1S1PA

Crystal structures of prostaglandin d2 11-ketoreductase (akr1c3) in complex with the non-steroidal anti-inflammatory drugs flufenamic acid and indomethacin
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of prostaglandin D(2) 11-ketoreductase (AKR1C3) in complex with the nonsteroidal anti-inflammatory drugs flufenamic acid and indomethacin.
pubmed doi rcsb
source organism Homo sapiens
total genus 119
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1s1pA00
3EB3A 2PDPA 1XJBA 1QWKA 2C91A 2PDXA 2HE5A 3R8GA 4IGSA 3O3RA 4XZNX 1S1PA 1T40A 2NVDA 2VDGA 3CV6A 4PRTA 2HVOA 4H8NA 2ACUA 3BUVA 3UP8A 1YE4A 2I17A 5LIYX 2IKGA 2FZ9A 1YNQA 3V36A 2ISFA 3KRBA 1S2AA 2PDUA 2PDLA 3CASA 4JIRA 3G1RA 3Q65A 2PDHA 1AZ1A 1EF3A 5KETA 3T42A 1US0A 3Q67A 4YS1A 4DBWA 2IPFA 4XO6A 3H7UA 3EB4A 1PZ0A 2QXWA 3COTA 5AZ0A 4JQ3A 1OG6A 2PD5A 2PDBA 5HA7A 4JTCA 3S3GA 3RX4A 2FZDA 4EXBA 1Z3NA 1ADSA 4WDUA 1LWIA 4XZMX 3GUGA 3GHTA 4I5XA 3UFYA 2PDWA 4LBSA 4QR6A 3CAQA 4ICCX 1ZUAX 2BGQA 1HQTA 2FVLA 3EAUA 3UGRA 2IKJA 2A79A 3WCZA 3FX4A 2J8TA 2IS7A 4LAZA 1EL3A 4GA8A 2DUXA 1ZSXA 3UZXA 4YVXA 1AH3A 4QBXA 3F7JA 1GVEA 2HE8A 3V0SA 2HV5A 2INZA 3RX3A 1MI3A 4LBRA 3GHUA 2PD9A 4FAMA 3LBOA 3V0TA 4HBKA 1X97A 1R38A 1T41A 3UG8A 1MRQA 3N2TA 1EXBA 2NVCA 4L1XA 2IQDA 3LENA 4WRHA 4RPQA 2F2KA 3O0KA 1AH0A 3UYIA 4DBSA 4XZLX 2BP1A 1PWMA 4WDWA 3BV7A 1IHIA 1C9WA 1XGDA 3DOPA 4JTQA 1S1RA 4GQGA 2PDIA 2R24A 3R6IA 4ZFCA 1YE6A 3LZ3A 2DV0A 4WGHA 3M0IA 3G5EA 3FJNA 3UWEA 3BCJA 4H7CA 4GABA 4Q3MA 4XZIA 2PDFA 1Q13A 3LQLA 3WG6A 1Z89A 3D3FA 4JTDA 3R43A 4YVPA 4MHBA 4JTRA 2WZTA 4XAPA 3GHRA 5HNTA 2PDGA 3M64A 4XK2A 1UR3M 4FZIA 4G5DA 4FALA 4WDTA 2ACRA 5LIUX 1AFSA 3V0UA 4WEVX 1S2CA 4PMJA 4QXIA 2IKIA 1QRQA 3V35A 4XVDA 4F40A 3LN3A 4LB4A 2FZBA 1HW6A 2F38A 3U2CA 2R9RA 3H4GA 2PDYA 3MB9A 2ACQA 4XVEA 1EKOA 4DBUA 2INEA 2ACSA 2DUZA 2BGSA 3CMFA 3R8HA 1AZ2A 3UZYA 4PRRA 2PFHA 2CLPA 1MZRA 4L1WA 4NKCA 4IJRA 5C7HA 1PZ1A 3WBYA 4Q7BA 3ERPA 4PR4A 1X96A 1AH4A 4JIIX 3LQGA 2PDJA 3DN5A 2PEVA 4XO7A 4GQ0A 2FZ8A 3LZ5A 3GHSA 3P2VA 1PYFA 2PDQA 4YVVA 4LB3A 5LIKX 2IPWA 4PUWA 1RY8A 4QX4A 1JEZA 3ONCA 2WZMA 1A80A 4YU1A 3UZWA 4JQAA 1YNPA 5M2FX 1IEIA 1Z9AA 2PDCA 1XF0A 3MC5A 4JQ1A 4AUBA 3B3DA 4JIHA 3LEPA 1FRBA 3LD5A 3R58A 5LIXX 2PZNA 3WBXA 3LUTA 3R94A 2PDNA 2HEJA 4WDXA 4JQ2A 3N6QA 3NTYA 4OTKA 4GACA 3RX2A 3R7MA 2P5NA 3CV7A 3QKZA 4LAUA 5LIWX 5AZ1A 4FA3A 4IJCA 2IPJA 3H7RA 3LNMA 3VXGA 5DANA 2IPGA 3C3UA 2PDMA 4R9OA 4HMNA 5HNUA 3UZZA 3BURA 4PUUA 4DZ5A 1RALA 4ASTA 1Q5MA 1Z8AA 1SM9A 5JH1A 3M4HA 1LQAA 1M9HA 2PF8A 4JTAA 3WBWA 3CAVA 2ALRA 4GCAA 2PDKA 1RY0A 2AGTA 1X98A 3ONBA 4GIEA 2IQ0A 5JH2A 1K8CA 1PWLA 4XZHA 1ZQ5A 2HVNA 2FGBA 4EXAA 2IKHA 4JQ4A 2I16A 1VP5A 1J96A 1ZGDA 2HDJA 1VBJA
chains in the Genus database with same CATH superfamily
1B57A 3N4AA 4AIEA 5AYBA 1YDYA 1GORA 2RDUA 2X1IA 5K9CA 1CGXA 2FVMA 1YKWA 4FX6M 2WVVB 3MJYA 4UMBA 2VOMA 1TQXA 3O63A 3BG9A 5EMYA 3W4RA 3B4YA 3K46A 3M5YA 4NAFA 4F3HA 1F6PA 4AF0A 3H2CA 1JYXA 5EYWA 3THCA 2J27A 3IJ9A 5CG0A 3TTSA 4S3EA 1CGUA 1FHUA 3CQ0A 5G4EA 1CBGA 4FLOA 4OOZA 1BHGA 3ATZA 4GYFA 4AY7A 3AYVA 1IF2A 2OO6A 2CESA 2VX6A 2X0HA 3VNIA 3AYRA 3UNDA 2PDUA 2PDLA 4P7NA 2A3BA 3G1RA 3ZYZA 4JAWA 4K2SA 3W37A 3PC0A 4LJ3A 3C5QA 1E6ZA 2XM1A 1JDEA 1ZB5A 2D2GA 2E67A 4XO6A 5H2ZA 1JYVA 3GVRA 3UG3A 1CZ1A 4MPKA 5KZDA 1SVDA 4F9DA 4DHGA 2YBTA 5AHMA 4GXWA 5AHIA 4IP5A 2BHZA 2OEMA 1GKRA 4DZIA 4O13A 4L64A 1H5YA 4Y8FA 3C0SA 5DY3A 3NQGA 1Z3NA 3OGSA 2GSHA 2Z27A 1R3TA 3M7WA 3NQBA 1K3UA 3T1GA 1GPFA 3BSHA 3DFOA 3UFYA 2FVLA 3H2FA 3UGRA 4QDMA 2C0AA 3GW0A 1Q45A 2QIIA 1RZMA 4QJ4B 1I45A 5I3FA 1N2VA 1UR0A 3WF1A 1HP4A 1G6CA 3SUWA 4CNUA 2A5HA 1KBIA 3F7JA 3M0LA 4GUHA 1Q6FA 1H51A 4QCFA 5GNXA 4M7TA 4B15A 2JKPA 3U7BA 1KV8A 3LBOA 3L23A 3AI0A 3WLJA 5C9XA 5HPOA 2QJJA 1PKLA 3AZSA 5CSRA 1FKWA 1EO7A 4KCTA 3UPBA 3MUCA 3R0DA 2XGIA 2X40A 2IQDA 2YCJA 4S23A 3ZLGA 9XIMA 1RVKA 2HK0A 3LGDA 3VKAA 3QTGA 2DSVA 3CNYA 2QGYA 3GAYA 1S5TA 4KIEA 4TVUA 1TA3A 1OX5A 7A3HA 5D04C 1S3HA 4GGHA 4QISA 3ZVIA 1M68A 2R24A 4HZMA 3O05A 2A2IA 1QPRA 4H7VA 3LRLA 4UR9A 1E5JA 1YW1A 4HZ6A 4N9DA 1W9XA 4AQLA 1NFGA 1RK6A 2WM1A 3MVIA 5FL1A 2FTPA 1E0WA 2LLEA 3TYZA 3IGXA 3N73A 5LGXA 4QS6A 2PCEA 2DDXA 3VZXA 2OWXA 4JEQA 4PMYA 2G41A 2TAAA 3GG8A 3HJZA 4QAIA 4FEZA 3VNZA 3NCOA 4C1NA 5LA2A 1BGAA 4LVAA 1XV8A 2OGJA 2OXNA 1LRNA 3VGEA 5CC5A 3BV4A 1EP3A 5KSWA 4IFRA 5MKGB 3WLRA 3HPZA 3DXIA 1LDCA 3D47A 3N4EA 4RNFA 1R46A 3GZAA 2XG9A 1VGAA 1QR7A 4RE0A 3M07A 1QO2A 1FDZA 1S5MA 1EYEA 1U22A 2Z1VA 4QLJA 5HXMA 4ZA0A 1VRDA 2EHHA 3DERA 2WMKA 2QJMA 4UMCA 2R9RA 3W7EA 3EDEA 3MUXA 2V6AA 4AEFA 1W9DM 3WY1A 5DF0A 2VEPA 4QSHA 4CQCA 1BEUA 1U1HA 3ZR6A 4DUWA 3E1F1 3CPUA 3IJQA 4GNKB 1GCYA 1LBMA 3FA3A 4DRSA 1JNEA 2VX5A 3WH7A 4CN6A 1JZ2A 1OFEA 1FHLA 5HATA 3L4VA 5C5YA 2P0OA 1HF6A 3GXPA 4PULA 1LP6A 2WYSA 1ME8A 4U2YA 3XIMA 4OUEA 3VIMA 2ZRUA 1J01A 3ABXA 1M7OA 1H2JA 4REQB 1VCFA 1S5VA 2ZX9A 1JEZA 4MADA 1QNQA 2VQTA 3UJ2A 2GGEA 3O07A 4GJIA 4MWAE 3CHFA 2DU2A 2PWEA 4JTFA 1B3XA 4C6FA 2D20A 4Z1CA 4AB4A 4A3YA 3NPVA 3P0WA 4ES4A 3MY9A 2WC4A 4QLLA 1OSEA 4ZZ9A 3W7JA 3S1WA 4M8UA 4GE8A 5HOSA 1L2QA 4LUJA 1WUEA 1B54A 5EPDA 2B7QA 2RGLA 2C13A 4HA1A 1MVYA 4QGCA 2VEIA 1NFPA 4NUWA 1R3QA 1UH2A 3SJNA 3FLUA 1JPDX 3EOOA 3KOXA 4UFLA 1NEYA 2Z6JA 2HBVA 4HCDA 3C3UA 3DGRA 3T9PA 3PNUA 4JIEA 5HNUA 4F0RA 1GWJA 5EMMA 3I3BA 3S4TA 4A8IA 3CJPA 4GUGA 1NDYA 4E8CA 1EWDA 3RYSA 1TTIA 3NZQA 1XLEA 3UA3A 3GTXA 4HYWA 1FWGC 1PX3A 1D3CA 3HPFA 3FSTA 1GUVA 2WWDA 5A6AA 1ME9A 2WJDA 4FXSA 4WSKA 1VP5A 4EWND 4B9YA 3DIPA 3RM9A 4QROA 5CCZA 4D8LA 2VENA 4GISA 4EX4A 4MDOA 1KRAC 6ALDA 2ZFAA 3DGBA 1I8JA 1O12A 3SEPA 5JBDA 5AC7A 5AHNA 1N8IA 1UIOA 1P7TA 2C91A 2Y8UA 3MI6A 4D71A 4QHRA 4BA0A 1VQTA 4ZGYA 1XBVA 3KX6A 5LNRA 1Z69A 2V2HA 1B1YA 1QI4A 2WCAA 4GI9A 2E25A 5DMLA 1G01A 2ZRWA 5DXXA 3OBKA 2QUNA 4Q22A 1B90A 1W1IE 3LBMA 3SGUA 3S5NA 2RKXA 3AUJA 1BAGA 1UG6A 4GY7A 3W25A 4JL2A 3G1VA 4KFNA 5LHFA 1LROA 3QZAA 1NWUA 2Y7DA 1PDZA 4JTLA 1HN1A 4C6PA 1HNYA 5AYZA 4EF9A 3W1AA 1UH4A 3VX1A 1P0KA 4GLEA 1E0VA 2YFNA 1BTMA 4NF7A 3AOFA 5F1UA 3L66A 1H60A 3C4UA 3DHUA 4PTWA 1QOPA 1NP0A 1KFCA 1NU5A 5JBEA 1ODUA 2WVTA 4O4WA 2G50A 3VIFA 4LUSA 3LM3A 4JTEA 3CAQA 3ZOAA 4GI6A 4PMUA 1Y7VA 3H21A 5CPMA 3IGSA 1FP9A 4NHVA 4UTTC 3WF0A 1T0OA 4H8VA 1BG4A 3W7HA 5LZLA 2ESCA 3TC7A 5ABTA 3NURA 3STPA 3B06A 3UZXA 5HUOA 3B0XA 1JDFA 4WVXA 3S46A 2E5DA 1MW1A 4M6PA 3SFWA 4WHBA 2PWDA 3PWIA 4DJFC 4F0SA 1AQMA 3WH9A 1E0UA 4B91A 1YMYA 3VKBA 3A5FA 3R11A 1VB9A 1P48A 1EYWA 3GDKA 1DJIA 1KFWA 2C1HA 2F2KA 1P1XA 1LOSA 3TN4A 3UT0A 3DOPA 4DX3A 1TPB1 5IRPA 1J6PA 5HMFA 4HGXA 1ZU8A 3AHVA 1ISYA 4HK5A 4O1EA 2C7FA 4JGDA 3DG7A 3OGRA 2C71A 1XCXA 3R1ZA 1C8QA 1E0TA 5CG7A 4ERGA 1XH2A 5A5WA 1TZ9A 1MNZA 2MANA 4LVBA 3W88A 1M6JA 3LPFA 1KBBA 4GQRA 2PDGA 3ABZA 4LXFA 4AX7A 3L4TA 1JDDA 1A5AA 4TMCA 1YTEA 2F6XA 1H61A 2FGLA 3N13A 3NDZA 4HJWA 1F4AA 2V8ZA 2GUYA 2PGFA 3EKLA 2VUYA 5F7UA 2GJXA 3UPMA 4DEFA 2ZZ2A 5B80A 3AWOA 4K8GA 4LWWA 4XVDA 3VD5A 1UZ4A 3NL6A 4I7UA 4J3UA 1HW6A 4DJFA 3GXDA 1B9BA 1F4HA 1ZBKA 2YBUA 4G7EB 2EJ1A 3VD9A 3CWHA 1UBSA 4H4IA 3WNOA 4HYRA 4WUIA 2V3EA 1XGZA 2A6NA 2J7DA 2TMDA 4NKCA 2XU2A 1ZAHA 2C15A 1GOMA 2CU0A 3NM1A 3TUUA 1XIFA 5DMMA 1TJRA 2ADAA 1V0KA 1XLKA 5JUVA 3VKDA 2D22A 4XO7A 4NY2A 2P88A 4UQDA 2QYGA 3TJXA 3TX9A 1KQZA 3MDUA 1K9EA 3TMQA 4IZGA 1AG1O 4BCEA 2G95A 2AAMA 2E0PA 4FR1A 1EJTC 3NG3A 5EBAA 3TV8A 4DZHA 3W75A 3AWNA 1QK0A 2YCLB 3BLEA 4JKKA 5FOOA 3NPXA 5TAOA 1D8WA 3S8HA 1MFVA 2WWCA 4GZJA 3IJ8A 3WK3A 1UMYA 1O1HA 4XUYA 3DI0A 1WXZA 2VL4A 2AKZA 4LEFA 2J74A 4WKHA 1DVJA 1SJDA 3W1XA 4L7ZA 1KA9F 1K8ZA 4R34A 2RGMA 1EJVC 5I5RA 5C2XA 2Y8VA 4GHRA 3G0SA 1XWYA 2RJGA 2V63A 3UWYA 1N8WA 1V7AA 1HJUA 4CQAA 4GO9A 1D3GA 1SZGA 2X42A 3AS0A 4Z0SA 3LV6A 1SFLA 3NSMA 1W17A 3TLQA 3D0CA 1W9VA 4WY0B 4CN4A 3I10A 3UCCA 3CT7A 3APTA 2ZZ6A 3BK0A 1M04A 3CAVA 5FJRA 1GZJA 3K2GA 2OSWA 1MXSA 4UTMA 5IXEA 1V6UA 1OBAA 4MJ2A 1K8CA 3DECA 3I4KA 2CC0A 4NJIA 1ZQ5A 1GQKA 2I16A 2XSXA 4OUIA 5G5IA 3IIPA 1RAKA 2OCZA 2PDPA 3PTDA 4RW5A 1F61A 2QUVA 3ME3A 3ALFA 2WHMA 4J3ZA 3SECA 2X41A 6TIMA 2PP3A 2YSWA 1RQBA 1PIIA 1G94A 3ZM8A 1SFSA 1XC4A 1MFUA 2POTA 1M1BA 1B3YA 2GVLA 2R14A 3VOHA 2CFFA 2Y63A 1LUCA 1TWZA 3GDTA 1UD2A 3ITYA 4I90A 1XKJA 2QJHA 2A6LA 2PLKA 2X7VA 4OV4A 4CD5A 4HT3A 3VIOA 1A47A 3Q37A 4PUEA 2YA0A 3QR1A 2X1RA 1PZ3A 4IIBA 3MI3A 1HL2A 2CLOA 3IAQA 4BI6A 1TG7A 2WOQA 3VGHA 2X2GA 3STCA 1UWSA 3NQEA 3QXBA 5D8ZA 4RZBA 3MUZ1 2I5GA 2Y2WA 5AYXA 5U7SA 2X05A 1NP2A 1J0IA 4JFWA 2ZKMX 1UKSA 2JIEA 3T7VA 4IXHA 4MUPA 3QYQA 3S3GA 3N2BA 5AHLA 3E9AA 1YBQB 2HWGA 3QYSA 4ZEPA 5FF4A 4ATLA 3PJUA 1ADSA 4CNOA 5A95A 3NEVA 5BMWA 3MSRA 3GUGA 3BZJA 2WMHA 3K8LA 1KO0A 1HQTA 1XI3A 4H6RA 2Y0FA 2P50A 5HANA 3F4VA 1NWTA 3RM8A 5KTLA 2VCAA 1QOQA 5GJMA 1KXTA 1ZSXA 4GKLA 2TSYA 3BQ6A 3QSTA 4H01A 4TXEA 4KWSA 2HV5A 3DFHA 2INZA 1MQRA 4LBRA 2Z2UA 1PE1A 3L2IA 3U57A 3UWZA 1G69A 3W38A 4Z2KA 2YDQA 3RLHA 1W5OA 3AXKA 3K13A 2JEPA 3IK2A 3GM8A 2F6KA 3THDA 1XYMA 1BXNA 4DWSA 3N2TA 2E9MA 4RNHA 1PUDA 1BYDA 3MYPA 4UC5A 3GS6A 3KL0A 4KRUA 3LENA 1GJWA 5GJPA 1OJXA 3CPGA 3ZZ1A 4HKPA 3TQ0A 3DX5A 4BQ2A 3NQVA 3LHYA 4IWWA 4OBSA 3RMJA 3SCVA 5E09A 4ROPA 4GFSA 1BXBA 2V68A 5BOOA 2ZDSA 4GQGA 1WUFA 2E6AA 3HO8A 3VNJA 2RFGA 1TV5A 1WXYA 1CXIA 4GCXA 3UWEA 3PBVA 4IXXA 4YWIA 4XIAA 3CXOA 4NAFB 4PUKA 3WSUA 3CHVA 1BSIA 3OQEA 7TIMA 1MW3A 1SSDA 2Z1WA 4PCTA 1UB3A 4W87A 4HMCA 2X1SA 3V7PA 3VIKA 4Q8MA 1JJKA 2MNRA 1WDSA 2WKLA 1XIBA 1K9TA 1FA2A 1T8XA 3I3DA 3WLTA 1XICA 2VEFA 4E6MA 2R1MA 4KEMA 3LS9A 2WBGA 1JPMA 2OJPA 1S2CA 1EGVA 3RG6A 3UA4A 1PKMA 2VR2A 4ML9A 4AHPA 5AC6A 2EG8A 3T8QA 3APGA 2YR1A 3CTTA 2DUZA 4AZCB 1KBJA 3K1DA 4QTGA 4FI4A 1JF6A 3OYZA 4XQ6A 3BC9A 1OFOA 3W2MA 4U31A 2A1YA 4EE9A 1N82A 1QPOA 3UY7A 1EJWC 3DYOA 4Q7BA 1UR4A 1AD1A 1CNVA 3E5PA 1A5BA 2KAUC 5HQMA 1FDJA 2WO5A 4CD7A 4GYKA 1RXOB 5LXEA 4JCLA 2FZ8A 4EWJA 1DWIM 3HA1A 2VX7A 3W1RA 3CZLA 1UBPC 1UZHA 3IRDA 4DXXA 5D2XA 3IUIA 2WZMA 4I8YA 3POCA 5IM51 1NAL1 5BYWA 9CGTA 1FTXA 3UZWA 1NDVA 3G3DA 5IDIA 2OB3A 4Q4SA 4CVUA 5C55A 3TNOA 1OK4A 2ZX7A 1P0BA 1ZJAA 5LIXX 2VRJA 1P6BA 4AC1X 2CW6A 1UR2A 2GDQA 3R94A 1Q65A 3GH7A 1TB3A 1AQ0A 4IG2A 1UKQA 4Q8WA 3HGJA 1ZAIA 2HEJA 4O1CA 4PMOA 3UG5A 4DI9A 4P7RA 4S3JA 1XUZA 2W9MA 1UP3A 2ZRXA 2UY3A 1UPMB 2X1UA 3V5CA 1EGZA 1GONA 5ECUA 4OVXA 5CKSA 2OWCA 4WR3A 4Z2HA 1EO5A 5BXRA 1US3A 2PP0A 4LGXA 1B0IA 4K1WA 1IR1A 5BRPA 4DF0A 4MB3A 4Y9OA 2WW5A 1XKYA 1SZFA 2J75A 1OG0A 1Q5MA 1RPKA 4OHQA 2R6OA 3NXLA 1M9HA 3F5JA 2OODA 2CBVA 1VFOA 4HNVA 4LT9A 5AB3A 2PCQA 3AFBA 3UNTA 3DAQA 5GVJA 1M3UA 1NIUA 3WF3A 5CPSA 4N6EA 3A9IA 4XZHA 3OEXA 2EGZA 1JD9A 1Q7MA 1V6VA 4MF4A 4O8RA 3RU8X 4GC4A 3W84A 1VEOA 3DYPA 2FHCA 1G0CA 3B8DA 1VBJA 3DG6A 4KWVA 1QI0A 2XTKA 7XIMA 2WB5A 2HE5A 3TTOA 4DF2A 3PR2A 5JU6A 4U4MA 1F05A 4LAOA 3U5UA 2YIHA 2CLEA 1J10A 5DY2A 1XPYA 1CW2A 4NI3A 3EWUA 3WN6A 3UCQA 2FMNA 4PRTA 1IXPA 1BQGA 2GSJA 4E38A 5FL0A 1UOZA 4X3ZA 1WX0A 2ISFA 2Y7EA 1SO3A 2R1PA 3PN8A 1EZ2A 2XN0A 1GW1A 5FEXA 1DIEA 2BOEX 1F5ZA 4MM1A 5H8UA 3LA4A 5GJNA 1GEHA 3LHUA 3EWBX 3PZQA 1O5QA 5BXPA 3I65A 4OECA 3WDIA 2JIWA 1R30A 3GC2A 2VXNA 2XH2A 4JQ3A 1TO3A 4DQWA 2F2HA 3MMWA 2DW6A 3U5YA 2PE4A 3LOTA 2NUYA 1KLZA 1SZRA 3L21A 2OTDA 2ZUSA 4M51A 3CQIA 1U83A 1Q8JA 1MUCA 1QUMA 4LC8A 3T44A 3E02A 2NUWA 3A13A 4MWAB 2G3FA 2BGQA 3ITCA 4AD2A 2HROA 5I07A 3UVAA 1ZHAA 3SN1A 1OD8A 1TTQA 1CGTA 1XLLA 3SQMA 2C0HA 4RDVA 2FKPA 1AH3A 1H09A 1GVEA 5H91A 3N15A 2X0SA 2Y7GA 2YPIA 4MSSA 3AALA 5E93A 3DHFA 3NDYA 1HKVA 1P5BA 2NX9A 1ZCOA 4RX0A 1FWTA 4K8HA 4O17A 1OQFA 4XKYA 5DFAA 2EXOA 3KOYA 1BRLA 2QIWA 4ZOBA 4E0CA 4JX5A 5ABEA 2V3DA 3I68A 3FGCB 4XB3A 3M5XA 3P8IA 2Z24A 1L6WA 4J28A 1PBGA 2W6RA 1NH6A 3LYEA 3I6EA 7REQA 4JHMA 5D2WA 4DBSA 4HYVA 1K8XA 2HPMA 3WEMA 4O1BA 2RDTA 3B0YA 3QJAA 1EX1A 1JXJA 4B5XA 1TREA 3GR4A 1PX4A 4DJFD 2VC9A 4ZFCA 1YE6A 1MZHA 5G4WA 3WD2A 3M0IA 2QNEA 1FKXA 2VVSA 1E1CB 2Z6IA 1LLWA 4ZO7A 1AD4A 3W01A 4Z17A 1J0ZA 1EJUC 1I2RA 4XZIA 1R7OA 3AXIA 1MW0A 1W91A 3D3FA 2YDSA 1J5SA 3NZ1A 3HMJG 3H23A 2QUUA 3DFNA 3DFYA 4D8AA 1WPCA 1QNRA 3OG2A 3ZT7A 5TQLA 2NT0A 3SW6A 2IXVA 1IR2A 5DXYA 1B2YA 3KCJA 3PJWA 4NT0A 4JTTA 3GH5A 2GOKA 2J62A 3MCNA 1EJSC 3AIEA 1SMDA 3BJTA 1EA9C 1J0YA 1KD0A 1BXCA 1QHZA 2ABAA 3WFAA 4DZAA 3PUGA 4JTIA 1EC8A 3M43A 3EXRA 3T0AA 3SCSA 1GK8A 4CEUC 2CXGA 4L4PA 3T05A 1BGGA 2VGFA 3RCYA 3GNNA 3V3WA 1EKOA 4NASA 3OZOA 4A3HA 1W3IA 2ACSA 5CAKA 3TYCA 4M6UA 3R8HA 1VFUA 1XCWA 4CKQA 1FWAC 1YLVA 1V3LA 3N3MA 3BMXA 2ZZ7A 2GSEA 1F74A 1W1TA 3C52A 1GVIA 3C0LA 4Q32A 3W6MA 2D0GA 4R9XA 1UD3A 2PWVA 2PDJA 2PU1A 1P6CA 5K4XA 3SRDA 1LWJA 3CB3A 2PTWA 4WJ8A 2QPSA 3L4XA 1O68A 1XYLA 5EB8A 4IGHA 1KBKA 3W24A 1LG2A 4JTKA 4YTSA 4H9VA 3W7OA 2AGKA 1OD0A 1TCMA 3B40A 3YPIA 4HA3A 3EOEA 2V81A 2YLAA 4MKNA 1EP2A 5CLTA 2C8NA 5T26A 1P43A 5DMNA 2QPUA 4W84A 3RCMA 4C7GA 4D6JA 1CB2A 3OZYA 4GK8A 3GR7A 1XYFA 4RKAA 4B3ZA 2D0FA 2H3BA 1HO4A 3QQWA 4MDPA 1M65A 2UV8G 3K8KA 3VD4A 1DP0A 3W7RA 3T0BA 4BK9A 2MUCA 1YDVA 1EGMA 3M16A 1WB0A 1FX6A 5HDRA 1CXKA 3C2EA 2Z0IA 2OT0A 1FFQA 1LOQA 1VIZA 1E40A 3B04A 1EH9A 2VELA 1AVAA 1TJ0A 2P1FA 3PAOA 2DFAA 2VKZG 1W31A 4Q8PA 2W61A 3H7RA 2A4AA 2J7EA 3RLGA 5CSUA 4FSAA 2QV5A 1W9BM 4R9OA 4N4PA 1WZAA 2E1DA 4PGLA 1H62A 4AYGA 2DJLA 3KE0A 4C90A 4CD4A 4FF7A 3PB2A 3UWQA 4JD4A 4GCAA 3W1PA 4S2CA 4ZB2A 1O5XA 1OGGA 2VZTA 2FIQA 5E0CA 4UXDA 2CYGA 1WA3A 2J7HA 4HNTA 4PTVA 5EY5A 3N9RA 2PTZA 5D30A 3PBMA 3KVJA 3MWCA 1UR8A 3IJIA 5FCZA 3MUY1 1W5PA 1E5NA 3EB3A 3PHAA 2WJEA 1T99A 4QCEA 3R8GA 1WKEA 4K3ZA 1FFRA 2WXDM 3EYPA 1H41A 2CEQA 1QW8A 4O50A 1FCVA 2V0TA 1UKOA 1RBAA 2Z25A 3GD6A 3QPEA 3CV6A 1RH9A 4UOJA 1WOBA 3A4WA 4AU0A 2GQ8A 1EIXA 1DHPA 4RXFA 1BWLA 1TPC1 5LIYX 1KRBC 4DF1A 3UZJA 4XZ9A 1HJQA 3G1HA 4PTDA 4DO4A 2BZNA 3QKEA 1XL9A 1PCKA 3W28A 1WQ5A 1US0A 4KWWA 4YS1A 2KZHA 4X0VA 4M80A 4P7QA 1LORA 3ZJ7A 2FTWA 5FAGA 2QKFA 4LYRA 5AZ0A 2J77A 4DWSD 4KRZA 1H63A 4ZODA 4W88A 3HOJA 2TODA 2D0HA 4W7WA 4BS0A 2GDVA 1R9XA 4PCFA 4A05A 3GKAA 3EBVA 3M0XA 5LA0A 5DBTA 2Q01A 3PVFA 5CJ5A 3NWRA 1L6GA 3PBUA 3W7PA 5TF0A 3WL0A 3EAUA 2IKJA 1I75A 2D3LA 3G1FA 4F2UA 1LL7A 3IAPA 1KTNA 4MAZA 1AW5A 2E6DA 3I7SA 5FI8A 1KB3A 1W1YA 3DYMA 1V6YA 2WVVA 1W9UA 4LV9A 4O11A 1VFMA 4ORIA 5HUPA 4LW7A 1Z7AA 3CUFA 4O52A 3RUBL 1FWRA 3RO6A 4XTIA 3R8RA 4K37A 4M6QA 4AD4A 1MRQA 3ZT5A 4RPPA 2Q8XA 4BJHA 4CNNA 3GDRA 4PC8A 3VD3A 2GL5A 1X7FA 4HU4A 1GTEA 3W1QA 3O16A 3USZA 3O8AA 4DPQA 3O0KA 4MLRA 3GYEA 1WDPA 4A8RA 1GOQA 5KZ6A 4JTQA 4CCCA 4RE4A 3FDGA 1EIBA 4J2MA 2X7WA 3EPMA 4UFMA 1YPXA 4K36A 4N0RA 4TX9A 2FZMA 3CO4A 4O1DA 1PXGA 1Y0EA 4GX9A 4Q3MA 3SZ8A 2Y7FA 3GTIA 2JBMA 2WZHA 5FSEC 1RBLA 2ZUWA 4XD3A 3VINA 4P2VA 3A5VA 4XX6A 3NYDA 4YVPA 5JIPA 3VDCA 7PTDA 3IGHX 2WJFA 3V75A 3F03K 4E4FA 3HG2A 5MHBA 4GC3A 1XRSA 4B5SA 4WDTA 5DLCA 2VWTA 1D7KA 1W3JA 1EDQA 3FK4A 4DLMA 1P4CA 4XBJA 3C0QA 1VAHA 3CBWA 1NY1A 1QRQA 2P53A 1W5MA 5CGMA 3K4AA 3LN3A 1H0GA 3WUFA 3CWOX 2GJRA 3LV5A 2F38A 1NF0A 4KWOA 2Z1SA 3CTLA 1J9YA 3LRMA 4FX8A 3EOLA 1GOKA 2VC7A 2Y5SA 2DZTA 1JDCA 2FQIA 3KRUA 4MPQA 1NFBA 1GW9A 1Q3NA 4UQ9A 1S39A 3KXQA 1JUKA 1F9CA 2Q3RA 5AYYA 3WLPA 1FOBA 3BPWA 3WUEA 5D9MA 1XISA 3R79A 3LXAA 4QLKA 1KM4A 1L2UA 4NZ1A 3NQ2A 1TE1A 1Z6KA 4JIIX 1ZBVA 4DO7A 2Y4SA 1JZ5A 2V5LA 2GOUA 1Q2RA 1YXYA 1H49A 1UD6A 1H7WA 3WLOA 2OLAA 3QV8A 3GHSA 4QDPA 3VGDA 4LB3A 1OFRA 3S2MA 2Z7KA 5LIKX 3ZLHA 3ONCA 5EGRA 1YPFA 5EMJA 4AXNA 2E7FA 4PFMA 3AAMA 2VURA 3SUSA 4NILA 3RO8A 3B3DA 2Z29A 1OFQA 4I7WA 3IUHA 5AC5A 3VNLA 4DYJA 1VIWA 2VWSA 4RK8A 3JVAA 4H9MA 4PMXA 3WBXA 5CC3A 1BD0A 4NZFA 1FDYA 3QY6A 3U0HA 2OKOA 1DQWA 2QEZA 3VFCA 3FHQA 3SN4A 1CI1A 3A22A 2D2HA 5MKGA 4A6GA 3KBSA 3SGGA 3C8NA 4G1KA 4F0MA 3RX2A 4M24A 3IJDA 2P5NA 5E6ZA 1IGSA 2J6VA 3AYTA 5D02A 4HIBA 4LAUA 3FVMA 1PJ9A 2FDSA 2PUZA 4M19A 4IJCA 2NXGA 3CUXA 1ZAJA 1JPHA 3AXMA 4EF8A 5A94A 4ECLA 3AHXA 1KXVA 1D7FA 1ONWA 1RALA 4I8DA 2VOTA 3RRXA 4FP1A 5JH1A 3SY8A 4C6QA 2FGZA 2XIBA 1XIGA 4IPPA 3EWYA 3S6OA 3BG5A 5CZKA 3KWXA 3NO5A 1XLHA 5A2AA 5A6BD 4PYSA 1K6WA 1A3HA 1E73M 1QNPA 4C6CA 4U33A 5J8LA 1R87A 2Y88A 2JGQA 4ICNA 3GIYA 2NZLA 5KITA 2OSYA 4REQA 4AVOA 3IV3A 3UXIA 1IGWA 1QWKA 3ITTA 2BY2A 1JCJA 5G2HA 3O3RA 2NQZA 1S1PA 4O53A 4BY3A 5M5DA 4DJDA 4GUJA 2YB1A 1DJHA 1ITQA 1ISVA 3QBUA 3LX9A 5HJYA 1RA0A 1I60A 4P7OA 2O0TA 3KBNA 2Z26A 5ABFB 2B31A 2Y1HA 4QSFA 3SCNA 4N2YA 1S2AA 2A7PA 4MY9A 5T91A 4F0KA 2YOCA 3V16A 1E3XA 2P8CA 1XDMA 3LDVA 1FWWA 3N2XA 4DO6A 3W7NA 2ZX8A 3M0ZA 3VK5A 4DBWA 1XG4A 2NT1A 5LA1A 3TDFA 3VILA 3HFYA 2DZVA 1X1ZA 4FO4A 1FWEC 3MP3A 5B7YA 5E9AA 3W26A 5E1QA 4U28A 4O12A 2VMFA 1Q6LA 3A9BA 1I1XA 1V5XA 1TR1A 1LRTA 4S3KA 1MQQA 2CZ5A 1HKIA 5CQ1A 4B3KA 1IZCA 2WK2A 4HPGA 4IM4A 5A8OA 4I9AA 3MKKA 2A7NA 3H2AA 3G6LA 3AMKA 2A79A 3QF0A 1CENA 3GTFA 3KTXA 2H90A 3B0PA 3NPWA 2G37A 2I7GA 3B97A 1ZBCA 3N18A 2HE8A 1V8EA 3BWWA 1RJQA 2ZUMA 2RH9A 1C8VA 3RGTA 4NXKA 4JHOA 1TV4A 1Q6GA 1S2TA 3WQ4A 2WNQA 3DI1A 1RV8A 3W22A 1X97A 1LYXA 2J8GA 3CHEA 2XWEA 1E15A 1REQA 1OC7A 2FJUB 4L1XA 3WNKA 3RR1A 3AZRA 5F2LA 5FKYA 4FLRA 4RPQA 4ZOEA 3W7LA 3M5ZA 1JDAA 1XLDA 2WMIB 2VD9A 2BBFA 3S1VA 2EQDA 3VUPA 4YCPA 1X39A 3ENLA 5K4ZA 3IPWA 3EWWA 1C9WA 4GRSA 2PURA 2Q8ZA 3KRSA 4W5ZA 4CQDA 4RUBA 4LCSA 3BLIA 4D6IA 1W0MA 2XVKA 1UKPA 4ALDA 4GZ7A 2PLMA 1L6YA 3P82A 3P3BA 1OGSA 4QG8A 1O5KA 3AS3A 3W2NA 1WNOA 1VF8A 1POJA 3VIJA 3WELA 4JTDA 4IP4A 3KL3A 5ECVA 1PTDA 2WZTA 4IQDA 4W4QA 2DSKA 3TWBA 3SQSA 1L8PA 4PBEA 1Q6RA 4WGXA 1TMLA 3OO2A 4JX4A 1LRQA 2W91A 2D24A 5KEZA 2W5FA 4ZVJA 5DEZA 3BSMA 4J27A 4WEVX 3UWUA 3P80A 4DN1A 2J25A 3DG3A 1Z32X 4A2SA 3V35A 4GIRA 1UUQA 1M53A 3AMCA 4UQCA 1B3VA 1D9EA 3T2PA 3WENA 3H8AA 4KESA 3S5YA 3PWGA 2X2YA 2XZ9A 2I9UA 1U33A 2O92A 2YDRA 1QJWA 3U2CA 1F8MA 4NZ5A 4OBTA 3SDOA 4F2TA 3GG1A 4ADUA 3F2DA 2J6XA 3PS7A 3GXMA 2G3IA 5I3IA 2IXUA 2E68A 2ZRZA 2OQYA 4LAMA 3P5YA 5CGTA 3HPAA 5D4YA 3O0FA 3BLKA 4PRRA 2HK1A 3TONA 1M5WA 2ANUA 2XISA 2QULA 4DJEC 3UPWA 1T96A 3VPLA 5GPRA 4Y90A 1E6QM 4IJRA 5AVNA 2E28A 5I00A 4X60A 1RQHA 1CTNA 3E0VA 4ADSA 3B9EA 1GOIA 4OQVA 1W3TA 1T7LA 3TYDA 3VGGA 4AVFA 3CHCA 2CCRA 3C6CA 2A7RA 4MKVA 2QDEA 3LZ5A 4MUZA 4BWLA 4GO8A 3G8EA 2X1TA 3STGA 4PB3A 1UA3A 2VGBA 2NXHA 1OB0A 3KS5A 1Z9AA 5AVHA 1JZ7A 4AUBA 4JIHA 4PB5A 3CZEA 3MU7A 4KFPA 1MEWA 4R88A 2BOFX 3LUTA 4PA8A 4NNCA 3MA8A 2QF7A 1PS9A 4DWDA 1CGWA 2XGZA 4Y2WA 3QMSA 4OOUA 3QMRA 4Q8OA 1PSCA 3B9DA 4JXCA 1FH9A 4WY0F 1O5RA 2D73A 2PRHA 2EKCA 4P8WA 5F2IA 3B4UA 1W9PA 5BWFA 3U6WA 2BXYA 1A3XA 3QW3A 2V5KA 1F3WA 1VFTA 2AAAA 1DYSA 1JGMA 4ZFMA 4GH3A 2FPVA 4KETA 4G7EA 4ZXOA 3AS2A 3RPMA 3OQ8A 4P8VA 4DZ5A 5AECA 1TPUA 4HSNA 1EXPA 1OX6A 5GQBA 3VKCA 3OVPA 3WMBA 1GPWA 3WQOA 2XIQA 1JQVA 4NVTA 1XCFA 5FAJA 1OYAA 3K1GA 3EMZA 2L5HA 3S9IA 1A5LC 3TN6A 4DYKA 1A50A 4HZ8A 3BLOA 4OZOA 2J9ZA 2JFEX 4EANA 1W3KA 2XN1A 2OVLA 3RN6A 4D6FA 2FH6A 1NSJA 1S3TC 2WSYA 4DO5A 3G1XA 1OFAA 4YTTA 3LCXA 3KZSA 2F7FA 2QDDA 3WD3A 4CNSA 4AG0A 3PY2A 3VC5A 1QT1A 4CCZA 2DP3A 2GLKA 1O60A 3RILA 3PBWA 3CAKA 1VFHA 2C79A 3S9ZA 1T8QA 1TRIA 3FEMA 3OU8A 2YCLA 4NXSA 2W66A 3L5AA 3P93A 1E9ZB 4F66A 2XFFA 5G4HC 2G5WA 3WZ0E 1HX0A 4QJ1A 1FWCC 4U3AA 4M6VA 2FZNA 3Q65A 3W27A 1U30A 3VYLA 3PZIA 1BWVA 3BG3A 4X22A 2ICSA 5REQB 3W7GA 1WZKA 3BAWA 3SADA 1ZRQA 2WKGA 4PL2A 1XLJA 2FH8A 2V9DA 2QXWA 3HGRA 1R5YA 5JQ9A 3AJXA 3CS2A 4BHYA 2VGGA 1EUAA 1AJ2A 3OLIA 1EOMA 1QOXA 2PODA 3WLIA 3NAVA 2NV9A 4WY0A 4C5YA 2TRSA 3IJ6A 3GU9A 5DQPA 3EKZA 3K8MA 1XLGA 3UWVA 3GHTA 3TSBA 2XIMA 3DU0A 3QQ0A 3MI2A 5AN7A 2QAPA 4DY1A 1J0KA 1EPVA 3XINA 3ITGA 4YVXA 4Y9NA 4B16A 1R8LA 2DH3A 1YNYA 1V02A 1R9YA 1X7IA 3T2QA 3G1DA 2WNWA 3ZSTA 1VHCA 4GNVA 3LGEA 1CDGA 1PHWA 2G8ZA 1W5QA 3LPOA 2OOFA 3MANA 2ZBTA 2I9EA 5EBUA 3BOFA 1MQPA 5DO8A 3SY1A 1BYBA 5I3GA 4J5NA 3O7UA 2DVTA 4AWTA 1SGJA 4UIOA 3LHVA 2JALA 4XZLX 2KX9A 4WDWA 4X9SA 4DBEA 1TYGA 5JBFA 4D2JA 1IIGA 1K77A 3C2OA 3R6IA 2DV0A 1RBOB 2QDGA 2ZWZA 5TD4A 2WC3A 5BOFA 3GVGA 3FJNA 4H7CA 5I09A 1UZ1A 1RQEA 3SRFA 1LG1A 3HPSA 3ZVHB 3PFMA 2Y62A 2YB4A 4C7DA 2AQVA 3IIVA 3A4AA 3R0UA 3R43A 3FA5A 3P6LA 1YBQA 2QCGA 1XYCA 5CC7A 5HNTA 3LERA 4HK7A 3CIXA 4RE3A 4B5VA 2WHKA 2A3LA 1VBUA 4MJ4A 2IMRA 3KHDA 3STFA 3V1PA 4S1FA 4GI4A 4RZ4A 2YCIX 2OELA 2O4MA 3N4FA 3VD7A 2G3NA 1GYNA 4Z1DA 1W2PA 2TPSA 4F40A 3QH2A 2QT3A 3WQVA 3UESA 2XIIA 2J9YA 3FAXA 4MKSA 4PMRA 5E5CA 5FSDC 3H4GA 3G0XA 4H9UA 1GQLA 2INEA 1QTWA 2OSXA 3S6TA 4F9JA 3FA4A 3U4AA 4RJEA 2OX4A 1DTUA 2DZBA 4KH2A 3W7KA 3E96A 3HGSA 2C1GA 3DFQA 4B5UA 4WXZA 7TAAA 4JZ5A 3OLGA 5CXPA 2XM2A 1E6NA 2DIJA 2AMXA 6REQA 1ALDA 3FKKA 2GVYA 4UMAA 3NM3A 3KRZA 2ZC8A 2A21A 2UY4A 4WKAA 3HU7A 3H53A 1A5MC 3TWAA 1SPQA 3BL3A 5HR7A 2IPWA 3VCCA 2OPJA 1FBAA 3T2OA 4HOXA 4PUMA 1X6NA 4QQ3A 1DWAM 3KOWA 3NVTA 3ITVA 1P0EA 4QE4A 4N42A 2Z1KA 2GFTA 2Q3OA 1WXJA 1NQKA 1ZBWA 1TSIA 3ZT6A 3B8SA 4CNTA 2ZTKA 2NV2A 2CLKA 3QC3A 1W1PA 3UXAA 3PTMA 5LYRA 1ESWA 4DXKA 1JPIA 3NR0A 1W3LA 3W7CA 5D32A 4L9XA 4E5TA 5A8PA 3VOFA 1GZ1A 1C90A 1V3MA 3LTYA 4JIPA 3R7MA 3IVSA 2J8FA 3CV7A 1B5TA 2VZSA 3BGGA 4HK6A 2ZXDA 4V2XA 1UR1A 3PJTA 1MYRA 4H3DA 1TPVA 3DEQA 4DJDD 4WIWA 3LCFA 4R85A 3TJLA 1KFKA 4AZCA 4US5A 2CBUA 1MDRA 1XIJA 4PUUA 3BZGA 3Q58A 1F3EA 4X0NA 4W5UA 4ML4A 1Z8AA 4RR4A 1SJBA 1XXXA 2ZQ0A 1LQAA 4QQUA 4WD0A 1LF1A 3IGUA 2OU4A 1KR0A 4J3SA 3CLMA 2AQWA 1A0EA 1RY0A 3AO0A 5HINA 3SJ3A 1G9HA 1WAUA 5ABGA 3WKZA 4NZ3A 1PHQA 4W9TA 3VABA 3C86A 3MHFA 4Q8QA 2Z4GA 1H11A 5CH9A 4YYFA 4ZQOA 4Z2JA 5JMUA 1V6XA 3CYVA 4IF2A 1W37A 1F8IA 4JFSA 4AW7A 3MW7A 1R6WA 4RE2A 5EMKA 4GVHA 5A6TC 3HG3A 4C91A 2ZE3A 3SR7A 1SQ7A 1T40A 1JF5A 4GYPA 4HJFA 3CYJA 1JUEA 4NZ4A 2R1LA 3LPGA 1RR2A 4JTJA 1KGUA 4NL1A 4XUGA 2ZZ1A 3SSJA 4B4HA 2Y61A 2OGYA 3SCQA 1RD6A 4URIA 2GUUA 1ZZMA 2H8ZA 2CZEA 2GGHA 1XG3A 2EPKX 2WMGA 4CU7A 1XHGA 1C7TA 1TZ7A 3LSBA 1V93A 5D09A 1SO6A 4GD0A 3GB6A 1QMLA 4GKTA 4G2DA 2FFIA 1YTKA 5L6UA 3ID7A 1UJPA 4ENLA 2FTYA 2C16A 2X0YA 4CEXC 2V38A 1FQ0A 1SZNA 1ODZA 1TR9A 3EWCA 1QDSA 1H1YA 5CBJA 1ZP4A 4BEQA 1M7JA 1QWGA 3HF3A 4FPSA 3VNDA 2O7SA 4ZBCA 2V30A 4JY9A 1E6XM 1HJSA 4MY8A 3CH9A 3KHJA 2J7FA 3WCZA 3KL5A 3N11A 3W86A 5A8GA 4GA8A 2AL2A 4Q4PA 2DVUA 1KW1A 4XAZA 3QV7A 4UQEA 4HD5A 2QCDB 3TFCA 1TMQA 1SW7A 3VGBA 3GHUA 1RCQA 3E0WA 1CCWB 4H9ZA 1Q4WA 1VJSA 1UMLA 3WDPP 3V0TA 4D6GA 2ZDRA 1R38A 2F9RA 4UTUA 5M3WA 3U4FA 3WQ8A 4H6KA 3PZGA 2H6RA 3I6TA 4HHMA 4DI8A 4PB4A 3CZJA 1E3ZA 1JPKA 2XDFA 4AWUA 3BV7A 3NQFA 2CLMA 3SRHA 1J4EA 3FHAA 4LUTA 1BPLB 2VEGA 4WGHA 3TZFA 4QEEA 4MOZA 1D2KA 1WDRA 4L9ZA 5A6JA 1ADDA 4WSHA 4EPDC 4L6OA 1GKPA 4Q8UA 2BFGA 3N12A 1DXEA 1GG0A 2CNCA 1HIZA 4G8TA 2QQ6A 3IANA 4MHBA 2V5BA 4JL1A 1I1WA 3CWNA 3HQPA 3TOYA 3W7IA 4CN1A 3E0LA 2GJLA 3TQPA 2PBGA 4J3VA 4GGBA 4UTKA 4MWAA 1ZTVA 2JF7A 3LB0A 3NDOA 4O0ZA 1IZJA 4QDWA 4C6NA 3GU1A 3SCWA 4JY8A 3ECQA 4HA4A 2IKIA 1JXKA 2PZ0A 4EXQA 4MZ1A 4QP0A 3QSRA 1R0MA 4MNJA 1HFBA 4AHOA 5FEWA 3CIWA 3DHDA 2VFGA 2GZXA 4Y9PA 1E43A 3N17A 3TA9A 3VGFA 5TIMA 2C18A 2ZOXA 3TTQA 4TMBA 1V08A 1ZP3A 2BGSA 3CMFA 3LY0A 4LYQA 1SFJA 2W79A 2CLPA 2NVAA 4LYKA 4F0HA 3ES7A 3FGCA 1MZRA 3ARSA 4XV0A 1IE7C 2FPTA 4ZL1A 4E8GA 4IPJA 1BYCA 3MJMA 4J1OA 3BOLA 1G4PA 2YW4A 4GVFA 5BMXA 3IVUA 3ERPA 1X96A 3A21A 3G22A 4K38A 5BW6A 4PZVA 4B9ZA 4H7ZA 3VNMA 2UBPC 2GWGA 2RUSA 5A6LA 1LBFA 4TX8A 4ZENA 3RLVA 3F4NA 3P2VA 3WD0A 1PYFA 1MW2A 4RZ6A 1Q63A 2AKMA 8XIAA 4C1LA 1IT0A 1E1CA 3ZXWA 4ZSUA 1EX5A 1TPWA 5EL1A 3KCLA 3L12A 3ZWSA 4IJBA 1LQ2A 4YU1A 4DJED 3CGTA 4E2DA 4H9XA 1REQB 2HMCA 2NUXA 3OP2A 3MO4A 1GOWA 4V1XA 3H24A 4MLJA 1IWPA 3R25A 1CB7B 2G96A 3PUEA 1DPMA 2EKGA 3O15A 3BSGA 3GG7A 2WM0A 1X1NA 3BGJA 3N34A 1IZKA 5XINA 4N7QA 3WQDA 3ARWA 2XVPA 2EPMX 3H26A 3QFWA 4JEJA 4JKMA 2R91A 2XH7A 3AIUA 4D1IA 1KCZA 5D9OA 4HOWA 4FNRA 1E9YB 1IQ8A 1E6PA 4QFUA 5LIWX 1ZJIA 4KBXA 2NQLA 3KM8A 5AOUA 1BYAA 3WDQA 5FJUA 4C6LA 2H9AB 1E0XA 3LNMA 4I7VA 4ATDA 5DANA 3S5SA 1YX1A 5BCAA 3QGAC 4F48A 3RPTA 2B7OA 2A3AA 1XC6A 3B8WA 3A3XA 4ASTA 4FNSA 5DT7A 2Z28A 2YA1A 3HPXA 1V3HA 3GNPA 1OZMA 1OFDA 1B4KA 2PDKA 3EWDA 4A8NA 3T07A 3GIQA 5LNWA 4NAEA 2DH2A 4DPPA 3WK0A 5CGQA 2ISDA 4UNLA 3V5FA 4EXAA 4CD6A 3NQCA 1AQHA 4LRSA 3KBJA 4HU0A 3GWQA 4G1NA 1J18A 5CZJA 1ZGDA 1HTIA 4GBUA 2G3JA 2PDXA 3STEA 3E49A 1NWSA 3PJXA 4F79A 2WCSA 4G7FA 3CUJA 5D8WA 4FMVA 4GY1A 2D1ZA 3AUOA 3ARXA 3MHUA 4ACZB 5AC4A 3S1UA 4ZMGA 1NWRA 1XM3A 4D1JA 1TE6A 2OYMA 2YJQA 3U48A 4ORMA 2FZ9A 2D69A 2Z2BA 1WBHA 1ONRA 4TTUA 2E6FA 1DXFA 4E2OA 4UZUA 1H7XA 3N29A 3CT2A 1JAKA 1B9ZA 1VZWA 1AZ1A 2PWHA 2VC6A 4ZR8A 1EEPA 3T42A 1LCOA 4YNGA 2O9TA 1Q85A 1O66A 6TAAA 5LKYA 3G18A 3NZGA 3PB0A 1JCLA 4ZQRA 4FNUA 1DKWA 3VUSA 4PBFA 3M9YA 3DC8A 4TIMA 3NL2A 1KCXA 1K9DA 1VHNA 1V77A 4QJ5B 3A47A 3G2GA 1UOKA 3GH4A 4TV6A 5C9RA 4M3PA 2AOSA 3MKVA 1V6WA 1CWYA 5HPCA 1A53A 4WDUA 1RA5A 2VCBA 3WUBA 4XZMX 2XHYA 1V3IA 5I78A 3OYXA 1K4GA 3GVVA 2NXIA 1SJAA 4ICCX 1ZUAX 1XDJA 2XFRA 3DENA 1L8NA 1TRDA 3CL7A 2CIPA 2Z7GA 1B3OA 3N2OA 3FX4A 3IK4A 4G6CA 1XQKA 4TTGA 1RJRA 4M81A 5HULA 2WKJA 1VD6A 4PMVA 1NF7A 4Q6XA 1PTGA 1R2RA 3EDDA 2I5IA 4Q4KA 2PD9A 1BSLA 4F2BA 4HNLA 1T41A 5C70A 5I7GA 1O95A 1DIDA 4MNKA 3WD4A 3QN3A 1HO1A 4RLIA 4Z0JA 4Z1BA 1Q6EA 2FPYA 4R7OA 3BQ5A 4BZYA 2WVUA 4MB1A 1ECQA 1EJXC 3EDFA 1QPNA 1PVNA 3VZZA 1JZ3A 1TUXA 1X1OA 2WMFA 3TCSA 1QI3A 4Q4OA 3LMYA 5JIWA 1VPQA 1I4NA 2ODOA 4HSOA 4R3UA 2GPTA 4LSBA 3KLKA 5CZTA 2PDFA 2B0MA 1BVNP 4KIRA 4IGMA 2JGYA 4HCLA 1V0NA 2HNHA 3G1SA 3AIQA 3ZIZA 4CU8A 3D5HA 3VDHA 2OYKA 1HKMA 2ZUTA 2VGIA 5HAOA 4AY8A 4DUOA 1R85A 3GNXA 4FALA 3FY1A 3REQB 2ZUUA 1Q8AA 3CL8A 3E2QA 3I4EA 2Y6ZA 1BF2A 4J3TA 1TIMA 4WJXA 1AL7A 3PZNA 1ZJHA 4P5UA 3ZR5A 1LM1A 2GVJA 3MCOA 2PDYA 1G4TA 3GFYA 1A5NC 3TYAA 2R8WA 1RSCA 1SSGA 4XTDA 4I3GA 2JF6A 3PG9A 1TCDA 2I5QA 3BMVA 4DVOA 3B0UX 4ZTXA 4J35A 3EOUA 4GG9A 1NDWA 1T6MA 4N9BA 2PWFA 4L1WA 3BAIA 3MBFA 1RP8A 1XYAA 4GZEA 4RCXA 3BDKA 3MSGA 1WYIA 4PR4A 2EPOA 1AH4A 3L0GA 4OFCA 4DNHA 4L9YA 1CYGA 1W56A 4IMAA 2FB3A 1XD1A 1SMAA 3PF3A 2Y8KA 3L0KA 3VIGA 3NNTA 2YXXA 3AU6A 4LX4A 1XUUA 1WAWA 4US5D 3KCOA 5AHFA 4KCWA 1TZZA 2PF0A 2ATMA 1UCWA 4JN7A 1DEDA 3AXXA 2X16A 2HS6A 2VYOA 1SO5A 2XSAA 4DWSC 1C8XA 1Q6OA 2BLEA 4A8LA 1PKNA 2PTYA 3VZYA 3SQLA 4A3QA 2QCCA 2PDNA 1HUVA 2REQB 5EMUA 4H9TA 8RUCA 5I23A 2VRQA 1QO5A 5I06A 3TJIA 1G4EA 4S3DA 1H7NA 4GX8A 1VYSX 2A85A 5CEWA 3C8FA 2C3ZA 1AK5A 3LG3A 1KFEA 1H50A 4KQNA 3GXNA 1UWQA 4HNOA 1ITUA 1FH8A 3WLKX 5AZ1A 3W29A 1UWRA 1KM2A 3A23A 3ARUA 4ONVA 2Q6ZA 2HVMA 4KEVA 2CLLA 1JCNA 4B5NA 3N9SA 2EF9A 2F84A 4YHEA 4TOQA 2GQAA 3W6YA 1KM5A 4PTXA 5M17A 4GIYA 3FJ6A 3H7VA 3R10A 2JEQA 3GXFA 2E77A 2CZDA 3W85A 4L61A 3WBWA 2QCEA 4IQJA 3NSNA 3KS6A 1KLYA 1OC6A 4UR8A 5F4XA 4B92A 3N3TA 3S2JA 4EACA 3BOXA 2O7QA 4L4MA 4JQ4A 4KCUA 1XLBA 4JPGA 4HPXA 2UZ9A 1ELSA 2VR5A 4O0KA 1KXQA 3P84A 2YW3A 3DZ1A 4AWEA 5FF7A 3TR2A 2VHLA 4FXJA 3VOJA 3VNYA 4IGSA 4A29A 2R1NA 2HRWA 1TJPA 4J7RA 3L2MA 4IIDA 2XUCA 4LAKA 1MDLA 2BMBA 4MFDA 1DORA 1OIFA 2J7BA 5IBXA 4IHCA 3WQFA 3ZFHA 1FH7A 2DZPA 3OW1A 3BW3A 4CQ8A 1KR1A 6REQB 4DM2A 4W8AA 2E6YA 3U8GA 5ENLA 4I6VA 2ZXQA 4KW2A 3USBA 4S3BA 5MF5A 2ZA1A 3ARZA 1KTBA 2YDAA 1UD8A 3CQKA 3WEZA 2NSXA 1UPPA 3F5KA 5I0DA 1H3GA 4ZB5A 3UU0A 3NQ7A 4LCRA 1V0MA 3CMGA 1EBGA 1C8YA 3SCRA 3BJSA 4K68A 5G1MA 3OZMA 4A4AA 4FHAA 5A2CA 5DRCA 1CECA 1XFCA 2OOGA 2FZDA 5H8PA 3GNDA 1MEHA 1QHPA 3CZ8A 4WLCA 3LHTA 3HB9A 3PZMA 4FXFA 4HB7A 3T81A 3QPZA 4RZ5A 2XIJA 4ICMA 4M82A 3L5MA 4HMDA 4IMDA 1ZPTA 1PB0A 3CV1A 4O19A 4PTMA 1SW0A 1A5KC 2J8TA 3CAWA 3SN0A 1GVQA 4GJ1A 3KFTA 1MSSA 5D2TA 3BTNA 3AYSA 3HURA 4W85A 2GVGA 4I5RA 3UXLA 1XSIA 1J79A 1JIBA 2YXOA 4MNMA 1XD0A 3TKFA 2IUZA 3M7SA 3KP0A 1GGOA 1JI1A 4G56A 1EXBA 4PN2A 4QJ3B 2ABBA 3PZVA 3BLFA 3V1HA 4MWAD 3ARPA 3NQMA 3K4DA 3EGJA 5ABFA 1YEYA 4IX0A 1QK2A 3H2OA 2OEKA 3HZ3A 4IISA 4Q7NA 4UZSA 3R5EA 3RM4A 1H0IA 1GYLA 1B30A 4I5UA 5HMDA 1KWKA 1SYTA 3WDJA 4CQ9A 4JICA 4C6DA 2D3NA 3QOKA 1GJUA 4DELA 5CZSA 5DCDA 3A12A 3RNDA 2WHLA 3Q94A 3PM6A 1TPDA 5K2ZA 1DE5A 2VI0A 3W87A 1OX4B 3BICA 3ELFA 3S83A 3GAKA 3TSMA 1E9IA 3PBYA 4JTSA 5EFFA 1UZDA 2E9BA 5A69A 3PSVA 2UWFA 2Y24A 5HBFA 3CO8A 1GT8A 3DFSA 3OB8A 2RHGA 3SCPA 3ZLFA 1IYXA 2HBXA 4POCA 1AFSA 4FLSA 5FD0A 4Q8TA 1M01A 5G2IA 4QXIA 1I6NA 1TV8A 1UQYA 3LHZA 1E4NA 2YCKX 2OQLA 3PZ9A 4IFKA 4MIMA 2WPBA 3WLSA 3M0YA 1L9WA 1X38A 2OLSA 1E55A 4AD1A 3W74A 2ZCGA 3FS2A 3SCTA 5DBUA 3W1LA 4V1YA 1KTCA 1S2VA 4GUFA 3W3OA 3VOCA 4JYDA 3AIBA 1NQ6A 3VM5A 1DJGA 3OG3A 5TBOA 4NI8A 2IQTA 4JTGA 1GOXA 1AZ2A 3NL5A 2VFIA 3C3NA 1XH1A 3O9NA 4C6JA 2J66A 3LMZA 3LXBA 5B7ZA 1H1NA 1ISZA 1NOWA 2ON3A 1OCBA 3UJRA 2WMIA 3WBYA 5AFDA 1R3VA 1OYCA 1NM9A 3B8IA 2AL2B 3QY8A 1UWTA 4UR7A 5A3HA 1K02A 1KRMA 2WSPA 3QV9A 3P14A 1A49A 4ZO6A 2WLYA 1RLCL 1WDQA 4UTIA 4CD8A 1LL6A 2XFYA 3WFZA 2RDWA 2E4TA 3FNDA 5K3VA 1KM3A 2CLFA 4IQEA 3TXZA 4O57A 4YIWA 1XF0A 1HL8A 3NGJA 3L4ZA 4OV9A 4AAJA 3DKJA 1KFLA 2QF8A 3W2UA 1OC5A 3MCMA 4IPIA 4Z2LA 4K6AA 4JKLA 4XAYA 4RDYA 3GW3A 3GXTA 4FNQA 3L7RA 4HPHA 3G1AA 3C2VA 3WEOA 1JCXA 1H7OA 3ARTA 1DE6A 1J5TA 4JQ2A 4LUTB 3BCFA 1LLZA 3NTYA 5M1TA 4KGJA 2NQJA 4GPNA 2PTDA 3HV8A 3WLHA 3NYZA 3EXTA 1RCOB 5IHRA 3R2GA 3S2LA 2DT0A 4FA3A 2WSKA 5E6YA 3GC5A 4AWSA 4Y96A 3GO2A 2IPJA 2E8YA 3F4WA 5I6SA 1U5VA 3THUA 4Y9MA 3VXGA 3MV01 3OHIA 2RAGA 1DTNA 2IPGA 4E2VA 4LQ1A 1OCQA 2FHFA 3AXHA 4TU1A 4E2BA 6XIMA 1E4MM 3F4CA 3GLCA 3DC0A 1DWJM 5CJMA 2PMQA 3J7HA 4JCMA 3P62A 1XLAA 2FYMA 2AGTA 5HQLA 2IQ0A 3E6EA 3L9CA 1ZY9A 2V5DA 4PSPA 4PUDA 1K03A 3L65A 2OQHA 1Y5WA 3LCHA 1CT5A 3CV2A 4HQVA 3VI2A 3SO7A 1UKTA 1KRCC 3R13A 1FCUA 1M7XA 4JFVA 3M5VA 2YL6A 3W02A 4L65A 3RDKA 3KW3A 4Q4QA 4W7VA 2NVDA 3I7RA 4WOZA 1QNSA 1IT8A 3ZWTA 3OBAA 1IEQA 4LUYA 5H8MA 3G8RA 5K9DA 3AMGA 2VJXA 2OEJA 4O18A 2DZWA 4K1GA 3BW2A 3ITLA 3ZR4A 2QJGA 3IEBA 2SFPA 4S3AA 6CGTA 2EJAA 4RW3A 4ZTYA 3JRKA 4LEQA 5C9ZA 1MNSA 3G77A 4NSBA 4S3CA 4OWGA 2DEPA 3EB2A 3W23A 4H6QA 2QJIA 4JIRA 1Y65A 3S6DA 1WCGA 3S1GA 2ZX5A 2VT0A 4TR9A 1ZLPA 3Q67A 4UB9A 1UD4A 1W54A 3M1ZA 5EU9A 3S2CA 4AISA 5I77A 4LOCA 3UF9A 3ARQA 2E40A 4FNTA 3ARVA 4PCNA 3VDGA 4KGLA 1C93A 1PAMA 2PDBA 4YYCA 1ZALA 2Z00A 4K7VA 3P60A 5K9XA 2WZEA 2OO0A 2JKAA 1NOFA 5XIAA 4YLWA 4RV8A 3HGOA 1LWIA 3POHA 3MQTA 4HZ7A 4I5XA 2EPHA 3TCEA 1J12A 1TIWA 1TWSA 4US6A 1CPUA 2ONEA 4RDZA 1CXHA 2BX7A 3NUKA 3N14A 1W1VA 2XH4A 4IMCA 2IS7A 3KEHA 4LAZA 4I6KA 1WZMA 4LF2A 2F61A 5IOBA 1IEWA 4QBXA 4IL0A 3N04A 3K4WA 4MJZA 1UASA 1ZFJA 1MI3A 2V69A 2HCVA 3WH5A 3SRKA 1P0NA 3NJ3A 2XVLA 1R86A 5BROA 3WX7A 2HS8A 2QAFA 3WBEA 3BO9A 1TQJA 1G67A 1OFPA 3MVTA 1XLIA 1UR9A 1KCKA 2CZFA 4NAEB 3IWPA 4TUFA 1EB3A 4H2HA 3CMJA 3MMTA 5DCEA 3WQWA 4HTBA 2WMJA 3UGVA 4AXKA 3UYIA 3DESA 3T09A 3P74A 1NOUA 1MRAA 2Y70A 4W86A 3H54A 3HM7A 2AL1A 2BV9A 2CHNA 1S1RA 2P76A 1TPEA 5REQA 2OLHA 3R89A 5HMEA 1PO9A 3ZJ8A 4ZO8A 1DL3A 1ISWA 3OVQA 2FLIA 3HBLA 3W2KA 1XIMA 3G24A 2Z1BA 3SY5A 4L56A 3WH6A 3EDKA 1U5HA 5F1VA 4IMEA 2GUBA 2V3GA 2B81A 1KBLA 1WBJA 2DQXA 2NWRA 4JNZA 4KT2A 4XAPA 3TW6A 1XIEA 4JIQA 1UYQA 3UW6A 2XFWA 2CKSA 3SB0A 1B31A 3WO8A 1IEVA 2DGAA 1QPKA 3OIXA 4D8ZA 3XISA 1OT1A 1XBZA 1HG3A 1W1A1 2VFEA 4EK7A 4MB5A 3EX3A 2QCMA 1IT7A 2G4FA 1Q4NX 1FWFC 5CSSA 2FB2A 3T0TA 2B7NA 2EO7A 1GZGA 1GQIA 3RLUA 1FCQA 2ZX6A 3MB9A 1E9LA 2OMAA 3P7YA 4NJKA 1JVNA 3PTQA 4NG3A 1IEXA 3PFRA 1VBHA 3LCWA 4HA0A 1PCWA 3B8UA 4OU1A 1UIPA 3WQGA 1AJ0A 9RUBA 1VPYA 5D9NA 5HWJA 4MGGA 3WQ6A 5IHSA 3ABRA 1HJWA 2XWDA 3M44A 4AZHA 1E6SM 2P8BA 4AD3A 5IFTA 2Y85A 3LQGA 4GQ0A 2HTMA 2ZIDA 1K9FA 1E4IA 3TIMA 2QW5A 1VBRA 2AQOA 2HQAA 1XLCA 3SGZA 1KM0A 3GVWA 5F4WA 4JHZA 4YTQA 3BJFA 3F1QA 4R27A 3T0DA 3E74A 4H1ZA 1RP9A 2J9XA 4WJEA 3GYCA 2W92A 1A80A 4GINA 1QPQA 4NJGA 4YL2A 4WF7A 3ZVHA 3OPSA 4P61A 3NO3A 1QXLA 4C6OA 1OCNA 3LD5A 5XIMA 2PZNA 5D38A 2DSZA 3IIOA 4JX6A 5BOEA 3JR2A 1K1DA 4V27A 2BVDA 2ZE0A 1OY0A 2EPLX 2QR6A 3WQCA 2NWSA 4Z08A 2YKKA 4UFJA 4XAGA 3MDWA 5BXTA 3CEUA 4OTKA 4LS1A 1XP3A 3GFZA 4J3XA 3W82A 2I57A 4UTTA 1VFFA 3ALGA 2GWNA 3QMTA 4UFHA 1PL9A 5CPLA 4NU7A 4D6CA 2BB0A 4FF5A 4HN4A 2DW7A 2YGYA 2YA2A 4DYEA 1CLVA 3W81A 1DHKA 1DIOA 1S5NA 1Q7QA 5HJLA 2EEXA 1VYPX 1TV2A 2ALRA 5FA5A 2X30A 5ABHA 3GDLA 1UROA 1EWEA 1THFD 2QCNA 2X8RA 3WK2A 2INFA 3TU9A 1JULA 2VTFA 3AIWA 2EG6A 4OGZA 2PAJA 1Z48A 1WDWA 3NQAA 4MNLA 2QUTA 1XRVA 1J96A 4O28A 1MUWA 2BY1A 2HDJA 4GWEA 1UJQA 4PRWA 1RLDA 4XBSA 3H22A 4Y7EA 3CUGA 2VDGA 2QHAA 3LK6A 1EC7A 3W70A 4NYUA 1J2WA 3O2LA 2VZVA 1IWAA 3V4BA 1G5AA 4I9TA 3PG8A 5FEPA 3URNA 5CPTA 1Z42A 3TW7A 5AY7A 1O7AA 3T6CA 5EKYA 4PEEA 3AQUA 1F6YA 3N19B 3O1NA 3DBNA 5HK4A 3T4CA 3AZTA 4F0LA 1KV5A 4A21A 3G3MA 1FWIC 4HMEA 1MUMA 1BWKA 4EPKA 3MS8A 2YX0A 3Q2DA 1DXIA 4D9PA 5DN1A 4QE1A 2VDIA 3EMCA 2XVGA 4ROQA 3TMLA 4PEKA 1PKYA 3NFUA 2NLIA 3M0VA 1OG6A 4CQBA 2V2CA 3OGVA 3RX4A 4IPNB 4EXBA 4MMWA 3LCGA 4B2DA 2WLZA 1Q6DA 1UWAA 3NQ6A 3OZPA 2OG9A 4W93A 3URAA 3TSDA 3NOYA 1LLOA 1HKJA 3PNZA 1ZL1A 4GZIA 3TAKA 1L0PA 8XIMA 2GQ3A 4DIAA 3VFLA 1U1UA 3UJSA 1EQCA 1DOSA 1RD5A 5FEZA 4AC7C 4Y8EA 5BU6A 3LLFA 4ZOCA 3D3AA 1DIKA 2EPNA 1US2A 1LT7A 3VOGA 4GH1A 4NNAA 3TXVA 4HSHA 4AYSA 4E3VA 3MHGA 5F2MA 3JS3A 2PGEA 1XW8A 3QPYA 1WZLA 1SU5A 4BF9A 3S47A 1OEPA 1ICPA 3INPA 3IS4A 1RHCA 3GIPA 2F6UA 3HG5A 3NQDA 1HKWA 5DELA 2P3EA 4H83A 4EPEC 1TX0A 5I2UA 3KVLA 2E5CA 1AH0A 5DCBA 4RXGA 4YXGA 1OYBA 1PWMA 2GDUA 2ZZ5A 1KM6A 4PH6A 1XGDA 2VD8A 4LH8A 4LU0A 4LVGA 3CM4A 4GMEA 3HMCA 9XIAA 2NQ5A 2PWGA 3EWZA 1Q13A 2FFCA 1UD5A 1X6LA 4J40A 4DJDC 3KOZA 1EEXA 4INFA 4UNKA 3TJ4A 5BWAA 1YHTA 1R3SA 2BY3A 4A3UA 4ZOAA 4FK9A 4D6DA 3L5LA 3H2MA 1QHOA 2OZ0A 4KS0A 3TTEA 1JFXA 3QR0A 1TELA 4NX0A 4IUOA 3WNPA 2DVXA 5JVLA 5FJJA 4O4VA 1A5SA 2DZXA 2W62A 3QV6A 2GK1B 1MEIA 3VCRA 2PU0A 1EFZA 1XYZA 1E70M 1FWHC 4GJJA 4OE7A 3ABQA 4CNPA 3MMDA 3UY8A 1MXDA 1PX8A 2DJXA 1V6TA 3QR3A 3MBDA 3HN3A 1CLKA 3TW9A 1IXQA 3HQNA 3VMOA 5HJXA 2BNJA 4UCFA 4FS9A 2QCDA 4LF1A 3BARA 3JUGA 2CBIA 1O6IA 3QOMA 4AZGA 4DBUA 4YTRA 3O6YX 3E12A 4IICA 4BF7A 4G9PA 3QLLA 2V67A 3W7DA 4HPJA 1XDLA 1GHRA 1QFEA 3T40A 2QUMA 3MUIA 3NL3A 2UY2A 3AICA 1TFVA 1NJJA 1F3XA 1BKHA 4LCQA 3WQEA 2CETA 4X9YA 3RRAA 4B4FA 4GY0A 1IIHA 4PMQA 3S2NA 2PEVA 1DJYA 3FN9A 1VKFA 2WV8A 4BFAA 3VOIA 3W6LA 2W27A 3BVJA 3FFSA 4LY8A 3VE7A 4QX4A 2CWNA 4PMZA 2QCFA 2O55A 4N4QA 3FYOA 3RHGA 3PANA 1YNPA 5M2FX 4AVNA 4CUCA 1SW3A 1W8GA 3WJWA 1NVMA 3PSWA 3U2ZA 3A4JA 3E2VA 3R58A 2ZRVA 4AF0B 3MWAA 3A4XA 1A5CA 3WDHA 1XYBA 1DBTA 4WX2A 3N6JA 1FWNA 1U2YA 2DT2A 2D2JA 1EPXA 4R7WA 3UQNA 4AD5A 1Z44A 2O9OA 3EOSA 3UWWA 1GQNA 3AISA 3FVDA 4Z2GA 3WQPA 4IT1A 4AIBA 1RVGA 4C6BA 1E1FA 3PUDA 2WBKA 1F07A 3PPHA 1OINA 4BKNA 3VU2A 3WL1A 3JW7A 3E5BA 3LI0A 5EA9A 3BLPX 2WPGA 1NARA 1BG9A 3VC6A 2HISA 4R33A 3FAWA 1OF8A 3VAVA 1YADA 2J79A 1EHAA 3SUUA 5JXQA 2A0NA 3LLDA 3RIKA 3CUZA 4TX6A 3VCNA 1FVPA 5LNSA 1PEZA 5CPOA 1JRCA 2PF8A 3HQOA 4XD5A 4NRSA 3UG4A 3ITXA 4JOMA 4WZHA 1H7PA 3UETA 4XSLA 4FX7A 5A8MA 3FJLA 3QRHA 4IFKB 7ENLA 1V03A 2WNZA 1MWOA 2ZVRA 3BCDA 3FW6A 4O15A 3OODA 1S46A 1JCTA 3N2CA 4PUNA 4N9CA 3HG4A 3AHYA 3EWXA 2DZAA 3VNKA 1EA0A 4PMDA 1R2TA 3LCIA 4IOTA 3VMPA 4XIMA 5C7VA 2CWXA 1JUBA 1R3YA 2PA6A 5HNNA 2W67A 5EMLA 3SM0A 3QVQA 3BAJA 1Y8BA 2Y89A 1GYMA 3LBCA 1WP6A 4R5EA 2OZ3A 4GVGA 2ACUA 2I1OA 1UHVA 3LU2A 3ANYA 1FWDC 2GVEA 5A6MA 1YE4A 5LNUA 2GJNA 1OGBA 3N9KA 3GNOA 1YNQA 1E71M 2V5CA 4JTHA 2XIOA 4QITA 2YYUA 1TA3B 2PDHA 3UYCA 4QAWA 3MPGA 4BWLC 6XIAA 2V3FA 5KETA 2DSUA 4DBDA 3U2EA 4XD6A 1HL9A 2IW0A 4E3TA 2ISSA 1JCMP 4R53A 3H7UA 4L4OA 4MTVA 2JK2A 4O0QA 5FF0A 4PMNA 3P8JA 1P1MA 2H9AA 1J0JA 3PUOA 3COTA 3EX6A 2VFDA 3QHOA 2GYIA 4M56A 3TC6A 2W3ZA 3T0CA 2ZYFA 1YQ2A 3WMLA 4EIVA 4C1KA 5C8BB 2QS8A 3LM7A 1UP2A 1TV3A 3II1A 3PULA 4C1NB 4C7FA 1KFJA 5HWMA 2E09A 1R47A 4D6HA 4AH7A 2DT3A 2DUAA 2FJKA 2B4GA 4LBSA 1EC9A 4K8EA 4YJ5A 1VLIA 3KZPA 3CZGA 3TFXA 3NIYA 5CJNA 4RNIA 1E51A 3KUMA 1PIFA 3EXSA 2DUXA 1Y5VA 1ME7A 1LBLA 3UERA 4PODA 3T8LA 3GK0A 4QG9A 4HHLA 3ICJA 3A24A 1RUSA 1GVSA 1XPGA 1XRTA 1JYNA 5BNKA 4ZXLA 1C91A 2WANA 3ES8A 4WCJA 1W6TA 2UY5A 4LV4A 5F4SA 2YYTA 3UG8A 3VIIA 3ZMRA 4PUJA 4CLMA 6A3HA 1VR6A 4ACZA 3M47A 1LT8A 2BSLA 1XGEA 3OA5A 1QBBA 3FCPA 3SFKA 3VX0A 1QU4A 1TV7A 3HQ1A 1N7KA 3GY1A 3QM3A 3C2YA 1WV2A 5FJPA 6PTDA 2BS9A 1B3ZA 4BR1A 2OZ8A 2Z2AA 3OHMB 1Q6CA 4QIUA 1SFTA 2W63A 2BOGX 4OIFA 4LS0A 3VDAA 4O1AA 2VC5A 1G4SA 2PDIA 1BKSA 1JG9A 2WAGA 1K7EA 1E56A 2Q09A 2ZVIA 1VS1A 1F3TA 2VDHA 4XAFA 2YBVA 5A6BA 5LHEA 2WVSA 5A1AA 1OM0A 5A6SA 3OLEA 5FIPA 3H2EA 3UR5A 4QM1A 4LALA 5D33A 1LL4A 2ZXBA 5I24A 3LQLA 2BG5A 3MYOA 1Z89A 1G7VA 4EP8C 4Z1YA 2OFJA 3BAKA 4JYEA 3EEZA 4JTRA 3B8TA 1J2BA 2QMKA 4HVXA 5FACA 3PP7A 3T08A 4HCHA 4W8LA 1OADA 1TJ2A 1DWHM 1RK5A 1OF6A 4X61A 3UBPC 2PC4A 1AW2A 2NX1A 3KVMA 3M0JA 2BVTA 3WLNA 2YL5A 1VH7A 5LSMA 4LTSA 4L1GA 5EFDA 2CXEA 4AZIA 4OKDA 5D37A 1AL8A 4S3GA 3W1UA 3W9ZA 4FNPA 4CVWA 3QHMA 2ACQA 3EPNA 4Q33A 4IX2A 2HJPA 1ECEA 4GFIA 4EVZA 2PFHA 3RU6A 3SURA 1JI2A 3M6DA 4UFIA 3NZRA 4JS3A 1AODA 3ARRA 3ZSSA 3E0FA 2WNNA 5C7HA 5A8NA 1PPIA 1YXDA 1JCYA 4LVFA 4UCGA 1ONXA 3B0VC 4JN8A 4KF1A 3FV9A 5HWNA 2VX4A 4ERAA 4UOQA 3W07A 4A2RA 2DIEA 4H2CA 3QW4B 4GI8A 2C19A 4LNYA 1CXLA 1VFLA 2PDQA 4FR6A 4YVVA 3ZS4A 1WKDA 3VIPA 2PGWA 1TTJA 1BF6A 3L2LA 1F2JA 3CH0A 1P7TB 3I3EA 2XGBA 2QDHA 4JQAA 1K8YA 3NO1A 2Y5JA 1S38A 3B9AA 2QCLA 4AFYA 4WKFA 4X63A 4IMGA 3BE7A 1HVXA 3PK7A 4TO8A 4MJMA 1I2QA 1GKQA 4AZBA 3NOEA 4L5ZA 3SCOA 3REQA 4XG1A 4C6IA 1HZYA 3W53A 2P10A 4GACA 1BVZA 4HHHA 4H9YA 3WUGA 4Q8VA 4C65A 1EBHA 2EBNA 3IV8A 1XX1A 4WSJA 4JDYA 4BF5A 5DRIA 1Z41A 1HT6A 4C5ZA 3D6NA 1UWUA 3RJXA 2ZZ3A 4M1RA 1A0CA 3OA3A 1EDGA 2XPKA 3W2LA 3W83A 3AC0A 2PDMA 2QJNA 1F6KA 1A4LA 3ZJKA 1DV7A 1F73A 1SM9A 1KNWA 1WKFA 3PZOA 1LWHA 1PV8A 3MSDA 1ZS2A 2OYLA 3WJXA 2W4XA 4Q7IA 5FJOA 1OVDA 4TQTA 3GRIA 2H3DA 4MVAA 1ZNNA 4LUSB 5E0FA 5JH2A 4N6FA 2I56A 4NZCA 3TAOA 3ZJ6A 2OX1A 1HGYA 5AHEA 1EJ7L 1B4EA 4GXMA 1JZ4A 2A3HA 3RF9A 4J4KA 2CBJA 2RDXA 4QS5A 2NX3A 1KXHA 1XJBA 2VEKA 7CGTA 1HXJA 3AHZA 3GXIA 4H41A 1TVLA 4B2DD 1UP0A 5I3KA 1QW9A 3O6DA 3AMDA 1AA1B 1R3RA 1ZCCA 5I3HA 2GGIA 1POKA 2YLLA 2HVOA 4IUGA 4UWMA 1R2SA 5CPNA 2I17A 2REQA 3MSYA 4IGNA 3M0KA 5D03A 5HMSA 4TVCA 4Q4RA 3WYZA 1S2UA 4Y9AA 1PZ2A 1YDNA 3KRBA 1GHSA 3CHDA 3F2BA 3P0XA 4H8HA 3WK1A 3U3HA 1EF3A 2C14A 1Q66A 5IDZA 4IIFA 1FUYA 2WQDA 5E70A 1VRXA 2IPFA 3WNMA 1VEPA 3THQA 2GGGA 4LPCA 3WBAA 4O54A 2XJ7A 3EX2A 1QATA 3DFTA 3VM7A 3TK7A 2I14A 2ZWYA 5DMYA 5PTDA 1HJVA 1EQPA 4HNCA 1KKOA 4MZYA 4JTCA 2ISVA 4D72A 2HZGA 3QZEA 2BHYA 1VBGA 4AZ7A 1U1JA 4HOZA 1CIUA 2H8XA 3WMCA 4C60A 3B8VA 4E8DA 2YCEA 3G1YA 2QGHA 4KPLA 5HQEA 3L4YA 4QR6A 4DM1A 1V51A 5C9WA 3KTSA 2QVHA 3R12A 2ZZ4A 2OT1A 1LJYA 3MUAA 5I3JA 2CPUA 2GJXB 2WSRA 1K6AA 3TYUA 4LC6A 2EG7A 1IWBA 4LFYA 1YYAA 3HV9A 1JL8A 4J3WA 2ZUVA 1AUSL 4C6EA 3E38A 2JKEA 1W1ZA 1XRFA 1KC7A 8A3HA 2BXZA 1GVRA 4JTUA 3MKCA 4L6HA 1OFBA 3EZ4A 4D6EA 4Z1AA 1UC4A 2YFOA 1C3FA 5TNVA 2OZTA 2VM8A 3L68A 2YZ5A 4J2PA 1EZWA 5BZAA 1JYWA 2OR2A 3AHTA 3MZ2A 2DPEA 5C54A 3GSMA 2A3CA 4PBGA 1T5AA 1ITXA 2X09A 3QEZA 2BP1A 4TV5A 1Q2SA 2ZA2A 1IHIA 5J5RA 2VEMA 5CSYA 4KMQA 3WNNA 3AJ7A 2NSOA 4MB4A 1GNXA 3CB8A 3LZ3A 3G6MA 3F5LA 4R7JA 5GNYA 1BFNA 3OTRA 3BGAA 2VFFA 1H7RA 1TMHA 3IARA 3G5EA 2NV1A 3SIMA 1F76A 3M0HA 1K7XA 3NEHA 1SZEA 4GYPC 4XWUA 3VE9A 3WG6A 3QC0A 3SUTA 3KVKA 4UQBA 3SBFA 1CXEA 1JNDA 4CU6A 1O4UA 4EPBC 2HNEA 3NSXA 1EHNA 3PTKA 1UR3M 2DZSA 4FZIA 5CBIA 5GNZA 3QLDA 5LIUX 3IACA 3KBVA 1GG1A 5HNRA 1VCGA 3WD1A 1CLXA 4O8AA 1DJNA 4ZCWA 4PMJA 3TTYA 3HIJA 1WKYA 3K30A 1TX2A 1N8FA 3BW4A 4LB4A 2BDQA 2VUNA 4Q8NA 3V18A 4KCVA 5FJIA 1OHLA 5C0QA 2V2DA 1XINA 2GJPA 4H04A 3N25A 1CX9A 1OK6A 2PRLA 3EA1A 1G1YA 3WIJA 2P3ZA 3M46A 4J9JA 3EX1A 3PPCA 1WE5A 1MO0A 4UTJA 3CPRA 4O10A 4OJYA 1PZ1A 3SIZA 4QE5A 4MYXA 1IXOA 4BI5A 3FSUA 5C9UA 4DUXA 5KINA 2FHBA 2CITA 2PP1A 4FOJA 1WDDA 1VJZA 2XN2A 3TVAA 4LYPA 3T78A 4GYJA 1RY8A 3TYEA 1Y5XA 4N02A 1XH0A 2QPXA 1J11A 1WOAA 3W73A 2PI6A 3RCNA 3GBEA 4EOUA 3E0IA 1OX4A 3TLLA 4GIAA 1HVQA 4WXYA 4XSMA 3UCDA 3WJSA 4BQ3A 4UTHA 4JQ1A 3S0CA 8TIMA 4PTNA 4QNWA 4K7YA 5D9PA 1KWGA 2QLYA 3A64A 4AHQA 1RJPA 2E3ZA 3AU2A 1XFBA 3GZ3A 2D23A 4EAMA 1ZENA 3B05A 2E1WA 2ISWA 1JZ8A 4B5TA 4IIEA 4KEZA 4WOQA 1LUCB 3U7VA 4WDXA 4NJHA 3MP4A 3MO7A 3N6QA 1J0HA 1OWQA 2BWGA 1X6UA 3EA2A 1EP1A 4IQLA 3V5OA 3QQ1A 4WQ6A 2P0IA 2OWWA 4XISA 2NW0A 1FHDA 3APYA 3WLQA 5CBBA 3MZNA 4AMCA 3QKZA 2YXGA 1UQZA 3LGGA 4UUIA 1FWSA 4L6DA 1FWJC 4PFHA 3ARYA 1CEOA 3WF2A 1AW1A 3NZPA 3QZ6A 3GU2A 2V82A 3WJYA 2G4JA 3TA6A 2PB1A 3A3WA 1I2PA 2C6QA 2DY3A 3UVIA 2NLYA 4M7SA 4YPJA 4KWUA 2PLJA 1AMYA 2QZRA 3SUVA 2J7GA 4V28A 3NGFA 4UBPC 3RAOA 3RPDA 4MWAC 3MP5A 3GTNA 3ONBA 3WJZA 3IJLA 3S42A 1QAPA 1RPXA 2F8QA 3B9OA 3H2NA 4OT7A 3EA3A 4IMFA 2QVNA 3PWAA 3FYPA 3W72A 3VA8A 3PZUA 4HU8A 5LXXA 2YL9A 4XZNX 3G0UA 1JAEA 1H5VA 3I6RA 4MG4A 2WQPA 3TQVA 2EAWA 3CUHA 1BLIA 2VQUA 1V4YA 5KZMA 1VC4A 4DWSB 4E4UA 2NQHA 3O06A 4C6MA 4F4RA 4H8NA 1ADOA 3BUVA 4HN8A 1X8CA 3FXYA 3L4UA 2IKGA 3R4IA 4TVDA 3KBWA 2CLIA 2Y5EA 4UOZA 1VYRA 4IIHA 3GBDA 1YIXA 3FJ4A 2ZICA 1FXQA 3FOKA 4CCEA 3F2CA 4JR5A 3LRKA 3GE7A 3W1NA 4WK9A 1TWWA 3WF4A 1QCWA 3GQYA 4V15A 1XBYA 2O9PA 1GVFA 2PRMA 5C2GA 1R7AA 1D8CA 1ICSA 1C7SA 1I9CB 1A5OC 3M41A 3MMUA 3FEQA 3QHNA 1UUOA 3GG0A 4YHGA 5CLWA 3NQ8A 4RV3A 2QV4A 4HTYA 4LUIA 5HA7A 2AMGA 2XYLA 4GQQA 3UXKA 3ZQ9A 2FVKA 1HJXA 4L80A 4ZO9A 5FJTA