1S1PA

Crystal structures of prostaglandin d2 11-ketoreductase (akr1c3) in complex with the non-steroidal anti-inflammatory drugs flufenamic acid and indomethacin
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of prostaglandin D(2) 11-ketoreductase (AKR1C3) in complex with the nonsteroidal anti-inflammatory drugs flufenamic acid and indomethacin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 119
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1s1pA00
4ZFCA 1Z3NA 3O3RA 2QXWA 2R9RA 3D3FA 4AUBA 1R38A 3R8HA 2PDQA 1AH3A 2HV5A 1RY0A 4G5DA 3T42A 2IS7A 2FZ9A 1RALA 1PYFA 4L1WA 2F2KA 2R24A 4WDWA 4WDUA 4GIEA 2PDPA 4PRTA 4EXAA 2PF8A 3M64A 2DUZA 3LN3A 4XO7A 1X97A 3RX2A 3LEPA 3ERPA 2FVLA 4JQ4A 4XZNX 2PDYA 1S2AA 3LD5A 4L1XA 4XVDA 1X96A 1UR3M 1XGDA 3R43A 4WGHA 1IHIA 2WZTA 2IKJA 4Q3MA 1A80A 3R94A 2A79A 2PEVA 3H7UA 2IQDA 2PDLA 2HE8A 1ZSXA 1PZ0A 4OTKA 3WG6A 4ASTA 3U2CA 4YVXA 3BURA 3BCJA 4XZLX 4DZ5A 1LQAA 3MB9A 1T41A 3CMFA 4YVPA 3RX4A 3RX3A 2CLPA 3CAQA 1S2CA 3M4HA 4FZIA 3V0SA 3GHTA 3FX4A 4LBSA 4I5XA 5LIWX 1Z8AA 4FA3A 3COTA 1EL3A 5C7HA 3R6IA 3C3UA 4XVEA 4LBRA 3QKZA 4PRRA 3GHRA 3GUGA 4GCAA 4JIRA 3B3DA 3R58A 1AH4A 3WCZA 2PDWA 2IKIA 1AZ2A 4ICCX 3EAUA 2IKHA 3FJNA 4FAMA 4JTQA 3LQGA 1GVEA 4GACA 4JTRA 5LIKX 4IJCA 4LB3A 2FZ8A 2HE5A 3S3GA 3V36A 5KETA 1EXBA 4JTAA 4GA8A 1JEZA 1VBJA 4HMNA 3P2VA 5JH1A 5AZ0A 4JQAA 2PDMA 2PFHA 3DOPA 4YS1A 4WDXA 3CV7A 2BP1A 2IPJA 4YU1A 4GQGA 2PD5A 2INZA 4WDTA 4IGSA 4HBKA 5AZ1A 1HW6A 2FZBA 3CAVA 3G5EA 4XK2A 4H7CA 5JH2A 3UZWA 3DN5A 3R8GA 2ISFA 3LENA 2F38A 3UP8A 4JQ2A 5HNUA 4XAPA 2AGTA 4QBXA 3V35A 2PDUA 3MC5A 3UGRA 4FALA 1Z9AA 2I17A 1US0A 3BV7A 2VDGA 4JQ1A 4IJRA 3EB3A 1AH0A 3VXGA 3BUVA 4JIIX 1ZQ5A 5LIUX 5HNTA 2NVCA 2IPGA 3UYIA 3LUTA 1S1PA 1YNQA 4LAZA 2PDFA 2WZMA 4R9OA 4DBWA 3KRBA 3N6QA 3LQLA 3LZ5A 4JTDA 1EKOA 3GHSA 3UWEA 4QX4A 4XZHA 2HEJA 1ADSA 1SM9A 3F7JA 2ACUA 1C9WA 3V0TA 3UZZA 4DBUA 2PDKA 1MRQA 5M2FX 1AFSA 1VP5A 4PUWA 2BGQA 3LBOA 1FRBA 2ALRA 1EF3A 4JIHA 2DUXA 2PDHA 3LNMA 1S1RA 3ONBA 1YNPA 4Q7BA 3UFYA 2IPWA 2ACRA 4MHBA 2PDJA 5DANA 3H4GA 3GHUA 4EXBA 3UZXA 4QXIA 3WBWA 2HDJA 3V0UA 4WEVX 1MI3A 4PR4A 1MZRA 4LB4A 1PWMA 1XF0A 3Q67A 2FGBA 3CASA 4GABA 2I16A 2PD9A 1YE4A 2NVDA 1YE6A 1RY8A 2IPFA 1Z89A 1K8CA 3LZ3A 4PMJA 5LIXX 1PWLA 2PDCA 3G1RA 4JQ3A 2HVOA 5HA7A 3ONCA 4PUUA 4JTCA 1XJBA 2ACQA 2INEA 3EB4A 3M0IA 3H7RA 1QWKA 3UZYA 1OG6A 1M9HA 1Q13A 4H8NA 3NTYA 4XZMX 4XO6A 2DV0A 3N2TA 2IKGA 4XZIA 1AZ1A 2PDNA 3O0KA 3CV6A 4NKCA 4QR6A 2C91A 2BGSA 4DBSA 2IQ0A 2PDGA 4RPQA 1ZUAX 1PZ1A 5LIYX 2PDXA 2HVNA 1Q5MA 1QRQA 4YVVA 1T40A 4LAUA 4WRHA 3Q65A 3WBYA 2P5NA 1X98A 1J96A 2J8TA 2PDIA 1IEIA 4F40A 2FZDA 1HQTA 3WBXA 2ACSA 1LWIA 4GQ0A 2PDBA 3R7MA 3UG8A 1ZGDA 2PZNA
chains in the Genus database with same CATH superfamily
3WLHA 1KTBA 1Q7MA 2QYGA 2OODA 3K8KA 3AHYA 3EA3A 2QXWA 3W7JA 2O56A 1CGTA 1XRVA 3ARVA 4QE1A 1PV8A 1KNWA 3EX6A 3U2OA 1P48A 3AC0A 3GSMA 1ZHAA 2G0WA 3W72A 4CD4A 4IFOA 1W9PA 2VX6A 3QW3A 4L4OA 3OVPA 3AS3A 3ZSSA 3TEVA 4PCFA 3QR0A 1R8LA 1LDCA 4J2MA 4K68A 4NX0A 4BR1A 3N29A 3P82A 5TQLA 2C8NA 4NXKA 4WGXA 2XIMA 1TRIA 3UWYA 4IG2A 4M8UA 4YHGA 3LA4A 1HIZA 4CCCA 5T8GA 4NQ1A 3HGJA 4GVFA 5A94A 4Q3MA 3QFEA 1B5TA 1TV4A 2C6QA 1H7XA 2QNEA 1K8YA 1NF0A 3RRAA 1W8GA 3MPGA 5DY2A 3EDKA 2XSAA 2AAAA 9RUBA 3MHGA 2MNRA 2QKFA 4JHOA 2OYKA 4JICA 1R85A 4XZLX 3B9EA 3F4DA 3R0UA 5HUPA 5EMUA 4N6EA 3MUAA 5BROA 2O9PA 1OHLA 1S2CA 2ZE3A 3LGDA 5F1VA 5TBOA 3CB8A 1QO2A 5LYRA 3V0SA 4US5A 3MY9A 4LW7A 3GVQA 4GZIA 4UMBA 2Z6JA 1NVMA 3W6YA 3OA3A 1S2WA 3WZ0E 3HURA 1YXYA 2PS2A 2F6UA 1H61A 1EL3A 4RLIA 3QR1A 2WC3A 2D1ZA 4NZCA 3SUTA 1HG3A 3VNZA 3T81A 4GCAA 2NUYA 3H2OA 4RE4A 2J74A 1PTGA 2Y6ZA 3CV1A 3NSNA 1GYMA 4Q7NA 3N18A 3RO8A 3DGRA 1VPYA 2VENA 4UNIA 3BW3A 1HKKA 1PHWA 4V2XA 3UWVA 4BS0A 1TO3A 4MZYA 4HT3A 4IP5A 4IM4A 3CL6A 3PTKA 3PJXA 1PIIA 2PAJA 3BWWA 4DI9A 2XN2A 4AY7A 5AHLA 1NOWA 3LBMA 1DP0A 4DJDD 3IJ6A 4QROA 3TJXA 2TPSA 3NQFA 2A3HA 3RR4A 1UR1A 1QU4A 2IW0A 3AISA 1REQB 2C18A 3AIEA 1Q2RA 4JPGA 4Z2GA 3ZMRA 3IGXA 4L4PA 1XLJA 1UC5A 3VM7A 3OPSA 5J8LA 1JPMA 1H7NA 3L66A 3PUGA 1XUUA 3TW7A 3PWAA 5EFDA 1TPFA 4NIRA 2A0NA 6TAAA 4XD3A 4UTIA 2OQYA 1HGWA 2ANUA 5XIAA 5FAJA 3GR8A 5HDRA 4AZBA 1CXKA 4E3TA 3DN5A 2C71A 2E4TA 3N1AA 3E5BA 4NF7A 4ZBCA 4FLSA 3U7VA 3WSUA 3KBNA 3W2LA 1E0VA 3GH5A 3B4UA 4O8RA 4RZ5A 5KTLA 3BJTA 5E9XA 5FJPA 3OB8A 1ZB5A 1W1VA 3AS0A 1KM4A 3BV7A 3VI2A 4MAZA 3KP0A 4KFOA 4AB4A 4REQA 3QSRA 1GTHA 3ZJ7A 1P0BA 4UQBA 1TVLA 5ECVA 3DFHA 4AYGA 4WJEA 2O7SA 5F1UA 2DW7A 1WKYA 4ZXOA 2PGWA 3DENA 4HOWA 2WBGA 1HKMA 4ML9A 1QW7A 2WZMA 3TW6A 3M0ZA 4DBWA 4HNCA 4H01A 1RHCA 1CCWB 2Y8KA 2WVUA 4LUTA 1EKOA 4FP1A 3Q2DA 2G3FA 3UJ2A 2W63A 4MLRA 3GR4A 5CEWA 1SM9A 4U31A 3V0TA 3EKLA 2IUZA 2PTWA 4RXGA 4P7OA 2DSKA 3HU7A 3B03A 1JCYA 3P3BA 2QCCA 3AHVA 2EBNA 4YYFA 3HM7A 5HNRA 1DXIA 1Z32X 1PCWA 1QDSA 4HVXA 4LANA 4PUMA 4TR9A 3WLMA 1XLAA 3LNMA 2YBUA 1TV5A 3HOJA 4B15A 3OZYA 2A3LA 3CQKA 2XH7A 4JTHA 4IQLA 2PBGA 2AOSA 3G22A 4DNMA 1B9ZA 2WHKA 1ECQA 3HBLA 1UUMA 4GVIA 2E68A 1MI3A 4MSSA 1ZU8A 3OHIA 4JTFA 4DJEC 3XISA 3TJ4A 3PBWA 1ZAIA 3S1GA 4GBUA 2QAFA 1RH9A 1R9XA 3SGGA 1OB0A 2XZ7A 3LZ3A 4S1FA 4M82A 3H2CA 3NYZA 1XSIA 1IEQA 2HVOA 4D6JA 4BK9A 1JZ3A 3BLLA 5BYWA 1DQWA 1XBZA 3W1RA 1OFBA 2Y5SA 4CQDA 3N9SA 2WSQA 1FH8A 2R1NA 2ZX8A 2VWTA 2W67A 1KCZA 2V5KA 3H21A 1WDSA 4GKTA 3L0KA 1TCMA 4A3QA 1DJWA 4RX0A 3R12A 5A6KA 2DT2A 3ID7A 1BD0A 5IXEA 3IVUA 3MWAA 4E6MA 3VOIA 4HZ6A 3DYMA 2RFGA 3TR2A 4LV9A 3AYSA 5DCDA 1JYNA 2PCQA 4YVVA 3WL0A 4CN4A 3N9KA 3S1WA 4WCJA 3RHGA 3Q65A 4YJ5A 5AHMA 2CLIA 1KA9F 1XQKA 3T8LA 4ADUA 1B3OA 2ZICA 5CSRA 2QJHA 2UY2A 3MV11 4JTTA 1N55A 3E2RA 4UTKA 3BCDA 3VNLA 4V15A 1UC4A 3E02A 5JXQA 1JYVA 2XGBA 1RLDA 4IMAA 3OJGA 4ZFCA 1R6WA 1W17A 4UTWC 5BRBA 1D3CA 3L9CA 4N4PA 2NW0A 2V3DA 4H4IA 3I3EA 1RCQA 5HQLA 4XTDA 5U7SA 4IIDA 3THUA 3J7HA 3WQPA 1L8NA 5BXPA 5LSMA 2GVEA 4DO7A 3PUOA 2VZSA 1LJYA 1QPNA 3RJYA 1TPDA 4RDVA 4QLKA 4GI6A 2DY3A 3L2IA 1ALDA 4B92A 2H90A 3ZYZA 1XQLA 4N6FA 2V5JA 2Y70A 1AK5A 1HVXA 1O95A 4NJJA 3N17A 5KMYA 1XLEA 5CKSA 3E1F1 1KTCA 1JFXA 2J25A 3FN9A 1IZCA 3RNDA 3MKCA 4MNKA 2OZ8A 2IKJA 5H8UA 1IWBA 2DJXA 3WH7A 5A6JA 3WDIA 4NAEA 4NZFA 1O7AA 2VXNA 4GY1A 3PP7A 4Z08A 4MKNA 4ZQNA 5EBUA 3KE0A 3MP3A 3IGHX 1ADOA 3VNYA 1DOSA 1JVNA 1XCWA 3MB9A 3GZ3A 4BF5A 3C5QA 3RX3A 3GZAA 3T0AA 3GNNA 1OIMA 4R33A 1C8XA 5CBJA 2HXUA 4E8GA 2J13A 3AIBA 1JNDA 1TVNA 2AMGA 4KFPA 3BANA 2CC0A 2VD8A 1ZJIA 2PURA 3CMJA 1VD6A 5LGXA 1GGOA 3MO4A 4FA3A 1J0KA 5E93A 4KCVA 4S3KA 1KBLA 2ZXDA 5I00A 2NV9A 4CN1A 1M3UA 1FP8A 2Q3RA 2YW4A 3OLIA 1DXFA 3VYLA 3HFYA 3W02A 5AYBA 1P7TA 4WSKA 1CB2A 3KZPA 3W70A 3QY6A 4HOZA 1UR9A 1GVEA 4JTRA 2JQXA 5LIKX 3QY8A 2ZX7A 4HQVA 4AF0A 1I2RA 2G3NA 4LNYA 5DRCA 4U2ZA 2X09A 3BLFA 2FJKA 1QHPA 2BVTA 4UFKA 5F2MA 4AXNA 4F79A 3B06A 1EZWA 1JEZA 2O4QA 1RPXA 1UD4A 3LM7A 4E2VA 4W5UA 3AXXA 2F84A 3UNTA 3URNA 4PBGA 4HA1A 4M6QA 1GOKA 4QJ3B 1VBGA 4FX7A 3V5CA 4O53A 6XIAA 1CLXA 4UIOA 2H9AA 4PRWA 1M68A 3CWNA 1RJQA 1KXQA 2XM2A 2QS8A 2INZA 2ZWZA 4IG2B 4IGSA 4Z1AA 3WQVA 2YL8A 4LQ1A 2A6NA 3THCA 1GPWA 3WH5A 3ES8A 3SCNA 3W83A 2UY5A 3BC9A 1DBTA 4RE3A 3CM4A 3AU2A 3CEPA 5I02A 1LLWA 3M0YA 3NVTA 1M7OA 1RUSA 1XC6A 4Q8TA 1XI3A 3MA8A 2JEQA 1P6WA 5H1WA 3UWWA 4PA8A 1Y7VA 1TUXA 3L12A 4KPLA 3ZQ9A 5AYIA 3D6NA 3TXZA 1GKPA 3QHOA 4MY8A 3P14A 4KCTA 5G1TA 3KVMA 1YDOA 4I6VA 3WK0A 3NQ2A 1L6YA 1UWTA 3GBDA 4TV5A 3LUTA 1WPCA 2B0MA 1PE1A 4J28A 1P1MA 2PDFA 2FHBA 3AMKA 2NWRA 4R9OA 3UW6A 2QCNA 3LQLA 3VIIA 3W07A 4DM2A 2VRKA 4ICNA 4HPNA 4AVFA 4PE8A 3TTSA 4LCRA 4XZHA 4GKLA 4RNFA 2ZUNA 3ALGA 1WB0A 3G1AA 3ARRA 1C8QA 2BXYA 1ZBVA 3OO2A 3QPZA 2CZFA 3TN5A 2HZGA 4WOQA 4FXJA 1TTJA 1QBBA 4QDPA 3ORWA 3PZVA 1XM3A 4GJJA 4XUYA 4QE5A 3VIFA 2VKZG 1PX4A 3BSGA 2ISSA 2X1RA 1HKWA 2QPUA 3U57A 4F9DA 1GKRA 1SZNA 2PLMA 2W92A 1KRAC 1ISWA 5FF3A 1TPVA 1C90A 3CUJA 3VOGA 4DO5A 1B9BA 3SN1A 3AIRA 3I6TA 2QDEA 4D6CA 1VEOA 2RDXA 3UR8A 1IEVA 1ELSA 4EXBA 4NU7A 4G7FA 2D0HA 4CD8A 4ZO6A 4I7VA 4QXIA 1OADA 3CIWA 1LOQA 4KMQA 1XLFA 4WKAA 1T0OA 5ABEA 1YDNA 4RE0A 1XF0A 3Q67A 1NELA 3WD2A 2EAWA 3QR3A 4EVZA 4PTMA 1W3KA 2YYTA 4DO4A 1F4HA 2ZXAA 3BAKA 4XKYA 3G0UA 4J3SA 1UD2A 5ABHA 2PP1A 5HA7A 3QM3A 1Q66A 4RV8A 2ACQA 3PUDA 1EP1A 4C1KA 5HQMA 3URQA 7TIMA 1A5SA 2RDWA 2Z0IA 1M9HA 4Y96A 5EA9A 4REQB 1KCKA 3FS2A 2NQ9A 4LNCA 2DZWA 1UWSA 2QV5A 3IAPA 5D38A 5AC7A 4GGBA 3C52A 1TV7A 3AYVA 1DHKA 5GVJA 4HYVA 1E3ZA 1H7WA 1UBSA 2OQLA 3RLHA 1GYLA 2WNNA 2WHLA 2PDXA 3VOCA 5EL1A 1WQ5A 1VF8A 4DLMA 3IJDA 3NGFA 3GDBA 3L4TA 3TA6A 4IT1A 3HF3A 3O6YX 4JFSA 4LUTB 2OWCA 1VQTA 1ZS2A 3GD6A 1J2BA 3P67A 3GVRA 1V0KA 5DO8A 4O28A 3SCOA 3EDJA 3N4AA 1OYAA 4NZ5A 2GQ8A 1HQTA 4UR7A 2GOUA 2QCMA 3RG6A 1BXBA 1Y5XA 1XICA 2Q09A 3W38A 1XC4A 6XIMA 4FOKA 4F2TA 4D71A 2ZUVA 1N2VA 4NJKA 1FWBC 2ZX5A 1TZ7A 2BSLA 3P5YA 3WF1A 4UOZA 2DJLA 1RY0A 5CJ5A 1GWJA 1PYFA 4ACZA 2Q8LA 1OC7A 1UD5A 2ZZ4A 1AD1A 3EKZA 3MVIA 2PF8A 3I6RA 3TE9A 1X97A 3W6LA 1ZAHA 3W24A 3AUJA 4FK9A 3GU9A 4AZ5A 2BY3A 2DQWA 1OGSA 3ZLHA 4CKQA 4XVDA 4DN1A 3FAWA 1GQKA 3PZNA 1C7SA 1UR3M 4BQ4A 1MYRA 3SBFA 1KFEA 2Z24A 1W8SA 4WR3A 5C6MA 4JEQA 5G2HA 2NLYA 4Z2LA 4JX5A 1V3MA 2HE8A 3VAVA 4B5TA 4GOAA 1S5VA 4GGHA 3W1NA 2QCLA 3E0WA 2UZ9A 4GC3A 4TVUA 3S42A 1H5YA 3LGEA 3G8RA 3MJYA 1WZLA 1E0TA 5I5RA 1TG7A 2VDHA 1US3A 3LPOA 5AHNA 3DAQA 4KEMA 1PS9A 3DH7A 4AEOA 1LBLA 2V0TA 2A3BA 2E9BA 1JZ5A 5AOUA 1Z8AA 4P7NA 3NQGA 4ZL1A 4JAWA 2OSYA 3KVJA 1FWRA 1AUSL 3GHRA 2MANA 1BTCA 3EWZA 3E0FA 2GVYA 1CBGA 4ZSUA 1DWGM 1QI3A 4XX6A 3L4WA 4HK7A 5A3HA 3CO8A 2ZOXA 1JFHA 1B90A 4EK7A 3IGSA 3MMDA 4M5PA 3CIXA 2VR2A 3B9DA 3WDJA 4P8WA 2O9OA 3ATZA 2WZHA 3FJLA 3ITYA 3MI3A 3CH0A 1MW3A 3PWGA 4Q8PA 1UR0A 4TX6A 1MUWA 2W3ZA 4M3PA 4B5VA 4LFYA 3GNDA 4FNRA 4FNPA 4Q8NA 4MWAC 3WQEA 4TUFA 5EU9A 3C0LA 4N9CA 4GYFA 2O92A 3MQTA 5CC7A 4I7WA 1MQRA 1UKTA 2ZZ5A 1G1YA 3P5ZA 3ABQA 4UFJA 2WMGA 5BOFA 3ITCA 1GZ1A 3AMLA 5FOOA 3ITLA 1SFJA 2E77A 2YBTA 4UNLA 2EJ1A 2NX1A 4GQGA 4IP7A 2ZDSA 2JKAA 1B57A 2G3MA 1LL6A 2CBVA 3FEMA 3UYCA 2J6VA 5JH2A 3MVTA 4NAEB 2Q71A 4OJYA 3UJSA 3WN6A 3QHNA 2PLCA 4D72A 4UFLA 3SSZA 3MZ2A 4IMFA 4S3FA 1CB7B 4YTQA 1BG9A 1HNYA 3LLDA 3QQWA 4MYAA 2GWGA 4KEUA 5LNWA 3VXGA 1G4PA 4GUHA 5GJNA 1A5CA 4UXDA 1A3WA 1VC4A 4B5UA 2EF9A 2XFRA 2SFPA 3S5NA 3AYRA 3QOMA 4CD7A 2Z29A 3W29A 4OQVA 4M29A 5FF4A 3I65A 1GVQA 3E38A 3GE7A 2H3BA 3RU8X 1XINA 3WLRA 1JF5A 3ZVHA 2EPMX 1D8CA 1VR6A 2ACUA 8TIMA 1C9WA 3MP4A 2DFAA 2QVNA 4UFMA 1QNVA 1P7TB 3GH4A 4HP5A 3S5OA 3C61A 4PUNA 4B9ZA 3SAZA 5T9CE 4B5WA 5M2FX 4ZE5A 4H2CA 3K4DA 4HIBA 4AF0B 3BXWA 1GNXA 1MW2A 3IIXA 1EQCA 2BY1A 3VCCA 3EXSA 3H53A 2CIPA 3V7PA 2Z7KA 3C2VA 1P0DA 3WNKA 1O94A 3EOLA 3EPOA 4J2PA 1NU5A 5BW6A 4UUIA 2BASA 1JD7A 3U5UA 4R53A 2QHAA 1GK8A 4X9SA 1FWCC 3DCPA 2ZX6A 3PNZA 1SQ7A 5DANA 1KM6A 2GGEA 1K3UA 2H9AB 4UTHA 3NXLA 4BI5A 5D09A 3N15A 1Q6EA 1VH7A 3VX1A 4ZQMA 4AD1A 1KTNA 4H2HA 1T5AA 2WK2A 1MW0A 1Q6LA 4AZ7A 3A3WA 4F4RA 3EWBX 3PN8A 2VFFA 3UF9A 1RY8A 4AX7A 1VHNA 1JCTA 2IPFA 1XLHA 5C9ZA 1U30A 1H0GA 1EA0A 3G1HA 1GJPA 2P0OA 2GUUA 3Q58A 1KR1A 2GL5A 8A3HA 4I9AA 2QPSA 3GXFA 4HZ8A 1AZ1A 3SSJA 2C79A 3CV6A 1GQNA 1KM5A 4HSHA 4L56A 4RPQA 1ZUAX 1WAWA 3S1XA 3LXAA 2GVGA 4W4QA 1Z7AA 2OVLA 2VX4A 5LNUA 4HYRA 3RITA 1T40A 2IQTA 2YBVA 1K7EA 1W5PA 3SADA 4LUIA 4Z2HA 5I24A 5PTDA 1KQZA 1XLKA 3KOZA 3HQNA 2E1WA 1KBBA 4LYKA 4K8EA 4IUGA 2J7BA 1OT2A 4HSOA 3ZWTA 3BTNA 4MDOA 4NAFA 1XHGA 3VVGA 5BMXA 1QNSA 2FGLA 5HATA 3LHTA 5BXTA 2VQTA 4JDBA 3RIKA 5E70A 5EY5A 1DV7A 4QQUA 3PB0A 5U4NA 4QJ1A 4QNEA 4WDUA 2D24A 4Q7IA 3TZFA 4GIEA 1UJQA 4PRTA 3GNXA 2FZNA 2HWGA 4AHOA 1EF2A 1S3HA 1N8WA 4RZ6A 1E5JA 3NXFA 3L0NA 1H63A 3C0QA 5IFTA 4G8TA 3TJIA 1A4MA 2X1SA 3KVLA 4XWUA 3GAYA 4V1YA 2ESCA 4B3KA 1XIMA 3NG3A 2NVAA 4XKYB 4ZVJA 2EHHA 5E1QA 3EX3A 2OT0A 4NASA 5EBAA 4R7OA 2VFEA 5ECUA 1W6TA 1PZ0A 1GKQA 4INFA 3MCNA 3QMRA 3BCJA 3VINA 1WDDA 2C0HA 1DWFM 5FSEC 1T41A 1O4UA 2YCKX 2DVTA 1OYBA 4LEQA 4WUIA 5XINA 3LHVA 3CAQA 5A2CA 2TRSA 1EPVA 1NAL1 3KOFA 3RPTA 3RN6A 3WNNA 1PIFA 3DECA 1I60A 1BG4A 1BXCA 3SZ8A 4LBSA 5D8WA 5H91A 3DFQA 3CQ0A 3SCWA 2XU2A 3WEOA 4O12A 1A50A 4PUEA 3WUEA 3THQA 3AHZA 2W27A 4LBRA 5L6UA 1TX2A 2GJNA 4D6IA 3PJWA 1W3IA 1HL8A 2AMXA 3STCA 4HNNA 3ZT6A 5TAOA 1JGIA 1GHSA 1TV8A 2HBXA 4NT0A 2IKHA 1ECEA 5C2GA 5HBFA 4FAMA 2Y8UA 4W8LA 4D6EA 3M9YA 4PZVA 3BG5A 1D9EA 4UTUA 4CEUC 5I3KA 1HUVA 3MTWA 3CZLA 2QPXA 1O6IA 3CZEA 4KKXA 3ZLFA 5ENLA 2GPTA 3DFTA 1TE1A 4Q4MA 3T0CA 3VDCA 1HL9A 4ACZB 2ZXQA 3VZXA 2DZBA 2PTDA 4DWSA 1XGEA 1D7FA 5LNSA 1SMDA 4HA0A 4WXZA 1UOKA 3KTCA 1VBHA 4JTSA 1ZJAA 4B91A 3V5FA 4UQCA 3GTHA 1KB3A 2NT1A 1YRRA 4XB3A 4HBKA 1PZ3A 2YW3A 3VKJA 1N8IA 2R1PA 2O55A 2OG9A 1HJWA 1T8QA 1UP2A 3R8GA 1E72M 1BQCA 4QFUA 1IXQA 3N13A 1W1YA 2W6RA 1NJJA 1X1ZA 4H8VA 4BI7A 3DKJA 4JR5A 3FAXA 4W87A 5CGQA 4PMOA 4KEVA 2BMBA 4AD2A 3P7YA 1GTEA 1JR1A 4AXKA 3WQ6A 2I56A 3QEZA 5MHBA 3SUUA 1BSIA 3VKBA 3CC1A 1QJWA 3NQ8A 4X2RA 1OM0A 4A4AA 3SRKA 3VC5A 4DRSA 1O66A 1NDWA 1E6PA 3WLNA 2XUCA 4DWSD 4NUWA 4MB4A 3WJZA 3HPFA 1LUCA 1QT1A 3DC8A 1R0MA 4AQLA 2RDTA 3WMSA 3GXIA 4XAYA 2GDUA 5SWUA 3M0HA 5DN1A 2QCEA 3FSTA 1MNZA 4DBUA 2A4AA 1IIHA 3M43A 4DPPA 4V28A 1DWHM 3TVAA 1J0HA 1XLCA 2PTZA 1W31A 4NRRA 1NH6A 1GOOA 1IE7C 2HRWA 4URIA 2DP3A 3TOPA 1V6WA 4IPPA 3LS9A 2WV8A 3MO7A 2OKTA 4C1NA 1J6OA 2DT3A 4AZIA 1V3IA 2HCVA 2QJGA 5C2XA 2DQXA 2J7DA 1M01A 2OMAA 4YPJA 3HZ3A 3PVFA 4PTXA 3M46A 3NQMA 5HJXA 4Z1BA 4TX9A 3M6DA 3OLGA 1TCDA 4HN8A 3BZJA 3GW0A 3WBWA 1SFLA 3V3WA 1W5QA 1PUDA 3T08A 1Q3NA 2EO7A 3W1MA 1GPFA 3C0SA 4I9JA 1LT7A 2FGBA 3CASA 4P7LA 3KHDA 3GXNA 2ZCGA 3TTEA 3NEVA 1G4TA 2UV8G 2QQ6A 1F76A 1XH2A 1PVNA 3WDPP 1RVKA 2P0IA 2CERA 3WUBA 1JDEA 4JTCA 1FWFC 3W6MA 1PBGA 3VU2A 4PCSA 3SFKA 2CHOA 4ZB0A 1J12A 2Z4GA 3STPA 1XRFA 3AUOA 3N2TA 4PCNA 1HVQA 4JNMA 4XZIA 4E2OA 2VEMA 4XAFA 2BOFX 1CW2A 1B3YA 3BICA 4YTTA 4MLJA 4O52A 1FVPA 2HROA 2V8ZA 3PTMA 3SECA 2DH3A 4HZ7A 3PTDA 4HU4A 1OT1A 1AW1A 3CT7A 2E3ZA 3ZVHB 4EF9A 1J96A 4AMAA 3EDFA 2ZA2A 5C5YA 2QIIA 4MUPA 2D3NA 1FBAA 1NQKA 4JTJA 2ACSA 5E6YA 3UCQA 2ZA3A 2FDSA 1CXIA 1JDCA 3CXOA 1EWDA 3VD7A 3M7WA 1M6JA 3O3RA 4CCZA 2D23A 1UA7A 1QOPA 1TWZA 4JN6A 5EYWA 3D3FA 2W9MA 1MDLA 2Y62A 1ZRQA 5BNKA 3GNOA 3MANA 4G5DA 2RJHA 4AZGA 4IIFA 4MB1A 4MWAE 4U5KA 3PBVA 1W1A1 3WK3A 4A8LA 3EA1A 3WLIA 3QZEA 3M0KA 3WQCA 4W8AA 2C1IA 1IXNA 1MEIA 3CK5A 3MSRA 4LU0A 1SPQA 4E4PA 4KIEA 1EPXA 3VIOA 4U28A 1LZOA 3QRHA 5G2WA 3BOXA 3SCPA 2C14A 4IICA 1DJZA 1UOZA 3R11A 2JK2A 4Q4RA 1CT5A 1OG0A 4G56A 2IXUA 1TQJA 3ZM8A 4JFVA 3H7UA 2IQDA 4BEUA 3ZWSA 1VJZA 3M16A 1GUVA 4OTKA 4UTJA 4GC4A 3AROA 1FCQA 1UMLA 5CBIA 3BVJA 3M5XA 1FWNA 4YVPA 1W3HA 1E73M 5DY3A 4EP8C 4MDPA 3NQDA 3RMEA 1UPMB 1EGVA 2Z28A 4PYSA 1LT8A 5D2VA 4HNUA 3SQMA 4KERA 3KTXA 1ZBKA 3H4XA 4O8AA 3LPGA 4Q8QA 4JCMA 3QHMA 2IMRA 3FJ4A 3N11A 4PRRA 3DFOA 3FA3A 2W79A 4XD5A 5GNXA 2WJZA 4NX5A 2VMFA 3GTXA 1K77A 1AZ2A 5FF2A 3FY1A 3XINA 3TQVA 2XN1A 5DFAA 5G1YA 3TC6A 4HA4A 3FJNA 1Q85A 4G1NA 2OEJA 4HCLA 5A8PA 2PC4A 1FOBA 3F4WA 4BJHA 1RP9A 3SB0A 2WZIA 4P7RA 1ZBCA 4GO8A 3SEPA 1EHAA 4LRSA 4PMRA 2ADAA 5LXXA 1O5XA 4HU3A 3OGRA 3AZRA 4NVTA 1A0CA 1J0IA 1I2NA 4PUKA 4UTLA 1JAKA 3PBMA 2PA6A 4LX4A 4WHBA 4FX8A 3ZO9A 1GVIA 3LSBA 4ATWA 5E5CA 3RLVA 2NQLA 5M5DA 1VENA 4C6MA 3LOTA 1F3TA 1U2YA 4TTGA 1JYWA 3T0TA 2OOGA 1J2WA 4M56A 1FCUA 2H6RA 3EGJA 4TTUA 4HCHA 4GI8A 3QYQA 2G97A 3M0VA 3UA3A 1RCXB 1EA9C 1S3TC 3HPSA 4ATLA 3VDAA 3P0XA 2VZOA 3THDA 1MZHA 4XK2A 2XVPA 1U5VA 3LENA 4DXKA 1X7IA 1PKYA 4GYPA 3C2EA 1PHQA 3O9NA 4WKHA 4Z0SA 5GPRA 1WXYA 1KFBA 4AVNA 1BWLA 3VNJA 4ADTA 2CYGA 4IJRA 1A5MC 1UZ1A 1NDYA 1DWAM 4IH3A 1V3KA 1XG3A 4LRTA 1SFSA 3K46A 1DKWA 2J79A 5FJRA 3AWNA 3CTTA 5I79A 2X42A 3S47A 5KINA 1WE5A 1JNEA 9XIAA 7XIMA 3IV8A 1ML1A 4ADSA 5HULA 4LSBA 4Y8FA 4A29A 4KRZA 3EX4A 4W93A 4N9BA 1UKPA 2BVDA 2CZDA 1WXZA 7ENLA 1WKDA 5D9PA 1V6UA 1V93A 2CLFA 3R4IA 3WK1A 2J8FA 2VT0A 2ALRA 3NJ3A 1LM1A 3H6OA 2CBJA 3T0BA 1WOAA 3WJWA 3LGGA 2X0HA 4M6PA 4ATDA 1OX5A 2XVKA 2PE4A 6A3HA 1BSLA 2IPWA 4DWSB 1V3HA 1YNYA 1YPFA 4QHRA 3CS2A 3EXTA 3CO4A 2GGIA 4GVHA 5CQ1A 4PMQA 3LLXA 2PTXA 2XM1A 3PZGA 5LA1A 2E1DA 1UPPA 5EGRA 3HQ1A 3T8QA 4GABA 5DCBA 1R3QA 3EPMA 3K5XA 1Q8JA 1E0WA 2Y89A 1CEOA 1W56A 3AOFA 2BHYA 3OYXA 4MTVA 3TFXA 3T05A 3IK4A 5KITA 1SJCA 4H41A 3H7RA 1QNPA 3QQ1A 4J7RA 2ZRVA 2VFDA 4IX2A 5BWAA 2GVLA 2CITA 1ZBWA 2PDNA 5CZJA 3WY1A 3NPWA 4C6BA 4H7ZA 2XSBA 3R5EA 4X9YA 3SRDA 1WZMA 2WXDM 4KBXA 4JOMA 3NM3A 3W37A 7TAAA 3O6CA 4R34A 3TIMA 1BLIA 4LAUA 3ARUA 1LUCB 2PUZA 3WBYA 3POHA 1J01A 1OGGA 2WQPA 4Z1YA 2HK0A 3IUDA 1DL3A 4C90A 4TQTA 4QJ5B 3USBA 4ALDA 5AC4A 1QUMA 4GQRA 3R7MA 4PEKA 2VUYA 4HU0A 3N12A 4CQ8A 3P8JA 1XXXA 2GQAA 1V5XA 4LOCA 4TU1A 3HG2A 4X63A 3DKLA 2R94A 4S2CA 1TTIA 5I06A 4C1NB 2HV5A 3UJRA 3PZIA 4JCLA 3WNLA 3A22A 3E0LA 1TPB1 4ZB5A 3C2RA 4AWSA 4Y90A 1RQHA 1XISA 1WP6A 3AIQA 1TJ2A 3QZ6A 3RX2A 5C71A 2DORA 2V81A 4NNBA 3LEPA 3PJTA 3W7NA 3T2PA 3WO8A 3W7MA 3H54A 5DQPA 2HBVA 4RDWA 3ABOA 3LXBA 3M0XA 3CHVA 1JCJA 1MXGA 3KL5A 1N7KA 2J7CA 2GJRA 3P61A 2Q6ZA 2WJDA 3R94A 3C0JA 1O68A 1I4NA 4KRTA 4J1OA 1MXDA 1FWTA 2CLEA 5HWNA 3IIOA 2G37A 2PF0A 3BJSA 3IRDA 3WLTA 7A3HA 3VX0A 2WYSA 5I03A 3ME3A 5I3GA 4FLRA 1PKMA 1VAHA 1QNQA 4DZ5A 3TV8A 1HFBA 2Z6IA 2ZXBA 4QDWA 1SJDA 3P80A 5IRPA 2G8ZA 5E0KA 4Q4OA 4DAFA 1HN1A 3HN3A 1YTKA 1IIGA 3N9RA 4HTYA 4N2YA 4YLWA 4OBRA 3C8NA 4N02A 2YKKA 1G7UA 1J5TA 2FH6A 2OO0A 3S2NA 4F0RA 5C54A 3TKFA 3UPBA 1QI4A 1M7PA 4UFIA 5C7HA 2PODA 1XIBA 1M65A 3ZZ1A 1I8JA 1E6XM 2XWDA 1VB9A 3TJLA 4AHPA 3GM8A 3TWBA 4DYKA 3GKFA 4W88A 5D9OA 2YDRA 3EAUA 1DVJA 3EMCA 3W22A 2WC7A 1E70M 2OT1A 1KV5A 2OEKA 3OEXA 3R2GA 3C8FA 1HF6A 1SSGA 4C6DA 4H3DA 4A3UA 5A6SA 3OVGA 4S23A 4C60A 1EXBA 1LWJA 2BHZA 4YIWA 4GZJA 4UTFA 3MDUA 4GA8A 3T55A 2BHUA 3SIMA 3ZJ8A 2OX4A 1AW5A 4RUBA 3TTYA 5CPQA 1NDZA 3VCRA 4WKFA 1WKFA 1WZAA 1KXTA 4OECA 3QVQA 5T26A 3BMWA 4M6VA 2GLKA 4GJIA 1ONXA 3K30A 4NG3A 1A4LA 2DW6A 3B97A 3SCTA 4G2DA 1JXKA 1POJA 3LDVA 1GW1A 3WK2A 4RE2A 4LYQA 3UNDA 4RNJA 1XCFA 5A95A 3HIJA 4IP4A 2F38A 3H2MA 1W1B1 2Z2AA 3VIPA 2VCAA 2REQA 4CCDA 3TWAA 4G7EA 1G67A 2I17A 3O7UA 4K3ZA 3KHJA 3E0VA 4HOXA 3CBWA 2VDGA 1YXCA 1AH0A 2RHGA 2PB1A 3GK0A 4B2DA 4CLMA 4LVDA 1OIFA 3WQDA 2VEFA 3S9ZA 3GS6A 6REQA 1EHNA 1NOFA 4Q8VA 2E28A 2P3ZA 4TVDA 1YNQA 2LLEA 3OGSA 5EFFA 3RUBL 2E67A 2ZC1A 3M5VA 1KC7A 3WH9A 1U22A 4H9ZA 4XISA 2VR5A 1UH2A 3TYBA 1DTNA 4C6FA 3WL1A 3WNMA 4IJBA 2E7FA 4FF5A 4QG8A 3WF4A 1XSJA 5E0CA 1AMKA 1CTNA 4M51A 3NA8A 4C5ZA 2NXHA 3QH2A 5GNZA 3APGA 2C13A 3AZSA 4PEEA 2WLYA 4OFCA 4DHGA 1H50A 3KDNA 2WWDA 1GT8A 1WNOA 2R8WA 3CWHA 4AEEA 2WLZA 3KS6A 1XP3A 4JHMA 1OY0A 1XDLA 1GEQA 2WZEA 4B2DD 5D2TA 3S9IA 5B7YA 1DIKA 2P3EA 3RYSA 3PSVA 2J88A 3VKAA 1Z44A 2WVTA 3TN6A 4KRUA 4FXFA 2YB4A 3A6OA 2D2OA 1VCFA 4LB4A 3EWDA 4J3ZA 5M3WA 1F8MA 3PFRA 5C9UA 3M44A 2ZYFA 1QWGA 1K70A 1BEUA 2ZZ2A 2YR1A 2F7FA 5T9BG 1VBRA 2PDCA 5GJPA 2VVSA 5CC5A 1UYQA 3GDTA 1Q6DA 2QZRA 1C9DA 2XH0A 1S39A 3NDOA 1WX0A 1W2VA 4F8XA 1J0YA 1PEZA 1R3VA 3SURA 1UB3A 3BMXA 1UZDA 1VIWA 2D69A 2G4FA 1QNOA 1S5WA 5GNYA 2EGZA 2ATMA 1BGGA 2QGYA 3E6EA 1ITQA 1KBKA 5K4ZA 3IUIA 1OJXA 2XDFA 3AI0A 5M1TA 2BLEA 1RZMA 3PJUA 2VEIA 1QPOA 4E4FA 3VIMA 5A8GA 3U9IA 5AFDA 3I3DA 2QMKA 4A8NA 2ISVA 3DFNA 4LY8A 1ZP4A 2C16A 2J8TA 2P76A 6TIMA 3M1ZA 3ZVIA 3NQ7A 1XLMA 3IIZA 3W7OA 4FIRA 4D1IA 2KAUC 2PWVA 3FEQA 4P5UA 1JUKA 5RUBA 5AC6A 1K7FA 2G50A 3GB6A 3MHFA 4C6CA 5EMYA 3WD3A 4IMGA 1XD0A 3CV2A 2WM1A 3S4TA 1VCVA 1DHPA 2C7FA 2PDQA 2YCEA 3CAKA 1OC5A 3O6AA 4BHYA 1VLIA 3PG8A 3WLQA 4EAMA 3M47A 1FY6A 4MYXA 3AHXA 2E6FA 1U33A 5CBBA 3TN3A 4Q8WA 3ZJ6A 1OZMA 1E9IA 1Q63A 3W1PA 4NRSA 2NQHA 4PSPA 2XIQA 4D6FA 1EYEA 1E51A 2XIOA 1WOBA 3OOQA 3QTGA 4RV3A 3WYZA 4PL2A 4S3DA 2F8QA 4QEEA 4D1JA 1CWYA 4KH2A 2EPLX 3RF9A 4J3UA 1E56A 1RK6A 1G6CA 3W1QA 1KWKA 1AJ2A 4RK8A 1SZEA 2OLSA 2J7FA 1FFQA 3CWOX 4YWIA 2OLAA 4Z1DA 2XN0A 3VK5A 2JBMA 3H2NA 5IBXC 3WJYA 2EKCA 3ICJA 1UW9A 3AXMA 3HMCA 1CNVA 1S5TA 3GUWA 5CPOA 5FCZA 4ZCWA 2BOGX 1UQZA 5FJUA 4J3VA 2HNEA 5FESA 4KIRA 5TIMA 3A12A 3N14A 1H4PA 3GG0A 4X22A 3VPLA 2ZUWA 3BLOA 4PTWA 1JCMP 2WWCA 4W85A 2J66A 4H9TA 3URBA 1BWVA 4U3AA 2V69A 3WLSA 1F74A 3WELA 3PNUA 1XIGA 1OBAA 4ZODA 4JTIA 1OK4A 2CCRA 3HO8A 3UVIA 3SUVA 2FFCA 1V0MA 1UWAA 2J7EA 1M04A 3OQ8A 4CD5A 3NFUA 4RDZA 4LVBA 4HMDA 4B16A 3LRKA 5HWJA 5CC3A 4I8DA 4O13A 3SR7A 2HS6A 4GG9A 3PF3A 5E9AA 3RMJA 3AO0A 3NM1A 1DJIA 1UASA 1C92A 3UCCA 3IJ8A 2ZUSA 2WANA 5I07A 3E96A 1EDGA 4LWWA 1FHDA 4UQEA 3MUIA 3ABXA 3LY0A 1VRDA 2IPJA 2YZ5A 2E8YA 4C5YA 2ZWYA 3S5ZA 4C1LA 2ON3A 3EXRA 4GY7A 4M24A 4DY1A 3IS4A 4CNOA 3E5PA 1J93A 4EPBC 5D30A 1X6NA 4QG6A 1LQ0A 4GYKA 1UBPC 1VEPA 5DX7A 3QW4B 3BO9A 3TQPA 1A47A 2XHYA 3GVVA 1AW2A 3N04A 2XTKA 2J4GA 3EB3A 3FK4A 1FHUA 1UIOA 3NEHA 2I57A 4F2BA 3O0FA 4GIAA 4K38A 3T2OA 1A3XA 1RBAA 2J7GA 3DHUA 5AVHA 1TMHA 4K8GA 2QAPA 2GGGA 3VD5A 3VMNA 4ZTXA 4BQ3A 4ZEPA 5ABFA 4O17A 2DZTA 3V1PA 2FVKA 2VFHA 1EDQA 3NZQA 3W76A 1E4MM 3EB2A 3A23A 1V0LA 4EACA 3QMSA 1XYMA 4QAIA 4DJFC 1OD0A 1I1XA 4FS9A 2NLIA 1O1HA 1JIBA 2YPIA 2OWWA 1LWHA 1VFUA 4J27A 2JKPA 4R85A 4LF1A 4MNLA 5AY7A 2PDHA 4BWLC 4EPKA 3WLOA 3IANA 3MCMA 3EMZA 3SRFA 2C15A 3TAOA 3B4YA 3GIPA 1NFPA 4WXYA 2VM8A 4S3BA 3NQAA 2ZRZA 4UTTA 2WNQA 5HMEA 1RPKA 3U5YA 3WFLA 4UFHA 4B90A 5XIMA 4QP0A 1GYNA 3QYSA 3H70A 3LXCA 1ZALA 4J3TA 5I7GA 3HG5A 3UXIA 1D7KA 3GU2A 1XPYA 5D02A 3VOFA 1FWWA 1NF7A 2DT1A 2P8CA 5HMDA 3W7KA 2VNCA 3ZJKA 2REQB 3ARSA 3W2UA 1LYXA 2Z1SA 1DQUA 4G7EB 3NSXA 2WCSA 3KUMA 5EMJA 4DJDA 5B7ZA 3VNDA 1E6SM 3MUY1 1K4GA 5D9MA 5FJIA 1JJKA 4NKCA 2GVJA 5K2ZA 6REQB 2X05A 5CGTA 3EWCA 4F3HA 3CUHA 1A49A 4U33A 3AHTA 1E1EA 3B8IA 4W7VA 1QRQA 3VE7A 4DVOA 3HTWA 3WDHA 1LOSA 1E5NA 4YNGA 4NZJA 3DFPA 2QJIA 4ZENA 4DXXA 2BGNE 3G6LA 2PPGA 1YADA 4FNUA 4Q4PA 3M5YA 1ME7A 4BI6A 5B80A 3L5AA 1VPQA 3NZ1A 4GE8A 1J4EA 2V5LA 1ZGDA 4D6HA 2GJPA 2ZDRA 4O1EA 2BS9A 3H4WA 5A6TC 3NWRA 3DI1A 1XRTA 2VEGA 4B3ZA 4CVUA 1FKXA 4B4HA 4QAWA 4ROPA 2Q8XA 1S5NA 4N9DA 4YCPA 4C7GA 3TQ0A 3QMTA 4GUIA 1JPHA 1W1IE 2CPUA 1ONRA 3HGOA 3PY2A 3BV4A 1MW1A 2A85A 3OVRA 5CJNA 4M1RA 1ISZA 2FKPA 1SO4A 3W7CA 1GOQA 3WENA 4KT2A 3SJ3A 1Q6OA 4BQ5A 4QDMA 1UJPA 4IX0A 4JZ5A 4NL1A 4WOZA 3TU9A 1QBAA 2QDHA 4O0ZA 1M41A 4WF7A 2WZTA 3LRLA 1GJWA 1PKLA 3KCOA 4GNVA 5FEWA 1K1DA 1SVDA 1RQEA 3U3HA 4A8RA 3VD3A 4S3EA 2DIKA 2ATSA 1ZSXA 4TXEA 3BURA 5HPCA 1EJTC 2OSXA 2G96A 3CMFA 1XIDA 1OX6A 1HJUA 1EIBA 3R10A 5LNRA 3W1UA 3O05A 2J8GA 1QVBA 3STFA 3B40A 3UA4A 1VYPX 4JNZA 1ZY9A 4DAIA 3GG8A 1RJPA 3IARA 1SO6A 2ZZ6A 3PBGA 4IL2A 1YTDA 3LPPA 4OVXA 2PC8A 2POTA 2OZ0A 2PWDA 3S2MA 1ZCCA 3VABA 3CUFA 4GYPC 2HPMA 3L23A 1RLCL 3K8MA 3ISIX 4JTLA 2ZFAA 4GI4A 4P61A 1C7TA 5MF5A 4YTSA 2JGQA 4NXSA 5IFPA 2CNCA 4C65A 4CNSA 4L1GA 1FH7A 1DWJM 3NDYA 3WKZA 2GFTA 1OZQA 3E3HA 4FIQA 4C6EA 3IWPA 3R13A 2ISWA 1JQVA 1EIXA 1KBJA 1R7OA 4QG9A 1I0BA 1SFTA 4DJEA 3RPDA 5JBFA 1THFD 5KZMA 3TNOA 2BOEX 3WBEA 1Q65A 3WEMA 2I1OA 4ZR8A 3ZT7A 4JTAA 3O1NA 4DNHA 4M80A 3UY8A 5LHFA 1KW1A 3BLIA 1FCVA 1O60A 1OFQA 1JXJA 4AMCA 3B8WA 3ANYA 1K9TA 4V27A 2RAGA 3MSYA 4GISA 1E0UA 1OSEA 2VEKA 3UCDA 1FDYA 3T7VA 1O1ZA 1OCQA 4DM1A 1X6LA 4B9YA 3RCYA 3STEA 4Y2WA 3QY7A 1V03A 2VL4A 4WDTA 2RJGA 2VGIA 1F6YA 1F8IA 3WQ5A 3NDZA 1O12A 3VDHA 3QLDA 3K1GA 5CPSA 2XIBA 4HA3A 3RGTA 3W73A 4J3WA 3BK0A 4OIFA 4Q22A 2PGEA 3TAKA 3ARQA 2VHLA 1FKWA 4FEZA 3T4CA 1KWGA 3S9YA 2QMJA 2PWEA 1ZZMA 4DJED 5JBDA 1JCXA 4MY1A 1XW8A 3NCOA 4PMXA 2G3JA 1PZ2A 3QC0A 1QTWA 1EGMA 3QXBA 4N42A 1H5VA 2ZRXA 3M5ZA 1K9EA 1JCNA 1CLKA 2RUSA 4D9PA 1JULA 1E6RA 1CXHA 2VOTA 3LZ5A 2VFIA 1PIGA 3FXGA 1E9LA 2HEJA 4CNPA 4DELA 4DUWA 4XV0A 2NSOA 1V7AA 1NIUA 5JBEA 2BG5A 4W89A 2CWXA 3OVQA 5FKYA 4UOJA 2VTFA 3N34A 4C91A 4NZ1A 1VFTA 2WVVA 1PSCA 3WQFA 3I3BA 3IJIA 1ISVA 4LGXA 3MYPA 3ABSA 1MO0A 1P5BA 1U1UA 3S8HA 4TVCA 1RV8A 3IRSA 3KRSA 5AC5A 1SR9A 4RCXA 1FWIC 1POKA 2I14A 2V30A 2YA1A 1FDZA 5A6AA 3MUZ1 2ZQ0A 2D2HA 3AU6A 1S2VA 4IGHA 2EQDA 3B0PA 3MUCA 4EAYA 2UBPC 3N3TA 1UZ4A 3SUWA 4RXFA 3QLLA 4RL3A 2XFYA 3FA5A 4I9TA 2NZLA 1W1TA 4HMEA 2DZSA 1TFVA 3PANA 2PD9A 2QUNA 3NOEA 2PGRA 3DFYA 2X0SA 1KFLA 2YZRA 3KBSA 1K8CA 4IISA 5D05A 2VO5A 3V18A 1ZJBA 1UUQA 2X2GA 4BY3A 3RLUA 1XJBA 2YLAA 4O15A 5FJTA 2KX9A 4N0RA 4A2RA 5CJMA 1UKSA 4J40A 4QJ4B 4ZOCA 5K9CA 2MUCA 1VBUA 4GBDA 3RLGA 1NOUA 1PTAA 4X60A 2TSYA 4FR1A 3EX1A 2A6LA 3O0KA 4O50A 2EG8A 3NURA 4FPSA 2PP3A 1XYAA 3WIJA 4PB4A 5LIYX 5FL0A 4FX6M 1C29A 4TX8A 4MZ8A 4AG0A 5DBUA 3MBDA 4D8ZA 1XWYA 3KRZA 2WC4A 5ABFB 1GORA 4K37A 2EPKX 4KF1A 1UA3A 1YW1A 3BL3A 2X8RA 4WQ6A 3PZMA 3LI0A 4C6LA 1VFOA 2HSAA 3TFCA 1XH0A 1LWIA 3FHQA 3CYVA 3ITOA 1T96A 1UR2A 3GYCA 3OLEA 4ILSA 1BPLB 5HJLA 1A5UA 5F7UA 2ZTJA 3UPMA 1Z41A 4P2VA 3CTLA 3WLLA 4OHQA 1UWQA 5IDIA 3GTIA 3AJXA 2WCAA 2R91A 3W1TA 3W2NA 3FDGA 3B04A 2R24A 2W62A 4EPDC 2AL1A 1MEHA 1W1ZA 1LF1A 1US2A 2PDPA 4DIAA 4IGNA 4U3CA 4XD6A 1TZ9A 1AL8A 4EXQA 5FEZA 4H00A 3UY7A 2OYMA 1IGSA 1RSCA 2AL2B 2WSKA 4CVWA 2PWHA 4GWEA 1TQXA 3RK8A 1T6MA 4L64A 1JG9A 3L4VA 3R43A 1IHIA 2BFGA 4R7WA 1TELA 3PG9A 3HJZA 4AU0A 1WCGA 1TE6A 4LV4A 3P84A 3VKKA 1EOKA 3RPMA 2VZUA 1QASA 3L4XA 2FPVA 4JNYA 4B4FA 4H7VA 5CPLA 4HNLA 4AFYA 1ICSA 1QK2A 4O57A 3RAOA 5H8PA 1LQAA 4PH6A 4CNUA 2YOCA 1M1BA 4H6QA 1JDDA 3G24A 3AWOA 1OK6A 1OCBA 2ZA1A 3FLUA 4AD4A 3JW7A 1YLVA 3GDMA 5BMWA 3U8GA 1QATA 3KFTA 4YXGA 3MDWA 1L8PA 6CGTA 3W7HA 1W5NA 1J8VA 1KGUA 1B4KA 3ES7A 3GNRA 4K8HA 2WMJA 3MT1A 2QCGA 3R6IA 2OPJA 1JL8A 3VNIA 1S46A 4UR8A 1IEXA 3WUGA 5L9FA 4FNSA 3USZA 1UP3A 3TCSA 2CFFA 3CMGA 2BZNA 2Z00A 4A2SA 4LB3A 5K9DA 3QKEA 3UR2A 2FH8A 3ITGA 4UOQA 3SQLA 4R9XA 1GVYA 1G69A 2HE5A 4JL1A 3CZKA 3OP2A 1AL7A 1CIUA 2AGKA 4S3GA 5FF0A 5BU6A 3KBVA 3DU0A 4PSRA 3F2DA 3HQPA 1VBJA 1S38A 4TV6A 4DEFA 3P2VA 3TDFA 3B8TA 1QCWA 2PDMA 3DG6A 4PC8A 1SU5A 1HL2A 2XISA 2WMKA 3L5MA 2W4XA 1FCBA 2BNJA 1V79A 3URAA 4H6RA 2CXGA 3LMZA 3IJLA 3KVKA 1YPXA 4A3RA 3CUGA 3FJ6A 3UETA 1IZKA 3CAVA 3FGCA 1G94A 3OBEA 2ZUMA 3UZWA 4CEXC 4R27A 2WW5A 1LRTA 3FKRA 2HNHA 1IT0A 2E5CA 2CETA 4UMAA 2AGTA 2A3AA 2OLHA 2VJXA 4E2BA 2PDUA 3G1VA 3HB9A 1LTDA 3D5HA 2QGHA 2ZX9A 3LTYA 1PB0A 2Z1BA 5CSUA 3K2GA 1G4SA 1YEYA 3A4JA 2D22A 1CZ1A 1NARA 3A24A 1XYFA 3AMGA 4HTBA 3I6EA 2E8ZA 5HNTA 1RJRA 3UBPC 2I9UA 1ICQA 5I3FA 1S1PA 1CLVA 4BQ2A 3KOXA 1PXGA 4DUVA 3II1A 2VOMA 2NV1A 2XVLA 4HPXA 1U1JA 3KRBA 5HWMA 4JN7A 1KFKA 3Q45A 1W2PA 4LPCA 1EX5A 1WBJA 3MKVA 4LYPA 3CHFA 4K1WA 4O10A 3BCFA 3VZYA 1SSDA 1I6NA 1MRAA 4AIBA 1ICPA 3SCRA 2FDMA 2EPNA 3IACA 4UTMA 2P1FA 1VPXA 4FR6A 5FAGA 1VFFA 1XPGA 1D3HA 3NPVA 3EPNA 1FRBA 3OG3A 5CPNA 2VZVA 2G3IA 4H9MA 4Q8MA 4CQBA 1LP6A 3BSHA 4O18A 5LNVA 4DF2A 4UMCA 3WNOA 1WDQA 2VX5A 1MSSA 2BTMA 3GLCA 3N2BA 3KWSA 1HJSA 1P0KA 4GFSA 3B8SA 1TMQA 1CECA 3MW7A 1ITXA 1D2KA 4JN8A 4CQCA 4C7FA 1FWGC 3W7PA 2ODOA 1HJVA 1R2SA 5BZAA 1GZJA 1SO3A 3WMBA 3NPXA 1PTDA 1DTUA 4L6DA 1L6WA 3P62A 1QI0A 2X1TA 3LHZA 5I0DA 3LB0A 8RUCA 4KWOA 2D3LA 2X41A 4ORMA 1TX0A 4L61A 3ZS4A 4H8NA 4HHPA 2WMFA 4Q8OA 1BFNA 4HPHA 2VELA 4R88A 2BGSA 5KZDA 4OBTA 4IFKA 1GZGA 3AXHA 3W2MA 4F66A 3K1DA 1P1XA 1TTQA 1Q5MA 2VWSA 3WJSA 1XYBA 4MWAA 1HX0A 3UVAA 4D8AA 3P8IA 2J75A 1MUCA 3L21A 5M17A 3G8EA 1X98A 4HNTA 1KO0A 4LXFA 2Z1XA 2PDIA 3PZQA 1CGWA 1XIJA 2UWFA 3OA5A 2FZDA 3HMJG 4JIPA 4NI8A 3QV6A 2I5IA 2PDBA 3BAXA 1TR9A 3GXPA 2WVVB 2QEZA 5G2IA 3DYPA 1E1FA 1OFEA 1JUEA 3E9AA 2FB3A 2BWGA 3CL8A 2OKOA 4NJHA 3SO7A 4AUBA 1B4EA 1FXPA 3IEBA 4RZ4A 3AXIA 5F2LA 4PULA 2JF7A 3C4UA 4H9VA 1XBVA 1TUFA 1LRNA 4AIOA 3BG3A 5D8ZA 4F0KA 3OBAA 2DGAA 1K6WA 4JFWA 1NWTA 1KM1A 3ZR4A 3S5SA 3U6WA 1EO7A 1S2AA 2E6AA 1TYGA 1UD6A 1IQ8A 3F03K 5EB8A 1TWDA 1WV2A 1XGDA 4WGHA 3RM8A 4MWAD 1MFUA 2EPOA 5IOBA 1XYZA 1EX1A 4HCDA 4DPQA 5AC8A 3CEUA 3LHYA 5ABTA 4LCQA 1EB3A 4ZFMA 1V8EA 1XBXA 1DE6A 4HPGA 1YIXA 2CEQA 1C93A 5A8OA 3TYCA 3CHEA 2TMDA 4MJ4A 1W3TA 2X7VA 1XBYA 4MM1A 5D9NA 5IM51 2NX9A 1H41A 3D3AA 3G0SA 3BGGA 3IJQA 3S1VA 3RXZA 2CLPA 4BCEA 3CYJA 2VZTA 3EWWA 1T99A 5BU9A 1CGVA 3FX4A 4A3HA 1FP9A 3C6CA 4I5XA 1J79A 2CZVA 3VIKA 1RBLA 4QM1A 3VOJA 5EPDA 2WAGA 3W71A 4PTDA 4XVEA 3TYUA 3S6DA 4MVAA 4DZAA 3SY1A 1TWWA 3PSWA 5F2GA 5HK4A 1R5YA 4ICCX 3PB2A 1FXQA 1WUEA 3IK2A 3K4AA 3G3MA 2Y85A 4GUFA 2W66A 4HJFA 1TJ0A 4WSHA 5D04C 1IEWA 6ALDA 1U83A 2BB0A 4DF0A 1QXLA 1XYCA 3A5VA 4PGLA 5CG0A 4LBUA 2XSXA 3V36A 3A9BA 2FPYA 5HQEA 3OZMA 4G9PA 1HT6A 1FWHC 1KKOA 3NVDA 3G1FA 4L5ZA 1G4EA 4YS1A 4M81A 3CPRA 4ACYA 3GAKA 3JZUA 3QBUA 4L9YA 3TX9A 2PD5A 1GVSA 4YL2A 1E15A 5CXPA 1HJXA 3TC3A 4AW7A 1JZ7A 3AMDA 3H24A 1UH4A 1WKEA 5AZ1A 1VIZA 3LSCA 2GWNA 4GH1A 3FKKA 2VGGA 4H7CA 2VEPA 4RNIA 3FDKA 3SUSA 1X6UA 2ISFA 1CXLA 1FWSA 4JTUA 4UTTC 4QRNA 4FALA 1F7BA 1BWKA 4O4VA 4JQ1A 3SCVA 2QF7A 4NYUA 1PL9A 1VKFA 4AIUA 1FDJA 5C9RA 4Q4SA 5MKGA 4JIIX 4LH8A 1BVNP 3ZLGA 1ZQ5A 2NVCA 3OGVA 4GK8A 1BGAA 3O8AA 3KOYA 2TAAA 4HD5A 3N6QA 4Y9PA 1VFHA 1X38A 1D3GA 2CBIA 2V3EA 3IJ7A 4KS0A 1UWRA 3N73A 4Z2JA 3REQA 4DJDC 2IXVA 4AISA 3L2LA 3FXYA 4KWVA 3UZ5A 1PX8A 3PS7A 4PUWA 3C3NA 1EUNA 1WBHA 1DXEA 3PBYA 1V02E 1G5AA 2BGQA 2FVMA 3MCOA 3FFSA 4MNMA 1KV8A 2CLKA 1F3XA 1EF3A 1TRDA 1CGYA 4ZXLA 1QK0A 4GX8A 1Y0EA 3KX6A 4GVGA 4GNKB 2ZADA 1W9VA 5D32A 3JUGA 3W2JA 3G1SA 4US5D 4QS5A 1EJXC 1F4AA 2D73A 2FZMA 3QC3A 4PB3A 1XH1A 1ZP3A 4YTUA 3NNTA 2HDJA 5DMNA 2WMIB 2HXTA 3S46A 3CGTA 3MSGA 3EOUA 4U2YA 1X8FA 1FFRA 4LALA 3FGCB 4A6GA 1YE4A 2CESA 1FWDC 4CNNA 3F5LA 3OLDA 1ITCA 1PWLA 3HGRA 2PWGA 1EC8A 4UQ9A 3T40A 3RCMA 2V82A 1KRBC 4H1ZA 4J9JA 4I8YA 4ZA0A 5DF0A 2INEA 5AHFA 4L6HA 4FNTA 1QWKA 2P50A 4H8UA 5JIPA 3QOKA 1Q45A 3ATYA 3S2JA 1XFCA 1BKHA 3T44A 3LCLA 1JZ2A 3QQ0A 3LCWA 4JX6A 4AH7A 3W27A 2YLLA 1ESWA 3VTRA 2CLMA 5K3VA 4OV9A 2XH2A 3ARWA 1E6ZA 3N4FA 1ZL1A 3AS2A 1QPQA 1BYAA 3L65A 1NQ6A 4UCGA 3T07A 3P74A 2WJFA 3W87A 5A8NA 3GC4A 2WB5A 3TA9A 3T9PA 3KLKA 1K03A 3M0LA 1X1NA 1D8WA 1AG1O 3WF2A 4W8BA 3GR7A 1MXSA 5EMLA 4Z0JA 3GXDA 4O0QA 3PZUA 3RU6A 3UPWA 1I2QA 5I3HA 4V1XA 3BSMA 3W26A 1F5ZA 3MKKA 2D2JA 1JDAA 3R8HA 4NJGA 5DBTA 3RR1A 4MPKA 4CUCA 4HNOA 3UG4A 1KFJA 1LRQA 3B9OA 1F07A 3T42A 3VGBA 3ARTA 2C1GA 3GU1A 3EDDA 3BOFA 5DCEA 3S1UA 2WO5A 2BODX 1W37A 1X39A 4WSJA 3W88A 2PWUA 4ZOEA 3M64A 2DUZA 3BW2A 1BXNA 2B4GA 3TSMA 3KZSA 4C6IA 1Z48A 1J11A 4FHAA 2GUYA 1F3EA 3LD5A 4MJMA 1RR2A 5JQ9A 3QJAA 4IIBA 3WMCA 4LYRA 1JQXA 2VC6A 3PK7A 3LRMA 2DSUA 4E4UA 5JU6A 3Q4DA 1NSJA 4AVOA 1CGXA 1Y8BA 2PEVA 4MG4A 2YSWA 4K2SA 5D03A 2B7PA 5HNNA 3W1LA 5HXMA 4NHVA 1B3WA 4QIUA 4XZ9A 1QHZA 4A3YA 3NO5A 1H60A 1XKYA 5FEPA 2VC5A 5CLTA 2WQDA 2E6YA 3UR5A 1EEPA 4JTKA 3B9AA 5DT5A 4AZ6A 1UP0A 2XIIA 1VS1A 3AALA 3PFMA 2PRMA 3M4HA 3ANUA 4V33A 4PTNA 3UGVA 4LVGA 3WH8A 3UEQA 4IFKB 1TB3A 3GVGA 2DZUA 1F2JA 3R0KA 2WM0A 2J62A 3TNBA 3EDEA 3QSTA 4AD0A 4MWAB 1AQMA 4LJ3A 1QW9A 3EWYA 3N2CA 3BGJA 1MMFA 4L80A 5J04A 3H7VA 4XBKA 3B3DA 3WCZA 1MUMA 3VGFA 3W0KA 1OWQA 5D2XA 4PB5A 2V68A 3TK7A 2FTWA 4IUOA 3S6TA 1UKOA 4GACA 5C55A 4LY4A 4CU7A 2V3GA 4TMCA 1GVRA 1GOMA 3UZJA 3CPUA 1V6VA 3IGUA 3QV8A 3ZXWA 5H6HA 3S3GA 1V4YA 4KESA 4JX4A 2DPEA 1VJSA 5DMYA 1GHRA 3GC5A 4Z2IA 3LBCA 2B7OA 1QOXA 2UY4A 2J78A 5AZ0A 2PBOA 4DBDA 4HK6A 2YDQA 4H9XA 4IXXA 5ABGA 3A5FA 1F3WA 2FHCA 3DOPA 4GYJA 4ZMGA 3EWXA 4IIEA 2WSRA 5F4SA 5LXEA 5I3JA 3LK6A 4JIEA 2HQAA 4M1BA 4HZMA 1TREA 4ZTYA 2GGHA 5A8MA 5I23A 4GY0A 2C0AA 2QV4A 1IZJA 4GINA 1HW6A 1Q7QA 3NO3A 1UIPA 4I5RA 1A5KC 1JPKA 1Q2SA 3VA8A 3UG5A 3N2XA 3W1AA 2BVWA 1V0NA 4OZOA 2EG6A 4PMDA 2ZTKA 1IWAA 4RPPA 1DEDA 4U5IA 4EIVA 1J0ZA 4XD4A 3AIWA 3LX9A 1Y5VA 5BWFA 3MC5A 1OX4A 1KKRA 2JKEA 4XAGA 1BF6A 1A5NC 4HHLA 3L5LA 3KM8A 3G1DA 1H1ZA 4XIMA 2QLYA 1OQFA 3KAOA 2Z27A 3LM3A 1Z6KA 3DHFA 3W7LA 1P43A 4A21A 5HINA 4IIGA 1PJ9A 3TZNA 5CAHA 2CZ5A 4UCFA 2HTMA 2OXNA 3VFLA 3LU2A 2Z26A 3INPA 2EEXA 3MSDA 1E9ZB 4LF2A 4W86A 4J4KA 2POZA 1FH9A 3ARPA 3EKGA 3O16A 7REQA 4CGTA 2F6XA 5M03A 3WF0A 5A5WA 3DBPA 1K7XA 3MMWA 2AKZA 1HKJA 3G18A 1VP5A 1TVPA 8XIAA 4AZCA 4F9JA 3W25A 3IVSA 4JD4A 3KXQA 1XIEA 3AS1A 2VYOA 3DESA 1NY1A 1V3JA 2PLJA 3I7QA 3OW1A 1E9YB 4H6EA 1GG0A 1YKWA 2YDAA 4FOJA 3A4XA 5KZ6A 1F61A 1ME9A 2DVUA 4Q33A 1YXDA 1O5KA 3NSMA 4ZO7A 4ZB2A 4ERIA 4JGDA 4MKVA 1EYWA 1C8VA 1XIIA 2YIHA 3BPWA 2PRHA 3UJFA 1DIOA 3QZAA 4WJXA 1K6AA 5CSSA 1XX1A 1OINA 2Y7GA 4QITA 4DBEA 1IT8A 4NILA 3TN4A 4DXVA 4QGCA 1EEXA 4AY8A 2YCLA 4WK9A 1J6PA 3VZZA 1WAUA 3GKAA 3GRIA 3E0IA 1O5RA 2XG9A 1DJXA 3TH6A 3KBJA 1AVAA 2ZKMX 4K1GA 1V51A 1ZAJA 3GG7A 1W1PA 3RM9A 1RA5A 2YB1A 3QGKC 2J47A 3DC0A 5IHRA 2DV0A 1VFLA 4PBEA 1VHCA 4D6DA 5MKGB 3WUFA 1V6TA 1PCKA 2PDGA 2GGJA 1FWAC 3FHAA 5EMKA 1QPKA 2YFNA 3ZOAA 4F0MA 3PR2A 3UXDA 2Q02A 4GUGA 3W7GA 2WPBA 4MKSA 3TONA 5CSYA 4EANA 5BRQA 3JU2A 3C2OA 2WSPA 5DMMA 3CUZA 3WLPA 3AICA 3REQB 1Q6QA 1VCGA 2JFEX 3B0XA 1HJQA 5BCAA 1A0DA 2XPKA 3BE7A 1UROA 4Q4KA 2VC9A 4M0XA 2NWSA 4GXPA 4X61A 3AMCA 1UKQA 4KQNA 1EQPA 5HMFA 5G4EA 1E43A 1CXFA 1P6BA 1F6PA 3WLJA 2V3FA 4L65A 2GQ3A 5LA0A 3WEZA 4L1WA 3G1XA 4NSBA 1AJ0A 5LKYA 1SW3A 2PGFA 2OQHA 3WJXA 2DU2A 2HJPA 1W9DM 3GW3A 1OYCA 3KL0A 3ERPA 3KLLA 4N4QA 2Z25A 4JQ4A 4XZNX 1U5HA 4CQAA 1R9ZA 3I10A 4LS2A 3K13A 1DJNA 2R1MA 3W01A 2PDLA 5FJOA 2W61A 4RW3A 1ODUA 1NEYA 2HVMA 1WDRA 1ZLPA 4DO6A 2OJPA 3WG6A 5D37A 2PI6A 4ZZ9A 3P0WA 1OD8A 4YVXA 5I09A 1A5OC 4PL1A 4A22A 2WHJA 1CDGA 4FMVA 3DFSA 4JTEA 1ZFJA 3RX4A 4ML4A 5CPMA 2PU0A 2DSZA 1NWUA 4O54A 4ZQCA 4P8UA 1FTXA 4QCEA 3CZGA 4FZIA 3GHTA 4AIEA 3BH4A 3SCQA 3B8DA 2WPGA 3FA4A 2QCDA 3CJPA 1NFGA 2A3EA 8XIMA 5LIWX 2EXOA 4AZHA 3I4KA 2ONEA 4NNCA 1I1WA 2WSYA 3C3UA 3WH6A 1KD0A 4F0LA 5HAOA 2E5DA 3GUGA 3E2SA 5G5IA 4HHHA 4DF1A 3ECQA 2J9ZA 4QSHA 3VUPA 4A8IA 4JKLA 3WQOA 1P4CA 1I9CB 3NQ6A 2NT0A 3KBWA 3UG3A 1B0IA 3OIHA 4UR9A 1T7LA 2CLOA 3DHDA 2NSXA 5REQA 2FLIA 1UCWA 2E0PA 4GH3A 3BQ6A 4IJCA 2JF6A 1ADDA 1WDPA 3OIXA 1UMYA 4AD3A 1P0EA 3LERA 5I3IA 3NL6A 5A6BA 2ZE0A 1W9UA 5LZLA 2GSJA 1TZZA 4JY8A 3B0UX 3BDKA 4GRSA 2V6AA 4LTSA 4LUYA 1LQ2A 3FW6A 1OCJA 4PMVA 5DLCA 3N25A 1JZ8A 2B81A 4QS6A 3RRXA 3GFZA 4BF9A 3LTSA 3O15A 3QN3A 2JIWA 5EKYA 2HMCA 4C6QA 4LVAA 6ENLA 1TWSA 4QEHA 3AFBA 2W0UA 1G0CA 1K8ZA 2X40A 1KCLA 2E9MA 4OE7A 4F0HA 1SZGA 2DZXA 4F0SA 3OBKA 1LBMA 3NQBA 2QR6A 1EDTA 4JQ2A 2ALDA 2YL5A 2VGBA 5CG7A 4H19A 1Z9AA 4JKMA 2VX7A 3BLDA 4IMEA 1H1NA 1AQFA 1DQXA 5C9XA 5HPOA 3V4BA 2X30A 2OELA 3MI2A 2ZIDA 5A6BD 1LLZA 5D33A 3TR9A 1Q6FA 2A5HA 5AKQA 1R3TA 5CGMA 2FYMA 3Q94A 2QVHA 1IXPA 3QGVA 1B30A 4WX2A 3WFAA 3IAQA 5AN7A 3TW9A 1TIMA 3S2LA 3FNDA 4JTDA 1HO1A 3UWEA 1IXOA 4QX4A 3LCXA 4YTRA 3B0VC 3VO0A 3B0YA 3F2CA 3MS8A 2YA2A 1XRSA 1R7AA 3UESA 4KGJA 5E0FA 2DT0A 4NZ3A 2CHRA 4IGMA 1A5AA 4MB3A 3L0GA 2JEPA 1R2RA 3G3DA 1ZENA 3W3OA 3UD6A 1TTPA 3IV3A 4JFTA 3LBOA 3G2GA 4LS1A 2NV2A 1TKKA 1YTEA 3P81A 4D6GA 1I75A 2V38A 3VCNA 1TWIA 2OR2A 3DUGA 1TPWA 2XJ7A 4GPNA 4Y9AA 1AQHA 2BXVA 2YGYA 4CCEA 4JIQA 1RAKA 3SW6A 1FWJC 1YPIA 1PAMA 1QPRA 3P6LA 3MYOA 3M7SA 1K8XA 3MU7A 4JKKA 2BXZA 3W81A 4ZGYA 1LCOA 4US6A 1M7XA 1E6NA 4JS3A 3POCA 3SRHA 1CYGA 3W82A 2YXXA 1VFMA 5DEZA 3HQOA 5C70A 3F1QA 1WYIA 3LCIA 3CH9A 1XSKA 3CIVA 5HR7A 3GH7A 3GTFA 2BDQA 1E4NA 1OX4B 1Q13A 1BYCA 2XZ9A 4XO6A 4RKAA 2DZPA 5A6MA 2VVNA 2X7WA 4S3AA 2YL9A 4W5ZA 2IQ0A 5CH9A 3O07A 1DJGA 1PZ1A 1G01A 2YCIX 5HJYA 2GJLA 4RDYA 4CQ9A 1KGXA 4LS0A 5FEXA 3VNKA 2P5NA 1BF2A 2H8ZA 2PWFA 4LAMA 3NR0A 2VGFA 3G77A 7REQB 1MDRA 3BLEA 3APYA 1PX3A 4IQJA 3Q37A 3B8VA 5EMMA 4JL2A 4QSFA 4O19A 2PZNA 2J27A 1SR0A 1AA1B 4AZCB 4CN6A 1W0MA 2EPHA 2XFWA 2R14A 2R9RA 3RJXA 3I68A 3QTPA 4X2PA 4RZBA 3DG3A 2X2YA 1J9YA 2FQIA 4JFUA 3KEHA 5CZ0A 4EX4A 1EOMA 4EOUA 1LROA 4PMUA 2IS7A 3CB3A 3SIZA 2F2KA 4Y9OA 4GZ7A 2GJXA 4F48A 2Z1VA 4WD0A 2XGZA 9XIMA 3SQSA 1E3XA 2YFOA 1DPMA 3OYZA 2FVLA 4KCUA 2D2GA 5A2AA 4ENLA 1XS2A 1X96A 3NQEA 3SFWA 2GOKA 1K4HA 4KW2A 4W7UA 1W54A 2YCLB 3FYYA 4NYYA 1JUBA 2QUTA 1E1CA 4PMNA 2Y2WA 4P8VA 1QI2A 3MV01 2JGYA 4UB9A 4GUJA 1WA3A 4JXCA 4FF7A 4IMDA 4N7QA 2XIJA 1ISXA 1EJWC 1GG1A 2YX0A 4MJ2A 4C6JA 1OGBA 1W9BM 4CU8A 3MZNA 3G1YA 3E2VA 2GDQA 1Q6GA 3ANVA 2YDSA 3KCLA 3PM6A 4HHMA 2DSWA 4ZO8A 2XINA 2DDXA 2BV9A 3VMPA 2QUMA 2VD9A 4FXSA 3VKCA 1TV2A 2ZVIA 3VIHA 3MBFA 1ZPTA 3GO2A 3IUHA 2PSNA 2HK1A 3VC6A 3COTA 3N3MA 3V1HA 3KWXA 3TSBA 3GYEA 2QCFA 2FIQA 1UH3A 5AVNA 3RM4A 2V2CA 3NPUA 4S38A 1IR1A 5AYZA 3CHCA 1EC7A 3BAIA 1XKJA 1R3RA 3VGHA 3R58A 5JMUA 3LI1A 3M0JA 3BJFA 2IKIA 1UUOA 2A7NA 3D0CA 4XBJA 4AWEA 3WBAA 4J5NA 1EH9A 4JTQA 3HJEA 2B31A 3TTQA 3W85A 2DIJA 2OYLA 4P7QA 3R8RA 4L4MA 5AYYA 5BOOA 2WKJA 3KP1A 1XDMA 3GIYA 2OZTA 2AQOA 2RH9A 4PODA 4L7ZA 1EJRC 3CZ8A 3OZOA 4BA0A 3F4VA 1CI1A 3CLMA 1L6SA 3PULA 2PFHA 1L2QA 1XCXA 3LG3A 2Y88A 4H9YA 4OT7A 1TJRA 4OOUA 4C6KA 5BXSA 2YXGA 2XVGA 5C2CA 1W3NA 3UXKA 4P8XA 4AX6A 2G41A 2ZUUA 2L5HA 5JVLA 1XG4A 4D8LA 3EZ4A 2PRLA 1A5LC 1YBQA 2J24A 1K9FA 3N6HA 1PYMA 3ARZA 4E3VA 1EJ7L 3SN4A 2X1UA 3C86A 3H26A 5HNUA 3L68A 3VMOA 3UGRA 1LG1A 1W3LA 1F73A 2GYIA 1GONA 1L9WA 4HGXA 4O1FA 1GOIA 3GTNA 4HJWA 3BUVA 1FWEC 1DJQA 1RD6A 3DYOA 2E5BA 4S3JA 2VRJA 1RP8A 3W7DA 1UG6A 2JE8A 1YMYA 2QCDB 4ZQPA 4D2JA 4HU8A 2DSVA 3ZSTA 3HV8A 4X0VA 4LAZA 1ME8A 1VLWA 1TPH1 1XLIA 2J9YA 3ZR5A 5FA5A 1VZWA 4YCOA 5FD0A 1B3XA 5TD4A 5BRPA 3JZEA 3HGSA 2ABBA 1Q4WA 4XSLA 3DZ1A 2E25A 1NWRA 1H1YA 3O6DA 3NZGA 1H7OA 1WXJA 3GC2A 5D2YA 5REQB 1MRQA 1GQJA 1QNRA 4QQ3A 1L0PA 2H8XA 2ZRYA 3MI6A 3U48A 1RBOB 2CHNA 2ZC8A 4Y9NA 1AJZA 1RXOB 1EJVC 2V5CA 3V16A 1G7VA 2FFIA 5CC6A 4A05A 3DERA 1VJIA 2ZUTA 3QV9A 3U4FA 1W9XA 3R0DA 1V08A 2B7NA 4WVXA 3JRKA 3ONBA 4YWSA 3RDKA 4Q7BA 1PO9A 3UFYA 5IBXA 1UR4A 1M5WA 1XGZA 1GQIA 3HG3A 1BVWA 1OFPA 2XYLA 2OGYA 4QTGA 3KDOA 4WEVX 1E4IA 3UERA 4OGZA 4Z2KA 5I77A 3NYDA 4O14A 3OZPA 2QCHA 4GX9A 2J77A 4HPJA 3VD9A 1TV3A 5DT7A 1RD5A 3DG7A 1WUFA 4POCA 3TMLA 2QULA 3TROA 1ENUA 2V67A 3RILA 4ERAA 2BX7A 4O1CA 4XAZA 3R1ZA 1JZ6A 3FVMA 1BQGA 1IGWA 3DEQA 3A13A 2Y0FA 3L7RA 2Y61A 1BRLA 1P6CA 3H55A 4CNTA 2WBKA 4UQDA 1Q6CA 1MVYA 4ZSTA 4DWSC 2ZVRA 4I9MA 4WJ8A 2IKGA 2FMOA 3ARXA 5CAKA 4Y7EA 1CPUA 4HSNA 3FCPA 1TR1A 1I0DA 3VDBA 1JDFA 2CKRA 4IPIA 3BLKA 1QW8A 3I7RA 2B7QA 3GDLA 4MNJA 3WFZA 4EE9A 4ZQOA 1OFOA 2YXOA 3V5OA 3DX5A 2OSWA 3N2OA 1Y5WA 3F2BA 4PMZA 2CU0A 2CWNA 3IIPA 4ZOAA 5C9WA 3OG2A 3W28A 1QOQA 4JHZA 2EG7A 2G5WA 5TNVA 4U4MA 3PUEA 1VRXA 3WNPA 3TCEA 4PCTA 1ZNNA 3WQWA 3WBXA 4QLLA 3A21A 4GQ0A 1GOXA 2R6OA 3WDQA 3HV9A 1U1HA 4LC6A 1J10A 1SYTA 4O1BA 4OV4A 1J18A 3SY8A 4IHCA 1R47A 3P60A 4IWWA 5AYXA 2VURA 2VRQA 4JBRA 3STGA 1KCXA 4IPJA 4LAOA 1A3HA 2WNWA 2FZ9A 1J5SA 5I78A 4PN2A 1YDVA 5H2ZA 1H0IA 1X8CA 5C8BB 3H12A 1Z42A 4PCPA 3LN3A 1FUYA 4MIMA 1NP0A 5TF0A 4AAJA 4TOQA 3A47A 4MAVA 1OCNA 3WDRA 2BY2A 2F2HA 3ENLA 2FTPA 2QW5A 4AEFA 1FQ0A 3APTA 1B54A 2QDDA 4LUSA 1SMAA 3PPCA 1A80A 3BAWA 1H11A 1NDVA 1W3JA 3GWQA 1YHTA 4YMZA 3CL7A 2NQJA 2X1IA 1YYAA 3BAYA 3N19B 4HN4A 3UXAA 1ZCOA 2WKGA 4H83A 1KM3A 2QUVA 1ONWA 3F4CA 4ZOBA 1GVOA 1FHVA 4EWJA 1IR2A 5DXYA 1EBHA 4U10A 5KSWA 4PMYA 1E0XA 2O9RA 3K8LA 4DJFA 1NP2A 2YJQA 3GX9A 3SM0A 5AHIA 3HPAA 3BG9A 3F4NA 1NM9A 2NQ5A 4TMBA 2QF8A 4I3GA 2DIEA 3G0XA 4GIRA 3I4EA 3W7QA 4BWLA 3TP4A 3TSDA 3ARYA 3QKZA 3KBMA 1I45A 2E40A 3CT2A 3U7BA 1HKIA 4JIRA 3HPZA 3SN0A 2F61A 1QR7A 3MMUA 3SCUA 4Y9MA 2DVXA 3ABRA 2P53A 3LQGA 3H23A 1TJ1A 3R25A 3NAVA 3CLWA 3HA1A 4GJ1A 4IPLA 2FZ8A 4CU6A 3O06A 2QJNA 4PFMA 4DYJA 3K4WA 4BZYA 3W7EA 3C2YA 3WD4A 3EA2A 4HYWA 4PFHA 4GIYA 3CAWA 4GNJA 2GJXB 3VFCA 2CKSA 4QE4A 4DJFD 1B3VA 3G6MA 1JPDX 4HK5A 3WQGA 3RFAA 4FO4A 4I6KA 1XLGA 4JTGA 3W7IA 4OBSA 2PMQA 5HUOA 3WLKX 3EEGA 2ICSA 4H9UA 3VNMA 4YU1A 3M0MA 5K9XA 2AL2A 3BMVA 1CX9A 1RVGA 3G5EA 1E1CB 5T91A 1HTIA 2QJJA 1IT7A 3GFYA 2V2HA 2QT3A 3DBNA 3W00A 5GJMA 4RW5A 3ITTA 1EP3A 2ZZ7A 4K6AA 3TYZA 5C0QA 3OHMB 1EZ2A 3NO1A 3SCSA 3V35A 5IHSA 1US0A 5DELA 3RCNA 1Q8AA 1TPC1 1K02A 7CGTA 3AQUA 3DIPA 4OWGA 4WLCA 4R3UA 3S2CA 4ERGA 3UQNA 3DGBA 4TIMA 4ZO9A 2ZRUA 5KZEA 2FB2A 2X16A 3L67A 1EUAA 3VIGA 4MOZA 1JI1A 3CPGA 1F6KA 3PPGA 2ZZ3A 2OGJA 3GHSA 5A69A 3PTQA 4C6PA 3IJ9A 1EGZA 1QO5A 3F7JA 3H8AA 1PDZA 2GQ9A 1V7YA 3A3XA 3UZZA 2OO6A 1H51A 2PDKA 1R2TA 1G9HA 1TSIA 1TPEA 4LUJA 5KEZA 3JVAA 2CLLA 3E49A 4NAFB 4OUIA 4IQDA 4BF7A 3NUKA 5F2IA 2O9TA 3PZOA 4LT9A 4Z17A 1V3LA 5JIWA 4E5TA 1TIWA 3LCFA 2HS8A 1TA3A 2YA0A 3DDMA 1L6GA 3O2LA 1ZTVA 2NXIA 2AAMA 1LBFA 2DUXA 5CZSA 4XKMA 4MB5A 3EEZA 1FA2A 3A4AA 2XGIA 1WDWA 2NUWA 2WCGA 3SDOA 2J9XA 2TYSA 3H4GA 3NGJA 1EO5A 1QI5A 2DZVA 5DMLA 4PUJA 2ZRWA 2VI0A 9CGTA 3T4WA 1KFCA 1KM0A 1KXHA 4GCXA 5J5DA 1DE5A 1R87A 1B31A 1YE6A 3L4YA 1MFVA 2WMHA 1YBQB 4S3CA 5AECA 3A4WA 3G1RA 2BY0A 3T1GA 5DXXA 4Q8UA 3ONCA 4JYEA 1NFBA 2Y8VA 2VUNA 2WNZA 3UZYA 3WX7A 4K7YA 4JEJA 3L4UA 4GMEA 4BFAA 2H3DA 2A21A 2R1LA 4XZMX 2A7PA 4S39A 3PWIA 5FL1A 1JYXA 4GQQA 2GK1A 4O4WA 2ISDA 1JRBA 5JUVA 1DWIM 2C91A 1H09A 2TODA 4DBSA 4YYCA 2NXGA 1R30A 3F5KA 1KLZA 3GFXA 4HMCA 4I90A 3TYAA 4B5XA 4GXMA 4IF2A 5A1AA 3T0DA 4CD6A 3EX2A 1Q7ZA 2P10A 4WRHA 4I7UA 3ZFHA 3WQ8A 1X1OA 4RJEA 4JDYA 5BOEA 2UY3A 3VGGA 1PKNA 2PZ0A 4E8CA 3UXLA 5FJJA 3IPWA 4F40A 1A5BA 5GQBA 2I5QA 4I5UA 4X0NA 1W5MA 4FSAA 4NY2A 3S5YA 3ZIZA 2G95A 4AC1X 4HB7A 3U2ZA 7ODCA 2PU1A 5HOSA 3W75A 4OU1A 3GG1A 1R38A 2FPTA 2BBFA 4C6OA 1KLYA 3AZTA 1AODA 2VP8A 2OX1A 3LMYA 1RALA 3VE9A 4QCFA 2DEPA 2OOFA 5E6ZA 2D20A 1BHGA 1BVZA 4DUOA 4EXAA 1OF8A 1OEPA 4XO7A 3PC0A 4MGGA 4E0CA 4UQAA