5FIPA 4OE7A 2ZBTA 4NU7A 5AYBA 4UTUA 2Q6ZA 3BSMA 5ABFA 1E9LA 2A4AA 4LYQA 3E5PA 2RJHA 3NL3A 4LVFA 2GFTA 3BAKA 4UMBA 2OT1A 4ZQMA 1H2JA 4Z42C 4HCDA 2BHZA 1B3XA 4BF9A 2OVLA 1TPDA 1PVNA 1E0VA 1UD2A 1BRLB 3DC0A 4JIPA 1EEPA 4JYFA 3EDKA 2IXUA 5G4HC 1TTJA 4EANA 4D6HA 1GJWA 3LBMA 2C19A 3E3HA 3TJXA 1NTHA 1C92A 1HJVA 4LUSB 1J6OA 5FF3A 4DYEA 3WQEA 1Z6KA 1UMYA 3RO8A 3H4XA 2R14A 1XDMA 5DANA 2XFFA 3UP8A 3BGJA 1HG3A 3WQPA 2OZ8A 1FTXA 4GLEA 4Z1DA 1CIUA 5LXEA 3W00A 4GISA 3WK0A 4KH2A 4J7RA 3MUCA 1V7AA 3VD5A 3N6QA 3D47A 4B9ZA 1VRDA 4I6VA 4IIHA 3D5HA 3AOFA 3U5YA 3L2LA 2F6KA 5H8MA 5CBIA 1K6AA 1G01A 4WDUA 3MI3A 2Y89A 3CC1A 1GZ1A 1SR9A 2Z2BA 1AD1A 3UY8A 3A47A 3KWXA 2QAFA 1D8CA 3KDNA 1TPC1 4CVUA 1H7NA 2PF8A 1EHNA 1R87A 2OWXA 4S2CA 2HROA 1G7UA 4JGDA 3IJLA 4R9OA 4GACA 2IPWA 4LS1A 2VGGA 3UG4A 1T7LA 4HT3A 4XV0A 5D38A 2YL9A 2XGZA 5TIMA 4Q8UA 3UG5A 1TYGA 4LUSA 3F4VA 3IS4A 1W1TA 1RH9A 3HPXA 3FDKA 1FWJC 4H4IA 3F2CA 4MKNA 1GUVA 5F2IA 1OJXA 4BQ4A 4IWWA 4TO8A 4HOWA 3WD1A 4LC8A 1TMLA 4XBKA 7REQB 2P0IA 1MW3A 3KW3A 3LTSA 4IIBA 1HO1A 1TJ0A 4HSOA 4W87A 5IHRA 2NQJA 3KRUA 4U28A 5E1QA 4AIEA 4US5D 1Z48A 4RZBA 4OHQA 2RJGA 5TNVA 3GTNA 1GG1A 4WX2A 1K6WA 3IUIA 2O7SA 3HQOA 4KRUA 2RKXA 3QMSA 4M80A 1DXEA 1H7OA 2L5HA 4EWJA 2POTA 5LZLA 3AWOA 3CZGA 1EIBA 1B9ZA 4N02A 4EPBC 5AKQA 5A6TC 5KTLA 4TMBA 4C6OA 1F3EA 4XB3A 2E3ZA 4P7RA 1XLEA 4H3DA 3U57A 4JCMA 1FKWA 2WMHA 3TA9A 5KZDA 1Y5WA 2IPGA 5AC7A 4L9YA 3UPWA 1YXCA 2QJGA 3AQUA 1W1IE 3PAOA 3LPFA 3VDGA 3I4EA 1KXQA 2NZLA 1V6XA 5IBXC 2XG9A 4H9UA 1X6UA 1C8VA 4YYFA 2XGIA 1Z89A 2B7QA 5FAJA 1H7RA 2XYLA 1R47A 4H9MA 1RK6A 1GOKA 1UA7A 5JQ9A 4BI7A 2V6AA 2DSKA 4JL2A 3PZQA 2QT3A 4US5A 3BPWA 3L12A 3GG7A 3E0WA 5CBBA 1WP6A 1KFEA 3HO8A 2ZA1A 2ZWZA 2QUVA 2DZUA 2GZXA 1SW0A 1TUXA 3W02A 1GOWA 4EX4A 4Q8PA 4REQA 1MRQA 4H9ZA 2R1PA 5H1WA 2PS2A 1B3WA 2VVSA 3RLGA 1BFNA 3ZM8A 4XUGA 1AJZA 3QH2A 3AJ7A 1ADDA 4RPPA 1TR9A 3KS5A 5BRPA 1P0KA 3W76A 1AA1B 1NQ6A 5EFFA 3W29A 1Z3NA 3G1FA 2QCMA 5DN1A 2WC3A 1Z69A 2GQAA 1QVBA 1US3A 3OG3A 1YDVA 2PGRA 1DIOA 3UR8A 3RR1A 2DZTA 3QZAA 1GOIA 4M0XA 3EXSA 4UFKA 2C0HA 3VNKA 1EP3A 3BUVA 2Q09A 2W79A 3FHQA 2D22A 4WY0F 2DH3A 4NHVA 2PAJA 2DV0A 3PZIA 4GNVA 4MKVA 3TFCA 3LEPA 1XC6A 4LAUA 3LNMA 4LAZA 3CT7A 4MMWA 3W2KA 1D3HA 3P74A 4QG9A 2UWFA 4UR8A 4CVWA 3ITOA 4MTVA 4WDWA 2YDRA 3VVGA 1W9DM 4NZ4A 2OO0A 3UGRA 1KRBC 3GR7A 4L4MA 1M7XA 4N4PA 3GH4A 5CGTA 2CHOA 1TTIA 2E67A 4Q8OA 4F2BA 4Z2GA 1EYWA 3R4IA 1NOFA 4MUPA 4IIDA 1N82A 3UXDA 2E0PA 2ZX5A 1X39A 2DUXA 5T9BG 1GT8A 5AZ1A 4A3YA 4UNLA 3K8KA 1UP3A 3NQAA 1IXNA 2I57A 3GG1A 5EL1A 1OC5A 2BWGA 1KCXA 3BJTA 3GXPA 5G2IA 4PL1A 1U30A 1V8EA 2A6LA 4L5ZA 1VFUA 2QYGA 4MYAA 3UZXA 4M51A 5IXEA 2QJJA 2A3EA 1M7PA 1OX4B 3BW2A 2KX9A 2ZUSA 2QCGA 3TYDA 3W81A 1G94A 3W53A 4S3KA 3WUFA 4FXJA 3T09A 4ALDA 1T99A 3QYQA 2OODA 1VFLA 1KFLA 2PDLA 4X22A 1LT8A 1QO5A 1SGJA 3LMZA 4JY8A 1VYSX 3C8NA 1BWLA 1XW8A 3KOYA 3OIXA 3AMCA 2FDMA 4NZ5A 3B0VC 4LOCA 4OV9A 3BLIA 1YBQB 1UCWA 3UFYA 3FYPA 4C90A 3NTYA 1XDJA 2WJFA 5HR7A 3PZOA 6XIMA 2ZXBA 3FXYA 3GNPA 3N4AA 3PF3A 2ZZ3A 3VUPA 1L6YA 1XDLA 4PTVA 3B8WA 4UTTC 3MUXA 3DG6A 3DESA 4NG3A 3KRBA 4IPIA 3WF0A 3GKFA 2GJXB 3UWWA 3W4RA 1UC4A 1LG2A 4N9DA 3P60A 3VINA 4Z1BA 3V7PA 3NL2A 4AD1A 3SCUA 3SJNA 4GQQA 3NQ2A 1MXGA 3N2BA 1MQRA 1OX4A 1ODZA 1LM1A 4NXKA 4PBEA 4W8BA 4UZUA 3U4FA 1A80A 1V6YA 4KW2A 1D2KA 1FXQA 1EQCA 1EOKA 3FW6A 5BU9A 3MV01 2BOFX 2H8XA 4LXFA 1LQAA 3TCSA 3BK0A 1YBQA 4RW5A 4CCEA 1NDZA 2PDUA 1C3FA 3FK4A 2E9MA 3W22A 2P10A 1QMLA 3C2OA 4LB4A 3WJWA 2QJNA 1HJWA 4XD5A 2NVCA 4LS0A 3NQDA 3T55A 3TDFA 4C7GA 2NXHA 3HPAA 2GJXA 2X1TA 3GXNA 4YJ5A 4N0RA 3UEQA 3BLFA 2OZ0A 4S3EA 2E6FA 1RD5A 4NZCA 3MHFA 3BTNA 3MKKA 1JCMP 4HHHA 4H1ZA 2FPVA 1IT7A 3MI6A 3QR1A 1JNDA 2VI0A 5H6HA 2E6YA 1SZNA 5IHSA 3L2MA 4Q32A 2Q02A 4CCDA 4JIRA 3SCWA 1XYFA 1QNPA 1VLWA 3V35A 4CNNA 4Z17A 4KWVA 1G7VA 3ZOAA 4K2SA 1REQB 2CU0A 3L5AA 3IJQA 1E6SM 4RNIA 5CGMA 3ANUA 2QCHA 3KX6A 2W0UA 3CL7A 4HA3A 1E73M 3G1HA 3WMBA 1NARA 4DQWA 1HVQA 2F6XA 2OKOA 3BW4A 4H6KA 3DU0A 1ZAIA 1AW2A 2NX9A 3ATYA 4U2YA 2J78A 1P0EA 2ZTJA 2W5FA 1C8YA 1GEQA 3MTWA 1W56A 1Q5MA 4DVOA 3RMEA 3VYLA 3KVKA 4UFMA 1PO9A 4DO5A 4WOZA 4J28A 2NQ9A 1F4HA 4G5DA 4P7LA 3USZA 4CKQA 1DTNA 3GTXA 2X16A 4I9TA 4HA1A 1OZMA 1GVSA 4IPPA 4XTIA 3MCMA 5C8BB 1PL9A 4WDTA 4FXFA 1I45A 4H00A 3S42A 2CNCA 1RXOB 4J3XA 1O12A 4DF0A 1GG0A 4PUWA 3B04A 3VCNA 4B5XA 2CXGA 1REQA 2HXUA 3SCVA 3F5LA 4JL1A 4GUFA 3UERA 2Y62A 2D0FA 4AHPA 2NV2A 4KS0A 2XINA 3WH6A 4F4RA 1JGMA 1EUNA 2FZ9A 2GL5A 2BASA 2BHYA 2YB1A 1JYXA 1P0DA 4WLCA 5I06A 1KBJA 4JFUA 1NSJA 3L9CA 5CH9A 1JAEA 1PIGA 4GUJA 1TWZA 2POZA 2FHBA 2D0GA 1XYMA 4LEFA 1W1A1 3H2MA 4UFJA 3AHZA 1YPFA 2HDJA 2UBPC 4NVTA 4D9PA 1ZAJA 1UQYA 3OEXA 1LJYA 3GQYA 3TMQA 2ZADA 3AIQA 3SN4A 2XH0A 2DQWA 1K70A 1KBBA 4X9YA 1T6MA 4FOJA 3G5EA 3REQB 1WPCA 5CPLA 4MWAD 1VFMA 3MSRA 1A0DA 3EA1A 4N42A 3U7BA 3W7GA 3QQ1A 2BLEA 5FL1A 4MWAB 3HG2A 3FYOA 4B92A 4MY8A 3VGHA 4YXGA 2Z1SA 3GDBA 3G8RA 4IJCA 1HL9A 3MUIA 3GHTA 3FKKA 3AMLA 5XIMA 5HANA 3GIQA 3SW6A 4V1YA 1PEZA 1DXIA 3CAQA 5D9MA 5M1TA 1Q3NA 3BJFA 5DY3A 4CN6A 1W3HA 1AQ0A 2QMJA 1FCQA 4GC4A 3T0DA 3R58A 2PWEA 2RFGA 3JVAA 1UH2A 2XSAA 3L0KA 1Q7QA 4M81A 4ZBCA 3WUGA 1TWSA 3GO2A 4ENLA 4C1NA 4H7VA 3IAQA 3QJAA 3VIHA 3BH4A 3MMUA 4N4QA 1QWGA 1KBIA 2ZUTA 2C0AA 1RQHA 4PTNA 4M3PA 2EPHA 1ITUA 4AAJA 1T5AA 3LENA 1M6JA 4IFRA 2PTZA 3C61A 4M24A 1X8FA 1W3KA 3CZEA 3MYPA 1J5SA 3VPLA 3N6JA 4K68A 1IYXA 2Z1VA 3REQA 4F2UA 4K6AA 1RSCA 2DZVA 2YDSA 4HU0A 3ARPA 3R8RA 4MWAA 1O94A 3JZEA 2J4GA 4PTWA 1JPKA 1LYXA 4C6MA 3KAOA 3KOZA 1JDFA 3M44A 1R38A 4XKYB 2ZUNA 3LXBA 5E9XA 1WAWA 5TQLA 3W23A 2OZ3A 3I6RA 4KT2A 1V0MA 4F8XA 1ML1A 2Q3RA 1GKQA 1CX9A 1RQEA 4K37A 1JQVA 1K03A 2BXYA 3SGUA 3DFTA 2OT0A 3EMZA 3OLGA 3A4XA 2VUNA 3EDFA 3ALFA 3V0UA 4DI9A 3AC0A 1XH2A 3TZFA 4GZIA 4FMVA 1R86A 4QR6A 4C60A 4LCSA 4D2JA 3AUJA 2BV9A 2EG8A 4L65A 1W1PA 1I0DA 2VEMA 5CC5A 3C2VA 3WDQA 4YYCA 1JUBA 4PODA 2WHLA 2GVJA 4TTGA 4HHLA 4IL2A 1U83A 2CESA 5RUBA 3ITVA 4FXRA 4H04A 3T9PA 3L66A 1SQ7A 4M29A 4O8RA 1CGWA 1GCYA 1YMYA 3MKVA 1F3WA 1ODUA 3UCDA 4QP0A 4IMAA 2WVSA 3LQGA 4U31A 2BVYA 1SJCA 3PBVA 2VR2A 5IBXA 2ZZ1A 2YBUA 1OVDA 3ARSA 3QKZA 4H9XA 2WB5A 3VIIA 3N1AA 1FA2A 3VUSA 3VKCA 2HS6A 3GDMA 4QJ5B 5LHFA 3WKZA 1F2JA 2BOEX 3DGRA 1J0HA 4GD0A 5EPDA 3DHPA 2X05A 2PUZA 3T40A 3M5ZA 2E7FA 2BB0A 1V93A 3N2CA 3BSGA 3OGSA 3DG7A 4MFEA 5FJOA 3LGGA 1KRCC 4PMYA 1GKRA 3PG8A 3HOJA 1IR1A 4YVXA 1KM2A 3ARRA 4LUTB 1AZ1A 1W9BM 1J96A 2OGJA 3S6TA 4CU6A 1VBUA 2ISFA 4JR5A 3PWIA 1QTWA 1WXJA 1EDQA 3CHVA 3CB8A 2EJ1A 2FH8A 2CFFA 2PZ0A 1UR8A 3H7UA 4JIEA 4GY7A 5PTDA 3CUIA 2WPGA 1G67A 3BGGA 4MZYA 3WX7A 1Q7MA 1IQ8A 3VGFA 2A6NA 5AC6A 3UZJA 7ODCA 2E9BA 1BVNP 3AAMA 4O1FA 1K9FA 5LXXA 3ZLFA 3O1NA 1A49A 4ZB2A 2IXVA 1JYVA 1WV2A 1UJPA 3UVAA 3C6CA 4MUZA 3WDIA 3W1NA 3LHYA 4R3UA 2Y85A 1DQXA 4O1BA 4FOKA 2VYOA 1EWEA 5TAOA 5HDRA 2Z28A 1U1JA 1DP0A 1RCQA 3WUEA 5AFDA 3GRIA 2BVDA 4OBRA 2A1YA 4AZ7A 4D8AA 1ADSA 2VHLA 1JG9A 2D3NA 3B0PA 4LUTA 4BFAA 3U5UA 3SCSA 3B9EA 2Q8LA 4F66A 2F84A 2V3EA 3LA4A 1AL8A 4HK5A 2DSUA 4Y7EA 1I0BA 2ACQA 1KCZA 4IM4A 1OCQA 4RXGA 2H90A 3G2GA 3GDLA 1LBMA 3ZT7A 3RLVA 3RXZA 2Y7GA 1GONA 4GKTA 3EWDA 1E56A 3WNPA 5FSDC 4P7NA 1DJNA 4UB9A 2QEZA 4W88A 2ISDA 5IDZA 3NA8A 3WDPP 1KD0A 2E77A 2FQIA 2O9OA 2GGEA 3H7VA 4XTDA 3GIYA 3PG9A 4QITA 2Y7DA 3GNXA 3E5BA 3PPFA 4MGGA 6TIMA 3AMGA 3W7JA 2PE4A 2P50A 1F76A 4PEEA 1UR4A 3LCLA 2QKFA 1ZAHA 4NP7A 3W7MA 2NWRA 1VIZA 2CKRA 3OGRA 4IPLA 1VCVA 1WB0A 2ZOXA 2RDXA 4J3ZA 3T4CA 4JBRA 1X1OA 3V4BA 2RDUA 3MCNA 1NM9A 1NWTA 1Q6EA 2QJMA 3B9NA 3CHCA 1D8WA 1KW1A 3U9IA 3GY1A 2G95A 3ZR6A 3CIWA 5A94A 4J5NA 4DHGA 9XIMA 3GXIA 4CNUA 3WJZA 4AEOA 1CDGA 2C3ZA 3R12A 3W7CA 4L6HA 5HQMA 1R5YA 3NUKA 3IJIA 3BLPX 4UTJA 3QN3A 3D3AA 2HK1A 3HQNA 1QRQA 3BQ5A 4R7OA 3ITLA 5BWAA 2DIEA 4IX0A 4F48A 2QDHA 3XIMA 4RE0A 2HVOA 2ODOA 1ZB5A 3BOLA 5CC6A 3WL1A 2V63A 3UWZA 4RNHA 3G3MA 1JPHA 2BGNE 3TTYA 1JDAA 2JBMA 3PFRA 3EKLA 1W8SA 3MSDA 3GXFA 4IJBA 1UKSA 5DMMA 4IPNB 1UWIA 3LV6A 3T0CA 3W7EA 5MKGB 2PF0A 3OVGA 1TMHA 3EB2A 1P1XA 2OPJA 4KGJA 4MY1A 1JL8A 4AXKA 2FVMA 1JCLA 3BC9A 2RH9A 1Q7ZA 3TIMA 2BP1A 4LJ3A 4UR9A 4GC3A 3WFLA 4XZNX 1Q6LA 2QIWA 3V16A 4UQ9A 1ECEA 1FCBA 9CGTA 1XLAA 3PUEA 1B0IA 1MWOA 2A2IA 4CU8A 3H2NA 2J6XA 4DB7A 4QBXA 4DJFC 4QE4A 1TUFA 3A64A 3APGA 4F0MA 2QCEA 2DZSA 4QNWA 1XLMA 3S83A 1ZS2A 2Z7GA 3DI0A 4I90A 1UP0A 4EVZA 1ME7A 3CUHA 5LGXA 3UNDA 1UWTA 5CAHA 3EMCA 2VEIA 1PHWA 1K7FA 1SO5A 2B31A 1JI2A 1H1YA 4L1XA 3W7IA 1A4LA 2VDHA 4URIA 3L5MA 3UJRA 3W7PA 1PTGA 4K1WA 3A22A 1T8XA 5MKGA 3VM7A 3NQCA 5F1VA 2BVWA 4GUIA 3RIKA 3CH9A 1FWGC 1TV2A 2QVHA 2XZ7A 5HPOA 2VR5A 1HT6A 1QHZA 4D6EA 1XPGA 3TC7A 4C5ZA 5K2ZA 3LLDA 3UVIA 4X0VA 1UOKA 1UUQA 4XD3A 4AZBA 4C1KA 5SWUA 3GC4A 3VD3A 1UHVA 1JAKA 2WVTA 3H7RA 3L0GA 4PMXA 5ABTA 1VB9A 2FGBA 1WNOA 1XBYA 2O9PA 1A5OC 2WWCA 1BXCA 3WF3A 4M19A 3W82A 3AO0A 1A0EA 4UIOA 1A5MC 1RA0A 4JQ3A 1A47A 1ZTVA 1V03A 4W85A 3EYPA 5BWFA 4DRSA 2Z7KA 4XZMX 2YR1A 5LIXX 2WLYA 2EF9A 4RK8A 3T6CA 3PUOA 4IP7A 4QXIA 5LIWX 4S3CA 4DNMA 1PJ9A 4YN5A 3NO3A 1H49A 2EG7A 3S9YA 1F05A 1WXZA 4PUJA 1QNRA 3M07A 1OY0A 4RPQA 3L4WA 1VH7A 5I3KA 2EKCA 3TXVA 3UJFA 1JD9A 4DLFA 3WK2A 2WMGA 3PK7A 1O6IA 5XINA 4JTJA 3VIFA 2P88A 1QW7A 3M47A 3KXQA 1XGZA 1KO0A 3Q4DA 3AXIA 4R53A 1R3VA 1UD6A 3P14A 5E5CA 4O50A 2E8YA 3U2CA 3SFWA 4W7WA 1IEWA 1NH6A 3QQ0A 1SSDA 1DJGA 2P1FA 1UMLA 4UWMA 3AUOA 3GAKA 1KXTA 4ZO6A 1R30A 2XIQA 2QDEA 4LVAA 3AU6A 2FIQA 5GJMA 3GNOA 3TUUA 4B4FA 4OZOA 2BXZA 3K30A 4GH1A 3WBYA 1V3HA 3MVIA 4AC1X 4WJXA 3W0KA 3G1DA 3NL5A 1KXHA 4I7VA 2EAWA 4LEQA 4UOQA 2VQTA 2YA1A 4RV8A 3W7NA 3ZJ8A 1SU5A 1U1HA 1EA0A 1PBGA 3P2VA 3QGAC 3TAOA 3H26A 3N12A 2FDSA 4FOUA 1I2PA 3EWUA 2VO5A 2EXOA 4TX9A 3WDHA 2FZDA 2PWFA 2GQ8A 5BRBA 1DIEA 1R9XA 4I5XA 2X1RA 4JTUA 2XFWA 4Q33A 4FNSA 5DEZA 3ZT6A 4UTFA 3EWWA 5LGZA 4QDPA 4GQRA 4BR1A 4K1GA 1R7OA 3MCOA 2OYLA 1YTDA 1PX4A 5IM51 1ADOA 3QOMA 4E8DA 2OOFA 4HNCA 4AY1A 1F73A 3CPGA 3CEPA 4KRTA 4QCFA 1PUDA 2PDQA 1UR3M 5L6UA 3T7VA 4IUGA 1DJZA 5LIUX 4ZE4A 3U8GA 5C7HA 1H09A 4FB7A 1GYNA 1GK8A 2R82A 1SMDA 2OLHA 2WSQA 4FLRA 1XSKA 2QGHA 1NVMA 3TLLA 4YWIA 2UZ9A 1EGVA 2QCNA 1UZ1A 3LX9A 4ZCWA 1WX0A 4C6BA 2D1ZA 4W93A 2CZ5A 5HNRA 3OBKA 3U4AA 1UYQA 2ABBA 2O4QA 2QCLA 5FF4A 2DVTA 1XLBA 2VFEA 4YHEA 1BD0A 3KRSA 4O17A 3XINA 3NO1A 1TZ9A 4UTWC 1UR1A 3B8IA 1DKWA 1HJSA 1KRMA 1FP8A 4L4OA 5AHMA 4Q4PA 1IXQA 2ASHA 4UNIA 3VCRA 4GI4A 1EB3A 3O15A 3UYCA 2CLOA 5GJPA 3VO0A 9XIAA 5D03A 1SZRA 2VQUA 3O6CA 4WGXA 1L6GA 3LDVA 4LYRA 1YTKA 3VABA 4ZVJA 4DJDC 1UWAA 4OBTA 2WQDA 3K4DA 4NZ1A 3MC5A 1U5HA 1R3WA 3G1RA 2PA6A 1EJ7L 1H60A 4RDYA 4NASA 2HVMA 1Q2RA 1UWRA 4Z2KA 4JTEA 1UBPC 3RM8A 4ORMA 4IXXA 7XIMA 4MYXA 1HX0A 3CQKA 3AIWA 4LBUA 1QO2A 4GIYA 2QJIA 3TJIA 5EMYA 1OABA 3EOOA 1ZP4A 3VNYA 3M0YA 5A1AA 2ATMA 1X38A 1IEQA 2QHAA 3PAJA 1QUMA 4Q8QA 1G4SA 2J9ZA 3H23A 4M7TA 3M5XA 4LT9A 4YTUA 1XG4A 2CWNA 4L64A 2WZIA 5G5IA 5A95A 3EX6A 1D7KA 4HNLA 1E51A 3G0SA 3ENLA 2FGLA 1CLKA 5FF2A 1OCJA 1WDRA 2Z1WA 1M53A 4INFA 1FWEC 3SRFA 3GHRA 1VBGA 1LG1A 4QRNA 1OD0A 3NXLA 4TX8A 3W7LA 4O1DA 2ISVA 5I03A 4KCVA 5CLTA 8CGTA 7PTDA 3O8AA 4CEXC 2A3BA 4RNJA 3G6LA 1EDTA 1E9ZB 1Q6QA 1LORA 1RLCL 2ZVIA 4DIAA 3P61A 5DMNA 3MB9A 1TPH1 3A5VA 2OG9A 5FCZA 3STPA 3N17A 2VTFA 2YBTA 4GUHA 1OHLA 4DPPA 5DCDA 2PWHA 3EKZA 3LI1A 1NOUA 3RRXA 2YSWA 3LZ5A 1WUEA 3W37A 5GNZA 2IKHA 2YCLB 3O06A 4DN1A 3EDEA 2J88A 3P0XA 1RCXB 4MWAE 3F2BA 4WGHA 4MSSA 4QG6A 3B05A 3GH5A 1ME9A 1LROA 4PTXA 4ZQCA 1PKMA 4ORIA 4IQJA 2DUAA 4JFTA 1XIMA 8XIAA 5ABGA 1UROA 4HCLA 4Q4SA 2OXNA 4L9ZA 4BWLC 2PZNA 3EEZA 1JCYA 2JGYA 1Y7VA 1H7XA 4BJHA 2R91A 1BXNA 2VCBA 3QV7A 3AYTA 2ZA3A 5C9XA 2QF8A 3NGJA 3M0MA 2FKPA 3E0IA 3THQA 3GW3A 1S3HA 3RX2A 5BOFA 1XLFA 2RGMA 4YL2A 1B57A 3VIGA 1V77A 3U3HA 1W5PA 3O07A 1HKKA 3ATZA 2DW7A 1UD4A 3ES7A 3FXGA 4YMZA 2V5CA 2PMQA 4KRZA 3E6EA 2ZUMA 1J12A 4QS5A 2YCLA 3MANA 1VFOA 2Z29A 3GXMA 4DO7A 1A53A 1O5RA 3A23A 1XFCA 3DECA 3LCGA 3CMFA 2JGQA 3KTCA 1E6QM 3CIXA 4G7FA 3S2NA 3U2ZA 1KQZA 4DZAA 2JKAA 3BO9A 4GYPA 4C6CA 4UTHA 2V82A 5DRCA 4DUOA 1F5ZA 1J0ZA 4S2BA 3MPGA 4PB3A 3WMLA 3B8UA 1BKSA 1X7FA 5FA5A 4AEFA 2WAGA 4HSHA 4A8RA 1XH0A 2EHHA 4DAIA 3MU7A 3VMPA 3KHDA 1Y5XA 4A35A 4P7OA 3VC5A 3OVPA 5FI8A 2J7BA 4AVFA 4QJ3B 1XXXA 4RE3A 3AIUA 2PWUA 4G8TA 2FMNA 2R1NA 1FHVA 2VUYA 5C55A 4FX6M 4HA4A 2Q71A 1BVZA 2FJKA 5EBUA 1TV3A 1H51A 3ITTA 1QPRA 3ES8A 4UTIA 4LYPA 2WANA 2G8ZA 4G2DA 3D6NA 1N7KA 1ZFJA 4ASTA 3TFXA 3CPRA 4OJYA 2YFOA 1L6FA 3QHNA 1P48A 5K4XA 5B7YA 3KCLA 3QQWA 4DM2A 4OU1A 1Q6DA 4CD5A 1G4TA 1LOQA 2YCJA 2JF7A 1KKRA 3I68A 4XZWA 2WHKA 5AECA 1B30A 3EOLA 4AIUA 3VZYA 1TJ2A 1RJRA 4CQAA 2QUUA 2BY1A 2VXNA 3H4WA 3WSUA 3S5YA 3C2YA 4DF2A 3ITGA 3TEVA 3DXIA 3BLOA 3N14A 2O9TA 4QISA 4BQ5A 2D2JA 1VPYA 2QJHA 4C7DA 4DO6A 4F0RA 1LWJA 1N8WA 4HPNA 3STGA 4HPHA 2OEMA 3BGAA 4ZQRA 2PCQA 4PCNA 3TOPA 3HFYA 1TFVA 4TIMA 1JR1A 3K8MA 4JN6A 3KL0A 4ROQA 1MZHA 3O05A 3CYVA 3JU2A 3CM4A 2INEA 3BVJA 1HZYA 3N3MA 1HQTA 4JZ5A 2HPMA 1MMFA 1Z42A 3OLEA 3F4WA 3PZ9A 1WBJA 4D6IA 4TVCA 3KS6A 5HPCA 2ZZ2A 2C1IA 1FCVA 3WD2A 2WCAA 2X42A 4W8AA 1BWVA 4MJMA 1BEUA 5BXSA 3H70A 2R9RA 4P5UA 3TNBA 2Z2AA 3NQGA 4BI6A 1EYEA 3S6OA 4NAEB 4D6JA 3OA3A 4YIWA 1DORA 4PULA 2XISA 2PSNA 3NJ3A 1Q63A 5H91A 5A8NA 3P80A 5CPSA 1V02A 4F0KA 5CBJA 3BV4A 1OX6A 2O55A 3TJ4A 3EGJA 3MV11 2VT0A 2YCEA 3N2TA 3TXZA 1WZLA 4QM1A 3K1DA 2W66A 3VNMA 2QQ6A 3M0KA 2OX4A 4C6DA 4CD7A 2X30A 1QU4A 4Y9MA 1B4KA 5FJIA 4MLJA 4DBEA 5AYXA 4WSHA 4DWSC 3V18A 3EDJA 3UY7A 4G7EB 3LMYA 2FZBA 3COTA 6PTDA 4JCLA 1GQLA 3GFZA 2PD9A 4GGBA 4X63A 3BWWA 2WKJA 2VC6A 3EWCA 5F4WA 4KCTA 2DZXA 4MIMA 1N2VA 4F0HA 3WBAA 1KFKA 3UETA 1M65A 1VHNA 3GR4A 3GXDA 4PZVA 1IR2A 3L67A 4DY1A 2V2HA 3VOGA 1NF7A 4NAEA 4GCAA 5HWNA 2UY5A 2CW6A 2VEGA 1H11A 3THUA 2GJRA 1RJQA 2PDGA 1GHSA 1ZU8A 4LTSA 3B8DA 3WQVA 1TWWA 4MZ8A 4YNGA 1YNYA 3S5ZA 4X60A 4ZTYA 1PWMA 3QPEA 3TH6A 4WJ8A 3CJPA 1VD6A 3ZJKA 3LCFA 3LV5A 2PGEA 3BMXA 5M03A 3CL8A 1BYAA 1G1YA 4X2RA 4UBPC 2BOGX 3VFLA 2DZAA 4G7EA 1PTAA 1ZJBA 1JFHA 1R2RA 3ABZA 1ZLPA 3BANA 1QWKA 4Q6XA 3OYXA 3Q37A 1EHAA 5FSEC 4GINA 1HTIA 5E09A 3IJDA 5CZTA 2V5DA 1XJBA 5CPTA 3VNLA 2FHFA 3LRKA 1FWWA 1UWUA 4XO6A 4S3FA 3L21A 3G0UA 4ATLA 3DDMA 1Z8AA 4CD4A 1JVNA 4HU3A 3DAQA 3BURA 1RCOB 3SZ8A 3RITA 4C6KA 5I79A 2RAGA 3PHAA 4YTRA 2FZMA 4UNKA 4C65A 2YL5A 3LXAA 4GZ7A 2J74A 4KF1A 5AHEA 1ICPA 1PB0A 3WJSA 3M5VA 3DFYA 4DELA 4O10A 1XD1A 2VGIA 3NYDA 4O14A 4O19A 2BFGA 3NSNA 3M6DA 1XIBA 3UJSA 5E0CA 2NQ5A 2PDYA 2WXDM 3OHMB 5HJLA 4XZ9A 3UYIA 1U5JA 4ACYA 2WSRA 3VKKA 5LA0A 3UZWA 4HNTA 1NDYA 3LHWA 1SUXA 1Q4WA 1GVEA 3IIPA 2PRHA 3AZSA 3MBDA 4FNUA 1KFJA 1IT8A 4XZHA 2KZHA 1JI1A 4G9PA 4O53A 3AWNA 3URNA 5AYIA 4D6CA 1CGUA 2OX1A 3P84A 2WHJA 1XPYA 3A3WA 4ZXOA 1KFCA 1UD3A 1LDCA 3POCA 1JRCA 2QV5A 2H8ZA 3E0FA 2V3GA 1K8YA 1C91A 1QHOA 2WO5A 1MZRA 5XIAA 1EGMA 5AYYA 4JKLA 4JKMA 4H9VA 3HPSA 3LG3A 4R5EA 4J2MA 1GVOA 3PZVA 4U2ZA 1AW5A 1OADA 1SW7A 3DFPA 3TX9A 1F7BA 3RN6A 1YXDA 4K38A 4AQLA 5DO8A 1W54A 1QPOA 3RPTA 4W86A 4IPJA 4GI9A 2R8WA 3P67A 1A3HA 1XUUA 3WEMA 1ZRQA 2ISWA 2VZUA 3MHGA 1EZWA 3SB0A 2V38A 2B7PA 3EB3A 3TZNA 3W86A 3W87A 3GZAA 4PUKA 4Y96A 3N15A 4MNJA 2A3HA 1HW6A 1S2CA 4PFMA 1C8QA 3UZ5A 3ZR4A 2J24A 3SI9A 3VNDA 2IKIA 1W32A 1SW3A 3D3FA 2FFIA 4UZSA 4JNYA 5EMKA 1P5BA 1Z7AA 2YDAA 4WOQA 3ZLHA 5JU6A 5A8MA 1DYSA 3PBWA 2CZEA 3VKDA 3QPZA 2G3NA 3LYEA 5H2ZA 1FWHC 3S5OA 1NWUA 1UR9A 2NT1A 2F2HA 5DMYA 4WXYA 4KEZA 4XD6A 1DEDA 1TQXA 4HMNA 3GG0A 1AFSA 2Z1XA 3EDDA 1F6YA 4US6A 2WOQA 2ZRXA 1BYDA 1IEVA 3UG8A 3SJ3A 2DPEA 4HCHA 4KERA 3EOEA 4LRSA 4NSBA 3G24A 3CTTA 2Z1BA 3AXHA 4Y90A 4C6LA 2RDTA 2Y24A 2DT0A 4HP5A 4B9YA 3HGRA 3NZPA 1LLZA 4L9XA 1OFDA 3STCA 2A0NA 4QJ1A 3CV1A 4R85A 3DBNA 5HWMA 3F2DA 3VOCA 3GE7A 1WXYA 2LLEA 4HOZA 4NL1A 2GK1B 2QUMA 3RO6A 4N9BA 4IIGA 1BXBA 3HGJA 1OYCA 2C18A 3C2FA 3FV9A 4A3HA 3S2LA 4IFOA 3WNOA 1BG4A 1F8MA 3M0ZA 1TPVA 5FEPA 4GIAA 4XAGA 1J79A 3F4CA 8TIMA 4S3JA 3TYUA 3PB2A 5A3HA 1PX8A 4H41A 4H7ZA 2VOTA 3POHA 3J7HA 4NYYA 5G1YA 4GZJA 3ZSSA 2CLHA 4S3DA 1ZBKA 5LSMA 5CC7A 1I60A 3QC0A 4GGHA 3RG6A 5JIPA 4HKPA 3NSMA 1O95A 3OZPA 4L4PA 4IGSA 1CTNA 4ZO9A 4E8CA 4EPEC 1CXIA 3PJTA 3EPOA 4C6JA 5LNVA 4DNHA 1VCFA 5AOUA 3INPA 1WDWA 3L4TA 5IFTA 4HOXA 5KEZA 5D9OA 3BJSA 2VDIA 3O0KA 1T8QA 2GUBA 5J5RA 2FHCA 4LNCA 1MVYA 3PR2A 2GK1A 2IQDA 1VZWA 4PCFA 2G37A 3WLHA 1DIDA 2R1LA 3G3DA 4AEEA 3GU1A 4JTDA 2CHRA 1XCFA 1EZ2A 2WBKA 3SY1A 2ZA2A 2X7WA 3KP0A 2DSZA 1J0KA 1V5XA 3UG3A 1JPDX 3CZLA 4XWUA 2PLJA 2W67A 2CBJA 5F2LA 4AIOA 4W8LA 1YIXA 3W2LA 1TB3A 4S3AA 2IKJA 3EOSA 1H0IA 4GHRA 4UFIA 4DUXA 3ITYA 4PSPA 5D2YA 3MUY1 4RE4A 3T1GA 3W1MA 2X41A 3QRHA 3C0QA 1R3TA 1BWKA 3GX9A 4ICNA 4GIRA 3OQEA 4B3ZA 1IIHA 4FLSA 4A8NA 4Z2HA 5I24A 3QKEA 4LUYA 4I9MA 1CECA 3CAWA 3SDOA 4P8UA 4M1RA 4D6GA 3TKFA 5CPMA 2W61A 2J8FA 4AHQA 4K8EA 4CD8A 4HMCA 1JUEA 4XKMA 3HMJG 3QZEA 6TAAA 3TSBA 4XK2A 2HCVA 3DKJA 5A8OA 3LN3A 4EF9A 2Z27A 5DT5A 1QI5A 3OB8A 3WG6A 3ARZA 5A6BD 1LL7A 3OO2A 4QAIA 1IGSA 1TTPA 2J7DA 3AHYA 4KQNA 4XQ6A 1W1YA 3HGSA 4IIEA 1S3TC 4MJZA 4O4VA 5EGRA 4MOZA 4B90A 2CZVA 1BGGA 3CHDA 2XUCA 3QV6A 5I78A 1M7JA 4AYGA 1A3XA 4PMZA 1YYAA 1DWGM 3M0HA 4GH3A 1W5QA 3OP2A 1Y0EA 4MPKA 3DKLA 3ZSTA 3GXTA 1NF0A 3MMWA 2VOMA 3UWQA 3BZGA 1P6WA 4EXAA 4HB7A 1XIJA 1QNSA 3QXBA 4IHCA 1CXEA 2YL8A 4FX7A 2XU2A 3QEZA 3WDJA 4FF5A 5LA2A 6CGTA 4DWSB 2WMIA 4ZOAA 4AVNA 3L5LA 1VBJA 2NXIA 5DBUA 2E5CA 3AIRA 1UWSA 4GVIA 3A4AA 5E9AA 4ZMGA 3PTKA 5A6BA 3N29A 3ZJ6A 5CCZA 3NM3A 4JD4A 2PB1A 4O1CA 3UXLA 4Q8VA 1KNWA 3MP5A 1UKQA 2DDXA 1C7TA 4IQEA 4ZO7A 2W6RA 5B7ZA 3EEGA 3TC6A 2ZX8A 1O5XA 2Y70A 3V36A 3TONA 3UWEA 4H83A 1EP1A 1EL3A 2F61A 3U7VA 2HBXA 1NELA 1EF2A 1AQFA 2JEQA 3KHJA 4ZB0A 4QHRA 3E96A 1CPUA 4XISA 1RPXA 1F8IA 2ZXAA 4F40A 3TN6A 4HJWA 4OOZA 2J7EA 4QQUA 4Y6GA 1BPLB 4LAMA 1CXLA 3TSMA 4V28A 2HEJA 3P6LA 4NRSA 2PDIA 4IJRA 4HGXA 4GY0A 3NQ6A 4LVGA 3M0JA 3HG5A 4MLRA 3M6YA 1VAHA 1IT0A 2E1WA 4W5UA 5DY2A 2YXXA 3G77A 3FA3A 5M17A 4HA0A 2GPTA 3LM7A 3H21A 3LCIA 2WQPA 3B9OA 3WEZA 1OYAA 5I3FA 4PBGA 4GPNA 3VD9A 2VC7A 3W2NA 2GJNA 1B4EA 4WKFA 2VP8A 4MG4A 1NP2A 1G5AA 2Y8VA 4LNYA 3VMOA 1F3TA 2G5WA 1Y8BA 4GQ0A 4S3BA 1IIGA 3O9NA 2FZNA 3BXWA 2ZICA 3HTWA 1C93A 4HD5A 3UPBA 3W7HA 5KSWA 2QF7A 4QDWA 5B80A 3RRAA 5JMUA 1W9UA 3G22A 3M0LA 3WLOA 3UW6A 3K4WA 4JFVA 3B97A 2QCCA 1HKMA 3NVDA 3T81A 4AYSA 5JH2A 1B54A 1XQLA 1K8XA 4UOZA 3L4UA 3S9ZA 1EC7A 3TWAA 4IICA 3UPMA 2AQVA 4GIEA 4KWUA 1QPQA 4PYSA 4IMEA 1O68A 1AG1O 2DZPA 4PUNA 4XAYA 3L7RA 4JIIX 3BOXA 1Q65A 2AKMA 3OLIA 5REQA 3NG3A 3G1VA 5LNRA 5DLCA 4R27A 1VKFA 2PD5A 3H2AA 1XHGA 4JTGA 3FCPA 3A21A 5EMJA 4PB4A 3C2EA 1GPWA 4QGCA 3WF1A 3NQMA 5C5YA 4A22A 1E0XA 3OJGA 4IXHA 1AW1A 4UQEA 2YYUA 9RUBA 1P6BA 1QNQA 3GDRA 1JD7A 1PKNA 3DOPA 3RAOA 1Q6CA 5AY7A 3IIXA 5JH1A 1B3YA 2XN0A 3N18A 4D8ZA 1ZHAA 3EPNA 5EY5A 3SUVA 2HPIA 1BLIA 1PKLA 4AUBA 1GQIA 5ECVA 4ZQPA 1EWDA 2BMBA 2CC0A 1XD0A 4XVEA 4DYKA 1V02E 2AAAA 2Z6IA 4HHPA 2G4JA 3TMLA 4S39A 4KFNA 4XUYA 2A3AA 2DU2A 3FY1A 3QR0A 3VGGA 2WNZA 2I56A 1JFXA 5BNKA 4I8YA 3IK2A 2JFEX 4V1XA 1DWHM 1GQJA 1KA9F 2H6RA 4JTHA 2ZIDA 4NNCA 4MB3A 3WF2A 1CB7B 1TMQA 4LX4A 1G4EA 1JULA 1VENA 4W7UA 2EEXA 4LFYA 4O13A 5D32A 5KZEA 2B0MA 3PZTA 4F0LA 2YJQA 4AZ5A 1EQPA 4DJED 3GNNA 1CYGA 3LGDA 2OSWA 3I4KA 1TPB1 3SCTA 1UKOA 2GUUA 3MMDA 4FA3A 4MWAC 1UBSA 2D73A 4I5UA 1FWFC 3CEUA 1NIUA 1BSIA 3BLEA 3ABOA 3R0DA 2I5IA 2VFGA 1ITCA 2YYTA 3WLLA 3VDCA 4NXSA 1IGWA 1OT1A 1TIWA 2OO6A 2XIMA 3C5QA 2GJPA 4FIQA 1VR6A 5JBFA 1RV8A 1I2NA 1NY1A 2VM8A 3HMCA 1LL6A 3DZ1A 3KBWA 2V9DA 1XBVA 3VIJA 3IEBA 3THCA 2GVGA 2C16A 1ZJIA 1UD8A 5EFDA 2NW0A 4REQB 3NQ8A 4PUEA 1RBOB 3OZOA 3QFEA 4XVDA 4GA8A 2YA2A 4XBJA 4DXVA 4I9JA 4KBXA 1MI3A 4TX6A 2ICSA 4U5IA 1LWIA 4DJEA 4B15A 4JQ2A 1Z41A 4MB4A 4IP4A 4OUIA 4GFIA 3GW0A 3SSJA 2PDKA 3TP4A 2C15A 4AG0A 3TYZA 2H9AA 2CZDA 2PP1A 2ON3A 2VCCA 3OVQA 3AROA 2NV9A 1R85A 4PUUA 5C9UA 5M5DA 1E5JA 3FA4A 5A8PA 5HQLA 3CMGA 4YTSA 1KWKA 5CSRA 3MWAA 1JGIA 2J8GA 4MKSA 3CL6A 4LH8A 4O28A 1FX6A 1IHIA 4FR1A 5K9CA 2PP3A 2CBVA 1PE1A 2ZTKA 3VGEA 1CXKA 1XGEA 2CERA 2PDNA 4WKHA 1JZ8A 2HZGA 4IZGA 2PTXA 1D3CA 3Q65A 4UOJA 1YHTA 5C54A 5CPOA 1FHUA 1K1DA 1FWAC 3WZ0E 2OYKA 3HA1A 4FALA 3JR2A 3QM3A 1GNXA 3ONBA 1WOAA 2OZTA 5FESA 3B0UX 3CU2A 3I6TA 4M6PA 5BYWA 3S1VA 3H53A 3V0SA 4O16A 1CGTA 4KEUA 3S2JA 2W9MA 2ZCGA 2CBUA 3WDRA 1GTHA 3M1ZA 3E49A 2A7RA 3MW7A 1ONEA 1TJPA 4WUIA 4P7QA 1TZ7A 3AS0A 3GIPA 2IPJA 4IG2B 4O57A 2YZ5A 4AZCB 4MAZA 4GXPA 4P8XA 2TSYA 4C7FA 3S1XA 4QLJA 1OF6A 2CYGA 3CWOX 5LHEA 5DX7A 2AMXA 3TQPA 1M1BA 3QFWA 4WD0A 3SY5A 4ADTA 1V0NA 5I09A 1MO0A 4PMDA 5I77A 4KFPA 1TSIA 3FSUA 2D0HA 2WSYA 1OF8A 2I5QA 2GWNA 5D05A 1MDLA 1J0IA 1NJJA 3GC2A 3QY6A 4O4WA 3PJXA 4QQ3A 3GTFA 4X61A 4P2VA 3DFSA 4GCXA 2HTMA 1OCNA 4UUIA 4ERGA 4R7JA 4JTQA 3V3WA 3KUMA 2A7PA 3PNZA 1I2QA 1HN1A 5AC8A 1E6RA 5F4SA 1UKPA 2NUXA 5FOOA 2ZUVA 3NQEA 1ZP3A 4PBFA 2J47A 3M0XA 2C79A 2VZTA 1CLXA 3ISIX 1NDWA 2VELA 4HBKA 4XZLX 3SRHA 4IG2A 4RJEA 3GVQA 5DF0A 3M9YA 4AZCA 2OJPA 4OIFA 1E1FA 1EC9A 3IRSA 4J3UA 4LAOA 3BSHA 1HFBA 4L6OA 4N2YA 5LNSA 1EPVA 3FIGA 1LL4A 1YE6A 3TU9A 3CV6A 6XIAA 3CS2A 2ACRA 2WJEA 3MBFA 1XYAA 3B06A 1OEPA 2WVVB 4XIMA 1ISZA 4FR6A 1RHCA 4WJEA 4E4FA 3W25A 2OYMA 3H22A 3CXOA 2ZRZA 4E8GA 3ERPA 1OIFA 1MDRA 3WMCA 3WQGA 1QR7A 1ZQ5A 3GYCA 2FZ8A 4DZHA 2CKSA 1TV5A 2KAUC 2ZRWA 4JTCA 5CPNA 3IV8A 4J9JA 4WZHA 3VKBA 1HL8A 1KFWA 4CNOA 4HVXA 1X7IA 2WPBA 1ZBWA 1JF5A 2IW0A 4H01A 3VDBA 3EA2A 5U4NA 3SGZA 4HHMA 3APYA 3G1SA 2CIPA 3PS7A 2R24A 3VKJA 4IQLA 2BNJA 3MKCA 2Z0IA 4KFOA 1WKYA 3SEPA 3ZVHB 5GNXA 3W88A 2NQHA 1DE6A 1JPMA 5IDIA 4YCOA 1ZL1A 2NQZA 5CQ1A 1G9HA 2BZNA 3KBJA 4O15A 2WVVA 3IJ7A 4RL3A 1UUOA 3EPMA 4TR9A 4NX5A 2V2CA 1PV8A 3OYZA 5BOOA 4Q8WA 4XX6A 2DP3A 5IOBA 3UR5A 1CWYA 8RUCA 1CZ1A 2HE8A 3LCHA 4RUBA 4FK9A 1LZOA 2D2HA 2DGAA 4GJJA 4D1IA 1OYBA 4R7WA 2OTDA 3QSTA 1KBLA 1H4PA 1W3JA 4OV4A 2Y2WA 3CLWA 3AZTA 3PZMA 2YLAA 3IAPA 4GJ1A 3W24A 1Q6FA 2ZX7A 2A85A 4Q3MA 1QW8A 2YBVA 3WH5A 2VL4A 2VKZG 3KOFA 2HNHA 2REQB 4HK6A 1XIHA 2A79A 1JCNA 1KFBA 3SN1A 2J13A 3WK1A 1CEOA 4MNKA 3H4GA 4POCA 1JZ2A 2PPGA 4ML9A 1AK5A 2GGHA 3E0VA 1BYCA 3S4TA 3FSTA 3ZVHA 2WMJA 3HB9A 3N34A 2WHMA 5HAOA 3VC6A 4NYUA 2W3ZA 4U3CA 2Z1KA 4ERIA 3GKAA 1H5VA 3M0VA 2XM1A 3W6MA 3UJ2A 3RLHA 1M68A 3C0SA 3YPIA 2F2KA 4BQ2A 3PBMA 1QDSA 2XIIA 3LLXA 4IL0A 3VDAA 5C2GA 4HSNA 3G18A 5AVHA 1DOSA 4NIRA 3I6EA 1GZGA 4R9XA 1JZ6A 1ESWA 3KFTA 1F07A 1VCGA 3H24A 2VEKA 1YPIA 4E2BA 1JUKA 3NCOA 4PSRA 5A6MA 2XPKA 5BOEA 4W7VA 3SQLA 4AX6A 1P43A 2Z24A 3W1PA 3LTYA 1KB3A 2ZZ4A 3PZGA 2REQA 3CHFA 4AZGA 2HRWA 4U33A 5C2CA 1VFFA 3N2OA 3PANA 6ALDA 3I10A 2ABAA 1TCMA 1KKOA 3R10A 1OFOA 3MP3A 3IJ8A 3MUAA 5FJPA 1ICSA 3EA3A 1V4YA 1QASA 5CSUA 3GFXA 3DG3A 1OD8A 2V3DA 3RILA 3NGFA 4QEHA 1WYIA 3KDOA 3RNDA 3RPDA 3W7DA 1JXKA 1ZNNA 2CZFA 1B90A 2XJ7A 3WQFA 1KQYA 2ZC8A 1HIZA 1KGUA 3BG3A 1K8ZA 3CUGA 5C71A 4OTKA 1CGYA 4U10A 3W7RA 1U33A 1UW9A 5BROA 4LQ1A 4JY9A 4ADUA 2PBOA 5CKSA 5CZ0A 5HUOA 2FMOA 1XLCA 3CYJA 5DFAA 1XSJA 4AZ6A 4EAMA 3F4NA 4HN8A 3VDHA 3QR3A 1UPMB 3QBUA 2ZDRA 4C1NB 2WMKA 1FDJA 4O18A 1M7OA 2Y7EA 4EWND 1J93A 1TVLA 3VE7A 4LVBA 1S2UA 3LUTA 2ACSA 2W92A 4AMAA 1PDZA 1XIEA 4MHBA 3QMTA 1CW2A 2XSBA 4PL2A 4OWGA 4Q4QA 4DBSA 3VU2A 3ZO9A 4GVGA 3DENA 3AHTA 4PMRA 5I3JA 3NDZA 1D7FA 3TK7A 2C91A 1QBBA 3W1AA 4GABA 2DIJA 4ONVA 3F7JA 3IJ6A 3MY9A 4EKJA 3AZRA 5D2WA 4F9DA 3W70A 4J3TA 3OA5A 4MF4A 2INFA 1TO3A 2R6OA 2VX7A 4AY8A 4Q4RA 3ZIZA 2Y88A 5HULA 2CLPA 3AYSA 4JHOA 3S1WA 1QPNA 4UTKA 1R2TA 1TPWA 1JJKA 4GK8A 1POJA 3VZXA 3THAA 3P5ZA 3LCXA 4WY0B 5LA1A 4PB5A 5CG7A 1LTDA 2VWSA 4O0KA 3WQ5A 2GSEA 3LPGA 4K3ZA 3OGVA 1KTNA 1KV5A 1QPKA 3QHMA 5E6YA 2G97A 1ZCOA 3QY8A 1WUFA 5KITA 1V0KA 3HN3A 1EXPA 1XX1A 1AH3A 4Q7NA 3O6YX 1S2VA 3FS2A 4ICMA 1E6PA 4FZIA 3M43A 4OT7A 1K77A 5E70A 3CAKA 3N4FA 1F9CA 2V67A 1RVGA 4AZHA 1KBKA 1W9VA 1MQQA 4BI5A 3N4EA 3QW4B 1TWIA 3N73A 3QVQA 1I1WA 4B5SA 1RR2A 2QDGA 1GPFA 3UZYA 3W6LA 2FB2A 3FLUA 1FWBC 4YU1A 3WF4A 3TYAA 2FTPA 4W84A 1B2YA 3ITCA 3Q58A 1MW1A 3SCOA 3VD7A 1KWGA 4WY0A 3NPXA 2AQWA 4W89A 1H1ZA 3PTQA 1XV8A 3M46A 1Q4NX 4EPKA 4DPQA 2X40A 1T40A 4C5YA 4GE8A 3VM5A 3UU0A 2F7FA 3R5EA 2OGYA 3FHAA 4MM1A 5MF5A 5I00A 4K39A 1G6CA 1DJYA 2X1SA 3W73A 4LB3A 4GYFA 2JKPA 4XZIA 4Z1CA 3EWYA 3U2OA 1YKWA 3Q45A 4LWWA 1IZJA 5T9CE 3ARXA 3H2CA 4XIAA 3LZ3A 2DVUA 2ZRYA 2DORA 4QSHA 1LRQA 2QUNA 3H54A 1KLZA 4HZMA 5GVJA 3HV9A 4MNMA 4H2HA 3EXTA 3WLQA 3HBLA 3W72A 2C1GA 4Q8MA 1WAUA 5EYWA 3LSCA 2VD9A 4DAFA 3WD4A 1GOXA 4JTIA 1LUCB 1SJDA 4IOTA 3TQKA 3PFMA 2FJUB 4AXNA 2V30A 2QZRA 4JTSA 2QV4A 1ZGDA 2VX5A 3MI2A 4BS0A 1BTMA 4LAKA 3QW3A 3L2IA 2PDBA 5A69A 2CITA 2C1HA 3ORWA 3GVRA 3GLCA 1J11A 3T05A 3RJXA 3SCPA 2D2GA 5G2HA 4KEMA 5HNUA 1GVYA 1E4IA 2GOUA 4Y8FA 2VFDA 1HJUA 5ABHA 1H7WA 4AWSA 4S23A 1XKYA 2OSXA 2G3FA 1N55A 3GG8A 1NDVA 4B5TA 1THFD 2XFYA 2GVLA 3JW7A 3BG9A 1VEPA 4IX2A 4F2TA 3VNZA 1F6PA 2DT2A 1LBFA 2Y8KA 5J04A 1LUCA 4HNUA 3GDKA 2NQLA 4L7ZA 3VGBA 1NFPA 5D9NA 3CUFA 1GYMA 3ZXWA 4LCRA 3AMKA 4GO8A 7TAAA 1XIFA 1MNSA 3C3NA 2OLSA 2BHUA 5J8LA 1PCWA 3KVMA 1O5QA 4HZ8A 1RJPA 1XBZA 2GJLA 2R1KA 4JQ4A 1VYPX 1S5TA 4AWEA 1E43A 1SM9A 4PC8A 3E1F1 4ZODA 3KZSA 3KL3A 4HMDA 2YZRA 3V1HA 4JX4A 1U1UA 4AW7A 4O0QA 3LY0A 1GORA 3DIPA 4PMOA 1O60A 2V5JA 4ACZB 1A3WA 4AD2A 3FKRA 4MAVA 4Z2LA 4MJ2A 3MJYA 2UY4A 4GNKB 5AN7A 4PRTA 1XYLA 3QTGA 1OSEA 2HMCA 1BHGA 2ZE3A 2CCRA 5HXMA 4JEQA 1CI1A 4GYPC 5C7VA 3WH8A 4JNMA 4AD4A 4FF7A 2YXOA 1MFUA 3LERA 4CN1A 1LP6A 3U2EA 1CCWB 2CPUA 5C0QA 3TWBA 4D6DA 3PSVA 3A12A 1VEMA 4X2PA 1UG6A 1UD5A 4IGNA 4ZOBA 3WQ6A 1UZHA 3VXGA 1T96A 4XSMA 3URBA 2V2DA 3GVGA 1KTCA 3ZT5A 1RP8A 1XWYA 1FH7A 2J77A 4D6FA 2J66A 2NUWA 3UJEA 4OKDA 2WK2A 1E3XA 2VVNA 1V6VA 3G1XA 1CGXA 2AL2A 3NPUA 3N3TA 1UASA 2DVXA 1QOQA 1SFJA 5H8PA 3H2EA 4UMCA 2I1OA 1TZZA 1UB3A 2XN2A 3SUUA 4ACZA 5DCEA 4B5UA 1EFZA 2HQAA 3F4DA 4XAZA 1XRFA 1E1CB 4A6GA 4JTKA 1PDYA 1HL2A 1XRTA 4B16A 4W9TA 7CGTA 1XLHA 2QS8A 4UQAA 2FLIA 1B5TA 3CB3A 4ZFMA 3W28A 1DQUA 2VFIA 1E6ZA 4B91A 1EH9A 1HGYA 4FPSA 4QROA 4X0NA 5F2GA 1UR2A 1TJRA 2B7OA 1FWNA 3QF0A 4J2PA 1US2A 4I5RA 3AU2A 8A3HA 3B4UA 6A3HA 3V5FA 3C52A 4OVXA 5FJRA 4NJKA 1BRLA 2BXVA 4H8VA 1E71M 2P5NA 4G6CA 4BQ3A 5CZSA 4UC5A 1GQKA 3R7MA 3H6OA 1MQPA 4ZL1A 5D2TA 1H3GA 1E0WA 1DIKA 1R46A 2VX6A 4LVDA 1AD4A 5A2CA 1MUMA 3WO8A 5A6JA 3AISA 1KC7A 1UR0A 3BLKA 5HR6A 3N9RA 3Q2DA 4B5NA 4GFSA 4RDZA 1NQKA 4H2CA 4BF5A 3M7WA 4TQTA 1WDDA 5CAKA 1QBAA 1RVKA 5I7GA 1E1CA 1S2WA 3EWZA 5AHFA 3ARTA 2BS9A 2NX1A 1LT7A 1BG9A 2HS8A 4UR7A 4M5PA 4ZO8A 1XM3A 1QT1A 2JKEA 2XHYA 4PRWA 3PZUA 1I4NA 4IUOA 2ZZ7A 3MP4A 3CWNA 3W2JA 3TR9A 4JDBA 4FP1A 1FRBA 5LYRA 4LY8A 3BL3A 4O8AA 1A50A 3DFNA 5A5WA 4JHMA 3K5XA 3C8FA 2QGYA 4H6QA 1A5CA 1IXOA 1KGWA 1PPIA 2Y5JA 4ICCX 4AD0A 1I2RA 3KBVA 3LS9A 5AHLA 1T0OA 5C9WA 1H1NA 2ZRVA 1VJSA 3AIVA 4CQBA 3ZWTA 1GJPA 1JCJA 4JFSA 1S5VA 6REQB 3R94A 5IFPA 4WK9A 1OGGA 2PCEA 3GU2A 3HURA 1SZEA 4M8UA 2QW5A 2XVGA 3M41A 1TTQA 3NWRA 2PTYA 1XLLA 4C6NA 4E2OA 5T8GA 3R43A 1J01A 4PMNA 3ANVA 3PNUA 4DM1A 1PZ3A 7REQA 3AS2A 4EAYA 1LWHA 2P0OA 1QI0A 3SCQA 2GLKA 3RUBL 4IT1A 4PMUA 1OC6A 5C2XA 5DCBA 4DO4A 1X98A 1TV8A 4A8LA 3Q67A 1EBHA 1R2SA 4PN2A 3RK8A 4P61A 3MVTA 2J7CA 3FVMA 4CQCA 2FGZA 3TW7A 1I8JA 4CNTA 4BY3A 3F1QA 3MT1A 2BSLA 3W26A 5FJTA 3RCMA 3KCJA 3OOQA 2NSXA 2YA0A 3WJYA 3W1UA 3VX0A 3B03A 4L1GA 6REQA 1GQNA 1W9PA 3AIEA 3BZJA 3VGDA 1X96A 4EF8A 2ZWYA 3MO4A 1MXSA 3CUJA 1OFRA 3IV3A 4F79A 4J1OA 3VOJA 4B5WA 2ISSA 1GW9A 1TVPA 2ZZ6A 1C9WA 1QK0A 1GVQA 4KWOA 1EC8A 5I6SA 4PTDA 3GNRA 4PA8A 4JYEA 4CCZA 1OBAA 1EO7A 3O16A 3FEMA 4LYKA 2VENA 1TREA 2G3IA 4TVUA 5DMLA 3FDGA 3GC5A 4FEZA 5CC3A 2ATSA 4E3TA 4WR3A 4F0SA 4RX0A 3T2QA 1HKVA 1CT5A 1UH3A 3UCCA 3VILA 2OWCA 1B1YA 4E38A 1PCKA 4WQ6A 1UZDA 4GO9A 4CQ8A 3N25A 3VNIA 2H3BA 3W85A 3W2UA 3WNMA 2HJPA 1Q85A 3RMJA 1Q6GA 1L8PA 4H8UA 3PVFA 1VC4A 4HNVA 5CEWA 3WNLA 4QG8A 4QFUA 3C86A 3N9KA 4JXCA 2Q3OA 3MZNA 2D3LA 3S6DA 2AMGA 2PGFA 4AC7C 1TX0A 1CGVA 3KVJA 4LF1A 4J3SA 2J9YA 3PPCA 2WZTA 2YL6A 4K7YA 1F74A 1RPKA 4HMEA 2RGLA 2CETA 1HGWA 3TTEA 3OIHA 5DXYA 3T0AA 5CJMA 3UQNA 2YXGA 1ITXA 2DT3A 4JX6A 3P8IA 4MY9A 2YPIA 1W1ZA 3IACA 4Y8EA 2WYSA 3AYRA 1J4EA 1NP0A 1DJIA 3BAXA 4LW7A 3GU9A 3E2VA 1UJQA 3PULA 4JTAA 3M64A 3AALA 2BVTA 3IVTA 1KGXA 1GHRA 3RR4A 1VP5A 3W1TA 3OHIA 1ZJHA 4ZOCA 4A4AA 2GGIA 4DXKA 4JDYA 4FLQA 3NOYA 4NUWA 3U0HA 3FJNA 1ZSXA 3FJ4A 5BMXA 2DSVA 2FFCA 5K3VA 3LOTA 2W63A 3NQVA 3UR7A 2IS7A 1M5WA 3S9IA 1C90A 1MEWA 4NNAA 1QNVA 4LBSA 3IGHX 3HIJA 4QAWA 1CNVA 4LCQA 3TLQA 4E6MA 3E9AA 1PS9A 5IRPA 3LNPA 3ARYA 1AQHA 1WDQA 2I14A 2J25A 5DBTA 3RLUA 4QCEA 3WN6A 3BLLA 2X1UA 3W6YA 2AAMA 4Q7BA 4H7CA 4KGLA 3RHGA 1SO6A